2ZL5A

Atomic resolution structural characterization of recognition of histo-blood group antigen by norwalk virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
289
structure length
289
Chain Sequence
FTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTIGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWVSRFYQLKPVGTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structural characterization of recognition of histo-blood group antigens by Norwalk virus
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
molecule keywords 58 kd capsid protein
total genus 67
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 2zl5A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 2zl5A01
4P3IA 5BSXA 5IYWA 4X7EA 3ASSA 4Z4TA 5F4JA 4OPVA 4Z4YA 5IYNA 4OOVA 4X07A 3ASPA 2OBSA 3PUNA 5J3OA 5J35A 4QUZA 4RDKA 3PA1A 5F4OA 4RDLA 5HZBA 4OPSA 5IYRA 4X0CA 4OOSA 3SLDA 4Z4RA 5KW9A 5F4MA 5E6TA 3ASQA 4Z4WA 3ONYA 2ZL6A 3Q38A 3Q3AA 4Z4VA 3RY8A 2OBTA 4P2NA 4OOXA 3ONUA 3LQ6A 4RM0A 3R6KA 3SLNA 3ASRA 3BQJA 4QV2A 4X06A 4Z4ZA 5BSYA 4RLZA 3Q39A 3Q6RA 3SJPA 4RPBA 3BY1A 2ZL5A 4X05A 3R6JA 4OPOA 4P25A 2OBRA 3Q6QA 4OP7A 2ZL7A 4ROXA 3ASTA 5IYQA 5IYPA 3V7AA 4X7DA 3PA2A 3SEJA 3SKBA 4QVJA 1IHMA 4QVAA 4WZLA 4Z4SA 5HZAA 4WZKA 4RPDA 3PVDA 4P12A 3PUMA 4Z4UA 4RDJA 4P26A 4X7CA 3LQEA 4WZTA 4X7FA 4WZEA 3BY2A 3D26A 4P1VA
chains in the Genus database with same CATH superfamily
5BSXA 4M4SA 3OKXA 1EFTA 3WNCA 3JQQA 2GJPA 2YWGA 4JMQA 4YAWA 4LC0A 1M90D 4XLAA 1FX0A 4Z4YA 5IYNA 2D3LA 4J0QA 1W0KA 4X07A 3ASPA 2WZPP 3AVYA 1KZLA 2JIZA 2BGJA 3WNDA 1FNCA 4OPSA 4Y9UA 1EFUA 5IYRA 2PE3A 4AVZA 1W35A 4UZEA 3V76A 2I1LA 3PENA 4Z4RA 5F4MA 4XD7A 1T6YA 4CQJA 4TMVA 2OTJB 2QN6A 3CPXA 3AGQA 2X6WA 4PAAA 3VNUA 1WOSA 4P2NA 3CPWB 1VQ4B 1EFCA 2RC6A 2XNCA 1ZUNB 4OOXA 2OK8A 4GQNA 1K9MD 1B2RA 5TY0A 1Q7YD 3ONUA 1EP2B 4RD2A 1PJ6A 4ZCMA 3FPKA 4PC6A 1DG1G 3BCDA 3JQRA 2ZXHA 1VQLB 4WQMA 1EFRA 1VQKB 1R5BA 4XORA 1VQ5B 4M2LA 3BQJA 2DETA 4B43A 1GR1A 1F20A 3QE2A 1E3ZA 1VQ9B 3CW2A 4B47A 4RD4A 4UAJA 4B3GA 1W87A 2ZZGA 2JN9A 3BY1A 2ZL5A 4RJLA 3OEHA 4OPOA 1G7CA 3I55B 3CP8A 1WP6A 3A3GA 1Q81D 3Q6QA 2GJKA 2RC5A 1H8EA 1OHHA 2M5SA 3AVUA 2BV3A 2AHOA 3P26A 4LBYA 4TT3A 1QUEA 3G4SB 4XN3A 4HE5A 2HMAA 2OK7A 4XLFA 4XN0A 1GAQA 1ZM4A 2VNJA 1GO2A 3WBKA 4G1BA 4E0FA 5KSWB 1U2RA 4LBZA 4N3NA 4U9UA 4RCYA 3PA2A 1KD1D 3T51B 3A8IA 3SKBA 4PC7A 1E1RA 5CDFA 4AC9A 3G6EB 2BVNA 1IHMA 3LNNA 4Z4SA 1GJRA 5HZAA 3GIRA 2C5HA 5DSZA 3OPOA 1GAWA 1FDRA 1PJ5A 3ZZUA 1E1QA 2GPJA 2QDXA 2F1LA 3G71B 1KRHA 1WSVA 3ZZ0A 4XOPA 2P3MA 4YALA 1WU8A 5A88A 1QVGB 2BSAA 4II3A 1NBMA 4G5GA 4WZTA 4X7FA 2R9VA 3SJZA 1K8AD 4L8JA 4P22A 1XQBA 1R5NA 4X8IA 2WYRA 2VBTA 4YHBA 1KK3A 1OB0A 2XNJA 4Z4TA 2GQFA 4OPVA 1QG0A 2NV4A 3VR6A 4NNJA 1E3XA 3B78A 1W2BB 2B7CA 3B8HA 3BC9A 4XM3A 3PUNA 3JU4A 1VQOB 2DERA 3PA1A 3T56B 3OZVA 1BX0A 3CRZA 5HZBA 2B5OA 1TVCA 1UD8A 3ZPNA 4X0CA 3HAGA 1NB9A 2Q6IA 1OB2A 5JBQA 4OOSA 2C78A 3GVLA 2C4TA 5FO0A 1SM4A 4NBSA 3WNBA 3J81k 2QMUA 2CRVA 2X3UA 4AF7A 1JNYA 2C2WA 2D9RA 2W6IA 4Z4WA 2ZBUA 3ONYA 1OGIA 3W2HA 2OYNA 3W2EA 4DQLA 4YELA 1VQMB 1BPLA 4YAFA 1FRNA 4TMTA 3Q3AA 3ZBUA 3CMEB 4Z4VA 5A89A 3CCUB 2V7XA 1JJ2B 4RD6A 2YWHA 1XB2A 1BLIA 1Q9SA 3ES9A 3CC7B 2F43A 4RM0A 2BMWA 1N0UA 4ACBA 5FA6A 1UD5A 4MYUA 3OOCA 1D2EA 2ZZEA 3H9NA 3ASRA 2ZBVA 1OB5A 1YIJB 3CMAB 2JJ1A 2BM1A 3WXMA 1YJNB 3CMMA 4RLZA 2VBUA 3Q39A 4NCNA 2WR8A 3CCRB 4Z1MA 1YHQB 3R6JA 3GQBA 3P27A 1UD4A 2Q6OA 2OBRA 4OP7A 1WPCA 4KKUA 1W34A 1WORA 4G1VA 3OFNA 2PIAA 1YLOA 4Y7CA 3CB4A 3QFRA 2BN4A 5IYQA 3ISXA 3E20A 2X8KA 5GV8A 1HVXA 2BGIA 2CNDA 2VNKA 3FPPA 3W2IA 1UD3A 3BCFA 4RCZA 1E79A 3MMPA 5A8AA 1T5EA 1E62A 3QSYA 1YX2A 5HXBA 2ZZQA 2VYQA 2CC2A 4DK1A 2W6JA 4M53A 1QFYA 5FO1A 2GREA 3VNVA 4PC1A 3ZBTA 1VQ6B 2DIEA 4WZLA 1JA0A 1T6ZA 3AVTA 2DYIA 2LZJA 4WZKA 2HCJB 4RPDA 3PVDA 2WZNA 5FIUA 3OEEA 4P12A 4P3YA 2XOKA 1KQSB 3A1PA 2WJVA 4Z4UA 4II2A 1DDGA 1NB0A 1V0FA 5DS0A 1AIPA 1DARA 4FK8A 4YXWA 1QGZA 4KKSA 4QFMA 2XGJA 4RDJA 4P26A 2DY1A 4ZGQB 3OZWA 4YEJA 1JA1A 1G7RA 1HA3A 2EIXA 4WZEA 3BY2A 4UZFA 2VJIA 3W5UA 1F60A 1K28D 3D26A 2V7TA 1QVFB 1CNEA 4P1VA 5FNZA 1YJ9B 4P3IA 4ZGNB 1BQEA 2F4NA 1COWA 4WWVA 4X7EA 5DN6A 1MABA 5IYWA 3ASSA 5H59A 5F4JA 1FNDA 3A8JA 1RQPA 1KK1A 3ZUGA 1ZM2A 2VZLA 1QGAA 2Q6KA 4OOVA 4TMXA 3VMFA 2OBSA 2KVOA 4RD1A 5J35A 3WY9A 5F4OA 5LMZA 1ZM3A 2C77A 2YWEA 2DOGA 3CXCB 2YWFA 2VBVA 1OGJA 2EFGA 4R71A 2V7QA 1K73D 4G6IA 3W5VA 5TV2A 1WSRA 4PABA 1Y0YA 5KW9A 2ZTNA 2JDIA 4LBWA 4C43A 4B3FX 1H8HA 5E6TA 1DDIA 3ASQA 4TMWA 1D1NA 2F1MA 3W5HA 1TUIA 3H94A 2XZOA 3VO2A 3NE5B 3RY8A 3W2GA 1YI2B 2DEUA 4XKWA 1A8PA 3WBJA 2GK6A 2XNDA 4AF6A 1EXMA 1KTVA 1SKYB 5AN9A 1WOPA 2CF4A 1BMFA 2WPDA 4K1XA 3CP2A 3WYAA 1Q86D 4ACAA 2GK7A 1N06A 3CC2B 1RQRA 4Z4ZA 2QEXB 2BF4A 4DQKA 3U6BA 2VNHA 2WJYA 1XE1A 3BH4A 4RPBA 4X05A 2V7VA 2X6XA 1N05A 3CC4B 4P25A 4DNRB 1BJKA 1V0EA 2X0KA 4FXUA 3E1YE 3CCLB 3A35A 3QFTA 2V7WA 2ZL7A 3OW7A 1E63A 2BPOA 1KK2A 4ZCLA 5KNLA 1I8DA 5IK2A 2QE7A 3OJXA 5IYPA 1PKVA 1B23P 3OW2B 1YITB 4PGOA 3OJWA 1WOOA 1KC8D 5TRDA 1UD6A 2ZXIA 2QGGA 4N3GA 1HZEA 2V7UA 3DDYA 4RD0A 4B48A 4B3XA 3CCSB 4X7DA 1IJEA 2VNIA 2D74A 1G7SA 1E64A 1VJSA 1VLOA 1W0JA 3CTAA 3AVXA 4YAUA 1UMKA 2PLFA 4QVJA 2HDNB 3GSIA 3LVBA 2C4UA 4QVAA 5B6IA 3B82A 5L46A 2VJJA 1VQ7B 4TKOB 4P6YA 4DK0A 3ZC3A 3OAAA 1FNMA 2NPFA 4TN1A 4H9GA 1AMOA 2QA4B 1WDTA 3OZUA 4XLCA 1N8RD 1FNBA 4TSFA 2XZLA 3KEWA 3MHPA 1QUFA 4PC2A 1WTHD 1IJFA 1R5OA 3QFCA 2X53S 3JQPA 5FL7A 1QFJA 5GV7A 4F7DA 1I18A 1NDHA 3GVKA 3MCAA 2XEXA 1QGYA 1TTTA 4XOTA 1I7PA 5J3OA 4QUZA 4RDKA 2PMDA 1S0UA 2V31A 4RDLA 2QTLA 2XZPA 3FKSA 1T6XA 3QFSA 1CNFA 3CCVB 1NJID 2D3NA 2WSSA 3FJOA 3SLDA 1P4MA 2HLDA 1QX4A 3U2QA 1N07A 2E1RA 4XQFA 3AVWA 2ZZFA 2V4DA 1GVHA 1J9ZA 5EMNA 4PC3A 1EP1B 4BPRA 1H42A 2GJRA 2FVGA 4HE6A 2ZL6A 1PJ7A 1CQXA 1D8TA 3BNWA 3Q38A 4ASUA 5HKKA 1BX1A 4XNFA 2OBTA 3OP1A 1KK0A 1ELOA 3ZIAA 1Q82D 4G7WA 4FN5A 3LQ6A 1TLLA 2C5BA 1E43A 4RD3A 3R6KA 4MYTA 1ZM9A 3SLNA 1V5VA 4XR6A 3CESA 2X85A 4QV2A 3CCMB 1MRZA 4X06A 1FRQA 5BSYA 5TR9A 4XLEA 4EH1A 4LBVA 4DNTB 4ZV4A 3Q6RA 4XMYA 3SJPA 1VHEA 2DCUA 4XKVA 1JB9A 4KKTA 1N0VC 1SKQA 1KJZA 1VQPB 1S4MA 3CCQB 4IW3B 1VQ8B 1G7TA 3ZZTA 4ROXA 1QFZA 3ASTA 2CK3A 3VO1A 2CBXA 3GVJA 2QTZA 4ZCIA 3CCEB 2Q6LA 2E1BA 2JJ2A 3LO8A 3I56B 3A8KA 4XL9A 3AGPA 3V7AA 4QHYA 4UZUA 3W2FA 4M1KA 1VHOA 1EWYA 1VF7A 2ZTGA 4C0SA 3OE7A 1M1KD 4HIZA 1KMHA 4G7XA 3SEJA 1W9XA 1UD2A 1S72B 5THXA 4XLHA 3T53B 4Y9RA 4B44A 1IB0A 1NRKA 1H85A 3KL9A 4P9SA 4TMZA 3WQZA 2B7BA 2OTLB 2R6HA 4XONA 4P6VF 5H5JA 2FX3A 4M0LA 3G05A 3U6KA 3PUMA 2J7KA 1VLYA 1QH0A 2X6YA 2Z6BD 2VBSA 1YJWB 3AVVA 1Y0RA 3A3BA 3CD6B 1N08A 4X7CA 1EP3B 3LQEA 4YAOA 3CCJB 4Q7JB 1XFOA 2BM0A 4FWTA 4B4DA 1VQNB 2ZITA 2CW5A 3I1FA
chains in the Genus database with same CATH topology
4P3IA 5BSXA 5IYWA 4X7EA 3ASSA 4Z4TA 5F4JA 4OPVA 4Z4YA 5IYNA 4OOVA 4X07A 3ASPA 2OBSA 3PUNA 5J3OA 5J35A 4QUZA 4RDKA 3PA1A 5F4OA 4RDLA 5HZBA 4OPSA 5IYRA 4X0CA 4OOSA 3SLDA 4Z4RA 5KW9A 5F4MA 5E6TA 3ASQA 4Z4WA 3ONYA 2ZL6A 3Q38A 3Q3AA 4Z4VA 3RY8A 2OBTA 4P2NA 4OOXA 3ONUA 3LQ6A 4RM0A 3R6KA 3SLNA 3ASRA 3BQJA 4QV2A 4X06A 4Z4ZA 5BSYA 4RLZA 3Q39A 3Q6RA 3SJPA 4RPBA 3BY1A 2ZL5A 4X05A 3R6JA 4OPOA 4P25A 2OBRA 3Q6QA 4OP7A 2ZL7A 4ROXA 3ASTA 5IYQA 5IYPA 3V7AA 4X7DA 3PA2A 3SEJA 3SKBA 4QVJA 1IHMA 4QVAA 4WZLA 4Z4SA 5HZAA 4WZKA 4RPDA 3PVDA 4P12A 3PUMA 4Z4UA 4RDJA 4P26A 4X7CA 3LQEA 4WZTA 4X7FA 4WZEA 3BY2A 3D26A 4P1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P3I A;  5BSX A;  5IYW A;  4X7E A;  3ASS A;  4Z4T A;  5F4J A;  4OPV A;  4Z4Y A;  5IYN A;  4OOV A;  4X07 A;  3ASP A;  2OBS A;  3PUN A;  5J3O A;  5J35 A;  4QUZ A;  4RDK A;  3PA1 A;  5F4O A;  4RDL A;  5HZB A;  4OPS A;  5IYR A;  4X0C A;  4OOS A;  3SLD A;  4Z4R A;  5KW9 A;  5F4M A;  5E6T A;  3ASQ A;  4Z4W A;  3ONY A;  2ZL6 A;  3Q38 A;  3Q3A A;  4Z4V A;  3RY8 A;  2OBT A;  4P2N A;  4OOX A;  3ONU A;  3LQ6 A;  4RM0 A;  3R6K A;  3SLN A;  3ASR A;  3BQJ A;  4QV2 A;  4X06 A;  4Z4Z A;  5BSY A;  4RLZ A;  3Q39 A;  3Q6R A;  3SJP A;  4RPB A;  3BY1 A;  2ZL5 A;  4X05 A;  3R6J A;  4OPO A;  4P25 A;  2OBR A;  3Q6Q A;  4OP7 A;  2ZL7 A;  4ROX A;  3AST A;  5IYQ A;  5IYP A;  3V7A A;  4X7D A;  3PA2 A;  3SEJ A;  3SKB A;  4QVJ A;  1IHM A;  4QVA A;  4WZL A;  4Z4S A;  5HZA A;  4WZK A;  4RPD A;  3PVD A;  4P12 A;  3PUM A;  4Z4U A;  4RDJ A;  4P26 A;  4X7C A;  3LQE A;  4WZT A;  4X7F A;  4WZE A;  3BY2 A;  3D26 A;  4P1V A; 
#chains in the Genus database with same CATH topology
 5BSX A;  4M4S A;  3OKX A;  1EFT A;  3WNC A;  3JQQ A;  2GJP A;  2YWG A;  4JMQ A;  4YAW A;  4LC0 A;  1M90 D;  4XLA A;  1FX0 A;  4Z4Y A;  5IYN A;  2D3L A;  4J0Q A;  1W0K A;  4X07 A;  3ASP A;  2WZP P;  3AVY A;  1KZL A;  2JIZ A;  2BGJ A;  3WND A;  1FNC A;  4OPS A;  4Y9U A;  1EFU A;  5IYR A;  2PE3 A;  4AVZ A;  1W35 A;  4UZE A;  3V76 A;  2I1L A;  3PEN A;  4Z4R A;  5F4M A;  4XD7 A;  1T6Y A;  4CQJ A;  4TMV A;  2OTJ B;  2QN6 A;  3CPX A;  3AGQ A;  2X6W A;  4PAA A;  3VNU A;  1WOS A;  4P2N A;  3CPW B;  1VQ4 B;  1EFC A;  2RC6 A;  2XNC A;  1ZUN B;  4OOX A;  2OK8 A;  4GQN A;  1K9M D;  1B2R A;  5TY0 A;  1Q7Y D;  3ONU A;  1EP2 B;  4RD2 A;  1PJ6 A;  4ZCM A;  3FPK A;  4PC6 A;  1DG1 G;  3BCD A;  3JQR A;  2ZXH A;  1VQL B;  4WQM A;  1EFR A;  1VQK B;  1R5B A;  4XOR A;  1VQ5 B;  4M2L A;  3BQJ A;  2DET A;  4B43 A;  1GR1 A;  1F20 A;  3QE2 A;  1E3Z A;  1VQ9 B;  3CW2 A;  4B47 A;  4RD4 A;  4UAJ A;  4B3G A;  1W87 A;  2ZZG A;  2JN9 A;  3BY1 A;  2ZL5 A;  4RJL A;  3OEH A;  4OPO A;  1G7C A;  3I55 B;  3CP8 A;  1WP6 A;  3A3G A;  1Q81 D;  3Q6Q A;  2GJK A;  2RC5 A;  1H8E A;  1OHH A;  2M5S A;  3AVU A;  2BV3 A;  2AHO A;  3P26 A;  4LBY A;  4TT3 A;  1QUE A;  3G4S B;  4XN3 A;  4HE5 A;  2HMA A;  2OK7 A;  4XLF A;  4XN0 A;  1GAQ A;  1ZM4 A;  2VNJ A;  1GO2 A;  3WBK A;  4G1B A;  4E0F A;  5KSW B;  1U2R A;  4LBZ A;  4N3N A;  4U9U A;  4RCY A;  3PA2 A;  1KD1 D;  3T51 B;  3A8I A;  3SKB A;  4PC7 A;  1E1R A;  5CDF A;  4AC9 A;  3G6E B;  2BVN A;  1IHM A;  3LNN A;  4Z4S A;  1GJR A;  5HZA A;  3GIR A;  2C5H A;  5DSZ A;  3OPO A;  1GAW A;  1FDR A;  1PJ5 A;  3ZZU A;  1E1Q A;  2GPJ A;  2QDX A;  2F1L A;  3G71 B;  1KRH A;  1WSV A;  3ZZ0 A;  4XOP A;  2P3M A;  4YAL A;  1WU8 A;  5A88 A;  1QVG B;  2BSA A;  4II3 A;  1NBM A;  4G5G A;  4WZT A;  4X7F A;  2R9V A;  3SJZ A;  1K8A D;  4L8J A;  4P22 A;  1XQB A;  1R5N A;  4X8I A;  2WYR A;  2VBT A;  4YHB A;  1KK3 A;  1OB0 A;  2XNJ A;  4Z4T A;  2GQF A;  4OPV A;  1QG0 A;  2NV4 A;  3VR6 A;  4NNJ A;  1E3X A;  3B78 A;  1W2B B;  2B7C A;  3B8H A;  3BC9 A;  4XM3 A;  3PUN A;  3JU4 A;  1VQO B;  2DER A;  3PA1 A;  3T56 B;  3OZV A;  1BX0 A;  3CRZ A;  5HZB A;  2B5O A;  1TVC A;  1UD8 A;  3ZPN A;  4X0C A;  3HAG A;  1NB9 A;  2Q6I A;  1OB2 A;  5JBQ A;  4OOS A;  2C78 A;  3GVL A;  2C4T A;  5FO0 A;  1SM4 A;  4NBS A;  3WNB A;  3J81 k;  2QMU A;  2CRV A;  2X3U A;  4AF7 A;  1JNY A;  2C2W A;  2D9R A;  2W6I A;  4Z4W A;  2ZBU A;  3ONY A;  1OGI A;  3W2H A;  2OYN A;  3W2E A;  4DQL A;  4YEL A;  1VQM B;  1BPL A;  4YAF A;  1FRN A;  4TMT A;  3Q3A A;  3ZBU A;  3CME B;  4Z4V A;  5A89 A;  3CCU B;  2V7X A;  1JJ2 B;  4RD6 A;  2YWH A;  1XB2 A;  1BLI A;  1Q9S A;  3ES9 A;  3CC7 B;  2F43 A;  4RM0 A;  2BMW A;  1N0U A;  4ACB A;  5FA6 A;  1UD5 A;  4MYU A;  3OOC A;  1D2E A;  2ZZE A;  3H9N A;  3ASR A;  2ZBV A;  1OB5 A;  1YIJ B;  3CMA B;  2JJ1 A;  2BM1 A;  3WXM A;  1YJN B;  3CMM A;  4RLZ A;  2VBU A;  3Q39 A;  4NCN A;  2WR8 A;  3CCR B;  4Z1M A;  1YHQ B;  3R6J A;  3GQB A;  3P27 A;  1UD4 A;  2Q6O A;  2OBR A;  4OP7 A;  1WPC A;  4KKU A;  1W34 A;  1WOR A;  4G1V A;  3OFN A;  2PIA A;  1YLO A;  4Y7C A;  3CB4 A;  3QFR A;  2BN4 A;  5IYQ A;  3ISX A;  3E20 A;  2X8K A;  5GV8 A;  1HVX A;  2BGI A;  2CND A;  2VNK A;  3FPP A;  3W2I A;  1UD3 A;  3BCF A;  4RCZ A;  1E79 A;  3MMP A;  5A8A A;  1T5E A;  1E62 A;  3QSY A;  1YX2 A;  5HXB A;  2ZZQ A;  2VYQ A;  2CC2 A;  4DK1 A;  2W6J A;  4M53 A;  1QFY A;  5FO1 A;  2GRE A;  3VNV A;  4PC1 A;  3ZBT A;  1VQ6 B;  2DIE A;  4WZL A;  1JA0 A;  1T6Z A;  3AVT A;  2DYI A;  2LZJ A;  4WZK A;  2HCJ B;  4RPD A;  3PVD A;  2WZN A;  5FIU A;  3OEE A;  4P12 A;  4P3Y A;  2XOK A;  1KQS B;  3A1P A;  2WJV A;  4Z4U A;  4II2 A;  1DDG A;  1NB0 A;  1V0F A;  5DS0 A;  1AIP A;  1DAR A;  4FK8 A;  4YXW A;  1QGZ A;  4KKS A;  4QFM A;  2XGJ A;  4RDJ A;  4P26 A;  2DY1 A;  4ZGQ B;  3OZW A;  4YEJ A;  1JA1 A;  1G7R A;  1HA3 A;  2EIX A;  4WZE A;  3BY2 A;  4UZF A;  2VJI A;  3W5U A;  1F60 A;  1K28 D;  3D26 A;  2V7T A;  1QVF B;  1CNE A;  4P1V A;  5FNZ A;  1YJ9 B;  4P3I A;  4ZGN B;  1BQE A;  2F4N A;  1COW A;  4WWV A;  4X7E A;  5DN6 A;  1MAB A;  5IYW A;  3ASS A;  5H59 A;  5F4J A;  1FND A;  3A8J A;  1RQP A;  1KK1 A;  3ZUG A;  1ZM2 A;  2VZL A;  1QGA A;  2Q6K A;  4OOV A;  4TMX A;  3VMF A;  2OBS A;  2KVO A;  4RD1 A;  5J35 A;  3WY9 A;  5F4O A;  5LMZ A;  1ZM3 A;  2C77 A;  2YWE A;  2DOG A;  3CXC B;  2YWF A;  2VBV A;  1OGJ A;  2EFG A;  4R71 A;  2V7Q A;  1K73 D;  4G6I A;  3W5V A;  5TV2 A;  1WSR A;  4PAB A;  1Y0Y A;  5KW9 A;  2ZTN A;  2JDI A;  4LBW A;  4C43 A;  4B3F X;  1H8H A;  5E6T A;  1DDI A;  3ASQ A;  4TMW A;  1D1N A;  2F1M A;  3W5H A;  1TUI A;  3H94 A;  2XZO A;  3VO2 A;  3NE5 B;  3RY8 A;  3W2G A;  1YI2 B;  2DEU A;  4XKW A;  1A8P A;  3WBJ A;  2GK6 A;  2XND A;  4AF6 A;  1EXM A;  1KTV A;  1SKY B;  5AN9 A;  1WOP A;  2CF4 A;  1BMF A;  2WPD A;  4K1X A;  3CP2 A;  3WYA A;  1Q86 D;  4ACA A;  2GK7 A;  1N06 A;  3CC2 B;  1RQR A;  4Z4Z A;  2QEX B;  2BF4 A;  4DQK A;  3U6B A;  2VNH A;  2WJY A;  1XE1 A;  3BH4 A;  4RPB A;  4X05 A;  2V7V A;  2X6X A;  1N05 A;  3CC4 B;  4P25 A;  4DNR B;  1BJK A;  1V0E A;  2X0K A;  4FXU A;  3E1Y E;  3CCL B;  3A35 A;  3QFT A;  2V7W A;  2ZL7 A;  3OW7 A;  1E63 A;  2BPO A;  1KK2 A;  4ZCL A;  5KNL A;  1I8D A;  5IK2 A;  2QE7 A;  3OJX A;  5IYP A;  1PKV A;  1B23 P;  3OW2 B;  1YIT B;  4PGO A;  3OJW A;  1WOO A;  1KC8 D;  5TRD A;  1UD6 A;  2ZXI A;  2QGG A;  4N3G A;  1HZE A;  2V7U A;  3DDY A;  4RD0 A;  4B48 A;  4B3X A;  3CCS B;  4X7D A;  1IJE A;  2VNI A;  2D74 A;  1G7S A;  1E64 A;  1VJS A;  1VLO A;  1W0J A;  3CTA A;  3AVX A;  4YAU A;  1UMK A;  2PLF A;  4QVJ A;  2HDN B;  3GSI A;  3LVB A;  2C4U A;  4QVA A;  5B6I A;  3B82 A;  5L46 A;  2VJJ A;  1VQ7 B;  4TKO B;  4P6Y A;  4DK0 A;  3ZC3 A;  3OAA A;  1FNM A;  2NPF A;  4TN1 A;  4H9G A;  1AMO A;  2QA4 B;  1WDT A;  3OZU A;  4XLC A;  1N8R D;  1FNB A;  4TSF A;  2XZL A;  3KEW A;  3MHP A;  1QUF A;  4PC2 A;  1WTH D;  1IJF A;  1R5O A;  3QFC A;  2X53 S;  3JQP A;  5FL7 A;  1QFJ A;  5GV7 A;  4F7D A;  1I18 A;  1NDH A;  3GVK A;  3MCA A;  2XEX A;  1QGY A;  1TTT A;  4XOT A;  1I7P A;  5J3O A;  4QUZ A;  4RDK A;  2PMD A;  1S0U A;  2V31 A;  4RDL A;  2QTL A;  2XZP A;  3FKS A;  1T6X A;  3QFS A;  1CNF A;  3CCV B;  1NJI D;  2D3N A;  2WSS A;  3FJO A;  3SLD A;  1P4M A;  2HLD A;  1QX4 A;  3U2Q A;  1N07 A;  2E1R A;  4XQF A;  3AVW A;  2ZZF A;  2V4D A;  1GVH A;  1J9Z A;  5EMN A;  4PC3 A;  1EP1 B;  4BPR A;  1H42 A;  2GJR A;  2FVG A;  4HE6 A;  2ZL6 A;  1PJ7 A;  1CQX A;  1D8T A;  3BNW A;  3Q38 A;  4ASU A;  5HKK A;  1BX1 A;  4XNF A;  2OBT A;  3OP1 A;  1KK0 A;  1ELO A;  3ZIA A;  1Q82 D;  4G7W A;  4FN5 A;  3LQ6 A;  1TLL A;  2C5B A;  1E43 A;  4RD3 A;  3R6K A;  4MYT A;  1ZM9 A;  3SLN A;  1V5V A;  4XR6 A;  3CES A;  2X85 A;  4QV2 A;  3CCM B;  1MRZ A;  4X06 A;  1FRQ A;  5BSY A;  5TR9 A;  4XLE A;  4EH1 A;  4LBV A;  4DNT B;  4ZV4 A;  3Q6R A;  4XMY A;  3SJP A;  1VHE A;  2DCU A;  4XKV A;  1JB9 A;  4KKT A;  1N0V C;  1SKQ A;  1KJZ A;  1VQP B;  1S4M A;  3CCQ B;  4IW3 B;  1VQ8 B;  1G7T A;  3ZZT A;  4ROX A;  1QFZ A;  3AST A;  2CK3 A;  3VO1 A;  2CBX A;  3GVJ A;  2QTZ A;  4ZCI A;  3CCE B;  2Q6L A;  2E1B A;  2JJ2 A;  3LO8 A;  3I56 B;  3A8K A;  4XL9 A;  3AGP A;  3V7A A;  4QHY A;  4UZU A;  3W2F A;  4M1K A;  1VHO A;  1EWY A;  1VF7 A;  2ZTG A;  4C0S A;  3OE7 A;  1M1K D;  4HIZ A;  1KMH A;  4G7X A;  3SEJ A;  1W9X A;  1UD2 A;  1S72 B;  5THX A;  4XLH A;  3T53 B;  4Y9R A;  4B44 A;  1IB0 A;  1NRK A;  1H85 A;  3KL9 A;  4P9S A;  4TMZ A;  3WQZ A;  2B7B A;  2OTL B;  2R6H A;  4XON A;  4P6V F;  5H5J A;  2FX3 A;  4M0L A;  3G05 A;  3U6K A;  3PUM A;  2J7K A;  1VLY A;  1QH0 A;  2X6Y A;  2Z6B D;  2VBS A;  1YJW B;  3AVV A;  1Y0R A;  3A3B A;  3CD6 B;  1N08 A;  4X7C A;  1EP3 B;  3LQE A;  4YAO A;  3CCJ B;  4Q7J B;  1XFO A;  2BM0 A;  4FWT A;  4B4D A;  1VQN B;  2ZIT A;  2CW5 A;  3I1F A; 
#chains in the Genus database with same CATH homology
 4P3I A;  5BSX A;  5IYW A;  4X7E A;  3ASS A;  4Z4T A;  5F4J A;  4OPV A;  4Z4Y A;  5IYN A;  4OOV A;  4X07 A;  3ASP A;  2OBS A;  3PUN A;  5J3O A;  5J35 A;  4QUZ A;  4RDK A;  3PA1 A;  5F4O A;  4RDL A;  5HZB A;  4OPS A;  5IYR A;  4X0C A;  4OOS A;  3SLD A;  4Z4R A;  5KW9 A;  5F4M A;  5E6T A;  3ASQ A;  4Z4W A;  3ONY A;  2ZL6 A;  3Q38 A;  3Q3A A;  4Z4V A;  3RY8 A;  2OBT A;  4P2N A;  4OOX A;  3ONU A;  3LQ6 A;  4RM0 A;  3R6K A;  3SLN A;  3ASR A;  3BQJ A;  4QV2 A;  4X06 A;  4Z4Z A;  5BSY A;  4RLZ A;  3Q39 A;  3Q6R A;  3SJP A;  4RPB A;  3BY1 A;  2ZL5 A;  4X05 A;  3R6J A;  4OPO A;  4P25 A;  2OBR A;  3Q6Q A;  4OP7 A;  2ZL7 A;  4ROX A;  3AST A;  5IYQ A;  5IYP A;  3V7A A;  4X7D A;  3PA2 A;  3SEJ A;  3SKB A;  4QVJ A;  1IHM A;  4QVA A;  4WZL A;  4Z4S A;  5HZA A;  4WZK A;  4RPD A;  3PVD A;  4P12 A;  3PUM A;  4Z4U A;  4RDJ A;  4P26 A;  4X7C A;  3LQE A;  4WZT A;  4X7F A;  4WZE A;  3BY2 A;  3D26 A;  4P1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...