2DYIA

Crystal structure of 16s ribosomal rna processing protein rimm from thermus thermophilus hb8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
162
structure length
162
Chain Sequence
MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 16S rRNA-processing protein rimM
publication title Crystal structure of 16S ribosomal RNA processing protein RimM from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ribosome
total genus 31
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2dyiA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2dyiA01
2QGGA 3A1PA 3HTRA 3H9NA 2DOGA 2F1LA 2DYIA 1PM3A
chains in the Genus database with same CATH superfamily
3SJPA 3LGLA 1ELOA 1GRIA 2CZ6B 4M77E 4F7UA 2Q6OA 4M75A 4P25A 2ZXHA 1RQPA 1N05A 1NYFA 3VKIA 1NJIR 3I56B 3FDRA 4KT0E 2ED0A 3CB4A 5FU7C 1T0JA 3H94A 3G6EB 1OB2A 2RI2A 4QKUA 4F7UF 3M0SA 3U2QA 4M75F 1IGUA 3GNFB 2P3MA 3AVXA 4MYTA 1V5VA 5FU6C 2V8IA 2C4TA 4AF6A 3JCMb 3R6OA 1AVZC 1E3XA 1I1JA 1QUEA 2WSCE 2M02A 3KUFA 2GJPA 4ELZC 4BI8B 4M77B 3VNUA 1I07A 1ZSZA 4PAAA 1RI0A 3INZA 1OEBA 1XB2A 2D3NA 1KD1D 3V8JA 3GIBA 3GLXA 3LO8A 4A4FA 3LGFA 2V7XA 3H0HA 1VQ9A 4HCZA 2NWMA 3V7RA 3H9NA 2VBTA 3QFTA 2AHJB 2CNDA 4C8QE 1VQNB 1YCSB 4QV2A 1I8DA 2ZZFA 1G3TA 2HSPA 2GQVA 1K76A 4M78E 1VQKA 3RBBB 2E4HA 1VQ9T 5CKBA 2NUTB 2O4XA 3AVWA 3OS1A 1MMNA 3GOXA 1MV0B 4JPBW 4YTLA 1GBQA 2MAMA 2BGJA 3A8JA 3SWNC 2BZXA 4F16A 1VQKT 3OAAA 3OY9A 3MHPA 2DD5A 4F17A 1EIFA 2EBPA 3L42A 4RCCA 1I0CA 3Q38A 3OS2A 3LYIA 1D0YA 1T6ZA 1DDGA 1M3BA 3OYHA 1VQMA 3QJ6A 2KE9A 4H9GA 4B9WA 4A4GA 4EIKA 4JMQA 3EG1A 2DL8A 1GXIE 2QQ9A 2YRCA 4C8QB 1X2KA 2LJ3A 5F4JA 3NTHA 1VQMT 1A0NB 4J6YA 1QLYA 2G6FX 3OYBA 1EFTA 2HL3A 5GV8A 3H8ZA 3UPUA 5IH2A 4XU1A 3CQTA 1HK9A 2K5FA 4M7DA 1WXUA 3MKDA 2CT3A 2QTVA 1OX8A 1DARA 1V0EA 3CCRQ 2X3XD 4F7DA 3HHTB 4J83A 4LDVA 4MMLA 4DEYA 5CK9A 3ASQA 2V7UA 3CC7Q 3VRYA 2KY9A 3JU4A 4TMVA 1QFYA 5FRMA 2KVQG 5J3OA 3OW2S 1UD3A 4JJCA 3RUXA 4DBRA 2WJYA 4RDJA 2CSQA 2Z0WA 2XK0A 2J6FA 2YHTA 1XOVA 3CCQA 1VQOQ 2DL4A 4P5NA 5HCKA 1VQ6A 3X26B 4PJOB 2M9UA 4XORA 4TKOB 3WNCA 1M3CA 4NL3A 3NFCA 1VQ4A 5EC7A 4ZTJA 4NOYA 3CD6Q 1AMOA 2I2LA 1OGIA 2VNHA 2ZPIB 2JM9A 4PJLA 2BSAA 4WZEA 3CCQT 2ZPFB 1VQ6T 1VA7A 1G3YA 1MGQA 4XN0A 3M55A 1E64A 4R71A 1VQ4T 1GBRA 2QGFB 3JCMe 4XL9A 1U2RA 1FXXA 1Y96A 3ASRA 4PC6A 3MP6A 4XLHA 2ECZA 1NJID 4RDLA 2BKDN 1RAGB 3OBYA 1QKXA 3WVDB 1UGRB 4AMCA 4M77D 2DIGA 1FNBA 5TR9A 1BCOA 2B86A 2E65A 4D6WA 5I2SA 1YWPA 5CKFA 2XZPA 4A54A 2RI3A 4QQ6A 1BKBA 4WCIA 3OW7A 3Q39A 2OI3A 4XTYA 2CP5A 2KMTA 1ZUYA 1V0FA 1QVGS 2CW5A 4QW2A 3ZL7C 1G3WA 2RI5A 2RC6A 5JBQA 3JB9F 2K7AA 2VKNA 1VQLA 3AHUA 2JMAA 5LJ5d 5BSYA 1JA1A 2FX3A 2ZPHB 2QK0A 4B9XA 4EMKC 4RTYA 1EFCA 1UD4A 3BFMA 3KBGA 1ARKA 4Z4TA 5FL7A 4RDKA 2DNUA 5CDFA 1UMKA 2EFIA 1VQLT 2EQMA 1VQ8Q 3C95A 1QVFA 2HQEA 4R55A 1SHFA 1VQPA 2F2XA 1XFOA 4PK4A 2BIVA 3R6JA 2DBKA 2LX7A 3OFNA 5FRNA 3CXCP 5HK0A 4Z4VA 1M8MA 3VS2A 1Q81U 4WWVA 3CC4A 1VQPT 2PIAA 5KE3A 4M78D 4RD6A 5LJ3j 2L5QA 1YX2A 1NYGA 1D1NA 3ZBDA 4ZTFA 3MHXA 3RY8A 3G71A 3CMEQ 1H42A 3G4SB 1Q81C 2D74A 1OQKA 2LMJA 5IYWA 1TUCA 2L8DA 3KL9A 1FWZA 1N27A 2RN8A 5KYXA 2PVOB 3CC4T 2KVOA 2YLBA 2DKGA 3C0CA 2YSQA 4QVCA 3OW2P 1K0SA 2DETA 2NPFA 5LL6S 2J6KA 2DRKA 5L8RE 4E7KA 3ASSA 1WOPA 3G71T 5TRDA 2KR3A 2FZGB 2KYBA 5IN1A 3WVEB 1GJRA 2DD4A 3M0UA 1YITQ 2OK7A 4P6YA 1RADB 3JCMg 1QCNA 4M7AF 3OYEA 4JJBA 4LBYA 1D0ZA 4YAFA 2CDTA 3QWYA 3KEWA 1QP3A 5CKEA 1JJ2A 4OB2B 2CUBA 4C5EA 3A3BA 3JCMX 3LWIA 2Z6BD 5H59A 3WQZA 4XD7A 2EYWA 2JXBA 2WZPP 3PMIA 1KK3A 1U1TA 2MPXC 1WOOA 2VNIA 2QA4Q 2HEQA 2DXBA 4OOXA 3ZFJA 3U6BA 1S1NA 4AFQC 3REBB 3E2UA 4ASUA 3E9FA 3P8HA 3OEEA 3CPXA 3OJXA 3CCVQ 2H3EB 3EG9B 5CVIA 3CXCB 3HKSA 2OTLQ 1QGZA 3FRNA 2F69A 3BE3A 2I1LA 3SEJA 2BZ8A 1SKYB 3CCSB 4A53A 4KGXB 4NNJA 3SB2A 1JJ2S 1M3AA 1W70A 4XM3A 2JIZA 1WTHD 2K3BA 2F2WA 3LWHA 4FN5A 2DTHA 4Z88A 1IGQA 5ECAA 1P92A 3Q3AA 5LJ3h 5GAMf 3VO1A 1QVGP 3ZUGA 2AIRB 3RMQA 1QQJA 2DJQA 2HZYA 4XTWA 4LBZA 3M5AA 4YXWA 1F60A 2GGRA 2NUPA 5IYRA 1UHCA 4YAWA 2ZPEB 3RDVA 1BI2A 2L3SA 1KK7A 1V29B 4G1BA 1YJNA 3QBYA 4OMOA 2B7BA 4Z1MA 5IXFA 2EYQA 3OYDA 1H641 4EMHA 3CMAB 2JNGA 1ZUNB 1ZA2B 2GFAA 1FX7A 2DRMA 4FWTA 1TTTA 4XQFA 4JRQA 3A1PA 2J7KA 3M0TA 5GJWB 5M9OA 1YJNT 2EYZA 4HKEA 2P0KA 1OHHA 3AVTA 4JS5A 1ZM2A 5C6SA 2C0TA 3CMMA 3LQ6A 4RCYA 1BU1A 5IYQA 4DNTB 2DF6A 2COWA 1Q81R 2DL7A 2C78A 1M1KU 5GV7A 5BSXA 1K73U 4UAJA 1KK2A 1H8HA 4Y92A 2FB7A 2GJRA 2IPOB 3EAEA 1UD5A 1K8AU 3WXMB 2RHIA 1IB8A 4X0CA 3CP2A 3OEHA 3PFSA 1YIJQ 4DQLA 2KK4A 1K73C 1KJWA 1ZX6A 4PJOG 1K8AC 1UTIA 4FSXA 8ATCB 2EJGA 3NMZC 4P9SA 5J26A 1QVGB 1TSFA 4FCYA 5IT9E 3MP1A 4C43A 1Z9QA 1FMKA 2ZPBB 3I56A 2ZBVA 4OMFB 1Q95G 5L23A 1VQ9Q 5EG2A 1JNYA 3VNVA 3BC9A 4ZGQB 1D3BB 4XTUA 3OYKA 4PJNA 2XKOC 2EQUA 4ZGDB 1B34B 2MIOA 3I56T 4ZV4A 3A8OB 1VQKQ 5GANd 1WXBA 4C0ZA 5I21A 3JB9I 2CP3A 4IUPA 3ZZTA 2A36A 3ZZUA 1VQ7A 1PWTA 2JM8A 1KHIA 1N8RC 3QXEB 1NLOC 3I1FA 3CC2A 2JN9A 4HE6A 4ZGEB 3SLDA 4N4IA 2HBPA 2BE9B 1H8EA 3QZ5B 4QT7A 1T6XA 1BI3A 2QI2A 3D26A 2LQNA 1JJ2P 2K4YA 4E7HA 2X9HA 2LRQA 1VQMQ 5D6WA 3CC2T 3J81k 4HCCA 2SRCA 1R5BA 3MEVA 2RC5A 1V76A 3JQQA 4RTXA 3E1YE 3M59A 4KRTA 4M77F 4C92C 1TUIA 4XOTA 1RAFB 4F7UG 4CI0C 4M75G 4LN2A 2VASA 1KG1A 1EP3B 4E7ZA 1VQNA 3HP9A 4HE5A 1R0CB 4P3YA 5FO1A 2ZL7A 2RMOA 1KIKA 4TSFA 3ZPNA 1OZ2A 3REAB 2NUTA 5KYUB 2K5LA 3QFRA 4LC0A 3L2ZA 4XR6A 3ME9A 1P4MA 2M51A 1KK0A 2W0ZA 2J06A 2MMPA 1VQNT 4B6MA 2GQFA 2G3RA 3GPLA 3I55Q 2E6NA 3HRUA 2ZZGA 3TVTA 3M0QA 1IJEA 3F70A 3CESA 3ULRB 4OPOA 4OOVA 3OYYA 2GNCA 2DVJA 4NS5A 1K1ZA 4RJLA 1M4ZA 1KMHA 2A37A 4QVAA 3JQPA 1W2BA 4B3XA 3SJZA 1K73R 1TUDA 2DPPB 1AHJB 2FPDA 2O9SA 3I35A 1VHEA 2QAZA 4X7CA 2JN0A 1K8AR 1W9XA 4UZEA 2CT4A 4BPRA 2YT6A 1ABQA 4J5YA 4C8QF 2OTJQ 5GAN4 4M4ZA 4J0QA 4E7LA 1Q86U 1VLOA 3CCLQ 3I5RA 4DK0A 4M78F 2DZCA 3OYNA 4OMMA 2KGTA 2AHOA 4FSSA 4P3IA 1G7CA 2KT8A 2KYMA 1Q86C 5CQXA 2F5KA 4P22A 1Q81D 3M54A 1KK1A 3EG3A 1W2BS 1XTDA 4PJOA 1ZUUA 2FHDA 2QEXA 3GIRA 3JAME 5GAOn 5FA6A 2DFUA 1UJYA 4C0GA 1N8RR 1BQEA 2O01E 3PNWC 4IIOA 1GCQC 4CQJA 4O6JA 3UA7A 4XAXB 1NBEB 4TMWA 4PJOF 4M53A 3BNWA 4XONA 5LJ3e 2EGEA 2F1LA 4DNRB 4ZCIA 2K79A 2QEXT 1VYTA 4PLIA 3EGXB 1TU0B 1VQLQ 3VO2A 1X27A 5B6IA 1WHLA 4JJNK 4EMGA 4Z4YA 3QO3A 4KGZB 4C92E 4LDYA 1S72Q 2A08A 3P8DA 1EP1B 2GPJA 2DYIA 2BPOA 1BX1A 4AG1C 3EGDA 2E70A 3DKMA 1RAHB 1AEYA 3O5ZA 4ME7A 4J8OA 2QQSA 2DYBA 1IXDA 4LDWA 1Y57A 5GANf 3LX7A 1XE1A 1X6BA 4E7IA 1VQ5Q 1W35A 3J81E 4AG2C 1AOJA 1WHMA 2X6WA 4AFSC 1SG5A 1BI1A 2YUPA 5KH6A 1GL5A 3G71Q 4RPBA 2PU9B 2DXTA 3E20A 1MUZA 3CCRB 4C92B 1QWEA 1UE9A 1Y0RA 1HYOA 2JMCA 3CEYA 1JB9A 4ACBA 1T3LA 2P84A 1KQSS 3CC7B 3JCMd 2FVUA 2M0OA 3I5SA 2YWEA 1KRHA 3VS7A 1W1FA 2ZXIA 2HQHA 3QYHB 1VQOB 1KTVA 2QDXA 1YP5A 4U9UA 1MMGA 3VJPA 4BY6C 4G7WA 2DILA 3H0FA 3QFSA 4BI4A 1QFJA 1M30A 2E1HA 5DN6A 5KYYA 2GBQA 3HRTA 4JZ4A 3CD6B 3CCEQ 5GAMj 3HL8A 1H3ZA 5DLOA 1GR1A 1SKUB 4HVWA 2RQVA 3J80E 3JB9G 1E79A 3VMFA 4YALA 3G4SA 1OPLA 1NM7A 2YWGA 1SEMA 1Q86R 1T3SA 2DZ9A 5J39A 4WTOB 4OPVA 4PC2A 2WR8A 4WF2A 3RMSA 4WZKA 2XOKA 1RL2A 1X75C 1PKVA 2OBRA 3G4ST 2DA9A 1BYMA 3WY9A 1RABB 1N9RA 1ZM4A 2KQWA 2CRVA 4RTTA 5LJ3g 4MDXA 2CUDA 1EXMA 1M1KD 1W0KA 2DO3A 1K73D 1N0UA 1HD3A 2RQRA 2K6DA 1K8AD 3ZBUA 1QUFA 1WQ7A 4FU6A 4L5GA 1XQBA 2JJ1A 3L2WA 4YAOA 2QGGA 3EFOB 1IB0A 4EH1A 1UFFA 1AZEA 4C0SA 2OAWA 3QE2A 3UATA 2E1BA 1M1GA 1YJNQ 2ROLA 4M75C 4AF7A 5GAN3 2CBXA 4GY5A 3AGQA 1UD8A 3M0RA 4Z4SA 2EVRA 1EP2B 1SRMA 4B3FX 1NB9A 1GAQA 2VVKA 5A89A 2KRNA 1B2RA 1DDIA 3GVKA 3CCSA 1VQ8B 5FWBA 4OMNA 2COYA 4M7AG 4M78B 1RACB 2KNBB 1OV3A 3L2UA 2E5KA 1QFZA 3FPPA 2A0FB 2VBUA 4B4DA 3M4YA 3A8LB 5GAN2 3A8GB 4GLMA 1VF7A 4Z02A 3CCST 4RKUE 2ZZQA 2VWFA 1Y0MA 2PUKB 4LE9A 2XDBA 1WXTA 1S0UA 3P27A 3ZIAA 3MEUA 3X25B 1ZSZC 3CMEB 2D3LA 3VU3C 4PFZA 3EHQA 4Z89A 2P4RA 1KQSP 4C92D 1K28D 1GCPA 1PNJA 1WPCA 3BQJA 1J9ZA 2C2WA 2BE7D 3B8HA 1TXQA 1H92A 1WORA 4RMOA 1BCMA 4RLZA 4L8JA 2OAUA 2QMUA 1YITB 4K1XA 2EWNA 3KXTA 3W5VA 2GF7A 1M2OA 4DQKA 1YJ9A 1YI2A 1AWOA 4YAUA 1IREB 5FU7B 4BE2A 2D6FA 1OB0A 4KGVB 4X9CA 2HLDA 2DIQA 4LDXA 2Q6LA 2DBMA 1YJ9T 1YI2T 2O2OA 3JV3A 2ZGWA 2K9GA 1VQ7Q 3WXMA 5FU6B 2QA4B 4FM4B 5GAN8 3M57A 4VUBA 3T53B 4Y9RA 3PVQA 3MO8A 1OU8A 3CC2Q 2X4JA 1CSKA 1RLPC 2JS2A 3CCVB 4CC2A 3UA6A 1WFWA 4X9DA 2OTLB 4A4EA 3PGGA 4LUDA 3I9QA 5DM7R 1M9SA 3HFOA 2LJ1A 2HKNA 2MOXA 4XU2A 2DL5A 2OX7A 1JEGA 4M7DC 3AVVA 5KNLA 2DIEA 2EJFA 3AGPA 4X8IA 2XNCA 1YJWQ 2M0YA 2VXFA 3T51B 4FW2A 4HCKA 4WZLA 1PRMC 5HKKA 1Q86D 2MK5A 2P0QA 1WU8A 4XLAA 1QG0A 5AN9A 3AT1B 1CNFA 3QHSA 5J35A 4PGOA 1D2EA 2V1RA 3M9QA 4B43A 2RNAA 2PTKA 2RF0A 5GAN6 1TS9A 4FT2A 2F1MA 2VZLA 3MP8A 5GMKj 1BI0A 3X20B 2O31A 4PFOA 2F4NA 4QFMA 3LLRA 3FPKA 4UZFA 1MV3A 3TSZA 2RJFA 3PUNA 3SWNB 5H5JA 4Y7CA 4FW1A 1H3HA 4EDUA 1Y07A 2X51A 2XGJA 5GAOr 4G7XA 2KT1A 4ATOA 2DOGA 2RM4A 3LH5A 2E5QA 3NGPA 2ZL6A 3Q6RA 2BTTA 3C94A 2RPNA 1S4MA 2DL3A 5FO0A 2LCCA 2P4TA 2ZTNA 2K3XA 4IUTA 3CBPA 5HZBA 3UF4A 3C12A 1QVFS 4M7AA 1A8PA 2RHZA 3U23A 1X43A 1NEGA 2JZ2A 2A3LA 4XU3A 5KYUA 3TEEA 2XNDA 1YIJB 4JS4A 3CCMA 1UD2A 3TSWA 3CPWA 5A88A 2BZYA 4M0LA 1B07A 2AK5A 3G05A 4C5IA 2NUZA 3QSYA 2CK3A 1EX4A 2ZCFB 1WGSA 1LJOA 4P12A 4YEJA 3W5HA 3CCMT 1WLPB 1Z9ZA 1YHQQ 3NE5B 2FL7A 2BUDA 1U8RA 5FIUA 5FNZA 2GQIA 1VQ9B 4M77G 4PJJA 4QQDA 2ROTA 2QEXQ 2ZZEA 2QYZA 5CKHA 2BVNA 3CCJQ 4C0FA 1UJ0A 4J6XA 3W2HA 1VQKB 3HFNA 4X1VA 4AVZA 4Y9UA 1OZ3A 2O4XB 5GMKh 3D7SB 2FRYA 2D8JA 4NCNA 4M7DE 3SKBA 3LW5E 3VS1A 4F14A 1N07A 1TLLA 2D9TA 4FIBA 5IYNA 3Q1JA 2Q6IA 4RD4A 3GBQA 3MPUB 2K2VA 1G83A 2AKLA 4XTVA 1FRQA 3NHNA 3ES9A 3OA6A 3JCMP 1PHTA 2E10A 4PFPA 3W2EA 1VQMB 1G8XA 2K2MA 4PC1A 4QVZA 2DTOA 3MCAB 1K0XA 1MHNA 2DERA 4AC9A 4QHYA 1I8FA 1W0JA 2EQIA 1OOTA 3OW2B 3BCFA 5KYWA 2LJ0A 1OULA 4ESRA 1E62A 4CC4B 4XKWA 4OPSA 2C06A 4RTWA 3X24B 3DB3A 1V1CA 1G2BA 3ISXA 1UECA 4DBHA 4X7EA 3IQLA 4MMKA 4M7DB 3U6KA 3CCUA 2M16A 1DG1G 4LXCA 3VUZA 4C8QG 4R56A 2JUFA 2NV4A 3VYHB 3A8HB 4IURA 2KI7A 3EGXA 4M78G 3VS3A 2QDYB 4BE1A 1JQQA 3I55B 2DCUA 3V7AA 2QG9B 1WP6A 2FYKA 3CCUT 4EMKB 4Z4UA 2IG0A 3PIOA 3A8KA 1XJWB 1G7SA 2BGIA 4LBWA 3E19A 3PMTA 4RCZA 2RJDA 3SHWA 3PIPA 1OYXA 3QDFA 4M75D 5LJ5f 3MEAA 2H3JA 1WNLA 5D7UA 3CRZA 2YUNA 1UEBA 4FYXB 2V7WA 4KH1B 1R0BG 2RD1A 1X69A 2HL5C 2KXDA 2RQUA 3EGUA 4G1VA 4XTXA 2FEIA 5F4MA 1KD1U 1WDTA 1CKAA 1QVFP 1KHCA 2DXUA 1LOJA 1YN8A 3LNNA 4FXUA 2HDAA 3OMCA 2OK8A 2EYYA 4TVRA 1WJRA 1JBMA 1KD1C 1M27C 2V26A 2M1HA 3CCRA 2OTJB 4NBSA 3OYMA 3OYIA 3OQ5A 1GVHA 4XN3A 3CCLB 5LJ3d 3ONYA 2PUOB 3FEOA 2J6OA 9ATCB 2LT4A 2CC2A 5TV2A 3CC7A 4CC7A 1NLPC 1BIAA 4JRIA 2X6YA 3CCRT 1PRLC 2R5MA 4C92F 1CNEA 4P2NA 3MJXA 3G6EA 2R5AA 3R6KA 2X4XA 1BBZA 3CC7T 1N8RU 4TT3A 4N4HA 4RCBA 1EFUA 2A7YA 2GTOA 3CD6A 2EGCA 4HVVA 2PMDA 1TWBA 3A98A 3S3MA 3WNDA 2X6XA 1VQOT 3G6ET 2LX9A 1WOSA 1FNDA 3QPHA 2CZ7B 3JCMW 2Y90A 4XKVA 4M77A 3CD6T 1VQLB 4E47A 1EWYA 1G3SA 5FLXE 1Y7XA 1TUGB 1S72B 4LD9K 5KE2A 3DLLA 4PABA 2C0IA 2CP0A 3OP1A 2A28A 3E1SA 3SD4A 3QUIA 2MYSA 4CC3A 1QVFB 1W34A 1E43A 5GAMg 3BDLA 1QGAA 1IZ6A 4JLIA 2DE0X 5KYNA 3OMGA 3OBWA 2VUBA 4X07A 4Y28E 2Q6KA 1VQ5B 2XD0A 2ZPGB 5GMKm 2ZBUA 3A3GA 4GQNA 5IHIA 1JO8A 1XNIA 2XICA 2YWWA 1SM4A 2EKOA 2BF4A 2H8HA 1F20A 3M58A 3FJ5A 4BDYA 3VS6A 1KC8U 4MZTA 4D8KA 3G71B 1WHJA 2NYSA 1J3TA 1QH0A 4M7DD 1HSQA 4PL6A 4AFZC 2AKKA 2EJ9A 3V7CA 2KXCA 2CF4A 3ASTA 1F1BB 2XDPA 3MEWA 3L2QA 3EH2A 1KC8C 2DMOA 3TREA 3CCQQ 4JRKA 2EFGA 2L3RA 2YWHA 4GLKA 1VQ6Q 1I4K1 1HXDA 3OYFA 2SEMA 3N5BB 3QKJA 1VQ4Q 4C8QA 3V76A 3AVYA 1C6VX 1OU9A 5LJ5g 1VQ8A 5CR2A 4HIZA 3CTAA 2X3WD 4M78A 2BM1A 1NRKA 2DJZA 2GTJA 3A35A 4DOWA 1YJ9Q 1ZHIA 1XQHA 5GJVB 1YI2Q 2JJ2A 1HA3A 1KD1R 1VIFA 1JJ2B 4OF1A 3JCMQ 4AFUC 1IHMA 4ROXA 1VQ8T 3CCEB 4UC4A 1KQ1A 4II2A 1R5NA 1Y71A 1TTHB 4X7FA 1NBMA 2ESWA 4KBMB 3RERA 4M77C 3VS5A 1W87A 2JTMA 3CMEA 3ER0A 2BM0A 1MABA 3FIFA 1PM3A 4X34A 3EFRA 4LDUA 4XMYA 4PJMA 4B44A 1QGYA 1QX4A 5GMKe 5GAOm 2RQTA 3VRZA 3LH0A 2V31A 3CMET 2EYXA 1AZGB 4OP7A 4RD3A 4CRIA 1T0HA 2C0OA 3FKSA 4PKCC 2J7IA 5J3BA 1YITA 1E6HA 2I0NA 5CQYA 1W6XA 3QIIA 1BPLA 2KAFA 1TH7A 2KROA 4J9HA 1SSHA 3NPFA 4KULA 1WA7A 3JB9D 1FNCA 1YITT 1SPKA 1YBYA 2JJ9A 1KZLA 3OKXA 2COZA 3CW2A 3W2FA 4G6IA 4K11A 1YJNB 3GQBA 2QA4A 2E3IA 3OYCA 5KCHA 1GFDA 2GK6A 4DK1A 1BK2A 4DEXA 4XQ3A 4XOPA 3OYAA 1UDLA 1VQPQ 2VNKA 2DVEA 4IIMA 4MZMA 3M56A 4C8QC 2CYZB 2VGNA 1WI7A 2QA4T 3OYGA 2W6JA 3OSVA 1IHWA 4X7DA 3R6NA 4C5HA 4BE0A 1UUEA 3FJOA 1UG1A 3SLNA 2HBWA 3CC4Q 3EG2A 1Q82U 5IYPA 1RUWA 1QWFA 1N06A 3EG0A 5AYFA 4ZGJB 4ZN1A 5GAN5 2VBVA 2KRMA 2ENMA 4II3A 2FO0A 1Q82C 5IHNA 2V8JA 1KC8R 5GMKi 2JTFA 1D1CA 5DS0A 1Q9SA 2X3UA 2MCNA 3CBOA 3RKXA 1I7PA 1EFNA 2CZ1B 8AT1B 2PQWA 2EW3A 1WX6A 3CCMQ 2PVGB 4X06A 4E7JA 3RIRA 3DLMA 4PJOC 2E1RA 4MDWA 2RH2A 2KDSA 3GVLA 4OB0B 1VIEA 2F5TX 1ZBXA 4LNPA 2RQWA 1RAAB 2E12A 4TMTA 3OOCA 1EZZB 2YWFA 1GAWA 1D1AA 3JSCA 5A2QE 1AT1B 3O8VA 1QKWA 2FPFA 1NG2A 1JXOA 2EQKA 3TU4K 1HZEA 2ZL5A 2DLPA 1Q7YU 1O9SA 3FLGA 2VYQA 4D8DA 4ANJA 4V2SA 2XEXA 4BACA 3SEMA 1U06A 2HAXA 1KQ2A 2KRSA 1FDRA 1Q7YC 2DEUA 4IW3B 1VQ7B 2LTOA 2BN4A 3H41A 3HPWA 2HKQB 3EH1A 3T9NA 1YIJA 1W2BP 2X4WA 4XNFA 3CC2B 4J6WA 2LCSA 5IK2A 2D8HA 4FYYB 2LQKA 4Q7JB 3UDCA 2OBSA 1M2VB 3OPOA 2RJCA 2HCJB 2L89A 2QTXA 1PD1A 3W5UA 1YIJT 1RAIB 3HRSA 4ACAA 3PVDA 4N3GA 1M90U 1PSEA 1R5OA 5LJ5j 1WHKA 2YLCA 2XZOA 4QVDA 1X6GA 2LP5A 4J9BA 2DXCA 1BX0A 2JVVA 3VS4A 1X01A 3VUBA 3X28B 1IHVA 1OGJA 1OX9A 1YJWB 2VXEA 1PJ6A 1M90C 2V7QA 3QDRB 3RR6A 2JDIA 3OZUA 1I5OB 2RHUA 3BCDA 1E7OA 1JB0E 3EHRA 1PC0A 1VYUA 5KSWB 3CCUQ 4R0KA 3EG9A 3CXCA 1E63A 2PNIA 1QMCA 1ZQ1A 2PLFA 3QSUA 5HY6A 3W2GA 2D0QB 5E6TA 2YUOA 5GANg 1WSVA 1YLOA 1N8RD 1SRLA 1SSFA 4DBFA 1O75A 3RKWA 2L3QA 3GP8A 4QUZA 2CP6A 2VNJA 3C4SA 2K57A 1SF9A 3ZBTA 5GAMh 4RD0A 5GAOq 1K9MU 4XTZA 1AIPA 2CREA 4J7IA 4RD2A 3WBJA 3MCAA 1Q82R 2CSIA 2L3PA 1DJ7B 3OW2A 4A63B 3G1JA 1WJSA 4QVJA 1NZ9A 2LQWA 1K9MC 1NB0A 3H6ZA 4PJOE 1W2BB 3CXCS 3CP8A 4ZGNB 2LNVA 4HT9A 1T6YA 2RA2A 4JUVA 3CMAA 2RHYA 1YFNA 5CO7A 1MNEA 2L0AA 4LD6A 2GK7A 1ZSGA 1VJSA 2WSEE 3JRZA 1ZA1B 2VV5A 3I55A 3A8MB 3CMAT 3I56Q 2LCLA 4KUDK 1AWWA 4EMKA 4M7DF 2HMAA 1TVCA 5LJ5h 2CH4A 1BJKA 4DBQA 1PJ7A 2EQJA 2X8KA 1YHQB 3G6EQ 2PE3A 4X05A 3RKYA 3I55T 1KC8D 3JCMf 5C0MA 3BH4A 2BV3A 4BY6B 4MYUA 2QEXB 2E41A 4IUQA 4ORZA 1Q7YR 2LZJA 4IUUA 3CCJB 4B3GA 4KKTA 2FRWA 4OP0A 1UHFA 4B47A 2LC4A 1X6OA 2IVWA 2X4YA 4RUGA 5FW9A 1N08A 2C4UA 4B48A 3M0PA 4E6RA 3PA1A 4A4HA 3Q6QA 1MRZA 3P26A 2EIXA 2OTJA 1FMWA 4JJDA 2XU8A 5GAMd 4IKFA 3ZC3A 1R77A 2W10A 1QVGA 3CCLA 2ABLA 1SKQA 3RESA 2LQ8A 1KSWA 5L46A 4F7UE 2Y4XA 4M75E 4M2LA 2R57A 1NDHA 2OBTA 1QCOA 2CS7A 2C5HA 3EGDB 3QJYA 2WZNA 1WPYA 5A8AA 2OTJT 5CCAA 1KQSB 1U5SA 1D3BA 4QQGA 1M90R 3CCLT 3PE0A 4MZPA 3S3OA 2FZCB 4J9EA 2LVMA 1VQNQ 4IUVA 3VV0A 2R6HA 3CPFA 1B34A 4L59A 1D09B 1WHHA 2X0KA 2YRVA 3OSSC 5AT1B 4N0AA 2XIDA 1U1SA 2M5SA 2ZZDA 2JTEA 2MI6A 2QE7A 2HCKA 2ED1A 3S3NA 1H8KA 1QVPA 5F4OA 1E1QA 4F7UB 4M75B 1SHGA 1S72A 1D0XA 2XMFA 4KH0B 2HNIA 1ACMB 3M53A 4JLGA 2HDNB 2X53S 2E6ZA 1COWA 4RG2A 4C92G 5GAN7 2RB6A 1K9MR 1D1BA 3UWNA 3SFMA 1C1AA 2HQXA 1AD5A 1S72T 2GFUA 2MWPA 1N0VC 3LVBA 3MMPA 4O5VA 2B7CA 4BUGA 5KYYB 1AWXA 3WYAA 1VQ5A 4HA8A 4OMLA 2CZ0B 2FZKB 3JCMJ 4C8QD 3PENA 4J9GA 1LPLA 4II1A 1WZOA 4LUEA 1JA0A 1KFZA 2E64A 2EPDA 3HAGA 3QWXX 1MMDA 2VYTA 3L1AA 4P6VF 4HT8A 1VQ5T 1ZSZB 4E0FA 2KEAA 2PZ1A 3T56B 3VR6A 2XNJA 4YELA 4L6V5 1PKTA 2DX1A 1Q82D 1FYNA 2X85A 1MNDA 4FT4A 5LMZA 4RM0A 3JB9J 5GANj 2HSEB 3HSBA 3WNBA 4OB3B 1N6AA 5FROA 2O9VA 2WSFE 4C0DC 4DA4A 1JU5C 3W2IA 4KKUA 2ZITA 2D9RA 1RLQC 2JS0A 4PJOD 1VOMA 3CBMA 4Y91A 5IAYA 3CPWS 2JOYA 4N0AC 1KJZA 3THKA 1Y0YA 3CCEA 2QQBA 2XZLA 4LBVA 2QXFA 1E3ZA 5HXBA 1TOVA 6AT1B 1RI9A 1N5ZA 1E1RA 2B5OA 3BY2A 1FNMA 2AZSA 2VGMA 3CCET 2RHXA 3UT1A 2GCXA 5DY9A 2RO0A 2LDMA 1HVXA 2RK2A 1WYXA 2EIFA 2K3YA 2R58A 5D6XA 4Z4ZA 2QQAA 3BDUA 1PJ5A 3GVJA 2ATCB 1Q7YD 4RTZA 3V8LA 3QG1A 1FRNA 4M7AC 4E2FB 4OVAA 1PD0A 2YXYA 5GAMe 2CKKA 2R9VA 5A0LA 4Z4RA 4HCBA 2V4DA 2Y4YA 2DY1A 3OB9A 4AT1B 4KUIA 4PC7A 2D1XA 1B23P 5IXBA 4ZCLA 2AT1B 5TY0A 1K9AA 1VHOA 4PC3A 5I22A 5CAIA 1G7RA 3QYGB 1QCFA 2D0NA 5D6YA 3URGA 1M90D 2LNHB 4TN1A 3CCQB 5GANh 1VQ6B 5IHKA 2C5BA 1ZLMA 2XDDA 4P26A 3OS0A 1VQ4B 3P8BB 2WYRA 5THXA 3QZ9B 1LNXA 1EFRA 2V8KA 3LQEA 1YJ9B 1YI2B 5HKCA 5LJ5e 3J7AF 1X2QA 2EAYA 3G4SQ 3PA2A 1UGPB 4C92A 1CQXA 2F2VA 1Y96B 4FYWB 1WHGA 1I18A 1ZM3A 4RTUA 3JCMV 1B7TA 4WZTA 4RPDA 1M1KC 1K9MD 4FL6A 2MF2A 5KCOA 4OGEA 7AT1B 1VQOA 2NLUA 2FG0A 1RAEB 2P0PA 1E6GA 4HXJA 1ZM9A 4OOSA 1IO6A 1JRIA 2RJEA 3KFVA 4FYVB 2VBSA 3OYLA 3CPWP 2CP2A 4J9DA 4Z4WA 2CH4W 2VJJA 2VB6A 1IRXA 1C0MA 4NL2A 1OB5A 5I2MA 3PVLA 3WBKA 2XG8D 4C0DB 2CP7A 4YHBA 3ZEHA 2QTZA 1GO2A 4JDSA 2V7TA 1NEBA 4TMXA 2EGAA 2J05A 3ASKA 2OJ2A 2XI9A 4OGCA 4M7AE 4N4GA 1UD6A 4XLCA 2X35A 2HD0A 4ZCMA 3E9GA 1VYVA 3CCSQ 4BDZA 1VQPB 3JCMc 4OB1B 1NPRA 3A5ZB 5DLQE 3VS0A 5HZAA 1PKSA 3L2RA 1W4SA 3A8IA 1M2VA 1VQ7T 4PNOA 2FVGA 1JXMA 1IJFA 4EPCA 3NTKA 1RQRA 3JQRA 1M8VA 4M4SA 3CC4B 3QFCA 5GAOp 1OPKA 3AVUA 2LZ6B 3EFOA 5DSZA 1BB9A 4DQ2A 1AWJA 2QTLA 4J9FA 2C77A 3OE7A 5KW9A 2F43A 5A0GA 3OZWA 1UGQB 1YJWA 4RD1A 4G5GA 1BIBA 3GF5A 4XU0A 5KYXB 2YRDA 4ZNXA 4JZ3A 3FC3A 2GREA 4M7AB 1UGSB 3CMAQ 2VJIA 4XK8E 1LVKA 2K5IA 2JT4A 1GCQA 2YDLA 3G7ZA 3B78A 4OMPA 5FWCA 1YJWT 1VUBA 1LCKA 1U3OA 5HK3A 1H85A 2ZTGA 2MWOA 3CCMB 3TCJA 1BMFA 3CPWB 2QDLA 2KSSA 1CKBA 4M1KA 4J9IA 1PSFA 2WPDA 1G7TA 1NJIU 1N9SA 2O88A 3B82A 3V8KA 2DEQA 2W6IA 3BY7A 3PTAA 4BI3A 1VLYA 4KKSA 1TG0A 1PCXA 5CIUA 1NJIC 5GMKl 1M1FA 4Z8AA 3DB4A 5I11A 1YCYA 2IIMA 1NE8A 1WIEA 4UZUA 1I5LA 3OZVA 3VYGA 1M5Q1 4J9CA 1M1KR 1WDXA 3PUMA 4Q5WA 4A4KA 2JW4A 2QN6A 3BW1A 1QP2A 1YNZA 3V7SA 3ONUA 2RK1A 1NPPA 3PT9A 4HVUA 3L2VA 1OI1A 2PVDB 4DOVA 2QQRA 2GJKA 3GNGA 2WSSA 1R8OB 3NTIA 3SDZA 3S6WA 3TQ7P 1ZBJA 4BD3A 1D8TA 4GBQA 2ZAEA 3DDYA 4RG8A 2BMWA 4JRPA 1WQWA 1ZUKA 4ELYC 1YHQA 3JCMh 5LJ3f 4C5GA 2B8AA 4XLFA 5EMNA 5KYWB 2NUPB 1K4US 2VC8A 2AZVA 1T5EA 1QW1A 1PG5B 1ABOA 3M4GA 3CCJA 2DTIA 1YHQT 1GFCA 3H0IA 1HJDA 2E3HA 3ASPA 2OYNA 4OMQA 3CCUB 3FJPA 1UB4A 3CCVA 4E7SA 2QASA 2OTLA 2DM1A 3CCJT 3HTRA 5GAOl 3RNJA 4TMZA 2V1QA 4M78C 4P1VA 3FB9A 2LT1A 4WQMA 1MMAA 4N3NA 3ZZ0A 1B3QA 1BLIA 4XLEA 4M7DG 1I81A 4J7FA 5A0DA 3CCVT 1UGVA 2WACA 2DAQA 2OTLT 1KQSA 2FPEA 3OS5A 4BB7A 3META 5GANe 4FK8A 1WJQA 2WJVA 1FMVA 4PLLA 1FX0A 2EKHA 3JB9H 3GSIA 4F04B 2DK3A 4ZN3A 2L2PA 2CGHA 2XHCA 1G5VA 2YUQA 3EFSA 5CKDA 3OJWA 1YWOA 2KBTA 2V7VA 3OYJA 3BY1A 4M7AD 4RTVA 3SWNA 1WSRA
chains in the Genus database with same CATH topology
2QGGA 3A1PA 3HTRA 3H9NA 2DOGA 2F1LA 2DYIA 1PM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGG A;  3A1P A;  3HTR A;  3H9N A;  2DOG A;  2F1L A;  2DYI A;  1PM3 A; 
#chains in the Genus database with same CATH topology
 3SJP A;  3LGL A;  1ELO A;  1GRI A;  2CZ6 B;  4M77 E;  4F7U A;  2Q6O A;  4M75 A;  4P25 A;  2ZXH A;  1RQP A;  1N05 A;  1NYF A;  3VKI A;  1NJI R;  3I56 B;  3FDR A;  4KT0 E;  2ED0 A;  3CB4 A;  5FU7 C;  1T0J A;  3H94 A;  3G6E B;  1OB2 A;  2RI2 A;  4QKU A;  4F7U F;  3M0S A;  3U2Q A;  4M75 F;  1IGU A;  3GNF B;  2P3M A;  3AVX A;  4MYT A;  1V5V A;  5FU6 C;  2V8I A;  2C4T A;  4AF6 A;  3JCM b;  3R6O A;  1AVZ C;  1E3X A;  1I1J A;  1QUE A;  2WSC E;  2M02 A;  3KUF A;  2GJP A;  4ELZ C;  4BI8 B;  4M77 B;  3VNU A;  1I07 A;  1ZSZ A;  4PAA A;  1RI0 A;  3INZ A;  1OEB A;  1XB2 A;  2D3N A;  1KD1 D;  3V8J A;  3GIB A;  3GLX A;  3LO8 A;  4A4F A;  3LGF A;  2V7X A;  3H0H A;  1VQ9 A;  4HCZ A;  2NWM A;  3V7R A;  3H9N A;  2VBT A;  3QFT A;  2AHJ B;  2CND A;  4C8Q E;  1VQN B;  1YCS B;  4QV2 A;  1I8D A;  2ZZF A;  1G3T A;  2HSP A;  2GQV A;  1K76 A;  4M78 E;  1VQK A;  3RBB B;  2E4H A;  1VQ9 T;  5CKB A;  2NUT B;  2O4X A;  3AVW A;  3OS1 A;  1MMN A;  3GOX A;  1MV0 B;  4JPB W;  4YTL A;  1GBQ A;  2MAM A;  2BGJ A;  3A8J A;  3SWN C;  2BZX A;  4F16 A;  1VQK T;  3OAA A;  3OY9 A;  3MHP A;  2DD5 A;  4F17 A;  1EIF A;  2EBP A;  3L42 A;  4RCC A;  1I0C A;  3Q38 A;  3OS2 A;  3LYI A;  1D0Y A;  1T6Z A;  1DDG A;  1M3B A;  3OYH A;  1VQM A;  3QJ6 A;  2KE9 A;  4H9G A;  4B9W A;  4A4G A;  4EIK A;  4JMQ A;  3EG1 A;  2DL8 A;  1GXI E;  2QQ9 A;  2YRC A;  4C8Q B;  1X2K A;  2LJ3 A;  5F4J A;  3NTH A;  1VQM T;  1A0N B;  4J6Y A;  1QLY A;  2G6F X;  3OYB A;  1EFT A;  2HL3 A;  5GV8 A;  3H8Z A;  3UPU A;  5IH2 A;  4XU1 A;  3CQT A;  1HK9 A;  2K5F A;  4M7D A;  1WXU A;  3MKD A;  2CT3 A;  2QTV A;  1OX8 A;  1DAR A;  1V0E A;  3CCR Q;  2X3X D;  4F7D A;  3HHT B;  4J83 A;  4LDV A;  4MML A;  4DEY A;  5CK9 A;  3ASQ A;  2V7U A;  3CC7 Q;  3VRY A;  2KY9 A;  3JU4 A;  4TMV A;  1QFY A;  5FRM A;  2KVQ G;  5J3O A;  3OW2 S;  1UD3 A;  4JJC A;  3RUX A;  4DBR A;  2WJY A;  4RDJ A;  2CSQ A;  2Z0W A;  2XK0 A;  2J6F A;  2YHT A;  1XOV A;  3CCQ A;  1VQO Q;  2DL4 A;  4P5N A;  5HCK A;  1VQ6 A;  3X26 B;  4PJO B;  2M9U A;  4XOR A;  4TKO B;  3WNC A;  1M3C A;  4NL3 A;  3NFC A;  1VQ4 A;  5EC7 A;  4ZTJ A;  4NOY A;  3CD6 Q;  1AMO A;  2I2L A;  1OGI A;  2VNH A;  2ZPI B;  2JM9 A;  4PJL A;  2BSA A;  4WZE A;  3CCQ T;  2ZPF B;  1VQ6 T;  1VA7 A;  1G3Y A;  1MGQ A;  4XN0 A;  3M55 A;  1E64 A;  4R71 A;  1VQ4 T;  1GBR A;  2QGF B;  3JCM e;  4XL9 A;  1U2R A;  1FXX A;  1Y96 A;  3ASR A;  4PC6 A;  3MP6 A;  4XLH A;  2ECZ A;  1NJI D;  4RDL A;  2BKD N;  1RAG B;  3OBY A;  1QKX A;  3WVD B;  1UGR B;  4AMC A;  4M77 D;  2DIG A;  1FNB A;  5TR9 A;  1BCO A;  2B86 A;  2E65 A;  4D6W A;  5I2S A;  1YWP A;  5CKF A;  2XZP A;  4A54 A;  2RI3 A;  4QQ6 A;  1BKB A;  4WCI A;  3OW7 A;  3Q39 A;  2OI3 A;  4XTY A;  2CP5 A;  2KMT A;  1ZUY A;  1V0F A;  1QVG S;  2CW5 A;  4QW2 A;  3ZL7 C;  1G3W A;  2RI5 A;  2RC6 A;  5JBQ A;  3JB9 F;  2K7A A;  2VKN A;  1VQL A;  3AHU A;  2JMA A;  5LJ5 d;  5BSY A;  1JA1 A;  2FX3 A;  2ZPH B;  2QK0 A;  4B9X A;  4EMK C;  4RTY A;  1EFC A;  1UD4 A;  3BFM A;  3KBG A;  1ARK A;  4Z4T A;  5FL7 A;  4RDK A;  2DNU A;  5CDF A;  1UMK A;  2EFI A;  1VQL T;  2EQM A;  1VQ8 Q;  3C95 A;  1QVF A;  2HQE A;  4R55 A;  1SHF A;  1VQP A;  2F2X A;  1XFO A;  4PK4 A;  2BIV A;  3R6J A;  2DBK A;  2LX7 A;  3OFN A;  5FRN A;  3CXC P;  5HK0 A;  4Z4V A;  1M8M A;  3VS2 A;  1Q81 U;  4WWV A;  3CC4 A;  1VQP T;  2PIA A;  5KE3 A;  4M78 D;  4RD6 A;  5LJ3 j;  2L5Q A;  1YX2 A;  1NYG A;  1D1N A;  3ZBD A;  4ZTF A;  3MHX A;  3RY8 A;  3G71 A;  3CME Q;  1H42 A;  3G4S B;  1Q81 C;  2D74 A;  1OQK A;  2LMJ A;  5IYW A;  1TUC A;  2L8D A;  3KL9 A;  1FWZ A;  1N27 A;  2RN8 A;  5KYX A;  2PVO B;  3CC4 T;  2KVO A;  2YLB A;  2DKG A;  3C0C A;  2YSQ A;  4QVC A;  3OW2 P;  1K0S A;  2DET A;  2NPF A;  5LL6 S;  2J6K A;  2DRK A;  5L8R E;  4E7K A;  3ASS A;  1WOP A;  3G71 T;  5TRD A;  2KR3 A;  2FZG B;  2KYB A;  5IN1 A;  3WVE B;  1GJR A;  2DD4 A;  3M0U A;  1YIT Q;  2OK7 A;  4P6Y A;  1RAD B;  3JCM g;  1QCN A;  4M7A F;  3OYE A;  4JJB A;  4LBY A;  1D0Z A;  4YAF A;  2CDT A;  3QWY A;  3KEW A;  1QP3 A;  5CKE A;  1JJ2 A;  4OB2 B;  2CUB A;  4C5E A;  3A3B A;  3JCM X;  3LWI A;  2Z6B D;  5H59 A;  3WQZ A;  4XD7 A;  2EYW A;  2JXB A;  2WZP P;  3PMI A;  1KK3 A;  1U1T A;  2MPX C;  1WOO A;  2VNI A;  2QA4 Q;  2HEQ A;  2DXB A;  4OOX A;  3ZFJ A;  3U6B A;  1S1N A;  4AFQ C;  3REB B;  3E2U A;  4ASU A;  3E9F A;  3P8H A;  3OEE A;  3CPX A;  3OJX A;  3CCV Q;  2H3E B;  3EG9 B;  5CVI A;  3CXC B;  3HKS A;  2OTL Q;  1QGZ A;  3FRN A;  2F69 A;  3BE3 A;  2I1L A;  3SEJ A;  2BZ8 A;  1SKY B;  3CCS B;  4A53 A;  4KGX B;  4NNJ A;  3SB2 A;  1JJ2 S;  1M3A A;  1W70 A;  4XM3 A;  2JIZ A;  1WTH D;  2K3B A;  2F2W A;  3LWH A;  4FN5 A;  2DTH A;  4Z88 A;  1IGQ A;  5ECA A;  1P92 A;  3Q3A A;  5LJ3 h;  5GAM f;  3VO1 A;  1QVG P;  3ZUG A;  2AIR B;  3RMQ A;  1QQJ A;  2DJQ A;  2HZY A;  4XTW A;  4LBZ A;  3M5A A;  4YXW A;  1F60 A;  2GGR A;  2NUP A;  5IYR A;  1UHC A;  4YAW A;  2ZPE B;  3RDV A;  1BI2 A;  2L3S A;  1KK7 A;  1V29 B;  4G1B A;  1YJN A;  3QBY A;  4OMO A;  2B7B A;  4Z1M A;  5IXF A;  2EYQ A;  3OYD A;  1H64 1;  4EMH A;  3CMA B;  2JNG A;  1ZUN B;  1ZA2 B;  2GFA A;  1FX7 A;  2DRM A;  4FWT A;  1TTT A;  4XQF A;  4JRQ A;  3A1P A;  2J7K A;  3M0T A;  5GJW B;  5M9O A;  1YJN T;  2EYZ A;  4HKE A;  2P0K A;  1OHH A;  3AVT A;  4JS5 A;  1ZM2 A;  5C6S A;  2C0T A;  3CMM A;  3LQ6 A;  4RCY A;  1BU1 A;  5IYQ A;  4DNT B;  2DF6 A;  2COW A;  1Q81 R;  2DL7 A;  2C78 A;  1M1K U;  5GV7 A;  5BSX A;  1K73 U;  4UAJ A;  1KK2 A;  1H8H A;  4Y92 A;  2FB7 A;  2GJR A;  2IPO B;  3EAE A;  1UD5 A;  1K8A U;  3WXM B;  2RHI A;  1IB8 A;  4X0C A;  3CP2 A;  3OEH A;  3PFS A;  1YIJ Q;  4DQL A;  2KK4 A;  1K73 C;  1KJW A;  1ZX6 A;  4PJO G;  1K8A C;  1UTI A;  4FSX A;  8ATC B;  2EJG A;  3NMZ C;  4P9S A;  5J26 A;  1QVG B;  1TSF A;  4FCY A;  5IT9 E;  3MP1 A;  4C43 A;  1Z9Q A;  1FMK A;  2ZPB B;  3I56 A;  2ZBV A;  4OMF B;  1Q95 G;  5L23 A;  1VQ9 Q;  5EG2 A;  1JNY A;  3VNV A;  3BC9 A;  4ZGQ B;  1D3B B;  4XTU A;  3OYK A;  4PJN A;  2XKO C;  2EQU A;  4ZGD B;  1B34 B;  2MIO A;  3I56 T;  4ZV4 A;  3A8O B;  1VQK Q;  5GAN d;  1WXB A;  4C0Z A;  5I21 A;  3JB9 I;  2CP3 A;  4IUP A;  3ZZT A;  2A36 A;  3ZZU A;  1VQ7 A;  1PWT A;  2JM8 A;  1KHI A;  1N8R C;  3QXE B;  1NLO C;  3I1F A;  3CC2 A;  2JN9 A;  4HE6 A;  4ZGE B;  3SLD A;  4N4I A;  2HBP A;  2BE9 B;  1H8E A;  3QZ5 B;  4QT7 A;  1T6X A;  1BI3 A;  2QI2 A;  3D26 A;  2LQN A;  1JJ2 P;  2K4Y A;  4E7H A;  2X9H A;  2LRQ A;  1VQM Q;  5D6W A;  3CC2 T;  3J81 k;  4HCC A;  2SRC A;  1R5B A;  3MEV A;  2RC5 A;  1V76 A;  3JQQ A;  4RTX A;  3E1Y E;  3M59 A;  4KRT A;  4M77 F;  4C92 C;  1TUI A;  4XOT A;  1RAF B;  4F7U G;  4CI0 C;  4M75 G;  4LN2 A;  2VAS A;  1KG1 A;  1EP3 B;  4E7Z A;  1VQN A;  3HP9 A;  4HE5 A;  1R0C B;  4P3Y A;  5FO1 A;  2ZL7 A;  2RMO A;  1KIK A;  4TSF A;  3ZPN A;  1OZ2 A;  3REA B;  2NUT A;  5KYU B;  2K5L A;  3QFR A;  4LC0 A;  3L2Z A;  4XR6 A;  3ME9 A;  1P4M A;  2M51 A;  1KK0 A;  2W0Z A;  2J06 A;  2MMP A;  1VQN T;  4B6M A;  2GQF A;  2G3R A;  3GPL A;  3I55 Q;  2E6N A;  3HRU A;  2ZZG A;  3TVT A;  3M0Q A;  1IJE A;  3F70 A;  3CES A;  3ULR B;  4OPO A;  4OOV A;  3OYY A;  2GNC A;  2DVJ A;  4NS5 A;  1K1Z A;  4RJL A;  1M4Z A;  1KMH A;  2A37 A;  4QVA A;  3JQP A;  1W2B A;  4B3X A;  3SJZ A;  1K73 R;  1TUD A;  2DPP B;  1AHJ B;  2FPD A;  2O9S A;  3I35 A;  1VHE A;  2QAZ A;  4X7C A;  2JN0 A;  1K8A R;  1W9X A;  4UZE A;  2CT4 A;  4BPR A;  2YT6 A;  1ABQ A;  4J5Y A;  4C8Q F;  2OTJ Q;  5GAN 4;  4M4Z A;  4J0Q A;  4E7L A;  1Q86 U;  1VLO A;  3CCL Q;  3I5R A;  4DK0 A;  4M78 F;  2DZC A;  3OYN A;  4OMM A;  2KGT A;  2AHO A;  4FSS A;  4P3I A;  1G7C A;  2KT8 A;  2KYM A;  1Q86 C;  5CQX A;  2F5K A;  4P22 A;  1Q81 D;  3M54 A;  1KK1 A;  3EG3 A;  1W2B S;  1XTD A;  4PJO A;  1ZUU A;  2FHD A;  2QEX A;  3GIR A;  3JAM E;  5GAO n;  5FA6 A;  2DFU A;  1UJY A;  4C0G A;  1N8R R;  1BQE A;  2O01 E;  3PNW C;  4IIO A;  1GCQ C;  4CQJ A;  4O6J A;  3UA7 A;  4XAX B;  1NBE B;  4TMW A;  4PJO F;  4M53 A;  3BNW A;  4XON A;  5LJ3 e;  2EGE A;  2F1L A;  4DNR B;  4ZCI A;  2K79 A;  2QEX T;  1VYT A;  4PLI A;  3EGX B;  1TU0 B;  1VQL Q;  3VO2 A;  1X27 A;  5B6I A;  1WHL A;  4JJN K;  4EMG A;  4Z4Y A;  3QO3 A;  4KGZ B;  4C92 E;  4LDY A;  1S72 Q;  2A08 A;  3P8D A;  1EP1 B;  2GPJ A;  2DYI A;  2BPO A;  1BX1 A;  4AG1 C;  3EGD A;  2E70 A;  3DKM A;  1RAH B;  1AEY A;  3O5Z A;  4ME7 A;  4J8O A;  2QQS A;  2DYB A;  1IXD A;  4LDW A;  1Y57 A;  5GAN f;  3LX7 A;  1XE1 A;  1X6B A;  4E7I A;  1VQ5 Q;  1W35 A;  3J81 E;  4AG2 C;  1AOJ A;  1WHM A;  2X6W A;  4AFS C;  1SG5 A;  1BI1 A;  2YUP A;  5KH6 A;  1GL5 A;  3G71 Q;  4RPB A;  2PU9 B;  2DXT A;  3E20 A;  1MUZ A;  3CCR B;  4C92 B;  1QWE A;  1UE9 A;  1Y0R A;  1HYO A;  2JMC A;  3CEY A;  1JB9 A;  4ACB A;  1T3L A;  2P84 A;  1KQS S;  3CC7 B;  3JCM d;  2FVU A;  2M0O A;  3I5S A;  2YWE A;  1KRH A;  3VS7 A;  1W1F A;  2ZXI A;  2HQH A;  3QYH B;  1VQO B;  1KTV A;  2QDX A;  1YP5 A;  4U9U A;  1MMG A;  3VJP A;  4BY6 C;  4G7W A;  2DIL A;  3H0F A;  3QFS A;  4BI4 A;  1QFJ A;  1M30 A;  2E1H A;  5DN6 A;  5KYY A;  2GBQ A;  3HRT A;  4JZ4 A;  3CD6 B;  3CCE Q;  5GAM j;  3HL8 A;  1H3Z A;  5DLO A;  1GR1 A;  1SKU B;  4HVW A;  2RQV A;  3J80 E;  3JB9 G;  1E79 A;  3VMF A;  4YAL A;  3G4S A;  1OPL A;  1NM7 A;  2YWG A;  1SEM A;  1Q86 R;  1T3S A;  2DZ9 A;  5J39 A;  4WTO B;  4OPV A;  4PC2 A;  2WR8 A;  4WF2 A;  3RMS A;  4WZK A;  2XOK A;  1RL2 A;  1X75 C;  1PKV A;  2OBR A;  3G4S T;  2DA9 A;  1BYM A;  3WY9 A;  1RAB B;  1N9R A;  1ZM4 A;  2KQW A;  2CRV A;  4RTT A;  5LJ3 g;  4MDX A;  2CUD A;  1EXM A;  1M1K D;  1W0K A;  2DO3 A;  1K73 D;  1N0U A;  1HD3 A;  2RQR A;  2K6D A;  1K8A D;  3ZBU A;  1QUF A;  1WQ7 A;  4FU6 A;  4L5G A;  1XQB A;  2JJ1 A;  3L2W A;  4YAO A;  2QGG A;  3EFO B;  1IB0 A;  4EH1 A;  1UFF A;  1AZE A;  4C0S A;  2OAW A;  3QE2 A;  3UAT A;  2E1B A;  1M1G A;  1YJN Q;  2ROL A;  4M75 C;  4AF7 A;  5GAN 3;  2CBX A;  4GY5 A;  3AGQ A;  1UD8 A;  3M0R A;  4Z4S A;  2EVR A;  1EP2 B;  1SRM A;  4B3F X;  1NB9 A;  1GAQ A;  2VVK A;  5A89 A;  2KRN A;  1B2R A;  1DDI A;  3GVK A;  3CCS A;  1VQ8 B;  5FWB A;  4OMN A;  2COY A;  4M7A G;  4M78 B;  1RAC B;  2KNB B;  1OV3 A;  3L2U A;  2E5K A;  1QFZ A;  3FPP A;  2A0F B;  2VBU A;  4B4D A;  3M4Y A;  3A8L B;  5GAN 2;  3A8G B;  4GLM A;  1VF7 A;  4Z02 A;  3CCS T;  4RKU E;  2ZZQ A;  2VWF A;  1Y0M A;  2PUK B;  4LE9 A;  2XDB A;  1WXT A;  1S0U A;  3P27 A;  3ZIA A;  3MEU A;  3X25 B;  1ZSZ C;  3CME B;  2D3L A;  3VU3 C;  4PFZ A;  3EHQ A;  4Z89 A;  2P4R A;  1KQS P;  4C92 D;  1K28 D;  1GCP A;  1PNJ A;  1WPC A;  3BQJ A;  1J9Z A;  2C2W A;  2BE7 D;  3B8H A;  1TXQ A;  1H92 A;  1WOR A;  4RMO A;  1BCM A;  4RLZ A;  4L8J A;  2OAU A;  2QMU A;  1YIT B;  4K1X A;  2EWN A;  3KXT A;  3W5V A;  2GF7 A;  1M2O A;  4DQK A;  1YJ9 A;  1YI2 A;  1AWO A;  4YAU A;  1IRE B;  5FU7 B;  4BE2 A;  2D6F A;  1OB0 A;  4KGV B;  4X9C A;  2HLD A;  2DIQ A;  4LDX A;  2Q6L A;  2DBM A;  1YJ9 T;  1YI2 T;  2O2O A;  3JV3 A;  2ZGW A;  2K9G A;  1VQ7 Q;  3WXM A;  5FU6 B;  2QA4 B;  4FM4 B;  5GAN 8;  3M57 A;  4VUB A;  3T53 B;  4Y9R A;  3PVQ A;  3MO8 A;  1OU8 A;  3CC2 Q;  2X4J A;  1CSK A;  1RLP C;  2JS2 A;  3CCV B;  4CC2 A;  3UA6 A;  1WFW A;  4X9D A;  2OTL B;  4A4E A;  3PGG A;  4LUD A;  3I9Q A;  5DM7 R;  1M9S A;  3HFO A;  2LJ1 A;  2HKN A;  2MOX A;  4XU2 A;  2DL5 A;  2OX7 A;  1JEG A;  4M7D C;  3AVV A;  5KNL A;  2DIE A;  2EJF A;  3AGP A;  4X8I A;  2XNC A;  1YJW Q;  2M0Y A;  2VXF A;  3T51 B;  4FW2 A;  4HCK A;  4WZL A;  1PRM C;  5HKK A;  1Q86 D;  2MK5 A;  2P0Q A;  1WU8 A;  4XLA A;  1QG0 A;  5AN9 A;  3AT1 B;  1CNF A;  3QHS A;  5J35 A;  4PGO A;  1D2E A;  2V1R A;  3M9Q A;  4B43 A;  2RNA A;  2PTK A;  2RF0 A;  5GAN 6;  1TS9 A;  4FT2 A;  2F1M A;  2VZL A;  3MP8 A;  5GMK j;  1BI0 A;  3X20 B;  2O31 A;  4PFO A;  2F4N A;  4QFM A;  3LLR A;  3FPK A;  4UZF A;  1MV3 A;  3TSZ A;  2RJF A;  3PUN A;  3SWN B;  5H5J A;  4Y7C A;  4FW1 A;  1H3H A;  4EDU A;  1Y07 A;  2X51 A;  2XGJ A;  5GAO r;  4G7X A;  2KT1 A;  4ATO A;  2DOG A;  2RM4 A;  3LH5 A;  2E5Q A;  3NGP A;  2ZL6 A;  3Q6R A;  2BTT A;  3C94 A;  2RPN A;  1S4M A;  2DL3 A;  5FO0 A;  2LCC A;  2P4T A;  2ZTN A;  2K3X A;  4IUT A;  3CBP A;  5HZB A;  3UF4 A;  3C12 A;  1QVF S;  4M7A A;  1A8P A;  2RHZ A;  3U23 A;  1X43 A;  1NEG A;  2JZ2 A;  2A3L A;  4XU3 A;  5KYU A;  3TEE A;  2XND A;  1YIJ B;  4JS4 A;  3CCM A;  1UD2 A;  3TSW A;  3CPW A;  5A88 A;  2BZY A;  4M0L A;  1B07 A;  2AK5 A;  3G05 A;  4C5I A;  2NUZ A;  3QSY A;  2CK3 A;  1EX4 A;  2ZCF B;  1WGS A;  1LJO A;  4P12 A;  4YEJ A;  3W5H A;  3CCM T;  1WLP B;  1Z9Z A;  1YHQ Q;  3NE5 B;  2FL7 A;  2BUD A;  1U8R A;  5FIU A;  5FNZ A;  2GQI A;  1VQ9 B;  4M77 G;  4PJJ A;  4QQD A;  2ROT A;  2QEX Q;  2ZZE A;  2QYZ A;  5CKH A;  2BVN A;  3CCJ Q;  4C0F A;  1UJ0 A;  4J6X A;  3W2H A;  1VQK B;  3HFN A;  4X1V A;  4AVZ A;  4Y9U A;  1OZ3 A;  2O4X B;  5GMK h;  3D7S B;  2FRY A;  2D8J A;  4NCN A;  4M7D E;  3SKB A;  3LW5 E;  3VS1 A;  4F14 A;  1N07 A;  1TLL A;  2D9T A;  4FIB A;  5IYN A;  3Q1J A;  2Q6I A;  4RD4 A;  3GBQ A;  3MPU B;  2K2V A;  1G83 A;  2AKL A;  4XTV A;  1FRQ A;  3NHN A;  3ES9 A;  3OA6 A;  3JCM P;  1PHT A;  2E10 A;  4PFP A;  3W2E A;  1VQM B;  1G8X A;  2K2M A;  4PC1 A;  4QVZ A;  2DTO A;  3MCA B;  1K0X A;  1MHN A;  2DER A;  4AC9 A;  4QHY A;  1I8F A;  1W0J A;  2EQI A;  1OOT A;  3OW2 B;  3BCF A;  5KYW A;  2LJ0 A;  1OUL A;  4ESR A;  1E62 A;  4CC4 B;  4XKW A;  4OPS A;  2C06 A;  4RTW A;  3X24 B;  3DB3 A;  1V1C A;  1G2B A;  3ISX A;  1UEC A;  4DBH A;  4X7E A;  3IQL A;  4MMK A;  4M7D B;  3U6K A;  3CCU A;  2M16 A;  1DG1 G;  4LXC A;  3VUZ A;  4C8Q G;  4R56 A;  2JUF A;  2NV4 A;  3VYH B;  3A8H B;  4IUR A;  2KI7 A;  3EGX A;  4M78 G;  3VS3 A;  2QDY B;  4BE1 A;  1JQQ A;  3I55 B;  2DCU A;  3V7A A;  2QG9 B;  1WP6 A;  2FYK A;  3CCU T;  4EMK B;  4Z4U A;  2IG0 A;  3PIO A;  3A8K A;  1XJW B;  1G7S A;  2BGI A;  4LBW A;  3E19 A;  3PMT A;  4RCZ A;  2RJD A;  3SHW A;  3PIP A;  1OYX A;  3QDF A;  4M75 D;  5LJ5 f;  3MEA A;  2H3J A;  1WNL A;  5D7U A;  3CRZ A;  2YUN A;  1UEB A;  4FYX B;  2V7W A;  4KH1 B;  1R0B G;  2RD1 A;  1X69 A;  2HL5 C;  2KXD A;  2RQU A;  3EGU A;  4G1V A;  4XTX A;  2FEI A;  5F4M A;  1KD1 U;  1WDT A;  1CKA A;  1QVF P;  1KHC A;  2DXU A;  1LOJ A;  1YN8 A;  3LNN A;  4FXU A;  2HDA A;  3OMC A;  2OK8 A;  2EYY A;  4TVR A;  1WJR A;  1JBM A;  1KD1 C;  1M27 C;  2V26 A;  2M1H A;  3CCR A;  2OTJ B;  4NBS A;  3OYM A;  3OYI A;  3OQ5 A;  1GVH A;  4XN3 A;  3CCL B;  5LJ3 d;  3ONY A;  2PUO B;  3FEO A;  2J6O A;  9ATC B;  2LT4 A;  2CC2 A;  5TV2 A;  3CC7 A;  4CC7 A;  1NLP C;  1BIA A;  4JRI A;  2X6Y A;  3CCR T;  1PRL C;  2R5M A;  4C92 F;  1CNE A;  4P2N A;  3MJX A;  3G6E A;  2R5A A;  3R6K A;  2X4X A;  1BBZ A;  3CC7 T;  1N8R U;  4TT3 A;  4N4H A;  4RCB A;  1EFU A;  2A7Y A;  2GTO A;  3CD6 A;  2EGC A;  4HVV A;  2PMD A;  1TWB A;  3A98 A;  3S3M A;  3WND A;  2X6X A;  1VQO T;  3G6E T;  2LX9 A;  1WOS A;  1FND A;  3QPH A;  2CZ7 B;  3JCM W;  2Y90 A;  4XKV A;  4M77 A;  3CD6 T;  1VQL B;  4E47 A;  1EWY A;  1G3S A;  5FLX E;  1Y7X A;  1TUG B;  1S72 B;  4LD9 K;  5KE2 A;  3DLL A;  4PAB A;  2C0I A;  2CP0 A;  3OP1 A;  2A28 A;  3E1S A;  3SD4 A;  3QUI A;  2MYS A;  4CC3 A;  1QVF B;  1W34 A;  1E43 A;  5GAM g;  3BDL A;  1QGA A;  1IZ6 A;  4JLI A;  2DE0 X;  5KYN A;  3OMG A;  3OBW A;  2VUB A;  4X07 A;  4Y28 E;  2Q6K A;  1VQ5 B;  2XD0 A;  2ZPG B;  5GMK m;  2ZBU A;  3A3G A;  4GQN A;  5IHI A;  1JO8 A;  1XNI A;  2XIC A;  2YWW A;  1SM4 A;  2EKO A;  2BF4 A;  2H8H A;  1F20 A;  3M58 A;  3FJ5 A;  4BDY A;  3VS6 A;  1KC8 U;  4MZT A;  4D8K A;  3G71 B;  1WHJ A;  2NYS A;  1J3T A;  1QH0 A;  4M7D D;  1HSQ A;  4PL6 A;  4AFZ C;  2AKK A;  2EJ9 A;  3V7C A;  2KXC A;  2CF4 A;  3AST A;  1F1B B;  2XDP A;  3MEW A;  3L2Q A;  3EH2 A;  1KC8 C;  2DMO A;  3TRE A;  3CCQ Q;  4JRK A;  2EFG A;  2L3R A;  2YWH A;  4GLK A;  1VQ6 Q;  1I4K 1;  1HXD A;  3OYF A;  2SEM A;  3N5B B;  3QKJ A;  1VQ4 Q;  4C8Q A;  3V76 A;  3AVY A;  1C6V X;  1OU9 A;  5LJ5 g;  1VQ8 A;  5CR2 A;  4HIZ A;  3CTA A;  2X3W D;  4M78 A;  2BM1 A;  1NRK A;  2DJZ A;  2GTJ A;  3A35 A;  4DOW A;  1YJ9 Q;  1ZHI A;  1XQH A;  5GJV B;  1YI2 Q;  2JJ2 A;  1HA3 A;  1KD1 R;  1VIF A;  1JJ2 B;  4OF1 A;  3JCM Q;  4AFU C;  1IHM A;  4ROX A;  1VQ8 T;  3CCE B;  4UC4 A;  1KQ1 A;  4II2 A;  1R5N A;  1Y71 A;  1TTH B;  4X7F A;  1NBM A;  2ESW A;  4KBM B;  3RER A;  4M77 C;  3VS5 A;  1W87 A;  2JTM A;  3CME A;  3ER0 A;  2BM0 A;  1MAB A;  3FIF A;  1PM3 A;  4X34 A;  3EFR A;  4LDU A;  4XMY A;  4PJM A;  4B44 A;  1QGY A;  1QX4 A;  5GMK e;  5GAO m;  2RQT A;  3VRZ A;  3LH0 A;  2V31 A;  3CME T;  2EYX A;  1AZG B;  4OP7 A;  4RD3 A;  4CRI A;  1T0H A;  2C0O A;  3FKS A;  4PKC C;  2J7I A;  5J3B A;  1YIT A;  1E6H A;  2I0N A;  5CQY A;  1W6X A;  3QII A;  1BPL A;  2KAF A;  1TH7 A;  2KRO A;  4J9H A;  1SSH A;  3NPF A;  4KUL A;  1WA7 A;  3JB9 D;  1FNC A;  1YIT T;  1SPK A;  1YBY A;  2JJ9 A;  1KZL A;  3OKX A;  2COZ A;  3CW2 A;  3W2F A;  4G6I A;  4K11 A;  1YJN B;  3GQB A;  2QA4 A;  2E3I A;  3OYC A;  5KCH A;  1GFD A;  2GK6 A;  4DK1 A;  1BK2 A;  4DEX A;  4XQ3 A;  4XOP A;  3OYA A;  1UDL A;  1VQP Q;  2VNK A;  2DVE A;  4IIM A;  4MZM A;  3M56 A;  4C8Q C;  2CYZ B;  2VGN A;  1WI7 A;  2QA4 T;  3OYG A;  2W6J A;  3OSV A;  1IHW A;  4X7D A;  3R6N A;  4C5H A;  4BE0 A;  1UUE A;  3FJO A;  1UG1 A;  3SLN A;  2HBW A;  3CC4 Q;  3EG2 A;  1Q82 U;  5IYP A;  1RUW A;  1QWF A;  1N06 A;  3EG0 A;  5AYF A;  4ZGJ B;  4ZN1 A;  5GAN 5;  2VBV A;  2KRM A;  2ENM A;  4II3 A;  2FO0 A;  1Q82 C;  5IHN A;  2V8J A;  1KC8 R;  5GMK i;  2JTF A;  1D1C A;  5DS0 A;  1Q9S A;  2X3U A;  2MCN A;  3CBO A;  3RKX A;  1I7P A;  1EFN A;  2CZ1 B;  8AT1 B;  2PQW A;  2EW3 A;  1WX6 A;  3CCM Q;  2PVG B;  4X06 A;  4E7J A;  3RIR A;  3DLM A;  4PJO C;  2E1R A;  4MDW A;  2RH2 A;  2KDS A;  3GVL A;  4OB0 B;  1VIE A;  2F5T X;  1ZBX A;  4LNP A;  2RQW A;  1RAA B;  2E12 A;  4TMT A;  3OOC A;  1EZZ B;  2YWF A;  1GAW A;  1D1A A;  3JSC A;  5A2Q E;  1AT1 B;  3O8V A;  1QKW A;  2FPF A;  1NG2 A;  1JXO A;  2EQK A;  3TU4 K;  1HZE A;  2ZL5 A;  2DLP A;  1Q7Y U;  1O9S A;  3FLG A;  2VYQ A;  4D8D A;  4ANJ A;  4V2S A;  2XEX A;  4BAC A;  3SEM A;  1U06 A;  2HAX A;  1KQ2 A;  2KRS A;  1FDR A;  1Q7Y C;  2DEU A;  4IW3 B;  1VQ7 B;  2LTO A;  2BN4 A;  3H41 A;  3HPW A;  2HKQ B;  3EH1 A;  3T9N A;  1YIJ A;  1W2B P;  2X4W A;  4XNF A;  3CC2 B;  4J6W A;  2LCS A;  5IK2 A;  2D8H A;  4FYY B;  2LQK A;  4Q7J B;  3UDC A;  2OBS A;  1M2V B;  3OPO A;  2RJC A;  2HCJ B;  2L89 A;  2QTX A;  1PD1 A;  3W5U A;  1YIJ T;  1RAI B;  3HRS A;  4ACA A;  3PVD A;  4N3G A;  1M90 U;  1PSE A;  1R5O A;  5LJ5 j;  1WHK A;  2YLC A;  2XZO A;  4QVD A;  1X6G A;  2LP5 A;  4J9B A;  2DXC A;  1BX0 A;  2JVV A;  3VS4 A;  1X01 A;  3VUB A;  3X28 B;  1IHV A;  1OGJ A;  1OX9 A;  1YJW B;  2VXE A;  1PJ6 A;  1M90 C;  2V7Q A;  3QDR B;  3RR6 A;  2JDI A;  3OZU A;  1I5O B;  2RHU A;  3BCD A;  1E7O A;  1JB0 E;  3EHR A;  1PC0 A;  1VYU A;  5KSW B;  3CCU Q;  4R0K A;  3EG9 A;  3CXC A;  1E63 A;  2PNI A;  1QMC A;  1ZQ1 A;  2PLF A;  3QSU A;  5HY6 A;  3W2G A;  2D0Q B;  5E6T A;  2YUO A;  5GAN g;  1WSV A;  1YLO A;  1N8R D;  1SRL A;  1SSF A;  4DBF A;  1O75 A;  3RKW A;  2L3Q A;  3GP8 A;  4QUZ A;  2CP6 A;  2VNJ A;  3C4S A;  2K57 A;  1SF9 A;  3ZBT A;  5GAM h;  4RD0 A;  5GAO q;  1K9M U;  4XTZ A;  1AIP A;  2CRE A;  4J7I A;  4RD2 A;  3WBJ A;  3MCA A;  1Q82 R;  2CSI A;  2L3P A;  1DJ7 B;  3OW2 A;  4A63 B;  3G1J A;  1WJS A;  4QVJ A;  1NZ9 A;  2LQW A;  1K9M C;  1NB0 A;  3H6Z A;  4PJO E;  1W2B B;  3CXC S;  3CP8 A;  4ZGN B;  2LNV A;  4HT9 A;  1T6Y A;  2RA2 A;  4JUV A;  3CMA A;  2RHY A;  1YFN A;  5CO7 A;  1MNE A;  2L0A A;  4LD6 A;  2GK7 A;  1ZSG A;  1VJS A;  2WSE E;  3JRZ A;  1ZA1 B;  2VV5 A;  3I55 A;  3A8M B;  3CMA T;  3I56 Q;  2LCL A;  4KUD K;  1AWW A;  4EMK A;  4M7D F;  2HMA A;  1TVC A;  5LJ5 h;  2CH4 A;  1BJK A;  4DBQ A;  1PJ7 A;  2EQJ A;  2X8K A;  1YHQ B;  3G6E Q;  2PE3 A;  4X05 A;  3RKY A;  3I55 T;  1KC8 D;  3JCM f;  5C0M A;  3BH4 A;  2BV3 A;  4BY6 B;  4MYU A;  2QEX B;  2E41 A;  4IUQ A;  4ORZ A;  1Q7Y R;  2LZJ A;  4IUU A;  3CCJ B;  4B3G A;  4KKT A;  2FRW A;  4OP0 A;  1UHF A;  4B47 A;  2LC4 A;  1X6O A;  2IVW A;  2X4Y A;  4RUG A;  5FW9 A;  1N08 A;  2C4U A;  4B48 A;  3M0P A;  4E6R A;  3PA1 A;  4A4H A;  3Q6Q A;  1MRZ A;  3P26 A;  2EIX A;  2OTJ A;  1FMW A;  4JJD A;  2XU8 A;  5GAM d;  4IKF A;  3ZC3 A;  1R77 A;  2W10 A;  1QVG A;  3CCL A;  2ABL A;  1SKQ A;  3RES A;  2LQ8 A;  1KSW A;  5L46 A;  4F7U E;  2Y4X A;  4M75 E;  4M2L A;  2R57 A;  1NDH A;  2OBT A;  1QCO A;  2CS7 A;  2C5H A;  3EGD B;  3QJY A;  2WZN A;  1WPY A;  5A8A A;  2OTJ T;  5CCA A;  1KQS B;  1U5S A;  1D3B A;  4QQG A;  1M90 R;  3CCL T;  3PE0 A;  4MZP A;  3S3O A;  2FZC B;  4J9E A;  2LVM A;  1VQN Q;  4IUV A;  3VV0 A;  2R6H A;  3CPF A;  1B34 A;  4L59 A;  1D09 B;  1WHH A;  2X0K A;  2YRV A;  3OSS C;  5AT1 B;  4N0A A;  2XID A;  1U1S A;  2M5S A;  2ZZD A;  2JTE A;  2MI6 A;  2QE7 A;  2HCK A;  2ED1 A;  3S3N A;  1H8K A;  1QVP A;  5F4O A;  1E1Q A;  4F7U B;  4M75 B;  1SHG A;  1S72 A;  1D0X A;  2XMF A;  4KH0 B;  2HNI A;  1ACM B;  3M53 A;  4JLG A;  2HDN B;  2X53 S;  2E6Z A;  1COW A;  4RG2 A;  4C92 G;  5GAN 7;  2RB6 A;  1K9M R;  1D1B A;  3UWN A;  3SFM A;  1C1A A;  2HQX A;  1AD5 A;  1S72 T;  2GFU A;  2MWP A;  1N0V C;  3LVB A;  3MMP A;  4O5V A;  2B7C A;  4BUG A;  5KYY B;  1AWX A;  3WYA A;  1VQ5 A;  4HA8 A;  4OML A;  2CZ0 B;  2FZK B;  3JCM J;  4C8Q D;  3PEN A;  4J9G A;  1LPL A;  4II1 A;  1WZO A;  4LUE A;  1JA0 A;  1KFZ A;  2E64 A;  2EPD A;  3HAG A;  3QWX X;  1MMD A;  2VYT A;  3L1A A;  4P6V F;  4HT8 A;  1VQ5 T;  1ZSZ B;  4E0F A;  2KEA A;  2PZ1 A;  3T56 B;  3VR6 A;  2XNJ A;  4YEL A;  4L6V 5;  1PKT A;  2DX1 A;  1Q82 D;  1FYN A;  2X85 A;  1MND A;  4FT4 A;  5LMZ A;  4RM0 A;  3JB9 J;  5GAN j;  2HSE B;  3HSB A;  3WNB A;  4OB3 B;  1N6A A;  5FRO A;  2O9V A;  2WSF E;  4C0D C;  4DA4 A;  1JU5 C;  3W2I A;  4KKU A;  2ZIT A;  2D9R A;  1RLQ C;  2JS0 A;  4PJO D;  1VOM A;  3CBM A;  4Y91 A;  5IAY A;  3CPW S;  2JOY A;  4N0A C;  1KJZ A;  3THK A;  1Y0Y A;  3CCE A;  2QQB A;  2XZL A;  4LBV A;  2QXF A;  1E3Z A;  5HXB A;  1TOV A;  6AT1 B;  1RI9 A;  1N5Z A;  1E1R A;  2B5O A;  3BY2 A;  1FNM A;  2AZS A;  2VGM A;  3CCE T;  2RHX A;  3UT1 A;  2GCX A;  5DY9 A;  2RO0 A;  2LDM A;  1HVX A;  2RK2 A;  1WYX A;  2EIF A;  2K3Y A;  2R58 A;  5D6X A;  4Z4Z A;  2QQA A;  3BDU A;  1PJ5 A;  3GVJ A;  2ATC B;  1Q7Y D;  4RTZ A;  3V8L A;  3QG1 A;  1FRN A;  4M7A C;  4E2F B;  4OVA A;  1PD0 A;  2YXY A;  5GAM e;  2CKK A;  2R9V A;  5A0L A;  4Z4R A;  4HCB A;  2V4D A;  2Y4Y A;  2DY1 A;  3OB9 A;  4AT1 B;  4KUI A;  4PC7 A;  2D1X A;  1B23 P;  5IXB A;  4ZCL A;  2AT1 B;  5TY0 A;  1K9A A;  1VHO A;  4PC3 A;  5I22 A;  5CAI A;  1G7R A;  3QYG B;  1QCF A;  2D0N A;  5D6Y A;  3URG A;  1M90 D;  2LNH B;  4TN1 A;  3CCQ B;  5GAN h;  1VQ6 B;  5IHK A;  2C5B A;  1ZLM A;  2XDD A;  4P26 A;  3OS0 A;  1VQ4 B;  3P8B B;  2WYR A;  5THX A;  3QZ9 B;  1LNX A;  1EFR A;  2V8K A;  3LQE A;  1YJ9 B;  1YI2 B;  5HKC A;  5LJ5 e;  3J7A F;  1X2Q A;  2EAY A;  3G4S Q;  3PA2 A;  1UGP B;  4C92 A;  1CQX A;  2F2V A;  1Y96 B;  4FYW B;  1WHG A;  1I18 A;  1ZM3 A;  4RTU A;  3JCM V;  1B7T A;  4WZT A;  4RPD A;  1M1K C;  1K9M D;  4FL6 A;  2MF2 A;  5KCO A;  4OGE A;  7AT1 B;  1VQO A;  2NLU A;  2FG0 A;  1RAE B;  2P0P A;  1E6G A;  4HXJ A;  1ZM9 A;  4OOS A;  1IO6 A;  1JRI A;  2RJE A;  3KFV A;  4FYV B;  2VBS A;  3OYL A;  3CPW P;  2CP2 A;  4J9D A;  4Z4W A;  2CH4 W;  2VJJ A;  2VB6 A;  1IRX A;  1C0M A;  4NL2 A;  1OB5 A;  5I2M A;  3PVL A;  3WBK A;  2XG8 D;  4C0D B;  2CP7 A;  4YHB A;  3ZEH A;  2QTZ A;  1GO2 A;  4JDS A;  2V7T A;  1NEB A;  4TMX A;  2EGA A;  2J05 A;  3ASK A;  2OJ2 A;  2XI9 A;  4OGC A;  4M7A E;  4N4G A;  1UD6 A;  4XLC A;  2X35 A;  2HD0 A;  4ZCM A;  3E9G A;  1VYV A;  3CCS Q;  4BDZ A;  1VQP B;  3JCM c;  4OB1 B;  1NPR A;  3A5Z B;  5DLQ E;  3VS0 A;  5HZA A;  1PKS A;  3L2R A;  1W4S A;  3A8I A;  1M2V A;  1VQ7 T;  4PNO A;  2FVG A;  1JXM A;  1IJF A;  4EPC A;  3NTK A;  1RQR A;  3JQR A;  1M8V A;  4M4S A;  3CC4 B;  3QFC A;  5GAO p;  1OPK A;  3AVU A;  2LZ6 B;  3EFO A;  5DSZ A;  1BB9 A;  4DQ2 A;  1AWJ A;  2QTL A;  4J9F A;  2C77 A;  3OE7 A;  5KW9 A;  2F43 A;  5A0G A;  3OZW A;  1UGQ B;  1YJW A;  4RD1 A;  4G5G A;  1BIB A;  3GF5 A;  4XU0 A;  5KYX B;  2YRD A;  4ZNX A;  4JZ3 A;  3FC3 A;  2GRE A;  4M7A B;  1UGS B;  3CMA Q;  2VJI A;  4XK8 E;  1LVK A;  2K5I A;  2JT4 A;  1GCQ A;  2YDL A;  3G7Z A;  3B78 A;  4OMP A;  5FWC A;  1YJW T;  1VUB A;  1LCK A;  1U3O A;  5HK3 A;  1H85 A;  2ZTG A;  2MWO A;  3CCM B;  3TCJ A;  1BMF A;  3CPW B;  2QDL A;  2KSS A;  1CKB A;  4M1K A;  4J9I A;  1PSF A;  2WPD A;  1G7T A;  1NJI U;  1N9S A;  2O88 A;  3B82 A;  3V8K A;  2DEQ A;  2W6I A;  3BY7 A;  3PTA A;  4BI3 A;  1VLY A;  4KKS A;  1TG0 A;  1PCX A;  5CIU A;  1NJI C;  5GMK l;  1M1F A;  4Z8A A;  3DB4 A;  5I11 A;  1YCY A;  2IIM A;  1NE8 A;  1WIE A;  4UZU A;  1I5L A;  3OZV A;  3VYG A;  1M5Q 1;  4J9C A;  1M1K R;  1WDX A;  3PUM A;  4Q5W A;  4A4K A;  2JW4 A;  2QN6 A;  3BW1 A;  1QP2 A;  1YNZ A;  3V7S A;  3ONU A;  2RK1 A;  1NPP A;  3PT9 A;  4HVU A;  3L2V A;  1OI1 A;  2PVD B;  4DOV A;  2QQR A;  2GJK A;  3GNG A;  2WSS A;  1R8O B;  3NTI A;  3SDZ A;  3S6W A;  3TQ7 P;  1ZBJ A;  4BD3 A;  1D8T A;  4GBQ A;  2ZAE A;  3DDY A;  4RG8 A;  2BMW A;  4JRP A;  1WQW A;  1ZUK A;  4ELY C;  1YHQ A;  3JCM h;  5LJ3 f;  4C5G A;  2B8A A;  4XLF A;  5EMN A;  5KYW B;  2NUP B;  1K4U S;  2VC8 A;  2AZV A;  1T5E A;  1QW1 A;  1PG5 B;  1ABO A;  3M4G A;  3CCJ A;  2DTI A;  1YHQ T;  1GFC A;  3H0I A;  1HJD A;  2E3H A;  3ASP A;  2OYN A;  4OMQ A;  3CCU B;  3FJP A;  1UB4 A;  3CCV A;  4E7S A;  2QAS A;  2OTL A;  2DM1 A;  3CCJ T;  3HTR A;  5GAO l;  3RNJ A;  4TMZ A;  2V1Q A;  4M78 C;  4P1V A;  3FB9 A;  2LT1 A;  4WQM A;  1MMA A;  4N3N A;  3ZZ0 A;  1B3Q A;  1BLI A;  4XLE A;  4M7D G;  1I81 A;  4J7F A;  5A0D A;  3CCV T;  1UGV A;  2WAC A;  2DAQ A;  2OTL T;  1KQS A;  2FPE A;  3OS5 A;  4BB7 A;  3MET A;  5GAN e;  4FK8 A;  1WJQ A;  2WJV A;  1FMV A;  4PLL A;  1FX0 A;  2EKH A;  3JB9 H;  3GSI A;  4F04 B;  2DK3 A;  4ZN3 A;  2L2P A;  2CGH A;  2XHC A;  1G5V A;  2YUQ A;  3EFS A;  5CKD A;  3OJW A;  1YWO A;  2KBT A;  2V7V A;  3OYJ A;  3BY1 A;  4M7A D;  4RTV A;  3SWN A;  1WSR A; 
#chains in the Genus database with same CATH homology
 2QGG A;  3A1P A;  3HTR A;  3H9N A;  2DOG A;  2F1L A;  2DYI A;  1PM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...