3A1PA

Structure of ribosome maturation protein rimm and ribosomal protein s19
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
RLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Ribosome maturation protein RimM and Ribosomal protein S19
rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
molecule keywords Ribosome maturation factor rimM
total genus 30
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3a1pA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3a1pA01
2F1LA 3HTRA 2DOGA 3H9NA 3A1PA 1PM3A 2QGGA 2DYIA
chains in the Genus database with same CATH superfamily
1QP3A 2L0AA 1EFUA 5FIUA 1QCNA 2QASA 4RTVA 3LX7A 5FO0A 1G7TA 1VQ4B 2ZL7A 3VO2A 2J06A 4KGXB 3Q39A 1YI2A 1VQ8A 1AT1B 5I2SA 1GFDA 2QMUA 1R77A 2E64A 1WDTA 1ZUUA 2RK1A 2DETA 3GQBA 2M02A 1ABQA 1MMAA 5GAOm 1FYNA 3HAGA 3CBOA 3PGGA 4IURA 2QXFA 3PNWC 3JCMg 1JNYA 1BU1A 1AWOA 1DDGA 4D8DA 3O5ZA 3FJ5A 3OS0A 3CXCP 3CCEQ 3G71A 4LD9K 1WHJA 2E70A 1F60A 2EYYA 3OYBA 5GAN8 1FNDA 2GK7A 1JRIA 2WPDA 1VQ9B 2X9HA 4EDUA 3DDYA 3M54A 3OYFA 1YJNT 1WQ7A 4BD3A 2PVDB 3EG9A 2QDLA 1D8TA 2XKOC 1SRMA 2R9VA 1QVFA 2KBTA 2V1RA 2ZGWA 1M1KC 4PJOF 4LE9A 4QVAA 1TTHB 4F16A 3JCMc 4FW1A 1VQMT 5DY9A 1JJ2B 1WNLA 1BMFA 3JU4A 2D8JA 1ZBJA 2OTJQ 1KG1A 1WX6A 2RJCA 2WZPP 4NBSA 2DL4A 2RHUA 3JCMP 2F4NA 3X26B 4C5HA 1M1KD 1H8KA 2J05A 4M7DF 4OOSA 2JJ1A 4BB7A 1YJNB 4OP0A 3A3GA 1KC8U 1JB9A 1RACB 5GAMg 1EP3B 2CT3A 2QTLA 1PNJA 2P3MA 2ZBVA 1YWPA 1TOVA 1GXIE 3I56T 3RUXA 5IN1A 2HQEA 2LJ3A 2PTKA 3HTRA 3JCMX 2CH4A 2DM1A 2RA2A 4C92E 4P12A 4DA4A 1PJ7A 1YI2B 3S3MA 2Q6LA 4RDKA 4YELA 2F1MA 5GANg 2XMFA 2OTLB 4AF7A 2Y4YA 4NL2A 3G4SB 3V7CA 2V7QA 1AD5A 4HA8A 4KKTA 4M7AC 1N08A 4RG2A 1SHGA 3SHWA 2DXTA 1TLLA 1E63A 3AVVA 4M2LA 3LWHA 5CDFA 3PE0A 4XN3A 1U1TA 4B6MA 2DK3A 3BW1A 1VQ6B 4PFPA 2LCLA 4IUUA 4ORZA 3JCMf 2LDMA 4C8QC 2YT6A 4KGZB 5KYNA 2JN0A 1UTIA 5CQXA 1KTVA 4RD6A 4X07A 4D8KA 2BKDN 3L42A 2O9VA 5IYWA 1IZ6A 4JRQA 3BNWA 1KQ1A 5KYUA 3CC4Q 1YHQQ 2H3EB 1B2RA 4C8QB 3R6JA 2RJDA 5HK0A 1U2RA 5LJ3d 3VS7A 1E3XA 2DZ9A 3VO1A 4M77A 5IAYA 3PVQA 3W2HA 1VQ5Q 4E2FB 4RCBA 2K5IA 3CCVB 2CH4W 3W2GA 1Y96A 2NUZA 3HSBA 3ASRA 4XD7A 3VJPA 2QGFB 4OGEA 1YJ9B 4BPRA 5CAIA 2Y4XA 3H8ZA 4M7DG 2LRQA 4RTYA 5AYFA 4IUTA 3OEHA 2CUDA 2QEXA 4AG2C 2WSFE 1BI0A 4DBFA 1KD1R 1K1ZA 1SEMA 2CBXA 4QV2A 1G7RA 4C92C 2F2XA 3ZZTA 4RM0A 5HZAA 5J3BA 4Y9UA 3SWNC 2BGJA 5KYYA 4WZTA 2M5SA 2XIDA 2YHTA 1KQ2A 5J26A 1ZBXA 4L8JA 3A8KA 2KRMA 4AFQC 2BV3A 4TMVA 3H41A 3CCUT 1E43A 3PIPA 2ABLA 3ZZUA 3G4ST 2M51A 1AIPA 1QFJA 4BE2A 1I8FA 5HZBA 1QVGB 3RKWA 3P26A 4WTOB 1EP2B 1M3AA 5GAN3 2LX9A 3L2VA 4BACA 3QSYA 4OP7A 1QKXA 2RQTA 1KRHA 1V76A 2DRMA 1UMKA 4FYYB 5GAMj 1Q86U 3ISXA 3CC7T 2DTOA 2RQWA 1AWXA 3TREA 3NTIA 2QQAA 4BY6B 1XNIA 1QCOA 3QG1A 3TSWA 4BDZA 4KBMB 1JJ2A 3JSCA 3KL9A 1TWBA 2LX7A 2KEAA 1VQ5B 1MUZA 3AVTA 1BIAA 3MEWA 1RI9A 1KFZA 1CNEA 3VS2A 5KE2A 3CW2A 5CQYA 4EMHA 3UATA 1VQ8T 2Q6OA 1OGIA 1Q9SA 1KK7A 2FHDA 1PSEA 1VQLA 2EPDA 2AZSA 1UGVA 2B8AA 3OS1A 1Q81U 1T5EA 3JCMe 2L3RA 2CP2A 2FO0A 1ZUKA 3AVWA 3U2QA 2GK6A 3BCDA 4G5GA 1KMHA 1YI2T 4UC4A 3ASKA 1OOTA 2FG0A 2CZ7B 4M78D 3QFRA 2BZ8A 4FCYA 3ONYA 2XOKA 1X43A 1V1CA 5F4OA 1X2KA 3VYHB 3A8MB 5GAOq 2GJRA 1KK1A 4DNRB 3QPHA 2JM9A 2QA4T 3B8HA 2D74A 4TT3A 4JJNK 3OYAA 1WPCA 1S4MA 3H0FA 3DLLA 5A8AA 2MWPA 2PNIA 4Q5WA 2DPPB 3DKMA 4MZPA 3QIIA 4DBRA 1VQLT 4DQ2A 2NLUA 2QI2A 3RMSA 1UD3A 1X69A 2EIXA 1ZSZC 2CZ0B 4JJCA 1VQKA 3QFCA 3U6BA 4PK4A 1X75C 6AT1B 2VGMA 2ZZEA 1WJQA 3ZL7C 1OPKA 2DVJA 2C4UA 1N6AA 3EH2A 1YIJB 3RESA 4XAXB 3QBYA 2ZTNA 2C77A 5H5JA 1I07A 2C0TA 3OYKA 1SKYB 4PJLA 2QQRA 5F4JA 2M1HA 2ZTGA 4WZLA 5DLOA 5GAN4 2WYRA 1WOOA 1ZSGA 4UZFA 3M4YA 3JQQA 5CCAA 4FXUA 1NJIR 4A54A 1VQ4A 3CMMA 3CQTA 1Q86C 1XOVA 2EKHA 3G6EA 2R5MA 1WU8A 3CD6Q 2W6JA 5FL7A 4RPBA 4M75G 2QG9B 3P8DA 4Z4UA 4X05A 1KC8D 3WXMA 4C8QG 3UWNA 1VQKT 2EVRA 1G83A 2YSQA 1M5Q1 2VXEA 3M53A 3EHQA 3H94A 3LQ6A 1WTHD 1K0XA 3OW2P 4N3NA 1NZ9A 3EG3A 1TSFA 2X6XA 2AZVA 1UDLA 2CNDA 4HVVA 2K3YA 3FB9A 3MMPA 1QX4A 1BX0A 1E79A 1R5BA 4CC3A 1YCYA 1K8AU 1VJSA 3J81E 3CPWA 1GCPA 1YI2Q 2V7WA 4NNJA 3GLXA 5HKCA 4QVJA 4Z4WA 4JMQA 4XLFA 1G8XA 4XTYA 3CCQT 1TTTA 3W5VA 1X6BA 5FNZA 1Y0MA 1VQOQ 3C95A 2IIMA 4J9CA 1I81A 2LVMA 2YWWA 1K8AR 1JJ2P 2LMJA 2E6NA 2FB7A 4CC2A 1PHTA 2F5KA 1E64A 3EFOA 2EWNA 4JLGA 4JLIA 2FPFA 4TSFA 4KRTA 1M4ZA 1E62A 3M0PA 2KT8A 1YITB 4PFZA 3W2IA 2C0OA 3G6EQ 1O75A 3GBQA 1Y0YA 4ATOA 2MK5A 4RJLA 2O31A 1Q81C 1MV3A 2DRKA 2MIOA 3CPWS 4J6YA 2VNKA 2VBTA 4PAAA 3ZIAA 3S3OA 2YRDA 2JTEA 5HCKA 1Q86D 2MAMA 1NLOC 1XFOA 1S72T 3SJPA 1T0JA 4ZGJB 1WYXA 4AFSC 3M9QA 2J6FA 4ME7A 1Q7YU 1GCQA 2JXBA 4C92F 1Y71A 5CVIA 3L2QA 2HBWA 1PG5B 2RK2A 2DFUA 3P8BB 2QDXA 1Y57A 2GCXA 1JXOA 1M90R 2DL5A 2QGGA 1AEYA 5GAN2 2DCUA 3NTHA 1VQ7A 3PENA 3GF5A 1PSFA 2JW4A 3L2WA 2ZZFA 4J9GA 4D6WA 4P5NA 3QFTA 3BDLA 2KAFA 3H0HA 5GAMh 3FEOA 2RC6A 4II2A 2EGAA 3OP1A 3CPWB 3V7AA 5L23A 4X34A 4PC7A 3CCRB 3LLRA 2K3XA 3OYLA 4N4IA 1KC8R 1I8DA 3EG9B 4B9XA 2JMCA 2OAUA 4OF1A 4IKFA 3NE5B 3OYIA 2A0FB 1KK0A 1KQSB 4BUGA 2JN9A 2MPXC 1SPKA 4RUGA 3JB9F 2DXCA 2C2WA 3CP2A 3QUIA 5D7UA 3OYYA 1YNZA 2ZPGB 3CCUQ 3EAEA 4J6WA 1WJRA 2P0KA 1IHMA 1VQKQ 4ELZC 1JA0A 3OSVA 1S0UA 2RHXA 5A0DA 1M1KU 3ZPNA 1WLPB 3U6KA 2DIQA 3E9GA 4ZV4A 1VQKB 3QDFA 3EG1A 1VQMQ 1DARA 4RTUA 3WBKA 2QQ9A 3GVKA 1KIKA 5FLXE 2VKNA 2EYWA 1WHLA 1RL2A 2C0IA 3GOXA 1T6XA 1NEGA 2GREA 1YCSB 4DQKA 1W6XA 4M77D 4BE1A 2SRCA 4KKUA 4F14A 1XTDA 3CCRQ 4HVUA 4LNPA 4KGVB 3AVUA 3JCMd 1M1GA 1QGZA 3HFOA 3CMEA 1KQSA 4NCNA 4EH1A 2E3HA 3LVBA 4GBQA 3F70A 5FRMA 3LGLA 3ASTA 3OYJA 2X0KA 3CCEA 2Q6KA 4YAUA 2WZNA 4OMMA 1FXXA 1GBRA 3V8KA 3GIBA 3SEJA 4Z4ZA 2GQIA 1N0VC 1QUFA 5KCHA 2YLBA 4ELYC 3ONUA 2OTLA 1W9XA 4BI4A 4G6IA 2KYBA 2YWHA 4CQJA 4P6VF 3BY1A 2WSSA 1QVGS 1T6YA 4E7HA 2DTHA 2LNHB 4OMFB 3FKSA 3OZWA 3EGXB 1YJNA 4LN2A 4WZKA 1MNDA 1PCXA 3NGPA 3OS5A 4FSSA 4C92A 3SLDA 3CBPA 1VQMA 1NPPA 2RJEA 1RLQC 1NJIC 4MDXA 1T6ZA 1Q82R 3CCMB 3EGXA 2HKQB 1VIEA 1WHHA 4AF6A 3CTAA 1FNMA 1GVHA 1MABA 2G3RA 4PJMA 4TMWA 3PTAA 3BC9A 1MNEA 2HBPA 3W5UA 3C94A 2X35A 4BY6C 1P4MA 5KSWB 2COZA 1RAHB 2HDAA 4JRPA 3M59A 1Y07A 1MGQA 4QQGA 3RDVA 1FX7A 2R58A 2RM4A 1D09B 3JCMh 4RMOA 4Y92A 1UECA 1G3YA 4JUVA 1KJZA 1ZHIA 4B47A 3JCMW 1QG0A 3WBJA 4WQMA 4CC4B 4XTWA 4LBVA 2QAZA 5TRDA 4AFZC 3EG0A 1PKSA 3CCQA 3CD6T 2DTIA 2F69A 2JJ2A 1N8RC 2K79A 2IVWA 5KH6A 3C12A 4C92B 3CPFA 2DX1A 3BCFA 1D1CA 2YUQA 4II3A 1M2VA 2HAXA 4X0CA 1G5VA 4TN1A 3MJXA 3CCQQ 2K9GA 1K73R 4J7IA 2Z0WA 1D1AA 4X9DA 2X4XA 2PMDA 3UF4A 2ZBUA 2HCJB 3FPPA 1XJWB 4EPCA 4A4HA 2BN4A 3ZUGA 2JIZA 1YIJT 2EJGA 2DYBA 1VQ9A 4M78C 1RLPC 2VASA 3EFSA 4A4EA 1BI3A 1R0CB 1RUWA 3ZBDA 3JB9I 2FX3A 3UA7A 4M4SA 2DEUA 1ELOA 4LDYA 1NJID 5CK9A 2DL8A 1IO6A 4P3IA 1RADB 5HY6A 1U06A 3MKDA 2JDIA 4DNTB 3RERA 3X25B 1OI1A 3E1SA 2CYZB 4P9SA 1VUBA 2PLFA 5IXFA 5IYPA 5KW9A 2ZPBB 2ZCFB 4DBHA 2QTZA 2QQSA 2KE9A 4E47A 1YX2A 1NRKA 2RHIA 3UPUA 2XDPA 3WXMB 4O6JA 2RMOA 2HL3A 3CXCS 3I55B 4U9UA 3CCSA 4FM4B 3P27A 4HE6A 2DLPA 1ZSZA 1QGYA 2EJFA 3ASQA 1YIJA 2RB6A 1VF7A 5IYRA 2OTLT 2O01E 5DLQE 3REBB 4M7DE 4B4DA 1BIBA 4HT9A 3VRYA 3H0IA 3SWNA 3RR6A 1E6HA 1FRNA 2RPNA 4L5GA 3L2RA 1ZA1B 4XK8E 3CCQB 2XDDA 1BI2A 2L3SA 1M2VB 1SF9A 2LC4A 3G4SA 2LQ8A 1TUCA 3ZC3A 3QZ5B 1G7CA 1QWFA 2F2VA 1FMWA 1YHQT 4WF2A 2RHYA 2C5HA 1LVKA 1M2OA 2A3LA 1VQOB 3A8HB 4FT2A 3PIOA 4PLIA 3RKYA 2KRNA 4P26A 2J6OA 4G1BA 2KYMA 2K57A 2XZOA 2OI3A 1BQEA 4Z4YA 2BE9B 2H3JA 2D3LA 2CP6A 1GAQA 2RNAA 4J0QA 3OYDA 2KY9A 5CO7A 2L89A 1H3HA 2MYSA 2BM0A 3I5RA 1OB0A 3OMGA 1GRIA 1QFYA 2DL3A 2AT1B 3L2UA 1YN8A 4QW2A 3HRSA 4PJJA 2V7VA 2XGJA 5GANj 1JA1A 1WZOA 1WGSA 1YJWA 4XOTA 1WOSA 2XZLA 4EMKB 3QHSA 4JS4A 4RTZA 3QYHB 1M3BA 1W70A 4E7JA 3QSUA 2DEQA 1JBMA 4JS5A 1Q81R 4OPOA 1Q82U 4B48A 2ENMA 4XTZA 4DOWA 1HJDA 5GANd 2XICA 5EC7A 4PJNA 5H59A 1M1FA 2GQFA 2HLDA 2NUTB 2VNJA 1UD5A 4M1KA 3UDCA 3A8IA 4M7DC 3SD4A 1ZM4A 3CXCB 5GMKj 3I1FA 1GFCA 2EYZA 2QYZA 2DBMA 2PUKB 1TG0A 4ZN3A 1SSHA 3VS4A 3CCUA 4C92G 4JZ3A 1B7TA 5IYQA 1ZLMA 3ASPA 3SJZA 2KGTA 4OOXA 2DE0X 1TUDA 1MRZA 1T3LA 4M77B 8AT1B 1M90U 4DBQA 1UJYA 1YWOA 2GTJA 5GMKl 3BFMA 3CB4A 3A35A 2QE7A 2KRSA 1UD4A 1OQKA 1AMOA 2XNJA 2OAWA 1IRXA 4FW2A 5KE3A 1AZEA 2GFUA 4PC6A 5CKFA 5CKEA 2OK8A 1ZUNB 2CRVA 4HXJA 1D3BB 2CKKA 4HIZA 3NPFA 3A8GB 4LXCA 2CS7A 1WORA 4YTLA 3CMAT 1KSWA 4P22A 3PA2A 2JZ2A 4UZEA 1BI1A 3S6WA 3Q3AA 3JB9H 4P2NA 2RN8A 1V29B 3J81k 5LJ3j 3CC7B 4HCKA 3UA6A 2LQNA 5A0GA 3CPWP 1VQLQ 1FDRA 3ULRB 1UEBA 1OYXA 2WSEE 1QW1A 4AT1B 3CC4T 2DZCA 3OFNA 5GANe 3CCRA 3G05A 3D7SB 2OTLQ 2BMWA 2D6FA 1W35A 2RI3A 3QE2A 3BY7A 1JO8A 2R5AA 2C78A 2D9TA 4X06A 3EHRA 1PD0A 1CKAA 1MMNA 1LOJA 5FU7B 1N05A 1M30A 4FIBA 4A4KA 2X6WA 1NB0A 3OJXA 4XR6A 5J39A 1K9MU 2GF7A 2HCKA 1MMGA 5GAN6 4F7UG 1T3SA 3GSIA 4RKUE 3CC7Q 2CW5A 4XLHA 5ECAA 2Z6BD 1QQJA 3S3NA 2RD1A 2CGHA 4RTWA 3PUNA 2KT1A 5BSYA 2J7IA 3OMCA 1M1KR 2NUPB 2L2PA 4IUPA 2F43A 2QA4B 4M77G 1BKBA 4M7DB 1XE1A 1WP6A 2EYXA 4DOVA 2V26A 3A5ZB 4RD1A 2E3IA 1KD1D 4XTXA 1WJSA 5GAMd 2VYQA 1WHGA 4M78F 5CKDA 1JEGA 4B3FX 4XU2A 1DDIA 1S72A 1V5VA 1WSRA 2KXCA 3CMEQ 1RI0A 3RIRA 2YRVA 4XONA 1EFRA 1KJWA 4PC1A 2O2OA 1K4US 2EQMA 5EG2A 4ANJA 3A98A 1HXDA 1I0CA 1TXQA 2KK4A 2MMPA 4C0GA 3CPXA 4E0FA 3CC2B 1FWZA 1SM4A 2NPFA 4F04B 3MCAA 2R6HA 1FX0A 3RMQA 3JB9D 3NTKA 3VKIA 4FL6A 4QVDA 3ZBUA 4FSXA 1QWEA 1ARKA 1GL5A 3AHUA 1SG5A 1VQ8Q 3MP6A 2B5OA 4KT0E 4PJOB 2VUBA 4NL3A 2VNIA 4BI8B 3M5AA 5IH2A 2V7XA 3GIRA 5LJ3h 2IG0A 1NG2A 2FZGB 1VQNA 5E6TA 1D2EA 3FDRA 3WNDA 1YLOA 1K76A 4PJOG 1QVGA 3CMEB 1Q7YR 4MMLA 2E41A 2X4JA 1R5NA 2EFGA 2ZXHA 4RCYA 2LJ0A 2WJYA 2DXBA 2VBVA 2B7CA 4XTUA 3VR6A 3RBBB 5FU7C 5LJ3g 1W2BP 1N8RR 3QYGB 1VQOA 1VQNQ 4Z4RA 1Q86R 1UD2A 1IHWA 4M4ZA 4P6YA 4XLAA 4XQFA 2QTXA 2X3XD 5IHIA 2JS0A 1B34A 2B86A 2WJVA 2E6ZA 3CD6B 3META 2QEXQ 5DM7R 3HFNA 5HK3A 3CC4A 1R5OA 3EG2A 1QGAA 1WXUA 1VQ6T 4OPVA 2SEMA 1KD1C 2V8KA 4JRKA 5FU6B 1UD6A 2AK5A 2RO0A 2R57A 1KK3A 1UGPB 5GAOr 2EAYA 2KR3A 3OZVA 3WVDB 2RHZA 3OA6A 3VS0A 5M9OA 1B34B 4PJOA 2COYA 3JAME 5F4MA 4RD3A 2YUPA 3FLGA 2BGIA 1ZM2A 3JB9J 2DILA 1IB0A 2BUDA 2AKKA 2DNUA 5GMKh 2DIEA 4M7AB 4Y7CA 3SDZA 4N4GA 3Q38A 3OB9A 1JQQA 3QWXX 5B6IA 1WDXA 1VQPT 4XORA 4ZTFA 4KKSA 4DQLA 1OZ2A 2M0OA 3CCVT 3C4SA 1VQ6Q 2J6KA 2G6FX 1NDHA 3SFMA 2QN6A 2VVKA 4OMPA 2FPEA 4PC3A 2CC2A 2B7BA 3L2ZA 5GAOn 1ZQ1A 4OMLA 2DO3A 3GVLA 3CMAB 4J9IA 3CRZA 4EMGA 4PFOA 4N0AA 3FIFA 5CKHA 2C4TA 5IT9E 2MOXA 1W4SA 4XU3A 3VU3C 3G4SQ 3OJWA 4ACBA 3J80E 1K73C 4RD4A 4R0KA 5GANh 1TVCA 2H8HA 2LTOA 1BBZA 1K9AA 1IGUA 2DAQA 2JMAA 3AGQA 3LYIA 3JB9G 4JPBW 3CC2A 2O4XB 4QVZA 3VS6A 3CP8A 3PMTA 2VJJA 3TVTA 2LT1A 4RCCA 3I56A 4ZGQB 1VQ5A 5GMKm 4XOPA 4C0SA 1VOMA 1CSKA 4X7CA 2VV5A 5TR9A 3CC2Q 3E9FA 1WXTA 1VQPA 4RDLA 3VNVA 1PC0A 2LCCA 5LJ3f 2QTVA 1X2QA 4Z88A 1LJOA 3CCRT 2W6IA 4QQDA 1OX9A 1H8HA 4PJOE 1XQHA 3V76A 3C0CA 3HHTB 4M78A 2JOYA 3CCMA 2V8JA 1PKTA 3A8JA 5KYWA 1K73D 4G1VA 4X1VA 2X8KA 4KH0B 3JQPA 4Y91A 3QJYA 1SKQA 1UE9A 3GPLA 2VBUA 1E7OA 1KD1U 4K11A 5GMKi 4ZCMA 3G6ET 2BM1A 4YEJA 1RQPA 3OE7A 3GP8A 1VQ4T 4E6RA 4E7KA 4TVRA 2XK0A 1R0BG 3BE3A 3TU4K 4XLEA 3CCEB 3MEUA 3E20A 1QKWA 1WI7A 2HDNB 2EW3A 4FU6A 3B78A 1H42A 3DB4A 2D8HA 2MI6A 4HVWA 1PM3A 5L46A 4FN5A 3CCMT 1XQBA 2CSQA 4RPDA 1Q7YD 1I1JA 1W34A 3WY9A 5D6WA 4AVZA 4Y9RA 1AWWA 1WXBA 2F5TX 1E3ZA 3QDRB 1GJRA 4B9WA 2P0QA 4OB1B 1VQ9T 1N9RA 2XNCA 1VQ4Q 5D6XA 2E4HA 4J9FA 1WHKA 5GJWB 4LUDA 2X3WD 2LCSA 1MHNA 2A36A 3SKBA 5FROA 2OBRA 2NYSA 3HP9A 3R6OA 3HRUA 1N9SA 3CCJA 4G7XA 2MF2A 4N4HA 4OOVA 2L3PA 3CCMQ 1GBQA 5KCOA 3CCSQ 3FJOA 4B3XA 4PJOC 4J6XA 3LO8A 2RQUA 1HVXA 3OW2A 5LJ5e 3OPOA 1VQPQ 1Z9ZA 2V8IA 1B3QA 1V0FA 1BX1A 5IHKA 4YAFA 1IXDA 2X4WA 3JCMV 2XD0A 5I2MA 1H85A 5GAMe 4OB0B 2EBPA 1FMKA 1EIFA 3OW2B 3VS5A 1QH0A 2K5FA 3ASSA 2LT4A 2L3QA 3VUBA 4LDWA 1PD1A 3VMFA 2DY1A 2XU8A 4L6V5 2P84A 4PKCC 3CCLQ 4FYWB 3RY8A 4J5YA 4LC0A 1N07A 4BE0A 2PU9B 4A53A 5AN9A 2VBSA 2WACA 1YIJQ 4RCZA 4IUQA 4FWTA 4XMYA 1RQRA 1W2BB 1WSVA 2K3BA 2V7TA 1HSQA 3O8VA 2RQRA 5CIUA 1EXMA 1B07A 4G7WA 3MHXA 5IHNA 1AZGB 4LD6A 3B82A 3PT9A 1VQ6A 1PKVA 4HT8A 5HXBA 4F7UF 1SHFA 3WNBA 1VQOT 5GV7A 3QO3A 3CXCA 4Q7JB 1U1SA 2P0PA 1K9MC 1M8MA 1P92A 1HK9A 3KUFA 3V8JA 1ZM3A 2YDLA 4N3GA 2ZXIA 1I7PA 3DLMA 3V7RA 1S1NA 2M0YA 3MEVA 5LJ5g 2ROTA 5DSZA 3J7AF 4M7DA 2BF4A 5LJ5h 2NUPA 3BDUA 4K1XA 2MCNA 3R6KA 4LDXA 4R71A 2DL7A 4MZMA 5C0MA 5FWBA 1QVFB 2AIRB 1YJWQ 4X7EA 5FWCA 1H92A 4C92D 1NJIU 5A89A 1T0HA 1M90D 1WOPA 4M75D 3EH1A 3FC3A 2ZZDA 1D1BA 5LJ5d 3HPWA 4BDYA 4C0DB 1M3CA 1MV0B 3G71B 3I56B 2CSIA 2E1RA 4XKWA 4M75B 3T9NA 1S72Q 5HKKA 4F17A 1C0MA 2KROA 3CCST 1YITQ 4CRIA 1LCKA 2EGEA 4IIOA 4M7DD 3M58A 4OMNA 4R56A 3WQZA 5LJ5j 2ZPIB 1MMDA 1ACMB 1JXMA 1BCMA 1JB0E 3INZA 2JJ9A 3CESA 3JV3A 2CP7A 2XG8D 4A63B 2VXFA 1YP5A 2OX7A 1VQ8B 4J83A 1YFNA 3I9QA 2BTTA 1VQ7Q 2NV4A 1OZ3A 2FVUA 4RTTA 5THXA 1K8AC 4GY5A 1V0EA 3G71T 5GJVB 3CCLT 3G1JA 1W2BA 1BYMA 2GJKA 4QHYA 4M78G 2V1QA 2W0ZA 3OYNA 1AVZC 3I5SA 3SEMA 2JM8A 4C8QE 2K2VA 2EQIA 5KYYB 2CZ6B 1WHMA 2PUOB 2YRCA 2OTJA 2LQKA 2DERA 5IYNA 3N5BB 5CR2A 3T56B 1OEBA 4R55A 3GVJA 2OK7A 3MHPA 5LMZA 2JVVA 2GNCA 3SWNB 4KH1B 2E5KA 3M4GA 1QVFS 2QEXB 4C8QD 1VQ7T 3OZUA 2OTJB 2PIAA 3ES9A 3MP8A 4ESRA 4Y28E 3OEEA 5IXBA 4QUZA 2EYQA 2VYTA 1TU0B 2ED1A 2FZCB 2KNBB 1EFTA 4L59A 2EQUA 1W87A 4F7DA 1BB9A 1OU9A 3VV0A 1K28D 4LBZA 4PNOA 2EGCA 4OB2B 3JCMJ 4VUBA 1BCOA 1K73U 4Z4TA 1OU8A 4F7UA 2W10A 2BIVA 2XHCA 3CCVQ 3CCJQ 4PC2A 1X6OA 2X53S 4ZN1A 1KHIA 2YXYA 3IQLA 4RLZA 3QWYA 1EWYA 2LZ6B 2CP0A 1X27A 2BZYA 1U5SA 1J3TA 1N27A 4PLLA 2PQWA 4TMTA 1G3TA 4YAOA 3PUMA 3CC4B 2OJ2A 3GNGA 1UUEA 3Q6QA 4OB3B 2E1HA 1NPRA 2CP3A 1EX4A 4QKUA 2DD4A 4C0ZA 1A0NB 1YITT 1K8AD 2E10A 2YWFA 5FA6A 1IJFA 4C0DC 2QDYB 4C0FA 4M77E 3RKXA 4JJDA 4B3GA 2LZJA 3ER0A 5FW9A 1OGJA 3BQJA 1KHCA 2K5LA 2DF6A 4HKEA 1PRMC 1RAFB 3U23A 4BI3A 2C06A 1M8VA 3OAAA 4C5EA 3CC2T 3M0TA 1NBMA 3X20B 3A8OB 1VIFA 3RNJA 1TH7A 3JCMb 1FNCA 1XB2A 2EFIA 4XNFA 1S72B 3FRNA 1N06A 4AC9A 2RC5A 1UG1A 4M78B 3M0UA 3G71Q 1U3OA 3LQEA 1VQMB 3THKA 4IIMA 2ROLA 2CK3A 4AG1C 2MWOA 3OYGA 4UAJA 5KYXA 4OVAA 2CZ1B 2QA4Q 1H8EA 2DJZA 3EGDB 3EFRA 1VQPB 3MCAB 3I35A 1KZLA 4OMOA 1G3SA 2F2WA 4P25A 2ECZA 1IHVA 3VS3A 3V7SA 4EMKA 4XU1A 3I55T 5KNLA 1UJ0A 2FEIA 3QZ9B 1CKBA 1W1FA 2LP5A 4A4GA 2ZPEB 1RAGB 1UFFA 1NEBA 2D3NA 1FMVA 3ZEHA 4C5GA 3Q6RA 2IPOB 2YLCA 1TS9A 1F1BB 1UB4A 5KYWB 1LPLA 4OMQA 1YJ9T 4RDJA 1WFWA 4XN0A 2LJ1A 4P3YA 3EGUA 2CF4A 1BPLA 2XDBA 2HZYA 3AVXA 1IGQA 4XU0A 1RAAB 2ZL5A 3A8LB 2FPDA 1BLIA 4AFUC 5J35A 4KUIA 1Q82C 1QMCA 4CI0C 1OB5A 3OW7A 1D0XA 4QVCA 2PZ1A 1VLOA 2RH2A 4TMZA 2RI5A 4QT7A 2EKOA 4ROXA 2KI7A 1VQ9Q 2QQBA 1HZEA 3OYCA 2BPOA 2HQXA 2RQVA 3W2FA 4PL6A 1Z9QA 3VRZA 4E7ZA 3I55A 3CC7A 1RABB 4DEYA 3ZBTA 4GLMA 3SB2A 4F7UE 4B44A 1WQWA 2CT4A 4E7SA 4LDUA 2COWA 2E5QA 2XZPA 1SKUB 1Q81D 4Z8AA 3FPKA 3M56A 9ATCB 3MP1A 4FYVB 2JTFA 5I21A 2PE3A 3LH5A 1FNBA 1VLYA 3SLNA 2E65A 2X51A 3BY2A 3R6NA 1RAEB 2O9SA 3MO8A 2BE7D 2KSSA 4JDSA 1H641 3AT1B 2VC8A 4PJOD 1N8RU 3OS2A 1YJ9A 1N0UA 3LWIA 4J7FA 5I22A 4M7AF 3CCET 1GAWA 1KQSS 2VWFA 1CNFA 4KUDK 4ZGEB 2A28A 2VJIA 4C43A 2X4YA 4DK1A 3TCJA 4X9CA 4M7AA 1W0KA 4ZCLA 4EIKA 2I1LA 3PMIA 1TUIA 2KDSA 1QUEA 3HKSA 5DS0A 1JU5C 4C8QF 1GR1A 4ZGDB 2Q6IA 1N8RD 3MEAA 4YALA 2M16A 7AT1B 2O88A 2I2LA 1BJKA 4CC7A 1ZM9A 3TEEA 1I5OB 3JRZA 3AGPA 4J9DA 1K9MD 4RG8A 4PABA 4MYUA 3JCMQ 5FRNA 2OTJT 5JBQA 2LNVA 1VQ7B 5CKBA 4II1A 3CCVA 1YJWT 4ASUA 4X7DA 1UD8A 2EQJA 3ME9A 1Q82D 3AVYA 2A08A 1IJEA 2X3UA 1ZUYA 2C5BA 5GV8A 3WYAA 1NB9A 1YBYA 3ZZ0A 4Z02A 4Z4VA 2HL5C 3CMAQ 2K7AA 4FYXB 2XI9A 2QK0A 1H3ZA 3D26A 1COWA 2VB6A 2CUBA 3I56Q 4M75C 2K4YA 1QVGP 4P1VA 3KEWA 4M53A 3LW5E 3JQRA 3LNNA 3OBWA 4E7IA 1NYFA 2RI2A 1JJ2S 4LDVA 5TV2A 4XL9A 2D0QB 1YJWB 3I55Q 1M27C 4H9GA 1WPYA 3WVEB 2DA9A 5I11A 3VS1A 1YJ9Q 3VUZA 3OQ5A 2HSPA 5A2QE 4E7LA 1VQLB 1VQNT 2GFAA 2PVGB 1C1AA 5GANf 4X7FA 1YJNQ 1HA3A 1RAIB 1M90C 1X01A 2DKGA 1YHQA 4B43A 2ED0A 4OGCA 4ZTJA 1QCFA 5A88A 2KVOA 5BSXA 1VYUA 1W2BS 2D1XA 4UZUA 4AMCA 1UGSB 2DYIA 2L8DA 2QA4A 3M0QA 1UGQB 3X28B 2F1LA 2ATCB 2LQWA 4ZCIA 1VYTA 2L5QA 4OPSA 1K0SA 3G7ZA 4HCBA 3LGFA 1SSFA 1OULA 4WZEA 4JJBA 2HQHA 4YXWA 1WIEA 2JS2A 2P4TA 2FYKA 3ZFJA 4PGOA 4RD0A 2Y90A 1YITA 2HD0A 3M0RA 1N5ZA 1D1NA 2JNGA 1TUGB 3A3BA 4QQ6A 2HNIA 3CMAA 2CP5A 3EFOB 1QLYA 3NFCA 3OYHA 1WA7A 4DEXA 4QFMA 4XQ3A 3X24B 2J7KA 3CCLB 3L1AA 3E1YE 5GAN7 3T51B 1EP1B 1J9ZA 2ZZGA 2HSEB 4M77F 1BK2A 2DJQA 1G2BA 3DB3A 5LJ5f 2OBSA 2ZPFB 2I0NA 3M0SA 2YUOA 2M9UA 2AHJB 1VYVA 1VHEA 3E2UA 4NOYA 3VYGA 5GAN5 2RJFA 1AWJA 1W0JA 2ZPHB 4HCZA 1PJ5A 1GCQC 1PRLC 1LNXA 3HRTA 4C8QA 2DVEA 1ZSZB 1B23P 2OBTA 2KXDA 2FZKB 1HD3A 3CCSB 2ZL6A 2D0NA 4MYTA 2HKNA 2DBKA 3LH0A 1CQXA 1SRLA 2JT4A 3CCJT 2VZLA 4DK0A 1G7SA 3QFSA 5A0LA 4X8IA 4Z4SA 4IW3B 3A1PA 1GO2A 4XTVA 4M75E 4N0AC 3OYMA 5AT1B 4M77C 1G3WA 1IB8A 1OV3A 1Q95G 3FJPA 5GMKe 2CREA 2GQVA 5GAOp 2X85A 2KVQG 1ZX6A 1VA7A 2EJ9A 3OYEA 1UGRB 3OY9A 1Q7YC 3CD6A 2OYNA 3G6EB 2BSAA 2EIFA 2FRWA 2DMOA 2X6YA 2A37A 3OW2S 4J8OA 4GLKA 4TKOB 2GGRA 2GTOA 4JZ4A 2FL7A 4M7AD 3T53B 4ZGNB 3VNUA 5KYUB 1DJ7B 2ZITA 3W5HA 5DN6A 3QKJA 4RTXA 4J9EA 3KXTA 1QFZA 2BZXA 4A4FA 4FK8A 2EQKA 3REAB 5GAOl 1ABOA 2QEXT 1Y0RA 2GPJA 3M57A 2XEXA 4KULA 3CCLA 4M7AE 4M75A 2GBQA 2CDTA 3PVLA 2YWEA 4WCIA 2V7UA 3OOCA 2NUTA 2ESWA 3H6ZA 3MPUB 4MMKA 1O9SA 3Q1JA 1VHOA 4WWVA 4IUVA 4GQNA 5TY0A 5LJ3e 1OB2A 3KBGA 2HMAA 2VGNA 1UHFA 3KFVA 2D9RA 1UHCA 1QP2A 2JTMA 2AHOA 2RF0A 5IK2A 2PVOB 1QVFP 4M0LA 4M75F 1X6GA 4V2SA 1EZZB 1YHQB 2FVGA 1VQ5T 3V8LA 2YWGA 5LL6S 3OBYA 2K6DA 1KK2A 1I18A 3BH4A 4M7AG 4HE5A 1A8PA 5J3OA 1OPLA 1Y7XA 2WR8A 1FRQA 4FT4A 2WSCE 3HL8A 1NM7A 4LBWA 1PJ6A 4Z89A 2KQWA 5EMNA 1DG1G 3CMET 4J9HA 4C5IA 4J9BA 1R8OB 4ZNXA 1C6VX 1E6GA 2AKLA 2BVNA 4ACAA 3EGDA 2E1BA 1NLPC 5KYXB 2ZAEA 2O4XA 3W2EA 1HYOA 4MDWA 2E12A 4RD2A 3GNFB 1NE8A 2K2MA 3CBMA 1EFNA 1NBEB 4YHBA 3P8HA 3PFSA 1E1QA 5L8RE 1K9MR 4XM3A 2ZZQA 5D6YA 4LUEA 2YUNA 1OX8A 2XNDA 3PVDA 4LBYA 1D3BA 4EMKC 1NYGA 4TMXA 5C6SA 1M9SA 1D0ZA 4M78E 2V4DA 1I4K1 2FRYA 3TQ7P 5FU6C 1I5LA 1U8RA 2GJPA 3CCJB 3H9NA 1EFCA 4NS5A 2P4RA 2DIGA 4F7UB 4YAWA 4O5VA 2KMTA 3TSZA 1AOJA 1KQSP 1IREB 2V31A 3WNCA 3NMZC 1ZA2B 4HCCA 3OSSC 3QJ6A 4XLCA 4XKVA 1AHJB 3M55A 5FO1A 8ATCB 3E19A 2DXUA 3CCUB 5GAMf 3OKXA 3URGA 2A7YA 2NWMA 2JUFA 1OHHA 1F20A 1D0YA 3UT1A 1E1RA 2DOGA 4Z1MA 1VQNB 4JRIA 3CEYA 2HEQA 4MZTA 3NHNA 2VNHA 3QXEB 1QVPA 1Y96B 1KC8C 2DD5A 1PWTA 3PA1A
chains in the Genus database with same CATH topology
2F1LA 3HTRA 2DOGA 3H9NA 3A1PA 1PM3A 2QGGA 2DYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1L A;  3HTR A;  2DOG A;  3H9N A;  3A1P A;  1PM3 A;  2QGG A;  2DYI A; 
#chains in the Genus database with same CATH topology
 1QP3 A;  2L0A A;  1EFU A;  5FIU A;  1QCN A;  2QAS A;  4RTV A;  3LX7 A;  5FO0 A;  1G7T A;  1VQ4 B;  2ZL7 A;  3VO2 A;  2J06 A;  4KGX B;  3Q39 A;  1YI2 A;  1VQ8 A;  1AT1 B;  5I2S A;  1GFD A;  2QMU A;  1R77 A;  2E64 A;  1WDT A;  1ZUU A;  2RK1 A;  2DET A;  3GQB A;  2M02 A;  1ABQ A;  1MMA A;  5GAO m;  1FYN A;  3HAG A;  3CBO A;  3PGG A;  4IUR A;  2QXF A;  3PNW C;  3JCM g;  1JNY A;  1BU1 A;  1AWO A;  1DDG A;  4D8D A;  3O5Z A;  3FJ5 A;  3OS0 A;  3CXC P;  3CCE Q;  3G71 A;  4LD9 K;  1WHJ A;  2E70 A;  1F60 A;  2EYY A;  3OYB A;  5GAN 8;  1FND A;  2GK7 A;  1JRI A;  2WPD A;  1VQ9 B;  2X9H A;  4EDU A;  3DDY A;  3M54 A;  3OYF A;  1YJN T;  1WQ7 A;  4BD3 A;  2PVD B;  3EG9 A;  2QDL A;  1D8T A;  2XKO C;  1SRM A;  2R9V A;  1QVF A;  2KBT A;  2V1R A;  2ZGW A;  1M1K C;  4PJO F;  4LE9 A;  4QVA A;  1TTH B;  4F16 A;  3JCM c;  4FW1 A;  1VQM T;  5DY9 A;  1JJ2 B;  1WNL A;  1BMF A;  3JU4 A;  2D8J A;  1ZBJ A;  2OTJ Q;  1KG1 A;  1WX6 A;  2RJC A;  2WZP P;  4NBS A;  2DL4 A;  2RHU A;  3JCM P;  2F4N A;  3X26 B;  4C5H A;  1M1K D;  1H8K A;  2J05 A;  4M7D F;  4OOS A;  2JJ1 A;  4BB7 A;  1YJN B;  4OP0 A;  3A3G A;  1KC8 U;  1JB9 A;  1RAC B;  5GAM g;  1EP3 B;  2CT3 A;  2QTL A;  1PNJ A;  2P3M A;  2ZBV A;  1YWP A;  1TOV A;  1GXI E;  3I56 T;  3RUX A;  5IN1 A;  2HQE A;  2LJ3 A;  2PTK A;  3HTR A;  3JCM X;  2CH4 A;  2DM1 A;  2RA2 A;  4C92 E;  4P12 A;  4DA4 A;  1PJ7 A;  1YI2 B;  3S3M A;  2Q6L A;  4RDK A;  4YEL A;  2F1M A;  5GAN g;  2XMF A;  2OTL B;  4AF7 A;  2Y4Y A;  4NL2 A;  3G4S B;  3V7C A;  2V7Q A;  1AD5 A;  4HA8 A;  4KKT A;  4M7A C;  1N08 A;  4RG2 A;  1SHG A;  3SHW A;  2DXT A;  1TLL A;  1E63 A;  3AVV A;  4M2L A;  3LWH A;  5CDF A;  3PE0 A;  4XN3 A;  1U1T A;  4B6M A;  2DK3 A;  3BW1 A;  1VQ6 B;  4PFP A;  2LCL A;  4IUU A;  4ORZ A;  3JCM f;  2LDM A;  4C8Q C;  2YT6 A;  4KGZ B;  5KYN A;  2JN0 A;  1UTI A;  5CQX A;  1KTV A;  4RD6 A;  4X07 A;  4D8K A;  2BKD N;  3L42 A;  2O9V A;  5IYW A;  1IZ6 A;  4JRQ A;  3BNW A;  1KQ1 A;  5KYU A;  3CC4 Q;  1YHQ Q;  2H3E B;  1B2R A;  4C8Q B;  3R6J A;  2RJD A;  5HK0 A;  1U2R A;  5LJ3 d;  3VS7 A;  1E3X A;  2DZ9 A;  3VO1 A;  4M77 A;  5IAY A;  3PVQ A;  3W2H A;  1VQ5 Q;  4E2F B;  4RCB A;  2K5I A;  3CCV B;  2CH4 W;  3W2G A;  1Y96 A;  2NUZ A;  3HSB A;  3ASR A;  4XD7 A;  3VJP A;  2QGF B;  4OGE A;  1YJ9 B;  4BPR A;  5CAI A;  2Y4X A;  3H8Z A;  4M7D G;  2LRQ A;  4RTY A;  5AYF A;  4IUT A;  3OEH A;  2CUD A;  2QEX A;  4AG2 C;  2WSF E;  1BI0 A;  4DBF A;  1KD1 R;  1K1Z A;  1SEM A;  2CBX A;  4QV2 A;  1G7R A;  4C92 C;  2F2X A;  3ZZT A;  4RM0 A;  5HZA A;  5J3B A;  4Y9U A;  3SWN C;  2BGJ A;  5KYY A;  4WZT A;  2M5S A;  2XID A;  2YHT A;  1KQ2 A;  5J26 A;  1ZBX A;  4L8J A;  3A8K A;  2KRM A;  4AFQ C;  2BV3 A;  4TMV A;  3H41 A;  3CCU T;  1E43 A;  3PIP A;  2ABL A;  3ZZU A;  3G4S T;  2M51 A;  1AIP A;  1QFJ A;  4BE2 A;  1I8F A;  5HZB A;  1QVG B;  3RKW A;  3P26 A;  4WTO B;  1EP2 B;  1M3A A;  5GAN 3;  2LX9 A;  3L2V A;  4BAC A;  3QSY A;  4OP7 A;  1QKX A;  2RQT A;  1KRH A;  1V76 A;  2DRM A;  1UMK A;  4FYY B;  5GAM j;  1Q86 U;  3ISX A;  3CC7 T;  2DTO A;  2RQW A;  1AWX A;  3TRE A;  3NTI A;  2QQA A;  4BY6 B;  1XNI A;  1QCO A;  3QG1 A;  3TSW A;  4BDZ A;  4KBM B;  1JJ2 A;  3JSC A;  3KL9 A;  1TWB A;  2LX7 A;  2KEA A;  1VQ5 B;  1MUZ A;  3AVT A;  1BIA A;  3MEW A;  1RI9 A;  1KFZ A;  1CNE A;  3VS2 A;  5KE2 A;  3CW2 A;  5CQY A;  4EMH A;  3UAT A;  1VQ8 T;  2Q6O A;  1OGI A;  1Q9S A;  1KK7 A;  2FHD A;  1PSE A;  1VQL A;  2EPD A;  2AZS A;  1UGV A;  2B8A A;  3OS1 A;  1Q81 U;  1T5E A;  3JCM e;  2L3R A;  2CP2 A;  2FO0 A;  1ZUK A;  3AVW A;  3U2Q A;  2GK6 A;  3BCD A;  4G5G A;  1KMH A;  1YI2 T;  4UC4 A;  3ASK A;  1OOT A;  2FG0 A;  2CZ7 B;  4M78 D;  3QFR A;  2BZ8 A;  4FCY A;  3ONY A;  2XOK A;  1X43 A;  1V1C A;  5F4O A;  1X2K A;  3VYH B;  3A8M B;  5GAO q;  2GJR A;  1KK1 A;  4DNR B;  3QPH A;  2JM9 A;  2QA4 T;  3B8H A;  2D74 A;  4TT3 A;  4JJN K;  3OYA A;  1WPC A;  1S4M A;  3H0F A;  3DLL A;  5A8A A;  2MWP A;  2PNI A;  4Q5W A;  2DPP B;  3DKM A;  4MZP A;  3QII A;  4DBR A;  1VQL T;  4DQ2 A;  2NLU A;  2QI2 A;  3RMS A;  1UD3 A;  1X69 A;  2EIX A;  1ZSZ C;  2CZ0 B;  4JJC A;  1VQK A;  3QFC A;  3U6B A;  4PK4 A;  1X75 C;  6AT1 B;  2VGM A;  2ZZE A;  1WJQ A;  3ZL7 C;  1OPK A;  2DVJ A;  2C4U A;  1N6A A;  3EH2 A;  1YIJ B;  3RES A;  4XAX B;  3QBY A;  2ZTN A;  2C77 A;  5H5J A;  1I07 A;  2C0T A;  3OYK A;  1SKY B;  4PJL A;  2QQR A;  5F4J A;  2M1H A;  2ZTG A;  4WZL A;  5DLO A;  5GAN 4;  2WYR A;  1WOO A;  1ZSG A;  4UZF A;  3M4Y A;  3JQQ A;  5CCA A;  4FXU A;  1NJI R;  4A54 A;  1VQ4 A;  3CMM A;  3CQT A;  1Q86 C;  1XOV A;  2EKH A;  3G6E A;  2R5M A;  1WU8 A;  3CD6 Q;  2W6J A;  5FL7 A;  4RPB A;  4M75 G;  2QG9 B;  3P8D A;  4Z4U A;  4X05 A;  1KC8 D;  3WXM A;  4C8Q G;  3UWN A;  1VQK T;  2EVR A;  1G83 A;  2YSQ A;  1M5Q 1;  2VXE A;  3M53 A;  3EHQ A;  3H94 A;  3LQ6 A;  1WTH D;  1K0X A;  3OW2 P;  4N3N A;  1NZ9 A;  3EG3 A;  1TSF A;  2X6X A;  2AZV A;  1UDL A;  2CND A;  4HVV A;  2K3Y A;  3FB9 A;  3MMP A;  1QX4 A;  1BX0 A;  1E79 A;  1R5B A;  4CC3 A;  1YCY A;  1K8A U;  1VJS A;  3J81 E;  3CPW A;  1GCP A;  1YI2 Q;  2V7W A;  4NNJ A;  3GLX A;  5HKC A;  4QVJ A;  4Z4W A;  4JMQ A;  4XLF A;  1G8X A;  4XTY A;  3CCQ T;  1TTT A;  3W5V A;  1X6B A;  5FNZ A;  1Y0M A;  1VQO Q;  3C95 A;  2IIM A;  4J9C A;  1I81 A;  2LVM A;  2YWW A;  1K8A R;  1JJ2 P;  2LMJ A;  2E6N A;  2FB7 A;  4CC2 A;  1PHT A;  2F5K A;  1E64 A;  3EFO A;  2EWN A;  4JLG A;  4JLI A;  2FPF A;  4TSF A;  4KRT A;  1M4Z A;  1E62 A;  3M0P A;  2KT8 A;  1YIT B;  4PFZ A;  3W2I A;  2C0O A;  3G6E Q;  1O75 A;  3GBQ A;  1Y0Y A;  4ATO A;  2MK5 A;  4RJL A;  2O31 A;  1Q81 C;  1MV3 A;  2DRK A;  2MIO A;  3CPW S;  4J6Y A;  2VNK A;  2VBT A;  4PAA A;  3ZIA A;  3S3O A;  2YRD A;  2JTE A;  5HCK A;  1Q86 D;  2MAM A;  1NLO C;  1XFO A;  1S72 T;  3SJP A;  1T0J A;  4ZGJ B;  1WYX A;  4AFS C;  3M9Q A;  2J6F A;  4ME7 A;  1Q7Y U;  1GCQ A;  2JXB A;  4C92 F;  1Y71 A;  5CVI A;  3L2Q A;  2HBW A;  1PG5 B;  2RK2 A;  2DFU A;  3P8B B;  2QDX A;  1Y57 A;  2GCX A;  1JXO A;  1M90 R;  2DL5 A;  2QGG A;  1AEY A;  5GAN 2;  2DCU A;  3NTH A;  1VQ7 A;  3PEN A;  3GF5 A;  1PSF A;  2JW4 A;  3L2W A;  2ZZF A;  4J9G A;  4D6W A;  4P5N A;  3QFT A;  3BDL A;  2KAF A;  3H0H A;  5GAM h;  3FEO A;  2RC6 A;  4II2 A;  2EGA A;  3OP1 A;  3CPW B;  3V7A A;  5L23 A;  4X34 A;  4PC7 A;  3CCR B;  3LLR A;  2K3X A;  3OYL A;  4N4I A;  1KC8 R;  1I8D A;  3EG9 B;  4B9X A;  2JMC A;  2OAU A;  4OF1 A;  4IKF A;  3NE5 B;  3OYI A;  2A0F B;  1KK0 A;  1KQS B;  4BUG A;  2JN9 A;  2MPX C;  1SPK A;  4RUG A;  3JB9 F;  2DXC A;  2C2W A;  3CP2 A;  3QUI A;  5D7U A;  3OYY A;  1YNZ A;  2ZPG B;  3CCU Q;  3EAE A;  4J6W A;  1WJR A;  2P0K A;  1IHM A;  1VQK Q;  4ELZ C;  1JA0 A;  3OSV A;  1S0U A;  2RHX A;  5A0D A;  1M1K U;  3ZPN A;  1WLP B;  3U6K A;  2DIQ A;  3E9G A;  4ZV4 A;  1VQK B;  3QDF A;  3EG1 A;  1VQM Q;  1DAR A;  4RTU A;  3WBK A;  2QQ9 A;  3GVK A;  1KIK A;  5FLX E;  2VKN A;  2EYW A;  1WHL A;  1RL2 A;  2C0I A;  3GOX A;  1T6X A;  1NEG A;  2GRE A;  1YCS B;  4DQK A;  1W6X A;  4M77 D;  4BE1 A;  2SRC A;  4KKU A;  4F14 A;  1XTD A;  3CCR Q;  4HVU A;  4LNP A;  4KGV B;  3AVU A;  3JCM d;  1M1G A;  1QGZ A;  3HFO A;  3CME A;  1KQS A;  4NCN A;  4EH1 A;  2E3H A;  3LVB A;  4GBQ A;  3F70 A;  5FRM A;  3LGL A;  3AST A;  3OYJ A;  2X0K A;  3CCE A;  2Q6K A;  4YAU A;  2WZN A;  4OMM A;  1FXX A;  1GBR A;  3V8K A;  3GIB A;  3SEJ A;  4Z4Z A;  2GQI A;  1N0V C;  1QUF A;  5KCH A;  2YLB A;  4ELY C;  3ONU A;  2OTL A;  1W9X A;  4BI4 A;  4G6I A;  2KYB A;  2YWH A;  4CQJ A;  4P6V F;  3BY1 A;  2WSS A;  1QVG S;  1T6Y A;  4E7H A;  2DTH A;  2LNH B;  4OMF B;  3FKS A;  3OZW A;  3EGX B;  1YJN A;  4LN2 A;  4WZK A;  1MND A;  1PCX A;  3NGP A;  3OS5 A;  4FSS A;  4C92 A;  3SLD A;  3CBP A;  1VQM A;  1NPP A;  2RJE A;  1RLQ C;  1NJI C;  4MDX A;  1T6Z A;  1Q82 R;  3CCM B;  3EGX A;  2HKQ B;  1VIE A;  1WHH A;  4AF6 A;  3CTA A;  1FNM A;  1GVH A;  1MAB A;  2G3R A;  4PJM A;  4TMW A;  3PTA A;  3BC9 A;  1MNE A;  2HBP A;  3W5U A;  3C94 A;  2X35 A;  4BY6 C;  1P4M A;  5KSW B;  2COZ A;  1RAH B;  2HDA A;  4JRP A;  3M59 A;  1Y07 A;  1MGQ A;  4QQG A;  3RDV A;  1FX7 A;  2R58 A;  2RM4 A;  1D09 B;  3JCM h;  4RMO A;  4Y92 A;  1UEC A;  1G3Y A;  4JUV A;  1KJZ A;  1ZHI A;  4B47 A;  3JCM W;  1QG0 A;  3WBJ A;  4WQM A;  4CC4 B;  4XTW A;  4LBV A;  2QAZ A;  5TRD A;  4AFZ C;  3EG0 A;  1PKS A;  3CCQ A;  3CD6 T;  2DTI A;  2F69 A;  2JJ2 A;  1N8R C;  2K79 A;  2IVW A;  5KH6 A;  3C12 A;  4C92 B;  3CPF A;  2DX1 A;  3BCF A;  1D1C A;  2YUQ A;  4II3 A;  1M2V A;  2HAX A;  4X0C A;  1G5V A;  4TN1 A;  3MJX A;  3CCQ Q;  2K9G A;  1K73 R;  4J7I A;  2Z0W A;  1D1A A;  4X9D A;  2X4X A;  2PMD A;  3UF4 A;  2ZBU A;  2HCJ B;  3FPP A;  1XJW B;  4EPC A;  4A4H A;  2BN4 A;  3ZUG A;  2JIZ A;  1YIJ T;  2EJG A;  2DYB A;  1VQ9 A;  4M78 C;  1RLP C;  2VAS A;  3EFS A;  4A4E A;  1BI3 A;  1R0C B;  1RUW A;  3ZBD A;  3JB9 I;  2FX3 A;  3UA7 A;  4M4S A;  2DEU A;  1ELO A;  4LDY A;  1NJI D;  5CK9 A;  2DL8 A;  1IO6 A;  4P3I A;  1RAD B;  5HY6 A;  1U06 A;  3MKD A;  2JDI A;  4DNT B;  3RER A;  3X25 B;  1OI1 A;  3E1S A;  2CYZ B;  4P9S A;  1VUB A;  2PLF A;  5IXF A;  5IYP A;  5KW9 A;  2ZPB B;  2ZCF B;  4DBH A;  2QTZ A;  2QQS A;  2KE9 A;  4E47 A;  1YX2 A;  1NRK A;  2RHI A;  3UPU A;  2XDP A;  3WXM B;  4O6J A;  2RMO A;  2HL3 A;  3CXC S;  3I55 B;  4U9U A;  3CCS A;  4FM4 B;  3P27 A;  4HE6 A;  2DLP A;  1ZSZ A;  1QGY A;  2EJF A;  3ASQ A;  1YIJ A;  2RB6 A;  1VF7 A;  5IYR A;  2OTL T;  2O01 E;  5DLQ E;  3REB B;  4M7D E;  4B4D A;  1BIB A;  4HT9 A;  3VRY A;  3H0I A;  3SWN A;  3RR6 A;  1E6H A;  1FRN A;  2RPN A;  4L5G A;  3L2R A;  1ZA1 B;  4XK8 E;  3CCQ B;  2XDD A;  1BI2 A;  2L3S A;  1M2V B;  1SF9 A;  2LC4 A;  3G4S A;  2LQ8 A;  1TUC A;  3ZC3 A;  3QZ5 B;  1G7C A;  1QWF A;  2F2V A;  1FMW A;  1YHQ T;  4WF2 A;  2RHY A;  2C5H A;  1LVK A;  1M2O A;  2A3L A;  1VQO B;  3A8H B;  4FT2 A;  3PIO A;  4PLI A;  3RKY A;  2KRN A;  4P26 A;  2J6O A;  4G1B A;  2KYM A;  2K57 A;  2XZO A;  2OI3 A;  1BQE A;  4Z4Y A;  2BE9 B;  2H3J A;  2D3L A;  2CP6 A;  1GAQ A;  2RNA A;  4J0Q A;  3OYD A;  2KY9 A;  5CO7 A;  2L89 A;  1H3H A;  2MYS A;  2BM0 A;  3I5R A;  1OB0 A;  3OMG A;  1GRI A;  1QFY A;  2DL3 A;  2AT1 B;  3L2U A;  1YN8 A;  4QW2 A;  3HRS A;  4PJJ A;  2V7V A;  2XGJ A;  5GAN j;  1JA1 A;  1WZO A;  1WGS A;  1YJW A;  4XOT A;  1WOS A;  2XZL A;  4EMK B;  3QHS A;  4JS4 A;  4RTZ A;  3QYH B;  1M3B A;  1W70 A;  4E7J A;  3QSU A;  2DEQ A;  1JBM A;  4JS5 A;  1Q81 R;  4OPO A;  1Q82 U;  4B48 A;  2ENM A;  4XTZ A;  4DOW A;  1HJD A;  5GAN d;  2XIC A;  5EC7 A;  4PJN A;  5H59 A;  1M1F A;  2GQF A;  2HLD A;  2NUT B;  2VNJ A;  1UD5 A;  4M1K A;  3UDC A;  3A8I A;  4M7D C;  3SD4 A;  1ZM4 A;  3CXC B;  5GMK j;  3I1F A;  1GFC A;  2EYZ A;  2QYZ A;  2DBM A;  2PUK B;  1TG0 A;  4ZN3 A;  1SSH A;  3VS4 A;  3CCU A;  4C92 G;  4JZ3 A;  1B7T A;  5IYQ A;  1ZLM A;  3ASP A;  3SJZ A;  2KGT A;  4OOX A;  2DE0 X;  1TUD A;  1MRZ A;  1T3L A;  4M77 B;  8AT1 B;  1M90 U;  4DBQ A;  1UJY A;  1YWO A;  2GTJ A;  5GMK l;  3BFM A;  3CB4 A;  3A35 A;  2QE7 A;  2KRS A;  1UD4 A;  1OQK A;  1AMO A;  2XNJ A;  2OAW A;  1IRX A;  4FW2 A;  5KE3 A;  1AZE A;  2GFU A;  4PC6 A;  5CKF A;  5CKE A;  2OK8 A;  1ZUN B;  2CRV A;  4HXJ A;  1D3B B;  2CKK A;  4HIZ A;  3NPF A;  3A8G B;  4LXC A;  2CS7 A;  1WOR A;  4YTL A;  3CMA T;  1KSW A;  4P22 A;  3PA2 A;  2JZ2 A;  4UZE A;  1BI1 A;  3S6W A;  3Q3A A;  3JB9 H;  4P2N A;  2RN8 A;  1V29 B;  3J81 k;  5LJ3 j;  3CC7 B;  4HCK A;  3UA6 A;  2LQN A;  5A0G A;  3CPW P;  1VQL Q;  1FDR A;  3ULR B;  1UEB A;  1OYX A;  2WSE E;  1QW1 A;  4AT1 B;  3CC4 T;  2DZC A;  3OFN A;  5GAN e;  3CCR A;  3G05 A;  3D7S B;  2OTL Q;  2BMW A;  2D6F A;  1W35 A;  2RI3 A;  3QE2 A;  3BY7 A;  1JO8 A;  2R5A A;  2C78 A;  2D9T A;  4X06 A;  3EHR A;  1PD0 A;  1CKA A;  1MMN A;  1LOJ A;  5FU7 B;  1N05 A;  1M30 A;  4FIB A;  4A4K A;  2X6W A;  1NB0 A;  3OJX A;  4XR6 A;  5J39 A;  1K9M U;  2GF7 A;  2HCK A;  1MMG A;  5GAN 6;  4F7U G;  1T3S A;  3GSI A;  4RKU E;  3CC7 Q;  2CW5 A;  4XLH A;  5ECA A;  2Z6B D;  1QQJ A;  3S3N A;  2RD1 A;  2CGH A;  4RTW A;  3PUN A;  2KT1 A;  5BSY A;  2J7I A;  3OMC A;  1M1K R;  2NUP B;  2L2P A;  4IUP A;  2F43 A;  2QA4 B;  4M77 G;  1BKB A;  4M7D B;  1XE1 A;  1WP6 A;  2EYX A;  4DOV A;  2V26 A;  3A5Z B;  4RD1 A;  2E3I A;  1KD1 D;  4XTX A;  1WJS A;  5GAM d;  2VYQ A;  1WHG A;  4M78 F;  5CKD A;  1JEG A;  4B3F X;  4XU2 A;  1DDI A;  1S72 A;  1V5V A;  1WSR A;  2KXC A;  3CME Q;  1RI0 A;  3RIR A;  2YRV A;  4XON A;  1EFR A;  1KJW A;  4PC1 A;  2O2O A;  1K4U S;  2EQM A;  5EG2 A;  4ANJ A;  3A98 A;  1HXD A;  1I0C A;  1TXQ A;  2KK4 A;  2MMP A;  4C0G A;  3CPX A;  4E0F A;  3CC2 B;  1FWZ A;  1SM4 A;  2NPF A;  4F04 B;  3MCA A;  2R6H A;  1FX0 A;  3RMQ A;  3JB9 D;  3NTK A;  3VKI A;  4FL6 A;  4QVD A;  3ZBU A;  4FSX A;  1QWE A;  1ARK A;  1GL5 A;  3AHU A;  1SG5 A;  1VQ8 Q;  3MP6 A;  2B5O A;  4KT0 E;  4PJO B;  2VUB A;  4NL3 A;  2VNI A;  4BI8 B;  3M5A A;  5IH2 A;  2V7X A;  3GIR A;  5LJ3 h;  2IG0 A;  1NG2 A;  2FZG B;  1VQN A;  5E6T A;  1D2E A;  3FDR A;  3WND A;  1YLO A;  1K76 A;  4PJO G;  1QVG A;  3CME B;  1Q7Y R;  4MML A;  2E41 A;  2X4J A;  1R5N A;  2EFG A;  2ZXH A;  4RCY A;  2LJ0 A;  2WJY A;  2DXB A;  2VBV A;  2B7C A;  4XTU A;  3VR6 A;  3RBB B;  5FU7 C;  5LJ3 g;  1W2B P;  1N8R R;  3QYG B;  1VQO A;  1VQN Q;  4Z4R A;  1Q86 R;  1UD2 A;  1IHW A;  4M4Z A;  4P6Y A;  4XLA A;  4XQF A;  2QTX A;  2X3X D;  5IHI A;  2JS0 A;  1B34 A;  2B86 A;  2WJV A;  2E6Z A;  3CD6 B;  3MET A;  2QEX Q;  5DM7 R;  3HFN A;  5HK3 A;  3CC4 A;  1R5O A;  3EG2 A;  1QGA A;  1WXU A;  1VQ6 T;  4OPV A;  2SEM A;  1KD1 C;  2V8K A;  4JRK A;  5FU6 B;  1UD6 A;  2AK5 A;  2RO0 A;  2R57 A;  1KK3 A;  1UGP B;  5GAO r;  2EAY A;  2KR3 A;  3OZV A;  3WVD B;  2RHZ A;  3OA6 A;  3VS0 A;  5M9O A;  1B34 B;  4PJO A;  2COY A;  3JAM E;  5F4M A;  4RD3 A;  2YUP A;  3FLG A;  2BGI A;  1ZM2 A;  3JB9 J;  2DIL A;  1IB0 A;  2BUD A;  2AKK A;  2DNU A;  5GMK h;  2DIE A;  4M7A B;  4Y7C A;  3SDZ A;  4N4G A;  3Q38 A;  3OB9 A;  1JQQ A;  3QWX X;  5B6I A;  1WDX A;  1VQP T;  4XOR A;  4ZTF A;  4KKS A;  4DQL A;  1OZ2 A;  2M0O A;  3CCV T;  3C4S A;  1VQ6 Q;  2J6K A;  2G6F X;  1NDH A;  3SFM A;  2QN6 A;  2VVK A;  4OMP A;  2FPE A;  4PC3 A;  2CC2 A;  2B7B A;  3L2Z A;  5GAO n;  1ZQ1 A;  4OML A;  2DO3 A;  3GVL A;  3CMA B;  4J9I A;  3CRZ A;  4EMG A;  4PFO A;  4N0A A;  3FIF A;  5CKH A;  2C4T A;  5IT9 E;  2MOX A;  1W4S A;  4XU3 A;  3VU3 C;  3G4S Q;  3OJW A;  4ACB A;  3J80 E;  1K73 C;  4RD4 A;  4R0K A;  5GAN h;  1TVC A;  2H8H A;  2LTO A;  1BBZ A;  1K9A A;  1IGU A;  2DAQ A;  2JMA A;  3AGQ A;  3LYI A;  3JB9 G;  4JPB W;  3CC2 A;  2O4X B;  4QVZ A;  3VS6 A;  3CP8 A;  3PMT A;  2VJJ A;  3TVT A;  2LT1 A;  4RCC A;  3I56 A;  4ZGQ B;  1VQ5 A;  5GMK m;  4XOP A;  4C0S A;  1VOM A;  1CSK A;  4X7C A;  2VV5 A;  5TR9 A;  3CC2 Q;  3E9F A;  1WXT A;  1VQP A;  4RDL A;  3VNV A;  1PC0 A;  2LCC A;  5LJ3 f;  2QTV A;  1X2Q A;  4Z88 A;  1LJO A;  3CCR T;  2W6I A;  4QQD A;  1OX9 A;  1H8H A;  4PJO E;  1XQH A;  3V76 A;  3C0C A;  3HHT B;  4M78 A;  2JOY A;  3CCM A;  2V8J A;  1PKT A;  3A8J A;  5KYW A;  1K73 D;  4G1V A;  4X1V A;  2X8K A;  4KH0 B;  3JQP A;  4Y91 A;  3QJY A;  1SKQ A;  1UE9 A;  3GPL A;  2VBU A;  1E7O A;  1KD1 U;  4K11 A;  5GMK i;  4ZCM A;  3G6E T;  2BM1 A;  4YEJ A;  1RQP A;  3OE7 A;  3GP8 A;  1VQ4 T;  4E6R A;  4E7K A;  4TVR A;  2XK0 A;  1R0B G;  3BE3 A;  3TU4 K;  4XLE A;  3CCE B;  3MEU A;  3E20 A;  1QKW A;  1WI7 A;  2HDN B;  2EW3 A;  4FU6 A;  3B78 A;  1H42 A;  3DB4 A;  2D8H A;  2MI6 A;  4HVW A;  1PM3 A;  5L46 A;  4FN5 A;  3CCM T;  1XQB A;  2CSQ A;  4RPD A;  1Q7Y D;  1I1J A;  1W34 A;  3WY9 A;  5D6W A;  4AVZ A;  4Y9R A;  1AWW A;  1WXB A;  2F5T X;  1E3Z A;  3QDR B;  1GJR A;  4B9W A;  2P0Q A;  4OB1 B;  1VQ9 T;  1N9R A;  2XNC A;  1VQ4 Q;  5D6X A;  2E4H A;  4J9F A;  1WHK A;  5GJW B;  4LUD A;  2X3W D;  2LCS A;  1MHN A;  2A36 A;  3SKB A;  5FRO A;  2OBR A;  2NYS A;  3HP9 A;  3R6O A;  3HRU A;  1N9S A;  3CCJ A;  4G7X A;  2MF2 A;  4N4H A;  4OOV A;  2L3P A;  3CCM Q;  1GBQ A;  5KCO A;  3CCS Q;  3FJO A;  4B3X A;  4PJO C;  4J6X A;  3LO8 A;  2RQU A;  1HVX A;  3OW2 A;  5LJ5 e;  3OPO A;  1VQP Q;  1Z9Z A;  2V8I A;  1B3Q A;  1V0F A;  1BX1 A;  5IHK A;  4YAF A;  1IXD A;  2X4W A;  3JCM V;  2XD0 A;  5I2M A;  1H85 A;  5GAM e;  4OB0 B;  2EBP A;  1FMK A;  1EIF A;  3OW2 B;  3VS5 A;  1QH0 A;  2K5F A;  3ASS A;  2LT4 A;  2L3Q A;  3VUB A;  4LDW A;  1PD1 A;  3VMF A;  2DY1 A;  2XU8 A;  4L6V 5;  2P84 A;  4PKC C;  3CCL Q;  4FYW B;  3RY8 A;  4J5Y A;  4LC0 A;  1N07 A;  4BE0 A;  2PU9 B;  4A53 A;  5AN9 A;  2VBS A;  2WAC A;  1YIJ Q;  4RCZ A;  4IUQ A;  4FWT A;  4XMY A;  1RQR A;  1W2B B;  1WSV A;  2K3B A;  2V7T A;  1HSQ A;  3O8V A;  2RQR A;  5CIU A;  1EXM A;  1B07 A;  4G7W A;  3MHX A;  5IHN A;  1AZG B;  4LD6 A;  3B82 A;  3PT9 A;  1VQ6 A;  1PKV A;  4HT8 A;  5HXB A;  4F7U F;  1SHF A;  3WNB A;  1VQO T;  5GV7 A;  3QO3 A;  3CXC A;  4Q7J B;  1U1S A;  2P0P A;  1K9M C;  1M8M A;  1P92 A;  1HK9 A;  3KUF A;  3V8J A;  1ZM3 A;  2YDL A;  4N3G A;  2ZXI A;  1I7P A;  3DLM A;  3V7R A;  1S1N A;  2M0Y A;  3MEV A;  5LJ5 g;  2ROT A;  5DSZ A;  3J7A F;  4M7D A;  2BF4 A;  5LJ5 h;  2NUP A;  3BDU A;  4K1X A;  2MCN A;  3R6K A;  4LDX A;  4R71 A;  2DL7 A;  4MZM A;  5C0M A;  5FWB A;  1QVF B;  2AIR B;  1YJW Q;  4X7E A;  5FWC A;  1H92 A;  4C92 D;  1NJI U;  5A89 A;  1T0H A;  1M90 D;  1WOP A;  4M75 D;  3EH1 A;  3FC3 A;  2ZZD A;  1D1B A;  5LJ5 d;  3HPW A;  4BDY A;  4C0D B;  1M3C A;  1MV0 B;  3G71 B;  3I56 B;  2CSI A;  2E1R A;  4XKW A;  4M75 B;  3T9N A;  1S72 Q;  5HKK A;  4F17 A;  1C0M A;  2KRO A;  3CCS T;  1YIT Q;  4CRI A;  1LCK A;  2EGE A;  4IIO A;  4M7D D;  3M58 A;  4OMN A;  4R56 A;  3WQZ A;  5LJ5 j;  2ZPI B;  1MMD A;  1ACM B;  1JXM A;  1BCM A;  1JB0 E;  3INZ A;  2JJ9 A;  3CES A;  3JV3 A;  2CP7 A;  2XG8 D;  4A63 B;  2VXF A;  1YP5 A;  2OX7 A;  1VQ8 B;  4J83 A;  1YFN A;  3I9Q A;  2BTT A;  1VQ7 Q;  2NV4 A;  1OZ3 A;  2FVU A;  4RTT A;  5THX A;  1K8A C;  4GY5 A;  1V0E A;  3G71 T;  5GJV B;  3CCL T;  3G1J A;  1W2B A;  1BYM A;  2GJK A;  4QHY A;  4M78 G;  2V1Q A;  2W0Z A;  3OYN A;  1AVZ C;  3I5S A;  3SEM A;  2JM8 A;  4C8Q E;  2K2V A;  2EQI A;  5KYY B;  2CZ6 B;  1WHM A;  2PUO B;  2YRC A;  2OTJ A;  2LQK A;  2DER A;  5IYN A;  3N5B B;  5CR2 A;  3T56 B;  1OEB A;  4R55 A;  3GVJ A;  2OK7 A;  3MHP A;  5LMZ A;  2JVV A;  2GNC A;  3SWN B;  4KH1 B;  2E5K A;  3M4G A;  1QVF S;  2QEX B;  4C8Q D;  1VQ7 T;  3OZU A;  2OTJ B;  2PIA A;  3ES9 A;  3MP8 A;  4ESR A;  4Y28 E;  3OEE A;  5IXB A;  4QUZ A;  2EYQ A;  2VYT A;  1TU0 B;  2ED1 A;  2FZC B;  2KNB B;  1EFT A;  4L59 A;  2EQU A;  1W87 A;  4F7D A;  1BB9 A;  1OU9 A;  3VV0 A;  1K28 D;  4LBZ A;  4PNO A;  2EGC A;  4OB2 B;  3JCM J;  4VUB A;  1BCO A;  1K73 U;  4Z4T A;  1OU8 A;  4F7U A;  2W10 A;  2BIV A;  2XHC A;  3CCV Q;  3CCJ Q;  4PC2 A;  1X6O A;  2X53 S;  4ZN1 A;  1KHI A;  2YXY A;  3IQL A;  4RLZ A;  3QWY A;  1EWY A;  2LZ6 B;  2CP0 A;  1X27 A;  2BZY A;  1U5S A;  1J3T A;  1N27 A;  4PLL A;  2PQW A;  4TMT A;  1G3T A;  4YAO A;  3PUM A;  3CC4 B;  2OJ2 A;  3GNG A;  1UUE A;  3Q6Q A;  4OB3 B;  2E1H A;  1NPR A;  2CP3 A;  1EX4 A;  4QKU A;  2DD4 A;  4C0Z A;  1A0N B;  1YIT T;  1K8A D;  2E10 A;  2YWF A;  5FA6 A;  1IJF A;  4C0D C;  2QDY B;  4C0F A;  4M77 E;  3RKX A;  4JJD A;  4B3G A;  2LZJ A;  3ER0 A;  5FW9 A;  1OGJ A;  3BQJ A;  1KHC A;  2K5L A;  2DF6 A;  4HKE A;  1PRM C;  1RAF B;  3U23 A;  4BI3 A;  2C06 A;  1M8V A;  3OAA A;  4C5E A;  3CC2 T;  3M0T A;  1NBM A;  3X20 B;  3A8O B;  1VIF A;  3RNJ A;  1TH7 A;  3JCM b;  1FNC A;  1XB2 A;  2EFI A;  4XNF A;  1S72 B;  3FRN A;  1N06 A;  4AC9 A;  2RC5 A;  1UG1 A;  4M78 B;  3M0U A;  3G71 Q;  1U3O A;  3LQE A;  1VQM B;  3THK A;  4IIM A;  2ROL A;  2CK3 A;  4AG1 C;  2MWO A;  3OYG A;  4UAJ A;  5KYX A;  4OVA A;  2CZ1 B;  2QA4 Q;  1H8E A;  2DJZ A;  3EGD B;  3EFR A;  1VQP B;  3MCA B;  3I35 A;  1KZL A;  4OMO A;  1G3S A;  2F2W A;  4P25 A;  2ECZ A;  1IHV A;  3VS3 A;  3V7S A;  4EMK A;  4XU1 A;  3I55 T;  5KNL A;  1UJ0 A;  2FEI A;  3QZ9 B;  1CKB A;  1W1F A;  2LP5 A;  4A4G A;  2ZPE B;  1RAG B;  1UFF A;  1NEB A;  2D3N A;  1FMV A;  3ZEH A;  4C5G A;  3Q6R A;  2IPO B;  2YLC A;  1TS9 A;  1F1B B;  1UB4 A;  5KYW B;  1LPL A;  4OMQ A;  1YJ9 T;  4RDJ A;  1WFW A;  4XN0 A;  2LJ1 A;  4P3Y A;  3EGU A;  2CF4 A;  1BPL A;  2XDB A;  2HZY A;  3AVX A;  1IGQ A;  4XU0 A;  1RAA B;  2ZL5 A;  3A8L B;  2FPD A;  1BLI A;  4AFU C;  5J35 A;  4KUI A;  1Q82 C;  1QMC A;  4CI0 C;  1OB5 A;  3OW7 A;  1D0X A;  4QVC A;  2PZ1 A;  1VLO A;  2RH2 A;  4TMZ A;  2RI5 A;  4QT7 A;  2EKO A;  4ROX A;  2KI7 A;  1VQ9 Q;  2QQB A;  1HZE A;  3OYC A;  2BPO A;  2HQX A;  2RQV A;  3W2F A;  4PL6 A;  1Z9Q A;  3VRZ A;  4E7Z A;  3I55 A;  3CC7 A;  1RAB B;  4DEY A;  3ZBT A;  4GLM A;  3SB2 A;  4F7U E;  4B44 A;  1WQW A;  2CT4 A;  4E7S A;  4LDU A;  2COW A;  2E5Q A;  2XZP A;  1SKU B;  1Q81 D;  4Z8A A;  3FPK A;  3M56 A;  9ATC B;  3MP1 A;  4FYV B;  2JTF A;  5I21 A;  2PE3 A;  3LH5 A;  1FNB A;  1VLY A;  3SLN A;  2E65 A;  2X51 A;  3BY2 A;  3R6N A;  1RAE B;  2O9S A;  3MO8 A;  2BE7 D;  2KSS A;  4JDS A;  1H64 1;  3AT1 B;  2VC8 A;  4PJO D;  1N8R U;  3OS2 A;  1YJ9 A;  1N0U A;  3LWI A;  4J7F A;  5I22 A;  4M7A F;  3CCE T;  1GAW A;  1KQS S;  2VWF A;  1CNF A;  4KUD K;  4ZGE B;  2A28 A;  2VJI A;  4C43 A;  2X4Y A;  4DK1 A;  3TCJ A;  4X9C A;  4M7A A;  1W0K A;  4ZCL A;  4EIK A;  2I1L A;  3PMI A;  1TUI A;  2KDS A;  1QUE A;  3HKS A;  5DS0 A;  1JU5 C;  4C8Q F;  1GR1 A;  4ZGD B;  2Q6I A;  1N8R D;  3MEA A;  4YAL A;  2M16 A;  7AT1 B;  2O88 A;  2I2L A;  1BJK A;  4CC7 A;  1ZM9 A;  3TEE A;  1I5O B;  3JRZ A;  3AGP A;  4J9D A;  1K9M D;  4RG8 A;  4PAB A;  4MYU A;  3JCM Q;  5FRN A;  2OTJ T;  5JBQ A;  2LNV A;  1VQ7 B;  5CKB A;  4II1 A;  3CCV A;  1YJW T;  4ASU A;  4X7D A;  1UD8 A;  2EQJ A;  3ME9 A;  1Q82 D;  3AVY A;  2A08 A;  1IJE A;  2X3U A;  1ZUY A;  2C5B A;  5GV8 A;  3WYA A;  1NB9 A;  1YBY A;  3ZZ0 A;  4Z02 A;  4Z4V A;  2HL5 C;  3CMA Q;  2K7A A;  4FYX B;  2XI9 A;  2QK0 A;  1H3Z A;  3D26 A;  1COW A;  2VB6 A;  2CUB A;  3I56 Q;  4M75 C;  2K4Y A;  1QVG P;  4P1V A;  3KEW A;  4M53 A;  3LW5 E;  3JQR A;  3LNN A;  3OBW A;  4E7I A;  1NYF A;  2RI2 A;  1JJ2 S;  4LDV A;  5TV2 A;  4XL9 A;  2D0Q B;  1YJW B;  3I55 Q;  1M27 C;  4H9G A;  1WPY A;  3WVE B;  2DA9 A;  5I11 A;  3VS1 A;  1YJ9 Q;  3VUZ A;  3OQ5 A;  2HSP A;  5A2Q E;  4E7L A;  1VQL B;  1VQN T;  2GFA A;  2PVG B;  1C1A A;  5GAN f;  4X7F A;  1YJN Q;  1HA3 A;  1RAI B;  1M90 C;  1X01 A;  2DKG A;  1YHQ A;  4B43 A;  2ED0 A;  4OGC A;  4ZTJ A;  1QCF A;  5A88 A;  2KVO A;  5BSX A;  1VYU A;  1W2B S;  2D1X A;  4UZU A;  4AMC A;  1UGS B;  2DYI A;  2L8D A;  2QA4 A;  3M0Q A;  1UGQ B;  3X28 B;  2F1L A;  2ATC B;  2LQW A;  4ZCI A;  1VYT A;  2L5Q A;  4OPS A;  1K0S A;  3G7Z A;  4HCB A;  3LGF A;  1SSF A;  1OUL A;  4WZE A;  4JJB A;  2HQH A;  4YXW A;  1WIE A;  2JS2 A;  2P4T A;  2FYK A;  3ZFJ A;  4PGO A;  4RD0 A;  2Y90 A;  1YIT A;  2HD0 A;  3M0R A;  1N5Z A;  1D1N A;  2JNG A;  1TUG B;  3A3B A;  4QQ6 A;  2HNI A;  3CMA A;  2CP5 A;  3EFO B;  1QLY A;  3NFC A;  3OYH A;  1WA7 A;  4DEX A;  4QFM A;  4XQ3 A;  3X24 B;  2J7K A;  3CCL B;  3L1A A;  3E1Y E;  5GAN 7;  3T51 B;  1EP1 B;  1J9Z A;  2ZZG A;  2HSE B;  4M77 F;  1BK2 A;  2DJQ A;  1G2B A;  3DB3 A;  5LJ5 f;  2OBS A;  2ZPF B;  2I0N A;  3M0S A;  2YUO A;  2M9U A;  2AHJ B;  1VYV A;  1VHE A;  3E2U A;  4NOY A;  3VYG A;  5GAN 5;  2RJF A;  1AWJ A;  1W0J A;  2ZPH B;  4HCZ A;  1PJ5 A;  1GCQ C;  1PRL C;  1LNX A;  3HRT A;  4C8Q A;  2DVE A;  1ZSZ B;  1B23 P;  2OBT A;  2KXD A;  2FZK B;  1HD3 A;  3CCS B;  2ZL6 A;  2D0N A;  4MYT A;  2HKN A;  2DBK A;  3LH0 A;  1CQX A;  1SRL A;  2JT4 A;  3CCJ T;  2VZL A;  4DK0 A;  1G7S A;  3QFS A;  5A0L A;  4X8I A;  4Z4S A;  4IW3 B;  3A1P A;  1GO2 A;  4XTV A;  4M75 E;  4N0A C;  3OYM A;  5AT1 B;  4M77 C;  1G3W A;  1IB8 A;  1OV3 A;  1Q95 G;  3FJP A;  5GMK e;  2CRE A;  2GQV A;  5GAO p;  2X85 A;  2KVQ G;  1ZX6 A;  1VA7 A;  2EJ9 A;  3OYE A;  1UGR B;  3OY9 A;  1Q7Y C;  3CD6 A;  2OYN A;  3G6E B;  2BSA A;  2EIF A;  2FRW A;  2DMO A;  2X6Y A;  2A37 A;  3OW2 S;  4J8O A;  4GLK A;  4TKO B;  2GGR A;  2GTO A;  4JZ4 A;  2FL7 A;  4M7A D;  3T53 B;  4ZGN B;  3VNU A;  5KYU B;  1DJ7 B;  2ZIT A;  3W5H A;  5DN6 A;  3QKJ A;  4RTX A;  4J9E A;  3KXT A;  1QFZ A;  2BZX A;  4A4F A;  4FK8 A;  2EQK A;  3REA B;  5GAO l;  1ABO A;  2QEX T;  1Y0R A;  2GPJ A;  3M57 A;  2XEX A;  4KUL A;  3CCL A;  4M7A E;  4M75 A;  2GBQ A;  2CDT A;  3PVL A;  2YWE A;  4WCI A;  2V7U A;  3OOC A;  2NUT A;  2ESW A;  3H6Z A;  3MPU B;  4MMK A;  1O9S A;  3Q1J A;  1VHO A;  4WWV A;  4IUV A;  4GQN A;  5TY0 A;  5LJ3 e;  1OB2 A;  3KBG A;  2HMA A;  2VGN A;  1UHF A;  3KFV A;  2D9R A;  1UHC A;  1QP2 A;  2JTM A;  2AHO A;  2RF0 A;  5IK2 A;  2PVO B;  1QVF P;  4M0L A;  4M75 F;  1X6G A;  4V2S A;  1EZZ B;  1YHQ B;  2FVG A;  1VQ5 T;  3V8L A;  2YWG A;  5LL6 S;  3OBY A;  2K6D A;  1KK2 A;  1I18 A;  3BH4 A;  4M7A G;  4HE5 A;  1A8P A;  5J3O A;  1OPL A;  1Y7X A;  2WR8 A;  1FRQ A;  4FT4 A;  2WSC E;  3HL8 A;  1NM7 A;  4LBW A;  1PJ6 A;  4Z89 A;  2KQW A;  5EMN A;  1DG1 G;  3CME T;  4J9H A;  4C5I A;  4J9B A;  1R8O B;  4ZNX A;  1C6V X;  1E6G A;  2AKL A;  2BVN A;  4ACA A;  3EGD A;  2E1B A;  1NLP C;  5KYX B;  2ZAE A;  2O4X A;  3W2E A;  1HYO A;  4MDW A;  2E12 A;  4RD2 A;  3GNF B;  1NE8 A;  2K2M A;  3CBM A;  1EFN A;  1NBE B;  4YHB A;  3P8H A;  3PFS A;  1E1Q A;  5L8R E;  1K9M R;  4XM3 A;  2ZZQ A;  5D6Y A;  4LUE A;  2YUN A;  1OX8 A;  2XND A;  3PVD A;  4LBY A;  1D3B A;  4EMK C;  1NYG A;  4TMX A;  5C6S A;  1M9S A;  1D0Z A;  4M78 E;  2V4D A;  1I4K 1;  2FRY A;  3TQ7 P;  5FU6 C;  1I5L A;  1U8R A;  2GJP A;  3CCJ B;  3H9N A;  1EFC A;  4NS5 A;  2P4R A;  2DIG A;  4F7U B;  4YAW A;  4O5V A;  2KMT A;  3TSZ A;  1AOJ A;  1KQS P;  1IRE B;  2V31 A;  3WNC A;  3NMZ C;  1ZA2 B;  4HCC A;  3OSS C;  3QJ6 A;  4XLC A;  4XKV A;  1AHJ B;  3M55 A;  5FO1 A;  8ATC B;  3E19 A;  2DXU A;  3CCU B;  5GAM f;  3OKX A;  3URG A;  2A7Y A;  2NWM A;  2JUF A;  1OHH A;  1F20 A;  1D0Y A;  3UT1 A;  1E1R A;  2DOG A;  4Z1M A;  1VQN B;  4JRI A;  3CEY A;  2HEQ A;  4MZT A;  3NHN A;  2VNH A;  3QXE B;  1QVP A;  1Y96 B;  1KC8 C;  2DD5 A;  1PWT A;  3PA1 A; 
#chains in the Genus database with same CATH homology
 2F1L A;  3HTR A;  2DOG A;  3H9N A;  3A1P A;  1PM3 A;  2QGG A;  2DYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...