3A1PA

Structure of ribosome maturation protein rimm and ribosomal protein s19
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
b'RLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome maturation factor rimM
molecule tags Ribosomal protein
source organism Thermus thermophilus
publication title Structure of Ribosome maturation protein RimM and Ribosomal protein S19
rcsb
total genus 30
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3a1pA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3a1pA01
2F1LA 3H9NA 2DYIA 2DOGA 3A1PA 1PM3A 3HTRA 2QGGA
chains in the Genus database with same CATH superfamily
3H94A 4B3FX 3UPUA 1TH7A 5IYQA 2HZYA 3L1AA 2DIGA 2GGRA 3EGDB 1TSFA 4XU0A 4BE0A 3A1PA 4Z4ZA 1X75C 1WSRA 1BMFA 2BN4A 3JB9D 1OX9A 1OQKA 2OTLA 2ZZQA 5A8AA 4KUIA 3V8JA 4RCYA 3ASPA 1W35A 2EIXA 4N3GA 4QKUA 3LWHA 3OSSC 2QQAA 5CQXA 1KD1U 3E9FA 2F1MA 2K79A 1PRMC 3EG1A 2DVJA 4TN1A 4J9HA 1ZSZB 5F4OA 4FK8A 1NRKA 3O8VA 1KQ2A 1CNFA 4IURA 4FSXA 4M78F 1QVFB 2NYSA 2V8IA 3OYDA 1WHJA 2COWA 4DEYA 2QA4Q 4EH1A 3VYHB 3QXEB 3CC4A 1QVFS 2YRCA 2PIAA 1JJ2P 2A36A 3GP8A 2MIOA 1GCQC 2K2MA 2VJIA 4X9CA 2JN9A 1QH0A 3NTIA 4JZ4A 1IB0A 2B86A 3VO2A 2HQHA 1G7SA 1KHCA 2OTJQ 4BI8B 4JS5A 1MNDA 2VB6A 2DL7A 2KMTA 1UGRB 4E47A 1HYOA 1PRLC 1IO6A 3ASRA 3Q3AA 3SHWA 4P9SA 4PL6A 2XNCA 3SWNC 1AWXA 3M59A 3VS3A 1WDXA 1Q7YR 2E1BA 3EFOB 4OGCA 4WWVA 2EFIA 3G05A 2QTLA 4HKEA 3CCMT 1V29B 3VS4A 5AYFA 4XQ3A 1EFRA 3X25B 2Q6KA 1Q82D 3AVTA 4C0GA 3VJPA 1NG2A 1QMCA 3ZZ0A 3OBYA 3CCSB 1N05A 3CC4B 4C8QG 1E7OA 4BD3A 1YJWA 2YHTA 1NLOC 1YP5A 2JW4A 2DF6A 1GAQA 2K5FA 5KYWA 1FWZA 4HCKA 1ZM4A 2QEXB 3BDLA 4P6YA 4WZEA 4OMNA 1YHQQ 2CDTA 5FNZA 2FO0A 1VLYA 3NTHA 1BK2A 5LJ3f 2VXFA 5CO7A 1QCNA 5EC7A 2VKNA 3B78A 2F43A 1K8AU 1X43A 4XLCA 4ZGJB 5IHKA 2WR8A 4XU1A 2ED1A 2LJ3A 3V8LA 4M7DB 4J8OA 2V7TA 5AN9A 3ZBUA 2JJ9A 7AT1B 4II3A 3CMEB 4RCCA 1UHFA 4EMHA 3LX7A 3CCUT 3CC7B 2J6FA 3MEWA 4E7ZA 2A0FB 5KCHA 1E1QA 3CPWP 1NPPA 4MZTA 4NL3A 4M78G 4PJOA 1Q81U 3R6KA 3M58A 4ZGQB 1T3SA 1U8RA 2ZL6A 3I55Q 1YITT 1VQ6T 2ZZGA 3BNWA 5FIUA 4Z4RA 1SRLA 2RO0A 1D0XA 1UE9A 4A4FA 4JJBA 1J9ZA 3JB9H 1TTHB 1OGIA 1FRQA 2EQJA 3LVBA 2M02A 2QTVA 3NGPA 2X3XD 2F4NA 2G6FX 1SKQA 3G71A 4X05A 5GAMh 5FA6A 4TKOB 1I1JA 1MABA 4KGVB 4C92G 4DOWA 1XQBA 4EMGA 1E3XA 1GVHA 2V26A 2QDXA 4K11A 1NLPC 4M7DE 3KL9A 4G7XA 2XDDA 1PHTA 3W2HA 1KG1A 1AWWA 5GJWB 4HIZA 4M7DG 4K1XA 1T5EA 5IK2A 2J06A 1Y7XA 1SF9A 4KRTA 1PKTA 3ZIAA 2EJGA 3PENA 3UDCA 3PVLA 1C1AA 2GJKA 3V76A 4OPSA 1IREB 2DZCA 2ZBUA 2LQWA 2A08A 1W1FA 1W0JA 3KFVA 1WQWA 3L2ZA 2VBVA 2WACA 3INZA 1KQSB 4J9DA 5GAOm 3JQPA 5D6YA 1S72Q 5LJ3e 2VUBA 3JCMX 3QBYA 5KYNA 1U5SA 4PJJA 3LNNA 3QE2A 3I9QA 1UGSB 2E6NA 2EBPA 2A3LA 3CCLQ 4N3NA 3JRZA 4IUQA 3T53B 3ZBTA 3CCQB 2VNKA 1VQ8Q 2KAFA 3I56A 3SLDA 4JUVA 4AFUC 3GBQA 4AFQC 1HSQA 1YI2B 2LVMA 2A7YA 1T6ZA 5IYPA 1ZUYA 1RI9A 4C8QB 2K57A 4TSFA 4M7AB 1V0EA 3N5BB 3R6NA 4BDYA 3MP1A 1VQPA 2CP0A 1WOSA 3EGDA 1W9XA 4Z02A 2KR3A 5THXA 4XU2A 3FC3A 3FB9A 1EZZB 2W10A 3BH4A 2ZZDA 3P26A 1BKBA 2CUBA 1KK0A 2DY1A 3OJXA 3VKIA 3U6BA 3HFNA 2Y4YA 2YWFA 2NUZA 2KYBA 3FDRA 3W5UA 4QUZA 2KRNA 3JCMQ 2G3RA 1N0VC 1GCPA 3R6JA 3CCLT 1UHCA 2XOKA 2CGHA 1NYGA 1JO8A 3GOXA 2O9SA 4WZTA 4B48A 5IT9E 4LUDA 2DM1A 1HXDA 1MMNA 2X0KA 1WTHD 2YXYA 5LJ5h 3JCMb 1YJ9B 2OK8A 1R8OB 3CMAB 4PJNA 2VZLA 1GR1A 4KT0E 4M78B 4OGEA 4MYTA 3VS5A 3KBGA 1VQ5T 2DZ9A 1VQ5Q 2BV3A 1BI0A 1VQ7T 5F4JA 3HRTA 1EP2B 1QUFA 1VQKB 4XMYA 3LH0A 2E41A 3VNUA 4AF6A 4GLMA 1BPLA 4Y7CA 3W2IA 2E5KA 3JB9I 4RD2A 1NYFA 2HSEB 3C0CA 1BBZA 3D7SB 1WA7A 1G7RA 5TR9A 1QGAA 5FL7A 2D1XA 4CC7A 4RTUA 1VQ9T 2LMJA 5HCKA 2NV4A 3A8GB 2B7BA 1MV3A 3PUMA 3CMEQ 2V1RA 2DXUA 2HAXA 4RPDA 5H59A 4A54A 4OMPA 5FU7B 3OYBA 4LNPA 4UZEA 3I55T 5LL6S 4BACA 1YITQ 1KQSA 1RQRA 4PKCC 1X27A 2RHUA 3QSYA 4BPRA 4AT1B 5GJVB 4A4EA 2HQXA 4LBZA 1VYTA 3E20A 5D6XA 5IN1A 2PVDB 5CDFA 5GMKm 3H6ZA 1HZEA 1QP3A 1FNBA 5DN6A 4OB3B 3FJPA 4J9EA 3M0QA 1Q82C 2RN8A 1LVKA 4RTXA 4V2SA 3HP9A 3L2WA 3ER0A 4IUTA 3P8BB 2YUPA 4NOYA 1K73R 1VQ6A 2AIRB 1WFWA 1NZ9A 3X24B 3PA1A 4J9CA 1MMAA 2K3XA 2XDBA 4WZKA 3JCMe 2CT4A 2R58A 4P26A 4DQLA 3MEUA 5FU7C 2EYQA 5CKEA 4DK1A 1VQ7A 1Q82U 2MYSA 3UWNA 5AT1B 1SRMA 4FT4A 4HVVA 4JJCA 3PUNA 3BFMA 1BCOA 2CP5A 1UUEA 2ED0A 2BF4A 2YSQA 1C0MA 1U06A 3WQZA 2ZPEB 3EG9B 2GREA 1ZUKA 4Z4WA 1VQLQ 3CCMQ 1O9SA 4F14A 2GK7A 4UZUA 2IVWA 2J7KA 2ZPBB 3WNCA 5IYWA 4OOXA 2OBSA 2XKOC 1YN8A 4MZMA 1KC8C 4FXUA 3CW2A 2DX1A 4FW2A 3MPUB 3JCMg 4PC2A 4CC3A 1YI2Q 1OGJA 1QG0A 1Q7YU 4XR6A 2ZPIB 3E2UA 1VUBA 4KH1B 2X53S 1GCQA 4R71A 4EMKC 3Q1JA 2JJ1A 3CD6T 4D6WA 3CESA 2KE9A 4XN0A 3V7AA 4PFPA 2RQVA 4TMXA 4XLHA 3WBKA 1YNZA 4RMOA 3JB9J 3PGGA 5GMKh 1VQOT 3AVUA 1Y57A 3CC7A 4JMQA 1ZUNB 1MMGA 3SEJA 2ROTA 2HEQA 2A28A 4PJMA 3GF5A 1SKYB 1H3HA 2GBQA 3OMCA 2GQFA 2HDNB 3OJWA 4Z89A 4JRKA 2RK1A 4PLLA 1QQJA 2LNVA 1YCYA 4KGZB 3LQEA 3M0RA 2HDAA 3L2RA 1X6BA 2QQ9A 1N07A 1OYXA 2X51A 2XI9A 2NPFA 4ORZA 1KFZA 1V1CA 1ZBXA 5ECAA 4F7UA 1HA3A 3G6EB 2FHDA 3PVDA 3BDUA 3LO8A 4XLFA 3CCRA 3NHNA 1GFCA 2VJJA 3OEEA 1VQ6Q 1GO2A 3CXCP 1YCSB 1N06A 2GF7A 1HVXA 4IUVA 2NUPA 4BE1A 4P5NA 2J6KA 2YRDA 3S3NA 1WXBA 4ELZC 4Y91A 1UGVA 5A0DA 1NB9A 4JJNK 3H8ZA 3NE5B 3JCMf 5FO1A 4IUPA 2EQIA 2E64A 3MMPA 1WHHA 4PAAA 2RC6A 1XNIA 2O4XB 4KULA 1Y0RA 1VQMB 2EYWA 2OK7A 1MUZA 5KE3A 3CCUB 4E7JA 1Q82R 5KYXB 2DBMA 2MI6A 2DJQA 4D8DA 1R5NA 4B6MA 4ZTJA 2COZA 3C12A 4ESRA 3PFSA 2P0KA 3RMQA 3M5AA 2XZOA 1R0CB 4QW2A 2LZJA 1VQOB 2AKLA 4VUBA 1A8PA 2Z0WA 3EH2A 1K8AR 2XNJA 4C92A 2W6JA 2D0QB 1LNXA 2VV5A 4IW3B 3T9NA 4C92F 2QG9B 3FJ5A 1AVZC 2HNIA 3M56A 2EGAA 3QIIA 1K9MU 2BZYA 1M27C 4OB0B 5L23A 2GQVA 4DBQA 2FEIA 4MMKA 4C5EA 2PQWA 4M7DA 2QMUA 2MK5A 3QWXX 4JLIA 1VQ4T 4NS5A 4F7DA 3CC4T 3OYHA 5EG2A 4UC4A 1JA1A 3H41A 1D1AA 1VQMA 3M57A 3SWNA 3TQ7P 5IHNA 4RUGA 2P4RA 2RQWA 2PE3A 4C5GA 5LMZA 5GAN6 1TVCA 2X6XA 2XK0A 2JUFA 5IHIA 4ZN3A 4HA8A 1TG0A 2ZL7A 4FWTA 1D1NA 3G4SB 4M75B 4XTYA 2E12A 5CKFA 1AIPA 2EYZA 4C0DB 4ZN1A 4M4SA 4YAUA 3TU4K 2XU8A 3ZEHA 3PA2A 2ZPGB 2BIVA 3JB9G 3UATA 5A2QE 3CPWS 3Q38A 5A0LA 1TUDA 3AVWA 1ZSZC 2KDSA 4PK4A 1ZX6A 3OZUA 3TREA 4PFZA 3AT1B 3META 1NE8A 1JQQA 3SDZA 1W2BA 1VA7A 2HCKA 1IJEA 1DDGA 2M51A 2LT1A 4PLIA 1PCXA 4PJOE 4DA4A 1IB8A 2D9RA 3I56T 1V5VA 1K73D 1RADB 3NTKA 4QFMA 3OYLA 3SKBA 1RAGB 3LWIA 3OFNA 1NM7A 2HCJB 4FT2A 5GAN5 3P27A 3FRNA 3JV3A 1JEGA 3MHXA 4M77D 1ZQ1A 3G1JA 2C06A 2HL3A 3CC7Q 2DXBA 3EG0A 1M3CA 3OYFA 3CMEA 1FMKA 5GAMd 1CKAA 5DY9A 1KK7A 3WVDB 4CRIA 4XOPA 4R0KA 4XNFA 2IIMA 4QVDA 1K8AC 3WYAA 5I2MA 4Y9UA 5KH6A 1OZ2A 3BC9A 4XORA 3CP2A 1RAIB 1BYMA 5HY6A 2M0OA 1SHFA 1JB0E 4MYUA 1C6VX 1M2VA 1ZM3A 3DKMA 4RTVA 1GAWA 1LOJA 2LZ6B 3EG9A 4OP7A 1KRHA 1KSWA 4IUUA 4M7DC 4D8KA 2KT8A 1FDRA 3WXMA 2K5LA 2B5OA 1D09B 3RMSA 4KGXB 1WOOA 4LUEA 2J7IA 2C2WA 1YFNA 2QN6A 3FLGA 1JJ2B 2QGFB 3CPWA 1M4ZA 2L5QA 2OTJA 2KVOA 1I81A 3ASTA 2RD1A 1JXOA 1GBQA 1UEBA 3MO8A 4LDUA 1QVFP 4HCCA 4KH0B 3CP8A 5A0GA 2LQNA 1RL2A 4B47A 1RABB 4FM4B 4XTUA 3V7SA 3JB9F 2M1HA 4BE2A 4QV2A 4PABA 3CMAT 4HT9A 2ZL5A 2V8JA 5GMKe 2V8KA 3CQTA 1KQSP 4L59A 4OMMA 3L2UA 1H85A 1TUIA 3RKXA 2V7WA 3QJ6A 1OOTA 2D3LA 5LJ5j 2EGEA 4A4GA 3RBBB 1WHLA 1KD1D 4DNRB 1H42A 3A8JA 3TSZA 3X26B 3VMFA 2DA9A 3CXCA 4Z4VA 2I1LA 2VGNA 3OPOA 1ZA1B 4EDUA 1OV3A 1WHKA 1U1SA 4M78C 3JCMd 2GJRA 2RI3A 2KK4A 4DOVA 2YLBA 3CCQA 1EP3B 2MWPA 1DARA 2L3QA 2PU9B 2OAWA 5GAOn 1PNJA 2CSIA 4Z4UA 8ATCB 2JZ2A 4MMLA 1D0YA 1QKXA 1N08A 1S72B 3M0TA 2RI2A 1F20A 3CCQT 1VQ4Q 5DS0A 3UA6A 3CCET 3REAB 3CCJQ 3EFOA 3CCRT 4II2A 4M7DD 3JCMP 2DXTA 3DB3A 2DTHA 2DIQA 5LJ3g 3PIPA 4YEJA 2YUOA 2XNDA 1I8DA 1X2QA 2CH4A 2XGJA 1RUWA 4LBVA 1XE1A 1Y96B 4ACBA 2LRQA 4LE9A 4PGOA 3CC2Q 3QSUA 2JS0A 1VHOA 2XZLA 1VQ5B 1SHGA 4TMZA 3LLRA 2EJ9A 2VBTA 3CCEA 4NBSA 3I35A 1EFUA 3GIRA 2LCSA 2DRKA 5IXFA 3ULRB 1OPKA 4CQJA 1YJ9T 4O5VA 3M0UA 3NMZC 3J81E 3OS1A 3ZZUA 5DLOA 2DFUA 1G3WA 4X34A 4AFSC 4A53A 3CTAA 4E0FA 3SJPA 4YALA 1OULA 3CCLB 3ONYA 3WXMB 3CB4A 1VQ8B 2XD0A 2QTXA 1H92A 3BCDA 4XN3A 1X69A 4BUGA 1UD4A 1VF7A 1FNDA 1QCFA 3H0HA 1K73C 1DJ7B 3A5ZB 5GAN8 1W0KA 1PSEA 1ARKA 5CQYA 1QVGS 2CBXA 1FRNA 3U6KA 1N8RU 1R5OA 4AG1C 4HCZA 5LJ3d 2FL7A 5FU6B 4C92C 1Y0YA 2QGGA 3RUXA 4OB1B 4XTWA 2OI3A 5FO0A 3MHPA 4F04B 1FNMA 3CC7T 1AHJB 3C95A 3CMET 2XHCA 2KQWA 3OMGA 2R5MA 4OPVA 2V7XA 3THKA 5TV2A 1OU8A 1VOMA 1W4SA 2DL5A 3CCLA 4ASUA 1K9AA 1K0SA 4ZCLA 4RCBA 4AF7A 2ZXHA 4F7UF 4L6V5 5GANg 1UD6A 2BE7D 4WCIA 4PJOC 3OE7A 2LT4A 3RIRA 1UD8A 3OW2S 2CP7A 1E62A 1S0UA 1QWEA 5IXBA 1K76A 2L8DA 4RTYA 3BW1A 4DQKA 4PJOG 4E2FB 3G71B 2QK0A 3SWNB 1B7TA 1XOVA 4J7IA 2LCLA 5J39A 1OPLA 1IHMA 1F60A 2PMDA 2RI5A 1E6HA 5CCAA 1VQ9Q 2WSEE 5GAN3 2F5KA 3QYHB 1VQ9A 2HKNA 1ZLMA 2O01E 1BX0A 2BMWA 4M4ZA 4ROXA 1ABQA 3OS0A 3OQ5A 2F5TX 3OOCA 4C92E 2JS2A 3WNDA 4B4DA 3AVYA 3A8IA 1G3SA 2Q6OA 4ACAA 3ZZTA 2XIDA 1UD5A 2QQRA 2FRYA 3P8DA 4X8IA 4KKSA 2OX7A 1VQNB 3JSCA 3I55A 1BLIA 4E7IA 4C8QD 3KXTA 5C6SA 1YITB 1YJ9Q 1E3ZA 1NB0A 1NJIR 2EW3A 4Z88A 1N9SA 3VUBA 1NDHA 1KZLA 4P25A 3PTAA 4KUDK 5KSWB 1RLPC 1QCOA 1FYNA 3I56B 3JQQA 4C8QE 1JU5C 2D74A 4Z4SA 1VYUA 1YLOA 2OBRA 3OZWA 5I22A 1G3YA 2RJDA 3M54A 5KYXA 4LD9K 3AVVA 2C0OA 4QHYA 4DNTB 5CKBA 1X01A 1VYVA 1JJ2S 3URGA 3C94A 3EG2A 2C4TA 1P92A 3M0SA 1SKUB 1UTIA 2EQUA 4JZ3A 3VS0A 1R0BG 3H0FA 3GQBA 1N8RR 2QEXT 4HVWA 5HK0A 4J9FA 2AT1B 1SPKA 2YDLA 3VYGA 4A4HA 3C4SA 4TT3A 4PC6A 1M5Q1 5CR2A 1XFOA 4XAXB 5GAN7 2CRVA 3OYAA 2V7VA 2IPOB 4M78E 2JTFA 4F17A 5GAOp 2DBKA 4QQDA 4Q7JB 2GNCA 3QFTA 3MEVA 1FX7A 1KJWA 2E4HA 1YWOA 2YT6A 2FZCB 3Q6RA 2GK6A 1T6YA 4ZCIA 1KC8D 2ZBVA 4XKWA 1TUCA 5I2SA 4M75C 1B34A 1VQMQ 2X4WA 2GTJA 1VQ7Q 2KRMA 1P4MA 2R6HA 4M2LA 2KYMA 4OVAA 3Q39A 1WHGA 2X3WD 1MHNA 2PLFA 1TS9A 1Q86D 2VXEA 1AMOA 4C43A 1VQOQ 3OYJA 3EG3A 1UD2A 4E7KA 3J80E 1VQOA 2RB6A 1W2BB 2MMPA 1VIEA 5FU6C 4C92B 3VRZA 3CXCB 4FN5A 3PNWC 4XD7A 1MGQA 2EWNA 1QVFA 1UB4A 2XMFA 3VU3C 3PVQA 4XLAA 4Z1MA 3ZPNA 3QPHA 1G2BA 1W2BP 1RAEB 1Q86U 5FLXE 2KI7A 1PC0A 1I7PA 4C5HA 3FJOA 1HK9A 1B34B 3M53A 1FMVA 3VUZA 3MCAA 4M53A 1RACB 3CCSA 1QVGB 2K9GA 2DL8A 1I18A 2RHIA 1WXTA 4IKFA 2DNUA 1UGPB 3W5HA 2FX3A 4QVCA 4C8QF 2E5QA 1VQ4A 4M7AF 1SSHA 4M75F 5CVIA 2EIFA 2HBPA 4DEXA 2DL4A 2EQMA 1BB9A 1D3BB 3CCVA 3VR6A 3OYYA 3OYEA 2VYTA 1Q86C 3JCMh 1M90R 1WORA 2SEMA 2OTLQ 2VBSA 4M7AE 3FPPA 2RK2A 2RM4A 1JXMA 1UMKA 3GVJA 1TWBA 1WX6A 3LQ6A 3X28B 4B9WA 1Q7YC 1M9SA 1OB0A 4JRQA 1H3ZA 2ENMA 3EHRA 2VYQA 1LJOA 1GBRA 4X7DA 2IG0A 1N27A 1B2RA 5A89A 2L3PA 5KE2A 4LDYA 1M8MA 3CD6B 2V31A 1UG1A 1RAHB 2HSPA 2RHYA 1EXMA 6AT1B 1Z9QA 5GAMj 2XDPA 2C5HA 3CC2B 2I0NA 2DTOA 2Z6BD 2ECZA 4FL6A 1BU1A 2F1LA 1G8XA 4LDVA 5HK3A 4N4IA 4C8QA 3RNJA 2EFGA 2D3NA 4N4HA 1PJ5A 1WJRA 4QVZA 4AMCA 5FROA 1AD5A 3OYIA 4TMWA 1X2KA 3T56B 2AZSA 4J6XA 4C0DC 4CC4B 3J7AF 1OHHA 2BGIA 4ATOA 4XQFA 2E65A 2EKHA 1GJRA 4M77C 1KTVA 2WPDA 2FZKB 2DJZA 3FEOA 2LDMA 3NPFA 4CI0C 1RQPA 4Y9RA 4LN2A 2DEUA 4EMKA 2CW5A 4QT7A 1M1FA 4JPBW 1JBMA 3G6ET 1AEYA 4Q5WA 5J26A 1ZA2B 1G3TA 1PSFA 1OI1A 5LJ5g 4ZGNB 2JM8A 2EQKA 2VNHA 4F7UB 3L2VA 1YJWQ 3CCMA 4Z4TA 2P4TA 1UDLA 3M9QA 4DBHA 4XOTA 1BI1A 3U23A 5GV7A 2YLCA 4M78A 2KRSA 5KYWB 1XJWB 2QEXA 4FCYA 2DERA 4WQMA 4J6YA 1I07A 4XTVA 2DYIA 3TEEA 2RQTA 2KBTA 4G1BA 1WU8A 3V8KA 1PG5B 2LCCA 1YHQT 3OB9A 2D8HA 3X20B 5GANe 4E6RA 4J9IA 4X9DA 4EPCA 3BY1A 3V7RA 3OYCA 3EFRA 1X6GA 2WSCE 3JQRA 3OW7A 3CCJA 4XTXA 2VBUA 1N9RA 4L8JA 4M7AA 4XL9A 2ZGWA 2HKQB 1S72T 1VLOA 3GPLA 2BTTA 4C0FA 2K5IA 4PJOF 3EH1A 1E43A 2HD0A 2C77A 2O4XA 1K9MD 2FB7A 1TUGB 1JRIA 5GMKl 2JJ2A 4C0SA 2B7CA 2KXDA 5HZBA 2O9VA 2RC5A 4B3XA 2FYKA 4AFZC 2LNHB 4M1KA 2E1HA 1VQ9B 3V7CA 2E1RA 2GQIA 1YITA 2OYNA 3B82A 2K3BA 1OZ3A 3M4GA 2K2VA 4X1VA 3M0PA 3A8KA 2LJ0A 1WJSA 4M0LA 5LJ5f 2BSAA 2ZZFA 5CKHA 1G5VA 1LPLA 1VQ7B 3HRSA 1G7CA 3CCJB 2XG8D 4X7CA 4ZTFA 2GTOA 2VGMA 3H9NA 1KHIA 4NCNA 2OTJT 2KVQG 5JBQA 4ANJA 4AG2C 3JCMW 2BPOA 2CREA 4XK8E 2GFUA 2OTLB 2BZXA 4OMLA 3QG1A 2QAZA 4PC1A 2Y90A 2CKKA 4FYVB 2WYRA 2NLUA 3CMAA 2GFAA 1E6GA 1UJYA 4X7FA 2D9TA 1Y71A 3DB4A 4BDZA 3S3MA 3LGLA 1H8EA 3MEAA 3GSIA 5IYNA 4J0QA 2DILA 1N5ZA 1F1BB 2WJYA 4DBRA 4RDKA 4QVAA 3I5SA 3RDVA 4OPOA 2WSSA 1OB5A 3CBOA 2DVEA 2DLPA 1WOPA 1VQ8A 4YTLA 4ZCMA 1H8HA 3ASSA 2V1QA 2KEAA 1B3QA 2FVUA 3OS5A 3ONUA 2HMAA 1QGYA 2JVVA 1I0CA 5BSXA 1QVPA 1ZSZA 1A0NB 4ZGDB 1YJNB 1K0XA 2DD5A 3A8OB 3SEMA 1YBYA 4OOSA 5D7UA 4LC0A 5J3BA 3L42A 5GAOl 1QX4A 2ZCFB 2O31A 1NPRA 4J83A 1HJDA 4M77A 4P1VA 4FW1A 1KC8R 3AVXA 1U1TA 3VRYA 1HD3A 1ABOA 4LXCA 1M1KU 5FWBA 1K28D 4CC2A 1Q9SA 3W2FA 2MF2A 3P8HA 1VQPB 3WNBA 2PUKB 4H9GA 1BI3A 1D1BA 3RR6A 1N6AA 2XICA 3SB2A 3PMTA 1TU0B 2P3MA 4FIBA 3EGXA 4NNJA 2I2LA 3WBJA 2E6ZA 4C0ZA 2JN0A 3CPFA 2WZPP 1FX0A 3BCFA 3GNGA 2CK3A 4MDXA 2BM0A 1NJIU 2O2OA 3QFCA 3CRZA 4X7EA 1E79A 2LX9A 3J81k 3GVKA 4PFOA 1Z9ZA 2QA4B 4E7LA 5GANd 3CCEQ 2M9UA 4N4GA 1K9MC 3AGPA 4P22A 2X4JA 5H5JA 1ZSGA 4XU3A 2KGTA 1YJ9A 4R55A 4HE6A 1CQXA 3DLLA 3G4ST 3CCVQ 3OAAA 4G1VA 1JB9A 3OYKA 2ZPHB 2QQSA 1TTTA 4X0CA 3QYGB 2DXCA 4II1A 2M16A 1QVGA 2GCXA 2FPDA 1PKVA 2P84A 4XLEA 4M7AC 2NUTB 2M5SA 1TLLA 2KNBB 4RD0A 4J7FA 1YIJA 1WJQA 1FNCA 1VQ4B 4DBFA 3OA6A 4P3IA 1B23P 1AZEA 4RG2A 4RTWA 1QLYA 2D6FA 1TXQA 3RKWA 3QKJA 3GIBA 2HBWA 2EAYA 1G7TA 1FMWA 3QHSA 3OBWA 4G5GA 1MMDA 2KSSA 4J6WA 2Y4XA 1GRIA 9ATCB 1D1CA 2DKGA 2C78A 3JCMJ 1JNYA 3I56Q 2LJ1A 3CCRQ 1FXXA 2BUDA 1KQSS 4PJOB 1N8RD 2L0AA 2YWEA 5GAOq 2CZ7B 3QZ9B 2WJVA 2GJPA 1PD0A 2V7QA 5E6TA 2K3YA 1WP6A 2D8JA 2MPXC 3JAME 4DQ2A 2YUNA 1EFTA 1PKSA 3VS1A 1YHQB 4GLKA 1WLPB 2LQ8A 3REBB 5FRMA 4TMTA 5DLQE 2JTMA 1YX2A 2BVNA 2QE7A 4RD6A 1I5LA 1UECA 3A98A 2C5BA 5GAMe 5L46A 4HCBA 4DK0A 2ZZEA 5GAN2 3CBMA 2YWGA 4RG8A 4HT8A 1VQMT 4M7DF 4G7WA 5DSZA 5HZAA 4M75A 1OU9A 3CCST 1KIKA 2FG0A 3HKSA 5CKDA 2P0QA 5KNLA 3BQJA 2PTKA 2J6OA 1K8AD 3FKSA 5D6WA 1JJ2A 2PNIA 1M3BA 1KK2A 5KYYB 1VQNQ 3I5RA 3G4SQ 3CCVT 1UFFA 4XTZA 5DM7R 5LJ3h 2XEXA 1RAFB 1IXDA 1KD1C 3G4SA 4FYYB 3OEHA 1OEBA 3BY2A 1D2EA 2FZGB 1DDIA 1QFYA 3TVTA 2X85A 1WHMA 4M75D 4M7AD 4YXWA 1M1KD 2QEXQ 5GMKj 4BI4A 2DPPB 4C92D 3AHUA 1WGSA 1O75A 2V4DA 1M1KC 1RAAB 2R9VA 1EFNA 2Q6LA 4YAOA 1XQHA 3PE0A 4OMFB 2KT1A 4GY5A 4OF1A 1W34A 3SJZA 2RHXA 1M3AA 5GAMf 3HSBA 1WNLA 1V76A 5CAIA 2H3JA 3QUIA 2K7AA 5GANf 1VHEA 3D26A 1EIFA 3BE3A 4OP0A 2ABLA 1KMHA 4F7UG 1ZM2A 2QYZA 3FPKA 2FVGA 2HL5C 4TMVA 1WZOA 1NBEB 1NEBA 3VS6A 4XM3A 1KC8U 2RA2A 2LX7A 2F2VA 2X6YA 3MJXA 1K73U 3I1FA 2AHOA 2CH4W 2WZNA 1BI2A 4JDSA 2CP6A 2CP2A 3VO1A 4PJOD 1D8TA 2LC4A 1COWA 2H3EB 4RD1A 1IZ6A 5F4MA 2NUTA 3ZBDA 3B8HA 4YAFA 1IGQA 1CSKA 5KYUB 4GQNA 1R5BA 2OJ2A 1M90D 1WPYA 2DAQA 3CC2A 2V7UA 2OAUA 1EP1B 2AZVA 3OYGA 3OS2A 1Q81R 2E10A 3HPWA 2JOYA 1Y96A 2NWMA 5L8RE 1CNEA 1UD3A 2ZTGA 1I8FA 4BY6B 2FPEA 2WSFE 2HQEA 1YJNQ 2DMOA 2RH2A 2X4YA 3L2QA 5GAN4 3DLMA 2A37A 2NUPB 4M7AG 4M77B 3AGQA 3RY8A 3CCVB 5TY0A 1BIAA 1OX8A 5CK9A 3HAGA 1VQKA 1CKBA 1PWTA 3MCAB 3BY7A 2BZ8A 2EKOA 1MV0B 1YIJQ 2CZ1B 3LGFA 2W0ZA 1G83A 4U9UA 1WYXA 3S6WA 3TCJA 1QW1A 4HXJA 4F16A 2YUQA 1VQPQ 1Q81C 1IRXA 5J35A 2AKKA 4XONA 3CCUA 2ZAEA 5I11A 5GAMg 2BE9B 2DK3A 4WZLA 2QTZA 4JRPA 3CBPA 1IHVA 1AT1B 2L3RA 5KYYA 3GNFB 4JLGA 2DCUA 1KQ1A 1QFJA 4J9GA 2X9HA 2BKDN 4KKUA 4FYWB 2L2PA 1VJSA 4HVUA 2DE0X 2X8KA 1PD1A 1VQLA 5IYRA 5I21A 3A8HB 2PUOB 3LH5A 4RTZA 3SFMA 4YELA 1KK3A 1T0HA 2ROLA 4RKUE 1QFZA 3OYMA 3I55B 2DOGA 2QASA 2ZITA 1QVGP 2RNAA 1WI7A 4PC3A 4BB7A 1VQLT 3E19A 1K1ZA 2F2XA 3MP6A 5GANh 3OP1A 4EIKA 4QQGA 3CXCS 3JCMV 5CIUA 5LJ5e 5TRDA 3LW5E 2YRVA 4J9BA 2OBTA 2PZ1A 5J3OA 2HLDA 1NJID 1AWJA 2JMAA 3ZUGA 1ZUUA 4UAJA 1Y0MA 1I5OB 4LDWA 1KK1A 3JU4A 1M30A 1M2VB 5M9OA 2K6DA 3HTRA 3U2QA 4Z8AA 2RF0A 3OW2B 4YAWA 2B8AA 1VQKT 1WXUA 3EGUA 4OOVA 4N0AC 4LBYA 4C8QC 2VNIA 3QFSA 1KD1R 2DD4A 2QA4T 2VASA 2JIZA 1VQ5A 2K4YA 2RJFA 5IH2A 3M55A 4Y28E 2PVGB 3QWYA 3CMMA 1IHWA 2JXBA 1YIJT 2CZ6B 3JCMc 2RQUA 2D0NA 3E1SA 2CF4A 1EWYA 4NL2A 3A8MB 1WPCA 2GPJA 5EMNA 1SG5A 2JM9A 3A35A 2Q6IA 2VWFA 4M77G 4B9XA 2KY9A 4RDLA 3FIFA 3CD6Q 1VQPT 4ELYC 2KXCA 3ASKA 3QO3A 4WF2A 1QKWA 2J05A 3MKDA 2C0IA 1VQNT 1ACMB 2E70A 1H641 5FWCA 4RTTA 2DL3A 4MZPA 1Q7YD 4N0AA 2LTOA 5HKCA 1VQKQ 1E1RA 4JRIA 2EYYA 2VC8A 1AOJA 1YJNT 1S72A 4KBMB 2ZTNA 1ZM9A 1NBMA 3A3GA 1NEGA 4RM0A 1N0UA 3LYIA 3HRUA 3RERA 3GLXA 4LD6A 2DYBA 4PNOA 1JA0A 1M90U 1YI2T 2ZXIA 3M4YA 4QVJA 2M0YA 1Q95G 4G6IA 3W2GA 5FRNA 1WDTA 2VVKA 3GVLA 2KROA 1T6XA 1S4MA 2DRMA 3G6EA 2DETA 4J5YA 4BY6C 4P2NA 3EAEA 2ATCB 3PT9A 1YWPA 1YJNA 3G71T 2X4XA 2F69A 2JMCA 5BSYA 2DTIA 4UZFA 1MNEA 3ZC3A 3R6OA 1EFCA 2DO3A 4A4KA 3ISXA 1YI2A 1B07A 1YJWB 1E63A 3CPWB 5GMKi 1IGUA 1XB2A 3ES9A 2JT4A 5KCOA 2EYXA 1M90C 1TOVA 4GBQA 1Q86R 4B3GA 3CCRB 3RKYA 1BJKA 2OTLT 1W70A 1BIBA 1PM3A 2DIEA 1YHQA 4ZGEB 1PJ7A 2QDLA 2X35A 1E64A 1U3OA 2RQRA 1K9MR 3EGXB 3F70A 3PMIA 2FRWA 1IJFA 1SM4A 1OB2A 2OTJB 1MRZA 5KYUA 2R5AA 2MWOA 2EVRA 1D0ZA 4OMQA 1M8VA 3CCJT 2JTEA 4X07A 4MDWA 3ME9A 2MAMA 1M2OA 3QDRB 2E3HA 3H0IA 3QFRA 4LDXA 2QXFA 3DDYA 4E7SA 3E1YE 2RPNA 3OSVA 3OW2A 3WVEB 4Y92A 2JNGA 4FYXB 2CC2A 2X6WA 1AZGB 4ME7A 2YWWA 3A3BA 1WSVA 1Q81D 2MOXA 4RD4A 3G7ZA 2W6IA 4WTOB 2QDYB 4Z4YA 1KJZA 2CSQA 2CZ0B 4PJLA 3CCSQ 4M75G 2FPFA 4M77E 1VQ8T 2CS7A 3RESA 2X3UA 2QI2A 4C5IA 4FU6A 3CD6A 3HFOA 1GFDA 1M1GA 5LJ5d 1ZBJA 3CC2T 1VIFA 1QP2A 3OW2P 2SRCA 3E9GA 1YIJB 4E7HA 5GAOr 3NFCA 2MCNA 4JS4A 4RD3A 3TSWA 1I4K1 4RJLA 4XKVA 1Y07A 1ZHIA 4YHBA 2O88A 3UT1A 2DEQA 2H8HA 2CNDA 1K4US 5C0MA 1DG1G 3HHTB 5GANj 3ASQA 3OKXA 1U2RA 1T3LA 1QUEA 4AVZA 1YJWT 4IIMA 1XTDA 1D3BA 3QJYA 1R77A 1AWOA 2BM1A 3CCEB 5IAYA 2L3SA 3W2EA 4R56A 3G6EQ 4EMKB 4QQ6A 4RDJA 1V0FA 2VNJA 4RLZA 2F2WA 3VS7A 5GV8A 1QWFA 2COYA 3MP8A 4RCZA 8AT1B 2CYZB 3T51B 3PIOA 3CC4Q 3SLNA 2ZPFB 1UJ0A 4O6JA 3UA7A 4ZV4A 1N8RC 1VQLB 3CCMB 1X6OA 1WQ7A 2BGJA 3UF4A 4OMOA 1T0JA 2AK5A 2P0PA 4P12A 4HE5A 2QA4A 1H8KA 2CUDA 4BI3A 2CP3A 3EHQA 1UGQB 4PC7A 2LP5A 2PVOB 3KUFA 4JJDA 3W5VA 5FW9A 4IIOA 3A8LB 3CPXA 1EX4A 5A88A 4ZNXA 3CCUQ 2RHZA 4AC9A 4B43A 4FSSA 3EFSA 4F7UE 3QDFA 3CMAQ 1WIEA 1VQ6B 3OZVA 1RLQC 4L5GA 2C0TA 1W6XA 2JDIA 3SD4A 2RMOA 2YWHA 1GL5A 5B6IA 3VNVA 2EJFA 2XZPA 1M1KR 1W2BS 4RPBA 1VQNA 2E3IA 1NJIC 1SSFA 4M75E 1BCMA 5HXBA 2R57A 2RJCA 1BQEA 3OY9A 2AHJB 1BX1A 1QGZA 4OB2B 1RI0A 1GXIE 3CEYA 1W87A 4A63B 3IQLA 1S1NA 4M77F 1ELOA 3ZL7C 1LCKA 3VS2A 3Q6QA 2RJEA 4P6VF 2L89A 5HKKA 3CCQQ 3ZFJA 4TVRA 4P3YA 3O5ZA 5LJ3j 3S3OA 2LQKA 3QZ5B 2ESWA 4KKTA 5KW9A 3VV0A 2C4UA 4B44A 3HL8A 3KEWA 4X06A 4M78D 1PJ6A 2EPDA 1J3TA 3WY9A 2CT3A 3G71Q 2QQBA 1SEMA 4LBWA 2EGCA 3OYNA
chains in the Genus database with same CATH topology
2F1LA 3H9NA 2DYIA 2DOGA 3A1PA 1PM3A 3HTRA 2QGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1L A;  3H9N A;  2DYI A;  2DOG A;  3A1P A;  1PM3 A;  3HTR A;  2QGG A; 
#chains in the Genus database with same CATH topology
 3H94 A;  4B3F X;  3UPU A;  1TH7 A;  5IYQ A;  2HZY A;  3L1A A;  2DIG A;  2GGR A;  3EGD B;  1TSF A;  4XU0 A;  4BE0 A;  3A1P A;  4Z4Z A;  1X75 C;  1WSR A;  1BMF A;  2BN4 A;  3JB9 D;  1OX9 A;  1OQK A;  2OTL A;  2ZZQ A;  5A8A A;  4KUI A;  3V8J A;  4RCY A;  3ASP A;  1W35 A;  2EIX A;  4N3G A;  4QKU A;  3LWH A;  3OSS C;  2QQA A;  5CQX A;  1KD1 U;  3E9F A;  2F1M A;  2K79 A;  1PRM C;  3EG1 A;  2DVJ A;  4TN1 A;  4J9H A;  1ZSZ B;  5F4O A;  4FK8 A;  1NRK A;  3O8V A;  1KQ2 A;  1CNF A;  4IUR A;  4FSX A;  4M78 F;  1QVF B;  2NYS A;  2V8I A;  3OYD A;  1WHJ A;  2COW A;  4DEY A;  2QA4 Q;  4EH1 A;  3VYH B;  3QXE B;  3CC4 A;  1QVF S;  2YRC A;  2PIA A;  1JJ2 P;  2A36 A;  3GP8 A;  2MIO A;  1GCQ C;  2K2M A;  2VJI A;  4X9C A;  2JN9 A;  1QH0 A;  3NTI A;  4JZ4 A;  1IB0 A;  2B86 A;  3VO2 A;  2HQH A;  1G7S A;  1KHC A;  2OTJ Q;  4BI8 B;  4JS5 A;  1MND A;  2VB6 A;  2DL7 A;  2KMT A;  1UGR B;  4E47 A;  1HYO A;  1PRL C;  1IO6 A;  3ASR A;  3Q3A A;  3SHW A;  4P9S A;  4PL6 A;  2XNC A;  3SWN C;  1AWX A;  3M59 A;  3VS3 A;  1WDX A;  1Q7Y R;  2E1B A;  3EFO B;  4OGC A;  4WWV A;  2EFI A;  3G05 A;  2QTL A;  4HKE A;  3CCM T;  1V29 B;  3VS4 A;  5AYF A;  4XQ3 A;  1EFR A;  3X25 B;  2Q6K A;  1Q82 D;  3AVT A;  4C0G A;  3VJP A;  1NG2 A;  1QMC A;  3ZZ0 A;  3OBY A;  3CCS B;  1N05 A;  3CC4 B;  4C8Q G;  1E7O A;  4BD3 A;  1YJW A;  2YHT A;  1NLO C;  1YP5 A;  2JW4 A;  2DF6 A;  1GAQ A;  2K5F A;  5KYW A;  1FWZ A;  4HCK A;  1ZM4 A;  2QEX B;  3BDL A;  4P6Y A;  4WZE A;  4OMN A;  1YHQ Q;  2CDT A;  5FNZ A;  2FO0 A;  1VLY A;  3NTH A;  1BK2 A;  5LJ3 f;  2VXF A;  5CO7 A;  1QCN A;  5EC7 A;  2VKN A;  3B78 A;  2F43 A;  1K8A U;  1X43 A;  4XLC A;  4ZGJ B;  5IHK A;  2WR8 A;  4XU1 A;  2ED1 A;  2LJ3 A;  3V8L A;  4M7D B;  4J8O A;  2V7T A;  5AN9 A;  3ZBU A;  2JJ9 A;  7AT1 B;  4II3 A;  3CME B;  4RCC A;  1UHF A;  4EMH A;  3LX7 A;  3CCU T;  3CC7 B;  2J6F A;  3MEW A;  4E7Z A;  2A0F B;  5KCH A;  1E1Q A;  3CPW P;  1NPP A;  4MZT A;  4NL3 A;  4M78 G;  4PJO A;  1Q81 U;  3R6K A;  3M58 A;  4ZGQ B;  1T3S A;  1U8R A;  2ZL6 A;  3I55 Q;  1YIT T;  1VQ6 T;  2ZZG A;  3BNW A;  5FIU A;  4Z4R A;  1SRL A;  2RO0 A;  1D0X A;  1UE9 A;  4A4F A;  4JJB A;  1J9Z A;  3JB9 H;  1TTH B;  1OGI A;  1FRQ A;  2EQJ A;  3LVB A;  2M02 A;  2QTV A;  3NGP A;  2X3X D;  2F4N A;  2G6F X;  1SKQ A;  3G71 A;  4X05 A;  5GAM h;  5FA6 A;  4TKO B;  1I1J A;  1MAB A;  4KGV B;  4C92 G;  4DOW A;  1XQB A;  4EMG A;  1E3X A;  1GVH A;  2V26 A;  2QDX A;  4K11 A;  1NLP C;  4M7D E;  3KL9 A;  4G7X A;  2XDD A;  1PHT A;  3W2H A;  1KG1 A;  1AWW A;  5GJW B;  4HIZ A;  4M7D G;  4K1X A;  1T5E A;  5IK2 A;  2J06 A;  1Y7X A;  1SF9 A;  4KRT A;  1PKT A;  3ZIA A;  2EJG A;  3PEN A;  3UDC A;  3PVL A;  1C1A A;  2GJK A;  3V76 A;  4OPS A;  1IRE B;  2DZC A;  2ZBU A;  2LQW A;  2A08 A;  1W1F A;  1W0J A;  3KFV A;  1WQW A;  3L2Z A;  2VBV A;  2WAC A;  3INZ A;  1KQS B;  4J9D A;  5GAO m;  3JQP A;  5D6Y A;  1S72 Q;  5LJ3 e;  2VUB A;  3JCM X;  3QBY A;  5KYN A;  1U5S A;  4PJJ A;  3LNN A;  3QE2 A;  3I9Q A;  1UGS B;  2E6N A;  2EBP A;  2A3L A;  3CCL Q;  4N3N A;  3JRZ A;  4IUQ A;  3T53 B;  3ZBT A;  3CCQ B;  2VNK A;  1VQ8 Q;  2KAF A;  3I56 A;  3SLD A;  4JUV A;  4AFU C;  3GBQ A;  4AFQ C;  1HSQ A;  1YI2 B;  2LVM A;  2A7Y A;  1T6Z A;  5IYP A;  1ZUY A;  1RI9 A;  4C8Q B;  2K57 A;  4TSF A;  4M7A B;  1V0E A;  3N5B B;  3R6N A;  4BDY A;  3MP1 A;  1VQP A;  2CP0 A;  1WOS A;  3EGD A;  1W9X A;  4Z02 A;  2KR3 A;  5THX A;  4XU2 A;  3FC3 A;  3FB9 A;  1EZZ B;  2W10 A;  3BH4 A;  2ZZD A;  3P26 A;  1BKB A;  2CUB A;  1KK0 A;  2DY1 A;  3OJX A;  3VKI A;  3U6B A;  3HFN A;  2Y4Y A;  2YWF A;  2NUZ A;  2KYB A;  3FDR A;  3W5U A;  4QUZ A;  2KRN A;  3JCM Q;  2G3R A;  1N0V C;  1GCP A;  3R6J A;  3CCL T;  1UHC A;  2XOK A;  2CGH A;  1NYG A;  1JO8 A;  3GOX A;  2O9S A;  4WZT A;  4B48 A;  5IT9 E;  4LUD A;  2DM1 A;  1HXD A;  1MMN A;  2X0K A;  1WTH D;  2YXY A;  5LJ5 h;  3JCM b;  1YJ9 B;  2OK8 A;  1R8O B;  3CMA B;  4PJN A;  2VZL A;  1GR1 A;  4KT0 E;  4M78 B;  4OGE A;  4MYT A;  3VS5 A;  3KBG A;  1VQ5 T;  2DZ9 A;  1VQ5 Q;  2BV3 A;  1BI0 A;  1VQ7 T;  5F4J A;  3HRT A;  1EP2 B;  1QUF A;  1VQK B;  4XMY A;  3LH0 A;  2E41 A;  3VNU A;  4AF6 A;  4GLM A;  1BPL A;  4Y7C A;  3W2I A;  2E5K A;  3JB9 I;  4RD2 A;  1NYF A;  2HSE B;  3C0C A;  1BBZ A;  3D7S B;  1WA7 A;  1G7R A;  5TR9 A;  1QGA A;  5FL7 A;  2D1X A;  4CC7 A;  4RTU A;  1VQ9 T;  2LMJ A;  5HCK A;  2NV4 A;  3A8G B;  2B7B A;  1MV3 A;  3PUM A;  3CME Q;  2V1R A;  2DXU A;  2HAX A;  4RPD A;  5H59 A;  4A54 A;  4OMP A;  5FU7 B;  3OYB A;  4LNP A;  4UZE A;  3I55 T;  5LL6 S;  4BAC A;  1YIT Q;  1KQS A;  1RQR A;  4PKC C;  1X27 A;  2RHU A;  3QSY A;  4BPR A;  4AT1 B;  5GJV B;  4A4E A;  2HQX A;  4LBZ A;  1VYT A;  3E20 A;  5D6X A;  5IN1 A;  2PVD B;  5CDF A;  5GMK m;  3H6Z A;  1HZE A;  1QP3 A;  1FNB A;  5DN6 A;  4OB3 B;  3FJP A;  4J9E A;  3M0Q A;  1Q82 C;  2RN8 A;  1LVK A;  4RTX A;  4V2S A;  3HP9 A;  3L2W A;  3ER0 A;  4IUT A;  3P8B B;  2YUP A;  4NOY A;  1K73 R;  1VQ6 A;  2AIR B;  1WFW A;  1NZ9 A;  3X24 B;  3PA1 A;  4J9C A;  1MMA A;  2K3X A;  2XDB A;  4WZK A;  3JCM e;  2CT4 A;  2R58 A;  4P26 A;  4DQL A;  3MEU A;  5FU7 C;  2EYQ A;  5CKE A;  4DK1 A;  1VQ7 A;  1Q82 U;  2MYS A;  3UWN A;  5AT1 B;  1SRM A;  4FT4 A;  4HVV A;  4JJC A;  3PUN A;  3BFM A;  1BCO A;  2CP5 A;  1UUE A;  2ED0 A;  2BF4 A;  2YSQ A;  1C0M A;  1U06 A;  3WQZ A;  2ZPE B;  3EG9 B;  2GRE A;  1ZUK A;  4Z4W A;  1VQL Q;  3CCM Q;  1O9S A;  4F14 A;  2GK7 A;  4UZU A;  2IVW A;  2J7K A;  2ZPB B;  3WNC A;  5IYW A;  4OOX A;  2OBS A;  2XKO C;  1YN8 A;  4MZM A;  1KC8 C;  4FXU A;  3CW2 A;  2DX1 A;  4FW2 A;  3MPU B;  3JCM g;  4PC2 A;  4CC3 A;  1YI2 Q;  1OGJ A;  1QG0 A;  1Q7Y U;  4XR6 A;  2ZPI B;  3E2U A;  1VUB A;  4KH1 B;  2X53 S;  1GCQ A;  4R71 A;  4EMK C;  3Q1J A;  2JJ1 A;  3CD6 T;  4D6W A;  3CES A;  2KE9 A;  4XN0 A;  3V7A A;  4PFP A;  2RQV A;  4TMX A;  4XLH A;  3WBK A;  1YNZ A;  4RMO A;  3JB9 J;  3PGG A;  5GMK h;  1VQO T;  3AVU A;  1Y57 A;  3CC7 A;  4JMQ A;  1ZUN B;  1MMG A;  3SEJ A;  2ROT A;  2HEQ A;  2A28 A;  4PJM A;  3GF5 A;  1SKY B;  1H3H A;  2GBQ A;  3OMC A;  2GQF A;  2HDN B;  3OJW A;  4Z89 A;  4JRK A;  2RK1 A;  4PLL A;  1QQJ A;  2LNV A;  1YCY A;  4KGZ B;  3LQE A;  3M0R A;  2HDA A;  3L2R A;  1X6B A;  2QQ9 A;  1N07 A;  1OYX A;  2X51 A;  2XI9 A;  2NPF A;  4ORZ A;  1KFZ A;  1V1C A;  1ZBX A;  5ECA A;  4F7U A;  1HA3 A;  3G6E B;  2FHD A;  3PVD A;  3BDU A;  3LO8 A;  4XLF A;  3CCR A;  3NHN A;  1GFC A;  2VJJ A;  3OEE A;  1VQ6 Q;  1GO2 A;  3CXC P;  1YCS B;  1N06 A;  2GF7 A;  1HVX A;  4IUV A;  2NUP A;  4BE1 A;  4P5N A;  2J6K A;  2YRD A;  3S3N A;  1WXB A;  4ELZ C;  4Y91 A;  1UGV A;  5A0D A;  1NB9 A;  4JJN K;  3H8Z A;  3NE5 B;  3JCM f;  5FO1 A;  4IUP A;  2EQI A;  2E64 A;  3MMP A;  1WHH A;  4PAA A;  2RC6 A;  1XNI A;  2O4X B;  4KUL A;  1Y0R A;  1VQM B;  2EYW A;  2OK7 A;  1MUZ A;  5KE3 A;  3CCU B;  4E7J A;  1Q82 R;  5KYX B;  2DBM A;  2MI6 A;  2DJQ A;  4D8D A;  1R5N A;  4B6M A;  4ZTJ A;  2COZ A;  3C12 A;  4ESR A;  3PFS A;  2P0K A;  3RMQ A;  3M5A A;  2XZO A;  1R0C B;  4QW2 A;  2LZJ A;  1VQO B;  2AKL A;  4VUB A;  1A8P A;  2Z0W A;  3EH2 A;  1K8A R;  2XNJ A;  4C92 A;  2W6J A;  2D0Q B;  1LNX A;  2VV5 A;  4IW3 B;  3T9N A;  4C92 F;  2QG9 B;  3FJ5 A;  1AVZ C;  2HNI A;  3M56 A;  2EGA A;  3QII A;  1K9M U;  2BZY A;  1M27 C;  4OB0 B;  5L23 A;  2GQV A;  4DBQ A;  2FEI A;  4MMK A;  4C5E A;  2PQW A;  4M7D A;  2QMU A;  2MK5 A;  3QWX X;  4JLI A;  1VQ4 T;  4NS5 A;  4F7D A;  3CC4 T;  3OYH A;  5EG2 A;  4UC4 A;  1JA1 A;  3H41 A;  1D1A A;  1VQM A;  3M57 A;  3SWN A;  3TQ7 P;  5IHN A;  4RUG A;  2P4R A;  2RQW A;  2PE3 A;  4C5G A;  5LMZ A;  5GAN 6;  1TVC A;  2X6X A;  2XK0 A;  2JUF A;  5IHI A;  4ZN3 A;  4HA8 A;  1TG0 A;  2ZL7 A;  4FWT A;  1D1N A;  3G4S B;  4M75 B;  4XTY A;  2E12 A;  5CKF A;  1AIP A;  2EYZ A;  4C0D B;  4ZN1 A;  4M4S A;  4YAU A;  3TU4 K;  2XU8 A;  3ZEH A;  3PA2 A;  2ZPG B;  2BIV A;  3JB9 G;  3UAT A;  5A2Q E;  3CPW S;  3Q38 A;  5A0L A;  1TUD A;  3AVW A;  1ZSZ C;  2KDS A;  4PK4 A;  1ZX6 A;  3OZU A;  3TRE A;  4PFZ A;  3AT1 B;  3MET A;  1NE8 A;  1JQQ A;  3SDZ A;  1W2B A;  1VA7 A;  2HCK A;  1IJE A;  1DDG A;  2M51 A;  2LT1 A;  4PLI A;  1PCX A;  4PJO E;  4DA4 A;  1IB8 A;  2D9R A;  3I56 T;  1V5V A;  1K73 D;  1RAD B;  3NTK A;  4QFM A;  3OYL A;  3SKB A;  1RAG B;  3LWI A;  3OFN A;  1NM7 A;  2HCJ B;  4FT2 A;  5GAN 5;  3P27 A;  3FRN A;  3JV3 A;  1JEG A;  3MHX A;  4M77 D;  1ZQ1 A;  3G1J A;  2C06 A;  2HL3 A;  3CC7 Q;  2DXB A;  3EG0 A;  1M3C A;  3OYF A;  3CME A;  1FMK A;  5GAM d;  1CKA A;  5DY9 A;  1KK7 A;  3WVD B;  4CRI A;  4XOP A;  4R0K A;  4XNF A;  2IIM A;  4QVD A;  1K8A C;  3WYA A;  5I2M A;  4Y9U A;  5KH6 A;  1OZ2 A;  3BC9 A;  4XOR A;  3CP2 A;  1RAI B;  1BYM A;  5HY6 A;  2M0O A;  1SHF A;  1JB0 E;  4MYU A;  1C6V X;  1M2V A;  1ZM3 A;  3DKM A;  4RTV A;  1GAW A;  1LOJ A;  2LZ6 B;  3EG9 A;  4OP7 A;  1KRH A;  1KSW A;  4IUU A;  4M7D C;  4D8K A;  2KT8 A;  1FDR A;  3WXM A;  2K5L A;  2B5O A;  1D09 B;  3RMS A;  4KGX B;  1WOO A;  4LUE A;  2J7I A;  2C2W A;  1YFN A;  2QN6 A;  3FLG A;  1JJ2 B;  2QGF B;  3CPW A;  1M4Z A;  2L5Q A;  2OTJ A;  2KVO A;  1I81 A;  3AST A;  2RD1 A;  1JXO A;  1GBQ A;  1UEB A;  3MO8 A;  4LDU A;  1QVF P;  4HCC A;  4KH0 B;  3CP8 A;  5A0G A;  2LQN A;  1RL2 A;  4B47 A;  1RAB B;  4FM4 B;  4XTU A;  3V7S A;  3JB9 F;  2M1H A;  4BE2 A;  4QV2 A;  4PAB A;  3CMA T;  4HT9 A;  2ZL5 A;  2V8J A;  5GMK e;  2V8K A;  3CQT A;  1KQS P;  4L59 A;  4OMM A;  3L2U A;  1H85 A;  1TUI A;  3RKX A;  2V7W A;  3QJ6 A;  1OOT A;  2D3L A;  5LJ5 j;  2EGE A;  4A4G A;  3RBB B;  1WHL A;  1KD1 D;  4DNR B;  1H42 A;  3A8J A;  3TSZ A;  3X26 B;  3VMF A;  2DA9 A;  3CXC A;  4Z4V A;  2I1L A;  2VGN A;  3OPO A;  1ZA1 B;  4EDU A;  1OV3 A;  1WHK A;  1U1S A;  4M78 C;  3JCM d;  2GJR A;  2RI3 A;  2KK4 A;  4DOV A;  2YLB A;  3CCQ A;  1EP3 B;  2MWP A;  1DAR A;  2L3Q A;  2PU9 B;  2OAW A;  5GAO n;  1PNJ A;  2CSI A;  4Z4U A;  8ATC B;  2JZ2 A;  4MML A;  1D0Y A;  1QKX A;  1N08 A;  1S72 B;  3M0T A;  2RI2 A;  1F20 A;  3CCQ T;  1VQ4 Q;  5DS0 A;  3UA6 A;  3CCE T;  3REA B;  3CCJ Q;  3EFO A;  3CCR T;  4II2 A;  4M7D D;  3JCM P;  2DXT A;  3DB3 A;  2DTH A;  2DIQ A;  5LJ3 g;  3PIP A;  4YEJ A;  2YUO A;  2XND A;  1I8D A;  1X2Q A;  2CH4 A;  2XGJ A;  1RUW A;  4LBV A;  1XE1 A;  1Y96 B;  4ACB A;  2LRQ A;  4LE9 A;  4PGO A;  3CC2 Q;  3QSU A;  2JS0 A;  1VHO A;  2XZL A;  1VQ5 B;  1SHG A;  4TMZ A;  3LLR A;  2EJ9 A;  2VBT A;  3CCE A;  4NBS A;  3I35 A;  1EFU A;  3GIR A;  2LCS A;  2DRK A;  5IXF A;  3ULR B;  1OPK A;  4CQJ A;  1YJ9 T;  4O5V A;  3M0U A;  3NMZ C;  3J81 E;  3OS1 A;  3ZZU A;  5DLO A;  2DFU A;  1G3W A;  4X34 A;  4AFS C;  4A53 A;  3CTA A;  4E0F A;  3SJP A;  4YAL A;  1OUL A;  3CCL B;  3ONY A;  3WXM B;  3CB4 A;  1VQ8 B;  2XD0 A;  2QTX A;  1H92 A;  3BCD A;  4XN3 A;  1X69 A;  4BUG A;  1UD4 A;  1VF7 A;  1FND A;  1QCF A;  3H0H A;  1K73 C;  1DJ7 B;  3A5Z B;  5GAN 8;  1W0K A;  1PSE A;  1ARK A;  5CQY A;  1QVG S;  2CBX A;  1FRN A;  3U6K A;  1N8R U;  1R5O A;  4AG1 C;  4HCZ A;  5LJ3 d;  2FL7 A;  5FU6 B;  4C92 C;  1Y0Y A;  2QGG A;  3RUX A;  4OB1 B;  4XTW A;  2OI3 A;  5FO0 A;  3MHP A;  4F04 B;  1FNM A;  3CC7 T;  1AHJ B;  3C95 A;  3CME T;  2XHC A;  2KQW A;  3OMG A;  2R5M A;  4OPV A;  2V7X A;  3THK A;  5TV2 A;  1OU8 A;  1VOM A;  1W4S A;  2DL5 A;  3CCL A;  4ASU A;  1K9A A;  1K0S A;  4ZCL A;  4RCB A;  4AF7 A;  2ZXH A;  4F7U F;  4L6V 5;  5GAN g;  1UD6 A;  2BE7 D;  4WCI A;  4PJO C;  3OE7 A;  2LT4 A;  3RIR A;  1UD8 A;  3OW2 S;  2CP7 A;  1E62 A;  1S0U A;  1QWE A;  5IXB A;  1K76 A;  2L8D A;  4RTY A;  3BW1 A;  4DQK A;  4PJO G;  4E2F B;  3G71 B;  2QK0 A;  3SWN B;  1B7T A;  1XOV A;  4J7I A;  2LCL A;  5J39 A;  1OPL A;  1IHM A;  1F60 A;  2PMD A;  2RI5 A;  1E6H A;  5CCA A;  1VQ9 Q;  2WSE E;  5GAN 3;  2F5K A;  3QYH B;  1VQ9 A;  2HKN A;  1ZLM A;  2O01 E;  1BX0 A;  2BMW A;  4M4Z A;  4ROX A;  1ABQ A;  3OS0 A;  3OQ5 A;  2F5T X;  3OOC A;  4C92 E;  2JS2 A;  3WND A;  4B4D A;  3AVY A;  3A8I A;  1G3S A;  2Q6O A;  4ACA A;  3ZZT A;  2XID A;  1UD5 A;  2QQR A;  2FRY A;  3P8D A;  4X8I A;  4KKS A;  2OX7 A;  1VQN B;  3JSC A;  3I55 A;  1BLI A;  4E7I A;  4C8Q D;  3KXT A;  5C6S A;  1YIT B;  1YJ9 Q;  1E3Z A;  1NB0 A;  1NJI R;  2EW3 A;  4Z88 A;  1N9S A;  3VUB A;  1NDH A;  1KZL A;  4P25 A;  3PTA A;  4KUD K;  5KSW B;  1RLP C;  1QCO A;  1FYN A;  3I56 B;  3JQQ A;  4C8Q E;  1JU5 C;  2D74 A;  4Z4S A;  1VYU A;  1YLO A;  2OBR A;  3OZW A;  5I22 A;  1G3Y A;  2RJD A;  3M54 A;  5KYX A;  4LD9 K;  3AVV A;  2C0O A;  4QHY A;  4DNT B;  5CKB A;  1X01 A;  1VYV A;  1JJ2 S;  3URG A;  3C94 A;  3EG2 A;  2C4T A;  1P92 A;  3M0S A;  1SKU B;  1UTI A;  2EQU A;  4JZ3 A;  3VS0 A;  1R0B G;  3H0F A;  3GQB A;  1N8R R;  2QEX T;  4HVW A;  5HK0 A;  4J9F A;  2AT1 B;  1SPK A;  2YDL A;  3VYG A;  4A4H A;  3C4S A;  4TT3 A;  4PC6 A;  1M5Q 1;  5CR2 A;  1XFO A;  4XAX B;  5GAN 7;  2CRV A;  3OYA A;  2V7V A;  2IPO B;  4M78 E;  2JTF A;  4F17 A;  5GAO p;  2DBK A;  4QQD A;  4Q7J B;  2GNC A;  3QFT A;  3MEV A;  1FX7 A;  1KJW A;  2E4H A;  1YWO A;  2YT6 A;  2FZC B;  3Q6R A;  2GK6 A;  1T6Y A;  4ZCI A;  1KC8 D;  2ZBV A;  4XKW A;  1TUC A;  5I2S A;  4M75 C;  1B34 A;  1VQM Q;  2X4W A;  2GTJ A;  1VQ7 Q;  2KRM A;  1P4M A;  2R6H A;  4M2L A;  2KYM A;  4OVA A;  3Q39 A;  1WHG A;  2X3W D;  1MHN A;  2PLF A;  1TS9 A;  1Q86 D;  2VXE A;  1AMO A;  4C43 A;  1VQO Q;  3OYJ A;  3EG3 A;  1UD2 A;  4E7K A;  3J80 E;  1VQO A;  2RB6 A;  1W2B B;  2MMP A;  1VIE A;  5FU6 C;  4C92 B;  3VRZ A;  3CXC B;  4FN5 A;  3PNW C;  4XD7 A;  1MGQ A;  2EWN A;  1QVF A;  1UB4 A;  2XMF A;  3VU3 C;  3PVQ A;  4XLA A;  4Z1M A;  3ZPN A;  3QPH A;  1G2B A;  1W2B P;  1RAE B;  1Q86 U;  5FLX E;  2KI7 A;  1PC0 A;  1I7P A;  4C5H A;  3FJO A;  1HK9 A;  1B34 B;  3M53 A;  1FMV A;  3VUZ A;  3MCA A;  4M53 A;  1RAC B;  3CCS A;  1QVG B;  2K9G A;  2DL8 A;  1I18 A;  2RHI A;  1WXT A;  4IKF A;  2DNU A;  1UGP B;  3W5H A;  2FX3 A;  4QVC A;  4C8Q F;  2E5Q A;  1VQ4 A;  4M7A F;  1SSH A;  4M75 F;  5CVI A;  2EIF A;  2HBP A;  4DEX A;  2DL4 A;  2EQM A;  1BB9 A;  1D3B B;  3CCV A;  3VR6 A;  3OYY A;  3OYE A;  2VYT A;  1Q86 C;  3JCM h;  1M90 R;  1WOR A;  2SEM A;  2OTL Q;  2VBS A;  4M7A E;  3FPP A;  2RK2 A;  2RM4 A;  1JXM A;  1UMK A;  3GVJ A;  1TWB A;  1WX6 A;  3LQ6 A;  3X28 B;  4B9W A;  1Q7Y C;  1M9S A;  1OB0 A;  4JRQ A;  1H3Z A;  2ENM A;  3EHR A;  2VYQ A;  1LJO A;  1GBR A;  4X7D A;  2IG0 A;  1N27 A;  1B2R A;  5A89 A;  2L3P A;  5KE2 A;  4LDY A;  1M8M A;  3CD6 B;  2V31 A;  1UG1 A;  1RAH B;  2HSP A;  2RHY A;  1EXM A;  6AT1 B;  1Z9Q A;  5GAM j;  2XDP A;  2C5H A;  3CC2 B;  2I0N A;  2DTO A;  2Z6B D;  2ECZ A;  4FL6 A;  1BU1 A;  2F1L A;  1G8X A;  4LDV A;  5HK3 A;  4N4I A;  4C8Q A;  3RNJ A;  2EFG A;  2D3N A;  4N4H A;  1PJ5 A;  1WJR A;  4QVZ A;  4AMC A;  5FRO A;  1AD5 A;  3OYI A;  4TMW A;  1X2K A;  3T56 B;  2AZS A;  4J6X A;  4C0D C;  4CC4 B;  3J7A F;  1OHH A;  2BGI A;  4ATO A;  4XQF A;  2E65 A;  2EKH A;  1GJR A;  4M77 C;  1KTV A;  2WPD A;  2FZK B;  2DJZ A;  3FEO A;  2LDM A;  3NPF A;  4CI0 C;  1RQP A;  4Y9R A;  4LN2 A;  2DEU A;  4EMK A;  2CW5 A;  4QT7 A;  1M1F A;  4JPB W;  1JBM A;  3G6E T;  1AEY A;  4Q5W A;  5J26 A;  1ZA2 B;  1G3T A;  1PSF A;  1OI1 A;  5LJ5 g;  4ZGN B;  2JM8 A;  2EQK A;  2VNH A;  4F7U B;  3L2V A;  1YJW Q;  3CCM A;  4Z4T A;  2P4T A;  1UDL A;  3M9Q A;  4DBH A;  4XOT A;  1BI1 A;  3U23 A;  5GV7 A;  2YLC A;  4M78 A;  2KRS A;  5KYW B;  1XJW B;  2QEX A;  4FCY A;  2DER A;  4WQM A;  4J6Y A;  1I07 A;  4XTV A;  2DYI A;  3TEE A;  2RQT A;  2KBT A;  4G1B A;  1WU8 A;  3V8K A;  1PG5 B;  2LCC A;  1YHQ T;  3OB9 A;  2D8H A;  3X20 B;  5GAN e;  4E6R A;  4J9I A;  4X9D A;  4EPC A;  3BY1 A;  3V7R A;  3OYC A;  3EFR A;  1X6G A;  2WSC E;  3JQR A;  3OW7 A;  3CCJ A;  4XTX A;  2VBU A;  1N9R A;  4L8J A;  4M7A A;  4XL9 A;  2ZGW A;  2HKQ B;  1S72 T;  1VLO A;  3GPL A;  2BTT A;  4C0F A;  2K5I A;  4PJO F;  3EH1 A;  1E43 A;  2HD0 A;  2C77 A;  2O4X A;  1K9M D;  2FB7 A;  1TUG B;  1JRI A;  5GMK l;  2JJ2 A;  4C0S A;  2B7C A;  2KXD A;  5HZB A;  2O9V A;  2RC5 A;  4B3X A;  2FYK A;  4AFZ C;  2LNH B;  4M1K A;  2E1H A;  1VQ9 B;  3V7C A;  2E1R A;  2GQI A;  1YIT A;  2OYN A;  3B82 A;  2K3B A;  1OZ3 A;  3M4G A;  2K2V A;  4X1V A;  3M0P A;  3A8K A;  2LJ0 A;  1WJS A;  4M0L A;  5LJ5 f;  2BSA A;  2ZZF A;  5CKH A;  1G5V A;  1LPL A;  1VQ7 B;  3HRS A;  1G7C A;  3CCJ B;  2XG8 D;  4X7C A;  4ZTF A;  2GTO A;  2VGM A;  3H9N A;  1KHI A;  4NCN A;  2OTJ T;  2KVQ G;  5JBQ A;  4ANJ A;  4AG2 C;  3JCM W;  2BPO A;  2CRE A;  4XK8 E;  2GFU A;  2OTL B;  2BZX A;  4OML A;  3QG1 A;  2QAZ A;  4PC1 A;  2Y90 A;  2CKK A;  4FYV B;  2WYR A;  2NLU A;  3CMA A;  2GFA A;  1E6G A;  1UJY A;  4X7F A;  2D9T A;  1Y71 A;  3DB4 A;  4BDZ A;  3S3M A;  3LGL A;  1H8E A;  3MEA A;  3GSI A;  5IYN A;  4J0Q A;  2DIL A;  1N5Z A;  1F1B B;  2WJY A;  4DBR A;  4RDK A;  4QVA A;  3I5S A;  3RDV A;  4OPO A;  2WSS A;  1OB5 A;  3CBO A;  2DVE A;  2DLP A;  1WOP A;  1VQ8 A;  4YTL A;  4ZCM A;  1H8H A;  3ASS A;  2V1Q A;  2KEA A;  1B3Q A;  2FVU A;  3OS5 A;  3ONU A;  2HMA A;  1QGY A;  2JVV A;  1I0C A;  5BSX A;  1QVP A;  1ZSZ A;  1A0N B;  4ZGD B;  1YJN B;  1K0X A;  2DD5 A;  3A8O B;  3SEM A;  1YBY A;  4OOS A;  5D7U A;  4LC0 A;  5J3B A;  3L42 A;  5GAO l;  1QX4 A;  2ZCF B;  2O31 A;  1NPR A;  4J83 A;  1HJD A;  4M77 A;  4P1V A;  4FW1 A;  1KC8 R;  3AVX A;  1U1T A;  3VRY A;  1HD3 A;  1ABO A;  4LXC A;  1M1K U;  5FWB A;  1K28 D;  4CC2 A;  1Q9S A;  3W2F A;  2MF2 A;  3P8H A;  1VQP B;  3WNB A;  2PUK B;  4H9G A;  1BI3 A;  1D1B A;  3RR6 A;  1N6A A;  2XIC A;  3SB2 A;  3PMT A;  1TU0 B;  2P3M A;  4FIB A;  3EGX A;  4NNJ A;  2I2L A;  3WBJ A;  2E6Z A;  4C0Z A;  2JN0 A;  3CPF A;  2WZP P;  1FX0 A;  3BCF A;  3GNG A;  2CK3 A;  4MDX A;  2BM0 A;  1NJI U;  2O2O A;  3QFC A;  3CRZ A;  4X7E A;  1E79 A;  2LX9 A;  3J81 k;  3GVK A;  4PFO A;  1Z9Z A;  2QA4 B;  4E7L A;  5GAN d;  3CCE Q;  2M9U A;  4N4G A;  1K9M C;  3AGP A;  4P22 A;  2X4J A;  5H5J A;  1ZSG A;  4XU3 A;  2KGT A;  1YJ9 A;  4R55 A;  4HE6 A;  1CQX A;  3DLL A;  3G4S T;  3CCV Q;  3OAA A;  4G1V A;  1JB9 A;  3OYK A;  2ZPH B;  2QQS A;  1TTT A;  4X0C A;  3QYG B;  2DXC A;  4II1 A;  2M16 A;  1QVG A;  2GCX A;  2FPD A;  1PKV A;  2P84 A;  4XLE A;  4M7A C;  2NUT B;  2M5S A;  1TLL A;  2KNB B;  4RD0 A;  4J7F A;  1YIJ A;  1WJQ A;  1FNC A;  1VQ4 B;  4DBF A;  3OA6 A;  4P3I A;  1B23 P;  1AZE A;  4RG2 A;  4RTW A;  1QLY A;  2D6F A;  1TXQ A;  3RKW A;  3QKJ A;  3GIB A;  2HBW A;  2EAY A;  1G7T A;  1FMW A;  3QHS A;  3OBW A;  4G5G A;  1MMD A;  2KSS A;  4J6W A;  2Y4X A;  1GRI A;  9ATC B;  1D1C A;  2DKG A;  2C78 A;  3JCM J;  1JNY A;  3I56 Q;  2LJ1 A;  3CCR Q;  1FXX A;  2BUD A;  1KQS S;  4PJO B;  1N8R D;  2L0A A;  2YWE A;  5GAO q;  2CZ7 B;  3QZ9 B;  2WJV A;  2GJP A;  1PD0 A;  2V7Q A;  5E6T A;  2K3Y A;  1WP6 A;  2D8J A;  2MPX C;  3JAM E;  4DQ2 A;  2YUN A;  1EFT A;  1PKS A;  3VS1 A;  1YHQ B;  4GLK A;  1WLP B;  2LQ8 A;  3REB B;  5FRM A;  4TMT A;  5DLQ E;  2JTM A;  1YX2 A;  2BVN A;  2QE7 A;  4RD6 A;  1I5L A;  1UEC A;  3A98 A;  2C5B A;  5GAM e;  5L46 A;  4HCB A;  4DK0 A;  2ZZE A;  5GAN 2;  3CBM A;  2YWG A;  4RG8 A;  4HT8 A;  1VQM T;  4M7D F;  4G7W A;  5DSZ A;  5HZA A;  4M75 A;  1OU9 A;  3CCS T;  1KIK A;  2FG0 A;  3HKS A;  5CKD A;  2P0Q A;  5KNL A;  3BQJ A;  2PTK A;  2J6O A;  1K8A D;  3FKS A;  5D6W A;  1JJ2 A;  2PNI A;  1M3B A;  1KK2 A;  5KYY B;  1VQN Q;  3I5R A;  3G4S Q;  3CCV T;  1UFF A;  4XTZ A;  5DM7 R;  5LJ3 h;  2XEX A;  1RAF B;  1IXD A;  1KD1 C;  3G4S A;  4FYY B;  3OEH A;  1OEB A;  3BY2 A;  1D2E A;  2FZG B;  1DDI A;  1QFY A;  3TVT A;  2X85 A;  1WHM A;  4M75 D;  4M7A D;  4YXW A;  1M1K D;  2QEX Q;  5GMK j;  4BI4 A;  2DPP B;  4C92 D;  3AHU A;  1WGS A;  1O75 A;  2V4D A;  1M1K C;  1RAA B;  2R9V A;  1EFN A;  2Q6L A;  4YAO A;  1XQH A;  3PE0 A;  4OMF B;  2KT1 A;  4GY5 A;  4OF1 A;  1W34 A;  3SJZ A;  2RHX A;  1M3A A;  5GAM f;  3HSB A;  1WNL A;  1V76 A;  5CAI A;  2H3J A;  3QUI A;  2K7A A;  5GAN f;  1VHE A;  3D26 A;  1EIF A;  3BE3 A;  4OP0 A;  2ABL A;  1KMH A;  4F7U G;  1ZM2 A;  2QYZ A;  3FPK A;  2FVG A;  2HL5 C;  4TMV A;  1WZO A;  1NBE B;  1NEB A;  3VS6 A;  4XM3 A;  1KC8 U;  2RA2 A;  2LX7 A;  2F2V A;  2X6Y A;  3MJX A;  1K73 U;  3I1F A;  2AHO A;  2CH4 W;  2WZN A;  1BI2 A;  4JDS A;  2CP6 A;  2CP2 A;  3VO1 A;  4PJO D;  1D8T A;  2LC4 A;  1COW A;  2H3E B;  4RD1 A;  1IZ6 A;  5F4M A;  2NUT A;  3ZBD A;  3B8H A;  4YAF A;  1IGQ A;  1CSK A;  5KYU B;  4GQN A;  1R5B A;  2OJ2 A;  1M90 D;  1WPY A;  2DAQ A;  3CC2 A;  2V7U A;  2OAU A;  1EP1 B;  2AZV A;  3OYG A;  3OS2 A;  1Q81 R;  2E10 A;  3HPW A;  2JOY A;  1Y96 A;  2NWM A;  5L8R E;  1CNE A;  1UD3 A;  2ZTG A;  1I8F A;  4BY6 B;  2FPE A;  2WSF E;  2HQE A;  1YJN Q;  2DMO A;  2RH2 A;  2X4Y A;  3L2Q A;  5GAN 4;  3DLM A;  2A37 A;  2NUP B;  4M7A G;  4M77 B;  3AGQ A;  3RY8 A;  3CCV B;  5TY0 A;  1BIA A;  1OX8 A;  5CK9 A;  3HAG A;  1VQK A;  1CKB A;  1PWT A;  3MCA B;  3BY7 A;  2BZ8 A;  2EKO A;  1MV0 B;  1YIJ Q;  2CZ1 B;  3LGF A;  2W0Z A;  1G83 A;  4U9U A;  1WYX A;  3S6W A;  3TCJ A;  1QW1 A;  4HXJ A;  4F16 A;  2YUQ A;  1VQP Q;  1Q81 C;  1IRX A;  5J35 A;  2AKK A;  4XON A;  3CCU A;  2ZAE A;  5I11 A;  5GAM g;  2BE9 B;  2DK3 A;  4WZL A;  2QTZ A;  4JRP A;  3CBP A;  1IHV A;  1AT1 B;  2L3R A;  5KYY A;  3GNF B;  4JLG A;  2DCU A;  1KQ1 A;  1QFJ A;  4J9G A;  2X9H A;  2BKD N;  4KKU A;  4FYW B;  2L2P A;  1VJS A;  4HVU A;  2DE0 X;  2X8K A;  1PD1 A;  1VQL A;  5IYR A;  5I21 A;  3A8H B;  2PUO B;  3LH5 A;  4RTZ A;  3SFM A;  4YEL A;  1KK3 A;  1T0H A;  2ROL A;  4RKU E;  1QFZ A;  3OYM A;  3I55 B;  2DOG A;  2QAS A;  2ZIT A;  1QVG P;  2RNA A;  1WI7 A;  4PC3 A;  4BB7 A;  1VQL T;  3E19 A;  1K1Z A;  2F2X A;  3MP6 A;  5GAN h;  3OP1 A;  4EIK A;  4QQG A;  3CXC S;  3JCM V;  5CIU A;  5LJ5 e;  5TRD A;  3LW5 E;  2YRV A;  4J9B A;  2OBT A;  2PZ1 A;  5J3O A;  2HLD A;  1NJI D;  1AWJ A;  2JMA A;  3ZUG A;  1ZUU A;  4UAJ A;  1Y0M A;  1I5O B;  4LDW A;  1KK1 A;  3JU4 A;  1M30 A;  1M2V B;  5M9O A;  2K6D A;  3HTR A;  3U2Q A;  4Z8A A;  2RF0 A;  3OW2 B;  4YAW A;  2B8A A;  1VQK T;  1WXU A;  3EGU A;  4OOV A;  4N0A C;  4LBY A;  4C8Q C;  2VNI A;  3QFS A;  1KD1 R;  2DD4 A;  2QA4 T;  2VAS A;  2JIZ A;  1VQ5 A;  2K4Y A;  2RJF A;  5IH2 A;  3M55 A;  4Y28 E;  2PVG B;  3QWY A;  3CMM A;  1IHW A;  2JXB A;  1YIJ T;  2CZ6 B;  3JCM c;  2RQU A;  2D0N A;  3E1S A;  2CF4 A;  1EWY A;  4NL2 A;  3A8M B;  1WPC A;  2GPJ A;  5EMN A;  1SG5 A;  2JM9 A;  3A35 A;  2Q6I A;  2VWF A;  4M77 G;  4B9X A;  2KY9 A;  4RDL A;  3FIF A;  3CD6 Q;  1VQP T;  4ELY C;  2KXC A;  3ASK A;  3QO3 A;  4WF2 A;  1QKW A;  2J05 A;  3MKD A;  2C0I A;  1VQN T;  1ACM B;  2E70 A;  1H64 1;  5FWC A;  4RTT A;  2DL3 A;  4MZP A;  1Q7Y D;  4N0A A;  2LTO A;  5HKC A;  1VQK Q;  1E1R A;  4JRI A;  2EYY A;  2VC8 A;  1AOJ A;  1YJN T;  1S72 A;  4KBM B;  2ZTN A;  1ZM9 A;  1NBM A;  3A3G A;  1NEG A;  4RM0 A;  1N0U A;  3LYI A;  3HRU A;  3RER A;  3GLX A;  4LD6 A;  2DYB A;  4PNO A;  1JA0 A;  1M90 U;  1YI2 T;  2ZXI A;  3M4Y A;  4QVJ A;  2M0Y A;  1Q95 G;  4G6I A;  3W2G A;  5FRN A;  1WDT A;  2VVK A;  3GVL A;  2KRO A;  1T6X A;  1S4M A;  2DRM A;  3G6E A;  2DET A;  4J5Y A;  4BY6 C;  4P2N A;  3EAE A;  2ATC B;  3PT9 A;  1YWP A;  1YJN A;  3G71 T;  2X4X A;  2F69 A;  2JMC A;  5BSY A;  2DTI A;  4UZF A;  1MNE A;  3ZC3 A;  3R6O A;  1EFC A;  2DO3 A;  4A4K A;  3ISX A;  1YI2 A;  1B07 A;  1YJW B;  1E63 A;  3CPW B;  5GMK i;  1IGU A;  1XB2 A;  3ES9 A;  2JT4 A;  5KCO A;  2EYX A;  1M90 C;  1TOV A;  4GBQ A;  1Q86 R;  4B3G A;  3CCR B;  3RKY A;  1BJK A;  2OTL T;  1W70 A;  1BIB A;  1PM3 A;  2DIE A;  1YHQ A;  4ZGE B;  1PJ7 A;  2QDL A;  2X35 A;  1E64 A;  1U3O A;  2RQR A;  1K9M R;  3EGX B;  3F70 A;  3PMI A;  2FRW A;  1IJF A;  1SM4 A;  1OB2 A;  2OTJ B;  1MRZ A;  5KYU A;  2R5A A;  2MWO A;  2EVR A;  1D0Z A;  4OMQ A;  1M8V A;  3CCJ T;  2JTE A;  4X07 A;  4MDW A;  3ME9 A;  2MAM A;  1M2O A;  3QDR B;  2E3H A;  3H0I A;  3QFR A;  4LDX A;  2QXF A;  3DDY A;  4E7S A;  3E1Y E;  2RPN A;  3OSV A;  3OW2 A;  3WVE B;  4Y92 A;  2JNG A;  4FYX B;  2CC2 A;  2X6W A;  1AZG B;  4ME7 A;  2YWW A;  3A3B A;  1WSV A;  1Q81 D;  2MOX A;  4RD4 A;  3G7Z A;  2W6I A;  4WTO B;  2QDY B;  4Z4Y A;  1KJZ A;  2CSQ A;  2CZ0 B;  4PJL A;  3CCS Q;  4M75 G;  2FPF A;  4M77 E;  1VQ8 T;  2CS7 A;  3RES A;  2X3U A;  2QI2 A;  4C5I A;  4FU6 A;  3CD6 A;  3HFO A;  1GFD A;  1M1G A;  5LJ5 d;  1ZBJ A;  3CC2 T;  1VIF A;  1QP2 A;  3OW2 P;  2SRC A;  3E9G A;  1YIJ B;  4E7H A;  5GAO r;  3NFC A;  2MCN A;  4JS4 A;  4RD3 A;  3TSW A;  1I4K 1;  4RJL A;  4XKV A;  1Y07 A;  1ZHI A;  4YHB A;  2O88 A;  3UT1 A;  2DEQ A;  2H8H A;  2CND A;  1K4U S;  5C0M A;  1DG1 G;  3HHT B;  5GAN j;  3ASQ A;  3OKX A;  1U2R A;  1T3L A;  1QUE A;  4AVZ A;  1YJW T;  4IIM A;  1XTD A;  1D3B A;  3QJY A;  1R77 A;  1AWO A;  2BM1 A;  3CCE B;  5IAY A;  2L3S A;  3W2E A;  4R56 A;  3G6E Q;  4EMK B;  4QQ6 A;  4RDJ A;  1V0F A;  2VNJ A;  4RLZ A;  2F2W A;  3VS7 A;  5GV8 A;  1QWF A;  2COY A;  3MP8 A;  4RCZ A;  8AT1 B;  2CYZ B;  3T51 B;  3PIO A;  3CC4 Q;  3SLN A;  2ZPF B;  1UJ0 A;  4O6J A;  3UA7 A;  4ZV4 A;  1N8R C;  1VQL B;  3CCM B;  1X6O A;  1WQ7 A;  2BGJ A;  3UF4 A;  4OMO A;  1T0J A;  2AK5 A;  2P0P A;  4P12 A;  4HE5 A;  2QA4 A;  1H8K A;  2CUD A;  4BI3 A;  2CP3 A;  3EHQ A;  1UGQ B;  4PC7 A;  2LP5 A;  2PVO B;  3KUF A;  4JJD A;  3W5V A;  5FW9 A;  4IIO A;  3A8L B;  3CPX A;  1EX4 A;  5A88 A;  4ZNX A;  3CCU Q;  2RHZ A;  4AC9 A;  4B43 A;  4FSS A;  3EFS A;  4F7U E;  3QDF A;  3CMA Q;  1WIE A;  1VQ6 B;  3OZV A;  1RLQ C;  4L5G A;  2C0T A;  1W6X A;  2JDI A;  3SD4 A;  2RMO A;  2YWH A;  1GL5 A;  5B6I A;  3VNV A;  2EJF A;  2XZP A;  1M1K R;  1W2B S;  4RPB A;  1VQN A;  2E3I A;  1NJI C;  1SSF A;  4M75 E;  1BCM A;  5HXB A;  2R57 A;  2RJC A;  1BQE A;  3OY9 A;  2AHJ B;  1BX1 A;  1QGZ A;  4OB2 B;  1RI0 A;  1GXI E;  3CEY A;  1W87 A;  4A63 B;  3IQL A;  1S1N A;  4M77 F;  1ELO A;  3ZL7 C;  1LCK A;  3VS2 A;  3Q6Q A;  2RJE A;  4P6V F;  2L89 A;  5HKK A;  3CCQ Q;  3ZFJ A;  4TVR A;  4P3Y A;  3O5Z A;  5LJ3 j;  3S3O A;  2LQK A;  3QZ5 B;  2ESW A;  4KKT A;  5KW9 A;  3VV0 A;  2C4U A;  4B44 A;  3HL8 A;  3KEW A;  4X06 A;  4M78 D;  1PJ6 A;  2EPD A;  1J3T A;  3WY9 A;  2CT3 A;  3G71 Q;  2QQB A;  1SEM A;  4LBW A;  2EGC A;  3OYN A; 
#chains in the Genus database with same CATH homology
 2F1L A;  3H9N A;  2DYI A;  2DOG A;  3A1P A;  1PM3 A;  3HTR A;  2QGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...