4X8IA

De novo crystal structure of the pyrococcus furiosus tet3 aminopeptidase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
346
structure length
337
Chain Sequence
MVDWELMKKIIESPGVSGYEHLGIRDLVVDILKDVADEVKIDKLGNVIAHFKGSAPKVMVAAHMDKIGLMVNHIDKDGYLRVVPIGGVLPETLIAQKIRFFTEKGERYGVVGVLPPHLRIDWDSIIVDVGASSREEAEEMGFRIGTIGEFAPNFTRLSEHRFATPYLDDRICLYAMIEAARQLGEHEADIYIVASVQEEIGLRGARVASFAIDPEVGIAMDVTFAKQPNDKGKIVPELGKGPVMDVGPNINPKLRQFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysyl aminopeptidase
publication title Tuned by metals: the TET peptidase activity is controlled by 3 metal binding sites.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 111
structure length 337
sequence length 346
chains with identical sequence B, C
ec nomenclature ec 3.4.11.15: Aminopeptidase Y.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 4x8iA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x8iA01
4X3RA 2PJ5A 1R3NA 1TF8A 1TKJA 1Q7LA 5LRJA 1FNOA 4P44A 2PJAA 4MHNA 2XEJA 1XFOA 4MCPA 3PEIA 3KL9A 3D68A 2OOTA 4OIDA 3WABA 1CP6A 4OC0A 3SJEA 2EK8A 4FBEA 5D29A 2C6PA 5LYFA 1ZG7A 5CPAA 4OC2A 3B2YA 5JM6A 3IEHA 3L2NA 4ONWA 4DUKA 3FH4A 2PJ8A 5K8MA 4NGSA 3PB4X 1DE4C 4IAVA 4PXDA 1BAVA 4OIWA 2DEAA 5D8NA 3WC5A 4OC5A 3SI0A 2XEIA 2V8VA 4G1PA 2PVWA 4MHPA 4BD9A 4FAIA 3H8FA 4TNUA 5JH9A 1LAPA 4P4FA 3S9LA 4NGQA 2ZEMA 4NGMA 1LCPA 1ARLA 4R8FA 3MN8A 4MCRA 3DGVA 2I3CA 4O23A 3K9TA 2ZEFA 4UIAA 2GLFA 2Q4ZA 4MXUA 3PB7X 2ZEOA 3D7DA 4PXEA 4EWTA 4UEFA 3RZAA 3KGQA 3NH4A 3NFZA 2V8HA 2FVGA 2PJBA 1IY7A 1HDUA 3FX6A 2AFOA 4P10A 3KQXA 1PCAA 1H8LA 5J1QA 2ANPA 4OC1A 2CTBA 3D7HA 4AXVA 3FJUA 2WYRA 3K2KA 3FMCA 1YLOA 4MCQA 3B7IA 1F2PA 3S9NA 2ZEGA 1OBRA 3PBEA 1YMEA 3FEDA 4MMOA 3GB0A 5LYIA 4IK2A 2PJ0A 2PJ6A 2ZEDA 4P4JA 4H2KA 4R7MA 1CX8A 3FEEA 3WC7A 2PJ9A 3TC8A 5LYLA 4KSIA 1KWMA 4Z65A 4ZY1A 2ZEHA 4NJRA 8CPAA 1Y7EA 4A37A 3I1UA 4EMEA 1ARMA 4PPZA 1VHEA 3RBUA 4YWYA 3KZWA 1XRYA 2AFXA 5HVHA 2ABZA 4R76A 3PBBA 5THWA 3IJ3A 1QMUA 3T8WA 3HUVA 1VGYA 1Z8LA 3SJXA 3IIBA 3KHXA 2IMOA 4F9UA 2IJZA 1TKHA 1AMPA 1NSAA 7CPAA 1Z5RA 3WT4A 2V8DA 1YW4A 4P4DA 4F9VA 1FT7A 2PJ7A 4F8ZA 4OMEA 5ELYA 2AFUA 4ZX9A 1ZLIA 2BOAA 4P45A 3LWUA 5LRGA 2PJ1A 1TF9A 3HLPA 1TXRA 3VARA 3FECA 3H8EA 3VATA 3D67A 3CPAA 4FWUA 3KHZA 2C6GA 4W9YA 2RFHA 3NH5A 4CPAA 5K8OA 1VIXA 2EK9A 3SJGA 3WC6A 4DYOA 4NJQA 2ZEEA 2PJ4A 1CP7A 5F09A 1RTQA 1HDQA 4MHYA 2G9DA 4A38A 3SI2A 1XMBA 2O53A 2J9AA 3IC1A 1HEEA 4EFDA 4PXBA 2WZNA 4ZX8A 4JYWA 2C1CA 1XJOA 5LYDA 3D7FA 5K8PA 3MRUA 4P4BA 4NFRA 4MRIA 2F7VA 4K3NA 3PFOA 2V8GA 2VL1A 3IWWA 4X8IA 2PCUA 3D7GA 2GLJA 1Y0YA 2CTCA 2PJ3A 4WJBA 2CIJA 1EE3P 4OP4A 4UEZA 4NGTA 3CDXA 2O4HA 5HXDA 3PB6X 3KQZA 1M4LA 2ZENA 2QYVA 3BHXA 4ZY2A 2POKA 4MHZA 4JZ0A 4MCSA 4IHMA 3JRUA 2HC9A 4NGNA 3IFEA 4OC4A 2QVPA 3ISZA 1TKFA 1Y0RA 2CF4A 5DS0A 1F2OA 3QNVA 3ISXA 4P4EA 5HVFA 2BCOA 2BO9A 3B3WA 2PRQA 3KASA 2AFSA 5I4MA 2XEFA 4A94A 5CBMA 4NGPA 4OC3A 3BXMA 2PE3A 3NH8A 3PRTA 4ZI6A 4TWEA 1AYEA 3PB9X 4OKOA 1F57A 3FF3A 1XBUA 2GU2A 3B3CA 4P4IA 2C6CA 2HB6A 2AFZA 3SJFA 2AFMA 2ZOFA 3H8GA 1Z2LA 3PFEA 3V38A 1CG2A 2IQ6A 2Q43A 3FVLA 4DJLA 4RUHA 3CT9A 4ZY0A 3B3SA 4A39A 5JGFA 3DLJA 4NGRA 3VH9A 1GYTA 2F8HA 2QJ8A 1UWYA 2PJCA 3B3VA 3D4UA 1BPNA 1YW6A 1CPSA 2NYQA 3LMSA 3PB8X 2JBKA 4PQAA 2Q51A 3S9MA 1ELLP 4YU9A 3KR4A 3TX8A 3N5FA 1DTDA 4X2TA 5IB9A 1QQ9A 2XEGA 3GLJA 3NA6A 1CPXA 2PJ2A 2PIZA 4Q7AA 1LANA 2ZOGA 1LFWA 4B6ZA 5HVGA 4FUUA 4UIBA 4PXCA 2JEWA 1VHOA 1YSJA 3BI1A 1ZLHA 5LRKA 1BLLE 2EWBA 2V77A 3RAMA 4WWVA 2PVVA 4UEEA 4GM5A 1ZG8A 4ZYQA 2NSMA 2PIYA 2GREA 1BPMA 1CBXA 1ZG9A 2ZELA 1PYTB 1JQGA 2RB7A 5K8NA 2ZEPA 1R43A 6CPAA 3V7ZA 3SI1A 4UF4A 2AFWA 3D66A 3KR5A 1LAMA 1ELMP 4P6YA 3GUXA 2OR4A 3B35A 1LOKA 3CPXA 3BI0A 2JBJA 3B3TA 4R6TA 1IGBA 3KI9A 4LQGA 3IO1A
chains in the Genus database with same CATH superfamily
2C4TA 4YHBA 1E64A 2BSAA 4YGOA 1FNOA 4P44A 4XOPA 3ZC3A 4CYNA 4Z4TA 1N71A 4II2A 2QMUA 1KK1A 3KL9A 1Q7YD 3CC4B 4OIDA 3CMMA 3IWEA 3WYAA 2EIXA 4ZGQB 1WORA 1DDGA 4YXWA 5IB0A 4FBEA 3OPOA 4MI4A 5FIUA 3JTKA 3D3SA 1NDHA 2WUUA 2YNDA 3L2NA 4U9YA 4X7DA 2PRBA 3SKBA 4OIWA 2DEAA 1CNEA 5D8NA 2ZW5A 3OOCA 1N05A 1DDIA 1CNFA 1T6XA 3Q3AA 2PVWA 1B6BA 1YVOA 4C2ZA 4TMWA 4FAIA 1IU8A 2Z3MA 3CCLB 2D4PA 3LVBA 4TNUA 2VBVA 1TIQA 2ZBUA 4FD6A 3S9LA 3KKWA 2I1LA 4TMZA 4WZKA 4O23A 4IF5A 3CMAB 2ZEFA 3K9TA 2Q4ZA 2B7BA 2VQYA 1QFYA 3JQPA 4L89A 2V7TA 3RZAA 4KOVA 4P26A 4H9GA 4X07A 3AVWA 4WQMA 3TE4A 2B7CA 2FVGA 1IY7A 4YAOA 3LACA 2EBJA 3H4QA 2AFOA 2B5GA 1BQEA 4P10A 1UD3A 4M3SA 1UMKA 4NXYA 1HA3A 1H8EA 4AXVA 3FJUA 3FMCA 3IGRA 4PC1A 1UD4A 3P2HA 3GYAA 3FEDA 2PLFA 5A88A 2XNCA 2V4DA 2HV2A 4IK2A 1VQ6B 4XLCA 4KLWA 1NE9A 4R7MA 3VMFA 1NB9A 2BPOA 3WC7A 2PJ9A 3TC8A 5LYLA 4KSIA 2OTLB 2GQFA 4K30A 4ZY1A 4NJRA 3D2PA 2CNDA 1Y7EA 3I1UA 4MFJA 4AF7A 4E0FA 1ARMA 5FO1A 4YWYA 4LUAA 2KVOA 4Q38A 3KZWA 2AFXA 4Q36A 4XN0A 4Y9RA 1QG0A 3VR6A 1QMUA 1N0VC 3LNNA 2G0BA 4HIZA 3VNVA 3OJXA 2BGIA 2ZBVA 2V8DA 2PJ7A 1W34A 1VQOB 4ZX9A 4P45A 1TXRA 3VATA 4YALA 4ZBGA 3CPAA 1I18A 4RDJA 3KHZA 2YNCC 4B5PA 2VNIA 4C2XA 4W9YA 2RFHA 1TVCA 3S6FA 4CPAA 2EK9A 1WOPA 1E3XA 4M4SA 1N0UA 2DYIA 2EVNA 4A95A 4LQ6A 1PKVA 2PJ4A 4RCZA 1EP2B 1CJWA 5F09A 1VQLB 2VYQA 3A9LA 2PQ8A 1YHQB 3FYNA 5KTDA 1XMBA 2O53A 2Q4YA 4PXBA 2WZNA 2EFGA 4QHYA 2HDNB 4JYWA 1QH0A 2XZOA 1KJZA 2C1CA 1G7CA 4P22A 1KC8D 1KUYA 2VJJA 4KKSA 5H5JA 1JJ2B 2J8MA 4NFRA 4WZLA 3BY2A 5GV8A 1D2EA 4MRIA 4K3NA 1AIPA 2VL1A 3OE7A 2PCUA 1YR0A 2NV4A 3BCDA 1M44A 3V7AA 1Y0YA 1BO4A 4LC0A 5EMNA 2CIJA 1EE3P 2O4HA 2R1IA 4XNHB 1JA1A 2DOGA 1VQ5B 4LBVA 1JNYA 2E1BA 3DDYA 4Z4WA 4NF1A 2BSWA 4A2ZA 5HH1A 3JRUA 4NGNA 4C7IA 3DNSA 2DIEA 2QVPA 2XNDA 3ISZA 1Y0RA 1TKFA 4DNTB 3G4SB 3OZWA 5DS0A 3ISXA 5HVFA 1VQ8B 1Z8TA 2DPSA 3IWGA 1WSVA 3KASA 1Y9KA 2XEFA 4KOTA 5F46A 3MMPA 1G7RA 2GFQA 4M6GA 1P4MA 2B5OA 3BXMA 2PE3A 1W87A 2YWEA 3B8HA 3PRTA 4TWEA 3K9UA 2K5TA 4DQLA 4AB7A 1XIXA 4M6HA 4RD1A 3PGPA 1P0HA 1WTHD 2OK8A 1R5OA 3AVVA 5GCNA 3GKRA 3EFAA 3TO7A 2IQ6A 2Q43A 1FY7A 1OGIA 1FNMA 1K4JA 1VQKB 4OP7A 3V8IA 2Q04A 3GSIA 1M1KD 4A39A 4AVCA 4NBSA 4OPOA 2F8HA 4UZEA 1UWYA 2PJCA 2IL4A 5GV7A 3GVJA 3B3VA 2YNCA 2VNKA 2ZITA 3GIRA 4KKUA 2ZPAA 3PB8X 2Q6KA 4CRYB 4YU9A 1IIDA 2REFA 3TX8A 1Q2DA 1ZM4A 1X12A 4A32A 4RD0A 2PR8A 2VXKA 2FCKA 4CYOA 2PJ2A 2Q6OA 3Q6RA 2ZOGA 2OH1A 4FUUA 2ZW7A 4P25A 2DPTA 4PXCA 1HVXA 2OBSA 3BNWA 4R9MA 1ZLHA 4FXUA 3ZBUA 5EMIA 3OJWA 1BLLE 4Z4VA 5F49A 5KNLA 4XN3A 3W6SA 4ORFA 3CXPA 3EY5A 4XOTA 2GREA 3WQZA 1CBXA 1ZG9A 2GANA 2GJKA 1QSNA 2RC5A 4UA3A 1V0FA 4XLFA 2CC2A 3V7ZA 3PUMA 4UF4A 3D66A 3KR5A 4QC6A 4X0CA 5H59A 1E79A 3QFRA 1KD1D 5FA6A 2B4DB 2X85A 4AF6A 2Z3PA 2ZXHA 3BI0A 5IYQA 3R9EA 4YAWA 1U2RA 5JBQA 5DSZA 5AN9A 1VJSA 1IGBA 1IJFA 4CRZB 2OBRA 2B5GB 4ZV4A 1OHHA 1R5NA 3IO1A 3FIXA 4E0AA 1TKJA 5LRJA 2PJAA 3ZUGA 1XFOA 1QVGB 3P27A 1YJWB 5AG7A 4ZGYB 2EK8A 2C6PA 5LYFA 1WP6A 1ZG7A 4BBHA 4E2AA 1Y9WA 4JLYA 4UCPA 3BJ7A 4ONWA 3OZVA 3WBJA 1M4GA 3WR7A 3TOAA 4NGSA 3LO8A 3FRMA 3AGQA 4IAVA 4M85A 4NSQA 1A2ZA 2GE3A 1VHSA 3WC5A 4FD7A 1YX0A 2AE6A 3PVDA 2XEIA 4P3YA 1S5KA 2Z10A 2AHOA 1PU9A 4MHPA 5E6TA 4U9UA 2B3UA 4MJ8A 4BD9A 4PC2A 1IB0A 2ZZGA 4RPDA 5TV2A 2Q7SA 3TCVA 4TMVA 3IU2A 2C5BA 2F4NA 1FNCA 1D8TA 4P4FA 2VBQA 3VWEA 4P3IA 4NGMA 1NJID 4R8FA 4OPSA 2LZJA 3ZJ0A 4MCRA 5ISVA 4YAFA 1W9XA 2GLFA 2WSAA 4MXUA 2QA4B 3PB7X 2DERA 3D7DA 3W2EA 5AG5A 2YWHA 3NH4A 1W0KA 1WDTA 1EP1B 3CESA 2V8HA 1COWA 2PJBA 3H94A 4KVME 4DK1A 1N08A 1ZUNB 2D9RA 1ON0A 2FL4A 4OC1A 2CTBA 2ZTNA 5TR9A 4TN1A 1YLOA 4PABA 4XR6A 2FX3A 3SJPA 3ZZTA 2VZYA 1BX1A 2JDDA 3B7IA 4PK3A 1F2PA 3S9NA 4JXRA 1QSOA 4RD4A 1YK3A 1MABA 4MMOA 2CBXA 2ZL6A 1VLYA 2RC6A 2PJ6A 2ZEDA 4OLLA 1H8HA 2JN9A 4M1KA 5IYPA 1NMTA 2ZW6A 4H2KA 4OPVA 1CX8A 3FEEA 4R71A 4B43A 2ARHA 1KWMA 1CM0A 3CRZA 1SKYB 4XPDB 1Q2YA 4UWJA 4CYPA 1UD2A 4PPZA 2DEUA 3LODA 1S4MA 2HLDA 1S3ZA 1N06A 2ZXIA 1VQMB 4R76A 5THWA 2REEA 3IJ3A 3T8WA 1VGYA 1Z8LA 3IIBA 1IOIA 2F1MA 2FIAA 1TKHA 1AMPA 4EVYA 1ZO0A 3QFCA 3CCUB 1Z5RA 1QGYA 4Q7JB 1K73D 1YW4A 4P4DA 2ZZFA 4B44A 4B10A 4F8ZA 4RM0A 2V7WA 2BOAA 1B2RA 5LRGA 2PJ1A 2JLMA 4X06A 3VARA 3FECA 1RQRA 3D67A 2C6GA 3NH5A 3SJGA 4TSFA 4DYOA 3EXNA 3AVUA 3GQBA 3WNCA 3NE5B 5BSYA 2BMWA 1EP3B 4AVZA 3PA2A 1MJ9A 5L46A 1NB0A 2GPJA 4C7HA 3G05A 3QFTA 3JU4A 4A38A 4F0YA 2J9AA 4B11A 1HEEA 2WPXA 4EFDA 4ASUA 1W2BB 3FPKA 3A1PA 4ROXA 3AGPA 5LYDA 4XORA 4JWPA 2B4DA 4PC6A 3BCFA 2XNJA 4P4BA 3LQEA 2V7VA 1K28D 3A8IA 4FWTA 3CXSA 3ZZIA 3D7GA 4C68A 1E1QA 3BLNA 1E43A 4WJBA 5I0CA 4MFQA 2WPDA 1R57A 5HXDA 3T9YA 4ZY2A 4OOVA 4MHZA 3QE2A 4MCSA 2O28A 1NSLA 2I79A 4XD7A 5F4OA 2J7KA 1JA0A 1RO5A 3QAHA 2ZTGA 3QNVA 4CYQA 2OZUA 2BCOA 1H85A 2BO9A 2WSSA 3B3WA 4KOSA 3SLDA 5I4MA 4Z1MA 2VI7A 2YWGA 3W5VA 1B87A 4NGPA 3RNZA 4UBRA 4PSWA 4B5OA 4ZI6A 3PB9X 4OKOA 4XLEA 4UZFA 3BC9A 2AFZA 5IYRA 5G1ZA 3JVNA 1EWYA 1VQ7B 2WJYA 2Z11A 2BV3A 1R5BA 2DETA 2BM1A 3PFEA 3V38A 2P3MA 1K8AD 5THXA 3G71B 4MYUA 3SEJA 3FPPA 3ASRA 3JUWA 5JGFA 3DLJA 4NGRA 1GYTA 5C88A 3D4UA 4LBWA 1BPNA 2BL1A 1CPSA 2NYQA 3R9FA 4BINA 3CPWB 2DY1A 3ZPNA 3A3BA 1VF7A 4XKWA 4NNJA 2OU2A 2QECA 4OOSA 5IYNA 5LMZA 3VNUA 4X2TA 3OKXA 1SM4A 4RDLA 3P26A 2JJ1A 2XEGA 3GLJA 2PIZA 1LANA 1Z4RA 1LFWA 3U6BA 5B6IA 1IYLA 2JEWA 1VHOA 3CP8A 1YSJA 3BI1A 4B13A 1XF8A 5C82A 2HUZA 2EWBA 4Z4RA 1G7SA 5HXBA 3CCSB 5J35A 3EO4A 1ZG8A 4ZGNB 2NSMA 3LQ6A 5KTCA 4QB9A 1V5VA 2FS5A 3IU1A 3QB8A 3H5ZA 3ES9A 4X5KA 1PJ6A 3ASQA 2RB7A 4X05A 1S7KA 3CB4A 3RY8A 5A89A 1KZFA 3B8GA 1R43A 6CPAA 2HCJB 3SI1A 4M6IA 2D74A 4LBZA 5H86A 4KS9A 1KZLA 2OB0A 3T53B 4FK8A 3GUXA 4CGLA 2OR4A 3B35A 3G8WA 2P6GA 3A8JA 3CPXA 2C77A 3WY9A 1FNDA 4B3GA 1IOFA 4MFLA 4R6TA 3OFNA 1GVHA 2Q4VA 3B78A 4CAVA 3KI9A 1QSMA 4LQGA 1GO2A 1WOSA 4ZCLA 4F6AA 5FL7A 4X3RA 4B3FX 4M53A 1R3NA 1LRZA 4XLHA 1TF8A 1Q7LA 4UCNA 4MHNA 1QGAA 2BM0A 2B3VA 2VBSA 1OZPA 3PEIA 3D68A 2YWFA 3WABA 1CP6A 4B48A 2D3NA 1NRKA 3AVTA 3TOBA 1Z9UA 3V76A 2BN4A 3ASTA 2I00A 4OC2A 2JJ2A 4U5YA 4UFXA 5CPAA 2JDCA 5KTAA 2P6FA 3CW2A 1BJKA 3IEHA 1S0UA 3C26A 2X53S 4NCNA 3D8PA 4DUKA 2XOKA 3FH4A 2PJ8A 4RS2A 2FT0A 1DE4C 2Z3OA 5EBVA 5IK2A 4PXDA 1N07A 4X7EA 4Y9UA 5KW9A 1NBMA 2OBTA 4OC5A 4KSFA 2XZLA 3Q38A 3SI0A 4YELA 4DNCA 2V8VA 3I3GA 2E1RA 3ASPA 3UY5A 1I12A 4PK2A 1DG1G 1XE4A 2YNEA 4OADA 4TT3A 3WNDA 4HPSA 1LAPA 3SHPA 4CAWA 3J81k 1Q82D 1QFZA 4RN7A 4X7FA 2X6XA 4TMXA 3MN8A 1GAQA 3DGVA 2I3CA 4M2LA 4QVTA 4UIAA 2CNMA 2W6JA 3HAGA 4B47A 1P4NA 1QGZA 2ZEOA 4HKFA 4QUSA 4XPLA 1WOOA 4EWTA 4UEFA 1GAWA 3F5BA 1L0CA 1VQ4B 3NFZA 2G3AA 4GQNA 1CQXA 4YRHA 1YGHA 3PUNA 4Z4SA 4P9SA 1KUVA 3FX6A 3OZUA 2ZL5A 1YIJB 1A8PA 1I7PA 3KQXA 1YLEA 2OK7A 4RPBA 5J1QA 4CAFA 4MHDA 4NCZA 3G6EB 4KUAA 3CD6B 5KSWB 1M4IA 2WYRA 5TY0A 5BSXA 4MCQA 2XEXA 2C27A 1E1RA 1Q81D 1U6MA 3TO9A 4DK0A 3PBEA 3RYOA 1MRZA 5AG6A 2QMLA 4CGMA 2GJPA 3R9GA 3E0KA 3W5UA 4WZTA 4P12A 1QSTA 1YQEA 1S60A 3OW2B 3OEHA 1H42A 3W91A 4KVXA 4R87A 1OGJA 2FSRA 2ZEHA 4A37A 4UFWA 2NMTA 4QBJA 1Q9SA 1I8DA 1QUEA 1VHEA 3RBUA 3W6XA 5DWMA 1XRYA 5HVHA 2X3UA 3PBBA 3HUVA 2VEZA 4YAUA 3KHXA 5J8CA 2QTLA 2V7UA 2VJIA 1IJEA 7CPAA 1Q2CA 1XEBA 4F9VA 5G21A 1FT7A 2ZZEA 4OMEA 4RD2A 5ELYA 2AFUA 2XGJA 4XLAA 2XZPA 3H8EA 4FWUA 4Z4YA 1IYKA 4JXQA 5K8OA 2VZLA 1VIXA 3TTHA 1VQPB 4HE6A 4UWIA 2X7BA 2VNHA 4NJQA 2ZEEA 4HNYB 4II3A 4IW3B 3FB3A 4KVOE 4FN5A 2G9DA 1I21A 2KCWA 3SI2A 2WR8A 2YGWA 3IC1A 4FD4A 3R95A 1EXMA 4ZX8A 5AG4A 3QAYA 4LX9A 3NE7A 3OW7A 1OB5A 1PUAA 2CRVA 2V8GA 1B23P 4KKTA 4X8IA 5DWNA 4J3GA 3OP1A 2CTCA 2PJ3A 3DR6A 4OP4A 4RDKA 4UEZA 4NGTA 1WWZA 3CDXA 1MJBA 2FE7A 3KQZA 1M4LA 4XL9A 4DNRB 3BHXA 1BOBA 2POKA 1AMOA 4II9A 1PJ7A 2NPFA 2W6IA 2GK6A 1UD5A 4PSXA 4JZ0A 4CAXA 2C4UA 4XQFA 4PC3A 4OC4A 2VBUA 2JEVA 2CF4A 3I56B 1F2OA 4Y49C 4P4EA 1X10A 1SQHA 2AFSA 1F60A 4A94A 4CGNA 1FX0A 1KK0A 5CBMA 2BUEA 4OC3A 2B4BA 2ZXVA 4AVAA 3U6KA 1F57A 4P4IA 1D1NA 4KZTA 1OB2A 2CK3A 3ONYA 4AG7A 2C5HA 3D26A 4HE5A 4N3GA 3VWDA 4P2NA 4JMQA 2R9VA 5A27A 5TRDA 3ZZUA 4ZY0A 1G7TA 1BPLA 2ODFA 5G20A 1EFRA 2BGJA 2QJ8A 5A28A 3QSYA 2HQYA 3ASSA 3SXOA 5BWAB 2DXQA 1Q86D 4RD3A 2Z6BD 2EO8A 1J9ZA 3NE8A 1ELLP 4KOUA 4TMTA 4MFZA 2P6EA 3AVXA 2Q0YA 1KK2A 4KUBA 1M1DA 1DTDA 1J4JA 5IB9A 1QQ9A 3R6JA 2Q6LA 1IB1E 4G1VA 2BEIA 4B6ZA 4RD6A 5HVGA 4UIBA 3D2MA 4A31A 2PR1A 4XNFA 5LRKA 4UAJA 2Q6IA 4HNWB 4C2YA 2V77A 1S7FA 4WWVA 1RXTA 4UEEA 4GM5A 3U2QA 1TUIA 1JWQA 4ZYQA 2FXFA 4B3XA 2DF5A 3CCMB 2PIYA 2HMAA 3FJOA 2WPWA 2ZELA 1PYTB 2CW5A 5F47A 1JQGA 1FDRA 1FNBA 4N3NA 1UD6A 3W2GA 2B58A 1KTVA 1UFHA 3BH4A 2WZPP 4ZCIA 2CNSA 4XPDC 1JB9A 4L8AA 4CQJA 3JQRA 1ZM9A 1ELOA 4H89A 1GR1A 4CS0B 4QVJA 1LOKA 3E1YE 1YI2B 1RQPA 3W5HA 4HNXB 4NEXA 3H9NA 4PGOA 1WSRA 4MY3A 4PV6A 2PSWA 4IUSA 4MFPA 4P6VF 4RI1A 2PDOA 2PJ5A 2XEJA 2A4NA 3P2FA 4MCPA 2OOTA 1OB0A 4AVBA 3W2IA 4L8JA 4OC0A 5J3OA 3SJEA 4XONA 1E3ZA 3TO6A 5D29A 3GY9A 2OZGA 4GXHA 1IICA 1IHMA 2C78A 3B2YA 5JM6A 3I9SA 3BJ8A 4JJXA 5F4MA 1KRHA 5K8MA 3PB4X 2F5IA 4ACAA 3RO0A 1BAVA 1XOVA 1HZEA 1VQNB 3VO2A 2GK7A 2OYNA 3N7ZA 3CCVB 3MHPA 2F43A 3T90A 3T51B 4G1PA 4G7XA 1UD8A 2QDXA 4CAEA 3H8FA 3ZBTA 3FBUA 4R3KA 1KQSB 2V7QA 5JH9A 1T5EA 1W0JA 1I1DA 1TTTA 1TLLA 2ATRA 4NGQA 3S6KA 2ZEMA 1V0EA 4E8OA 1KUXA 1LCPA 1YREA 4RJLA 1ARLA 1FRQA 2R6HA 4YEJA 5HKKA 2CY2A 4QV2A 2V31A 5HZAA 2QGGA 1XE1A 4CGOA 4KOYA 4KOXA 3CC7B 2Z3NA 1EFTA 4PXEA 2P0WA 3GIUA 3KGQA 2DCUA 4DQKA 3CCEB 1E62A 1BMFA 5HZBA 2VZZA 2F1LA 3I1FA 1HDUA 2R8VA 1N8RD 1PCAA 4JD6A 4MYTA 1H8LA 1WPCA 4RCYA 2ANPA 3R6KA 1VQ9B 3D7HA 4A30A 3K2KA 3OWCA 2AJ6A 1VKCA 2PMDA 2ZEGA 1OBRA 3PA1A 2VBTA 1YMEA 5CDFA 4H6UA 3GB0A 5LYIA 3R96A 3F8KA 2PJ0A 4P4JA 2Z0ZA 5H84A 1W35A 4UZUA 5IX3A 3ZIAA 2H5MA 1EFUA 3TFYA 4Z65A 4MBUA 8CPAA 3SXNA 5F4JA 3CCRB 4EMEA 2PC1A 3F0AA 4PC7A 2Q44A 4QVAA 2OTJB 3TT2A 2ABZA 5FVJA 1PJ5A 2ZL7A 1Z8WA 3SJXA 3G3SA 4C0SA 2IMOA 2V7XA 4F9UA 5E96A 2D4OA 3GVLA 2IJZA 4I49A 2JIZA 5IV0A 1NSAA 4XMYA 4AG9A 4TKOB 3WT4A 3AVYA 1QX4A 1EFCA 4G7WA 1K9MD 3ZZ0A 1ZLIA 3MCAA 1WK4A 2D3LA 3LWUA 2X0KA 3W2HA 1TF9A 2WJVA 3HLPA 4YFJA 1GJRA 1AUGA 4B4DA 1FRNA 3FXTA 4PAAA 2QEXB 2QE7A 4C43A 5FO0A 2J8NA 3WC6A 4QFMA 1SKQA 3EC4A 1CP7A 5F48A 2ZW4A 2VNJA 1RTQA 5FNZA 1QVFB 1HDQA 4XNHC 4MHYA 3PZJA 1BLIA 1GHEA 3T56B 3CZXA 4MFKA 3DDDA 1XJOA 5EC4A 3JQQA 2RC4A 3ONUA 3D7FA 4U9ZA 5K8PA 3MRUA 4ACBA 2F7VA 3PFOA 5IYWA 4XPKA 3IWWA 2Z3KA 3CXCB 1M90D 4OAEA 2GLJA 2G3TA 4J0QA 2M5SA 1Z8XA 3SLNA 5G22A 4QUZA 3WNBA 1V0CA 5J8FA 3PB6X 2ZENA 2QYVA 3CP2A 1T6ZA 4XM3A 3A35A 4CGPA 1QSRA 1XB2A 4IHMA 3W2FA 2HC9A 3I55B 4MY0A 3IFEA 1M4DA 1Z4EA 4KOWA 2JDIA 3LD2A 4XKVA 4RLZA 4H6ZA 3E20A 3CCQB 1BX0A 4K1XA 3WXMA 2PRQA 2C2WA 5DN6A 1YJ9B 2OZHA 2QN6A 3A3GA 4ZCMA 3NH8A 1YX2A 1AYEA 1YVKA 2X6WA 3CXQA 1QFJA 3MGDA 3FF3A 1XBUA 2GU2A 3B3CA 1ZM2A 3CCJB 4X7CA 2C6CA 2HB6A 2Z3LA 4ONUA 3Q39A 3Q6QA 3SJFA 3PENA 2AFMA 2ZOFA 1VLOA 3H8GA 1Z2LA 4EH1A 1CG2A 4UCMA 4Y49B 1XMTA 2PIAA 3PP9A 2CXAA 3FVLA 4DJLA 4RUHA 3CT9A 3B82A 2Y0MA 3VO1A 4WZEA 3B3SA 4G6IA 3KEWA 3VH9A 2QTZA 4B14A 3CMEB 1MK4A 1YW6A 1DARA 5CNPA 3LMSA 2R7HA 1KK3A 2JBKA 4PQAA 2Q51A 1S7NA 5AGEA 3S9MA 2QIRA 2ZZQA 3KR4A 1S7LA 3N5FA 3QFSA 1YJNB 2X8KA 4GS4A 3BY1A 3DR8A 4BMHA 3FNCA 5A8AA 1CPXA 3CTAA 3NA6A 4Q7AA 3S6HA 4A33A 2X6YA 1QUFA 4F0XA 5HMNA 1S72B 2BF4A 3BQJA 4M0LA 3WBKA 1MJAA 2GJRA 3OEEA 4KLVA 4BPRA 2BVNA 1YITB 2Q7BA 4AC9A 3RAMA 2PVVA 4B5PB 1KMHA 4OOXA 2EUIA 2FIWA 1XQBA 4P1VA 3GVKA 4B12A 4Z4ZA 1ZM3A 1BPMA 1T6YA 3DSBA 4FD5A 3R1KA 2R98A 5K8NA 2ZEPA 4KSAA 5JQ4A 5JPHA 2AFWA 2CNTA 1LAMA 4P6YA 1ELMP 2GIVA 4R3LA 3S6GA 4G5GA 3FKSA 4KORA 1E63A 1F20A 4R57A 4F7DA 2J8RA 2JBJA 4Z4UA 3SJZA 3B3TA 3OAAA 1Y7RA 1WU8A 4Y7CA 4UFVA 3A8KA 4LBYA 4G1BA 3CC2B
chains in the Genus database with same CATH topology
4X3RA 2PJ5A 1R3NA 1TF8A 1TKJA 1Q7LA 5LRJA 1FNOA 4P44A 2PJAA 4MHNA 2XEJA 1XFOA 4MCPA 3PEIA 3KL9A 3D68A 2OOTA 4OIDA 3WABA 1CP6A 4OC0A 3SJEA 2EK8A 4FBEA 5D29A 2C6PA 5LYFA 1ZG7A 5CPAA 4OC2A 3B2YA 5JM6A 3IEHA 3L2NA 4ONWA 4DUKA 3FH4A 2PJ8A 5K8MA 4NGSA 3PB4X 1DE4C 4IAVA 4PXDA 1BAVA 4OIWA 2DEAA 5D8NA 3WC5A 4OC5A 3SI0A 2XEIA 2V8VA 4G1PA 2PVWA 4MHPA 4BD9A 4FAIA 3H8FA 4TNUA 5JH9A 1LAPA 4P4FA 3S9LA 4NGQA 2ZEMA 4NGMA 1LCPA 1ARLA 4R8FA 3MN8A 4MCRA 3DGVA 2I3CA 4O23A 3K9TA 2ZEFA 4UIAA 2GLFA 2Q4ZA 4MXUA 3PB7X 2ZEOA 3D7DA 4PXEA 4EWTA 4UEFA 3RZAA 3KGQA 3NH4A 3NFZA 2V8HA 2FVGA 2PJBA 1IY7A 1HDUA 3FX6A 2AFOA 4P10A 3KQXA 1PCAA 1H8LA 5J1QA 2ANPA 4OC1A 2CTBA 3D7HA 4AXVA 3FJUA 2WYRA 3K2KA 3FMCA 1YLOA 4MCQA 3B7IA 1F2PA 3S9NA 2ZEGA 1OBRA 3PBEA 1YMEA 3FEDA 4MMOA 3GB0A 5LYIA 4IK2A 2PJ0A 2PJ6A 2ZEDA 4P4JA 4H2KA 4R7MA 1CX8A 3FEEA 3WC7A 2PJ9A 3TC8A 5LYLA 4KSIA 1KWMA 4Z65A 4ZY1A 2ZEHA 4NJRA 8CPAA 1Y7EA 4A37A 3I1UA 4EMEA 1ARMA 4PPZA 1VHEA 3RBUA 4YWYA 3KZWA 1XRYA 2AFXA 5HVHA 2ABZA 4R76A 3PBBA 5THWA 3IJ3A 1QMUA 3T8WA 3HUVA 1VGYA 1Z8LA 3SJXA 3IIBA 3KHXA 2IMOA 4F9UA 2IJZA 1TKHA 1AMPA 1NSAA 7CPAA 1Z5RA 3WT4A 2V8DA 1YW4A 4P4DA 4F9VA 1FT7A 2PJ7A 4F8ZA 4OMEA 5ELYA 2AFUA 4ZX9A 1ZLIA 2BOAA 4P45A 3LWUA 5LRGA 2PJ1A 1TF9A 3HLPA 1TXRA 3VARA 3FECA 3H8EA 3VATA 3D67A 3CPAA 4FWUA 3KHZA 2C6GA 4W9YA 2RFHA 3NH5A 4CPAA 5K8OA 1VIXA 2EK9A 3SJGA 3WC6A 4DYOA 4NJQA 2ZEEA 2PJ4A 1CP7A 5F09A 1RTQA 1HDQA 4MHYA 2G9DA 4A38A 3SI2A 1XMBA 2O53A 2J9AA 3IC1A 1HEEA 4EFDA 4PXBA 2WZNA 4ZX8A 4JYWA 2C1CA 1XJOA 5LYDA 3D7FA 5K8PA 3MRUA 4P4BA 4NFRA 4MRIA 2F7VA 4K3NA 3PFOA 2V8GA 2VL1A 3IWWA 4X8IA 2PCUA 3D7GA 2GLJA 1Y0YA 2CTCA 2PJ3A 4WJBA 2CIJA 1EE3P 4OP4A 4UEZA 4NGTA 3CDXA 2O4HA 5HXDA 3PB6X 3KQZA 1M4LA 2ZENA 2QYVA 3BHXA 4ZY2A 2POKA 4MHZA 4JZ0A 4MCSA 4IHMA 3JRUA 2HC9A 4NGNA 3IFEA 4OC4A 2QVPA 3ISZA 1TKFA 1Y0RA 2CF4A 5DS0A 1F2OA 3QNVA 3ISXA 4P4EA 5HVFA 2BCOA 2BO9A 3B3WA 2PRQA 3KASA 2AFSA 5I4MA 2XEFA 4A94A 5CBMA 4NGPA 4OC3A 3BXMA 2PE3A 3NH8A 3PRTA 4ZI6A 4TWEA 1AYEA 3PB9X 4OKOA 1F57A 3FF3A 1XBUA 2GU2A 3B3CA 4P4IA 2C6CA 2HB6A 2AFZA 3SJFA 2AFMA 2ZOFA 3H8GA 1Z2LA 3PFEA 3V38A 1CG2A 2IQ6A 2Q43A 3FVLA 4DJLA 4RUHA 3CT9A 4ZY0A 3B3SA 4A39A 5JGFA 3DLJA 4NGRA 3VH9A 1GYTA 2F8HA 2QJ8A 1UWYA 2PJCA 3B3VA 3D4UA 1BPNA 1YW6A 1CPSA 2NYQA 3LMSA 3PB8X 2JBKA 4PQAA 2Q51A 3S9MA 1ELLP 4YU9A 3KR4A 3TX8A 3N5FA 1DTDA 4X2TA 5IB9A 1QQ9A 2XEGA 3GLJA 3NA6A 1CPXA 2PJ2A 2PIZA 4Q7AA 1LANA 2ZOGA 1LFWA 4B6ZA 5HVGA 4FUUA 4UIBA 4PXCA 2JEWA 1VHOA 1YSJA 3BI1A 1ZLHA 5LRKA 1BLLE 2EWBA 2V77A 3RAMA 4WWVA 2PVVA 4UEEA 4GM5A 1ZG8A 4ZYQA 2NSMA 2PIYA 2GREA 1BPMA 1CBXA 1ZG9A 2ZELA 1PYTB 1JQGA 2RB7A 5K8NA 2ZEPA 1R43A 6CPAA 3V7ZA 3SI1A 4UF4A 2AFWA 3D66A 3KR5A 1LAMA 1ELMP 4P6YA 3GUXA 2OR4A 3B35A 1LOKA 3CPXA 3BI0A 2JBJA 3B3TA 4R6TA 1IGBA 3KI9A 4LQGA 3IO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3R A;  2PJ5 A;  1R3N A;  1TF8 A;  1TKJ A;  1Q7L A;  5LRJ A;  1FNO A;  4P44 A;  2PJA A;  4MHN A;  2XEJ A;  1XFO A;  4MCP A;  3PEI A;  3KL9 A;  3D68 A;  2OOT A;  4OID A;  3WAB A;  1CP6 A;  4OC0 A;  3SJE A;  2EK8 A;  4FBE A;  5D29 A;  2C6P A;  5LYF A;  1ZG7 A;  5CPA A;  4OC2 A;  3B2Y A;  5JM6 A;  3IEH A;  3L2N A;  4ONW A;  4DUK A;  3FH4 A;  2PJ8 A;  5K8M A;  4NGS A;  3PB4 X;  1DE4 C;  4IAV A;  4PXD A;  1BAV A;  4OIW A;  2DEA A;  5D8N A;  3WC5 A;  4OC5 A;  3SI0 A;  2XEI A;  2V8V A;  4G1P A;  2PVW A;  4MHP A;  4BD9 A;  4FAI A;  3H8F A;  4TNU A;  5JH9 A;  1LAP A;  4P4F A;  3S9L A;  4NGQ A;  2ZEM A;  4NGM A;  1LCP A;  1ARL A;  4R8F A;  3MN8 A;  4MCR A;  3DGV A;  2I3C A;  4O23 A;  3K9T A;  2ZEF A;  4UIA A;  2GLF A;  2Q4Z A;  4MXU A;  3PB7 X;  2ZEO A;  3D7D A;  4PXE A;  4EWT A;  4UEF A;  3RZA A;  3KGQ A;  3NH4 A;  3NFZ A;  2V8H A;  2FVG A;  2PJB A;  1IY7 A;  1HDU A;  3FX6 A;  2AFO A;  4P10 A;  3KQX A;  1PCA A;  1H8L A;  5J1Q A;  2ANP A;  4OC1 A;  2CTB A;  3D7H A;  4AXV A;  3FJU A;  2WYR A;  3K2K A;  3FMC A;  1YLO A;  4MCQ A;  3B7I A;  1F2P A;  3S9N A;  2ZEG A;  1OBR A;  3PBE A;  1YME A;  3FED A;  4MMO A;  3GB0 A;  5LYI A;  4IK2 A;  2PJ0 A;  2PJ6 A;  2ZED A;  4P4J A;  4H2K A;  4R7M A;  1CX8 A;  3FEE A;  3WC7 A;  2PJ9 A;  3TC8 A;  5LYL A;  4KSI A;  1KWM A;  4Z65 A;  4ZY1 A;  2ZEH A;  4NJR A;  8CPA A;  1Y7E A;  4A37 A;  3I1U A;  4EME A;  1ARM A;  4PPZ A;  1VHE A;  3RBU A;  4YWY A;  3KZW A;  1XRY A;  2AFX A;  5HVH A;  2ABZ A;  4R76 A;  3PBB A;  5THW A;  3IJ3 A;  1QMU A;  3T8W A;  3HUV A;  1VGY A;  1Z8L A;  3SJX A;  3IIB A;  3KHX A;  2IMO A;  4F9U A;  2IJZ A;  1TKH A;  1AMP A;  1NSA A;  7CPA A;  1Z5R A;  3WT4 A;  2V8D A;  1YW4 A;  4P4D A;  4F9V A;  1FT7 A;  2PJ7 A;  4F8Z A;  4OME A;  5ELY A;  2AFU A;  4ZX9 A;  1ZLI A;  2BOA A;  4P45 A;  3LWU A;  5LRG A;  2PJ1 A;  1TF9 A;  3HLP A;  1TXR A;  3VAR A;  3FEC A;  3H8E A;  3VAT A;  3D67 A;  3CPA A;  4FWU A;  3KHZ A;  2C6G A;  4W9Y A;  2RFH A;  3NH5 A;  4CPA A;  5K8O A;  1VIX A;  2EK9 A;  3SJG A;  3WC6 A;  4DYO A;  4NJQ A;  2ZEE A;  2PJ4 A;  1CP7 A;  5F09 A;  1RTQ A;  1HDQ A;  4MHY A;  2G9D A;  4A38 A;  3SI2 A;  1XMB A;  2O53 A;  2J9A A;  3IC1 A;  1HEE A;  4EFD A;  4PXB A;  2WZN A;  4ZX8 A;  4JYW A;  2C1C A;  1XJO A;  5LYD A;  3D7F A;  5K8P A;  3MRU A;  4P4B A;  4NFR A;  4MRI A;  2F7V A;  4K3N A;  3PFO A;  2V8G A;  2VL1 A;  3IWW A;  4X8I A;  2PCU A;  3D7G A;  2GLJ A;  1Y0Y A;  2CTC A;  2PJ3 A;  4WJB A;  2CIJ A;  1EE3 P;  4OP4 A;  4UEZ A;  4NGT A;  3CDX A;  2O4H A;  5HXD A;  3PB6 X;  3KQZ A;  1M4L A;  2ZEN A;  2QYV A;  3BHX A;  4ZY2 A;  2POK A;  4MHZ A;  4JZ0 A;  4MCS A;  4IHM A;  3JRU A;  2HC9 A;  4NGN A;  3IFE A;  4OC4 A;  2QVP A;  3ISZ A;  1TKF A;  1Y0R A;  2CF4 A;  5DS0 A;  1F2O A;  3QNV A;  3ISX A;  4P4E A;  5HVF A;  2BCO A;  2BO9 A;  3B3W A;  2PRQ A;  3KAS A;  2AFS A;  5I4M A;  2XEF A;  4A94 A;  5CBM A;  4NGP A;  4OC3 A;  3BXM A;  2PE3 A;  3NH8 A;  3PRT A;  4ZI6 A;  4TWE A;  1AYE A;  3PB9 X;  4OKO A;  1F57 A;  3FF3 A;  1XBU A;  2GU2 A;  3B3C A;  4P4I A;  2C6C A;  2HB6 A;  2AFZ A;  3SJF A;  2AFM A;  2ZOF A;  3H8G A;  1Z2L A;  3PFE A;  3V38 A;  1CG2 A;  2IQ6 A;  2Q43 A;  3FVL A;  4DJL A;  4RUH A;  3CT9 A;  4ZY0 A;  3B3S A;  4A39 A;  5JGF A;  3DLJ A;  4NGR A;  3VH9 A;  1GYT A;  2F8H A;  2QJ8 A;  1UWY A;  2PJC A;  3B3V A;  3D4U A;  1BPN A;  1YW6 A;  1CPS A;  2NYQ A;  3LMS A;  3PB8 X;  2JBK A;  4PQA A;  2Q51 A;  3S9M A;  1ELL P;  4YU9 A;  3KR4 A;  3TX8 A;  3N5F A;  1DTD A;  4X2T A;  5IB9 A;  1QQ9 A;  2XEG A;  3GLJ A;  3NA6 A;  1CPX A;  2PJ2 A;  2PIZ A;  4Q7A A;  1LAN A;  2ZOG A;  1LFW A;  4B6Z A;  5HVG A;  4FUU A;  4UIB A;  4PXC A;  2JEW A;  1VHO A;  1YSJ A;  3BI1 A;  1ZLH A;  5LRK A;  1BLL E;  2EWB A;  2V77 A;  3RAM A;  4WWV A;  2PVV A;  4UEE A;  4GM5 A;  1ZG8 A;  4ZYQ A;  2NSM A;  2PIY A;  2GRE A;  1BPM A;  1CBX A;  1ZG9 A;  2ZEL A;  1PYT B;  1JQG A;  2RB7 A;  5K8N A;  2ZEP A;  1R43 A;  6CPA A;  3V7Z A;  3SI1 A;  4UF4 A;  2AFW A;  3D66 A;  3KR5 A;  1LAM A;  1ELM P;  4P6Y A;  3GUX A;  2OR4 A;  3B35 A;  1LOK A;  3CPX A;  3BI0 A;  2JBJ A;  3B3T A;  4R6T A;  1IGB A;  3KI9 A;  4LQG A;  3IO1 A; 
#chains in the Genus database with same CATH topology
 2C4T A;  4YHB A;  1E64 A;  2BSA A;  4YGO A;  1FNO A;  4P44 A;  4XOP A;  3ZC3 A;  4CYN A;  4Z4T A;  1N71 A;  4II2 A;  2QMU A;  1KK1 A;  3KL9 A;  1Q7Y D;  3CC4 B;  4OID A;  3CMM A;  3IWE A;  3WYA A;  2EIX A;  4ZGQ B;  1WOR A;  1DDG A;  4YXW A;  5IB0 A;  4FBE A;  3OPO A;  4MI4 A;  5FIU A;  3JTK A;  3D3S A;  1NDH A;  2WUU A;  2YND A;  3L2N A;  4U9Y A;  4X7D A;  2PRB A;  3SKB A;  4OIW A;  2DEA A;  1CNE A;  5D8N A;  2ZW5 A;  3OOC A;  1N05 A;  1DDI A;  1CNF A;  1T6X A;  3Q3A A;  2PVW A;  1B6B A;  1YVO A;  4C2Z A;  4TMW A;  4FAI A;  1IU8 A;  2Z3M A;  3CCL B;  2D4P A;  3LVB A;  4TNU A;  2VBV A;  1TIQ A;  2ZBU A;  4FD6 A;  3S9L A;  3KKW A;  2I1L A;  4TMZ A;  4WZK A;  4O23 A;  4IF5 A;  3CMA B;  2ZEF A;  3K9T A;  2Q4Z A;  2B7B A;  2VQY A;  1QFY A;  3JQP A;  4L89 A;  2V7T A;  3RZA A;  4KOV A;  4P26 A;  4H9G A;  4X07 A;  3AVW A;  4WQM A;  3TE4 A;  2B7C A;  2FVG A;  1IY7 A;  4YAO A;  3LAC A;  2EBJ A;  3H4Q A;  2AFO A;  2B5G A;  1BQE A;  4P10 A;  1UD3 A;  4M3S A;  1UMK A;  4NXY A;  1HA3 A;  1H8E A;  4AXV A;  3FJU A;  3FMC A;  3IGR A;  4PC1 A;  1UD4 A;  3P2H A;  3GYA A;  3FED A;  2PLF A;  5A88 A;  2XNC A;  2V4D A;  2HV2 A;  4IK2 A;  1VQ6 B;  4XLC A;  4KLW A;  1NE9 A;  4R7M A;  3VMF A;  1NB9 A;  2BPO A;  3WC7 A;  2PJ9 A;  3TC8 A;  5LYL A;  4KSI A;  2OTL B;  2GQF A;  4K30 A;  4ZY1 A;  4NJR A;  3D2P A;  2CND A;  1Y7E A;  3I1U A;  4MFJ A;  4AF7 A;  4E0F A;  1ARM A;  5FO1 A;  4YWY A;  4LUA A;  2KVO A;  4Q38 A;  3KZW A;  2AFX A;  4Q36 A;  4XN0 A;  4Y9R A;  1QG0 A;  3VR6 A;  1QMU A;  1N0V C;  3LNN A;  2G0B A;  4HIZ A;  3VNV A;  3OJX A;  2BGI A;  2ZBV A;  2V8D A;  2PJ7 A;  1W34 A;  1VQO B;  4ZX9 A;  4P45 A;  1TXR A;  3VAT A;  4YAL A;  4ZBG A;  3CPA A;  1I18 A;  4RDJ A;  3KHZ A;  2YNC C;  4B5P A;  2VNI A;  4C2X A;  4W9Y A;  2RFH A;  1TVC A;  3S6F A;  4CPA A;  2EK9 A;  1WOP A;  1E3X A;  4M4S A;  1N0U A;  2DYI A;  2EVN A;  4A95 A;  4LQ6 A;  1PKV A;  2PJ4 A;  4RCZ A;  1EP2 B;  1CJW A;  5F09 A;  1VQL B;  2VYQ A;  3A9L A;  2PQ8 A;  1YHQ B;  3FYN A;  5KTD A;  1XMB A;  2O53 A;  2Q4Y A;  4PXB A;  2WZN A;  2EFG A;  4QHY A;  2HDN B;  4JYW A;  1QH0 A;  2XZO A;  1KJZ A;  2C1C A;  1G7C A;  4P22 A;  1KC8 D;  1KUY A;  2VJJ A;  4KKS A;  5H5J A;  1JJ2 B;  2J8M A;  4NFR A;  4WZL A;  3BY2 A;  5GV8 A;  1D2E A;  4MRI A;  4K3N A;  1AIP A;  2VL1 A;  3OE7 A;  2PCU A;  1YR0 A;  2NV4 A;  3BCD A;  1M44 A;  3V7A A;  1Y0Y A;  1BO4 A;  4LC0 A;  5EMN A;  2CIJ A;  1EE3 P;  2O4H A;  2R1I A;  4XNH B;  1JA1 A;  2DOG A;  1VQ5 B;  4LBV A;  1JNY A;  2E1B A;  3DDY A;  4Z4W A;  4NF1 A;  2BSW A;  4A2Z A;  5HH1 A;  3JRU A;  4NGN A;  4C7I A;  3DNS A;  2DIE A;  2QVP A;  2XND A;  3ISZ A;  1Y0R A;  1TKF A;  4DNT B;  3G4S B;  3OZW A;  5DS0 A;  3ISX A;  5HVF A;  1VQ8 B;  1Z8T A;  2DPS A;  3IWG A;  1WSV A;  3KAS A;  1Y9K A;  2XEF A;  4KOT A;  5F46 A;  3MMP A;  1G7R A;  2GFQ A;  4M6G A;  1P4M A;  2B5O A;  3BXM A;  2PE3 A;  1W87 A;  2YWE A;  3B8H A;  3PRT A;  4TWE A;  3K9U A;  2K5T A;  4DQL A;  4AB7 A;  1XIX A;  4M6H A;  4RD1 A;  3PGP A;  1P0H A;  1WTH D;  2OK8 A;  1R5O A;  3AVV A;  5GCN A;  3GKR A;  3EFA A;  3TO7 A;  2IQ6 A;  2Q43 A;  1FY7 A;  1OGI A;  1FNM A;  1K4J A;  1VQK B;  4OP7 A;  3V8I A;  2Q04 A;  3GSI A;  1M1K D;  4A39 A;  4AVC A;  4NBS A;  4OPO A;  2F8H A;  4UZE A;  1UWY A;  2PJC A;  2IL4 A;  5GV7 A;  3GVJ A;  3B3V A;  2YNC A;  2VNK A;  2ZIT A;  3GIR A;  4KKU A;  2ZPA A;  3PB8 X;  2Q6K A;  4CRY B;  4YU9 A;  1IID A;  2REF A;  3TX8 A;  1Q2D A;  1ZM4 A;  1X12 A;  4A32 A;  4RD0 A;  2PR8 A;  2VXK A;  2FCK A;  4CYO A;  2PJ2 A;  2Q6O A;  3Q6R A;  2ZOG A;  2OH1 A;  4FUU A;  2ZW7 A;  4P25 A;  2DPT A;  4PXC A;  1HVX A;  2OBS A;  3BNW A;  4R9M A;  1ZLH A;  4FXU A;  3ZBU A;  5EMI A;  3OJW A;  1BLL E;  4Z4V A;  5F49 A;  5KNL A;  4XN3 A;  3W6S A;  4ORF A;  3CXP A;  3EY5 A;  4XOT A;  2GRE A;  3WQZ A;  1CBX A;  1ZG9 A;  2GAN A;  2GJK A;  1QSN A;  2RC5 A;  4UA3 A;  1V0F A;  4XLF A;  2CC2 A;  3V7Z A;  3PUM A;  4UF4 A;  3D66 A;  3KR5 A;  4QC6 A;  4X0C A;  5H59 A;  1E79 A;  3QFR A;  1KD1 D;  5FA6 A;  2B4D B;  2X85 A;  4AF6 A;  2Z3P A;  2ZXH A;  3BI0 A;  5IYQ A;  3R9E A;  4YAW A;  1U2R A;  5JBQ A;  5DSZ A;  5AN9 A;  1VJS A;  1IGB A;  1IJF A;  4CRZ B;  2OBR A;  2B5G B;  4ZV4 A;  1OHH A;  1R5N A;  3IO1 A;  3FIX A;  4E0A A;  1TKJ A;  5LRJ A;  2PJA A;  3ZUG A;  1XFO A;  1QVG B;  3P27 A;  1YJW B;  5AG7 A;  4ZGY B;  2EK8 A;  2C6P A;  5LYF A;  1WP6 A;  1ZG7 A;  4BBH A;  4E2A A;  1Y9W A;  4JLY A;  4UCP A;  3BJ7 A;  4ONW A;  3OZV A;  3WBJ A;  1M4G A;  3WR7 A;  3TOA A;  4NGS A;  3LO8 A;  3FRM A;  3AGQ A;  4IAV A;  4M85 A;  4NSQ A;  1A2Z A;  2GE3 A;  1VHS A;  3WC5 A;  4FD7 A;  1YX0 A;  2AE6 A;  3PVD A;  2XEI A;  4P3Y A;  1S5K A;  2Z10 A;  2AHO A;  1PU9 A;  4MHP A;  5E6T A;  4U9U A;  2B3U A;  4MJ8 A;  4BD9 A;  4PC2 A;  1IB0 A;  2ZZG A;  4RPD A;  5TV2 A;  2Q7S A;  3TCV A;  4TMV A;  3IU2 A;  2C5B A;  2F4N A;  1FNC A;  1D8T A;  4P4F A;  2VBQ A;  3VWE A;  4P3I A;  4NGM A;  1NJI D;  4R8F A;  4OPS A;  2LZJ A;  3ZJ0 A;  4MCR A;  5ISV A;  4YAF A;  1W9X A;  2GLF A;  2WSA A;  4MXU A;  2QA4 B;  3PB7 X;  2DER A;  3D7D A;  3W2E A;  5AG5 A;  2YWH A;  3NH4 A;  1W0K A;  1WDT A;  1EP1 B;  3CES A;  2V8H A;  1COW A;  2PJB A;  3H94 A;  4KVM E;  4DK1 A;  1N08 A;  1ZUN B;  2D9R A;  1ON0 A;  2FL4 A;  4OC1 A;  2CTB A;  2ZTN A;  5TR9 A;  4TN1 A;  1YLO A;  4PAB A;  4XR6 A;  2FX3 A;  3SJP A;  3ZZT A;  2VZY A;  1BX1 A;  2JDD A;  3B7I A;  4PK3 A;  1F2P A;  3S9N A;  4JXR A;  1QSO A;  4RD4 A;  1YK3 A;  1MAB A;  4MMO A;  2CBX A;  2ZL6 A;  1VLY A;  2RC6 A;  2PJ6 A;  2ZED A;  4OLL A;  1H8H A;  2JN9 A;  4M1K A;  5IYP A;  1NMT A;  2ZW6 A;  4H2K A;  4OPV A;  1CX8 A;  3FEE A;  4R71 A;  4B43 A;  2ARH A;  1KWM A;  1CM0 A;  3CRZ A;  1SKY B;  4XPD B;  1Q2Y A;  4UWJ A;  4CYP A;  1UD2 A;  4PPZ A;  2DEU A;  3LOD A;  1S4M A;  2HLD A;  1S3Z A;  1N06 A;  2ZXI A;  1VQM B;  4R76 A;  5THW A;  2REE A;  3IJ3 A;  3T8W A;  1VGY A;  1Z8L A;  3IIB A;  1IOI A;  2F1M A;  2FIA A;  1TKH A;  1AMP A;  4EVY A;  1ZO0 A;  3QFC A;  3CCU B;  1Z5R A;  1QGY A;  4Q7J B;  1K73 D;  1YW4 A;  4P4D A;  2ZZF A;  4B44 A;  4B10 A;  4F8Z A;  4RM0 A;  2V7W A;  2BOA A;  1B2R A;  5LRG A;  2PJ1 A;  2JLM A;  4X06 A;  3VAR A;  3FEC A;  1RQR A;  3D67 A;  2C6G A;  3NH5 A;  3SJG A;  4TSF A;  4DYO A;  3EXN A;  3AVU A;  3GQB A;  3WNC A;  3NE5 B;  5BSY A;  2BMW A;  1EP3 B;  4AVZ A;  3PA2 A;  1MJ9 A;  5L46 A;  1NB0 A;  2GPJ A;  4C7H A;  3G05 A;  3QFT A;  3JU4 A;  4A38 A;  4F0Y A;  2J9A A;  4B11 A;  1HEE A;  2WPX A;  4EFD A;  4ASU A;  1W2B B;  3FPK A;  3A1P A;  4ROX A;  3AGP A;  5LYD A;  4XOR A;  4JWP A;  2B4D A;  4PC6 A;  3BCF A;  2XNJ A;  4P4B A;  3LQE A;  2V7V A;  1K28 D;  3A8I A;  4FWT A;  3CXS A;  3ZZI A;  3D7G A;  4C68 A;  1E1Q A;  3BLN A;  1E43 A;  4WJB A;  5I0C A;  4MFQ A;  2WPD A;  1R57 A;  5HXD A;  3T9Y A;  4ZY2 A;  4OOV A;  4MHZ A;  3QE2 A;  4MCS A;  2O28 A;  1NSL A;  2I79 A;  4XD7 A;  5F4O A;  2J7K A;  1JA0 A;  1RO5 A;  3QAH A;  2ZTG A;  3QNV A;  4CYQ A;  2OZU A;  2BCO A;  1H85 A;  2BO9 A;  2WSS A;  3B3W A;  4KOS A;  3SLD A;  5I4M A;  4Z1M A;  2VI7 A;  2YWG A;  3W5V A;  1B87 A;  4NGP A;  3RNZ A;  4UBR A;  4PSW A;  4B5O A;  4ZI6 A;  3PB9 X;  4OKO A;  4XLE A;  4UZF A;  3BC9 A;  2AFZ A;  5IYR A;  5G1Z A;  3JVN A;  1EWY A;  1VQ7 B;  2WJY A;  2Z11 A;  2BV3 A;  1R5B A;  2DET A;  2BM1 A;  3PFE A;  3V38 A;  2P3M A;  1K8A D;  5THX A;  3G71 B;  4MYU A;  3SEJ A;  3FPP A;  3ASR A;  3JUW A;  5JGF A;  3DLJ A;  4NGR A;  1GYT A;  5C88 A;  3D4U A;  4LBW A;  1BPN A;  2BL1 A;  1CPS A;  2NYQ A;  3R9F A;  4BIN A;  3CPW B;  2DY1 A;  3ZPN A;  3A3B A;  1VF7 A;  4XKW A;  4NNJ A;  2OU2 A;  2QEC A;  4OOS A;  5IYN A;  5LMZ A;  3VNU A;  4X2T A;  3OKX A;  1SM4 A;  4RDL A;  3P26 A;  2JJ1 A;  2XEG A;  3GLJ A;  2PIZ A;  1LAN A;  1Z4R A;  1LFW A;  3U6B A;  5B6I A;  1IYL A;  2JEW A;  1VHO A;  3CP8 A;  1YSJ A;  3BI1 A;  4B13 A;  1XF8 A;  5C82 A;  2HUZ A;  2EWB A;  4Z4R A;  1G7S A;  5HXB A;  3CCS B;  5J35 A;  3EO4 A;  1ZG8 A;  4ZGN B;  2NSM A;  3LQ6 A;  5KTC A;  4QB9 A;  1V5V A;  2FS5 A;  3IU1 A;  3QB8 A;  3H5Z A;  3ES9 A;  4X5K A;  1PJ6 A;  3ASQ A;  2RB7 A;  4X05 A;  1S7K A;  3CB4 A;  3RY8 A;  5A89 A;  1KZF A;  3B8G A;  1R43 A;  6CPA A;  2HCJ B;  3SI1 A;  4M6I A;  2D74 A;  4LBZ A;  5H86 A;  4KS9 A;  1KZL A;  2OB0 A;  3T53 B;  4FK8 A;  3GUX A;  4CGL A;  2OR4 A;  3B35 A;  3G8W A;  2P6G A;  3A8J A;  3CPX A;  2C77 A;  3WY9 A;  1FND A;  4B3G A;  1IOF A;  4MFL A;  4R6T A;  3OFN A;  1GVH A;  2Q4V A;  3B78 A;  4CAV A;  3KI9 A;  1QSM A;  4LQG A;  1GO2 A;  1WOS A;  4ZCL A;  4F6A A;  5FL7 A;  4X3R A;  4B3F X;  4M53 A;  1R3N A;  1LRZ A;  4XLH A;  1TF8 A;  1Q7L A;  4UCN A;  4MHN A;  1QGA A;  2BM0 A;  2B3V A;  2VBS A;  1OZP A;  3PEI A;  3D68 A;  2YWF A;  3WAB A;  1CP6 A;  4B48 A;  2D3N A;  1NRK A;  3AVT A;  3TOB A;  1Z9U A;  3V76 A;  2BN4 A;  3AST A;  2I00 A;  4OC2 A;  2JJ2 A;  4U5Y A;  4UFX A;  5CPA A;  2JDC A;  5KTA A;  2P6F A;  3CW2 A;  1BJK A;  3IEH A;  1S0U A;  3C26 A;  2X53 S;  4NCN A;  3D8P A;  4DUK A;  2XOK A;  3FH4 A;  2PJ8 A;  4RS2 A;  2FT0 A;  1DE4 C;  2Z3O A;  5EBV A;  5IK2 A;  4PXD A;  1N07 A;  4X7E A;  4Y9U A;  5KW9 A;  1NBM A;  2OBT A;  4OC5 A;  4KSF A;  2XZL A;  3Q38 A;  3SI0 A;  4YEL A;  4DNC A;  2V8V A;  3I3G A;  2E1R A;  3ASP A;  3UY5 A;  1I12 A;  4PK2 A;  1DG1 G;  1XE4 A;  2YNE A;  4OAD A;  4TT3 A;  3WND A;  4HPS A;  1LAP A;  3SHP A;  4CAW A;  3J81 k;  1Q82 D;  1QFZ A;  4RN7 A;  4X7F A;  2X6X A;  4TMX A;  3MN8 A;  1GAQ A;  3DGV A;  2I3C A;  4M2L A;  4QVT A;  4UIA A;  2CNM A;  2W6J A;  3HAG A;  4B47 A;  1P4N A;  1QGZ A;  2ZEO A;  4HKF A;  4QUS A;  4XPL A;  1WOO A;  4EWT A;  4UEF A;  1GAW A;  3F5B A;  1L0C A;  1VQ4 B;  3NFZ A;  2G3A A;  4GQN A;  1CQX A;  4YRH A;  1YGH A;  3PUN A;  4Z4S A;  4P9S A;  1KUV A;  3FX6 A;  3OZU A;  2ZL5 A;  1YIJ B;  1A8P A;  1I7P A;  3KQX A;  1YLE A;  2OK7 A;  4RPB A;  5J1Q A;  4CAF A;  4MHD A;  4NCZ A;  3G6E B;  4KUA A;  3CD6 B;  5KSW B;  1M4I A;  2WYR A;  5TY0 A;  5BSX A;  4MCQ A;  2XEX A;  2C27 A;  1E1R A;  1Q81 D;  1U6M A;  3TO9 A;  4DK0 A;  3PBE A;  3RYO A;  1MRZ A;  5AG6 A;  2QML A;  4CGM A;  2GJP A;  3R9G A;  3E0K A;  3W5U A;  4WZT A;  4P12 A;  1QST A;  1YQE A;  1S60 A;  3OW2 B;  3OEH A;  1H42 A;  3W91 A;  4KVX A;  4R87 A;  1OGJ A;  2FSR A;  2ZEH A;  4A37 A;  4UFW A;  2NMT A;  4QBJ A;  1Q9S A;  1I8D A;  1QUE A;  1VHE A;  3RBU A;  3W6X A;  5DWM A;  1XRY A;  5HVH A;  2X3U A;  3PBB A;  3HUV A;  2VEZ A;  4YAU A;  3KHX A;  5J8C A;  2QTL A;  2V7U A;  2VJI A;  1IJE A;  7CPA A;  1Q2C A;  1XEB A;  4F9V A;  5G21 A;  1FT7 A;  2ZZE A;  4OME A;  4RD2 A;  5ELY A;  2AFU A;  2XGJ A;  4XLA A;  2XZP A;  3H8E A;  4FWU A;  4Z4Y A;  1IYK A;  4JXQ A;  5K8O A;  2VZL A;  1VIX A;  3TTH A;  1VQP B;  4HE6 A;  4UWI A;  2X7B A;  2VNH A;  4NJQ A;  2ZEE A;  4HNY B;  4II3 A;  4IW3 B;  3FB3 A;  4KVO E;  4FN5 A;  2G9D A;  1I21 A;  2KCW A;  3SI2 A;  2WR8 A;  2YGW A;  3IC1 A;  4FD4 A;  3R95 A;  1EXM A;  4ZX8 A;  5AG4 A;  3QAY A;  4LX9 A;  3NE7 A;  3OW7 A;  1OB5 A;  1PUA A;  2CRV A;  2V8G A;  1B23 P;  4KKT A;  4X8I A;  5DWN A;  4J3G A;  3OP1 A;  2CTC A;  2PJ3 A;  3DR6 A;  4OP4 A;  4RDK A;  4UEZ A;  4NGT A;  1WWZ A;  3CDX A;  1MJB A;  2FE7 A;  3KQZ A;  1M4L A;  4XL9 A;  4DNR B;  3BHX A;  1BOB A;  2POK A;  1AMO A;  4II9 A;  1PJ7 A;  2NPF A;  2W6I A;  2GK6 A;  1UD5 A;  4PSX A;  4JZ0 A;  4CAX A;  2C4U A;  4XQF A;  4PC3 A;  4OC4 A;  2VBU A;  2JEV A;  2CF4 A;  3I56 B;  1F2O A;  4Y49 C;  4P4E A;  1X10 A;  1SQH A;  2AFS A;  1F60 A;  4A94 A;  4CGN A;  1FX0 A;  1KK0 A;  5CBM A;  2BUE A;  4OC3 A;  2B4B A;  2ZXV A;  4AVA A;  3U6K A;  1F57 A;  4P4I A;  1D1N A;  4KZT A;  1OB2 A;  2CK3 A;  3ONY A;  4AG7 A;  2C5H A;  3D26 A;  4HE5 A;  4N3G A;  3VWD A;  4P2N A;  4JMQ A;  2R9V A;  5A27 A;  5TRD A;  3ZZU A;  4ZY0 A;  1G7T A;  1BPL A;  2ODF A;  5G20 A;  1EFR A;  2BGJ A;  2QJ8 A;  5A28 A;  3QSY A;  2HQY A;  3ASS A;  3SXO A;  5BWA B;  2DXQ A;  1Q86 D;  4RD3 A;  2Z6B D;  2EO8 A;  1J9Z A;  3NE8 A;  1ELL P;  4KOU A;  4TMT A;  4MFZ A;  2P6E A;  3AVX A;  2Q0Y A;  1KK2 A;  4KUB A;  1M1D A;  1DTD A;  1J4J A;  5IB9 A;  1QQ9 A;  3R6J A;  2Q6L A;  1IB1 E;  4G1V A;  2BEI A;  4B6Z A;  4RD6 A;  5HVG A;  4UIB A;  3D2M A;  4A31 A;  2PR1 A;  4XNF A;  5LRK A;  4UAJ A;  2Q6I A;  4HNW B;  4C2Y A;  2V77 A;  1S7F A;  4WWV A;  1RXT A;  4UEE A;  4GM5 A;  3U2Q A;  1TUI A;  1JWQ A;  4ZYQ A;  2FXF A;  4B3X A;  2DF5 A;  3CCM B;  2PIY A;  2HMA A;  3FJO A;  2WPW A;  2ZEL A;  1PYT B;  2CW5 A;  5F47 A;  1JQG A;  1FDR A;  1FNB A;  4N3N A;  1UD6 A;  3W2G A;  2B58 A;  1KTV A;  1UFH A;  3BH4 A;  2WZP P;  4ZCI A;  2CNS A;  4XPD C;  1JB9 A;  4L8A A;  4CQJ A;  3JQR A;  1ZM9 A;  1ELO A;  4H89 A;  1GR1 A;  4CS0 B;  4QVJ A;  1LOK A;  3E1Y E;  1YI2 B;  1RQP A;  3W5H A;  4HNX B;  4NEX A;  3H9N A;  4PGO A;  1WSR A;  4MY3 A;  4PV6 A;  2PSW A;  4IUS A;  4MFP A;  4P6V F;  4RI1 A;  2PDO A;  2PJ5 A;  2XEJ A;  2A4N A;  3P2F A;  4MCP A;  2OOT A;  1OB0 A;  4AVB A;  3W2I A;  4L8J A;  4OC0 A;  5J3O A;  3SJE A;  4XON A;  1E3Z A;  3TO6 A;  5D29 A;  3GY9 A;  2OZG A;  4GXH A;  1IIC A;  1IHM A;  2C78 A;  3B2Y A;  5JM6 A;  3I9S A;  3BJ8 A;  4JJX A;  5F4M A;  1KRH A;  5K8M A;  3PB4 X;  2F5I A;  4ACA A;  3RO0 A;  1BAV A;  1XOV A;  1HZE A;  1VQN B;  3VO2 A;  2GK7 A;  2OYN A;  3N7Z A;  3CCV B;  3MHP A;  2F43 A;  3T90 A;  3T51 B;  4G1P A;  4G7X A;  1UD8 A;  2QDX A;  4CAE A;  3H8F A;  3ZBT A;  3FBU A;  4R3K A;  1KQS B;  2V7Q A;  5JH9 A;  1T5E A;  1W0J A;  1I1D A;  1TTT A;  1TLL A;  2ATR A;  4NGQ A;  3S6K A;  2ZEM A;  1V0E A;  4E8O A;  1KUX A;  1LCP A;  1YRE A;  4RJL A;  1ARL A;  1FRQ A;  2R6H A;  4YEJ A;  5HKK A;  2CY2 A;  4QV2 A;  2V31 A;  5HZA A;  2QGG A;  1XE1 A;  4CGO A;  4KOY A;  4KOX A;  3CC7 B;  2Z3N A;  1EFT A;  4PXE A;  2P0W A;  3GIU A;  3KGQ A;  2DCU A;  4DQK A;  3CCE B;  1E62 A;  1BMF A;  5HZB A;  2VZZ A;  2F1L A;  3I1F A;  1HDU A;  2R8V A;  1N8R D;  1PCA A;  4JD6 A;  4MYT A;  1H8L A;  1WPC A;  4RCY A;  2ANP A;  3R6K A;  1VQ9 B;  3D7H A;  4A30 A;  3K2K A;  3OWC A;  2AJ6 A;  1VKC A;  2PMD A;  2ZEG A;  1OBR A;  3PA1 A;  2VBT A;  1YME A;  5CDF A;  4H6U A;  3GB0 A;  5LYI A;  3R96 A;  3F8K A;  2PJ0 A;  4P4J A;  2Z0Z A;  5H84 A;  1W35 A;  4UZU A;  5IX3 A;  3ZIA A;  2H5M A;  1EFU A;  3TFY A;  4Z65 A;  4MBU A;  8CPA A;  3SXN A;  5F4J A;  3CCR B;  4EME A;  2PC1 A;  3F0A A;  4PC7 A;  2Q44 A;  4QVA A;  2OTJ B;  3TT2 A;  2ABZ A;  5FVJ A;  1PJ5 A;  2ZL7 A;  1Z8W A;  3SJX A;  3G3S A;  4C0S A;  2IMO A;  2V7X A;  4F9U A;  5E96 A;  2D4O A;  3GVL A;  2IJZ A;  4I49 A;  2JIZ A;  5IV0 A;  1NSA A;  4XMY A;  4AG9 A;  4TKO B;  3WT4 A;  3AVY A;  1QX4 A;  1EFC A;  4G7W A;  1K9M D;  3ZZ0 A;  1ZLI A;  3MCA A;  1WK4 A;  2D3L A;  3LWU A;  2X0K A;  3W2H A;  1TF9 A;  2WJV A;  3HLP A;  4YFJ A;  1GJR A;  1AUG A;  4B4D A;  1FRN A;  3FXT A;  4PAA A;  2QEX B;  2QE7 A;  4C43 A;  5FO0 A;  2J8N A;  3WC6 A;  4QFM A;  1SKQ A;  3EC4 A;  1CP7 A;  5F48 A;  2ZW4 A;  2VNJ A;  1RTQ A;  5FNZ A;  1QVF B;  1HDQ A;  4XNH C;  4MHY A;  3PZJ A;  1BLI A;  1GHE A;  3T56 B;  3CZX A;  4MFK A;  3DDD A;  1XJO A;  5EC4 A;  3JQQ A;  2RC4 A;  3ONU A;  3D7F A;  4U9Z A;  5K8P A;  3MRU A;  4ACB A;  2F7V A;  3PFO A;  5IYW A;  4XPK A;  3IWW A;  2Z3K A;  3CXC B;  1M90 D;  4OAE A;  2GLJ A;  2G3T A;  4J0Q A;  2M5S A;  1Z8X A;  3SLN A;  5G22 A;  4QUZ A;  3WNB A;  1V0C A;  5J8F A;  3PB6 X;  2ZEN A;  2QYV A;  3CP2 A;  1T6Z A;  4XM3 A;  3A35 A;  4CGP A;  1QSR A;  1XB2 A;  4IHM A;  3W2F A;  2HC9 A;  3I55 B;  4MY0 A;  3IFE A;  1M4D A;  1Z4E A;  4KOW A;  2JDI A;  3LD2 A;  4XKV A;  4RLZ A;  4H6Z A;  3E20 A;  3CCQ B;  1BX0 A;  4K1X A;  3WXM A;  2PRQ A;  2C2W A;  5DN6 A;  1YJ9 B;  2OZH A;  2QN6 A;  3A3G A;  4ZCM A;  3NH8 A;  1YX2 A;  1AYE A;  1YVK A;  2X6W A;  3CXQ A;  1QFJ A;  3MGD A;  3FF3 A;  1XBU A;  2GU2 A;  3B3C A;  1ZM2 A;  3CCJ B;  4X7C A;  2C6C A;  2HB6 A;  2Z3L A;  4ONU A;  3Q39 A;  3Q6Q A;  3SJF A;  3PEN A;  2AFM A;  2ZOF A;  1VLO A;  3H8G A;  1Z2L A;  4EH1 A;  1CG2 A;  4UCM A;  4Y49 B;  1XMT A;  2PIA A;  3PP9 A;  2CXA A;  3FVL A;  4DJL A;  4RUH A;  3CT9 A;  3B82 A;  2Y0M A;  3VO1 A;  4WZE A;  3B3S A;  4G6I A;  3KEW A;  3VH9 A;  2QTZ A;  4B14 A;  3CME B;  1MK4 A;  1YW6 A;  1DAR A;  5CNP A;  3LMS A;  2R7H A;  1KK3 A;  2JBK A;  4PQA A;  2Q51 A;  1S7N A;  5AGE A;  3S9M A;  2QIR A;  2ZZQ A;  3KR4 A;  1S7L A;  3N5F A;  3QFS A;  1YJN B;  2X8K A;  4GS4 A;  3BY1 A;  3DR8 A;  4BMH A;  3FNC A;  5A8A A;  1CPX A;  3CTA A;  3NA6 A;  4Q7A A;  3S6H A;  4A33 A;  2X6Y A;  1QUF A;  4F0X A;  5HMN A;  1S72 B;  2BF4 A;  3BQJ A;  4M0L A;  3WBK A;  1MJA A;  2GJR A;  3OEE A;  4KLV A;  4BPR A;  2BVN A;  1YIT B;  2Q7B A;  4AC9 A;  3RAM A;  2PVV A;  4B5P B;  1KMH A;  4OOX A;  2EUI A;  2FIW A;  1XQB A;  4P1V A;  3GVK A;  4B12 A;  4Z4Z A;  1ZM3 A;  1BPM A;  1T6Y A;  3DSB A;  4FD5 A;  3R1K A;  2R98 A;  5K8N A;  2ZEP A;  4KSA A;  5JQ4 A;  5JPH A;  2AFW A;  2CNT A;  1LAM A;  4P6Y A;  1ELM P;  2GIV A;  4R3L A;  3S6G A;  4G5G A;  3FKS A;  4KOR A;  1E63 A;  1F20 A;  4R57 A;  4F7D A;  2J8R A;  2JBJ A;  4Z4U A;  3SJZ A;  3B3T A;  3OAA A;  1Y7R A;  1WU8 A;  4Y7C A;  4UFV A;  3A8K A;  4LBY A;  4G1B A;  3CC2 B; 
#chains in the Genus database with same CATH homology
 4X3R A;  2PJ5 A;  1R3N A;  1TF8 A;  1TKJ A;  1Q7L A;  5LRJ A;  1FNO A;  4P44 A;  2PJA A;  4MHN A;  2XEJ A;  1XFO A;  4MCP A;  3PEI A;  3KL9 A;  3D68 A;  2OOT A;  4OID A;  3WAB A;  1CP6 A;  4OC0 A;  3SJE A;  2EK8 A;  4FBE A;  5D29 A;  2C6P A;  5LYF A;  1ZG7 A;  5CPA A;  4OC2 A;  3B2Y A;  5JM6 A;  3IEH A;  3L2N A;  4ONW A;  4DUK A;  3FH4 A;  2PJ8 A;  5K8M A;  4NGS A;  3PB4 X;  1DE4 C;  4IAV A;  4PXD A;  1BAV A;  4OIW A;  2DEA A;  5D8N A;  3WC5 A;  4OC5 A;  3SI0 A;  2XEI A;  2V8V A;  4G1P A;  2PVW A;  4MHP A;  4BD9 A;  4FAI A;  3H8F A;  4TNU A;  5JH9 A;  1LAP A;  4P4F A;  3S9L A;  4NGQ A;  2ZEM A;  4NGM A;  1LCP A;  1ARL A;  4R8F A;  3MN8 A;  4MCR A;  3DGV A;  2I3C A;  4O23 A;  3K9T A;  2ZEF A;  4UIA A;  2GLF A;  2Q4Z A;  4MXU A;  3PB7 X;  2ZEO A;  3D7D A;  4PXE A;  4EWT A;  4UEF A;  3RZA A;  3KGQ A;  3NH4 A;  3NFZ A;  2V8H A;  2FVG A;  2PJB A;  1IY7 A;  1HDU A;  3FX6 A;  2AFO A;  4P10 A;  3KQX A;  1PCA A;  1H8L A;  5J1Q A;  2ANP A;  4OC1 A;  2CTB A;  3D7H A;  4AXV A;  3FJU A;  2WYR A;  3K2K A;  3FMC A;  1YLO A;  4MCQ A;  3B7I A;  1F2P A;  3S9N A;  2ZEG A;  1OBR A;  3PBE A;  1YME A;  3FED A;  4MMO A;  3GB0 A;  5LYI A;  4IK2 A;  2PJ0 A;  2PJ6 A;  2ZED A;  4P4J A;  4H2K A;  4R7M A;  1CX8 A;  3FEE A;  3WC7 A;  2PJ9 A;  3TC8 A;  5LYL A;  4KSI A;  1KWM A;  4Z65 A;  4ZY1 A;  2ZEH A;  4NJR A;  8CPA A;  1Y7E A;  4A37 A;  3I1U A;  4EME A;  1ARM A;  4PPZ A;  1VHE A;  3RBU A;  4YWY A;  3KZW A;  1XRY A;  2AFX A;  5HVH A;  2ABZ A;  4R76 A;  3PBB A;  5THW A;  3IJ3 A;  1QMU A;  3T8W A;  3HUV A;  1VGY A;  1Z8L A;  3SJX A;  3IIB A;  3KHX A;  2IMO A;  4F9U A;  2IJZ A;  1TKH A;  1AMP A;  1NSA A;  7CPA A;  1Z5R A;  3WT4 A;  2V8D A;  1YW4 A;  4P4D A;  4F9V A;  1FT7 A;  2PJ7 A;  4F8Z A;  4OME A;  5ELY A;  2AFU A;  4ZX9 A;  1ZLI A;  2BOA A;  4P45 A;  3LWU A;  5LRG A;  2PJ1 A;  1TF9 A;  3HLP A;  1TXR A;  3VAR A;  3FEC A;  3H8E A;  3VAT A;  3D67 A;  3CPA A;  4FWU A;  3KHZ A;  2C6G A;  4W9Y A;  2RFH A;  3NH5 A;  4CPA A;  5K8O A;  1VIX A;  2EK9 A;  3SJG A;  3WC6 A;  4DYO A;  4NJQ A;  2ZEE A;  2PJ4 A;  1CP7 A;  5F09 A;  1RTQ A;  1HDQ A;  4MHY A;  2G9D A;  4A38 A;  3SI2 A;  1XMB A;  2O53 A;  2J9A A;  3IC1 A;  1HEE A;  4EFD A;  4PXB A;  2WZN A;  4ZX8 A;  4JYW A;  2C1C A;  1XJO A;  5LYD A;  3D7F A;  5K8P A;  3MRU A;  4P4B A;  4NFR A;  4MRI A;  2F7V A;  4K3N A;  3PFO A;  2V8G A;  2VL1 A;  3IWW A;  4X8I A;  2PCU A;  3D7G A;  2GLJ A;  1Y0Y A;  2CTC A;  2PJ3 A;  4WJB A;  2CIJ A;  1EE3 P;  4OP4 A;  4UEZ A;  4NGT A;  3CDX A;  2O4H A;  5HXD A;  3PB6 X;  3KQZ A;  1M4L A;  2ZEN A;  2QYV A;  3BHX A;  4ZY2 A;  2POK A;  4MHZ A;  4JZ0 A;  4MCS A;  4IHM A;  3JRU A;  2HC9 A;  4NGN A;  3IFE A;  4OC4 A;  2QVP A;  3ISZ A;  1TKF A;  1Y0R A;  2CF4 A;  5DS0 A;  1F2O A;  3QNV A;  3ISX A;  4P4E A;  5HVF A;  2BCO A;  2BO9 A;  3B3W A;  2PRQ A;  3KAS A;  2AFS A;  5I4M A;  2XEF A;  4A94 A;  5CBM A;  4NGP A;  4OC3 A;  3BXM A;  2PE3 A;  3NH8 A;  3PRT A;  4ZI6 A;  4TWE A;  1AYE A;  3PB9 X;  4OKO A;  1F57 A;  3FF3 A;  1XBU A;  2GU2 A;  3B3C A;  4P4I A;  2C6C A;  2HB6 A;  2AFZ A;  3SJF A;  2AFM A;  2ZOF A;  3H8G A;  1Z2L A;  3PFE A;  3V38 A;  1CG2 A;  2IQ6 A;  2Q43 A;  3FVL A;  4DJL A;  4RUH A;  3CT9 A;  4ZY0 A;  3B3S A;  4A39 A;  5JGF A;  3DLJ A;  4NGR A;  3VH9 A;  1GYT A;  2F8H A;  2QJ8 A;  1UWY A;  2PJC A;  3B3V A;  3D4U A;  1BPN A;  1YW6 A;  1CPS A;  2NYQ A;  3LMS A;  3PB8 X;  2JBK A;  4PQA A;  2Q51 A;  3S9M A;  1ELL P;  4YU9 A;  3KR4 A;  3TX8 A;  3N5F A;  1DTD A;  4X2T A;  5IB9 A;  1QQ9 A;  2XEG A;  3GLJ A;  3NA6 A;  1CPX A;  2PJ2 A;  2PIZ A;  4Q7A A;  1LAN A;  2ZOG A;  1LFW A;  4B6Z A;  5HVG A;  4FUU A;  4UIB A;  4PXC A;  2JEW A;  1VHO A;  1YSJ A;  3BI1 A;  1ZLH A;  5LRK A;  1BLL E;  2EWB A;  2V77 A;  3RAM A;  4WWV A;  2PVV A;  4UEE A;  4GM5 A;  1ZG8 A;  4ZYQ A;  2NSM A;  2PIY A;  2GRE A;  1BPM A;  1CBX A;  1ZG9 A;  2ZEL A;  1PYT B;  1JQG A;  2RB7 A;  5K8N A;  2ZEP A;  1R43 A;  6CPA A;  3V7Z A;  3SI1 A;  4UF4 A;  2AFW A;  3D66 A;  3KR5 A;  1LAM A;  1ELM P;  4P6Y A;  3GUX A;  2OR4 A;  3B35 A;  1LOK A;  3CPX A;  3BI0 A;  2JBJ A;  3B3T A;  4R6T A;  1IGB A;  3KI9 A;  4LQG A;  3IO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...