4X8IA

De novo crystal structure of the pyrococcus furiosus tet3 aminopeptidase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
346
structure length
337
Chain Sequence
MVDWELMKKIIESPGVSGYEHLGIRDLVVDILKDVADEVKIDKLGNVIAHFKGSAPKVMVAAHMDKIGLMVNHIDKDGYLRVVPIGGVLPETLIAQKIRFFTEKGERYGVVGVLPPHLRIDWDSIIVDVGASSREEAEEMGFRIGTIGEFAPNFTRLSEHRFATPYLDDRICLYAMIEAARQLGEHEADIYIVASVQEEIGLRGARVASFAIDPEVGIAMDVTFAKQPNDKGKIVPELGKGPVMDVGPNINPKLRQFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tuned by metals: the TET peptidase activity is controlled by 3 metal binding sites.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Lysyl aminopeptidase
total genus 111
structure length 337
sequence length 346
chains with identical sequence B, C
ec nomenclature ec 3.4.11.15: Aminopeptidase Y.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 4x8iA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x8iA01
3HUVA 3FJUA 4NJRA 2ZOFA 2PJAA 2NYQA 4FBEA 3BI1A 4R76A 3QNVA 3GUXA 3GLJA 1FT7A 4O23A 3IEHA 1TF8A 1UWYA 3SI1A 5LRKA 1EE3P 4OIWA 3FMCA 3DGVA 1Y0YA 1TKFA 2PE3A 3IC1A 2C1CA 2ZEMA 4ZY1A 5I4MA 2I3CA 4OMEA 3T8WA 1TKJA 3SI2A 3V38A 3IO1A 4DYOA 4FUUA 2F8HA 1CP7A 2EWBA 2HB6A 3NH4A 3D66A 4MRIA 1CBXA 2C6PA 3CT9A 3NH5A 4BD9A 4OP4A 4P4EA 2XEIA 3CPXA 2XEJA 5HVHA 4ONWA 3DLJA 3RAMA 2IQ6A 3WC5A 1RTQA 1Z2LA 5HVFA 3VATA 1R3NA 2V77A 3B3VA 7CPAA 4ZX9A 1HDQA 3KHZA 2PVWA 3D67A 1YW6A 4P10A 1F2OA 2F7VA 2IJZA 4MCSA 5JH9A 3WT4A 4NFRA 4JZ0A 4NGTA 4MHYA 2XEFA 3BI0A 4Q7AA 2G9DA 4CPAA 5JM6A 3TX8A 3PB4X 2Q4ZA 3KGQA 4F9VA 1ZG8A 4OC2A 4P4BA 3RBUA 2DEAA 4WJBA 3PB9X 5JGFA 3FEDA 4UEZA 4YWYA 5LRJA 3I1UA 1ZG9A 5LYDA 2PJBA 1AMPA 4X8IA 2HC9A 4P4IA 5ELYA 1LCPA 4LQGA 4OC4A 2PJCA 2O53A 4NGSA 3SI0A 2GREA 3IIBA 4PXBA 4A39A 3S9MA 3GB0A 1CX8A 2PJ8A 1LOKA 2BO9A 3D68A 3HLPA 4NGMA 5F09A 5LYFA 4P6YA 1FNOA 2AFXA 4ZYQA 2XEGA 6CPAA 1XFOA 3PB7X 5LRGA 4F8ZA 1NSAA 2CIJA 1YW4A 2PRQA 3FF3A 5HXDA 4EFDA 5DS0A 1BLLE 2V8HA 2ZELA 4A37A 2ZENA 4PXCA 1F2PA 1ZG7A 2PCUA 3PB8X 2POKA 1Z8LA 1XMBA 4PXEA 2CTCA 2ZEEA 4P4DA 4X2TA 2PJ4A 4EMEA 2FVGA 2RB7A 1OBRA 2PIYA 4MCQA 4MCRA 3NFZA 1IY7A 2ZEPA 5K8MA 2V8DA 1KWMA 3KR4A 1HDUA 2ZEDA 3L2NA 4R8FA 2EK9A 2V8VA 3S9LA 1YSJA 3FECA 3K9TA 3H8EA 3B3WA 3PFEA 4P4JA 1ARLA 2CTBA 2EK8A 3PRTA 1Q7LA 4MHNA 2PJ3A 2ZEHA 5THWA 4UEEA 1QQ9A 4JYWA 4A38A 2WZNA 1LANA 1VGYA 3PBEA 3SJGA 3TC8A 4MCPA 1BPNA 4UIAA 1AYEA 1R43A 2GLJA 1QMUA 4OC5A 3B2YA 3BXMA 3CPAA 4MMOA 4A94A 2AFSA 4OC1A 4RUHA 3MN8A 3KI9A 5K8NA 3SJEA 1LAPA 4NGPA 1ZLIA 3IJ3A 1VIXA 5LYIA 2PVVA 5J1QA 4NGNA 4P45A 4TWEA 4NGRA 1Y7EA 3NH8A 1HEEA 4G1PA 5LYLA 4DUKA 4KSIA 4GM5A 3N5FA 4NJQA 2PJ7A 2V8GA 3MRUA 4MHZA 1PYTB 2GU2A 1JQGA 2VL1A 4P44A 2C6CA 2PJ5A 3KASA 3B3CA 2BCOA 1TXRA 3V7ZA 3BHXA 4UEFA 4R7MA 3PBBA 1M4LA 3D7GA 4Z65A 3JRUA 3ISZA 3NA6A 2JBJA 4H2KA 3KQXA 4OC3A 4PQAA 3VH9A 3WABA 1CP6A 4ZI6A 4TNUA 5K8PA 2PJ1A 1IGBA 4K3NA 2QYVA 3D7FA 1Z5RA 1ARMA 2J9AA 2RFHA 5CPAA 4IHMA 3SJFA 3KL9A 2ANPA 3LMSA 3S9NA 2AFMA 3KHXA 2QVPA 2PJ2A 4FWUA 2WYRA 2PJ9A 4F9UA 8CPAA 1VHOA 4ZY2A 1F57A 3RZAA 1PCAA 1LAMA 2GLFA 3FVLA 2ABZA 1CPSA 4W9YA 1LFWA 1TKHA 3KR5A 1XRYA 2OOTA 1ZLHA 4IK2A 3SJXA 3PB6X 1H8LA 3IFEA 1ELLP 1XBUA 4OKOA 4MXUA 4IAVA 4MHPA 2BOAA 1VHEA 4OC0A 1CPXA 3FX6A 3B35A 3K2KA 5HVGA 3KZWA 5IB9A 4P4FA 4UF4A 2PJ0A 2AFWA 3D4UA 2IMOA 4X3RA 1ELMP 2ZEGA 3CDXA 3B3TA 4FAIA 2AFZA 2JEWA 2QJ8A 3WC7A 4NGQA 1YMEA 4AXVA 1XJOA 2PJ6A 3FEEA 4PXDA 2AFUA 1BPMA 4R6TA 4PPZA 3H8FA 1GYTA 3WC6A 1BAVA 5K8OA 1CG2A 3D7HA 3ISXA 3FH4A 3PFOA 2C6GA 4ZY0A 4EWTA 3B7IA 2PIZA 3IWWA 4DJLA 2Q51A 1DTDA 1DE4C 5D8NA 2ZEOA 2O4HA 1Y0RA 2JBKA 3D7DA 4ZX8A 5D29A 4YU9A 1TF9A 2ZEFA 4B6ZA 2Q43A 4UIBA 3VARA 2AFOA 3B3SA 2NSMA 3PEIA 1YLOA 4WWVA 4OIDA 2ZOGA 3H8GA 5CBMA 2CF4A 3KQZA 3LWUA 2OR4A
chains in the Genus database with same CATH superfamily
2Q6KA 2FXFA 4NJRA 4P3YA 3LD2A 4XLEA 1E64A 4B47A 5F49A 1ZUNB 4FBEA 1E1QA 2IL4A 4RD3A 1ZO0A 4CAVA 3GLJA 5GCNA 4FD5A 4LQ6A 5JQ4A 3NE5B 3FMCA 3UY5A 1S72B 5L46A 3AVYA 4B44A 1Y0YA 1S3ZA 4I49A 3TOBA 4ZY1A 4XPLA 1H42A 1OB2A 2VBUA 1CQXA 1JNYA 2I3CA 1YI2B 4CRYB 3C26A 2OZGA 1PKVA 3WY9A 1KJZA 3SI2A 1IJFA 4DYOA 2F8HA 3ZZTA 3V8IA 3OW7A 3Q3AA 4BPRA 5E96A 4MRIA 2BL1A 1CBXA 3CT9A 1MJAA 3R95A 2B4BA 1B23P 2WZPP 3RAMA 1S5KA 4HE5A 2C5BA 2YNCA 2BPOA 1R3NA 2D3NA 2BSAA 1BPLA 4XLCA 4ZBGA 4ZX9A 3FBUA 3KHZA 3FYNA 1I12A 1OGIA 4B12A 3PP9A 1F2OA 4P10A 1J4JA 5EC4A 1N8RD 4XM3A 5JH9A 1B6BA 4NFRA 3WT4A 2D3LA 3TE4A 2Q4VA 5KNLA 4OPOA 2HLDA 4C0SA 2G9DA 3CP2A 4RJLA 1K9MD 3PB4X 1U6MA 1P4MA 2W6IA 2Q0YA 3GY9A 1DDIA 4CQJA 2Q4ZA 3KGQA 4PK3A 4OC2A 4C68A 1Q9SA 1KRHA 5JGFA 2PIAA 3J81k 3KEWA 2Q7SA 4B5PA 2E1RA 4ZCMA 3DNSA 1QG0A 2BV3A 1S0UA 3ES9A 3T56B 1W34A 3CXSA 3QFTA 5BSXA 1YITB 3WNDA 2VI7A 2ODFA 2I79A 4PXBA 5H59A 1CX8A 3S6KA 2C4TA 1CM0A 2Q6OA 4P6YA 3SLNA 5IYPA 3ZZUA 2X6YA 3JU4A 4X7CA 3KKWA 4F0XA 4PAAA 3RYOA 5DWNA 5LRGA 1W35A 2PRQA 2ZXIA 3FF3A 4L8AA 2ZBUA 2JDDA 2FE7A 4EFDA 1E63A 5DS0A 2ZELA 4A37A 2JEVA 1F2PA 4M3SA 3A8IA 1RQRA 4Z4UA 4QV2A 1BJKA 2PCUA 4PC6A 3RO0A 2X0KA 3SXNA 2PRBA 4P4DA 2Z10A 4KOTA 3CCRB 2OZUA 1B2RA 4UA3A 4MCQA 4MCRA 3A9LA 1IY7A 4E0FA 2V7QA 2V8DA 2C2WA 2Z6BD 3KR4A 4RD4A 1I18A 3T90A 3S9LA 3I56B 3K9TA 2RC6A 2ZITA 4ASUA 1KMHA 1QSNA 3TO7A 2HQYA 3F8KA 4B3FX 1QSOA 2XZLA 2PJ3A 2H5MA 4P26A 1LANA 3PBEA 3SJGA 5HZAA 2GLJA 5BSYA 4DNTB 3BXMA 1G7CA 2AFSA 4OC1A 3PUMA 4WZEA 2DIEA 3W2FA 3PUNA 3MN8A 3VMFA 3SJEA 1EP1B 2EFGA 4KORA 5H84A 5LYIA 2PVVA 4M53A 3EO4A 2ZXVA 2B4DA 2QEXB 1K73D 3VWEA 5IYNA 2QTZA 4MY3A 4DUKA 4PABA 4HIZA 4KOYA 4NJQA 2V8GA 1IB0A 4PSWA 1PYTB 4P3IA 2YNDA 3BCFA 1UD2A 2PJ5A 1QUFA 3B3CA 1TXRA 3EY5A 2DETA 1L0CA 1WTHD 3PBBA 5KTCA 3S6HA 3D7GA 4KOSA 3MMPA 2YWGA 3OJXA 4PQAA 3R6JA 2AE6A 4TMVA 4CAFA 3AVUA 2JN9A 1T6ZA 3W5UA 4Z4VA 2E1BA 3QFRA 2G0BA 1ZM3A 4CYQA 3TFYA 4KOVA 2QYVA 1ARMA 3I9SA 2VNKA 2VJJA 4RDJA 1G7RA 2D4OA 3JQPA 3A8JA 3LMSA 5DN6A 1KK3A 2QVPA 4RI1A 8CPAA 4PC7A 5F4OA 1CJWA 2QIRA 1TIQA 4NNJA 3T9YA 4YRHA 1TKHA 1MJBA 3IWGA 2OH1A 4XLAA 2QMUA 1KZFA 3S6GA 1XBUA 3W2EA 2QTLA 4IAVA 3E1YE 2DEUA 2CC2A 4OC0A 1CPXA 2DPTA 2QECA 2XNDA 1N0VC 5HVGA 1D8TA 5A88A 3W2GA 1YGHA 2YGWA 4P4FA 3H5ZA 4LBVA 1WORA 1D2EA 1SKQA 4JXRA 4L89A 3I3GA 1VQ5B 1PUAA 4DNRB 1NDHA 4AVCA 4NGQA 5EMIA 4AXVA 4OPVA 2PJ6A 3FEEA 2AFUA 1BPMA 4KVXA 3H8FA 3JUWA 1N07A 3PVDA 2XNJA 1JB9A 4M6GA 3OP1A 3LODA 3B7IA 3GVKA 5AG4A 2B7CA 3BC9A 3BJ8A 5D8NA 2ZPAA 2ZEOA 2C78A 5IK2A 4XORA 3D7DA 4ZX8A 1TF9A 4B6ZA 1OHHA 2Q43A 4KKUA 1GO2A 4JMQA 4RPBA 2ZOGA 3H8GA 2BMWA 3H94A 2CF4A 4QVJA 5AN9A 3T51B 1F60A 2OR4A 2ZL7A 3HUVA 3BY1A 3R9GA 4RCYA 2ARHA 1GR1A 3QNVA 4TMWA 1I8DA 3AGPA 4O23A 5FVJA 4TT3A 2V7WA 2X53S 3SI1A 4J0QA 3JTKA 5LRKA 3G8WA 4KSAA 1PJ6A 1UD4A 5CNPA 3DGVA 3BY2A 1TKFA 4B48A 3IU1A 2ZEMA 5I4MA 2JJ2A 1S7NA 3CCQB 2WR8A 4X05A 1TKJA 1YR0A 2Z3NA 4TSFA 4CYOA 1Y9KA 2EWBA 3BNWA 4MYUA 2GFQA 3D66A 1UD8A 2C6PA 2REFA 3NH5A 2CXAA 4OP4A 2XEIA 4YAFA 3SLDA 2XEJA 1TTTA 3B82A 2EUIA 5JBQA 3ZBTA 3I55B 1Z2LA 2XNCA 3CXCB 2XEXA 4OAEA 1QFYA 4DK1A 4MFJA 4RDLA 4WQMA 1R5OA 4IW3B 2PVWA 4ZGQB 3D67A 1YW6A 4FD4A 5G22A 4E8OA 1P4NA 2PSWA 2Z3LA 4CAXA 1JA0A 4J3GA 4MFZA 3FNCA 4NGTA 4X0CA 4CGPA 3CB4A 1Q81D 3QFCA 5F46A 2Z11A 3R6KA 4OLLA 5JM6A 2F1MA 5TRDA 3VWDA 3RBUA 4B4DA 1EWYA 3PB9X 3ZZIA 4H6ZA 1RQPA 1UMKA 3FEDA 4YWYA 5LRJA 3BQJA 1I7PA 5LYDA 4OPSA 3LO8A 1AMPA 2RC4A 4OP7A 4OC4A 1JJ2B 1YVKA 4Q36A 2O53A 5J8FA 1R57A 1GJRA 1MK4A 1D1NA 3P26A 2GREA 4LBWA 3IIBA 4A39A 1WK4A 4YAOA 1YK3A 2B5GB 2BO9A 2WSSA 3HLPA 4NGMA 5LYFA 3EC4A 2OZHA 1Z8WA 4ZGNB 5F47A 2WPXA 3D2MA 1BQEA 2GJRA 1FNOA 4ZYQA 3OEHA 1Z9UA 3IU2A 3OZUA 3AVTA 4F7DA 4UWJA 1ON0A 4X7FA 4F8ZA 2G3AA 3P2FA 1WPCA 4E2AA 1QGZA 1I21A 4M6IA 1YQEA 4YELA 4X7EA 3FPPA 2GK7A 3GYAA 2V8HA 2F4NA 4RLZA 3VR6A 1ZG7A 2C5HA 2HUZA 4FN5A 2POKA 4KKTA 1Z8LA 1QFZA 1IU8A 4FWTA 1VQPB 4EMEA 2FVGA 5FL7A 2PIYA 2LZJA 3GQBA 4XL9A 4A33A 3W6XA 3NFZA 4LC0A 1H85A 3OEEA 4KZTA 2FIWA 1G7TA 4TMXA 3OW2B 1HDUA 2R8VA 3FECA 1ZM2A 4R3LA 2DCUA 4KVME 1VLOA 4X07A 3H8EA 1E43A 2B3UA 3B3WA 1W0KA 4M2LA 2CRVA 3CRZA 1IHMA 1ARLA 2CW5A 3PRTA 4UZUA 2ZEHA 4B14A 5THXA 4CS0B 4PC1A 3S6FA 4NCNA 5GV8A 4IUSA 1BPNA 1ZM9A 4TN1A 5A28A 1R43A 4BINA 1QMUA 3TO6A 3W5VA 3B2YA 4MMOA 1KK1A 3LQ6A 2QDXA 4RD6A 1UD3A 2FSRA 4Y7CA 5KW9A 3TO9A 3SJPA 2A4NA 1CNEA 2P6EA 4FD6A 4P9SA 3WBKA 4P45A 4TWEA 4NGRA 1Q7YD 1IOIA 1HEEA 4G1PA 2X8KA 1S7KA 4GM5A 3N5FA 3W91A 1YHQB 3OE7A 2XZOA 4CGMA 1CNFA 2D74A 4YXWA 2Q4YA 3I1FA 2OBSA 2C6CA 2QA4B 3ZJ0A 1A2ZA 1BX0A 4RDKA 2BCOA 3BHXA 1XB2A 1M4LA 1VF7A 2ZZEA 3JQQA 4Y49C 2VZZA 4PC3A 5HH1A 4OC3A 4NXYA 3VH9A 4LBYA 1V5VA 1KK2A 2ZW7A 4TNUA 3D3SA 1LRZA 3GSIA 4JXQA 1TUIA 2M5SA 4K3NA 4ZCIA 3DDYA 2J9AA 2RFHA 2WJYA 4C2XA 5DWMA 3PENA 2FIAA 5FO1A 3SJFA 2P0WA 5KSWB 3KL9A 4H89A 1WU8A 3CCEB 2JDCA 2GJPA 3S9NA 1NB0A 4UCPA 4NF1A 5A8AA 2DPSA 2WYRA 2B58A 2PJ9A 4ZY2A 4WZLA 1R5NA 1F20A 2V7XA 3CW2A 2OTJB 3OFNA 4U9UA 4Q7JB 1BMFA 1VQKB 2C4UA 2Q6LA 2ABZA 4KLVA 5BWAB 3OZWA 1V0CA 1N05A 2OOTA 1Z8XA 1K28D 4G1BA 3PB6X 3CXPA 1H8LA 2ZTGA 1SQHA 4M6HA 4UCMA 4OKOA 2F43A 3LNNA 4G7XA 4MXUA 1QVFB 3G6EB 3FX6A 3KZWA 4YGOA 3HAGA 4XMYA 5IB9A 1EFUA 4UF4A 2PJ0A 1OGJA 2IMOA 3TTHA 3T53B 3GKRA 1IIDA 4AG7A 3B3TA 4FAIA 1KUVA 1IYKA 2AFZA 2B4DB 2QJ8A 3CCLB 3MHPA 1MJ9A 2WUUA 3WNCA 1XJOA 3CPWB 2W6JA 4DK0A 1KQSB 4XPDC 2B5OA 2BM0A 1GYTA 1UFHA 4XN3A 2V31A 5K8OA 1NRKA 4AVZA 3D7HA 3PFOA 1FY7A 2C6GA 4UFXA 2OK8A 1WDTA 1XE4A 3A3GA 4Z4SA 1N0UA 1XE1A 4G7WA 1XIXA 3FIXA 2ZW4A 4LBZA 2Q51A 1DTDA 1DE4C 1OB5A 4RCZA 1WOPA 3CTAA 1HVXA 4HNYB 4UFWA 4YU9A 4MJ8A 3P2HA 1VQ9B 4LUAA 3ZC3A 4JLYA 4UIBA 2F1LA 2AFOA 1XEBA 5J3OA 5B6IA 4YALA 4OOSA 3LWUA 1QVGB 2F5IA 5AG6A 4MFLA 4Z4WA 2ZOFA 4M0LA 1Y9WA 2PJAA 2NYQA 4B3GA 4R76A 1FT7A 4XLFA 3FKSA 1TF8A 3D2PA 1UWYA 3G3SA 4GXHA 1COWA 1EE3P 4OIWA 1P0HA 1S7FA 2FS5A 3IC1A 2C1CA 1K8AD 2OB0A 3OAAA 4Z1MA 2D4PA 4OMEA 1T6YA 3T8WA 3IO1A 2VBSA 4FUUA 4NBSA 3TT2A 3SJZA 1YLEA 1M1DA 4KOWA 4CGLA 3IWEA 3BJ7A 3OJWA 4P4EA 2GJKA 3CPXA 1S60A 4B13A 4Z4RA 2J8MA 4ONWA 2IQ6A 4MBUA 1KTVA 4FK8A 3WC5A 1RTQA 4B43A 1QUEA 3VATA 2V77A 3CZXA 2NV4A 3FXTA 1WWZA 1HDQA 4Q38A 5J35A 5H5JA 4M1KA 1MABA 4QVTA 4ZV4A 2BGJA 2VEZA 2OYNA 4HNWB 1T5EA 2IJZA 1M1KD 4MCSA 1QH0A 5F4MA 2HCJB 4A30A 1E79A 4JZ0A 1W9XA 2OU2A 1NBMA 1WSVA 2XEFA 1QGAA 4MHYA 3A8KA 3SEJA 2J8RA 4Q7AA 4XKVA 4AG9A 5KTDA 4E0AA 3VNUA 3W2IA 1ZG8A 3OWCA 4P4BA 3CD6B 5TY0A 1VHSA 2YNCC 1IICA 1NB9A 2X6XA 4UEZA 4MFKA 4ZCLA 4AB7A 4C7HA 1ZG9A 2C27A 4P4IA 2XGJA 5ELYA 1J9ZA 5A89A 4TMTA 4XNFA 1XOVA 2V7TA 2X7BA 4M4SA 4RD0A 4C2ZA 1AUGA 2PDOA 3SI0A 3JVNA 2PLFA 2B7BA 1FDRA 3U2QA 3GB0A 3BCDA 4Y9RA 2PJ8A 3OPOA 4HPSA 1NMTA 4B10A 5F09A 2OBRA 2PC1A 2AFXA 1WSRA 4QFMA 2J8NA 3QSYA 1JWQA 3LQEA 1KZLA 4PK2A 4A2ZA 3PB7X 2VBTA 1B87A 1YW4A 2VXKA 2CNTA 1E3XA 2V7VA 3NE7A 2CNSA 5HXDA 5IV0A 3AVWA 4KSFA 2V4DA 4XNHC 2VQYA 1YREA 2ZENA 4PXCA 1QX4A 4KOUA 3PB8X 1XMBA 4PXEA 2CTCA 2ZEEA 4X2TA 2VYQA 2PQ8A 2PJ4A 2Z3MA 1NE9A 3ASRA 2RB7A 3ZIAA 5IYQA 2Z3PA 2ZL6A 2ZEPA 5K8MA 4II3A 4QC6A 1KWMA 1Z4RA 1YJ9B 2P3MA 2ZEDA 1RXTA 2EK9A 2V8VA 5ISVA 1YSJA 5G1ZA 2WJVA 2JJ1A 4QUSA 1Z4EA 4UWIA 3PFEA 1IOFA 1H8HA 1TVCA 5AGEA 1IB1E 2CTBA 2EK8A 1Q7LA 4KUAA 4XKWA 1UD6A 5THWA 3DR8A 1G7SA 1QQ9A 2VNJA 4R87A 2DXQA 4MCPA 1EFRA 4UIAA 2DOGA 1AYEA 2C77A 2J7KA 2VZYA 4DQKA 1HA3A 5HKKA 1SKYB 2ZW5A 3G05A 2Q7BA 4B3XA 5K8NA 2PR1A 1KK0A 4P1VA 3IJ3A 2ZXHA 1OZPA 4PGOA 4XOPA 4DNCA 3R9EA 1Y7EA 3DR6A 3TCVA 3NH8A 4TMZA 4KSIA 2O28A 4G1VA 1QGYA 2QGGA 1YJWB 3F0AA 4MHZA 3ASPA 2Q44A 4Z4TA 1M44A 1YJNB 2ZZFA 4P44A 3ASQA 2KVOA 3KASA 1N71A 3CESA 4YEJA 5G21A 4UEFA 4R7MA 4UBRA 1V0EA 1KUXA 5EMNA 3D26A 1N06A 5A27A 2JBJA 4C2YA 4CAEA 4ZI6A 2YWHA 1EXMA 5CDFA 2GIVA 1KC8D 3G71B 2YNEA 4CYNA 2GE3A 2QMLA 4B5PB 3AVXA 1Y7RA 2RC5A 3GIRA 3D7FA 1W0JA 4IHMA 2BUEA 4QUZA 2AFMA 5IYWA 3K9UA 3PGPA 2PJ2A 4F9UA 1VHOA 2GANA 1BX1A 1YVOA 1F57A 1U2RA 1DDGA 3RZAA 4OOXA 1PCAA 2ZTNA 3FVLA 2GLFA 4R71A 1CPSA 1S7LA 4W9YA 2HV2A 3KR5A 5HZBA 1Q2DA 3DDDA 1FNCA 4A31A 2JDIA 1ELLP 1VQLB 1VQNB 2DERA 3NE8A 1E62A 4XPDB 5FNZA 4MHPA 2BOAA 4KS9A 1VHEA 4N3NA 1IYLA 3B35A 1WOOA 3K2KA 4YFJA 2ATRA 1BO4A 4NCZA 3V7AA 1M4DA 3LACA 3B78A 4UAJA 4R3KA 2AFWA 3D4UA 4Y9UA 2CK3A 1YX0A 2ZEGA 2ZW6A 5HXBA 3WNBA 1PJ5A 5LMZA 1VJSA 2BEIA 4JD6A 2P6FA 1MRZA 4HKFA 1XF8A 4PPZA 3ZZ0A 1VQ6B 3U6BA 4AF6A 3WC6A 4NSQA 1M4IA 3QAHA 1NSLA 3ZPNA 2EVNA 1CG2A 5IX3A 3ISXA 1VQOB 4K1XA 1FNMA 3FJOA 2QE7A 4RPDA 4ZY0A 3A3BA 3V76A 4H9GA 4EWTA 1W2BB 2PIZA 1VQ8B 1QSMA 3IWWA 4KOXA 5EBVA 4XONA 3CC2B 2VJIA 3BLNA 3CCVB 1Y0RA 4YAWA 2JBKA 2XOKA 4L8JA 5D29A 3QE2A 2B5GA 2ZEFA 3VNVA 3B8HA 5G20A 5FIUA 4P25A 1FRQA 1GAQA 3B3SA 2NSMA 1YIJB 1YLOA 3Q6RA 4TKOB 3H4QA 4NEXA 4X7DA 5CBMA 5AG5A 1XQBA 1I1DA 4QVAA 3CP8A 3ONYA 3FJUA 2R6HA 2VNIA 4KVOE 3BI1A 2WPDA 4Y49B 4U5YA 3P27A 3GUXA 3CC7B 3CMEB 2WPWA 3IEHA 1NJID 4MFQA 3CXQA 2BGIA 4HE6A 3CMAB 1PU9A 2CBXA 2PE3A 4ROXA 3VO1A 4X5KA 4A95A 1A8PA 4A32A 3V38A 4UZEA 3PA1A 3G4SB 1CP7A 2HB6A 3NH4A 4RD2A 3RNZA 1WP6A 3N7ZA 4BD9A 4WZKA 4MY0A 5J8CA 5HVHA 3DLJA 2P6GA 1W87A 3ASTA 4MHDA 4H6UA 5HVFA 3B3VA 7CPAA 2BM1A 2DF5A 3FRMA 2KCWA 3SKBA 3W2HA 2F7VA 4P22A 2X6WA 2PMDA 4XQFA 4YAUA 2NPFA 2Q04A 3Q38A 1QSTA 3BI0A 1EP2B 3JQRA 2OTLB 5AG7A 4CPAA 1YX2A 4MFPA 4AF7A 2FL4A 3TX8A 4OOVA 4N3GA 4F9VA 2DEAA 4WJBA 3PZJA 4CRZB 2ZZGA 3CCJB 1VQ7B 4XD7A 4BBHA 2OBTA 2JIZA 3I1UA 3Q6QA 2VBQA 1EFCA 5F4JA 2PJBA 4X8IA 1Q86D 2HC9A 4CAWA 2R98A 1LCPA 4LQGA 1H8EA 2PJCA 3DSBA 1KD1D 1Q2CA 2G3TA 1XMTA 2Z0ZA 4NGSA 5C88A 4KLWA 1RO5A 3BH4A 3S9MA 1LOKA 4CGOA 3PA2A 3D68A 4FD7A 4ONUA 4RD1A 4UZFA 2YWFA 4P6VF 2VZLA 4LX9A 2R1IA 4B5OA 4RS2A 1FRNA 2JLMA 2XEGA 6CPAA 1WOSA 4CGNA 1XFOA 1NSAA 2CIJA 2WSAA 1EFTA 2EIXA 2CNDA 4XPKA 2FT0A 1M4GA 2D9RA 1BLLE 5TV2A 1VQMB 4Z4YA 1TLLA 1S4MA 2VBVA 3FB3A 2ZZQA 2I00A 3WXMA 2NMTA 1AIPA 1T6XA 1OBRA 5KTAA 3F5BA 4AVBA 1ZM4A 4F6AA 2BSWA 3L2NA 4R8FA 3RY8A 2DYIA 4ACBA 2GPJA 5FO0A 3WBJA 4GQNA 2BVNA 3W6SA 1OB0A 1UD5A 3ZUGA 2EBJA 4P12A 1JA1A 4P4JA 2REEA 4U9YA 2QN6A 4MHNA 4UEEA 5TR9A 4JYWA 4A38A 2WZNA 1VGYA 3TC8A 1HZEA 2Y0MA 2FCKA 4DQLA 4FXUA 2YWEA 2HMAA 4IF5A 4EVYA 1V0FA 4OC5A 5C82A 3CPAA 4A94A 4RUHA 4M85A 1FX0A 1X12A 4UFVA 4ZGYB 3OOCA 3KI9A 2VNHA 1LAPA 4NGPA 1ZLIA 4WZTA 1VIXA 5J1QA 3R1KA 2Z3OA 4NGNA 2X3UA 2XZPA 2X85A 2ZL5A 2AJ6A 4X06A 5LYLA 1X10A 2Q6IA 1Q82D 4MYTA 2PJ7A 3MRUA 5IB0A 1AMOA 4P2NA 2V7UA 3CMMA 3AVVA 1Z8TA 1KUYA 2GU2A 1JQGA 2VL1A 1FNBA 3R9FA 3AGQA 4XN0A 4U9ZA 3V7ZA 1BLIA 1VKCA 3IGRA 3MGDA 3SXOA 4Z65A 4PV6A 3JRUA 4II2A 3GVJA 3ISZA 3NA6A 3E0KA 4H2KA 3KQXA 4KKSA 4ORFA 3QB8A 3WABA 1CP6A 3LVBA 3ONUA 3WR7A 1DG1G 5K8PA 3MCAA 1E3ZA 2PJ1A 2BF4A 4F0YA 1IGBA 4EH1A 1BOBA 1FNDA 1Z5RA 5CPAA 1IJEA 4OADA 4AC9A 1ELOA 1DARA 2R9VA 2ANPA 2CNMA 4JJXA 3R96A 1SM4A 2ZBVA 4C7IA 1QSRA 3KHXA 4FWUA 3U6KA 3SHPA 2AHOA 4QB9A 3QAYA 3H9NA 3OZVA 3A35A 4QHYA 2PR8A 3VO2A 1N08A 2CY2A 1LAMA 4XOTA 4C43A 3GIUA 1LFWA 3CCUB 1XRYA 4XLHA 1ZLHA 4IK2A 4CYPA 2R7HA 1VLYA 3SJXA 5IYRA 4B11A 3IFEA 2DY1A 5H86A 3WYAA 3GVLA 2B3VA 3CC4B 1VQ4B 3W5HA 3QFSA 1K4JA 3EXNA 5FA6A 2GQFA 4X3RA 3OKXA 1ELMP 5DSZA 4QBJA 4K30A 4R9MA 3CDXA 4PSXA 1PJ7A 2JEWA 3CCMB 1GHEA 4GS4A 3WC7A 1E1RA 1YMEA 5I0CA 4ACAA 2HDNB 1GAWA 3CCSB 3E20A 4PXDA 4G5GA 4R6TA 2BN4A 4MI4A 3WQZA 1BAVA 1EP3B 3Q39A 3FH4A 4RN7A 4R57A 4UCNA 4AVAA 3ASSA 3FPKA 4Z4ZA 3D8PA 1GVHA 3TOAA 4YHBA 5E6TA 2OK7A 4DJLA 2K5TA 5GV7A 5HMNA 2O4HA 1M90D 4PC2A 5JPHA 5F48A 1R5BA 2EO8A 4JWPA 4XNHB 4HNXB 3VARA 2Z3KA 3ZBUA 3PEIA 4RM0A 2GK6A 2I1LA 4WWVA 3A1PA 4OIDA 4XR6A 4BMHA 4II9A 4G6IA 3B8GA 1Q2YA 3KQZA 4KUBA 2FX3A 1QFJA 3EFAA
chains in the Genus database with same CATH topology
3HUVA 3FJUA 4NJRA 2ZOFA 2PJAA 2NYQA 4FBEA 3BI1A 4R76A 3QNVA 3GUXA 3GLJA 1FT7A 4O23A 3IEHA 1TF8A 1UWYA 3SI1A 5LRKA 1EE3P 4OIWA 3FMCA 3DGVA 1Y0YA 1TKFA 2PE3A 3IC1A 2C1CA 2ZEMA 4ZY1A 5I4MA 2I3CA 4OMEA 3T8WA 1TKJA 3SI2A 3V38A 3IO1A 4DYOA 4FUUA 2F8HA 1CP7A 2EWBA 2HB6A 3NH4A 3D66A 4MRIA 1CBXA 2C6PA 3CT9A 3NH5A 4BD9A 4OP4A 4P4EA 2XEIA 3CPXA 2XEJA 5HVHA 4ONWA 3DLJA 3RAMA 2IQ6A 3WC5A 1RTQA 1Z2LA 5HVFA 3VATA 1R3NA 2V77A 3B3VA 7CPAA 4ZX9A 1HDQA 3KHZA 2PVWA 3D67A 1YW6A 4P10A 1F2OA 2F7VA 2IJZA 4MCSA 5JH9A 3WT4A 4NFRA 4JZ0A 4NGTA 4MHYA 2XEFA 3BI0A 4Q7AA 2G9DA 4CPAA 5JM6A 3TX8A 3PB4X 2Q4ZA 3KGQA 4F9VA 1ZG8A 4OC2A 4P4BA 3RBUA 2DEAA 4WJBA 3PB9X 5JGFA 3FEDA 4UEZA 4YWYA 5LRJA 3I1UA 1ZG9A 5LYDA 2PJBA 1AMPA 4X8IA 2HC9A 4P4IA 5ELYA 1LCPA 4LQGA 4OC4A 2PJCA 2O53A 4NGSA 3SI0A 2GREA 3IIBA 4PXBA 4A39A 3S9MA 3GB0A 1CX8A 2PJ8A 1LOKA 2BO9A 3D68A 3HLPA 4NGMA 5F09A 5LYFA 4P6YA 1FNOA 2AFXA 4ZYQA 2XEGA 6CPAA 1XFOA 3PB7X 5LRGA 4F8ZA 1NSAA 2CIJA 1YW4A 2PRQA 3FF3A 5HXDA 4EFDA 5DS0A 1BLLE 2V8HA 2ZELA 4A37A 2ZENA 4PXCA 1F2PA 1ZG7A 2PCUA 3PB8X 2POKA 1Z8LA 1XMBA 4PXEA 2CTCA 2ZEEA 4P4DA 4X2TA 2PJ4A 4EMEA 2FVGA 2RB7A 1OBRA 2PIYA 4MCQA 4MCRA 3NFZA 1IY7A 2ZEPA 5K8MA 2V8DA 1KWMA 3KR4A 1HDUA 2ZEDA 3L2NA 4R8FA 2EK9A 2V8VA 3S9LA 1YSJA 3FECA 3K9TA 3H8EA 3B3WA 3PFEA 4P4JA 1ARLA 2CTBA 2EK8A 3PRTA 1Q7LA 4MHNA 2PJ3A 2ZEHA 5THWA 4UEEA 1QQ9A 4JYWA 4A38A 2WZNA 1LANA 1VGYA 3PBEA 3SJGA 3TC8A 4MCPA 1BPNA 4UIAA 1AYEA 1R43A 2GLJA 1QMUA 4OC5A 3B2YA 3BXMA 3CPAA 4MMOA 4A94A 2AFSA 4OC1A 4RUHA 3MN8A 3KI9A 5K8NA 3SJEA 1LAPA 4NGPA 1ZLIA 3IJ3A 1VIXA 5LYIA 2PVVA 5J1QA 4NGNA 4P45A 4TWEA 4NGRA 1Y7EA 3NH8A 1HEEA 4G1PA 5LYLA 4DUKA 4KSIA 4GM5A 3N5FA 4NJQA 2PJ7A 2V8GA 3MRUA 4MHZA 1PYTB 2GU2A 1JQGA 2VL1A 4P44A 2C6CA 2PJ5A 3KASA 3B3CA 2BCOA 1TXRA 3V7ZA 3BHXA 4UEFA 4R7MA 3PBBA 1M4LA 3D7GA 4Z65A 3JRUA 3ISZA 3NA6A 2JBJA 4H2KA 3KQXA 4OC3A 4PQAA 3VH9A 3WABA 1CP6A 4ZI6A 4TNUA 5K8PA 2PJ1A 1IGBA 4K3NA 2QYVA 3D7FA 1Z5RA 1ARMA 2J9AA 2RFHA 5CPAA 4IHMA 3SJFA 3KL9A 2ANPA 3LMSA 3S9NA 2AFMA 3KHXA 2QVPA 2PJ2A 4FWUA 2WYRA 2PJ9A 4F9UA 8CPAA 1VHOA 4ZY2A 1F57A 3RZAA 1PCAA 1LAMA 2GLFA 3FVLA 2ABZA 1CPSA 4W9YA 1LFWA 1TKHA 3KR5A 1XRYA 2OOTA 1ZLHA 4IK2A 3SJXA 3PB6X 1H8LA 3IFEA 1ELLP 1XBUA 4OKOA 4MXUA 4IAVA 4MHPA 2BOAA 1VHEA 4OC0A 1CPXA 3FX6A 3B35A 3K2KA 5HVGA 3KZWA 5IB9A 4P4FA 4UF4A 2PJ0A 2AFWA 3D4UA 2IMOA 4X3RA 1ELMP 2ZEGA 3CDXA 3B3TA 4FAIA 2AFZA 2JEWA 2QJ8A 3WC7A 4NGQA 1YMEA 4AXVA 1XJOA 2PJ6A 3FEEA 4PXDA 2AFUA 1BPMA 4R6TA 4PPZA 3H8FA 1GYTA 3WC6A 1BAVA 5K8OA 1CG2A 3D7HA 3ISXA 3FH4A 3PFOA 2C6GA 4ZY0A 4EWTA 3B7IA 2PIZA 3IWWA 4DJLA 2Q51A 1DTDA 1DE4C 5D8NA 2ZEOA 2O4HA 1Y0RA 2JBKA 3D7DA 4ZX8A 5D29A 4YU9A 1TF9A 2ZEFA 4B6ZA 2Q43A 4UIBA 3VARA 2AFOA 3B3SA 2NSMA 3PEIA 1YLOA 4WWVA 4OIDA 2ZOGA 3H8GA 5CBMA 2CF4A 3KQZA 3LWUA 2OR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUV A;  3FJU A;  4NJR A;  2ZOF A;  2PJA A;  2NYQ A;  4FBE A;  3BI1 A;  4R76 A;  3QNV A;  3GUX A;  3GLJ A;  1FT7 A;  4O23 A;  3IEH A;  1TF8 A;  1UWY A;  3SI1 A;  5LRK A;  1EE3 P;  4OIW A;  3FMC A;  3DGV A;  1Y0Y A;  1TKF A;  2PE3 A;  3IC1 A;  2C1C A;  2ZEM A;  4ZY1 A;  5I4M A;  2I3C A;  4OME A;  3T8W A;  1TKJ A;  3SI2 A;  3V38 A;  3IO1 A;  4DYO A;  4FUU A;  2F8H A;  1CP7 A;  2EWB A;  2HB6 A;  3NH4 A;  3D66 A;  4MRI A;  1CBX A;  2C6P A;  3CT9 A;  3NH5 A;  4BD9 A;  4OP4 A;  4P4E A;  2XEI A;  3CPX A;  2XEJ A;  5HVH A;  4ONW A;  3DLJ A;  3RAM A;  2IQ6 A;  3WC5 A;  1RTQ A;  1Z2L A;  5HVF A;  3VAT A;  1R3N A;  2V77 A;  3B3V A;  7CPA A;  4ZX9 A;  1HDQ A;  3KHZ A;  2PVW A;  3D67 A;  1YW6 A;  4P10 A;  1F2O A;  2F7V A;  2IJZ A;  4MCS A;  5JH9 A;  3WT4 A;  4NFR A;  4JZ0 A;  4NGT A;  4MHY A;  2XEF A;  3BI0 A;  4Q7A A;  2G9D A;  4CPA A;  5JM6 A;  3TX8 A;  3PB4 X;  2Q4Z A;  3KGQ A;  4F9V A;  1ZG8 A;  4OC2 A;  4P4B A;  3RBU A;  2DEA A;  4WJB A;  3PB9 X;  5JGF A;  3FED A;  4UEZ A;  4YWY A;  5LRJ A;  3I1U A;  1ZG9 A;  5LYD A;  2PJB A;  1AMP A;  4X8I A;  2HC9 A;  4P4I A;  5ELY A;  1LCP A;  4LQG A;  4OC4 A;  2PJC A;  2O53 A;  4NGS A;  3SI0 A;  2GRE A;  3IIB A;  4PXB A;  4A39 A;  3S9M A;  3GB0 A;  1CX8 A;  2PJ8 A;  1LOK A;  2BO9 A;  3D68 A;  3HLP A;  4NGM A;  5F09 A;  5LYF A;  4P6Y A;  1FNO A;  2AFX A;  4ZYQ A;  2XEG A;  6CPA A;  1XFO A;  3PB7 X;  5LRG A;  4F8Z A;  1NSA A;  2CIJ A;  1YW4 A;  2PRQ A;  3FF3 A;  5HXD A;  4EFD A;  5DS0 A;  1BLL E;  2V8H A;  2ZEL A;  4A37 A;  2ZEN A;  4PXC A;  1F2P A;  1ZG7 A;  2PCU A;  3PB8 X;  2POK A;  1Z8L A;  1XMB A;  4PXE A;  2CTC A;  2ZEE A;  4P4D A;  4X2T A;  2PJ4 A;  4EME A;  2FVG A;  2RB7 A;  1OBR A;  2PIY A;  4MCQ A;  4MCR A;  3NFZ A;  1IY7 A;  2ZEP A;  5K8M A;  2V8D A;  1KWM A;  3KR4 A;  1HDU A;  2ZED A;  3L2N A;  4R8F A;  2EK9 A;  2V8V A;  3S9L A;  1YSJ A;  3FEC A;  3K9T A;  3H8E A;  3B3W A;  3PFE A;  4P4J A;  1ARL A;  2CTB A;  2EK8 A;  3PRT A;  1Q7L A;  4MHN A;  2PJ3 A;  2ZEH A;  5THW A;  4UEE A;  1QQ9 A;  4JYW A;  4A38 A;  2WZN A;  1LAN A;  1VGY A;  3PBE A;  3SJG A;  3TC8 A;  4MCP A;  1BPN A;  4UIA A;  1AYE A;  1R43 A;  2GLJ A;  1QMU A;  4OC5 A;  3B2Y A;  3BXM A;  3CPA A;  4MMO A;  4A94 A;  2AFS A;  4OC1 A;  4RUH A;  3MN8 A;  3KI9 A;  5K8N A;  3SJE A;  1LAP A;  4NGP A;  1ZLI A;  3IJ3 A;  1VIX A;  5LYI A;  2PVV A;  5J1Q A;  4NGN A;  4P45 A;  4TWE A;  4NGR A;  1Y7E A;  3NH8 A;  1HEE A;  4G1P A;  5LYL A;  4DUK A;  4KSI A;  4GM5 A;  3N5F A;  4NJQ A;  2PJ7 A;  2V8G A;  3MRU A;  4MHZ A;  1PYT B;  2GU2 A;  1JQG A;  2VL1 A;  4P44 A;  2C6C A;  2PJ5 A;  3KAS A;  3B3C A;  2BCO A;  1TXR A;  3V7Z A;  3BHX A;  4UEF A;  4R7M A;  3PBB A;  1M4L A;  3D7G A;  4Z65 A;  3JRU A;  3ISZ A;  3NA6 A;  2JBJ A;  4H2K A;  3KQX A;  4OC3 A;  4PQA A;  3VH9 A;  3WAB A;  1CP6 A;  4ZI6 A;  4TNU A;  5K8P A;  2PJ1 A;  1IGB A;  4K3N A;  2QYV A;  3D7F A;  1Z5R A;  1ARM A;  2J9A A;  2RFH A;  5CPA A;  4IHM A;  3SJF A;  3KL9 A;  2ANP A;  3LMS A;  3S9N A;  2AFM A;  3KHX A;  2QVP A;  2PJ2 A;  4FWU A;  2WYR A;  2PJ9 A;  4F9U A;  8CPA A;  1VHO A;  4ZY2 A;  1F57 A;  3RZA A;  1PCA A;  1LAM A;  2GLF A;  3FVL A;  2ABZ A;  1CPS A;  4W9Y A;  1LFW A;  1TKH A;  3KR5 A;  1XRY A;  2OOT A;  1ZLH A;  4IK2 A;  3SJX A;  3PB6 X;  1H8L A;  3IFE A;  1ELL P;  1XBU A;  4OKO A;  4MXU A;  4IAV A;  4MHP A;  2BOA A;  1VHE A;  4OC0 A;  1CPX A;  3FX6 A;  3B35 A;  3K2K A;  5HVG A;  3KZW A;  5IB9 A;  4P4F A;  4UF4 A;  2PJ0 A;  2AFW A;  3D4U A;  2IMO A;  4X3R A;  1ELM P;  2ZEG A;  3CDX A;  3B3T A;  4FAI A;  2AFZ A;  2JEW A;  2QJ8 A;  3WC7 A;  4NGQ A;  1YME A;  4AXV A;  1XJO A;  2PJ6 A;  3FEE A;  4PXD A;  2AFU A;  1BPM A;  4R6T A;  4PPZ A;  3H8F A;  1GYT A;  3WC6 A;  1BAV A;  5K8O A;  1CG2 A;  3D7H A;  3ISX A;  3FH4 A;  3PFO A;  2C6G A;  4ZY0 A;  4EWT A;  3B7I A;  2PIZ A;  3IWW A;  4DJL A;  2Q51 A;  1DTD A;  1DE4 C;  5D8N A;  2ZEO A;  2O4H A;  1Y0R A;  2JBK A;  3D7D A;  4ZX8 A;  5D29 A;  4YU9 A;  1TF9 A;  2ZEF A;  4B6Z A;  2Q43 A;  4UIB A;  3VAR A;  2AFO A;  3B3S A;  2NSM A;  3PEI A;  1YLO A;  4WWV A;  4OID A;  2ZOG A;  3H8G A;  5CBM A;  2CF4 A;  3KQZ A;  3LWU A;  2OR4 A; 
#chains in the Genus database with same CATH topology
 2Q6K A;  2FXF A;  4NJR A;  4P3Y A;  3LD2 A;  4XLE A;  1E64 A;  4B47 A;  5F49 A;  1ZUN B;  4FBE A;  1E1Q A;  2IL4 A;  4RD3 A;  1ZO0 A;  4CAV A;  3GLJ A;  5GCN A;  4FD5 A;  4LQ6 A;  5JQ4 A;  3NE5 B;  3FMC A;  3UY5 A;  1S72 B;  5L46 A;  3AVY A;  4B44 A;  1Y0Y A;  1S3Z A;  4I49 A;  3TOB A;  4ZY1 A;  4XPL A;  1H42 A;  1OB2 A;  2VBU A;  1CQX A;  1JNY A;  2I3C A;  1YI2 B;  4CRY B;  3C26 A;  2OZG A;  1PKV A;  3WY9 A;  1KJZ A;  3SI2 A;  1IJF A;  4DYO A;  2F8H A;  3ZZT A;  3V8I A;  3OW7 A;  3Q3A A;  4BPR A;  5E96 A;  4MRI A;  2BL1 A;  1CBX A;  3CT9 A;  1MJA A;  3R95 A;  2B4B A;  1B23 P;  2WZP P;  3RAM A;  1S5K A;  4HE5 A;  2C5B A;  2YNC A;  2BPO A;  1R3N A;  2D3N A;  2BSA A;  1BPL A;  4XLC A;  4ZBG A;  4ZX9 A;  3FBU A;  3KHZ A;  3FYN A;  1I12 A;  1OGI A;  4B12 A;  3PP9 A;  1F2O A;  4P10 A;  1J4J A;  5EC4 A;  1N8R D;  4XM3 A;  5JH9 A;  1B6B A;  4NFR A;  3WT4 A;  2D3L A;  3TE4 A;  2Q4V A;  5KNL A;  4OPO A;  2HLD A;  4C0S A;  2G9D A;  3CP2 A;  4RJL A;  1K9M D;  3PB4 X;  1U6M A;  1P4M A;  2W6I A;  2Q0Y A;  3GY9 A;  1DDI A;  4CQJ A;  2Q4Z A;  3KGQ A;  4PK3 A;  4OC2 A;  4C68 A;  1Q9S A;  1KRH A;  5JGF A;  2PIA A;  3J81 k;  3KEW A;  2Q7S A;  4B5P A;  2E1R A;  4ZCM A;  3DNS A;  1QG0 A;  2BV3 A;  1S0U A;  3ES9 A;  3T56 B;  1W34 A;  3CXS A;  3QFT A;  5BSX A;  1YIT B;  3WND A;  2VI7 A;  2ODF A;  2I79 A;  4PXB A;  5H59 A;  1CX8 A;  3S6K A;  2C4T A;  1CM0 A;  2Q6O A;  4P6Y A;  3SLN A;  5IYP A;  3ZZU A;  2X6Y A;  3JU4 A;  4X7C A;  3KKW A;  4F0X A;  4PAA A;  3RYO A;  5DWN A;  5LRG A;  1W35 A;  2PRQ A;  2ZXI A;  3FF3 A;  4L8A A;  2ZBU A;  2JDD A;  2FE7 A;  4EFD A;  1E63 A;  5DS0 A;  2ZEL A;  4A37 A;  2JEV A;  1F2P A;  4M3S A;  3A8I A;  1RQR A;  4Z4U A;  4QV2 A;  1BJK A;  2PCU A;  4PC6 A;  3RO0 A;  2X0K A;  3SXN A;  2PRB A;  4P4D A;  2Z10 A;  4KOT A;  3CCR B;  2OZU A;  1B2R A;  4UA3 A;  4MCQ A;  4MCR A;  3A9L A;  1IY7 A;  4E0F A;  2V7Q A;  2V8D A;  2C2W A;  2Z6B D;  3KR4 A;  4RD4 A;  1I18 A;  3T90 A;  3S9L A;  3I56 B;  3K9T A;  2RC6 A;  2ZIT A;  4ASU A;  1KMH A;  1QSN A;  3TO7 A;  2HQY A;  3F8K A;  4B3F X;  1QSO A;  2XZL A;  2PJ3 A;  2H5M A;  4P26 A;  1LAN A;  3PBE A;  3SJG A;  5HZA A;  2GLJ A;  5BSY A;  4DNT B;  3BXM A;  1G7C A;  2AFS A;  4OC1 A;  3PUM A;  4WZE A;  2DIE A;  3W2F A;  3PUN A;  3MN8 A;  3VMF A;  3SJE A;  1EP1 B;  2EFG A;  4KOR A;  5H84 A;  5LYI A;  2PVV A;  4M53 A;  3EO4 A;  2ZXV A;  2B4D A;  2QEX B;  1K73 D;  3VWE A;  5IYN A;  2QTZ A;  4MY3 A;  4DUK A;  4PAB A;  4HIZ A;  4KOY A;  4NJQ A;  2V8G A;  1IB0 A;  4PSW A;  1PYT B;  4P3I A;  2YND A;  3BCF A;  1UD2 A;  2PJ5 A;  1QUF A;  3B3C A;  1TXR A;  3EY5 A;  2DET A;  1L0C A;  1WTH D;  3PBB A;  5KTC A;  3S6H A;  3D7G A;  4KOS A;  3MMP A;  2YWG A;  3OJX A;  4PQA A;  3R6J A;  2AE6 A;  4TMV A;  4CAF A;  3AVU A;  2JN9 A;  1T6Z A;  3W5U A;  4Z4V A;  2E1B A;  3QFR A;  2G0B A;  1ZM3 A;  4CYQ A;  3TFY A;  4KOV A;  2QYV A;  1ARM A;  3I9S A;  2VNK A;  2VJJ A;  4RDJ A;  1G7R A;  2D4O A;  3JQP A;  3A8J A;  3LMS A;  5DN6 A;  1KK3 A;  2QVP A;  4RI1 A;  8CPA A;  4PC7 A;  5F4O A;  1CJW A;  2QIR A;  1TIQ A;  4NNJ A;  3T9Y A;  4YRH A;  1TKH A;  1MJB A;  3IWG A;  2OH1 A;  4XLA A;  2QMU A;  1KZF A;  3S6G A;  1XBU A;  3W2E A;  2QTL A;  4IAV A;  3E1Y E;  2DEU A;  2CC2 A;  4OC0 A;  1CPX A;  2DPT A;  2QEC A;  2XND A;  1N0V C;  5HVG A;  1D8T A;  5A88 A;  3W2G A;  1YGH A;  2YGW A;  4P4F A;  3H5Z A;  4LBV A;  1WOR A;  1D2E A;  1SKQ A;  4JXR A;  4L89 A;  3I3G A;  1VQ5 B;  1PUA A;  4DNR B;  1NDH A;  4AVC A;  4NGQ A;  5EMI A;  4AXV A;  4OPV A;  2PJ6 A;  3FEE A;  2AFU A;  1BPM A;  4KVX A;  3H8F A;  3JUW A;  1N07 A;  3PVD A;  2XNJ A;  1JB9 A;  4M6G A;  3OP1 A;  3LOD A;  3B7I A;  3GVK A;  5AG4 A;  2B7C A;  3BC9 A;  3BJ8 A;  5D8N A;  2ZPA A;  2ZEO A;  2C78 A;  5IK2 A;  4XOR A;  3D7D A;  4ZX8 A;  1TF9 A;  4B6Z A;  1OHH A;  2Q43 A;  4KKU A;  1GO2 A;  4JMQ A;  4RPB A;  2ZOG A;  3H8G A;  2BMW A;  3H94 A;  2CF4 A;  4QVJ A;  5AN9 A;  3T51 B;  1F60 A;  2OR4 A;  2ZL7 A;  3HUV A;  3BY1 A;  3R9G A;  4RCY A;  2ARH A;  1GR1 A;  3QNV A;  4TMW A;  1I8D A;  3AGP A;  4O23 A;  5FVJ A;  4TT3 A;  2V7W A;  2X53 S;  3SI1 A;  4J0Q A;  3JTK A;  5LRK A;  3G8W A;  4KSA A;  1PJ6 A;  1UD4 A;  5CNP A;  3DGV A;  3BY2 A;  1TKF A;  4B48 A;  3IU1 A;  2ZEM A;  5I4M A;  2JJ2 A;  1S7N A;  3CCQ B;  2WR8 A;  4X05 A;  1TKJ A;  1YR0 A;  2Z3N A;  4TSF A;  4CYO A;  1Y9K A;  2EWB A;  3BNW A;  4MYU A;  2GFQ A;  3D66 A;  1UD8 A;  2C6P A;  2REF A;  3NH5 A;  2CXA A;  4OP4 A;  2XEI A;  4YAF A;  3SLD A;  2XEJ A;  1TTT A;  3B82 A;  2EUI A;  5JBQ A;  3ZBT A;  3I55 B;  1Z2L A;  2XNC A;  3CXC B;  2XEX A;  4OAE A;  1QFY A;  4DK1 A;  4MFJ A;  4RDL A;  4WQM A;  1R5O A;  4IW3 B;  2PVW A;  4ZGQ B;  3D67 A;  1YW6 A;  4FD4 A;  5G22 A;  4E8O A;  1P4N A;  2PSW A;  2Z3L A;  4CAX A;  1JA0 A;  4J3G A;  4MFZ A;  3FNC A;  4NGT A;  4X0C A;  4CGP A;  3CB4 A;  1Q81 D;  3QFC A;  5F46 A;  2Z11 A;  3R6K A;  4OLL A;  5JM6 A;  2F1M A;  5TRD A;  3VWD A;  3RBU A;  4B4D A;  1EWY A;  3PB9 X;  3ZZI A;  4H6Z A;  1RQP A;  1UMK A;  3FED A;  4YWY A;  5LRJ A;  3BQJ A;  1I7P A;  5LYD A;  4OPS A;  3LO8 A;  1AMP A;  2RC4 A;  4OP7 A;  4OC4 A;  1JJ2 B;  1YVK A;  4Q36 A;  2O53 A;  5J8F A;  1R57 A;  1GJR A;  1MK4 A;  1D1N A;  3P26 A;  2GRE A;  4LBW A;  3IIB A;  4A39 A;  1WK4 A;  4YAO A;  1YK3 A;  2B5G B;  2BO9 A;  2WSS A;  3HLP A;  4NGM A;  5LYF A;  3EC4 A;  2OZH A;  1Z8W A;  4ZGN B;  5F47 A;  2WPX A;  3D2M A;  1BQE A;  2GJR A;  1FNO A;  4ZYQ A;  3OEH A;  1Z9U A;  3IU2 A;  3OZU A;  3AVT A;  4F7D A;  4UWJ A;  1ON0 A;  4X7F A;  4F8Z A;  2G3A A;  3P2F A;  1WPC A;  4E2A A;  1QGZ A;  1I21 A;  4M6I A;  1YQE A;  4YEL A;  4X7E A;  3FPP A;  2GK7 A;  3GYA A;  2V8H A;  2F4N A;  4RLZ A;  3VR6 A;  1ZG7 A;  2C5H A;  2HUZ A;  4FN5 A;  2POK A;  4KKT A;  1Z8L A;  1QFZ A;  1IU8 A;  4FWT A;  1VQP B;  4EME A;  2FVG A;  5FL7 A;  2PIY A;  2LZJ A;  3GQB A;  4XL9 A;  4A33 A;  3W6X A;  3NFZ A;  4LC0 A;  1H85 A;  3OEE A;  4KZT A;  2FIW A;  1G7T A;  4TMX A;  3OW2 B;  1HDU A;  2R8V A;  3FEC A;  1ZM2 A;  4R3L A;  2DCU A;  4KVM E;  1VLO A;  4X07 A;  3H8E A;  1E43 A;  2B3U A;  3B3W A;  1W0K A;  4M2L A;  2CRV A;  3CRZ A;  1IHM A;  1ARL A;  2CW5 A;  3PRT A;  4UZU A;  2ZEH A;  4B14 A;  5THX A;  4CS0 B;  4PC1 A;  3S6F A;  4NCN A;  5GV8 A;  4IUS A;  1BPN A;  1ZM9 A;  4TN1 A;  5A28 A;  1R43 A;  4BIN A;  1QMU A;  3TO6 A;  3W5V A;  3B2Y A;  4MMO A;  1KK1 A;  3LQ6 A;  2QDX A;  4RD6 A;  1UD3 A;  2FSR A;  4Y7C A;  5KW9 A;  3TO9 A;  3SJP A;  2A4N A;  1CNE A;  2P6E A;  4FD6 A;  4P9S A;  3WBK A;  4P45 A;  4TWE A;  4NGR A;  1Q7Y D;  1IOI A;  1HEE A;  4G1P A;  2X8K A;  1S7K A;  4GM5 A;  3N5F A;  3W91 A;  1YHQ B;  3OE7 A;  2XZO A;  4CGM A;  1CNF A;  2D74 A;  4YXW A;  2Q4Y A;  3I1F A;  2OBS A;  2C6C A;  2QA4 B;  3ZJ0 A;  1A2Z A;  1BX0 A;  4RDK A;  2BCO A;  3BHX A;  1XB2 A;  1M4L A;  1VF7 A;  2ZZE A;  3JQQ A;  4Y49 C;  2VZZ A;  4PC3 A;  5HH1 A;  4OC3 A;  4NXY A;  3VH9 A;  4LBY A;  1V5V A;  1KK2 A;  2ZW7 A;  4TNU A;  3D3S A;  1LRZ A;  3GSI A;  4JXQ A;  1TUI A;  2M5S A;  4K3N A;  4ZCI A;  3DDY A;  2J9A A;  2RFH A;  2WJY A;  4C2X A;  5DWM A;  3PEN A;  2FIA A;  5FO1 A;  3SJF A;  2P0W A;  5KSW B;  3KL9 A;  4H89 A;  1WU8 A;  3CCE B;  2JDC A;  2GJP A;  3S9N A;  1NB0 A;  4UCP A;  4NF1 A;  5A8A A;  2DPS A;  2WYR A;  2B58 A;  2PJ9 A;  4ZY2 A;  4WZL A;  1R5N A;  1F20 A;  2V7X A;  3CW2 A;  2OTJ B;  3OFN A;  4U9U A;  4Q7J B;  1BMF A;  1VQK B;  2C4U A;  2Q6L A;  2ABZ A;  4KLV A;  5BWA B;  3OZW A;  1V0C A;  1N05 A;  2OOT A;  1Z8X A;  1K28 D;  4G1B A;  3PB6 X;  3CXP A;  1H8L A;  2ZTG A;  1SQH A;  4M6H A;  4UCM A;  4OKO A;  2F43 A;  3LNN A;  4G7X A;  4MXU A;  1QVF B;  3G6E B;  3FX6 A;  3KZW A;  4YGO A;  3HAG A;  4XMY A;  5IB9 A;  1EFU A;  4UF4 A;  2PJ0 A;  1OGJ A;  2IMO A;  3TTH A;  3T53 B;  3GKR A;  1IID A;  4AG7 A;  3B3T A;  4FAI A;  1KUV A;  1IYK A;  2AFZ A;  2B4D B;  2QJ8 A;  3CCL B;  3MHP A;  1MJ9 A;  2WUU A;  3WNC A;  1XJO A;  3CPW B;  2W6J A;  4DK0 A;  1KQS B;  4XPD C;  2B5O A;  2BM0 A;  1GYT A;  1UFH A;  4XN3 A;  2V31 A;  5K8O A;  1NRK A;  4AVZ A;  3D7H A;  3PFO A;  1FY7 A;  2C6G A;  4UFX A;  2OK8 A;  1WDT A;  1XE4 A;  3A3G A;  4Z4S A;  1N0U A;  1XE1 A;  4G7W A;  1XIX A;  3FIX A;  2ZW4 A;  4LBZ A;  2Q51 A;  1DTD A;  1DE4 C;  1OB5 A;  4RCZ A;  1WOP A;  3CTA A;  1HVX A;  4HNY B;  4UFW A;  4YU9 A;  4MJ8 A;  3P2H A;  1VQ9 B;  4LUA A;  3ZC3 A;  4JLY A;  4UIB A;  2F1L A;  2AFO A;  1XEB A;  5J3O A;  5B6I A;  4YAL A;  4OOS A;  3LWU A;  1QVG B;  2F5I A;  5AG6 A;  4MFL A;  4Z4W A;  2ZOF A;  4M0L A;  1Y9W A;  2PJA A;  2NYQ A;  4B3G A;  4R76 A;  1FT7 A;  4XLF A;  3FKS A;  1TF8 A;  3D2P A;  1UWY A;  3G3S A;  4GXH A;  1COW A;  1EE3 P;  4OIW A;  1P0H A;  1S7F A;  2FS5 A;  3IC1 A;  2C1C A;  1K8A D;  2OB0 A;  3OAA A;  4Z1M A;  2D4P A;  4OME A;  1T6Y A;  3T8W A;  3IO1 A;  2VBS A;  4FUU A;  4NBS A;  3TT2 A;  3SJZ A;  1YLE A;  1M1D A;  4KOW A;  4CGL A;  3IWE A;  3BJ7 A;  3OJW A;  4P4E A;  2GJK A;  3CPX A;  1S60 A;  4B13 A;  4Z4R A;  2J8M A;  4ONW A;  2IQ6 A;  4MBU A;  1KTV A;  4FK8 A;  3WC5 A;  1RTQ A;  4B43 A;  1QUE A;  3VAT A;  2V77 A;  3CZX A;  2NV4 A;  3FXT A;  1WWZ A;  1HDQ A;  4Q38 A;  5J35 A;  5H5J A;  4M1K A;  1MAB A;  4QVT A;  4ZV4 A;  2BGJ A;  2VEZ A;  2OYN A;  4HNW B;  1T5E A;  2IJZ A;  1M1K D;  4MCS A;  1QH0 A;  5F4M A;  2HCJ B;  4A30 A;  1E79 A;  4JZ0 A;  1W9X A;  2OU2 A;  1NBM A;  1WSV A;  2XEF A;  1QGA A;  4MHY A;  3A8K A;  3SEJ A;  2J8R A;  4Q7A A;  4XKV A;  4AG9 A;  5KTD A;  4E0A A;  3VNU A;  3W2I A;  1ZG8 A;  3OWC A;  4P4B A;  3CD6 B;  5TY0 A;  1VHS A;  2YNC C;  1IIC A;  1NB9 A;  2X6X A;  4UEZ A;  4MFK A;  4ZCL A;  4AB7 A;  4C7H A;  1ZG9 A;  2C27 A;  4P4I A;  2XGJ A;  5ELY A;  1J9Z A;  5A89 A;  4TMT A;  4XNF A;  1XOV A;  2V7T A;  2X7B A;  4M4S A;  4RD0 A;  4C2Z A;  1AUG A;  2PDO A;  3SI0 A;  3JVN A;  2PLF A;  2B7B A;  1FDR A;  3U2Q A;  3GB0 A;  3BCD A;  4Y9R A;  2PJ8 A;  3OPO A;  4HPS A;  1NMT A;  4B10 A;  5F09 A;  2OBR A;  2PC1 A;  2AFX A;  1WSR A;  4QFM A;  2J8N A;  3QSY A;  1JWQ A;  3LQE A;  1KZL A;  4PK2 A;  4A2Z A;  3PB7 X;  2VBT A;  1B87 A;  1YW4 A;  2VXK A;  2CNT A;  1E3X A;  2V7V A;  3NE7 A;  2CNS A;  5HXD A;  5IV0 A;  3AVW A;  4KSF A;  2V4D A;  4XNH C;  2VQY A;  1YRE A;  2ZEN A;  4PXC A;  1QX4 A;  4KOU A;  3PB8 X;  1XMB A;  4PXE A;  2CTC A;  2ZEE A;  4X2T A;  2VYQ A;  2PQ8 A;  2PJ4 A;  2Z3M A;  1NE9 A;  3ASR A;  2RB7 A;  3ZIA A;  5IYQ A;  2Z3P A;  2ZL6 A;  2ZEP A;  5K8M A;  4II3 A;  4QC6 A;  1KWM A;  1Z4R A;  1YJ9 B;  2P3M A;  2ZED A;  1RXT A;  2EK9 A;  2V8V A;  5ISV A;  1YSJ A;  5G1Z A;  2WJV A;  2JJ1 A;  4QUS A;  1Z4E A;  4UWI A;  3PFE A;  1IOF A;  1H8H A;  1TVC A;  5AGE A;  1IB1 E;  2CTB A;  2EK8 A;  1Q7L A;  4KUA A;  4XKW A;  1UD6 A;  5THW A;  3DR8 A;  1G7S A;  1QQ9 A;  2VNJ A;  4R87 A;  2DXQ A;  4MCP A;  1EFR A;  4UIA A;  2DOG A;  1AYE A;  2C77 A;  2J7K A;  2VZY A;  4DQK A;  1HA3 A;  5HKK A;  1SKY B;  2ZW5 A;  3G05 A;  2Q7B A;  4B3X A;  5K8N A;  2PR1 A;  1KK0 A;  4P1V A;  3IJ3 A;  2ZXH A;  1OZP A;  4PGO A;  4XOP A;  4DNC A;  3R9E A;  1Y7E A;  3DR6 A;  3TCV A;  3NH8 A;  4TMZ A;  4KSI A;  2O28 A;  4G1V A;  1QGY A;  2QGG A;  1YJW B;  3F0A A;  4MHZ A;  3ASP A;  2Q44 A;  4Z4T A;  1M44 A;  1YJN B;  2ZZF A;  4P44 A;  3ASQ A;  2KVO A;  3KAS A;  1N71 A;  3CES A;  4YEJ A;  5G21 A;  4UEF A;  4R7M A;  4UBR A;  1V0E A;  1KUX A;  5EMN A;  3D26 A;  1N06 A;  5A27 A;  2JBJ A;  4C2Y A;  4CAE A;  4ZI6 A;  2YWH A;  1EXM A;  5CDF A;  2GIV A;  1KC8 D;  3G71 B;  2YNE A;  4CYN A;  2GE3 A;  2QML A;  4B5P B;  3AVX A;  1Y7R A;  2RC5 A;  3GIR A;  3D7F A;  1W0J A;  4IHM A;  2BUE A;  4QUZ A;  2AFM A;  5IYW A;  3K9U A;  3PGP A;  2PJ2 A;  4F9U A;  1VHO A;  2GAN A;  1BX1 A;  1YVO A;  1F57 A;  1U2R A;  1DDG A;  3RZA A;  4OOX A;  1PCA A;  2ZTN A;  3FVL A;  2GLF A;  4R71 A;  1CPS A;  1S7L A;  4W9Y A;  2HV2 A;  3KR5 A;  5HZB A;  1Q2D A;  3DDD A;  1FNC A;  4A31 A;  2JDI A;  1ELL P;  1VQL B;  1VQN B;  2DER A;  3NE8 A;  1E62 A;  4XPD B;  5FNZ A;  4MHP A;  2BOA A;  4KS9 A;  1VHE A;  4N3N A;  1IYL A;  3B35 A;  1WOO A;  3K2K A;  4YFJ A;  2ATR A;  1BO4 A;  4NCZ A;  3V7A A;  1M4D A;  3LAC A;  3B78 A;  4UAJ A;  4R3K A;  2AFW A;  3D4U A;  4Y9U A;  2CK3 A;  1YX0 A;  2ZEG A;  2ZW6 A;  5HXB A;  3WNB A;  1PJ5 A;  5LMZ A;  1VJS A;  2BEI A;  4JD6 A;  2P6F A;  1MRZ A;  4HKF A;  1XF8 A;  4PPZ A;  3ZZ0 A;  1VQ6 B;  3U6B A;  4AF6 A;  3WC6 A;  4NSQ A;  1M4I A;  3QAH A;  1NSL A;  3ZPN A;  2EVN A;  1CG2 A;  5IX3 A;  3ISX A;  1VQO B;  4K1X A;  1FNM A;  3FJO A;  2QE7 A;  4RPD A;  4ZY0 A;  3A3B A;  3V76 A;  4H9G A;  4EWT A;  1W2B B;  2PIZ A;  1VQ8 B;  1QSM A;  3IWW A;  4KOX A;  5EBV A;  4XON A;  3CC2 B;  2VJI A;  3BLN A;  3CCV B;  1Y0R A;  4YAW A;  2JBK A;  2XOK A;  4L8J A;  5D29 A;  3QE2 A;  2B5G A;  2ZEF A;  3VNV A;  3B8H A;  5G20 A;  5FIU A;  4P25 A;  1FRQ A;  1GAQ A;  3B3S A;  2NSM A;  1YIJ B;  1YLO A;  3Q6R A;  4TKO B;  3H4Q A;  4NEX A;  4X7D A;  5CBM A;  5AG5 A;  1XQB A;  1I1D A;  4QVA A;  3CP8 A;  3ONY A;  3FJU A;  2R6H A;  2VNI A;  4KVO E;  3BI1 A;  2WPD A;  4Y49 B;  4U5Y A;  3P27 A;  3GUX A;  3CC7 B;  3CME B;  2WPW A;  3IEH A;  1NJI D;  4MFQ A;  3CXQ A;  2BGI A;  4HE6 A;  3CMA B;  1PU9 A;  2CBX A;  2PE3 A;  4ROX A;  3VO1 A;  4X5K A;  4A95 A;  1A8P A;  4A32 A;  3V38 A;  4UZE A;  3PA1 A;  3G4S B;  1CP7 A;  2HB6 A;  3NH4 A;  4RD2 A;  3RNZ A;  1WP6 A;  3N7Z A;  4BD9 A;  4WZK A;  4MY0 A;  5J8C A;  5HVH A;  3DLJ A;  2P6G A;  1W87 A;  3AST A;  4MHD A;  4H6U A;  5HVF A;  3B3V A;  7CPA A;  2BM1 A;  2DF5 A;  3FRM A;  2KCW A;  3SKB A;  3W2H A;  2F7V A;  4P22 A;  2X6W A;  2PMD A;  4XQF A;  4YAU A;  2NPF A;  2Q04 A;  3Q38 A;  1QST A;  3BI0 A;  1EP2 B;  3JQR A;  2OTL B;  5AG7 A;  4CPA A;  1YX2 A;  4MFP A;  4AF7 A;  2FL4 A;  3TX8 A;  4OOV A;  4N3G A;  4F9V A;  2DEA A;  4WJB A;  3PZJ A;  4CRZ B;  2ZZG A;  3CCJ B;  1VQ7 B;  4XD7 A;  4BBH A;  2OBT A;  2JIZ A;  3I1U A;  3Q6Q A;  2VBQ A;  1EFC A;  5F4J A;  2PJB A;  4X8I A;  1Q86 D;  2HC9 A;  4CAW A;  2R98 A;  1LCP A;  4LQG A;  1H8E A;  2PJC A;  3DSB A;  1KD1 D;  1Q2C A;  2G3T A;  1XMT A;  2Z0Z A;  4NGS A;  5C88 A;  4KLW A;  1RO5 A;  3BH4 A;  3S9M A;  1LOK A;  4CGO A;  3PA2 A;  3D68 A;  4FD7 A;  4ONU A;  4RD1 A;  4UZF A;  2YWF A;  4P6V F;  2VZL A;  4LX9 A;  2R1I A;  4B5O A;  4RS2 A;  1FRN A;  2JLM A;  2XEG A;  6CPA A;  1WOS A;  4CGN A;  1XFO A;  1NSA A;  2CIJ A;  2WSA A;  1EFT A;  2EIX A;  2CND A;  4XPK A;  2FT0 A;  1M4G A;  2D9R A;  1BLL E;  5TV2 A;  1VQM B;  4Z4Y A;  1TLL A;  1S4M A;  2VBV A;  3FB3 A;  2ZZQ A;  2I00 A;  3WXM A;  2NMT A;  1AIP A;  1T6X A;  1OBR A;  5KTA A;  3F5B A;  4AVB A;  1ZM4 A;  4F6A A;  2BSW A;  3L2N A;  4R8F A;  3RY8 A;  2DYI A;  4ACB A;  2GPJ A;  5FO0 A;  3WBJ A;  4GQN A;  2BVN A;  3W6S A;  1OB0 A;  1UD5 A;  3ZUG A;  2EBJ A;  4P12 A;  1JA1 A;  4P4J A;  2REE A;  4U9Y A;  2QN6 A;  4MHN A;  4UEE A;  5TR9 A;  4JYW A;  4A38 A;  2WZN A;  1VGY A;  3TC8 A;  1HZE A;  2Y0M A;  2FCK A;  4DQL A;  4FXU A;  2YWE A;  2HMA A;  4IF5 A;  4EVY A;  1V0F A;  4OC5 A;  5C82 A;  3CPA A;  4A94 A;  4RUH A;  4M85 A;  1FX0 A;  1X12 A;  4UFV A;  4ZGY B;  3OOC A;  3KI9 A;  2VNH A;  1LAP A;  4NGP A;  1ZLI A;  4WZT A;  1VIX A;  5J1Q A;  3R1K A;  2Z3O A;  4NGN A;  2X3U A;  2XZP A;  2X85 A;  2ZL5 A;  2AJ6 A;  4X06 A;  5LYL A;  1X10 A;  2Q6I A;  1Q82 D;  4MYT A;  2PJ7 A;  3MRU A;  5IB0 A;  1AMO A;  4P2N A;  2V7U A;  3CMM A;  3AVV A;  1Z8T A;  1KUY A;  2GU2 A;  1JQG A;  2VL1 A;  1FNB A;  3R9F A;  3AGQ A;  4XN0 A;  4U9Z A;  3V7Z A;  1BLI A;  1VKC A;  3IGR A;  3MGD A;  3SXO A;  4Z65 A;  4PV6 A;  3JRU A;  4II2 A;  3GVJ A;  3ISZ A;  3NA6 A;  3E0K A;  4H2K A;  3KQX A;  4KKS A;  4ORF A;  3QB8 A;  3WAB A;  1CP6 A;  3LVB A;  3ONU A;  3WR7 A;  1DG1 G;  5K8P A;  3MCA A;  1E3Z A;  2PJ1 A;  2BF4 A;  4F0Y A;  1IGB A;  4EH1 A;  1BOB A;  1FND A;  1Z5R A;  5CPA A;  1IJE A;  4OAD A;  4AC9 A;  1ELO A;  1DAR A;  2R9V A;  2ANP A;  2CNM A;  4JJX A;  3R96 A;  1SM4 A;  2ZBV A;  4C7I A;  1QSR A;  3KHX A;  4FWU A;  3U6K A;  3SHP A;  2AHO A;  4QB9 A;  3QAY A;  3H9N A;  3OZV A;  3A35 A;  4QHY A;  2PR8 A;  3VO2 A;  1N08 A;  2CY2 A;  1LAM A;  4XOT A;  4C43 A;  3GIU A;  1LFW A;  3CCU B;  1XRY A;  4XLH A;  1ZLH A;  4IK2 A;  4CYP A;  2R7H A;  1VLY A;  3SJX A;  5IYR A;  4B11 A;  3IFE A;  2DY1 A;  5H86 A;  3WYA A;  3GVL A;  2B3V A;  3CC4 B;  1VQ4 B;  3W5H A;  3QFS A;  1K4J A;  3EXN A;  5FA6 A;  2GQF A;  4X3R A;  3OKX A;  1ELM P;  5DSZ A;  4QBJ A;  4K30 A;  4R9M A;  3CDX A;  4PSX A;  1PJ7 A;  2JEW A;  3CCM B;  1GHE A;  4GS4 A;  3WC7 A;  1E1R A;  1YME A;  5I0C A;  4ACA A;  2HDN B;  1GAW A;  3CCS B;  3E20 A;  4PXD A;  4G5G A;  4R6T A;  2BN4 A;  4MI4 A;  3WQZ A;  1BAV A;  1EP3 B;  3Q39 A;  3FH4 A;  4RN7 A;  4R57 A;  4UCN A;  4AVA A;  3ASS A;  3FPK A;  4Z4Z A;  3D8P A;  1GVH A;  3TOA A;  4YHB A;  5E6T A;  2OK7 A;  4DJL A;  2K5T A;  5GV7 A;  5HMN A;  2O4H A;  1M90 D;  4PC2 A;  5JPH A;  5F48 A;  1R5B A;  2EO8 A;  4JWP A;  4XNH B;  4HNX B;  3VAR A;  2Z3K A;  3ZBU A;  3PEI A;  4RM0 A;  2GK6 A;  2I1L A;  4WWV A;  3A1P A;  4OID A;  4XR6 A;  4BMH A;  4II9 A;  4G6I A;  3B8G A;  1Q2Y A;  3KQZ A;  4KUB A;  2FX3 A;  1QFJ A;  3EFA A; 
#chains in the Genus database with same CATH homology
 3HUV A;  3FJU A;  4NJR A;  2ZOF A;  2PJA A;  2NYQ A;  4FBE A;  3BI1 A;  4R76 A;  3QNV A;  3GUX A;  3GLJ A;  1FT7 A;  4O23 A;  3IEH A;  1TF8 A;  1UWY A;  3SI1 A;  5LRK A;  1EE3 P;  4OIW A;  3FMC A;  3DGV A;  1Y0Y A;  1TKF A;  2PE3 A;  3IC1 A;  2C1C A;  2ZEM A;  4ZY1 A;  5I4M A;  2I3C A;  4OME A;  3T8W A;  1TKJ A;  3SI2 A;  3V38 A;  3IO1 A;  4DYO A;  4FUU A;  2F8H A;  1CP7 A;  2EWB A;  2HB6 A;  3NH4 A;  3D66 A;  4MRI A;  1CBX A;  2C6P A;  3CT9 A;  3NH5 A;  4BD9 A;  4OP4 A;  4P4E A;  2XEI A;  3CPX A;  2XEJ A;  5HVH A;  4ONW A;  3DLJ A;  3RAM A;  2IQ6 A;  3WC5 A;  1RTQ A;  1Z2L A;  5HVF A;  3VAT A;  1R3N A;  2V77 A;  3B3V A;  7CPA A;  4ZX9 A;  1HDQ A;  3KHZ A;  2PVW A;  3D67 A;  1YW6 A;  4P10 A;  1F2O A;  2F7V A;  2IJZ A;  4MCS A;  5JH9 A;  3WT4 A;  4NFR A;  4JZ0 A;  4NGT A;  4MHY A;  2XEF A;  3BI0 A;  4Q7A A;  2G9D A;  4CPA A;  5JM6 A;  3TX8 A;  3PB4 X;  2Q4Z A;  3KGQ A;  4F9V A;  1ZG8 A;  4OC2 A;  4P4B A;  3RBU A;  2DEA A;  4WJB A;  3PB9 X;  5JGF A;  3FED A;  4UEZ A;  4YWY A;  5LRJ A;  3I1U A;  1ZG9 A;  5LYD A;  2PJB A;  1AMP A;  4X8I A;  2HC9 A;  4P4I A;  5ELY A;  1LCP A;  4LQG A;  4OC4 A;  2PJC A;  2O53 A;  4NGS A;  3SI0 A;  2GRE A;  3IIB A;  4PXB A;  4A39 A;  3S9M A;  3GB0 A;  1CX8 A;  2PJ8 A;  1LOK A;  2BO9 A;  3D68 A;  3HLP A;  4NGM A;  5F09 A;  5LYF A;  4P6Y A;  1FNO A;  2AFX A;  4ZYQ A;  2XEG A;  6CPA A;  1XFO A;  3PB7 X;  5LRG A;  4F8Z A;  1NSA A;  2CIJ A;  1YW4 A;  2PRQ A;  3FF3 A;  5HXD A;  4EFD A;  5DS0 A;  1BLL E;  2V8H A;  2ZEL A;  4A37 A;  2ZEN A;  4PXC A;  1F2P A;  1ZG7 A;  2PCU A;  3PB8 X;  2POK A;  1Z8L A;  1XMB A;  4PXE A;  2CTC A;  2ZEE A;  4P4D A;  4X2T A;  2PJ4 A;  4EME A;  2FVG A;  2RB7 A;  1OBR A;  2PIY A;  4MCQ A;  4MCR A;  3NFZ A;  1IY7 A;  2ZEP A;  5K8M A;  2V8D A;  1KWM A;  3KR4 A;  1HDU A;  2ZED A;  3L2N A;  4R8F A;  2EK9 A;  2V8V A;  3S9L A;  1YSJ A;  3FEC A;  3K9T A;  3H8E A;  3B3W A;  3PFE A;  4P4J A;  1ARL A;  2CTB A;  2EK8 A;  3PRT A;  1Q7L A;  4MHN A;  2PJ3 A;  2ZEH A;  5THW A;  4UEE A;  1QQ9 A;  4JYW A;  4A38 A;  2WZN A;  1LAN A;  1VGY A;  3PBE A;  3SJG A;  3TC8 A;  4MCP A;  1BPN A;  4UIA A;  1AYE A;  1R43 A;  2GLJ A;  1QMU A;  4OC5 A;  3B2Y A;  3BXM A;  3CPA A;  4MMO A;  4A94 A;  2AFS A;  4OC1 A;  4RUH A;  3MN8 A;  3KI9 A;  5K8N A;  3SJE A;  1LAP A;  4NGP A;  1ZLI A;  3IJ3 A;  1VIX A;  5LYI A;  2PVV A;  5J1Q A;  4NGN A;  4P45 A;  4TWE A;  4NGR A;  1Y7E A;  3NH8 A;  1HEE A;  4G1P A;  5LYL A;  4DUK A;  4KSI A;  4GM5 A;  3N5F A;  4NJQ A;  2PJ7 A;  2V8G A;  3MRU A;  4MHZ A;  1PYT B;  2GU2 A;  1JQG A;  2VL1 A;  4P44 A;  2C6C A;  2PJ5 A;  3KAS A;  3B3C A;  2BCO A;  1TXR A;  3V7Z A;  3BHX A;  4UEF A;  4R7M A;  3PBB A;  1M4L A;  3D7G A;  4Z65 A;  3JRU A;  3ISZ A;  3NA6 A;  2JBJ A;  4H2K A;  3KQX A;  4OC3 A;  4PQA A;  3VH9 A;  3WAB A;  1CP6 A;  4ZI6 A;  4TNU A;  5K8P A;  2PJ1 A;  1IGB A;  4K3N A;  2QYV A;  3D7F A;  1Z5R A;  1ARM A;  2J9A A;  2RFH A;  5CPA A;  4IHM A;  3SJF A;  3KL9 A;  2ANP A;  3LMS A;  3S9N A;  2AFM A;  3KHX A;  2QVP A;  2PJ2 A;  4FWU A;  2WYR A;  2PJ9 A;  4F9U A;  8CPA A;  1VHO A;  4ZY2 A;  1F57 A;  3RZA A;  1PCA A;  1LAM A;  2GLF A;  3FVL A;  2ABZ A;  1CPS A;  4W9Y A;  1LFW A;  1TKH A;  3KR5 A;  1XRY A;  2OOT A;  1ZLH A;  4IK2 A;  3SJX A;  3PB6 X;  1H8L A;  3IFE A;  1ELL P;  1XBU A;  4OKO A;  4MXU A;  4IAV A;  4MHP A;  2BOA A;  1VHE A;  4OC0 A;  1CPX A;  3FX6 A;  3B35 A;  3K2K A;  5HVG A;  3KZW A;  5IB9 A;  4P4F A;  4UF4 A;  2PJ0 A;  2AFW A;  3D4U A;  2IMO A;  4X3R A;  1ELM P;  2ZEG A;  3CDX A;  3B3T A;  4FAI A;  2AFZ A;  2JEW A;  2QJ8 A;  3WC7 A;  4NGQ A;  1YME A;  4AXV A;  1XJO A;  2PJ6 A;  3FEE A;  4PXD A;  2AFU A;  1BPM A;  4R6T A;  4PPZ A;  3H8F A;  1GYT A;  3WC6 A;  1BAV A;  5K8O A;  1CG2 A;  3D7H A;  3ISX A;  3FH4 A;  3PFO A;  2C6G A;  4ZY0 A;  4EWT A;  3B7I A;  2PIZ A;  3IWW A;  4DJL A;  2Q51 A;  1DTD A;  1DE4 C;  5D8N A;  2ZEO A;  2O4H A;  1Y0R A;  2JBK A;  3D7D A;  4ZX8 A;  5D29 A;  4YU9 A;  1TF9 A;  2ZEF A;  4B6Z A;  2Q43 A;  4UIB A;  3VAR A;  2AFO A;  3B3S A;  2NSM A;  3PEI A;  1YLO A;  4WWV A;  4OID A;  2ZOG A;  3H8G A;  5CBM A;  2CF4 A;  3KQZ A;  3LWU A;  2OR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...