4X8IA

De novo crystal structure of the pyrococcus furiosus tet3 aminopeptidase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
346
structure length
337
Chain Sequence
b'MVDWELMKKIIESPGVSGYEHLGIRDLVVDILKDVADEVKIDKLGNVIAHFKGSAPKVMVAAHMDKIGLMVNHIDKDGYLRVVPIGGVLPETLIAQKIRFFTEKGERYGVVGVLPPHLRIDWDSIIVDVGASSREEAEEMGFRIGTIGEFAPNFTRLSEHRFATPYLDDRICLYAMIEAARQLGEHEADIYIVASVQEEIGLRGARVASFAIDPEVGIAMDVTFAKQPNDKGKIVPELGKGPVMDVGPNINPKLRQFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysyl aminopeptidase
molecule tags Hydrolase
source organism Pyrococcus furiosus
publication title Tuned by metals: the TET peptidase activity is controlled by 3 metal binding sites.
pubmed doi rcsb
total genus 111
structure length 337
sequence length 346
chains with identical sequence B, C
ec nomenclature ec 3.4.11.15: Aminopeptidase Y.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 4x8iA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x8iA01
2F7VA 4PXCA 2EWBA 2OOTA 5LYDA 2Q43A 2PJCA 3FEDA 3PFEA 3IFEA 4UEEA 4ZY0A 4JZ0A 4P4EA 3B3VA 1UWYA 2PJ3A 3L2NA 1XMBA 2O53A 4YWYA 1XRYA 1OBRA 1JQGA 3RAMA 4P4DA 3CT9A 1F2OA 3I1UA 2ZEOA 2PE3A 2HC9A 5CBMA 3B3WA 5HVGA 2ZEHA 2ZEMA 2PJ7A 3IEHA 1YLOA 1ZLHA 4OIDA 3SJFA 3BI0A 1IGBA 4ONWA 3ISZA 2ABZA 4IK2A 1LOKA 3D66A 1AMPA 4P44A 1TKFA 3SJXA 2XEGA 4OC3A 3D7DA 2BO9A 4F9UA 3RZAA 1ZG7A 2GLFA 3PRTA 2Q4ZA 2CTCA 5JH9A 1XBUA 5HVFA 1ZLIA 4OC5A 2WYRA 4NGTA 4TWEA 4IHMA 2IQ6A 4P6YA 2PJ0A 2PJ5A 3SJGA 2DEAA 4B6ZA 3CDXA 2QJ8A 3B7IA 2AFMA 5D29A 4W9YA 1VHEA 5LYFA 1TKHA 3CPXA 4NFRA 2PJ8A 2ZEEA 2C6GA 3PBBA 5ELYA 2C1CA 1H8LA 3KR5A 3ISXA 3HUVA 1CX8A 2BCOA 2IMOA 3V7ZA 4R6TA 3PB6X 4OIWA 2V8DA 3QNVA 3FVLA 3NFZA 4NGNA 4TNUA 4ZY2A 1ELMP 2V8HA 1AYEA 5JGFA 4OC0A 3T8WA 1EE3P 2CF4A 4H2KA 1CPXA 4GM5A 5K8NA 1VHOA 3VH9A 4K3NA 4MCRA 3IIBA 4MMOA 3S9LA 2PVVA 2PRQA 3GUXA 2QYVA 1TXRA 1RTQA 1XJOA 3WC6A 2V8GA 4F9VA 3KHZA 4F8ZA 4EMEA 1Y0RA 3B3CA 1XFOA 4MXUA 2C6PA 4CPAA 1QMUA 4MCPA 4DYOA 3K2KA 4P10A 7CPAA 3CPAA 3KL9A 2PJ1A 5THWA 3RBUA 4R8FA 1VIXA 1R3NA 2FVGA 3IO1A 2WZNA 1ARMA 1VGYA 4PXBA 2PJ2A 2ZEGA 3H8GA 2VL1A 3PFOA 3WC5A 3B2YA 4NJRA 4R7MA 1M4LA 2AFZA 3HLPA 5JM6A 2XEIA 4DUKA 3NH4A 3S9MA 4OC1A 3KHXA 4OMEA 2ZENA 4UIAA 2GLJA 3WABA 4AXVA 3D68A 1TKJA 4DJLA 1Z2LA 8CPAA 3IJ3A 1LAPA 4MRIA 3H8FA 1DE4C 3GB0A 3KI9A 2I3CA 2PIZA 3LWUA 5HXDA 4RUHA 4WWVA 4FUUA 1YSJA 4NGRA 3MN8A 3NH8A 2PVWA 1ARLA 1LFWA 2OR4A 4UEFA 2XEJA 2ZEFA 2GREA 2EK9A 3B3TA 4NGSA 4EWTA 3D7FA 1ZG8A 2ZOFA 4BD9A 3FEEA 4A37A 4PXDA 1F2PA 1QQ9A 2PIYA 3FF3A 2NYQA 3K9TA 5HVHA 3GLJA 3NH5A 4MHPA 4P4JA 1LAMA 2EK8A 2POKA 4NJQA 4FAIA 1TF9A 4JYWA 1FNOA 5LYIA 4EFDA 5F09A 3WT4A 3PB9X 2AFSA 3KGQA 2ZEPA 3PBEA 3D7GA 5D8NA 3SJEA 1ZG9A 4P4FA 4ZYQA 3D7HA 4UF4A 2PJAA 4Z65A 4NGQA 2O4HA 4NGPA 4OKOA 4FBEA 1PCAA 2AFXA 5I4MA 1LCPA 3IC1A 4R76A 4ZX8A 3PEIA 3FH4A 3KASA 1BLLE 1CP7A 1BPMA 4MHZA 3N5FA 2CIJA 3TX8A 2XEFA 2J9AA 3S9NA 4X8IA 3TC8A 2V8VA 2PJ9A 5K8OA 2G9DA 2V77A 2PJ6A 1R43A 2RB7A 1HDQA 4P45A 3KR4A 4WJBA 1ELLP 3B35A 2JBKA 5K8MA 5DS0A 2Q51A 2RFHA 1CPSA 3KZWA 3FJUA 2PJ4A 4A38A 3D4UA 2IJZA 2AFWA 4PPZA 2JEWA 1NSAA 3VATA 3PB7X 4ZI6A 1DTDA 3SI0A 3SI2A 1HEEA 4P4BA 5CPAA 4KSIA 3B3SA 4MCSA 4PQAA 4P4IA 3H8EA 1TF8A 2QVPA 1KWMA 3DGVA 3BI1A 3KQXA 4OC4A 4ZX9A 4MHNA 2JBJA 6CPAA 2GU2A 2NSMA 3SI1A 1GYTA 3NA6A 1CP6A 4MCQA 1FT7A 4YU9A 5LYLA 1Y0YA 2ANPA 2ZOGA 2C6CA 3FECA 4FWUA 2F8HA 4A94A 1Z5RA 4X2TA 1YW4A 2PJBA 4MHYA 5LRGA 4A39A 3VARA 1Y7EA 1CG2A 1PYTB 3BHXA 4LQGA 1LANA 2AFUA 3KQZA 4PXEA 1F57A 4UEZA 4UIBA 3JRUA 4O23A 5LRKA 5J1QA 1YW6A 2ZELA 4X3RA 5LRJA 4OC2A 5IB9A 2HB6A 3FMCA 4IAVA 1Q7LA 3PB8X 1CBXA 2AFOA 3LMSA 5K8PA 3FX6A 1BPNA 3MRUA 1YMEA 4ZY1A 3WC7A 2BOAA 1HDUA 3BXMA 3PB4X 4G1PA 2CTBA 4Q7AA 2PCUA 4OP4A 3V38A 1Z8LA 3DLJA 4NGMA 2ZEDA 3D67A 1BAVA 1IY7A 3IWWA
chains in the Genus database with same CATH superfamily
4R71A 1R5NA 4PXCA 1COWA 1W34A 2Q43A 2PJCA 5AN9A 3PGPA 4RD0A 3IFEA 4R87A 4ZY0A 4RM0A 4JZ0A 2D4PA 4KUBA 5A88A 4YAWA 2PJ3A 5KTAA 1OBRA 2ZW7A 3P27A 3G71B 3P2FA 3RAMA 4QUSA 4HE5A 2OK8A 1F2OA 2ZEOA 1QGZA 4QB9A 2GK7A 2D74A 2ZEMA 1VQMB 5LMZA 4MFQA 4CGPA 2PJ7A 3SJFA 3B78A 4OIDA 1WSRA 3CXQA 2WPXA 2DY1A 4FD7A 4OOSA 3VO1A 3PENA 2ZZQA 5IV0A 3D7DA 4F9UA 5KTCA 5IB0A 1ZG7A 3U6KA 2ZL5A 4XL9A 4KOSA 2QA4B 2OK7A 2B4DB 2CTCA 1YJWB 4MJ8A 5CNPA 4G7WA 2D9RA 2BMWA 3VNUA 3I56B 4P6YA 2VBUA 2DEAA 4B6ZA 1Q2CA 4XPDC 1WP6A 3B7IA 1S7FA 3S6GA 3VMFA 4W9YA 1VHEA 2B4BA 3GSIA 5LYFA 1TKHA 2C6GA 1S7KA 3KR5A 2BPOA 1CX8A 1Y9KA 2BCOA 2X6XA 4MYUA 3PB6X 4OIWA 1I1DA 3GYAA 3FVLA 1E79A 4A31A 1Y9WA 3I55B 1AYEA 4XQFA 3T8WA 2BVNA 2CF4A 1K73D 4H2KA 1CPXA 3LNNA 1VHOA 3CCJB 1KQSB 4MCRA 4M6HA 4UCNA 1QSOA 2OZHA 1G7TA 3GUXA 3TFYA 2Z3PA 1TXRA 1XJOA 3WC6A 2CY2A 4FK8A 4F9VA 4RN7A 1XMTA 1OB0A 4OAEA 2VZZA 2G0BA 2DOGA 4CPAA 4RDJA 4MCPA 4ZCLA 4WZKA 1IOIA 3CPAA 2PJ1A 3A3BA 2YNEA 4DNCA 2JIZA 4ZGYB 2JN9A 5E6TA 4QVAA 1R3NA 2FVGA 3Q6RA 1QFYA 5F46A 1VGYA 4PXBA 2GE3A 4UWJA 4LC0A 3CC7B 1IYLA 5FO1A 1EP1B 2Q0YA 1S7LA 4NJRA 1KC8D 4R7MA 3CCMB 4RPBA 3HLPA 5JM6A 4DUKA 5A89A 3QFSA 3MCAA 4P6VF 2ZENA 3E20A 1Q82D 1LAPA 1TUIA 1VJSA 5E96A 2PR1A 3R1KA 3GB0A 4QV2A 5HMNA 3ZJ0A 2PIZA 1QSMA 4CGMA 5G20A 3CXCB 3MN8A 4PC7A 3NH8A 1LFWA 4UEFA 2ZEFA 2R7HA 3SLDA 4B3FX 3ZUGA 4UCPA 1BQEA 1UFHA 3SJZA 1YQEA 1Q7YD 4PXDA 1F2PA 4CS0B 3FF3A 2BN4A 4MHPA 4RDLA 1BO4A 4KKTA 4NJQA 4FAIA 4RLZA 3TOBA 4FN5A 4RPDA 5LYIA 4EFDA 4C2ZA 2FXFA 5F09A 3CD6B 1BPLA 4OPVA 1SM4A 5IX3A 1CNFA 2BM0A 4XORA 1NJID 3PUNA 5KTDA 4C0SA 3KGQA 3D7GA 1E63A 3TE4A 2QIRA 2KCWA 4P4FA 2X53S 1UMKA 2CRVA 1WK4A 3E1YE 4MFZA 2PJAA 4ZBGA 3LODA 1GVHA 4M4SA 4FBEA 3EC4A 1D1NA 3U2QA 5IYPA 4XNHB 1AUGA 1J9ZA 2ZXIA 3A35A 1CNEA 1LCPA 4QBJA 3FNCA 1SKQA 4ZX8A 1BPMA 2DCUA 2CNMA 4FD5A 2QEXB 4I49A 1S4MA 4PK3A 3S9NA 3OKXA 1YHQB 4P3YA 3BCFA 2PJ9A 2V8VA 2V77A 2PJ6A 4B14A 2RB7A 1V5VA 4P45A 3KR4A 4WJBA 5K8MA 1EXMA 3K9UA 2Q51A 2RFHA 2Q6OA 2CXAA 3TCVA 3OOCA 3FJUA 4H6UA 2V7XA 2HV2A 4M6GA 2JEWA 2CK3A 3BNWA 3ASPA 1S72B 1XOVA 4CYOA 1HEEA 1JNYA 4P4BA 1I7PA 4KSIA 2Z3OA 1GJRA 4HNXB 4P4IA 3D8PA 3IWGA 3H8EA 1QFZA 4LBYA 1I21A 2Q6IA 1KWMA 4KVME 3KQXA 1G7CA 1BOBA 2JBJA 2GU2A 1B2RA 3SI1A 1WDTA 3W5UA 4FD4A 1GYTA 3GIUA 1XE4A 4NCNA 2WPDA 5AG4A 4H6ZA 4NCZA 1IICA 2ANPA 2ZXHA 4FWUA 2R1IA 1QH0A 4DQLA 3R9FA 1GO2A 2C5HA 5F49A 3BJ7A 2GK6A 4RD1A 2C78A 1VQ4B 4MHYA 1MK4A 1Y7EA 2ZTNA 3SEJA 4Z4VA 1Z8XA 3KQZA 2J8NA 4PXEA 1KD1D 3QFRA 5AGEA 4XOPA 1N8RD 3JRUA 5J1QA 5LRKA 4OC2A 1S60A 1UD5A 3T56B 4JXRA 4GXHA 1VQ8B 1BPNA 3MRUA 3D2MA 5EMNA 4E0FA 3GVKA 3T53B 1E62A 1IHMA 2WSSA 3MGDA 2J8MA 1VLYA 2CNTA 1I12A 1WORA 2V31A 4UFVA 2PCUA 5GV8A 2ODFA 4XM3A 1QGAA 1Z8LA 2FS5A 3DLJA 4YELA 4P1VA 2BEIA 5F4MA 3LO8A 5IYWA 4TMZA 5H86A 2F7VA 1HA3A 1KZFA 2OOTA 1GAWA 3WBKA 5LYDA 2B58A 2VEZA 2EIXA 2JLMA 4KLWA 1MJAA 4UEEA 4UCMA 4DK1A 3W2GA 4PC6A 3CW2A 3B3VA 1XMBA 1XRYA 5IYNA 3R9EA 4P4DA 3CT9A 1N07A 1WWZA 3V76A 4H89A 5DSZA 3B3WA 2WR8A 1SKYB 3OFNA 1ZLHA 4F6AA 1FNMA 4M6IA 2REFA 3N7ZA 3A3GA 4HNYB 4PSXA 2VBVA 4H9GA 4X7FA 4XONA 4OC3A 1EFUA 4AVBA 3UY5A 1EP2B 5KSWB 3RZAA 1QSNA 3PA2A 2GLFA 5DWMA 3LQ6A 2NV4A 1VKCA 2OTJB 1KMHA 4GS4A 4TKOB 3AVXA 1WPCA 1XBUA 5L46A 4KVXA 4OC5A 2AHOA 3H9NA 2IQ6A 5H84A 4UA3A 4P25A 3NE5B 3PP9A 5DWNA 2QJ8A 3ZC3A 3G8WA 4Q7JB 4HE6A 5GCNA 2VBQA 2FIAA 3CPXA 3FRMA 3CP2A 3PBBA 2C1CA 3ISXA 4WZLA 3V7ZA 4C7HA 4CYNA 5TV2A 3AVTA 3LQEA 4RJLA 4ZY2A 3VNVA 4JMQA 3CMMA 3B82A 2Q6KA 5JGFA 2VBSA 4OC0A 2P3MA 1XIXA 4GM5A 3V8IA 3JQPA 4K3NA 4MMOA 3H94A 3S9LA 4AG9A 2PRQA 4Y9RA 2ZBVA 1M44A 3EXNA 1RTQA 2V8GA 2HDNB 3CPWB 3OZUA 1FX0A 3IU2A 4F8ZA 3E0KA 4EMEA 3W2FA 3BCDA 3B3CA 5JQ4A 3SXNA 1VQLB 4R57A 2GQFA 3K2KA 7CPAA 1YX0A 2CNSA 4YGOA 4R8FA 3VWEA 4YALA 1K8AD 1T6XA 1YVOA 1IU8A 1ARMA 4M1KA 1ZM3A 2PJ2A 2ZEGA 3H8GA 4FXUA 3WC5A 4G1VA 1Q9SA 5IYRA 4B3GA 1E64A 2ZITA 4X7DA 1YI2B 2BF4A 1BX0A 1M4LA 5G21A 2W6JA 4AF7A 1UD6A 2GJRA 1GR1A 1T5EA 2Q4YA 3WY9A 1WSVA 1XE1A 1ZO0A 8CPAA 3P2HA 3IJ3A 2Q04A 3BY1A 2VNKA 4A2ZA 1OB5A 2C2WA 1DE4C 2WUUA 1QX4A 4P3IA 3JUWA 3HAGA 1XQBA 1G7RA 3CCRB 4OOXA 5GV7A 1YSJA 4E2AA 1ARLA 4II3A 4M53A 1UD4A 4PK2A 2QTZA 4KZTA 2ZOFA 3Q38A 4YFJA 1NB9A 1D8TA 4RD3A 4A37A 2QECA 3CCSB 2R6HA 3ASTA 3BY2A 4B11A 3D26A 2XNDA 2AJ6A 4AC9A 3K9TA 3W5VA 4P4JA 1LAMA 2VI7A 5A28A 1TF9A 3JVNA 3CCQB 1L0CA 2R8VA 4XNHC 1B23P 1IB1E 1VQOB 3I3GA 1VQNB 1V0FA 1RQPA 2AFSA 2JJ1A 2WJYA 5D8NA 3SJEA 3Q3AA 4X07A 4X7EA 1I8DA 4NF1A 4Z65A 2YWEA 2IL4A 1YGHA 4NGQA 2X8KA 4J3GA 3CCUB 4F0XA 5I4MA 3CESA 4G7XA 2BSWA 3W6SA 4XMYA 4YHBA 4QVTA 3FH4A 3PEIA 3KASA 1PJ5A 1Z4RA 1H8HA 2BGJA 4MHZA 4XOTA 3DNSA 5HZBA 3R95A 5ISVA 3NE8A 3A8IA 4AVAA 4X8IA 3TC8A 3NE7A 2WSAA 1ZM2A 4YXWA 3OWCA 4NXYA 4Y49B 5K8OA 3LVBA 2C4TA 3R9GA 4B44A 5DN6A 1HDQA 5A27A 3WNCA 3B35A 3R96A 2OU2A 4X0CA 3KZWA 2ATRA 4A38A 4XPDB 3W5HA 2AFWA 2ZW6A 4ZI6A 1DTDA 4RS2A 1JB9A 2PR8A 1OGIA 5CPAA 1E43A 2X0KA 3B3SA 2FT0A 4PQAA 1KZLA 1G7SA 5HKKA 1OB2A 1H8EA 4KOWA 1WTHD 4F7DA 3BI1A 4OC4A 4BMHA 3D3SA 4MFJA 4YRHA 1EFCA 2NSMA 1FNBA 3BJ8A 3CCVB 1TVCA 1CP6A 2Q4VA 2ZZEA 1N71A 2DIEA 5AG6A 3FYNA 1FT7A 4AB7A 5LYLA 1W87A 2YNCA 4L89A 2ZOGA 3S6FA 2Z3NA 4RI1A 3ZZIA 1PJ6A 4A94A 1IJEA 4XLEA 1YW4A 2D4OA 3WR7A 3KKWA 3AGQA 5LRGA 3VARA 1CG2A 1PYTB 3CB4A 4KKUA 2RC5A 3QFCA 4TMXA 3T9YA 2KVOA 4YAOA 1LANA 2AFUA 2GPJA 3R6KA 4KUAA 2PC1A 3OW2B 4Q36A 2F43A 4UEZA 2PLFA 3BC9A 4UIBA 3PVDA 1YW6A 4X3RA 2HB6A 3I1FA 3PB8X 3KEWA 1YVKA 2XEXA 4DNTB 1YMEA 3CRZA 2C5BA 1Q2DA 4TMWA 4Z4TA 3EY5A 1XF8A 1HDUA 2V7WA 2ZL7A 3BXMA 4G1PA 4L8AA 2FL4A 4PSWA 2CTBA 4Q7AA 4PC1A 3FPKA 1KJZA 4P2NA 4EH1A 1UD3A 3V38A 1KUXA 2B5GA 1Z9UA 2VJIA 1NE9A 3GY9A 2FSRA 2QTLA 1EP3B 2F4NA 1BAVA 1IY7A 2V7VA 4B5OA 3RY8A 1Q81D 4MFLA 2EWBA 5J3OA 2I00A 3RNZA 2BSAA 2X7BA 3FEDA 4PGOA 4HKFA 4B43A 2GANA 1M1DA 3IU1A 2HLDA 4JD6A 5A8AA 1Z8WA 4P4EA 1KRHA 2I79A 3H4QA 4C2XA 4AVZA 3OJXA 1JQGA 2BGIA 5G1ZA 2FIWA 1M90D 4R9MA 3CXSA 2Z6BD 4G5GA 3D2PA 3F8KA 2BM1A 1GHEA 4CYQA 2ZEHA 2B5GB 1YLOA 4OADA 3BI0A 4A30A 3MMPA 1IGBA 4X5KA 2ABZA 1RXTA 3A8JA 2B3UA 3D66A 3SJXA 3G05A 4ZGNB 2XEGA 5HH1A 4DQKA 2BO9A 2PSWA 5EC4A 2H5MA 2VNHA 2REEA 2ARHA 1JWQA 3AGPA 4B5PB 5JH9A 5HVFA 2C77A 5KNLA 1ZLIA 4ZV4A 4BPRA 2WYRA 4FD6A 2WPWA 4AF6A 4OPOA 2VNIA 4A95A 3CDXA 4UFXA 4KOVA 5D29A 2G3AA 4NFRA 4Q38A 3HUVA 1BX1A 4R6TA 3QAYA 4XN3A 1BLIA 3MHPA 4NGNA 3WNBA 5BWAB 2ZL6A 1SQHA 4B13A 3TT2A 2V8HA 1R57A 5AG7A 4N3NA 2Q44A 5AG5A 4GQNA 2PVVA 1DG1G 4XNFA 1IOFA 2V7TA 1IIDA 4LX9A 3RYOA 3LACA 4NSQA 3KHZA 1Z8TA 5FL7A 3QSYA 5FA6A 1Y0RA 4MXUA 1XFOA 4CGLA 3S6HA 1M4GA 1V0CA 2GJPA 4J0QA 1E3ZA 3TO9A 4DYOA 3SXOA 4Z4RA 2RC4A 3KL9A 3EO4A 4MYTA 4P22A 2JDCA 4C68A 5THWA 2BV3A 5CDFA 1VQ5B 4U9ZA 4LQ6A 2ZW5A 2QN6A 4AVCA 4Y49C 3SLNA 5C82A 3IO1A 4BBHA 2WZNA 3ZZUA 1ZUNB 4KOXA 4CQJA 2LZJA 2JEVA 3F5BA 1VHSA 3VO2A 4XLAA 5EMIA 4K30A 3B8GA 3ZZTA 3GQBA 2Y0MA 3AVVA 4RDKA 4JXQA 4NBSA 2XEIA 3FB3A 2R98A 4IF5A 4U9YA 2CW5A 3W2IA 3ONUA 3S9MA 4OC1A 4KLVA 2WZPP 2ZW4A 1EWYA 4Y9UA 3W91A 3FJOA 3ASSA 3CMAB 4OMEA 4AXVA 3D68A 1S3ZA 4XN0A 1Z2LA 2Z3LA 4ORFA 4MRIA 3H8FA 1K4JA 4II2A 1KUYA 1S5KA 3KI9A 1MABA 2X85A 4RUHA 4FUUA 2OTLB 3JQRA 2PVWA 3PUMA 4X06A 4PV6A 2XEJA 2GREA 2B4DA 4EWTA 3PZJA 1ZG8A 1RO5A 4C7IA 3FEEA 4U5YA 4HNWB 1QSRA 4UBRA 1QQ9A 1Q2YA 3FBUA 2NYQA 1N0VC 5HXBA 1FRQA 3GLJA 3NH5A 3CC2B 1IYKA 5HZAA 3TO7A 3WYAA 4XLFA 2XGJA 4MFPA 1DDGA 1X10A 4K1XA 1HVXA 3P26A 4ZGQB 4UAJA 1NB0A 2YNDA 1UD8A 5BSXA 1B87A 5H59A 3WT4A 3VWDA 4OPSA 3OEHA 1YK3A 2ZEPA 2B7BA 1Z4EA 2O28A 3PBEA 4XD7A 5TY0A 1N08A 3QB8A 1PU9A 4CAXA 4MHDA 2OBRA 1E1QA 4OKOA 5TRDA 5IYQA 4CGOA 1PCAA 1NMTA 2AFXA 3TO6A 3IC1A 4TN1A 1R5OA 4R76A 2JDIA 1T6YA 3PA1A 1BLLE 1CP7A 4E0AA 2CC2A 4M85A 3N5FA 2CIJA 3TX8A 4CAFA 4B4DA 3ZBTA 3WQZA 2G9DA 1BMFA 2DXQA 1YR0A 1ELLP 4HPSA 1VQ9B 1CPSA 2PJ4A 3D4UA 4PPZA 3GKRA 1NSAA 3VATA 3PB7X 3DDYA 1YLEA 3WBJA 2OZGA 4F0YA 3BQJA 4R3LA 4MCSA 3ONYA 5F4OA 4FWTA 1TF8A 1F60A 4IUSA 2QVPA 5JPHA 4ZX9A 1VQ6B 2F1LA 1LRZA 1OHHA 3A8KA 4CYPA 4KKSA 3T90A 4XR6A 5J8FA 1ELOA 3WNDA 3DSBA 3G3SA 4MCQA 1QSTA 2JJ2A 2EO8A 4PAAA 3Q39A 4OOVA 1A8PA 5B6IA 1RQRA 2C6CA 3FECA 4Z1MA 4U9UA 2HCJB 4TT3A 1XEBA 2F8HA 1J4JA 1FY7A 1JA1A 2B5OA 1Z5RA 2EUIA 4WZEA 4DNRB 4X2TA 3FIXA 2XZPA 1H85A 4A39A 1DDIA 1R5BA 1PUAA 1VQ7B 2K5TA 3BHXA 2P6GA 1ZM9A 4LQGA 2D3LA 3ZIAA 2P6EA 3QFTA 3ASQA 1NDHA 2QGGA 1YIJB 2Z10A 3IGRA 3AVUA 2EVNA 4Z4YA 2PMDA 4Z4UA 2ZELA 5LRJA 4IAVA 5FIUA 5KW9A 1CBXA 3QAHA 1W0JA 2HMAA 1X12A 3F0AA 3FX6A 4XLCA 2Q7BA 1I18A 1QUFA 1UD2A 3WC7A 4RCYA 2BOAA 3U6BA 1N0UA 2VBTA 3PB4X 1TLLA 4XLHA 2BL1A 3OE7A 2YGWA 4Z4ZA 4ZCMA 5H5JA 2R9VA 4OP4A 4UFWA 2RC6A 4BINA 2YWHA 4HIZA 3IWWA 3OJWA 4LUAA 1EFRA 4B5PA 3OP1A 2VQYA 2ZPAA 3IWEA 2J8RA 3PFEA 4QUZA 2DETA 1B6BA 4WQMA 4JJXA 1QVFB 4G1BA 1UWYA 3L2NA 4XPLA 2X6WA 2O53A 3H5ZA 4YWYA 3OZWA 2X3UA 1D2EA 3G6EB 4X7CA 3I1UA 1CM0A 4B47A 3ASRA 2PE3A 4DK0A 2DPTA 2HC9A 3ZZ0A 3CCLB 5CBMA 2CBXA 5THXA 5HVGA 2EBJA 1MRZA 3DDDA 3IEHA 4CGNA 4CRYB 3T51B 4CAWA 4ONWA 3ISZA 2P6FA 4IK2A 1LOKA 1AMPA 4P44A 1TKFA 4M3SA 4L8JA 3BH4A 1M4DA 1T6ZA 2C27A 1H42A 2ZZGA 1S0UA 3TTHA 3PRTA 2Q4ZA 2Z11A 4KOYA 1N05A 1FRNA 2YWGA 4X05A 1EFTA 2NPFA 3R6JA 3JQQA 4TSFA 4A33A 4NGTA 4TWEA 4IHMA 4UZEA 1KK2A 3GIRA 2OH1A 1YX2A 2PJ0A 2PJ5A 2YNCC 3SJGA 3DR6A 1KK3A 2J7KA 2DERA 2AFMA 2HQYA 1YITB 4RD2A 2Z3MA 2PJ8A 2ZEEA 1MJBA 5ELYA 1H8LA 2VNJA 2IMOA 5C88A 4G6IA 1Y7RA 3SHPA 5FO0A 1PKVA 2V8DA 3QNVA 1VQPB 3FPPA 3NFZA 4TNUA 1ELMP 1QFJA 1IJFA 1M1KD 1NSLA 4KSFA 3RO0A 1KTVA 2W6IA 1EE3P 4UZUA 4TMTA 2PDOA 5K8NA 2E1BA 2V7QA 4LBWA 3VH9A 4QVJA 3IIBA 3VR6A 4MY0A 4B12A 1PJ7A 2QYVA 3CP8A 2C4UA 4LBVA 2VYQA 1W35A 2FCKA 4PC3A 1BJKA 4RCZA 2C6PA 1QMUA 2Q6LA 5J8CA 2B7CA 1IB0A 3QE2A 4P10A 3OZVA 1QUEA 2VJJA 2XNCA 2XOKA 3RBUA 3I9SA 3ZBUA 1VF7A 3FXTA 4II9A 1FDRA 1CJWA 1VIXA 2Z3KA 2OBSA 3GVJA 3TOAA 4KVOE 2FE7A 1OZPA 2M5SA 1QG0A 2OZUA 2VL1A 3OEEA 3PFOA 2OYNA 4N3GA 4ACAA 3B2YA 4C2YA 2QE7A 4RD4A 2AFZA 4AG7A 1YJNB 1WOSA 2PQ8A 2V7UA 2JDDA 2QMLA 4ONUA 4IW3B 3NH4A 3CTAA 1FNCA 3KHXA 2ZTGA 4UIAA 3WABA 2GLJA 4UWIA 1K28D 1TKJA 4DJLA 2WJVA 3ZPNA 4CAEA 1XB2A 4QFMA 3W2EA 2I3CA 1NRKA 2BUEA 3LWUA 5HXDA 4WWVA 2ZXVA 2QDXA 4NGRA 5F48A 4XKWA 1NBMA 2OR4A 3OPOA 2EK9A 3B3TA 4XKVA 4NGSA 3A1PA 3D7FA 3ES9A 4MY3A 2VXKA 4B48A 2D3NA 4BD9A 1E3XA 1KK1A 1W2BB 4ASUA 3CCEB 1YREA 1GAQA 4Z4WA 2G3TA 4JWPA 4A32A 4B3XA 1VQKB 2PIYA 2PRBA 1P4MA 3W2HA 5HVHA 4LBZA 1M4IA 3A9LA 2A4NA 2DYIA 3FKSA 5IK2A 4NNJA 4ACBA 4P12A 1KUVA 2EK8A 2POKA 3GVLA 2FX3A 4JYWA 1FNOA 3CMEB 2XZOA 2HUZA 3B8HA 4NEXA 4KOTA 1K9MD 3PB9X 1W9XA 1Q86D 3AVYA 2F1MA 1TIQA 1MJ9A 1ZG9A 4Z4SA 4ZYQA 3D7HA 4UF4A 4M0LA 2Q7SA 3G4SB 2O4HA 4NGPA 2E1RA 2DF5A 1S7NA 3OAAA 1WU8A 4CAVA 3CZXA 3S6KA 4P26A 3DR8A 4M2LA 1FNDA 4ZCIA 3SJPA 1JA0A 2XEFA 2J9AA 4KSAA 3CC4B 1ON0A 5JBQA 1R43A 4KS9A 2I1LA 2JBKA 4JLYA 5DS0A 1JJ2B 5F4JA 4R3KA 3C26A 4MI4A 3AVWA 2IJZA 2CNDA 4EVYA 2Z0ZA 3SI0A 3SI2A 4E8OA 1KK0A 1VLOA 4YEJA 2XNJA 1A2ZA 5BSYA 3J81k 3OW7A 4B10A 1QVGB 2YWFA 3DGVA 1U6MA 2GJKA 4MHNA 1WOPA 3CXPA 1N06A 2VZLA 6CPAA 1QGYA 1P4NA 2OBTA 4XPKA 3BLNA 4CRZB 4C43A 3NA6A 2AE6A 5EBVA 3LD2A 1CQXA 5FNZA 2OB0A 4YU9A 2ZBUA 1DARA 4KOUA 1Y0YA 4OP7A 4MBUA 1OGJA 1ZM4A 2GIVA 2V4DA 2F5IA 2PJBA 2B3VA 1AIPA 2NMTA 5TR9A 3V7AA 3JU4A 4PC2A 3WXMA 4YAFA 1AMOA 4WZTA 4P9SA 4RD6A 3EFAA 1U2RA 1F57A 5FVJA 4TMVA 3SKBA 1YJ9B 2X6YA 3JTKA 1HZEA 2DPSA 4O23A 3W6XA 1TTTA 5IB9A 4UZFA 3FMCA 5J35A 5I0CA 1Q7LA 1W0KA 1F20A 2QMUA 2AFOA 3LMSA 4KORA 5K8PA 4YAUA 2P0WA 2GFQA 2DEUA 2VZYA 4ZY1A 3Q6QA 1V0EA 4PABA 4OLLA 1E1RA 5F47A 4MFKA 2ZZFA 1WOOA 4ROXA 2XZLA 4QHYA 1P0HA 5G22A 4NGMA 2ZEDA 3D67A 4Y7CA 2PIAA 4QC6A 2EFGA
chains in the Genus database with same CATH topology
2F7VA 4PXCA 2EWBA 2OOTA 5LYDA 2Q43A 2PJCA 3FEDA 3PFEA 3IFEA 4UEEA 4ZY0A 4JZ0A 4P4EA 3B3VA 1UWYA 2PJ3A 3L2NA 1XMBA 2O53A 4YWYA 1XRYA 1OBRA 1JQGA 3RAMA 4P4DA 3CT9A 1F2OA 3I1UA 2ZEOA 2PE3A 2HC9A 5CBMA 3B3WA 5HVGA 2ZEHA 2ZEMA 2PJ7A 3IEHA 1YLOA 1ZLHA 4OIDA 3SJFA 3BI0A 1IGBA 4ONWA 3ISZA 2ABZA 4IK2A 1LOKA 3D66A 1AMPA 4P44A 1TKFA 3SJXA 2XEGA 4OC3A 3D7DA 2BO9A 4F9UA 3RZAA 1ZG7A 2GLFA 3PRTA 2Q4ZA 2CTCA 5JH9A 1XBUA 5HVFA 1ZLIA 4OC5A 2WYRA 4NGTA 4TWEA 4IHMA 2IQ6A 4P6YA 2PJ0A 2PJ5A 3SJGA 2DEAA 4B6ZA 3CDXA 2QJ8A 3B7IA 2AFMA 5D29A 4W9YA 1VHEA 5LYFA 1TKHA 3CPXA 4NFRA 2PJ8A 2ZEEA 2C6GA 3PBBA 5ELYA 2C1CA 1H8LA 3KR5A 3ISXA 3HUVA 1CX8A 2BCOA 2IMOA 3V7ZA 4R6TA 3PB6X 4OIWA 2V8DA 3QNVA 3FVLA 3NFZA 4NGNA 4TNUA 4ZY2A 1ELMP 2V8HA 1AYEA 5JGFA 4OC0A 3T8WA 1EE3P 2CF4A 4H2KA 1CPXA 4GM5A 5K8NA 1VHOA 3VH9A 4K3NA 4MCRA 3IIBA 4MMOA 3S9LA 2PVVA 2PRQA 3GUXA 2QYVA 1TXRA 1RTQA 1XJOA 3WC6A 2V8GA 4F9VA 3KHZA 4F8ZA 4EMEA 1Y0RA 3B3CA 1XFOA 4MXUA 2C6PA 4CPAA 1QMUA 4MCPA 4DYOA 3K2KA 4P10A 7CPAA 3CPAA 3KL9A 2PJ1A 5THWA 3RBUA 4R8FA 1VIXA 1R3NA 2FVGA 3IO1A 2WZNA 1ARMA 1VGYA 4PXBA 2PJ2A 2ZEGA 3H8GA 2VL1A 3PFOA 3WC5A 3B2YA 4NJRA 4R7MA 1M4LA 2AFZA 3HLPA 5JM6A 2XEIA 4DUKA 3NH4A 3S9MA 4OC1A 3KHXA 4OMEA 2ZENA 4UIAA 2GLJA 3WABA 4AXVA 3D68A 1TKJA 4DJLA 1Z2LA 8CPAA 3IJ3A 1LAPA 4MRIA 3H8FA 1DE4C 3GB0A 3KI9A 2I3CA 2PIZA 3LWUA 5HXDA 4RUHA 4WWVA 4FUUA 1YSJA 4NGRA 3MN8A 3NH8A 2PVWA 1ARLA 1LFWA 2OR4A 4UEFA 2XEJA 2ZEFA 2GREA 2EK9A 3B3TA 4NGSA 4EWTA 3D7FA 1ZG8A 2ZOFA 4BD9A 3FEEA 4A37A 4PXDA 1F2PA 1QQ9A 2PIYA 3FF3A 2NYQA 3K9TA 5HVHA 3GLJA 3NH5A 4MHPA 4P4JA 1LAMA 2EK8A 2POKA 4NJQA 4FAIA 1TF9A 4JYWA 1FNOA 5LYIA 4EFDA 5F09A 3WT4A 3PB9X 2AFSA 3KGQA 2ZEPA 3PBEA 3D7GA 5D8NA 3SJEA 1ZG9A 4P4FA 4ZYQA 3D7HA 4UF4A 2PJAA 4Z65A 4NGQA 2O4HA 4NGPA 4OKOA 4FBEA 1PCAA 2AFXA 5I4MA 1LCPA 3IC1A 4R76A 4ZX8A 3PEIA 3FH4A 3KASA 1BLLE 1CP7A 1BPMA 4MHZA 3N5FA 2CIJA 3TX8A 2XEFA 2J9AA 3S9NA 4X8IA 3TC8A 2V8VA 2PJ9A 5K8OA 2G9DA 2V77A 2PJ6A 1R43A 2RB7A 1HDQA 4P45A 3KR4A 4WJBA 1ELLP 3B35A 2JBKA 5K8MA 5DS0A 2Q51A 2RFHA 1CPSA 3KZWA 3FJUA 2PJ4A 4A38A 3D4UA 2IJZA 2AFWA 4PPZA 2JEWA 1NSAA 3VATA 3PB7X 4ZI6A 1DTDA 3SI0A 3SI2A 1HEEA 4P4BA 5CPAA 4KSIA 3B3SA 4MCSA 4PQAA 4P4IA 3H8EA 1TF8A 2QVPA 1KWMA 3DGVA 3BI1A 3KQXA 4OC4A 4ZX9A 4MHNA 2JBJA 6CPAA 2GU2A 2NSMA 3SI1A 1GYTA 3NA6A 1CP6A 4MCQA 1FT7A 4YU9A 5LYLA 1Y0YA 2ANPA 2ZOGA 2C6CA 3FECA 4FWUA 2F8HA 4A94A 1Z5RA 4X2TA 1YW4A 2PJBA 4MHYA 5LRGA 4A39A 3VARA 1Y7EA 1CG2A 1PYTB 3BHXA 4LQGA 1LANA 2AFUA 3KQZA 4PXEA 1F57A 4UEZA 4UIBA 3JRUA 4O23A 5LRKA 5J1QA 1YW6A 2ZELA 4X3RA 5LRJA 4OC2A 5IB9A 2HB6A 3FMCA 4IAVA 1Q7LA 3PB8X 1CBXA 2AFOA 3LMSA 5K8PA 3FX6A 1BPNA 3MRUA 1YMEA 4ZY1A 3WC7A 2BOAA 1HDUA 3BXMA 3PB4X 4G1PA 2CTBA 4Q7AA 2PCUA 4OP4A 3V38A 1Z8LA 3DLJA 4NGMA 2ZEDA 3D67A 1BAVA 1IY7A 3IWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F7V A;  4PXC A;  2EWB A;  2OOT A;  5LYD A;  2Q43 A;  2PJC A;  3FED A;  3PFE A;  3IFE A;  4UEE A;  4ZY0 A;  4JZ0 A;  4P4E A;  3B3V A;  1UWY A;  2PJ3 A;  3L2N A;  1XMB A;  2O53 A;  4YWY A;  1XRY A;  1OBR A;  1JQG A;  3RAM A;  4P4D A;  3CT9 A;  1F2O A;  3I1U A;  2ZEO A;  2PE3 A;  2HC9 A;  5CBM A;  3B3W A;  5HVG A;  2ZEH A;  2ZEM A;  2PJ7 A;  3IEH A;  1YLO A;  1ZLH A;  4OID A;  3SJF A;  3BI0 A;  1IGB A;  4ONW A;  3ISZ A;  2ABZ A;  4IK2 A;  1LOK A;  3D66 A;  1AMP A;  4P44 A;  1TKF A;  3SJX A;  2XEG A;  4OC3 A;  3D7D A;  2BO9 A;  4F9U A;  3RZA A;  1ZG7 A;  2GLF A;  3PRT A;  2Q4Z A;  2CTC A;  5JH9 A;  1XBU A;  5HVF A;  1ZLI A;  4OC5 A;  2WYR A;  4NGT A;  4TWE A;  4IHM A;  2IQ6 A;  4P6Y A;  2PJ0 A;  2PJ5 A;  3SJG A;  2DEA A;  4B6Z A;  3CDX A;  2QJ8 A;  3B7I A;  2AFM A;  5D29 A;  4W9Y A;  1VHE A;  5LYF A;  1TKH A;  3CPX A;  4NFR A;  2PJ8 A;  2ZEE A;  2C6G A;  3PBB A;  5ELY A;  2C1C A;  1H8L A;  3KR5 A;  3ISX A;  3HUV A;  1CX8 A;  2BCO A;  2IMO A;  3V7Z A;  4R6T A;  3PB6 X;  4OIW A;  2V8D A;  3QNV A;  3FVL A;  3NFZ A;  4NGN A;  4TNU A;  4ZY2 A;  1ELM P;  2V8H A;  1AYE A;  5JGF A;  4OC0 A;  3T8W A;  1EE3 P;  2CF4 A;  4H2K A;  1CPX A;  4GM5 A;  5K8N A;  1VHO A;  3VH9 A;  4K3N A;  4MCR A;  3IIB A;  4MMO A;  3S9L A;  2PVV A;  2PRQ A;  3GUX A;  2QYV A;  1TXR A;  1RTQ A;  1XJO A;  3WC6 A;  2V8G A;  4F9V A;  3KHZ A;  4F8Z A;  4EME A;  1Y0R A;  3B3C A;  1XFO A;  4MXU A;  2C6P A;  4CPA A;  1QMU A;  4MCP A;  4DYO A;  3K2K A;  4P10 A;  7CPA A;  3CPA A;  3KL9 A;  2PJ1 A;  5THW A;  3RBU A;  4R8F A;  1VIX A;  1R3N A;  2FVG A;  3IO1 A;  2WZN A;  1ARM A;  1VGY A;  4PXB A;  2PJ2 A;  2ZEG A;  3H8G A;  2VL1 A;  3PFO A;  3WC5 A;  3B2Y A;  4NJR A;  4R7M A;  1M4L A;  2AFZ A;  3HLP A;  5JM6 A;  2XEI A;  4DUK A;  3NH4 A;  3S9M A;  4OC1 A;  3KHX A;  4OME A;  2ZEN A;  4UIA A;  2GLJ A;  3WAB A;  4AXV A;  3D68 A;  1TKJ A;  4DJL A;  1Z2L A;  8CPA A;  3IJ3 A;  1LAP A;  4MRI A;  3H8F A;  1DE4 C;  3GB0 A;  3KI9 A;  2I3C A;  2PIZ A;  3LWU A;  5HXD A;  4RUH A;  4WWV A;  4FUU A;  1YSJ A;  4NGR A;  3MN8 A;  3NH8 A;  2PVW A;  1ARL A;  1LFW A;  2OR4 A;  4UEF A;  2XEJ A;  2ZEF A;  2GRE A;  2EK9 A;  3B3T A;  4NGS A;  4EWT A;  3D7F A;  1ZG8 A;  2ZOF A;  4BD9 A;  3FEE A;  4A37 A;  4PXD A;  1F2P A;  1QQ9 A;  2PIY A;  3FF3 A;  2NYQ A;  3K9T A;  5HVH A;  3GLJ A;  3NH5 A;  4MHP A;  4P4J A;  1LAM A;  2EK8 A;  2POK A;  4NJQ A;  4FAI A;  1TF9 A;  4JYW A;  1FNO A;  5LYI A;  4EFD A;  5F09 A;  3WT4 A;  3PB9 X;  2AFS A;  3KGQ A;  2ZEP A;  3PBE A;  3D7G A;  5D8N A;  3SJE A;  1ZG9 A;  4P4F A;  4ZYQ A;  3D7H A;  4UF4 A;  2PJA A;  4Z65 A;  4NGQ A;  2O4H A;  4NGP A;  4OKO A;  4FBE A;  1PCA A;  2AFX A;  5I4M A;  1LCP A;  3IC1 A;  4R76 A;  4ZX8 A;  3PEI A;  3FH4 A;  3KAS A;  1BLL E;  1CP7 A;  1BPM A;  4MHZ A;  3N5F A;  2CIJ A;  3TX8 A;  2XEF A;  2J9A A;  3S9N A;  4X8I A;  3TC8 A;  2V8V A;  2PJ9 A;  5K8O A;  2G9D A;  2V77 A;  2PJ6 A;  1R43 A;  2RB7 A;  1HDQ A;  4P45 A;  3KR4 A;  4WJB A;  1ELL P;  3B35 A;  2JBK A;  5K8M A;  5DS0 A;  2Q51 A;  2RFH A;  1CPS A;  3KZW A;  3FJU A;  2PJ4 A;  4A38 A;  3D4U A;  2IJZ A;  2AFW A;  4PPZ A;  2JEW A;  1NSA A;  3VAT A;  3PB7 X;  4ZI6 A;  1DTD A;  3SI0 A;  3SI2 A;  1HEE A;  4P4B A;  5CPA A;  4KSI A;  3B3S A;  4MCS A;  4PQA A;  4P4I A;  3H8E A;  1TF8 A;  2QVP A;  1KWM A;  3DGV A;  3BI1 A;  3KQX A;  4OC4 A;  4ZX9 A;  4MHN A;  2JBJ A;  6CPA A;  2GU2 A;  2NSM A;  3SI1 A;  1GYT A;  3NA6 A;  1CP6 A;  4MCQ A;  1FT7 A;  4YU9 A;  5LYL A;  1Y0Y A;  2ANP A;  2ZOG A;  2C6C A;  3FEC A;  4FWU A;  2F8H A;  4A94 A;  1Z5R A;  4X2T A;  1YW4 A;  2PJB A;  4MHY A;  5LRG A;  4A39 A;  3VAR A;  1Y7E A;  1CG2 A;  1PYT B;  3BHX A;  4LQG A;  1LAN A;  2AFU A;  3KQZ A;  4PXE A;  1F57 A;  4UEZ A;  4UIB A;  3JRU A;  4O23 A;  5LRK A;  5J1Q A;  1YW6 A;  2ZEL A;  4X3R A;  5LRJ A;  4OC2 A;  5IB9 A;  2HB6 A;  3FMC A;  4IAV A;  1Q7L A;  3PB8 X;  1CBX A;  2AFO A;  3LMS A;  5K8P A;  3FX6 A;  1BPN A;  3MRU A;  1YME A;  4ZY1 A;  3WC7 A;  2BOA A;  1HDU A;  3BXM A;  3PB4 X;  4G1P A;  2CTB A;  4Q7A A;  2PCU A;  4OP4 A;  3V38 A;  1Z8L A;  3DLJ A;  4NGM A;  2ZED A;  3D67 A;  1BAV A;  1IY7 A;  3IWW A; 
#chains in the Genus database with same CATH topology
 4R71 A;  1R5N A;  4PXC A;  1COW A;  1W34 A;  2Q43 A;  2PJC A;  5AN9 A;  3PGP A;  4RD0 A;  3IFE A;  4R87 A;  4ZY0 A;  4RM0 A;  4JZ0 A;  2D4P A;  4KUB A;  5A88 A;  4YAW A;  2PJ3 A;  5KTA A;  1OBR A;  2ZW7 A;  3P27 A;  3G71 B;  3P2F A;  3RAM A;  4QUS A;  4HE5 A;  2OK8 A;  1F2O A;  2ZEO A;  1QGZ A;  4QB9 A;  2GK7 A;  2D74 A;  2ZEM A;  1VQM B;  5LMZ A;  4MFQ A;  4CGP A;  2PJ7 A;  3SJF A;  3B78 A;  4OID A;  1WSR A;  3CXQ A;  2WPX A;  2DY1 A;  4FD7 A;  4OOS A;  3VO1 A;  3PEN A;  2ZZQ A;  5IV0 A;  3D7D A;  4F9U A;  5KTC A;  5IB0 A;  1ZG7 A;  3U6K A;  2ZL5 A;  4XL9 A;  4KOS A;  2QA4 B;  2OK7 A;  2B4D B;  2CTC A;  1YJW B;  4MJ8 A;  5CNP A;  4G7W A;  2D9R A;  2BMW A;  3VNU A;  3I56 B;  4P6Y A;  2VBU A;  2DEA A;  4B6Z A;  1Q2C A;  4XPD C;  1WP6 A;  3B7I A;  1S7F A;  3S6G A;  3VMF A;  4W9Y A;  1VHE A;  2B4B A;  3GSI A;  5LYF A;  1TKH A;  2C6G A;  1S7K A;  3KR5 A;  2BPO A;  1CX8 A;  1Y9K A;  2BCO A;  2X6X A;  4MYU A;  3PB6 X;  4OIW A;  1I1D A;  3GYA A;  3FVL A;  1E79 A;  4A31 A;  1Y9W A;  3I55 B;  1AYE A;  4XQF A;  3T8W A;  2BVN A;  2CF4 A;  1K73 D;  4H2K A;  1CPX A;  3LNN A;  1VHO A;  3CCJ B;  1KQS B;  4MCR A;  4M6H A;  4UCN A;  1QSO A;  2OZH A;  1G7T A;  3GUX A;  3TFY A;  2Z3P A;  1TXR A;  1XJO A;  3WC6 A;  2CY2 A;  4FK8 A;  4F9V A;  4RN7 A;  1XMT A;  1OB0 A;  4OAE A;  2VZZ A;  2G0B A;  2DOG A;  4CPA A;  4RDJ A;  4MCP A;  4ZCL A;  4WZK A;  1IOI A;  3CPA A;  2PJ1 A;  3A3B A;  2YNE A;  4DNC A;  2JIZ A;  4ZGY B;  2JN9 A;  5E6T A;  4QVA A;  1R3N A;  2FVG A;  3Q6R A;  1QFY A;  5F46 A;  1VGY A;  4PXB A;  2GE3 A;  4UWJ A;  4LC0 A;  3CC7 B;  1IYL A;  5FO1 A;  1EP1 B;  2Q0Y A;  1S7L A;  4NJR A;  1KC8 D;  4R7M A;  3CCM B;  4RPB A;  3HLP A;  5JM6 A;  4DUK A;  5A89 A;  3QFS A;  3MCA A;  4P6V F;  2ZEN A;  3E20 A;  1Q82 D;  1LAP A;  1TUI A;  1VJS A;  5E96 A;  2PR1 A;  3R1K A;  3GB0 A;  4QV2 A;  5HMN A;  3ZJ0 A;  2PIZ A;  1QSM A;  4CGM A;  5G20 A;  3CXC B;  3MN8 A;  4PC7 A;  3NH8 A;  1LFW A;  4UEF A;  2ZEF A;  2R7H A;  3SLD A;  4B3F X;  3ZUG A;  4UCP A;  1BQE A;  1UFH A;  3SJZ A;  1YQE A;  1Q7Y D;  4PXD A;  1F2P A;  4CS0 B;  3FF3 A;  2BN4 A;  4MHP A;  4RDL A;  1BO4 A;  4KKT A;  4NJQ A;  4FAI A;  4RLZ A;  3TOB A;  4FN5 A;  4RPD A;  5LYI A;  4EFD A;  4C2Z A;  2FXF A;  5F09 A;  3CD6 B;  1BPL A;  4OPV A;  1SM4 A;  5IX3 A;  1CNF A;  2BM0 A;  4XOR A;  1NJI D;  3PUN A;  5KTD A;  4C0S A;  3KGQ A;  3D7G A;  1E63 A;  3TE4 A;  2QIR A;  2KCW A;  4P4F A;  2X53 S;  1UMK A;  2CRV A;  1WK4 A;  3E1Y E;  4MFZ A;  2PJA A;  4ZBG A;  3LOD A;  1GVH A;  4M4S A;  4FBE A;  3EC4 A;  1D1N A;  3U2Q A;  5IYP A;  4XNH B;  1AUG A;  1J9Z A;  2ZXI A;  3A35 A;  1CNE A;  1LCP A;  4QBJ A;  3FNC A;  1SKQ A;  4ZX8 A;  1BPM A;  2DCU A;  2CNM A;  4FD5 A;  2QEX B;  4I49 A;  1S4M A;  4PK3 A;  3S9N A;  3OKX A;  1YHQ B;  4P3Y A;  3BCF A;  2PJ9 A;  2V8V A;  2V77 A;  2PJ6 A;  4B14 A;  2RB7 A;  1V5V A;  4P45 A;  3KR4 A;  4WJB A;  5K8M A;  1EXM A;  3K9U A;  2Q51 A;  2RFH A;  2Q6O A;  2CXA A;  3TCV A;  3OOC A;  3FJU A;  4H6U A;  2V7X A;  2HV2 A;  4M6G A;  2JEW A;  2CK3 A;  3BNW A;  3ASP A;  1S72 B;  1XOV A;  4CYO A;  1HEE A;  1JNY A;  4P4B A;  1I7P A;  4KSI A;  2Z3O A;  1GJR A;  4HNX B;  4P4I A;  3D8P A;  3IWG A;  3H8E A;  1QFZ A;  4LBY A;  1I21 A;  2Q6I A;  1KWM A;  4KVM E;  3KQX A;  1G7C A;  1BOB A;  2JBJ A;  2GU2 A;  1B2R A;  3SI1 A;  1WDT A;  3W5U A;  4FD4 A;  1GYT A;  3GIU A;  1XE4 A;  4NCN A;  2WPD A;  5AG4 A;  4H6Z A;  4NCZ A;  1IIC A;  2ANP A;  2ZXH A;  4FWU A;  2R1I A;  1QH0 A;  4DQL A;  3R9F A;  1GO2 A;  2C5H A;  5F49 A;  3BJ7 A;  2GK6 A;  4RD1 A;  2C78 A;  1VQ4 B;  4MHY A;  1MK4 A;  1Y7E A;  2ZTN A;  3SEJ A;  4Z4V A;  1Z8X A;  3KQZ A;  2J8N A;  4PXE A;  1KD1 D;  3QFR A;  5AGE A;  4XOP A;  1N8R D;  3JRU A;  5J1Q A;  5LRK A;  4OC2 A;  1S60 A;  1UD5 A;  3T56 B;  4JXR A;  4GXH A;  1VQ8 B;  1BPN A;  3MRU A;  3D2M A;  5EMN A;  4E0F A;  3GVK A;  3T53 B;  1E62 A;  1IHM A;  2WSS A;  3MGD A;  2J8M A;  1VLY A;  2CNT A;  1I12 A;  1WOR A;  2V31 A;  4UFV A;  2PCU A;  5GV8 A;  2ODF A;  4XM3 A;  1QGA A;  1Z8L A;  2FS5 A;  3DLJ A;  4YEL A;  4P1V A;  2BEI A;  5F4M A;  3LO8 A;  5IYW A;  4TMZ A;  5H86 A;  2F7V A;  1HA3 A;  1KZF A;  2OOT A;  1GAW A;  3WBK A;  5LYD A;  2B58 A;  2VEZ A;  2EIX A;  2JLM A;  4KLW A;  1MJA A;  4UEE A;  4UCM A;  4DK1 A;  3W2G A;  4PC6 A;  3CW2 A;  3B3V A;  1XMB A;  1XRY A;  5IYN A;  3R9E A;  4P4D A;  3CT9 A;  1N07 A;  1WWZ A;  3V76 A;  4H89 A;  5DSZ A;  3B3W A;  2WR8 A;  1SKY B;  3OFN A;  1ZLH A;  4F6A A;  1FNM A;  4M6I A;  2REF A;  3N7Z A;  3A3G A;  4HNY B;  4PSX A;  2VBV A;  4H9G A;  4X7F A;  4XON A;  4OC3 A;  1EFU A;  4AVB A;  3UY5 A;  1EP2 B;  5KSW B;  3RZA A;  1QSN A;  3PA2 A;  2GLF A;  5DWM A;  3LQ6 A;  2NV4 A;  1VKC A;  2OTJ B;  1KMH A;  4GS4 A;  4TKO B;  3AVX A;  1WPC A;  1XBU A;  5L46 A;  4KVX A;  4OC5 A;  2AHO A;  3H9N A;  2IQ6 A;  5H84 A;  4UA3 A;  4P25 A;  3NE5 B;  3PP9 A;  5DWN A;  2QJ8 A;  3ZC3 A;  3G8W A;  4Q7J B;  4HE6 A;  5GCN A;  2VBQ A;  2FIA A;  3CPX A;  3FRM A;  3CP2 A;  3PBB A;  2C1C A;  3ISX A;  4WZL A;  3V7Z A;  4C7H A;  4CYN A;  5TV2 A;  3AVT A;  3LQE A;  4RJL A;  4ZY2 A;  3VNV A;  4JMQ A;  3CMM A;  3B82 A;  2Q6K A;  5JGF A;  2VBS A;  4OC0 A;  2P3M A;  1XIX A;  4GM5 A;  3V8I A;  3JQP A;  4K3N A;  4MMO A;  3H94 A;  3S9L A;  4AG9 A;  2PRQ A;  4Y9R A;  2ZBV A;  1M44 A;  3EXN A;  1RTQ A;  2V8G A;  2HDN B;  3CPW B;  3OZU A;  1FX0 A;  3IU2 A;  4F8Z A;  3E0K A;  4EME A;  3W2F A;  3BCD A;  3B3C A;  5JQ4 A;  3SXN A;  1VQL B;  4R57 A;  2GQF A;  3K2K A;  7CPA A;  1YX0 A;  2CNS A;  4YGO A;  4R8F A;  3VWE A;  4YAL A;  1K8A D;  1T6X A;  1YVO A;  1IU8 A;  1ARM A;  4M1K A;  1ZM3 A;  2PJ2 A;  2ZEG A;  3H8G A;  4FXU A;  3WC5 A;  4G1V A;  1Q9S A;  5IYR A;  4B3G A;  1E64 A;  2ZIT A;  4X7D A;  1YI2 B;  2BF4 A;  1BX0 A;  1M4L A;  5G21 A;  2W6J A;  4AF7 A;  1UD6 A;  2GJR A;  1GR1 A;  1T5E A;  2Q4Y A;  3WY9 A;  1WSV A;  1XE1 A;  1ZO0 A;  8CPA A;  3P2H A;  3IJ3 A;  2Q04 A;  3BY1 A;  2VNK A;  4A2Z A;  1OB5 A;  2C2W A;  1DE4 C;  2WUU A;  1QX4 A;  4P3I A;  3JUW A;  3HAG A;  1XQB A;  1G7R A;  3CCR B;  4OOX A;  5GV7 A;  1YSJ A;  4E2A A;  1ARL A;  4II3 A;  4M53 A;  1UD4 A;  4PK2 A;  2QTZ A;  4KZT A;  2ZOF A;  3Q38 A;  4YFJ A;  1NB9 A;  1D8T A;  4RD3 A;  4A37 A;  2QEC A;  3CCS B;  2R6H A;  3AST A;  3BY2 A;  4B11 A;  3D26 A;  2XND A;  2AJ6 A;  4AC9 A;  3K9T A;  3W5V A;  4P4J A;  1LAM A;  2VI7 A;  5A28 A;  1TF9 A;  3JVN A;  3CCQ B;  1L0C A;  2R8V A;  4XNH C;  1B23 P;  1IB1 E;  1VQO B;  3I3G A;  1VQN B;  1V0F A;  1RQP A;  2AFS A;  2JJ1 A;  2WJY A;  5D8N A;  3SJE A;  3Q3A A;  4X07 A;  4X7E A;  1I8D A;  4NF1 A;  4Z65 A;  2YWE A;  2IL4 A;  1YGH A;  4NGQ A;  2X8K A;  4J3G A;  3CCU B;  4F0X A;  5I4M A;  3CES A;  4G7X A;  2BSW A;  3W6S A;  4XMY A;  4YHB A;  4QVT A;  3FH4 A;  3PEI A;  3KAS A;  1PJ5 A;  1Z4R A;  1H8H A;  2BGJ A;  4MHZ A;  4XOT A;  3DNS A;  5HZB A;  3R95 A;  5ISV A;  3NE8 A;  3A8I A;  4AVA A;  4X8I A;  3TC8 A;  3NE7 A;  2WSA A;  1ZM2 A;  4YXW A;  3OWC A;  4NXY A;  4Y49 B;  5K8O A;  3LVB A;  2C4T A;  3R9G A;  4B44 A;  5DN6 A;  1HDQ A;  5A27 A;  3WNC A;  3B35 A;  3R96 A;  2OU2 A;  4X0C A;  3KZW A;  2ATR A;  4A38 A;  4XPD B;  3W5H A;  2AFW A;  2ZW6 A;  4ZI6 A;  1DTD A;  4RS2 A;  1JB9 A;  2PR8 A;  1OGI A;  5CPA A;  1E43 A;  2X0K A;  3B3S A;  2FT0 A;  4PQA A;  1KZL A;  1G7S A;  5HKK A;  1OB2 A;  1H8E A;  4KOW A;  1WTH D;  4F7D A;  3BI1 A;  4OC4 A;  4BMH A;  3D3S A;  4MFJ A;  4YRH A;  1EFC A;  2NSM A;  1FNB A;  3BJ8 A;  3CCV B;  1TVC A;  1CP6 A;  2Q4V A;  2ZZE A;  1N71 A;  2DIE A;  5AG6 A;  3FYN A;  1FT7 A;  4AB7 A;  5LYL A;  1W87 A;  2YNC A;  4L89 A;  2ZOG A;  3S6F A;  2Z3N A;  4RI1 A;  3ZZI A;  1PJ6 A;  4A94 A;  1IJE A;  4XLE A;  1YW4 A;  2D4O A;  3WR7 A;  3KKW A;  3AGQ A;  5LRG A;  3VAR A;  1CG2 A;  1PYT B;  3CB4 A;  4KKU A;  2RC5 A;  3QFC A;  4TMX A;  3T9Y A;  2KVO A;  4YAO A;  1LAN A;  2AFU A;  2GPJ A;  3R6K A;  4KUA A;  2PC1 A;  3OW2 B;  4Q36 A;  2F43 A;  4UEZ A;  2PLF A;  3BC9 A;  4UIB A;  3PVD A;  1YW6 A;  4X3R A;  2HB6 A;  3I1F A;  3PB8 X;  3KEW A;  1YVK A;  2XEX A;  4DNT B;  1YME A;  3CRZ A;  2C5B A;  1Q2D A;  4TMW A;  4Z4T A;  3EY5 A;  1XF8 A;  1HDU A;  2V7W A;  2ZL7 A;  3BXM A;  4G1P A;  4L8A A;  2FL4 A;  4PSW A;  2CTB A;  4Q7A A;  4PC1 A;  3FPK A;  1KJZ A;  4P2N A;  4EH1 A;  1UD3 A;  3V38 A;  1KUX A;  2B5G A;  1Z9U A;  2VJI A;  1NE9 A;  3GY9 A;  2FSR A;  2QTL A;  1EP3 B;  2F4N A;  1BAV A;  1IY7 A;  2V7V A;  4B5O A;  3RY8 A;  1Q81 D;  4MFL A;  2EWB A;  5J3O A;  2I00 A;  3RNZ A;  2BSA A;  2X7B A;  3FED A;  4PGO A;  4HKF A;  4B43 A;  2GAN A;  1M1D A;  3IU1 A;  2HLD A;  4JD6 A;  5A8A A;  1Z8W A;  4P4E A;  1KRH A;  2I79 A;  3H4Q A;  4C2X A;  4AVZ A;  3OJX A;  1JQG A;  2BGI A;  5G1Z A;  2FIW A;  1M90 D;  4R9M A;  3CXS A;  2Z6B D;  4G5G A;  3D2P A;  3F8K A;  2BM1 A;  1GHE A;  4CYQ A;  2ZEH A;  2B5G B;  1YLO A;  4OAD A;  3BI0 A;  4A30 A;  3MMP A;  1IGB A;  4X5K A;  2ABZ A;  1RXT A;  3A8J A;  2B3U A;  3D66 A;  3SJX A;  3G05 A;  4ZGN B;  2XEG A;  5HH1 A;  4DQK A;  2BO9 A;  2PSW A;  5EC4 A;  2H5M A;  2VNH A;  2REE A;  2ARH A;  1JWQ A;  3AGP A;  4B5P B;  5JH9 A;  5HVF A;  2C77 A;  5KNL A;  1ZLI A;  4ZV4 A;  4BPR A;  2WYR A;  4FD6 A;  2WPW A;  4AF6 A;  4OPO A;  2VNI A;  4A95 A;  3CDX A;  4UFX A;  4KOV A;  5D29 A;  2G3A A;  4NFR A;  4Q38 A;  3HUV A;  1BX1 A;  4R6T A;  3QAY A;  4XN3 A;  1BLI A;  3MHP A;  4NGN A;  3WNB A;  5BWA B;  2ZL6 A;  1SQH A;  4B13 A;  3TT2 A;  2V8H A;  1R57 A;  5AG7 A;  4N3N A;  2Q44 A;  5AG5 A;  4GQN A;  2PVV A;  1DG1 G;  4XNF A;  1IOF A;  2V7T A;  1IID A;  4LX9 A;  3RYO A;  3LAC A;  4NSQ A;  3KHZ A;  1Z8T A;  5FL7 A;  3QSY A;  5FA6 A;  1Y0R A;  4MXU A;  1XFO A;  4CGL A;  3S6H A;  1M4G A;  1V0C A;  2GJP A;  4J0Q A;  1E3Z A;  3TO9 A;  4DYO A;  3SXO A;  4Z4R A;  2RC4 A;  3KL9 A;  3EO4 A;  4MYT A;  4P22 A;  2JDC A;  4C68 A;  5THW A;  2BV3 A;  5CDF A;  1VQ5 B;  4U9Z A;  4LQ6 A;  2ZW5 A;  2QN6 A;  4AVC A;  4Y49 C;  3SLN A;  5C82 A;  3IO1 A;  4BBH A;  2WZN A;  3ZZU A;  1ZUN B;  4KOX A;  4CQJ A;  2LZJ A;  2JEV A;  3F5B A;  1VHS A;  3VO2 A;  4XLA A;  5EMI A;  4K30 A;  3B8G A;  3ZZT A;  3GQB A;  2Y0M A;  3AVV A;  4RDK A;  4JXQ A;  4NBS A;  2XEI A;  3FB3 A;  2R98 A;  4IF5 A;  4U9Y A;  2CW5 A;  3W2I A;  3ONU A;  3S9M A;  4OC1 A;  4KLV A;  2WZP P;  2ZW4 A;  1EWY A;  4Y9U A;  3W91 A;  3FJO A;  3ASS A;  3CMA B;  4OME A;  4AXV A;  3D68 A;  1S3Z A;  4XN0 A;  1Z2L A;  2Z3L A;  4ORF A;  4MRI A;  3H8F A;  1K4J A;  4II2 A;  1KUY A;  1S5K A;  3KI9 A;  1MAB A;  2X85 A;  4RUH A;  4FUU A;  2OTL B;  3JQR A;  2PVW A;  3PUM A;  4X06 A;  4PV6 A;  2XEJ A;  2GRE A;  2B4D A;  4EWT A;  3PZJ A;  1ZG8 A;  1RO5 A;  4C7I A;  3FEE A;  4U5Y A;  4HNW B;  1QSR A;  4UBR A;  1QQ9 A;  1Q2Y A;  3FBU A;  2NYQ A;  1N0V C;  5HXB A;  1FRQ A;  3GLJ A;  3NH5 A;  3CC2 B;  1IYK A;  5HZA A;  3TO7 A;  3WYA A;  4XLF A;  2XGJ A;  4MFP A;  1DDG A;  1X10 A;  4K1X A;  1HVX A;  3P26 A;  4ZGQ B;  4UAJ A;  1NB0 A;  2YND A;  1UD8 A;  5BSX A;  1B87 A;  5H59 A;  3WT4 A;  3VWD A;  4OPS A;  3OEH A;  1YK3 A;  2ZEP A;  2B7B A;  1Z4E A;  2O28 A;  3PBE A;  4XD7 A;  5TY0 A;  1N08 A;  3QB8 A;  1PU9 A;  4CAX A;  4MHD A;  2OBR A;  1E1Q A;  4OKO A;  5TRD A;  5IYQ A;  4CGO A;  1PCA A;  1NMT A;  2AFX A;  3TO6 A;  3IC1 A;  4TN1 A;  1R5O A;  4R76 A;  2JDI A;  1T6Y A;  3PA1 A;  1BLL E;  1CP7 A;  4E0A A;  2CC2 A;  4M85 A;  3N5F A;  2CIJ A;  3TX8 A;  4CAF A;  4B4D A;  3ZBT A;  3WQZ A;  2G9D A;  1BMF A;  2DXQ A;  1YR0 A;  1ELL P;  4HPS A;  1VQ9 B;  1CPS A;  2PJ4 A;  3D4U A;  4PPZ A;  3GKR A;  1NSA A;  3VAT A;  3PB7 X;  3DDY A;  1YLE A;  3WBJ A;  2OZG A;  4F0Y A;  3BQJ A;  4R3L A;  4MCS A;  3ONY A;  5F4O A;  4FWT A;  1TF8 A;  1F60 A;  4IUS A;  2QVP A;  5JPH A;  4ZX9 A;  1VQ6 B;  2F1L A;  1LRZ A;  1OHH A;  3A8K A;  4CYP A;  4KKS A;  3T90 A;  4XR6 A;  5J8F A;  1ELO A;  3WND A;  3DSB A;  3G3S A;  4MCQ A;  1QST A;  2JJ2 A;  2EO8 A;  4PAA A;  3Q39 A;  4OOV A;  1A8P A;  5B6I A;  1RQR A;  2C6C A;  3FEC A;  4Z1M A;  4U9U A;  2HCJ B;  4TT3 A;  1XEB A;  2F8H A;  1J4J A;  1FY7 A;  1JA1 A;  2B5O A;  1Z5R A;  2EUI A;  4WZE A;  4DNR B;  4X2T A;  3FIX A;  2XZP A;  1H85 A;  4A39 A;  1DDI A;  1R5B A;  1PUA A;  1VQ7 B;  2K5T A;  3BHX A;  2P6G A;  1ZM9 A;  4LQG A;  2D3L A;  3ZIA A;  2P6E A;  3QFT A;  3ASQ A;  1NDH A;  2QGG A;  1YIJ B;  2Z10 A;  3IGR A;  3AVU A;  2EVN A;  4Z4Y A;  2PMD A;  4Z4U A;  2ZEL A;  5LRJ A;  4IAV A;  5FIU A;  5KW9 A;  1CBX A;  3QAH A;  1W0J A;  2HMA A;  1X12 A;  3F0A A;  3FX6 A;  4XLC A;  2Q7B A;  1I18 A;  1QUF A;  1UD2 A;  3WC7 A;  4RCY A;  2BOA A;  3U6B A;  1N0U A;  2VBT A;  3PB4 X;  1TLL A;  4XLH A;  2BL1 A;  3OE7 A;  2YGW A;  4Z4Z A;  4ZCM A;  5H5J A;  2R9V A;  4OP4 A;  4UFW A;  2RC6 A;  4BIN A;  2YWH A;  4HIZ A;  3IWW A;  3OJW A;  4LUA A;  1EFR A;  4B5P A;  3OP1 A;  2VQY A;  2ZPA A;  3IWE A;  2J8R A;  3PFE A;  4QUZ A;  2DET A;  1B6B A;  4WQM A;  4JJX A;  1QVF B;  4G1B A;  1UWY A;  3L2N A;  4XPL A;  2X6W A;  2O53 A;  3H5Z A;  4YWY A;  3OZW A;  2X3U A;  1D2E A;  3G6E B;  4X7C A;  3I1U A;  1CM0 A;  4B47 A;  3ASR A;  2PE3 A;  4DK0 A;  2DPT A;  2HC9 A;  3ZZ0 A;  3CCL B;  5CBM A;  2CBX A;  5THX A;  5HVG A;  2EBJ A;  1MRZ A;  3DDD A;  3IEH A;  4CGN A;  4CRY B;  3T51 B;  4CAW A;  4ONW A;  3ISZ A;  2P6F A;  4IK2 A;  1LOK A;  1AMP A;  4P44 A;  1TKF A;  4M3S A;  4L8J A;  3BH4 A;  1M4D A;  1T6Z A;  2C27 A;  1H42 A;  2ZZG A;  1S0U A;  3TTH A;  3PRT A;  2Q4Z A;  2Z11 A;  4KOY A;  1N05 A;  1FRN A;  2YWG A;  4X05 A;  1EFT A;  2NPF A;  3R6J A;  3JQQ A;  4TSF A;  4A33 A;  4NGT A;  4TWE A;  4IHM A;  4UZE A;  1KK2 A;  3GIR A;  2OH1 A;  1YX2 A;  2PJ0 A;  2PJ5 A;  2YNC C;  3SJG A;  3DR6 A;  1KK3 A;  2J7K A;  2DER A;  2AFM A;  2HQY A;  1YIT B;  4RD2 A;  2Z3M A;  2PJ8 A;  2ZEE A;  1MJB A;  5ELY A;  1H8L A;  2VNJ A;  2IMO A;  5C88 A;  4G6I A;  1Y7R A;  3SHP A;  5FO0 A;  1PKV A;  2V8D A;  3QNV A;  1VQP B;  3FPP A;  3NFZ A;  4TNU A;  1ELM P;  1QFJ A;  1IJF A;  1M1K D;  1NSL A;  4KSF A;  3RO0 A;  1KTV A;  2W6I A;  1EE3 P;  4UZU A;  4TMT A;  2PDO A;  5K8N A;  2E1B A;  2V7Q A;  4LBW A;  3VH9 A;  4QVJ A;  3IIB A;  3VR6 A;  4MY0 A;  4B12 A;  1PJ7 A;  2QYV A;  3CP8 A;  2C4U A;  4LBV A;  2VYQ A;  1W35 A;  2FCK A;  4PC3 A;  1BJK A;  4RCZ A;  2C6P A;  1QMU A;  2Q6L A;  5J8C A;  2B7C A;  1IB0 A;  3QE2 A;  4P10 A;  3OZV A;  1QUE A;  2VJJ A;  2XNC A;  2XOK A;  3RBU A;  3I9S A;  3ZBU A;  1VF7 A;  3FXT A;  4II9 A;  1FDR A;  1CJW A;  1VIX A;  2Z3K A;  2OBS A;  3GVJ A;  3TOA A;  4KVO E;  2FE7 A;  1OZP A;  2M5S A;  1QG0 A;  2OZU A;  2VL1 A;  3OEE A;  3PFO A;  2OYN A;  4N3G A;  4ACA A;  3B2Y A;  4C2Y A;  2QE7 A;  4RD4 A;  2AFZ A;  4AG7 A;  1YJN B;  1WOS A;  2PQ8 A;  2V7U A;  2JDD A;  2QML A;  4ONU A;  4IW3 B;  3NH4 A;  3CTA A;  1FNC A;  3KHX A;  2ZTG A;  4UIA A;  3WAB A;  2GLJ A;  4UWI A;  1K28 D;  1TKJ A;  4DJL A;  2WJV A;  3ZPN A;  4CAE A;  1XB2 A;  4QFM A;  3W2E A;  2I3C A;  1NRK A;  2BUE A;  3LWU A;  5HXD A;  4WWV A;  2ZXV A;  2QDX A;  4NGR A;  5F48 A;  4XKW A;  1NBM A;  2OR4 A;  3OPO A;  2EK9 A;  3B3T A;  4XKV A;  4NGS A;  3A1P A;  3D7F A;  3ES9 A;  4MY3 A;  2VXK A;  4B48 A;  2D3N A;  4BD9 A;  1E3X A;  1KK1 A;  1W2B B;  4ASU A;  3CCE B;  1YRE A;  1GAQ A;  4Z4W A;  2G3T A;  4JWP A;  4A32 A;  4B3X A;  1VQK B;  2PIY A;  2PRB A;  1P4M A;  3W2H A;  5HVH A;  4LBZ A;  1M4I A;  3A9L A;  2A4N A;  2DYI A;  3FKS A;  5IK2 A;  4NNJ A;  4ACB A;  4P12 A;  1KUV A;  2EK8 A;  2POK A;  3GVL A;  2FX3 A;  4JYW A;  1FNO A;  3CME B;  2XZO A;  2HUZ A;  3B8H A;  4NEX A;  4KOT A;  1K9M D;  3PB9 X;  1W9X A;  1Q86 D;  3AVY A;  2F1M A;  1TIQ A;  1MJ9 A;  1ZG9 A;  4Z4S A;  4ZYQ A;  3D7H A;  4UF4 A;  4M0L A;  2Q7S A;  3G4S B;  2O4H A;  4NGP A;  2E1R A;  2DF5 A;  1S7N A;  3OAA A;  1WU8 A;  4CAV A;  3CZX A;  3S6K A;  4P26 A;  3DR8 A;  4M2L A;  1FND A;  4ZCI A;  3SJP A;  1JA0 A;  2XEF A;  2J9A A;  4KSA A;  3CC4 B;  1ON0 A;  5JBQ A;  1R43 A;  4KS9 A;  2I1L A;  2JBK A;  4JLY A;  5DS0 A;  1JJ2 B;  5F4J A;  4R3K A;  3C26 A;  4MI4 A;  3AVW A;  2IJZ A;  2CND A;  4EVY A;  2Z0Z A;  3SI0 A;  3SI2 A;  4E8O A;  1KK0 A;  1VLO A;  4YEJ A;  2XNJ A;  1A2Z A;  5BSY A;  3J81 k;  3OW7 A;  4B10 A;  1QVG B;  2YWF A;  3DGV A;  1U6M A;  2GJK A;  4MHN A;  1WOP A;  3CXP A;  1N06 A;  2VZL A;  6CPA A;  1QGY A;  1P4N A;  2OBT A;  4XPK A;  3BLN A;  4CRZ B;  4C43 A;  3NA6 A;  2AE6 A;  5EBV A;  3LD2 A;  1CQX A;  5FNZ A;  2OB0 A;  4YU9 A;  2ZBU A;  1DAR A;  4KOU A;  1Y0Y A;  4OP7 A;  4MBU A;  1OGJ A;  1ZM4 A;  2GIV A;  2V4D A;  2F5I A;  2PJB A;  2B3V A;  1AIP A;  2NMT A;  5TR9 A;  3V7A A;  3JU4 A;  4PC2 A;  3WXM A;  4YAF A;  1AMO A;  4WZT A;  4P9S A;  4RD6 A;  3EFA A;  1U2R A;  1F57 A;  5FVJ A;  4TMV A;  3SKB A;  1YJ9 B;  2X6Y A;  3JTK A;  1HZE A;  2DPS A;  4O23 A;  3W6X A;  1TTT A;  5IB9 A;  4UZF A;  3FMC A;  5J35 A;  5I0C A;  1Q7L A;  1W0K A;  1F20 A;  2QMU A;  2AFO A;  3LMS A;  4KOR A;  5K8P A;  4YAU A;  2P0W A;  2GFQ A;  2DEU A;  2VZY A;  4ZY1 A;  3Q6Q A;  1V0E A;  4PAB A;  4OLL A;  1E1R A;  5F47 A;  4MFK A;  2ZZF A;  1WOO A;  4ROX A;  2XZL A;  4QHY A;  1P0H A;  5G22 A;  4NGM A;  2ZED A;  3D67 A;  4Y7C A;  2PIA A;  4QC6 A;  2EFG A; 
#chains in the Genus database with same CATH homology
 2F7V A;  4PXC A;  2EWB A;  2OOT A;  5LYD A;  2Q43 A;  2PJC A;  3FED A;  3PFE A;  3IFE A;  4UEE A;  4ZY0 A;  4JZ0 A;  4P4E A;  3B3V A;  1UWY A;  2PJ3 A;  3L2N A;  1XMB A;  2O53 A;  4YWY A;  1XRY A;  1OBR A;  1JQG A;  3RAM A;  4P4D A;  3CT9 A;  1F2O A;  3I1U A;  2ZEO A;  2PE3 A;  2HC9 A;  5CBM A;  3B3W A;  5HVG A;  2ZEH A;  2ZEM A;  2PJ7 A;  3IEH A;  1YLO A;  1ZLH A;  4OID A;  3SJF A;  3BI0 A;  1IGB A;  4ONW A;  3ISZ A;  2ABZ A;  4IK2 A;  1LOK A;  3D66 A;  1AMP A;  4P44 A;  1TKF A;  3SJX A;  2XEG A;  4OC3 A;  3D7D A;  2BO9 A;  4F9U A;  3RZA A;  1ZG7 A;  2GLF A;  3PRT A;  2Q4Z A;  2CTC A;  5JH9 A;  1XBU A;  5HVF A;  1ZLI A;  4OC5 A;  2WYR A;  4NGT A;  4TWE A;  4IHM A;  2IQ6 A;  4P6Y A;  2PJ0 A;  2PJ5 A;  3SJG A;  2DEA A;  4B6Z A;  3CDX A;  2QJ8 A;  3B7I A;  2AFM A;  5D29 A;  4W9Y A;  1VHE A;  5LYF A;  1TKH A;  3CPX A;  4NFR A;  2PJ8 A;  2ZEE A;  2C6G A;  3PBB A;  5ELY A;  2C1C A;  1H8L A;  3KR5 A;  3ISX A;  3HUV A;  1CX8 A;  2BCO A;  2IMO A;  3V7Z A;  4R6T A;  3PB6 X;  4OIW A;  2V8D A;  3QNV A;  3FVL A;  3NFZ A;  4NGN A;  4TNU A;  4ZY2 A;  1ELM P;  2V8H A;  1AYE A;  5JGF A;  4OC0 A;  3T8W A;  1EE3 P;  2CF4 A;  4H2K A;  1CPX A;  4GM5 A;  5K8N A;  1VHO A;  3VH9 A;  4K3N A;  4MCR A;  3IIB A;  4MMO A;  3S9L A;  2PVV A;  2PRQ A;  3GUX A;  2QYV A;  1TXR A;  1RTQ A;  1XJO A;  3WC6 A;  2V8G A;  4F9V A;  3KHZ A;  4F8Z A;  4EME A;  1Y0R A;  3B3C A;  1XFO A;  4MXU A;  2C6P A;  4CPA A;  1QMU A;  4MCP A;  4DYO A;  3K2K A;  4P10 A;  7CPA A;  3CPA A;  3KL9 A;  2PJ1 A;  5THW A;  3RBU A;  4R8F A;  1VIX A;  1R3N A;  2FVG A;  3IO1 A;  2WZN A;  1ARM A;  1VGY A;  4PXB A;  2PJ2 A;  2ZEG A;  3H8G A;  2VL1 A;  3PFO A;  3WC5 A;  3B2Y A;  4NJR A;  4R7M A;  1M4L A;  2AFZ A;  3HLP A;  5JM6 A;  2XEI A;  4DUK A;  3NH4 A;  3S9M A;  4OC1 A;  3KHX A;  4OME A;  2ZEN A;  4UIA A;  2GLJ A;  3WAB A;  4AXV A;  3D68 A;  1TKJ A;  4DJL A;  1Z2L A;  8CPA A;  3IJ3 A;  1LAP A;  4MRI A;  3H8F A;  1DE4 C;  3GB0 A;  3KI9 A;  2I3C A;  2PIZ A;  3LWU A;  5HXD A;  4RUH A;  4WWV A;  4FUU A;  1YSJ A;  4NGR A;  3MN8 A;  3NH8 A;  2PVW A;  1ARL A;  1LFW A;  2OR4 A;  4UEF A;  2XEJ A;  2ZEF A;  2GRE A;  2EK9 A;  3B3T A;  4NGS A;  4EWT A;  3D7F A;  1ZG8 A;  2ZOF A;  4BD9 A;  3FEE A;  4A37 A;  4PXD A;  1F2P A;  1QQ9 A;  2PIY A;  3FF3 A;  2NYQ A;  3K9T A;  5HVH A;  3GLJ A;  3NH5 A;  4MHP A;  4P4J A;  1LAM A;  2EK8 A;  2POK A;  4NJQ A;  4FAI A;  1TF9 A;  4JYW A;  1FNO A;  5LYI A;  4EFD A;  5F09 A;  3WT4 A;  3PB9 X;  2AFS A;  3KGQ A;  2ZEP A;  3PBE A;  3D7G A;  5D8N A;  3SJE A;  1ZG9 A;  4P4F A;  4ZYQ A;  3D7H A;  4UF4 A;  2PJA A;  4Z65 A;  4NGQ A;  2O4H A;  4NGP A;  4OKO A;  4FBE A;  1PCA A;  2AFX A;  5I4M A;  1LCP A;  3IC1 A;  4R76 A;  4ZX8 A;  3PEI A;  3FH4 A;  3KAS A;  1BLL E;  1CP7 A;  1BPM A;  4MHZ A;  3N5F A;  2CIJ A;  3TX8 A;  2XEF A;  2J9A A;  3S9N A;  4X8I A;  3TC8 A;  2V8V A;  2PJ9 A;  5K8O A;  2G9D A;  2V77 A;  2PJ6 A;  1R43 A;  2RB7 A;  1HDQ A;  4P45 A;  3KR4 A;  4WJB A;  1ELL P;  3B35 A;  2JBK A;  5K8M A;  5DS0 A;  2Q51 A;  2RFH A;  1CPS A;  3KZW A;  3FJU A;  2PJ4 A;  4A38 A;  3D4U A;  2IJZ A;  2AFW A;  4PPZ A;  2JEW A;  1NSA A;  3VAT A;  3PB7 X;  4ZI6 A;  1DTD A;  3SI0 A;  3SI2 A;  1HEE A;  4P4B A;  5CPA A;  4KSI A;  3B3S A;  4MCS A;  4PQA A;  4P4I A;  3H8E A;  1TF8 A;  2QVP A;  1KWM A;  3DGV A;  3BI1 A;  3KQX A;  4OC4 A;  4ZX9 A;  4MHN A;  2JBJ A;  6CPA A;  2GU2 A;  2NSM A;  3SI1 A;  1GYT A;  3NA6 A;  1CP6 A;  4MCQ A;  1FT7 A;  4YU9 A;  5LYL A;  1Y0Y A;  2ANP A;  2ZOG A;  2C6C A;  3FEC A;  4FWU A;  2F8H A;  4A94 A;  1Z5R A;  4X2T A;  1YW4 A;  2PJB A;  4MHY A;  5LRG A;  4A39 A;  3VAR A;  1Y7E A;  1CG2 A;  1PYT B;  3BHX A;  4LQG A;  1LAN A;  2AFU A;  3KQZ A;  4PXE A;  1F57 A;  4UEZ A;  4UIB A;  3JRU A;  4O23 A;  5LRK A;  5J1Q A;  1YW6 A;  2ZEL A;  4X3R A;  5LRJ A;  4OC2 A;  5IB9 A;  2HB6 A;  3FMC A;  4IAV A;  1Q7L A;  3PB8 X;  1CBX A;  2AFO A;  3LMS A;  5K8P A;  3FX6 A;  1BPN A;  3MRU A;  1YME A;  4ZY1 A;  3WC7 A;  2BOA A;  1HDU A;  3BXM A;  3PB4 X;  4G1P A;  2CTB A;  4Q7A A;  2PCU A;  4OP4 A;  3V38 A;  1Z8L A;  3DLJ A;  4NGM A;  2ZED A;  3D67 A;  1BAV A;  1IY7 A;  3IWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...