3A1PA

Structure of ribosome maturation protein rimm and ribosomal protein s19
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
RLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Ribosome maturation protein RimM and Ribosomal protein S19
rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
molecule keywords Ribosome maturation factor rimM
total genus 30
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3a1pA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3a1pA01
2DYIA 3H9NA 1PM3A 3A1PA 3HTRA 2F1LA 2QGGA 2DOGA
chains in the Genus database with same CATH superfamily
1FMKA 4PC1A 3CXCA 3G4SQ 4HE5A 2GPJA 2DF6A 1I07A 3OW7A 1T5EA 3LWHA 3G6EA 4LBZA 1G83A 1M2VA 5CO7A 3CXCP 3CPFA 1QVFP 2ZXHA 2PZ1A 4PJOG 4D8DA 2CH4A 4P5NA 2CT3A 3N5BB 3WYAA 2CSIA 2EVRA 2DOGA 3OQ5A 4AMCA 5HKCA 1MV0B 1Q7YU 3H0HA 2OTJB 3OEEA 1TS9A 4OF1A 1WOSA 4TKOB 1RI0A 4LDWA 2GTJA 3KBGA 2EYZA 4M2LA 2XZOA 1MV3A 4KGVB 1BJKA 1TTTA 2YLBA 1QFJA 4M77A 5KYUA 5GAN8 1ZM2A 3CPWA 2FL7A 1K8AC 4M78A 1AMOA 1WI7A 1RAGB 5EG2A 2Q6IA 2DD5A 2RJDA 1WOPA 4MDWA 2L3QA 4XTUA 2CF4A 1S72B 3LX7A 4HA8A 1GJRA 3CMEB 2MI6A 4M77C 3RIRA 4B48A 1S1NA 1OGIA 3MP1A 3AHUA 3CCEB 1IREB 3PTAA 1Q9SA 1K8AU 3UPUA 3H94A 4Z4VA 2CUDA 3MPUB 4X7CA 1Y57A 3AT1B 2WPDA 3CPWB 2DJQA 4ZGJB 3WBKA 4RTZA 4MZMA 3FRNA 2PUOB 3JCMe 2AHOA 4Y92A 2NYSA 3M0TA 1M1KD 4M7AC 2K6DA 2HEQA 3W2GA 1MNEA 2COZA 1KFZA 4JZ4A 2C78A 5IT9E 1J9ZA 3J80E 1CQXA 3HFNA 4EPCA 2BM0A 4TMTA 4PJOD 1K28D 1D09B 1IB8A 4DBHA 1Q86C 1W0KA 2YWHA 4XR6A 5GV7A 2FEIA 5J39A 3CCUA 3Q38A 4BE2A 2QEXA 1UMKA 1M2OA 4AVZA 4RUGA 1FYNA 1GRIA 1WJQA 4YAUA 1QKWA 1VOMA 3AGPA 3ASPA 3PVDA 2EW3A 1R77A 2QI2A 2KRNA 1H3ZA 2NPFA 2KXCA 2JXBA 1QCOA 1BIAA 2RQTA 2LQWA 4RLZA 2X8KA 4DQLA 3CCRB 1ELOA 1I8FA 1VQ9B 4JRKA 5GANd 1I8DA 2DXTA 3OYGA 2GREA 3JCMc 2EYYA 1M1FA 4X07A 4TN1A 2P0PA 3UT1A 2LRQA 1X2QA 4U9UA 1MHNA 1RLQC 2EKOA 3GNGA 2DLPA 3EGXB 1N07A 4NL2A 2ROLA 2YXYA 4M75G 4FCYA 2OK8A 5DM7R 1NJIR 2VBUA 3BQJA 3EFOA 1Z9ZA 3JRZA 1IZ6A 1FDRA 1WXUA 3ZBTA 3OA6A 2E1HA 4KKSA 2BMWA 3GIRA 2YDLA 1PD0A 2FZKB 2KY9A 4LDUA 1JB0E 2KT8A 4FYYB 3CCSA 1T6YA 1DJ7B 1SF9A 2JTMA 4MMKA 1WDTA 4J9IA 4UZUA 3CBPA 3FEOA 3G71Q 1AIPA 1S0UA 3G4SA 2C2WA 3BCFA 1YJNB 5GAN6 1FRNA 3AVYA 3VS2A 2OYNA 4DBFA 2QAZA 1E1QA 4RDLA 2EAYA 4OVAA 3CTAA 4FT2A 5LL6S 2B5OA 5J3OA 4X0CA 5IH2A 1OX9A 2A0FB 1VIFA 2ZZQA 3A5ZB 4PJOA 1YJWB 1G3YA 4AC9A 1EXMA 4XNFA 5HXBA 2CC2A 1NJID 2LZJA 3LO8A 2ATCB 4M7DG 1RAIB 4KGZB 2VUBA 1VQPB 2HDAA 3A8OB 3NFCA 4DQKA 2RC6A 1Q82R 2JDIA 3QIIA 4ZGEB 4PAAA 1VYTA 1IJFA 4QQDA 4AF6A 2ESWA 3OYAA 5E6TA 2DZ9A 4OPOA 1WZOA 4C0DB 1VQOA 2ZBUA 4XLFA 1UGQB 4EMHA 2X4WA 1BPLA 2DM1A 5GMKe 3ZZUA 1N8RD 2ECZA 4C0DC 3WVEB 1IB0A 4XM3A 3VU3C 4NL3A 5LJ3h 5FU6B 2B86A 4F7UB 1WXTA 3M55A 2CK3A 1EP3B 2OBRA 2QA4T 1Q81D 2QQBA 4VUBA 4Z4SA 1LNXA 3JCMQ 2Y90A 3EAEA 2JIZA 2CGHA 4RD6A 3ZUGA 1FMVA 3CCET 2KSSA 2XNJA 1ZUYA 5GMKi 1PJ6A 5EC7A 1NJIC 3CCLT 1U3OA 5M9OA 1VQKA 2D9RA 3ONYA 1RAAB 3V76A 3NTHA 4AFUC 1YITQ 1QP2A 4FSSA 5HK3A 4M7DA 2RMOA 4J9CA 2J7IA 2JJ1A 4RCZA 3BY1A 2Y4XA 4OGEA 5IXFA 3J81E 1W1FA 2EYQA 3OYDA 2OTLQ 4HE6A 2X85A 5FL7A 2XZLA 4ZTFA 4TMXA 2MCNA 4Z88A 1LPLA 4GLKA 2V7XA 2RQRA 2XEXA 4XN0A 1UHCA 2ROTA 2QQ9A 4Z4TA 2HSPA 1I18A 3CEYA 2GJRA 2JTFA 1VQMQ 4G1VA 2C0OA 1YHQA 1M1GA 1M90R 1ZA2B 2FO0A 2YRDA 4XLAA 1WJSA 4FK8A 1B7TA 3QFSA 3R6NA 2F5KA 1TSFA 1IGQA 1YIJT 2GJPA 5KE2A 1DDIA 2ZPIB 3CMAQ 3UWNA 3FPPA 4NCNA 3KFVA 3RBBB 3UA7A 3L2UA 2ZBVA 5LJ5g 2QDXA 2FPDA 5H59A 3TVTA 3HAGA 4FXUA 1AWWA 4P25A 1TWBA 4Z4WA 2E6ZA 5GAOr 4ASUA 2PMDA 5D6XA 1VQPA 4A4EA 3OW2P 5LJ3g 4II2A 3V7AA 4E7IA 3CCMQ 2LJ1A 3A8LB 3HRSA 5CR2A 1Q82U 4KUIA 2V4DA 2RH2A 2DA9A 3X26B 3LW5E 1FNMA 1VQ8T 2HMAA 4PK4A 4PNOA 4HKEA 1UB4A 4YALA 1I7PA 4M1KA 5GANe 2ED1A 4E47A 3CCSB 4Z4UA 2HNIA 2DL4A 2X3UA 1JB9A 4B3XA 4BDYA 4C43A 5LMZA 3DB3A 2LJ3A 4C0GA 1H641 4YAWA 5FA6A 3EFOB 3JAME 2NLUA 3W2IA 2QDYB 2KT1A 5D7UA 3EG2A 1M9SA 2RPNA 1UDLA 4NBSA 1VQNB 2EGAA 3E19A 4KT0E 3BH4A 1VF7A 4M7DB 3CC4T 1SRLA 2ZTGA 4Z4RA 2QTVA 2F2XA 3E9GA 1AEYA 1VLYA 1NEBA 1YLOA 3ASKA 2NV4A 4F04B 1VQMA 5A88A 3G71B 1QVGS 1IRXA 1G7TA 3CCVA 4WZLA 1PD1A 3CC7T 2CT4A 4C8QC 3C12A 1G3SA 4OMPA 1YWPA 1SEMA 1H8EA 1HSQA 1KTVA 4CC3A 3QUIA 5AT1B 1QWFA 1OZ2A 5GAOn 4QV2A 2W6JA 5FWCA 5GAOp 1D3BA 3VKIA 1CNEA 1WNLA 2DERA 2O4XB 1JU5C 3FC3A 3VS5A 5LJ5h 4XLEA 3RKWA 4PKCC 2PVGB 3L1AA 1T6XA 2C06A 3UA6A 2EFGA 5KYYA 3HL8A 1H8KA 4TT3A 2QG9B 3X28B 3HP9A 4YAOA 1NB9A 1YHQT 1VQOB 1QFZA 4M4SA 1UE9A 2H3EB 3JSCA 3MKDA 2P84A 3V8JA 1VQNQ 4GQNA 2DVJA 4JJCA 2ZZEA 3Q6RA 4NOYA 4X7EA 3V8KA 3L2WA 2F43A 4AT1B 3M0QA 4ZGDB 2QGGA 3JB9G 1TU0B 3OMGA 1MNDA 4WF2A 1VJSA 3VUBA 4IIOA 1WFWA 1VQNA 2KRSA 3G71T 2V31A 3X25B 2EYWA 1LVKA 3MEWA 4ZN1A 3CCSQ 4C92A 3CCLQ 3P26A 1MMGA 1XB2A 1VHEA 4KKUA 2RHZA 4F16A 1Q81C 4XAXB 4ESRA 3H6ZA 5GMKm 4OMMA 1KQ1A 3ZBDA 1KMHA 2DFUA 4N3GA 2JNGA 2V7WA 5KW9A 1Q86R 3P8HA 4M0LA 3SEJA 3M0RA 1WJRA 1ZSZB 1FX0A 3FJPA 3GIBA 4HCCA 3BY7A 3OB9A 4B43A 4FSXA 4FN5A 1Y96B 4XU0A 1QFYA 1EFCA 1YI2Q 5DLQE 3QZ9B 2NUTA 2GF7A 2P0QA 1ZUUA 4JJNK 3CC4B 2GNCA 4AG2C 1OB2A 2RF0A 1CSKA 1FRQA 1OB5A 4XTVA 2XHCA 2EFIA 2JW4A 2E4HA 4RCYA 1KC8R 4GBQA 2GFUA 3ZIAA 3EGDB 2XDBA 4XD7A 1QW1A 1VQ9T 3PT9A 4IUTA 2FHDA 4QQ6A 2M0YA 2L0AA 3CPXA 2CZ0B 3CC4A 5AN9A 3CCST 2RNAA 3CXCS 1BI0A 1RI9A 2Z0WA 1M4ZA 1RAEB 1YN8A 2E70A 2BV3A 4C8QA 3FLGA 4F17A 3QZ5B 5LJ5e 2O4XA 2VJJA 2W10A 3U6KA 1AD5A 2DNUA 3SB2A 3OPOA 3H0IA 1S4MA 1DG1G 4XQFA 2X53S 3BFMA 2QA4B 2C77A 3S6WA 4X8IA 2HL3A 3JCMh 4A4FA 3BY2A 2LMJA 2YUNA 4QKUA 1N6AA 2BSAA 4G1BA 1Q81U 1CKBA 1I1JA 1WHMA 5F4JA 4J7FA 2ZAEA 5B6IA 1T3SA 5GAOl 3VV0A 1YITB 4A4HA 3SD4A 4LBWA 3QHSA 1YWOA 2OTJQ 4EMGA 1EP1B 1MUZA 2BTTA 2CDTA 2F1MA 3LGLA 2X4JA 3M0SA 1QGYA 5IHIA 1YI2A 1KQSS 3U2QA 1N8RC 3DB4A 3Q6QA 4XLCA 2KROA 5CK9A 2RO0A 3BNWA 4XLHA 3QFTA 2K57A 3CD6A 1JJ2B 2DIEA 2FVGA 1QKXA 2F2VA 2CW5A 1PC0A 3M53A 3OW2A 1E3XA 3OP1A 2QQAA 2DPPB 2ZZGA 1TH7A 1BMFA 5CKHA 1H85A 2P3MA 4DBQA 1QUEA 2O31A 5A2QE 1VQ6T 5IYNA 2DL8A 1D0YA 4E2FB 4C5EA 4D8KA 3OS1A 4J8OA 3CCLA 2C5HA 4G5GA 3SWNB 1K73R 3CCLB 4IUQA 2E1BA 4ZCMA 3SJZA 1RABB 3EG9B 2D0NA 1D3BB 4GY5A 4WTOB 1VQ8B 4RG8A 2X6YA 2LQKA 4A4KA 1VQLT 4OPVA 1R0CB 2HDNB 2V8IA 2V1QA 3SHWA 4BY6C 2PUKB 2NUPA 1UJ0A 2XD0A 4M7DC 1E43A 3BE3A 3CCUT 4DK1A 3MO8A 4E6RA 3LVBA 2LQNA 4RDKA 5IN1A 2RI2A 2L3PA 1T3LA 5CAIA 2KEAA 5KCHA 1M8MA 2WJYA 5A8AA 1O75A 4C92D 1Q86U 4OB1B 2JT4A 4KULA 3GF5A 5FNZA 2W6IA 2K7AA 1WQ7A 2XZPA 3VS3A 5F4OA 3VJPA 4QVZA 1F1BB 1KQSB 1NLOC 1SKYB 3I55A 3OW2S 2R6HA 1W34A 1VHOA 1B34A 1QGZA 2XNDA 3PGGA 3J7AF 3RERA 4P22A 3I1FA 5KNLA 1YCYA 1D1BA 2A36A 2E3IA 1GVHA 4LNPA 1YIJA 1I81A 2CZ6B 4BACA 2LVMA 4EDUA 3OOCA 2RA2A 1YX2A 3S3OA 2GBQA 2LP5A 2LX9A 2VGNA 5GAMg 3I55T 3MEVA 1W9XA 3E1YE 3S3MA 2B8AA 4JUVA 4B4DA 1P92A 5D6WA 3CESA 1YP5A 3PE0A 3A3GA 2FVUA 3PUNA 1VQPT 4M7AA 2YUPA 1UGSB 3I5SA 1YJ9T 2HKQB 3LGFA 3GBQA 1M5Q1 4JS4A 1PSEA 2KAFA 3QWXX 3VS6A 1G7CA 3TSZA 2KE9A 4IW3B 4O5VA 3WQZA 1OPKA 9ATCB 1VQ8Q 3I56T 2ZGWA 3CMMA 3EH2A 2CP2A 1IHWA 2KR3A 2MPXC 1YJWA 3OZVA 2BZYA 2I2LA 3C94A 1KC8D 4M7AB 2GTOA 1YJNT 5ECAA 2RHXA 5GV8A 4XOPA 1LJOA 3WXMA 2DZCA 3CW2A 1WIEA 3CRZA 8AT1B 4ELZC 1QLYA 1W2BA 4J83A 3NMZC 5FROA 1BX0A 2DMOA 1U1TA 1QVGP 3TCJA 4N0AC 3LWIA 4XQ3A 3X24B 5DY9A 2K9GA 4XN3A 4QVCA 3JCMX 5GJWB 5KH6A 2FZCB 3OW2B 4Y9RA 2X4YA 3PA1A 1RQPA 1YNZA 2DE0X 3VS7A 2YHTA 3WY9A 3C95A 4R55A 4DNTB 2MAMA 1E79A 3QE2A 4K11A 2OBSA 1U8RA 2QGFB 1GCQC 2CKKA 4PABA 5GAN2 2FRWA 2YWWA 4RTXA 1TUIA 1ABOA 5D6YA 3E2UA 3RR6A 3CCVT 4DBRA 5HZBA 1M27C 3JV3A 1PNJA 4LDXA 5FRMA 1YITA 4BY6B 1TOVA 2R9VA 1MMNA 1X6OA 3PMIA 3G7ZA 5I21A 1Q82C 2EQMA 1JEGA 3GOXA 1Y96A 2YSQA 1U06A 2K5LA 3QBYA 5CCAA 3CCRA 4ACBA 1O9SA 2D9TA 1C0MA 5GAMh 2RHIA 2VBVA 3AVVA 2M0OA 3RKXA 2PLFA 1GFDA 1S72Q 4MZTA 3WNBA 2ZPHB 3ZZTA 1K9AA 5FU6C 3BCDA 1U2RA 4X7FA 3CCUQ 1VQ7B 3REBB 8ATCB 1Y7XA 2SRCA 1QGAA 4PLIA 2QEXB 5DS0A 1AWJA 2LCLA 4RTYA 1MABA 2BKDN 2FRYA 2KK4A 1VQ5T 4ROXA 3QSYA 1J3TA 1HD3A 1TXQA 1UG1A 2OAWA 2VJIA 3CC2B 1QUFA 2O01E 1KIKA 3RY8A 2FYKA 3OS2A 1UHFA 4CRIA 3H9NA 2XOKA 2D0QB 1H92A 2PE3A 2DILA 3RMSA 1RUWA 1WX6A 5TY0A 4UAJA 3SFMA 3HTRA 1D1AA 3EG3A 2BGIA 4YELA 1YI2B 1G8XA 3V7CA 2KGTA 4C5GA 4RD0A 2SEMA 3CC2A 4O6JA 3AVXA 3CB4A 2VGMA 2AKKA 4X34A 4A4GA 3QFCA 4PC2A 3NHNA 4DQ2A 1D1NA 4R56A 1KK3A 3BDUA 2FG0A 1B3QA 1QVPA 3VRYA 4II1A 4JLIA 4XU2A 5DLOA 4DEXA 2Q6OA 2JMAA 3EHQA 2IPOB 3CC7Q 3OE7A 1YIJQ 1B34B 1ZM4A 2HCKA 4DEYA 5A89A 2JS2A 1OPLA 2MWOA 2EYXA 1N0UA 3WNDA 3I55Q 1HJDA 4N3NA 2A28A 4BDZA 1XJWB 1EFTA 5LJ5j 3GP8A 1FWZA 2KYBA 4J9DA 2X9HA 5IHNA 1VQ4T 1TUDA 4K1XA 1WHGA 3U23A 1TLLA 1H42A 4BB7A 2LZ6B 3CCEA 3LH5A 2G6FX 1JBMA 2J6FA 5KYWA 4ZCIA 2RN8A 3OY9A 3M56A 2D6FA 4BE1A 1NB0A 4X7DA 2LJ0A 1TVCA 4G7WA 4RPDA 3AGQA 2RD1A 2XK0A 5EMNA 2LNHB 1ZSZC 3T53B 1VQ6Q 3CXCB 1AT1B 1D0XA 2AKLA 4LDYA 1D1CA 1G3TA 3DLMA 1QX4A 4TMWA 2WR8A 4HCBA 1BCOA 1YCSB 3CCRT 4CQJA 2LCCA 2DTOA 2HD0A 3PA2A 3CC7A 4C92G 4H9GA 1V0FA 4FL6A 3WXMB 2WSEE 2DEUA 3I56Q 4FYXB 1ZBJA 3P8BB 2DIQA 2EQUA 1KJWA 3OSSC 2X0KA 2XG8D 1M1KC 3WVDB 2PU9B 1ZM3A 2GK6A 5GMKl 4QT7A 3VS1A 1Y0MA 5GANf 4X05A 4ATOA 5KYWB 4IUVA 4LUDA 1PKTA 1X2KA 1Q7YR 1N8RU 3MCAB 4MDXA 2OJ2A 2AHJB 4M4ZA 1QMCA 4LBYA 4M78F 1T6ZA 2NUTB 2PVOB 4RJLA 3OMCA 1RADB 1E64A 1PWTA 1JJ2S 4P2NA 1GBQA 5J3BA 1PCXA 1RAFB 3OSVA 1N08A 3CMEA 3D26A 1XNIA 4GLMA 3D7SB 2V8JA 1NJIU 4M75C 1KK1A 1PRLC 2NWMA 3JB9D 1QCNA 1B07A 3GQBA 2DRMA 1A0NB 3CMET 1N9SA 1EP2B 4X9DA 4C8QB 3I55B 1VQ4B 3JCMP 3ES9A 2PVDB 1EWYA 2VBSA 2I0NA 3B78A 1K0SA 1RACB 4DK0A 2O9SA 2YUOA 5LJ5d 1QVFS 1KHCA 3TSWA 3O5ZA 2C0IA 1G5VA 4PJOE 3QPHA 2PIAA 2L89A 4WWVA 4NS5A 1G7RA 4RD1A 3EG0A 1SSFA 2XU8A 4WQMA 4Y91A 1MMDA 3G1JA 1NYGA 3CMEQ 1Y07A 1I4K1 2LTOA 2RQWA 1VQ9A 3ONUA 4Z02A 4Y28E 1YJ9B 2HL5C 1H8HA 4LD9K 2K5IA 1HZEA 2CZ7B 1R5BA 3FPKA 4QQGA 1N8RR 4P6YA 2QA4Q 1Q82D 1W6XA 1N5ZA 4BI4A 1XTDA 4RTUA 2EQIA 3PFSA 3QYGB 1KC8U 4QVAA 5THXA 2RB6A 5LJ3j 2QEXQ 3CCUB 2E1RA 3SWNA 3CMAB 2DTIA 4PGOA 1X6BA 1OEBA 1KD1R 6AT1B 2COYA 3CPWP 4JS5A 1NLPC 1VQ7A 4C0SA 5GMKj 3W2FA 2RJFA 2DK3A 3CCVB 3M4GA 1VQMB 2YT6A 4E7SA 4PFPA 1VQ7Q 1F60A 2P4TA 2L5QA 2C0TA 2BN4A 2F5TX 3TREA 2ZPFB 4E7JA 5FLXE 1DDGA 3CBOA 2RI3A 2OTLB 2HQHA 1UUEA 1PJ7A 4RD3A 3CD6T 3VS0A 4PC3A 2EKHA 2J6OA 4FYVB 4X1VA 3QJYA 4ANJA 5GAN7 2ZITA 2K79A 4R71A 3PNWC 1NE8A 1SG5A 1VQKB 5JBQA 4CC4B 2CZ1B 4TSFA 2EQJA 1VQ4Q 2E5QA 1VQ6A 1VQLQ 2QA4A 3A3BA 2JM9A 2LQ8A 2KBTA 1X27A 1KQSP 3CCQQ 3GPLA 1WA7A 1GBRA 1HK9A 4RTTA 2E10A 2QASA 2V26A 4L6V5 3CPWS 2QEXT 1AWXA 1VYUA 4E7HA 5C6SA 5KYUB 2DO3A 2VC8A 5GJVB 4M77E 1KQSA 4OMFB 1UD3A 5IYWA 4OPSA 3AVUA 3ULRB 3VUZA 2K3BA 1OGJA 3DKMA 3FKSA 1U5SA 4OMQA 2VZLA 3CCJT 4M77F 3EGXA 4ORZA 1Y0RA 3URGA 3LLRA 4OGCA 1KQ2A 5IHKA 4E0FA 1PG5B 2XICA 4JRQA 2CYZB 3EGDA 4M7DE 2QTLA 1GO2A 3CD6B 3B8HA 2KVOA 1X69A 3OYMA 1K9MR 1M2VB 1VUBA 2XDDA 2J05A 5GAN4 1M1KR 1EX4A 4KUDK 4OMNA 2J7KA 2M5SA 4X9CA 2RJCA 2HCJB 1KD1D 2V8KA 4OB3B 1W87A 4KKTA 2DD4A 1Q81R 3VNUA 4F7DA 3I56B 5GAMd 4Q5WA 2RM4A 3H0FA 1BX1A 4FIBA 4BE0A 1XOVA 1HYOA 3G4ST 1TTHB 5GAMe 4WZEA 4Y9UA 3A98A 1PKSA 2VV5A 1JA1A 1GAWA 4DOVA 4XTYA 2HZYA 2BZ8A 3OYLA 3ZC3A 4M7DD 2JJ2A 3T56B 4J9BA 3H41A 3A8MB 5I2SA 2HSEB 1K9MD 2ZPGB 4PC6A 2VWFA 5GMKh 2O88A 3V8LA 2CP7A 5LJ3e 3OYFA 3LNNA 1OOTA 1N9RA 5TV2A 1KK0A 1NDHA 1AHJB 1ZLMA 1T0JA 1SPKA 4M75E 2A3LA 3CCJB 3R6OA 2CP6A 5A0DA 1H3HA 4M78B 2DEQA 2F1LA 4JJBA 2KMTA 1FNCA 3G6EB 1OB0A 3BC9A 2BE7D 1YI2T 4M77B 2CP0A 3CCRQ 2WYRA 3A8KA 3CC7B 3VYHB 4F7UA 3PMTA 1WHLA 3JCMd 1RLPC 4M77D 1M3BA 1TG0A 1YJNA 4XORA 2WZPP 4J9EA 4P26A 1XFOA 2XIDA 2EJGA 1JJ2A 1JXMA 2DKGA 2YWFA 5DSZA 4AG1C 2DL3A 3FIFA 5H5JA 3JQQA 4LD6A 5CKEA 4RG2A 2DL7A 2YUQA 4QVJA 5A0LA 1NPRA 3VS4A 1S72T 4BI8B 1NZ9A 2LDMA 3V7SA 2FPEA 1WQWA 4X06A 3CP8A 1UGPB 4PFOA 2NUZA 3REAB 3SLDA 1CNFA 4Y7CA 1NRKA 4YEJA 1BQEA 5FRNA 4B3FX 3OYIA 2X51A 3OBYA 2X6WA 2BF4A 4RTWA 1KK2A 2AZSA 2KNBB 4ME7A 1GCQA 5I2MA 4PJNA 4C5IA 1V76A 5I11A 3DDYA 2CUBA 2ENMA 2VVKA 2E64A 1VQ5A 2C4UA 5KYXB 1OULA 3W5HA 2FZGB 4N4IA 2EGCA 3VO1A 3WBJA 2RJEA 2QYZA 1OV3A 1FNDA 4RPBA 2B7BA 1BBZA 4MYTA 4WZTA 3QWYA 1M30A 2VB6A 4Z4YA 3B82A 5DN6A 4RMOA 1WP6A 4PJOF 2A08A 3UATA 5AYFA 2V7VA 5J35A 5GANh 3QSUA 3LYIA 4M75F 4J6YA 2GCXA 1BK2A 3GLXA 4LC0A 3TQ7P 2CS7A 4RDJA 3RUXA 5HKKA 2D8JA 3NTKA 1WLPB 1VQ8A 1SKUB 4BPRA 3OJXA 1QWEA 3A8GB 3ER0A 2LX7A 3L2ZA 4B9XA 5IK2A 2JZ2A 4C8QE 3G4SB 2ZL5A 1B2RA 5FO0A 1B23P 3MP8A 4HXJA 2ZPEB 1AVZC 3KUFA 2E5KA 1BI2A 1BLIA 2JMCA 3OYEA 3VNVA 5GANj 1UJYA 2K3XA 3HFOA 3PIPA 5HK0A 1VIEA 3C0CA 1K73U 2DY1A 2M51A 4RCBA 1GR1A 2K2MA 3S3NA 5BSXA 2QMUA 3MHPA 3U6BA 4HVVA 3RNJA 1E1RA 1VLOA 4WZKA 1GXIE 2PNIA 2HAXA 3FB9A 3KEWA 2I1LA 1SSHA 1RAHB 2KYMA 1VQOQ 1D2EA 4YHBA 3RKYA 3AVWA 1VQKT 2DTHA 4QW2A 3CCJQ 1VQPQ 4E7KA 3INZA 5KYYB 3EG1A 2CNDA 2NUPB 1OU9A 4B44A 2JUFA 4C92C 1WPCA 1M90U 1JO8A 1YJWQ 1ZQ1A 4XKWA 3M57A 1ARKA 4YAFA 2A7YA 4XKVA 1D0ZA 2KRMA 2R58A 3LH0A 4PJLA 3UF4A 1M1KU 2ZCFB 4WCIA 2M9UA 3H8ZA 2KVQG 2V7QA 1KSWA 4FT4A 3ZL7C 2VNJA 2LNVA 1M3AA 2PQWA 3HHTB 1K9MU 3OYJA 1P4MA 1W4SA 3VYGA 1UD6A 2CRVA 1OHHA 2AZVA 2YRVA 3HRTA 3P27A 5CKBA 3FJOA 2OTJA 1M90C 2K3YA 4OP0A 1QVFA 4ACAA 1WU8A 2R5MA 3JB9H 1K73D 2XGJA 5GAN3 3NTIA 2R57A 3MEAA 2DL5A 2HQXA 3PUMA 5TR9A 1VQ9Q 3VR6A 3M4YA 3OEHA 2EBPA 1VQ6B 1AOJA 1E62A 2O2OA 5GAMf 3HPWA 2DXBA 2L3RA 2ZZDA 4B6MA 4C8QD 2E6NA 1EFRA 4KGXB 3PVQA 1XQHA 1V1CA 2WSSA 3QFRA 4OB0B 2MIOA 2JVVA 1KC8C 1PKVA 5L46A 4M75B 4PJMA 1FNBA 1RL2A 2P0KA 2LCSA 1ACMB 2ZL7A 7AT1B 1N05A 1K8AR 2KI7A 1IGUA 2DXUA 2OAUA 2OX7A 4HVUA 2DAQA 1ZBXA 1YBYA 1YIJB 1QVGA 3OBWA 4EMKC 4MZPA 4C8QF 2WZNA 3OYHA 3NGPA 1PJ5A 3VO2A 3M0PA 3OYBA 3KXTA 5CVIA 4UC4A 5LJ3d 1VQLA 4J9GA 2K5FA 3TEEA 1KD1C 2EWNA 2VASA 3JQPA 1IJEA 2HKNA 4P3IA 3HSBA 1E6GA 3L2RA 1GAQA 3GVLA 2AK5A 2DBMA 4RM0A 2LC4A 2JS0A 1A8PA 2JN0A 1PHTA 1WTHD 3E20A 3X20B 3G6ET 4ZNXA 1ZHIA 1IHMA 4MYUA 2D3NA 4CC2A 3OYNA 1KJZA 1GFCA 1V29B 1WGSA 3GVJA 3JCMW 1KD1U 4DA4A 3LQEA 3EH1A 1K0XA 1YFNA 1E63A 3OYKA 3F70A 2VNIA 3UDCA 2QTZA 3OKXA 1I5OB 4M53A 2VYTA 4JPBW 4M7AG 4A54A 2DIGA 4C92E 2FB7A 3O8VA 5HZAA 1HVXA 2V7UA 1U1SA 2MMPA 4G6IA 1VYVA 4B9WA 3CQTA 4PJJA 1YHQB 1VQ7T 1QVFB 1W2BP 4XK8E 5LJ3f 1NM7A 2BVNA 2KQWA 1UD2A 4QHYA 3PVLA 1UGVA 3M9QA 4L5GA 4R0KA 3BW1A 1COWA 1FMWA 4LDVA 1NBEB 4OP7A 1UD5A 2CH4W 1UFFA 2Q6KA 5HY6A 4UZEA 3RDVA 1X43A 4A53A 3ZZ0A 1XE1A 3SKBA 1GL5A 2IG0A 1E3ZA 4J9FA 2WSCE 3SLNA 2AT1B 2RHUA 4RCCA 3W5VA 1AZGB 1N06A 2E12A 4OOXA 2C4TA 2L8DA 2VNKA 2L2PA 4CI0C 1YJ9Q 1Q86D 1WHJA 2HQEA 3L2QA 3OS5A 1M90D 3CC4Q 1R0BG 3M59A 3HKSA 1IO6A 3SEMA 4JDSA 1VQOT 5KYNA 3CBMA 3ZBUA 2HLDA 1UEBA 3RESA 2BZXA 1I5LA 2RI5A 3JQRA 2AIRB 2H8HA 1RQRA 2X3WD 4EH1A 4FW2A 2GFAA 4HVWA 4P3YA 4ELYC 3GSIA 5A0GA 3OJWA 4J5YA 3BDLA 2JJ9A 4AFQC 1NEGA 1OZ3A 4B3GA 1W2BB 2DVEA 2EIFA 4LXCA 2F69A 5GAMj 5CQXA 3OS0A 3W2HA 2KDSA 2ZPBB 4XMYA 1K76A 2EIXA 1WSVA 3A8HB 2VXEA 2DYIA 1MMAA 2JOYA 1SHGA 2H3JA 3META 4PL6A 4Z89A 2MWPA 4D6WA 2MYSA 4ZGQB 4QFMA 4XTWA 3MJXA 2VYQA 4EIKA 4XONA 1OQKA 1BU1A 4F14A 3QXEB 4M78G 1WPYA 3ASQA 1UGRB 1Z9QA 2X35A 1PM3A 2QDLA 1WORA 1KHIA 3G6EQ 3J81k 2J06A 4PJOB 3ASSA 5KSWB 4EMKA 4M77G 2WJVA 4XOTA 5IYRA 4QVDA 1PSFA 3Q39A 1QP3A 2MK5A 4CC7A 2M02A 4OB2B 5IYQA 1ZSZA 3W5UA 1Q7YC 2C5BA 2QQSA 5CKFA 3QG1A 1C1AA 3MHXA 2BIVA 3QYHB 1CKAA 1QQJA 3OZWA 2EPDA 4OOSA 4C8QG 3T9NA 3VMFA 1HA3A 3T51B 4HIZA 3GVKA 1EFNA 2O9VA 2HBPA 2KXDA 4J9HA 2PTKA 1SM4A 2GGRA 3JU4A 3CMAA 2EQKA 1BKBA 3G05A 4M75A 4PFZA 1DARA 2RK2A 4E7LA 1ZUNB 2JN9A 1OYXA 4F7UG 4FW1A 4LN2A 4BD3A 4YXWA 4M78E 2DJZA 3I56A 2DETA 3NE5B 1T0HA 4IIMA 4C92F 1TUGB 4E7ZA 2OBTA 4LBVA 2FX3A 2K4YA 3TU4K 1QH0A 2FPFA 1YJ9A 1ABQA 2CP3A 1KZLA 3EG9A 1BI3A 3FJ5A 1KG1A 4PC7A 3JCMb 4BUGA 1NG2A 5L8RE 2YLCA 3HRUA 4J6XA 3MEUA 2F2WA 3QDFA 3Q1JA 3OFNA 1E6HA 1MRZA 4XTZA 1JRIA 2MF2A 2BPOA 3EHRA 4HT8A 3C4SA 5FW9A 2HBWA 4JJDA 4FM4B 3R6KA 4OOVA 2V1RA 5FIUA 3MMPA 1VQLB 1Y0YA 4XL9A 4Z8AA 1VQ5Q 2ED0A 2XI9A 1VQKQ 1W35A 3EGUA 5KYXA 5FO1A 3QO3A 4AFZC 1WHHA 4JRPA 3CCMT 4M7DF 1AWOA 3CCEQ 4PJOC 4Q7JB 3JCMg 2XNCA 4AF7A 5C0MA 3JB9J 2DX1A 4PLLA 3CCJA 2EJFA 4N0AA 2RQUA 1OI1A 4AFSC 3CCMB 3A1PA 5CDFA 1VQMT 4DNRB 4OMOA 2BUDA 3P8DA 1WHKA 4JMQA 4B47A 5IAYA 1S72A 2MOXA 5GAOq 2ZTNA 2VNHA 2VXFA 5HCKA 2X3XD 4HCKA 1JA0A 3CCVQ 3EFSA 4LUEA 1JQQA 1PRMC 2EGEA 1BI1A 1BIBA 2WACA 3M54A 3JB9I 2D74A 2X6XA 3E9FA 1LOJA 4N4GA 5F4MA 4IUPA 4F7UF 3OAAA 3NPFA 3M58A 2GK7A 1MGQA 1K73C 2DBKA 1JJ2P 2E65A 1VA7A 3CC2Q 2CREA 1IHVA 2WSFE 3EFRA 4ZGNB 3L2VA 2CSQA 3IQLA 1K8AD 1G2BA 2EJ9A 1WSRA 2P4RA 3LQ6A 2ZL6A 3W2EA 4FWTA 1UECA 1SRMA 4A63B 1N27A 2GQIA 4M78C 2BGJA 1UTIA 2RQVA 2Z6BD 5J26A 4EMKB 4QUZA 1HXDA 4P9SA 2JTEA 1FX7A 4M7AF 1YHQQ 4IUUA 1UD8A 3OYCA 2DXCA 3CC2T 3CMAT 4KH1B 1QG0A 4JRIA 4ZCLA 3SWNC 4M7AE 3KL9A 3ASTA 4JLGA 2ZXIA 4L8JA 4P12A 4TMVA 4MMLA 3A8JA 2DYBA 4C0ZA 4C5HA 3QKJA 1X01A 1KRHA 4ZTJA 2E41A 2DRKA 2OTLA 4IURA 5TRDA 4N4HA 1K9MC 2CBXA 3ZPNA 1Y71A 4TVRA 2F4NA 1SKQA 4RD4A 5I22A 3JCMJ 1EFUA 2YRCA 5FWBA 5GAOm 1YJWT 2BE9B 1D8TA 2K2VA 1V0EA 2A37A 2GJKA 2IIMA 4TMZA 2D8HA 4XTXA 1VQ4A 3THKA 1VQ5B 3OYYA 5KE3A 1K4US 4L59A 3ZFJA 3JCMV 1QVGB 3SDZA 3MP6A 1WDXA 3A8IA 2RK1A 3PIOA 3ASRA 1Q95G 1W70A 5CIUA 4G7XA 1BCMA 3QDRB 4J6WA 1IXDA 1JNYA 4P1VA 2Q6LA 1QCFA 4C92B 2QE7A 3FDRA 4YTLA 3CCMA 1C6VX 3SJPA 1ZA1B 3MCAA 2RC5A 2JM8A 1EZZB 3L42A 1TUCA 2VKNA 3I9QA 4FU6A 1YJNQ 2D3LA 1NBMA 1R5NA 2QN6A 2YWEA 4V2SA 1KK7A 2LT1A 4KBMB 1YITT 5FU7B 2VBTA 2COWA 5GANg 2XKOC 1GCPA 2L3SA 2W0ZA 1G7SA 2R5AA 1SHFA 2QK0A 1EIFA 2RHYA 1NYFA 2DCUA 4BI3A 1ZSGA 2Y4YA 1XQBA 1X6GA 4C0FA 3DLLA 4M75D 2J6KA 1R5OA 3I35A 1K1ZA 4DOWA 1UD4A 2V7TA 4J7IA 4M7AD 1V5VA 1LCKA 5IYPA 1JXOA 1ZUKA 4HT9A 2GQFA 2IVWA 2YWGA 2OTJT 3I5RA 5L23A 3AVTA 4Z4ZA 2E3HA 3G71A 3JB9F 4Z1MA 3ME9A 1WOOA 4OMLA 1FXXA 1I0CA 4KH0B 2GQVA 3V7RA 1WXBA 2QXFA 2B7CA 1OX8A 2ABLA 5IXBA 1BB9A 5FU7C 5GAN5 2G3RA 3R6JA 2XDPA 1NPPA 3E1SA 4JZ3A 1X75C 1W0JA 4RD2A 2BM1A 1M8VA 4RTVA 4F7UE 4XU3A 2LT4A 2XMFA 4ZV4A 3M5AA 4IKFA 4II3A 4P6VF 5CKDA 3CD6Q 4M78D 3WNCA 4FYWB 2M16A 4NNJA 4ZN3A 1F20A 1W2BS 1VQNT 5KCOA 1WYXA 1AZEA 3CCQA 3QJ6A 2ZZFA 3CCQB 2OTLT 5CQYA 3PENA 1BYMA 2QQRA 3A35A 4RKUE 3JCMf 3ZEHA 3VRZA 1N0VC 4J0QA 1M3CA 2OK7A 2X4XA 2CP5A 2OI3A 5BSYA 1ZM9A 3OZUA 3CCQT 5LJ5f 1R8OB 4HCZA 1OU8A 4LE9A 4XU1A 1Q7YD 3GNFB 1G3WA 2QTXA 4KRTA 1ZX6A 1E7OA 2D1XA 3CP2A 3ISXA 3Q3AA 4UZFA 3RMQA 2M1HA 3M0UA
chains in the Genus database with same CATH topology
2DYIA 3H9NA 1PM3A 3A1PA 3HTRA 2F1LA 2QGGA 2DOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYI A;  3H9N A;  1PM3 A;  3A1P A;  3HTR A;  2F1L A;  2QGG A;  2DOG A; 
#chains in the Genus database with same CATH topology
 1FMK A;  4PC1 A;  3CXC A;  3G4S Q;  4HE5 A;  2GPJ A;  2DF6 A;  1I07 A;  3OW7 A;  1T5E A;  3LWH A;  3G6E A;  4LBZ A;  1G83 A;  1M2V A;  5CO7 A;  3CXC P;  3CPF A;  1QVF P;  2ZXH A;  2PZ1 A;  4PJO G;  4D8D A;  2CH4 A;  4P5N A;  2CT3 A;  3N5B B;  3WYA A;  2CSI A;  2EVR A;  2DOG A;  3OQ5 A;  4AMC A;  5HKC A;  1MV0 B;  1Q7Y U;  3H0H A;  2OTJ B;  3OEE A;  1TS9 A;  4OF1 A;  1WOS A;  4TKO B;  1RI0 A;  4LDW A;  2GTJ A;  3KBG A;  2EYZ A;  4M2L A;  2XZO A;  1MV3 A;  4KGV B;  1BJK A;  1TTT A;  2YLB A;  1QFJ A;  4M77 A;  5KYU A;  5GAN 8;  1ZM2 A;  3CPW A;  2FL7 A;  1K8A C;  4M78 A;  1AMO A;  1WI7 A;  1RAG B;  5EG2 A;  2Q6I A;  2DD5 A;  2RJD A;  1WOP A;  4MDW A;  2L3Q A;  4XTU A;  2CF4 A;  1S72 B;  3LX7 A;  4HA8 A;  1GJR A;  3CME B;  2MI6 A;  4M77 C;  3RIR A;  4B48 A;  1S1N A;  1OGI A;  3MP1 A;  3AHU A;  3CCE B;  1IRE B;  3PTA A;  1Q9S A;  1K8A U;  3UPU A;  3H94 A;  4Z4V A;  2CUD A;  3MPU B;  4X7C A;  1Y57 A;  3AT1 B;  2WPD A;  3CPW B;  2DJQ A;  4ZGJ B;  3WBK A;  4RTZ A;  4MZM A;  3FRN A;  2PUO B;  3JCM e;  2AHO A;  4Y92 A;  2NYS A;  3M0T A;  1M1K D;  4M7A C;  2K6D A;  2HEQ A;  3W2G A;  1MNE A;  2COZ A;  1KFZ A;  4JZ4 A;  2C78 A;  5IT9 E;  1J9Z A;  3J80 E;  1CQX A;  3HFN A;  4EPC A;  2BM0 A;  4TMT A;  4PJO D;  1K28 D;  1D09 B;  1IB8 A;  4DBH A;  1Q86 C;  1W0K A;  2YWH A;  4XR6 A;  5GV7 A;  2FEI A;  5J39 A;  3CCU A;  3Q38 A;  4BE2 A;  2QEX A;  1UMK A;  1M2O A;  4AVZ A;  4RUG A;  1FYN A;  1GRI A;  1WJQ A;  4YAU A;  1QKW A;  1VOM A;  3AGP A;  3ASP A;  3PVD A;  2EW3 A;  1R77 A;  2QI2 A;  2KRN A;  1H3Z A;  2NPF A;  2KXC A;  2JXB A;  1QCO A;  1BIA A;  2RQT A;  2LQW A;  4RLZ A;  2X8K A;  4DQL A;  3CCR B;  1ELO A;  1I8F A;  1VQ9 B;  4JRK A;  5GAN d;  1I8D A;  2DXT A;  3OYG A;  2GRE A;  3JCM c;  2EYY A;  1M1F A;  4X07 A;  4TN1 A;  2P0P A;  3UT1 A;  2LRQ A;  1X2Q A;  4U9U A;  1MHN A;  1RLQ C;  2EKO A;  3GNG A;  2DLP A;  3EGX B;  1N07 A;  4NL2 A;  2ROL A;  2YXY A;  4M75 G;  4FCY A;  2OK8 A;  5DM7 R;  1NJI R;  2VBU A;  3BQJ A;  3EFO A;  1Z9Z A;  3JRZ A;  1IZ6 A;  1FDR A;  1WXU A;  3ZBT A;  3OA6 A;  2E1H A;  4KKS A;  2BMW A;  3GIR A;  2YDL A;  1PD0 A;  2FZK B;  2KY9 A;  4LDU A;  1JB0 E;  2KT8 A;  4FYY B;  3CCS A;  1T6Y A;  1DJ7 B;  1SF9 A;  2JTM A;  4MMK A;  1WDT A;  4J9I A;  4UZU A;  3CBP A;  3FEO A;  3G71 Q;  1AIP A;  1S0U A;  3G4S A;  2C2W A;  3BCF A;  1YJN B;  5GAN 6;  1FRN A;  3AVY A;  3VS2 A;  2OYN A;  4DBF A;  2QAZ A;  1E1Q A;  4RDL A;  2EAY A;  4OVA A;  3CTA A;  4FT2 A;  5LL6 S;  2B5O A;  5J3O A;  4X0C A;  5IH2 A;  1OX9 A;  2A0F B;  1VIF A;  2ZZQ A;  3A5Z B;  4PJO A;  1YJW B;  1G3Y A;  4AC9 A;  1EXM A;  4XNF A;  5HXB A;  2CC2 A;  1NJI D;  2LZJ A;  3LO8 A;  2ATC B;  4M7D G;  1RAI B;  4KGZ B;  2VUB A;  1VQP B;  2HDA A;  3A8O B;  3NFC A;  4DQK A;  2RC6 A;  1Q82 R;  2JDI A;  3QII A;  4ZGE B;  4PAA A;  1VYT A;  1IJF A;  4QQD A;  4AF6 A;  2ESW A;  3OYA A;  5E6T A;  2DZ9 A;  4OPO A;  1WZO A;  4C0D B;  1VQO A;  2ZBU A;  4XLF A;  1UGQ B;  4EMH A;  2X4W A;  1BPL A;  2DM1 A;  5GMK e;  3ZZU A;  1N8R D;  2ECZ A;  4C0D C;  3WVE B;  1IB0 A;  4XM3 A;  3VU3 C;  4NL3 A;  5LJ3 h;  5FU6 B;  2B86 A;  4F7U B;  1WXT A;  3M55 A;  2CK3 A;  1EP3 B;  2OBR A;  2QA4 T;  1Q81 D;  2QQB A;  4VUB A;  4Z4S A;  1LNX A;  3JCM Q;  2Y90 A;  3EAE A;  2JIZ A;  2CGH A;  4RD6 A;  3ZUG A;  1FMV A;  3CCE T;  2KSS A;  2XNJ A;  1ZUY A;  5GMK i;  1PJ6 A;  5EC7 A;  1NJI C;  3CCL T;  1U3O A;  5M9O A;  1VQK A;  2D9R A;  3ONY A;  1RAA B;  3V76 A;  3NTH A;  4AFU C;  1YIT Q;  1QP2 A;  4FSS A;  5HK3 A;  4M7D A;  2RMO A;  4J9C A;  2J7I A;  2JJ1 A;  4RCZ A;  3BY1 A;  2Y4X A;  4OGE A;  5IXF A;  3J81 E;  1W1F A;  2EYQ A;  3OYD A;  2OTL Q;  4HE6 A;  2X85 A;  5FL7 A;  2XZL A;  4ZTF A;  4TMX A;  2MCN A;  4Z88 A;  1LPL A;  4GLK A;  2V7X A;  2RQR A;  2XEX A;  4XN0 A;  1UHC A;  2ROT A;  2QQ9 A;  4Z4T A;  2HSP A;  1I18 A;  3CEY A;  2GJR A;  2JTF A;  1VQM Q;  4G1V A;  2C0O A;  1YHQ A;  1M1G A;  1M90 R;  1ZA2 B;  2FO0 A;  2YRD A;  4XLA A;  1WJS A;  4FK8 A;  1B7T A;  3QFS A;  3R6N A;  2F5K A;  1TSF A;  1IGQ A;  1YIJ T;  2GJP A;  5KE2 A;  1DDI A;  2ZPI B;  3CMA Q;  3UWN A;  3FPP A;  4NCN A;  3KFV A;  3RBB B;  3UA7 A;  3L2U A;  2ZBV A;  5LJ5 g;  2QDX A;  2FPD A;  5H59 A;  3TVT A;  3HAG A;  4FXU A;  1AWW A;  4P25 A;  1TWB A;  4Z4W A;  2E6Z A;  5GAO r;  4ASU A;  2PMD A;  5D6X A;  1VQP A;  4A4E A;  3OW2 P;  5LJ3 g;  4II2 A;  3V7A A;  4E7I A;  3CCM Q;  2LJ1 A;  3A8L B;  3HRS A;  5CR2 A;  1Q82 U;  4KUI A;  2V4D A;  2RH2 A;  2DA9 A;  3X26 B;  3LW5 E;  1FNM A;  1VQ8 T;  2HMA A;  4PK4 A;  4PNO A;  4HKE A;  1UB4 A;  4YAL A;  1I7P A;  4M1K A;  5GAN e;  2ED1 A;  4E47 A;  3CCS B;  4Z4U A;  2HNI A;  2DL4 A;  2X3U A;  1JB9 A;  4B3X A;  4BDY A;  4C43 A;  5LMZ A;  3DB3 A;  2LJ3 A;  4C0G A;  1H64 1;  4YAW A;  5FA6 A;  3EFO B;  3JAM E;  2NLU A;  3W2I A;  2QDY B;  2KT1 A;  5D7U A;  3EG2 A;  1M9S A;  2RPN A;  1UDL A;  4NBS A;  1VQN B;  2EGA A;  3E19 A;  4KT0 E;  3BH4 A;  1VF7 A;  4M7D B;  3CC4 T;  1SRL A;  2ZTG A;  4Z4R A;  2QTV A;  2F2X A;  3E9G A;  1AEY A;  1VLY A;  1NEB A;  1YLO A;  3ASK A;  2NV4 A;  4F04 B;  1VQM A;  5A88 A;  3G71 B;  1QVG S;  1IRX A;  1G7T A;  3CCV A;  4WZL A;  1PD1 A;  3CC7 T;  2CT4 A;  4C8Q C;  3C12 A;  1G3S A;  4OMP A;  1YWP A;  1SEM A;  1H8E A;  1HSQ A;  1KTV A;  4CC3 A;  3QUI A;  5AT1 B;  1QWF A;  1OZ2 A;  5GAO n;  4QV2 A;  2W6J A;  5FWC A;  5GAO p;  1D3B A;  3VKI A;  1CNE A;  1WNL A;  2DER A;  2O4X B;  1JU5 C;  3FC3 A;  3VS5 A;  5LJ5 h;  4XLE A;  3RKW A;  4PKC C;  2PVG B;  3L1A A;  1T6X A;  2C06 A;  3UA6 A;  2EFG A;  5KYY A;  3HL8 A;  1H8K A;  4TT3 A;  2QG9 B;  3X28 B;  3HP9 A;  4YAO A;  1NB9 A;  1YHQ T;  1VQO B;  1QFZ A;  4M4S A;  1UE9 A;  2H3E B;  3JSC A;  3MKD A;  2P84 A;  3V8J A;  1VQN Q;  4GQN A;  2DVJ A;  4JJC A;  2ZZE A;  3Q6R A;  4NOY A;  4X7E A;  3V8K A;  3L2W A;  2F43 A;  4AT1 B;  3M0Q A;  4ZGD B;  2QGG A;  3JB9 G;  1TU0 B;  3OMG A;  1MND A;  4WF2 A;  1VJS A;  3VUB A;  4IIO A;  1WFW A;  1VQN A;  2KRS A;  3G71 T;  2V31 A;  3X25 B;  2EYW A;  1LVK A;  3MEW A;  4ZN1 A;  3CCS Q;  4C92 A;  3CCL Q;  3P26 A;  1MMG A;  1XB2 A;  1VHE A;  4KKU A;  2RHZ A;  4F16 A;  1Q81 C;  4XAX B;  4ESR A;  3H6Z A;  5GMK m;  4OMM A;  1KQ1 A;  3ZBD A;  1KMH A;  2DFU A;  4N3G A;  2JNG A;  2V7W A;  5KW9 A;  1Q86 R;  3P8H A;  4M0L A;  3SEJ A;  3M0R A;  1WJR A;  1ZSZ B;  1FX0 A;  3FJP A;  3GIB A;  4HCC A;  3BY7 A;  3OB9 A;  4B43 A;  4FSX A;  4FN5 A;  1Y96 B;  4XU0 A;  1QFY A;  1EFC A;  1YI2 Q;  5DLQ E;  3QZ9 B;  2NUT A;  2GF7 A;  2P0Q A;  1ZUU A;  4JJN K;  3CC4 B;  2GNC A;  4AG2 C;  1OB2 A;  2RF0 A;  1CSK A;  1FRQ A;  1OB5 A;  4XTV A;  2XHC A;  2EFI A;  2JW4 A;  2E4H A;  4RCY A;  1KC8 R;  4GBQ A;  2GFU A;  3ZIA A;  3EGD B;  2XDB A;  4XD7 A;  1QW1 A;  1VQ9 T;  3PT9 A;  4IUT A;  2FHD A;  4QQ6 A;  2M0Y A;  2L0A A;  3CPX A;  2CZ0 B;  3CC4 A;  5AN9 A;  3CCS T;  2RNA A;  3CXC S;  1BI0 A;  1RI9 A;  2Z0W A;  1M4Z A;  1RAE B;  1YN8 A;  2E70 A;  2BV3 A;  4C8Q A;  3FLG A;  4F17 A;  3QZ5 B;  5LJ5 e;  2O4X A;  2VJJ A;  2W10 A;  3U6K A;  1AD5 A;  2DNU A;  3SB2 A;  3OPO A;  3H0I A;  1S4M A;  1DG1 G;  4XQF A;  2X53 S;  3BFM A;  2QA4 B;  2C77 A;  3S6W A;  4X8I A;  2HL3 A;  3JCM h;  4A4F A;  3BY2 A;  2LMJ A;  2YUN A;  4QKU A;  1N6A A;  2BSA A;  4G1B A;  1Q81 U;  1CKB A;  1I1J A;  1WHM A;  5F4J A;  4J7F A;  2ZAE A;  5B6I A;  1T3S A;  5GAO l;  3VV0 A;  1YIT B;  4A4H A;  3SD4 A;  4LBW A;  3QHS A;  1YWO A;  2OTJ Q;  4EMG A;  1EP1 B;  1MUZ A;  2BTT A;  2CDT A;  2F1M A;  3LGL A;  2X4J A;  3M0S A;  1QGY A;  5IHI A;  1YI2 A;  1KQS S;  3U2Q A;  1N8R C;  3DB4 A;  3Q6Q A;  4XLC A;  2KRO A;  5CK9 A;  2RO0 A;  3BNW A;  4XLH A;  3QFT A;  2K57 A;  3CD6 A;  1JJ2 B;  2DIE A;  2FVG A;  1QKX A;  2F2V A;  2CW5 A;  1PC0 A;  3M53 A;  3OW2 A;  1E3X A;  3OP1 A;  2QQA A;  2DPP B;  2ZZG A;  1TH7 A;  1BMF A;  5CKH A;  1H85 A;  2P3M A;  4DBQ A;  1QUE A;  2O31 A;  5A2Q E;  1VQ6 T;  5IYN A;  2DL8 A;  1D0Y A;  4E2F B;  4C5E A;  4D8K A;  3OS1 A;  4J8O A;  3CCL A;  2C5H A;  4G5G A;  3SWN B;  1K73 R;  3CCL B;  4IUQ A;  2E1B A;  4ZCM A;  3SJZ A;  1RAB B;  3EG9 B;  2D0N A;  1D3B B;  4GY5 A;  4WTO B;  1VQ8 B;  4RG8 A;  2X6Y A;  2LQK A;  4A4K A;  1VQL T;  4OPV A;  1R0C B;  2HDN B;  2V8I A;  2V1Q A;  3SHW A;  4BY6 C;  2PUK B;  2NUP A;  1UJ0 A;  2XD0 A;  4M7D C;  1E43 A;  3BE3 A;  3CCU T;  4DK1 A;  3MO8 A;  4E6R A;  3LVB A;  2LQN A;  4RDK A;  5IN1 A;  2RI2 A;  2L3P A;  1T3L A;  5CAI A;  2KEA A;  5KCH A;  1M8M A;  2WJY A;  5A8A A;  1O75 A;  4C92 D;  1Q86 U;  4OB1 B;  2JT4 A;  4KUL A;  3GF5 A;  5FNZ A;  2W6I A;  2K7A A;  1WQ7 A;  2XZP A;  3VS3 A;  5F4O A;  3VJP A;  4QVZ A;  1F1B B;  1KQS B;  1NLO C;  1SKY B;  3I55 A;  3OW2 S;  2R6H A;  1W34 A;  1VHO A;  1B34 A;  1QGZ A;  2XND A;  3PGG A;  3J7A F;  3RER A;  4P22 A;  3I1F A;  5KNL A;  1YCY A;  1D1B A;  2A36 A;  2E3I A;  1GVH A;  4LNP A;  1YIJ A;  1I81 A;  2CZ6 B;  4BAC A;  2LVM A;  4EDU A;  3OOC A;  2RA2 A;  1YX2 A;  3S3O A;  2GBQ A;  2LP5 A;  2LX9 A;  2VGN A;  5GAM g;  3I55 T;  3MEV A;  1W9X A;  3E1Y E;  3S3M A;  2B8A A;  4JUV A;  4B4D A;  1P92 A;  5D6W A;  3CES A;  1YP5 A;  3PE0 A;  3A3G A;  2FVU A;  3PUN A;  1VQP T;  4M7A A;  2YUP A;  1UGS B;  3I5S A;  1YJ9 T;  2HKQ B;  3LGF A;  3GBQ A;  1M5Q 1;  4JS4 A;  1PSE A;  2KAF A;  3QWX X;  3VS6 A;  1G7C A;  3TSZ A;  2KE9 A;  4IW3 B;  4O5V A;  3WQZ A;  1OPK A;  9ATC B;  1VQ8 Q;  3I56 T;  2ZGW A;  3CMM A;  3EH2 A;  2CP2 A;  1IHW A;  2KR3 A;  2MPX C;  1YJW A;  3OZV A;  2BZY A;  2I2L A;  3C94 A;  1KC8 D;  4M7A B;  2GTO A;  1YJN T;  5ECA A;  2RHX A;  5GV8 A;  4XOP A;  1LJO A;  3WXM A;  2DZC A;  3CW2 A;  1WIE A;  3CRZ A;  8AT1 B;  4ELZ C;  1QLY A;  1W2B A;  4J83 A;  3NMZ C;  5FRO A;  1BX0 A;  2DMO A;  1U1T A;  1QVG P;  3TCJ A;  4N0A C;  3LWI A;  4XQ3 A;  3X24 B;  5DY9 A;  2K9G A;  4XN3 A;  4QVC A;  3JCM X;  5GJW B;  5KH6 A;  2FZC B;  3OW2 B;  4Y9R A;  2X4Y A;  3PA1 A;  1RQP A;  1YNZ A;  2DE0 X;  3VS7 A;  2YHT A;  3WY9 A;  3C95 A;  4R55 A;  4DNT B;  2MAM A;  1E79 A;  3QE2 A;  4K11 A;  2OBS A;  1U8R A;  2QGF B;  1GCQ C;  2CKK A;  4PAB A;  5GAN 2;  2FRW A;  2YWW A;  4RTX A;  1TUI A;  1ABO A;  5D6Y A;  3E2U A;  3RR6 A;  3CCV T;  4DBR A;  5HZB A;  1M27 C;  3JV3 A;  1PNJ A;  4LDX A;  5FRM A;  1YIT A;  4BY6 B;  1TOV A;  2R9V A;  1MMN A;  1X6O A;  3PMI A;  3G7Z A;  5I21 A;  1Q82 C;  2EQM A;  1JEG A;  3GOX A;  1Y96 A;  2YSQ A;  1U06 A;  2K5L A;  3QBY A;  5CCA A;  3CCR A;  4ACB A;  1O9S A;  2D9T A;  1C0M A;  5GAM h;  2RHI A;  2VBV A;  3AVV A;  2M0O A;  3RKX A;  2PLF A;  1GFD A;  1S72 Q;  4MZT A;  3WNB A;  2ZPH B;  3ZZT A;  1K9A A;  5FU6 C;  3BCD A;  1U2R A;  4X7F A;  3CCU Q;  1VQ7 B;  3REB B;  8ATC B;  1Y7X A;  2SRC A;  1QGA A;  4PLI A;  2QEX B;  5DS0 A;  1AWJ A;  2LCL A;  4RTY A;  1MAB A;  2BKD N;  2FRY A;  2KK4 A;  1VQ5 T;  4ROX A;  3QSY A;  1J3T A;  1HD3 A;  1TXQ A;  1UG1 A;  2OAW A;  2VJI A;  3CC2 B;  1QUF A;  2O01 E;  1KIK A;  3RY8 A;  2FYK A;  3OS2 A;  1UHF A;  4CRI A;  3H9N A;  2XOK A;  2D0Q B;  1H92 A;  2PE3 A;  2DIL A;  3RMS A;  1RUW A;  1WX6 A;  5TY0 A;  4UAJ A;  3SFM A;  3HTR A;  1D1A A;  3EG3 A;  2BGI A;  4YEL A;  1YI2 B;  1G8X A;  3V7C A;  2KGT A;  4C5G A;  4RD0 A;  2SEM A;  3CC2 A;  4O6J A;  3AVX A;  3CB4 A;  2VGM A;  2AKK A;  4X34 A;  4A4G A;  3QFC A;  4PC2 A;  3NHN A;  4DQ2 A;  1D1N A;  4R56 A;  1KK3 A;  3BDU A;  2FG0 A;  1B3Q A;  1QVP A;  3VRY A;  4II1 A;  4JLI A;  4XU2 A;  5DLO A;  4DEX A;  2Q6O A;  2JMA A;  3EHQ A;  2IPO B;  3CC7 Q;  3OE7 A;  1YIJ Q;  1B34 B;  1ZM4 A;  2HCK A;  4DEY A;  5A89 A;  2JS2 A;  1OPL A;  2MWO A;  2EYX A;  1N0U A;  3WND A;  3I55 Q;  1HJD A;  4N3N A;  2A28 A;  4BDZ A;  1XJW B;  1EFT A;  5LJ5 j;  3GP8 A;  1FWZ A;  2KYB A;  4J9D A;  2X9H A;  5IHN A;  1VQ4 T;  1TUD A;  4K1X A;  1WHG A;  3U23 A;  1TLL A;  1H42 A;  4BB7 A;  2LZ6 B;  3CCE A;  3LH5 A;  2G6F X;  1JBM A;  2J6F A;  5KYW A;  4ZCI A;  2RN8 A;  3OY9 A;  3M56 A;  2D6F A;  4BE1 A;  1NB0 A;  4X7D A;  2LJ0 A;  1TVC A;  4G7W A;  4RPD A;  3AGQ A;  2RD1 A;  2XK0 A;  5EMN A;  2LNH B;  1ZSZ C;  3T53 B;  1VQ6 Q;  3CXC B;  1AT1 B;  1D0X A;  2AKL A;  4LDY A;  1D1C A;  1G3T A;  3DLM A;  1QX4 A;  4TMW A;  2WR8 A;  4HCB A;  1BCO A;  1YCS B;  3CCR T;  4CQJ A;  2LCC A;  2DTO A;  2HD0 A;  3PA2 A;  3CC7 A;  4C92 G;  4H9G A;  1V0F A;  4FL6 A;  3WXM B;  2WSE E;  2DEU A;  3I56 Q;  4FYX B;  1ZBJ A;  3P8B B;  2DIQ A;  2EQU A;  1KJW A;  3OSS C;  2X0K A;  2XG8 D;  1M1K C;  3WVD B;  2PU9 B;  1ZM3 A;  2GK6 A;  5GMK l;  4QT7 A;  3VS1 A;  1Y0M A;  5GAN f;  4X05 A;  4ATO A;  5KYW B;  4IUV A;  4LUD A;  1PKT A;  1X2K A;  1Q7Y R;  1N8R U;  3MCA B;  4MDX A;  2OJ2 A;  2AHJ B;  4M4Z A;  1QMC A;  4LBY A;  4M78 F;  1T6Z A;  2NUT B;  2PVO B;  4RJL A;  3OMC A;  1RAD B;  1E64 A;  1PWT A;  1JJ2 S;  4P2N A;  1GBQ A;  5J3B A;  1PCX A;  1RAF B;  3OSV A;  1N08 A;  3CME A;  3D26 A;  1XNI A;  4GLM A;  3D7S B;  2V8J A;  1NJI U;  4M75 C;  1KK1 A;  1PRL C;  2NWM A;  3JB9 D;  1QCN A;  1B07 A;  3GQB A;  2DRM A;  1A0N B;  3CME T;  1N9S A;  1EP2 B;  4X9D A;  4C8Q B;  3I55 B;  1VQ4 B;  3JCM P;  3ES9 A;  2PVD B;  1EWY A;  2VBS A;  2I0N A;  3B78 A;  1K0S A;  1RAC B;  4DK0 A;  2O9S A;  2YUO A;  5LJ5 d;  1QVF S;  1KHC A;  3TSW A;  3O5Z A;  2C0I A;  1G5V A;  4PJO E;  3QPH A;  2PIA A;  2L89 A;  4WWV A;  4NS5 A;  1G7R A;  4RD1 A;  3EG0 A;  1SSF A;  2XU8 A;  4WQM A;  4Y91 A;  1MMD A;  3G1J A;  1NYG A;  3CME Q;  1Y07 A;  1I4K 1;  2LTO A;  2RQW A;  1VQ9 A;  3ONU A;  4Z02 A;  4Y28 E;  1YJ9 B;  2HL5 C;  1H8H A;  4LD9 K;  2K5I A;  1HZE A;  2CZ7 B;  1R5B A;  3FPK A;  4QQG A;  1N8R R;  4P6Y A;  2QA4 Q;  1Q82 D;  1W6X A;  1N5Z A;  4BI4 A;  1XTD A;  4RTU A;  2EQI A;  3PFS A;  3QYG B;  1KC8 U;  4QVA A;  5THX A;  2RB6 A;  5LJ3 j;  2QEX Q;  3CCU B;  2E1R A;  3SWN A;  3CMA B;  2DTI A;  4PGO A;  1X6B A;  1OEB A;  1KD1 R;  6AT1 B;  2COY A;  3CPW P;  4JS5 A;  1NLP C;  1VQ7 A;  4C0S A;  5GMK j;  3W2F A;  2RJF A;  2DK3 A;  3CCV B;  3M4G A;  1VQM B;  2YT6 A;  4E7S A;  4PFP A;  1VQ7 Q;  1F60 A;  2P4T A;  2L5Q A;  2C0T A;  2BN4 A;  2F5T X;  3TRE A;  2ZPF B;  4E7J A;  5FLX E;  1DDG A;  3CBO A;  2RI3 A;  2OTL B;  2HQH A;  1UUE A;  1PJ7 A;  4RD3 A;  3CD6 T;  3VS0 A;  4PC3 A;  2EKH A;  2J6O A;  4FYV B;  4X1V A;  3QJY A;  4ANJ A;  5GAN 7;  2ZIT A;  2K79 A;  4R71 A;  3PNW C;  1NE8 A;  1SG5 A;  1VQK B;  5JBQ A;  4CC4 B;  2CZ1 B;  4TSF A;  2EQJ A;  1VQ4 Q;  2E5Q A;  1VQ6 A;  1VQL Q;  2QA4 A;  3A3B A;  2JM9 A;  2LQ8 A;  2KBT A;  1X27 A;  1KQS P;  3CCQ Q;  3GPL A;  1WA7 A;  1GBR A;  1HK9 A;  4RTT A;  2E10 A;  2QAS A;  2V26 A;  4L6V 5;  3CPW S;  2QEX T;  1AWX A;  1VYU A;  4E7H A;  5C6S A;  5KYU B;  2DO3 A;  2VC8 A;  5GJV B;  4M77 E;  1KQS A;  4OMF B;  1UD3 A;  5IYW A;  4OPS A;  3AVU A;  3ULR B;  3VUZ A;  2K3B A;  1OGJ A;  3DKM A;  3FKS A;  1U5S A;  4OMQ A;  2VZL A;  3CCJ T;  4M77 F;  3EGX A;  4ORZ A;  1Y0R A;  3URG A;  3LLR A;  4OGC A;  1KQ2 A;  5IHK A;  4E0F A;  1PG5 B;  2XIC A;  4JRQ A;  2CYZ B;  3EGD A;  4M7D E;  2QTL A;  1GO2 A;  3CD6 B;  3B8H A;  2KVO A;  1X69 A;  3OYM A;  1K9M R;  1M2V B;  1VUB A;  2XDD A;  2J05 A;  5GAN 4;  1M1K R;  1EX4 A;  4KUD K;  4OMN A;  2J7K A;  2M5S A;  4X9C A;  2RJC A;  2HCJ B;  1KD1 D;  2V8K A;  4OB3 B;  1W87 A;  4KKT A;  2DD4 A;  1Q81 R;  3VNU A;  4F7D A;  3I56 B;  5GAM d;  4Q5W A;  2RM4 A;  3H0F A;  1BX1 A;  4FIB A;  4BE0 A;  1XOV A;  1HYO A;  3G4S T;  1TTH B;  5GAM e;  4WZE A;  4Y9U A;  3A98 A;  1PKS A;  2VV5 A;  1JA1 A;  1GAW A;  4DOV A;  4XTY A;  2HZY A;  2BZ8 A;  3OYL A;  3ZC3 A;  4M7D D;  2JJ2 A;  3T56 B;  4J9B A;  3H41 A;  3A8M B;  5I2S A;  2HSE B;  1K9M D;  2ZPG B;  4PC6 A;  2VWF A;  5GMK h;  2O88 A;  3V8L A;  2CP7 A;  5LJ3 e;  3OYF A;  3LNN A;  1OOT A;  1N9R A;  5TV2 A;  1KK0 A;  1NDH A;  1AHJ B;  1ZLM A;  1T0J A;  1SPK A;  4M75 E;  2A3L A;  3CCJ B;  3R6O A;  2CP6 A;  5A0D A;  1H3H A;  4M78 B;  2DEQ A;  2F1L A;  4JJB A;  2KMT A;  1FNC A;  3G6E B;  1OB0 A;  3BC9 A;  2BE7 D;  1YI2 T;  4M77 B;  2CP0 A;  3CCR Q;  2WYR A;  3A8K A;  3CC7 B;  3VYH B;  4F7U A;  3PMT A;  1WHL A;  3JCM d;  1RLP C;  4M77 D;  1M3B A;  1TG0 A;  1YJN A;  4XOR A;  2WZP P;  4J9E A;  4P26 A;  1XFO A;  2XID A;  2EJG A;  1JJ2 A;  1JXM A;  2DKG A;  2YWF A;  5DSZ A;  4AG1 C;  2DL3 A;  3FIF A;  5H5J A;  3JQQ A;  4LD6 A;  5CKE A;  4RG2 A;  2DL7 A;  2YUQ A;  4QVJ A;  5A0L A;  1NPR A;  3VS4 A;  1S72 T;  4BI8 B;  1NZ9 A;  2LDM A;  3V7S A;  2FPE A;  1WQW A;  4X06 A;  3CP8 A;  1UGP B;  4PFO A;  2NUZ A;  3REA B;  3SLD A;  1CNF A;  4Y7C A;  1NRK A;  4YEJ A;  1BQE A;  5FRN A;  4B3F X;  3OYI A;  2X51 A;  3OBY A;  2X6W A;  2BF4 A;  4RTW A;  1KK2 A;  2AZS A;  2KNB B;  4ME7 A;  1GCQ A;  5I2M A;  4PJN A;  4C5I A;  1V76 A;  5I11 A;  3DDY A;  2CUB A;  2ENM A;  2VVK A;  2E64 A;  1VQ5 A;  2C4U A;  5KYX B;  1OUL A;  3W5H A;  2FZG B;  4N4I A;  2EGC A;  3VO1 A;  3WBJ A;  2RJE A;  2QYZ A;  1OV3 A;  1FND A;  4RPB A;  2B7B A;  1BBZ A;  4MYT A;  4WZT A;  3QWY A;  1M30 A;  2VB6 A;  4Z4Y A;  3B82 A;  5DN6 A;  4RMO A;  1WP6 A;  4PJO F;  2A08 A;  3UAT A;  5AYF A;  2V7V A;  5J35 A;  5GAN h;  3QSU A;  3LYI A;  4M75 F;  4J6Y A;  2GCX A;  1BK2 A;  3GLX A;  4LC0 A;  3TQ7 P;  2CS7 A;  4RDJ A;  3RUX A;  5HKK A;  2D8J A;  3NTK A;  1WLP B;  1VQ8 A;  1SKU B;  4BPR A;  3OJX A;  1QWE A;  3A8G B;  3ER0 A;  2LX7 A;  3L2Z A;  4B9X A;  5IK2 A;  2JZ2 A;  4C8Q E;  3G4S B;  2ZL5 A;  1B2R A;  5FO0 A;  1B23 P;  3MP8 A;  4HXJ A;  2ZPE B;  1AVZ C;  3KUF A;  2E5K A;  1BI2 A;  1BLI A;  2JMC A;  3OYE A;  3VNV A;  5GAN j;  1UJY A;  2K3X A;  3HFO A;  3PIP A;  5HK0 A;  1VIE A;  3C0C A;  1K73 U;  2DY1 A;  2M51 A;  4RCB A;  1GR1 A;  2K2M A;  3S3N A;  5BSX A;  2QMU A;  3MHP A;  3U6B A;  4HVV A;  3RNJ A;  1E1R A;  1VLO A;  4WZK A;  1GXI E;  2PNI A;  2HAX A;  3FB9 A;  3KEW A;  2I1L A;  1SSH A;  1RAH B;  2KYM A;  1VQO Q;  1D2E A;  4YHB A;  3RKY A;  3AVW A;  1VQK T;  2DTH A;  4QW2 A;  3CCJ Q;  1VQP Q;  4E7K A;  3INZ A;  5KYY B;  3EG1 A;  2CND A;  2NUP B;  1OU9 A;  4B44 A;  2JUF A;  4C92 C;  1WPC A;  1M90 U;  1JO8 A;  1YJW Q;  1ZQ1 A;  4XKW A;  3M57 A;  1ARK A;  4YAF A;  2A7Y A;  4XKV A;  1D0Z A;  2KRM A;  2R58 A;  3LH0 A;  4PJL A;  3UF4 A;  1M1K U;  2ZCF B;  4WCI A;  2M9U A;  3H8Z A;  2KVQ G;  2V7Q A;  1KSW A;  4FT4 A;  3ZL7 C;  2VNJ A;  2LNV A;  1M3A A;  2PQW A;  3HHT B;  1K9M U;  3OYJ A;  1P4M A;  1W4S A;  3VYG A;  1UD6 A;  2CRV A;  1OHH A;  2AZV A;  2YRV A;  3HRT A;  3P27 A;  5CKB A;  3FJO A;  2OTJ A;  1M90 C;  2K3Y A;  4OP0 A;  1QVF A;  4ACA A;  1WU8 A;  2R5M A;  3JB9 H;  1K73 D;  2XGJ A;  5GAN 3;  3NTI A;  2R57 A;  3MEA A;  2DL5 A;  2HQX A;  3PUM A;  5TR9 A;  1VQ9 Q;  3VR6 A;  3M4Y A;  3OEH A;  2EBP A;  1VQ6 B;  1AOJ A;  1E62 A;  2O2O A;  5GAM f;  3HPW A;  2DXB A;  2L3R A;  2ZZD A;  4B6M A;  4C8Q D;  2E6N A;  1EFR A;  4KGX B;  3PVQ A;  1XQH A;  1V1C A;  2WSS A;  3QFR A;  4OB0 B;  2MIO A;  2JVV A;  1KC8 C;  1PKV A;  5L46 A;  4M75 B;  4PJM A;  1FNB A;  1RL2 A;  2P0K A;  2LCS A;  1ACM B;  2ZL7 A;  7AT1 B;  1N05 A;  1K8A R;  2KI7 A;  1IGU A;  2DXU A;  2OAU A;  2OX7 A;  4HVU A;  2DAQ A;  1ZBX A;  1YBY A;  1YIJ B;  1QVG A;  3OBW A;  4EMK C;  4MZP A;  4C8Q F;  2WZN A;  3OYH A;  3NGP A;  1PJ5 A;  3VO2 A;  3M0P A;  3OYB A;  3KXT A;  5CVI A;  4UC4 A;  5LJ3 d;  1VQL A;  4J9G A;  2K5F A;  3TEE A;  1KD1 C;  2EWN A;  2VAS A;  3JQP A;  1IJE A;  2HKN A;  4P3I A;  3HSB A;  1E6G A;  3L2R A;  1GAQ A;  3GVL A;  2AK5 A;  2DBM A;  4RM0 A;  2LC4 A;  2JS0 A;  1A8P A;  2JN0 A;  1PHT A;  1WTH D;  3E20 A;  3X20 B;  3G6E T;  4ZNX A;  1ZHI A;  1IHM A;  4MYU A;  2D3N A;  4CC2 A;  3OYN A;  1KJZ A;  1GFC A;  1V29 B;  1WGS A;  3GVJ A;  3JCM W;  1KD1 U;  4DA4 A;  3LQE A;  3EH1 A;  1K0X A;  1YFN A;  1E63 A;  3OYK A;  3F70 A;  2VNI A;  3UDC A;  2QTZ A;  3OKX A;  1I5O B;  4M53 A;  2VYT A;  4JPB W;  4M7A G;  4A54 A;  2DIG A;  4C92 E;  2FB7 A;  3O8V A;  5HZA A;  1HVX A;  2V7U A;  1U1S A;  2MMP A;  4G6I A;  1VYV A;  4B9W A;  3CQT A;  4PJJ A;  1YHQ B;  1VQ7 T;  1QVF B;  1W2B P;  4XK8 E;  5LJ3 f;  1NM7 A;  2BVN A;  2KQW A;  1UD2 A;  4QHY A;  3PVL A;  1UGV A;  3M9Q A;  4L5G A;  4R0K A;  3BW1 A;  1COW A;  1FMW A;  4LDV A;  1NBE B;  4OP7 A;  1UD5 A;  2CH4 W;  1UFF A;  2Q6K A;  5HY6 A;  4UZE A;  3RDV A;  1X43 A;  4A53 A;  3ZZ0 A;  1XE1 A;  3SKB A;  1GL5 A;  2IG0 A;  1E3Z A;  4J9F A;  2WSC E;  3SLN A;  2AT1 B;  2RHU A;  4RCC A;  3W5V A;  1AZG B;  1N06 A;  2E12 A;  4OOX A;  2C4T A;  2L8D A;  2VNK A;  2L2P A;  4CI0 C;  1YJ9 Q;  1Q86 D;  1WHJ A;  2HQE A;  3L2Q A;  3OS5 A;  1M90 D;  3CC4 Q;  1R0B G;  3M59 A;  3HKS A;  1IO6 A;  3SEM A;  4JDS A;  1VQO T;  5KYN A;  3CBM A;  3ZBU A;  2HLD A;  1UEB A;  3RES A;  2BZX A;  1I5L A;  2RI5 A;  3JQR A;  2AIR B;  2H8H A;  1RQR A;  2X3W D;  4EH1 A;  4FW2 A;  2GFA A;  4HVW A;  4P3Y A;  4ELY C;  3GSI A;  5A0G A;  3OJW A;  4J5Y A;  3BDL A;  2JJ9 A;  4AFQ C;  1NEG A;  1OZ3 A;  4B3G A;  1W2B B;  2DVE A;  2EIF A;  4LXC A;  2F69 A;  5GAM j;  5CQX A;  3OS0 A;  3W2H A;  2KDS A;  2ZPB B;  4XMY A;  1K76 A;  2EIX A;  1WSV A;  3A8H B;  2VXE A;  2DYI A;  1MMA A;  2JOY A;  1SHG A;  2H3J A;  3MET A;  4PL6 A;  4Z89 A;  2MWP A;  4D6W A;  2MYS A;  4ZGQ B;  4QFM A;  4XTW A;  3MJX A;  2VYQ A;  4EIK A;  4XON A;  1OQK A;  1BU1 A;  4F14 A;  3QXE B;  4M78 G;  1WPY A;  3ASQ A;  1UGR B;  1Z9Q A;  2X35 A;  1PM3 A;  2QDL A;  1WOR A;  1KHI A;  3G6E Q;  3J81 k;  2J06 A;  4PJO B;  3ASS A;  5KSW B;  4EMK A;  4M77 G;  2WJV A;  4XOT A;  5IYR A;  4QVD A;  1PSF A;  3Q39 A;  1QP3 A;  2MK5 A;  4CC7 A;  2M02 A;  4OB2 B;  5IYQ A;  1ZSZ A;  3W5U A;  1Q7Y C;  2C5B A;  2QQS A;  5CKF A;  3QG1 A;  1C1A A;  3MHX A;  2BIV A;  3QYH B;  1CKA A;  1QQJ A;  3OZW A;  2EPD A;  4OOS A;  4C8Q G;  3T9N A;  3VMF A;  1HA3 A;  3T51 B;  4HIZ A;  3GVK A;  1EFN A;  2O9V A;  2HBP A;  2KXD A;  4J9H A;  2PTK A;  1SM4 A;  2GGR A;  3JU4 A;  3CMA A;  2EQK A;  1BKB A;  3G05 A;  4M75 A;  4PFZ A;  1DAR A;  2RK2 A;  4E7L A;  1ZUN B;  2JN9 A;  1OYX A;  4F7U G;  4FW1 A;  4LN2 A;  4BD3 A;  4YXW A;  4M78 E;  2DJZ A;  3I56 A;  2DET A;  3NE5 B;  1T0H A;  4IIM A;  4C92 F;  1TUG B;  4E7Z A;  2OBT A;  4LBV A;  2FX3 A;  2K4Y A;  3TU4 K;  1QH0 A;  2FPF A;  1YJ9 A;  1ABQ A;  2CP3 A;  1KZL A;  3EG9 A;  1BI3 A;  3FJ5 A;  1KG1 A;  4PC7 A;  3JCM b;  4BUG A;  1NG2 A;  5L8R E;  2YLC A;  3HRU A;  4J6X A;  3MEU A;  2F2W A;  3QDF A;  3Q1J A;  3OFN A;  1E6H A;  1MRZ A;  4XTZ A;  1JRI A;  2MF2 A;  2BPO A;  3EHR A;  4HT8 A;  3C4S A;  5FW9 A;  2HBW A;  4JJD A;  4FM4 B;  3R6K A;  4OOV A;  2V1R A;  5FIU A;  3MMP A;  1VQL B;  1Y0Y A;  4XL9 A;  4Z8A A;  1VQ5 Q;  2ED0 A;  2XI9 A;  1VQK Q;  1W35 A;  3EGU A;  5KYX A;  5FO1 A;  3QO3 A;  4AFZ C;  1WHH A;  4JRP A;  3CCM T;  4M7D F;  1AWO A;  3CCE Q;  4PJO C;  4Q7J B;  3JCM g;  2XNC A;  4AF7 A;  5C0M A;  3JB9 J;  2DX1 A;  4PLL A;  3CCJ A;  2EJF A;  4N0A A;  2RQU A;  1OI1 A;  4AFS C;  3CCM B;  3A1P A;  5CDF A;  1VQM T;  4DNR B;  4OMO A;  2BUD A;  3P8D A;  1WHK A;  4JMQ A;  4B47 A;  5IAY A;  1S72 A;  2MOX A;  5GAO q;  2ZTN A;  2VNH A;  2VXF A;  5HCK A;  2X3X D;  4HCK A;  1JA0 A;  3CCV Q;  3EFS A;  4LUE A;  1JQQ A;  1PRM C;  2EGE A;  1BI1 A;  1BIB A;  2WAC A;  3M54 A;  3JB9 I;  2D74 A;  2X6X A;  3E9F A;  1LOJ A;  4N4G A;  5F4M A;  4IUP A;  4F7U F;  3OAA A;  3NPF A;  3M58 A;  2GK7 A;  1MGQ A;  1K73 C;  2DBK A;  1JJ2 P;  2E65 A;  1VA7 A;  3CC2 Q;  2CRE A;  1IHV A;  2WSF E;  3EFR A;  4ZGN B;  3L2V A;  2CSQ A;  3IQL A;  1K8A D;  1G2B A;  2EJ9 A;  1WSR A;  2P4R A;  3LQ6 A;  2ZL6 A;  3W2E A;  4FWT A;  1UEC A;  1SRM A;  4A63 B;  1N27 A;  2GQI A;  4M78 C;  2BGJ A;  1UTI A;  2RQV A;  2Z6B D;  5J26 A;  4EMK B;  4QUZ A;  1HXD A;  4P9S A;  2JTE A;  1FX7 A;  4M7A F;  1YHQ Q;  4IUU A;  1UD8 A;  3OYC A;  2DXC A;  3CC2 T;  3CMA T;  4KH1 B;  1QG0 A;  4JRI A;  4ZCL A;  3SWN C;  4M7A E;  3KL9 A;  3AST A;  4JLG A;  2ZXI A;  4L8J A;  4P12 A;  4TMV A;  4MML A;  3A8J A;  2DYB A;  4C0Z A;  4C5H A;  3QKJ A;  1X01 A;  1KRH A;  4ZTJ A;  2E41 A;  2DRK A;  2OTL A;  4IUR A;  5TRD A;  4N4H A;  1K9M C;  2CBX A;  3ZPN A;  1Y71 A;  4TVR A;  2F4N A;  1SKQ A;  4RD4 A;  5I22 A;  3JCM J;  1EFU A;  2YRC A;  5FWB A;  5GAO m;  1YJW T;  2BE9 B;  1D8T A;  2K2V A;  1V0E A;  2A37 A;  2GJK A;  2IIM A;  4TMZ A;  2D8H A;  4XTX A;  1VQ4 A;  3THK A;  1VQ5 B;  3OYY A;  5KE3 A;  1K4U S;  4L59 A;  3ZFJ A;  3JCM V;  1QVG B;  3SDZ A;  3MP6 A;  1WDX A;  3A8I A;  2RK1 A;  3PIO A;  3ASR A;  1Q95 G;  1W70 A;  5CIU A;  4G7X A;  1BCM A;  3QDR B;  4J6W A;  1IXD A;  1JNY A;  4P1V A;  2Q6L A;  1QCF A;  4C92 B;  2QE7 A;  3FDR A;  4YTL A;  3CCM A;  1C6V X;  3SJP A;  1ZA1 B;  3MCA A;  2RC5 A;  2JM8 A;  1EZZ B;  3L42 A;  1TUC A;  2VKN A;  3I9Q A;  4FU6 A;  1YJN Q;  2D3L A;  1NBM A;  1R5N A;  2QN6 A;  2YWE A;  4V2S A;  1KK7 A;  2LT1 A;  4KBM B;  1YIT T;  5FU7 B;  2VBT A;  2COW A;  5GAN g;  2XKO C;  1GCP A;  2L3S A;  2W0Z A;  1G7S A;  2R5A A;  1SHF A;  2QK0 A;  1EIF A;  2RHY A;  1NYF A;  2DCU A;  4BI3 A;  1ZSG A;  2Y4Y A;  1XQB A;  1X6G A;  4C0F A;  3DLL A;  4M75 D;  2J6K A;  1R5O A;  3I35 A;  1K1Z A;  4DOW A;  1UD4 A;  2V7T A;  4J7I A;  4M7A D;  1V5V A;  1LCK A;  5IYP A;  1JXO A;  1ZUK A;  4HT9 A;  2GQF A;  2IVW A;  2YWG A;  2OTJ T;  3I5R A;  5L23 A;  3AVT A;  4Z4Z A;  2E3H A;  3G71 A;  3JB9 F;  4Z1M A;  3ME9 A;  1WOO A;  4OML A;  1FXX A;  1I0C A;  4KH0 B;  2GQV A;  3V7R A;  1WXB A;  2QXF A;  2B7C A;  1OX8 A;  2ABL A;  5IXB A;  1BB9 A;  5FU7 C;  5GAN 5;  2G3R A;  3R6J A;  2XDP A;  1NPP A;  3E1S A;  4JZ3 A;  1X75 C;  1W0J A;  4RD2 A;  2BM1 A;  1M8V A;  4RTV A;  4F7U E;  4XU3 A;  2LT4 A;  2XMF A;  4ZV4 A;  3M5A A;  4IKF A;  4II3 A;  4P6V F;  5CKD A;  3CD6 Q;  4M78 D;  3WNC A;  4FYW B;  2M16 A;  4NNJ A;  4ZN3 A;  1F20 A;  1W2B S;  1VQN T;  5KCO A;  1WYX A;  1AZE A;  3CCQ A;  3QJ6 A;  2ZZF A;  3CCQ B;  2OTL T;  5CQY A;  3PEN A;  1BYM A;  2QQR A;  3A35 A;  4RKU E;  3JCM f;  3ZEH A;  3VRZ A;  1N0V C;  4J0Q A;  1M3C A;  2OK7 A;  2X4X A;  2CP5 A;  2OI3 A;  5BSY A;  1ZM9 A;  3OZU A;  3CCQ T;  5LJ5 f;  1R8O B;  4HCZ A;  1OU8 A;  4LE9 A;  4XU1 A;  1Q7Y D;  3GNF B;  1G3W A;  2QTX A;  4KRT A;  1ZX6 A;  1E7O A;  2D1X A;  3CP2 A;  3ISX A;  3Q3A A;  4UZF A;  3RMQ A;  2M1H A;  3M0U A; 
#chains in the Genus database with same CATH homology
 2DYI A;  3H9N A;  1PM3 A;  3A1P A;  3HTR A;  2F1L A;  2QGG A;  2DOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...