2DYIA

Crystal structure of 16s ribosomal rna processing protein rimm from thermus thermophilus hb8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
162
structure length
162
Chain Sequence
b'MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 16S rRNA-processing protein rimM
molecule tags Ribosome
source organism Thermus thermophilus
publication title Crystal structure of 16S ribosomal RNA processing protein RimM from Thermus thermophilus HB8
rcsb
total genus 31
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2dyiA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2dyiA01
3HTRA 2DOGA 3H9NA 2DYIA 1PM3A 2F1LA 2QGGA 3A1PA
chains in the Genus database with same CATH superfamily
2AK5A 3HRTA 3QIIA 2HCJB 1VLYA 2L3RA 1SRLA 1ZUNB 3H6ZA 4Z4SA 2HDNB 1ZA2B 3DDYA 1I5OB 5ECAA 4O6JA 4QW2A 3GNGA 5KYNA 3M0QA 4C5HA 3PUNA 5FU7C 3OYLA 4FN5A 4LC0A 2K4YA 4HCKA 3PFSA 2CK3A 2RA2A 3MHPA 1GFDA 1JJ2P 1NB0A 2K57A 3RESA 1YIJT 3RKWA 1F20A 5DM7R 4E7ZA 2Y90A 1QFYA 4OP7A 4P6YA 2ZXIA 5IYQA 1QVGB 5CKDA 1WX6A 1K9MU 1YITT 4M77C 5GAOq 3S3NA 3QXEB 1RAHB 4QQGA 1Y0YA 3I55B 3GOXA 3CD6B 2BZXA 2DLPA 4LBYA 1FXXA 2OJ2A 4HVVA 5KW9A 4RDJA 4J6WA 3C4SA 1MNDA 1CKBA 4C0SA 1BBZA 4IURA 4OMQA 3WXMB 1UE9A 2CP2A 2NLUA 2ZPIB 3CCQA 1PKSA 2RHUA 4XMYA 1WDXA 1M1KR 3ASSA 4OGEA 1NZ9A 5LJ5h 5KYXA 3MKDA 2LT1A 2D74A 3EGXA 5I21A 3BY2A 2DOGA 2YUQA 5LJ5d 3OA6A 4GQNA 3W2IA 3EG9B 1BPLA 3QG1A 4A4KA 1VQMA 2HDAA 1IGQA 2LJ0A 5AN9A 1WJQA 3E1YE 4XLFA 3G71A 2JM9A 2PE3A 5DLQE 1WOSA 2R5AA 4Z8AA 1U1SA 2GQFA 4DNRB 1KSWA 4C92F 4RM0A 4JJCA 5GAOr 3OBYA 1LCKA 1H3HA 4PFZA 4PC3A 1RI0A 4QHYA 3U23A 2MYSA 3CCEA 2JJ9A 4BI3A 3Q39A 3UWNA 2EQIA 1AZEA 2YRVA 2OTJA 1OB2A 3AVXA 3CMMA 3H9NA 1JXOA 5DSZA 1VYUA 5FO1A 4XOPA 2BGJA 2OTLQ 2DTIA 3D7SB 2KYMA 2RK2A 1IREB 5GAMh 4AT1B 3AVUA 4PC7A 2GNCA 2AHOA 2WSCE 3BNWA 3SHWA 1G7SA 4L8JA 2BMWA 2HBPA 4LDYA 1NEGA 2LNHB 4AFUC 4PJOE 3LLRA 1G7CA 1PSFA 3CCJB 1KHIA 5KNLA 1Y7XA 2B86A 1PSEA 3REBB 3WNCA 2PQWA 1ZBXA 2K3YA 4B9XA 1XQBA 2DYIA 1QVFP 2O4XA 5F4MA 5FW9A 1OV3A 3ER0A 3OYCA 2BM0A 4TMWA 3VS7A 2F2XA 1UD3A 4JS4A 3WNDA 1W2BA 2QASA 1IGUA 4KBMB 2EBPA 1U2RA 2B8AA 3CCUQ 2VGMA 3PE0A 5HKCA 5LJ5j 4TT3A 4EMHA 1V5VA 4RJLA 2EJ9A 4PJLA 1N8RU 2X85A 3ASKA 1S72B 3TU4K 2DNUA 3GIBA 2B5OA 3GQBA 1ZX6A 2DRKA 2HQEA 1YI2Q 2E6ZA 4Z4TA 4XD7A 1QH0A 2LX9A 2EW3A 2C5BA 2C0TA 1OX8A 4ELYC 4PGOA 4GBQA 4JLGA 1SM4A 2CDTA 1TUGB 1K28D 2JIZA 1KD1D 2FG0A 4C92D 2ZZFA 3M54A 1ZQ1A 4FW2A 1ELOA 1N05A 1QGYA 2GQIA 1IB8A 5TY0A 1UGSB 4Y28E 1RI9A 1BB9A 1D1CA 3A8HB 2KVQG 2JXBA 2KDSA 3I56T 2RK1A 4K11A 1GJRA 1RUWA 2ABLA 2F4NA 5H59A 4HA8A 2M51A 3TSZA 1N08A 1KMHA 3DB4A 1IXDA 2M0OA 1BLIA 2QA4A 3EHQA 4C92G 3VRYA 4PC1A 1X6GA 2EJFA 1E64A 4RTYA 4C0FA 5I22A 3CPWP 7AT1B 1KC8R 4Z4RA 1VQ8T 1M1GA 3ZC3A 1YJNB 5IN1A 3NTHA 1WXUA 5IHNA 2QYZA 4QVDA 2J7KA 4DNTB 3ZPNA 1S72T 2FB7A 1OB5A 2BUDA 3VNVA 1Q9SA 5FU7B 4G5GA 1V76A 3R6JA 1N8RC 2DAQA 2E6NA 1J3TA 2XZOA 2XDDA 3THKA 3CPWA 3CCVQ 3V7SA 3CPFA 4OMNA 3ZUGA 4E7KA 3CMAA 1Q7YR 3KXTA 2FVUA 2PNIA 5A0GA 2RQRA 3PIPA 4O5VA 1AWXA 2WSEE 1IJFA 4IW3B 4ACAA 4Q5WA 4EMKB 1HA3A 2C5HA 2RQWA 1W35A 4J9DA 5HXBA 1VQ7T 2GQVA 3VJPA 5KCHA 4BUGA 4PLIA 4RUGA 2DX1A 4M7DG 2SEMA 4X9DA 1VUBA 4FK8A 6AT1B 4BPRA 2Z0WA 2VGNA 1QMCA 3P8HA 4RPDA 1FDRA 4XU0A 1X6BA 4RD4A 1VQPT 1MMGA 1AWWA 3V8KA 2ZPGB 4JMQA 1XNIA 3CCRT 1ZM3A 2OAUA 2EPDA 3O5ZA 1UD4A 4BY6C 4YAOA 2P0QA 2LQNA 3E20A 2P3MA 3OOCA 4JRPA 4NL3A 5CCAA 3JB9D 4RCYA 3MEVA 2RI5A 2VBUA 4XU3A 1U3OA 4RD2A 1T3LA 2DIQA 3BC9A 4TMXA 3CC4Q 3V7CA 2RC6A 3SLDA 2E5KA 1M1FA 3SFMA 1YHQA 2ED1A 2F2VA 4BD3A 4RCZA 3NTIA 3HFOA 2QEXT 1DG1G 4YAUA 1UMKA 3JCMc 4XL9A 4OF1A 1D1AA 2JS2A 1PD1A 3CCRB 1I7PA 4J9GA 1G3SA 1ZUKA 4F7DA 2DL7A 5IXFA 5J39A 4ANJA 3I55Q 2QG9B 4QVZA 3RKXA 5CKBA 1I8FA 2AT1B 4HVUA 3CCET 2JM8A 3OYYA 5F4JA 3M56A 1B23P 3H0FA 3M55A 1W2BP 3CPXA 4XTYA 1WHKA 2HLDA 1W70A 2XICA 4KKUA 4C0DC 2F69A 3CCSQ 1YJWQ 4BACA 4XTXA 4QV2A 3ULRB 2V7QA 3OMCA 5HZBA 5FA6A 3BCFA 2X6XA 5GAMg 1IHVA 3MCAB 5FRNA 1N9SA 1PHTA 1OOTA 1M1KD 3GP8A 1VQ4Q 3GNFB 1W2BB 1JO8A 2RD1A 3JAME 1AOJA 2O31A 3OP1A 1WJRA 1YNZA 2EJGA 4NL2A 3UATA 4OB1B 3C12A 1BCMA 1XQHA 2RQVA 2RO0A 4WQMA 2PZ1A 1UGVA 1VQOQ 2EQKA 5GANf 1VQ6Q 2LX7A 3ZZTA 3G7ZA 4XQFA 1H8HA 4MZMA 2LCLA 1K9MC 5FU6B 1JJ2S 3PVDA 1H42A 5GAOm 2OX7A 1RLQC 2OTJT 4IUPA 3QUIA 1QUEA 2JJ1A 2Q6LA 3QYGB 2YLBA 5GANg 1BX0A 1S4MA 1VQNA 4JJBA 2G6FX 3QZ5B 2COZA 4Z88A 2KROA 5AT1B 2OAWA 3VS4A 2K2VA 2P84A 2QTZA 4OB3B 1K0XA 3I56B 4RTZA 2L3SA 4PABA 4ZTJA 5CDFA 1GR1A 1M4ZA 2BE7D 3OYJA 2MOXA 2CZ6B 2V8JA 5LJ5e 1E3ZA 3OZUA 3W2EA 1VQLT 2KRMA 5BSXA 4LDWA 3CD6T 1UUEA 4XNFA 1TUCA 3BCDA 4OOSA 2XNJA 3KL9A 1QCFA 5J26A 1I5LA 4II3A 3A8JA 1M2VB 2CZ7B 2AZSA 2DEQA 4R55A 2XKOC 4M77D 2EGCA 1Y0MA 4JUVA 2GBQA 2FZCB 4M75B 4XN0A 4C0ZA 4F16A 1NYGA 4A4GA 4C92C 2GK6A 3G71B 4IUQA 1HVXA 1K9MR 1G7RA 1E1QA 1JQQA 4UZFA 1Z9ZA 1GRIA 1Q86U 1T0JA 1XOVA 1S1NA 2CSQA 4BY6B 4RTTA 2HEQA 2XU8A 1QVGS 2E41A 3AHUA 3EG3A 3PIOA 2CT4A 1RAIB 2KT1A 1WHGA 1E63A 3CMAB 1I18A 2BZ8A 2DETA 1WZOA 2NUPB 1M90U 2PLFA 2HL5C 5TRDA 3B78A 1LNXA 2LVMA 1VA7A 3WVEB 1SSFA 1VQPB 1WJSA 2MF2A 1NBEB 4DA4A 2AKLA 2EYQA 2K5LA 3L2ZA 2VNIA 4PJNA 2GPJA 1GAWA 1EFNA 1SKUB 1QQJA 5FRMA 5KYYA 1HZEA 2QGGA 3CCLQ 5CAIA 1BYMA 3WNBA 1KD1R 2D8HA 3MP6A 2RJDA 3EAEA 1VHEA 1N27A 5GAN2 2E3HA 1WP6A 2VYQA 4WZLA 2QA4B 1QKWA 1I0CA 1TUIA 2GCXA 1RAFB 2Q6IA 1Q82C 3JCMh 4DK1A 1B34A 3OYMA 4QQ6A 2L3QA 3Q3AA 1X6OA 2L0AA 9ATCB 2J6OA 4J83A 2FL7A 4OP0A 1VQNT 2M9UA 2G3RA 3PNWC 3VS1A 3CCEQ 1H8EA 3CMEQ 4RTXA 2V1QA 2VXEA 3OSSC 5A8AA 1Z9QA 4MZPA 3M53A 1AIPA 3G05A 3T9NA 5LJ3e 3A3BA 2QA4T 1Q7YC 4NCNA 3EG0A 3T51B 5LJ5f 3FJOA 3OYKA 3CCUT 1I1JA 5IXBA 1S72A 3B82A 4J6XA 1Q81D 4M7DF 2QQRA 2RQTA 3E19A 4M78D 1QVFB 1KQ1A 3FJ5A 1QGAA 3QFCA 4B9WA 5CKFA 1C1AA 2E1RA 3WY9A 2RJFA 3JCMX 2EYXA 2VNHA 1G8XA 5TR9A 2FPDA 4M78F 4PJOF 3SEMA 2QN6A 5F4OA 2O4XB 4B3XA 4ESRA 3OW2A 1Y57A 4WWVA 1W1FA 4J6YA 1M30A 1Q81R 1QKXA 3CCJA 2X51A 4P3YA 4AG2C 1CNFA 3GVJA 5B6IA 2WJVA 3JB9F 5BSYA 2CS7A 1MHNA 1PKTA 4N4IA 2J06A 3HKSA 4M75A 3VO2A 5L46A 2DXCA 1YITQ 3HFNA 5C0MA 5IYPA 1TG0A 4OMPA 4CQJA 2VVKA 4OVAA 4BDZA 3CD6Q 2RMOA 2XZLA 1YHQT 3CCLA 1W2BS 2DA9A 3SWNA 2KVOA 1M5Q1 4Q7JB 2D9RA 1WXTA 3OYAA 3OS5A 1YJNA 3PMIA 1SKQA 2YUOA 3EFOA 1PRMC 3VUZA 4IKFA 2YWEA 3MPUB 3E9GA 1M27C 2QQBA 1YJNT 1VQKQ 1X01A 3M0RA 1BU1A 2A3LA 1PJ6A 4B48A 4UAJA 5A0LA 4QVCA 1CSKA 4F04B 2DVJA 1BX1A 2F1MA 2PVDB 1N0VC 4EPCA 1WIEA 2O2OA 4L6V5 5GANj 2WR8A 2DPPB 1E3XA 2YUPA 5EG2A 3AT1B 2VXFA 3CMEA 3LNNA 2CH4W 2KRSA 3CC4B 4PKCC 2VV5A 5DS0A 3EHRA 3ZL7C 3F70A 3AVVA 4DQKA 4M7AF 4FIBA 4X7DA 1UD6A 5GMKi 4M1KA 2EIXA 2Z6BD 3CCMA 3SEJA 4IUUA 4C92B 2ZZQA 3VMFA 4PJJA 2DL8A 4KT0E 1H3ZA 4E7IA 5L23A 3CMAQ 2K3XA 3M4GA 1FNMA 3FB9A 2R57A 1SG5A 4KUDK 3IQLA 3OE7A 3UA6A 4NBSA 2YHTA 4AF6A 3CBMA 3WXMA 5FNZA 5I2SA 3A8LB 1D09B 3KUFA 4TKOB 3BH4A 3ZZ0A 4Z02A 1YLOA 3CBOA 2K5IA 3JQPA 4WZKA 3FKSA 3A98A 1GBRA 4M7AA 3JCMV 1TSFA 5H5JA 1AMOA 3G4SQ 1RACB 1TH7A 2P4RA 3CCMQ 4ZV4A 2XGJA 1Q86D 1ZSZC 3EG2A 4YELA 3GLXA 4XM3A 3SKBA 3QSYA 3VS0A 2RHYA 3MEAA 2DD5A 3CCQT 3OW2S 1K73R 3HPWA 1I8DA 3SJPA 3JB9J 3FLGA 4PJOG 3CCJQ 2ECZA 1SPKA 4P1VA 2E1BA 1LJOA 2C06A 2V1RA 4J9EA 1K73D 4FT4A 3M4YA 3QFSA 1Q82R 2X4YA 1K9AA 2OTJB 3HSBA 3A3GA 1ZSZA 2V26A 1TU0B 4KGXB 3R6NA 4M7DB 2D8JA 1M3BA 3PVQA 3E2UA 3CCEB 4PC6A 4M0LA 2HSEB 2FO0A 2LDMA 1T0HA 1D3BB 1WGSA 5AYFA 1M1KU 5LJ3h 2NUTA 1JRIA 3H8ZA 1QVPA 1WYXA 4JRQA 3VKIA 1VHOA 4CI0C 4RTVA 3GBQA 2EYZA 2ZL6A 1LOJA 3JCMf 1VQ9T 2R58A 4XTZA 2HKNA 1P4MA 3QJ6A 1WSVA 1VQKA 3JQRA 2V31A 2RI3A 3OS2A 4F7UA 4XU1A 2FEIA 1AEYA 2GJRA 3L42A 3WBJA 2GK7A 1ZA1B 3LO8A 1D0YA 1RAAB 1UD8A 4P26A 4EMKA 4QQDA 4PJOA 4OPVA 4M7DE 4M78G 3ASRA 1O9SA 2A28A 3GVKA 3PVLA 2DL5A 4XLCA 2YLCA 4ZGJB 1YFNA 4JRKA 1W0KA 2IVWA 2ZPBB 1YIJQ 2BSAA 3BDUA 3MP1A 2LCSA 3VR6A 3CPWB 1H641 1YHQQ 1VIFA 2JMAA 3R6KA 1QLYA 4R56A 1HXDA 3NGPA 1E1RA 2KGTA 1YX2A 2KK4A 1KRHA 3GIRA 1VQ5Q 1V29B 4Y91A 1YIJA 1KK2A 5IHKA 3DKMA 1N07A 3S3MA 3QO3A 3I55A 2KAFA 3I5SA 3LX7A 4FW1A 4E7LA 1M3AA 3KBGA 1NB9A 1E7OA 1GXIE 1VQ5A 1NJID 2DZ9A 3M0PA 1QVGA 4N4GA 3G6EQ 2DEUA 2CZ0B 2DBKA 3LH0A 2ZL7A 2OTLA 2JOYA 1W9XA 2FVGA 2C4UA 4OB2B 1X2QA 4JJNK 4RCCA 4Y9RA 4RD0A 4Y92A 2K2MA 1N5ZA 3OPOA 1QW1A 2O9SA 4Z4VA 1GL5A 4LBWA 5IK2A 3CBPA 3L2WA 4G1BA 3G4SA 3SLNA 2QMUA 1T5EA 4QKUA 4HCZA 3EG1A 4YHBA 2W10A 4E7JA 2KT8A 2X3WD 1WU8A 2RB6A 1Q86R 4LUDA 2OYNA 4X05A 4RKUE 4XAXB 4MMLA 2RHXA 3CW2A 3J81k 3OW2P 4P25A 1NYFA 2BN4A 2BPOA 3MJXA 5IYNA 2RNAA 2CP7A 2D3LA 1RQRA 4PJOC 4M78C 3TSWA 4J9CA 1Q81C 1EP1B 2DD4A 1YI2T 1WORA 2YSQA 1UD2A 4IIMA 3G71T 3CP8A 1N6AA 1KK3A 4IUVA 3C0CA 4M7DC 3OS1A 1NRKA 5GANe 4QUZA 2IG0A 1FMKA 2NV4A 2XNCA 3OFNA 3OW7A 5I11A 1FRQA 2QTXA 1X27A 2DF6A 2OTLT 1ARKA 2DY1A 4CC7A 2HAXA 1BMFA 3G1JA 2V7WA 3A8MB 2FRWA 3JB9G 5CQYA 3CCUB 2ZPHB 4Z89A 3RNJA 1W4SA 1YJ9B 3ISXA 1JBMA 5GAMj 3ME9A 1ZUUA 1TTTA 3JCMb 1ZSZB 1MNEA 1R0BG 2DJZA 3A5ZB 2E70A 1SEMA 2D1XA 1KQ2A 2DTHA 2EKOA 2GFAA 2MMPA 3W2GA 4PNOA 4JZ4A 5CVIA 3CCSA 1QCNA 1YJWA 5IYWA 1OZ3A 1XE1A 4CC3A 1JB0E 4BE0A 1I81A 2DE0X 4AMCA 3JB9I 4C8QC 4XLHA 1IHWA 1EWYA 3H0HA 1QP3A 2K5FA 5GMKh 1MMAA 1AZGB 1C0MA 2X4XA 3CCVA 1COWA 4XU2A 1VQ6T 4C5EA 2WSSA 1W6XA 1JB9A 2VB6A 2Y4YA 2LQ8A 4II1A 4KGZB 1VQ9B 3EG9A 4YALA 1SRMA 5CIUA 1VJSA 1JNYA 1KC8U 2HSPA 1UD5A 4LDXA 2DTOA 2DIEA 1M2OA 3I35A 2P4TA 3CC2T 2YRCA 4C5IA 2OBSA 3OYDA 4XLAA 3P8DA 3RMSA 2QI2A 5KYWA 4XOTA 1H8KA 5KYXB 3KEWA 3NE5B 3OEEA 4Z4ZA 2LJ1A 2JTFA 3I56Q 4M77G 2MK5A 1RAGB 1Y96B 1VQLB 2EFGA 4ZNXA 1FYNA 4VUBA 1G3WA 2JNGA 5IH2A 1G2BA 1X43A 2CP5A 2O9VA 2KSSA 1VQMQ 1HK9A 1VIEA 3HAGA 2OBTA 3ZBUA 3L2QA 2ZZEA 1EZZB 3EGDA 4KULA 3G4SB 2X53S 5KSWB 2K9GA 2X4JA 1K8AU 4EDUA 2ZL5A 1WPCA 2DYBA 1GCQC 4M7DD 2Y4XA 1T6XA 4XTWA 1VQ7A 3X24B 1ZM9A 2M5SA 2EGEA 2DIGA 1SKYB 2QAZA 1OB0A 3Q6QA 1SHGA 2V8IA 4EMGA 2QE7A 1N8RD 1E62A 4HKEA 5GAN3 1IRXA 2XEXA 4M77F 2BKDN 3WBKA 1OPLA 2LRQA 1NLOC 4LXCA 4XTUA 1TWBA 3ONUA 1EIFA 2D0NA 3EFOB 1GCQA 4M77B 1EFTA 1ZHIA 3CCSB 1YJWB 3MHXA 5CKEA 1F60A 3SWNB 3CCLB 1QP2A 1W34A 1IJEA 2HCKA 3META 1YITA 4X06A 2ESWA 4B43A 1VQ8A 3FPKA 1M90D 4X8IA 3I9QA 1OGJA 3MEUA 4OMFB 4HE5A 2XDPA 2JS0A 3CXCB 3VUBA 1H85A 5CKHA 1V1CA 4M75F 1VQPQ 3QHSA 3V76A 4XONA 5HZAA 3CCRQ 1M90R 4J9BA 5A0DA 4QVAA 2VUBA 1WLPB 4OPOA 1NJIC 2QTLA 2PVGB 2DCUA 1KD1C 1PJ7A 4LE9A 4F7UB 3QWXX 2DM1A 3OW2B 4X7CA 4Z4UA 2QDXA 4M7AE 1NEBA 2K79A 4FSSA 4V2SA 2CP3A 2CSIA 1KK7A 1WQ7A 2KXCA 2QDYB 4DOVA 3CCQQ 1M8VA 4NOYA 2E12A 3I55T 1OEBA 1FWZA 2XI9A 4J7FA 4XR6A 3RIRA 4AFZC 1Y71A 4FU6A 4JZ3A 3X26B 2ZPEB 1T6YA 3NMZC 2M1HA 4XTVA 4BI8B 2RJEA 2LZ6B 1YJ9Q 3A8IA 1WPYA 3E9FA 3A8KA 3BY7A 2EYYA 1B7TA 5E6TA 3N5BB 2V7VA 2MAMA 4C92E 4DQLA 8ATCB 2R9VA 4KGVB 2KNBB 2WYRA 4M77A 1A8PA 4N3GA 2ED0A 1S72Q 4E47A 1R5OA 1PD0A 5I2MA 2FX3A 1VQ4T 1XJWB 2XHCA 2A0FB 4P2NA 1BKBA 4TVRA 5EC7A 2COWA 2KRNA 3FC3A 3OAAA 2FRYA 4K1XA 1AD5A 3OQ5A 4HVWA 4FWTA 4JS5A 3W2FA 4AVZA 3OKXA 3PT9A 3JCMd 4R71A 1OI1A 3PENA 4M75D 5KYYB 4FCYA 4GLMA 4AFSC 3BE3A 4TSFA 2XOKA 4P5NA 3EGDB 4G7WA 4IUTA 5FIUA 2L5QA 3L2RA 2KEAA 4Z4YA 5GAMe 5GAN6 1K73C 1UGRB 4C5GA 4WCIA 2CT3A 3OMGA 4C0GA 1MMDA 1W0JA 2YUNA 1Y96A 1QX4A 3INZA 1WOOA 2RF0A 2XNDA 1PWTA 1Y07A 3P27A 2R6HA 3AGPA 1NG2A 1VQLQ 2CYZB 1NBMA 4PJMA 1MV3A 4QFMA 1DDIA 1YWPA 2O01E 3SDZA 1PKVA 4PJOB 2J05A 4DBHA 3C95A 4PJOD 4X7EA 5CR2A 5HK3A 1VYTA 2L3PA 4P6VF 2WACA 1YJNQ 2A7YA 3QFRA 1VQ8Q 1WTHD 2JW4A 4OB0B 3R6OA 1H92A 1BJKA 3JQQA 2ZXHA 2KBTA 4X34A 4KH1B 4M7AG 3RR6A 5FLXE 1NJIU 4ZCIA 1VQKB 1V0EA 1UDLA 2D0QB 5CK9A 2E5QA 1BQEA 2WZPP 3MP8A 1K8AR 1K76A 3QWYA 1GBQA 4N4HA 4OMLA 5A2QE 4C8QF 4HT9A 2BGIA 3CCVB 3SWNC 2D3NA 5D6XA 4HXJA 1SSHA 2CRVA 4YTLA 3W5HA 3ZFJA 4N0AC 3I5RA 5FU6C 1OHHA 4E0FA 1IZ6A 2W0ZA 3FJPA 3M5AA 1N0UA 1QFZA 3P26A 1GVHA 3CTAA 3CC2A 3LWHA 1Q95G 1M3CA 1GFCA 3S6WA 3AGQA 1YJ9A 3QFTA 1JJ2B 3CRZA 4M77E 4Y9UA 3VYGA 3RBBB 2DXBA 2QQ9A 2QK0A 3M57A 2D9TA 4OMOA 4OPSA 3OY9A 2A08A 1E43A 1QVGP 2DK3A 1WHHA 1R8OB 1PC0A 2F1LA 4J9FA 1VQ6A 3OBWA 2KI7A 3Q6RA 1ACMB 1K8AC 1OYXA 1PRLC 3CCMT 3ZZUA 4X9CA 1TTHB 1WDTA 3JU4A 2BVNA 4XORA 3CXCP 3URGA 4LD6A 1R5BA 3G6EB 3DLLA 4C8QD 1WHLA 2W6IA 4MDXA 1UFFA 1VQNQ 1IO6A 4AG1C 4FYVB 2CF4A 3O8VA 2FZGB 3CMET 1J9ZA 2OI3A 3FEOA 2H8HA 5HK0A 1M9SA 1XFOA 2EGAA 3MMPA 4N0AA 2H3EB 4D8DA 4A54A 5HKKA 3G6EA 1K73U 1PG5B 5LJ3d 1TOVA 2CZ1B 3PGGA 1KHCA 3LWIA 2B7BA 2ZITA 1DARA 1KC8C 2X4WA 5IT9E 2C0IA 2C78A 4PK4A 3ONYA 4PAAA 2FPFA 5LJ3j 1AWOA 1VYVA 2JMCA 4C43A 3GVLA 3TVTA 2VNJA 3CMEB 4YEJA 1B07A 2MWPA 3M59A 4YAFA 1QWFA 5KYUB 2OTLB 1I4K1 1FNDA 1FNCA 4FXUA 2HQHA 3L2VA 4ROXA 1YHQB 2ZZGA 2HL3A 4F7UG 2A36A 2Q6KA 3CC2Q 1Q7YD 5JBQA 4MYUA 5IHIA 1UGQB 2KQWA 2ROTA 3ZBTA 3CC7B 5HY6A 4GY5A 1T6ZA 1TLLA 2QDLA 3RERA 4M75G 5LJ3g 3GPLA 1OPKA 5A88A 4ZGDB 2VJIA 4KRTA 2NUZA 2XMFA 4G6IA 1VQMT 1KQSB 2NYSA 4ME7A 3QSUA 3EH1A 1ZM2A 3AVWA 1HYOA 3HL8A 1NDHA 2GREA 1WSRA 2EFIA 3E1SA 1UJ0A 1MMNA 3HP9A 3M0TA 4C8QA 3JCMQ 3V7AA 2YT6A 3VS6A 2HKQB 1K4US 2X8KA 2PUOB 1KD1U 4RG2A 4C8QB 3EGUA 3FPPA 4RD6A 2B7CA 1N9RA 4RDLA 2JT4A 2X3UA 1D8TA 4II2A 1KQSA 2HNIA 1DDGA 1YI2B 2LP5A 4ELZC 1VQ4A 3CCVT 4FT2A 4DBRA 5GAOp 1QVFA 1M2VA 4BDYA 3ES9A 2NUTB 3CC7Q 4LD9K 2CKKA 4E7HA 1D3BA 1O75A 4B44A 1QVFS 3RDVA 2M02A 2RPNA 3A8GB 3JRZA 2YWFA 3DB3A 4M7DA 4B3FX 2VASA 4OGCA 4M78B 1CNEA 4AF7A 2V7UA 4DOWA 2DERA 2E10A 3QPHA 1E79A 4E6RA 3M0UA 2LQKA 3V8JA 1VLOA 1KJZA 3V7RA 1VQNB 1JU5C 1AT1B 4ATOA 3OEHA 4ZN3A 2QEXA 3HTRA 2HD0A 2QEXB 1YP5A 4OOVA 1B2RA 1JEGA 2DFUA 2QXFA 3NHNA 4HIZA 3H41A 4M7AB 2IPOB 1UHFA 2Q6OA 4XN3A 4BB7A 1PJ5A 4M78A 1G5VA 5LJ5g 2RQUA 3PUMA 4EMKC 4MZTA 3BDLA 5GAMd 2ZCFB 2E1HA 1VQPA 1OU9A 2JVVA 5DLOA 2EQJA 3B8HA 4Z1MA 5GAMf 1K1ZA 4TMVA 5GJVB 1B3QA 1WA7A 1W87A 3HRSA 3J7AF 1VQ4B 4M75E 2HMAA 3U2QA 1I07A 2EVRA 1NPPA 3L1AA 1G3YA 2X35A 1FX7A 4C92A 1NM7A 1WFWA 4LBZA 3UA7A 3CCMB 4M7AD 1K9MD 1EX4A 2GJKA 2P0PA 1F1BB 3OYHA 2CP6A 2BE9B 4XK8E 4AC9A 1VQ6B 3JV3A 1M8MA 1D0XA 4MYTA 2MPXC 2OK7A 1WI7A 3BW1A 1Y0RA 5GANd 1FX0A 2ROLA 4FYWB 1EXMA 3EH2A 3AVYA 2BM1A 5LL6S 3RMQA 2FPEA 1EP2B 1JJ2A 3Q38A 1M1KC 1VF7A 1MGQA 5HCKA 3CESA 4M75C 2C4TA 5GV8A 1OGIA 1U5SA 3DLMA 3CC2B 2AZVA 1KC8D 2DKGA 5M9OA 4RG8A 1D1BA 2YWWA 1UJYA 3VS2A 3GF5A 2DL3A 5FROA 1ABOA 2X0KA 2GF7A 4ZGNB 2CBXA 1A0NB 2P0KA 4L5GA 1PM3A 1RAEB 2MCNA 1VQ7Q 2XDBA 1TUDA 4QT7A 1ZBJA 2GTJA 4DBQA 5GMKl 2EIFA 4XQ3A 3I56A 4P12A 5J35A 3FDRA 2HZYA 2KR3A 1VQ5T 4A63B 5A89A 1DJ7B 2YRDA 2JDIA 3WQZA 1UG1A 1VQMB 5EMNA 4PLLA 2JN9A 2RHIA 3EFSA 3OSVA 3WVDB 3D26A 3QJYA 3LQEA 1K8AD 2OK8A 5GMKe 1KK0A 3OJXA 1KTVA 2XD0A 3QDRB 1FNBA 2LQWA 3QZ9B 4WZEA 3OZVA 1TS9A 4X1VA 1VQKT 2KXDA 4J9HA 1Q81U 4A4EA 4A53A 3CC7T 3JB9H 1XB2A 2DZCA 3JCMP 4M78E 4M2LA 1LPLA 3KFVA 1U8RA 4XKWA 4BI4A 1X2KA 2YDLA 3LYIA 3OYIA 2VKNA 3OYGA 3TQ7P 1QUFA 3PMTA 2J7IA 2GFUA 4OMMA 1HD3A 3CD6A 4WF2A 2CREA 4P9SA 2YWHA 2CC2A 4C0DB 4TMTA 3W2HA 2HQXA 3AVTA 3CCST 1YJWT 1AWJA 3JSCA 1MV0B 1YCSB 2V7XA 3QDFA 3H0IA 1BI0A 4DBFA 3LH5A 4A4FA 3QBYA 1GAQA 2XK0A 4CC4B 4LN2A 4ZGEB 4M4ZA 3CCRA 1UECA 1NE8A 1BIAA 4U9UA 1B34B 2K6DA 4NS5A 4HCBA 5GV7A 1WNLA 4FYYB 3LW5E 1TVCA 3G71Q 3RUXA 1U06A 1VQOT 1X69A 2EWNA 4P3IA 5GMKm 4MMKA 3CC4T 2VC8A 3OZWA 2WPDA 3CPWS 2V8KA 3I1FA 1U1TA 4LDUA 3FIFA 3CCUA 1D2EA 1UEBA 2LMJA 2RHZA 1IB0A 3BFMA 3HHTB 2DILA 3PA1A 1PCXA 2FHDA 2NUPA 3OS0A 1YI2A 2OTJQ 5D6WA 4HCCA 3H94A 2PTKA 2X6WA 4XKVA 2COYA 2AIRB 1R77A 2GGRA 4PL6A 3VV0A 1G7TA 2BF4A 4F7UF 3U6BA 2FZKB 2LCCA 1NLPC 5LJ3f 3ZBDA 2L89A 2IIMA 1RQPA 4KH0B 4KKTA 5FL7A 3A1PA 1QGZA 1BI3A 3JCMW 1KJWA 4JDSA 4Y7CA 1BK2A 3NPFA 3TREA 4J5YA 3OYNA 2C2WA 2VWFA 3G6ET 4DEYA 5IAYA 2OBRA 3A8OB 4WTOB 2PIAA 3TEEA 2C0OA 2RJCA 4X0CA 1ZSGA 2XZPA 3CXCA 1VQOB 3VU3C 5J3BA 1N8RR 4KUIA 2YWGA 2ZBVA 4PC2A 1WXBA 2A37A 4YAWA 4YXWA 3W5UA 2W6JA 4RDKA 2EQUA 2RC5A 2LTOA 1ABQA 2CUBA 3M58A 1KIKA 4A4HA 3CC7A 3CB4A 3V8LA 2JTMA 1TXQA 3NTKA 3CXCS 2DMOA 1RADB 4R0KA 3MO8A 1SF9A 3OYBA 2ZBUA 3LQ6A 2VBVA 3WYAA 4B3GA 2ATCB 1HSQA 3MEWA 3LGFA 2ENMA 2H3JA 3TCJA 3OJWA 4JRIA 1QFJA 4J0QA 3ZEHA 4ZN1A 2ZTNA 5KYUA 2LJ3A 3VS3A 2LNVA 4FYXB 1K0SA 3VS5A 1VQ5B 1E6GA 2KY9A 1S0UA 3ASPA 1Q82U 2JTEA 2AKKA 3X20B 4C8QE 4DK0A 4LNPA 2RH2A 3EFRA 4FM4B 1HJDA 5GAN4 4UC4A 1MABA 3CCLT 3LGLA 1YIJB 4ACBA 2MWOA 4KKSA 1OU8A 2DVEA 3QKJA 1LVKA 4CRIA 2PMDA 2BZYA 1ZUYA 1NPRA 1XTDA 2HBWA 1EFCA 1CKAA 1VQLA 2I1LA 2WSFE 4RTUA 4DEXA 5J3OA 1E6HA 2CGHA 5CO7A 3J80E 1GO2A 4J9IA 5GJWB 3UT1A 5FO0A 3CP2A 3QYHB 2EYWA 3CCQB 1M90C 3BY1A 1KZLA 1R5NA 3MCAA 3VO1A 1BIBA 1OX9A 1UHCA 5GAN7 4GLKA 2PU9B 1ZM4A 2EAYA 3CCJT 1NJIR 4MDWA 1QCOA 4FSXA 4EH1A 3QE2A 4N3NA 4ZCMA 4J8OA 5KH6A 4M7AC 2BTTA 3OYFA 1QWEA 2E4HA 2LC4A 1Q86C 2JJ2A 2DXUA 2KE9A 3JCMe 4M4SA 2QA4Q 2FYKA 2ZPFB 4XLEA 4EIKA 2CNDA 5KE2A 2X9HA 1PNJA 2QQSA 4X07A 1RABB 1UTIA 1P92A 5DY9A 3X28B 1KG1A 3U6KA 2VZLA 1EFRA 4FL6A 2E65A 1JA1A 1G3TA 2L8DA 4LDVA 1G83A 2VNKA 3JCMJ 2RM4A 2J6KA 1RLPC 2CW5A 5DN6A 2XG8D 3X25B 3CQTA 1YITB 4OOXA 5L8RE 2F5KA 4B6MA 3SB2A 2I0NA 2C77A 1YN8A 2DJQA 2DL4A 4TMZA 1OULA 2RI2A 5GAN8 4ZCLA 4E2FB 3T53B 3PTAA 4BE2A 3SJZA 3OYEA 2LT4A 2BIVA 2QTVA 5FWCA 5TV2A 2RN8A 2QQAA 3UDCA 3FRNA 3RY8A 1ZLMA 2M16A 1YJ9T 1IHMA 4D6WA 4ZTFA 5C6SA 3JCMg 4UZUA 4NNJA 1VQ7B 1EP3B 2NPFA 4ORZA 3PA2A 3OB9A 1BCOA 1BI1A 1UGPB 1QG0A 2EKHA 2O88A 4RPBA 1FMVA 2XIDA 2GJPA 4PFPA 2VYTA 2CUDA 1WOPA 1VOMA 3S3OA 2WZNA 3RKYA 1EFUA 2KMTA 4E7SA 3EGXB 2DXTA 5IYRA 1OQKA 4PFOA 5FWBA 3REAB 3L2UA 1UB4A 4H9GA 5GAOn 4HT8A 5THXA 3UPUA 4J7IA 4RD3A 2PUKB 5CQXA 3M9QA 4G1VA 1R0CB 2VBTA 2EQMA 5KYWB 2YXYA 4F7UE 1VQ9Q 1Q7YU 5GMKj 2ZZDA 4ASUA 3VRZA 2DO3A 1D1NA 2I2LA 2PVOB 4LBVA 4TN1A 2K3BA 4JLIA 1KQSS 1CQXA 4X7FA 1YWOA 2ZGWA 1VQ9A 3Q1JA 2BV3A 1T3SA 1JXMA 2CP0A 2X3XD 1KQSP 3CC4A 2V4DA 2E64A 1AVZC 5GANh 2R5MA 1OZ2A 4RD1A 8AT1B 1WHMA 2ZTGA 1FMWA 3NFCA 3ASTA 1FRNA 4BE1A 5GAOl 2F2WA 3CMAT 2F5TX 1WHJA 3VNUA 3ZIAA 4RLZA 5D7UA 1GCPA 4DQ2A 3W5VA 3HRUA 4QVJA 4B47A 4M53A 3A35A 1JA0A 1MUZA 4WZTA 2MIOA 5GAN5 3BQJA 1KK1A 2WJYA 2DRMA 5D6YA 4P22A 5LMZA 1BI2A 3VYHB 3C94A 3SD4A 1V0FA 1VQOA 2ZAEA 2F43A 4Z4WA 2LZJA 1MRZA 1SHFA 1RL2A 2M0YA 3G4ST 4IIOA 2QEXQ 2CH4A 2JZ2A 2AHJB 2J6FA 2KYBA 1WQWA 1AHJB 3UF4A 2DBMA 2K7AA 2GTOA 4RMOA 3ASQA 1YCYA 4B4DA 4ZGQB 3M0SA 3GSIA 3CEYA 2NWMA 5KE3A 1KFZA 5KCOA 4G7XA 4F17A 4JJDA 2L2PA 2VBSA 2QGFB 1Q82D 4HE6A 2JN0A 1YBYA 3J81E 2E3IA 1N06A 2VJJA 4LUEA 1D0ZA 4CC2A 2V7TA 2X6YA 3P8BB 4UZEA 2D6FA 3T56B 4RCBA 1C6VX 4RTWA 4AFQC 4F14A 4C8QG 2MI6A 2SRCA 1X75C 2JUFA 3LVBA 1VQ8B 4D8KA 4JPBW 4L59A
chains in the Genus database with same CATH topology
3HTRA 2DOGA 3H9NA 2DYIA 1PM3A 2F1LA 2QGGA 3A1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTR A;  2DOG A;  3H9N A;  2DYI A;  1PM3 A;  2F1L A;  2QGG A;  3A1P A; 
#chains in the Genus database with same CATH topology
 2AK5 A;  3HRT A;  3QII A;  2HCJ B;  1VLY A;  2L3R A;  1SRL A;  1ZUN B;  3H6Z A;  4Z4S A;  2HDN B;  1ZA2 B;  3DDY A;  1I5O B;  5ECA A;  4O6J A;  4QW2 A;  3GNG A;  5KYN A;  3M0Q A;  4C5H A;  3PUN A;  5FU7 C;  3OYL A;  4FN5 A;  4LC0 A;  2K4Y A;  4HCK A;  3PFS A;  2CK3 A;  2RA2 A;  3MHP A;  1GFD A;  1JJ2 P;  1NB0 A;  2K57 A;  3RES A;  1YIJ T;  3RKW A;  1F20 A;  5DM7 R;  4E7Z A;  2Y90 A;  1QFY A;  4OP7 A;  4P6Y A;  2ZXI A;  5IYQ A;  1QVG B;  5CKD A;  1WX6 A;  1K9M U;  1YIT T;  4M77 C;  5GAO q;  3S3N A;  3QXE B;  1RAH B;  4QQG A;  1Y0Y A;  3I55 B;  3GOX A;  3CD6 B;  2BZX A;  2DLP A;  4LBY A;  1FXX A;  2OJ2 A;  4HVV A;  5KW9 A;  4RDJ A;  4J6W A;  3C4S A;  1MND A;  1CKB A;  4C0S A;  1BBZ A;  4IUR A;  4OMQ A;  3WXM B;  1UE9 A;  2CP2 A;  2NLU A;  2ZPI B;  3CCQ A;  1PKS A;  2RHU A;  4XMY A;  1WDX A;  1M1K R;  3ASS A;  4OGE A;  1NZ9 A;  5LJ5 h;  5KYX A;  3MKD A;  2LT1 A;  2D74 A;  3EGX A;  5I21 A;  3BY2 A;  2DOG A;  2YUQ A;  5LJ5 d;  3OA6 A;  4GQN A;  3W2I A;  3EG9 B;  1BPL A;  3QG1 A;  4A4K A;  1VQM A;  2HDA A;  1IGQ A;  2LJ0 A;  5AN9 A;  1WJQ A;  3E1Y E;  4XLF A;  3G71 A;  2JM9 A;  2PE3 A;  5DLQ E;  1WOS A;  2R5A A;  4Z8A A;  1U1S A;  2GQF A;  4DNR B;  1KSW A;  4C92 F;  4RM0 A;  4JJC A;  5GAO r;  3OBY A;  1LCK A;  1H3H A;  4PFZ A;  4PC3 A;  1RI0 A;  4QHY A;  3U23 A;  2MYS A;  3CCE A;  2JJ9 A;  4BI3 A;  3Q39 A;  3UWN A;  2EQI A;  1AZE A;  2YRV A;  2OTJ A;  1OB2 A;  3AVX A;  3CMM A;  3H9N A;  1JXO A;  5DSZ A;  1VYU A;  5FO1 A;  4XOP A;  2BGJ A;  2OTL Q;  2DTI A;  3D7S B;  2KYM A;  2RK2 A;  1IRE B;  5GAM h;  4AT1 B;  3AVU A;  4PC7 A;  2GNC A;  2AHO A;  2WSC E;  3BNW A;  3SHW A;  1G7S A;  4L8J A;  2BMW A;  2HBP A;  4LDY A;  1NEG A;  2LNH B;  4AFU C;  4PJO E;  3LLR A;  1G7C A;  1PSF A;  3CCJ B;  1KHI A;  5KNL A;  1Y7X A;  2B86 A;  1PSE A;  3REB B;  3WNC A;  2PQW A;  1ZBX A;  2K3Y A;  4B9X A;  1XQB A;  2DYI A;  1QVF P;  2O4X A;  5F4M A;  5FW9 A;  1OV3 A;  3ER0 A;  3OYC A;  2BM0 A;  4TMW A;  3VS7 A;  2F2X A;  1UD3 A;  4JS4 A;  3WND A;  1W2B A;  2QAS A;  1IGU A;  4KBM B;  2EBP A;  1U2R A;  2B8A A;  3CCU Q;  2VGM A;  3PE0 A;  5HKC A;  5LJ5 j;  4TT3 A;  4EMH A;  1V5V A;  4RJL A;  2EJ9 A;  4PJL A;  1N8R U;  2X85 A;  3ASK A;  1S72 B;  3TU4 K;  2DNU A;  3GIB A;  2B5O A;  3GQB A;  1ZX6 A;  2DRK A;  2HQE A;  1YI2 Q;  2E6Z A;  4Z4T A;  4XD7 A;  1QH0 A;  2LX9 A;  2EW3 A;  2C5B A;  2C0T A;  1OX8 A;  4ELY C;  4PGO A;  4GBQ A;  4JLG A;  1SM4 A;  2CDT A;  1TUG B;  1K28 D;  2JIZ A;  1KD1 D;  2FG0 A;  4C92 D;  2ZZF A;  3M54 A;  1ZQ1 A;  4FW2 A;  1ELO A;  1N05 A;  1QGY A;  2GQI A;  1IB8 A;  5TY0 A;  1UGS B;  4Y28 E;  1RI9 A;  1BB9 A;  1D1C A;  3A8H B;  2KVQ G;  2JXB A;  2KDS A;  3I56 T;  2RK1 A;  4K11 A;  1GJR A;  1RUW A;  2ABL A;  2F4N A;  5H59 A;  4HA8 A;  2M51 A;  3TSZ A;  1N08 A;  1KMH A;  3DB4 A;  1IXD A;  2M0O A;  1BLI A;  2QA4 A;  3EHQ A;  4C92 G;  3VRY A;  4PC1 A;  1X6G A;  2EJF A;  1E64 A;  4RTY A;  4C0F A;  5I22 A;  3CPW P;  7AT1 B;  1KC8 R;  4Z4R A;  1VQ8 T;  1M1G A;  3ZC3 A;  1YJN B;  5IN1 A;  3NTH A;  1WXU A;  5IHN A;  2QYZ A;  4QVD A;  2J7K A;  4DNT B;  3ZPN A;  1S72 T;  2FB7 A;  1OB5 A;  2BUD A;  3VNV A;  1Q9S A;  5FU7 B;  4G5G A;  1V76 A;  3R6J A;  1N8R C;  2DAQ A;  2E6N A;  1J3T A;  2XZO A;  2XDD A;  3THK A;  3CPW A;  3CCV Q;  3V7S A;  3CPF A;  4OMN A;  3ZUG A;  4E7K A;  3CMA A;  1Q7Y R;  3KXT A;  2FVU A;  2PNI A;  5A0G A;  2RQR A;  3PIP A;  4O5V A;  1AWX A;  2WSE E;  1IJF A;  4IW3 B;  4ACA A;  4Q5W A;  4EMK B;  1HA3 A;  2C5H A;  2RQW A;  1W35 A;  4J9D A;  5HXB A;  1VQ7 T;  2GQV A;  3VJP A;  5KCH A;  4BUG A;  4PLI A;  4RUG A;  2DX1 A;  4M7D G;  2SEM A;  4X9D A;  1VUB A;  4FK8 A;  6AT1 B;  4BPR A;  2Z0W A;  2VGN A;  1QMC A;  3P8H A;  4RPD A;  1FDR A;  4XU0 A;  1X6B A;  4RD4 A;  1VQP T;  1MMG A;  1AWW A;  3V8K A;  2ZPG B;  4JMQ A;  1XNI A;  3CCR T;  1ZM3 A;  2OAU A;  2EPD A;  3O5Z A;  1UD4 A;  4BY6 C;  4YAO A;  2P0Q A;  2LQN A;  3E20 A;  2P3M A;  3OOC A;  4JRP A;  4NL3 A;  5CCA A;  3JB9 D;  4RCY A;  3MEV A;  2RI5 A;  2VBU A;  4XU3 A;  1U3O A;  4RD2 A;  1T3L A;  2DIQ A;  3BC9 A;  4TMX A;  3CC4 Q;  3V7C A;  2RC6 A;  3SLD A;  2E5K A;  1M1F A;  3SFM A;  1YHQ A;  2ED1 A;  2F2V A;  4BD3 A;  4RCZ A;  3NTI A;  3HFO A;  2QEX T;  1DG1 G;  4YAU A;  1UMK A;  3JCM c;  4XL9 A;  4OF1 A;  1D1A A;  2JS2 A;  1PD1 A;  3CCR B;  1I7P A;  4J9G A;  1G3S A;  1ZUK A;  4F7D A;  2DL7 A;  5IXF A;  5J39 A;  4ANJ A;  3I55 Q;  2QG9 B;  4QVZ A;  3RKX A;  5CKB A;  1I8F A;  2AT1 B;  4HVU A;  3CCE T;  2JM8 A;  3OYY A;  5F4J A;  3M56 A;  1B23 P;  3H0F A;  3M55 A;  1W2B P;  3CPX A;  4XTY A;  1WHK A;  2HLD A;  1W70 A;  2XIC A;  4KKU A;  4C0D C;  2F69 A;  3CCS Q;  1YJW Q;  4BAC A;  4XTX A;  4QV2 A;  3ULR B;  2V7Q A;  3OMC A;  5HZB A;  5FA6 A;  3BCF A;  2X6X A;  5GAM g;  1IHV A;  3MCA B;  5FRN A;  1N9S A;  1PHT A;  1OOT A;  1M1K D;  3GP8 A;  1VQ4 Q;  3GNF B;  1W2B B;  1JO8 A;  2RD1 A;  3JAM E;  1AOJ A;  2O31 A;  3OP1 A;  1WJR A;  1YNZ A;  2EJG A;  4NL2 A;  3UAT A;  4OB1 B;  3C12 A;  1BCM A;  1XQH A;  2RQV A;  2RO0 A;  4WQM A;  2PZ1 A;  1UGV A;  1VQO Q;  2EQK A;  5GAN f;  1VQ6 Q;  2LX7 A;  3ZZT A;  3G7Z A;  4XQF A;  1H8H A;  4MZM A;  2LCL A;  1K9M C;  5FU6 B;  1JJ2 S;  3PVD A;  1H42 A;  5GAO m;  2OX7 A;  1RLQ C;  2OTJ T;  4IUP A;  3QUI A;  1QUE A;  2JJ1 A;  2Q6L A;  3QYG B;  2YLB A;  5GAN g;  1BX0 A;  1S4M A;  1VQN A;  4JJB A;  2G6F X;  3QZ5 B;  2COZ A;  4Z88 A;  2KRO A;  5AT1 B;  2OAW A;  3VS4 A;  2K2V A;  2P84 A;  2QTZ A;  4OB3 B;  1K0X A;  3I56 B;  4RTZ A;  2L3S A;  4PAB A;  4ZTJ A;  5CDF A;  1GR1 A;  1M4Z A;  2BE7 D;  3OYJ A;  2MOX A;  2CZ6 B;  2V8J A;  5LJ5 e;  1E3Z A;  3OZU A;  3W2E A;  1VQL T;  2KRM A;  5BSX A;  4LDW A;  3CD6 T;  1UUE A;  4XNF A;  1TUC A;  3BCD A;  4OOS A;  2XNJ A;  3KL9 A;  1QCF A;  5J26 A;  1I5L A;  4II3 A;  3A8J A;  1M2V B;  2CZ7 B;  2AZS A;  2DEQ A;  4R55 A;  2XKO C;  4M77 D;  2EGC A;  1Y0M A;  4JUV A;  2GBQ A;  2FZC B;  4M75 B;  4XN0 A;  4C0Z A;  4F16 A;  1NYG A;  4A4G A;  4C92 C;  2GK6 A;  3G71 B;  4IUQ A;  1HVX A;  1K9M R;  1G7R A;  1E1Q A;  1JQQ A;  4UZF A;  1Z9Z A;  1GRI A;  1Q86 U;  1T0J A;  1XOV A;  1S1N A;  2CSQ A;  4BY6 B;  4RTT A;  2HEQ A;  2XU8 A;  1QVG S;  2E41 A;  3AHU A;  3EG3 A;  3PIO A;  2CT4 A;  1RAI B;  2KT1 A;  1WHG A;  1E63 A;  3CMA B;  1I18 A;  2BZ8 A;  2DET A;  1WZO A;  2NUP B;  1M90 U;  2PLF A;  2HL5 C;  5TRD A;  3B78 A;  1LNX A;  2LVM A;  1VA7 A;  3WVE B;  1SSF A;  1VQP B;  1WJS A;  2MF2 A;  1NBE B;  4DA4 A;  2AKL A;  2EYQ A;  2K5L A;  3L2Z A;  2VNI A;  4PJN A;  2GPJ A;  1GAW A;  1EFN A;  1SKU B;  1QQJ A;  5FRM A;  5KYY A;  1HZE A;  2QGG A;  3CCL Q;  5CAI A;  1BYM A;  3WNB A;  1KD1 R;  2D8H A;  3MP6 A;  2RJD A;  3EAE A;  1VHE A;  1N27 A;  5GAN 2;  2E3H A;  1WP6 A;  2VYQ A;  4WZL A;  2QA4 B;  1QKW A;  1I0C A;  1TUI A;  2GCX A;  1RAF B;  2Q6I A;  1Q82 C;  3JCM h;  4DK1 A;  1B34 A;  3OYM A;  4QQ6 A;  2L3Q A;  3Q3A A;  1X6O A;  2L0A A;  9ATC B;  2J6O A;  4J83 A;  2FL7 A;  4OP0 A;  1VQN T;  2M9U A;  2G3R A;  3PNW C;  3VS1 A;  3CCE Q;  1H8E A;  3CME Q;  4RTX A;  2V1Q A;  2VXE A;  3OSS C;  5A8A A;  1Z9Q A;  4MZP A;  3M53 A;  1AIP A;  3G05 A;  3T9N A;  5LJ3 e;  3A3B A;  2QA4 T;  1Q7Y C;  4NCN A;  3EG0 A;  3T51 B;  5LJ5 f;  3FJO A;  3OYK A;  3CCU T;  1I1J A;  5IXB A;  1S72 A;  3B82 A;  4J6X A;  1Q81 D;  4M7D F;  2QQR A;  2RQT A;  3E19 A;  4M78 D;  1QVF B;  1KQ1 A;  3FJ5 A;  1QGA A;  3QFC A;  4B9W A;  5CKF A;  1C1A A;  2E1R A;  3WY9 A;  2RJF A;  3JCM X;  2EYX A;  2VNH A;  1G8X A;  5TR9 A;  2FPD A;  4M78 F;  4PJO F;  3SEM A;  2QN6 A;  5F4O A;  2O4X B;  4B3X A;  4ESR A;  3OW2 A;  1Y57 A;  4WWV A;  1W1F A;  4J6Y A;  1M30 A;  1Q81 R;  1QKX A;  3CCJ A;  2X51 A;  4P3Y A;  4AG2 C;  1CNF A;  3GVJ A;  5B6I A;  2WJV A;  3JB9 F;  5BSY A;  2CS7 A;  1MHN A;  1PKT A;  4N4I A;  2J06 A;  3HKS A;  4M75 A;  3VO2 A;  5L46 A;  2DXC A;  1YIT Q;  3HFN A;  5C0M A;  5IYP A;  1TG0 A;  4OMP A;  4CQJ A;  2VVK A;  4OVA A;  4BDZ A;  3CD6 Q;  2RMO A;  2XZL A;  1YHQ T;  3CCL A;  1W2B S;  2DA9 A;  3SWN A;  2KVO A;  1M5Q 1;  4Q7J B;  2D9R A;  1WXT A;  3OYA A;  3OS5 A;  1YJN A;  3PMI A;  1SKQ A;  2YUO A;  3EFO A;  1PRM C;  3VUZ A;  4IKF A;  2YWE A;  3MPU B;  3E9G A;  1M27 C;  2QQB A;  1YJN T;  1VQK Q;  1X01 A;  3M0R A;  1BU1 A;  2A3L A;  1PJ6 A;  4B48 A;  4UAJ A;  5A0L A;  4QVC A;  1CSK A;  4F04 B;  2DVJ A;  1BX1 A;  2F1M A;  2PVD B;  1N0V C;  4EPC A;  1WIE A;  2O2O A;  4L6V 5;  5GAN j;  2WR8 A;  2DPP B;  1E3X A;  2YUP A;  5EG2 A;  3AT1 B;  2VXF A;  3CME A;  3LNN A;  2CH4 W;  2KRS A;  3CC4 B;  4PKC C;  2VV5 A;  5DS0 A;  3EHR A;  3ZL7 C;  3F70 A;  3AVV A;  4DQK A;  4M7A F;  4FIB A;  4X7D A;  1UD6 A;  5GMK i;  4M1K A;  2EIX A;  2Z6B D;  3CCM A;  3SEJ A;  4IUU A;  4C92 B;  2ZZQ A;  3VMF A;  4PJJ A;  2DL8 A;  4KT0 E;  1H3Z A;  4E7I A;  5L23 A;  3CMA Q;  2K3X A;  3M4G A;  1FNM A;  3FB9 A;  2R57 A;  1SG5 A;  4KUD K;  3IQL A;  3OE7 A;  3UA6 A;  4NBS A;  2YHT A;  4AF6 A;  3CBM A;  3WXM A;  5FNZ A;  5I2S A;  3A8L B;  1D09 B;  3KUF A;  4TKO B;  3BH4 A;  3ZZ0 A;  4Z02 A;  1YLO A;  3CBO A;  2K5I A;  3JQP A;  4WZK A;  3FKS A;  3A98 A;  1GBR A;  4M7A A;  3JCM V;  1TSF A;  5H5J A;  1AMO A;  3G4S Q;  1RAC B;  1TH7 A;  2P4R A;  3CCM Q;  4ZV4 A;  2XGJ A;  1Q86 D;  1ZSZ C;  3EG2 A;  4YEL A;  3GLX A;  4XM3 A;  3SKB A;  3QSY A;  3VS0 A;  2RHY A;  3MEA A;  2DD5 A;  3CCQ T;  3OW2 S;  1K73 R;  3HPW A;  1I8D A;  3SJP A;  3JB9 J;  3FLG A;  4PJO G;  3CCJ Q;  2ECZ A;  1SPK A;  4P1V A;  2E1B A;  1LJO A;  2C06 A;  2V1R A;  4J9E A;  1K73 D;  4FT4 A;  3M4Y A;  3QFS A;  1Q82 R;  2X4Y A;  1K9A A;  2OTJ B;  3HSB A;  3A3G A;  1ZSZ A;  2V26 A;  1TU0 B;  4KGX B;  3R6N A;  4M7D B;  2D8J A;  1M3B A;  3PVQ A;  3E2U A;  3CCE B;  4PC6 A;  4M0L A;  2HSE B;  2FO0 A;  2LDM A;  1T0H A;  1D3B B;  1WGS A;  5AYF A;  1M1K U;  5LJ3 h;  2NUT A;  1JRI A;  3H8Z A;  1QVP A;  1WYX A;  4JRQ A;  3VKI A;  1VHO A;  4CI0 C;  4RTV A;  3GBQ A;  2EYZ A;  2ZL6 A;  1LOJ A;  3JCM f;  1VQ9 T;  2R58 A;  4XTZ A;  2HKN A;  1P4M A;  3QJ6 A;  1WSV A;  1VQK A;  3JQR A;  2V31 A;  2RI3 A;  3OS2 A;  4F7U A;  4XU1 A;  2FEI A;  1AEY A;  2GJR A;  3L42 A;  3WBJ A;  2GK7 A;  1ZA1 B;  3LO8 A;  1D0Y A;  1RAA B;  1UD8 A;  4P26 A;  4EMK A;  4QQD A;  4PJO A;  4OPV A;  4M7D E;  4M78 G;  3ASR A;  1O9S A;  2A28 A;  3GVK A;  3PVL A;  2DL5 A;  4XLC A;  2YLC A;  4ZGJ B;  1YFN A;  4JRK A;  1W0K A;  2IVW A;  2ZPB B;  1YIJ Q;  2BSA A;  3BDU A;  3MP1 A;  2LCS A;  3VR6 A;  3CPW B;  1H64 1;  1YHQ Q;  1VIF A;  2JMA A;  3R6K A;  1QLY A;  4R56 A;  1HXD A;  3NGP A;  1E1R A;  2KGT A;  1YX2 A;  2KK4 A;  1KRH A;  3GIR A;  1VQ5 Q;  1V29 B;  4Y91 A;  1YIJ A;  1KK2 A;  5IHK A;  3DKM A;  1N07 A;  3S3M A;  3QO3 A;  3I55 A;  2KAF A;  3I5S A;  3LX7 A;  4FW1 A;  4E7L A;  1M3A A;  3KBG A;  1NB9 A;  1E7O A;  1GXI E;  1VQ5 A;  1NJI D;  2DZ9 A;  3M0P A;  1QVG A;  4N4G A;  3G6E Q;  2DEU A;  2CZ0 B;  2DBK A;  3LH0 A;  2ZL7 A;  2OTL A;  2JOY A;  1W9X A;  2FVG A;  2C4U A;  4OB2 B;  1X2Q A;  4JJN K;  4RCC A;  4Y9R A;  4RD0 A;  4Y92 A;  2K2M A;  1N5Z A;  3OPO A;  1QW1 A;  2O9S A;  4Z4V A;  1GL5 A;  4LBW A;  5IK2 A;  3CBP A;  3L2W A;  4G1B A;  3G4S A;  3SLN A;  2QMU A;  1T5E A;  4QKU A;  4HCZ A;  3EG1 A;  4YHB A;  2W10 A;  4E7J A;  2KT8 A;  2X3W D;  1WU8 A;  2RB6 A;  1Q86 R;  4LUD A;  2OYN A;  4X05 A;  4RKU E;  4XAX B;  4MML A;  2RHX A;  3CW2 A;  3J81 k;  3OW2 P;  4P25 A;  1NYF A;  2BN4 A;  2BPO A;  3MJX A;  5IYN A;  2RNA A;  2CP7 A;  2D3L A;  1RQR A;  4PJO C;  4M78 C;  3TSW A;  4J9C A;  1Q81 C;  1EP1 B;  2DD4 A;  1YI2 T;  1WOR A;  2YSQ A;  1UD2 A;  4IIM A;  3G71 T;  3CP8 A;  1N6A A;  1KK3 A;  4IUV A;  3C0C A;  4M7D C;  3OS1 A;  1NRK A;  5GAN e;  4QUZ A;  2IG0 A;  1FMK A;  2NV4 A;  2XNC A;  3OFN A;  3OW7 A;  5I11 A;  1FRQ A;  2QTX A;  1X27 A;  2DF6 A;  2OTL T;  1ARK A;  2DY1 A;  4CC7 A;  2HAX A;  1BMF A;  3G1J A;  2V7W A;  3A8M B;  2FRW A;  3JB9 G;  5CQY A;  3CCU B;  2ZPH B;  4Z89 A;  3RNJ A;  1W4S A;  1YJ9 B;  3ISX A;  1JBM A;  5GAM j;  3ME9 A;  1ZUU A;  1TTT A;  3JCM b;  1ZSZ B;  1MNE A;  1R0B G;  2DJZ A;  3A5Z B;  2E70 A;  1SEM A;  2D1X A;  1KQ2 A;  2DTH A;  2EKO A;  2GFA A;  2MMP A;  3W2G A;  4PNO A;  4JZ4 A;  5CVI A;  3CCS A;  1QCN A;  1YJW A;  5IYW A;  1OZ3 A;  1XE1 A;  4CC3 A;  1JB0 E;  4BE0 A;  1I81 A;  2DE0 X;  4AMC A;  3JB9 I;  4C8Q C;  4XLH A;  1IHW A;  1EWY A;  3H0H A;  1QP3 A;  2K5F A;  5GMK h;  1MMA A;  1AZG B;  1C0M A;  2X4X A;  3CCV A;  1COW A;  4XU2 A;  1VQ6 T;  4C5E A;  2WSS A;  1W6X A;  1JB9 A;  2VB6 A;  2Y4Y A;  2LQ8 A;  4II1 A;  4KGZ B;  1VQ9 B;  3EG9 A;  4YAL A;  1SRM A;  5CIU A;  1VJS A;  1JNY A;  1KC8 U;  2HSP A;  1UD5 A;  4LDX A;  2DTO A;  2DIE A;  1M2O A;  3I35 A;  2P4T A;  3CC2 T;  2YRC A;  4C5I A;  2OBS A;  3OYD A;  4XLA A;  3P8D A;  3RMS A;  2QI2 A;  5KYW A;  4XOT A;  1H8K A;  5KYX B;  3KEW A;  3NE5 B;  3OEE A;  4Z4Z A;  2LJ1 A;  2JTF A;  3I56 Q;  4M77 G;  2MK5 A;  1RAG B;  1Y96 B;  1VQL B;  2EFG A;  4ZNX A;  1FYN A;  4VUB A;  1G3W A;  2JNG A;  5IH2 A;  1G2B A;  1X43 A;  2CP5 A;  2O9V A;  2KSS A;  1VQM Q;  1HK9 A;  1VIE A;  3HAG A;  2OBT A;  3ZBU A;  3L2Q A;  2ZZE A;  1EZZ B;  3EGD A;  4KUL A;  3G4S B;  2X53 S;  5KSW B;  2K9G A;  2X4J A;  1K8A U;  4EDU A;  2ZL5 A;  1WPC A;  2DYB A;  1GCQ C;  4M7D D;  2Y4X A;  1T6X A;  4XTW A;  1VQ7 A;  3X24 B;  1ZM9 A;  2M5S A;  2EGE A;  2DIG A;  1SKY B;  2QAZ A;  1OB0 A;  3Q6Q A;  1SHG A;  2V8I A;  4EMG A;  2QE7 A;  1N8R D;  1E62 A;  4HKE A;  5GAN 3;  1IRX A;  2XEX A;  4M77 F;  2BKD N;  3WBK A;  1OPL A;  2LRQ A;  1NLO C;  4LXC A;  4XTU A;  1TWB A;  3ONU A;  1EIF A;  2D0N A;  3EFO B;  1GCQ A;  4M77 B;  1EFT A;  1ZHI A;  3CCS B;  1YJW B;  3MHX A;  5CKE A;  1F60 A;  3SWN B;  3CCL B;  1QP2 A;  1W34 A;  1IJE A;  2HCK A;  3MET A;  1YIT A;  4X06 A;  2ESW A;  4B43 A;  1VQ8 A;  3FPK A;  1M90 D;  4X8I A;  3I9Q A;  1OGJ A;  3MEU A;  4OMF B;  4HE5 A;  2XDP A;  2JS0 A;  3CXC B;  3VUB A;  1H85 A;  5CKH A;  1V1C A;  4M75 F;  1VQP Q;  3QHS A;  3V76 A;  4XON A;  5HZA A;  3CCR Q;  1M90 R;  4J9B A;  5A0D A;  4QVA A;  2VUB A;  1WLP B;  4OPO A;  1NJI C;  2QTL A;  2PVG B;  2DCU A;  1KD1 C;  1PJ7 A;  4LE9 A;  4F7U B;  3QWX X;  2DM1 A;  3OW2 B;  4X7C A;  4Z4U A;  2QDX A;  4M7A E;  1NEB A;  2K79 A;  4FSS A;  4V2S A;  2CP3 A;  2CSI A;  1KK7 A;  1WQ7 A;  2KXC A;  2QDY B;  4DOV A;  3CCQ Q;  1M8V A;  4NOY A;  2E12 A;  3I55 T;  1OEB A;  1FWZ A;  2XI9 A;  4J7F A;  4XR6 A;  3RIR A;  4AFZ C;  1Y71 A;  4FU6 A;  4JZ3 A;  3X26 B;  2ZPE B;  1T6Y A;  3NMZ C;  2M1H A;  4XTV A;  4BI8 B;  2RJE A;  2LZ6 B;  1YJ9 Q;  3A8I A;  1WPY A;  3E9F A;  3A8K A;  3BY7 A;  2EYY A;  1B7T A;  5E6T A;  3N5B B;  2V7V A;  2MAM A;  4C92 E;  4DQL A;  8ATC B;  2R9V A;  4KGV B;  2KNB B;  2WYR A;  4M77 A;  1A8P A;  4N3G A;  2ED0 A;  1S72 Q;  4E47 A;  1R5O A;  1PD0 A;  5I2M A;  2FX3 A;  1VQ4 T;  1XJW B;  2XHC A;  2A0F B;  4P2N A;  1BKB A;  4TVR A;  5EC7 A;  2COW A;  2KRN A;  3FC3 A;  3OAA A;  2FRY A;  4K1X A;  1AD5 A;  3OQ5 A;  4HVW A;  4FWT A;  4JS5 A;  3W2F A;  4AVZ A;  3OKX A;  3PT9 A;  3JCM d;  4R71 A;  1OI1 A;  3PEN A;  4M75 D;  5KYY B;  4FCY A;  4GLM A;  4AFS C;  3BE3 A;  4TSF A;  2XOK A;  4P5N A;  3EGD B;  4G7W A;  4IUT A;  5FIU A;  2L5Q A;  3L2R A;  2KEA A;  4Z4Y A;  5GAM e;  5GAN 6;  1K73 C;  1UGR B;  4C5G A;  4WCI A;  2CT3 A;  3OMG A;  4C0G A;  1MMD A;  1W0J A;  2YUN A;  1Y96 A;  1QX4 A;  3INZ A;  1WOO A;  2RF0 A;  2XND A;  1PWT A;  1Y07 A;  3P27 A;  2R6H A;  3AGP A;  1NG2 A;  1VQL Q;  2CYZ B;  1NBM A;  4PJM A;  1MV3 A;  4QFM A;  1DDI A;  1YWP A;  2O01 E;  3SDZ A;  1PKV A;  4PJO B;  2J05 A;  4DBH A;  3C95 A;  4PJO D;  4X7E A;  5CR2 A;  5HK3 A;  1VYT A;  2L3P A;  4P6V F;  2WAC A;  1YJN Q;  2A7Y A;  3QFR A;  1VQ8 Q;  1WTH D;  2JW4 A;  4OB0 B;  3R6O A;  1H92 A;  1BJK A;  3JQQ A;  2ZXH A;  2KBT A;  4X34 A;  4KH1 B;  4M7A G;  3RR6 A;  5FLX E;  1NJI U;  4ZCI A;  1VQK B;  1V0E A;  1UDL A;  2D0Q B;  5CK9 A;  2E5Q A;  1BQE A;  2WZP P;  3MP8 A;  1K8A R;  1K76 A;  3QWY A;  1GBQ A;  4N4H A;  4OML A;  5A2Q E;  4C8Q F;  4HT9 A;  2BGI A;  3CCV B;  3SWN C;  2D3N A;  5D6X A;  4HXJ A;  1SSH A;  2CRV A;  4YTL A;  3W5H A;  3ZFJ A;  4N0A C;  3I5R A;  5FU6 C;  1OHH A;  4E0F A;  1IZ6 A;  2W0Z A;  3FJP A;  3M5A A;  1N0U A;  1QFZ A;  3P26 A;  1GVH A;  3CTA A;  3CC2 A;  3LWH A;  1Q95 G;  1M3C A;  1GFC A;  3S6W A;  3AGQ A;  1YJ9 A;  3QFT A;  1JJ2 B;  3CRZ A;  4M77 E;  4Y9U A;  3VYG A;  3RBB B;  2DXB A;  2QQ9 A;  2QK0 A;  3M57 A;  2D9T A;  4OMO A;  4OPS A;  3OY9 A;  2A08 A;  1E43 A;  1QVG P;  2DK3 A;  1WHH A;  1R8O B;  1PC0 A;  2F1L A;  4J9F A;  1VQ6 A;  3OBW A;  2KI7 A;  3Q6R A;  1ACM B;  1K8A C;  1OYX A;  1PRL C;  3CCM T;  3ZZU A;  4X9C A;  1TTH B;  1WDT A;  3JU4 A;  2BVN A;  4XOR A;  3CXC P;  3URG A;  4LD6 A;  1R5B A;  3G6E B;  3DLL A;  4C8Q D;  1WHL A;  2W6I A;  4MDX A;  1UFF A;  1VQN Q;  1IO6 A;  4AG1 C;  4FYV B;  2CF4 A;  3O8V A;  2FZG B;  3CME T;  1J9Z A;  2OI3 A;  3FEO A;  2H8H A;  5HK0 A;  1M9S A;  1XFO A;  2EGA A;  3MMP A;  4N0A A;  2H3E B;  4D8D A;  4A54 A;  5HKK A;  3G6E A;  1K73 U;  1PG5 B;  5LJ3 d;  1TOV A;  2CZ1 B;  3PGG A;  1KHC A;  3LWI A;  2B7B A;  2ZIT A;  1DAR A;  1KC8 C;  2X4W A;  5IT9 E;  2C0I A;  2C78 A;  4PK4 A;  3ONY A;  4PAA A;  2FPF A;  5LJ3 j;  1AWO A;  1VYV A;  2JMC A;  4C43 A;  3GVL A;  3TVT A;  2VNJ A;  3CME B;  4YEJ A;  1B07 A;  2MWP A;  3M59 A;  4YAF A;  1QWF A;  5KYU B;  2OTL B;  1I4K 1;  1FND A;  1FNC A;  4FXU A;  2HQH A;  3L2V A;  4ROX A;  1YHQ B;  2ZZG A;  2HL3 A;  4F7U G;  2A36 A;  2Q6K A;  3CC2 Q;  1Q7Y D;  5JBQ A;  4MYU A;  5IHI A;  1UGQ B;  2KQW A;  2ROT A;  3ZBT A;  3CC7 B;  5HY6 A;  4GY5 A;  1T6Z A;  1TLL A;  2QDL A;  3RER A;  4M75 G;  5LJ3 g;  3GPL A;  1OPK A;  5A88 A;  4ZGD B;  2VJI A;  4KRT A;  2NUZ A;  2XMF A;  4G6I A;  1VQM T;  1KQS B;  2NYS A;  4ME7 A;  3QSU A;  3EH1 A;  1ZM2 A;  3AVW A;  1HYO A;  3HL8 A;  1NDH A;  2GRE A;  1WSR A;  2EFI A;  3E1S A;  1UJ0 A;  1MMN A;  3HP9 A;  3M0T A;  4C8Q A;  3JCM Q;  3V7A A;  2YT6 A;  3VS6 A;  2HKQ B;  1K4U S;  2X8K A;  2PUO B;  1KD1 U;  4RG2 A;  4C8Q B;  3EGU A;  3FPP A;  4RD6 A;  2B7C A;  1N9R A;  4RDL A;  2JT4 A;  2X3U A;  1D8T A;  4II2 A;  1KQS A;  2HNI A;  1DDG A;  1YI2 B;  2LP5 A;  4ELZ C;  1VQ4 A;  3CCV T;  4FT2 A;  4DBR A;  5GAO p;  1QVF A;  1M2V A;  4BDY A;  3ES9 A;  2NUT B;  3CC7 Q;  4LD9 K;  2CKK A;  4E7H A;  1D3B A;  1O75 A;  4B44 A;  1QVF S;  3RDV A;  2M02 A;  2RPN A;  3A8G B;  3JRZ A;  2YWF A;  3DB3 A;  4M7D A;  4B3F X;  2VAS A;  4OGC A;  4M78 B;  1CNE A;  4AF7 A;  2V7U A;  4DOW A;  2DER A;  2E10 A;  3QPH A;  1E79 A;  4E6R A;  3M0U A;  2LQK A;  3V8J A;  1VLO A;  1KJZ A;  3V7R A;  1VQN B;  1JU5 C;  1AT1 B;  4ATO A;  3OEH A;  4ZN3 A;  2QEX A;  3HTR A;  2HD0 A;  2QEX B;  1YP5 A;  4OOV A;  1B2R A;  1JEG A;  2DFU A;  2QXF A;  3NHN A;  4HIZ A;  3H41 A;  4M7A B;  2IPO B;  1UHF A;  2Q6O A;  4XN3 A;  4BB7 A;  1PJ5 A;  4M78 A;  1G5V A;  5LJ5 g;  2RQU A;  3PUM A;  4EMK C;  4MZT A;  3BDL A;  5GAM d;  2ZCF B;  2E1H A;  1VQP A;  1OU9 A;  2JVV A;  5DLO A;  2EQJ A;  3B8H A;  4Z1M A;  5GAM f;  1K1Z A;  4TMV A;  5GJV B;  1B3Q A;  1WA7 A;  1W87 A;  3HRS A;  3J7A F;  1VQ4 B;  4M75 E;  2HMA A;  3U2Q A;  1I07 A;  2EVR A;  1NPP A;  3L1A A;  1G3Y A;  2X35 A;  1FX7 A;  4C92 A;  1NM7 A;  1WFW A;  4LBZ A;  3UA7 A;  3CCM B;  4M7A D;  1K9M D;  1EX4 A;  2GJK A;  2P0P A;  1F1B B;  3OYH A;  2CP6 A;  2BE9 B;  4XK8 E;  4AC9 A;  1VQ6 B;  3JV3 A;  1M8M A;  1D0X A;  4MYT A;  2MPX C;  2OK7 A;  1WI7 A;  3BW1 A;  1Y0R A;  5GAN d;  1FX0 A;  2ROL A;  4FYW B;  1EXM A;  3EH2 A;  3AVY A;  2BM1 A;  5LL6 S;  3RMQ A;  2FPE A;  1EP2 B;  1JJ2 A;  3Q38 A;  1M1K C;  1VF7 A;  1MGQ A;  5HCK A;  3CES A;  4M75 C;  2C4T A;  5GV8 A;  1OGI A;  1U5S A;  3DLM A;  3CC2 B;  2AZV A;  1KC8 D;  2DKG A;  5M9O A;  4RG8 A;  1D1B A;  2YWW A;  1UJY A;  3VS2 A;  3GF5 A;  2DL3 A;  5FRO A;  1ABO A;  2X0K A;  2GF7 A;  4ZGN B;  2CBX A;  1A0N B;  2P0K A;  4L5G A;  1PM3 A;  1RAE B;  2MCN A;  1VQ7 Q;  2XDB A;  1TUD A;  4QT7 A;  1ZBJ A;  2GTJ A;  4DBQ A;  5GMK l;  2EIF A;  4XQ3 A;  3I56 A;  4P12 A;  5J35 A;  3FDR A;  2HZY A;  2KR3 A;  1VQ5 T;  4A63 B;  5A89 A;  1DJ7 B;  2YRD A;  2JDI A;  3WQZ A;  1UG1 A;  1VQM B;  5EMN A;  4PLL A;  2JN9 A;  2RHI A;  3EFS A;  3OSV A;  3WVD B;  3D26 A;  3QJY A;  3LQE A;  1K8A D;  2OK8 A;  5GMK e;  1KK0 A;  3OJX A;  1KTV A;  2XD0 A;  3QDR B;  1FNB A;  2LQW A;  3QZ9 B;  4WZE A;  3OZV A;  1TS9 A;  4X1V A;  1VQK T;  2KXD A;  4J9H A;  1Q81 U;  4A4E A;  4A53 A;  3CC7 T;  3JB9 H;  1XB2 A;  2DZC A;  3JCM P;  4M78 E;  4M2L A;  1LPL A;  3KFV A;  1U8R A;  4XKW A;  4BI4 A;  1X2K A;  2YDL A;  3LYI A;  3OYI A;  2VKN A;  3OYG A;  3TQ7 P;  1QUF A;  3PMT A;  2J7I A;  2GFU A;  4OMM A;  1HD3 A;  3CD6 A;  4WF2 A;  2CRE A;  4P9S A;  2YWH A;  2CC2 A;  4C0D B;  4TMT A;  3W2H A;  2HQX A;  3AVT A;  3CCS T;  1YJW T;  1AWJ A;  3JSC A;  1MV0 B;  1YCS B;  2V7X A;  3QDF A;  3H0I A;  1BI0 A;  4DBF A;  3LH5 A;  4A4F A;  3QBY A;  1GAQ A;  2XK0 A;  4CC4 B;  4LN2 A;  4ZGE B;  4M4Z A;  3CCR A;  1UEC A;  1NE8 A;  1BIA A;  4U9U A;  1B34 B;  2K6D A;  4NS5 A;  4HCB A;  5GV7 A;  1WNL A;  4FYY B;  3LW5 E;  1TVC A;  3G71 Q;  3RUX A;  1U06 A;  1VQO T;  1X69 A;  2EWN A;  4P3I A;  5GMK m;  4MMK A;  3CC4 T;  2VC8 A;  3OZW A;  2WPD A;  3CPW S;  2V8K A;  3I1F A;  1U1T A;  4LDU A;  3FIF A;  3CCU A;  1D2E A;  1UEB A;  2LMJ A;  2RHZ A;  1IB0 A;  3BFM A;  3HHT B;  2DIL A;  3PA1 A;  1PCX A;  2FHD A;  2NUP A;  3OS0 A;  1YI2 A;  2OTJ Q;  5D6W A;  4HCC A;  3H94 A;  2PTK A;  2X6W A;  4XKV A;  2COY A;  2AIR B;  1R77 A;  2GGR A;  4PL6 A;  3VV0 A;  1G7T A;  2BF4 A;  4F7U F;  3U6B A;  2FZK B;  2LCC A;  1NLP C;  5LJ3 f;  3ZBD A;  2L89 A;  2IIM A;  1RQP A;  4KH0 B;  4KKT A;  5FL7 A;  3A1P A;  1QGZ A;  1BI3 A;  3JCM W;  1KJW A;  4JDS A;  4Y7C A;  1BK2 A;  3NPF A;  3TRE A;  4J5Y A;  3OYN A;  2C2W A;  2VWF A;  3G6E T;  4DEY A;  5IAY A;  2OBR A;  3A8O B;  4WTO B;  2PIA A;  3TEE A;  2C0O A;  2RJC A;  4X0C A;  1ZSG A;  2XZP A;  3CXC A;  1VQO B;  3VU3 C;  5J3B A;  1N8R R;  4KUI A;  2YWG A;  2ZBV A;  4PC2 A;  1WXB A;  2A37 A;  4YAW A;  4YXW A;  3W5U A;  2W6J A;  4RDK A;  2EQU A;  2RC5 A;  2LTO A;  1ABQ A;  2CUB A;  3M58 A;  1KIK A;  4A4H A;  3CC7 A;  3CB4 A;  3V8L A;  2JTM A;  1TXQ A;  3NTK A;  3CXC S;  2DMO A;  1RAD B;  4R0K A;  3MO8 A;  1SF9 A;  3OYB A;  2ZBU A;  3LQ6 A;  2VBV A;  3WYA A;  4B3G A;  2ATC B;  1HSQ A;  3MEW A;  3LGF A;  2ENM A;  2H3J A;  3TCJ A;  3OJW A;  4JRI A;  1QFJ A;  4J0Q A;  3ZEH A;  4ZN1 A;  2ZTN A;  5KYU A;  2LJ3 A;  3VS3 A;  2LNV A;  4FYX B;  1K0S A;  3VS5 A;  1VQ5 B;  1E6G A;  2KY9 A;  1S0U A;  3ASP A;  1Q82 U;  2JTE A;  2AKK A;  3X20 B;  4C8Q E;  4DK0 A;  4LNP A;  2RH2 A;  3EFR A;  4FM4 B;  1HJD A;  5GAN 4;  4UC4 A;  1MAB A;  3CCL T;  3LGL A;  1YIJ B;  4ACB A;  2MWO A;  4KKS A;  1OU8 A;  2DVE A;  3QKJ A;  1LVK A;  4CRI A;  2PMD A;  2BZY A;  1ZUY A;  1NPR A;  1XTD A;  2HBW A;  1EFC A;  1CKA A;  1VQL A;  2I1L A;  2WSF E;  4RTU A;  4DEX A;  5J3O A;  1E6H A;  2CGH A;  5CO7 A;  3J80 E;  1GO2 A;  4J9I A;  5GJW B;  3UT1 A;  5FO0 A;  3CP2 A;  3QYH B;  2EYW A;  3CCQ B;  1M90 C;  3BY1 A;  1KZL A;  1R5N A;  3MCA A;  3VO1 A;  1BIB A;  1OX9 A;  1UHC A;  5GAN 7;  4GLK A;  2PU9 B;  1ZM4 A;  2EAY A;  3CCJ T;  1NJI R;  4MDW A;  1QCO A;  4FSX A;  4EH1 A;  3QE2 A;  4N3N A;  4ZCM A;  4J8O A;  5KH6 A;  4M7A C;  2BTT A;  3OYF A;  1QWE A;  2E4H A;  2LC4 A;  1Q86 C;  2JJ2 A;  2DXU A;  2KE9 A;  3JCM e;  4M4S A;  2QA4 Q;  2FYK A;  2ZPF B;  4XLE A;  4EIK A;  2CND A;  5KE2 A;  2X9H A;  1PNJ A;  2QQS A;  4X07 A;  1RAB B;  1UTI A;  1P92 A;  5DY9 A;  3X28 B;  1KG1 A;  3U6K A;  2VZL A;  1EFR A;  4FL6 A;  2E65 A;  1JA1 A;  1G3T A;  2L8D A;  4LDV A;  1G83 A;  2VNK A;  3JCM J;  2RM4 A;  2J6K A;  1RLP C;  2CW5 A;  5DN6 A;  2XG8 D;  3X25 B;  3CQT A;  1YIT B;  4OOX A;  5L8R E;  2F5K A;  4B6M A;  3SB2 A;  2I0N A;  2C77 A;  1YN8 A;  2DJQ A;  2DL4 A;  4TMZ A;  1OUL A;  2RI2 A;  5GAN 8;  4ZCL A;  4E2F B;  3T53 B;  3PTA A;  4BE2 A;  3SJZ A;  3OYE A;  2LT4 A;  2BIV A;  2QTV A;  5FWC A;  5TV2 A;  2RN8 A;  2QQA A;  3UDC A;  3FRN A;  3RY8 A;  1ZLM A;  2M16 A;  1YJ9 T;  1IHM A;  4D6W A;  4ZTF A;  5C6S A;  3JCM g;  4UZU A;  4NNJ A;  1VQ7 B;  1EP3 B;  2NPF A;  4ORZ A;  3PA2 A;  3OB9 A;  1BCO A;  1BI1 A;  1UGP B;  1QG0 A;  2EKH A;  2O88 A;  4RPB A;  1FMV A;  2XID A;  2GJP A;  4PFP A;  2VYT A;  2CUD A;  1WOP A;  1VOM A;  3S3O A;  2WZN A;  3RKY A;  1EFU A;  2KMT A;  4E7S A;  3EGX B;  2DXT A;  5IYR A;  1OQK A;  4PFO A;  5FWB A;  3REA B;  3L2U A;  1UB4 A;  4H9G A;  5GAO n;  4HT8 A;  5THX A;  3UPU A;  4J7I A;  4RD3 A;  2PUK B;  5CQX A;  3M9Q A;  4G1V A;  1R0C B;  2VBT A;  2EQM A;  5KYW B;  2YXY A;  4F7U E;  1VQ9 Q;  1Q7Y U;  5GMK j;  2ZZD A;  4ASU A;  3VRZ A;  2DO3 A;  1D1N A;  2I2L A;  2PVO B;  4LBV A;  4TN1 A;  2K3B A;  4JLI A;  1KQS S;  1CQX A;  4X7F A;  1YWO A;  2ZGW A;  1VQ9 A;  3Q1J A;  2BV3 A;  1T3S A;  1JXM A;  2CP0 A;  2X3X D;  1KQS P;  3CC4 A;  2V4D A;  2E64 A;  1AVZ C;  5GAN h;  2R5M A;  1OZ2 A;  4RD1 A;  8AT1 B;  1WHM A;  2ZTG A;  1FMW A;  3NFC A;  3AST A;  1FRN A;  4BE1 A;  5GAO l;  2F2W A;  3CMA T;  2F5T X;  1WHJ A;  3VNU A;  3ZIA A;  4RLZ A;  5D7U A;  1GCP A;  4DQ2 A;  3W5V A;  3HRU A;  4QVJ A;  4B47 A;  4M53 A;  3A35 A;  1JA0 A;  1MUZ A;  4WZT A;  2MIO A;  5GAN 5;  3BQJ A;  1KK1 A;  2WJY A;  2DRM A;  5D6Y A;  4P22 A;  5LMZ A;  1BI2 A;  3VYH B;  3C94 A;  3SD4 A;  1V0F A;  1VQO A;  2ZAE A;  2F43 A;  4Z4W A;  2LZJ A;  1MRZ A;  1SHF A;  1RL2 A;  2M0Y A;  3G4S T;  4IIO A;  2QEX Q;  2CH4 A;  2JZ2 A;  2AHJ B;  2J6F A;  2KYB A;  1WQW A;  1AHJ B;  3UF4 A;  2DBM A;  2K7A A;  2GTO A;  4RMO A;  3ASQ A;  1YCY A;  4B4D A;  4ZGQ B;  3M0S A;  3GSI A;  3CEY A;  2NWM A;  5KE3 A;  1KFZ A;  5KCO A;  4G7X A;  4F17 A;  4JJD A;  2L2P A;  2VBS A;  2QGF B;  1Q82 D;  4HE6 A;  2JN0 A;  1YBY A;  3J81 E;  2E3I A;  1N06 A;  2VJJ A;  4LUE A;  1D0Z A;  4CC2 A;  2V7T A;  2X6Y A;  3P8B B;  4UZE A;  2D6F A;  3T56 B;  4RCB A;  1C6V X;  4RTW A;  4AFQ C;  4F14 A;  4C8Q G;  2MI6 A;  2SRC A;  1X75 C;  2JUF A;  3LVB A;  1VQ8 B;  4D8K A;  4JPB W;  4L59 A; 
#chains in the Genus database with same CATH homology
 3HTR A;  2DOG A;  3H9N A;  2DYI A;  1PM3 A;  2F1L A;  2QGG A;  3A1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...