3A1PA

Structure of ribosome maturation protein rimm and ribosomal protein s19
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
RLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome maturation factor rimM
publication title Structure of Ribosome maturation protein RimM and Ribosomal protein S19
rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 30
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3a1pA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3a1pA01
2DYIA 2DOGA 2QGGA 3A1PA 3H9NA 2F1LA 1PM3A 3HTRA
chains in the Genus database with same CATH superfamily
2DBMA 3MCAB 1VQ6Q 3CCLA 1CNFA 2C5HA 4X0CA 1S72A 4IURA 4G7WA 4AT1B 2Y4XA 5A0DA 1M1KC 2HMAA 1RACB 4QT7A 3P8BB 1N05A 2QI2A 2D8JA 5I2MA 4RD3A 3EG1A 4LDYA 5A8AA 4RCCA 1VQKA 5CQXA 4M77G 3KEWA 3GF5A 4BE2A 1KK3A 2KQWA 2ZL5A 1FMKA 1TUDA 2E12A 1I7PA 2C06A 1LPLA 2BSAA 2KAFA 2FYKA 3SD4A 2JMAA 2KYBA 2X53S 3ASSA 4M7DF 3CP8A 3HAGA 3B82A 1UDLA 1WHMA 3V7AA 4UZUA 3QIIA 3VS5A 2E1BA 2GK6A 1CQXA 1OZ3A 1ZUKA 1T6XA 1TWBA 1KQ1A 2OBRA 2R5MA 4Z4SA 4KT0E 1IHVA 5GAMe 4UZEA 4RDKA 5J39A 4IIMA 3CXCP 2LQ8A 1MNDA 4JZ3A 4RG8A 1VLOA 5IT9E 2DAQA 3V8JA 1M1GA 4OMPA 4OGCA 2XI9A 3M9QA 1VQLQ 2FO0A 3EG0A 1RAGB 2F1LA 2IG0A 1KK1A 4EIKA 4ESRA 5KYXB 3CCET 4Z4YA 3W2HA 4WZTA 4J8OA 1NYGA 2A28A 5DLOA 2CZ1B 1AWOA 2FHDA 1BPLA 1OGIA 1G3WA 4P3YA 3WXMB 3M56A 3A8KA 4B3FX 3JCMe 3CD6Q 2E3IA 1O75A 1X75C 1ZM3A 1CSKA 1GXIE 2HD0A 2JIZA 3VS7A 1E62A 1HJDA 3LGLA 1X69A 3NGPA 2KNBB 1W4SA 4J6WA 3QSUA 1TVCA 2ZPEB 3AVUA 5GMKm 4MZPA 3WQZA 1OU8A 2O4XA 1PHTA 2ZGWA 3Q6RA 1VQ8A 1X6OA 1U1TA 1M90C 1RADB 3KBGA 4XU2A 3S3MA 2LJ3A 1VQ7A 2W6IA 2DL7A 2NUPB 4Z4TA 2BV3A 4XAXB 4ELYC 3HHTB 2QDLA 4HKEA 3A1PA 3ZEHA 1B07A 3EFOA 1QVGB 2KRMA 2D0NA 1H3HA 4EDUA 4C92B 4B3GA 1E6HA 3J80E 3G71T 4AF6A 4O5VA 4JUVA 4WQMA 1Q81R 1YIJQ 1YWOA 3WVEB 2QAZA 2RM4A 4MDWA 1WDTA 3VKIA 2D1XA 1RI9A 2O9SA 1TH7A 1T6ZA 3CTAA 2QA4A 1K9AA 2HCKA 3O8VA 4E7KA 1AZEA 4IKFA 4KH0B 4J9CA 3OBWA 3GVKA 5IXBA 1D1AA 3CCMB 5GAN8 2V26A 3CPFA 1R5OA 1AHJB 1B7TA 2KRNA 5DN6A 2ED1A 1M90R 1RLPC 3MJXA 5FWBA 3OZUA 3GP8A 1M30A 5FL7A 2MPXC 2VASA 3OPOA 4X06A 2MF2A 4OOXA 3MP1A 2WSEE 3AVWA 2LNHB 3CP2A 3QBYA 4OB2B 4J83A 2JUFA 1KK7A 3LGFA 4HVVA 2FRWA 2NLUA 3VRYA 2HLDA 2HBPA 1SG5A 4TMXA 5CIUA 4XU3A 3J7AF 4E7HA 1PG5B 4X9CA 1VQMQ 2H3EB 2X6XA 1OOTA 3J81E 5KYUA 1S4MA 1JQQA 3HPWA 1ABOA 1F60A 4Q5WA 2DZCA 3OYDA 4JZ4A 3BE3A 3P8DA 2F2XA 3CPXA 2EPDA 3CMEB 3CW2A 4HVWA 3ULRB 1KK2A 4FXUA 1B34B 1AIPA 1SKYB 4B6MA 4M75F 2GJRA 1EFNA 2EYXA 4M75C 2CT3A 4FSSA 1A0NB 4XLEA 2XEXA 3H0HA 4TMVA 1ZSZC 3OYGA 2R57A 4E7SA 2AKKA 1N06A 4C92D 2XDBA 2NUZA 3OYMA 3KUFA 3OSVA 4JJNK 2DVJA 5IN1A 4MZTA 3I56T 4TMZA 1X27A 2M02A 4AFUC 3LW5E 9ATCB 3HRUA 1VUBA 2VJJA 4M4SA 5TR9A 3JCMJ 1P92A 2XIDA 1EIFA 1Y96B 2FZGB 3UA6A 3CBMA 2I2LA 2K5FA 2YRCA 2QQSA 4KRTA 3JQQA 4M75A 3VNUA 2XHCA 2DFUA 2RI2A 4L8JA 3CCRB 2WACA 1ZSZA 1FNCA 3OEHA 1ZLMA 4DA4A 3AGPA 4AG1C 3FB9A 1GCQC 2HCJB 5I22A 3PVQA 1UECA 4IUUA 1RL2A 4N0AC 1E1RA 1M1KU 3QFCA 1HD3A 1BK2A 1U3OA 4M75E 1HZEA 2JJ2A 2COYA 3JB9D 2ZZEA 1NM7A 2RI5A 2BTTA 3I55Q 1I8FA 4OVAA 4C92F 3OS1A 5IYWA 4C5GA 4C8QB 4FU6A 1RUWA 3Q3AA 4J9EA 3R6NA 2MOXA 1XFOA 1FMWA 4M77C 4LD9K 3CRZA 2QEXQ 2C0OA 1VQ6A 3CCSQ 2AK5A 4Y9UA 5KW9A 3ONUA 1V1CA 1GCQA 1G3TA 4YTLA 4NNJA 1KQSS 3OYJA 1VQPT 4N0AA 1Y0MA 2VYTA 1AEYA 3ASKA 3CMAB 1YJWB 1K8AC 3H94A 3NTIA 4OPSA 5JBQA 3QDFA 3TREA 3VJPA 3OYFA 2ZPFB 4L5GA 1NZ9A 1NJIC 4PLIA 4AVZA 4JRIA 2EYYA 2MAMA 1RLQC 4M77A 2PUOB 2QXFA 1W35A 2DK3A 1PJ5A 3V8KA 4M53A 5DSZA 4U9UA 2A08A 4RDLA 3T9NA 2GK7A 1BI3A 2HKQB 3CC2B 2PZ1A 3HTRA 3CPWB 4XL9A 3IQLA 2CW5A 1QKWA 1U8RA 2KY9A 4RTXA 4M77E 3CC7T 2A7YA 2BM0A 3CCEB 1I0CA 5FRNA 2BM1A 4LUDA 4P2NA 4C5HA 2NPFA 2OTLT 2DXTA 4HVUA 5KE2A 2D9TA 4P26A 2GPJA 2AHJB 1JNYA 3M0RA 1BB9A 2JTFA 1E64A 5IYRA 4N4HA 5J3BA 2GCXA 1YI2Q 1Q81U 1FMVA 1NJIR 1VQLA 1K1ZA 1RAFB 3SWNC 5LJ3e 3W2FA 1YJ9B 2OJ2A 3LWIA 4PFOA 5HKKA 5GJWB 4AG2C 2RK1A 1EFUA 2YDLA 1VQ9T 2DL4A 1KD1C 2JNGA 4CC4B 2JJ1A 2ZITA 1M90U 1YCYA 3JAME 3CD6A 1UD8A 4XKVA 1HYOA 3EG9B 2AZVA 2DCUA 3CCUB 5H5JA 1Q9SA 2QYZA 5HXBA 3BQJA 2RHIA 2DOGA 2LJ1A 4OMNA 1Q7YC 4XTYA 3S6WA 3REBB 4CRIA 3RIRA 3QFTA 5TRDA 2CZ0B 1YJNB 3SWNA 3CCVT 2EQIA 5FRMA 2YHTA 1CKBA 2VV5A 2LNVA 4BB7A 4M2LA 4X7CA 2VNIA 3G71B 1RAIB 4X07A 1I5OB 3H6ZA 4F7UG 4E0FA 2FL7A 3ONYA 2DMOA 1YITT 2DRMA 1KD1R 2EGCA 1OYXA 1IJFA 1SPKA 1W2BA 5IH2A 1LNXA 1WHHA 2DJQA 5GAMg 1JJ2P 4BY6B 4RTVA 4J7FA 1O9SA 5GAN3 3S3NA 5CKEA 2K4YA 1VQ5T 3QWXX 1Q7YR 4WZEA 4JRPA 1YIJA 5KYYB 3CB4A 1VQPQ 1QFZA 5J3OA 2VBVA 4M78B 4RTUA 1JU5C 3M55A 2X85A 1R8OB 4M4ZA 3NTHA 4UAJA 3KXTA 3VS3A 5FU6C 2EJ9A 1OB5A 2C0IA 2E65A 3OZVA 2QTVA 5GJVB 2BVNA 3JCMg 4XOPA 1N9RA 2M0OA 2D9RA 1H3ZA 4DK1A 4NBSA 2FZKB 1QLYA 5FO1A 2DIQA 3A8HB 2EGEA 2A0FB 5A0LA 3PUNA 1WJSA 1WZOA 2FVUA 5TV2A 1DARA 1N27A 1T3LA 1VIFA 3VR6A 2CBXA 1TSFA 3L42A 2WJVA 4LC0A 1Y07A 2EQKA 2GGRA 3H9NA 3CC7Q 4A53A 5KE3A 4JMQA 4E7JA 1WLPB 4H9GA 1VQMA 5KH6A 4NCNA 3AVVA 5DM7R 2J7KA 2V7UA 2V1RA 2W0ZA 3CCQA 2ZTGA 3I56B 4AFSC 2KBTA 4M7AB 4TT3A 2LVMA 3LX7A 2V7TA 1GO2A 1XE1A 3FRNA 5GAOn 1ZA2B 4JS5A 4J9IA 3ZC3A 4AMCA 2X3XD 3QO3A 1UFFA 4XD7A 3QSYA 2X6YA 1M9SA 1VQNT 4PJOB 5L8RE 2V8KA 1IGUA 3CXCA 1W0KA 4WZKA 4M78D 4II3A 3JCMb 1MABA 2CSQA 2KMTA 2E5QA 2X6WA 1VYTA 2ZPIB 2SEMA 3A8GB 1EP1B 3CCLB 2DE0X 1S72B 3Q39A 3OYBA 4B3XA 1SRLA 2L3QA 4DEXA 4ZGNB 1D2EA 1WQWA 4CC7A 1HXDA 2R6HA 4CQJA 3G05A 2MI6A 1D1CA 2GBQA 2ZBVA 2VGMA 1SHGA 2XZPA 2C0TA 1MV0B 2CGHA 1NYFA 2R5AA 3C95A 3V8LA 5KNLA 1VQKB 3I55A 3DB4A 4OP0A 2RC6A 1D0XA 3M57A 4NL3A 1X2QA 2YWFA 3CCMT 2XNCA 4X7FA 1NJIU 2V1QA 3PVDA 1N5ZA 2VYQA 1KHIA 2M9UA 2QEXA 2HQXA 3CCSA 4G5GA 1KC8D 2CH4A 3I35A 2ZBUA 1QWFA 5J35A 4LE9A 5LJ5d 2OTJB 3PTAA 1W0JA 2OBTA 4F14A 2D6FA 1AWWA 1TXQA 4PJOD 3E20A 2K57A 2CT4A 1WPYA 2LQNA 3QYHB 1FRQA 2VZLA 2EBPA 4NOYA 3OS0A 5GV8A 3OFNA 3VS1A 1QP3A 1NDHA 1JRIA 1WDXA 4PABA 2OTLB 3RY8A 2VC8A 5GAMj 3CC4T 3CXCS 2MWOA 2E6ZA 1DJ7B 1I8DA 5AN9A 4XLAA 4J9HA 2QMUA 3PMTA 2EYZA 2QDYB 1N0VC 4YAWA 2C77A 4JPBW 4YELA 2OBSA 1QG0A 2C4TA 1WP6A 1EX4A 1X01A 1KD1U 4OMMA 1JXOA 1ZM4A 2QGFB 1RI0A 2VVKA 3X24B 1M2OA 1KIKA 2ZXIA 3G7ZA 3ZZUA 3FDRA 4K1XA 5CKBA 1C1AA 1KJWA 5I21A 4XQ3A 4PJOF 2VKNA 2O4XB 1Q7YU 1YI2A 2ECZA 1VQ8B 2ZPGB 4AFQC 1K9MR 3DLMA 1M8MA 5CO7A 4FYVB 2CS7A 1R5BA 1W87A 1K73D 2DO3A 4HXJA 4RCBA 2ED0A 4MMLA 3CCRT 3B8HA 2NUTA 2BF4A 2KYMA 4WF2A 4JLGA 3Q38A 4XKWA 4IW3B 4RTZA 3EFOB 5D7UA 5FW9A 3EGDA 4F17A 4E7ZA 1Z9QA 5CKDA 1WHGA 4QVAA 4FCYA 4ZGEB 4EMKB 2JM9A 1YITB 4LDWA 3V7CA 2CYZB 2V7WA 1MV3A 3VV0A 4R56A 2R9VA 2CKKA 2K2MA 4B4DA 2HDAA 4QW2A 1KSWA 1NPPA 2BZYA 4C0GA 2PQWA 3GNGA 2DKGA 4C92G 1Q86C 2DJZA 2LRQA 1VQ5B 1BI1A 1M3CA 4C5EA 4OOVA 2KVOA 3OMCA 2DILA 2PTKA 2YUNA 2C5BA 4F7UA 2QASA 2CREA 3MEWA 2PMDA 2JMCA 2E3HA 2L3SA 4QHYA 3RDVA 5D6YA 3ZBDA 3CCMQ 3CMAT 1YJWT 3AGQA 5KYWB 3R6JA 3ZUGA 4M7DC 4RCYA 1X6BA 4JJCA 1S0UA 3MHXA 1VYUA 4DOWA 4OPOA 4F7UE 4DBRA 2HQEA 2KI7A 1M1KR 2P0QA 3W2EA 3ZBUA 3TEEA 2L3PA 1B3QA 5LJ3g 1WJRA 1UMKA 2XMFA 4PJJA 4EMGA 1KQSB 1QVFS 4P9SA 4RDJA 3JB9G 1Q86R 5FLXE 3QYGB 4HT9A 4OF1A 5GAMf 4RPDA 3CC2T 3MEUA 1M1FA 1FNDA 1D0YA 4ZGQB 4RTYA 3EGXA 1M8VA 4WZLA 4RLZA 3PMIA 1QCNA 2BN4A 1VQOT 2JZ2A 1Q81D 4M7DA 5LJ5g 3OP1A 4FM4B 2LT4A 1U5SA 3G6EB 1GBRA 3TSWA 3CMEQ 1RAHB 2YXYA 5GANh 1IGQA 2DYIA 3FPPA 1SKQA 4PC1A 1JEGA 4M7DE 3CC7A 4BUGA 5B6IA 4IUQA 2OAUA 3QG1A 4XTVA 3JCMf 5GANd 1D3BA 1YJ9T 3ZBTA 2G3RA 2F43A 2K9GA 1IB0A 1VQNB 3EHQA 4PJNA 2XKOC 2LMJA 2A36A 3GNFB 4D8KA 3G4SA 4A54A 2WZNA 1N6AA 2SRCA 1UG1A 7AT1B 4Y9RA 3CCUT 3W5HA 2QQAA 1UJ0A 3BY7A 1M2VB 3DLLA 2V7QA 4QV2A 5GAOr 1SRMA 3CCRQ 3ASPA 4E7LA 3X25B 2D74A 1VQ4Q 1R77A 1YJNT 3OW2P 5CKHA 4C0DB 1F1BB 3A35A 4RD2A 2QQBA 1IXDA 2F5KA 4M1KA 2JS0A 4J9FA 2DVEA 4GLKA 4X9DA 3T51B 1PSFA 3HL8A 4C8QG 3ER0A 5TY0A 3PVLA 1Q95G 1OU9A 1NB0A 1I18A 1UHCA 4Z1MA 3D7SB 5KSWB 1UGQB 2L89A 3MCAA 1PJ6A 5HK0A 1H42A 2JM8A 2CNDA 4LBWA 1R0BG 4X1VA 3FC3A 2KT1A 2ZXHA 4JJBA 2MYSA 3A8JA 2ZZQA 4RJLA 3VO1A 3PUMA 4LD6A 1DG1G 1PJ7A 3CMAQ 3VS0A 1G3YA 4ATOA 2ZPHB 4II1A 1GFDA 3M0PA 1QQJA 4KGVB 4RD0A 3C12A 1K9MU 1C0MA 2XNDA 2Z0WA 3O5ZA 4PJMA 2LC4A 2RJEA 1BJKA 5DS0A 5IYQA 4C5IA 1U2RA 2D3LA 1G7CA 4PAAA 3SDZA 4TN1A 3VYHB 2QTXA 3CC4B 1SKUB 3NMZC 1FX0A 3UPUA 2P3MA 2GF7A 1UGPB 2V8JA 1BCOA 1JJ2A 4ME7A 1K0XA 1N0UA 3OKXA 2PVOB 4HIZA 4X8IA 3DKMA 3M58A 1ZA1B 3ISXA 3L2UA 3N5BB 3CCEQ 2E4HA 2XZLA 1QMCA 4YEJA 2AKLA 4HE6A 3U2QA 5GMKi 2GJPA 2GTOA 2RN8A 3U6BA 1I4K1 4PGOA 3A98A 5I2SA 4D6WA 4ORZA 4HCCA 1Z9ZA 3VS6A 1NEGA 2WYRA 4OPVA 1PKSA 1YP5A 4PC7A 1FXXA 3CD6B 5M9OA 2DYBA 5KYXA 1YJ9Q 2RQVA 1WOPA 3INZA 1COWA 5LJ3j 3PIOA 2PUKB 1N9SA 1V0FA 2ZZGA 3BCDA 1BLIA 4XQFA 2X9HA 3GVLA 2NWMA 3VYGA 3RR6A 1QUFA 2Q6IA 2X3UA 3REAB 3CCUQ 4QQDA 1Y0RA 1YFNA 3H0FA 3JB9H 2H3JA 3CCLT 3VS4A 5LJ5j 1S72T 4OB3B 2EYWA 1V76A 1Q86U 1MNEA 4C92C 1AWXA 3AVTA 2H8HA 4TMWA 4YAOA 1M4ZA 1QGZA 1W9XA 4Z4VA 2QDXA 1UD2A 2DEQA 3G71Q 1WX6A 4ZNXA 4XLHA 3MKDA 4PLLA 2LX7A 2IPOB 1BU1A 5FA6A 1VQKT 1WI7A 2B86A 4J7IA 2CF4A 2NUPA 4K11A 4ZTJA 4DBQA 2LZJA 4XLCA 1JJ2S 3BCFA 1QW1A 4OB0B 1QVGA 2EQJA 2RHXA 4B9XA 1HVXA 4OP7A 2D8HA 4X7DA 1FYNA 4C92A 1BQEA 1UGSB 2CP5A 4JLIA 4XU1A 4FIBA 4MMKA 5DY9A 4M78G 4HCZA 1WXUA 3FLGA 4JRQA 2KXCA 1YLOA 5GMKj 3JB9F 4FT4A 2DL5A 1EFTA 2DRKA 2E70A 2OTJT 2PIAA 4WWVA 2XZOA 2B7CA 1N8RD 3CCMA 4C92E 1BIAA 3C4SA 4TSFA 4YHBA 3ASQA 1OV3A 1V0EA 2XG8D 1NBMA 1W1FA 1VA7A 5HZBA 4IUPA 1VQOB 4J9GA 1J9ZA 3M5AA 4XR6A 3RNJA 2RC5A 2MK5A 1K8AR 3DDYA 3E1SA 3CCQB 2JW4A 4MYTA 4J6XA 3EG3A 2L8DA 4LDUA 4C8QD 3OE7A 2JTMA 1Q82D 2KRSA 3BDLA 3AHUA 1KG1A 2OK8A 3L2QA 2Q6LA 3WBJA 3LQEA 1JB0E 2KR3A 2KEAA 3QXEB 4M7AG 3I56Q 4FYWB 1QX4A 3CMEA 1OB0A 5LJ3f 2AHOA 3W5VA 2LTOA 2A3LA 3OA6A 5F4OA 3QZ9B 3UWNA 5IYNA 2K6DA 3L2VA 2BGJA 2VBTA 3I9QA 2LZ6B 3ME9A 4QVZA 2CUBA 1VQ8T 5KCOA 5LJ5e 4PJOG 2VNHA 4GQNA 2K79A 1AVZC 4JDSA 1YHQB 8ATCB 5LJ5f 1LOJA 2M16A 2EFGA 2RB6A 3HP9A 1VQ7T 3W2IA 2ROTA 3VS2A 2GJKA 3PENA 4CC2A 4AF7A 3OB9A 1T3SA 1KQ2A 2E41A 2OYNA 3I1FA 3FEOA 2GQVA 3M0UA 1ZHIA 4C8QF 5IHNA 5BSYA 1WXBA 3MHPA 2GFUA 1Y96A 3PGGA 4B9WA 3OYAA 3VO2A 3CCLQ 3VNVA 1M3BA 1ABQA 1AWJA 4QVJA 3R6KA 5HZAA 1GRIA 2J6OA 3CCRA 4N3NA 3BH4A 3I55B 2DD5A 2XOKA 1VQ4A 1MMGA 2QTZA 1PD1A 4J6YA 4P5NA 3GIRA 4IUTA 3HSBA 3X20B 4BDZA 4EMHA 1X6GA 5GMKe 1VQKQ 1TUGB 4QVDA 3M4YA 4FT2A 3M54A 3JQRA 2QEXB 5H59A 3MP6A 4TVRA 1KQSP 4G1BA 3JCMX 3MEAA 2JOYA 5FWCA 4PKCC 4RUGA 2EJFA 2DEUA 5GAOq 1JBMA 1WSVA 2EIXA 1BI0A 2YUPA 2I1LA 1UGVA 3D26A 2Z6BD 3CCJB 1M3AA 5CDFA 4P1VA 4C8QE 4BI3A 4ZTFA 1RAAB 2OK7A 1NEBA 2VBUA 1KTVA 2OTJQ 2KROA 1WSRA 2CP7A 3A8OB 3CMAA 4C0ZA 1QFJA 1F20A 3FJOA 3A3GA 4DK0A 2FRYA 2CP6A 1MMNA 2LQWA 3QJYA 1SF9A 4ZN3A 5FO0A 3U6KA 3DB3A 2F2VA 2OTLQ 2YRVA 1ZM2A 2RHYA 2ATCB 3G6ET 4J9DA 4V2SA 1BMFA 2QGGA 4PFPA 3QWYA 2CZ7B 2BGIA 1WA7A 1E7OA 2DTOA 1C6VX 4BI4A 5GAN2 1QVFB 2COZA 4OMOA 4GBQA 1GL5A 5A2QE 4KKUA 2V8IA 3WYAA 3M0SA 1UB4A 3W5UA 1XJWB 2P0KA 3UATA 3CCEA 1TUCA 2CDTA 3H41A 2F1MA 1YX2A 4JJDA 2F2WA 2JS2A 1VQ9Q 4J9BA 1W2BS 5KYNA 2QQRA 4HT8A 1WIEA 1OEBA 2YT6A 1QFYA 1QVGP 2BUDA 4ZGDB 2O2OA 2VB6A 4II2A 1OPLA 5LL6S 4BE0A 2HZYA 4Z89A 4Z4ZA 3EGDB 2DM1A 4Z4WA 1YJ9A 3JV3A 5FROA 5D6WA 3CCVQ 2KE9A 5EMNA 1ELOA 1K0SA 2EKOA 2ZPBB 4Z4RA 4A4KA 1BBZA 2CZ6B 1QKXA 1W34A 2EAYA 2VBSA 4N4IA 3ASTA 3KL9A 4F16A 4QUZA 2HEQA 2DD4A 3PE0A 1EWYA 2KSSA 4QQ6A 2CP2A 1YITQ 5GAOp 1ZUYA 2RJDA 2DA9A 1VQ6T 2MCNA 1WHLA 1K8AU 2RF0A 2X4WA 2IVWA 4Y28E 1G2BA 3BNWA 4GLMA 4M78F 5GANe 4M78C 3AT1B 3OYYA 1VQ5Q 3G71A 4M7AD 1MGQA 2C2WA 4PFZA 3TSZA 1K9MD 3L2RA 2FPDA 4DBFA 1WOOA 4Y7CA 4ZN1A 2HKNA 1P4MA 2QN6A 4A4HA 3Q1JA 1YN8A 1RQPA 1UJYA 5IXFA 3OW2A 3RMQA 4HCKA 2WSFE 3FKSA 3RESA 4A63B 2AZSA 1EP3B 3OOCA 2MMPA 5KYYA 3GOXA 1Y7XA 3LH5A 1E3ZA 5L46A 2I0NA 5GAN7 2E1RA 3M59A 1R0CB 3FPKA 1NG2A 3JCMc 1SEMA 2K3YA 1D8TA 1NPRA 2DTHA 2YWWA 4RTTA 4ZCLA 4M78E 3VU3C 4M7AF 1VIEA 1HK9A 4R71A 5HCKA 2XDDA 3E9FA 1VQLT 1UD6A 3G6EQ 1KC8C 4IUVA 1D3BB 1KHCA 2KT8A 1RABB 2EQMA 2MIOA 1BYMA 1H92A 1N08A 1PNJA 1SSHA 2LCSA 1OPKA 2XICA 2YRDA 2K7AA 3GLXA 4P3IA 1H8HA 1G5VA 2NYSA 4JRKA 1Y0YA 3UF4A 1KFZA 1WHJA 4PJOC 3G4SB 1GVHA 5CK9A 1EFCA 3CD6T 1JO8A 2BIVA 5FU7C 1RQRA 1JA1A 2G6FX 1VQNQ 1M1KD 4RG2A 1H85A 3ES9A 2K3XA 4G7XA 5GV7A 4KBMB 4ELZC 1VQ7B 3I56A 5THXA 4RPBA 5A88A 4ROXA 3ZL7C 5AYFA 4CC3A 4E2FB 4MDXA 2HL3A 1KZLA 3Q6QA 4IIOA 1K28D 1UE9A 1D1BA 2X0KA 4RMOA 4XTXA 1KC8R 5F4MA 4BDYA 4PJOA 2V7XA 4M7AE 4FYYB 3JRZA 4XONA 4RKUE 2RHUA 1B2RA 1AOJA 1EXMA 4ZCIA 3VUBA 4OMQA 2QA4B 1A8PA 3X26B 3OW2S 1IJEA 3OYEA 2JTEA 3META 4PJOE 1ZSGA 3ZFJA 2PVGB 2ZZFA 2OX7A 4QVCA 1YIJT 3B78A 6AT1B 1E79A 2DIEA 4XM3A 4ASUA 2L2PA 1K73C 4AC9A 3THKA 1BX1A 4F04B 1ZUNB 2DY1A 3S3OA 3CPWP 3FIFA 2RPNA 1UD4A 1QGYA 4BI8B 2RH2A 3LYIA 1V5VA 1TOVA 2RQWA 4BD3A 2EJGA 1Y57A 1VQPA 1XB2A 1GFCA 3RERA 5KYUB 1I1JA 3MPUB 1KJZA 4Z4UA 1WQ7A 1WOSA 2ENMA 5HK3A 4RD6A 3ZZTA 2PNIA 1UHFA 4KULA 4QQGA 1TG0A 1JJ2B 4OMLA 2X35A 1ZUUA 1E63A 3CESA 4R0KA 4X34A 4DOVA 4FWTA 2QE7A 1K73R 4KUIA 1VQMT 5DLQE 2EQUA 3LH0A 2YWGA 3E2UA 3CC4Q 2OTJA 1JB9A 1OX8A 1WFWA 3UDCA 1I07A 1UUEA 4LDVA 3V7SA 3CCQT 1D0ZA 1FNMA 2XGJA 1ZX6A 4LXCA 1M90D 2VUBA 3RKXA 2NV4A 1J3TA 2C78A 1XNIA 2ZCFB 4LBYA 1WORA 1UD5A 3QPHA 4G6IA 2X4XA 4LBVA 3RKYA 2OTLA 3BW1A 2DBKA 4XU0A 2L5QA 2VXFA 4M75B 4GY5A 3OAAA 2DETA 2X8KA 4LBZA 4C43A 4TKOB 1WXTA 3SFMA 1QUEA 1ZSZB 5IHIA 1B23P 3OS2A 2RD1A 3OYHA 4NL2A 3P26A 3SEJA 2XU8A 3OQ5A 1ZBXA 4FW2A 2IIMA 1CNEA 3TCJA 1K76A 4O6JA 3TQ7P 1WGSA 1YHQT 1Q81C 1VQ9A 5A89A 1T0JA 2HBWA 4EMKC 4BPRA 2RQTA 4Z02A 3I5SA 3MMPA 1G3SA 4LUEA 4ZGJB 2M1HA 2FVGA 3A8IA 3NFCA 1IO6A 2EGAA 1VQ6B 4N3GA 3M0TA 1T5EA 1PC0A 4Z8AA 4A4EA 4DQLA 1EP2B 2DL8A 3CCVA 1SHFA 3I55T 1GAWA 5LMZA 1SM4A 1XQHA 1TTHB 1X2KA 2D3NA 2RA2A 3QE2A 2DXUA 5J26A 4EMKA 4MYUA 2LCCA 1ARKA 3NE5B 4J0QA 4YAUA 1YITA 2QEXT 2WSCE 3CCST 2YWEA 3OYIA 3QFRA 4XNFA 1MUZA 2EIFA 4M77B 1YJWQ 1E1QA 2L0AA 3OYCA 4ACBA 3RKWA 2GREA 4RTWA 5GAOl 3BY2A 2KXDA 3E19A 4M75D 4D8DA 4KUDK 1G7TA 1FX7A 2CRVA 4RD1A 5CQYA 2DNUA 1VQ5A 3EG2A 2FX3A 2DIGA 3CCJT 5FNZA 1E3XA 2PU9B 1ZQ1A 2LJ0A 4OGEA 2E64A 5KYWA 1QVFP 3SHWA 3CC2Q 3WNCA 3PA1A 3P8HA 1G8XA 2DTIA 2LP5A 1KC8U 3UA7A 1VQOQ 2PVDB 3SJZA 4KH1B 3SLNA 3OMGA 3NTKA 2X51A 1VQLB 1GBQA 1M27C 3E9GA 2BKDN 1FNBA 2WR8A 2K3BA 4A4GA 1KQSA 3CCQQ 3PA2A 2BZXA 4PC2A 1VF7A 2K2VA 1OULA 2HSEB 2HAXA 4PC3A 3EH2A 3OY9A 5C6SA 2ZTNA 1XOVA 2X4JA 2RJFA 4RCZA 3MEVA 3NHNA 3QUIA 1YI2T 3TU4K 1VHOA 2KK4A 2KGTA 1H641 2VGNA 2P84A 3G6EA 2CK3A 3MP8A 2O01E 1OB2A 2Y90A 2RO0A 1WYXA 3WXMA 1KK0A 3SWNB 4M77D 4FL6A 1AMOA 2XDPA 2RMOA 4PC6A 2DX1A 2RI3A 4N4GA 5GANg 4PK4A 4KGZB 4XTWA 4C0DC 1YHQQ 2Y4YA 3F70A 1VQNA 3T53B 5GAMh 1WPCA 3BDUA 1YJNQ 2O88A 1K8AD 2CP0A 1W2BB 2Q6KA 1AT1B 4Y92A 1UGRB 3OZWA 4F7DA 4ZCMA 3JCMW 3OYNA 1VQ4B 5GAMd 3P27A 5FIUA 1BI2A 3T56B 1GR1A 1E43A 1NJID 1M2VA 2GFAA 1K73U 4X7EA 3ZZ0A 1QH0A 4L6V5 2PLFA 1EZZB 3NPFA 1OZ2A 2HNIA 1YIJB 2QG9B 1S1NA 4G1VA 2HQHA 3LO8A 1TS9A 5F4JA 2J06A 2BZ8A 4PNOA 3C0CA 2ROLA 3H0IA 3WVDB 4HE5A 2LDMA 3SLDA 3CQTA 5E6TA 3GPLA 2XNJA 4C0FA 3G1JA 1QCOA 1LJOA 3JCMh 5HY6A 3VRZA 3BY1A 4M77F 2FEIA 1I5LA 1PRLC 1BIBA 3EHRA 2J6FA 3OYLA 3OSSC 4J5YA 2BE7D 1NLPC 2WZPP 2CP3A 4E6RA 4YAFA 3BC9A 3JCMd 4PJLA 2DXCA 2O31A 4CI0C 1NRKA 2OAWA 4P6YA 4B47A 1YNZA 3OS5A 3M0QA 3JQPA 3FJPA 5EC7A 1OX9A 1GAQA 4FK8A 3QJ6A 1JXMA 5ECAA 1H8EA 4C0SA 2B5OA 4HA8A 1U06A 1VYVA 3CCJQ 1QP2A 2B8AA 4ZV4A 4XK8E 2DPPB 3EFRA 2GQFA 4DNRB 1VQMB 4QKUA 3FJ5A 5FU6B 2X4YA 2ZL7A 1UEBA 3RBBB 4OOSA 1VHEA 1KD1D 1G7SA 4QFMA 2CUDA 3X28B 1G7RA 4EPCA 3V76A 3WNBA 2VNJA 2RQRA 2M0YA 4Z88A 1DDIA 3LNNA 1TUIA 5I11A 2HL5C 1Q7YD 4P12A 8AT1B 5GMKl 4YXWA 4Y91A 3AVXA 4ACAA 3HRSA 4XN0A 3M53A 3CC4A 2DERA 1OI1A 1B34A 3GBQA 2K5IA 2BPOA 4AFZC 4KGXB 2B7BA 3CXCB 4E47A 1N8RC 3HFOA 3ASRA 5IHKA 3SB2A 3G4ST 3QDRB 2HSPA 1WHKA 1QGAA 2P4RA 1FDRA 4DBHA 4XN3A 2JJ9A 1FRNA 2JVVA 2F69A 5CVIA 3JB9J 2KDSA 3LWHA 4XLFA 1D1NA 4EH1A 2F4NA 2CSIA 4LN2A 5CKFA 1TU0B 4XORA 2BMWA 1YCSB 1AZGB 1QVGS 3PT9A 2C4UA 2EVRA 2V7VA 1JA0A 2YSQA 4C8QC 2VNKA 2KVQG 1Q82C 2WPDA 1S72Q 2EYQA 1KMHA 2OI3A 2ABLA 2QTLA 2R58A 1IRXA 3I5RA 2QA4T 1N8RR 2YLBA 4TMTA 1CKAA 2JN9A 2VXEA 3L2WA 4LDXA 1WU8A 4XTZA 3WY9A 4UC4A 1RAEB 1T6YA 2V31A 4P22A 4VUBA 1NB9A 1PD0A 3CCSB 2XK0A 1MHNA 4C8QA 1TLLA 5L23A 1FWZA 1VLYA 5IK2A 3JCMP 2DZ9A 1MRZA 1WTHD 2VWFA 3A8LB 3OW2B 3URGA 3KFVA 1Q82R 5GANj 4FSXA 5GAN6 4E7IA 3OW7A 1WNLA 5D6XA 1QCFA 4UZFA 1MMAA 1E6GA 1UTIA 1HA3A 2LQKA 2DXBA 2CC2A 1SSFA 1YJWA 4RM0A 2L3RA 4JS4A 2E10A 5CCAA 3JCMV 2AIRB 2YUOA 3TVTA 1W70A 4M7DG 1DDGA 3EFSA 4B48A 2EFIA 3R6OA 3UT1A 3WNDA 3LVBA 1X43A 3ZPNA 5GAN4 3W2GA 1KRHA 3OBYA 3CC2A 3CPWA 1Y71A 3PFSA 5EG2A 3VMFA 3J81k 1T0HA 1GCPA 1VQOA 1YI2B 2P4TA 5KCHA 2BE9B 2E5KA 3PNWC 2EW3A 4L59A 4MZMA 1PKVA 2ESWA 2J05A 4PL6A 2J6KA 4X05A 2NUTB 3G4SQ 1K4US 1BKBA 1OHHA 2RJCA 3C94A 1LVKA 1VQ8Q 2ZL6A 2AT1B 5CAIA 4YALA 1H8KA 2DF6A 4WTOB 5BSXA 3V7RA 2M51A 3CMMA 1VQ7Q 4OMFB 5IAYA 3CBOA 1OQKA 3JU4A 3LQ6A 3LLRA 4LNPA 2FG0A 3M4GA 5FU7B 5C0MA 2D0QB 4OB1B 2Q6OA 3HFNA 3EG9A 3CCUA 2A37A 4BACA 3HRTA 1V29B 2K5LA 2V4DA 1BX0A 4ANJA 4NS5A 1YHQA 4BY6C 3ZIAA 1IHWA 4F7UB 2QA4Q 2VJIA 1YJNA 2LX9A 1ZBJA 1QVPA 2E6NA 2PE3A 2YWHA 3A8MB 3MO8A 1IHMA 5IYPA 1R5NA 3RMSA 1ACMB 2RQUA 4DNTB 2XD0A 4KKSA 2E1HA 2GNCA 1BCMA 2COWA 2RHZA 3EGUA 5LJ3h 5GANf 4KKTA 1PKTA 3WBKA 4FYXB 1MMDA 1VQPB 1PM3A 5LJ3d 5GAN5 1YWPA 2DL3A 2X3WD 2LCLA 3CPWS 2QQ9A 5CR2A 1XQBA 1NE8A 3QHSA 3VUZA 4P6VF 2ZAEA 3RUXA 2JT4A 3CBPA 5LJ5h 3EGXB 3JB9I 4A4FA 2HDNB 4FW1A 4Q7JB 3AVYA 4M78A 4XOTA 1XTDA 1AD5A 4M7DB 1EFRA 2FPEA 3CEYA 3EAEA 3JCMQ 3A5ZB 4RD4A 2EWNA 2EKHA 2GTJA 2M5SA 3U23A 1OGJA 3BFMA 3A3BA 2JN0A 4B44A 3CCJA 3OYKA 3GIBA 1VOMA 2FB7A 5GAOm 2GQIA 1PRMC 4M7AC 2J7IA 3CC7B 1W6XA 4WCIA 1IB8A 2YUQA 2F5TX 4HCBA 1K9MC 1N8RU 2YLCA 1IREB 1IZ6A 3OEEA 4P25A 3PIPA 1ZM9A 3L2ZA 3CMET 1NBEB 1TTTA 1M5Q1 2RK2A 2W10A 4DQ2A 3GVJA 3OJWA 4XTUA 5GMKh 2JXBA 5HKCA 3GSIA 3OJXA 1PSEA 2FZCB 3QZ5B 4FN5A 4M75G 1HSQA 1PCXA 5AT1B 3E1YE 1YBYA 4R55A 3EH1A 1LCKA 2LT1A 2CH4W 3L1AA 1PWTA 1W2BP 2DLPA 1VQ9B 2FPFA 2JDIA 4B43A 4M7AA 5A0GA 4M0LA 1QVFA 1Q86D 1Q82U 3HKSA 2WSSA 1VJSA 1D09B 1QWEA 2MWPA 1G83A 3SJPA 2RNAA 2P0PA 4XMYA 1GJRA 3JSCA 1I81A 3QFSA 3H8ZA 4DQKA 2W6JA 1WJQA 3QKJA 1UD3A 3GQBA 1N07A 2QK0A 2ZZDA 1U1SA 4M7DD 4DEYA 3CCVB 1NLOC 1VQ4T 2WJYA 3SEMA 2O9VA 4F7UF 4BE1A 3SKBA
chains in the Genus database with same CATH topology
2DYIA 2DOGA 2QGGA 3A1PA 3H9NA 2F1LA 1PM3A 3HTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYI A;  2DOG A;  2QGG A;  3A1P A;  3H9N A;  2F1L A;  1PM3 A;  3HTR A; 
#chains in the Genus database with same CATH topology
 2DBM A;  3MCA B;  1VQ6 Q;  3CCL A;  1CNF A;  2C5H A;  4X0C A;  1S72 A;  4IUR A;  4G7W A;  4AT1 B;  2Y4X A;  5A0D A;  1M1K C;  2HMA A;  1RAC B;  4QT7 A;  3P8B B;  1N05 A;  2QI2 A;  2D8J A;  5I2M A;  4RD3 A;  3EG1 A;  4LDY A;  5A8A A;  4RCC A;  1VQK A;  5CQX A;  4M77 G;  3KEW A;  3GF5 A;  4BE2 A;  1KK3 A;  2KQW A;  2ZL5 A;  1FMK A;  1TUD A;  2E12 A;  1I7P A;  2C06 A;  1LPL A;  2BSA A;  2KAF A;  2FYK A;  3SD4 A;  2JMA A;  2KYB A;  2X53 S;  3ASS A;  4M7D F;  3CP8 A;  3HAG A;  3B82 A;  1UDL A;  1WHM A;  3V7A A;  4UZU A;  3QII A;  3VS5 A;  2E1B A;  2GK6 A;  1CQX A;  1OZ3 A;  1ZUK A;  1T6X A;  1TWB A;  1KQ1 A;  2OBR A;  2R5M A;  4Z4S A;  4KT0 E;  1IHV A;  5GAM e;  4UZE A;  4RDK A;  5J39 A;  4IIM A;  3CXC P;  2LQ8 A;  1MND A;  4JZ3 A;  4RG8 A;  1VLO A;  5IT9 E;  2DAQ A;  3V8J A;  1M1G A;  4OMP A;  4OGC A;  2XI9 A;  3M9Q A;  1VQL Q;  2FO0 A;  3EG0 A;  1RAG B;  2F1L A;  2IG0 A;  1KK1 A;  4EIK A;  4ESR A;  5KYX B;  3CCE T;  4Z4Y A;  3W2H A;  4WZT A;  4J8O A;  1NYG A;  2A28 A;  5DLO A;  2CZ1 B;  1AWO A;  2FHD A;  1BPL A;  1OGI A;  1G3W A;  4P3Y A;  3WXM B;  3M56 A;  3A8K A;  4B3F X;  3JCM e;  3CD6 Q;  2E3I A;  1O75 A;  1X75 C;  1ZM3 A;  1CSK A;  1GXI E;  2HD0 A;  2JIZ A;  3VS7 A;  1E62 A;  1HJD A;  3LGL A;  1X69 A;  3NGP A;  2KNB B;  1W4S A;  4J6W A;  3QSU A;  1TVC A;  2ZPE B;  3AVU A;  5GMK m;  4MZP A;  3WQZ A;  1OU8 A;  2O4X A;  1PHT A;  2ZGW A;  3Q6R A;  1VQ8 A;  1X6O A;  1U1T A;  1M90 C;  1RAD B;  3KBG A;  4XU2 A;  3S3M A;  2LJ3 A;  1VQ7 A;  2W6I A;  2DL7 A;  2NUP B;  4Z4T A;  2BV3 A;  4XAX B;  4ELY C;  3HHT B;  2QDL A;  4HKE A;  3A1P A;  3ZEH A;  1B07 A;  3EFO A;  1QVG B;  2KRM A;  2D0N A;  1H3H A;  4EDU A;  4C92 B;  4B3G A;  1E6H A;  3J80 E;  3G71 T;  4AF6 A;  4O5V A;  4JUV A;  4WQM A;  1Q81 R;  1YIJ Q;  1YWO A;  3WVE B;  2QAZ A;  2RM4 A;  4MDW A;  1WDT A;  3VKI A;  2D1X A;  1RI9 A;  2O9S A;  1TH7 A;  1T6Z A;  3CTA A;  2QA4 A;  1K9A A;  2HCK A;  3O8V A;  4E7K A;  1AZE A;  4IKF A;  4KH0 B;  4J9C A;  3OBW A;  3GVK A;  5IXB A;  1D1A A;  3CCM B;  5GAN 8;  2V26 A;  3CPF A;  1R5O A;  1AHJ B;  1B7T A;  2KRN A;  5DN6 A;  2ED1 A;  1M90 R;  1RLP C;  3MJX A;  5FWB A;  3OZU A;  3GP8 A;  1M30 A;  5FL7 A;  2MPX C;  2VAS A;  3OPO A;  4X06 A;  2MF2 A;  4OOX A;  3MP1 A;  2WSE E;  3AVW A;  2LNH B;  3CP2 A;  3QBY A;  4OB2 B;  4J83 A;  2JUF A;  1KK7 A;  3LGF A;  4HVV A;  2FRW A;  2NLU A;  3VRY A;  2HLD A;  2HBP A;  1SG5 A;  4TMX A;  5CIU A;  4XU3 A;  3J7A F;  4E7H A;  1PG5 B;  4X9C A;  1VQM Q;  2H3E B;  2X6X A;  1OOT A;  3J81 E;  5KYU A;  1S4M A;  1JQQ A;  3HPW A;  1ABO A;  1F60 A;  4Q5W A;  2DZC A;  3OYD A;  4JZ4 A;  3BE3 A;  3P8D A;  2F2X A;  3CPX A;  2EPD A;  3CME B;  3CW2 A;  4HVW A;  3ULR B;  1KK2 A;  4FXU A;  1B34 B;  1AIP A;  1SKY B;  4B6M A;  4M75 F;  2GJR A;  1EFN A;  2EYX A;  4M75 C;  2CT3 A;  4FSS A;  1A0N B;  4XLE A;  2XEX A;  3H0H A;  4TMV A;  1ZSZ C;  3OYG A;  2R57 A;  4E7S A;  2AKK A;  1N06 A;  4C92 D;  2XDB A;  2NUZ A;  3OYM A;  3KUF A;  3OSV A;  4JJN K;  2DVJ A;  5IN1 A;  4MZT A;  3I56 T;  4TMZ A;  1X27 A;  2M02 A;  4AFU C;  3LW5 E;  9ATC B;  3HRU A;  1VUB A;  2VJJ A;  4M4S A;  5TR9 A;  3JCM J;  1P92 A;  2XID A;  1EIF A;  1Y96 B;  2FZG B;  3UA6 A;  3CBM A;  2I2L A;  2K5F A;  2YRC A;  2QQS A;  4KRT A;  3JQQ A;  4M75 A;  3VNU A;  2XHC A;  2DFU A;  2RI2 A;  4L8J A;  3CCR B;  2WAC A;  1ZSZ A;  1FNC A;  3OEH A;  1ZLM A;  4DA4 A;  3AGP A;  4AG1 C;  3FB9 A;  1GCQ C;  2HCJ B;  5I22 A;  3PVQ A;  1UEC A;  4IUU A;  1RL2 A;  4N0A C;  1E1R A;  1M1K U;  3QFC A;  1HD3 A;  1BK2 A;  1U3O A;  4M75 E;  1HZE A;  2JJ2 A;  2COY A;  3JB9 D;  2ZZE A;  1NM7 A;  2RI5 A;  2BTT A;  3I55 Q;  1I8F A;  4OVA A;  4C92 F;  3OS1 A;  5IYW A;  4C5G A;  4C8Q B;  4FU6 A;  1RUW A;  3Q3A A;  4J9E A;  3R6N A;  2MOX A;  1XFO A;  1FMW A;  4M77 C;  4LD9 K;  3CRZ A;  2QEX Q;  2C0O A;  1VQ6 A;  3CCS Q;  2AK5 A;  4Y9U A;  5KW9 A;  3ONU A;  1V1C A;  1GCQ A;  1G3T A;  4YTL A;  4NNJ A;  1KQS S;  3OYJ A;  1VQP T;  4N0A A;  1Y0M A;  2VYT A;  1AEY A;  3ASK A;  3CMA B;  1YJW B;  1K8A C;  3H94 A;  3NTI A;  4OPS A;  5JBQ A;  3QDF A;  3TRE A;  3VJP A;  3OYF A;  2ZPF B;  4L5G A;  1NZ9 A;  1NJI C;  4PLI A;  4AVZ A;  4JRI A;  2EYY A;  2MAM A;  1RLQ C;  4M77 A;  2PUO B;  2QXF A;  1W35 A;  2DK3 A;  1PJ5 A;  3V8K A;  4M53 A;  5DSZ A;  4U9U A;  2A08 A;  4RDL A;  3T9N A;  2GK7 A;  1BI3 A;  2HKQ B;  3CC2 B;  2PZ1 A;  3HTR A;  3CPW B;  4XL9 A;  3IQL A;  2CW5 A;  1QKW A;  1U8R A;  2KY9 A;  4RTX A;  4M77 E;  3CC7 T;  2A7Y A;  2BM0 A;  3CCE B;  1I0C A;  5FRN A;  2BM1 A;  4LUD A;  4P2N A;  4C5H A;  2NPF A;  2OTL T;  2DXT A;  4HVU A;  5KE2 A;  2D9T A;  4P26 A;  2GPJ A;  2AHJ B;  1JNY A;  3M0R A;  1BB9 A;  2JTF A;  1E64 A;  5IYR A;  4N4H A;  5J3B A;  2GCX A;  1YI2 Q;  1Q81 U;  1FMV A;  1NJI R;  1VQL A;  1K1Z A;  1RAF B;  3SWN C;  5LJ3 e;  3W2F A;  1YJ9 B;  2OJ2 A;  3LWI A;  4PFO A;  5HKK A;  5GJW B;  4AG2 C;  2RK1 A;  1EFU A;  2YDL A;  1VQ9 T;  2DL4 A;  1KD1 C;  2JNG A;  4CC4 B;  2JJ1 A;  2ZIT A;  1M90 U;  1YCY A;  3JAM E;  3CD6 A;  1UD8 A;  4XKV A;  1HYO A;  3EG9 B;  2AZV A;  2DCU A;  3CCU B;  5H5J A;  1Q9S A;  2QYZ A;  5HXB A;  3BQJ A;  2RHI A;  2DOG A;  2LJ1 A;  4OMN A;  1Q7Y C;  4XTY A;  3S6W A;  3REB B;  4CRI A;  3RIR A;  3QFT A;  5TRD A;  2CZ0 B;  1YJN B;  3SWN A;  3CCV T;  2EQI A;  5FRM A;  2YHT A;  1CKB A;  2VV5 A;  2LNV A;  4BB7 A;  4M2L A;  4X7C A;  2VNI A;  3G71 B;  1RAI B;  4X07 A;  1I5O B;  3H6Z A;  4F7U G;  4E0F A;  2FL7 A;  3ONY A;  2DMO A;  1YIT T;  2DRM A;  1KD1 R;  2EGC A;  1OYX A;  1IJF A;  1SPK A;  1W2B A;  5IH2 A;  1LNX A;  1WHH A;  2DJQ A;  5GAM g;  1JJ2 P;  4BY6 B;  4RTV A;  4J7F A;  1O9S A;  5GAN 3;  3S3N A;  5CKE A;  2K4Y A;  1VQ5 T;  3QWX X;  1Q7Y R;  4WZE A;  4JRP A;  1YIJ A;  5KYY B;  3CB4 A;  1VQP Q;  1QFZ A;  5J3O A;  2VBV A;  4M78 B;  4RTU A;  1JU5 C;  3M55 A;  2X85 A;  1R8O B;  4M4Z A;  3NTH A;  4UAJ A;  3KXT A;  3VS3 A;  5FU6 C;  2EJ9 A;  1OB5 A;  2C0I A;  2E65 A;  3OZV A;  2QTV A;  5GJV B;  2BVN A;  3JCM g;  4XOP A;  1N9R A;  2M0O A;  2D9R A;  1H3Z A;  4DK1 A;  4NBS A;  2FZK B;  1QLY A;  5FO1 A;  2DIQ A;  3A8H B;  2EGE A;  2A0F B;  5A0L A;  3PUN A;  1WJS A;  1WZO A;  2FVU A;  5TV2 A;  1DAR A;  1N27 A;  1T3L A;  1VIF A;  3VR6 A;  2CBX A;  1TSF A;  3L42 A;  2WJV A;  4LC0 A;  1Y07 A;  2EQK A;  2GGR A;  3H9N A;  3CC7 Q;  4A53 A;  5KE3 A;  4JMQ A;  4E7J A;  1WLP B;  4H9G A;  1VQM A;  5KH6 A;  4NCN A;  3AVV A;  5DM7 R;  2J7K A;  2V7U A;  2V1R A;  2W0Z A;  3CCQ A;  2ZTG A;  3I56 B;  4AFS C;  2KBT A;  4M7A B;  4TT3 A;  2LVM A;  3LX7 A;  2V7T A;  1GO2 A;  1XE1 A;  3FRN A;  5GAO n;  1ZA2 B;  4JS5 A;  4J9I A;  3ZC3 A;  4AMC A;  2X3X D;  3QO3 A;  1UFF A;  4XD7 A;  3QSY A;  2X6Y A;  1M9S A;  1VQN T;  4PJO B;  5L8R E;  2V8K A;  1IGU A;  3CXC A;  1W0K A;  4WZK A;  4M78 D;  4II3 A;  3JCM b;  1MAB A;  2CSQ A;  2KMT A;  2E5Q A;  2X6W A;  1VYT A;  2ZPI B;  2SEM A;  3A8G B;  1EP1 B;  3CCL B;  2DE0 X;  1S72 B;  3Q39 A;  3OYB A;  4B3X A;  1SRL A;  2L3Q A;  4DEX A;  4ZGN B;  1D2E A;  1WQW A;  4CC7 A;  1HXD A;  2R6H A;  4CQJ A;  3G05 A;  2MI6 A;  1D1C A;  2GBQ A;  2ZBV A;  2VGM A;  1SHG A;  2XZP A;  2C0T A;  1MV0 B;  2CGH A;  1NYF A;  2R5A A;  3C95 A;  3V8L A;  5KNL A;  1VQK B;  3I55 A;  3DB4 A;  4OP0 A;  2RC6 A;  1D0X A;  3M57 A;  4NL3 A;  1X2Q A;  2YWF A;  3CCM T;  2XNC A;  4X7F A;  1NJI U;  2V1Q A;  3PVD A;  1N5Z A;  2VYQ A;  1KHI A;  2M9U A;  2QEX A;  2HQX A;  3CCS A;  4G5G A;  1KC8 D;  2CH4 A;  3I35 A;  2ZBU A;  1QWF A;  5J35 A;  4LE9 A;  5LJ5 d;  2OTJ B;  3PTA A;  1W0J A;  2OBT A;  4F14 A;  2D6F A;  1AWW A;  1TXQ A;  4PJO D;  3E20 A;  2K57 A;  2CT4 A;  1WPY A;  2LQN A;  3QYH B;  1FRQ A;  2VZL A;  2EBP A;  4NOY A;  3OS0 A;  5GV8 A;  3OFN A;  3VS1 A;  1QP3 A;  1NDH A;  1JRI A;  1WDX A;  4PAB A;  2OTL B;  3RY8 A;  2VC8 A;  5GAM j;  3CC4 T;  3CXC S;  2MWO A;  2E6Z A;  1DJ7 B;  1I8D A;  5AN9 A;  4XLA A;  4J9H A;  2QMU A;  3PMT A;  2EYZ A;  2QDY B;  1N0V C;  4YAW A;  2C77 A;  4JPB W;  4YEL A;  2OBS A;  1QG0 A;  2C4T A;  1WP6 A;  1EX4 A;  1X01 A;  1KD1 U;  4OMM A;  1JXO A;  1ZM4 A;  2QGF B;  1RI0 A;  2VVK A;  3X24 B;  1M2O A;  1KIK A;  2ZXI A;  3G7Z A;  3ZZU A;  3FDR A;  4K1X A;  5CKB A;  1C1A A;  1KJW A;  5I21 A;  4XQ3 A;  4PJO F;  2VKN A;  2O4X B;  1Q7Y U;  1YI2 A;  2ECZ A;  1VQ8 B;  2ZPG B;  4AFQ C;  1K9M R;  3DLM A;  1M8M A;  5CO7 A;  4FYV B;  2CS7 A;  1R5B A;  1W87 A;  1K73 D;  2DO3 A;  4HXJ A;  4RCB A;  2ED0 A;  4MML A;  3CCR T;  3B8H A;  2NUT A;  2BF4 A;  2KYM A;  4WF2 A;  4JLG A;  3Q38 A;  4XKW A;  4IW3 B;  4RTZ A;  3EFO B;  5D7U A;  5FW9 A;  3EGD A;  4F17 A;  4E7Z A;  1Z9Q A;  5CKD A;  1WHG A;  4QVA A;  4FCY A;  4ZGE B;  4EMK B;  2JM9 A;  1YIT B;  4LDW A;  3V7C A;  2CYZ B;  2V7W A;  1MV3 A;  3VV0 A;  4R56 A;  2R9V A;  2CKK A;  2K2M A;  4B4D A;  2HDA A;  4QW2 A;  1KSW A;  1NPP A;  2BZY A;  4C0G A;  2PQW A;  3GNG A;  2DKG A;  4C92 G;  1Q86 C;  2DJZ A;  2LRQ A;  1VQ5 B;  1BI1 A;  1M3C A;  4C5E A;  4OOV A;  2KVO A;  3OMC A;  2DIL A;  2PTK A;  2YUN A;  2C5B A;  4F7U A;  2QAS A;  2CRE A;  3MEW A;  2PMD A;  2JMC A;  2E3H A;  2L3S A;  4QHY A;  3RDV A;  5D6Y A;  3ZBD A;  3CCM Q;  3CMA T;  1YJW T;  3AGQ A;  5KYW B;  3R6J A;  3ZUG A;  4M7D C;  4RCY A;  1X6B A;  4JJC A;  1S0U A;  3MHX A;  1VYU A;  4DOW A;  4OPO A;  4F7U E;  4DBR A;  2HQE A;  2KI7 A;  1M1K R;  2P0Q A;  3W2E A;  3ZBU A;  3TEE A;  2L3P A;  1B3Q A;  5LJ3 g;  1WJR A;  1UMK A;  2XMF A;  4PJJ A;  4EMG A;  1KQS B;  1QVF S;  4P9S A;  4RDJ A;  3JB9 G;  1Q86 R;  5FLX E;  3QYG B;  4HT9 A;  4OF1 A;  5GAM f;  4RPD A;  3CC2 T;  3MEU A;  1M1F A;  1FND A;  1D0Y A;  4ZGQ B;  4RTY A;  3EGX A;  1M8V A;  4WZL A;  4RLZ A;  3PMI A;  1QCN A;  2BN4 A;  1VQO T;  2JZ2 A;  1Q81 D;  4M7D A;  5LJ5 g;  3OP1 A;  4FM4 B;  2LT4 A;  1U5S A;  3G6E B;  1GBR A;  3TSW A;  3CME Q;  1RAH B;  2YXY A;  5GAN h;  1IGQ A;  2DYI A;  3FPP A;  1SKQ A;  4PC1 A;  1JEG A;  4M7D E;  3CC7 A;  4BUG A;  5B6I A;  4IUQ A;  2OAU A;  3QG1 A;  4XTV A;  3JCM f;  5GAN d;  1D3B A;  1YJ9 T;  3ZBT A;  2G3R A;  2F43 A;  2K9G A;  1IB0 A;  1VQN B;  3EHQ A;  4PJN A;  2XKO C;  2LMJ A;  2A36 A;  3GNF B;  4D8K A;  3G4S A;  4A54 A;  2WZN A;  1N6A A;  2SRC A;  1UG1 A;  7AT1 B;  4Y9R A;  3CCU T;  3W5H A;  2QQA A;  1UJ0 A;  3BY7 A;  1M2V B;  3DLL A;  2V7Q A;  4QV2 A;  5GAO r;  1SRM A;  3CCR Q;  3ASP A;  4E7L A;  3X25 B;  2D74 A;  1VQ4 Q;  1R77 A;  1YJN T;  3OW2 P;  5CKH A;  4C0D B;  1F1B B;  3A35 A;  4RD2 A;  2QQB A;  1IXD A;  2F5K A;  4M1K A;  2JS0 A;  4J9F A;  2DVE A;  4GLK A;  4X9D A;  3T51 B;  1PSF A;  3HL8 A;  4C8Q G;  3ER0 A;  5TY0 A;  3PVL A;  1Q95 G;  1OU9 A;  1NB0 A;  1I18 A;  1UHC A;  4Z1M A;  3D7S B;  5KSW B;  1UGQ B;  2L89 A;  3MCA A;  1PJ6 A;  5HK0 A;  1H42 A;  2JM8 A;  2CND A;  4LBW A;  1R0B G;  4X1V A;  3FC3 A;  2KT1 A;  2ZXH A;  4JJB A;  2MYS A;  3A8J A;  2ZZQ A;  4RJL A;  3VO1 A;  3PUM A;  4LD6 A;  1DG1 G;  1PJ7 A;  3CMA Q;  3VS0 A;  1G3Y A;  4ATO A;  2ZPH B;  4II1 A;  1GFD A;  3M0P A;  1QQJ A;  4KGV B;  4RD0 A;  3C12 A;  1K9M U;  1C0M A;  2XND A;  2Z0W A;  3O5Z A;  4PJM A;  2LC4 A;  2RJE A;  1BJK A;  5DS0 A;  5IYQ A;  4C5I A;  1U2R A;  2D3L A;  1G7C A;  4PAA A;  3SDZ A;  4TN1 A;  3VYH B;  2QTX A;  3CC4 B;  1SKU B;  3NMZ C;  1FX0 A;  3UPU A;  2P3M A;  2GF7 A;  1UGP B;  2V8J A;  1BCO A;  1JJ2 A;  4ME7 A;  1K0X A;  1N0U A;  3OKX A;  2PVO B;  4HIZ A;  4X8I A;  3DKM A;  3M58 A;  1ZA1 B;  3ISX A;  3L2U A;  3N5B B;  3CCE Q;  2E4H A;  2XZL A;  1QMC A;  4YEJ A;  2AKL A;  4HE6 A;  3U2Q A;  5GMK i;  2GJP A;  2GTO A;  2RN8 A;  3U6B A;  1I4K 1;  4PGO A;  3A98 A;  5I2S A;  4D6W A;  4ORZ A;  4HCC A;  1Z9Z A;  3VS6 A;  1NEG A;  2WYR A;  4OPV A;  1PKS A;  1YP5 A;  4PC7 A;  1FXX A;  3CD6 B;  5M9O A;  2DYB A;  5KYX A;  1YJ9 Q;  2RQV A;  1WOP A;  3INZ A;  1COW A;  5LJ3 j;  3PIO A;  2PUK B;  1N9S A;  1V0F A;  2ZZG A;  3BCD A;  1BLI A;  4XQF A;  2X9H A;  3GVL A;  2NWM A;  3VYG A;  3RR6 A;  1QUF A;  2Q6I A;  2X3U A;  3REA B;  3CCU Q;  4QQD A;  1Y0R A;  1YFN A;  3H0F A;  3JB9 H;  2H3J A;  3CCL T;  3VS4 A;  5LJ5 j;  1S72 T;  4OB3 B;  2EYW A;  1V76 A;  1Q86 U;  1MNE A;  4C92 C;  1AWX A;  3AVT A;  2H8H A;  4TMW A;  4YAO A;  1M4Z A;  1QGZ A;  1W9X A;  4Z4V A;  2QDX A;  1UD2 A;  2DEQ A;  3G71 Q;  1WX6 A;  4ZNX A;  4XLH A;  3MKD A;  4PLL A;  2LX7 A;  2IPO B;  1BU1 A;  5FA6 A;  1VQK T;  1WI7 A;  2B86 A;  4J7I A;  2CF4 A;  2NUP A;  4K11 A;  4ZTJ A;  4DBQ A;  2LZJ A;  4XLC A;  1JJ2 S;  3BCF A;  1QW1 A;  4OB0 B;  1QVG A;  2EQJ A;  2RHX A;  4B9X A;  1HVX A;  4OP7 A;  2D8H A;  4X7D A;  1FYN A;  4C92 A;  1BQE A;  1UGS B;  2CP5 A;  4JLI A;  4XU1 A;  4FIB A;  4MMK A;  5DY9 A;  4M78 G;  4HCZ A;  1WXU A;  3FLG A;  4JRQ A;  2KXC A;  1YLO A;  5GMK j;  3JB9 F;  4FT4 A;  2DL5 A;  1EFT A;  2DRK A;  2E70 A;  2OTJ T;  2PIA A;  4WWV A;  2XZO A;  2B7C A;  1N8R D;  3CCM A;  4C92 E;  1BIA A;  3C4S A;  4TSF A;  4YHB A;  3ASQ A;  1OV3 A;  1V0E A;  2XG8 D;  1NBM A;  1W1F A;  1VA7 A;  5HZB A;  4IUP A;  1VQO B;  4J9G A;  1J9Z A;  3M5A A;  4XR6 A;  3RNJ A;  2RC5 A;  2MK5 A;  1K8A R;  3DDY A;  3E1S A;  3CCQ B;  2JW4 A;  4MYT A;  4J6X A;  3EG3 A;  2L8D A;  4LDU A;  4C8Q D;  3OE7 A;  2JTM A;  1Q82 D;  2KRS A;  3BDL A;  3AHU A;  1KG1 A;  2OK8 A;  3L2Q A;  2Q6L A;  3WBJ A;  3LQE A;  1JB0 E;  2KR3 A;  2KEA A;  3QXE B;  4M7A G;  3I56 Q;  4FYW B;  1QX4 A;  3CME A;  1OB0 A;  5LJ3 f;  2AHO A;  3W5V A;  2LTO A;  2A3L A;  3OA6 A;  5F4O A;  3QZ9 B;  3UWN A;  5IYN A;  2K6D A;  3L2V A;  2BGJ A;  2VBT A;  3I9Q A;  2LZ6 B;  3ME9 A;  4QVZ A;  2CUB A;  1VQ8 T;  5KCO A;  5LJ5 e;  4PJO G;  2VNH A;  4GQN A;  2K79 A;  1AVZ C;  4JDS A;  1YHQ B;  8ATC B;  5LJ5 f;  1LOJ A;  2M16 A;  2EFG A;  2RB6 A;  3HP9 A;  1VQ7 T;  3W2I A;  2ROT A;  3VS2 A;  2GJK A;  3PEN A;  4CC2 A;  4AF7 A;  3OB9 A;  1T3S A;  1KQ2 A;  2E41 A;  2OYN A;  3I1F A;  3FEO A;  2GQV A;  3M0U A;  1ZHI A;  4C8Q F;  5IHN A;  5BSY A;  1WXB A;  3MHP A;  2GFU A;  1Y96 A;  3PGG A;  4B9W A;  3OYA A;  3VO2 A;  3CCL Q;  3VNV A;  1M3B A;  1ABQ A;  1AWJ A;  4QVJ A;  3R6K A;  5HZA A;  1GRI A;  2J6O A;  3CCR A;  4N3N A;  3BH4 A;  3I55 B;  2DD5 A;  2XOK A;  1VQ4 A;  1MMG A;  2QTZ A;  1PD1 A;  4J6Y A;  4P5N A;  3GIR A;  4IUT A;  3HSB A;  3X20 B;  4BDZ A;  4EMH A;  1X6G A;  5GMK e;  1VQK Q;  1TUG B;  4QVD A;  3M4Y A;  4FT2 A;  3M54 A;  3JQR A;  2QEX B;  5H59 A;  3MP6 A;  4TVR A;  1KQS P;  4G1B A;  3JCM X;  3MEA A;  2JOY A;  5FWC A;  4PKC C;  4RUG A;  2EJF A;  2DEU A;  5GAO q;  1JBM A;  1WSV A;  2EIX A;  1BI0 A;  2YUP A;  2I1L A;  1UGV A;  3D26 A;  2Z6B D;  3CCJ B;  1M3A A;  5CDF A;  4P1V A;  4C8Q E;  4BI3 A;  4ZTF A;  1RAA B;  2OK7 A;  1NEB A;  2VBU A;  1KTV A;  2OTJ Q;  2KRO A;  1WSR A;  2CP7 A;  3A8O B;  3CMA A;  4C0Z A;  1QFJ A;  1F20 A;  3FJO A;  3A3G A;  4DK0 A;  2FRY A;  2CP6 A;  1MMN A;  2LQW A;  3QJY A;  1SF9 A;  4ZN3 A;  5FO0 A;  3U6K A;  3DB3 A;  2F2V A;  2OTL Q;  2YRV A;  1ZM2 A;  2RHY A;  2ATC B;  3G6E T;  4J9D A;  4V2S A;  1BMF A;  2QGG A;  4PFP A;  3QWY A;  2CZ7 B;  2BGI A;  1WA7 A;  1E7O A;  2DTO A;  1C6V X;  4BI4 A;  5GAN 2;  1QVF B;  2COZ A;  4OMO A;  4GBQ A;  1GL5 A;  5A2Q E;  4KKU A;  2V8I A;  3WYA A;  3M0S A;  1UB4 A;  3W5U A;  1XJW B;  2P0K A;  3UAT A;  3CCE A;  1TUC A;  2CDT A;  3H41 A;  2F1M A;  1YX2 A;  4JJD A;  2F2W A;  2JS2 A;  1VQ9 Q;  4J9B A;  1W2B S;  5KYN A;  2QQR A;  4HT8 A;  1WIE A;  1OEB A;  2YT6 A;  1QFY A;  1QVG P;  2BUD A;  4ZGD B;  2O2O A;  2VB6 A;  4II2 A;  1OPL A;  5LL6 S;  4BE0 A;  2HZY A;  4Z89 A;  4Z4Z A;  3EGD B;  2DM1 A;  4Z4W A;  1YJ9 A;  3JV3 A;  5FRO A;  5D6W A;  3CCV Q;  2KE9 A;  5EMN A;  1ELO A;  1K0S A;  2EKO A;  2ZPB B;  4Z4R A;  4A4K A;  1BBZ A;  2CZ6 B;  1QKX A;  1W34 A;  2EAY A;  2VBS A;  4N4I A;  3AST A;  3KL9 A;  4F16 A;  4QUZ A;  2HEQ A;  2DD4 A;  3PE0 A;  1EWY A;  2KSS A;  4QQ6 A;  2CP2 A;  1YIT Q;  5GAO p;  1ZUY A;  2RJD A;  2DA9 A;  1VQ6 T;  2MCN A;  1WHL A;  1K8A U;  2RF0 A;  2X4W A;  2IVW A;  4Y28 E;  1G2B A;  3BNW A;  4GLM A;  4M78 F;  5GAN e;  4M78 C;  3AT1 B;  3OYY A;  1VQ5 Q;  3G71 A;  4M7A D;  1MGQ A;  2C2W A;  4PFZ A;  3TSZ A;  1K9M D;  3L2R A;  2FPD A;  4DBF A;  1WOO A;  4Y7C A;  4ZN1 A;  2HKN A;  1P4M A;  2QN6 A;  4A4H A;  3Q1J A;  1YN8 A;  1RQP A;  1UJY A;  5IXF A;  3OW2 A;  3RMQ A;  4HCK A;  2WSF E;  3FKS A;  3RES A;  4A63 B;  2AZS A;  1EP3 B;  3OOC A;  2MMP A;  5KYY A;  3GOX A;  1Y7X A;  3LH5 A;  1E3Z A;  5L46 A;  2I0N A;  5GAN 7;  2E1R A;  3M59 A;  1R0C B;  3FPK A;  1NG2 A;  3JCM c;  1SEM A;  2K3Y A;  1D8T A;  1NPR A;  2DTH A;  2YWW A;  4RTT A;  4ZCL A;  4M78 E;  3VU3 C;  4M7A F;  1VIE A;  1HK9 A;  4R71 A;  5HCK A;  2XDD A;  3E9F A;  1VQL T;  1UD6 A;  3G6E Q;  1KC8 C;  4IUV A;  1D3B B;  1KHC A;  2KT8 A;  1RAB B;  2EQM A;  2MIO A;  1BYM A;  1H92 A;  1N08 A;  1PNJ A;  1SSH A;  2LCS A;  1OPK A;  2XIC A;  2YRD A;  2K7A A;  3GLX A;  4P3I A;  1H8H A;  1G5V A;  2NYS A;  4JRK A;  1Y0Y A;  3UF4 A;  1KFZ A;  1WHJ A;  4PJO C;  3G4S B;  1GVH A;  5CK9 A;  1EFC A;  3CD6 T;  1JO8 A;  2BIV A;  5FU7 C;  1RQR A;  1JA1 A;  2G6F X;  1VQN Q;  1M1K D;  4RG2 A;  1H85 A;  3ES9 A;  2K3X A;  4G7X A;  5GV7 A;  4KBM B;  4ELZ C;  1VQ7 B;  3I56 A;  5THX A;  4RPB A;  5A88 A;  4ROX A;  3ZL7 C;  5AYF A;  4CC3 A;  4E2F B;  4MDX A;  2HL3 A;  1KZL A;  3Q6Q A;  4IIO A;  1K28 D;  1UE9 A;  1D1B A;  2X0K A;  4RMO A;  4XTX A;  1KC8 R;  5F4M A;  4BDY A;  4PJO A;  2V7X A;  4M7A E;  4FYY B;  3JRZ A;  4XON A;  4RKU E;  2RHU A;  1B2R A;  1AOJ A;  1EXM A;  4ZCI A;  3VUB A;  4OMQ A;  2QA4 B;  1A8P A;  3X26 B;  3OW2 S;  1IJE A;  3OYE A;  2JTE A;  3MET A;  4PJO E;  1ZSG A;  3ZFJ A;  2PVG B;  2ZZF A;  2OX7 A;  4QVC A;  1YIJ T;  3B78 A;  6AT1 B;  1E79 A;  2DIE A;  4XM3 A;  4ASU A;  2L2P A;  1K73 C;  4AC9 A;  3THK A;  1BX1 A;  4F04 B;  1ZUN B;  2DY1 A;  3S3O A;  3CPW P;  3FIF A;  2RPN A;  1UD4 A;  1QGY A;  4BI8 B;  2RH2 A;  3LYI A;  1V5V A;  1TOV A;  2RQW A;  4BD3 A;  2EJG A;  1Y57 A;  1VQP A;  1XB2 A;  1GFC A;  3RER A;  5KYU B;  1I1J A;  3MPU B;  1KJZ A;  4Z4U A;  1WQ7 A;  1WOS A;  2ENM A;  5HK3 A;  4RD6 A;  3ZZT A;  2PNI A;  1UHF A;  4KUL A;  4QQG A;  1TG0 A;  1JJ2 B;  4OML A;  2X35 A;  1ZUU A;  1E63 A;  3CES A;  4R0K A;  4X34 A;  4DOV A;  4FWT A;  2QE7 A;  1K73 R;  4KUI A;  1VQM T;  5DLQ E;  2EQU A;  3LH0 A;  2YWG A;  3E2U A;  3CC4 Q;  2OTJ A;  1JB9 A;  1OX8 A;  1WFW A;  3UDC A;  1I07 A;  1UUE A;  4LDV A;  3V7S A;  3CCQ T;  1D0Z A;  1FNM A;  2XGJ A;  1ZX6 A;  4LXC A;  1M90 D;  2VUB A;  3RKX A;  2NV4 A;  1J3T A;  2C78 A;  1XNI A;  2ZCF B;  4LBY A;  1WOR A;  1UD5 A;  3QPH A;  4G6I A;  2X4X A;  4LBV A;  3RKY A;  2OTL A;  3BW1 A;  2DBK A;  4XU0 A;  2L5Q A;  2VXF A;  4M75 B;  4GY5 A;  3OAA A;  2DET A;  2X8K A;  4LBZ A;  4C43 A;  4TKO B;  1WXT A;  3SFM A;  1QUE A;  1ZSZ B;  5IHI A;  1B23 P;  3OS2 A;  2RD1 A;  3OYH A;  4NL2 A;  3P26 A;  3SEJ A;  2XU8 A;  3OQ5 A;  1ZBX A;  4FW2 A;  2IIM A;  1CNE A;  3TCJ A;  1K76 A;  4O6J A;  3TQ7 P;  1WGS A;  1YHQ T;  1Q81 C;  1VQ9 A;  5A89 A;  1T0J A;  2HBW A;  4EMK C;  4BPR A;  2RQT A;  4Z02 A;  3I5S A;  3MMP A;  1G3S A;  4LUE A;  4ZGJ B;  2M1H A;  2FVG A;  3A8I A;  3NFC A;  1IO6 A;  2EGA A;  1VQ6 B;  4N3G A;  3M0T A;  1T5E A;  1PC0 A;  4Z8A A;  4A4E A;  4DQL A;  1EP2 B;  2DL8 A;  3CCV A;  1SHF A;  3I55 T;  1GAW A;  5LMZ A;  1SM4 A;  1XQH A;  1TTH B;  1X2K A;  2D3N A;  2RA2 A;  3QE2 A;  2DXU A;  5J26 A;  4EMK A;  4MYU A;  2LCC A;  1ARK A;  3NE5 B;  4J0Q A;  4YAU A;  1YIT A;  2QEX T;  2WSC E;  3CCS T;  2YWE A;  3OYI A;  3QFR A;  4XNF A;  1MUZ A;  2EIF A;  4M77 B;  1YJW Q;  1E1Q A;  2L0A A;  3OYC A;  4ACB A;  3RKW A;  2GRE A;  4RTW A;  5GAO l;  3BY2 A;  2KXD A;  3E19 A;  4M75 D;  4D8D A;  4KUD K;  1G7T A;  1FX7 A;  2CRV A;  4RD1 A;  5CQY A;  2DNU A;  1VQ5 A;  3EG2 A;  2FX3 A;  2DIG A;  3CCJ T;  5FNZ A;  1E3X A;  2PU9 B;  1ZQ1 A;  2LJ0 A;  4OGE A;  2E64 A;  5KYW A;  1QVF P;  3SHW A;  3CC2 Q;  3WNC A;  3PA1 A;  3P8H A;  1G8X A;  2DTI A;  2LP5 A;  1KC8 U;  3UA7 A;  1VQO Q;  2PVD B;  3SJZ A;  4KH1 B;  3SLN A;  3OMG A;  3NTK A;  2X51 A;  1VQL B;  1GBQ A;  1M27 C;  3E9G A;  2BKD N;  1FNB A;  2WR8 A;  2K3B A;  4A4G A;  1KQS A;  3CCQ Q;  3PA2 A;  2BZX A;  4PC2 A;  1VF7 A;  2K2V A;  1OUL A;  2HSE B;  2HAX A;  4PC3 A;  3EH2 A;  3OY9 A;  5C6S A;  2ZTN A;  1XOV A;  2X4J A;  2RJF A;  4RCZ A;  3MEV A;  3NHN A;  3QUI A;  1YI2 T;  3TU4 K;  1VHO A;  2KK4 A;  2KGT A;  1H64 1;  2VGN A;  2P84 A;  3G6E A;  2CK3 A;  3MP8 A;  2O01 E;  1OB2 A;  2Y90 A;  2RO0 A;  1WYX A;  3WXM A;  1KK0 A;  3SWN B;  4M77 D;  4FL6 A;  1AMO A;  2XDP A;  2RMO A;  4PC6 A;  2DX1 A;  2RI3 A;  4N4G A;  5GAN g;  4PK4 A;  4KGZ B;  4XTW A;  4C0D C;  1YHQ Q;  2Y4Y A;  3F70 A;  1VQN A;  3T53 B;  5GAM h;  1WPC A;  3BDU A;  1YJN Q;  2O88 A;  1K8A D;  2CP0 A;  1W2B B;  2Q6K A;  1AT1 B;  4Y92 A;  1UGR B;  3OZW A;  4F7D A;  4ZCM A;  3JCM W;  3OYN A;  1VQ4 B;  5GAM d;  3P27 A;  5FIU A;  1BI2 A;  3T56 B;  1GR1 A;  1E43 A;  1NJI D;  1M2V A;  2GFA A;  1K73 U;  4X7E A;  3ZZ0 A;  1QH0 A;  4L6V 5;  2PLF A;  1EZZ B;  3NPF A;  1OZ2 A;  2HNI A;  1YIJ B;  2QG9 B;  1S1N A;  4G1V A;  2HQH A;  3LO8 A;  1TS9 A;  5F4J A;  2J06 A;  2BZ8 A;  4PNO A;  3C0C A;  2ROL A;  3H0I A;  3WVD B;  4HE5 A;  2LDM A;  3SLD A;  3CQT A;  5E6T A;  3GPL A;  2XNJ A;  4C0F A;  3G1J A;  1QCO A;  1LJO A;  3JCM h;  5HY6 A;  3VRZ A;  3BY1 A;  4M77 F;  2FEI A;  1I5L A;  1PRL C;  1BIB A;  3EHR A;  2J6F A;  3OYL A;  3OSS C;  4J5Y A;  2BE7 D;  1NLP C;  2WZP P;  2CP3 A;  4E6R A;  4YAF A;  3BC9 A;  3JCM d;  4PJL A;  2DXC A;  2O31 A;  4CI0 C;  1NRK A;  2OAW A;  4P6Y A;  4B47 A;  1YNZ A;  3OS5 A;  3M0Q A;  3JQP A;  3FJP A;  5EC7 A;  1OX9 A;  1GAQ A;  4FK8 A;  3QJ6 A;  1JXM A;  5ECA A;  1H8E A;  4C0S A;  2B5O A;  4HA8 A;  1U06 A;  1VYV A;  3CCJ Q;  1QP2 A;  2B8A A;  4ZV4 A;  4XK8 E;  2DPP B;  3EFR A;  2GQF A;  4DNR B;  1VQM B;  4QKU A;  3FJ5 A;  5FU6 B;  2X4Y A;  2ZL7 A;  1UEB A;  3RBB B;  4OOS A;  1VHE A;  1KD1 D;  1G7S A;  4QFM A;  2CUD A;  3X28 B;  1G7R A;  4EPC A;  3V76 A;  3WNB A;  2VNJ A;  2RQR A;  2M0Y A;  4Z88 A;  1DDI A;  3LNN A;  1TUI A;  5I11 A;  2HL5 C;  1Q7Y D;  4P12 A;  8AT1 B;  5GMK l;  4YXW A;  4Y91 A;  3AVX A;  4ACA A;  3HRS A;  4XN0 A;  3M53 A;  3CC4 A;  2DER A;  1OI1 A;  1B34 A;  3GBQ A;  2K5I A;  2BPO A;  4AFZ C;  4KGX B;  2B7B A;  3CXC B;  4E47 A;  1N8R C;  3HFO A;  3ASR A;  5IHK A;  3SB2 A;  3G4S T;  3QDR B;  2HSP A;  1WHK A;  1QGA A;  2P4R A;  1FDR A;  4DBH A;  4XN3 A;  2JJ9 A;  1FRN A;  2JVV A;  2F69 A;  5CVI A;  3JB9 J;  2KDS A;  3LWH A;  4XLF A;  1D1N A;  4EH1 A;  2F4N A;  2CSI A;  4LN2 A;  5CKF A;  1TU0 B;  4XOR A;  2BMW A;  1YCS B;  1AZG B;  1QVG S;  3PT9 A;  2C4U A;  2EVR A;  2V7V A;  1JA0 A;  2YSQ A;  4C8Q C;  2VNK A;  2KVQ G;  1Q82 C;  2WPD A;  1S72 Q;  2EYQ A;  1KMH A;  2OI3 A;  2ABL A;  2QTL A;  2R58 A;  1IRX A;  3I5R A;  2QA4 T;  1N8R R;  2YLB A;  4TMT A;  1CKA A;  2JN9 A;  2VXE A;  3L2W A;  4LDX A;  1WU8 A;  4XTZ A;  3WY9 A;  4UC4 A;  1RAE B;  1T6Y A;  2V31 A;  4P22 A;  4VUB A;  1NB9 A;  1PD0 A;  3CCS B;  2XK0 A;  1MHN A;  4C8Q A;  1TLL A;  5L23 A;  1FWZ A;  1VLY A;  5IK2 A;  3JCM P;  2DZ9 A;  1MRZ A;  1WTH D;  2VWF A;  3A8L B;  3OW2 B;  3URG A;  3KFV A;  1Q82 R;  5GAN j;  4FSX A;  5GAN 6;  4E7I A;  3OW7 A;  1WNL A;  5D6X A;  1QCF A;  4UZF A;  1MMA A;  1E6G A;  1UTI A;  1HA3 A;  2LQK A;  2DXB A;  2CC2 A;  1SSF A;  1YJW A;  4RM0 A;  2L3R A;  4JS4 A;  2E10 A;  5CCA A;  3JCM V;  2AIR B;  2YUO A;  3TVT A;  1W70 A;  4M7D G;  1DDG A;  3EFS A;  4B48 A;  2EFI A;  3R6O A;  3UT1 A;  3WND A;  3LVB A;  1X43 A;  3ZPN A;  5GAN 4;  3W2G A;  1KRH A;  3OBY A;  3CC2 A;  3CPW A;  1Y71 A;  3PFS A;  5EG2 A;  3VMF A;  3J81 k;  1T0H A;  1GCP A;  1VQO A;  1YI2 B;  2P4T A;  5KCH A;  2BE9 B;  2E5K A;  3PNW C;  2EW3 A;  4L59 A;  4MZM A;  1PKV A;  2ESW A;  2J05 A;  4PL6 A;  2J6K A;  4X05 A;  2NUT B;  3G4S Q;  1K4U S;  1BKB A;  1OHH A;  2RJC A;  3C94 A;  1LVK A;  1VQ8 Q;  2ZL6 A;  2AT1 B;  5CAI A;  4YAL A;  1H8K A;  2DF6 A;  4WTO B;  5BSX A;  3V7R A;  2M51 A;  3CMM A;  1VQ7 Q;  4OMF B;  5IAY A;  3CBO A;  1OQK A;  3JU4 A;  3LQ6 A;  3LLR A;  4LNP A;  2FG0 A;  3M4G A;  5FU7 B;  5C0M A;  2D0Q B;  4OB1 B;  2Q6O A;  3HFN A;  3EG9 A;  3CCU A;  2A37 A;  4BAC A;  3HRT A;  1V29 B;  2K5L A;  2V4D A;  1BX0 A;  4ANJ A;  4NS5 A;  1YHQ A;  4BY6 C;  3ZIA A;  1IHW A;  4F7U B;  2QA4 Q;  2VJI A;  1YJN A;  2LX9 A;  1ZBJ A;  1QVP A;  2E6N A;  2PE3 A;  2YWH A;  3A8M B;  3MO8 A;  1IHM A;  5IYP A;  1R5N A;  3RMS A;  1ACM B;  2RQU A;  4DNT B;  2XD0 A;  4KKS A;  2E1H A;  2GNC A;  1BCM A;  2COW A;  2RHZ A;  3EGU A;  5LJ3 h;  5GAN f;  4KKT A;  1PKT A;  3WBK A;  4FYX B;  1MMD A;  1VQP B;  1PM3 A;  5LJ3 d;  5GAN 5;  1YWP A;  2DL3 A;  2X3W D;  2LCL A;  3CPW S;  2QQ9 A;  5CR2 A;  1XQB A;  1NE8 A;  3QHS A;  3VUZ A;  4P6V F;  2ZAE A;  3RUX A;  2JT4 A;  3CBP A;  5LJ5 h;  3EGX B;  3JB9 I;  4A4F A;  2HDN B;  4FW1 A;  4Q7J B;  3AVY A;  4M78 A;  4XOT A;  1XTD A;  1AD5 A;  4M7D B;  1EFR A;  2FPE A;  3CEY A;  3EAE A;  3JCM Q;  3A5Z B;  4RD4 A;  2EWN A;  2EKH A;  2GTJ A;  2M5S A;  3U23 A;  1OGJ A;  3BFM A;  3A3B A;  2JN0 A;  4B44 A;  3CCJ A;  3OYK A;  3GIB A;  1VOM A;  2FB7 A;  5GAO m;  2GQI A;  1PRM C;  4M7A C;  2J7I A;  3CC7 B;  1W6X A;  4WCI A;  1IB8 A;  2YUQ A;  2F5T X;  4HCB A;  1K9M C;  1N8R U;  2YLC A;  1IRE B;  1IZ6 A;  3OEE A;  4P25 A;  3PIP A;  1ZM9 A;  3L2Z A;  3CME T;  1NBE B;  1TTT A;  1M5Q 1;  2RK2 A;  2W10 A;  4DQ2 A;  3GVJ A;  3OJW A;  4XTU A;  5GMK h;  2JXB A;  5HKC A;  3GSI A;  3OJX A;  1PSE A;  2FZC B;  3QZ5 B;  4FN5 A;  4M75 G;  1HSQ A;  1PCX A;  5AT1 B;  3E1Y E;  1YBY A;  4R55 A;  3EH1 A;  1LCK A;  2LT1 A;  2CH4 W;  3L1A A;  1PWT A;  1W2B P;  2DLP A;  1VQ9 B;  2FPF A;  2JDI A;  4B43 A;  4M7A A;  5A0G A;  4M0L A;  1QVF A;  1Q86 D;  1Q82 U;  3HKS A;  2WSS A;  1VJS A;  1D09 B;  1QWE A;  2MWP A;  1G83 A;  3SJP A;  2RNA A;  2P0P A;  4XMY A;  1GJR A;  3JSC A;  1I81 A;  3QFS A;  3H8Z A;  4DQK A;  2W6J A;  1WJQ A;  3QKJ A;  1UD3 A;  3GQB A;  1N07 A;  2QK0 A;  2ZZD A;  1U1S A;  4M7D D;  4DEY A;  3CCV B;  1NLO C;  1VQ4 T;  2WJY A;  3SEM A;  2O9V A;  4F7U F;  4BE1 A;  3SKB A; 
#chains in the Genus database with same CATH homology
 2DYI A;  2DOG A;  2QGG A;  3A1P A;  3H9N A;  2F1L A;  1PM3 A;  3HTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...