4X8IA

De novo crystal structure of the pyrococcus furiosus tet3 aminopeptidase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
346
structure length
337
Chain Sequence
MVDWELMKKIIESPGVSGYEHLGIRDLVVDILKDVADEVKIDKLGNVIAHFKGSAPKVMVAAHMDKIGLMVNHIDKDGYLRVVPIGGVLPETLIAQKIRFFTEKGERYGVVGVLPPHLRIDWDSIIVDVGASSREEAEEMGFRIGTIGEFAPNFTRLSEHRFATPYLDDRICLYAMIEAARQLGEHEADIYIVASVQEEIGLRGARVASFAIDPEVGIAMDVTFAKQPNDKGKIVPELGKGPVMDVGPNINPKLRQFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysyl aminopeptidase
publication title Tuned by metals: the TET peptidase activity is controlled by 3 metal binding sites.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 111
structure length 337
sequence length 346
chains with identical sequence B, C
ec nomenclature ec 3.4.11.15: Aminopeptidase Y.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 4x8iA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x8iA01
3IFEA 1CP6A 1VHOA 2AFUA 1TKFA 3CT9A 4ZI6A 3FMCA 4OMEA 5F09A 1LAMA 3FF3A 4A37A 5CBMA 4UIAA 4R8FA 1XBUA 4PXEA 1ELMP 5LYDA 3KQXA 1ARMA 2AFZA 4P6YA 4R76A 5LYLA 4X3RA 4F9UA 2V8HA 4OC4A 3SJEA 4PQAA 5HVFA 2G9DA 1Z8LA 4GM5A 3I1UA 2ZEFA 2GLFA 4F8ZA 3IIBA 3D68A 3KI9A 3KGQA 1F2OA 3KHXA 2EK8A 2Q51A 1LFWA 3KR4A 2PJBA 2AFOA 3PFEA 1DE4C 2HB6A 1GYTA 3B3TA 3HLPA 4AXVA 2XEGA 4NGNA 1TF8A 2DEAA 2QYVA 1LOKA 4H2KA 3B3SA 7CPAA 2JBJA 4NJQA 4OC5A 3T8WA 2IJZA 3D4UA 3SI1A 2Q43A 3PB4X 3PRTA 4P4EA 4JYWA 5LYIA 4B6ZA 2PVWA 4OC3A 4YU9A 2GREA 3PBEA 1LAPA 2BO9A 3FEEA 5HXDA 4P4JA 2GLJA 2PJCA 3NFZA 2AFXA 2ZEOA 5DS0A 3IWWA 3SI0A 2OR4A 1R3NA 4ZX8A 1F2PA 1TKHA 2IQ6A 3PB8X 1ELLP 2PIYA 4NGTA 2PIZA 3D7HA 4KSIA 4A39A 2ZEHA 3NH4A 3S9LA 4P4IA 1TXRA 3S9NA 2PJ4A 1ZG9A 2QJ8A 4NGMA 3WABA 4WWVA 1KWMA 3NA6A 2EWBA 2XEIA 3FECA 1VGYA 4DUKA 4PXBA 5LYFA 3KL9A 3PB7X 1M4LA 2PCUA 2I3CA 4ZX9A 4YWYA 4UF4A 2C6PA 2CTCA 1ZLIA 3D7FA 4Z65A 2ZEGA 3JRUA 4PXCA 4X2TA 2F8HA 4DYOA 1ARLA 2PJ9A 4P4FA 4ZYQA 3H8GA 3ISXA 2AFMA 4ZY2A 2PJ8A 3IJ3A 3SI2A 2WYRA 1H8LA 1CPXA 4ZY1A 2C6CA 3VARA 3B3WA 3CPAA 2PJ1A 4OIWA 1ZG8A 1DTDA 3L2NA 3LWUA 4OC1A 4RUHA 3S9MA 3N5FA 3H8FA 5THWA 4FUUA 5D29A 1TKJA 2CTBA 3GB0A 5HVHA 4OIDA 4A38A 5K8NA 5JM6A 3V38A 2AFWA 3RBUA 2PJ6A 4P45A 2WZNA 2BOAA 2PRQA 1YMEA 2V8DA 5I4MA 2PJ5A 2FVGA 2ZOGA 3WC5A 1JQGA 1VIXA 1PCAA 1NSAA 1ZG7A 5D8NA 4EWTA 2XEFA 4NGPA 1FNOA 4MMOA 4TNUA 4IAVA 3PB9X 2PJ0A 2PJAA 2PJ3A 1Y0RA 3VATA 1ZLHA 4NJRA 4DJLA 1QQ9A 4FAIA 2NSMA 3MRUA 3VH9A 4F9VA 4ONWA 3BI0A 4NGRA 4OP4A 1FT7A 1IGBA 1F57A 3KHZA 3IO1A 3DLJA 4P4DA 4UEZA 4MHYA 6CPAA 5LRGA 2C6GA 3B35A 4FWUA 1LCPA 1YW6A 3FVLA 3D66A 2Q4ZA 4JZ0A 5J1QA 4G1PA 3D67A 3ISZA 3KASA 4UIBA 2O4HA 4NGSA 1Y0YA 4R6TA 3RAMA 2ZOFA 1CG2A 2ZEEA 4MHPA 1BAVA 1YSJA 4ZY0A 3NH5A 4UEFA 2JEWA 5LRKA 1QMUA 3FH4A 2PVVA 2V8VA 3HUVA 3B7IA 3B3VA 4OC0A 5K8PA 2ZEMA 1Y7EA 3KR5A 8CPAA 3IEHA 2RB7A 1PYTB 2EK9A 2ZELA 3KZWA 4A94A 1EE3P 3H8EA 4CPAA 3B2YA 3IC1A 2BCOA 5K8OA 1YLOA 2V77A 1XJOA 3BXMA 4R7MA 2HC9A 3DGVA 3V7ZA 4LQGA 5JGFA 4UEEA 2NYQA 3FJUA 1CBXA 3CPXA 2JBKA 3TC8A 3D7GA 1XFOA 1BPMA 5HVGA 3SJXA 3BI1A 3PFOA 1Z5RA 2PE3A 1IY7A 4OC2A 3SJGA 3NH8A 2GU2A 2RFHA 1CX8A 1R43A 3PEIA 1HEEA 3CDXA 1LANA 4X8IA 1OBRA 3FEDA 3QNVA 4EMEA 2VL1A 4PPZA 3WC6A 4TWEA 1RTQA 2OOTA 3TX8A 3K2KA 3K9TA 2PJ7A 4W9YA 5LRJA 2ZENA 4MXUA 4FBEA 2ANPA 1AYEA 5CPAA 1UWYA 2C1CA 4K3NA 3RZAA 3LMSA 1VHEA 2IMOA 3KQZA 5ELYA 4EFDA 1BPNA 1XRYA 4OKOA 4MHZA 2XEJA 3WT4A 2PJ2A 2ABZA 3PB6X 4MCPA 2F7VA 3SJFA 4MCQA 1Q7LA 3BHXA 1TF9A 2CIJA 2POKA 1XMBA 2J9AA 2CF4A 4P10A 3MN8A 4MHNA 4WJBA 4P4BA 4P44A 4NFRA 5IB9A 4O23A 3GLJA 3B3CA 2AFSA 3GUXA 2QVPA 3PBBA 2ZEDA 1AMPA 3D7DA 1BLLE 4IK2A 2O53A 1Z2LA 2V8GA 5K8MA 1HDQA 4IHMA 1CP7A 1YW4A 4PXDA 2ZEPA 3WC7A 4MRIA 5JH9A 4Q7AA 4MCSA 4BD9A 4MCRA 1HDUA 1CPSA 4NGQA 3FX6A
chains in the Genus database with same CATH superfamily
1VHOA 4CYOA 4QVAA 4ZI6A 3CESA 2JIZA 3SXOA 1TVCA 4RDKA 1KK3A 5F09A 3B8HA 3FF3A 4A37A 3FNCA 5LYDA 1KTVA 1ARMA 4ZGQB 3E20A 3CCLB 4KOVA 5IYQA 2DEUA 2VNKA 4UWIA 1WWZA 2NMTA 3SEJA 2G9DA 3TOAA 3R9FA 2WSSA 4GM5A 1VQ7B 5TR9A 1I12A 2GLFA 3IIBA 3D68A 4KKSA 2WPXA 1F2OA 1GJRA 1RXTA 2EK8A 2Q51A 3F0AA 1LFWA 4U9UA 1VQKB 1DE4C 2VZZA 4DQKA 2HB6A 1Z4EA 2GE3A 3VNUA 4NGNA 3RNZA 5C88A 1I18A 2P6EA 5IYRA 2C5BA 2F43A 4XLCA 1DDIA 2VEZA 1EP3B 1TLLA 5AGEA 2CNDA 4HIZA 7CPAA 5FO0A 2YNCC 3SKBA 3VO1A 1YX0A 5L46A 4P4EA 1E62A 4B6ZA 4Y9RA 2OBRA 3CXCB 1N0UA 5CDFA 4OC3A 5H59A 2VNHA 2EUIA 3H94A 1GO2A 2P0WA 4E8OA 1LAPA 5HXDA 2WJVA 4UA3A 2VNJA 2GLJA 3U2QA 1Y9KA 2HDNB 1S3ZA 1F20A 3CCQB 3SI0A 1QFYA 2RC5A 2DPTA 3PB8X 3LODA 1QGAA 3CW2A 4G7WA 4CAEA 4FD6A 3NH4A 4K1XA 2R8VA 2Z3NA 5TV2A 2CXAA 3S9NA 1TTTA 3T53B 1T6YA 4YXWA 1P0HA 4NGMA 1OGJA 2XEIA 1JB9A 1NB0A 1IYLA 3FECA 3QB8A 1R5OA 4DUKA 1COWA 1M4LA 2DPSA 2PCUA 3U6KA 2ZL6A 4YWYA 1WP6A 2VBQA 4ASUA 4UF4A 4UZUA 1M4IA 1ZO0A 4AVBA 3CCMB 2KVOA 2PR8A 4P3IA 2R6HA 4X2TA 4B13A 4HPSA 4DYOA 2EO8A 3BJ7A 3P2HA 3FRMA 4P4FA 2PDOA 3G71B 2XZLA 2FIWA 3TTHA 4YGOA 4UBRA 1WSVA 1WU8A 1EWYA 4X0CA 2AFMA 4KSFA 1N05A 2XGJA 3SI2A 2OBSA 5GV8A 2HV2A 4Y49B 1W87A 1RQRA 4QUZA 3CPAA 2CK3A 1ZG8A 5F4OA 1DTDA 3L2NA 3LWUA 4OC1A 2FS5A 3S9MA 3N5FA 2BPOA 4FUUA 1YX2A 4P1VA 5G22A 2CTBA 3GB0A 1QFJA 4XM3A 4OIDA 2X6WA 5JM6A 2BM0A 2X85A 3ZPNA 4EVYA 3OPOA 2V7WA 2WZNA 2BOAA 4XLEA 2V8DA 1VIXA 2PLFA 3NE5B 1IJFA 1NSAA 1WOSA 4KKUA 4XPLA 2GJKA 4MMOA 3ZZIA 2YGWA 1VQPB 2PJ0A 1QVFB 5E96A 3VATA 2EVNA 1AIPA 4FD7A 3BQJA 4L8JA 1QGZA 3OFNA 3VH9A 1BMFA 1ZM2A 4E0FA 4NGRA 3B8GA 4OP4A 1QSMA 5CNPA 1FT7A 2B5GB 2BGIA 1F57A 3ONUA 4P12A 1KK1A 4E2AA 5FIUA 3K9UA 3SHPA 4UEZA 5H86A 3R6KA 2JEVA 3BCFA 4G7XA 4FWUA 2CBXA 4PABA 5BWAB 1LCPA 1YW6A 2FCKA 3R9EA 2PR1A 3D66A 3FVLA 5J1QA 4F6AA 4AVAA 4UIBA 1Y0YA 3TO6A 4KKTA 2ZOFA 2EBJA 5F4MA 5A88A 4MHPA 1AMOA 3NE7A 2XEXA 4XLAA 1YSJA 4A31A 2LZJA 2BM1A 1QMUA 3P27A 1YITB 5AN9A 3WR7A 3W2HA 5B6IA 4UCMA 3S6FA 1ZM3A 4NNJA 1Y7EA 4RPBA 4MJ8A 1PYTB 4MHDA 1XF8A 1NJID 3OZUA 1WOOA 1EE3P 2B7BA 4OP7A 2F1MA 1SKYB 3ONYA 1K8AD 5K8OA 3FPPA 2FXFA 3W5HA 3BXMA 1UD2A 2B4BA 4XORA 3CCSB 3V7ZA 1W9XA 4P22A 4XMYA 5DSZA 5JGFA 3C26A 4UEEA 2Q4VA 3FJUA 5A27A 3TE4A 3SJXA 4B4DA 2GK7A 2F1LA 2PE3A 1V5VA 3Q39A 4C7HA 4UCNA 1HEEA 3PUMA 2B5OA 3ZBUA 3CDXA 4EMEA 2DCUA 4YALA 4KOSA 3ZZ0A 4QVTA 3K2KA 4FD5A 1YGHA 3WBKA 3ASTA 4MXUA 1FNDA 1E63A 2Z11A 1AYEA 3SJPA 4B14A 4K3NA 3LMSA 3ZZUA 4DQLA 2IMOA 3DSBA 1QSNA 5AG6A 1T6ZA 4DK0A 4TMTA 3BCDA 4RD1A 4AG7A 2XEJA 2AHOA 4AF7A 1I7PA 4HE5A 1NBMA 2D4PA 4KSAA 3BHXA 1TF9A 2CIJA 3WNBA 1UMKA 2XZPA 2OZGA 3GIRA 2CF4A 4ACBA 1Q82D 3MN8A 2G3TA 1ON0A 3A9LA 4P44A 4NFRA 4ROXA 4PV6A 1Q7YD 2C4TA 4XKWA 4B5PB 1VQ5B 4O23A 1YVOA 4Y49C 4CRZB 4UAJA 4Z4YA 1FNBA 4IK2A 3P2FA 2O53A 2J8MA 3A35A 4KOYA 1GAQA 1YW4A 5AG7A 1YJ9B 1VQ9B 1Q86D 4TMZA 4MCRA 2QEXB 1CPSA 1NDHA 3FX6A 2WZPP 5GCNA 4CAWA 4HE6A 3CT9A 2J8RA 5KSWB 3CMMA 3JU4A 4QBJA 3A3BA 2QGGA 1EP2B 1KK2A 5CBMA 4TKOB 4R8FA 3JQQA 1XBUA 3GVLA 1ELMP 3R6JA 1CQXA 5THXA 4RJLA 3ES9A 4C68A 4R76A 4X3RA 2V8HA 4OC4A 4PQAA 2HUZA 4FD4A 5IK2A 4ZBGA 4KVXA 5IB0A 1KMHA 1Z8LA 3D2PA 3A8IA 3G6EB 3I3GA 1XEBA 3S6KA 3A1PA 1PKVA 4LUAA 3KHXA 3B3TA 3HLPA 4FN5A 3LQ6A 3IU2A 4R57A 1J9ZA 1OHHA 1W34A 1YI2B 4L8AA 1TF8A 2DEAA 4CGLA 5A28A 2J7KA 1Z8XA 4F7DA 1FNMA 2Z6BD 3T8WA 1BJKA 4FXUA 5HZAA 2B58A 2DIEA 3KKWA 4A2ZA 2VYQA 3FKSA 2Q43A 4X7CA 4RCZA 2BMWA 1ZM4A 3I9SA 4JYWA 2W6IA 2PVWA 3ASPA 4JXQA 4YU9A 1SQHA 1WK4A 1MJ9A 3CC4B 3PBEA 4C2YA 3N7ZA 1I8DA 1KUXA 4P4JA 2PJCA 3QFRA 4KVME 1UD4A 1XMTA 1Z4RA 4H6ZA 2DF5A 2BSWA 2BEIA 5IX3A 4M1KA 4ZX8A 4WZLA 4MFLA 1WOPA 1F2PA 1TUIA 2YWGA 1H8EA 2IQ6A 2ZL5A 1ELLP 2Z0ZA 2PIYA 3CCEB 3DR6A 1S72B 1E43A 5FNZA 1M1DA 2HQYA 2ZEHA 4P4IA 1TXRA 3W2IA 3E0KA 4H9GA 4XNHC 1YIJB 1MJBA 2X6YA 2ZW5A 3WABA 1KWMA 5JPHA 1NB9A 3CRZA 1E3ZA 2P3MA 1VGYA 1VQ8B 2P6GA 4PXBA 3KL9A 2R1IA 3PB7X 4DK1A 5HXBA 4TT3A 1IB0A 3GKRA 4A95A 2D3LA 1IOFA 1JNYA 4XQFA 3WQZA 1ZLIA 2BL1A 1WPCA 2C6PA 2ZEGA 3JRUA 3E1YE 3D2MA 2QDXA 2Z3PA 5ISVA 2Q6OA 3BC9A 1QG0A 4KLVA 1PUAA 2PMDA 2JJ2A 1V0CA 2NPFA 1WORA 4Z4TA 3GYAA 2PJ8A 5AG4A 2CW5A 3RO0A 3VR6A 3CZXA 4ZCMA 1IJEA 5H84A 2FSRA 4ZY1A 3SXNA 1KRHA 2B4DB 2PJ1A 4PC7A 4LBVA 1NE9A 4YAUA 5A8AA 1E1RA 2GK6A 3A3GA 4XKVA 4RUHA 2BGJA 4PC3A 3H8FA 3B78A 1G7RA 1VJSA 3I55B 4TSFA 5EC4A 1VF7A 5HVHA 5BSXA 4LBZA 3RBUA 4CAXA 4P45A 4NSQA 2XNCA 3OWCA 4XOTA 3AGPA 3G05A 2FVGA 2PJ5A 3CCRB 2ZOGA 5BSYA 4YFJA 1PCAA 4MFZA 4QFMA 1KZLA 2XEFA 2VI7A 1FNOA 4TNUA 5C82A 3OJWA 4Z1MA 1CM0A 2PJ3A 1Y0RA 2X53S 4LC0A 4XONA 2K5TA 3BH4A 3U6BA 2DETA 3MRUA 2CRVA 2G0BA 3EXNA 3D8PA 4CGPA 1OGIA 1IGBA 3LVBA 4II2A 4R9MA 2X7BA 1YQEA 2Q6LA 3OEEA 1XE1A 4Q38A 1QSRA 3ZC3A 3DLJA 2OK7A 4U5YA 4CYQA 5KTCA 4CAVA 1BX1A 1UD5A 5LRGA 1FY7A 2HMAA 4HNYB 1DG1G 4G1PA 4JJXA 4PC6A 4C0SA 4NGSA 3LQEA 1S4MA 4X7DA 4R6TA 4RS2A 1CG2A 4M6HA 4N3GA 4AF6A 4ZY0A 3NH5A 4UEFA 4YRHA 2JEWA 4G1BA 2GFQA 4A30A 2PVVA 2EFGA 1K73D 3B7IA 4RCYA 4OOXA 5FL7A 3KR5A 1I21A 1V0EA 4RPDA 5IYWA 2ATRA 2V7XA 1ZM9A 4A94A 1MRZA 1QX4A 1HVXA 1B2RA 3W2GA 2M5SA 3IC1A 4R7MA 2HC9A 1M90D 3DGVA 1S60A 1KK0A 2GPJA 2BUEA 5KTAA 1OB0A 1G7CA 1W2BB 4B48A 2NYQA 2B3UA 1U2RA 5IYPA 1CBXA 2JBKA 4B3XA 5F47A 3T9YA 5HVGA 3W5VA 2DERA 1Z5RA 1JJ2B 4OC2A 4L89A 4DNRB 3SJGA 3NH8A 4KLWA 2GU2A 3OE7A 1R43A 3QSYA 2YNCA 5J8FA 1FDRA 1XQBA 2VJIA 1LANA 1FRNA 5HKKA 4AB7A 4PPZA 3WC6A 1RTQA 3HAGA 2OZHA 3Q38A 3CP8A 3FXTA 4FK8A 5TRDA 1UFHA 2VQYA 3DR8A 4KOUA 1N8RD 2ZZEA 5KNLA 4RD6A 4Z4RA 4OPSA 3KQZA 3BY1A 4KORA 1S7NA 2VNIA 4AVZA 3VWDA 1DDGA 4M53A 4M6IA 1EFRA 3PVDA 4CRYB 1XMBA 4M6GA 2KCWA 4P10A 1QSTA 3V8IA 3VWEA 1T6XA 4MHNA 2ZZFA 4WJBA 3CC7B 4RDLA 4P4BA 1B23P 2FL4A 4KUBA 5IB9A 3GLJA 3GUXA 3WXMA 4JMQA 2HLDA 2QVPA 4PSWA 1AMPA 3GVJA 2JLMA 3W6SA 1QSOA 3QAHA 2E1BA 1Z2LA 3LD2A 5K8MA 1HDQA 4Z4WA 3S6HA 4NF1A 2YWFA 1CP7A 3ZZTA 3A8JA 1M1KD 2OTLB 2ZEPA 2A4NA 3QAYA 3WC7A 3SLDA 4MRIA 1BPLA 5JH9A 2ZXHA 1W0KA 4U9ZA 2OB0A 4BD9A 2AE6A 1EFUA 2ZTGA 4MFKA 1HDUA 1E1QA 4PK3A 1CP6A 4CGMA 4YELA 1TKFA 4G6IA 4MY3A 2JDIA 3CB4A 3G4SB 1Y9WA 2DYIA 3TT2A 1WSRA 3RY8A 1EXMA 2AFZA 1Z8TA 1RQPA 4XNHB 4OPOA 3Q6QA 4KOTA 2BF4A 2IL4A 5HVFA 1FNCA 2XOKA 4WZEA 3ASRA 4G5GA 2FIAA 2ZEFA 2D4OA 2W6JA 4JD6A 3OW7A 3KGQA 3KR4A 2PJBA 2AFOA 1GYTA 4X7EA 3W2EA 4EH1A 2BV3A 2XEGA 3F8KA 4MY0A 2QYVA 4H2KA 4II3A 4IW3B 4GS4A 4OC5A 2JDDA 3D4UA 1IYKA 3MGDA 3PRTA 1IU8A 5LYIA 2ZW7A 1PJ6A 4KUAA 3R96A 4Y9UA 4NCNA 4PGOA 2BO9A 3FEEA 4B47A 4WZKA 2ZBUA 1MABA 4WQMA 3NFZA 3Q6RA 5DS0A 3IWWA 1NMTA 2OR4A 2YNDA 4CYPA 1XB2A 4HKFA 1TKHA 4NCZA 1VQ6B 2OZUA 4NGTA 2PIZA 4M2LA 3D7HA 4ACAA 3CXSA 2XZOA 4A39A 1L0CA 1VQMB 3S9LA 3TO7A 4ONUA 5IYNA 4AC9A 1VLOA 3JVNA 1ZG9A 2QJ8A 1CJWA 2PIAA 1PU9A 4WWVA 3W2FA 3NA6A 2VJJA 3WNCA 4R3KA 2Q4YA 2ZITA 1QFZA 1BLIA 4Y7CA 1M4GA 4AG9A 1G7SA 1B6BA 1XIXA 2I3CA 4RD0A 1QH0A 3IWGA 4GXHA 4B5OA 1S7LA 3OKXA 2CTCA 3D7FA 1ZUNB 3OOCA 4XPDC 2QTLA 4PXCA 1F60A 1ARLA 4RD4A 4ORFA 2QA4B 2OBTA 1IICA 4P2NA 4E0AA 4C43A 5LMZA 4JWPA 4ZYQA 3VNVA 1TIQA 2CNTA 4ZY2A 2G3AA 4N3NA 3CP2A 4B3FX 4MYUA 2WYRA 1N06A 1CPXA 2C6CA 1VQLB 4J3GA 3B3WA 2QE7A 2I79A 5FO1A 5THWA 1N07A 4PC2A 1KC8D 4TN1A 2V7TA 1GVHA 1IB1E 2BVNA 3AVVA 3T90A 3AVYA 1R5NA 2ZXVA 4A38A 5K8NA 4PC1A 2Q7BA 2AFWA 1CNEA 3V38A 3A8KA 4RDJA 3AGQA 2PRQA 3V7AA 1YMEA 4ZCLA 5I4MA 1YVKA 2VZLA 3WY9A 1V0FA 4LX9A 4IAVA 2PJAA 4I49A 3QFCA 4II9A 3EC4A 4NJRA 4B12A 2Z10A 5J3OA 2QN6A 1I1DA 1UD3A 3BI0A 3B82A 4CGOA 4M85A 4Z4SA 5F49A 2ZZGA 4A32A 4CS0B 4M4SA 1M4DA 1Z9UA 3P26A 1GHEA 4UFXA 1U6MA 3CD6B 5DWMA 6CPAA 3BY2A 3B35A 4C7IA 3ZJ0A 4YHBA 2H5MA 2OTJB 4P25A 3ISZA 4IUSA 5J35A 3KASA 2B3VA 3VMFA 3TOBA 4G1VA 2D3NA 2CNMA 3RAMA 4XR6A 4PK2A 4MFPA 3CPWB 3WBJA 2Z3KA 1E64A 4XN3A 1QVGB 3CCJB 2I00A 3FH4A 4KS9A 3ZUGA 1VKCA 3OEHA 2ODFA 3KEWA 4OC0A 4R3LA 8CPAA 3H5ZA 2ZW6A 3KZWA 4DNCA 4CPAA 3B2YA 4UCPA 1VLYA 5H5JA 1YLOA 4R87A 2V77A 2B5GA 4P9SA 2X6XA 3DDDA 4JXRA 4MBUA 2FE7A 5I0CA 1Q9SA 1N71A 4Q7JB 5JQ4A 5IV0A 3ZIAA 4BMHA 3TC8A 4H89A 1WTHD 1FX0A 1BPMA 2Q44A 3J81k 1G7TA 3JUWA 4OLLA 1BX0A 2V7VA 1D1NA 2CY2A 2RFHA 1CX8A 4UFWA 3QNVA 1MK4A 1QGYA 3BNWA 2NV4A 2VL1A 3JTKA 3GQBA 1SM4A 4XL9A 2OOTA 2D74A 3PZJA 4W9YA 2Y0MA 4WZTA 2ZENA 5F46A 5EMNA 3DNSA 2XNDA 2WPDA 5CPAA 2C1CA 2PQ8A 3RZAA 1VHEA 2C27A 2YNEA 3GVKA 2PRBA 2ZL7A 4ZCIA 1OZPA 3FB3A 4C2ZA 3CXPA 2VBVA 3OW2B 4MFJA 3G8WA 4XLHA 4Q36A 1XRYA 4OKOA 4MHZA 3WT4A 1EFTA 4BPRA 2ABZA 3PB6X 1HA3A 3EY5A 1D8TA 2C78A 4LQ6A 2O28A 3SJFA 1Q7LA 4B43A 2VBSA 2VBUA 1E79A 2J9AA 1PJ7A 3F5BA 4TMVA 2Z3LA 1JWQA 5KW9A 3TCVA 4QV2A 3B3CA 2AFSA 1K4JA 5G21A 2QMUA 2P6FA 1H85A 5DWNA 5J8CA 4PXDA 1Y7RA 2X8KA 3AVWA 4NXYA 3I56B 4RD2A 5GV7A 3QFTA 3CCVB 4UZEA 3QE2A 3S6GA 3IFEA 4NBSA 4DNTB 2AFUA 3G3SA 3WNDA 2XNJA 4XD7A 3FMCA 1W35A 4X07A 1J4JA 4OMEA 1KD1D 2GQFA 1LAMA 2REFA 4UIAA 3R95A 4PXEA 2C4UA 4X06A 1WDTA 4QB9A 2QTZA 3KQXA 4PAAA 3OP1A 5F4JA 4P6YA 2R7HA 5LYLA 4P6VF 4F9UA 4BINA 3SJEA 1Q2CA 1YK3A 3ZBTA 1A2ZA 3FJOA 4B5PA 3W6XA 2AJ6A 3V76A 2YWHA 4TMXA 1LRZA 3I1UA 1YJWB 4F8ZA 3OZWA 3KI9A 1RO5A 4QVJA 3PFEA 4XPDB 4KVOE 4AXVA 3PUNA 2F5IA 2ZTNA 1LOKA 3ASQA 3B3SA 1KZFA 2JBJA 4NJQA 2IJZA 1YJNB 3SI1A 3JQRA 3PB4X 3FBUA 1EP1B 3EO4A 2C77A 1GR1A 1T5EA 3R9GA 2WSAA 4P26A 3SJZA 3W5UA 2GREA 4YAWA 4CAFA 1A8PA 4KOWA 2AFXA 2ZEOA 2I1LA 2Z3MA 4F0XA 4C2XA 3RYOA 5G1ZA 1X10A 4UWJA 1R3NA 2Z3OA 1W0JA 5A89A 5HZBA 2OU2A 3LNNA 4BBHA 1NSLA 1QUEA 4QUSA 1BO4A 4KSIA 1MJAA 3IWEA 1CNFA 3CTAA 2BSAA 2PJ4A 4OOVA 1BOBA 4J0QA 4MI4A 2EWBA 2HCJB 3NE8A 2REEA 5LYFA 3LO8A 3GIUA 5HH1A 4ZX9A 4UFVA 1VQ4B 3MMPA 3ASSA 1H42A 4Z65A 2B7CA 2DOGA 3W91A 5AG5A 4TMWA 4MYTA 1UD8A 2E1RA 2F8HA 1X12A 4LBWA 2PJ9A 2VZYA 3D3SA 5F48A 1VHSA 3H8GA 2GANA 3ISXA 3MCAA 4YEJA 4M3SA 1Q2YA 1AUGA 3IJ3A 1H8LA 5KTDA 3CMAB 4OADA 4A33A 1E3XA 4KZTA 3VARA 1OB5A 4RI1A 4OIWA 4U9YA 4RD3A 2J8NA 4X7FA 4LBYA 2PC1A 1N0VC 1BQEA 2WUUA 5D29A 4JLYA 1S5KA 3CXQA 3LACA 1TKJA 3PENA 4HNWB 3GSIA 2JJ1A 4RM0A 4ZV4A 3IGRA 1KQSB 4IF5A 2ZZQA 4YAOA 1GAWA 4FWTA 2PJ6A 1R5BA 1XE4A 2R98A 5TY0A 1S0UA 2GJPA 3OZVA 5G20A 4M0LA 4B44A 1JQGA 1KUVA 3WC5A 1IIDA 2OYNA 2Q7SA 1KJZA 2F4NA 1ZG7A 2YWEA 2VBTA 5D8NA 4X5KA 4HNXB 4EWTA 2RC6A 4NGPA 3PGPA 3R1KA 2ZBVA 2QMLA 3PB9X 3T56B 4Z4UA 1D2EA 1OB2A 1ZLHA 1P4MA 4DJLA 4XOPA 3AVXA 1QQ9A 4FAIA 2NSMA 2WPWA 1H8HA 2V7QA 2WR8A 3TFYA 4F9VA 2C2WA 4ONWA 4QC6A 2B4DA 4CYNA 3VO2A 1UD6A 3KHZA 3PA2A 5DN6A 3IO1A 1YLEA 2EIXA 4KOXA 4RN7A 1YHQB 4P4DA 1JA0A 4MHYA 3JQPA 3FPKA 2ZPAA 2C6GA 2QIRA 2CNSA 1YREA 3CCUB 4JZ0A 2Q4ZA 2JDCA 3D67A 2O4HA 2VXKA 2ZXIA 3OJXA 4B11A 3WYAA 5E6TA 1YR0A 4OOSA 2ZEEA 4AVCA 4B10A 2Q6IA 1BAVA 2QECA 2C5HA 2V31A 4ZGYB 3SLNA 1Q81D 2ZW4A 5LRKA 3TO9A 5EBVA 2V8VA 3HUVA 2Q04A 2RC4A 3B3VA 5FVJA 4XPKA 5K8PA 2ZEMA 2OK8A 3GY9A 3IEHA 2RB7A 2EK9A 2ZELA 3OAAA 3H8EA 3D26A 4P3YA 3EFAA 2BCOA 4XN0A 1XJOA 1JA1A 5EMIA 2PSWA 4H6UA 3H9NA 4LQGA 1VQOB 2CC2A 1KUYA 1N08A 2ARHA 3CPXA 3D7GA 1XFOA 3QFSA 1IOIA 1S7KA 3H4QA 3BI1A 3PFOA 1IY7A 4RLZA 2D9RA 4XLFA 1Z8WA 3PEIA 2DY1A 3FIXA 4X8IA 1OBRA 2DXQA 3FEDA 1R57A 3PA1A 3DDYA 2OH1A 3AVUA 2V7UA 5JBQA 1IHMA 4TWEA 4CGNA 3TX8A 4MFQA 3K9TA 2PJ7A 1VQNB 4OAEA 5LRJA 3BLNA 1K28D 3IU1A 2X3UA 4OPVA 4FBEA 2ANPA 1UWYA 2X0KA 1NRKA 1DARA 4F0YA 4Z4ZA 3UY5A 1P4NA 4NEXA 1ELOA 3PP9A 5ELYA 1FRQA 1Q2DA 4EFDA 1BPNA 1QUFA 3T51B 4B3GA 2PJ2A 1SKQA 3MHPA 1PJ5A 2R9VA 4XNFA 4MCPA 2GJRA 2F7VA 4MCQA 3BJ8A 2POKA 2FT0A 3Q3AA 2FX3A 5FA6A 4QHYA 4GQNA 1XOVA 5HMNA 2Q6KA 4PSXA 2WJYA 1EFCA 3CMEB 2ZEDA 3PBBA 1K9MD 4R71A 3D7DA 1BLLE 4K30A 2V8GA 4CQJA 2Q0YA 4IHMA 3FYNA 4X05A 3AVTA 4Z4VA 4UZFA 2V4DA 4Q7AA 3CC2B 4MCSA 2GIVA 1S7FA 4YAFA 4ZGNB 2JN9A 1B87A 4NGQA 1M44A 2BN4A 3I1FA 1HZEA
chains in the Genus database with same CATH topology
3IFEA 1CP6A 1VHOA 2AFUA 1TKFA 3CT9A 4ZI6A 3FMCA 4OMEA 5F09A 1LAMA 3FF3A 4A37A 5CBMA 4UIAA 4R8FA 1XBUA 4PXEA 1ELMP 5LYDA 3KQXA 1ARMA 2AFZA 4P6YA 4R76A 5LYLA 4X3RA 4F9UA 2V8HA 4OC4A 3SJEA 4PQAA 5HVFA 2G9DA 1Z8LA 4GM5A 3I1UA 2ZEFA 2GLFA 4F8ZA 3IIBA 3D68A 3KI9A 3KGQA 1F2OA 3KHXA 2EK8A 2Q51A 1LFWA 3KR4A 2PJBA 2AFOA 3PFEA 1DE4C 2HB6A 1GYTA 3B3TA 3HLPA 4AXVA 2XEGA 4NGNA 1TF8A 2DEAA 2QYVA 1LOKA 4H2KA 3B3SA 7CPAA 2JBJA 4NJQA 4OC5A 3T8WA 2IJZA 3D4UA 3SI1A 2Q43A 3PB4X 3PRTA 4P4EA 4JYWA 5LYIA 4B6ZA 2PVWA 4OC3A 4YU9A 2GREA 3PBEA 1LAPA 2BO9A 3FEEA 5HXDA 4P4JA 2GLJA 2PJCA 3NFZA 2AFXA 2ZEOA 5DS0A 3IWWA 3SI0A 2OR4A 1R3NA 4ZX8A 1F2PA 1TKHA 2IQ6A 3PB8X 1ELLP 2PIYA 4NGTA 2PIZA 3D7HA 4KSIA 4A39A 2ZEHA 3NH4A 3S9LA 4P4IA 1TXRA 3S9NA 2PJ4A 1ZG9A 2QJ8A 4NGMA 3WABA 4WWVA 1KWMA 3NA6A 2EWBA 2XEIA 3FECA 1VGYA 4DUKA 4PXBA 5LYFA 3KL9A 3PB7X 1M4LA 2PCUA 2I3CA 4ZX9A 4YWYA 4UF4A 2C6PA 2CTCA 1ZLIA 3D7FA 4Z65A 2ZEGA 3JRUA 4PXCA 4X2TA 2F8HA 4DYOA 1ARLA 2PJ9A 4P4FA 4ZYQA 3H8GA 3ISXA 2AFMA 4ZY2A 2PJ8A 3IJ3A 3SI2A 2WYRA 1H8LA 1CPXA 4ZY1A 2C6CA 3VARA 3B3WA 3CPAA 2PJ1A 4OIWA 1ZG8A 1DTDA 3L2NA 3LWUA 4OC1A 4RUHA 3S9MA 3N5FA 3H8FA 5THWA 4FUUA 5D29A 1TKJA 2CTBA 3GB0A 5HVHA 4OIDA 4A38A 5K8NA 5JM6A 3V38A 2AFWA 3RBUA 2PJ6A 4P45A 2WZNA 2BOAA 2PRQA 1YMEA 2V8DA 5I4MA 2PJ5A 2FVGA 2ZOGA 3WC5A 1JQGA 1VIXA 1PCAA 1NSAA 1ZG7A 5D8NA 4EWTA 2XEFA 4NGPA 1FNOA 4MMOA 4TNUA 4IAVA 3PB9X 2PJ0A 2PJAA 2PJ3A 1Y0RA 3VATA 1ZLHA 4NJRA 4DJLA 1QQ9A 4FAIA 2NSMA 3MRUA 3VH9A 4F9VA 4ONWA 3BI0A 4NGRA 4OP4A 1FT7A 1IGBA 1F57A 3KHZA 3IO1A 3DLJA 4P4DA 4UEZA 4MHYA 6CPAA 5LRGA 2C6GA 3B35A 4FWUA 1LCPA 1YW6A 3FVLA 3D66A 2Q4ZA 4JZ0A 5J1QA 4G1PA 3D67A 3ISZA 3KASA 4UIBA 2O4HA 4NGSA 1Y0YA 4R6TA 3RAMA 2ZOFA 1CG2A 2ZEEA 4MHPA 1BAVA 1YSJA 4ZY0A 3NH5A 4UEFA 2JEWA 5LRKA 1QMUA 3FH4A 2PVVA 2V8VA 3HUVA 3B7IA 3B3VA 4OC0A 5K8PA 2ZEMA 1Y7EA 3KR5A 8CPAA 3IEHA 2RB7A 1PYTB 2EK9A 2ZELA 3KZWA 4A94A 1EE3P 3H8EA 4CPAA 3B2YA 3IC1A 2BCOA 5K8OA 1YLOA 2V77A 1XJOA 3BXMA 4R7MA 2HC9A 3DGVA 3V7ZA 4LQGA 5JGFA 4UEEA 2NYQA 3FJUA 1CBXA 3CPXA 2JBKA 3TC8A 3D7GA 1XFOA 1BPMA 5HVGA 3SJXA 3BI1A 3PFOA 1Z5RA 2PE3A 1IY7A 4OC2A 3SJGA 3NH8A 2GU2A 2RFHA 1CX8A 1R43A 3PEIA 1HEEA 3CDXA 1LANA 4X8IA 1OBRA 3FEDA 3QNVA 4EMEA 2VL1A 4PPZA 3WC6A 4TWEA 1RTQA 2OOTA 3TX8A 3K2KA 3K9TA 2PJ7A 4W9YA 5LRJA 2ZENA 4MXUA 4FBEA 2ANPA 1AYEA 5CPAA 1UWYA 2C1CA 4K3NA 3RZAA 3LMSA 1VHEA 2IMOA 3KQZA 5ELYA 4EFDA 1BPNA 1XRYA 4OKOA 4MHZA 2XEJA 3WT4A 2PJ2A 2ABZA 3PB6X 4MCPA 2F7VA 3SJFA 4MCQA 1Q7LA 3BHXA 1TF9A 2CIJA 2POKA 1XMBA 2J9AA 2CF4A 4P10A 3MN8A 4MHNA 4WJBA 4P4BA 4P44A 4NFRA 5IB9A 4O23A 3GLJA 3B3CA 2AFSA 3GUXA 2QVPA 3PBBA 2ZEDA 1AMPA 3D7DA 1BLLE 4IK2A 2O53A 1Z2LA 2V8GA 5K8MA 1HDQA 4IHMA 1CP7A 1YW4A 4PXDA 2ZEPA 3WC7A 4MRIA 5JH9A 4Q7AA 4MCSA 4BD9A 4MCRA 1HDUA 1CPSA 4NGQA 3FX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFE A;  1CP6 A;  1VHO A;  2AFU A;  1TKF A;  3CT9 A;  4ZI6 A;  3FMC A;  4OME A;  5F09 A;  1LAM A;  3FF3 A;  4A37 A;  5CBM A;  4UIA A;  4R8F A;  1XBU A;  4PXE A;  1ELM P;  5LYD A;  3KQX A;  1ARM A;  2AFZ A;  4P6Y A;  4R76 A;  5LYL A;  4X3R A;  4F9U A;  2V8H A;  4OC4 A;  3SJE A;  4PQA A;  5HVF A;  2G9D A;  1Z8L A;  4GM5 A;  3I1U A;  2ZEF A;  2GLF A;  4F8Z A;  3IIB A;  3D68 A;  3KI9 A;  3KGQ A;  1F2O A;  3KHX A;  2EK8 A;  2Q51 A;  1LFW A;  3KR4 A;  2PJB A;  2AFO A;  3PFE A;  1DE4 C;  2HB6 A;  1GYT A;  3B3T A;  3HLP A;  4AXV A;  2XEG A;  4NGN A;  1TF8 A;  2DEA A;  2QYV A;  1LOK A;  4H2K A;  3B3S A;  7CPA A;  2JBJ A;  4NJQ A;  4OC5 A;  3T8W A;  2IJZ A;  3D4U A;  3SI1 A;  2Q43 A;  3PB4 X;  3PRT A;  4P4E A;  4JYW A;  5LYI A;  4B6Z A;  2PVW A;  4OC3 A;  4YU9 A;  2GRE A;  3PBE A;  1LAP A;  2BO9 A;  3FEE A;  5HXD A;  4P4J A;  2GLJ A;  2PJC A;  3NFZ A;  2AFX A;  2ZEO A;  5DS0 A;  3IWW A;  3SI0 A;  2OR4 A;  1R3N A;  4ZX8 A;  1F2P A;  1TKH A;  2IQ6 A;  3PB8 X;  1ELL P;  2PIY A;  4NGT A;  2PIZ A;  3D7H A;  4KSI A;  4A39 A;  2ZEH A;  3NH4 A;  3S9L A;  4P4I A;  1TXR A;  3S9N A;  2PJ4 A;  1ZG9 A;  2QJ8 A;  4NGM A;  3WAB A;  4WWV A;  1KWM A;  3NA6 A;  2EWB A;  2XEI A;  3FEC A;  1VGY A;  4DUK A;  4PXB A;  5LYF A;  3KL9 A;  3PB7 X;  1M4L A;  2PCU A;  2I3C A;  4ZX9 A;  4YWY A;  4UF4 A;  2C6P A;  2CTC A;  1ZLI A;  3D7F A;  4Z65 A;  2ZEG A;  3JRU A;  4PXC A;  4X2T A;  2F8H A;  4DYO A;  1ARL A;  2PJ9 A;  4P4F A;  4ZYQ A;  3H8G A;  3ISX A;  2AFM A;  4ZY2 A;  2PJ8 A;  3IJ3 A;  3SI2 A;  2WYR A;  1H8L A;  1CPX A;  4ZY1 A;  2C6C A;  3VAR A;  3B3W A;  3CPA A;  2PJ1 A;  4OIW A;  1ZG8 A;  1DTD A;  3L2N A;  3LWU A;  4OC1 A;  4RUH A;  3S9M A;  3N5F A;  3H8F A;  5THW A;  4FUU A;  5D29 A;  1TKJ A;  2CTB A;  3GB0 A;  5HVH A;  4OID A;  4A38 A;  5K8N A;  5JM6 A;  3V38 A;  2AFW A;  3RBU A;  2PJ6 A;  4P45 A;  2WZN A;  2BOA A;  2PRQ A;  1YME A;  2V8D A;  5I4M A;  2PJ5 A;  2FVG A;  2ZOG A;  3WC5 A;  1JQG A;  1VIX A;  1PCA A;  1NSA A;  1ZG7 A;  5D8N A;  4EWT A;  2XEF A;  4NGP A;  1FNO A;  4MMO A;  4TNU A;  4IAV A;  3PB9 X;  2PJ0 A;  2PJA A;  2PJ3 A;  1Y0R A;  3VAT A;  1ZLH A;  4NJR A;  4DJL A;  1QQ9 A;  4FAI A;  2NSM A;  3MRU A;  3VH9 A;  4F9V A;  4ONW A;  3BI0 A;  4NGR A;  4OP4 A;  1FT7 A;  1IGB A;  1F57 A;  3KHZ A;  3IO1 A;  3DLJ A;  4P4D A;  4UEZ A;  4MHY A;  6CPA A;  5LRG A;  2C6G A;  3B35 A;  4FWU A;  1LCP A;  1YW6 A;  3FVL A;  3D66 A;  2Q4Z A;  4JZ0 A;  5J1Q A;  4G1P A;  3D67 A;  3ISZ A;  3KAS A;  4UIB A;  2O4H A;  4NGS A;  1Y0Y A;  4R6T A;  3RAM A;  2ZOF A;  1CG2 A;  2ZEE A;  4MHP A;  1BAV A;  1YSJ A;  4ZY0 A;  3NH5 A;  4UEF A;  2JEW A;  5LRK A;  1QMU A;  3FH4 A;  2PVV A;  2V8V A;  3HUV A;  3B7I A;  3B3V A;  4OC0 A;  5K8P A;  2ZEM A;  1Y7E A;  3KR5 A;  8CPA A;  3IEH A;  2RB7 A;  1PYT B;  2EK9 A;  2ZEL A;  3KZW A;  4A94 A;  1EE3 P;  3H8E A;  4CPA A;  3B2Y A;  3IC1 A;  2BCO A;  5K8O A;  1YLO A;  2V77 A;  1XJO A;  3BXM A;  4R7M A;  2HC9 A;  3DGV A;  3V7Z A;  4LQG A;  5JGF A;  4UEE A;  2NYQ A;  3FJU A;  1CBX A;  3CPX A;  2JBK A;  3TC8 A;  3D7G A;  1XFO A;  1BPM A;  5HVG A;  3SJX A;  3BI1 A;  3PFO A;  1Z5R A;  2PE3 A;  1IY7 A;  4OC2 A;  3SJG A;  3NH8 A;  2GU2 A;  2RFH A;  1CX8 A;  1R43 A;  3PEI A;  1HEE A;  3CDX A;  1LAN A;  4X8I A;  1OBR A;  3FED A;  3QNV A;  4EME A;  2VL1 A;  4PPZ A;  3WC6 A;  4TWE A;  1RTQ A;  2OOT A;  3TX8 A;  3K2K A;  3K9T A;  2PJ7 A;  4W9Y A;  5LRJ A;  2ZEN A;  4MXU A;  4FBE A;  2ANP A;  1AYE A;  5CPA A;  1UWY A;  2C1C A;  4K3N A;  3RZA A;  3LMS A;  1VHE A;  2IMO A;  3KQZ A;  5ELY A;  4EFD A;  1BPN A;  1XRY A;  4OKO A;  4MHZ A;  2XEJ A;  3WT4 A;  2PJ2 A;  2ABZ A;  3PB6 X;  4MCP A;  2F7V A;  3SJF A;  4MCQ A;  1Q7L A;  3BHX A;  1TF9 A;  2CIJ A;  2POK A;  1XMB A;  2J9A A;  2CF4 A;  4P10 A;  3MN8 A;  4MHN A;  4WJB A;  4P4B A;  4P44 A;  4NFR A;  5IB9 A;  4O23 A;  3GLJ A;  3B3C A;  2AFS A;  3GUX A;  2QVP A;  3PBB A;  2ZED A;  1AMP A;  3D7D A;  1BLL E;  4IK2 A;  2O53 A;  1Z2L A;  2V8G A;  5K8M A;  1HDQ A;  4IHM A;  1CP7 A;  1YW4 A;  4PXD A;  2ZEP A;  3WC7 A;  4MRI A;  5JH9 A;  4Q7A A;  4MCS A;  4BD9 A;  4MCR A;  1HDU A;  1CPS A;  4NGQ A;  3FX6 A; 
#chains in the Genus database with same CATH topology
 1VHO A;  4CYO A;  4QVA A;  4ZI6 A;  3CES A;  2JIZ A;  3SXO A;  1TVC A;  4RDK A;  1KK3 A;  5F09 A;  3B8H A;  3FF3 A;  4A37 A;  3FNC A;  5LYD A;  1KTV A;  1ARM A;  4ZGQ B;  3E20 A;  3CCL B;  4KOV A;  5IYQ A;  2DEU A;  2VNK A;  4UWI A;  1WWZ A;  2NMT A;  3SEJ A;  2G9D A;  3TOA A;  3R9F A;  2WSS A;  4GM5 A;  1VQ7 B;  5TR9 A;  1I12 A;  2GLF A;  3IIB A;  3D68 A;  4KKS A;  2WPX A;  1F2O A;  1GJR A;  1RXT A;  2EK8 A;  2Q51 A;  3F0A A;  1LFW A;  4U9U A;  1VQK B;  1DE4 C;  2VZZ A;  4DQK A;  2HB6 A;  1Z4E A;  2GE3 A;  3VNU A;  4NGN A;  3RNZ A;  5C88 A;  1I18 A;  2P6E A;  5IYR A;  2C5B A;  2F43 A;  4XLC A;  1DDI A;  2VEZ A;  1EP3 B;  1TLL A;  5AGE A;  2CND A;  4HIZ A;  7CPA A;  5FO0 A;  2YNC C;  3SKB A;  3VO1 A;  1YX0 A;  5L46 A;  4P4E A;  1E62 A;  4B6Z A;  4Y9R A;  2OBR A;  3CXC B;  1N0U A;  5CDF A;  4OC3 A;  5H59 A;  2VNH A;  2EUI A;  3H94 A;  1GO2 A;  2P0W A;  4E8O A;  1LAP A;  5HXD A;  2WJV A;  4UA3 A;  2VNJ A;  2GLJ A;  3U2Q A;  1Y9K A;  2HDN B;  1S3Z A;  1F20 A;  3CCQ B;  3SI0 A;  1QFY A;  2RC5 A;  2DPT A;  3PB8 X;  3LOD A;  1QGA A;  3CW2 A;  4G7W A;  4CAE A;  4FD6 A;  3NH4 A;  4K1X A;  2R8V A;  2Z3N A;  5TV2 A;  2CXA A;  3S9N A;  1TTT A;  3T53 B;  1T6Y A;  4YXW A;  1P0H A;  4NGM A;  1OGJ A;  2XEI A;  1JB9 A;  1NB0 A;  1IYL A;  3FEC A;  3QB8 A;  1R5O A;  4DUK A;  1COW A;  1M4L A;  2DPS A;  2PCU A;  3U6K A;  2ZL6 A;  4YWY A;  1WP6 A;  2VBQ A;  4ASU A;  4UF4 A;  4UZU A;  1M4I A;  1ZO0 A;  4AVB A;  3CCM B;  2KVO A;  2PR8 A;  4P3I A;  2R6H A;  4X2T A;  4B13 A;  4HPS A;  4DYO A;  2EO8 A;  3BJ7 A;  3P2H A;  3FRM A;  4P4F A;  2PDO A;  3G71 B;  2XZL A;  2FIW A;  3TTH A;  4YGO A;  4UBR A;  1WSV A;  1WU8 A;  1EWY A;  4X0C A;  2AFM A;  4KSF A;  1N05 A;  2XGJ A;  3SI2 A;  2OBS A;  5GV8 A;  2HV2 A;  4Y49 B;  1W87 A;  1RQR A;  4QUZ A;  3CPA A;  2CK3 A;  1ZG8 A;  5F4O A;  1DTD A;  3L2N A;  3LWU A;  4OC1 A;  2FS5 A;  3S9M A;  3N5F A;  2BPO A;  4FUU A;  1YX2 A;  4P1V A;  5G22 A;  2CTB A;  3GB0 A;  1QFJ A;  4XM3 A;  4OID A;  2X6W A;  5JM6 A;  2BM0 A;  2X85 A;  3ZPN A;  4EVY A;  3OPO A;  2V7W A;  2WZN A;  2BOA A;  4XLE A;  2V8D A;  1VIX A;  2PLF A;  3NE5 B;  1IJF A;  1NSA A;  1WOS A;  4KKU A;  4XPL A;  2GJK A;  4MMO A;  3ZZI A;  2YGW A;  1VQP B;  2PJ0 A;  1QVF B;  5E96 A;  3VAT A;  2EVN A;  1AIP A;  4FD7 A;  3BQJ A;  4L8J A;  1QGZ A;  3OFN A;  3VH9 A;  1BMF A;  1ZM2 A;  4E0F A;  4NGR A;  3B8G A;  4OP4 A;  1QSM A;  5CNP A;  1FT7 A;  2B5G B;  2BGI A;  1F57 A;  3ONU A;  4P12 A;  1KK1 A;  4E2A A;  5FIU A;  3K9U A;  3SHP A;  4UEZ A;  5H86 A;  3R6K A;  2JEV A;  3BCF A;  4G7X A;  4FWU A;  2CBX A;  4PAB A;  5BWA B;  1LCP A;  1YW6 A;  2FCK A;  3R9E A;  2PR1 A;  3D66 A;  3FVL A;  5J1Q A;  4F6A A;  4AVA A;  4UIB A;  1Y0Y A;  3TO6 A;  4KKT A;  2ZOF A;  2EBJ A;  5F4M A;  5A88 A;  4MHP A;  1AMO A;  3NE7 A;  2XEX A;  4XLA A;  1YSJ A;  4A31 A;  2LZJ A;  2BM1 A;  1QMU A;  3P27 A;  1YIT B;  5AN9 A;  3WR7 A;  3W2H A;  5B6I A;  4UCM A;  3S6F A;  1ZM3 A;  4NNJ A;  1Y7E A;  4RPB A;  4MJ8 A;  1PYT B;  4MHD A;  1XF8 A;  1NJI D;  3OZU A;  1WOO A;  1EE3 P;  2B7B A;  4OP7 A;  2F1M A;  1SKY B;  3ONY A;  1K8A D;  5K8O A;  3FPP A;  2FXF A;  3W5H A;  3BXM A;  1UD2 A;  2B4B A;  4XOR A;  3CCS B;  3V7Z A;  1W9X A;  4P22 A;  4XMY A;  5DSZ A;  5JGF A;  3C26 A;  4UEE A;  2Q4V A;  3FJU A;  5A27 A;  3TE4 A;  3SJX A;  4B4D A;  2GK7 A;  2F1L A;  2PE3 A;  1V5V A;  3Q39 A;  4C7H A;  4UCN A;  1HEE A;  3PUM A;  2B5O A;  3ZBU A;  3CDX A;  4EME A;  2DCU A;  4YAL A;  4KOS A;  3ZZ0 A;  4QVT A;  3K2K A;  4FD5 A;  1YGH A;  3WBK A;  3AST A;  4MXU A;  1FND A;  1E63 A;  2Z11 A;  1AYE A;  3SJP A;  4B14 A;  4K3N A;  3LMS A;  3ZZU A;  4DQL A;  2IMO A;  3DSB A;  1QSN A;  5AG6 A;  1T6Z A;  4DK0 A;  4TMT A;  3BCD A;  4RD1 A;  4AG7 A;  2XEJ A;  2AHO A;  4AF7 A;  1I7P A;  4HE5 A;  1NBM A;  2D4P A;  4KSA A;  3BHX A;  1TF9 A;  2CIJ A;  3WNB A;  1UMK A;  2XZP A;  2OZG A;  3GIR A;  2CF4 A;  4ACB A;  1Q82 D;  3MN8 A;  2G3T A;  1ON0 A;  3A9L A;  4P44 A;  4NFR A;  4ROX A;  4PV6 A;  1Q7Y D;  2C4T A;  4XKW A;  4B5P B;  1VQ5 B;  4O23 A;  1YVO A;  4Y49 C;  4CRZ B;  4UAJ A;  4Z4Y A;  1FNB A;  4IK2 A;  3P2F A;  2O53 A;  2J8M A;  3A35 A;  4KOY A;  1GAQ A;  1YW4 A;  5AG7 A;  1YJ9 B;  1VQ9 B;  1Q86 D;  4TMZ A;  4MCR A;  2QEX B;  1CPS A;  1NDH A;  3FX6 A;  2WZP P;  5GCN A;  4CAW A;  4HE6 A;  3CT9 A;  2J8R A;  5KSW B;  3CMM A;  3JU4 A;  4QBJ A;  3A3B A;  2QGG A;  1EP2 B;  1KK2 A;  5CBM A;  4TKO B;  4R8F A;  3JQQ A;  1XBU A;  3GVL A;  1ELM P;  3R6J A;  1CQX A;  5THX A;  4RJL A;  3ES9 A;  4C68 A;  4R76 A;  4X3R A;  2V8H A;  4OC4 A;  4PQA A;  2HUZ A;  4FD4 A;  5IK2 A;  4ZBG A;  4KVX A;  5IB0 A;  1KMH A;  1Z8L A;  3D2P A;  3A8I A;  3G6E B;  3I3G A;  1XEB A;  3S6K A;  3A1P A;  1PKV A;  4LUA A;  3KHX A;  3B3T A;  3HLP A;  4FN5 A;  3LQ6 A;  3IU2 A;  4R57 A;  1J9Z A;  1OHH A;  1W34 A;  1YI2 B;  4L8A A;  1TF8 A;  2DEA A;  4CGL A;  5A28 A;  2J7K A;  1Z8X A;  4F7D A;  1FNM A;  2Z6B D;  3T8W A;  1BJK A;  4FXU A;  5HZA A;  2B58 A;  2DIE A;  3KKW A;  4A2Z A;  2VYQ A;  3FKS A;  2Q43 A;  4X7C A;  4RCZ A;  2BMW A;  1ZM4 A;  3I9S A;  4JYW A;  2W6I A;  2PVW A;  3ASP A;  4JXQ A;  4YU9 A;  1SQH A;  1WK4 A;  1MJ9 A;  3CC4 B;  3PBE A;  4C2Y A;  3N7Z A;  1I8D A;  1KUX A;  4P4J A;  2PJC A;  3QFR A;  4KVM E;  1UD4 A;  1XMT A;  1Z4R A;  4H6Z A;  2DF5 A;  2BSW A;  2BEI A;  5IX3 A;  4M1K A;  4ZX8 A;  4WZL A;  4MFL A;  1WOP A;  1F2P A;  1TUI A;  2YWG A;  1H8E A;  2IQ6 A;  2ZL5 A;  1ELL P;  2Z0Z A;  2PIY A;  3CCE B;  3DR6 A;  1S72 B;  1E43 A;  5FNZ A;  1M1D A;  2HQY A;  2ZEH A;  4P4I A;  1TXR A;  3W2I A;  3E0K A;  4H9G A;  4XNH C;  1YIJ B;  1MJB A;  2X6Y A;  2ZW5 A;  3WAB A;  1KWM A;  5JPH A;  1NB9 A;  3CRZ A;  1E3Z A;  2P3M A;  1VGY A;  1VQ8 B;  2P6G A;  4PXB A;  3KL9 A;  2R1I A;  3PB7 X;  4DK1 A;  5HXB A;  4TT3 A;  1IB0 A;  3GKR A;  4A95 A;  2D3L A;  1IOF A;  1JNY A;  4XQF A;  3WQZ A;  1ZLI A;  2BL1 A;  1WPC A;  2C6P A;  2ZEG A;  3JRU A;  3E1Y E;  3D2M A;  2QDX A;  2Z3P A;  5ISV A;  2Q6O A;  3BC9 A;  1QG0 A;  4KLV A;  1PUA A;  2PMD A;  2JJ2 A;  1V0C A;  2NPF A;  1WOR A;  4Z4T A;  3GYA A;  2PJ8 A;  5AG4 A;  2CW5 A;  3RO0 A;  3VR6 A;  3CZX A;  4ZCM A;  1IJE A;  5H84 A;  2FSR A;  4ZY1 A;  3SXN A;  1KRH A;  2B4D B;  2PJ1 A;  4PC7 A;  4LBV A;  1NE9 A;  4YAU A;  5A8A A;  1E1R A;  2GK6 A;  3A3G A;  4XKV A;  4RUH A;  2BGJ A;  4PC3 A;  3H8F A;  3B78 A;  1G7R A;  1VJS A;  3I55 B;  4TSF A;  5EC4 A;  1VF7 A;  5HVH A;  5BSX A;  4LBZ A;  3RBU A;  4CAX A;  4P45 A;  4NSQ A;  2XNC A;  3OWC A;  4XOT A;  3AGP A;  3G05 A;  2FVG A;  2PJ5 A;  3CCR B;  2ZOG A;  5BSY A;  4YFJ A;  1PCA A;  4MFZ A;  4QFM A;  1KZL A;  2XEF A;  2VI7 A;  1FNO A;  4TNU A;  5C82 A;  3OJW A;  4Z1M A;  1CM0 A;  2PJ3 A;  1Y0R A;  2X53 S;  4LC0 A;  4XON A;  2K5T A;  3BH4 A;  3U6B A;  2DET A;  3MRU A;  2CRV A;  2G0B A;  3EXN A;  3D8P A;  4CGP A;  1OGI A;  1IGB A;  3LVB A;  4II2 A;  4R9M A;  2X7B A;  1YQE A;  2Q6L A;  3OEE A;  1XE1 A;  4Q38 A;  1QSR A;  3ZC3 A;  3DLJ A;  2OK7 A;  4U5Y A;  4CYQ A;  5KTC A;  4CAV A;  1BX1 A;  1UD5 A;  5LRG A;  1FY7 A;  2HMA A;  4HNY B;  1DG1 G;  4G1P A;  4JJX A;  4PC6 A;  4C0S A;  4NGS A;  3LQE A;  1S4M A;  4X7D A;  4R6T A;  4RS2 A;  1CG2 A;  4M6H A;  4N3G A;  4AF6 A;  4ZY0 A;  3NH5 A;  4UEF A;  4YRH A;  2JEW A;  4G1B A;  2GFQ A;  4A30 A;  2PVV A;  2EFG A;  1K73 D;  3B7I A;  4RCY A;  4OOX A;  5FL7 A;  3KR5 A;  1I21 A;  1V0E A;  4RPD A;  5IYW A;  2ATR A;  2V7X A;  1ZM9 A;  4A94 A;  1MRZ A;  1QX4 A;  1HVX A;  1B2R A;  3W2G A;  2M5S A;  3IC1 A;  4R7M A;  2HC9 A;  1M90 D;  3DGV A;  1S60 A;  1KK0 A;  2GPJ A;  2BUE A;  5KTA A;  1OB0 A;  1G7C A;  1W2B B;  4B48 A;  2NYQ A;  2B3U A;  1U2R A;  5IYP A;  1CBX A;  2JBK A;  4B3X A;  5F47 A;  3T9Y A;  5HVG A;  3W5V A;  2DER A;  1Z5R A;  1JJ2 B;  4OC2 A;  4L89 A;  4DNR B;  3SJG A;  3NH8 A;  4KLW A;  2GU2 A;  3OE7 A;  1R43 A;  3QSY A;  2YNC A;  5J8F A;  1FDR A;  1XQB A;  2VJI A;  1LAN A;  1FRN A;  5HKK A;  4AB7 A;  4PPZ A;  3WC6 A;  1RTQ A;  3HAG A;  2OZH A;  3Q38 A;  3CP8 A;  3FXT A;  4FK8 A;  5TRD A;  1UFH A;  2VQY A;  3DR8 A;  4KOU A;  1N8R D;  2ZZE A;  5KNL A;  4RD6 A;  4Z4R A;  4OPS A;  3KQZ A;  3BY1 A;  4KOR A;  1S7N A;  2VNI A;  4AVZ A;  3VWD A;  1DDG A;  4M53 A;  4M6I A;  1EFR A;  3PVD A;  4CRY B;  1XMB A;  4M6G A;  2KCW A;  4P10 A;  1QST A;  3V8I A;  3VWE A;  1T6X A;  4MHN A;  2ZZF A;  4WJB A;  3CC7 B;  4RDL A;  4P4B A;  1B23 P;  2FL4 A;  4KUB A;  5IB9 A;  3GLJ A;  3GUX A;  3WXM A;  4JMQ A;  2HLD A;  2QVP A;  4PSW A;  1AMP A;  3GVJ A;  2JLM A;  3W6S A;  1QSO A;  3QAH A;  2E1B A;  1Z2L A;  3LD2 A;  5K8M A;  1HDQ A;  4Z4W A;  3S6H A;  4NF1 A;  2YWF A;  1CP7 A;  3ZZT A;  3A8J A;  1M1K D;  2OTL B;  2ZEP A;  2A4N A;  3QAY A;  3WC7 A;  3SLD A;  4MRI A;  1BPL A;  5JH9 A;  2ZXH A;  1W0K A;  4U9Z A;  2OB0 A;  4BD9 A;  2AE6 A;  1EFU A;  2ZTG A;  4MFK A;  1HDU A;  1E1Q A;  4PK3 A;  1CP6 A;  4CGM A;  4YEL A;  1TKF A;  4G6I A;  4MY3 A;  2JDI A;  3CB4 A;  3G4S B;  1Y9W A;  2DYI A;  3TT2 A;  1WSR A;  3RY8 A;  1EXM A;  2AFZ A;  1Z8T A;  1RQP A;  4XNH B;  4OPO A;  3Q6Q A;  4KOT A;  2BF4 A;  2IL4 A;  5HVF A;  1FNC A;  2XOK A;  4WZE A;  3ASR A;  4G5G A;  2FIA A;  2ZEF A;  2D4O A;  2W6J A;  4JD6 A;  3OW7 A;  3KGQ A;  3KR4 A;  2PJB A;  2AFO A;  1GYT A;  4X7E A;  3W2E A;  4EH1 A;  2BV3 A;  2XEG A;  3F8K A;  4MY0 A;  2QYV A;  4H2K A;  4II3 A;  4IW3 B;  4GS4 A;  4OC5 A;  2JDD A;  3D4U A;  1IYK A;  3MGD A;  3PRT A;  1IU8 A;  5LYI A;  2ZW7 A;  1PJ6 A;  4KUA A;  3R96 A;  4Y9U A;  4NCN A;  4PGO A;  2BO9 A;  3FEE A;  4B47 A;  4WZK A;  2ZBU A;  1MAB A;  4WQM A;  3NFZ A;  3Q6R A;  5DS0 A;  3IWW A;  1NMT A;  2OR4 A;  2YND A;  4CYP A;  1XB2 A;  4HKF A;  1TKH A;  4NCZ A;  1VQ6 B;  2OZU A;  4NGT A;  2PIZ A;  4M2L A;  3D7H A;  4ACA A;  3CXS A;  2XZO A;  4A39 A;  1L0C A;  1VQM B;  3S9L A;  3TO7 A;  4ONU A;  5IYN A;  4AC9 A;  1VLO A;  3JVN A;  1ZG9 A;  2QJ8 A;  1CJW A;  2PIA A;  1PU9 A;  4WWV A;  3W2F A;  3NA6 A;  2VJJ A;  3WNC A;  4R3K A;  2Q4Y A;  2ZIT A;  1QFZ A;  1BLI A;  4Y7C A;  1M4G A;  4AG9 A;  1G7S A;  1B6B A;  1XIX A;  2I3C A;  4RD0 A;  1QH0 A;  3IWG A;  4GXH A;  4B5O A;  1S7L A;  3OKX A;  2CTC A;  3D7F A;  1ZUN B;  3OOC A;  4XPD C;  2QTL A;  4PXC A;  1F60 A;  1ARL A;  4RD4 A;  4ORF A;  2QA4 B;  2OBT A;  1IIC A;  4P2N A;  4E0A A;  4C43 A;  5LMZ A;  4JWP A;  4ZYQ A;  3VNV A;  1TIQ A;  2CNT A;  4ZY2 A;  2G3A A;  4N3N A;  3CP2 A;  4B3F X;  4MYU A;  2WYR A;  1N06 A;  1CPX A;  2C6C A;  1VQL B;  4J3G A;  3B3W A;  2QE7 A;  2I79 A;  5FO1 A;  5THW A;  1N07 A;  4PC2 A;  1KC8 D;  4TN1 A;  2V7T A;  1GVH A;  1IB1 E;  2BVN A;  3AVV A;  3T90 A;  3AVY A;  1R5N A;  2ZXV A;  4A38 A;  5K8N A;  4PC1 A;  2Q7B A;  2AFW A;  1CNE A;  3V38 A;  3A8K A;  4RDJ A;  3AGQ A;  2PRQ A;  3V7A A;  1YME A;  4ZCL A;  5I4M A;  1YVK A;  2VZL A;  3WY9 A;  1V0F A;  4LX9 A;  4IAV A;  2PJA A;  4I49 A;  3QFC A;  4II9 A;  3EC4 A;  4NJR A;  4B12 A;  2Z10 A;  5J3O A;  2QN6 A;  1I1D A;  1UD3 A;  3BI0 A;  3B82 A;  4CGO A;  4M85 A;  4Z4S A;  5F49 A;  2ZZG A;  4A32 A;  4CS0 B;  4M4S A;  1M4D A;  1Z9U A;  3P26 A;  1GHE A;  4UFX A;  1U6M A;  3CD6 B;  5DWM A;  6CPA A;  3BY2 A;  3B35 A;  4C7I A;  3ZJ0 A;  4YHB A;  2H5M A;  2OTJ B;  4P25 A;  3ISZ A;  4IUS A;  5J35 A;  3KAS A;  2B3V A;  3VMF A;  3TOB A;  4G1V A;  2D3N A;  2CNM A;  3RAM A;  4XR6 A;  4PK2 A;  4MFP A;  3CPW B;  3WBJ A;  2Z3K A;  1E64 A;  4XN3 A;  1QVG B;  3CCJ B;  2I00 A;  3FH4 A;  4KS9 A;  3ZUG A;  1VKC A;  3OEH A;  2ODF A;  3KEW A;  4OC0 A;  4R3L A;  8CPA A;  3H5Z A;  2ZW6 A;  3KZW A;  4DNC A;  4CPA A;  3B2Y A;  4UCP A;  1VLY A;  5H5J A;  1YLO A;  4R87 A;  2V77 A;  2B5G A;  4P9S A;  2X6X A;  3DDD A;  4JXR A;  4MBU A;  2FE7 A;  5I0C A;  1Q9S A;  1N71 A;  4Q7J B;  5JQ4 A;  5IV0 A;  3ZIA A;  4BMH A;  3TC8 A;  4H89 A;  1WTH D;  1FX0 A;  1BPM A;  2Q44 A;  3J81 k;  1G7T A;  3JUW A;  4OLL A;  1BX0 A;  2V7V A;  1D1N A;  2CY2 A;  2RFH A;  1CX8 A;  4UFW A;  3QNV A;  1MK4 A;  1QGY A;  3BNW A;  2NV4 A;  2VL1 A;  3JTK A;  3GQB A;  1SM4 A;  4XL9 A;  2OOT A;  2D74 A;  3PZJ A;  4W9Y A;  2Y0M A;  4WZT A;  2ZEN A;  5F46 A;  5EMN A;  3DNS A;  2XND A;  2WPD A;  5CPA A;  2C1C A;  2PQ8 A;  3RZA A;  1VHE A;  2C27 A;  2YNE A;  3GVK A;  2PRB A;  2ZL7 A;  4ZCI A;  1OZP A;  3FB3 A;  4C2Z A;  3CXP A;  2VBV A;  3OW2 B;  4MFJ A;  3G8W A;  4XLH A;  4Q36 A;  1XRY A;  4OKO A;  4MHZ A;  3WT4 A;  1EFT A;  4BPR A;  2ABZ A;  3PB6 X;  1HA3 A;  3EY5 A;  1D8T A;  2C78 A;  4LQ6 A;  2O28 A;  3SJF A;  1Q7L A;  4B43 A;  2VBS A;  2VBU A;  1E79 A;  2J9A A;  1PJ7 A;  3F5B A;  4TMV A;  2Z3L A;  1JWQ A;  5KW9 A;  3TCV A;  4QV2 A;  3B3C A;  2AFS A;  1K4J A;  5G21 A;  2QMU A;  2P6F A;  1H85 A;  5DWN A;  5J8C A;  4PXD A;  1Y7R A;  2X8K A;  3AVW A;  4NXY A;  3I56 B;  4RD2 A;  5GV7 A;  3QFT A;  3CCV B;  4UZE A;  3QE2 A;  3S6G A;  3IFE A;  4NBS A;  4DNT B;  2AFU A;  3G3S A;  3WND A;  2XNJ A;  4XD7 A;  3FMC A;  1W35 A;  4X07 A;  1J4J A;  4OME A;  1KD1 D;  2GQF A;  1LAM A;  2REF A;  4UIA A;  3R95 A;  4PXE A;  2C4U A;  4X06 A;  1WDT A;  4QB9 A;  2QTZ A;  3KQX A;  4PAA A;  3OP1 A;  5F4J A;  4P6Y A;  2R7H A;  5LYL A;  4P6V F;  4F9U A;  4BIN A;  3SJE A;  1Q2C A;  1YK3 A;  3ZBT A;  1A2Z A;  3FJO A;  4B5P A;  3W6X A;  2AJ6 A;  3V76 A;  2YWH A;  4TMX A;  1LRZ A;  3I1U A;  1YJW B;  4F8Z A;  3OZW A;  3KI9 A;  1RO5 A;  4QVJ A;  3PFE A;  4XPD B;  4KVO E;  4AXV A;  3PUN A;  2F5I A;  2ZTN A;  1LOK A;  3ASQ A;  3B3S A;  1KZF A;  2JBJ A;  4NJQ A;  2IJZ A;  1YJN B;  3SI1 A;  3JQR A;  3PB4 X;  3FBU A;  1EP1 B;  3EO4 A;  2C77 A;  1GR1 A;  1T5E A;  3R9G A;  2WSA A;  4P26 A;  3SJZ A;  3W5U A;  2GRE A;  4YAW A;  4CAF A;  1A8P A;  4KOW A;  2AFX A;  2ZEO A;  2I1L A;  2Z3M A;  4F0X A;  4C2X A;  3RYO A;  5G1Z A;  1X10 A;  4UWJ A;  1R3N A;  2Z3O A;  1W0J A;  5A89 A;  5HZB A;  2OU2 A;  3LNN A;  4BBH A;  1NSL A;  1QUE A;  4QUS A;  1BO4 A;  4KSI A;  1MJA A;  3IWE A;  1CNF A;  3CTA A;  2BSA A;  2PJ4 A;  4OOV A;  1BOB A;  4J0Q A;  4MI4 A;  2EWB A;  2HCJ B;  3NE8 A;  2REE A;  5LYF A;  3LO8 A;  3GIU A;  5HH1 A;  4ZX9 A;  4UFV A;  1VQ4 B;  3MMP A;  3ASS A;  1H42 A;  4Z65 A;  2B7C A;  2DOG A;  3W91 A;  5AG5 A;  4TMW A;  4MYT A;  1UD8 A;  2E1R A;  2F8H A;  1X12 A;  4LBW A;  2PJ9 A;  2VZY A;  3D3S A;  5F48 A;  1VHS A;  3H8G A;  2GAN A;  3ISX A;  3MCA A;  4YEJ A;  4M3S A;  1Q2Y A;  1AUG A;  3IJ3 A;  1H8L A;  5KTD A;  3CMA B;  4OAD A;  4A33 A;  1E3X A;  4KZT A;  3VAR A;  1OB5 A;  4RI1 A;  4OIW A;  4U9Y A;  4RD3 A;  2J8N A;  4X7F A;  4LBY A;  2PC1 A;  1N0V C;  1BQE A;  2WUU A;  5D29 A;  4JLY A;  1S5K A;  3CXQ A;  3LAC A;  1TKJ A;  3PEN A;  4HNW B;  3GSI A;  2JJ1 A;  4RM0 A;  4ZV4 A;  3IGR A;  1KQS B;  4IF5 A;  2ZZQ A;  4YAO A;  1GAW A;  4FWT A;  2PJ6 A;  1R5B A;  1XE4 A;  2R98 A;  5TY0 A;  1S0U A;  2GJP A;  3OZV A;  5G20 A;  4M0L A;  4B44 A;  1JQG A;  1KUV A;  3WC5 A;  1IID A;  2OYN A;  2Q7S A;  1KJZ A;  2F4N A;  1ZG7 A;  2YWE A;  2VBT A;  5D8N A;  4X5K A;  4HNX B;  4EWT A;  2RC6 A;  4NGP A;  3PGP A;  3R1K A;  2ZBV A;  2QML A;  3PB9 X;  3T56 B;  4Z4U A;  1D2E A;  1OB2 A;  1ZLH A;  1P4M A;  4DJL A;  4XOP A;  3AVX A;  1QQ9 A;  4FAI A;  2NSM A;  2WPW A;  1H8H A;  2V7Q A;  2WR8 A;  3TFY A;  4F9V A;  2C2W A;  4ONW A;  4QC6 A;  2B4D A;  4CYN A;  3VO2 A;  1UD6 A;  3KHZ A;  3PA2 A;  5DN6 A;  3IO1 A;  1YLE A;  2EIX A;  4KOX A;  4RN7 A;  1YHQ B;  4P4D A;  1JA0 A;  4MHY A;  3JQP A;  3FPK A;  2ZPA A;  2C6G A;  2QIR A;  2CNS A;  1YRE A;  3CCU B;  4JZ0 A;  2Q4Z A;  2JDC A;  3D67 A;  2O4H A;  2VXK A;  2ZXI A;  3OJX A;  4B11 A;  3WYA A;  5E6T A;  1YR0 A;  4OOS A;  2ZEE A;  4AVC A;  4B10 A;  2Q6I A;  1BAV A;  2QEC A;  2C5H A;  2V31 A;  4ZGY B;  3SLN A;  1Q81 D;  2ZW4 A;  5LRK A;  3TO9 A;  5EBV A;  2V8V A;  3HUV A;  2Q04 A;  2RC4 A;  3B3V A;  5FVJ A;  4XPK A;  5K8P A;  2ZEM A;  2OK8 A;  3GY9 A;  3IEH A;  2RB7 A;  2EK9 A;  2ZEL A;  3OAA A;  3H8E A;  3D26 A;  4P3Y A;  3EFA A;  2BCO A;  4XN0 A;  1XJO A;  1JA1 A;  5EMI A;  2PSW A;  4H6U A;  3H9N A;  4LQG A;  1VQO B;  2CC2 A;  1KUY A;  1N08 A;  2ARH A;  3CPX A;  3D7G A;  1XFO A;  3QFS A;  1IOI A;  1S7K A;  3H4Q A;  3BI1 A;  3PFO A;  1IY7 A;  4RLZ A;  2D9R A;  4XLF A;  1Z8W A;  3PEI A;  2DY1 A;  3FIX A;  4X8I A;  1OBR A;  2DXQ A;  3FED A;  1R57 A;  3PA1 A;  3DDY A;  2OH1 A;  3AVU A;  2V7U A;  5JBQ A;  1IHM A;  4TWE A;  4CGN A;  3TX8 A;  4MFQ A;  3K9T A;  2PJ7 A;  1VQN B;  4OAE A;  5LRJ A;  3BLN A;  1K28 D;  3IU1 A;  2X3U A;  4OPV A;  4FBE A;  2ANP A;  1UWY A;  2X0K A;  1NRK A;  1DAR A;  4F0Y A;  4Z4Z A;  3UY5 A;  1P4N A;  4NEX A;  1ELO A;  3PP9 A;  5ELY A;  1FRQ A;  1Q2D A;  4EFD A;  1BPN A;  1QUF A;  3T51 B;  4B3G A;  2PJ2 A;  1SKQ A;  3MHP A;  1PJ5 A;  2R9V A;  4XNF A;  4MCP A;  2GJR A;  2F7V A;  4MCQ A;  3BJ8 A;  2POK A;  2FT0 A;  3Q3A A;  2FX3 A;  5FA6 A;  4QHY A;  4GQN A;  1XOV A;  5HMN A;  2Q6K A;  4PSX A;  2WJY A;  1EFC A;  3CME B;  2ZED A;  3PBB A;  1K9M D;  4R71 A;  3D7D A;  1BLL E;  4K30 A;  2V8G A;  4CQJ A;  2Q0Y A;  4IHM A;  3FYN A;  4X05 A;  3AVT A;  4Z4V A;  4UZF A;  2V4D A;  4Q7A A;  3CC2 B;  4MCS A;  2GIV A;  1S7F A;  4YAF A;  4ZGN B;  2JN9 A;  1B87 A;  4NGQ A;  1M44 A;  2BN4 A;  3I1F A;  1HZE A; 
#chains in the Genus database with same CATH homology
 3IFE A;  1CP6 A;  1VHO A;  2AFU A;  1TKF A;  3CT9 A;  4ZI6 A;  3FMC A;  4OME A;  5F09 A;  1LAM A;  3FF3 A;  4A37 A;  5CBM A;  4UIA A;  4R8F A;  1XBU A;  4PXE A;  1ELM P;  5LYD A;  3KQX A;  1ARM A;  2AFZ A;  4P6Y A;  4R76 A;  5LYL A;  4X3R A;  4F9U A;  2V8H A;  4OC4 A;  3SJE A;  4PQA A;  5HVF A;  2G9D A;  1Z8L A;  4GM5 A;  3I1U A;  2ZEF A;  2GLF A;  4F8Z A;  3IIB A;  3D68 A;  3KI9 A;  3KGQ A;  1F2O A;  3KHX A;  2EK8 A;  2Q51 A;  1LFW A;  3KR4 A;  2PJB A;  2AFO A;  3PFE A;  1DE4 C;  2HB6 A;  1GYT A;  3B3T A;  3HLP A;  4AXV A;  2XEG A;  4NGN A;  1TF8 A;  2DEA A;  2QYV A;  1LOK A;  4H2K A;  3B3S A;  7CPA A;  2JBJ A;  4NJQ A;  4OC5 A;  3T8W A;  2IJZ A;  3D4U A;  3SI1 A;  2Q43 A;  3PB4 X;  3PRT A;  4P4E A;  4JYW A;  5LYI A;  4B6Z A;  2PVW A;  4OC3 A;  4YU9 A;  2GRE A;  3PBE A;  1LAP A;  2BO9 A;  3FEE A;  5HXD A;  4P4J A;  2GLJ A;  2PJC A;  3NFZ A;  2AFX A;  2ZEO A;  5DS0 A;  3IWW A;  3SI0 A;  2OR4 A;  1R3N A;  4ZX8 A;  1F2P A;  1TKH A;  2IQ6 A;  3PB8 X;  1ELL P;  2PIY A;  4NGT A;  2PIZ A;  3D7H A;  4KSI A;  4A39 A;  2ZEH A;  3NH4 A;  3S9L A;  4P4I A;  1TXR A;  3S9N A;  2PJ4 A;  1ZG9 A;  2QJ8 A;  4NGM A;  3WAB A;  4WWV A;  1KWM A;  3NA6 A;  2EWB A;  2XEI A;  3FEC A;  1VGY A;  4DUK A;  4PXB A;  5LYF A;  3KL9 A;  3PB7 X;  1M4L A;  2PCU A;  2I3C A;  4ZX9 A;  4YWY A;  4UF4 A;  2C6P A;  2CTC A;  1ZLI A;  3D7F A;  4Z65 A;  2ZEG A;  3JRU A;  4PXC A;  4X2T A;  2F8H A;  4DYO A;  1ARL A;  2PJ9 A;  4P4F A;  4ZYQ A;  3H8G A;  3ISX A;  2AFM A;  4ZY2 A;  2PJ8 A;  3IJ3 A;  3SI2 A;  2WYR A;  1H8L A;  1CPX A;  4ZY1 A;  2C6C A;  3VAR A;  3B3W A;  3CPA A;  2PJ1 A;  4OIW A;  1ZG8 A;  1DTD A;  3L2N A;  3LWU A;  4OC1 A;  4RUH A;  3S9M A;  3N5F A;  3H8F A;  5THW A;  4FUU A;  5D29 A;  1TKJ A;  2CTB A;  3GB0 A;  5HVH A;  4OID A;  4A38 A;  5K8N A;  5JM6 A;  3V38 A;  2AFW A;  3RBU A;  2PJ6 A;  4P45 A;  2WZN A;  2BOA A;  2PRQ A;  1YME A;  2V8D A;  5I4M A;  2PJ5 A;  2FVG A;  2ZOG A;  3WC5 A;  1JQG A;  1VIX A;  1PCA A;  1NSA A;  1ZG7 A;  5D8N A;  4EWT A;  2XEF A;  4NGP A;  1FNO A;  4MMO A;  4TNU A;  4IAV A;  3PB9 X;  2PJ0 A;  2PJA A;  2PJ3 A;  1Y0R A;  3VAT A;  1ZLH A;  4NJR A;  4DJL A;  1QQ9 A;  4FAI A;  2NSM A;  3MRU A;  3VH9 A;  4F9V A;  4ONW A;  3BI0 A;  4NGR A;  4OP4 A;  1FT7 A;  1IGB A;  1F57 A;  3KHZ A;  3IO1 A;  3DLJ A;  4P4D A;  4UEZ A;  4MHY A;  6CPA A;  5LRG A;  2C6G A;  3B35 A;  4FWU A;  1LCP A;  1YW6 A;  3FVL A;  3D66 A;  2Q4Z A;  4JZ0 A;  5J1Q A;  4G1P A;  3D67 A;  3ISZ A;  3KAS A;  4UIB A;  2O4H A;  4NGS A;  1Y0Y A;  4R6T A;  3RAM A;  2ZOF A;  1CG2 A;  2ZEE A;  4MHP A;  1BAV A;  1YSJ A;  4ZY0 A;  3NH5 A;  4UEF A;  2JEW A;  5LRK A;  1QMU A;  3FH4 A;  2PVV A;  2V8V A;  3HUV A;  3B7I A;  3B3V A;  4OC0 A;  5K8P A;  2ZEM A;  1Y7E A;  3KR5 A;  8CPA A;  3IEH A;  2RB7 A;  1PYT B;  2EK9 A;  2ZEL A;  3KZW A;  4A94 A;  1EE3 P;  3H8E A;  4CPA A;  3B2Y A;  3IC1 A;  2BCO A;  5K8O A;  1YLO A;  2V77 A;  1XJO A;  3BXM A;  4R7M A;  2HC9 A;  3DGV A;  3V7Z A;  4LQG A;  5JGF A;  4UEE A;  2NYQ A;  3FJU A;  1CBX A;  3CPX A;  2JBK A;  3TC8 A;  3D7G A;  1XFO A;  1BPM A;  5HVG A;  3SJX A;  3BI1 A;  3PFO A;  1Z5R A;  2PE3 A;  1IY7 A;  4OC2 A;  3SJG A;  3NH8 A;  2GU2 A;  2RFH A;  1CX8 A;  1R43 A;  3PEI A;  1HEE A;  3CDX A;  1LAN A;  4X8I A;  1OBR A;  3FED A;  3QNV A;  4EME A;  2VL1 A;  4PPZ A;  3WC6 A;  4TWE A;  1RTQ A;  2OOT A;  3TX8 A;  3K2K A;  3K9T A;  2PJ7 A;  4W9Y A;  5LRJ A;  2ZEN A;  4MXU A;  4FBE A;  2ANP A;  1AYE A;  5CPA A;  1UWY A;  2C1C A;  4K3N A;  3RZA A;  3LMS A;  1VHE A;  2IMO A;  3KQZ A;  5ELY A;  4EFD A;  1BPN A;  1XRY A;  4OKO A;  4MHZ A;  2XEJ A;  3WT4 A;  2PJ2 A;  2ABZ A;  3PB6 X;  4MCP A;  2F7V A;  3SJF A;  4MCQ A;  1Q7L A;  3BHX A;  1TF9 A;  2CIJ A;  2POK A;  1XMB A;  2J9A A;  2CF4 A;  4P10 A;  3MN8 A;  4MHN A;  4WJB A;  4P4B A;  4P44 A;  4NFR A;  5IB9 A;  4O23 A;  3GLJ A;  3B3C A;  2AFS A;  3GUX A;  2QVP A;  3PBB A;  2ZED A;  1AMP A;  3D7D A;  1BLL E;  4IK2 A;  2O53 A;  1Z2L A;  2V8G A;  5K8M A;  1HDQ A;  4IHM A;  1CP7 A;  1YW4 A;  4PXD A;  2ZEP A;  3WC7 A;  4MRI A;  5JH9 A;  4Q7A A;  4MCS A;  4BD9 A;  4MCR A;  1HDU A;  1CPS A;  4NGQ A;  3FX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...