2DYIA

Crystal structure of 16s ribosomal rna processing protein rimm from thermus thermophilus hb8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
162
structure length
162
Chain Sequence
b'MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 16S rRNA-processing protein rimM
publication title Crystal structure of 16S ribosomal RNA processing protein RimM from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ribosome
total genus 31
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2dyiA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2dyiA01
3H9NA 1PM3A 3HTRA 2DOGA 3A1PA 2F1LA 2DYIA 2QGGA
chains in the Genus database with same CATH superfamily
5EMNA 3GVLA 4QT7A 5FROA 2ESWA 3OB9A 1W9XA 3E1YE 4RDKA 1AZGB 3OYBA 1YFNA 4VUBA 5L46A 2EYYA 2Z0WA 4DK0A 4C8QB 2FZCB 3LVBA 3MP6A 1DDIA 3OYIA 3BCFA 4Z4UA 4YEJA 2FYKA 4AMCA 2NPFA 1TU0B 3VJPA 2DYBA 5LJ3g 3OKXA 3M4YA 3ZZUA 1E62A 3VNVA 2YUQA 3MHPA 1T0HA 4NL3A 2RPNA 2QA4T 3OYAA 1VQLQ 2YDLA 2XU8A 2YHTA 4J9CA 4KUIA 3OW7A 4ELZC 5I2SA 4M1KA 2ATCB 1QFYA 2L3PA 2RHYA 4AT1B 4XLCA 1KSWA 1OQKA 4G5GA 5D6WA 4WZEA 2AK5A 2XICA 1C1AA 4QVCA 1BK2A 4J0QA 4PKCC 2EPDA 1GRIA 2L3SA 3VU3C 4B44A 4PFOA 4JUVA 1VQLB 1M3AA 3W2IA 1QP2A 2ED0A 3OJWA 1B7TA 2JNGA 1B07A 2CZ6B 2DE0X 4DA4A 5CDFA 3OYMA 5IYWA 2DK3A 2LQKA 2VBVA 2GK7A 4J9FA 3VS7A 2VBUA 1KQ2A 1N07A 3AGPA 1WJSA 2RHXA 2DVJA 2LTOA 1N9SA 4XQ3A 2DETA 1T6ZA 3DB4A 2GQVA 3CBMA 2IVWA 3MEAA 1VQPQ 3ME9A 3MP8A 4KH1B 1WOOA 3V7CA 3HL8A 2A7YA 2LJ3A 5FWCA 1G3SA 3JCMb 2R57A 2Q6LA 2BM0A 1EWYA 3ZZ0A 5CO7A 3V7RA 2K9GA 4CC2A 4EDUA 2KMTA 3TREA 1KD1U 1VQNT 2C4TA 4X7CA 4Z89A 3Q38A 4ROXA 3V8LA 1IHVA 1VQPB 3EHQA 3QIIA 4C8QD 2BF4A 3G4SB 5FNZA 4XR6A 4XAXB 4N3NA 2DPPB 4C0GA 1H3HA 1MMNA 4P12A 4ASUA 5TV2A 2EQMA 1YBYA 4CC4B 2LCCA 1HA3A 3ZUGA 3JB9J 1T3LA 1BU1A 1UJYA 3PTAA 1AIPA 3QWYA 2RJEA 2EBPA 2RK1A 3W2FA 1WOPA 4ATOA 3QSYA 1X69A 2QDYB 3M54A 1KC8U 2BTTA 4ZN3A 2KRSA 3M56A 1WA7A 2M0YA 3ZFJA 2HBPA 4Z4YA 2QE7A 2CUDA 3CCMT 4DQKA 4FXUA 2X6XA 1R8OB 2GFAA 1PNJA 1WSVA 1AWJA 2K4YA 1SRLA 5GAMe 3G1JA 4X1VA 4QHYA 2BPOA 4ESRA 1S72B 3MP1A 2V31A 1VQ9T 2J05A 1D8TA 1IRXA 4J83A 1W4SA 1FWZA 2L2PA 2CP7A 4PL6A 1XQHA 1B34B 1UD5A 2EYQA 1BI0A 4M75E 1PJ7A 2D8HA 3OAAA 2EAYA 4OPOA 2EKOA 1NJIC 2Q6IA 2QA4Q 1Y0MA 3TU4K 4HVUA 1PKSA 1WOSA 1PKVA 1ZHIA 5GANf 4Z4TA 2E3HA 5FLXE 5I2MA 2DL5A 3L2VA 4O5VA 1G7CA 2DTOA 3PUNA 1LJOA 4PC7A 3VS6A 1JXOA 2KDSA 3CB4A 1FMWA 2QXFA 3TVTA 3JCMe 4WZLA 2RJDA 1WHKA 2QA4B 2BVNA 4HE6A 2IIMA 4RUGA 4XN0A 3CCET 1IGQA 3EAEA 1Q7YD 3HKSA 3UA7A 3META 2ED1A 3RERA 2DNUA 1R0CB 3LQEA 2PLFA 1I8FA 5M9OA 2X0KA 3EFOB 2E6ZA 4J9BA 1U5SA 4P9SA 3GBQA 1GCQA 1GCQC 1GBQA 2K2VA 5HZBA 1QFZA 3P27A 5HY6A 2CUBA 4X7FA 2JJ1A 3T56B 2XHCA 4FYXB 2F69A 3MEVA 2ZPIB 2KI7A 4DNRB 1QKXA 1IO6A 1NBMA 3S3NA 5GAMh 5I21A 4OMNA 2WSCE 4P6YA 3ZZTA 4LDWA 4A4FA 2E1HA 2WYRA 5C6SA 1VA7A 3M59A 4BE0A 3CCQA 2DILA 4QQ6A 2ZXIA 3QZ5B 1M90D 3CCUT 1OPLA 1KQSP 4BPRA 3ES9A 3JB9D 3G05A 5E6TA 3ZBDA 2JTMA 4P3IA 3EG9B 3B8HA 2P3MA 4II3A 5HKKA 4M75A 3WBJA 4M75C 2HNIA 2V7VA 2QTLA 4TMZA 4PJLA 4DBFA 4QKUA 3CCVA 4NS5A 4PABA 4HT8A 5DLOA 4AG1C 2KT1A 1OB0A 2V1RA 2DXBA 4ZGJB 4EMGA 1WLPB 5KYYA 1VQNB 4XTUA 2QTVA 2X4WA 3V8KA 3OYNA 2GJPA 4B6MA 3Q3AA 2YWGA 5CIUA 3O5ZA 2OX7A 2RC6A 1V0EA 2ZAEA 5DY9A 3JCMh 1KJZA 2WZNA 4XU0A 3IQLA 3OZUA 1TUDA 1U3OA 4Q5WA 2WJYA 1QGYA 4ZTJA 5KCOA 2V4DA 2MIOA 1BB9A 2RC5A 2F2XA 3L42A 2JUFA 3DLLA 2WSSA 4HVVA 4M77E 4HCBA 2QI2A 2MOXA 1Y0RA 3VV0A 3E9FA 3QYGB 4RCYA 3CCQQ 3CCRT 3CCEA 1SKYB 2KQWA 4ZTFA 1I1JA 2BIVA 4C0DC 4MYUA 4ZCIA 1JBMA 1XOVA 5D6XA 2JN0A 5HKCA 3QFTA 2WACA 3FJOA 1QWFA 1HSQA 4XLHA 3CCMB 2QASA 3C12A 3O8VA 1JJ2P 3CCVQ 4DNTB 4LDXA 1T5EA 1QGZA 1C6VX 4E7JA 4OB0B 2XZOA 4BY6C 4X06A 5IHNA 1X43A 2QQSA 1QVPA 3CC2A 1K73R 4OMMA 5FWBA 5FRNA 2ENMA 3RNJA 5KNLA 1KQSB 1VQ9B 4JJCA 2OAWA 4M78E 4JZ4A 1SHFA 1M1KD 3CMEA 2P4TA 2K3YA 2IG0A 1BPLA 2V8JA 3CCUA 1K8AR 2VYTA 1EP3B 8ATCB 1PG5B 5GAN4 1ZUNB 5DM7R 1KMHA 4A4EA 5KYYB 2G3RA 4C43A 1O75A 2YRVA 3CC7T 3U6KA 3CCEQ 1O9SA 2ABLA 3QZ9B 2OBTA 4P2NA 1H8KA 2F1LA 5CK9A 3TQ7P 3QE2A 2NUPB 1EFUA 3WVEB 4C0FA 5IHKA 1SRMA 1WP6A 2DJQA 3NTIA 4QVZA 3HAGA 2O4XB 4RCCA 4DQ2A 4BDZA 3CCEB 3OYEA 3HPWA 4UAJA 1VQOA 2BM1A 4M77A 4JRKA 2EQUA 3CC2Q 2HSEB 2C2WA 4ACBA 2ZPGB 2GTOA 3QDFA 5IYRA 4OMLA 1VQ6T 4RKUE 3LYIA 3CCST 1R0BG 1H8EA 2E5QA 6AT1B 1H641 2BN4A 3TSWA 3ZC3A 1ZBXA 1JJ2B 3CCUQ 4EMKB 2X9HA 5IYPA 1MABA 3CC4T 4M75F 4MZTA 3OY9A 4RTVA 3G71B 2FX3A 2KK4A 1Q82D 2DXTA 1D0XA 2K6DA 4XU3A 4KULA 1FX7A 1OULA 2K79A 1NG2A 3E9GA 1W0KA 1QH0A 2QGGA 3W2EA 5B6IA 2MAMA 4G1VA 4X7DA 3CMAT 1G83A 3I35A 3CCUB 3ULRB 1S4MA 4BE1A 4M78A 4X9DA 2YRDA 3E19A 4XM3A 4OVAA 3WXMB 2CSQA 3H0HA 2ZPFB 3E1SA 1KK0A 3T53B 4YALA 3F70A 3A8KA 3R6JA 1E79A 5KE2A 3JCMW 2ZL7A 5A88A 4XONA 4MDWA 4Q7JB 2AZSA 2F5KA 1JA1A 4V2SA 2RF0A 3NTHA 1QCOA 3JB9H 2FB7A 1N8RC 3R6OA 1E1QA 2D0QB 2HCKA 2RD1A 2FO0A 2O31A 4OMOA 3CTAA 5CKEA 4M7AC 3J81k 4AF6A 3OW2S 2Y4XA 4Z4RA 1RAFB 2HMAA 3OFNA 1RI9A 2A3LA 2KRNA 4AFQC 2DLPA 2EIFA 1N08A 4WF2A 2J7KA 4DQLA 3BNWA 2QMUA 3CESA 4G7XA 3CCRB 2C06A 4HCCA 4P22A 4QVAA 5LJ3f 3HRSA 4JPBW 1NLPC 4QQGA 3MPUB 5LJ5f 1R5BA 4XMYA 2F1MA 2GF7A 1VQ6A 5GAOp 3CCSA 3X25B 2CNDA 2AZVA 2OK8A 2HSPA 1RQPA 4LBZA 2ZGWA 2V7XA 3CC4A 2XIDA 1F20A 1UGPB 1WHHA 3GNGA 2CBXA 2GREA 5GAOm 2A08A 1Q86R 5FU7B 2NUTB 2OTLA 3JQQA 5IHIA 2ZL5A 1WHMA 1WXBA 2E70A 1YWOA 1WZOA 4NL2A 3PENA 1QG0A 4HCKA 4PC6A 3CXCP 1QVFP 4ZCLA 4E7IA 2ZPHB 2EYZA 2FG0A 4IUVA 4LD6A 4R56A 1ZSZA 1PWTA 3OEHA 1KD1D 4M77F 1ZUUA 3BY1A 4F04B 3CC7B 3VR6A 1WHJA 2QQBA 3PE0A 4DOWA 1YJ9A 4XU1A 2HKQB 2L0AA 3BH4A 1KZLA 5FO1A 1VQ6Q 2BSAA 3CCSQ 2D8JA 1YI2T 4RJLA 2NWMA 2CZ0B 2JMCA 2V26A 4XN3A 3CP2A 3OEEA 4BI4A 4P26A 4RTWA 3CC4Q 1NRKA 5GAOn 2X3UA 2HCJB 2LZ6B 3WNCA 2BE7D 1EX4A 2XNCA 2W6IA 4OPSA 5IAYA 2OTLQ 5GAOl 2F43A 2RM4A 4PFPA 3BE3A 1ZUYA 1KC8D 1VQ6B 5CAIA 2QQRA 3CCSB 2P0PA 2HAXA 1BQEA 4HA8A 2RQVA 4M78F 1RLQC 1VIEA 2KE9A 2DZCA 3X28B 3A98A 4F17A 3CMAQ 1TXQA 3G7ZA 3V7SA 2RI2A 2H8HA 2P0KA 1NJIU 3PVDA 3I55A 1DARA 2OYNA 3INZA 4DK1A 1XE1A 4XKVA 5GAMd 2EIXA 3OS1A 1HK9A 2RI5A 3LNNA 1YJ9Q 3ASRA 1WDTA 2R9VA 3EG0A 4Y28E 3SLNA 4LDUA 3CMAB 2OK7A 1UB4A 4C8QC 3CXCB 1QVFB 3CBPA 4DOVA 4M7AF 3RDVA 2QEXB 1Q81C 3REAB 3NFCA 4N4IA 2WSFE 2JS2A 4RDJA 4YXWA 3WNBA 1YHQA 3ZL7C 2A36A 1AHJB 4OB1B 2WJVA 2RJCA 3MJXA 3AGQA 3PNWC 4M75G 4F7UE 4C5HA 3RBBB 2WR8A 5F4OA 2OBSA 1YIJT 3HP9A 4LDYA 2XZLA 4C5IA 1CNEA 3I55Q 1ABOA 1W6XA 3A8JA 4XTWA 2PUKB 4UZFA 1YI2A 3UDCA 2X51A 4D6WA 5LL6S 3OYCA 4PC1A 1Q86D 1OU9A 3OP1A 1E6GA 2GFUA 4ME7A 1VQMT 3OSSC 2H3EB 3CCJA 3ONYA 1LNXA 4JZ3A 5GAOq 1M5Q1 2ZBVA 2E5KA 3OW2A 4XQFA 2YXYA 2Y90A 3OS5A 3SDZA 3CEYA 2CYZB 4FIBA 5KE3A 4UC4A 4O6JA 5GANd 3RKWA 1YHQQ 4M7DE 2E4HA 2CS7A 1JQQA 5KYWA 3AHUA 2MWPA 3PUMA 2YWEA 2JT4A 1PSEA 3TEEA 1RAIB 3VYHB 5LJ5g 4LN2A 4P5NA 2DO3A 3OJXA 1GCPA 1COWA 7AT1B 3FJ5A 4IURA 1W87A 4RD6A 3EGDB 3OOCA 4ORZA 2XI9A 1QFJA 1YI2Q 1PHTA 4KKTA 4OF1A 5GANj 1JA0A 1UTIA 4FN5A 2CSIA 1E1RA 3CCJQ 4F7UA 2ZBUA 4WZKA 2PIAA 4PC3A 2XDDA 4M4SA 2I1LA 2EJFA 4LC0A 2VJIA 1OGJA 1QMCA 4RD0A 1YIJA 1Q7YR 2ZL6A 1V5VA 3DLMA 3Q39A 3UA6A 1JRIA 1BCOA 4NNJA 1BYMA 1M9SA 4F7DA 1UFFA 2DL3A 4JRPA 2DVEA 2FL7A 1N06A 1MUZA 2FHDA 4L6V5 4FU6A 4PJMA 2RO0A 3CW2A 4B3XA 2FZGB 3I56A 2LCSA 4M77G 1VQMA 2DERA 1UGRB 3WNDA 3U2QA 1VLYA 1V0FA 1DG1G 3SKBA 5KH6A 4ZGNB 2R6HA 4M7DA 4L5GA 3MO8A 4M7DC 2E12A 4FW2A 5GV8A 4C5GA 1YWPA 2JM8A 4AG2C 3OYFA 1M90R 3OMCA 1WU8A 1GXIE 1U06A 2E3IA 2AIRB 3EH2A 1OV3A 1BKBA 1PRMC 4HVWA 2I0NA 1B23P 2NLUA 1V1CA 3OYYA 4G1BA 3REBB 1YIJQ 1BIAA 2K7AA 5KYXA 2XOKA 1BI2A 1TS9A 3JB9I 2Z6BD 2PVOB 4E6RA 2LQ8A 2GK6A 2JDIA 4LUDA 4J6YA 4M78G 3JV3A 1JB9A 4DEXA 1KJWA 3VS3A 3OZWA 1TWBA 4N0AC 2C4UA 5TY0A 4P3YA 1WX6A 3A8GB 4OP0A 3J81E 1ZM2A 3MMPA 3I56Q 3T51B 1YIJB 1KRHA 2EKHA 1VQMQ 3HRTA 3KFVA 1RQRA 2V7UA 3CCQT 3A8LB 1BCMA 2EFGA 1YITA 3ZEHA 1NZ9A 3GVKA 4FYVB 4IKFA 2J6KA 2RH2A 1IZ6A 1QCFA 3VO2A 4M7AG 1AT1B 2VWFA 1WIEA 3OPOA 3CCVT 1VOMA 1GFCA 1KFZA 2XDPA 1YLOA 1VQMB 3W2HA 5A2QE 1HJDA 1Y96A 1W2BS 3ASSA 4PJOE 3HRUA 2C78A 5A89A 3NTKA 2KROA 3SFMA 5THXA 2VNKA 2W10A 3EGXA 3VS4A 1NBEB 1ABQA 2YUOA 3QXEB 2ZITA 1R5OA 2XNDA 1NB9A 1GFDA 1LOJA 2RQTA 4PAAA 4F7UF 4B3GA 2Y4YA 2JVVA 1M1KR 1TLLA 5KYXB 4A53A 2PU9B 3JQRA 2EVRA 1N8RU 4EPCA 1BJKA 4Y9RA 3AVVA 1OYXA 3NGPA 3CCLA 2KBTA 2JZ2A 2O01E 1YITQ 5GAN8 1RABB 1T0JA 4OB2B 5CR2A 2JN9A 1Q95G 2VBTA 4CI0C 4JJNK 4FYYB 3NE5B 5GAN3 4DBRA 2AHOA 5DSZA 4C92E 2X4XA 2HQHA 1MRZA 1OHHA 2EQKA 2JIZA 1A8PA 5GANe 2F2WA 3H0IA 2LJ1A 3CC2T 3OS2A 1JNYA 4NCNA 1E64A 4BI3A 4BE2A 2KNBB 1U1TA 3RKYA 3CMET 4M7DF 3S6WA 1ZBJA 3ASPA 3GLXA 1G3YA 3Q6RA 1G7TA 1ZLMA 4E7KA 2XD0A 4G6IA 3FPPA 2X6YA 4OP7A 3GP8A 1ELOA 2SRCA 4X0CA 2K5IA 1I18A 4PJOA 4PJOC 1B3QA 1U2RA 4L59A 1Q82R 1M2VA 4OMPA 2RB6A 8AT1B 2DY1A 2VKNA 3ER0A 4AFSC 4JMQA 2B8AA 1UHFA 2VB6A 5CQYA 1H8HA 4J8OA 1GAQA 3QSUA 2PTKA 1VQOT 3PT9A 1ZA1B 4XU2A 2WZPP 1N5ZA 1OX8A 3AVYA 4M4ZA 2OI3A 1WNLA 3CPWS 2JXBA 2E41A 4FW1A 3VS5A 4B3FX 1SKQA 1QVGS 4Z88A 3A1PA 2F5TX 1H85A 3A8HB 5LJ3d 1OI1A 4C92A 4F16A 4C92C 3MEWA 3C0CA 1RI0A 2WPDA 4RG2A 4DBHA 2BV3A 4E7SA 4X9CA 1PJ6A 5GANh 5GAMg 2DF6A 5IN1A 1K73C 2KEAA 2JM9A 4NBSA 1G7SA 4PGOA 3A5ZB 3CCQB 4XL9A 4RPBA 1ACMB 1WXTA 1Y57A 4FCYA 3JCMV 1K8AC 9ATCB 1VQ5A 3OYJA 2LCLA 1IJEA 2VZLA 1VIFA 3PFSA 1T3SA 4M75B 2X3WD 1K9MU 4KRTA 1PC0A 4YAFA 1GJRA 2BZ8A 5TRDA 3CCVB 5LJ3j 2X6WA 2PNIA 2XMFA 4RD3A 4IIMA 4EMKC 3VUBA 4LE9A 1AWWA 3X20B 4XOPA 1M3BA 2EYWA 2EGAA 4PJNA 1E63A 1Q81U 1D1NA 2CKKA 3I1FA 1NJID 2DMOA 1UEBA 3VYGA 4A54A 5BSXA 2GBQA 1VYUA 1M8VA 3TSZA 4RCBA 1S1NA 5GMKj 1D1BA 4HT9A 2BKDN 1UD2A 3ISXA 3JCMg 1W2BA 5KYUA 5FL7A 1BX1A 4M7AE 5CKFA 3ASQA 3SWNA 3KXTA 3SWNC 1WGSA 4TMWA 4KGZB 3BFMA 2FZKB 2DL4A 2ECZA 4E2FB 1FDRA 2NUZA 1YJNA 1A0NB 5J3OA 4C0DB 2LDMA 3AVWA 1VQ5Q 1KD1R 1WPCA 1WDXA 2L8DA 4JS5A 4XD7A 1PCXA 3DKMA 3G6EA 2DIEA 2L5QA 3CMEQ 3TCJA 2B7BA 2P0QA 2E6NA 2E65A 4BY6B 3MCAA 4PJOF 1I07A 4Y9UA 3WBKA 2CC2A 4AF7A 2HL3A 2OTLT 1X27A 3CC2B 4F7UG 2FVUA 1NB0A 1UDLA 2GGRA 4M2LA 4X05A 3CMEB 2GTJA 4F14A 1K76A 2BE9B 3NMZC 1KC8R 3SJPA 5CKBA 2GPJA 5KYNA 4N3GA 3W2GA 2VNIA 1E3XA 2HDAA 5GAN5 2KXCA 1WI7A 5IYQA 4TKOB 1YJ9T 1YJNQ 4MYTA 1VQOQ 1IB0A 1N6AA 4M75D 2F4NA 1WSRA 1GO2A 3KL9A 1F60A 1JO8A 1OZ3A 1TUCA 4Z02A 2CZ1B 2DEUA 2LQNA 3CD6A 3OQ5A 1VQKA 4II2A 1KK7A 3M4GA 3G6EQ 1WJRA 2X85A 3OE7A 5FU7C 4KKSA 4RG8A 4HXJA 2X4JA 4C92F 3V76A 4PC2A 1NDHA 2YWHA 4M7AA 3OS0A 4XTXA 4M7DG 3MEUA 3E20A 1R5NA 1QQJA 1VQOB 3VS2A 3LX7A 4M77B 4XLAA 5D6YA 4LUEA 1TSFA 3OYLA 1QUFA 1ZM4A 2MMPA 2GCXA 4C0ZA 4KUDK 1DJ7B 2H3JA 1YP5A 2C0IA 1E6HA 2QK0A 4RTYA 5HK3A 2NV4A 4L8JA 1I8DA 1FYNA 2DTHA 2FPEA 2XEXA 3I55T 2CP6A 2X35A 2CH4W 4A4GA 2M02A 4FSSA 2KYBA 3MCAB 1UGSB 2RHIA 4X34A 3RIRA 2M1HA 1RAHB 2HEQA 2K5LA 2KAFA 4J7FA 1Q86C 3CPWA 3BDUA 3LGLA 4LD9K 3A3GA 4XOTA 1UGVA 2DFUA 3A8OB 2X53S 1K1ZA 1MMDA 3UT1A 1K0XA 1QVGA 1VF7A 4B43A 1PKTA 1RL2A 4Z4WA 4BI8B 5AYFA 3RKXA 3CD6Q 3B82A 1MV0B 1ZQ1A 3URGA 1VQKQ 4M78B 1K28D 1FMKA 2LVMA 4TT3A 2VBSA 1ZX6A 3FDRA 4LDVA 1YJWT 2VGMA 4WWVA 2PUOB 4C8QE 1EP2B 4XLEA 1YN8A 2K2MA 2YWWA 3QYHB 1YHQT 3EG1A 2B86A 1I0CA 4KH0B 3HTRA 1X01A 3SD4A 4QUZA 3RMSA 1AMOA 2BGJA 4IW3B 4R55A 1VHOA 5LJ3e 4TMXA 3GIRA 3A3BA 5LJ5e 2OJ2A 1WYXA 4RTXA 4KBMB 4HE5A 3M0UA 4M7AB 1XJWB 2EYXA 2I2LA 5GMKm 3PA1A 3THKA 4DEYA 4IUUA 1MMAA 1UECA 4QW2A 4ZV4A 1D3BA 2DX1A 4GY5A 3FIFA 5GMKe 3GVJA 4Z1MA 4U9UA 5L8RE 3CCJT 2A37A 1Y0YA 5FW9A 3DB3A 3P26A 2DTIA 1OU8A 3FB9A 4LNPA 3DDYA 2QYZA 4XTVA 4UZEA 4WQMA 4M77D 1NEGA 3H6ZA 3PIPA 1EFTA 4J9IA 4B9XA 3H9NA 5FU6C 1KTVA 4FWTA 3J80E 2ZTNA 3WY9A 4FSXA 3CC4B 2PVGB 1BI1A 3QJ6A 2KY9A 1VQ8A 2ZZFA 2OTLB 2DIQA 4PJJA 4PFZA 1YCYA 1IGUA 1X6GA 4XTYA 2PZ1A 2YWFA 5DLQE 2DIGA 3ZIAA 4IUQA 1FRNA 2BGIA 4QQDA 4C8QA 5GMKl 4N4HA 1WQ7A 1ZSZB 1YJWA 4M78D 2AT1B 1CQXA 3ASTA 5FA6A 1IJFA 2BMWA 2JOYA 3VRYA 1YJ9B 5LJ3h 2VJJA 5HCKA 2SEMA 2D9RA 1V29B 2RMOA 1CKBA 3M53A 4PK4A 4PJOG 3LW5E 3S3OA 3R6NA 2AHJB 2K57A 4GBQA 1W35A 2E1RA 4II1A 4KT0E 3SJZA 4E7ZA 3BCDA 2ZZEA 1WORA 1QKWA 5GMKh 1N8RD 1LVKA 2ZPBB 2C5BA 3M57A 5CVIA 1VQ8Q 4M7AD 1HYOA 2FPFA 1GAWA 4Y92A 4JLGA 1RLPC 2HDNB 5CKDA 3EG2A 4YAOA 1SG5A 3I56T 3EGUA 3CPXA 2VV5A 4OMFB 1G2BA 4BUGA 4IUTA 3GF5A 3OYKA 3J7AF 1VQLA 2XNJA 3I55B 2CGHA 1FNBA 1T6YA 2ROTA 1CSKA 5GJVB 1N0VC 1YJWQ 5A0LA 3OA6A 1IB8A 3H0FA 1WTHD 4XNFA 1SSFA 4C92G 2K5FA 4BDYA 3LH0A 1X6BA 4M0LA 4TSFA 3BY2A 2KVOA 2FRWA 5J3BA 5H5JA 2XDBA 2D6FA 5IXFA 4ZGQB 1RADB 4B9WA 1TTTA 4J5YA 1YJWB 1AD5A 4Z4SA 3JU4A 1FXXA 3QUIA 1VUBA 4RDLA 2PQWA 1YHQB 2VXFA 2P84A 3L1AA 3M0SA 3JSCA 4MMKA 3RMQA 4YAWA 2V8KA 1M1FA 2KT8A 3LLRA 1VQPA 3G4SA 1KHIA 3B78A 3Q1JA 1Q7YC 1RACB 2LMJA 2FEIA 3PGGA 4XKWA 4OMQA 4FT2A 2DYIA 1QP3A 2KXDA 1P92A 1YITT 4D8KA 3H8ZA 3HSBA 2MYSA 1UUEA 2COWA 2L89A 4E0FA 4HCZA 1YI2B 1K73U 2HQEA 2M0OA 2EQIA 2KGTA 2QQAA 3VS0A 2C5HA 1UD6A 5AN9A 2B5OA 5GV7A 2O2OA 4XK8E 1VYVA 1I4K1 3CCJB 1K8AU 2LT4A 3QFRA 1ARKA 1TTHB 4JS4A 1MNDA 1TH7A 3HFOA 3OW2B 3OYGA 1D0YA 1MMGA 4MZPA 2LRQA 1KQSS 2CP3A 4TMVA 4QFMA 3H94A 1OEBA 5FO0A 5HZAA 2MWOA 2DCUA 4C8QF 1G3TA 1M90C 2LC4A 1QGAA 4LBYA 2QTZA 3KUFA 4X8IA 5KYWB 4TVRA 4GLMA 2L3QA 5F4JA 1EP1B 1S72A 2GJRA 3G4SQ 2KSSA 4J9EA 5IH2A 1SEMA 1FNCA 2V8IA 3V7AA 2XGJA 2E10A 3QFSA 1T6XA 2HZYA 2FPDA 3CCLT 1F1BB 1X2KA 1D09B 4YHBA 2M16A 5F4MA 1B34A 1BLIA 1K9MD 3CMMA 1YNZA 3M0PA 3ZBTA 2FVGA 3ZBUA 1QX4A 1MGQA 2RN8A 2HBWA 2D74A 2HL5C 5IK2A 5GAMf 4MDXA 2E1BA 1K4US 2C0OA 2VC8A 2VUBA 4FL6A 4F7UB 1PSFA 1Q81D 4ZCMA 1FRQA 2OBRA 1OPKA 4N0AA 1Y7XA 1EFNA 4Y91A 3ONUA 4KKUA 4RD2A 2GQIA 1UD4A 3C95A 4DBQA 4B4DA 1FMVA 1LPLA 3PMIA 2QA4A 4P1VA 1EZZB 1JJ2S 3MKDA 1D1AA 2HLDA 2YUPA 4N4GA 3M55A 4JJBA 1TUGB 4YAUA 1S72Q 1N0UA 2LZJA 4BACA 3CPFA 1AWOA 2J6FA 4K11A 1VQ4T 4A4HA 2GQFA 3EFOA 3L2ZA 1VQ7T 2BZYA 3I56B 1I81A 5J39A 5TR9A 4AFUC 2XZPA 3GIBA 1NYFA 1K0SA 3OBYA 1N27A 1K9AA 5KW9A 5A0GA 2YLCA 3JCMf 5CKHA 4ZN1A 1AEYA 1IREB 2VVKA 3I5SA 5H59A 4JRIA 4M7DB 3QWXX 1IHWA 3FC3A 2AKKA 1ZA2B 2COYA 1CNFA 2QTXA 1M1KC 2K3BA 2DD5A 2QDLA 1RAEB 1G8XA 3VUZA 3QDRB 4KGVB 3QKJA 1XTDA 1C0MA 2L3RA 4Y7CA 1TG0A 3W5HA 4Z4VA 3WQZA 1SSHA 2ZTGA 2A0FB 3U6BA 1BI3A 5GAN2 3EG9A 1Y71A 1AWXA 1G7RA 1VJSA 1M2OA 3VO1A 1EIFA 3FRNA 2W6JA 3W5UA 2J06A 3FPKA 3KBGA 1QLYA 1SPKA 3JAME 2W0ZA 1NJIR 2RK2A 3L2UA 5CCAA 5LMZA 1JXMA 1VQNA 2EWNA 5BSYA 1MHNA 1H42A 1HD3A 3I9QA 5DN6A 1XB2A 3BQJA 2QDXA 5KSWB 2ROLA 2DAQA 2ZXHA 4X07A 2VGNA 1P4MA 4C5EA 3LWIA 1OX9A 1M1GA 2EGCA 2D3LA 1YITB 3M58A 1VQ5T 1Q9SA 1Q86U 1MV3A 1Z9ZA 4K1XA 4P25A 2KR3A 4PLLA 3JB9F 1AVZC 3OBWA 1FNDA 3M9QA 1X75C 1MNEA 3SLDA 2M9UA 4Z8AA 3VNUA 4XORA 2V7WA 1AOJA 1D0ZA 2CP5A 2P4RA 1Y96B 1Q82C 3R6KA 2MI6A 1XNIA 4WTOB 4LXCA 1IXDA 3A8MB 3G71T 1VQ4A 4OOVA 1EXMA 4OGEA 3MHXA 3BC9A 1I5LA 4ZGDB 3CCLQ 1VQ7A 4R0KA 3P8DA 3EGXB 3CCMA 2DM1A 3BY7A 1SM4A 1JEGA 2LNHB 4XTZA 1GR1A 1RAGB 4OPVA 2CP0A 1I7PA 2CW5A 3P8HA 2COZA 1VQNQ 5IT9E 4IIOA 2JTFA 4X7EA 1KQSA 2CREA 2KRMA 1VQ9A 3WYAA 3ZPNA 2VNHA 4M7DD 4A4KA 3L2QA 1WFWA 4J7IA 1RAAB 2K3XA 1VYTA 2ZZGA 3CCLB 1M8MA 1NYGA 1YJNT 5L23A 4J6WA 1V76A 1WQWA 2JJ9A 3T9NA 4JRQA 1W1FA 1UMKA 4C0SA 2R5MA 1GBRA 1OZ2A 4NOYA 2LQWA 5I22A 2AKLA 3G6ET 4RD4A 2DRMA 3EFSA 2RQWA 4FM4B 3JCMc 3LH5A 5GAOr 3UPUA 2OTJT 2MPXC 3GPLA 4C8QG 4J9GA 4RPDA 2BZXA 1ZM3A 1XFOA 2GJKA 1N9RA 1VQ4Q 2NUPA 5LJ5d 2A28A 1M27C 1SKUB 2EJGA 1VQ7Q 5HK0A 3W5VA 3CCMQ 5GMKi 3X24B 4BB7A 5A8AA 2JJ2A 2LX7A 4ZNXA 2O4XA 1CKAA 2X4YA 3LWHA 5FRMA 5EC7A 4ZGEB 4AVZA 1QCNA 2HKNA 2OAUA 3RUXA 1QWEA 5FIUA 1VQ9Q 2ZZQA 1VQ4B 1PJ5A 5IXBA 2DXCA 1GL5A 2DBKA 2J6OA 1VQ7B 4PJOB 3E2UA 5CQXA 1JJ2A 2M5SA 4EMKA 1M2VB 5LJ5j 3WVDB 3G71A 2DJZA 3CD6T 1VQKT 2R5AA 3QJYA 1PD0A 3CXCS 1QVFS 4RD1A 2NYSA 1M30A 3X26B 2XG8D 4JJDA 1RUWA 3SHWA 1IHMA 2RA2A 1W2BP 2V7TA 1PM3A 3LO8A 1AZEA 2QAZA 2YSQA 1W34A 5D7UA 2HD0A 2DBMA 3QG1A 1KD1C 4B48A 2LJ0A 3HHTB 3GQBA 3EFRA 3WXMA 3FLGA 3H41A 2VYQA 1NLOC 4GQNA 1KQ1A 4ANJA 3PIOA 2DOGA 4C92B 2DKGA 1UD3A 4A63B 4YELA 2V1QA 3GSIA 4RTUA 1UE9A 5GANg 2OTJA 3I5RA 1I5OB 1UJ0A 1U1SA 1EFRA 5GJWB 4Z4ZA 1OB5A 3G71Q 2R58A 3FKSA 3EH1A 2V7QA 2O9SA 5HXBA 1KC8C 3EHRA 1VQ5B 4M77C 3AVUA 5IYNA 2XK0A 3GOXA 2JS0A 4E7HA 3M5AA 3CCRA 3FEOA 2O9VA 2PMDA 1B2RA 1E3ZA 4JDSA 3M0TA 1TVCA 3NPFA 1SF9A 2GNCA 3PVLA 4LBWA 1FX0A 1OB2A 1H92A 4UZUA 2KVQG 4HIZA 2ZCFB 4YTLA 2MK5A 1D1CA 2YT6A 4OOSA 1WHGA 4PJOD 1WHLA 1ZUKA 1SHGA 2VNJA 3KEWA 1W2BB 5KYUB 1U8RA 1GVHA 2RHUA 4E7LA 3S3MA 3AT1B 4OOXA 4J6XA 3PMTA 3EG3A 2DXUA 2NUTA 1OOTA 1KHCA 4E47A 4M78C 3JCMP 3VS1A 1Q7YU 3QPHA 3SWNB 1KK3A 2OTJQ 3JB9G 2QEXT 1X6OA 1JU5C 4LBVA 2DL8A 1E7OA 3UATA 5KCHA 5J26A 1YJNB 4WZTA 4J9HA 3OMGA 2KYMA 1BX0A 1BMFA 1NE8A 4OGCA 1G5VA 1J9ZA 5I11A 4G7WA 2BUDA 2LT1A 4EIKA 5DS0A 3RY8A 3G6EB 3CP8A 1QW1A 2RQRA 3CCRQ 3CC7A 1ZM9A 2OTJB 2DL7A 2MCNA 3QFCA 4P6VF 4RM0A 2DRKA 2X8KA 2QG9B 3CPWP 1VQ8T 4MZMA 4C92D 1YCSB 1QVGP 3PVQA 1M90U 1N8RR 2CH4A 3JQPA 1BBZA 2C77A 1DDGA 1K73D 3U23A 2J7IA 3SB2A 4RLZA 4EMHA 3JCMJ 2ZPEB 3QBYA 3QHSA 2YRCA 1UGQB 4KGXB 3FJPA 1K8AD 3JCMQ 4XLFA 1PRLC 4FYWB 2WSEE 5C0MA 3CBOA 3GNFB 1D2EA 1JB0E 4TN1A 1EFCA 5JBQA 2D3NA 3CD6B 2YLBA 1VQKB 2RNAA 5J35A 2DEQA 2CF4A 3A35A 1YX2A 1X2QA 2B7CA 3CC7Q 2YUNA 2QQ9A 4CRIA 3RR6A 1KIKA 2PE3A 4CC3A 3LGFA 1FNMA 1XQBA 3UWNA 1TUIA 1TOVA 4IUPA 3M0RA 3CMAA 1N05A 2JMAA 1LCKA 1G3WA 3SEJA 2LP5A 3SEMA 1UHCA 2HQXA 3CXCA 1QVFA 2ZZDA 2RQUA 2QEXA 1WJQA 2LX9A 2CRVA 2CP2A 1ZSZC 2EJ9A 4RMOA 3L2RA 2G6FX 3ASKA 2D9TA 4M53A 1VQLT 5ECAA 4OB3B 4B47A 4CQJA 1WXUA 2VASA 2DZ9A 3NHNA 2QGFB 1KK1A 1Y07A 2RJFA 3V8JA 2PVDB 1NM7A 3CPWB 4J9DA 3L2WA 2DD4A 2CDTA 2VXEA 3D26A 1WPYA 3CQTA 3AVTA 3D7SB 3A8IA 3UF4A 4BD3A 1QVGB 3LQ6A 1KG1A 3N5BB 3C94A 1UD8A 2MF2A 4MMLA 4EH1A 5EG2A 3CRZA 2QN6A 1VLOA 4QV2A 1J3TA 1W70A 1M1KU 2JTEA 3M0QA 2O88A 3OZVA 2E64A 3OYHA 4PNOA 1UG1A 3OYDA 2RI3A 2Q6KA 4FT4A 4TMTA 4WCIA 5A0DA 2CK3A 1NPPA 1M3CA 2X3XD 1HXDA 1PD1A 4CC7A 2D0NA 1VQPT 4RCZA 3Q6QA 3RESA 2QEXQ 3G4ST 3QO3A 4JLIA 2Q6OA 4FK8A 1BIBA 4ACAA 2IPOB 4RTZA 3VMFA 4QVJA 2CZ7B 3C4SA 4PLIA 2CT4A 4QVDA 1K9MC 2D1XA 5LJ5h 3VRZA 3AVXA 1NEBA 2EQJA 1QUEA 1H3ZA 1NPRA 4HKEA 5GAN6 1HVXA 4ELYC 1D3BB 2DA9A 5GAN7 1Z9QA 2EFIA 2RHZA 1R77A 2F2VA 1K9MR 3BW1A 3P8BB 3JRZA 1M4ZA 1W0JA 2XKOC 1OGIA 3OSVA 3EGDA 4R71A 4AC9A 3VKIA 4D8DA 1S0UA 3PA2A 3BDLA 1ZSGA 4RTTA 4AFZC 5GAMj 1E43A 4H9GA 1Q81R 2FRYA 2JW4A 3JCMX 2LNVA 2M51A 3OW2P 5FU6B 1VHEA 1Q82U 4GLKA 1KK2A 2EW3A 5AT1B 3JCMd 1S72T 2CT3A 3HFNA 2C0TA 1VQ8B 1HZEA 2EGEA
chains in the Genus database with same CATH topology
3H9NA 1PM3A 3HTRA 2DOGA 3A1PA 2F1LA 2DYIA 2QGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9N A;  1PM3 A;  3HTR A;  2DOG A;  3A1P A;  2F1L A;  2DYI A;  2QGG A; 
#chains in the Genus database with same CATH topology
 5EMN A;  3GVL A;  4QT7 A;  5FRO A;  2ESW A;  3OB9 A;  1W9X A;  3E1Y E;  4RDK A;  1AZG B;  3OYB A;  1YFN A;  4VUB A;  5L46 A;  2EYY A;  2Z0W A;  4DK0 A;  4C8Q B;  2FZC B;  3LVB A;  3MP6 A;  1DDI A;  3OYI A;  3BCF A;  4Z4U A;  4YEJ A;  2FYK A;  4AMC A;  2NPF A;  1TU0 B;  3VJP A;  2DYB A;  5LJ3 g;  3OKX A;  3M4Y A;  3ZZU A;  1E62 A;  3VNV A;  2YUQ A;  3MHP A;  1T0H A;  4NL3 A;  2RPN A;  2QA4 T;  3OYA A;  1VQL Q;  2YDL A;  2XU8 A;  2YHT A;  4J9C A;  4KUI A;  3OW7 A;  4ELZ C;  5I2S A;  4M1K A;  2ATC B;  1QFY A;  2L3P A;  2RHY A;  4AT1 B;  4XLC A;  1KSW A;  1OQK A;  4G5G A;  5D6W A;  4WZE A;  2AK5 A;  2XIC A;  1C1A A;  4QVC A;  1BK2 A;  4J0Q A;  4PKC C;  2EPD A;  1GRI A;  2L3S A;  3VU3 C;  4B44 A;  4PFO A;  4JUV A;  1VQL B;  1M3A A;  3W2I A;  1QP2 A;  2ED0 A;  3OJW A;  1B7T A;  2JNG A;  1B07 A;  2CZ6 B;  2DE0 X;  4DA4 A;  5CDF A;  3OYM A;  5IYW A;  2DK3 A;  2LQK A;  2VBV A;  2GK7 A;  4J9F A;  3VS7 A;  2VBU A;  1KQ2 A;  1N07 A;  3AGP A;  1WJS A;  2RHX A;  2DVJ A;  2LTO A;  1N9S A;  4XQ3 A;  2DET A;  1T6Z A;  3DB4 A;  2GQV A;  3CBM A;  2IVW A;  3MEA A;  1VQP Q;  3ME9 A;  3MP8 A;  4KH1 B;  1WOO A;  3V7C A;  3HL8 A;  2A7Y A;  2LJ3 A;  5FWC A;  1G3S A;  3JCM b;  2R57 A;  2Q6L A;  2BM0 A;  1EWY A;  3ZZ0 A;  5CO7 A;  3V7R A;  2K9G A;  4CC2 A;  4EDU A;  2KMT A;  3TRE A;  1KD1 U;  1VQN T;  2C4T A;  4X7C A;  4Z89 A;  3Q38 A;  4ROX A;  3V8L A;  1IHV A;  1VQP B;  3EHQ A;  3QII A;  4C8Q D;  2BF4 A;  3G4S B;  5FNZ A;  4XR6 A;  4XAX B;  4N3N A;  2DPP B;  4C0G A;  1H3H A;  1MMN A;  4P12 A;  4ASU A;  5TV2 A;  2EQM A;  1YBY A;  4CC4 B;  2LCC A;  1HA3 A;  3ZUG A;  3JB9 J;  1T3L A;  1BU1 A;  1UJY A;  3PTA A;  1AIP A;  3QWY A;  2RJE A;  2EBP A;  2RK1 A;  3W2F A;  1WOP A;  4ATO A;  3QSY A;  1X69 A;  2QDY B;  3M54 A;  1KC8 U;  2BTT A;  4ZN3 A;  2KRS A;  3M56 A;  1WA7 A;  2M0Y A;  3ZFJ A;  2HBP A;  4Z4Y A;  2QE7 A;  2CUD A;  3CCM T;  4DQK A;  4FXU A;  2X6X A;  1R8O B;  2GFA A;  1PNJ A;  1WSV A;  1AWJ A;  2K4Y A;  1SRL A;  5GAM e;  3G1J A;  4X1V A;  4QHY A;  2BPO A;  4ESR A;  1S72 B;  3MP1 A;  2V31 A;  1VQ9 T;  2J05 A;  1D8T A;  1IRX A;  4J83 A;  1W4S A;  1FWZ A;  2L2P A;  2CP7 A;  4PL6 A;  1XQH A;  1B34 B;  1UD5 A;  2EYQ A;  1BI0 A;  4M75 E;  1PJ7 A;  2D8H A;  3OAA A;  2EAY A;  4OPO A;  2EKO A;  1NJI C;  2Q6I A;  2QA4 Q;  1Y0M A;  3TU4 K;  4HVU A;  1PKS A;  1WOS A;  1PKV A;  1ZHI A;  5GAN f;  4Z4T A;  2E3H A;  5FLX E;  5I2M A;  2DL5 A;  3L2V A;  4O5V A;  1G7C A;  2DTO A;  3PUN A;  1LJO A;  4PC7 A;  3VS6 A;  1JXO A;  2KDS A;  3CB4 A;  1FMW A;  2QXF A;  3TVT A;  3JCM e;  4WZL A;  2RJD A;  1WHK A;  2QA4 B;  2BVN A;  4HE6 A;  2IIM A;  4RUG A;  4XN0 A;  3CCE T;  1IGQ A;  3EAE A;  1Q7Y D;  3HKS A;  3UA7 A;  3MET A;  2ED1 A;  3RER A;  2DNU A;  1R0C B;  3LQE A;  2PLF A;  1I8F A;  5M9O A;  2X0K A;  3EFO B;  2E6Z A;  4J9B A;  1U5S A;  4P9S A;  3GBQ A;  1GCQ A;  1GCQ C;  1GBQ A;  2K2V A;  5HZB A;  1QFZ A;  3P27 A;  5HY6 A;  2CUB A;  4X7F A;  2JJ1 A;  3T56 B;  2XHC A;  4FYX B;  2F69 A;  3MEV A;  2ZPI B;  2KI7 A;  4DNR B;  1QKX A;  1IO6 A;  1NBM A;  3S3N A;  5GAM h;  5I21 A;  4OMN A;  2WSC E;  4P6Y A;  3ZZT A;  4LDW A;  4A4F A;  2E1H A;  2WYR A;  5C6S A;  1VA7 A;  3M59 A;  4BE0 A;  3CCQ A;  2DIL A;  4QQ6 A;  2ZXI A;  3QZ5 B;  1M90 D;  3CCU T;  1OPL A;  1KQS P;  4BPR A;  3ES9 A;  3JB9 D;  3G05 A;  5E6T A;  3ZBD A;  2JTM A;  4P3I A;  3EG9 B;  3B8H A;  2P3M A;  4II3 A;  5HKK A;  4M75 A;  3WBJ A;  4M75 C;  2HNI A;  2V7V A;  2QTL A;  4TMZ A;  4PJL A;  4DBF A;  4QKU A;  3CCV A;  4NS5 A;  4PAB A;  4HT8 A;  5DLO A;  4AG1 C;  2KT1 A;  1OB0 A;  2V1R A;  2DXB A;  4ZGJ B;  4EMG A;  1WLP B;  5KYY A;  1VQN B;  4XTU A;  2QTV A;  2X4W A;  3V8K A;  3OYN A;  2GJP A;  4B6M A;  3Q3A A;  2YWG A;  5CIU A;  3O5Z A;  2OX7 A;  2RC6 A;  1V0E A;  2ZAE A;  5DY9 A;  3JCM h;  1KJZ A;  2WZN A;  4XU0 A;  3IQL A;  3OZU A;  1TUD A;  1U3O A;  4Q5W A;  2WJY A;  1QGY A;  4ZTJ A;  5KCO A;  2V4D A;  2MIO A;  1BB9 A;  2RC5 A;  2F2X A;  3L42 A;  2JUF A;  3DLL A;  2WSS A;  4HVV A;  4M77 E;  4HCB A;  2QI2 A;  2MOX A;  1Y0R A;  3VV0 A;  3E9F A;  3QYG B;  4RCY A;  3CCQ Q;  3CCR T;  3CCE A;  1SKY B;  2KQW A;  4ZTF A;  1I1J A;  2BIV A;  4C0D C;  4MYU A;  4ZCI A;  1JBM A;  1XOV A;  5D6X A;  2JN0 A;  5HKC A;  3QFT A;  2WAC A;  3FJO A;  1QWF A;  1HSQ A;  4XLH A;  3CCM B;  2QAS A;  3C12 A;  3O8V A;  1JJ2 P;  3CCV Q;  4DNT B;  4LDX A;  1T5E A;  1QGZ A;  1C6V X;  4E7J A;  4OB0 B;  2XZO A;  4BY6 C;  4X06 A;  5IHN A;  1X43 A;  2QQS A;  1QVP A;  3CC2 A;  1K73 R;  4OMM A;  5FWB A;  5FRN A;  2ENM A;  3RNJ A;  5KNL A;  1KQS B;  1VQ9 B;  4JJC A;  2OAW A;  4M78 E;  4JZ4 A;  1SHF A;  1M1K D;  3CME A;  2P4T A;  2K3Y A;  2IG0 A;  1BPL A;  2V8J A;  3CCU A;  1K8A R;  2VYT A;  1EP3 B;  8ATC B;  1PG5 B;  5GAN 4;  1ZUN B;  5DM7 R;  1KMH A;  4A4E A;  5KYY B;  2G3R A;  4C43 A;  1O75 A;  2YRV A;  3CC7 T;  3U6K A;  3CCE Q;  1O9S A;  2ABL A;  3QZ9 B;  2OBT A;  4P2N A;  1H8K A;  2F1L A;  5CK9 A;  3TQ7 P;  3QE2 A;  2NUP B;  1EFU A;  3WVE B;  4C0F A;  5IHK A;  1SRM A;  1WP6 A;  2DJQ A;  3NTI A;  4QVZ A;  3HAG A;  2O4X B;  4RCC A;  4DQ2 A;  4BDZ A;  3CCE B;  3OYE A;  3HPW A;  4UAJ A;  1VQO A;  2BM1 A;  4M77 A;  4JRK A;  2EQU A;  3CC2 Q;  2HSE B;  2C2W A;  4ACB A;  2ZPG B;  2GTO A;  3QDF A;  5IYR A;  4OML A;  1VQ6 T;  4RKU E;  3LYI A;  3CCS T;  1R0B G;  1H8E A;  2E5Q A;  6AT1 B;  1H64 1;  2BN4 A;  3TSW A;  3ZC3 A;  1ZBX A;  1JJ2 B;  3CCU Q;  4EMK B;  2X9H A;  5IYP A;  1MAB A;  3CC4 T;  4M75 F;  4MZT A;  3OY9 A;  4RTV A;  3G71 B;  2FX3 A;  2KK4 A;  1Q82 D;  2DXT A;  1D0X A;  2K6D A;  4XU3 A;  4KUL A;  1FX7 A;  1OUL A;  2K79 A;  1NG2 A;  3E9G A;  1W0K A;  1QH0 A;  2QGG A;  3W2E A;  5B6I A;  2MAM A;  4G1V A;  4X7D A;  3CMA T;  1G83 A;  3I35 A;  3CCU B;  3ULR B;  1S4M A;  4BE1 A;  4M78 A;  4X9D A;  2YRD A;  3E19 A;  4XM3 A;  4OVA A;  3WXM B;  2CSQ A;  3H0H A;  2ZPF B;  3E1S A;  1KK0 A;  3T53 B;  4YAL A;  3F70 A;  3A8K A;  3R6J A;  1E79 A;  5KE2 A;  3JCM W;  2ZL7 A;  5A88 A;  4XON A;  4MDW A;  4Q7J B;  2AZS A;  2F5K A;  1JA1 A;  4V2S A;  2RF0 A;  3NTH A;  1QCO A;  3JB9 H;  2FB7 A;  1N8R C;  3R6O A;  1E1Q A;  2D0Q B;  2HCK A;  2RD1 A;  2FO0 A;  2O31 A;  4OMO A;  3CTA A;  5CKE A;  4M7A C;  3J81 k;  4AF6 A;  3OW2 S;  2Y4X A;  4Z4R A;  1RAF B;  2HMA A;  3OFN A;  1RI9 A;  2A3L A;  2KRN A;  4AFQ C;  2DLP A;  2EIF A;  1N08 A;  4WF2 A;  2J7K A;  4DQL A;  3BNW A;  2QMU A;  3CES A;  4G7X A;  3CCR B;  2C06 A;  4HCC A;  4P22 A;  4QVA A;  5LJ3 f;  3HRS A;  4JPB W;  1NLP C;  4QQG A;  3MPU B;  5LJ5 f;  1R5B A;  4XMY A;  2F1M A;  2GF7 A;  1VQ6 A;  5GAO p;  3CCS A;  3X25 B;  2CND A;  2AZV A;  2OK8 A;  2HSP A;  1RQP A;  4LBZ A;  2ZGW A;  2V7X A;  3CC4 A;  2XID A;  1F20 A;  1UGP B;  1WHH A;  3GNG A;  2CBX A;  2GRE A;  5GAO m;  2A08 A;  1Q86 R;  5FU7 B;  2NUT B;  2OTL A;  3JQQ A;  5IHI A;  2ZL5 A;  1WHM A;  1WXB A;  2E70 A;  1YWO A;  1WZO A;  4NL2 A;  3PEN A;  1QG0 A;  4HCK A;  4PC6 A;  3CXC P;  1QVF P;  4ZCL A;  4E7I A;  2ZPH B;  2EYZ A;  2FG0 A;  4IUV A;  4LD6 A;  4R56 A;  1ZSZ A;  1PWT A;  3OEH A;  1KD1 D;  4M77 F;  1ZUU A;  3BY1 A;  4F04 B;  3CC7 B;  3VR6 A;  1WHJ A;  2QQB A;  3PE0 A;  4DOW A;  1YJ9 A;  4XU1 A;  2HKQ B;  2L0A A;  3BH4 A;  1KZL A;  5FO1 A;  1VQ6 Q;  2BSA A;  3CCS Q;  2D8J A;  1YI2 T;  4RJL A;  2NWM A;  2CZ0 B;  2JMC A;  2V26 A;  4XN3 A;  3CP2 A;  3OEE A;  4BI4 A;  4P26 A;  4RTW A;  3CC4 Q;  1NRK A;  5GAO n;  2X3U A;  2HCJ B;  2LZ6 B;  3WNC A;  2BE7 D;  1EX4 A;  2XNC A;  2W6I A;  4OPS A;  5IAY A;  2OTL Q;  5GAO l;  2F43 A;  2RM4 A;  4PFP A;  3BE3 A;  1ZUY A;  1KC8 D;  1VQ6 B;  5CAI A;  2QQR A;  3CCS B;  2P0P A;  2HAX A;  1BQE A;  4HA8 A;  2RQV A;  4M78 F;  1RLQ C;  1VIE A;  2KE9 A;  2DZC A;  3X28 B;  3A98 A;  4F17 A;  3CMA Q;  1TXQ A;  3G7Z A;  3V7S A;  2RI2 A;  2H8H A;  2P0K A;  1NJI U;  3PVD A;  3I55 A;  1DAR A;  2OYN A;  3INZ A;  4DK1 A;  1XE1 A;  4XKV A;  5GAM d;  2EIX A;  3OS1 A;  1HK9 A;  2RI5 A;  3LNN A;  1YJ9 Q;  3ASR A;  1WDT A;  2R9V A;  3EG0 A;  4Y28 E;  3SLN A;  4LDU A;  3CMA B;  2OK7 A;  1UB4 A;  4C8Q C;  3CXC B;  1QVF B;  3CBP A;  4DOV A;  4M7A F;  3RDV A;  2QEX B;  1Q81 C;  3REA B;  3NFC A;  4N4I A;  2WSF E;  2JS2 A;  4RDJ A;  4YXW A;  3WNB A;  1YHQ A;  3ZL7 C;  2A36 A;  1AHJ B;  4OB1 B;  2WJV A;  2RJC A;  3MJX A;  3AGQ A;  3PNW C;  4M75 G;  4F7U E;  4C5H A;  3RBB B;  2WR8 A;  5F4O A;  2OBS A;  1YIJ T;  3HP9 A;  4LDY A;  2XZL A;  4C5I A;  1CNE A;  3I55 Q;  1ABO A;  1W6X A;  3A8J A;  4XTW A;  2PUK B;  4UZF A;  1YI2 A;  3UDC A;  2X51 A;  4D6W A;  5LL6 S;  3OYC A;  4PC1 A;  1Q86 D;  1OU9 A;  3OP1 A;  1E6G A;  2GFU A;  4ME7 A;  1VQM T;  3OSS C;  2H3E B;  3CCJ A;  3ONY A;  1LNX A;  4JZ3 A;  5GAO q;  1M5Q 1;  2ZBV A;  2E5K A;  3OW2 A;  4XQF A;  2YXY A;  2Y90 A;  3OS5 A;  3SDZ A;  3CEY A;  2CYZ B;  4FIB A;  5KE3 A;  4UC4 A;  4O6J A;  5GAN d;  3RKW A;  1YHQ Q;  4M7D E;  2E4H A;  2CS7 A;  1JQQ A;  5KYW A;  3AHU A;  2MWP A;  3PUM A;  2YWE A;  2JT4 A;  1PSE A;  3TEE A;  1RAI B;  3VYH B;  5LJ5 g;  4LN2 A;  4P5N A;  2DO3 A;  3OJX A;  1GCP A;  1COW A;  7AT1 B;  3FJ5 A;  4IUR A;  1W87 A;  4RD6 A;  3EGD B;  3OOC A;  4ORZ A;  2XI9 A;  1QFJ A;  1YI2 Q;  1PHT A;  4KKT A;  4OF1 A;  5GAN j;  1JA0 A;  1UTI A;  4FN5 A;  2CSI A;  1E1R A;  3CCJ Q;  4F7U A;  2ZBU A;  4WZK A;  2PIA A;  4PC3 A;  2XDD A;  4M4S A;  2I1L A;  2EJF A;  4LC0 A;  2VJI A;  1OGJ A;  1QMC A;  4RD0 A;  1YIJ A;  1Q7Y R;  2ZL6 A;  1V5V A;  3DLM A;  3Q39 A;  3UA6 A;  1JRI A;  1BCO A;  4NNJ A;  1BYM A;  1M9S A;  4F7D A;  1UFF A;  2DL3 A;  4JRP A;  2DVE A;  2FL7 A;  1N06 A;  1MUZ A;  2FHD A;  4L6V 5;  4FU6 A;  4PJM A;  2RO0 A;  3CW2 A;  4B3X A;  2FZG B;  3I56 A;  2LCS A;  4M77 G;  1VQM A;  2DER A;  1UGR B;  3WND A;  3U2Q A;  1VLY A;  1V0F A;  1DG1 G;  3SKB A;  5KH6 A;  4ZGN B;  2R6H A;  4M7D A;  4L5G A;  3MO8 A;  4M7D C;  2E12 A;  4FW2 A;  5GV8 A;  4C5G A;  1YWP A;  2JM8 A;  4AG2 C;  3OYF A;  1M90 R;  3OMC A;  1WU8 A;  1GXI E;  1U06 A;  2E3I A;  2AIR B;  3EH2 A;  1OV3 A;  1BKB A;  1PRM C;  4HVW A;  2I0N A;  1B23 P;  2NLU A;  1V1C A;  3OYY A;  4G1B A;  3REB B;  1YIJ Q;  1BIA A;  2K7A A;  5KYX A;  2XOK A;  1BI2 A;  1TS9 A;  3JB9 I;  2Z6B D;  2PVO B;  4E6R A;  2LQ8 A;  2GK6 A;  2JDI A;  4LUD A;  4J6Y A;  4M78 G;  3JV3 A;  1JB9 A;  4DEX A;  1KJW A;  3VS3 A;  3OZW A;  1TWB A;  4N0A C;  2C4U A;  5TY0 A;  4P3Y A;  1WX6 A;  3A8G B;  4OP0 A;  3J81 E;  1ZM2 A;  3MMP A;  3I56 Q;  3T51 B;  1YIJ B;  1KRH A;  2EKH A;  1VQM Q;  3HRT A;  3KFV A;  1RQR A;  2V7U A;  3CCQ T;  3A8L B;  1BCM A;  2EFG A;  1YIT A;  3ZEH A;  1NZ9 A;  3GVK A;  4FYV B;  4IKF A;  2J6K A;  2RH2 A;  1IZ6 A;  1QCF A;  3VO2 A;  4M7A G;  1AT1 B;  2VWF A;  1WIE A;  3OPO A;  3CCV T;  1VOM A;  1GFC A;  1KFZ A;  2XDP A;  1YLO A;  1VQM B;  3W2H A;  5A2Q E;  1HJD A;  1Y96 A;  1W2B S;  3ASS A;  4PJO E;  3HRU A;  2C78 A;  5A89 A;  3NTK A;  2KRO A;  3SFM A;  5THX A;  2VNK A;  2W10 A;  3EGX A;  3VS4 A;  1NBE B;  1ABQ A;  2YUO A;  3QXE B;  2ZIT A;  1R5O A;  2XND A;  1NB9 A;  1GFD A;  1LOJ A;  2RQT A;  4PAA A;  4F7U F;  4B3G A;  2Y4Y A;  2JVV A;  1M1K R;  1TLL A;  5KYX B;  4A53 A;  2PU9 B;  3JQR A;  2EVR A;  1N8R U;  4EPC A;  1BJK A;  4Y9R A;  3AVV A;  1OYX A;  3NGP A;  3CCL A;  2KBT A;  2JZ2 A;  2O01 E;  1YIT Q;  5GAN 8;  1RAB B;  1T0J A;  4OB2 B;  5CR2 A;  2JN9 A;  1Q95 G;  2VBT A;  4CI0 C;  4JJN K;  4FYY B;  3NE5 B;  5GAN 3;  4DBR A;  2AHO A;  5DSZ A;  4C92 E;  2X4X A;  2HQH A;  1MRZ A;  1OHH A;  2EQK A;  2JIZ A;  1A8P A;  5GAN e;  2F2W A;  3H0I A;  2LJ1 A;  3CC2 T;  3OS2 A;  1JNY A;  4NCN A;  1E64 A;  4BI3 A;  4BE2 A;  2KNB B;  1U1T A;  3RKY A;  3CME T;  4M7D F;  3S6W A;  1ZBJ A;  3ASP A;  3GLX A;  1G3Y A;  3Q6R A;  1G7T A;  1ZLM A;  4E7K A;  2XD0 A;  4G6I A;  3FPP A;  2X6Y A;  4OP7 A;  3GP8 A;  1ELO A;  2SRC A;  4X0C A;  2K5I A;  1I18 A;  4PJO A;  4PJO C;  1B3Q A;  1U2R A;  4L59 A;  1Q82 R;  1M2V A;  4OMP A;  2RB6 A;  8AT1 B;  2DY1 A;  2VKN A;  3ER0 A;  4AFS C;  4JMQ A;  2B8A A;  1UHF A;  2VB6 A;  5CQY A;  1H8H A;  4J8O A;  1GAQ A;  3QSU A;  2PTK A;  1VQO T;  3PT9 A;  1ZA1 B;  4XU2 A;  2WZP P;  1N5Z A;  1OX8 A;  3AVY A;  4M4Z A;  2OI3 A;  1WNL A;  3CPW S;  2JXB A;  2E41 A;  4FW1 A;  3VS5 A;  4B3F X;  1SKQ A;  1QVG S;  4Z88 A;  3A1P A;  2F5T X;  1H85 A;  3A8H B;  5LJ3 d;  1OI1 A;  4C92 A;  4F16 A;  4C92 C;  3MEW A;  3C0C A;  1RI0 A;  2WPD A;  4RG2 A;  4DBH A;  2BV3 A;  4E7S A;  4X9C A;  1PJ6 A;  5GAN h;  5GAM g;  2DF6 A;  5IN1 A;  1K73 C;  2KEA A;  2JM9 A;  4NBS A;  1G7S A;  4PGO A;  3A5Z B;  3CCQ B;  4XL9 A;  4RPB A;  1ACM B;  1WXT A;  1Y57 A;  4FCY A;  3JCM V;  1K8A C;  9ATC B;  1VQ5 A;  3OYJ A;  2LCL A;  1IJE A;  2VZL A;  1VIF A;  3PFS A;  1T3S A;  4M75 B;  2X3W D;  1K9M U;  4KRT A;  1PC0 A;  4YAF A;  1GJR A;  2BZ8 A;  5TRD A;  3CCV B;  5LJ3 j;  2X6W A;  2PNI A;  2XMF A;  4RD3 A;  4IIM A;  4EMK C;  3VUB A;  4LE9 A;  1AWW A;  3X20 B;  4XOP A;  1M3B A;  2EYW A;  2EGA A;  4PJN A;  1E63 A;  1Q81 U;  1D1N A;  2CKK A;  3I1F A;  1NJI D;  2DMO A;  1UEB A;  3VYG A;  4A54 A;  5BSX A;  2GBQ A;  1VYU A;  1M8V A;  3TSZ A;  4RCB A;  1S1N A;  5GMK j;  1D1B A;  4HT9 A;  2BKD N;  1UD2 A;  3ISX A;  3JCM g;  1W2B A;  5KYU A;  5FL7 A;  1BX1 A;  4M7A E;  5CKF A;  3ASQ A;  3SWN A;  3KXT A;  3SWN C;  1WGS A;  4TMW A;  4KGZ B;  3BFM A;  2FZK B;  2DL4 A;  2ECZ A;  4E2F B;  1FDR A;  2NUZ A;  1YJN A;  1A0N B;  5J3O A;  4C0D B;  2LDM A;  3AVW A;  1VQ5 Q;  1KD1 R;  1WPC A;  1WDX A;  2L8D A;  4JS5 A;  4XD7 A;  1PCX A;  3DKM A;  3G6E A;  2DIE A;  2L5Q A;  3CME Q;  3TCJ A;  2B7B A;  2P0Q A;  2E6N A;  2E65 A;  4BY6 B;  3MCA A;  4PJO F;  1I07 A;  4Y9U A;  3WBK A;  2CC2 A;  4AF7 A;  2HL3 A;  2OTL T;  1X27 A;  3CC2 B;  4F7U G;  2FVU A;  1NB0 A;  1UDL A;  2GGR A;  4M2L A;  4X05 A;  3CME B;  2GTJ A;  4F14 A;  1K76 A;  2BE9 B;  3NMZ C;  1KC8 R;  3SJP A;  5CKB A;  2GPJ A;  5KYN A;  4N3G A;  3W2G A;  2VNI A;  1E3X A;  2HDA A;  5GAN 5;  2KXC A;  1WI7 A;  5IYQ A;  4TKO B;  1YJ9 T;  1YJN Q;  4MYT A;  1VQO Q;  1IB0 A;  1N6A A;  4M75 D;  2F4N A;  1WSR A;  1GO2 A;  3KL9 A;  1F60 A;  1JO8 A;  1OZ3 A;  1TUC A;  4Z02 A;  2CZ1 B;  2DEU A;  2LQN A;  3CD6 A;  3OQ5 A;  1VQK A;  4II2 A;  1KK7 A;  3M4G A;  3G6E Q;  1WJR A;  2X85 A;  3OE7 A;  5FU7 C;  4KKS A;  4RG8 A;  4HXJ A;  2X4J A;  4C92 F;  3V76 A;  4PC2 A;  1NDH A;  2YWH A;  4M7A A;  3OS0 A;  4XTX A;  4M7D G;  3MEU A;  3E20 A;  1R5N A;  1QQJ A;  1VQO B;  3VS2 A;  3LX7 A;  4M77 B;  4XLA A;  5D6Y A;  4LUE A;  1TSF A;  3OYL A;  1QUF A;  1ZM4 A;  2MMP A;  2GCX A;  4C0Z A;  4KUD K;  1DJ7 B;  2H3J A;  1YP5 A;  2C0I A;  1E6H A;  2QK0 A;  4RTY A;  5HK3 A;  2NV4 A;  4L8J A;  1I8D A;  1FYN A;  2DTH A;  2FPE A;  2XEX A;  3I55 T;  2CP6 A;  2X35 A;  2CH4 W;  4A4G A;  2M02 A;  4FSS A;  2KYB A;  3MCA B;  1UGS B;  2RHI A;  4X34 A;  3RIR A;  2M1H A;  1RAH B;  2HEQ A;  2K5L A;  2KAF A;  4J7F A;  1Q86 C;  3CPW A;  3BDU A;  3LGL A;  4LD9 K;  3A3G A;  4XOT A;  1UGV A;  2DFU A;  3A8O B;  2X53 S;  1K1Z A;  1MMD A;  3UT1 A;  1K0X A;  1QVG A;  1VF7 A;  4B43 A;  1PKT A;  1RL2 A;  4Z4W A;  4BI8 B;  5AYF A;  3RKX A;  3CD6 Q;  3B82 A;  1MV0 B;  1ZQ1 A;  3URG A;  1VQK Q;  4M78 B;  1K28 D;  1FMK A;  2LVM A;  4TT3 A;  2VBS A;  1ZX6 A;  3FDR A;  4LDV A;  1YJW T;  2VGM A;  4WWV A;  2PUO B;  4C8Q E;  1EP2 B;  4XLE A;  1YN8 A;  2K2M A;  2YWW A;  3QYH B;  1YHQ T;  3EG1 A;  2B86 A;  1I0C A;  4KH0 B;  3HTR A;  1X01 A;  3SD4 A;  4QUZ A;  3RMS A;  1AMO A;  2BGJ A;  4IW3 B;  4R55 A;  1VHO A;  5LJ3 e;  4TMX A;  3GIR A;  3A3B A;  5LJ5 e;  2OJ2 A;  1WYX A;  4RTX A;  4KBM B;  4HE5 A;  3M0U A;  4M7A B;  1XJW B;  2EYX A;  2I2L A;  5GMK m;  3PA1 A;  3THK A;  4DEY A;  4IUU A;  1MMA A;  1UEC A;  4QW2 A;  4ZV4 A;  1D3B A;  2DX1 A;  4GY5 A;  3FIF A;  5GMK e;  3GVJ A;  4Z1M A;  4U9U A;  5L8R E;  3CCJ T;  2A37 A;  1Y0Y A;  5FW9 A;  3DB3 A;  3P26 A;  2DTI A;  1OU8 A;  3FB9 A;  4LNP A;  3DDY A;  2QYZ A;  4XTV A;  4UZE A;  4WQM A;  4M77 D;  1NEG A;  3H6Z A;  3PIP A;  1EFT A;  4J9I A;  4B9X A;  3H9N A;  5FU6 C;  1KTV A;  4FWT A;  3J80 E;  2ZTN A;  3WY9 A;  4FSX A;  3CC4 B;  2PVG B;  1BI1 A;  3QJ6 A;  2KY9 A;  1VQ8 A;  2ZZF A;  2OTL B;  2DIQ A;  4PJJ A;  4PFZ A;  1YCY A;  1IGU A;  1X6G A;  4XTY A;  2PZ1 A;  2YWF A;  5DLQ E;  2DIG A;  3ZIA A;  4IUQ A;  1FRN A;  2BGI A;  4QQD A;  4C8Q A;  5GMK l;  4N4H A;  1WQ7 A;  1ZSZ B;  1YJW A;  4M78 D;  2AT1 B;  1CQX A;  3AST A;  5FA6 A;  1IJF A;  2BMW A;  2JOY A;  3VRY A;  1YJ9 B;  5LJ3 h;  2VJJ A;  5HCK A;  2SEM A;  2D9R A;  1V29 B;  2RMO A;  1CKB A;  3M53 A;  4PK4 A;  4PJO G;  3LW5 E;  3S3O A;  3R6N A;  2AHJ B;  2K57 A;  4GBQ A;  1W35 A;  2E1R A;  4II1 A;  4KT0 E;  3SJZ A;  4E7Z A;  3BCD A;  2ZZE A;  1WOR A;  1QKW A;  5GMK h;  1N8R D;  1LVK A;  2ZPB B;  2C5B A;  3M57 A;  5CVI A;  1VQ8 Q;  4M7A D;  1HYO A;  2FPF A;  1GAW A;  4Y92 A;  4JLG A;  1RLP C;  2HDN B;  5CKD A;  3EG2 A;  4YAO A;  1SG5 A;  3I56 T;  3EGU A;  3CPX A;  2VV5 A;  4OMF B;  1G2B A;  4BUG A;  4IUT A;  3GF5 A;  3OYK A;  3J7A F;  1VQL A;  2XNJ A;  3I55 B;  2CGH A;  1FNB A;  1T6Y A;  2ROT A;  1CSK A;  5GJV B;  1N0V C;  1YJW Q;  5A0L A;  3OA6 A;  1IB8 A;  3H0F A;  1WTH D;  4XNF A;  1SSF A;  4C92 G;  2K5F A;  4BDY A;  3LH0 A;  1X6B A;  4M0L A;  4TSF A;  3BY2 A;  2KVO A;  2FRW A;  5J3B A;  5H5J A;  2XDB A;  2D6F A;  5IXF A;  4ZGQ B;  1RAD B;  4B9W A;  1TTT A;  4J5Y A;  1YJW B;  1AD5 A;  4Z4S A;  3JU4 A;  1FXX A;  3QUI A;  1VUB A;  4RDL A;  2PQW A;  1YHQ B;  2VXF A;  2P84 A;  3L1A A;  3M0S A;  3JSC A;  4MMK A;  3RMQ A;  4YAW A;  2V8K A;  1M1F A;  2KT8 A;  3LLR A;  1VQP A;  3G4S A;  1KHI A;  3B78 A;  3Q1J A;  1Q7Y C;  1RAC B;  2LMJ A;  2FEI A;  3PGG A;  4XKW A;  4OMQ A;  4FT2 A;  2DYI A;  1QP3 A;  2KXD A;  1P92 A;  1YIT T;  4D8K A;  3H8Z A;  3HSB A;  2MYS A;  1UUE A;  2COW A;  2L89 A;  4E0F A;  4HCZ A;  1YI2 B;  1K73 U;  2HQE A;  2M0O A;  2EQI A;  2KGT A;  2QQA A;  3VS0 A;  2C5H A;  1UD6 A;  5AN9 A;  2B5O A;  5GV7 A;  2O2O A;  4XK8 E;  1VYV A;  1I4K 1;  3CCJ B;  1K8A U;  2LT4 A;  3QFR A;  1ARK A;  1TTH B;  4JS4 A;  1MND A;  1TH7 A;  3HFO A;  3OW2 B;  3OYG A;  1D0Y A;  1MMG A;  4MZP A;  2LRQ A;  1KQS S;  2CP3 A;  4TMV A;  4QFM A;  3H94 A;  1OEB A;  5FO0 A;  5HZA A;  2MWO A;  2DCU A;  4C8Q F;  1G3T A;  1M90 C;  2LC4 A;  1QGA A;  4LBY A;  2QTZ A;  3KUF A;  4X8I A;  5KYW B;  4TVR A;  4GLM A;  2L3Q A;  5F4J A;  1EP1 B;  1S72 A;  2GJR A;  3G4S Q;  2KSS A;  4J9E A;  5IH2 A;  1SEM A;  1FNC A;  2V8I A;  3V7A A;  2XGJ A;  2E10 A;  3QFS A;  1T6X A;  2HZY A;  2FPD A;  3CCL T;  1F1B B;  1X2K A;  1D09 B;  4YHB A;  2M16 A;  5F4M A;  1B34 A;  1BLI A;  1K9M D;  3CMM A;  1YNZ A;  3M0P A;  3ZBT A;  2FVG A;  3ZBU A;  1QX4 A;  1MGQ A;  2RN8 A;  2HBW A;  2D74 A;  2HL5 C;  5IK2 A;  5GAM f;  4MDX A;  2E1B A;  1K4U S;  2C0O A;  2VC8 A;  2VUB A;  4FL6 A;  4F7U B;  1PSF A;  1Q81 D;  4ZCM A;  1FRQ A;  2OBR A;  1OPK A;  4N0A A;  1Y7X A;  1EFN A;  4Y91 A;  3ONU A;  4KKU A;  4RD2 A;  2GQI A;  1UD4 A;  3C95 A;  4DBQ A;  4B4D A;  1FMV A;  1LPL A;  3PMI A;  2QA4 A;  4P1V A;  1EZZ B;  1JJ2 S;  3MKD A;  1D1A A;  2HLD A;  2YUP A;  4N4G A;  3M55 A;  4JJB A;  1TUG B;  4YAU A;  1S72 Q;  1N0U A;  2LZJ A;  4BAC A;  3CPF A;  1AWO A;  2J6F A;  4K11 A;  1VQ4 T;  4A4H A;  2GQF A;  3EFO A;  3L2Z A;  1VQ7 T;  2BZY A;  3I56 B;  1I81 A;  5J39 A;  5TR9 A;  4AFU C;  2XZP A;  3GIB A;  1NYF A;  1K0S A;  3OBY A;  1N27 A;  1K9A A;  5KW9 A;  5A0G A;  2YLC A;  3JCM f;  5CKH A;  4ZN1 A;  1AEY A;  1IRE B;  2VVK A;  3I5S A;  5H59 A;  4JRI A;  4M7D B;  3QWX X;  1IHW A;  3FC3 A;  2AKK A;  1ZA2 B;  2COY A;  1CNF A;  2QTX A;  1M1K C;  2K3B A;  2DD5 A;  2QDL A;  1RAE B;  1G8X A;  3VUZ A;  3QDR B;  4KGV B;  3QKJ A;  1XTD A;  1C0M A;  2L3R A;  4Y7C A;  1TG0 A;  3W5H A;  4Z4V A;  3WQZ A;  1SSH A;  2ZTG A;  2A0F B;  3U6B A;  1BI3 A;  5GAN 2;  3EG9 A;  1Y71 A;  1AWX A;  1G7R A;  1VJS A;  1M2O A;  3VO1 A;  1EIF A;  3FRN A;  2W6J A;  3W5U A;  2J06 A;  3FPK A;  3KBG A;  1QLY A;  1SPK A;  3JAM E;  2W0Z A;  1NJI R;  2RK2 A;  3L2U A;  5CCA A;  5LMZ A;  1JXM A;  1VQN A;  2EWN A;  5BSY A;  1MHN A;  1H42 A;  1HD3 A;  3I9Q A;  5DN6 A;  1XB2 A;  3BQJ A;  2QDX A;  5KSW B;  2ROL A;  2DAQ A;  2ZXH A;  4X07 A;  2VGN A;  1P4M A;  4C5E A;  3LWI A;  1OX9 A;  1M1G A;  2EGC A;  2D3L A;  1YIT B;  3M58 A;  1VQ5 T;  1Q9S A;  1Q86 U;  1MV3 A;  1Z9Z A;  4K1X A;  4P25 A;  2KR3 A;  4PLL A;  3JB9 F;  1AVZ C;  3OBW A;  1FND A;  3M9Q A;  1X75 C;  1MNE A;  3SLD A;  2M9U A;  4Z8A A;  3VNU A;  4XOR A;  2V7W A;  1AOJ A;  1D0Z A;  2CP5 A;  2P4R A;  1Y96 B;  1Q82 C;  3R6K A;  2MI6 A;  1XNI A;  4WTO B;  4LXC A;  1IXD A;  3A8M B;  3G71 T;  1VQ4 A;  4OOV A;  1EXM A;  4OGE A;  3MHX A;  3BC9 A;  1I5L A;  4ZGD B;  3CCL Q;  1VQ7 A;  4R0K A;  3P8D A;  3EGX B;  3CCM A;  2DM1 A;  3BY7 A;  1SM4 A;  1JEG A;  2LNH B;  4XTZ A;  1GR1 A;  1RAG B;  4OPV A;  2CP0 A;  1I7P A;  2CW5 A;  3P8H A;  2COZ A;  1VQN Q;  5IT9 E;  4IIO A;  2JTF A;  4X7E A;  1KQS A;  2CRE A;  2KRM A;  1VQ9 A;  3WYA A;  3ZPN A;  2VNH A;  4M7D D;  4A4K A;  3L2Q A;  1WFW A;  4J7I A;  1RAA B;  2K3X A;  1VYT A;  2ZZG A;  3CCL B;  1M8M A;  1NYG A;  1YJN T;  5L23 A;  4J6W A;  1V76 A;  1WQW A;  2JJ9 A;  3T9N A;  4JRQ A;  1W1F A;  1UMK A;  4C0S A;  2R5M A;  1GBR A;  1OZ2 A;  4NOY A;  2LQW A;  5I22 A;  2AKL A;  3G6E T;  4RD4 A;  2DRM A;  3EFS A;  2RQW A;  4FM4 B;  3JCM c;  3LH5 A;  5GAO r;  3UPU A;  2OTJ T;  2MPX C;  3GPL A;  4C8Q G;  4J9G A;  4RPD A;  2BZX A;  1ZM3 A;  1XFO A;  2GJK A;  1N9R A;  1VQ4 Q;  2NUP A;  5LJ5 d;  2A28 A;  1M27 C;  1SKU B;  2EJG A;  1VQ7 Q;  5HK0 A;  3W5V A;  3CCM Q;  5GMK i;  3X24 B;  4BB7 A;  5A8A A;  2JJ2 A;  2LX7 A;  4ZNX A;  2O4X A;  1CKA A;  2X4Y A;  3LWH A;  5FRM A;  5EC7 A;  4ZGE B;  4AVZ A;  1QCN A;  2HKN A;  2OAU A;  3RUX A;  1QWE A;  5FIU A;  1VQ9 Q;  2ZZQ A;  1VQ4 B;  1PJ5 A;  5IXB A;  2DXC A;  1GL5 A;  2DBK A;  2J6O A;  1VQ7 B;  4PJO B;  3E2U A;  5CQX A;  1JJ2 A;  2M5S A;  4EMK A;  1M2V B;  5LJ5 j;  3WVD B;  3G71 A;  2DJZ A;  3CD6 T;  1VQK T;  2R5A A;  3QJY A;  1PD0 A;  3CXC S;  1QVF S;  4RD1 A;  2NYS A;  1M30 A;  3X26 B;  2XG8 D;  4JJD A;  1RUW A;  3SHW A;  1IHM A;  2RA2 A;  1W2B P;  2V7T A;  1PM3 A;  3LO8 A;  1AZE A;  2QAZ A;  2YSQ A;  1W34 A;  5D7U A;  2HD0 A;  2DBM A;  3QG1 A;  1KD1 C;  4B48 A;  2LJ0 A;  3HHT B;  3GQB A;  3EFR A;  3WXM A;  3FLG A;  3H41 A;  2VYQ A;  1NLO C;  4GQN A;  1KQ1 A;  4ANJ A;  3PIO A;  2DOG A;  4C92 B;  2DKG A;  1UD3 A;  4A63 B;  4YEL A;  2V1Q A;  3GSI A;  4RTU A;  1UE9 A;  5GAN g;  2OTJ A;  3I5R A;  1I5O B;  1UJ0 A;  1U1S A;  1EFR A;  5GJW B;  4Z4Z A;  1OB5 A;  3G71 Q;  2R58 A;  3FKS A;  3EH1 A;  2V7Q A;  2O9S A;  5HXB A;  1KC8 C;  3EHR A;  1VQ5 B;  4M77 C;  3AVU A;  5IYN A;  2XK0 A;  3GOX A;  2JS0 A;  4E7H A;  3M5A A;  3CCR A;  3FEO A;  2O9V A;  2PMD A;  1B2R A;  1E3Z A;  4JDS A;  3M0T A;  1TVC A;  3NPF A;  1SF9 A;  2GNC A;  3PVL A;  4LBW A;  1FX0 A;  1OB2 A;  1H92 A;  4UZU A;  2KVQ G;  4HIZ A;  2ZCF B;  4YTL A;  2MK5 A;  1D1C A;  2YT6 A;  4OOS A;  1WHG A;  4PJO D;  1WHL A;  1ZUK A;  1SHG A;  2VNJ A;  3KEW A;  1W2B B;  5KYU B;  1U8R A;  1GVH A;  2RHU A;  4E7L A;  3S3M A;  3AT1 B;  4OOX A;  4J6X A;  3PMT A;  3EG3 A;  2DXU A;  2NUT A;  1OOT A;  1KHC A;  4E47 A;  4M78 C;  3JCM P;  3VS1 A;  1Q7Y U;  3QPH A;  3SWN B;  1KK3 A;  2OTJ Q;  3JB9 G;  2QEX T;  1X6O A;  1JU5 C;  4LBV A;  2DL8 A;  1E7O A;  3UAT A;  5KCH A;  5J26 A;  1YJN B;  4WZT A;  4J9H A;  3OMG A;  2KYM A;  1BX0 A;  1BMF A;  1NE8 A;  4OGC A;  1G5V A;  1J9Z A;  5I11 A;  4G7W A;  2BUD A;  2LT1 A;  4EIK A;  5DS0 A;  3RY8 A;  3G6E B;  3CP8 A;  1QW1 A;  2RQR A;  3CCR Q;  3CC7 A;  1ZM9 A;  2OTJ B;  2DL7 A;  2MCN A;  3QFC A;  4P6V F;  4RM0 A;  2DRK A;  2X8K A;  2QG9 B;  3CPW P;  1VQ8 T;  4MZM A;  4C92 D;  1YCS B;  1QVG P;  3PVQ A;  1M90 U;  1N8R R;  2CH4 A;  3JQP A;  1BBZ A;  2C77 A;  1DDG A;  1K73 D;  3U23 A;  2J7I A;  3SB2 A;  4RLZ A;  4EMH A;  3JCM J;  2ZPE B;  3QBY A;  3QHS A;  2YRC A;  1UGQ B;  4KGX B;  3FJP A;  1K8A D;  3JCM Q;  4XLF A;  1PRL C;  4FYW B;  2WSE E;  5C0M A;  3CBO A;  3GNF B;  1D2E A;  1JB0 E;  4TN1 A;  1EFC A;  5JBQ A;  2D3N A;  3CD6 B;  2YLB A;  1VQK B;  2RNA A;  5J35 A;  2DEQ A;  2CF4 A;  3A35 A;  1YX2 A;  1X2Q A;  2B7C A;  3CC7 Q;  2YUN A;  2QQ9 A;  4CRI A;  3RR6 A;  1KIK A;  2PE3 A;  4CC3 A;  3LGF A;  1FNM A;  1XQB A;  3UWN A;  1TUI A;  1TOV A;  4IUP A;  3M0R A;  3CMA A;  1N05 A;  2JMA A;  1LCK A;  1G3W A;  3SEJ A;  2LP5 A;  3SEM A;  1UHC A;  2HQX A;  3CXC A;  1QVF A;  2ZZD A;  2RQU A;  2QEX A;  1WJQ A;  2LX9 A;  2CRV A;  2CP2 A;  1ZSZ C;  2EJ9 A;  4RMO A;  3L2R A;  2G6F X;  3ASK A;  2D9T A;  4M53 A;  1VQL T;  5ECA A;  4OB3 B;  4B47 A;  4CQJ A;  1WXU A;  2VAS A;  2DZ9 A;  3NHN A;  2QGF B;  1KK1 A;  1Y07 A;  2RJF A;  3V8J A;  2PVD B;  1NM7 A;  3CPW B;  4J9D A;  3L2W A;  2DD4 A;  2CDT A;  2VXE A;  3D26 A;  1WPY A;  3CQT A;  3AVT A;  3D7S B;  3A8I A;  3UF4 A;  4BD3 A;  1QVG B;  3LQ6 A;  1KG1 A;  3N5B B;  3C94 A;  1UD8 A;  2MF2 A;  4MML A;  4EH1 A;  5EG2 A;  3CRZ A;  2QN6 A;  1VLO A;  4QV2 A;  1J3T A;  1W70 A;  1M1K U;  2JTE A;  3M0Q A;  2O88 A;  3OZV A;  2E64 A;  3OYH A;  4PNO A;  1UG1 A;  3OYD A;  2RI3 A;  2Q6K A;  4FT4 A;  4TMT A;  4WCI A;  5A0D A;  2CK3 A;  1NPP A;  1M3C A;  2X3X D;  1HXD A;  1PD1 A;  4CC7 A;  2D0N A;  1VQP T;  4RCZ A;  3Q6Q A;  3RES A;  2QEX Q;  3G4S T;  3QO3 A;  4JLI A;  2Q6O A;  4FK8 A;  1BIB A;  4ACA A;  2IPO B;  4RTZ A;  3VMF A;  4QVJ A;  2CZ7 B;  3C4S A;  4PLI A;  2CT4 A;  4QVD A;  1K9M C;  2D1X A;  5LJ5 h;  3VRZ A;  3AVX A;  1NEB A;  2EQJ A;  1QUE A;  1H3Z A;  1NPR A;  4HKE A;  5GAN 6;  1HVX A;  4ELY C;  1D3B B;  2DA9 A;  5GAN 7;  1Z9Q A;  2EFI A;  2RHZ A;  1R77 A;  2F2V A;  1K9M R;  3BW1 A;  3P8B B;  3JRZ A;  1M4Z A;  1W0J A;  2XKO C;  1OGI A;  3OSV A;  3EGD A;  4R71 A;  4AC9 A;  3VKI A;  4D8D A;  1S0U A;  3PA2 A;  3BDL A;  1ZSG A;  4RTT A;  4AFZ C;  5GAM j;  1E43 A;  4H9G A;  1Q81 R;  2FRY A;  2JW4 A;  3JCM X;  2LNV A;  2M51 A;  3OW2 P;  5FU6 B;  1VHE A;  1Q82 U;  4GLK A;  1KK2 A;  2EW3 A;  5AT1 B;  3JCM d;  1S72 T;  2CT3 A;  3HFN A;  2C0T A;  1VQ8 B;  1HZE A;  2EGE A; 
#chains in the Genus database with same CATH homology
 3H9N A;  1PM3 A;  3HTR A;  2DOG A;  3A1P A;  2F1L A;  2DYI A;  2QGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...