1QG0A

Wild-type pea fnr
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
HSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
publication title A productive NADP+ binding mode of ferredoxin-NADP+ reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 91
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qg0A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qg0A02
1GAQA 1F60A 1W2BB 1VQ7B 2HMAA 3JQQA 3U6KA 4M1KA 3AGPA 3CCEB 1WDTA 3V76A 3G71B 4ZCLA 4ZCIA 1D2EA 4Q7JB 1E63A 2ZITA 2CRVA 2DCUA 4P3YA 1FNDA 1QGYA 4TMZA 4ZCMA 4PC7A 4TMXA 1F20A 4R71A 3AVVA 3ZZTA 2YWEA 2B5OA 4IW3B 2PIAA 3VO2A 3OZWA 3CXCB 3W2GA 3U2QA 1GJRA 3G6EB 2DETA 1BJKA 4PC2A 1CQXA 3LYUA 2QMUA 2OTJB 1Q81D 1R5BA 5DSZA 4H9GA 2BN4A 3CCRB 2RC6A 2XNJA 1ELOA 1YJNB 2YWGA 1VQ8B 4PC1A 4B3XA 4M2LA 1FRQA 1VQLB 3CC4B 4M53A 2B7CA 2DY1A 2C77A 3JQRA 1ZM2A 1IB0A 1KJZA 1VQ5B 3W5UA 4RD2A 3CMAB 2J7KA 1QGAA 4N3GA 3B82A 1DDGA 1QVFB 4DQLA 1M1KD 2EIXA 4DQKA 2GPJA 1VQ6B 1BX0A 1D1NA 1OGIA 1KK3A 2BGIA 2D74A 4HE6A 1R5OA 3QFSA 4PC3A 4EH1A 1G7CA 4RD6A 3VNVA 1EP3B 4RJLA 4QHYA 4AF7A 4K1XA 3B8HA 1JA0A 1W35A 1FNBA 1KRHA 1KD1D 1TVCA 4RD0A 5KSWB 4YAFA 3P26A 1DG1G 1QX4A 4M0LA 1S72B 2XEXA 1IJEA 3FJOA 1QFZA 1CNEA 1VQNB 4TN1A 1KTVA 2X3UA 1EFUA 1VQ4B 3CCSB 2HCJB 3MCAA 4YHBA 2B7BA 1K8AD 5HXBA 3W2FA 1G7RA 1VQKB 1QUEA 3LRXA 3CCLB 3PENA 4N3NA 3CCUB 1I7PA 4ZGQB 2OTLB 3CW2A 2VNKA 3CD6B 3LVBA 4B43A 5H59A 1KK0A 1QVGB 1EXMA 2DEUA 1S0UA 4F7DA 1QUFA 1EFCA 2OK8A 3AVXA 2E1RA 1QGZA 4FWTA 1Q82D 2QA4B 4RD4A 4B47A 2QTLA 3ZZUA 3W5VA 2R6HA 3U6BA 3ZZ0A 1GVHA 4YAWA 4M4SA 2BVNA 1OB5A 3CB4A 2BPOA 1EP1B 2PMDA 1NJID 4FK8A 3E1YE 2HDNB 3QFTA 3OZUA 2VNJA 4NBSA 2QDXA 2QEXB 1ZM3A 3J81k 3VNUA 3A1FA 1W87A 3AGQA 1QH0A 2BV3A 1FNCA 1GO2A 3MHPA 1XE1A 3WBJA 1YITB 4RCYA 3B78A 4AC9A 2QN6A 1N0VC 2RC5A 1R5NA 1G7TA 1SKQA 3CCMB 3AVUA 3CCVB 1YJ9B 2VNHA 3AVWA 1E62A 2OK7A 3JQPA 5TV2A 4AF6A 3AVYA 2YWFA 1FDRA 4C43A 1CNFA 3OZVA 2CNDA 3WNCA 3I56B 1VQMB 1GAWA 1GR1A 1EP2B 3WYAA 2VNIA 1YI2B 5GV8A 4NCNA 4LBWA 2BM1A 1SM4A 4B48A 1B2RA 1VQPB 1M90D 1XB2A 1OB2A 4B44A 1J9ZA 4WQMA 3OW2B 1ZM9A 1QG0A 2DERA 1QFJA 4PC6A 4B4DA 5EMNA 3QSYA 1YIJB 4RCZA 1AIPA 4ZGNB 2BGJA 1B23P 4P6VF 2BM0A 4PGOA 1JB9A 4U9UA 1JJ2B 1ZUNB 1TLLA 3G4SB 2BSAA 4QFMA 5TR9A 1TTTA 4G1BA 1KC8D 3CC2B 3CCJB 1JNYA 5TY0A 1BX1A 4HE5A 4J0QA 3AVTA 1HA3A 3ZBUA 1VQ9B 1YJWB 4FN5A 3ZBTA 3CC7B 3FPKA 2BF4A 4BPRA 1JA1A 4MYTA 1E64A 1KK2A 1H42A 2QTZA 2NPFA 1N8RD 4RD3A 1W34A 4G5GA 2YWHA 3W2EA 4UAJA 4LBZA 1H85A 5GV7A 1TUIA 1EFTA 1Q86D 3W2IA 4G1VA 4ACAA 4ZV4A 2GQFA 4YAOA 5THXA 1BQEA 1EWYA 3W2HA 4TMVA 1IJFA 4Y9UA 3QE2A 3LO8A 1K9MD 3CRZA 3VO1A 3WNBA 3I55B 3CMEB 3ZC3A 4RD1A 3QFRA 3OJXA 1UMKA 2VZLA 1KQSB 2FX3A 3P27A 1FRNA 2EFGA 3CPWB 4MYUA 4YAUA 1N0UA 4LC0A 1VQOB 1AMOA 4C0SA 1ZM4A 1OGJA 2VYQA 5FA6A 4ACBA 1K73D 1G7SA 3QFCA 3WBKA 4YALA 2XNCA 3MMPA 3SJZA 3CCQB 3WXMA 1DDIA 3W5HA 3OJWA 1DARA 3E20A 2AHOA 1Q7YD 4TMWA 5AN9A 3ES9A 1U2RA 1FNMA 4LBVA 1A8PA 1D8TA 5H5JA 1QFYA 2PLFA 3VMFA 4Y7CA 2BMWA 3WNDA 4LBYA 3WY9A 1NDHA 1KK1A 1YHQB 3I1FA 4TMTA 5JBQA 2C78A 4Y9RA
chains in the Genus database with same CATH superfamily
1NVVQ 4WI1A 2IBMA 1BXRA 5CNJA 2YVKA 1MW9X 5IYPA 3VSEA 1F60A 3KNZA 1D9ZA 1W2BB 3P0JA 5LPNA 4DA6A 5ED4A 3RHSA 1P81A 2VJLA 5M34A 2FW1A 4OHXA 5F77A 4B6OA 1KE2A 5DNYB 2CV2A 2RCNA 1NONA 4ZCLA 1N7JA 4N1AA 2WM8A 1X1AA 4J7AA 3DDUA 2WKRA 1S2IA 4CVNA 1K1EA 1RYHA 3CN7A 4F3CA 1Y63A 1MO4A 4TV8F 2XDAA 4YAKA 2YV5A 1QGYA 4LYDA 4ZAYA 4CLOB 1L5OA 4NWIA 4LZOA 3TB6A 3BY1A 4X41A 1J2YA 3LC7O 4IVRA 4W5JA 1U1EA 3KPWA 1LDYA 1PBNA 3UTCA 5A5VA 5JNTA 2CUTA 4OAOA 3KQWA 1UBSB 5KS2A 2Z6BD 2ZBVA 1OFHA 1U8EA 4GD3Q 4JJKA 1BGXT 5AJTA 3S70A 5AP9A 5K51A 3AHHA 2H18A 3UB4A 2H0RA 2G77B 3AR6A 3P0HA 4LEIA 2YWXA 3K15A 2P2GA 3D8SA 1PVOA 3VYRB 4M9CA 1GSOA 4LWZA 3MEQA 3SPXA 3E2PA 5KOYA 4JV5B 1UPTA 3WGTA 3U3JA 1LPNA 1UJMA 4E09A 4BLSA 10MHA 3GJZA 3O0DA 5GJWC 4DCGA 4ZI7A 2IYNA 2O8CB 5KYYB 1QGOA 1XPJA 1TYDE 4AUNA 5LOVB 5KSOA 3SZRA 5SYNA 1LFAA 2WU1A 3EBOA 3GLHA 3R09A 4PQYA 1USWA 3TLGA 3OF2A 2EERA 2FPGB 3T0GA 1KH2A 1BVRA 3JZAA 3OY2A 1JIKA 3NKVA 4FKMA 1NV8A 1QKKA 2XUIA 3ST7A 1A7UA 5JPCA 3ZVKA 3AF3A 1IBMB 5H7XA 2AZDA 4ZVUA 3QNMA 4QXRA 4MYCA 2QN3A 1ELOA 3ITNA 3PT5A 5IABA 3SZGA 1Z4IA 4FBMA 3R9IA 1DWPA 1WF6A 3FNGA 5EIAA 3JAMA 1V3UA 3DMNA 4KHPB 5FULA 4C4TA 3CXUA 2HL6A 1I80A 4M2LA 3I52A 4J3JA 1MXHA 5CXXA 3ZHSA 4DLRA 1P1IA 4Z4CA 5BR7A 5CIWA 2O2IA 1T25A 2V7UA 4LFAB 2XGOA 3MTJA 4UEWA 3D4NA 3PE3A 3C87A 3BCFA 2XOXA 1T9GR 3ANNA 3HGTA 4MUIA 3WK8A 1X9HA 4AJ9A 1O5IA 3VKUA 1FL9A 1Z6YA 3GO4A 4Q48A 4IDEA 1QO9A 1B0UA 4RK1A 3I3OA 2ZEJA 2QNBA 3A3KA 3ZTTA 1EB8A 1VG0B 5EWMA 3AZOA 4JI2B 1JSZA 4JI0B 3GFOA 5CRIA 4UTRA 3W5UA 1M75A 2D7JA 3OE5A 4DJFC 3RC8A 1B74A 5DMHA 1E9VA 1IBLB 1EESA 4C2UA 4Z9AA 4OSOA 1V47A 2ACVA 2IHJA 3PC3A 5CU7A 4BJ1A 4IXNA 3P94A 4BNHA 1JX6A 2HWYA 2CXOA 5IZCC 5JVDB 4C20A 4UHJA 2PE5A 1W1IA 3V8RA 1F7UA 1TVKB 1O9BA 2N75A 3NRCA 1T91A 1YAHA 1F3LA 2WJ6A 3ZZNA 2G5TA 2VK4A 2FP3A 3AY7A 1RTTA 1DAEA 5DV9A 4KMSA 4XIIA 4W5TA 3JZFA 1CUFA 3IVAA 4JS0A 1UAYA 3MC1A 3KVRA 4YT4A 4DV5B 1GPAA 1VBFA 3MWDB 4UTXA 5J2TB 4CU2A 4EQZA 2EBUA 4KU4A 4ZT7A 4ASUA 4XNFA 4UASA 1QANA 2BR4A 4PO3X 3PGXA 4EX7A 7YASA 4V1CB 4CLOA 1CZKA 1SVMA 1L6IA 2ZAGA 3OZTA 1R0ZA 2RGEA 3MJTA 1LPSA 2P1ZA 3B9QA 1JLSA 1HSZA 2GBCA 5JXHA 4R8LA 5AKGA 3KDSE 4HVAA 2FPIB 4L3VA 1ZUD1 2AYXA 4QULA 3ZXIA 3VPFA 4DRYA 2ECQA 1PL8A 2PKWA 1DBVO 2I99A 2J3QA 1A77A 5B7NA 5IBQA 4C4PA 4EVQA 5EE5B 4NENB 4CCYB 3NIGB 4FMDF 2Q6OA 3W8DA 1E3ZA 1VHJA 4KUGA 3Q41A 4W5RA 3AIKA 2MINB 2LTAA 3DVQX 1OXKB 4HLDA 4P81A 1JI3A 1T5DX 5D3KA 1THMA 5ALIA 4BP3A 2O8CA 2PUEA 5KYYA 3UC9A 1L1QA 1B8UA 3GFQA 4UU1A 3SFTA 4JBHA 3KQVA 5LOVA 3ZD8A 4H1HA 3EC1A 3ER6A 4BEBA 2JLYA 4IJQA 2G67A 5DNCA 4EWLA 1NXTA 2ZIVB 3DO8A 5CB6A 2CN1A 2OXIA 3WHKA 5K4HA 1QPGA 3FZYA 1MMFB 2AZMA 2FPGA 4EABA 3ADPA 2BKUA 3ZIUA 1TQ6A 3UXHA 3VKVA 3ANMA 3PA1A 3RVPA 3CT6A 1EWRA 3R9WA 1SC9A 3AQIA 2OP1A 2P9QA 4P38A 4DCPA 4E2YA 5TJ9A 3AJAA 5JFOA 4YDHB 3KPUA 4G97A 5DI9A 1YDWA 1ONSA 1H6BA 1E3QA 2HSDA 2HA3A 4ETMA 2WAOA 4M0PA 1TM2A 5EJGA 3UW1A 3AZQA 1OF1A 3DTVD 3P9IA 2VQSA 4AICA 3RTGA 4CG1A 3N74A 5FHRA 4R1MA 3E2IA 3ZDCA 1DOHA 3PKZA 3SHVA 1VOTA 1NE2A 3LPAA 3JQAD 4KE8A 4BMSA 4RXTA 1EXMA 1UD5A 2DULA 3DEKA 4JB8A 4OQZA 3E9NA 3O7MA 3ZU4A 3R6TA 2EZ9A 4MWOA 3HXOA 5FB3A 4U7WA 2IOQA 2PEZA 3DHYA 2O1XA 1WPXA 4X8MA 2QR3A 4QYSA 3ASSA 2DT5A 3WMWA 2IXBA 5H4HA 3I53A 3NDIA 2GMWA 3PRKE 1WM1A 3ENKA 1VIAA 4DK0A 1UPUA 3ANLA 5SICE 3EPJA 4DJJA 1F8XA 4IL5A 4QJ5A 2RI0A 1G0OA 3P9NA 1VCOA 1I0LA 3CQ9A 5EXSA 5C7IO 3U9LA 3WLMA 5HZMA 1DQYA 4W9MC 4LHZA 3M49A 4QEDA 3IE0A 5JVDA 1CDEA 3M3DA 1XA3A 2A8YA 4C22A 4RFVA 1QP8A 1TVKA 2XAUA 4OFZA 5HBGA 4LXHA 3JVVA 2JLBA 1UKYA 4AMVA 1KS9A 4Y2RA 2PGJA 4LOLA 1LVHA 3B70A 2QUHA 3SVZA 1FMCA 1OCEA 5AM0A 3NHYA 1ARZA 4Q9NA 3CB4A 1L0BA 2JFBA 1WBJB 4MPJA 4S0ZA 5DK4A 3TI7A 1FQJA 1I1NA 2GCGA 2KSQA 1FMLA 2VF8A 3LRPA 2AIRA 3N5KA 4O4HB 4QUAA 1GSIA 1RVDA 2X9QA 3MWDA 4BV8A 2LXNA 1WPQA 3ZWMA 2XLBA 3BHJA 3PQ8A 5D2CA 2HJ9A 1SIUA 2VO1A 4ZANA 3KHKA 1UT5A 3DO5A 2VUTA 3RKUA 3B7WA 4B3CA 1QYRA 1FNNA 3HKDB 3KKMA 4V1CA 2P6UA 2ZTVA 3IMCA 3HSYA 2VHYA 1M8KA 2ISCA 3M81A 3VO9A 1PGQA 2FWJA 2DMRA 2FHSA 2W2PA 3IT3A 2ERXA 2QEXB 3LL4A 4EATA 1Y4SA 1N07A 1LS6A 1DEXA 4GNRA 2FPIA 1DAOA 1ZUIA 3ZGVA 3E9YA 4HRAA 4C01A 4D9EA 2Y1XA 4HB4A 5GPBA 1OVGA 4B4VA 1KWGA 1P60A 1ESDA 5J3OA 4QUGA 1D8AA 2JIPA 3UMVA 4LYAA 3D8RA 3VV3A 5JI3E 1WZNA 2Z5GA 2RIPA 3IUBA 3WWZA 3K2EA 1Z7BA 2FZ4A 4NENA 1ECJA 3KEWA 5EXXA 4CCYA 4DDTA 2AMFA 4G25A 4Q0MA 4E5MA 3MHPA 1ZNXA 2OXRA 1ZH8A 2MINA 1H4QA 3GUYA 2DUUA 2FE4A 3C98A 5TGTA 1VCHA 2KX7A 2J48A 3FKSA 4JLWA 1SWWA 3CRW1 4HZIA 4FYHA 2YVAA 1KFJB 2I2BA 1SXIA 4I46A 4YRRA 5KO2A 3DPUA 3WL8A 1KOGA 3PEEA 1NXVA 3MJDA 3CCVB 2BT4A 2ZPUA 3AEZA 3OPYB 4ZO8A 4EG0A 3QOXA 1Y3IA 4HDQB 3A3YA 3HJGA 5BSGA 4QNMA 1IN7A 1OZFA 2CUKA 3I6ZA 4L57A 1I5RA 1FP6A 1OWMA 2FZGA 5T3YA 4JP1A 1YKGA 1Z8HA 3PQ7A 4YO7A 3SYNA 4YONB 3FR8A 2DFTA 4KDFA 4U2CA 4Q00A 3IT2A 4QYMA 1QFXA 3OCZA 4HNVA 4JCOA 1N5OX 1ST2A 4MVJE 4BBJA 2PNJA 5I48A 3QF7A 3CISA 5LYJF 2VLBA 1DKUA 3WBFA 3A1TA 2RI1A 3R5KA 4DDKA 4B2YA 1QRDA 4C0JA 4RHFA 1EP2B 1NP3A 2YMLA 3BA1A 1VCNA 3T5BA 4QJ3A 3RTBA 4F12A 2UVDA 4FMDB 1OOEA 3IP1A 3DMHA 3QPBA 1Y9EA 3TVTA 1DRVA 2ACKA 3FTCA 3RUIA 1HT3A 3WKCA 1EQUA 3AKCA 1NUPA 1ZRNA 4NU6A 1XT6A 2P75A 16PKA 2YR0A 3PDJA 4J3NA 4D98A 1P2GA 1U7XA 3K9FC 2LE0A 3M1YA 1FLDA 2Y4OA 1UPAA 2NSLA 5SV2A 1K5DA 4KLRA 4NEGA 2BR5A 1D07A 1ZGGA 3F9IA 3QWIA 2BSQA 3ADDA 4H15A 1V6CA 1N1DA 3CLUD 3W6ZA 1GAXA 2R1UA 4AQYB 3T3NA 3R76A 5EJIA 2P68A 2P27A 4BWYA 3KKZA 4OBBA 4E13A 2A1IA 3QQ5A 1Z5NA 3GVLA 1I4EB 1JQAA 2OB1A 3KQYA 2JCYA 4IJKA 5K8JB 3K5IA 1Z16A 1AIPA 2BIFA 3I64A 5HKKA 3IOCA 1VLOA 1UFOA 3LHSA 2HLHA 1N6PA 4WUTA 1UL1X 5DDIP 2GLTA 3G49A 1T29A 1XD2B 4U9UA 1U8UA 5CIQA 1JJ2B 4XLAA 2K2WA 4GX5A 5IDQA 1UZAA 2BOVA 2JJYA 1NSFA 2YHIB 3QE0A 4FEAA 1I0ZA 4O4HA 5COQA 4OI4A 4NS4A 4FHGA 5LMUB 1DXYA 2GCNA 1SCKA 3L7DA 3HKDA 1WOPA 4GIBA 4O08A 5L6LB 1YTLA 4UREA 1VE5A 2A0WA 4D44A 5NLLA 1BMFA 5ES4B 1SUDA 2PX6A 4YRTA 3UCFA 1Z4PX 3NOQA 2WBLC 4H1UA 2ES4A 4ZAXA 3CC7B 1TCUA 3HCRA 1GAJA 4DNXA 1ZI9A 5C9ZA 5BN1A 4CYMA 2JHAA 4YQEA 3TSAA 2VFAA 2Q2VA 4QJBA 1DQSA 2ZT7A 5AKEA 1NX9A 4TVKA 2NPOA 3FFXA 3MJRA 1D2CA 3TIGA 4CNQA 3FSEA 2KM1A 1JHMA 1W2HA 6ABPA 1TZBA 1WV0A 3DL0A 2I54A 3DP7A 1SY7A 4IOJA 4D0GA 3ZGZA 3T5CA 1OVMA 1EVYA 4C7XA 2OR3A 2VDWB 2WYIA 1RHJA 1UANA 4G4SO 3RW9A 1ZD1A 2ZSKA 3N1UA 2ZIXB 2Z4RA 3T5MA 2AR9A 2B25A 1HBJA 1T34A 3CJRA 4GR4A 1I1OA 4Q19A 3PGMA 2FW7A 2WKWA 2IDJA 1QZXA 2HHCA 3OPYA 3BFXA 4HTAA 4GM0A 1BQEA 1LLFA 2PXHA 4JXJA 1SBQA 1ZIXA 4MKRA 4LY0A 3I0ZA 5EXDA 2E85A 3BRQA 4PYQA 2C3PA 4JEIA 2WTBA 1LWOA 1KY4A 3PITA 4TTTS 5FWXB 2V3VA 1YQEA 2QUJA 2UYOA 3OZAA 1M8FA 5M5BA 3RT9A 5FIUA 1OT5A 1C3OB 3OJXA 2GZ2A 1A5ZA 3MT8A 4MVJD 4V38A 4D4MA 3OX2A 4CQNA 1HOTA 1CTQA 1OXBB 1GU0A 2NUTB 5E8RA 3WTCA 1NJ8A 1VA4A 5THQA 4K46A 4OATA 2I76A 3ZTWA 4XWOA 4TKLA 2B1QA 2Z3VA 2A0UA 1P75A 3KU4A 2LR0A 2OO7A 4MJXA 1K8RA 3ITKA 4Y2HA 2RGRA 4KDEA 1XQ1A 2D8AA 5HJEA 3JX9A 2OZPA 2OILA 4YAUA 3L79A 3B1KA 2XVMA 1A96A 5CYGA 2I91A 1GTJ1 4IINA 1K73D 1V5WA 4MPRA 3ZWCA 3K1YA 4ZVNA 4KRFA 4Q7EA 5ERXA 2X8KA 3F46A 4LIPD 3T06B 2ET6A 3WBKA 3HU2A 5IAOA 2H63A 2QLBA 2I7XA 2X8JB 3R6GA 2J08A 2R5FA 4CQMB 2BDTA 3SJZA 3CCQB 3IHTA 1JZQA 3AOGA 3L1VA 4IM7A 4MB2A 1DDIA 4MWSA 4U6QA 3UJBA 4D9FA 3I37X 3OJWA 3RKSA 2CK3D 1ZN7A 3PRJA 1FFWA 5A4MS 4R2WA 2OV1A 4BGIA 3T51B 2P77A 4NXMB 2J9RA 3PXEA 5DB4A 2IV7A 2CWDA 2PD6A 3LUPA 4B73A 2OCLA 5G3ZA 3FGOA 4JP2A 5LZ7A 2Q6KA 3FZEA 5LYJB 3ZIAA 5JNUA 3HKBB 3EUAA 3L18A 4F93B 4R2KA 4Z7QB 2QX6A 3H2KA 4Y3UA 2XGJA 4PZYA 2J7PD 2XE6A 1I6MA 4QLAA 3MTDA 5AH0A 5I7WA 3DMTC 1W76A 1DLIA 1Z73A 3DKIA 3RVQA 4A36A 3HBFA 2YS6A 5D3QA 5LM3A 1ZAYA 2YC2C 4BQPA 4F9GA 1KETA 1VKHA 1YHQB 3EZ7A 1C80A 2QQGA 3M83A 3I1FA 4HPWA 2A9KA 3F9CA 3X43A 2KW5A 1FUYB 1W5BA 2JIRA 1ZNWA 3AUXA 4B3GA 2GEDA 3GRPA 3U4DA 4HAOA 2VWHA 4OP2A 1JQBA 2XHZA 1PWZA 2WTXA 4QREA 3EBLA 2QQ0A 1CUYA 1DT5A 4M9RA 3MMSA 4Z86A 4ZWNA 1H8HD 1Y4ZA 4XVRA 5F9HA 3PJEA 5GOTA 4LJLA 3VYSB 4EHAA 2FG5A 4J0GA 3SQWA 2UDPA 1URPA 3KAKA 3RGWS 3GIDA 3VPXA 4JR1A 1WCXA 3DL2A 1XRSB 1Y80A 3VVCA 3DEIA 5FUQA 1VLHA 2Z6VA 3C6KA 4RTMA 4Q7JB 1TW2A 3M4YA 2HO5A 4X91A 3RRFA 3QEKA 4JI5B 3RS8A 3IKMB 1RAFA 3S8MA 3A6EA 5EJ6A 3UAOA 3D2BA 2QRNA 3A4LA 2H0QA 4URHA 2E4UA 1N5KA 3EPHA 1K4KA 2XWQA 2VDWA 3FZGA 4EO9A 2RH5A 2CL7X 1QIFA 5J4KA 3PEYA 5FPHA 1YZLA 4GBED 1Z2PX 2ZIXA 2POCA 3L1HA 3IIMA 4K87A 2X4DA 3JQDA 4V39A 1ZD9A 1IZZA 5BWOA 2QGGA 1JFFB 2BZ1A 3LDGA 1K5PA 3CX8A 4URVR 4ZEVA 2O0LA 3I4CA 2WTEA 2GAOA 4RU1A 5I7UA 5FWXA 3F6CA 2IHTA 3DVAB 4P8RA 4PPFA 1J5EB 1XALA 3PX7A 1ILEA 1H94A 3EH1A 4NFSA 9LDBA 3HJNA 2VF4X 1T26A 3V1KA 4LYFA 1H1LB 3UVEA 3PRHA 4L8GA 2NUTA 4MDFA 2EW8A 4NICA 5AW8A 1XU7A 3F1LA 5IS2A 2DETA 1Q21A 3H8JA 4OPMA 5F1YA 5JNLA 5LXTF 4N82A 5BSKA 1T3LA 3R5JA 5BWCA 3SHFA 3QVWA 4QARA 1KJ8A 5KQSA 4YCJA 2DH5A 2EXXA 3LP8A 3CRVA 4UBIA 2BN4A 2HX1A 3VJLA 1U2TA 3H1TA 3LJKA 2IITA 3IDQA 3PP8A 1G4HA 3QXXA 3T8YA 4CR6A 4CT4B 1DIGA 1ECPA 1U8TA 2LZ0A 2PX3A 2X8JA 3L92A 3OF5A 4OOFA 1TL7C 3D64A 4NFLA 4U0JA 3TZLA 4CQMA 3FDZB 3EISA 1P4AA 4D8WA 3DLTA 4QYIB 4E5UA 3BCHA 2DHQA 3B36A 1NKVA 2CLMB 4KB5A 4ZVKA 4Q3CA 4R2JA 1H05A 1L1RA 3AEQB 5F7XA 3R6KA 1IOZA 1Z5WA 4V1CI 1P3Y1 1ZR2A 3INYA 3NQ41 1VQLB 1QK4A 3Q9LA 4D0NA 4IIUA 1Y82A 4MWTA 5HDBB 4O2LA 1SKBA 1JVSA 1PSWA 3THOA 2CLHB 3I05A 5LYJA 2ZIAA 3TFWA 4Q1CA 5TS3A 3N2GB 1NJGA 3HKBA 3MS2A 4URZR 3L7BA 3PXCX 5AW1A 4QVIA 2GN9A 1OFGA 2OBLA 3CRQA 3HO8A 2Y0PA 3ZXUB 1IPEA 1R6AA 1W44A 4JWTA 4AN0A 3BHNA 4OHMA 4JLDA 3QNWA 5KU7A 4MA5A 5TARA 3L4SO 4QATA 4I9HA 3B82A 4B3RB 1QQTA 4GU5A 1XCGB 1DDGA 3D59A 1X2EA 2VJBA 1FQOA 5JC8A 1TIKA 4XH9B 4IIYA 1X9GA 2GUGA 1ZG3A 1LV7A 2AK2A 4HEA6 4JEUA 3P9QA 4BO4A 4ECEA 1P0QA 3LQFA 1NPDA 3LLCA 3GJSA 3R3XA 4ER7A 4F56A 1EXVA 3IP8A 3JWHA 4E2ZA 4II7A 2NU7B 4FXPA 3TW8B 5JDIA 4II2A 3E22B 4GZ6A 3M0EA 4L16A 1ZSNA 3MG9A 1EFPB 4GUAA 4YS6A 4XQCA 4ZCRA 4OLBA 1G7CA 2AD1A 2QGNA 3LO5A 4JC5A 2Q9CA 2A9FA 4Y6QA 5LQSA 2CDAA 4ZCTA 1ND6A 4QTUB 3KV1A 4JXKA 1P2DA 2EHDA 4TS3A 4BL5A 4YMTA 1Z06A 3ZHXA 3KQLA 4KQKA 5AVRA 3KDPA 2JIOA 1QNFA 1K7XB 4QGGA 4RMGA 2QLLA 1D2NA 3MHTA 1ECGA 1VBMA 5A3QA 3F8TA 1I36A 2GETA 3NI2A 2FWAA 2NN3C 4W5WA 5A4AA 3N2IA 4KC0A 2Y2UA 3B2QA 3BIOA 5KTRA 2FTKE 1Y6QA 2GEKA 1JFFA 3A04A 4HQFA 3RVNA 4PTYA 1RRPA 3GWZA 4I8DA 1HGXA 1H5UA 3AJ9A 3D7KA 4JL6A 3U3XA 2OZVA 4AZWA 3PFBA 4NZ9A 4U1RA 1OWOA 3DVAA 4XTRA 2EBFX 4HATA 2WILA 1MH1A 2CMDA 5JMOA 4KKSA 4OOSA 1GGNA 2EL7A 4XDGA 2LBPA 4HQLA 4XE5A 3F5FA 4INZA 1H1LA 4Q1BA 2QJTA 3W3AA 3L7MA 4OIMA 4WMLA 1ULHA 3FMPB 4L9WA 2WWFA 5AHWA 5ADUS 2X40A 2HCJB 1E6LA 4X6UA 4E5VA 3AERB 4TROA 4LRSB 1PS0A 2HYDA 4LY6A 2QXTA 4FGKA 4JL8A 5FWNA 3ESYA 5AI6A 2QMYA 4G8BA 5CDTA 1R8XA 1VJGA 5LA6F 1G63A 3OQ6A 1G7RA 2FSVC 4OBWA 3HN2A 2XZOA 1DE0A 4PW0A 2NO0A 3LY8A 4P98A 3K6SA 2WICA 3NEAA 1F2TB 1GDHA 1PWHA 3FDZA 2W6QA 4QYIA 2G6TA 3MOIA 4AJ4A 1ZIPA 3F78A 3V42A 3DH0A 1L4FA 5AR1A 3AEQA 3ZV7A 1R18A 4FWBA 1HG0A 4R8MA 2QD1A 3PYMA 2P7HA 3KZNA 3WLPA 2RHDA 2CUZA 4HIZA 1G42A 3E3OA 5C4MA 2ZKIA 3IVCA 1VP3A 3RD5A 3ANSA 4U02A 3Q2KA 3KL9A 1AKEA 2VHTA 4R1SA 4RENA 4IGEA 3U1TA 1AX9A 2WMNB 5LQDA 5C51B 3N2GA 4PSAA 4LZZA 1IB6A 1ODLA 3I73A 4CEJB 2P4SA 2WJ4A 4R1QA 4AKIA 1E9CA 4UU7A 4ZC1A 2VPWA 4M0KA 5LXTB 3QU5A 5EXEA 1SUFA 2ODTX 4YB8A 3OAAD 1K86A 1IULA 1P7CA 2P5YA 1T6YA 3QU9A 1QP7A 3MK31 5ILGA 4DIOA 1NNEA 1S4QA 3QVKA 1X39A 4RK0A 4L8LA 4XWKA 1A5TA 1K2WA 2PU5A 3EEIA 4YT5A 1GTSA 3CSSA 4D57A 2VDUE 4LSWA 1TYAE 1JYFA 3RHFA 1TU3A 3DCYA 3NH9A 3LFTA 3A2LA 4GWLA 4DV4B 3RYIB 4M83A 3AJRA 4JU9A 3SFVA 2HU7A 3W05A 1TD1A 1D09A 1W0CA 3DDNA 2A4MA 2NU7A 4HQOA 3EVZA 3TW8A 5A3VA 3E22A 2BPOA 1VPVA 3A37A 3DKRA 1MVOA 4N54A 1EFPA 3N6XA 4BYMA 4EG5A 1E1NA 1NJID 3H7IA 4FFLA 3A27A 1Z2OX 1IFXA 3BE5A 4U3JB 3WGLA 5AUPB 4M22A 4BGUA 1RKBA 5F64A 4PG7A 4D8VA 4J1TA 5CVEA 3G9TA 4CRWB 1K28D 1S89A 5IKPA 4OFWA 2P91A 2NV6A 3HJUA 2I9PA 3KAPA 3Q3IA 4KN5A 4BEWA 1SCJA 3I9V1 4DPLA 2AMLA 4CI9A 3SLGA 3BE6A 1C5KA 1RWWA 3QKWA 4HMOA 4IDPA 3HUDA 1YGPA 5I4BA 4P54A 5J2UF 2CY0A 4JYCA 2ORED 1H1TA 4MYRA 4DQUA 3M6MD 1F0NA 4KKVA 3AGQA 4AD8A 4D8XA 3IP9A 4UE6A 4XRGA 3M5DA 3F2IA 4L9AA 4OQMA 3D8NA 1XZAA 3K70C 3HA5A 3IEIA 1KOLA 5DS0A 4CDMA 5INTA 2O6HA 2PVCA 4HP8A 4ZO4A 4RMHA 1YITB 4G5OA 3TTVA 2OQIA 1TEHA 5DX1A 1CUCA 2CZCA 2Q5CA 1C1HA 1K4MA 1WPCA 2GNAA 3JASB 3KPYA 1ODJA 1W36D 3AERA 1J7KA 3CCMB 3AVUA 4JOQA 5BSUA 3TRFA 1MAWA 1U4OA 1JHOA 5DCYA 1EZ1A 5JSQA 3OTGA 3A3GA 1AKYA 1VFNA 4IDFA 1SD2A 2X1HA 3BD6A 3CB2A 5F2OA 4HQRA 3GRRA 5EKSA 4GVXA 1KYIA 2DHCA 5B6JA 2WUFA 2WVJA 1NLUA 1F2TA 3ELWA 5ECWA 5FLKA 5BW5A 3DAGA 1UBOS 4J7UA 4R1UA 1RYDA 4OHBA 3D7MA 5B53A 3Q6MA 2OECA 4RHEA 5HRAA 2FH5B 4HAIA 3PDWA 4XD7A 2J1LA 3L02A 3KQQA 3NAZA 4NCNA 4TMYA 1YH3A 2JARA 1S3IA 3WMXA 3HK2A 2BM1A 4RGVA 1IOLA 2RBGA 4K9NA 2GSWA 4TWJA 4Q3DA 2YXPX 4CEJA 3N8IA 1M90D 1F8YA 2C5GA 2O8VA 2OQ2A 5IUNC 4RPKA 4Z4WA 1OYYA 5IDXA 5LXTA 4FZ3A 1LS1A 4XRRA 1JIXA 4FGZA 4MI1A 2WTMA 4MEAA 4EP1A 4AW9A 4F38A 3V1UA 4BMXA 4GP7A 3KQSA 2XTNA 3ZVLA 4P3PA 4G5FA 5B6IA 1BFDA 1KJQA 2OORA 3ENNA 5LA6B 2HIMA 4D6PA 5A9SB 3SIRA 3W90A 4J07A 4KKXB 5G02A 4PC6A 4JLUA 3NV7A 4KE6A 5CX1B 2OOSA 3PD0A 3GA7A 1Z0JA 1T0HB 1ML3A 2DSTA 4JOCA 5FL7A 1IIRA 3AOEA 1GEEA 3EGDB 1WR8A 3D6VA 4PTZA 2ERCA 2WMOB 3RYIA 5CX4A 2FPWA 3HCAA 3H3XA 4ZVSA 1DG9A 4B85A 1LPMA 1NA5A 2QTGA 3ELBA 2OLEA 1XTZA 2BUAA 3P97A 3L8HA 3TPCA 4INJA 2B8JA 3FN4A 2Z5LA 1A9XB 2BSAA 4AMYA 2XVXA 1MH9A 2C3YA 2I1QA 4FDLA 4OP3A 4WD3A 3L6CA 1H2FA 1QZ3A 4U3JA 5TC4A 1MR3F 3NXKA 4G1BA 1DWQA 3L01A 5CXUA 1CNMA 1R16A 3PQ6A 4BJ3A 2BGGA 3SZMA 2B30A 3OCWA 3KKLA 4EA9A 3ZUGA 3AP1A 2IY7A 3OBIA 4M7RA 4YMWA 1OKKD 3COJA 3ZBUA 1GPH1 3E03A 4J6EA 5JMPA 3TBHA 2FUEA 1BWSA 4G5YA 4GOJA 4RH0A 1FY2A 3S0JA 4CLXA 2F4VB 2BISA 3TJMA 3U61B 1P62B 5A71A 1CDOA 1EK0A 1SU7A 1Y42X 4QBTA 4J0JA 1L3BA 2WAAA 4E51A 2WU8A 5H68A 4RH1A 1L6RA 1RIIA 3NHZA 2CSXA 1A3CA 3GRVA 5K03A 5CEJA 1JIVA 4F91B 1JAIA 3DB2A 3H4TA 5AVQA 2XUGA 1VC2A 2W4QA 3RFXA 4AMUA 1RRCA 4L27A 4ATNA 4JI1B 1S1MA 1WORA 3PVDA 4KN6A 4WINA 1YO6A 1PG0A 1OBHA 5FNVB 4HJXA 2QJOA 3DKPA 3JASA 1G20B 1Z0DA 2NVWA 3NAMA 1ZJ5A 4HF7A 3WGKA 4BWVA 4RVGA 1ZYUA 5K3SA 3AF6A 1T1EA 2RGXA 3C14C 1TX4B 2VWGA 3LC1O 1KYVA 4BVEA 1EWYA 1V96A 3GAZA 3U3MA 1NW8A 2OFOA 5BWMA 2ONJA 5FTKA 1KVUA 1E5QA 1VIYA 3DVLA 2TSYB 2I8AA 2R5WA 3C5EA 4QBHA 5F1KA 1C4XA 1AV6A 2WJWA 5J2UB 3JQ9A 4O4LF 4Y2JA 1PFGA 2VQFB 2YS7A 3LWBA 1ZSYA 4OPOA 2GH1A 1L5SA 3LFUA 3RWOA 4H7PA 1C7JA 4BFYA 5C1PA 2B35A 3LDFA 3N7TA 4M60A 1IMOA 2HA4A 1OWNA 3CXRA 3HUEA 4OQPA 1FDOA 2JI9A 3B5IA 4I1IA 4W7IA 1DFHA 1RDFA 1QORA 4M1EA 1CHDA 3C8MA 4RYDA 4YEDA 4ZEWA 3DKVA 3HUTA 1QLWA 5ALHA 1YZTA 1EXDA 1DC6A 4LC0A 3DW3X 4HPXB 4MVJG 2PGNA 2ZBFA 4R1LA 1KWKA 3DDYA 1UPCA 2AUMA 3K0BA 4QPDA 4WUVA 1XE3A 1J33A 4NJMA 2WIBA 5HP4A 1IJBA 3C85A 3PTZA 4M1OA 2HAEA 3GUHA 4MGKR 4O1IA 4B7CA 4WKBA 2PUWA 3FUCA 5I8ZA 3EG5A 2XVZA 4MLZA 1MB0A 1DT3A 2Q3JA 4LMAA 5AJHA 3QKTA 1RLMA 5LA6A 3WLQA 1EK2A 2ZJZA 3LPDA 5A9SA 1H5NA 1L5RA 3BTVA 4M8NE 3W6OA 5I9IA 4JDPA 1SELA 1B3RA 5CX1A 4CL3A 4GFDA 5ESRA 4B3DA 3GN2A 2B4AA 3FLAA 2FPLA 5A5DA 1T8WA 5ALSA 3DVRX 3EGDA 1GXSB 4J4HA 1WL8A 2J9XB 3KWFA 3E5RA 5TQ0A 2O19A 4LJ4A 3G2LA 3DEHA 2QW0X 1O2DA 2OCPA 3BIXA 3OFSA 5E0OA 1VG8A 2I33A 1QFYA 2JF0A 2YVQA 1PKVA 1XDZA 3PWKA 1A9XA 2JFHA 2XTAA 3F4LA 4CNBA 4Q12A 3WNDA 1YNOA 2QSYA 3PC4A 3EPKA 2HC9A 4P0QB 4DABA 1YONA 3KM0A 1OTHA 4KIGA 4UE3S 4MW5A 1QZUA 1Y1QA 3RBAA 1RKXA 3E9CA 4XSGA 1VBKA 2X13A 3VHQA 3HTXA 4HQKA 3HBJA 1YNSA 2C78A 2BL4A 3JVIA 4TTVA 4Y9RA 1XJ5A 4PAWA 2OO5A 2W2QA 3IB6A 2J32A 1T43A 3C5VA 4ZHSA 1YDEA 2RGBA 1ZUHA 2NTJA 5KWJA 4DIDA 4F4DA 4UM5A 1P5FA 2G9RA 4DIUA 4EFMA 3IMKA 2NX2A 2JD1A 2PL5A 2NSDA 2E3JA 4K6HA 4J2OA 3PB3A 4UMDA 5CVUA 4UZSA 5IARA 1WDTA 1RQPA 3GLVA 4DIBA 1KPGA 4EPYA 2H1VA 5HIMA 3M6UA 1L4MA 3VTFA 1WO8A 1A5AB 1Y1RA 5JS2A 1R15A 1USVA 1SCIA 3PEVA 1CJCA 1PR1A 1CZHA 4I4TF 2PT9A 2D1TA 1JMKC 5A0VA 1KSHA 2ACWA 1MRZA 4TQ9A 4EKYA 5FTNA 3KEMA 5FNVA 1FDSA 1PL6A 3BX1A 5EMMA 4R7ZA 1UDBA 3NT4A 4XN0A 1KFBB 1G20A 3RVDA 1AS2A 2OCDA 2XYPA 3JQCA 4EPWA 4E03A 1QRSA 1J06A 1VHOA 2F3PA 3QXGA 4KRXA 2C0CA 5JAMA 3ND8A 4B3JA 1MNQA 5BQ3A 4JUCA 5DN6D 2DQZA 2H4HA 2QM8A 3V46A 5FEMA 2C2GA 5KX5B 3TFQA 4H4DA 2PVPA 4R40A 3ETNA 2QAGC 5DPMA 3W77A 1GLNA 3ZU3A 1MEOA 1H65A 5J2UA 3WLEA 5DBOA 4EUFA 3ZD7A 4B84A 1ACJA 2CVZA 3NYQA 4GLOA 3OZWA 3DDWA 1HFWA 4FCWA 1NL3A 4NEHB 5KMGA 1Y8CA 1LDGA 4RDXA 1E6UA 1E1QD 1B0PA 3OM9A 3MFQA 4B81A 1RQGA 5ESXA 5E9WA 4IMIB 4MUAA 3EFEA 3J81A 2E4XA 1T6NA 1P29A 4R2XA 5DOZA 4WTOA 3KIPA 1P45A 5AOAA 4OREX 4AKHA 1SKAA 4HN2A 1SCBA 3O1IC 4N18A 4M9ZA 5EMJA 2YV4A 4L0MA 5GTDA 3SX4A 1TB4A 3R4VA 4B76A 3PUZA 3PUNA 1VQ8B 1DWUA 2BM9A 2BY4A 2FXIA 3MRXA 5FTMA 3NHUA 1Z5ZA 3OO1A 1BEUB 1X38A 1VCIA 3BXPA 3NHWA 4XYBA 5K0NA 1IOWA 3ZHRA 4BP1A 2RGUA 1X13A 3C74A 2FY8A 1YL6A 3MCUA 2F3TA 4EYOA 2Z08A 3CF4G 4BFWA 1P5RA 3L5OA 4HVLA 5IJ0B 4M53A 4O4LB 1FP1D 4XDHA 4ES6A 1GXSA 3DOFA 3HYNA 3KT8A 1Z6ZA 1I2CA 3T3DA 2O50A 3WK5A 2J9ZB 4EMTA 3R8FA 3ROEA 2ZDQA 4HJRA 4YJDA 2Q5HA 1U1GA 4UDOA 1U0JA 3AF4A 4AG6A 1ZM2A 3FPPA 1UBNA 2Q7XA 3K5PA 3L93A 1VL6A 1Q6ZA 5DTJA 5CT4A 3UICA 1UMCB 4J49A 2XMSA 2BGTA 1M2NA 2HWUA 4XR9A 4YK7A 2N1MA 3WGMA 3S7TA 1C0IA 1XMIA 3G79A 3IOYA 3NHKA 4UAUA 1SXJE 4X0EA 1I14A 3SBXA 4A10A 1IHDA 4Z51A 1H4SA 1TAUA 3TLXA 4IICA 4CG0A 4IGFA 2CHVA 2YWDA 3L0SA 1YIDA 1KI6B 2Y6UA 4MVCA 3S29A 5JR3A 1OAAA 2Y05A 2YMMA 3TQQA 2W48A 1VQ6B 4CLHA 1A9RA 4IEIA 3RU7A 3WQSB 4BN5A 1B93A 3BK2A 4WZZA 2OD7A 1ZP6A 3NHBA 4KIJA 2GPNA 4KN8A 5B4TA 4DYVA 1JHYA 1Z07A 3HI4A 2WJZB 2VIIA 2IXAA 4QELA 3CKYA 4NZZA 4CPDA 1PD0A 4QOFA 5B3JC 5BRAA 2CT8A 1N1GA 1WKVA 2HBQA 4DIFA 1H1DA 4QZVA 3PEFA 5K45A 1NJFA 1PP4A 2Q6TA 4ZT2A 3AVOA 4CIXA 1PI3A 1N5RA 4RY0A 2WWIA 4V0LA 1QR6A 1DBPA 1Z5GA 4KYVA 4N7JA 4CUKA 1J49A 3FCSB 3NUQA 4TLCA 1AKTA 3B8HA 4HB2A 4UUPA 3PLNA 2A1TR 1NVFA 2PH7A 3CVOA 221PA 1ZI6A 2JEYA 3PUIA 3E35A 4PO9A 2XCSB 1QCZA 2ZSFA 3JD1A 2B9EA 2PXAA 2OFPA 1I3LA 3UJ3X 3JYPA 3OZCA 5KC8A 3BXEA 3PVSA 3Q3HA 4FMPA 3DOUA 4LK3A 1G2IA 1DG1G 5TPZD 5KX5A 1XDSA 4WZBB 1WUJS 4QO8A 1AGRA 2O4UX 3B1WA 2OVFA 2NMVA 5BV8A 4TLEA 3UH1A 3LNCA 2PT7A 3DCJA 3G6KA 3R5FA 4WESB 3HJTA 1AZLA 4D56A 4DSZA 5EKTA 5JJ5A 3UMMA 5E3JA 5IXYA 5KBYA 3I9JA 4UU0A 4Q34A 4XQFA 4B6SA 2BI8A 2VKQA 3F6RA 1O96B 1Z9BA 2WOJA 4YIHA 3NIDB 3N53A 4P4LA 3U7JA 3THSA 1PJTA 1IEQA 3PHIA 3ZY4A 2GPYA 2OCGA 4I4TB 4D42A 1N5MA 4QX6A 1DLJA 4TLAA 2IBSA 4LZAA 4QBKA 3IUNA 3DD5A 2HF9A 3OOJA 3WL5A 5J47A 1YS9A 2XYVA 3VOTA 3QYPA 1IH8A 3VDNB 4BVHA 3KALA 3WOVA 3C6BA 2D2VA 4JNCA 4OF4A 4XIYA 4AURA 2XBLA 4PNHA 2LUOA 3L1IA 4R84A 5IFKA 3PQ4A 2P2SA 3VMMA 3JQ6A 3O4GA 3C97A 2VLIA 3NG1A 4PCLA 4RKRA 4F5DA 3AFHA 4Q1FA 3CD6B 2YUIA 3BVPA 2GS9A 5F2NA 5IYZB 2IBTA 1GSHA 2DP4E 5IJ0A 1P7VA 4O4LA 4KQXA 3N2LA 3GZ4A 4KN9S 4KVFA 4PFQA 2EZTA 5AK6A 4ZMSA 5KVVA 3MPOA 2HXGA 4FC7A 4MH0R 5ALZA 2BFOA 3UKOA 2AYZA 2C20A 2Q1UA 3COPA 3HJAA 3N3AC 4ND8B 4P53A 4OOEA 3T53B 1NVBA 2JFGA 2VI5A 1H4TA 2H5LA 4FBGA 4ESVA 3QEAZ 4MYSA 4MPDA 2V7BA 4PLWA 3LT0A 4JJFA 3DLIA 3IOBA 1VGQA 1N3BA 5AI9A 4HB3A 4DRZA 1HUQA 1HNXB 1UMCA 4YCSA 2XMZA 2P5UA 2VOJA 2VBVA 4Z5XA 3I0NA 2G25A 4IQFA 4J2TA 5C8YB 1N1EA 4UPEA 2BKEA 1QGZA 1EXWA 3B1XA 2MSNA 3FOWA 4JZYA 1J9GA 1FS5A 3CP2A 3ZCPA 1KI6A 1MAAA 4OXQA 5KZMB 4U5QA 1U3VA 1ZIYA 2EW2A 4NSNA 5EIWA 1QGDA 3I2FA 5BSTA 2AEJA 3WICA 3P0FA 3V5NA 1BKDR 4Z8XA 4MIOA 3GLQA 1NXSA 4NYMR 3C5WP 3TEMA 1JWAB 2SICE 2GO1A 3KL4A 1PDWA 3NOXA 2QUKA 3TQIA 4BTVA 5JRJA 1A8SA 4DV1B 2ZROA 4OHWA 4D4JA 2DR2A 5AHRA 4LY9A 2JKZA 1QYIA 2PZMA 3CESA 1YQUA 3CPHA 5JY6A 3QW2A 3UAXA 4BNIA 4JI8B 5JMTA 2BTEA 1UADA 1Z6XA 4Z1MD 1PIWA 3FFTA 1W5TA 2GF2A 1G60A 2YICA 4BLPA 5J4HA 4C2BA 4DIKA 3RBVA 4UPVA 1CIJA 4YQFA 4NBSA 1RYNA 3A36A 2QDXA 2N46A 1K0FA 3E58A 1YL7A 2W6ZA 1N2HA 3H8WA 2INGX 2RONA 2PZGA 3HA2A 3HVKA 1IQUA 3VU9B 2KPOA 2HLDA 3VNUA 2ID9A 3QYJA 4J0EA 3T34A 3DQQA 1SKYB 4GQAA 5FBVB 4JMLA 2WYWA 4YRQA 4KRYA 2F90A 3TNJA 3HXPA 3OHMA 4GXQA 4OJYA 4WZBA 2MDTA 4GKBA 1TNDA 3NBQA 3OOYA 1V7ZA 4J16A 1QCDA 3RARA 2FPKA 1EHCA 3HBLA 4WESA 1LA2A 3SHTA 1U2DA 3PWSA 2YFKA 3JU3A 4MVXA 3IV7A 4JZKA 1G5TA 2GASA 1E92A 3TTXA 2WF7A 2ZIZA 1KVQA 4R8KA 1I5EA 2GK6A 2WM9B 2PQMA 2QN6A 1EINA 1O96A 1ZVKA 4DQXA 5JNVA 4RMNA 4HRYA 4AZTA 5K20A 1T2AA 3AHCA 4KIFA 4Y8VA 1V6SA 5CDUA 1U9IA 4I4TA 3BF8A 2C7RA 1PJRA 3JQPA 1QHFA 1P8JA 4GXNA 1MN6A 5IDWA 1H2YA 1G3UA 1GY8A 1P61B 4L0CA 4Q3KA 1WU8A 1C0LA 2VPXA 4ID9A 3NLLA 4YAIA 5DXFA 1XROA 1ZVMA 4FE4A 2NQ2C 3GEEA 3KOOA 2C9DA 2PMWB 1Z15A 2W2NA 3ESZA 3GFTA 5K1ZA 4GC9A 1NWHA 3DHVA 2VR1A 5KYKA 2CLOB 1XWIA 3HS3A 4XQ9A 5TT1A 1CJVC 2FWRA 3ZPXA 5IYZA 1E94E 1KARA 3CG0A 1W73A 4C4OA 5IWCA 2PSEA 1L4KA 1GA6A 1KJWA 2AMYA 2H4YA 2HJHA 1SG6A 3IE1A 4P7JA 3NCHA 1N0WA 2FMHA 4B32A 1Z4KA 1YCFA 1CZUA 2UYYA 2O8NA 1YK0A 3MMZA 3N8GA 4ND8A 4DPMA 5I4KA 4BCDA 121PA 2CFSA 1NJ6A 5DISB 1P8AA 4A5SA 3LY9A 4FDTA 1F0PA 5EE0A 3BMCB 2NVUB 3RJTA 2VDRB 1YVPA 2RGAA 3KUUA 2WEKA 4B45A 1N8TA 2YW2A 4BFLA 3W5CA 2F4NA 3F97A 3O8OB 5C8YA 3L7JA 3L0PA 1AURA 3PXBA 2FSUA 3QE3A 3OW2B 1V4NA 3D4PA 5HWSA 3PCXA 1FYDA 4DZZA 1T8RA 1RJWA 2Q29A 4DB4A 4V0MA 4CMKA 3O73A 3W9UA 3UGJA 1BVYF 1YR2A 3HCNA 1X0XA 2I4RA 4N5LA 3PD1A 4A5OA 3NJRA 3T9FA 2ZZGA 1P9NA 3WFZA 3K0EA 1XNGA 5COBA 2P9ZA 4ZGNB 2AL7A 3BMQB 1C2YA 3FLEA 2Z43A 4P6VF 1DIRA 3D2AA 3SJCA 4BB5A 4Y0NA 2ZIUB 4PGOA 3CUKA 3PC6A 4S1TA 4BJ5A 2FK8A 5JS7A 1PWXA 2WG2A 4LN1A 4TLBA 4AZVA 3KSUA 5A88A 1ZK3A 4AT1A 1U9CA 1OI2A 5LZ5A 4P0TA 1M34E 1DO0A 3OZSA 3C3BA 1OX4A 5BORA 4QM7A 3H6KA 1VM6A 3BUSA 4TRMA 5ALFA 2VA9A 3A7EA 4BZQA 2HA6A 2JH8A 2R7KA 3UATA 2UU9B 3PC7A 1KH3A 2DJIA 2YQ5A 4Q47A 1Q22A 2GILA 4U2DA 3RRXA 2JG3A 1PR5A 3Q3JB 2UUOA 2ZJ2A 1GYRA 5CG1A 4KFRA 2HT6A 3OPQA 3VU9A 3FF4A 1FW6A 2J30A 3CH6A 1FRFS 3HG7A 4UHBA 3DZJA 3VGPA 2ZT5A 3HZHA 4HAUA 1K9SA 1QV9A 1ZVVA 3FTEA 1M73E 4QVJA 3PX2A 1I7SB 3OOWA 2CB9A 3M6VA 4MRMB 3VGJA 3RS9A 1DCKA 3F67A 4MR9B 3A1DA 2IZ7A 3EA4A 3U40A 4HVTA 2ZUCA 5AXDA 4HRXA 3FNFA 1NX6A 3IAHA 4LBZA 3W1EA 3VXKA 2O52A 5J63A 5CCEA 1BYUA 1AO0A 2O07A 2WSSD 1W9XA 1PFQA 2X0RA 3RAJA 3VTKA 2G1AA 2CCGA 5JNSA 1QIIA 2QSUA 2HREA 2Y2VA 2WJPA 3LBFA 4JIGA 5DEOA 3VR6D 2JL1A 3SGLA 1OWLA 1RFGE 5P8WA 4CQLB 4GRDA 3V7NA 4L85A 3P71T 4D4LA 2IX3A 4MKZA 3B51X 4DMGA 4WW0A 4IZOA 2E37A 4WK2B 4EW6A 2UYGA 3ILVA 1DU4A 2DKOA 2FUCA 2A9QA 3N8KA 1KAQA 5FQOA 3VPDA 1I4OA 1TO6A 3I2HA 3I72A 1NN3A 1IJFA 1CZNA 3WTBA 1F2VA 1WZ2A 4NZNA 2C5LA 4X84A 4LOKA 4DA9A 1PV1A 1ZH2A 1KMQA 2QL6A 3CMEB 2H59A 3DZIA 2O7VA 4ZO9A 1R00A 1FJXA 4TWBA 1WXXA 1NPTO 2A84A 1PTKA 1M6VB 1VSTA 5KW9A 2X5KO 2C3UA 2P3QA 3TQSA 5AFSA 1QDEA 3EMDA 3ENWA 5LFAA 1HI9A 2VP4A 4JJ6A 1V7QA 5FWYB 1L7BA 2B20A 4I36A 3LC2O 5A0TA 1EVQA 4N7RA 3CPWB 2ONYA 5ER9A 4ZV7A 5HZKA 1JBQA 2RAPA 1GUBA 2DQKA 4KXYA 5C52B 2CDNA 3OHSX 5K2MA 1MNAA 3D02A 4FDAA 2K4MA 3A2KA 4OK6A 4XPIB 3SD7A 3T3HA 3ZTYA 2R751 3GEBA 2X8WA 3ITEA 4S04A 2NVUA 4YALA 2OBMA 3BMCA 4LTDA 3UUGA 3KJGA 4XGIA 3DS8A 5JU6A 3E8XA 4K9LA 4J0HA 4IJ6A 4JB2A 4MVJF 3O8OA 3DCIA 2NZ2A 2O7RA 2XGMA 4E21A 1ISHA 3B5JA 4IVPA 3CBGA 3C8ZA 3AR9A 4NE9A 1JEJA 3U13A 1XRLA 3AR5A 4R1OA 4S3MA 3Q3CA 4RWEA 1ATIA 1K6IA 1QVZA 3NUGA 4JB0A 4Q6WA 3WISA 1KFKB 3BMQA 4LYGA 4JBXA 3AFOA 2EWWA 4FZVA 2EEPA 3GVCA 1YQDA 2JI6A 3KX2A 3WSWA 3ASQA 3IYLW 3QVXA 3FNEA 5H5JA 3IBTA 3OWOA 2XXAB 1AUVA 4Y7CA 1IUNA 1MC5A 4QWWA 1GHTA 2HF2A 4UHFA 2QQEA 2UAGA 4YTEA 5C34B 3W5DA 3PR2B 4QHSA 1V7PC 4CIBA 1EDOA 5HUJA 1IN1A 3BDAA 3SDBA 3G0BA 5CB4B 3UT5B 3P9KA 4UNSA 5TQVA 1DBIA 2AG5A 1M8PA 3FRJA 1VL0A 1HNZB 4EMSA 4YRJA 4B6QA 2H1FA 4UQLA 1YMUA 4Q01A 2ZJAA 1RWOA 4KX3A 2X2PA 2D59A 3AG5A 4E5YA 4NR0A 4WXYB 3RSSA 3HJCA 5MGBA 3AFNA 3E3MA 5HF9A 4AUMA 2QENA 3FGPA 3RM3A 4D97A 1CDZA 3ZEAA 4BLUA 1E2UA 3EIXA 3L8MA 4RGYA 4KI0A 3L07A 4MRMA 3O26A 2E4YA 5EMLA 4MR9A 1WDLA 3LWZA 4BKMA 2E82A 1FTGA 3K05A 1X8XA 2B69A 3P52A 4UBLA 4P31A 3TD9A 3L4BC 5HA5A 3RADC 2ZITA 5L3QB 4EG8A 3ADCA 1BMQA 1GCIA 2VF7A 3OU6A 4WX2B 2CRVA 3JSXA 3PZBA 3MCWA 4ZQHA 3WV5A 3T52A 5LD2C 4TMZA 2HEIA 4ZT5A 3UNXA 4CQLA 3LPNA 4EENA 4WCFC 3H1BA 1YUMA 3LSTA 1BRMA 4UCWA 3L6RA 3ZDYB 1UDWA 2V7GA 1ODTC 3FTFA 5FT9A 4GRIA 4M0MA 3TQOA 5EZSA 2XMPA 1ZN8A 5T8KA 2Q9UA 2YZMA 1WE2A 3QBDA 1DDOA 2Y0CA 3HN6A 1J7JA 4XUGB 5KREA 1AV7A 3K4PA 3DMFA 4XKVA 3EARA 2ZRMA 3OCUA 2IPOA 4LPKA 3A6KA 3NW9A 1NATA 4YO8A 3QENA 3MS4A 2PIAA 3F6BX 1WMSA 4OQQA 3VR0A 1E6CA 2REBA 2JBWA 4ICIA 4L6CA 2HXYA 4JMQA 1M6VA 4XXHA 3O83A 3RRNA 4PS0A 4YMSA 3I04M 1HDXA 2ZYTX 1WZEA 3WKEA 2X6XA 5FWYA 2WJJA 5TVKA 1AG9A 2QG9A 2NZXA 2WMDA 4W5NA 1NDQA 1CIVA 3FYHA 3UY4A 5J4YA 5LIPA 4Z4HA 3L49A 4JBWA 1EVEA 2QMUA 5J1TB 1FUEA 4X7PA 1RXEA 2C2KA 5EYPB 3S8YA 5L6MB 1XDBA 2I2XB 3EHEA 4X3CA 5T4FA 3WMRA 1NM5A 4CFZA 4XPIA 3Q8MA 3CCRB 2W6JA 1S2NA 3CNBA 3K6JA 4D9CA 4KREA 1N2CB 2WZQA 1CUWA 3K9QO 4G07A 3CM0A 4RH3A 5A3SA 4MHSA 5HNKA 3CFYA 1B16A 3L6DA 3R0VA 5KYXB 1NW4A 4IXWA 4NONA 2WWXA 1LSJA 4IZHA 4ANFA 4YT8A 1W6UA 4H0CA 3ANYB 1KKMA 4LC1A 4Y98A 2F8LA 1AUXA 3A2MA 4CDNA 1UODA 3UOAB 1EDEA 1SBNE 3WIBA 4DMUB 2IXGA 3ZI4A 2QL5A 3QWBA 1G8JA 1KDRA 3I42A 5GQSA 3UJDA 1NBMA 4LCEA 3TLMA 5IYRA 1R0SA 3AW8A 1RYYA 2P5TB 3A2NA 3A9SA 3NE5B 3PEUA 4I1OA 4WY5A 5EP4A 4W1QA 4KH1A 4FYMA 2ZBEA 5ALYA 1L5NA 5LBTA 1YRWA 5BYKA 3Q3AA 1UDXA 4WKOA 3W7BA 3N05A 4PZ0A 1CJKC 2JGIA 1YRBA 2XNSA 3DLCA 3WAJA 4FEYA 5DX0A 2AZ4A 5EAIA 2J7KA 1WZCA 3SE0A 2QWXA 3KPJA 1X1RA 6NULA 2X3YA 2C92A 4D45A 3I3SR 5CB4A 2J0QA 1NRIA 3UT5A 1SUAA 4B7UA 1EUYA 5ED0A 3ZQUA 4F97A 3DHWC 2VHWA 3TO5A 4DR7B 1UKZA 1ECCA 4MO9A 3V33A 1ZKMA 3DE3X 2GX6A 1FSGA 3UJ6A 3WMEA 4LF5B 2JJ2A 1P9RA 2AEEA 2OQVA 4JSYA 4DUYB 2PR7A 1QONA 3D6HA 4NPHA 1E1LA 1C4WA 2GTHA 4TQAA 2GXSA 2VK2A 4DBLE 1Q0PA 4E30A 4HEA1 3FRIA 2DUJA 4LGCA 4NFYA 3RF6A 5K4AA 4F8JA 1NQTA 1NN5A 1NUAA 3IESA 3NJ4A 1U2PA 2LW7A 4W1RA 4C03A 4P22A 3BL6A 5GVRA 1X77A 3I9OA 1G9XA 2FN3A 4I1YA 2H1HA 1K27A 4R8VA 1KP9A 3A26A 1XZMA 3EC7A 1W35A 3LQ4A 1A5BB 3NWPA 5KJFA 4G0UA 2REOA 4OL9A 1V5EA 1B1AA 3IAS1 3KVNA 3O3NB 2V59A 4FBLA 3V1YA 3GW8A 4RD0A 4QBIA 5B1SA 1QTIA 4FX5A 1V2GA 2PZBA 3MTIA 4AYTA 3WA6A 2QLJA 2OFWA 2A59A 1QLHA 3MTGA 3FPAA 4CM4B 2DF8A 2WSIA 4NBTA 1SPBS 2HSJA 4YWHA 1QGED 3IO5A 3DOEA 4Z4ZA 2DSNA 5L7WA 3ILSA 2W71A 3T7KA 4N0DA 2FSSA 3F5SA 3I2IA 5K09A 4IIHA 1OB0A 1YLOA 4ZEMA 2AUTA 1O95A 1FIUA 4WGGA 1Y0YA 3PD7A 1C3JA 4DANA 5D1NA 1OHHD 4XVUA 2QTCA 3BXOA 2ZAOA 1P4HA 3WBBA 2PRIA 1IBSA 5TGDA 4G89A 2ZK7A 3CEMA 3L8CA 2B7BA 2N0SA 1X1CA 3FPBA 3H65A 4RK7A 1TD9A 1CE8B 5EYPA 1FFEA 3B9BA 5CTJA 3E3AA 4PBRA 5D5HA 4ETIA 4RTPA 1Z8DA 1GYPA 3H2GA 3HGMA 4M7OA 1NRKA 1M66A 3C43A 1N2CA 1ULUA 1Y8AA 4OU5A 1UWVA 1Y33E 1J0AA 1CUJA 1NAIA 1SOUA 1WF3A 3BYZA 3L77A 3OEWA 1NP7A 5EKXA 5EWLB 3WL6A 3ZKWB 2FDXA 5KYXA 5A06A 1K68A 4RM3A 4B80A 4C4XA 1SHTX 4AB1A 3D43A 2O3SA 1RQLA 4LQDA 4N6NA 3CW2A 3TGWA 5EI5A 5FUYA 3X1KA 2ZYGA 3GAFA 4MHTA 2XNDD 3I6YA 5H59A 2FEAA 1YI1A 2QU7A 1ODCA 4XFJA 2H7CA 3NKFA 3OCYA 3PXDA 4PZPA 2HPVA 1NHWA 1WOSA 4QPJC 4WFKA 3WE7A 4TWAA 2BEJA 4L1KA 5CLGA 5E2BA 1D5WA 1UMDB 3V34A 1BKYA 4KWIA 2Q1TA 4LYHA 1ZA2A 2ZJFA 4UHDA 3H16A 2ORWA 4DIEA 3DQZA 1K0UA 4ZOQI 4MLCA 1N9GB 3RVBA 4DRXB 4FWTA 1IUOA 1N6OA 2C83A 2H5EA 2XSZA 3D6TB 1AHIA 1ZN9A 1ZMBA 3IAM6 2XODA 1XKXA 1U4SA 1R88A 3HCFA 1PR3A 2F1MA 3W5VA 1FTYA 2VYVA 3RK4A 4MCJA 1GVHA 4X1OA 3TX6A 4MRVA 1NYRA 4MVJA 4DPKA 3A4NA 2EU8A 4TL6A 2B1JA 1GKLA 1Q0HA 1DIOB 3H13A 2OGZA 4WZKA 1RHMA 1TKBA 4YPOA 1QNLA 4WK4B 3UMGA 4IIJB 1GCUA 2VYCA 1T5SA 2ANBA 4Y6LA 3MFYA 3E1YE 1E5LA 1M3SA 1EUQA 1ZCFA 1TQ4A 4OOVA 1H0SA 5TLSA 2FN4A 1JW9B 2QZ9A 4GL2A 2LZJA 2R8BA 4GEKA 2J5KA 4PABA 1AQJA 3BB3A 1E89A 4H17A 4PVDA 3WGYA 3L4KA 1ZU4A 4FR0A 4QT0A 3ZWNA 2XI4A 1QE5A 3BORA 5BSEA 5JNWA 1H22A 4CMEC 1SGWA 2AH5A 1S2LA 4YRFA 1ZWKA 4H7DA 2W00A 2RHHA 1VBNA 2NYRA 4M46A 2YV2A 3CBQA 5M29A 4CM4A 1E9FA 5KDDA 4B71A 2IZ5A 5G53C 4Z3OA 2H3EA 2PFGA 3CLTD 3QPCA 1B00A 4O8ZA 4OQNA 2BV3A 4DCVA 4HCJA 1ZBQA 1CJUC 4AULA 3CW9A 2O8DA 1B6SA 2ZSEA 1YBMA 3QX8A 4G9GA 4IX9A 4DLXA 4RHCA 4O3FA 4QSMA 1YULA 1CJTC 1HL3A 1NF3A 2HF8A 2NQTA 1QRAA 3GBPA 4JJ7A 4XOUA 2X22A 4OGGA 4PPNA 1T9KA 5BV1A 1FXUA 2UYCA 3EK2A 2XRYA 1Y89A 4OK3A 4XQ0A 3CWCA 3OCXA 2F9FA 3KFVA 1GFSA 4LDZA 2X86A 4G4JA 5CJ2A 1G7TA 1O94A 3V3KA 4E0BA 3AM1A 4Q82A 5JEDA 1HPLA 3VO8A 5TV2A 1CE8A 3F5QA 3RUDA 1TK2A 2K87A 2YNMD 4TQGA 5E1OA 1DO8A 2QGZA 1SEVA 3R6WA 3ZLUA 5EKUA 5KYUB 1BQ3A 3CEAA 3UOWA 2W42A 1KFEB 1Y5NA 4ID3A 1KZ9A 4OAQA 1XF9A 5DWDA 5EWLA 5IF3A 1P2UA 2O0JA 3PE4A 1E1RD 2ZYAA 3ZKWA 3PQDA 5FTWA 1R4MA 4X64B 1JHZA 2R1TB 4LDAA 4M1TA 2OHHA 2OBSA 3F2VA 5SZJA 4AVZA 4RTQA 1KYQA 1ZMTA 2WY2D 2V5UA 3CCFA 5BT9A 3NBAA 3NHRA 3K70D 1W8DA 2CFCA 1VHQA 4XSHA 1Z38A 5SYAA 3E9EA 2I66A 1ISFA 3PQ5A 3T1QA 1JHDA 2Z2IA 4PLFA 5FFFA 1SZJG 4HX5A 4EQ6B 1WRBA 4QU5A 5G3YA 2GQ0A 5HGJA 4LWQA 1L5MA 3KLBA 1G5QA 4GEGA 3ZK8A 4PQGA 4BNUA 5TRTA 1SVKA 2TMYA 1YVDA 1LPOA 1UMDA 2DECA 5FCDA 2IZ1A 5F7JA 5IC4A 4MUEA 5FPSA 2P69A 1NI5A 1R1DA 1N9GA 1RAGA 2RB5A 3QELB 1KY2A 4PWYA 4DRXA 3WMGA 3QMPA 1YR7A 2OM2A 2OC4A 1KDTA 4G8DA 2FU5C 1Q3KA 1QKJA 3VZPA 2WD9A 5GIOE 2OTCA 2ZB4A 3FMOB 1DIAA 5F4OA 3VSDA 3HC7A 2GHIA 1T10A 4JJAA 2J0UB 4LX8A 3Q85A 4YBZA 5JE8A 3GLIE 4IIJA 1D03A 1FYEA 1YWGO 2VQ3A 4I3GA 1EFHA 4LDPA 1JPUA 1VRCA 1PG2A 3URKA 1R9MA 2QM7A 1PBTA 1KF0A 4FFWA 5ARBA 5DTMA 2V9CA 2ODNA 5K7SA 4YUZA 3IXMA 3P9ZA 4DHWA 1BX1A 1NQAO 4EX6A 2X5JO 3CF4A 2HNAA 3DZBA 2O3JA 4BQIA 4D9HA 1EFAA 4M89A 4CHTA 5AUNB 1EIZA 5K05A 3OLQA 5JARA 3U9TA 1I2MA 2VBTA 2NXEA 2FJUA 3FYUC 1T9BA 1ZX1A 4ZU3A 2VYNA 5KNCH 1U0SY 5D5PA 1Y1PA 2WP0A 2NPFA 5DM1A 5ALGA 1YDFA 4G5GA 3P2EA 4IEFB 4IDBA 3BK7A 1RPAA 5TF4A 1MO3A 1CP2A 5FI0B 4LVNA 3OE7D 521PA 5DO9A 1YTUA 4NHOA 1SQSA 4MP3A 1SVNA 2G83A 4H16A 1H85A 1BS9A 4KBYA 4OUKX 3Q3VA 5EESA 1OASA 3QTTA 2P7IA 2AXPA 4OCZA 3ZDZB 2AN5A 1JDTA 2J6CA 5JSZB 3G88A 3JAKB 4KO1S 3F7OA 2JGFA 3SKXA 3U3RA 3N2ZB 1HFEL 1WIWA 5ALLA 4G0ZA 2GO7A 2ZL6A 1KP3A 3NHLA 2VH1A 4XW2A 4JC4A 4JQOA 1MEEA 1IG0A 3VUFA 1MX5A 1U7TA 2FR8C 2IPAB 3W2HA 3H9BA 3C3DA 5ALQA 2IH4A 4QOEA 1Z7YA 3VR2D 2JFQA 4JLVA 2YFHA 1ZK2A 5FPTA 4C2TA 2K5UA 4AMBA 5KYUA 1JTVA 3FYTA 3INGA 1GQYA 2BFAA 4HDCA 4MKIA 4ZALA 1TQ2A 3D3NA 1IUKA 3TTUA 4BX9A 2QSJA 3QFRA 1RACA 3KKQA 4KQCA 4Z2YA 5K8TA 2AFIB 3DUFB 1RADA 5TJHA 1VSBA 4X66B 2IZZA 2RGDA 3EA5A 2R1TA 3EJWA 2NT4A 4X8LA 1MZVA 2XCLA 1J2UA 3DD1A 2JNWA 4W4TA 1A69A 3U1VA 2J3EA 3PPYA 3MBIA 3DE1X 3H2IA 1CCWA 3IUPA 4BMDA 4HGRA 4A7PA 3HDJA 5IHXA 3H5AA 2QYOA 2OB2A 3KL2A 1TRHA 4YXWA 2CZGA 5CYFA 5EJ2A 1GKUB 3UAGA 2R2AA 2ZT8A 3PHCA 3ZVMA 4HGPA 4EQ6A 1KKUA 4FGSA 4M1QA 5JD4A 1D7AA 3KVYA 4LJ7A 2EKDA 4RO0A 3HY6A 1PT9A 4ISBA 4NYJQ 2PZJA 3MJCA 3S6JA 1YMQA 3CZRA 2K6GA 4IDGA 2P2ZA 4KQ2A 1KDVA 2B21A 3BQNB 1SCUB 3ND7A 4GYYA 4ALIA 3QELA 4IS2A 4MB0A 2ABWA 4DCMA 4YUAA 1M2VB 2PX4A 5HIIA 4J91A 4LKOA 5DGDA 1JI0A 3L1JA 1JKIA 5HUQA 4JUBA 1O5TA 5LUAA 3C3EA 4ZOLF 1F4PA 3H2YA 1RBYA 1EVIA 1BAPA 2J0UA 2WSBA 3EQZA 1W48A 3BHMA 2L0XA 3N2YA 1U81A 1PJ6A 5KAMA 2WZPP 3U3OA 4CM9D 3FRHA 4Q21A 1W9MA 2J5QA 4K9SA 3UV6A 3VMFA 4TVSA 3PFGA 1KERA 2GFHA 4I08A 4NMMA 1M7BA 1T5IA 1X1EA 3C7KA 4KQIA 4FGWA 3H1GA 4U00A 5I7AA 1M33A 2W4MA 1TZ2A 3BJMA 2X4GA 3VDRA 3A0UA 3FOCA 4YREA 1E5XA 1IM8A 1HXHA 3LT4A 4KODA 4LYEA 4TMTA 5JBQA 1ND5A 4Y2TA 5K6RA 1FP2A 4BLVA 2YXNA 3G82C 3K73O 1H2XA 3H9JA 5E8JA 4FNAA 3HNPA 3W5SA 1HE5A 1OX5A 2BBOA 2NWQA 2V65A 3EXEA 2Z4SA 1TIBA 3FDXA 2G28A 4ARAA 5KINB 3R7NA 4XWTA 1HFKA 2R6ZA 1EHYA 3I8XA 2I4LA 4KQFA 3WZMA 3AGPA 4JP8A 3CX3A 2CV1A 1KHTA 4MTCA 3VR4D 1GKIA 3V76A 2D1SA 5DWQA 1B73A 5CCBA 4JKYA 1DJPA 1WULS 3LOUA 2TMKA 1CQZA 3LPMA 4I6JA 4Y2YA 4EF5A 4RYLA 1XZIA 2XYQA 3HB0A 5DHAA 2BKVA 1X1DA 5DXAA 1WETA 1AK1A 1KOJA 1R2QA 4P3YA 2H92A 2XB9A 4GMXA 4KGZA 4Q9HA 5JROA 5LNK6 1E0JA 4KEAA 1HRDA 2W6CX 4OYHA 1MX9A 4ARVA 1XXLA 3R44A 4BB6A 2NTVA 4ZCMA 3TN7A 3N7UA 3AXTA 3AYZB 3JAKA 3TOXA 3W5IA 3X2FA 5EIBC 5JSZA 2OAEA 2ZSIA 4R71A 1NMQA 3ONUA 3C3WA 1AGXA 3OAAA 2IYYA 3LAWA 4I8IA 2HZ7A 5DASA 3UOGA 5LMNB 3EEYA 2JLXA 1YJXA 1IHXA 3RAFC 4REOA 2IIVA 2WM3A 3FDFA 5JZSA 5D01A 1YZQA 1HO3A 2XTJA 2YHAA 4QD3A 2IWRA 4YUWA 3Q15C 1ZGJA 3AILA 3HY4A 4RVSA 2I6FA 3ZOZA 1LC0A 1DPGA 2AFIA 3O4RA 3LHFA 4C89A 3OTHA 4OHCA 2FFAA 3OOSA 3LX8A 2ZRJA 1GQOA 4NU8X 2R7MA 2FW9A 4Y2UA 5AJXA 5DFAA 3BHIA 2AFHB 5IVDA 3AHJA 1NQ5A 4I9UA 1H93A 1O0SA 3VYWA 2VDVE 3N75A 1YBAA 4ZARA 1VJCA 1TM7E 2QRHA 3KQKA 2PWZA 1NN0A 3EVAA 4R5MA 3TZEA 3RT1A 3MQ4A 3ORFA 3FB4A 4KSYA 1YDMA 1WABA 3C7TA 5KNDH 3HJFA 2WHRA 2A0FA 1WA5A 1FW8A 3EAGA 5D6NA 3MTEA 4BBAA 2XNJA 3GFGA 3NXSA 3WWOA 1J90A 3WGJA 1KIFA 4EGFA 3VHXB 4ED9A 4L0QA 4ZQFA 2Z3WA 1UWLA 2OY0A 4NRDA 1OIVA 3BKXA 3ZCUA 2M5SA 1SCUA 2H4JA 2HNKA 3KEGA 5DBEX 4A0QA 2IKSA 4N03A 1M2VA 3SP1A 2W8ZA 1NY5A 2QZJA 2RARA 5L7YA 2R1ZA 3A9TA 3HN7A 2Q27A 3VU0A 4RTOA 1E79D 1FLVA 2B78A 1XYVA 2WOOA 1AGYA 3GPBA 1MG5A 3IC5A 3KP1A 4I4IA 3ME5A 4IF6A 4RZ2A 4GI2A 4MW7A 5CFNA 2XVAA 2AVNA 1F7VA 1J07A 2GYUA 3LZCA 2VDOB 4HZGA 1ANKA 2EGHA 2Q3BA 1B1CA 3OVMA 4IIFA 1CYDA 2H48A 5J59A 4A6EA 1VIMA 4WNCA 4GM4A 1BXKA 1ORIA 1IB0A 2RHWA 2JJMA 4LOJA 3HJBA 1KJZA 2CNNA 1VQ5B 3Q0TA 5CHEA 3TNFA 2D6FA 3HI6A 3NRJA 4J0CA 2P2CA 2IF2A 4O0LA 1U8ZA 2GGSA 3ZXSA 1OPRA 1Y4UA 2UUCB 3HP1A 1J21A 1NF8A 2Z57A 7MDHA 4HWKA 4X63A 3EF1A 1QMGA 1WHSB 2HA0A 3HYLA 5CXQA 1XVVA 3QYAA 2RBEA 1K92A 4FR5A 4REQB 5BOSB 1P1KA 1Q2XA 1JIUA 5CUQA 3QUBA 4V0SA 5HF5A 1ZITA 3P32A 4P3IA 3JD0A 3TNDA 4YMLA 2D74A 1JDUA 5LP1A 1NBEA 4US0R 2RI6A 3VR5H 1CZRA 1IN5A 3FCXA 2A67A 2X6QA 4ZOBA 3TZCA 1Z37A 3I8SA 3LYAA 1DTSA 1P4JA 4B2LA 1KORA 3FJYA 1OC2A 1KJ9A 5I9SA 3R74A 5CURA 2LP4Y 3DVSX 4ZOLB 1QBGA 5ESDA 2FLKA 3LDAA 2JEOA 4QRHA 4ZOAA 1VZ3A 1YOBA 4AP6A 3NIBA 3C4VA 1P9LA 3QZUA 5FV4A 4MWCA 1SO8A 3JQGB 1NBOA 3SQOA 2E9SA 2IKQA 5ARDA 4HMQA 2NUBA 3THWB 2A4KA 2B1IA 4Z0HO 4E12A 5IAKA 2PY6A 3VKFA 2Z8YM 1R8YA 2JZNA 4JQYA 2JCGA 3NDJA 2BEVB 5DCUA 5FD8A 4PHGA 3TEFA 4BKUA 2PBLA 5EZ6B 4P7FA 3RFUA 4M0LA 3PFFA 5DHQA 5A9TA 2PZ8A 3VTAA 2BGKA 5HM8A 1ZU5A 2I4OA 1PGPA 1QFZA 3QITA 2PYIA 1YZUA 4LDNA 5EE3A 5BXQC 1VQNB 1D4AA 3D6JA 3PCTA 2JZOA 3OUZA 3PZRA 1L7NA 4QJIA 3IB3A 2WIAA 1E6KA 3O93A 4G0XA 3V7YA 2IOFK 2O06A 2ZBUA 3LVFO 4ETNA 1KDYA 2NZJA 1NVVR 2AFHA 1B26A 5J3JA 3SMQA 4B5LA 1ISIA 3RFFA 1LXCA 4BV3A 2NACA 4B7XA 1WTAA 4KXMA 1LBEA 4XJVA 1IBKB 3SQXA 6LDHA 3QMVA 3D54D 3IRUA 3GJ0A 4YP1A 3KXDA 1H8ED 3VTZA 5FX2A 3MD0A 1DIBA 1A8HA 3KR9A 3FKJA 3VFDA 2ZUUA 3CZ4A 3ZHBA 2ONKA 1C3LA 1W4BA 4QTXA 1CUGA 1BX3A 1YUNA 1ZDMA 3H1FA 1C3EA 2Y9MB 3R0QA 4KQMA 4MV3A 4L78A 3VHXA 2ZPTX 3SBDA 2ATXA 2FSHA 3SSOA 1A9ZA 2RAFA 3T1OA 4DKXA 4UTNA 1IN4A 3ENZA 1I33A 3FBTA 4QIHA 2D5BA 4OJKA 4PSCA 3QPVA 1U2SA 5LB4A 1MOZA 1S9HA 3ACBA 3E4DA 4MCHA 3RSZA 4AROA 5B7PA 4GWGA 2VNKA 1QIGA 3ISVA 3TINA 3CP8A 1KQNA 4YEJA 4QU8A 4BKPA 1QBKC 4TXLA 1JKMA 2O5EA 3IXQA 1V1MA 5IKMA 1S96A 2BM8A 1XTKA 3TSYA 1S0UA 1R6TA 4M9SA 4Y9TA 5J58A 4KR9A 4L8YA 4OLAA 4ZQBA 2XW6A 4D9JA 3MWGA 4G2NA 4CLRB 3WL7A 3ZH9B 2IYZA 1JG1A 3T5GA 2P62A 1NE7A 3DJFA 2ZUBA 2MR6A 3MAGA 2J0SA 1AS3A 4TRRA 1CW2B 4UXIA 2X1VA 3JVUA 3JQ8B 3LA8A 3UCXA 5I51A 4L51A 3CRNA 4MULA 3OZGA 3AVXA 3QLEA 3DOJA 4LDQA 5HMMA 4NTZA 4DW8A 1GG5A 2ECFA 2J6IA 3EW7A 1RWBA 1WHSA 1VPDA 1YHZA 3O8DA 3OSZA 3DSRA 1XCJA 2B3DA 2PZFA 1MABB 3ABZA 4OSEA 4REQA 2WG0A 5DCLA 3I4FA 1E2HA 5BOSA 1RJFA 3LXUX 1BKSB 2GBPA 4Y2VA 5E6UB 3ZE8A 2PXXA 1ZL2A 4C04A 4AY6A 1N2IA 3M4XA 1JDVA 2CBZA 2GBLC 4P3XA 4AK9A 4X0CA 3VZRA 5C3UA 2WUGA 4H35A 3U81A 2JKVA 3URMA 3G2MA 1A9YA 2CZQA 2DKFA 2QUIA 4C3UA 4KGDA 4HWSA 5L8VA 1S6YA 4ND2A 3CHYA 2F1RA 4GQBA 3CMMA 1GRVA 1NHGA 3P2MA 4ZOLA 2M6KA 3EQ9A 3R8XA 1OH7A 3K53A 5AXCA 2WU4A 2OG1A 5ENVA 4PNPA 3Q8WA 3JQGA 4Q7MB 1E2LA 2J45A 3ZGXA 2XZTA 2VRNA 1B15A 2G40A 5GGYA 1SHJA 1HRKA 3IVGA 3NV9A 4QSHA 3THWA 4B3MB 3UO8B 5LQJA 1ONOA 1ZM3A 4Z7JA 3RBXA 2V7WA 2BEVA 2XIJA 3EXIB 4BV9A 1L7MA 1PJAA 1DZ3A 1K5GA 3RG8A 4FD3A 4INAA 4RSMA 5EPUA 5IYNA 1D1QA 1N7GA 2CLDX 4GXRA 1T2UA 1Q44A 1QDLB 4RZQA 5KKCA 5I7FA 2V8OA 2Y1KA 2ZW9A 2Q1WA 5TXGA 3HZOA 3NBUA 4NBNA 1W7AA 1XQXA 5AVKA 4AU1A 1PT7A 4D8UA 2FRDC 1SBHA 4R68A 1QS0B 4UHCA 4NHEA 1OT3A 4JLMA 3ZW7A 2B5WA 4Y6GB 3L41A 4IY1A 1F6WA 2H4FA 1PW5A 2OHFA 1ISJA 1AKRA 3HMQA 3NGMA 4FFBB 1XKTA 1VPTA 5AESA 2ZTGA 3OP4A 4H31A 1F8UA 5CDFE 3WQQA 5CTAA 3ML1A 1J8DA 1UM8A 1H2HA 1S3FA 3NC0C 4L07A 4YGXB 1KMIY 2XQFA 5JISA 5EJAA 1E3LA 2PS3A 4URWR 1CUSA 1RRVA 3DZCA 3LX6A 3PSHA 1PX2A 3WLTA 3JWGA 3GJ7A 1Q5PA 1VJ5A 2GEJA 1BIFA 4XUCA 2ZJ1A 3RAEC 1JV2B 1KZYC 1PZMA 1TVEA 2H2IA 3MVEA 3D5TA 5F2EA 1V8OA 4ZMBA 4ZYVA 1CUUA 1GTVA 1X80B 2IC5A 1P0FA 1KAGA 2ORYA 4ZRMA 2HYIC 3GR6A 3E3NA 3BDIA 1UJ2A 2NTNA 2WD8A 4R2MA 2FEKA 4ZN6A 3OM8A 1Y3FE 2H7XA 1X7XB 4RS4A 4C06A 3M4JA 4CM7A 4QFDA 1PJ2A 2OT3B 4PFSA 2Q5FA 4JHLA 2C59A 3UGQA 4IHKA 1OTXA 4CLRA 1UPBA 3T4UA 4KVGA 3FUTA 1H2AS 1MAVA 2WHYA 4PG8A 4KZPA 3W9SA 3O2SB 3QOWA 4MK4A 1OB2A 1S5PA 3K0HA 4G01B 3QUSA 1KZ4A 3JQ8A 3O21A 3W5JA 1T9AA 4NI5A 3IMFA 4D3FA 3ZCQA 4CDRA 3RV4A 1OAKA 1ILWA 1TE2A 4UQOA 2Z6UA 3ZU6A 3R77A 2WE7A 5HS6A 2QZZA 5JNRA 4WGFA 3TRDA 4F2PA 4NK5A 3TAUA 3A14A 1TMKA 1L5HB 1WOMA 1J5XA 3V48A 1A98A 4WXRA 1MABA 2AX3A 2VPIA 3IODA 4RCZA 2I87A 3CZAA 4TUYF 3QE4A 2TS1A 4YASA 5E6UA 4HDSB 1YI0A 2QV7A 3DFMA 1WMFA 1IDOA 3C3KA 5IZCA 2OAQ1 1OBFO 2F1HA 4ZYTA 3V3TA 1E1QA 1ZUNB 5AK0A 2D0PB 4NFHA 4ZVRA 4EVRA 2KYRA 1C4KA 2XKBA 1CY7A 1OXUA 3KLPX 4KFTA 2XOKD 4N9QA 2A94A 2WPDD 4ZZ3A 3PG5A 3K6RA 3H5IA 2GZ1A 5GOZA 2FWIA 2ZQZA 1QIMA 2W0MA 4WOJA 5KPDA 3J7AC 3OU7A 2VDQB 1BA3A 1CX9B 3D26A 3CH5A 3G89A 5BO5A 1NI4B 1YZ3A 1I2DA 4UMVA 5AQEA 1BQ4A 1E99A 5I5EA 2I9KA 1ZHFA 2YDXA 3K0KA 5FXMA 4QVAA 3AUYA 4URXR 5LDHA 1TU0A 2ODEA 3BMXA 1PQ4A 4W9NC 4XUDA 4EITA 5G4KB 5IBCA 4O29A 4D4IA 1D04A 2QX9A 3Q3EA 4JLOA 4CXMA 4L50A 3EGIA 1DC7A 2B8EA 3P9YA 3EXIA 4V0OA 5BT8A 2JI4A 1NMSA 3ADKA 3QVMA 4X7DA 4LJ9A 4PWZA 2HY7A 2Y1WA