4X8IA

De novo crystal structure of the pyrococcus furiosus tet3 aminopeptidase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
346
structure length
337
Chain Sequence
MVDWELMKKIIESPGVSGYEHLGIRDLVVDILKDVADEVKIDKLGNVIAHFKGSAPKVMVAAHMDKIGLMVNHIDKDGYLRVVPIGGVLPETLIAQKIRFFTEKGERYGVVGVLPPHLRIDWDSIIVDVGASSREEAEEMGFRIGTIGEFAPNFTRLSEHRFATPYLDDRICLYAMIEAARQLGEHEADIYIVASVQEEIGLRGARVASFAIDPEVGIAMDVTFAKQPNDKGKIVPELGKGPVMDVGPNINPKLRQFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lysyl aminopeptidase
publication title Tuned by metals: the TET peptidase activity is controlled by 3 metal binding sites.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 111
structure length 337
sequence length 346
chains with identical sequence B, C
ec nomenclature ec 3.4.11.15: Aminopeptidase Y.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 4x8iA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x8iA01
4P4EA 4EWTA 5JM6A 2PJ3A 4MCRA 4DUKA 3BI0A 1CBXA 4ZYQA 4DYOA 3NH4A 1NSAA 1AMPA 3SJGA 2PJ9A 3FECA 3I1UA 3CPXA 4ZY0A 4X8IA 2NYQA 4G1PA 1KWMA 3BXMA 4JZ0A 4X3RA 2WZNA 5LYIA 4MHYA 4OC1A 4AXVA 2OOTA 4OIWA 3WC5A 1AYEA 3IO1A 3VARA 2EK8A 4P45A 5D29A 3D68A 4MHNA 4IHMA 2V77A 1CP7A 1ZLHA 1YLOA 4OC3A 4P4FA 2V8VA 3IJ3A 3KASA 1EE3P 1H8LA 2C1CA 2IQ6A 2JEWA 1CP6A 5HXDA 3PRTA 4NJRA 1UWYA 3KR4A 2CTCA 4Q7AA 2PRQA 3B2YA 4MCQA 2F8HA 5CPAA 2ZENA 1TKJA 5JGFA 2ZEDA 2BO9A 2ZEMA 4OC0A 4TWEA 4P44A 4F8ZA 1XBUA 3NFZA 4JYWA 4ZI6A 2V8DA 3PEIA 3K2KA 4MHPA 5DS0A 1XMBA 3FH4A 4NGQA 7CPAA 3KQZA 4RUHA 4B6ZA 3RBUA 2C6GA 2I3CA 2POKA 4NFRA 1BLLE 1ZLIA 3DGVA 2PIZA 5JH9A 3IEHA 1QMUA 4F9VA 2AFWA 4MRIA 2NSMA 4A37A 5LRGA 4UEEA 4UEFA 3D7HA 2PJ1A 3PFEA 2PE3A 1BPMA 1CG2A 3KHXA 1RTQA 2PJ2A 3LWUA 2ZEGA 3GLJA 1PYTB 1Y7EA 4IK2A 3ISXA 5THWA 2PJCA 2EK9A 3CPAA 1LCPA 3TX8A 1HEEA 4FBEA 1FNOA 3PBEA 3RZAA 4KSIA 4F9UA 5LRJA 5LYLA 4NJQA 2ZEHA 3D7FA 3BHXA 2WYRA 3PB7X 1YSJA 4OC2A 4NGPA 4TNUA 3SJEA 3SI0A 3PB8X 4PXEA 4P4JA 3FX6A 3S9NA 2ZOGA 2Q51A 1HDQA 1ZG7A 1Y0RA 5D8NA 1TF9A 1VGYA 4MCSA 2F7VA 2FVGA 4Z65A 5ELYA 3SJFA 4OC5A 3PB9X 3H8EA 1TF8A 3B7IA 3SI2A 4PXBA 1QQ9A 3KL9A 4PQAA 3CDXA 1ARLA 5LRKA 2IMOA 4OP4A 4FUUA 4UF4A 2HB6A 4P4BA 2PIYA 2BOAA 4W9YA 3QNVA 1LAMA 2ZEOA 1DTDA 3N5FA 3KGQA 1YW4A 3IC1A 2PJ5A 3SI1A 1ZG9A 2J9AA 4NGSA 1LANA 2OR4A 2C6CA 4NGNA 4OMEA 1CX8A 4R8FA 1YMEA 4K3NA 1LFWA 3K9TA 4OIDA 3T8WA 2PJ0A 4H2KA 2AFOA 3KZWA 4PPZA 4OC4A 4FWUA 2PJ8A 2RFHA 2DEAA 3L2NA 1VHOA 2QYVA 1FT7A 2QVPA 3D4UA 3FEDA 4DJLA 3H8FA 4ZX8A 2PJ6A 3ISZA 2HC9A 1LOKA 1BPNA 4R76A 2ZOFA 2CF4A 2ANPA 4P6YA 3FVLA 3VATA 2PCUA 2PVVA 3D66A 1OBRA 2PJ4A 3CT9A 4X2TA 3IFEA 6CPAA 1IY7A 3NA6A 4P4DA 5LYFA 1CPSA 1F2PA 4IAVA 1Z5RA 3FF3A 3RAMA 8CPAA 1DE4C 2JBKA 3GUXA 1F57A 3B3WA 5IB9A 1BAVA 3IIBA 1M4LA 2GU2A 4A38A 3PBBA 4ZY1A 1VHEA 3H8GA 4MMOA 2ZEEA 3VH9A 4ZX9A 3FJUA 1ZG8A 4NGMA 3KR5A 3B3SA 2PJ7A 2GLFA 2AFMA 5K8PA 1Q7LA 1CPXA 2AFSA 2VL1A 1Y0YA 4NGTA 2XEIA 4MHZA 2V8GA 1LAPA 2C6PA 3NH5A 3NH8A 4OKOA 3KQXA 1ARMA 1YW6A 3GB0A 1JQGA 4O23A 4ONWA 4GM5A 4P4IA 4MXUA 1R43A 2IJZA 4WJBA 3BI1A 2V8HA 3JRUA 2XEGA 3WC7A 3WT4A 2O4HA 4FAIA 2ABZA 4CPAA 3DLJA 1F2OA 3SJXA 3S9LA 3HUVA 3FEEA 4A39A 3MRUA 1ELLP 2CIJA 3KHZA 4ZY2A 2AFXA 2JBJA 3FMCA 5K8OA 2CTBA 4R6TA 3PFOA 3V38A 1XRYA 4NGRA 3WC6A 2ZELA 2AFUA 1TXRA 4EMEA 5HVFA 4YWYA 3TC8A 2GLJA 4UEZA 3B35A 3KI9A 2Q43A 3WABA 1XJOA 1GYTA 4EFDA 4PXDA 4R7MA 2XEFA 3B3CA 3S9MA 3PB4X 3B3TA 1HDUA 2Q4ZA 4PXCA 3B3VA 2QJ8A 1TKHA 5HVGA 2AFZA 1IGBA 1R3NA 2ZEFA 2PJBA 4BD9A 3D7GA 3PB6X 3HLPA 4YU9A 5F09A 4UIAA 1Z8LA 5HVHA 2GREA 2ZEPA 5K8NA 1PCAA 2PVWA 5LYDA 2BCOA 2XEJA 3MN8A 1ELMP 2G9DA 1XFOA 4P10A 3V7ZA 2RB7A 3IWWA 2EWBA 1Z2LA 5CBMA 5I4MA 5K8MA 4A94A 4LQGA 4MCPA 3D67A 2O53A 1VIXA 3LMSA 2PJAA 5J1QA 4WWVA 3D7DA 4UIBA 1TKFA
chains in the Genus database with same CATH superfamily
1KZFA 3TO6A 4DK1A 3BI0A 4X7CA 4G7WA 3CC4B 1NSAA 2QMUA 4MY3A 3QAYA 4YAWA 4Y9UA 3JVNA 4B48A 4JD6A 4UWIA 3MHPA 1Z8XA 4HNYB 4Z4YA 4KUBA 4X7DA 3D26A 1XE1A 2AJ6A 4G1PA 4OOVA 4NCZA 4X3RA 2WZNA 4MHYA 3S6KA 3ASQA 3CCRB 3CCVB 2BPOA 4OIWA 4XNHB 2B7CA 3CZXA 1OB2A 2V7VA 3ZC3A 2VBVA 1YJNB 3LO8A 4P3IA 1IB1E 3TT2A 3IJ3A 2R1IA 1N06A 4RCYA 1K9MD 2JEWA 4AVCA 2CTCA 2YNEA 3FXTA 4FK8A 4Q7AA 2QE7A 4AG7A 4OOXA 4F7DA 4X7FA 1VHSA 4RI1A 4XD7A 2ZTNA 3CC7B 4BBHA 2FE7A 2F5IA 4J0QA 5JGFA 1QX4A 3VNUA 4JMQA 4L8AA 3BCFA 4ROXA 2VXKA 4OC0A 3TCVA 5H59A 1L0CA 1XBUA 5IYNA 3N7ZA 2V8DA 3MMPA 4KZTA 3CPWB 1N0UA 4RN7A 5B6IA 4MHPA 4XLEA 2ZTGA 1S4MA 1GR1A 2C6GA 4B11A 1VQOB 5GV7A 2I3CA 1W87A 3DGVA 2JJ2A 2PIZA 5JH9A 4Z4ZA 2REEA 2HMAA 3AVWA 1G7RA 2NSMA 4A37A 2DOGA 3SJPA 5KSWB 3H94A 4U9YA 4G1BA 3PFEA 1Z4EA 2FX3A 1BPMA 2PR8A 2G3TA 5KW9A 3KHXA 3LWUA 2Q44A 3CCEB 4GS4A 4HPSA 2Z10A 4AVBA 1QSMA 3GLJA 1PYTB 4B5OA 2OZUA 5A28A 1FNMA 4HIZA 3CPAA 3IU1A 3BC9A 4E8OA 1Q81D 2GJPA 4FBEA 1I12A 4A31A 1FNOA 1CNFA 3RZAA 4U5YA 2GJRA 5LRJA 5LYLA 4FD6A 4B14A 4NJQA 4R3KA 2QTLA 3VO1A 2ZEHA 4UCPA 4TMTA 4NGPA 4KVXA 3SJEA 3PB8X 4PXEA 3A3GA 4P4JA 2Q51A 1K73D 4MCSA 2GIVA 3T56B 1TF8A 4M0LA 3GSIA 1EFRA 4WZTA 3WNDA 3I56B 3ASSA 4PQAA 3NE5B 3D8PA 5LRKA 4FUUA 5BSXA 3GIRA 4DNTB 3Q6RA 2PIYA 2JDCA 2ZW7A 3CC2B 3G71B 3U6BA 1B2RA 3CCLB 2DIEA 1P0HA 4BMHA 3T53B 4LBWA 2J8MA 1YW4A 3R96A 3SXOA 4QVTA 4NGSA 2JDIA 5A8AA 1KK1A 2C6CA 4OMEA 3FRMA 1BJKA 3OE7A 4R9MA 4M6GA 4OIDA 2FS5A 1W34A 3OKXA 3PGPA 4RD0A 4PPZA 2Q7BA 4M53A 1V0EA 1YITB 1I1DA 2RFHA 1VQ5B 1JWQA 2ZZEA 1FNCA 3IWEA 3FEDA 2QDXA 2WSSA 4UCMA 4CAXA 2YGWA 4XPKA 4QHYA 1QFYA 4ZCIA 1BPNA 4YELA 3I3GA 3S6GA 2OB0A 1DARA 3E0KA 2PCUA 2YWGA 3JQRA 4QUZA 3CT9A 1OB0A 2B4BA 3IFEA 3JUWA 4X2TA 3VWDA 1S0UA 1X12A 4KOTA 4UFXA 1CPSA 1F2PA 5TY0A 3CTAA 2JBKA 4M1KA 4XNHC 1H42A 4XPLA 4KOSA 1F57A 5IB9A 1PJ7A 3IIBA 1M4LA 4ACBA 1S7FA 4M6IA 2P6EA 2GU2A 4A95A 3A8JA 3PBBA 4ZCLA 2OBRA 3ASRA 2CNDA 1DDGA 2ZEEA 1D2EA 2YNCC 3KR5A 3B3SA 5K8PA 2GLFA 4PAAA 2Q6OA 4MHZA 2V8GA 2HDNB 2C6PA 3D2PA 4CGMA 4OKOA 1JJ2B 2BVNA 1E43A 1YW6A 2C5BA 4TMVA 4P4IA 1N0VC 4QVAA 1QFZA 4KLWA 2IJZA 5E6TA 4CAEA 4WJBA 3BI1A 4B5PA 3PUNA 2XGJA 3JU4A 3FBUA 4IF5A 4AVZA 4XMYA 1KUYA 2D74A 4FAIA 2ABZA 4CPAA 3DLJA 3HAGA 1F2OA 2Q6KA 1EFTA 1W0KA 2K5TA 4CGOA 4TN1A 2W6IA 2BUEA 5F48A 4PK3A 3ZBUA 2R6HA 3MRUA 3DR8A 3KHZA 2JBJA 3W5VA 2CTBA 3ES9A 1V5VA 3BY1A 3WC6A 1T6YA 5JBQA 3EC4A 1CNEA 3LNNA 2OH1A 3B35A 4Q38A 1V0CA 1XJOA 1VQ6B 5THXA 1GYTA 4EFDA 3FJOA 1I7PA 3B3CA 4B43A 2PDOA 2WZPP 4XKVA 4KOWA 4PC7A 4DNRB 3OFNA 1YLEA 4JXRA 1R3NA 5HVGA 2PJBA 2P6FA 4BD9A 2M5SA 4QUSA 1NRKA 4MHDA 5F46A 5HVHA 4Q36A 4BPRA 4B10A 2BCOA 4KOXA 1MRZA 2ODFA 2XEJA 3LD2A 1ELMP 2G9DA 1XFOA 3GVKA 1KC8D 4R71A 2B3VA 1E1QA 3ZZ0A 2BMWA 3IWWA 1UMKA 2Z11A 4ZGQB 5I4MA 2B58A 4YAUA 2DETA 1Q82D 2ZITA 3OZUA 1VIXA 3LMSA 2PJAA 2VBQA 4UIBA 1VQ7B 1HA3A 5JM6A 2CY2A 4FD5A 4GQNA 5TRDA 1CBXA 3AVXA 2VNIA 1WSVA 3KEWA 3W2EA 3TE4A 1AMPA 2ZW6A 2PJ9A 5IYRA 5EBVA 4XKWA 1QGZA 3I1UA 4IUSA 4KSFA 5H86A 1KWMA 1J4JA 3B78A 3G4SB 1RQRA 5LYIA 1VQMB 2QA4B 1NE9A 1NDHA 2ZW5A 2OOTA 1AYEA 1E63A 4TMWA 5FO1A 4XLFA 2HCJB 2D4OA 3FYNA 4UFVA 3D68A 4IHMA 3CXPA 2V77A 3RO0A 4OC3A 4B3XA 4LBYA 2XZLA 2V8VA 1WTHD 2Q7SA 1MABA 2BGIA 1ELOA 2VYQA 1CP6A 4CYPA 3GKRA 2YWHA 1Z8TA 2ARHA 3KR4A 4MCQA 2F8HA 5CPAA 2ZENA 1KK3A 1SM4A 1TKJA 1Q2DA 1B6BA 4P1VA 4KOUA 4XORA 5A89A 1UD2A 4M2LA 4TWEA 3K9UA 5C82A 3GVJA 3BH4A 4F8ZA 1NB9A 3NFZA 1IHMA 5IV0A 4CAWA 3K2KA 4JLYA 1XMBA 7CPAA 3KQZA 1AUGA 4RUHA 4B6ZA 3RBUA 1UD8A 1QVGB 2POKA 4NFRA 1BLLE 1ZLIA 3ZZIA 1QMUA 1M4IA 4UA3A 4F9VA 3A3BA 2Y0MA 1EP3B 1LRZA 1S72B 3ZZTA 3CMEB 1CG2A 2D4PA 2XEXA 1RTQA 3UY5A 2ZEGA 3DNSA 5H5JA 1COWA 3ISXA 4RLZA 1F60A 1I21A 4Y9RA 2DCUA 3EO4A 3PB7X 2VBTA 1KZLA 4E0AA 2B3UA 1VQ4B 1Q2YA 3FX6A 2ZOGA 3W2FA 2JDDA 1Y0RA 3DDDA 3W5HA 5D8NA 3LQEA 1VGYA 1FNDA 4UCNA 2VZZA 2F7VA 4Z65A 1SQHA 1Z9UA 3H8EA 3B7IA 5KTCA 4P12A 3SI2A 4M4SA 3W91A 3G05A 3LVBA 1KQSB 3RYOA 3CDXA 1N05A 3TFYA 4JWPA 3W2IA 4YALA 2NPFA 4OP4A 4UF4A 4P4BA 3A35A 1N71A 2PSWA 3DR6A 5AG5A 2XNCA 4M3SA 3OJWA 3PA1A 2EUIA 4LUAA 3TTHA 1VQ9B 3ONYA 5DN6A 3EFAA 3PVDA 4G6IA 1VKCA 1W2BB 2ZEOA 1TVCA 2BL1A 3KGQA 4H6ZA 3BQJA 4U9ZA 2PJ5A 1YGHA 2J9AA 3PP9A 4KKSA 5KNLA 3H9NA 1BMFA 4C43A 2OR4A 3R95A 3SHPA 1CX8A 1P4NA 1YMEA 2F1MA 4E0FA 4ASUA 4H2KA 3E20A 2ZL7A 1CM0A 4KUAA 4ZV4A 3TOAA 1S3ZA 2HQYA 4FWUA 3WY9A 2JIZA 1PUAA 2V7XA 2DEUA 1FT7A 4OPSA 2Z6BD 4H9GA 4C2YA 1R57A 4WZKA 4C7IA 4E2AA 1I18A 1GHEA 2Q04A 2YNCA 2ANPA 4P6YA 5JQ4A 2PVVA 4AC9A 3D66A 4RD3A 1VQLB 1XOVA 1WSRA 6CPAA 4YFJA 1IY7A 4P4DA 2QEXB 5JPHA 4XL9A 1Z5RA 3P2HA 1DDIA 5HZAA 1DE4C 4KORA 2EFGA 4F0YA 3PA2A 5F4JA 3B3WA 2P6GA 5HKKA 1OGIA 2D9RA 2ZPAA 1WOSA 4ZBGA 3H8GA 4MMOA 1G7TA 2XNJA 4Q7JB 1OGJA 4Z4UA 4PC3A 1CJWA 3VH9A 3WXMA 1XEBA 1M4GA 2QTZA 2AFMA 4B3GA 2I1LA 4RD4A 3NH5A 1QG0A 1YR0A 2WR8A 2VZYA 3F8KA 1N07A 2GE3A 2Z0ZA 2FCKA 1E1RA 3GB0A 1JQGA 1MK4A 2C77A 1YVKA 1XMTA 4PSWA 4F0XA 2B4DB 1PJ6A 2XEGA 3WC7A 1PKVA 3S9LA 3G8WA 3FKSA 4J3GA 3R9FA 1X10A 4RPDA 1FNBA 2F4NA 4A39A 3Q38A 4LQ6A 2ZXIA 3WR7A 3VO2A 3FMCA 1KUXA 4CS0B 3OZVA 2CK3A 5IK2A 2QGGA 2VNKA 2CXAA 4XNFA 1XRYA 2DERA 3V38A 1VQKB 2ZELA 3OW7A 3TC8A 1DG1G 2B7BA 4HE6A 2Z3NA 4QB9A 3E1YE 1XQBA 3GQBA 3KI9A 2BSWA 2Q43A 4PV6A 5BWAB 5FVJA 2VJJA 4PXDA 1KMHA 2XEFA 1EXMA 1PU9A 3S9MA 3AGPA 1HDUA 2Q4ZA 3SLNA 1Z8WA 2QJ8A 4X06A 4CGPA 1IGBA 4DNCA 3CXSA 2E1RA 3CCMB 5HH1A 3HLPA 4TT3A 5I0CA 1PCAA 2D3NA 3B8HA 4B47A 3A8KA 3V7ZA 2RB7A 2OU2A 1QSRA 2FL4A 2Q4YA 2EWBA 2PIAA 1D8TA 4RCZA 5C88A 3D67A 4L89A 1WDTA 4AG9A 2PLFA 4WWVA 1BOBA 4TMZA 4NF1A 1KJZA 4QC6A 4P4EA 4B44A 4EWTA 4MY0A 1GVHA 2PJ3A 2JJ1A 1P4MA 3J81k 4ZYQA 2ZW4A 1K4JA 1WP6A 4N3GA 3VR6A 3SEJA 3SJGA 4QV2A 3FECA 5EC4A 3W2GA 3CPXA 2R98A 4ZY0A 1K28D 1FX0A 2NYQA 3B8GA 4JZ0A 3Q39A 2YWFA 4OC1A 5F4MA 2WSAA 4AXVA 5EMNA 3AVVA 3WC5A 3WYAA 3ZUGA 2X0KA 1Y9WA 3IO1A 2EK8A 4P45A 5D29A 1VJSA 4B4DA 4P25A 1FDRA 3CCSB 4KVOE 1YLOA 3T51B 2DPSA 3C26A 4H6UA 4P4FA 4CGLA 2V7TA 4KOYA 4CYNA 1QFJA 3WNBA 1B87A 3KASA 1EE3P 1H8LA 3TOBA 2BM0A 2C1CA 3PRTA 1K8AD 1VQPB 5IB0A 1U6MA 2PRQA 1W35A 4YHBA 4ZGNB 4XLCA 4YEJA 1KK0A 1WOOA 1A8PA 5CDFA 3QFSA 4RDKA 2BO9A 5CNPA 4XLAA 1H8HA 4JYWA 2OZGA 3JTKA 2GQFA 3A9LA 3LODA 5DS0A 3IWGA 4NGQA 1E62A 2ZZGA 1VF7A 2VNJA 4PGOA 5BSYA 3IEHA 2QMLA 2X7BA 1U2RA 4MYUA 2G3AA 3OOCA 2DXQA 4OADA 3D7HA 4UEFA 2PJ1A 1KK2A 3CD6B 1UFHA 1YJ9B 1ZM2A 2PJ2A 3WBJA 2XOKA 2V7UA 4X7EA 3A8IA 3CMAB 1RO5A 1YREA 4JXQA 4EVYA 2Z3PA 4XN3A 5FNZA 4IK2A 3QSYA 3P27A 5THWA 2PJCA 2DY1A 2EK9A 1QUFA 3TX8A 4HE5A 4KKUA 1S7KA 1GAWA 4KSIA 4PK2A 1YIJB 3GIUA 1M1DA 3BHXA 2WYRA 2CNTA 1YSJA 2Q0YA 4OC2A 4TNUA 3SI0A 3S9NA 2CW5A 1HDQA 2I79A 3CXCB 1E79A 3AVTA 1E3XA 2FVGA 5ELYA 3MGDA 2Q6LA 1SKYB 1Y9KA 1TIQA 2PQ8A 2R7HA 1KRHA 4PXBA 2C27A 1QQ9A 4F6AA 3KL9A 2GJKA 1IJFA 2WPXA 1N08A 3ZJ0A 4Z4TA 1QGYA 2IMOA 3TO9A 3FNCA 2VNHA 5AG6A 2HB6A 2ZXHA 4K1XA 2B5OA 3F0AA 4FD4A 4KVME 1UD3A 3PZJA 2D3LA 3QNVA 1JNYA 3GVLA 3VWEA 1LAMA 2AE6A 1DTDA 3N5FA 3T9YA 4XONA 2R9VA 1WK4A 2NV4A 5G22A 3SI1A 3BNWA 2EVNA 4YAOA 3AVUA 1YK3A 2YNDA 1M4DA 4NSQA 4R8FA 1CQXA 1Q9SA 4C2XA 3ASTA 1IYLA 1LFWA 4CQJA 3K9TA 3T8WA 5DSZA 4NNJA 2AFOA 4OAEA 2R8VA 3KZWA 2DEAA 4LBZA 1OHHA 3H5ZA 3L2NA 2KVOA 2V31A 2QYVA 2QVPA 3D4UA 4DJLA 1NMTA 1D1NA 4C7HA 2CC2A 4FXUA 1IIDA 3ISZA 2HC9A 1LOKA 1N8RD 4R76A 4AVAA 4ONUA 1QSOA 1YQEA 4PC1A 3FVLA 2HV2A 3W6XA 3VATA 3CCQB 4G1VA 2PJ4A 3CB4A 4A2ZA 4RD6A 1BQEA 4NCNA 3NA6A 5LYFA 4IAVA 3JQPA 3FF3A 3QB8A 2X3UA 4R3LA 3GUXA 3EXNA 4LC0A 4DQKA 1SKQA 3BY2A 4KLVA 4A38A 3U6KA 5J3OA 4ZY1A 1VHEA 1S60A 4ZX9A 1ZM9A 3FPPA 1ZG8A 1YI2B 4NGMA 4HKFA 2PJ7A 5HZBA 2AFSA 2VL1A 4NGTA 2QIRA 3LACA 2BF4A 3GY9A 1IYKA 2C5HA 1LAPA 3W5UA 3CCJB 2CNSA 4RDLA 2IL4A 5HMNA 3VNVA 2EBJA 1JB9A 4O23A 4ONWA 4XR6A 4GM5A 3G3SA 2V4DA 1R43A 2J7KA 2V8HA 4CAVA 3IGRA 5AGEA 2E1BA 1EP1B 3JRUA 3KKWA 1UD5A 3CW2A 3P26A 2RC5A 2O4HA 5KTAA 2OTLB 3HUVA 1S7NA 4II2A 2JN9A 1ELLP 1F20A 2CIJA 1J9ZA 3GYAA 4ZY2A 2XNDA 2AFXA 3R6KA 4C2ZA 4R6TA 2J8NA 3OZWA 2WJVA 4YAFA 3PFOA 5AG4A 2GFQA 1KTVA 1V0FA 3BCDA 2AFUA 4EMEA 4N3NA 3I55B 4Z1MA 4UZEA 4MFPA 2GLJA 4UEZA 5G1ZA 4U9UA 2Q4VA 1EP2B 3FB3A 1XF8A 5J8CA 1Q2CA 3SKBA 4R7MA 5EMIA 2X85A 3PB4X 1JA0A 2BV3A 3B3TA 3R9EA 4RD1A 1TKHA 3PENA 4P2NA 4RDJA 1ZM4A 2OTJB 4HNXB 5F47A 1T5EA 4CRZB 3PB6X 3QFRA 1BO4A 4Z4RA 4YU9A 5F09A 4PC6A 1Z8LA 3W2HA 2ZEPA 4P22A 3DSBA 4IW3B 4OLLA 5AG7A 4TKOB 2PVWA 5IX3A 5HXBA 4FN5A 3G6EB 3MN8A 4RM0A 4UAJA 2P0WA 4P10A 2ZZFA 4UFWA 5GCNA 1NBMA 3FPKA 1EWYA 4NXYA 1Z2LA 1OZPA 5CBMA 4P3YA 5K8MA 4LQGA 2WJYA 4KSAA 4MCPA 2QN6A 1HVXA 1IB0A 4XPDB 3IU2A 2XZPA 5J1QA 2BM1A 4G7XA 4Y7CA 4A33A 2GPJA 2OZHA 4DQLA 4X0CA 4MCRA 4DUKA 2B5GB 1PJ5A 4DYOA 1ZO0A 3NH4A 5J35A 4II9A 1VLOA 4OPOA 4I49A 5IYWA 2OYNA 4KS9A 3WNCA 2V7WA 1IOFA 1M1KD 2FT0A 4P9SA 2DF5A 4X8IA 3BXMA 2WPDA 4G5GA 1XE4A 4L8JA 4EH1A 2HLDA 2OK7A 4NBSA 2WPWA 3VARA 4ZCMA 5FO0A 4MHNA 2EO8A 1JA1A 3V8IA 4AB7A 1CP7A 1ZLHA 4UZUA 5DWNA 2V7QA 2CRVA 2FSRA 1H85A 4A32A 2OK8A 2WUUA 1EFUA 1KD1D 2VJIA 5TV2A 1YX0A 2IQ6A 5HXDA 4NJRA 4CYQA 1YVOA 1VQ8B 1UWYA 4RJLA 4RD2A 3B2YA 4II3A 3BLNA 1IJEA 4XQFA 2B5GA 2VI7A 3MCAA 4HNWB 4MYTA 4MFKA 1KUVA 3EY5A 4FWTA 4QBJA 2FXFA 4R87A 2ZEDA 1W9XA 2ZEMA 4P44A 1H8EA 3OJXA 1HZEA 2VBUA 1G7CA 4C68A 4UBRA 4ZI6A 3PEIA 2DYIA 3SXNA 4K30A 2X6WA 1T6ZA 1IICA 3FH4A 1E64A 3ONUA 3R6JA 4P6VF 2B4DA 1BPLA 1AIPA 2AFWA 3OEHA 4OOSA 3A1PA 4MRIA 2H5MA 3S6HA 4WQMA 4OP7A 3V7AA 3CESA 5LRGA 1QSNA 4UEEA 4AF6A 3SLDA 1TTTA 2PE3A 2KCWA 4B3FX 2XZOA 4XOPA 5J8FA 3OW2B 4AF7A 3TO7A 4ACAA 1MJ9A 1I8DA 3F5BA 3CP2A 1YHQB 1Y7EA 2A4NA 2W6JA 5G20A 5AN9A 4M85A 4B5PB 1LCPA 3BJ8A 2X53S 1HEEA 3NE7A 4B13A 4WZEA 1UD6A 4FD7A 1S7LA 3PBEA 3AVYA 2DPTA 4F9UA 4MFQA 1M90D 4TMXA 2LZJA 5F4OA 3B82A 3D7FA 2ZBUA 1FRNA 4MFLA 1QGAA 1QH0A 3QAHA 3WBKA 3QFTA 2GK7A 2PMDA 1ZG7A 3CCUB 3I9SA 1YJWB 1TF9A 1Y7RA 4LBVA 1GO2A 3SJFA 4OC5A 3PB9X 1WPCA 1Z4RA 4UWJA 2P3MA 1TLLA 2ZZQA 3H4QA 4ZGYB 4UZFA 1ARLA 2QECA 2BSAA 2C78A 3D3SA 4YRHA 4Y49B 1RQPA 3V76A 2C2WA 1RXTA 3ZBTA 2BOAA 2ZBVA 4W9YA 3T90A 4BINA 2NMTA 3ZIAA 4X07A 3IC1A 3R1KA 1NJID 1QUEA 1OB5A 1ZG9A 2Z3KA 2PRBA 1R5BA 4CGNA 1LANA 4NGNA 4K3NA 1FY7A 4MFZA 3OP1A 4X5KA 5A27A 2PJ0A 2O28A 4NEXA 4OC4A 2PJ8A 1A2ZA 4RPBA 1ON0A 1VQNB 1BX0A 2PC1A 2FIAA 2OBTA 1VHOA 1MJBA 2BGJA 2VBSA 4XPDC 5ISVA 2Z3MA 5FIUA 3ZPNA 3H8FA 4ZX8A 5FA6A 2PJ6A 3R9GA 3P2FA 1QVFB 3W6SA 1WU8A 4Z4SA 2ZOFA 2CF4A 2I00A 1E3ZA 4DK0A 3CP8A 4XLHA 1WOPA 2X6XA 1OBRA 3PUMA 1R5OA 4B12A 4GXHA 5IYPA 3OAAA 2GK6A 3CRZA 3RAMA 4KOVA 8CPAA 3D2MA 1IU8A 1WORA 1Q7YD 1BAVA 2GANA 4RS2A 3AGQA 5DWMA 5E96A 2RC4A 2C4TA 2ATRA 5H84A 2VEZA 2ZXVA 3QE2A 1NSLA 1T6XA 3FJUA 1UD4A 4CYOA 1NB0A 2F43A 3CMMA 2Z3OA 2J8RA 1Q7LA 1CPXA 2BN4A 1MJAA 4Z4VA 1Y0YA 3BJ7A 2PR1A 2XEIA 3RNZA 1ZM3A 5F49A 5L46A 3FIXA 3NH8A 4KKTA 4PABA 2AHOA 4MBUA 3KQXA 1ARMA 1M44A 1S5KA 3JQQA 1B23P 2VQYA 2Z3LA 3OPOA 2CBXA 4MXUA 1W0JA 1VLYA 2RC6A 4R57A 3OWCA 4M6HA 4ORFA 1TUIA 3CXQA 3RY8A 2FIWA 1GJRA 3WT4A 3SJXA 1XIXA 3FEEA 5LMZA 4CRYB 1R5NA 1QSTA 4PSXA 3VMFA 4QFMA 4XN0A 5K8OA 4XOTA 4OPVA 3DDYA 4Z4WA 4NGRA 4MI4A 1TXRA 3U2QA 5HVFA 1YX2A 2JEVA 4YWYA 1XB2A 2HUZA 4YGOA 3WABA 5G21A 1BX1A 2F1LA 2X6YA 2REFA 3QFCA 4C0SA 3SJZA 2VZLA 1EFCA 5TR9A 4MJ8A 3I1FA 2Q6IA 2ZL5A 1BLIA 1WWZA 4PXCA 3B3VA 3Q6QA 2OBSA 2AFZA 5KTDA 2ZEFA 2JLMA 3D7GA 3ZZUA 4MFJA 1GAQA 2ZL6A 4P26A 5A88A 4UIAA 4X05A 2GREA 5K8NA 4H89A 3WQZA 3NE8A 3OEEA 1AMOA 2EIXA 5LYDA 1IOIA 2C4UA 4QVJA 2CNMA 2BEIA 2X8KA 5GV8A 4A30A 1G7SA 3Q3AA 4TSFA 4PC2A 4LX9A 4YXWA 2G0BA 3S6FA 5IYQA 4JJXA 1FRQA 1ZUNB 4A94A 4XM3A 5FL7A 3LQ6A 2O53A 4CAFA 4WZLA 3ASPA 2YWEA 3D7DA 4Y49C 1TKFA 1Q86D
chains in the Genus database with same CATH topology
4P4EA 4EWTA 5JM6A 2PJ3A 4MCRA 4DUKA 3BI0A 1CBXA 4ZYQA 4DYOA 3NH4A 1NSAA 1AMPA 3SJGA 2PJ9A 3FECA 3I1UA 3CPXA 4ZY0A 4X8IA 2NYQA 4G1PA 1KWMA 3BXMA 4JZ0A 4X3RA 2WZNA 5LYIA 4MHYA 4OC1A 4AXVA 2OOTA 4OIWA 3WC5A 1AYEA 3IO1A 3VARA 2EK8A 4P45A 5D29A 3D68A 4MHNA 4IHMA 2V77A 1CP7A 1ZLHA 1YLOA 4OC3A 4P4FA 2V8VA 3IJ3A 3KASA 1EE3P 1H8LA 2C1CA 2IQ6A 2JEWA 1CP6A 5HXDA 3PRTA 4NJRA 1UWYA 3KR4A 2CTCA 4Q7AA 2PRQA 3B2YA 4MCQA 2F8HA 5CPAA 2ZENA 1TKJA 5JGFA 2ZEDA 2BO9A 2ZEMA 4OC0A 4TWEA 4P44A 4F8ZA 1XBUA 3NFZA 4JYWA 4ZI6A 2V8DA 3PEIA 3K2KA 4MHPA 5DS0A 1XMBA 3FH4A 4NGQA 7CPAA 3KQZA 4RUHA 4B6ZA 3RBUA 2C6GA 2I3CA 2POKA 4NFRA 1BLLE 1ZLIA 3DGVA 2PIZA 5JH9A 3IEHA 1QMUA 4F9VA 2AFWA 4MRIA 2NSMA 4A37A 5LRGA 4UEEA 4UEFA 3D7HA 2PJ1A 3PFEA 2PE3A 1BPMA 1CG2A 3KHXA 1RTQA 2PJ2A 3LWUA 2ZEGA 3GLJA 1PYTB 1Y7EA 4IK2A 3ISXA 5THWA 2PJCA 2EK9A 3CPAA 1LCPA 3TX8A 1HEEA 4FBEA 1FNOA 3PBEA 3RZAA 4KSIA 4F9UA 5LRJA 5LYLA 4NJQA 2ZEHA 3D7FA 3BHXA 2WYRA 3PB7X 1YSJA 4OC2A 4NGPA 4TNUA 3SJEA 3SI0A 3PB8X 4PXEA 4P4JA 3FX6A 3S9NA 2ZOGA 2Q51A 1HDQA 1ZG7A 1Y0RA 5D8NA 1TF9A 1VGYA 4MCSA 2F7VA 2FVGA 4Z65A 5ELYA 3SJFA 4OC5A 3PB9X 3H8EA 1TF8A 3B7IA 3SI2A 4PXBA 1QQ9A 3KL9A 4PQAA 3CDXA 1ARLA 5LRKA 2IMOA 4OP4A 4FUUA 4UF4A 2HB6A 4P4BA 2PIYA 2BOAA 4W9YA 3QNVA 1LAMA 2ZEOA 1DTDA 3N5FA 3KGQA 1YW4A 3IC1A 2PJ5A 3SI1A 1ZG9A 2J9AA 4NGSA 1LANA 2OR4A 2C6CA 4NGNA 4OMEA 1CX8A 4R8FA 1YMEA 4K3NA 1LFWA 3K9TA 4OIDA 3T8WA 2PJ0A 4H2KA 2AFOA 3KZWA 4PPZA 4OC4A 4FWUA 2PJ8A 2RFHA 2DEAA 3L2NA 1VHOA 2QYVA 1FT7A 2QVPA 3D4UA 3FEDA 4DJLA 3H8FA 4ZX8A 2PJ6A 3ISZA 2HC9A 1LOKA 1BPNA 4R76A 2ZOFA 2CF4A 2ANPA 4P6YA 3FVLA 3VATA 2PCUA 2PVVA 3D66A 1OBRA 2PJ4A 3CT9A 4X2TA 3IFEA 6CPAA 1IY7A 3NA6A 4P4DA 5LYFA 1CPSA 1F2PA 4IAVA 1Z5RA 3FF3A 3RAMA 8CPAA 1DE4C 2JBKA 3GUXA 1F57A 3B3WA 5IB9A 1BAVA 3IIBA 1M4LA 2GU2A 4A38A 3PBBA 4ZY1A 1VHEA 3H8GA 4MMOA 2ZEEA 3VH9A 4ZX9A 3FJUA 1ZG8A 4NGMA 3KR5A 3B3SA 2PJ7A 2GLFA 2AFMA 5K8PA 1Q7LA 1CPXA 2AFSA 2VL1A 1Y0YA 4NGTA 2XEIA 4MHZA 2V8GA 1LAPA 2C6PA 3NH5A 3NH8A 4OKOA 3KQXA 1ARMA 1YW6A 3GB0A 1JQGA 4O23A 4ONWA 4GM5A 4P4IA 4MXUA 1R43A 2IJZA 4WJBA 3BI1A 2V8HA 3JRUA 2XEGA 3WC7A 3WT4A 2O4HA 4FAIA 2ABZA 4CPAA 3DLJA 1F2OA 3SJXA 3S9LA 3HUVA 3FEEA 4A39A 3MRUA 1ELLP 2CIJA 3KHZA 4ZY2A 2AFXA 2JBJA 3FMCA 5K8OA 2CTBA 4R6TA 3PFOA 3V38A 1XRYA 4NGRA 3WC6A 2ZELA 2AFUA 1TXRA 4EMEA 5HVFA 4YWYA 3TC8A 2GLJA 4UEZA 3B35A 3KI9A 2Q43A 3WABA 1XJOA 1GYTA 4EFDA 4PXDA 4R7MA 2XEFA 3B3CA 3S9MA 3PB4X 3B3TA 1HDUA 2Q4ZA 4PXCA 3B3VA 2QJ8A 1TKHA 5HVGA 2AFZA 1IGBA 1R3NA 2ZEFA 2PJBA 4BD9A 3D7GA 3PB6X 3HLPA 4YU9A 5F09A 4UIAA 1Z8LA 5HVHA 2GREA 2ZEPA 5K8NA 1PCAA 2PVWA 5LYDA 2BCOA 2XEJA 3MN8A 1ELMP 2G9DA 1XFOA 4P10A 3V7ZA 2RB7A 3IWWA 2EWBA 1Z2LA 5CBMA 5I4MA 5K8MA 4A94A 4LQGA 4MCPA 3D67A 2O53A 1VIXA 3LMSA 2PJAA 5J1QA 4WWVA 3D7DA 4UIBA 1TKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4E A;  4EWT A;  5JM6 A;  2PJ3 A;  4MCR A;  4DUK A;  3BI0 A;  1CBX A;  4ZYQ A;  4DYO A;  3NH4 A;  1NSA A;  1AMP A;  3SJG A;  2PJ9 A;  3FEC A;  3I1U A;  3CPX A;  4ZY0 A;  4X8I A;  2NYQ A;  4G1P A;  1KWM A;  3BXM A;  4JZ0 A;  4X3R A;  2WZN A;  5LYI A;  4MHY A;  4OC1 A;  4AXV A;  2OOT A;  4OIW A;  3WC5 A;  1AYE A;  3IO1 A;  3VAR A;  2EK8 A;  4P45 A;  5D29 A;  3D68 A;  4MHN A;  4IHM A;  2V77 A;  1CP7 A;  1ZLH A;  1YLO A;  4OC3 A;  4P4F A;  2V8V A;  3IJ3 A;  3KAS A;  1EE3 P;  1H8L A;  2C1C A;  2IQ6 A;  2JEW A;  1CP6 A;  5HXD A;  3PRT A;  4NJR A;  1UWY A;  3KR4 A;  2CTC A;  4Q7A A;  2PRQ A;  3B2Y A;  4MCQ A;  2F8H A;  5CPA A;  2ZEN A;  1TKJ A;  5JGF A;  2ZED A;  2BO9 A;  2ZEM A;  4OC0 A;  4TWE A;  4P44 A;  4F8Z A;  1XBU A;  3NFZ A;  4JYW A;  4ZI6 A;  2V8D A;  3PEI A;  3K2K A;  4MHP A;  5DS0 A;  1XMB A;  3FH4 A;  4NGQ A;  7CPA A;  3KQZ A;  4RUH A;  4B6Z A;  3RBU A;  2C6G A;  2I3C A;  2POK A;  4NFR A;  1BLL E;  1ZLI A;  3DGV A;  2PIZ A;  5JH9 A;  3IEH A;  1QMU A;  4F9V A;  2AFW A;  4MRI A;  2NSM A;  4A37 A;  5LRG A;  4UEE A;  4UEF A;  3D7H A;  2PJ1 A;  3PFE A;  2PE3 A;  1BPM A;  1CG2 A;  3KHX A;  1RTQ A;  2PJ2 A;  3LWU A;  2ZEG A;  3GLJ A;  1PYT B;  1Y7E A;  4IK2 A;  3ISX A;  5THW A;  2PJC A;  2EK9 A;  3CPA A;  1LCP A;  3TX8 A;  1HEE A;  4FBE A;  1FNO A;  3PBE A;  3RZA A;  4KSI A;  4F9U A;  5LRJ A;  5LYL A;  4NJQ A;  2ZEH A;  3D7F A;  3BHX A;  2WYR A;  3PB7 X;  1YSJ A;  4OC2 A;  4NGP A;  4TNU A;  3SJE A;  3SI0 A;  3PB8 X;  4PXE A;  4P4J A;  3FX6 A;  3S9N A;  2ZOG A;  2Q51 A;  1HDQ A;  1ZG7 A;  1Y0R A;  5D8N A;  1TF9 A;  1VGY A;  4MCS A;  2F7V A;  2FVG A;  4Z65 A;  5ELY A;  3SJF A;  4OC5 A;  3PB9 X;  3H8E A;  1TF8 A;  3B7I A;  3SI2 A;  4PXB A;  1QQ9 A;  3KL9 A;  4PQA A;  3CDX A;  1ARL A;  5LRK A;  2IMO A;  4OP4 A;  4FUU A;  4UF4 A;  2HB6 A;  4P4B A;  2PIY A;  2BOA A;  4W9Y A;  3QNV A;  1LAM A;  2ZEO A;  1DTD A;  3N5F A;  3KGQ A;  1YW4 A;  3IC1 A;  2PJ5 A;  3SI1 A;  1ZG9 A;  2J9A A;  4NGS A;  1LAN A;  2OR4 A;  2C6C A;  4NGN A;  4OME A;  1CX8 A;  4R8F A;  1YME A;  4K3N A;  1LFW A;  3K9T A;  4OID A;  3T8W A;  2PJ0 A;  4H2K A;  2AFO A;  3KZW A;  4PPZ A;  4OC4 A;  4FWU A;  2PJ8 A;  2RFH A;  2DEA A;  3L2N A;  1VHO A;  2QYV A;  1FT7 A;  2QVP A;  3D4U A;  3FED A;  4DJL A;  3H8F A;  4ZX8 A;  2PJ6 A;  3ISZ A;  2HC9 A;  1LOK A;  1BPN A;  4R76 A;  2ZOF A;  2CF4 A;  2ANP A;  4P6Y A;  3FVL A;  3VAT A;  2PCU A;  2PVV A;  3D66 A;  1OBR A;  2PJ4 A;  3CT9 A;  4X2T A;  3IFE A;  6CPA A;  1IY7 A;  3NA6 A;  4P4D A;  5LYF A;  1CPS A;  1F2P A;  4IAV A;  1Z5R A;  3FF3 A;  3RAM A;  8CPA A;  1DE4 C;  2JBK A;  3GUX A;  1F57 A;  3B3W A;  5IB9 A;  1BAV A;  3IIB A;  1M4L A;  2GU2 A;  4A38 A;  3PBB A;  4ZY1 A;  1VHE A;  3H8G A;  4MMO A;  2ZEE A;  3VH9 A;  4ZX9 A;  3FJU A;  1ZG8 A;  4NGM A;  3KR5 A;  3B3S A;  2PJ7 A;  2GLF A;  2AFM A;  5K8P A;  1Q7L A;  1CPX A;  2AFS A;  2VL1 A;  1Y0Y A;  4NGT A;  2XEI A;  4MHZ A;  2V8G A;  1LAP A;  2C6P A;  3NH5 A;  3NH8 A;  4OKO A;  3KQX A;  1ARM A;  1YW6 A;  3GB0 A;  1JQG A;  4O23 A;  4ONW A;  4GM5 A;  4P4I A;  4MXU A;  1R43 A;  2IJZ A;  4WJB A;  3BI1 A;  2V8H A;  3JRU A;  2XEG A;  3WC7 A;  3WT4 A;  2O4H A;  4FAI A;  2ABZ A;  4CPA A;  3DLJ A;  1F2O A;  3SJX A;  3S9L A;  3HUV A;  3FEE A;  4A39 A;  3MRU A;  1ELL P;  2CIJ A;  3KHZ A;  4ZY2 A;  2AFX A;  2JBJ A;  3FMC A;  5K8O A;  2CTB A;  4R6T A;  3PFO A;  3V38 A;  1XRY A;  4NGR A;  3WC6 A;  2ZEL A;  2AFU A;  1TXR A;  4EME A;  5HVF A;  4YWY A;  3TC8 A;  2GLJ A;  4UEZ A;  3B35 A;  3KI9 A;  2Q43 A;  3WAB A;  1XJO A;  1GYT A;  4EFD A;  4PXD A;  4R7M A;  2XEF A;  3B3C A;  3S9M A;  3PB4 X;  3B3T A;  1HDU A;  2Q4Z A;  4PXC A;  3B3V A;  2QJ8 A;  1TKH A;  5HVG A;  2AFZ A;  1IGB A;  1R3N A;  2ZEF A;  2PJB A;  4BD9 A;  3D7G A;  3PB6 X;  3HLP A;  4YU9 A;  5F09 A;  4UIA A;  1Z8L A;  5HVH A;  2GRE A;  2ZEP A;  5K8N A;  1PCA A;  2PVW A;  5LYD A;  2BCO A;  2XEJ A;  3MN8 A;  1ELM P;  2G9D A;  1XFO A;  4P10 A;  3V7Z A;  2RB7 A;  3IWW A;  2EWB A;  1Z2L A;  5CBM A;  5I4M A;  5K8M A;  4A94 A;  4LQG A;  4MCP A;  3D67 A;  2O53 A;  1VIX A;  3LMS A;  2PJA A;  5J1Q A;  4WWV A;  3D7D A;  4UIB A;  1TKF A; 
#chains in the Genus database with same CATH topology
 1KZF A;  3TO6 A;  4DK1 A;  3BI0 A;  4X7C A;  4G7W A;  3CC4 B;  1NSA A;  2QMU A;  4MY3 A;  3QAY A;  4YAW A;  4Y9U A;  3JVN A;  4B48 A;  4JD6 A;  4UWI A;  3MHP A;  1Z8X A;  4HNY B;  4Z4Y A;  4KUB A;  4X7D A;  3D26 A;  1XE1 A;  2AJ6 A;  4G1P A;  4OOV A;  4NCZ A;  4X3R A;  2WZN A;  4MHY A;  3S6K A;  3ASQ A;  3CCR B;  3CCV B;  2BPO A;  4OIW A;  4XNH B;  2B7C A;  3CZX A;  1OB2 A;  2V7V A;  3ZC3 A;  2VBV A;  1YJN B;  3LO8 A;  4P3I A;  1IB1 E;  3TT2 A;  3IJ3 A;  2R1I A;  1N06 A;  4RCY A;  1K9M D;  2JEW A;  4AVC A;  2CTC A;  2YNE A;  3FXT A;  4FK8 A;  4Q7A A;  2QE7 A;  4AG7 A;  4OOX A;  4F7D A;  4X7F A;  1VHS A;  4RI1 A;  4XD7 A;  2ZTN A;  3CC7 B;  4BBH A;  2FE7 A;  2F5I A;  4J0Q A;  5JGF A;  1QX4 A;  3VNU A;  4JMQ A;  4L8A A;  3BCF A;  4ROX A;  2VXK A;  4OC0 A;  3TCV A;  5H59 A;  1L0C A;  1XBU A;  5IYN A;  3N7Z A;  2V8D A;  3MMP A;  4KZT A;  3CPW B;  1N0U A;  4RN7 A;  5B6I A;  4MHP A;  4XLE A;  2ZTG A;  1S4M A;  1GR1 A;  2C6G A;  4B11 A;  1VQO B;  5GV7 A;  2I3C A;  1W87 A;  3DGV A;  2JJ2 A;  2PIZ A;  5JH9 A;  4Z4Z A;  2REE A;  2HMA A;  3AVW A;  1G7R A;  2NSM A;  4A37 A;  2DOG A;  3SJP A;  5KSW B;  3H94 A;  4U9Y A;  4G1B A;  3PFE A;  1Z4E A;  2FX3 A;  1BPM A;  2PR8 A;  2G3T A;  5KW9 A;  3KHX A;  3LWU A;  2Q44 A;  3CCE B;  4GS4 A;  4HPS A;  2Z10 A;  4AVB A;  1QSM A;  3GLJ A;  1PYT B;  4B5O A;  2OZU A;  5A28 A;  1FNM A;  4HIZ A;  3CPA A;  3IU1 A;  3BC9 A;  4E8O A;  1Q81 D;  2GJP A;  4FBE A;  1I12 A;  4A31 A;  1FNO A;  1CNF A;  3RZA A;  4U5Y A;  2GJR A;  5LRJ A;  5LYL A;  4FD6 A;  4B14 A;  4NJQ A;  4R3K A;  2QTL A;  3VO1 A;  2ZEH A;  4UCP A;  4TMT A;  4NGP A;  4KVX A;  3SJE A;  3PB8 X;  4PXE A;  3A3G A;  4P4J A;  2Q51 A;  1K73 D;  4MCS A;  2GIV A;  3T56 B;  1TF8 A;  4M0L A;  3GSI A;  1EFR A;  4WZT A;  3WND A;  3I56 B;  3ASS A;  4PQA A;  3NE5 B;  3D8P A;  5LRK A;  4FUU A;  5BSX A;  3GIR A;  4DNT B;  3Q6R A;  2PIY A;  2JDC A;  2ZW7 A;  3CC2 B;  3G71 B;  3U6B A;  1B2R A;  3CCL B;  2DIE A;  1P0H A;  4BMH A;  3T53 B;  4LBW A;  2J8M A;  1YW4 A;  3R96 A;  3SXO A;  4QVT A;  4NGS A;  2JDI A;  5A8A A;  1KK1 A;  2C6C A;  4OME A;  3FRM A;  1BJK A;  3OE7 A;  4R9M A;  4M6G A;  4OID A;  2FS5 A;  1W34 A;  3OKX A;  3PGP A;  4RD0 A;  4PPZ A;  2Q7B A;  4M53 A;  1V0E A;  1YIT B;  1I1D A;  2RFH A;  1VQ5 B;  1JWQ A;  2ZZE A;  1FNC A;  3IWE A;  3FED A;  2QDX A;  2WSS A;  4UCM A;  4CAX A;  2YGW A;  4XPK A;  4QHY A;  1QFY A;  4ZCI A;  1BPN A;  4YEL A;  3I3G A;  3S6G A;  2OB0 A;  1DAR A;  3E0K A;  2PCU A;  2YWG A;  3JQR A;  4QUZ A;  3CT9 A;  1OB0 A;  2B4B A;  3IFE A;  3JUW A;  4X2T A;  3VWD A;  1S0U A;  1X12 A;  4KOT A;  4UFX A;  1CPS A;  1F2P A;  5TY0 A;  3CTA A;  2JBK A;  4M1K A;  4XNH C;  1H42 A;  4XPL A;  4KOS A;  1F57 A;  5IB9 A;  1PJ7 A;  3IIB A;  1M4L A;  4ACB A;  1S7F A;  4M6I A;  2P6E A;  2GU2 A;  4A95 A;  3A8J A;  3PBB A;  4ZCL A;  2OBR A;  3ASR A;  2CND A;  1DDG A;  2ZEE A;  1D2E A;  2YNC C;  3KR5 A;  3B3S A;  5K8P A;  2GLF A;  4PAA A;  2Q6O A;  4MHZ A;  2V8G A;  2HDN B;  2C6P A;  3D2P A;  4CGM A;  4OKO A;  1JJ2 B;  2BVN A;  1E43 A;  1YW6 A;  2C5B A;  4TMV A;  4P4I A;  1N0V C;  4QVA A;  1QFZ A;  4KLW A;  2IJZ A;  5E6T A;  4CAE A;  4WJB A;  3BI1 A;  4B5P A;  3PUN A;  2XGJ A;  3JU4 A;  3FBU A;  4IF5 A;  4AVZ A;  4XMY A;  1KUY A;  2D74 A;  4FAI A;  2ABZ A;  4CPA A;  3DLJ A;  3HAG A;  1F2O A;  2Q6K A;  1EFT A;  1W0K A;  2K5T A;  4CGO A;  4TN1 A;  2W6I A;  2BUE A;  5F48 A;  4PK3 A;  3ZBU A;  2R6H A;  3MRU A;  3DR8 A;  3KHZ A;  2JBJ A;  3W5V A;  2CTB A;  3ES9 A;  1V5V A;  3BY1 A;  3WC6 A;  1T6Y A;  5JBQ A;  3EC4 A;  1CNE A;  3LNN A;  2OH1 A;  3B35 A;  4Q38 A;  1V0C A;  1XJO A;  1VQ6 B;  5THX A;  1GYT A;  4EFD A;  3FJO A;  1I7P A;  3B3C A;  4B43 A;  2PDO A;  2WZP P;  4XKV A;  4KOW A;  4PC7 A;  4DNR B;  3OFN A;  1YLE A;  4JXR A;  1R3N A;  5HVG A;  2PJB A;  2P6F A;  4BD9 A;  2M5S A;  4QUS A;  1NRK A;  4MHD A;  5F46 A;  5HVH A;  4Q36 A;  4BPR A;  4B10 A;  2BCO A;  4KOX A;  1MRZ A;  2ODF A;  2XEJ A;  3LD2 A;  1ELM P;  2G9D A;  1XFO A;  3GVK A;  1KC8 D;  4R71 A;  2B3V A;  1E1Q A;  3ZZ0 A;  2BMW A;  3IWW A;  1UMK A;  2Z11 A;  4ZGQ B;  5I4M A;  2B58 A;  4YAU A;  2DET A;  1Q82 D;  2ZIT A;  3OZU A;  1VIX A;  3LMS A;  2PJA A;  2VBQ A;  4UIB A;  1VQ7 B;  1HA3 A;  5JM6 A;  2CY2 A;  4FD5 A;  4GQN A;  5TRD A;  1CBX A;  3AVX A;  2VNI A;  1WSV A;  3KEW A;  3W2E A;  3TE4 A;  1AMP A;  2ZW6 A;  2PJ9 A;  5IYR A;  5EBV A;  4XKW A;  1QGZ A;  3I1U A;  4IUS A;  4KSF A;  5H86 A;  1KWM A;  1J4J A;  3B78 A;  3G4S B;  1RQR A;  5LYI A;  1VQM B;  2QA4 B;  1NE9 A;  1NDH A;  2ZW5 A;  2OOT A;  1AYE A;  1E63 A;  4TMW A;  5FO1 A;  4XLF A;  2HCJ B;  2D4O A;  3FYN A;  4UFV A;  3D68 A;  4IHM A;  3CXP A;  2V77 A;  3RO0 A;  4OC3 A;  4B3X A;  4LBY A;  2XZL A;  2V8V A;  1WTH D;  2Q7S A;  1MAB A;  2BGI A;  1ELO A;  2VYQ A;  1CP6 A;  4CYP A;  3GKR A;  2YWH A;  1Z8T A;  2ARH A;  3KR4 A;  4MCQ A;  2F8H A;  5CPA A;  2ZEN A;  1KK3 A;  1SM4 A;  1TKJ A;  1Q2D A;  1B6B A;  4P1V A;  4KOU A;  4XOR A;  5A89 A;  1UD2 A;  4M2L A;  4TWE A;  3K9U A;  5C82 A;  3GVJ A;  3BH4 A;  4F8Z A;  1NB9 A;  3NFZ A;  1IHM A;  5IV0 A;  4CAW A;  3K2K A;  4JLY A;  1XMB A;  7CPA A;  3KQZ A;  1AUG A;  4RUH A;  4B6Z A;  3RBU A;  1UD8 A;  1QVG B;  2POK A;  4NFR A;  1BLL E;  1ZLI A;  3ZZI A;  1QMU A;  1M4I A;  4UA3 A;  4F9V A;  3A3B A;  2Y0M A;  1EP3 B;  1LRZ A;  1S72 B;  3ZZT A;  3CME B;  1CG2 A;  2D4P A;  2XEX A;  1RTQ A;  3UY5 A;  2ZEG A;  3DNS A;  5H5J A;  1COW A;  3ISX A;  4RLZ A;  1F60 A;  1I21 A;  4Y9R A;  2DCU A;  3EO4 A;  3PB7 X;  2VBT A;  1KZL A;  4E0A A;  2B3U A;  1VQ4 B;  1Q2Y A;  3FX6 A;  2ZOG A;  3W2F A;  2JDD A;  1Y0R A;  3DDD A;  3W5H A;  5D8N A;  3LQE A;  1VGY A;  1FND A;  4UCN A;  2VZZ A;  2F7V A;  4Z65 A;  1SQH A;  1Z9U A;  3H8E A;  3B7I A;  5KTC A;  4P12 A;  3SI2 A;  4M4S A;  3W91 A;  3G05 A;  3LVB A;  1KQS B;  3RYO A;  3CDX A;  1N05 A;  3TFY A;  4JWP A;  3W2I A;  4YAL A;  2NPF A;  4OP4 A;  4UF4 A;  4P4B A;  3A35 A;  1N71 A;  2PSW A;  3DR6 A;  5AG5 A;  2XNC A;  4M3S A;  3OJW A;  3PA1 A;  2EUI A;  4LUA A;  3TTH A;  1VQ9 B;  3ONY A;  5DN6 A;  3EFA A;  3PVD A;  4G6I A;  1VKC A;  1W2B B;  2ZEO A;  1TVC A;  2BL1 A;  3KGQ A;  4H6Z A;  3BQJ A;  4U9Z A;  2PJ5 A;  1YGH A;  2J9A A;  3PP9 A;  4KKS A;  5KNL A;  3H9N A;  1BMF A;  4C43 A;  2OR4 A;  3R95 A;  3SHP A;  1CX8 A;  1P4N A;  1YME A;  2F1M A;  4E0F A;  4ASU A;  4H2K A;  3E20 A;  2ZL7 A;  1CM0 A;  4KUA A;  4ZV4 A;  3TOA A;  1S3Z A;  2HQY A;  4FWU A;  3WY9 A;  2JIZ A;  1PUA A;  2V7X A;  2DEU A;  1FT7 A;  4OPS A;  2Z6B D;  4H9G A;  4C2Y A;  1R57 A;  4WZK A;  4C7I A;  4E2A A;  1I18 A;  1GHE A;  2Q04 A;  2YNC A;  2ANP A;  4P6Y A;  5JQ4 A;  2PVV A;  4AC9 A;  3D66 A;  4RD3 A;  1VQL B;  1XOV A;  1WSR A;  6CPA A;  4YFJ A;  1IY7 A;  4P4D A;  2QEX B;  5JPH A;  4XL9 A;  1Z5R A;  3P2H A;  1DDI A;  5HZA A;  1DE4 C;  4KOR A;  2EFG A;  4F0Y A;  3PA2 A;  5F4J A;  3B3W A;  2P6G A;  5HKK A;  1OGI A;  2D9R A;  2ZPA A;  1WOS A;  4ZBG A;  3H8G A;  4MMO A;  1G7T A;  2XNJ A;  4Q7J B;  1OGJ A;  4Z4U A;  4PC3 A;  1CJW A;  3VH9 A;  3WXM A;  1XEB A;  1M4G A;  2QTZ A;  2AFM A;  4B3G A;  2I1L A;  4RD4 A;  3NH5 A;  1QG0 A;  1YR0 A;  2WR8 A;  2VZY A;  3F8K A;  1N07 A;  2GE3 A;  2Z0Z A;  2FCK A;  1E1R A;  3GB0 A;  1JQG A;  1MK4 A;  2C77 A;  1YVK A;  1XMT A;  4PSW A;  4F0X A;  2B4D B;  1PJ6 A;  2XEG A;  3WC7 A;  1PKV A;  3S9L A;  3G8W A;  3FKS A;  4J3G A;  3R9F A;  1X10 A;  4RPD A;  1FNB A;  2F4N A;  4A39 A;  3Q38 A;  4LQ6 A;  2ZXI A;  3WR7 A;  3VO2 A;  3FMC A;  1KUX A;  4CS0 B;  3OZV A;  2CK3 A;  5IK2 A;  2QGG A;  2VNK A;  2CXA A;  4XNF A;  1XRY A;  2DER A;  3V38 A;  1VQK B;  2ZEL A;  3OW7 A;  3TC8 A;  1DG1 G;  2B7B A;  4HE6 A;  2Z3N A;  4QB9 A;  3E1Y E;  1XQB A;  3GQB A;  3KI9 A;  2BSW A;  2Q43 A;  4PV6 A;  5BWA B;  5FVJ A;  2VJJ A;  4PXD A;  1KMH A;  2XEF A;  1EXM A;  1PU9 A;  3S9M A;  3AGP A;  1HDU A;  2Q4Z A;  3SLN A;  1Z8W A;  2QJ8 A;  4X06 A;  4CGP A;  1IGB A;  4DNC A;  3CXS A;  2E1R A;  3CCM B;  5HH1 A;  3HLP A;  4TT3 A;  5I0C A;  1PCA A;  2D3N A;  3B8H A;  4B47 A;  3A8K A;  3V7Z A;  2RB7 A;  2OU2 A;  1QSR A;  2FL4 A;  2Q4Y A;  2EWB A;  2PIA A;  1D8T A;  4RCZ A;  5C88 A;  3D67 A;  4L89 A;  1WDT A;  4AG9 A;  2PLF A;  4WWV A;  1BOB A;  4TMZ A;  4NF1 A;  1KJZ A;  4QC6 A;  4P4E A;  4B44 A;  4EWT A;  4MY0 A;  1GVH A;  2PJ3 A;  2JJ1 A;  1P4M A;  3J81 k;  4ZYQ A;  2ZW4 A;  1K4J A;  1WP6 A;  4N3G A;  3VR6 A;  3SEJ A;  3SJG A;  4QV2 A;  3FEC A;  5EC4 A;  3W2G A;  3CPX A;  2R98 A;  4ZY0 A;  1K28 D;  1FX0 A;  2NYQ A;  3B8G A;  4JZ0 A;  3Q39 A;  2YWF A;  4OC1 A;  5F4M A;  2WSA A;  4AXV A;  5EMN A;  3AVV A;  3WC5 A;  3WYA A;  3ZUG A;  2X0K A;  1Y9W A;  3IO1 A;  2EK8 A;  4P45 A;  5D29 A;  1VJS A;  4B4D A;  4P25 A;  1FDR A;  3CCS B;  4KVO E;  1YLO A;  3T51 B;  2DPS A;  3C26 A;  4H6U A;  4P4F A;  4CGL A;  2V7T A;  4KOY A;  4CYN A;  1QFJ A;  3WNB A;  1B87 A;  3KAS A;  1EE3 P;  1H8L A;  3TOB A;  2BM0 A;  2C1C A;  3PRT A;  1K8A D;  1VQP B;  5IB0 A;  1U6M A;  2PRQ A;  1W35 A;  4YHB A;  4ZGN B;  4XLC A;  4YEJ A;  1KK0 A;  1WOO A;  1A8P A;  5CDF A;  3QFS A;  4RDK A;  2BO9 A;  5CNP A;  4XLA A;  1H8H A;  4JYW A;  2OZG A;  3JTK A;  2GQF A;  3A9L A;  3LOD A;  5DS0 A;  3IWG A;  4NGQ A;  1E62 A;  2ZZG A;  1VF7 A;  2VNJ A;  4PGO A;  5BSY A;  3IEH A;  2QML A;  2X7B A;  1U2R A;  4MYU A;  2G3A A;  3OOC A;  2DXQ A;  4OAD A;  3D7H A;  4UEF A;  2PJ1 A;  1KK2 A;  3CD6 B;  1UFH A;  1YJ9 B;  1ZM2 A;  2PJ2 A;  3WBJ A;  2XOK A;  2V7U A;  4X7E A;  3A8I A;  3CMA B;  1RO5 A;  1YRE A;  4JXQ A;  4EVY A;  2Z3P A;  4XN3 A;  5FNZ A;  4IK2 A;  3QSY A;  3P27 A;  5THW A;  2PJC A;  2DY1 A;  2EK9 A;  1QUF A;  3TX8 A;  4HE5 A;  4KKU A;  1S7K A;  1GAW A;  4KSI A;  4PK2 A;  1YIJ B;  3GIU A;  1M1D A;  3BHX A;  2WYR A;  2CNT A;  1YSJ A;  2Q0Y A;  4OC2 A;  4TNU A;  3SI0 A;  3S9N A;  2CW5 A;  1HDQ A;  2I79 A;  3CXC B;  1E79 A;  3AVT A;  1E3X A;  2FVG A;  5ELY A;  3MGD A;  2Q6L A;  1SKY B;  1Y9K A;  1TIQ A;  2PQ8 A;  2R7H A;  1KRH A;  4PXB A;  2C27 A;  1QQ9 A;  4F6A A;  3KL9 A;  2GJK A;  1IJF A;  2WPX A;  1N08 A;  3ZJ0 A;  4Z4T A;  1QGY A;  2IMO A;  3TO9 A;  3FNC A;  2VNH A;  5AG6 A;  2HB6 A;  2ZXH A;  4K1X A;  2B5O A;  3F0A A;  4FD4 A;  4KVM E;  1UD3 A;  3PZJ A;  2D3L A;  3QNV A;  1JNY A;  3GVL A;  3VWE A;  1LAM A;  2AE6 A;  1DTD A;  3N5F A;  3T9Y A;  4XON A;  2R9V A;  1WK4 A;  2NV4 A;  5G22 A;  3SI1 A;  3BNW A;  2EVN A;  4YAO A;  3AVU A;  1YK3 A;  2YND A;  1M4D A;  4NSQ A;  4R8F A;  1CQX A;  1Q9S A;  4C2X A;  3AST A;  1IYL A;  1LFW A;  4CQJ A;  3K9T A;  3T8W A;  5DSZ A;  4NNJ A;  2AFO A;  4OAE A;  2R8V A;  3KZW A;  2DEA A;  4LBZ A;  1OHH A;  3H5Z A;  3L2N A;  2KVO A;  2V31 A;  2QYV A;  2QVP A;  3D4U A;  4DJL A;  1NMT A;  1D1N A;  4C7H A;  2CC2 A;  4FXU A;  1IID A;  3ISZ A;  2HC9 A;  1LOK A;  1N8R D;  4R76 A;  4AVA A;  4ONU A;  1QSO A;  1YQE A;  4PC1 A;  3FVL A;  2HV2 A;  3W6X A;  3VAT A;  3CCQ B;  4G1V A;  2PJ4 A;  3CB4 A;  4A2Z A;  4RD6 A;  1BQE A;  4NCN A;  3NA6 A;  5LYF A;  4IAV A;  3JQP A;  3FF3 A;  3QB8 A;  2X3U A;  4R3L A;  3GUX A;  3EXN A;  4LC0 A;  4DQK A;  1SKQ A;  3BY2 A;  4KLV A;  4A38 A;  3U6K A;  5J3O A;  4ZY1 A;  1VHE A;  1S60 A;  4ZX9 A;  1ZM9 A;  3FPP A;  1ZG8 A;  1YI2 B;  4NGM A;  4HKF A;  2PJ7 A;  5HZB A;  2AFS A;  2VL1 A;  4NGT A;  2QIR A;  3LAC A;  2BF4 A;  3GY9 A;  1IYK A;  2C5H A;  1LAP A;  3W5U A;  3CCJ B;  2CNS A;  4RDL A;  2IL4 A;  5HMN A;  3VNV A;  2EBJ A;  1JB9 A;  4O23 A;  4ONW A;  4XR6 A;  4GM5 A;  3G3S A;  2V4D A;  1R43 A;  2J7K A;  2V8H A;  4CAV A;  3IGR A;  5AGE A;  2E1B A;  1EP1 B;  3JRU A;  3KKW A;  1UD5 A;  3CW2 A;  3P26 A;  2RC5 A;  2O4H A;  5KTA A;  2OTL B;  3HUV A;  1S7N A;  4II2 A;  2JN9 A;  1ELL P;  1F20 A;  2CIJ A;  1J9Z A;  3GYA A;  4ZY2 A;  2XND A;  2AFX A;  3R6K A;  4C2Z A;  4R6T A;  2J8N A;  3OZW A;  2WJV A;  4YAF A;  3PFO A;  5AG4 A;  2GFQ A;  1KTV A;  1V0F A;  3BCD A;  2AFU A;  4EME A;  4N3N A;  3I55 B;  4Z1M A;  4UZE A;  4MFP A;  2GLJ A;  4UEZ A;  5G1Z A;  4U9U A;  2Q4V A;  1EP2 B;  3FB3 A;  1XF8 A;  5J8C A;  1Q2C A;  3SKB A;  4R7M A;  5EMI A;  2X85 A;  3PB4 X;  1JA0 A;  2BV3 A;  3B3T A;  3R9E A;  4RD1 A;  1TKH A;  3PEN A;  4P2N A;  4RDJ A;  1ZM4 A;  2OTJ B;  4HNX B;  5F47 A;  1T5E A;  4CRZ B;  3PB6 X;  3QFR A;  1BO4 A;  4Z4R A;  4YU9 A;  5F09 A;  4PC6 A;  1Z8L A;  3W2H A;  2ZEP A;  4P22 A;  3DSB A;  4IW3 B;  4OLL A;  5AG7 A;  4TKO B;  2PVW A;  5IX3 A;  5HXB A;  4FN5 A;  3G6E B;  3MN8 A;  4RM0 A;  4UAJ A;  2P0W A;  4P10 A;  2ZZF A;  4UFW A;  5GCN A;  1NBM A;  3FPK A;  1EWY A;  4NXY A;  1Z2L A;  1OZP A;  5CBM A;  4P3Y A;  5K8M A;  4LQG A;  2WJY A;  4KSA A;  4MCP A;  2QN6 A;  1HVX A;  1IB0 A;  4XPD B;  3IU2 A;  2XZP A;  5J1Q A;  2BM1 A;  4G7X A;  4Y7C A;  4A33 A;  2GPJ A;  2OZH A;  4DQL A;  4X0C A;  4MCR A;  4DUK A;  2B5G B;  1PJ5 A;  4DYO A;  1ZO0 A;  3NH4 A;  5J35 A;  4II9 A;  1VLO A;  4OPO A;  4I49 A;  5IYW A;  2OYN A;  4KS9 A;  3WNC A;  2V7W A;  1IOF A;  1M1K D;  2FT0 A;  4P9S A;  2DF5 A;  4X8I A;  3BXM A;  2WPD A;  4G5G A;  1XE4 A;  4L8J A;  4EH1 A;  2HLD A;  2OK7 A;  4NBS A;  2WPW A;  3VAR A;  4ZCM A;  5FO0 A;  4MHN A;  2EO8 A;  1JA1 A;  3V8I A;  4AB7 A;  1CP7 A;  1ZLH A;  4UZU A;  5DWN A;  2V7Q A;  2CRV A;  2FSR A;  1H85 A;  4A32 A;  2OK8 A;  2WUU A;  1EFU A;  1KD1 D;  2VJI A;  5TV2 A;  1YX0 A;  2IQ6 A;  5HXD A;  4NJR A;  4CYQ A;  1YVO A;  1VQ8 B;  1UWY A;  4RJL A;  4RD2 A;  3B2Y A;  4II3 A;  3BLN A;  1IJE A;  4XQF A;  2B5G A;  2VI7 A;  3MCA A;  4HNW B;  4MYT A;  4MFK A;  1KUV A;  3EY5 A;  4FWT A;  4QBJ A;  2FXF A;  4R87 A;  2ZED A;  1W9X A;  2ZEM A;  4P44 A;  1H8E A;  3OJX A;  1HZE A;  2VBU A;  1G7C A;  4C68 A;  4UBR A;  4ZI6 A;  3PEI A;  2DYI A;  3SXN A;  4K30 A;  2X6W A;  1T6Z A;  1IIC A;  3FH4 A;  1E64 A;  3ONU A;  3R6J A;  4P6V F;  2B4D A;  1BPL A;  1AIP A;  2AFW A;  3OEH A;  4OOS A;  3A1P A;  4MRI A;  2H5M A;  3S6H A;  4WQM A;  4OP7 A;  3V7A A;  3CES A;  5LRG A;  1QSN A;  4UEE A;  4AF6 A;  3SLD A;  1TTT A;  2PE3 A;  2KCW A;  4B3F X;  2XZO A;  4XOP A;  5J8F A;  3OW2 B;  4AF7 A;  3TO7 A;  4ACA A;  1MJ9 A;  1I8D A;  3F5B A;  3CP2 A;  1YHQ B;  1Y7E A;  2A4N A;  2W6J A;  5G20 A;  5AN9 A;  4M85 A;  4B5P B;  1LCP A;  3BJ8 A;  2X53 S;  1HEE A;  3NE7 A;  4B13 A;  4WZE A;  1UD6 A;  4FD7 A;  1S7L A;  3PBE A;  3AVY A;  2DPT A;  4F9U A;  4MFQ A;  1M90 D;  4TMX A;  2LZJ A;  5F4O A;  3B82 A;  3D7F A;  2ZBU A;  1FRN A;  4MFL A;  1QGA A;  1QH0 A;  3QAH A;  3WBK A;  3QFT A;  2GK7 A;  2PMD A;  1ZG7 A;  3CCU B;  3I9S A;  1YJW B;  1TF9 A;  1Y7R A;  4LBV A;  1GO2 A;  3SJF A;  4OC5 A;  3PB9 X;  1WPC A;  1Z4R A;  4UWJ A;  2P3M A;  1TLL A;  2ZZQ A;  3H4Q A;  4ZGY B;  4UZF A;  1ARL A;  2QEC A;  2BSA A;  2C78 A;  3D3S A;  4YRH A;  4Y49 B;  1RQP A;  3V76 A;  2C2W A;  1RXT A;  3ZBT A;  2BOA A;  2ZBV A;  4W9Y A;  3T90 A;  4BIN A;  2NMT A;  3ZIA A;  4X07 A;  3IC1 A;  3R1K A;  1NJI D;  1QUE A;  1OB5 A;  1ZG9 A;  2Z3K A;  2PRB A;  1R5B A;  4CGN A;  1LAN A;  4NGN A;  4K3N A;  1FY7 A;  4MFZ A;  3OP1 A;  4X5K A;  5A27 A;  2PJ0 A;  2O28 A;  4NEX A;  4OC4 A;  2PJ8 A;  1A2Z A;  4RPB A;  1ON0 A;  1VQN B;  1BX0 A;  2PC1 A;  2FIA A;  2OBT A;  1VHO A;  1MJB A;  2BGJ A;  2VBS A;  4XPD C;  5ISV A;  2Z3M A;  5FIU A;  3ZPN A;  3H8F A;  4ZX8 A;  5FA6 A;  2PJ6 A;  3R9G A;  3P2F A;  1QVF B;  3W6S A;  1WU8 A;  4Z4S A;  2ZOF A;  2CF4 A;  2I00 A;  1E3Z A;  4DK0 A;  3CP8 A;  4XLH A;  1WOP A;  2X6X A;  1OBR A;  3PUM A;  1R5O A;  4B12 A;  4GXH A;  5IYP A;  3OAA A;  2GK6 A;  3CRZ A;  3RAM A;  4KOV A;  8CPA A;  3D2M A;  1IU8 A;  1WOR A;  1Q7Y D;  1BAV A;  2GAN A;  4RS2 A;  3AGQ A;  5DWM A;  5E96 A;  2RC4 A;  2C4T A;  2ATR A;  5H84 A;  2VEZ A;  2ZXV A;  3QE2 A;  1NSL A;  1T6X A;  3FJU A;  1UD4 A;  4CYO A;  1NB0 A;  2F43 A;  3CMM A;  2Z3O A;  2J8R A;  1Q7L A;  1CPX A;  2BN4 A;  1MJA A;  4Z4V A;  1Y0Y A;  3BJ7 A;  2PR1 A;  2XEI A;  3RNZ A;  1ZM3 A;  5F49 A;  5L46 A;  3FIX A;  3NH8 A;  4KKT A;  4PAB A;  2AHO A;  4MBU A;  3KQX A;  1ARM A;  1M44 A;  1S5K A;  3JQQ A;  1B23 P;  2VQY A;  2Z3L A;  3OPO A;  2CBX A;  4MXU A;  1W0J A;  1VLY A;  2RC6 A;  4R57 A;  3OWC A;  4M6H A;  4ORF A;  1TUI A;  3CXQ A;  3RY8 A;  2FIW A;  1GJR A;  3WT4 A;  3SJX A;  1XIX A;  3FEE A;  5LMZ A;  4CRY B;  1R5N A;  1QST A;  4PSX A;  3VMF A;  4QFM A;  4XN0 A;  5K8O A;  4XOT A;  4OPV A;  3DDY A;  4Z4W A;  4NGR A;  4MI4 A;  1TXR A;  3U2Q A;  5HVF A;  1YX2 A;  2JEV A;  4YWY A;  1XB2 A;  2HUZ A;  4YGO A;  3WAB A;  5G21 A;  1BX1 A;  2F1L A;  2X6Y A;  2REF A;  3QFC A;  4C0S A;  3SJZ A;  2VZL A;  1EFC A;  5TR9 A;  4MJ8 A;  3I1F A;  2Q6I A;  2ZL5 A;  1BLI A;  1WWZ A;  4PXC A;  3B3V A;  3Q6Q A;  2OBS A;  2AFZ A;  5KTD A;  2ZEF A;  2JLM A;  3D7G A;  3ZZU A;  4MFJ A;  1GAQ A;  2ZL6 A;  4P26 A;  5A88 A;  4UIA A;  4X05 A;  2GRE A;  5K8N A;  4H89 A;  3WQZ A;  3NE8 A;  3OEE A;  1AMO A;  2EIX A;  5LYD A;  1IOI A;  2C4U A;  4QVJ A;  2CNM A;  2BEI A;  2X8K A;  5GV8 A;  4A30 A;  1G7S A;  3Q3A A;  4TSF A;  4PC2 A;  4LX9 A;  4YXW A;  2G0B A;  3S6F A;  5IYQ A;  4JJX A;  1FRQ A;  1ZUN B;  4A94 A;  4XM3 A;  5FL7 A;  3LQ6 A;  2O53 A;  4CAF A;  4WZL A;  3ASP A;  2YWE A;  3D7D A;  4Y49 C;  1TKF A;  1Q86 D; 
#chains in the Genus database with same CATH homology
 4P4E A;  4EWT A;  5JM6 A;  2PJ3 A;  4MCR A;  4DUK A;  3BI0 A;  1CBX A;  4ZYQ A;  4DYO A;  3NH4 A;  1NSA A;  1AMP A;  3SJG A;  2PJ9 A;  3FEC A;  3I1U A;  3CPX A;  4ZY0 A;  4X8I A;  2NYQ A;  4G1P A;  1KWM A;  3BXM A;  4JZ0 A;  4X3R A;  2WZN A;  5LYI A;  4MHY A;  4OC1 A;  4AXV A;  2OOT A;  4OIW A;  3WC5 A;  1AYE A;  3IO1 A;  3VAR A;  2EK8 A;  4P45 A;  5D29 A;  3D68 A;  4MHN A;  4IHM A;  2V77 A;  1CP7 A;  1ZLH A;  1YLO A;  4OC3 A;  4P4F A;  2V8V A;  3IJ3 A;  3KAS A;  1EE3 P;  1H8L A;  2C1C A;  2IQ6 A;  2JEW A;  1CP6 A;  5HXD A;  3PRT A;  4NJR A;  1UWY A;  3KR4 A;  2CTC A;  4Q7A A;  2PRQ A;  3B2Y A;  4MCQ A;  2F8H A;  5CPA A;  2ZEN A;  1TKJ A;  5JGF A;  2ZED A;  2BO9 A;  2ZEM A;  4OC0 A;  4TWE A;  4P44 A;  4F8Z A;  1XBU A;  3NFZ A;  4JYW A;  4ZI6 A;  2V8D A;  3PEI A;  3K2K A;  4MHP A;  5DS0 A;  1XMB A;  3FH4 A;  4NGQ A;  7CPA A;  3KQZ A;  4RUH A;  4B6Z A;  3RBU A;  2C6G A;  2I3C A;  2POK A;  4NFR A;  1BLL E;  1ZLI A;  3DGV A;  2PIZ A;  5JH9 A;  3IEH A;  1QMU A;  4F9V A;  2AFW A;  4MRI A;  2NSM A;  4A37 A;  5LRG A;  4UEE A;  4UEF A;  3D7H A;  2PJ1 A;  3PFE A;  2PE3 A;  1BPM A;  1CG2 A;  3KHX A;  1RTQ A;  2PJ2 A;  3LWU A;  2ZEG A;  3GLJ A;  1PYT B;  1Y7E A;  4IK2 A;  3ISX A;  5THW A;  2PJC A;  2EK9 A;  3CPA A;  1LCP A;  3TX8 A;  1HEE A;  4FBE A;  1FNO A;  3PBE A;  3RZA A;  4KSI A;  4F9U A;  5LRJ A;  5LYL A;  4NJQ A;  2ZEH A;  3D7F A;  3BHX A;  2WYR A;  3PB7 X;  1YSJ A;  4OC2 A;  4NGP A;  4TNU A;  3SJE A;  3SI0 A;  3PB8 X;  4PXE A;  4P4J A;  3FX6 A;  3S9N A;  2ZOG A;  2Q51 A;  1HDQ A;  1ZG7 A;  1Y0R A;  5D8N A;  1TF9 A;  1VGY A;  4MCS A;  2F7V A;  2FVG A;  4Z65 A;  5ELY A;  3SJF A;  4OC5 A;  3PB9 X;  3H8E A;  1TF8 A;  3B7I A;  3SI2 A;  4PXB A;  1QQ9 A;  3KL9 A;  4PQA A;  3CDX A;  1ARL A;  5LRK A;  2IMO A;  4OP4 A;  4FUU A;  4UF4 A;  2HB6 A;  4P4B A;  2PIY A;  2BOA A;  4W9Y A;  3QNV A;  1LAM A;  2ZEO A;  1DTD A;  3N5F A;  3KGQ A;  1YW4 A;  3IC1 A;  2PJ5 A;  3SI1 A;  1ZG9 A;  2J9A A;  4NGS A;  1LAN A;  2OR4 A;  2C6C A;  4NGN A;  4OME A;  1CX8 A;  4R8F A;  1YME A;  4K3N A;  1LFW A;  3K9T A;  4OID A;  3T8W A;  2PJ0 A;  4H2K A;  2AFO A;  3KZW A;  4PPZ A;  4OC4 A;  4FWU A;  2PJ8 A;  2RFH A;  2DEA A;  3L2N A;  1VHO A;  2QYV A;  1FT7 A;  2QVP A;  3D4U A;  3FED A;  4DJL A;  3H8F A;  4ZX8 A;  2PJ6 A;  3ISZ A;  2HC9 A;  1LOK A;  1BPN A;  4R76 A;  2ZOF A;  2CF4 A;  2ANP A;  4P6Y A;  3FVL A;  3VAT A;  2PCU A;  2PVV A;  3D66 A;  1OBR A;  2PJ4 A;  3CT9 A;  4X2T A;  3IFE A;  6CPA A;  1IY7 A;  3NA6 A;  4P4D A;  5LYF A;  1CPS A;  1F2P A;  4IAV A;  1Z5R A;  3FF3 A;  3RAM A;  8CPA A;  1DE4 C;  2JBK A;  3GUX A;  1F57 A;  3B3W A;  5IB9 A;  1BAV A;  3IIB A;  1M4L A;  2GU2 A;  4A38 A;  3PBB A;  4ZY1 A;  1VHE A;  3H8G A;  4MMO A;  2ZEE A;  3VH9 A;  4ZX9 A;  3FJU A;  1ZG8 A;  4NGM A;  3KR5 A;  3B3S A;  2PJ7 A;  2GLF A;  2AFM A;  5K8P A;  1Q7L A;  1CPX A;  2AFS A;  2VL1 A;  1Y0Y A;  4NGT A;  2XEI A;  4MHZ A;  2V8G A;  1LAP A;  2C6P A;  3NH5 A;  3NH8 A;  4OKO A;  3KQX A;  1ARM A;  1YW6 A;  3GB0 A;  1JQG A;  4O23 A;  4ONW A;  4GM5 A;  4P4I A;  4MXU A;  1R43 A;  2IJZ A;  4WJB A;  3BI1 A;  2V8H A;  3JRU A;  2XEG A;  3WC7 A;  3WT4 A;  2O4H A;  4FAI A;  2ABZ A;  4CPA A;  3DLJ A;  1F2O A;  3SJX A;  3S9L A;  3HUV A;  3FEE A;  4A39 A;  3MRU A;  1ELL P;  2CIJ A;  3KHZ A;  4ZY2 A;  2AFX A;  2JBJ A;  3FMC A;  5K8O A;  2CTB A;  4R6T A;  3PFO A;  3V38 A;  1XRY A;  4NGR A;  3WC6 A;  2ZEL A;  2AFU A;  1TXR A;  4EME A;  5HVF A;  4YWY A;  3TC8 A;  2GLJ A;  4UEZ A;  3B35 A;  3KI9 A;  2Q43 A;  3WAB A;  1XJO A;  1GYT A;  4EFD A;  4PXD A;  4R7M A;  2XEF A;  3B3C A;  3S9M A;  3PB4 X;  3B3T A;  1HDU A;  2Q4Z A;  4PXC A;  3B3V A;  2QJ8 A;  1TKH A;  5HVG A;  2AFZ A;  1IGB A;  1R3N A;  2ZEF A;  2PJB A;  4BD9 A;  3D7G A;  3PB6 X;  3HLP A;  4YU9 A;  5F09 A;  4UIA A;  1Z8L A;  5HVH A;  2GRE A;  2ZEP A;  5K8N A;  1PCA A;  2PVW A;  5LYD A;  2BCO A;  2XEJ A;  3MN8 A;  1ELM P;  2G9D A;  1XFO A;  4P10 A;  3V7Z A;  2RB7 A;  3IWW A;  2EWB A;  1Z2L A;  5CBM A;  5I4M A;  5K8M A;  4A94 A;  4LQG A;  4MCP A;  3D67 A;  2O53 A;  1VIX A;  3LMS A;  2PJA A;  5J1Q A;  4WWV A;  3D7D A;  4UIB A;  1TKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...