1QG0A

Wild-type pea fnr
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
HSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A productive NADP+ binding mode of ferredoxin-NADP+ reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
total genus 91
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qg0A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qg0A02
1KTVA 4M0LA 2BVNA 1D2EA 4B4DA 3P26A 3W5VA 4AF7A 2PIAA 5KSWB 1QVGB 4LC0A 3OJWA 4M1KA 4DQLA 4PC2A 3AVVA 2VNKA 1U2RA 5AN9A 3W2GA 1VQ4B 1F60A 2X3UA 1HA3A 2AHOA 2BM1A 2C78A 3WBJA 3WNDA 3ZBTA 1KK1A 1ZM2A 1JB9A 1QGAA 3OJXA 2BSAA 2EFGA 4ZGQB 1W35A 5THXA 3QE2A 5TY0A 1VQNB 3CCLB 1FRQA 2OK7A 1B23P 3LYUA 1TUIA 1K9MD 1G7CA 1GO2A 5JBQA 3P27A 1TLLA 3CCQB 3B8HA 4FK8A 4TMWA 3W2HA 1IJEA 1D8TA 2PLFA 3AVUA 5H59A 3W2FA 2BV3A 3I55B 2NPFA 1SM4A 2YWEA 2QMUA 4ZGNB 3CCUB 2XEXA 4Y7CA 1BX1A 1EP1B 4WQMA 1YJWB 3OZVA 3SJZA 4Y9RA 1AIPA 2EIXA 2QEXB 4YAWA 1H85A 4EH1A 4TN1A 3U2QA 1BX0A 1JA1A 1R5BA 3AVWA 3FPKA 1CNEA 2VYQA 3LVBA 1FNBA 2DETA 3QFTA 1B2RA 3JQPA 3MMPA 2YWFA 2CRVA 2DCUA 4BPRA 3VO2A 3MHPA 1NJID 3CCSB 3VO1A 2FX3A 4B48A 3FJOA 3W2IA 4HE6A 4ZCIA 1VQ8B 4RD6A 3LRXA 1BJKA 2VNJA 3U6BA 1YITB 1XB2A 3OW2B 3CB4A 3CCMB 2B7BA 4RD0A 1WDTA 2RC6A 2CNDA 1R5OA 1ZM3A 3WNBA 1F20A 4N3GA 4UAJA 1JA0A 1NDHA 1BQEA 2QTZA 4YAFA 1W34A 1KK2A 4QFMA 5TR9A 1VQMB 1QGZA 1VQLB 3JQQA 1QUEA 1DDIA 2XNJA 3CXCB 3ZZ0A 4TMTA 1QVFB 1VQOB 1VQ6B 2HDNB 4Q7JB 1VQKB 4B44A 2QDXA 1R5NA 1S0UA 3PENA 2HCJB 3CW2A 3V76A 4Y9UA 2ZITA 1G7SA 3G71B 3CCEB 1H42A 2PMDA 2E1RA 4PC1A 4AF6A 1KD1D 5GV8A 2DERA 4M4SA 3AGQA 4YHBA 2VNIA 4YAOA 1ZUNB 3OZWA 3ES9A 1KC8D 2OK8A 1E64A 4YAUA 1GAQA 4H9GA 4AC9A 2BGIA 3AGPA 3I1FA 1VQPB 2YWHA 1ZM9A 2QN6A 4U9UA 3QFCA 3AVXA 4FN5A 3WY9A 3E20A 1IJFA 2GQFA 1EFTA 3CPWB 4P6VF 4B47A 1DG1G 4B43A 1KJZA 4N3NA 2RC5A 4K1XA 3I56B 1Q7YD 3CCVB 1M90D 1GVHA 1OGJA 4G1BA 3CMEB 2BPOA 3CC4B 3VNUA 1CNFA 3CCJB 1JNYA 4J0QA 3AVYA 1QUFA 1ELOA 1N0VC 1Q81D 2BN4A 1FNDA 1QGYA 5GV7A 4TMVA 3J81k 3ZZTA 1DARA 4B3XA 1QFJA 4NCNA 1AMOA 1EFCA 3VMFA 2D74A 1YI2B 1M1KD 1K8AD 3ZC3A 3A1FA 1QFYA 4MYUA 3W5HA 3QFSA 4IW3B 4RD4A 2B7CA 3G4SB 5H5JA 4ACAA 3ZZUA 2BGJA 2BF4A 1N8RD 4RCZA 1IB0A 1G7TA 1FDRA 3CCRB 2OTJB 3QSYA 5TV2A 1EP3B 1Q86D 1UMKA 3ZBUA 1S72B 5FA6A 3CC2B 4FWTA 3B82A 2R6HA 1FNCA 4LBWA 1YJNB 4C43A 1DDGA 4F7DA 1QFZA 4G5GA 1I7PA 1VQ7B 3W2EA 1K73D 3E1YE 2GPJA 4DQKA 4YALA 4QHYA 2BM0A 4HE5A 1XE1A 4RD1A 3W5UA 4RCYA 1QH0A 2QA4B 1J9ZA 4G1VA 1W2BB 1GAWA 5DSZA 2HMAA 1OGIA 3CRZA 1KK3A 3LO8A 2OTLB 2XNCA 2VZLA 1N0UA 3WYAA 3OZUA 1QG0A 4ACBA 1YJ9B 1QX4A 2BMWA 4NBSA 4RD3A 1FNMA 1FRNA 1Q82D 1GR1A 3CD6B 5HXBA 1EWYA 1SKQA 4TMXA 1YHQB 3AVTA 1KK0A 3B78A 4RD2A 2QTLA 1A8PA 2C77A 2J7KA 2YWGA 3JQRA 1EFUA 4LBVA 1EP2B 4LBYA 3MCAA 1OB2A 1VQ9B 1YIJB 1GJRA 3U6KA 4ZV4A 1TTTA 1W87A 3WNCA 1ZM4A 1KRHA 3CMAB 3QFRA 1D1NA 3G6EB 4PGOA 3WBKA 3CC7B 2DEUA 1E63A 4M53A 3VNVA 4M2LA 4P3YA 1VQ5B 1CQXA 1EXMA 1G7RA 1TVCA 2DY1A 4PC3A 4MYTA 5EMNA 4RJLA 4ZCLA 4PC6A 2VNHA 1E62A 4PC7A 3WXMA 4ZCMA 4C0SA 1KQSB 1OB5A 4R71A 4TMZA 4LBZA 2B5OA 1JJ2B
chains in the Genus database with same CATH superfamily
3PEEA 3F8WA 4PYJA 4Z7JA 1M2FA 5CNJA 1Z5NA 3I01M 3X1JA 2IBMA 1OWMA 3GEDA 3W1EA 1GG5A 3PCTA 1E1QD 4C4PA 3I0MA 4EG1A 2PIAA 5CVVA 1RC0A 4BLPA 5JJLA 3AEQB 1JB1A 1DFGA 4FD3A 4MVXA 4YASA 4GMGA 1IUNA 1XZLA 2NMVA 1C8LA 2AQHA 2SKDA 3ZI4A 3O9MA 3OU6A 2OY0A 2GMWA 4K7JA 4MX8A 3H1FA 3VOBA 1ZMBA 2VCEA 3DMDA 1PR9A 2F8SA 4EKDA 1YWGO 4LSMA 1RWNA 3W2GA 1UXIA 3NEPX 3V1YA 5IZCC 5K2MA 2X85A 3ZV6A 1E89A 2EBFX 1VMEA 3E58A 2PAAA 1VLZA 4LMBA 5ABPA 3F47A 2IOFK 3F6CA 1NE7A 1RADA 4R2JA 2VXYA 3JARB 4UDOA 4O2LA 3KKEA 4GX5A 5B12A 1ISPA 3O4VA 4N6NA 2HQRA 4XX0A 2JCGA 1R1DA 4MS1A 3S7TA 2BSAA 5E4JA 1V8PA 2CYBA 1MX9A 4QGGA 4A0GA 2EVWX 4RDCA 5HVNA 1POXA 4CUZA 2BKXA 4DDHA 4O4IA 3BH4A 2F1HA 3QI2A 2GKOA 3DDNA 1GYPA 4P3KA 4BDTA 3MJDA 4E07A 4TYMA 4KSYA 2XW6A 2FEMA 1RR6A 1TECE 3PSAA 1NLFA 5CT5A 5E6RB 2QS9A 3BIJA 4B4WA 1Z4JA 1X7YA 1Z0IA 4TKUB 5KNBA 3IQGX 3ZH9B 4IHJB 1LRLA 5JBQA 3TRKA 4PAGA 4TOIA 3G1WA 5A9TA 3O8OB 2BCJQ 1P0PA 1KI1A 1TLLA 4OLFA 2IPMA 3QBTA 1YASA 2M2IA 1AUVA 5JZMA 3AB3A 2N3ZA 1JTEA 2VYNA 1QYWA 2IEIA 3GPIA 4O4LF 2PMFA 4IIJA 4LRXA 3D9QX 4RHCA 3DE3X 3D6UA 2WD8A 3QOFA 4KN8A 4OK6A 2XAUA 4HNHA 3PLRA 1E79D 5DIFA 4FXPA 1CUVA 1UKZA 2PU7A 2Q41A 1Q92A 1TJNA 1XVAA 2X3FA 4MROA 1E98A 4ABTA 2YWEA 1VCIA 4B3RB 4W8HA 4KLZA 3B9QA 1IQ0A 3B3GA 2SKEA 3V7NA 1I2ZA 4JAVC 1CJTC 1ZH4A 2XEXA 5IM4A 2CNWA 2XYGA 3RUIA 4PHFA 4K8RB 3H19A 2PX6A 4B3DA 5LD2C 1NXPA 3PDHA 2IYZA 2AOXA 4B3JA 3NUZA 1PJ8A 5DHUA 3GNQA 1IHXA 3D2AA 3IEVA 1CE8B 5EQDA 2B3TA 2PBFA 2VDOB 2YIVX 3AT1A 3BF8A 1EXNA 4XGNA 3T41A 1FFAA 2EIXA 2QEXB 2I2BA 2PQ0A 3MYRA 3QXCA 5K6TA 4BATA 2IYEA 4BO0A 1VYTA 4YAWA 2DE0X 3I72A 3JWJA 1KMIY 2VP2A 1TTPB 3FH0A 4QREA 3CT4A 4RLZA 1G1MA 1OKKD 3U9LA 3KCNA 2IEBA 3U2QA 1A72A 1KZLA 1JFFA 3TQHA 3HADA 2PKXA 4DCJA 1IK4A 1W85B 3CF2A 2J8ZA 1KORA 2OMKA 1BCRA 1Z2PX 1XKXA 1QF9A 2PV7A 1WHTB 3CUKA 3E9CA 3NRCA 1I6KA 3PDUA 1KSFX 5HM8A 4TSKA 2ODWA 4RX1A 3TPFA 3FRJA 3INYA 4IICA 5KX5B 2OC4A 2B9VA 3EEQA 5FXMA 4JODA 1V3VA 2A59A 4RJKA 1YE3A 4H0CA 3JALA 3NM6B 2VBSA 5HBRA 3RRZA 4J90A 4WBNB 4JV5B 1PTJC 1N8TA 4KN5A 2EP8A 3AB8A 3CONA 1CY6A 1GADO 3BWYA 4JOSA 1GZ5A 3SYMA 4EVRA 2W2TA 1YONA 1RHQA 2C59A 1RHMA 3OQIA 3W5BA 1SCJA 4B48A 4BZQA 2R8OA 3IBFA 1EDDA 2P9CA 1XJCA 3E7FA 3LUBA 4NCJA 5JQGF 5F4JA 4XWWA 2P9QA 1K98A 2OECA 1PFVA 4L9RA 5JLAA 1IG0A 1NNLA 1I5EA 1ZS9A 3NUGA 3N2GB 4TTIA 1LRJA 2QYSA 3UEOA 3USCS 5C4IA 2EU8A 4HCJA 3WTBA 3OLYA 3FTEA 4HMOA 2Y66A 1UXJA 3RUFA 3GVCA 1WCWA 3REQA 3EDQA 4IZOA 2OD2A 1CZNA 1LSSA 1HYHA 4RY0A 4AX4A 4BX9A 5IKPA 4YJDA 3WWPA 5I7UA 3B1JA 4OHOA 4JVLA 2PA3A 2JEYA 2VYND 1SKBA 3HSKA 5HF5A 4YJGA 4F8EA 5CITA 1IL0A 1UBMS 4GP7A 1ZEMA 4G86A 4PZYA 5E0OA 1Y5LA 4HJXA 3RIYA 3OZBA 2ICAA 4EHJA 1OBVA 2OAEA 4PZ9A 3U31A 1UBKS 5BSGA 1BQEA 3ICQB 3MTQA 1BWQA 4PLCA 5EZQA 3V00A 1QO0D 3TDMA 4O4LA 4WK0B 5KU1A 4IIDA 1P9OA 4QXOA 1XKQA 4BQOA 3CURA 1PDOA 3IJRA 2BEVB 2VTKA 4LXUA 1T10A 4MPDA 2EQ5A 1K4MA 3PC8C 4XQ0A 3ASSA 1I94B 4B44A 2C1ZA 2H59A 1E1NA 1G16A 1ENZA 3DGFC 1Z56C 3H9JA 1CB0A 2FVYA 1RRGA 4IP0A 3GARA 4MINA 4IDCA 4KLAA 2VC2B 2XMCA 4Q5IA 5F5NA 5IC6A 4BGEA 1YNOA 2B8TA 1ARZA 4N39A 5GM1A 3SP1A 4R51A 4AECA 4KWTA 3ZW9A 2VUSA 3SHQA 1R27A 1QQ5A 4QUBA 1G7SA 1X7YB 1LVHA 2JAPA 4C3OB 5B5SA 4CL2A 1OOEA 1H42A 2PMDA 2I8LA 3TKYA 2ZUWA 1G5RA 5F1KA 2JVJA 3I2HA 1XO1A 4GYWA 4CXMA 2LZ0A 5AHXA 1E2DA 1UM8A 3I04M 4MWSA 2E4YA 2QG9A 4QYIA 2QR2A 5DV9A 4PQEA 3RE1A 4G1EB 3W6UA 1B8PA 2BFEA 2IYRA 2SICE 3OPNA 4CMIB 1VIMA 1GGKA 2H8GA 5I3ZA 2XDYA 4LHYA 3THSA 3AR2A 2DYKA 5EE9A 1KQFA 2ZTMA 1EZ4A 4A6EA 4OHRA 4BMSA 4YAOA 2QNIA 2FGKA 3DCIA 3HDVA 3WHLA 5HUHA 3OD1A 2GYUA 5EKDA 2PK3A 5CM9C 3AHDA 1RWPA 2G5CA 3JARA 2I76A 3KL2A 4ZTBA 4FGWA 1T3SA 3B6JA 2HV9A 4Y2XA 4GZ5A 3RBXA 3CVUA 1ZR2A 3SNKA 2NZ8A 3EGDA 4AUMA 3LPDA 2WDPA 1XJWA 4Z4FA 5CDYA 2Q3FA 3C74A 3AFIA 4KO3S 3RBAA 3AJRA 1FX1A 2YWHA 1JN0A 1R8XA 1RM4A 4JQYA 1FQWA 4PLZA 3TB6A 2MWMA 4Z4YA 1Z8HA 2H06A 4QE3A 5CLQA 3W4JA 1WRBA 3QFCA 1JT2A 1K7FB 2PYZA 4L5AA 5KB3A 5ENVA 1JEOA 5CA1A 3Q11A 1KMHA 3MT9A 4BC0A 1IDOA 1WXXA 5A4KA 4X05A 2BKLA 1S2DA 2LP4Y 2AOVA 1M2JA 3B6MA 3V7FA 5GVRA 2X1LA 2PT6A 4DG9A 1XK7A 3F9IA 2CXQA 3TZHA 4HDRA 2OFXA 3ACDA 3QX8A 3NORA 4XM2A 1W29A 1RMYA 3QVOA 1X38A 4RFVA 2E82A 1SOAA 1T9CA 2XMPA 3T8YA 4JJAA 1VPDA 2GPYA 3OFVA 5G0SA 3O91A 5TEWA 4G1FA 1H9BA 2I8CA 3DTTA 3H5TA 4U2GA 3D5QA 3AZQA 3KL9A 4CDMA 3NASA 3URMA 3I9FA 3QEMB 3ZNPA 4CQMA 2G5GX 2H31A 4KO8A 1M1YA 2ZIEA 2Q3JA 1NUQA 3KEFA 5HWSA 3GBVA 4RMJA 3CW8X 2NAPA 4C7OB 2FEOA 2OUIA 5JD5A 1ELOA 2DECA 2HIHA 2NO5A 4OP3A 4LDZA 1IZZA 3KKKA 1AHIA 1XPJA 2FU5C 1EPUA 3NRJA 1RC8A 1K0FA 5DTQA 3I5MA 1R18A 5K0EA 2XY4A 5K9ZA 3DNFA 1KVUA 3VMFA 1O95C 3KOWA 4GOND 4HSEA 3TF5A 1V2GA 1NBWB 1TADA 3LFHA 3MXOA 4NEHB 5D6OA 3NNSA 2WTXA 3ZG6A 1GRCA 5T4EA 1K5PA 5KWVA 3HVJA 5KPJA 3TGPA 1TKAA 4AJKA 5KTTA 4DY4A 4W5NA 3OC6A 2QRGA 4NZOA 5DHTA 2DIEA 2AFRA 2HR1A 2OHJA 4PPFA 3MD9A 1U5AA 4RF2A 1NJ8A 3G4SB 3RADC 1NQOA 2ADMA 4PZPA 4XUGB 4ZC8A 1G55A 1T36A 4DUPA 4N0PA 4YUAA 4A91A 4CTJA 1QC5B 4JJ8A 1GARA 2QJRA 2X8BA 1SU8A 3LO5A 1EK1A 2DFDA 3KB6A 4ZHSA 2BHLA 3CMCO 2HSWA 4MVJG 5A5EA 5G0UA 5M2QA 2YNMD 1J2RA 3F3KA 5JASA 2FEXA 2I87A 4OMFG 2Y4NA 1NLZA 3ENZA 2IW1A 1FOEB 4H60A 2VBCA 5EMLA 3LDGA 3X2SA 4CIWA 2OAQ1 2VJCA 3DO6A 2LKDA 3JCZA 3L4EA 3MGGA 3PDJA 4PCVA 2X0IA 4YDSA 2M6LA 5CFMA 3U4HA 1GNLA 3JWPA 5ELXA 3P19A 3IMKA 4JBGA 4UXHA 5K7SA 4FHGA 5EINA 2X8KA 4J0KA 2NIPA 3FVQA 2R1VA 2VDPB 5D2CA 4QPZA 2ECOA 2GRJA 5FP0A 3B82A 3KO8A 4HUQB 1SCIA 4ID3A 4EKYA 5BN4A 2G04A 1NXQA 4YJ3F 4PXYA 1A77A 4RGQA 2NVUB 2OXCA 4YFYA 1TK9A 3PHIA 2Q6VA 3C0KA 3TZCA 4E09A 4EECA 1J99A 2OBFA 2Z6QA 4F38A 3KQWA 3QVKA 4PZAA 3TAUA 1X1AA 3WMGA 4DV7B 1QK4A 1TJYA 1OHHD 3EXEA 5ALDA 4W7SA 1IEVA 3H84A 4RHTA 3QIVA 3G0DA 4FHEA 4JP8A 4K05A 1TW3A 2BIFA 2HBRA 4D7AA 1Z6YA 3H3XA 1PR4A 5ENDA 3RVBA 4B71A 3AJDA 1V7PC 5CVUA 1FC0A 2WOOA 5KEIA 2A78A 2VOJA 5F35A 2YINC 2YZMA 1BH2A 5D87A 1MW9X 1UOOA 1VA5A 3AUAA 4U2EA 3WWCA 3U44A 2FZLA 1M6VB 3W5UA 3I45A 4JSTA 1XZKA 3IP6A 4TWZA 2I1VB 2GPBA 4BFZA 1DXOA 5BSKA 4N5NA 1MB4A 1MQ9A 3LT1A 2AB0A 2FE4A 3AEKA 5J4LA 1CBUA 1ISFA 4PSDA 5KWJA 5IYPA 4OPSA 1GAWA 3BMOB 2C4UA 4HDKA 1KF0A 1A4IA 1ZK0A 2ZJ0A 3EZ7A 3T3PB 2QWXA 2OTLB 1DP4A 1UXOA 1GZHB 2C96A 3NJRA 4KDEA 3WFZA 2AR7A 2ZI5A 5DEIA 3OZUA 2H1CA 4MUBA 1E3TA 1IN7A 4G7XA 3H3JA 1NMSA 4ZVQA 5JAHA 2X22A 5H70A 5HRUA 5H8WA 3PTAA 1JLRA 4EENA 2OXIA 2J33A 1KY3A 4P22A 2FKAA 2UDPA 1WB9A 4N76A 3LL4A 4MEBA 2DUUA 1XPUA 2QIOA 2WDZA 1JG4A 5JTTA 1DWQA 3ZDAA 1BVHA 1UPUA 4F6RA 1A96A 2Q27A 2VPWA 3A9UA 3R7LA 3DP9A 2HJ9A 3H2JA 1LZKA 1K0UA 5TGTA 1ZOOA 4JENA 1N57A 2BHRA 4P0QB 4X00A 3H0KA 2Z98A 3K0CC 1K06A 4NFSA 4X20A 2C77A 1MX3A 4BNLA 4LJAA 4HAVA 1WOMA 3UAGA 1XQYA 4O2BB 1IRXA 2FEWB 1ADCA 2RK4A 1XQ9A 2P2SA 4IG9A 1YZGA 2I3AA 3WO0A 4L73A 5ECGC 1VMKA 3HUFA 4G89A 3HO1A 3LM8A 1QE0A 1OX5A 3QPWA 1CV2A 1KJJA 3HSYA 1FYFA 2I6XA 3CUVA 3OHMA 1A2OA 3RUHA 1U5BB 2ZRGA 1BHO1 5HZAA 1UDCA 3JZAA 4RDIA 2D5CA 4YCJA 1TI7A 1R9JA 3K94A 3KT3A 1PJZA 4EDHA 1FDVA 5JU6A 3VNVA 1OA0A 1RBZA 2FVXA 3F96A 1Z7BA 2OBLA 3L46A 3RSZA 3I37X 5IUNC 5EWLB 2CUNA 3PXCX 4FUTA 2BTEA 1JRLA 4FOOA 5C9ZA 1QP7A 3DTVD 3EGIA 1EXMA 2WPDD 5COQA 4AJHA 1X2BA 4U02A 2YCBA 5ED0A 3LHFA 4CCYB 2RH4A 4GPAA 1MO6A 1NM5A 4YJHA 5BYJA 4OP7A 3Q9NA 4O2BA 5HIMA 3BCFA 4EB6A 1MAHA 1KFBB 1MO5A 2LV8A 2RBKA 4B2PA 4BFLA 4OOVA 2WRZA 3SIXA 4UVDA 2WTUA 3TQIA 3HDQA 4WGGA 3R6JA 1RM3A 1G2IA 1MT0A 1OFUX 1VLMA 1F06A 4ZZIA 4F2PA 1E62A 2IZ7A 4R0NA 2XWPA 4X1KB 5G0TA 4HNGA 5SYAA 3WL7A 3MBIA 2GJAA 2BOVA 3SJCA 4AVYA 5A6SA 3D4PA 4N9QA 7ADHA 1NVGA 1ZSNA 2C4TA 4A0QA 2D5LA 1L5HB 2VJPA 3CWQA 3DFZA 2OYRA 2QRZA 4ND7A 2PE3A 1UWKA 4HVAA 5BP7A 4HAOA 1OBCA 2H17A 3DVSX 3HG7A 3T54A 1XR3A 4BMYA 2FRDA 3PT9A 3GLSA 4WADA 3DA8A 2E4VA 4EPTA 5LZ5A 1V25A 2WYOA 1G41A 2Q9UA 3GUZA 3IP1A 3JRXA 4M6WB 1RRPA 2PJUA 3NTQA 4B4DA 3VV2A 5IK2D 3GCGA 4YAGA 4NJEB 4EKNB 5HJ7A 5JQGB 3QX3A 2QRHA 3E9NA 2Z09A 1Y8RB 3O4RA 2E18A 1VDZA 2B4RO 4X9XA 3CR3C 2EHJA 3LW7A 5KMGB 1JZSA 1EDOA 3PKIA 1LWNA 3IOYA 2C5EA 1DIHA 1M2KA 2KSQA 3KJQA 4H77A 4BJ5A 4BCCA 4BRZA 1ECBA 4HRXA 4WZZA 3L1UA 1PYOA 4Q1BA 4W1PA 4EUKA 2QUIA 3GDGA 3DE5X 3PQCA 3BH6A 3HGMA 3TNLA 3AHFA 2OKCA 2BM1A 3CX3A 5JHGB 2C82A 3C3KA 1P1CA 2XYRA 1HFEL 1MRNA 3EXHB 2OO5A 1JB9A 1OB0A 1M2WA 3A2KA 2CHGA 2ZJOA 5D3KA 3ZWPA 4F4CA 5K5EA 3OJXA 4WKGA 4HZIA 2HSEA 2IEZA 1JIQA 2X5NA 1LPBB 4FNGA 3BULA 1O95D 1Y98A 5ALZA 4D0RA 1EWQA 4ZI7F 5THXA 2YRWA 1T5DX 4ZCRA 4P08A 3O82A 4C76A 4OV6B 5JRJA 3WADA 1G8YA 1XN4A 1H0HA 2QP9X 3FKSD 3KZMA 4UVGA 4KP7A 5EJGA 2ODQA 2Q2NA 5B1EA 3A1PA 1Y4DE 3NTOA 4MV8A 2IV2X 2YHAA 5I9NA 1S02A 1JHYA 4D46A 3I58A 4KO4S 1PKEA 3F3SA 1RKUA 2ZU0C 4XWKA 4FBMA 2MINB 1PJCA 2KX7A 3STUA 4O4JA 1JH9A 3A9SA 3C3JA 2WSSA 1RS0A 3UENA 2UUBB 1YUMA 4M1TA 4P53A 1NBMA 3NQ41 3PV0A 5C46F 1PSZA 1MMFB 1BKYA 2IBTA 2CCGA 4BZXA 1H6CA 3MXTA 1LDYA 2GK3A 3A3YA 3KWFA 2QE7A 1ZUD1 4M21A 2ZFUA 3NHPA 5FI0B 2FQYA 4FFSA 1L5RA 1U2EA 2ZE7A 4DJAA 4MHTA 2GARA 2LTAA 4ZGBA 1EUQA 3BL8A 3ADOA 3HJHA 4BO3A 1WLYA 1X0VA 3DMHA 4RTJA 1L8QA 2CJPA 1Z29A 1P7CA 3DOHA 1CY2A 3SBEA 2DLCX 4JHLA 2KS6A 3PFNA 3HKEA 4JEUA 4QYWA 4R1MA 3UATA 1Q6YA 2ZBUA 2V1UA 2GA8A 4GMXA 2PSSA 4OM8A 1XQBA 4U7HA 2GZ3A 2J3MA 4UMVA 4LAFA 3I2JA 4AL4A 3AF6A 3V7AA 4CM5A 3PXXA 1B8UA 2VDJA 4BLTA 3BCSA 5EJ9A 1IZYA 1PNVA 2PKQP 1TM4E 3M3HA 5KOHB 1L1EA 2IOHA 1EP1B 2Q4TA 3H1PA 2XCTB 4KPFC 4BNDA 1P4RA 4ZV7A 1BS2A 3L1KA 5LWQA 5IT5A 5CM2Z 4IL5A 4H2DA 1CDOA 3ZK9A 2ZBGA 3KE9A 3SIWA 3EOBI 2IKSA 3LJKA 1TE2A 4I08A 3SJZA 4UAGA 1Y8QB 1XJ5A 3BGDA 1F2DA 4CETA 1WKBA 3N8GA 4BX3A 3KOOA 4BO2A 2ZE8A 5ARCA 2I6SA 1TTQB 1CUHA 1BE1A 1CUIA 2OXTA 2A67A 1Z13A 5DCUA 1QORA 4C7OA 1Z5GA 4R84A 2IUUA 5CP8A 4HI0E 3R5JA 1KOFA 4R7TA 1BX0A 5E8JA 1ZI8A 3DDWA 1XOIA 4MA0A 4IIJF 1Q0PA 3QF7A 3B48A 2QL7A 1C4KA 4XPIA 2JC3A 1VSTA 3F1KA 1CNEA 4WTOA 4PY2A 2ZWOA 3LV8A 3OQ6A 2G9VA 1JL3A 4HEQA 5C1PA 5IANA 3HYNA 1QYXA 1X7ZA 1R4NA 4WA7A 1NQXA 3PX2A 2YUIA 5HYVA 1HNXB 1K8ZB 1CVRA 1G8MA 1QPBA 5DHQA 1VBKA 5EP2A 1NUPA 1PNOA 1WKCA 1TU3A 3MHPA 4I55A 1GUBA 1SJ9A 2BGRA 3T5TA 2CT8A 1CP2A 1ORRA 3STXA 2I6UA 4WN3A 1E1YA 4RAOA 4Q3AA 3ROMA 2JFUA 1KYVA 3KUDA 3DZFA 4WCDA 2FZ4A 3Q9UA 2X7XA 1CU1A 5KC8A 2R8XA 3B13B 3PC6A 4ZZ1A 1E9DA 1E5VA 2V74B 3K8ZA 3R0JA 4FSHA 4NAVA 4PYKA 5KTRA 4JEMA 5DRTA 1L5LA 3N2EA 4M9CA 2FWPA 5IM4F 2CXRA 3LUAA 3AHJA 1ABFA 3FTDA 1JYSA 2NN3C 1EFVA 1OJLA 1DAIA 1TTHA 3EH1A 3ZW7A 3ZXYA 3D0QA 4PFJA 1HFJA 1KPIA 1PJ3A 3SNHA 5HHTA 2FMFA 1NR5A 1GPJA 1GN9A 4OYLA 2F3QA 2B30A 3FZGA 4Q7QA 3GFTA 1YAJA 1P75A 1RXVA 2GZ1A 4JQSA 4UNPA 4C4TA 2X7JA 5BRAA 4UDXX 2OA0A 2IUSA 5FJIA 4MO9A 4RNCA 3LF2A 2CFSA 1FNSA 2F9FA 1TYZA 3G6KA 4UJ3A 5ALYA 5L3RA 1EFLA 4G0VA 4HQ6A 3GBSA 3FCEA 3RRJA 5B55A 4EB0A 1F8FA 1NQWA 2RKBA 3O1LA 2QVGA 4GQAA 3UXMA 2AT1A 2JFZA 1WCV1 2FPGA 1VLVA 3AX6A 3ENWA 3KDAA 4HAYA 4I14A 2BFEB 5I7EA 4ARIA 3EVZA 3HCBA 3FPFA 3KRTA 4NMHA 1DDIA 1F4LA 5FV7A 2YL2A 4NNOA 3MWDA 5FJJA 1J1UA 3HN2A 2JI9A 3A6FA 2VF5X 3IUJA 4KG7A 4P4TA 3TIGA 4XAQA 2WIDA 4ZYTA 5TT1A 2EYUA 3WL5A 3F3YA 3H5WA 1UBFA 4QASA 5I8WA 3IERA 5KVCA 2HWUA 4DV6B 2ZJ6A 4WZ6A 2I2WA 4LYYA 2IU0A 3FDFA 3WL6A 4HG2A 4JDUA 4AS3A 3BJRA 3E5NA 3N2GA 4IIXA 1UD3A 4L5YA 4EOGA 1JFRA 4KQWA 2F1LA 3EVAA 3B7GA 4NMXB 2XBMA 4WLVA 4XMYA 2HO4A 1ZO8A 4G0UA 4CLRB 2E1RA 2RIRA 4O29A 5KSPA 5FNZA 2OFPA 3N0VA 2HBYA 4UEKA 5L95A 4N65A 3HV2A 5K3BA 2GN2A 3IP8A 4V3BA 3RIHA 4O4LB 3AGQA 3G05A 1KAQA 4KR9A 3VOAA 4G81A 4MLDA 1IWOA 3VYWA 2VTBB 2IYAA 1LDMA 4BXOB 3VZCA 1T0UA 4KZPA 5JHHB 3AFHA 4HTAA 1JXAA 1HG0A 1Z88A 1EIWA 1V3UA 2D5AA 4PGMA 4RVSA 2FE1A 3ZWWA 5HUQA 1OUMA 2ZYGA 4KDFA 5C7YA 5MF6A 2SKCA 5G4KA 4P1VA 1YX2A 3E9MA 3OC0A 2GTPA 4IUDS 1NB0A 1Z2DA 1BU5A 1G98A 2H57A 2O1XA 3FYUA 1NYLA 3STVA 4D9BA 5B3LA 1T5OA 1E2MA 4IKOA 3ZCUA 3WIUA 5FNVB 2VPYA 5AKHA 1D4OA 1R7RA 2UZIR 3BBPA 3DEZA 2YW9A 3Q7QA 3L5KA 3OHPA 4TLAA 2Q21A 4R0MA 2MSDB 5HZGA 2PGAA 4FHDA 1CE8A 1TYAE 2C0CA 5HZBA 1TMGE 3GLRA 3GGOA 4BFXA 1A2KC 2XH8A 3DVQX 2W2LA 2HTEA 2FWBA 4WZTA 2XPCA 4GPBA 5KBYA 1JQLB 3OCXA 4FYYA 1FVOA 3LWDA 2FOXA 3ZY6A 1AO0A 2E5WA 2YMPA 5F73A 2FPUA 2NT4A 2DUJA 3DZGA 1FE8A 1XKLA 2CVFA 2OPBA 3BE5A 4DCMA 5BWCA 1XTSA 1W5AA 1RP1A 4FZRA 3SKVA 3RS5A 1IUKA 2IY9A 1MLDA 3TFQA 2ODBA 1ZGZA 2EYQA 5DYWA 1JR6A 2XXJA 3GV0A 2P5YA 1P0CA 2ENUA 2H1VA 2XYQA 3D3NA 4TYYA 4NAHA 1HQDA 3MWEA 3N5KA 1JHZA 4DSNA 5KX5A 4JL8A 2JBHA 4R6WA 3UCEA 3RJMA 1U0HC 4YR7A 2LD4A 4UPEA 2HKIA 5EFZA 1M1NB 5JDIA 3EPKA 3LD9A 3E1KA 4ZI5A 4AZ0A 4FKZA 4CMBA 4Q9LA 2D2IA 5BVGB 1XQWA 2FWAA 1K7XB 2O8DA 1O2DA 4DCCA 3E2MA 2BGLA 2WIJA 3JQ8B 4V1CB 1IHPA 1X8JA 4QU5A 2YWRA 4D74A 4TMVA 3J81k 7REQB 3IQWA 2YQ4A 1WZEA 3E15A 1X6VA 1ULBA 1VLHA 1KU6A 2AK3A 4HB4A 1AU9A 1VKZA 3UA3A 4DVJA 3I61A 1NWHA 1YBMA 3NAZA 2HWWA 1U31A 2BMEA 3PFWO 1CYEA 1VP9A 3MJ4A 2JFYA 4E12A 1KXJA 4KNVA 3SGLA 1L5YA 4C03A 3C8ZA 4MGYR 4X3OA 5MN4A 5H9VA 4OHZA 1Z2NX 3O47A 1N2SA 2E4AA 1CS0B 4D79A 5IJ9B 1YI8A 1PCXA 4L6CA 2H18A 4QECA 3RS4A 2VPXA 2VRBA 4O5OA 4R8SA 4RVUA 1Q83A 2B1JA 1B3BA 3QV2A 1E92A 1Q3KA 1SWVA 3CF6R 3OTHA 3PG5A 4AU1A 2AFIA 4F06A 5IMSA 1KXZA 3WYFA 3FIUA 1XMSA 3TDKA 3BHIA 5IHXA 4YXFA 3KSZO 2GNPA 1YZUA 4RXUA 4ZCSA 3UANA 5E3HA 5FFFA 4IDPA 3ANMA 3VFDA 4HMQA 1XTJA 1EA5A 4EI9A 4DCPA 1L5QA 1BMFD 1SAYA 1TOAA 1JEQB 1K6EA 2C7GA 2P2NA 4OQPA 3EGWA 3MUOA 5FQNA 1U7WA 1ZNYA 3SY8A 3QSYA 2JLSA 4I1RA 4ZQGA 1QONA 1Q86D 5HRAA 3PPXA 2C7RA 5E6UB 1YGPA 3HXLA 3HJBA 4N9WA 4KRXA 3W6PA 4ZGGA 3PF9A 4W5JA 2V45A 3OQBA 3CVWA 1MW8X 1L1QA 3U56A 1FNCA 1EA7A 3AJ9A 2TRSB 2KMLA 5DH9A 4J0EA 1SUSA 3G5UA 4XQFA 1G66A 1X1CA 4Y67A 2FEAA 1UBLS 5CB0A 3G0HA 5A0TA 1V0FA 1JDNA 3GJRA 1FTQA 1NURA 3LBFA 4BFSA 5IFLA 2YCLA 3DMNA 4JIGA 1YKSA 3CSUA 1UBOS 3BF7A 3FF4A 4FJ0A 1KETA 4OB8A 1BN6A 3TNDA 4WN9B 4MS1B 5JC1A 1XAIA 4DTIA 1IEXA 3GLGB 2XDQA 2NV0A 2JJMA 3W2EA 3AP1A 2HNKA 1ECLA 1PIWA 1UKYA 3DOJA 3ITEA 4MGHA 1O4VA 3AF1A 3C87A 5JAQA 3S2GA 3NCHA 5FWXB 2QTTA 1EBFA 2XTMA 3HZHA 4QULA 4AMGA 3PXBA 2XT9A 4RPIA 4I0WB 5AJTA 3JAWA 2AA3A 2EDCA 4ZJPA 2Q5CA 3EGEA 1XMOB 3OG9A 1DUSA 1MA0A 4FWIB 1U0GA 2NO1A 2QSUA 5DTIA 5LA6A 4ZJYA 4O1MA 3AKCA 4WXMA 3OMXA 5EXSA 5EWMA 3S7ZA 5CA0F 5LXTA 4IDEA 2B21A 5FPPA 4ZQIA 1BW9A 4Y8VA 5C80A 3OHSX 5EIFA 1W4BA 1NMQA 2WFAA 1DQPA 2EL7A 2ZB4A 4S0ZA 1NLMA 5T3YA 4C4ZA 5YASA 1E6KA 1RWOA 1L9KA 3K0FB 3KXKA 1J0AA 3FUCA 2GK4A 3GEBA 1QK5A 3CZAA 3I5AA 2Z3WA 1NOKA 3KVVA 5KVAA 3CEMA 2PYDA 5FUWA 2WMOB 2OCYC 1EHYA 3SS9X 4L8JA 1RBMA 2JGEA 2CVOA 1KSGA 5F33A 4GRIA 1SBHA 3WICA 3EBLA 3LUKA 1H2YA 1YZTA 2IW3A 4BV9A 2HRQA 3H9CA 3SU8A 4EJSA 2FUG1 2NXCA 3CLVA 2DJ5A 3EIEA 4P4SB 5E2IA 3MSCA 3D3EA 1WUTA 4JLUA 5JQWA 1OF1A 4BVGA 4MUXA 2ZL5A 2OORC 1G6KA 4RE6A 4NY1A 2MCFA 4JZKA 1COWA 3G2PA 1U7PA 1DO0A 4OGKA 3RAPR 3T7EA 1HTTA 2WIBA 1VPTA 1MR3F 3STWA 1GTSA 2AEFA 3O03A 1M2VB 2QRMA 2HUNA 4MB0A 4ERNA 2HCRA 3TI7A 2FH5B 4HH1A 2C8KA 2AOWA 3K0SA 1ETHA 2GXUA 4HXGA 3OURA 1UK6A 4QL3A 4RBNA 5FTNA 2BGNA 4DANA 4M1ZA 3MCAA 5LOVA 3PQDA 4OPVA 4BX2A 1MAVA 2O8BB 4S2EA 3DUFA 2CXXA 3U6KA 4HAZA 4BFUA 1BMQA 1OTHA 221PA 1NSFA 3ILSA 4MS3A 1RLMA 3L7OA 4EKEA 2ZYRA 2PS0A 1U0EA 1DIRA 2EW1A 2RB5A 2VSYA 3G0CA 3MB8A 4Z1MD 1YKGA 2XGJA 4PPQA 4PINA 4ETNA 3URKA 2PEZA 2HFKA 4DADA 5KTMA 3T06B 1ONOA 4JJFA 5BNFA 3X1WA 2V3CC 3F6BX 3V8QA 4LY9A 1WETA 2FOIA 1T2NA 1NM5C 3V4VB 4KOEC 4OXIA 1UMCA 3HYCA 3KZCA 3HN6A 4FINA 1CK4A 4FLEA 4A0SA 1EB9A 1P4GA 2IZOA 1SUCA 2NVWA 2GPSA 2OCGA 4QVAA 4J1QA 4XXHA 4YMUA 5K3OA 5LJLA 1AKWA 2Q0XA 4DEXA 3RC9A 1RXIA 1TVCA 3P97A 2D5IA 3P5BA 3MFQA 4A10A 1L2TA 4PWZA 3M8KA 1R0LA 3RFVA 4CUJA 2W6MA 2HPAA 3MYYA 4TMKA 1C30A 2DHDA 2RHHA 2WJHA 3H87A 4G0MA 4GXRA 5I7WA 1N7IA 1UD2A 1X74A 1JALA 1VL1A 1LUAA 2JA2A 4EZBA 1KAGA 2GR9A 1OYWA 5EHZA 4BO7A 2NW6A 4ZQEA 1WNFA 1NAHA 1C9KA 1LS1A 2QTVB 4A9AA 3DMPA 4L3OA 3C5EA 1ZIOA 4ZC1A 1DELA 4QHSA 4AROA 4QT4A 3FCXA 1CUWA 1VL0A 1QP8A 2G83A 4UZEA 2GJ8A 4R4JA 3VBEA 4RM2A 5JATA 4LBZA 5C8YA 4EPYA 5A3SA 2XF8A 1KTVA 1BSVA 1EJ6A 1IHDA 1UWCA 1VL8A 4R8VA 5JSYA 4UM9B 2E5FA 4PFQA 2ZIWB 4WSOA 4NVRA 3BB4A 4ZAZA 3T15A 2W2QA 3DONA 3VH2A 2AC2A 3BXGA 2F9LA 4M22A 1PR2A 1GLVA 1NB9A 4OUDB 4A8JA 3I4CA 2GO1A 2RGNA 2CDRA 3HO6A 1TNDA 3VR1A 1W49A 4DYVA 2G1JA 2X8AA 4M1KA 4ASUA 4EABA 1L8XA 4DQLA 1DG3A 3NVKI 1RQ2A 4ROSA 4HYQA 1SKAA 2FGJA 1H6BA 3DO8A 3HGQA 4R2IA 4ZFNA 1YJ5A 2F8LA 4N7JA 2NTVA 3H97A 1T34A 2NQ8A 4O6VA 1A9XB 1CETA 3RVOA 2PKQO 1Y82A 1WMFA 4P3NA 4HATA 1WCIB 4ARZB 5LP1A 5CYOA 5LYJA 4EJ2A 2PLRA 3GBPA 3LWNA 4AN0A 4OLAA 1TZCA 1T0IA 1WZIA 4CHTA 1SNYA 1V37A 4NCHA 5JW6A 1O6GA 2YOHA 4YP9A 1D8AA 1OC2A 2RAFA 1CLUA 2Q07A 1ZN2A 1YTLA 1X9HA 3HB4X 1BDJA 4EBBA 1V4VA 3TTXA 1D03A 1QVZA 2O2GA 3UHOA 3KP1A 3WL8A 3ZGXA 1A9RA 2H6EA 1LWOA 3K09C 3RUDA 5C1OA 1FXUA 1JEYB 1YZKA 4MI3A 3QK7A 4IDNA 1LPPA 2WV7A 2IS6A 2QVCA 1BJRE 1SUPA 4RLFA 1VE5A 2AYXA 2JFVA 1NW3A 2X6RA 3L4BC 4PZZA 3UXEA 2IDMA 3TTYA 4B4KA 2YASA 2HF9A 3W6OA 4BNNA 3QTTA 2OXRA 3TSYA 2MYTA 3THWA 2QUKA 3JQ9C 2BMVA 1VJGA 5EHXA 2JCYA 1EDZA 1SKYE 4KV9A 4DWOA 4LF4B 2Q5EA 4RH0A 2XUIA 4Q48A 5KNLA 4ZKDA 2B99A 4QT0A 3TLJA 4C6RA 4B85A 3IUYA 1EQAA 3FRIA 3NTLA 4RPKA 4XA8A 2AXNA 4PZ0A 3LX5A 4F3TA 2R8BA 4G67A 2QF7A 3JVIA 1SM4A 3NBFA 1Y8ZA 1TPYA 2FR1A 4MV6A 3AESA 4XN0A 4ALNA 2O3RA 5K3EA 1NLUA 2AJDA 4LQ4A 3SM9A 1DWUA 3FPSA 3ITDA 2DKFA 2CXTA 3KAQA 4NG4A 4QG3A 5AHOA 4J9VA 4QD3A 1EFPA 3IKTA 3KLNA 1EE1A 1VCHA 2Q8NA 1EFAA 2FXIA 1YB5A 1TB4A 3I9KA 5COAA 4C5CA 1RKBA 1MDFA 4R3NA 4S1VA 2P6OA 3K1TA 3WZ2A 1UM9A 5U4XA 3G9ZA 4EW1A 4E5PA 4MRNA 2XVMA 5DX1A 3TD9A 4EA9A 4QAQA 4BNMA 1I7NA 1MRSA 5C0OE 3X1DA 4Y1RA 5H7XA 1UBJS 5J2UB 2ADOA 5IF9A 1RZVA 3GLFA 3L7YA 3DEJA 1U2GA 2YJ4A 3O4HA 4GO1A 1CQJB 1EE9A 3JQCA 1GA1A 5AW4A 1Z0UA 2O2IA 4KQXA 2C9YA 2QVLA 1EVEA 5AM1A 2Y68A 4YRBA 1GA4A 4JBYA 3GLQA 2I55A 1N8NA 3DVRX 1VBNA 3B36A 2WSYB 2WTEA 3E5RA 4NU5A 1JLHA 5G3YA 4C06A 4OH1A 4GOMD 2VYQA 1OXVA 3KQUA 4F3KA 1EK5A 3CVVA 4WKBA 3IPAA 3EK2A 5FT9A 3L06A 3WXBA 3VKVA 4CU5A 2HPHA 1B2RA 1U3VA 1NRIA 1XA0A 2CNNA 4NPAA 2DFLA 3K9QO 5FULA 4BZZA 1TQDA 3RVKA 2A3NA 3UICA 4MUNA 2O4CA 2JI7A 4YLEA 4BAZA 3D8RA 4E1AA 2I33A 4ZRMA 5I8PA 2JJ2D 4JMQA 4GBED 4IXDA 4Y6GB 3HA7A 5K09A 3A1NA 4YC7A 3OCVA 1VYUA 4RGVA 3UG7A 1G8AA 1M74A 3DEIA 2XOKD 1ODKA 4RD6A 2VNSA 3LRXA 2H1LA 3S28A 2JFFA 4M7OA 4CGZA 2I2DA 2ZYAA 3V4SA 1OBOA 4BOYA 1PUXA 1IC6A 3DDZX 1K8XB 2ONYA 2QLMA 3V4LA 3SXPA 4H7IA 3CB4A 3HNPA 6PFKA 1F1BA 3QUQA 5E7QA 5AD1A 4EG0A 1JFLA 1E6LA 3DQPA 1TJ4A 3STHA 4NENA 2AI1A 3VR3D 4A8JC 2JKYA 2HC9A 2HPZA 3FB4A 4V24A 3TMYA 1G6OA 3UXYA 3B2QA 1PVDA 3AR4A 1PUIA 4MAAA 3M6XA 1JG7A 3CV3A 3QNUA 3K0AB 3DZJA 1F20A 3AI1A 2Q5JA 2YVKA 2ROQA 1Y7IA 3WWOA 3OTWA 2YHBA 3G59A 3CLTD 4JLOA 3TKAA 4CTKA 4CLOA 1MIHA 4E0BA 1NDHA 1EX1A 1NVBA 4D3FA 3MLAA 3W0LB 4KV7A 4I5DA 3PNOA 4DJJA 1VRVA 4H7DA 4URYR 4AJPA 4E5MA 1WP9A 4RTSA 4Q4HA 2RHLA 4AG3A 4W6ZA 2XNJA 3T9DA 3WFJA 5TQ2A 1ISSA 4ZEWA 1QG4A 4LE1A 13PKA 2IHYA 3WFIA 3GLIA 4L28A 3FKSA 1JH8A 2E21A 2OFOA 1YDMA 3PGLA 1IZ0A 1I8TA 1WXDA 2Q1UA 5K1ZA 5HOQA 5ALHA 3OTQA 4QU0A 3A37A 2BF7A 4DFDA 1IQRA 4QPPA 1XMVA 1D4ZA 5B30A 4MMZB 1BC5A 5ENZA 2F4NA 3FMOB 1J7KA 3L0SA 3RQSA 4EMSA 5CBPB 4TTJA 4PX9A 3ZK8A 3DDOA 3R8FA 3FJYA 1X9IA 1THGA 3A36A 4XARA 1BVYF 2ZIZA 2E7ZA 4B3FX 2AH5A 3FGOA 1U7DA 3CMMA 2H3EA 3F6PA 3AOEA 3P0FA 2VYFA 4YCBA 1OH5A 4LFBB 1RYYA 4XTRA 3PRJA 2GBIA 1EWVA 1V9SA 3U1VA 4DR3B 1YVRA 1E2LA 3D54D 3SHVA 1LRKA 1ISRA 1NPYA 2F8MA 1MTOA 4E32A 1IH8A 4X7DA 2NU8B 2C8JA 3AMVA 3KEOA 2J9ZB 4PG4A 4KUGA 2P4QA 4YI5A 3CE6A 2EFHB 3RH0A 1P4SA 4RTQA 2DBRA 1RLIA 2ECQA 2PZAA 4WRRA 4DABA 1SCQA 1QTRA 1UIRA 2HDHA 3QLVA 1WMSA 4KDRA 1E7WA 4LDRA 1G63A 3K0AA 2RFLA 1ZH8A 4PLPA 1X1RA 4NIMA 4PV7A 1MT3A 1UJBA 1YE5A 3U3JA 3F73A 3E8SA 1UT8A 2HIMA 4XVRA 5F3DA 5JXWA 1VPVA 4CM6A 2BGMA 4PGAA 3GSIA 1ZJYA 2Y92A 2WJ3A 3ANTA 3QI7A 1DX4A 5K8VA 4BC1A 3U7QB 4UBLA 4NV0A 2HQBA 5FO1A 3ZE1B 3S5UA 3AY0A 2JLRA 1Y8RA 2H0RA 1N8KA 4DBLE 1LJLA 4CV1A 4KB5A 1TAHA 3TN7A 1MJFA 1YCDA 1I7QB 3C6MA 3LP8A 1XRMA 5LNK1 2B4KA 2AX3A 2PFGA 1MJHA 3VPBA 4D80A 2Y1KA 4M6WA 4N5IX 4B47A 1CPYA 1RLUA 2D2FA 4C6HA 1MV5A 1DT3A 3G9XA 3M7IA 4KL8S 2RC5A 4R1LA 2BGWA 3P9ZA 1M7GA 3DEHA 1IPFA 3CGWA 2VN8A 2A1UB 1T5IA 3F46A 4GKBA 1I4DD 1NG1A 4TXNA 3NI2A 4FGSA 3GJ5A 4MXDA 1NUTA 2HFJA 3EODA 4IEEA 5LIPA 1NA5A 1ZONA 5I7VA 1Y6QA 2BHNA 5H0IA 4LZJA 5C7OO 3L84A 2BE7A 1LW6E 3QEOA 1RHJA 4NCIA 2GK6A 1SQSA 1M3SA 1M6WA 1W76A 2XOEA 3TOZA 4XQEA 1PJ2A 3W5IA 3CMEB 3KOMA 2PCLA 5IUKC 2P11A 1T91A 2W0MA 3SQMA 2OKGA 3CC4B 2ZSFA 4H0FA 3MQ4A 2BISA 1W75A 2WVAA 1SO8A 4PYMA 4Z4SA 4S1OA 4W1QA 5ELLA 1U0FA 4GM1A 4Y2HA 4ENPA 3E4DA 3B2NA 1JG2A 3G2NA 4EEZA 3ZE6A 4MGIR 3BGWA 3KBBA 2V4ZA 2WHYA 4OI4A 1LDNA 4W5QA 1J42A 2ZI4A 2C7PA 2HQSA 1F3LA 3TLBA 1XP5A 2HJSA 1Z6TA 2P78A 2VRNA 1JFTA 1NVTA 2FHPA 3H04A 5I9BA 4NBNA 3KQNA 1WUYA 5ECWA 1IEQA 5I9TA 3F2VA 1TYEB 4H7EA 3A1FA 4UCQA 3UJBA 4BPBA 4RDXA 1KDTA 2XNSA 1G59A 2G76A 3D81A 5CLGA 4XZ3A 3QFSA 3L02A 2C0QA 3D7LA 3HFGA 3N07A 4IIUA 2NYUA 4V0KA 3HLTA 3U81A 3SSAA 3DLTA 2C54A 4FFRA 5BUSA 4DLWA 4CGYA 2GLTA 3MJTA 2O7SA 3PXAA 5EPEA 1TFUA 3TFWA 5BVHA 4K9KA 5AH0A 4B4UA 1KPGA 2NU6B 3C97A 3UJCA 5DYYA 2FA9A 4EA7A 2V3VA 1E3WB 4X64B 3V5NA 4N12A 1EUDA 2DY0A 1DEXA 1NBHA 2RGEA 4UBIA 5TS3A 1N9GB 4IEFB 1PJLA 1SGWA 1RPTA 521PA 4U63A 2IPNA 3DB1A 1L5OA 4LOAA 4G0WA 4XSHA 5K45A 4UUBA 3K0BA 1P2BA 3EJ6A 4HWGA 5CFRA 5L3ZA 1Z7WA 2HSGA 3USZA 3PE3A 1ZOPA 5H83A 2OWEA 3W9UA 1MH9A 2QTMA 4IWYA 2IE0A 4JCCA 1Y3CE 5H68A 3C1OA 4I9NA 2J6BA 5ALTA 1Q6ZA 2O5CA 4U3JB 1ZD4A 4GBGA 2E89A 3BC9A 3VR4D 1TO2E 4C0XA 1CVIA 1U5CA 1JG6A 3AFNA 1ODFA 3SSOA 2X1HA 4K26A 3D4OA 4UCWA 5CVTA 3LNNA 2AOUA 2AUTA 2PSFA 3ABRB 5I5GA 2I9KA 3SS7X 3OPYA 2V65A 2VH1A 3F78A 1IWBB 2AIRA 3VR2A 3HXTA 1F0YA 5LYJB 1E9CA 2UUPA 4RA6B 4C7XA 4ND2A 1Z8NA 3CH5A 4XIYA 3K32A 1MVNA 3EMKA 3DL7A 2QI9F 4G5QA 4X20B 1G6HA 2C2HA 2P65A 1NQ5A 4KFCA 1SCUA 1M1ZA 1M6YA 1ZJ4A 4H4EA 4KRYA 2RJNA 1SQ6A 1XE1A 3G5AA 4MO2A 4QYSA 2HN9A 5M34A 5AK5A 3TW0A 4B4OA 3U7RA 1U8EA 4WDRA 3U3XA 2OGZA 1H22A 4C14A 1TLFA 1JZTA 5BQ5A 1F5SA 2EX0A 2P3SA 3PGVA 1AGNA 1QFSA 2MU1A 5BNTA 5C1BA 4XTCS 5CURA 2AR0A 3SZOA 3NDJA 1O1YA 2RHTA 4W82A 4JLAA 1JQEA 3V34A 5FHQA 1QQ6A 5K0BA 3NC4A 2Y0CA 4KITB 1JV2B 2ODTX 4JQOA 5CDFA 3LU1A 3PVZA 3MJRA 1IXSB 4C4AA 4GI1A 1BVUA 3BCRA 3NWJA 2JZOA 4LW8A 3B3AA 5LDGA 3ZJ4A 1AKVA 4RIEA 4DNXA 3EVEA 3ESXA 4CEIA 1I0IA 2VKTA 2CJWB 4GS5A 4JROA 5CFQA 2EZTA 3BEOA 2FOLA 1KMNA 1XLUA 2Y9PB 2PUDA 1AS3A 3BMOA 3DL4A 1WQ4A 3HNRA 1L5VA 3K0EA 4Q4DA 1TC2A 1ZGJA 4TXHA 1Q7EA 3F6YA 3QYFA 1MC8A 4ZIRA 3B9PA 1L4HA 2WZCA 2E48A 3H16A 4U9HS 3PXUA 1W36D 1XWWA 5KYXA 2QTLA 3FNBA 4TQAA 3W4IA 1DXQA 4PSKA 5CEFA 5LLDA 1AK9A 1RYMA 1FFCA 1JLKA 2EFYA 1T3LA 3CNBA 3HRHA 3NB0A 2PUEA 1TM5E 2NV6A 4LBYA 4EW3A 3GA0A 1QCYA 2IEYA 1V5GA 5REQA 4A27A 4KIWA 4TZKA 2RGYA 1SA0B 1U8FO 1Y1QA 2HJGA 3T3NA 1B73A 2GXAA 5CT8A 1UD8A 2OM6A 4FOLA 1SIUA 4FYMA 1FXWA 1UMCB 3TSCA 2RDMA 3TNJA 3TS1A 3FNIA 2C29D 2L0XA 3HVUA 3C6ZA 1E0KA 1KYIA 3OJCA 4JGBA 4DR6B 1I1NA 2LBPA 2BTQA 4I4LA 2J7PD 1PLKA 5E2BA 3SBOA 4I1YA 4K9PA 2HA3A 3OECA 2ZTNA 2JFHA 5IWAB 5LQSA 2B4AA 1V9CA 2PZFA 3BILA 3PGKA 1SOVA 3H2GA 1KBZA 1X42A 4R5MA 5AI5A 2BJVA 1GDDA 1Z4NA 2C98A 3BWMA 3PUKA 3NNNA 4QOSA 5KSOA 1JR4A 2IHUA 1GQ2A 5IKEA 2B2XA 2QMYA 1EEXB 1ETUA 2DWUA 1QR2A 4W5RA 1GGJA 1GDTA 1ZHOA 5DHAA 3AY3A 2JLCA 3Q8WA 1M0SA 2D3TA 3G7SA 5CW2A 1A0OA 3KNZA 4CQMB 1PHRA 5CNMA 2PRJA 1GSAA 2OBRA 3DAFA 4U2DA 2VTDA 4CF3A 4MYRA 5FUXA 3UZUA 4M9RA 1CIVA 3FMVA 3UJ7A 4H6XA 1ORTA 1LLFA 2CYAA 1SXJB 4ZCMA 2AG8A 1UBSB 2TECE 3CKMA 1KQSB 3RFTA 4KPYA 3I62A 2ZJFA 3NO4A 2GJPA 1E69A 4XWYA 2NUAB 2JLVA 5F4MA 4WFIA 3JAKB 5EXXA 1CF4A 3WGNA 2JHGA 4FT4A 2BFWA 4CVNA 2FZWA 5CX1A 4E46A 2L82A 4EG7A 4D3ZA 2IRWA 4F5DA 5KQLA 3QU5A 3RHFA 3H6HA 1YZQA 2KJQA 5M5BA 4M0LA 1H2ZA 1ZAYA 4XW2A 5DWDA 3FYUC 4UEQA 3W7VA 1IXYA 4B75A 3N6RA 5IMBA 1TKCA 5E1MA 4FEAA 3W5VA 2BUCA 3NBMA 1U6JA 3ZHZA 2O2XA 2VJKA 2CXHA 3CKLA 3GFBA 1RCFA 1PGOA 3M33A 3DAPA 5IM5A 2IKQA 3ZR4B 4FB4A 4GRAA 1G5FA 3R7NA 3L0PA 5DGCA 2ABWA 1FS6A 2BW0A 4N18A 1B2LA 4RDJA 4JR0A 3SX2A 2DTXA 1P5JA 1CRLA 3SOZA 3ACCA 1KVSA 4JNCA 4DNFA 8OHMA 4B6GA 2D3WA 4GMDA 4XJTA 1CD5A 5HQ3A 5AN9A 4MV5A 1M1YB 3ABSB 3BTVA 2AZDA 4QFBA 1EUYA 3OFND 1CNMA 2Q3BA 4TL6A 1GZ6A 1W93A 4RUKA 2JK0A 2WJYA 1GAEO 3VISA 4M0UA 3WV5A 2Z43A 1KO7A 2R87A 4YK7A 4P4UA 2H00A 5JO0A 2RGDA 3LS2A 3IIJA 1TEVA 3ZD7A 3J7AC 4WJKB 3BXOA 3UYLA 4WZEA 1C0KA 5JBNA 4RPJA 2YN0A 2HEGA 4D97A 1UDAA 3ISVA 1ZCAA 4FFLA 1W35A 1G4HA 1H8HA 4WNIA 2Q45A 1MH1A 2WU1A 4ISBA 5EVJA 3N7TA 1HF3A 4MS4B 3AK4A 1XV5A 3SOPA 2PUWA 2VHVA 3K8QA 1BDIA 1PQYA 3LLSA 3UAYA 2ZCUA 4UW9A 1FUKA 2ATEA 3AV3A 1M6EX 2W2KA 4IUBS 4R9RA 4FIDA 5E6UA 4JMPA 3UQYS 3HR8A 2ZJ7A 4C0LA 1K9MD 2JBWA 4FQ7A 4BNJA 4LOLA 5LQMA 2V6JA 1GO2A 3EUEA 4ER5A 1QIDA 3D5TA 3AWIA 3NG1A 1JEQA 1ZUIA 3P27A 1FVHA 1PDVA 2Y9MB 3I04A 3L9XA 5JLJA 3KETA 5A88A 3BD6A 4WZAE 2I6QA 3JQ7B 3CNQS 4FK8A 3R3ZA 1GZ7A 1H2XA 1N2CE 3OX3A 1ONBA 3V7YA 5LNK6 5A4FS 5JJCA 4D9HA 3P94A 4TYQA 1C9EA 3PDWA 4MIYA 1AV7A 1XWFA 2GA9A 4RKQA 4BE4A 4JX9A 2V0CA 1M6NA 5ER6A 5AHRA 3VPHA 1HGXA 1UF9A 3HE3A 3PVSA 4OA5A 3ZV5A 4CUKA 5B2FA 4MVWA 2R00A 5CGQB 2OLKA 4S3MA 4D9FA 2I5PO 4LNAA 2QMUA 1R0BA 1LDGA 4NYMQ 2A7XA 1AO3A 1XCPA 1LH0A 1MA3A 3FDZA 3HRIA 4HLDA 4L6AA 2YBEA 3AIOA 4OA8A 3F90A 1PZEA 4JC5A 4EJFA 2NZWA 1I8DA 4ONEA 5G02A 4F3NA 2J6HA 2OG2A 1GUAA 4Z1MA 1PFGA 1WEHA 1HL7A 4QYIB 3RVNA 4V38A 3GFOA 3HDHA 1THZA 5HIJA 3GGSA 4REQB 4UBMA 2BWJA 1UD6A 1N3LA 3M4NA 4M9ZA 4B3CA 3K3PA 5T5QA 4AP6A 5A3RA 3NIBA 3FOZA 3K09A 3DR3A 1P2TA 3KCQA 1Y3BE 2QM3A 2WF7A 1GTL1 2AMVA 5JSFA 2VQFB 3IEUA 4EH1A 2DWQA 3BJEA 3LCUA 4ZANA 4XKVA 4WKOA 3JQDA 3WJAA 3H9UA 4US0R 1JEJA 2J3IA 5DO9A 4FUQA 3GEPA 1YVPA 4CKBA 1JR3A 4NULA 5I9IA 4Z99A 4IHAA 3U60B 4D9GA 3KV3O 2M1XA 4L76A 4YIKA 4ZA2A 3K9CA 3R7WA 4OHFA 4DDTA 3CRNA 2LCIA 3MWJA 4YMIA 5HKOA 3LVBA 2BEVA 5A0FA 5JCXA 3W6NA 3ROZA 2FKNA 1VHQA 4BNIA 4II2A 1OLUB 3HL0A 2B92A 2CNLA 1UPBA 2AGVA 4JWTA 3W7AA 2CKMA 3WLHA 4DW8A 3GLIE 3SC4A 3CXUA 3FMGA 3WAJA 3CH6A 3F98A 5CCDA 5AESA 3FOCA 2G9RA 1HMYA 3IAAA 2ATIA 3P7MA 3ZDBA 3VVMA 1D2CA 1YQWA 2FX3A 5INTA 5KO2A 3HCWA 2H65A 5D84A 5DFAA 5TE9A 4YJKA 5A5DA 4QM6A 3CLRD 2G08A 2IOQA 2LWIA 2FV8A 1MAUA 5JAMA 2QYHA 4OF4A 3C5WP 5AW5A 4M89A 5L53A 3KYDA 2IP4A 2LDBA 3GEMA 3UMMA 4PCUA 3VNBA 5J58A 3HBJA 1P5HA 4KYTA 3HJNA 5A05A 3DOUA 3GA5A 2P7IA 3M6AA 3UMRA 3X1KA 2QI9C 4FN4A 1XB2A 3A7DA 4MUKA 1XK6A 4A23A 4CKWA 4O3MA 2X5XA 3CKKA 4JJZA 1UBUS 1ZNXA 2PRYA 4YRTA 2Q7DA 3WQQA 3E48A 1O54A 3FFWA 4RD0A 3QUBA 4LJ5A 4PQGA 4ZO6A 5ANRB 4CWAA 1EQ2A 3X43A 4AICA 4HV4A 3I5YA 1P1RA 1IBSA 4JMLA 2H1RA 3IKLA 4L9SA 5CT6A 5CFPA 2DWPA 4HRAA 1XL1A 2QV0A 3VQTA 2HLDA 3AQ4A 4K9QA 1FP6A 5D86A 4DUZB 4HMPA 1VB3A 3F8TA 5KKNB 2CZQA 3T99A 3KJHA 4LZNA 4Y6PA 1HYBA 3QU2A 1SBNE 4IIVA 2FG6C 4EPVA 3QKSB 4KREA 2VTBA 4BXOA 3KJFA 4I5EA 2VRCD 5KIAA 5K0SA 4H1VA 1MJGM 5T8KC 3F4BA 1UJMA 2R6R1 3H1TA 1CZKA 2Z5VA 5ITZA 1BQ3A 1J9EA 5AVTA 2XB9A 2PMBA 3IEIA 4KWIA 3VZDA 1YC5A 1CUJA 2FUCA 5FPSA 4X1IA 4QJ5A 1J21A 4TMYA 4HDMA 4R1TA 1IAVA 1WCXA 3FPLA 3D3QA 3RIXA 1GZ3A 3CUUA 3LPNA 4KQHA 1CUAA 1NW5A 1VLJA 2XE7A 3JQFC 3QXXA 4XGQA 5DP2A 3GJQA 3G1UA 1ONSA 2Y0BA 3OO0A 5EY5B 4YREA 4DNPA 3UMYA 2ISCA 4RS4A 2O0JA 3I42A 2RHDA 4O2AF 3V76A 1EEHA 2W0SA 4U6QA 1IBLB 3AY6A 2FWRA 1DKPA 2X8JB 3AR6A 3R3YA 1NVVQ 2Q4OA 4GC5A 4OHXA 2PXAA 2QORA 3GGDA 4QODA 2P5SA 2MOKA 1ZJ6A 1QH8B 4IJQA 3ZI7A 3LC2O 1KEZA 1AF4A 2PWAA 4WOCA 4BB6A 2EDAA 2Y05A 1E18A 4PLYA 4V0SA 1OGYA 3UHPA 1K5GA 3WP0A 4ALKA 4IF4A 5CDGA 1W0CA 1QYIA 2XRYA 3LW8A 4IOJA 4CFSA 2FPGB 3KUXA 1YA6A 1SVNA 1Y6ZA 2O3UA 3EVFA 4M4SA 2OMEA 2DQYA 1YMQA 3BD9A 3CRMA 1GKIA 5J1TB 4OXXA 3WLNA 4GLBA 5SZIA 4CF4A 4AY5A 4BQFA 1LCIA 1KH3A 4DSAA 1YUNA 4OSPA 1IXZA 1G20B 2K5UA 3U39A 3N05A 3BJMA 4XLZA 4JKYA 4EUHA 1E0AA 2CLLB 5LMZA 1X39A 2CCJA 2VPPA 3OETA 3OTIA 3PICA 4HDSA 4M0FA 3L0IB 2AXEA 1Y3AA 2H2HA 3CISA 1G21B 2X5OA 2ZVPX 1ZVKA 1CY0A 1KJYA 3D6HA 2OT3B 4NARA 4H9GA 3K0CA 4W99A 4WKPA 1TRHA 3LDAA 3F3MA 1OLOA 2WJPA 3BXHA 3O2SB 4NJOA 2Z4TA 3N75A 1ZM9A 3S99A 2BD0A 1KI4A 3AI2A 2P3LA 5I3CA 1Z7EA 3J80A 4B7ZA 1DU4A 1AN9A 4F3CA 4IH4A 5JECA 3L1IA 4G4IA 3PLAE 6GPBA 4W1RA 1J0BA 1K8QA 3LPLA 2A33A 4TKZA 4H7HA 3WIBA 2V54A 3HCFA 3WIDA 5J2UF 1EDEA 2I99A 4K9DA 4DQDA 5CNKA 3A3NA 3DXXA 2JDIA 2H4FA 5AQEA 3CPWB 1Z5VA 4MS4A 1ZH6A 3CCBA 3EGOA 3QMPA 1RQNA 3QWBA 4G0PA 3VC7A 4BZPA 3FUWA 2JS7A 2IVFA 3A9RA 2NOAA 1N2ZA 2ZVJA 1OWOA 1QZUA 3WR5A 2OHIA 3WVNA 2BFCB 2H2FA 3E22A 3TIFA 4D6PA 3I01A 3H6KA 4JYPA 4Q6BA 2X2EA 3HB1A 5E9JA 1YC2A 3BIXA 3WQSB 4Z9FA 1B3RA 3FY4A 3IUEA 1MNQA 4TQ9A 1Z8FA 5ITWA 2F62A 4JUCA 4UAUA 2SECE 5FA8A 2OVFA 4L27A 1UC4B 3BHMA 4NP6A 1IDN1 2KLBA 3ND8A 3RR2A 5LU8A 1AMNA 3D4LA 1ZH2A 2WM9B 1A98A 2IIPA 1ILWA 1WUHS 3JQ7A 3PRKE 1JWBB 4WUVA 3V42A 3ZIAA 2ZAMA 4OHUA 1KI6B 4QELA 4C3VA 1G9TA 5L40A 1N0WA 3FTCA 2XVAA 2JJQA 3CN9A 2WWIA 1HE3A 4PPGA 5HMMA 4I99A 3UAXA 3NKVA 3K05A 1F4VA 4FOPA 4HFJA 1AMOA 1MVLA 1LU9A 1T9ZA 2GYWA 4YP0A 2G9QA 1JX6A 3DR5A 2POCA 3H9QA 5K3CA 2D6FA 5FOSA 1XNQB 5KYYA 1E1CA 2WUEA 3M6UA 3QFHA 1UEJA 4EHFA 3ZWCA 3A2NA 3D6AA 1L5WA 4F6LA 1WLSA 5JNVA 4GWGA 2FI1A 3Q7SA 4R16A 5EHGA 2Z8XA 4RK6A 3KQMA 5BO5A 4DK1A 1L4YA 1MB3A 3O4FA 5JXJA 1Q15A 4XNFA 1NF3A 2WU8A 1G64A 2ZIAA 2OV3A 3M5WA 4G8CA 4IH9A 4QOHA 5FBKA 2O8EA 2QTCA 4Q1DA 3RYHB 1U3GA 1RRFA 3FR8A 4R40A 2J4FA 1J8QA 1OW3B 1Q2UA 1W96A 2I66A 4QBIA 4OFWA 2IS2A 5TPWA 4BBPA 1AM4D 2PD6A 1SUBA 1UP7A 5D3ZA 5F76A 3T9BA 4BNTA 5A4JA 5AI8A 5CDFE 2ZRNA 3GZTB 4EGJA 2C42A 5P21A 1O5IA 1NAIA 2YIMA 5IBRA 2QM7A 4KXXA 2K2WA 3PNQA 1BX3A 4ER0A 4BY9E 1E1LA 2FPPB 2R84A 1S96A 2OTJB 1DC7A 1U3FA 2AW5A 3NHMA 4H59A 4Q24A 2WHXA 4XKJA 2O54A 4UTRA 1SBYA 1X92A 3H42B 1RKXA 2WSMA 3P4UA 4J6FA 4O4JB 4JJ4A 1VXOA 4Q4JB 2NAFA 1K92A 3FI0A 2QAGB 2IUFA 2IF0A 3PNPA 3VR5D 1K97A 4RQTA 5EUQB 2OYCA 2QHXA 4F2GA 4JLKA 4IDQA 1C1XB 5EVCA 1O96B 4ETIA 5LB2A 4PYIA 3UIEA 3ESBA 1DC4A 3JYPA 4G5XA 1LLUA 2JDID 1L5ZA 3FOBA 4PO3X 4S1TA 4PYQA 3HWX1 3GG9A 3AU9A 1Q95A 1UD4A 1H1LA 1QF7A 1S7GA 3PJEA 4JB2A 4MQ5A 1DKOA 4FDMA 3V2IA 1DRUA 1HRDA 3BC1A 4A6PA 4GLOA 2YX1A 3ZHVA 3F5FA 1J0CA 3AKEA 3PI7A 2RGRA 1BHQ1 2Q5FA 4X7RA 4Q93A 2ACEA 3RASA 1J39A 3T1VA 4HAIA 3VJKA 2Q1XA 4Q37A 4NK4A 1G1AA 2VUUA 3KHTA 4WLOA 1HTBA 1GTMA 2PO7A 1LEHA 1XTTA 3EFOA 2CMFA 3S27A 3UUWA 2FLWA 4JQCA 1VI6A 2DBYA 1GITA 2XUPA 1OQAA 1WY7A 4Z0HO 3R9WA 4HX2A 1H1DA 1NLYA 2O3JA 3ETHA 2QXUA 5DCLA 1TVKB 3PHCA 4JJKA 1YIDA 2P41A 4O59O 2GS9A 5HUJA 4MPRA 5KX5F 1N33B 1JE1A 1GQSA 4CMKA 3CRZA 2EP7A 3TX6A 1KK3A 1DC6A 3GFSA 2XNCA 1NJ6A 5G1OA 1ID8A 4F45A 4UQPA 3ZHCA 3OCZA 3A1TA 4NV3A 2JN9A 1FQKA 2KB0A 3IOCA 3L92A 1GGFA 2YV4A 4TKOB 1T4CB 4MI9A 3GCWA 2CHVA 1AXEA 1SRRA 3JPYA 3R6DA 2UVPA 2VF7A 4WPGA 3T3HA 3VJRA 1KE2A 1DAPA 4RSGA 2COEA 2PL3A 2VAVA 2X6XA 3CSDA 3S70A 3IC5A 3PA8A 4ZO7A 3WLLA 4UZFA 1FNMA 1LZLA 1UR5A 1FRNA 1XVIA 1IATA 2UXCB 4OSEA 3SDSA 4RC9A 4JLPA 5IBPA 1GL3A 1BOOA 3X0DA 1K3TA 1T5EA 4ZOQI 1SKQA 2WD7B 2WYWA 1R9MA 4L75A 4ZYXA 1YHQB 2NG1A 1Q0TA 4XUDA 1BXZA 1XZHA 4LGCA 2G6BA 2NV2B 4PZUA 3TLGA 3P9YA 1KS9A 2WYIA 1XFAA 2Z5GA 3V2HA 1VIAA 2XA1A 3ZU5A 4CJXA 1NNUA 5IC5A 2FZCA 4QYXA 4EB6B 2XTZA 4JJGA 3I0NA 4IVPA 2C2ZA 3E7DA 2GEKA 1D2RA 2EG5A 1S2GA 2B4TO 2QP3A 2V6BA 2YW2A 3GLTA 3PNLA 4IIBA 2QVBA 4QXRA 5F2EA 5B1HA 3WOHA 4ZICA 4ARVA 2RE8A 3JVEA 5BPFA 1Y1SA 3LUJA 4MR8B 5FL7D 1QHYA 2QRKA 3LQYA 4KFRA 3I6MA 1FS4A 2PZEA 2CJFA 3E81A 3LX8A 3HR4A 3GG2A 4YRCA 1QZTA 1UK7A 1J7JA 2QUBA 4K2HA 2DEUA 3MM4A 3KAJA 3ORQA 4NFYA 4L08A 1UC5B 1ZHHA 4RU1A 1SC3A 2C4MA 1PJ6A 2HXYA 1EZZA 3H4VA 1HDEA 4M2LA 5JISA 1MFPA 4WAUA 3W6ZA 1ADBA 4HAWA 1E4YA 4PTZA 1EGAA 3QVJA 1E3SA 1E1RD 4G84A 5J43A 2IWHA 4BN5A 4FILA 4DM3A 5CYGA 1OXTA 5DN6A 2INGX 3A0RB 1W2WB 5DF1A 1IN6A 3EEBA 1EE2A 1E4OA 4Z0NA 3FVWA 3MD0A 2B78A 3WB2A 1IWPB 4EI8A 1HH4A 2AJCA 4H3VA 4QXAA 4JI5B 3VR4H 5JG7A 1EUDB 2WG1A 4LJ7A 3V8MA 3MWLA 4TLEA 4KPGA 4UTPA 4P0PB 3GFFA 4RA6A 4PC7A 1PQPA 2R7MA 1JR2A 3EA5A 3BCHA 4KGXA 1KJ8A 2Q4EA 5GQSA 5FOTA 3T4XA 5CG1A 4BLRA 4I1UA 3NETA 2UUAB 2CEAA 3AC0A 2VUHB 1O03A 2NP7A 3FAKA 4DHWA 1ECFA 1P0MA 2GWHA 2WHQA 1Q1NA 3KR2A 4NV1A 5F77A 2PT5A 2VK1A 3WK5A 5KSZA 3SIRA 2X14A 2PRIA 2YRFA 4OUKX 2ILVA 3KQHA 3RPEA 1A4XA 4ADSG 3DE0X 3QLUA 5L6LB 3C3WA 1N5IA 4FGLA 1Z4PX 3AF4A 3GGPA 2PWZA 1HLPA 2GEFA 2V7QD 2OQVA 3Q6NA 3VR4A 3BK1A 1T2UA 1XQXA 3LKBA 5KOJB 2PO5A 2V58A 3NMUF 5F12A 4EO4A 3OJWA 1YQDA 4Z7QB 2QT0A 2DPYA 3NHRA 1UJ4A 2VDRB 4N7RA 2CDAA 4DLXA 1M67A 4CTOA 1S8OA 2GKSA 3L49A 3AVVA 1GQFA 2J41A 2P7HA 3E7WA 5K0CA 2XQJA 4KIFA 4FI3F 1BD3A 1P29A 3GRVA 3IFSA 4D4IA 2ZYTX 2PHZA 2X3UA 3BREA 3T56B 3LMKA 5I7SA 1E3WA 3WGLA 2WJJA 1Q0HA 3AW8A 3PXEA 2C78A 1AK1A 2XCUA 5F5XA 3ZBTA 4CKCA 3WLOA 4F7WA 3ZE7A 2DSNA 1OT5A 3HCAA 3HBFA 4M7RA 3H1EA 1KKUA 3JQAD 4LDQA 3WO1A 5FAKA 2H0QA 1RXCA 3C39A 2W2NA 1P2SA 2E0IA 5DM2A 4GI7A 5T57A 3NIDB 3TKLA 2OFWA 4PZLA 3ZE0B 1O0CA 1AMUA 2P8JA 2F90A 3O75A 5TY0A 3VAAA 1FFWA 1NDUA 4GMKA 4DJ5X 5DU2A 1X3SA 2RHRA 3NBXX 4JWKA 4HUQA 4NHOA 5BV7A 3CCLB 2H1FA 3VVLA 1RFLA 5KUTA 1CQWA 4IV0A 4JCOA 4WOJA 4CIVA 2HUPA 4F5YA 4OX9B 4HN4B 1OROA 5D7BA 1K8YB 4YJ2B 3OJOA 4X60A 5DYIA 4MV9A 5AT1A 2PWBA 1GU0A 1ZITA 4WK4B 1G7CA 1VKJA 3MJFA 1F0KA 3D1LA 1B8VA 3GFPA 4ND8A 3A7EA 2EKDA 2HIAA 2HHAA 2XGGA 2CXUA 2D3LA 3O3MB 3QTBA 3RY8A 3PJFA 5TMEA 5HS6A 3PTZA 3W2HA 4KX3A 3U13A 5DN6D 3WLEA 5ICSA 1WD5A 3FNEA 3WGMA 1N6LA 5BUZA 2WNIA 3F6RA 3ZHUA 4L9WA 4OQLA 4H4CA 2FPMA 1ZUNA 2VZEA 5LLSA 2RH9B 4G5HA 2QTBA 4FR5A 3OO1A 3EVBA 1RXWA 4GE3A 2XUZA 2J09A 3N87A 3W3AA 3KKMA 2WINI 4ZGNB 4WZBE 2W6JD 1X77A 2EZUA 3VI3B 4BBZA 2D4AA 3OY7A 1NN3A 5DMHA 3K72B 4O8CA 2XE8A 1KHTA 1HMPA 3CLUC 4HQOA 5BSTA 4A8PA 3A4IA 4BBAA 4H6PA 4TWBA 3QWHA 1IZ7A 1GPLA 2E6KA 3EZNA 3QNMA 3W3AH 5LLTA 2ECPA 2XWJI 4YJFA 5DTRA 3DF9A 5IT4A 2XQKA 3T7KA 2NU9B 5GZ6A 4JKOA 2YWDA 4DRYA 4BX0A 1C9NA 3L8FA 5KWIA 5AO9A 1XXHA 4OMUA 4FFBA 3RJ9A 5HFAA 1R6AA 2PS1A 3AUUA 3LHIA 3M82A 1MAAA 3M6WA 4HWSA 4KMOA 4TUYA 2OOSA 3AH8A 3P0JA 4LOKA 2NZVG 2VK4A 3CZRA 5LBTA 4B34A 5A02A 5GVSA 4PU0A 1T8SA 4DKJA 3GPDG 2CK3D 1T1IA 1FTYA 3PVCA 4WW0A 1O94C 3QFTA 2OHVA 3QVWA 1WPXA 4RA9A 5KNCH 2PSHA 3I9V1 3MGAA 4M0EA 2JG3A 2J5KA 4CM1A 4EKGA 3QELA 4GGPA 4U5QA 5CDUA 1DWOA 4B79A 2CRVA 1DOZA 1IONA 2WJ4A 3IKJA 4X54A 1PKXA 1WSAA 2WJGA 4XB2A 2AE2A 3ZCSA 1T5LA 3NHFA 4OK3A 5T4HA 1K28D 2VBTA 3SMQA 3HCDA 4WK6A 4DDVA 2I29A 5KYWB 1IN1A 3MRSA 3HACA 5CXSA 2FPLA 1QLJA 3CP2A 1E8DA 1I3KA 4OMDA 4HE6A 4UNQA 5BN5B 3UB4A 4EMTA 4G7WA 3SC6A 3SVZA 3NDPA 2VHWA 4MQBA 1NHGA 3FWHA 2HGSA 2HMTA 1BHJA 1EBBA 3DCJA 3IQFA 1LBQA 1Z08A 3PUWA 3PWKA 4HN9A 2XRMA 4GUDA 4XYLA 1VL6A 2ZCJA 2NU9A 4PLVA 4LSWA 3R9XA 4CKXA 1U0SY 2XCQA 1GGMA 3ZTYA 4EYEA 2XAAA 3LQ4A 4YJFB 3IVXA 3T1TA 3KTDA 4GYKA 3WG9A 1P3Y1 3G0BA 3ECAA 3F5QA 3GEEA 4V0ME 3PIDA 5E95A 2BI8A 1K5HA 2YJ6A 1QP4A 5DLDA 3QOWA 3TSAA 4DLSA 2FFBA 1J00A 3MT0A 2CXSA 1M8KA 4Y6LA 2PU5A 4W5WA 1XLTC 4ZQBA 5GJWC 3NTRA 5B36A 4AY4A 2RHWA 4E13A 3GLFE 3PE4A 1C1HA 2P3QA 1TEXA 1PLLA 3ICOA 2DUWA 2W4QA 4W4TA 4YWJA 5ES4B 1OHHA 1ZCJA 1XEXB 3MW8A 4CQJA 1LQ2A 1W34A 4PAAA 1K75A 3DQQA 5D5HA 4YIHA 2NSDA 4GYJA 5KS2A 2DFPA 3EIFA 4HGOA 2QD5A 5J4KA 3Q85A 3W4KA 4MH0R 1QGZA 3G2LA 3E18A 1QB8A 2OB2A 4QTYA 5KQGA 3OJEA 5HQTA 4LZZA 2QXTA 3KLMX 2WUFA 1QUEA 3Q7TA 4QTTB 1VQOB 3RFCA 2PWYA 3D7NA 2P69A 1Y6FA 3R0ZA 2ENWA 1ZOSA 3WLQA 2J87A 4LDPA 4DK0A 1HV8A 4IYRA 1E4EA 1K6MA 3ISJA 5L3SB 3KTAA 3FNFA 3A2MA 3OSUA 1BCSB 1R0KA 4Z49A 3WGZA 5KHLB 5KNDD 2HCJB 1PGQA 2ZT6A 2I54A 2C00A 2ZITA 2OL4A 2IU4A 2BFFB 4H1HA 3D3WA 1W1UA 3M3PA 1JUDA 5DASA 1U8ZA 2NU7B 4KJZA 5FWNA 1BA2A 2OBYA 1UM9B 2TMGA 2X9NA 3HH8A 1VKHA 3I3OA 4LECA 4Y9SA 1MOQA 1JIUA 4FLMA 4L95C 4DIDA 5IARA 5BNWA 3SQXA 1U1CA 3GJSA 4Q3CA 1BWPA 1H93A 1ZRMA 5DHFA 4AF6A 2WTNA 3AWDA 3G2OA 3OF2A 1XRNA 3H86A 2J3DA 1N9KA 3OLVA 3ONEA 3P0RA 3HXOA 1UKEA 1EM8A 2QGZA 2ZQYA 4G65A 2H92A 4JEHA 4BMCA 5C52B 2YIDA 1VSVA 1DADA 2AQ8A 2PGJA 2CDBA 2I4MA 1Q0UA 1DC3A 1T0JB 1TIPA 2R11A 4LMAA 4OYRA 1GU7A 3QUTA 4UE2A 4F97A 2ZYUX 2QNBA 1VCMA 5CLFA 4EHBA 2PL9A 2QY6A 4WUTA 2JI6A 1KZHA 4NYMR 2XYVA 2EXXA 1VHJA 4TQGA 1QO7A 2BZSA 4L4ZA 1URPA 5CYFA 3FJ1A 5EEHA 4KQJA 3H94A 5B6IA 1W5TA 5D8DA 4AC9A 1KHHA 1W6RA 5IDVA 3IEPA 2R1TB 2EP5A 3SVTA 3THWB 1DLIA 1N6KA 1P4HA 2QN6A 3JYHA 2WAMA 1OFHA 2BEWA 4F4UA 1GKUB 4P2NA 1L7OA 2HBQA 1XN1A 2SCUB 2XYHA 3LC1O 4K3UA 4R9UC 1QKIA 2W6NA 2JIMA 4Q9KA 2RGNC 3DVLA 4ZHQB 2IYTA 1Z22A 1CVLA 1CJMA 2GQFA 4EF4A 3L0YA 5B7GA 2NWQA 5KJEA 4X6YA 1ZLXA 2P4SA 3ABIA 4P6VF 2Q0SA 4JB3A 4N3NA 4OHKA 4OQYA 4B3SB 1PVOA 3SM3A 4HWRA 4R2XA 3VAYA 4O8ZA 1JVSA 2C03A 2XKAA 2ZWIA 5DBEX 2KM1A 3TL3A 3FPPA 3ZUPA 1SKMA 4ZT2A 4OJQA 4TV9B 1FZTA 1Q7GA 1XF9A 3H7IA 5IC4A 4IRMA 3OQPA 4RHXA 3O7MA 5LA6F 4AUKA 1EAMA 2B8JA 2BONA 4EYOA 4PR0A 2BFDB 4TVBA 1UFKA 4RNDB 3DBHB 4ZV9A 1XTIA 3D0OA 3JRNA 1NJ5A 2C3OA 4N6GA 1WPRA 1YJCA 2CLOB 1TVMA 2RH8A 3KOYA 1HE2A 1XTVA 4II7A 4WJLA 4J0QA 3KYCB 4TT3D 4EJMA 1QIJA 3M34A 3N9IA 3NP9A 4CIAA 3PUZA 4D3DA 5LSAA 1SHUX 1YV9A 3D2CA 3L7KA 1WBJB 5LUAA 4J75A 3H11A 2O8VA 3BQ9A 2AZTA 3QG5A 5CT4A 5MFPA 4Y3UA 5EIOA 1TYDE 4MYSA 1PJRA 1HSZA 2I1LA 4BNGA 4UQLA 3HUEA 3G2IA 3NJ4A 5F51A 3AW9A 3UJ9A 2FJPA 4MYUA 1V9LA 2OV1A 4DKXA 4RDHA 2JH9A 4G85A 2P9BA 1A5TA 1NI4B 4HDNA 4IV8A 3DE4X 4COKA 3H5RA 4QDOA 4CL3A 3QBVA 1YZHA 4CFYA 1FQJA 3UCFA 4EY3A 4XSVA 2PWPA 3O6VA 1E8MA 4KXUA 3TOXA 2NPOA 2QN3A 1ST2A 1XVTA 3A31A 3GJ7A 3JY6A 1FEZA 1GPYA 1DAEA 2B0CA 2WTBA 1JQDA 4LCBA 5AJZA 5JALA 5K8TA 3CLSD 3A6ZA 4ESEA 4IWXA 1YR1A 1PGNA 1XTRA 1S2OA 3HCNA 2IDKA 2GN4A 2P2ZA 3OM9A 4UULA 2W5UA 4XJXA 4BFTA 1G42A 3C5VA 1G7TA 5CEJA 1VSUA 4MYCA 1D4AA 3DLPX 1FDRA 1O95A 4MVJF 3PXDA 5EKUA 3G88A 3IS3A 3B1XA 3WRXC 2CC2A 3MRVA 3HJAA 5ESDA 1JHXA 1EFRD 4H7KA 2IXBA 2QVZX 3DPIA 3CC2B 6NULA 2V7VA 3AY7A 1CEEA 1DIGA 4EHLA 4HGPA 2HW8A 4BIMA 1B16A 3G13A