2DYIA

Crystal structure of 16s ribosomal rna processing protein rimm from thermus thermophilus hb8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
162
structure length
162
Chain Sequence
MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Probable 16S rRNA-processing protein rimM
publication title Crystal structure of 16S ribosomal RNA processing protein RimM from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 31
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2dyiA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2dyiA01
2DOGA 3HTRA 2QGGA 2F1LA 3A1PA 1PM3A 3H9NA 2DYIA
chains in the Genus database with same CATH superfamily
3OAAA 2CT4A 2L0AA 1TOVA 3CBOA 5GMKi 4FN5A 2A08A 1Q86U 1YP5A 1KQ1A 3CCJQ 2RK2A 1GR1A 1RI0A 2DIEA 3T56B 3EGUA 1G3WA 3OS5A 4M75B 1SEMA 5FNZA 5LJ3j 1FNMA 2FVGA 2X4WA 1QFYA 2EQKA 2VNKA 3AVYA 3CCSB 5KYUB 2OYNA 4QUZA 2RI5A 1WDTA 2LNVA 4LUEA 2FZKB 1EP1B 3W2EA 1K73R 1I81A 3MP1A 1PJ6A 3MCAB 4M75G 1UD6A 1N9RA 5GAN7 4XNFA 2DFUA 2KXDA 4OMNA 3CCSA 1EXMA 5KYUA 2YWEA 2QEXQ 2BN4A 4GLMA 4LBZA 3INZA 4AC9A 1R5BA 4QKUA 4X05A 2ZXIA 2PU9B 3MCAA 3RBBB 3A3GA 3U23A 4C8QE 4PJOA 2O31A 5GAMf 2VZLA 2DMOA 4B9XA 2IVWA 2L3PA 2Y4XA 1YJ9Q 1UUEA 2CP7A 4QVAA 4EDUA 4M7AC 5D7UA 1OZ3A 4UZUA 2DJZA 1I7PA 1WFWA 1ZM3A 2CDTA 2Y4YA 1WIEA 2CSQA 3QWXX 2NUZA 5HK3A 1D3BB 1O9SA 3QUIA 3OYJA 1K0XA 1TVCA 4TKOB 4XN3A 1Q82U 2DO3A 4IUVA 4RG8A 4M4ZA 4RDLA 3OS1A 4M2LA 1D3BA 2ZZEA 4XTUA 1R5NA 3VYHB 1Q81R 3KEWA 3ZZUA 2K6DA 2C2WA 1X43A 2HBWA 5ECAA 1FYNA 3META 3JCMd 2ROLA 2Q6KA 4WWVA 8AT1B 4II3A 3FPKA 3OPOA 2F2XA 1FMKA 3OEEA 1QWEA 3QIIA 5GJWB 3J81k 3CCSQ 2EAYA 2OTLT 1T0JA 4KUIA 4X9CA 5CCAA 1I1JA 2JOYA 3BC9A 2QASA 3LWHA 4KT0E 1WPCA 1SKYB 1VQ8T 2LDMA 1H641 3REAB 1QMCA 1Q81C 2BGIA 1D1CA 1IZ6A 2GGRA 5A0DA 1Q82C 4J9DA 3AT1B 3CBPA 3EHQA 2DBMA 2J6FA 4RM0A 2JZ2A 2AT1B 3OW7A 1N8RR 1LOJA 3EGXB 1TUDA 4PLIA 4ELZC 1IJEA 3VV0A 5GAOn 3FRNA 1I4K1 2XKOC 4AF7A 2A0FB 2CS7A 3AVXA 1WXBA 2J7KA 3EGXA 3E9FA 4MMLA 1N0UA 2GJRA 4RD2A 3CCUB 1YJNB 3Q6QA 2YRVA 4NL3A 1YJWT 2CC2A 5LJ3e 1VQ9T 1JU5C 4M75D 4JJCA 4M7AB 2MWOA 3HP9A 4KGZB 1UJYA 2MYSA 3CCUA 1YJNA 5FO1A 4G1BA 2LQNA 2EGAA 1YWOA 3MEUA 1UFFA 3OBWA 1W2BP 4M7AG 4M7AA 4FWTA 1T6YA 1QCNA 4KGVB 1N8RC 1I18A 4A4HA 3HL8A 3EFOB 2DTIA 4X0CA 1EZZB 1UGQB 3VS2A 2RHZA 2DF6A 1K9MD 1X6BA 2DLPA 2XDBA 2V8JA 4DA4A 1KD1R 3ONUA 1TS9A 2F2VA 3JCMf 2O01E 2MIOA 2VKNA 3EFOA 3CCQA 3A8MB 4J6YA 1FMWA 4IURA 2KE9A 2CZ1B 4P25A 2V26A 2BMWA 1W0KA 4X07A 1X6OA 1KQ2A 1D0ZA 4E7LA 4P3YA 5A0LA 1RLQC 2HDAA 4OB3B 2X6YA 1U06A 5KE2A 1G3TA 2ZTNA 1QKWA 4MDWA 1GFCA 3VKIA 2QAZA 4DK0A 5DS0A 3RIRA 4C43A 1AVZC 3M4YA 4LD6A 4JRPA 2RJFA 4XU0A 2FEIA 3A8GB 1YI2B 1OGJA 4X7DA 3X28B 1GBQA 1PSFA 2WSSA 2GTOA 5AT1B 4XD7A 2MI6A 3W5UA 2KRMA 1TH7A 3CMAA 2GBQA 1I5LA 1YJNQ 3GP8A 1YI2A 4AF6A 3BH4A 3C12A 1UEBA 4WZLA 3FJOA 3VUBA 5B6IA 1ZA1B 2RMOA 2X3WD 1G7TA 3CXCP 2L8DA 4G5GA 2BZ8A 2JMCA 4A4FA 1EFTA 1QGYA 3E1YE 3OA6A 4PJOE 2VXEA 4K1XA 2V8KA 2KSSA 3QZ9B 3GBQA 1YN8A 1MNEA 3QYGB 1VQ4T 3SKBA 1NPPA 1UHFA 2GFAA 1BIAA 4JJBA 5GMKl 2EYQA 3VNUA 2PMDA 2DL8A 2SEMA 4CI0C 4LDUA 4HT8A 1K8AR 1U8RA 1VQMT 1OPLA 4AFSC 1Y7XA 1WX6A 1JO8A 2BSAA 1Q7YD 2EKOA 5J26A 3CC7T 1DG1G 1I8DA 4JRKA 1PM3A 1W87A 1IHVA 5HCKA 2LJ1A 4OMFB 2ECZA 3MO8A 1BX1A 2EQJA 4BI3A 2R6HA 2K9GA 1XQBA 2RO0A 1ZM2A 1X6GA 3CMMA 5FRMA 3V7RA 1BLIA 1YI2Q 2ZPEB 4M78A 4RUGA 5IXBA 1W2BA 2A28A 2WPDA 2DE0X 1VQNB 2DZ9A 1IGUA 2E65A 5I21A 3M0PA 3DLMA 2OBTA 2CZ7B 3LWIA 1K8AC 2ENMA 4ZCIA 3L1AA 1P4MA 5DY9A 2O9VA 2ZITA 4F04B 3OY9A 1RI9A 3MEAA 2MOXA 2DEUA 1LNXA 3OYYA 4FYXB 4OGCA 4OOVA 3CCMB 3GVLA 3OYLA 1VIFA 2ZPBB 1Q86D 3PIOA 4A4KA 4EMKC 3B78A 3B82A 1OB5A 3VMFA 2DXUA 1QG0A 4Z1MA 3CCMA 3TCJA 1VJSA 4BPRA 2G6FX 3E20A 2CP0A 3A8JA 3ISXA 4XLEA 3Q3AA 3I56T 2DAQA 2VBUA 2VJJA 1HZEA 3BQJA 1OU8A 2DOGA 3HSBA 1QUFA 2RQRA 1VQ7B 4TMVA 4A54A 1W9XA 4J6XA 4C92E 4PJMA 3RNJA 2GPJA 1EFNA 1UHCA 2X4JA 4P2NA 2YRDA 1BCOA 4RTYA 1E7OA 4RMOA 4XM3A 3Q1JA 1R0BG 1P92A 1GAQA 2QTZA 4XORA 4ZGJB 3CMEA 2WZNA 3QSUA 4OMPA 1V5VA 1Q95G 1UD5A 1VQNQ 3DB3A 1Q82D 2QXFA 3ZEHA 2COYA 1QP2A 2ZPIB 3SB2A 4D8KA 4OP0A 3W2FA 1IJFA 3BDLA 3WVDB 1QQJA 1UB4A 3ASQA 4OF1A 2BVNA 5IHKA 3OYHA 3A8IA 3CCMQ 3SFMA 2LQWA 2A36A 1KC8R 3JV3A 3THKA 4C8QF 1VYTA 2DXBA 4BUGA 3PT9A 3MMPA 1YIJT 3JCMc 5EC7A 1C0MA 3BW1A 5GAN3 3C94A 5IAYA 3UF4A 4PFZA 4YTLA 3EG9B 1BMFA 2AZSA 1VQLB 3L2RA 2JTEA 1WXUA 2GQIA 2HCKA 1X2QA 4CC4B 1SSHA 3JCMe 1VQ7Q 3DKMA 1XE1A 3EG9A 1VQLA 1W4SA 2CF4A 4K11A 5EMNA 3W5VA 2QMUA 4EMKB 3J7AF 4PC2A 4IUQA 1RADB 2FPFA 4M7DA 2YXYA 1QW1A 1XNIA 2RHIA 4II1A 3IQLA 3VS1A 3X20B 3BNWA 4EMKA 1TWBA 2JJ9A 4DNRB 4OB0B 5KYYB 1H8KA 2QEXT 2EYZA 3ASTA 4RCZA 2JW4A 1PKSA 2M0OA 4ZCMA 1ZSZA 4RD4A 5KYYA 5DN6A 1M1KD 2HBPA 1CQXA 2KVOA 3AVWA 3NPFA 4PJJA 3VS0A 5GMKm 3CC2T 2Y90A 1T6ZA 1A8PA 4ZNXA 3C95A 3OFNA 2EFIA 2FPEA 3FPPA 5CKEA 3SWNC 1QVGB 3ME9A 1M2VB 4JDSA 4P12A 4N4GA 1FX0A 3OYBA 1UD8A 1T3SA 5A88A 1OYXA 4RDJA 2MMPA 3PNWC 1QVGA 4XLHA 1VQLQ 2HQHA 1TTHB 1M2VA 3ASSA 1W34A 1PJ7A 4RTXA 1MGQA 5I2SA 3A35A 4YALA 1PSEA 1YLOA 4DOWA 1X69A 4M77F 2VBVA 2L3SA 2KXCA 4M78E 5CKFA 4TMXA 4B3XA 1AHJB 4RLZA 2WYRA 2LCCA 4IUPA 1SKUB 4OMOA 2EJ9A 5IH2A 1N06A 2ZTGA 1N0VC 2ZZGA 2ROTA 1W35A 5J3OA 2VASA 3CCST 1Z9ZA 2HLDA 3CD6Q 3CCVB 2VNHA 2K3BA 1WXTA 2DETA 1SF9A 2JS0A 4R56A 4B3FX 4JPBW 4DEYA 2C5HA 3VS6A 3CCVA 3OZVA 1K9MR 4X7CA 2J6OA 2V1RA 1WNLA 2WACA 4F7UA 4PC7A 4CC7A 3R6JA 1JB0E 1H8HA 1R8OB 4LD9K 3M5AA 4XN0A 2X35A 4QQ6A 2L3RA 5CAIA 2P4RA 1QGZA 5THXA 2CGHA 4XTWA 2PTKA 1IB0A 3UA7A 3PVQA 2CSIA 3B8HA 2EJGA 2LMJA 2DD4A 2L89A 3OQ5A 2IG0A 2MF2A 5FU6C 5GV8A 5KSWB 3JCMV 3CRZA 3QSYA 3T51B 4Y9RA 4BE1A 1M90R 1R5OA 1M2OA 1JA0A 2JS2A 2DZCA 2E64A 5LJ3f 2DJQA 1M5Q1 1K9MC 2HQEA 2RQWA 2DIQA 2KI7A 3FLGA 3CCJB 3CESA 2RD1A 4AFZC 1E79A 3G4SB 1ZQ1A 4RTZA 4QVDA 2RC6A 2HL5C 2YUNA 2C77A 2V7VA 1WJQA 2D8HA 4V2SA 2BZYA 1NYFA 3SWNB 3CCJA 5IHIA 3PE0A 4P3IA 2LZ6B 3OEHA 2FZCB 2DEQA 1KK2A 2KT1A 4YAOA 2E70A 3OMCA 1RQRA 1MMGA 3SWNA 1UE9A 3SJZA 4PJOF 3JB9F 1Q7YU 1PKTA 2QDXA 4XOTA 3M58A 4JJDA 4RTTA 1G8XA 1GRIA 2E4HA 4MZPA 4O5VA 3OYIA 4RD3A 5CDFA 3A8HB 1JEGA 2DXTA 3PENA 1VQ5B 2XGJA 1NYGA 1E6GA 3JCMb 4XR6A 1SHGA 4WZTA 1TG0A 5TRDA 1JXOA 4OB1B 2ED1A 4HIZA 1EIFA 2J05A 3RDVA 3P26A 4CRIA 4Q7JB 4NBSA 1U5SA 4KGXB 3VS5A 2QTVA 2C78A 3W2IA 1S72B 2CZ6B 4M7DE 5BSXA 2IPOB 1I5OB 1M3BA 1AWWA 1WYXA 1WJRA 9ATCB 3HKSA 3CCUT 2E1HA 1AT1B 1VOMA 4RTVA 1QCOA 4E0FA 1S72A 3G4SQ 1YCSB 2QK0A 4HCZA 1BYMA 1S1NA 2K5FA 4FCYA 2E6NA 4C5HA 2F5KA 1Q7YC 1NE8A 2ZZDA 3E1SA 4ELYC 1WHGA 5FU6B 1Q86R 1BK2A 3WY9A 4M75A 2HSPA 2WSEE 1WP6A 1KHCA 5LL6S 1N08A 5LJ5h 3CP8A 3A1PA 3CCQT 2XZPA 2P0QA 4GLKA 3WBJA 2XG8D 4OPOA 3TVTA 1ZBJA 1MABA 5FO0A 2YLBA 5FRNA 4J9HA 1VQOB 3M54A 4PJLA 4QHYA 3PGGA 3AVVA 2FZGB 2BE9B 1AMOA 2ZPFB 3G71B 2EGCA 1VQKB 1R0CB 2QA4Q 3QHSA 5JBQA 3CC4T 1VQ5Q 1VQOA 4B43A 4DBHA 4Z4ZA 1E62A 3G71A 2JTFA 3Q39A 4G1VA 1VQKA 3WNBA 4X8IA 1K1ZA 3EGDB 4HXJA 1QVGS 2FHDA 2JVVA 3PIPA 2W0ZA 1Q86C 1WSRA 3LO8A 2P3MA 1H8EA 4C92F 3CMAT 4HCCA 2XD0A 1WSVA 1YI2T 4LDYA 3EGDA 3F70A 1M9SA 4E7SA 1S72Q 4CC3A 1X75C 1PG5B 4HCBA 3JB9I 1Q82R 2YWFA 2P0PA 2XNJA 4YAUA 4RDKA 1N6AA 5EG2A 4B48A 3P8BB 3G6EB 2NPFA 2X6XA 1ZUYA 5GANh 4JRIA 3RUXA 4BD3A 2DL5A 4XMYA 2WJVA 4Z4TA 4F7UE 2QTLA 4BE0A 2D0QB 4LDVA 2CW5A 3OW2B 4ASUA 4JZ4A 2BM1A 1H85A 2ABLA 4Z02A 5I2MA 1SKQA 2EFGA 1YITB 5FLXE 4PC3A 3RKWA 4KH1B 3CBMA 3OSSC 3OW2A 4ZGEB 2V7UA 4E7IA 2VB6A 3PFSA 2PVOB 1YITA 1OB0A 3ASKA 2E1BA 3PVLA 1VQOQ 3TSWA 4X7EA 2HDNB 4FYWB 1IRXA 4VUBA 1ARKA 2FRYA 3G71Q 2OTJT 3GVKA 5GV7A 2FYKA 5AYFA 3CQTA 2XMFA 3UDCA 1VQKQ 3SLDA 1E1RA 4ME7A 4KKTA 3CP2A 4PAAA 4PNOA 2AHJB 2K79A 2QGGA 4PFOA 4XU2A 2BV3A 4JLIA 3TEEA 1NZ9A 1ELOA 4OP7A 5DM7R 2PLFA 2DL3A 4N4HA 4M77E 4QQDA 2QQAA 4XKVA 2KQWA 4YEJA 3ONYA 2L3QA 1M1KU 1RABB 2YUQA 4ACBA 1S4MA 2QG9B 2RH2A 3S6WA 2KDSA 4MYUA 2D0NA 2C06A 3HAGA 2ZZFA 2CP5A 2KGTA 4OPVA 2AK5A 4MDXA 3DDYA 3LH5A 2KNBB 1WI7A 3CW2A 3G6EQ 2GQVA 3OYCA 1G3YA 3LQ6A 3VUZA 1TSFA 1F20A 2FO0A 4ZGNB 2COWA 4WF2A 3CEYA 4MZTA 1MRZA 4DQKA 4X9DA 5D6YA 3EH2A 2WR8A 1PCXA 1YITQ 1JA1A 1GFDA 4F7DA 2CREA 1KK3A 1LVKA 4L59A 4KBMB 3HTRA 3WQZA 4X34A 4J7IA 5LJ5g 4PJOD 4EMGA 4RTWA 3JB9D 4U9UA 2HD0A 3FB9A 3EFSA 1KJWA 4OMQA 1KK1A 1AWJA 4ZGDB 2ZL7A 1BIBA 1D1NA 3QDRB 4WZKA 1WLPB 2RN8A 1PWTA 1M1KC 5H5JA 2R57A 1QUEA 3LNNA 3CMET 2H8HA 4OMMA 4ZCLA 1QVFB 1VHOA 3AVUA 4XTXA 1Y71A 3LGFA 3ZFJA 3RY8A 4M78F 4H9GA 2YUPA 3OYEA 2BE7D 2JT4A 1U2RA 3VO1A 5FWCA 2DX1A 1B07A 1QVFA 2RJCA 3QPHA 2BF4A 2X85A 4KRTA 4JMQA 4A4EA 1QWFA 4FYVB 5GAN4 1NB9A 5IYWA 1OB2A 2AKLA 1HVXA 3RMSA 3OKXA 4M75E 5M9OA 1W70A 4G7WA 2E5KA 3UT1A 3OZUA 4II2A 2K4YA 1VF7A 2F5TX 2K2VA 2VUBA 2LX7A 2JJ1A 3CPXA 3I55T 2VBTA 5GAN6 4GBQA 3MEWA 2OAWA 4RCCA 4JZ3A 1AD5A 2QDYB 3L2VA 3J80E 3BE3A 1FNDA 3OMGA 5GANg 4C5GA 3D26A 4LXCA 1EWYA 1VQ6B 2EYWA 5KCOA 2Q6LA 3JU4A 4QFMA 3D7SB 5KNLA 1BB9A 4OOSA 3BFMA 3LH0A 2L2PA 2MPXC 1VQLT 1VQ6A 4QT7A 2JUFA 4E7ZA 1KSWA 2I1LA 4QVJA 4XU3A 5CIUA 2XDPA 5DLQE 2VYQA 1F60A 4Z4RA 1RAAB 2JM9A 1Y96B 1NM7A 4WZEA 3JB9H 2E12A 2I0NA 3H94A 4L6V5 3JQQA 3G05A 3C0CA 2V8IA 2MWPA 2R58A 2YRCA 5D6WA 1Y96A 1B23P 1OQKA 2A3LA 4C92D 3OS2A 4B4DA 3GF5A 4LBYA 2BGJA 5GAMh 4N0AC 2QN6A 2D74A 5J35A 1TXQA 4IW3B 1GVHA 1V0EA 3W2GA 2QDLA 3FIFA 4PL6A 1VQNA 3M0UA 2E3HA 4A63B 1GJRA 1Y07A 2VVKA 1NLPC 1YWPA 5C0MA 1WDXA 4P9SA 2DM1A 3NGPA 1PNJA 2KK4A 4L8JA 1YJWB 1KHIA 2HMAA 3OW2S 3SJPA 3ZUGA 1S0UA 4ROXA 3AGPA 4G7XA 4D6WA 5FU7C 2HKQB 1VQ6Q 2Q6OA 4FIBA 1YJWA 3TSZA 5GAOl 4DBQA 3URGA 2LT1A 4N3GA 2O88A 5KYXB 2GJPA 2RJDA 4E7KA 1LCKA 1YHQB 2C0OA 4LNPA 3M0TA 1D09B 3ZC3A 4ESRA 3OSVA 2PUKB 1UGPB 1FWZA 3W2HA 1VLOA 2VNIA 2L5QA 3BDUA 1VQ7A 1UTIA 1A0NB 3ASRA 4AVZA 1QVGP 1YHQA 1V29B 4M7DF 4PK4A 1BQEA 2R5AA 2XIDA 1N5ZA 4C5IA 1WGSA 2KRSA 3CCVT 1GBRA 1EFUA 2RC5A 1RUWA 1QH0A 3NMZC 3ZL7C 2DRKA 1OI1A 1PJ5A 4AFQC 3RKXA 4M7AE 2RJEA 1UGSB 1MV0B 5IT9E 5A0GA 3RMQA 2LX9A 5GANd 1KZLA 1HJDA 2ZPGB 1AZEA 5I22A 3A8LB 2W10A 2R5MA 1NEGA 4JS5A 4RD1A 4J9GA 5A89A 2X0KA 2F2WA 4BACA 2YLCA 1YJWQ 8ATCB 4HA8A 4J7FA 1KC8U 3PUMA 1WZOA 3TREA 3EG0A 2KVQG 2BKDN 2X4XA 5GAN2 3T53B 3ULRB 4Z4UA 1WHMA 4R0KA 3ZBUA 1VQ4B 4JLGA 5CQXA 1ZA2B 4Z88A 1U1SA 3QWYA 4Z4WA 2F1MA 1YHQQ 3JCMQ 1K28D 4FW2A 2VJIA 3CCJT 3BCDA 3LQEA 1SHFA 4RG2A 1NG2A 3QDFA 3WNDA 2AHOA 1K4US 1VQMB 1GAWA 3CD6B 1E64A 4J9FA 1PHTA 1QVFS 5KH6A 4QVCA 1CSKA 3HRSA 2GNCA 4HVWA 4RPDA 3CC7B 2VXFA 1VQMA 1M1GA 2DVJA 2BIVA 2V7QA 4LC0A 3ZZ0A 3CD6A 3REBB 1AOJA 2GTJA 3PA2A 3VO2A 2NWMA 4M78D 3JCMh 2DL4A 3AGQA 2VV5A 4WCIA 4F7UF 4TMWA 4C0DC 3A5ZB 3VS3A 2CBXA 5CR2A 1G7SA 2EGEA 1YJ9T 3NHNA 5GAMg 2W6IA 1BI1A 2V1QA 2GFUA 4KKSA 3SEMA 3PTAA 3NTHA 1K9AA 1TU0B 3MPUB 2PE3A 2QE7A 1O75A 4DK1A 2XOKA 4FYYB 1PRMC 4EH1A 5GMKj 2LNHB 3CCRB 1RACB 1LPLA 3OYNA 4MYTA 3X25B 1JXMA 3EAEA 3MHPA 4OOXA 3CCRA 4AT1B 4WTOB 3OZWA 1WOOA 3H0IA 3A8KA 1PD0A 2Z0WA 3MP8A 4C8QG 1S72T 1VQ4Q 2XEXA 4OMLA 1TUIA 1HK9A 2J06A 4OB2B 1GL5A 3ASPA 4N4IA 2X6WA 4BDYA 4Y7CA 4OGEA 2RHUA 3I56B 1IO6A 1BBZA 2LC4A 1OGIA 1VQMQ 2KEAA 3V7AA 5C6SA 1IXDA 4F16A 2DTOA 1D1BA 1YNZA 3TQ7P 3E9GA 1ZUUA 2JM8A 3I56A 3H8ZA 3CC7Q 2DNUA 3CB4A 1QKXA 3HFOA 5F4MA 3M0RA 2B7CA 5LJ5j 3LLRA 5L8RE 3JRZA 1EFCA 4LDWA 3KFVA 1NEBA 4FL6A 1HXDA 4Y92A 2A7YA 1MMNA 3AHUA 4ORZA 3DLLA 2R9VA 1GCQC 1MMAA 2DYIA 3QZ5B 2D6FA 1J9ZA 3I1FA 1VQPB 4E47A 3QJ6A 2RNAA 3G71T 2CP6A 3CCEB 1VQKT 4Z8AA 3JSCA 2EBPA 3GNGA 4XTYA 4BB7A 3EG2A 3W5HA 1VQPA 2A37A 2X3UA 4G6IA 5GAOm 4QV2A 1KQSB 3CCRQ 3CCEA 4CQJA 1MMDA 2K57A 4A53A 2M5SA 2XHCA 2MCNA 1H92A 4ZTJA 3CPWP 1RL2A 1UMKA 2K3XA 2ZL6A 4NS5A 1BPLA 2EIFA 4QW2A 2PVGB 3L42A 5FW9A 2DBKA 2CKKA 4C0DB 4XOPA 4KKUA 2CUBA 1CKAA 4PJOC 5TV2A 3H9NA 2B5OA 1WPYA 3MHXA 5GANj 1NJIU 4LDXA 3OBYA 3I56Q 1JQQA 2GJKA 3G4SA 4M75F 2H3JA 4RTUA 1WQ7A 4X7FA 2DIGA 4KH0B 4M7DD 4ZTFA 4B47A 1D0XA 5GAMd 1JNYA 1YITT 3OJWA 3FC3A 4M77G 2B86A 1W0JA 4JUVA 2VYTA 1C6VX 5GAOq 2WSFE 2OI3A 2NUTB 2K2MA 2DTHA 1TUGB 4ATOA 4M4SA 1WTHD 3JCMg 2QA4B 1M30A 1VQPQ 2NUTA 5GMKe 3M56A 2Q6IA 2LRQA 2M02A 1ZBXA 1Q7YR 3CCEQ 2BZXA 3P27A 3JQPA 1AWOA 3OW2P 2QA4A 4LE9A 4C8QD 3UATA 1VQ5A 5FROA 3GIRA 3RERA 3NTIA 3PMIA 5KYWB 4P26A 3CC2B 3R6OA 4J9BA 3TU4K 4RD0A 5D6XA 1DDGA 1PD1A 5GAN5 4ZN3A 1NJIC 1M8VA 1WOSA 1SG5A 4PJNA 4Q5WA 1FRQA 1IHMA 1YJNT 2VC8A 5KYWA 3CPFA 4PC6A 1K76A 2K5IA 3CC2A 3VJPA 2M51A 2V7WA 2YWGA 1BI3A 2PNIA 4MMKA 4TT3A 3GIBA 4BY6C 1IREB 2BPOA 1KTVA 4C0GA 1GCQA 3BY2A 2K7AA 1VHEA 1I07A 3PVDA 3RESA 1ZSGA 2XK0A 4WQMA 1K73U 4FSXA 1W6XA 2JJ2A 2HNIA 1ZM9A 3CPWB 2M1HA 2HL3A 2RQUA 2DERA 1AEYA 4AMCA 4XLFA 3QJYA 1N9SA 4C92C 2LCLA 2CNDA 4DBFA 4JJNK 2C0IA 1SM4A 3CPWA 4PJOB 2VWFA 1JB9A 2JN0A 2NLUA 2D9TA 1CKBA 1HD3A 2ZGWA 1UECA 2GREA 4Z89A 1BI2A 2COZA 4PJOG 3JB9G 1G83A 4AG1C 1RAGB 2DK3A 1U3OA 5IHNA 2ED0A 3JQRA 4E7HA 5CO7A 3ZZTA 5CVIA 5GAOp 1KC8D 2RI3A 3CC2Q 5KW9A 1YX2A 2X53S 4FW1A 5IYQA 3OYKA 2D3NA 5GANe 2FG0A 1V76A 2M9UA 1Q81U 1RLPC 1K73C 3OJXA 1WJSA 1ABQA 2ZCFB 1J3TA 4M77D 4M53A 3M0SA 3MEVA 4Z4SA 1KMHA 1QGAA 5HXBA 4M7AF 3QFTA 1QVFP 3OYDA 1D0YA 3PUNA 1JRIA 3G6EA 4IKFA 1KIKA 4XLAA 3SEJA 2CP2A 2CZ0B 5A8AA 4FSSA 5HKCA 1R77A 4BI8B 1W1FA 2M0YA 2DPPB 2RM4A 1VQ6T 4LBWA 4J9EA 2KROA 4UC4A 1B7TA 2XNDA 2ZL5A 3U6BA 4LN2A 4RCBA 4DQLA 1D2EA 2D1XA 2GK7A 4M0LA 4BY6B 4BDZA 4P5NA 1QX4A 3H6ZA 3FKSA 1OX8A 3R6KA 3FJPA 1CNEA 4UZEA 4FU6A 1EFRA 2JN9A 4Y91A 1ZX6A 1M3CA 2DKGA 3MJXA 4C0SA 1I8FA 3OP1A 1FX7A 1KQSS 4X06A 1N8RU 3UA6A 2P84A 2OK7A 2GCXA 4BI4A 4GQNA 2CT3A 3FEOA 3O5ZA 4TN1A 2EQUA 4HCKA 2LTOA 1VQNT 4C92B 1GXIE 5GAMj 2OK8A 1E6HA 1G3SA 3JCMX 4P6YA 2ZZQA 2IIMA 2LQKA 2C5BA 4E2FB 2GF7A 3CCLB 1X27A 5DSZA 1M1KR 3KBGA 4EIKA 5IXFA 4C92G 3L2ZA 4C92A 2O4XB 3CCMT 3SLNA 3H0FA 5IN1A 2RHXA 1RAEB 2JIZA 1UDLA 2HAXA 5HKKA 2F69A 3H0HA 1PKVA 3CCLA 3LW5E 1D1AA 3LYIA 1QP3A 2O4XA 3I5SA 3JCMJ 1HYOA 3OOCA 5CK9A 3LX7A 3S3NA 1WU8A 5LJ3h 3QXEB 3WBKA 5IYRA 2DCUA 1XQHA 1KD1U 2RI2A 1AIPA 1XFOA 2QQSA 4P6VF 2KYBA 4M78C 2CP3A 1VA7A 1VQ7T 2X3XD 2BUDA 4DEXA 2E10A 4J8OA 3VU3C 3BY7A 3CCQB 3LGLA 3V76A 1RAHB 1YHQT 1NB0A 2X4YA 4YXWA 1OX9A 2J7IA 2BTTA 4Z4VA 2C4UA 1QCFA 1T3LA 5AN9A 2MAMA 2LQ8A 1NRKA 3NTKA 1U1TA 1WHLA 4R55A 1E3XA 1MNDA 4X1VA 2FL7A 2LCSA 4C0FA 1SRLA 4PFPA 3CC4B 2AKKA 2XICA 2GK6A 1JJ2P 4HE6A 1T6XA 1XB2A 1MV3A 5IYPA 1BKBA 1XOVA 3UPUA 3EG1A 1BI0A 2VBSA 3JCMP 4UZFA 5TY0A 3CC4A 2JXBA 1WHKA 1ZHIA 4XTZA 3ZPNA 1KRHA 2PZ1A 2DYBA 3VR6A 3GSIA 1D8TA 1M90D 3CMAB 3CCLQ 5GJVB 2VNJA 3I35A 4OVAA 1ZM4A 4XKWA 2LZJA 4NNJA 2HEQA 3M53A 1Y0YA 3GNFB 1E1QA 1KD1C 4FK8A 3SDZA 3Q38A 2DD5A 2LP5A 3CCUQ 4OPSA 1M1FA 1NJID 3HRTA 3QO3A 1QVPA 5FWBA 3P8DA 7AT1B 2FVUA 3OYMA 3OYAA 4L5GA 4JS4A 3CPWS 1EP3B 4XLCA 4XQFA 5HZAA 1V1CA 4TMTA 2M16A 2OTLB 2SRCA 2KR3A 1TLLA 5E6TA 2EW3A 4XTVA 1VYVA 1X2KA 4C0ZA 3JCMW 1K8AU 4NCNA 4IUUA 5F4JA 4HVUA 2ZAEA 4J5YA 5KYNA 4HT9A 1F1BB 1JBMA 2JMAA 2OTLA 3CCQQ 4PKCC 4XL9A 1IGQA 1WA7A 4Y28E 4JRQA 5FA6A 4J9CA 1ACMB 1BJKA 1VQ8B 1OEBA 2KRNA 3ZBTA 4F14A 1DARA 2KY9A 3KUFA 2DVEA 4QVZA 4D8DA 6AT1B 3CD6T 2D8JA 2OTJB 2RQTA 3WVEB 5GAMe 2E41A 2QGFB 4AG2C 1VQ8A 1N05A 1C1AA 3CC4Q 2CUDA 3OE7A 3WXMB 4EMHA 3OYFA 2KBTA 2VGNA 2V7TA 3ER0A 3VRYA 1Y0MA 3M4GA 3V7SA 1WQWA 2OTJA 4M78B 2OJ2A 4P22A 2J6KA 1W2BB 3E2UA 5FIUA 3KL9A 2YDLA 2ZXHA 3WXMA 2HCJB 3CMAQ 3PA1A 2AZVA 3T9NA 3X24B 1WHHA 4E6RA 1TTTA 2XDDA 2EYXA 1OPKA 2F1LA 4M78G 5LMZA 5HY6A 4HE5A 2WSCE 3FJ5A 1VQ9B 2RK1A 5CKBA 1SPKA 5LJ5d 4M7AD 3NFCA 3BY1A 3L2QA 2YWHA 2Z6BD 3QBYA 4IIOA 2EJFA 4EPCA 4F17A 3G1JA 3CCRT 3QFRA 4TSFA 1E3ZA 3G7ZA 2DILA 1RQPA 3V8LA 3I5RA 2RF0A 1VQ9A 2YUOA 2DA9A 4M7DC 3QE2A 1B3QA 2FPDA 1NPRA 1ZUNB 3V8KA 1K73D 1JJ2B 5A2QE 2O2OA 2OTLQ 3M55A 3OYGA 3AVTA 3LVBA 5LJ3g 3J81E 4UAJA 2QQBA 2HSEB 1LJOA 3VRZA 4P1VA 4YELA 4BE2A 1JJ2A 4IUTA 1B2RA 2V31A 5KYXA 2G3RA 1MUZA 2OBSA 1ZSZC 2OBRA 1VQ8Q 5KCHA 2XNCA 1UGVA 4LBVA 2EPDA 2OTJQ 3O8VA 2DY1A 2EWNA 4C8QC 1IHWA 3H41A 3GPLA 2HZYA 4QQGA 2FX3A 4MZMA 2B8AA 3CXCB 3CMEB 3HPWA 2JTMA 2EQIA 3EFRA 4GY5A 3QYHB 3NE5B 2KAFA 1KK0A 2XZOA 5IYNA 5KE3A 2JNGA 1Y57A 5J3BA 5I11A 2PIAA 3CXCA 4ACAA 4RPBA 2HKNA 1VQPT 5FL7A 1Q81D 5CQYA 3CCET 3OS0A 1QLYA 1VQ9Q 4N3NA 4DOVA 2NUPB 2NYSA 4PABA 1OU9A 1UD3A 3MKDA 3I55B 4FT2A 2OX7A 4FM4B 2QTXA 2NUPA 3GQBA 3QG1A 2LT4A 3A98A 3GVJA 1BU1A 3PMTA 1WOPA 3EG3A 3I55A 1AZGB 4N0AA 4E7JA 4J9IA 2FRWA 4HVVA 1Q9SA 2YHTA 1VQ4A 3G4ST 2NV4A 1NDHA 2D3LA 5LJ5f 3WNCA 2RQVA 1CNFA 1KQSP 1T5EA 5FU7B 3ZBDA 1KK7A 5CKDA 2C4TA 1M3AA 1M4ZA 3U6KA 1H3ZA 2QQRA 4Z4YA 2E6ZA 1WHJA 2PVDB 4M7DB 1M8MA 3S3OA 2E1RA 2LVMA 4XONA 3HHTB 1H42A 2EKHA 1N8RD 4ANJA 1G5VA 2RPNA 3CMEQ 3CC7A 2AIRB 3VS4A 2MK5A 1KC8C 1EP2B 4M7DG 1NLOC 4FT4A 1RAIB 2KT8A 3MP6A 2ZBVA 4Y9UA 1UGRB 2HQXA 4B3GA 2QA4T 1UJ0A 2ZPHB 2PQWA 4RD6A 1ZSZB 1VQ5T 4RJLA 4YAFA 4R71A 4PLLA 2E5QA 2DL7A 3S3MA 3U2QA 4M77C 1N07A 1VUBA 4NOYA 5LJ3d 4HKEA 4C8QB 2CH4W 2K5LA 1Y0RA 1BCMA 1OOTA 2YWWA 3I55Q 3L2UA 4NL2A 2JDIA 5GANf 4C5EA 4PC1A 4C8QA 3UWNA 3ES9A 1FXXA 4M1KA 2H3EB 4J6WA 4XAXB 4XU1A 2LJ0A 3M57A 3VS7A 1FRNA 3SHWA 1KD1D 3A8OB 4RKUE 3I9QA 1UD4A 3M59A 1KFZA 1XJWB 3QFCA 4B44A 1SSFA 3M9QA 3QFSA 3RKYA 2B7BA 2D9RA 3V8JA 1SRMA 1YFNA 2P4TA 2XU8A 3QKJA 3ZIAA 3JB9J 1DJ7B 1VYUA 1UD2A 2OAUA 2GQFA 1YBYA 2V4DA 3A3BA 2RHYA 4DNTB 2WJYA 3WYAA 2C0TA 1ABOA 2I2LA 1IB8A 3GLXA 1VQOT 1K9MU 1W2BS 5L46A 3HFNA 1TUCA 1I0CA 1PC0A 2VGMA 3E19A 1UG1A 2XZLA 4F7UB 1B34B 2BM0A 5IK2A 4CC2A 1YCYA 1NBEB 4YHBA 3BCFA 3CTAA 1AWXA 2DXCA 1G7CA 4J83A 5HZBA 4F7UG 1B34A 3EHRA 2E3IA 4A4GA 3GOXA 2QI2A 4TMZA 2CRVA 2YT6A 1N27A 3P8HA 2V7XA 4ZGQB 1M90U 1KQSA 4M75C 1Z9QA 1PRLC 1JJ2S 1E43A 3C4SA 5TR9A 1YIJB 2KYMA 1BX0A 3VNVA 3Q6RA 2O9SA 2PUOB 3EH1A 2CH4A 1RAFB 1WORA 3M0QA 2EVRA 2RB6A 2F4NA 3FDRA 2QYZA 4RCYA 1VLYA 2DRMA 3SD4A 1HSQA 1YIJA 1K8AD 5CKHA 3G6ET 1G7RA 1OHHA 2ZBUA 4XQ3A 1V0FA 4M77B 4B9WA 2P0KA 1VIEA 3KXTA 1ZLMA 4AFUC 1OZ2A 1FNBA 1E63A 1QFZA 3L2WA 1GCPA 5DLOA 1HA3A 4ZN1A 2EQMA 1K0SA 2KMTA 1M27C 3JAME 2LJ3A 1NBMA 4M77A 5GAN8 5L23A 5HK0A 1NJIR 5H59A 1ZUKA 4TVRA 3N5BB 3CXCS 1G2BA 1COWA 1OV3A 5BSYA 2ATCB 1QFJA 4DBRA 3CCVQ 2CK3A 3V7CA 3X26B 1H3HA 3RR6A 3VYGA 1X01A 2QEXB 2EIXA 5GAOr 2CYZB 1FNCA 1M90C 2W6JA 4KULA 4O6JA 1GO2A 4J0QA 2YSQA 2X9HA 4XK8E 4KUDK 2QEXA 1YJ9B 1FDRA 1KJZA 2F43A 2FB7A 4B6MA 1DDIA 2EYYA 1KG1A 2QQ9A 3R6NA 1YJ9A 4PGOA 1EX4A 3HRUA 1YIJQ 4ZV4A 3DB4A 1OULA 2ESWA 4DQ2A 5GMKh 2RA2A 1MHNA 3OB9A 2XI9A 2X8KA 1T0HA 5J39A 5F4OA 1FMVA 2WZPP 2K3YA 4IIMA 3CCLT 4LUDA 4YAWA 4FXUA 2X51A 1XTDA 5LJ5e
chains in the Genus database with same CATH topology
2DOGA 3HTRA 2QGGA 2F1LA 3A1PA 1PM3A 3H9NA 2DYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOG A;  3HTR A;  2QGG A;  2F1L A;  3A1P A;  1PM3 A;  3H9N A;  2DYI A; 
#chains in the Genus database with same CATH topology
 3OAA A;  2CT4 A;  2L0A A;  1TOV A;  3CBO A;  5GMK i;  4FN5 A;  2A08 A;  1Q86 U;  1YP5 A;  1KQ1 A;  3CCJ Q;  2RK2 A;  1GR1 A;  1RI0 A;  2DIE A;  3T56 B;  3EGU A;  1G3W A;  3OS5 A;  4M75 B;  1SEM A;  5FNZ A;  5LJ3 j;  1FNM A;  2FVG A;  2X4W A;  1QFY A;  2EQK A;  2VNK A;  3AVY A;  3CCS B;  5KYU B;  2OYN A;  4QUZ A;  2RI5 A;  1WDT A;  2LNV A;  4LUE A;  2FZK B;  1EP1 B;  3W2E A;  1K73 R;  1I81 A;  3MP1 A;  1PJ6 A;  3MCA B;  4M75 G;  1UD6 A;  1N9R A;  5GAN 7;  4XNF A;  2DFU A;  2KXD A;  4OMN A;  3CCS A;  1EXM A;  5KYU A;  2YWE A;  2QEX Q;  2BN4 A;  4GLM A;  4LBZ A;  3INZ A;  4AC9 A;  1R5B A;  4QKU A;  4X05 A;  2ZXI A;  2PU9 B;  3MCA A;  3RBB B;  3A3G A;  3U23 A;  4C8Q E;  4PJO A;  2O31 A;  5GAM f;  2VZL A;  2DMO A;  4B9X A;  2IVW A;  2L3P A;  2Y4X A;  1YJ9 Q;  1UUE A;  2CP7 A;  4QVA A;  4EDU A;  4M7A C;  5D7U A;  1OZ3 A;  4UZU A;  2DJZ A;  1I7P A;  1WFW A;  1ZM3 A;  2CDT A;  2Y4Y A;  1WIE A;  2CSQ A;  3QWX X;  2NUZ A;  5HK3 A;  1D3B B;  1O9S A;  3QUI A;  3OYJ A;  1K0X A;  1TVC A;  4TKO B;  4XN3 A;  1Q82 U;  2DO3 A;  4IUV A;  4RG8 A;  4M4Z A;  4RDL A;  3OS1 A;  4M2L A;  1D3B A;  2ZZE A;  4XTU A;  1R5N A;  3VYH B;  1Q81 R;  3KEW A;  3ZZU A;  2K6D A;  2C2W A;  1X43 A;  2HBW A;  5ECA A;  1FYN A;  3MET A;  3JCM d;  2ROL A;  2Q6K A;  4WWV A;  8AT1 B;  4II3 A;  3FPK A;  3OPO A;  2F2X A;  1FMK A;  3OEE A;  1QWE A;  3QII A;  5GJW B;  3J81 k;  3CCS Q;  2EAY A;  2OTL T;  1T0J A;  4KUI A;  4X9C A;  5CCA A;  1I1J A;  2JOY A;  3BC9 A;  2QAS A;  3LWH A;  4KT0 E;  1WPC A;  1SKY B;  1VQ8 T;  2LDM A;  1H64 1;  3REA B;  1QMC A;  1Q81 C;  2BGI A;  1D1C A;  1IZ6 A;  2GGR A;  5A0D A;  1Q82 C;  4J9D A;  3AT1 B;  3CBP A;  3EHQ A;  2DBM A;  2J6F A;  4RM0 A;  2JZ2 A;  2AT1 B;  3OW7 A;  1N8R R;  1LOJ A;  3EGX B;  1TUD A;  4PLI A;  4ELZ C;  1IJE A;  3VV0 A;  5GAO n;  3FRN A;  1I4K 1;  2XKO C;  4AF7 A;  2A0F B;  2CS7 A;  3AVX A;  1WXB A;  2J7K A;  3EGX A;  3E9F A;  4MML A;  1N0U A;  2GJR A;  4RD2 A;  3CCU B;  1YJN B;  3Q6Q A;  2YRV A;  4NL3 A;  1YJW T;  2CC2 A;  5LJ3 e;  1VQ9 T;  1JU5 C;  4M75 D;  4JJC A;  4M7A B;  2MWO A;  3HP9 A;  4KGZ B;  1UJY A;  2MYS A;  3CCU A;  1YJN A;  5FO1 A;  4G1B A;  2LQN A;  2EGA A;  1YWO A;  3MEU A;  1UFF A;  3OBW A;  1W2B P;  4M7A G;  4M7A A;  4FWT A;  1T6Y A;  1QCN A;  4KGV B;  1N8R C;  1I18 A;  4A4H A;  3HL8 A;  3EFO B;  2DTI A;  4X0C A;  1EZZ B;  1UGQ B;  3VS2 A;  2RHZ A;  2DF6 A;  1K9M D;  1X6B A;  2DLP A;  2XDB A;  2V8J A;  4DA4 A;  1KD1 R;  3ONU A;  1TS9 A;  2F2V A;  3JCM f;  2O01 E;  2MIO A;  2VKN A;  3EFO A;  3CCQ A;  3A8M B;  4J6Y A;  1FMW A;  4IUR A;  2KE9 A;  2CZ1 B;  4P25 A;  2V26 A;  2BMW A;  1W0K A;  4X07 A;  1X6O A;  1KQ2 A;  1D0Z A;  4E7L A;  4P3Y A;  5A0L A;  1RLQ C;  2HDA A;  4OB3 B;  2X6Y A;  1U06 A;  5KE2 A;  1G3T A;  2ZTN A;  1QKW A;  4MDW A;  1GFC A;  3VKI A;  2QAZ A;  4DK0 A;  5DS0 A;  3RIR A;  4C43 A;  1AVZ C;  3M4Y A;  4LD6 A;  4JRP A;  2RJF A;  4XU0 A;  2FEI A;  3A8G B;  1YI2 B;  1OGJ A;  4X7D A;  3X28 B;  1GBQ A;  1PSF A;  2WSS A;  2GTO A;  5AT1 B;  4XD7 A;  2MI6 A;  3W5U A;  2KRM A;  1TH7 A;  3CMA A;  2GBQ A;  1I5L A;  1YJN Q;  3GP8 A;  1YI2 A;  4AF6 A;  3BH4 A;  3C12 A;  1UEB A;  4WZL A;  3FJO A;  3VUB A;  5B6I A;  1ZA1 B;  2RMO A;  2X3W D;  1G7T A;  3CXC P;  2L8D A;  4G5G A;  2BZ8 A;  2JMC A;  4A4F A;  1EFT A;  1QGY A;  3E1Y E;  3OA6 A;  4PJO E;  2VXE A;  4K1X A;  2V8K A;  2KSS A;  3QZ9 B;  3GBQ A;  1YN8 A;  1MNE A;  3QYG B;  1VQ4 T;  3SKB A;  1NPP A;  1UHF A;  2GFA A;  1BIA A;  4JJB A;  5GMK l;  2EYQ A;  3VNU A;  2PMD A;  2DL8 A;  2SEM A;  4CI0 C;  4LDU A;  4HT8 A;  1K8A R;  1U8R A;  1VQM T;  1OPL A;  4AFS C;  1Y7X A;  1WX6 A;  1JO8 A;  2BSA A;  1Q7Y D;  2EKO A;  5J26 A;  3CC7 T;  1DG1 G;  1I8D A;  4JRK A;  1PM3 A;  1W87 A;  1IHV A;  5HCK A;  2LJ1 A;  4OMF B;  2ECZ A;  3MO8 A;  1BX1 A;  2EQJ A;  4BI3 A;  2R6H A;  2K9G A;  1XQB A;  2RO0 A;  1ZM2 A;  1X6G A;  3CMM A;  5FRM A;  3V7R A;  1BLI A;  1YI2 Q;  2ZPE B;  4M78 A;  4RUG A;  5IXB A;  1W2B A;  2A28 A;  2WPD A;  2DE0 X;  1VQN B;  2DZ9 A;  1IGU A;  2E65 A;  5I21 A;  3M0P A;  3DLM A;  2OBT A;  2CZ7 B;  3LWI A;  1K8A C;  2ENM A;  4ZCI A;  3L1A A;  1P4M A;  5DY9 A;  2O9V A;  2ZIT A;  4F04 B;  3OY9 A;  1RI9 A;  3MEA A;  2MOX A;  2DEU A;  1LNX A;  3OYY A;  4FYX B;  4OGC A;  4OOV A;  3CCM B;  3GVL A;  3OYL A;  1VIF A;  2ZPB B;  1Q86 D;  3PIO A;  4A4K A;  4EMK C;  3B78 A;  3B82 A;  1OB5 A;  3VMF A;  2DXU A;  1QG0 A;  4Z1M A;  3CCM A;  3TCJ A;  1VJS A;  4BPR A;  2G6F X;  3E20 A;  2CP0 A;  3A8J A;  3ISX A;  4XLE A;  3Q3A A;  3I56 T;  2DAQ A;  2VBU A;  2VJJ A;  1HZE A;  3BQJ A;  1OU8 A;  2DOG A;  3HSB A;  1QUF A;  2RQR A;  1VQ7 B;  4TMV A;  4A54 A;  1W9X A;  4J6X A;  4C92 E;  4PJM A;  3RNJ A;  2GPJ A;  1EFN A;  1UHC A;  2X4J A;  4P2N A;  2YRD A;  1BCO A;  4RTY A;  1E7O A;  4RMO A;  4XM3 A;  3Q1J A;  1R0B G;  1P92 A;  1GAQ A;  2QTZ A;  4XOR A;  4ZGJ B;  3CME A;  2WZN A;  3QSU A;  4OMP A;  1V5V A;  1Q95 G;  1UD5 A;  1VQN Q;  3DB3 A;  1Q82 D;  2QXF A;  3ZEH A;  2COY A;  1QP2 A;  2ZPI B;  3SB2 A;  4D8K A;  4OP0 A;  3W2F A;  1IJF A;  3BDL A;  3WVD B;  1QQJ A;  1UB4 A;  3ASQ A;  4OF1 A;  2BVN A;  5IHK A;  3OYH A;  3A8I A;  3CCM Q;  3SFM A;  2LQW A;  2A36 A;  1KC8 R;  3JV3 A;  3THK A;  4C8Q F;  1VYT A;  2DXB A;  4BUG A;  3PT9 A;  3MMP A;  1YIJ T;  3JCM c;  5EC7 A;  1C0M A;  3BW1 A;  5GAN 3;  3C94 A;  5IAY A;  3UF4 A;  4PFZ A;  4YTL A;  3EG9 B;  1BMF A;  2AZS A;  1VQL B;  3L2R A;  2JTE A;  1WXU A;  2GQI A;  2HCK A;  1X2Q A;  4CC4 B;  1SSH A;  3JCM e;  1VQ7 Q;  3DKM A;  1XE1 A;  3EG9 A;  1VQL A;  1W4S A;  2CF4 A;  4K11 A;  5EMN A;  3W5V A;  2QMU A;  4EMK B;  3J7A F;  4PC2 A;  4IUQ A;  1RAD B;  2FPF A;  4M7D A;  2YXY A;  1QW1 A;  1XNI A;  2RHI A;  4II1 A;  3IQL A;  3VS1 A;  3X20 B;  3BNW A;  4EMK A;  1TWB A;  2JJ9 A;  4DNR B;  4OB0 B;  5KYY B;  1H8K A;  2QEX T;  2EYZ A;  3AST A;  4RCZ A;  2JW4 A;  1PKS A;  2M0O A;  4ZCM A;  1ZSZ A;  4RD4 A;  5KYY A;  5DN6 A;  1M1K D;  2HBP A;  1CQX A;  2KVO A;  3AVW A;  3NPF A;  4PJJ A;  3VS0 A;  5GMK m;  3CC2 T;  2Y90 A;  1T6Z A;  1A8P A;  4ZNX A;  3C95 A;  3OFN A;  2EFI A;  2FPE A;  3FPP A;  5CKE A;  3SWN C;  1QVG B;  3ME9 A;  1M2V B;  4JDS A;  4P12 A;  4N4G A;  1FX0 A;  3OYB A;  1UD8 A;  1T3S A;  5A88 A;  1OYX A;  4RDJ A;  2MMP A;  3PNW C;  1QVG A;  4XLH A;  1VQL Q;  2HQH A;  1TTH B;  1M2V A;  3ASS A;  1W34 A;  1PJ7 A;  4RTX A;  1MGQ A;  5I2S A;  3A35 A;  4YAL A;  1PSE A;  1YLO A;  4DOW A;  1X69 A;  4M77 F;  2VBV A;  2L3S A;  2KXC A;  4M78 E;  5CKF A;  4TMX A;  4B3X A;  1AHJ B;  4RLZ A;  2WYR A;  2LCC A;  4IUP A;  1SKU B;  4OMO A;  2EJ9 A;  5IH2 A;  1N06 A;  2ZTG A;  1N0V C;  2ZZG A;  2ROT A;  1W35 A;  5J3O A;  2VAS A;  3CCS T;  1Z9Z A;  2HLD A;  3CD6 Q;  3CCV B;  2VNH A;  2K3B A;  1WXT A;  2DET A;  1SF9 A;  2JS0 A;  4R56 A;  4B3F X;  4JPB W;  4DEY A;  2C5H A;  3VS6 A;  3CCV A;  3OZV A;  1K9M R;  4X7C A;  2J6O A;  2V1R A;  1WNL A;  2WAC A;  4F7U A;  4PC7 A;  4CC7 A;  3R6J A;  1JB0 E;  1H8H A;  1R8O B;  4LD9 K;  3M5A A;  4XN0 A;  2X35 A;  4QQ6 A;  2L3R A;  5CAI A;  2P4R A;  1QGZ A;  5THX A;  2CGH A;  4XTW A;  2PTK A;  1IB0 A;  3UA7 A;  3PVQ A;  2CSI A;  3B8H A;  2EJG A;  2LMJ A;  2DD4 A;  2L89 A;  3OQ5 A;  2IG0 A;  2MF2 A;  5FU6 C;  5GV8 A;  5KSW B;  3JCM V;  3CRZ A;  3QSY A;  3T51 B;  4Y9R A;  4BE1 A;  1M90 R;  1R5O A;  1M2O A;  1JA0 A;  2JS2 A;  2DZC A;  2E64 A;  5LJ3 f;  2DJQ A;  1M5Q 1;  1K9M C;  2HQE A;  2RQW A;  2DIQ A;  2KI7 A;  3FLG A;  3CCJ B;  3CES A;  2RD1 A;  4AFZ C;  1E79 A;  3G4S B;  1ZQ1 A;  4RTZ A;  4QVD A;  2RC6 A;  2HL5 C;  2YUN A;  2C77 A;  2V7V A;  1WJQ A;  2D8H A;  4V2S A;  2BZY A;  1NYF A;  3SWN B;  3CCJ A;  5IHI A;  3PE0 A;  4P3I A;  2LZ6 B;  3OEH A;  2FZC B;  2DEQ A;  1KK2 A;  2KT1 A;  4YAO A;  2E70 A;  3OMC A;  1RQR A;  1MMG A;  3SWN A;  1UE9 A;  3SJZ A;  4PJO F;  3JB9 F;  1Q7Y U;  1PKT A;  2QDX A;  4XOT A;  3M58 A;  4JJD A;  4RTT A;  1G8X A;  1GRI A;  2E4H A;  4MZP A;  4O5V A;  3OYI A;  4RD3 A;  5CDF A;  3A8H B;  1JEG A;  2DXT A;  3PEN A;  1VQ5 B;  2XGJ A;  1NYG A;  1E6G A;  3JCM b;  4XR6 A;  1SHG A;  4WZT A;  1TG0 A;  5TRD A;  1JXO A;  4OB1 B;  2ED1 A;  4HIZ A;  1EIF A;  2J05 A;  3RDV A;  3P26 A;  4CRI A;  4Q7J B;  4NBS A;  1U5S A;  4KGX B;  3VS5 A;  2QTV A;  2C78 A;  3W2I A;  1S72 B;  2CZ6 B;  4M7D E;  5BSX A;  2IPO B;  1I5O B;  1M3B A;  1AWW A;  1WYX A;  1WJR A;  9ATC B;  3HKS A;  3CCU T;  2E1H A;  1AT1 B;  1VOM A;  4RTV A;  1QCO A;  4E0F A;  1S72 A;  3G4S Q;  1YCS B;  2QK0 A;  4HCZ A;  1BYM A;  1S1N A;  2K5F A;  4FCY A;  2E6N A;  4C5H A;  2F5K A;  1Q7Y C;  1NE8 A;  2ZZD A;  3E1S A;  4ELY C;  1WHG A;  5FU6 B;  1Q86 R;  1BK2 A;  3WY9 A;  4M75 A;  2HSP A;  2WSE E;  1WP6 A;  1KHC A;  5LL6 S;  1N08 A;  5LJ5 h;  3CP8 A;  3A1P A;  3CCQ T;  2XZP A;  2P0Q A;  4GLK A;  3WBJ A;  2XG8 D;  4OPO A;  3TVT A;  1ZBJ A;  1MAB A;  5FO0 A;  2YLB A;  5FRN A;  4J9H A;  1VQO B;  3M54 A;  4PJL A;  4QHY A;  3PGG A;  3AVV A;  2FZG B;  2BE9 B;  1AMO A;  2ZPF B;  3G71 B;  2EGC A;  1VQK B;  1R0C B;  2QA4 Q;  3QHS A;  5JBQ A;  3CC4 T;  1VQ5 Q;  1VQO A;  4B43 A;  4DBH A;  4Z4Z A;  1E62 A;  3G71 A;  2JTF A;  3Q39 A;  4G1V A;  1VQK A;  3WNB A;  4X8I A;  1K1Z A;  3EGD B;  4HXJ A;  1QVG S;  2FHD A;  2JVV A;  3PIP A;  2W0Z A;  1Q86 C;  1WSR A;  3LO8 A;  2P3M A;  1H8E A;  4C92 F;  3CMA T;  4HCC A;  2XD0 A;  1WSV A;  1YI2 T;  4LDY A;  3EGD A;  3F70 A;  1M9S A;  4E7S A;  1S72 Q;  4CC3 A;  1X75 C;  1PG5 B;  4HCB A;  3JB9 I;  1Q82 R;  2YWF A;  2P0P A;  2XNJ A;  4YAU A;  4RDK A;  1N6A A;  5EG2 A;  4B48 A;  3P8B B;  3G6E B;  2NPF A;  2X6X A;  1ZUY A;  5GAN h;  4JRI A;  3RUX A;  4BD3 A;  2DL5 A;  4XMY A;  2WJV A;  4Z4T A;  4F7U E;  2QTL A;  4BE0 A;  2D0Q B;  4LDV A;  2CW5 A;  3OW2 B;  4ASU A;  4JZ4 A;  2BM1 A;  1H85 A;  2ABL A;  4Z02 A;  5I2M A;  1SKQ A;  2EFG A;  1YIT B;  5FLX E;  4PC3 A;  3RKW A;  4KH1 B;  3CBM A;  3OSS C;  3OW2 A;  4ZGE B;  2V7U A;  4E7I A;  2VB6 A;  3PFS A;  2PVO B;  1YIT A;  1OB0 A;  3ASK A;  2E1B A;  3PVL A;  1VQO Q;  3TSW A;  4X7E A;  2HDN B;  4FYW B;  1IRX A;  4VUB A;  1ARK A;  2FRY A;  3G71 Q;  2OTJ T;  3GVK A;  5GV7 A;  2FYK A;  5AYF A;  3CQT A;  2XMF A;  3UDC A;  1VQK Q;  3SLD A;  1E1R A;  4ME7 A;  4KKT A;  3CP2 A;  4PAA A;  4PNO A;  2AHJ B;  2K79 A;  2QGG A;  4PFO A;  4XU2 A;  2BV3 A;  4JLI A;  3TEE A;  1NZ9 A;  1ELO A;  4OP7 A;  5DM7 R;  2PLF A;  2DL3 A;  4N4H A;  4M77 E;  4QQD A;  2QQA A;  4XKV A;  2KQW A;  4YEJ A;  3ONY A;  2L3Q A;  1M1K U;  1RAB B;  2YUQ A;  4ACB A;  1S4M A;  2QG9 B;  2RH2 A;  3S6W A;  2KDS A;  4MYU A;  2D0N A;  2C06 A;  3HAG A;  2ZZF A;  2CP5 A;  2KGT A;  4OPV A;  2AK5 A;  4MDX A;  3DDY A;  3LH5 A;  2KNB B;  1WI7 A;  3CW2 A;  3G6E Q;  2GQV A;  3OYC A;  1G3Y A;  3LQ6 A;  3VUZ A;  1TSF A;  1F20 A;  2FO0 A;  4ZGN B;  2COW A;  4WF2 A;  3CEY A;  4MZT A;  1MRZ A;  4DQK A;  4X9D A;  5D6Y A;  3EH2 A;  2WR8 A;  1PCX A;  1YIT Q;  1JA1 A;  1GFD A;  4F7D A;  2CRE A;  1KK3 A;  1LVK A;  4L59 A;  4KBM B;  3HTR A;  3WQZ A;  4X34 A;  4J7I A;  5LJ5 g;  4PJO D;  4EMG A;  4RTW A;  3JB9 D;  4U9U A;  2HD0 A;  3FB9 A;  3EFS A;  1KJW A;  4OMQ A;  1KK1 A;  1AWJ A;  4ZGD B;  2ZL7 A;  1BIB A;  1D1N A;  3QDR B;  4WZK A;  1WLP B;  2RN8 A;  1PWT A;  1M1K C;  5H5J A;  2R57 A;  1QUE A;  3LNN A;  3CME T;  2H8H A;  4OMM A;  4ZCL A;  1QVF B;  1VHO A;  3AVU A;  4XTX A;  1Y71 A;  3LGF A;  3ZFJ A;  3RY8 A;  4M78 F;  4H9G A;  2YUP A;  3OYE A;  2BE7 D;  2JT4 A;  1U2R A;  3VO1 A;  5FWC A;  2DX1 A;  1B07 A;  1QVF A;  2RJC A;  3QPH A;  2BF4 A;  2X85 A;  4KRT A;  4JMQ A;  4A4E A;  1QWF A;  4FYV B;  5GAN 4;  1NB9 A;  5IYW A;  1OB2 A;  2AKL A;  1HVX A;  3RMS A;  3OKX A;  4M75 E;  5M9O A;  1W70 A;  4G7W A;  2E5K A;  3UT1 A;  3OZU A;  4II2 A;  2K4Y A;  1VF7 A;  2F5T X;  2K2V A;  2VUB A;  2LX7 A;  2JJ1 A;  3CPX A;  3I55 T;  2VBT A;  5GAN 6;  4GBQ A;  3MEW A;  2OAW A;  4RCC A;  4JZ3 A;  1AD5 A;  2QDY B;  3L2V A;  3J80 E;  3BE3 A;  1FND A;  3OMG A;  5GAN g;  4C5G A;  3D26 A;  4LXC A;  1EWY A;  1VQ6 B;  2EYW A;  5KCO A;  2Q6L A;  3JU4 A;  4QFM A;  3D7S B;  5KNL A;  1BB9 A;  4OOS A;  3BFM A;  3LH0 A;  2L2P A;  2MPX C;  1VQL T;  1VQ6 A;  4QT7 A;  2JUF A;  4E7Z A;  1KSW A;  2I1L A;  4QVJ A;  4XU3 A;  5CIU A;  2XDP A;  5DLQ E;  2VYQ A;  1F60 A;  4Z4R A;  1RAA B;  2JM9 A;  1Y96 B;  1NM7 A;  4WZE A;  3JB9 H;  2E12 A;  2I0N A;  3H94 A;  4L6V 5;  3JQQ A;  3G05 A;  3C0C A;  2V8I A;  2MWP A;  2R58 A;  2YRC A;  5D6W A;  1Y96 A;  1B23 P;  1OQK A;  2A3L A;  4C92 D;  3OS2 A;  4B4D A;  3GF5 A;  4LBY A;  2BGJ A;  5GAM h;  4N0A C;  2QN6 A;  2D74 A;  5J35 A;  1TXQ A;  4IW3 B;  1GVH A;  1V0E A;  3W2G A;  2QDL A;  3FIF A;  4PL6 A;  1VQN A;  3M0U A;  2E3H A;  4A63 B;  1GJR A;  1Y07 A;  2VVK A;  1NLP C;  1YWP A;  5C0M A;  1WDX A;  4P9S A;  2DM1 A;  3NGP A;  1PNJ A;  2KK4 A;  4L8J A;  1YJW B;  1KHI A;  2HMA A;  3OW2 S;  3SJP A;  3ZUG A;  1S0U A;  4ROX A;  3AGP A;  4G7X A;  4D6W A;  5FU7 C;  2HKQ B;  1VQ6 Q;  2Q6O A;  4FIB A;  1YJW A;  3TSZ A;  5GAO l;  4DBQ A;  3URG A;  2LT1 A;  4N3G A;  2O88 A;  5KYX B;  2GJP A;  2RJD A;  4E7K A;  1LCK A;  1YHQ B;  2C0O A;  4LNP A;  3M0T A;  1D09 B;  3ZC3 A;  4ESR A;  3OSV A;  2PUK B;  1UGP B;  1FWZ A;  3W2H A;  1VLO A;  2VNI A;  2L5Q A;  3BDU A;  1VQ7 A;  1UTI A;  1A0N B;  3ASR A;  4AVZ A;  1QVG P;  1YHQ A;  1V29 B;  4M7D F;  4PK4 A;  1BQE A;  2R5A A;  2XID A;  1N5Z A;  4C5I A;  1WGS A;  2KRS A;  3CCV T;  1GBR A;  1EFU A;  2RC5 A;  1RUW A;  1QH0 A;  3NMZ C;  3ZL7 C;  2DRK A;  1OI1 A;  1PJ5 A;  4AFQ C;  3RKX A;  4M7A E;  2RJE A;  1UGS B;  1MV0 B;  5IT9 E;  5A0G A;  3RMQ A;  2LX9 A;  5GAN d;  1KZL A;  1HJD A;  2ZPG B;  1AZE A;  5I22 A;  3A8L B;  2W10 A;  2R5M A;  1NEG A;  4JS5 A;  4RD1 A;  4J9G A;  5A89 A;  2X0K A;  2F2W A;  4BAC A;  2YLC A;  1YJW Q;  8ATC B;  4HA8 A;  4J7F A;  1KC8 U;  3PUM A;  1WZO A;  3TRE A;  3EG0 A;  2KVQ G;  2BKD N;  2X4X A;  5GAN 2;  3T53 B;  3ULR B;  4Z4U A;  1WHM A;  4R0K A;  3ZBU A;  1VQ4 B;  4JLG A;  5CQX A;  1ZA2 B;  4Z88 A;  1U1S A;  3QWY A;  4Z4W A;  2F1M A;  1YHQ Q;  3JCM Q;  1K28 D;  4FW2 A;  2VJI A;  3CCJ T;  3BCD A;  3LQE A;  1SHF A;  4RG2 A;  1NG2 A;  3QDF A;  3WND A;  2AHO A;  1K4U S;  1VQM B;  1GAW A;  3CD6 B;  1E64 A;  4J9F A;  1PHT A;  1QVF S;  5KH6 A;  4QVC A;  1CSK A;  3HRS A;  2GNC A;  4HVW A;  4RPD A;  3CC7 B;  2VXF A;  1VQM A;  1M1G A;  2DVJ A;  2BIV A;  2V7Q A;  4LC0 A;  3ZZ0 A;  3CD6 A;  3REB B;  1AOJ A;  2GTJ A;  3PA2 A;  3VO2 A;  2NWM A;  4M78 D;  3JCM h;  2DL4 A;  3AGQ A;  2VV5 A;  4WCI A;  4F7U F;  4TMW A;  4C0D C;  3A5Z B;  3VS3 A;  2CBX A;  5CR2 A;  1G7S A;  2EGE A;  1YJ9 T;  3NHN A;  5GAM g;  2W6I A;  1BI1 A;  2V1Q A;  2GFU A;  4KKS A;  3SEM A;  3PTA A;  3NTH A;  1K9A A;  1TU0 B;  3MPU B;  2PE3 A;  2QE7 A;  1O75 A;  4DK1 A;  2XOK A;  4FYY B;  1PRM C;  4EH1 A;  5GMK j;  2LNH B;  3CCR B;  1RAC B;  1LPL A;  3OYN A;  4MYT A;  3X25 B;  1JXM A;  3EAE A;  3MHP A;  4OOX A;  3CCR A;  4AT1 B;  4WTO B;  3OZW A;  1WOO A;  3H0I A;  3A8K A;  1PD0 A;  2Z0W A;  3MP8 A;  4C8Q G;  1S72 T;  1VQ4 Q;  2XEX A;  4OML A;  1TUI A;  1HK9 A;  2J06 A;  4OB2 B;  1GL5 A;  3ASP A;  4N4I A;  2X6W A;  4BDY A;  4Y7C A;  4OGE A;  2RHU A;  3I56 B;  1IO6 A;  1BBZ A;  2LC4 A;  1OGI A;  1VQM Q;  2KEA A;  3V7A A;  5C6S A;  1IXD A;  4F16 A;  2DTO A;  1D1B A;  1YNZ A;  3TQ7 P;  3E9G A;  1ZUU A;  2JM8 A;  3I56 A;  3H8Z A;  3CC7 Q;  2DNU A;  3CB4 A;  1QKX A;  3HFO A;  5F4M A;  3M0R A;  2B7C A;  5LJ5 j;  3LLR A;  5L8R E;  3JRZ A;  1EFC A;  4LDW A;  3KFV A;  1NEB A;  4FL6 A;  1HXD A;  4Y92 A;  2A7Y A;  1MMN A;  3AHU A;  4ORZ A;  3DLL A;  2R9V A;  1GCQ C;  1MMA A;  2DYI A;  3QZ5 B;  2D6F A;  1J9Z A;  3I1F A;  1VQP B;  4E47 A;  3QJ6 A;  2RNA A;  3G71 T;  2CP6 A;  3CCE B;  1VQK T;  4Z8A A;  3JSC A;  2EBP A;  3GNG A;  4XTY A;  4BB7 A;  3EG2 A;  3W5H A;  1VQP A;  2A37 A;  2X3U A;  4G6I A;  5GAO m;  4QV2 A;  1KQS B;  3CCR Q;  3CCE A;  4CQJ A;  1MMD A;  2K57 A;  4A53 A;  2M5S A;  2XHC A;  2MCN A;  1H92 A;  4ZTJ A;  3CPW P;  1RL2 A;  1UMK A;  2K3X A;  2ZL6 A;  4NS5 A;  1BPL A;  2EIF A;  4QW2 A;  2PVG B;  3L42 A;  5FW9 A;  2DBK A;  2CKK A;  4C0D B;  4XOP A;  4KKU A;  2CUB A;  1CKA A;  4PJO C;  5TV2 A;  3H9N A;  2B5O A;  1WPY A;  3MHX A;  5GAN j;  1NJI U;  4LDX A;  3OBY A;  3I56 Q;  1JQQ A;  2GJK A;  3G4S A;  4M75 F;  2H3J A;  4RTU A;  1WQ7 A;  4X7F A;  2DIG A;  4KH0 B;  4M7D D;  4ZTF A;  4B47 A;  1D0X A;  5GAM d;  1JNY A;  1YIT T;  3OJW A;  3FC3 A;  4M77 G;  2B86 A;  1W0J A;  4JUV A;  2VYT A;  1C6V X;  5GAO q;  2WSF E;  2OI3 A;  2NUT B;  2K2M A;  2DTH A;  1TUG B;  4ATO A;  4M4S A;  1WTH D;  3JCM g;  2QA4 B;  1M30 A;  1VQP Q;  2NUT A;  5GMK e;  3M56 A;  2Q6I A;  2LRQ A;  2M02 A;  1ZBX A;  1Q7Y R;  3CCE Q;  2BZX A;  3P27 A;  3JQP A;  1AWO A;  3OW2 P;  2QA4 A;  4LE9 A;  4C8Q D;  3UAT A;  1VQ5 A;  5FRO A;  3GIR A;  3RER A;  3NTI A;  3PMI A;  5KYW B;  4P26 A;  3CC2 B;  3R6O A;  4J9B A;  3TU4 K;  4RD0 A;  5D6X A;  1DDG A;  1PD1 A;  5GAN 5;  4ZN3 A;  1NJI C;  1M8V A;  1WOS A;  1SG5 A;  4PJN A;  4Q5W A;  1FRQ A;  1IHM A;  1YJN T;  2VC8 A;  5KYW A;  3CPF A;  4PC6 A;  1K76 A;  2K5I A;  3CC2 A;  3VJP A;  2M51 A;  2V7W A;  2YWG A;  1BI3 A;  2PNI A;  4MMK A;  4TT3 A;  3GIB A;  4BY6 C;  1IRE B;  2BPO A;  1KTV A;  4C0G A;  1GCQ A;  3BY2 A;  2K7A A;  1VHE A;  1I07 A;  3PVD A;  3RES A;  1ZSG A;  2XK0 A;  4WQM A;  1K73 U;  4FSX A;  1W6X A;  2JJ2 A;  2HNI A;  1ZM9 A;  3CPW B;  2M1H A;  2HL3 A;  2RQU A;  2DER A;  1AEY A;  4AMC A;  4XLF A;  3QJY A;  1N9S A;  4C92 C;  2LCL A;  2CND A;  4DBF A;  4JJN K;  2C0I A;  1SM4 A;  3CPW A;  4PJO B;  2VWF A;  1JB9 A;  2JN0 A;  2NLU A;  2D9T A;  1CKB A;  1HD3 A;  2ZGW A;  1UEC A;  2GRE A;  4Z89 A;  1BI2 A;  2COZ A;  4PJO G;  3JB9 G;  1G83 A;  4AG1 C;  1RAG B;  2DK3 A;  1U3O A;  5IHN A;  2ED0 A;  3JQR A;  4E7H A;  5CO7 A;  3ZZT A;  5CVI A;  5GAO p;  1KC8 D;  2RI3 A;  3CC2 Q;  5KW9 A;  1YX2 A;  2X53 S;  4FW1 A;  5IYQ A;  3OYK A;  2D3N A;  5GAN e;  2FG0 A;  1V76 A;  2M9U A;  1Q81 U;  1RLP C;  1K73 C;  3OJX A;  1WJS A;  1ABQ A;  2ZCF B;  1J3T A;  4M77 D;  4M53 A;  3M0S A;  3MEV A;  4Z4S A;  1KMH A;  1QGA A;  5HXB A;  4M7A F;  3QFT A;  1QVF P;  3OYD A;  1D0Y A;  3PUN A;  1JRI A;  3G6E A;  4IKF A;  1KIK A;  4XLA A;  3SEJ A;  2CP2 A;  2CZ0 B;  5A8A A;  4FSS A;  5HKC A;  1R77 A;  4BI8 B;  1W1F A;  2M0Y A;  2DPP B;  2RM4 A;  1VQ6 T;  4LBW A;  4J9E A;  2KRO A;  4UC4 A;  1B7T A;  2XND A;  2ZL5 A;  3U6B A;  4LN2 A;  4RCB A;  4DQL A;  1D2E A;  2D1X A;  2GK7 A;  4M0L A;  4BY6 B;  4BDZ A;  4P5N A;  1QX4 A;  3H6Z A;  3FKS A;  1OX8 A;  3R6K A;  3FJP A;  1CNE A;  4UZE A;  4FU6 A;  1EFR A;  2JN9 A;  4Y91 A;  1ZX6 A;  1M3C A;  2DKG A;  3MJX A;  4C0S A;  1I8F A;  3OP1 A;  1FX7 A;  1KQS S;  4X06 A;  1N8R U;  3UA6 A;  2P84 A;  2OK7 A;  2GCX A;  4BI4 A;  4GQN A;  2CT3 A;  3FEO A;  3O5Z A;  4TN1 A;  2EQU A;  4HCK A;  2LTO A;  1VQN T;  4C92 B;  1GXI E;  5GAM j;  2OK8 A;  1E6H A;  1G3S A;  3JCM X;  4P6Y A;  2ZZQ A;  2IIM A;  2LQK A;  2C5B A;  4E2F B;  2GF7 A;  3CCL B;  1X27 A;  5DSZ A;  1M1K R;  3KBG A;  4EIK A;  5IXF A;  4C92 G;  3L2Z A;  4C92 A;  2O4X B;  3CCM T;  3SLN A;  3H0F A;  5IN1 A;  2RHX A;  1RAE B;  2JIZ A;  1UDL A;  2HAX A;  5HKK A;  2F69 A;  3H0H A;  1PKV A;  3CCL A;  3LW5 E;  1D1A A;  3LYI A;  1QP3 A;  2O4X A;  3I5S A;  3JCM J;  1HYO A;  3OOC A;  5CK9 A;  3LX7 A;  3S3N A;  1WU8 A;  5LJ3 h;  3QXE B;  3WBK A;  5IYR A;  2DCU A;  1XQH A;  1KD1 U;  2RI2 A;  1AIP A;  1XFO A;  2QQS A;  4P6V F;  2KYB A;  4M78 C;  2CP3 A;  1VA7 A;  1VQ7 T;  2X3X D;  2BUD A;  4DEX A;  2E10 A;  4J8O A;  3VU3 C;  3BY7 A;  3CCQ B;  3LGL A;  3V76 A;  1RAH B;  1YHQ T;  1NB0 A;  2X4Y A;  4YXW A;  1OX9 A;  2J7I A;  2BTT A;  4Z4V A;  2C4U A;  1QCF A;  1T3L A;  5AN9 A;  2MAM A;  2LQ8 A;  1NRK A;  3NTK A;  1U1T A;  1WHL A;  4R55 A;  1E3X A;  1MND A;  4X1V A;  2FL7 A;  2LCS A;  4C0F A;  1SRL A;  4PFP A;  3CC4 B;  2AKK A;  2XIC A;  2GK6 A;  1JJ2 P;  4HE6 A;  1T6X A;  1XB2 A;  1MV3 A;  5IYP A;  1BKB A;  1XOV A;  3UPU A;  3EG1 A;  1BI0 A;  2VBS A;  3JCM P;  4UZF A;  5TY0 A;  3CC4 A;  2JXB A;  1WHK A;  1ZHI A;  4XTZ A;  3ZPN A;  1KRH A;  2PZ1 A;  2DYB A;  3VR6 A;  3GSI A;  1D8T A;  1M90 D;  3CMA B;  3CCL Q;  5GJV B;  2VNJ A;  3I35 A;  4OVA A;  1ZM4 A;  4XKW A;  2LZJ A;  4NNJ A;  2HEQ A;  3M53 A;  1Y0Y A;  3GNF B;  1E1Q A;  1KD1 C;  4FK8 A;  3SDZ A;  3Q38 A;  2DD5 A;  2LP5 A;  3CCU Q;  4OPS A;  1M1F A;  1NJI D;  3HRT A;  3QO3 A;  1QVP A;  5FWB A;  3P8D A;  7AT1 B;  2FVU A;  3OYM A;  3OYA A;  4L5G A;  4JS4 A;  3CPW S;  1EP3 B;  4XLC A;  4XQF A;  5HZA A;  1V1C A;  4TMT A;  2M16 A;  2OTL B;  2SRC A;  2KR3 A;  1TLL A;  5E6T A;  2EW3 A;  4XTV A;  1VYV A;  1X2K A;  4C0Z A;  3JCM W;  1K8A U;  4NCN A;  4IUU A;  5F4J A;  4HVU A;  2ZAE A;  4J5Y A;  5KYN A;  4HT9 A;  1F1B B;  1JBM A;  2JMA A;  2OTL A;  3CCQ Q;  4PKC C;  4XL9 A;  1IGQ A;  1WA7 A;  4Y28 E;  4JRQ A;  5FA6 A;  4J9C A;  1ACM B;  1BJK A;  1VQ8 B;  1OEB A;  2KRN A;  3ZBT A;  4F14 A;  1DAR A;  2KY9 A;  3KUF A;  2DVE A;  4QVZ A;  4D8D A;  6AT1 B;  3CD6 T;  2D8J A;  2OTJ B;  2RQT A;  3WVE B;  5GAM e;  2E41 A;  2QGF B;  4AG2 C;  1VQ8 A;  1N05 A;  1C1A A;  3CC4 Q;  2CUD A;  3OE7 A;  3WXM B;  4EMH A;  3OYF A;  2KBT A;  2VGN A;  2V7T A;  3ER0 A;  3VRY A;  1Y0M A;  3M4G A;  3V7S A;  1WQW A;  2OTJ A;  4M78 B;  2OJ2 A;  4P22 A;  2J6K A;  1W2B B;  3E2U A;  5FIU A;  3KL9 A;  2YDL A;  2ZXH A;  3WXM A;  2HCJ B;  3CMA Q;  3PA1 A;  2AZV A;  3T9N A;  3X24 B;  1WHH A;  4E6R A;  1TTT A;  2XDD A;  2EYX A;  1OPK A;  2F1L A;  4M78 G;  5LMZ A;  5HY6 A;  4HE5 A;  2WSC E;  3FJ5 A;  1VQ9 B;  2RK1 A;  5CKB A;  1SPK A;  5LJ5 d;  4M7A D;  3NFC A;  3BY1 A;  3L2Q A;  2YWH A;  2Z6B D;  3QBY A;  4IIO A;  2EJF A;  4EPC A;  4F17 A;  3G1J A;  3CCR T;  3QFR A;  4TSF A;  1E3Z A;  3G7Z A;  2DIL A;  1RQP A;  3V8L A;  3I5R A;  2RF0 A;  1VQ9 A;  2YUO A;  2DA9 A;  4M7D C;  3QE2 A;  1B3Q A;  2FPD A;  1NPR A;  1ZUN B;  3V8K A;  1K73 D;  1JJ2 B;  5A2Q E;  2O2O A;  2OTL Q;  3M55 A;  3OYG A;  3AVT A;  3LVB A;  5LJ3 g;  3J81 E;  4UAJ A;  2QQB A;  2HSE B;  1LJO A;  3VRZ A;  4P1V A;  4YEL A;  4BE2 A;  1JJ2 A;  4IUT A;  1B2R A;  2V31 A;  5KYX A;  2G3R A;  1MUZ A;  2OBS A;  1ZSZ C;  2OBR A;  1VQ8 Q;  5KCH A;  2XNC A;  1UGV A;  4LBV A;  2EPD A;  2OTJ Q;  3O8V A;  2DY1 A;  2EWN A;  4C8Q C;  1IHW A;  3H41 A;  3GPL A;  2HZY A;  4QQG A;  2FX3 A;  4MZM A;  2B8A A;  3CXC B;  3CME B;  3HPW A;  2JTM A;  2EQI A;  3EFR A;  4GY5 A;  3QYH B;  3NE5 B;  2KAF A;  1KK0 A;  2XZO A;  5IYN A;  5KE3 A;  2JNG A;  1Y57 A;  5J3B A;  5I11 A;  2PIA A;  3CXC A;  4ACA A;  4RPB A;  2HKN A;  1VQP T;  5FL7 A;  1Q81 D;  5CQY A;  3CCE T;  3OS0 A;  1QLY A;  1VQ9 Q;  4N3N A;  4DOV A;  2NUP B;  2NYS A;  4PAB A;  1OU9 A;  1UD3 A;  3MKD A;  3I55 B;  4FT2 A;  2OX7 A;  4FM4 B;  2QTX A;  2NUP A;  3GQB A;  3QG1 A;  2LT4 A;  3A98 A;  3GVJ A;  1BU1 A;  3PMT A;  1WOP A;  3EG3 A;  3I55 A;  1AZG B;  4N0A A;  4E7J A;  4J9I A;  2FRW A;  4HVV A;  1Q9S A;  2YHT A;  1VQ4 A;  3G4S T;  2NV4 A;  1NDH A;  2D3L A;  5LJ5 f;  3WNC A;  2RQV A;  1CNF A;  1KQS P;  1T5E A;  5FU7 B;  3ZBD A;  1KK7 A;  5CKD A;  2C4T A;  1M3A A;  1M4Z A;  3U6K A;  1H3Z A;  2QQR A;  4Z4Y A;  2E6Z A;  1WHJ A;  2PVD B;  4M7D B;  1M8M A;  3S3O A;  2E1R A;  2LVM A;  4XON A;  3HHT B;  1H42 A;  2EKH A;  1N8R D;  4ANJ A;  1G5V A;  2RPN A;  3CME Q;  3CC7 A;  2AIR B;  3VS4 A;  2MK5 A;  1KC8 C;  1EP2 B;  4M7D G;  1NLO C;  4FT4 A;  1RAI B;  2KT8 A;  3MP6 A;  2ZBV A;  4Y9U A;  1UGR B;  2HQX A;  4B3G A;  2QA4 T;  1UJ0 A;  2ZPH B;  2PQW A;  4RD6 A;  1ZSZ B;  1VQ5 T;  4RJL A;  4YAF A;  4R71 A;  4PLL A;  2E5Q A;  2DL7 A;  3S3M A;  3U2Q A;  4M77 C;  1N07 A;  1VUB A;  4NOY A;  5LJ3 d;  4HKE A;  4C8Q B;  2CH4 W;  2K5L A;  1Y0R A;  1BCM A;  1OOT A;  2YWW A;  3I55 Q;  3L2U A;  4NL2 A;  2JDI A;  5GAN f;  4C5E A;  4PC1 A;  4C8Q A;  3UWN A;  3ES9 A;  1FXX A;  4M1K A;  2H3E B;  4J6W A;  4XAX B;  4XU1 A;  2LJ0 A;  3M57 A;  3VS7 A;  1FRN A;  3SHW A;  1KD1 D;  3A8O B;  4RKU E;  3I9Q A;  1UD4 A;  3M59 A;  1KFZ A;  1XJW B;  3QFC A;  4B44 A;  1SSF A;  3M9Q A;  3QFS A;  3RKY A;  2B7B A;  2D9R A;  3V8J A;  1SRM A;  1YFN A;  2P4T A;  2XU8 A;  3QKJ A;  3ZIA A;  3JB9 J;  1DJ7 B;  1VYU A;  1UD2 A;  2OAU A;  2GQF A;  1YBY A;  2V4D A;  3A3B A;  2RHY A;  4DNT B;  2WJY A;  3WYA A;  2C0T A;  1ABO A;  2I2L A;  1IB8 A;  3GLX A;  1VQO T;  1K9M U;  1W2B S;  5L46 A;  3HFN A;  1TUC A;  1I0C A;  1PC0 A;  2VGM A;  3E19 A;  1UG1 A;  2XZL A;  4F7U B;  1B34 B;  2BM0 A;  5IK2 A;  4CC2 A;  1YCY A;  1NBE B;  4YHB A;  3BCF A;  3CTA A;  1AWX A;  2DXC A;  1G7C A;  4J83 A;  5HZB A;  4F7U G;  1B34 A;  3EHR A;  2E3I A;  4A4G A;  3GOX A;  2QI2 A;  4TMZ A;  2CRV A;  2YT6 A;  1N27 A;  3P8H A;  2V7X A;  4ZGQ B;  1M90 U;  1KQS A;  4M75 C;  1Z9Q A;  1PRL C;  1JJ2 S;  1E43 A;  3C4S A;  5TR9 A;  1YIJ B;  2KYM A;  1BX0 A;  3VNV A;  3Q6R A;  2O9S A;  2PUO B;  3EH1 A;  2CH4 A;  1RAF B;  1WOR A;  3M0Q A;  2EVR A;  2RB6 A;  2F4N A;  3FDR A;  2QYZ A;  4RCY A;  1VLY A;  2DRM A;  3SD4 A;  1HSQ A;  1YIJ A;  1K8A D;  5CKH A;  3G6E T;  1G7R A;  1OHH A;  2ZBU A;  4XQ3 A;  1V0F A;  4M77 B;  4B9W A;  2P0K A;  1VIE A;  3KXT A;  1ZLM A;  4AFU C;  1OZ2 A;  1FNB A;  1E63 A;  1QFZ A;  3L2W A;  1GCP A;  5DLO A;  1HA3 A;  4ZN1 A;  2EQM A;  1K0S A;  2KMT A;  1M27 C;  3JAM E;  2LJ3 A;  1NBM A;  4M77 A;  5GAN 8;  5L23 A;  5HK0 A;  1NJI R;  5H59 A;  1ZUK A;  4TVR A;  3N5B B;  3CXC S;  1G2B A;  1COW A;  1OV3 A;  5BSY A;  2ATC B;  1QFJ A;  4DBR A;  3CCV Q;  2CK3 A;  3V7C A;  3X26 B;  1H3H A;  3RR6 A;  3VYG A;  1X01 A;  2QEX B;  2EIX A;  5GAO r;  2CYZ B;  1FNC A;  1M90 C;  2W6J A;  4KUL A;  4O6J A;  1GO2 A;  4J0Q A;  2YSQ A;  2X9H A;  4XK8 E;  4KUD K;  2QEX A;  1YJ9 B;  1FDR A;  1KJZ A;  2F43 A;  2FB7 A;  4B6M A;  1DDI A;  2EYY A;  1KG1 A;  2QQ9 A;  3R6N A;  1YJ9 A;  4PGO A;  1EX4 A;  3HRU A;  1YIJ Q;  4ZV4 A;  3DB4 A;  1OUL A;  2ESW A;  4DQ2 A;  5GMK h;  2RA2 A;  1MHN A;  3OB9 A;  2XI9 A;  2X8K A;  1T0H A;  5J39 A;  5F4O A;  1FMV A;  2WZP P;  2K3Y A;  4IIM A;  3CCL T;  4LUD A;  4YAW A;  4FXU A;  2X51 A;  1XTD A;  5LJ5 e; 
#chains in the Genus database with same CATH homology
 2DOG A;  3HTR A;  2QGG A;  2F1L A;  3A1P A;  1PM3 A;  3H9N A;  2DYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...