2ZL5A

Atomic resolution structural characterization of recognition of histo-blood group antigen by norwalk virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
289
structure length
289
Chain Sequence
FTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTIGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWVSRFYQLKPVGTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
publication title Atomic resolution structural characterization of recognition of histo-blood group antigens by Norwalk virus
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 67
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 2zl5A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 2zl5A01
4P3IA 4RDLA 4QUZA 4RPBA 4Z4RA 3R6KA 4Z4ZA 2OBSA 4Z4SA 3RY8A 4Z4UA 3PUNA 5E6TA 3Q3AA 4RLZA 4X7FA 3Q6QA 4X7DA 4P25A 4X7CA 3PA2A 3Q6RA 3SJPA 3SKBA 4P1VA 3SEJA 4Z4YA 1IHMA 4QV2A 5F4MA 5HZAA 3SLDA 4WZKA 3BY1A 4QVAA 3ASRA 3LQ6A 4WZLA 3SLNA 4OP7A 5F4JA 3ASPA 3R6JA 3V7AA 4Z4VA 4X7EA 3D26A 5IYQA 4X07A 4QVJA 3LQEA 4RDKA 5KW9A 5J35A 5BSXA 5J3OA 2ZL6A 3ASQA 4RPDA 5IYWA 5IYRA 5F4OA 4OOSA 4OPSA 4ROXA 4RDJA 3Q38A 4RM0A 3Q39A 4P2NA 4P12A 4Z4TA 4WZEA 4OOVA 3PVDA 4OPOA 4Z4WA 3BQJA 4X05A 4P26A 2ZL5A 3ASTA 5BSYA 4X06A 2ZL7A 4WZTA 3PA1A 5IYPA 5IYNA 3PUMA 4X0CA 2OBRA 4OOXA 4OPVA 3ASSA 2OBTA 3ONYA 5HZBA 3ONUA 3BY2A
chains in the Genus database with same CATH superfamily
1KK2A 2XZPA 1CQXA 4QUZA 5JBQA 1E79A 4XM3A 4M4SA 1DARA 4ZGQB 1VQ5B 3CP8A 5TRDA 5DSZA 1R5BA 3OPOA 4FN5A 4PC2A 3PUNA 1T5EA 1T6YA 2B7CA 4UZFA 3CMAB 3CD6B 1ELOA 3AGPA 3CB4A 3GQBA 1F20A 2J7KA 3OZVA 3JQPA 3G6EB 1AIPA 3SJPA 1KMHA 2HDNB 3SKBA 3I56B 3G4SB 2D9RA 4B44A 1TVCA 1IHMA 4QV2A 2YWFA 4LC0A 1UD8A 1BLIA 3T51B 2GPJA 3CC2B 5HZAA 2AHOA 3J81k 1RQPA 1YHQB 4PABA 2BVNA 1W2BB 3MHPA 4B48A 2V7VA 5LMZA 3CCSB 4FK8A 1NBMA 1QGYA 1H42A 3ASRA 3CRZA 2QEXB 3LNNA 1KTVA 4WZLA 1XB2A 1WORA 1JNYA 3OZWA 3AVVA 3ZC3A 2C5HA 2JJ1A 2PIAA 1OHHA 1EXMA 1UD6A 3KEWA 1JA1A 4G7XA 3WNDA 1UMKA 3AVWA 3R6JA 2VNJA 3A1PA 3ZBUA 2XGJA 4PC3A 3D26A 4AVZA 3CP2A 5IYQA 1YIJB 4X07A 2ZZFA 2C77A 3OW2B 4G1VA 2DYIA 3OFNA 2RC5A 2DEUA 3B78A 3LQEA 2JIZA 1QFZA 4RDKA 1U2RA 1W9XA 2BF4A 2DIEA 5IYRA 1N8RD 4YEJA 2Q6OA 1SM4A 4RCYA 4XMYA 2RC6A 3VNVA 1QFYA 1MRZA 3GSIA 4G1BA 2V31A 4ZGNB 3JU4A 4DNRB 3I1FA 3QFSA 4RM0A 4RJLA 1BQEA 1W35A 3AVTA 2BMWA 1N06A 4Z4TA 2GJPA 2YWGA 3OW7A 4II2A 4M2LA 2X6YA 3CCVB 2XNJA 2VJIA 2GJKA 4LBZA 1YJ9B 5AN9A 3OZUA 1WU8A 4U9UA 1T6ZA 4CQJA 1K8AD 3CCMB 2ZTGA 2ZZEA 1VLYA 2ZL7A 1BPLA 4N3GA 3PA1A 1I8DA 2ZXHA 1VF7A 1XE1A 3OAAA 4G5GA 4KKSA 2JJ2A 4XKWA 3CPWB 2EFGA 4XQFA 5B6IA 1JA0A 2F1MA 1GR1A 1E63A 2XZOA 4XLFA 5KSWB 4P3IA 1VQLB 2M5SA 4RDLA 3OJWA 1WTHD 2Q6IA 2BV3A 3B82A 4Y9UA 4Z4RA 2WZPP 5DS0A 3OOCA 1W0JA 3BY2A 1EP1B 2OBSA 3BCFA 5TY0A 2QTLA 4GQNA 1RQRA 3Q3AA 1SKQA 5H5JA 3QE2A 1S0UA 3CC4B 4P25A 4IW3B 4XNFA 1MABA 3VO1A 3WBKA 4DQKA 4II3A 5A88A 2GJRA 2V7UA 2ZBVA 2XNDA 2HCJB 4P1VA 3SEJA 1H85A 1UD2A 1IJEA 2V4DA 2VBUA 1W0KA 2WJYA 4P6YA 2PE3A 3CCRB 1GAWA 4XD7A 2ZXIA 2C4UA 3WBJA 1M1KD 2QDXA 3A35A 2WPDA 2ZITA 5FO1A 2WZNA 1YJNB 3SLDA 3E20A 4G7WA 4WZKA 4TMTA 4WWVA 5TV2A 1R5NA 3NE5B 2X85A 4P22A 2B7BA 4XONA 2OTLB 3W2HA 1VQ8B 5KNLA 4BPRA 1NJID 1I7PA 2X6XA 2CF4A 1Q7YD 4ASUA 3AVXA 2QTZA 4XL9A 4ACBA 1JJ2B 4Z4VA 1W34A 4LBVA 1VQ9B 1FNCA 1GVHA 4ZCIA 4RD1A 2FVGA 4QHYA 3CCQB 3P27A 4WQMA 4YELA 1CNEA 2I1LA 1FX0A 5J3OA 2ZL6A 3ASQA 4RPDA 4RD2A 3U6BA 4UZUA 1VHEA 1KJZA 1TUIA 3GVKA 4TKOB 4Z1MA 4ROXA 3W2EA 3BNWA 4EH1A 3ES9A 2R6HA 4KKTA 4YAUA 4RDJA 4DNTB 2DETA 2VBSA 2WR8A 1KK0A 2X53S 4TMXA 4P12A 1OB2A 1UD3A 2B5OA 3T53B 2VJJA 4NNJA 4WZEA 4OOVA 3PVDA 2JN9A 2DERA 3BQJA 1G7CA 2BGJA 4X05A 1E62A 3ISXA 1H8EA 2Z6BD 2Q6LA 4XLEA 4B43A 1S72B 1EP2B 1WPCA 2ZL5A 4XLAA 3WNCA 3ZZTA 4X06A 4FXUA 2WYRA 1ZUNB 4P9SA 4DQLA 3QSYA 1Q86D 1Q82D 1FNDA 3ZPNA 1W87A 5IYPA 1V0FA 2V7TA 3CTAA 4XN0A 3WXMA 1N08A 2D74A 1CNFA 1KC8D 2BPOA 4M0LA 5HKKA 4X8IA 3I55B 3FPKA 2ZZGA 3ONYA 4DK0A 3WYAA 2QGGA 1M90D 1FRQA 3P26A 5A8AA 2EIXA 3OEEA 1Y0RA 4M1KA 2R9VA 4TMWA 3CCJB 4Z4ZA 3VO2A 3T56B 3CW2A 4ZV4A 2Q6KA 3V76A 5E6TA 1IJFA 2F1LA 1ZM3A 4X7DA 1G7RA 4FWTA 2C4TA 2VNHA 1KD1D 3A3BA 3PENA 2E1BA 4XN3A 4AC9A 2W6IA 4E0FA 1K73D 3WNBA 1VQ6B 1JB9A 4DK1A 1V0EA 2DOGA 3A8KA 3MMPA 1YI2B 4F7DA 3VMFA 2GREA 4UAJA 2DCUA 4YAOA 1Y0YA 4B4DA 2VBVA 4PAAA 2D3LA 2BN4A 3A8IA 3A8JA 2ZZQA 5FA6A 4R71A 3QFTA 1YJWB 3G71B 1EP3B 2QE7A 3E1YE 4QVAA 1YX2A 1EFUA 1PJ6A 2CK3A 2GK7A 3SLNA 3ASPA 4C0SA 3B8HA 2WSSA 4RD0A 4UZEA 4B3XA 2NPFA 4YALA 2NV4A 1OGIA 3W2GA 1UD4A 2VNKA 1S4MA 1VQPB 4QVJA 3HAGA 4XR6A 1FRNA 1XFOA 1HVXA 1B23P 4B3GA 5GV8A 1QVGB 4XLCA 3U6KA 5KW9A 3CCLB 1TLLA 3FPPA 5J35A 5BSXA 1WSVA 3JQQA 1OGJA 3H9NA 4H9GA 4JMQA 4YAFA 5IYWA 5F4OA 2CNDA 1VLOA 3ZBTA 4LBYA 4OOSA 4PC6A 4OPSA 1D2EA 1SKYB 4TT3A 2QN6A 1FNMA 3GVJA 1QUEA 1WP6A 5FIUA 4QFMA 3VR6A 1DDIA 5THXA 3Q38A 1K9MD 3Q39A 4HE6A 1WOOA 1QUFA 2BSAA 2VBTA 4Y9RA 4XOTA 1PJ5A 4ZCLA 5IK2A 1D1NA 2LZJA 4TMZA 1WOSA 3DDYA 1K28D 4XLHA 1YLOA 4RD3A 1FNBA 4NCNA 4P26A 4XKVA 4PGOA 3ASTA 4NBSA 5BSYA 1ZM9A 1KRHA 1G7SA 1NB9A 3ZUGA 4K1XA 2V7WA 3LVBA 2C78A 2QMUA 4YAWA 1N05A 1NB0A 5IYNA 1F60A 3PUMA 4XOPA 2BM1A 4RCZA 2OK7A 4KKUA 2OBRA 4OOXA 1BJKA 3W2IA 3VNUA 1E64A 1E43A 4Y7CA 5HZBA 1QVFB 3ONUA 2VZLA 1EFCA 1QX4A 1FDRA 4LBWA 4RD6A 4P6VF 2YWEA 2X6WA 4TSFA 2W6JA 4RPBA 4TMVA 3ZIAA 3R6KA 3JQRA 2GK6A 3LO8A 4Z4SA 3RY8A 2GQFA 4Z4UA 3BC9A 4RLZA 4X7FA 3Q6QA 1COWA 1E1RA 1QH0A 4XORA 4MYTA 4MYUA 4X7CA 4PC1A 1WOPA 5A89A 2QA4B 2JDIA 3PA2A 3Q6RA 1VHOA 4HIZA 1AMOA 2V7QA 1P4MA 2XEXA 5FL7A 3U2QA 4Z4YA 1PJ7A 3GIRA 3G05A 4ACAA 5F4MA 1DG1G 1ZM4A 4Q7JB 1VQ7B 1QFJA 1N0VC 1N07A 2FX3A 1EFRA 3WY9A 1Q9SA 1OB5A 2OTJB 2PLFA 3CESA 1GJRA 1KK1A 1HA3A 3BY1A 1BX1A 2XNCA 2C5BA 1G7TA 1GAQA 2C2WA 2KVOA 3QFRA 1VQNB 2YWHA 3LQ6A 3QFCA 4OP7A 5F4JA 3SJZA 4YXWA 2XOKA 1J9ZA 3V7AA 1R5OA 4X7EA 3BH4A 2CC2A 1OB0A 2F4NA 2OK8A 5GV7A 1QGZA 1BX0A 3CXCB 3KL9A 2F43A 5DN6A 1QGAA 2X3UA 1VQMB 1V5VA 1TTTA 4AF6A 1I18A 3OEHA 3OE7A 2VNIA 3CC7B 4B47A 3OP1A 5CDFA 1EFTA 3MCAA 2PMDA 4HE5A 5EMNA 4TN1A 1KK3A 2DY1A 1HZEA 3FKSA 3AGQA 3BCDA 4M53A 1T6XA 1YITB 1VQ4B 4G6IA 4B3FX 1PKVA 1WDTA 3CCUB 1BMFA 3OKXA 3OJXA 4PC7A 1VQOB 1UD5A 1Q81D 1D8TA 2ZBUA 3A3GA 3CMMA 4N3NA 3CCEB 3FJOA 4P2NA 3WQZA 3W5VA 2HMAA 3AVUA 2HLDA 2WJVA 1IB0A 5HXBA 3ZZUA 4ZCMA 4L8JA 3W5UA 5H59A 1E3ZA 1B2RA 2VYQA 2P3MA 4RD4A 5TR9A 4OPOA 4Z4WA 3CPXA 5FO0A 4AF7A 3W5HA 1GO2A 1E3XA 1VJSA 1E1QA 1NDHA 2V7XA 4C43A 1N0UA 4P3YA 1WSRA 1A8PA 2ZTNA 2XZLA 3ZZ0A 2CBXA 3AVYA 2BM0A 2BGIA 4WZTA 5FNZA 1KZLA 3GVLA 2CRVA 2CW5A 1VQKB 2D3NA 1DDGA 4X0CA 1QG0A 3H94A 3W2FA 1ZM2A 1XQBA 2E1RA 4OPVA 3ASSA 2OBTA 4J0QA 2OYNA 2X8KA 4YHBA 3CMEB 1KQSB 5L46A 2X0KA 1EWYA 1H8HA 1NRKA
chains in the Genus database with same CATH topology
4P3IA 4RDLA 4QUZA 4RPBA 4Z4RA 3R6KA 4Z4ZA 2OBSA 4Z4SA 3RY8A 4Z4UA 3PUNA 5E6TA 3Q3AA 4RLZA 4X7FA 3Q6QA 4X7DA 4P25A 4X7CA 3PA2A 3Q6RA 3SJPA 3SKBA 4P1VA 3SEJA 4Z4YA 1IHMA 4QV2A 5F4MA 5HZAA 3SLDA 4WZKA 3BY1A 4QVAA 3ASRA 3LQ6A 4WZLA 3SLNA 4OP7A 5F4JA 3ASPA 3R6JA 3V7AA 4Z4VA 4X7EA 3D26A 5IYQA 4X07A 4QVJA 3LQEA 4RDKA 5KW9A 5J35A 5BSXA 5J3OA 2ZL6A 3ASQA 4RPDA 5IYWA 5IYRA 5F4OA 4OOSA 4OPSA 4ROXA 4RDJA 3Q38A 4RM0A 3Q39A 4P2NA 4P12A 4Z4TA 4WZEA 4OOVA 3PVDA 4OPOA 4Z4WA 3BQJA 4X05A 4P26A 2ZL5A 3ASTA 5BSYA 4X06A 2ZL7A 4WZTA 3PA1A 5IYPA 5IYNA 3PUMA 4X0CA 2OBRA 4OOXA 4OPVA 3ASSA 2OBTA 3ONYA 5HZBA 3ONUA 3BY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P3I A;  4RDL A;  4QUZ A;  4RPB A;  4Z4R A;  3R6K A;  4Z4Z A;  2OBS A;  4Z4S A;  3RY8 A;  4Z4U A;  3PUN A;  5E6T A;  3Q3A A;  4RLZ A;  4X7F A;  3Q6Q A;  4X7D A;  4P25 A;  4X7C A;  3PA2 A;  3Q6R A;  3SJP A;  3SKB A;  4P1V A;  3SEJ A;  4Z4Y A;  1IHM A;  4QV2 A;  5F4M A;  5HZA A;  3SLD A;  4WZK A;  3BY1 A;  4QVA A;  3ASR A;  3LQ6 A;  4WZL A;  3SLN A;  4OP7 A;  5F4J A;  3ASP A;  3R6J A;  3V7A A;  4Z4V A;  4X7E A;  3D26 A;  5IYQ A;  4X07 A;  4QVJ A;  3LQE A;  4RDK A;  5KW9 A;  5J35 A;  5BSX A;  5J3O A;  2ZL6 A;  3ASQ A;  4RPD A;  5IYW A;  5IYR A;  5F4O A;  4OOS A;  4OPS A;  4ROX A;  4RDJ A;  3Q38 A;  4RM0 A;  3Q39 A;  4P2N A;  4P12 A;  4Z4T A;  4WZE A;  4OOV A;  3PVD A;  4OPO A;  4Z4W A;  3BQJ A;  4X05 A;  4P26 A;  2ZL5 A;  3AST A;  5BSY A;  4X06 A;  2ZL7 A;  4WZT A;  3PA1 A;  5IYP A;  5IYN A;  3PUM A;  4X0C A;  2OBR A;  4OOX A;  4OPV A;  3ASS A;  2OBT A;  3ONY A;  5HZB A;  3ONU A;  3BY2 A; 
#chains in the Genus database with same CATH topology
 1KK2 A;  2XZP A;  1CQX A;  4QUZ A;  5JBQ A;  1E79 A;  4XM3 A;  4M4S A;  1DAR A;  4ZGQ B;  1VQ5 B;  3CP8 A;  5TRD A;  5DSZ A;  1R5B A;  3OPO A;  4FN5 A;  4PC2 A;  3PUN A;  1T5E A;  1T6Y A;  2B7C A;  4UZF A;  3CMA B;  3CD6 B;  1ELO A;  3AGP A;  3CB4 A;  3GQB A;  1F20 A;  2J7K A;  3OZV A;  3JQP A;  3G6E B;  1AIP A;  3SJP A;  1KMH A;  2HDN B;  3SKB A;  3I56 B;  3G4S B;  2D9R A;  4B44 A;  1TVC A;  1IHM A;  4QV2 A;  2YWF A;  4LC0 A;  1UD8 A;  1BLI A;  3T51 B;  2GPJ A;  3CC2 B;  5HZA A;  2AHO A;  3J81 k;  1RQP A;  1YHQ B;  4PAB A;  2BVN A;  1W2B B;  3MHP A;  4B48 A;  2V7V A;  5LMZ A;  3CCS B;  4FK8 A;  1NBM A;  1QGY A;  1H42 A;  3ASR A;  3CRZ A;  2QEX B;  3LNN A;  1KTV A;  4WZL A;  1XB2 A;  1WOR A;  1JNY A;  3OZW A;  3AVV A;  3ZC3 A;  2C5H A;  2JJ1 A;  2PIA A;  1OHH A;  1EXM A;  1UD6 A;  3KEW A;  1JA1 A;  4G7X A;  3WND A;  1UMK A;  3AVW A;  3R6J A;  2VNJ A;  3A1P A;  3ZBU A;  2XGJ A;  4PC3 A;  3D26 A;  4AVZ A;  3CP2 A;  5IYQ A;  1YIJ B;  4X07 A;  2ZZF A;  2C77 A;  3OW2 B;  4G1V A;  2DYI A;  3OFN A;  2RC5 A;  2DEU A;  3B78 A;  3LQE A;  2JIZ A;  1QFZ A;  4RDK A;  1U2R A;  1W9X A;  2BF4 A;  2DIE A;  5IYR A;  1N8R D;  4YEJ A;  2Q6O A;  1SM4 A;  4RCY A;  4XMY A;  2RC6 A;  3VNV A;  1QFY A;  1MRZ A;  3GSI A;  4G1B A;  2V31 A;  4ZGN B;  3JU4 A;  4DNR B;  3I1F A;  3QFS A;  4RM0 A;  4RJL A;  1BQE A;  1W35 A;  3AVT A;  2BMW A;  1N06 A;  4Z4T A;  2GJP A;  2YWG A;  3OW7 A;  4II2 A;  4M2L A;  2X6Y A;  3CCV B;  2XNJ A;  2VJI A;  2GJK A;  4LBZ A;  1YJ9 B;  5AN9 A;  3OZU A;  1WU8 A;  4U9U A;  1T6Z A;  4CQJ A;  1K8A D;  3CCM B;  2ZTG A;  2ZZE A;  1VLY A;  2ZL7 A;  1BPL A;  4N3G A;  3PA1 A;  1I8D A;  2ZXH A;  1VF7 A;  1XE1 A;  3OAA A;  4G5G A;  4KKS A;  2JJ2 A;  4XKW A;  3CPW B;  2EFG A;  4XQF A;  5B6I A;  1JA0 A;  2F1M A;  1GR1 A;  1E63 A;  2XZO A;  4XLF A;  5KSW B;  4P3I A;  1VQL B;  2M5S A;  4RDL A;  3OJW A;  1WTH D;  2Q6I A;  2BV3 A;  3B82 A;  4Y9U A;  4Z4R A;  2WZP P;  5DS0 A;  3OOC A;  1W0J A;  3BY2 A;  1EP1 B;  2OBS A;  3BCF A;  5TY0 A;  2QTL A;  4GQN A;  1RQR A;  3Q3A A;  1SKQ A;  5H5J A;  3QE2 A;  1S0U A;  3CC4 B;  4P25 A;  4IW3 B;  4XNF A;  1MAB A;  3VO1 A;  3WBK A;  4DQK A;  4II3 A;  5A88 A;  2GJR A;  2V7U A;  2ZBV A;  2XND A;  2HCJ B;  4P1V A;  3SEJ A;  1H85 A;  1UD2 A;  1IJE A;  2V4D A;  2VBU A;  1W0K A;  2WJY A;  4P6Y A;  2PE3 A;  3CCR B;  1GAW A;  4XD7 A;  2ZXI A;  2C4U A;  3WBJ A;  1M1K D;  2QDX A;  3A35 A;  2WPD A;  2ZIT A;  5FO1 A;  2WZN A;  1YJN B;  3SLD A;  3E20 A;  4G7W A;  4WZK A;  4TMT A;  4WWV A;  5TV2 A;  1R5N A;  3NE5 B;  2X85 A;  4P22 A;  2B7B A;  4XON A;  2OTL B;  3W2H A;  1VQ8 B;  5KNL A;  4BPR A;  1NJI D;  1I7P A;  2X6X A;  2CF4 A;  1Q7Y D;  4ASU A;  3AVX A;  2QTZ A;  4XL9 A;  4ACB A;  1JJ2 B;  4Z4V A;  1W34 A;  4LBV A;  1VQ9 B;  1FNC A;  1GVH A;  4ZCI A;  4RD1 A;  2FVG A;  4QHY A;  3CCQ B;  3P27 A;  4WQM A;  4YEL A;  1CNE A;  2I1L A;  1FX0 A;  5J3O A;  2ZL6 A;  3ASQ A;  4RPD A;  4RD2 A;  3U6B A;  4UZU A;  1VHE A;  1KJZ A;  1TUI A;  3GVK A;  4TKO B;  4Z1M A;  4ROX A;  3W2E A;  3BNW A;  4EH1 A;  3ES9 A;  2R6H A;  4KKT A;  4YAU A;  4RDJ A;  4DNT B;  2DET A;  2VBS A;  2WR8 A;  1KK0 A;  2X53 S;  4TMX A;  4P12 A;  1OB2 A;  1UD3 A;  2B5O A;  3T53 B;  2VJJ A;  4NNJ A;  4WZE A;  4OOV A;  3PVD A;  2JN9 A;  2DER A;  3BQJ A;  1G7C A;  2BGJ A;  4X05 A;  1E62 A;  3ISX A;  1H8E A;  2Z6B D;  2Q6L A;  4XLE A;  4B43 A;  1S72 B;  1EP2 B;  1WPC A;  2ZL5 A;  4XLA A;  3WNC A;  3ZZT A;  4X06 A;  4FXU A;  2WYR A;  1ZUN B;  4P9S A;  4DQL A;  3QSY A;  1Q86 D;  1Q82 D;  1FND A;  3ZPN A;  1W87 A;  5IYP A;  1V0F A;  2V7T A;  3CTA A;  4XN0 A;  3WXM A;  1N08 A;  2D74 A;  1CNF A;  1KC8 D;  2BPO A;  4M0L A;  5HKK A;  4X8I A;  3I55 B;  3FPK A;  2ZZG A;  3ONY A;  4DK0 A;  3WYA A;  2QGG A;  1M90 D;  1FRQ A;  3P26 A;  5A8A A;  2EIX A;  3OEE A;  1Y0R A;  4M1K A;  2R9V A;  4TMW A;  3CCJ B;  4Z4Z A;  3VO2 A;  3T56 B;  3CW2 A;  4ZV4 A;  2Q6K A;  3V76 A;  5E6T A;  1IJF A;  2F1L A;  1ZM3 A;  4X7D A;  1G7R A;  4FWT A;  2C4T A;  2VNH A;  1KD1 D;  3A3B A;  3PEN A;  2E1B A;  4XN3 A;  4AC9 A;  2W6I A;  4E0F A;  1K73 D;  3WNB A;  1VQ6 B;  1JB9 A;  4DK1 A;  1V0E A;  2DOG A;  3A8K A;  3MMP A;  1YI2 B;  4F7D A;  3VMF A;  2GRE A;  4UAJ A;  2DCU A;  4YAO A;  1Y0Y A;  4B4D A;  2VBV A;  4PAA A;  2D3L A;  2BN4 A;  3A8I A;  3A8J A;  2ZZQ A;  5FA6 A;  4R71 A;  3QFT A;  1YJW B;  3G71 B;  1EP3 B;  2QE7 A;  3E1Y E;  4QVA A;  1YX2 A;  1EFU A;  1PJ6 A;  2CK3 A;  2GK7 A;  3SLN A;  3ASP A;  4C0S A;  3B8H A;  2WSS A;  4RD0 A;  4UZE A;  4B3X A;  2NPF A;  4YAL A;  2NV4 A;  1OGI A;  3W2G A;  1UD4 A;  2VNK A;  1S4M A;  1VQP B;  4QVJ A;  3HAG A;  4XR6 A;  1FRN A;  1XFO A;  1HVX A;  1B23 P;  4B3G A;  5GV8 A;  1QVG B;  4XLC A;  3U6K A;  5KW9 A;  3CCL B;  1TLL A;  3FPP A;  5J35 A;  5BSX A;  1WSV A;  3JQQ A;  1OGJ A;  3H9N A;  4H9G A;  4JMQ A;  4YAF A;  5IYW A;  5F4O A;  2CND A;  1VLO A;  3ZBT A;  4LBY A;  4OOS A;  4PC6 A;  4OPS A;  1D2E A;  1SKY B;  4TT3 A;  2QN6 A;  1FNM A;  3GVJ A;  1QUE A;  1WP6 A;  5FIU A;  4QFM A;  3VR6 A;  1DDI A;  5THX A;  3Q38 A;  1K9M D;  3Q39 A;  4HE6 A;  1WOO A;  1QUF A;  2BSA A;  2VBT A;  4Y9R A;  4XOT A;  1PJ5 A;  4ZCL A;  5IK2 A;  1D1N A;  2LZJ A;  4TMZ A;  1WOS A;  3DDY A;  1K28 D;  4XLH A;  1YLO A;  4RD3 A;  1FNB A;  4NCN A;  4P26 A;  4XKV A;  4PGO A;  3AST A;  4NBS A;  5BSY A;  1ZM9 A;  1KRH A;  1G7S A;  1NB9 A;  3ZUG A;  4K1X A;  2V7W A;  3LVB A;  2C78 A;  2QMU A;  4YAW A;  1N05 A;  1NB0 A;  5IYN A;  1F60 A;  3PUM A;  4XOP A;  2BM1 A;  4RCZ A;  2OK7 A;  4KKU A;  2OBR A;  4OOX A;  1BJK A;  3W2I A;  3VNU A;  1E64 A;  1E43 A;  4Y7C A;  5HZB A;  1QVF B;  3ONU A;  2VZL A;  1EFC A;  1QX4 A;  1FDR A;  4LBW A;  4RD6 A;  4P6V F;  2YWE A;  2X6W A;  4TSF A;  2W6J A;  4RPB A;  4TMV A;  3ZIA A;  3R6K A;  3JQR A;  2GK6 A;  3LO8 A;  4Z4S A;  3RY8 A;  2GQF A;  4Z4U A;  3BC9 A;  4RLZ A;  4X7F A;  3Q6Q A;  1COW A;  1E1R A;  1QH0 A;  4XOR A;  4MYT A;  4MYU A;  4X7C A;  4PC1 A;  1WOP A;  5A89 A;  2QA4 B;  2JDI A;  3PA2 A;  3Q6R A;  1VHO A;  4HIZ A;  1AMO A;  2V7Q A;  1P4M A;  2XEX A;  5FL7 A;  3U2Q A;  4Z4Y A;  1PJ7 A;  3GIR A;  3G05 A;  4ACA A;  5F4M A;  1DG1 G;  1ZM4 A;  4Q7J B;  1VQ7 B;  1QFJ A;  1N0V C;  1N07 A;  2FX3 A;  1EFR A;  3WY9 A;  1Q9S A;  1OB5 A;  2OTJ B;  2PLF A;  3CES A;  1GJR A;  1KK1 A;  1HA3 A;  3BY1 A;  1BX1 A;  2XNC A;  2C5B A;  1G7T A;  1GAQ A;  2C2W A;  2KVO A;  3QFR A;  1VQN B;  2YWH A;  3LQ6 A;  3QFC A;  4OP7 A;  5F4J A;  3SJZ A;  4YXW A;  2XOK A;  1J9Z A;  3V7A A;  1R5O A;  4X7E A;  3BH4 A;  2CC2 A;  1OB0 A;  2F4N A;  2OK8 A;  5GV7 A;  1QGZ A;  1BX0 A;  3CXC B;  3KL9 A;  2F43 A;  5DN6 A;  1QGA A;  2X3U A;  1VQM B;  1V5V A;  1TTT A;  4AF6 A;  1I18 A;  3OEH A;  3OE7 A;  2VNI A;  3CC7 B;  4B47 A;  3OP1 A;  5CDF A;  1EFT A;  3MCA A;  2PMD A;  4HE5 A;  5EMN A;  4TN1 A;  1KK3 A;  2DY1 A;  1HZE A;  3FKS A;  3AGQ A;  3BCD A;  4M53 A;  1T6X A;  1YIT B;  1VQ4 B;  4G6I A;  4B3F X;  1PKV A;  1WDT A;  3CCU B;  1BMF A;  3OKX A;  3OJX A;  4PC7 A;  1VQO B;  1UD5 A;  1Q81 D;  1D8T A;  2ZBU A;  3A3G A;  3CMM A;  4N3N A;  3CCE B;  3FJO A;  4P2N A;  3WQZ A;  3W5V A;  2HMA A;  3AVU A;  2HLD A;  2WJV A;  1IB0 A;  5HXB A;  3ZZU A;  4ZCM A;  4L8J A;  3W5U A;  5H59 A;  1E3Z A;  1B2R A;  2VYQ A;  2P3M A;  4RD4 A;  5TR9 A;  4OPO A;  4Z4W A;  3CPX A;  5FO0 A;  4AF7 A;  3W5H A;  1GO2 A;  1E3X A;  1VJS A;  1E1Q A;  1NDH A;  2V7X A;  4C43 A;  1N0U A;  4P3Y A;  1WSR A;  1A8P A;  2ZTN A;  2XZL A;  3ZZ0 A;  2CBX A;  3AVY A;  2BM0 A;  2BGI A;  4WZT A;  5FNZ A;  1KZL A;  3GVL A;  2CRV A;  2CW5 A;  1VQK B;  2D3N A;  1DDG A;  4X0C A;  1QG0 A;  3H94 A;  3W2F A;  1ZM2 A;  1XQB A;  2E1R A;  4OPV A;  3ASS A;  2OBT A;  4J0Q A;  2OYN A;  2X8K A;  4YHB A;  3CME B;  1KQS B;  5L46 A;  2X0K A;  1EWY A;  1H8H A;  1NRK A; 
#chains in the Genus database with same CATH homology
 4P3I A;  4RDL A;  4QUZ A;  4RPB A;  4Z4R A;  3R6K A;  4Z4Z A;  2OBS A;  4Z4S A;  3RY8 A;  4Z4U A;  3PUN A;  5E6T A;  3Q3A A;  4RLZ A;  4X7F A;  3Q6Q A;  4X7D A;  4P25 A;  4X7C A;  3PA2 A;  3Q6R A;  3SJP A;  3SKB A;  4P1V A;  3SEJ A;  4Z4Y A;  1IHM A;  4QV2 A;  5F4M A;  5HZA A;  3SLD A;  4WZK A;  3BY1 A;  4QVA A;  3ASR A;  3LQ6 A;  4WZL A;  3SLN A;  4OP7 A;  5F4J A;  3ASP A;  3R6J A;  3V7A A;  4Z4V A;  4X7E A;  3D26 A;  5IYQ A;  4X07 A;  4QVJ A;  3LQE A;  4RDK A;  5KW9 A;  5J35 A;  5BSX A;  5J3O A;  2ZL6 A;  3ASQ A;  4RPD A;  5IYW A;  5IYR A;  5F4O A;  4OOS A;  4OPS A;  4ROX A;  4RDJ A;  3Q38 A;  4RM0 A;  3Q39 A;  4P2N A;  4P12 A;  4Z4T A;  4WZE A;  4OOV A;  3PVD A;  4OPO A;  4Z4W A;  3BQJ A;  4X05 A;  4P26 A;  2ZL5 A;  3AST A;  5BSY A;  4X06 A;  2ZL7 A;  4WZT A;  3PA1 A;  5IYP A;  5IYN A;  3PUM A;  4X0C A;  2OBR A;  4OOX A;  4OPV A;  3ASS A;  2OBT A;  3ONY A;  5HZB A;  3ONU A;  3BY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...