1QG0A

Wild-type pea fnr
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
HSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A productive NADP+ binding mode of ferredoxin-NADP+ reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
total genus 91
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qg0A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qg0A02
3CCRB 4LC0A 2QTZA 1E62A 1UMKA 3P27A 1A8PA 4PC2A 1JA0A 1EXMA 4M1KA 3LVBA 2RC5A 1NDHA 1ZM4A 1QUEA 3OJWA 1EFCA 4EH1A 4MYTA 1GVHA 1HA3A 1D2EA 1GAWA 4QFMA 4G5GA 4RD6A 3CMEB 2YWGA 5TR9A 2BN4A 4TMVA 2QA4B 1E63A 4RD4A 2E1RA 3OZUA 3ZZTA 4B47A 3B82A 2B7BA 1VQMB 1QFYA 4M4SA 4Y9UA 1D1NA 2XEXA 3G6EB 2CNDA 3QFRA 1FNMA 4WQMA 2GPJA 1E64A 3W2IA 3VNUA 2VNHA 1R5BA 1QUFA 3WBKA 4H9GA 1K9MD 1DARA 3CCVB 4YAWA 1IJFA 3OW2B 3MHPA 2OTJB 3LYUA 1IJEA 3CD6B 4TMWA 4DQLA 4B43A 4YAUA 1KD1D 3CMAB 4YHBA 2YWEA 2BM1A 4B48A 3CCQB 1AMOA 2BVNA 4B3XA 3A1FA 3U6BA 1G7TA 4G1VA 3WY9A 1VQNB 5FA6A 4DQKA 2QDXA 2DCUA 3W2HA 2VNKA 1TUIA 2VNIA 2C78A 1I7PA 3B8HA 3CRZA 1ELOA 5JBQA 1YI2B 4BPRA 1EP2B 2QN6A 2VZLA 3P26A 2VNJA 3OZWA 1W34A 1DDGA 1G7CA 1R5OA 3JQRA 1KK3A 1F20A 4YALA 4FN5A 3CPWB 3CC2B 4N3GA 1DG1G 3QE2A 1ZM3A 1QH0A 2BSAA 4AF7A 4B4DA 5EMNA 1VQKB 2HMAA 1R5NA 1FNBA 4TN1A 3WXMA 3W2EA 2HCJB 2OTLB 3CXCB 4YAFA 4RD3A 3B78A 5TV2A 3AVVA 1W35A 3W5UA 3I1FA 2PLFA 1ZUNB 3PENA 3MMPA 3QFTA 3OZVA 2D74A 4AC9A 1FNCA 3I55B 1FRNA 3WBJA 4Y7CA 4AF6A 1YITB 1OGIA 4P6VF 3CCLB 2PMDA 4LBWA 2GQFA 2HDNB 4C0SA 2QTLA 2BMWA 1QGYA 4PC1A 3ZC3A 1VQ6B 3ES9A 1VQ5B 1CNEA 2CRVA 1YIJB 3I56B 1M90D 2QMUA 3VO2A 4G1BA 1YJNB 4RD0A 3QFCA 2C77A 1H85A 4QHYA 3WNCA 4MYUA 1S0UA 3AGPA 1KJZA 2QEXB 3JQQA 1KTVA 3JQPA 1KQSB 5H5JA 2BPOA 1VQOB 1OB2A 1TTTA 4HE5A 3CCJB 1F60A 3CCUB 1KC8D 1BX0A 1EP3B 1BX1A 1JNYA 2RC6A 1N8RD 4P3YA 4TMZA 4ZGQB 4ZCMA 1EP1B 2BGJA 1J9ZA 3CW2A 1TLLA 3CCEB 2YWHA 4J0QA 4YAOA 1VQ4B 1GJRA 4IW3B 2NPFA 3AVYA 2FX3A 1JB9A 4ACAA 4FWTA 4LBVA 4K1XA 3WNDA 4RCZA 4ZGNB 3ZBTA 3WYAA 4UAJA 2J7KA 4PC6A 3W5VA 5AN9A 2X3UA 1GR1A 3CB4A 5GV7A 5DSZA 4U9UA 4RCYA 1VQ7B 3VO1A 2BM0A 2PIAA 1W87A 5KSWB 3VNVA 3ZBUA 1EFTA 4ZV4A 1XE1A 1N0UA 3OJXA 3ZZ0A 1QGZA 1KK1A 3AVTA 2B7CA 3WNBA 3G71B 4M2LA 1DDIA 2ZITA 1B2RA 1BQEA 1VQ8B 1K8AD 1EFUA 5HXBA 4M53A 4R71A 1ZM2A 3ZZUA 1W2BB 1KRHA 2BV3A 1VQ9B 1ZM9A 4PGOA 1SM4A 4PC3A 4N3NA 1QVGB 3AVXA 3U6KA 4PC7A 1JJ2B 1CNFA 1KK0A 4TMTA 4B44A 5GV8A 1M1KD 1QFJA 3AGQA 4LBYA 1FDRA 3AVWA 2DERA 1BJKA 2BF4A 4C43A 3E20A 4LBZA 2OK8A 4ZCLA 1AIPA 4FK8A 1QG0A 1OB5A 2EIXA 1K73D 2DY1A 4TMXA 1FRQA 1FNDA 4NBSA 1KK2A 1YJ9B 2XNCA 1QFZA 4ZCIA 1YHQB 1QVFB 3QFSA 3W2GA 1QGAA 1Q7YD 2DEUA 4ACBA 3MCAA 2VYQA 2BGIA 3QSYA 3E1YE 1VQLB 1JA1A 4M0LA 1VQPB 4RJLA 3LRXA 1OGJA 2R6HA 1QX4A 1WDTA 3V76A 3LO8A 3SJZA 1G7RA 3W2FA 3CCMB 4Y9RA 3CC7B 3FPKA 1TVCA 2YWFA 3AVUA 3W5HA 1N0VC 1SKQA 4F7DA 4RD1A 4HE6A 1Q81D 2B5OA 1XB2A 2OK7A 3G4SB 3FJOA 3U2QA 1H42A 2AHOA 3CC4B 4Q7JB 1EWYA 1D8TA 1G7SA 3J81k 5H59A 4NCNA 2EFGA 1Q82D 1B23P 5THXA 5TY0A 1YJWB 1Q86D 1CQXA 2DETA 1GAQA 1NJID 2XNJA 3CCSB 3VMFA 1S72B 4RD2A 1GO2A 1U2RA 1IB0A
chains in the Genus database with same CATH superfamily
5CU7A 3SP1A 4LV6A 5T4EA 3LLCA 4F5YA 1FYFA 1IM5A 1YQXA 2DQZA 4PC2A 2HU2A 1I3KA 1ZOLA 2NADA 5JISA 1N5JA 1L8QA 1YI0A 2VPXA 2Z3WA 4MKGA 3WS7A 4IRXA 3E7PA 1QLWA 1WXEA 5B1HA 2PANA 2R3SA 1NKTA 2WNHA 2C5EA 1HTBA 1IDN1 2BSXA 3AL0C 3VV3A 1THMA 1W5SA 4GWKA 4JNKA 2IX3A 1Z0KA 2ACWA 2B8NA 2CUTA 3ANMA 4MYTA 1SXJE 1LBIA 1S9DA 1X7YB 1ZJ5A 2H92A 2OBNA 2QJRA 3LSTA 3BDAA 4FSDA 4UQOA 1OFUA 2AMJA 1SCUB 4WLOA 3M49A 5DYWA 1O1YA 2RDMA 4XUEA 3TB4A 3ZCPA 5BPHA 3KVYA 1WTCA 4PXAA 2RGYA 3OJ0A 2PZBA 4MQMA 3ZY2A 2E1RA 2PR2A 5E7MA 5AVZA 5A8AA 1GTJ1 4LZOA 4Y6PA 4Z1MA 3DDNA 1KQFA 2UZ0A 1KP3A 1LWNA 3WRXA 2YYZA 2W6NA 1ADCA 4QSHA 5C5IA 5CFNA 3GMSA 1T8RA 3ZJ5A 2H06A 5AHRA 1D1NA 4J90A 3D3KA 2CNDA 1ITZA 2GHIA 2M6RA 2ORED 4L02A 4UEKA 5C34B 4AN0A 4D9IA 1Q7TA 5GGYA 1HI9A 1YB6A 4RHCA 1PJ2A 4XWGA 3TRJA 3ASYA 2VVTA 4D99A 2DE0X 1D7OA 5F76A 2VT6A 4MA4A 1KU6A 1UZUA 5L51A 4YIKA 3TSZA 1WPGA 4NU5A 3NYIA 4H16A 1F8YA 1C3EA 2NM0A 1W47A 2PRKA 1EGHA 5JCXA 4MV8A 1KO7A 4P22A 4C7MA 4M8IA 4EK9A 3IVAA 3FPEA 2IPNA 3L9XA 2CT8A 2D1SA 4MQFB 4Y67A 5CNKA 1YACA 4OP3A 4RIIA 3H0EA 3GBSA 4R1QA 3VZCA 3P0FA 2P3LA 4S0ZA 2QMZA 4UHHA 3ONDA 1AUXA 3PQEA 2PS3A 2QL5A 3C3YA 3HVIA 1EP9A 2MOKA 4XWAA 3HNPA 3MGGA 4WT7A 3U4HA 4OQLA 2OGSA 1PFGA 2HLHA 2ZRNA 1XMXA 2IT1A 5HS6A 4ZYZA 1CY2A 1NLZA 2VPYA 4GXRA 4CLOA 4UFPA 2X5NA 1ESEA 3ZWCA 5DIZA 5C7IO 2J9FB 2YWRA 3RW9A 4EW1A 3NRJA 5I7OA 3DNMA 3OOEA 5TQ2A 4IDDA 4ETIA 3KSDO 5G53C 4RHYA 4RTOA 2J3LA 4JJ4A 4PSUA 1T8WA 4RA6A 4FS8A 4KLAA 5REQA 2IV3A 3U4CA 4L2IA 3CRRA 3OVMA 1IK6A 1YCFA 3E8MA 4FOTA 1J56A 4W1SA 2C5SA 3MRSA 2DECA 2JH9A 3RRYA 4BNHA 2OFPA 1Y8QA 3DQZA 1FX1A 2VBFA 2CMDA 4X7DA 1K98A 3G02A 3FUCA 4HNQA 1JEOA 2AQHA 4HG2A 1QLHA 4ENQA 5BUQA 2HQOA 1XLTC 1P6XA 2J3EA 5BO5A 2CBXA 1J25A 4MGIR 4WRRA 3RSHA 4OAQA 3VR4A 3BCHA 2YHIB 1E0JA 5KWVA 3EAGA 2Z95A 4ZTUB 4BP3A 5JY6A 3O4HA 4JC8A 4TKZA 4KN9S 1J07A 5ULLA 5IVHA 3K1ZA 2ZAGA 3VUEA 3LGAA 1MJGM 1U2GC 2J45A 3FTEA 5AK4A 4HS4A 1G6OA 2QRNA 4YDRA 2IIPA 5CITA 3GJ3A 2JGMA 4N82A 3K94A 1N05A 3SIPA 2HRZA 2E4ZA 4JELA 1HM5A 3CLSD 2NXWA 4BVLA 2C3UA 2AMLA 4XM3A 5LM3A 1ZH6A 2HQSA 3U56A 1ONSA 3O8DA 1GSIA 1TQ2A 2HV8A 3FSEA 1KHTA 4DQ0A 2RGBA 2I4TA 4RSGA 4D46A 3QWHA 4TRNA 5BN5A 1C9JA 4UHDA 3HWSA 4J0CA 2RBEA 1XTVA 1IZ0A 1F8GA 3EXHC 3JXEA 3Q41A 5CLQA 2DYKA 2IXTA 4B71A 1JMKC 3JTEA 3D6TB 4YCDA 2HJHA 4HEA6 4QBFA 3W7BA 1MEOA 2A94A 1DRJA 3G49A 3DUWA 3DV9A 1UANA 3ZLVA 5BWOA 1USWA 2F00A 2E4WA 4FFBB 2HMAA 3EQ6A 3RT9A 4AJ9A 5BVGB 4YREA 2HHHB 2R1ZA 2H8KA 3FDJA 5I8WA 2D2FA 5IEJA 3KB8A 1ZGBA 3Q6QA 4WNCA 1SXPA 2QTGA 3G6KA 2YXLA 3U3RA 5JT1A 1Y48E 1L5LA 3CXCB 4YAFA 5D84A 5LZ7A 1FX0B 2C1ZA 3KZ1E 1U1IA 3PC8C 3WDLA 1XZQA 3I9V6 5LU9A 5TV2A 1XZGA 2LBPA 4LRTB 4ZT4A 1I1NA 3BNWA 3PHHA 2ZJ1A 3EFEA 1JRLA 4O4IF 5JV5A 2PWYA 3ADPA 1KDVA 2OA0A 2OB1A 4GX2A 1HOTA 1DEKA 1C14A 3LRTA 3QLVA 3UAZA 3M2PA 1E89A 4B1FA 2MSLA 3HZOA 3N9IA 4X61A 1ZI9A 2DB3A 3U7GA 3T3EA 2QMOA 3O94A 4NYJQ 1FYEA 3A9VA 1MXHA 2ZR7A 3ONNA 2VZ9A 2ZZEA 2VP2A 5E9JA 2NU6A 2Y1KA 3JD1A 4M21A 1VE9A 5E4TA 3E7WA 4X7RA 3HCPA 3J7TA 2R8YA 4TLMB 2GQFA 4Z4SA 5JAPA 7GPBA 3NE5B 4CCYA 3SS8A 1H1DA 1ZN9A 5IZ4A 1Z4LA 1FLNA 3NUZA 1JLLB 2BMWA 2D54A 5FHQA 4CLOB 3ABQB 4B3HA 3HUUA 1PW7A 1AE1A 1CZUA 1RWWA 4GRIA 5DM1A 2CE2X 2R4UA 2EWMA 5FWYB 3ZI7A 3MT9A 1FW6A 4P3OA 1L3IA 2YS6A 1P4SA 3BN3A 5EEGA 1T13A 2ZJ5A 1RWQA 3NOQA 2P1RA 3NJ8A 4BBPA 2PDAA 3DEKA 4RYDA 3VO2A 3A58B 2IDMA 3PPXA 2W2LA 5EQDA 3RSGA 3CX4A 5B2ZA 4CKEB 3I8SA 4HS9A 4AY6A 1N8SA 4LE0A 1ABBA 1O08A 5IJAA 3TZKA 4DANA 8ADHA 2AC7A 4FFNA 1G8KA 1M34E 5C9ZA 3O93A 4BXOB 2P79A 2AYYA 1QKJA 3IEMA 2BYTA 4HFJA 3C6QA 4MR8A 4IS2A 3S5JA 1J06A 2B2CA 4DLUA 3ZWDA 1J0DA 4R3UC 3IQGX 4KKUA 5BRJA 1GN9A 4FFOA 3UZUA 1CZLA 2FG6C 2H5IA 2ZI3A 3MCTA 2PH5A 5J59A 3JVEA 1C2YA 4P12A 4E21A 3IAS1 2FF7A 2QXYA 2NUAA 4S1PA 3B85A 3W3AA 3HJUA 1ISMA 3A7EA 3U7RA 1U4OA 1LF0A 2P6OA 1WMAA 2GJAA 4YLGA 2JFUA 1UM9A 2UZ3A 3E7FA 1UBJS 1F60A 1ND5A 1R00A 4G2TA 1IXKA 4D8YA 3VZSA 1R3UA 3IVMA 1Z7GA 3MRXA 2J3IA 3BRQA 4PPQA 4V0ME 1WVGA 4DSAA 1PK9A 1NU8A 3KXKA 3ZNQA 1JNYA 3BH0A 3L93A 2IFTA 2A5YB 4I1IA 4TMZA 5DMXA 3O5AA 2EQ5A 4OHOA 4FXOA 2O14A 3FN4A 4KMSA 3AKDA 4BRSA 4KXUA 4YMGA 1H2FA 1UPXA 5FXMA 1D1TA 2WYUA 5DH9A 2A57A 5TQ0A 1LSOA 1GTRA 1H22A 2X4IA 4LY6A 2PJDA 4OH1A 3NUQA 5JXHA 4I5GA 1X70A 4HZIA 1YULA 4JP5A 3SOPA 4WY5A 4TQAA 4BLQA 1QYWA 4ZEOA 7ADHA 3AVYA 3N8NA 4B4WA 1E6LA 1NLYA 1Y5NA 1H2AS 3IDSA 4XA8A 3CLTC 5HDQA 2ZPUA 1M1NA 3ENZA 4Z0TA 3I8OA 5TRDA 3WNDA 3PNSA 3SDBA 4LJLA 4CG3A 3B60A 1L7NA 2QG4A 2FQWA 5I4IA 5LUAA 3IEVA 1PT5A 1SUCA 3CUWA 1AZSC 3NHPA 1DOHA 1NQAO 2VP6A 3CHYA 3I9JA 4UU7A 3K4PA 5ECYA 3D3WA 3OOWA 5K0GA 1JZSA 4FEEA 5D1NA 4F6LA 3FYTA 5KTMA 3W5VA 2OYNA 1KIMA 1GR1A 1LVGA 1YKGA 1ZQ9A 2WV7A 3ETHA 2OWDA 4MKFA 1P5ZB 1LXCA 4QYTA 5D3MB 3TMYA 4UNNA 3MMXA 3GYBA 1E2HA 1R0SA 2WKPA 1BDJA 3QEKA 5EWJA 2NU9B 3TAXA 1LTQA 4RO0A 4BX0A 1PVOA 2DWUA 1A8QA 4KO3S 4QOHA 4PZUA 1SY7A 3CRVA 4YLEA 3OD5A 4G5SA 4CQLA 1N77A 4PCAA 4C0JA 4O29A 3OW7A 2NO9A 3UENA 4DXHA 2C4NA 3H2JA 1FNSA 2WU4A 2WYVA 4L9AA 2BUAA 5HZAA 1A9PA 4R16A 2E4VA 3RC2A 3MJTA 3PNOA 4Q4HA 1RJ9B 2BFDA 4K81B 3W5IA 4QUEA 5CLLA 4YRTA 3L8ZA 4E1BA 1O94D 1RHKA 3DKIA 3O0DA 5JWOA 4FLMA 1TM5E 1TQ8A 4B7UA 3L0SA 1VKNA 4U7JA 1K8YB 1WG8A 3N5KA 1KZHA 4DV3B 1O97C 2ZBPA 5ESWA 1ENZA 2Z3ZA 1Q1NA 4DA9A 4ZQFA 2VDRB 4UDYX 1TJPB 1Z36A 1GZ6A 5BSXA 2XYVA 3B3QA 2MHCA 2QI9F 3SCZA 3DBLB 4R1OA 1XXHB 4XCVA 4BV9A 4HVCA 2YJZA 4IIFA 1NVBA 2O2CA 5CDHA 3IKTA 3BGVA 4H7JA 3BCDA 3EQ7A 1J0XO 3HEBA 4G0ZA 5CT5A 5ALVA 2ZITA 4WN9A 4D80A 3BZUA 4C7VA 2V8OA 3LQFA 4JYCA 1K8AD 4P33A 2JCSA 1YUBA 1JEDA 5JQGA 3PQ8A 1H1LB 3KQQA 3N76A 3K9GA 2PT5A 4J76A 1UFVA 3NBXX 1BOOA 1YIOA 3NLLA 4DLYA 3KTOA 2HR1A 4XD7A 1XRSB 3RG2A 3O4JA 3ZXYA 2G17A 1RTKA 2C0PA 5F7JA 4ENPA 1T0BA 4P5DA 3NP9A 1XLWA 4CJXA 2BEKA 4JI1B 3W9YA 3UK2A 2LDBA 5A9TA 4CPDA 4MVJI 2BGUA 3MPUA 4O2BB 1P2TA 4UPVA 1KJQA 4NZNA 3RVSA 3V4FA 2QENA 3EXHB 2EZUA 1POXA 3A3OA 2ZE5A 4MO9A 4N65A 2WHQA 2CDCA 2M1XA 4Q7MB 4WZLA 3F7NA 1U3DA 3PYLA 4NAUA 3IUPA 2QKYA 4QGFA 3QXHA 1KNQA 4KPGA 4RE5A 4YPVA 5EINA 5BV0A 3D0RA 1CNFA 4U2EA 4EY7A 1WPXA 5ERGB 3UV3A 4DCJA 2A7QA 3VDRA 3DQPA 3MTJA 5G2OA 4BNUA 3PL1A 1H6AA 5LZ2A 3EIXA 1TTQB 4C7OA 2FOXA 5I7SA 3PX3A 1JDZA 1GAXA 3ZY6A 4NICA 2ZJBA 4A23A 5BW5A 2HUPA 3BMCA 3CZAA 4P34A 4P2BA 3H9QA 3LP5A 1K4YA 1N75A 2C7GA 2FR8A 4MYRA 4XVCA 4U0JA 5KTYA 3OTOB 1FLVA 1SXQA 4FGZA 2FSHA 1P29A 1KYWA 4GPBA 3PWSA 4O4IA 1YSCA 4INAA 4DDKA 3P9PA 4DDHA 4BQQA 1WTHD 1EUYA 2ENUA 3EX7C 4DWVA 2BW0A 4PQEA 3AKEA 5HCUA 1RRMA 3N2LA 2D59A 4OI4A 1SBCA 4LAFA 4BMZA 1ZMBA 3Q7TA 1NLMA 3PV0A 3D1LA 1BH6A 3MJRA 1P2VA 1MUUA 3MVEA 3NS7A 3AEKA 4WBNB 3SU8A 3AKCA 1J97A 4G09A 1IE3A 3JQ9C 2BGWA 3HXQA 2Q0XA 2XUFA 2CLSA 3EIHA 1QGAA 3M1IA 3KSZO 2L17A 3R3UA 4UAUA 2BR3A 1GL3A 3AK4A 1NVVR 3ORHA 4FGJA 4PX5A 3OLQA 1G5IA 4LJSA 1NSTA 1JHRA 2AFIA 1KZ9A 2P4SA 3B1JA 5IYQA 4Q3NA 5C1OA 3ANSA 1XP8A 3GJ5A 2L0XA 1UT6A 2WWHA 1UK7A 1N7HA 2CN1A 3FNHA 3M4NA 4F1WA 4V0QA 3NWOA 2CB9A 4FBGA 3HXKA 3UG7A 1JA9A 2V0NA 1NC3A 1NI5A 3BERA 3ESZA 4ENUA 4EG7A 2DYIA 1SQFA 2WIGA 2XVZA 3K09A 4X8HA 1M1XB 1UC5B 4Y2HA 3T5GA 5JRDS 2RH8A 4J3NA 1UPTA 4Y6OA 2IYLD 4PNHA 4DAEA 2XUQA 4J3FA 3U44B 3R24A 4B7AA 1N0VC 4RDKA 4OGGA 4EJSC 5HWSA 3ZVNA 5JC8A 4DFDA 4XYLA 2J3MA 3THWB 2ZWMA 5L9AA 1LWOA 2X0DA 2BRUA 3TH5A 4RD1A 3U16A 1Q81D 3EPJA 1TFUA 4HAVA 1SCKA 2BKVA 4OKIA 2JIOA 4JNCA 4K88A 5F21A 1IFXA 2OZEA 4IJMA 1HNZB 1OWPA 5CCBA 4TTQA 2CVFA 2NU8A 4INPA 4LK3A 1VGQA 5IJWA 3WK9A 5KC8A 4EGJA 2VHVA 3C45A 3IAHA 1XZPA 5JZVA 4L8WB 1AGXA 1HDYA 2X0NA 3CC4B 4Q7JB 1EWYA 1JLMA 1C7EA 2D1TA 2XMCA 5CBPB 1AMUA 4M7OA 4AY2A 3C8HA 4KVGA 1ZLXA 4M7PA 1NXXA 3FPJA 1I1QB 2YR0A 2EFEB 4WE3A 1IN7A 5BSUA 2VF5X 3TIXB 5JNTA 4IEEA 2WYIA 3NTRA 4QZVA 3GLIE 2HT6A 1JEYA 4Q16A 1L4FA 5DI9A 3T35A 3BPSA 3GT3A 3DQQA 3KZCA 3GRUA 4TTTS 4US1R 3C1UA 1U2DC 5JNSA 3R6LA 1MH1A 3ED5A 4DHEA 2QIPA 2I1WA 4YEDA 5KX5F 4WA7A 1EAMA 1E69A 4DYHA 3CGWA 3JQ7A 3TXXA 3VVMA 4PLFA 2R4TA 4LYJA 4NOMA 5TEVA 3REFA 3WHIA 1N5RA 1IB0A 4AAYA 3C5WP 3CCRB 3ZWXA 1MAWA 4UW9A 4YCCA 3IUNA 5J4HA 4A0HA 1BOFA 1K86A 2QW0X 4HNAA 3NVMB 4ZVOA 5ICFA 1XBTA 4EFNA 4OGKA 4PNZA 4EKDA 1M66A 4JOBA 4B83A 3AHFA 3BJIC 5FL7D 1Z33A 3QLUC 4MKRA 1N08A 1AKQA 1G4HA 2COEA 2RFLA 3HP4A 3A04A 4HSGA 1QB8A 4HVAA 4NOJA 4TTRA 2XTMA 4RL6A 3OA0A 4Z2AA 2R7MA 4N8DA 2F1JA 2VOJA 1M67A 2XB8A 3BCUA 4LDZA 2QR2A 1XAGA 3AY0A 2KWIA 3I83A 2F3TA 3UT5B 2ECFA 2IZ1A 3VBEA 5BSWA 3PX2A 4RWEA 1T5SA 5K8UA 4QFMA 1BE0A 2O07A 3ZNOA 3ND9A 3AF6A 3H3XA 3PNPA 4O4IB 1ZRHA 3VNQA 1B6RA 2DUJA 5HUQA 3C16C 2HKIA 1E63A 4TL8A 3IKJA 4P98A 4EKNB 3LF1A 5J3OA 1NV9A 1Z07A 2FFAA 3Q40A 3BKWA 5EQFA 3ZI0A 2BRUC 3MPOA 3UATA 3RFFA 1CEXA 3A37A 4IMRA 3K9FC 3Q11A 1QX3A 2XEXA 4JL5A 1T9CA 1YI8A 3GJXC 3ZE1B 4M22A 2PAFA 2R8PA 3EH2A 5D5HA 1E79D 4TKMA 3GF4A 5HGJA 1RTTA 1ZRSA 2QSUA 3H9NA 3UJ7A 3HSSA 4XB6B 2ZK7A 3RSOA 3JU4A 2I3AA 4X90A 4XL9A 3V8QA 3U60B 3FDXA 3UTCA 4EHFA 1MR3F 1Z15A 5KC9A 3AEUB 4FXPA 1NVFA 2JF0A 1KEPA 2X0JA 2O8VA 2ZYGA 3ENVA 5AMXA 3MWGA 4WFKA 4HEQA 5IYZF 4BB6A 5JWRA 1QCDA 2CLHB 4K0RA 1TJ3A 3WGKA 4WX2B 2AFIB 2QRGA 1MX1A 5EOVA 3CURA 5KSPA 5FUWA 1A0OA 1OXSC 3TVYA 1V3UA 3K35A 4RKYA 2DUUA 3LX8A 4H60A 1N0IA 1ODKA 3AI1A 2XV1A 1ZZGA 4FKZA 1W93A 2O8BB 4MLCA 1EFPA 1SC6A 3K1AA 3V1MA 2ZKLA 2C7PA 1KYQA 3NZEA 2GASA 2LGJA 1CR0A 2XLBA 3AHJA 3OC6A 1RAAA 4O4HB 2ISQA 3KJIA 4IHJA 1DX6A 4DQLA 1V5FA 2ATEA 3C5EA 1A88A 4P80A 4ZYWA 2Q6IA 4GP6A 2ZL5A 2ZBUA 2XT6A 4NE2A 4R51A 4FDVA 2DBVO 2HCTA 5F4JA 1NI4B 3JATB 4R0VA 3AM1A 2YWEA 2WOJA 4MUNA 1LK0A 4EDHA 4D5EA 1UP7A 4DUPA 1IXYA 2R62A 2IEIA 1RHMA 5H70A 2Y92A 3B6ZA 3AUTA 2O2EA 1G7TA 1JQEA 3KWFA 4LEIA 3H0CA 3KX2A 2OLKA 2DOKA 2IGTA 2ZLBA 3M4ZA 4IMIB 1E4YA 1C8KA 4X20A 1A9XA 4J75A 4HAUA 3FNEA 5LC1A 3U61B 1US8B 4HGQA 4NCJA 1ACJA 1P9LA 4XJSA 4HDAA 2QVYX 2DTXA 4MRMA 4PHTA 5HNKA 1X7WB 2FZEA 2Z43A 3AERA 4OLFA 4R2WA 3WX0A 1EVIA 1AK9A 1G3RA 2O2JA 3AUJB 1CWUA 1SVUA 2B4YA 2XVMA 4RIHA 4DCMA 1JH9A 3B6IA 4EA8A 4LF8B 4HHEA 2G9UA 1UM9B 1TX4B 4AZ0B 3GVIA 5CEEA 3PEUA 3EVZA 1DBWA 2PUFA 1JQKA 5AW8A 3HG7A 5GP1A 2AMVA 5CT8A 1VKRA 5EQTA 1XDSA 1UXOA 4RTJA 2WTXA 2RHRA 1MENA 3ICEA 3FFAA 4Y3UA 1KEKA 4FYWA 2OQVA 1D04A 1I10A 1S8OA 2LXNA 4QXMA 1FVHA 4R40A 4RORA 3OOYA 2BEVA 3WTCA 5FWAA 1K3FA 1FXWA 4HPJB 2MSCB 2GBGA 2WHPA 1RAFA 4BATA 2PUWA 2FETA 1CJCA 2C8LA 1YQQA 3OIYA 3WSTA 4XWOA 2C0QA 1RI1A 5DN6A 1N9GB 1YZNA 4IUBS 4YALA 4E22A 4R2MA 2FZKA 4MQUA 3H1TA 4RBNA 1TAGA 2GTIA 4J6EA 5JFGA 4B4UA 3TQQA 3C8ZA 1Z38A 1QXSA 1Q0ZA 4UD6A 5FB3A 1UMBA 5FUBA 3E8XA 2P6NA 1U7HA 4XFDA 1RLJA 1AG9A 5BSMA 1T2VA 4I4CA 2N46A 1PSDA 3DEAA 1Y3HA 4FEYA 4CMKA 4S05A 4Z1MD 2I66A 2WE8A 2WBLC 5DTQA 4DQVA 1MVLA 2ZB8A 2B1RA 1ID1A 3IBCA 4R2XA 4FS3A 3SEZA 4ARBA 2W9XA 2WKQA 2XGOA 1G19A 1RZUA 3WRWA 4D25A 4NOLA 3W5UA 2AXQA 4HDKB 3WMRA 1U81A 4KACA 4CI9A 3DAOA 1ZUNB 4KGVA 4BLWA 4Q37A 4EHHA 1ZOSA 2OT3B 1IOWA 1E5DA 4Q1CA 3KQSA 3QFTA 1RRKA 4OHKA 2JFNA 3UKDA 2O19A 4PPFA 1V4NA 2QZJA 3V1UA 3INTA 1Q14A 4HTFA 4ZJYA 3QITA 1HDCA 3N0RA 4DM4A 2WILA 2ZZFA 1V0FA 3EG9B 3LY7A 1JHXA 3AR5A 3Q0IA 1MV5A 1T1RA 4R2JA 4Y7CA 1CHDA 1HRKA 4HOYA 5AHXA 3LHSA 1CS4C 2JBAA 1YXMA 3FCCA 4LYDA 1QVAA 1FPMA 3BTUA 3OZRA 3DMGA 3DP9A 3KE8A 2F9FA 4HAIA 4BO4A 1YB7A 1IULA 1F8XA 2V7BA 2ZRMA 3HXTA 3PQDA 4IXWA 4LXYA 4UEOA 4RQUA 2P68A 4B17A 3CLVA 1QGYA 1EUDA 4A2WA 1FRFS 4LHEA 5DM70 5LB4A 2G04A 4G0PA 2ZUBA 2AIRA 2V7QD 3L79A 4GLFA 1NVEA 1BXRB 4UDXX 5JE8A 1Z4QA 2AG1A 2YZKA 4Z0HO 1F0PA 7YASA 2ZB4A 5MHTA 4Q47A 4RPGA 1W30A 3A6DA 3P4XA 5DM4A 5DLQC 1BDIA 2HT1A 3CXUA 3GMTA 1RJWA 2JHCA 2CC2A 4OPVA 3QE0A 1JIKA 2I80A 1ZSNA 1F4PA 4MXDA 4OK6A 2PD3A 4MUJA 2ZUCA 3FMFA 3S99A 5HG0A 1IBSA 4RD0A 3KKNA 3T4UA 1GEGA 1ZGAA 4NZ9A 1P3JA 2Z4SA 1J8MF 4IH9A 2FUCA 3H5LA 3F4LA 2IHUA 3QY9A 3UICA 1AO0A 5DULA 4RHFA 5CK5A 4I9HA 5KYKA 1KDTA 2M6SA 3QELB 1SXJD 3IT2A 3IP7A 4J0FA 2O1WA 3K8YA 5JCZA 2Y1LA 1PGQA 3HB7A 3MT0A 1WUIS 2ZROA 4B74A 2IITA 3M81A 4UOZA 2DHCA 1Z13A 1MU0A 2OAEA 1WW8A 3KWMA 4RKRA 3Q3CA 5EEHA 2YASA 5H9WA 1ZRNA 3EDQA 3EH1A 3KVOA 4Y9SA 3NGXA 4WLUA 3DHVA 2OAQ1 3T15A 1KAMA 1N5OX 1P0CA 3K15A 5K51A 4A5OA 3H75A 3DVAB 1VE6A 2ZPTX 2D0OB 4AKSA 4EFLA 1DBIA 1CSEE 2E85A 3VJRA 4DB4A 9LDBA 4HH4A 5LLDA 2ZP1A 1KC8D 1M76A 1U8CB 2VUTA 4RLQA 4KOAA 1B0AA 2QVXX 4YV2A 1NJ6A 4ZEVA 4OQMA 3MSXA 2I9PA 4BGVA 3EZGA 3MWJA 8MHTA 1DKQA 2Q7XA 1SU6A 1BWSA 3IEKA 3KALA 1AY0A 2YQ5A 2IUEA 3LOQA 5FOQA 2KHZA 5K3FA 5T3YA 3ELYA 5EA2A 4MP3A 4EG3A 4DDTA 4IZHA 4N76A 5LOVA 4XGKA 5ITVA 4I6EA 4XQCA 1YV9A 1EDOA 1V8OA 5BN3B 1G4AE 4TWRA 3KRTA 3WHPA 2WTUA 1ABEA 4II2A 1OLSA 2RGEA 3HXPA 4W5HA 1LBEA 2JKYA 1U0RA 3NKVA 5I7EA 3L0OA 5CLIA 3LX6A 4R2KA 3KTDA 2BFEB 4WBSA 5JD3A 1V71A 2CBGA 5EJGA 1AB6A 1PJQA 1GUBA 5KOHB 3FYUA 3BSFA 3F5SA 4HYYA 5AM2A 4X60A 4F3YA 2GK6A 2PUAA 3UAXA 3HO1A 3ZS9A 3KAJA 1O03A 3PGLA 1JFFA 4DIKA 4XOIA 2ZDHA 1RQ2A 5ALKA 4RTRA 3LPNA 1FU8A 4PYRA 1EVJA 4Y2UA 3F6BX 1NMEA 1D6NA 1M83A 2XGJA 1G3MA 4WVFA 1JR6A 1B93A 2ZJ2A 3J81A 2JLRA 4PYOA 5D7NA 1W1IA 4GF5A 2DFNA 4XN0A 1W2WB 5K6AC 4HH3C 3N59A 1GZUA 5CUQA 3IX7A 4BO6A 2NOAA 3CTMA 3UTDA 1TA4A 3QG5A 4C4XA 3OX2A 2H2GA 2VP9A 4LRYA 3D6HA 5FBZA 3UAGA 3ZW7A 4DBLC 5JASA 2FLVA 2FWJA 4MW4A 2OV2A 3STXA 1NPDA 1PJ4A 3LE8A 4NK4A 2PLNA 4BLUA 1V48A 4YCLA 1MJFA 4K9NA 2YY6A 2EFDB 3DFKA 4ZAXA 5EWMB 1E2FA 5HK8A 1P0MA 5CA0F 3OETA 3MWEA 1YVPA 1P62B 4GMGA 2A0XA 1EUZA 4HX2A 4BNWA 4Z86A 3VYSB 3G0BA 4J7CA 5DM0A 5CFRA 3COVA 3R09A 5I45A 4WXMA 1Y4ZA 4RVNA 5LKRA 4IVNA 5K3DA 3OZTA 1SIBE 1NBHA 4BYGA 3AVTA 2B7CA 3WNBA 1IY9A 4QRIA 3D6VA 1PT8A 1ZPDA 3RG8A 4ESOA 3GFTA 2EBWA 4QBIA 3SS9X 1M6WA 1Q7EA 1SUWA 4XXHA 3TFQA 1BWPA 2TMYA 1AUOA 2GN9A 1ZJWA 1Y98A 4J0KA 4WK6A 3WKDA 3OIDA 3GQBA 1UFQA 2Q2NA 4C5AA 1J2EA 3C4VA 3GEPA 2YWBA 3VHRA 5JYBA 3NTOA 1A04A 1UBRS 1U6IA 2N1BA 3FKJA 3G2OA 3WV5A 3CNQS 4G65A 3WICA 2AI2A 2RONA 5B4VA 1YS6A 4JIMA 4ND8A 4KFSA 1FBNA 1XALA 3CR3C 4HSEA 1O6CA 4Q7KA 4WXHA 5EG5A 3UB4A 4OVKA 2MIIA 1JU4A 4Y2TA 2CCGA 5ADUS 4D4MA 3ZHVA 4EVIA 8LDHA 3ASVA 5DYYA 3A6PC 3QBJA 4K9QA 3TQOA 3TIVA 1MV8A 3WYDA 4WUVA 3GEEA 5DK4A 1XMQB 2IIQA 3K2EA 3OZSA 2DX7A 5LQSA 2FPSA 4OHFA 1JJ2B 5AJZA 4IDGA 1IN5A 5FBRB 4JWKA 3TKAA 421PA 4BQSA 2ZSFA 3VDNB 3ZK7A 4EYKA 2R8BA 2P77A 3RFXA 2QGGA 3I52A 1X87A 3EEYA 3CINA 4OHXA 3ZZNA 4CUJA 3WADA 1UBHS 5F35A 1BJKA 1CUEA 3GLFB 2G80A 1XDUA 3C5VA 3O92A 3OP4A 4KI7A 3K96A 4Y2GA 4CNQA 1PEKE 5CA0A 1XLVA 3TBKA 1XQYA 4DWWA 2H4WA 3M1LA 4FGWA 4PW0A 5FF9A 5JJKA 1ZHHA 3R0XA 4OPOA 2I7XA 1SQ6A 4FCVA 1JG1A 3VOTA 4NZOA 1QG0A 4UZFA 4WZAB 4F4CA 1H2BA 2EIXA 5AUNB 1VPTA 1MOZA 5AWFC 2XE7A 1TVEA 3GRCA 4NU0A 3P0IA 1UAYA 3UK7A 3KSBC 2ZTMA 3I37X 3W77A 1W25A 2K5UA 1YHYA 1AKWA 3LUJA 4TZKA 2IEGA 4Y2JA 4CU5A 1NN5A 1FIUA 1JN0A 3D8RA 2VQEB 2JAHA 1L8OA 2FA9A 3B48A 5EXSA 5FP0A 1HZEA 1H9BA 4EHNA 5I7UA 4Z0NA 5B1SA 2F43A 2COUA 4AX8A 4AJNA 1R4MA 4B6JA 4N41A 5KPDA 1H0KA 1UC4B 1TEHA 3HCFA 3JZFA 3Q6IA 3C7KA 1QYVA 1GZSA 4KMOA 2R6HA 3QUBA 3L7OA 4HH0A 1WDTA 1WZEA 1Z73A 2FW0A 4I9UA 4AF8A 3LO8A 6AT1A 3JYHA 5CG2A 4G0VA 1YZGA 2G88A 4FZJA 2HPZA 3V7FA 1QONA 4PZCA 4R98A 2JHPA 4MAFA 3Q85A 4KH1A 2YWFA 2XXAB 3BXXA 3W5HA 1I3OA 4LZWA 4Q93A 1JR3A 4DSOA 2ZJ3A 5AK3A 1PLLA 3SPXA 1V7PC 2HI0A 5TGZA 4EB3A 3TOVA 1LS1A 1NVUQ 4X91A 1X77A 3RVJA 4EI9A 4U5XA 1ZN8A 5SZJA 3TTYA 4J16A 3WQBA 3FHTA 2B5OA 1G20B 2FW9A 3HU2A 3N2YA 2HMTA 5AI6A 2HO4A 2VP3A 1U0OC 2OV4A 1F5SA 3CZRA 4CDMA 4EABA 2H1RA 1WRBA 2JW5A 2WAOA 2R6ZA 2Y67A 2V65A 2VAXA 4ALNA 3A1DA 4BC0A 2Z08A 4BVKA 2P0AA 1RYFA 5EJ8A 5IC4A 1XELA 1P2BA 3NC0C 3CUVA 3VFDA 1U4NA 3DULA 5IWAB 4OHCA 2G67A 1HFEL 2QVZX 1KGSA 2A1TR 3LYHA 4B0PA 4DTIA 4DLSA 3J81k 1IH8A 1WS6A 4RM3A 4UNPA 1G0OA 1CG6A 1SA0A 4XD7D 2VJLA 1T34A 1LTHR 1LD3A 3RU7A 4HIZA 4E6EA 4UOEA 1AQ6A 4C87A 4WNAA 3RYTC 1DTWB 1NVGA 4N54A 2HWUA 2PV7A 1WW3A 4ONEA 3RRJA 3GLHB 5HZBA 1BC5A 2OC9A 3QXJA 3SK0A 1YR9A 1B8VA 1QHXA 2ZPAA 3OECA 4UNRA 2VT7A 3Q3JB 5B6PA 1SKMA 3BM5A 1MHPA 2YNMC 2C7BA 3L1UA 1J5XA 1Z0AA 3D4NA 3HBMA 2BHNA 2PUHA 3A1TA 3G9UA 1GO2A 4JC0A 4FWTA 3RK1A 5HYVA 3K30A 4YJHB 4HF7A 2QTRA 3FW1A 3W2TA 4KR3A 2H85A 1BIFA 2QQGA 1UAAA 3QYAA 4XMYA 4EPWA 4LHXA 1VA5A 1WBJB 1LZLA 4KFUA 4HQFA 4ENTA 5KEIA 5HTOA 3H11B 5EC8A 4OB8A 1NDHA 5C4GB 1U4SA 1FSGA 1CY7A 1KPIA 2HV9A 1M6HA 2VP5A 3MTBA 4O59O 2BZ0A 4CM7A 1YOBA 4FR2A 5KHOC 3JARB 1ZHOA 1GVHA 1ZMOA 3PNLA 3SKVA 3A2LA 3T94A 1VB3A 2P8JA 5T8KC 3EF3A 2VSNA 2QUZA 2R7NA 2EDAA 3OJEA 2YWGA 4Y9TA 4HYQA 2FMUA 4TMVA 4Y98A 2Z9BA 3L5KA 5T67A 4QOSA 5C32A 1MBZA 2OP0A 2Y71A 3BXZA 2HF7A 4JT8A 3WISA 1L4LA 3ZUPA 1K92A 1XPRA 4NZZA 2QNBA 2X5KO 5SY4A 1CUCA 4K9DA 5ALSA 2VQ3A 2LKDA 4KK3A 4P9NA 3VDMA 3FF4A 5CVDA 2WP8J 1I0ZA 4JLJA 3UWMA 1FU4A 2OUKA 1M0SA 1E1LA 2RB5A 4GPTA 3ZXIA 2ZZGA 4RY2A 2Q4TA 1QRAA 2F7SA 3O73A 3P20A 1UOQA 3C3DA 3TI7A 4H9GA 1WY5A 3AHCA 3HKDA 5GOTA 5A03A 1JE0A 4OK3A 2W22A 2EYUA 3I72A 3QVJA 2HWWA 2CEKA 4HGNA 3EXFB 2BL4A 3HCOA 2B34A 4W5NA 4MUFA 3EGXA 3UJHA 3E5MA 1IWBB 4ZEMA 3RJ5A 1YL6A 4HV4A 2O8BA 5AYVA 4ARZB 2OTJB 5MGNA 4U63A 1C50A 1XRRA 3BRWA 5LQAA 3OPOA 3IR5A 3ERCA 1QR6A 3N0TA 5EFZA 4BGUA 4QJ5A 4JEIA 1JKMA 4CMJA 3O95A 3PQ3A 4EGCB 2IEDA 2BJHA 4QOEA 1GP2A 2AS0A 4HLNA 2WPNA 4K87A 1KPHA 1SXJB 3FB1A 3FUXA 3D1VA 1TT5B 2PS9A 1IG0A 4QELA 1YZHA 3TRKA 2K87A 4IXTA 3ADKA 2QD2A 4KIFA 4WWHA 4ZIRA 4NXMB 1H2EA 1Q12A 4LSWA 4GOLD 4OU4A 5K3SA 1VPVA 4EVSA 4XPIB 2J0SA 5HFJA 1KH2A 1R12A 4MV5A 4PZEA 5CDGA 3GVHA 2GMWA 2FFBA 4CR6A 1PJRA 2D4HA 1ZNYA 4S1VA 2X0FA 3TIFA 1FMCA 2YJ4A 2NU8B 3FBWA 3F3SA 4MW9A 3DV0A 1TMYA 3BKXA 2OD9A 4OMUA 1VQNB 4CTOA 2VQ6A 2YJ5A 1YS7A 3A1SA 1Z4MA 1TUIA 1C0LA 2GCOB 3FNGA 5F5NA 4B45A 2BM9A 4MZXA 3DZFA 3EFOB 3GJ7A 5JBQA 1DCMA 4UMFA 5TDHA 5BURA 2A1IA 3DEIA 3M34A 4S04A 4BAGA 4D9FA 3NTXA 2VZLA 2EX0A 2Q27A 2QL7A 3JD4A 5B7PA 5A6VA 3REQB 2RHMA 1JDPA 2PGDA 5ALOA 1YJCA 4EFDA 2R6R1 2VPIA 1NURA 4DA7A 3HUFA 4EZIA 1QV6A 4M8LA 4TVSA 2ZYDA 2AF4C 2PAAA 3ITNA 4XPZA 2W2MA 3FCEA 4LJ6A 5GQSA 1WA5A 3UV7A 5CH8A 3MIZA 4LE1A 3BD9A 4CKBA 1Y9EA 2ZIZA 4HMOA 1TMOA 4R7TA 1CUZA 2ZYUX 3PSHA 2RHGB 4QHSA 4V03A 3VPAA 4MV4A 2XXBA 5BSRA 4DY4A 3CC2B 2UYCA 1RPNA 2Y1CA 4LECA 3M0EA 3ORRA 5HMMA 3ZU5A 5K0FA 2Z5GA 2BSAA 2NW6A 2AFRA 2HD4A 2VUIB 2Y2VA 4W9RA 4XJVA 2I03A 3IURA 2CJWB 1CUVA 1R5JA 8GPBA 1WHSA 4U7GA 2XWBF 2AQ8A 1Z63A 3ZLBA 5FBWB 1FNBA 1I9CA 3DD1A 2DMRA 2PKEA 4DIMA 1M2HA 4X3OA 3VPCA 4WN3A 3G2KA 4N1AA 4DW8A 1ZD5A 4P08A 2AUTA 3TRFA 3KKQA 3C5HA 1IXZA 1E2MA 3K73O 2A86A 2L2QA 3QV1A 4IWXA 4EMUA 4NJOA 2FPIA 2PJUA 2LTAA 2RGRA 4KRFA 3KJZA 1GU0A 1Z7WA 4BNIA 5C31A 2PMKA 4KRGA 3BXPA 4WD3A 1QTQA 3D6MA 1QHYA 2H2DA 3C43A 1EZ1A 3IQDB 4WOPA 4Y2VA 3VKFA 5JD5A 2NP7A 1G2IA 2O2DA 2FQXA 3EMVA 4Y6LA 3CUKA 5CT9A 1O0SA 521PA 4KAAA 1YONA 3WFJA 4BLOA 4JVLA 3ER8A 3K8OE 5BUSA 3PF9A 5J4VA 2JLCA 1FRNA 1RJ9A 2BFDB 3F8WA 3PPWA 1RP7A 3P2IA 1J1IA 2F3SA 3ZQJA 2BTOA 3R5SA 1VPEA 2J5KA 1T8TA 2YVKA 5IJ0B 4RPKA 2GJ9A 5DBOA 4HVTA 2XA2A 2PD4A 2C94A 2F90A 3BFJA 3EW9A 3ZN2A 1GU7A 1KJJA 1ZH0A 5DPMA 2QTLA 3MGAA 3NPMA 5C8YA 2NAFA 2EFYA 4YUVA 3BSWA 1QR2A 4DWJA 4F45A 2E5FA 1EM6A 1S2OA 3KT0A 1L7QA 1B7GO 2ILVA 4JI6B 3C14C 5D86A 2ONZA 1Y7IA 2DBYA 5FNVF 4WFIA 1V5VA 3Q7RA 3ZD8A 3BMNA 4KUEA 5C51B 3BB1A 3RSZA 3U81A 1M90D 1AKRA 3SZRA 1UXHA 4CIDA 5KHLB 4NU8X 1KYVA 2G09A 2OV1A 1T4BA 1W581 2ZAMA 3KKPA 2H4XA 4B6SA 3H3FA 4E46A 4FJ0A 2WZDA 3RTDA 2E9SA 3GCZA 2UXCB 5HCIA 2WF6A 3TIGA 2IYUA 4KO8A 4M0UA 4RMGA 1H9CA 5JDCC 1PV2A 4NLLA 2ZYSA 4QGAA 5BNWA 4MYUA 3WKAA 4YC7A 2OBYA 1XK7A 4L5BA 2JJQA 5CX4A 3GEBA 4PIMA 4GX5A 2VZEA 1S0UA 3JRNA 3RODA 3ZDZB 3GJSA 4LDAA 3LT5A 3AGPA 3UHOA 3VR5H 1IBKB 1Z56C 3KVRA 4D42A 5KYYB 2FV8A 3DFUA 3FI0A 1SA0B 4NPHA 2R79A 4DQUA 5L4LA 3V2UA 2O8CB 4JSRA 1KQSB 2OILA 3T7DA 2D9RA 1OYWA 5EJ4A 2Q1XA 2JEYA 2P9EA 3EZ7A 1N2ZA 4ATNA 3FFWA 2BPOA 3HCRA 3HL0A 3GIRA 4K6FA 4LZJA 5J2TA 4RM0A 1OVMA 1E6EA 4WADA 4BNVA 3VYTB 4QNMA 2RCNA 3AF3A 5JS6A 4ZHQF 4EPTA 3N87A 5K20A 1EDEA 2Q5QA 2QX6A 3A4IA 3WI7A 1WXDA 5F5XA 1AS3A 4ZMRA 1E2BA 4G1FA 4TOIA 2WPDD 2HC9A 3N0WA 4LDRA 4W63A 4A0GA 1YJXA 1L1FA 4DNFA 3ROTA 2WMYA 3SEFA 3ZPXA 4AS2A 3RYIA 5EXXA 3R75A 1T0JB 4BV8A 1CR6A 2YV2A 3KZXA 4A0FA 1R37A 5HHTA 2C59A 2Q0QA 2VRWA 1XD8A 2ZYAA 3OFKA 4TQ9A 4ZT2A 4I50F 5H8WA 1UINA 5K8CA 4JUAA 2IH4A 1DP4A 5SY6A 2X2FA 1L7EA 4DNPA 4UTPA 5EIEA 1TVKB 2NZUG 3PLAE 4DJAA 1C3LA 4PO3X 4I8IA 2XRFA 3BGDA 5KVSA 2IYRA 1HURA 5HF9A 4YEJA 4U7DA 1LLQA 1UM8A 1R8XA 1DBQA 4JA0A 1WB4A 4I9GA 4QICA 3SC6A 3ZS8A 2P6UA 1M1NB 1GQOA 1V1RA 4I3GA 5CCDA 3RSFA 2J5BA 4Z4CA 5JFTA 3BXHA 1OOEA 2OMKA 4JENA 5DRTA 1N3IA 3FOEC 1KA9H 2JN9A 1V8FA 2Q07A 3V55A 1E0AA 2ZR0A 4ZGNB 3EGWA 2IE0A 5DHAA 1N1MA 5A6SB 2ASVA 1R0XA 4WN9B 1F17A 2G1UA 4BAUA 2OHXA 4CUZA 4XH9B 2E4XA 1QF9A 4KG7A 2RH4A 1CJBA 2H48A 1QGOA 1Y4AE 1O3YA 3CB4A 4XVQA 4UARA 4U9HS 3T7JA 2WJPA 1EM8A 4H0FA 4QU9A 4MVJA 3T5CA 2RI0A 1VQ7B 3WFZA 4X41A 3OKPA 4Z49A 1MB4A 3WWEA 2GEKA 5ICSA 1VL6A 1VE3A 4RVDA 1CVLA 2CKMA 4UM9D 2BBWA 2JGDA 5EMLA 2EJCA 3GEDA 5F3RA 2PIAA 1XNJA 3K5IA 2AG5A 1ICIA 3D8UA 3GSIA 3OTGA 1ZAYA 1Q3KA 3Q87B 5BYJA 2V4DA 4BMNA 1CBUA 1K1EA 4HN2A 1Y6ZA 5ILQA 1S9HA 1AVTA 4XRGA 5AI0A 4ROXA 4LVUA 5K05A 1ECFA 4F3RA 1MC8A 2ZRPA 4Q3LA 1KS2A 3PQFA 1X1SA 5ALIA 1H3EA 1BN7A 4PG5A 2CF5A 3X1JA 4C29A 3ZH2A 3KOYA 2V55B 2YINC 3F8TA 5ALLA 3O3MB 1K9SA 3F7MA 3CEPB 1S02A 3P9RA 1P1KA 4OQFA 1GILA 4Z4FA 1F3LA 1HQDA 2HU5A 3KHTA 2GDJA 2EFJA 4BZZA 1OBHA 3R3YA 5DT9A 4BO2A 4GX0A 4D6XA 1DC6A 1FB5A 1LI7A 1KOGA 2WHYA 3E9NA 4JK3A 3D3QA 4DLWA 4XORA 4YX9A 2I6UA 2YVUA 3K1TA 4MCHA 2FP4B 2XOKD 5IBPA 3UW3A 5KJ1A 4Q1EA 4BB5A 2D6FA 4CQMA 5F9FA 4MQBA 4BB0A 5GZ1A 5JRZA 4KC0A 4PYMA 1M5RA 4FI3C 4DY6A 2RAUA 4PRZA 2QX9A 5IT4A 3VYWA 1XFAA 2I6XA 3KWJA 3PKZA 5JANA 4Q02A 4FDUA 3RGWS 4TUYB 1EM8B 4RZIA 4ER3A 4LV8B 3R9WA 1KC3A 5BRNA 1XCPA 1RXSA 5F4ZA 4C4OA 3MAAC 1GEEA 5EZYF 4CLRA 5LOVB 1PJBA 2XF2A 4TYWA 2P9FA 3PI6A 4OLAA 2GCNA 2VHTA 3E1KA 4RJJA 1P60A 1UBGA 5EVCA 2OQRA 3D02A 3NBZC 4PZPA 4YHHB 1J20A 2GPBA 3DXXA 3FJYA 4N49A 4IDCA 4R7ZA 5KOJA 4LFAB 2VTBA 1U9JA 1ZXXA 2FSUA 5DDIP 3T5TA 1NMZA 1DCKA 1X7ZB 2ATXA 2VJPA 2ZTSA 4U0KA 1J5PA 1FP4B 1NZFA 3IIIA 5ALHA 2BFPA 1CUJA 3FVWA 2C97A 3ORQA 1O94C 4OOFA 4G41A 5ISMA 5LXTB 2IPMA 1SUSA 1Y9ZA 3HM9A 2NZVG 1H0RA 3PJRA 2WSSD 3HLYA 5FLKA 2FSSA 4WFQA 4FD2A 2QN1A 4GPIB 2PSHA 1U99A 5CDFE 2FPKA 3DF9A 4XW2A 4MUKA 5IT0A 1JWAB 1THZA 3FR8A 2ZAIA 3KJHA 3TWOA 4AWBA 4BKPA 5B1YA 3WLHA 1QU3A 2HK7A 2FPPA 3PHCA 3DZGA 2FB9A 3NM5A 6Q21A 4DCGA 3KR2A 2INGX 3AM4A 1B4DA 3VR6A 1FS6A 4L9SA 4ZOLB 3ODGA 4MGEA 3R0IA 2G9ZA 3H1FA 2JAOA 3M5PA 3II6X 1YJ9B 5CH3A 5ECDA 1PQUA 3UJ3X 4EMTA 2EATA 5L4NA 1F48A 2QD5A 2AVNA 4BL5A 4QO8A 5EHZA 4JBNA 4ZT7A 2IYPA 3P52A 2DHRA 2RHCA 1JFSA 3TK1A 16PKA 1ZW1A 4TKUB 3LCCA 3ZU2A 1N6KA 2PBLA 2R6GA 3R0ZA 1NQ5A 4V24A 3REOA 4N5DA 1IIBA 4D3SA 1JA1A 3UXMA 2PUCA 4ZC8A 1KMHB 3E7XA 1BNCA 2QAIA 2H4FA 2VL7A 2V7WA 4JJZA 4FR0A 4YRDA 2GT1A 4KTTE 5JZSA 3HV2A 5BV7A 2PRYA 1S96A 3I05A 1AXGA 2Q29A 1TCCA 4ENVA 3DDCA 1WW2A 4QPNA 4DR2B 4QQNA 2WSSA 1MX3A 1VDMA 3HKEB 2IU3A 2QN2A 3PXXA 3GCWA 2XNKA 3EVEA 1X92A 4KHPB 1S3GA 3PJGA 5B64A 4N12A 1DCFA 2WZCA 3KSAC 3T52A 5LU8A 3AI7A 2G25A 3OM0A 2VPQA 1TXGA 5BP7A 1OLUA 3A05A 2B20A 4PPGA 3T7EA 1VSQA 2JL1A 3TEJA 4NJEA 5EJIA 3OIFA 2JJ2A 3T3MB 1XB2A 1K5PA 2AZDA 1QRUA 1H0HA 2GTPA 1DJQA 1EAYA 3BG5A 1RLOA 2H16A 1FQKA 3OEYA 4GQIA 4ZC1A 4QGSA 3H5VA 4X1YB 4OHYA 2W2OA 4Z0PA 1TOAA 3FJOA 3GEMA 4BEBA 4ZTZB 1P4MA 3C6XA 4H7KA 1GFSA 5F73A 3KG2A 1T2FA 4OQYA 3OKCA 4D9EA 3DLAA 2R85A 4ZRDA 4RK5A 3SDZA 2YZNA 1PJAA 1QOPB 1RQNA 1X7WA 3WLTA 4U8GA 4WXRA 2ZIFA 1S3SA 1CD5A 1JIQA 2VI5A 2Z9CA 4PLGA 4B8YA 1US8A 1Y1PA 4BMOB 4NBUA 4BFZA 4Q1BA 3JS5A 3DBRA 1W0KD 2NT3A 4D2IA 1T9ZA 3AF4A 5DTRA 2OBMA 2QLBA 3UM9A 2BH2A 1EX1A 1N6NA 3H5TA 4F92B 4IV5A 4FDLA 1WMSA 5TMPA 5FBHA 2C3YA 2C9OA 4X64B 2GZSA 3GT7A 1F9AA 2W8BB 3LGSA 1E5XA 4XI9A 1ODTC 1TK3A 5AO9A 2WHPB 2Z5FA 2X0IA 4C3UA 1E3ZA 1USIA 2A9KA 1PYDA 3LFUA 3FPCA 3MCVA 1YAHA 4NEQA 4PTLA 2IP1A 5F2KA 3WK7A 4M1KA 4L4SA 4MROA 1R10A 5A9SA 1AGRA 2Y27A 4HRXA 5EP2A 4AZ3A 4EZEA 3GVLA 4KLRA 3WLNA 4F6RA 1J8VA 2H8GA 4MITA 1YB2A 4CE6A 4UOQA 5FOXA 3AFGA 2UDPA 3I42A 4ILKA 2Y9MB 3FCXA 1FDVA 2C4UA 4KWCA 2EZ8A 5KVCA 3OEWA 1H93A 3IQZA 3ROPA 2A1TS 5FOTA 2VJAA 1YJ5A 5IBRA 4BY9E 3M83A 3MB8A 4IH1A 4AO6A 4Z7NB 3DL4A 4EJFA 1EE2A 2VDNB 3RYCA 1TQHA 4XGQA 4H7PA 1X3LA 2IBMA 2V4MA 3HJAA 3KQWA 1NBMD 4OFWA 2D4AA 3GP5A 1ZCFA 4TTSA 4ZPJA 3RSQA 1ONNA 4J2OA 2JIZA 2X6RA 1RC0A 3EGDB 2GX6A 3L6EA 5C4IA 5GZ3A 3KQNA 1G5TA 2YIJA 1O95A 1MAVA 3K9WA 3W5AA 3C7CB 3WBKA 1CE8A 1Q84A 1SHKA 3GJ6A 3OJOA 2GLXA 4DV2B 5AIBA 1VCIA 2Z6QA 1JE1A 1PJLA 2E37A 1A9YA 2HWKA 4W7HA 1AB5A 1AGYA 1E2JA 4D4KA 2V6BA 4EY5A 2Y6UA 1WCV1 3MGKA 3UC5A 3R8CA 1HLDA 4HB0A 4LX0A 2IDJA 3B1XA 5LP6A 5FNVB 1JAYA 1HTWA 1VPWA 5LMCA 1GZ5A 3Q0TA 3TBHA 5F3DA 2LZ0A 3X1DA 4X8LA 4U7HA 3ZQUA 4QPJC 1OREA 3WNZA 1C3OB 3ZIDA 3Q8MA 3KFVA 4GRDA 4ENWA 4EYEA 2Z6VA 1A4XA 5I9BA 5SICE 2VTDA 3UCXA 4OBBA 2I6FA 2HK6A 2HNBA 4KFRA 2CL0X 1Y3FE 2GNAA 2ZE8A 2Q6OA 3ZVRA 2BI4A 3KVVA 4QEDA 2VK1A 3ZK8A 2YW2A 5AVUA 1UADA 2P3OA 3HNRA 3MW8A 2OZVA 1YKSA 1JBEA 1Y81A 1ZVKA 2CL6X 3ZK9A 1TYAE 4HN4B 5F98A 3NGMA 5AJUA 1Z7BA 5ARDA 3A1FA 2FAXA 3N8GA 1NKVA 4F91B 1ORHA 3DZDA 3M8KA 1QIKA 1WZUA 1CY8A 4KKSA 3GUYA 3F47A 4EGAA 2P2SA 1YL7A 4TXJA 4X7EA 1R16A 2EJTA 1Y5RA 2VBIA 3COYA 3GLHA 2W2VA 3BEDA 2P5TB 1A77A 4CTKA 2BIFA 3D7SA 2VNKA 1Z7EA 3UMMA 3DXYA 2JJ8A 4RLFA 3OCWA 2R6JA 3OPQA 4PXSA 5IT9A 3ZIAD 1U0LA 3OZEA 3S1AA 1GSAA 4RDCA 1Z62A 1KZ6A 2HLPA 3QJGA 3LH5A 3TNYA 5LL6P 2AUNA 2I4RA 3L4BC 1KI3A 3LUCA 1Y8CA 5JUWA 4HAOA 4AZVA 1KRWA 4KBFA 4I4TB 3TQFA 4I50B 5BV2P 1XTZA 3PA8A 1H6BA 1M6VB 2GPWA 3AHHA 4IEIA 5EIBC 4JD5A 2WWRA 3GFSA 5CVCA 2WD8A 3E58A 3KZOA 3TLYA 4FYVA 2CMKA 1DFIA 2BKLA 4RZ3A 4YP7A 1W34A 1YQGA 3KOOA 3A1VA 4YCBA 1JHQA 1Q7BA 1YQDA 4IFEA 2AOTB 2HCBA 2EC5A 3QOFA 5I7HA 1K6XA 3CE9A 4HBZA 3QEBZ 4IHAA 4BNTA 4ITRC 2C88A 4A1FA 4PNEA 3GWZA 1D4ZA 3CUTA 3A0UA 4NE7A 1FW8A 1ZM3A 3KDPA 2J0EA 1ORIA 4I14A 4LWPA 3R7NA 1QVZA 2FSGA 1RFGE 4AVYA 2ADMA 2JARA 4ZMBA 4TZTA 2XCRB 3SHVA 3GJ0A 3RO7A 1VQKB 3UWPA 3O8OA 3QG1A 5CNJA 2ZXHA 3VNAA 3R6KA 4RTSA 1R0WA 4DR3B 2EERA 2QPTA 4HNUA 5KYUB 2WZQA 1YB4A 2J7PA 3A4MA 4LXIA 3W2EA 3C15C 5A4MS 5DCYA 5IXSA 2J9ZB 3VPBA 1A2OA 4TYYA 3W6OA 4HUTA 4HEJA 5CLJA 5EJ7A 4GM0A 4RD3A 4XJXA 1NFRA 3OAAA 1PTJA 1SC9A 3LGXA 3M6MD 1RCFA 4U3JA 4GP7A 2PFGA 3E48A 4Q39A 2TS1A 4MZDA 3VNBA 5KW9A 4XSGA 4JR1A 3TEFA 1K66A 1XKQA 4LJ8A 1XUOA 3DZ8A 4FFRA 2XMGA 3I55B 3JQ8B 5DHSA 1LQUA 1PLJA 2Q4RA 4Y6QA 3VR1A 3MWDA 1WDLA 1H2ZA 3IFSA 1OA0A 3HLTA 3PEFA 3T5DA 3MWDB 3TIIA 4G5OA 3TR0A 4GI2A 4M1SA 3RC8A 1UIRA 1M6VA 2E87A 4F38A 1RM0A 1ZC3A 4RY0A 5U1PA 2GNPA 2FHSA 3BTVA 5E4YA 3DYBA 3FDZA 2AJTA 3IBSA 1H2RS 4PC1A 4HDSB 2YVLA 1B14A 3WIDA 4UU8A 3O03A 3KIPA 4B82A 4ZN6A 3K1JA 4P3PA 3ELUA 3NTVA 1V6CA 3K9CA 2GN2A 4LCBA 4AJHA 5JYEA 1QQTA 3WLOA 3D54D 1IXRC 3G0IA 1K06A 4C7OB 1HE2A 3PC4A 4TS1A 3I6MA 1XHEA 2QMUA 2PVSA 1VSTA 3CPHA 3BH7A 4W8GA 2GTHA 5C7YA 1UXKA 2NTYC 5JMPA 4PN7A 3HCEA 1JG4A 4AULA 3AQIA 3IESA 1XA0A 4XZ3A 5HRUA 3DBVO 4V0NA 3ZY3A 1U9ZA 3ONFA 1PWHA 3IVGA 1I14A 2M6LA 1X1TA 1QWOA 2SKEA 3WJAA 1E2IA 1E77A 1OY1A 1WXIA 4XQEA 1VJDA 3BMOB 1JDTA 1L8AA 5EZYB 2YOGA 3AEKB 2WTBA 4NBVA 3UQZA 1HDIA 1NJ2A 5JNRA 4HX9A 4P4UA 4FNGA 1KTVA 5K0SA 3AJRA 5IMBA 1UDXA 5TF4A 1DAPA 1JEQA 4ABYA 5IHXA 2H63A 1SZCA 3DTYA 3WGOA 4TKVA 1J24A 1IJKA 3K0AA 4RVSA 4R84A 3M5DA 4XE5A 3W3AH 5GM1A 4LDQA 4LOHA 1I4EB 3HY4A 1MA0A 3QOXA 5EERA 3GB9A 4DMFA 3G79A 4BDSA 4EECA 3AIIA 3DAYA 2A5FA 3V2IA 2Q3CA 3ZG6A 4Z1OA 3JWIA 4MJ7A 2GJRA 1YIAA 2CL5A 3DMNA 4E12A 3PNKA 4Y1GA 3LS2A 6ABPA 4M9XA 2BMAA 2UZIR 3HEAA 4P4NA 4R8RA 4EAAA 4HRVA 2DPXA 3U44A 1T4CA 3BGOS 4TQUS 1MT0A 3FUVA 3MCWA 4MUGA 2DQSA 4CN9A 1XF1A 3A1PA 4O6VA 1EPUA 2GN6A 3JAWB 3KVNA 2ZM5A 3H4IA 4UQPA 1HFWA 2ZT7A 3CCBA 1NIPA 4KMRA 2QV0A 2BDTA 4PGAA 3EIOA 2O7VA 3SF8A 4QPCA 3ZE8A 3IE1A 2OTCA 1PT6A 2I2CA 4PG4A 1VF7A 1MNQA 2V5UA 1P9NA 4R5MA 1U0GA 3GFPA 4F71A 1QRDA 5L3SA 2P67A 1NB9A 2I1QA 3FPFA 4OTZA 4ZZIA 1HX7A 2C58A 1R0LA 4MHOA 4Y2RA 5A7HA 2X1VA 1FQJA 3TZ6A 1AN0A 5BSYA 1UBNA 1DXHA 3ENWA 4L73A 4WJZA 2VHCA 1Y1QA 3G3EA 3VVBA 3WAGA 1IM8A 3ZKWA 1FZQA 1TK9A 4RMHA 5AUQA 2TMKA 3EHEA 2IWRA 2FJPA 5EFOA 3ZTYA 2H0AA 2HK8A 1CHNA 3GRVA 1R4NA 1P5JA 3RAPR 4D74A 3TD6A 3UMJA 4OOXA 2DWPA 4MEBA 1E3QA 2O4CA 3M33A 1URPA 1PFWA 4MV9A 4G1CA 4R1PA 1A76A 1Z34A 1A5BB 1I33A 2NVWA 3ZDQA 4ZI2A 2O2IA 3FSGA 4XYMA 4YR9A 1YF3A 2W8BA 3TZHA 3V8EA 2R1VA 2YCBA 2VJIA 1VL1A 1DRKA 3T38A 5EIFA 3LW7A 2ZJAA 5F1PA 1IZ7A 4FPXA 2WKRA 4Q4AB 3R41A 3B8EA 1C7FA 2O3RA 4W9NC 1QZUA 2CYBA 2EF0A 2PX4A 4TLBA 2P2DA 5B7NA 5TT0A 4YUWA 1OTXA 1N0UA 2GRAA 5UKDA 4PSAA 3ZBQA 4PVDA 3UHFA 1E60A 1QG6A 1R0BA 1XZEA 1M0TA 5EJ2A 5D3ZA 3W5JA 3OQJA 2AKAB 5E7QA 3OOSA 4Z51A 2FN8A 5COBA 4DQXA 4N5IX 5ABPA 4R1NA 2AUMA 1OFUX 5ALFA 1DQPA 1Q95A 2IS6A 4YRQA 2P7IA 1G8FA 4NXNB 1NGSA 1P33A 1DMSA 2C92A 3B6EA 4B3RB 1QYRA 1DG9A 4PCVA 2NO7A 2I7DA 3D5QA 4FBLA 4GI7A 4Y2SA 4EHJA 2V45A 2CXRA 4Q3EA 3MUOA 4B0OA 2AWNA 5CIWA 1TO2E 1H3FA 5K9ZA 3DUFB 2Y1OA 2GZDA 4FWBA 2XWSA 5BRAA 3KAPA 2NT4A 1QHFA 4CMIB 5K0JA 3GMIA 2GILA 5BSGA 1R6UA 4BE9A 1T5DX 2V7QA 4JQZA 4YGXB 1FFEA 5FPSA 4DBVO 2NYVA 4OXNA 4JP3A 3W8NA 1UMDA 3DO6A 4BQNA 1ZESA 5FBKA 4EHAA 4L0MA 4WCFA 1QVGB 2E55A 1PYGA 1MG5A 2ID4A 3Q4GA 5JCJA 3IMGA 5I8PA 1NW5A 2JFFA 3MMZA 4C6RA 5LP6B 2VOEA 4LHYA 3B6JA 3FROA 1KK0A 3C5CA 4JJ8A 4OBEA 5L7YA 1K6MA 1LNSA 4TMTA 4ZOEA 3ZDAA 1T36B 2H29A 1PR9A 4JYMA 1ANKA 1GSHA 4Q7EA 2V3WA 1QFJA 4YWJA 1FDRA 3FM9A 4LQLA 4REQA 4OA8A 5IK2A 1JWBB 1KDRA 3L7DA 1GSOA 1H4SA 4J0IA 1P9WA 2RGDA 1G4UR 4EA7A 1CR2A 3GLFA 4GKKB 1PWZA 2W2KA 1Y3BE 4L4ZA 2A92A 2X9LA 4O4JA 5KKNB 3EIWA 4JLSA 4M6WB 3G0GA 4PINA 5AW2A 1QK5A 2H54A 1G20A 4PGFA 5IK2D 1DBPA 3CEHA 5LQNA 4DHWA 2RHWA 2IDKA 1WNFA 1R64A 4RHUA 4H3VA 5AOAA 5TVGA 4FOSA 1T9BA 1P17A 1VLJA 4UVDA 4OF4A 5L4SA 4TMXA 1Q57A 1FRQA 1XHFA 3NNDA 5E6TA 4MX8A 4ZCRA 3CE6A 4EF6A 3BWEA 4INOA 1AC5A 4YDQA 2A0KA 4U00A 4WESB 2NP6A 4D92A 2KS6A 4XEHA 2B7LA 3CW9A 3AFOA 2AOUA 2ZRDA 4WERA 5LBIA 4O02B 3H2IA 4I36A 3U3JA 4FFWA 1HE5A 2QN9A 1USKA 4HDKA 1U28C 1VQLB 4ZVMA 4K7JA 4EP1A 3OCJA 4ZCQA 1A1VA 2IH2A 4F5DA 3TTSA 1CF4A 1W85B 2ZDQA 3BICA 1XDWA 1FBTA 1V11B 2IYQA 1ONBA 4RH3A 1A9ZA 1V41E 3RVRA 1VHLA 2E49A 1G7RA 3HS3A 4JCCA 4KQGA 3W2FA 1H4VB 1OXTA 3K0KA 3G9QA 2HHJA 2P2NA 2OENG 5KAMA 2J3KA 4Q82A 5EIHA 3SQMA 4D9JA 3KU4A 1V7ZA 4IJKA 1K8RA 2C57A 1UIMA 3ZLUA 5H9VA 3OIWA 3HZRA 5K8LA 2Q1YA 1YE8A 1FUYB 4KU4A 5U4QA 3BD7A 4KR7A 2VAPA 3MMSA 3T6KA 1XRPA 3CO5A 1TM4E 5DNDA 1Y4SA 3OKXA 1PUXA 3MN1A 4BX8A 3FG9A 3F2IA 1WPQA 2XX3A 1EUCB 4B2YA 2F6RA 3HR7A 3PJDA 4MNTA 4W6QA 3GH1A 4I4NA 4UC0A 1YBVA 4PLVA 4Z4VA 4R2HA 4OHVA 5CYOA 2AH5A 2P35A 2X7XA 2XBUA 3DAHA 1ZGCA 4L75A 2OHOA 4NR0A 3LLUA 1DIRA 1EWQA 3N53A 4KODA 3WO0A 2XUPA 1BMQA 3W6UA 4JEUA 4ZQHA 3RQIA 2YH2A 2YNMD 3I0ZA 1ECPA 4J91A 4MICA 4WESA 5E6UA 3WKBA 5KSYA 2VPZA 1FX0A 3HB9A 5LQKA 5L46A 5JXWA 1PWXA 4KXNA 4KQJA 2VQSA 2ZRCA 4J8PA 3CR7A 4DZTA 5HUJA 5CM2Z 4I4TF 3LQ1A 1P0PA 1WSDA 3F71A 4DEVA 1VM6A 3GIDA 1T0UA 5ADHA 5K45A 1E2NA 2VBUA 3R5KA 4HZUB 1OIVA 2YUIA 4X1KB 4DVJA 1G8AA 3BWBA 5DYGA 4IIVA 5M3BA 1IZ9A 2Y76A 3A4YA 5KYTA 1H1TA 2CYCA 4CF3A 2ZZMA 4TWBA 3V6LA 3A2KA 2VUSA 3GZJA 2XB6A 4FD3A 4US2R 4J1NA 3HJBA 3M9LA 2ZWOA 4C5BA 1P75A 2AJCA 4F46A 4S35A 2GA9A 1M2WA 1QIHA 2QTZA 5KNBD 4IYJA 4J9UE 1ULAA 2BFFA 3C3BA 4JT9A 3DFFA 1ZIPA 2PA0A 4DB2A 1IOVA 1KVTA 1W49A 1KAHA 5EIXA 3U31A 2O5EA 3ZE6A 4EUKA 1Z4JA 1U0FA 3I9MA 4I0WB 4J94A 2ROQA 3NYRA 3LXRA 4NE9A 4RF5A 5T6BA 4W5RA 1UDWA 3QVGB 1J00A 1E8DA 1GUZA 4WIAA 1KJWA 1L7VC 1ATIA 1U0JA 4X7CA 2K7ZA 4H3HB 2BCEA 3O2QB 5K3FB 2JI9A 2AE1A 2Z2XA 1ZCAA 2ZGVA 3OY7A 1JKJB 4O4HF 4NONA 1NRXA 5CVEA 3TDMA 1SMKA 4QPPA 5C81A 4Z5XA 1QF6A 1BQ4A 2XRYA 4WKOA 2H9IA 1T35A 2YVQA 4X6YA 3A32A 4B47A 1C4XA 1C30A 1RAGA 4DRXB 3DZIA 3JYNA 1Q9SA 3T12A 1FJ2A 2EAUA 3RFTA 4PTZA 2I8CA 1ZXBA 3IQIX 1DVRA 3KTFA 4GSYA 1UD6A 4B3JA 1UOOA 1E7MA 4U7TB 3UJ6A 4A8JA 3MF4A 1M6NA 2AF3C 1QU2A 4AS1A 1DO8A 2DU8A 5THQA 2AK3A 1ZU5A 2BTQA 4N6OA 1T3TA 3QA9A 5AKZA 4ER7A 1B2LA 3P1JA 3KKMA 3LC2O 3R7WA 1C4KA 4C0LA 5JS8A 3GN1A 4NYMR 1AKYA 2F8SA 4ZVQA 1LF5A 4R31A 1M2EA 3MJSA 1SVKA 3MERA 2Y9PB 3WIVA 4UBJA 4ES6A 5HUHA 3P2OA 1FC0A 5JFOA 1U2TA 1A27A 3OWHA 2VRCA 4EG6A 5HXAA 1ZGJA 4IVRA 4GAEA 2ENWA 3LPCA 4W6ZA 2I7VA 1GPJA 2WIDA 3VPDA 4MR8B 4FP9A 2H0QA 3R5JA 1KI7A 1RWOA 3UJBA 5K6RA 2CB0A 4AJPA 4IUCS 2R5NA 5BWCA 3KOXA 1RXVA 2YV4A 5DEOA 5KNBH 3OZFA 5G4KA 4B87A 1JG6A 2PT7A 2RAVA 3N74A 1KVSA 3GT0A 5EJMA 1BU5A 3FPLA 1QDLB 5BNTA 3MQ2A 5ESRA 4ER6A 2EBFX 3SSOA 4Y1RB 1FDIA 3E4CA 3AVQA 4AYTA 4DG5A 3O21A 3H94A 1UEJA 3HDHA 4I66A 1Z5ZA 1ZWLA 3UK6A 5KYNA 1AHPA 2WV9A 3IEXA 5G3ZA 3WJ2A 2C5HA 4EB6A 4MI6A 1UMCA 1T4DA 1OWMA 4BS9A 1E3LA 1OWLA 4RLHA 3MFQA 4NZPA 1GT91 3HDGA 1U3VA 3SOZA 4B73A 1PNQA 5HIMA 1GPDG 1FNNA 1XVUA 2F1OA 2JGRA 4I9FA 1S8AA 3G8CA 3X43A 2B5VA 2PT9A 5K3OA 1W8DA 2VDJA 3OQ6A 1I0IA 4OK5A 3RROA 2D2EA 3B12A 4JUFA 2JFGA 3NHYA 2NXEA 3O31A 4L4UA 3VPHA 5LJLA 1ZJZA 3CN9A 4FCTA 2M5SA 2HYDA 4X94A 5FDFA 1XJQA 3SM3A 4M9UA 2VNJA 4TSKA 4JVSB 2O6LA 3KAKA 2BT4A 4LNAA 3SD7A 3RDPA 2X7JA 1QP8A 3ENKA 1AZTA 2C00A 4KQXA 3RQSA 5DGIA 4RPIA 1TU0A 2P5SA 4WK4B 1N9KA 2W2PA 3I32A 3DOIA 1R5OA 1WMBA 1VPDA 3RPEA 1XCOA 1KKLA 2IYVA 4TS3A 4MULA 2XTAA 3F6PA 3JALA 4C9BA 1Y5MA 1Q50A 2QPOA 1A97A 1RHQA 3L6DA 2P9YA 1OE0A 1VJ5A 4BDTA 5B57C 3ICOA 1MJGA 4TGLA 3GC6A 3PVSA 3I04M 5E8RA 2IS4A 1DG3A 1PGOA 2I1VB 4RGVA 2VWHA 2ZYWX 1HFJA 2ZTLA 3PRHA 2IY8A 4LDNA 5A1JA 3IELA 3ZE0B 2R00C 5LLTA 1EXNA 2Q28A 5E8JA 3K2IA 5LQMA 4LMPA 3PDIA 4OLBA 1L7DA 1NT4A 2JFXA 4HNSA 2RG7A 5K0NA 1ZFNA 4E2YA 5JYDA 1JJBA 4QEZA 5JYCA 1J0EA 3DPUA 4AZ0A 2DUWA 3MMPA 5AHWA 1NF9A 1S2IA 4K03A 2V31A 5DTIA 2QM0A 1P61B 4OXIA 1QOZA 2DQYA 1AKUA 1K75A 1BD4A 3AERB 3NKFA 4RQTA 2TMDA 2P69A 1YITB 1JAZA 3O8QA 3WVNA 1R7RA 1JDSA 4QLAA 4KN6A 4MUHA 4QYXA 4P6VF 3RNOA 4LBWA 2GR9A 1HSOA 4G5QA 5L3ZA 4G01B 3EQ2A 4ND5A 5FLYA 1T8UA 4NESA 1TC1A 3L7NA 4FZ3A 4LHWA 4YRFA 3WC4A 1P80A 2HREA 2ZWIA 3A6ZA 4MUYA 5TMDA 5GJCA 4AY4A 1XZBA 4ETWA 3UOWA 3OC0A 1BXKA 1YJQA 4ZVVA 3VHQA 1S2LA 2L18A 4CQNA 4GP9A 3S2GA 3VUFA 4CIAA 1FTGA 2C2GA 3CZMA 4GLLA 4DNXA 1YRHA 2HXSA 4IAOA 4B31A 3CLHA 3FOZA 1MO2A 2B21A 4ALJA 5BYKA 4JC4A 3D43A 4MI3A 1M1YB 4BLPA 5F5LA 3OPNA 4K05A 1W94A 1YZ3A 5TX7A 3L46A 3NHJA 1P1RA 5JZ9A 5BSEA 1JIUA 3QFCA 1J22A 2R8RA 3ISXA 1I13A 1TCAA 4Q03A 3ZPNA 2PTGA 4RHEA 4QHYA 1SHLA 4DXDA 4B3MB 5BQFA 4XSVA 5KREA 2B94A 1PTKA 4D4HA 2XYPA 2P4QA 3E3LA 3N0XA 3WDSA 4MA5A 2XA1A 4ISBA 2C9DA 3H5WA 4V1CA 3BA6A 1XD2A 2ZJ4A 4QDOA 1RRGA 3VR2D 3UAVA 4DV0B 2BE9A 4O2RA 5INTA 1T9GR 4P3KA 3CPXA 2PTHA 4RGBA 3FBTA 1D0IA 2Z4TA 2XITA 3C7AA 3SKBA 4JT4A 3I58A 4P38A 4JI5B 1NP7A 5JHGB 1FXSA 1Y8RB 4NDZA 5B4UA 3A1EA 2DXIA 3CF2A 1SXJC 2GF0A 1EG7A 3RABA 3VSEA 3ZH9B 3KYIB 2Y05A 1F6DA 4ZYXA 1N2CA 3N2KB 3BIOA 4P36A 5P8WA 1EVLA 2D3WA 1XA3A 3DPSA 1BTOA 1GKLA 1IG3A 3FSGD 3PFCA 4B6FA 5EHXA 3AB8A 5JI3E 1SXIA 3B70A 4JBHA 4UVIA 4BRZA 4ZCTA 1T9GS 2KE5A 4RM2A 1NR5A 2WG1A 4BP8A 4DJEC 3ANLA 3ZDFA 1GG9A 3PC7A 2ZYHA 1Q7RA 4ZCMA 1YO6A 3ZXUB 4BN0A 4DREA 5E9WA 1VLLA 3O4RA 4GYJA 2X8LA 1IQ0A 4I7EA 3N86A 2O1XA 1GITA 4ZAWA 3KOZA 4YAOA 1X7XB 3PNYA 2G0AA 1BYUA 5A3SA 3CH5A 4RESA 1JG2A 1BFDA 2BZ1A 1Q3HA 1X7XA 2GXSA 1Y0YA 3VDQA 4X44A 1VHJA 3FPSA 2EQBA 3C8UA 5DGCA 1FLDA 3BE6A 2N9UA 2E0IA 3DE2X 3RUFA 5B6JA 1E5QA 1NNLA 2O7QA 3DZCA 5G3YA 1T1JA 3ZWOA 1U02A 4RGQA 2YC2C 1LDEA 1U9CA 3FZQA 4JJ6A 3RANA 2FKNA 5GINE 1AQJA 3KEFA 1YNSA 1KXZA 2MSEB 4ZVPA 3SWWA 1AS2A 3U3MA 1KVUA 1NSFA 1VL8A 2IKSA 3BL6A 1A1SA 4BNNA 1MN6A 3IPYA 4PC6A 5AN9A 4YP0A 3ACBA 3OIVA 3DOHA 4BO3A 5BQ3A 1JP7A 2BTEA 4PO8A 1UKCA 4GLBA 2ZRAA 2HQRA 1ZJJA 1WUYA 1KGDA 1ZNQO 1W76A 2PFSA 3WRYC 5HF8A 3LF2A 1GTG1 4R2LA 5AI5A 1QHNA 1TGVA 2A0FA 3ADOA 5AKKA 3SDSA 2BM0A 4V0OA 4KDCA 3O4VA 3BK1A 2O2GA 3OTHA 3OPYI 2ECOA 2XTJA 3DDWA 3SQWA 2GM4A 3LFTA 1M6YA 4XGIA 1CS0B 5ALGA 4YMLA 3AUYA 4MEAA 3GCXA 2ZYIA 4QASA 3AETB 1UFOA 1R1DA 5FL7A 3EDRA 4RPLA 3P0HA 3P9SA 5C4MA 4QVAA 4RLZA 1T1EA 3BE8A 3B38A 3D2BA 3KZNA 2JLWA 3FCSB 4KIWA 2ZEJA 5C5EA 4B3GA 5KVVA 1KR5A 1X38A 4LWQA 3T7KA 1XTKA 2B99A 3OJXA 3ZZ0A 2Z0MA 4KPFC 2FZVA 2VSQA 1PS0A 1B76A 4M49A 4EY8A 3EQZA 1CQIA 2PXHA 1NHWA 1GT6A 3I9NA 1T10A 2QUAA 3BJEA 3CRW1 3T4PA 3OBIA 1Q7GA 5DHUA 4C88A 1UKAA 1G21A 1E79A 4RVUA 2PQ2A 2EKZA 1Y34E 4PHFA 1Z22A 2O6HA 3DBHB 4X1YA 4BU1A 4ZVLA 4PYNA 2KB0A 5FTMA 2B82A 1X2BA 2JPDA 2H08A 3RVMA 2Z57A 2FU5C 4OXQA 4I3HA 1ZM2A 3GN2A 2QUKA 4L3OA 3AONB 1DT5A 3NATA 4AECA 1KS9A 4LOLA 1RAHA 1PQYA 4PZ0A 3CFYA 3ND6A 1NVDA 1D3AA 3GCDA 3IAFA 5DP1A 3KQYA 4Q4JA 3ZHXA 4DQDA 4V1CI 3FCUB 3EBLA 2P0EA 4PGOA 4IDAA 1A9RA 1LTKA 3AG6A 4BV2A 2CNWA 2QRZA 1HFKA 2YIMA 2QPAA 4RTMA 2D5BA 2C3OA 1VE7A 5DNWA 4KR9A 2RJ3A 2QT0A 5I9NA 5LD2B 4L8GA 5E6RA 3KPUA 1Z37A 4GKBA 2Q41A 2G71A 5JAOA 2Q6LA 1OUMA 1W75A 2OE2A 3H83A 3QKRA 4DADA 1VCOA 4FYJA 3I5XA 3D0QA 2YN2A 1NW4A 4YAGA 3DZJA 4D0GA 2L42A 4CU2A 3CP2A 1LRKA 1OXXK 4GC5A 4MI1A 4KKTA 4V0LA 5DW0A 4D8UA 4AQYB 1F6WA 3KP1A 4NNPA 1T29A 4JUBA 1LUAA 4OH7A 1QO9A 3WIEA 1KU0A 4IFTA 4D6YA 2Q7DA 3S29A 3AJ8A 2BY4A 4N7JA 4TKLA 3T53B 4YT8A 3VR3A 4DK0A 4CDGA 3EPLA 3EZFA 2FN9A 1WHTB 2V6FA 4ZCLA 5E9AA 2AB0A 1PG0A 2LDXA 3ZE9A 1LLDA 3E5RA 3OPVA 1I3NA 3I23A 3LD9A 3U4QB 2DY1A 2E21A 2AYXA 2E1BA 1RZVA 1ZGGA 2PN1A 4HQOA 4UKDA 4DJFC 4XD2A 1A4RA 5B1EA 4OEHA 1WCXA 2XWJI 1CDEA 1PEDA 1XZ8A 2FPMA 1Q7YD 2Q62A 2Q99A 4FYIA 1OFGA 1GCAA 4G0QA 5I9IA 2PCLA 4C1BA 3NW9A 4A10A 3ZHYA 3OQMA 4GOJA 5E3JA 3F5DA 4FHGA 1VL0A 3VHXA 4QUGA 1W1UA 2I3BA 1A98A 4KWTA 1HQCA 3OEED 3WMEA 2WP0A 5JTUA 4IQ8A 5SZHB 3GLTA 4RJLA 3B5JA 1CYEA 3V7UA 1GVNB 1K5DA 3DWFA 2IU0A 2A0WA 2I3GA 2DHQA 4GZ3A 5BSKA 5C8ZA 4EGSA 2BH9A 4G0YA 2YJ6A