3A1PA

Structure of ribosome maturation protein rimm and ribosomal protein s19
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
RLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Ribosome maturation protein RimM and Ribosomal protein S19
rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
molecule keywords Ribosome maturation factor rimM
total genus 30
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3a1pA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3a1pA01
2QGGA 2DOGA 2F1LA 2DYIA 3H9NA 1PM3A 3A1PA 3HTRA
chains in the Genus database with same CATH superfamily
5IHNA 3G6EQ 1BJKA 2BE9B 1RAHB 1VQMQ 4OMFB 4DBQA 1KIKA 1PSEA 2E3IA 5FIUA 1QMCA 1RI9A 4ZN3A 1BYMA 4E0FA 1TUCA 2BGIA 3ZEHA 1VLYA 1VJSA 1XB2A 3JQPA 5M9OA 4NL3A 1N06A 4M77D 3HFNA 2GQIA 2DKGA 5IHIA 1S0UA 2F4NA 3RR6A 4RUGA 2Z0WA 2XNJA 2EQUA 2D8HA 2DXCA 3CCSQ 3LGLA 4C8QC 1WJQA 3T51B 3SEJA 1OU8A 5GMKh 3OE7A 3CCJQ 4ACBA 1VQMT 1QGZA 2QASA 2EAYA 3CMEB 2AKKA 1YIJA 1N8RD 3AGQA 2DF6A 1NEBA 2M16A 1ZM3A 5IYRA 2ZPBB 3BY2A 1TUGB 5CKEA 2KT8A 2QEXT 1WHLA 2LMJA 4BUGA 3HPWA 4XQ3A 2D9RA 1VQMB 2EKOA 2ZL7A 1Q7YD 1M2OA 1NBEB 1WZOA 3PNWC 2DPPB 1KRHA 2VYQA 1Q7YC 2DL4A 4X9CA 2C77A 2VNJA 3AVXA 2EIFA 2ZBVA 3QPHA 2JOYA 3GNFB 4B3FX 2RHXA 3WXMA 3ASQA 3GVKA 3GNGA 3GPLA 4J9CA 2KK4A 5TV2A 1F1BB 2EJFA 2ED1A 2EFGA 3AVTA 2KVOA 1WOOA 1RACB 2DO3A 4M75A 2JM9A 1JNYA 1TU0B 1OZ2A 4LE9A 1FX0A 4PJJA 4B47A 3QFCA 1GJRA 4B3XA 1XQHA 3EG1A 3CC7T 1S4MA 3UATA 4B43A 3EGDA 2OTLT 1TTTA 4GLKA 4Q7JB 2A7YA 2DBKA 2DL3A 2RNAA 3NGPA 1R5BA 5TY0A 1H85A 4XQFA 1HK9A 3ZFJA 2HQHA 1HA3A 4Y9UA 2RQRA 2M5SA 2CP5A 4M2LA 2BTTA 2EQIA 1WJSA 3EG0A 1OX8A 3CD6Q 3Q1JA 4FYXB 2D0QB 4QW2A 1GBQA 2L3QA 1K1ZA 1R0BG 1RAAB 3NTKA 1D2EA 4ASUA 4DNRB 4XLHA 2OTLQ 2BUDA 3WNCA 1PKVA 3VUBA 4NOYA 5GAOl 3FIFA 1KHCA 2WSEE 3H8ZA 1QLYA 2R5MA 2EYQA 4QVDA 1VQKQ 3M56A 2KYMA 3WYAA 5FO1A 3W2GA 2Z6BD 2KROA 2ZZQA 2NLUA 1Q82C 2OTLB 1IHVA 2KMTA 1HVXA 1PJ5A 3CCUA 2FPEA 1K8AU 1TXQA 1X2QA 2VZLA 3CPXA 7AT1B 1VQLT 1PJ7A 3JQQA 2JS0A 3CD6B 2R6HA 2E4HA 1KHIA 3L42A 3V8JA 5BSXA 1G7CA 3P27A 2HLDA 4QQ6A 1KQSS 4ZGDB 2OTJT 3REBB 1YIJB 1UD8A 1G7SA 1KTVA 1KD1R 2QXFA 3OYYA 4RD3A 1XTDA 2BZYA 1ZBXA 4C8QB 3CRZA 4OMNA 2M0YA 4P3IA 3G4SB 2DVEA 2O31A 2GPJA 2NWMA 1JB0E 2I2LA 2JIZA 4HVWA 4FN5A 2EPDA 4RTXA 1OPLA 2A37A 4PLIA 4E7KA 3UPUA 4F16A 4Z4ZA 1RQPA 2YHTA 1M2VB 4J6XA 1I8FA 1Y96A 1VQ6Q 3CEYA 1KQSB 3FC3A 2G6FX 5KYYB 2FL7A 5HK0A 2GFUA 3NFCA 2X3XD 1UECA 4XTWA 3VYHB 2VYTA 2K5LA 2ESWA 5DM7R 1WFWA 3MEVA 4LD6A 1BCMA 2E1BA 1SHFA 1AVZC 2NUPB 4BE0A 2YRVA 1MMNA 3CCUT 1UD5A 3R6NA 1FNDA 4DEXA 3CD6A 2MMPA 2NV4A 1NG2A 1YHQA 2Y4YA 1QVPA 3VNUA 1U3OA 4C0DC 2XIDA 4P2NA 1UTIA 3QUIA 3TQ7P 1VQOA 2DRMA 3VO2A 5IYPA 5J3BA 4C92E 5IH2A 3CCUQ 4J6YA 1E6GA 1KQ2A 4A4FA 2K5IA 4AFSC 2XNDA 2MPXC 4C0ZA 5F4MA 1WLPB 3P8HA 4HCBA 4ZGEB 3OW2S 1BI1A 2GTJA 1QVGP 2COWA 1JB9A 1UHFA 1NEGA 3OS0A 3LW5E 3CC7A 3GVJA 3H94A 3X25B 2K79A 4OGCA 2CC2A 4DK1A 3VS6A 1SKQA 1UJYA 3EG9B 3OYLA 1M30A 2HZYA 3EG2A 4YHBA 3G71B 5LJ3f 3ULRB 1Y0YA 4RG2A 1VIEA 3EGXB 4RCCA 1K4US 4RD0A 1NE8A 3QKJA 2QAZA 4KUDK 1M8VA 2G3RA 2KI7A 3AGPA 3GF5A 5GANg 2ZPEB 2EQMA 1E43A 1YITB 4LC0A 3WVDB 2OI3A 2ZZFA 4DA4A 6AT1B 4RD4A 4TN1A 2YT6A 3S3MA 3I55B 2V8KA 5CKHA 3PIOA 4M7DG 2CZ1B 3D7SB 2QDXA 3OJXA 3IQLA 2BPOA 3NHNA 2RHIA 2CKKA 1QKXA 2P0KA 4IKFA 2V26A 4J6WA 4PJOC 4ZGQB 2NUZA 1Y7XA 1IRXA 4N4HA 1YIJT 4KH1B 1R0CB 1K73U 2F69A 5L8RE 3DKMA 4KT0E 1I4K1 2IG0A 4XU1A 1QFZA 2DXUA 2XGJA 2P4TA 1YJNT 1JBMA 4B44A 4DQKA 2DYBA 2ZTNA 1M5Q1 3EFOA 3NTHA 1ZUUA 3JAME 1IHMA 1E7OA 1HJDA 2V1QA 1PWTA 2FZKB 5E6TA 4XN0A 1W2BA 4E7HA 1G5VA 4MZTA 2OJ2A 2VNIA 1YNZA 2D3NA 3JCMe 1VHOA 1GFDA 1NJIR 4Y91A 1AWWA 3QZ9B 2JW4A 3BDUA 2XDPA 1X43A 2B7CA 5J35A 4TMXA 1VQ4B 1IJFA 3URGA 4RDJA 2DILA 4NL2A 3JCMW 4YAFA 1B07A 4QQDA 3FJPA 1JA0A 4AVZA 4B3GA 2FO0A 2LTOA 3PMTA 1VQ8A 3SD4A 4R56A 1DDGA 1RQRA 1JU5C 3V7AA 2P3MA 1OB2A 1M1FA 2I0NA 5CK9A 1AEYA 2OTJQ 3LQ6A 1SF9A 1QW1A 2O4XA 3I55Q 3GIBA 3CCVB 2LJ1A 4M75E 4QVJA 2DERA 3M55A 2D0NA 1FNCA 2MAMA 1JXOA 1NLPC 4KKSA 1UD4A 1XQBA 3RESA 1YITQ 3ZBUA 3EG3A 1QG0A 2PVOB 4LUEA 3JB9G 1SM4A 3U6BA 3EGDB 1AMOA 1OEBA 1NB9A 3CBOA 4G1BA 1WX6A 4DNTB 2PVDB 1FRQA 4LN2A 3RKXA 3CC2T 1WSVA 2C5HA 3GOXA 2K3YA 3OYHA 4JDSA 3VNVA 2VBVA 1QVFS 4FYYB 3OYKA 1BI0A 2AHJB 2V4DA 1UJ0A 3CXCS 1I18A 5LJ3h 4LBVA 3C4SA 3ONUA 3PMIA 1VQPA 1S72B 2JN9A 2EBPA 4IIOA 2LQKA 4P9SA 2X4XA 2CP6A 3E19A 2W6IA 1FXXA 4Z89A 4KGVB 3NMZC 4X7DA 2FPDA 1ZSZA 4M78C 3HFOA 3I5RA 3B78A 2HEQA 1ZA1B 3L2UA 3CCET 2K6DA 4XTYA 1QVFP 3TEEA 1K8AC 3GSIA 5GAN8 4DOWA 2VASA 4PC3A 3KUFA 2QTXA 4RD1A 1W87A 3M4GA 1G7TA 4DBFA 3C94A 3EAEA 5GANj 5LJ5h 4AF7A 1I7PA 2CRVA 1ELOA 1P4MA 3CC4T 5A88A 2ABLA 4EH1A 2YRDA 5J39A 2K2VA 2HSEB 1M1KU 4HT9A 2RJEA 1EFUA 2PQWA 4UZFA 5GJVB 5A0DA 2X6WA 1V0FA 2ZGWA 3CCEQ 1FYNA 5DY9A 1BBZA 1Q86C 5GMKl 2KY9A 1WTHD 4XTVA 2X3UA 2RI2A 2L3RA 1YN8A 1SG5A 3CP8A 1BCOA 1W2BS 3QSUA 4FU6A 1PRLC 3V8KA 1FMWA 3ZPNA 2B5OA 2LJ3A 2IPOB 3VR6A 3FPPA 3LLRA 4XTUA 5D6XA 3VMFA 3CCQA 2DEUA 2EYYA 1VQ4T 2AZVA 3L2ZA 3JCMg 3M9QA 2D74A 1KG1A 4N0AC 1GL5A 4C8QD 3OYEA 3VS0A 2NUTB 2X51A 3LNNA 1N0VC 1PM3A 2DJQA 4CC7A 3RKWA 1K0SA 1OU9A 1QKWA 3G71A 2B86A 2HAXA 4RCYA 1RLQC 4N3GA 4RDKA 4PJLA 4M7AG 2CH4W 1NYGA 2O01E 4AFQC 4OPOA 3GLXA 1K8AR 4J7FA 1T0JA 4Z88A 2FPFA 1KSWA 4PFZA 1BQEA 2XI9A 4IURA 3QSYA 3G7ZA 1ZX6A 5I2SA 1I07A 5F4JA 1QUEA 3JQRA 4M0LA 1T3LA 2NYSA 2PTKA 2BMWA 1QGYA 1N5ZA 3ZBDA 3OW2P 4DEYA 2BZXA 2K5FA 1KJZA 1WJRA 2DD5A 2P0QA 3M0UA 1JA1A 3KEWA 1VQKB 2RN8A 1UGVA 4LD9K 2C4TA 3E2UA 2F2VA 4DK0A 3FDRA 5FU7C 3ZZ0A 3CD6T 1MNDA 1PCXA 4FM4B 5HZBA 3JU4A 2JMCA 1YX2A 1W4SA 1U1SA 1SPKA 1IGQA 2DVJA 3I56T 3ZBTA 2ZXHA 2PVGB 1M1GA 2W10A 1YI2A 1VQOQ 4F17A 3JV3A 1NJIC 4PGOA 2L0AA 4ZN1A 3H41A 3WY9A 1E79A 2J7IA 4PKCC 1FMKA 2CP0A 4YAOA 3H6ZA 2ZCFB 2YXYA 2F2XA 3RMQA 3CMEQ 1W70A 2EGCA 2RI5A 4IUPA 4CC4B 3OYCA 2GK6A 5KSWB 1Q81D 2QQRA 4FW2A 4M7AB 3MCAB 4BDYA 1EFTA 1K0XA 5BSYA 1EX4A 5GMKe 4ZGJB 2VVKA 2LQNA 4LDYA 1WA7A 2L3PA 1BIBA 4M78B 4C92G 5IXBA 2AIRB 2Q6LA 5FA6A 2DEQA 4ZTFA 3ZC3A 1UE9A 4CQJA 1C0MA 4XU3A 1Y0MA 3CC4B 1S72A 4N0AA 1K9MR 2CF4A 5AT1B 3NPFA 2OK8A 2BN4A 4XD7A 2JXBA 4Y28E 4KGZB 3SB2A 3E9GA 1R5OA 1Q7YR 3ES9A 2YWGA 2RQUA 2X0KA 2DIEA 5KCOA 9ATCB 1H8HA 3OYIA 2KXDA 4HXJA 4BDZA 2WACA 3ZL7C 2OBTA 4JLIA 2WYRA 2YWHA 1DG1G 1VQ7A 2ZBUA 2V1RA 1WGSA 1P92A 4TMTA 4Z4WA 2K57A 4UZUA 1WI7A 5B6IA 1IZ6A 4C0DB 4IIMA 3OPOA 5IHKA 1GCPA 1OPKA 1YWOA 1B23P 2QGGA 1VUBA 2EYWA 1BMFA 1EP1B 3CCMQ 2MWPA 2GJPA 3LWIA 3OBYA 2W6JA 4XLAA 4PAAA 4M75G 1WSRA 4RMOA 1JO8A 2OBRA 1WHHA 3G6EB 1KQSA 4N4GA 1VQ5T 3W5VA 3HL8A 4NBSA 2P0PA 3EFRA 4HIZA 3MEUA 5IYQA 2VGMA 3PTAA 4MZMA 2OTLA 3OYFA 1K9MD 1AWJA 1KFZA 4L5GA 4ESRA 1AD5A 1H8KA 1K76A 2XNCA 2ZAEA 2X4WA 3F70A 2ZZDA 4FYWB 4D6WA 2YUNA 5D6WA 2GK7A 1MMDA 1XOVA 4VUBA 2XHCA 3U6KA 2MI6A 5FW9A 1WORA 3A8JA 1K9MC 3L2VA 3CP2A 1AZGB 1V1CA 1QH0A 1BI2A 1VQPQ 2DMOA 1EP2B 2WSSA 2MCNA 5IT9E 3EHRA 5J26A 3S3NA 1YCYA 4A4GA 1YJ9T 2CP7A 1YHQQ 3PA1A 2YUPA 4J9GA 2QK0A 1TWBA 3FB9A 2ZPFB 4YALA 2E5QA 2JTEA 3Q38A 2BGJA 3I35A 3JCMc 5CDFA 4E2FB 3A1PA 2GQFA 4HA8A 4XLEA 4AMCA 4UZEA 4R0KA 3CXCP 5GAMj 2QGFB 4FK8A 5KYWB 1X27A 3CCRB 3JCMP 3CC2A 3VRYA 3ISXA 3OKXA 3BNWA 1H42A 2GFAA 1QVFA 4R71A 5HCKA 5GAMf 4E47A 2V7VA 1QCFA 1CKBA 1EFCA 1D8TA 1BX0A 1EP3B 4OGEA 1C1AA 3OOCA 4BI8B 1EZZB 1RUWA 3A8HB 4DBRA 2ZL5A 2XZLA 3CPFA 2L2PA 2F5TX 4KRTA 4B9XA 1S1NA 1VYTA 1A0NB 5LJ5j 8AT1B 1E1RA 2PNIA 4J9BA 3AVYA 4CC3A 4CRIA 4E7SA 4K1XA 1VQ8Q 1VQNB 2HL3A 1YI2T 1PKSA 5CAIA 5I2MA 4C0SA 1GVHA 4GQNA 3SLDA 3I56A 3CCMB 1VQ5B 2OAUA 4OB0B 1IGUA 3OMCA 2V7UA 1LVKA 4IUTA 4Z4RA 1SRLA 4P3YA 4QHYA 2KDSA 1DARA 4LXCA 3R6OA 3O8VA 3M57A 1E3ZA 1H3ZA 3LQEA 4FL6A 2A36A 2YUOA 5TRDA 4FW1A 2FG0A 5DLOA 3Q39A 2K9GA 2HCKA 2XOKA 1N0UA 3QWYA 2VXFA 4FWTA 1FWZA 3CCRA 2PLFA 5A89A 1WDXA 5FU6B 4XLCA 2QQ9A 2O9SA 4M4ZA 3M54A 2ROLA 1PD1A 3G4SA 2V8JA 2E1RA 3CMMA 2J7KA 2AKLA 3HKSA 1VYUA 1ACMB 3BDLA 4L6V5 3OW2B 3MHPA 2VNHA 3OEEA 1WP6A 3OYJA 3GVLA 1OZ3A 2VXEA 2RK2A 4JJBA 1SKUB 4Y9RA 1WHMA 3OZWA 3Q6RA 5HK3A 2JM8A 3JB9H 1X2KA 3QJYA 2EQKA 1YJNA 4X7CA 5LJ5e 3BY1A 4HE5A 2CYZB 2KT1A 2PZ1A 4C92C 2B7BA 5GV7A 3CCVT 4C5HA 4M78A 3E1SA 3LO8A 2R57A 2ZTGA 3JCMQ 1OGIA 3D26A 1T5EA 1SSHA 4ELZC 2H3JA 1YJWA 3OZVA 2KGTA 2DL7A 1VQ5A 1W0JA 4CI0C 3H9NA 1VQ8B 1YWPA 1EWYA 4LUDA 2CT3A 1SSFA 5KYXB 2F43A 2V7QA 4M77A 3FPKA 3ASRA 2L5QA 2CH4A 2XICA 4RM0A 5HZAA 1M90C 4II3A 4J5YA 5D7UA 3E1YE 2CGHA 2PUKB 3OP1A 1EFRA 1WHJA 1IO6A 3LX7A 4QFMA 4QV2A 2EYZA 3WVEB 4OOXA 3PVQA 4BACA 3CC7Q 3BQJA 3V7CA 2EYXA 2LP5A 2EW3A 3G4SQ 5D6YA 3CXCA 1VQ5Q 1KK2A 4LNPA 1KZLA 5CR2A 4XL9A 2QDLA 4V2SA 1Z9ZA 4P1VA 3RY8A 4M7AC 4X06A 4EPCA 3CCRQ 1IHWA 3GQBA 4FT4A 3QDRB 4C0GA 2HQXA 1GFCA 3A98A 1TLLA 4Z4YA 1X01A 1OX9A 1M4ZA 2FZGB 3JRZA 1VQ7Q 2RC6A 1JRIA 3BCDA 2E5KA 2J06A 4EMKB 1QVFB 5KYUB 3PE0A 3A3BA 4KBMB 2E64A 4AFUC 1PHTA 4J9FA 4XORA 5KW9A 2ZPIB 2R5AA 3PT9A 4JJNK 4JRQA 3T53B 1VQKT 1D1AA 1RAFB 1KQ1A 1D1BA 1ZSZB 3QYGB 2QA4Q 2M0OA 2NPFA 5IN1A 4TVRA 5AYFA 3A8IA 2KNBB 3A8OB 5H59A 3JB9F 3BE3A 4OB3B 4WZKA 1WU8A 3V7RA 1ZSZC 4F7UA 1SEMA 2E70A 1YHQT 5CKDA 4FSXA 4PL6A 1Q81C 5GAOm 1W0KA 2MOXA 4BE2A 5ECAA 1AZEA 3HAGA 3AT1B 3META 3MCAA 1KK0A 3H0HA 3CCSA 1AOJA 1FDRA 4PC6A 5GAN7 2XMFA 1VQ6A 4P6YA 1ZUYA 2C0IA 1X6BA 1UGQB 4GY5A 3UWNA 1BLIA 3WXMB 2BIVA 1ZLMA 2HBPA 3O5ZA 4OMLA 3RDVA 3U23A 1VLOA 4PJOD 3ZZTA 1D09B 1IB8A 2D6FA 4FSSA 4FCYA 4FXUA 4WQMA 1MV0B 2M02A 4C5EA 3CMAT 1YI2Q 3G6EA 5EMNA 3P8DA 4P5NA 4EMKA 3CCJB 2R58A 2ROTA 2FHDA 2FX3A 3N5BB 4BI4A 2QTLA 3QDFA 3LWHA 5L46A 2DOGA 2EJGA 3EG9A 4IUQA 3MP1A 4X9DA 3MMPA 1NDHA 1U8RA 1QQJA 1V29B 2DZ9A 2V31A 4M75F 2QTVA 3CCST 4PJOA 1ZM9A 1T0HA 4RTZA 5LMZA 2BVNA 5HKKA 2MIOA 5GMKj 3CXCB 4RTUA 1WYXA 1I5LA 3QFRA 1UDLA 2DIGA 3CC4Q 4LBWA 3TVTA 5I21A 4LDVA 4LDXA 2FYKA 4M53A 5GAN2 3HP9A 1YJWB 3M0PA 3TSWA 3QYHB 4IUUA 3QJ6A 5AN9A 1YJWQ 1E63A 4TT3A 4C8QF 4P26A 4M7DD 4FIBA 2LCCA 4QQGA 1O9SA 1OOTA 4M75D 2O9VA 4C92B 1Q86R 3CCQB 3BC9A 3M0RA 2VKNA 2ZXIA 5F4OA 4RG8A 3VYGA 1LNXA 4L8JA 3CCMA 3I56B 1X6OA 1TS9A 1I0CA 4DBHA 5IAYA 5KYWA 3PIPA 1G3TA 1Q81R 3KBGA 5H5JA 1YJWT 2X9HA 1WPYA 3PUMA 2AHOA 4M7AD 5CIUA 1QX4A 1N27A 2DTIA 1Y96B 5GANe 2CP2A 3E20A 3OY9A 1E3XA 1MNEA 2YLCA 4NNJA 1BI3A 2PUOB 1Q9SA 4ZCMA 5IYNA 1U06A 1Y57A 1YI2B 3LYIA 3L2QA 2EWNA 4PJOF 4PC7A 1BB9A 3OW2A 1GAQA 4JS4A 4MZPA 3UT1A 2GCXA 3LGFA 4C8QA 5GAOn 4KUIA 1AWXA 2RA2A 2VJIA 3OS5A 3CBPA 2RM4A 3P26A 4C43A 3A3GA 1OI1A 5GANf 1H641 1PD0A 3SJZA 2DZCA 2LZ6B 2BM0A 2JMAA 4NCNA 1PSFA 4JS5A 4XONA 2XEXA 2EGAA 3JCMV 3MO8A 2WZNA 2DX1A 2WJVA 5HKCA 2L3SA 4PC2A 1I81A 2F2WA 3MPUB 1D1NA 1TVCA 2VBTA 4QVCA 4MMKA 3QHSA 2XD0A 4D8DA 3UF4A 2HQEA 1VQOT 1QFJA 3MHXA 3VRZA 1BKBA 1V76A 3CC7B 4JRIA 4F7UF 1B34B 4PLLA 2AK5A 1M3BA 4HKEA 2GJKA 3AHUA 1BPLA 3B8HA 1VQ9B 2VV5A 4ELYC 2L89A 1VQNA 1Y71A 4RPDA 4M4SA 4Z4TA 1MMGA 2KXCA 2K7AA 3VS5A 2Q6IA 3CPWA 2RO0A 4M77E 1CNFA 3JCMX 1NB0A 4DQLA 3A8MB 3LH0A 3G1JA 4C5GA 4XLFA 1QP3A 2AT1B 2DETA 3X28B 4J9HA 2EIXA 2XG8D 2DL8A 2BE7D 3BY7A 4F14A 1GAWA 1KC8U 1AWOA 3CCEB 4YAUA 4M78E 3VS4A 3I55A 4PNOA 4M1KA 1NPRA 2O88A 3EFSA 3A8GB 1M90D 1WQ7A 3CMEA 3A5ZB 4N4IA 3QFSA 3HTRA 3OZUA 5GAOq 1YITT 2VNKA 3ZZUA 3CMAQ 2KQWA 1WHGA 4OOSA 1ZA2B 3OAAA 4M77B 1KQSP 1TG0A 3I55T 5LJ3j 2QN6A 1EFNA 3OFNA 2DK3A 2OTJA 4M77G 3E9FA 4QT7A 1AHJB 3FJ5A 2MK5A 2ZZGA 3JB9J 3OS1A 3CC2B 2JJ2A 1QVGS 3ASSA 2RQVA 4ACAA 1HZEA 3QE2A 4BI3A 1UGPB 4AT1B 1NPPA 5GAN4 1IREB 3OS2A 2OYNA 2LNHB 3W5UA 1B34A 2JS2A 3RBBB 4A53A 5FRNA 2E6ZA 2D9TA 5CVIA 1G8XA 5FROA 1AT1B 2CUDA 2EKHA 5IK2A 2P84A 2YWEA 3CQTA 5I11A 2VBUA 4BY6C 2M51A 3VUZA 1OGJA 4M75C 4MMLA 1G2BA 1WXUA 4Z4SA 1I1JA 2DM1A 3OSSC 1N6AA 5FWBA 3I5SA 2BZ8A 3RNJA 1BK2A 3C0CA 4M7DE 1QGAA 2JJ9A 4YXWA 1KJWA 1D1CA 2EQJA 1YJ9A 3UA6A 5A8AA 1AIPA 2EJ9A 3W5HA 3W2HA 2LCSA 1D3BA 1NZ9A 2AZSA 3NTIA 5KYYA 5LJ5g 3FJOA 1N9RA 2LT4A 2QMUA 2JVVA 2DTHA 1H92A 3SWNC 1BU1A 2KVQG 4M77F 2DXBA 1EXMA 1VOMA 1KC8C 2HDAA 2M1HA 1C6VX 2QYZA 1N05A 5FU7B 2QE7A 4WZEA 3JB9D 2ED0A 4QVZA 3OYGA 3WNDA 4BY6B 2ZZEA 2OAWA 4J9DA 5GMKm 3X24B 4P22A 3DLLA 4HT8A 1VQ4Q 2HSPA 2RJCA 4X34A 2HDNB 4EMGA 2BKDN 1Q7YU 3R6JA 2VUBA 4JZ3A 3QXEB 2X4YA 3HRUA 4XTXA 3FKSA 1BIAA 1SRMA 1JQQA 1RAEB 5KH6A 4Y7CA 1YJNB 3CC4A 3LVBA 5FLXE 2A0FB 1HSQA 2LQ8A 4X7EA 4QKUA 2O4XB 2DE0X 4RCZA 1D3BB 1DJ7B 2E3HA 4Z4UA 1VQPB 3EHQA 5GANd 1CNEA 4PJOE 3QIIA 2LQWA 1RL2A 2A3LA 2EGEA 4YEJA 3M0QA 4XKWA 4TKOB 2L8DA 4F04B 3JCMf 3GBQA 2I1LA 2VB6A 3VV0A 3RKYA 2QA4B 2RHYA 2KBTA 1NLOC 4EDUA 4B4DA 4HCZA 5DN6A 1NBMA 3OEHA 2JT4A 3J7AF 3LH5A 3A8KA 2RB6A 3J81k 5TR9A 4DQ2A 5GAN5 2DIQA 1MV3A 4AF6A 4HVUA 2ENMA 1LPLA 2RK1A 4BB7A 1YJNQ 4XMYA 3CBMA 1YBYA 3JCMd 2Y4XA 2GREA 1R77A 3CCRT 3MKDA 2C78A 1QCOA 2DFUA 3RMSA 3TSZA 4AG1C 2RQWA 1FNMA 3KFVA 1M90R 1WQWA 1QCNA 1HD3A 1JJ2B 2DYIA 1TOVA 2VWFA 1LOJA 4XN3A 2CW5A 2V7WA 1UG1A 1YITA 2LZJA 1NM7A 3KXTA 1H8EA 4JLGA 2JDIA 1LJOA 3SJPA 4JUVA 4OB1B 1M1KC 3BCFA 1NJIU 3G71Q 4BD3A 2D1XA 3ASKA 5GAMe 4YAWA 4GLMA 4Q5WA 1FX7A 1KMHA 2QA4T 2NUTA 4PJNA 3JCMh 3OQ5A 2P4RA 4F7UG 4RTYA 4C92D 1WDTA 2CNDA 1VQ6T 4DOVA 3EGXA 1K8AD 1U5SA 3JCMb 2SRCA 1JJ2S 3M53A 2EVRA 2GQVA 3CCQQ 4F7UB 1RI0A 2LNVA 5THXA 1FRNA 4WWVA 3WBKA 1ZBJA 4ZNXA 4RLZA 2Q6OA 1ZQ1A 2RHUA 3M58A 4J9EA 1R5NA 4Z8AA 1RAGB 1PRMC 5IXFA 3CCUB 3ZUGA 4J9IA 2KRSA 2IVWA 4OMMA 4PK4A 1E6HA 2WSCE 3MP6A 2RF0A 1K73C 5A2QE 1UD3A 4Z1MA 5KYUA 1O75A 3CCQT 1WXBA 3CCLQ 2DTOA 2ZPGB 1B7TA 3RERA 2QEXB 2FB7A 4ORZA 4XM3A 3VU3C 2PIAA 2YWFA 2E10A 4IUVA 1CQXA 2CDTA 4RD2A 3QFTA 2OX7A 1B2RA 5KCHA 3INZA 4XK8E 2OBSA 3CC2Q 2C4UA 1WOPA 2COYA 2F5KA 2LDMA 2XK0A 2H8HA 1OB0A 1H3HA 3TCJA 4L59A 2VGNA 2PE3A 1QUFA 3QG1A 3SFMA 2E1HA 4ME7A 3Q3AA 1W2BB 1X69A 4M7DA 2OK7A 3OJWA 1MMAA 1G83A 1KD1U 2JN0A 4A4EA 3V76A 5GANh 3SHWA 2QTZA 2FVUA 3RUXA 4CC2A 4GBQA 3SLNA 2HD0A 1D0XA 4XOTA 2C5BA 3PFSA 2J05A 2FEIA 3M0SA 1VQOB 3I9QA 1W2BP 1N9SA 3CCJT 5LL6S 1N8RU 2WPDA 5CQYA 1CKAA 3CCVA 4PJMA 4II2A 2ZPHB 1UMKA 4MYTA 2QQBA 3V8LA 5DSZA 3ASPA 1N8RC 2KSSA 2V7TA 1XNIA 4ANJA 4OF1A 5C6SA 2KR3A 4WTOB 5GV8A 1OB5A 1DDIA 4PFOA 4LBYA 1LCKA 1YJ9B 4RTTA 1VQ9Q 2K2MA 1SHGA 2E12A 3TU4K 3EH2A 4E7JA 2X3WD 3MP8A 1VF7A 1QWEA 3OBWA 2YRCA 2DA9A 2HCJB 1UFFA 3P8BB 2WJYA 2COZA 3H0IA 4XR6A 2JTMA 1F20A 2F1MA 1ZM2A 1TTHB 4HCKA 5DLQE 2HMAA 3CPWS 3W2IA 1WIEA 1R8OB 3W2FA 2RMOA 1MRZA 3Q6QA 3OMGA 2CT4A 2K4YA 3L1AA 3SKBA 3PUNA 3OW7A 5I22A 1V5VA 2SEMA 3X26B 2DL5A 4J8OA 3DB4A 1A8PA 4JRKA 3VJPA 2ATCB 3FRNA 1S72T 3G05A 4P12A 3J80E 1M1KD 2H3EB 2F1LA 1G3SA 4OP0A 4QUZA 2HKNA 3CESA 3G6ET 4AFZC 2KEAA 3M59A 4OMQA 3I1FA 4Z02A 4MYUA 2X6YA 4ZCIA 2JTFA 1NRKA 4JRPA 1I5OB 4II1A 5CO7A 4RPBA 4X07A 1GO2A 2LX7A 2RH2A 3T9NA 5KE2A 1FNBA 2C0TA 1N8RR 1S72Q 2QA4A 3J81E 4G7XA 4M7DB 2DRKA 4X7FA 2RJFA 1T6YA 2QG9B 3PA2A 4LDUA 3I56Q 1KK3A 4X05A 2C06A 3EH1A 3A8LB 3CCLB 1Q82D 4FT2A 3CCSB 2CSQA 2WZPP 2KRMA 2FVGA 4G7WA 1SKYB 4AC9A 2KRNA 5HY6A 3OYAA 1WXTA 1YP5A 1G7RA 1UGSB 3OA6A 2HNIA 4ZGNB 1VQKA 1VQ9A 1MABA 5IYWA 2BM1A 2X4JA 3QWXX 5A0LA 1VHEA 2RI3A 1TSFA 2PU9B 4K11A 2X53S 1M3CA 3WQZA 1M1KR 1U1TA 4M7DF 1W34A 2EFIA 4LDWA 3HRSA 2JNGA 4ZCLA 4A4HA 4J7IA 3CW2A 2J6OA 2KAFA 1K73D 2YSQA 1QVGA 1JJ2A 1VQLA 2W0ZA 3CCVQ 4BPRA 1TUDA 4AG2C 1Q86D 3ASTA 2WR8A 1ZSGA 4XNFA 3PVLA 2BV3A 2D8JA 2DLPA 2GBQA 2RHZA 3CCLT 3QBYA 4JJCA 5CQXA 2LRQA 2QQSA 4E7LA 3CTAA 1I8DA 3A35A 2YUQA 2QDYB 2X6XA 1T6ZA 3FLGA 1PG5B 4TMZA 4OPVA 3CPWB 2BSAA 1ZUKA 8ATCB 2JZ2A 1VYVA 1X6GA 4WF2A 3ONYA 2OTJB 2QQAA 2J6KA 1E1QA 1EIFA 1XJWB 3UDCA 2YDLA 4WCIA 5DS0A 5FRMA 4RDLA 3CCMT 3HSBA 3M5AA 1VQLB 3W2EA 1QVGB 2CZ0B 5LJ5f 1QFYA 1VA7A 3BFMA 1Z9QA 3SWNB 2DJZA 1QWFA 1OULA 4KKTA 2Y90A 1KC8D 4ZTJA 1T6XA 3CCLA 2DY1A 2DCUA 1G3YA 2CS7A 2DAQA 3L2RA 4OVAA 4OOVA 1RAIB 2LC4A 1VQ7T 1Q86U 4F7DA 4C0FA 3CPWP 2Q6KA 1E62A 2FZCB 2D3LA 1J9ZA 5LJ3d 5FO0A 4YTLA 3V7SA 1COWA 2QEXA 4HCCA 2CBXA 1PKTA 2RC5A 4UC4A 1UD2A 2CSIA 5KE3A 2LCLA 4LBZA 1VQ9T 2YWWA 3DDYA 4F7UE 4EIKA 4PJOG 3C12A 2X8KA 1YJ9Q 3R6KA 1KK1A 2XZOA 1TUIA 4PJOB 3GIRA 1ABQA 3EGUA 1N08A 4JJDA 4JZ4A 4RJLA 2CZ6B 1Q81U 4A63B 3QO3A 1N07A 1KD1C 3JB9I 1W35A 2O2OA 2DNUA 1M27C 4E7IA 4WZLA 4U9UA 1VQ7B 3QZ5B 1M90U 1Y0RA 5GAN6 4KULA 5KNLA 3OB9A 2KE9A 4M78F 4XTZA 3BW1A 1HXDA 3EFOB 1MHNA 2CZ7B 2RJDA 4BE1A 4PABA 4X8IA 3THKA 3SDZA 3OYBA 3CB4A 4C8QG 2XU8A 4Y92A 2B8AA 4R55A 4XU0A 1JEGA 1Q82R 2GJRA 1D0YA 1VIFA 2ECZA 2JUFA 3CMET 1K28D 2ZL6A 5CCAA 5HXBA 3PVDA 1F60A 2MWOA 4OMPA 2A28A 4RD6A 1W1FA 1YLOA 5J3OA 5EG2A 1RLPC 1OQKA 4X0CA 4A54A 2J6FA 4M7AE 2MF2A 1PC0A 5JBQA 4UAJA 4KH0B 2LJ0A 2V8IA 4YELA 4IW3B 3X20B 2IIMA 4M78D 5L23A 4PC1A 1MGQA 2RD1A 4XKVA 3S6WA 4KKUA 2RPNA 2M9UA 2R9VA 4JMQA 3G71T 5FWCA 4M75B 1VQNT 2QEXQ 4P25A 2WSFE 1VQ6B 5LJ3g 2V7XA 3VO1A 4FYVB 4EMKC 4NS5A 4Z4VA 3U2QA 2CK3A 2E65A 3ME9A 3AVWA 3MEWA 2DXTA 2FRYA 1IXDA 1YFNA 5C0MA 1X75C 3UA7A 1Q82U 1MUZA 4RKUE 3L2WA 1VQ4A 1IJEA 2XKOC 4M7DC 1UD6A 5LJ5d 4B9WA 1E64A 3WBJA 1V0EA 2NUPA 1UB4A 1FMVA 1WNLA 4MDWA 3VKIA 3AVUA 4XU2A 4RCBA 4C92F 1VQNQ 1M9SA 1UUEA 1YIJQ 3T56B 1IB0A 3SWNA 2LT1A 2VC8A 5CKBA 1BX1A 1HYOA 3CCJA 1T3SA 1ABOA 4C5IA 2CUBA 1M2VA 1OHHA 3PGGA 1RABB 3SEMA 2JJ1A 4N3NA 2X35A 3HRTA 1XFOA 1KK7A 1W9XA 1KC8R 1WOSA 2LX9A 3OYDA 2C2WA 2DD4A 2X85A 4JPBW 1M8MA 1Q95G 2BF4A 4B48A 1NJID 4OPSA 4J83A 1VQMA 1G3WA 1WPCA 3CMAB 2LVMA 4PFPA 3CCEA 4MDXA 4M78G 3VS1A 1UEBA 1K9MU 4O6JA 3MJXA 1K73R 2A08A 2GGRA 2C0OA 1RADB 3DB3A 1K9AA 1NYFA 5GAN3 3GP8A 1J3TA 1U2RA 4E6RA 1D0ZA 1VQPT 3TREA 1ZHIA 1UGRB 5GAOr 4OB2B 1YCSB 1GXIE 2GTOA 4G1VA 3S3OA 4M7AA 1WHKA 5FNZA 2XDDA 2HBWA 1CSKA 2QI2A 4OMOA 2VJJA 2XZPA 3M4YA 3JSCA 3C95A 3G4ST 3B82A 1B3QA 4ROXA 1YHQB 4TSFA 3WNBA 5A0GA 3BH4A 1UHCA 4M7AF 4G6IA 1GR1A 2DBMA 2KYBA 5KYXA 1ZM4A 2GF7A 4RTWA 4D8KA 4J0QA 2MYSA 1GCQC 3ZIAA 5GAMg 3JCMJ 2ZITA 1ARKA 2GNCA 3PENA 4P6VF 4M77C 5GJWB 3M0TA 1Y07A 1PNJA 3NE5B 4E7ZA 1VQLQ 1ZUNB 1M3AA 3CMAA 2RQTA 4B6MA 2E6NA 1GCQA 2VBSA 4RTVA 3REAB 2E41A 3VS2A 4ATOA 3VS3A 4TMVA 4C8QE 5GAOp 2CP3A 1W6XA 3OYNA 3RIRA 4TMWA 4KGXB 1JXMA 4C92A 1JJ2P 1GBRA 4H9GA 5GAMd 3HHTB 1TH7A 2PMDA 3OSVA 3H0FA 3ER0A 4QVAA 5KYNA 1PJ6A 4ZV4A 5LJ3e 1KD1D 1VQ8T 2HL5C 3AVVA 1OYXA 1QP2A 4OP7A 4EMHA 4G5GA 1OV3A 5GMKi 3DLMA 5FL7A 4WZTA 2CREA 2FRWA 1GRIA 4XOPA 4X1VA 3FEOA 2K3XA 4O5VA 5FU6C 4XAXB 4A4KA 2XDBA 2YLBA 3KL9A 4HE6A 3OYMA 5CKFA 5EC7A 3MEAA 2K3BA 5GAMh 2HKQB 4HVVA 3VS7A 1XE1A
chains in the Genus database with same CATH topology
2QGGA 2DOGA 2F1LA 2DYIA 3H9NA 1PM3A 3A1PA 3HTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGG A;  2DOG A;  2F1L A;  2DYI A;  3H9N A;  1PM3 A;  3A1P A;  3HTR A; 
#chains in the Genus database with same CATH topology
 5IHN A;  3G6E Q;  1BJK A;  2BE9 B;  1RAH B;  1VQM Q;  4OMF B;  4DBQ A;  1KIK A;  1PSE A;  2E3I A;  5FIU A;  1QMC A;  1RI9 A;  4ZN3 A;  1BYM A;  4E0F A;  1TUC A;  2BGI A;  3ZEH A;  1VLY A;  1VJS A;  1XB2 A;  3JQP A;  5M9O A;  4NL3 A;  1N06 A;  4M77 D;  3HFN A;  2GQI A;  2DKG A;  5IHI A;  1S0U A;  2F4N A;  3RR6 A;  4RUG A;  2Z0W A;  2XNJ A;  2EQU A;  2D8H A;  2DXC A;  3CCS Q;  3LGL A;  4C8Q C;  1WJQ A;  3T51 B;  3SEJ A;  1OU8 A;  5GMK h;  3OE7 A;  3CCJ Q;  4ACB A;  1VQM T;  1QGZ A;  2QAS A;  2EAY A;  3CME B;  2AKK A;  1YIJ A;  1N8R D;  3AGQ A;  2DF6 A;  1NEB A;  2M16 A;  1ZM3 A;  5IYR A;  2ZPB B;  3BY2 A;  1TUG B;  5CKE A;  2KT8 A;  2QEX T;  1WHL A;  2LMJ A;  4BUG A;  3HPW A;  4XQ3 A;  2D9R A;  1VQM B;  2EKO A;  2ZL7 A;  1Q7Y D;  1M2O A;  1NBE B;  1WZO A;  3PNW C;  2DPP B;  1KRH A;  2VYQ A;  1Q7Y C;  2DL4 A;  4X9C A;  2C77 A;  2VNJ A;  3AVX A;  2EIF A;  2ZBV A;  3QPH A;  2JOY A;  3GNF B;  4B3F X;  2RHX A;  3WXM A;  3ASQ A;  3GVK A;  3GNG A;  3GPL A;  4J9C A;  2KK4 A;  5TV2 A;  1F1B B;  2EJF A;  2ED1 A;  2EFG A;  3AVT A;  2KVO A;  1WOO A;  1RAC B;  2DO3 A;  4M75 A;  2JM9 A;  1JNY A;  1TU0 B;  1OZ2 A;  4LE9 A;  1FX0 A;  4PJJ A;  4B47 A;  3QFC A;  1GJR A;  4B3X A;  1XQH A;  3EG1 A;  3CC7 T;  1S4M A;  3UAT A;  4B43 A;  3EGD A;  2OTL T;  1TTT A;  4GLK A;  4Q7J B;  2A7Y A;  2DBK A;  2DL3 A;  2RNA A;  3NGP A;  1R5B A;  5TY0 A;  1H85 A;  4XQF A;  1HK9 A;  3ZFJ A;  2HQH A;  1HA3 A;  4Y9U A;  2RQR A;  2M5S A;  2CP5 A;  4M2L A;  2BTT A;  2EQI A;  1WJS A;  3EG0 A;  1OX8 A;  3CD6 Q;  3Q1J A;  4FYX B;  2D0Q B;  4QW2 A;  1GBQ A;  2L3Q A;  1K1Z A;  1R0B G;  1RAA B;  3NTK A;  1D2E A;  4ASU A;  4DNR B;  4XLH A;  2OTL Q;  2BUD A;  3WNC A;  1PKV A;  3VUB A;  4NOY A;  5GAO l;  3FIF A;  1KHC A;  2WSE E;  3H8Z A;  1QLY A;  2R5M A;  2EYQ A;  4QVD A;  1VQK Q;  3M56 A;  2KYM A;  3WYA A;  5FO1 A;  3W2G A;  2Z6B D;  2KRO A;  2ZZQ A;  2NLU A;  1Q82 C;  2OTL B;  1IHV A;  2KMT A;  1HVX A;  1PJ5 A;  3CCU A;  2FPE A;  1K8A U;  1TXQ A;  1X2Q A;  2VZL A;  3CPX A;  7AT1 B;  1VQL T;  1PJ7 A;  3JQQ A;  2JS0 A;  3CD6 B;  2R6H A;  2E4H A;  1KHI A;  3L42 A;  3V8J A;  5BSX A;  1G7C A;  3P27 A;  2HLD A;  4QQ6 A;  1KQS S;  4ZGD B;  2OTJ T;  3REB B;  1YIJ B;  1UD8 A;  1G7S A;  1KTV A;  1KD1 R;  2QXF A;  3OYY A;  4RD3 A;  1XTD A;  2BZY A;  1ZBX A;  4C8Q B;  3CRZ A;  4OMN A;  2M0Y A;  4P3I A;  3G4S B;  2DVE A;  2O31 A;  2GPJ A;  2NWM A;  1JB0 E;  2I2L A;  2JIZ A;  4HVW A;  4FN5 A;  2EPD A;  4RTX A;  1OPL A;  2A37 A;  4PLI A;  4E7K A;  3UPU A;  4F16 A;  4Z4Z A;  1RQP A;  2YHT A;  1M2V B;  4J6X A;  1I8F A;  1Y96 A;  1VQ6 Q;  3CEY A;  1KQS B;  3FC3 A;  2G6F X;  5KYY B;  2FL7 A;  5HK0 A;  2GFU A;  3NFC A;  2X3X D;  1UEC A;  4XTW A;  3VYH B;  2VYT A;  2K5L A;  2ESW A;  5DM7 R;  1WFW A;  3MEV A;  4LD6 A;  1BCM A;  2E1B A;  1SHF A;  1AVZ C;  2NUP B;  4BE0 A;  2YRV A;  1MMN A;  3CCU T;  1UD5 A;  3R6N A;  1FND A;  4DEX A;  3CD6 A;  2MMP A;  2NV4 A;  1NG2 A;  1YHQ A;  2Y4Y A;  1QVP A;  3VNU A;  1U3O A;  4C0D C;  2XID A;  4P2N A;  1UTI A;  3QUI A;  3TQ7 P;  1VQO A;  2DRM A;  3VO2 A;  5IYP A;  5J3B A;  4C92 E;  5IH2 A;  3CCU Q;  4J6Y A;  1E6G A;  1KQ2 A;  4A4F A;  2K5I A;  4AFS C;  2XND A;  2MPX C;  4C0Z A;  5F4M A;  1WLP B;  3P8H A;  4HCB A;  4ZGE B;  3OW2 S;  1BI1 A;  2GTJ A;  1QVG P;  2COW A;  1JB9 A;  1UHF A;  1NEG A;  3OS0 A;  3LW5 E;  3CC7 A;  3GVJ A;  3H94 A;  3X25 B;  2K79 A;  4OGC A;  2CC2 A;  4DK1 A;  3VS6 A;  1SKQ A;  1UJY A;  3EG9 B;  3OYL A;  1M30 A;  2HZY A;  3EG2 A;  4YHB A;  3G71 B;  5LJ3 f;  3ULR B;  1Y0Y A;  4RG2 A;  1VIE A;  3EGX B;  4RCC A;  1K4U S;  4RD0 A;  1NE8 A;  3QKJ A;  2QAZ A;  4KUD K;  1M8V A;  2G3R A;  2KI7 A;  3AGP A;  3GF5 A;  5GAN g;  2ZPE B;  2EQM A;  1E43 A;  1YIT B;  4LC0 A;  3WVD B;  2OI3 A;  2ZZF A;  4DA4 A;  6AT1 B;  4RD4 A;  4TN1 A;  2YT6 A;  3S3M A;  3I55 B;  2V8K A;  5CKH A;  3PIO A;  4M7D G;  2CZ1 B;  3D7S B;  2QDX A;  3OJX A;  3IQL A;  2BPO A;  3NHN A;  2RHI A;  2CKK A;  1QKX A;  2P0K A;  4IKF A;  2V26 A;  4J6W A;  4PJO C;  4ZGQ B;  2NUZ A;  1Y7X A;  1IRX A;  4N4H A;  1YIJ T;  4KH1 B;  1R0C B;  1K73 U;  2F69 A;  5L8R E;  3DKM A;  4KT0 E;  1I4K 1;  2IG0 A;  4XU1 A;  1QFZ A;  2DXU A;  2XGJ A;  2P4T A;  1YJN T;  1JBM A;  4B44 A;  4DQK A;  2DYB A;  2ZTN A;  1M5Q 1;  3EFO A;  3NTH A;  1ZUU A;  3JAM E;  1IHM A;  1E7O A;  1HJD A;  2V1Q A;  1PWT A;  2FZK B;  5E6T A;  4XN0 A;  1W2B A;  4E7H A;  1G5V A;  4MZT A;  2OJ2 A;  2VNI A;  1YNZ A;  2D3N A;  3JCM e;  1VHO A;  1GFD A;  1NJI R;  4Y91 A;  1AWW A;  3QZ9 B;  2JW4 A;  3BDU A;  2XDP A;  1X43 A;  2B7C A;  5J35 A;  4TMX A;  1VQ4 B;  1IJF A;  3URG A;  4RDJ A;  2DIL A;  4NL2 A;  3JCM W;  4YAF A;  1B07 A;  4QQD A;  3FJP A;  1JA0 A;  4AVZ A;  4B3G A;  2FO0 A;  2LTO A;  3PMT A;  1VQ8 A;  3SD4 A;  4R56 A;  1DDG A;  1RQR A;  1JU5 C;  3V7A A;  2P3M A;  1OB2 A;  1M1F A;  2I0N A;  5CK9 A;  1AEY A;  2OTJ Q;  3LQ6 A;  1SF9 A;  1QW1 A;  2O4X A;  3I55 Q;  3GIB A;  3CCV B;  2LJ1 A;  4M75 E;  4QVJ A;  2DER A;  3M55 A;  2D0N A;  1FNC A;  2MAM A;  1JXO A;  1NLP C;  4KKS A;  1UD4 A;  1XQB A;  3RES A;  1YIT Q;  3ZBU A;  3EG3 A;  1QG0 A;  2PVO B;  4LUE A;  3JB9 G;  1SM4 A;  3U6B A;  3EGD B;  1AMO A;  1OEB A;  1NB9 A;  3CBO A;  4G1B A;  1WX6 A;  4DNT B;  2PVD B;  1FRQ A;  4LN2 A;  3RKX A;  3CC2 T;  1WSV A;  2C5H A;  3GOX A;  2K3Y A;  3OYH A;  4JDS A;  3VNV A;  2VBV A;  1QVF S;  4FYY B;  3OYK A;  1BI0 A;  2AHJ B;  2V4D A;  1UJ0 A;  3CXC S;  1I18 A;  5LJ3 h;  4LBV A;  3C4S A;  3ONU A;  3PMI A;  1VQP A;  1S72 B;  2JN9 A;  2EBP A;  4IIO A;  2LQK A;  4P9S A;  2X4X A;  2CP6 A;  3E19 A;  2W6I A;  1FXX A;  4Z89 A;  4KGV B;  3NMZ C;  4X7D A;  2FPD A;  1ZSZ A;  4M78 C;  3HFO A;  3I5R A;  3B78 A;  2HEQ A;  1ZA1 B;  3L2U A;  3CCE T;  2K6D A;  4XTY A;  1QVF P;  3TEE A;  1K8A C;  3GSI A;  5GAN 8;  4DOW A;  2VAS A;  4PC3 A;  3KUF A;  2QTX A;  4RD1 A;  1W87 A;  3M4G A;  1G7T A;  4DBF A;  3C94 A;  3EAE A;  5GAN j;  5LJ5 h;  4AF7 A;  1I7P A;  2CRV A;  1ELO A;  1P4M A;  3CC4 T;  5A88 A;  2ABL A;  4EH1 A;  2YRD A;  5J39 A;  2K2V A;  2HSE B;  1M1K U;  4HT9 A;  2RJE A;  1EFU A;  2PQW A;  4UZF A;  5GJV B;  5A0D A;  2X6W A;  1V0F A;  2ZGW A;  3CCE Q;  1FYN A;  5DY9 A;  1BBZ A;  1Q86 C;  5GMK l;  2KY9 A;  1WTH D;  4XTV A;  2X3U A;  2RI2 A;  2L3R A;  1YN8 A;  1SG5 A;  3CP8 A;  1BCO A;  1W2B S;  3QSU A;  4FU6 A;  1PRL C;  3V8K A;  1FMW A;  3ZPN A;  2B5O A;  2LJ3 A;  2IPO B;  3VR6 A;  3FPP A;  3LLR A;  4XTU A;  5D6X A;  3VMF A;  3CCQ A;  2DEU A;  2EYY A;  1VQ4 T;  2AZV A;  3L2Z A;  3JCM g;  3M9Q A;  2D74 A;  1KG1 A;  4N0A C;  1GL5 A;  4C8Q D;  3OYE A;  3VS0 A;  2NUT B;  2X51 A;  3LNN A;  1N0V C;  1PM3 A;  2DJQ A;  4CC7 A;  3RKW A;  1K0S A;  1OU9 A;  1QKW A;  3G71 A;  2B86 A;  2HAX A;  4RCY A;  1RLQ C;  4N3G A;  4RDK A;  4PJL A;  4M7A G;  2CH4 W;  1NYG A;  2O01 E;  4AFQ C;  4OPO A;  3GLX A;  1K8A R;  4J7F A;  1T0J A;  4Z88 A;  2FPF A;  1KSW A;  4PFZ A;  1BQE A;  2XI9 A;  4IUR A;  3QSY A;  3G7Z A;  1ZX6 A;  5I2S A;  1I07 A;  5F4J A;  1QUE A;  3JQR A;  4M0L A;  1T3L A;  2NYS A;  2PTK A;  2BMW A;  1QGY A;  1N5Z A;  3ZBD A;  3OW2 P;  4DEY A;  2BZX A;  2K5F A;  1KJZ A;  1WJR A;  2DD5 A;  2P0Q A;  3M0U A;  1JA1 A;  3KEW A;  1VQK B;  2RN8 A;  1UGV A;  4LD9 K;  2C4T A;  3E2U A;  2F2V A;  4DK0 A;  3FDR A;  5FU7 C;  3ZZ0 A;  3CD6 T;  1MND A;  1PCX A;  4FM4 B;  5HZB A;  3JU4 A;  2JMC A;  1YX2 A;  1W4S A;  1U1S A;  1SPK A;  1IGQ A;  2DVJ A;  3I56 T;  3ZBT A;  2ZXH A;  2PVG B;  1M1G A;  2W10 A;  1YI2 A;  1VQO Q;  4F17 A;  3JV3 A;  1NJI C;  4PGO A;  2L0A A;  4ZN1 A;  3H41 A;  3WY9 A;  1E79 A;  2J7I A;  4PKC C;  1FMK A;  2CP0 A;  4YAO A;  3H6Z A;  2ZCF B;  2YXY A;  2F2X A;  3RMQ A;  3CME Q;  1W70 A;  2EGC A;  2RI5 A;  4IUP A;  4CC4 B;  3OYC A;  2GK6 A;  5KSW B;  1Q81 D;  2QQR A;  4FW2 A;  4M7A B;  3MCA B;  4BDY A;  1EFT A;  1K0X A;  5BSY A;  1EX4 A;  5GMK e;  4ZGJ B;  2VVK A;  2LQN A;  4LDY A;  1WA7 A;  2L3P A;  1BIB A;  4M78 B;  4C92 G;  5IXB A;  2AIR B;  2Q6L A;  5FA6 A;  2DEQ A;  4ZTF A;  3ZC3 A;  1UE9 A;  4CQJ A;  1C0M A;  4XU3 A;  1Y0M A;  3CC4 B;  1S72 A;  4N0A A;  1K9M R;  2CF4 A;  5AT1 B;  3NPF A;  2OK8 A;  2BN4 A;  4XD7 A;  2JXB A;  4Y28 E;  4KGZ B;  3SB2 A;  3E9G A;  1R5O A;  1Q7Y R;  3ES9 A;  2YWG A;  2RQU A;  2X0K A;  2DIE A;  5KCO A;  9ATC B;  1H8H A;  3OYI A;  2KXD A;  4HXJ A;  4BDZ A;  2WAC A;  3ZL7 C;  2OBT A;  4JLI A;  2WYR A;  2YWH A;  1DG1 G;  1VQ7 A;  2ZBU A;  2V1R A;  1WGS A;  1P92 A;  4TMT A;  4Z4W A;  2K57 A;  4UZU A;  1WI7 A;  5B6I A;  1IZ6 A;  4C0D B;  4IIM A;  3OPO A;  5IHK A;  1GCP A;  1OPK A;  1YWO A;  1B23 P;  2QGG A;  1VUB A;  2EYW A;  1BMF A;  1EP1 B;  3CCM Q;  2MWP A;  2GJP A;  3LWI A;  3OBY A;  2W6J A;  4XLA A;  4PAA A;  4M75 G;  1WSR A;  4RMO A;  1JO8 A;  2OBR A;  1WHH A;  3G6E B;  1KQS A;  4N4G A;  1VQ5 T;  3W5V A;  3HL8 A;  4NBS A;  2P0P A;  3EFR A;  4HIZ A;  3MEU A;  5IYQ A;  2VGM A;  3PTA A;  4MZM A;  2OTL A;  3OYF A;  1K9M D;  1AWJ A;  1KFZ A;  4L5G A;  4ESR A;  1AD5 A;  1H8K A;  1K76 A;  2XNC A;  2ZAE A;  2X4W A;  3F70 A;  2ZZD A;  4FYW B;  4D6W A;  2YUN A;  5D6W A;  2GK7 A;  1MMD A;  1XOV A;  4VUB A;  2XHC A;  3U6K A;  2MI6 A;  5FW9 A;  1WOR A;  3A8J A;  1K9M C;  3L2V A;  3CP2 A;  1AZG B;  1V1C A;  1QH0 A;  1BI2 A;  1VQP Q;  2DMO A;  1EP2 B;  2WSS A;  2MCN A;  5IT9 E;  3EHR A;  5J26 A;  3S3N A;  1YCY A;  4A4G A;  1YJ9 T;  2CP7 A;  1YHQ Q;  3PA1 A;  2YUP A;  4J9G A;  2QK0 A;  1TWB A;  3FB9 A;  2ZPF B;  4YAL A;  2E5Q A;  2JTE A;  3Q38 A;  2BGJ A;  3I35 A;  3JCM c;  5CDF A;  4E2F B;  3A1P A;  2GQF A;  4HA8 A;  4XLE A;  4AMC A;  4UZE A;  4R0K A;  3CXC P;  5GAM j;  2QGF B;  4FK8 A;  5KYW B;  1X27 A;  3CCR B;  3JCM P;  3CC2 A;  3VRY A;  3ISX A;  3OKX A;  3BNW A;  1H42 A;  2GFA A;  1QVF A;  4R71 A;  5HCK A;  5GAM f;  4E47 A;  2V7V A;  1QCF A;  1CKB A;  1EFC A;  1D8T A;  1BX0 A;  1EP3 B;  4OGE A;  1C1A A;  3OOC A;  4BI8 B;  1EZZ B;  1RUW A;  3A8H B;  4DBR A;  2ZL5 A;  2XZL A;  3CPF A;  2L2P A;  2F5T X;  4KRT A;  4B9X A;  1S1N A;  1VYT A;  1A0N B;  5LJ5 j;  8AT1 B;  1E1R A;  2PNI A;  4J9B A;  3AVY A;  4CC3 A;  4CRI A;  4E7S A;  4K1X A;  1VQ8 Q;  1VQN B;  2HL3 A;  1YI2 T;  1PKS A;  5CAI A;  5I2M A;  4C0S A;  1GVH A;  4GQN A;  3SLD A;  3I56 A;  3CCM B;  1VQ5 B;  2OAU A;  4OB0 B;  1IGU A;  3OMC A;  2V7U A;  1LVK A;  4IUT A;  4Z4R A;  1SRL A;  4P3Y A;  4QHY A;  2KDS A;  1DAR A;  4LXC A;  3R6O A;  3O8V A;  3M57 A;  1E3Z A;  1H3Z A;  3LQE A;  4FL6 A;  2A36 A;  2YUO A;  5TRD A;  4FW1 A;  2FG0 A;  5DLO A;  3Q39 A;  2K9G A;  2HCK A;  2XOK A;  1N0U A;  3QWY A;  2VXF A;  4FWT A;  1FWZ A;  3CCR A;  2PLF A;  5A89 A;  1WDX A;  5FU6 B;  4XLC A;  2QQ9 A;  2O9S A;  4M4Z A;  3M54 A;  2ROL A;  1PD1 A;  3G4S A;  2V8J A;  2E1R A;  3CMM A;  2J7K A;  2AKL A;  3HKS A;  1VYU A;  1ACM B;  3BDL A;  4L6V 5;  3OW2 B;  3MHP A;  2VNH A;  3OEE A;  1WP6 A;  3OYJ A;  3GVL A;  1OZ3 A;  2VXE A;  2RK2 A;  4JJB A;  1SKU B;  4Y9R A;  1WHM A;  3OZW A;  3Q6R A;  5HK3 A;  2JM8 A;  3JB9 H;  1X2K A;  3QJY A;  2EQK A;  1YJN A;  4X7C A;  5LJ5 e;  3BY1 A;  4HE5 A;  2CYZ B;  2KT1 A;  2PZ1 A;  4C92 C;  2B7B A;  5GV7 A;  3CCV T;  4C5H A;  4M78 A;  3E1S A;  3LO8 A;  2R57 A;  2ZTG A;  3JCM Q;  1OGI A;  3D26 A;  1T5E A;  1SSH A;  4ELZ C;  2H3J A;  1YJW A;  3OZV A;  2KGT A;  2DL7 A;  1VQ5 A;  1W0J A;  4CI0 C;  3H9N A;  1VQ8 B;  1YWP A;  1EWY A;  4LUD A;  2CT3 A;  1SSF A;  5KYX B;  2F43 A;  2V7Q A;  4M77 A;  3FPK A;  3ASR A;  2L5Q A;  2CH4 A;  2XIC A;  4RM0 A;  5HZA A;  1M90 C;  4II3 A;  4J5Y A;  5D7U A;  3E1Y E;  2CGH A;  2PUK B;  3OP1 A;  1EFR A;  1WHJ A;  1IO6 A;  3LX7 A;  4QFM A;  4QV2 A;  2EYZ A;  3WVE B;  4OOX A;  3PVQ A;  4BAC A;  3CC7 Q;  3BQJ A;  3V7C A;  2EYX A;  2LP5 A;  2EW3 A;  3G4S Q;  5D6Y A;  3CXC A;  1VQ5 Q;  1KK2 A;  4LNP A;  1KZL A;  5CR2 A;  4XL9 A;  2QDL A;  4V2S A;  1Z9Z A;  4P1V A;  3RY8 A;  4M7A C;  4X06 A;  4EPC A;  3CCR Q;  1IHW A;  3GQB A;  4FT4 A;  3QDR B;  4C0G A;  2HQX A;  1GFC A;  3A98 A;  1TLL A;  4Z4Y A;  1X01 A;  1OX9 A;  1M4Z A;  2FZG B;  3JRZ A;  1VQ7 Q;  2RC6 A;  1JRI A;  3BCD A;  2E5K A;  2J06 A;  4EMK B;  1QVF B;  5KYU B;  3PE0 A;  3A3B A;  4KBM B;  2E64 A;  4AFU C;  1PHT A;  4J9F A;  4XOR A;  5KW9 A;  2ZPI B;  2R5A A;  3PT9 A;  4JJN K;  4JRQ A;  3T53 B;  1VQK T;  1D1A A;  1RAF B;  1KQ1 A;  1D1B A;  1ZSZ B;  3QYG B;  2QA4 Q;  2M0O A;  2NPF A;  5IN1 A;  4TVR A;  5AYF A;  3A8I A;  2KNB B;  3A8O B;  5H59 A;  3JB9 F;  3BE3 A;  4OB3 B;  4WZK A;  1WU8 A;  3V7R A;  1ZSZ C;  4F7U A;  1SEM A;  2E70 A;  1YHQ T;  5CKD A;  4FSX A;  4PL6 A;  1Q81 C;  5GAO m;  1W0K A;  2MOX A;  4BE2 A;  5ECA A;  1AZE A;  3HAG A;  3AT1 B;  3MET A;  3MCA A;  1KK0 A;  3H0H A;  3CCS A;  1AOJ A;  1FDR A;  4PC6 A;  5GAN 7;  2XMF A;  1VQ6 A;  4P6Y A;  1ZUY A;  2C0I A;  1X6B A;  1UGQ B;  4GY5 A;  3UWN A;  1BLI A;  3WXM B;  2BIV A;  1ZLM A;  2HBP A;  3O5Z A;  4OML A;  3RDV A;  3U23 A;  1VLO A;  4PJO D;  3ZZT A;  1D09 B;  1IB8 A;  2D6F A;  4FSS A;  4FCY A;  4FXU A;  4WQM A;  1MV0 B;  2M02 A;  4C5E A;  3CMA T;  1YI2 Q;  3G6E A;  5EMN A;  3P8D A;  4P5N A;  4EMK A;  3CCJ B;  2R58 A;  2ROT A;  2FHD A;  2FX3 A;  3N5B B;  4BI4 A;  2QTL A;  3QDF A;  3LWH A;  5L46 A;  2DOG A;  2EJG A;  3EG9 A;  4IUQ A;  3MP1 A;  4X9D A;  3MMP A;  1NDH A;  1U8R A;  1QQJ A;  1V29 B;  2DZ9 A;  2V31 A;  4M75 F;  2QTV A;  3CCS T;  4PJO A;  1ZM9 A;  1T0H A;  4RTZ A;  5LMZ A;  2BVN A;  5HKK A;  2MIO A;  5GMK j;  3CXC B;  4RTU A;  1WYX A;  1I5L A;  3QFR A;  1UDL A;  2DIG A;  3CC4 Q;  4LBW A;  3TVT A;  5I21 A;  4LDV A;  4LDX A;  2FYK A;  4M53 A;  5GAN 2;  3HP9 A;  1YJW B;  3M0P A;  3TSW A;  3QYH B;  4IUU A;  3QJ6 A;  5AN9 A;  1YJW Q;  1E63 A;  4TT3 A;  4C8Q F;  4P26 A;  4M7D D;  4FIB A;  2LCC A;  4QQG A;  1O9S A;  1OOT A;  4M75 D;  2O9V A;  4C92 B;  1Q86 R;  3CCQ B;  3BC9 A;  3M0R A;  2VKN A;  2ZXI A;  5F4O A;  4RG8 A;  3VYG A;  1LNX A;  4L8J A;  3CCM A;  3I56 B;  1X6O A;  1TS9 A;  1I0C A;  4DBH A;  5IAY A;  5KYW A;  3PIP A;  1G3T A;  1Q81 R;  3KBG A;  5H5J A;  1YJW T;  2X9H A;  1WPY A;  3PUM A;  2AHO A;  4M7A D;  5CIU A;  1QX4 A;  1N27 A;  2DTI A;  1Y96 B;  5GAN e;  2CP2 A;  3E20 A;  3OY9 A;  1E3X A;  1MNE A;  2YLC A;  4NNJ A;  1BI3 A;  2PUO B;  1Q9S A;  4ZCM A;  5IYN A;  1U06 A;  1Y57 A;  1YI2 B;  3LYI A;  3L2Q A;  2EWN A;  4PJO F;  4PC7 A;  1BB9 A;  3OW2 A;  1GAQ A;  4JS4 A;  4MZP A;  3UT1 A;  2GCX A;  3LGF A;  4C8Q A;  5GAO n;  4KUI A;  1AWX A;  2RA2 A;  2VJI A;  3OS5 A;  3CBP A;  2RM4 A;  3P26 A;  4C43 A;  3A3G A;  1OI1 A;  5GAN f;  1H64 1;  1PD0 A;  3SJZ A;  2DZC A;  2LZ6 B;  2BM0 A;  2JMA A;  4NCN A;  1PSF A;  4JS5 A;  4XON A;  2XEX A;  2EGA A;  3JCM V;  3MO8 A;  2WZN A;  2DX1 A;  2WJV A;  5HKC A;  2L3S A;  4PC2 A;  1I81 A;  2F2W A;  3MPU B;  1D1N A;  1TVC A;  2VBT A;  4QVC A;  4MMK A;  3QHS A;  2XD0 A;  4D8D A;  3UF4 A;  2HQE A;  1VQO T;  1QFJ A;  3MHX A;  3VRZ A;  1BKB A;  1V76 A;  3CC7 B;  4JRI A;  4F7U F;  1B34 B;  4PLL A;  2AK5 A;  1M3B A;  4HKE A;  2GJK A;  3AHU A;  1BPL A;  3B8H A;  1VQ9 B;  2VV5 A;  4ELY C;  2L89 A;  1VQN A;  1Y71 A;  4RPD A;  4M4S A;  4Z4T A;  1MMG A;  2KXC A;  2K7A A;  3VS5 A;  2Q6I A;  3CPW A;  2RO0 A;  4M77 E;  1CNF A;  3JCM X;  1NB0 A;  4DQL A;  3A8M B;  3LH0 A;  3G1J A;  4C5G A;  4XLF A;  1QP3 A;  2AT1 B;  2DET A;  3X28 B;  4J9H A;  2EIX A;  2XG8 D;  2DL8 A;  2BE7 D;  3BY7 A;  4F14 A;  1GAW A;  1KC8 U;  1AWO A;  3CCE B;  4YAU A;  4M78 E;  3VS4 A;  3I55 A;  4PNO A;  4M1K A;  1NPR A;  2O88 A;  3EFS A;  3A8G B;  1M90 D;  1WQ7 A;  3CME A;  3A5Z B;  4N4I A;  3QFS A;  3HTR A;  3OZU A;  5GAO q;  1YIT T;  2VNK A;  3ZZU A;  3CMA Q;  2KQW A;  1WHG A;  4OOS A;  1ZA2 B;  3OAA A;  4M77 B;  1KQS P;  1TG0 A;  3I55 T;  5LJ3 j;  2QN6 A;  1EFN A;  3OFN A;  2DK3 A;  2OTJ A;  4M77 G;  3E9F A;  4QT7 A;  1AHJ B;  3FJ5 A;  2MK5 A;  2ZZG A;  3JB9 J;  3OS1 A;  3CC2 B;  2JJ2 A;  1QVG S;  3ASS A;  2RQV A;  4ACA A;  1HZE A;  3QE2 A;  4BI3 A;  1UGP B;  4AT1 B;  1NPP A;  5GAN 4;  1IRE B;  3OS2 A;  2OYN A;  2LNH B;  3W5U A;  1B34 A;  2JS2 A;  3RBB B;  4A53 A;  5FRN A;  2E6Z A;  2D9T A;  5CVI A;  1G8X A;  5FRO A;  1AT1 B;  2CUD A;  2EKH A;  5IK2 A;  2P84 A;  2YWE A;  3CQT A;  5I11 A;  2VBU A;  4BY6 C;  2M51 A;  3VUZ A;  1OGJ A;  4M75 C;  4MML A;  1G2B A;  1WXU A;  4Z4S A;  1I1J A;  2DM1 A;  3OSS C;  1N6A A;  5FWB A;  3I5S A;  2BZ8 A;  3RNJ A;  1BK2 A;  3C0C A;  4M7D E;  1QGA A;  2JJ9 A;  4YXW A;  1KJW A;  1D1C A;  2EQJ A;  1YJ9 A;  3UA6 A;  5A8A A;  1AIP A;  2EJ9 A;  3W5H A;  3W2H A;  2LCS A;  1D3B A;  1NZ9 A;  2AZS A;  3NTI A;  5KYY A;  5LJ5 g;  3FJO A;  1N9R A;  2LT4 A;  2QMU A;  2JVV A;  2DTH A;  1H92 A;  3SWN C;  1BU1 A;  2KVQ G;  4M77 F;  2DXB A;  1EXM A;  1VOM A;  1KC8 C;  2HDA A;  2M1H A;  1C6V X;  2QYZ A;  1N05 A;  5FU7 B;  2QE7 A;  4WZE A;  3JB9 D;  2ED0 A;  4QVZ A;  3OYG A;  3WND A;  4BY6 B;  2ZZE A;  2OAW A;  4J9D A;  5GMK m;  3X24 B;  4P22 A;  3DLL A;  4HT8 A;  1VQ4 Q;  2HSP A;  2RJC A;  4X34 A;  2HDN B;  4EMG A;  2BKD N;  1Q7Y U;  3R6J A;  2VUB A;  4JZ3 A;  3QXE B;  2X4Y A;  3HRU A;  4XTX A;  3FKS A;  1BIA A;  1SRM A;  1JQQ A;  1RAE B;  5KH6 A;  4Y7C A;  1YJN B;  3CC4 A;  3LVB A;  5FLX E;  2A0F B;  1HSQ A;  2LQ8 A;  4X7E A;  4QKU A;  2O4X B;  2DE0 X;  4RCZ A;  1D3B B;  1DJ7 B;  2E3H A;  4Z4U A;  1VQP B;  3EHQ A;  5GAN d;  1CNE A;  4PJO E;  3QII A;  2LQW A;  1RL2 A;  2A3L A;  2EGE A;  4YEJ A;  3M0Q A;  4XKW A;  4TKO B;  2L8D A;  4F04 B;  3JCM f;  3GBQ A;  2I1L A;  2VB6 A;  3VV0 A;  3RKY A;  2QA4 B;  2RHY A;  2KBT A;  1NLO C;  4EDU A;  4B4D A;  4HCZ A;  5DN6 A;  1NBM A;  3OEH A;  2JT4 A;  3J7A F;  3LH5 A;  3A8K A;  2RB6 A;  3J81 k;  5TR9 A;  4DQ2 A;  5GAN 5;  2DIQ A;  1MV3 A;  4AF6 A;  4HVU A;  2ENM A;  1LPL A;  2RK1 A;  4BB7 A;  1YJN Q;  4XMY A;  3CBM A;  1YBY A;  3JCM d;  2Y4X A;  2GRE A;  1R77 A;  3CCR T;  3MKD A;  2C78 A;  1QCO A;  2DFU A;  3RMS A;  3TSZ A;  4AG1 C;  2RQW A;  1FNM A;  3KFV A;  1M90 R;  1WQW A;  1QCN A;  1HD3 A;  1JJ2 B;  2DYI A;  1TOV A;  2VWF A;  1LOJ A;  4XN3 A;  2CW5 A;  2V7W A;  1UG1 A;  1YIT A;  2LZJ A;  1NM7 A;  3KXT A;  1H8E A;  4JLG A;  2JDI A;  1LJO A;  3SJP A;  4JUV A;  4OB1 B;  1M1K C;  3BCF A;  1NJI U;  3G71 Q;  4BD3 A;  2D1X A;  3ASK A;  5GAM e;  4YAW A;  4GLM A;  4Q5W A;  1FX7 A;  1KMH A;  2QA4 T;  2NUT A;  4PJN A;  3JCM h;  3OQ5 A;  2P4R A;  4F7U G;  4RTY A;  4C92 D;  1WDT A;  2CND A;  1VQ6 T;  4DOV A;  3EGX A;  1K8A D;  1U5S A;  3JCM b;  2SRC A;  1JJ2 S;  3M53 A;  2EVR A;  2GQV A;  3CCQ Q;  4F7U B;  1RI0 A;  2LNV A;  5THX A;  1FRN A;  4WWV A;  3WBK A;  1ZBJ A;  4ZNX A;  4RLZ A;  2Q6O A;  1ZQ1 A;  2RHU A;  3M58 A;  4J9E A;  1R5N A;  4Z8A A;  1RAG B;  1PRM C;  5IXF A;  3CCU B;  3ZUG A;  4J9I A;  2KRS A;  2IVW A;  4OMM A;  4PK4 A;  1E6H A;  2WSC E;  3MP6 A;  2RF0 A;  1K73 C;  5A2Q E;  1UD3 A;  4Z1M A;  5KYU A;  1O75 A;  3CCQ T;  1WXB A;  3CCL Q;  2DTO A;  2ZPG B;  1B7T A;  3RER A;  2QEX B;  2FB7 A;  4ORZ A;  4XM3 A;  3VU3 C;  2PIA A;  2YWF A;  2E10 A;  4IUV A;  1CQX A;  2CDT A;  4RD2 A;  3QFT A;  2OX7 A;  1B2R A;  5KCH A;  3INZ A;  4XK8 E;  2OBS A;  3CC2 Q;  2C4U A;  1WOP A;  2COY A;  2F5K A;  2LDM A;  2XK0 A;  2H8H A;  1OB0 A;  1H3H A;  3TCJ A;  4L59 A;  2VGN A;  2PE3 A;  1QUF A;  3QG1 A;  3SFM A;  2E1H A;  4ME7 A;  3Q3A A;  1W2B B;  1X69 A;  4M7D A;  2OK7 A;  3OJW A;  1MMA A;  1G83 A;  1KD1 U;  2JN0 A;  4A4E A;  3V76 A;  5GAN h;  3SHW A;  2QTZ A;  2FVU A;  3RUX A;  4CC2 A;  4GBQ A;  3SLN A;  2HD0 A;  1D0X A;  4XOT A;  2C5B A;  3PFS A;  2J05 A;  2FEI A;  3M0S A;  1VQO B;  3I9Q A;  1W2B P;  1N9S A;  3CCJ T;  5LL6 S;  1N8R U;  2WPD A;  5CQY A;  1CKA A;  3CCV A;  4PJM A;  4II2 A;  2ZPH B;  1UMK A;  4MYT A;  2QQB A;  3V8L A;  5DSZ A;  3ASP A;  1N8R C;  2KSS A;  2V7T A;  1XNI A;  4ANJ A;  4OF1 A;  5C6S A;  2KR3 A;  4WTO B;  5GV8 A;  1OB5 A;  1DDI A;  4PFO A;  4LBY A;  1LCK A;  1YJ9 B;  4RTT A;  1VQ9 Q;  2K2M A;  1SHG A;  2E12 A;  3TU4 K;  3EH2 A;  4E7J A;  2X3W D;  3MP8 A;  1VF7 A;  1QWE A;  3OBW A;  2YRC A;  2DA9 A;  2HCJ B;  1UFF A;  3P8B B;  2WJY A;  2COZ A;  3H0I A;  4XR6 A;  2JTM A;  1F20 A;  2F1M A;  1ZM2 A;  1TTH B;  4HCK A;  5DLQ E;  2HMA A;  3CPW S;  3W2I A;  1WIE A;  1R8O B;  3W2F A;  2RMO A;  1MRZ A;  3Q6Q A;  3OMG A;  2CT4 A;  2K4Y A;  3L1A A;  3SKB A;  3PUN A;  3OW7 A;  5I22 A;  1V5V A;  2SEM A;  3X26 B;  2DL5 A;  4J8O A;  3DB4 A;  1A8P A;  4JRK A;  3VJP A;  2ATC B;  3FRN A;  1S72 T;  3G05 A;  4P12 A;  3J80 E;  1M1K D;  2H3E B;  2F1L A;  1G3S A;  4OP0 A;  4QUZ A;  2HKN A;  3CES A;  3G6E T;  4AFZ C;  2KEA A;  3M59 A;  4OMQ A;  3I1F A;  4Z02 A;  4MYU A;  2X6Y A;  4ZCI A;  2JTF A;  1NRK A;  4JRP A;  1I5O B;  4II1 A;  5CO7 A;  4RPB A;  4X07 A;  1GO2 A;  2LX7 A;  2RH2 A;  3T9N A;  5KE2 A;  1FNB A;  2C0T A;  1N8R R;  1S72 Q;  2QA4 A;  3J81 E;  4G7X A;  4M7D B;  2DRK A;  4X7F A;  2RJF A;  1T6Y A;  2QG9 B;  3PA2 A;  4LDU A;  3I56 Q;  1KK3 A;  4X05 A;  2C06 A;  3EH1 A;  3A8L B;  3CCL B;  1Q82 D;  4FT2 A;  3CCS B;  2CSQ A;  2WZP P;  2KRM A;  2FVG A;  4G7W A;  1SKY B;  4AC9 A;  2KRN A;  5HY6 A;  3OYA A;  1WXT A;  1YP5 A;  1G7R A;  1UGS B;  3OA6 A;  2HNI A;  4ZGN B;  1VQK A;  1VQ9 A;  1MAB A;  5IYW A;  2BM1 A;  2X4J A;  3QWX X;  5A0L A;  1VHE A;  2RI3 A;  1TSF A;  2PU9 B;  4K11 A;  2X53 S;  1M3C A;  3WQZ A;  1M1K R;  1U1T A;  4M7D F;  1W34 A;  2EFI A;  4LDW A;  3HRS A;  2JNG A;  4ZCL A;  4A4H A;  4J7I A;  3CW2 A;  2J6O A;  2KAF A;  1K73 D;  2YSQ A;  1QVG A;  1JJ2 A;  1VQL A;  2W0Z A;  3CCV Q;  4BPR A;  1TUD A;  4AG2 C;  1Q86 D;  3AST A;  2WR8 A;  1ZSG A;  4XNF A;  3PVL A;  2BV3 A;  2D8J A;  2DLP A;  2GBQ A;  2RHZ A;  3CCL T;  3QBY A;  4JJC A;  5CQX A;  2LRQ A;  2QQS A;  4E7L A;  3CTA A;  1I8D A;  3A35 A;  2YUQ A;  2QDY B;  2X6X A;  1T6Z A;  3FLG A;  1PG5 B;  4TMZ A;  4OPV A;  3CPW B;  2BSA A;  1ZUK A;  8ATC B;  2JZ2 A;  1VYV A;  1X6G A;  4WF2 A;  3ONY A;  2OTJ B;  2QQA A;  2J6K A;  1E1Q A;  1EIF A;  1XJW B;  3UDC A;  2YDL A;  4WCI A;  5DS0 A;  5FRM A;  4RDL A;  3CCM T;  3HSB A;  3M5A A;  1VQL B;  3W2E A;  1QVG B;  2CZ0 B;  5LJ5 f;  1QFY A;  1VA7 A;  3BFM A;  1Z9Q A;  3SWN B;  2DJZ A;  1QWF A;  1OUL A;  4KKT A;  2Y90 A;  1KC8 D;  4ZTJ A;  1T6X A;  3CCL A;  2DY1 A;  2DCU A;  1G3Y A;  2CS7 A;  2DAQ A;  3L2R A;  4OVA A;  4OOV A;  1RAI B;  2LC4 A;  1VQ7 T;  1Q86 U;  4F7D A;  4C0F A;  3CPW P;  2Q6K A;  1E62 A;  2FZC B;  2D3L A;  1J9Z A;  5LJ3 d;  5FO0 A;  4YTL A;  3V7S A;  1COW A;  2QEX A;  4HCC A;  2CBX A;  1PKT A;  2RC5 A;  4UC4 A;  1UD2 A;  2CSI A;  5KE3 A;  2LCL A;  4LBZ A;  1VQ9 T;  2YWW A;  3DDY A;  4F7U E;  4EIK A;  4PJO G;  3C12 A;  2X8K A;  1YJ9 Q;  3R6K A;  1KK1 A;  2XZO A;  1TUI A;  4PJO B;  3GIR A;  1ABQ A;  3EGU A;  1N08 A;  4JJD A;  4JZ4 A;  4RJL A;  2CZ6 B;  1Q81 U;  4A63 B;  3QO3 A;  1N07 A;  1KD1 C;  3JB9 I;  1W35 A;  2O2O A;  2DNU A;  1M27 C;  4E7I A;  4WZL A;  4U9U A;  1VQ7 B;  3QZ5 B;  1M90 U;  1Y0R A;  5GAN 6;  4KUL A;  5KNL A;  3OB9 A;  2KE9 A;  4M78 F;  4XTZ A;  3BW1 A;  1HXD A;  3EFO B;  1MHN A;  2CZ7 B;  2RJD A;  4BE1 A;  4PAB A;  4X8I A;  3THK A;  3SDZ A;  3OYB A;  3CB4 A;  4C8Q G;  2XU8 A;  4Y92 A;  2B8A A;  4R55 A;  4XU0 A;  1JEG A;  1Q82 R;  2GJR A;  1D0Y A;  1VIF A;  2ECZ A;  2JUF A;  3CME T;  1K28 D;  2ZL6 A;  5CCA A;  5HXB A;  3PVD A;  1F60 A;  2MWO A;  4OMP A;  2A28 A;  4RD6 A;  1W1F A;  1YLO A;  5J3O A;  5EG2 A;  1RLP C;  1OQK A;  4X0C A;  4A54 A;  2J6F A;  4M7A E;  2MF2 A;  1PC0 A;  5JBQ A;  4UAJ A;  4KH0 B;  2LJ0 A;  2V8I A;  4YEL A;  4IW3 B;  3X20 B;  2IIM A;  4M78 D;  5L23 A;  4PC1 A;  1MGQ A;  2RD1 A;  4XKV A;  3S6W A;  4KKU A;  2RPN A;  2M9U A;  2R9V A;  4JMQ A;  3G71 T;  5FWC A;  4M75 B;  1VQN T;  2QEX Q;  4P25 A;  2WSF E;  1VQ6 B;  5LJ3 g;  2V7X A;  3VO1 A;  4FYV B;  4EMK C;  4NS5 A;  4Z4V A;  3U2Q A;  2CK3 A;  2E65 A;  3ME9 A;  3AVW A;  3MEW A;  2DXT A;  2FRY A;  1IXD A;  1YFN A;  5C0M A;  1X75 C;  3UA7 A;  1Q82 U;  1MUZ A;  4RKU E;  3L2W A;  1VQ4 A;  1IJE A;  2XKO C;  4M7D C;  1UD6 A;  5LJ5 d;  4B9W A;  1E64 A;  3WBJ A;  1V0E A;  2NUP A;  1UB4 A;  1FMV A;  1WNL A;  4MDW A;  3VKI A;  3AVU A;  4XU2 A;  4RCB A;  4C92 F;  1VQN Q;  1M9S A;  1UUE A;  1YIJ Q;  3T56 B;  1IB0 A;  3SWN A;  2LT1 A;  2VC8 A;  5CKB A;  1BX1 A;  1HYO A;  3CCJ A;  1T3S A;  1ABO A;  4C5I A;  2CUB A;  1M2V A;  1OHH A;  3PGG A;  1RAB B;  3SEM A;  2JJ1 A;  4N3N A;  2X35 A;  3HRT A;  1XFO A;  1KK7 A;  1W9X A;  1KC8 R;  1WOS A;  2LX9 A;  3OYD A;  2C2W A;  2DD4 A;  2X85 A;  4JPB W;  1M8M A;  1Q95 G;  2BF4 A;  4B48 A;  1NJI D;  4OPS A;  4J83 A;  1VQM A;  1G3W A;  1WPC A;  3CMA B;  2LVM A;  4PFP A;  3CCE A;  4MDX A;  4M78 G;  3VS1 A;  1UEB A;  1K9M U;  4O6J A;  3MJX A;  1K73 R;  2A08 A;  2GGR A;  2C0O A;  1RAD B;  3DB3 A;  1K9A A;  1NYF A;  5GAN 3;  3GP8 A;  1J3T A;  1U2R A;  4E6R A;  1D0Z A;  1VQP T;  3TRE A;  1ZHI A;  1UGR B;  5GAO r;  4OB2 B;  1YCS B;  1GXI E;  2GTO A;  4G1V A;  3S3O A;  4M7A A;  1WHK A;  5FNZ A;  2XDD A;  2HBW A;  1CSK A;  2QI2 A;  4OMO A;  2VJJ A;  2XZP A;  3M4Y A;  3JSC A;  3C95 A;  3G4S T;  3B82 A;  1B3Q A;  4ROX A;  1YHQ B;  4TSF A;  3WNB A;  5A0G A;  3BH4 A;  1UHC A;  4M7A F;  4G6I A;  1GR1 A;  2DBM A;  2KYB A;  5KYX A;  1ZM4 A;  2GF7 A;  4RTW A;  4D8K A;  4J0Q A;  2MYS A;  1GCQ C;  3ZIA A;  5GAM g;  3JCM J;  2ZIT A;  1ARK A;  2GNC A;  3PEN A;  4P6V F;  4M77 C;  5GJW B;  3M0T A;  1Y07 A;  1PNJ A;  3NE5 B;  4E7Z A;  1VQL Q;  1ZUN B;  1M3A A;  3CMA A;  2RQT A;  4B6M A;  2E6N A;  1GCQ A;  2VBS A;  4RTV A;  3REA B;  2E41 A;  3VS2 A;  4ATO A;  3VS3 A;  4TMV A;  4C8Q E;  5GAO p;  2CP3 A;  1W6X A;  3OYN A;  3RIR A;  4TMW A;  4KGX B;  1JXM A;  4C92 A;  1JJ2 P;  1GBR A;  4H9G A;  5GAM d;  3HHT B;  1TH7 A;  2PMD A;  3OSV A;  3H0F A;  3ER0 A;  4QVA A;  5KYN A;  1PJ6 A;  4ZV4 A;  5LJ3 e;  1KD1 D;  1VQ8 T;  2HL5 C;  3AVV A;  1OYX A;  1QP2 A;  4OP7 A;  4EMH A;  4G5G A;  1OV3 A;  5GMK i;  3DLM A;  5FL7 A;  4WZT A;  2CRE A;  2FRW A;  1GRI A;  4XOP A;  4X1V A;  3FEO A;  2K3X A;  4O5V A;  5FU6 C;  4XAX B;  4A4K A;  2XDB A;  2YLB A;  3KL9 A;  4HE6 A;  3OYM A;  5CKF A;  5EC7 A;  3MEA A;  2K3B A;  5GAM h;  2HKQ B;  4HVV A;  3VS7 A;  1XE1 A; 
#chains in the Genus database with same CATH homology
 2QGG A;  2DOG A;  2F1L A;  2DYI A;  3H9N A;  1PM3 A;  3A1P A;  3HTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...