2DYIA

Crystal structure of 16s ribosomal rna processing protein rimm from thermus thermophilus hb8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
162
structure length
162
Chain Sequence
MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 16S ribosomal RNA processing protein RimM from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ribosome
molecule keywords Probable 16S rRNA-processing protein rimM
total genus 31
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2dyiA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2dyiA01
3H9NA 2DYIA 3A1PA 2QGGA 2DOGA 2F1LA 1PM3A 3HTRA
chains in the Genus database with same CATH superfamily
1NPPA 2EJ9A 2M0YA 2JXBA 3M56A 2JDIA 4XR6A 3J7AF 1OGIA 3QE2A 4Y91A 4X7CA 1G3YA 4AFZC 2RPNA 5A2QE 3OS5A 3VS3A 4LDXA 2A7YA 1NRKA 4F04B 4JRQA 2K5IA 1H641 1VQ4Q 1IRXA 1ZHIA 2RQUA 1N06A 1TUGB 1KJZA 4M78F 1QLYA 2KMTA 3M4GA 1B34B 4ME7A 1CKAA 3I56B 2DEUA 2KSSA 3JB9G 4QQ6A 1Y0MA 4ZV4A 1G5VA 3OYMA 2L5QA 3BDLA 4IUVA 2RA2A 3QSUA 2Y4XA 4GQNA 5TRDA 1PD1A 4RDJA 2KT1A 2DKGA 3EG0A 1WSRA 2DRKA 1WFWA 4XOPA 1MMAA 2JTEA 3TSZA 4XLHA 1N0VC 2AKLA 2X4XA 1XOVA 3M5AA 3PMTA 3N5BB 4LDVA 2HL3A 1MGQA 4P12A 4HCKA 1T0JA 1PWTA 4HCCA 2OBTA 2VASA 1WJSA 3GPLA 1GCQA 1LPLA 1XQBA 1NEBA 2CZ0B 2EW3A 1KK2A 1K73U 2PIAA 2HKQB 1EIFA 4PFPA 4YELA 2F4NA 1QWEA 1KD1R 2WPDA 5ECAA 2QXFA 3CCUA 3SLNA 3UA6A 4RD6A 3BW1A 4Z4UA 1RACB 3CCJA 1KHCA 1VQ8A 3CPWP 1LOJA 1WHMA 2DMOA 3BDUA 2QYZA 3PGGA 1HXDA 5GANj 2DO3A 5CO7A 4QVAA 1VA7A 4JPBW 2AT1B 3PA1A 2G3RA 3H8ZA 1GFCA 3C94A 2JJ2A 2DL7A 1VQMB 4EMKC 4N3GA 3CCSA 1T6YA 5J26A 7AT1B 1W0JA 4AFUC 4J0QA 1YFNA 4AFQC 3EFSA 1I4K1 1WDXA 2AZVA 3M0UA 4PJLA 2DBMA 2C5HA 1C6VX 1U5SA 1QCOA 1Z9QA 2KE9A 5GAN4 1V0FA 3FPKA 4CI0C 2CNDA 3CQTA 1B7TA 4M7DD 5F4JA 3LO8A 4F17A 1W2BP 1D0ZA 2BPOA 3LQEA 3JAME 3QWYA 4YTLA 4AG1C 2LJ3A 1YJWB 1WQ7A 4L8JA 1QVPA 3ZZTA 1S72T 4ZNXA 2DIGA 3M0PA 1D0XA 3E1YE 3V7CA 4XQFA 4KULA 1GL5A 5HK0A 3E1SA 1SRLA 1QKWA 4M7DF 1QGZA 2PZ1A 4C8QA 3OYNA 2C0TA 1RUWA 3HSBA 5IT9E 2MWOA 3FKSA 4L5GA 4C0DC 4M7AC 4MDXA 1TUIA 1WQWA 4ZGQB 4ZGEB 5KYXB 4C92A 2LCCA 5D6XA 1UG1A 4FW2A 3HHTB 2BF4A 3GIRA 3MEVA 2LMJA 1ZSZC 4Z4VA 4E7KA 5GAOq 3OAAA 2MAMA 3PUMA 3UWNA 3EGXA 3JB9J 4HVVA 4C8QC 4AT1B 1QQJA 5FW9A 2CUDA 1UE9A 2EQKA 3HL8A 3P8HA 3M0SA 1WOPA 2CUBA 3M59A 1Q9SA 2DIEA 2BZYA 2I0NA 3HRTA 1PD0A 4J8OA 3BCDA 1OEBA 2JIZA 4B43A 1N8RC 1YWPA 3CXCA 3MHXA 4PJOD 4XQ3A 2QG9B 3QIIA 5A0DA 1OB2A 3JCMQ 4RPBA 4C92D 1QVFB 3X25B 3JRZA 3ES9A 3RNJA 4Z89A 3LH5A 2K3YA 4JJBA 4C5EA 3FPPA 2VVKA 4KBMB 3BNWA 3NPFA 3OS1A 1KRHA 1VQ7Q 2NUPA 2V7UA 5I2MA 3CCUT 4M1KA 3HP9A 1R77A 5F4MA 1ABOA 1M27C 4G1VA 2EGEA 4WQMA 5KW9A 1BI1A 3JQQA 4M77B 2HQHA 3CB4A 2AHJB 4NNJA 4B47A 1BMFA 4M53A 4DQ2A 4M78C 2VXFA 1M90R 2F43A 1ACMB 3W5HA 1YI2B 4Z4SA 4OF1A 4E2FB 2HBPA 2DL4A 1WDTA 3HAGA 1VQNB 1XTDA 3G4SQ 4IW3B 1PKSA 1G3SA 3EH1A 4JRPA 3CC4B 5GAMd 2EWNA 5FL7A 3E19A 4J83A 2XNJA 3OE7A 2YWGA 3C4SA 3AGPA 3CXCP 3CD6T 4RTZA 1QUEA 1HJDA 2VJJA 5KYYA 4P1VA 2ZL6A 1VQPQ 2O4XB 3OYKA 3EHQA 1Q7YD 1NJID 3LQ6A 3JCMe 3CW2A 3SB2A 1MV3A 2EGAA 3KUFA 2ZXIA 2W0ZA 4OP7A 4RUGA 2RC5A 2BE9B 1B2RA 1D2EA 4PAAA 3QYHB 1XB2A 4FYVB 1FNBA 3CCMQ 5IYQA 2KRMA 2RMOA 4Z88A 1RAIB 2JVVA 2E1HA 3PVDA 1BCMA 4M75F 1KD1U 3CESA 3CPWA 1N9SA 2MPXC 1EFRA 2E1RA 1ZM3A 1DDGA 5DSZA 4ORZA 3WVEB 1PSFA 3I55B 1H92A 3OYYA 4TT3A 4HA8A 1JJ2B 2Z6BD 2YWHA 1ARKA 1IZ6A 2CP7A 2DXTA 4E7JA 1VQ5A 1WHLA 1ZM4A 2CH4W 1M90C 1H42A 2BSAA 4M78D 4FSSA 1QFYA 1W9XA 3V7SA 1UGPB 2GTOA 2E10A 3FB9A 5FU6C 1K9MU 2ZXHA 5CKBA 1Q82C 2LQ8A 4OGCA 2JMCA 1VQ8Q 1FRQA 3GBQA 4JRKA 1VQOQ 3C12A 4UZUA 4X9CA 3Q39A 3OYCA 5KYWA 1P4MA 1X75C 5IH2A 2DE0X 4RTTA 2EVRA 4PC6A 3DB4A 5B6IA 4A4KA 2LT4A 2E41A 3QJ6A 2K79A 5KYUA 1UGSB 2ZZQA 4Z4WA 4PJOC 3CCRB 2ABLA 1N8RD 4M77F 1PRLC 4M78B 4F7UA 1YI2T 1WOOA 2FX3A 1UFFA 4L59A 3LWIA 1W4SA 4FL6A 3CCSB 5GMKh 1SPKA 4JZ3A 2RK1A 3I9QA 2CP0A 3VYHB 1IB0A 2GJKA 3W5UA 4ACAA 3LGFA 4ZTJA 5E6TA 4Z02A 4B6MA 1E6HA 1BI2A 3FRNA 3TSWA 2DZCA 1Y71A 4OOSA 1OPLA 4FWTA 4AFSC 1IREB 3L2VA 3MEAA 4Y28E 1VOMA 2FZGB 4HCBA 4PGOA 3M9QA 1RABB 4OMMA 4JZ4A 5LMZA 3JV3A 2RQRA 5IN1A 1B34A 2D6FA 1G3TA 4WF2A 1V0EA 2Y90A 1BU1A 4V2SA 2ZTGA 2YUPA 1YNZA 1M2OA 3G71Q 5HCKA 3ONUA 3LWHA 3LVBA 3M53A 1VQ6A 5EMNA 2VUBA 4Z4ZA 3OYAA 3C0CA 1YJNA 4XLFA 5CQYA 2ENMA 3VJPA 1FNMA 3IQLA 3V8LA 3JU4A 4NS5A 3WNCA 1BI3A 1JB0E 1OZ2A 1Y0YA 4UAJA 3KFVA 2RHXA 1KK0A 2X3WD 5LJ3f 1UUEA 1EP1B 1EFNA 1V29B 2XU8A 2O9VA 5FU7B 2QGGA 4E7LA 1G83A 2OYNA 4JMQA 5L8RE 4BI4A 1VLYA 2VBVA 1UD2A 4HT8A 3H6ZA 3H94A 1VQLB 2BKDN 5FU7C 1AMOA 5GAMg 1M4ZA 2QDXA 1MMNA 3V8JA 1LCKA 2VJIA 3ISXA 1QVGS 4LE9A 1UD3A 1OI1A 5KCHA 2LX9A 1X6GA 3M0RA 3GSIA 2PTKA 1X01A 2RH2A 4LNPA 5HKCA 4NL3A 2JZ2A 1W6XA 1TUDA 2OK8A 1ZQ1A 4M78G 2AIRB 3SKBA 3G4SA 1M3CA 2J7IA 3NTHA 1R5OA 1T3LA 3PVQA 3S3MA 1YN8A 4KGXB 1BLIA 3CCLB 1U3OA 2DNUA 1YLOA 1BX1A 2QK0A 3CBOA 2COYA 4FYWB 3SDZA 1Y96A 1UB4A 1WPCA 1K8AU 2VGMA 3U23A 5GAN5 2JM9A 4R55A 2MK5A 2PU9B 5I11A 1AWOA 4F14A 3CTAA 2YHTA 2L3PA 2CP6A 1YI2A 4K1XA 3ZZUA 3AGQA 1MNEA 1LVKA 3PIPA 2MIOA 2ROTA 4AG2C 4JS5A 3I1FA 2EIFA 2OBSA 1OOTA 1KC8R 5LL6S 1VQ4B 3OYDA 2ZAEA 4PJOE 4PLLA 1U8RA 1QW1A 2QEXB 3GIBA 1FMKA 3SJZA 5A0LA 4XLCA 5KE3A 4XLEA 4FT2A 1K73C 1PJ5A 1T6XA 2ZBVA 3X20B 1KD1C 1PM3A 2NPFA 4IURA 2BIVA 2NYSA 4G7XA 3GVKA 2XOKA 2CREA 3G05A 1FYNA 3TVTA 4TKOB 3WY9A 1I1JA 5IXFA 1IJFA 1UJ0A 1VQKA 2V7TA 5GAOr 1QVFP 4M4ZA 4RD0A 1KTVA 2K3BA 3ASTA 1OQKA 4RG8A 2HBWA 1VQ9Q 2VB6A 3EGXB 1NJIR 1AIPA 2F2XA 1VQ9T 1N27A 2M02A 1GAQA 4PK4A 5HKKA 3MO8A 3JQRA 1TS9A 5F4OA 1GFDA 3QSYA 5IYPA 2FPEA 3CMEB 1D0YA 4M7AE 1W35A 1VIEA 1K0SA 1TG0A 2JTFA 2CBXA 2XK0A 5KYUB 2R58A 1YITT 2CW5A 3NGPA 3SJPA 2JN0A 1VQKB 2GNCA 2XG8D 1IXDA 1FWZA 2KRNA 3OYLA 3GVJA 4OB2B 2EYZA 4TN1A 4YHBA 3EGDA 3CD6Q 1VQMQ 2EQMA 4RTUA 1ZUUA 2QQSA 3ER0A 3VS6A 2P84A 5DM7R 5FWCA 4JLGA 6AT1B 1M5Q1 5HY6A 4RDLA 2CSQA 4E7HA 8AT1B 5L23A 1GAWA 2EFIA 4M7AD 2A28A 2HLDA 3B8HA 2XNDA 1K9MR 4TSFA 1M1KC 3E9GA 4ZCIA 4RCCA 2ZITA 2J6OA 2HQXA 2PNIA 1PJ6A 3VMFA 1GXIE 5LJ5h 1VIFA 4EH1A 4N0AA 3RR6A 1V76A 5LJ5d 5H5JA 1EWYA 3PVLA 2FB7A 1N08A 1FMWA 4MZMA 1RQRA 3HPWA 2H3JA 3G6EA 2YUOA 3VS5A 3CCQQ 1QVFS 4C92E 3OSVA 1PG5B 1OPKA 5GJWB 4LBZA 1KMHA 5KNLA 2QN6A 1AD5A 3QHSA 4NL2A 1SKYB 4AF6A 3JCMd 2KR3A 3M0QA 4EDUA 1K8AD 3ZBDA 4DBQA 1BJKA 1I0CA 3CCJQ 2L3RA 1HK9A 3MP1A 4QVCA 3VS7A 3CCUB 1VQPA 4LBWA 3E20A 4X7FA 1NEGA 4QFMA 1G2BA 4OMPA 1E63A 2VZLA 1MMGA 3QDFA 5A0GA 1W70A 5M9OA 2RC6A 1AEYA 3CMAQ 3HTRA 3OB9A 3GNGA 1E6GA 1VYVA 4II1A 2CDTA 1SSFA 2CZ1B 2P0KA 1M8MA 1QGYA 1VQ5B 2V4DA 2H3EB 2C5BA 2K5FA 3GLXA 4OVAA 2CF4A 1UD4A 2M51A 4IIOA 3CC4T 4UZFA 2ZL7A 3OA6A 1YITA 4QKUA 4MYTA 3VV0A 1XFOA 2CYZB 1VLOA 1VQLT 2E4HA 4PLIA 4ZN1A 3QFSA 2RN8A 2QDLA 4P26A 4C8QE 4JLIA 2RJDA 2XEXA 1Q81U 1BPLA 2XDBA 1EP2B 4JS4A 2V1QA 3JCMW 3WNBA 4M7AB 3CMMA 1F60A 2LZJA 1YIJB 4XOTA 2BUDA 1X2KA 2JS0A 3X28B 3A8GB 2GPJA 1QH0A 2LC4A 2D9RA 3RBBB 1ZSZA 3EFOA 3WVDB 2LT1A 1NZ9A 1KK7A 4ZCLA 3S3OA 1N5ZA 1YI2Q 4BB7A 3VO2A 1ZM2A 4EPCA 3G4SB 1R0BG 2PVDB 2PMDA 3MEUA 2HCKA 5AYFA 4FIBA 4DQLA 4F7UG 1S72A 1G7RA 2RNAA 4Z4RA 1TH7A 3CCLA 3LYIA 1VQNT 4M7DB 4M7DE 1VQ8T 1QFZA 1VHOA 4FM4B 4B9WA 1SG5A 4J6XA 1QWFA 4M7DG 4Z4TA 3B78A 1GRIA 4PC1A 1W87A 4J9CA 2FPDA 2V7QA 2B8AA 4A63B 4BE1A 3FJ5A 3MJXA 2V7VA 4J9BA 3U2QA 2AK5A 2X6XA 1YJWA 2V7XA 2WZNA 1GO2A 5H59A 2ESWA 1YJ9Q 2W10A 2KGTA 1KC8D 1D09B 4M7DA 1RLPC 1MABA 1AWJA 2YT6A 2IVWA 1NDHA 4RLZA 4OP0A 3UPUA 3H41A 4C43A 1GCPA 2PVGB 1EFTA 1NB0A 4BUGA 1W2BB 4Q7JB 3PENA 1AWXA 3M55A 4BY6C 4E6RA 3ME9A 9ATCB 3CC2Q 3CCMT 2QTXA 1SRMA 4XD7A 2YLCA 1TSFA 4J6WA 1KSWA 4WZKA 5KYNA 4Z8AA 5IHNA 3J81E 4CRIA 4RPDA 2CZ6B 2GBQA 2DD5A 1YITB 1VQ6Q 1VQ4T 3OYIA 1WIEA 1FXXA 2E70A 1FMVA 2XICA 2RM4A 3OYHA 1D1AA 3NTKA 2CKKA 1VQ8B 4OPSA 1C0MA 3MPUB 2QI2A 4M7AA 4Y9UA 2RQWA 1Q86C 2DXCA 3OS0A 1NE8A 2X6WA 2M16A 1KQSP 2AHOA 1YJ9T 1EFCA 4M75G 2BN4A 4ZTFA 3E9FA 3QZ5B 3WBKA 4WZEA 3W2EA 3VU3C 1JRIA 3OP1A 2WJYA 3CXCB 2DM1A 4M77C 3ZL7C 1U2RA 2C0IA 3B82A 4PNOA 4RTVA 4D8DA 4J7IA 4M78A 4F7UB 1E64A 3LGLA 1QCNA 2OTJQ 4YAFA 4RKUE 2CS7A 2EJFA 1N8RU 2RO0A 3HFNA 2JS2A 2ECZA 4X07A 4RJLA 4BI8B 4C0GA 3OYEA 4AC9A 1SF9A 1AWWA 4BE0A 1UHFA 1E62A 1BIAA 4Y9RA 1E3ZA 2M0OA 5KCOA 3GNFB 2X53S 1VQ7T 2QA4B 5FLXE 3CC2A 2YWEA 2VKNA 4J9HA 3VO1A 3MHPA 4C5HA 3EG1A 4X05A 4J9GA 3RERA 4M77A 1YHQQ 4RTYA 4XU2A 4X9DA 5C6SA 2VNJA 5GMKm 3OZVA 4C5IA 5IK2A 4B4DA 5FROA 3JCMh 3PUNA 3A1PA 3PT9A 1R0CB 3QUIA 5GMKj 4A4GA 3SHWA 4M7AG 2C4TA 2QTVA 1I5OB 2B7CA 3CCET 3I55A 4XTYA 1I8DA 3CC7Q 4M75E 1N0UA 2BGJA 3JCMJ 1WYXA 2CGHA 4RCBA 3OKXA 4ROXA 1MMDA 2V26A 1Q81C 2MWPA 3MEWA 3SD4A 3VS2A 1X43A 2LNHB 2HSEB 3THKA 4HT9A 1K73R 3TREA 1R5NA 4HE6A 4LUDA 1A8PA 1OYXA 1U1SA 1WXBA 4BI3A 4ANJA 1JEGA 2WSCE 2OTLA 2BM0A 3Q38A 3ZBTA 4GLKA 2NLUA 5TR9A 1CKBA 3H0FA 3DKMA 4XU0A 2DFUA 1VQLQ 4N4IA 2D0NA 3EHRA 1UECA 4P6VF 2PVOB 2EYWA 4JUVA 3ZBUA 1SSHA 1PCXA 3QYGB 3EGDB 3I55T 4E7SA 2D8HA 4XU1A 3WXMB 2OJ2A 4EMKB 2J6KA 3CCVQ 1RI0A 3CMAT 2RI2A 5KE2A 2XNCA 5FA6A 1UD8A 3UT1A 4G7WA 5THXA 2L3QA 2B86A 4LN2A 3CPWS 1YIJA 2JOYA 4G5GA 4II2A 4P3IA 1XQHA 1M90D 2B5OA 2A36A 1ZA2B 2OAUA 3X24B 1WOSA 1S1NA 4M75D 1ZX6A 2E3HA 2R57A 3A8IA 4P2NA 2CP2A 3NMZC 3ASQA 2DIQA 4PJOA 3I56Q 2Z0WA 4QUZA 1U06A 1TOVA 2RF0A 1IGUA 1WA7A 2ZL5A 4X7EA 4M77D 4EMKA 2YRDA 4PC7A 1YHQT 2SEMA 2XIDA 2QA4A 4LDWA 4A4FA 5GAOp 3META 2O9SA 1AT1B 2QQRA 4BDZA 4X1VA 2D3NA 4X06A 4YXWA 1KIKA 3ULRB 2LJ0A 4TMZA 3REBB 1UHCA 4P22A 3CCRA 1WSVA 1Q7YR 2KXCA 2Q6OA 1GJRA 1Q7YU 3I56A 1HD3A 4DOWA 2DVJA 3A3BA 3UF4A 2DTHA 3V7RA 2D74A 1VQ7A 4AMCA 4NOYA 3R6NA 4P9SA 4DBFA 4XTVA 4GY5A 2E12A 2FEIA 3A3GA 2YLBA 4EIKA 3RESA 5IHKA 1VYTA 2HD0A 4DBRA 1RADB 3GF5A 3GOXA 2DZ9A 1PC0A 1DARA 4HIZA 2D8JA 5GMKe 5KSWB 2RQVA 2FVGA 4QHYA 2FG0A 2RD1A 3L1AA 3QO3A 2WR8A 5L46A 1Y07A 2RI3A 4GLMA 3CC7T 1J3TA 1WHHA 3CMEQ 1AOJA 1PJ7A 1RI9A 2Q6IA 5IYWA 4F16A 1QVGA 1VQNA 3FIFA 3EAEA 1N9RA 4EMHA 1VQ6T 4XKVA 3BFMA 2VGNA 1YP5A 1HYOA 3VUZA 3A8LB 2FZKB 2O2OA 2BGIA 1G7SA 1MHNA 3M54A 3BQJA 2C2WA 5KYXA 3SWNC 3WNDA 2QGFB 1Q82U 2DA9A 5GAN3 4RD1A 1YJNB 3PIOA 3CD6B 2O01E 4DNTB 1ZBJA 5I21A 1YJWT 3RMQA 2CRVA 3R6OA 1M1GA 4RD4A 2HMAA 2KVQG 1KK1A 3Q3AA 3G71A 3NE5B 4HVWA 1CNEA 3GP8A 2MF2A 3EG9B 3VRZA 5CCAA 4RG2A 2X9HA 1ZLMA 2J05A 2XI9A 4XN3A 3OFNA 4OMFB 4QVJA 5DS0A 4XK8E 2O88A 1E1RA 5GMKl 1VF7A 3BE3A 4C0DB 1UGQB 1KFZA 1N05A 4M75B 2KQWA 2XMFA 1K0XA 4KH1B 3OW7A 1F1BB 1T6ZA 4RDKA 2RQTA 2WSSA 3CCQB 3BY1A 4X7DA 1JO8A 2V31A 5A88A 1K4US 5CQXA 5J35A 1JXOA 2HQEA 4FXUA 1IO6A 2P0PA 3LW5E 5D6WA 2NV4A 2E64A 2BE7D 3ONYA 1GR1A 5GJVB 1Y57A 2QTLA 2OK7A 1J9ZA 2F5KA 4A4HA 2VBTA 2J7KA 4EMGA 2KNBB 4HE5A 1RAHB 3S6WA 5GAN6 4XL9A 5CAIA 1EP3B 2JW4A 1I8FA 4PJJA 1JXMA 2A0FB 2DY1A 4PJMA 1VQKT 3SEJA 2PUOB 3M58A 1SHFA 4FK8A 3WBJA 2CC2A 2GFUA 3A8KA 1XNIA 4CC7A 5CDFA 3M4YA 4AVZA 3J80E 3ZC3A 3L2WA 1Q86U 1SHGA 3CMAB 1KQSA 5GAMj 1UDLA 4OB3B 1G3WA 4P3YA 4M77G 1M8VA 5GAMh 1VQ5Q 2PUKB 2YUQA 2LVMA 5EG2A 1WXTA 2V8JA 4JJCA 2K7AA 4BDYA 4FT4A 4J9DA 1WU8A 2ZZEA 2CP5A 3W2GA 1XJWB 2LRQA 1WTHD 3RUXA 3QFTA 2VXEA 1TLLA 1Q7YC 1OZ3A 1Y7XA 1H8KA 4M0LA 3U6BA 3BY7A 2KT8A 3QXEB 1WI7A 5LJ5g 5GANh 1VQNQ 2DOGA 5GANd 4Q5WA 2HAXA 3CMEA 4UZEA 4LD9K 5GANg 3SFMA 4C92G 3A5ZB 2A08A 5I2SA 2OAWA 1FX7A 2RJEA 5GV7A 2EIXA 3FJPA 4OOVA 2DJZA 4MMLA 3WXMA 1AVZC 4C92C 3QBYA 2DK3A 3U6KA 3G71T 2EQIA 1EZZB 2GGRA 1Q82D 4BY6B 5GMKi 4RM0A 3CCJT 1EXMA 4CC4B 3CBPA 3CXCS 1Q86R 2WZPP 3RY8A 2ZTNA 4XORA 2RHIA 3T51B 4C92F 1KZLA 3CEYA 4Y7CA 1PNJA 2WSEE 2FPFA 2P4TA 3QZ9B 2L2PA 3RKXA 3CCQT 3G6ET 2V7WA 2SRCA 3VRYA 2DL5A 2EGCA 1FX0A 4XKWA 2VBSA 1OB5A 3A8OB 2IPOB 5GAOm 1S72B 3JSCA 3OY9A 3OMCA 4P5NA 2P3MA 4WZTA 1IGQA 3RKYA 2YDLA 2PE3A 5FRNA 2X8KA 1GVHA 3JB9D 2QEXT 1M2VB 5FRMA 4C8QB 4ACBA 1M1FA 1VYUA 2E3IA 1WP6A 1GCQC 1YJ9B 2F2WA 5LJ3h 4C8QG 2DBKA 2J06A 4PFOA 1VQOT 3NHNA 2X51A 3W2HA 1VQOB 3QPHA 2BZXA 3CC2B 3ASSA 1YX2A 2C06A 3M57A 1UJYA 1KQ2A 2DRMA 3CCRT 1WHKA 2ED0A 1BX0A 1FNCA 3Q1JA 1OV3A 2CT3A 4E7IA 3FEOA 2GF7A 2W6IA 1NBMA 1YITQ 2F69A 1WGSA 1FDRA 2ZPBB 1VQ6B 1UGRB 2A3LA 2MYSA 3WYAA 3VS4A 4PABA 2YWWA 1NPRA 2LNVA 5GAOl 1B07A 2BV3A 2DF6A 1M90U 1COWA 1O9SA 3CC4Q 2BMWA 2GREA 1I7PA 3OBWA 5LJ3e 3S3NA 3TQ7P 1E43A 2JUFA 3LLRA 3OZUA 1YIJT 5LJ3g 1PRMC 2DXUA 4PC3A 1I18A 1K9MD 1X6BA 2D3LA 4P6YA 1D8TA 4TMXA 2L8DA 4HKEA 1KQSS 4JRIA 4M2LA 1BI0A 1ZBXA 3UATA 1QVGP 1MNDA 2KI7A 1QUFA 3OJWA 4YALA 4XM3A 5GANf 3I35A 3G71B 3PA2A 5FWBA 1NJIU 3Q6QA 2F1MA 4MZTA 4OPVA 1TTTA 3CPFA 4XU3A 2GQFA 4RD3A 3CCEA 3CCMB 2VNKA 1NLPC 2V8IA 1JA1A 4IKFA 4RTXA 1VQMT 2Q6LA 4YEJA 2PLFA 2JJ9A 1M9SA 4M75A 2X4YA 1YHQB 4KUDK 2EQUA 5CKDA 1HSQA 2VBUA 2MMPA 5HZAA 3GVLA 3G6EB 3G4ST 3OSSC 1Y96B 2BTTA 2KXDA 1M1KU 2VWFA 3LH0A 5LJ3j 4RTWA 1OHHA 3KEWA 3RKWA 1O75A 1YCYA 4B48A 2EPDA 2CZ7B 2DVEA 2FVUA 1TTHB 4C0ZA 5BSYA 1NJIC 3BH4A 1YJ9A 2GFAA 2L3SA 3CCEB 3G7ZA 4TVRA 4M78E 2LTOA 3OEEA 5GV8A 3BCFA 3QJYA 4X8IA 2P0QA 3VS0A 1E3XA 5IYRA 1Q95G 1PKTA 3V7AA 2EKHA 2GTJA 1S0UA 4OOXA 3KXTA 1K28D 3VNVA 2D0QB 1JQQA 3FLGA 4LXCA 1QKXA 3R6KA 4DA4A 3CPWB 2E5KA 3ZUGA 1V1CA 3ASRA 1C1AA 2DLPA 4FN5A 3CCLQ 2KYMA 1ZSGA 1QGAA 5J39A 3CCRQ 4OMQA 4Z4YA 2E1BA 5A8AA 4N4GA 2HL5C 2LQWA 4J5YA 1F20A 2EQJA 2ZPHB 2NUTA 3EFRA 1UGVA 4PFZA 4B9XA 1R8OB 1LJOA 1IHVA 1ZA1B 4PL6A 1G7CA 1ELOA 2C77A 1M1KR 1ZUKA 4DBHA 2BZ8A 3SWNB 1NYGA 2COWA 4QQDA 5TY0A 5GANe 1WPYA 2EFGA 4OB0B 3OW2P 5J3BA 4F7UF 3OS2A 2FO0A 4ELZC 2KY9A 1UD5A 2F1LA 4PKCC 4TMTA 2DX1A 1T5EA 1OB0A 2QE7A 2XKOC 1X2QA 3A8HB 2YUNA 5CKHA 2NWMA 4XTZA 1BBZA 5FO1A 3I5SA 3SWNA 3HRSA 5CKFA 3VKIA 4WCIA 3MKDA 5I22A 1QVFA 5EC7A 2OBRA 4II3A 4KKSA 3TEEA 1PKVA 4C8QD 1TVCA 2DYIA 3PNWC 2EAYA 3NFCA 2D9TA 2LZ6B 1LNXA 4FYYB 4PJOB 4RMOA 4DEXA 5GAOn 4Y92A 4BD3A 1E7OA 1JB9A 1Q81R 3PE0A 4FSXA 2XZLA 3J81k 2E6NA 5IAYA 1BIBA 1Q86D 3EG2A 4JJNK 4DEYA 4XMYA 4ASUA 2DILA 1WLPB 1BQEA 2W6JA 1HZEA 2KBTA 1I81A 4LBVA 1AZGB 1EX4A 5GAMf 2HCJB 1KQSB 3HFOA 4XTXA 1V5VA 3CMAA 1AZEA 1H8EA 1W34A 4HXJA 3FJOA 2JN9A 2OX7A 1U1TA 1NB9A 2I1LA 2OTLB 1X6OA 3L2UA 3P8DA 4KKUA 1UD6A 2ATCB 3O5ZA 2XZOA 3G1JA 1TXQA 2K5LA 2R5AA 4XAXB 5LJ3d 1A0NB 1WJQA 2LDMA 2QDYB 1BCOA 2ZPGB 3ASPA 3CP2A 3V76A 2EYYA 1B23P 3CCVA 2VYTA 2FRYA 5KYYB 2K9GA 3P26A 3TCJA 4BE2A 4WTOB 3NTIA 2GJPA 1KC8C 3JCMf 4E47A 3MP6A 3RDVA 2V8KA 4OB1B 4QV2A 2YRVA 4KT0E 2E5QA 3MMPA 2X4WA 4M7DC 3L42A 1NG2A 5CKEA 2VYQA 2YWFA 1QP3A 2DL3A 2F5TX 3SEMA 1VQ5T 4KKTA 4TMVA 5FO0A 5JBQA 3OYGA 3URGA 4F7DA 2X0KA 1I5LA 1B3QA 1SEMA 1T0HA 1RAGB 2OTJA 3RIRA 2XZPA 4U9UA 2G6FX 3JCMP 1I07A 2NUPB 4QT7A 1M3BA 3A8MB 2CH4A 1OU8A 3F70A 2VV5A 3QFCA 1QG0A 4C92B 2QEXQ 2ZCFB 4KH0B 2ZPIB 2M5SA 3ZEHA 4ELYC 3QG1A 3CCJB 3CP8A 1QMCA 2K4YA 3R6JA 2HZYA 2Y4YA 3JB9I 5FU6B 2X6YA 2H8HA 4OMLA 4FCYA 3H0IA 2JNGA 2DL8A 5AT1B 1VQPT 1OX8A 2CK3A 1KJWA 4PJOG 4O5VA 1P92A 1CNFA 5DN6A 1CSKA 2IG0A 3CC4A 1VQ9B 3CCQA 4FW1A 2FHDA 2HDNB 5D6YA 4RD2A 5GAMe 1RAEB 4IUQA 2DPPB 5GAN2 1N07A 4YAWA 1D1NA 1VHEA 3Q6RA 1OU9A 2O31A 2A37A 3D7SB 3PTAA 1W1FA 4C0FA 2YXYA 5HK3A 3KBGA 2YSQA 5CIUA 2XDDA 2C0OA 1JA0A 4C8QF 2COZA 1UTIA 1ZM9A 1N8RR 1VQKQ 2E6ZA 4XONA 1VQOA 3CPXA 4J9EA 3CC7A 5CK9A 5TV2A 4A54A 3HKSA 3EG3A 1VQ4A 1WXUA 2KVOA 1YJWQ 1GBRA 1KK3A 1K73D 2K2MA 2LJ1A 2KRSA 2QEXA 4MZPA 4R0KA 5LJ5e 4P25A 2WSFE 2R9VA 5D7UA 4WZLA 4J9FA 1NBEB 5FNZA 1ABQA 2ZZGA 5J3OA 4KUIA 4X0CA 3OYFA 4B44A 1H3HA 1W2BA 4R56A 1JJ2A 4G1BA 4LC0A 1JBMA 1WZOA 2CSIA 3EH2A 4RCYA 4B3XA 2KK4A 3CMET 3CCLT 1HA3A 2HDAA 2EJGA 3QWXX 1W0KA 5DY9A 2X4JA 2KDSA 3OJXA 3LNNA 2DD4A 2EKOA 2WACA 2QA4T 2CT4A 4QW2A 3PFSA 5C0MA 3L2RA 4DK1A 2LP5A 2YRCA 3QFRA 3H0HA 3OMGA 1N6AA 2RJCA 1NM7A 4D6WA 3DDYA 4LDYA 1FNDA 2ZPEB 4C0SA 4ZGJB 2RJFA 3VYGA 2RHYA 1DG1G 2P4RA 3ZFJA 2X85A 3H9NA 4AF7A 1IJEA 4J6YA 3VUBA 2KEAA 2PQWA 1PSEA 3CCUQ 2DXBA 3E2UA 2QMUA 1MRZA 2GJRA 1M1KD 2ZPFB 2QAZA 4CC3A 3JQPA 3KL9A 2HKNA 4OMOA 4M77E 3OYJA 3W2FA 4Z1MA 1WORA 2C78A 1WX6A 2LCSA 1S72Q 1D3BB 5BSXA 3CCST 2L0AA 3JCMc 1VUBA 2K57A 3X26B 2BM1A 2DCUA 1VQ7B 4L6V5 5HZBA 3BY2A 4XTWA 2CP3A 2EYQA 1WJRA 3P8BB 4ZN3A 2DERA 4DK0A 2L89A 3A98A 3T9NA 1DDIA 1JJ2S 1G7TA 4KRTA 1KG1A 4XLAA 1UEBA 1TUCA 5CVIA 2ED1A 3REAB 2VNHA 3CRZA 5KYWB 3T53B 4LDUA 3AVXA 1R5BA 1D3BA 4LUEA 1BYMA 3EGUA 4OMNA 5IHIA 4QVDA 3CCVT 4OPOA 1D1CA 4N4HA 1YIJQ 1OX9A 3DB3A 1Q81D 2ZBUA 3TU4K 4MMKA 1ZUNB 3A8JA 3ZPNA 1QCFA 2X35A 4XNFA 1KHIA 4GBQA 1VQPB 2FZCB 2GQVA 2O4XA 4QQGA 3JCMg 1FRNA 4DNRB 2HEQA 2OI3A 4XTUA 2VNIA 5DLQE 1X69A 1JU5C 3QDRB 2XD0A 3I56T 4NBSA 1SKQA 2FRWA 2NUTB 3OEHA 1WHJA 4J9IA 2EYXA 2QQAA 4C5GA 2F2VA 4KGZB 4MYUA 1KD1D 4LD6A 1VQLA 2KROA 4RCZA 4DQKA 3BC9A 2DTOA 4X34A 4BACA 3AVYA 4N0AC 3OYBA 2X3UA 2M9UA 3L2QA 1JNYA 3DLLA 2JMAA 3I5RA 3INZA 3ASKA 1H3ZA 4B3GA 3RMSA 2LQNA 2R5MA 4O6JA 3I55Q 1UMKA 3MCAB 4HVUA 4A4EA 4A53A 1WNLA 1ZSZB 2FYKA 3EFOB 3MP8A 1S4MA 1RAAB 1PHTA 3W2IA 3CC7B 3LX7A 3DLMA 2B7BA 1BK2A 4YAOA 2DEQA 4NCNA 1M2VA 2RB6A 1E79A 3VNUA 3UDCA 3OZWA 1K9MC 1YCSB 5DLOA 3OQ5A 1BB9A 1YHQA 2GK7A 2D1XA 2ZZFA 4ZCMA 1W2BS 4CC2A 3C95A 3L2ZA 1K1ZA 2JT4A 3G6EQ 1M3AA 3T56B 1YWOA 4MDWA 4QVZA 3SLDA 1IHWA 4HCZA 2OTJT 2DAQA 2K2VA 4WWVA 3QKJA 1IHMA 1KC8U 5IXBA 4UC4A 3A35A 3W5VA 1K76A 3VR6A 1TU0B 2ROLA 3O8VA 4IIMA 4IUTA 5FIUA 4TMWA 4D8KA 2JJ1A 3OPOA 4K11A 1GBQA 1SKUB 4FYXB 3CCEQ 3PMIA 1VQ9A 3JB9H 3OW2B 2K3XA 3EG9A 4B3FX 3OBYA 3CCSQ 3UA7A 2J6FA 1H85A 2M1HA 2GQIA 1RL2A 2DJQA 3CCVB 1M30A 2ZGWA 1IB8A 2RK2A 2JTMA 2XHCA 5LJ5j 1H8HA 1YBYA 1VQMA 2HNIA 1ZUYA 3JCMX 1XE1A 1OULA 3M0TA 3CBMA 4E7ZA 4G6IA 4IUUA 4F7UE 1WHGA 4H9GA 3FC3A 3WQZA 2XDPA 4PJOF 1RQPA 1T3SA 4N3NA 2DETA 1X27A 3OW2A 1BKBA 2LQKA 3AVTA 5LJ5f 1K8AR 1K9AA 3D26A 1QVGB 2OTJB 1CQXA 2MOXA 2X3XD 4M7AF 4CQJA 2DYBA 2R6HA 2QQ9A 3P27A 3FDRA 1SM4A 5A89A 1RLQC 5IYNA 2LX7A 2KYBA 2I2LA 3ZZ0A 4E0FA 1KQ1A 3AHUA 1D1BA 2QA4Q 1EFUA 4JDSA 4ESRA 5CR2A 1AHJB 2MCNA 4IUPA 4BPRA 2WYRA 2ZZDA 4PC2A 4FU6A 3AVUA 2OTLT 1Q82R 3ZIAA 2IIMA 1E1QA 2AKKA 3JCMV 3AVWA 1VJSA 2DTIA 4M4SA 4JJDA 3V8KA 2C4UA 3JCMb 2QTZA 2AZSA 5AN9A 1NYFA 2EBPA 5GAN7 2QQBA 3CD6A 3MCAA 1RAFB 4R71A 4ZGDB 2RI5A 1Y0RA 4YAUA 2BVNA 2NUZA 2KAFA 2MI6A 1MV0B 2E65A 1Z9ZA 3GQBA 4KGVB 3HRUA 4M75C 2GK6A 2VC8A 1NLOC 3CC2T 2JM8A 2V1RA 5GAN8 5HXBA 1TWBA 1MUZA 5KH6A 2RHUA 1OGJA 2LCLA 4ZGNB 4J7FA 4VUBA 1QFJA 4XN0A 3VS1A 2GCXA 8ATCB 2K6DA 1JJ2P 4OGEA 4DOVA 3AT1B 4PJNA 2HSPA 1G8XA 1YJNT 1QX4A 2RHZA 3OW2S 4LBYA 1DJ7B 1QP2A 2FL7A 2Q6KA 2QASA 2OTLQ 3CCMA 3JB9F 2XGJA 1YJNQ 2WJVA 1K8AC 3OOCA 3AVVA 4ATOA 1HVXA
chains in the Genus database with same CATH topology
3H9NA 2DYIA 3A1PA 2QGGA 2DOGA 2F1LA 1PM3A 3HTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9N A;  2DYI A;  3A1P A;  2QGG A;  2DOG A;  2F1L A;  1PM3 A;  3HTR A; 
#chains in the Genus database with same CATH topology
 1NPP A;  2EJ9 A;  2M0Y A;  2JXB A;  3M56 A;  2JDI A;  4XR6 A;  3J7A F;  1OGI A;  3QE2 A;  4Y91 A;  4X7C A;  1G3Y A;  4AFZ C;  2RPN A;  5A2Q E;  3OS5 A;  3VS3 A;  4LDX A;  2A7Y A;  1NRK A;  4F04 B;  4JRQ A;  2K5I A;  1H64 1;  1VQ4 Q;  1IRX A;  1ZHI A;  2RQU A;  1N06 A;  1TUG B;  1KJZ A;  4M78 F;  1QLY A;  2KMT A;  3M4G A;  1B34 B;  4ME7 A;  1CKA A;  3I56 B;  2DEU A;  2KSS A;  3JB9 G;  4QQ6 A;  1Y0M A;  4ZV4 A;  1G5V A;  3OYM A;  2L5Q A;  3BDL A;  4IUV A;  2RA2 A;  3QSU A;  2Y4X A;  4GQN A;  5TRD A;  1PD1 A;  4RDJ A;  2KT1 A;  2DKG A;  3EG0 A;  1WSR A;  2DRK A;  1WFW A;  4XOP A;  1MMA A;  2JTE A;  3TSZ A;  4XLH A;  1N0V C;  2AKL A;  2X4X A;  1XOV A;  3M5A A;  3PMT A;  3N5B B;  4LDV A;  2HL3 A;  1MGQ A;  4P12 A;  4HCK A;  1T0J A;  1PWT A;  4HCC A;  2OBT A;  2VAS A;  1WJS A;  3GPL A;  1GCQ A;  1LPL A;  1XQB A;  1NEB A;  2CZ0 B;  2EW3 A;  1KK2 A;  1K73 U;  2PIA A;  2HKQ B;  1EIF A;  4PFP A;  4YEL A;  2F4N A;  1QWE A;  1KD1 R;  2WPD A;  5ECA A;  2QXF A;  3CCU A;  3SLN A;  3UA6 A;  4RD6 A;  3BW1 A;  4Z4U A;  1RAC B;  3CCJ A;  1KHC A;  1VQ8 A;  3CPW P;  1LOJ A;  1WHM A;  2DMO A;  3BDU A;  2QYZ A;  3PGG A;  1HXD A;  5GAN j;  2DO3 A;  5CO7 A;  4QVA A;  1VA7 A;  4JPB W;  2AT1 B;  3PA1 A;  2G3R A;  3H8Z A;  1GFC A;  3C94 A;  2JJ2 A;  2DL7 A;  1VQM B;  4EMK C;  4N3G A;  3CCS A;  1T6Y A;  5J26 A;  7AT1 B;  1W0J A;  4AFU C;  4J0Q A;  1YFN A;  4AFQ C;  3EFS A;  1I4K 1;  1WDX A;  2AZV A;  3M0U A;  4PJL A;  2DBM A;  2C5H A;  1C6V X;  1U5S A;  1QCO A;  1Z9Q A;  2KE9 A;  5GAN 4;  1V0F A;  3FPK A;  4CI0 C;  2CND A;  3CQT A;  1B7T A;  4M7D D;  5F4J A;  3LO8 A;  4F17 A;  1W2B P;  1D0Z A;  2BPO A;  3LQE A;  3JAM E;  3QWY A;  4YTL A;  4AG1 C;  2LJ3 A;  1YJW B;  1WQ7 A;  4L8J A;  1QVP A;  3ZZT A;  1S72 T;  4ZNX A;  2DIG A;  3M0P A;  1D0X A;  3E1Y E;  3V7C A;  4XQF A;  4KUL A;  1GL5 A;  5HK0 A;  3E1S A;  1SRL A;  1QKW A;  4M7D F;  1QGZ A;  2PZ1 A;  4C8Q A;  3OYN A;  2C0T A;  1RUW A;  3HSB A;  5IT9 E;  2MWO A;  3FKS A;  4L5G A;  4C0D C;  4M7A C;  4MDX A;  1TUI A;  1WQW A;  4ZGQ B;  4ZGE B;  5KYX B;  4C92 A;  2LCC A;  5D6X A;  1UG1 A;  4FW2 A;  3HHT B;  2BF4 A;  3GIR A;  3MEV A;  2LMJ A;  1ZSZ C;  4Z4V A;  4E7K A;  5GAO q;  3OAA A;  2MAM A;  3PUM A;  3UWN A;  3EGX A;  3JB9 J;  4HVV A;  4C8Q C;  4AT1 B;  1QQJ A;  5FW9 A;  2CUD A;  1UE9 A;  2EQK A;  3HL8 A;  3P8H A;  3M0S A;  1WOP A;  2CUB A;  3M59 A;  1Q9S A;  2DIE A;  2BZY A;  2I0N A;  3HRT A;  1PD0 A;  4J8O A;  3BCD A;  1OEB A;  2JIZ A;  4B43 A;  1N8R C;  1YWP A;  3CXC A;  3MHX A;  4PJO D;  4XQ3 A;  2QG9 B;  3QII A;  5A0D A;  1OB2 A;  3JCM Q;  4RPB A;  4C92 D;  1QVF B;  3X25 B;  3JRZ A;  3ES9 A;  3RNJ A;  4Z89 A;  3LH5 A;  2K3Y A;  4JJB A;  4C5E A;  3FPP A;  2VVK A;  4KBM B;  3BNW A;  3NPF A;  3OS1 A;  1KRH A;  1VQ7 Q;  2NUP A;  2V7U A;  5I2M A;  3CCU T;  4M1K A;  3HP9 A;  1R77 A;  5F4M A;  1ABO A;  1M27 C;  4G1V A;  2EGE A;  4WQM A;  5KW9 A;  1BI1 A;  3JQQ A;  4M77 B;  2HQH A;  3CB4 A;  2AHJ B;  4NNJ A;  4B47 A;  1BMF A;  4M53 A;  4DQ2 A;  4M78 C;  2VXF A;  1M90 R;  2F43 A;  1ACM B;  3W5H A;  1YI2 B;  4Z4S A;  4OF1 A;  4E2F B;  2HBP A;  2DL4 A;  1WDT A;  3HAG A;  1VQN B;  1XTD A;  3G4S Q;  4IW3 B;  1PKS A;  1G3S A;  3EH1 A;  4JRP A;  3CC4 B;  5GAM d;  2EWN A;  5FL7 A;  3E19 A;  4J83 A;  2XNJ A;  3OE7 A;  2YWG A;  3C4S A;  3AGP A;  3CXC P;  3CD6 T;  4RTZ A;  1QUE A;  1HJD A;  2VJJ A;  5KYY A;  4P1V A;  2ZL6 A;  1VQP Q;  2O4X B;  3OYK A;  3EHQ A;  1Q7Y D;  1NJI D;  3LQ6 A;  3JCM e;  3CW2 A;  3SB2 A;  1MV3 A;  2EGA A;  3KUF A;  2ZXI A;  2W0Z A;  4OP7 A;  4RUG A;  2RC5 A;  2BE9 B;  1B2R A;  1D2E A;  4PAA A;  3QYH B;  1XB2 A;  4FYV B;  1FNB A;  3CCM Q;  5IYQ A;  2KRM A;  2RMO A;  4Z88 A;  1RAI B;  2JVV A;  2E1H A;  3PVD A;  1BCM A;  4M75 F;  1KD1 U;  3CES A;  3CPW A;  1N9S A;  2MPX C;  1EFR A;  2E1R A;  1ZM3 A;  1DDG A;  5DSZ A;  4ORZ A;  3WVE B;  1PSF A;  3I55 B;  1H92 A;  3OYY A;  4TT3 A;  4HA8 A;  1JJ2 B;  2Z6B D;  2YWH A;  1ARK A;  1IZ6 A;  2CP7 A;  2DXT A;  4E7J A;  1VQ5 A;  1WHL A;  1ZM4 A;  2CH4 W;  1M90 C;  1H42 A;  2BSA A;  4M78 D;  4FSS A;  1QFY A;  1W9X A;  3V7S A;  1UGP B;  2GTO A;  2E10 A;  3FB9 A;  5FU6 C;  1K9M U;  2ZXH A;  5CKB A;  1Q82 C;  2LQ8 A;  4OGC A;  2JMC A;  1VQ8 Q;  1FRQ A;  3GBQ A;  4JRK A;  1VQO Q;  3C12 A;  4UZU A;  4X9C A;  3Q39 A;  3OYC A;  5KYW A;  1P4M A;  1X75 C;  5IH2 A;  2DE0 X;  4RTT A;  2EVR A;  4PC6 A;  3DB4 A;  5B6I A;  4A4K A;  2LT4 A;  2E41 A;  3QJ6 A;  2K79 A;  5KYU A;  1UGS B;  2ZZQ A;  4Z4W A;  4PJO C;  3CCR B;  2ABL A;  1N8R D;  4M77 F;  1PRL C;  4M78 B;  4F7U A;  1YI2 T;  1WOO A;  2FX3 A;  1UFF A;  4L59 A;  3LWI A;  1W4S A;  4FL6 A;  3CCS B;  5GMK h;  1SPK A;  4JZ3 A;  2RK1 A;  3I9Q A;  2CP0 A;  3VYH B;  1IB0 A;  2GJK A;  3W5U A;  4ACA A;  3LGF A;  4ZTJ A;  5E6T A;  4Z02 A;  4B6M A;  1E6H A;  1BI2 A;  3FRN A;  3TSW A;  2DZC A;  1Y71 A;  4OOS A;  1OPL A;  4FWT A;  4AFS C;  1IRE B;  3L2V A;  3MEA A;  4Y28 E;  1VOM A;  2FZG B;  4HCB A;  4PGO A;  3M9Q A;  1RAB B;  4OMM A;  4JZ4 A;  5LMZ A;  3JV3 A;  2RQR A;  5IN1 A;  1B34 A;  2D6F A;  1G3T A;  4WF2 A;  1V0E A;  2Y90 A;  1BU1 A;  4V2S A;  2ZTG A;  2YUP A;  1YNZ A;  1M2O A;  3G71 Q;  5HCK A;  3ONU A;  3LWH A;  3LVB A;  3M53 A;  1VQ6 A;  5EMN A;  2VUB A;  4Z4Z A;  3OYA A;  3C0C A;  1YJN A;  4XLF A;  5CQY A;  2ENM A;  3VJP A;  1FNM A;  3IQL A;  3V8L A;  3JU4 A;  4NS5 A;  3WNC A;  1BI3 A;  1JB0 E;  1OZ2 A;  1Y0Y A;  4UAJ A;  3KFV A;  2RHX A;  1KK0 A;  2X3W D;  5LJ3 f;  1UUE A;  1EP1 B;  1EFN A;  1V29 B;  2XU8 A;  2O9V A;  5FU7 B;  2QGG A;  4E7L A;  1G83 A;  2OYN A;  4JMQ A;  5L8R E;  4BI4 A;  1VLY A;  2VBV A;  1UD2 A;  4HT8 A;  3H6Z A;  3H94 A;  1VQL B;  2BKD N;  5FU7 C;  1AMO A;  5GAM g;  1M4Z A;  2QDX A;  1MMN A;  3V8J A;  1LCK A;  2VJI A;  3ISX A;  1QVG S;  4LE9 A;  1UD3 A;  1OI1 A;  5KCH A;  2LX9 A;  1X6G A;  3M0R A;  3GSI A;  2PTK A;  1X01 A;  2RH2 A;  4LNP A;  5HKC A;  4NL3 A;  2JZ2 A;  1W6X A;  1TUD A;  2OK8 A;  1ZQ1 A;  4M78 G;  2AIR B;  3SKB A;  3G4S A;  1M3C A;  2J7I A;  3NTH A;  1R5O A;  1T3L A;  3PVQ A;  3S3M A;  1YN8 A;  4KGX B;  1BLI A;  3CCL B;  1U3O A;  2DNU A;  1YLO A;  1BX1 A;  2QK0 A;  3CBO A;  2COY A;  4FYW B;  3SDZ A;  1Y96 A;  1UB4 A;  1WPC A;  1K8A U;  2VGM A;  3U23 A;  5GAN 5;  2JM9 A;  4R55 A;  2MK5 A;  2PU9 B;  5I11 A;  1AWO A;  4F14 A;  3CTA A;  2YHT A;  2L3P A;  2CP6 A;  1YI2 A;  4K1X A;  3ZZU A;  3AGQ A;  1MNE A;  1LVK A;  3PIP A;  2MIO A;  2ROT A;  4AG2 C;  4JS5 A;  3I1F A;  2EIF A;  2OBS A;  1OOT A;  1KC8 R;  5LL6 S;  1VQ4 B;  3OYD A;  2ZAE A;  4PJO E;  4PLL A;  1U8R A;  1QW1 A;  2QEX B;  3GIB A;  1FMK A;  3SJZ A;  5A0L A;  4XLC A;  5KE3 A;  4XLE A;  4FT2 A;  1K73 C;  1PJ5 A;  1T6X A;  2ZBV A;  3X20 B;  1KD1 C;  1PM3 A;  2NPF A;  4IUR A;  2BIV A;  2NYS A;  4G7X A;  3GVK A;  2XOK A;  2CRE A;  3G05 A;  1FYN A;  3TVT A;  4TKO B;  3WY9 A;  1I1J A;  5IXF A;  1IJF A;  1UJ0 A;  1VQK A;  2V7T A;  5GAO r;  1QVF P;  4M4Z A;  4RD0 A;  1KTV A;  2K3B A;  3AST A;  1OQK A;  4RG8 A;  2HBW A;  1VQ9 Q;  2VB6 A;  3EGX B;  1NJI R;  1AIP A;  2F2X A;  1VQ9 T;  1N27 A;  2M02 A;  1GAQ A;  4PK4 A;  5HKK A;  3MO8 A;  3JQR A;  1TS9 A;  5F4O A;  1GFD A;  3QSY A;  5IYP A;  2FPE A;  3CME B;  1D0Y A;  4M7A E;  1W35 A;  1VIE A;  1K0S A;  1TG0 A;  2JTF A;  2CBX A;  2XK0 A;  5KYU B;  2R58 A;  1YIT T;  2CW5 A;  3NGP A;  3SJP A;  2JN0 A;  1VQK B;  2GNC A;  2XG8 D;  1IXD A;  1FWZ A;  2KRN A;  3OYL A;  3GVJ A;  4OB2 B;  2EYZ A;  4TN1 A;  4YHB A;  3EGD A;  3CD6 Q;  1VQM Q;  2EQM A;  4RTU A;  1ZUU A;  2QQS A;  3ER0 A;  3VS6 A;  2P84 A;  5DM7 R;  5FWC A;  4JLG A;  6AT1 B;  1M5Q 1;  5HY6 A;  4RDL A;  2CSQ A;  4E7H A;  8AT1 B;  5L23 A;  1GAW A;  2EFI A;  4M7A D;  2A28 A;  2HLD A;  3B8H A;  2XND A;  1K9M R;  4TSF A;  1M1K C;  3E9G A;  4ZCI A;  4RCC A;  2ZIT A;  2J6O A;  2HQX A;  2PNI A;  1PJ6 A;  3VMF A;  1GXI E;  5LJ5 h;  1VIF A;  4EH1 A;  4N0A A;  3RR6 A;  1V76 A;  5LJ5 d;  5H5J A;  1EWY A;  3PVL A;  2FB7 A;  1N08 A;  1FMW A;  4MZM A;  1RQR A;  3HPW A;  2H3J A;  3G6E A;  2YUO A;  3VS5 A;  3CCQ Q;  1QVF S;  4C92 E;  3OSV A;  1PG5 B;  1OPK A;  5GJW B;  4LBZ A;  1KMH A;  5KNL A;  2QN6 A;  1AD5 A;  3QHS A;  4NL2 A;  1SKY B;  4AF6 A;  3JCM d;  2KR3 A;  3M0Q A;  4EDU A;  1K8A D;  3ZBD A;  4DBQ A;  1BJK A;  1I0C A;  3CCJ Q;  2L3R A;  1HK9 A;  3MP1 A;  4QVC A;  3VS7 A;  3CCU B;  1VQP A;  4LBW A;  3E20 A;  4X7F A;  1NEG A;  4QFM A;  1G2B A;  4OMP A;  1E63 A;  2VZL A;  1MMG A;  3QDF A;  5A0G A;  1W70 A;  5M9O A;  2RC6 A;  1AEY A;  3CMA Q;  3HTR A;  3OB9 A;  3GNG A;  1E6G A;  1VYV A;  4II1 A;  2CDT A;  1SSF A;  2CZ1 B;  2P0K A;  1M8M A;  1QGY A;  1VQ5 B;  2V4D A;  2H3E B;  2C5B A;  2K5F A;  3GLX A;  4OVA A;  2CF4 A;  1UD4 A;  2M51 A;  4IIO A;  3CC4 T;  4UZF A;  2ZL7 A;  3OA6 A;  1YIT A;  4QKU A;  4MYT A;  3VV0 A;  1XFO A;  2CYZ B;  1VLO A;  1VQL T;  2E4H A;  4PLI A;  4ZN1 A;  3QFS A;  2RN8 A;  2QDL A;  4P26 A;  4C8Q E;  4JLI A;  2RJD A;  2XEX A;  1Q81 U;  1BPL A;  2XDB A;  1EP2 B;  4JS4 A;  2V1Q A;  3JCM W;  3WNB A;  4M7A B;  3CMM A;  1F60 A;  2LZJ A;  1YIJ B;  4XOT A;  2BUD A;  1X2K A;  2JS0 A;  3X28 B;  3A8G B;  2GPJ A;  1QH0 A;  2LC4 A;  2D9R A;  3RBB B;  1ZSZ A;  3EFO A;  3WVD B;  2LT1 A;  1NZ9 A;  1KK7 A;  4ZCL A;  3S3O A;  1N5Z A;  1YI2 Q;  4BB7 A;  3VO2 A;  1ZM2 A;  4EPC A;  3G4S B;  1R0B G;  2PVD B;  2PMD A;  3MEU A;  2HCK A;  5AYF A;  4FIB A;  4DQL A;  4F7U G;  1S72 A;  1G7R A;  2RNA A;  4Z4R A;  1TH7 A;  3CCL A;  3LYI A;  1VQN T;  4M7D B;  4M7D E;  1VQ8 T;  1QFZ A;  1VHO A;  4FM4 B;  4B9W A;  1SG5 A;  4J6X A;  1QWF A;  4M7D G;  4Z4T A;  3B78 A;  1GRI A;  4PC1 A;  1W87 A;  4J9C A;  2FPD A;  2V7Q A;  2B8A A;  4A63 B;  4BE1 A;  3FJ5 A;  3MJX A;  2V7V A;  4J9B A;  3U2Q A;  2AK5 A;  2X6X A;  1YJW A;  2V7X A;  2WZN A;  1GO2 A;  5H59 A;  2ESW A;  1YJ9 Q;  2W10 A;  2KGT A;  1KC8 D;  1D09 B;  4M7D A;  1RLP C;  1MAB A;  1AWJ A;  2YT6 A;  2IVW A;  1NDH A;  4RLZ A;  4OP0 A;  3UPU A;  3H41 A;  4C43 A;  1GCP A;  2PVG B;  1EFT A;  1NB0 A;  4BUG A;  1W2B B;  4Q7J B;  3PEN A;  1AWX A;  3M55 A;  4BY6 C;  4E6R A;  3ME9 A;  9ATC B;  3CC2 Q;  3CCM T;  2QTX A;  1SRM A;  4XD7 A;  2YLC A;  1TSF A;  4J6W A;  1KSW A;  4WZK A;  5KYN A;  4Z8A A;  5IHN A;  3J81 E;  4CRI A;  4RPD A;  2CZ6 B;  2GBQ A;  2DD5 A;  1YIT B;  1VQ6 Q;  1VQ4 T;  3OYI A;  1WIE A;  1FXX A;  2E70 A;  1FMV A;  2XIC A;  2RM4 A;  3OYH A;  1D1A A;  3NTK A;  2CKK A;  1VQ8 B;  4OPS A;  1C0M A;  3MPU B;  2QI2 A;  4M7A A;  4Y9U A;  2RQW A;  1Q86 C;  2DXC A;  3OS0 A;  1NE8 A;  2X6W A;  2M16 A;  1KQS P;  2AHO A;  1YJ9 T;  1EFC A;  4M75 G;  2BN4 A;  4ZTF A;  3E9F A;  3QZ5 B;  3WBK A;  4WZE A;  3W2E A;  3VU3 C;  1JRI A;  3OP1 A;  2WJY A;  3CXC B;  2DM1 A;  4M77 C;  3ZL7 C;  1U2R A;  2C0I A;  3B82 A;  4PNO A;  4RTV A;  4D8D A;  4J7I A;  4M78 A;  4F7U B;  1E64 A;  3LGL A;  1QCN A;  2OTJ Q;  4YAF A;  4RKU E;  2CS7 A;  2EJF A;  1N8R U;  2RO0 A;  3HFN A;  2JS2 A;  2ECZ A;  4X07 A;  4RJL A;  4BI8 B;  4C0G A;  3OYE A;  4AC9 A;  1SF9 A;  1AWW A;  4BE0 A;  1UHF A;  1E62 A;  1BIA A;  4Y9R A;  1E3Z A;  2M0O A;  5KCO A;  3GNF B;  2X53 S;  1VQ7 T;  2QA4 B;  5FLX E;  3CC2 A;  2YWE A;  2VKN A;  4J9H A;  3VO1 A;  3MHP A;  4C5H A;  3EG1 A;  4X05 A;  4J9G A;  3RER A;  4M77 A;  1YHQ Q;  4RTY A;  4XU2 A;  4X9D A;  5C6S A;  2VNJ A;  5GMK m;  3OZV A;  4C5I A;  5IK2 A;  4B4D A;  5FRO A;  3JCM h;  3PUN A;  3A1P A;  3PT9 A;  1R0C B;  3QUI A;  5GMK j;  4A4G A;  3SHW A;  4M7A G;  2C4T A;  2QTV A;  1I5O B;  2B7C A;  3CCE T;  3I55 A;  4XTY A;  1I8D A;  3CC7 Q;  4M75 E;  1N0U A;  2BGJ A;  3JCM J;  1WYX A;  2CGH A;  4RCB A;  3OKX A;  4ROX A;  1MMD A;  2V26 A;  1Q81 C;  2MWP A;  3MEW A;  3SD4 A;  3VS2 A;  1X43 A;  2LNH B;  2HSE B;  3THK A;  4HT9 A;  1K73 R;  3TRE A;  1R5N A;  4HE6 A;  4LUD A;  1A8P A;  1OYX A;  1U1S A;  1WXB A;  4BI3 A;  4ANJ A;  1JEG A;  2WSC E;  2OTL A;  2BM0 A;  3Q38 A;  3ZBT A;  4GLK A;  2NLU A;  5TR9 A;  1CKB A;  3H0F A;  3DKM A;  4XU0 A;  2DFU A;  1VQL Q;  4N4I A;  2D0N A;  3EHR A;  1UEC A;  4P6V F;  2PVO B;  2EYW A;  4JUV A;  3ZBU A;  1SSH A;  1PCX A;  3QYG B;  3EGD B;  3I55 T;  4E7S A;  2D8H A;  4XU1 A;  3WXM B;  2OJ2 A;  4EMK B;  2J6K A;  3CCV Q;  1RI0 A;  3CMA T;  2RI2 A;  5KE2 A;  2XNC A;  5FA6 A;  1UD8 A;  3UT1 A;  4G7W A;  5THX A;  2L3Q A;  2B86 A;  4LN2 A;  3CPW S;  1YIJ A;  2JOY A;  4G5G A;  4II2 A;  4P3I A;  1XQH A;  1M90 D;  2B5O A;  2A36 A;  1ZA2 B;  2OAU A;  3X24 B;  1WOS A;  1S1N A;  4M75 D;  1ZX6 A;  2E3H A;  2R57 A;  3A8I A;  4P2N A;  2CP2 A;  3NMZ C;  3ASQ A;  2DIQ A;  4PJO A;  3I56 Q;  2Z0W A;  4QUZ A;  1U06 A;  1TOV A;  2RF0 A;  1IGU A;  1WA7 A;  2ZL5 A;  4X7E A;  4M77 D;  4EMK A;  2YRD A;  4PC7 A;  1YHQ T;  2SEM A;  2XID A;  2QA4 A;  4LDW A;  4A4F A;  5GAO p;  3MET A;  2O9S A;  1AT1 B;  2QQR A;  4BDZ A;  4X1V A;  2D3N A;  4X06 A;  4YXW A;  1KIK A;  3ULR B;  2LJ0 A;  4TMZ A;  3REB B;  1UHC A;  4P22 A;  3CCR A;  1WSV A;  1Q7Y R;  2KXC A;  2Q6O A;  1GJR A;  1Q7Y U;  3I56 A;  1HD3 A;  4DOW A;  2DVJ A;  3A3B A;  3UF4 A;  2DTH A;  3V7R A;  2D74 A;  1VQ7 A;  4AMC A;  4NOY A;  3R6N A;  4P9S A;  4DBF A;  4XTV A;  4GY5 A;  2E12 A;  2FEI A;  3A3G A;  2YLB A;  4EIK A;  3RES A;  5IHK A;  1VYT A;  2HD0 A;  4DBR A;  1RAD B;  3GF5 A;  3GOX A;  2DZ9 A;  1PC0 A;  1DAR A;  4HIZ A;  2D8J A;  5GMK e;  5KSW B;  2RQV A;  2FVG A;  4QHY A;  2FG0 A;  2RD1 A;  3L1A A;  3QO3 A;  2WR8 A;  5L46 A;  1Y07 A;  2RI3 A;  4GLM A;  3CC7 T;  1J3T A;  1WHH A;  3CME Q;  1AOJ A;  1PJ7 A;  1RI9 A;  2Q6I A;  5IYW A;  4F16 A;  1QVG A;  1VQN A;  3FIF A;  3EAE A;  1N9R A;  4EMH A;  1VQ6 T;  4XKV A;  3BFM A;  2VGN A;  1YP5 A;  1HYO A;  3VUZ A;  3A8L B;  2FZK B;  2O2O A;  2BGI A;  1G7S A;  1MHN A;  3M54 A;  3BQJ A;  2C2W A;  5KYX A;  3SWN C;  3WND A;  2QGF B;  1Q82 U;  2DA9 A;  5GAN 3;  4RD1 A;  1YJN B;  3PIO A;  3CD6 B;  2O01 E;  4DNT B;  1ZBJ A;  5I21 A;  1YJW T;  3RMQ A;  2CRV A;  3R6O A;  1M1G A;  4RD4 A;  2HMA A;  2KVQ G;  1KK1 A;  3Q3A A;  3G71 A;  3NE5 B;  4HVW A;  1CNE A;  3GP8 A;  2MF2 A;  3EG9 B;  3VRZ A;  5CCA A;  4RG2 A;  2X9H A;  1ZLM A;  2J05 A;  2XI9 A;  4XN3 A;  3OFN A;  4OMF B;  4QVJ A;  5DS0 A;  4XK8 E;  2O88 A;  1E1R A;  5GMK l;  1VF7 A;  3BE3 A;  4C0D B;  1UGQ B;  1KFZ A;  1N05 A;  4M75 B;  2KQW A;  2XMF A;  1K0X A;  4KH1 B;  3OW7 A;  1F1B B;  1T6Z A;  4RDK A;  2RQT A;  2WSS A;  3CCQ B;  3BY1 A;  4X7D A;  1JO8 A;  2V31 A;  5A88 A;  1K4U S;  5CQX A;  5J35 A;  1JXO A;  2HQE A;  4FXU A;  1IO6 A;  2P0P A;  3LW5 E;  5D6W A;  2NV4 A;  2E64 A;  2BE7 D;  3ONY A;  1GR1 A;  5GJV B;  1Y57 A;  2QTL A;  2OK7 A;  1J9Z A;  2F5K A;  4A4H A;  2VBT A;  2J7K A;  4EMG A;  2KNB B;  4HE5 A;  1RAH B;  3S6W A;  5GAN 6;  4XL9 A;  5CAI A;  1EP3 B;  2JW4 A;  1I8F A;  4PJJ A;  1JXM A;  2A0F B;  2DY1 A;  4PJM A;  1VQK T;  3SEJ A;  2PUO B;  3M58 A;  1SHF A;  4FK8 A;  3WBJ A;  2CC2 A;  2GFU A;  3A8K A;  1XNI A;  4CC7 A;  5CDF A;  3M4Y A;  4AVZ A;  3J80 E;  3ZC3 A;  3L2W A;  1Q86 U;  1SHG A;  3CMA B;  1KQS A;  5GAM j;  1UDL A;  4OB3 B;  1G3W A;  4P3Y A;  4M77 G;  1M8V A;  5GAM h;  1VQ5 Q;  2PUK B;  2YUQ A;  2LVM A;  5EG2 A;  1WXT A;  2V8J A;  4JJC A;  2K7A A;  4BDY A;  4FT4 A;  4J9D A;  1WU8 A;  2ZZE A;  2CP5 A;  3W2G A;  1XJW B;  2LRQ A;  1WTH D;  3RUX A;  3QFT A;  2VXE A;  1TLL A;  1Q7Y C;  1OZ3 A;  1Y7X A;  1H8K A;  4M0L A;  3U6B A;  3BY7 A;  2KT8 A;  3QXE B;  1WI7 A;  5LJ5 g;  5GAN h;  1VQN Q;  2DOG A;  5GAN d;  4Q5W A;  2HAX A;  3CME A;  4UZE A;  4LD9 K;  5GAN g;  3SFM A;  4C92 G;  3A5Z B;  2A08 A;  5I2S A;  2OAW A;  1FX7 A;  2RJE A;  5GV7 A;  2EIX A;  3FJP A;  4OOV A;  2DJZ A;  4MML A;  3WXM A;  1AVZ C;  4C92 C;  3QBY A;  2DK3 A;  3U6K A;  3G71 T;  2EQI A;  1EZZ B;  2GGR A;  1Q82 D;  4BY6 B;  5GMK i;  4RM0 A;  3CCJ T;  1EXM A;  4CC4 B;  3CBP A;  3CXC S;  1Q86 R;  2WZP P;  3RY8 A;  2ZTN A;  4XOR A;  2RHI A;  3T51 B;  4C92 F;  1KZL A;  3CEY A;  4Y7C A;  1PNJ A;  2WSE E;  2FPF A;  2P4T A;  3QZ9 B;  2L2P A;  3RKX A;  3CCQ T;  3G6E T;  2V7W A;  2SRC A;  3VRY A;  2DL5 A;  2EGC A;  1FX0 A;  4XKW A;  2VBS A;  1OB5 A;  3A8O B;  2IPO B;  5GAO m;  1S72 B;  3JSC A;  3OY9 A;  3OMC A;  4P5N A;  2P3M A;  4WZT A;  1IGQ A;  3RKY A;  2YDL A;  2PE3 A;  5FRN A;  2X8K A;  1GVH A;  3JB9 D;  2QEX T;  1M2V B;  5FRM A;  4C8Q B;  4ACB A;  1M1F A;  1VYU A;  2E3I A;  1WP6 A;  1GCQ C;  1YJ9 B;  2F2W A;  5LJ3 h;  4C8Q G;  2DBK A;  2J06 A;  4PFO A;  1VQO T;  3NHN A;  2X51 A;  3W2H A;  1VQO B;  3QPH A;  2BZX A;  3CC2 B;  3ASS A;  1YX2 A;  2C06 A;  3M57 A;  1UJY A;  1KQ2 A;  2DRM A;  3CCR T;  1WHK A;  2ED0 A;  1BX0 A;  1FNC A;  3Q1J A;  1OV3 A;  2CT3 A;  4E7I A;  3FEO A;  2GF7 A;  2W6I A;  1NBM A;  1YIT Q;  2F69 A;  1WGS A;  1FDR A;  2ZPB B;  1VQ6 B;  1UGR B;  2A3L A;  2MYS A;  3WYA A;  3VS4 A;  4PAB A;  2YWW A;  1NPR A;  2LNV A;  5GAO l;  1B07 A;  2BV3 A;  2DF6 A;  1M90 U;  1COW A;  1O9S A;  3CC4 Q;  2BMW A;  2GRE A;  1I7P A;  3OBW A;  5LJ3 e;  3S3N A;  3TQ7 P;  1E43 A;  2JUF A;  3LLR A;  3OZU A;  1YIJ T;  5LJ3 g;  1PRM C;  2DXU A;  4PC3 A;  1I18 A;  1K9M D;  1X6B A;  2D3L A;  4P6Y A;  1D8T A;  4TMX A;  2L8D A;  4HKE A;  1KQS S;  4JRI A;  4M2L A;  1BI0 A;  1ZBX A;  3UAT A;  1QVG P;  1MND A;  2KI7 A;  1QUF A;  3OJW A;  4YAL A;  4XM3 A;  5GAN f;  3I35 A;  3G71 B;  3PA2 A;  5FWB A;  1NJI U;  3Q6Q A;  2F1M A;  4MZT A;  4OPV A;  1TTT A;  3CPF A;  4XU3 A;  2GQF A;  4RD3 A;  3CCE A;  3CCM B;  2VNK A;  1NLP C;  2V8I A;  1JA1 A;  4IKF A;  4RTX A;  1VQM T;  2Q6L A;  4YEJ A;  2PLF A;  2JJ9 A;  1M9S A;  4M75 A;  2X4Y A;  1YHQ B;  4KUD K;  2EQU A;  5CKD A;  1HSQ A;  2VBU A;  2MMP A;  5HZA A;  3GVL A;  3G6E B;  3G4S T;  3OSS C;  1Y96 B;  2BTT A;  2KXD A;  1M1K U;  2VWF A;  3LH0 A;  5LJ3 j;  4RTW A;  1OHH A;  3KEW A;  3RKW A;  1O75 A;  1YCY A;  4B48 A;  2EPD A;  2CZ7 B;  2DVE A;  2FVU A;  1TTH B;  4C0Z A;  5BSY A;  1NJI C;  3BH4 A;  1YJ9 A;  2GFA A;  2L3S A;  3CCE B;  3G7Z A;  4TVR A;  4M78 E;  2LTO A;  3OEE A;  5GV8 A;  3BCF A;  3QJY A;  4X8I A;  2P0Q A;  3VS0 A;  1E3X A;  5IYR A;  1Q95 G;  1PKT A;  3V7A A;  2EKH A;  2GTJ A;  1S0U A;  4OOX A;  3KXT A;  1K28 D;  3VNV A;  2D0Q B;  1JQQ A;  3FLG A;  4LXC A;  1QKX A;  3R6K A;  4DA4 A;  3CPW B;  2E5K A;  3ZUG A;  1V1C A;  3ASR A;  1C1A A;  2DLP A;  4FN5 A;  3CCL Q;  2KYM A;  1ZSG A;  1QGA A;  5J39 A;  3CCR Q;  4OMQ A;  4Z4Y A;  2E1B A;  5A8A A;  4N4G A;  2HL5 C;  2LQW A;  4J5Y A;  1F20 A;  2EQJ A;  2ZPH B;  2NUT A;  3EFR A;  1UGV A;  4PFZ A;  4B9X A;  1R8O B;  1LJO A;  1IHV A;  1ZA1 B;  4PL6 A;  1G7C A;  1ELO A;  2C77 A;  1M1K R;  1ZUK A;  4DBH A;  2BZ8 A;  3SWN B;  1NYG A;  2COW A;  4QQD A;  5TY0 A;  5GAN e;  1WPY A;  2EFG A;  4OB0 B;  3OW2 P;  5J3B A;  4F7U F;  3OS2 A;  2FO0 A;  4ELZ C;  2KY9 A;  1UD5 A;  2F1L A;  4PKC C;  4TMT A;  2DX1 A;  1T5E A;  1OB0 A;  2QE7 A;  2XKO C;  1X2Q A;  3A8H B;  2YUN A;  5CKH A;  2NWM A;  4XTZ A;  1BBZ A;  5FO1 A;  3I5S A;  3SWN A;  3HRS A;  5CKF A;  3VKI A;  4WCI A;  3MKD A;  5I22 A;  1QVF A;  5EC7 A;  2OBR A;  4II3 A;  4KKS A;  3TEE A;  1PKV A;  4C8Q D;  1TVC A;  2DYI A;  3PNW C;  2EAY A;  3NFC A;  2D9T A;  2LZ6 B;  1LNX A;  4FYY B;  4PJO B;  4RMO A;  4DEX A;  5GAO n;  4Y92 A;  4BD3 A;  1E7O A;  1JB9 A;  1Q81 R;  3PE0 A;  4FSX A;  2XZL A;  3J81 k;  2E6N A;  5IAY A;  1BIB A;  1Q86 D;  3EG2 A;  4JJN K;  4DEY A;  4XMY A;  4ASU A;  2DIL A;  1WLP B;  1BQE A;  2W6J A;  1HZE A;  2KBT A;  1I81 A;  4LBV A;  1AZG B;  1EX4 A;  5GAM f;  2HCJ B;  1KQS B;  3HFO A;  4XTX A;  1V5V A;  3CMA A;  1AZE A;  1H8E A;  1W34 A;  4HXJ A;  3FJO A;  2JN9 A;  2OX7 A;  1U1T A;  1NB9 A;  2I1L A;  2OTL B;  1X6O A;  3L2U A;  3P8D A;  4KKU A;  1UD6 A;  2ATC B;  3O5Z A;  2XZO A;  3G1J A;  1TXQ A;  2K5L A;  2R5A A;  4XAX B;  5LJ3 d;  1A0N B;  1WJQ A;  2LDM A;  2QDY B;  1BCO A;  2ZPG B;  3ASP A;  3CP2 A;  3V76 A;  2EYY A;  1B23 P;  3CCV A;  2VYT A;  2FRY A;  5KYY B;  2K9G A;  3P26 A;  3TCJ A;  4BE2 A;  4WTO B;  3NTI A;  2GJP A;  1KC8 C;  3JCM f;  4E47 A;  3MP6 A;  3RDV A;  2V8K A;  4OB1 B;  4QV2 A;  2YRV A;  4KT0 E;  2E5Q A;  3MMP A;  2X4W A;  4M7D C;  3L42 A;  1NG2 A;  5CKE A;  2VYQ A;  2YWF A;  1QP3 A;  2DL3 A;  2F5T X;  3SEM A;  1VQ5 T;  4KKT A;  4TMV A;  5FO0 A;  5JBQ A;  3OYG A;  3URG A;  4F7D A;  2X0K A;  1I5L A;  1B3Q A;  1SEM A;  1T0H A;  1RAG B;  2OTJ A;  3RIR A;  2XZP A;  4U9U A;  2G6F X;  3JCM P;  1I07 A;  2NUP B;  4QT7 A;  1M3B A;  3A8M B;  2CH4 A;  1OU8 A;  3F70 A;  2VV5 A;  3QFC A;  1QG0 A;  4C92 B;  2QEX Q;  2ZCF B;  4KH0 B;  2ZPI B;  2M5S A;  3ZEH A;  4ELY C;  3QG1 A;  3CCJ B;  3CP8 A;  1QMC A;  2K4Y A;  3R6J A;  2HZY A;  2Y4Y A;  3JB9 I;  5FU6 B;  2X6Y A;  2H8H A;  4OML A;  4FCY A;  3H0I A;  2JNG A;  2DL8 A;  5AT1 B;  1VQP T;  1OX8 A;  2CK3 A;  1KJW A;  4PJO G;  4O5V A;  1P92 A;  1CNF A;  5DN6 A;  1CSK A;  2IG0 A;  3CC4 A;  1VQ9 B;  3CCQ A;  4FW1 A;  2FHD A;  2HDN B;  5D6Y A;  4RD2 A;  5GAM e;  1RAE B;  4IUQ A;  2DPP B;  5GAN 2;  1N07 A;  4YAW A;  1D1N A;  1VHE A;  3Q6R A;  1OU9 A;  2O31 A;  2A37 A;  3D7S B;  3PTA A;  1W1F A;  4C0F A;  2YXY A;  5HK3 A;  3KBG A;  2YSQ A;  5CIU A;  2XDD A;  2C0O A;  1JA0 A;  4C8Q F;  2COZ A;  1UTI A;  1ZM9 A;  1N8R R;  1VQK Q;  2E6Z A;  4XON A;  1VQO A;  3CPX A;  4J9E A;  3CC7 A;  5CK9 A;  5TV2 A;  4A54 A;  3HKS A;  3EG3 A;  1VQ4 A;  1WXU A;  2KVO A;  1YJW Q;  1GBR A;  1KK3 A;  1K73 D;  2K2M A;  2LJ1 A;  2KRS A;  2QEX A;  4MZP A;  4R0K A;  5LJ5 e;  4P25 A;  2WSF E;  2R9V A;  5D7U A;  4WZL A;  4J9F A;  1NBE B;  5FNZ A;  1ABQ A;  2ZZG A;  5J3O A;  4KUI A;  4X0C A;  3OYF A;  4B44 A;  1H3H A;  1W2B A;  4R56 A;  1JJ2 A;  4G1B A;  4LC0 A;  1JBM A;  1WZO A;  2CSI A;  3EH2 A;  4RCY A;  4B3X A;  2KK4 A;  3CME T;  3CCL T;  1HA3 A;  2HDA A;  2EJG A;  3QWX X;  1W0K A;  5DY9 A;  2X4J A;  2KDS A;  3OJX A;  3LNN A;  2DD4 A;  2EKO A;  2WAC A;  2QA4 T;  2CT4 A;  4QW2 A;  3PFS A;  5C0M A;  3L2R A;  4DK1 A;  2LP5 A;  2YRC A;  3QFR A;  3H0H A;  3OMG A;  1N6A A;  2RJC A;  1NM7 A;  4D6W A;  3DDY A;  4LDY A;  1FND A;  2ZPE B;  4C0S A;  4ZGJ B;  2RJF A;  3VYG A;  2RHY A;  1DG1 G;  2P4R A;  3ZFJ A;  2X85 A;  3H9N A;  4AF7 A;  1IJE A;  4J6Y A;  3VUB A;  2KEA A;  2PQW A;  1PSE A;  3CCU Q;  2DXB A;  3E2U A;  2QMU A;  1MRZ A;  2GJR A;  1M1K D;  2ZPF B;  2QAZ A;  4CC3 A;  3JQP A;  3KL9 A;  2HKN A;  4OMO A;  4M77 E;  3OYJ A;  3W2F A;  4Z1M A;  1WOR A;  2C78 A;  1WX6 A;  2LCS A;  1S72 Q;  1D3B B;  5BSX A;  3CCS T;  2L0A A;  3JCM c;  1VUB A;  2K57 A;  3X26 B;  2BM1 A;  2DCU A;  1VQ7 B;  4L6V 5;  5HZB A;  3BY2 A;  4XTW A;  2CP3 A;  2EYQ A;  1WJR A;  3P8B B;  4ZN3 A;  2DER A;  4DK0 A;  2L89 A;  3A98 A;  3T9N A;  1DDI A;  1JJ2 S;  1G7T A;  4KRT A;  1KG1 A;  4XLA A;  1UEB A;  1TUC A;  5CVI A;  2ED1 A;  3REA B;  2VNH A;  3CRZ A;  5KYW B;  3T53 B;  4LDU A;  3AVX A;  1R5B A;  1D3B A;  4LUE A;  1BYM A;  3EGU A;  4OMN A;  5IHI A;  4QVD A;  3CCV T;  4OPO A;  1D1C A;  4N4H A;  1YIJ Q;  1OX9 A;  3DB3 A;  1Q81 D;  2ZBU A;  3TU4 K;  4MMK A;  1ZUN B;  3A8J A;  3ZPN A;  1QCF A;  2X35 A;  4XNF A;  1KHI A;  4GBQ A;  1VQP B;  2FZC B;  2GQV A;  2O4X A;  4QQG A;  3JCM g;  1FRN A;  4DNR B;  2HEQ A;  2OI3 A;  4XTU A;  2VNI A;  5DLQ E;  1X69 A;  1JU5 C;  3QDR B;  2XD0 A;  3I56 T;  4NBS A;  1SKQ A;  2FRW A;  2NUT B;  3OEH A;  1WHJ A;  4J9I A;  2EYX A;  2QQA A;  4C5G A;  2F2V A;  4KGZ B;  4MYU A;  1KD1 D;  4LD6 A;  1VQL A;  2KRO A;  4RCZ A;  4DQK A;  3BC9 A;  2DTO A;  4X34 A;  4BAC A;  3AVY A;  4N0A C;  3OYB A;  2X3U A;  2M9U A;  3L2Q A;  1JNY A;  3DLL A;  2JMA A;  3I5R A;  3INZ A;  3ASK A;  1H3Z A;  4B3G A;  3RMS A;  2LQN A;  2R5M A;  4O6J A;  3I55 Q;  1UMK A;  3MCA B;  4HVU A;  4A4E A;  4A53 A;  1WNL A;  1ZSZ B;  2FYK A;  3EFO B;  3MP8 A;  1S4M A;  1RAA B;  1PHT A;  3W2I A;  3CC7 B;  3LX7 A;  3DLM A;  2B7B A;  1BK2 A;  4YAO A;  2DEQ A;  4NCN A;  1M2V A;  2RB6 A;  1E79 A;  3VNU A;  3UDC A;  3OZW A;  1K9M C;  1YCS B;  5DLO A;  3OQ5 A;  1BB9 A;  1YHQ A;  2GK7 A;  2D1X A;  2ZZF A;  4ZCM A;  1W2B S;  4CC2 A;  3C95 A;  3L2Z A;  1K1Z A;  2JT4 A;  3G6E Q;  1M3A A;  3T56 B;  1YWO A;  4MDW A;  4QVZ A;  3SLD A;  1IHW A;  4HCZ A;  2OTJ T;  2DAQ A;  2K2V A;  4WWV A;  3QKJ A;  1IHM A;  1KC8 U;  5IXB A;  4UC4 A;  3A35 A;  3W5V A;  1K76 A;  3VR6 A;  1TU0 B;  2ROL A;  3O8V A;  4IIM A;  4IUT A;  5FIU A;  4TMW A;  4D8K A;  2JJ1 A;  3OPO A;  4K11 A;  1GBQ A;  1SKU B;  4FYX B;  3CCE Q;  3PMI A;  1VQ9 A;  3JB9 H;  3OW2 B;  2K3X A;  3EG9 A;  4B3F X;  3OBY A;  3CCS Q;  3UA7 A;  2J6F A;  1H85 A;  2M1H A;  2GQI A;  1RL2 A;  2DJQ A;  3CCV B;  1M30 A;  2ZGW A;  1IB8 A;  2RK2 A;  2JTM A;  2XHC A;  5LJ5 j;  1H8H A;  1YBY A;  1VQM A;  2HNI A;  1ZUY A;  3JCM X;  1XE1 A;  1OUL A;  3M0T A;  3CBM A;  4E7Z A;  4G6I A;  4IUU A;  4F7U E;  1WHG A;  4H9G A;  3FC3 A;  3WQZ A;  2XDP A;  4PJO F;  1RQP A;  1T3S A;  4N3N A;  2DET A;  1X27 A;  3OW2 A;  1BKB A;  2LQK A;  3AVT A;  5LJ5 f;  1K8A R;  1K9A A;  3D26 A;  1QVG B;  2OTJ B;  1CQX A;  2MOX A;  2X3X D;  4M7A F;  4CQJ A;  2DYB A;  2R6H A;  2QQ9 A;  3P27 A;  3FDR A;  1SM4 A;  5A89 A;  1RLQ C;  5IYN A;  2LX7 A;  2KYB A;  2I2L A;  3ZZ0 A;  4E0F A;  1KQ1 A;  3AHU A;  1D1B A;  2QA4 Q;  1EFU A;  4JDS A;  4ESR A;  5CR2 A;  1AHJ B;  2MCN A;  4IUP A;  4BPR A;  2WYR A;  2ZZD A;  4PC2 A;  4FU6 A;  3AVU A;  2OTL T;  1Q82 R;  3ZIA A;  2IIM A;  1E1Q A;  2AKK A;  3JCM V;  3AVW A;  1VJS A;  2DTI A;  4M4S A;  4JJD A;  3V8K A;  2C4U A;  3JCM b;  2QTZ A;  2AZS A;  5AN9 A;  1NYF A;  2EBP A;  5GAN 7;  2QQB A;  3CD6 A;  3MCA A;  1RAF B;  4R71 A;  4ZGD B;  2RI5 A;  1Y0R A;  4YAU A;  2BVN A;  2NUZ A;  2KAF A;  2MI6 A;  1MV0 B;  2E65 A;  1Z9Z A;  3GQB A;  4KGV B;  3HRU A;  4M75 C;  2GK6 A;  2VC8 A;  1NLO C;  3CC2 T;  2JM8 A;  2V1R A;  5GAN 8;  5HXB A;  1TWB A;  1MUZ A;  5KH6 A;  2RHU A;  1OGJ A;  2LCL A;  4ZGN B;  4J7F A;  4VUB A;  1QFJ A;  4XN0 A;  3VS1 A;  2GCX A;  8ATC B;  2K6D A;  1JJ2 P;  4OGE A;  4DOV A;  3AT1 B;  4PJN A;  2HSP A;  1G8X A;  1YJN T;  1QX4 A;  2RHZ A;  3OW2 S;  4LBY A;  1DJ7 B;  1QP2 A;  2FL7 A;  2Q6K A;  2QAS A;  2OTL Q;  3CCM A;  3JB9 F;  2XGJ A;  1YJN Q;  2WJV A;  1K8A C;  3OOC A;  3AVV A;  4ATO A;  1HVX A; 
#chains in the Genus database with same CATH homology
 3H9N A;  2DYI A;  3A1P A;  2QGG A;  2DOG A;  2F1L A;  1PM3 A;  3HTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...