3A1PA

Structure of ribosome maturation protein rimm and ribosomal protein s19
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
RLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords Ribosome maturation factor rimM
publication title Structure of Ribosome maturation protein RimM and Ribosomal protein S19
rcsb
source organism Thermus thermophilus
total genus 30
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3a1pA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3a1pA01
2DYIA 2DOGA 3HTRA 2F1LA 2QGGA 1PM3A 3A1PA 3H9NA
chains in the Genus database with same CATH superfamily
2E12A 4K11A 3CCQQ 1VQ7T 3NTHA 4FT2A 1SHGA 4C0FA 3CBPA 1JJ2A 2DL8A 5C0MA 3SB2A 4YAWA 1WI7A 2C77A 4PC7A 4XKVA 2IPOB 3CCVA 1Q86D 2QXFA 1IHVA 2VXEA 3EH2A 5GAMd 4X7EA 1QWFA 5FL7A 1Y07A 4KULA 3CD6A 1YITA 3QO3A 1MNDA 1SEMA 1U2RA 4J83A 1T0JA 1Q7YC 3A8KA 2VYTA 3PMTA 3ASRA 4HVUA 1QWEA 2A0FB 3DLLA 5CQXA 3CC7T 1WOOA 1SF9A 2HBWA 4J7IA 1G3YA 3C12A 2C5HA 4ZCLA 4II1A 4LDUA 1G8XA 3BH4A 3EHQA 2VNKA 2FEIA 3A5ZB 3NTKA 1F20A 2F4NA 4LDYA 2L3PA 2DEQA 2A37A 2H3JA 3VJPA 4C0DB 1R77A 2Z0WA 5HKKA 1EZZB 2E1HA 3N5BB 1VQNA 1MMGA 5A0GA 3G6ET 3PVDA 5GMKh 4UZUA 1JA1A 2D3NA 2YUOA 1QGZA 1OHHA 2ZZGA 4N0AC 1X6BA 2EYWA 4KKSA 1WU8A 2JS0A 2KYMA 2DBKA 4HCKA 1J3TA 4OGEA 2E1BA 1E64A 4YTLA 4RMOA 1VF7A 4N4GA 2CREA 3FC3A 4HE6A 2E70A 2GCXA 2KGTA 1JJ2B 3ASQA 2XEXA 1VQKB 2K3YA 1ELOA 2X3XD 5FLXE 3OYJA 3ZPNA 2FO0A 4JLGA 3CCVB 3A8LB 4OP7A 1MMAA 1AZEA 1T3LA 3VMFA 3MO8A 5GAN6 4IW3B 3CD6B 1YITB 3AGQA 4AVZA 1MMNA 1PKVA 1AEYA 2CUBA 2QDXA 1P92A 3BY1A 4ACBA 1AWWA 2CT3A 2DRMA 1M90D 2B7CA 1R0CB 2RHUA 4JJDA 4P26A 4PFPA 1TOVA 3MHPA 1VQ4A 3OS1A 1M5Q1 4TT3A 1W4SA 1D1CA 3OYCA 4RCBA 5GAOq 1T6XA 3BY2A 4HE5A 2LX7A 3JCMb 3CMEQ 3WXMA 3PIOA 1FMKA 4AT1B 2QDLA 3I55T 4HVVA 2EQKA 4XQFA 1QG0A 3EG9B 1JBMA 4OB1B 1IRXA 5TV2A 2FZCB 3RKYA 2X85A 3JCMW 4OPOA 1TU0B 1VQNB 5A88A 3CMET 4OPSA 1NPRA 1OGIA 2Z6BD 2CZ0B 4EPCA 3SWNA 2ENMA 1QCFA 2RI2A 3PVQA 3QIIA 4Z4UA 1OV3A 2C0TA 4OMLA 2ZCFB 2OTLA 3EHRA 3JCMP 3M5AA 1N0VC 3MKDA 1AD5A 4LNPA 5GAN2 1M8MA 3EGXA 1X43A 5FROA 3V76A 2RI3A 2VGNA 1IREB 3SLDA 4X9CA 2O4XB 2CF4A 4YEJA 2KMTA 1RAHB 5L23A 4Z4RA 1AHJB 4R0KA 3RNJA 3W2HA 1VQOQ 1Q86C 3CCJA 1WDTA 3SLNA 4C5GA 5HK0A 3JCMe 4PAAA 3TCJA 1M1KR 2X0KA 3ONUA 5GANj 4PL6A 1NG2A 1YIJT 3H0FA 1ZSZA 3DLMA 2HD0A 1UD8A 4E7IA 1VQ4B 4N3NA 4RD4A 3FJOA 5GANe 1YLOA 2LVMA 3Q6QA 2DK3A 5GAN7 1VQ6Q 4IUPA 3OYYA 4A54A 3OSVA 1D3BB 4EMKA 1GFCA 4ACAA 1PJ5A 1VQLA 2PLFA 1S72B 4FN5A 3ZZUA 4Q7JB 1BKBA 3JB9D 1NB9A 2RK1A 1YJ9A 1VQ6T 1M1KU 3GQBA 1OPLA 2PVOB 2WSCE 3M0TA 5GMKi 4RM0A 3ZEHA 1IGQA 3SWNB 4C5HA 1KSWA 4ORZA 5IT9E 1QVGS 1NZ9A 2KE9A 1KQSP 3KFVA 3CC2T 5IHIA 1IJEA 1NLOC 2NUPB 3I1FA 2OTLB 1WHJA 1QFJA 3G4SA 4RG2A 2R6HA 4QW2A 2X4WA 2E64A 2PE3A 2DFUA 1OU8A 4AG1C 4MDXA 2LQNA 2YHTA 1NJIR 1KD1U 3PNWC 1N9RA 3SJZA 2E6NA 3G71Q 4ROXA 2RC5A 2QN6A 1YBYA 2B5OA 4KGVB 4OMQA 2GK6A 1YHQT 4X06A 5M9OA 4FK8A 4RTYA 2F2WA 1QVFP 2QA4A 1ZM2A 2LTOA 3QXEB 4C5EA 4C0DC 4II3A 3G71T 1H8KA 1YN8A 2IIMA 3MEUA 1VQ5A 4G6IA 2VC8A 3QYHB 4F04B 1I7PA 3L2QA 5CKHA 1M90C 2NUTA 2BZ8A 3VRYA 3CPWP 1KK2A 1NJIU 4MDWA 2WYRA 4RTVA 1FX7A 2QG9B 4EMKB 1ABQA 4VUBA 1GCQA 4P5NA 1LCKA 2KR3A 1TLLA 3OW2B 5KE3A 2R9VA 3CCQA 2OX7A 3FJPA 1YJ9B 4M78E 2A28A 3GNGA 2YRCA 3HHTB 1BI1A 1DDGA 4P3IA 5IYNA 2ZPIB 1HK9A 1K9AA 4PNOA 1H92A 5GAN4 4XL9A 2EFGA 1RLPC 3C94A 4X9DA 3ZBDA 3OP1A 1KRHA 4L59A 2KEAA 3I56A 3P8DA 4HVWA 4M78F 4OOXA 3G7ZA 1YFNA 3G4SB 4A4HA 1K9MU 4RKUE 5TR9A 5LJ3j 2E10A 3FJ5A 2RHZA 1VQ9Q 2DO3A 2VJJA 3M0PA 2GF7A 5LJ3e 2WJYA 2JTEA 5GAMh 1N07A 2RF0A 4KGZB 1XB2A 1W87A 5CKFA 2FRYA 3X24B 4EMGA 5FWBA 4Y7CA 2PQWA 2QA4B 1W9XA 4DNTB 2E6ZA 4MZPA 4E7ZA 3WQZA 2LJ0A 2PTKA 3QWXX 1VQ8Q 1M3CA 2K9GA 3M58A 3VNVA 1I0CA 1VQ5B 3AVWA 3J80E 2XD0A 3X25B 5GANg 2W0ZA 1H42A 1W2BP 2NUTB 3OMGA 4PFOA 1MABA 4J8OA 1RLQC 2KXCA 3A98A 2WZPP 4E7JA 3QYGB 4TMTA 5LJ3f 1K8AC 1N6AA 1ZQ1A 2LC4A 3CCLA 4AMCA 3CCQB 1WXBA 4PJOG 4E7HA 4AFUC 2ED1A 4HKEA 1PJ6A 4BY6B 1JA0A 3R6OA 4M7AD 1D09B 1VIEA 2JTMA 3SKBA 1E6GA 4XN3A 3GIBA 4XLEA 3M0SA 4L6V5 2YXYA 4JLIA 2RHXA 3LWHA 2OAUA 4F7UE 1FYNA 2MWOA 4RCZA 1H3ZA 2DXCA 2KDSA 2MI6A 3ASKA 1E3XA 3CPFA 2MMPA 4M75G 2QQ9A 5LJ5d 2W10A 1GAWA 2BUDA 1E6HA 1OI1A 1GR1A 1YP5A 5KE2A 3WYAA 2KSSA 3VKIA 1YI2Q 3CCVT 2OBTA 1QVGA 3ZZTA 4F7UF 4AG2C 4LBVA 1ZBJA 2DL7A 1RAEB 3WNDA 4E2FB 1M2VA 2JXBA 4AFSC 3CD6T 1YITT 4NL2A 3EFOA 4C8QB 3H9NA 1D0ZA 1MUZA 4XU2A 2AHOA 4EDUA 4QVDA 4XQ3A 4NCNA 3SWNC 2JNGA 2L3QA 1RACB 4MMKA 4DOVA 1KHCA 4HCCA 5GAOn 3S6WA 4DQ2A 1UD6A 2FPDA 2OBSA 2V7TA 4BDZA 5A89A 2XZLA 1N0UA 1VYTA 3HFOA 4QVZA 4RCCA 1COWA 4GY5A 1AVZC 5IXFA 1VQNT 1ZUNB 3I35A 4M2LA 4C8QD 2GNCA 5KYXA 3VO1A 1WHMA 2HL3A 2H3EB 3QWYA 2NLUA 3VS4A 4ZGJB 4ZGEB 2ZZDA 5C6SA 4Q5WA 2X51A 3I5SA 1VQOA 2ZBUA 4B9WA 2C0OA 1WGSA 4M0LA 5FW9A 3L2VA 2V8IA 2VNHA 1JNYA 3WNCA 1XTDA 4M75A 4XORA 1KC8R 2DE0X 1QVGB 3C0CA 1FNBA 3X26B 5KCOA 1M2VB 4EMKC 2ZL6A 4Z02A 4EH1A 4AF6A 3CMEB 1E1QA 3EFOB 4A53A 1XOVA 5J26A 2V8KA 4M77B 1KQSS 2LDMA 2RH2A 2OBRA 2LCSA 2C4UA 2FZGB 1I5OB 1VQ4T 4Z4ZA 3BNWA 1F1BB 5CK9A 1U06A 1B2RA 3JV3A 4BUGA 1UEBA 3P8BB 5IN1A 4Z8AA 1G5VA 5EG2A 2YSQA 2MYSA 1WQWA 3QSYA 1Q7YD 2QGGA 5LJ5e 3QFTA 2NV4A 1PJ7A 4BACA 1NPPA 1D0XA 1W6XA 4XD7A 1D1BA 5I11A 1QP3A 2MWPA 3DB4A 1FNMA 4J9CA 4XLAA 4M77D 1X6OA 5TY0A 4LBWA 1ACMB 4R71A 2WR8A 1TWBA 1SG5A 3CPWS 4Z88A 1UTIA 1GFDA 2D3LA 2F43A 2X6WA 4JDSA 2OTLT 1VQOB 2JJ9A 5AYFA 3F70A 3HRTA 1SKYB 2ZPBB 5EMNA 4KBMB 3H0IA 3CCJQ 1KK1A 4M75B 2EYZA 4IIOA 2LJ3A 1ZUYA 5GV8A 1EWYA 1VQ6B 1D8TA 4G7XA 3CCJT 4M7DB 2EGAA 3CXCP 2GGRA 4XKWA 3INZA 4TMXA 4CC2A 1TUGB 4JRIA 4OB2B 1DDIA 4IKFA 3OAAA 4DNRB 2K2VA 1YNZA 2K5LA 1GCPA 4A4FA 4BY6C 1VQLQ 4ELZC 3CQTA 3W5HA 2EJ9A 2ZZQA 5H59A 1SM4A 1H85A 1KJZA 2YWWA 3L2WA 5HCKA 4B44A 2JM9A 3JCMJ 2WSEE 1RL2A 2M0YA 4J9EA 1VQLT 1EFRA 1PM3A 2XDBA 3RMSA 1BMFA 3OZWA 1Y0RA 3OJWA 2FRWA 3M0UA 2YRVA 1NEGA 3M0RA 1YJ9T 2KXDA 3VS0A 1E3ZA 3HAGA 3FPKA 2KBTA 4PJMA 2EJGA 4M7DD 1VQ9A 2MOXA 4KT0E 4MYUA 1EFNA 2SRCA 2ECZA 2AIRB 4O6JA 2B7BA 3G71B 4WZLA 5KCHA 3T56B 3CEYA 3OFNA 2LT4A 3G4ST 1Q81D 4J7FA 2VWFA 1VQ8A 5CIUA 2P0PA 3RR6A 3GVKA 2E5QA 2QASA 2HSEB 2RI5A 3KBGA 4B6MA 1E43A 2GREA 4P25A 1P4MA 1U1SA 4P6VF 1K73U 5I2SA 2VBTA 5DS0A 4PC6A 2K4YA 1H8HA 2QA4T 3UA7A 3MJXA 4YALA 5HK3A 2VBUA 1XQHA 2VZLA 3EFRA 3ME9A 4FCYA 4DQLA 1VQ5T 1MGQA 2H8HA 5KYYA 5CO7A 3QFRA 3SEJA 2A36A 4LBYA 4ATOA 3GBQA 3RERA 1IJFA 2YWFA 2FVUA 1RQPA 4XU3A 1ARKA 1H641 4RD2A 2DD4A 1KQSA 1XJWB 2BE9B 2COYA 1PKSA 2KT8A 3ZC3A 3FRNA 3CCQT 4EIKA 2KROA 5LJ5g 4PC2A 2QE7A 4B4DA 3PMIA 2RA2A 1HXDA 3I56Q 1VQ9B 1M1KC 1YI2A 2ZXHA 2DBMA 1S1NA 5CKEA 1WXUA 4QHYA 4C92A 2BZYA 4M77C 4MYTA 3X20B 3I56T 2XICA 2DNUA 4L5GA 3R6NA 4C0GA 1NBMA 3OS0A 2OJ2A 2DX1A 2DIEA 1VQ8B 1OEBA 3OMCA 4DBQA 5LJ5h 3ISXA 1QP2A 2K3XA 5DM7R 4FXUA 3JCMd 1KK3A 3AHUA 1TUIA 2JVVA 1KD1C 3CPWA 1BBZA 4X7FA 4F7DA 2YWHA 1VQMA 4P3YA 3S3NA 5GANd 1D2EA 4E0FA 2D0NA 1R8OB 1ZA1B 4C0ZA 2I2LA 2NWMA 2EW3A 4ZN1A 2DZ9A 1R5BA 1IZ6A 1ZX6A 4KUIA 3M0QA 2KYBA 3M9QA 5KYYB 1B34B 4DA4A 1OULA 2KRMA 2CYZB 3H6ZA 2FX3A 2E1RA 3LH0A 2J05A 1ZLMA 3CCLQ 1SKQA 4C0SA 1YWOA 2Y4XA 3PFSA 3UATA 4OPVA 1AZGB 3VS6A 1OQKA 3CCLT 2D9TA 1X69A 1OU9A 2CT4A 3CCRA 3W5VA 1RI0A 1BQEA 4M75C 4P6YA 1C0MA 1TH7A 1YI2B 1UUEA 2JZ2A 3V7AA 3MP6A 1WYXA 2EJFA 4DBRA 2F5KA 2HQHA 2QTVA 3VS5A 1IXDA 1EFTA 1GJRA 4L8JA 5DLOA 4C92B 4QVJA 4M7DC 1HJDA 3LQEA 5CDFA 3TREA 5CVIA 3M4GA 1T5EA 3PT9A 4F16A 2DL3A 2BVNA 2L0AA 2X4XA 2LJ1A 4ZTJA 5F4MA 4B47A 3KXTA 1K9MC 4OMFB 3CCSQ 3URGA 1KK7A 3S3MA 1WHKA 4OB0B 4OP0A 2EFIA 3CBOA 3FEOA 1Q81C 2XGJA 4FSSA 2OK7A 1Q95G 1VQMB 4FM4B 1LOJA 3PUMA 2B86A 1LNXA 2RN8A 5CCAA 2OYNA 1FWZA 3BC9A 2GTOA 5GAN5 2MCNA 2XIDA 3RESA 3TU4K 2L2PA 4C92D 2E3IA 4JJBA 1N8RR 2W6IA 1C1AA 1AIPA 3VRZA 5GAOm 1D1NA 4XTWA 2HQXA 3QBYA 2ZITA 4DQKA 2V7QA 4JUVA 4FW1A 2AHJB 4BE1A 2DIGA 4A4GA 1GAQA 5LMZA 3CMMA 1UJ0A 4FT4A 5CQYA 2C5BA 2WZNA 2L5QA 5GV7A 3OYDA 2K57A 2ZBVA 1YX2A 3V7RA 3JB9H 3CXCS 3ONYA 1YWPA 2RQRA 1UGQB 2IG0A 4UZFA 5CR2A 1X2KA 3JU4A 1Z9ZA 1X01A 5J3BA 5FA6A 4WWVA 2NPFA 1PC0A 5FO0A 1TXQA 3FIFA 4HCBA 1BJKA 3GVJA 4J9IA 2QEXQ 1VQOT 5HXBA 1BLIA 1K8AD 5LJ3d 1IHMA 3TQ7P 3WXMB 1SSFA 3IQLA 2VXFA 4PC3A 1UD2A 1QLYA 5GAMf 1X6GA 4XLFA 1IO6A 1LVKA 3OY9A 3A35A 3VO2A 3JB9F 1YJNQ 4O5VA 5BSXA 1XE1A 2X3UA 1Q7YR 9ATCB 1BU1A 4FYVB 2O31A 2EVRA 1BPLA 4JZ4A 3LNNA 3AVUA 3AT1B 2DA9A 2HCKA 4ELYC 2RM4A 1QUEA 2O2OA 2P4TA 2CW5A 3TSWA 4QVAA 3HP9A 3JRZA 3TVTA 3W2FA 3CP2A 2JN9A 1PD1A 3S3OA 1Q9SA 4JJCA 1WORA 4RTWA 5JBQA 2XMFA 5D6XA 1OYXA 3VS2A 3RDVA 2RB6A 2XNJA 2M51A 2PZ1A 1Q82R 2J6FA 3PE0A 2F2XA 3EGXB 1QGAA 5IH2A 1YCSB 2FHDA 2DL4A 4V2SA 3O5ZA 2HLDA 3OYBA 2FYKA 2PU9B 3PUNA 1KZLA 1FNCA 2PNIA 3A3GA 4X05A 4Y9UA 3CCJB 2LQWA 5J3OA 2JMCA 5DN6A 1V29B 3UA6A 2GJRA 4N4IA 2ZZEA 1OB2A 1ZSZB 1I1JA 4Z4YA 1Y0MA 2QAZA 1KIKA 3JQRA 1BCMA 4IUVA 3OEHA 1Q82U 2QTLA 2DVEA 2HNIA 2VBVA 4CC7A 2XZPA 2V7WA 1BI2A 4KGXB 1VQLB 1V5VA 2A08A 1W70A 3GNFB 1K73D 2EYQA 1H3HA 5FU7B 5AT1B 3W2GA 5ECAA 3UPUA 1KQ1A 3CCEQ 2KT1A 3JQPA 1QCNA 1QX4A 2DYIA 2RJDA 2YWEA 1VLYA 4AF7A 3JQQA 1MHNA 1GL5A 2X6XA 1BX0A 3WVEB 3ER0A 3CBMA 4PABA 1CKBA 1DG1G 3V7SA 3JCMQ 2M0OA 4Z4SA 2NYSA 3QE2A 4TSFA 4C92C 1B23P 2M1HA 4FSXA 4X7CA 3OYLA 2RHIA 4M1KA 1U3OA 4F14A 3Q39A 4JPBW 1VQ9T 4G1BA 3VR6A 2DTIA 4QFMA 1AWXA 1TVCA 1QKXA 3JCMg 2DPPB 4RD1A 4XNFA 1MRZA 1S4MA 3JCMV 2Q6KA 4AC9A 4J5YA 4RDKA 4GQNA 2EQMA 4WQMA 5D6YA 3OYEA 3EG1A 4RG8A 3E19A 1U1TA 2JUFA 4M7AE 2D9RA 1C6VX 2WPDA 4PGOA 3CXCA 3QJYA 4LD9K 3VYHB 1VQ8T 3DDYA 4N4HA 3RKXA 5EC7A 1BIBA 3X28B 4E47A 1YJWQ 1F60A 1Q86R 1X2QA 2DTHA 5FU6B 1HD3A 3UDCA 4M7AF 3JCMh 3ZL7C 3NTIA 3T53B 4PLLA 2L3SA 3LYIA 2Y90A 4UC4A 3VS1A 2XKOC 4X7DA 3EG3A 4YAOA 5I2MA 5GANh 2O88A 3M4YA 1X27A 2E4HA 4RD6A 2K5FA 1TG0A 2BSAA 2RO0A 1WSRA 5HY6A 3R6KA 4NS5A 4LUEA 4ZGDB 3I56B 2ZPFB 3CC4Q 3VUBA 1CQXA 2LMJA 2VJIA 3SHWA 3OZUA 4PK4A 2XHCA 3L2ZA 3H94A 4Z89A 1W35A 4R56A 2K5IA 1KG1A 2C0IA 2ZL7A 4YELA 1YI2T 1ZSGA 4MZMA 3CCSA 5I22A 3OYKA 2BMWA 1W0JA 3T51B 1M3AA 2E5KA 4OOVA 4DOWA 3I5RA 1UGSB 4NL3A 3QJ6A 1FDRA 4YHBA 2MIOA 4XOTA 3ZFJA 3LQ6A 1CNEA 3G1JA 1WLPB 4C8QE 3HSBA 2XNCA 1BIAA 4QQGA 3LW5E 3PA1A 4E7SA 1A8PA 1VQMQ 1UHCA 4M4SA 1HYOA 5D7UA 3A8JA 3CCUA 4QUZA 1EP3B 1FRNA 4ZCIA 2P84A 3CCLB 3EGDA 2DKGA 1V76A 2WSFE 2R5AA 4C8QF 1VQMT 3EAEA 2LCCA 3OW2P 1K73C 3E20A 3W2EA 2LCLA 4BPRA 4PJOA 4OB3B 5J35A 2JOYA 2AT1B 2KNBB 2P0KA 3PENA 4XMYA 1N9SA 1M90R 4KUDK 2MF2A 2CZ6B 4ZGQB 4Y92A 4WCIA 2CSIA 5B6IA 4BDYA 2RJCA 2AK5A 5GAOr 3CCRQ 1ZSZC 2F1LA 2CZ1B 4N0AA 4XTXA 2YLCA 4E6RA 2BE7D 4PJLA 1KMHA 4BI4A 2QEXA 4XLHA 3SJPA 3QFSA 3OYMA 1BI0A 2CBXA 2J6KA 1BI3A 2W6JA 3FDRA 3OOCA 1I4K1 5LJ3g 1WOPA 3CCRT 2LRQA 2EQJA 1UE9A 4RDJA 1Z9QA 3WY9A 3CRZA 1M90U 2K79A 1GO2A 3CCSB 1KHIA 5FU7C 1G7SA 2CDTA 1YJNA 1KTVA 3H41A 3UT1A 3DKMA 3VV0A 4DEXA 1GRIA 2EKOA 5A0DA 3VYGA 5FIUA 4M77E 1KC8U 1TUDA 3MPUB 1G7RA 2XG8D 5LJ3h 1CNFA 4HCZA 2XDDA 2EYYA 2ROLA 1ZM9A 2HKQB 4JRKA 1M1KD 2IVWA 2OK8A 3EGDB 5IYPA 4ANJA 1QVFS 2P0QA 4M77F 3D7SB 3LLRA 2KQWA 4G5GA 5KYXB 4ASUA 4PJOB 4DK0A 2XI9A 3BE3A 2I1LA 2VGMA 3RMQA 1BK2A 3CMAQ 3P8HA 4Y91A 2ZPGB 3FB9A 2A7YA 4OMNA 2OTJA 3ZZ0A 4KH1B 4WF2A 1K8AR 3B8HA 4E7KA 1M8VA 1KD1D 2V1QA 2A3LA 4YAFA 1UD4A 2RK2A 3Q6RA 1G3SA 5IXBA 5GMKj 2QEXB 4XTUA 1VQPA 1SSHA 1W1FA 1HSQA 3H0HA 5CKBA 3OYAA 3RUXA 5GMKe 4LDXA 1GBQA 1VHOA 2E65A 1GCQC 4LBZA 3UWNA 3QDRB 4BE2A 3V8JA 4J9BA 3CCMQ 4BB7A 1OB0A 3ASPA 5FU6C 4PJOD 5IYWA 2M02A 1YJNB 4FW2A 1NEBA 2QQRA 4JZ3A 3E1YE 1FMVA 2V31A 2O01E 3CCEA 4II2A 2DOGA 3HFNA 1NJID 4M7DE 2L89A 1M9SA 4DBFA 4XK8E 3GPLA 2QGFB 4M75F 1OPKA 2DZCA 2PUKB 2AZVA 3P26A 1MV0B 1UDLA 1CSKA 2MK5A 4M75D 4HA8A 3RBBB 2COWA 1W34A 2BF4A 4ESRA 4M7DF 4NNJA 3U6KA 1R5OA 3M57A 1XNIA 2CS7A 4B3XA 2J6OA 3OSSC 2JN0A 4IURA 2FL7A 1UD5A 4RD3A 2P4RA 1TS9A 3A8MB 3C95A 3CPXA 1W2BS 1NB0A 3QFCA 4ME7A 2PVDB 1NDHA 4XTYA 4LE9A 3WVDB 1K9MD 2CKKA 4PFZA 1JB9A 2GJPA 1Y96A 4XM3A 3V8KA 4GLMA 4X07A 1Y57A 3VNUA 1JB0E 4QKUA 2CH4A 2ROTA 3OZVA 2DMOA 4IUTA 1EXMA 3MP1A 4LUDA 2OAWA 1H8EA 4LD6A 3GP8A 4J9DA 1WXTA 1OOTA 1AWJA 1YJWA 2WJVA 4P2NA 1WIEA 2DY1A 2Q6OA 4PJJA 1EFUA 1E1RA 2KI7A 2LX9A 4TMZA 3CCEB 4IIMA 3FPPA 4HT9A 2F2VA 4XTZA 2DF6A 1JU5C 4PC1A 5GAN3 2HL5C 3B78A 2ED0A 4TMVA 4JS5A 3NHNA 1UECA 3NFCA 5IYRA 2EGCA 2X35A 1PNJA 1VYUA 1NBEB 1NM7A 3L2RA 3CC4A 1VQ7Q 1M2OA 1SHFA 2JS2A 3A8OB 1G83A 5KYNA 2DILA 2K7AA 1R0BG 2KVOA 3PA2A 1GXIE 3MEAA 2DXBA 2BIVA 3PGGA 3MEWA 2HZYA 3BFMA 4QQ6A 4WZTA 4OMMA 4M4ZA 4P1VA 4Y9RA 4IUQA 5IHKA 2V7UA 1VQKA 5A2QE 2C2WA 1V0FA 5LL6S 3CP8A 3JB9G 1ZHIA 2YUQA 2YWGA 5BSYA 1QVFA 2M5SA 1WJQA 3GF5A 2KAFA 3E9FA 3TEEA 5AN9A 1Y96B 3CC7Q 1T0HA 5IYQA 2C78A 1UGVA 1TTTA 3HTRA 2FPFA 2D1XA 2JM8A 3E2UA 5GAOp 5H5JA 3OW2S 3ZIAA 2MPXC 1BB9A 1QH0A 2G6FX 2XNDA 3L42A 2AKLA 2VV5A 3A3BA 2DXUA 2D8JA 1K4US 2XOKA 1YJWB 5GMKl 1MV3A 1VA7A 1BX1A 3JB9I 2YDLA 2VNJA 3EGUA 4B9XA 1EFCA 2ZXIA 3G6EQ 3BW1A 2PUOB 5F4JA 2JTFA 1PWTA 4WZKA 3T9NA 2ZTNA 4PJOC 4OOSA 2F69A 2RHYA 3EG9A 4ZNXA 2GJKA 2X6YA 3U2QA 3V7CA 2X53S 1Q82C 2GK7A 3PVLA 1NJIC 2KY9A 1KQSB 2DYBA 1WZOA 4LDVA 3QKJA 4J9GA 4XU1A 3AVYA 1K76A 3CC4B 1B7TA 3MEVA 4G7WA 4UAJA 5GAOl 5L46A 2BM1A 4TVRA 4X34A 3QHSA 3RIRA 3OBYA 3EH1A 2RNAA 1FX0A 1UMKA 1UGRB 2SEMA 3L2UA 3JB9J 4BI8B 1UJYA 4GBQA 4LDWA 2ZL5A 3OYHA 1RAIB 4LC0A 1QVFB 2XK0A 4OMOA 4D6WA 1A0NB 4RPBA 5GMKm 2O4XA 2XZOA 4C92E 3FLGA 2GQFA 4JRPA 4XONA 1UHFA 4OF1A 4RTUA 1W2BA 3A8HB 2QMUA 3CPWB 2G3RA 4RD0A 4WZEA 3I55Q 2EYXA 3OYFA 4M78G 4HT8A 3CCST 5KNLA 4C92F 3CB4A 1HVXA 2HAXA 4HIZA 1GVHA 3NMZC 1D3BA 4RCYA 2JDIA 2BV3A 4OVAA 1KC8D 1VUBA 3CCUQ 1KJWA 3OA6A 2KVQG 1S72A 1EP2B 1OGJA 1I8FA 3EFSA 3AGPA 2V26A 4J9HA 4A4EA 1I81A 5GAMj 4M53A 3U6BA 1SPKA 4PKCC 3CMAA 3GSIA 4P22A 3CCUT 2CH4W 2EBPA 1PG5B 1PRLC 5GAMe 3NGPA 2QTXA 3DB3A 2QYZA 3CCRB 2RC6A 4WTOB 4NOYA 4CC4B 5HZBA 3ASTA 2BZXA 1M4ZA 2E41A 1EIFA 2NUPA 5D6WA 5DY9A 1N06A 2RQVA 3AVVA 1N8RU 5A8AA 1N5ZA 2YUPA 1S0UA 3OKXA 2MAMA 1ZBXA 2CRVA 4KRTA 1K0SA 1UD3A 1VHEA 7AT1B 4M7AG 4D8KA 1I07A 3GOXA 3CCMA 1YIJQ 4FYXB 1I8DA 5FNZA 1HZEA 2VASA 1RAFB 1TSFA 2M9UA 2CC2A 1E7OA 5E6TA 2QEXT 2EQUA 4OGCA 1FRQA 1WHHA 3J81k 2NUZA 2LZJA 5DSZA 1W2BB 1WA7A 4J9FA 1N05A 3J81E 1SRLA 3HPWA 1Y0YA 3BCDA 1G2BA 2FZKB 2Q6IA 4XAXB 3OW7A 1OX8A 3LO8A 1YJNT 3THKA 1NE8A 3A1PA 2JIZA 4FYWB 3LGLA 3I9QA 4M78A 5KH6A 2QQSA 5HZAA 4AFZC 1UG1A 4XTVA 3HKSA 4J6XA 2PMDA 3JSCA 3U23A 4F7UG 3OW2A 3EG2A 2DLPA 2KRSA 2HQEA 1KD1R 1QFZA 2VBSA 3JCMf 3CC2Q 1Q7YU 3CMAB 2YUNA 2BGIA 1WJSA 3H8ZA 5KYWA 3M59A 3HRSA 2K6DA 2YT6A 3VS7A 3M54A 2ZGWA 2R58A 1JJ2P 1I5LA 1N08A 5GANf 4RDLA 2LNHB 2PVGB 2OTJQ 4J0QA 4Z4WA 3JCMc 3G05A 4X1VA 2FPEA 2X4JA 4Z1MA 4A4KA 1TUCA 1YHQQ 2BM0A 1OZ2A 3QUIA 2CGHA 4FIBA 2OTJT 1AWOA 2RJEA 1VQPQ 3OJXA 3CCMB 2ATCB 2BKDN 4C8QG 3BCFA 4DBHA 4X8IA 2EKHA 2XDPA 3OE7A 4J6WA 4M7AA 3ZBUA 2CP5A 6AT1B 2DETA 5THXA 1RUWA 1JQQA 1MNEA 1ZUKA 1ZM4A 1VQPT 1MMDA 4RTZA 3ZBTA 3OBWA 4KH0B 2HMAA 3W5UA 2FVGA 2HSPA 1RI9A 3REAB 2CP7A 3QZ9B 4ZN3A 2CP3A 5FO1A 1WHLA 4CC3A 4UZEA 5HKCA 4P12A 1ABOA 1JRIA 1IB0A 4TKOB 1WOSA 1VQ7A 4M78B 3CCET 3OPOA 1I18A 3WBKA 1VYVA 2VB6A 1K9MR 2GPJA 1AOJA 3CW2A 1NLPC 1D0YA 4A63B 1KQ2A 2CK3A 1TTHB 2K2MA 2ZTGA 1Q81R 1KC8C 4F7UA 2F1MA 4HXJA 3VUZA 4LXCA 3HRUA 5A0LA 5KYWB 1IHWA 3UF4A 1DARA 1AMOA 2CUDA 1WPYA 5GAMg 4KKUA 4C43A 2JJ1A 2D8HA 1XFOA 3BDUA 5IAYA 3CC7A 4FYYB 3NE5B 2GQVA 4B3FX 8AT1B 2EQIA 2VYQA 4M78D 3D26A 3QG1A 1M1FA 3CESA 2VNIA 3VU3C 2ZZFA 1B07A 3R6JA 1FXXA 1Q81U 2C4TA 3AVXA 1M27C 4M77G 4JS4A 3FKSA 1WTHD 2VUBA 4M7AB 3G6EA 4C8QA 1M1GA 2QQAA 2O9SA 3LH5A 1JO8A 1QCOA 2B8AA 2LQ8A 3M55A 2C06A 1B3QA 2PIAA 4XN0A 4N3GA 4NBSA 1VIFA 1BCOA 1YJWT 1K0XA 2V7VA 3QPHA 5TRDA 4X0CA 2YRDA 1U8RA 1VQ7B 1LJOA 1JXMA 4FL6A 4QV2A 1WFWA 3Q1JA 3ES9A 2RQUA 1Q86U 2RQWA 4GLKA 3KEWA 3OS5A 4F7UB 5I21A 1WP6A 3JAME 4RPDA 2LZ6B 2LP5A 1J9ZA 1WJRA 4Y28E 3CC4T 4ZGNB 1R5NA 1PSFA 1VQKQ 4MZTA 3L1AA 3CC7B 1NYGA 1Y71A 4CQJA 3EG0A 2ZPHB 3QZ5B 3CCVQ 3E9GA 1IGUA 1IB8A 4DEYA 3C4SA 2HCJB 4EMHA 4YAUA 3CD6Q 5L8RE 2HBPA 1YITQ 4BI3A 2O9VA 1VQKT 2QK0A 5GJWB 3M53A 3OQ5A 1ZA2B 3SD4A 3RKWA 4KKTA 3I55A 3NPFA 1G3TA 5KYUA 4B48A 1PHTA 3CXCB 2R5MA 2LNVA 1G7CA 4M7DG 3O8VA 5CAIA 2CNDA 2L8DA 2FG0A 1O9SA 3G6EB 4XLCA 3CMEA 2ESWA 4PJNA 1UGPB 4M77A 4CRIA 2DEUA 2ZAEA 2DCUA 1EP1B 1O75A 2ABLA 4JMQA 3TSZA 1KFZA 2DL5A 2GQIA 1M30A 4QVCA 2QDYB 1T6YA 1K28D 2EPDA 3OYNA 3LX7A 2M16A 1RAAB 1QGYA 2AZSA 4RTTA 3MCAA 1VJSA 1OZ3A 1ZUUA 1PKTA 2VKNA 1SRMA 3M56A 5CKDA 4ZTFA 1HA3A 1AT1B 1VQNQ 2RD1A 2KRNA 3GIRA 3KL9A 2X8KA 4QT7A 3WBJA 1PCXA 5IK2A 4BE0A 4Z4TA 1NRKA 2DRKA 2DJQA 3REBB 4OMPA 5FRMA 2DM1A 1QVPA 2WACA 4D8DA 4JJNK 1VOMA 3LGFA 2RQTA 1WQ7A 2J7IA 2BTTA 1YIJA 2CP0A 1N8RD 1W0KA 2HDNB 2K3BA 2EIXA 2P3MA 3MP8A 4FU6A 2X4YA 4FWTA 1PSEA 2FB7A 3QSUA 2GTJA 4P9SA 3I55B 2F5TX 5KYUB 2GFUA 2X9HA 2OI3A 1UFFA 4M78C 2JJ2A 2RJFA 2ZPEB 1T3SA 1VQ4Q 2GFAA 1VQ6A 1JJ2S 2CP6A 2BN4A 1QUFA 4M7DA 3CCUB 1D1AA 3B82A 2J7KA 2V8JA 5DLQE 1QMCA 1VLOA 1RADB 1N27A 1UB4A 3CC2A 2J06A 1S72Q 3MCAB 3BDLA 1WSVA 4B43A 3A8IA 1LPLA 2RPNA 1G3WA 2RMOA 4R55A 1WPCA 2I0NA 5LJ5j 1NYFA 3BQJA 1T6ZA 4TMWA 2KK4A 4AFQC 2EWNA 1S72T 3MMPA 4B3GA 3KUFA 4PJOE 1CKAA 1SKUB 1X75C 1JEGA 4U9UA 3CMAT 2LQKA 1YHQA 5KW9A 2OTLQ 4PLIA 3OYIA 4XU0A 2HDAA 5J39A 3RY8A 2D0QB 2VVKA 4RTXA 4DK1A 3G71A 2HKNA 1YIJB 4M7AC 2EGEA 2LT1A 1OX9A 4PJOF 3W2IA 1V0EA 4M75E 4QQDA 2DERA 3ASSA 1E62A 1WX6A 2BGJA 2EAYA 2DXTA 2JW4A 2COZA 4RUGA 3OYGA 1K8AU 3VS3A 1Q82D 2YLBA 1KK0A 4YXWA 2CP2A 5LJ5f 2DTOA 1DJ7B 1QKWA 2V4DA 2V7XA 3CCMT 4RLZA 1U5SA 3LVBA 2BPOA 3HL8A 2GBQA 2D74A 5F4OA 1EX4A 4XR6A 2DAQA 1PD0A 1V1CA 1M3BA 2DIQA 1FNDA 3QDFA 3GLXA 2D6FA 2HEQA 1BYMA 3CC2B 4F17A 1WHGA 1QFYA 3SFMA 3ZUGA 1RAGB 3AVTA 3E1SA 1Y7XA 1YJ9Q 4K1XA 4MMLA 2DD5A 4CI0C 4J6YA 2DVJA 2OTJB 3ULRB 4E7LA 4TN1A 1FMWA 4IUUA 3OS2A 3SDZA 2X3WD 1YHQB 5KSWB 4LN2A 1G7TA 4C92G 3G4SQ 1OB5A 1K73R 2JT4A 3PTAA 1YCYA 1VQPB 3J7AF 1E63A 5FRNA 4XOPA 3LWIA 4C5IA 4ZCMA 3OB9A 3SEMA 2EIFA 4C8QC 5IHNA 2E3HA 4BD3A 5GJVB 1QVGP 3Q38A 2WSSA 1ZM3A 4Z4VA 4H9GA 3OEEA 3Q3AA 2CZ7B 1N8RC 3META 3V8LA 5FWCA 4JRQA 3BY7A 1GBRA 3P27A 1WNLA 1XQBA 1QQJA 2XU8A 3MHXA 2QA4Q 2R57A 3GVLA 4G1VA 1WDXA 2QQBA 2Y4YA 4RJLA 2QI2A 1VQ5Q 2DJZA 1PRMC 1JXOA 2CSQA 2QTZA 5GAN8 2JMAA 3CTAA 1RABB 1RQRA 8ATCB 3PIPA 4ZV4A 1QW1A 3WNBA 2V1RA 1B34A 1K1ZA 1E79A 2AKKA 3JCMX 2L3RA 2Q6LA 3A8GB
chains in the Genus database with same CATH topology
2DYIA 2DOGA 3HTRA 2F1LA 2QGGA 1PM3A 3A1PA 3H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYI A;  2DOG A;  3HTR A;  2F1L A;  2QGG A;  1PM3 A;  3A1P A;  3H9N A; 
#chains in the Genus database with same CATH topology
 2E12 A;  4K11 A;  3CCQ Q;  1VQ7 T;  3NTH A;  4FT2 A;  1SHG A;  4C0F A;  3CBP A;  1JJ2 A;  2DL8 A;  5C0M A;  3SB2 A;  4YAW A;  1WI7 A;  2C77 A;  4PC7 A;  4XKV A;  2IPO B;  3CCV A;  1Q86 D;  2QXF A;  1IHV A;  2VXE A;  3EH2 A;  5GAM d;  4X7E A;  1QWF A;  5FL7 A;  1Y07 A;  4KUL A;  3CD6 A;  1YIT A;  3QO3 A;  1MND A;  1SEM A;  1U2R A;  4J83 A;  1T0J A;  1Q7Y C;  3A8K A;  2VYT A;  3PMT A;  3ASR A;  4HVU A;  1QWE A;  2A0F B;  3DLL A;  5CQX A;  3CC7 T;  1WOO A;  1SF9 A;  2HBW A;  4J7I A;  1G3Y A;  3C12 A;  2C5H A;  4ZCL A;  4II1 A;  4LDU A;  1G8X A;  3BH4 A;  3EHQ A;  2VNK A;  2FEI A;  3A5Z B;  3NTK A;  1F20 A;  2F4N A;  4LDY A;  2L3P A;  2DEQ A;  2A37 A;  2H3J A;  3VJP A;  4C0D B;  1R77 A;  2Z0W A;  5HKK A;  1EZZ B;  2E1H A;  3N5B B;  1VQN A;  1MMG A;  5A0G A;  3G6E T;  3PVD A;  5GMK h;  4UZU A;  1JA1 A;  2D3N A;  2YUO A;  1QGZ A;  1OHH A;  2ZZG A;  4N0A C;  1X6B A;  2EYW A;  4KKS A;  1WU8 A;  2JS0 A;  2KYM A;  2DBK A;  4HCK A;  1J3T A;  4OGE A;  2E1B A;  1E64 A;  4YTL A;  4RMO A;  1VF7 A;  4N4G A;  2CRE A;  3FC3 A;  4HE6 A;  2E70 A;  2GCX A;  2KGT A;  1JJ2 B;  3ASQ A;  2XEX A;  1VQK B;  2K3Y A;  1ELO A;  2X3X D;  5FLX E;  3OYJ A;  3ZPN A;  2FO0 A;  4JLG A;  3CCV B;  3A8L B;  4OP7 A;  1MMA A;  1AZE A;  1T3L A;  3VMF A;  3MO8 A;  5GAN 6;  4IW3 B;  3CD6 B;  1YIT B;  3AGQ A;  4AVZ A;  1MMN A;  1PKV A;  1AEY A;  2CUB A;  2QDX A;  1P92 A;  3BY1 A;  4ACB A;  1AWW A;  2CT3 A;  2DRM A;  1M90 D;  2B7C A;  1R0C B;  2RHU A;  4JJD A;  4P26 A;  4PFP A;  1TOV A;  3MHP A;  1VQ4 A;  3OS1 A;  1M5Q 1;  4TT3 A;  1W4S A;  1D1C A;  3OYC A;  4RCB A;  5GAO q;  1T6X A;  3BY2 A;  4HE5 A;  2LX7 A;  3JCM b;  3CME Q;  3WXM A;  3PIO A;  1FMK A;  4AT1 B;  2QDL A;  3I55 T;  4HVV A;  2EQK A;  4XQF A;  1QG0 A;  3EG9 B;  1JBM A;  4OB1 B;  1IRX A;  5TV2 A;  2FZC B;  3RKY A;  2X85 A;  3JCM W;  4OPO A;  1TU0 B;  1VQN B;  5A88 A;  3CME T;  4OPS A;  1NPR A;  1OGI A;  2Z6B D;  2CZ0 B;  4EPC A;  3SWN A;  2ENM A;  1QCF A;  2RI2 A;  3PVQ A;  3QII A;  4Z4U A;  1OV3 A;  2C0T A;  4OML A;  2ZCF B;  2OTL A;  3EHR A;  3JCM P;  3M5A A;  1N0V C;  3MKD A;  1AD5 A;  4LNP A;  5GAN 2;  1M8M A;  3EGX A;  1X43 A;  5FRO A;  3V76 A;  2RI3 A;  2VGN A;  1IRE B;  3SLD A;  4X9C A;  2O4X B;  2CF4 A;  4YEJ A;  2KMT A;  1RAH B;  5L23 A;  4Z4R A;  1AHJ B;  4R0K A;  3RNJ A;  3W2H A;  1VQO Q;  1Q86 C;  3CCJ A;  1WDT A;  3SLN A;  4C5G A;  5HK0 A;  3JCM e;  4PAA A;  3TCJ A;  1M1K R;  2X0K A;  3ONU A;  5GAN j;  4PL6 A;  1NG2 A;  1YIJ T;  3H0F A;  1ZSZ A;  3DLM A;  2HD0 A;  1UD8 A;  4E7I A;  1VQ4 B;  4N3N A;  4RD4 A;  3FJO A;  5GAN e;  1YLO A;  2LVM A;  3Q6Q A;  2DK3 A;  5GAN 7;  1VQ6 Q;  4IUP A;  3OYY A;  4A54 A;  3OSV A;  1D3B B;  4EMK A;  1GFC A;  4ACA A;  1PJ5 A;  1VQL A;  2PLF A;  1S72 B;  4FN5 A;  3ZZU A;  4Q7J B;  1BKB A;  3JB9 D;  1NB9 A;  2RK1 A;  1YJ9 A;  1VQ6 T;  1M1K U;  3GQB A;  1OPL A;  2PVO B;  2WSC E;  3M0T A;  5GMK i;  4RM0 A;  3ZEH A;  1IGQ A;  3SWN B;  4C5H A;  1KSW A;  4ORZ A;  5IT9 E;  1QVG S;  1NZ9 A;  2KE9 A;  1KQS P;  3KFV A;  3CC2 T;  5IHI A;  1IJE A;  1NLO C;  2NUP B;  3I1F A;  2OTL B;  1WHJ A;  1QFJ A;  3G4S A;  4RG2 A;  2R6H A;  4QW2 A;  2X4W A;  2E64 A;  2PE3 A;  2DFU A;  1OU8 A;  4AG1 C;  4MDX A;  2LQN A;  2YHT A;  1NJI R;  1KD1 U;  3PNW C;  1N9R A;  3SJZ A;  2E6N A;  3G71 Q;  4ROX A;  2RC5 A;  2QN6 A;  1YBY A;  2B5O A;  4KGV B;  4OMQ A;  2GK6 A;  1YHQ T;  4X06 A;  5M9O A;  4FK8 A;  4RTY A;  2F2W A;  1QVF P;  2QA4 A;  1ZM2 A;  2LTO A;  3QXE B;  4C5E A;  4C0D C;  4II3 A;  3G71 T;  1H8K A;  1YN8 A;  2IIM A;  3MEU A;  1VQ5 A;  4G6I A;  2VC8 A;  3QYH B;  4F04 B;  1I7P A;  3L2Q A;  5CKH A;  1M90 C;  2NUT A;  2BZ8 A;  3VRY A;  3CPW P;  1KK2 A;  1NJI U;  4MDW A;  2WYR A;  4RTV A;  1FX7 A;  2QG9 B;  4EMK B;  1ABQ A;  4VUB A;  1GCQ A;  4P5N A;  1LCK A;  2KR3 A;  1TLL A;  3OW2 B;  5KE3 A;  2R9V A;  3CCQ A;  2OX7 A;  3FJP A;  1YJ9 B;  4M78 E;  2A28 A;  3GNG A;  2YRC A;  3HHT B;  1BI1 A;  1DDG A;  4P3I A;  5IYN A;  2ZPI B;  1HK9 A;  1K9A A;  4PNO A;  1H92 A;  5GAN 4;  4XL9 A;  2EFG A;  1RLP C;  3C94 A;  4X9D A;  3ZBD A;  3OP1 A;  1KRH A;  4L59 A;  2KEA A;  3I56 A;  3P8D A;  4HVW A;  4M78 F;  4OOX A;  3G7Z A;  1YFN A;  3G4S B;  4A4H A;  1K9M U;  4RKU E;  5TR9 A;  5LJ3 j;  2E10 A;  3FJ5 A;  2RHZ A;  1VQ9 Q;  2DO3 A;  2VJJ A;  3M0P A;  2GF7 A;  5LJ3 e;  2WJY A;  2JTE A;  5GAM h;  1N07 A;  2RF0 A;  4KGZ B;  1XB2 A;  1W87 A;  5CKF A;  2FRY A;  3X24 B;  4EMG A;  5FWB A;  4Y7C A;  2PQW A;  2QA4 B;  1W9X A;  4DNT B;  2E6Z A;  4MZP A;  4E7Z A;  3WQZ A;  2LJ0 A;  2PTK A;  3QWX X;  1VQ8 Q;  1M3C A;  2K9G A;  3M58 A;  3VNV A;  1I0C A;  1VQ5 B;  3AVW A;  3J80 E;  2XD0 A;  3X25 B;  5GAN g;  2W0Z A;  1H42 A;  1W2B P;  2NUT B;  3OMG A;  4PFO A;  1MAB A;  4J8O A;  1RLQ C;  2KXC A;  3A98 A;  2WZP P;  4E7J A;  3QYG B;  4TMT A;  5LJ3 f;  1K8A C;  1N6A A;  1ZQ1 A;  2LC4 A;  3CCL A;  4AMC A;  3CCQ B;  1WXB A;  4PJO G;  4E7H A;  4AFU C;  2ED1 A;  4HKE A;  1PJ6 A;  4BY6 B;  1JA0 A;  3R6O A;  4M7A D;  1D09 B;  1VIE A;  2JTM A;  3SKB A;  1E6G A;  4XN3 A;  3GIB A;  4XLE A;  3M0S A;  4L6V 5;  2YXY A;  4JLI A;  2RHX A;  3LWH A;  2OAU A;  4F7U E;  1FYN A;  2MWO A;  4RCZ A;  1H3Z A;  2DXC A;  2KDS A;  2MI6 A;  3ASK A;  1E3X A;  3CPF A;  2MMP A;  4M75 G;  2QQ9 A;  5LJ5 d;  2W10 A;  1GAW A;  2BUD A;  1E6H A;  1OI1 A;  1GR1 A;  1YP5 A;  5KE2 A;  3WYA A;  2KSS A;  3VKI A;  1YI2 Q;  3CCV T;  2OBT A;  1QVG A;  3ZZT A;  4F7U F;  4AG2 C;  4LBV A;  1ZBJ A;  2DL7 A;  1RAE B;  3WND A;  4E2F B;  1M2V A;  2JXB A;  4AFS C;  3CD6 T;  1YIT T;  4NL2 A;  3EFO A;  4C8Q B;  3H9N A;  1D0Z A;  1MUZ A;  4XU2 A;  2AHO A;  4EDU A;  4QVD A;  4XQ3 A;  4NCN A;  3SWN C;  2JNG A;  2L3Q A;  1RAC B;  4MMK A;  4DOV A;  1KHC A;  4HCC A;  5GAO n;  3S6W A;  4DQ2 A;  1UD6 A;  2FPD A;  2OBS A;  2V7T A;  4BDZ A;  5A89 A;  2XZL A;  1N0U A;  1VYT A;  3HFO A;  4QVZ A;  4RCC A;  1COW A;  4GY5 A;  1AVZ C;  5IXF A;  1VQN T;  1ZUN B;  3I35 A;  4M2L A;  4C8Q D;  2GNC A;  5KYX A;  3VO1 A;  1WHM A;  2HL3 A;  2H3E B;  3QWY A;  2NLU A;  3VS4 A;  4ZGJ B;  4ZGE B;  2ZZD A;  5C6S A;  4Q5W A;  2X51 A;  3I5S A;  1VQO A;  2ZBU A;  4B9W A;  2C0O A;  1WGS A;  4M0L A;  5FW9 A;  3L2V A;  2V8I A;  2VNH A;  1JNY A;  3WNC A;  1XTD A;  4M75 A;  4XOR A;  1KC8 R;  2DE0 X;  1QVG B;  3C0C A;  1FNB A;  3X26 B;  5KCO A;  1M2V B;  4EMK C;  2ZL6 A;  4Z02 A;  4EH1 A;  4AF6 A;  3CME B;  1E1Q A;  3EFO B;  4A53 A;  1XOV A;  5J26 A;  2V8K A;  4M77 B;  1KQS S;  2LDM A;  2RH2 A;  2OBR A;  2LCS A;  2C4U A;  2FZG B;  1I5O B;  1VQ4 T;  4Z4Z A;  3BNW A;  1F1B B;  5CK9 A;  1U06 A;  1B2R A;  3JV3 A;  4BUG A;  1UEB A;  3P8B B;  5IN1 A;  4Z8A A;  1G5V A;  5EG2 A;  2YSQ A;  2MYS A;  1WQW A;  3QSY A;  1Q7Y D;  2QGG A;  5LJ5 e;  3QFT A;  2NV4 A;  1PJ7 A;  4BAC A;  1NPP A;  1D0X A;  1W6X A;  4XD7 A;  1D1B A;  5I11 A;  1QP3 A;  2MWP A;  3DB4 A;  1FNM A;  4J9C A;  4XLA A;  4M77 D;  1X6O A;  5TY0 A;  4LBW A;  1ACM B;  4R71 A;  2WR8 A;  1TWB A;  1SG5 A;  3CPW S;  4Z88 A;  1UTI A;  1GFD A;  2D3L A;  2F43 A;  2X6W A;  4JDS A;  2OTL T;  1VQO B;  2JJ9 A;  5AYF A;  3F70 A;  3HRT A;  1SKY B;  2ZPB B;  5EMN A;  4KBM B;  3H0I A;  3CCJ Q;  1KK1 A;  4M75 B;  2EYZ A;  4IIO A;  2LJ3 A;  1ZUY A;  5GV8 A;  1EWY A;  1VQ6 B;  1D8T A;  4G7X A;  3CCJ T;  4M7D B;  2EGA A;  3CXC P;  2GGR A;  4XKW A;  3INZ A;  4TMX A;  4CC2 A;  1TUG B;  4JRI A;  4OB2 B;  1DDI A;  4IKF A;  3OAA A;  4DNR B;  2K2V A;  1YNZ A;  2K5L A;  1GCP A;  4A4F A;  4BY6 C;  1VQL Q;  4ELZ C;  3CQT A;  3W5H A;  2EJ9 A;  2ZZQ A;  5H59 A;  1SM4 A;  1H85 A;  1KJZ A;  2YWW A;  3L2W A;  5HCK A;  4B44 A;  2JM9 A;  3JCM J;  2WSE E;  1RL2 A;  2M0Y A;  4J9E A;  1VQL T;  1EFR A;  1PM3 A;  2XDB A;  3RMS A;  1BMF A;  3OZW A;  1Y0R A;  3OJW A;  2FRW A;  3M0U A;  2YRV A;  1NEG A;  3M0R A;  1YJ9 T;  2KXD A;  3VS0 A;  1E3Z A;  3HAG A;  3FPK A;  2KBT A;  4PJM A;  2EJG A;  4M7D D;  1VQ9 A;  2MOX A;  4KT0 E;  4MYU A;  1EFN A;  2SRC A;  2ECZ A;  2AIR B;  4O6J A;  2B7B A;  3G71 B;  4WZL A;  5KCH A;  3T56 B;  3CEY A;  3OFN A;  2LT4 A;  3G4S T;  1Q81 D;  4J7F A;  2VWF A;  1VQ8 A;  5CIU A;  2P0P A;  3RR6 A;  3GVK A;  2E5Q A;  2QAS A;  2HSE B;  2RI5 A;  3KBG A;  4B6M A;  1E43 A;  2GRE A;  4P25 A;  1P4M A;  1U1S A;  4P6V F;  1K73 U;  5I2S A;  2VBT A;  5DS0 A;  4PC6 A;  2K4Y A;  1H8H A;  2QA4 T;  3UA7 A;  3MJX A;  4YAL A;  5HK3 A;  2VBU A;  1XQH A;  2VZL A;  3EFR A;  3ME9 A;  4FCY A;  4DQL A;  1VQ5 T;  1MGQ A;  2H8H A;  5KYY A;  5CO7 A;  3QFR A;  3SEJ A;  2A36 A;  4LBY A;  4ATO A;  3GBQ A;  3RER A;  1IJF A;  2YWF A;  2FVU A;  1RQP A;  4XU3 A;  1ARK A;  1H64 1;  4RD2 A;  2DD4 A;  1KQS A;  1XJW B;  2BE9 B;  2COY A;  1PKS A;  2KT8 A;  3ZC3 A;  3FRN A;  3CCQ T;  4EIK A;  2KRO A;  5LJ5 g;  4PC2 A;  2QE7 A;  4B4D A;  3PMI A;  2RA2 A;  1HXD A;  3I56 Q;  1VQ9 B;  1M1K C;  1YI2 A;  2ZXH A;  2DBM A;  1S1N A;  5CKE A;  1WXU A;  4QHY A;  4C92 A;  2BZY A;  4M77 C;  4MYT A;  3X20 B;  3I56 T;  2XIC A;  2DNU A;  4L5G A;  3R6N A;  4C0G A;  1NBM A;  3OS0 A;  2OJ2 A;  2DX1 A;  2DIE A;  1VQ8 B;  1OEB A;  3OMC A;  4DBQ A;  5LJ5 h;  3ISX A;  1QP2 A;  2K3X A;  5DM7 R;  4FXU A;  3JCM d;  1KK3 A;  3AHU A;  1TUI A;  2JVV A;  1KD1 C;  3CPW A;  1BBZ A;  4X7F A;  4F7D A;  2YWH A;  1VQM A;  4P3Y A;  3S3N A;  5GAN d;  1D2E A;  4E0F A;  2D0N A;  1R8O B;  1ZA1 B;  4C0Z A;  2I2L A;  2NWM A;  2EW3 A;  4ZN1 A;  2DZ9 A;  1R5B A;  1IZ6 A;  1ZX6 A;  4KUI A;  3M0Q A;  2KYB A;  3M9Q A;  5KYY B;  1B34 B;  4DA4 A;  1OUL A;  2KRM A;  2CYZ B;  3H6Z A;  2FX3 A;  2E1R A;  3LH0 A;  2J05 A;  1ZLM A;  3CCL Q;  1SKQ A;  4C0S A;  1YWO A;  2Y4X A;  3PFS A;  3UAT A;  4OPV A;  1AZG B;  3VS6 A;  1OQK A;  3CCL T;  2D9T A;  1X69 A;  1OU9 A;  2CT4 A;  3CCR A;  3W5V A;  1RI0 A;  1BQE A;  4M75 C;  4P6Y A;  1C0M A;  1TH7 A;  1YI2 B;  1UUE A;  2JZ2 A;  3V7A A;  3MP6 A;  1WYX A;  2EJF A;  4DBR A;  2F5K A;  2HQH A;  2QTV A;  3VS5 A;  1IXD A;  1EFT A;  1GJR A;  4L8J A;  5DLO A;  4C92 B;  4QVJ A;  4M7D C;  1HJD A;  3LQE A;  5CDF A;  3TRE A;  5CVI A;  3M4G A;  1T5E A;  3PT9 A;  4F16 A;  2DL3 A;  2BVN A;  2L0A A;  2X4X A;  2LJ1 A;  4ZTJ A;  5F4M A;  4B47 A;  3KXT A;  1K9M C;  4OMF B;  3CCS Q;  3URG A;  1KK7 A;  3S3M A;  1WHK A;  4OB0 B;  4OP0 A;  2EFI A;  3CBO A;  3FEO A;  1Q81 C;  2XGJ A;  4FSS A;  2OK7 A;  1Q95 G;  1VQM B;  4FM4 B;  1LOJ A;  3PUM A;  2B86 A;  1LNX A;  2RN8 A;  5CCA A;  2OYN A;  1FWZ A;  3BC9 A;  2GTO A;  5GAN 5;  2MCN A;  2XID A;  3RES A;  3TU4 K;  2L2P A;  4C92 D;  2E3I A;  4JJB A;  1N8R R;  2W6I A;  1C1A A;  1AIP A;  3VRZ A;  5GAO m;  1D1N A;  4XTW A;  2HQX A;  3QBY A;  2ZIT A;  4DQK A;  2V7Q A;  4JUV A;  4FW1 A;  2AHJ B;  4BE1 A;  2DIG A;  4A4G A;  1GAQ A;  5LMZ A;  3CMM A;  1UJ0 A;  4FT4 A;  5CQY A;  2C5B A;  2WZN A;  2L5Q A;  5GV7 A;  3OYD A;  2K57 A;  2ZBV A;  1YX2 A;  3V7R A;  3JB9 H;  3CXC S;  3ONY A;  1YWP A;  2RQR A;  1UGQ B;  2IG0 A;  4UZF A;  5CR2 A;  1X2K A;  3JU4 A;  1Z9Z A;  1X01 A;  5J3B A;  5FA6 A;  4WWV A;  2NPF A;  1PC0 A;  5FO0 A;  1TXQ A;  3FIF A;  4HCB A;  1BJK A;  3GVJ A;  4J9I A;  2QEX Q;  1VQO T;  5HXB A;  1BLI A;  1K8A D;  5LJ3 d;  1IHM A;  3TQ7 P;  3WXM B;  1SSF A;  3IQL A;  2VXF A;  4PC3 A;  1UD2 A;  1QLY A;  5GAM f;  1X6G A;  4XLF A;  1IO6 A;  1LVK A;  3OY9 A;  3A35 A;  3VO2 A;  3JB9 F;  1YJN Q;  4O5V A;  5BSX A;  1XE1 A;  2X3U A;  1Q7Y R;  9ATC B;  1BU1 A;  4FYV B;  2O31 A;  2EVR A;  1BPL A;  4JZ4 A;  3LNN A;  3AVU A;  3AT1 B;  2DA9 A;  2HCK A;  4ELY C;  2RM4 A;  1QUE A;  2O2O A;  2P4T A;  2CW5 A;  3TSW A;  4QVA A;  3HP9 A;  3JRZ A;  3TVT A;  3W2F A;  3CP2 A;  2JN9 A;  1PD1 A;  3S3O A;  1Q9S A;  4JJC A;  1WOR A;  4RTW A;  5JBQ A;  2XMF A;  5D6X A;  1OYX A;  3VS2 A;  3RDV A;  2RB6 A;  2XNJ A;  2M51 A;  2PZ1 A;  1Q82 R;  2J6F A;  3PE0 A;  2F2X A;  3EGX B;  1QGA A;  5IH2 A;  1YCS B;  2FHD A;  2DL4 A;  4V2S A;  3O5Z A;  2HLD A;  3OYB A;  2FYK A;  2PU9 B;  3PUN A;  1KZL A;  1FNC A;  2PNI A;  3A3G A;  4X05 A;  4Y9U A;  3CCJ B;  2LQW A;  5J3O A;  2JMC A;  5DN6 A;  1V29 B;  3UA6 A;  2GJR A;  4N4I A;  2ZZE A;  1OB2 A;  1ZSZ B;  1I1J A;  4Z4Y A;  1Y0M A;  2QAZ A;  1KIK A;  3JQR A;  1BCM A;  4IUV A;  3OEH A;  1Q82 U;  2QTL A;  2DVE A;  2HNI A;  2VBV A;  4CC7 A;  2XZP A;  2V7W A;  1BI2 A;  4KGX B;  1VQL B;  1V5V A;  2A08 A;  1W70 A;  3GNF B;  1K73 D;  2EYQ A;  1H3H A;  5FU7 B;  5AT1 B;  3W2G A;  5ECA A;  3UPU A;  1KQ1 A;  3CCE Q;  2KT1 A;  3JQP A;  1QCN A;  1QX4 A;  2DYI A;  2RJD A;  2YWE A;  1VLY A;  4AF7 A;  3JQQ A;  1MHN A;  1GL5 A;  2X6X A;  1BX0 A;  3WVE B;  3ER0 A;  3CBM A;  4PAB A;  1CKB A;  1DG1 G;  3V7S A;  3JCM Q;  2M0O A;  4Z4S A;  2NYS A;  3QE2 A;  4TSF A;  4C92 C;  1B23 P;  2M1H A;  4FSX A;  4X7C A;  3OYL A;  2RHI A;  4M1K A;  1U3O A;  4F14 A;  3Q39 A;  4JPB W;  1VQ9 T;  4G1B A;  3VR6 A;  2DTI A;  4QFM A;  1AWX A;  1TVC A;  1QKX A;  3JCM g;  2DPP B;  4RD1 A;  4XNF A;  1MRZ A;  1S4M A;  3JCM V;  2Q6K A;  4AC9 A;  4J5Y A;  4RDK A;  4GQN A;  2EQM A;  4WQM A;  5D6Y A;  3OYE A;  3EG1 A;  4RG8 A;  3E19 A;  1U1T A;  2JUF A;  4M7A E;  2D9R A;  1C6V X;  2WPD A;  4PGO A;  3CXC A;  3QJY A;  4LD9 K;  3VYH B;  1VQ8 T;  3DDY A;  4N4H A;  3RKX A;  5EC7 A;  1BIB A;  3X28 B;  4E47 A;  1YJW Q;  1F60 A;  1Q86 R;  1X2Q A;  2DTH A;  5FU6 B;  1HD3 A;  3UDC A;  4M7A F;  3JCM h;  3ZL7 C;  3NTI A;  3T53 B;  4PLL A;  2L3S A;  3LYI A;  2Y90 A;  4UC4 A;  3VS1 A;  2XKO C;  4X7D A;  3EG3 A;  4YAO A;  5I2M A;  5GAN h;  2O88 A;  3M4Y A;  1X27 A;  2E4H A;  4RD6 A;  2K5F A;  1TG0 A;  2BSA A;  2RO0 A;  1WSR A;  5HY6 A;  3R6K A;  4NS5 A;  4LUE A;  4ZGD B;  3I56 B;  2ZPF B;  3CC4 Q;  3VUB A;  1CQX A;  2LMJ A;  2VJI A;  3SHW A;  3OZU A;  4PK4 A;  2XHC A;  3L2Z A;  3H94 A;  4Z89 A;  1W35 A;  4R56 A;  2K5I A;  1KG1 A;  2C0I A;  2ZL7 A;  4YEL A;  1YI2 T;  1ZSG A;  4MZM A;  3CCS A;  5I22 A;  3OYK A;  2BMW A;  1W0J A;  3T51 B;  1M3A A;  2E5K A;  4OOV A;  4DOW A;  3I5R A;  1UGS B;  4NL3 A;  3QJ6 A;  1FDR A;  4YHB A;  2MIO A;  4XOT A;  3ZFJ A;  3LQ6 A;  1CNE A;  3G1J A;  1WLP B;  4C8Q E;  3HSB A;  2XNC A;  1BIA A;  4QQG A;  3LW5 E;  3PA1 A;  4E7S A;  1A8P A;  1VQM Q;  1UHC A;  4M4S A;  1HYO A;  5D7U A;  3A8J A;  3CCU A;  4QUZ A;  1EP3 B;  1FRN A;  4ZCI A;  2P84 A;  3CCL B;  3EGD A;  2DKG A;  1V76 A;  2WSF E;  2R5A A;  4C8Q F;  1VQM T;  3EAE A;  2LCC A;  3OW2 P;  1K73 C;  3E20 A;  3W2E A;  2LCL A;  4BPR A;  4PJO A;  4OB3 B;  5J35 A;  2JOY A;  2AT1 B;  2KNB B;  2P0K A;  3PEN A;  4XMY A;  1N9S A;  1M90 R;  4KUD K;  2MF2 A;  2CZ6 B;  4ZGQ B;  4Y92 A;  4WCI A;  2CSI A;  5B6I A;  4BDY A;  2RJC A;  2AK5 A;  5GAO r;  3CCR Q;  1ZSZ C;  2F1L A;  2CZ1 B;  4N0A A;  4XTX A;  2YLC A;  4E6R A;  2BE7 D;  4PJL A;  1KMH A;  4BI4 A;  2QEX A;  4XLH A;  3SJP A;  3QFS A;  3OYM A;  1BI0 A;  2CBX A;  2J6K A;  1BI3 A;  2W6J A;  3FDR A;  3OOC A;  1I4K 1;  5LJ3 g;  1WOP A;  3CCR T;  2LRQ A;  2EQJ A;  1UE9 A;  4RDJ A;  1Z9Q A;  3WY9 A;  3CRZ A;  1M90 U;  2K79 A;  1GO2 A;  3CCS B;  1KHI A;  5FU7 C;  1G7S A;  2CDT A;  1YJN A;  1KTV A;  3H41 A;  3UT1 A;  3DKM A;  3VV0 A;  4DEX A;  1GRI A;  2EKO A;  5A0D A;  3VYG A;  5FIU A;  4M77 E;  1KC8 U;  1TUD A;  3MPU B;  1G7R A;  2XG8 D;  5LJ3 h;  1CNF A;  4HCZ A;  2XDD A;  2EYY A;  2ROL A;  1ZM9 A;  2HKQ B;  4JRK A;  1M1K D;  2IVW A;  2OK8 A;  3EGD B;  5IYP A;  4ANJ A;  1QVF S;  2P0Q A;  4M77 F;  3D7S B;  3LLR A;  2KQW A;  4G5G A;  5KYX B;  4ASU A;  4PJO B;  4DK0 A;  2XI9 A;  3BE3 A;  2I1L A;  2VGM A;  3RMQ A;  1BK2 A;  3CMA Q;  3P8H A;  4Y91 A;  2ZPG B;  3FB9 A;  2A7Y A;  4OMN A;  2OTJ A;  3ZZ0 A;  4KH1 B;  4WF2 A;  1K8A R;  3B8H A;  4E7K A;  1M8V A;  1KD1 D;  2V1Q A;  2A3L A;  4YAF A;  1UD4 A;  2RK2 A;  3Q6R A;  1G3S A;  5IXB A;  5GMK j;  2QEX B;  4XTU A;  1VQP A;  1SSH A;  1W1F A;  1HSQ A;  3H0H A;  5CKB A;  3OYA A;  3RUX A;  5GMK e;  4LDX A;  1GBQ A;  1VHO A;  2E65 A;  1GCQ C;  4LBZ A;  3UWN A;  3QDR B;  4BE2 A;  3V8J A;  4J9B A;  3CCM Q;  4BB7 A;  1OB0 A;  3ASP A;  5FU6 C;  4PJO D;  5IYW A;  2M02 A;  1YJN B;  4FW2 A;  1NEB A;  2QQR A;  4JZ3 A;  3E1Y E;  1FMV A;  2V31 A;  2O01 E;  3CCE A;  4II2 A;  2DOG A;  3HFN A;  1NJI D;  4M7D E;  2L89 A;  1M9S A;  4DBF A;  4XK8 E;  3GPL A;  2QGF B;  4M75 F;  1OPK A;  2DZC A;  2PUK B;  2AZV A;  3P26 A;  1MV0 B;  1UDL A;  1CSK A;  2MK5 A;  4M75 D;  4HA8 A;  3RBB B;  2COW A;  1W34 A;  2BF4 A;  4ESR A;  4M7D F;  4NNJ A;  3U6K A;  1R5O A;  3M57 A;  1XNI A;  2CS7 A;  4B3X A;  2J6O A;  3OSS C;  2JN0 A;  4IUR A;  2FL7 A;  1UD5 A;  4RD3 A;  2P4R A;  1TS9 A;  3A8M B;  3C95 A;  3CPX A;  1W2B S;  1NB0 A;  3QFC A;  4ME7 A;  2PVD B;  1NDH A;  4XTY A;  4LE9 A;  3WVD B;  1K9M D;  2CKK A;  4PFZ A;  1JB9 A;  2GJP A;  1Y96 A;  4XM3 A;  3V8K A;  4GLM A;  4X07 A;  1Y57 A;  3VNU A;  1JB0 E;  4QKU A;  2CH4 A;  2ROT A;  3OZV A;  2DMO A;  4IUT A;  1EXM A;  3MP1 A;  4LUD A;  2OAW A;  1H8E A;  4LD6 A;  3GP8 A;  4J9D A;  1WXT A;  1OOT A;  1AWJ A;  1YJW A;  2WJV A;  4P2N A;  1WIE A;  2DY1 A;  2Q6O A;  4PJJ A;  1EFU A;  1E1R A;  2KI7 A;  2LX9 A;  4TMZ A;  3CCE B;  4IIM A;  3FPP A;  4HT9 A;  2F2V A;  4XTZ A;  2DF6 A;  1JU5 C;  4PC1 A;  5GAN 3;  2HL5 C;  3B78 A;  2ED0 A;  4TMV A;  4JS5 A;  3NHN A;  1UEC A;  3NFC A;  5IYR A;  2EGC A;  2X35 A;  1PNJ A;  1VYU A;  1NBE B;  1NM7 A;  3L2R A;  3CC4 A;  1VQ7 Q;  1M2O A;  1SHF A;  2JS2 A;  3A8O B;  1G83 A;  5KYN A;  2DIL A;  2K7A A;  1R0B G;  2KVO A;  3PA2 A;  1GXI E;  3MEA A;  2DXB A;  2BIV A;  3PGG A;  3MEW A;  2HZY A;  3BFM A;  4QQ6 A;  4WZT A;  4OMM A;  4M4Z A;  4P1V A;  4Y9R A;  4IUQ A;  5IHK A;  2V7U A;  1VQK A;  5A2Q E;  2C2W A;  1V0F A;  5LL6 S;  3CP8 A;  3JB9 G;  1ZHI A;  2YUQ A;  2YWG A;  5BSY A;  1QVF A;  2M5S A;  1WJQ A;  3GF5 A;  2KAF A;  3E9F A;  3TEE A;  5AN9 A;  1Y96 B;  3CC7 Q;  1T0H A;  5IYQ A;  2C78 A;  1UGV A;  1TTT A;  3HTR A;  2FPF A;  2D1X A;  2JM8 A;  3E2U A;  5GAO p;  5H5J A;  3OW2 S;  3ZIA A;  2MPX C;  1BB9 A;  1QH0 A;  2G6F X;  2XND A;  3L42 A;  2AKL A;  2VV5 A;  3A3B A;  2DXU A;  2D8J A;  1K4U S;  2XOK A;  1YJW B;  5GMK l;  1MV3 A;  1VA7 A;  1BX1 A;  3JB9 I;  2YDL A;  2VNJ A;  3EGU A;  4B9X A;  1EFC A;  2ZXI A;  3G6E Q;  3BW1 A;  2PUO B;  5F4J A;  2JTF A;  1PWT A;  4WZK A;  3T9N A;  2ZTN A;  4PJO C;  4OOS A;  2F69 A;  2RHY A;  3EG9 A;  4ZNX A;  2GJK A;  2X6Y A;  3U2Q A;  3V7C A;  2X53 S;  1Q82 C;  2GK7 A;  3PVL A;  1NJI C;  2KY9 A;  1KQS B;  2DYB A;  1WZO A;  4LDV A;  3QKJ A;  4J9G A;  4XU1 A;  3AVY A;  1K76 A;  3CC4 B;  1B7T A;  3MEV A;  4G7W A;  4UAJ A;  5GAO l;  5L46 A;  2BM1 A;  4TVR A;  4X34 A;  3QHS A;  3RIR A;  3OBY A;  3EH1 A;  2RNA A;  1FX0 A;  1UMK A;  1UGR B;  2SEM A;  3L2U A;  3JB9 J;  4BI8 B;  1UJY A;  4GBQ A;  4LDW A;  2ZL5 A;  3OYH A;  1RAI B;  4LC0 A;  1QVF B;  2XK0 A;  4OMO A;  4D6W A;  1A0N B;  4RPB A;  5GMK m;  2O4X A;  2XZO A;  4C92 E;  3FLG A;  2GQF A;  4JRP A;  4XON A;  1UHF A;  4OF1 A;  4RTU A;  1W2B A;  3A8H B;  2QMU A;  3CPW B;  2G3R A;  4RD0 A;  4WZE A;  3I55 Q;  2EYX A;  3OYF A;  4M78 G;  4HT8 A;  3CCS T;  5KNL A;  4C92 F;  3CB4 A;  1HVX A;  2HAX A;  4HIZ A;  1GVH A;  3NMZ C;  1D3B A;  4RCY A;  2JDI A;  2BV3 A;  4OVA A;  1KC8 D;  1VUB A;  3CCU Q;  1KJW A;  3OA6 A;  2KVQ G;  1S72 A;  1EP2 B;  1OGJ A;  1I8F A;  3EFS A;  3AGP A;  2V26 A;  4J9H A;  4A4E A;  1I81 A;  5GAM j;  4M53 A;  3U6B A;  1SPK A;  4PKC C;  3CMA A;  3GSI A;  4P22 A;  3CCU T;  2CH4 W;  2EBP A;  1PG5 B;  1PRL C;  5GAM e;  3NGP A;  2QTX A;  3DB3 A;  2QYZ A;  3CCR B;  2RC6 A;  4WTO B;  4NOY A;  4CC4 B;  5HZB A;  3AST A;  2BZX A;  1M4Z A;  2E41 A;  1EIF A;  2NUP A;  5D6W A;  5DY9 A;  1N06 A;  2RQV A;  3AVV A;  1N8R U;  5A8A A;  1N5Z A;  2YUP A;  1S0U A;  3OKX A;  2MAM A;  1ZBX A;  2CRV A;  4KRT A;  1K0S A;  1UD3 A;  1VHE A;  7AT1 B;  4M7A G;  4D8K A;  1I07 A;  3GOX A;  3CCM A;  1YIJ Q;  4FYX B;  1I8D A;  5FNZ A;  1HZE A;  2VAS A;  1RAF B;  1TSF A;  2M9U A;  2CC2 A;  1E7O A;  5E6T A;  2QEX T;  2EQU A;  4OGC A;  1FRQ A;  1WHH A;  3J81 k;  2NUZ A;  2LZJ A;  5DSZ A;  1W2B B;  1WA7 A;  4J9F A;  1N05 A;  3J81 E;  1SRL A;  3HPW A;  1Y0Y A;  3BCD A;  1G2B A;  2FZK B;  2Q6I A;  4XAX B;  3OW7 A;  1OX8 A;  3LO8 A;  1YJN T;  3THK A;  1NE8 A;  3A1P A;  2JIZ A;  4FYW B;  3LGL A;  3I9Q A;  4M78 A;  5KH6 A;  2QQS A;  5HZA A;  4AFZ C;  1UG1 A;  4XTV A;  3HKS A;  4J6X A;  2PMD A;  3JSC A;  3U23 A;  4F7U G;  3OW2 A;  3EG2 A;  2DLP A;  2KRS A;  2HQE A;  1KD1 R;  1QFZ A;  2VBS A;  3JCM f;  3CC2 Q;  1Q7Y U;  3CMA B;  2YUN A;  2BGI A;  1WJS A;  3H8Z A;  5KYW A;  3M59 A;  3HRS A;  2K6D A;  2YT6 A;  3VS7 A;  3M54 A;  2ZGW A;  2R58 A;  1JJ2 P;  1I5L A;  1N08 A;  5GAN f;  4RDL A;  2LNH B;  2PVG B;  2OTJ Q;  4J0Q A;  4Z4W A;  3JCM c;  3G05 A;  4X1V A;  2FPE A;  2X4J A;  4Z1M A;  4A4K A;  1TUC A;  1YHQ Q;  2BM0 A;  1OZ2 A;  3QUI A;  2CGH A;  4FIB A;  2OTJ T;  1AWO A;  2RJE A;  1VQP Q;  3OJX A;  3CCM B;  2ATC B;  2BKD N;  4C8Q G;  3BCF A;  4DBH A;  4X8I A;  2EKH A;  2XDP A;  3OE7 A;  4J6W A;  4M7A A;  3ZBU A;  2CP5 A;  6AT1 B;  2DET A;  5THX A;  1RUW A;  1JQQ A;  1MNE A;  1ZUK A;  1ZM4 A;  1VQP T;  1MMD A;  4RTZ A;  3ZBT A;  3OBW A;  4KH0 B;  2HMA A;  3W5U A;  2FVG A;  2HSP A;  1RI9 A;  3REA B;  2CP7 A;  3QZ9 B;  4ZN3 A;  2CP3 A;  5FO1 A;  1WHL A;  4CC3 A;  4UZE A;  5HKC A;  4P12 A;  1ABO A;  1JRI A;  1IB0 A;  4TKO B;  1WOS A;  1VQ7 A;  4M78 B;  3CCE T;  3OPO A;  1I18 A;  3WBK A;  1VYV A;  2VB6 A;  1K9M R;  2GPJ A;  1AOJ A;  3CW2 A;  1NLP C;  1D0Y A;  4A63 B;  1KQ2 A;  2CK3 A;  1TTH B;  2K2M A;  2ZTG A;  1Q81 R;  1KC8 C;  4F7U A;  2F1M A;  4HXJ A;  3VUZ A;  4LXC A;  3HRU A;  5A0L A;  5KYW B;  1IHW A;  3UF4 A;  1DAR A;  1AMO A;  2CUD A;  1WPY A;  5GAM g;  4KKU A;  4C43 A;  2JJ1 A;  2D8H A;  1XFO A;  3BDU A;  5IAY A;  3CC7 A;  4FYY B;  3NE5 B;  2GQV A;  4B3F X;  8AT1 B;  2EQI A;  2VYQ A;  4M78 D;  3D26 A;  3QG1 A;  1M1F A;  3CES A;  2VNI A;  3VU3 C;  2ZZF A;  1B07 A;  3R6J A;  1FXX A;  1Q81 U;  2C4T A;  3AVX A;  1M27 C;  4M77 G;  4JS4 A;  3FKS A;  1WTH D;  2VUB A;  4M7A B;  3G6E A;  4C8Q A;  1M1G A;  2QQA A;  2O9S A;  3LH5 A;  1JO8 A;  1QCO A;  2B8A A;  2LQ8 A;  3M55 A;  2C06 A;  1B3Q A;  2PIA A;  4XN0 A;  4N3G A;  4NBS A;  1VIF A;  1BCO A;  1YJW T;  1K0X A;  2V7V A;  3QPH A;  5TRD A;  4X0C A;  2YRD A;  1U8R A;  1VQ7 B;  1LJO A;  1JXM A;  4FL6 A;  4QV2 A;  1WFW A;  3Q1J A;  3ES9 A;  2RQU A;  1Q86 U;  2RQW A;  4GLK A;  3KEW A;  3OS5 A;  4F7U B;  5I21 A;  1WP6 A;  3JAM E;  4RPD A;  2LZ6 B;  2LP5 A;  1J9Z A;  1WJR A;  4Y28 E;  3CC4 T;  4ZGN B;  1R5N A;  1PSF A;  1VQK Q;  4MZT A;  3L1A A;  3CC7 B;  1NYG A;  1Y71 A;  4CQJ A;  3EG0 A;  2ZPH B;  3QZ5 B;  3CCV Q;  3E9G A;  1IGU A;  1IB8 A;  4DEY A;  3C4S A;  2HCJ B;  4EMH A;  4YAU A;  3CD6 Q;  5L8R E;  2HBP A;  1YIT Q;  4BI3 A;  2O9V A;  1VQK T;  2QK0 A;  5GJW B;  3M53 A;  3OQ5 A;  1ZA2 B;  3SD4 A;  3RKW A;  4KKT A;  3I55 A;  3NPF A;  1G3T A;  5KYU A;  4B48 A;  1PHT A;  3CXC B;  2R5M A;  2LNV A;  1G7C A;  4M7D G;  3O8V A;  5CAI A;  2CND A;  2L8D A;  2FG0 A;  1O9S A;  3G6E B;  4XLC A;  3CME A;  2ESW A;  4PJN A;  1UGP B;  4M77 A;  4CRI A;  2DEU A;  2ZAE A;  2DCU A;  1EP1 B;  1O75 A;  2ABL A;  4JMQ A;  3TSZ A;  1KFZ A;  2DL5 A;  2GQI A;  1M30 A;  4QVC A;  2QDY B;  1T6Y A;  1K28 D;  2EPD A;  3OYN A;  3LX7 A;  2M16 A;  1RAA B;  1QGY A;  2AZS A;  4RTT A;  3MCA A;  1VJS A;  1OZ3 A;  1ZUU A;  1PKT A;  2VKN A;  1SRM A;  3M56 A;  5CKD A;  4ZTF A;  1HA3 A;  1AT1 B;  1VQN Q;  2RD1 A;  2KRN A;  3GIR A;  3KL9 A;  2X8K A;  4QT7 A;  3WBJ A;  1PCX A;  5IK2 A;  4BE0 A;  4Z4T A;  1NRK A;  2DRK A;  2DJQ A;  3REB B;  4OMP A;  5FRM A;  2DM1 A;  1QVP A;  2WAC A;  4D8D A;  4JJN K;  1VOM A;  3LGF A;  2RQT A;  1WQ7 A;  2J7I A;  2BTT A;  1YIJ A;  2CP0 A;  1N8R D;  1W0K A;  2HDN B;  2K3B A;  2EIX A;  2P3M A;  3MP8 A;  4FU6 A;  2X4Y A;  4FWT A;  1PSE A;  2FB7 A;  3QSU A;  2GTJ A;  4P9S A;  3I55 B;  2F5T X;  5KYU B;  2GFU A;  2X9H A;  2OI3 A;  1UFF A;  4M78 C;  2JJ2 A;  2RJF A;  2ZPE B;  1T3S A;  1VQ4 Q;  2GFA A;  1VQ6 A;  1JJ2 S;  2CP6 A;  2BN4 A;  1QUF A;  4M7D A;  3CCU B;  1D1A A;  3B82 A;  2J7K A;  2V8J A;  5DLQ E;  1QMC A;  1VLO A;  1RAD B;  1N27 A;  1UB4 A;  3CC2 A;  2J06 A;  1S72 Q;  3MCA B;  3BDL A;  1WSV A;  4B43 A;  3A8I A;  1LPL A;  2RPN A;  1G3W A;  2RMO A;  4R55 A;  1WPC A;  2I0N A;  5LJ5 j;  1NYF A;  3BQJ A;  1T6Z A;  4TMW A;  2KK4 A;  4AFQ C;  2EWN A;  1S72 T;  3MMP A;  4B3G A;  3KUF A;  4PJO E;  1CKA A;  1SKU B;  1X75 C;  1JEG A;  4U9U A;  3CMA T;  2LQK A;  1YHQ A;  5KW9 A;  2OTL Q;  4PLI A;  3OYI A;  4XU0 A;  2HDA A;  5J39 A;  3RY8 A;  2D0Q B;  2VVK A;  4RTX A;  4DK1 A;  3G71 A;  2HKN A;  1YIJ B;  4M7A C;  2EGE A;  2LT1 A;  1OX9 A;  4PJO F;  3W2I A;  1V0E A;  4M75 E;  4QQD A;  2DER A;  3ASS A;  1E62 A;  1WX6 A;  2BGJ A;  2EAY A;  2DXT A;  2JW4 A;  2COZ A;  4RUG A;  3OYG A;  1K8A U;  3VS3 A;  1Q82 D;  2YLB A;  1KK0 A;  4YXW A;  2CP2 A;  5LJ5 f;  2DTO A;  1DJ7 B;  1QKW A;  2V4D A;  2V7X A;  3CCM T;  4RLZ A;  1U5S A;  3LVB A;  2BPO A;  3HL8 A;  2GBQ A;  2D74 A;  5F4O A;  1EX4 A;  4XR6 A;  2DAQ A;  1PD0 A;  1V1C A;  1M3B A;  2DIQ A;  1FND A;  3QDF A;  3GLX A;  2D6F A;  2HEQ A;  1BYM A;  3CC2 B;  4F17 A;  1WHG A;  1QFY A;  3SFM A;  3ZUG A;  1RAG B;  3AVT A;  3E1S A;  1Y7X A;  1YJ9 Q;  4K1X A;  4MML A;  2DD5 A;  4CI0 C;  4J6Y A;  2DVJ A;  2OTJ B;  3ULR B;  4E7L A;  4TN1 A;  1FMW A;  4IUU A;  3OS2 A;  3SDZ A;  2X3W D;  1YHQ B;  5KSW B;  4LN2 A;  1G7T A;  4C92 G;  3G4S Q;  1OB5 A;  1K73 R;  2JT4 A;  3PTA A;  1YCY A;  1VQP B;  3J7A F;  1E63 A;  5FRN A;  4XOP A;  3LWI A;  4C5I A;  4ZCM A;  3OB9 A;  3SEM A;  2EIF A;  4C8Q C;  5IHN A;  2E3H A;  4BD3 A;  5GJV B;  1QVG P;  3Q38 A;  2WSS A;  1ZM3 A;  4Z4V A;  4H9G A;  3OEE A;  3Q3A A;  2CZ7 B;  1N8R C;  3MET A;  3V8L A;  5FWC A;  4JRQ A;  3BY7 A;  1GBR A;  3P27 A;  1WNL A;  1XQB A;  1QQJ A;  2XU8 A;  3MHX A;  2QA4 Q;  2R57 A;  3GVL A;  4G1V A;  1WDX A;  2QQB A;  2Y4Y A;  4RJL A;  2QI2 A;  1VQ5 Q;  2DJZ A;  1PRM C;  1JXO A;  2CSQ A;  2QTZ A;  5GAN 8;  2JMA A;  3CTA A;  1RAB B;  1RQR A;  8ATC B;  3PIP A;  4ZV4 A;  1QW1 A;  3WNB A;  2V1R A;  1B34 A;  1K1Z A;  1E79 A;  2AKK A;  3JCM X;  2L3R A;  2Q6L A;  3A8G B; 
#chains in the Genus database with same CATH homology
 2DYI A;  2DOG A;  3HTR A;  2F1L A;  2QGG A;  1PM3 A;  3A1P A;  3H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...