4X8IA

De novo crystal structure of the pyrococcus furiosus tet3 aminopeptidase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
346
structure length
337
Chain Sequence
MVDWELMKKIIESPGVSGYEHLGIRDLVVDILKDVADEVKIDKLGNVIAHFKGSAPKVMVAAHMDKIGLMVNHIDKDGYLRVVPIGGVLPETLIAQKIRFFTEKGERYGVVGVLPPHLRIDWDSIIVDVGASSREEAEEMGFRIGTIGEFAPNFTRLSEHRFATPYLDDRICLYAMIEAARQLGEHEADIYIVASVQEEIGLRGARVASFAIDPEVGIAMDVTFAKQPNDKGKIVPELGKGPVMDVGPNINPKLRQFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tuned by metals: the TET peptidase activity is controlled by 3 metal binding sites.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Lysyl aminopeptidase
total genus 111
structure length 337
sequence length 346
chains with identical sequence B, C
ec nomenclature ec 3.4.11.15: Aminopeptidase Y.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 4x8iA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x8iA01
4X2TA 3LMSA 3NA6A 3JRUA 1FNOA 4MCRA 2Q43A 1CPSA 2CTBA 3FECA 5LRGA 4R76A 1ELLP 4DYOA 2PE3A 4FWUA 4R7MA 4MHNA 4UEFA 8CPAA 4P4BA 1YW4A 4GM5A 3FH4A 2C1CA 2ZENA 4O23A 2JEWA 1CPXA 2IQ6A 2PJ6A 2F8HA 3FF3A 2POKA 4OKOA 4UF4A 1YSJA 1YMEA 4P4EA 4G1PA 1BLLE 3SI1A 1LANA 3FEDA 1XJOA 3SI0A 3BXMA 5HXDA 4F8ZA 4DJLA 3NH5A 4PQAA 5THWA 3MN8A 1F57A 3B35A 1LFWA 5D29A 1GYTA 3SI2A 3PRTA 1FT7A 2ZEEA 2V77A 3D7GA 3SJXA 2AFSA 2V8HA 2ZELA 2PRQA 3V38A 3S9MA 1EE3P 3PB9X 4F9VA 2PJAA 5K8OA 2QVPA 3KGQA 4NJRA 4ZY0A 4MMOA 1F2OA 1CP7A 2XEGA 4R6TA 3WT4A 4NGTA 4P6YA 3KL9A 3K2KA 3D68A 3SJFA 3H8FA 4DUKA 4NGRA 4NGQA 1HEEA 1F2PA 1Z8LA 3TC8A 5JM6A 2PJ2A 4W9YA 1TKHA 2PVVA 3D7FA 3GLJA 2ZEOA 4FAIA 5CBMA 2VL1A 2PJ7A 1Y7EA 4ZY1A 4JZ0A 3B3WA 1IGBA 5LYIA 2ZEFA 4PXEA 1TKJA 2HC9A 2QJ8A 1Y0YA 3L2NA 1ZLIA 2XEFA 3H8GA 3VARA 2RB7A 1BAVA 4R8FA 1DE4C 2GLJA 1ARMA 2C6PA 4X3RA 2PJ9A 2IMOA 1M4LA 1TKFA 4MXUA 4OC5A 2PJ3A 3QNVA 2C6GA 2PJ1A 3B2YA 4P10A 3CPXA 5LYLA 1R43A 4OC4A 3KR5A 4FUUA 4KSIA 4NGNA 3KR4A 3TX8A 4IHMA 4LQGA 4F9UA 2IJZA 2PJ4A 4ZX8A 4NJQA 4OC2A 3MRUA 3PFEA 3B7IA 5LRJA 4OC1A 4OC0A 1Q7LA 3B3VA 1Z2LA 3PEIA 1IY7A 5JGFA 5I4MA 4MCSA 3RZAA 3KI9A 5JH9A 5DS0A 2AFUA 4FBEA 1ZG8A 1AMPA 1LAMA 1ELMP 3PBBA 3PFOA 1KWMA 3D7HA 4Z65A 3CT9A 4YWYA 1HDQA 2EWBA 3D7DA 2QYVA 2CIJA 5LYFA 2PIYA 2XEJA 1R3NA 2OOTA 5HVGA 3SJEA 3PB8X 1XFOA 3N5FA 1UWYA 4PPZA 4P45A 1VIXA 1NSAA 3I1UA 2GLFA 1VGYA 3D66A 4UEEA 1H8LA 2O53A 4WWVA 4B6ZA 1ZLHA 2AFOA 2AFWA 4UIBA 2EK9A 4NGSA 3WC6A 1ZG7A 2ZEGA 2GREA 3KZWA 4P4DA 3V7ZA 4P4IA 4MRIA 4OP4A 3ISZA 2PCUA 1LAPA 3IJ3A 3ISXA 4IAVA 2ZOFA 3FX6A 4EWTA 2AFXA 5F09A 1YLOA 1BPMA 3IC1A 5K8PA 3PB6X 4P4JA 3T8WA 5K8MA 4TWEA 3KHXA 4UEZA 4PXBA 2CF4A 4NGMA 4EMEA 4BD9A 2BCOA 2GU2A 3D67A 3KHZA 3WC7A 2RFHA 3DLJA 4RUHA 4TNUA 3SJGA 4ZY2A 1HDUA 2Q51A 3D4UA 4ZX9A 5CPAA 3PBEA 2AFZA 2JBJA 4K3NA 4MHYA 3RAMA 2G9DA 5D8NA 3KQXA 3K9TA 3LWUA 1AYEA 3BI1A 4OIDA 3KQZA 4CPAA 3B3CA 5IB9A 5LYDA 1CG2A 2Q4ZA 3CPAA 4IK2A 3IO1A 1CP6A 2C6CA 1XRYA 1TF8A 3BI0A 3NFZA 4OMEA 4NGPA 3CDXA 3GB0A 4P4FA 1QMUA 5LRKA 2O4HA 4PXDA 2XEIA 3PB4X 4OC3A 4ONWA 3DGVA 3IFEA 2ZEPA 3BHXA 5HVFA 3B3TA 1Z5RA 4A38A 1PYTB 7CPAA 2ZEHA 4ZYQA 1BPNA 3FMCA 4Q7AA 2NSMA 2BO9A 2JBKA 5K8NA 2HB6A 4H2KA 4X8IA 3IIBA 2WZNA 2CTCA 1JQGA 5HVHA 1YW6A 1TF9A 3WC5A 2PJ8A 3IEHA 2ANPA 3HUVA 4EFDA 4MCQA 2V8VA 2WYRA 3PB7X 2PVWA 1OBRA 2PJ5A 4MCPA 5ELYA 2ZEDA 4MHPA 1PCAA 2V8DA 1RTQA 3S9NA 3FVLA 3GUXA 4A37A 2EK8A 2FVGA 4WJBA 6CPAA 4ZI6A 1Y0RA 2AFMA 4JYWA 3FEEA 3H8EA 1TXRA 2PJBA 5J1QA 2OR4A 1QQ9A 3HLPA 2PIZA 1DTDA 2PJCA 1VHEA 3RBUA 4A39A 1XBUA 1LOKA 3NH8A 2PJ0A 1VHOA 2V8GA 2NYQA 3VATA 1XMBA 3S9LA 3KASA 2ZOGA 2F7VA 3VH9A 3FJUA 4PXCA 4NFRA 4AXVA 2I3CA 3B3SA 2ZEMA 3IWWA 2J9AA 1ARLA 1LCPA 4P44A 4MHZA 2DEAA 1CX8A 4OIWA 1CBXA 4A94A 2ABZA 4YU9A 2BOAA 4UIAA 1ZG9A 3NH4A 3WABA
chains in the Genus database with same CATH superfamily
4X2TA 5TRDA 1TLLA 3NA6A 4WZKA 4MCRA 2YWGA 1CPSA 4OPVA 2PE3A 4DNTB 2OBTA 2I1LA 4Y49C 3WNDA 8CPAA 4XLEA 3FRMA 1YW4A 2ZENA 2OU2A 2PJ6A 1G7CA 1E64A 3CP8A 2Q4VA 4OKOA 1Q9SA 4RS2A 4AVCA 3SI0A 2ZTGA 4HPSA 4F8ZA 4DJLA 2GJKA 4Q38A 3MN8A 4WZEA 3B35A 5G20A 2B7BA 2PRBA 3SI2A 2BEIA 3D26A 3FPKA 4AVBA 3ZPNA 5TY0A 1WORA 2ZEEA 2V77A 1EFTA 3SJXA 2AFSA 4E0FA 2PRQA 3S9MA 3OJXA 4L8AA 5AN9A 5AGEA 1F60A 4KVXA 2PJAA 4ZY0A 3R1KA 4Z1MA 4MMOA 2XEGA 4CYQA 1TIQA 4RDKA 1KUXA 1FRQA 3KL9A 5JPHA 1GO2A 4B5OA 1JA1A 3D68A 1SM4A 4AC9A 1RO5A 2B58A 2EUIA 1F2PA 3P2HA 1SKYB 1YI2B 4W9YA 2PVVA 1U6MA 3TOBA 3WNBA 1S7NA 4ZY1A 2C4UA 4JZ0A 3GKRA 1B87A 3B3WA 1IGBA 4FWTA 2ZEFA 1QSTA 3R9GA 3H5ZA 2ZW4A 4F7DA 3A9LA 4P9SA 4B5PA 2WPDA 3H8GA 1E79A 1IIDA 1QVFB 4R8FA 3I1FA 4X0CA 4U5YA 3W2HA 4WZLA 2IMOA 3AVVA 2FL4A 1VQNB 4ONUA 3RY8A 3QNVA 2EIXA 4DQLA 1Q7YD 3B2YA 5L46A 2BSWA 2VNHA 1Y9WA 4ORFA 3CD6B 1R43A 5LYLA 4Z4WA 3KR5A 2EO8A 4OAEA 3JQQA 3GVJA 4KSIA 5E96A 3HAGA 2WJYA 4GXHA 4CAFA 3KR4A 4CYOA 3TX8A 2OK7A 2Q7SA 4NJQA 1QFZA 3PFEA 1UMKA 3TO7A 5LRJA 2ZL7A 3SEJA 3BCDA 3G3SA 4MCSA 1FNBA 2GJRA 5GCNA 5I0CA 3SXNA 1V0EA 5LMZA 2ARHA 3A3GA 2AFUA 3R6KA 4XL9A 2CW5A 3D2MA 1KZLA 4B3FX 4UFXA 4YWYA 3CCQB 3CXPA 3BH4A 5LYFA 3H4QA 2XEJA 2OOTA 2FS5A 3SJEA 3PB8X 2X8KA 5IYRA 1XFOA 3N5FA 2OB0A 2GFQA 4KOWA 3Q3AA 5KNLA 4UCNA 1K9MD 4ZCMA 4KZTA 4RCYA 2XNCA 4XPDB 2WSSA 3D66A 5F46A 4LQ6A 1EXMA 1H8LA 1W9XA 4WWVA 1ZLHA 1N71A 4U9UA 4CAVA 3F0AA 1V5VA 4RI1A 2GREA 4P4DA 4JJXA 4P4IA 3VMFA 3IJ3A 3OJWA 4B14A 2Z10A 3QSYA 4IAVA 1WP6A 2M5SA 4EWTA 2AFXA 1KK2A 1YLOA 3IC1A 4P4JA 3AVUA 3T8WA 4PC2A 4X5KA 1NBMA 4LUAA 1GAWA 2DEUA 1V0CA 4BD9A 1YX2A 2BCOA 5HZBA 2XNDA 5JQ4A 3D67A 3KHZA 4AVAA 2RFHA 3DLJA 2ZW6A 4A95A 3VNVA 1YQEA 4ZY2A 3SJGA 2ZZFA 2JIZA 3BLNA 5G1ZA 3IU1A 4KUAA 1QX4A 2D3NA 1M90D 4MHYA 3GSIA 1AYEA 3KQZA 5IB9A 3CPAA 4IK2A 1CP6A 2XZOA 2C6CA 1TF8A 1PKVA 3OPOA 2Z0ZA 4KOUA 1E1QA 4ZGYB 1QMUA 5LRKA 4CRYB 3ASQA 1Z8XA 3LQ6A 4UAJA 3WBKA 2DF5A 2OYNA 3KEWA 5A27A 2EVNA 4FD5A 1Z5RA 4RD4A 4A38A 1PYTB 1HVXA 2VYQA 2ZEHA 4KSAA 4E2AA 4XNHB 1N05A 1R5OA 4QB9A 4MI4A 3FMCA 4B48A 1N0VC 4PK3A 2VBVA 2JBKA 1NB0A 3N7ZA 3JUWA 1J4JA 4YAWA 1Q2CA 1QSMA 5DWNA 2WZNA 2QTLA 2PC1A 4RD6A 4MHDA 3HUVA 4EFDA 3H94A 4MCQA 1VLOA 4NSQA 2WYRA 3NE5B 3CESA 5AG4A 2HCJB 1NB9A 5F4OA 4MCPA 3GIRA 1WSRA 2Q4YA 2GK6A 2ZEDA 1ZM4A 4MHPA 2R98A 1EWYA 1RTQA 5CNPA 2RC4A 1AUGA 5IYPA 4KOVA 3QFTA 5AG6A 5DSZA 4ZI6A 2QN6A 2RC5A 4U9YA 4JYWA 5IB0A 2B4DA 5C82A 4NEXA 1CQXA 3R9EA 1EFCA 4BPRA 2BVNA 4UCMA 2QMLA 2OTJB 4X7CA 5J1QA 1VJSA 2F1LA 3LODA 4C7IA 2PIZA 3TFYA 1PJ5A 5GV7A 4M6IA 1VHEA 4A39A 1PU9A 3ZBUA 1LOKA 1BOBA 3OOCA 4UFVA 3T56B 1XMBA 3S9LA 2BM1A 1G7SA 2VEZA 5A88A 2ZOGA 5DWMA 2V31A 4AXVA 3SLDA 2I3CA 4R57A 2CC2A 2B3UA 3CCVB 4X7EA 2J9AA 4DK1A 1UD4A 3PUNA 3B78A 3NE8A 2CNSA 2XNJA 1FY7A 3CCLB 1N8RD 3CC4B 4P3IA 4Q7JB 4M1KA 4ZBGA 2C77A 3WABA 1UD5A 4ZCLA 2C27A 1BX1A 4XORA 2Z11A 2CNMA 5G21A 2Q6LA 2V7WA 4X07A 3FECA 4NNJA 4R76A 1GHEA 1FDRA 4X06A 4FWUA 3Q6RA 4XM3A 3ONYA 4M4SA 3CCUB 4IW3B 4QBJA 4UEFA 3B8HA 4P4BA 5HMNA 2BV3A 3A8KA 5B6IA 4GM5A 1UFHA 3G71B 4WZTA 2JEWA 1VQ9B 2IQ6A 1IJFA 2F8HA 2Q6OA 4AF6A 3WYAA 1H42A 4P4EA 3PZJA 1LANA 1NMTA 3JQPA 1D2EA 4R3KA 4BBHA 2W6IA 3E20A 4R9MA 4ZV4A 4CGPA 2WPXA 3VR6A 1UD2A 2D4PA 2Z3MA 1FT7A 3D7GA 2V8HA 4ASUA 3CCMB 1RQRA 1DG1G 1EE3P 1W87A 4YAUA 5K8OA 2QVPA 3KKWA 4B12A 3LVBA 4PSWA 3OAAA 2BSAA 1CP7A 2HUZA 1K73D 3TO6A 3CCEB 2V7XA 4PC1A 4P6YA 2JDIA 1AIPA 4H89A 4MFLA 5JBQA 5EMIA 4N3NA 2D4OA 4JXRA 4YHBA 3H8FA 3Q39A 1JNYA 4DUKA 3A1PA 2B5OA 5IYWA 2PJ2A 3GLJA 3D7FA 2ZEOA 5CBMA 1Z4RA 2DPSA 2VL1A 1JWQA 1VQ4B 3IGRA 1QGZA 4QVAA 3CXCB 2VQYA 4ACBA 5LYIA 4CGLA 2X3UA 4PV6A 1Y0YA 3L2NA 2XEFA 1T6YA 4NCZA 3BC9A 3VARA 4P22A 3FBUA 2GLJA 1ARMA 2VZLA 2ATRA 5EC4A 3GY9A 3SHPA 1M4LA 2NV4A 2PJ3A 4XPDC 2PQ8A 3CPXA 3AVWA 1IU8A 4XLCA 2V7VA 4OC4A 2B5GA 1WWZA 1ON0A 3FXTA 3K9UA 1QH0A 4IHMA 1U2RA 4LQGA 3G6EB 5FL7A 1WOOA 5F49A 4OC2A 1SKQA 3B7IA 1XE4A 4OC1A 1ZUNB 3V7AA 2DCUA 1YJNB 1Z8TA 2P6FA 1MABA 3ZZIA 1YIJB 1KD1D 1IY7A 4KOXA 5JGFA 1M1DA 3CRZA 2JJ1A 3RZAA 2X85A 3S6HA 3KI9A 2OBRA 5JH9A 1JA0A 4FBEA 1MJAA 1PJ6A 1LAMA 1ELMP 3AVTA 3PBBA 3PFOA 1KWMA 3D7HA 1BX0A 2BF4A 3D2PA 2D9RA 5F48A 1HDQA 1CM0A 2EWBA 4MFQA 1CJWA 5H59A 2R8VA 2CIJA 1R3NA 3I56B 4YGOA 4A32A 4MBUA 2XZLA 1FNCA 3A8IA 1IHMA 2DETA 4YFJA 1VIXA 4PC7A 1NSAA 2DOGA 2VNIA 4UA3A 3I1UA 1BQEA 4TMZA 4CAXA 1B23P 3TOAA 1OHHA 2BMWA 4CGOA 2VI7A 2O53A 2BM0A 2YNCA 5FO0A 2AFOA 1VQ5B 2G3TA 3R95A 3WC6A 1YJ9B 3KZWA 3V7ZA 4OP4A 3ISZA 2VBUA 4E0AA 1W35A 1LAPA 3E0KA 4LBVA 1XEBA 4UWJA 3ISXA 2HDNB 1H85A 1KRHA 1NDHA 5F09A 4MY0A 4JXQA 5K8PA 1MJBA 4Y7CA 1YGHA 2PDOA 2CF4A 4NGMA 4OADA 1M44A 1WPCA 3W5VA 3WC7A 4CRZB 4FD6A 4HNWB 3QAHA 4TNUA 3UY5A 4Y9UA 1VQ6B 1HDUA 2Q51A 4C2YA 1IB0A 3I9SA 1XB2A 1QGAA 3BQJA 4UZEA 2ZBVA 5D8NA 3KQXA 4MYTA 3K9TA 3BI1A 2YWHA 1CG2A 3LD2A 3OE7A 2C2WA 1N06A 3TCVA 2EBJA 4TMTA 2DIEA 4OMEA 4JMQA 3T90A 4M6HA 3CDXA 2BGIA 3I55B 5IYNA 2B3VA 3OKXA 5BSXA 1ZM2A 1XE1A 4Z4YA 3WQZA 2Y0MA 4PXDA 2ZEPA 4KOTA 5FNZA 1Q81D 1IICA 4XPLA 2C4TA 2REEA 2QECA 2OZGA 1GAQA 1N0UA 3FJOA 1BJKA 3AGQA 3JU4A 1VQLB 4H2KA 4PAAA 3SLNA 3EY5A 4XR6A 3IIBA 3ZJ0A 1JQGA 3FPPA 2E1BA 4HIZA 3RO0A 3U6BA 3WC5A 2Z3PA 2WUUA 4TSFA 1OGIA 4C0SA 1N08A 2PVWA 3TTHA 1GJRA 2DPTA 2P3MA 1OB0A 1OBRA 5HKKA 2CK3A 4LX9A 3V8IA 1Q86D 1I21A 4R71A 2YNCC 5F47A 4A37A 2FVGA 2C5BA 2WPWA 3ASSA 4TMVA 4KVOE 2AFMA 2AJ6A 2ZXVA 2D74A 4QUZA 2VBQA 1TUIA 2PSWA 1M4DA 3GIUA 3QAYA 1DTDA 2PJCA 1FRNA 4BINA 1VLYA 4PC6A 4OLLA 2F4NA 4A33A 2VZYA 3ONUA 2WJVA 3PUMA 2Q6IA 2AHOA 2V8GA 2NYQA 3CMAB 3VATA 5FIUA 4B3GA 1XQBA 3VO2A 3CC2B 4Z4TA 1F20A 2F7VA 3FJUA 1XIXA 2QDXA 5F4MA 2FX3A 1WDTA 4GQNA 1QSOA 3AVYA 1QUFA 1ARLA 4KVME 3OW2B 2JDCA 1PJ7A 2DEAA 4FD4A 1UD8A 1OB2A 1S4MA 4OIWA 3CW2A 4TKOB 4XKWA 1CBXA 1YJWB 2ZZEA 5FO1A 4CGMA 5ISVA 4Y49B 3LMSA 4NF1A 2F43A 3JRUA 1FNOA 1G7TA 2GE3A 4E8OA 2A4NA 2CTBA 4A2ZA 2P6GA 2P6EA 4M0LA 3ZBTA 4M2LA 1KK1A 3CZXA 4R7MA 4MHNA 4RN7A 4O23A 1CPXA 4UZFA 2REFA 4AG7A 4G5GA 2V4DA 3DDDA 1VQKB 2POKA 4UF4A 5HXBA 1NSLA 2X6WA 4Z4UA 2WR8A 3BXMA 5J35A 1PUAA 3NH5A 2JLMA 4MFJA 1F57A 1LFWA 2G0BA 1IOIA 4X7FA 5A28A 1WSVA 4XN0A 4G7XA 3CXSA 4IF5A 1T6ZA 3WXMA 4F9VA 1R57A 4NJRA 4Z4ZA 1IJEA 2FIAA 4JWPA 3G8WA 4AVZA 5A89A 4XPKA 4HNXB 1T6XA 4QHYA 4G1BA 2R7HA 1FNDA 3VWEA 2XEXA 4B11A 1S7KA 4J0QA 1D8TA 1KQSB 4HNYB 1HEEA 1L0CA 2P0WA 5J8CA 3TC8A 1R5NA 3TE4A 1TKHA 4K1XA 2R1IA 5GV8A 1Y7EA 1XOVA 1VHSA 5HH1A 1YVOA 4P6VF 1T5EA 4P2NA 2HC9A 4QV2A 2QJ8A 4KLWA 4KOSA 4HE6A 3BJ8A 2OZHA 1S7LA 2RB7A 2VBSA 1VQ8B 3BJ7A 2C6PA 2PJ9A 4B4DA 4MXUA 2XGJA 4OC5A 2ZW7A 2C6GA 1CNEA 3QE2A 2PJ1A 4A31A 4P10A 3PENA 3EC4A 5C88A 3PA1A 4OP7A 2YNEA 5J3OA 4NGNA 3ASTA 2LZJA 2QTZA 4MFKA 4RJLA 1KK3A 1IB1E 2IJZA 2PJ4A 1HZEA 2CRVA 1M1KD 1WU8A 2ODFA 2DXQA 4QVJA 2FSRA 2F1MA 1ZM9A 2CNDA 4OC0A 1Q7LA 4Y9RA 3IWEA 3P27A 4RDJA 3B3VA 4DK0A 3CMMA 3PEIA 4YAFA 4OOVA 3C26A 4YELA 3CP2A 2VJJA 5DS0A 3P26A 3SXOA 1AMPA 3OP1A 1DDIA 2C78A 3D3SA 3D7DA 2QGGA 4II9A 4Q36A 2PIYA 1I1DA 4PC3A 1UWYA 4QUSA 4EVYA 3DR6A 3AGPA 1KC8D 2GLFA 3R9FA 1VGYA 4Z4RA 4UEEA 1X12A 1YHQB 4UWIA 1GVHA 1E1RA 1OB5A 3VNUA 4B6ZA 2EFGA 4A30A 4UIBA 1QG0A 3F5BA 2B5GB 3OZWA 3R6JA 1QSRA 4NGSA 2ZEGA 3MGDA 4RDLA 3U6KA 3OZUA 3TT2A 4RCZA 1KK0A 2ZOFA 2I00A 1BPMA 3GVLA 4TWEA 3P2FA 5AG7A 4TMXA 4CAWA 4EMEA 4Z4VA 2OBSA 3WBJA 1EP3B 1XMTA 2Z3KA 4AG9A 3E1YE 4P3YA 5E6TA 1X10A 1QGYA 4RUHA 3FNCA 4ZGQB 3IWGA 2Z6BD 3D4UA 4X05A 4B13A 4M85A 5J8FA 1IYKA 2JBJA 4YEJA 3CTAA 4K3NA 3RAMA 4C7HA 1EP2B 4WQMA 3ASPA 4OIDA 2XOKA 5F4JA 2Q4ZA 4C68A 1YX0A 4JD6A 4JLYA 4LBWA 5AG5A 1XRYA 2VNKA 3MCAA 2PLFA 1S3ZA 4L8JA 4M6GA 4NGPA 4P4FA 3LQEA 4I49A 2ZL6A 2O4HA 3W5UA 4P26A 4P1VA 4OC3A 2JDDA 4ONWA 3DGVA 3BHXA 4CQJA 5HVFA 2GK7A 2Q6KA 3GYAA 5A8AA 5CDFA 7CPAA 4XKVA 2ZZQA 4G6IA 2IL4A 2BPOA 4KKTA 1BPNA 2PIAA 4C2XA 1I18A 2X6XA 1VQOB 2BO9A 5BSYA 3S6FA 4X8IA 4H6ZA 2CTCA 1YW6A 4FK8A 1Q82D 1TF9A 2PJ8A 1W2BB 5H84A 3BNWA 2ANPA 4F0XA 3SJZA 3Q38A 1ZO0A 2V8VA 4OPSA 3LACA 3PB7X 4MFPA 1P4NA 4KS9A 3VWDA 3PA2A 3AVXA 2PJ5A 3OEHA 4NXYA 2YWFA 5ELYA 3FIXA 2VJIA 1W34A 2V8DA 3ZZ0A 4LBYA 3GUXA 2Q0YA 2KVOA 6CPAA 3MHPA 3IU2A 1Y0RA 2HLDA 2KCWA 2WSAA 2OTLB 2K5TA 3R96A 1EP1B 2ZPAA 1MRZA 5KTDA 2PJBA 1I8DA 2R6HA 3QFRA 2OR4A 1QQ9A 3HLPA 2V7QA 3BY2A 1S7FA 2PJ0A 3OZVA 2CBXA 2B4BA 2VBTA 1QSNA 3OW7A 2V7UA 3VH9A 2HMAA 4PXCA 1RQPA 4NFRA 1EFRA 4U9ZA 3A35A 3B3SA 4M3SA 2J7KA 4DNRB 4P44A 3QFSA 2YNDA 1YREA 4QC6A 2FIWA 5KTCA 4K30A 2FXFA 3B8GA 4A94A 4LBZA 4RD1A 2ABZA 4YU9A 3FKSA 3W6XA 1E3XA 4ZCIA 4HE5A 1S72B 4AF7A 1OGJA 3TO9A 2G3AA 3FYNA 3W91A 3SKBA 3MMPA 4XLFA 1NJID 2Q43A 1IYLA 5HZAA 3FB3A 5TR9A 3B82A 5LRGA 1TVCA 1ELLP 1QUEA 4DYOA 4FXUA 2AE6A 2PR8A 4XNHC 3BY1A 4J3GA 1M4GA 1KTVA 1YVKA 1Y7RA 2D3LA 2DY1A 2ZXHA 1Z9UA 1J9ZA 1Z4EA 3FH4A 4OOXA 2C1CA 3EO4A 2OZUA 2E1RA 1YK3A 1YR0A 1G7RA 1D1NA 1JJ2B 3FF3A 3JVNA 3ASRA 1YSJA 1YMEA 4G1PA 1BLLE 3SI1A 1WOPA 1JB9A 3FEDA 1XJOA 2Z3LA 5HXDA 4QFMA 4PQAA 5THWA 4XONA 4KLVA 1YITB 3W2GA 5D29A 1GYTA 1YLEA 3G05A 1SQHA 3PRTA 3NE7A 4UZUA 4II3A 2NPFA 4B3XA 1BO4A 5FA6A 2ZELA 4GS4A 3V38A 3PB9X 4PGOA 3W2IA 3KGQA 2QA4B 2C5HA 4R3LA 1I7PA 1I12A 1BMFA 3ZZTA 4MFZA 1K28D 1B2RA 4TT3A 3WNCA 1F2OA 2ZBUA 5G22A 3I3GA 2ZW5A 4R6TA 3WT4A 3Q6QA 4MY3A 4NGTA 5EMNA 4ROXA 1VQPB 4MYUA 1VQ7B 3K2KA 3SJFA 4NGRA 4NGQA 2XZPA 1VKCA 4UBRA 1B6BA 3DNSA 2OH1A 4X7DA 1P0HA 1Z8LA 2Q7BA 4ACAA 5JM6A 2BL1A 1QVGB 1R5BA 4FAIA 3PVDA 4RD0A 2W6JA 1GR1A 4YALA 3RNZA 2PJ7A 5KTAA 2FCKA 4FN5A 5KSWB 2FT0A 1DDGA 4PXEA 1BPLA 1TKJA 4XLHA 3DDYA 1ZLIA 2PMDA 1BAVA 1DE4C 2CY2A 4X3RA 2H5MA 3D8PA 1TTTA 2BGJA 2B7CA 1TKFA 2VNJA 1H8HA 4UFWA 3OFNA 4N3GA 4II2A 4P12A 4FUUA 2VZZA 3J81k 1N07A 4KKSA 1K4JA 4KKUA 2X7BA 5DN6A 3CXQA 2ZITA 4YXWA 4F9UA 1WOSA 4RD2A 3W5HA 4HKFA 4ZX8A 1Q2DA 3ES9A 3MRUA 3BCFA 2GPJA 1FX0A 2X53S 1Z2LA 2JJ2A 3WY9A 4B10A 5I4MA 4RM0A 4PK2A 2O28A 4XOTA 4ZGNB 3LNNA 4DNCA 2HQYA 4OOSA 1Z8WA 1ZG8A 4CYPA 3T51B 4XNFA 4PABA 3H9NA 2QMUA 1V0FA 2BUEA 4Z65A 1A2ZA 3CT9A 2ZL5A 1M4IA 2QYVA 5HVGA 2I79A 4PPZA 2CXAA 4P45A 3JQRA 4CYNA 2J8RA 4G1VA 1AMOA 3CCRB 1A8PA 2BN4A 1K8AD 1ZM3A 4CAEA 3ZUGA 4L89A 1P4MA 4XN3A 3SJPA 1Q2YA 2AFWA 3G4SB 2EK9A 1HA3A 1ZG7A 3GVKA 3EFAA 4F0YA 4MRIA 2V7TA 4RPDA 2Z3NA 2PCUA 2WZPP 1Y9KA 1E63A 4CS0B 1E43A 4R87A 3FX6A 2QE7A 3PB6X 5K8MA 3GQBA 3V76A 1KUVA 3KHXA 4YRHA 4UEZA 4PXBA 1RXTA 1UD3A 2GQFA 4B5PB 4KORA 4QVTA 2VXKA 1MJ9A 3CPWB 2GU2A 4KOYA 2NMTA 5IX3A 4B44A 4OPOA 5IV0A 4UCPA 1KUYA 4B43A 4ZX9A 5CPAA 1QFJA 3PBEA 4PSXA 4M53A 2AFZA 2G9DA 1E62A 1XF8A 3LWUA 5H5JA 4IUSA 2JN9A 3B3CA 1BLIA 2FE7A 5LYDA 4CPAA 1WTHD 4NBSA 2Q44A 3IO1A 2JEVA 3DR8A 2HV2A 3S6KA 2CNTA 2Z3OA 3BI0A 3PGPA 3NFZA 5FVJA 4F6AA 3GB0A 3QB8A 3F8KA 3CC7B 3JTKA 2XEIA 4C2ZA 3PB4X 1VQMB 3IFEA 1OZPA 1EFUA 1CNFA 4DQKA 3CCSB 2DERA 3ZIAA 4Z4SA 3B3TA 4CGNA 4H6UA 2YWEA 2R9VA 1COWA 3LO8A 4ZYQA 2ZXIA 5BWAB 3ZZUA 3CMEB 1IOFA 2YGWA 2RC6A 4Q7AA 3T53B 3OEEA 5H86A 1WK4A 2NSMA 4BMHA 5K8NA 4KSFA 1KMHA 2HB6A 3ZC3A 4P25A 1S0UA 1S5KA 3W6SA 4MJ8A 5HVHA 4RLZA 1E3ZA 3IEHA 4RD3A 5KW9A 1KZFA 4LC0A 2J8NA 4G7WA 3EXNA 4B47A 3CB4A 2ZZGA 4AB7A 3PP9A 1ELOA 3W2FA 5EBVA 5IK2A 3A3BA 4FD7A 2QEXB 1MK4A 1PCAA 3S9NA 3FVLA 1KJZA 1W0JA 5IYQA 4XOPA 2EK8A 4WJBA 4NCNA 3W2EA 3T9YA 2DYIA 2B4DB 2F5IA 2GANA 1W0KA 1LRZA 3FEEA 4XD7A 3DSBA 3H8EA 3RYOA 1TXRA 4C43A 2GIVA 3WR7A 1DARA 3RBUA 1XBUA 4KUBA 1NRKA 3OWCA 5TV2A 3NH8A 2QIRA 2X0KA 4YAOA 1VHOA 4TMWA 1NE9A 1FNMA 4XLAA 4EH1A 5THXA 4XQFA 4XMYA 3VO1A 3KASA 3CCJB 4RPBA 2ZTNA 3QFCA 1VF7A 2PR1A 2ZEMA 3IWWA 1QFYA 1LCPA 4TN1A 2J8MA 3A8JA 2OK8A 1S60A 4MHZA 1CX8A 2X6YA 2GJPA 3U2QA 4H9GA 1H8EA 2BOAA 4UIAA 3S6GA 1ZG9A 1UD6A 3NH4A 2Q04A
chains in the Genus database with same CATH topology
4X2TA 3LMSA 3NA6A 3JRUA 1FNOA 4MCRA 2Q43A 1CPSA 2CTBA 3FECA 5LRGA 4R76A 1ELLP 4DYOA 2PE3A 4FWUA 4R7MA 4MHNA 4UEFA 8CPAA 4P4BA 1YW4A 4GM5A 3FH4A 2C1CA 2ZENA 4O23A 2JEWA 1CPXA 2IQ6A 2PJ6A 2F8HA 3FF3A 2POKA 4OKOA 4UF4A 1YSJA 1YMEA 4P4EA 4G1PA 1BLLE 3SI1A 1LANA 3FEDA 1XJOA 3SI0A 3BXMA 5HXDA 4F8ZA 4DJLA 3NH5A 4PQAA 5THWA 3MN8A 1F57A 3B35A 1LFWA 5D29A 1GYTA 3SI2A 3PRTA 1FT7A 2ZEEA 2V77A 3D7GA 3SJXA 2AFSA 2V8HA 2ZELA 2PRQA 3V38A 3S9MA 1EE3P 3PB9X 4F9VA 2PJAA 5K8OA 2QVPA 3KGQA 4NJRA 4ZY0A 4MMOA 1F2OA 1CP7A 2XEGA 4R6TA 3WT4A 4NGTA 4P6YA 3KL9A 3K2KA 3D68A 3SJFA 3H8FA 4DUKA 4NGRA 4NGQA 1HEEA 1F2PA 1Z8LA 3TC8A 5JM6A 2PJ2A 4W9YA 1TKHA 2PVVA 3D7FA 3GLJA 2ZEOA 4FAIA 5CBMA 2VL1A 2PJ7A 1Y7EA 4ZY1A 4JZ0A 3B3WA 1IGBA 5LYIA 2ZEFA 4PXEA 1TKJA 2HC9A 2QJ8A 1Y0YA 3L2NA 1ZLIA 2XEFA 3H8GA 3VARA 2RB7A 1BAVA 4R8FA 1DE4C 2GLJA 1ARMA 2C6PA 4X3RA 2PJ9A 2IMOA 1M4LA 1TKFA 4MXUA 4OC5A 2PJ3A 3QNVA 2C6GA 2PJ1A 3B2YA 4P10A 3CPXA 5LYLA 1R43A 4OC4A 3KR5A 4FUUA 4KSIA 4NGNA 3KR4A 3TX8A 4IHMA 4LQGA 4F9UA 2IJZA 2PJ4A 4ZX8A 4NJQA 4OC2A 3MRUA 3PFEA 3B7IA 5LRJA 4OC1A 4OC0A 1Q7LA 3B3VA 1Z2LA 3PEIA 1IY7A 5JGFA 5I4MA 4MCSA 3RZAA 3KI9A 5JH9A 5DS0A 2AFUA 4FBEA 1ZG8A 1AMPA 1LAMA 1ELMP 3PBBA 3PFOA 1KWMA 3D7HA 4Z65A 3CT9A 4YWYA 1HDQA 2EWBA 3D7DA 2QYVA 2CIJA 5LYFA 2PIYA 2XEJA 1R3NA 2OOTA 5HVGA 3SJEA 3PB8X 1XFOA 3N5FA 1UWYA 4PPZA 4P45A 1VIXA 1NSAA 3I1UA 2GLFA 1VGYA 3D66A 4UEEA 1H8LA 2O53A 4WWVA 4B6ZA 1ZLHA 2AFOA 2AFWA 4UIBA 2EK9A 4NGSA 3WC6A 1ZG7A 2ZEGA 2GREA 3KZWA 4P4DA 3V7ZA 4P4IA 4MRIA 4OP4A 3ISZA 2PCUA 1LAPA 3IJ3A 3ISXA 4IAVA 2ZOFA 3FX6A 4EWTA 2AFXA 5F09A 1YLOA 1BPMA 3IC1A 5K8PA 3PB6X 4P4JA 3T8WA 5K8MA 4TWEA 3KHXA 4UEZA 4PXBA 2CF4A 4NGMA 4EMEA 4BD9A 2BCOA 2GU2A 3D67A 3KHZA 3WC7A 2RFHA 3DLJA 4RUHA 4TNUA 3SJGA 4ZY2A 1HDUA 2Q51A 3D4UA 4ZX9A 5CPAA 3PBEA 2AFZA 2JBJA 4K3NA 4MHYA 3RAMA 2G9DA 5D8NA 3KQXA 3K9TA 3LWUA 1AYEA 3BI1A 4OIDA 3KQZA 4CPAA 3B3CA 5IB9A 5LYDA 1CG2A 2Q4ZA 3CPAA 4IK2A 3IO1A 1CP6A 2C6CA 1XRYA 1TF8A 3BI0A 3NFZA 4OMEA 4NGPA 3CDXA 3GB0A 4P4FA 1QMUA 5LRKA 2O4HA 4PXDA 2XEIA 3PB4X 4OC3A 4ONWA 3DGVA 3IFEA 2ZEPA 3BHXA 5HVFA 3B3TA 1Z5RA 4A38A 1PYTB 7CPAA 2ZEHA 4ZYQA 1BPNA 3FMCA 4Q7AA 2NSMA 2BO9A 2JBKA 5K8NA 2HB6A 4H2KA 4X8IA 3IIBA 2WZNA 2CTCA 1JQGA 5HVHA 1YW6A 1TF9A 3WC5A 2PJ8A 3IEHA 2ANPA 3HUVA 4EFDA 4MCQA 2V8VA 2WYRA 3PB7X 2PVWA 1OBRA 2PJ5A 4MCPA 5ELYA 2ZEDA 4MHPA 1PCAA 2V8DA 1RTQA 3S9NA 3FVLA 3GUXA 4A37A 2EK8A 2FVGA 4WJBA 6CPAA 4ZI6A 1Y0RA 2AFMA 4JYWA 3FEEA 3H8EA 1TXRA 2PJBA 5J1QA 2OR4A 1QQ9A 3HLPA 2PIZA 1DTDA 2PJCA 1VHEA 3RBUA 4A39A 1XBUA 1LOKA 3NH8A 2PJ0A 1VHOA 2V8GA 2NYQA 3VATA 1XMBA 3S9LA 3KASA 2ZOGA 2F7VA 3VH9A 3FJUA 4PXCA 4NFRA 4AXVA 2I3CA 3B3SA 2ZEMA 3IWWA 2J9AA 1ARLA 1LCPA 4P44A 4MHZA 2DEAA 1CX8A 4OIWA 1CBXA 4A94A 2ABZA 4YU9A 2BOAA 4UIAA 1ZG9A 3NH4A 3WABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X2T A;  3LMS A;  3NA6 A;  3JRU A;  1FNO A;  4MCR A;  2Q43 A;  1CPS A;  2CTB A;  3FEC A;  5LRG A;  4R76 A;  1ELL P;  4DYO A;  2PE3 A;  4FWU A;  4R7M A;  4MHN A;  4UEF A;  8CPA A;  4P4B A;  1YW4 A;  4GM5 A;  3FH4 A;  2C1C A;  2ZEN A;  4O23 A;  2JEW A;  1CPX A;  2IQ6 A;  2PJ6 A;  2F8H A;  3FF3 A;  2POK A;  4OKO A;  4UF4 A;  1YSJ A;  1YME A;  4P4E A;  4G1P A;  1BLL E;  3SI1 A;  1LAN A;  3FED A;  1XJO A;  3SI0 A;  3BXM A;  5HXD A;  4F8Z A;  4DJL A;  3NH5 A;  4PQA A;  5THW A;  3MN8 A;  1F57 A;  3B35 A;  1LFW A;  5D29 A;  1GYT A;  3SI2 A;  3PRT A;  1FT7 A;  2ZEE A;  2V77 A;  3D7G A;  3SJX A;  2AFS A;  2V8H A;  2ZEL A;  2PRQ A;  3V38 A;  3S9M A;  1EE3 P;  3PB9 X;  4F9V A;  2PJA A;  5K8O A;  2QVP A;  3KGQ A;  4NJR A;  4ZY0 A;  4MMO A;  1F2O A;  1CP7 A;  2XEG A;  4R6T A;  3WT4 A;  4NGT A;  4P6Y A;  3KL9 A;  3K2K A;  3D68 A;  3SJF A;  3H8F A;  4DUK A;  4NGR A;  4NGQ A;  1HEE A;  1F2P A;  1Z8L A;  3TC8 A;  5JM6 A;  2PJ2 A;  4W9Y A;  1TKH A;  2PVV A;  3D7F A;  3GLJ A;  2ZEO A;  4FAI A;  5CBM A;  2VL1 A;  2PJ7 A;  1Y7E A;  4ZY1 A;  4JZ0 A;  3B3W A;  1IGB A;  5LYI A;  2ZEF A;  4PXE A;  1TKJ A;  2HC9 A;  2QJ8 A;  1Y0Y A;  3L2N A;  1ZLI A;  2XEF A;  3H8G A;  3VAR A;  2RB7 A;  1BAV A;  4R8F A;  1DE4 C;  2GLJ A;  1ARM A;  2C6P A;  4X3R A;  2PJ9 A;  2IMO A;  1M4L A;  1TKF A;  4MXU A;  4OC5 A;  2PJ3 A;  3QNV A;  2C6G A;  2PJ1 A;  3B2Y A;  4P10 A;  3CPX A;  5LYL A;  1R43 A;  4OC4 A;  3KR5 A;  4FUU A;  4KSI A;  4NGN A;  3KR4 A;  3TX8 A;  4IHM A;  4LQG A;  4F9U A;  2IJZ A;  2PJ4 A;  4ZX8 A;  4NJQ A;  4OC2 A;  3MRU A;  3PFE A;  3B7I A;  5LRJ A;  4OC1 A;  4OC0 A;  1Q7L A;  3B3V A;  1Z2L A;  3PEI A;  1IY7 A;  5JGF A;  5I4M A;  4MCS A;  3RZA A;  3KI9 A;  5JH9 A;  5DS0 A;  2AFU A;  4FBE A;  1ZG8 A;  1AMP A;  1LAM A;  1ELM P;  3PBB A;  3PFO A;  1KWM A;  3D7H A;  4Z65 A;  3CT9 A;  4YWY A;  1HDQ A;  2EWB A;  3D7D A;  2QYV A;  2CIJ A;  5LYF A;  2PIY A;  2XEJ A;  1R3N A;  2OOT A;  5HVG A;  3SJE A;  3PB8 X;  1XFO A;  3N5F A;  1UWY A;  4PPZ A;  4P45 A;  1VIX A;  1NSA A;  3I1U A;  2GLF A;  1VGY A;  3D66 A;  4UEE A;  1H8L A;  2O53 A;  4WWV A;  4B6Z A;  1ZLH A;  2AFO A;  2AFW A;  4UIB A;  2EK9 A;  4NGS A;  3WC6 A;  1ZG7 A;  2ZEG A;  2GRE A;  3KZW A;  4P4D A;  3V7Z A;  4P4I A;  4MRI A;  4OP4 A;  3ISZ A;  2PCU A;  1LAP A;  3IJ3 A;  3ISX A;  4IAV A;  2ZOF A;  3FX6 A;  4EWT A;  2AFX A;  5F09 A;  1YLO A;  1BPM A;  3IC1 A;  5K8P A;  3PB6 X;  4P4J A;  3T8W A;  5K8M A;  4TWE A;  3KHX A;  4UEZ A;  4PXB A;  2CF4 A;  4NGM A;  4EME A;  4BD9 A;  2BCO A;  2GU2 A;  3D67 A;  3KHZ A;  3WC7 A;  2RFH A;  3DLJ A;  4RUH A;  4TNU A;  3SJG A;  4ZY2 A;  1HDU A;  2Q51 A;  3D4U A;  4ZX9 A;  5CPA A;  3PBE A;  2AFZ A;  2JBJ A;  4K3N A;  4MHY A;  3RAM A;  2G9D A;  5D8N A;  3KQX A;  3K9T A;  3LWU A;  1AYE A;  3BI1 A;  4OID A;  3KQZ A;  4CPA A;  3B3C A;  5IB9 A;  5LYD A;  1CG2 A;  2Q4Z A;  3CPA A;  4IK2 A;  3IO1 A;  1CP6 A;  2C6C A;  1XRY A;  1TF8 A;  3BI0 A;  3NFZ A;  4OME A;  4NGP A;  3CDX A;  3GB0 A;  4P4F A;  1QMU A;  5LRK A;  2O4H A;  4PXD A;  2XEI A;  3PB4 X;  4OC3 A;  4ONW A;  3DGV A;  3IFE A;  2ZEP A;  3BHX A;  5HVF A;  3B3T A;  1Z5R A;  4A38 A;  1PYT B;  7CPA A;  2ZEH A;  4ZYQ A;  1BPN A;  3FMC A;  4Q7A A;  2NSM A;  2BO9 A;  2JBK A;  5K8N A;  2HB6 A;  4H2K A;  4X8I A;  3IIB A;  2WZN A;  2CTC A;  1JQG A;  5HVH A;  1YW6 A;  1TF9 A;  3WC5 A;  2PJ8 A;  3IEH A;  2ANP A;  3HUV A;  4EFD A;  4MCQ A;  2V8V A;  2WYR A;  3PB7 X;  2PVW A;  1OBR A;  2PJ5 A;  4MCP A;  5ELY A;  2ZED A;  4MHP A;  1PCA A;  2V8D A;  1RTQ A;  3S9N A;  3FVL A;  3GUX A;  4A37 A;  2EK8 A;  2FVG A;  4WJB A;  6CPA A;  4ZI6 A;  1Y0R A;  2AFM A;  4JYW A;  3FEE A;  3H8E A;  1TXR A;  2PJB A;  5J1Q A;  2OR4 A;  1QQ9 A;  3HLP A;  2PIZ A;  1DTD A;  2PJC A;  1VHE A;  3RBU A;  4A39 A;  1XBU A;  1LOK A;  3NH8 A;  2PJ0 A;  1VHO A;  2V8G A;  2NYQ A;  3VAT A;  1XMB A;  3S9L A;  3KAS A;  2ZOG A;  2F7V A;  3VH9 A;  3FJU A;  4PXC A;  4NFR A;  4AXV A;  2I3C A;  3B3S A;  2ZEM A;  3IWW A;  2J9A A;  1ARL A;  1LCP A;  4P44 A;  4MHZ A;  2DEA A;  1CX8 A;  4OIW A;  1CBX A;  4A94 A;  2ABZ A;  4YU9 A;  2BOA A;  4UIA A;  1ZG9 A;  3NH4 A;  3WAB A; 
#chains in the Genus database with same CATH topology
 4X2T A;  5TRD A;  1TLL A;  3NA6 A;  4WZK A;  4MCR A;  2YWG A;  1CPS A;  4OPV A;  2PE3 A;  4DNT B;  2OBT A;  2I1L A;  4Y49 C;  3WND A;  8CPA A;  4XLE A;  3FRM A;  1YW4 A;  2ZEN A;  2OU2 A;  2PJ6 A;  1G7C A;  1E64 A;  3CP8 A;  2Q4V A;  4OKO A;  1Q9S A;  4RS2 A;  4AVC A;  3SI0 A;  2ZTG A;  4HPS A;  4F8Z A;  4DJL A;  2GJK A;  4Q38 A;  3MN8 A;  4WZE A;  3B35 A;  5G20 A;  2B7B A;  2PRB A;  3SI2 A;  2BEI A;  3D26 A;  3FPK A;  4AVB A;  3ZPN A;  5TY0 A;  1WOR A;  2ZEE A;  2V77 A;  1EFT A;  3SJX A;  2AFS A;  4E0F A;  2PRQ A;  3S9M A;  3OJX A;  4L8A A;  5AN9 A;  5AGE A;  1F60 A;  4KVX A;  2PJA A;  4ZY0 A;  3R1K A;  4Z1M A;  4MMO A;  2XEG A;  4CYQ A;  1TIQ A;  4RDK A;  1KUX A;  1FRQ A;  3KL9 A;  5JPH A;  1GO2 A;  4B5O A;  1JA1 A;  3D68 A;  1SM4 A;  4AC9 A;  1RO5 A;  2B58 A;  2EUI A;  1F2P A;  3P2H A;  1SKY B;  1YI2 B;  4W9Y A;  2PVV A;  1U6M A;  3TOB A;  3WNB A;  1S7N A;  4ZY1 A;  2C4U A;  4JZ0 A;  3GKR A;  1B87 A;  3B3W A;  1IGB A;  4FWT A;  2ZEF A;  1QST A;  3R9G A;  3H5Z A;  2ZW4 A;  4F7D A;  3A9L A;  4P9S A;  4B5P A;  2WPD A;  3H8G A;  1E79 A;  1IID A;  1QVF B;  4R8F A;  3I1F A;  4X0C A;  4U5Y A;  3W2H A;  4WZL A;  2IMO A;  3AVV A;  2FL4 A;  1VQN B;  4ONU A;  3RY8 A;  3QNV A;  2EIX A;  4DQL A;  1Q7Y D;  3B2Y A;  5L46 A;  2BSW A;  2VNH A;  1Y9W A;  4ORF A;  3CD6 B;  1R43 A;  5LYL A;  4Z4W A;  3KR5 A;  2EO8 A;  4OAE A;  3JQQ A;  3GVJ A;  4KSI A;  5E96 A;  3HAG A;  2WJY A;  4GXH A;  4CAF A;  3KR4 A;  4CYO A;  3TX8 A;  2OK7 A;  2Q7S A;  4NJQ A;  1QFZ A;  3PFE A;  1UMK A;  3TO7 A;  5LRJ A;  2ZL7 A;  3SEJ A;  3BCD A;  3G3S A;  4MCS A;  1FNB A;  2GJR A;  5GCN A;  5I0C A;  3SXN A;  1V0E A;  5LMZ A;  2ARH A;  3A3G A;  2AFU A;  3R6K A;  4XL9 A;  2CW5 A;  3D2M A;  1KZL A;  4B3F X;  4UFX A;  4YWY A;  3CCQ B;  3CXP A;  3BH4 A;  5LYF A;  3H4Q A;  2XEJ A;  2OOT A;  2FS5 A;  3SJE A;  3PB8 X;  2X8K A;  5IYR A;  1XFO A;  3N5F A;  2OB0 A;  2GFQ A;  4KOW A;  3Q3A A;  5KNL A;  4UCN A;  1K9M D;  4ZCM A;  4KZT A;  4RCY A;  2XNC A;  4XPD B;  2WSS A;  3D66 A;  5F46 A;  4LQ6 A;  1EXM A;  1H8L A;  1W9X A;  4WWV A;  1ZLH A;  1N71 A;  4U9U A;  4CAV A;  3F0A A;  1V5V A;  4RI1 A;  2GRE A;  4P4D A;  4JJX A;  4P4I A;  3VMF A;  3IJ3 A;  3OJW A;  4B14 A;  2Z10 A;  3QSY A;  4IAV A;  1WP6 A;  2M5S A;  4EWT A;  2AFX A;  1KK2 A;  1YLO A;  3IC1 A;  4P4J A;  3AVU A;  3T8W A;  4PC2 A;  4X5K A;  1NBM A;  4LUA A;  1GAW A;  2DEU A;  1V0C A;  4BD9 A;  1YX2 A;  2BCO A;  5HZB A;  2XND A;  5JQ4 A;  3D67 A;  3KHZ A;  4AVA A;  2RFH A;  3DLJ A;  2ZW6 A;  4A95 A;  3VNV A;  1YQE A;  4ZY2 A;  3SJG A;  2ZZF A;  2JIZ A;  3BLN A;  5G1Z A;  3IU1 A;  4KUA A;  1QX4 A;  2D3N A;  1M90 D;  4MHY A;  3GSI A;  1AYE A;  3KQZ A;  5IB9 A;  3CPA A;  4IK2 A;  1CP6 A;  2XZO A;  2C6C A;  1TF8 A;  1PKV A;  3OPO A;  2Z0Z A;  4KOU A;  1E1Q A;  4ZGY B;  1QMU A;  5LRK A;  4CRY B;  3ASQ A;  1Z8X A;  3LQ6 A;  4UAJ A;  3WBK A;  2DF5 A;  2OYN A;  3KEW A;  5A27 A;  2EVN A;  4FD5 A;  1Z5R A;  4RD4 A;  4A38 A;  1PYT B;  1HVX A;  2VYQ A;  2ZEH A;  4KSA A;  4E2A A;  4XNH B;  1N05 A;  1R5O A;  4QB9 A;  4MI4 A;  3FMC A;  4B48 A;  1N0V C;  4PK3 A;  2VBV A;  2JBK A;  1NB0 A;  3N7Z A;  3JUW A;  1J4J A;  4YAW A;  1Q2C A;  1QSM A;  5DWN A;  2WZN A;  2QTL A;  2PC1 A;  4RD6 A;  4MHD A;  3HUV A;  4EFD A;  3H94 A;  4MCQ A;  1VLO A;  4NSQ A;  2WYR A;  3NE5 B;  3CES A;  5AG4 A;  2HCJ B;  1NB9 A;  5F4O A;  4MCP A;  3GIR A;  1WSR A;  2Q4Y A;  2GK6 A;  2ZED A;  1ZM4 A;  4MHP A;  2R98 A;  1EWY A;  1RTQ A;  5CNP A;  2RC4 A;  1AUG A;  5IYP A;  4KOV A;  3QFT A;  5AG6 A;  5DSZ A;  4ZI6 A;  2QN6 A;  2RC5 A;  4U9Y A;  4JYW A;  5IB0 A;  2B4D A;  5C82 A;  4NEX A;  1CQX A;  3R9E A;  1EFC A;  4BPR A;  2BVN A;  4UCM A;  2QML A;  2OTJ B;  4X7C A;  5J1Q A;  1VJS A;  2F1L A;  3LOD A;  4C7I A;  2PIZ A;  3TFY A;  1PJ5 A;  5GV7 A;  4M6I A;  1VHE A;  4A39 A;  1PU9 A;  3ZBU A;  1LOK A;  1BOB A;  3OOC A;  4UFV A;  3T56 B;  1XMB A;  3S9L A;  2BM1 A;  1G7S A;  2VEZ A;  5A88 A;  2ZOG A;  5DWM A;  2V31 A;  4AXV A;  3SLD A;  2I3C A;  4R57 A;  2CC2 A;  2B3U A;  3CCV B;  4X7E A;  2J9A A;  4DK1 A;  1UD4 A;  3PUN A;  3B78 A;  3NE8 A;  2CNS A;  2XNJ A;  1FY7 A;  3CCL B;  1N8R D;  3CC4 B;  4P3I A;  4Q7J B;  4M1K A;  4ZBG A;  2C77 A;  3WAB A;  1UD5 A;  4ZCL A;  2C27 A;  1BX1 A;  4XOR A;  2Z11 A;  2CNM A;  5G21 A;  2Q6L A;  2V7W A;  4X07 A;  3FEC A;  4NNJ A;  4R76 A;  1GHE A;  1FDR A;  4X06 A;  4FWU A;  3Q6R A;  4XM3 A;  3ONY A;  4M4S A;  3CCU B;  4IW3 B;  4QBJ A;  4UEF A;  3B8H A;  4P4B A;  5HMN A;  2BV3 A;  3A8K A;  5B6I A;  4GM5 A;  1UFH A;  3G71 B;  4WZT A;  2JEW A;  1VQ9 B;  2IQ6 A;  1IJF A;  2F8H A;  2Q6O A;  4AF6 A;  3WYA A;  1H42 A;  4P4E A;  3PZJ A;  1LAN A;  1NMT A;  3JQP A;  1D2E A;  4R3K A;  4BBH A;  2W6I A;  3E20 A;  4R9M A;  4ZV4 A;  4CGP A;  2WPX A;  3VR6 A;  1UD2 A;  2D4P A;  2Z3M A;  1FT7 A;  3D7G A;  2V8H A;  4ASU A;  3CCM B;  1RQR A;  1DG1 G;  1EE3 P;  1W87 A;  4YAU A;  5K8O A;  2QVP A;  3KKW A;  4B12 A;  3LVB A;  4PSW A;  3OAA A;  2BSA A;  1CP7 A;  2HUZ A;  1K73 D;  3TO6 A;  3CCE B;  2V7X A;  4PC1 A;  4P6Y A;  2JDI A;  1AIP A;  4H89 A;  4MFL A;  5JBQ A;  5EMI A;  4N3N A;  2D4O A;  4JXR A;  4YHB A;  3H8F A;  3Q39 A;  1JNY A;  4DUK A;  3A1P A;  2B5O A;  5IYW A;  2PJ2 A;  3GLJ A;  3D7F A;  2ZEO A;  5CBM A;  1Z4R A;  2DPS A;  2VL1 A;  1JWQ A;  1VQ4 B;  3IGR A;  1QGZ A;  4QVA A;  3CXC B;  2VQY A;  4ACB A;  5LYI A;  4CGL A;  2X3U A;  4PV6 A;  1Y0Y A;  3L2N A;  2XEF A;  1T6Y A;  4NCZ A;  3BC9 A;  3VAR A;  4P22 A;  3FBU A;  2GLJ A;  1ARM A;  2VZL A;  2ATR A;  5EC4 A;  3GY9 A;  3SHP A;  1M4L A;  2NV4 A;  2PJ3 A;  4XPD C;  2PQ8 A;  3CPX A;  3AVW A;  1IU8 A;  4XLC A;  2V7V A;  4OC4 A;  2B5G A;  1WWZ A;  1ON0 A;  3FXT A;  3K9U A;  1QH0 A;  4IHM A;  1U2R A;  4LQG A;  3G6E B;  5FL7 A;  1WOO A;  5F49 A;  4OC2 A;  1SKQ A;  3B7I A;  1XE4 A;  4OC1 A;  1ZUN B;  3V7A A;  2DCU A;  1YJN B;  1Z8T A;  2P6F A;  1MAB A;  3ZZI A;  1YIJ B;  1KD1 D;  1IY7 A;  4KOX A;  5JGF A;  1M1D A;  3CRZ A;  2JJ1 A;  3RZA A;  2X85 A;  3S6H A;  3KI9 A;  2OBR A;  5JH9 A;  1JA0 A;  4FBE A;  1MJA A;  1PJ6 A;  1LAM A;  1ELM P;  3AVT A;  3PBB A;  3PFO A;  1KWM A;  3D7H A;  1BX0 A;  2BF4 A;  3D2P A;  2D9R A;  5F48 A;  1HDQ A;  1CM0 A;  2EWB A;  4MFQ A;  1CJW A;  5H59 A;  2R8V A;  2CIJ A;  1R3N A;  3I56 B;  4YGO A;  4A32 A;  4MBU A;  2XZL A;  1FNC A;  3A8I A;  1IHM A;  2DET A;  4YFJ A;  1VIX A;  4PC7 A;  1NSA A;  2DOG A;  2VNI A;  4UA3 A;  3I1U A;  1BQE A;  4TMZ A;  4CAX A;  1B23 P;  3TOA A;  1OHH A;  2BMW A;  4CGO A;  2VI7 A;  2O53 A;  2BM0 A;  2YNC A;  5FO0 A;  2AFO A;  1VQ5 B;  2G3T A;  3R95 A;  3WC6 A;  1YJ9 B;  3KZW A;  3V7Z A;  4OP4 A;  3ISZ A;  2VBU A;  4E0A A;  1W35 A;  1LAP A;  3E0K A;  4LBV A;  1XEB A;  4UWJ A;  3ISX A;  2HDN B;  1H85 A;  1KRH A;  1NDH A;  5F09 A;  4MY0 A;  4JXQ A;  5K8P A;  1MJB A;  4Y7C A;  1YGH A;  2PDO A;  2CF4 A;  4NGM A;  4OAD A;  1M44 A;  1WPC A;  3W5V A;  3WC7 A;  4CRZ B;  4FD6 A;  4HNW B;  3QAH A;  4TNU A;  3UY5 A;  4Y9U A;  1VQ6 B;  1HDU A;  2Q51 A;  4C2Y A;  1IB0 A;  3I9S A;  1XB2 A;  1QGA A;  3BQJ A;  4UZE A;  2ZBV A;  5D8N A;  3KQX A;  4MYT A;  3K9T A;  3BI1 A;  2YWH A;  1CG2 A;  3LD2 A;  3OE7 A;  2C2W A;  1N06 A;  3TCV A;  2EBJ A;  4TMT A;  2DIE A;  4OME A;  4JMQ A;  3T90 A;  4M6H A;  3CDX A;  2BGI A;  3I55 B;  5IYN A;  2B3V A;  3OKX A;  5BSX A;  1ZM2 A;  1XE1 A;  4Z4Y A;  3WQZ A;  2Y0M A;  4PXD A;  2ZEP A;  4KOT A;  5FNZ A;  1Q81 D;  1IIC A;  4XPL A;  2C4T A;  2REE A;  2QEC A;  2OZG A;  1GAQ A;  1N0U A;  3FJO A;  1BJK A;  3AGQ A;  3JU4 A;  1VQL B;  4H2K A;  4PAA A;  3SLN A;  3EY5 A;  4XR6 A;  3IIB A;  3ZJ0 A;  1JQG A;  3FPP A;  2E1B A;  4HIZ A;  3RO0 A;  3U6B A;  3WC5 A;  2Z3P A;  2WUU A;  4TSF A;  1OGI A;  4C0S A;  1N08 A;  2PVW A;  3TTH A;  1GJR A;  2DPT A;  2P3M A;  1OB0 A;  1OBR A;  5HKK A;  2CK3 A;  4LX9 A;  3V8I A;  1Q86 D;  1I21 A;  4R71 A;  2YNC C;  5F47 A;  4A37 A;  2FVG A;  2C5B A;  2WPW A;  3ASS A;  4TMV A;  4KVO E;  2AFM A;  2AJ6 A;  2ZXV A;  2D74 A;  4QUZ A;  2VBQ A;  1TUI A;  2PSW A;  1M4D A;  3GIU A;  3QAY A;  1DTD A;  2PJC A;  1FRN A;  4BIN A;  1VLY A;  4PC6 A;  4OLL A;  2F4N A;  4A33 A;  2VZY A;  3ONU A;  2WJV A;  3PUM A;  2Q6I A;  2AHO A;  2V8G A;  2NYQ A;  3CMA B;  3VAT A;  5FIU A;  4B3G A;  1XQB A;  3VO2 A;  3CC2 B;  4Z4T A;  1F20 A;  2F7V A;  3FJU A;  1XIX A;  2QDX A;  5F4M A;  2FX3 A;  1WDT A;  4GQN A;  1QSO A;  3AVY A;  1QUF A;  1ARL A;  4KVM E;  3OW2 B;  2JDC A;  1PJ7 A;  2DEA A;  4FD4 A;  1UD8 A;  1OB2 A;  1S4M A;  4OIW A;  3CW2 A;  4TKO B;  4XKW A;  1CBX A;  1YJW B;  2ZZE A;  5FO1 A;  4CGM A;  5ISV A;  4Y49 B;  3LMS A;  4NF1 A;  2F43 A;  3JRU A;  1FNO A;  1G7T A;  2GE3 A;  4E8O A;  2A4N A;  2CTB A;  4A2Z A;  2P6G A;  2P6E A;  4M0L A;  3ZBT A;  4M2L A;  1KK1 A;  3CZX A;  4R7M A;  4MHN A;  4RN7 A;  4O23 A;  1CPX A;  4UZF A;  2REF A;  4AG7 A;  4G5G A;  2V4D A;  3DDD A;  1VQK B;  2POK A;  4UF4 A;  5HXB A;  1NSL A;  2X6W A;  4Z4U A;  2WR8 A;  3BXM A;  5J35 A;  1PUA A;  3NH5 A;  2JLM A;  4MFJ A;  1F57 A;  1LFW A;  2G0B A;  1IOI A;  4X7F A;  5A28 A;  1WSV A;  4XN0 A;  4G7X A;  3CXS A;  4IF5 A;  1T6Z A;  3WXM A;  4F9V A;  1R57 A;  4NJR A;  4Z4Z A;  1IJE A;  2FIA A;  4JWP A;  3G8W A;  4AVZ A;  5A89 A;  4XPK A;  4HNX B;  1T6X A;  4QHY A;  4G1B A;  2R7H A;  1FND A;  3VWE A;  2XEX A;  4B11 A;  1S7K A;  4J0Q A;  1D8T A;  1KQS B;  4HNY B;  1HEE A;  1L0C A;  2P0W A;  5J8C A;  3TC8 A;  1R5N A;  3TE4 A;  1TKH A;  4K1X A;  2R1I A;  5GV8 A;  1Y7E A;  1XOV A;  1VHS A;  5HH1 A;  1YVO A;  4P6V F;  1T5E A;  4P2N A;  2HC9 A;  4QV2 A;  2QJ8 A;  4KLW A;  4KOS A;  4HE6 A;  3BJ8 A;  2OZH A;  1S7L A;  2RB7 A;  2VBS A;  1VQ8 B;  3BJ7 A;  2C6P A;  2PJ9 A;  4B4D A;  4MXU A;  2XGJ A;  4OC5 A;  2ZW7 A;  2C6G A;  1CNE A;  3QE2 A;  2PJ1 A;  4A31 A;  4P10 A;  3PEN A;  3EC4 A;  5C88 A;  3PA1 A;  4OP7 A;  2YNE A;  5J3O A;  4NGN A;  3AST A;  2LZJ A;  2QTZ A;  4MFK A;  4RJL A;  1KK3 A;  1IB1 E;  2IJZ A;  2PJ4 A;  1HZE A;  2CRV A;  1M1K D;  1WU8 A;  2ODF A;  2DXQ A;  4QVJ A;  2FSR A;  2F1M A;  1ZM9 A;  2CND A;  4OC0 A;  1Q7L A;  4Y9R A;  3IWE A;  3P27 A;  4RDJ A;  3B3V A;  4DK0 A;  3CMM A;  3PEI A;  4YAF A;  4OOV A;  3C26 A;  4YEL A;  3CP2 A;  2VJJ A;  5DS0 A;  3P26 A;  3SXO A;  1AMP A;  3OP1 A;  1DDI A;  2C78 A;  3D3S A;  3D7D A;  2QGG A;  4II9 A;  4Q36 A;  2PIY A;  1I1D A;  4PC3 A;  1UWY A;  4QUS A;  4EVY A;  3DR6 A;  3AGP A;  1KC8 D;  2GLF A;  3R9F A;  1VGY A;  4Z4R A;  4UEE A;  1X12 A;  1YHQ B;  4UWI A;  1GVH A;  1E1R A;  1OB5 A;  3VNU A;  4B6Z A;  2EFG A;  4A30 A;  4UIB A;  1QG0 A;  3F5B A;  2B5G B;  3OZW A;  3R6J A;  1QSR A;  4NGS A;  2ZEG A;  3MGD A;  4RDL A;  3U6K A;  3OZU A;  3TT2 A;  4RCZ A;  1KK0 A;  2ZOF A;  2I00 A;  1BPM A;  3GVL A;  4TWE A;  3P2F A;  5AG7 A;  4TMX A;  4CAW A;  4EME A;  4Z4V A;  2OBS A;  3WBJ A;  1EP3 B;  1XMT A;  2Z3K A;  4AG9 A;  3E1Y E;  4P3Y A;  5E6T A;  1X10 A;  1QGY A;  4RUH A;  3FNC A;  4ZGQ B;  3IWG A;  2Z6B D;  3D4U A;  4X05 A;  4B13 A;  4M85 A;  5J8F A;  1IYK A;  2JBJ A;  4YEJ A;  3CTA A;  4K3N A;  3RAM A;  4C7H A;  1EP2 B;  4WQM A;  3ASP A;  4OID A;  2XOK A;  5F4J A;  2Q4Z A;  4C68 A;  1YX0 A;  4JD6 A;  4JLY A;  4LBW A;  5AG5 A;  1XRY A;  2VNK A;  3MCA A;  2PLF A;  1S3Z A;  4L8J A;  4M6G A;  4NGP A;  4P4F A;  3LQE A;  4I49 A;  2ZL6 A;  2O4H A;  3W5U A;  4P26 A;  4P1V A;  4OC3 A;  2JDD A;  4ONW A;  3DGV A;  3BHX A;  4CQJ A;  5HVF A;  2GK7 A;  2Q6K A;  3GYA A;  5A8A A;  5CDF A;  7CPA A;  4XKV A;  2ZZQ A;  4G6I A;  2IL4 A;  2BPO A;  4KKT A;  1BPN A;  2PIA A;  4C2X A;  1I18 A;  2X6X A;  1VQO B;  2BO9 A;  5BSY A;  3S6F A;  4X8I A;  4H6Z A;  2CTC A;  1YW6 A;  4FK8 A;  1Q82 D;  1TF9 A;  2PJ8 A;  1W2B B;  5H84 A;  3BNW A;  2ANP A;  4F0X A;  3SJZ A;  3Q38 A;  1ZO0 A;  2V8V A;  4OPS A;  3LAC A;  3PB7 X;  4MFP A;  1P4N A;  4KS9 A;  3VWD A;  3PA2 A;  3AVX A;  2PJ5 A;  3OEH A;  4NXY A;  2YWF A;  5ELY A;  3FIX A;  2VJI A;  1W34 A;  2V8D A;  3ZZ0 A;  4LBY A;  3GUX A;  2Q0Y A;  2KVO A;  6CPA A;  3MHP A;  3IU2 A;  1Y0R A;  2HLD A;  2KCW A;  2WSA A;  2OTL B;  2K5T A;  3R96 A;  1EP1 B;  2ZPA A;  1MRZ A;  5KTD A;  2PJB A;  1I8D A;  2R6H A;  3QFR A;  2OR4 A;  1QQ9 A;  3HLP A;  2V7Q A;  3BY2 A;  1S7F A;  2PJ0 A;  3OZV A;  2CBX A;  2B4B A;  2VBT A;  1QSN A;  3OW7 A;  2V7U A;  3VH9 A;  2HMA A;  4PXC A;  1RQP A;  4NFR A;  1EFR A;  4U9Z A;  3A35 A;  3B3S A;  4M3S A;  2J7K A;  4DNR B;  4P44 A;  3QFS A;  2YND A;  1YRE A;  4QC6 A;  2FIW A;  5KTC A;  4K30 A;  2FXF A;  3B8G A;  4A94 A;  4LBZ A;  4RD1 A;  2ABZ A;  4YU9 A;  3FKS A;  3W6X A;  1E3X A;  4ZCI A;  4HE5 A;  1S72 B;  4AF7 A;  1OGJ A;  3TO9 A;  2G3A A;  3FYN A;  3W91 A;  3SKB A;  3MMP A;  4XLF A;  1NJI D;  2Q43 A;  1IYL A;  5HZA A;  3FB3 A;  5TR9 A;  3B82 A;  5LRG A;  1TVC A;  1ELL P;  1QUE A;  4DYO A;  4FXU A;  2AE6 A;  2PR8 A;  4XNH C;  3BY1 A;  4J3G A;  1M4G A;  1KTV A;  1YVK A;  1Y7R A;  2D3L A;  2DY1 A;  2ZXH A;  1Z9U A;  1J9Z A;  1Z4E A;  3FH4 A;  4OOX A;  2C1C A;  3EO4 A;  2OZU A;  2E1R A;  1YK3 A;  1YR0 A;  1G7R A;  1D1N A;  1JJ2 B;  3FF3 A;  3JVN A;  3ASR A;  1YSJ A;  1YME A;  4G1P A;  1BLL E;  3SI1 A;  1WOP A;  1JB9 A;  3FED A;  1XJO A;  2Z3L A;  5HXD A;  4QFM A;  4PQA A;  5THW A;  4XON A;  4KLV A;  1YIT B;  3W2G A;  5D29 A;  1GYT A;  1YLE A;  3G05 A;  1SQH A;  3PRT A;  3NE7 A;  4UZU A;  4II3 A;  2NPF A;  4B3X A;  1BO4 A;  5FA6 A;  2ZEL A;  4GS4 A;  3V38 A;  3PB9 X;  4PGO A;  3W2I A;  3KGQ A;  2QA4 B;  2C5H A;  4R3L A;  1I7P A;  1I12 A;  1BMF A;  3ZZT A;  4MFZ A;  1K28 D;  1B2R A;  4TT3 A;  3WNC A;  1F2O A;  2ZBU A;  5G22 A;  3I3G A;  2ZW5 A;  4R6T A;  3WT4 A;  3Q6Q A;  4MY3 A;  4NGT A;  5EMN A;  4ROX A;  1VQP B;  4MYU A;  1VQ7 B;  3K2K A;  3SJF A;  4NGR A;  4NGQ A;  2XZP A;  1VKC A;  4UBR A;  1B6B A;  3DNS A;  2OH1 A;  4X7D A;  1P0H A;  1Z8L A;  2Q7B A;  4ACA A;  5JM6 A;  2BL1 A;  1QVG B;  1R5B A;  4FAI A;  3PVD A;  4RD0 A;  2W6J A;  1GR1 A;  4YAL A;  3RNZ A;  2PJ7 A;  5KTA A;  2FCK A;  4FN5 A;  5KSW B;  2FT0 A;  1DDG A;  4PXE A;  1BPL A;  1TKJ A;  4XLH A;  3DDY A;  1ZLI A;  2PMD A;  1BAV A;  1DE4 C;  2CY2 A;  4X3R A;  2H5M A;  3D8P A;  1TTT A;  2BGJ A;  2B7C A;  1TKF A;  2VNJ A;  1H8H A;  4UFW A;  3OFN A;  4N3G A;  4II2 A;  4P12 A;  4FUU A;  2VZZ A;  3J81 k;  1N07 A;  4KKS A;  1K4J A;  4KKU A;  2X7B A;  5DN6 A;  3CXQ A;  2ZIT A;  4YXW A;  4F9U A;  1WOS A;  4RD2 A;  3W5H A;  4HKF A;  4ZX8 A;  1Q2D A;  3ES9 A;  3MRU A;  3BCF A;  2GPJ A;  1FX0 A;  2X53 S;  1Z2L A;  2JJ2 A;  3WY9 A;  4B10 A;  5I4M A;  4RM0 A;  4PK2 A;  2O28 A;  4XOT A;  4ZGN B;  3LNN A;  4DNC A;  2HQY A;  4OOS A;  1Z8W A;  1ZG8 A;  4CYP A;  3T51 B;  4XNF A;  4PAB A;  3H9N A;  2QMU A;  1V0F A;  2BUE A;  4Z65 A;  1A2Z A;  3CT9 A;  2ZL5 A;  1M4I A;  2QYV A;  5HVG A;  2I79 A;  4PPZ A;  2CXA A;  4P45 A;  3JQR A;  4CYN A;  2J8R A;  4G1V A;  1AMO A;  3CCR B;  1A8P A;  2BN4 A;  1K8A D;  1ZM3 A;  4CAE A;  3ZUG A;  4L89 A;  1P4M A;  4XN3 A;  3SJP A;  1Q2Y A;  2AFW A;  3G4S B;  2EK9 A;  1HA3 A;  1ZG7 A;  3GVK A;  3EFA A;  4F0Y A;  4MRI A;  2V7T A;  4RPD A;  2Z3N A;  2PCU A;  2WZP P;  1Y9K A;  1E63 A;  4CS0 B;  1E43 A;  4R87 A;  3FX6 A;  2QE7 A;  3PB6 X;  5K8M A;  3GQB A;  3V76 A;  1KUV A;  3KHX A;  4YRH A;  4UEZ A;  4PXB A;  1RXT A;  1UD3 A;  2GQF A;  4B5P B;  4KOR A;  4QVT A;  2VXK A;  1MJ9 A;  3CPW B;  2GU2 A;  4KOY A;  2NMT A;  5IX3 A;  4B44 A;  4OPO A;  5IV0 A;  4UCP A;  1KUY A;  4B43 A;  4ZX9 A;  5CPA A;  1QFJ A;  3PBE A;  4PSX A;  4M53 A;  2AFZ A;  2G9D A;  1E62 A;  1XF8 A;  3LWU A;  5H5J A;  4IUS A;  2JN9 A;  3B3C A;  1BLI A;  2FE7 A;  5LYD A;  4CPA A;  1WTH D;  4NBS A;  2Q44 A;  3IO1 A;  2JEV A;  3DR8 A;  2HV2 A;  3S6K A;  2CNT A;  2Z3O A;  3BI0 A;  3PGP A;  3NFZ A;  5FVJ A;  4F6A A;  3GB0 A;  3QB8 A;  3F8K A;  3CC7 B;  3JTK A;  2XEI A;  4C2Z A;  3PB4 X;  1VQM B;  3IFE A;  1OZP A;  1EFU A;  1CNF A;  4DQK A;  3CCS B;  2DER A;  3ZIA A;  4Z4S A;  3B3T A;  4CGN A;  4H6U A;  2YWE A;  2R9V A;  1COW A;  3LO8 A;  4ZYQ A;  2ZXI A;  5BWA B;  3ZZU A;  3CME B;  1IOF A;  2YGW A;  2RC6 A;  4Q7A A;  3T53 B;  3OEE A;  5H86 A;  1WK4 A;  2NSM A;  4BMH A;  5K8N A;  4KSF A;  1KMH A;  2HB6 A;  3ZC3 A;  4P25 A;  1S0U A;  1S5K A;  3W6S A;  4MJ8 A;  5HVH A;  4RLZ A;  1E3Z A;  3IEH A;  4RD3 A;  5KW9 A;  1KZF A;  4LC0 A;  2J8N A;  4G7W A;  3EXN A;  4B47 A;  3CB4 A;  2ZZG A;  4AB7 A;  3PP9 A;  1ELO A;  3W2F A;  5EBV A;  5IK2 A;  3A3B A;  4FD7 A;  2QEX B;  1MK4 A;  1PCA A;  3S9N A;  3FVL A;  1KJZ A;  1W0J A;  5IYQ A;  4XOP A;  2EK8 A;  4WJB A;  4NCN A;  3W2E A;  3T9Y A;  2DYI A;  2B4D B;  2F5I A;  2GAN A;  1W0K A;  1LRZ A;  3FEE A;  4XD7 A;  3DSB A;  3H8E A;  3RYO A;  1TXR A;  4C43 A;  2GIV A;  3WR7 A;  1DAR A;  3RBU A;  1XBU A;  4KUB A;  1NRK A;  3OWC A;  5TV2 A;  3NH8 A;  2QIR A;  2X0K A;  4YAO A;  1VHO A;  4TMW A;  1NE9 A;  1FNM A;  4XLA A;  4EH1 A;  5THX A;  4XQF A;  4XMY A;  3VO1 A;  3KAS A;  3CCJ B;  4RPB A;  2ZTN A;  3QFC A;  1VF7 A;  2PR1 A;  2ZEM A;  3IWW A;  1QFY A;  1LCP A;  4TN1 A;  2J8M A;  3A8J A;  2OK8 A;  1S60 A;  4MHZ A;  1CX8 A;  2X6Y A;  2GJP A;  3U2Q A;  4H9G A;  1H8E A;  2BOA A;  4UIA A;  3S6G A;  1ZG9 A;  1UD6 A;  3NH4 A;  2Q04 A; 
#chains in the Genus database with same CATH homology
 4X2T A;  3LMS A;  3NA6 A;  3JRU A;  1FNO A;  4MCR A;  2Q43 A;  1CPS A;  2CTB A;  3FEC A;  5LRG A;  4R76 A;  1ELL P;  4DYO A;  2PE3 A;  4FWU A;  4R7M A;  4MHN A;  4UEF A;  8CPA A;  4P4B A;  1YW4 A;  4GM5 A;  3FH4 A;  2C1C A;  2ZEN A;  4O23 A;  2JEW A;  1CPX A;  2IQ6 A;  2PJ6 A;  2F8H A;  3FF3 A;  2POK A;  4OKO A;  4UF4 A;  1YSJ A;  1YME A;  4P4E A;  4G1P A;  1BLL E;  3SI1 A;  1LAN A;  3FED A;  1XJO A;  3SI0 A;  3BXM A;  5HXD A;  4F8Z A;  4DJL A;  3NH5 A;  4PQA A;  5THW A;  3MN8 A;  1F57 A;  3B35 A;  1LFW A;  5D29 A;  1GYT A;  3SI2 A;  3PRT A;  1FT7 A;  2ZEE A;  2V77 A;  3D7G A;  3SJX A;  2AFS A;  2V8H A;  2ZEL A;  2PRQ A;  3V38 A;  3S9M A;  1EE3 P;  3PB9 X;  4F9V A;  2PJA A;  5K8O A;  2QVP A;  3KGQ A;  4NJR A;  4ZY0 A;  4MMO A;  1F2O A;  1CP7 A;  2XEG A;  4R6T A;  3WT4 A;  4NGT A;  4P6Y A;  3KL9 A;  3K2K A;  3D68 A;  3SJF A;  3H8F A;  4DUK A;  4NGR A;  4NGQ A;  1HEE A;  1F2P A;  1Z8L A;  3TC8 A;  5JM6 A;  2PJ2 A;  4W9Y A;  1TKH A;  2PVV A;  3D7F A;  3GLJ A;  2ZEO A;  4FAI A;  5CBM A;  2VL1 A;  2PJ7 A;  1Y7E A;  4ZY1 A;  4JZ0 A;  3B3W A;  1IGB A;  5LYI A;  2ZEF A;  4PXE A;  1TKJ A;  2HC9 A;  2QJ8 A;  1Y0Y A;  3L2N A;  1ZLI A;  2XEF A;  3H8G A;  3VAR A;  2RB7 A;  1BAV A;  4R8F A;  1DE4 C;  2GLJ A;  1ARM A;  2C6P A;  4X3R A;  2PJ9 A;  2IMO A;  1M4L A;  1TKF A;  4MXU A;  4OC5 A;  2PJ3 A;  3QNV A;  2C6G A;  2PJ1 A;  3B2Y A;  4P10 A;  3CPX A;  5LYL A;  1R43 A;  4OC4 A;  3KR5 A;  4FUU A;  4KSI A;  4NGN A;  3KR4 A;  3TX8 A;  4IHM A;  4LQG A;  4F9U A;  2IJZ A;  2PJ4 A;  4ZX8 A;  4NJQ A;  4OC2 A;  3MRU A;  3PFE A;  3B7I A;  5LRJ A;  4OC1 A;  4OC0 A;  1Q7L A;  3B3V A;  1Z2L A;  3PEI A;  1IY7 A;  5JGF A;  5I4M A;  4MCS A;  3RZA A;  3KI9 A;  5JH9 A;  5DS0 A;  2AFU A;  4FBE A;  1ZG8 A;  1AMP A;  1LAM A;  1ELM P;  3PBB A;  3PFO A;  1KWM A;  3D7H A;  4Z65 A;  3CT9 A;  4YWY A;  1HDQ A;  2EWB A;  3D7D A;  2QYV A;  2CIJ A;  5LYF A;  2PIY A;  2XEJ A;  1R3N A;  2OOT A;  5HVG A;  3SJE A;  3PB8 X;  1XFO A;  3N5F A;  1UWY A;  4PPZ A;  4P45 A;  1VIX A;  1NSA A;  3I1U A;  2GLF A;  1VGY A;  3D66 A;  4UEE A;  1H8L A;  2O53 A;  4WWV A;  4B6Z A;  1ZLH A;  2AFO A;  2AFW A;  4UIB A;  2EK9 A;  4NGS A;  3WC6 A;  1ZG7 A;  2ZEG A;  2GRE A;  3KZW A;  4P4D A;  3V7Z A;  4P4I A;  4MRI A;  4OP4 A;  3ISZ A;  2PCU A;  1LAP A;  3IJ3 A;  3ISX A;  4IAV A;  2ZOF A;  3FX6 A;  4EWT A;  2AFX A;  5F09 A;  1YLO A;  1BPM A;  3IC1 A;  5K8P A;  3PB6 X;  4P4J A;  3T8W A;  5K8M A;  4TWE A;  3KHX A;  4UEZ A;  4PXB A;  2CF4 A;  4NGM A;  4EME A;  4BD9 A;  2BCO A;  2GU2 A;  3D67 A;  3KHZ A;  3WC7 A;  2RFH A;  3DLJ A;  4RUH A;  4TNU A;  3SJG A;  4ZY2 A;  1HDU A;  2Q51 A;  3D4U A;  4ZX9 A;  5CPA A;  3PBE A;  2AFZ A;  2JBJ A;  4K3N A;  4MHY A;  3RAM A;  2G9D A;  5D8N A;  3KQX A;  3K9T A;  3LWU A;  1AYE A;  3BI1 A;  4OID A;  3KQZ A;  4CPA A;  3B3C A;  5IB9 A;  5LYD A;  1CG2 A;  2Q4Z A;  3CPA A;  4IK2 A;  3IO1 A;  1CP6 A;  2C6C A;  1XRY A;  1TF8 A;  3BI0 A;  3NFZ A;  4OME A;  4NGP A;  3CDX A;  3GB0 A;  4P4F A;  1QMU A;  5LRK A;  2O4H A;  4PXD A;  2XEI A;  3PB4 X;  4OC3 A;  4ONW A;  3DGV A;  3IFE A;  2ZEP A;  3BHX A;  5HVF A;  3B3T A;  1Z5R A;  4A38 A;  1PYT B;  7CPA A;  2ZEH A;  4ZYQ A;  1BPN A;  3FMC A;  4Q7A A;  2NSM A;  2BO9 A;  2JBK A;  5K8N A;  2HB6 A;  4H2K A;  4X8I A;  3IIB A;  2WZN A;  2CTC A;  1JQG A;  5HVH A;  1YW6 A;  1TF9 A;  3WC5 A;  2PJ8 A;  3IEH A;  2ANP A;  3HUV A;  4EFD A;  4MCQ A;  2V8V A;  2WYR A;  3PB7 X;  2PVW A;  1OBR A;  2PJ5 A;  4MCP A;  5ELY A;  2ZED A;  4MHP A;  1PCA A;  2V8D A;  1RTQ A;  3S9N A;  3FVL A;  3GUX A;  4A37 A;  2EK8 A;  2FVG A;  4WJB A;  6CPA A;  4ZI6 A;  1Y0R A;  2AFM A;  4JYW A;  3FEE A;  3H8E A;  1TXR A;  2PJB A;  5J1Q A;  2OR4 A;  1QQ9 A;  3HLP A;  2PIZ A;  1DTD A;  2PJC A;  1VHE A;  3RBU A;  4A39 A;  1XBU A;  1LOK A;  3NH8 A;  2PJ0 A;  1VHO A;  2V8G A;  2NYQ A;  3VAT A;  1XMB A;  3S9L A;  3KAS A;  2ZOG A;  2F7V A;  3VH9 A;  3FJU A;  4PXC A;  4NFR A;  4AXV A;  2I3C A;  3B3S A;  2ZEM A;  3IWW A;  2J9A A;  1ARL A;  1LCP A;  4P44 A;  4MHZ A;  2DEA A;  1CX8 A;  4OIW A;  1CBX A;  4A94 A;  2ABZ A;  4YU9 A;  2BOA A;  4UIA A;  1ZG9 A;  3NH4 A;  3WAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...