2DYIA

Crystal structure of 16s ribosomal rna processing protein rimm from thermus thermophilus hb8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
162
structure length
162
Chain Sequence
MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 16S ribosomal RNA processing protein RimM from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ribosome
molecule keywords Probable 16S rRNA-processing protein rimM
total genus 31
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2dyiA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2dyiA01
2F1LA 2DOGA 3HTRA 3A1PA 1PM3A 2DYIA 3H9NA 2QGGA
chains in the Genus database with same CATH superfamily
3FJ5A 2WZNA 5HK3A 1N0VC 1PRMC 3OJWA 2B8AA 1I4K1 1UD2A 1HVXA 4HKEA 3EG0A 2C78A 3QE2A 1Z9QA 5D6WA 4Z4TA 4ELYC 2ZAEA 5LJ3d 3JCMJ 3JV3A 2LRQA 1FWZA 3U6BA 1G3YA 3PENA 2ATCB 2HKNA 4X34A 2JJ2A 4X7DA 5D7UA 4BD3A 3VS1A 3HAGA 3W5HA 3CBOA 2ZTNA 4OB2B 4XTWA 1GVHA 3VKIA 2YUPA 3C0CA 4J9DA 3RDVA 3FJPA 1VQPT 1MMDA 2X6WA 3I9QA 4OPVA 1VQ4T 2CUBA 3A8LB 2K5LA 2OK8A 4FN5A 3SWNA 4MDWA 4YEJA 1TVCA 3PTAA 4ESRA 4M7DE 2BGIA 3X24B 1G7SA 1UB4A 3QJ6A 1PJ7A 2K7AA 2CKKA 3OW2A 1VQKT 2ZL5A 5L23A 1GR1A 3CXCB 3WY9A 2K9GA 4IKFA 4JRQA 4UZFA 3W2GA 3VS5A 4LUDA 4N4IA 2QEXT 3BCFA 2QASA 2C2WA 5IYPA 5FRMA 4XONA 4IURA 3UA6A 4ACBA 3SD4A 4C0GA 3JCMb 1M90C 4OOSA 5IH2A 5CKDA 4H9GA 1QP3A 4A4GA 1VQOT 1RQPA 3ASTA 4QUZA 1VHEA 4X7EA 1M1KD 2DPPB 3E1SA 2J7KA 2LQNA 2LQWA 3MHPA 3EG1A 3RKWA 2XK0A 1SKYB 1QKWA 4P9SA 5TRDA 4G7XA 5H5JA 4N0AC 4M77F 5KE3A 1VQOB 2AT1B 2ZL6A 2ZZFA 3GQBA 1LCKA 2JIZA 2JN9A 4FW1A 3VU3C 1AHJB 2BF4A 4DBHA 3JSCA 1UE9A 3MCAA 1YI2B 2QEXB 1AD5A 3MEAA 1AWOA 5FROA 5FO0A 1H85A 2L5QA 2EIXA 3CTAA 4QVDA 1D0ZA 1K8AC 1BX1A 1FMVA 2DTHA 1LOJA 1TS9A 1Y7XA 3ZC3A 4LUEA 1N07A 1FNCA 1M90U 4WQMA 4Z4RA 1R0BG 1SKUB 3NTKA 1NLPC 5A0DA 3CB4A 4LBYA 2Q6OA 1WQWA 1UHFA 3EFOB 3C12A 4ZV4A 2DL7A 2HD0A 2LQKA 2RQUA 2EJFA 4Z4UA 5AN9A 5FU7B 2GJKA 2RQWA 2X85A 3SLDA 4C5IA 4UZUA 5C6SA 2ENMA 4D6WA 4XTVA 5THXA 2W10A 4FW2A 3BCDA 2CF4A 4HVWA 4M77D 1H92A 3TSWA 1Q7YR 2BMWA 2PVDB 3JB9I 3W2FA 1WLPB 2P0KA 2H8HA 2O2OA 1OPKA 3KL9A 2LC4A 1G7TA 1VQLA 2R9VA 2EKOA 3QG1A 4LBZA 4XLEA 1N6AA 5TY0A 4MYUA 3SWNC 3P27A 1Z9ZA 3CMAB 1TTTA 2XDBA 2DEUA 4OOXA 2B5OA 1D0XA 1KD1D 5FO1A 1VQ9Q 4M4SA 3I56B 2G3RA 3CCQB 2V7UA 5CCAA 2EYXA 1IHWA 1QLYA 4J6WA 4GQNA 5IHNA 2I2LA 2CT3A 2X3WD 1TUGB 1SHFA 3A5ZB 2CP2A 1Y71A 3R6OA 4XU1A 1VYVA 3A35A 1RL2A 1VQOA 2FG0A 5GAOr 5M9OA 3GNFB 1OOTA 3BY7A 2EAYA 4FYVB 2KSSA 1QCNA 1D1CA 3OMCA 4XU0A 2C77A 2LX9A 4XOTA 4FU6A 1VIFA 3Q6RA 2MIOA 1SKQA 2K4YA 5GAOl 4AFZC 1NRKA 1IXDA 3JCMe 5GAN2 1VQLQ 4X7CA 1Q86R 1BIBA 1EFUA 3RUXA 3CCST 1VQ8T 2XGJA 4BY6C 4RTYA 4B6MA 3RIRA 4X0CA 2D6FA 4OVAA 3TSZA 1VF7A 3PT9A 1YWPA 1AMOA 3OOCA 3L2WA 2DXBA 2VNIA 2WSSA 1PWTA 1VQ9A 2XIDA 4C8QC 4OB0B 3G4SA 2XKOC 1DJ7B 3AVUA 3CCSB 1VQ8B 3THKA 1CNFA 2YRDA 3CCQQ 1YJ9T 2QN6A 2DLPA 3CESA 5GAMe 1U1TA 3JCMP 4M78A 1A8PA 4M7AG 5J3BA 5LJ3g 3X20B 4FIBA 4X1VA 3I55B 3V7AA 5KCOA 1KQ2A 2M9UA 2F1MA 1G83A 1SSHA 4II1A 3SFMA 1KC8R 4ZN3A 1BI1A 1K8AU 2RQTA 3FB9A 3QO3A 1G7CA 4ZCMA 3M54A 2XEXA 3ZUGA 2ZCFB 3ZFJA 1QVGA 4RM0A 3A3BA 3OSSC 3QHSA 1YJWQ 3A1PA 1PKTA 4F7UE 2AKKA 1WHJA 3CCRQ 4PJOG 1NDHA 2JJ9A 2QA4Q 2GNCA 1NBMA 3G7ZA 3LGFA 5J35A 3CCEA 3LH5A 5A8AA 5HZAA 4YAWA 1AWXA 3CEYA 4BE0A 3MMPA 4OGCA 5B6IA 2NUPB 1WNLA 2EJGA 4QV2A 1NJIU 4FT4A 5KYYB 1FDRA 1C1AA 1F20A 1WOSA 4B43A 3BY2A 3QBYA 2FZCB 1Q82R 3H94A 3EGXA 3A8GB 1IHVA 2O4XA 3C4SA 3T56B 3VS6A 1H3ZA 5CKBA 3KBGA 4ZGDB 4ZCIA 1ZUUA 2D9TA 4RUGA 2BZXA 2JNGA 1VQ7A 2RA2A 5GMKl 5J39A 4ROXA 1K73R 4FYXB 4JRIA 1AZGB 3Q1JA 1TU0B 4N0AA 4IUUA 3QJYA 1GBQA 1NJIC 3META 1K1ZA 1QGZA 2X4YA 1PD0A 2D0QB 4XU3A 4C92A 2QI2A 2EQMA 4PC6A 2M16A 3BW1A 2HL5C 2RI2A 4M75B 1VQ9T 2RF0A 3S3MA 5IYRA 5CKEA 2A3LA 2LVMA 4HXJA 3CD6Q 1ZUKA 5LJ3e 1W2BP 3OEEA 3CPWA 3H9NA 2KMTA 2BVNA 2KROA 2ZXHA 3ZZ0A 2JMAA 1SRLA 3JB9H 4KUIA 1PC0A 2KGTA 4JLGA 1N06A 1IHMA 2V7VA 2D3LA 3G4SB 2PUOB 1OHHA 3H0FA 4HT8A 2F2VA 2R57A 2X0KA 3CXCP 4OP0A 4RTUA 1Q7YC 5GJVB 4IUQA 1RACB 2FPFA 3NTIA 3EH2A 1OULA 3ZBTA 3JCMV 4RJLA 2CZ1B 2VUBA 5LJ5f 2FPDA 2KAFA 3QZ9B 4K1XA 1M2OA 4RTVA 2LCSA 3GOXA 3VS4A 4NOYA 2DL8A 4IUTA 1IJEA 3BDUA 5GAOn 4IIMA 1E43A 1I8DA 1F60A 3OYIA 2VBTA 3GVJA 1YITB 1NZ9A 2X51A 2QDXA 2XDPA 3CMEQ 3BQJA 4KUDK 2NYSA 1AWJA 2KRNA 1K9AA 3RBBB 3BNWA 2P3MA 1GL5A 3RMQA 4RG2A 3OFNA 3QKJA 4F7UF 1E1RA 2E5KA 1K73D 5KYUA 5FLXE 1VQLB 3BFMA 4P1VA 4DA4A 2KYMA 2JXBA 1RLQC 1ZSZA 3WVEB 1ZM9A 2YLCA 2ZBVA 1VQ6Q 3QWXX 3OS2A 1D1BA 4E7JA 1WYXA 1FRNA 2D3NA 1I5OB 4J9CA 5HCKA 5LJ5d 2M1HA 4QKUA 3FPKA 3U2QA 4JDSA 1WDTA 1WIEA 4XL9A 3GVKA 1D3BA 2I1LA 4C92B 3A8JA 1W35A 2EVRA 4ZGQB 2OAWA 2RM4A 3CC4A 3ASKA 3WNDA 1KMHA 2NWMA 4M7DF 1TUDA 4DBFA 4GLKA 1ZUYA 4JPBW 1YFNA 4E7SA 1QWEA 3EGDB 3QFTA 4RDJA 3I5SA 2CSQA 1N8RD 2C0IA 1Q81D 1TSFA 2DXTA 2FB7A 3G1JA 2NUTB 1ZA2B 4J9BA 4JUVA 1Y0RA 3UPUA 3RNJA 3ER0A 4DK1A 4C8QF 3MEVA 2CNDA 5KH6A 2WJVA 3A3GA 2FPEA 2EYYA 2FHDA 1VQKB 4FL6A 3HPWA 4DQ2A 3QZ5B 4JRPA 4M77B 1E3ZA 4QQGA 1FRQA 1AVZC 3JB9J 1NEBA 1R5NA 4M77C 4FXUA 5CK9A 1H3HA 2P84A 4P6VF 1GFCA 1SSFA 2JM8A 2X3XD 2OTLQ 2M51A 1MUZA 3MP1A 2RHZA 4M75D 5LJ3f 5LL6S 3CCMT 1IZ6A 2KY9A 2JW4A 1TWBA 4M7DD 4J7IA 3HP9A 3OE7A 4C5GA 1BMFA 3RY8A 5IN1A 2YWHA 1RABB 3J7AF 3QDFA 1PM3A 4MMKA 3SHWA 4IIOA 3VS7A 4NL2A 1ABOA 2HDNB 3PFSA 4NCNA 1HA3A 5GJWB 3BH4A 2DKGA 2CZ7B 3CCMA 4TMVA 1FX7A 4E7ZA 4P26A 4QVCA 5GAN4 3HFNA 2K5FA 3Q6QA 4B9XA 4C8QD 3CPWB 1ZA1B 2HZYA 2MI6A 1JJ2A 2W6JA 1K73C 1YI2Q 3CC7T 2M02A 5LJ5e 1ZSZC 3I35A 1KK2A 1ZBXA 3REAB 1W4SA 2ZZGA 1PCXA 3LLRA 2BKDN 3I56Q 1VQ6B 2QTZA 4JMQA 2L0AA 1K8AR 3CRZA 3PMIA 1D3BB 4WCIA 4Z8AA 1GBRA 4YAUA 1WDXA 2PZ1A 1FMKA 2FL7A 3V8JA 3OYEA 1YHQT 3M0SA 3L2VA 3CCRT 4G1VA 5KW9A 2RJCA 4ELZC 2V7XA 2XNJA 2KRMA 3ZZUA 5GV7A 3JCMh 1NJID 1JA1A 3BDLA 2BTTA 4RTXA 1Q82D 4V2SA 4OGEA 2RO0A 3X26B 1XE1A 2L3QA 5EMNA 3SDZA 3EG2A 2XZPA 1I7PA 1NJIR 3CCLT 2V8JA 4L8JA 4HCBA 3OYAA 1WFWA 2ZZEA 2JZ2A 2GBQA 2K3YA 2LNHB 3F70A 1KC8C 4EPCA 2FRWA 3I56T 5J3OA 4QQDA 2QK0A 3CMEB 3NHNA 4M78C 1OZ3A 2FYKA 4IUPA 3V7CA 1G5VA 3AT1B 2XOKA 2GK6A 2MK5A 2YWWA 4B47A 3QFSA 1R77A 3OA6A 2JOYA 4HVUA 2GJRA 4F17A 2M5SA 2DO3A 3L1AA 2RJEA 3D7SB 4M7AD 1FX0A 2JS2A 1BPLA 1ZLMA 1QVFP 1ZM3A 4BB7A 1GO2A 3CCUQ 3A8KA 4PFOA 1BB9A 3NGPA 3BY1A 5BSYA 2RC5A 1LNXA 4QFMA 1I07A 1E1QA 3PUMA 5FL7A 3VYGA 4M2LA 3SKBA 1MMAA 4C8QB 1KTVA 3VS3A 2D74A 3M5AA 2DNUA 3R6NA 5FWBA 4ZGEB 1WGSA 2SEMA 3OQ5A 1EP1B 1K9MC 5GAN3 4PABA 4CC7A 4ZGNB 2PUKB 2PU9B 4KRTA 4CC4B 4PKCC 4TMZA 3OEHA 2CZ0B 1RLPC 3QIIA 1EX4A 1KD1R 1ZX6A 3NE5B 8AT1B 2XZOA 1UTIA 3RKXA 2OK7A 4KGZB 3DKMA 2FRYA 1P4MA 4Z89A 2HCKA 3PMTA 3CCQT 3B82A 4X9DA 3M56A 2IG0A 4LDYA 4M7AF 1J9ZA 5A88A 1LJOA 2YRVA 4Y9UA 2K3BA 2WSEE 5KYUB 1YHQQ 3Q38A 2QA4A 3SJZA 3I5RA 3CCEQ 1PSFA 4WZLA 3J81E 1NYFA 4CC2A 2AZVA 3JCMf 4HE5A 2RHXA 1V0FA 5FU6C 4J7FA 2HDAA 3J80E 1H42A 1QVFS 2D9RA 3OYYA 4PJOF 4RPBA 3E1YE 1VYUA 4DOVA 1AWWA 2E6NA 1QQJA 4AVZA 3OJXA 2R5MA 3OW2B 3CC2T 4ASUA 4QQ6A 1QUEA 2WR8A 4C0SA 3P8HA 3OZVA 2NLUA 1C6VX 5C0MA 2DEQA 2E3IA 4PAAA 2DZCA 2QQBA 2VBUA 1PD1A 3CD6B 1FNBA 2EQKA 1W9XA 2YDLA 2V7WA 1YCSB 2XHCA 3CC2A 4J9GA 2O9SA 5GAMf 1VQMQ 4JRKA 3B8HA 4RCBA 1M27C 3V7RA 4XR6A 1G3TA 2IPOB 4J9HA 1X6BA 2ZGWA 3AHUA 1Q9SA 3CP8A 3CCVQ 2YUNA 2E6ZA 4PJJA 1ZM2A 4YALA 1IB0A 1X2QA 4KKSA 5FU6B 1WXTA 2OTJB 4II3A 2ZPHB 5GAOp 2BZYA 4XORA 3MCAB 3T51B 1I0CA 4TMXA 1VQ4B 2VYTA 2VBVA 1IREB 1VQPB 4XKWA 2PVGB 1QVGS 3G4SQ 4NL3A 1AZEA 1YIJQ 1E64A 3WNCA 2E12A 5KE2A 2LP5A 5I2SA 3BC9A 4A4HA 4JJCA 2V1RA 3MEWA 4G6IA 2QXFA 2WYRA 2C0TA 1FMWA 4U9UA 4RCZA 3E2UA 3CCVT 1T6ZA 1U3OA 3J81k 3PA1A 5KYXA 1M1KU 1G8XA 2CZ6B 1VQMA 3CMEA 1UGVA 2OJ2A 3FLGA 2CP0A 3LH0A 1YJWA 3RESA 1RAIB 2E64A 2ECZA 4F7UA 3CCVA 2ZL7A 4XTZA 2ROLA 2FX3A 2PE3A 2HQEA 2GTOA 1XTDA 3EGUA 4LC0A 4P2NA 1N27A 3TEEA 1CQXA 2GFAA 2RH2A 4JJNK 2AHOA 1QCFA 2AZSA 1K73U 4J9FA 4P25A 4J9IA 2H3EB 2RQVA 1T5EA 3Q39A 1VQ6A 3JQPA 2OAUA 3OMGA 4DBQA 2KXDA 5F4MA 1YIJA 3CCET 5JBQA 3JCMX 1WPYA 2R5AA 4AG2C 1EFCA 1N9RA 1DG1G 4G5GA 2R6HA 3KXTA 4M7AB 1LVKA 2EYWA 2JT4A 4EMKA 4OMOA 3CC7Q 3W2EA 2QDYB 1E6GA 4FCYA 2COYA 1QVFA 2C5HA 5FA6A 4M78B 2F1LA 1MRZA 3D26A 2X35A 5IK2A 4LDWA 5DY9A 3CCJT 3OBWA 5TR9A 1PKVA 1D1NA 3I55A 1OYXA 1GFDA 1W2BB 1KQSA 2X6YA 4N3NA 3A8IA 4KGXB 3WQZA 1V1CA 3GSIA 4PJMA 2LT4A 1T0JA 4J83A 3TU4K 5KCHA 1QG0A 4P12A 2V31A 1S72A 4FSSA 1AEYA 2NUPA 3WXMA 4NNJA 3V8LA 2EQIA 1OQKA 5CKFA 3EG9A 2VZLA 2E65A 3R6KA 4C8QE 3CPFA 1VQ4A 1MABA 3PVDA 1QFYA 2ZPIB 1W1FA 5GAMh 1ZUNB 3OZUA 4C92F 2QTVA 3OAAA 2D0NA 1S0UA 1H8KA 1Q82C 2F69A 1D2EA 3VO1A 3UF4A 2SRCA 1W70A 3HRUA 2CP7A 2RMOA 1B34A 5J26A 2EBPA 5I2MA 2OTLA 2E1HA 2FO0A 4TN1A 1VQ7B 3AGQA 1W87A 1VOMA 2F5KA 3CP2A 1OX9A 3GF5A 2WZPP 3BE3A 4TMTA 2GQFA 4EMKC 4FYWB 3ZZTA 1MNDA 4OMPA 3UWNA 1HZEA 1M2VA 1K9MU 1XFOA 2E1RA 2X9HA 4J8OA 1BJKA 4FK8A 2CS7A 3CCMQ 1ZQ1A 2CP3A 5DLOA 2OTJQ 5GV8A 1RAFB 4MYTA 3CCLQ 2E1BA 1BU1A 2DAQA 4OP7A 2O31A 2PVOB 4QHYA 2W0ZA 4C92D 1VQ4Q 4LN2A 8ATCB 4WZKA 3E9FA 4M75E 1BK2A 4C0ZA 4OMMA 5DN6A 3OKXA 2HL3A 2RK2A 1T3LA 3V76A 1VQPA 4Z4SA 1Y0YA 2KDSA 4R56A 1NYGA 1W0KA 1KJWA 4ATOA 3JRZA 2V26A 3S6WA 1Y96B 1BI3A 3MPUB 4XU2A 3UT1A 3JQRA 5FWCA 1EZZB 1VA7A 1UMKA 3VYHB 3L2ZA 5CO7A 2RD1A 3EGXB 2HQHA 5GMKi 3WYAA 4Z4WA 2ZXIA 4LDVA 3LQEA 4IW3B 4RCCA 2XI9A 5LJ5h 2IIMA 3FDRA 3C95A 2BV3A 4LE9A 2BZ8A 4D8KA 2CK3A 4DOWA 3VNUA 1V76A 1CKAA 2J6FA 2ZITA 3CMAT 2C4UA 4PLLA 5A89A 2D8HA 1YJWB 3HL8A 2MCNA 3VJPA 1EXMA 3OW2S 2B7CA 3CCLA 1NLOC 2Q6IA 4A4EA 2BIVA 4RD2A 2K2MA 5CR2A 3WBKA 2EYQA 3JCMQ 3JQQA 4KH0B 1KHIA 5GMKh 2CP6A 1WHKA 2KVOA 1QMCA 1BI0A 4XLAA 5IYNA 4XN3A 3CMMA 1JB0E 4A63B 1RQRA 1MMGA 2L8DA 2RN8A 4XN0A 2DL3A 4DK0A 4M78D 1TH7A 3W2HA 2RK1A 1K4US 1QFZA 1JNYA 4X7FA 4PK4A 2Y4YA 1IJFA 3CCUB 1KK3A 2XICA 4XM3A 1G3SA 4EMKB 4AF6A 1JBMA 4A53A 4TKOB 2AK5A 2CGHA 1FNMA 2MOXA 5A0GA 1M1GA 5IXFA 1WXBA 2OTJT 2VYQA 1YNZA 1M2VB 3H0HA 1GAQA 3H6ZA 1KK0A 2CP5A 1U2RA 4KGVB 1S72T 2DBKA 2MWOA 1U8RA 3GVLA 3QUIA 2DILA 2QTLA 2ED1A 4R71A 1E7OA 2QQSA 5F4JA 3MP8A 5FRNA 4PL6A 1K0SA 1PKSA 2HAXA 4PFPA 2DRMA 4NS5A 4C92E 1TG0A 2NUTA 1YIJT 1RADB 2YUQA 5KSWB 1YI2A 4AFUC 1UGRB 1QP2A 1OB0A 4WTOB 5GANj 3M57A 5BSXA 3CW2A 2HBWA 1WJSA 4AFSC 1JXOA 5LMZA 4M77G 2DZ9A 5GMKj 4XQ3A 1SPKA 1TUCA 2K3XA 3UA7A 1D1AA 1B34B 4Y7CA 4RDKA 2L89A 1YN8A 2VXEA 6AT1B 5KYWB 2DYIA 3EFRA 4JJDA 2ABLA 3CXCA 2Y90A 3C94A 2KE9A 5LJ3h 5DSZA 3DLLA 5IT9E 2YXYA 1B23P 2RQRA 1EIFA 4M7AC 4M75C 2NV4A 1WHLA 2B86A 3OYMA 2A08A 4O6JA 5GMKe 4BUGA 1U1SA 2JMCA 3G4ST 4LD9K 1UECA 2E10A 2GQIA 4OMLA 4HA8A 4LBVA 4M53A 4ANJA 3CC2Q 1M1FA 2GF7A 3U6KA 2OBSA 2L2PA 1VQLT 2BGJA 3W5UA 5IYWA 3MHXA 4XTXA 4KT0E 1KSWA 1WHHA 2IVWA 2HBPA 4L6V5 4HT9A 4PFZA 4YTLA 1I1JA 4HCKA 2ZBUA 1UUEA 3L42A 4Y9RA 1T6XA 1VQ9B 4JS5A 3HSBA 4Z4ZA 2O01E 4B44A 3CCUA 1VIEA 4RLZA 4PLIA 4ZGJB 5GANh 2YWGA 3X28B 3A8HB 3QXEB 2NUZA 1OEBA 5L46A 3QDRB 2VGNA 2ZZDA 2X6XA 2COZA 3W5VA 3SJPA 1JA0A 4B9WA 2C4TA 4Y28E 1NG2A 1DARA 3P8DA 1OU8A 2VASA 2C0OA 1KQ1A 3ME9A 3MJXA 4PJLA 4N4GA 4R0KA 1UEBA 2QMUA 4DNTB 2HMAA 2XU8A 1Y07A 2ZPFB 4JZ3A 1O75A 2RI5A 5LJ3j 3FKSA 3MP6A 5DLQE 1SM4A 1IRXA 1VQOQ 1I5LA 4PJOA 1E63A 2K5IA 1UGSB 2O88A 1QCOA 1QGYA 1VLYA 4P6YA 4BACA 2A28A 2OX7A 4E6RA 4C0DB 1QVGP 2Q6KA 1XQHA 3G6EQ 2CYZB 2DTIA 1Q82U 3QFCA 4RD3A 1UD5A 3ONYA 3P26A 4PGOA 2LQ8A 2A36A 2FZKB 1XOVA 1M30A 1Q7YU 4X8IA 2DFUA 4RG8A 1UJ0A 3QPHA 2KEAA 2C06A 2X4JA 1BCMA 2EW3A 3GLXA 1ZHIA 2E3HA 1HYOA 5IAYA 1QFJA 4XK8E 3ONUA 5F4OA 3I55T 1KZLA 3MKDA 5GANf 1RI9A 2KBTA 3HKSA 4BY6B 5CIUA 2F4NA 2LDMA 3B78A 2ROTA 2WSFE 4Z1MA 2DVJA 3CCQA 2WSCE 1K9MR 4PJOE 1E3XA 1JJ2P 1M90R 1KJZA 2EJ9A 3OYHA 1OZ2A 1WOPA 2DIEA 1IGUA 1ACMB 2V8IA 1NEGA 2KQWA 1G3WA 1EP3B 5HY6A 1PNJA 1KRHA 2K2VA 1QVGB 4RD6A 3MO8A 3LYIA 1WP6A 2KT1A 2JDIA 3SB2A 3VUZA 2GK7A 4Z02A 1W0JA 4NBSA 2V8KA 4XMYA 1Q86D 3LX7A 4EH1A 4C5EA 2RPNA 2V4DA 2DERA 1WSRA 2GCXA 4B4DA 5GAMj 4PJOD 4FWTA 1AT1B 2XNCA 1SHGA 2DF6A 3ASRA 2CSIA 5EC7A 2CH4W 2A0FB 5KYYA 5IHKA 2VWFA 1N8RC 3EFSA 3HFOA 1V29B 4LD6A 2OI3A 3OYCA 2DD4A 2QQ9A 2KR3A 2DJQA 2EGEA 3PNWC 5KYWA 2X8KA 3AGPA 4BE1A 3OYLA 2QYZA 4X06A 3GIBA 2ESWA 3H0IA 4PJOB 1EFTA 1FYNA 1OI1A 1K76A 3EG3A 9ATCB 4JLIA 4C92G 3OPOA 1A0NB 5CAIA 2YSQA 1NPPA 2P0PA 3ZL7C 4F14A 1VQ5T 1EP2B 3GP8A 2OTLT 1D09B 4AF7A 3CBPA 3GIRA 2JM9A 2QQAA 2V1QA 3INZA 4VUBA 2E5QA 3A8OB 5CKHA 1R5OA 4G7WA 4N3GA 1NB0A 1MMNA 4WWVA 1OGIA 3CCJB 1DDGA 1N0UA 4WZEA 1WTHD 2OTJA 4FSXA 2PNIA 1WJQA 1VYTA 4ACAA 1UD4A 2DD5A 3HRSA 1Q81R 1VJSA 2EPDA 3RKYA 3UDCA 1M3AA 2E70A 4ZNXA 1T3SA 1SF9A 1VQMT 3CQTA 1HK9A 2KK4A 3OW7A 2QA4B 3VV0A 1C0MA 5GAN5 3NTHA 4XLFA 1Y0MA 5GAN8 3M53A 4B3GA 3H8ZA 2W6IA 2XD0A 2JTEA 1QWFA 1W2BS 1M3CA 2L3SA 1VQ7Q 3LQ6A 2V7TA 3FEOA 5I11A 3CC7A 2D8JA 1PRLC 5LJ5j 3EHRA 4XQFA 2EQUA 4OMNA 1YITA 3CCSA 1VQ8A 2DJZA 2F2WA 4AFQC 1BQEA 1K8AD 2OBTA 2HLDA 4M78G 3H41A 2VNJA 1N8RU 4K11A 2YWFA 2ZZQA 3RR6A 3LO8A 3CD6A 1GXIE 5GANe 4X05A 1TUIA 3L2UA 2DL5A 2XMFA 1GAWA 1N9SA 4BI4A 4F7UB 3R6JA 3CCVB 4MZMA 3CBMA 4KKTA 4DEYA 3W2IA 1ZSZB 2DBMA 1UD8A 3A8MB 5HZBA 3CMAQ 2MWPA 1JEGA 1JQQA 1RAEB 2QGGA 5IHIA 4F7UG 3S3OA 4LDXA 2DA9A 3OS5A 4FM4B 4E7LA 1R5BA 3OZWA 2HKQB 4KH1B 4RD1A 2K6DA 1MGQA 4E7HA 4B3FX 1UDLA 3M0RA 4PC7A 2DIQA 3CPWP 1W2BA 2CW5A 4P3YA 2JVVA 1YITQ 2DYBA 1IGQA 1N8RR 1BCOA 2VJJA 1FXXA 2EKHA 1G2BA 3DB3A 2DX1A 2E41A 2VKNA 3AVYA 1S72B 1X27A 2JTFA 3DDYA 4ME7A 4F7DA 4M4ZA 3PUNA 2QEXA 2QGFB 4M78E 2C5BA 1TTHB 3M4GA 2GJPA 4GLMA 1VQKQ 1PJ5A 1YI2T 2XDDA 2DK3A 1VQMB 1QW1A 2E4HA 3E20A 1VUBA 4OPOA 4M78F 3M58A 1I8FA 1MV0B 3SWNB 1VQ5Q 2LZ6B 2KNBB 3EFOA 4M77E 2DM1A 3WNBA 3PVQA 2DOGA 3VS2A 2GGRA 2LJ3A 1KQSS 4M7DB 1Q86C 2YUOA 2F2XA 2X4XA 1VQNT 1M3BA 4ZTJA 2VV5A 1E6HA 3OP1A 4C8QG 2YHTA 1D8TA 2CH4A 4CC3A 2DETA 2P4TA 2WPDA 1T6YA 1YBYA 2OTLB 1H8EA 2GFUA 4Y91A 2M0OA 1YIJB 4C92C 3TQ7P 3Q3AA 2J05A 2RJDA 1YJWT 3CCJQ 1WQ7A 1X01A 1X69A 4QVJA 3M59A 2H3JA 2CT4A 1TLLA 3FIFA 2OBRA 1WHMA 1IB8A 4RTTA 3DLMA 1NM7A 1KHCA 1VLOA 2LMJA 4C0DC 2NPFA 5E6TA 2JTMA 1BKBA 4IUVA 3FPPA 2O9VA 1EFNA 3P8BB 2FVGA 2HEQA 1JU5C 2J6OA 3OYFA 4PJNA 1WX6A 4LDUA 3CCUT 4KKUA 3WXMB 1BI2A 3RERA 3I56A 4QVZA 4J6YA 1VQ6T 1RUWA 1GCQC 1GRIA 4Z88A 2EGCA 2KVQG 1YX2A 1AIPA 2LX7A 2D1XA 3GBQA 4J6XA 3G71A 4PNOA 2CREA 2LT1A 1X43A 3JCMg 3CC7B 2BSAA 5HKCA 2ED0A 1R8OB 3HTRA 5GAOm 3M0UA 3E9GA 2I0NA 2LCCA 1KG1A 2FZGB 3JCMW 4E7KA 1GCPA 1QH0A 1IO6A 3I1FA 3FRNA 2VNKA 5TV2A 3JB9G 4TSFA 1V0EA 1Q81U 3CC4B 1BYMA 4ZCLA 2VXFA 4AG1C 2HSEB 5KNLA 3G6EA 4II2A 2J7IA 5FIUA 2A7YA 1YJNB 4WF2A 4AT1B 3CCRB 5CQYA 1QUFA 3S3NA 3OY9A 2EFGA 2OYNA 1KD1U 3O5ZA 4E47A 1M1KC 2DE0X 3JB9D 1RI0A 4Y92A 3CC4T 1YJNT 1RAGB 2DMOA 3LNNA 1Q7YD 1JXMA 2VGMA 4DBRA 2ZTGA 3JU4A 3EAEA 2GQVA 4RTZA 4A4FA 4YELA 3G71Q 3QSYA 4MZPA 1S4MA 1UGPB 2M0YA 5GANd 3LVBA 1N05A 2BN4A 1W6XA 4UC4A 3OYBA 1OB2A 2CDTA 1Y96A 2P4RA 5GAOq 2Z0WA 3M55A 2FEIA 2X53S 3AVTA 2EQJA 1ZM4A 5FU7C 1WHGA 1KK7A 1N08A 5FNZA 2BM0A 4P3IA 2EWNA 3LGLA 4ZN1A 3GNGA 4LXCA 4XTUA 3LW5E 4P5NA 1T0HA 1M4ZA 2KI7A 4EDUA 3ISXA 2PIAA 4LBWA 3CCEB 4MMLA 1FNDA 4YAOA 3ZBDA 2PLFA 3VR6A 3FC3A 2BUDA 1VQ7T 1YLOA 2JJ1A 2LNVA 5HKKA 3CCMB 2PQWA 4F16A 4G1BA 3M4YA 3CPWS 3JB9F 1QX4A 5GMKm 3VO2A 3URGA 4C43A 1QKXA 2PMDA 1GCQA 2CRVA 5GAN7 3OS0A 3VS0A 2X4WA 1WU8A 5H59A 1YJ9Q 2AIRB 4N4HA 2EGAA 3E19A 3VRYA 4XLHA 3LWHA 4M7DA 2AKLA 3NFCA 1OV3A 1OU9A 2DY1A 5CDFA 3ZEHA 3NPFA 4MZTA 4MDXA 5DM7R 4BPRA 3OBYA 2F43A 5HK0A 2RB6A 2DCUA 1JB9A 4PC1A 1K0XA 4XLCA 5ECAA 2HNIA 2Y4XA 4RTWA 2P0QA 5CQXA 1DDIA 2CBXA 3PGGA 4TVRA 3HHTB 2DIGA 1WA7A 3M0QA 2EFIA 1Y57A 1YJNA 3G6EB 4OB1B 2QG9B 1M9SA 1BIAA 2ZPGB 4EMGA 7AT1B 4Q5WA 1CNEA 4DQLA 3AVXA 4B3XA 1B2RA 1PSEA 1KFZA 4X07A 4J9EA 4ORZA 5IXBA 1XJWB 2LJ1A 4EIKA 3LWIA 1NB9A 4E0FA 1YHQA 1V5VA 2KYBA 1UGQB 2LTOA 1PG5B 4PJOC 2HCJB 2RJFA 3OW2P 1YJ9A 5GAMd 3EH1A 1UFFA 3NMZC 1JJ2S 1W34A 2JUFA 4X9CA 2EYZA 3QSUA 2O4XB 2YLBA 3O8VA 3G71B 4B48A 3EHQA 3PE0A 2QTXA 2GREA 3ASPA 4TMWA 4RKUE 4P22A 2ZPEB 2QDLA 1X6OA 3OSVA 4O5VA 2FVUA 3CD6T 4UZEA 1LPLA 1OPLA 4BDYA 3G71T 1Q95G 4E7IA 4HVVA 4JJBA 3VUBA 4L59A 4QT7A 2KRSA 3OYKA 1X6GA 1YJNQ 1PJ6A 3AVWA 2RHUA 4M75A 1YITT 1VHOA 2X3UA 2BE9B 4PC3A 4E2FB 2QAZA 2HQXA 5IYQA 4RCYA 3ZPNA 5A2QE 1Q86U 1F1BB 2A37A 3QWYA 4FT2A 3CCRA 4GBQA 4XAXB 1U5SA 1TXQA 3VRZA 4BE2A 1CSKA 1YP5A 4CI0C 4M1KA 1S1NA 1KC8U 1NE8A 2K57A 1NPRA 4A54A 1D0YA 1WORA 5D6XA 4J5YA 2MMPA 4YXWA 3QYGB 3G6ET 2EIFA 2J06A 1KIKA 4HIZA 4KBMB 1GJRA 1QVPA 1HJDA 1CKBA 1RAAB 4AC9A 5GAN6 1HD3A 1SEMA 1KD1C 4OMFB 4CRIA 4L5GA 4HCCA 3U23A 4YHBA 1O9SA 1COWA 3V8KA 2AHJB 1N5ZA 2CC2A 3JCMd 1QVFB 5D6YA 4F04B 1P92A 2B7BA 3ZIAA 1OX8A 2VC8A 1VQNQ 1ABQA 1ZBJA 1UJYA 1R0CB 2Q6LA 1B3QA 1SG5A 2COWA 1KQSB 5I22A 2RI3A 4J0QA 2PTKA 3I55Q 4Z4YA 3PIOA 3SEJA 3IQLA 1XQBA 5HXBA 3OYNA 4YAFA 3ULRB 2RHYA 3PA2A 3RMSA 2BM1A 5KYXB 3VNVA 1PHTA 1BX0A 1UD6A 2JS0A 1XB2A 1WI7A 2DVEA 4JZ4A 2DTOA 4XTYA 3PIPA 2QA4T 4XKVA 3WBJA 1S72Q 1BLIA 4M7AE 4QVAA 3SLNA 1YJ9B 3EG9B 1OB5A 2LJ0A 3CC2B 1VQKA 4HE6A 2GTJA 2BPOA 2KXCA 1M8MA 4AMCA 4OOVA 1I18A 1RAHB 3TREA 4C5HA 3OYDA 4R55A 1JO8A 2F5TX 2HSPA 3CPXA 1MHNA 2VVKA 4OPSA 3T9NA 5LJ5g 2ZPBB 1M1KR 2XG8D 4DEXA 2DL4A 3V7SA 1EFRA 3PVLA 1VQ5B 1HXDA 4ZTFA 5KYNA 3QFRA 2YRCA 1JRIA 4RD0A 1Q81C 4RDLA 5GANg 1MNEA 3HRTA 1ELOA 2LZJA 3G05A 1WPCA 5A0LA 3UATA 4JS4A 2RNAA 4M75G 4XOPA 3VMFA 1VQNA 1WZOA 4CQJA 3CCSQ 1VQ8Q 1X2KA 1U06A 2BE7D 1ZSGA 1WJRA 2J6KA 2G6FX 3KUFA 3OYGA 4M0LA 3CCJA 1KK1A 3JAME 1UG1A 1UD3A 4TT3A 3CCLB 2DXCA 3L2QA 5L8RE 3REBB 4BI3A 4BI8B 2MAMA 2L3RA 1KQSP 3ES9A 1AOJA 1NBEB 2R58A 1I81A 2VNHA 3ZBUA 1B7TA 1EWYA 3EGDA 4LNPA 3MEUA 1YHQB 1M90D 4C0FA 1UHCA 3FJOA 4DNRB 2WACA 1YCYA 1SRMA 5CVIA 3T53B 3OYJA 3DB4A 4HCZA 3CMAA 5I21A 2Z6BD 2XZLA 1X75C 2MPXC 4UAJA 4XD7A 3X25B 1WXUA 4Q7JB 4D8DA 1M5Q1 3ASSA 3TVTA 2VJIA 2YWEA 2XNDA 3M0PA 1OGJA 3ASQA 4RD4A 2DXUA 4KULA 2RHIA 1TOVA 1J3TA 4OMQA 2LCLA 2QE7A 4M77A 4RMOA 1E62A 4FYYB 4RPDA 2GPJA 4OB3B 2MYSA 3L2RA 1WOOA 3OS1A 2QQRA 3CC4Q 1K9MD 3CMET 3SEMA 3AVVA 4M7AA 4OF1A 2K79A 1ARKA 3CXCS 2YT6A 3TCJA 1YWOA 3A98A 3KFVA 4BDZA 1E79A 1HSQA 2QEXQ 2WJYA 2JN0A 4M75F 3GPLA 3OB9A 1G7RA 4DQKA 5AYFA 5AT1B 4GY5A 2RC6A 2L3PA 3M9QA 4QW2A 4EMHA 4PC2A 2V7QA 4M7DG 3JCMc 3WVDB 1K28D 3KEWA 3QYHB 4M7DC 2KT8A 1JJ2B 1VQ5A 1QGAA 2CUDA 5GAMg 2MF2A 2VB6A 4C8QA 2VBSA 1M8VA 1VQPQ 1MV3A 1H641 5EG2A 1WSVA 1XNIA 1BBZA 2DRKA 5DS0A 1KC8D 4WZTA 3M0TA 4XNFA 4A4KA 3N5BB 1B07A 1H8HA 4Z4VA 1VQNB 5FW9A
chains in the Genus database with same CATH topology
2F1LA 2DOGA 3HTRA 3A1PA 1PM3A 2DYIA 3H9NA 2QGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1L A;  2DOG A;  3HTR A;  3A1P A;  1PM3 A;  2DYI A;  3H9N A;  2QGG A; 
#chains in the Genus database with same CATH topology
 3FJ5 A;  2WZN A;  5HK3 A;  1N0V C;  1PRM C;  3OJW A;  2B8A A;  1I4K 1;  1UD2 A;  1HVX A;  4HKE A;  3EG0 A;  2C78 A;  3QE2 A;  1Z9Q A;  5D6W A;  4Z4T A;  4ELY C;  2ZAE A;  5LJ3 d;  3JCM J;  3JV3 A;  2LRQ A;  1FWZ A;  3U6B A;  1G3Y A;  3PEN A;  2ATC B;  2HKN A;  4X34 A;  2JJ2 A;  4X7D A;  5D7U A;  4BD3 A;  3VS1 A;  3HAG A;  3W5H A;  3CBO A;  2ZTN A;  4OB2 B;  4XTW A;  1GVH A;  3VKI A;  2YUP A;  3C0C A;  4J9D A;  3RDV A;  3FJP A;  1VQP T;  1MMD A;  2X6W A;  3I9Q A;  4OPV A;  1VQ4 T;  2CUB A;  3A8L B;  2K5L A;  2OK8 A;  4FN5 A;  3SWN A;  4MDW A;  4YEJ A;  1TVC A;  3PTA A;  4ESR A;  4M7D E;  2BGI A;  3X24 B;  1G7S A;  1UB4 A;  3QJ6 A;  1PJ7 A;  2K7A A;  2CKK A;  3OW2 A;  1VQK T;  2ZL5 A;  5L23 A;  1GR1 A;  3CXC B;  3WY9 A;  2K9G A;  4IKF A;  4JRQ A;  4UZF A;  3W2G A;  3VS5 A;  4LUD A;  4N4I A;  2QEX T;  3BCF A;  2QAS A;  2C2W A;  5IYP A;  5FRM A;  4XON A;  4IUR A;  3UA6 A;  4ACB A;  3SD4 A;  4C0G A;  3JCM b;  1M90 C;  4OOS A;  5IH2 A;  5CKD A;  4H9G A;  1QP3 A;  4A4G A;  1VQO T;  1RQP A;  3AST A;  4QUZ A;  1VHE A;  4X7E A;  1M1K D;  2DPP B;  3E1S A;  2J7K A;  2LQN A;  2LQW A;  3MHP A;  3EG1 A;  3RKW A;  2XK0 A;  1SKY B;  1QKW A;  4P9S A;  5TRD A;  4G7X A;  5H5J A;  4N0A C;  4M77 F;  5KE3 A;  1VQO B;  2AT1 B;  2ZL6 A;  2ZZF A;  3GQB A;  1LCK A;  2JIZ A;  2JN9 A;  4FW1 A;  3VU3 C;  1AHJ B;  2BF4 A;  4DBH A;  3JSC A;  1UE9 A;  3MCA A;  1YI2 B;  2QEX B;  1AD5 A;  3MEA A;  1AWO A;  5FRO A;  5FO0 A;  1H85 A;  2L5Q A;  2EIX A;  3CTA A;  4QVD A;  1D0Z A;  1K8A C;  1BX1 A;  1FMV A;  2DTH A;  1LOJ A;  1TS9 A;  1Y7X A;  3ZC3 A;  4LUE A;  1N07 A;  1FNC A;  1M90 U;  4WQM A;  4Z4R A;  1R0B G;  1SKU B;  3NTK A;  1NLP C;  5A0D A;  3CB4 A;  4LBY A;  2Q6O A;  1WQW A;  1UHF A;  3EFO B;  3C12 A;  4ZV4 A;  2DL7 A;  2HD0 A;  2LQK A;  2RQU A;  2EJF A;  4Z4U A;  5AN9 A;  5FU7 B;  2GJK A;  2RQW A;  2X85 A;  3SLD A;  4C5I A;  4UZU A;  5C6S A;  2ENM A;  4D6W A;  4XTV A;  5THX A;  2W10 A;  4FW2 A;  3BCD A;  2CF4 A;  4HVW A;  4M77 D;  1H92 A;  3TSW A;  1Q7Y R;  2BMW A;  2PVD B;  3JB9 I;  3W2F A;  1WLP B;  2P0K A;  2H8H A;  2O2O A;  1OPK A;  3KL9 A;  2LC4 A;  1G7T A;  1VQL A;  2R9V A;  2EKO A;  3QG1 A;  4LBZ A;  4XLE A;  1N6A A;  5TY0 A;  4MYU A;  3SWN C;  3P27 A;  1Z9Z A;  3CMA B;  1TTT A;  2XDB A;  2DEU A;  4OOX A;  2B5O A;  1D0X A;  1KD1 D;  5FO1 A;  1VQ9 Q;  4M4S A;  3I56 B;  2G3R A;  3CCQ B;  2V7U A;  5CCA A;  2EYX A;  1IHW A;  1QLY A;  4J6W A;  4GQN A;  5IHN A;  2I2L A;  2CT3 A;  2X3W D;  1TUG B;  1SHF A;  3A5Z B;  2CP2 A;  1Y71 A;  3R6O A;  4XU1 A;  1VYV A;  3A35 A;  1RL2 A;  1VQO A;  2FG0 A;  5GAO r;  5M9O A;  3GNF B;  1OOT A;  3BY7 A;  2EAY A;  4FYV B;  2KSS A;  1QCN A;  1D1C A;  3OMC A;  4XU0 A;  2C77 A;  2LX9 A;  4XOT A;  4FU6 A;  1VIF A;  3Q6R A;  2MIO A;  1SKQ A;  2K4Y A;  5GAO l;  4AFZ C;  1NRK A;  1IXD A;  3JCM e;  5GAN 2;  1VQL Q;  4X7C A;  1Q86 R;  1BIB A;  1EFU A;  3RUX A;  3CCS T;  1VQ8 T;  2XGJ A;  4BY6 C;  4RTY A;  4B6M A;  3RIR A;  4X0C A;  2D6F A;  4OVA A;  3TSZ A;  1VF7 A;  3PT9 A;  1YWP A;  1AMO A;  3OOC A;  3L2W A;  2DXB A;  2VNI A;  2WSS A;  1PWT A;  1VQ9 A;  2XID A;  4C8Q C;  4OB0 B;  3G4S A;  2XKO C;  1DJ7 B;  3AVU A;  3CCS B;  1VQ8 B;  3THK A;  1CNF A;  2YRD A;  3CCQ Q;  1YJ9 T;  2QN6 A;  2DLP A;  3CES A;  5GAM e;  1U1T A;  3JCM P;  4M78 A;  1A8P A;  4M7A G;  5J3B A;  5LJ3 g;  3X20 B;  4FIB A;  4X1V A;  3I55 B;  3V7A A;  5KCO A;  1KQ2 A;  2M9U A;  2F1M A;  1G83 A;  1SSH A;  4II1 A;  3SFM A;  1KC8 R;  4ZN3 A;  1BI1 A;  1K8A U;  2RQT A;  3FB9 A;  3QO3 A;  1G7C A;  4ZCM A;  3M54 A;  2XEX A;  3ZUG A;  2ZCF B;  3ZFJ A;  1QVG A;  4RM0 A;  3A3B A;  3OSS C;  3QHS A;  1YJW Q;  3A1P A;  1PKT A;  4F7U E;  2AKK A;  1WHJ A;  3CCR Q;  4PJO G;  1NDH A;  2JJ9 A;  2QA4 Q;  2GNC A;  1NBM A;  3G7Z A;  3LGF A;  5J35 A;  3CCE A;  3LH5 A;  5A8A A;  5HZA A;  4YAW A;  1AWX A;  3CEY A;  4BE0 A;  3MMP A;  4OGC A;  5B6I A;  2NUP B;  1WNL A;  2EJG A;  4QV2 A;  1NJI U;  4FT4 A;  5KYY B;  1FDR A;  1C1A A;  1F20 A;  1WOS A;  4B43 A;  3BY2 A;  3QBY A;  2FZC B;  1Q82 R;  3H94 A;  3EGX A;  3A8G B;  1IHV A;  2O4X A;  3C4S A;  3T56 B;  3VS6 A;  1H3Z A;  5CKB A;  3KBG A;  4ZGD B;  4ZCI A;  1ZUU A;  2D9T A;  4RUG A;  2BZX A;  2JNG A;  1VQ7 A;  2RA2 A;  5GMK l;  5J39 A;  4ROX A;  1K73 R;  4FYX B;  4JRI A;  1AZG B;  3Q1J A;  1TU0 B;  4N0A A;  4IUU A;  3QJY A;  1GBQ A;  1NJI C;  3MET A;  1K1Z A;  1QGZ A;  2X4Y A;  1PD0 A;  2D0Q B;  4XU3 A;  4C92 A;  2QI2 A;  2EQM A;  4PC6 A;  2M16 A;  3BW1 A;  2HL5 C;  2RI2 A;  4M75 B;  1VQ9 T;  2RF0 A;  3S3M A;  5IYR A;  5CKE A;  2A3L A;  2LVM A;  4HXJ A;  3CD6 Q;  1ZUK A;  5LJ3 e;  1W2B P;  3OEE A;  3CPW A;  3H9N A;  2KMT A;  2BVN A;  2KRO A;  2ZXH A;  3ZZ0 A;  2JMA A;  1SRL A;  3JB9 H;  4KUI A;  1PC0 A;  2KGT A;  4JLG A;  1N06 A;  1IHM A;  2V7V A;  2D3L A;  3G4S B;  2PUO B;  1OHH A;  3H0F A;  4HT8 A;  2F2V A;  2R57 A;  2X0K A;  3CXC P;  4OP0 A;  4RTU A;  1Q7Y C;  5GJV B;  4IUQ A;  1RAC B;  2FPF A;  3NTI A;  3EH2 A;  1OUL A;  3ZBT A;  3JCM V;  4RJL A;  2CZ1 B;  2VUB A;  5LJ5 f;  2FPD A;  2KAF A;  3QZ9 B;  4K1X A;  1M2O A;  4RTV A;  2LCS A;  3GOX A;  3VS4 A;  4NOY A;  2DL8 A;  4IUT A;  1IJE A;  3BDU A;  5GAO n;  4IIM A;  1E43 A;  1I8D A;  1F60 A;  3OYI A;  2VBT A;  3GVJ A;  1YIT B;  1NZ9 A;  2X51 A;  2QDX A;  2XDP A;  3CME Q;  3BQJ A;  4KUD K;  2NYS A;  1AWJ A;  2KRN A;  1K9A A;  3RBB B;  3BNW A;  2P3M A;  1GL5 A;  3RMQ A;  4RG2 A;  3OFN A;  3QKJ A;  4F7U F;  1E1R A;  2E5K A;  1K73 D;  5KYU A;  5FLX E;  1VQL B;  3BFM A;  4P1V A;  4DA4 A;  2KYM A;  2JXB A;  1RLQ C;  1ZSZ A;  3WVE B;  1ZM9 A;  2YLC A;  2ZBV A;  1VQ6 Q;  3QWX X;  3OS2 A;  1D1B A;  4E7J A;  1WYX A;  1FRN A;  2D3N A;  1I5O B;  4J9C A;  5HCK A;  5LJ5 d;  2M1H A;  4QKU A;  3FPK A;  3U2Q A;  4JDS A;  1WDT A;  1WIE A;  4XL9 A;  3GVK A;  1D3B A;  2I1L A;  4C92 B;  3A8J A;  1W35 A;  2EVR A;  4ZGQ B;  2OAW A;  2RM4 A;  3CC4 A;  3ASK A;  3WND A;  1KMH A;  2NWM A;  4M7D F;  1TUD A;  4DBF A;  4GLK A;  1ZUY A;  4JPB W;  1YFN A;  4E7S A;  1QWE A;  3EGD B;  3QFT A;  4RDJ A;  3I5S A;  2CSQ A;  1N8R D;  2C0I A;  1Q81 D;  1TSF A;  2DXT A;  2FB7 A;  3G1J A;  2NUT B;  1ZA2 B;  4J9B A;  4JUV A;  1Y0R A;  3UPU A;  3RNJ A;  3ER0 A;  4DK1 A;  4C8Q F;  3MEV A;  2CND A;  5KH6 A;  2WJV A;  3A3G A;  2FPE A;  2EYY A;  2FHD A;  1VQK B;  4FL6 A;  3HPW A;  4DQ2 A;  3QZ5 B;  4JRP A;  4M77 B;  1E3Z A;  4QQG A;  1FRQ A;  1AVZ C;  3JB9 J;  1NEB A;  1R5N A;  4M77 C;  4FXU A;  5CK9 A;  1H3H A;  2P84 A;  4P6V F;  1GFC A;  1SSF A;  2JM8 A;  2X3X D;  2OTL Q;  2M51 A;  1MUZ A;  3MP1 A;  2RHZ A;  4M75 D;  5LJ3 f;  5LL6 S;  3CCM T;  1IZ6 A;  2KY9 A;  2JW4 A;  1TWB A;  4M7D D;  4J7I A;  3HP9 A;  3OE7 A;  4C5G A;  1BMF A;  3RY8 A;  5IN1 A;  2YWH A;  1RAB B;  3J7A F;  3QDF A;  1PM3 A;  4MMK A;  3SHW A;  4IIO A;  3VS7 A;  4NL2 A;  1ABO A;  2HDN B;  3PFS A;  4NCN A;  1HA3 A;  5GJW B;  3BH4 A;  2DKG A;  2CZ7 B;  3CCM A;  4TMV A;  1FX7 A;  4E7Z A;  4P26 A;  4QVC A;  5GAN 4;  3HFN A;  2K5F A;  3Q6Q A;  4B9X A;  4C8Q D;  3CPW B;  1ZA1 B;  2HZY A;  2MI6 A;  1JJ2 A;  2W6J A;  1K73 C;  1YI2 Q;  3CC7 T;  2M02 A;  5LJ5 e;  1ZSZ C;  3I35 A;  1KK2 A;  1ZBX A;  3REA B;  1W4S A;  2ZZG A;  1PCX A;  3LLR A;  2BKD N;  3I56 Q;  1VQ6 B;  2QTZ A;  4JMQ A;  2L0A A;  1K8A R;  3CRZ A;  3PMI A;  1D3B B;  4WCI A;  4Z8A A;  1GBR A;  4YAU A;  1WDX A;  2PZ1 A;  1FMK A;  2FL7 A;  3V8J A;  3OYE A;  1YHQ T;  3M0S A;  3L2V A;  3CCR T;  4G1V A;  5KW9 A;  2RJC A;  4ELZ C;  2V7X A;  2XNJ A;  2KRM A;  3ZZU A;  5GV7 A;  3JCM h;  1NJI D;  1JA1 A;  3BDL A;  2BTT A;  4RTX A;  1Q82 D;  4V2S A;  4OGE A;  2RO0 A;  3X26 B;  1XE1 A;  2L3Q A;  5EMN A;  3SDZ A;  3EG2 A;  2XZP A;  1I7P A;  1NJI R;  3CCL T;  2V8J A;  4L8J A;  4HCB A;  3OYA A;  1WFW A;  2ZZE A;  2JZ2 A;  2GBQ A;  2K3Y A;  2LNH B;  3F70 A;  1KC8 C;  4EPC A;  2FRW A;  3I56 T;  5J3O A;  4QQD A;  2QK0 A;  3CME B;  3NHN A;  4M78 C;  1OZ3 A;  2FYK A;  4IUP A;  3V7C A;  1G5V A;  3AT1 B;  2XOK A;  2GK6 A;  2MK5 A;  2YWW A;  4B47 A;  3QFS A;  1R77 A;  3OA6 A;  2JOY A;  4HVU A;  2GJR A;  4F17 A;  2M5S A;  2DO3 A;  3L1A A;  2RJE A;  3D7S B;  4M7A D;  1FX0 A;  2JS2 A;  1BPL A;  1ZLM A;  1QVF P;  1ZM3 A;  4BB7 A;  1GO2 A;  3CCU Q;  3A8K A;  4PFO A;  1BB9 A;  3NGP A;  3BY1 A;  5BSY A;  2RC5 A;  1LNX A;  4QFM A;  1I07 A;  1E1Q A;  3PUM A;  5FL7 A;  3VYG A;  4M2L A;  3SKB A;  1MMA A;  4C8Q B;  1KTV A;  3VS3 A;  2D74 A;  3M5A A;  2DNU A;  3R6N A;  5FWB A;  4ZGE B;  1WGS A;  2SEM A;  3OQ5 A;  1EP1 B;  1K9M C;  5GAN 3;  4PAB A;  4CC7 A;  4ZGN B;  2PUK B;  2PU9 B;  4KRT A;  4CC4 B;  4PKC C;  4TMZ A;  3OEH A;  2CZ0 B;  1RLP C;  3QII A;  1EX4 A;  1KD1 R;  1ZX6 A;  3NE5 B;  8AT1 B;  2XZO A;  1UTI A;  3RKX A;  2OK7 A;  4KGZ B;  3DKM A;  2FRY A;  1P4M A;  4Z89 A;  2HCK A;  3PMT A;  3CCQ T;  3B82 A;  4X9D A;  3M56 A;  2IG0 A;  4LDY A;  4M7A F;  1J9Z A;  5A88 A;  1LJO A;  2YRV A;  4Y9U A;  2K3B A;  2WSE E;  5KYU B;  1YHQ Q;  3Q38 A;  2QA4 A;  3SJZ A;  3I5R A;  3CCE Q;  1PSF A;  4WZL A;  3J81 E;  1NYF A;  4CC2 A;  2AZV A;  3JCM f;  4HE5 A;  2RHX A;  1V0F A;  5FU6 C;  4J7F A;  2HDA A;  3J80 E;  1H42 A;  1QVF S;  2D9R A;  3OYY A;  4PJO F;  4RPB A;  3E1Y E;  1VYU A;  4DOV A;  1AWW A;  2E6N A;  1QQJ A;  4AVZ A;  3OJX A;  2R5M A;  3OW2 B;  3CC2 T;  4ASU A;  4QQ6 A;  1QUE A;  2WR8 A;  4C0S A;  3P8H A;  3OZV A;  2NLU A;  1C6V X;  5C0M A;  2DEQ A;  2E3I A;  4PAA A;  2DZC A;  2QQB A;  2VBU A;  1PD1 A;  3CD6 B;  1FNB A;  2EQK A;  1W9X A;  2YDL A;  2V7W A;  1YCS B;  2XHC A;  3CC2 A;  4J9G A;  2O9S A;  5GAM f;  1VQM Q;  4JRK A;  3B8H A;  4RCB A;  1M27 C;  3V7R A;  4XR6 A;  1G3T A;  2IPO B;  4J9H A;  1X6B A;  2ZGW A;  3AHU A;  1Q9S A;  3CP8 A;  3CCV Q;  2YUN A;  2E6Z A;  4PJJ A;  1ZM2 A;  4YAL A;  1IB0 A;  1X2Q A;  4KKS A;  5FU6 B;  1WXT A;  2OTJ B;  4II3 A;  2ZPH B;  5GAO p;  2BZY A;  4XOR A;  3MCA B;  3T51 B;  1I0C A;  4TMX A;  1VQ4 B;  2VYT A;  2VBV A;  1IRE B;  1VQP B;  4XKW A;  2PVG B;  1QVG S;  3G4S Q;  4NL3 A;  1AZE A;  1YIJ Q;  1E64 A;  3WNC A;  2E12 A;  5KE2 A;  2LP5 A;  5I2S A;  3BC9 A;  4A4H A;  4JJC A;  2V1R A;  3MEW A;  4G6I A;  2QXF A;  2WYR A;  2C0T A;  1FMW A;  4U9U A;  4RCZ A;  3E2U A;  3CCV T;  1T6Z A;  1U3O A;  3J81 k;  3PA1 A;  5KYX A;  1M1K U;  1G8X A;  2CZ6 B;  1VQM A;  3CME A;  1UGV A;  2OJ2 A;  3FLG A;  2CP0 A;  3LH0 A;  1YJW A;  3RES A;  1RAI B;  2E64 A;  2ECZ A;  4F7U A;  3CCV A;  2ZL7 A;  4XTZ A;  2ROL A;  2FX3 A;  2PE3 A;  2HQE A;  2GTO A;  1XTD A;  3EGU A;  4LC0 A;  4P2N A;  1N27 A;  3TEE A;  1CQX A;  2GFA A;  2RH2 A;  4JJN K;  2AHO A;  1QCF A;  2AZS A;  1K73 U;  4J9F A;  4P25 A;  4J9I A;  2H3E B;  2RQV A;  1T5E A;  3Q39 A;  1VQ6 A;  3JQP A;  2OAU A;  3OMG A;  4DBQ A;  2KXD A;  5F4M A;  1YIJ A;  3CCE T;  5JBQ A;  3JCM X;  1WPY A;  2R5A A;  4AG2 C;  1EFC A;  1N9R A;  1DG1 G;  4G5G A;  2R6H A;  3KXT A;  4M7A B;  1LVK A;  2EYW A;  2JT4 A;  4EMK A;  4OMO A;  3CC7 Q;  3W2E A;  2QDY B;  1E6G A;  4FCY A;  2COY A;  1QVF A;  2C5H A;  5FA6 A;  4M78 B;  2F1L A;  1MRZ A;  3D26 A;  2X35 A;  5IK2 A;  4LDW A;  5DY9 A;  3CCJ T;  3OBW A;  5TR9 A;  1PKV A;  1D1N A;  3I55 A;  1OYX A;  1GFD A;  1W2B B;  1KQS A;  2X6Y A;  4N3N A;  3A8I A;  4KGX B;  3WQZ A;  1V1C A;  3GSI A;  4PJM A;  2LT4 A;  1T0J A;  4J83 A;  3TU4 K;  5KCH A;  1QG0 A;  4P12 A;  2V31 A;  1S72 A;  4FSS A;  1AEY A;  2NUP A;  3WXM A;  4NNJ A;  3V8L A;  2EQI A;  1OQK A;  5CKF A;  3EG9 A;  2VZL A;  2E65 A;  3R6K A;  4C8Q E;  3CPF A;  1VQ4 A;  1MAB A;  3PVD A;  1QFY A;  2ZPI B;  1W1F A;  5GAM h;  1ZUN B;  3OZU A;  4C92 F;  2QTV A;  3OAA A;  2D0N A;  1S0U A;  1H8K A;  1Q82 C;  2F69 A;  1D2E A;  3VO1 A;  3UF4 A;  2SRC A;  1W70 A;  3HRU A;  2CP7 A;  2RMO A;  1B34 A;  5J26 A;  2EBP A;  5I2M A;  2OTL A;  2E1H A;  2FO0 A;  4TN1 A;  1VQ7 B;  3AGQ A;  1W87 A;  1VOM A;  2F5K A;  3CP2 A;  1OX9 A;  3GF5 A;  2WZP P;  3BE3 A;  4TMT A;  2GQF A;  4EMK C;  4FYW B;  3ZZT A;  1MND A;  4OMP A;  3UWN A;  1HZE A;  1M2V A;  1K9M U;  1XFO A;  2E1R A;  2X9H A;  4J8O A;  1BJK A;  4FK8 A;  2CS7 A;  3CCM Q;  1ZQ1 A;  2CP3 A;  5DLO A;  2OTJ Q;  5GV8 A;  1RAF B;  4MYT A;  3CCL Q;  2E1B A;  1BU1 A;  2DAQ A;  4OP7 A;  2O31 A;  2PVO B;  4QHY A;  2W0Z A;  4C92 D;  1VQ4 Q;  4LN2 A;  8ATC B;  4WZK A;  3E9F A;  4M75 E;  1BK2 A;  4C0Z A;  4OMM A;  5DN6 A;  3OKX A;  2HL3 A;  2RK2 A;  1T3L A;  3V76 A;  1VQP A;  4Z4S A;  1Y0Y A;  2KDS A;  4R56 A;  1NYG A;  1W0K A;  1KJW A;  4ATO A;  3JRZ A;  2V26 A;  3S6W A;  1Y96 B;  1BI3 A;  3MPU B;  4XU2 A;  3UT1 A;  3JQR A;  5FWC A;  1EZZ B;  1VA7 A;  1UMK A;  3VYH B;  3L2Z A;  5CO7 A;  2RD1 A;  3EGX B;  2HQH A;  5GMK i;  3WYA A;  4Z4W A;  2ZXI A;  4LDV A;  3LQE A;  4IW3 B;  4RCC A;  2XI9 A;  5LJ5 h;  2IIM A;  3FDR A;  3C95 A;  2BV3 A;  4LE9 A;  2BZ8 A;  4D8K A;  2CK3 A;  4DOW A;  3VNU A;  1V76 A;  1CKA A;  2J6F A;  2ZIT A;  3CMA T;  2C4U A;  4PLL A;  5A89 A;  2D8H A;  1YJW B;  3HL8 A;  2MCN A;  3VJP A;  1EXM A;  3OW2 S;  2B7C A;  3CCL A;  1NLO C;  2Q6I A;  4A4E A;  2BIV A;  4RD2 A;  2K2M A;  5CR2 A;  3WBK A;  2EYQ A;  3JCM Q;  3JQQ A;  4KH0 B;  1KHI A;  5GMK h;  2CP6 A;  1WHK A;  2KVO A;  1QMC A;  1BI0 A;  4XLA A;  5IYN A;  4XN3 A;  3CMM A;  1JB0 E;  4A63 B;  1RQR A;  1MMG A;  2L8D A;  2RN8 A;  4XN0 A;  2DL3 A;  4DK0 A;  4M78 D;  1TH7 A;  3W2H A;  2RK1 A;  1K4U S;  1QFZ A;  1JNY A;  4X7F A;  4PK4 A;  2Y4Y A;  1IJF A;  3CCU B;  1KK3 A;  2XIC A;  4XM3 A;  1G3S A;  4EMK B;  4AF6 A;  1JBM A;  4A53 A;  4TKO B;  2AK5 A;  2CGH A;  1FNM A;  2MOX A;  5A0G A;  1M1G A;  5IXF A;  1WXB A;  2OTJ T;  2VYQ A;  1YNZ A;  1M2V B;  3H0H A;  1GAQ A;  3H6Z A;  1KK0 A;  2CP5 A;  1U2R A;  4KGV B;  1S72 T;  2DBK A;  2MWO A;  1U8R A;  3GVL A;  3QUI A;  2DIL A;  2QTL A;  2ED1 A;  4R71 A;  1E7O A;  2QQS A;  5F4J A;  3MP8 A;  5FRN A;  4PL6 A;  1K0S A;  1PKS A;  2HAX A;  4PFP A;  2DRM A;  4NS5 A;  4C92 E;  1TG0 A;  2NUT A;  1YIJ T;  1RAD B;  2YUQ A;  5KSW B;  1YI2 A;  4AFU C;  1UGR B;  1QP2 A;  1OB0 A;  4WTO B;  5GAN j;  3M57 A;  5BSX A;  3CW2 A;  2HBW A;  1WJS A;  4AFS C;  1JXO A;  5LMZ A;  4M77 G;  2DZ9 A;  5GMK j;  4XQ3 A;  1SPK A;  1TUC A;  2K3X A;  3UA7 A;  1D1A A;  1B34 B;  4Y7C A;  4RDK A;  2L89 A;  1YN8 A;  2VXE A;  6AT1 B;  5KYW B;  2DYI A;  3EFR A;  4JJD A;  2ABL A;  3CXC A;  2Y90 A;  3C94 A;  2KE9 A;  5LJ3 h;  5DSZ A;  3DLL A;  5IT9 E;  2YXY A;  1B23 P;  2RQR A;  1EIF A;  4M7A C;  4M75 C;  2NV4 A;  1WHL A;  2B86 A;  3OYM A;  2A08 A;  4O6J A;  5GMK e;  4BUG A;  1U1S A;  2JMC A;  3G4S T;  4LD9 K;  1UEC A;  2E10 A;  2GQI A;  4OML A;  4HA8 A;  4LBV A;  4M53 A;  4ANJ A;  3CC2 Q;  1M1F A;  2GF7 A;  3U6K A;  2OBS A;  2L2P A;  1VQL T;  2BGJ A;  3W5U A;  5IYW A;  3MHX A;  4XTX A;  4KT0 E;  1KSW A;  1WHH A;  2IVW A;  2HBP A;  4L6V 5;  4HT9 A;  4PFZ A;  4YTL A;  1I1J A;  4HCK A;  2ZBU A;  1UUE A;  3L42 A;  4Y9R A;  1T6X A;  1VQ9 B;  4JS5 A;  3HSB A;  4Z4Z A;  2O01 E;  4B44 A;  3CCU A;  1VIE A;  4RLZ A;  4PLI A;  4ZGJ B;  5GAN h;  2YWG A;  3X28 B;  3A8H B;  3QXE B;  2NUZ A;  1OEB A;  5L46 A;  3QDR B;  2VGN A;  2ZZD A;  2X6X A;  2COZ A;  3W5V A;  3SJP A;  1JA0 A;  4B9W A;  2C4T A;  4Y28 E;  1NG2 A;  1DAR A;  3P8D A;  1OU8 A;  2VAS A;  2C0O A;  1KQ1 A;  3ME9 A;  3MJX A;  4PJL A;  4N4G A;  4R0K A;  1UEB A;  2QMU A;  4DNT B;  2HMA A;  2XU8 A;  1Y07 A;  2ZPF B;  4JZ3 A;  1O75 A;  2RI5 A;  5LJ3 j;  3FKS A;  3MP6 A;  5DLQ E;  1SM4 A;  1IRX A;  1VQO Q;  1I5L A;  4PJO A;  1E63 A;  2K5I A;  1UGS B;  2O88 A;  1QCO A;  1QGY A;  1VLY A;  4P6Y A;  4BAC A;  2A28 A;  2OX7 A;  4E6R A;  4C0D B;  1QVG P;  2Q6K A;  1XQH A;  3G6E Q;  2CYZ B;  2DTI A;  1Q82 U;  3QFC A;  4RD3 A;  1UD5 A;  3ONY A;  3P26 A;  4PGO A;  2LQ8 A;  2A36 A;  2FZK B;  1XOV A;  1M30 A;  1Q7Y U;  4X8I A;  2DFU A;  4RG8 A;  1UJ0 A;  3QPH A;  2KEA A;  2C06 A;  2X4J A;  1BCM A;  2EW3 A;  3GLX A;  1ZHI A;  2E3H A;  1HYO A;  5IAY A;  1QFJ A;  4XK8 E;  3ONU A;  5F4O A;  3I55 T;  1KZL A;  3MKD A;  5GAN f;  1RI9 A;  2KBT A;  3HKS A;  4BY6 B;  5CIU A;  2F4N A;  2LDM A;  3B78 A;  2ROT A;  2WSF E;  4Z1M A;  2DVJ A;  3CCQ A;  2WSC E;  1K9M R;  4PJO E;  1E3X A;  1JJ2 P;  1M90 R;  1KJZ A;  2EJ9 A;  3OYH A;  1OZ2 A;  1WOP A;  2DIE A;  1IGU A;  1ACM B;  2V8I A;  1NEG A;  2KQW A;  1G3W A;  1EP3 B;  5HY6 A;  1PNJ A;  1KRH A;  2K2V A;  1QVG B;  4RD6 A;  3MO8 A;  3LYI A;  1WP6 A;  2KT1 A;  2JDI A;  3SB2 A;  3VUZ A;  2GK7 A;  4Z02 A;  1W0J A;  4NBS A;  2V8K A;  4XMY A;  1Q86 D;  3LX7 A;  4EH1 A;  4C5E A;  2RPN A;  2V4D A;  2DER A;  1WSR A;  2GCX A;  4B4D A;  5GAM j;  4PJO D;  4FWT A;  1AT1 B;  2XNC A;  1SHG A;  2DF6 A;  3ASR A;  2CSI A;  5EC7 A;  2CH4 W;  2A0F B;  5KYY A;  5IHK A;  2VWF A;  1N8R C;  3EFS A;  3HFO A;  1V29 B;  4LD6 A;  2OI3 A;  3OYC A;  2DD4 A;  2QQ9 A;  2KR3 A;  2DJQ A;  2EGE A;  3PNW C;  5KYW A;  2X8K A;  3AGP A;  4BE1 A;  3OYL A;  2QYZ A;  4X06 A;  3GIB A;  2ESW A;  3H0I A;  4PJO B;  1EFT A;  1FYN A;  1OI1 A;  1K76 A;  3EG3 A;  9ATC B;  4JLI A;  4C92 G;  3OPO A;  1A0N B;  5CAI A;  2YSQ A;  1NPP A;  2P0P A;  3ZL7 C;  4F14 A;  1VQ5 T;  1EP2 B;  3GP8 A;  2OTL T;  1D09 B;  4AF7 A;  3CBP A;  3GIR A;  2JM9 A;  2QQA A;  2V1Q A;  3INZ A;  4VUB A;  2E5Q A;  3A8O B;  5CKH A;  1R5O A;  4G7W A;  4N3G A;  1NB0 A;  1MMN A;  4WWV A;  1OGI A;  3CCJ B;  1DDG A;  1N0U A;  4WZE A;  1WTH D;  2OTJ A;  4FSX A;  2PNI A;  1WJQ A;  1VYT A;  4ACA A;  1UD4 A;  2DD5 A;  3HRS A;  1Q81 R;  1VJS A;  2EPD A;  3RKY A;  3UDC A;  1M3A A;  2E70 A;  4ZNX A;  1T3S A;  1SF9 A;  1VQM T;  3CQT A;  1HK9 A;  2KK4 A;  3OW7 A;  2QA4 B;  3VV0 A;  1C0M A;  5GAN 5;  3NTH A;  4XLF A;  1Y0M A;  5GAN 8;  3M53 A;  4B3G A;  3H8Z A;  2W6I A;  2XD0 A;  2JTE A;  1QWF A;  1W2B S;  1M3C A;  2L3S A;  1VQ7 Q;  3LQ6 A;  2V7T A;  3FEO A;  5I11 A;  3CC7 A;  2D8J A;  1PRL C;  5LJ5 j;  3EHR A;  4XQF A;  2EQU A;  4OMN A;  1YIT A;  3CCS A;  1VQ8 A;  2DJZ A;  2F2W A;  4AFQ C;  1BQE A;  1K8A D;  2OBT A;  2HLD A;  4M78 G;  3H41 A;  2VNJ A;  1N8R U;  4K11 A;  2YWF A;  2ZZQ A;  3RR6 A;  3LO8 A;  3CD6 A;  1GXI E;  5GAN e;  4X05 A;  1TUI A;  3L2U A;  2DL5 A;  2XMF A;  1GAW A;  1N9S A;  4BI4 A;  4F7U B;  3R6J A;  3CCV B;  4MZM A;  3CBM A;  4KKT A;  4DEY A;  3W2I A;  1ZSZ B;  2DBM A;  1UD8 A;  3A8M B;  5HZB A;  3CMA Q;  2MWP A;  1JEG A;  1JQQ A;  1RAE B;  2QGG A;  5IHI A;  4F7U G;  3S3O A;  4LDX A;  2DA9 A;  3OS5 A;  4FM4 B;  4E7L A;  1R5B A;  3OZW A;  2HKQ B;  4KH1 B;  4RD1 A;  2K6D A;  1MGQ A;  4E7H A;  4B3F X;  1UDL A;  3M0R A;  4PC7 A;  2DIQ A;  3CPW P;  1W2B A;  2CW5 A;  4P3Y A;  2JVV A;  1YIT Q;  2DYB A;  1IGQ A;  1N8R R;  1BCO A;  2VJJ A;  1FXX A;  2EKH A;  1G2B A;  3DB3 A;  2DX1 A;  2E41 A;  2VKN A;  3AVY A;  1S72 B;  1X27 A;  2JTF A;  3DDY A;  4ME7 A;  4F7D A;  4M4Z A;  3PUN A;  2QEX A;  2QGF B;  4M78 E;  2C5B A;  1TTH B;  3M4G A;  2GJP A;  4GLM A;  1VQK Q;  1PJ5 A;  1YI2 T;  2XDD A;  2DK3 A;  1VQM B;  1QW1 A;  2E4H A;  3E20 A;  1VUB A;  4OPO A;  4M78 F;  3M58 A;  1I8F A;  1MV0 B;  3SWN B;  1VQ5 Q;  2LZ6 B;  2KNB B;  3EFO A;  4M77 E;  2DM1 A;  3WNB A;  3PVQ A;  2DOG A;  3VS2 A;  2GGR A;  2LJ3 A;  1KQS S;  4M7D B;  1Q86 C;  2YUO A;  2F2X A;  2X4X A;  1VQN T;  1M3B A;  4ZTJ A;  2VV5 A;  1E6H A;  3OP1 A;  4C8Q G;  2YHT A;  1D8T A;  2CH4 A;  4CC3 A;  2DET A;  2P4T A;  2WPD A;  1T6Y A;  1YBY A;  2OTL B;  1H8E A;  2GFU A;  4Y91 A;  2M0O A;  1YIJ B;  4C92 C;  3TQ7 P;  3Q3A A;  2J05 A;  2RJD A;  1YJW T;  3CCJ Q;  1WQ7 A;  1X01 A;  1X69 A;  4QVJ A;  3M59 A;  2H3J A;  2CT4 A;  1TLL A;  3FIF A;  2OBR A;  1WHM A;  1IB8 A;  4RTT A;  3DLM A;  1NM7 A;  1KHC A;  1VLO A;  2LMJ A;  4C0D C;  2NPF A;  5E6T A;  2JTM A;  1BKB A;  4IUV A;  3FPP A;  2O9V A;  1EFN A;  3P8B B;  2FVG A;  2HEQ A;  1JU5 C;  2J6O A;  3OYF A;  4PJN A;  1WX6 A;  4LDU A;  3CCU T;  4KKU A;  3WXM B;  1BI2 A;  3RER A;  3I56 A;  4QVZ A;  4J6Y A;  1VQ6 T;  1RUW A;  1GCQ C;  1GRI A;  4Z88 A;  2EGC A;  2KVQ G;  1YX2 A;  1AIP A;  2LX7 A;  2D1X A;  3GBQ A;  4J6X A;  3G71 A;  4PNO A;  2CRE A;  2LT1 A;  1X43 A;  3JCM g;  3CC7 B;  2BSA A;  5HKC A;  2ED0 A;  1R8O B;  3HTR A;  5GAO m;  3M0U A;  3E9G A;  2I0N A;  2LCC A;  1KG1 A;  2FZG B;  3JCM W;  4E7K A;  1GCP A;  1QH0 A;  1IO6 A;  3I1F A;  3FRN A;  2VNK A;  5TV2 A;  3JB9 G;  4TSF A;  1V0E A;  1Q81 U;  3CC4 B;  1BYM A;  4ZCL A;  2VXF A;  4AG1 C;  2HSE B;  5KNL A;  3G6E A;  4II2 A;  2J7I A;  5FIU A;  2A7Y A;  1YJN B;  4WF2 A;  4AT1 B;  3CCR B;  5CQY A;  1QUF A;  3S3N A;  3OY9 A;  2EFG A;  2OYN A;  1KD1 U;  3O5Z A;  4E47 A;  1M1K C;  2DE0 X;  3JB9 D;  1RI0 A;  4Y92 A;  3CC4 T;  1YJN T;  1RAG B;  2DMO A;  3LNN A;  1Q7Y D;  1JXM A;  2VGM A;  4DBR A;  2ZTG A;  3JU4 A;  3EAE A;  2GQV A;  4RTZ A;  4A4F A;  4YEL A;  3G71 Q;  3QSY A;  4MZP A;  1S4M A;  1UGP B;  2M0Y A;  5GAN d;  3LVB A;  1N05 A;  2BN4 A;  1W6X A;  4UC4 A;  3OYB A;  1OB2 A;  2CDT A;  1Y96 A;  2P4R A;  5GAO q;  2Z0W A;  3M55 A;  2FEI A;  2X53 S;  3AVT A;  2EQJ A;  1ZM4 A;  5FU7 C;  1WHG A;  1KK7 A;  1N08 A;  5FNZ A;  2BM0 A;  4P3I A;  2EWN A;  3LGL A;  4ZN1 A;  3GNG A;  4LXC A;  4XTU A;  3LW5 E;  4P5N A;  1T0H A;  1M4Z A;  2KI7 A;  4EDU A;  3ISX A;  2PIA A;  4LBW A;  3CCE B;  4MML A;  1FND A;  4YAO A;  3ZBD A;  2PLF A;  3VR6 A;  3FC3 A;  2BUD A;  1VQ7 T;  1YLO A;  2JJ1 A;  2LNV A;  5HKK A;  3CCM B;  2PQW A;  4F16 A;  4G1B A;  3M4Y A;  3CPW S;  3JB9 F;  1QX4 A;  5GMK m;  3VO2 A;  3URG A;  4C43 A;  1QKX A;  2PMD A;  1GCQ A;  2CRV A;  5GAN 7;  3OS0 A;  3VS0 A;  2X4W A;  1WU8 A;  5H59 A;  1YJ9 Q;  2AIR B;  4N4H A;  2EGA A;  3E19 A;  3VRY A;  4XLH A;  3LWH A;  4M7D A;  2AKL A;  3NFC A;  1OV3 A;  1OU9 A;  2DY1 A;  5CDF A;  3ZEH A;  3NPF A;  4MZT A;  4MDX A;  5DM7 R;  4BPR A;  3OBY A;  2F43 A;  5HK0 A;  2RB6 A;  2DCU A;  1JB9 A;  4PC1 A;  1K0X A;  4XLC A;  5ECA A;  2HNI A;  2Y4X A;  4RTW A;  2P0Q A;  5CQX A;  1DDI A;  2CBX A;  3PGG A;  4TVR A;  3HHT B;  2DIG A;  1WA7 A;  3M0Q A;  2EFI A;  1Y57 A;  1YJN A;  3G6E B;  4OB1 B;  2QG9 B;  1M9S A;  1BIA A;  2ZPG B;  4EMG A;  7AT1 B;  4Q5W A;  1CNE A;  4DQL A;  3AVX A;  4B3X A;  1B2R A;  1PSE A;  1KFZ A;  4X07 A;  4J9E A;  4ORZ A;  5IXB A;  1XJW B;  2LJ1 A;  4EIK A;  3LWI A;  1NB9 A;  4E0F A;  1YHQ A;  1V5V A;  2KYB A;  1UGQ B;  2LTO A;  1PG5 B;  4PJO C;  2HCJ B;  2RJF A;  3OW2 P;  1YJ9 A;  5GAM d;  3EH1 A;  1UFF A;  3NMZ C;  1JJ2 S;  1W34 A;  2JUF A;  4X9C A;  2EYZ A;  3QSU A;  2O4X B;  2YLB A;  3O8V A;  3G71 B;  4B48 A;  3EHQ A;  3PE0 A;  2QTX A;  2GRE A;  3ASP A;  4TMW A;  4RKU E;  4P22 A;  2ZPE B;  2QDL A;  1X6O A;  3OSV A;  4O5V A;  2FVU A;  3CD6 T;  4UZE A;  1LPL A;  1OPL A;  4BDY A;  3G71 T;  1Q95 G;  4E7I A;  4HVV A;  4JJB A;  3VUB A;  4L59 A;  4QT7 A;  2KRS A;  3OYK A;  1X6G A;  1YJN Q;  1PJ6 A;  3AVW A;  2RHU A;  4M75 A;  1YIT T;  1VHO A;  2X3U A;  2BE9 B;  4PC3 A;  4E2F B;  2QAZ A;  2HQX A;  5IYQ A;  4RCY A;  3ZPN A;  5A2Q E;  1Q86 U;  1F1B B;  2A37 A;  3QWY A;  4FT2 A;  3CCR A;  4GBQ A;  4XAX B;  1U5S A;  1TXQ A;  3VRZ A;  4BE2 A;  1CSK A;  1YP5 A;  4CI0 C;  4M1K A;  1S1N A;  1KC8 U;  1NE8 A;  2K57 A;  1NPR A;  4A54 A;  1D0Y A;  1WOR A;  5D6X A;  4J5Y A;  2MMP A;  4YXW A;  3QYG B;  3G6E T;  2EIF A;  2J06 A;  1KIK A;  4HIZ A;  4KBM B;  1GJR A;  1QVP A;  1HJD A;  1CKB A;  1RAA B;  4AC9 A;  5GAN 6;  1HD3 A;  1SEM A;  1KD1 C;  4OMF B;  4CRI A;  4L5G A;  4HCC A;  3U23 A;  4YHB A;  1O9S A;  1COW A;  3V8K A;  2AHJ B;  1N5Z A;  2CC2 A;  3JCM d;  1QVF B;  5D6Y A;  4F04 B;  1P92 A;  2B7B A;  3ZIA A;  1OX8 A;  2VC8 A;  1VQN Q;  1ABQ A;  1ZBJ A;  1UJY A;  1R0C B;  2Q6L A;  1B3Q A;  1SG5 A;  2COW A;  1KQS B;  5I22 A;  2RI3 A;  4J0Q A;  2PTK A;  3I55 Q;  4Z4Y A;  3PIO A;  3SEJ A;  3IQL A;  1XQB A;  5HXB A;  3OYN A;  4YAF A;  3ULR B;  2RHY A;  3PA2 A;  3RMS A;  2BM1 A;  5KYX B;  3VNV A;  1PHT A;  1BX0 A;  1UD6 A;  2JS0 A;  1XB2 A;  1WI7 A;  2DVE A;  4JZ4 A;  2DTO A;  4XTY A;  3PIP A;  2QA4 T;  4XKV A;  3WBJ A;  1S72 Q;  1BLI A;  4M7A E;  4QVA A;  3SLN A;  1YJ9 B;  3EG9 B;  1OB5 A;  2LJ0 A;  3CC2 B;  1VQK A;  4HE6 A;  2GTJ A;  2BPO A;  2KXC A;  1M8M A;  4AMC A;  4OOV A;  1I18 A;  1RAH B;  3TRE A;  4C5H A;  3OYD A;  4R55 A;  1JO8 A;  2F5T X;  2HSP A;  3CPX A;  1MHN A;  2VVK A;  4OPS A;  3T9N A;  5LJ5 g;  2ZPB B;  1M1K R;  2XG8 D;  4DEX A;  2DL4 A;  3V7S A;  1EFR A;  3PVL A;  1VQ5 B;  1HXD A;  4ZTF A;  5KYN A;  3QFR A;  2YRC A;  1JRI A;  4RD0 A;  1Q81 C;  4RDL A;  5GAN g;  1MNE A;  3HRT A;  1ELO A;  2LZJ A;  3G05 A;  1WPC A;  5A0L A;  3UAT A;  4JS4 A;  2RNA A;  4M75 G;  4XOP A;  3VMF A;  1VQN A;  1WZO A;  4CQJ A;  3CCS Q;  1VQ8 Q;  1X2K A;  1U06 A;  2BE7 D;  1ZSG A;  1WJR A;  2J6K A;  2G6F X;  3KUF A;  3OYG A;  4M0L A;  3CCJ A;  1KK1 A;  3JAM E;  1UG1 A;  1UD3 A;  4TT3 A;  3CCL B;  2DXC A;  3L2Q A;  5L8R E;  3REB B;  4BI3 A;  4BI8 B;  2MAM A;  2L3R A;  1KQS P;  3ES9 A;  1AOJ A;  1NBE B;  2R58 A;  1I81 A;  2VNH A;  3ZBU A;  1B7T A;  1EWY A;  3EGD A;  4LNP A;  3MEU A;  1YHQ B;  1M90 D;  4C0F A;  1UHC A;  3FJO A;  4DNR B;  2WAC A;  1YCY A;  1SRM A;  5CVI A;  3T53 B;  3OYJ A;  3DB4 A;  4HCZ A;  3CMA A;  5I21 A;  2Z6B D;  2XZL A;  1X75 C;  2MPX C;  4UAJ A;  4XD7 A;  3X25 B;  1WXU A;  4Q7J B;  4D8D A;  1M5Q 1;  3ASS A;  3TVT A;  2VJI A;  2YWE A;  2XND A;  3M0P A;  1OGJ A;  3ASQ A;  4RD4 A;  2DXU A;  4KUL A;  2RHI A;  1TOV A;  1J3T A;  4OMQ A;  2LCL A;  2QE7 A;  4M77 A;  4RMO A;  1E62 A;  4FYY B;  4RPD A;  2GPJ A;  4OB3 B;  2MYS A;  3L2R A;  1WOO A;  3OS1 A;  2QQR A;  3CC4 Q;  1K9M D;  3CME T;  3SEM A;  3AVV A;  4M7A A;  4OF1 A;  2K79 A;  1ARK A;  3CXC S;  2YT6 A;  3TCJ A;  1YWO A;  3A98 A;  3KFV A;  4BDZ A;  1E79 A;  1HSQ A;  2QEX Q;  2WJY A;  2JN0 A;  4M75 F;  3GPL A;  3OB9 A;  1G7R A;  4DQK A;  5AYF A;  5AT1 B;  4GY5 A;  2RC6 A;  2L3P A;  3M9Q A;  4QW2 A;  4EMH A;  4PC2 A;  2V7Q A;  4M7D G;  3JCM c;  3WVD B;  1K28 D;  3KEW A;  3QYH B;  4M7D C;  2KT8 A;  1JJ2 B;  1VQ5 A;  1QGA A;  2CUD A;  5GAM g;  2MF2 A;  2VB6 A;  4C8Q A;  2VBS A;  1M8V A;  1VQP Q;  1MV3 A;  1H64 1;  5EG2 A;  1WSV A;  1XNI A;  1BBZ A;  2DRK A;  5DS0 A;  1KC8 D;  4WZT A;  3M0T A;  4XNF A;  4A4K A;  3N5B B;  1B07 A;  1H8H A;  4Z4V A;  1VQN B;  5FW9 A; 
#chains in the Genus database with same CATH homology
 2F1L A;  2DOG A;  3HTR A;  3A1P A;  1PM3 A;  2DYI A;  3H9N A;  2QGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...