3A1PA

Structure of ribosome maturation protein rimm and ribosomal protein s19
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
b'RLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGLFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome maturation factor rimM
publication title Structure of Ribosome maturation protein RimM and Ribosomal protein S19
rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 30
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3a1pA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3a1pA01
3HTRA 1PM3A 2DOGA 3H9NA 2DYIA 3A1PA 2F1LA 2QGGA
chains in the Genus database with same CATH superfamily
1BI0A 2XHCA 4OMLA 1E6GA 3LGLA 1I4K1 1OULA 4JUVA 5GJVB 1EFCA 3BY2A 2D8JA 2KEAA 4DQKA 2CSIA 2E70A 2QQAA 3CMAT 1WX6A 5A2QE 3W2HA 5KSWB 3OYHA 4N0AA 2V7UA 1NPPA 1BK2A 1I07A 2KROA 4B43A 4RD1A 5GAMe 5LJ3f 3BH4A 1TXQA 2CP6A 2EGEA 4UZUA 1FNDA 3CRZA 4FM4B 1QCFA 4XKWA 1X01A 2LVMA 2BUDA 4YTLA 3R6NA 2Q6OA 2SEMA 2VASA 1B2RA 3CCSB 2E12A 4PJOA 3V8KA 1GAQA 1X2KA 4YAOA 2D74A 3JQPA 2RHIA 4JS5A 3RIRA 2RQRA 1IJEA 1TS9A 5LJ5h 4FW1A 2B86A 3KXTA 2JDIA 2E1HA 1I5LA 2L3SA 1SG5A 1U5SA 5LJ3g 1D2EA 1VQLT 5AYFA 3LQEA 3CCMT 3WQZA 1Q82R 2HL3A 2DIGA 4AF7A 3B8HA 4NOYA 1I81A 1PHTA 3V7SA 4HXJA 2VGMA 3CCQA 4CC3A 1RACB 3MCAB 2F4NA 2X6WA 2F2VA 2QQSA 2AHJB 2PUOB 4PJOC 3OW2A 3OBWA 2NV4A 5TV2A 3N5BB 2D0QB 3VS5A 3C12A 5DM7R 1B07A 4PNOA 1Q9SA 2E6NA 2AHOA 4Y92A 4MZMA 1NJIC 3VR6A 1K73R 2EPDA 3KFVA 3A1PA 2DTHA 2RC5A 1WXBA 1O75A 2BV3A 3FLGA 4OB1B 2E5QA 4BB7A 3FPPA 3CCJQ 1R0CB 3ASTA 5GMKj 4XOPA 3FEOA 4XLAA 2Y4YA 1KFZA 2F1MA 5GANe 1M2VA 4Z02A 1XQBA 4QVCA 3MO8A 2FRYA 2Z0WA 2DTIA 1YN8A 3EGXA 1LNXA 1VQ7A 3M9QA 4XONA 2KT8A 4Y9RA 2EQJA 1K0SA 3CC2A 2ZITA 3ZPNA 4Z1MA 1CNEA 3ONYA 4DEYA 1KQSS 4M7AC 1UTIA 5KYWB 4E7SA 1M1GA 1PG5B 2VUBA 2O01E 4EMKC 2P0PA 3FKSA 3PUNA 4II2A 1VQNQ 4XTUA 5HXBA 4F16A 2HCKA 1VUBA 4UC4A 1YNZA 2NWMA 4NCNA 1K9AA 2QE7A 2LP5A 4M77A 3D7SB 3SLNA 3LLRA 1W2BS 1U2RA 3BFMA 2NUTA 2LQKA 3O8VA 4PGOA 3W2GA 2GJKA 2DL7A 1WHMA 2EJFA 4RUGA 2CT3A 4NL2A 1V1CA 2M9UA 2EVRA 1PD1A 5FWCA 2PVOB 3CCVQ 3CCJB 1RI9A 1AD5A 3AGQA 3NPFA 1BPLA 4Z8AA 5GV7A 1UD5A 2C77A 2L89A 4LC0A 5KYNA 1WXTA 1BQEA 4C0SA 3OJXA 4ZGQB 2XDBA 1YI2B 1D3BB 1KJZA 5CKBA 4RPDA 2DAQA 2FG0A 4M77C 2FHDA 2CNDA 4C92G 1W35A 2CS7A 3TVTA 1AZEA 3LWHA 3X26B 2O9VA 1Z9QA 4OF1A 1WIEA 2DVJA 1PWTA 1D1BA 1M27C 3MP1A 1VQNB 1AWJA 3M53A 3CPXA 2DZ9A 3OYEA 2SRCA 2LCCA 4XR6A 3QFCA 1WHJA 2EKHA 2V26A 1WHGA 1G7RA 5IK2A 1M90R 3JCMe 2BIVA 5GAMh 3WBJA 3CXCB 3GP8A 2BM1A 2FZGB 1B34B 2FZKB 4LBYA 4KUDK 1GO2A 2C4UA 5F4MA 3LX7A 4PJOG 5GAN4 5J35A 2NPFA 2DRMA 1ZUKA 1H3HA 2EAYA 4QQ6A 4BE2A 1VQMA 4HKEA 3J81k 3WNDA 3SJPA 2H8HA 4WCIA 2Q6LA 2R5AA 3T53B 3C4SA 2HDAA 1YCSB 1YITT 4YAUA 2K4YA 2R57A 4ELZC 4M78A 4XU1A 4LN2A 1FWZA 2D6FA 3MP6A 2KT1A 1KQSA 3EFSA 3QHSA 1C0MA 2JUFA 4E2FB 4XNFA 2X6YA 4RG8A 5A0GA 2M0YA 3X24B 4C92B 2BF4A 1QCOA 2DE0X 1Q81D 4IIOA 5FO1A 4XTYA 2YT6A 4L59A 1T5EA 5EG2A 3CCQQ 3Q1JA 2NUZA 1NBEB 2QASA 1QLYA 1W2BA 1QW1A 4M78C 1T0JA 3DDYA 4EMHA 4WZTA 4X7DA 5FU7C 1HXDA 4N4IA 4ZN1A 1PKSA 2HKQB 2Q6KA 1N07A 4XN0A 2YLCA 1KSWA 3M0SA 2VVKA 3J80E 3QFTA 4A4EA 2DETA 3QE2A 1U3OA 3M56A 5GANh 4TVRA 3VMFA 5KYUA 2WACA 4X7CA 1VQ9T 3G1JA 4CC2A 3BW1A 1OOTA 2HL5C 1TTHB 1EIFA 1QVGS 5LJ5f 2M5SA 3A8OB 4UAJA 4LD9K 1ZSZA 4HCKA 4QQGA 4ZGJB 3H94A 3OP1A 3CB4A 1VQ7Q 3CC2Q 5H5JA 2RH2A 4YAWA 5IN1A 2LDMA 4FXUA 4F7UF 2QEXA 1JXMA 2GK7A 2RQVA 4PJJA 4M77G 4WF2A 3RERA 3OQ5A 2K3YA 5IHKA 4FSSA 3CBOA 1D1NA 3CCQB 3RBBB 4XOTA 2HQXA 1WPYA 3OMGA 1YJNA 4RTZA 3CCVT 4RCBA 3CC7A 1UGRB 3UATA 2WSCE 5LJ5j 1EP2B 3V76A 2RK1A 3OYAA 4E7ZA 4M7DB 1M3AA 4PC2A 2RHXA 5LJ5g 4YHBA 3OSSC 2GTJA 4Z4TA 2W0ZA 3L2VA 3OOCA 4OP0A 2BGIA 3M0QA 4FSXA 2QA4A 2PTKA 3FJPA 2WSFE 1UD3A 1VQOA 1KC8U 4TMZA 1Q7YU 3AVXA 3QKJA 1RADB 2F43A 1M2VB 4ME7A 2QTZA 3L2RA 3JCMc 2MYSA 5HZAA 1D09B 5I2MA 4RM0A 3EGXB 1BX0A 1BU1A 3VS7A 1BI1A 1LPLA 1RAGB 4BDYA 1CSKA 4P22A 2OJ2A 2QGFB 1HJDA 2V31A 3QDFA 3JCMd 4PJOD 1T3SA 1PNJA 4N4GA 1RAAB 2ZZGA 3HRUA 2YUNA 3A98A 1NJID 1Y96B 1G7CA 2R6HA 4OOVA 3L2WA 3CQTA 4P6VF 1FMKA 2L3QA 3VV0A 2OAWA 4LE9A 1K0XA 2K5LA 4QUZA 2XNJA 1K9MR 3WBKA 1AWXA 4PJMA 3QSUA 2RN8A 3A3BA 4H9GA 1JU5C 2L3RA 4KGVB 2ED0A 1VIEA 5GAN7 1NBMA 4M78G 3Q6RA 4XU3A 1TUGB 2FVGA 4NBSA 2BSAA 3OYJA 2XI9A 4QT7A 3J7AF 3CXCP 2VNHA 3Q3AA 3QFSA 4ACBA 1VQMQ 3W2IA 4M7AD 2XEXA 3CBMA 5HCKA 1HK9A 3RNJA 2ROTA 1QVGA 3EG9A 1MMGA 5FA6A 2ZPEB 5GAOn 1H92A 1VQ5Q 3BY1A 1S72A 4M7AF 4DEXA 1YX2A 3MMPA 3QFRA 1WHKA 2EYYA 3L1AA 1N0VC 3CCQT 1LVKA 1OX9A 3EH2A 3E1YE 3NE5B 3OJWA 4XTZA 5DS0A 3V8JA 4DBHA 1WOPA 2YWHA 2MMPA 4QFMA 1EFRA 1VYVA 2AKLA 2D1XA 1WZOA 1QVFP 3OMCA 4F7DA 4LXCA 4D8KA 3QZ5B 2OYNA 1Q82C 4X0CA 5GAMf 4J9IA 4RD3A 2DVEA 2EW3A 3EHQA 3ZFJA 2COWA 4KH0B 2ZL6A 2WPDA 4E7LA 1I0CA 4OB2B 4C8QF 1V76A 2DD5A 3BY7A 1KTVA 3QSYA 1PRMC 3FDRA 3VUBA 3VJPA 3SLDA 5IYNA 3GVKA 2JTEA 4PL6A 4M77D 1SRMA 3E19A 3WVEB 4XLEA 2DLPA 4FT2A 4AMCA 1VQMB 4E6RA 1K73C 1VQ7T 1E3XA 2HSPA 4E7HA 1HD3A 1S1NA 4E0FA 3CC2T 2V8JA 5GAOm 1PKTA 1KK2A 2DEQA 3OBYA 5GAMj 4XM3A 2PU9B 5FU6C 1VQ5B 3FRNA 2RJFA 1KHCA 5KCHA 2EYQA 5A88A 2P4TA 2RB6A 4Y28E 3CBPA 5IHNA 2BGJA 1UDLA 1OU9A 1ZM9A 1VQKA 1UFFA 2WYRA 1NLPC 1R0BG 3OAAA 1QVFS 3QYHB 1RI0A 3PVLA 1M1KC 4RDJA 2QEXQ 3G7ZA 3CCMQ 1WDTA 4HIZA 3LWIA 2LTOA 1C1AA 1JXOA 2E65A 3DB3A 2QK0A 2P4RA 4JZ4A 3MPUB 1M2OA 2EQKA 2X4YA 3AHUA 1YJNQ 2JOYA 3CC7Q 1E1QA 3HRTA 1KQ1A 3DKMA 3I9QA 1G7TA 1OHHA 2QDYB 5GAN8 4RD6A 5AN9A 4RD0A 2O2OA 3CCEA 3IQLA 3SWNB 3SKBA 2ZCFB 3JCMJ 2BZYA 4FCYA 2D3NA 3ZL7C 5GANf 1RQRA 2JNGA 3SEJA 2DCUA 2QAZA 2V1QA 5AT1B 1NEBA 4JRIA 2QA4Q 5KYUB 1XB2A 1G3YA 1IHVA 2A08A 1VQOQ 2A37A 1RAHB 4HCBA 2CYZB 1JA1A 3M0UA 5GV8A 2X9HA 3BCFA 1PM3A 4PJOE 4DBFA 4BY6C 2CZ0B 2KGTA 1BYMA 1ZSZB 2CW5A 4RD2A 1Q82U 1QH0A 3U23A 1XJWB 2QTXA 2JN9A 1ZQ1A 1NPRA 3CCMB 4ESRA 3B78A 5GANj 2DK3A 4M78D 3J81E 2JVVA 3P8BB 1X2QA 1P4MA 3P26A 3MKDA 2VXFA 3MJXA 4OMOA 2EYWA 2CBXA 3CC7B 5H59A 1BX1A 1IGQA 4G1BA 1RABB 4F7UA 3RDVA 2EGAA 2FYKA 4RDLA 4HT8A 2X4XA 1VQMT 5TY0A 4PFPA 1T3LA 3R6JA 4XK8E 1M90C 2O88A 1OZ3A 3PFSA 4M7AE 2XZPA 2JM9A 3MEAA 1JA0A 4RCYA 4A4KA 3CPWS 5BSYA 8AT1B 1ELOA 1VQOB 1QX4A 1N8RR 2YRDA 1KD1U 5F4JA 3I5RA 2ZPFB 2AK5A 4GY5A 2XIDA 2YWGA 3GBQA 2Q6IA 5A0DA 5CAIA 4X9DA 1M1KU 2JW4A 2VXEA 1QVPA 2GQVA 4OGEA 1GCPA 3ASKA 2PZ1A 3QO3A 2XZOA 3OYNA 2QDLA 4F17A 3PTAA 5KYYA 4NS5A 2MK5A 4WWVA 5IH2A 1S72Q 1EFUA 3ZBUA 2XZLA 4XTVA 1QVFA 4KRTA 3WYAA 3C94A 4TKOB 1CKAA 3OS0A 5F4OA 1PSEA 2QQRA 1AZGB 2A0FB 3JCMf 3JCMP 1ABQA 4J0QA 2CKKA 2EQUA 2MAMA 2MF2A 1JQQA 3C0CA 4LD6A 4DQ2A 2I2LA 4M2LA 3JAME 1TH7A 2RHUA 3QUIA 2E5KA 4JRPA 4M77E 3V7RA 5A89A 3M0PA 2RK2A 1G5VA 1B7TA 5LJ5d 2HKNA 4ZV4A 1W0KA 2W10A 1H85A 2FPDA 2DEUA 1YWPA 2IVWA 4G5GA 2F1LA 2CH4A 2B7BA 1ZA1B 1W6XA 1OPKA 2M0OA 1HYOA 3JCMg 4JRQA 1G3WA 1YHQA 5IAYA 1XNIA 2ZBVA 2QEXT 2IG0A 1YITQ 1SKUB 2MWOA 4JLGA 2DO3A 5HK0A 4DBQA 4GLKA 4CC7A 1Q81U 1OGJA 1WDXA 1S72B 4J7FA 3H41A 4C0DB 3RKYA 1A8PA 2MCNA 1GJRA 4II3A 1VQKQ 1YJNT 4ZCMA 1QWFA 5GAN2 3CC7T 1W87A 4KBMB 4XTWA 4Z4ZA 3U6BA 2ZPIB 3QPHA 5EC7A 3G6EA 1HA3A 4NL3A 3RKWA 4M7AA 4JJDA 2BKDN 4MMLA 2VJJA 3MP8A 2D3LA 2Z6BD 1SHGA 1BI3A 4EMKA 4PFOA 2WSSA 4UZFA 1N27A 2QA4T 4YELA 4HE6A 1UD8A 3E2UA 1VQOT 3S6WA 4DK0A 3CCEQ 1VQ6A 3REAB 4J83A 1WI7A 4DOWA 5IXFA 1GBRA 5CCAA 3HP9A 3CPWA 3RMQA 3TCJA 5C0MA 1UGPB 5GAN3 4E7JA 1N9RA 4N3GA 1W4SA 2V7QA 3EFOA 4C8QA 1V29B 5CQXA 1WJQA 1J9ZA 5DY9A 5L46A 3PA1A 2DNUA 2YUPA 3FPKA 2DBMA 2RO0A 1YITB 2MWPA 4X7FA 4AG2C 2K3XA 1VQ9Q 1JRIA 2AT1B 2AZVA 4R56A 4M78E 3PENA 2HNIA 4ASUA 2CP0A 1LJOA 2NUPB 1Q82D 1OU8A 3A8LB 4ORZA 2DL5A 2LQNA 4F7UG 2HQEA 1WXUA 2JJ2A 2JIZA 3GVLA 2RQWA 1MABA 2ZXIA 2M51A 1W70A 3EGDA 4EPCA 2DBKA 4MZTA 4MYTA 4C8QC 3HHTB 4OP7A 2P0QA 3GIRA 2CP7A 3CTAA 5CQYA 2EIFA 3T9NA 1N05A 2J7KA 4E7IA 1X75C 2WJVA 1Y0MA 2D9TA 3CC4A 2C78A 1K73D 3CCEB 4OB0B 2BZ8A 2EIXA 1MMNA 1G7SA 3WNCA 4PC6A 3M57A 1E7OA 2ABLA 1X6GA 1K9MC 1Z9ZA 3SEMA 1FNCA 1WSRA 4ROXA 3OYMA 3PIPA 2DL4A 2DXCA 2XNCA 1SF9A 2PMDA 3OW7A 1VQ9B 3I55A 1DG1G 1KD1D 1S72T 4JJCA 2ZPHB 4J9DA 2K5IA 2RI3A 2MPXC 1M1KD 5GAMd 1NJIU 3CW2A 3PE0A 4LNPA 4J9FA 3INZA 1KRHA 5KYXA 3JU4A 1AEYA 2ECZA 4B47A 1OGIA 3NGPA 3F70A 4RMOA 4RG2A 5A0LA 1TG0A 1R77A 4QHYA 1PD0A 1KK0A 5ECAA 2DD4A 2LRQA 1S0UA 3JSCA 5JBQA 1H8KA 1XOVA 4PKCC 2LJ0A 5CR2A 3VYHB 4PC3A 3CCVB 4KGXB 3S3MA 5CKFA 4FYWB 4CI0C 1IHMA 4F7UB 2DX1A 2GF7A 4QVJA 5CVIA 2V7TA 3H6ZA 2J05A 3W5VA 1WFWA 1WQ7A 2VGNA 2GFUA 4IUVA 1RAIB 2PUKB 1TOVA 5FRNA 3JB9D 3JB9J 2KNBB 1X43A 2COYA 2DZCA 1E63A 4L5GA 2FL7A 2OTJA 4WZLA 1ABOA 3OB9A 3TSWA 1MV0B 4JZ3A 5LL6S 1GR1A 3A35A 1LCKA 2E10A 3JB9F 1VQ8A 4XMYA 3E20A 4RTTA 3OZVA 2KQWA 4X9CA 1U8RA 4KKUA 4P2NA 1VQKT 1YJ9A 3KUFA 4UZEA 2JJ1A 1NLOC 1JJ2B 3T51B 5L8RE 1SHFA 4HVVA 3SFMA 5IYWA 1RL2A 5CO7A 1M8VA 1NE8A 2CP3A 2E3IA 2LT4A 3LNNA 1U1TA 4M7AG 2FZCB 1Y0RA 3MHPA 1YCYA 3EG3A 2FX3A 4RLZA 5KW9A 1NRKA 2C5BA 4M75C 2F69A 4R71A 2O4XA 5GANd 2G3RA 1YJWA 3S3NA 3OYDA 1VQ4A 1M90D 3DLLA 3MEVA 3CCET 1G2BA 1K9MU 1WYXA 1VA7A 1A0NB 1NDHA 3ZC3A 2P0KA 2LX9A 1CQXA 3PGGA 4E47A 4XL9A 2CZ1B 5D6YA 3HPWA 4C8QG 5CKDA 1OQKA 1UGVA 2VB6A 4QVDA 1ZHIA 3E1SA 4RPBA 3P8HA 2CDTA 4PJOB 4OOSA 2OAUA 3CCLA 1D8TA 1EXMA 3NFCA 3MHXA 3OYBA 2CZ6B 1Q86R 5FIUA 2A36A 3WXMA 2ZTGA 6AT1B 1WU8A 3M55A 2K6DA 2XICA 4DBRA 2YWWA 4R0KA 2EJ9A 2EWNA 4YXWA 2VNIA 2M02A 2BZXA 2MIOA 1M4ZA 1N5ZA 1XE1A 1YIJA 4LBZA 2L3PA 1AIPA 2I1LA 5CDFA 4C5HA 1MGQA 3HRSA 1GL5A 5J39A 1YLOA 5I22A 1HVXA 2GJRA 2F5KA 4JMQA 1UG1A 2ZPBB 3OW2B 3EG2A 4JJBA 1JO8A 3C95A 3QIIA 4Z89A 4LDYA 2OBSA 2BVNA 3A8MB 4M7AB 3VS6A 1K8AR 2KXCA 2OTLA 2ATCB 4EMKB 5FL7A 1PC0A 4BACA 3G4SA 1QQJA 1WORA 2O31A 1E64A 2C5HA 4ACAA 2GTOA 3CP2A 1M3BA 1RLQC 2YSQA 1GVHA 4X06A 2L5QA 4K1XA 4KUIA 4JS4A 2MI6A 3GOXA 3GQBA 3JRZA 4XAXB 2KBTA 1VQ7B 3EFOB 3ZBTA 3CC2B 2GFAA 2DOGA 4Z88A 3PVQA 4F14A 1UGQB 5TRDA 2QTLA 3I35A 1PRLC 1GBQA 2X4WA 3REBB 3I55Q 2QQBA 3I56A 1N8RC 4VUBA 4JLIA 4IUTA 2X8KA 1YP5A 2LNHB 2V8IA 4HA8A 4HT9A 1OPLA 1T6ZA 3G05A 3SHWA 2CSQA 5D6WA 1ZUNB 2AZSA 4RTUA 3R6KA 4QV2A 3E9GA 2WJYA 2QMUA 2EQMA 1Q95G 4Q5WA 4M77B 2D9RA 2X0KA 2ENMA 2KR3A 2NUTB 4X1VA 4P3YA 4P25A 2HBWA 1UEBA 5DN6A 1GRIA 4LDWA 5GAN5 1BBZA 1V0EA 4F04B 2KVOA 1JBMA 1UUEA 4IIMA 1G83A 3JQRA 4PK4A 2KI7A 3ZEHA 2ROLA 3SD4A 3META 4OMQA 3DLMA 5LJ3h 4B9WA 4OMFB 3A8JA 2VWFA 1ZBJA 4M53A 1M9SA 2ZAEA 3RY8A 1YHQT 4G6IA 3ZUGA 1MHNA 2GGRA 4Z4WA 1SM4A 1QUFA 4IUPA 2OTJQ 3CCSA 1F60A 4RCCA 1T6YA 3I55B 1WJSA 3S3OA 4Q7JB 1KG1A 4XTXA 2E41A 3VS3A 3OEEA 1AT1B 3VRZA 5L23A 2EYZA 1Y0YA 5CIUA 4AVZA 1WTHD 2E4HA 1YJ9Q 3NTKA 3QG1A 4FIBA 2PE3A 2V4DA 4P26A 4TMWA 2P3MA 3OZUA 2KVQG 4QVZA 4A4GA 3EAEA 4C8QD 3QZ9B 3G6ET 4Z4YA 3U6KA 2CRVA 2A28A 1ZM2A 4Z4SA 3AVYA 4M7DF 3WY9A 2V1RA 1D0YA 4QKUA 4FT4A 2WZPP 2DYBA 2HZYA 1JJ2P 3NTHA 4XU2A 2X35A 2BTTA 3JCMb 3CCUA 2DM1A 4PLIA 2HAXA 1MRZA 2V7XA 1VQ4Q 2KRNA 3I5SA 1K9MD 2R5MA 1VQ6T 3E9FA 2DFUA 2PNIA 3CXCS 1WHLA 3A5ZB 4DOVA 2J7IA 2B8AA 4F7UE 4XU0A 5I2SA 4BE1A 2XG8D 5KE2A 1E6HA 1SKQA 1QKXA 3VO2A 4KH1B 4M78B 2DILA 3JB9H 1TSFA 2GQIA 5GAMg 3CCLQ 2K2VA 3P8DA 5FU7B 3ES9A 2LCLA 1JNYA 1VJSA 2OBRA 2CP2A 5DLQE 1KQSB 1I8FA 5IHIA 4OMNA 1KC8R 3OSVA 3GIBA 3QDRB 4EMGA 4J6YA 1Q7YR 4II1A 3CMMA 3A8IA 4G7WA 2A3LA 1AWOA 4IKFA 4PJNA 5KYWA 1YIJQ 2FO0A 4RCZA 3PA2A 4A4HA 2EBPA 2K79A 1WHHA 1WJRA 1TWBA 1H8HA 4MDWA 3BDUA 5C6SA 5B6IA 1W2BB 1OB2A 2IPOB 2ZZDA 1RQPA 1VQ4B 3CC4T 1EFNA 2H3EB 5GAOr 3CCRA 2LC4A 3Q39A 3L42A 2VBUA 5KNLA 2DJZA 1BLIA 1ZSGA 4J9CA 4ELYC 3OW2P 4Z4UA 3G4SQ 2CP5A 1H641 7AT1B 5J3OA 4OOXA 1VHEA 2E3HA 4IUUA 3H9NA 4TMTA 3CCJA 3I55T 1S4MA 3UF4A 1JB9A 3CCLB 2HEQA 4O5VA 1AVZC 1B23P 2C06A 3FJOA 3M0RA 3WXMB 4FK8A 2J6KA 4X34A 3V8LA 4MDXA 3QBYA 1FYNA 3GF5A 3EGUA 4JPBW 1YI2A 5D6XA 1D3BA 4M75D 3PMTA 2QEXB 3X25B 3LH0A 4ZGNB 2JS2A 1RUWA 2XD0A 4X8IA 3H0FA 3FJ5A 1YIJB 3I56Q 3BNWA 2E1BA 2LMJA 1K28D 1D1AA 1QP2A 4ANJA 5GANg 4DNRB 3CD6A 1IHWA 3Q38A 3CMEA 3A8HB 4M75F 5IXBA 1YJNB 1FRNA 1VQNA 2KMTA 1R5NA 3A8GB 2Y4XA 2LQ8A 1T0HA 2HQHA 4QW2A 2W6IA 4HCCA 1K73U 1OZ2A 2ZL5A 4X05A 1ZLMA 4LDXA 3ISXA 1HSQA 1MNEA 1OB0A 4ZTFA 1V0FA 2KDSA 3WNBA 5IYQA 3TREA 4OMPA 2KYMA 3CXCA 2A7YA 3G4SB 2K7AA 2V8KA 3RUXA 2QA4B 5LMZA 2OTJT 1VLYA 2B7CA 1N0UA 4HCZA 4OGCA 2M16A 2KXDA 2VJIA 2GK6A 1FNMA 1VQ8T 1UB4A 1IO6A 2RHZA 1I7PA 1YJ9T 3RR6A 5D7UA 1VHOA 4M4SA 4B48A 1AOJA 2DYIA 3BCDA 2X3UA 4OPSA 4FN5A 2ZXHA 4C8QE 2L2PA 4AC9A 3ASQA 3I56B 1BCMA 1R8OB 4J9EA 4O6JA 5M9OA 4P1VA 2X53S 1PSFA 2X6XA 3GLXA 1ZX6A 1J3TA 4N3NA 1YJWT 5FWBA 1VQ4T 2RJEA 3OFNA 3BQJA 1QFZA 4EDUA 2EQIA 2RHYA 3X20B 4C92A 5GMKi 4ATOA 1QWEA 4FYXB 3ONUA 3EG1A 2BMWA 3H8ZA 4M0LA 2EFGA 3HKSA 4N4HA 4MZPA 1R5BA 2RM4A 3ZZUA 1AHJB 4ZGEB 2CF4A 2BPOA 4J9BA 3CCUQ 2VBVA 4B3XA 2BE7D 4AFSC 3M5AA 3CCLT 4GLMA 4D6WA 3L2UA 3EFRA 2JS0A 4XORA 5GAOl 4L8JA 2VBTA 1MV3A 4JDSA 1N8RD 1QGAA 3H0IA 4MYUA 3ZIAA 4TT3A 1QVGB 3EG9B 2GQFA 4C92C 2RI2A 3VRYA 1EZZB 3M0TA 1YBYA 2RJCA 1YIJT 5DSZA 1D1CA 3OEHA 3M4YA 3JB9G 1ACMB 3MEWA 3FB9A 1RAEB 3SDZA 2K3BA 2QYZA 2K57A 1XTDA 5HY6A 1Q86C 4J9HA 4N0AC 2HSEB 4IUQA 2OK8A 2XMFA 1PKVA 3OPOA 1YWOA 5J3BA 1QG0A 5LJ3j 3EH1A 4LUDA 2CREA 1M90U 2C4TA 2HLDA 3LH5A 3OKXA 3JV3A 1SEMA 2QTVA 4XQFA 4J7IA 1BI2A 2C0OA 3B82A 4RJLA 4EH1A 2QXFA 5FU6B 1KQSP 4BI3A 1MUZA 2XDDA 2OTLT 3OE7A 2DIEA 3G4ST 3LW5E 2RNAA 3A3GA 1U06A 1G3TA 2PLFA 3CCUB 4FYYB 4XD7A 3T56B 3CCRQ 3OZWA 4PC7A 2PVGB 4ZNXA 4R55A 4M7DA 2PVDB 1K8AC 1W2BP 2X85A 1T6XA 3OS2A 1VYTA 2JMAA 2LX7A 4B9XA 4B3FX 2BE9B 1TU0B 1KZLA 1RLPC 3M4GA 2C2WA 2DTOA 3NHNA 1WOOA 4M4ZA 4M75E 3ASSA 3UT1A 3I56T 1QGYA 2PQWA 2RQTA 4YEJA 1OI1A 2WSEE 4P3IA 1SSHA 2CT4A 2E6ZA 2HDNB 1NZ9A 1VQKB 1VQPA 2JT4A 1MNDA 3I1FA 1KD1R 3PUMA 3W2EA 5FRMA 1YI2Q 2XK0A 1GFDA 3SB2A 4RTVA 1QP3A 3OS1A 5HZBA 4M7DC 1M1KR 1WPCA 3X28B 1UE9A 2I0NA 5FLXE 4KULA 4RTYA 3OY9A 1EX4A 3W5HA 4J8OA 1GFCA 1BMFA 3QWYA 3CD6Q 2KE9A 3L2ZA 3CMEQ 1UHCA 4BY6B 1E79A 1W9XA 4OPOA 2LT1A 4AFZC 2LZJA 4OB3B 5CKEA 5HK3A 1Y96A 2VNKA 3CCRB 1D0XA 1WQWA 2FPEA 3ASPA 3G71A 3ME9A 4Y91A 2DA9A 1NB9A 2LNVA 2YDLA 1ZUYA 2XOKA 3AVUA 4E7KA 5A8AA 3NTIA 2QDXA 3JCMX 5I21A 1Q86U 3CCST 3VS1A 3Q6QA 4LDVA 4PAAA 3PMIA 4HVUA 3OYLA 4JJNK 5I11A 2XDPA 3ULRB 1FX0A 5IYRA 3QXEB 1N6AA 2RPNA 1XFOA 2OBTA 4AFQC 2LJ1A 2QG9B 4XLFA 3PVDA 4XKVA 1W1FA 4PABA 2ZZFA 4B3GA 4CRIA 3HFOA 4WQMA 2FB7A 4XQ3A 4DA4A 2P84A 1KIKA 5FROA 2CUBA 3OYGA 2R9VA 3LVBA 2KSSA 1OB5A 2W6JA 1COWA 1OX8A 3CD6B 1R5OA 2L0AA 5TR9A 1IREB 1H3ZA 2V7VA 3CMEB 4HVWA 1JEGA 1N9SA 1K76A 2GNCA 4KKSA 2K5FA 1Q81R 3CCUT 4PJLA 1K8AU 2HD0A 2X4JA 3UDCA 2ED1A 4AFUC 3QWXX 2FRWA 3FIFA 2EGCA 1VF7A 2KRMA 1VLOA 4RDKA 4WZEA 3HAGA 4YAFA 1K1ZA 4M75A 2LCSA 4G7XA 4BUGA 5LJ3e 2QQ9A 4Y7CA 5J26A 2VKNA 1WLPB 4HE5A 2YRCA 4XLHA 3TEEA 2YUQA 1Y7XA 2JTFA 2LZ6B 4TSFA 4GBQA 3CP8A 3PNWC 3TSZA 1LOJA 3ZZTA 2EFIA 2DPPB 1YHQQ 2NLUA 3PIOA 3WVDB 2DL3A 5FW9A 2JMCA 3KL9A 2EYXA 2E64A 5KYYB 2OX7A 2J6FA 4P5NA 1VQ5A 1QVFB 3RKXA 2BM0A 2RC6A 5KE3A 2ZZEA 2E1RA 4IW3B 3ZBDA 1E62A 1QVGP 2DXTA 3W2FA 3RESA 4B44A 3CPFA 2YRVA 1D0ZA 2WR8A 1WA7A 1KC8C 1Q7YC 2EJGA 3VS0A 4C0FA 5HKCA 4J9GA 1VOMA 3G6EQ 3CCRT 1DARA 4GQNA 3GPLA 1QFJA 2J06A 5FO0A 3KBGA 2Y90A 1UD6A 5GMKe 4M7DG 1TUCA 4PLLA 3DB4A 1AMOA 1F1BB 4LUEA 4QQDA 4PFZA 2XU8A 3MEUA 4X7EA 3CMAA 2ZGWA 2GBQA 4A53A 1FNBA 2GJPA 4AG1C 3JB9I 3CCJT 1N06A 4BI4A 1VQ6Q 1NB0A 4FYVB 1FXXA 3ER0A 2HMAA 4LDUA 4FU6A 1M1FA 3SWNA 1O9SA 1CNFA 1QCNA 1YHQB 2CH4W 4J6WA 1YI2T 1M5Q1 1XQHA 2JTMA 1QUEA 1Y57A 3HTRA 2RF0A 3P27A 3OYYA 1GCQA 5IYPA 1I1JA 1WP6A 1IXDA 3CD6T 2KK4A 2CGHA 3CMET 1QKWA 4P6YA 4P9SA 3BDLA 1ZUUA 1VQPQ 1VQNT 4Z4VA 1IB0A 1IB8A 1P92A 3G6EB 1PJ7A 3JCMV 2C0TA 2K2MA 1VQLA 3SWNC 3LGFA 3EG0A 3CCMA 1X27A 2VNJA 3SJZA 1NJIR 1IRXA 1TUIA 4BDZA 1SSFA 4WTOB 2CK3A 2YHTA 5KCOA 3EHRA 2ZPGB 1UJ0A 4C43A 1GCQC 3VO1A 1WGSA 2JM8A 5DLOA 3V7AA 3CC4Q 1TUDA 3OYCA 1VQ6B 2DJQA 3G71Q 4C92D 3CPWB 3HSBA 1ZSZC 4TN1A 4QVAA 4J5YA 1X6BA 2NYSA 2DY1A 1NG2A 4C8QB 4PC1A 3UWNA 2F2WA 2MOXA 2XGJA 9ATCB 1TLLA 5HKKA 1Q86D 3LO8A 1MMAA 4C92F 1BIBA 4BE0A 2RMOA 2DKGA 2H3JA 1UHFA 4G1VA 1KMHA 3QJYA 2LJ3A 1M30A 1OV3A 2YLBA 3JQQA 2RQUA 3QJ6A 2XNDA 1VQPB 2ESWA 2VV5A 3AVTA 1FMVA 1VIFA 4B4DA 2FPFA 3VUZA 1NM7A 1V5VA 5IT9E 3JCMQ 2X51A 2X3XD 1UJYA 3AT1B 1EP1B 1KK1A 3EGDB 5FNZA 1ZBXA 3VNUA 2VZLA 5LJ3d 1ARKA 1FDRA 1KK3A 8ATCB 1MMDA 4M75G 2YWEA 4XLCA 3H0HA 2DIQA 3VKIA 2ZZQA 1K8AD 2HBPA 3CC4B 3JCMh 1BKBA 2B5OA 3L2QA 4PJOF 2JZ2A 2JN0A 1X6OA 2DL8A 3G71B 4DQLA 1DJ7B 4C5IA 2JXBA 1KJWA 2RD1A 2COZA 1BJKA 4Z4RA 1K4US 3UPUA 1G8XA 4KKTA 4A54A 5GMKm 4BPRA 3GNFB 2QN6A 4TMVA 4KGZB 4BD3A 3BC9A 4LBWA 1UD2A 1Y07A 1QGZA 4IURA 1PCXA 1YFNA 1KK7A 1VQ8Q 1ZM3A 4AF6A 2D8HA 3AVWA 2CUDA 4M7DD 2R58A 4CC4B 3ZZ0A 1IGUA 3GNGA 3O5ZA 5KYXB 5CK9A 1I8DA 4NNJA 1OEBA 1GAWA 2OI3A 4A4FA 3GSIA 5KH6A 2RI5A 3PT9A 3W5UA 3AGPA 3JCMW 2KRSA 1E3ZA 2D0NA 4ZCIA 3MCAA 5GAN6 5GMKh 2YXYA 1FRQA 1YJWQ 1IZ6A 2QI2A 2VYTA 4DNTB 4U9UA 3D26A 5EMNA 1NEGA 4J6XA 1Y71A 4C0GA 4LBVA 1TTTA 4Y9UA 1UD4A 1N8RU 3V7CA 1F20A 3CMAQ 1I18A 4M75B 2AKKA 1UECA 4B6MA 4ZN3A 2OTJB 2AIRB 2JJ9A 1WSVA 2PIAA 3VNVA 1VQ8B 5CKHA 1KQ2A 3UA7A 4AT1B 1DDIA 1PJ5A 4C0DC 1UGSB 4RD4A 2K9GA 1X69A 4JRKA 5E6TA 1YJ9B 4BI8B 1VQPT 4EIKA 2FEIA 1W34A 3HL8A 1YITA 1NYFA 2YWFA 5LJ5e 4M77F 3VU3C 3RMSA 3M59A 4ZGDB 1JJ2S 3AVVA 1G3SA 3NMZC 1ZA2B 3U2QA 3CEYA 3OYIA 2C0IA 2NUPA 2O4XB 2X3WD 1KD1C 3KEWA 4YALA 1YJWB 2L8DA 3TU4K 2DMOA 1QMCA 3G71T 1VQLQ 2DF6A 3LQ6A 2OTLQ 4C92E 2QGGA 3CMAB 3HFNA 2GREA 3M58A 4RTWA 2V7WA 2F2XA 2O9SA 3ASRA 4OVAA 1I5OB 4C5GA 1H42A 4RKUE 2KY9A 2RJDA 3TQ7P 4OMMA 4KT0E 3OA6A 1OYXA 1IJFA 4C5EA 3M54A 4MMKA 2DXUA 1WNLA 1BCOA 2F5TX 1KHIA 1TVCA 3A8KA 2HCJB 3CPWP 1KC8D 1VQ9A 1EFTA 4FWTA 2M1HA 1Q7YD 4FW2A 2GPJA 2IIMA 1BIAA 1QFYA 1FX7A 1M8MA 2WZNA 3GVJA 3OS5A 3QYGB 2ZBUA 1PJ6A 4P12A 1JB0E 4CQJA 4M1KA 4ZTJA 1EWYA 4OPVA 4DK1A 4WZKA 5BSXA 3URGA 1VQLB 1SRLA 2OK7A 2KAFA 3VS4A 2DERA 2OTLB 2G6FX 3OW2S 1W0JA 3UA6A 2CC2A 2VC8A 2CZ7B 1N08A 1UMKA 2RA2A 4C0ZA 1E43A 4A63B 1B34A 2DRKA 1Q81C 3CCVA 5THXA 5GAOq 2VYQA 1B3QA 1M3CA 1NYGA 4M78F 3OYFA 4V2SA 2EKOA 1FMWA 2KYBA 3LYIA 4K11A 2ZL7A 1HZEA 5GMKl 1CKBA 1BB9A 2GCXA 5GAOp 2LQWA 2FVUA 4M7DE 1DDGA 2J6OA 1WOSA 2XKOC 3THKA 3CCSQ 1VYUA 3VYGA 3OYKA 1H8EA 1SKYB 4X07A 1VQ5T 5GJWB 3FC3A 3CESA 4ZCLA 2YUOA 1GXIE 1RAFB 4D8DA 1AWWA 2DXBA 4L6V5 4RTXA 3BE3A 2BN4A 4TMXA 1SPKA 1C6VX 2ZTNA 4XN3A 1U1SA 4FL6A 1EP3B 1ZM4A 3VS2A 1JJ2A 3R6OA 2VBSA 1E1RA
chains in the Genus database with same CATH topology
3HTRA 1PM3A 2DOGA 3H9NA 2DYIA 3A1PA 2F1LA 2QGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTR A;  1PM3 A;  2DOG A;  3H9N A;  2DYI A;  3A1P A;  2F1L A;  2QGG A; 
#chains in the Genus database with same CATH topology
 1BI0 A;  2XHC A;  4OML A;  1E6G A;  3LGL A;  1I4K 1;  1OUL A;  4JUV A;  5GJV B;  1EFC A;  3BY2 A;  2D8J A;  2KEA A;  4DQK A;  2CSI A;  2E70 A;  2QQA A;  3CMA T;  1WX6 A;  5A2Q E;  3W2H A;  5KSW B;  3OYH A;  4N0A A;  2V7U A;  1NPP A;  1BK2 A;  1I07 A;  2KRO A;  4B43 A;  4RD1 A;  5GAM e;  5LJ3 f;  3BH4 A;  1TXQ A;  2CP6 A;  2EGE A;  4UZU A;  1FND A;  3CRZ A;  4FM4 B;  1QCF A;  4XKW A;  1X01 A;  2LVM A;  2BUD A;  4YTL A;  3R6N A;  2Q6O A;  2SEM A;  2VAS A;  1B2R A;  3CCS B;  2E12 A;  4PJO A;  3V8K A;  1GAQ A;  1X2K A;  4YAO A;  2D74 A;  3JQP A;  2RHI A;  4JS5 A;  3RIR A;  2RQR A;  1IJE A;  1TS9 A;  5LJ5 h;  4FW1 A;  2B86 A;  3KXT A;  2JDI A;  2E1H A;  1I5L A;  2L3S A;  1SG5 A;  1U5S A;  5LJ3 g;  1D2E A;  1VQL T;  5AYF A;  3LQE A;  3CCM T;  3WQZ A;  1Q82 R;  2HL3 A;  2DIG A;  4AF7 A;  3B8H A;  4NOY A;  1I81 A;  1PHT A;  3V7S A;  4HXJ A;  2VGM A;  3CCQ A;  4CC3 A;  1RAC B;  3MCA B;  2F4N A;  2X6W A;  2F2V A;  2QQS A;  2AHJ B;  2PUO B;  4PJO C;  3OW2 A;  3OBW A;  2NV4 A;  5TV2 A;  3N5B B;  2D0Q B;  3VS5 A;  3C12 A;  5DM7 R;  1B07 A;  4PNO A;  1Q9S A;  2E6N A;  2AHO A;  4Y92 A;  4MZM A;  1NJI C;  3VR6 A;  1K73 R;  2EPD A;  3KFV A;  3A1P A;  2DTH A;  2RC5 A;  1WXB A;  1O75 A;  2BV3 A;  3FLG A;  4OB1 B;  2E5Q A;  4BB7 A;  3FPP A;  3CCJ Q;  1R0C B;  3AST A;  5GMK j;  4XOP A;  3FEO A;  4XLA A;  2Y4Y A;  1KFZ A;  2F1M A;  5GAN e;  1M2V A;  4Z02 A;  1XQB A;  4QVC A;  3MO8 A;  2FRY A;  2Z0W A;  2DTI A;  1YN8 A;  3EGX A;  1LNX A;  1VQ7 A;  3M9Q A;  4XON A;  2KT8 A;  4Y9R A;  2EQJ A;  1K0S A;  3CC2 A;  2ZIT A;  3ZPN A;  4Z1M A;  1CNE A;  3ONY A;  4DEY A;  1KQS S;  4M7A C;  1UTI A;  5KYW B;  4E7S A;  1M1G A;  1PG5 B;  2VUB A;  2O01 E;  4EMK C;  2P0P A;  3FKS A;  3PUN A;  4II2 A;  1VQN Q;  4XTU A;  5HXB A;  4F16 A;  2HCK A;  1VUB A;  4UC4 A;  1YNZ A;  2NWM A;  4NCN A;  1K9A A;  2QE7 A;  2LP5 A;  4M77 A;  3D7S B;  3SLN A;  3LLR A;  1W2B S;  1U2R A;  3BFM A;  2NUT A;  2LQK A;  3O8V A;  4PGO A;  3W2G A;  2GJK A;  2DL7 A;  1WHM A;  2EJF A;  4RUG A;  2CT3 A;  4NL2 A;  1V1C A;  2M9U A;  2EVR A;  1PD1 A;  5FWC A;  2PVO B;  3CCV Q;  3CCJ B;  1RI9 A;  1AD5 A;  3AGQ A;  3NPF A;  1BPL A;  4Z8A A;  5GV7 A;  1UD5 A;  2C77 A;  2L89 A;  4LC0 A;  5KYN A;  1WXT A;  1BQE A;  4C0S A;  3OJX A;  4ZGQ B;  2XDB A;  1YI2 B;  1D3B B;  1KJZ A;  5CKB A;  4RPD A;  2DAQ A;  2FG0 A;  4M77 C;  2FHD A;  2CND A;  4C92 G;  1W35 A;  2CS7 A;  3TVT A;  1AZE A;  3LWH A;  3X26 B;  2O9V A;  1Z9Q A;  4OF1 A;  1WIE A;  2DVJ A;  1PWT A;  1D1B A;  1M27 C;  3MP1 A;  1VQN B;  1AWJ A;  3M53 A;  3CPX A;  2DZ9 A;  3OYE A;  2SRC A;  2LCC A;  4XR6 A;  3QFC A;  1WHJ A;  2EKH A;  2V26 A;  1WHG A;  1G7R A;  5IK2 A;  1M90 R;  3JCM e;  2BIV A;  5GAM h;  3WBJ A;  3CXC B;  3GP8 A;  2BM1 A;  2FZG B;  1B34 B;  2FZK B;  4LBY A;  4KUD K;  1GO2 A;  2C4U A;  5F4M A;  3LX7 A;  4PJO G;  5GAN 4;  5J35 A;  2NPF A;  2DRM A;  1ZUK A;  1H3H A;  2EAY A;  4QQ6 A;  4BE2 A;  1VQM A;  4HKE A;  3J81 k;  3WND A;  3SJP A;  2H8H A;  4WCI A;  2Q6L A;  2R5A A;  3T53 B;  3C4S A;  2HDA A;  1YCS B;  1YIT T;  4YAU A;  2K4Y A;  2R57 A;  4ELZ C;  4M78 A;  4XU1 A;  4LN2 A;  1FWZ A;  2D6F A;  3MP6 A;  2KT1 A;  1KQS A;  3EFS A;  3QHS A;  1C0M A;  2JUF A;  4E2F B;  4XNF A;  2X6Y A;  4RG8 A;  5A0G A;  2M0Y A;  3X24 B;  4C92 B;  2BF4 A;  1QCO A;  2DE0 X;  1Q81 D;  4IIO A;  5FO1 A;  4XTY A;  2YT6 A;  4L59 A;  1T5E A;  5EG2 A;  3CCQ Q;  3Q1J A;  2NUZ A;  1NBE B;  2QAS A;  1QLY A;  1W2B A;  1QW1 A;  4M78 C;  1T0J A;  3DDY A;  4EMH A;  4WZT A;  4X7D A;  5FU7 C;  1HXD A;  4N4I A;  4ZN1 A;  1PKS A;  2HKQ B;  2Q6K A;  1N07 A;  4XN0 A;  2YLC A;  1KSW A;  3M0S A;  2VVK A;  3J80 E;  3QFT A;  4A4E A;  2DET A;  3QE2 A;  1U3O A;  3M56 A;  5GAN h;  4TVR A;  3VMF A;  5KYU A;  2WAC A;  4X7C A;  1VQ9 T;  3G1J A;  4CC2 A;  3BW1 A;  1OOT A;  2HL5 C;  1TTH B;  1EIF A;  1QVG S;  5LJ5 f;  2M5S A;  3A8O B;  4UAJ A;  4LD9 K;  1ZSZ A;  4HCK A;  4QQG A;  4ZGJ B;  3H94 A;  3OP1 A;  3CB4 A;  1VQ7 Q;  3CC2 Q;  5H5J A;  2RH2 A;  4YAW A;  5IN1 A;  2LDM A;  4FXU A;  4F7U F;  2QEX A;  1JXM A;  2GK7 A;  2RQV A;  4PJJ A;  4M77 G;  4WF2 A;  3RER A;  3OQ5 A;  2K3Y A;  5IHK A;  4FSS A;  3CBO A;  1D1N A;  3CCQ B;  3RBB B;  4XOT A;  2HQX A;  1WPY A;  3OMG A;  1YJN A;  4RTZ A;  3CCV T;  4RCB A;  3CC7 A;  1UGR B;  3UAT A;  2WSC E;  5LJ5 j;  1EP2 B;  3V76 A;  2RK1 A;  3OYA A;  4E7Z A;  4M7D B;  1M3A A;  4PC2 A;  2RHX A;  5LJ5 g;  4YHB A;  3OSS C;  2GTJ A;  4Z4T A;  2W0Z A;  3L2V A;  3OOC A;  4OP0 A;  2BGI A;  3M0Q A;  4FSX A;  2QA4 A;  2PTK A;  3FJP A;  2WSF E;  1UD3 A;  1VQO A;  1KC8 U;  4TMZ A;  1Q7Y U;  3AVX A;  3QKJ A;  1RAD B;  2F43 A;  1M2V B;  4ME7 A;  2QTZ A;  3L2R A;  3JCM c;  2MYS A;  5HZA A;  1D09 B;  5I2M A;  4RM0 A;  3EGX B;  1BX0 A;  1BU1 A;  3VS7 A;  1BI1 A;  1LPL A;  1RAG B;  4BDY A;  1CSK A;  4P22 A;  2OJ2 A;  2QGF B;  1HJD A;  2V31 A;  3QDF A;  3JCM d;  4PJO D;  1T3S A;  1PNJ A;  4N4G A;  1RAA B;  2ZZG A;  3HRU A;  2YUN A;  3A98 A;  1NJI D;  1Y96 B;  1G7C A;  2R6H A;  4OOV A;  3L2W A;  3CQT A;  4P6V F;  1FMK A;  2L3Q A;  3VV0 A;  2OAW A;  4LE9 A;  1K0X A;  2K5L A;  4QUZ A;  2XNJ A;  1K9M R;  3WBK A;  1AWX A;  4PJM A;  3QSU A;  2RN8 A;  3A3B A;  4H9G A;  1JU5 C;  2L3R A;  4KGV B;  2ED0 A;  1VIE A;  5GAN 7;  1NBM A;  4M78 G;  3Q6R A;  4XU3 A;  1TUG B;  2FVG A;  4NBS A;  2BSA A;  3OYJ A;  2XI9 A;  4QT7 A;  3J7A F;  3CXC P;  2VNH A;  3Q3A A;  3QFS A;  4ACB A;  1VQM Q;  3W2I A;  4M7A D;  2XEX A;  3CBM A;  5HCK A;  1HK9 A;  3RNJ A;  2ROT A;  1QVG A;  3EG9 A;  1MMG A;  5FA6 A;  2ZPE B;  5GAO n;  1H92 A;  1VQ5 Q;  3BY1 A;  1S72 A;  4M7A F;  4DEX A;  1YX2 A;  3MMP A;  3QFR A;  1WHK A;  2EYY A;  3L1A A;  1N0V C;  3CCQ T;  1LVK A;  1OX9 A;  3EH2 A;  3E1Y E;  3NE5 B;  3OJW A;  4XTZ A;  5DS0 A;  3V8J A;  4DBH A;  1WOP A;  2YWH A;  2MMP A;  4QFM A;  1EFR A;  1VYV A;  2AKL A;  2D1X A;  1WZO A;  1QVF P;  3OMC A;  4F7D A;  4LXC A;  4D8K A;  3QZ5 B;  2OYN A;  1Q82 C;  4X0C A;  5GAM f;  4J9I A;  4RD3 A;  2DVE A;  2EW3 A;  3EHQ A;  3ZFJ A;  2COW A;  4KH0 B;  2ZL6 A;  2WPD A;  4E7L A;  1I0C A;  4OB2 B;  4C8Q F;  1V76 A;  2DD5 A;  3BY7 A;  1KTV A;  3QSY A;  1PRM C;  3FDR A;  3VUB A;  3VJP A;  3SLD A;  5IYN A;  3GVK A;  2JTE A;  4PL6 A;  4M77 D;  1SRM A;  3E19 A;  3WVE B;  4XLE A;  2DLP A;  4FT2 A;  4AMC A;  1VQM B;  4E6R A;  1K73 C;  1VQ7 T;  1E3X A;  2HSP A;  4E7H A;  1HD3 A;  1S1N A;  4E0F A;  3CC2 T;  2V8J A;  5GAO m;  1PKT A;  1KK2 A;  2DEQ A;  3OBY A;  5GAM j;  4XM3 A;  2PU9 B;  5FU6 C;  1VQ5 B;  3FRN A;  2RJF A;  1KHC A;  5KCH A;  2EYQ A;  5A88 A;  2P4T A;  2RB6 A;  4Y28 E;  3CBP A;  5IHN A;  2BGJ A;  1UDL A;  1OU9 A;  1ZM9 A;  1VQK A;  1UFF A;  2WYR A;  1NLP C;  1R0B G;  3OAA A;  1QVF S;  3QYH B;  1RI0 A;  3PVL A;  1M1K C;  4RDJ A;  2QEX Q;  3G7Z A;  3CCM Q;  1WDT A;  4HIZ A;  3LWI A;  2LTO A;  1C1A A;  1JXO A;  2E65 A;  3DB3 A;  2QK0 A;  2P4R A;  4JZ4 A;  3MPU B;  1M2O A;  2EQK A;  2X4Y A;  3AHU A;  1YJN Q;  2JOY A;  3CC7 Q;  1E1Q A;  3HRT A;  1KQ1 A;  3DKM A;  3I9Q A;  1G7T A;  1OHH A;  2QDY B;  5GAN 8;  4RD6 A;  5AN9 A;  4RD0 A;  2O2O A;  3CCE A;  3IQL A;  3SWN B;  3SKB A;  2ZCF B;  3JCM J;  2BZY A;  4FCY A;  2D3N A;  3ZL7 C;  5GAN f;  1RQR A;  2JNG A;  3SEJ A;  2DCU A;  2QAZ A;  2V1Q A;  5AT1 B;  1NEB A;  4JRI A;  2QA4 Q;  5KYU B;  1XB2 A;  1G3Y A;  1IHV A;  2A08 A;  1VQO Q;  2A37 A;  1RAH B;  4HCB A;  2CYZ B;  1JA1 A;  3M0U A;  5GV8 A;  2X9H A;  3BCF A;  1PM3 A;  4PJO E;  4DBF A;  4BY6 C;  2CZ0 B;  2KGT A;  1BYM A;  1ZSZ B;  2CW5 A;  4RD2 A;  1Q82 U;  1QH0 A;  3U23 A;  1XJW B;  2QTX A;  2JN9 A;  1ZQ1 A;  1NPR A;  3CCM B;  4ESR A;  3B78 A;  5GAN j;  2DK3 A;  4M78 D;  3J81 E;  2JVV A;  3P8B B;  1X2Q A;  1P4M A;  3P26 A;  3MKD A;  2VXF A;  3MJX A;  4OMO A;  2EYW A;  2CBX A;  3CC7 B;  5H59 A;  1BX1 A;  1IGQ A;  4G1B A;  1RAB B;  4F7U A;  3RDV A;  2EGA A;  2FYK A;  4RDL A;  4HT8 A;  2X4X A;  1VQM T;  5TY0 A;  4PFP A;  1T3L A;  3R6J A;  4XK8 E;  1M90 C;  2O88 A;  1OZ3 A;  3PFS A;  4M7A E;  2XZP A;  2JM9 A;  3MEA A;  1JA0 A;  4RCY A;  4A4K A;  3CPW S;  5BSY A;  8AT1 B;  1ELO A;  1VQO B;  1QX4 A;  1N8R R;  2YRD A;  1KD1 U;  5F4J A;  3I5R A;  2ZPF B;  2AK5 A;  4GY5 A;  2XID A;  2YWG A;  3GBQ A;  2Q6I A;  5A0D A;  5CAI A;  4X9D A;  1M1K U;  2JW4 A;  2VXE A;  1QVP A;  2GQV A;  4OGE A;  1GCP A;  3ASK A;  2PZ1 A;  3QO3 A;  2XZO A;  3OYN A;  2QDL A;  4F17 A;  3PTA A;  5KYY A;  4NS5 A;  2MK5 A;  4WWV A;  5IH2 A;  1S72 Q;  1EFU A;  3ZBU A;  2XZL A;  4XTV A;  1QVF A;  4KRT A;  3WYA A;  3C94 A;  4TKO B;  1CKA A;  3OS0 A;  5F4O A;  1PSE A;  2QQR A;  1AZG B;  2A0F B;  3JCM f;  3JCM P;  1ABQ A;  4J0Q A;  2CKK A;  2EQU A;  2MAM A;  2MF2 A;  1JQQ A;  3C0C A;  4LD6 A;  4DQ2 A;  2I2L A;  4M2L A;  3JAM E;  1TH7 A;  2RHU A;  3QUI A;  2E5K A;  4JRP A;  4M77 E;  3V7R A;  5A89 A;  3M0P A;  2RK2 A;  1G5V A;  1B7T A;  5LJ5 d;  2HKN A;  4ZV4 A;  1W0K A;  2W10 A;  1H85 A;  2FPD A;  2DEU A;  1YWP A;  2IVW A;  4G5G A;  2F1L A;  2CH4 A;  2B7B A;  1ZA1 B;  1W6X A;  1OPK A;  2M0O A;  1HYO A;  3JCM g;  4JRQ A;  1G3W A;  1YHQ A;  5IAY A;  1XNI A;  2ZBV A;  2QEX T;  2IG0 A;  1YIT Q;  1SKU B;  2MWO A;  4JLG A;  2DO3 A;  5HK0 A;  4DBQ A;  4GLK A;  4CC7 A;  1Q81 U;  1OGJ A;  1WDX A;  1S72 B;  4J7F A;  3H41 A;  4C0D B;  3RKY A;  1A8P A;  2MCN A;  1GJR A;  4II3 A;  1VQK Q;  1YJN T;  4ZCM A;  1QWF A;  5GAN 2;  3CC7 T;  1W87 A;  4KBM B;  4XTW A;  4Z4Z A;  3U6B A;  2ZPI B;  3QPH A;  5EC7 A;  3G6E A;  1HA3 A;  4NL3 A;  3RKW A;  4M7A A;  4JJD A;  2BKD N;  4MML A;  2VJJ A;  3MP8 A;  2D3L A;  2Z6B D;  1SHG A;  1BI3 A;  4EMK A;  4PFO A;  2WSS A;  4UZF A;  1N27 A;  2QA4 T;  4YEL A;  4HE6 A;  1UD8 A;  3E2U A;  1VQO T;  3S6W A;  4DK0 A;  3CCE Q;  1VQ6 A;  3REA B;  4J83 A;  1WI7 A;  4DOW A;  5IXF A;  1GBR A;  5CCA A;  3HP9 A;  3CPW A;  3RMQ A;  3TCJ A;  5C0M A;  1UGP B;  5GAN 3;  4E7J A;  1N9R A;  4N3G A;  1W4S A;  2V7Q A;  3EFO A;  4C8Q A;  1V29 B;  5CQX A;  1WJQ A;  1J9Z A;  5DY9 A;  5L46 A;  3PA1 A;  2DNU A;  2YUP A;  3FPK A;  2DBM A;  2RO0 A;  1YIT B;  2MWP A;  4X7F A;  4AG2 C;  2K3X A;  1VQ9 Q;  1JRI A;  2AT1 B;  2AZV A;  4R56 A;  4M78 E;  3PEN A;  2HNI A;  4ASU A;  2CP0 A;  1LJO A;  2NUP B;  1Q82 D;  1OU8 A;  3A8L B;  4ORZ A;  2DL5 A;  2LQN A;  4F7U G;  2HQE A;  1WXU A;  2JJ2 A;  2JIZ A;  3GVL A;  2RQW A;  1MAB A;  2ZXI A;  2M51 A;  1W70 A;  3EGD A;  4EPC A;  2DBK A;  4MZT A;  4MYT A;  4C8Q C;  3HHT B;  4OP7 A;  2P0Q A;  3GIR A;  2CP7 A;  3CTA A;  5CQY A;  2EIF A;  3T9N A;  1N05 A;  2J7K A;  4E7I A;  1X75 C;  2WJV A;  1Y0M A;  2D9T A;  3CC4 A;  2C78 A;  1K73 D;  3CCE B;  4OB0 B;  2BZ8 A;  2EIX A;  1MMN A;  1G7S A;  3WNC A;  4PC6 A;  3M57 A;  1E7O A;  2ABL A;  1X6G A;  1K9M C;  1Z9Z A;  3SEM A;  1FNC A;  1WSR A;  4ROX A;  3OYM A;  3PIP A;  2DL4 A;  2DXC A;  2XNC A;  1SF9 A;  2PMD A;  3OW7 A;  1VQ9 B;  3I55 A;  1DG1 G;  1KD1 D;  1S72 T;  4JJC A;  2ZPH B;  4J9D A;  2K5I A;  2RI3 A;  2MPX C;  1M1K D;  5GAM d;  1NJI U;  3CW2 A;  3PE0 A;  4LNP A;  4J9F A;  3INZ A;  1KRH A;  5KYX A;  3JU4 A;  1AEY A;  2ECZ A;  4B47 A;  1OGI A;  3NGP A;  3F70 A;  4RMO A;  4RG2 A;  5A0L A;  1TG0 A;  1R77 A;  4QHY A;  1PD0 A;  1KK0 A;  5ECA A;  2DD4 A;  2LRQ A;  1S0U A;  3JSC A;  5JBQ A;  1H8K A;  1XOV A;  4PKC C;  2LJ0 A;  5CR2 A;  3VYH B;  4PC3 A;  3CCV B;  4KGX B;  3S3M A;  5CKF A;  4FYW B;  4CI0 C;  1IHM A;  4F7U B;  2DX1 A;  2GF7 A;  4QVJ A;  5CVI A;  2V7T A;  3H6Z A;  2J05 A;  3W5V A;  1WFW A;  1WQ7 A;  2VGN A;  2GFU A;  4IUV A;  1RAI B;  2PUK B;  1TOV A;  5FRN A;  3JB9 D;  3JB9 J;  2KNB B;  1X43 A;  2COY A;  2DZC A;  1E63 A;  4L5G A;  2FL7 A;  2OTJ A;  4WZL A;  1ABO A;  3OB9 A;  3TSW A;  1MV0 B;  4JZ3 A;  5LL6 S;  1GR1 A;  3A35 A;  1LCK A;  2E10 A;  3JB9 F;  1VQ8 A;  4XMY A;  3E20 A;  4RTT A;  3OZV A;  2KQW A;  4X9C A;  1U8R A;  4KKU A;  4P2N A;  1VQK T;  1YJ9 A;  3KUF A;  4UZE A;  2JJ1 A;  1NLO C;  1JJ2 B;  3T51 B;  5L8R E;  1SHF A;  4HVV A;  3SFM A;  5IYW A;  1RL2 A;  5CO7 A;  1M8V A;  1NE8 A;  2CP3 A;  2E3I A;  2LT4 A;  3LNN A;  1U1T A;  4M7A G;  2FZC B;  1Y0R A;  3MHP A;  1YCY A;  3EG3 A;  2FX3 A;  4RLZ A;  5KW9 A;  1NRK A;  2C5B A;  4M75 C;  2F69 A;  4R71 A;  2O4X A;  5GAN d;  2G3R A;  1YJW A;  3S3N A;  3OYD A;  1VQ4 A;  1M90 D;  3DLL A;  3MEV A;  3CCE T;  1G2B A;  1K9M U;  1WYX A;  1VA7 A;  1A0N B;  1NDH A;  3ZC3 A;  2P0K A;  2LX9 A;  1CQX A;  3PGG A;  4E47 A;  4XL9 A;  2CZ1 B;  5D6Y A;  3HPW A;  4C8Q G;  5CKD A;  1OQK A;  1UGV A;  2VB6 A;  4QVD A;  1ZHI A;  3E1S A;  4RPB A;  3P8H A;  2CDT A;  4PJO B;  4OOS A;  2OAU A;  3CCL A;  1D8T A;  1EXM A;  3NFC A;  3MHX A;  3OYB A;  2CZ6 B;  1Q86 R;  5FIU A;  2A36 A;  3WXM A;  2ZTG A;  6AT1 B;  1WU8 A;  3M55 A;  2K6D A;  2XIC A;  4DBR A;  2YWW A;  4R0K A;  2EJ9 A;  2EWN A;  4YXW A;  2VNI A;  2M02 A;  2BZX A;  2MIO A;  1M4Z A;  1N5Z A;  1XE1 A;  1YIJ A;  4LBZ A;  2L3P A;  1AIP A;  2I1L A;  5CDF A;  4C5H A;  1MGQ A;  3HRS A;  1GL5 A;  5J39 A;  1YLO A;  5I22 A;  1HVX A;  2GJR A;  2F5K A;  4JMQ A;  1UG1 A;  2ZPB B;  3OW2 B;  3EG2 A;  4JJB A;  1JO8 A;  3C95 A;  3QII A;  4Z89 A;  4LDY A;  2OBS A;  2BVN A;  3A8M B;  4M7A B;  3VS6 A;  1K8A R;  2KXC A;  2OTL A;  2ATC B;  4EMK B;  5FL7 A;  1PC0 A;  4BAC A;  3G4S A;  1QQJ A;  1WOR A;  2O31 A;  1E64 A;  2C5H A;  4ACA A;  2GTO A;  3CP2 A;  1M3B A;  1RLQ C;  2YSQ A;  1GVH A;  4X06 A;  2L5Q A;  4K1X A;  4KUI A;  4JS4 A;  2MI6 A;  3GOX A;  3GQB A;  3JRZ A;  4XAX B;  2KBT A;  1VQ7 B;  3EFO B;  3ZBT A;  3CC2 B;  2GFA A;  2DOG A;  4Z88 A;  3PVQ A;  4F14 A;  1UGQ B;  5TRD A;  2QTL A;  3I35 A;  1PRL C;  1GBQ A;  2X4W A;  3REB B;  3I55 Q;  2QQB A;  3I56 A;  1N8R C;  4VUB A;  4JLI A;  4IUT A;  2X8K A;  1YP5 A;  2LNH B;  2V8I A;  4HA8 A;  4HT9 A;  1OPL A;  1T6Z A;  3G05 A;  3SHW A;  2CSQ A;  5D6W A;  1ZUN B;  2AZS A;  4RTU A;  3R6K A;  4QV2 A;  3E9G A;  2WJY A;  2QMU A;  2EQM A;  1Q95 G;  4Q5W A;  4M77 B;  2D9R A;  2X0K A;  2ENM A;  2KR3 A;  2NUT B;  4X1V A;  4P3Y A;  4P25 A;  2HBW A;  1UEB A;  5DN6 A;  1GRI A;  4LDW A;  5GAN 5;  1BBZ A;  1V0E A;  4F04 B;  2KVO A;  1JBM A;  1UUE A;  4IIM A;  1G83 A;  3JQR A;  4PK4 A;  2KI7 A;  3ZEH A;  2ROL A;  3SD4 A;  3MET A;  4OMQ A;  3DLM A;  5LJ3 h;  4B9W A;  4OMF B;  3A8J A;  2VWF A;  1ZBJ A;  4M53 A;  1M9S A;  2ZAE A;  3RY8 A;  1YHQ T;  4G6I A;  3ZUG A;  1MHN A;  2GGR A;  4Z4W A;  1SM4 A;  1QUF A;  4IUP A;  2OTJ Q;  3CCS A;  1F60 A;  4RCC A;  1T6Y A;  3I55 B;  1WJS A;  3S3O A;  4Q7J B;  1KG1 A;  4XTX A;  2E41 A;  3VS3 A;  3OEE A;  1AT1 B;  3VRZ A;  5L23 A;  2EYZ A;  1Y0Y A;  5CIU A;  4AVZ A;  1WTH D;  2E4H A;  1YJ9 Q;  3NTK A;  3QG1 A;  4FIB A;  2PE3 A;  2V4D A;  4P26 A;  4TMW A;  2P3M A;  3OZU A;  2KVQ G;  4QVZ A;  4A4G A;  3EAE A;  4C8Q D;  3QZ9 B;  3G6E T;  4Z4Y A;  3U6K A;  2CRV A;  2A28 A;  1ZM2 A;  4Z4S A;  3AVY A;  4M7D F;  3WY9 A;  2V1R A;  1D0Y A;  4QKU A;  4FT4 A;  2WZP P;  2DYB A;  2HZY A;  1JJ2 P;  3NTH A;  4XU2 A;  2X35 A;  2BTT A;  3JCM b;  3CCU A;  2DM1 A;  4PLI A;  2HAX A;  1MRZ A;  2V7X A;  1VQ4 Q;  2KRN A;  3I5S A;  1K9M D;  2R5M A;  1VQ6 T;  3E9F A;  2DFU A;  2PNI A;  3CXC S;  1WHL A;  3A5Z B;  4DOV A;  2J7I A;  2B8A A;  4F7U E;  4XU0 A;  5I2S A;  4BE1 A;  2XG8 D;  5KE2 A;  1E6H A;  1SKQ A;  1QKX A;  3VO2 A;  4KH1 B;  4M78 B;  2DIL A;  3JB9 H;  1TSF A;  2GQI A;  5GAM g;  3CCL Q;  2K2V A;  3P8D A;  5FU7 B;  3ES9 A;  2LCL A;  1JNY A;  1VJS A;  2OBR A;  2CP2 A;  5DLQ E;  1KQS B;  1I8F A;  5IHI A;  4OMN A;  1KC8 R;  3OSV A;  3GIB A;  3QDR B;  4EMG A;  4J6Y A;  1Q7Y R;  4II1 A;  3CMM A;  3A8I A;  4G7W A;  2A3L A;  1AWO A;  4IKF A;  4PJN A;  5KYW A;  1YIJ Q;  2FO0 A;  4RCZ A;  3PA2 A;  4A4H A;  2EBP A;  2K79 A;  1WHH A;  1WJR A;  1TWB A;  1H8H A;  4MDW A;  3BDU A;  5C6S A;  5B6I A;  1W2B B;  1OB2 A;  2IPO B;  2ZZD A;  1RQP A;  1VQ4 B;  3CC4 T;  1EFN A;  2H3E B;  5GAO r;  3CCR A;  2LC4 A;  3Q39 A;  3L42 A;  2VBU A;  5KNL A;  2DJZ A;  1BLI A;  1ZSG A;  4J9C A;  4ELY C;  3OW2 P;  4Z4U A;  3G4S Q;  2CP5 A;  1H64 1;  7AT1 B;  5J3O A;  4OOX A;  1VHE A;  2E3H A;  4IUU A;  3H9N A;  4TMT A;  3CCJ A;  3I55 T;  1S4M A;  3UF4 A;  1JB9 A;  3CCL B;  2HEQ A;  4O5V A;  1AVZ C;  1B23 P;  2C06 A;  3FJO A;  3M0R A;  3WXM B;  4FK8 A;  2J6K A;  4X34 A;  3V8L A;  4MDX A;  3QBY A;  1FYN A;  3GF5 A;  3EGU A;  4JPB W;  1YI2 A;  5D6X A;  1D3B A;  4M75 D;  3PMT A;  2QEX B;  3X25 B;  3LH0 A;  4ZGN B;  2JS2 A;  1RUW A;  2XD0 A;  4X8I A;  3H0F A;  3FJ5 A;  1YIJ B;  3I56 Q;  3BNW A;  2E1B A;  2LMJ A;  1K28 D;  1D1A A;  1QP2 A;  4ANJ A;  5GAN g;  4DNR B;  3CD6 A;  1IHW A;  3Q38 A;  3CME A;  3A8H B;  4M75 F;  5IXB A;  1YJN B;  1FRN A;  1VQN A;  2KMT A;  1R5N A;  3A8G B;  2Y4X A;  2LQ8 A;  1T0H A;  2HQH A;  4QW2 A;  2W6I A;  4HCC A;  1K73 U;  1OZ2 A;  2ZL5 A;  4X05 A;  1ZLM A;  4LDX A;  3ISX A;  1HSQ A;  1MNE A;  1OB0 A;  4ZTF A;  1V0F A;  2KDS A;  3WNB A;  5IYQ A;  3TRE A;  4OMP A;  2KYM A;  3CXC A;  2A7Y A;  3G4S B;  2K7A A;  2V8K A;  3RUX A;  2QA4 B;  5LMZ A;  2OTJ T;  1VLY A;  2B7C A;  1N0U A;  4HCZ A;  4OGC A;  2M16 A;  2KXD A;  2VJI A;  2GK6 A;  1FNM A;  1VQ8 T;  1UB4 A;  1IO6 A;  2RHZ A;  1I7P A;  1YJ9 T;  3RR6 A;  5D7U A;  1VHO A;  4M4S A;  4B48 A;  1AOJ A;  2DYI A;  3BCD A;  2X3U A;  4OPS A;  4FN5 A;  2ZXH A;  4C8Q E;  2L2P A;  4AC9 A;  3ASQ A;  3I56 B;  1BCM A;  1R8O B;  4J9E A;  4O6J A;  5M9O A;  4P1V A;  2X53 S;  1PSF A;  2X6X A;  3GLX A;  1ZX6 A;  1J3T A;  4N3N A;  1YJW T;  5FWB A;  1VQ4 T;  2RJE A;  3OFN A;  3BQJ A;  1QFZ A;  4EDU A;  2EQI A;  2RHY A;  3X20 B;  4C92 A;  5GMK i;  4ATO A;  1QWE A;  4FYX B;  3ONU A;  3EG1 A;  2BMW A;  3H8Z A;  4M0L A;  2EFG A;  3HKS A;  4N4H A;  4MZP A;  1R5B A;  2RM4 A;  3ZZU A;  1AHJ B;  4ZGE B;  2CF4 A;  2BPO A;  4J9B A;  3CCU Q;  2VBV A;  4B3X A;  2BE7 D;  4AFS C;  3M5A A;  3CCL T;  4GLM A;  4D6W A;  3L2U A;  3EFR A;  2JS0 A;  4XOR A;  5GAO l;  4L8J A;  2VBT A;  1MV3 A;  4JDS A;  1N8R D;  1QGA A;  3H0I A;  4MYU A;  3ZIA A;  4TT3 A;  1QVG B;  3EG9 B;  2GQF A;  4C92 C;  2RI2 A;  3VRY A;  1EZZ B;  3M0T A;  1YBY A;  2RJC A;  1YIJ T;  5DSZ A;  1D1C A;  3OEH A;  3M4Y A;  3JB9 G;  1ACM B;  3MEW A;  3FB9 A;  1RAE B;  3SDZ A;  2K3B A;  2QYZ A;  2K57 A;  1XTD A;  5HY6 A;  1Q86 C;  4J9H A;  4N0A C;  2HSE B;  4IUQ A;  2OK8 A;  2XMF A;  1PKV A;  3OPO A;  1YWO A;  5J3B A;  1QG0 A;  5LJ3 j;  3EH1 A;  4LUD A;  2CRE A;  1M90 U;  2C4T A;  2HLD A;  3LH5 A;  3OKX A;  3JV3 A;  1SEM A;  2QTV A;  4XQF A;  4J7I A;  1BI2 A;  2C0O A;  3B82 A;  4RJL A;  4EH1 A;  2QXF A;  5FU6 B;  1KQS P;  4BI3 A;  1MUZ A;  2XDD A;  2OTL T;  3OE7 A;  2DIE A;  3G4S T;  3LW5 E;  2RNA A;  3A3G A;  1U06 A;  1G3T A;  2PLF A;  3CCU B;  4FYY B;  4XD7 A;  3T56 B;  3CCR Q;  3OZW A;  4PC7 A;  2PVG B;  4ZNX A;  4R55 A;  4M7D A;  2PVD B;  1K8A C;  1W2B P;  2X85 A;  1T6X A;  3OS2 A;  1VYT A;  2JMA A;  2LX7 A;  4B9X A;  4B3F X;  2BE9 B;  1TU0 B;  1KZL A;  1RLP C;  3M4G A;  2C2W A;  2DTO A;  3NHN A;  1WOO A;  4M4Z A;  4M75 E;  3ASS A;  3UT1 A;  3I56 T;  1QGY A;  2PQW A;  2RQT A;  4YEJ A;  1OI1 A;  2WSE E;  4P3I A;  1SSH A;  2CT4 A;  2E6Z A;  2HDN B;  1NZ9 A;  1VQK B;  1VQP A;  2JT4 A;  1MND A;  3I1F A;  1KD1 R;  3PUM A;  3W2E A;  5FRM A;  1YI2 Q;  2XK0 A;  1GFD A;  3SB2 A;  4RTV A;  1QP3 A;  3OS1 A;  5HZB A;  4M7D C;  1M1K R;  1WPC A;  3X28 B;  1UE9 A;  2I0N A;  5FLX E;  4KUL A;  4RTY A;  3OY9 A;  1EX4 A;  3W5H A;  4J8O A;  1GFC A;  1BMF A;  3QWY A;  3CD6 Q;  2KE9 A;  3L2Z A;  3CME Q;  1UHC A;  4BY6 B;  1E79 A;  1W9X A;  4OPO A;  2LT1 A;  4AFZ C;  2LZJ A;  4OB3 B;  5CKE A;  5HK3 A;  1Y96 A;  2VNK A;  3CCR B;  1D0X A;  1WQW A;  2FPE A;  3ASP A;  3G71 A;  3ME9 A;  4Y91 A;  2DA9 A;  1NB9 A;  2LNV A;  2YDL A;  1ZUY A;  2XOK A;  3AVU A;  4E7K A;  5A8A A;  3NTI A;  2QDX A;  3JCM X;  5I21 A;  1Q86 U;  3CCS T;  3VS1 A;  3Q6Q A;  4LDV A;  4PAA A;  3PMI A;  4HVU A;  3OYL A;  4JJN K;  5I11 A;  2XDP A;  3ULR B;  1FX0 A;  5IYR A;  3QXE B;  1N6A A;  2RPN A;  1XFO A;  2OBT A;  4AFQ C;  2LJ1 A;  2QG9 B;  4XLF A;  3PVD A;  4XKV A;  1W1F A;  4PAB A;  2ZZF A;  4B3G A;  4CRI A;  3HFO A;  4WQM A;  2FB7 A;  4XQ3 A;  4DA4 A;  2P84 A;  1KIK A;  5FRO A;  2CUB A;  3OYG A;  2R9V A;  3LVB A;  2KSS A;  1OB5 A;  2W6J A;  1COW A;  1OX8 A;  3CD6 B;  1R5O A;  2L0A A;  5TR9 A;  1IRE B;  1H3Z A;  2V7V A;  3CME B;  4HVW A;  1JEG A;  1N9S A;  1K76 A;  2GNC A;  4KKS A;  2K5F A;  1Q81 R;  3CCU T;  4PJL A;  1K8A U;  2HD0 A;  2X4J A;  3UDC A;  2ED1 A;  4AFU C;  3QWX X;  2FRW A;  3FIF A;  2EGC A;  1VF7 A;  2KRM A;  1VLO A;  4RDK A;  4WZE A;  3HAG A;  4YAF A;  1K1Z A;  4M75 A;  2LCS A;  4G7X A;  4BUG A;  5LJ3 e;  2QQ9 A;  4Y7C A;  5J26 A;  2VKN A;  1WLP B;  4HE5 A;  2YRC A;  4XLH A;  3TEE A;  2YUQ A;  1Y7X A;  2JTF A;  2LZ6 B;  4TSF A;  4GBQ A;  3CP8 A;  3PNW C;  3TSZ A;  1LOJ A;  3ZZT A;  2EFI A;  2DPP B;  1YHQ Q;  2NLU A;  3PIO A;  3WVD B;  2DL3 A;  5FW9 A;  2JMC A;  3KL9 A;  2EYX A;  2E64 A;  5KYY B;  2OX7 A;  2J6F A;  4P5N A;  1VQ5 A;  1QVF B;  3RKX A;  2BM0 A;  2RC6 A;  5KE3 A;  2ZZE A;  2E1R A;  4IW3 B;  3ZBD A;  1E62 A;  1QVG P;  2DXT A;  3W2F A;  3RES A;  4B44 A;  3CPF A;  2YRV A;  1D0Z A;  2WR8 A;  1WA7 A;  1KC8 C;  1Q7Y C;  2EJG A;  3VS0 A;  4C0F A;  5HKC A;  4J9G A;  1VOM A;  3G6E Q;  3CCR T;  1DAR A;  4GQN A;  3GPL A;  1QFJ A;  2J06 A;  5FO0 A;  3KBG A;  2Y90 A;  1UD6 A;  5GMK e;  4M7D G;  1TUC A;  4PLL A;  3DB4 A;  1AMO A;  1F1B B;  4LUE A;  4QQD A;  4PFZ A;  2XU8 A;  3MEU A;  4X7E A;  3CMA A;  2ZGW A;  2GBQ A;  4A53 A;  1FNB A;  2GJP A;  4AG1 C;  3JB9 I;  3CCJ T;  1N06 A;  4BI4 A;  1VQ6 Q;  1NB0 A;  4FYV B;  1FXX A;  3ER0 A;  2HMA A;  4LDU A;  4FU6 A;  1M1F A;  3SWN A;  1O9S A;  1CNF A;  1QCN A;  1YHQ B;  2CH4 W;  4J6W A;  1YI2 T;  1M5Q 1;  1XQH A;  2JTM A;  1QUE A;  1Y57 A;  3HTR A;  2RF0 A;  3P27 A;  3OYY A;  1GCQ A;  5IYP A;  1I1J A;  1WP6 A;  1IXD A;  3CD6 T;  2KK4 A;  2CGH A;  3CME T;  1QKW A;  4P6Y A;  4P9S A;  3BDL A;  1ZUU A;  1VQP Q;  1VQN T;  4Z4V A;  1IB0 A;  1IB8 A;  1P92 A;  3G6E B;  1PJ7 A;  3JCM V;  2C0T A;  2K2M A;  1VQL A;  3SWN C;  3LGF A;  3EG0 A;  3CCM A;  1X27 A;  2VNJ A;  3SJZ A;  1NJI R;  1IRX A;  1TUI A;  4BDZ A;  1SSF A;  4WTO B;  2CK3 A;  2YHT A;  5KCO A;  3EHR A;  2ZPG B;  1UJ0 A;  4C43 A;  1GCQ C;  3VO1 A;  1WGS A;  2JM8 A;  5DLO A;  3V7A A;  3CC4 Q;  1TUD A;  3OYC A;  1VQ6 B;  2DJQ A;  3G71 Q;  4C92 D;  3CPW B;  3HSB A;  1ZSZ C;  4TN1 A;  4QVA A;  4J5Y A;  1X6B A;  2NYS A;  2DY1 A;  1NG2 A;  4C8Q B;  4PC1 A;  3UWN A;  2F2W A;  2MOX A;  2XGJ A;  9ATC B;  1TLL A;  5HKK A;  1Q86 D;  3LO8 A;  1MMA A;  4C92 F;  1BIB A;  4BE0 A;  2RMO A;  2DKG A;  2H3J A;  1UHF A;  4G1V A;  1KMH A;  3QJY A;  2LJ3 A;  1M30 A;  1OV3 A;  2YLB A;  3JQQ A;  2RQU A;  3QJ6 A;  2XND A;  1VQP B;  2ESW A;  2VV5 A;  3AVT A;  1FMV A;  1VIF A;  4B4D A;  2FPF A;  3VUZ A;  1NM7 A;  1V5V A;  5IT9 E;  3JCM Q;  2X51 A;  2X3X D;  1UJY A;  3AT1 B;  1EP1 B;  1KK1 A;  3EGD B;  5FNZ A;  1ZBX A;  3VNU A;  2VZL A;  5LJ3 d;  1ARK A;  1FDR A;  1KK3 A;  8ATC B;  1MMD A;  4M75 G;  2YWE A;  4XLC A;  3H0H A;  2DIQ A;  3VKI A;  2ZZQ A;  1K8A D;  2HBP A;  3CC4 B;  3JCM h;  1BKB A;  2B5O A;  3L2Q A;  4PJO F;  2JZ2 A;  2JN0 A;  1X6O A;  2DL8 A;  3G71 B;  4DQL A;  1DJ7 B;  4C5I A;  2JXB A;  1KJW A;  2RD1 A;  2COZ A;  1BJK A;  4Z4R A;  1K4U S;  3UPU A;  1G8X A;  4KKT A;  4A54 A;  5GMK m;  4BPR A;  3GNF B;  2QN6 A;  4TMV A;  4KGZ B;  4BD3 A;  3BC9 A;  4LBW A;  1UD2 A;  1Y07 A;  1QGZ A;  4IUR A;  1PCX A;  1YFN A;  1KK7 A;  1VQ8 Q;  1ZM3 A;  4AF6 A;  2D8H A;  3AVW A;  2CUD A;  4M7D D;  2R58 A;  4CC4 B;  3ZZ0 A;  1IGU A;  3GNG A;  3O5Z A;  5KYX B;  5CK9 A;  1I8D A;  4NNJ A;  1OEB A;  1GAW A;  2OI3 A;  4A4F A;  3GSI A;  5KH6 A;  2RI5 A;  3PT9 A;  3W5U A;  3AGP A;  3JCM W;  2KRS A;  1E3Z A;  2D0N A;  4ZCI A;  3MCA A;  5GAN 6;  5GMK h;  2YXY A;  1FRQ A;  1YJW Q;  1IZ6 A;  2QI2 A;  2VYT A;  4DNT B;  4U9U A;  3D26 A;  5EMN A;  1NEG A;  4J6X A;  1Y71 A;  4C0G A;  4LBV A;  1TTT A;  4Y9U A;  1UD4 A;  1N8R U;  3V7C A;  1F20 A;  3CMA Q;  1I18 A;  4M75 B;  2AKK A;  1UEC A;  4B6M A;  4ZN3 A;  2OTJ B;  2AIR B;  2JJ9 A;  1WSV A;  2PIA A;  3VNV A;  1VQ8 B;  5CKH A;  1KQ2 A;  3UA7 A;  4AT1 B;  1DDI A;  1PJ5 A;  4C0D C;  1UGS B;  4RD4 A;  2K9G A;  1X69 A;  4JRK A;  5E6T A;  1YJ9 B;  4BI8 B;  1VQP T;  4EIK A;  2FEI A;  1W34 A;  3HL8 A;  1YIT A;  1NYF A;  2YWF A;  5LJ5 e;  4M77 F;  3VU3 C;  3RMS A;  3M59 A;  4ZGD B;  1JJ2 S;  3AVV A;  1G3S A;  3NMZ C;  1ZA2 B;  3U2Q A;  3CEY A;  3OYI A;  2C0I A;  2NUP A;  2O4X B;  2X3W D;  1KD1 C;  3KEW A;  4YAL A;  1YJW B;  2L8D A;  3TU4 K;  2DMO A;  1QMC A;  3G71 T;  1VQL Q;  2DF6 A;  3LQ6 A;  2OTL Q;  4C92 E;  2QGG A;  3CMA B;  3HFN A;  2GRE A;  3M58 A;  4RTW A;  2V7W A;  2F2X A;  2O9S A;  3ASR A;  4OVA A;  1I5O B;  4C5G A;  1H42 A;  4RKU E;  2KY9 A;  2RJD A;  3TQ7 P;  4OMM A;  4KT0 E;  3OA6 A;  1OYX A;  1IJF A;  4C5E A;  3M54 A;  4MMK A;  2DXU A;  1WNL A;  1BCO A;  2F5T X;  1KHI A;  1TVC A;  3A8K A;  2HCJ B;  3CPW P;  1KC8 D;  1VQ9 A;  1EFT A;  4FWT A;  2M1H A;  1Q7Y D;  4FW2 A;  2GPJ A;  2IIM A;  1BIA A;  1QFY A;  1FX7 A;  1M8M A;  2WZN A;  3GVJ A;  3OS5 A;  3QYG B;  2ZBU A;  1PJ6 A;  4P12 A;  1JB0 E;  4CQJ A;  4M1K A;  4ZTJ A;  1EWY A;  4OPV A;  4DK1 A;  4WZK A;  5BSX A;  3URG A;  1VQL B;  1SRL A;  2OK7 A;  2KAF A;  3VS4 A;  2DER A;  2OTL B;  2G6F X;  3OW2 S;  1W0J A;  3UA6 A;  2CC2 A;  2VC8 A;  2CZ7 B;  1N08 A;  1UMK A;  2RA2 A;  4C0Z A;  1E43 A;  4A63 B;  1B34 A;  2DRK A;  1Q81 C;  3CCV A;  5THX A;  5GAO q;  2VYQ A;  1B3Q A;  1M3C A;  1NYG A;  4M78 F;  3OYF A;  4V2S A;  2EKO A;  1FMW A;  2KYB A;  3LYI A;  4K11 A;  2ZL7 A;  1HZE A;  5GMK l;  1CKB A;  1BB9 A;  2GCX A;  5GAO p;  2LQW A;  2FVU A;  4M7D E;  1DDG A;  2J6O A;  1WOS A;  2XKO C;  3THK A;  3CCS Q;  1VYU A;  3VYG A;  3OYK A;  1H8E A;  1SKY B;  4X07 A;  1VQ5 T;  5GJW B;  3FC3 A;  3CES A;  4ZCL A;  2YUO A;  1GXI E;  1RAF B;  4D8D A;  1AWW A;  2DXB A;  4L6V 5;  4RTX A;  3BE3 A;  2BN4 A;  4TMX A;  1SPK A;  1C6V X;  2ZTN A;  4XN3 A;  1U1S A;  4FL6 A;  1EP3 B;  1ZM4 A;  3VS2 A;  1JJ2 A;  3R6O A;  2VBS A;  1E1R A; 
#chains in the Genus database with same CATH homology
 3HTR A;  1PM3 A;  2DOG A;  3H9N A;  2DYI A;  3A1P A;  2F1L A;  2QGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...