1QG0A

Wild-type pea fnr
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
HSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
publication title A productive NADP+ binding mode of ferredoxin-NADP+ reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
total genus 91
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qg0A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qg0A02
1FNDA 5H59A 3SJZA 5TV2A 3WBJA 4RD4A 1G7SA 4PC3A 3JQRA 1GJRA 4LC0A 2GPJA 1QGYA 1QUEA 5KSWB 2YWEA 5DSZA 5EMNA 3W2EA 1YJWB 4C43A 3QE2A 4Y7CA 2NPFA 4P6VF 3LYUA 2QN6A 3VO2A 1N0UA 3LO8A 2X3UA 1E64A 2DEUA 3B78A 1JJ2B 4RD6A 1I7PA 3FPKA 1JNYA 2BV3A 2BVNA 1YI2B 1QFZA 1AMOA 1JA0A 2HDNB 1TTTA 1QGZA 3G4SB 2D74A 1TUIA 3I55B 2HMAA 1R5OA 1CNFA 1YITB 1DARA 4ZCMA 3OJWA 2BM0A 1NDHA 4TMXA 4HE6A 2OTLB 3MMPA 1ZM2A 5AN9A 3CMEB 1U2RA 1E63A 5GV8A 1KK0A 1VQNB 3PENA 4YAOA 1EFTA 1SKQA 2BMWA 4LBYA 4PC6A 1ZM4A 4RCYA 1QVFB 3LRXA 4G1BA 2VNIA 2ZITA 5THXA 2E1RA 2RC6A 4ZGQB 1K9MD 4B48A 1HA3A 3AGPA 4MYUA 4MYTA 4ZCLA 3CCLB 4M53A 2EIXA 1EP3B 3W2IA 3J81k 4R71A 4RD3A 1D1NA 1EWYA 3WY9A 4LBVA 1F20A 4TMZA 1XB2A 4M4SA 1FNCA 1VQ9B 1KD1D 3QFRA 1K8AD 1YHQB 1TLLA 4P3YA 1EP1B 3WNDA 4TMVA 1ZUNB 3CCRB 3VNUA 4TMTA 1JA1A 1G7CA 2OK8A 4PC2A 1VQ4B 1DDGA 1BQEA 2QTLA 4Q7JB 1YJ9B 1GVHA 3CW2A 4YAWA 3OJXA 3OW2B 4RD1A 4M2LA 1VQPB 1XE1A 3ZBTA 3CC2B 1N0VC 1D2EA 4NCNA 4RCZA 3AVUA 3ZZUA 5TY0A 1Q86D 1OGJA 2DY1A 1K73D 4EH1A 4PC1A 4U9UA 1BX0A 3CXCB 2QDXA 2YWFA 4TMWA 4FWTA 3CB4A 5GV7A 1EFUA 1GR1A 1M90D 1QUFA 4PGOA 3A1FA 1VQMB 1EP2B 2B5OA 4HE5A 1FRQA 1H42A 3W5UA 3WXMA 3AVWA 4UAJA 1QG0A 3CC7B 3P27A 4NBSA 1JB9A 3CCJB 4LBWA 1NJID 2VYQA 1B2RA 1S72B 2QTZA 3G6EB 1GO2A 4ZV4A 3AVVA 1VQ6B 2C77A 1N8RD 1GAQA 1VQOB 1E62A 4B43A 2VZLA 2BPOA 1KC8D 2VNKA 3U6KA 2XNJA 4Y9RA 3E20A 2YWGA 3W2HA 1S0UA 4K1XA 2VNJA 1WDTA 1G7RA 1GAWA 3ZZTA 1M1KD 3CCEB 1W35A 4F7DA 1TVCA 4FK8A 1VQ7B 3OZUA 3ZBUA 2B7BA 2BSAA 3AVXA 2PMDA 3WYAA 3CCQB 2PIAA 3V76A 3ZC3A 4IW3B 1QH0A 2BGIA 1KQSB 4B47A 4TN1A 3CCUB 1CQXA 1B23P 1KK1A 4G1VA 1KJZA 2GQFA 4RD2A 3VO1A 1BJKA 1VQ8B 2YWHA 4N3GA 1R5NA 5HXBA 2QEXB 1EXMA 4YAFA 1VQKB 1KRHA 3QFSA 3CCMB 2VNHA 1G7TA 2DCUA 4AC9A 3OZVA 4PC7A 1ELOA 4ZCIA 1A8PA 3W2FA 1QFJA 3CRZA 1DDIA 1UMKA 4BPRA 2C78A 1IJFA 1QX4A 4G5GA 5FA6A 1DG1G 3CMAB 2BM1A 2CRVA 3I1FA 3MCAA 4YAUA 4DQLA 1Q82D 1R5BA 3U2QA 1QGAA 1H85A 4J0QA 5H5JA 4B4DA 1EFCA 3CPWB 2PLFA 3WNBA 2CNDA 2FX3A 3QFCA 3WNCA 2QMUA 1OB5A 4M1KA 1IB0A 3VMFA 4YHBA 1SM4A 3B82A 4RJLA 1KK2A 1VQLB 1OB2A 2BN4A 3W5VA 3I56B 4ACBA 4LBZA 1Q81D 4DQKA 3ZZ0A 1ZM9A 5JBQA 1FNBA 1BX1A 3QFTA 2OTJB 2B7CA 2EFGA 1CNEA 1FNMA 1ZM3A 2OK7A 1W2BB 1VQ5B 1F60A 4QFMA 3MHPA 3CCSB 1J9ZA 1FRNA 4QHYA 4ACAA 2J7KA 3CD6B 2XEXA 3CC4B 1KK3A 3JQPA 1D8TA 2RC5A 4AF6A 1Q7YD 3VNVA 2DERA 1YIJB 2R6HA 4H9GA 1YJNB 3AVTA 2BF4A 3P26A 4RD0A 1QFYA 1W34A 3B8HA 3AGQA 4N3NA 3JQQA 4M0LA 3ES9A 4B44A 1IJEA 4ZGNB 3FJOA 3CCVB 3WBKA 3W5HA 1FDRA 4YALA 1KTVA 4WQMA 3U6BA 3LVBA 2DETA 2XNCA 3QSYA 2AHOA 2HCJB 4FN5A 4Y9UA 1QVGB 4B3XA 1W87A 3OZWA 1OGIA 3W2GA 3G71B 1AIPA 3E1YE 2BGJA 2QA4B 4C0SA 5TR9A 3AVYA 4AF7A
chains in the Genus database with same CATH superfamily
1GU1A 1JLLA 2EX4A 3H1BA 3GG9A 3VR2A 1Q74A 2Q3EA 2W6ID 3HFGA 1NN5A 4XR4A 3HCWA 3UMBA 2C2BA 1OFUA 3VR4H 1MRSA 4I1YA 5C35A 4E31A 2FW9A 4MVJA 4CODB 1OI4A 2C3PA 1KMMA 2DPYA 4OCZA 2VBIA 4QULA 4ZYYA 2I7VA 2QTBA 3OG9A 3QG5A 3T7KA 4F56A 5KHOC 4U39A 1AOXA 4Z4HA 4GQNA 4YEJA 5HYVA 3E18A 5FI1B 4A3SA 3OAAD 1L8OA 3QV1A 2YOHA 2PTHA 4AN0A 1MAAA 3VVCA 2YRXA 3VOTA 4TT3A 1J7JA 1FP7A 1T13A 1UBUS 4P83A 1QRTA 1FBNA 1SZPA 3IKTA 2JAUA 4J3JA 4RY8A 1KBOA 2JCBA 3LT1A 4CXMA 3DLHA 2QVCA 3CH4B 1RYDA 5LNK6 1ULBA 1QIEA 5FO0A 2WC1A 3NKFA 1PBNA 3TIFA 3CEHA 4JODA 4RC9A 3WL6A 4WKNA 2H4WA 2C2YA 1V5FA 4NYIR 4AICA 1DKQA 5JAMA 3GL9A 1WEHA 3DL2A 1GTRA 2J7PD 3ED1A 4HYQA 4URYR 2VBVA 5DN9A 2FEXA 2L82A 3BAZA 3OURA 4UE6A 3EPLA 5HFNA 2OCIA 2WTEA 4EKGA 1GTZA 3ECSA 3V8EA 1FFXB 5A3RA 3H87A 2BGGA 4Q3DA 5H16A 1ZK0A 2NADA 3R40A 4AUMA 1XKTA 5GVSA 5JDCA 2IH2A 1KRWA 5H3CA 2F3UA 4MUAA 4W8HA 5BSWA 2R97A 3EC2A 4KIWA 4C5CA 2A57A 4W5NA 5A3VA 1Z0KA 2JAWA 3PLRA 4MV1A 3VH2A 4CM6A 3VKHA 3HN2A 3M49A 1II8A 1Z3CA 1QQBA 2ENUA 1FSGA 3NT5A 4HS4A 5DNVA 3PXDA 3ZV7A 2XKAA 2V59A 1XZEA 4IEIA 3A8KA 3EC1A 1LLDA 1E5VA 3IQGX 3UKOA 3EPRA 3IDZA 3ER9A 5E1OA 2WOJA 3ROXA 4EYQA 3ELDA 4KFUA 3SNHA 4CMCA 4RTOA 1ZMBA 1Z5ZA 2JLSA 4RW0A 2G1PA 2V4UA 3KD3A 3GRZA 1N6RA 1FTWA 2Y05A 3AX6A 2VOEA 3ZX4A 3GYBA 2JI9A 3SKYA 2OQVA 1E63A 4IAOA 3KTFA 4KGVA 5BSMA 1C1HA 2HQOA 2O3RA 2YYSA 3GJZA 1JJIA 1W0KA 1H6DA 2ODBA 2HLDD 4H7EA 5EWJA 5GJCA 3VRHA 3C98A 1V4NA 4HB4A 4K6OA 4X60A 3NFRA 1XC7A 4IIHA 2VK1A 3F6RA 2C5SA 2V65A 4P0TA 2BE7A 4DCPA 3UCFA 1UFOA 1GPMA 3FNHA 4G1BA 4CIDA 2WWIA 2LRHA 5KWSA 4BFLA 1Y7PA 2ZYWX 3FTPA 2CNNA 4J0HA 5DX1A 3ZWNA 4H3VA 1JR3A 2VYVA 4H6WA 1ZL0A 5ETJA 2ZI5A 3THYA 4AVZA 2NLOA 4JUDX 3HDJA 1GY8A 1EDZA 1L5OA 4P3OA 2NU8A 1EX9A 3UWPA 1OYWA 1TZBA 2YOGA 3CXRA 4MS4A 4ND2A 4NZNA 5HGJA 1QIHA 1UJBA 3I0MA 4YMUA 1CZRA 2AMFA 3QLEA 3HQ4O 4G0OA 4PIVA 5CU7A 5EHXA 1TKRA 2HWUA 4IZ6A 1E2LA 2EIXA 1FP4A 4RJ2A 3G5TA 4IR7A 2P75A 2DJIA 5FV4A 5IRCD 3LP8A 1XXHE 1I3KA 2AE2A 5LP6F 1PDVA 3VNQA 1BFKA 1Q77A 3BB3A 1R4NB 5J3OA 1SCUA 1EFLA 4OBEA 4II7A 1V1MA 1KPGA 5DYGA 1THTA 2J4FA 3L02A 3AV3A 2GPNA 2H07A 3L79A 1T34A 5C8VA 3VYVA 1J33A 3AUJB 1VKJA 5E7JA 1YHQB 2O8FA 3TG8A 5ARBA 3WNDA 1JPVA 3JZIA 3K1YA 2FWJA 3B6EA 3PKIA 4M98A 2B94A 4X7PA 2Q7DA 2LNDA 3OZ7A 3O3NB 2EQAA 3JQAD 4LSWA 5SZHB 3RVPA 3ASPA 1FYEA 2FA9A 2YDXA 3RUPA 3H0KA 3HA2A 4L7QA 4P53A 3STXA 1VG1A 2XPCA 3NMUF 4OUDB 3FAKA 4WLEA 1AO0A 4B87A 3MZ0A 4N7RA 1PT7A 5ALTA 3GRVA 4JXZA 1ML3A 3JAWB 5EJEA 2CZQA 1Q7TA 4OH7A 5G1OA 3PQDA 2JGKA 2RH5A 2X0JA 3QMPA 2Y0PA 1PSWA 2REXB 4M0DA 4Z99A 2NU9A 2XTMA 1BQEA 2MIIA 4PO1A 4GRDA 4KOEC 1VSBA 4YAEA 1I1HA 3L9XA 3K0CC 2GBGA 2R5FA 3Q3VA 5F1KA 2IXBA 4LJKA 4RPIA 4YRAA 2OO7A 4JJ6A 3WDLA 3GNLA 2VFAA 2FR8C 3QKWA 1NVVQ 3KKZA 1XE1A 4EDFA 1IM5A 2WM3A 2WUEA 1NIPA 1VL8A 3ZQ4A 4C03A 4P93A 1KOGA 5J5AA 2XBMA 2Z56A 2BDTA 1FEZA 4TKMA 4U7WA 3R76A 5D3KA 1TAHA 3TJMA 4BO2A 5CX1B 4CKEB 1P2GA 1RCUA 1WQ4A 4UPDA 3VPDA 2GEFA 4AZTA 4LZJA 3OI7A 2YHIB 1N3LA 3L7KA 5M2QA 1NVTA 2VAXA 2DQZA 1DO8A 2HDHA 4F6LA 4X05A 3L7DA 1FSPA 1SXJE 2IEBA 2KS6A 3G6WA 1G8SA 4IHAA 1JJ7A 2KPOA 3STTA 1WB9A 3B60A 3OICA 3SJCA 5TMPA 2PT9A 5IJ0A 1DLJA 1VE1A 4MINA 3TZEA 1AK9A 2FRDC 3PQ7A 4HX5A 2Q2OA 4L2IB 3QG1A 4CM9D 4XX0B 1K06A 5I9IA 1ZK3A 1AGRA 5IYZB 4HNHA 4RF5A 2YY7A 1SU7A 4ZOQI 4UKDA 4YIKA 3TLXA 2XCIA 4WCFA 1EFUA 4JLKA 4PLVA 2UZ1A 4P54A 1KQOA 4CMEC 1FTSA 4TLAA 3R7WA 3AUFA 4NMXB 3G2MA 3T7RA 1MRNA 1WD7A 1PJZA 3PGKA 4EGCB 1UD5A 1F6DA 1P0FA 4YJDA 1JLSA 5JCXA 4KQXA 3R0QA 4NU8X 4XR9A 2FZLA 3WXMA 2AR0A 5JIBA 4EL5A 5CW2A 4KL8S 2E4YA 2WLSA 2VP3A 1PS8A 3TRHA 1NR7A 2WKPA 5CB8A 1ACLA 4KKVA 1QR6A 4Y6GB 4DXAA 4J07A 4FCVA 1JB9A 1IVNA 4U9IS 1G2PA 3R2JA 4JY7A 2CLFB 3R7FA 2PXAA 3VBEA 1TJYA 5FWNA 4ILEA 1EWTA 3DFUA 4WFKA 4XQ0A 1OBVA 3RRJA 4WXRA 2M2IA 4J4TA 2NTNA 3NBAA 3G6EB 1FVOA 5EHNA 5FTMA 5IT5A 1NSFA 2ORED 3WKEA 5JYEA 2HY7A 2ZB2A 3E8MA 4KLCA 2Y9PB 3QBJA 1VPVA 1E2GA 3A3PA 3T9AA 2H2IA 3ZK9A 2H57A 3NVMB 1OWOA 2O0JA 3H2YA 4NBRA 4RFLA 4Y7DA 1WTCA 5DK6A 3EVBA 1W0JA 3VPHA 1W46A 3PNQA 3U6KA 1Y5RA 3DAYA 1W6UA 2YN4A 2YQZA 3DONA 3QLJA 3R6WA 2P9ZA 1S3GA 4TWZA 2EJTA 5CNMA 1DIRA 4XW2A 5AQEA 3SM3A 1V3TA 5KDDA 5K20A 3AKCA 2HQSA 1N1EA 1GGEA 5C7LO 2ZIUB 1H8HA 1GAWA 1MEOA 3C8ZA 3ROZA 2W6PA 1QRRA 4BE9A 3OCVA 2X4GA 4G0YA 4A6PA 4PAMA 3PQ6A 1XP5A 4EZEA 3A0RB 3CCEB 1YOVB 1BMTA 1RBQA 2VS1A 2Y1KA 3HKBB 3H4TA 1RQNA 4R7TA 3BX1A 3CUEF 5KMGB 4MQ4A 2DPMA 2FFJA 2VHJA 1LDBA 3A7DA 3WDMA 3ZI4A 3AR7A 3C3CA 3DS8A 3LL4A 4IH9A 4F4HA 2A9KA 1P1IA 4I9GA 2ZSJA 1ZCAA 4LHEA 3I0NA 4QRIA 2ZRIA 3E4DA 3WADA 3GIDA 3V4VB 2NPIA 2JAHA 3SEQA 3UJ9A 1GZHB 3D6AA 1ZGJA 4AO7A 1JG7A 4A82A 5K6AC 3B1ZA 5H7XA 1CQXA 1T36A 2E3JA 1E1QA 2EGUA 2QRVB 4H7PA 5AKYA 3TXYA 4KIUA 4GVPA 5CLHA 1IMJA 3STVA 1JBEA 4LXQA 2ZJ3A 3OT1B 4OJNA 5IJAA 1Q3TA 2BI8A 4KXXA 2J3JA 3ENWA 2N46A 3VU9B 3CO0S 1YKGA 3PXAA 4G2TA 5EYPB 1XL0A 4BV2A 3GEIA 5C1OA 1BVYF 3FI9A 1HF3A 1MGOA 2O8CA 5A5VA 1SC6A 3F5SA 2Q5CA 3FKJA 4MVJH 1J0EA 1CJSA 2PX0A 3VPFA 2DRIA 4TUYA 1VRVA 1SXPA 3UFBA 2Z2ZA 3PUHA 2VNHA 4OLJA 4G09A 2YX1A 4QYIB 4TTIA 4XXHA 1FDWA 5CJJA 4JYMA 3S44A 3T15A 3DA8A 2HLPA 3WGLA 2ZTHA 1ZD1A 5LMNB 1UC8A 3OFND 1Z47A 3IQFA 1V5EA 5JCOA 4B8ZA 1NDUA 4EGFA 2HRDA 2EFJA 1TPYA 1FJGB 2X23A 4IXMA 1M6VA 2Z9DA 3PNBA 5A04A 5JMOA 1UPFA 4WMLA 1JQ3A 1TL7C 2E89A 3DYVA 4Z4IA 2GXQA 4J3NA 1AQUA 4YP6A 1GXSA 1OILA 3I83A 1LH0A 1KFBB 5CUQA 4YRTA 1MEJA 3MHTA 3ILVA 1N5JA 4KQ9A 2WPNA 2CVHA 4LC9A 4A0RA 5SZKB 3GUYA 4XIIA 3NTRA 1WCWA 4XFKA 3CMAB 3HHEA 2WD9A 2XA2A 5F7XA 1X3LA 3ST7A 1F14A 4ZT4A 1GGNA 3PC3A 2GYYA 4QA9A 3A36A 3LFHA 1UM9B 2HOQA 4LHZA 3FZQA 4MB6A 1YE3A 1NB9A 2NUTB 3AUTA 4COKA 1T25A 1OXSC 4HAVA 1KYTA 1AS0A 4QUHA 2R6FA 2FPPA 4KMSA 4F60A 5MHTA 3FCOA 3PUNA 3QVKA 4CLOB 3Q38A 4PCAA 2DWOA 3QY9A 4AAYA 2PS9A 3DMYA 2XE7A 4QVJA 3OZSA 3R3ZA 3CS3A 2ZEJA 3FUTA 3R9XA 1QVAA 3P4XA 3RFCA 2G80A 2YIMA 1UZMA 2ZTMA 3ZKWA 3TRIA 5JJBA 3F3KA 3NKVA 1U8EA 2BGRA 1GEGA 4DK0A 1Z82A 3PVDA 1B2LA 2FZGA 2RONA 4PYOA 2OPHA 4FYIA 4IH1A 4HWTA 4JYBA 1DUSA 2ZT8A 3FE2A 4XYMA 2PYIA 3LXRA 1JFLA 1UPUA 4NJEA 3PNSA 2R4TA 3C0KA 5F4JA 1ABEA 2P6MA 5CTJA 1E5TA 3N59A 1UMDB 4ZK6A 1EAYA 3D26A 1J0AA 1Z17A 2QRHA 3ET5A 3I04A 2WYOA 1NLZA 3HR7A 3OJOA 4GQAA 1DGQA 1NQAO 4Q9LA 1T10A 3OIVA 3QKRB 4WXYB 1L7DA 1HV8A 5A9RA 5IF3A 3QEKA 3ADCA 1KDPA 5LQRA 1GA4A 3I5YA 3VTAA 2VSFA 4TXMA 1N4DA 1X8KA 1XCGB 5BSVA 1DWOA 1DQZA 2HRQA 3H1GA 4N03A 3SN6A 5LOVA 2PUFA 4WK2B 3C1UA 3E70C 4P4GA 2Z1DA 3CTPA 4LTDA 4IOJA 3JYOA 4NJOA 1Z62A 1TTPB 4R1MA 4IFTA 1H8ED 1Y48E 4ER3A 3K9QO 1PKXA 1FRNA 5K3BA 1FJHA 2VP6A 4LYJA 3GLUA 3L8EA 3R5TA 2JHAA 4NV1A 1YR8A 2W9XA 1K1EA 2WV9A 4JJEA 5G4LA 1COWD 2J7KA 2FP4B 1OZ0A 2LCFA 4D25A 4PTYA 4KIFA 4O29A 1HNZB 3FDZB 1D8TA 1XA0A 2GPSA 3NU1A 4B5KA 4Y1FA 2H1HA 4DJEC 5ARCA 3AI1A 3GT7A 4JFAA 1CLUA 4IIBA 3RVMA 2P30A 4K05A 5M34A 1R4MB 2YN2A 2GN0A 4UQOA 3KOMA 1EIZA 1DL5A 2BF4A 2P4EA 5EXPA 2Q9CA 3FFWA 3MJDA 2HC9A 2Y4OA 4IGFA 1INLA 3NT2A 4LJ8A 4DIDA 3EGCA 3MCWA 4D42A 4EQ6B 2ZRBA 5KJFA 1ZJ5A 1QH1A 1IM2A 2Y1XA 1P9LA 4CKWA 1U0JA 5CIQA 4M54A 5LDGA 3MS2A 5JH7F 3NP7A 1NTRA 1NI5A 1VMIA 2PXHA 4BB6A 3BBLA 5B58T 4P2NA 1IJEA 2VCYA 2IEGA 3HYNA 1N2OA 3V4FA 1XFAA 3P7MA 1U1DA 1QGED 2AVNA 3OPNA 3QLUC 1EFRD 3N6XA 5AKLA 4OK3A 4XARA 1OC4A 2A6PA 3LXUX 3JPYA 2OB2A 1YQXA 3B1WA 4AN1A 5I9NA 1SD5A 1V16B 2ZKIA 1TC1A 3E0QA 3C7TA 2PNJA 5CFNA 3VR3D 3M6UA 1SFRA 4QUZA 3Q87B 4UE3S 4M83A 4EWLA 1QO9A 1P7YA 9LDBA 1KNQA 5E3IA 2GDJA 3NDRA 3NTXA 4DLBA 5CVTA 2QJTA 3THSA 4XWYA 3LG2A 4ZU6X 2QMEA 3HVJA 4IDFA 1KFCB 3N53A 2OCPA 2LCIA 2AEFA 5DN6A 3H17A 4A8HA 4E70A 3HEBA 1GGVA 4EFNA 3JXEA 5IAKA 8GPBA 1M76A 4I8XA 4DS3A 2IUYA 4QXAA 1LJUA 3TL3A 3OEHA 1QOZA 4G41A 1TUGA 3ADPA 4PV7A 4WLOA 4BXOA 1J2EA 4QZVA 1QP0A 1NUSA 4MITA 2QN7A 2ATEA 1JEJA 3KQNA 4BBZA 2QUZA 2H2HA 3GFSA 3H13A 1H23A 1HZJA 2F3PA 1PV1A 3P0IA 1RI2A 2BE9A 2LKDA 1G21E 4Z4RA 4LV5B 5T4FA 4EFMA 2JK1A 4FGUA 4MYSA 4WOJA 3ABQB 4B4UA 4EYEA 4J3FA 2P62A 4FZ3A 1Y9JA 3LZDA 4DA9A 3GHYA 4QU8A 4C2UA 2P6OA 4QUDA 3REFA 5JAZA 4UU8A 2X42A 3ORSA 1NRJB 5EMNA 2KM1A 3ZNPA 4BNLA 2H0AA 1LPAB 2XQJA 3DXZA 4WY8A 1VDMA 2ABWA 4C0LA 4LC1A 4RSHA 4TYYA 4BU1A 8ABPA 4EJSC 4NWIA 2AXPA 3U9LA 4Q3CA 4JKYA 2IHKA 2EHDA 4QNMA 4GMGA 1UP6A 3JQ7B 4B6EA 1B8OA 2DEUA 4LI3X 3TE6A 4MKXA 2PKWA 1NAHA 1EDDA 3ZNQA 2FW8A 3K0KA 4KQIA 4ZVSA 3R6DA 1A3CA 1Y7IA 1TEVA 2CWWA 3TLZA 3TM5A 4EHLA 3WIUA 3RE1A 3E5RA 1IN1A 2O2SA 2X6TA 4C4TA 5A89A 1U3CA 2XQGA 2Z2YA 3RYFB 2GQ0A 1DJQA 4JEIA 2P91A 2ACKA 1NJ6A 1T6BY 5HM6A 4NFHA 1NASA 4K8OA 2D74A 1G5QA 3A2MA 4ZODA 3I2FA 4WBNB 1XHEA 4BE4A 2P3LA 1Y6QA 4HTAA 1YGPA 4GW3A 3UG6A 4KWTA 1OH6A 3W9YA 4XVQA 3AU9A 3H1AA 2J8ZA 5EP1A 1YR7A 5AYVA 1TK9A 1J90A 1KOFA 5A88A 4YCBA 1YNOA 2F9LA 4OF4A 4PVCA 1OWMA 2QMZA 3EGIA 1HYBA 4Q9IA 4F84A 1SC3A 1C41A 4ND7A 1F2TA 5A6VA 1UCFA 4ZAGA 4FGLA 2XTJA 4Q9NA 3E7DA 5KX5F 1J00A 2WP0A 1OKKD 2VSOA 3AO0B 4MO9A 5T41A 1MKYA 4FXUA 2OKCA 3FRHA 5CNKA 4C89A 5FJJA 4AUNA 1ZU4A 1NW8A 1WKCA 2H4JA 3PZRA 1EFTA 1ZVKA 2JF0A 3F8TA 3IR7A 2BFBB 3O8NA 1VP3A 4JP5A 5B1YA 3WLLA 1YVDA 1KEPA 1QJ4A 3LTEA 1DCFA 5H1YA 1OU0A 2YYZA 2FI1A 3LXMA 4HB2A 1NV9A 4YRIA 1LQ2A 3LOPA 3KKLA 4BTEA 4DHEA 3MWEA 3V4ZA 1KTIA 1KA9H 1SVMA 3GLHA 5ECDA 3IJ5A 5EXTA 2X5XA 4KQCA 3W1WA 1LKZA 2OGZA 3DXFA 5DMHA 1DRWA 1O5OA 4ZGQB 2DTEA 3TSAA 1QORA 3TQRA 2OCDA 4KQFA 2D3NA 5G4KB 1Z75A 3P0RA 3MYYA 5GONA 5CDUA 1Q7CA 1A7JA 2P9GA 1RW4A 3DYIA 3AFIA 3LLCA 3NHJA 2HSZA 3SLDA 2PD6A 2PZBA 2WDZA 3A25A 1K4MA 5E95A 2VJBA 1BXZA 3DBIA 3RS4A 3CVXA 4TYQA 3GFRA 2V7UA 4LECA 1AUVA 4FFPA 4NBUA 5H82A 1DUIA 3GRFA 3JU3A 2W2LA 3OA0A 1R6XA 3KZOA 2OC4A 3SJAA 1VJ0A 3IAEA 3WYEA 4UD2A 4BTLA 4V1CI 3LQ1A 4M4SA 4LJ5A 4QOGA 3AOEC 1H94A 2MU1A 4NZMA 2CE7A 1IG3A 3K4HA 4MPDA 5DNEA 3T41A 3WRXC 4ONEA 1A76A 4RJKA 5EIBD 4ON9A 2VJIA 1PFVA 1NMQA 4P3YA 5L46A 1RRGA 4B0OA 3MMSA 1VHOA 1A97A 1ZMOA 4QDXA 4X93A 4BO4A 3KUCA 2ZCUA 4HDRB 3VOSA 2C9MA 4YPVA 4GP9A 4RVGA 5DP1A 5F78A 4PCLA 2R1UA 5CT5A 1Y5NA 2ET6A 4AZVA 4X8MA 3PA1A 4V03A 5DNWA 4Z7QB 3D5EA 3KZVA 2OCKA 1NP6A 3L07A 5TNXA 4JX9A 3B20A 1WBBA 4E13A 3DAOA 1TOAA 3HI6A 3UHOA 1MAWA 2GXAA 1QWSA 2ZYUX 1TFUA 3RU7A 4EATA 2A5YB 4TV8B 2IY8A 4MS1A 5BNIA 1EHYA 2PRSA 2R8YA 3TX6A 1PAUA 1Y6RA 4P1VA 2WUWE 1BXGA 4C0KA 3PNVA 2C83A 3CW2A 3CE6A 2X7HA 4DK1A 3K8YA 4ZA2A 3SBXA 1MFPA 2P2CA 5K01A 1GUAA 1H5UA 3C3DA 4EGAA 3D3JA 1ISJA 4I6EA 1YGYA 2GARA 2H2GA 2JAQA 3Q2IA 5LQUA 4OHXA 2NO1A 3T4EA 5ELXA 2GERA 1KYYA 2BKUA 1HKHA 1FP2A 1RT9A 2VF4X 3PCXA 5BW8A 4N47A 1E69A 1HO3A 1A5SB 2GA9A 1P31A 1B0AA 1G41A 2VT7A 5TJHA 3X1MA 4JI4B 3JQ8A 2R6R1 1KY3A 2M1ZA 3HKDA 3O8QA 3KJIA 1LC3A 4P7JA 4U3JA 2X6QA 4URWR 4KXUA 1QS0A 4HGOA 1EE1A 1FSZA 4DCGA 1F0PA 1Z15A 4OI4A 3STWA 3N8KA 1GITA 3IUJA 5FWXB 3M3HA 1XQ9A 4L85A 4YXWA 2JJ8A 3EQ8A 2B69A 4E1VA 5A3QA 3S1AA 1I3MA 4YRLA 1QHYA 1QBGA 2HCFA 3KXDA 3WSVA 4Z2AA 1ZEJA 1L7RA 3AIKA 3JSXA 5LQSA 1ADCA 4CT4B 2ASEA 3O0DA 3ICOA 3OOSA 4OIFA 1R74A 4Q15A 2E4AA 4UJ3A 1BH6A 3MGBA 5AOBA 5EZ5A 4YGXB 3TJZA 3PA2A 9MHTA 2UVPA 1ZRMA 3OHMA 4E7PA 2NWQA 1TK3A 4RS3A 2GO7A 1XELA 4UAVA 1I9GA 2HWKA 3QRWA 5LN1A 3D81A 4RHYA 4I55A 2CLLB 3ELUA 2B4RO 3F67A 1BSVA 2VUHB 2YMMA 4K6MA 3UUEA 4ZI3A 3EZFA 2O2XA 3TBFA 1SMKA 1ZQ9A 2ZJ8A 5IASA 2IHYA 1SRRA 5BYAA 1OB0A 3ASSA 4GP7A 5CA1A 4NBSA 1F6BA 4KE8A 1E3QA 1V7CA 4LMBA 3ITEA 3VYTB 3W6NA 2BT4A 4QYMA 4XD7D 1X1RA 3DBRB 1EVIA 1YBHA 2C2OA 2QI9F 3D6JA 3W1EA 5FUVA 1UOEA 3AVQA 3RAJA 1XXHB 2R7AA 5ESWA 4MWCA 2PLAA 2Y6UA 4N9WA 2Q2WA 3L6DA 1TYDE 3C8UA 2WNSA 4AG3A 1RDFA 4BNGA 4DUPA 3PC2A 5JYCA 3VU1A 2X4IA 1CJBA 1V6CA 4X91A 4F38A 3T5PA 1OASA 1VF7A 2BEUA 4JGGA 3DEZA 2X6WA 2XHEA 1YVUA 3DO5A 1G6Q1 3I6MA 2HGSA 3IKJA 1PLLA 4QQ8A 1KQFA 4V1CB 3OJFA 4PGFA 1Z4JA 1YRBA 1C8VB 2BKEA 2JGRA 3SYRA 2IEIA 2AG1A 4HUJA 2WMNB 4K7JA 4FMDF 2OZVA 4OSPA 2IKSA 4D4IA 2BTEA 4DJFC 1P17A 3RU2A 3CH5A 3RBVA 4UREA 3VZQA 1NQWA 2WZPP 4ZT7A 3EZYA 1JBKA 5K0CA 1ADBA 1WF3A 2E48A 2RHLA 1RE1A 4PX9A 4NULA 1JDSA 3GQBA 4QOIA 3ONDA 4ISCA 4L6AA 1C9YA 3VSDA 4CKBB 4LJYA 2JKYA 3VZCA 4P3KA 1TVCA 2BSQA 3FHOA 3KR0A 1NNLA 4PLCA 4EELA 1RJDA 3PQEA 5L7TA 1HNXB 1TGYA 5JSFA 1F9AA 2Y6VA 2ZJBA 2VQFB 3HCFA 4MW2A 3M5DA 3O8LA 2YFKA 4FYKA 1VG9B 1CWUA 1PZEA 1Z5VA 2GM9A 3A8IA 2CY0A 2V3WA 3DPSA 3UKDA 1JXQA 3ZTTA 1JR4A 4JC4A 4DBLE 1XRJA 3BN3A 4CJXA 2UYQA 3D59A 1FYVA 2VJQA 1B23P 2QZSA 1HYQA 1P9OA 3OIGA 3Q0TA 1GA6A 1XRSB 2CFRA 2VWHA 4M9QA 5BMVA 1M2GA 2RD2A 1GEEA 2YFQA 4RACA 2KBFA 4TV9A 4ENWA 1UDRA 3B53X 3FPFA 4YEDA 5HIMA 3DVLA 2WU3A 2OSBA 2UZIR 2YZKA 3CCFA 4D9EA 4TLLB 2P8SA 4NDZA 1SXJB 3IV9A 3T9FA 2Y1CA 4U63A 3GFVA 3DE1X 4S0XA 4JLBA 2ORYA 2PZKA 2VHUA 4IL5A 1IQ0A 3AKEA 1CFJA 1QHIA 1T9GS 1W8IA 5K7SA 1X9GA 2YBEA 3A9UA 3NFYA 3O47A 1YZKA 3FWNA 5HJ5A 2PBZA 3VPBA 4H1HA 3E82A 1YMVA 1I7LA 4KWCA 2DX7A 1WCIA 5K0SA 2ORWA 1OAOA 3EXFA 1VECA 1VLVA 3OTIA 4IRXA 3JWGA 4D9JA 3C1OA 2PL1A 3IT2A 4KXFB 1KZ1A 2ZIGA 5GP1A 1JG3A 2X9LA 4GOLD 3RG2A 3M83A 5DGHA 4TT8A 4KYVA 1QF6A 3KXPA 1P62B 4HIZA 2W71A 3D7NA 1WQ1R 3SR0A 2OV8A 1NV8A 1L4BA 1XVIA 5A8AA 2IUFA 1KZ7B 2WAXA 1CLEA 1YQDA 4WAUA 3VJMA 3VU3A 5F23A 3LKDA 1SD1A 1WL8A 2WHEA 4A5SA 3OTOB 3FVVA 1F1BA 1H3FA 3EK2A 5KQSA 2G82A 4KGXA 2ACEA 4FS3A 4O2BA 4PYIA 1Y1TA 1BGWA 2OQRA 2XOKA 1A8SA 3KZCA 3LW7A 4QTUB 5K4GA 4H1WA 4N5IX 1IBCA 3EWIA 3NTUA 4PR0A 3O31A 3ZIAD 1ZUD1 2P0EA 3DNPA 3FCUB 2YNMA 3JS5A 1WB6A 4GXNA 4MV5A 3A06A 3AYXB 4FSXA 4OXKA 4AVYA 5KOHB 3TCXB 1V35A 4F3CA 2V7WA 4X95A 2FOLA 3ZCSA 4ER6A 1ZD2P 1YFKA 2P7IA 3RFVA 2P1RA 3EGWA 4IUYA 2O0KA 1L5KA 3AY6A 2NXNA 4YN3A 2PKQP 1CR2A 1V5GA 4PU0A 2VXYA 3DCIA 1P19A 1ZXXA 2PS0A 1BPLA 1TFRA 3A1SA 5UKDA 1SUEA 3V55A 4OA5A 4E2ZA 4ENPA 1UUFA 3IBTA 2O9JA 4YJ3B 2CL6X 2ECKA 1W8DA 2DR2A 1IB0A 2VJNA 3I62A 2YW2A 3QNMA 3KPWA 1G38A 4PPFA 2ZIAA 3PHBE 1KZHA 1Z0FA 3LHSA 4OHCA 2YJNA 5BV1A 2ZR8A 3A9VA 1FFAA 4NH4A 1HSZA 3CUWA 4Q1AA 4CF4A 3OCWA 5EJ6A 2G1AA 1RQRA 5CAEB 1OD6A 3T5CA 4YIHA 2VQDA 1EBBA 4V24A 2PG3A 3RC2A 1P60A 2ECFA 4C4SA 1SB9A 3MIZA 5JXGA 5JSZB 1F3LA 4WA8A 3OFVA 3E3OA 2BHTA 3JZFA 3IGFA 2P40A 3O1JC 4Q66C 3QBDA 2PGXA 5E6UA 4YCMA 2Q3LA 3CJQA 3KS9A 4MPJA 4IZIA 2QN1A 4BLSA 1FDOA 3EXG2 2ERXA 3PBKA 2GN1A 3CHYA 4MGEA 4YO8A 2WZQA 1BKSB 1Z6ZA 2LDBA 1SCBA 2DQKA 4HF7A 4DN6A 2HO5A 1BU5A 5EHZA 4I6GA 4AM8A 3IVRA 5BT8A 3L82B 3OFJA 2VUTA 3LKVA 2P2NA 3L7CA 1IBRA 1JXOA 2HUNA 3AZPA 3IP5A 4W9RA 2WJPA 4LGCA 4F93B 4REOA 5TXGA 1VCIA 3WGNA 2PUCA 4BLWA 2ZPAA 1N2JA 3H18A 1LK0A 3PEYA 3UKJA 4JT8A 5KJEA 4RJJA 4B34A 2OHJA 4LGVA 3FYUC 5JQWA 4RVFA 5JT1A 2AVDA 4RYLA 4H9GA 1JJVA 3KOZA 1J06A 1Q50A 1YJAA 3N07A 2LPMA 4XMYA 2ZS7A 2O7NA 2VHZA 3PUWA 4YQEA 4CM8B 1UDWA 2VLIA 2ZRHA 3CX3A 2OUIA 2UUAB 1DZIA 1GTL1 1L7VC 3T4PA 3UWSA 5EQJB 2BUCA 2C7PA 2DPHA 1Y8CA 1SUFA 3L1HA 1ZIPA 5CCXA 2JASA 4ALLA 1D7AA 4R2XA 1IZ8A 4ZD6A 4UTPA 4DPMA 3ZGOA 3RIMA 1Z28A 2FE1A 4M0LA 5IJXA 2X76A 2ZTGA 2Q2VA 3BIFA 4R5HA 4A0GA 2WINI 1R0XA 3LECA 3QKIA 2BHLA 1J56A 4ESHA 4ZAFA 2H59A 4JNKA 3TDKA 4MUFA 2WD7B 5AJZA 3A0UA 1KTVA 4E88A 2IDKA 1JTEA 4ZRNA 4D3XA 2VLBA 1Z6AA 1IWPB 4NFLA 4BQQA 4LYYA 2KB0A 1XAIA 5IBPA 2D1QA 2IYPA 1XCOA 1S02A 3G9QA 2F43B 1ESNA 2NVBA 2HJVA 3AUKA 4KXVA 5KU1A 3N2LA 3LW8A 5BP7A 1E66A 1UBSB 1XMVA 2IY7A 4XRRA 3GBVA 5E0OA 3KKMA 2FAXA 2IOFK 3F98A 4J91A 3I4LA 4LK3A 3T94A 3S0JA 5AI0A 2FUEA 3KELA 3VC7A 4BLOA 2XJ9A 2CDNA 2JDIA 1CU1A 1Q17A 5I7OA 1HRDA 3E9YA 3PKZA 3RSFA 1PFGA 3AC0A 2B0CA 3TQCA 3EVDA 4GOKA 1F1JA 4JOQA 2K4MA 3RTEA 2ETXA 3WZ2A 4B0PA 1BFUA 3DMNA 3L05A 4LOHA 2J6BA 4NMLA 3PVCA 2V3VA 2CFTA 1F2DA 2XUAA 3CRNA 2BGNA 2HJSA 3IESA 4ZOAA 5E2IA 4CL2A 4PGGA 1KWKA 4HNTA 3IIMA 3FYUB 1M66A 4MW5A 2BMVA 3NBQA 2WSSA 5KWEA 1LF5A 2F1IA 1PIWA 4NJMB 4HRXA 2EJBA 2QD5A 3D6NB 4YAGA 3W2EA 4EPRA 3GIRA 2D0OB 1JVBA 3HKCB 3H9CA 5DKFA 3I9MA 3F6CA 1FQWA 4W5QA 1G4AE 3Q6NA 4HLNA 1ENYA 2DSTA 3ESDA 3PDIA 2IU4A 1AKRA 1XI2A 2P79A 1ZHOA 2J3EA 5CDFA 2YXEA 3W5CA 4M9CA 1FA9A 4UXHA 1Y0YA 3TE7A 3LAWA 2BLNA 4Y9TA 1LA2A 2QD2A 2PM8A 4X24A 1WVIA 2VRWA 5C1IA 3U3MA 3UGQA 2F1JA 3D6TB 5JNSA 2QQ5A 4LQCA 4QHSA 3KZNA 1FYXA 2P78A 3DT8A 3H19A 2EEZA 3IV7A 3K5PA 1NKSA 1XA3A 2XE6A 4LG1A 4OAOA 4Q12A 4QDJA 4YUXA 1DX6A 2VHYA 1SCNE 3LWBA 4Y2JA 1TDJA 2HK8A 4KQ6A 2GRAA 1G3IA 1TTTA 2O50A 1RRVA 3CP2A 2AR9A 3AHCA 3EFBA 4JLNA 5L6MB 4I5EA 3EUFA 1B73A 3EIXA 1X7XB 1KEUA 1N3YA 2EW2A 2G40A 3P5BA 3PEFA 5WRFA 5FQNA 3B6KA 1U0FA 2CWDA 4D43A 3CP8A 3OJWA 4PXYA 3DJYA 3QBVA 4YR9A 2WMOB 5JRJA 3RO7A 5FWYB 1ODLA 3L7OA 5C0OE 4A2CA 3CESA 3D6HA 1ZICA 2NNWB 4LVUA 5EUQB 4PYRA 1KO5A 3SM9A 1HETA 5JQGA 2XDYA 3LKBA 4H1VA 2WIFA 5E38A 5E8RA 3GNTA 4X0CA 5KYUA 4AJ9A 4D9NA 3VR0A 1AS3A 3KUXA 3B89A 1M2OA 1XVLA 2PZEA 3OMXA 3ZEIA 4M0FA 1EEXB 2C1XA 2IYZA 4K88A 4O4HF 3RADC 2C99A 1NM5A 2NO6A 3JVUA 4ZEWA 2QN3A 2HRZA 4BDTA 4OH1A 1MVOA 3ILYA 3CCBA 3K9HA 3O1IC 5CX4A 2QX8A 2ZS9A 4PZZA 3K31A 2NO4A 2NZXA 3C5WP 4HN9A 2V45A 3IAUA 2ZXFA 3JCZA 1BMQA 1PCXA 4N4AA 1IPFA 1CCWA 1LBEA 1PR1A 4A8JB 4ESOA 1FNSA 1WLSA 4M1YA 4R40A 5THXA 1KI3A 1PR0A 2E1RA 2GD1O 2GPYA 1M8PA 4L8GA 3VDXA 1W44A 3AM4A 1AURA 1G3UA 2ID8A 2O7SA 3WVNA 3ACBA 1ZIXA 1F0YA 1Y8QB 1Y7TA 2MYUA 3VPAA 4F4CA 2Y9MB 3VTZA 1IZYA 3P94A 4DJJA 2GF2A 3NBXX 3BKXA 2W8ZA 4F2HA 1NJ8A 3BRCA 1GPUA 2GZ3A 3I32A 4GECA 2V7EA 4CLHA 4K9MA 2A5FA 4MUJA 4DV0B 2JD1A 1C7IA 4ALIA 2C1ZA 4RIIA 5EIBC 1PLJA 3LRPA 4FDUA 5IYQA 2X8JB 2QUBA 4E15A 2JPDA 3CINA 1YL6A 1P44A 2IXAA 1TO6A 4L28A 1NE2A 4F6CA 3ECCA 4RF2A 3TOXA 2IZ5A 4ZYZA 4LBVA 1ZGHA 2P9EA 2NV6A 1F20A 4HFMA 1PWZA 4WZKA 1G21B 1VFNA 2ZYDA 3PDCA 4FLFA 4IV8A 2Q3MA 3TN7A 3DAPA 2V7QA 3QFRA 3ISXA 1WBJB 2HIHA 2YNMD 1SOUA 1RMQA 2AEMA 1DI0A 3IQDB 3Q6QA 3C97A 4GOOD 1J2RA 3OTWA 3DCNA 3F6BX 3A35A 1QZXA 2II6A 2C88A 2B78A 4MO2A 4HAYA 4B2LA 3IURA 1O95D 3ER6A 1VLLA 2BCGY 3GI1A 3JTMA 3R6GA 4ARSA 2X5KO 4W1QA 1LBIA 1WR8A 4E94A 1X8JA 3HU5A 5KQRA 1HG1A 2W6OA 4GPZA 3GLFE 1TM7E 2Y0BA 3PJDA 1N2CE 2Q4RA 4OFWA 4TM8A 3RK0A 4Z1OA 4K6HA 1NATA 5IK2D 1Q6ZA 3IAM6 1GTVA 4GZ5A 4CU2A 5J58A 3WLFA 3KB1A 4MLCA 2AX4A 4R31A 2ZPUA 4WV3A 1WX1A 3WK8A 3WJ2A 3JAMA 4J2HA 2ILVA 1H5QA 1UKAA 3CZAA 4GYJA 2IL1A 3VSBA 3ZG6A 1E6WA 1C4OA 2OHVA 1Y8ZA 1I94B 4YAWA 1R0YA 2MTBA 4DM4A 2HWWA 5HBGA 1YZYA 2O2IA 5ADWA 3FY4A 1BCRB 1A8QA 3CJTA 3G1TA 2FSHA 3T9EA 1J1ZA 3SPXA 1AKNA 1V0JA 3ZJYA 4ZJUA 2OYRA 5JXIA 2MYNA 4H77A 4MXDA 2XHZA 2RHDA 3BA1A 1Q22A 3NVAA 3VISA 3CMCO 3WJ7A 5L40A 3ONEA 1YOBA 3U26A 1N33B 2NUPB 4AJ1A 4K9OA 4FM9A 4I1PA 3BZWA 3T3PB 2JH8A 4L15A 2JLVA 1V1RB 2ZTSA 3BCRA 2FN7A 3IAAA 4TXHA 1GQSA 1TT5A 1QB8A 3GGOA 4DXDA 1DG9A 1IZ7A 3QFFA 1MZVA 2HQBA 3I6BA 2FSVA 4OJTA 5ERGB 4D6PA 2EDCA 1H0RA 2X1HA 5KKAA 5FYQA 1CR0A 4GDMA 2JFQA 2F8MA 3K3PA 2UZ0A 2XF2A 5IYWA 3AM5A 2AOXA 4PGOA 3A1FA 3BEOA 3P97A 1I9CA 4NFYA 3QP9A 4C6SA 4FVTA 4MRVA 3QMWA 3A3BA 1UQUA 1QZZA 3QU2A 2EARA 4RHCA 4U7GA 1YL7A 3EAQA 3P52A 1OXTA 4WEQA 4IZHA 1P91A 4YUVA 2CV0A 3K1AA 4XGKA 4JKOA 1RZUA 4S3MA 1RPAA 1QG0A 1H5NA 3TW4A 2EKBA 2FDXA 1IN7A 3ABZA 5DW3A 1QOQB 3U0BA 4Z0PA 5BXYA 2GWRA 1W2GA 1Z25A 2GTIA 2HDWA 4UBJA 3AF6A 2JLUA 2AFRA 3HKEA 1XCJA 2O8EA 2YXLA 4MR8B 1GPLA 5FPKA 1UAAA 4J1QA 4V3BA 3SBOA 3FYCA 3OMWA 1JFVA 5G0TA 2GKOA 2PXXA 4V38A 2Q29A 1W88A 1WF6A 2CCKA 1UMCB 1P9WA 2DJ5A 2WFLA 4OPOA 4ED9A 4GG1A 3RRMA 4D98A 1Y1PA 2G1JA 3G1UA 4RF4A 5J59A 1DV2A 1VQ6B 3KHTA 4HQLA 1V5IA 4IXNA 4O1MA 1KMNA 4AKTA 1GG8A 3HXMA 2AOVA 2O2HA 4XJTA 3VX3A 1G20A 2ZB8A 3E84A 4HI0E 3X0DA 2WIDA 4UFOA 4GKJB 1O87A 3D54D 2E87A 1GL3A 2RGGA 4ZMSA 4I1UA 2FG7C 3OD1A 3QUQA 4XVUA 3FOFC 1BS9A 4KR9A 3NDBB 3OKPA 2WUVA 5EKDA 2QUIA 2GEBA 3KCNA 4N5DA 5DBIA 1MTZA 1TAGA 2UYGA 1ZLXA 3B5EA 2ZCJA 4Q39A 3NO4A 1QRAA 3QNWA 3ZLVA 5A0FA 1RCFA 1C9NA 1BE6A 5T64A 2QYTA 4O2RA 5FX2A 1S8FA 3IUSA 4MW4A 4RKEA 4UTOA 3U4QA 2GBLA 1EM6A 1EFHA 1Q7BA 3SLKA 4IVRA 3VHQA 4V0QA 5EKTA 3UA3A 1CS4C 2C94A 3KT0A 3SLRA 3RV3A 3FF1A 4WX2B 4ZT5A 3O74A 3DLTA 5BN5A 4WW0A 5A9TA 1RZRD 4KPUB 4K6KA 2EWMA 3SVLA 4XEUA 4M7RA 3EMBA 3E03A 2JI6A 4DR1B 4WUVA 1E77A 1E2EA 1F38A 3HSSA 3RB8A 4H6VA 1GT91 3DZBA 3PGJA 4OHMA 4AKGA 2E85A 3HN6A 3KAKA 3ONVA 1Z12A 1EVLA 2DFTA 3ZXYA 4D9FA 1WXFA 2Y93A 3UOAB 2ZB4A 2GD0A 3C7KA 5FYDA 3A31A 2NU7B 5D1NA 1VQ8B 5LA6F 4MQ6A 3MW8A 1LS6A 4I1SA 4NV0A 2MMCA 5CB4B 1JIQA 3NXKA 1P3DA 2OO5A 3LK6A 2ZBPA 3CSSA 2ZQ5A 1YB5A 2I7CA 2HIAA 4JYAB 3L6OO 1KYQA 1Z4QA 3R8FA 3SX4A 2QG6A 4IDPA 3FHLA 1DDOA 1E1YA 4NESA 4WN9B 3L0PA 3QY0A 4BKQA 4PW0A 5AVJA 5KOIA 1VGQA 3KDPA 4ERXA 1A9SA 2I7XA 2WAOA 1L5YA 2I2AA 4AO6A 2ZZGA 5ICEA 1H3EA 3L5KA 1WV1A 2PIDA 4LY0A 3M1LA 1P4RA 5B7PA 2IYOA 1JXAA 3KB2A 3EMVA 2FPOA 2P4QA 5A4KA 5B36A 3AVOA 3NUZA 1RKVA 1QX4A 3UJBA 4MWOA 4JLPA 1T2FA 1ZW6A 2ZG6A 4QTZA 3H9NA 4KCGA 5I7AA 4EDHA 2ONCA 4BP1A 3X1ZA 4YMSA 3RRZA 5MN4A 3OWXA 1M1YA 1Q0TA 2REQA 4WOKA 2JN9A 1AE1A 1GPJA 3TZQA 4FUQA 1JKFA 1P2DA 4PRYA 3G0HA 3X2SA 4LF6B 4Z86A 3CWQA 2C7BA 4NQZA 4LF4B 2ZRFA 4I9UA 2B99A 3RAPR 4OHUA 4QVAA 4ZRMA 3NC1C 3OZBA 2NZWA 3PPWA 1P5FA 4ZMRA 4Z5XA 2POCA 2YJ3A 3IVAA 1NOIA 1QGAA 1C8LA 1DQYA 1FRFS 1T6NA 1XYGA 2XCLA 3COVA 5J2UF 1G6KA 5JZSA 1OFTA 2C2WA 4CF6A 1PKVA 1L4MA 2AZTA 4MSUA 5I01A 3WGYA 3K32A 3QVXA 1KHHA 2NO9A 3WYGA 3TTVA 4HQNA 3NOVA 4ROTA 3CRW1 3WP1B 5DTRA 4P80A 1HC7A 2OE2A 3DL0A 1HFWA 4H0CA 2O3QA 3QFCA 1Z73A 2QMOA 4UMFA 2ZWVA 4K9RA 1KWGA 1PQPA 3A6PC 4PCVA 1K75A 2IWHA 3ONWA 1GNPA 4YHBA 5DW0A 3GDWA 3JASB 2F64A 2WM8A 3SR4A 1PR2A 3LPAA 4RJLA 2JIOA 1OLUA 2VQSA 3INYA 5JY6A 2G5GX 3ZWDA 1T2NA 1DAKA 5FPTA 4I8IA 3T0IA 1U02A 4NU0A 4DG8A 3AF3A 1OB2A 2VSXA 4BMSA 4R81A 4MUMA 4MGKR 4PVDA 5CRIA 1BA3A 1XU4A 4IP0A 4DQKA 3QIVA 4GEGA 1RQGA 1PWHA 1WIWA 3CT4A 1E2QA 4QJ4A 3AOGA 1OXVA 4KREA 1JQDA 1JW9B 4N1AA 1T2CA 4HYTA 4KNVA 3OZXA 4ZP1A 5IMBA 1LJLA 1TK2A 5AK0A 5HUQA 1QG2A 4FGWA 4HEA1 1ST3A 2NP7A 3IEMA 4L6CA 1THGA 3QXCA 4W8GA 1L7BA 1XVVA 3LNCA 3LNTA 4P7GA 1MH1A 3EG9A 4MQBA 1NU6A 3SQLA 2I78A 1J2TA 1EINA 3D0KA 2I34A 1YA8A 2W2OA 3OE7A 2WSBA 5JS1A 2JFOA 4OHPA 3TH5A 3I05A 4OHBA 1BEUB 2W70A 2HU2A 3BAFA 5CCDA 3RC1A 3RROA 4D41A 5A71A 1LK5A 1KYZA 2DUNA 5J4VA 1OXKB 4G0MA 1JP7A 3RVJA 2GJ9A 3ECAA 2QJRA 4Q1CA 3D3WA 4FOOA 4PICA 4AZ3A 4B75A 4OOFA 4EI8A 3IELA 2OGUA 2D13A 3JQPA 3G0IA 2P2GA 5FT9A 5I9SA 1E2NA 1RQ7A 1ZFNA 1B3RA 2FF5A 3KHUA 4Y3UA 3E48A 3L1JA 5I4KA 4HK4A 3U44A 2NMVA 2JZCA 3UWOA 3LP6A 4MWTA 3WO1A 3UY4A 4KKSA 1IQRA 2NAPA 4L0MA 3IH5A 1B6SA 3JQFA 3NIFB 5KYYA 1PNQA 4KE6A 1JKXA 1XX6A 3N0XA 5GVRA 2IVZA 2AC4A 1A1VA 1JLKA 4OB6A 3X1JA 5EJ5A 1P6UA 2QM7A 3EHDA 2C7VA 2H65A 2XWJI 4GQBA 1PVOA 1CC1S 4DB2A 1RS0A 1N9GB 1T8PA 2B1RA 2DPGA 5CT8A 4YRSA 3PXGA 2JBHA 4AMZA 4IUBS 3KCQA 3FJYA 4JS0A 3GBSA 4Y2XA 2ZI3A 3N2NA 1HZZA 1UXHA 2D2EA 5DM1A 1YQWA 4X71A 3RKRA 5FTLA 3U80A 3GLSA 1L7NA 1LY1A 1YB2A 1V95A 5FUYA 1FDRA 1AHHA 3EA4A 3FPGA 3C4VA 4WCVA 5GGXA 1JKJB 1QB7A 3UT5A 4F0JA 5B1EA 3CZ9A 2DKNA 1V48A 2OOKA 3GPBA 3HCNA 3N9IA 3KAJA 2V6MA 3WYDA 3SYTA 4YCCA 2WWXA 1BD3A 1PYOA 4JUCA 2QXUA 2ZU0C 4NAUA 2JLWA 1U0NA 4FN5A 3PD7A 3OPYI 5AKZA 1UBHS 1X86B 2W2PA 2RG7A 2Z5FA 2YBDA 1L8XA 1Q1QA 3AY7A 5J9FA 3IPRA 1SC4A 4FR0A 5ITSA 4C4YA 4IIDA 1JBQA 3GH1A 2I7DA 1OA0A 3C6KA 4N65A 1W581 1QGUA 2BGJA 2FN8A 2FVXA 2V6BA 4G5QA 3K92A 2AFHE 5H68A 1AGYA 4DARA 1M83A 2CCJA 1RRFA 1XE3A 1XTJA 1XP8A 1ESZA 4PZAA 3PQ3A 1MV5A 3EH2A 5T7BA 1ZN9A 4HDMB 2VXBA 5DFAA 4AF7A 2PE5A 1Q2UA 1XQYA 3IJPA 3ULKA 1PNVA 4ZO8A 1EFAA 4LFAB 4RGYA 2WJZB 2BFPA 2C4WA 2ZTUA 2OKGA 1YTLA 2NTJA 4LKRA 1F5SA 4B6RA 3KZMA 5A0VA 1Q2XA 4NS4A 1JI0A 4JC5A 1AD2A 4RGVA 4YJKA 1UH5A 3EUAA 4QXQA 1SBZA 3HV2A 1V8FA 4HNAA 1QQTA 1GJRA 1RXYA 3BMCB 1EGHA 5FTKA 4AQ7A 5KSWB 2WG2A 1CIJA 2F6RA 4HQFA 2Z30A 4OPSA 2PX2A 4S2UA 4GLFA 4RM3A 4WD3A 1TM2A 1GQ2A 3BMNA 3HBNA 5AVUA 1KAHA 1NYTA 5DCUA 5IEBA 5B3LA 3A9TA 4R51A 2XYRA 3OQ1A 5HW0A 4C14A 4N9QA 6REQA 2WYUA 1CVLA 4KNYA 2RGUA 3URMA 3VO8A 1X1DA 3K71B 3B3FA 3I01M 1MAUA 1K86A 4GBED 1PZNA 3U17A 1U2DA 2WVJA 3N6RA 4MVJE 2BFMA 1NVAA 1DAOA 1QIDA 4EZBA 3ADKA 5BWBA 5HFJA 1V11B 2XAUA 1PJ3A 3VNRA 1QLHA 3EULA 4R6XA 1XALA 2P5SA 4CIYA 2PUVA 2IH5A 3HNOA 4RNCA 4FB5A 5CGQB 4LHVA 1GCIA 2BUBA 4YMLA 2WAMA 2QPLA 1YI2B 1RKQA 1W30A 1YCGA 3KL4A 2XF8A 4JWTA 5FOVA 3WZMA 2XXAA 2QAGA 1KE2A 2AWNA 1RP1A 1PV2A 2PD3A 1MN6A 2YWBA 2Z98A 3CNBA 1TUIA 1DAEA 4R5MA 4TKUA 2HBQA 5DCWA 3T5DA 1N08A 1E3EA 2P9FA 2YZMA 1EUCA 1NPDA 1H6CA 3NE5B 2X2FA 3I9OA 3MT8A 2IDZA 4PHGA 3RD5A 3OZIA 1ZYUA 1H1LA 3R23A 5K8VA 1RJWA 1C30A 3IQIX 4DA0A 4QNRA 4N76A 4KFCA 2R1ZA 4BKUA 3G2IA 4JOSA 1Q0ZA 3OM0A 1NVMB 2VDJA 1G5IA 3DB2A 5ALEA 4QU9A 1L4YA 1C4KA 3W5SA 1FLAA 1JPUA 1OAOC 2QNIA 2JEYA 3KYDB 3QBEA 1GRNA 1T2DA 4GRIA 3UMSA 5C52B 3D4LA 2I3GA 1T1JA 1HURA 1JTFA 1ZJWA 1EJBA 4CQMA 1Y1KE 3C3BA 5ES3A 4EPYA 3TAXA 3BM5A 4Y1RA 2ZM5A 3NAMA 4FS8A 4PIPA 3SS9X 1T0IA 4G01B 3MCVA 1DAGA 2ZITA 3E1SA 1MB2A 2VEDA 3SOPA 2CCGA 4RZ2A 5LBUA 2FXIA 3D3EA 4YJ2A 2NO0A 3IPLA 5FWAA 2H2FA 3NORA 3W8DA 2WYWA 5I8PA 1EX7A 4LZPA 2Q5EA 3TDNA 1J2YA 1D2MA 1PSDA 1ND5A 2YYYA 1GPH1 4MAAA 4NCKA 4OAPA 3OPYB 3IRVA 3BK2A 3BULA 3DNFA 4KI0A 3ETNA 2NTEA 3KEGA 3FWZA 4DDUA 2EZUA 4OKNA 5GIPE 1FMCA 2BBWA 4B79A 1CQPA 1FLNA 3DBLB 5CCBA 8MHTA 3HDQA 2FK7A 2H16A 3GVIA 3QSGA 1VHDA 4BNHA 3UWKA 3W2IA 1V4BA 3SE0A 2H7YA 5DYTA 2YV1A 2J9YB 3K6SA 4KB5A 3EXIA 1JR3E 1O95C 4HAZA 5DSXA 4DC9A 3VAYA 3TCKA 4EHJA 5IYZF 3MINB 4BO8A 1LSSA 3FD8A 3BXGA 3V32A 1LUAA 3CCCA 1PJSA 1XWWA 3KB6A 3TBKA 7YASA 1DMSA 4P0QB 3GYGA 2XITA 1I7QB 1U0OC 4AS3A 2ZJFA 3RSOA 1QRSA 1E2KA 2V7PA 4O8ZA 2G0AA 3A9CA 1UOPA 3C8DA 4OPMA 1A9ZA 1UBJS 4ZGWA 4CUZA 1X1SA 2I54A 1B74A 5BWNA 3G8AA 4TXNA 2YTZA 1M2JA 4FW9A 2C7OA 1R3UA 1BOFA 1X1EA 2XRFA 3Q3JB 5FIUA 4I4TA 4DIKA 4M6WB 3EGDB 1R6TA 1VL6A 1CUEA 2OK8A 1DAPA 2H5LA 2ZBDA 3M0EA 3JAKB 1MG0A 1RWVA 4ZI7B 1NJFA 1XMJA 2R79A 1E9CA 1VJCA 3DOEA 4UAUA 4D4MA 2CMDA 4YRZA 1AK2A 1TZMA 2XT9A 3ILHA 3IMCA 1VMAA 1Z4LA 2LZ0A 3BXZA 4R9VA 1VGVA 3BXFA 1XPRA 2PYZA 4NENA 4IHQA 3F49S 2V7XA 1Y4DE 1Y89A 3WA7A 1T0BA 1W85A 2OBYA 2Z8YM 3BUSA 4Q1DA 3N2ZB 1GV1A 3DT6A 3IAS6 3VZBA 3AJRA 3GUVA 1S8OA 3VUFA 4DKJA 1QZ3A 4N7BA 5FI5A 2UDPA 1PT9A 3ZGLA 2EX0A 3Q8MA 4MRMA 4PAQA 4G4IA 4C2TA 2VA8A 1JQBA 3QOFA 1EFPB 4LYDA 3DFZA 3LBIA 4KE9A 3DE4X 2FWIA 1US8A 1P39A 1N0VC 3DHEA 1M2EA 4KQJA 2CGEA 4MIEA 3DLBA 2QRKA 1X80A 1CX9B 4DCMA 3IO3A 3M5WA 1GHTA 3A9SA 1TA9A 4C3UA 2D8MA 2R66A 2GESA 4AYXA 3FKQA 4DPLA 2IBMA 4G7WA 3EEIA 4KMRA 1Z4MA 3OE7D 1WMDA 4BMDA 4DZRA 1FRVA 3ZD7A 3C8HA 3M6FA 3VVBA 1JLMA 2IYXA 2BFFB 4UU1A 1X0VA 2G4VA 3VZRA 1FUUA 3UGKA 2BW0A 5I7RA 3EJ6A 4PC1A 4U2DA 5FTNA 1H9CA 3MWLA 1BX0A 3CXCB 1SGWA 4M87A 1XR3A 3PF9A 1AY0A 2R7NA 2O2ZA 2XTNA 3KOXA 4IG9A 4LHWA 5F5NA 1A69A 1GZ6A 4MWZA 1GRCA 3CPSA 2GS9A 2HIMA 1H3NA 5TEWA 5TGZA 1BHJA 2GNAA 4MEAA 1DIAA 3U19A 1Y33E 3F97A 2WIGA 4XH9B 2X8BA 1EP2B 3LXXA 3UXEA 2I66A 3NWOA 1GTSA 1WEKA 2XQKA 3NIGB 2AD1A 2JFYA 4GU5A 4NSNA 3DWEX 4PYLA 3T7TA 2WJHA 4PZCA 1UEIA 2ZBVA 3P2JA 4QYSA 3LQ4A 4TLBA 4UOEA 4IIVA 3PC7A 5LXTB 1TTHA 4QM7A 3ORFA 1OROA 1UD4A 3TSYA 1N5IA 4CU5A 3A4MA 1WTHD 3HXTA 3NBMA 4P3NA 3Q88A 3LLUA 3ASQA 4IQGA 3Q40A 1D04A 2I91A 2FPGA 2CFIA 1ZIDA 2FMFA 5SYNA 3T9CA 3NETA 4WJLA 2XYPA 1Q20A 2R8OA 5I7FA 3HNRA 3EWAA 1CE8A 3MQ4A 3RAEC 2HMTA 2K7ZA 5EGSA 3ZWOA 2ZYSA 2Q6OA 1BS2A 1NXSA 1UBCA 3EZ9A 1NW5A 1ECGA 1YAJA 3H1PA 1EH5A 3EHEA 3QJ5A 3E5HA 3CISA 4MCHA 3DDZX 2HCTA 2NO5A 1PT6A 2X15A 1CQWA 4A0HA 5REQB 3NNNA 3O03A 3D64A 2WVHA 1GKLA 4MS3A 3OHPA 4XONA 1EK5A 1HH4A 3LI2A 3VHXA 1IOZA 3I9V6 3RGWS 4X5OA 1C50A 2BEJA 2GZMA 1AHIA 2Y27A 2Z43A 3EWNA 3FOWA 5K8JB 2W2QA 2ZR9A 5GJBA 1XQWA 3ASZA 1MUUA 2IZ1A 1BIFA 3J7TA 5BOSB 1NULA 2G1KA 5BN3A 2V7VA 3PDHA 4F2WA 2ATIA 1GPAA 1PZXA 3R1IA 2X86A 3M7IA 3BCHA 4H3KB 5IKMA 2GBCA 1PTKA 5MDHA 3OU6A 3GEEA 4D8WA 1G7RA 5F7OA 2FN3A 2GFHA 4GR9A 1PK8A 4C7VA 4UE2A 4UHDA 1Y1QA 3DFMA 3GLFB 1K08A 3T3NA 4JU8A 2IPLA 1N2CB 1CEYA 4OJYA 2DFKB 3NGXA 2JLRA 3NHRA 3OBBA 3V1MA 3LVQE 1NP7A 1RPZA 1W35A 5DEOA 1R18A 1L7EA 1WPGA 4KLNA 2I76A 4JEHA 4J49A 4QPCA 4UUBA 5ANRB 5AXBA 5BN1A 1FU4A 3L4BC 3COWA 3OZUA 4TYNA 4N6OA 5HG0A 4WESB 3D6UA 4EHAA 4R7GA 3CGGA 1JEDA 1K63A 1ZCFA 2C31A 4KV9A 5T4EA 4ZHQA 2H4ZA 1P73A 3AL3A 1KAOA 5H4HA 1RFLA 3IBSA 1RE0A 2OAP1 3ZC3A 2P68A 3O8CA 3RUDA 4X20B 1EZZA 2H1IA 2NNLD 2FP3A 5DBHX 4CCYB 3G5LA 2FWAA 4HATA 2O23A 3ADOA 3MGKA 4QG7A 1IZ0A 1T9HA 5EMMA 3VU0A 3AH8A 2Y0CA 1GKKA 2OHXA 4JQOA 5DI9A 1H0SA 2HD4A 4PG8A 1ONBA 1ZSYA 1S9DA 2IE0A 2PZMA 3ASUA 2FK8A 3SSAA 1V96A 2GB4A 4PX5A 3BSYA 2D8AA 1L9KA 1MH9A 4QQRA 1SA0A 3C6BA 3KUKA 4D5EA 3V5NA 1P2BA 2D7JA 2Q5IA 2Q9UA 3WV4A 4YWHA 3L0IB 4UXJA 2IY9A 2CXOA 1K8QA 4Q7KA 3LRTA 2W8BB 4E30A 1FFSA 3CCMB 4ZYVA 4J6FA 4XPIA 1N2SA 5EG5A 1Q15A 4DA8A 3JQBA 3PGLA 1WOYA 2CDCA 4QRDA 2O19A 4RTQA 1ESCA 3D4BA 4MJ3A 2GFQA 1A95A 3H6GA 2W5UA 1UBRS 4H35A 2QU8A 1T5DX 4DSOA 2FPRA 1B1CA 2AXQA 2YWDA 4A1OA 5KJ6A 4E21A 2GN9A 2ZZFA 1RWXA 2BFEB 1C3XA 4R2KA 1QV9A 5CLQA 4MV4A 1NUQA 4ZQIA 3LUPA 3L84A 1T1GA 1QDUA 2PU5A 1NM5C 1Y4SA 4JJ8A 4L4SA 3OIWA 1O6GA 4Q4JA 2BUAA 4XX1A 4QT4A 2B25A 4KQWA 2R7MA 4I2VA 2MOKA 4AYWA 4DY4A 3V1NA 5C8YB 2P5TB 2NV4A 1XLTA 1IHDA 1Z26A 2FWRA 3I1FA 3MCAA 3CF0A 5EJAA 5EE5B 3WFIA 5EE0A 1PDOA 1H69A 1HE1C 1C2TA 4HB0A 4KSCA 3SX2A 2FSUA 1A5TA 4RTPA 3WKBA 3FCAA 1D2AA 3D7KA 4CQMD 2QRGA 2VJKA 3DKPA 5KVQA 2CHQA 2D1SA 4I4LA 4LQDA 2NX2A 5DNUA 3IDSA 3I6ZA 3QMMA 4UBIA 5KTRA 3BFKA 4LYFA 1YI1A 1YKFA 1O4WA 3KL9A 3QA9A 4W1RA 5EWLA 4ZN6A 4W5WA 3TUZC 1I80A 4GI5A 1T9ZA 3E9RA 5G3ZA 2QQEA 4V02A 4QHTA 4HXGA 3RREA 1MJNA 1IJKA 4PFJA 2JH3A 3IPCA 2GXUA 5CH5A 3MGGA 4XJVA 3D5QA 1SULA 3LV8A 2XRZA 2PKQO 2LBPA 3UMRA 4ENVA 2FDRA 2H85A 3FBWA 1BVUA 2VCHA 3UOGA 4IDEA 1OB5A 3HK2A 2QS9A 1CG6A 4M1KA 1M0WA 2BWJA 2E7ZA 2PQ2A 2J0UA 2WVAA 3H2SA 3OZRA 4KW7A 1PWXA 2LDXA 1MHPA 1X87A 5AKGA 1RTKA 2IHZA 4PO9A 4E5UA 1KK2A 2CC2A 1KIMA 1DC6A 1XFDA 2PMFA 3H3FA 1CDZA 1XBTA 4RPLA 1EMDA 5AJTA 4B7AA 1T91A 2AMVA 5K99A 2JFWA 2BH2A 4IDHA 5IDQA 2ZSEA 1KMQA 2ZVJA 3CX8A 4KIJA 2M1XA 1TNDA 3LUBA 3NBZC 3E2MA 2C0QA 1P1JA 2QVYX 4FOTA 3IVCA 3I6IA 2ZSHA 4D3ZA 3HUFA 3NUQA 2W2VA 5AW0A 4RIGA 5THKA 2ZYTX 1JAYA 1E9VA 1GKUB 2GCNA 3E7WA 3S55A 4RKQA 1U94A 2FPLA 2I2DA 2J3QA 3ZZNA 2P6PA 4EG8A 1OIWA 1WP6A 2PWAA 3H8JA 2WUFA 1E2FA 3C1TA 4K0RA 4Q4HB 3SZOA 3VVLA 4AL4A 4BO3A 4D4LA 1XV5A 2IYYA 1PZHA 2I6FA 3Q7PA 4QO7A 2X0EA 3HGQA 1FMLA 2BJWA 5GQSA 1KH2A 2D3WA 1U3DA 2P77A 2ZI9A 3L7YA 4H6XA 4ESVA 3S2ZA 4KDCA 4U00A 4RMNA 5FNZA 2V6IA 3VKFA 3CE9A 1G0OA 2ZI6A 4JR2A 4XM0A 1J42A 3VC3A 1WO8A 3DZCA 2HW8A 2DBQA 2WU4A 3N2KB 2D1YA 4G07A 2Z08A 4KMOA 2WOOA 1GFSA 4FONA 4G1FA 3AR4A 3W7AA 3KYCB 3HH8A 2B8EA 2HZ7A 1NSTA 2NPOA 4LHSA 4P31A 1TQ2A 1WUYA 2ADOA 4YRDA 2VN8A 1KI7A 4IKPA 3ZU3A 3K9WA 3U7QB 1LNQA 5DTQA 3QU5A 3A37A 5AK3A 4X1IB 5LJLA 1TM1E 1PUJA 4O2LA 3Q98A 2CE2X 4L5AA 1TCVA 3N2GA 4R16A 4CFZA 3D8HA 5JXHA 4X66B 1SUDA 3GNSA 3K5WA 2H48A 4R01A 2P27A 3PPXA 2Q62A 4X85A 3REGA 4MLPA 4EI2A 2FDCA 1NRWA 3NW9A 3MJSA 4ROSA 1JQLB 4N49A 4OLAA 1NZFA 2MSDB 3FETA 3NJ8A 3QE3A 4V0RA 5AI5A 2CHFA 2HMYB 2ZAMA 3BOSA 4UCFA 5LP6C 2AZMA 1JXMA 5KTMA 3D7MA 2VOJA 4FYYA 2BISA 3BMOB 3HJGA 1T4CB 3EQ7A 3IT3A 1T4DA 4BNZA 1F51E 1ONSA 3IHWA 3PJEA 3FNQA 3RK1A 4D9KA 3OT5A 1YMUA 4UFPA 5DT9A 5FUMA 1RPJA 1SVOA 3VGJA 3PVZA 2XE4A 2IEYA 3NGLA 3T3EA 3AETA 1KQ3A 4F8YA 4FSDA 1IUNA 1C3EA 1DAMA 4G67A 2D1RA 3CUKA 4AO8A 3PHJA 3OZWA 1YR6A 1EFVA 1CUAA 2CZCA 4XVRA 3Q7QA 4OMCA 4PNHA 4C20A 4E5KA 5JS8A 4IDNA 1RWNA 4Y2GA 4BQIA 5HOQA 1NMZA 2F4VB 2GOYA 3QVVA 5KDLA 2VAMA 2R4QA 2CLIB 4XSHA 3B1KA 3KKNA 1ZUNA 2OWDA 1HDGO 4YFYA 4TOIA 5KREA 3STHA 4DMMA 3UQYS 1BXRB 2FZCA 4QPZA 5DGCA 2Q9AA 5TIIA 4B3GA 1GTMA 5TV2A 1ZUWA 5KSZA 4C7OA 1WXDA 1MO3A 4K3UA 2JC3A 1Q21A 4NZZA 3TVYA 3DO8A 4WJZA 4HGRA 4XLLA 4G23A 4OP2A 4PC3A 3LBAA 2LKCA 3F78A 4DXHA 2GPJA 1UWVA 4WSOA 4CTKA 5IJ9A 5AK4A 4PLTA 5LLDA 3NHKA 3PWZA 2IW3A 4P82A 2ZYHA 3EQ2A 1UDBA 3DKIA 3OT4A 4HXYA 2DHEA 2ZE5A 4XM3A 5JZVA 3ZX5A 4D82A 1HQKA 1LXCA 4LOKA 5LPNA 4UPEA 4P12A 1J9EA 3IUBA 4MVJI 2ZDGA 3OLQA 1F4PA 4FZRA 4CV2A 1QBKC 2HFJA 4ZZIA 3VR5A 4NECA 2COEA 2XLBA 3CA8A 3LHFA 5JC1A 1T8WA 3H9BA 3IUPA 3AERB 3KQOA 1YE8A 4DDTA 3O75A 2EZ8A 1L5RA 5MF6A 4C30A 3RBZA 4HZIA 1N7JA 4JJZA 3N1UA 2O20A 3DOCA 1TC2A 3E23A 1KIFA 3H7IA 2QYHA 2VSNA 3UFXA 3UM9A 1VJSA 2MINA 5CD1A 2Q4TA 1E3JA 3MF4A 4KHPB 4LI0A 2GZ2A 2EJUA 3DZKA 3TUIC 1XNJA 3CTMA 1A1SA 2OCYC 3CLUD 3M4YA 4ERNA 4X3PA 2Q4OA 4K87A 7MHTA 1LJ8A 4M89A 1NSYA 4AURA 1CB0A 3JD3A 1W1WA 2NU6B 1UEXC 1K68A 4C7JA 1IOWA 1G5HA 1WXIA 2JVIA 3GW8A 4FGZA 4I46A 3LCMA 1VM6A 4Y0VA 1SZJG 4D44A 1ZM2A 4YXFA 2NSYA 1NW6A 1SG0A 1JFTA 4OXYA 5KYNA 2EGHA 3F6PA 5DM4A 9LDTA 1E7RA 2AK3A 1DJOA 2E9SA 4AU1A 4TV8F 4I1RA 1EXDA 4FD2A 2AXEA 2OECA 3HLTA 4GVLA 4MYHA 5EZYA 3PENA 4LV6A 5F2KA 5TQJA 5IMSA 1GZ3A 1TM4E 4F4JA 5KOJA 1SVUA 4RCYA 2G04A 5FD8A 4UW9A 1MC8A 3MK31 1HLPA 3EISA 4LA4A 4O4JA 4OQEA 1UJCA 2C8VA 4KWIA 4XOUA 4H3SA 1QP7A 4W1SA 5H3HA 1D3AA 1E6LA 4PLHA 4DQDA 4C0JA 3AY3A 3LYHA 2DZDA 4Q16A 1OLXA 3BVPA 1R50A 4IJMA 4OL0A 1Z8HA 3PUJA 3ZYCA 1EKXA 3JQGA 5J63A 2UYOA 3TOCA 4YTEA 3F7MA 2VI5A 1WORA 3NS7A 2V55B 4M0UA 1N1DA 4RESA 1GG5A 3ZE8A 1XQBA 3EFOA 3UC9A 4KUGA 2I22A 4MYUA 3MUEA 1WU7A 3AP3A 4IUDS 3KUUA 4RA6B 4MYTA 2AFHB 3JQEA 3R4VA 3MMXA 1TJNA 4GBJA 3K9CA 4CNBA 1SXGA 1KPHA 4BWFB 4U8GA 1SU6A 2ZUDA 4XCQA 2WFMA 3RVQA 3ZGYA 2R9VA 5ISMA 1KETA 3KHSA 2B2NA 1NZDA 1XEXA 1KDZA 1DXHA 2Q99A 3GLHE 3N5CA 221PA 1YR3A 3N74A 2GN6A 4DTCA 3DQPA 5CXQA 1E5XA 1L6RA 1U1FA 3CNLA 3K0AB 3FPPA 3WRWA 2ZE6A 8LDHA 1CQJA 5FFMA 3ZJVA 1KY2A 1B8PA 2HSDA 1SC1A 3H5LA 4IH4A 2OCGA 3BFJA 5JAQA 1PNRA 1N5MA 4ABYA 1EP1B 4UBNA 1SQ0A 5AK5A 1PWEA 3QXSA 2JAXA 4V0NA 4XLAA 3MJFA 1C2YA 1Z56C 4AUKA 5JCOC 3VNUA 1Y1SA 3IHKA 1N32B 1TD9A 3TR5A 1JKIA 1MEEA 1O77A 2J1LA 1MQAA 3ESXA 1EM8A 1JG1A 3PX2A 3CX4A 5E8JA 4DDWA 2BM8A 2XNDA 4Q4DA 2ZSKA 2DAPA 3IUQA 3L8HA 4HDOB 3TG2A 3FWKA 2CVQA 3PRHA 1T5BA 3ZD6A 4ALMA 1GT6A 4FHCA 1QV7A 4JLAA 3AP2A 1P3JA 2F17A 4I9NA 3ZHXA 4DG5A 5BWOA 1FQJA 3CLHA 3Q5GA 4OM8A 1PP4A 2ZAIA 3Q7TA 2DY0A 2J0SA 3NOQA 3SVZA 1GNRA 3LIPA 3T3DA 3W8FA 4BTVA 5IKEA 4MDFA 1XOIA 4J0KA 1QK4A 2VJDA 4Z4EA 1U9IA 2A9JA 2R6ZA 2RH9B 3I04M 2QYOA 4RKYA 4ZO6A 5I5EA 5IDVA 3VXKA 3DKKA 3A11A 2G4LA 3RAFC 4O4IA 1F6WA 2G0NA 3QK7A 1GZDA 1UJ2A 4IEEA 5AM5A 3AL2A 4FDMA 4PSVA 4QEKA 2JJ2A 1N57A 4ZQCB 2QUKA 3GDFA 3IEPA 1D1SA 2JLBA 3GWZA 1XWFA 5EMLA 2PWBA 4I5DA 4BIIA 1F4LA 4CBVA 3LY8A 4YRRA 4ZKDA 2B4QA 1JHAA 1DJNA 3TL6A 3QVGA 4IGIA 4AP9A 4PO8A 3WLEA 4V0MA 3OESA 5JJKA 1FXWF 5EIEA 1W19A 3HY6A 4DSTA 1W4ZA 3W8RA 4MQ5A 1T0UA 4YAKA 4CEHA 2W4MA 2HFKA 2Y3IA 3IBFA 5HJ2A 3EZ6A 4TMWA 1FC0A 3F7OA 3OZFA 3FMOB 4QGSA 3CB2A 1II8B 2ISCA 4PG6A 1FU8A 2X1VA 1QUFA 4X7FA 5DRTA 3UAGA 1YHZA 3QMVA 3T3HA 1L3BA 2IYWA 2YH2A 5JDIA 4PHHA 2HMSA 2X5NA 4G5OA 1G5FA 3AQ4A 3RHSA 2N1BA 4B32A 3PNYA 1NBEA 5IANA 4P36A 3I2JA 2XCSB 4UC0A 3ML1A 4X07A 3K73O 4DJDC 5L53A 2QWXA 2B83A 1R0BA 1WUIS 4UAJA 1OGYA 2ZPTX 3BHIA 4B73A 5C4GB 2Q6LA 2V03A 2F1HA 3IP3A 2XNSA 2PK3A 4EO9A 5HM8A 4ZOLA 1CIVA 1EBFA 1X2EA 5AI9A 1I36A 1UPBA 1Z35A 3D0OA 3CLKA 3R44A 3CTAA 5EWJB 3RNLA 2QMQA 4KAAA 3WIEA 1ISMA 1C8KA 3OSUA 4QXRA 4A2QA 2CKMA 1WM1A 5B37A 4QFCA 1K3UB 2IPMA 2WJIA 3SEJA 2C61A 1FVFA 1JQJC 2LGJA 2QTGA 2CL5A 4DF3A 1TMKA 1OLSA 1Z6QA 4RHTA 2JIZD 4AQYB 2QZPA 3D1VA 3B7PA 1XTSA 5FR1A 4H7IA 4NBKA 3NHBA 4YRGA 2EWVA 1LSJA 3DDUA 4KWHA 2ESRA 4XLFA 4PQEA 2ZANA 3FNBA 4IO1A 5IN4A 4M9XA 1ISGA 2IBSA 3THYB 4D0NA 2ODEA 3MD9A 3O3MB 3VNBA 1XJCA 2NU8B 2EP5A 5AW6A 2OHGA 4KKXB 2XUJA 4RBNA 5CVUA 5ALZA 4AY4A 3GROA 6GPBA 4MS4B 1EI9A 5BN4A 1W4AA 4MJLA 3DTVA 2P67A 5E4JA 4LSMA 2G36A 4UEKA 1PZGA 1FP4B 4PINA 1ISPA 3LP5A 2ZP1A 4HWPA 4UM9D 3EDQA 2QPAA 2A0XA 3FH0A 3WLRA 4IV0A 4LJ4A 1H2XA 1Q3KA 2VDOB 4K9QA 4DLLA 2CK3A 1M1KD 1XEWY 2A58A 4IIEA 2XJ4A 3RC9A 1SCUB 1X8XA 1V1MB 4JI2B 5BPFA 3OZEA 4DNOA 2R47A 1JFRA 1IU9A 1BMDA 3A58B 3BS4A 2BAGA 4JBYA 3WQHA 5BQXA 1Z5WA 4FYVA 1NN0A 3QPAA 4EUEA 2A9PA 4FI3F 4NU5A 3V8RA 2F3QA 5GOZA 1JR6A 2B7BA 1EVJA 3L3BA 2JGJA 2YWRA 1W7AA 5F51A 1N75A 3LE8A 4G26A 2K2WA 1E18A 4H17A 2V1XA 5JD3A 2WU8A 1Q3HA 3TLAA 1SK9A 4RKWA 1TM5E 2WIJA 3A2NA 3EYWA 3X2FA 4ARBA 1IBMB 2FRXA 3SP1A 1R7RA 3CCUB 1VHLA 4BVKA 5K3OA 3U09A 3PT5A 1BDHA 2V6JA 4BY9E 1JE1A 1GU7A 1LV7A 2NIPA 3BTVA 6YASA 3PGA1 1P18A 4RDKA 3ANTA 1N2HA 3KSRA 4KX5A 4YAJA 1OFVA 1A77A 2YRWA 3R7AA 2NU9B 3H11A 3VYRB 2AC2A 4YJ3F 4JLOA 1P4AA 3H4IA 5EE3A 5F3DA 1LD3A 4UFNA 3G68A 4ZAYA 4U2FA 4CL3A 2B35A 4URXR 4EG5A 2EERA 4LCBA 5K3FA 1RYEA 1VPLA 1KERA 3B6MA 1SUIA 2QEXB 1ACJA 4P4NA 1E3MA 5A02A 2W2XA 2PMWB 4KR2A 2O7VA 4DRXA 4HVCA 2PD4A 1SPBS 3L40A 3OPMA 3H8VA 4TSKA 4Y2SA 5AW7A 5KC8A 1MQ9A 4H7DA 3CKKA 4RVNA 5SICE 3OQMA 5KQGA 1ELOA 4NTZA 1YBFA 3DE6X 2R8RA 3U3RA 4UULA 4DSZA 5KYXA 5F4MA 2IYQA 4DGQA 4N8EA 1KKUA 3Q7SA 4KKUA 1H66A 1XXLA 2FWPA 4FKMA 4KVZA 4LUCA 5CLGA 5ALSA 4ALKA 1OX4B 3VR5H 3NYWA 3OECA 1XAHA 2EG9A 4E5MA 4DBZA 1ZD3A 5IJ0B 3BWCA 4ZI2A 4G5GA 4E5VA 1NUTA 3ZHYA 5FA6A 2AOUA 1F8UA 3TPZA 5KWVA 1PS9A 3UC5A 1TMYA 4WGFA 4WCFB 1E9AA 3L7LA 3NONA 3TLYA 2UZ1B 1VTKA 3DWIA 4P58A 4UBKA 3R7WB 3F0TA 3I39X 4CKYA 2IUTA 4EYSA 2RGDA 1OA1A 2PGLA 3BWDD 3LK7A 5D7BA 3L4SO 5K3DA 2Q6IA 3O2JA 5CG1A 1V3QE 3QNUA 1TW3A 2PXCA 4N0DA 2AJBA 3ZDQA 4FCWA 1GQQA 1SCQA 1JYFA 2XD4A 1I5OA 1CD5A 2P9HA 2MT9A 3E1KA 3GFGA 1EE2A 1G9SA 5IBQA 3VPSA 4KXMA 4TL9A 2OLKA 4YV2A 3B6IA 4FLMA 2Z1NA 3A4YA 5AVVA 1SN7A 4TZ6A 3UBMA 4WXMA 2XCQA 4WZAE 4ZVPA 5AW9A 2JLCA 3KV1A 3BEDA 3KYIB 4ZIRA 2IYUA 4GE3A 4I1IA 1GDDA 1SUCA 1YLOA 1WMEA 3C85A 5LBIA 3VDMA 2RMKA 2X4LA 1OWLA 1N5KA 5T8KA 3DWFA 4J0DA 2PVSA 4DGSA 1UFQA 3HP4A 4EMBA 3EXHA 3GRUA 3PFFA 4EKNB 3A2LA 1XF9A 3DMRA 3ELBA 4GVXA 5CURA 3B1JA 4YI3A 4Z9FA 2C5EA 4WLNA 4E5PA 1R8SA 4RCVA 1ZM9A 3ZNNA 2V4MA 3FPAA 5DYIA 1ZNZA 2BI4A 2Q3BA 1LRLA 1YDMA 1TKCA 3EPKA 2QLNA 3SQXA 2B1QA 2DHCA 2NXWA 4XQGA 1FFYA 3TRFA 1R6VA 2F3RA 3KWFA 1ZM3A 1N8KA 3D8UA 1AQNA 2D5BA 3IX7A 1JLRA 3H9UA 3QPVA 3RIHA 1U6KA 4Y6LA 2XDAA 3CF6R 721PA 3HG7A 4XEHA 2BGMA