2ZL5A

Atomic resolution structural characterization of recognition of histo-blood group antigen by norwalk virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
289
structure length
289
Chain Sequence
b'FTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTIGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWVSRFYQLKPVGTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
molecule tags Viral protein
source organism Norwalk virus
publication title Atomic resolution structural characterization of recognition of histo-blood group antigens by Norwalk virus
pubmed doi rcsb
total genus 67
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 2zl5A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 2zl5A01
4P26A 4RDKA 4X7CA 3V7AA 4Z4TA 3R6JA 5F4MA 3ONUA 3ASRA 3LQ6A 5J35A 3LQEA 3SKBA 4P12A 5IYQA 4RDJA 4RM0A 3PVDA 4RPDA 2OBTA 4Z4VA 4ROXA 3RY8A 5IYNA 5BSYA 3SLNA 3Q38A 2ZL7A 4RDLA 4X7FA 5KW9A 3BY1A 3Q6QA 5J3OA 4X0CA 3BY2A 4OOVA 3ASQA 4OPSA 3R6KA 4X06A 3Q39A 3BQJA 5F4JA 4Z4SA 4OOSA 4P25A 4X05A 4OP7A 4QUZA 4WZTA 3PA2A 2ZL6A 4X07A 3SJPA 3ASSA 5HZAA 3PA1A 2OBSA 5IYPA 4P2NA 4QV2A 5HZBA 5F4OA 3ASTA 4WZKA 5IYWA 4Z4UA 3D26A 4P1VA 3PUNA 4Z4WA 4Z4ZA 4RPBA 4X7EA 3Q3AA 4QVAA 1IHMA 2OBRA 4OOXA 3PUMA 3SLDA 4Z4RA 3ASPA 4OPOA 3ONYA 2ZL5A 5E6TA 3SEJA 5BSXA 5IYRA 4QVJA 4RLZA 4OPVA 4Z4YA 4P3IA 3Q6RA 4WZEA 4X7DA 4WZLA
chains in the Genus database with same CATH superfamily
1EFTA 2RC5A 1S0UA 1OB2A 3ISXA 3CMEB 2NPFA 3CMMA 3CC2B 1U2RA 1FNDA 2EIXA 5JBQA 3V7AA 4Z4TA 2WJVA 1BLIA 1DDGA 3AVWA 5F4MA 3CCRB 2XNJA 4PGOA 3W2FA 1KC8D 3CPXA 3G71B 4R71A 4GQNA 2YWEA 4Y7CA 4F7DA 1T6XA 2QE7A 3SKBA 2NV4A 1KJZA 1ZUNB 1T5EA 1NDHA 1XQBA 1PJ6A 4B3XA 1IJFA 1OHHA 3CRZA 4RM0A 5TR9A 3T51B 3G6EB 3QSYA 4DQKA 1EP3B 4Z4VA 4RD4A 4TMXA 4ROXA 1R5NA 4ACBA 1N08A 2BN4A 1H42A 2XEXA 2D9RA 1F60A 4ZGQB 3OW2B 4NNJA 1QGZA 2P3MA 3W2HA 3BCFA 3OOCA 3CCLB 1EFCA 1GJRA 1NJID 4M0LA 4P6VF 2BMWA 4RDLA 1B23P 3JU4A 4XN3A 1FRNA 3H9NA 4TMVA 5TY0A 3OZVA 3CCSB 1VQLB 2OTLB 4X0CA 3A35A 4B48A 3H94A 3QFCA 3OJXA 5A89A 1PJ5A 4OOVA 3A8IA 1H8HA 1YX2A 3Q39A 2HCJB 3BQJA 1FNMA 3G4SB 4XKWA 3E20A 2XZLA 5F4JA 2YWGA 1UD3A 3MMPA 5FO1A 1S4MA 4M53A 4B3GA 1VQMB 2ZL6A 1VQ8B 2CK3A 1SM4A 1D1NA 3NE5B 3ASSA 5HZAA 1WOPA 1E63A 3CC4B 2OK7A 1E43A 1YI2B 1WTHD 4PC1A 1QUEA 2I1LA 4QFMA 5GV7A 3AGQA 1QGYA 1EP2B 1ZM3A 3CTAA 5L46A 3AVXA 4XM3A 4II3A 3ZZ0A 1PJ7A 5H59A 1QX4A 3D26A 3PUNA 1NB0A 1KK0A 4U9UA 2Q6OA 2VNIA 4Z1MA 2GK6A 4C43A 1YHQB 1Y0YA 1SKQA 3WY9A 2X8KA 4NCNA 5FO0A 5FNZA 1BX1A 1W9XA 2V31A 4QVAA 1M1KD 2QMUA 4P22A 1CQXA 1WU8A 1R5BA 3ZBTA 3A3BA 4UZFA 4XONA 4G5GA 2F1MA 1HZEA 4XNFA 2HMAA 2R9VA 2BVNA 1V5VA 3JQQA 2B5OA 3ONYA 2CBXA 2V7XA 4LBVA 1N0VC 3GSIA 3W2GA 1E3ZA 3SEJA 4TMWA 2ZZFA 3OZUA 2ZXHA 3OEEA 2LZJA 2BSAA 1Q86D 4P3YA 1OB0A 5KSWB 4XLCA 3WNDA 3W2IA 4B4DA 4HIZA 3A3GA 1J9ZA 3MCAA 4UAJA 3CCUB 4WQMA 2X6WA 2XNCA 2JJ1A 3ONUA 3QFRA 3ASRA 2D74A 1VLYA 1N8RD 4AVZA 4ASUA 3P26A 4RCZA 4TSFA 1B2RA 3I56B 4RDJA 2VNJA 3CESA 1E62A 2GJPA 3PVDA 3W5UA 4DK0A 2OBTA 4KKSA 1MRZA 5FIUA 4II2A 5IYNA 3QFSA 1Q7YD 1DDIA 1JA1A 3SLNA 4YAUA 4NBSA 4DQLA 2W6JA 2VJJA 4B47A 4CQJA 2KVOA 2VNHA 2VBTA 1R5OA 3VNUA 2XZPA 4X7FA 5KW9A 4DK1A 4B44A 3FPPA 1K73D 1TVCA 3Q6QA 4X8IA 1MABA 4TT3A 1FX0A 1HVXA 4YAFA 1IB0A 2BGIA 1I7PA 3GVJA 3ASQA 4N3GA 4X06A 4G1BA 1VQ4B 1W87A 4AC9A 2WYRA 3GIRA 2C78A 4TN1A 2V7QA 3OJWA 3AVYA 4G1VA 4P25A 4TMTA 1OGIA 2HLDA 3VNVA 4X05A 1E1QA 1TLLA 2C4TA 5CDFA 1CNFA 5B6IA 1K9MD 1AMOA 4XQFA 3PA1A 1EFUA 2ZXIA 3FKSA 4K1XA 1QH0A 2E1BA 4P2NA 4ZV4A 1W34A 4QV2A 4HE6A 1UD2A 3CW2A 4PC2A 3WQZA 3T56B 2CF4A 1P4MA 1VQPB 2PIAA 4M1KA 3CD6B 3WXMA 5TV2A 2D3LA 1RQPA 1UD5A 2WZNA 1EFRA 4FK8A 3I1FA 2JIZA 3ZZUA 3E1YE 2CW5A 3CP2A 4J0QA 1VQ9B 2YWFA 2GREA 1QUFA 4G6IA 2ZZGA 2ZZEA 3I55B 4MYUA 1E3XA 2QN6A 4XOTA 2GJRA 2F4NA 1W0JA 1WSRA 4BPRA 1ZM4A 1BQEA 1QVGB 4XMYA 4RCYA 1YJNB 2PE3A 5A8AA 1KQSB 4YALA 2RC6A 2VBSA 1G7TA 1ZM9A 2ZITA 1KRHA 2PLFA 3A8JA 3BCDA 4E0FA 1Q9SA 4QVJA 1Y0RA 2BM0A 2JN9A 1H85A 3QE2A 4P3IA 4B43A 3Q6RA 5LMZA 3B78A 3V76A 2VBVA 1F20A 1V0EA 1OB5A 2DERA 1D2EA 1FDRA 5EMNA 4P26A 1VHOA 4RDKA 3B82A 4X7CA 3OZWA 4YAOA 1JJ2B 3BH4A 2F1LA 4LBZA 4M4SA 3GVLA 1E79A 4C0SA 1G7SA 3W5HA 3GQBA 1KMHA 3CCMB 1YITB 3LQ6A 5J35A 1WOSA 3LQEA 3QFTA 1T6YA 4P12A 2V4DA 2EFGA 3CCEB 4RD0A 4G7XA 4RD1A 4RPDA 5H5JA 3WBJA 2DIEA 3OPOA 1VQ6B 2B7CA 5BSYA 2Z6BD 1N06A 2HDNB 2V7WA 2GK7A 2B7BA 1QFYA 1TUIA 2ZL7A 3U6BA 1KD1D 2BM1A 1D8TA 3JQPA 1WP6A 2QDXA 1GVHA 1VLOA 3BC9A 3BY1A 1NRKA 1GR1A 4Q7JB 5J3OA 2WSSA 1RQRA 5KNLA 3CCVB 1VF7A 3ES9A 3PENA 2V7TA 2X6XA 4PC7A 4UZUA 2E1RA 4KKTA 1XE1A 4DNTB 4XN0A 3U2QA 4ACAA 4FXUA 1QFZA 2X53S 4XL9A 2QEXB 2Q6LA 1BMFA 4OPSA 4XLAA 3R6KA 1YJWB 3WNBA 2XZOA 2XGJA 3CB4A 5DSZA 3KL9A 4RD2A 4P6YA 4Z4SA 1KZLA 1WPCA 2D3NA 3AVUA 3MHPA 4OP7A 4QUZA 4WZTA 2GJKA 3PA2A 2BGJA 4X07A 3SJPA 4RD3A 3OEHA 4EH1A 1EP1B 1VQ7B 2GQFA 2JDIA 1K28D 5IYPA 4ZCLA 4N3NA 5THXA 4M2LA 3P27A 5F4OA 4WZKA 1Q81D 4FN5A 4Z4UA 1E64A 2VZLA 5IK2A 2C2WA 4XLFA 1IJEA 1XFOA 3HAGA 4Z4WA 4KKUA 1T6ZA 2F43A 3LVBA 1VQNB 3U6KA 1BX0A 3Q3AA 2QTLA 4PC6A 5A88A 1WSVA 2BF4A 4RD6A 1UMKA 2BPOA 3FJOA 4XORA 4XKVA 4RJLA 1IHMA 1NBMA 4OOXA 1A8PA 4ZGNB 1DARA 2XNDA 3LO8A 2WZPP 2X0KA 5GV8A 3OP1A 2W6IA 3AGPA 2JJ2A 1YJ9B 2ZL5A 2CRVA 1OGJA 2VBUA 2ZTGA 5BSXA 2CC2A 5IYRA 1VQ5B 1VQKB 5HXBA 1UD8A 1VHEA 2X3UA 2C77A 4LC0A 4WWVA 3DDYA 4WZEA 3CC7B 3T53B 3ZPNA 2GPJA 3CMAB 3OW7A 4X7DA 2DEUA 1N07A 2ZBUA 1DG1G 2BV3A 2WPDA 1ELOA 3CPWB 3WBKA 4L8JA 4DNRB 3WNCA 2C4UA 3FPKA 1NB9A 2OK8A 3BNWA 5DS0A 1FRQA 1SKYB 2X85A 2VJIA 1EWYA 1COWA 3R6JA 1WDTA 2M5SA 4PC3A 4P9SA 3ZBUA 2VNKA 2C5BA 4YXWA 3VO1A 1W2BB 3G05A 4YELA 4HE5A 5IYQA 4XR6A 5FA6A 4TMZA 4LBYA 4AF7A 1BJKA 2C5HA 2FVGA 1W0KA 3RY8A 1YLOA 3A8KA 1EXMA 3B8HA 3CP8A 3GVKA 4H9GA 3SJZA 3AVTA 4MYTA 3W5VA 3JQRA 3OKXA 3Q38A 3A1PA 1N0UA 4AF6A 1FNBA 3OAAA 4ZCMA 1I8DA 4YEJA 1H8EA 2AHOA 2DETA 4XD7A 1M90D 4XOPA 1QG0A 2FX3A 1QGAA 2ZTNA 4IW3B 3W2EA 1S72B 1UD4A 1KK2A 3BY2A 4Y9RA 5HKKA 5AN9A 1QFJA 2Q6KA 3CCJB 2XOKA 4XLEA 1CNEA 1I18A 2V7UA 1KK3A 4OOSA 1G7CA 1WOOA 1VQOB 4JMQA 1JB9A 5TRDA 1ZM2A 4ZCIA 2QGGA 3KEWA 2PMDA 3AVVA 2OBSA 5HZBA 2ZZQA 2QA4B 1G7RA 3VO2A 2YWHA 3VMFA 3ZZTA 1PKVA 1N05A 4TKOB 2DYIA 3ASTA 1Q82D 1E1RA 4LBWA 5IYWA 4G7WA 5FL7A 2R6HA 4P1VA 3OE7A 3ZIAA 2VYQA 1FNCA 4Z4ZA 1GAWA 4RPBA 1VJSA 1W35A 2OYNA 3CCQB 4FWTA 2DCUA 2WJYA 4X7EA 2OTJB 1TTTA 1XB2A 1UD6A 2QTZA 2V7VA 1HA3A 4QHYA 1BPLA 2OBRA 2Q6IA 5DN6A 1GO2A 1WORA 1YIJB 2DOGA 3PUMA 3SLDA 4Z4RA 3ASPA 1GAQA 4OPOA 4YAWA 4YHBA 1JNYA 3CXCB 3OFNA 2WR8A 1AIPA 2ZBVA 3J81k 4B3FX 3WYAA 4UZEA 1K8AD 1KK1A 4PAAA 5E6TA 1QVFB 3ZUGA 4XLHA 3LNNA 4RLZA 4OPVA 2DY1A 4Z4YA 1JA0A 3VR6A 2CNDA 1KTVA 4PABA 2J7KA 3ZC3A 4Y9UA 2X6YA 4WZLA 1V0FA
chains in the Genus database with same CATH topology
4P26A 4RDKA 4X7CA 3V7AA 4Z4TA 3R6JA 5F4MA 3ONUA 3ASRA 3LQ6A 5J35A 3LQEA 3SKBA 4P12A 5IYQA 4RDJA 4RM0A 3PVDA 4RPDA 2OBTA 4Z4VA 4ROXA 3RY8A 5IYNA 5BSYA 3SLNA 3Q38A 2ZL7A 4RDLA 4X7FA 5KW9A 3BY1A 3Q6QA 5J3OA 4X0CA 3BY2A 4OOVA 3ASQA 4OPSA 3R6KA 4X06A 3Q39A 3BQJA 5F4JA 4Z4SA 4OOSA 4P25A 4X05A 4OP7A 4QUZA 4WZTA 3PA2A 2ZL6A 4X07A 3SJPA 3ASSA 5HZAA 3PA1A 2OBSA 5IYPA 4P2NA 4QV2A 5HZBA 5F4OA 3ASTA 4WZKA 5IYWA 4Z4UA 3D26A 4P1VA 3PUNA 4Z4WA 4Z4ZA 4RPBA 4X7EA 3Q3AA 4QVAA 1IHMA 2OBRA 4OOXA 3PUMA 3SLDA 4Z4RA 3ASPA 4OPOA 3ONYA 2ZL5A 5E6TA 3SEJA 5BSXA 5IYRA 4QVJA 4RLZA 4OPVA 4Z4YA 4P3IA 3Q6RA 4WZEA 4X7DA 4WZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P26 A;  4RDK A;  4X7C A;  3V7A A;  4Z4T A;  3R6J A;  5F4M A;  3ONU A;  3ASR A;  3LQ6 A;  5J35 A;  3LQE A;  3SKB A;  4P12 A;  5IYQ A;  4RDJ A;  4RM0 A;  3PVD A;  4RPD A;  2OBT A;  4Z4V A;  4ROX A;  3RY8 A;  5IYN A;  5BSY A;  3SLN A;  3Q38 A;  2ZL7 A;  4RDL A;  4X7F A;  5KW9 A;  3BY1 A;  3Q6Q A;  5J3O A;  4X0C A;  3BY2 A;  4OOV A;  3ASQ A;  4OPS A;  3R6K A;  4X06 A;  3Q39 A;  3BQJ A;  5F4J A;  4Z4S A;  4OOS A;  4P25 A;  4X05 A;  4OP7 A;  4QUZ A;  4WZT A;  3PA2 A;  2ZL6 A;  4X07 A;  3SJP A;  3ASS A;  5HZA A;  3PA1 A;  2OBS A;  5IYP A;  4P2N A;  4QV2 A;  5HZB A;  5F4O A;  3AST A;  4WZK A;  5IYW A;  4Z4U A;  3D26 A;  4P1V A;  3PUN A;  4Z4W A;  4Z4Z A;  4RPB A;  4X7E A;  3Q3A A;  4QVA A;  1IHM A;  2OBR A;  4OOX A;  3PUM A;  3SLD A;  4Z4R A;  3ASP A;  4OPO A;  3ONY A;  2ZL5 A;  5E6T A;  3SEJ A;  5BSX A;  5IYR A;  4QVJ A;  4RLZ A;  4OPV A;  4Z4Y A;  4P3I A;  3Q6R A;  4WZE A;  4X7D A;  4WZL A; 
#chains in the Genus database with same CATH topology
 1EFT A;  2RC5 A;  1S0U A;  1OB2 A;  3ISX A;  3CME B;  2NPF A;  3CMM A;  3CC2 B;  1U2R A;  1FND A;  2EIX A;  5JBQ A;  3V7A A;  4Z4T A;  2WJV A;  1BLI A;  1DDG A;  3AVW A;  5F4M A;  3CCR B;  2XNJ A;  4PGO A;  3W2F A;  1KC8 D;  3CPX A;  3G71 B;  4R71 A;  4GQN A;  2YWE A;  4Y7C A;  4F7D A;  1T6X A;  2QE7 A;  3SKB A;  2NV4 A;  1KJZ A;  1ZUN B;  1T5E A;  1NDH A;  1XQB A;  1PJ6 A;  4B3X A;  1IJF A;  1OHH A;  3CRZ A;  4RM0 A;  5TR9 A;  3T51 B;  3G6E B;  3QSY A;  4DQK A;  1EP3 B;  4Z4V A;  4RD4 A;  4TMX A;  4ROX A;  1R5N A;  4ACB A;  1N08 A;  2BN4 A;  1H42 A;  2XEX A;  2D9R A;  1F60 A;  4ZGQ B;  3OW2 B;  4NNJ A;  1QGZ A;  2P3M A;  3W2H A;  3BCF A;  3OOC A;  3CCL B;  1EFC A;  1GJR A;  1NJI D;  4M0L A;  4P6V F;  2BMW A;  4RDL A;  1B23 P;  3JU4 A;  4XN3 A;  1FRN A;  3H9N A;  4TMV A;  5TY0 A;  3OZV A;  3CCS B;  1VQL B;  2OTL B;  4X0C A;  3A35 A;  4B48 A;  3H94 A;  3QFC A;  3OJX A;  5A89 A;  1PJ5 A;  4OOV A;  3A8I A;  1H8H A;  1YX2 A;  3Q39 A;  2HCJ B;  3BQJ A;  1FNM A;  3G4S B;  4XKW A;  3E20 A;  2XZL A;  5F4J A;  2YWG A;  1UD3 A;  3MMP A;  5FO1 A;  1S4M A;  4M53 A;  4B3G A;  1VQM B;  2ZL6 A;  1VQ8 B;  2CK3 A;  1SM4 A;  1D1N A;  3NE5 B;  3ASS A;  5HZA A;  1WOP A;  1E63 A;  3CC4 B;  2OK7 A;  1E43 A;  1YI2 B;  1WTH D;  4PC1 A;  1QUE A;  2I1L A;  4QFM A;  5GV7 A;  3AGQ A;  1QGY A;  1EP2 B;  1ZM3 A;  3CTA A;  5L46 A;  3AVX A;  4XM3 A;  4II3 A;  3ZZ0 A;  1PJ7 A;  5H59 A;  1QX4 A;  3D26 A;  3PUN A;  1NB0 A;  1KK0 A;  4U9U A;  2Q6O A;  2VNI A;  4Z1M A;  2GK6 A;  4C43 A;  1YHQ B;  1Y0Y A;  1SKQ A;  3WY9 A;  2X8K A;  4NCN A;  5FO0 A;  5FNZ A;  1BX1 A;  1W9X A;  2V31 A;  4QVA A;  1M1K D;  2QMU A;  4P22 A;  1CQX A;  1WU8 A;  1R5B A;  3ZBT A;  3A3B A;  4UZF A;  4XON A;  4G5G A;  2F1M A;  1HZE A;  4XNF A;  2HMA A;  2R9V A;  2BVN A;  1V5V A;  3JQQ A;  2B5O A;  3ONY A;  2CBX A;  2V7X A;  4LBV A;  1N0V C;  3GSI A;  3W2G A;  1E3Z A;  3SEJ A;  4TMW A;  2ZZF A;  3OZU A;  2ZXH A;  3OEE A;  2LZJ A;  2BSA A;  1Q86 D;  4P3Y A;  1OB0 A;  5KSW B;  4XLC A;  3WND A;  3W2I A;  4B4D A;  4HIZ A;  3A3G A;  1J9Z A;  3MCA A;  4UAJ A;  3CCU B;  4WQM A;  2X6W A;  2XNC A;  2JJ1 A;  3ONU A;  3QFR A;  3ASR A;  2D74 A;  1VLY A;  1N8R D;  4AVZ A;  4ASU A;  3P26 A;  4RCZ A;  4TSF A;  1B2R A;  3I56 B;  4RDJ A;  2VNJ A;  3CES A;  1E62 A;  2GJP A;  3PVD A;  3W5U A;  4DK0 A;  2OBT A;  4KKS A;  1MRZ A;  5FIU A;  4II2 A;  5IYN A;  3QFS A;  1Q7Y D;  1DDI A;  1JA1 A;  3SLN A;  4YAU A;  4NBS A;  4DQL A;  2W6J A;  2VJJ A;  4B47 A;  4CQJ A;  2KVO A;  2VNH A;  2VBT A;  1R5O A;  3VNU A;  2XZP A;  4X7F A;  5KW9 A;  4DK1 A;  4B44 A;  3FPP A;  1K73 D;  1TVC A;  3Q6Q A;  4X8I A;  1MAB A;  4TT3 A;  1FX0 A;  1HVX A;  4YAF A;  1IB0 A;  2BGI A;  1I7P A;  3GVJ A;  3ASQ A;  4N3G A;  4X06 A;  4G1B A;  1VQ4 B;  1W87 A;  4AC9 A;  2WYR A;  3GIR A;  2C78 A;  4TN1 A;  2V7Q A;  3OJW A;  3AVY A;  4G1V A;  4P25 A;  4TMT A;  1OGI A;  2HLD A;  3VNV A;  4X05 A;  1E1Q A;  1TLL A;  2C4T A;  5CDF A;  1CNF A;  5B6I A;  1K9M D;  1AMO A;  4XQF A;  3PA1 A;  1EFU A;  2ZXI A;  3FKS A;  4K1X A;  1QH0 A;  2E1B A;  4P2N A;  4ZV4 A;  1W34 A;  4QV2 A;  4HE6 A;  1UD2 A;  3CW2 A;  4PC2 A;  3WQZ A;  3T56 B;  2CF4 A;  1P4M A;  1VQP B;  2PIA A;  4M1K A;  3CD6 B;  3WXM A;  5TV2 A;  2D3L A;  1RQP A;  1UD5 A;  2WZN A;  1EFR A;  4FK8 A;  3I1F A;  2JIZ A;  3ZZU A;  3E1Y E;  2CW5 A;  3CP2 A;  4J0Q A;  1VQ9 B;  2YWF A;  2GRE A;  1QUF A;  4G6I A;  2ZZG A;  2ZZE A;  3I55 B;  4MYU A;  1E3X A;  2QN6 A;  4XOT A;  2GJR A;  2F4N A;  1W0J A;  1WSR A;  4BPR A;  1ZM4 A;  1BQE A;  1QVG B;  4XMY A;  4RCY A;  1YJN B;  2PE3 A;  5A8A A;  1KQS B;  4YAL A;  2RC6 A;  2VBS A;  1G7T A;  1ZM9 A;  2ZIT A;  1KRH A;  2PLF A;  3A8J A;  3BCD A;  4E0F A;  1Q9S A;  4QVJ A;  1Y0R A;  2BM0 A;  2JN9 A;  1H85 A;  3QE2 A;  4P3I A;  4B43 A;  3Q6R A;  5LMZ A;  3B78 A;  3V76 A;  2VBV A;  1F20 A;  1V0E A;  1OB5 A;  2DER A;  1D2E A;  1FDR A;  5EMN A;  4P26 A;  1VHO A;  4RDK A;  3B82 A;  4X7C A;  3OZW A;  4YAO A;  1JJ2 B;  3BH4 A;  2F1L A;  4LBZ A;  4M4S A;  3GVL A;  1E79 A;  4C0S A;  1G7S A;  3W5H A;  3GQB A;  1KMH A;  3CCM B;  1YIT B;  3LQ6 A;  5J35 A;  1WOS A;  3LQE A;  3QFT A;  1T6Y A;  4P12 A;  2V4D A;  2EFG A;  3CCE B;  4RD0 A;  4G7X A;  4RD1 A;  4RPD A;  5H5J A;  3WBJ A;  2DIE A;  3OPO A;  1VQ6 B;  2B7C A;  5BSY A;  2Z6B D;  1N06 A;  2HDN B;  2V7W A;  2GK7 A;  2B7B A;  1QFY A;  1TUI A;  2ZL7 A;  3U6B A;  1KD1 D;  2BM1 A;  1D8T A;  3JQP A;  1WP6 A;  2QDX A;  1GVH A;  1VLO A;  3BC9 A;  3BY1 A;  1NRK A;  1GR1 A;  4Q7J B;  5J3O A;  2WSS A;  1RQR A;  5KNL A;  3CCV B;  1VF7 A;  3ES9 A;  3PEN A;  2V7T A;  2X6X A;  4PC7 A;  4UZU A;  2E1R A;  4KKT A;  1XE1 A;  4DNT B;  4XN0 A;  3U2Q A;  4ACA A;  4FXU A;  1QFZ A;  2X53 S;  4XL9 A;  2QEX B;  2Q6L A;  1BMF A;  4OPS A;  4XLA A;  3R6K A;  1YJW B;  3WNB A;  2XZO A;  2XGJ A;  3CB4 A;  5DSZ A;  3KL9 A;  4RD2 A;  4P6Y A;  4Z4S A;  1KZL A;  1WPC A;  2D3N A;  3AVU A;  3MHP A;  4OP7 A;  4QUZ A;  4WZT A;  2GJK A;  3PA2 A;  2BGJ A;  4X07 A;  3SJP A;  4RD3 A;  3OEH A;  4EH1 A;  1EP1 B;  1VQ7 B;  2GQF A;  2JDI A;  1K28 D;  5IYP A;  4ZCL A;  4N3N A;  5THX A;  4M2L A;  3P27 A;  5F4O A;  4WZK A;  1Q81 D;  4FN5 A;  4Z4U A;  1E64 A;  2VZL A;  5IK2 A;  2C2W A;  4XLF A;  1IJE A;  1XFO A;  3HAG A;  4Z4W A;  4KKU A;  1T6Z A;  2F43 A;  3LVB A;  1VQN B;  3U6K A;  1BX0 A;  3Q3A A;  2QTL A;  4PC6 A;  5A88 A;  1WSV A;  2BF4 A;  4RD6 A;  1UMK A;  2BPO A;  3FJO A;  4XOR A;  4XKV A;  4RJL A;  1IHM A;  1NBM A;  4OOX A;  1A8P A;  4ZGN B;  1DAR A;  2XND A;  3LO8 A;  2WZP P;  2X0K A;  5GV8 A;  3OP1 A;  2W6I A;  3AGP A;  2JJ2 A;  1YJ9 B;  2ZL5 A;  2CRV A;  1OGJ A;  2VBU A;  2ZTG A;  5BSX A;  2CC2 A;  5IYR A;  1VQ5 B;  1VQK B;  5HXB A;  1UD8 A;  1VHE A;  2X3U A;  2C77 A;  4LC0 A;  4WWV A;  3DDY A;  4WZE A;  3CC7 B;  3T53 B;  3ZPN A;  2GPJ A;  3CMA B;  3OW7 A;  4X7D A;  2DEU A;  1N07 A;  2ZBU A;  1DG1 G;  2BV3 A;  2WPD A;  1ELO A;  3CPW B;  3WBK A;  4L8J A;  4DNR B;  3WNC A;  2C4U A;  3FPK A;  1NB9 A;  2OK8 A;  3BNW A;  5DS0 A;  1FRQ A;  1SKY B;  2X85 A;  2VJI A;  1EWY A;  1COW A;  3R6J A;  1WDT A;  2M5S A;  4PC3 A;  4P9S A;  3ZBU A;  2VNK A;  2C5B A;  4YXW A;  3VO1 A;  1W2B B;  3G05 A;  4YEL A;  4HE5 A;  5IYQ A;  4XR6 A;  5FA6 A;  4TMZ A;  4LBY A;  4AF7 A;  1BJK A;  2C5H A;  2FVG A;  1W0K A;  3RY8 A;  1YLO A;  3A8K A;  1EXM A;  3B8H A;  3CP8 A;  3GVK A;  4H9G A;  3SJZ A;  3AVT A;  4MYT A;  3W5V A;  3JQR A;  3OKX A;  3Q38 A;  3A1P A;  1N0U A;  4AF6 A;  1FNB A;  3OAA A;  4ZCM A;  1I8D A;  4YEJ A;  1H8E A;  2AHO A;  2DET A;  4XD7 A;  1M90 D;  4XOP A;  1QG0 A;  2FX3 A;  1QGA A;  2ZTN A;  4IW3 B;  3W2E A;  1S72 B;  1UD4 A;  1KK2 A;  3BY2 A;  4Y9R A;  5HKK A;  5AN9 A;  1QFJ A;  2Q6K A;  3CCJ B;  2XOK A;  4XLE A;  1CNE A;  1I18 A;  2V7U A;  1KK3 A;  4OOS A;  1G7C A;  1WOO A;  1VQO B;  4JMQ A;  1JB9 A;  5TRD A;  1ZM2 A;  4ZCI A;  2QGG A;  3KEW A;  2PMD A;  3AVV A;  2OBS A;  5HZB A;  2ZZQ A;  2QA4 B;  1G7R A;  3VO2 A;  2YWH A;  3VMF A;  3ZZT A;  1PKV A;  1N05 A;  4TKO B;  2DYI A;  3AST A;  1Q82 D;  1E1R A;  4LBW A;  5IYW A;  4G7W A;  5FL7 A;  2R6H A;  4P1V A;  3OE7 A;  3ZIA A;  2VYQ A;  1FNC A;  4Z4Z A;  1GAW A;  4RPB A;  1VJS A;  1W35 A;  2OYN A;  3CCQ B;  4FWT A;  2DCU A;  2WJY A;  4X7E A;  2OTJ B;  1TTT A;  1XB2 A;  1UD6 A;  2QTZ A;  2V7V A;  1HA3 A;  4QHY A;  1BPL A;  2OBR A;  2Q6I A;  5DN6 A;  1GO2 A;  1WOR A;  1YIJ B;  2DOG A;  3PUM A;  3SLD A;  4Z4R A;  3ASP A;  1GAQ A;  4OPO A;  4YAW A;  4YHB A;  1JNY A;  3CXC B;  3OFN A;  2WR8 A;  1AIP A;  2ZBV A;  3J81 k;  4B3F X;  3WYA A;  4UZE A;  1K8A D;  1KK1 A;  4PAA A;  5E6T A;  1QVF B;  3ZUG A;  4XLH A;  3LNN A;  4RLZ A;  4OPV A;  2DY1 A;  4Z4Y A;  1JA0 A;  3VR6 A;  2CND A;  1KTV A;  4PAB A;  2J7K A;  3ZC3 A;  4Y9U A;  2X6Y A;  4WZL A;  1V0F A; 
#chains in the Genus database with same CATH homology
 4P26 A;  4RDK A;  4X7C A;  3V7A A;  4Z4T A;  3R6J A;  5F4M A;  3ONU A;  3ASR A;  3LQ6 A;  5J35 A;  3LQE A;  3SKB A;  4P12 A;  5IYQ A;  4RDJ A;  4RM0 A;  3PVD A;  4RPD A;  2OBT A;  4Z4V A;  4ROX A;  3RY8 A;  5IYN A;  5BSY A;  3SLN A;  3Q38 A;  2ZL7 A;  4RDL A;  4X7F A;  5KW9 A;  3BY1 A;  3Q6Q A;  5J3O A;  4X0C A;  3BY2 A;  4OOV A;  3ASQ A;  4OPS A;  3R6K A;  4X06 A;  3Q39 A;  3BQJ A;  5F4J A;  4Z4S A;  4OOS A;  4P25 A;  4X05 A;  4OP7 A;  4QUZ A;  4WZT A;  3PA2 A;  2ZL6 A;  4X07 A;  3SJP A;  3ASS A;  5HZA A;  3PA1 A;  2OBS A;  5IYP A;  4P2N A;  4QV2 A;  5HZB A;  5F4O A;  3AST A;  4WZK A;  5IYW A;  4Z4U A;  3D26 A;  4P1V A;  3PUN A;  4Z4W A;  4Z4Z A;  4RPB A;  4X7E A;  3Q3A A;  4QVA A;  1IHM A;  2OBR A;  4OOX A;  3PUM A;  3SLD A;  4Z4R A;  3ASP A;  4OPO A;  3ONY A;  2ZL5 A;  5E6T A;  3SEJ A;  5BSX A;  5IYR A;  4QVJ A;  4RLZ A;  4OPV A;  4Z4Y A;  4P3I A;  3Q6R A;  4WZE A;  4X7D A;  4WZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...