2DYIA

Crystal structure of 16s ribosomal rna processing protein rimm from thermus thermophilus hb8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
162
structure length
162
Chain Sequence
MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 16S ribosomal RNA processing protein RimM from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ribosome
molecule keywords Probable 16S rRNA-processing protein rimM
total genus 31
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2dyiA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2dyiA01
2F1LA 3A1PA 2DYIA 1PM3A 2QGGA 2DOGA 3H9NA 3HTRA
chains in the Genus database with same CATH superfamily
1PKVA 2F2VA 2YDLA 2VZLA 3RBBB 4N4HA 4F17A 2KR3A 1UEBA 4M2LA 4OOVA 3L2UA 2CH4W 5FRMA 4ASUA 1VIEA 4FCYA 1VQLT 3OYAA 3M4YA 2LCSA 3QZ5B 5GANh 1ZM3A 5L46A 2YRVA 4RTUA 4C5IA 4DBFA 2RH2A 4PAAA 3QWYA 2KQWA 1NBEB 3OYEA 1K9AA 4P2NA 3VNUA 2HBWA 2LZ6B 2GFAA 1LOJA 5D7UA 1PNJA 1WPCA 3CCET 1G7SA 5DSZA 1TWBA 4KKUA 5DLOA 1VQ6Q 4YAUA 4HIZA 4M78D 4XN0A 3OMGA 1X6GA 2EKOA 2LQWA 4RPBA 3G7ZA 3HAGA 5DN6A 3CXCS 1AMOA 4UZEA 3QSYA 1SKUB 1M2OA 2RQRA 4J0QA 5J39A 1UD5A 2V7WA 2I1LA 4GLKA 2VXFA 5THXA 2LJ3A 3C12A 1RAHB 2DEUA 1G7TA 4OP7A 2GF7A 3RIRA 4X07A 3A35A 3BY7A 3W2IA 1T0HA 2C2WA 1OEBA 5CAIA 3JCMd 2P0PA 1PCXA 1QCFA 2BPOA 2R57A 4AFSC 3JB9G 1BX0A 1Q82U 3A8JA 5D6YA 2WJYA 5I2MA 1X75C 1IJEA 3L2ZA 4DOWA 1AEYA 1K73C 4PC2A 4OMOA 4BUGA 2J6KA 2V7VA 4BPRA 4LD6A 2XG8D 3M55A 4PL6A 4DBRA 1DDGA 4BB7A 3D7SB 1M1GA 2P3MA 2PE3A 2NWMA 2CKKA 1QGYA 2SEMA 3H0HA 3S3OA 2R58A 1K9MU 2RQTA 3DB3A 3VS1A 5HXBA 1VQ9A 1HYOA 2O9SA 1D3BB 1QMCA 1SPKA 1AZGB 2DILA 1VLOA 3PIPA 2ZTGA 2ZL7A 3JCMf 3CCLB 1JXOA 3MCAB 4PKCC 1DJ7B 1NEBA 1ABOA 4FN5A 4ZV4A 1HJDA 2V8IA 5LJ5j 2QTLA 3JSCA 1VQMA 4KKSA 1FMKA 2XIDA 4VUBA 1BMFA 1UD4A 4B6MA 2HSPA 1GRIA 4NS5A 4G7XA 4QVAA 1JO8A 5I11A 3ZIAA 1M90C 1I18A 5I21A 2XK0A 4BI3A 2X4YA 4Y28E 2E5KA 1VQ6T 1EFNA 2EYZA 3W5HA 1VQ5A 4F7UA 1R0BG 2WSEE 3AVXA 3FRNA 4OMFB 1W2BB 2EBPA 1HVXA 4P12A 2W10A 4J7IA 2OTLB 3EG1A 2EYXA 1UG1A 2J6OA 1Q81R 1UGRB 2QEXA 1KD1R 2O2OA 3CCQB 1BU1A 1TTHB 1BK2A 2QK0A 3QKJA 2MAMA 1U2RA 2DD4A 2X6YA 2P84A 5F4OA 4MDXA 3QDFA 1N8RC 4M7DC 2LP5A 1Q86R 2RJFA 4RD4A 3VO1A 1V0EA 4PFZA 3CRZA 1WSVA 4PFPA 4OOSA 2RQUA 1VQ4A 1M8VA 1HD3A 3TVTA 4P26A 3BY1A 2DL8A 2F2XA 1ZA1B 2CT3A 1M27C 3NE5B 2ZGWA 3CC2Q 4TMXA 4F14A 1W2BA 3L2RA 2GPJA 3QE2A 4G7WA 5TR9A 4LDUA 3W2FA 2M0YA 1PC0A 3JB9D 1ZBXA 2P4RA 2BVNA 3BE3A 2MK5A 3V76A 2O9VA 2GJRA 2L3QA 2DXBA 2MPXC 3QSUA 3OE7A 3CCRA 3CC4A 3WVEB 5CQYA 1MMNA 4ZN3A 4LDXA 1GVHA 4RDJA 2KAFA 4C92D 2EJ9A 3M59A 2KY9A 2OTLQ 4XOTA 4PJOE 2K2MA 4EMHA 4LNPA 3TREA 1B07A 4XKVA 1AVZC 3OYMA 1EFTA 2CP2A 3A98A 3CC7Q 1G3TA 1KTVA 5A8AA 1T6YA 2E6NA 4J6XA 1BQEA 3LW5E 4M75A 1N6AA 3LNNA 3CCJB 3DB4A 4L59A 3MCAA 3G4ST 2DAQA 3QWXX 3UA6A 2ZITA 1N9SA 1GCQC 2DYBA 3FLGA 5IK2A 2AT1B 2E3HA 4KKTA 4D8DA 2BZYA 5LJ5d 2K5FA 4UC4A 3ASRA 3TU4K 5GV7A 4M77E 2QAZA 3A8LB 3EG9A 1YHQQ 4FYVB 2PU9B 4IUUA 2YUPA 1YJ9T 3G6EB 2DBMA 2QTXA 3VRYA 3RDVA 4EMKC 2OTLA 1GR1A 1BI0A 2PMDA 4BDZA 4JS4A 1JEGA 2XNJA 1BIAA 2FVUA 4KRTA 1FRQA 3B82A 1PJ6A 1NLPC 2KRMA 4OGCA 2EJFA 2OAUA 3CCEA 1C6VX 3PT9A 1RQRA 1I4K1 3RY8A 4ZGDB 4G6IA 3GNFB 3TEEA 1M3AA 1TUIA 2KRNA 1VQKT 1OU8A 1NJIC 4FU6A 1I81A 5I2SA 3RKWA 2DF6A 4IIOA 4CC3A 4TVRA 4XM3A 1G3YA 1WA7A 3VO2A 3CPWB 5KE3A 4M75G 3P8HA 2AHJB 2DD5A 4C92A 2CDTA 3M56A 4JLGA 2EGCA 1JA0A 2FL7A 2RB6A 4A4EA 2ZPBB 4F7UB 4NCNA 4HVUA 4P1VA 5KW9A 3TQ7P 3J7AF 3AGPA 1ZSZC 1I8DA 4EIKA 5D6WA 3CQTA 4R71A 3LH5A 4ZGEB 3KEWA 1YJ9A 1WDTA 2Y4YA 2RM4A 1H8KA 4PJOB 2HL5C 1TTTA 3JQQA 3MEWA 3SLNA 5A89A 4E0FA 3OY9A 1YWPA 2JUFA 1PJ5A 4Z88A 4M0LA 3NMZC 4IURA 4TKOB 5HKCA 3CPFA 3OJXA 2PVDB 1W0JA 3WVDB 3PUMA 3ZBUA 3I55B 5LJ3d 4M75C 1ZLMA 4OPVA 1IXDA 1ZSZB 2WYRA 5LJ3j 2FG0A 4IUQA 2CZ1B 1YJNQ 3ASSA 3FEOA 3RKXA 4Q5WA 4C8QG 1IHMA 3FJOA 1WZOA 1QFJA 2RA2A 2DKGA 2D9TA 3EG2A 2CYZB 4PJOC 3EG0A 1TUCA 2FHDA 2JZ2A 4MZPA 3CEYA 1UD3A 4BD3A 1QVGS 3E2UA 3M0QA 4GY5A 2CF4A 4JS5A 1VQOA 1W0KA 1TOVA 1WP6A 4OB3B 4RTZA 3OBYA 5EG2A 5HCKA 1XJWB 4TMVA 4WCIA 2E4HA 3H8ZA 4ROXA 2RMOA 1WGSA 4KUIA 3CCUB 1YI2A 1QCOA 4HCCA 1SSFA 1NJIR 4PGOA 2BZ8A 2DXTA 4M78G 2RHYA 1KMHA 4J5YA 2X3XD 3CC2T 4EMKA 4M75B 1UFFA 3WQZA 3A3BA 1XTDA 3CMEB 2O31A 3NHNA 2J7KA 4RTXA 4JJBA 3I5RA 2X53S 3URGA 1N07A 4QVDA 3OPOA 2J7IA 2DZ9A 3B8HA 4ACBA 1E7OA 1XNIA 4J7FA 2BN4A 4HE6A 5J35A 4LUDA 3LWHA 2CUBA 3S3MA 1UMKA 3META 3OEEA 3VR6A 1YJWA 4PNOA 1VQLA 5I22A 1Y57A 1WHKA 3R6OA 1NJID 1QVGA 3RR6A 4J9DA 4QV2A 1SRLA 4XNFA 4E7SA 3X28B 1Q81U 2LNHB 2BM0A 1BI1A 4JDSA 1KZLA 2L89A 1VQ8T 1JA1A 3PMIA 3DLLA 5FL7A 3EHQA 2D1XA 3J81E 3QFCA 3SLDA 4IW3B 3E19A 1PHTA 3NTIA 4J6YA 4P25A 1E6GA 1UHFA 3CC2A 2G6FX 1UD8A 3GVLA 3VV0A 5GAN8 1XFOA 2KGTA 1X27A 1W6XA 1FMWA 5L23A 3AGQA 2X85A 1YNZA 2J6FA 4M75F 5EC7A 1K9MR 1EFUA 5GV8A 2NLUA 1PM3A 1K73D 5FU7C 3AVYA 2ZTNA 1QVGB 3OYYA 2CP5A 5HK3A 3O8VA 1RAGB 3ASQA 2KYBA 4C8QB 1H92A 1Q82D 2GTJA 2RF0A 1HSQA 3R6JA 2ED0A 4C8QD 1YLOA 2RK2A 3M9QA 2G3RA 3EHRA 3QIIA 1WHJA 3A8GB 3ASKA 1CKBA 2GQIA 4M7DA 1BKBA 4J9HA 3MPUB 3T53B 4BY6C 2QN6A 1V1CA 5IXFA 2MF2A 1BX1A 3GSIA 2X0KA 2DE0X 1QGZA 2XI9A 4RD0A 2OYNA 3NPFA 3OZWA 1G5VA 1I7PA 3VKIA 2XMFA 1GAQA 2B8AA 3T51B 5FU6B 2CZ6B 2D8HA 1KK2A 2YWEA 1VYVA 4RPDA 1X69A 3A8OB 1OI1A 3CMAA 2VUBA 4N0AC 5GAOl 2JMCA 2AKLA 2QTVA 2V8JA 3REBB 3LWIA 3S3NA 4Z89A 2ZZQA 2KVQG 3CCUQ 1RLPC 3UATA 1Z9QA 4TMTA 4XLHA 3X20B 1T6ZA 4FXUA 2R6HA 4ZNXA 4UZFA 1BJKA 3CCSA 3CD6B 3CCVA 4M7DB 3Q38A 3EAEA 2A0FB 3OYJA 1KRHA 2VNHA 2Q6IA 2KXDA 5GANg 1DDIA 1OU9A 5GAMf 4P5NA 4HCKA 2QMUA 2X3UA 5JBQA 3SEJA 3M5AA 4B3XA 3SFMA 3JRZA 1XQBA 2JVVA 4CC4B 2C4UA 4Y9RA 2JNGA 1X6BA 4OGEA 2ZAEA 4C8QE 1E43A 2W6JA 4XLCA 1W34A 2A37A 2DY1A 3G71Q 2RN8A 4M7DG 1PJ7A 1YJ9B 2LX9A 2DA9A 2QA4B 4CRIA 3UPUA 1QWFA 4LBVA 3VS0A 1FMVA 3MEUA 1YJNT 1FNDA 3GIBA 4RTWA 3CC2B 2VNIA 4QT7A 1X2QA 5E6TA 3I56B 3N5BB 4FT4A 3OYLA 4DQLA 2CZ7B 3OYCA 3WBJA 1ZM9A 2EAYA 1KC8R 3GNGA 1KSWA 2A3LA 4EDUA 4RD2A 3CCQQ 4PFOA 4M4ZA 2DJQA 1MHNA 2K9GA 3PVLA 1VQ7A 1VQ7B 3CCST 4A4GA 1AT1B 3CCVT 3CCLA 1QW1A 3CCMA 5FA6A 4Y9UA 4PC6A 1PD0A 2A08A 3I1FA 1AZEA 2LJ0A 4L6V5 4OVAA 5LJ3f 2X9HA 1VQ5Q 1YI2T 2ABLA 3JU4A 1EWYA 6AT1B 3W5UA 2EGEA 3M54A 1TH7A 5IYRA 3SWNC 3W2GA 3CW2A 2EYWA 1WQWA 1JB0E 1M3CA 1WXUA 2RJCA 4FWTA 4JZ3A 2OTJT 1KFZA 3G71B 2M02A 2K3XA 2X4JA 4D8KA 1YJNA 5GAMg 1QFYA 5HK0A 1LNXA 2HNIA 2KK4A 3M0UA 2E12A 2WSFE 2MCNA 4HXJA 4QW2A 2VYTA 4M78F 4J9EA 3JQPA 3EFOB 1VQNA 1G8XA 4O6JA 2LTOA 1QG0A 3VS6A 4ATOA 4XLEA 3SB2A 1BB9A 1W70A 5LJ5g 2JMAA 3OA6A 4WZTA 4GQNA 4PJOF 4N3NA 2R5AA 1Q86U 3OQ5A 2ZXIA 3ULRB 4TT3A 4CC2A 3OMCA 1OZ2A 3V7CA 3PIOA 3FB9A 2OK8A 2PLFA 4PJMA 3E9GA 4QQDA 4ELZC 4M77C 1VA7A 3OYDA 3CBPA 2RJDA 1QUEA 2QDLA 4C92B 3X25B 2O4XA 4M78E 1TUGB 1BI2A 2QG9B 1Q95G 2ZBVA 1D2EA 1SKYB 3ZBDA 2F5KA 2VGMA 1W1FA 1B34B 2CP0A 4A53A 1W2BP 3CD6Q 1D8TA 1JU5C 1AD5A 2QDXA 3TSWA 2NUTA 2D74A 5IHIA 2PQWA 1VQPT 5HZBA 1AWWA 1VHOA 3CC7B 4Z4VA 4Z4RA 3EG3A 2QQBA 2RHUA 4C43A 1N5ZA 2EQMA 3CCRB 1ZUKA 3CC4B 2YUOA 1VQ8A 1N08A 1KD1U 1YCYA 1S72A 4OOXA 4R56A 4C0ZA 3BC9A 1FNBA 1BBZA 2QI2A 3WXMB 1AIPA 2PZ1A 4YAWA 3X24B 1JRIA 4KH1B 2QA4Q 1Q81C 1BIBA 5GAOq 4IKFA 1NPPA 4RD6A 4M78C 2Z6BD 2O4XB 2IPOB 2VKNA 3RUXA 4BE0A 2YSQA 3OW7A 4Z1MA 5IYQA 3BY2A 2YWHA 4MZTA 5ECAA 2JM9A 5A0GA 3H6ZA 3RMQA 3KFVA 1YHQA 1K73U 5HY6A 4MYTA 4ZCLA 4OB1B 4Z4ZA 1WSRA 2ENMA 3C0CA 3CCUT 4F7UG 2K7AA 1ZHIA 3H94A 2V8KA 2EQKA 4E6RA 1AWXA 3SWNA 2BTTA 2DO3A 2JM8A 3P8BB 3OW2A 3CMAT 3HL8A 1D1NA 2WZPP 3PFSA 3VUZA 4KH0B 4M7AA 4M7AB 1YJNB 3EFRA 1ZUYA 1O9SA 3RNJA 3G6EA 5GMKh 4XQ3A 1S0UA 4DK1A 1OZ3A 3ER0A 1E1RA 2WJVA 5KYWB 1RI0A 1VLYA 5KYNA 2BUDA 5F4MA 4J8OA 3OYGA 1T3LA 2I2LA 1KIKA 1EP1B 1VQMB 2ZZFA 2DTOA 2VBVA 4P9SA 2HCJB 1JQQA 5KCHA 4YAFA 4X1VA 4LDWA 1MGQA 2HKQB 5CKDA 3QXEB 1G7CA 2RHZA 4DNRB 1KK3A 2DEQA 2HMAA 1KQ2A 2FVGA 2ZPHB 5BSYA 3O5ZA 4K11A 4M77F 4RTYA 4RKUE 4X7EA 3FPKA 3OAAA 4B3GA 4XD7A 1T3SA 3OEHA 1WHLA 2WACA 3CCQT 1H8HA 1R5BA 4YEJA 3HKSA 1HZEA 4LN2A 3CCSQ 3JCMJ 5LJ5e 3MP8A 2LDMA 3BDLA 1NB9A 4Z4YA 1QVFS 2KNBB 4QKUA 2DETA 1T5EA 1PSFA 3QYHB 1M90D 3LGFA 1SKQA 1QGAA 1VQ4B 3OZUA 3CCMT 4U9UA 2V7UA 1H641 4DQ2A 1IB8A 1I5LA 2R5MA 4PLIA 1PSEA 5LL6S 4PJNA 3SD4A 4ZGJB 2L8DA 3QDRB 1WI7A 4M7AE 1NB0A 5FU7B 4B3FX 5AT1B 1MRZA 2EQUA 2COZA 2RNAA 3FC3A 3VNVA 2F5TX 4GLMA 2VGNA 2Q6LA 1YJWT 5GMKm 3W2HA 1QP2A 2BE7D 4Q7JB 1E62A 3OW2S 3BNWA 2F1LA 2KI7A 2DCUA 4JUVA 4J83A 2DFUA 4QQGA 2GQFA 3C4SA 1VQPB 5L8RE 4QQ6A 3QYGB 2XDPA 3CCLQ 1QCNA 2JS0A 2ZXHA 4E7KA 3CP8A 4OMNA 4XORA 3G4SA 2XOKA 1RAFB 2QGFB 3G4SB 1KD1C 2OBRA 3EH2A 1G2BA 2MWOA 5GAOm 2Y4XA 4A4FA 3H0FA 3A5ZB 3V7AA 5IHKA 2HCKA 3CD6T 4KULA 4E7LA 4WWVA 1VYTA 3T56B 3Q39A 4X7DA 3NFCA 5EMNA 2M51A 4EMGA 3KUFA 5IXBA 2HDAA 1ELOA 2X8KA 3MMPA 1CNEA 4J9CA 4AG1C 3OS1A 1CQXA 1C0MA 1CKAA 5KYYB 5IYPA 1M1KU 2RO0A 5D6XA 3VMFA 3PTAA 2CSIA 1D0XA 4XTXA 3WNDA 2FYKA 2QYZA 1MUZA 2GREA 2DZCA 4TMWA 4LDYA 1TG0A 1WHMA 1ZUNB 2ZPEB 2XEXA 2D8JA 2ATCB 3V7RA 2GJKA 2LNVA 5A0LA 1VQ9T 2V7QA 4LUEA 2CREA 1QVPA 4ME7A 3QJYA 3OP1A 2KBTA 1VQ6A 4QVJA 3OYIA 2VBUA 5CVIA 4N4IA 1YHQT 1R5OA 2VNJA 1K8AC 2D9RA 1YWOA 4DBQA 2M16A 1Q82C 3RERA 3GIRA 3E20A 1VQLB 1I8FA 1YI2B 1NM7A 4AT1B 3NGPA 3E1YE 2DMOA 3CPWP 4M4SA 4YHBA 3CXCB 3UDCA 4AF7A 2E1RA 1Y0YA 3CMEA 2XNCA 2H3JA 2D0NA 2QEXB 1UHCA 1EFRA 1PD1A 1PKSA 3A3GA 4RCZA 4DEXA 1FX0A 5GAOp 4A4HA 4RM0A 2CRVA 3OFNA 3M0PA 3OBWA 4LC0A 3I55T 2ZBUA 3SHWA 4F04B 3CCUA 4XL9A 1M2VA 1M2VB 1W4SA 3LH0A 5LMZA 1BLIA 1KK7A 2NUPA 3CXCP 3H41A 4XU0A 2LQKA 1WYXA 3SJZA 2XDBA 1OX9A 1IB0A 3LYIA 1W2BS 4XLFA 2CC2A 3G4SQ 1N0VC 2JT4A 2MI6A 5GJVB 5B6IA 4NL3A 4OMLA 1YITA 1VQLQ 4PJOG 4XU2A 3G6EQ 1IHVA 5GAOr 5GAMd 1UJ0A 1I07A 4M77B 3V8KA 5C0MA 3I5SA 2DOGA 1I1JA 1VOMA 4XONA 4C92C 1XE1A 3D26A 3P27A 2K79A 3M57A 5IAYA 3MEAA 2RI5A 1XQHA 3I56Q 3ZFJA 5LJ5h 1UE9A 2H3EB 1S1NA 4J9GA 3FDRA 3CCQA 1VQ7Q 5M9OA 3CCJQ 1M4ZA 1E3XA 4X7FA 3P26A 1AHJB 2FO0A 1U06A 2XD0A 1QH0A 4HE5A 2W0ZA 5CKEA 1E1QA 2DPPB 4HA8A 1YITQ 1E63A 4P3IA 4BI4A 4ZTJA 4E7ZA 4YAOA 2COYA 4RTTA 3ASPA 3AVWA 3RKYA 1YIJQ 3JB9I 2BGJA 2V26A 5GAMe 2DL5A 4P6YA 1K8AD 2VVKA 2QASA 4HVVA 2K3YA 2X4WA 1U3OA 2CW5A 1X43A 2GTOA 4EH1A 1VQ4Q 4PJOA 4PJJA 1N9RA 4F16A 5TRDA 2LRQA 2HAXA 2CUDA 4PC1A 4E47A 3OW2B 5CR2A 3I55Q 4J6WA 1YN8A 1QQJA 2MYSA 2OJ2A 4M78A 1TVCA 1X01A 2ZPFB 2DIEA 1VQ9B 4HCZA 2EW3A 3CCJA 4V2SA 1E3ZA 2E41A 4Z4UA 1VQMT 2DERA 1QFZA 2MOXA 2EGAA 3X26B 1UGVA 1E79A 2LC4A 5FLXE 4XMYA 2D3NA 3ZZTA 5GMKi 1KK1A 2CGHA 3ONYA 3SEMA 3CC7A 2BSAA 4E2FB 2CP6A 1QP3A 1Y0RA 4KGZB 1FX7A 2EQIA 2K5LA 1GBRA 5KYXB 1EP3B 3SKBA 3HFNA 5KYYA 3Q3AA 1S72B 1W9XA 1M30A 3GOXA 1K1ZA 2X6XA 1RACB 5FRNA 4C0SA 4ZCMA 2V7XA 2M5SA 2OTJQ 1D1BA 4FL6A 2FPEA 1BCOA 4PK4A 3CXCA 1G3WA 1OOTA 2DL7A 4C0GA 4M7AG 2ZCFB 4C5GA 3CCMB 3FKSA 3QUIA 3OYKA 2QA4A 1N8RD 4QVZA 3CCJT 2C4TA 2RC6A 4TSFA 4RCCA 1Q7YD 2JJ9A 1CSKA 3HP9A 4PJLA 4AFQC 3VJPA 3AVVA 3GBQA 3Q1JA 1QVFA 2CSQA 3ZZUA 4C0DB 3I56A 2E64A 2HQEA 1SHGA 1ARKA 2L3RA 2CNDA 2ROTA 2I0NA 2M0OA 4JJDA 1OB2A 3MJXA 2CS7A 4ZCIA 3LO8A 4QVCA 1K28D 2ESWA 5TV2A 2YRDA 1N8RR 3FJ5A 3ZC3A 5IHNA 1NRKA 2JTMA 4R55A 2KXCA 3U23A 4GBQA 5FU6C 2CH4A 2RJEA 1FXXA 2AKKA 2XICA 3OS0A 2ZPIB 1KQ1A 3IQLA 4Y91A 4UZUA 4TMZA 5KCOA 3PA1A 3GLXA 4EPCA 3I9QA 2JS2A 2RPNA 2NUZA 5FIUA 3FJPA 1RQPA 2LT4A 3CMET 2JJ1A 2OBSA 3CPWS 3G1JA 3CCSB 2IVWA 3R6KA 3GVJA 3NTHA 1VQMQ 3V7SA 1YX2A 3HTRA 1P4MA 3GQBA 1VYUA 5FROA 2V7TA 4BE2A 3JCMP 5TY0A 2X3WD 4JLIA 5GMKe 2EFGA 2V1RA 2DVEA 2EIFA 5IYWA 4KGXB 4XAXB 3OZVA 3MKDA 3ZEHA 4OPSA 1JXMA 3L2QA 2ZL5A 4XOPA 2E3IA 3JB9J 1H3HA 4O5VA 2OI3A 4XR6A 4FSSA 4OB2B 2BF4A 1VIFA 1Y96B 2KVOA 2VASA 1ZA2B 4NNJA 3GP8A 1G3SA 4FIBA 3V8LA 5CKBA 2QEXT 1OV3A 1VQNT 5CK9A 2D3LA 1SSHA 1Q7YU 3WYAA 1LVKA 3E1SA 1UD6A 1S4MA 2DJZA 1H3ZA 2XHCA 1EZZB 5GANd 3R6NA 3REAB 1B7TA 5FO1A 1YFNA 2L3PA 1J3TA 4MMKA 4UAJA 3DDYA 4CQJA 1VQOQ 3MHXA 1F20A 3PNWC 1ZM4A 4R0KA 4TN1A 2RD1A 4X9DA 1B23P 3AT1B 2A36A 4FM4B 1OGIA 4Z4TA 3KL9A 1TSFA 2VWFA 4RD3A 2KT1A 1M90U 1GJRA 1KJZA 2YUQA 1V76A 3MP1A 4XTVA 4QHYA 4LBYA 1ZSGA 4B9XA 2GK6A 4KBMB 3LGLA 4G5GA 1M1FA 4M53A 4RCBA 2M1HA 4KT0E 3CPXA 5IH2A 1BYMA 2JJ2A 1OPLA 2Q6KA 2EVRA 2YUNA 1FYNA 2VC8A 4N0AA 4C8QF 1BPLA 3PA2A 2KMTA 3OJWA 2Y90A 2CT4A 3G71A 1SG5A 3OS5A 2E10A 3M0TA 8AT1B 1VQOB 3L2WA 4Z8AA 2AIRB 2A7YA 2LCCA 3KBGA 3OB9A 1WJSA 2D0QB 3HRSA 5GMKl 1H85A 2M9UA 3HRTA 3JCMh 4M7AD 2E1BA 2LZJA 4YTLA 2JW4A 2ZZEA 1PRLC 2P4TA 2BV3A 2O01E 2B86A 2CZ0B 4LBWA 2HLDA 1NE8A 4M7DD 2MWPA 2JDIA 1WPYA 3CMAB 2LCLA 5GAN7 2DBKA 2FZGB 2YLBA 4XTYA 5GAOn 1YI2Q 2XZOA 1U8RA 4FK8A 1K0SA 2DRKA 1RUWA 3HPWA 1RI9A 3DLMA 2DM1A 1WOSA 1Y7XA 3Q6QA 2QA4T 3CCLT 4AC9A 1F60A 1D3BA 1M8MA 3OS2A 1Q86C 3H9NA 4LXCA 2DXCA 2P0KA 5KE2A 4AF6A 3FPPA 3I56T 1MV0B 4Z4SA 1VQKA 2YWFA 1VQKB 1WDXA 4JRPA 2QE7A 2DL4A 1TXQA 4XTWA 2F69A 1SHFA 1LPLA 2F2WA 1RAAB 5GAN6 3G05A 2RI2A 1QLYA 1ZBJA 1KHCA 3QO3A 1SEMA 5H59A 1Q82R 3EGDB 1D09B 1UGPB 3EGDA 1U1SA 1QKWA 4ZN1A 2CK3A 1UGSB 3QFTA 1Y96A 4C92G 3MHPA 4PABA 2PIAA 3TCJA 3QFSA 4F7DA 1YITT 2C06A 2X51A 2RI3A 4M75D 3JCMe 1VQ5B 4C92E 3QBYA 2LT1A 5CIUA 5DM7R 2K57A 2KROA 1FNMA 2PTKA 3EGXA 4DEYA 7AT1B 2ZPGB 1AOJA 3M53A 2GQVA 4IUPA 4JPBW 3CCVQ 4PC7A 4RTVA 1K8AR 5GAMj 5A2QE 1KC8D 3OYBA 2C0OA 2WZNA 3CP2A 4QUZA 5F4JA 5CDFA 1OYXA 3BCFA 3EGUA 1IGQA 3QPHA 2LQ8A 2F1MA 4RDKA 1YP5A 1Y0MA 3VYGA 2V1QA 4X0CA 1YIJB 1MMAA 3PENA 2VJIA 3JCMV 2CBXA 3B78A 2QQRA 3ZBTA 2GJPA 1SF9A 4X06A 1OQKA 1YJWB 1N8RU 2QGGA 1EP2B 3W5VA 4E7HA 2QQSA 4C8QC 1ZM2A 2FRYA 5J3BA 2W6IA 2AHOA 1WOOA 1OULA 4G1VA 3CCEB 4FYWB 1S72T 2WPDA 1X2KA 2EYQA 3L1AA 2YLCA 3UF4A 1IO6A 3FIFA 2DTHA 2NYSA 3UT1A 1MMDA 4QFMA 4F7UF 4RMOA 2BIVA 4AMCA 4P22A 1WX6A 1M1KR 1K9MD 1D1CA 1K73R 4BY6B 3SJPA 3VS4A 2L3SA 1RADB 4Y7CA 2YT6A 4MYUA 2YHTA 2C0IA 3CC4T 3CCRT 2LQNA 1N27A 3CMAQ 4X05A 2GCXA 1FWZA 4FYXB 3THKA 1RAIB 2KE9A 1EIFA 2FPFA 2AK5A 4WQMA 2L5QA 2K3BA 2VV5A 1JNYA 2KEAA 4N4GA 4ZGNB 2X4XA 5FW9A 1ABQA 3JCMc 2OBTA 1COWA 1QKXA 3VUBA 2ZZDA 2NPFA 3RMSA 5GANj 1D0ZA 5LJ3h 1YIJA 4BI8B 3QHSA 2XKOC 3BCDA 2OAWA 4J9BA 4N3GA 3JV3A 5GAN3 1KD1D 4YXWA 2DX1A 5GJWB 2DL3A 2E65A 2J06A 2ZL6A 2C78A 1IJFA 1N05A 5KYUA 5GAMh 4X34A 5GAN2 2IG0A 4P6VF 4BDYA 4E7JA 2XNDA 3CMMA 3ZL7C 2FX3A 1N06A 2V4DA 3J81k 2PNIA 2YWWA 3EFOA 3G71T 5IYNA 1VQNB 2AZVA 2F4NA 4FYYB 1V5VA 1JJ2A 1UECA 2GK7A 2YWGA 2D6FA 2KRSA 4JRIA 2E6ZA 2PUOB 3QG1A 4C5HA 5LJ5f 2RQVA 2K4YA 4AFUC 1NBMA 2EYYA 1WHGA 2GNCA 1QUFA 3CCVB 2Z0WA 1EFCA 2YXYA 1GAWA 3ONUA 2MIOA 1P92A 4RJLA 3MO8A 1XOVA 1NG2A 1M9SA 5BSXA 1M5Q1 2EWNA 2ROLA 2WSCE 4NL2A 5CKFA 3JAME 1GL5A 3F70A 1TLLA 4M1KA 2KT8A 4DBHA 1M1KC 4HVWA 1S72Q 4NOYA 1DARA 3EGXB 4JRKA 1VUBA 4AVZA 2XGJA 3UA7A 5GMKj 1VQ5T 2VBTA 2HSEB 2OTJB 1YJWQ 2OTJA 2XZLA 3Q6RA 4IIMA 4WZLA 1PG5B 2EPDA 2AZSA 3AHUA 1GXIE 1EX4A 2BM1A 3CBMA 2B5OA 4LBZA 3WNBA 1SM4A 1UDLA 4CC7A 3PVDA 4OF1A 4DNTB 4ZTFA 1VF7A 3L2VA 2JXBA 4XU3A 1KC8U 1KQSA 1M3BA 1UB4A 1VQOT 2J05A 1MMGA 2QTZA 1DG1G 3MEVA 4X9CA 4OMPA 1MABA 3OKXA 2DRMA 1KQSS 5HZAA 1WFWA 5CO7A 1I5OB 2HD0A 1G7RA 2C0TA 1QVFB 1TUDA 3VU3C 1PWTA 1WXTA 3A8IA 5KYXA 5LJ3g 3VRZA 1WJQA 1J9ZA 4WZEA 3WNCA 1UUEA 5GANe 3M4GA 4OP0A 3OYFA 1A0NB 1Y71A 1IREB 2BZXA 2DXUA 1MNEA 3U6KA 4J9IA 2NUPB 1HA3A 4HKEA 1IHWA 2DNUA 4EMKB 1QX4A 3P8DA 1SRMA 1WQ7A 4ANJA 4HT9A 4M7AF 4Y92A 2BGIA 2C77A 4JMQA 2QDYB 1VQ8Q 4WZKA 1B3QA 1K8AU 2DIQA 2RK1A 3A8KA 1ZSZA 1NZ9A 1GCPA 2C5BA 1NJIU 1OPKA 3PUNA 1N0UA 2KDSA 1WJRA 1KG1A 5A88A 4RCYA 3VS5A 4X7CA 3BDUA 1MNDA 4PLLA 5FO0A 4OMQA 2VNKA 2KSSA 4LDVA 1TS9A 1KQSP 5FWCA 1GO2A 3BFMA 1XB2A 2EKHA 2EFIA 3JB9F 2COWA 1JJ2S 1VHEA 1HK9A 1H8EA 1RAEB 4XTZA 5A0DA 1K4US 3W2EA 2HDNB 1OHHA 4RDLA 1M1KD 1FDRA 1NPRA 2WR8A 2K5IA 3HHTB 3M0SA 1MV3A 4M77A 1JJ2P 3QJ6A 2ECZA 1OB0A 4P3YA 5HKKA 1KK0A 2K6DA 4BE1A 3T9NA 2FRWA 4M7AC 2R9VA 5KH6A 2L0AA 1YIJT 1QVFP 2F43A 1R77A 1JBMA 4DOVA 2PVOB 3OSVA 2FZCB 2BKDN 2BE9B 3VS2A 1GCQA 3BH4A 3GPLA 3ISXA 4HCBA 1WOPA 4A54A 2GGRA 1IZ6A 1PKTA 5GANf 3ZUGA 2VYQA 4MDWA 1I0CA 3CBOA 3LVBA 4NBSA 2P0QA 4C92F 1Q86D 2QEXQ 1FNCA 1YBYA 3AVTA 2DTIA 4B43A 2JIZA 4M78B 1W87A 3U6BA 3CB4A 4FT2A 5DLQE 4D6WA 1HXDA 4M75E 4B47A 3CESA 1LJOA 3PE0A 1Q81D 4OMMA 2XDDA 4ORZA 3C95A 2HZYA 4RG8A 4JJNK 1GBQA 3QFRA 3A8HB 2LMJA 4DA4A 1E6HA 3S6WA 3UWNA 1Q9SA 1VJSA 2DYIA 1ZQ1A 3L42A 2JN0A 4IUVA 1FRNA 1V0FA 2JTEA 2B7CA 2VJJA 4ESRA 4XQFA 2RHXA 3JB9H 4X8IA 1BCMA 1WXBA 1WTHD 4II1A 1WORA 3NTKA 1T0JA 4DQKA 1YJ9Q 4M77G 4M77D 3WY9A 2EQJA 5AYFA 2DLPA 2LX7A 4JJCA 2CP7A 2NUTB 4II2A 1X6OA 2RHIA 4MZMA 5DY9A 2E1HA 2NV4A 4RLZA 2WSSA 2CP3A 1ACMB 4F7UE 3PMTA 3V8JA 1U1TA 2H8HA 1UGQB 4B44A 3E9FA 9ATCB 4WF2A 5IN1A 4YALA 3JCMQ 4M7DE 2A28A 1VQ4T 4C0DC 1VQKQ 4YELA 4ZGQB 5FWBA 5C6SA 4IUTA 1NYFA 4XTUA 3INZA 2E70A 1U5SA 2DVJA 5FNZA 5H5JA 2KYMA 2YRCA 2BMWA 4FW2A 4BACA 3LQ6A 2QQAA 1BI3A 3EFSA 4C5EA 1KQSB 5CCAA 1F1BB 1NDHA 3A1PA 4HT8A 1E64A 4ACAA 5KYUB 1LCKA 4C0FA 3JQRA 1CNFA 3CTAA 4MMLA 2HBPA 2RQWA 1IGUA 3HFOA 4E7IA 2XZPA 1K9MC 1YITB 4JZ4A 1Y07A 5J26A 3ZZ0A 3OYHA 3A8MB 1V29B 4M7DF 5KNLA 2V31A 1OX8A 3SDZA 1AWJA 1W35A 3ASTA 4Z02A 5CQXA 3CCMQ 3OYNA 3I35A 3J80E 2RC5A 3CCEQ 2B7BA 3ES9A 1R8OB 4PC3A 2HL3A 2ZZGA 2ED1A 4JRQA 1JB9A 4B9WA 2K2VA 3H0IA 5KYWA 2X6WA 3BQJA 1YCSB 5DS0A 2JOYA 1O75A 1YHQB 1GFDA 1B2RA 1VQ9Q 4RG2A 2HQHA 1KHIA 4FSXA 1R5NA 4XN3A 2GBQA 3OSSC 1UJYA 4WTOB 3VS7A 1KC8C 4XU1A 1VQPA 4A4KA 4J9FA 3WXMA 2JTFA 1VQNQ 2VB6A 4OB0B 3OW2P 1H42A 2OTLT 1UD2A 2QQ9A 4FW1A 2OK7A 5GAN5 1EXMA 4B4DA 2X35A 3CC7T 2SRCA 1RLQC 2HEQA 3KXTA 1M90R 2VBSA 4C8QA 3JCMX 4PJOD 1WLPB 1JJ2B 4H9GA 1OB5A 1D0YA 4LE9A 5J3OA 3MP6A 1Z9ZA 2OX7A 3PGGA 3CD6A 3U2QA 3EH1A 1NYGA 4K1XA 4L8JA 4XLAA 4DK0A 1A8PA 5KSWB 2MMPA 3RESA 4II3A 2HKNA 2XU8A 1C1AA 4AFZC 5GAN4 3GVKA 1KJWA 1Q7YR 1RABB 1WIEA 1VQPQ 4OPOA 2E5QA 4G1BA 4LD9K 2EIXA 3TSZA 1GFCA 4ELYC 3AVUA 1TU0B 3QZ9B 1WHHA 1ZX6A 3ZPNA 4Z4WA 2L2PA 4RUGA 2PUKB 3G6ET 2GFUA 1G83A 5CKHA 1K76A 4AG2C 3LLRA 3VYHB 3SWNB 5LJ3e 3HSBA 1D1AA 1AWOA 1T6XA 4XK8E 3C94A 2LJ1A 3VS3A 2Q6OA 2QXFA 3M0RA 1PRMC 3M58A 4CI0C 2JN9A 2IIMA 2C5HA 4XKWA 5AN9A 3BW1A 3CC4Q 3CCRQ 4RD1A 1ZUUA 1OGJA 4B48A 1QVGP 2DIGA 8ATCB 3LX7A 2VXEA 1B34A 3WBKA 1K0XA 2LVMA 3JCMb 4KGVB 1VQ7T 2HQXA 1IRXA 1VQ6B 3JCMW 1WNLA 4L5GA 3ME9A 2EJGA 1Q7YC 1UTIA 2PVGB 2FEIA 3CMEQ 3EG9B 3DKMA 3CPWA 1WU8A 1VQ8B 2FB7A 1NLOC 4A63B 5IT9E 3GF5A 2DK3A 3JCMg 1RL2A 1NEGA 3OOCA 3HRUA 3PVQA 2FZKB 4KUDK 2FPDA 1R0CB 3LQEA 2O88A 3I55A 1QWEA
chains in the Genus database with same CATH topology
2F1LA 3A1PA 2DYIA 1PM3A 2QGGA 2DOGA 3H9NA 3HTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1L A;  3A1P A;  2DYI A;  1PM3 A;  2QGG A;  2DOG A;  3H9N A;  3HTR A; 
#chains in the Genus database with same CATH topology
 1PKV A;  2F2V A;  2YDL A;  2VZL A;  3RBB B;  4N4H A;  4F17 A;  2KR3 A;  1UEB A;  4M2L A;  4OOV A;  3L2U A;  2CH4 W;  5FRM A;  4ASU A;  1VIE A;  4FCY A;  1VQL T;  3OYA A;  3M4Y A;  2LCS A;  3QZ5 B;  5GAN h;  1ZM3 A;  5L46 A;  2YRV A;  4RTU A;  4C5I A;  4DBF A;  2RH2 A;  4PAA A;  3QWY A;  2KQW A;  1NBE B;  3OYE A;  1K9A A;  4P2N A;  3VNU A;  2HBW A;  2LZ6 B;  2GFA A;  1LOJ A;  5D7U A;  1PNJ A;  1WPC A;  3CCE T;  1G7S A;  5DSZ A;  1TWB A;  4KKU A;  5DLO A;  1VQ6 Q;  4YAU A;  4HIZ A;  4M78 D;  4XN0 A;  3OMG A;  1X6G A;  2EKO A;  2LQW A;  4RPB A;  3G7Z A;  3HAG A;  5DN6 A;  3CXC S;  1AMO A;  4UZE A;  3QSY A;  1SKU B;  1M2O A;  2RQR A;  4J0Q A;  5J39 A;  1UD5 A;  2V7W A;  2I1L A;  4GLK A;  2VXF A;  5THX A;  2LJ3 A;  3C12 A;  1RAH B;  2DEU A;  1G7T A;  4OP7 A;  2GF7 A;  3RIR A;  4X07 A;  3A35 A;  3BY7 A;  3W2I A;  1T0H A;  2C2W A;  1OEB A;  5CAI A;  3JCM d;  2P0P A;  1PCX A;  1QCF A;  2BPO A;  2R57 A;  4AFS C;  3JB9 G;  1BX0 A;  1Q82 U;  3A8J A;  5D6Y A;  2WJY A;  5I2M A;  1X75 C;  1IJE A;  3L2Z A;  4DOW A;  1AEY A;  1K73 C;  4PC2 A;  4OMO A;  4BUG A;  2J6K A;  2V7V A;  4BPR A;  4LD6 A;  2XG8 D;  3M55 A;  4PL6 A;  4DBR A;  1DDG A;  4BB7 A;  3D7S B;  1M1G A;  2P3M A;  2PE3 A;  2NWM A;  2CKK A;  1QGY A;  2SEM A;  3H0H A;  3S3O A;  2R58 A;  1K9M U;  2RQT A;  3DB3 A;  3VS1 A;  5HXB A;  1VQ9 A;  1HYO A;  2O9S A;  1D3B B;  1QMC A;  1SPK A;  1AZG B;  2DIL A;  1VLO A;  3PIP A;  2ZTG A;  2ZL7 A;  3JCM f;  3CCL B;  1JXO A;  3MCA B;  4PKC C;  1DJ7 B;  1NEB A;  1ABO A;  4FN5 A;  4ZV4 A;  1HJD A;  2V8I A;  5LJ5 j;  2QTL A;  3JSC A;  1VQM A;  4KKS A;  1FMK A;  2XID A;  4VUB A;  1BMF A;  1UD4 A;  4B6M A;  2HSP A;  1GRI A;  4NS5 A;  4G7X A;  4QVA A;  1JO8 A;  5I11 A;  3ZIA A;  1M90 C;  1I18 A;  5I21 A;  2XK0 A;  4BI3 A;  2X4Y A;  4Y28 E;  2E5K A;  1VQ6 T;  1EFN A;  2EYZ A;  3W5H A;  1VQ5 A;  4F7U A;  1R0B G;  2WSE E;  3AVX A;  3FRN A;  4OMF B;  1W2B B;  2EBP A;  1HVX A;  4P12 A;  2W10 A;  4J7I A;  2OTL B;  3EG1 A;  2EYX A;  1UG1 A;  2J6O A;  1Q81 R;  1UGR B;  2QEX A;  1KD1 R;  2O2O A;  3CCQ B;  1BU1 A;  1TTH B;  1BK2 A;  2QK0 A;  3QKJ A;  2MAM A;  1U2R A;  2DD4 A;  2X6Y A;  2P84 A;  5F4O A;  4MDX A;  3QDF A;  1N8R C;  4M7D C;  2LP5 A;  1Q86 R;  2RJF A;  4RD4 A;  3VO1 A;  1V0E A;  4PFZ A;  3CRZ A;  1WSV A;  4PFP A;  4OOS A;  2RQU A;  1VQ4 A;  1M8V A;  1HD3 A;  3TVT A;  4P26 A;  3BY1 A;  2DL8 A;  2F2X A;  1ZA1 B;  2CT3 A;  1M27 C;  3NE5 B;  2ZGW A;  3CC2 Q;  4TMX A;  4F14 A;  1W2B A;  3L2R A;  2GPJ A;  3QE2 A;  4G7W A;  5TR9 A;  4LDU A;  3W2F A;  2M0Y A;  1PC0 A;  3JB9 D;  1ZBX A;  2P4R A;  2BVN A;  3BE3 A;  2MK5 A;  3V76 A;  2O9V A;  2GJR A;  2L3Q A;  2DXB A;  2MPX C;  3QSU A;  3OE7 A;  3CCR A;  3CC4 A;  3WVE B;  5CQY A;  1MMN A;  4ZN3 A;  4LDX A;  1GVH A;  4RDJ A;  2KAF A;  4C92 D;  2EJ9 A;  3M59 A;  2KY9 A;  2OTL Q;  4XOT A;  4PJO E;  2K2M A;  4EMH A;  4LNP A;  3TRE A;  1B07 A;  4XKV A;  1AVZ C;  3OYM A;  1EFT A;  2CP2 A;  3A98 A;  3CC7 Q;  1G3T A;  1KTV A;  5A8A A;  1T6Y A;  2E6N A;  4J6X A;  1BQE A;  3LW5 E;  4M75 A;  1N6A A;  3LNN A;  3CCJ B;  3DB4 A;  4L59 A;  3MCA A;  3G4S T;  2DAQ A;  3QWX X;  3UA6 A;  2ZIT A;  1N9S A;  1GCQ C;  2DYB A;  3FLG A;  5IK2 A;  2AT1 B;  2E3H A;  4KKT A;  4D8D A;  2BZY A;  5LJ5 d;  2K5F A;  4UC4 A;  3ASR A;  3TU4 K;  5GV7 A;  4M77 E;  2QAZ A;  3A8L B;  3EG9 A;  1YHQ Q;  4FYV B;  2PU9 B;  4IUU A;  2YUP A;  1YJ9 T;  3G6E B;  2DBM A;  2QTX A;  3VRY A;  3RDV A;  4EMK C;  2OTL A;  1GR1 A;  1BI0 A;  2PMD A;  4BDZ A;  4JS4 A;  1JEG A;  2XNJ A;  1BIA A;  2FVU A;  4KRT A;  1FRQ A;  3B82 A;  1PJ6 A;  1NLP C;  2KRM A;  4OGC A;  2EJF A;  2OAU A;  3CCE A;  1C6V X;  3PT9 A;  1RQR A;  1I4K 1;  3RY8 A;  4ZGD B;  4G6I A;  3GNF B;  3TEE A;  1M3A A;  1TUI A;  2KRN A;  1VQK T;  1OU8 A;  1NJI C;  4FU6 A;  1I81 A;  5I2S A;  3RKW A;  2DF6 A;  4IIO A;  4CC3 A;  4TVR A;  4XM3 A;  1G3Y A;  1WA7 A;  3VO2 A;  3CPW B;  5KE3 A;  4M75 G;  3P8H A;  2AHJ B;  2DD5 A;  4C92 A;  2CDT A;  3M56 A;  4JLG A;  2EGC A;  1JA0 A;  2FL7 A;  2RB6 A;  4A4E A;  2ZPB B;  4F7U B;  4NCN A;  4HVU A;  4P1V A;  5KW9 A;  3TQ7 P;  3J7A F;  3AGP A;  1ZSZ C;  1I8D A;  4EIK A;  5D6W A;  3CQT A;  4R71 A;  3LH5 A;  4ZGE B;  3KEW A;  1YJ9 A;  1WDT A;  2Y4Y A;  2RM4 A;  1H8K A;  4PJO B;  2HL5 C;  1TTT A;  3JQQ A;  3MEW A;  3SLN A;  5A89 A;  4E0F A;  3OY9 A;  1YWP A;  2JUF A;  1PJ5 A;  4Z88 A;  4M0L A;  3NMZ C;  4IUR A;  4TKO B;  5HKC A;  3CPF A;  3OJX A;  2PVD B;  1W0J A;  3WVD B;  3PUM A;  3ZBU A;  3I55 B;  5LJ3 d;  4M75 C;  1ZLM A;  4OPV A;  1IXD A;  1ZSZ B;  2WYR A;  5LJ3 j;  2FG0 A;  4IUQ A;  2CZ1 B;  1YJN Q;  3ASS A;  3FEO A;  3RKX A;  4Q5W A;  4C8Q G;  1IHM A;  3FJO A;  1WZO A;  1QFJ A;  2RA2 A;  2DKG A;  2D9T A;  3EG2 A;  2CYZ B;  4PJO C;  3EG0 A;  1TUC A;  2FHD A;  2JZ2 A;  4MZP A;  3CEY A;  1UD3 A;  4BD3 A;  1QVG S;  3E2U A;  3M0Q A;  4GY5 A;  2CF4 A;  4JS5 A;  1VQO A;  1W0K A;  1TOV A;  1WP6 A;  4OB3 B;  4RTZ A;  3OBY A;  5EG2 A;  5HCK A;  1XJW B;  4TMV A;  4WCI A;  2E4H A;  3H8Z A;  4ROX A;  2RMO A;  1WGS A;  4KUI A;  3CCU B;  1YI2 A;  1QCO A;  4HCC A;  1SSF A;  1NJI R;  4PGO A;  2BZ8 A;  2DXT A;  4M78 G;  2RHY A;  1KMH A;  4J5Y A;  2X3X D;  3CC2 T;  4EMK A;  4M75 B;  1UFF A;  3WQZ A;  3A3B A;  1XTD A;  3CME B;  2O31 A;  3NHN A;  2J7K A;  4RTX A;  4JJB A;  3I5R A;  2X53 S;  3URG A;  1N07 A;  4QVD A;  3OPO A;  2J7I A;  2DZ9 A;  3B8H A;  4ACB A;  1E7O A;  1XNI A;  4J7F A;  2BN4 A;  4HE6 A;  5J35 A;  4LUD A;  3LWH A;  2CUB A;  3S3M A;  1UMK A;  3MET A;  3OEE A;  3VR6 A;  1YJW A;  4PNO A;  1VQL A;  5I22 A;  1Y57 A;  1WHK A;  3R6O A;  1NJI D;  1QVG A;  3RR6 A;  4J9D A;  4QV2 A;  1SRL A;  4XNF A;  4E7S A;  3X28 B;  1Q81 U;  2LNH B;  2BM0 A;  1BI1 A;  4JDS A;  1KZL A;  2L89 A;  1VQ8 T;  1JA1 A;  3PMI A;  3DLL A;  5FL7 A;  3EHQ A;  2D1X A;  3J81 E;  3QFC A;  3SLD A;  4IW3 B;  3E19 A;  1PHT A;  3NTI A;  4J6Y A;  4P25 A;  1E6G A;  1UHF A;  3CC2 A;  2G6F X;  1UD8 A;  3GVL A;  3VV0 A;  5GAN 8;  1XFO A;  2KGT A;  1X27 A;  1W6X A;  1FMW A;  5L23 A;  3AGQ A;  2X85 A;  1YNZ A;  2J6F A;  4M75 F;  5EC7 A;  1K9M R;  1EFU A;  5GV8 A;  2NLU A;  1PM3 A;  1K73 D;  5FU7 C;  3AVY A;  2ZTN A;  1QVG B;  3OYY A;  2CP5 A;  5HK3 A;  3O8V A;  1RAG B;  3ASQ A;  2KYB A;  4C8Q B;  1H92 A;  1Q82 D;  2GTJ A;  2RF0 A;  1HSQ A;  3R6J A;  2ED0 A;  4C8Q D;  1YLO A;  2RK2 A;  3M9Q A;  2G3R A;  3EHR A;  3QII A;  1WHJ A;  3A8G B;  3ASK A;  1CKB A;  2GQI A;  4M7D A;  1BKB A;  4J9H A;  3MPU B;  3T53 B;  4BY6 C;  2QN6 A;  1V1C A;  5IXF A;  2MF2 A;  1BX1 A;  3GSI A;  2X0K A;  2DE0 X;  1QGZ A;  2XI9 A;  4RD0 A;  2OYN A;  3NPF A;  3OZW A;  1G5V A;  1I7P A;  3VKI A;  2XMF A;  1GAQ A;  2B8A A;  3T51 B;  5FU6 B;  2CZ6 B;  2D8H A;  1KK2 A;  2YWE A;  1VYV A;  4RPD A;  1X69 A;  3A8O B;  1OI1 A;  3CMA A;  2VUB A;  4N0A C;  5GAO l;  2JMC A;  2AKL A;  2QTV A;  2V8J A;  3REB B;  3LWI A;  3S3N A;  4Z89 A;  2ZZQ A;  2KVQ G;  3CCU Q;  1RLP C;  3UAT A;  1Z9Q A;  4TMT A;  4XLH A;  3X20 B;  1T6Z A;  4FXU A;  2R6H A;  4ZNX A;  4UZF A;  1BJK A;  3CCS A;  3CD6 B;  3CCV A;  4M7D B;  3Q38 A;  3EAE A;  2A0F B;  3OYJ A;  1KRH A;  2VNH A;  2Q6I A;  2KXD A;  5GAN g;  1DDI A;  1OU9 A;  5GAM f;  4P5N A;  4HCK A;  2QMU A;  2X3U A;  5JBQ A;  3SEJ A;  3M5A A;  4B3X A;  3SFM A;  3JRZ A;  1XQB A;  2JVV A;  4CC4 B;  2C4U A;  4Y9R A;  2JNG A;  1X6B A;  4OGE A;  2ZAE A;  4C8Q E;  1E43 A;  2W6J A;  4XLC A;  1W34 A;  2A37 A;  2DY1 A;  3G71 Q;  2RN8 A;  4M7D G;  1PJ7 A;  1YJ9 B;  2LX9 A;  2DA9 A;  2QA4 B;  4CRI A;  3UPU A;  1QWF A;  4LBV A;  3VS0 A;  1FMV A;  3MEU A;  1YJN T;  1FND A;  3GIB A;  4RTW A;  3CC2 B;  2VNI A;  4QT7 A;  1X2Q A;  5E6T A;  3I56 B;  3N5B B;  4FT4 A;  3OYL A;  4DQL A;  2CZ7 B;  3OYC A;  3WBJ A;  1ZM9 A;  2EAY A;  1KC8 R;  3GNG A;  1KSW A;  2A3L A;  4EDU A;  4RD2 A;  3CCQ Q;  4PFO A;  4M4Z A;  2DJQ A;  1MHN A;  2K9G A;  3PVL A;  1VQ7 A;  1VQ7 B;  3CCS T;  4A4G A;  1AT1 B;  3CCV T;  3CCL A;  1QW1 A;  3CCM A;  5FA6 A;  4Y9U A;  4PC6 A;  1PD0 A;  2A08 A;  3I1F A;  1AZE A;  2LJ0 A;  4L6V 5;  4OVA A;  5LJ3 f;  2X9H A;  1VQ5 Q;  1YI2 T;  2ABL A;  3JU4 A;  1EWY A;  6AT1 B;  3W5U A;  2EGE A;  3M54 A;  1TH7 A;  5IYR A;  3SWN C;  3W2G A;  3CW2 A;  2EYW A;  1WQW A;  1JB0 E;  1M3C A;  1WXU A;  2RJC A;  4FWT A;  4JZ3 A;  2OTJ T;  1KFZ A;  3G71 B;  2M02 A;  2K3X A;  2X4J A;  4D8K A;  1YJN A;  5GAM g;  1QFY A;  5HK0 A;  1LNX A;  2HNI A;  2KK4 A;  3M0U A;  2E12 A;  2WSF E;  2MCN A;  4HXJ A;  4QW2 A;  2VYT A;  4M78 F;  4J9E A;  3JQP A;  3EFO B;  1VQN A;  1G8X A;  4O6J A;  2LTO A;  1QG0 A;  3VS6 A;  4ATO A;  4XLE A;  3SB2 A;  1BB9 A;  1W70 A;  5LJ5 g;  2JMA A;  3OA6 A;  4WZT A;  4GQN A;  4PJO F;  4N3N A;  2R5A A;  1Q86 U;  3OQ5 A;  2ZXI A;  3ULR B;  4TT3 A;  4CC2 A;  3OMC A;  1OZ2 A;  3V7C A;  3PIO A;  3FB9 A;  2OK8 A;  2PLF A;  4PJM A;  3E9G A;  4QQD A;  4ELZ C;  4M77 C;  1VA7 A;  3OYD A;  3CBP A;  2RJD A;  1QUE A;  2QDL A;  4C92 B;  3X25 B;  2O4X A;  4M78 E;  1TUG B;  1BI2 A;  2QG9 B;  1Q95 G;  2ZBV A;  1D2E A;  1SKY B;  3ZBD A;  2F5K A;  2VGM A;  1W1F A;  1B34 B;  2CP0 A;  4A53 A;  1W2B P;  3CD6 Q;  1D8T A;  1JU5 C;  1AD5 A;  2QDX A;  3TSW A;  2NUT A;  2D74 A;  5IHI A;  2PQW A;  1VQP T;  5HZB A;  1AWW A;  1VHO A;  3CC7 B;  4Z4V A;  4Z4R A;  3EG3 A;  2QQB A;  2RHU A;  4C43 A;  1N5Z A;  2EQM A;  3CCR B;  1ZUK A;  3CC4 B;  2YUO A;  1VQ8 A;  1N08 A;  1KD1 U;  1YCY A;  1S72 A;  4OOX A;  4R56 A;  4C0Z A;  3BC9 A;  1FNB A;  1BBZ A;  2QI2 A;  3WXM B;  1AIP A;  2PZ1 A;  4YAW A;  3X24 B;  1JRI A;  4KH1 B;  2QA4 Q;  1Q81 C;  1BIB A;  5GAO q;  4IKF A;  1NPP A;  4RD6 A;  4M78 C;  2Z6B D;  2O4X B;  2IPO B;  2VKN A;  3RUX A;  4BE0 A;  2YSQ A;  3OW7 A;  4Z1M A;  5IYQ A;  3BY2 A;  2YWH A;  4MZT A;  5ECA A;  2JM9 A;  5A0G A;  3H6Z A;  3RMQ A;  3KFV A;  1YHQ A;  1K73 U;  5HY6 A;  4MYT A;  4ZCL A;  4OB1 B;  4Z4Z A;  1WSR A;  2ENM A;  3C0C A;  3CCU T;  4F7U G;  2K7A A;  1ZHI A;  3H94 A;  2V8K A;  2EQK A;  4E6R A;  1AWX A;  3SWN A;  2BTT A;  2DO3 A;  2JM8 A;  3P8B B;  3OW2 A;  3CMA T;  3HL8 A;  1D1N A;  2WZP P;  3PFS A;  3VUZ A;  4KH0 B;  4M7A A;  4M7A B;  1YJN B;  3EFR A;  1ZUY A;  1O9S A;  3RNJ A;  3G6E A;  5GMK h;  4XQ3 A;  1S0U A;  4DK1 A;  1OZ3 A;  3ER0 A;  1E1R A;  2WJV A;  5KYW B;  1RI0 A;  1VLY A;  5KYN A;  2BUD A;  5F4M A;  4J8O A;  3OYG A;  1T3L A;  2I2L A;  1KIK A;  1EP1 B;  1VQM B;  2ZZF A;  2DTO A;  2VBV A;  4P9S A;  2HCJ B;  1JQQ A;  5KCH A;  4YAF A;  4X1V A;  4LDW A;  1MGQ A;  2HKQ B;  5CKD A;  3QXE B;  1G7C A;  2RHZ A;  4DNR B;  1KK3 A;  2DEQ A;  2HMA A;  1KQ2 A;  2FVG A;  2ZPH B;  5BSY A;  3O5Z A;  4K11 A;  4M77 F;  4RTY A;  4RKU E;  4X7E A;  3FPK A;  3OAA A;  4B3G A;  4XD7 A;  1T3S A;  3OEH A;  1WHL A;  2WAC A;  3CCQ T;  1H8H A;  1R5B A;  4YEJ A;  3HKS A;  1HZE A;  4LN2 A;  3CCS Q;  3JCM J;  5LJ5 e;  3MP8 A;  2LDM A;  3BDL A;  1NB9 A;  4Z4Y A;  1QVF S;  2KNB B;  4QKU A;  2DET A;  1T5E A;  1PSF A;  3QYH B;  1M90 D;  3LGF A;  1SKQ A;  1QGA A;  1VQ4 B;  3OZU A;  3CCM T;  4U9U A;  2V7U A;  1H64 1;  4DQ2 A;  1IB8 A;  1I5L A;  2R5M A;  4PLI A;  1PSE A;  5LL6 S;  4PJN A;  3SD4 A;  4ZGJ B;  2L8D A;  3QDR B;  1WI7 A;  4M7A E;  1NB0 A;  5FU7 B;  4B3F X;  5AT1 B;  1MRZ A;  2EQU A;  2COZ A;  2RNA A;  3FC3 A;  3VNV A;  2F5T X;  4GLM A;  2VGN A;  2Q6L A;  1YJW T;  5GMK m;  3W2H A;  1QP2 A;  2BE7 D;  4Q7J B;  1E62 A;  3OW2 S;  3BNW A;  2F1L A;  2KI7 A;  2DCU A;  4JUV A;  4J83 A;  2DFU A;  4QQG A;  2GQF A;  3C4S A;  1VQP B;  5L8R E;  4QQ6 A;  3QYG B;  2XDP A;  3CCL Q;  1QCN A;  2JS0 A;  2ZXH A;  4E7K A;  3CP8 A;  4OMN A;  4XOR A;  3G4S A;  2XOK A;  1RAF B;  2QGF B;  3G4S B;  1KD1 C;  2OBR A;  3EH2 A;  1G2B A;  2MWO A;  5GAO m;  2Y4X A;  4A4F A;  3H0F A;  3A5Z B;  3V7A A;  5IHK A;  2HCK A;  3CD6 T;  4KUL A;  4E7L A;  4WWV A;  1VYT A;  3T56 B;  3Q39 A;  4X7D A;  3NFC A;  5EMN A;  2M51 A;  4EMG A;  3KUF A;  5IXB A;  2HDA A;  1ELO A;  2X8K A;  3MMP A;  1CNE A;  4J9C A;  4AG1 C;  3OS1 A;  1CQX A;  1C0M A;  1CKA A;  5KYY B;  5IYP A;  1M1K U;  2RO0 A;  5D6X A;  3VMF A;  3PTA A;  2CSI A;  1D0X A;  4XTX A;  3WND A;  2FYK A;  2QYZ A;  1MUZ A;  2GRE A;  2DZC A;  4TMW A;  4LDY A;  1TG0 A;  1WHM A;  1ZUN B;  2ZPE B;  2XEX A;  2D8J A;  2ATC B;  3V7R A;  2GJK A;  2LNV A;  5A0L A;  1VQ9 T;  2V7Q A;  4LUE A;  2CRE A;  1QVP A;  4ME7 A;  3QJY A;  3OP1 A;  2KBT A;  1VQ6 A;  4QVJ A;  3OYI A;  2VBU A;  5CVI A;  4N4I A;  1YHQ T;  1R5O A;  2VNJ A;  1K8A C;  2D9R A;  1YWO A;  4DBQ A;  2M16 A;  1Q82 C;  3RER A;  3GIR A;  3E20 A;  1VQL B;  1I8F A;  1YI2 B;  1NM7 A;  4AT1 B;  3NGP A;  3E1Y E;  2DMO A;  3CPW P;  4M4S A;  4YHB A;  3CXC B;  3UDC A;  4AF7 A;  2E1R A;  1Y0Y A;  3CME A;  2XNC A;  2H3J A;  2D0N A;  2QEX B;  1UHC A;  1EFR A;  1PD1 A;  1PKS A;  3A3G A;  4RCZ A;  4DEX A;  1FX0 A;  5GAO p;  4A4H A;  4RM0 A;  2CRV A;  3OFN A;  3M0P A;  3OBW A;  4LC0 A;  3I55 T;  2ZBU A;  3SHW A;  4F04 B;  3CCU A;  4XL9 A;  1M2V A;  1M2V B;  1W4S A;  3LH0 A;  5LMZ A;  1BLI A;  1KK7 A;  2NUP A;  3CXC P;  3H41 A;  4XU0 A;  2LQK A;  1WYX A;  3SJZ A;  2XDB A;  1OX9 A;  1IB0 A;  3LYI A;  1W2B S;  4XLF A;  2CC2 A;  3G4S Q;  1N0V C;  2JT4 A;  2MI6 A;  5GJV B;  5B6I A;  4NL3 A;  4OML A;  1YIT A;  1VQL Q;  4PJO G;  4XU2 A;  3G6E Q;  1IHV A;  5GAO r;  5GAM d;  1UJ0 A;  1I07 A;  4M77 B;  3V8K A;  5C0M A;  3I5S A;  2DOG A;  1I1J A;  1VOM A;  4XON A;  4C92 C;  1XE1 A;  3D26 A;  3P27 A;  2K79 A;  3M57 A;  5IAY A;  3MEA A;  2RI5 A;  1XQH A;  3I56 Q;  3ZFJ A;  5LJ5 h;  1UE9 A;  2H3E B;  1S1N A;  4J9G A;  3FDR A;  3CCQ A;  1VQ7 Q;  5M9O A;  3CCJ Q;  1M4Z A;  1E3X A;  4X7F A;  3P26 A;  1AHJ B;  2FO0 A;  1U06 A;  2XD0 A;  1QH0 A;  4HE5 A;  2W0Z A;  5CKE A;  1E1Q A;  2DPP B;  4HA8 A;  1YIT Q;  1E63 A;  4P3I A;  4BI4 A;  4ZTJ A;  4E7Z A;  4YAO A;  2COY A;  4RTT A;  3ASP A;  3AVW A;  3RKY A;  1YIJ Q;  3JB9 I;  2BGJ A;  2V26 A;  5GAM e;  2DL5 A;  4P6Y A;  1K8A D;  2VVK A;  2QAS A;  4HVV A;  2K3Y A;  2X4W A;  1U3O A;  2CW5 A;  1X43 A;  2GTO A;  4EH1 A;  1VQ4 Q;  4PJO A;  4PJJ A;  1N9R A;  4F16 A;  5TRD A;  2LRQ A;  2HAX A;  2CUD A;  4PC1 A;  4E47 A;  3OW2 B;  5CR2 A;  3I55 Q;  4J6W A;  1YN8 A;  1QQJ A;  2MYS A;  2OJ2 A;  4M78 A;  1TVC A;  1X01 A;  2ZPF B;  2DIE A;  1VQ9 B;  4HCZ A;  2EW3 A;  3CCJ A;  4V2S A;  1E3Z A;  2E41 A;  4Z4U A;  1VQM T;  2DER A;  1QFZ A;  2MOX A;  2EGA A;  3X26 B;  1UGV A;  1E79 A;  2LC4 A;  5FLX E;  4XMY A;  2D3N A;  3ZZT A;  5GMK i;  1KK1 A;  2CGH A;  3ONY A;  3SEM A;  3CC7 A;  2BSA A;  4E2F B;  2CP6 A;  1QP3 A;  1Y0R A;  4KGZ B;  1FX7 A;  2EQI A;  2K5L A;  1GBR A;  5KYX B;  1EP3 B;  3SKB A;  3HFN A;  5KYY A;  3Q3A A;  1S72 B;  1W9X A;  1M30 A;  3GOX A;  1K1Z A;  2X6X A;  1RAC B;  5FRN A;  4C0S A;  4ZCM A;  2V7X A;  2M5S A;  2OTJ Q;  1D1B A;  4FL6 A;  2FPE A;  1BCO A;  4PK4 A;  3CXC A;  1G3W A;  1OOT A;  2DL7 A;  4C0G A;  4M7A G;  2ZCF B;  4C5G A;  3CCM B;  3FKS A;  3QUI A;  3OYK A;  2QA4 A;  1N8R D;  4QVZ A;  3CCJ T;  2C4T A;  2RC6 A;  4TSF A;  4RCC A;  1Q7Y D;  2JJ9 A;  1CSK A;  3HP9 A;  4PJL A;  4AFQ C;  3VJP A;  3AVV A;  3GBQ A;  3Q1J A;  1QVF A;  2CSQ A;  3ZZU A;  4C0D B;  3I56 A;  2E64 A;  2HQE A;  1SHG A;  1ARK A;  2L3R A;  2CND A;  2ROT A;  2I0N A;  2M0O A;  4JJD A;  1OB2 A;  3MJX A;  2CS7 A;  4ZCI A;  3LO8 A;  4QVC A;  1K28 D;  2ESW A;  5TV2 A;  2YRD A;  1N8R R;  3FJ5 A;  3ZC3 A;  5IHN A;  1NRK A;  2JTM A;  4R55 A;  2KXC A;  3U23 A;  4GBQ A;  5FU6 C;  2CH4 A;  2RJE A;  1FXX A;  2AKK A;  2XIC A;  3OS0 A;  2ZPI B;  1KQ1 A;  3IQL A;  4Y91 A;  4UZU A;  4TMZ A;  5KCO A;  3PA1 A;  3GLX A;  4EPC A;  3I9Q A;  2JS2 A;  2RPN A;  2NUZ A;  5FIU A;  3FJP A;  1RQP A;  2LT4 A;  3CME T;  2JJ1 A;  2OBS A;  3CPW S;  3G1J A;  3CCS B;  2IVW A;  3R6K A;  3GVJ A;  3NTH A;  1VQM Q;  3V7S A;  1YX2 A;  3HTR A;  1P4M A;  3GQB A;  1VYU A;  5FRO A;  2V7T A;  4BE2 A;  3JCM P;  5TY0 A;  2X3W D;  4JLI A;  5GMK e;  2EFG A;  2V1R A;  2DVE A;  2EIF A;  5IYW A;  4KGX B;  4XAX B;  3OZV A;  3MKD A;  3ZEH A;  4OPS A;  1JXM A;  3L2Q A;  2ZL5 A;  4XOP A;  2E3I A;  3JB9 J;  1H3H A;  4O5V A;  2OI3 A;  4XR6 A;  4FSS A;  4OB2 B;  2BF4 A;  1VIF A;  1Y96 B;  2KVO A;  2VAS A;  1ZA2 B;  4NNJ A;  3GP8 A;  1G3S A;  4FIB A;  3V8L A;  5CKB A;  2QEX T;  1OV3 A;  1VQN T;  5CK9 A;  2D3L A;  1SSH A;  1Q7Y U;  3WYA A;  1LVK A;  3E1S A;  1UD6 A;  1S4M A;  2DJZ A;  1H3Z A;  2XHC A;  1EZZ B;  5GAN d;  3R6N A;  3REA B;  1B7T A;  5FO1 A;  1YFN A;  2L3P A;  1J3T A;  4MMK A;  4UAJ A;  3DDY A;  4CQJ A;  1VQO Q;  3MHX A;  1F20 A;  3PNW C;  1ZM4 A;  4R0K A;  4TN1 A;  2RD1 A;  4X9D A;  1B23 P;  3AT1 B;  2A36 A;  4FM4 B;  1OGI A;  4Z4T A;  3KL9 A;  1TSF A;  2VWF A;  4RD3 A;  2KT1 A;  1M90 U;  1GJR A;  1KJZ A;  2YUQ A;  1V76 A;  3MP1 A;  4XTV A;  4QHY A;  4LBY A;  1ZSG A;  4B9X A;  2GK6 A;  4KBM B;  3LGL A;  4G5G A;  1M1F A;  4M53 A;  4RCB A;  2M1H A;  4KT0 E;  3CPX A;  5IH2 A;  1BYM A;  2JJ2 A;  1OPL A;  2Q6K A;  2EVR A;  2YUN A;  1FYN A;  2VC8 A;  4N0A A;  4C8Q F;  1BPL A;  3PA2 A;  2KMT A;  3OJW A;  2Y90 A;  2CT4 A;  3G71 A;  1SG5 A;  3OS5 A;  2E10 A;  3M0T A;  8AT1 B;  1VQO B;  3L2W A;  4Z8A A;  2AIR B;  2A7Y A;  2LCC A;  3KBG A;  3OB9 A;  1WJS A;  2D0Q B;  3HRS A;  5GMK l;  1H85 A;  2M9U A;  3HRT A;  3JCM h;  4M7A D;  2E1B A;  2LZJ A;  4YTL A;  2JW4 A;  2ZZE A;  1PRL C;  2P4T A;  2BV3 A;  2O01 E;  2B86 A;  2CZ0 B;  4LBW A;  2HLD A;  1NE8 A;  4M7D D;  2MWP A;  2JDI A;  1WPY A;  3CMA B;  2LCL A;  5GAN 7;  2DBK A;  2FZG B;  2YLB A;  4XTY A;  5GAO n;  1YI2 Q;  2XZO A;  1U8R A;  4FK8 A;  1K0S A;  2DRK A;  1RUW A;  3HPW A;  1RI9 A;  3DLM A;  2DM1 A;  1WOS A;  1Y7X A;  3Q6Q A;  2QA4 T;  3CCL T;  4AC9 A;  1F60 A;  1D3B A;  1M8M A;  3OS2 A;  1Q86 C;  3H9N A;  4LXC A;  2DXC A;  2P0K A;  5KE2 A;  4AF6 A;  3FPP A;  3I56 T;  1MV0 B;  4Z4S A;  1VQK A;  2YWF A;  1VQK B;  1WDX A;  4JRP A;  2QE7 A;  2DL4 A;  1TXQ A;  4XTW A;  2F69 A;  1SHF A;  1LPL A;  2F2W A;  1RAA B;  5GAN 6;  3G05 A;  2RI2 A;  1QLY A;  1ZBJ A;  1KHC A;  3QO3 A;  1SEM A;  5H59 A;  1Q82 R;  3EGD B;  1D09 B;  1UGP B;  3EGD A;  1U1S A;  1QKW A;  4ZN1 A;  2CK3 A;  1UGS B;  3QFT A;  1Y96 A;  4C92 G;  3MHP A;  4PAB A;  2PIA A;  3TCJ A;  3QFS A;  4F7D A;  1YIT T;  2C06 A;  2X51 A;  2RI3 A;  4M75 D;  3JCM e;  1VQ5 B;  4C92 E;  3QBY A;  2LT1 A;  5CIU A;  5DM7 R;  2K57 A;  2KRO A;  1FNM A;  2PTK A;  3EGX A;  4DEY A;  7AT1 B;  2ZPG B;  1AOJ A;  3M53 A;  2GQV A;  4IUP A;  4JPB W;  3CCV Q;  4PC7 A;  4RTV A;  1K8A R;  5GAM j;  5A2Q E;  1KC8 D;  3OYB A;  2C0O A;  2WZN A;  3CP2 A;  4QUZ A;  5F4J A;  5CDF A;  1OYX A;  3BCF A;  3EGU A;  1IGQ A;  3QPH A;  2LQ8 A;  2F1M A;  4RDK A;  1YP5 A;  1Y0M A;  3VYG A;  2V1Q A;  4X0C A;  1YIJ B;  1MMA A;  3PEN A;  2VJI A;  3JCM V;  2CBX A;  3B78 A;  2QQR A;  3ZBT A;  2GJP A;  1SF9 A;  4X06 A;  1OQK A;  1YJW B;  1N8R U;  2QGG A;  1EP2 B;  3W5V A;  4E7H A;  2QQS A;  4C8Q C;  1ZM2 A;  2FRY A;  5J3B A;  2W6I A;  2AHO A;  1WOO A;  1OUL A;  4G1V A;  3CCE B;  4FYW B;  1S72 T;  2WPD A;  1X2K A;  2EYQ A;  3L1A A;  2YLC A;  3UF4 A;  1IO6 A;  3FIF A;  2DTH A;  2NYS A;  3UT1 A;  1MMD A;  4QFM A;  4F7U F;  4RMO A;  2BIV A;  4AMC A;  4P22 A;  1WX6 A;  1M1K R;  1K9M D;  1D1C A;  1K73 R;  4BY6 B;  3SJP A;  3VS4 A;  2L3S A;  1RAD B;  4Y7C A;  2YT6 A;  4MYU A;  2YHT A;  2C0I A;  3CC4 T;  3CCR T;  2LQN A;  1N27 A;  3CMA Q;  4X05 A;  2GCX A;  1FWZ A;  4FYX B;  3THK A;  1RAI B;  2KE9 A;  1EIF A;  2FPF A;  2AK5 A;  4WQM A;  2L5Q A;  2K3B A;  2VV5 A;  1JNY A;  2KEA A;  4N4G A;  4ZGN B;  2X4X A;  5FW9 A;  1ABQ A;  3JCM c;  2OBT A;  1COW A;  1QKX A;  3VUB A;  2ZZD A;  2NPF A;  3RMS A;  5GAN j;  1D0Z A;  5LJ3 h;  1YIJ A;  4BI8 B;  3QHS A;  2XKO C;  3BCD A;  2OAW A;  4J9B A;  4N3G A;  3JV3 A;  5GAN 3;  1KD1 D;  4YXW A;  2DX1 A;  5GJW B;  2DL3 A;  2E65 A;  2J06 A;  2ZL6 A;  2C78 A;  1IJF A;  1N05 A;  5KYU A;  5GAM h;  4X34 A;  5GAN 2;  2IG0 A;  4P6V F;  4BDY A;  4E7J A;  2XND A;  3CMM A;  3ZL7 C;  2FX3 A;  1N06 A;  2V4D A;  3J81 k;  2PNI A;  2YWW A;  3EFO A;  3G71 T;  5IYN A;  1VQN B;  2AZV A;  2F4N A;  4FYY B;  1V5V A;  1JJ2 A;  1UEC A;  2GK7 A;  2YWG A;  2D6F A;  2KRS A;  4JRI A;  2E6Z A;  2PUO B;  3QG1 A;  4C5H A;  5LJ5 f;  2RQV A;  2K4Y A;  4AFU C;  1NBM A;  2EYY A;  1WHG A;  2GNC A;  1QUF A;  3CCV B;  2Z0W A;  1EFC A;  2YXY A;  1GAW A;  3ONU A;  2MIO A;  1P92 A;  4RJL A;  3MO8 A;  1XOV A;  1NG2 A;  1M9S A;  5BSX A;  1M5Q 1;  2EWN A;  2ROL A;  2WSC E;  4NL2 A;  5CKF A;  3JAM E;  1GL5 A;  3F70 A;  1TLL A;  4M1K A;  2KT8 A;  4DBH A;  1M1K C;  4HVW A;  1S72 Q;  4NOY A;  1DAR A;  3EGX B;  4JRK A;  1VUB A;  4AVZ A;  2XGJ A;  3UA7 A;  5GMK j;  1VQ5 T;  2VBT A;  2HSE B;  2OTJ B;  1YJW Q;  2OTJ A;  2XZL A;  3Q6R A;  4IIM A;  4WZL A;  1PG5 B;  2EPD A;  2AZS A;  3AHU A;  1GXI E;  1EX4 A;  2BM1 A;  3CBM A;  2B5O A;  4LBZ A;  3WNB A;  1SM4 A;  1UDL A;  4CC7 A;  3PVD A;  4OF1 A;  4DNT B;  4ZTF A;  1VF7 A;  3L2V A;  2JXB A;  4XU3 A;  1KC8 U;  1KQS A;  1M3B A;  1UB4 A;  1VQO T;  2J05 A;  1MMG A;  2QTZ A;  1DG1 G;  3MEV A;  4X9C A;  4OMP A;  1MAB A;  3OKX A;  2DRM A;  1KQS S;  5HZA A;  1WFW A;  5CO7 A;  1I5O B;  2HD0 A;  1G7R A;  2C0T A;  1QVF B;  1TUD A;  3VU3 C;  1PWT A;  1WXT A;  3A8I A;  5KYX A;  5LJ3 g;  3VRZ A;  1WJQ A;  1J9Z A;  4WZE A;  3WNC A;  1UUE A;  5GAN e;  3M4G A;  4OP0 A;  3OYF A;  1A0N B;  1Y71 A;  1IRE B;  2BZX A;  2DXU A;  1MNE A;  3U6K A;  4J9I A;  2NUP B;  1HA3 A;  4HKE A;  1IHW A;  2DNU A;  4EMK B;  1QX4 A;  3P8D A;  1SRM A;  1WQ7 A;  4ANJ A;  4HT9 A;  4M7A F;  4Y92 A;  2BGI A;  2C77 A;  4JMQ A;  2QDY B;  1VQ8 Q;  4WZK A;  1B3Q A;  1K8A U;  2DIQ A;  2RK1 A;  3A8K A;  1ZSZ A;  1NZ9 A;  1GCP A;  2C5B A;  1NJI U;  1OPK A;  3PUN A;  1N0U A;  2KDS A;  1WJR A;  1KG1 A;  5A88 A;  4RCY A;  3VS5 A;  4X7C A;  3BDU A;  1MND A;  4PLL A;  5FO0 A;  4OMQ A;  2VNK A;  2KSS A;  4LDV A;  1TS9 A;  1KQS P;  5FWC A;  1GO2 A;  3BFM A;  1XB2 A;  2EKH A;  2EFI A;  3JB9 F;  2COW A;  1JJ2 S;  1VHE A;  1HK9 A;  1H8E A;  1RAE B;  4XTZ A;  5A0D A;  1K4U S;  3W2E A;  2HDN B;  1OHH A;  4RDL A;  1M1K D;  1FDR A;  1NPR A;  2WR8 A;  2K5I A;  3HHT B;  3M0S A;  1MV3 A;  4M77 A;  1JJ2 P;  3QJ6 A;  2ECZ A;  1OB0 A;  4P3Y A;  5HKK A;  1KK0 A;  2K6D A;  4BE1 A;  3T9N A;  2FRW A;  4M7A C;  2R9V A;  5KH6 A;  2L0A A;  1YIJ T;  1QVF P;  2F43 A;  1R77 A;  1JBM A;  4DOV A;  2PVO B;  3OSV A;  2FZC B;  2BKD N;  2BE9 B;  3VS2 A;  1GCQ A;  3BH4 A;  3GPL A;  3ISX A;  4HCB A;  1WOP A;  4A54 A;  2GGR A;  1IZ6 A;  1PKT A;  5GAN f;  3ZUG A;  2VYQ A;  4MDW A;  1I0C A;  3CBO A;  3LVB A;  4NBS A;  2P0Q A;  4C92 F;  1Q86 D;  2QEX Q;  1FNC A;  1YBY A;  3AVT A;  2DTI A;  4B43 A;  2JIZ A;  4M78 B;  1W87 A;  3U6B A;  3CB4 A;  4FT2 A;  5DLQ E;  4D6W A;  1HXD A;  4M75 E;  4B47 A;  3CES A;  1LJO A;  3PE0 A;  1Q81 D;  4OMM A;  2XDD A;  4ORZ A;  3C95 A;  2HZY A;  4RG8 A;  4JJN K;  1GBQ A;  3QFR A;  3A8H B;  2LMJ A;  4DA4 A;  1E6H A;  3S6W A;  3UWN A;  1Q9S A;  1VJS A;  2DYI A;  1ZQ1 A;  3L42 A;  2JN0 A;  4IUV A;  1FRN A;  1V0F A;  2JTE A;  2B7C A;  2VJJ A;  4ESR A;  4XQF A;  2RHX A;  3JB9 H;  4X8I A;  1BCM A;  1WXB A;  1WTH D;  4II1 A;  1WOR A;  3NTK A;  1T0J A;  4DQK A;  1YJ9 Q;  4M77 G;  4M77 D;  3WY9 A;  2EQJ A;  5AYF A;  2DLP A;  2LX7 A;  4JJC A;  2CP7 A;  2NUT B;  4II2 A;  1X6O A;  2RHI A;  4MZM A;  5DY9 A;  2E1H A;  2NV4 A;  4RLZ A;  2WSS A;  2CP3 A;  1ACM B;  4F7U E;  3PMT A;  3V8J A;  1U1T A;  2H8H A;  1UGQ B;  4B44 A;  3E9F A;  9ATC B;  4WF2 A;  5IN1 A;  4YAL A;  3JCM Q;  4M7D E;  2A28 A;  1VQ4 T;  4C0D C;  1VQK Q;  4YEL A;  4ZGQ B;  5FWB A;  5C6S A;  4IUT A;  1NYF A;  4XTU A;  3INZ A;  2E70 A;  1U5S A;  2DVJ A;  5FNZ A;  5H5J A;  2KYM A;  2YRC A;  2BMW A;  4FW2 A;  4BAC A;  3LQ6 A;  2QQA A;  1BI3 A;  3EFS A;  4C5E A;  1KQS B;  5CCA A;  1F1B B;  1NDH A;  3A1P A;  4HT8 A;  1E64 A;  4ACA A;  5KYU B;  1LCK A;  4C0F A;  3JQR A;  1CNF A;  3CTA A;  4MML A;  2HBP A;  2RQW A;  1IGU A;  3HFO A;  4E7I A;  2XZP A;  1K9M C;  1YIT B;  4JZ4 A;  1Y07 A;  5J26 A;  3ZZ0 A;  3OYH A;  3A8M B;  1V29 B;  4M7D F;  5KNL A;  2V31 A;  1OX8 A;  3SDZ A;  1AWJ A;  1W35 A;  3AST A;  4Z02 A;  5CQX A;  3CCM Q;  3OYN A;  3I35 A;  3J80 E;  2RC5 A;  3CCE Q;  2B7B A;  3ES9 A;  1R8O B;  4PC3 A;  2HL3 A;  2ZZG A;  2ED1 A;  4JRQ A;  1JB9 A;  4B9W A;  2K2V A;  3H0I A;  5KYW A;  2X6W A;  3BQJ A;  1YCS B;  5DS0 A;  2JOY A;  1O75 A;  1YHQ B;  1GFD A;  1B2R A;  1VQ9 Q;  4RG2 A;  2HQH A;  1KHI A;  4FSX A;  1R5N A;  4XN3 A;  2GBQ A;  3OSS C;  1UJY A;  4WTO B;  3VS7 A;  1KC8 C;  4XU1 A;  1VQP A;  4A4K A;  4J9F A;  3WXM A;  2JTF A;  1VQN Q;  2VB6 A;  4OB0 B;  3OW2 P;  1H42 A;  2OTL T;  1UD2 A;  2QQ9 A;  4FW1 A;  2OK7 A;  5GAN 5;  1EXM A;  4B4D A;  2X35 A;  3CC7 T;  2SRC A;  1RLQ C;  2HEQ A;  3KXT A;  1M90 R;  2VBS A;  4C8Q A;  3JCM X;  4PJO D;  1WLP B;  1JJ2 B;  4H9G A;  1OB5 A;  1D0Y A;  4LE9 A;  5J3O A;  3MP6 A;  1Z9Z A;  2OX7 A;  3PGG A;  3CD6 A;  3U2Q A;  3EH1 A;  1NYG A;  4K1X A;  4L8J A;  4XLA A;  4DK0 A;  1A8P A;  5KSW B;  2MMP A;  3RES A;  4II3 A;  2HKN A;  2XU8 A;  1C1A A;  4AFZ C;  5GAN 4;  3GVK A;  1KJW A;  1Q7Y R;  1RAB B;  1WIE A;  1VQP Q;  4OPO A;  2E5Q A;  4G1B A;  4LD9 K;  2EIX A;  3TSZ A;  1GFC A;  4ELY C;  3AVU A;  1TU0 B;  3QZ9 B;  1WHH A;  1ZX6 A;  3ZPN A;  4Z4W A;  2L2P A;  4RUG A;  2PUK B;  3G6E T;  2GFU A;  1G83 A;  5CKH A;  1K76 A;  4AG2 C;  3LLR A;  3VYH B;  3SWN B;  5LJ3 e;  3HSB A;  1D1A A;  1AWO A;  1T6X A;  4XK8 E;  3C94 A;  2LJ1 A;  3VS3 A;  2Q6O A;  2QXF A;  3M0R A;  1PRM C;  3M58 A;  4CI0 C;  2JN9 A;  2IIM A;  2C5H A;  4XKW A;  5AN9 A;  3BW1 A;  3CC4 Q;  3CCR Q;  4RD1 A;  1ZUU A;  1OGJ A;  4B48 A;  1QVG P;  2DIG A;  8ATC B;  3LX7 A;  2VXE A;  1B34 A;  3WBK A;  1K0X A;  2LVM A;  3JCM b;  4KGV B;  1VQ7 T;  2HQX A;  1IRX A;  1VQ6 B;  3JCM W;  1WNL A;  4L5G A;  3ME9 A;  2EJG A;  1Q7Y C;  1UTI A;  2PVG B;  2FEI A;  3CME Q;  3EG9 B;  3DKM A;  3CPW A;  1WU8 A;  1VQ8 B;  2FB7 A;  1NLO C;  4A63 B;  5IT9 E;  3GF5 A;  2DK3 A;  3JCM g;  1RL2 A;  1NEG A;  3OOC A;  3HRU A;  3PVQ A;  2FZK B;  4KUD K;  2FPD A;  1R0C B;  3LQE A;  2O88 A;  3I55 A;  1QWE A; 
#chains in the Genus database with same CATH homology
 2F1L A;  3A1P A;  2DYI A;  1PM3 A;  2QGG A;  2DOG A;  3H9N A;  3HTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...