1QG0A

Wild-type pea fnr
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
b'HSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
publication title A productive NADP+ binding mode of ferredoxin-NADP+ reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 91
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qg0A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qg0A02
4UAJA 2QN6A 3CCRB 1F60A 1CNEA 1KC8D 4B44A 3B8HA 3LO8A 1JJ2B 2E1RA 4Y9RA 1JA1A 5JBQA 4RD3A 5H59A 1F20A 2EIXA 3VNVA 2BVNA 3WY9A 1EP1B 2BF4A 1OB5A 4NBSA 1QG0A 4N3GA 3OZWA 3CCMB 4RD1A 1ZM4A 3AVVA 3LVBA 4LBYA 1Q81D 2C78A 1EFUA 3AGPA 2FX3A 1K73D 4BPRA 3I1FA 1ELOA 3QFRA 1N8RD 1M1KD 2J7KA 2DETA 4ACBA 5HXBA 4LBVA 3CC2B 3CXCB 3FPKA 5AN9A 1QGYA 1I7PA 1AMOA 4TMZA 1KK0A 4FK8A 2RC5A 3AGQA 3W5UA 1GAQA 2QTLA 1FNDA 3G6EB 3ZBUA 3ZC3A 3OJWA 1NDHA 4DQLA 3QFTA 3WBKA 2GQFA 1NJID 3ZZUA 1B2RA 3WNBA 3WYAA 3VO2A 4C0SA 4U9UA 3CCJB 2QEXB 1QGAA 3CW2A 2VYQA 3CCEB 1U2RA 1TUIA 3AVYA 1TLLA 4H9GA 1DDGA 2B7BA 4J0QA 4B4DA 1IJFA 5THXA 1OB2A 1Q7YD 2ZITA 4ACAA 3E20A 1E62A 4YALA 5TY0A 2DY1A 4ZGQB 3PENA 2BSAA 1WDTA 1YIJB 3FJOA 4N3NA 1YJNB 3WNDA 1KTVA 2VNJA 2DCUA 4FWTA 1K8AD 4QHYA 4RCZA 2X3UA 3MHPA 4RD4A 1BQEA 1YITB 3ZZ0A 1W34A 2XNCA 3U6KA 3CRZA 3CPWB 1KJZA 2OK7A 1HA3A 4TMTA 1W87A 4G1BA 2DEUA 3CCVB 2AHOA 3E1YE 3ZZTA 3G71B 4MYUA 1R5NA 3CB4A 1G7TA 3W5VA 3OZVA 1YJWB 1G7RA 1BX1A 2HDNB 2HCJB 1N0VC 1A8PA 1D2EA 1CQXA 1QUEA 5EMNA 4B47A 4M2LA 2QTZA 3I56B 2BGIA 4YHBA 1VQKB 1EXMA 2BM0A 1EFCA 4Q7JB 1VQMB 5TR9A 4PC3A 3WBJA 3CCQB 1FNBA 1QUFA 5GV8A 4F7DA 1VQOB 3W2IA 1ZM2A 4RCYA 2BMWA 4C43A 1QGZA 1TTTA 1ZM3A 3ZBTA 1GO2A 3CC4B 3SJZA 3JQQA 3AVXA 4TMXA 3OJXA 1AIPA 1IJEA 1D1NA 1UMKA 1Q82D 1G7CA 3WNCA 2B7CA 3A1FA 1JNYA 1KK3A 2YWFA 1GJRA 1QH0A 1QX4A 2GPJA 2OTLB 1ZM9A 3VMFA 1BJKA 1H85A 4LC0A 4TMWA 2NPFA 1QFZA 3CCUB 1DDIA 4PGOA 1M90D 1GAWA 4YAUA 3LRXA 3CD6B 1YJ9B 3WXMA 1QFYA 4ZGNB 2BGJA 1OGJA 4RD0A 1EP2B 4HE6A 1VQLB 5GV7A 1QVFB 2CNDA 1VQ6B 5FA6A 3G4SB 1JA0A 1OGIA 1GR1A 1N0UA 3AVWA 4HE5A 1K9MD 4RD2A 2OK8A 4M4SA 4PC7A 2PIAA 3LYUA 2YWEA 1JB9A 1R5BA 2DERA 1IB0A 4YAFA 3CMAB 1Q86D 1EP3B 2YWGA 1VQ9B 1SKQA 2PMDA 3U2QA 1XE1A 2PLFA 4QFMA 4Y9UA 2D74A 1H42A 2VNHA 2B5OA 4FN5A 1J9ZA 5H5JA 1VQ8B 1FRQA 2BPOA 1YI2B 2CRVA 5DSZA 3W2HA 1FDRA 3CC7B 2QDXA 4B43A 1YHQB 1FNMA 3ES9A 1BX0A 3VO1A 4PC1A 1EFTA 4WQMA 4G5GA 4Y7CA 4P3YA 4AF6A 5KSWB 4IW3B 2VNIA 4AF7A 2OTJB 4YAWA 1XB2A 2VZLA 4PC2A 4DQKA 3I55B 1KD1D 2BN4A 4AC9A 2BM1A 1VQ5B 3JQPA 3CMEB 4K1XA 4TN1A 1B23P 1CNFA 1VQ7B 4M0LA 3OW2B 3W2GA 1E64A 1KK2A 4ZCLA 2XEXA 1S0UA 4EH1A 4LBZA 4PC6A 2EFGA 4RD6A 1TVCA 2BV3A 4P6VF 3AVTA 1FRNA 3VNUA 4ZV4A 4LBWA 3QE2A 2HMAA 3P26A 1G7SA 3JQRA 3CCLB 1DARA 1R5OA 3B78A 3MMPA 1S72B 3AVUA 2QMUA 3MCAA 3V76A 3U6BA 4M1KA 4ZCMA 2VNKA 2C77A 3QFSA 3B82A 1EWYA 2QA4B 1KK1A 4B48A 1E63A 1VQNB 2RC6A 1KQSB 4RJLA 1QFJA 4G1VA 1FNCA 4B3XA 1VQPB 3W5HA 1GVHA 2XNJA 1VQ4B 1DG1G 1QVGB 1ZUNB 4ZCIA 1W2BB 3W2FA 1SM4A 3W2EA 4R71A 5TV2A 1W35A 3J81k 3QFCA 4MYTA 4NCNA 1KRHA 4YAOA 4M53A 3OZUA 3CCSB 3P27A 2R6HA 2YWHA 1D8TA 3QSYA 4TMVA
chains in the Genus database with same CATH superfamily
2VT2A 5A2GA 3B13B 5EXPA 3EIHA 1SU7A 3PCRB 1VHWA 3VH2A 1M66A 1MFZA 5I7OA 4BO1A 4DBLE 1BRTA 2X7XA 4X54A 5EGSA 5A3SA 3ZXSA 3B8HA 3A35A 4JIGA 3P9XA 4IH1A 2KWIA 3RRFA 1K0UA 2CKMA 1GEGA 2BFEB 3HL4A 3UWOA 2PR7A 4U4AA 4EHLA 3ESDA 5JBQA 4R1QA 5ITZB 5LN1A 9MHTA 2P0AA 3KKMA 4BZWA 1FMFA 3FKSA 4IZ6A 3E2IA 3CRMA 2QM7A 4C4YA 2LXNA 1IVYA 3G5AA 1QG0A 4Y6LA 5K8LA 4TV9A 3FVTA 4UQLA 1GU0A 3ND7A 3H9NA 3BMNB 3GB9A 3QI2A 4IIYA 3K8OE 4MYCA 5IMBA 1Z7GA 4DY6A 1LQUA 3Q6QA 4HK4A 4KFCA 1IHXA 2WHPA 1ST3A 4CUJA 4LE0A 1YOVB 4WVLA 1IZ9A 1V7PC 3SDZA 4DVGA 3U7GA 1C1DA 1XZAA 3DKVA 4DBVO 1IY2A 4EECA 3PJDA 3LUDA 1RHUA 3HKCB 4D9NA 1M1KD 4LYDA 4OH1A 1DV2A 1L5VA 2D1YA 1F2TA 1L7MA 4X0EA 5LNK1 2ROQA 4JH0A 3OIDA 4R98A 4ZPJA 3IHTA 1HZJA 4ZVLA 1XAHA 4WCFC 4KIFA 3F98A 2OL4A 1P74A 2IITA 2UYOA 1W9XA 3ND8A 3RC8A 4AY2A 3RS2A 4YDHB 2G83A 4G0MA 1U2ZA 3HFSA 3NAZA 2QK4A 4M9RA 4Q4AA 4AG6A 3K9FC 2GAIA 1PFUA 5FNVB 3SC6A 3QPAA 1N5KA 3O84A 2XF2A 4DUGA 5LSAA 1NU8A 3GYGA 4QYTA 1T26A 4W5JA 4IINA 3H5TA 2GRUA 1R27A 3HJGA 4F4UA 3Q2KA 2XE8A 5IJ9A 4JX9A 4II3A 2VXBA 1ZESA 3E7PA 3EA4A 4U2GA 3ZBUA 4XPIB 3W3AA 3ROFA 2A9RA 4Q4HB 3DEJA 3VU3A 3TQCA 9LDTA 2J33A 2PUJA 4IUBS 4HLCA 4QPCA 4A9AA 4QLBA 1L5YA 1R0XA 2GQFA 3VOSA 2QPTA 4JBNA 4XM0A 3OTGA 5BR7A 2WJHA 5KTPA 5CA0F 2C7PA 1RBZA 3DEIA 5ERXA 3ASUA 4O6VA 3TXAA 1UKZA 2I34A 1QAMA 4S1OA 5FTJA 2FR0A 4NZNA 4B7ZA 4NDAA 4U63A 4ATNA 4HOYA 1DBVO 3HXPA 4Q3OA 3N8NA 1WW3A 5DBOA 3VVLA 3RY8A 1ZY2A 3WJ2A 3IBFA 5ITVA 5CFLA 5LP6B 4D25A 2JJYA 4LDAA 3TIGA 3LCJA 2ZATA 4OA5A 3OM0A 3TD2A 4BX2A 4QYXA 3OEWA 1IUPA 1NAHA 1A5BB 5ES3A 3UYKA 1RQLA 1M2VA 5CDUA 1T0UA 3IUBA 5DMXA 4J2HA 4TKOB 2MSEB 1Y3FE 1OIXA 1T5DX 2UZAA 4RJJA 3HCNA 1B26A 4GLOA 2PSDA 5K3AA 3TN7A 3NV7A 1Z0KA 4OHRA 3QPDA 1Z8DA 5KOJB 4BWVA 1DBWA 5TMDA 4WCDA 1W75A 3BWBA 3OIGA 2VK4A 2O48X 2IBMA 4CM4B 3Q1LA 1E3ZA 3B6JA 4V03A 4EB6B 3ZCTA 4GR5A 4MVXA 3PENA 2A2ZA 3CVUA 4FQ8A 1GRVA 3M81A 5LA6F 4C87A 1RPNA 1HDOA 1W4LA 1SKYB 2EBHX 5FEUA 3NV9A 3NWJA 3I9LA 3WJ1A 2JAHA 4TL9A 4KDFA 1T9GS 2GUWA 3LQKA 4G5YA 3RTCA 1KTVA 1CJVC 1SEVA 3K9NA 3G2LA 1YR9A 3ETCA 1IN8A 2OHXA 4E70A 2DPMA 2HXYA 4S05A 4HEA1 4Z4WA 2R65A 2VJAA 3P97A 4RF3A 3E35A 4WXHA 4LF4B 3DEKA 4BBAA 5JAOA 2HLDA 4XCQA 4Z0TA 1L9XA 2P0YA 2QRMA 3JQBA 4OHKA 2QSZA 3E8SA 1RNLA 2I67A 2MJLA 3HA2A 4IMRA 5EIHA 5TGDA 4TQUS 4JBXA 5JSKA 1WMFA 4ZQBA 2ZT7A 3RNLA 3U7JA 4UE2A 4CDNA 4UU1A 1KJZA 5DCUA 2IPOA 4PPFA 2ORED 1F48A 2ID7A 4L8WB 1V16A 3ZE8A 2GNAA 3N7AA 3H75A 4HWRA 1JDZA 4X3CA 2O8EB 3ZIAA 2ZROA 4YV0A 4C7VA 3TGPA 1CZUA 4DCNA 5AJTA 3BQJA 1RADA 2JANA 3AR9A 3COVA 3FVQA 5EJ6A 1UINA 4CEIB 2GK6A 4LXQA 4O4LA 5EINA 4D6XA 1U04A 1CV2A 1SKAA 1PNQA 1UKVY 1VE1A 1T4DA 3DNPA 2QSUA 1ONOA 1QGED 3GGJA 3IPCA 4MICA 5AKJA 4F06A 2O5CA 5ESRA 3PE6A 1G7TA 1YJWB 2HU2A 2QRJA 4IRMA 3THYB 4DC9A 1M1YE 4DWWA 3LX4A 3RIYA 1FS6A 3FUWA 1N6NA 3U3XA 5B1EA 1NTOA 3VR4H 5KJ1A 1QUEA 2O0HA 1A76A 4ARIA 3LGAA 5DHPA 3D43A 1EM8A 1XEWY 2VC2B 4G9BA 4U2CA 2VAVA 3WLMA 1MUUA 1FU8A 1VG1A 5FPHA 3QVJA 3COWA 3OLYA 4ZXPA 2Z95A 4UULA 2F8TA 1G60A 3K1YA 3LE8A 2W4MA 5FBKA 1GNPA 1P91A 1L5MA 3KQYA 4LTDA 1DQNA 1P5FA 3LT5A 4FYPA 2ZM5A 2QR5A 4HS4A 1I3OA 3EXIA 2I7VA 1YT5A 1Z47A 5HF5A 1ZUIA 4QEKA 4DM7A 3FUXA 1JLRA 4OBEA 1E18A 2JD1A 4AG3A 2YZMA 3I58A 3V34A 2EQAA 4Z3DA 1T2EA 2BKLA 4JLPA 5KJFA 3UCXA 5SY9A 2OZVA 4EMBA 2C83A 1TTTA 3V8RA 2C8VA 2FN3A 3CC4B 4HEA6 3C16C 3I45A 4MQEB 3K6JA 2AEMA 4KDEA 4XSGA 1D2NA 1ESNA 1H3FA 5JCOC 5A5GA 4HH0A 3ZWDA 4AJ2A 1X1BA 1W49A 3ZGVA 3FSJX 1E9VA 4I14A 4D9BA 3L07A 4QPDA 1HQKA 1U1DA 2V54A 2HMUA 2YN0A 3MS4A 3NOQA 2B3TA 2YJGA 1FJHA 1KOLA 3UFXB 2O14A 3T53B 1U0HC 3BORA 3DLCA 4KBFA 4AN4A 5A4DA 1YTUA 3SDSA 3EG9A 4LWOA 1N3IA 5BN5A 2RGUA 4RPJA 3ZY2A 1EFLA 1ZEMA 3KHTA 3QKRA 1NQXA 3PLAE 1OUMA 3GDOA 4I08A 4XWGA 4EX6A 1PZXA 3T12A 1WXWA 1N9GA 5B12A 3BCUA 3RYIB 1GTSA 2QMYA 1I30A 2YXEA 1VIYA 1MX1A 3AYZB 1CUAA 3OF3A 1O6ZA 5BUSA 1CD5A 5TQ0A 4PO9A 2IY7A 4B2IA 5I7EA 4IZIA 2JFXA 2R48A 3TIIA 5AH0A 2V5UA 3AJRA 4BC0A 4C2BA 2R6DA 5JCXA 2E0IA 2RHCA 3F73A 5CHEA 1FX0A 2ZI9A 3BMXA 3OF5A 4JUBA 3GZ4A 3LHSA 1W4BA 3V8BA 3VPSA 1QYXA 3LRXA 2C4HA 2BFFA 3IBYA 3R7WB 2XKJE 1DRWA 1S2GA 3AEUA 3UWMA 4F2WA 3A3NA 1YR8A 2OKGA 1QO9A 2HMVA 2WRZA 1MX5A 3CZ4A 4G0ZA 3EJ6A 5KQGA 2O6LA 1KQOA 1HMPA 3ZDXB 1YMQA 2HPHA 1UJBA 1LF5A 3JASA 4MKFA 4O59O 1Q0SA 3AEQB 3HKBB 4IS2A 4U7GA 1L5GB 2QNBA 2FWJA 3I8OA 4CLEA 3P9NA 1S01A 2WT9A 4UVHA 3WXBA 3KAJA 2ZTGA 5D5QA 1DRKA 4B45A 2PUFA 1W0JA 1YJAA 2NSHA 3TI7A 3DUFB 5A7FA 5K03A 5CH3A 3BTUA 4HE5A 1WZUA 3JQ9C 4X7PA 1CY8A 1U5BB 1SCIA 3QMPA 1YJCA 1G5IA 4RSMA 4N18A 1AA9A 1NC3A 1WY7A 4B0PA 1H8EA 2H7XA 5A04A 3NIBA 4GU5A 5FUXA 1C9DB 1JX6A 1CS4C 3RK0A 2AN9A 3QU5A 3EIFA 4DREA 5KTKA 4I4TF 2FX2A 2GDJA 1ZLXA 1R6BX 2C3OA 4UW9A 3IXLA 4QUKA 3UW3A 1SKQA 2GD6A 4MUJA 1B73A 5A5FA 1V9SA 4ALKA 2X0RA 1ODLA 1O95A 1ZZGA 4RQTA 5DDIP 2FGJA 2GPTA 4IY1A 1EM6A 3RJ5A 5B7QA 5BMOA 4QGAA 4JT8A 1Y1KE 5ALTA 5DK6A 3O93A 5J1TB 4P93A 4RTSA 3D4NA 5T64A 1FFYA 3GRPA 3K9QO 1R8QA 5C8ZA 2A4MA 2TYSB 3K20A 3C5VA 5TJ9A 4Q4LA 1KBZA 3DA8A 2RK6A 1LPBB 1YI2B 4KQ9A 2J3HA 4UASA 3Q0TA 3D2CA 3KKNA 1RWPA 3O4JA 3S2EA 3Q7EA 4Z4ZA 3HL0A 2ZP1A 1SH7A 1XTSA 5JAHA 4AKTA 5JXJA 2X4DA 1ZD9A 1ZMRA 1QOQB 1GAEO 4IMPA 4P0TA 1MHTA 1DQYA 4ZRDA 4Z53A 3OVMA 1JBKA 2GFHA 3EOBI 3WLAA 1JJ7A 1Z0SA 4GZ6A 4WT7A 4FX2A 4H1VA 4R5HA 1A2OA 3WRYC 3EGVA 3CUVA 1KETA 2UVPB 2Y8EA 2OYCA 2QJTA 3HA5A 3BGIA 4N1AA 4KXUA 2EXXA 3A6EA 5H8WA 2UUBB 4GPBA 2FPPB 1AUVA 3H5AA 5J2TA 5L4SA 5CIYA 4ZK2A 5B58C 1YFKA 2J87A 3LVRE 1FYDA 5JAQA 4X7MA 1HWYA 1B00A 4NCBA 2O1WA 3T7AA 5BRNA 1YR6A 2HCRA 3OOWA 3NTVA 4OP2A 3OE1A 3VC1A 4D4IA 4Z6KA 5HX7A 2FSFA 1OZHA 1FFHA 4LF7B 3FLBA 4ND1A 4PFQA 3C3BA 3R5XA 4DCGA 7REQA 2ZJBA 4UTOA 3I23A 4MP3A 4AS1A 5JH7F 3T9EA 1TVKB 1S0UA 4EH1A 1K3TA 2CXHA 2J5BA 1YKGA 1U7OA 2XMCA 2FPUA 3FNIA 2E1BA 3I73A 1WULS 1XO1A 3A8IA 4OLHA 3WGHA 4AZ0B 3CLSD 3KOUA 4RTLA 5KC8A 4IVNA 1D4FA 2G1UA 1JDBB 1GGEA 1XWFA 3C70A 4JI3B 1FRNA 4RV4A 1SA0B 2PKCA 1I6MA 4PZUA 4TM7A 3TZCA 3K35A 5BWBA 2VQFB 1FCJA 2IT1A 4PGMA 4NYMQ 4WNAB 2OHGA 2ZGVA 4P4UA 3QE2A 5ELMA 1G4AE 3W04A 2X2OA 5IBCA 1AB5A 1TIPA 3HCBA 4QEZA 1SXIA 3C97A 5BN1A 2FPGA 2FN8A 3ABSB 1E7WA 3CCLB 3PHJA 2AHRA 3UH0A 4X07A 2YRWA 1BCRB 3W8DA 5BN4B 3ED5A 4XQCA 4H77A 3WWYA 4X65B 4LF6B 5I4IA 1M8KA 3HKEB 5FULA 1UFOA 1P6UA 3KXKA 4E6PA 2GBFA 5A4IS 5C7YA 5BO5A 5JFOA 1PFYA 3GV0A 5D3ZA 1UFKA 2FZKA 2G06A 4RIFA 4PBRA 3BZWA 1GUFA 3DFKA 4MRMA 2CL5A 2VYND 4P92A 1RHJA 4B0OA 1AXEA 1NJSA 4K9SA 3TOVA 3ZU3A 4DV5B 1T2CA 3N74A 3R0QA 1CDZA 3FGPA 2ZQZA 1OXKB 1Z6XA 3HDVA 4IUCS 5DBEX 5THQA 5CRIA 3RVLA 1X1EA 2CHFA 1VQNB 4BLWA 1Y6RA 4EFLA 3VO8A 3QVLA 1TLFA 3JAKB 1R6DA 2IDZA 1M8GA 4B3XA 1YE3A 3EODA 4NEHB 2VATA 4R1NA 4ZAZA 4Z9XA 3TUJC 1T2AA 3EQ2A 1AS3A 4QREA 3V55A 5BVGA 1GV0A 1O9HA 4AZ3A 5HCUA 1EDDA 1JQ5A 4WASA 5BW4A 3RSSA 1CY7A 1NJ5A 2WWVD 1FFXA 1N5RA 4HZGA 3KKPA 5BVHA 3LBFA 4HGYA 4HI0E 4HUTA 2JAPA 5DM70 1LC0A 2G0AA 4PCVA 3K0EA 2H5EA 2HUPA 2OYSA 3IEPA 5FTMA 1JHQA 3GW8A 5HCIA 3D5EA 5C4GB 4B79A 4DKXA 2WTUA 1NXWA 2V3WA 3V7FA 3GPIA 1Q19A 4ENSA 2CK3A 1XCPA 6AT1A 3M5CA 5D1NA 2KSQA 3IEXA 3ZU6A 4UC0A 1VBKA 1UDAA 3KZCA 3J7AC 1XL1A 1H6BA 2JI6A 2X41A 3MIIA 2CXTA 3A32A 4R05A 1X8KA 3ZD8A 3G8DA 3PSHA 1URPA 4ALJA 5FV7A 3UUEA 5F35A 3IURA 3DLIA 2JIBA 3K8YA 4G23A 3T3PB 2FUG1 4KXNA 3WMRA 3I72A 1DAPA 3IT1A 2J0SA 4M53A 1HDZA 1HQYE 2O3RA 3JVIA 4N65A 4CKWB 1J1UA 2VPZA 2Q1TA 3LNCA 3OCVA 4GUAA 3WQZA 1WCIA 1P2FA 4CM9D 2X0EA 1VLQA 2XYPA 2GCGA 4RJTA 3NR2A 2GVZC 1KRWA 2R6HA 1FFEA 2FN4A 3T52A 1ORWA 5KSOA 3BXFA 3RHTA 3P52A 2XGMA 4XJVA 2IKSA 4C7KA 3SJUA 1D0VA 2R1TB 3B1WA 3HN6A 4P2NA 4QQRA 5A1TA 4Q7EA 3USCS 3K9GA 4OAPA 5ER9A 1VSTA 4ZODA 2X5OA 3PQ3A 1EH5A 1VL1A 2HZBA 2V0NA 3JTMA 1WTAA 1XHFA 2ATEA 1YDEA 4MIOA 4Y2GA 1RPAA 4HV4A 2BHNA 3ENZA 4RKFA 1WUTA 5BV2P 3VU0A 1HLPA 3IVCA 3U39A 3THOA 2BRUC 3N2KA 4I9UA 1HMYA 2HPAA 4TSFD 4YCCA 5LYJA 1SBIA 3OZSA 1WP4A 4RELA 2H9YA 4WGGA 1ECFA 1XZDA 2Z5FA 1ZKDA 4IJKA 1J42A 3PFCA 3PNBA 4UQPA 2CFTA 1UBCA 3FTPA 1GL3A 2GN4A 1NN1A 3KB2A 4ZVOA 2V55B 5AJVB 4LYEA 3BTVA 1S1MA 5LU8A 1YC5A 3FPGA 1N5OX 3GK3A 3LBHA 4QHTA 3ZXXA 3NASA 4R0MA 1E3WB 4J1QA 1IBSA 4OBBA 3AM1A 5B7PA 5B4UA 1CUBA 1R5JA 4KCGA 4G81A 3D02A 1C9EA 1WORA 4D4LA 2WUWE 3KLMX 2IHUA 5EWLB 1TM3E 4ACBA 3EE6A 1JPNA 1XVVA 2WUFA 1WG8A 1ZBQA 2NNLD 2OHOA 4Z0NA 2BKVA 3HMKA 1VKJA 2CLDX 2FSHA 4MDYA 4LTMA 4L51A 2PKQO 3LLMA 2XUPA 3W1WA 4BAGA 1F0KA 2XUOA 1P2TA 3NHSA 2FUG6 4BJ6A 2KB0A 3GZNB 1L5KA 1T6XA 3U5TA 2IS6A 2IF0A 1GZ6A 4KG7A 2FSSA 3F8WA 2A3NA 2RGYA 3L6UA 5CVJA 4NRDA 4XM2A 3I5YA 1FUYB 1A7AA 1N3YA 4ENPA 3ZTYA 3I5MA 1R66A 3ILYA 3QFTA 1EFRD 1YIOA 2I66A 2XDWA 1QIIA 2GB4A 5GJWC 4RDCA 2D3NA 1O96B 1RBYA 3UXEA 3Q98A 5CLIA 1O94A 4B34A 4H6WA 4BKRA 1Z0FA 2ACWA 1DKNA 1KYYA 1QHFA 3N0VA 4E09A 1YQTA 2Z57A 3UJCA 2H1SA 1Q0HA 4F6RA 2Q9UA 1SVLA 2JRCA 5IUJC 2Y1EA 3RSQA 1BXKA 5FWXB 4YXWA 1G8AA 2DTXA 1MVOA 2GOYA 2VOEA 3KTDA 5EE3A 4FE3A 3THWA 3I2GA 5JADA 1T8UA 3IIKA 1HDRA 3ESBA 5C31A 1U2RA 2EP7A 3K05A 4WJLA 1JLLA 1VRWA 4JJFA 1VJGA 1P2SA 2WIAA 3FAZA 1J24A 3OTWA 4QV2A 2R1VA 5LDDC 3MT8A 2Q0XA 4MYHA 5A6SA 2ZTSA 3T5AA 3Q0EA 2Q6OA 4IQ8A 4P9NA 1EA7A 3ZJ5A 2QYTA 4CMIB 1UFRA 5JANA 1XAIA 3AERA 4E31A 4XEHA 1XIVA 3WAGA 2ZBEA 4ARBA 3H4MA 2PEZA 2Y99A 4WZ6A 4ZCTA 1OLSB 3HCEA 4DY4A 1Q7YD 4H59A 3MAAC 8OHMA 2QTHA 3G9XA 3JQFA 3A7EA 4C0KA 5COAA 3A06A 1JVSA 3SBXA 4ZGQB 4X7DA 1FFWA 2VG8A 2G1PA 4E32A 2EWMA 2AXPA 3TQHA 5D00A 2VHUA 3JALA 1NSYA 2ZETA 4A2CA 4US2R 3LV8A 4FSXA 1AKRA 3ANSA 1REQB 3PQ8A 1CJCA 2IPNA 4M0DA 1PJ2A 2ETXA 4JI6B 1E2HA 1JHDA 3WNDA 4IDHA 3GRFA 3SI7A 2DCUA 1XD2B 1UD3A 3BFPA 2WSBA 1TT7A 3UT5A 3G02A 2R96A 5E7IA 2I3BA 4N6NA 1Z9BA 2OV6A 4QHYA 1PJ5A 2C2XA 1Z06A 5DWQA 3AHEA 4JQOA 1MG0A 4P5DA 3K9WA 3IPRA 1KZ1A 2WTAA 4E6EA 2NU7B 1A1VA 1DFGA 1CJSA 4HQLA 4QBFA 1GCGA 1HG1A 4V24A 3EF3A 3T51B 5B1HA 1ZNQO 4GMKA 2BFDB 2FN7A 2RAUA 2FZVA 2CJFA 2O2IA 5EKSA 5BQFA 5JQWA 1X6VA 5FIUA 1EFDN 1E61A 1RWQA 2J0UA 2PKXA 3CNOA 2C2ZA 3KAQA 5FHQA 2PANA 2Q9BA 4Y1GA 2Q6LA 4BUCA 3W8EA 4RMIA 5TQ2A 1QQTA 4L5YA 4RV9A 5DHFA 5IULC 5BNZA 3P9SA 3VKHA 5JI3E 3H84A 4QBKA 1E9RA 3MVEA 4C01A 5KJCA 4K9LA 2VBIA 1BX1A 2I5PO 4I1SA 5CT6A 3M3PA 1DHRA 3AXSA 5FH9A 1T5HX 5BSYA 2AA3A 2WZCA 2E85A 1SXJC 2BC9A 3QYJA 2QXTA 4WN9B 1E3SA 1IUKA 4FWBA 4DCTA 1A98A 2MTBA 2VVTA 4M1OA 2POCA 3A6KA 4OK3A 2IXDA 3RUEA 4QIHA 1A71A 1JBQA 4TS4A 4YPVA 5CX1A 4RM0A 2GBIA 3DMDA 4KOAA 5EUCA 5F7JA 1BXRB 2B7LA 3BB1A 4O4IB 1PYOA 3FNRA 1G8SA 3CPEA 4L0CA 3BSWA 4MV1A 4ZTBA 1Y1TA 3AW9A 4GX0A 4DLXA 3KQHA 4Q3KA 3ICWA 2RHRA 2X4GA 4AU1A 1ZOSA 3KYDB 3LY7A 1ZXBA 3V6LA 4XVCA 3IB6A 1P2UA 3UMJA 3V1UA 2GF0A 4L72A 5E95A 4F7DA 1PR6A 2IVZA 2XVZA 4X91A 2B37A 5D86A 5EWMA 2PTHA 4MPTA 3C1AA 3T4UA 4EFMA 1LGYA 4DM4A 4ZYXA 3LT2A 3RV3A 1A9XA 2A84A 3SF8A 4ZC1A 4CW7A 4F9EA 5B30A 2YX1A 3R3HA 1EFVA 4O4LF 3JQQA 1VL6A 1CJUC 1KKMA 1Y9EA 3BD8A 1Y5LA 3HVHA 3KTOA 4FPXA 4MINA 5EJGA 3ISVA 9ABPA 3PQ2A 1V96A 2JBAB 4YREA 5JNSA 2FQYA 3N6XA 4MA5A 5ALVA 1FPQA 4EQ6A 1ZXXA 3KJXA 4LPKA 4RPCA 1ECGA 1WS6A 4EOGA 2B7CA 2PKYX 2VDMB 2WR8A 3OHMA 2WKQA 4NCAA 2BONA 2X8WA 4HMPA 4ROSA 1PKEA 3JQEA 3KOZA 1JQEA 4JAVC 3RFXA 1YRHA 5CM9C 1OBCA 1XVIA 4ZWNA 1P61B 1TQ6A 4UHCA 2J08A 3LUJA 3ZDAA 2YWFA 4DB2A 1IONA 3PEYA 1UOPA 1GNVA 4XARA 2R8YA 2E1PA 4YASA 1T9DA 1US8A 2HQSA 2I80A 3PF8A 4DARA 3DQPA 2Q2WA 2ARKA 3PFKA 2E4ZA 1B6RA 5FKJA 1MO2A 3AR5A 4CNQA 5BV7A 1RMTA 3W5JA 5M7EA 1DE0A 1TFRA 1NXTA 3IP7A 1ARZA 3GHYA 4RX1A 2Z09A 5F4OA 1D4AA 1FYVA 5JALA 4A7PA 5FPQA 1QRAA 1L7VC 3EAQA 1PLKA 4EUSA 3WI7A 1WHSB 4AP5A 3WXMA 1NLFA 4ETWA 3EBOA 5EIEA 4RPHA 1T4GA 2C7QA 3ZX5A 2E3JA 1BJTA 3GWGA 5GV7A 1XP5A 4UBKA 3GY0A 1AO0A 3CG4A 3B3GA 5TPWA 2REQA 4BMCA 3NOVA 2XKAA 3C6KA 1ZCJA 5DCLA 2FZWA 1UQUA 1VECA 1DAKA 3G4SB 5JISA 1S2DA 5EI5A 2J9GA 4DR5B 5KJ6A 1JG1A 2A0UA 3FR7A 2OXCA 1XVLA 1A1SA 1YZYA 3NT2A 5IJ0B 1D2MA 2BKEA 2QMHA 4P86A 4RH1A 1P39A 1Y1SA 1VGRA 1ZH2A 2YQ4A 3K94A 1M0SA 3HU5A 3NE5B 1B2LA 5FCDA 1IG0A 3HJBA 1C7QA 3SMQA 3FOZA 4OFWA 3PEWA 2EFJA 4R54A 13PKA 1F51E 3GEMA 5AM0A 5TPZA 4GNKA 5KBYA 1RKXA 1TMKA 4QYMA 1HYBA 1MABB 4MGHA 1AU9A 1YBVA 3PXDA 2WICA 4PZPA 4CODB 5T4EA 5JJBA 3PFGA 4I8DA 1GPBA 5GWXA 3OQIA 5JS2A 1MC1A 1J99A 3F71A 4XGQA 3VR5A 5JD5A 3QEMA 3A6ZA 3KVNA 4XYBA 2ZSFA 3SHFA 1Q95A 2VJPA 3MWFA 4FXPA 4MTLA 5JCJA 1KZGB 5F3WB 3ZJYA 4C2TA 2YCBA 3VPHA 2VNHA 1CNMA 1VE3A 2LP4Y 4XYMA 2MMGA 3LA8A 1U3FA 4EYKA 5J4YA 1D1QA 3R7SA 5EIBD 1L1EA 3NTOA 4A0FA 1GYPA 4CWAA 5IW8A 4LRYA 2D0IA 4E2WA 4COKA 4OQYA 1NI5A 4Q9LA 2OVBA 2KMLA 4MS3A 3C6BA 4XPIA 3SYKA 4IOKA 2D1TA 5DGHA 2IHZA 4MWOA 3GJSA 4ZDJA 4JYAB 4YCSA 1SEPA 3D3JA 4KXXA 2RGEA 1HR0B 2IGBA 3WX0A 4OSOA 4HBGA 5ALOA 2NO4A 3PIIA 3EMBA 2YJ5A 5DBGA 3RUAA 2PX2A 2Z2JA 3ELWA 5B1SA 3AF4A 2ODPA 4OQZA 2D8MA 1GFWA 1A9PA 4YAWA 1TF5A 2C7GA 2GYUA 2GPBA 5GP1A 3TTUA 3IV9A 3HP1A 4FB4A 2E5LB 1NJ1A 2VA8A 2DFNA 2WTEA 1WPRA 2WVAA 1GTVA 5EE1A 5L3RA 1R9NA 2M2IA 4B8WA 3B8EA 3IEKA 3MXTA 4TYQA 1ZRSA 5EJ4A 3BOSA 3INRA 3WYGA 3RTBA 1JHYA 4KBGA 4X1KB 4GXNA 4QOSA 1FB5A 2QHXA 1HLFA 2GREA 1B8VA 4N8EA 4LYHA 1ACJA 2IDMA 5CJPA 2DQZA 3F6PA 2P9EA 1YQQA 4GLLA 4KXLA 1DS6A 3R9KA 4TN1A 1UIMA 3VTAA 1S8OA 1NZDA 3QIVA 1S6YA 2PL3A 3QEOA 3GGDA 3ZVLA 2XAAA 4LDRA 1IMOA 1N33B 4FKMA 1D4OA 4WDQA 3DVLA 4GL4A 5D5PA 1V5IA 5CG1A 5A4AA 2RHDA 3JYPA 3MJFA 5JY6A 2Z5GA 3EY4A 3TBHA 2FUNB 4WI1A 4AQ7A 3I0NA 3NYRA 2A30A 3TMYA 4K86A 2C8LA 2I2AA 2OZLB 4DM3A 4NHEA 3I01M 1GAJA 2VUTA 4WVFA 1Z2EA 3F3KA 3GLHB 4J90A 3A8KA 1WF6A 4OM7A 3IEMA 3H19A 1P29A 3L0DA 1G8GA 3QPBA 1LC3A 4JLBA 2XZTA 4Z7JA 5AW4A 1ZUHA 4QUHA 2XW6A 3KZMA 3R77A 1ONBA 5EJ9A 2HK9A 1FXWF 1NBIA 4UOEA 1UD8A 3EFBA 1BE6A 1PGNA 2R85A 3KUXA 1YVRA 2QMOA 2R2GA 3LQRA 1UT5A 4MB0A 4BVFA 1Q9SA 4EY3A 2BSQA 3FTEA 3V76A 1O95D 1YS1X 2C8JA 3IBTA 4FDAA 1SBYA 2CWWA 1TM5E 4C2AA 1WNTA 4OD0A 1R8XA 3L7OA 2G0TA 3FBWA 5ITWA 5C51B 2QAGB 4M1KA 3WJAA 1UZAA 1KS2A 1XFDA 4ZCMA 4JIMA 2WK1A 5KU7A 2VNKA 1SRRA 5EOVA 2C94A 2BJHA 2KQUA 3HUTA 3LW7A 3N5KA 2GXQA 3VZQA 3W8RA 2FRXA 2P3QA 3A58B 2P2ZA 3C15C 2GSDA 3O94A 4IDEA 1CEQA 1R3DA 4M98A 5DYYA 3V2HA 5IWCA 3BT7A 1QYDA 3BE5A 4YPOA 1J0CA 4FDMA 4WXRA 5KKAA 2Y6UA 1T13A 3GCDA 1U28C 1A4UA 2ZXUA 4J4HA 2GCEA 4H16A 2AFHA 1Z33A 4P3KA 4L85A 821PA 3FTNA 2PRYA 3OFND 4IDFA 5EE9A 2JH8A 1Z6TA 4KQHA 1AF7A 3A1PA 1AQYA 1Q1AA 1LCIA 1QIJA 3OCZA 4Q24A 1OAKA 1U0GA 2C84A 3CPJB 4I8XA 4NR0A 3RE1A 4D43A 4EG1A 4ZTUB 1QH8A 1MJHA 2C04A 5EZQA 2WTXA 1JZTA 3FVWA 4BE9A 2O59A 4IFBA 3R3SA 4M1SA 4YP7A 1CUYA 3OY7A 3X1JA 3KSRA 2ZYGA 1WVIA 1CHDA 4UTNA 4P08A 4XH9B 1RXCA 4B46A 1NI4B 1NIPA 1T8YA 2FW0A 3CZ5A 3H3FA 3L4EA 3KJFA 4L27A 3UC5A 4EO7A 1U02A 2YQ5A 3DVAB 2HJHA 2FF7A 2HLPA 2ZUWA 3G9QA 3KVYA 5COQA 3WLSA 4LFAB 5E9WA 4NJEB 1SCUB 1Y3BE 3AB8A 1IE3A 4KHZA 3ZCSA 2LGJA 3AU9A 4M37A 4Y0AA 1YZUA 8ATCA 2ENUA 2PV0A 5CJ2A 2W2LD 4DLTA 4UBIA 1NBMD 2O7QA 5AFSA 1P4RA 1DTEA 2PWAA 3GN2A 2Q3CA 3HBLA 3M89A 3HLTA 1RKQA 4GHWA 1WQ4A 3BEDA 4I1YA 1QANA 3OUZA 5BMVA 1H2FA 2CLSA 1POXA 4BYGA 1G18A 3MUOA 2BFCB 3DZJA 4AX4A 5EC8A 2P9QA 2E82A 3GJQA 1BGWA 3CFYA 4RGBA 2BGLA 2TMYA 4XFJA 4FXOA 3WHKA 5GMOA 4DSZA 4NULA 5K01A 4GIBA 3CPHA 1PL0A 1GKUB 2FEPA 2FPMA 2WSLA 4EELA 4U6SA 5D6NA 3PUYA 1E43A 4YRMA 5B36A 4GR4A 2ZBQA 1PJ8A 4U8GA 2FEKA 3ZHRA 5B64A 1DT3A 3VSCA 4B44A 1PR1A 4RANA 2X53S 4G7XA 1V8OA 1BAPA 1MKYA 2BZGA 1S2IA 2CLHB 1ZPDA 2EBUA 2OLJA 2OO5C 3E1KA 2EIHA 1P9WA 4PYRA 2I33A 1YAJA 1LFDB 2Y71A 4WEOA 1TCAA 4XJXA 5HQTA 1CFZA 3H6GA 3KELA 3KDSE 1V9LA 2TMGA 3W6ZA 5AHRA 1Y7LA 2W70A 3J7TA 1XALA 1CQJB 3QOWA 5KMGB 2YJNA 1T1EA 3MGKA 5ULLA 1JNXX 3QE9Y 4WZBA 2WHQA 1GPMA 1DC6A 3UB3A 1ZW6A 1MENA 1TM7E 2E21A 2VNAA 4D8VA 4HDAA 4QL3A 5ECGC 2AR9A 2J5XA 2IYLD 2ZIXB 3ROTA 4ZCPA 4AWAA 5K1ZA 2FX3A 4HUJA 1KZ6A 2ZKIA 2QX9A 3JARB 1CUIA 1LJ8A 3CRRA 3VYSB 3CVXA 1NHGA 2RHJA 5JROA 3R74A 4LTNA 3IQXA 5B37A 3FRIA 3K5HA 4X1IB 3OY2A 1G2PA 4CCWA 4LBVA 1T9KA 3RSFA 1L4YA 1NU6A 3QW4B 3REQB 5LB2A 3PVZA 4QD3A 2X0JA 1KY5A 4DQDA 5JG7A 2DTEA 1XFOA 3PWTA 4Z1MA 1Z4JA 2AZMA 3MWGA 4KIGA 1NW7A 4ZT4A 5HK8A 1ZKMA 3AEQA 3DXZA 1LU9A 3HGMA 2ZI6A 1DAOA 4DCJA 2H1WA 4LXTA 4ZD6A 2IEAA 4PAAA 1F7VA 2P65A 1IHOA 1FQKA 3S2SA 5B4TA 3KSAC 4XRRA 1E8MA 3GP3A 2AK2A 1UWKA 3VH4A 4BO4A 2ZB2A 2HCFA 1I5EA 4X9XA 5LYJF 4YMUA 2HQOA 3GFRA 2QTVB 2CK3D 3FCOA 3O8QA 4LCJA 1D7OA 4AYXA 4HBZA 3GQBA 1E3MA 3B9QA 3ZZUA 4F84A 2ZL7A 2ZTLA 1VP3A 2V45A 4YP9A 4DT1A 1UMDA 4RGVA 1Z63A 3OP1A 1P77A 4GX1A 4A91A 2DUNA 2XUHA 4IEEA 4MGKR 4F4IA 2IL1A 3FHLA 3RWBA 3ETJA 4NU5A 3QPVA 3RM3A 4AMVA 5CFQA 5HSGA 3EEBA 4LVNA 3TINA 1G2OA 5MFPA 1U1EA 3RBZA 3A9CA 2H0AA 2WYRA 4AYWA 2POQX 4RE5A 2XRZA 2KHZA 3MIZA 2CE7A 5HQJA 3SSNA 4MQBA 2I2DA 1EX1A 5EGNA 3HYRA 2IU0A 4OHYA 2RHHA 4MWCA 1X1SA 4G3XA 4A2PA 4DA0A 4AY4A 3DB1A 2WY2D 1BU5A 3WKBA 3E48A 2ZITA 1JFLA 3ADKA 1PG2A 4DJ5X 4EJSA 1FUUA 3K6SA 1NBME 5EFOA 2ZZMA 4C76A 5JWOA 5TY0A 1FFSA 3PEFA 5K99A 4ZP1A 1A97A 2MCFA 3GZTB 3P0HA 2YC2C 3ACBA 1XCBA 2Z8XA 1O6GA 1LSOA 3B7PA 4K9OA 3A37A 2FFJA 1NGSA 2J4DA 2G07A 2UYYA 4BFYA 4URZR 1WBBA 3AH8A 1VF7A 3KQUA 4UARA 1UD4A 3B1VA 2QT9A 1QH1B 1EX9A 3AF1A 4NSNA 3GFSA 3L7CA 5D1HA 5EXEA 5HF9A 1U2GC 3GNQA 4KAJA 2GJRA 4EPWA 2ZB3A 3EWSA 1HQCA 4PYNA 1M5RA 2ZREA 2VPTA 4GI1A 1EUDB 2PA0A 2QROA 3K0KA 1C8BA 1MH1A 1HFKA 4U2EA 3AUSA 3KKLA 2IBSA 4ZC8A 1BMQA 2X3UA 5C9ZA 1GL6A 3PXUA 4RD4A 5FBVB 4GPZA 4A3SA 2F1IA 1SKBA 5KDDA 1MIHA 3AM4A 3CWCA 3NM6B 5AHWA 1OPXA 3C0KA 3C7KA 5CVVA 4RLQA 3H6KA 4NI5A 1XRLA 4BDTA 2OBRA 5IK2A 2RCYA 4IOLA 3FOBA 5ALNA 3MFYA 1JEDA 4GOND 2IEIA 1SUEA 4YO8A 3MWDA 4G84A 1GG5A 3WB0A 3VR1A 2P79A 4ALMA 5AUOB 2FCRA 4WOCA 2GZ2A 1DO2A 2QUBA 4KTTE 3VO9A 2QVBA 3TNFA 4QQKA 1YOBA 2QP9X 4ZREA 5IH3A 2A1UA 4HP8A 2L69A 2ZAGA 1WF3A 5C1IA 2AE1A 3HVIA 2B21A 3BWMA 1WSDA 4K9QA 4HGZA 1D2EA 2H5LA 2XUFA 4QYSA 3L1VA 1WKVA 1VDZA 3OM1A 4H0CA 2ZRBA 4WV3A 5FJIA 4ZVQA 3TVYA 4DR1B 1N2BA 2IYQA 4ASUA 1XA0A 2BKAA 3TCKA 1U0NA 4PNEA 4BB0A 1N3LA 3V2IA 4KC0A 3PDHA 4BC1A 2J30A 3EXHB 2Y0EA 3CEJA 4O33A 3GDFA 2XDQB 1VE7A 5A4KA 3WQSB 2W2XA 5EMKA 2I3ZA 5B7NA 1AQNA 1FY2A 3DEZA 1EKXA 3T8YA 5GZ3A 1JYSA 2JAQA 3WQRA 1VHQA 1CQIA 2NSJA 3ZVRA 1FNBA 1JHOA 4ND6A 4QOFA 4XQGA 3MCZA 5K09A 3CC8A 4KO8A 3ZWQA 3SHQA 3O4RA 3EDYA 4DMLA 2WUVA 5HKAA 4JYMA 1FSFA 1MVLA 2GCOB 1HC7A 3DWIA 3AHCA 4TM8A 3RC3A 2DH6A 3M49A 2Z9DA 2AQKA 5AW6A 1QRSA 1CEEA 2C03A 4KHPB 2ZTMA 4N40A 3BMCB 3LHIA 3MT0A 3HY3A 1Y48E 1QO0D 2GNPA 2EJTA 2NVUA 1XMIA 4ME6A 4REQA 4TYNA 3PRJA 4QLOA 4U02A 2Z1MA 3TEJA 1XMOB 4KB5A 1Z68A 1DB3A 1JEEA 1FA9A 2VHYA 2VWGA 3HB0A 4JHLA 4WE3A 2DUUA 5ETJA 6REQA 1UMKA 2J3DA 3B1YA 3EA5A 4I3FA 3I53A 4LRSB 3R6KA 1Q1EA 5LLTA 1LI4A 1X1CA 2XCLA 1AKNA 3K4PA 3RD5A 3M6FA 4UM9D 1K75A 1M1NA 2QF7A 4LJ9A 5FPSA 2YJ3A 4RKWA 5K4HA 4TZ0A 1Q3KA 5B3JA 3EOZA 2Q2OA 4ZVMA 3VPAA 1IWPB 1C7RA 1M0EA 1ZN2A 1YR7A 4QPJC 5HZMA 1ABFA 3E53A 3H1PA 1BS1A 2FPLA 2PNJA 3AHJA 1XQ9A 2B1JA 1HL7A 5EJIA 3L7AA 4LV6A 1EVIA 4Q00A 1NUSA 3BD9A 1DCMA 2UYGA 5I5EA 5FOUA 1SOWA 3A70A 3MMNA 1S2NA 3VYUB 1QG4A 3A04A 4TL8A 1QFZA 4LOIA 3WWOA 4QUEA 1BRMA 5B3AA 1P2BA 1XOIA 3NW9A 2WWWA 2JFVA 3UAYA 3ZD6A 4MUFA 1NI3A 1IRXA 2C07A 4YAUA 1DRJA 5LZ2A 3DMNA 4FOPA 1KMNA 5DX0A 5JARA 1TYEB 2ZRHA 2QGZA 2BGJA 1P4HA 3Q6MA 1O1YA 4XDZA 2MYNA 2CJPA 2D5IA 5ESDA 2AFIB 2OORC 4ND8A 4E07A 5E6UA 5JWRA 1P9LA 2CFSA 3Q38A 4AQYB 1J90A 1QFMA 5FA6A 2P27A 1Q1GA 3IEVA 1PZGA 1RM4A 2BR3A 4IKOA 4A6PA 3UGJA 3SKYA 1WQ3A 3F5QA 2RJOA 1Q0LA 4EG4A 4CEJA 4KQWA 1Z08A 1L4NA 3EEQA 4BN4A 2VSQA 4BGIA 3QYFA 4HTAA 4EVQA 2EQBA 5BR4A 1K5GA 2QN1A 3RRNA 5J5CA 4PNHA 3ZU5A 1T43A 3COZA 3DMHA 4QJBA 4DK1A 1E9CA 2B61A 4JXXA 1HZZC 2IH2A 1KSFX 1NXPA 1XTTA 1NG9A 1K9MD 2OK8A 3OO1A 4QAQA 4ZMSA 2PIAA 3BDAA 3DB2A 4EF4A 4DK0A 3ZLTA 1OXTA 1UMCA 1AKTA 3EK2A 4TTAA 4CE6A 1XCMA 3B3AA 4XYEA 1P5HA 4RPBA 4CMJA 4W63A 3EYAA 4DUPA 3RHSA 4O4HA 2B4KA 2QRVB 3B70A 3A3BA 2JH3A 3PJEA 2ZJ5A 4YIHA 4G63A 3CZQA 6PFKA 3O8NA 3QI7A 2G5CA 3BD6A 5TQVA 5BWCA 4PX5A 2CYAA 1EAYA 1RAFA 1DINA 2C7VA 3I6MA 1X7ZA 5T3UA 1UIRA 2ID9A 4K8OA 4FBMA 4S2EA 5DGXA 3FTQA 2IS1A 1G21A 3SY8A 3FFTA 3I12A 2H08A 3SC3A 2OOKA 2IVFA 2PX0A 2JFNA 2B5OA 1XMVA 3NUZA 4XLZA 3ZWVA 3I9FA 5DO9A 3CIOA 1LRJA 4UDOA 1E1YA 1D5WA 2VSXA 2CXSA 5CVDA 3LHFA 4H7EA 1RAGA 3UFBA 4MQLA 3B9BA 3PEUA 4DW8A 3DJYA 2F64A 2IZ1A 3L7MA 3M6XA 4BTVA 3VDMA 2XLCA 4GX2A 4JKYA 2QW1A 3Q2IA 4HN9A 2NO9A 4IXWA 1HKHA 3CH4B 3ZKWA 1W9HA 3WZ2A 2G1AA 2A5LA 4K9NA 5BNFA 3CIFA 1F38A 3PA6A 4IOJA 2X9GA 3LMKA 1NJ6A 4TXMA 3TRHA 3LNNA 4C1NA 2ZPAA 4CKYA 1JI0A 1RRCA 1UJ2A 1VIMA 4PU0A 2VJLA 1NYRA 3UJAA 4WLNA 4QSHA 1BS9A 3QLUC 1L3CA 4MVJA 3X1ZA 3PITA 5KSYA 1SD2A 3V4PB 4TS9A 3LH5A 1NY5A 5KVCA 2XDAA 2VCHA 1VQ5B 1THGA 1QV9A 2VH5R 3VYVA 4TROA 5JDCA 1CIVA 3BMOA 1TADA 1M6VB 3KPWA 4G1EB 3MB8A 4JVMA 4K1XA 1MT3A 4XGKA 3GAZA 3D8RA 2UKDA 2YMQA 5KNBH 4NJMB 2O3UA 3OPYI 1LNZA 1G4UR 3O0TA 3OQHA 2OD7A 2Z9BA 3C4QA 5ENZA 3QBVA 4QU5A 1FYWA 1E66A 3NOOA 1K8ZB 1I4DD 2IXGA 4HAOA 3RFVA 1KJIA 1OFTA 2WB2A 1KHTA 2P4EA 2J0QA 4XONA 5T8KC 2H9IA 2ZRKA 4MKGA 1EK5A 1L4HA 2QBYA 1L4BA 1K3UB 3LBAA 3PFWO 5HF6A 2RH9B 1SCAA 3L0IB 2DHDA 1I32A 3P26A 4K6CA 2P4UA 2WMOB 4QU0A 2D2IA 3WNVA 2XODA 2ZBVA 4ZCQA 3HYSA 3GJ6A 1Y7IA 4H0FA 2AF3C 2ZB8A 1DJLA 3MERA 3QSGA 1ACLA 1XU7A 3M5PA 3BYZA 5EP1A 3W9BA 5A9SB 2ZK7A 1PU2A 3TRDA 3AVUA 3OQVA 4X64B 1FFCA 4GMDA 2XT0A 4OYYA 1ULBA 2HK6A 1IN7A 2IE0A 2PO5A 1KVRA 2VXYA 4ROXA 4HRAA 5C8DA 4KR7A 4KL8S 3CW8X 3ECCA 4UDXX 1G20A 1UJ4A 4CUZA 1H4SA 3H1TA 2V8OA 3LCVB 3R6WA 2ZM6B 1NT4A 4R8SA 3M5DA 1CLEA 2NTNA 1KI8A 3F2IA 5DJ5A 4EPVA 5K0FA 3ZVKA 1J0AA 1QF9A 4TRNA 2NUAB 3UVEA 2O2SA 4C5AA 3W4JA 3KOWA 3GLVA 1GPUA 2PRJA 2ZJFA 1QFJA 3ABZA 4YI3A 4YJHB 1E58A 4OB8A 5DT2A 3R3YA 3WIEA 5DRYA 5CLQA 3E82A 1RM3A 1O6BA 1QKKA 1YHZA 2WP8J 4CMAA 3CYFA 1NFRA 1AVTA 3AF0A 2J9FA 4DRXB 3NBZC 3D4IA 3R5KA 2B4TO 2Q8NA 4BMYA 4K6KA 3OE7A 5IDXA 4J1NA 1PDOA 4E4TA 1CDDA 4WN9A 2QRPA 2VDQB 3U49A 4HNTA 4RDKA 2YWBA 4JV5B 1ZG3A 1OLXA 2WHRA 1P31A 1I51A 1CR4A 4RZSA 3NTXA 5DI9A 5ALGA 3U1VA 5DMHA 1TZCA 3PDIA 2TECE 2IODA 3W2FA 2AEJA 2R8PA 2YDYA 4C14A 3ZK8A 3TJZA 1BXRA 1SCKA 2PMBA 4UKDA 4DLYA 2HK8A 4YAGA 1GRNA 1NHWA 3GFGA 4U2KA 4GT1A 1W35A 2XSZD 3BICA 1V26A 2XH8A 3H86A 4PLVA 3S8EA 2R6JA 1M72A 1RRMA 2A9FA 4BLSA 4E03A 2ZTHA 3QKTA 2CDAA 3SXPA 4BNDB 1E2QA 1YVEI 3DOHA 3ENNA 1JIJA 1C7IA 2WM9B 1XTKA 3QVXA 3UQYS 3V7NA 3WIOA 2IS4A 3CKKA 3UF0A 2VDWB 4WXEA 3IMKA 4J49A 1NM5A 1VHTA 3FMOB 5JHHB 3CEPB 3L5OA 3HLYA 5HRUA 2FPWA 4QOJA 4ZZIA 5A6VA 1K97A 5DWDA 3I09A 4MO9A 3DMTA 2VDNB 4R31A 4Q6WA 4DMKA 4LISA 2ZI7A 2ZIZA 4QTTB 3SE0A 2QA5A 4DWJA 1MU0A 1UR5A 2XA2A 3Q9SA 1G5FA 4J07A 1XHLA 3S8YA 2CHVA 2O3SA 4EO9A 2EGHA 2MYTA 3DL0A 5CBKA 4CF6A 2E49A 4K6GA 2HSEA 3IQWA 2JI8A 3MB5A 4E14A 3U1BA 1CR1A 2JB9A 2OG1A 1R4MA 1FRFS 5JS8A 1MORA 4HLUA 3QUCA 3PXXA 3LCRA 3H5RA 3MWJA 4ZJUA 1JFFB 1HTBA 2F62A 1TQ2A 4F7WA 2OA0A 1N34B 1OB5A 4HFNA 1YB6A 4XVRA 3VC7A 4PYOA 4DAOA 2H07A 3AEXA 3AONB 2P9GA 3F5FA 4JS0A 4F0JA 4QKQA 1DIOB 5KYYA 4K88A 3X43A 3BA6A 1Y4SA 3GAAA 1ZGBA 2C78A 3NATA 3PKIA 4JL5A 3HKDA 2X6RA 4RIIA 5DU2A 4XIYA 4CL0A 3CXRA 2J59A 2WF9A 2JLWA 5LDHA 4M8KA 1TJPB 4BPRA 2WSSA 5BMVF 1ELOA 3DTVA 5TLSA 5ECDA 4KU4A 1WMSA 1FSGA 3A6FA 4GC9A 1KDOA 4KXVA 3ZDFA 4QGBA 1M2FA 3HCAA 5HDQA 5ALHA 2Y6VA 2LIPA 4QBHA 3CE9A 3CXCB 3E03A 3NHFA 2XZLA 2RHGB 2CBZA 3PGXA 4E1AA 4UBMA 2NN3C 4X90A 2HA4A 2BGNA 3LQ1A 3ZWYA 4KN9S 1ISRA 4KPFC 1H8HA 2J3IA 4FZVA 3FPEA 3NEAA 4TMZA 1KEEA 3OEHA 4DZTA 1NUHA 2QL6A 3OMLA 3C6XA 4HLNA 4WK4B 5CBPB 5MGNA 2PUBA 4GWLA 1II8B 2VEOA 4PQEA 1X86B 3OBIA 4ZOBA 1GA6A 1GQSA 4JVSB 3OZXA 2V6IA 4W8OA 3UK2A 1MO4A 1TUBB 1CQZA 1YS7A 3SYRA 3WQQA 2DGDA 1O77A 1NDHA 2DG2A 3F1KA 3WBBA 2Q5JA 4CLHA 4OPMA 2VSOA 4M88A 1QZTA 1CDOA 1EI9A 4IHJA 3QF4B 4PIMA 5EUQB 2ZR8A 4CJXA 1B2RA 3FSRA 1HDXA 3FYUC 3RT9A 1OBOA 3EH2A 1EINA 2X2EA 4KKXB 1GPKA 2ZYRA 1M54A 3O7WA 1P1CA 4DPMA 2N1MA 4Q15A 4V0OA 1DIAA 4JHXA 5EWJA 2C1EA 3OQJA 2W42A 2ZXHA 1J8YF 1RI2A 4HLDA 4QUBA 4UHDA 2ZRPA 4ZEVA 4M55A 5EZYB 5IXSA 3HK2A 2O8BB 2KPOA 4UZSA 2QU8A 1SRQA 4B2YA 2GJ8A 3P32A 4GBGA 3STYA 4B3HA 2E18A 3UPUA 1W2HA 1D6NA 3FHTA 4IDQA 1R0WA 3CW2A 4P7GA 4LGMA 2CDBA 2VHWA 4FEAA 1Z12A 1L5LA 5KQMA 1IK4A 2DLNA 1TA9A 1WSAA 3BHNA 3DL2A 4CKBA 1Y8RB 2WF6A 3CO5A 3GGSA 4L3VA 3JTEA 3DP9A 5JSFA 4UEWA 1YS9A 4YGYA 5HE8A 1YVPA 1FRVA 2F9FA 3AG5A 1NW3A 2PY6A 1S9DA 3KEQA 5L3QA 1C8VB 2MINB 3DZGA 1II9A 4YJ2B 3S5UA 3SSMA 3LTNC 3W5BA 1AUQA 3NDJA 4DCVA 4FE7A 1JGTA 3LFTA 3FDXA 4UNQA 7YASA 2ZDQA 2O8EA 4PFKA 5JRDS 3BB4A 5SYAA 5I4CA 1ZUD1 4JLDA 2OCXA 1M1XB 4N5NA 2V6MA 3JQDA 2VXCA 2J5KA 5DYIA 3DULA 5ALFA 3HB7A 5EIAA 5ALIA 5DM2A 3RC1A 3K0AB 4L3OA 3AI7A 4EGFA 2XA9A 1NIJA 2OR3A 2P3OA 2O3TA 3ZCQA 5JQGA 1DIRA 3RTEA 3N86A 5FI0B 3I6QA 2PKQP 1GPWB 5C5IA 1UMBA 2C2YA 2Z6AA 3SZGA 1SKYE 3BB3A 5L45A 4A26A 4XW2A 5IKPA 3H8VA 2CV2A 5EJAA 2HU7A 2QENA 4Q9AA 1NKVA 4CIXA 2NP7A 2G5GX 2WHEA 4LY9A 1TCBA 4OXQA 1UM9B 4RHEA 4RFVA 2PZGA 1P5RA 4O2BB 1JG2A 1QPBA 5IYZB 3MUEA 4Z1MD 3NWEA 4Q0MA 2II6A 3LRTA 3K2EA 3OAAA 3UMSA 4QWWA 1XQXA 3G6WA 4IO0A 4WL0A 2XIJA 5JDIA 5EY5B 3RSHA 1XPUA 1PNRA 2C57A 1ZD4A 3OQNA 3FYHA 1G3QA 1ESDA 3FRHA 4Z0PA 4RMJA 1JHMA 1GA4A 2GHTA 3Q10A 4URWR 4L3WA 4TLDA 5HDBB 1ZAKA 1N8KA 5DTEA 2X9QA 1TFUA 3PPIA 3TLGA 2W6OA 4A82A 3E1YE 1ZN7A 5C8YB 3JVEA 5CDTA 4OOFA 4LNAA 7GPBA 3WOVA 3QJ5A 1XL0A 2GKGA 1EVKA 2NZ2A 3W5VA 2D4HA 2ZDGA 3K5WA 3ZDEA 1WWKA 3ZWPA 2R47A 5BN3A 2QLNA 4NDNE 5H16A 3D6UA 5L7YA 3DLBA 3BFKA 1GY8A 2EL7A 1YTLA 1JHZA 2WAAA 1F3LA 3GLRA 4LMAA 4JB2A 3B51X 4PLWA 4C5CA 5EMNA 4W1PA 1GTRA 1V1MA 4H7JA 1UBUS 1W36B 3DDCA 4XUDA 1E1RD 2WKPA 1O08A 5C37A 3D54D 3GLGA 1JDVA 5IKMA 2R0QC 2UZ1A 2PZMA 1FW8A 4JYCA 4OJTA 4UNNA 4QBIA 3JD3A 2WWGA 2QJFA 1VKZA 1E7SA 1EBFA 5T6MA 5DHTA 3HJFA 1JJFA 4ZAYA 4R1PA 5E6RA 3PGJA 1QYRA 1RRPA 2RGDA 1P4AA 2R5WA 2QVCA 2X8JB 1GGHA 3CA8A 5F2NA 4IJVA 1VQMB 2VP9A 4UU8A 4DIDA 2VJIA 4PSAA 4YUVA 2Y66A 4KFTA 3TD6A 3EWIA 1QUFA 1PD1A 3HB9A 2FWPA 1RR6A 1FDOA 3A05A 3BWYA 3VTZA 3AEZA 4CF7A 3E3OA 4OMFG 1GO2A 4BB5A 4NAVA 5LZ4A 1N06A 1LY1A 3SJZA 1U3VA 3OX2A 1EVEA 3C8UA 4PZYA 4XYGA 1N2SA 1NF2A 4H15A 4L15A 2G3YA 5K8CA 5FBRB 1BO6A 4QDOA 4WKBA 5KYKA 1KEKA 2NP6A 1RRGA 5KO2A 2VTBA 3KYBA 3ZTTA 3D2LA 1IJEA 3BKXA 1LSSA 3E3AA 4FDVA 3T7KA 1IN5A 1E5XA 3M6MD 1CUEA 4LE1A 4PTZA 4AO7A 2X9NA 5A0FA 2RGXA 4E08A 1MN6A 1AGRA 1PLLA 4F86A 3A3KA 3ABIA 1YRQA 3KZVA 4PAMA 1R50A 4V0NA 4G97A 1P1FA 2XBLA 5AW7A 2ZBUA 2GM9A 3GVHA 4PPGA 2XTJA 5G1PA 2VP4A 3RVQA 4EM6A 3DMPA 4KAFA 4MGZR 2KX7A 1ODSA 4P98A 1XF1A 4NCXA 3JVVA 2J46A 2PS0A 3MCTA 3GRRA 1UWVA 3RRYA 5IASA 1QH0A 4NJEA 2C4KA 4KK4A 2H7YA 2X5JO 4D0GA 3IP6A 4HNHA 3U3OA 3I32A 3W5IA 2A9VA 2J6BA 3NWPA 4X8OA 4JOCA 4G5FA 2H3HA 1U7WA 2AD5A 1DDIA 2BTQA 3TK1A 3D0RA 5CB4A 3NGMA 2AQIA 4QGGA 3I1IA 5IK2D 4D26A 2B99A 3S6JA 1JKXA 1GAWA 3OIVA 1AC5A 2BEUA 2FP4B 4K03A 1YJ9B 1CY6A 1U7ZA 1QFYA 2GHIA 3CRNA 1ICEA 1PE0A 4CIWA 1P0QA 4YRRA 1ZK0A 4XEUA 4HAYA 5FUWA 1EYZA 3QVKA 3FCAA 3IR5A 1YDMA 1F5SA 1FU4A 3ISJA 2VR1A 2WU4A 1KBQA 4OA8A 2QTAA 2WWTA 5CYPA 2QX4A 1N2HA 4HEJA 4U0JA 3BRSA 4RK7A 4WOBA 1V2HE 4D9MA 1OXUA 1OGIA 1QLHA 2NVWA 2DAPA 3DBLA 5C3MA 4E12A 1ZOLA 1DFIA 1H2XA 2VCYA 5EIOA 1XGKA 2VOJA 1QORA 3TLAA 2ZSDA 1VKHA 2ZBRA 1ZHHA 3ZZNA 3NZEA 4XIFA 3RUPA 5KKNB 4PG4A 3PXGA 3GFVA 2W6MA 4B3IA 4OLAA 4HNSA 1K7EB 1RYFA 2HADA 4RTJA 2WJWA 5EKTA 3X3HA 2W2KB 2FJPA 3F6EX 4C7MA 5JAUA 2C4UA 2RAPA 3IC5A 2B25A 2QB5A 4RSRA 2O2DA 4BO5A 2A0WA 2O52A 1YJ5A 1GYRA 1RHQA 3CT6A 1F8UA 1K7FB 1OFHA 3JARA 4AS2A 1SNYA 2WYIA 1D7AA 3P9KA 1YHYA 1PZNA 4IS3A 4IHAA 2H4ZA 2HWUA 2RHTA 1HGXA 4LNUB 4CZ2A 3EX7C 1LK7A 2BHSA 3H16A 1MTOA 6YASA 1J2UA 2HA0A 3AETB 4I9NA 1Y7HA 1RWKA 3K4QA 5DNWA 3REQA 5AM4A 3DM5A 3QMWA 1UK9A 2XNHA 3HR8A 3NH6A 4DOMA 4U9IS 1T35A 2N42A 2NQ8A 3QOYA 3X44A 4NNJA 4URUR 2PH1A 3BJMA 3AI2A 4A73A 3RSGA 2SECE 2BGGA 1JXAA 4K6FA 1T36A 3R1IA 3D6TB 2BPOA 4LA4A 4PYKA 4R6WA 2M5SA 2QN9A 2YJ4A 2ZRNA 5I7UA 4I9FA 5LLDA 1L5WA 3GEDA 1CTQA 4JI5B 1FC0A 3TTVA 3ZJTA 2YNMD 4FMDF 1XTPA 3QVWA 5A0TA 1PT9A 1XMSA 3T9AA 3H97A 5AKKA 1QGUA 3LQ6A 2ZIWB 5FOSA 2OENG 4L5IA 5F5XA 3S8MA 3L0CA 4BNNA 4ED9A 1KSHA 3EYWA 4Q5IA 4E46A 2PGAA 1PDWA 5KSWB 1NBOA 4FGKA 4O4HF 5IAGA 2FZ4A 4TZTA 2PZJA 3ACDA 4OL0A 1DMRA 5ILGA 1W4RA 1YRWA 2V7WA 2QD5A 3E9YA 2ZJOA 3HJCA 1YZNA 1A8UA 1X7YB 3AINA 3ZWMA 1KVQA 3HZOA 1O6CA 2W83A 3CF2A 2PZFA 5DM0A 3KX2A 2DBVO 4GZLA 2ZAYA 3OC0A 4ZOEA 2G77B 2WDZA 1FQWA 1IAVA 3UJ8A 1P5ZB 3KE9A 2NO0A 4KR0A 3ZDYB 4GECA 1XLVA 3TW8B 5LC1A 3UV6A 1U81A 3A25A 1RVV1 3MXOA 4X3PA 1KDTA 5GTDA 3WP1B 3M70A 2YFYA 4MAAA 5AVKA 2JLBA 1HFWA 1MAUA 5GZ6A 4OQPA 1ZSNA 1NA5A 1Z6GA 3JX9A 4LDNA 4PCAA 4R9UC 4W9NA 3HR4A 4J9VA 2HJWA 3DV0A 3ONDA 4WY2A 2Y1OA 1UPAA 1U8YA 2EFGA 2C9OA 3B3JA 4HAXA 5DPMA 5G41A 3O73A 1E2FA 1TVCA 3EPHA 2BV3A 4AZSA 4GXRA 3H2ZA 4LK3A 2JK1A 2D1FA 5HKLA 4BV9A 4H17A 5JD6A 2FN9A 4FYIA 1ABEA 4JGIA 2HX1A 5KAMA 3R76A 1ZWLA 1VHEA 5EQFA 4YV7A 1K3FA 5HUJA 3K15A 2ZSBA 2OESA 3EXAA 3ZXIA 3FG9A 3L6BA 2DR0A 4YMLA 2ADOA 1J7JA 2X13A 4HH1A 2QZJA 4AP6A 3SVTA 1NKTA 3PHIA 3KDPA 1AMUA 5IJZA 4HYEA 4MRAA 1ISPA 2NXWA 4JXZA 1XLTA 1X0XA 4NKRA 1S72B 3NCHA 3RS4A 4D1YA 2NX2A 4GOMD 1XXHB 1N2IA 1QVVA 4MVJF 1HE2A 4MWDA 1HDYA 3RIMA 4C7BA 2RDMA 2XXAB 1Y89A 2YXLA 3LF1A 3NKLA 2QP3A 1OJ7A 3IDSA 3O82A 1MTZA 1OZAA 3A6DA 1GCUA 2FFBA 2B9EA 4TZKA 1JJVA 1D2RA 1KH1A 4BCCA 3O8RA 1UD6A 3AUJB 3JD4A 4QO7A 2AZTA 1QG2A 1DPFA 1VPTA 1UC4B 3D8HA 3M9XA 2HGSA 2ONZA 1J33A 1T9CA 1M73E 5DK4A 3L8HA 1TYCA 3OFSA 4JEHA 3WIDA 2BTEA 3RVJA 1E3EA 2Y77A 3D0OA 3OPOA 3ILHA 8ABPA 2XVMA 1YK1A 3KZOA 3LGSA 3MUNA 3NYIA 4I50A 4FFSA 4HYQA 4OEHA 4WFJA 1GU7A 1YB2A 1M7GA 4RADA 1N77A 1JKJB 3UM9A 4GW3A 1UDBA 3QUAA 2GAAA 2HUNA 1HXHA 3LO5A 3F6CA 3NIGB 3RR2A 3BERA 2VYFA 1MQ9A 5DLPA 2NO7A 2GN1A 2V4MA 4HCJA 4O1HA 5DXFA 5GIOE 2H2GA 4TLCA 3T95A 1QKIA 1TKBA 3ZDQA 1C8LA 4I8IA 3PGVA 1C4XA 4JI4B 1H65A 3QOFA 2H2IA 4OATA 3VDNB 2Q5QA 3NBAA 3OZDA 3GCZA 1V8FA 5BOVA 2W98A 4EUFA 4TMKA 3L46A 1ZCFA 5P21A 2QW8A 2OPBA 3PU6A 4DSUA 2A0FA 1SXGA 1S2MA 1NBAA 4UHBA 5CT5A 3WO1A 3WGLA 1RI1A 2DBYA 2IK8A 2A9QA 1N2EA 3NU1A 5DTRA 4GMHA 4EPXA 4P84A 4CDMA 3R7LA 3KYJB 1L7AA 1EX6A 4E13A 4PO3X 1E4EB 1JIQA 4FYJA 4M99A 4PN3A 5E7MA 5U4XA 5CT4A 5A9RA 1QCZA 1JXQA 2RONA 3FWHA 4QQ8A 3SBDA 1NOIA 2CZQA 3OZUA 3L1JA 4MWSA 4BMOB 4EYEA 4BZPA 3CCSB 3I6YA 1HEUA 1Z4MA 3L01A 3FDZB 2EZTA 3P27A 2C5SA 1I2MA 3JQBC 2YWHA 4XTRA 3SNHA 2REXB 4MSUA 2Y68A 4POAA 4D9CA 2XHEA 1ZI9A 2GEBA 3VA7A 5KNDD 6ABPA 5BP7A 4UAJA 1U3UA 3T5BA 1KI4A 5TE9A 2P40A 4KVFA 5CGQB 4PYLA 5G4LA 3ZD9A 3H9UA 1T4CA 5BUCA 1YCDA 3NHLA 1LI7A 4DC0A 5IAAA 1FDUA 1OPRA 4EEZA 3LO8A 1BN7A 3HWWA 3IOBA 4Y8VA 3ONVA 1B7GO 3VNVA 1FDIA 4P31A 1CZLA 1CY2A 3GFOA 4KK3A 3OD1A 2PQ2A 3L1KA 4TSRA 3WY9A 1RAIA 5CCDA 1EP1B 1JECA 4WJKB 4NBSA 1X7DA 3OE5A 5D6OA 5A3JA 5JRZA 2O7VA 3OZWA 4TVBA 2E6KA 2XGSA 4UHJA 1C3VA 3ZOZA 2B4YA 3HDQA 3R7NA 3TCNA 1GZ7A 4BLUA 1I4WA 1NW8A 6LDHA 4J7XA 1W5AA 3UTDA 5C4IA 3DAPA 4I4LA 2FOLA 2FZCA 4DCCA 2PJZA 2EFYA 4B6SA 1GRQA 3BNWA 4J0JA 4ZDWA 3PNVA 2XE7A 2G82A 3DE3X 1MPXA 4O25A 2BEVA 5H4HA 4YT2A 2XMZA 2HWWA 4CMCA 1NAIA 5BORA 2DETA 4DR2B 5HXBA 1E9FA 2I7TA 4PNPA 2CJWA 2XQFA 3O5AA 3JWJA 4R0VA 2C3UA 4BIIA 5IVDA 4ZQGA 1RC8A 4E0BA 2MYPA 4UCXA 2ZYSA 4Q1VA 3AQIA 2QXYA 2B6NA 1LQ2A 2VPIA 5LZ8A 1GT6A 2GZ1A 3K72B 2A1TR 4WY5A 4Z0HO 3T3MB 5EJFA 1A9ZA 1WKBA 2JFGA 3LFHA 3PHLA 4KXFB 5KU1A 4E7PA 1J49A 4NBWA 4XAQA 3Q3AA 3ISXA 1IXKA 2RC5A 3W5UA 1SIUA 1G21E 2VPQA 2EZ9A 2ZSHA 3EZGA 4GMFA 1B42A 3RNOA 3WOHA 4YR9A 4HGPA 2M6LA 5JNVA 5LMCA 3USZA 3WMFA 3G6EB 3ZC3A 4KQ1A 4AJ9A 1P7CA 5C1OA 3ICQB 3GLFA 3IELA 1QTRA 2FE1A 3WBKA 5K0JA 1U8XX 1EUCB 2GEFA 3OQOA 3ZVMA 4TXJA 4JOBA 2V0CA 5F7XA 3KL4A 3GMDA 3QVOA 4FZRA 4L8LA 2Y05A 1E5LA 1ZJ5A 1OVGA 3V33A 3UPTA 2ZRDA 4ZXFA 4B4WA 3KT3A 3NHJA 3H11B 3SS9X 4DTCA 2QY9A 1RXIA 3A7DA 2WD8A 3KXLA 3PK0A 3J81A 4WCFB 4B40A 4I7EA 4U9UA 1ZMBA 3U31A 4LV8B 1XDUA 2BBWA 2LV8A 1OFIA 3S1LA 4HDNB 3Q39A 4RPIA 1X19A 5G0WA 4Z49A 4DHEA 5F2EA 1QGAA 1JMYA 4P3XA 1BFUA 2OZKA 3ZWWA 2SNIE 5CITA 3SVLA 1SN7A 1Q0PA 2FMIA 3PQCA 2V6BA 4C22A 3AUYA 3W8NA 2Z04A 2PGIA 3CKLA 3FPBA 4IRXA 4JKIA 4RENA 5EIXA 1DC3A 3OZ7A 3L92A 4OXYA 1SIBE 2CNBA 2HO5A 2JRLA 3VDXA 3W77A 3O8CA 2XZPA 5FI3A 1N92A 1C0LA 2CUKA 1I36A 4J0QA 3QE0A 4LHEA 1X74A 4MULA 4BE7B 2JGAA 4CIVA 1KE2A 5ES4B 1WBDA 4HDMB 1N1MA 3H5IA 3N05A 3BRCA 2BKUA 1YGYA 3HPQA 5AM3A 4PZAA 4F3TA 2QE7D 2GN2A 2PFSA 1E62A 1RD4A 4KFUA 4TKUA 1JAHA 4W9RA 1ZCAA 3QMMA 2CVOA 4WUTA 1X39A 2DY1A 2PZEA 3GH3A 4IHJF 4PRLA 4R3WA 4DMFA 2IZZA 4Y9TA 1ODFA 4YRAA 2BSAA 1UDWA 3X1WA 1CX9B 4KUGA 4KRFA 5AKEA 2N46A 1CP2A 3F96A 2MT9A 2ZS7A 2IIPA 5ENVA 3KTFA 1E2UA 1KOFA 2FV8A 2I29A 2NU8B 3DUWA 3FZEA 2HDOA 2ZJ1A 4M0CA 4ZAXA 3BGOS 4RGYA 2C29D 3GLIB 1Y6JA 1ZJ4A 3VJRA 2VNJA 2HREA 4LOKA 2PGXA 2HGZA 5JXGA 4GSKA 4RF4A 4A0QA 4UEKA 4BMXA 2W6IA 3ROQA 2GT1A 2G9RA 3ZLVA 2W5UA 5AKHA 3P5BA 1ZIDA 5U9CA 3FZGA 3VM6A 2XUKA 3N53A 2DLDA 3I6ZA 3E05A 1YITB 4PSUA 2GJKA 4DHWA 2O8CA 4X7EA 2WPDD 2Y76A 2FZEA 4KVGA 1V0JA 1AKYA 1Q84A 3CUYA 3NYQA 4FHEA 3URMA 1JH9A 3KQOA 4RAOA 4JMLA 2OBLA 2R87A 2XXJA 3NNSA 5DIZA 1T9BA 2H4HA 3ZEAA 4BFSA 4M8SA 4D82A 3ITNA 5J9FA 1B8PA 1TD1A 1YVUA 3PQFA 3JQ7A 2A9KA 2EATA 3ONWA 5AUNB 5ALWA 4KREA 4OO3A 3SZOA 2CD9A 2CKDA 2IYZA 3TRKA 3AX6A 2AJ8A 2ZIAA 2KS6A 1GDTA 3KQNA 2JJ1A 4EEXA 1EIZA 1VCNA 2J67A 2ZUDA 4HUQB 3SPXA 1AKUA 5FQOA 4IWNA 1XEAA 2Q8PA 1G7RA 3HCDA 4LN1A 3SN6A 5B5SA 1U5CA 5JQGF 2B1RA 1SHZA 4XN3A 5AUQA 4LF5B 2P0EA 5IS2A 4TXHA 3KM0A 1PX0A 5HUQA 3QHQA 4KQKA 5KYUB 4M22A 1WUYA 1ZA2A 1XVAA 2VTDA 4M1QA 1WB9A 4XMYA 1TT5B 4QUJA 2YWRA 2ZIVB 2CUZA 3ROMA 4EG7A 2WA2A 1PW5A 4G7WA 4HNGA 4IGKA 4L4ZA 3LHKA 4G8CA 1ZC4A 2IYUA 3C7CB 1AT1A 3SIRA 3FCYA 2BTOA 1L7NA 1AV7A 2O1EA 3IBGA 1FDWA 3QMVA 3WIVA 3NS7A 3H18A 1K68A 2SKDA 1Q21A 4QBTA 4EG0A 1BQ3A 4C2UA 2QVXX 1MOPA 3H7AA 1UADA 3A2KA 1CB0A 1SBQA 1NPDA 1GCAA 3W2IA 1K9VF 3IT3A 1ZM2A 2GI4A 2YKGA 1RABA 3HCRA 4C43A 2FF5A 4GC5A 2HBYA 3GDGA 2XCIA 4BNMA 3NI2A 2I1WA 5C35A 4RZUA 4M8LA 1A77A 4YJHA 3T7RA 3WMGA 5MN5A 3H4IA 3MTDA 4JJ4A 4JC8A 4WZTA 3ULKA 2VS1A 5HQ3A 1CR0A 2J48A 3TKLA 2PLWA 4YC7A 4S35A 2RIRA 2IW3A 5L53A 1G3MA 1H69A 1SZJG 4I36A 5JAPA 1FJ2A 3TLKA 1Q82D 1NVUQ 4HWSA 1B8UA 3KPJA 3ZHZA 2HQ1A 3IS3A 5I5GA 3ADBA 3CW9A 4E2XA 5C32A 2X19A 4OI1A 1WPGA 2IU3A 5FAKA 5TSDA 5EHNA 1JNYA 2QJOA 3WLQA 4YQFA 4BQEA 2VBVA 3CLVA 4B75A 1E59A 3A4VA 4HB2A 3TQRA 3UA3A 4O3FA 3HS3A 3LP5A 5TGZA 5E3HA 5IX8A 1R0LA 1U3CA 3AHIA 3C1UA 1RQGA 3O92A 3LOPA 1R4AA 1C2YA 3HFRA 5HKKD 3CUEF 3KEGA 3VSDA 1JHAA 1OC2A 3OE4A 4RIHA 4J6EA 1Z5GA 2NM0A 3KBOA 4F3YA 3TEFA 1PVVA 1QLJA 1ZRHA 2XD9A 4NFSA 5EFZA 2G6TA 3W4KA 4C6TB 4LC0A 1O97D 4CQLB 1KFKB 4MHTA 3D8NA 1JHVA 3H1FA 3I30X 2D2EA 3F46A 1ZS9A 1TZKA 1I4OA 1PJRA 4GVXA 4W7SA 2UXDB 3OETA 3W3AH 2VEDA 4JBYA 4Q18A 5FX2A 1SVNA 5IJAA 2BBTA 1GP2A 1E4YA 4M1ZA 4JR2A 4HE6A 1I4EB 2HV9A 3T1OA 2YFQA 3P9PA 4RHFA 2JLXA 1KZ4A 4YUYA 1QAQA 3PP8A 2JHCA 2PZAA 3PEEA 1J5EB 2OHFA 2CL7X 4UCFA 3GBVA 5HGJA 1NVVR 3LQFA 5J2UA 2R3SA 5KVVA 1A8SA 1FSPA 3RH0A 2EKZA 1N1DA 3TWOA 4D99A 4ZKDA 3WA7A 2D3WA 1XZBA 1PJSA 4TKMA 1GD1O 1Z6AA 5DHQA 2K6GA 5K3FB 3PX3A 2AXEA 3T5DA 3HSKA 4QO8A 1JTVA 4RC9A 3TI9A 4EPRA 3N2GB 3IIEA 1BJRE 3JAWA 3RVRA 3CS3A 1JWLA 5IN5A 1G3UA 2PX4A 1HV8A 1E79D 1TA4A 3LKBA 4KXWA 1UXJA 5E1BA 5TVGA 3FKQA 3SSAA 1AGXA 4DXAA 3U7IA 1E1QD 1GNTA 1VJTA 2W8BA 3AK4A 1VBMA 3ITKA 2VZ9A 4LJ5A 1VG0B 4RMHA 2PAFA 1RQPA 3UJ3X 1Y5NA 4Z4QA 1CUSA 3O1HB 2C1ZA 5AHXA 5CB4F 3WLKX 1CRPA 1BKYA 1Q86D 2FWMX 4NLLA 2BE7A 4XM1A 4LK2A 4Y9SA 4OU4A 3AZPA 4UDNA 5K0BA 3NWOA 4LRTB 1THZA 3EB9A 1UAYA 3ETDA 2GGSA 2PMCA 2Z5LA 3GBSA 5DIFA 4BQPA 1CHNA 4ETIA 1KPGA 4P3OA 3DTNA 4V0RA 5IYWA 4FFMA 1OXXK 2BKXA 2R62A 3M4JA 4FN5A 3SQXA 1NWCA 5DGIA 4U1RA 4KKTA 3OM8A 1VQ8B 2C5GA 2IUUA 1TNDA 5A2QA 4HXGA 5K3OA 2A5GA 2P35A 3PD7A 4C6HA 2WVHA 1C3JA 3TR6A 5DSZA 2I2FA 3FZYA 1V8BA 3FYCA 2ZUBA 1SC6A 3PRYA 4W1QA 4RY2A 4MGEA 2V65A 4FBLA 4CGZA 2ODBA 4GGOA 2CFOA 2EJUA 4RYLA 5DULA 1BX0A 1T5EA 2BYTA 4CM5A 1SUPA 2SICE 4S12A 3WJ7A 4RTMA 4TL7A 2ZDHA 1YU6A 4G5GA 1E3QA 3HVUA 3L1UA 4YRPA 4LSMA 4UAVA 4P3YA 3NQ41 3R9IA 5AVTA 4AF7A 1LBQA 3BAZA 3CURA 2ODNA 1I1NA 3ZNOA 5JVDA 3RU2A 1J1ZA 3OFJA 1IY1A 2LCFA 3OPMA 4AP9A 3FNEA 3OPNA 1LF0A 4AYTA 2VSNA 4EI2A 3OCXA 1LLUA 3AM5A 4M0UA 2P9JA 5EA2A 1P75A 2VQSA 3NBQA 3HHEA 1V2GA 5AR1A 3CLTD 4UVEA 5CFMA 3IOYA 1YRBA 1LK5A 3LYLA 3KFXA 2EKQA 1VXRA 2P68A 3BILA 3OIUA 4TX1A 4JYPA 1Y9AA 4TPKA 3JQPA 1G291 5DLDA 5K0LA 1Y8RA 4CEHB 5FWDA 3QVSA 3KAPA 4Z7QB 2O57A 3FSGA 4UUPA 1MJFA 1U63A 5LKRA 5I7HA 4DV0B 1XRQA 1GHTA 4UJ3A 3R8CA 4DSOA 1OH6A 1ZNZA 2VHTA 1H5QA 3CEAA 3DEHA 1DKMA 3NBYC 3KG2A 1VL8A 3RU7A 3U44A 1M74A 2J3JA 2ASEA 4Y1EA 1TJ3A 5EXXA 2B20A 2FI1A 4XGIA 2ZSIA 1VQ1A 1WW8A 3IQGX 4YX9A 2FKAA 1BEEA 3U4IA 5LQRA 3KXDA 1YA6A 2Q5FA 1BIFA 2Y9PB 2VAXA 1Y33E 3MFQA 1JKMA 1HYGA 1MR3F 1X7WA 1NNLA 2F1KA 4R9SA 2KVOA 4WESA 4Z8XA 2PIDA 5F9MA 1IDOA 2PU5A 5CIWA 5EMHA 3RYCB 2HLHA 2V7XA 1ODCA 4CQMB 3QBEA 3ZUGA 4EA9A 1XEXA 4PVCA 3EG5A 2HMAA 1UODA 2DKOA 3AEKB 3KV1A 3NTUA 5BSUA 4AW9A 4B17A 2X3YA 3UOWA 3UV3A 5FR1A 4FFOA 3GLHE 1QK4A 5LOVB 2R4UA 1EB9A 1OIWA 2I1QA 3HEBA 3KU4A 4CF3A 1F2UA 1UPFA 1U8FO 3OSUA 3PUWA 2BP7A 4DMMA 5C53B 1PFGA 1Z8NA 1KPHA 3GRKA 3IOCA 3BS4A 3WGGA 4URVR 1ZA1A 2G8LA 2EGUA 1PR2A 1GPJA 1ZISA 4HYYA 4NE7A 5JMOA 4AKIA 1G16A 4IQFA 2G71A 5BXQC 1R3UA 1DNPA 1QCDA 3O95A 4HTFB 5IYZA 1GZ5A 2EHDA 4YECA 5L51A 4YRQA 1GXSB 1O94C 1ODJA 1PQYA 1JYFA 5H83A 4B3TB 5H3LA 3U3RA 3GLGE 1E5TA 5ILQA 3CJRA 3C7AA 2Q28A 2OAP1 5FBHA 4D9HA 1Z45A 1SZCA 1SK9A 3CNHA 3KSZO 3OZGA 4FYHA 1DKPA 1SOAA 3LLSA 4LX0A 3T5CA 4U5QA 1OMOA 4RQUA 1KJJA 1DXQA 2DYKA 4HO1X 1KYQA 2Z6BD 2PVPA 3VSEA 4OUDB 3VVBA 1E2EA 4OQMA 1FNCA 4H7FA 5PNTA 3CVOA 5DCWA 1F4VA 1L4FA 3PGMA 5CIQA 4EB0A 5BY2A 1EESA 4C7OB 3H5NA 1P18A 2Z58A 2HZ7A 1RPJA 4ENQA