1QG0A

Wild-type pea fnr
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
HSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
publication title A productive NADP+ binding mode of ferredoxin-NADP+ reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 91
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qg0A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qg0A02
3ZC3A 2VNKA 3MCAA 4LBVA 3JQQA 4AC9A 1R5NA 4B3XA 4RD2A 3W2IA 3QFTA 1GJRA 3PENA 1N8RD 3WYAA 1Q82D 2DETA 4FK8A 3LYUA 1JA0A 3ZZUA 4Y9RA 4RD0A 2BMWA 1WDTA 3AVVA 2OK7A 4P6VF 2C78A 3CCLB 1VQ4B 3CD6B 1KK2A 1AMOA 1QGZA 1KK0A 4TMVA 3CMAB 3WY9A 3VMFA 2OK8A 4MYTA 2QMUA 3ZZTA 3CCMB 1SKQA 3E1YE 1GVHA 1KRHA 4HE6A 1N0UA 4NCNA 4M2LA 3U6BA 1KD1D 1FDRA 3W5VA 2HMAA 1SM4A 1FNBA 2GQFA 2X3UA 4PGOA 3LO8A 1VQ9B 1QGYA 2BSAA 2DEUA 4ZGQB 4RD6A 1OB2A 1D8TA 3WBKA 3CXCB 1XE1A 4YAUA 4Y7CA 3WNCA 3OW2B 1EXMA 4PC3A 3P27A 1JJ2B 1OGIA 1QFZA 3CCVB 1CQXA 1DG1G 4ZCLA 3QFRA 1Q86D 4PC1A 4C43A 3OJXA 4C0SA 3ES9A 2BVNA 1GR1A 1ZM4A 2RC6A 1D2EA 3FPKA 2XNJA 5THXA 4B44A 1VQLB 3CCJB 1EFCA 1E62A 1BQEA 2ZITA 1D1NA 1U2RA 4H9GA 1G7TA 2E1RA 1W87A 2XEXA 4TMTA 3AGPA 2B7BA 3JQRA 1QG0A 1M90D 3B8HA 4TMWA 1BX0A 4QHYA 1S72B 5H5JA 1QVGB 1QH0A 1KQSB 1TTTA 3WBJA 3I1FA 1G7RA 1S0UA 3WNDA 1K73D 4IW3B 1FRNA 1ZUNB 2YWFA 1VQMB 3JQPA 4RD4A 3CC2B 3G6EB 4B4DA 4YAOA 3AVWA 2VNJA 2HCJB 4WQMA 4QFMA 3QSYA 4N3NA 2D74A 3A1FA 4ZV4A 1H42A 4ACAA 1KK1A 4R71A 3WXMA 1KK3A 1DARA 2HDNB 2VNIA 2QTZA 3LRXA 1EP1B 1TLLA 4MYUA 1KJZA 4FN5A 3W2EA 2BV3A 1GO2A 1IJEA 2VNHA 3CRZA 3CW2A 1FNDA 1QX4A 3AVTA 4PC6A 1GAQA 2QEXB 1QUEA 3CCRB 2J7KA 2GPJA 1IB0A 1DDGA 3G4SB 2QN6A 3QE2A 4YAFA 1EWYA 3ZBUA 3OJWA 4M4SA 3U2QA 3VNVA 4DQLA 4B47A 1NDHA 1F60A 2YWGA 4U9UA 2FX3A 1NJID 1E64A 4LBYA 3AGQA 3CB4A 1FNCA 2PMDA 4ZCIA 1FNMA 2PLFA 1F20A 4B48A 1K8AD 1M1KD 4G1BA 3G71B 4PC7A 1UMKA 4DQKA 3VNUA 4ZCMA 4G5GA 4Y9UA 5JBQA 4UAJA 4F7DA 1G7CA 4J0QA 4LC0A 3CMEB 4RCZA 4YALA 1JB9A 1ZM3A 2QA4B 4AF7A 1YITB 1W2BB 4YAWA 1VQ8B 2QDXA 3W2FA 1YJ9B 2BF4A 4PC2A 4LBZA 2OTLB 1R5BA 5DSZA 1EP2B 4HE5A 4Q7JB 4ZGNB 1J9ZA 3LVBA 5TR9A 2NPFA 3V76A 1G7SA 2RC5A 1BX1A 3OZVA 1YJNB 1JA1A 3FJOA 2BGJA 4EH1A 3OZWA 1IJFA 5TV2A 1YI2B 2B5OA 3VO1A 1QUFA 2BN4A 4M1KA 1EFTA 1EFUA 1TVCA 4ACBA 1H85A 1W34A 3CCQB 4RD3A 3I56B 1ELOA 4YHBA 3MHPA 5GV7A 2R6HA 5FA6A 5HXBA 3WNBA 1EP3B 3AVXA 5GV8A 1VQ7B 1QGAA 1W35A 4RCYA 3W5UA 1R5OA 3B78A 1QVFB 3VO2A 3P26A 1QFJA 1VQKB 1OGJA 1N0VC 2CRVA 2QTLA 4N3GA 2EFGA 1YHQB 3W2GA 1BJKA 1DDIA 4BPRA 1ZM9A 1KTVA 2AHOA 1E63A 1B23P 3AVUA 4B43A 1A8PA 5EMNA 3QFCA 1HA3A 3CCEB 4M0LA 2B7CA 1TUIA 4TN1A 3W2HA 4AF6A 3I55B 3U6KA 2YWHA 5TY0A 2VZLA 1QFYA 2EIXA 1YJWB 2DY1A 1Q81D 3CCSB 4TMZA 3QFSA 1VQ5B 5H59A 4LBWA 1VQOB 1VQNB 1VQPB 3B82A 4RJLA 1JNYA 1Q7YD 2VYQA 3SJZA 4P3YA 3E20A 3CC4B 1GAWA 3MMPA 4G1VA 5AN9A 4RD1A 1CNFA 3CPWB 2BGIA 2DERA 2OTJB 1FRQA 3CC7B 3CCUB 4TMXA 1CNEA 2YWEA 4M53A 1VQ6B 1ZM2A 4K1XA 3OZUA 2C77A 4NBSA 3ZZ0A 2BM1A 1I7PA 1KC8D 3J81k 1K9MD 2PIAA 2XNCA 1YIJB 1B2RA 3AVYA 3ZBTA 1AIPA 2BPOA 4FWTA 5KSWB 2DCUA 1XB2A 3W5HA 1OB5A 2CNDA 2BM0A
chains in the Genus database with same CATH superfamily
4LBVA 5DS0A 1FTSA 2VUHB 1U9CA 1THZA 5IXJA 2AMJA 5IUNC 4MQLA 4MCAA 3OA0A 5JAOA 1EU1A 2PVCA 1Z5PA 4BNDA 5GINE 1LLCA 5C51B 1GEGA 4JC8A 4MUIA 4P53A 4BEVA 3K2EA 4R1LA 2ZUBA 3T5BA 1Z5WA 3DEJA 3A70A 1VIYA 4DHWA 4XWWA 3B1YA 1TQDA 1SULA 3OWOA 1RC0A 2I54A 3IAFA 4TYPA 3LKZA 1ZXXA 4E5YA 4E2ZA 2GCEA 1CUJA 1J1ZA 3IBTA 3GQBB 1M2JA 2DE0X 3EQ7A 1W8IA 2P69A 3Q8LA 2OK7A 1YVDA 3OIWA 3Q6RA 4B09A 3NVDA 4G5XA 4R1SA 1A7JA 2JJQA 4P0PB 2FPMA 3VVLA 3VH2A 5JC1A 3FWPA 3RIGA 3E7WA 1VPLA 1AKRA 4MHSA 1C81A 2IXEA 1VI2A 3PGA1 4D44A 1IG3A 4UBMA 1V8BA 4LA4A 1C4WA 3STYA 2XUHA 4AU1A 5IT0A 4HLUA 3SJ7A 5JI2E 2FF5A 3HSKA 1G41A 1ULSA 2NWQA 4Y2QA 3CR8A 4GXQA 4HE6A 4GQBA 1EUQA 5DM2A 5G2OA 2VBTA 2FZVA 4C4XA 4FGWA 2X53S 4OU4A 1CQWA 3DO6A 5I9NA 3NWEA 2R00C 1XZCA 2YFQA 5JNLA 2GQFA 1WKBA 2O1EA 5BN4A 5IG2A 1TK2A 1UINA 1UXHA 3VRHA 1SG0A 2DTXA 3IKVA 4NFLA 3P9RA 4WFKA 1T6XA 3BAZA 5BV0A 3K2IA 4C6TA 3HJRA 3P9IA 4L3VA 4U7PB 4BAGA 4MHTA 1TLFA 5JU6A 1QDLB 1TYEB 3COVA 3PT9A 2W2PA 4CU2A 8LDHA 4ZQIA 1NBHA 2RIPA 4N6GA 1U7XA 2PUWA 4L4RA 4POAA 1V0EA 3N2LA 2WSSA 3ASRA 3H0CA 3M33A 4F6RA 3LW7A 3NBAA 3NHZA 1AXEA 4H35A 3TR0A 3NPAA 4CMEC 2NP7A 4YAUA 4Y7CA 3A7DA 3GLGE 2YVKA 3JQ6A 2IOQA 4CLRA 1AXGA 1NN3A 4QNMA 3SKBA 4G07A 4KO4S 4KW7A 1Q22A 1UD6A 1JEQB 1AQIA 1P3DA 3GGDA 5DNVA 1DTWB 1Z0SA 2PGOA 3GFTA 2Q0QA 4FCTA 5JCJA 4EVQA 4I66A 5G1PA 3RARA 2UYOA 3CCFA 5CITA 2PX5A 2QUKA 1Q16A 3AQ4A 3WQRA 5FWYA 3KQLA 2GTIA 1E2EA 4BXOA 1L9XA 4DIBA 1QRRA 1BD3A 4I50A 5G4KB 2DPLA 3SSNA 2ZR0A 2DU8A 2QTMA 3OCZA 4FOSA 1F8YA 2C5FA 1E79A 2NVUA 2REQA 3PE6A 3WKDA 3TBHA 2J9FA 1IUPA 1D09A 2WU0A 1PS9A 2AD1A 3H2BA 1PR4A 4NJOA 3LVFO 1ORWA 3GLFA 1XRJA 3DMRA 1EFCA 3LUCA 2AV6A 2X2OA 2Y27A 2EKPA 3PNOA 4MW5A 5TT0A 4JVSB 1FA9A 4TTQA 3RGGA 2FWIA 4BNXA 3NBXX 4URUR 4H9GA 2WUFA 1ZIDA 4I36A 4E46A 4HPXB 1TADA 3LHIA 3RF6A 1E2FA 4RK5A 1C7ZA 2RAPA 1I8DA 4LPKA 5LP6C 3I28A 1E5LA 2B2XA 1IRXA 2JZOA 3OCXA 5ILQA 2WMNB 2I4IA 4BQFA 2OPBA 1W5TA 5D87A 4UAGA 1BX0A 2I2CA 5IHXA 1XTRA 3IGFA 1G21B 5L46A 4OF4A 1MMFB 2HA4A 3A14A 1PBTA 5E95A 4RXUA 1ESZA 2FMHA 2VJQA 1GNPA 1QKJA 3C3AA 5CYOA 3L1VA 3WO0A 2HJWA 1AU9A 1FYWA 4GPBA 2YN0A 3FG9A 3R3YA 5ADUS 2CLDX 2F1JA 3WNDA 3RJTA 2R9VA 4QUEA 4NLLA 1SHUX 2HWYA 2XV1A 4FSDA 4KMSA 4D0GA 1GRRA 1B8PA 3W0LB 3ESBA 4RGYA 2ZSHA 4FLMA 5LZ4A 1Z2PX 3OUZA 5BVGB 1X87A 3ESZA 1IHUA 3HXTA 3TK1A 4R40A 2BMAA 2PZLA 4TLCA 4TTTS 4D0NA 3TSOA 4HEA6 3GUHA 3TFOA 1FW6A 2HLDA 3RIXA 3K0BA 1Y5NA 4RHXA 3AVWA 4B0PA 4BO6A 3KUUA 1CJBA 4N5DA 4GAEA 1MGOA 4NC9A 1JJBA 2EARA 1WMAA 5D84A 5AJXA 4N3NA 1U4OA 4PPFA 3DKKA 4WV3A 1XSEA 3NJRA 5HF5A 4ZHQF 3OPYA 1UKVY 3GP5A 1TRHA 4XQEA 1HDYA 1NIPA 3GN1A 5SZJA 2I2FA 1BMDA 1H9AA 2JHGA 4GPAA 3F9RA 1KQPA 2I9PA 4LPSA 4MW6A 3AESB 5LMCA 2WU1A 3FW1A 3BQMB 3KUXA 3MOSA 4CNBA 1OFHA 5IDQA 2VNIA 2C0QA 4OMFG 1A1VA 3A1PA 2NSYA 4L5AA 3EZ6A 1E0SA 3F98A 3WLPA 4HAWA 1NLMA 1Z28A 2L18A 2PH1A 2HK9A 3D0OA 3D81A 3GEIA 1T0PA 3E1SA 2QZ4A 3O2NA 3WX0A 4F8YA 4OU5A 4PLYA 2QQ5A 4QM7A 1E89A 3AUSA 3EARA 4K6GA 3JALB 3QKSB 2VAPA 3AVTA 4JEUA 3ZDFA 1E99A 4JLOA 4JUAA 4GI3A 1Y34E 1SQ5A 4IO0A 1SXQA 3PC8C 4MGIR 4RLFA 2WAXA 4CMAA 4N6OA 4EDFA 1ENYA 2G9RA 4RSHA 1OV4A 4JR2A 1VLZA 1ONNA 1YAJA 2AG1A 1YKGA 3K8QA 3OPNA 4RY0A 3CVWA 4EKGA 2YHIB 3TNLA 2GRJA 2H4HA 1X9GA 4MRMB 4PSCA 4WOJA 1ZUNA 3BE8A 3CE6A 3ETNA 3A32A 3HXQA 4HNSA 3LYAA 4JT9A 2VPZA 5J2UB 1P4AA 1OLUB 2HMUA 5FFFA 2FCAA 3IYLW 2NV6A 3NAGA 1XK7A 3VDMA 4C5BA 2BBOA 4DQLA 3KKNA 1D0VA 1VG0B 3OWXA 1U8TA 1Y0RA 1C7RA 3V8RA 1B15A 3WWOA 3ZDQA 5IYZA 4ISBA 3RS0A 1KZLA 1X70A 2VWHA 3HQ4O 3URMA 1VL6A 3QV1A 1NMSA 4LWPA 2ZWPA 5C7IO 2VSNA 5L40A 2AIRA 4M1MA 4NYIR 2BKAA 2AMYA 1WHTA 2WWFA 3PR2B 3X2EA 2OZVA 4DYHA 1SKBA 3LYLA 3PJGA 1UEJA 4TWAA 3H11B 5CD1A 4W9NC 4FDUA 4PEVA 3TSAA 3GXOA 3IVGA 8AT1A 4JLNA 1CJVC 1EFVA 1KE2A 3QJGA 1JHAA 1Q3HA 1TQ4A 2QM3A 3KQOA 3DE7X 4Q4HB 5CFRA 2VJLA 3ZVMA 2IZ5A 2QTNA 5F21A 1E1DA 1Z62A 2C54A 3DYVA 3HNRA 4NHOA 3TSYA 1CUBA 1JKMA 1AGXA 4JROA 2E4XA 5JBQA 1ODFA 3W8DA 5BMOA 4UAJA 3QEOA 3T0FA 2OV2A 1F2UA 4B3JA 1S3FA 5AW9A 3JCZA 4YCNA 2XAUA 3QKRB 3M5WA 3QI7A 1Q3KA 3DH0A 5CA1A 1JJIA 1SXGA 1MVLA 2W71A 4G25A 2Q3CA 3L46A 4C6SA 4RMJA 1FU8A 1VJSA 2PH5A 5DYWA 4DDHA 1JIJA 3K5WA 3K8ZA 4Q7LA 4KFCA 1F8UA 3W04A 2VA8A 4Y1EA 1VRWA 2ZEJA 2VUTA 1BEZA 4XVUA 4J0DA 4PLHA 1VL8A 4IQ4A 4TT3D 1P1HA 3FHJA 1GZVA 1W52X 2WBLC 3EVNA 4RZIA 3KSZO 1WMDA 1HE4A 4NNOA 2OHGA 2A0KA 1HYQA 3GFBA 5H83A 3PEYA 3DL0A 5EIEA 1E3ZA 1VYUA 2G9VA 1XUOA 2A5JA 5DNWA 4DPKA 5JAPA 4ZKDA 4QQFA 3RSQA 1NRWA 1QH8A 3RQSA 4ZDIA 2BEVA 1XMQB 4P4GA 4G6IA 1PFKA 1YQTA 2NAFA 2W58A 3G88A 1YR8A 5GM2A 3PUMA 1B14A 4X6LA 3FPJA 3PJRA 1LJLA 3CPJB 1MJGM 4R8MA 1YJCA 5BPFA 1XRPA 4ZGBA 5ITZA 2KX7A 3GO4A 1J9ZA 4UVEA 3FXAA 3QU4A 4B6FA 3PXBA 5D5QA 3QPWA 1DX4A 1OFIA 2ZI7A 4NG5A 1TU0A 3ABZA 3LDAA 4D3SA 3DL7A 4CL8A 3OVMA 4C6HA 2ES4A 2IHJA 4KLZA 3SSOA 4YUZA 4ARVA 3PC3A 3GRAA 1VB3A 2X0KA 2EQBA 1J06A 4WK0B 4RJ2A 4E4YA 3NALA 5HFNA 2OO3A 3VO1A 2WD7B 1ENZA 3I8SA 3IP8A 4FXPA 3G9XA 1XZ8A 3U4DA 3C3EA 3ZU6A 1HV8A 3H5NA 3HDYA 5AW2A 1QYVA 1CWUA 2DX7A 2JJYA 2NSDA 5A4JA 4BIMA 1MDFA 3GELA 3N9IA 1ZVKA 4RLSA 4YRQA 1ZL0A 1TU4A 1PN3A 4N82A 4ADSG 4IXWA 1Z6XA 4RD3A 3Q10A 2FMTA 3S55A 1ZI9A 3KQNA 2V1XA 1RCFA 4OMCA 1PQYA 2IGTA 3E03A 4AB1A 3GNLA 4G1UC 2R6HA 4ETMA 5ADWA 2H63A 4I5GA 2FJUA 1T2FA 4NENB 3VC2A 4NU0A 4R2WA 3VI3B 1UQUA 4X41A 4KMOA 3EGEA 5C1PA 4MKHA 2DGDA 4TM7A 4RCYA 1WVGA 2JA1A 4JA0A 2JK1A 3KQHA 1UXJA 4RPLA 5KHAA 4D9EA 3E82A 4RTLA 5AVKA 4EVRA 4OY3A 2Q5FA 2AOUB 1NBIA 1AGPA 5NLLA 2C1EA 4IEFB 3LD9A 2L69A 2VF5X 3ST7A 3GRVA 1VYHA 2PH3A 4V38A 1QVFB 2GM3A 4CEJB 2QUIA 4WEOA 2QAGB 2X19A 4DZZA 2O8EB 4ZYXA 3L4BA 1M8GA 4MR8B 1JDPA 1IY8A 2I87A 2B20A 1LPMA 4CUKA 4OD0A 1GZ6A 3K4QA 1WV1A 2ZSKA 3DDHA 4EW1A 4UHCA 1ZXBA 3DUFB 3O82A 4R83A 4DZTA 1GTVA 1R7RA 2BH2A 4FLFA 2LNDA 3EXHA 3LCRA 4MUNA 4NF2A 3BKXA 2UUBB 3UOAB 1U2QA 3PYXA 4E1AA 1E63A 1SEVA 1W94A 4UXJA 2ZXEA 5ESWA 1ADFA 4X1IA 1UXOA 3I3OA 2DBZA 4UD6A 3L7NA 3STUA 2W9XA 2XNDA 2QLTA 2O8NA 3ZHYA 1DWQA 2E7ZA 2I80A 3JAKB 3ZDAA 1JH8A 3U4HA 3TB4A 1R6VA 5GADl 2V65A 4ZEOA 5IJWA 3FPEA 2Q1WA 2EHDA 3ZE7A 1IXRC 2O05A 1TMKA 4OOVA 1X1SA 1XRMA 2IPNA 2PU7A 1ULUA 3NTLA 1XALA 3FOBA 1WSRA 4BMPB 1ZNYA 3B6ZA 4UHBA 4C21A 4O2LA 1UQTA 1UC8A 4I0WB 4R54A 2GYUA 3IOBA 4KR9A 1PJ8A 3FFWA 5JD6A 4WADA 1X94A 2C3OA 2MSCB 5KO2A 3PXUA 1HYBA 4FJ2A 2WKSA 4TYQA 2X9VA 3DOHA 4IJKA 1DHTA 2R7NA 3KYCB 4RK0A 4KITB 1T35A 2QJWA 4S1OA 4KO3S 3TD9A 5HW0A 5BT8A 2EIXA 4JJGA 4TL7A 4C3UA 2ATEA 2O8DA 5I7FA 2GFHA 3A9WA 1LPBB 3MD9A 3PQ7A 1H8ED 1YDEA 2OWDA 1G8SA 4MQFB 5K0NA 4BNGA 4NYJQ 3MJVA 4J91A 5KQRA 2E5WA 4BZPA 1NW6A 3O9VA 2PRJA 3CEMA 5AJYA 1ZCJA 2OVBA 3DP7A 1Q92A 2CE7A 1AQYA 4YJFB 1P5JA 2PQ6A 3H8VA 1FBTA 1T9HA 4PIMA 3CBQA 3BRCA 5JDCC 3OEED 3GFSA 1K68A 5ULLA 1PJ4A 3TYXA 3QI2A 5JW6A 1Q19A 3IQIX 1DJQA 4FE7A 5J2TF 1V8FA 4XUEA 2CF4A 4AZSA 5IVHA 4OFZA 3I0ZA 5LQDA 1NR5A 1WS6A 3C4JA 3LUDA 4JP8A 5CVDA 2OYNA 1B8NA 1HURA 1OXVA 5KPDA 1RWKA 2VK2A 3PYMA 3LPMA 2IE8A 3GT4A 2AXPA 1JMYA 2Y71A 4X7BA 1P33A 1GPWB 2UZ1A 2WK1A 4B3SB 2WIFA 2C7QA 1Y4SA 5AUPB 1AB5A 1ICIA 1YOBA 3KYDB 5AKXA 1N6RA 5H9VA 5F5NA 5FUMA 5HQ3A 4RELA 5IBPA 3DZGA 3PGLA 3MTAA 1Z34A 2PRYA 2ERXA 4JWTA 4ZQCB 3WGOA 5BSGA 2ATIA 3V48A 3SR0A 1QJCA 1DHRA 1ATZA 1G3IA 3HU3A 5ENZA 1T9GR 5LKRA 3NVKI 1D6JA 4XB6B 1FVFA 3N8DA 1GLGA 2BKLA 4WN3A 4EDHA 2YW2A 2OCAA 1E3WB 2RGNC 1E2PA 3ZLTA 4U4AA 3LPLA 1CIVA 1GYPA 2LDXA 4L9AA 2EP5A 3V1MA 4ZGWA 2KJQA 4QGAA 3MT8A 3MRXA 5ESXA 1KAEA 5ALSA 3FCUB 2EDCA 1MKYA 2YWBA 3VZRA 5E2AA 5IXYA 5EXEA 1N2ZA 4B35A 3AEZA 3UQZA 4RF4A 3ZKWB 1RZRA 2BM0A 1UMCB 3O0DA 2VNKA 3VJLA 4LXUA 3P2EA 3A9CA 1WB6A 1ZLXA 3HJCA 4LECA 1PTJA 2GCOA 2H31A 3DFKA 3GA7A 4OBXA 3IALA 1X14A 5DM0A 3KJEA 2VPTA 4RD2A 2F64A 4QYTA 1BXRB 3GLIB 4QC2A 3ED1A 4DEVA 4F9EA 1L5ZA 1GSAA 1GNVA 2YASA 1BAPA 2QUAA 2D5BA 3FYUC 3E81A 3H6KA 2LCIA 4COOA 4L6IA 1VIDA 2AX3A 2W90A 4BQPA 2JC3A 3WMWA 1RR6A 2VYVD 3LFTA 2VEDA 4PQEA 1WUJS 4MVJA 3ME5A 4OYLA 3B36A 4H6VA 2ILVA 1H22A 3L9WA 1WCXA 3JRWA 2A9QA 2P2DA 2WHPB 3A6FA 3L0SA 2PD4A 2VHYA 2IHTA 1R0XA 3K20A 3W3AH 2QWXA 1U0FA 3JQ7B 4KNYA 1PHPA 3SM3A 1R37A 4X90A 1NW8A 2Q9CA 1WCIA 3NOXA 3IMGA 2HWWA 4QUAA 3L82B 1L5MA 1OC4A 1JZQA 2WU8A 2H0RA 3ZV6A 2Z9BA 3CUUA 2JGFA 3BIOA 2OXTA 4LQDA 2XKJE 4BNWA 5JHHB 3DS8A 1XAHA 1G63A 1P4JA 5IDWA 5A5DA 4CTJA 4URYR 4NJMB 3RRXA 2PTGA 1VJ1A 3O2JA 3R3JA 4MW0A 1SM4A 1E3SA 2NG1A 4TUYB 4PGOA 1P4HA 1WBBA 5AP9A 3DVLA 1KOJA 3SDBA 1J2EA 3ZS8A 1E94E 2I6GA 4TYWA 1NKTA 5JT1A 3V7NA 4RKRA 5L7TA 3SF0A 1QVRA 1KNXA 4F3YA 3E53A 1I6LA 1DU4A 1DKOA 3OH8A 5KYTA 3EFHA 3NYRA 2Y0CA 1POXA 1ZYUA 3OHSX 1L7BA 1S89A 3K9QO 3U0VA 4OB8A 4RABA 3UH1A 3ZGNA 3U9LA 2V0NA 4ZGQB 5F64A 5JAHA 1W1IA 5JD5A 4HLCA 1R6BX 4HDKB 4R3NA 2QBYB 3I6QA 3TLYA 1T8PA 2Z04A 3SBEA 4GH5A 5LKAA 4XM0A 1E6KA 3EVDA 1A5BB 1AN0A 1UKBA 1M33A 2PRZA 1GNSA 3LWBA 2J4FA 2OE2A 4PZZA 1NXVA 2A35A 2P35A 2Z08A 2GJ4A 1KJNA 3WLFA 1X7ZA 2QZPA 3JR3A 3A04A 5BSUA 1X8JA 4JFAA 1PG0A 1RPAA 2DH6A 5DGHA 5CT4A 2CHGA 4AJIA 5C5IA 3O26A 1T0UA 4MVJG 4Z3OA 2AL7A 3OG9A 4A2PA 1Z5VA 1OA0A 4WLVA 2O7RA 3TQQA 1BE6A 2F6RA 4DV7B 3VTAA 3DNMA 2WMDA 1FYXA 3KZMA 1H66A 4NQZA 1P1KA 1N75A 4IIVA 4LJ6A 5IEBA 4D45A 1QMGA 2HT6A 4HPWA 3I23A 3KB2A 4EB6B 3GVHA 3PGJA 1M6EX 1Z45A 2IE0A 2IYRA 4Q82A 2JFNA 2JHCA 4HPJB 4ZOAA 2GJ9A 2ZOSA 5MHTA 1SC6A 3F7OA 1QTRA 4YS6A 4GBGA 1WCV1 1Z83A 4R5HA 1CB7A 1SU4A 2DQYA 3AFIA 4MKXA 1E62A 1BDHA 3SSAA 5J59A 3M6MD 4L5JA 1MGPA 5EIXA 1TF2A 2H5LA 2OBXA 2OC4A 2ZE8A 3BL5A 3O47A 3MELA 4JYAB 3UNXA 2E4WA 4ZVOA 3QXGA 1E6LA 2FR0A 3Q11A 4HUQB 3GZ4A 4PS0A 4X7MA 1Z7GA 5LN1A 2NZXA 3A9VA 4IQ8A 2BONA 3I4LA 2WPNA 1UP7A 2YXDA 4URHA 4E4TA 4CKZA 2GBIA 2FRDC 4RA6A 3L6RA 5MN5A 3JWHA 3G2HA 1SXPA 4XN3A 3FLBA 2C5AA 5AKEA 4YJ2F 1NBAA 4PVDA 1A7UA 3C8HA 4DV3B 3O1IC 4Z7OB 4ZI3A 4AXBA 2Q7DA 4YREA 3KTAA 3FPGA 3MM4A 4FWBA 3ZI7A 4DSAA 1EJ6A 4TKLA 2A5LA 1J70A 3IODA 4YBRA 5EZSA 1HLDA 3H18A 4PR0A 4ZCSA 3KXPA 3V4PB 2ZRLA 4CUZA 4ZZ0A 5U9CA 4IW3B 1DWUA 1IZ8A 2JJ2A 1I01A 1V1MA 1WL8A 1AK9A 3K35A 1ZWKA 3WRXC 4B6OA 4CM6A 2IYLD 1EGVB 2OCBA 3E1KA 4MV5A 4H31A 1SCNE 1N7IA 2CKDA 2X6RA 3OKFA 5IANA 3G6EB 1YZVA 2OORA 5I5GA 4AIRA 2QYOA 4YRSA 1A2KC 1ZI6A 4KAJA 2O2GA 4MO2A 4MUXA 3I9V6 2QW1A 5KYNA 2VNJA 2HMSA 1OVGA 2JARA 2XGSA 2JLRA 3A4NA 4A27A 2WSLA 1O96A 4HDAA 4BX3A 3KFLA 1ZIOA 3VNQA 3NHSA 5KHOC 4OHYA 5E0OA 3OY2A 3E3AA 1SUBA 1QC5A 4HWPA 2XUPA 4D8YA 3HGQA 3SFVA 3BH6A 3WIDA 5K3DA 2PKWA 2EG5A 3ROZA 3VU9A 2QVBA 2ZAGA 3DHNA 1PR0A 1XLVA 4ESVA 3KZNA 2AB0A 4PN7A 1MXFA 2I0FA 1FP4B 3KOOA 2FQQA 1FDSA 2EFYA 3M81A 1JQLB 1K9SA 4NEQA 4EVSA 4RYDA 4QUJA 5I8ZA 1YNOA 4Z4FA 2REXB 1TZJA 2QPOA 2O9JA 5LYJA 3HWX1 5CFMA 2JFWA 1KEUA 2ZTHA 4KB5A 5ALNA 2QZSA 3HYNA 4KQMA 4QVAA 1JEAA 4BGDA 2B2CA 1JR3D 1KO1A 3HZHA 1TAGA 5L4SA 1QAOA 3TL6A 1RKQA 3KM0A 1OLOA 2JIMA 4DNPA 4LF4B 3KAQA 4NBTA 4XJVA 1UZNA 3KLNA 3WK7A 4TS1A 1LI5A 2E82A 5JZ9A 2P27A 3OP1A 4QQKA 1XJ5A 4GRDA 2NVWA 4X93A 1ZVJA 2R8OA 5F77A 5DU2A 4F3RA 1AZWA 1N9ZA 1YJXA 3A05A 3ANNA 2A5GA 3TVDA 4NICA 1K8YB 2ESRA 4WA7A 3KPUA 3R9IA 3G6KA 3CCRB 3UVEA 1PQPA 3X44A 1NMZA 1SVUA 1XFOA 3TAXA 3LAWA 1T5OA 1A9XB 4OHWA 4OJNA 1VZ3A 2AC2A 3DOCA 1XTUA 1LH0A 3FH0A 4OLBA 4KK3A 2ZVPX 4AJ4A 4JXKA 1E5XA 1PFVA 1WZIA 4JIMA 1BX3A 1U2GA 2H9YA 1KSGA 4BCDA 1CEEA 4KLNA 3U3MA 2GD1O 1DQSA 1K3FA 4HYQA 5EMKA 4CF6A 1NDHA 2W2TA 1EVJA 1G2PA 2C3MA 4YJHA 4EHJA 2ZL6A 3M2PA 4B3MB 4NYMR 4YUXA 1CR4A 1ZOPA 3QWAA 5C4MA 3NNSA 4JC5A 3L1IA 2VRCA 3CB4A 1E9FA 2VAXA 2ZZKA 3VVCA 1N3LA 1KXZA 2J7PA 1VGVA 1ZKMA 2JJ1D 3FUWA 3HBAA 3QG1A 3OE7A 4RAQA 1DCTA 3AVQA 2GETA 4ZCIA 3K6JA 1T5IA 2ZP1A 4DIFA 1ZW6A 4E3ZA 5DNUA 7REQB 1Z8DA 4X9XA 3E5HA 1YQWA 4JEIA 2YZMA 3K70B 2NO5A 1RYBA 1Y1PA 2IZ7A 5CXQA 1E1QA 3STTA 4PC7A 4LAFA 2X1LA 1ZHOA 5AKZA 2F48A 3MRSA 3RB8A 4PQFA 1SCJA 4DUYB 2V5VA 3SJCA 4AFNA 2BTEA 3GJ3A 1IVNA 1K3UB 3ZV4A 2C5EA 3CEHA 4OJYA 5IM4F 2H11A 2W2XA 3RUFA 3JQFC 5KKNB 1GPYA 4K9MA 4E5NA 1SZJG 4S05A 1YKFA 1FIUA 1Q12A 5H7XA 1RYDA 5DLEA 2C61A 3N8NA 4PGMA 4QT0A 3NIDB 4ON9A 4Z9YA 2CXTA 2FAXA 4EBFA 3O8CA 1RRPA 1KEZA 2H54A 3M4NA 3KX2A 4IV5A 1IULA 4YRRA 4MUYA 3EHDA 4ZKEA 1P7ZA 2I2DA 4X0EA 1YL5A 1IQ0A 5HUJA 1D1PA 4AF7A 3B51X 1KDYA 5MF6A 1JNXX 2IQ5A 3C85A 4EG8A 1S2OA 4BP1A 3CX3A 3BGDA 3ETLA 4F6LA 5BV8A 4GO1A 4NAVA 4L75A 5EFOA 4OHRA 5FLKA 5JH7A 4HGYA 1R4AA 2CMKA 4IYRA 4DBLE 1N32B 1IOVA 1DPGA 1V8DA 3L6CA 3EXG1 2NLOA 4EW3A 2LDBA 3B9BA 2HQBA 4HNHA 4JLDA 1CEXA 1U3TA 1WD7A 1BZYA 3A26A 3ESCA 3G2NA 1EK5A 3JATB 1DWPA 4C4RA 2ZXIA 2ZYHA 2AZ4A 1QO0D 3MJTA 4Z4IA 1OKKA 2RGYA 3P2OA 1DKMA 4HWTA 3R3UA 5HCUA 4BFUA 2NT3A 3ELDA 5ELXA 1KHTA 3K0CA 4DR7B 1N1EA 1CS0A 3TRKA 2CMHA 3Q88A 4MP8A 3GJ7A 3HB7A 1L7RA 5CGQB 3ZHOA 1ZXLA 1BOOA 1D4AA 2DYKA 2FQWA 2BGUA 3VOTA 3DE1X 3NP7A 2XYRA 3L9XA 2EGGA 3ELBA 5DISB 4L8FA 2PAFA 3IMKA 4ZODA 4N5IX 1IN1A 5KI6A 2BR4A 2FEAA 3JAWA 1RE0A 2FWBA 4NYJR 1EFUA 2V6IA 1TVCA 2JI8A 3OZBA 4MARA 3TPCA 1N08A 1ZD5A 3UH0A 4B9AA 3C1UA 4AMVA 1PEDA 4J2TA 4US1R 3GEPA 1UJCA 3NAMA 3GW8A 1PT7A 2G83A 4JOBA 4TKOB 2YUTA 3ZNNA 4CN9A 3A8JA 2NVOA 4JXZA 2X3YA 5JCOC 1VQ1A 3BIXA 2QQEA 2QN2A 2A57A 1LQTA 4GMXA 4L51A 4GI7A 1XHFA 2OHOA 1COWD 2VUIB 4RUKA 5EHQA 3AVXA 1C3OB 3PNQA 1SGWA 3LV8A 3VNBA 3BDVA 2D4AA 3JXEA 2AOTB 4KGVA 4OXNA 2MTBA 1E9CA 4O29A 2D2EA 2Q4OA 4F84A 2UUAB 4F71A 3IC5A 4H6PA 4ZVTA 3VR1A 2QPAA 3VBEA 3WK9A 4UUAA 2WSYB 3G6WA 2FSUA 3ZE6A 1OWNA 2CN1A 1EQUA 4XDGA 2GN0A 3R5TA 1PGNA 3WE7A 2AG8A 1NDQA 3SAJA 5IYNA 1U28A 5KJCA 1QFJA 1I32A 1EB9A 1VQKB 1LLFA 1TW3A 2IYOA 3C48A 3ZD8A 4BLVA 2Y0BA 1MIOA 2HF8A 2Y66A 3DD1A 3H4IA 4LKOA 4QPPA 2WHRA 3ONWA 5D3MB 2PX6A 4Z1MA 4YGYA 3SIPA 5IYWA 2Q3FA 4BMVA 4ZHSA 2XA1A 4LE2A 2P2NA 2X8LA 4UCFA 2YRFA 3HCPA 2FP4B 3W34A 3C7DB 1PK7A 4MP3A 5B4VA 1NVKA 4HXEB 5F5XA 3AI1A 1NN5A 1JHUA 1KTVA 1CZRA 1RP1A 3G13A 2QSUA 2C9BA 2PM8A 4BFTA 5CXUA 1V5VA 2DPGA 3I2FA 1CLUA 3WWZA 2XXAA 4KREA 3SXPA 4XVQA 2PDAA 3O9ZA 2D1SA 2G67A 1I2ZA 1ILWA 1CUGA 5GOZA 1NA5A 3EY4A 1ZESA 4XJTA 5TX7A 4V0LA 3FPHA 1N5LA 3E8SA 4IOMA 2AG6A 3CU5A 4G0ZA 2GTHA 2LV8A 3GOHA 1Z12A 2IY7A 4G8DA 2W2KA 1W2GA 4JB3A 4LF9B 5KTYA 1VHTA 2WSIA 2J4CA 4OHZA 1IQPA 2QIPA 3EVBA 4FMDF 2AUNA 2WAYA 2OV8A 4B3GA 4LDZA 4D99A 1AQ6A 3FR7A 4H6XA 1HOTA 3RAGA 4B7CA 5CDFE 3GD7A 1EUDB 1MFPA 2RHCA 3C6XA 3DWIA 1MEOA 4M9CA 4C7OA 1DL5A 1FRVA 4Y67A 3IB6A 3KQQA 2HB6A 4ZWNA 1C8KA 2YJNA 1H2AS 1YULA 4GZMA 1XKXA 1LVHA 4MV6A 4NK5A 2HDOA 4OHUA 4OIMA 2FWJA 1W4ZA 2I4RA 2IXDA 2A94A 2FEOA 2HSEA 3H1FA 5LXTA 3K16A 3F1LA 4MEAA 4W1PA 1OWOA 3KT3A 3EPLA 5TVGA 4EUKA 2P67A 3WB2A 1QP8A 1A5ZA 1JSZA 2QYHA 1NW9B 2Z8ZA 4LVOA 5SYAA 1P2BA 4E09A 3CUVA 2VH1A 3ED5A 2GPSA 3P0FA 4BVLA 4OK3A 1NWCA 2ZZGA 1JEDA 3T1VA 3MWDA 3SJZA 4LZLA 4BRWA 4P3YA 1FY2A 3OPQA 3W4JA 2CGEA 3CNLA 4J3JA 3U7JA 1PWXA 2GCIA 3UW3A 4EWLA 2XOKA 4B4OA 2R84A 3GJ0A 2HRRA 2YXPX 3HCWA 3SEJA 1BYIA 1ETUA 4O2RA 4Y7DA 4FC6A 4F9FA 5JSQA 1W73A 2UYQA 4YFVA 3LQ2A 3UT0A 1H2EA 2PKCA 1RT9A 2H8GA 2QXUA 4ETIA 2WDZA 3IULA 4EKNB 3CPWB 2YY6A 2ZB8A 3L4KA 1XFDA 4EX6A 2WAAA 3MGBA 5HK9A 4EUSA 2GH1A 2FHSA 3TDKA 4K9RA 3MW8A 4YRGA 3OZUA 3PE4A 2QRNA 1L4EA 3R5SA 1P18A 1KWGA 2VHJA 4BOYA 2ZDHA 3AT1A 4WDQA 3Q0TA 4KHZA 3QF4B 5I9SA 3U4QB 2ZRMA 5KNDA 3ICOA 5EJ5A 4LXHA 4UVDA 2JFOA 2QL9A 3HCCA 3A6LA 1YIJB 4HDQB 2VHUA 4A1OA 4CQLA 3FNFA 2QNRA 1XA4A 2M2IA 1HNWB 1GN8A 5TJ9A 3OQIA 3PUJA 1FLDA 2IIVA 1QHHA 2PZEA 3LHFA 3RSHA 3OE1A 4F38A 1HSZA 2BFCB 4QVIA 1PVOA 2R44A 3M8KA 2QTBA 2BP7B 1E6MA 4OH1A 4XDHA 4HATA 1QQ6A 3MBIA 1RLIA 3GIWA 4C0BA 3CXRA 1DXYA 2CFCA 5CEEA 5I8PA 1BDBA 1X2EA 4PXSA 3T9BA 4XDYA 2XQVA 3Q7SA 1NRKA 2P9QA 4XTCS 1U31A 5F4MA 1JDBC 3D6TB 3DVSX 3MJ4A 5CDUA 3OT1B 1DAEA 3SFTA 5CCDA 3W3ZB 3PENA 3OHMA 1VB5A 3WLIA 4F5WA 3DM9B 2XR1A 2NADA 4AECA 4O4IF 5BN3A 2E5FA 1N7GA 4JVNA 1TVKA 2JH8A 5TQVA 2W2MA 1PEKE 1OW3B 1XKTA 1HXHA 5IKPA 3ETJA 3AVVA 3RFUA 3W1VA 1MO3A 2O2ZA 4EW6A 1R5JA 1UAYA 3AM3A 3H04A 1TMYA 3LQFA 1MAUA 3TD6A 3DKVA 2FPGA 4GIBA 3H2ZA 1ADYA 1GOTA 1AMOA 1QGZA 1AZTA 1QM5A 2V0CA 4M0KA 1KZ9A 1L4NA 1D2GA 1IDN1 2EFEB 3PXEA 5FHRA 4U2FA 3BF7A 4XGKA 1ZZGA 3BL6A 5BWNA 2A30A 5LA6A 5K6AC 3LUPA 5E6SB 2V4UA 3PL5A 3ZG6A 5F73A 4ZHQB 1T2VA 4H6WA 4CW7A 1EVLA 3E1YE 4BZZA 4M22A 4EPRA 1XT6A 2FR8A 3O6VA 4V39A 2DUUA 1FVXA 2VTBA 1JG1A 2FB9A 2W4MA 4IOKA 1AGRA 4N01A 1WXXA 1BMQA 1G20A 2NU7A 3B1FA 3BB4A 4LJ7A 4P7GA 1K7YA 2J30A 4OXXA 3RNLA 4PBSA 4RTJA 3J81A 4N7MA 1UBTS 1PFGA 2BSAA 4OI4A 5B7NA 1SK9A 3UWDA 4Z7QB 5LU9A 3I1YA 4O59O 3UA4A 2H92A 3D1LA 4DLNA 4DSZA 4DDWA 4ZAWA 4Z4UA 3RCBA 1QANA 4QJIA 1BTOA 2YHBA 3NX4A 2Z0MA 4G6ZA 4D1YA 2H2AA 3OO1A 4CIWA 1R6TA 4RVGA 4LXIA 2C5BA 2DQKA 5HBGA 2AHRA 3T7RA 1LVGA 1Y33E 2NNLD 1I4WA 1I7NA 3CZ9A 3GYBA 2UXDB 3BMCB 3OW2B 4WXPA 5YASA 3MNFA 4AMUA 1FJHA 1WXHA 5KQGA 3DCJA 2PKQO 2PY6A 2G1JA 2VJAA 1KDOA 4QXQA 2FZKA 4KGZA 2W0MA 3ZX4A 3WMXA 5LL6P 1CQIB 3L40A 2VT2A 3RIYA 3T1NA 3GQBA 3GT3A 3UJAA 4DC9A 3ND6A 4DS3A 3OJXA 3NXSA 4C0SA 1DC5A 2ZM5A 4X24A 5D8DA 3WGYA 3WLEA 5CB4F 1ZM4A 3FNIA 4E5SA 2OO5A 3E7XA 2F67A 3C7AA 1K06A 1M1NB 3OJLA 2AKYA 3G79A 4QPCA 3VH3A 3B9RA 1LBHA 5A5EA 2ZJ0A 1VBKA 2C07A 3ZQJA 2CLLB 2C4UA 2OSBA 4Z4QA 5BWMA 2GESA 5JI3E 2IP2A 3UB3A 3HPQA 3NDJA 5EFZA 3ZH9B 4MXDA 1I6WA 3JVUA 4D02A 2ZSJA 3BTVA 3JARB 1TZBA 1I2MA 1U0TA 3Q6NA 4FLEA 3UMJA 1F7UA 1B3RA 4TMTA 3ELYA 1D6NA 1ZN8A 4R7TA 2OAGA 2Q3DA 4CIVA 5K0GA 1QG0A 1NJ1A 3IAEA 3BAFA 4I55A 2KMLA 5DTQA 3DB1A 4UFNA 3U7QB 1XA3A 2OCIA 1JR2A 5I7SA 4KXNA 4MWEA 4EGQA 3EPHA 5IF3A 4ID3A 1LZKA 2OB1A 3ITDA 4BGUA 4WZTA 1R6XA 4QULA 1DBQA 3I1FA 2AZMA 2DPXA 1T2EA 2ZSAA 1X0XA 4LSMA 1QHEA 3SVZA 7MDHA 4UW9A 4EI2A 2RE8A 1LDEA 3W9YA 1UBMS 1EWQA 5A0VA 4ALKA 1ISHA 3O8DA 2F1OA 4ZC1A 1EFRD 1T2AA 2FDRA 2BHTA 2FDXA 5DHSA 5A9TA 4NZPA 4MB6A 4B4DA 3OM0A 2OBNA 3DNPA 4RJTA 1E1YA 1JEQA 2X41A 2CMFA 1DTWA 1MVNA 2EJTA 3D3EA 4EY6A 4LRXA 3ASPA 4V0NA 2VDLB 4R2KA 5DRYA 4XRGA 3NTOA 5HZGA 4DCPA 3ONUA 5H70A 1OTYA 1RTKA 5BQPA 2HMWA 1APBA 1KU0A 1USUA 5J63A 2GNOA 1RIIA 4MKFA 4BTEA 2D5CA 2W2OA 1J99A 4KX5A 5G4KA 2VWGA 4FINA 4NONA 4YA6A 2R1TB 3FF1A 2XWPA 1GFZA 4KIGA 2V8BA 3TQFA 3QJ5A 4XYGA 1KK3A 2VL7A 4QOFA 4BUJA 3H5WA 1LA2A 2VZ0A 1ZIXA 2WFLA 1OYYA 3GZNB 3NFYA 4WLUA 2PYIA 3UATA 2X22A 2NYRA 4MVWA 3TKLA 1J1IA 1JEEA 4HC4A 3WJ7A 1BFKA 4I1PA 13PKA 2WUEA 1HUQA 3FUTA 1G8JA 4PZLA 3DT9A 3OBIA 1U9JA 4UEQA 2YIMA 5CK5A 5AK4A 2JCYA 1K89A 1XN1A 3FX2A 1I4TD 1YR7A 4MIEA 3I3SR 5KOIA 2HA2A 3TR5A 3KUKA 3ZDYB 1ZO8A 1H94A 1Q20A 3QLVA 4NH4A 3UMYA 1PFUA 3JRXA 1TO1E 3DF7A 3WAJA 4K86A 4WGFA 4II2A 1FMFA 4MB0A 2Z58A 3CCBA 4JUDX 5TNXA 4DRZA 1IOLA 4IFBA 2Y6UA 1A2OA 4NHEA 2MR6A 1YB1A 1Q7TA 1XZPA 2QY6A 4N7RA 1E5DA 3L1JA 1UT6A 2UZAA 4MZDA 4FEAA 5I9LA 4M9QA 2QN6A 2RHHA 3DFIA 4XH9B 2XKAA 3QE2A 2XODA 2BTQB 5CJ2A 4QOHA 3F3KA 3OOSA 2C88A 4N0EA 4X91A 3F3SA 5CM9C 2QXYA 3UFBA 3TM5A 5BVGA 1M34E 1ZRSA 3B5JA 3H1GA 4L57A 4GFDA 4QASA 5TF0A 3WDKA 5IULC 5J4LA 1A2QA 4UZUA 4B45A 2AG5A 2OV6A 1N2SA 4HQLA 3SI7A 2G9QA 3N6XA 4CUJA 1RAAA 1V47A 1XZIA 4NFSA 5EE1A 4GLOA 3GUZA 1XZBA 4RDHA 3HCDA 4COKA 4Q16A 3A8IA 5E9QA 1ULTA 1ESEA 3EG9B 4JOQA 4EJFA 1EM6A 5K8JB 4NCBA 3QOYA 1O9HA 3KJNA 3MMXA 4P2NA 3AGQA 1C1XB 3H1EA 3QSGA 1FNCA 2ZTLA 1L5NA 5C7YA 2O6LA 4E2WA 4IDOA 3EPPA 2RJNA 1RBYA 4O0LA 1VBNA 4JDPA 2IEBA 5EHXA 4DF3A 4QECA 1E3IA 2C0PA 1M2KA 2ORIA 1S96A 3AESA 5T4EA 3TLZA 3S2ZA 1JP7A 1PJ2A 2C83A 3L0PA 1YR6A 4QOEA 4FOOA 3ZOKA 1VLYA 1RLOA 4CM5A 3CW9A 3VGJA 2CHEA 3PXDA 4LHYA 4H7IA 1IUNA 5ALYA 3DOUA 3LP8A 2Q28A 4J0EA 5LBUA 3RT9A 3TPFA 5HK8A 4UREA 2JBWA 2O57A 2OBTA 4AJKA 5TPZD 4EZEA 1RAHA 2HPZA 3BVPA 3PDHA 4UNNA 3QKSA 5CX1B 3ADBA 4O3FA 1SCUB 1V1RB 1XCJA 2HFJA 1IL0A 3FHLA 4KXWA 3IIKA 5A9SB 1MX1A 3R75A 3BK7A 1N9GB 1YGYA 3LL4A 1Y0YA 2IOFA 4H7FA 1IM2A 5COBA 1B6RA 4KUHA 3RFTA 1L7MA 3VSCA 1P8AA 4LK2A 1S5PA 2ZB2A 3KEQA 3LTEA 3MWLA 4HDRB 4MRMA 4PC2A 1KIAA 2NXJA 2VT6A 3MJRA 3WHIA 2WM8A 5EHIA 3PI7A 1UD8A 2BLNA 1GCAA 4FX2A 3C5EA 3H5RA 1R5BA 3FJYA 1OLUA 2UU9B 2QYTA 2KPOA 1FDWA 1EBUA 2FW6A 4KR6A 3DGFC 3K73O 1C50A 4IS3A 4X7EA 2X9NA 4M0CA 2GJRA 1K7SN 2VK8A 3KPVA 3UJ8A 1BKSB 1L4UA 4XQCA 3MFQA 3LVBA 1LXCA 3WGQA 1KU6A 2WLSA 2O2SA 2MR5A 2QLNA 4EGCB 1PR6A 2EP8A 3P71T 4EH1A 1OFUX 2CLMB 4F93B 1X74A 3BXZA 3PHGA 4JU9A 4Z5XA 4Q4JB 1QUFA 1QVAA 3H11A 4NE9A 4BAUA 4WBNB 1YS6A 1UJ5A 3KFXA 3ZN2A 1RPTA 1V3QE 4QHSA 5FTLA 3KHKA 3LUFA 3LO5A 3F71A 2WABA 3LE8A 4Q4HA 3T3IA 1GGNA 4QOIA 4WK2B 1ULAA 3S44A 1GPNA 1MVOA 2IUFA 2FVGA 3I2GA 4GKAA 3AF6A 3MS4A 1P2SA 4RKQA 1A9TA 2QM0A 1U04A 3GEHA 3GY0A 2ZJ3A 3ZK8A 3SSMA 1NT2A 1XN4A 2PWYA 4GYKA 1SHZA 3QKRA 3WLLA 3WNBA 4ZO6A 5LVAA 4GX1A 4B3RB 2QN9A 4JCCA 3NXKA 2ZXHA 5F76A 5GZ3A 1O0CA 1ZMOA 4JUCA 1JG3A 3D3WB 5JAIA 4EATA 3KSUA 2Z3VA 4M0MA 1DE0A 3BZBA 1M75A 3OZSA 4O8CA 1NVVQ 1ZH2A 2VJCA 1BPLA 5KB3A 5T8KA 2G9NA 1AXRA 4WIAA 5FX2A 5AXAA 5TT1A 3I01A 1O54A 2V3CC 3NCTA 1I1HA 2MWMA 4IINA 3AIMA 2E87A 3BGVA 2EP7A 3H9EO 3NHJA 3EN0A 5CVVA 1UM8A 3L3BA 2WP8J 3OCUA 4CL0A 2IH4A 4BFXA 4RS4A 1JG4A 2FOIA 1I8TA 1Q7EA 5AYVA 2ZVQX 1H4QA 3K7EA 3LXMA 4D9JA 4LYYA 3NDRA 1ZC4A 2HHHB 2I67A 5DW3A 2CVPA 4DWJA 1B6GA 5FAKA 4TT3A 5IYPA 1B23P 3IB3A 1VYTA 1ID8A 4OV6B 1Q7CA 1YB5A 4EY3A 5A4IS 3ENZA 3OM1A 4WLEA 2V6MA 3RE1A 3E4CA 1NJSA 4L85A 3M3DA 2PV7A 2NTEA 5IVIA 3T7SA 5JY1A 5TQ2B 3JRNA 4ZT5A 3VH4A 1L4GA 1E7YA 1NC3A 1NZFA 2WD7A 3AP1A 2DOKA 2QRQA 1UBCA 4LX0A 4URFA 3AONB 5HTKA 3B1WA 2R85A 2RG1A 1QP7A 3AKCA 3HWWA 5HIMA 3VYVA 1PFWA 5DX1A 5ABPA 5HJ5A 2RH9B 1FFXB 5KYGA 3L0IB 1TVMA 2I4NA 1UH5A 2HD4A 1XTBA 2NTVA 3AIOA 2QG4A 3L93A 5D7NA 5LMUB 4OX9Y 1ITZA 2X1HA 4KIJA 4CDNA 5IKEA 2BCEA 2AJ8A 4QLAA 2E55A 4E70A 1SPXA 1BVHA 5CG2A 4FB4A 2NN3C 2Y2VA 4QOJA 1NVAA 1DJPA 2WJYA 2QUZA 3ZDEA 3OHPA 4OOFA 1Q0PA 4NENA 5LMNB 1XZGA 1DPFA 3ZQ4A 3CHYA 3B2NA 3GH3A 5K8IA 1T2CA 5FWNA 4LBWA 2Q8NA 3UK2A 1T6YA 3V34A 2VHTA 2AOUA 4DJDC 3MMNA 3K72B 4M46A 4QGBA 3W05A 1KTIA 1PO7A 3BX1A 3QOWA 1WXDA 3TX6A 2VKTA 3F46A 2GRUA 3DFFA 2ODNA 2PL9A 4CEJA 2QAGA 4XKVA 2IUSA 3DHEA 4MEBA 2FUG6 1D2RA 4DMKA 2O8EA 3FZGA 4WZBA 2Y92A 1OLSB 5AJUA 1R50A 4MR8A 3EF1A 3REFA 1RKUA 4F4HA 1T9CA 1K6XA 1DRUA 4P3KA 3EZYA 3H5TA 1X19A 3GG9A 3DUFA 3SYLA 2Q27A 2P9BA 3OTWA 3S7TA 1JLLB 1KARA 1L4LA 2NPOA 4M9RA 5LZ5A 5AN9A 2ID4A 4TZKA 4LY6A 4MQ4A 4X6XA 5FI5A 4N40A 4B7XA 5HMMA 1CD5A 3DBLA 3NV9A 4MWZA 3THOA 4IZ6A 2PS3A 4CR7A 2PQMA 3F97A 3MLAA 3RKSA 5AOBA 4HIZA 1CJKC 1XMSA 2EQ5A 2VPYA 3NB0A 4MROA 3SBOA 2AYZA 4O1IA 3USZA 4KSYA 2Q8PA 3N53A 5FYQA 2Q8QA 1E20A 1M6YA 2COUA 4UDYX 2G1PA 3FF4A 5GONB 1T5LA 4ROSA 2OPHA 1QQAA 3E5RA 3SYMA 2NOAA 4YP0A 5LQUA 3ZBTA 3P9XA 3THXA 1P1BA 3JWPA 4O1MA 1NJ6A 2X13A 3KYCA 3DMFA 2YZNA 2WAMA 3B89A 3EOZA 4HRVA 1CUVA 2O2YA 1W88A 2OCKA 4BGEA 1XJCA 3DB2A 5FBLB 5IABA 3G2IA 2YVLA 4HWGA 2IZZA 1IONA 1HG0A 3EA4A 3M49A 4MQFA 1L6RA 3T4XA 5BWCA 1UAAA 3TZEA 3MQ4A 3W2IA 4QKQA 1M5RA 1HG1A 1Y6QA 3PL1A 3SC6A 3U48A 2X76A 4KXUA 4QELA 1RZ3A 2O14A 2WTNA 5BSFA 4AY6A 1YOVB 5AVVA 4FK8A 4ZN6A 1V4NA 1JA0A 2IZOA 4YJFA 5CNKA 4GM1A 2ZJOA 4R1QA 3HBFA 4E21A 4HZUB 1Q6ZA 1PUIA 5B1IA 3UHPA 4QZVA 4G4IA 1ISJA 1L5RA 4G97A 3THRA 3GLUA 2XTAA 4H60A 3VZPA 1Z3IX 5KDLA 1K98A 1A71A 1KJ8A 4MKIA 2CYBA 4AJNA 1H8EA 1DAPA 4US2R 3JU3A 1R8QA 2WIJA 2HF2A 4C88A 3V5NA 4P25A 2XRYA 5CEJA 5IXSA 3CMAB 3KQTA 3AWIA 4XQGA 1YIDA 3KEMA 1YVUA 1NYTA 2PSDA 1EA7A 2VJIA 1NLYA 3H83A 1EINA 3KYDA 3VR4H 4V0SA 5ELMA 5BO5A 4QYMA 1C30B 1LQUA 3V46A 4AJOA 4EL0A 3F73A 3ZQUA 5AM1A 4TZ6A 5EERA 1UFOA 1M8JA 2Q2QA 3E61A 2JDID 3HRHA 1QH9A 3OEEA 2RB5A 3FROA 4XB2A 4Y2RA 3DKRA 3WIOA 4L6CA 3Q2OA 721PA 4FNGA 1HPLA 4AKIA 2QTRA 3D6MA 4BNTA 2Q2NA 1E3WA 1CRLA 3TI9A 1SVKA 2QQ0A 3N2GB 4YP9A 3WWCA 1K2VN 2IT1A 4NG4A 4ONEA 3GZJA 2QUBA 2JGEA 3H5LA 5DM4A 4DDMA 4PCAA 4IHKA 3IQHX 2XZPA 4JJ7A 1QORA 4JSRA 2IUYA 3LBYA 3KEWA 1I4DD 1UMCA 1EVQA 3H4VA 3OTOB 4FZRA 4O4HF 2F3UA 1XEAA 3AHEA 4FXOA 3NHPA 4WXYB 3SEFA 3M4YA 1OZFA 1FQKA 1R0LA 3IEKA 4MLZA 3GDGA 3WV4A 3R3SA 4IKOA 1AUQA 4AJ9A 4CYMA 1YMQA 3KSDO 3GLIA 3BCDA 1BW9B 3IDQA 1RZUA 3N0RA 4LOJA 2BIFA 5U4XA 1WXIA 4IP0A 4OA8A 1P7CA 3W7AA 4ER5A 4ZGGA 2ZDGA 621PA 2CSXA 4OO3A 1CQXA 1E2NA 1ODSA 1MP0A 3FSGD 4YRJA 3ZXYA 2IODA 3QX9A 4E31A 2BUBA 2NU8A 4BJ1A 1KGSA 3W5SA 2F1MA 4X7RA 3M6FA 5BV2P 3L7BA 2HK6A 3NHFA 3NRBA 3R0JA 1IU9A 1WW8A 4Q7QA 1DVRA 4OJKA 2GPAA 5ILOA 3ICPA 1JS1X 1U8FO 2D06A 2PK3A 1R1DA 2HJHA 3AL3A 3FCAA 5IAAA 5IX8A 3UJNA 5FPYA 4KI7A 3T7IA 4PZCA 4KZPA 2WJVA 4KPGA 2Y4OA 3JQ7A 5AOAA 3ROGA 4AI6A 4EHDA 2O3QA 3EFOB 4YRFA 2YICA 1I2AA 2XOXA 3VI4B 5GIOE 4B44A 3I2HA 3MWKA 5T3UA 2WHQA 3C2QA 2C3YA 5CLGA 3ZJYA 1KO7A 2BBSA 1SXJE 4AKEA 4EFKA 3V33A 4D8XA 2JNWA 3AF5A 4TQGA 2OV3A 3AKYA 3D59A 4NJMA 3WGVA 1EFHA 4WZBE 5AK5A 3UPDA 1XRQA 3DMPA 4PO1A 3AHCA 3HK2A 3FNGA 4G9BA 3OP4A 4Y2XA 3ZZ1A 1NI5A 4I4TF 4NZZA 5LLSA 1I0ZA 1RJWA 1M90D 3VFDA 3PQ2A 3H2JA 5TQ0B 3UFXB 1IXZA 5GZ1A 3IHKA 3KKMA 3A1EA 2QVXX 3NRJA 1F8GA 2HUNA 3DXYA 4GPZA 1T0IA 4KG7A 1YR3A 1LLQA 1DKRA 3ECSA 2EVWX 3DMTA 3GQVA 3HNOA 4KDFA 4XARA 4DCSA 3WBJA 3UGJA 3ISXA 4HEQA 5FOXA 4FP9A 1EHIA 2AJLI 2NM0A 4TXHA 4P83A 4GGPA 4HDKA 3TNDA 3A36A 4RTPA 2QBYA 3RYCB 4EY4A 5HZBA 1F5SA 1RRGA 4LYEA 4LE1A 4TLAA 3GBPA 2CVOA 4ZYVA 4WXEA 1XTTA 1IOWA 3WZ2A 3RJ5A 1UWCA 4UNPA 4KMRA 2RK6A 4RJIA 1D2HA 2A0YA 1NVBA 1J0XO 1AF4A 2ONCA 3AINA 3B6IA 1AOXA 1LNZA 1M1XB 1SVNA 2NSLA 2WKRA 4CM3A 1U8AA 3L8GA 4ERNA 1WZ2A 3AHHA 3MPUA 2GK3A 2V9CA 3NHRA 1RI1A 4XN0A 1REQA 1FRFS 5AKYA 2HCJB 4D4KA 4QFMA 3R3XA 1GZ5A 1JU9A 1NB9A 2DHEA 3AY3A 2HKIA 3R5HA 2WJHA 3HLYA 4P3PA 5TMDA 1L5LA 5J1SB 3M6VA 3ZCQA 1SUEA 4DA9A 1NNEA 3D8SA 2W6ID 4EB6A 2W4QA 2V7GA 3KT8A 1SHKA 1UMBB 1G8MA 2ZAIA 4R8KA 3Q3AA 2OGWA 2H1IA 2RHWA 3BB1A 3IXLA 3QJYA 3B85A 1UOEA 3DE2X 3ICEA 4WY8A 1AGNA 1Z0UA 3IAUA 3MUEA 2QP4A 4FI3C 1I3LA 1C3VA 4DCJA 1DOAA 3T1QA 2FFQA 2V55B 3QEMA 4MIKA 5BPHA 2B36A 4L5BA 4W7IA 1QTNA 1U2DC 5SY9A 3UENA 4CFYA 3FNHA 1EP1B 3BCHA 1E5TA 3DZHA 4QU0A 2HV9A 3WSWA 1X7WB 3H6HA 4I1IA 4Q18A 2QORA 4C20A 1IE3A 4QUHA 1CY1A 2Z95A 1VXRA 2W6QA 3ECCA 5AK3A 2PBZA 1ZK1A 5HQJA 4BECA 4HUQA 2NVBA 2JI7A 2V6BA 2W93A 3K6KA 3FBWA 4WNCA 4OMDA 1EFAA 3CW2A 3LI2A 1VHDA 3L8FA 3ILXA 3O8OB 3P9SA 1QUEA 1PWEA 4J6FA 3GAMA 2V4ZA 4L15A 2VFAA 1HTTA 5AI8A 4YONB 3WIEA 1QR6A 5KNBD 4LN1A 1QSGA 2H2WA 2OESA 2WD8A 2XECA 4FS3A 4LCEA 4RZSA 4UE6A 3TTVA 3BMOB 3CPEA 4AW9A 1IB0A 1ZNXA 5DTRA 1G98A 3LT5A 2P9HA 3H8SA 4ABYA 3VC3A 1PGJA 3ETEA 2XUOA 1SG9A 3UCEA 4BKQA 4QBTA 1KZ7B 2XW6A 4KDRA 2EKQA 4LTDA 2YN2A 1J39A 3MYRA 3ZE0B 2XZDA 4IUBS 1S01A 4DXAA 3N2KB 1YCFA 3S8MA 3I9JA 1NXWA 1JDVA 3UW1A 1IMJA 1M73E 4GL4A 3ABIA 3C4QA 2YY7A 3KHTA 4B47A 1PUJA 4HAYA 4KGDA 3CONA 2I9KA 1BDIA 3VTKA 1EA5A 1W75A 1H6CA 3O8NA 1T13A 2NZWA 2O2HA 3LX5A 4IG4A 5DNAA 5BSHA 3G23A 2GAOA 4FHFA 4GZ6A 3WJ2A 4XWKA 4CKCB 1ZK4A 1P8JA 1K6EA 1WEHA 3M6UA 4TTRA 5FORA 4R2HA 4F91B 4NSNA 1E7RA 1QYWA 3H86A 5IW8A 4MCJA 3ZJUA 4U8HA 2R751 2IK8A 2FK7A 4HWSA 4NBUA 1XU9A 4P34A 4EG0A 8MHTA 3HYTA 2XUDA 3FKQA 3OESA 5E6RB 2FEMA 4Z8XA 2DUNA 3E2PA 4KV7A 4RE6A 2G25A 4WUTA 1AUXA 2VBSA 1FP4A 4XYBA 1L5HA 1P29A 1L0BA 1JYEA 3RROA 3TG2A 4OYHA 4EHNA 4JI4B 1PIWA 3JYQA 2Q62A 1KYVA 1C7IA 2LKCA 1S7CA 3FDZB 1PR2A 4MGHA 1XHEA 4G0XA 1Q0HA 4BMSA 2RJOA 4MJLA 5K8CA 2E2WA 3HLKA 5B1DA 1FC0A 4TROA 1E2JA 3D5QA 5BQOA 4A16A 1W36C 1HZZC 3DNFA 3CE9A 1E0DA 4KPYA 2FZWA 3Q2IA 4RIIA 5EQJB 3OCYA 4A8JB 2A2ZA 4LC0A 3NC0C 3NU1A 3CMEB 1ISPA 1W48A 1QLJA 2Y2UA 3CEJA 1XL1A 2ZRBA 3GRYA 2I1LA 5CHEA 1DRWA 1KYTA 1SKYE 4JWKA 4TZ0A 2P8SA 3GRFA 4EKIA 1V43A 2FEPA 2JKVA 5LLDA 5JIBA 2IZ6A 2XCUA 2CNLA 2DCMA 2QA4B 2FSGA 4CFZA 1WKVA 4FMDB 5KUTA 1YITB 3ZD9A 4DLXA 1NM5A 1XZMA 3R24A 4EPXA 3U3JA 3MF4A 4PYLA 4Z3KA 1SCQA 3EGWA 4OGKA 1UR5A 4TQAA 3CRVA 5TARA 1JR3A 4M83A 4HS4A 5FUXA 5JCXA 1RYNA 3RODA 5IMBA 4HWOA 3P0HA 3LC0A 4BFZA 3JU4A 4L5YA 3R3HA 3IS3A 4E5VA 1QDEA 3AF4A 1O57A 1XJ0A 3IMCA 3UWSA 4CKBB 5CBPB 3QEBZ 1J20A 4IRUB 3G2LA 3NUGA 4OQZA 2H0AA 1Y6RA 4L8GA 4W6ZA 4L78A 5D86A 1KI1A 1ZQ1A 1CW2B 4OH7A 4BJHB 4U7FA 1KBOA 1TM5E 3AG6A 3FSEA 3S1AB 2H1RA 3PZRA 4G3XA 2X86A 4LVUA 5T4FA 2BGJA 2J67A 2JBAA 5HF6A 1Z15A 4NDNE 1T5EA 1F6BA 2WQ6A 1OXBB 1KSFX 3LC1O 2PKRA 4HGNA 4BJ3A 2GN9A 1X1AA 3PC2A 3L0YA 3OD1A 2AVDA 3ACBA 3NC1C 4PLWA 1UC9A 3O93A 3OETA 3R4VA 5FJIA 3UMSA 4AQ7A 4PPNA 4ACBA 1GARA 2YVAA 4U8GA 4HAUA 3LK7A 3F3MA 4KQKA 1FQOA 1ZNQO 4QPDA 1NPTO 3A1CA 4LWOA 5KYWB 4NU8X 3MJEA 4B80A 5I7RA 2QMEA 5GIPE 3T51B 1NFFA 1PZNA 3A1TA 4LY9A 4Q7MB 4I81A 3LX6A 1HRDA 4E6PA 1A9QA 1JJAA 2JJ1A 1JIQA 1G6OA 2J87A 2W83A 3DE3X 3P96A 3WMFA 4HNQA 4XYLA 3JZDA 1QGAA 2Q9AA 2E1PA 2WV9A 2EWVA 3L8YA 3NBUA 5L51A 1QP0A 4P9NA 2X7HA 3I1JA 3PVDA 1O95A 3O1LA 1KP2A 1YACA 3PFIA 3U4CA 4IUDS 1SR8A 5HQTA 2IH2A 4CTOA 1GV0A 5KYXB 1SELA 2YQZA 3ZHCA 4D92A 1AA6A 3GFRA 1NV8A 4OPVA 2HQOA 2HDWA 3ESXA 2I29A 3PHLA 3RTBA 2O8BB 1P2FA 1W9MA 3I9NA 4JJZA 2JAOA 5I47A 4GBED 1I30A 4MV7A 3QYJA 4AP5A 4HGOA 5B36A 2QD5A 3QIVA 4MJ7A 1NLFA 4F04A 2RSLA 2JIZD 3CZRA 4KUGA 3AETB 4TRJA 5IAKA 5BNZA 1V7ZA 3K15A 4LRYA 5JRZA 3PUIA 2ZJFA 2CLOB 2DFLA 2QTLA 2Q4DA 4R8VA 2FY8A 2EX1A 1ESCA 1TF5A 1AHHA 1L4BA 1PI3A 3WGJA 3PUXA 3FYCA 4X8IA 3JATA 1CULC 1W4AA 1TJYA 4ZAYA 3RIEA 4MNTA 3NBFA 1V0FA 2WZNA 1PJQA 1QCYA 2C94A 2Q3HA 3NFRA 4I5EA 2PZMA 4KVZA 4LX8A 3U7EB 1W5EA 2VNAA 1PWZA 1XRRA 2OZLB 4OKNA 3RABA 1A4UA 1H23A 1K75A 4O4IB 8ATCA 3QUTA 5FWXB 5I3CA 1RC8A 3E9NA 2RHJA 5T4HA 4OL9A 2VTVA 3HN6A 3O4FA 4D8WA 1PW5A 4XJXA 3SC3A 5C5CA 4CLXA 2BGMA 1R8XA 4BE9A 4F12A 3W5AA 4DA7A 4NNJA 4DY6A 4YT5A 1KWKA 5K8LA 4AO7A 1E8NA 3CFYA 4MV8A 3A27A 4BMNA 3F6SA 2PUBA 3OOJA 3FOAA 1CXZA 1S2MA 4Q1FA 4V0MA 4J3FA 1OAOC 4WKOA 4XM2A 4ARIA 1BH2A 2XE8A 4EQ6B 4ZMRA 4M0LA 2A0UA 3ZPNA 2SICE 1WDLA 1JDTA 2GT1A 4IDPA 2QT0A 3T4EA 4DW8A 1QO0A 3ENQA 1MRSA 4K9LA 4Z7JA 4DUPA 5JJLA 2D5LA 1XTJA 3D6AA 4R9UC 5TY0A 4J6EA 4EYSA 1YDGA 2AQHA 1EESA 4P9SA 1GQSA 1CR0A 4DIEA 1YJWB 1DINA 2D1RA 3SZRA 1M2OA 4BKMA 1I7SB 4JI8B 2ZYAA 1ULHA 1Y8QB 4OQFA 3HV0A 4X1KB 2OQRA 2Q5CA 4DIUA 2QTGA 3PG5A 2AOTA 1WW2A 3I64A 2WFAA 1XPUA 4GX0A 4YAKA 2ZE6A 1QFXA 2G9UA 4XDZA 2R6FA 3HDGA 3HH8A 4EMSA 2IF0A 3UCFA 5JBIA 1MB0A 3DZJA 3F1KA 1DG9A 2ODBA 3NWBA 3LC2O 1XU7A 4JUBA 4DIMA 3RM3A 1OFGA 2CYAA 1F8FA 2ID7A 4RU1A 1AH2A 1G5TA 3G2QA 3DL4A 2CJPA 1TGYA 2WG2A 3H9CA 5D3MA 1X9HA 2RI1A 1KJIA 1COWA 2WIGA 3BBLA 3KSBC 3WK6A 4ZK6A 4CF7A 4TVBA 3VO8A 1IZ7A 4D9NA 6LDHA 2XBLA 2FP4A 5K3SA 5I7UA 3OU6A 1RM0A 1HRKA 2PZJA 2Q6TA 1WR8A 2IOHA 1NWHA 4EPWA 3CTMA 2OLEA 1T8TA 4LHVA 1NAHA 2YMMA 5KVSA 1WQ1R 5BXQC 3KJQA 3I5YA 1WMFA 2VZ9A 2PMEA 3ULKA 4C4YA 3L6DA 1U98A 1XDUA 3HN7A 3DW1X 1AN9A 1JA9A 3EBOA 1VQ6B 3PFCA 3VPFA 2A9FA 2DIEA 1KKMA 3PDUA 5GWXA 4HI0E 3UJ6A 1DJMA 1XWIA 1IM8A 1MO5A 2Q2VA 3ZW9A 5CB4B 3MT7A 4OQNA 5BQ5A 3ZLVA 4K6FA 4NE7A 3ROXA 4CDGA 3BT7A 4GU5A 3A4YA 4RKWA 1L5QA 4IIFA 4C7VA 1K9MD 3E27A 3PSHA 4J16A 3RUCA 2AC4A 3E9RA 3UYLA 2H1VA 1G5PA 4IIUA 4QJ3A 4ZEVA 3E3OA 4KQJA 2N47A 1SU6A 5L7YA 1E59A 4UTXA 5DGIA 3K8OE 1EVEA 4LGMA 2ZJ5A 5FAXA 5ECGC 3RVMA 4U39A 4LSZA 4I14A 3K70C 3ISVA 3GAFA 1EUDA 3IPAA 4JBLA 1X6VA 3LQRA 1USIA 1HE1C 1L5GB 4P08A 2EC5A 4TV9F 3ICCA 3KE9A 5BWBA 1G3UA 3RBAA 4JKOA 2CLKB 1ZIYA 4C7JA 2NQ8A 4ZQEA 3QVTA 1Z0AA 1H2BA 1KI4A 2A9JA 1O3YA 2XE4A 4BV8A 1G8PA 3CZPA 3I6IA 4DV2B 1MQ9A 1GG8A 3I6ZA 4RMIA 3TGLA 1SBCA 3PWSA 5K51A 2LWIA 2O1SA 3AEKB 2JI9A 3JZIA 4N47A 1P0IA 3GX1A 1N36B 2JIPA 3X1DA 1E0KA 1ZGBA 4LXXA 1XVTA 2OKGA 2VJMB 3WMGA 5K0SA 1NFRA 1O95C 1WQ3A 4RY2A 3D4PA 4ZT6A 1Y3HA 3BB3A 4R4JA 1J33A 3QVSA 2N1MA 4EG1A 5JDIC 4XKJA 1ECLA 2BUAA 1UDAA 1UCFA 4P81A 4Y2GA 5M7EA 4AJLA 1OGYA 3V7FA 3CVXA 1G38A 3EGVA 4ND1A 3RRJA 3TQSA 3T4UA 3E4DA 2D4HA 2C2OA 3TSZA 1LF5A 2UYCA 1SUSA 5B1SA 3E3LA 4MGEA 2AXEA 4Q7EA 3L4JA 1WB5A 1YZHA 3ZZTA 1H6AA 1YRYE 4OKIA 4CRWB 4QJBA 4MDFA 3SYNA 2N9UA 4MVYA 5FNVF 4F60A 3QU2A 4MW1A 5TF4A 5DEIA 2IV3A 3LCCA 4DQDA 1Y3CE 3GV0A 3F9CA 4B0OA 1V4BA 2Q6OA 1QHXA 1UUFA 2QGNA 2PSEA 5C46F 4L50A 4A5SA 3ZHQA 1K8QA 3TJZA 3IEXA 3LGAA 3QF4A 3P2JA 3UMVA 3U4QA 2W6CX 4Q93A 3SY8A 4WXRA 5REQB 1F51E 3B8EA 1AO0A 2OFFA 4PRZA 4ABTA 4KE8A 3MWJA 4G23A 3Q3GE 1W93A 2O48X 2OHVA 1C7FA 1Z4IA 2QK4A 4JIGA 4WFJA 1LFAA 3NGXA 1EFLA 2AWNA 2I7XA 3FYHA 3PKIA 2YIVX 5HE8A 1MAHA 1TT7A 4XTRA 1XCBA 1I5RA 2CZGA 4ZFNA 5B7GA 4ZJYA 2FMXA 3H65A 4HEA1 3G2PA 2XDQA 4QE3A 5HKLA 3ROKA 4CZ2A 1EX7A 2QDKA 3MWGA 2ZZEA 4YHHB 1J8QA 2EKLA 1ABFA 4OSEA 1T2NA 2PNFA 2JFYA 2Q41A 3PX2A 2JFHA 4EAQA 1VCNA 3BHMA 4R51A 1D1SA 1NN0A 1X7HA 2ARKA 2Y1XA 1IY1A 1II8B 2CXSA 3ADOA 4FJ1A 4FYHA 3QFRA 1H0SA 3AY6A 3TL3A 3HFGA 2BFBB 4PFQA 2V9PA 2VXOA 4AMBA 3W5CA 3AVOA 4RL4A 3AL0C 5CCXA 1MJHA 4Y1RB 4LJKA 4E11A 1YJBA 5K3AA 1BH6A 2Y1EA 3G2KA 1TM2A 3DR3A 4PAWA 4DANA 2IP1A 2XTZA 1CY6A 5A6VA 3FPKA 3IP6A 4IIYA 1LPAB 2QMHA 1OWLA 1QIMA 1QPGA 1PQUA 3CIFA 5E2IA 5KCMA 4GKKB 3VKHA 2G72A 3O21A 4JJ8A 5E6SA 4EARA 3SR3A 1HWYA 2GXUA 4OA5A 4TZTA 2OMEA 5I3ZA 3D9QX 3KR0A 5P21A 1B1CA 1BGVA 2H18A 3TZKA 4Z4RA 3DCNA 5KHLB 1LS1A 3TTYA 4X20B 4KXVA 2ZIXA 2FSIA 3MCUA 4ALMA 1T4DA 4CCYA 4J0KA 1TUBB 1AQNA 1DC7A 1MO6A 2CCJA 4J1NA 5JYCA 4BEBA 3WL3A 1RWWA 3OF5A 1EGHA 3JQRA 1OZGA 3TEMA 1C0LA 4NULA 1MX5A 4ZOLF 1ODIA 1QHGA 2VDWB 2XAAA 1LDYA 5IJ9B 6Q21A 4AROA 2FF7A 4F5ZA 5M04A 3SFZA 1QIKA 3K4HA 3EZXA 1JSRA 3RHZA 4L4XA 5ALPA 1ND6A 4GMFA 3M34A 1G8AA 3KU1A 5EGNA 4EHHA 3C1OA 2KSQA 3A1SA 3C3DA 4TV8B 2AJDA 2ODAA 5INTA 2GAAA 1SOUA 3DTNA 3M2TA 3N76A 4GOJA 4KDCA 1EVYA 5AKIA 3RC7A 5IBRA 2W8ZA 1PGQA 1L6IA 1XKLA 1RI4A 3KQWA 4WKGA 4GMGA 4RDXA 3QU7A 4KTVE 4IH9A 1JHRA 3S2UA 4RD4A 3ZHUA 3QVOA 3BMCA 4L2IA 4Q4DA 4YJDA 2Q3JA 3WNVA 5K3EA 4KACA 3PXAA 2C7GA 3WL6A 1XRNA 1GITA 2FFAA 1G6KA 3ESQA 4IHJF 2C4HA 4IVRA 4N48A 3ANYB 1E2DA 1Z5OA 4AWAA 3DT8A 5C52B 1Q44A 1H2HA 3U4IA 2AQ8A 5HFJA 4Q48A 1RE1A 2D0PB 1CQIA 3AKEA 3T3PB 2BGKA 2CVFA 2Q45A 1XVUA 2NV0A 4MRRA 3TMYA 5EIHA 1L4HA 1SEPA 1YSCA 2DR2A 4MV4A 2A9PA 2J5KA 1IEQA 4M89A 4FCVA 4NWIA 3FWZA 1U6KA 3JQ8B 1RZVA 4MLCA 1GL9B 1PQ4A 1U9IC 4A6PA 1DP4A 4H7EA 3DJYA 1W4LA 1P44A 1GRQA 4P4TA 3DQQA 1INLA 3H5IA 4P92A 5GQSA 4N8DA 3TR6A 4C0XA 8ABPA 3O1JC 1RJGA 3NBKA 3VZCA 2GR9A 1I7LA 2XXBA 3JARA 4KNVA 5ALGA 3O0TA 3NW9A 3GJZA 4GBMA 4B79A 4IZHA 2H52A 1E7SA 5K09A 1ZCFA 3S4YA 3GEMA 4Q47A 5CVUA 2QQGA 3NM4A 4Q3AA 1EUYA 1ORVA 3BTOA 5TPWB 3PKJA 2HSDA 3AX6A 4PC6A 5L3VA 2CNBA 1B42A 2YJ6A 4OUDA 4JI1B 1IH8A 4E3WA 3L01A 3IL2A 3N6VA 1AD2A 3U7QA 1NP3A 3KKKA 4ZAVA 2XCSB 2J3EA 1DNPA 1N1MA 3DEAA 4YN3A 3FLMA 3FNQA 4X62B 2NTJA 3ON5A 4NMWA 1PCXA 2FA9A 1D07A 1SCKA 4RJKA 3CZ4A 4E1BA 2XCRB 2GB4A 3U7GA 1YDHA 3FHOA 4KODA 3WQZA 2PSSA 2PUFA 2XHEA 1SG6A 1T3ZA 1OIXA 2OZEA 5ESRA 2WJWA 1HO3A 1WCYA 1Q3TA 1BHQ1 1GU1A 5IJ0A 5BYAA 4WWHA 4UDXX 1CEYA 4KPUA 1H2YA 3VC7A 1XLTA 2XYGA 3ZBPA 4D9HA 4ENPA 5DYNA 5ITSA 3SC2B 1KL7A 4MAMA 3INTA 1E2QA 4P36A 2Y0DA 1F60A 5E7MA 1JR4A 3I34X 2FX3A 4W5TA 2ZJZA 4MV0A 3GVCA 3LVRE 4EMTA 1LRLA 1TVEA 1BA2A 4ZANA 1BFDA 1LPPA 3L0CA 1LKZA 3D4OA 4WZKA 3E70C 2QD1A 1A8HA 1W5SA 4Q6BA 3LDGA 4MUEA 3F78A 3ASVA 3K30A 4URZR 5LQNA 2RGUA 4WH0A 3U1VA 3RYTC 2RB4A 1EFRA 4CI9A 1DAKA 1EFPA 1FMLA 1O6FA 5JSUA 1ISFA 2CL6X 4W5RA 4M1SA 2C59A 1M1KD 2GO7A 2XLBA 3EC7A 3ENKA 4GR4A 4DNQA 1FNSA 1HLGA 6CHYA 4HO1X 1EK0A 5EN4A 4AKTA 5BMVF 1OIWA 5D6OA 2AXQA 4G09A 4D74A 3D8TA 4KSBA 4NZ9A 4G7XA 2C2MA 2XUJA 2YY5A 2JEYA 4DCGA 4EABA 2JGMA 5CLHA 1BU8A 4NBRA 2A67A 2HK8A 1DT3A 2IIBA 3W6NA 5EQTA 1RRMA 3MPOA 4TRRA 1JYSA 1BJTA 2I78A 5KOJB 4D6PA 4YALA 5KYKA 1JB9A 1PD0A 2ZBQA 2F8SA 4F11A 1D6SA 2D1QA 3D6VA 2AE1A 3RRBA 3KKZA 3LY8A 1U8EA 2FLKA 5TS3A 1J8YF 4U7HA 3MERA 4C7MA 1HDOA 5C1DA 4Z4EA 4UEOA 1NUUA 2W00A 1CFZA 4G2TA 3LY5A 2DUWA 4IGIA 5FQOA 5HM8A 1OH6A 2FEXA 1ZSNA 2BTQA 4D26A 2OTLB 1T8UA 3EEQA 1YZYA 1H5UA 3BGIA 5M5BA 4FFWA 1K6JA 4OIFA 1SBZA 1TX4B 2DF8A 4RMNA 1MB9A 2I5PO 2X4GA 2GZ1A 3PLNA 1EP2B 2AZDA 2RBGA 2VWPA 4GX2A 1QZ3A 3NKLA 3OLCX 4MPJA 1YR2A 1UL1X 1YR1A 5JR3A 1T91A 3MGGA 1DEAA 4II3A 4M1OA 1A9ZA 1T1RA 3QY0A 4FMPA 3SE7A 1TF7A 2E4YA 2ZKLA 3EG9A 4W8HA 3EUAA 3RVSA 5BR1A 2VEOA 1ZLYA 1C1XA 4QYSA 1NT4A 2M5SA 1NRIA 1FX1A 3EQ9A 4NJEB 1QWOA 2DKOA 5LCXA 4EO9A 4Z51A 5HSGA 5KOYA 3WSTA 1IJFA 2O07A 3I2JA 3PPYA 4KQWA 1A9RA 2R6R1 3BC1A 1RMQA 1T5BA 3HVUA 4H7DA 4JC0A 3DV0B 3C8UA 1JDUA 4IO1A 3VDNB 2XD4A 3AJRA 3KAKA 2BI8A 4IGAA 5KSYA 3OZEA 1FQJA 1WE2A 4GWKA 1JDSA 4WW0A 4KAAA 4RK7A 5KQPA 3ZJVA 1Q1ZA 5AKJA 5K20A 1WLSA 3V8QA 5EWMB 4GP9A 3EIQA 2IXFA 3H94A 3I56B 5CFLA 1TPZA 4AO6A 3SE0A 1ELOA 1P0FA 5AM3A 3PP8A 3GYGA 5L3QB 3FFTA 1JKIA 4NH0A 1ZH8A 2XLCA 1P80A 2PH7A 2TRSB 4IKEA 4Q39A 5GY7A 4B33A 3A3BA 3ZOZA 4HH0A 4M7RA 1UBHS 2ZYTX 2Q4BA 4ND2A 1FUUA 1TA0A 1WP9A 4S0XA 4D3FA 4S1NA 2QPLA 1P7VA 1YWGO 4XIIA 1ZEMA 1V1RA 4OK5A 2O0MA 2P2GA 4EJMA 3USES 2GKSA 5A9SA 2FETA 2O5VA 3TD2A 1EX6A 1PJAA 2VXBA 1F6DA 2Y0EA 4FFVA 1N9GA 3OY7A 1R5OA 4KQEA 4KR0A 2E6UX 4V2IA 4DV0B 2DTDA 3HXPA 3A28A 3ZVKA 1HLFA 1BN6A 1S4QA 5AUQA 4C5AA 1MB2A 1CPYA 4GP6A 3CKLA 4HDRA 4TYYA 3P9KA 3G0BA 1IY9A 1CJSA 1BD4A 2G7ZA 4Q66C 4TPKA 5HZAA 1HX7A 3K0KA 4ZAGA 5A71A 2OC9A 5TPZA 5JS6A 5EKXA 3A1UA 2NW6A 4N3GA 4B2YA 1YHQB 1WUTA 2QSYA 4ZICA 3ILVA 1L7DA 2RGRA 1FYEA 5EXPA 3ZHBA 1S8OA 4JI6B 4YEDA 4H1UA 1VC2A 1L7PA 2GEDA 1W1UA 4DSNA 1RJEA 4KN5A 1S6YA 3HDHA 1ETHA 4URWR 3RSFA 1Q0QA 2HLPA 2NQ2C 3QMVA 2R87A 5J5CA 1KH1A 2EF0A 1VE9A 2HSJA 2C4KA 4K6HA 1PJTA 4AJ1A 5DGCA 1YL7A 1NW3A 4PHHA 3I0NA 3AHIA 5J2TA 1IXYA 4ER3A 1A8PA 1WSDA 1ESDA 3NC4A 4Q4JA 2LPMA 1LGYA 1J25A 2C4WA 5ALFA 3ONEA 1SZCA 3TJRA 5B1YA 2XA2A 4YCJA 1ACJA 3CCEB 1CDEA 3OMLA 4L3OA 3V8VA 4DB4A 3SLRA 3C3WA 3AHDA 4BQEA 5H3HA 3J80A 3I8XA 2VBVA 3L06A 3NO4A 4OTZA 5FOQA 4TN1A 5C8DA 1FJXA 1RWOA 3NIWA 5FQNA 1C8LA 4JYCA 1P2TA 5FFMA 3ZU3A 3UXEA 3U6KA 1Z8FA 3VKWA 3FZEA 1PJ5A 1ABEA 2WFMA 1FYDA 4HDSB 3LU1A 1SUWA 2I2AA 3TINA 3FCCA 1XOIA 3MCZA 2P68A 3ANTA 2PZ8A 3CX7A 3N2EA 4QUIA 1E2BA 2MMCA 4IG9A 3L7DA 2CLSA 3S81A 2FG7C 3T38A 1ZA1A 5KVAA 1QHNA 2IYSA 4KAFA 3D3WA 5LIRA 2Q5IA 4DG5A 2BH9A 1UKCA 3C5WP 3HRKA 4BWFB