1QG0A

Wild-type pea fnr
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
HSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A productive NADP+ binding mode of ferredoxin-NADP+ reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
total genus 91
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qg0A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qg0A02
4TN1A 2DCUA 4Q7JB 1B2RA 4B3XA 1BX0A 4DQKA 2VNKA 3CB4A 4FK8A 3LRXA 3WBJA 2FX3A 4HE6A 3W5UA 1E62A 4B4DA 1SM4A 1IJFA 2BM0A 2J7KA 4N3GA 4ZCMA 1CNEA 4RD1A 1HA3A 1E64A 4F7DA 5TY0A 3U6KA 1GR1A 1TLLA 2AHOA 2QTLA 3G71B 5GV8A 1GAWA 3CCQB 3JQPA 2BV3A 3LYUA 3CMEB 5THXA 3I55B 1ZM3A 3CCMB 5TV2A 3W5VA 3WNCA 4K1XA 1VQPB 4RCZA 3CCJB 2B7BA 1FNMA 4Y9RA 1ZM4A 4N3NA 4ZGQB 1KK1A 1WDTA 1JNYA 3B8HA 1AMOA 3LO8A 4RD0A 1YJNB 1QVFB 3VNUA 4EH1A 4QFMA 1EP1B 1W2BB 1QG0A 4P6VF 3WXMA 3ZBTA 4M4SA 4YAFA 1G7CA 1EFUA 1N0VC 4M2LA 3CRZA 4PC2A 2DEUA 1D8TA 3QFRA 1K9MD 3AGPA 1CQXA 4TMXA 1DDIA 2BMWA 4MYUA 2HDNB 1KK3A 1G7TA 1OGJA 3OW2B 1K73D 3U6BA 1KQSB 1M1KD 1ELOA 1G7RA 5JBQA 1FRNA 2RC6A 4LBZA 1VQMB 4RJLA 4U9UA 2HMAA 2QA4B 2CNDA 1VQ9B 1IB0A 2GQFA 2XEXA 4HE5A 4LBYA 5EMNA 4ACAA 3MCAA 1D1NA 3WNDA 4M0LA 2X3UA 4G5GA 3ZZTA 3ZZUA 4PC3A 2CRVA 1TUIA 1KTVA 2R6HA 3VO1A 1KK2A 4UAJA 1GJRA 3CCEB 4QHYA 1NJID 3CC4B 1QGAA 2OTLB 1K8AD 4C43A 1A8PA 1VQ7B 4LBWA 4H9GA 2GPJA 3B82A 1QH0A 1N0UA 4TMTA 2BGJA 2YWHA 4B43A 1AIPA 1KJZA 1ZM2A 3AVYA 3V76A 1FDRA 1F60A 3MMPA 1DDGA 3AVUA 4RD2A 4G1VA 3CC2B 1EFCA 2E1RA 1OB5A 3CMAB 4YAOA 4ZGNB 1BX1A 1ZUNB 2HCJB 5DSZA 3ZC3A 4Y7CA 4ACBA 1KK0A 2QN6A 3FPKA 3W2IA 1EP2B 1Q7YD 1H85A 1SKQA 1QFJA 5AN9A 1VQOB 4P3YA 2YWGA 1QUFA 3AVVA 1QUEA 1QFYA 2DETA 1UMKA 1NDHA 1S72B 2PIAA 3I56B 4LBVA 1YITB 1Q81D 3AVXA 4BPRA 3CCSB 3QSYA 4R71A 3W2EA 4TMWA 2BGIA 3OJXA 1KD1D 2C78A 3QE2A 3QFSA 1JA1A 2BM1A 2QDXA 3AVWA 1I7PA 1W35A 3CXCB 3P27A 2EFGA 3W5HA 1QVGB 3AGQA 2OTJB 3VNVA 1R5NA 1KRHA 4C0SA 2QTZA 2OK8A 3WYAA 2RC5A 1JA0A 2C77A 3E20A 3WY9A 2BPOA 3VMFA 4RD4A 3W2GA 1KC8D 2PMDA 4RCYA 1QX4A 1BJKA 3CCRB 1YJ9B 4MYTA 1DG1G 2D74A 1YI2B 5GV7A 3LVBA 4B47A 4RD3A 3OJWA 3SJZA 3PENA 3WBKA 2YWEA 2BF4A 1FRQA 3OZWA 3W2FA 3JQQA 1XE1A 1VQLB 1Q82D 4AF6A 4Y9UA 4PC1A 4ZV4A 1IJEA 2B5OA 3OZUA 4NBSA 3CCLB 2ZITA 4AC9A 4DQLA 3ZZ0A 4FWTA 1EXMA 2QEXB 1YJWB 2OK7A 2DERA 1OB2A 1FNCA 1N8RD 4ZCLA 4PGOA 1YIJB 1TVCA 5FA6A 1M90D 1U2RA 1DARA 1FNDA 2XNCA 2PLFA 1GO2A 1VQ8B 1XB2A 3QFCA 4TMZA 1TTTA 1QGYA 1H42A 4YHBA 4TMVA 3W2HA 1R5BA 3OZVA 3G4SB 3WNBA 2VNJA 3VO2A 3CPWB 1ZM9A 1G7SA 3ES9A 1VQKB 2VNIA 1YHQB 1JB9A 4B44A 3FJOA 2VZLA 1VQNB 3J81k 5KSWB 4B48A 4LC0A 5H5JA 1VQ6B 4AF7A 1F20A 1QFZA 2B7CA 4IW3B 2EIXA 1JJ2B 1E63A 1EFTA 1W34A 2NPFA 1D2EA 3ZBUA 3I1FA 2BVNA 3U2QA 4M1KA 1Q86D 2QMUA 2BN4A 4PC6A 2DY1A 3CCVB 1J9ZA 3CW2A 1B23P 5H59A 3P26A 1R5OA 3QFTA 4WQMA 4YALA 2VNHA 4M53A 4RD6A 2XNJA 3AVTA 3B78A 2VYQA 5HXBA 4YAWA 1CNFA 2YWFA 4PC7A 1QGZA 3JQRA 4G1BA 1BQEA 1FNBA 1VQ4B 4FN5A 5TR9A 1EWYA 1EP3B 1OGIA 1GAQA 4NCNA 2BSAA 4YAUA 1W87A 3CD6B 3E1YE 4J0QA 1VQ5B 3A1FA 1S0UA 3MHPA 1GVHA 4ZCIA 3G6EB 3CCUB 3CC7B
chains in the Genus database with same CATH superfamily
4LRYA 4RKWA 2ZT5A 1UPCA 3R74A 3T94A 2PUJA 1MU0A 1RWOA 1AU9A 1D09A 1XHLA 1E2PA 1LDNA 3G88A 1FRFS 3O9VA 1NUQA 3PA2A 5FWAA 2OENG 4PLYA 4AJ1A 1QBGA 2GQ0A 3TGPA 2D6FA 1L8AA 3D3EA 3F8TA 3O4IA 5ANRB 4JP8A 4TQUS 3C3YA 5KU1A 4TTPA 3V1UA 5G3ZA 4KPEC 4N4AA 1JSCA 4B4DA 1QYIA 4JJZA 5IJ9B 1QK5A 3CF6R 4BPBA 3Q7TA 3CZCA 3OPVA 3PE6A 1OLUA 1PU2A 2CVHA 2VI5A 2VUIB 4TV8A 3GNTA 3UYKA 4B4OA 1D03A 1VJCA 1EU1A 1TEVA 5E7JA 4J4HA 3KBOA 1BSVA 3PR2B 5IABA 1EWQA 2V0NA 1UD3A 2WYVA 4US0R 5BWCA 2CNKA 3TLZA 3BMQB 4F7DA 1I5EA 4ND7A 1JWAB 2GHRA 4G6IA 1IOLA 1EDOA 4DQVA 2AFHE 2JG3A 2YYSA 3EVGA 2PR2A 2CN1A 1JFFA 2IHKA 2R7NA 3K2EA 3JWJA 4B76A 5AESA 2CV2A 1Z73A 3NDJA 2QTRA 2LD4A 4NZNA 4B6JA 4ZKEA 1NF3A 4A2WA 1KAQA 4DC0A 5ADUS 2A0UA 3HBMA 2WAOA 2ZDGA 3H9GA 4Y2SA 5ALIA 1ZXXA 4S1VA 5REQB 2B20A 1BYUA 1KI2A 1NP3A 2IYEA 2QLNA 4MLDA 4KO8A 4RPJA 4K1XA 2ZSFA 4RK6A 5T67A 3DGEC 2AFIE 3KB1A 3P9KA 4Z4QA 3A6JA 2GLUA 4MDEA 1XG5A 4YFVA 1TOAA 2FWPA 1TLFA 2H4WA 2WVJA 2R8RA 4EMBA 1NU8A 3M8KA 3GRAA 4US2R 1FUKA 1UKCA 4M0CA 4N3NA 4B6SA 3CNHA 4PX5A 3N0TA 4EHHA 3KKNA 4FYJA 5JYEA 3LUKA 4AFNA 1W7AA 2C4NA 4FN4A 5DM4A 5EZSA 1U02A 3V7FA 3GSIA 3BERA 2XD9A 3Q15C 1JV2B 3C3AA 2YXDA 2GEUA 3LCJA 2C88A 3WA6A 4GOOD 5H3LA 5ECDA 1Y5MA 5LYYA 2VDQB 1W2BB 4Q93A 1Z6PA 5E8JA 5EJFA 3RRJA 2H51A 1HT1E 2HQ1A 1HEUA 4LQLA 5SYMA 5E9WA 2ZIUB 4W1RA 4DLKA 1I33A 3Q0IA 1OD6A 1RCUA 4CMBA 1X7HA 3H3JA 4D0NA 3QE3A 4ENTA 4R83A 1DUVG 1FXUA 3AHGA 1KMMA 5IT5A 1QAOA 4FBGA 3O38A 1PBNA 4CUJA 5EEHA 4OQDA 1M0TA 2IXGA 2Y0BA 3JQBC 2PBFA 2BCJQ 4KWEA 4O5AA 2BGLA 1EBUA 3V3TA 4ZEVA 3V1LA 1WHSB 1I0LA 3QNUA 4YN3A 2PWZA 2QW1A 3PRYA 4JLJA 2P2ZA 4P0PB 1DOZA 2L82A 1BCRA 4Q3EA 4UDYX 2CSXA 4LJ4A 1JKIA 3FVVA 2NQTA 2HWUA 3HBFA 1SD1A 3IQZA 3HVJA 4ZJYA 3C16C 1N8TA 2VQ6A 2YY6A 3RYFB 2WD9A 1Y80A 3FPPA 2IUFA 3RANA 4MJXA 1HMPA 4NCJA 3QA9A 4AYWA 2ZXFA 4J7CA 1MH1A 1E0JA 4CM7A 2FFRA 3FDFA 1GAJA 4BGIA 3AKDA 3HRIA 5GVSA 1UMBA 3TR0A 5JBQA 1NQTA 5TQ0A 5DW3A 1Z63A 3ZK7A 1E3QA 1JG3A 3K92A 3RVMA 2ATCA 2QM7A 4TRMA 2PGIA 2ZZKA 3T56B 1P2SA 1S4QA 2ZYDA 5HZAA 1IB0A 4Y1RB 2HMUA 1X1RA 2CZQA 1E2FA 2Q4EA 2Z2XA 3P2OA 3MCAA 1P7VA 2WHQA 4OP7A 4UHJA 4WVLA 4OHBA 2R6R1 1E2GA 1XJ0A 3C85A 4MVJP 3AR9A 4EY3A 1SBYA 2RMKA 2ZUDA 1TDJA 3H11A 3VVCA 1RWPA 1U2DC 2EARA 3K0KA 4I50F 1E7MA 5AVQA 4YJ3B 4P3KA 4DMUB 4UUAA 3TJZA 3BTVA 4KFCA 2IY7A 4UBOA 3STTA 2ZZFA 5GOZA 3DPUA 2I80A 2J9RA 3OJOA 4G0ZA 1KAOA 4EL0A 1GJRA 1FDOA 4N0MA 1K8ZB 4OXKA 3TMAA 5H4HA 1EFLA 3B70A 3O1JC 4HSGA 2CLKB 1CU1A 4IS3A 3FKJA 4L74A 2YZMA 4AKEA 2IA5A 4TLLB 3L18A 4DZRA 2DR2A 4AJKA 5F3WB 3L8HA 4MPDA 1KYXA 1XJCA 3N2KB 1SQ0A 4HDKB 4I1PA 1WDWB 3GARA 3MFYA 1PRYA 3A1NA 3C6QA 3D1LA 4QG7A 3P1JA 4ZARA 5GM1A 4V0SA 4KR6A 3D1JA 4EG1A 3D31A 4PBTA 4GIBA 4L2IA 3WMEA 3H1GA 4L5IA 3OKPA 5KYUB 1FDVA 1KMIY 3TPFA 1TPYA 1QO7A 4Q3NA 3O95A 2EERA 1GCAA 3IBCA 5EP4A 1PLLA 1CR1A 3FVQA 2EBHX 4IIEA 2QUIA 1HBJA 3V8RA 1J2RA 2IW1A 3H9NA 1MNAA 4M8LA 4BWYA 1PK7A 3H2ZA 4Z7NB 5A9RA 4XR6A 1SXJA 5CDGA 4V2IA 4BZWA 5F4BA 4I9UA 1SNYA 1V11B 4PHTA 4Q9IA 2ZPTX 5J4HA 3VR2A 3H2SA 2XB8A 3PPWA 4O8ZA 4BMSA 1YSCA 2E1RA 2C4UA 3FZQA 2I4NA 4DXDA 3OFND 4CWAA 4ZGNB 2D3LA 3D26A 2I7VA 5ILGA 3FOFC 2UUBB 3AL0C 1Y8QB 4U3JB 3NHSA 2FHPA 3TRDA 1L5ZA 2MYPA 4IRXA 4X7DA 3K0FB 2DLDA 1W8IA 2QRVA 3D8SA 3TEJA 4N18A 2K2QB 5LZ9A 3UEOA 1RPAA 2FKAA 3KEOA 5COBA 1EP2B 1DU4A 4DR4B 4IV8A 1RBMA 3V7YA 1NXOA 2FPXA 2P9ZA 4ZVKA 3V8NA 3KSMA 3UG7A 2FMXA 5B7QA 4WDQA 2WMNB 3HKDB 1QFJA 4IRMA 3ER6A 3T5DA 2YW2A 1JTVA 3OSZA 5K6AC 1G2PA 2HADA 1XC7A 5IYNA 3FM9A 3IR5A 5L3QB 1P2UA 1RJFA 4AY3A 2WU1A 1NJ8A 5LZ4A 4O3MA 3ZGVA 2C8VA 1OU0A 5EIBC 4C06A 3E7WA 1JIUA 3O7WA 1VMEA 1RYNA 3CF2A 3FUUA 4HL6A 4JSYA 4AMYA 2YC2C 1K6EA 5CA1B 4ZWNA 4AKHA 4WJLA 4XDZA 5KDLA 2O7SA 3FHLA 3CCSB 8MHTA 1SKAA 3DF7A 3V8BA 4EKGA 1MQSA 2YWRA 3R9XA 3W2EA 3KVOA 1CIPA 1CUBA 2HNKA 3GPDG 1WF3A 3QOXA 4GAEA 4CF6A 5MN5A 3VNSA 5AW7A 5JI2E 1N2BA 5A4FS 1Q0SA 2XT9A 4IHQA 2BM1A 2RGAA 1CR2A 4F5EA 1P0PA 4K6HA 4IIJF 4RSMA 1OX4A 5IMBA 4D3FA 1U9IA 1TAQA 4PCVA 3BL5A 1SIUA 2BFFA 3IAM1 2ZTLA 3M4NA 3NM6B 1QVGB 1LLUA 1QVZA 2WUDA 3CSDA 1XLTC 3ONVA 4MWZA 3DEYX 4DIBA 5BUZA 1UDRA 1R5NA 2IHTA 4C0SA 5D85A 3E9MA 3CWZA 3SNHA 1J07A 3IHKA 4R1OA 3TLGB 2O3SA 3FDXA 3P2EA 4YXWD 5JCXA 1NSYA 1T36B 2PBLA 4TOIA 1RXVA 4LK3A 1W8DA 5ELLA 2CE2X 4D6YA 3KU4A 3LUBA 3OUTA 3SVTA 4MIKA 2QJWA 3GBSA 1ZUD1 1RRKA 5C51B 4EPVA 5TQJA 4RKRA 2J67A 2QE7D 4QSHA 3SYTA 1V7PC 3AFHA 4WA7A 4BC0A 3OJCA 1M2WA 2P9BA 2XGGA 3DO8A 4RTQA 5JEDA 4QA9A 4S04A 1RRMA 2PT9A 3NM4A 3PQDA 5MHTA 3TLAA 3EEIA 1Z83A 3S2SA 4UUBA 1WOOA 1NY6A 2XMRA 3OCJA 4B47A 4Q4AB 1L4EA 1DX4A 2BDTA 3JZMA 1TQ2A 4G56A 4CEIB 1FF9A 5G0SA 3B3QA 1R66A 3ECSA 1WQ4A 3LKZA 3PA6A 3KKZA 5AP9A 2PXHA 1K7XB 4MIEA 3S2YA 3VNAA 2HIHA 1Q84A 3WQRA 1MX1A 1SG0A 4Y9SA 4XWWA 2OFFA 1ZZEA 1VG1A 5CNJA 4HPWA 1WW2A 2VH1A 4PN3A 4HGZA 1OVGA 3VJRA 1RBYA 2I67A 3NHPA 3QMWA 4YJ2A 2FRXA 4KXMA 2NP7A 4PC1A 3Q98A 4H59A 4IINA 4O2LA 1GNVA 1WSRA 1YCDA 4EGAA 3WNZA 4Q5IA 4QDKA 5EHIA 3UY4A 3IPRA 4YMWA 2FQQA 3ZWPA 3EIFA 1JQDA 2LKCA 3W6UA 3WGVA 2OSBA 4J0EA 4NMMA 4W8HA 1L5NA 4FWTA 5DGCA 3UJ8A 3VKHA 2I6XA 4PZUA 5CFMA 1DCTA 4I2NA 4G8BA 4UREA 3KTDA 2GJPA 4NBWA 4PFSA 4Y9TA 5FPYA 3C6ZA 4R3WA 5DLQC 2F55A 1OBOA 3OCVA 4JC0A 4WBNA 1Y9AA 5AVTA 3VJMA 4V0KA 4QG3A 1ZI9A 1VCIA 2DXIA 4OHWA 1K97A 1OT3A 1YIJB 3FDJA 4ND8A 1BX3A 1DEKA 2CK3D 3TAHA 3DLPX 3FGOA 4XA8A 4MVJE 2AMLA 3QE4A 4CM5A 4UOZA 3K70C 2FDCA 4JXZA 1KYQA 2DQZA 1FNNA 2C20A 3R6WA 2ROQA 3AU8A 4JDUA 1Q6ZA 5DWVA 1YAHA 2E3JA 4PPYA 4Y2JA 4TZ6A 3O2NA 4FFBB 1MXFA 1WORA 2RGRA 3PWZA 2H29A 1L6IA 2A9VA 2O8FB 1Z39A 3C4JA 2AN9A 2O2DA 2FR1A 3EEYA 4J0KA 1SPXA 5SV2A 2PUFA 1RJ9A 5C2JB 2QVYX 4CM1A 5FWYA 2GLXA 4MARA 4WZAB 3DE2X 1UXIA 2QVCA 4BJ6A 4EZIA 5IUJC 3HPQA 1E59A 1OH8A 2AMYA 4UNSA 1FXWF 2ZRJA 2YHIA 2VJIA 1YJXA 4N65A 4KAXA 5LDGA 3RU3A 5DGHA 4MGEA 4ESVA 3UMRA 3PHHA 3RIEA 3GRUA 3ZH2A 2OVFA 2BZGA 4PRKA 2FETA 2PD4A 3G68A 3ZV3A 3EW7A 3JQBA 4IF6A 4L4YA 2I66A 5FQNA 3WIUA 4EW2A 1ADYA 1I01A 4E6EA 2Q5LA 3NNSA 5B2ZA 1I6KA 3G8CA 4M1OA 1HFEL 1XJQA 2RONA 1DXQA 3RQSA 1YC5A 2LDBA 3BWXA 4WV3A 1SXGA 4DBLE 2BBOA 2HWKA 3QBEA 4NQRA 3RAEC 2DMRA 4UZSA 1RQGA 3SQDA 5HJ5A 1JLLB 3DWIA 3EXAA 4HMOA 3ZHVA 5BVHA 2Z2IA 4DUGA 4JN6B 1G9SA 1OLXB 1PE0A 1CUCA 4OOFA 3RG2A 2O2XA 2ODQA 1I2BA 3QX7A 1Z5PA 5J5VA 3DHVA 4QUEA 2I8AA 4W5HA 1FOEB 4HAUA 3CXUA 3WLAA 4ZOCA 2X22A 4G01B 4M9XA 3PUNA 1K3FA 1E8DA 4D44A 4JJAA 4DDVA 4FC6A 1QU3A 3PHCA 2GZDA 3COPA 4CM3A 1VE3A 1XMPA 1ZOLA 2BEKA 2GA9A 4CT0A 3DQQA 2WE7A 2YVLA 4BVBA 1NQ5A 1A1SA 3NHZA 3RVJA 4KO1S 4OJTA 3A1EA 4LRXA 3AOGA 3PEVA 4JC4A 4R9UC 4C0JA 1CUWA 1KR5A 2OUIA 2C5GA 2NO5A 4EG4A 1K4KA 3IBFA 1RBQA 3QVLA 3D6VA 4JYBA 2ACWA 3UJHA 4PR0A 3D2AA 1WXEA 1NI4B 2JZNA 4MS4A 3FSGD 1N5LA 4X7RA 2VYQA 4WJZA 2XWPA 2J6BA 3EDYA 4Y2YA 5JWHA 5G40A 3LT1A 2NV0A 4YAWA 3K6KA 4FDUA 2VK8A 3NALA 1PZFA 3LQ1A 1HOTA 3AFNA 3MXTA 4L57A 4P2NA 3NWOA 1X6VA 4KGZA 4BRSA 4C7MA 2A5JA 1JKJA 3N6XA 3E0XA 4JUAA 5CX4A 4Q12A 2HI0A 1OE0A 4MQ4A 1LWNA 2WK1A 4LGYA 1YZKA 3K6JA 4G1BA 4Y2UA 3WHKA 1DLJA 4FDMA 3IXMA 4K9QA 2OBBA 2PVCA 3C70A 3CRMA 5CP8A 2G9NA 1ZMTA 1E2QA 4XI9A 4YREA 1ZQ1A 1F5NA 4OXNA 4L16A 3O0TA 3UT0A 2PGNA 3M1IA 2JIRA 1E2JA 1KKUA 3T9EA 1UDBA 4K0KB 1PJBA 2QRKA 1VJ5A 3EVNA 3KR1A 4K3VA 3HM2A 3PFIA 3FN4A 4EF5A 3SQXA 4E94A 4JUCA 4M3NA 2G07A 4P4SA 2OYCA 3Q10A 1LTKA 2ICAA 4C5CA 2GD2A 3CG0A 1VCMA 4E08A 1IXSB 3N2GB 4LS3A 2IITA 4B6PA 4RV9A 2OP1A 3BFKA 4HF7A 1CY4A 2A6PA 4K81B 4QECA 4E14A 4CTNA 4YUYA 4F93B 2VZEA 4HVCA 1XTZA 4TL9A 4DG5A 1AQYA 4HNQA 3CB2A 4TXMA 5DNCA 2ONKA 4FXPA 4Y9DA 5AK3A 1UDXA 2PLAA 4F8EA 4A23A 1RXUA 2WIDA 2P6PA 2C4VA 3ZTWA 3RTDA 4ZJUA 3GVIA 3TNFA 3I34X 4NONA 1PJZA 2Q45A 2VRNA 4K6KA 1YL6A 5EAIA 2Q4RA 1AS3A 1MX5A 2M6KA 5LB2A 2YV4A 4Q3BA 4R1SA 2RAUA 2C2YA 3G2LA 3CVOA 4URYR 1SB8A 1YRLA 2AXNA 1PWHA 4B0OA 2R11A 3MELA 1YR9A 5BRNA 1LRKA 7ABPA 2QHXA 1QR2A 3P9RA 4BNXA 1KORA 4OD0A 3BXGA 4REMA 2Z4RA 2MCFA 3A1SA 1XV5A 3WIDA 1CQJB 2A94A 1GT6A 4UNQA 4B6GA 3U6KA 3BDIA 3U9SA 4FX5A 1HQCA 3WLEA 3M4YA 1UMDB 4FCCA 4G4IA 4MRMB 3R5KA 3PT5A 2IHNA 4CCWA 4D41A 1SUSA 3PD0A 2GZ1A 4XH9B 5IAOA 2ZVPX 3QX3A 2C5SA 2WSMA 2F1JA 3CCQB 1NUTA 4H1VA 2JFGA 2DWQA 4DLZA 1TEHA 3WMFA 3G5TA 4N3CA 2A30A 1N32B 3R0IA 4YJFA 3HAGA 4LPKA 5THXA 1ZMXA 2CEKA 3B6IA 4IWXA 4E5KA 2V1XA 2VUUA 4NAVA 2L0XA 4KI7A 2JVIA 1UOEA 3SNKA 3ZU3A 1P77A 3K9GA 5B2FA 4EB6A 2ZTHA 3BWDD 2O2IA 3R7DA 1WKVA 1Z2AA 3RBXA 4DR2B 1QXSA 1M1YB 2WR8A 1T5IA 2P3SA 1CRPA 2C94A 3AI3A 2X5OA 2FG7C 1HNXB 2BFBA 2P1RA 3KKPA 2EZUA 4L85A 3E9CA 4KKUA 2A1TR 5BSWA 3Q8MA 3ITDA 3S5JA 3LDAA 4FQ5A 3TB6A 4YRAA 1JLRA 2ZM6B 1QK3A 3WDSA 1ML3A 3F73A 3E9ZA 3EQ8A 4RCVA 5A88A 3B8HA 1T15A 3GLHE 4Q4HA 2X23A 4P83A 1E1RD 3ESAA 4KLCA 4OMCA 4CUKA 3VTFA 1EK1A 1HLGA 3EOZA 3F97A 4KNWA 4PZ9A 4F4DA 4PNHA 2FSHA 2R00C 4Q7LA 5JLAA 1ZWKA 4FMDF 4S0ZA 1EP1B 1G20E 1LK0A 1P1CA 4HY3A 4O2AB 1Z18A 3N70A 3OQJA 2GDZA 3I9FA 5LL6P 2WUGA 2PUDA 5AUPB 2ZI3A 2I6FA 1XQBA 5BO5A 2LCFA 3SSNA 3HJGA 3HR4A 5E6SA 1YBMA 2DPHA 1VLQA 3FLAA 4BVAA 4KVGA 1EBFA 3HU2A 1U6IA 4M49A 1WY5A 5E6RB 4J0HA 1X1BA 4Z4UA 4UCWA 3A4YA 4MYCA 3UJPA 5FDFA 2ZBEA 2BMFA 2O07A 5F4OA 2AFIB 1W36D 2DEUA 1J90A 3M6IA 3DUFB 1YR8A 4RGVA 1S1CA 1LLDA 1ZHHA 4FOTA 4Q3KA 2X8KA 4V03A 4AT1A 3ZGYA 1Q57A 2WYHA 4RHTA 2CGEA 2YRXA 3AV0B 3KAKA 1ZD2P 1MB9A 4OMDA 1R16A 4M0UA 3H1EA 3VPSA 3ZE8A 2F6RA 5EXTA 1ESNA 1K8YB 2KM1A 2BMWA 3HJNA 4FMCF 2BLLA 3T3PB 4C3ZA 3RVBA 2BUCA 3L2OB 1QTNA 4LGMA 2OCIA 3PTZA 3S0JA 4ARSA 4X6YA 1EFVB 4S35A 4BNFA 7YASA 2VCYA 4CLRA 5ED4A 1TGVA 3NIWA 4I4TB 4KC0A 4P36A 8OHMA 1ZH6A 1KTIA 4EGQA 3F1LA 4QJ4A 1QMPA 5AHRA 4RJLA 1Y3DE 4CMCA 3NM5A 4ER5A 1FW6A 2RCYA 1UD6A 2AN4A 3E5NA 4Q1AA 5HCIA 2QYTA 2KBFA 1S3FA 2HMYB 1BOOA 3KT0A 1ZO8A 4MRNA 4GPD1 2ES4A 4PRZA 4WGGA 5D2CA 5H7XA 3WKBA 3WQHA 2VXCA 5IYZB 1TQHA 1VLLA 1BNCA 2YC4C 3F7OA 2VHJA 5F9MA 1L3IA 5C34B 4XLFA 2P77A 5F64A 4ZEOA 5B2EA 2GZHA 1KPHA 1E18A 1YZ3A 2CD9A 4RDCA 5IAGA 4D8XA 4ZGWA 3ADBA 3L4KA 5I01A 3U09A 1IUKA 1NIJA 5HJ2A 4ITUA 1WSDA 1QU2A 3H5NA 1L4LA 1JQAA 1D8AA 2R6HA 3C7TA 4R2JA 4S3MA 3SC4A 2BP7A 1G18A 2GJ4A 4CG2A 1ZHOA 2D7DA 4QGSA 3CCEB 2BJHA 3GLFA 1Z56C 1Q0QA 5LWQA 1DRUA 1Z28A 2O3JA 5JQGB 4OHZA 2VCHA 3H42B 2ZUTA 2AWOA 5TS2A 3OTHA 2NIPA 4BNWA 3E9RA 1UEIA 1S4MA 1V8DA 5IASA 2XMZA 1N6IA 5FUVA 3ETCA 5F2NA 3E48A 1SHJA 1LPPA 5EJ9A 4YT2A 4YJ2F 2AA3A 2I7DA 5CURA 4NEHB 5CEEA 1PTJA 5DRTA 4BKUA 1OLOA 5C80A 4M98A 1VSTA 4FUQA 1N1MA 3IHWA 4PZ0A 5JAHA 2JCXA 5JW6A 1J42A 2JASA 3DZKA 1UZNA 4I1UA 3ZWOA 5A03A 5KTKA 4GXQA 2BMEA 5D8DA 1TU0A 1XRQA 1NBME 2VDKB 2ZYVX 5DYTA 1KJWA 1S2IA 2FE4A 2OFPA 3AKYA 3IV9A 4MV1A 1TMKA 1C7RA 1ISGA 1HDZA 2X40A 3EGXA 4ZCTA 1N92A 4FI3C 5EZYB 4D26A 3BL8A 4HFMA 1ISSA 4JY7A 1FQKA 2XTJA 2JANA 4UE6A 4YO7A 3TCNA 2D2EA 1E2UA 4PWZA 2QG9A 3BIWA 4BLQA 4Z7OB 5CPFA 1RQPA 5FD8A 2XHZA 1L5KA 1O08A 1FYVA 2MSWA 4YBRA 2O5EA 3NJRA 1GITA 3PFHA 1X9HA 4TTIA 2XZLA 4IDNA 2YXEA 4HDCA 2Q2WA 1NATA 4ZI7A 2YS6A 3FCEA 5AW2A 4Z53A 4EJFA 4F38A 3O3CA 3HM9A 4GKJB 5ILQA 3V4FA 2RGUA 3MGCA 3OKFA 1U8YA 4EY6A 1DO2A 5M5BA 4R40A 1SUBA 2OV8A 1UP7A 2NSYA 3G2QA 4CGZA 3RSCA 3H83A 4BHTA 5K0EA 1T13A 5AQEA 1YQTA 3SZUA 3K6SA 5AM0A 3W2IA 4O4JF 4N49A 1MXHA 1PT7A 1OQAA 4QTUB 4U7HA 4EVSA 4ZVOA 1Z4IA 3S1LA 4CL3A 3GWZA 5I9SA 3E9DA 1TJ4A 2PQ0A 3EGXB 2GPAA 4A03A 2W2VA 4CKEB 1Q7EA 1PR6A 1EHYA 1VGRA 2D59A 4CE6A 4P92A 1T0JB 1NNUA 3S28A 3BXXA 4I46A 4F84A 3GLUA 3VX3A 1HTTA 1UWCA 1T2NA 2WPDD 4EW6A 2VT3A 2LVBA 1LS6A 1JHQA 3KZCA 1W94A 1Q81D 3TIXB 1MA3A 1Z6QA 1IEXA 2C95A 2IZOA 1ZJJA 2JIMA 3F5QA 4BKQA 2WSSD 4CEJA 1GNLA 1TM4E 3V4ZA 3ZCRA 2ERYA 3PUWA 4ZKDA 3E8SA 1M2EA 1P5JA 3OZFA 4XUCA 3D5QA 3MT7A 3REGA 3J7AC 3GLFB 4U4AA 3UUGA 3U44B 1LBIA 1U7OA 4D9KA 3OJXA 5LR6A 2BSQA 4IDAA 2Q49A 3AJ8A 3SY8A 4R5MA 1EFRD 4QVAA 2WU8A 4YAEA 3ROPA 4RIHA 5LYJB 1AKUA 1ITZA 1CKEA 4P84A 5F1KA 1IM8A 3LQQA 3P9PA 4RHUA 5K0LA 2WNHA 4HDAA 1O95A 5TVKA 3SU8A 1XDGA 2XI4A 4RJIA 1NKVA 4GGOA 3T3EA 5HKKA 4Y3UA 2QVZX 2YIVX 2WIJA 2J3LA 1X9IA 3OE4A 3S99A 4QNMA 4AAYA 5CA0F 2QM8A 4Z5XA 4GR9A 4DCVA 3BWMA 3DKPA 3MTGA 3LPAA 4L3VA 8ABPA 2PUWA 1ZXBA 1JA0A 2N47A 1CY6A 1U1CA 3MAAC 2XKKA 4DT1B 3BVPA 3GN1A 3VR2D 4RD4A 3W2GA 3A4LA 3DLAA 4OQLA 4QYMA 6ADHA 5CD1A 4CF3A 3B6KA 4E5SA 2W2LA 2A9QA 2C3OA 3TBFA 1HE3A 5A8AA 2VQSA 2JPDA 4S05A 1G3MA 2MIIA 4JCOA 2H16A 2UAGA 4QEDA 5BOSA 5LZ5A 1R2QA 3P2KA 1HDCA 4WFIA 1TYCA 1ESDA 2QD3A 3FPHA 1FK8A 3HC7A 3LVFO 3OJWA 2R1TB 4DMCA 3E53A 2PD6A 4R51A 3QHPA 5CLIA 4DTIA 2IV2X 4KDFA 2IF2A 1QJ4A 3WLOA 2N42A 2JFHA 3DUFA 3W5JA 2YWEA 1H2RS 3FAKA 4NH0A 4EA6A 3JQQA 4JEMA 2AI3A 3F49S 4HQOA 3NX4A 2C9MA 2C03A 1RDFA 3DL0A 1A2OA 5TQ2B 4DAEA 1OI4A 3HGMA 5ELXA 1KBZA 3WX0A 3CLTC 1NVFA 1QZUA 1ZNQO 1YOVA 4M8NE 1W1UA 1CQPA 2CNLA 2DUMA 5JJLA 1YIAA 1BEZA 1RHRA 3IT0A 4RQAA 1D2RA 1SK8A 2ZRMA 3UKJA 5IC5A 3A6PC 1TAUA 1Z25A 1GPAA 4NCHA 2WDPA 5K0GA 4JJGA 2GWRA 3K4QA 4YBZA 4YRGA 4HQ6A 3G1UA 1D3AA 2GM3A 4QLAA 4YAGA 2FSGA 1VIMA 4WZBA 2YZKA 3JQGB 2M1XA 4HVLA 1E2NA 4FFLA 4MROA 3LL7A 4W5TA 4Q4HB 3TAXA 3GJ3A 5AVUA 4WKBA 4MWDA 1NV9A 3X2FA 3SFTA 4DR5B 3SX0A 1W52X 3AC0A 4V1CI 5DV9A 1DKOA 1F2TA 2QR2A 1M2JA 1UK9A 4QU0A 1CSEE 1KZ1A 3IELA 3BM5A 5IG2A 3KAJA 1XQXA 3GCGA 1L7BA 1Q1ZA 2WMDA 3K9QO 4JC5A 2W2KB 1E2KA 3N3BC 3PI6A 3AYZB 5EIWA 3ZV7A 2VNAA 5C5IA 2HMTA 2A7XA 2O7RA 3WMXA 3RB8A 1VQ8B 1N0IA 1WDKA 3LP5A 3O4GA 4JL6A 4DWOA 5CLFA 2MSLA 3KXIA 1J9GA 5GAJA 2YZ7A 2AYYA 3V2IA 1LFAA 9LDTA 3FTDA 1M1ZA 1TADA 1PZXA 1E2MA 5DYIA 5ES3A 3RTGA 1NLMA 2CLHB 2DZDA 4Q24A 3O8QA 2IYTA 3IVAA 4A0GA 1YGPA 3OD1A 2CV1A 3TJMA 1XJWA 4UQOA 2AVDA 1E3LA 4JXXA 4F60A 1NJ5A 4PLVA 5BYAA 1B6TA 1CZNA 1GPKA 2J33A 2ZL6A 1UMDA 4NEGA 3ZG6A 4G0VA 1M5RA 2CD7A 7REQA 2XYRA 3AF1A 3TGLA 2EFYA 3JD2A 3E05A 1BXRB 4F4JA 5IEJA 3SX4A 5LJLA 2NU7B 4UJ5A 1J8YF 3OX4A 3SJPA 1SU7A 1H23A 3N2NA 3VFDA 1USIA 1D2NA 4TYNA 5F33A 3TECE 3EC1A 1Z08A 2YN2A 1P33A 2QGNA 1XKLA 3S1AA 3IE0A 4R84A 1SB9A 2CBZA 1YB2A 2HQSA 4KGDA 4WN9A 3DV0A 1SKYB 4C22A 1TM2A 4XEHA 3DEAA 3K30A 3PL1A 4PG4A 5CH8A 5E7MA 3WYDA 1Z38A 8ADHA 4PXYA 1UD8A 1CFZA 3SFVA 2NYAA 3EXG1 3RASA 1T0PA 4IW3B 4PGGA 4OLBA 4D4JA 3ER8A 5DSXA 4GMFA 2GAIA 2W93A 4UDOA 5F23A 1KAEA 1QGDA 5DFAA 1IH8A 1TQ8A 3P8ZA 1KRXA 4R31A 2DB3A 3WLHA 5A7HA 3LIIA 1NMSA 3UA4A 5F12A 4I1OA 1JHPA 4DW8A 1CZUA 4OUDA 1E9VA 3EMBA 4UJ3A 4KFRA 4M7OA 4YECA 1RAIA 1RXSA 2LV8A 4GSLA 2VJBA 4XOIA 5TMBA 3E3OA 1KIMA 4B87A 2Q3MA 2R5NA 3LNCA 3LZCA 1XWFA 3DL4A 2ZT8A 4GRAA 4O4HB 1OOEA 4E88A 3ACBA 1UM9B 3ISJA 3KM0A 3M81A 4KBFA 4LDRA 4P0QB 1FJGB 4RZIA 3DE5X 1OCEA 3V8VA 2A5YB 3ZTTA 1SUDA 1IN5A 1E1QD 3WSWA 2A14A 3H2JA 3BCUA 3GR6A 2BD0A 4HWOA 4I3FA 2PX5A 5BT9A 4CTKA 4CQMB 1T9HA 1CNFA 1B8PA 1QWSA 2W6MA 3V34A 6AT1A 2I4LA 1CRZA 4FI3F 5MDHA 5DM70 4FNAA 4JT2A 2W48A 4BOYA 4G8CA 2IYQA 3LOUA 4KU4A 1QPBA 4RESA 1N2CE 3NHUA 1JJVA 4P3XA 3EX7C 4TKVB 1V9LA 3RKSA 1K0UA 3PICA 4NU6A 5E6UB 1CK4A 1X7ZA 1W59A 4O63O 5GINE 1XZDA 1LJ8A 4ZREA 1U2TA 1DAEA 3OQ6A 1II8A 1R9MA 5HF8A 721PA 1VLYA 1H4TA 2I7XA 1L7PA 4P7JA 2YNMC 3KR2A 1RZ3A 2P65A 5LDHA 2ZROA 1T2VA 1B2LA 2I6GA 1NI4A 2SKCA 2X6TA 3MS7A 3U60B 2O14A 2OD7A 4PVDA 2YRFA 1Q1BA 1Q92A 4RHFA 1TUEA 1GNPA 1QFMA 4S1PA 4UAVA 5EKDA 2D00A 4WXRA 3A25A 3F7MA 1WUKS 4WWVA 2P2YA 3IKVA 4J90A 1CX9B 1YH3A 3FX2A 4N0PA 5JT1A 1DKPA 4DLVA 2NZWA 1FX0B 2PH1A 4ZHQF 1IPFA 5J58A 3FOEC 4LVUA 3HYLA 3QQ5A 1R4ZA 3SHOA 5JD6A 3ICEA 1U9JA 1PEKE 2PS3A 4D0GA 1RHKA 3G89A 1VZ3A 5EIXA 1JR2A 3O6VA 4DGSA 4ZRNA 1IN1A 4Q9AA 3MUFA 3CTPA 3DNMA 3CXRA 3ZHBA 4D3DA 3BXFA 1B00A 2I0FA 4O2AF 3U7QA 2Q3HA 4D9BA 2D4AA 5A2GA 4W5QA 3GLGB 3RS7A 1RLMA 1T5TA 1M34E 2JRLA 2WWIA 2AKYA 2C8KA 5CYFA 1MORA 4CU2A 5BVHB 1ZUNA 5H81A 3OLZA 1VSUA 2XGSA 3TOZA 2NO1A 2V6IA 1JLLA 1NU6A 3PCTA 2YASA 1NUHA 2EZ8A 4EO9A 5KOIA 4MVJD 4X95A 3RG8A 1G98A 3DR3A 4QBIA 3D4IA 3KEGA 2V7EA 3L1KA 3WRXA 2BTOA 1KYIA 3ILVA 2AX4A 4BEWA 5FPKA 2XEDA 3ID6C 4X41A 3FWHA 1J7KA 1HQDA 3IEMA 4CLOA 3DMRA 3QV1A 2VJMB 3ESBA 5HTKA 4R54A 2AHOA 3KJQA 3AR3A 3CZQA 3BQNB 4CG1A 3A3PA 1QONA 2YHIB 4F4UA 3WZ2A 4G26A 3GFVA 2P69A 1QB7A 3FW1A 4JKYA 1F14A 4M37A 3SPXA 5FWYB 2E85A 5AW3A 3ZY6A 5MF6A 1YB4A 2CWDA 2QAGB 4EYSA 2F67A 1VBNA 3IDZA 1WOPA 3W8FA 2AXQA 2HIMA 2WVAA 1P4HA 3KP1A 2Z56A 3G7NA 4JWKA 4MV4A 2V31A 1EEXB 1W581 3EW9A 4NQZA 2XDQA 5EMJA 1QF6A 3WNCA 2OQIA 3W06A 2OHHA 4LQDA 5C7YA 5EPUA 1TM1E 4FFBA 3UWKA 1KMHA 1E98A 5CNKA 4E03A 5EHGA 4E6PA 2R5FA 1O54A 4P4GA 3RSFA 3TOCA 4Y9RA 5K8VA 4MICA 1NMZA 1L7MA 1EX9A 1U7WA 4C76A 2CZCA 5KJEA 3UF0A 2ZQYA 3ASQA 1U7XA 1Z0SA 1I3NA 4INPA 2Z43A 4WZZA 4DSTA 5FOUA 4OM7A 1GRRA 4RDHA 3CNEA 1ORHA 3FKSD 4H0NA 4IG4A 5DNDA 2QSZA 3FPEA 4MWCA 1E2IA 3JYQA 2W6QA 3D3QA 3NV7A 1NRKA 1L9KA 1QIIA 2FVYA 2HB6A 2JK0A 3GRYA 2HTEA 3I9KA 3QKWA 4IOMA 5CW1A 5LN1A 2E89A 1VLHA 4J16A 3BC9A 3HJUA 5G1PA 4TZKA 5B4VA 1DINA 2EJCA 2H1WA 3E81A 4JBGA 1KC1A 2Q3BA 1J8FA 3M6WA 4WCDA 4FSHA 3AF6A 2NZXA 1QKIA 4OOSA 2VAWA 5G53C 1XU4A 1B14A 3ZBTA 3FBWA 3PR3A 3DXYA 3ZKWA 1TYZA 2OOSA 4LJ6A 4X1OA 5EJ5A 5DTMA 4B6FA 1ATIA 2GH1A 4GT1A 2ZJFA 4LWQA 1RLJA 4YJ2B 5ICMA 3F6PA 5IJ0B 3QWBA 4KH0A 4OOEA 2O1EA 2Z30A 4PCAA 2WG0A 2ADFA 3F4BA 4L5AA 2E1BA 1T1GA 4PC2A 4K5QA 5J35A 4AW9A 4D8VA 2CLOB 3B20A 3NXKA 4XONA 1P9RA 5G0VA 1V7ZA 4FOPA 4GL4A 1HNZB 2JCYA 3TTWA 3K8YA 2UVDA 2QY6A 4XPIA 2A0XA 3CE6A 4ZQCB 3LF2A 4YCMA 1FQWA 1E2BA 3G7UA 1LCIA 2GEVA 1V0JA 2XOXA 3RIXA 3G9TA 2JGDB 3L07A 4QXOA 5CGZA 4WMLA 5IFLA 1ZGZA 3BFJA 1Q95A 3EZGA 4L73A 4NTZA 3RSHA 1ISMA 4M9QA 5EYPA 1ISJA 1E99A 3DDCA 4DR7B 4D98A 5AVZA 1WJGA 2CHGA 3Q8WA 2XUZA 2IXTA 3UMBA 4PAOA 3VYWA 4B3DA 5DB4A 5IXYA 2CXNA 3VU0A 4N0EA 4BNIA 1A50B 3L9WA 5E4JA 3GAFA 4ZDIA 2HREA 2P5UA 3OM9A 4N8EA 3T7KA 4J9VA 3TLGA 3W05A 1XD2B 3M5DA 3KQSA 3L49A 2FR8A 1P2VA 2XTNA 4GMKA 2WSYB 4DMFA 4ACAA 1BKSB 2NZ2A 1F5SA 2P9TA 4RYDA 4O4JB 3MERA 4J1NA 4M7WA 2DG2A 3UJBA 2Q0QA 3EIHA 3BMOA 2YNMA 1KJ9A 1GTL1 4UMFA 3KPUA 2AG1A 2IX9A 3EVBA 4NJOA 4PEVA 1SXIA 1GAEO 5H16A 3WB1A 4DPLA 1EE1A 1KFBB 5C4IA 3BULA 1OREA 1HYBA 1NZDA 3JQ7A 3JASA 4DUPA 2D5LA 1Z2DA 5G4KB 4B32A 5ICGA 5HKBA 5HNKA 2ZIWB 1EVIA 1UXOA 3WDMA 3GNLA 3ASPA 3L0ZA 2VG8A 2RH5A 1TCAA 2YV5A 4JQCA 1MQ8B 5T6BA 3O3MB 4WINA 5T7BA 2CLSA 2WILA 3DXFA 1UKAA 2NO9A 4RQTA 5CJPA 2Q07A 5CA1A 1OXUA 3EDCA 1J24A 1DRVA 3KQOA 1FUIA 2BM9A 3GN2A 3IQDB 3LFHA 2AUNA 2VDMB 3PXXA 4MKIA 3TSYA 4ER7A 3HKCA 1QS0A 4E13A 4YWJA 2HX1A 2JFFA 2O2ZA 4A0HA 2PJDA 3FUCA 5LMCA 3R6LA 5G1NA 2A8YA 1IY8A 2ATEA 3H9QA 3IESA 3P9YA 4L6IA 3I0MA 5LYJF 5BSMA 5CCEA 3SICE 5CDUA 1IQRA 5C1DA 5CX1A 3FNEA 2R8ZA 2Q1YA 1JLKA 1OTHA 4ZODA 5G4LA 3FB4A 2DOGA 1U98A 2CXHA 4PRLA 4ALIA 2QJRA 3G9QA 4AKTA 1ECFA 5FBQB 1LF5A 3LU1A 2QXTA 3DFZA 1FDTA 2BDUA 4ZALA 2G0NA 4I55A 2IH2A 1F2UB 4L0CA 2ZUCA 1VLMA 4MR7A 4KBGA 3M6VA 5AMXA 2QK4A 2ZXHA 3FMOB 3QPWA 4QVIA 2Z6VA 4BMNA 3FB1A 3BMXA 1OB5A 3O3OB 3CZAA 5E3IA 1VKJA 3JU4A 3LK7A 4P31A 2HU5A 1TTQB 4YRLA 4TM8A 2XMDA 1R9GA 4A0QA 3K5WA 1S7GA 4FOOA 2J3KA 3UH0A 3F3YA 3BCRA 3PUJA 3K1AB 3SN6A 5JRZA 3B9BA 3L4BA 3NO4A 5F5NA 5A9TA 3ZDRA 1FMTA 3KQNA 2YUTA 5C4GB 4PQRA 4G0OA 1PZEA 3JYLA 4CMIB 1HZZA 4X7MA 1TJ5A 1WXIA 3KQUA 1IDN1 3HDGA 4BO5A 2Q8PA 4Z4HA 4NNOA 1VRCA 4CM6A 1AO3A 5U9CA 2GCNA 3PK0A 1F3LA 3A04A 1I3CA 3EMKA 5J47A 1HWYA 3FKSA 1VCOA 2ACEA 4N0QA 2OBTA 2ZRBA 4XGQA 3KSBC 3KOZA 4TYWA 2B5VA 1QWOA 4HDKA 3I9NA 3N2KA 3ZIDA 3MTEA 3GX1A 5F9HA 1XRJA 4JP5A 5GVRA 4IICA 2CKDA 3QBDA 3U3JA 1UDWA 2BR3A 3DKKA 2C99A 3WKEA 1OFIA 1EJBA 3FY4A 1XN4A 3GROA 4MYRA 4X0EA 3CBQA 4BEVA 1SXPA 4FKZA 4DZTA 1BKDR 2ZJZA 4UTXA 1VKNA 4A91A 2I4MA 3HJHA 5EIBD 3THWA 1YWGO 3FGNA 4MCJA 4PX9A 2VTKA 4LGVA 2D0DA 3ZE2B 2G4VA 4GRDA 4BVLA 3G9XA 3LZDA 1C7FA 4HQKA 4IEIA 5AXCA 1SOWA 3LF1A 3KJIA 3AHJA 4RACA 2J3HA 4NY1A 5GIOE 3CXCB 1AGNA 3CZ5A 3ND8A 1T8YA 4O02B 4WKOA 4AKGA 3H11B 1LI4A 3KT6A 4KGXA 3NLLA 4DQDA 3MCTA 4OP3A 4ND1A 4ZMSA 1Y42X 2A9FA 3RVOA 1I6LA 5AW4A 4UEKA 2AEJA 4Z3DA 2W22A 1JXOA 1JMKC 5ICEA 3L7NA 2AR7A 2V5UA 1JPJA 2JNWA 5AM4A 4DMGA 1Z07A 1CT9A 3PQ8A 5KWJA 4XJSA 5EIOA 2GN1A 1QHHB 4ZEXA 1JQJC 1ZLXA 2Y0PA 1GU0A 1Y4DE 1W2HA 3VMFA 4QJ3A 4WADA 3RWBA 5K6RA 2NV2B 1T4CB 5TQ0B 1V7QA 4CI0B 1NUSA 4P5DA 1KC8D 1JFSA 2G9VA 1QORA 1VP9A 2VWPA 2IDMA 4KWIA 2B7LA 4YA6A 5BSVA 3KFVA 2NP6A 1IHOA 3BJIC 4S1NA 2NU9B 1Z4PX 1NN5A 1PYDA 2JAUA 2JFNA 3A31A 3CLRC 3E6AA 4LJ9A 2CLLB 2R00A 5AOCA 3IAHA 2BHLA 4XRGA 2V7BA 2VBTA 4BNLA 4RBNA 1HMYA 2Q6VA 3AEKA 2IGTA 1EUCA 3F6BX 3JU3A 4ZAVA 1PSZA 3BIOA 2FSFA 4Y2PA 2P5YA 4K0RA 3WGTA 5JS1A 4HI0E 4QREA 3NHBA 3ZWDA 3FOWA 1P2FA 3N28A 4K1LA 3W2FA 1CE8B 1CQZA 4FP9A 4NYIQ 1CULC 1UWKA 3GZTB 3OHMA 5HUQA 1IMJA 1MPTA 3CC8A 4GOLD 4R9RA 3VSCA 3MNFA 1N5IA 4WCVA 3VR4H 2YXBA 1YDHA 4XAQA 4AF6A 4YELA 1W0CA 2FGJA 5JAZA 2XF2A 1R3UA 4YJ3F 1RPJA 3OMLA 1TYAE 1E0AA 1FBNA 4D42A 4NBSA 5AM3A 1W44A 1E58A 2UKDA 5JNWA 2IEBA 4C05A 3OHPA 1M8KA 3EGDA 1KZLA 5CB6A 2JD1A 4M1WA 4QU5A 4JLBA 1MGPA 2H9IA 4CLHA 1XT6A 2POQX 3FZNA 4Q4JA 4GI7A 5FOTA 1ZX1A 5JNRA 3L1UA 5JU6A 4OK3A 3R76A 4DJTA 4EUNA 1U3CA 1HE5A 1YA8A 1RWWA 2PWBA 1IEQA 2HRRA 5A3SA 4ZC8A 2VKQA 4D8WA 1MC5A 4DVGA 4TUYB 2FPRA 1H1LB 3U3RA 1NBMD 3CEJA 4H3HB 4DM4A 4J7AA 1QH8A 2HA6A 3K0CA 1KYZA 1M3SA 4KN6A 4N03A 5FJIA 4KOAA 3W79A 2QX9A 2ZSBA 1SRRA 4WOKA 1PX2A 3BB3A 2NG1A 3CF0A 1GO2A 3GZNA 3IKLA 4P7BA 3BQJA 3V5NA 3WGYA 4AUKA 4DM7A 5AUQA 1JG6A 1XB2A 4K9OA 3LPLA 1VE6A 3EWAA 3G02A 3K5PA 3KFXA 4UDNA 2ZSHA 5AVXA 2MTBA 4LZLA 4GE0A 3MCZA 1G1MA 1T5LA 1UJ2A 2VP4A 3Q3EA 5JROA 4EYQA 4TKZA 2BIFA 4WZKA 2VHVA 3GDGA 1MRZA 1AUPA 1I4OA 2CXXA 1B42A 3GEPA 1VSVA 3AVOA 3IAUA 3R40A 5CVEA 1VMIA 2IJGX 3LBNA 4GX5A 2FWIA 5EKSA 2ZJBA 3ANXA 3ABOB 4YPVA 2ZWMA 3NW9A 4DYHA 5ADVA 1AZLA 4XKVA 1JHMA 1GUAA 1P5HA 3V6MA 4F9EA 1GGJA 1ZSVA 2C92A 3IH5A 4IS2A 4LRWA 2CXQA 3BMQA 5B64A 1TA0A 4OYYA 3CPWB 1JPNA 1OWPA 1SO8A 1ZVJA 2G04A 5EMKA 1SC3A 4P4UA 3ADCA 1JALA 1F4PA 3DOCA 4D9JA 3EIEA 3K96A 3ZCTA 3W0LB 1J0AA 5KHAA 1JJBA 3LVQE 1JB9A 5ALPA 5TGTA 3UV3A 2X0NA 4Z8YA 2PGDA 1KVRA 3IUSA 1MEJA 1FFHA 2AEFA 3VO8A 3AM1A 4NKRA 4BVHA 4O4LF 4LHVA 4XFDA 4M9SA 4DAOA 1XNGA 1ZKDA 3TI9A 5IJ9A 3GJYA 5DEIA 2BC9A 2QRQA 1P2GA 2FZWA 4BBPA 1J8VA 3BH7A 1VSBA 4KUGA 3A14A 5DK6A 3TRIA 4BMDA 2GCIA 1ORTA 2EIXA 4IGKA 1GNTA 4U6NA 4XTRA 4J1QA 5E2IA 3PKZA 4CKBA 4EX7A 4LCJA 4AZ3B 3QEAZ 3T52A 5HZMA 2IS6A 2OBRA 1NBAA 2WHPA 2VZ9A 3Q3GE 5DKFA 1Y1KE 4YRNA 5CYPA 1Q86D 5GM2A 4Z2YA 4EFDA 2NXCA 1UJ4A 3CNBA 1JDNA 1NR5A 3O8LA 3PLAE 1SHLA 3L6CA 3NEYA 4H15A 2AVNA 3NHKA 2NXNA 4J75A 1CQIA 1D5WA 1BEEA 2R44A 1E3SA 2ZPUA 3DE7X 3DTVD 3EG9B 3QUAA 3PXBA 3OQBA 1ID1A 4FVTA 3JD3A 4G5XA 4I5FA 4KB5A 4MEJA 4MPTA 2XYHA 3VKGA 2A0WA 1BHQ1 2AN3A 4J3JA 4EG6A 5JYCA 1IPHA 2O2SA 3T1QA 1N0HA 5E95A 3RFVA 5DHUA 4D0RA 3PEEA 1EK0A 3ZU4A 5HXBA 3ZQKA 4QBFA 1JAIA 1R0KA 1H4QA 3E7XA 2BAGA 4JNKA 3SOPA 1L3BA 3WK9A 3PJDA 4DIKA 3JWHA 1Z5NA 2OCYC 4P8RA 3ACDA 4KR2A 2ZCJA 1B93A 3KKEA 3EXHA 4PYRA 4I3HA 3LXXA 1I3MA 2GUWA 2XRYA 2XNKA 1UZLA 1NX9A 3G2NA 2CMDA 3PG5A 5KOHA 1ZNZA 4WOCA 5JXGA 1QGUB 5ILOA 1DRJA 5JCOA 4QRIA 3SFZA 3VPCA 4WASA 3TQHA 3DWGA 3OZIA 4D99A 2OKCA 3K9HA 2ZDHA 1S2DA 2D2FA 2EL9A 1G5IA 2O1WA 2ZJ6A 1G8PA 2WINI 3SCZA 3MTQA 1O5IA 4UXIA 4MHTA 3T4EA 1YHYA 2BEWB 2DJ5A 4RF2A 3PIDA 5L7TA 3H16A 4L75A 4L5CA 5AVJA 4CXMA 4JLWA 2FHSA 3WLIA 3BT7A 1ZOPA 1RWMA 2JFUA 3EZFA 1DB3A 1I1QB 3GEMA 1XQ9A 3OT5A 2RHMA 4WZEA 1D4OA 2C1ZA 1GPJA 4AZ3A 1R15A 2XMQA 1P91A 3KRTA 2C7QA 1K7FB 3N39C 5AH0A 1IEVA 3MD9A 4CKBB 5K01A 2IIQA 3IDAA 4KW7A 4ETNA 3GLIB 4KBYA 1X1CA 1FU4A 3WV5A 1YK1A 5U4XA 4TYQA 4CLEA 4MV3A 2VPIA 4UTNA 3QLUA 3LHDA 1YRWA 3FTPA 4RMJA 2IYYA 2D0PB 4MPRA 3RIYA 2J7KA 1LW7A 4MUNA 4IWYA 5E3HA 1Z34A 4ER3A 5CB8A 1L6RA 3ENVA 3NE5B 2C96A 4QD3A 3VR5A 1ZRSA 2E2WA 3I1JA 1TMYA 4MVJG 1GTZA 5A5FA 1AQJA 2E5LB 1B4DA 1HA3A 5FORA 1D1SA 1FY2A 1YE5A 3LCVB 5L40A 1R5JA 3OPMA 1XQ1A 3SYKA 2VAMA 4ZIRA 5B4UA 5F73A 4GKBA 1XCPA 2IUSA 1RYYA 1SBQA 3V1KA 2NO4A 1FEZA 3S1SA 3PNLA 3K9WA 3T61A 1Y6GA 1QOQB 1ZN2A 2XCOA 5E1MA 2A1UB 5ER9A 3PIRA 4M8SA 3FXAA 4HX5A 5K4AA 3QVSA 1YQGA 2QN1A 3ZDAA 1HO3A 1QQ6A 4CCSA 1XTVA 4BZQA 3T7CA 5EKUA 1SD5A 1Q1EA 2FA9A 4RENA 2A3NA 3I55B 2HK6A 3O31A 3CCMB 2O0JA 4N39A 2X7HA 2XE7A 1G6Q1 1NVDA 4ZVUA 1R8JA 2PSEA 3ZV6A 3M0EA 4B8WA 1SU8A 3D3JA 3PUHA 4W8GA 5KPDA 4JLUA 5A5GA 3EZNA 3KAQA 1GPYA 1WOSA 1VZ2A 2COEA 1UEXC 3TLXA 2HK8A 5DHRA 2YMLA 4TGLA 2ZBQA 4ZAZA 1ZM4A 1X38A 5EY5B 2BEVB 2JLWA 1YJCA 3GD7A 4LX8A 4ZYWA 4HRVA 4ISCA 3LNTA 5JLJA 2VHUA 1EZ1A 5FBHA 1NW6A 1TEXA 3WYCA 3FJ1A 2KLBA 2YVUA 3KZKA 2P8SA 5CCDA 1MA0A 5BXYA 1AMOA 2JLSA 2PTHA 4Y1EA 1GZ4A 1L7DA 3ANNA 3M2TA 4D9HA 4KQCA 1DX9A 2Q3DA 3KJNA 4EKDA 1PTJC 4XYLA 2REXB 5K8IA 1KHTA 2GYWA 1NMYA 1KZYC 2OZLA 3VYRB 5L46A 2QVXX 1F38A 5ALSA 4IVQA 3C3XA 3CV3A 1ZGBA 1LVGA 1KIAA 1LNSA 2QTWB 4DVJA 4KO2S 4N6NA 3W3AA 5DCWA 3F6YA 5HDQA 4GPBA 4Z4TA 5EUBA 3HQ4O 3KUDA 1HT0A 3D8TA 2JAXA 2PCJA 1NMXA 4I9FA 3A1PA 3B1YA 2GO7A 3PPVA 5EIHA 1OLSA 2B34A 1WXXA 4ETMA 2YFQA 4K6OA 2HHLA 1ZJ4A 2CDRA 4RZXA 4W82A 1SUEA 5LZ2A 5BV7A 4TMXA 5HOQA 2DT8A 3LX8A 3CCBA 1ECGA 4ZO4A 1FVXA 2AMJA 1H1DA 1CR6A 2NU9A 3MJEA 1EFPB 3G1WA 1I14A 2ENWA 1PL7A 3G49A 2JW5A 3GFSA 4YI5A 1RU3A 3A3OA 3BE4A 4G07A 4PZEA 5TEWA 1K73D 2WT8A 4PX3A 1MT0A 3IJRA 1D4FA 3B1KA 3PVSA 2V45A 4ITVA 3TL2A 1VHOA 1XR3A 3EZ6A 3IS3A 1I3OA 2ONJA 2BHTA 2GDJA 1X1AA 1FDSA 4OAOA 5JJBA 3N8GA 1CYDA 1Z4KA 5IP5A 2R84A 4W7HA 5EJGA 1JIVA 5EOVA 2NU8A 4XVHA 4LBYA 2YN0A 3T1TA 3GLGA 1D1NA 1P0CA 2A33A 2GFIA 3T1OA 3ASYA 4AZWA 5LP6A 5A0VA 3QLVC 2WWVD 4RC9A 2QX8A 3VPHA 1XCOA 1QP7A 3SQNA 4DFDA 3KD2A 4K86A 3UUFA 5GADl 3BZWA 4D02A 5JMPA 1FDWA 2NYUA 3HZZA 4KR3A 2GPWA 1KK2A 2DQYA 1H0HA 2CHEA 1VJGA 3DZDA 2O8EB 1DBRA 3IPLA 3DTNA 1RTKA 1QV6A 1VYUA 2A9RA 4KQGA 4MDYA 2CLCX 3RSOA 3SS9X 1M2KA 2RB5A 3ILXA 1V0EA 2GN9A 4D79A 1OH7A 4ND6A 4FYPA 4MMXB 5DULA 4RZ2A 4DBVO 3GVKA 3HGTA 2G67A 3UK1A 1G16A 4KQ1A 1U0JA 2DP4E 2F8MA 2YYZA 4ZV9A 2W42A 4XWTA 3D8BA 2JCGA 1VCHA 3CGGA 1VECA 2Z5LA 1VE1A 4PPQA 4XDGA 1AQUA 2FLVA 5B55A 1T5HX 2YQ5A 1JXAA 4YMTA 4FW8A 3HB4X 3G0GA 3NU1A 3O26A 4OATA 5TSDA 1OFGA 5AM2A 3LPCA 5AM5A 4B43A 1GVNB 1JYSA 2PRKA 3FSJX 1W96A 2A5GA 2O06A 1P7WA 1U28A 1ZM2A 2XCUA 4KIGA 1R74A 4M9UA 1X3SA 3JD0A 1XZAA 3MIZA 1JHDA 4ILKA 3IAEA 3H2HA 5DPMA 3UKDA 4YIHA 3MMPA 5KTPA 3LJKA 1PVDA 4NCKA 2OM6A 1YRBA 3E9YA 3R6DA 4QAJA 3NEPX 3VNBA 1UBJS 4L95C 1MBZA 1N2ZA 1QIHA 3REOA 3EH1A 3RFUA 2AS0A 1SJ9A 5BV8A 3VH3A 3UOAB 1YRYE 4R1QA 1VA5A 4PGAA 2FUCA 3CMAB 3RODA 1UR5A 1VHJA 3AP3A 3ETDA 3C5WP 7ADHA 2C4WA 1K3UB 3A36A 3RJ5A 3WAGA 5P8WA 3N74A 3T3MB 3DXXA 5K51A 1E5TA 2C8LA 4OSPA 1F2UA 4MR7B 1YV9A 4I55B 2P40A 3LC2O 2RD2A 5AXAA 3FPKA 2L19A 1OKKD 1W1WA 4NZ9A 2B21A 2XZOA 2C0PA 4A7PA 1AK1A 1NVTA 4G8JA 1AGRA 1SXQA 4EMSA 1LS1A 5TC4A 3THXA 2LP4Y 2GB4A 2MHCA 5TEVA 4ZYZA 4U2FA 1HYHA 3FZYA 5JDIA 2O1XA 3AB7A 3ZS8A 1NPYA 1VPLA 4LV5B 2VBSA 1XTRA 2JI9A 2GAOA 4DLRA 1ZGHA 1JIJA 1IZZA 1BEUB 3CJRA 3I5AA 4R2XA 4YP6A 3IRUA 2QSUA 2B4TO 3WHLA 2JLUA 1K8RA 1QS0B 1KDVA 1NOJA 3LBYA 2FZGA 2GZRA 4K87A 1E7WA 5IN5A 1DL5A 2PSSA 3NGXA 4BQIA 3WG9A 1QQBA 2J9GA 1ZM7A 1W46A 1G8MA 2G36A 2RKOA 2WHYA 2ZRPA 4FEGA 4H7JA 3T3GA 5LIPA 1Q1AA 3ENWA 1UMCA 2CCJA 3PNKA 2PS9A 1O77A 1ZGGA 2CF5A 2H06A 1NB9A 3CHYA 3IEUA 1AJEA 3PFCA 5KYYB 4OG2A 4L8GA 1BH6A 2XLCA 3HABA 3LWZA 5HGXA 4C03A 4LHEA 3JASB 4P53A 3W1WA 2QDXA 1J00A 1G63A 4HNGA 3K0SA 3WHPA 1D1PA 2BKUA 2YHSA 4R1PA 2YTZA 4AMUA 4WY2A 1XKTA 4UBKA 5DLYA 5KB3A 3W5HA 1Z0FA 3DZBA 4BNVA 5FFMA 3TEFA 1NP7A 1W85A 4V1CA 1QPZA 2ECQA 4LF7B 4GVLA 1CG6A 2HLDD 1CUVA 4M1MA 4JL8A 2A86A 2JVJA 2OQRA 1QLJA 2EATA 3VKFA 4C87A 3BCHA 3T9AA 2QU8A 1SOVA 1VYHA 3OZRA 5ECYA 1COWA 5KMGA 1B1AA 1G5FA 3HXKA 3FNRA 4FZJA 3WL8A 421PA 1AD2A 3MQ4A 1D2MA 1JIKA 1S9DA 3VR4D 9ATCA 1R18A 1Q3HA 2JIOA 2V3WA 4ZVRA 3OTIA 4W9MC 3CVYA 1NGSA 1HV8A 1XWWA 4N7BA 4N8DA 3UB3A 2EKPA 2IYNA 1VPVA 3R3UA 4D6XA 2CVQA 2XCIA 3FMFA 4QGAA 4Y2TA 3WYBA 2EEPA 2C82A 3PV0A 3UXEA 3K2BA 4ZP1A 5EYPB 4F1KA 4EA9A 2MSNA 3IOYA 1DG1G 1DRWA 1EIWA 1U99A 5GV7A 5FI0B 2VFAA 3TTYA 3H94A 2GK7A 2KMLA 2CXOA 4OV6B 5BWBA 1BHJA 1LLFA 3L92A 3LFUA 5HZKA 4KMSA 2WJPA 3N75A 2BW0A 5AVSA 4JS0A 2C5AA 3VNQA 4DNXA 1N9GA 3CLKA 1MX3A 2YVKA 3WJ1A 3PNMA 2GF0A 1KDRA 2EF1A 3TW6A 1K5PA 1E3IA 1K63A 2WU3A 4WUTA 1RVDA 5L7YA 5IJ0A 4GP9A 3K72B 5JV5A 2NWQA 3VQTA 2K4MA 3ZKWB 4W5WA 3VU3A 3OEHD 1Y6RA 4YRTA 3VR3A 2ISCA 1NLZA 3QEBZ 3GLHA 3GGDA 2ECKA 4IJMA 1LC3A 3V4RA 2ZITA 1ZKMA 1Z3CA 2W8BB 3K2QA 4HXFB 4NE7A 1C2TA 4PZYA 3RS5A 3ZD9A 3ZW8A 1QYWA 4ASUD 4AY5A 2GF2A 3B13B 1Q91A 3IX7A 1YJWB 2G8LA 2HHAA 3MUOA 4YONB 3V6LA 5FKJA 1IDOA 2WOJA 3ZNNA 4AZTA 2ZSUA 3ZBPA 1YVUA 4ZAXA 2JLBA 3G79A 3HCEA 1ZJ5A 1YZFA 2ECFA 4UD6A 5EGNA 1KZ7B 1P4MA 4O1HA 1REQB 1N8RD 1SXJD 5E0OA 4ZI7F 5E9JA 1BW9B 4LMBA 3U48A 1GGEA 2A1IA 2Z4SA 2EP7A 4HNHA 3NBZC 1N9KA 3QVWA 3VV2A 3OIUA 3ZNOA 1UOQA 3NT4A 5HYVA 1CC1S 4HN4B 2C57A 4OO3A 4XSHA 4JVNA 1WWKA 2GK6A 4P4TA 1DC6A 1KY3A 4B85A 3C5CA 1IULA 1KMHB 5EZYF 1O6ZA 5G3YA 2H1FA 5JAMA 1P7YA 2RHGB 2YDXA 4XM0A 2QL6A 2X77A 3I01A 4X71A 4QOGA 1QV7A 1XA3A 4X8HA 1E89A 5CFOA 3GY0A 1DC7A 1Q2XA 1UFKA 1RXEA 4NU5A 4BYMA 2W0SA 2WQ7A 2UUAB 1J8QA 1FYEA 4MUIA 1LH0A 2BGRA 4YGXB 5AW8A 1H42A 1P31A 4EATA 1PV2A 4CKCB 5CVUA 1PJQA 1O03A 1BW9A 1Z8NA 2ZG6A 3FYHA 2GFHA 4K7JA 5A3RA 2R65A 3LPMA 1N2JA 4R7TA 2CFCA 3CN9A 4GBED 1OR8A 1EVEA 4NV3A 2Z3WA 1P3JA 3AY6A 3NDIA 4FFDA 4OK5A 3SEFA 1DAMA 5FIUA 1S02A 1GILA 2R7MA 3MB8A 3B51X 4E5YA 5BMOA 4GHWA 1BWPA 3PGLA 4CV1A 5A4DA 5KYXB 4DNQA 3O5AA 2ODTX 5JAOA 3CW9A 5JISA 3LLMA 2POCA 1CZRA 2ODPA 2BBSA 2VP3A 1KPGA 2IZ1A 1OXSC 2E9SA 5SZIA 2IQIA 2JLZA 5AVOA 3UHJA 4EG5A 2AB0A 3HP7A 3W8NA 2VAPA 5C5CA 5FBWB 3R3XA 5GTDA 2W5UA 1GFSA 1XAJA 3IT3A 3N2EA 2PPVA 1K08A 3IIMA 1M6NA 3SHTA 3ONFA 3L84A 4RGBA 5DYWA 1QIKA 1V5FA 4FNMA 5BN5B 3GLFE 4TTQA 2B82A 1JHXA 2G5TA 2MR5A 3AZQA 4PSCA 2QRUA 1OROA 2FZEA 3L0IB 3WGKA 4U0JA 4HS9A 4CIDA 3I4CA 1BWRA 1W5BA 2WG1A 3DYVA 3MLBA 1FX0A 4X1YA 4GOMD 2EC5A 4Q1CA 4UE3S 4TTRA 5BSGA 1Z36A 2GETA 4OQZA 1HDGO 2ZU0C 1MUUA 3EWNA 1GG8A 1ETHA 4Z4FA 4BUCA 3BJEA 1UDCA 3PC6A 4FYXA 1HQYE 4HBGA 4N5LA 4LRSB 4XFKA 4PCUA 3GYGA 3GUZA 2O0KA 4IYRA 1V9CA 4BB6A 3FR7A 2WWTA 2SBTA 2F8SA 1U1EA 3AM5A 1AKNA 1DV2A 4B31A 5BRJA 1SEPA 3UMMA 1X7ZB 2EWMA 2DBVO 3GAMA 3RUAA 3VR4A 1SC9A 3QU5A 1YJQA 3MTAA 4R01A 4MWTA 2GKOA 4X94A 5CFNA 2UDPA 4L50A 1PG5A 4L8FA 5DXAA 5BWMA 3QUCA 1OZ0A 2Q1XA 5EJ6A 4FBMA 3UPDA 2MSEB 3EPPA 4CUZA 3OIVA 5BT8A 1O9BA 1WLSA 1YA4A 4RS4A 2CNWD 4CQMA 3C3DA 4QQFA 1NQAO 5KYYA 2A9KA 4Q1EA 3VNRA 1Q7RA 4DLSA 3CH6A 1SBHA 4RQBA 1T6NA 3SM3A 1H5QA 1VFNA 2Y66A 3SC3A 5LLDA 3N5KA 2Q0XA 4TWZA 3P52A 4DLYA 1QKJA 5L4LA 4Q66C 1I18A 1UM9A 4BB9A 2X0RA 3KZXA 1C8VB 1ARZA 2H57A 2P11A 3B6EA 2JIDA 5BN4B 1GA6A 4RF5A 1FSSA 1K5GA 3JX9A 2GN2A 2ASVA 3IOMA 1E6KA 3PVDA 1JE1A 4RVFA 3RIHA 4BTVA 4E0BA 4ADSG 1PGPA 5HX7A 2VDVE 4TRNA 4J16C 4MUBA 1SG9A 2YCLA 3EXFA 1C0EA 3CUTA 1NJ2A 4I1IA 2NZJA 3ZXYA 4AB1A 4A3SA 2C2ZA 4HN9A 3CX6A 3MWJA 4LXYA 1U7HA 2VNKA 2O6LA 3W5CA 4HLUC 4I2VA 1BU8A 4WLUA 4EOGA 1EM8B 2I5PO 3B36A 3FYSA 3ZZMA 1COZA 1W4LA 2QT9A 4BLWA 2OHJA 4IH1A 5DN9A 1GZHB 4B3IA 3L8EA 1ZFNA 3DVAB 1XROA 2FX3A 5T3YA 3HBNA 4G97A 4D3XA 4ZEMA 3S8YA 3NAZA 3S2IA 2EP8A 5A71A 4GNRA 1USKA 4W6ZA 1U0HC 3BMNB 3VAAA 1C3OB 2ZI9A 3GT0A 2PG3A 2EU8A 4G1EB 4M36A 5EXXA 1Y3HA 5EIEA 3BTUA 4ARZA 1T0IA 1T8SA 3QXCA 2CBXA 3DTVA 2WVHA 4KK4A 3WXBA 2P9YA 1O9HA 1NZFA 4GR4A 1OBFO 1SBNE 2VPYA 2ERXA 3KKKA 2NU7A 2VXYA 3BZUA 4G89A 1QIFA 4BMVA 1IZ8A 3IP3A 5FJJA 2E7ZA 2D13A 2QPAA 1NQWA 1WABA 5K03A 4ES6A 4P86A 2YJZA 4RU1A 2GD0A 4HFRA 2ZWIA 2GPSA 3IMGA 5GWXA 5IX8A 3THOA 3HWWA 4XOUA 3C6MA 3QW4B 3CYFA 3CONA 2X8WA 4XGKA 5IN4A 1ZLYA 1BYIA 1N5MA 4YTEA 3FNHA 5TRTA 3E03A 2I78A 3AI2A 4LWZA 4MP6A 1VIAA 4LK2A 1VB3A 2ZPAA 4RVDA 1RHUA 1WXHA 5L95A 2WSBA 1VQPB 3AOEC 1AZTA 2BFCB 2PMBA 5FB3A 1T24A 3FVRA 4YGYA 3UATA 3ZE0B 1FNMA 4OFZA 2HA5A 3AX6A 5T6MA 5CLQA 1ZK3A 5I9IA 4PNZA 4YXFA 1UC9A 3HU1A 1YVPA 1YVDA 1U94A 5K2MA 1FPMA 4IZOA 5H1YA 4W4TA 3AM4A 2PKCA 1E9CA 1QHXA 4P12A 2G0TA 3QIVA 4J9UE 1YJNB 3OIFA 1WSVA 2Y1KA 3JQGA 4XVQA 3HUUA 3OOHA 1N5DA 5L3ZA 4X91A 4XVCA 1NYRA 4P6YA 1NUPA 2I62A 3IIIA 3O3NB 2QP9X 3COWA 2W6NA 1ORDA 4HLNA 5EN4A 1UF9A 2NU8B 3RVQA 3X1ZA 2V7GA 4UHDA 2ZTSA 4ND4A 1QG0A 3CT6A 3GG2A 4O08A 4MUGA 2CW5A 5K8CA 4NR0A 3WGLA 1PQPA 4WZBE 2X1LA 4R81A 2CT8A 3FPJA 1YOVB 1QO0D 2G9RA 2Q28A 5JR3A 2GZSA 2WV9A 4YUVA 1BMTA 4NATA 3ROKA 2R5WA 4F11A 4BDSA 2VUSA 1PDOA 3DEHA 3W5SA 1K68A 3M3PA 4FCVA 1YZQA 1OXXK 2J3QA 2O57A 2GXUA 4IMRA 2WTNA 4FGSA 2HJHA 1F7UA 3A9RA 3VJKA 1EG7A 1O96B 1YCHA 1NXVA 1JT9A 5JSUA 5KNLA 1E7SA 1DDIA 5DO9A 4XIFA 3T1YB 1NVEA 1X80B 5KSOA 1V25A 3K0BA 5I3CA 3A10A 1U2GC 3PUMA 2CXTA 5BYBA 4WA8A 4XYMA 4ZVQA 3S40A 1X19A 4I1YA 1IBMB 1NYLA 4XVUA 1KEZA 3Q9SA 3SC2A 2NXEA 2J3JA 5LZ7A 1EUYA 1R0YA 4XWAA 4MYSA 2TMGA 4WW0A 1BE0A 4BKOA 4FWIB 1OXKB 4DT1A 5BYKA 2X9LA 3UJAA 3M5WA 1Z2CA 2GEFA 3NPMA 3LUPA 4KYIB 1WU7A 3ZPXA 1W36C 2JI6A 4NK5A 3D2LA 3ESCA 3RS4A 2YNMD 1U7PA 4M8KA 4E5NA 2V7WA 1D1QA 1K89A 3VH4A 4JGGA 1GCGA 1V5GA 4F4CA 1P3DA 1M2FA 3T15A 1J56A 4YRSA 1F2VA 4LDAA 1TMGE 5AJVB 4H27A 1CS0B 5ALQA 3RFCA 4DIFA 4DNRB 1CUIA 4KODA 5I5EA 3AT1A 3A9TA 3A1DA 1B43A 3PXEA 4IIBA 4B80A 3WO0A 3PE3A 3R3WA 4IIYA 3E70C 5LYJA 2B98A 3OOEA 2F3UA 4I1SA 4JLPA 4YRIA 3P94A 4EVRA 1J8DA 3VO1A 4N41A 1YDEA 4W5RA 4G7WA 3NDPA 3NYRA 4PYNA 2HJSA 3MOGA 4QVGA 3BTSA 4D5EA 2N46A 2AKAB 3AH8A 3OMXA 4KXYA 4XN3A 4XNFA 1NJ6A 3AQIA 4LE0A 2IYRA 4H9GA 3NATA 3SM9A 2BFPA 3TM4A 4GPAA 4YJDA 1ZI6A 2R48A 3H5WA 1DT5A 2CJYA 2I9PA 1EGVB 2PYZA 3EUEA 4EHAA 4EM6A 5HM6A 5IYWA 4NBTA 5BSUA 3TQSA 1QLHA 4FFVA 1Y5RA 3DF9A 4FFRA 4I5DA 4X3PA 1HVXA 2PUAA 4OQYA 3UVEA 2IOHA 3RNOA 4CNBA 1JFLA 4CKEA 3ML1A 1AUOA 4DJDC 4EEKA 3CLSC 2DUNA 1AIPA 3N2LA 5B3JA 1ZVKA 3ZJ5A 3WLFA 2C4MA 2QP3A 3PQ6A 4K6GA 4AULA 3CP2A 2YFKA 3K6SB 1VHLA 3S29A 4A2QA 1BAPA 3AVUA 3ZD6A 1DWUA 5K0SA 1H2XA 2ZJ1A 3RREA 1WW3A 1IQPA 1YJ8A 3UJ9A 1HE1C 4Z51A 1XA4A 3JAKB 4MVJI 4GP7A 4BO2A 2FEKA 1FRZA 1FSPA 2O0HA 3HEBA 3KS9A 3MJVA 4WBNF 4OP2A 2C54A 3WQQA 2WKPA 4LYFA 3YASA 2WHRA 4NAHA 4PLFA 5E4FA 3PGVA 3BRCA 4DRXA 3O93A 1D0VA 5IAAA 2YHBA 3OCCA 2WUWE 5E4YA 2G82A 3W5IA 4PG6A 4XPZA 4ENVA 1W4RA 3RE1A 1SBCA 5B1IA 1LLCA 2QVBA 1P6XA 2ZTVA 4DWWA 1GSIA 2Z4TA 3NDRA 4PSUA 2DFPA 5DI3A 3V8QA 5LKAA 2NT4A 1SUAA 4M8IA 4OSOA 2V6JA 4JZYA 2RH9B 5EHQA 1WZCA 1CEYA 5K0NA 4CPDA 4P3YA 5CT9A 1V41E 4FONA 3L5OA 5FNZA 3PDJA 2JFPA 2PKWA 4MCHA 1T8TA 3OCXA 4X8OA 2NUAB 4ZT5A 1UMKA 4LRUA 3T9BA 4BU0A 4RVCA 2RHBA 3H5LA 4B0PA 4H1WA 5IZCC 1F0NA 2P7HA 5ABPA 1EQUA 3V4SA 4CL2A 2XYPA 3PNOA 3L8CA 2XITA 1TQ6A 3TNLA 3QBVA 4BWGA 1XLWA 3U4AA 2B4RO 2K7FA 1PZMA 5KJCA 3SQMA 4KQFA 3NTQA 3NYIA 4A26A 1QGUA 4EZBA 3S55A 3MOSA 1Z6TA 2PWAA 3ITKA 5KOHB 4I6EA 1Z2PX 4LXXA 2B6NA 3TQOA 1XZBA 3NTUA 1P61B 1AX9A 1WEKA 4F21A 4OMUA 1W19A 3UT6A 1M0EA 5BN3B 3H75A 5L6LB 1X7DA 1ZN8A 1FTSA 2YDYA 3P0EA 4IJQA 2ZXUA 1MF7A 1XDZA 1ZJYA 4LDQA 5LA6A 4EHJA 1SUWA 3GJZA 3RSSA 4F6LA 3MINB 5M29A 4AJJA 4PCLA 2HBZA 3NH9A 4WNIA 4BFYA 1N57A 1LSJA 2YMMA 4RGYA 2TYSB 1KJIA 4M1ZA 2DX7A 4MA5A 3UK6A 3R6JA 1MOQA 2VO1A 3DEZA 4MV9A 2HPHA 4A6XA 3BMCA 3GJ7A 2HTFA 4D9FA 4YT4A 4PSDA 3SIRA 1Y9JA 4UNIA 1EWTA 3ZDEA 2PRJA 3M3DA 1T0BA 3EARA 2JBWA 3JRXA 4UBLA 4I4TA 3WIOA 1CDZA 4ZYYA 2A67A 1C9DB 4DREA 1ZD8A 2G3YA 3ZW9A 1XFAA 4CDMA 1YJ9B 3CCRB 4CLRB 3COJA 3OLWA 3DOFA 2HPAA 3GAZA 5ALGA 4I9NA 2CE7A 1ZD4A 1NXQA 5AK4A 3CO5A 2NTYC 2HUNA 3H17A 4PGFA 4H4CA 4TSKA 2V0CA 2WHPB 2HV9A 2QN3A 5CCBA 4XL9A 4KLNA 5I8WA 2Z9CA 1Z33A 1I7NA 1ENOA 1MG0A 2WWFA 3KCQA 3GGPA 4GBGA 2ZUEA 2WI8A 2PSDA 1LKZA 5K9ZA 2ZRHA 3UGQA 4J76A 1HDEA 1A4RA 4C78A 1C14A 4QELA 1ZCAA 5JBNA 2BCGY 2K87A 3AVQA 3OECA 3ASSA 4RLSA 4ERNA 3IUJA 3H84A 4AICA 4AS2A 4B4UA 2GXAA 4OI0A 1E1LA 5T4BA 5FUQA 1DPFA 2J08A 3ASTA 5E6SB 2HCBA 3ILYA 1F0PA 4Y2VA 4B7UA 4DHWA 2V6BA 4M0KA 4YPOA 4PBSA 2AL7A 3HXOA 4IO0A 3IQGX 4O2AA 3RHFA 1S3GA 2XW6A 3KDAA 4LNAA 4B5KA 2YWBA 1B1CA 4KRYA 5EFOA 5HCNA 4GI2A 5AW9A 1EVYA 2EW2A 3T3HA 3CPHA 2CCGA 3PWSA 3KLNA 1HSZA 4RVOA 4AU1A 5AD1A 1KZHA 3FLEA 3ND5A 3DLTA 3WLPA 5BUCA 1I30A 4XB1A 3EBLA 4XQGA 4AIIA 4KQHA 1QVVA 1YUNA 4J49A 2P2LA 5FTWA 1OF1A 4PGOA 1F6DA 4WT7A 3KU1A 3WIEA 5K09A 1NT4A 3BGDA 3FJYA 1SZJG 4L76A 4FJ1A 3SBEA 3GJ0A 1V5IA 3TH5A 3BCDA 2BRUA 1VE5A 2ZT6A 5NLLA 1M1YA 4QATA 3WL3A 3B3AA 3AK4A 4TXNA 4KWCA 3U4CA 4ZFNA 2HLDA 3OOCA 2EZ4A 4B74A 1T3TA 1W5EA 1IB6A 3F9IA 4C29A 3GZNB 4KAAA 3K9CA 3ZY4A 4CCYB 4PAWA 3X1XA 1NN0A 1SIWA 1OYWA 4ICIA 2C5BA 2XXJA 3I9V6 3WNVA 5B58C 3U3XA 2WJYA 1ACJA 1QH8B 4IVRA 3RADC 3U61B 3AY7A 1RT9A 4IUYA 1X7GA 3H9CA 4YJFB 1GTJ1 3PFWO 4B6RA 1YLOA 1H1LA 4HAYA 1N77A 3F46A 2V97A 4YHBA 1XZIA 5TNXA 1ODSA 4I5IA 1U0TA 1W5FA 4JI4B 4BFUA 5TMPA 3KWJA 3I04M 4YNBA 1BS1A 4B35A 2KWIA 1JHYA 1DBQA 1ONSA 1C7IA 4Q4JB 3NWEA 3VOTA 3VPXA 2FMIA 3EGEA 6CHYA 2G88A 1A9RA 3MBIA 1V1MA 4RVUA 3EGDB 2WPDA 5K3DA 2Q2QA 1GFWA 2VT7A 1V47A 5CUQA 1WXQA 4HGNA 3ES9A 5ERGB 3WLSA 4QEZA 3S70A 3FJOA 4DEXA 3CX7A 3BOSA 3EB9A 1W5SA 1LI7A 2H0AA 2IS2A 2H4ZA 1IEWA 1OJ7A 1ZISA 3N6VA 4B45A 2PNFA 2I1QA 4E1BA 3DEIA 4OYLA 1ESEA 1ZAYA 2IYFA 5BOVA 1J20A 4XVRA 1J8MF 4Q6WA 4NC9A 4OMFG 4DY4A 5CFPA 5GZ3A 5K0FA 1CE8A 2YZ2A 4R2MA 1T34A 5KS2A 2OG2A 4C4YA 2G4LA 1M6EX 4Q82A 4ALKA 3LK6A 4C7BA 2XAUA 5DGXA 4I81A 5DCLA 4AO8A 1U31A 3AEKB 2Z98A 1JDPA 4YDHB 1X8JA 3ROFA 4N1AA 1VHDA 3ZBUA 4L08A 4OAQA 3UXYA 1P1IA 3I1FA 3WRXC 2BVNA 2PKYX 4O0MA 4M1KA 3V8MA 4MRVA 5DYGA 2QMUA 4BY9E 2JJQA 4JV5B 1J9ZA 2B1RA 5FO0A 2DUWA 4CIVA 2RHCA 4BQEA 4RIIA 5DSTA 5HIKA 2P30A 4EG3A 3OQNA 1KYTA 1T4CA 2ZRFA 3LT5A 4JB2A 2OCDA 4ITRC 2X8AA 4X20B 1AXRA 1OC2A 4EYOA 3P97A 1IQUA 1QHHA 3ZHQA 3UPUA 2W2LD 2XNJA 2HT6A 5LP6F 7MHTA 1JDUA 3PTAA 3MQ2A 4MW5A 3V7WA 3LUAA 3RWOA 4A4DA 3GJTA 3RC1A 4HHEA 1G3IA 3B1ZA 4E2XA 1IMOA 2YYYA 1C0LA 2XGJA 2YOGA 2Q21A 4RPKA 3B8EA 3D1VA 3E4DA 4Z3OA 3ZWVA 4K3UA 3PPYA 4QQNA 4Q03A