4BPRA

Ferredoxin-nadp reductase mutant with tyr 79 replaced by phe (y79f)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
291
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLFSIASTRHGDDVDDKTISLCVRQLEYKHPTVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title A Hydrogen Bond Network in the Active Site of Anabaena Ferredoxin-Nadp(+) Reductase Modulates its Catalytic Efficiency.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 90
structure length 291
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4bprA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4bprA02
2BPOA 1XB2A 4N3NA 1CNEA 4PGOA 2VYQA 4P3YA 4TN1A 4G1VA 4RCZA 1JA1A 2DERA 1D2EA 1TUIA 1K8AD 2BSAA 4LBYA 3FPKA 4YAUA 2E1RA 3W5VA 3I1FA 3CXCB 1QFYA 4RCYA 1NJID 3JQQA 3ZBTA 2NPFA 1FRQA 3U2QA 1YITB 4PC1A 4P6VF 1BJKA 4PC2A 1OGJA 4RD6A 1J9ZA 4YAFA 4AF7A 3VO1A 2AHOA 1R5BA 3P27A 4MYTA 2J7KA 3QFTA 2B5OA 1B23P 5AN9A 5H5JA 2ZITA 4DQKA 3CW2A 1QVGB 3G6EB 3OW2B 1ZM3A 1QGYA 1SKQA 3G4SB 1N0UA 1H42A 1VQOB 4B4DA 1D1NA 3CB4A 1SM4A 1QH0A 5HXBA 4J0QA 1IJFA 4M2LA 1VQMB 1FNCA 1FRNA 1UMKA 4Y9UA 3W2HA 1EFUA 4YALA 1W34A 3QFCA 4TMVA 1Q82D 3W5UA 4R71A 2FX3A 4B48A 1N8RD 3LYUA 2OK7A 3SJZA 3PENA 2HDNB 3I56B 1BX0A 4PC6A 1VQ7B 1QGAA 1EWYA 2YWEA 3CMAB 3CCSB 3B82A 1YIJB 4Q7JB 2XNJA 3CCUB 3A1FA 2BM0A 1Q86D 1KQSB 4PC7A 1OB5A 3CPWB 4DQLA 4H9GA 4FN5A 1EFTA 4NCNA 2BV3A 4F7DA 3AVXA 3B8HA 1FDRA 3P26A 2RC5A 1YJWB 1TVCA 4B3XA 1KC8D 3OJXA 1FNMA 3CC7B 1OGIA 1EFCA 3QFRA 3CD6B 4HE5A 3B78A 2VNHA 2D74A 4ZCIA 1VQ6B 1DG1G 1F20A 3MCAA 5H59A 1KK2A 4YHBA 5KSWB 2XNCA 1GAWA 1GJRA 1R5NA 4RD0A 3W2GA 2VNKA 3W2EA 4C43A 1M1KD 4FWTA 3CC2B 1AMOA 2DETA 3LRXA 1CNFA 3VNUA 1G7RA 5GV7A 1GVHA 4ACBA 2C77A 1QFJA 4BPRA 1G7SA 3JQRA 4RD2A 2OTJB 1QUFA 3ZZUA 3LO8A 5JBQA 1JJ2B 3U6BA 2BF4A 1YI2B 4WQMA 1D8TA 2BGJA 1YJ9B 1FNBA 1GR1A 1H85A 3CCEB 4FK8A 3MHPA 2C78A 1S72B 4QHYA 3CCVB 1NDHA 3G71B 3W2FA 2DCUA 2YWGA 4LBVA 4K1XA 1EP1B 1BQEA 4RD4A 5DSZA 3VMFA 3WBKA 1KTVA 4LC0A 1QX4A 4ZCLA 3WXMA 2GPJA 1XE1A 1TLLA 1DDIA 2HMAA 1DDGA 2CRVA 4N3GA 4UAJA 2X3UA 3AGQA 1I7PA 3CCMB 3ZZTA 1S0UA 4ZV4A 1QG0A 4M53A 3WYAA 3AVUA 2QTZA 4RD1A 2QN6A 3J81k 1B2RA 3MMPA 1E63A 1IJEA 3QFSA 4MYUA 2PIAA 1U2RA 1KD1D 3AVWA 1VQNB 2YWFA 3AVVA 2CNDA 1HA3A 3CC4B 1VQ8B 4ZCMA 1M90D 1EP3B 4M0LA 3U6KA 4TMWA 1QUEA 1EP2B 1FNDA 3AVYA 1W2BB 1VQLB 5GV8A 4U9UA 2OTLB 3OJWA 3OZWA 2DEUA 2VZLA 3OZUA 4EH1A 3WNCA 1ELOA 1YHQB 2BMWA 1DARA 4TMTA 1BX1A 1KJZA 5TV2A 4Y9RA 1KK0A 1QFZA 4M1KA 4RD3A 4RJLA 3QSYA 1F60A 3JQPA 2QA4B 1Q7YD 1K9MD 2QTLA 2VNJA 1E62A 4AF6A 3E1YE 1IB0A 3ES9A 4M4SA 2R6HA 3V76A 1TTTA 2DY1A 1KK1A 1YJNB 1W35A 3OZVA 1ZM4A 2HCJB 1GAQA 1G7TA 4LBZA 3ZBUA 1W87A 3CCJB 3E20A 3WY9A 1VQPB 3CCLB 4NBSA 1JB9A 4ACAA 1KRHA 2QMUA 1AIPA 1E64A 1VQ4B 3ZC3A 1Q81D 4HE6A 1VQ5B 3WNBA 4ZGQB 4YAWA 1ZUNB 2GQFA 4Y7CA 1R5OA 4TMZA 1VQ9B 1JA0A 2VNIA 1VQKB 3CRZA 1QVFB 5EMNA 1GO2A 2XEXA 1EXMA 4B43A 1WDTA 2RC6A 3LVBA 2YWHA 2PLFA 1ZM2A 5TY0A 1CQXA 4G1BA 3VO2A 4YAOA 1A8PA 4QFMA 4ZGNB 4TMXA 2BGIA 2OK8A 3QE2A 2QDXA 4B44A 3CMEB 2BN4A 4LBWA 2BM1A 4PC3A 1G7CA 1ZM9A 3I55B 3AVTA 1N0VC 1KK3A 4AC9A 2EIXA 3W2IA 2B7CA 4B47A 5THXA 2EFGA 4C0SA 3CCRB 3WNDA 2PMDA 1K73D 5FA6A 3FJOA 1JNYA 4IW3B 3CCQB 1OB2A 2B7BA 2BVNA 1QGZA 3VNVA 3W5HA 3AGPA 3ZZ0A 5TR9A 4G5GA 3WBJA 2QEXB
chains in the Genus database with same CATH superfamily
3F73A 4HAZA 3PDHA 1WB9A 2IXTA 5I4KA 3BSYA 1XVUA 1CRQA 3RYFB 5KJ6A 2R87A 4L73A 2C61A 3IVXA 4PLCA 4G7WA 1YV9A 2P0EA 3GJ8A 1XUOA 2YUTA 1S3IA 4OYHA 5FFFA 1HFEL 2FMUA 1IU9A 2AYZA 2YWXA 3VR0A 4DSUA 4ZK6A 4KFCA 2C83A 4MR9A 1GFWA 4XQGA 5KWJA 1TYEB 1VMKA 1IXKA 1V5FA 5IUJC 2G9NA 1BMQA 1TOAA 2ZJ0A 1TC1A 3MIIA 2MOKA 1M33A 5T6BA 3I01A 5BPFA 1QQAA 1T1EA 4W7IA 5JRZA 1FYDA 1P0MA 7ADHA 4IV8A 4BGEA 2CXPA 3TTVA 1FMJA 3EZNA 1KOJA 1KVSA 3PT9A 4REMA 4LBYA 4GOMD 2ZJ7A 4HNGA 1IUOA 3GLGE 5FPYA 1QTNA 1VSQA 3CVJA 3G3EA 4XPIA 1NW3A 3ZGVA 5FWNA 3LL7A 2TECE 3TRHA 3PR1A 7GPBA 3OE7D 2PZKA 4FONA 4GQAA 1USUA 2XEDA 4UXIA 5B3JC 4TYNA 1E2EA 2GJPA 4G4IA 1SQ0A 2BUBA 4DIFA 1QWOA 1YITB 3ASVA 5JD6A 5I45A 3MGGA 4C78A 4LOHA 1HOTA 5JAMA 3UAWA 1IVYA 3KP1A 3BE6A 3IBSA 3CEMA 2Q5JA 3LDFA 3PPXA 5DWDA 4K6MA 1DAOA 4RANA 3GT0A 3VO1A 3HB9A 1A4IA 3IEKA 1X1RA 3QXXA 4FLMA 4RF4A 2QNIA 4H60A 3A14A 1QHXA 3LYHA 1U3WA 1UF9A 3NG1A 4LTNA 1BD4A 1GU7A 1L5QA 3E22B 2YRWA 5JJ5A 2H2FA 3IVMA 1I2DA 4FKMA 1I2CA 3R6TA 3VO8A 4FZVA 1GQQA 4NMWA 3ZD8A 2GK7A 4GQBA 4KSBA 1SUAA 2R5FA 4N0DA 5DKFA 5TVKA 4DQKA 2HQ1A 4WDRA 4GYJA 1P4MA 5H80A 4CI0B 1DEKA 4UZSA 3WRXA 5CVVA 5EE1A 4M6WB 5HQ3A 4FYHA 4KXFB 4E22A 2WJZB 2XMRA 1U2GA 5I7VA 1UQUA 4DAEA 3R9XA 2PKQP 3KR9A 2B61A 4N0EA 3ZJ4A 1E60A 1Z0ZA 4I66A 4ARAA 4JCCA 2IRWA 1K3TA 1GTJ1 1DCMA 2LUOA 2P2YA 3FF4A 5D3KA 4RV9A 1D1NA 3CB4A 1W9HA 4JX9A 4M1EA 4GLLA 2C7PA 2OAP1 3N8HA 3PXUA 4MW6A 5GZ3A 5DI3B 5AI9A 4X05A 4EHHA 2RGEA 4Z4EA 4BKRA 1K68A 4M2LA 3O84A 5PGMA 3HCDA 1FNCA 3MMZA 2AN9A 3MAJA 4H2DA 4CLRA 4YO8A 5HK9A 3EK2A 4DJFC 4KDRA 2D3WA 4DV4B 1MQ9A 4YJGB 1QONA 4F04A 1EFUA 4S1NA 5AICA 1LF5A 1CUWA 1SULA 3C7AA 1T9DA 3CZRA 3D6VA 3M7IA 4X20A 4ZI5A 4D0GA 1CUCA 2CVHA 2X8KA 5DTMA 4ALMA 1E1QD 2IYRA 3NWOA 1ABFA 2BHNA 2P4QA 4R71A 3BOSA 3GJXC 1R3DA 2EQBA 1Q92A 1ZU4A 3HWSA 3KOYA 5LA6B 2ZT8A 3T15A 4LCBA 2V5UA 2ZYGA 4QUJA 1J2EA 2PV0A 1YDFA 5E4TA 4OFZA 1IWBB 1EX1A 3PKJA 3SDZA 1JFSA 3IKVA 2XNHA 4JVOA 4KZPA 2G80A 4G0QA 1HDCA 3ZJUA 4HNAA 4KX3A 4UPDA 2XB2A 4EEZA 1FLNA 3ZV3A 1VBFA 2IHYA 3UG7A 1NVMB 2J5RA 4ER3A 1GRCA 2IY8A 1W8DA 2RAFA 3SM3A 1DXQA 3CMAB 1I10A 4KG7A 3HCCA 3NT2A 3TIIA 4BAGA 1ML4A 4A26A 1AV6A 1DPFA 1ULZA 2REXB 2FXVA 4LRQA 2XNJA 4Z4YA 5SZIA 4L51A 4LXIA 1QKJA 5DOVA 2FQ1A 1GXSA 8ATCA 2F48A 4PC7A 3IEIA 5LBTA 2YHSA 3TBKA 4YUWA 3C8ZA 2GYYA 4IH9A 3F6RA 2D7DA 2FPWA 4OM8A 5BSVA 3Q3AA 1YFKA 2PD3A 4EA6A 1O08A 1XA3A 2PQMA 4S24A 4UCWA 4J75A 1FDRA 1A50B 1EVQA 4R0VA 1TM2A 3KOOA 5FPKA 3OHPA 1PDVA 4KXMA 3A1PA 5F2NA 1QWSA 3QEOA 1O6FA 2XDQA 3BHMA 4ZN6A 3HJGA 1NQ5A 4WD3A 3VR6H 4KIFA 1G8YA 5BVGB 2ZSFA 5FTLA 3KBBA 4CLHA 2DPMA 1HEYA 1JHUA 1WEHA 1D07A 2WD9A 3VPCA 2CUZA 3CH7A 3RFTA 3AI7A 4GWLA 4DLAA 3EXIA 4G0NA 1CDEA 2A9KA 2K2QB 2W4MA 2IKSA 4G5YA 2Y9PB 2FSFA 4I4IA 4R1OA 1EGQA 4RMNA 4URWR 1DG1G 2EKQA 4BB5A 1ECLA 1VLQA 2DWQA 2GESA 2C4NA 2VC2B 1HKHA 1OZAA 3D2BA 4EGSA 4RX1A 1P9WA 1N33B 3EVGA 1YI0A 1GJRA 2C97A 1X8LA 1E9RA 3GT3A 5IVPA 3HLTA 4ND8B 1ZICA 1I3NA 3FYSA 1JS1X 3RTCA 2BFDA 1E69A 2BCJQ 3P0JA 1SVKA 3EEIA 3DMRA 2RG1A 4FWTA 4KJXA 1Q7RA 1NULA 2HCFA 2V65A 1CJUC 1X2BA 4F2PA 4HUTA 4TXNA 2CNOA 1ZNWA 3QU9A 3RIYA 4AP6A 1ISIA 1EFAA 5DWVA 1G8JA 4QM7A 2J7PA 2LBPA 3QBTA 2OBFA 2RHGB 3QJGA 3AKCA 4FP9A 1QO0D 2JBHA 1QFJA 1DEXA 3V46A 1M1YA 1N25A 4R2HA 3RIMA 8ADHA 5K3FA 2IDJA 2I2AA 3ONUA 1JXMA 2Q0SA 4CMJA 2G1KA 1UAAA 1T4BA 4YV2A 4ZYLA 5AM2A 3U60B 2I2DA 4CF6A 2VHJA 1RC1A 2VPPA 3BD7A 3EGCA 3L8FA 3SX0A 4BNXA 3UK0A 2PKQO 4FBMA 1N9GA 4DSOA 4EW3A 3VR2A 3IB3A 5IARA 1KI1A 3ZVKA 4AI6A 3I28A 1XP8A 4IHAA 3ECAA 3U6BA 4KNYA 4G5XA 3DAOA 2ZBGA 3E27A 4ZI2A 5JQGF 4KX5A 3B2EA 1IN4A 1NQOA 1X38A 2QXUA 1NL3A 3SQLA 3SYNA 3T3MB 2QL5A 1RQ7A 3ZKWA 4NNOA 3A9UA 3FSJX 5AHKA 2DFNA 2FR0A 2R8XA 1SCBA 4DA0A 3E9DA 1BE8A 3G0GA 3MTDA 3A2KA 1QAQA 1FFWA 2VXCA 2ZZKA 3BWDD 3LXUX 3ABSB 5TQ0A 2TMDA 4Y0VA 4JLBA 3C24A 4QGSA 4L27A 4Z7QB 2Y1WA 4I9GA 2VS1A 4Q4DA 2FZEA 2R1VA 3U7FB 3MA0A 2QMEA 5L4SA 3RS0A 4FD2A 2DWCA 4ZPJA 2FMTA 1Z08A 1K4KA 2WRZA 3P0HA 1VE7A 4Q37A 4EMTA 1YCGA 3F6CA 1LI4A 2CWDA 4G3XA 4TKZA 1P4RA 1E3ZA 1O6CA 2CHUA 2P35A 1Q0QA 1Z6YA 2W2KA 1Q2UA 4YP6A 3CMMA 2NW6A 3T5CA 2WEKA 3UW3A 4X62B 4K1XA 1B6GA 2O06A 2F1LA 5IXSA 1KYVA 2GCGA 2QQFA 1ORHA 2C4KA 3LHIA 2NYRA 3CTPA 3IA2A 4NHEA 4QPCA 5K51A 4F92B 5FAKA 5H4GA 2AN4A 4DPLA 1QX4A 4BXOA 3A7EA 1PNQA 1SUFA 5F4JA 1B8NA 2PX6A 4IINA 4A82A 3LBYA 1AKTA 1JQEA 1WPGA 2C96A 2INGX 3PC4A 3QU5A 4WY8A 5DP1A 4DCUA 1HF3A 4EG8A 4C7OA 4BCCA 4YJ2B 4BAZA 4KHZA 2WWYA 5IG2A 4EPVA 4UCFA 4B3SB 5FUXA 1DSSG 1A9QA 3VJRA 4X07A 3PGKA 2GVNA 5KKNB 4BU0A 4NEHB 2BUCA 1E6LA 3ZWKA 5A9TA 1V3VA 2HC9A 1YB6A 4IVRA 4GU5A 2NP6A 1YZKA 1FNNA 2G25A 1A69A 4RZSA 1A9PA 1XV5A 1MLDA 2A88A 1CHNA 3SC3A 2HMTA 1ADJA 4RVSA 1D9ZA 1XJ0A 1FRVA 2X6XA 1LNSA 1NV9A 2NZXA 4Q3CA 5G1PA 2M6LA 3G2OA 4M7PA 2NU7A 1VCHA 2AFHE 1DBQA 3BTSA 4I4TB 4D98A 2JFYA 3BA6A 3DAHA 2XWQA 3CVXA 5LPNA 1AKQA 3AOEC 2Z95A 3DOFA 2FN4A 2HV9A 1KAOA 3DT6A 4UFPA 3AVVA 1KAEA 1PJCA 1UMCA 4E4YA 1B76A 1RHRA 3M6VA 4MP6A 1SEPA 2I7CA 1VQ8B 2ZAOA 1TZKA 1L7MA 1UT8A 3L8CA 4HF7A 3F67A 4K9QA 4PGHA 2IFTA 4QYMA 4X7BA 2I7VA 4QLOA 1UBNA 3HYTA 3KUDA 2A92A 5AIAA 1PP4A 4CCYA 3PDCA 4JR2A 3UH1A 1HUQA 3GRUA 2Y1KA 3TZQA 4MOWA 4DYVA 1RAEA 1Z37A 4U7TB 1AUPA 3FSGA 3NW9A 4NULA 3ADCA 1C7ZA 1OUMA 3O8CA 4KR6A 2VZLA 2BI7A 3AEQB 4EK9A 4XLCA 3DHVA 2XQVA 3TEMA 2GCOA 3O9MA 4ZCRA 2IBTA 4IFTA 2WHEA 4Q39A 1Q7GA 3AWIA 2D7CA 3W8EA 3NWBA 1UJ4A 4J0GA 5THQA 1BX1A 3ORQA 1CIPA 1N5LA 4NV3A 2QRVB 2W6OA 2W4QA 5TVGA 1SC4A 1QFZA 1GPMA 3NWJA 2I8CA 3D59A 3H8VA 5EN4A 1F60A 2B25A 2Z1DA 2ISQA 2ZAYA 3TSWA 2W8BB 1SHZA 4AJPA 3A9SA 3A9VA 4Q4LA 1OVGA 4XM0A 1E94E 2IEIA 3E18A 4RVFA 3H9BA 5EJMA 3FWNA 3GFFA 4EYGA 4M4SA 2C2KA 4HDMA 1STOA 1IBCA 3M9WA 2J9RA 5HRCA 1B74A 3ACCA 3OT1A 1A4RA 1WQ1R 3QUSA 4XI9A 1T5IA 3UYLA 3QVXA 1YU6A 4HQFA 4JLVA 1BRMA 1C3JA 1UDBA 1UL1X 1Z63A 4DOMA 3WQZA 4I1SA 5REQB 3E61A 5I7OA 2A7QA 2X2PA 4BE7B 5AESA 3KB6A 2QN1A 4IG9A 1KDYA 3II6X 4O25A 1ZM4A 3HO8A 3VYSB 1ML3A 1EAYA 4CF4A 3S1SA 1J90A 1W7AA 2DHRA 1R8YA 4K6CA 4A10A 3MLAA 4HWRA 3UMGA 3N2YA 4M83A 2NMVA 2LWIA 3K30A 4GM4A 3TR5A 3WJ7A 4OJMX 5EP3A 1QS0A 1M2HA 4L7VA 1MB4A 2XUPA 2MJLA 2Z43A 1KYTA 1QNLA 3RK0A 1Q1AA 5FPHA 1PYOA 1KC3A 3KD2A 4JI6B 3O4GA 5C5EA 2VDNB 3DLPX 3OCXA 1VHTA 2ZCJA 3PEYA 3IQHX 2ZRAA 3AUJB 3VU0A 1FJHA 1WMEA 5B1EA 4OLJA 2HPAA 3EWSA 1G64A 2BKLA 2JLSA 3AF1A 3MMXA 5KYUA 1L7OA 2R8YA 5HZAA 1SUEA 3OEYA 5EEHA 4JLWA 1JQ5A 1UBMS 3BTVA 2XB9A 3H05A 4K26A 4REOA 2EFDB 3ISXA 1WW2A 2H52A 2HO5A 5E3JA 1NKSA 2R7KA 3KE8A 1XK7A 4D4KA 3LWBA 3ONNA 1U7UA 2IYWA 3B6EA 5EG5A 2FZCA 3HB7A 3IEPA 4B6RA 1L4EA 3RS4A 3G13A 2C3OA 1UD4A 3KYIB 4H7IA 2ZYHA 1WBBA 4NOLA 1B15A 2ARKA 1WXHA 2FUNB 3GK3A 1SUIA 2G06A 5F1YA 4Z8XA 2SECE 1JQBA 1LKZA 2YXDA 4IRXA 4MA0A 4ASUD 1HLDA 5LB4A 1RM0A 3DAGA 1E8DA 1NLYA 4Y7CA 3U80A 3ZLTA 1NYQA 3OF2A 4Q0MA 1Y0YA 3AR7A 2UZAA 1QAMA 5LLDA 1BW9A 2LPMA 1XMOB 3OZIA 1OBCA 2Q6IA 2DCMA 4QT0A 4V0MA 3VR5A 4XFJA 2Q49A 4GM0A 4RY8A 4K88A 2XT6A 1SBTA 1EFRA 1EXMA 3WISA 4ETNA 3IL2A 1W2HA 1QBGA 3REQB 2PLFA 4MARA 4XYGA 1NP7A 5E0KB 1SPXA 4UEWA 5TIIA 3ZDBA 2O8EB 1JJIA 4WCDA 3ESRA 4N0MA 3H11A 3SBOA 3DYVA 3U49A 5JVDA 4X44A 2C3YA 4EBFA 1K9VF 5TGZA 1BDHA 1XAHA 1V37A 3UKOA 2O1SA 3LAWA 4BMVA 2IHNA 1YDGA 4FB4A 1ZH6A 1PNOA 4JLUA 1T9GR 3A4YA 3T12A 1O58A 2WA1A 4M9UA 5HYVA 2VDKB 2QTWB 3Q3HA 4JODA 1Z7GA 4DJDC 4DNXA 2UXCB 4B44A 2ECPA 2FPSA 1MO2A 1DBPA 3D3NA 4EY7A 2R47A 4JC8A 2EL7A 3K0KA 2E3JA 2QSZA 4MUXA 3WFJA 1NBHA 4HQ6A 1R4NB 3GLKA 2JIZA 5DN6D 2DQ4A 1N0IA 2A2ZA 1G66A 1KSHA 3JD3A 1WNTA 3WNVA 3ENZA 5IP5A 3SPXA 2JGJA 2YFYA 3PS9A 4X60A 5HSGA 4X84A 2EFCB 5JCJD 2G77B 4M76B 5BXYA 4LDPA 4YAGA 5G40A 3GP8A 1ZU5A 1YQDA 1DJMA 1J4AA 2YFKA 3WV5A 4LF8B 4G65A 4CG3A 4HP8A 3O75A 5J58A 2BZGA 1UAGA 3PUVA 3MTAA 1QGZA 4WFKA 1E6EA 1VLJA 4IF4A 5EMKA 1SVOA 3L7AA 1X8XA 3BT7A 3HBLA 5WRFA 2AMVA 5ELXA 4DABA 2PR7A 4PBTA 1GSIA 1SOUA 3CWZA 5KTKA 1N8TA 1X39A 5JPIA 4W9RA 4BB9A 1CFJA 3IP6A 4LDNA 3USCS 4ZGBA 4A6EA 1PR0A 1MW9X 2BDTA 2J9YB 2QTTA 3Q7IA 5AKYA 5TB5A 2ZRPA 5EHZA 1JHYA 2YV4A 5ALNA 1D2EA 1TUIA 5HZHA 4LF7B 4HMQA 2WHPA 3GJ5A 2WUWE 5EXEA 2FN8A 2QGZA 2QX8A 2RHJA 5EE3A 2Q3CA 2JGDA 4Q3BA 3X1DA 4B8YA 5FWXB 4V02A 3O1IC 1ZD3A 2K4MA 3JSXA 2HR1A 1GARA 2JCXA 4IG4A 2PJRA 2JCYA 1BS2A 2YJ6A 3C45A 1Y7HA 4WTOA 3UPTA 3E9CA 5JFGA 3GBVA 1SMKA 1E2UA 5INTA 2O4UX 3TJMA 5AQ1A 2ONZA 4NATA 1CE8A 3Q9UA 2TYSB 3WYFA 5IJZA 3L4SO 1BMFD 3QXGA 1GN8A 1BWPA 3B52X 5MHTA 1GZ7A 3BGVA 3FN4A 3PHBE 1VKNA 5FFNA 3WFZA 3A31A 4JY7A 4KWTA 4WY2A 1XAIA 4LQCA 4FHGA 4Y6LA 5A89A 2XUOA 4WHMA 5F21A 2CXOA 3M33A 4S0ZA 2VHUA 1CEYA 2D2XA 3OOCA 1OI7A 3GVKA 3CRW1 1XPJA 3KPWA 4RENA 5FB3A 4Q1VA 3D3JA 1DT5A 1WHTB 4ES6A 1Z5WA 3PNSA 3MELA 5HGJA 3ZTWA 4OK6A 1V2GA 1GL3A 1SC9A 1U94A 2WMDA 1ZW1A 2YZMA 4DC9A 3KQPA 1CEEA 5EWJA 1LLQA 1R8SA 2Q99A 3CRQA 3UHFA 3PQ4A 4NFSA 4C0BA 4EMSA 2GZ3A 5K6TA 1VQ1A 3NONA 4PX2A 3PUIA 1NUSA 4Z0PA 3TW0A 3SHOA 2RGCA 3L8EA 4IPTA 3IBGA 3EC2A 2RAPA 2W6QA 3O8OB 3D6AA 4Z4ZA 1T0IA 3PHJA 1T5EA 3NH6A 5DV9A 5H68A 3VDQA 5JRJA 4DY4A 4CCAA 1L5VA 2P2SA 3LZDA 1BEEA 5J1TB 4IDFA 1K8RA 2F4NA 4J03A 5AW9A 1GD1O 5LYJA 3BFVA 2Z2JA 5KPJA 4QUAA 4D9IA 5FL3A 3QW4B 3GBSA 4G85A 3OF5A 3EQ7A 5LZ2A 1P19A 4B85A 2Q28A 2R3SA 3IILA 4UMEA 1AUQA 1MABB 3EMDA 1DCTA 2B37A 2J5KA 3W2HA 1LA2A 2FZWA 4GECA 2CL0X 1NUUA 4MVCA 1P1IA 4RK0A 4HB4A 4C7JA 4CUZA 3MRTA 4XXHA 2JAOA 4F45A 5LOVF 3VC1A 5C1PA 3EA4A 1U8EA 3FGPA 1KAHA 4CIVA 1KU0A 3ZVRA 1Q82D 2XMPA 3CP2A 3EZ9A 4ZALA 5JDCC 5AVXA 3T7EA 4A4DA 4KGXA 5IUKC 4CCWA 2R6JA 3L7BA 1NVDA 1U0HC 3ESDA 4NFLA 5FLYA 1FLDA 2PDAA 1THTA 1A8HA 1U3DA 3FFXA 4XOUA 4Z1MD 1GCIA 1F6DA 1AHHA 2Q3FA 1T0HB 3CLUC 2BEKA 2ZB2A 1L7PA 3MCVA 4WZBA 2ZTUA 1O97C 2UZ1A 4WZ6A 3RWMB 4D1YA 4UTRA 1BX0A 5KWSA 1RWNA 2I99A 3KOMA 4P84A 2ZUFA 1TZJA 3QQPA 3U4MA 1JHDA 1BDIA 2PZEA 3CCSB 4JLJA 5AW8A 1HYHA 4IIEA 3WK9A 4GEKA 3BWCA 1LBIA 4NS1A 3B1JA 1OH7A 3AZPA 1IBMB 2O8CA 2IYYA 4BNFA 4I1PA 1AQIA 4OSPA 5CFOA 1IDN1 4LXUA 2DY0A 2ZRNA 4L95C 2D3TA 4PW0A 4JGGA 5PNTA 4MAAA 2OZVA 1YI8A 2BV3A 1PJ3A 4HMOA 3C3KA 4F21A 1EA5A 1H23A 1Y3HA 3C5VA 2CHEA 2JD0A 2C0QA 2FSHA 5EMLA 1ZBDA 1JTEA 2JJYA 4M55A 3SHWA 4PZ9A 5JTTA 4JELA 2V0GA 3S8YA 2J59A 4MTCA 2G82A 4G5HA 2CLSA 3A4MA 4TL8A 5DS0A 4BP9A 3OMWA 2XDWA 1KC8D 3JASA 4F11A 5A6SA 3AUKA 3DMDA 3QKUA 3SFVA 2XYVA 3QH4A 4PCUA 2VYFA 3G59A 2ZYIA 2WZBA 2X8JB 2WTNA 5HBRA 2A33A 1E5DA 4LY3A 1PHPA 3JU4A 3O95A 4P92A 1MVLA 2F7SA 4MV1A 4HWSA 1DU4A 1XD9A 1R9NA 4GR9A 4DBZA 4HLQB 1ID1A 5BT8A 4KV9A 5AI6A 2Z57A 3NBZC 4R7GA 4H16A 4NU5A 3RRNA 4DMCA 4C08A 2ZTLA 2HY7A 4MVJF 3A3BA 1OLXA 4ZHQF 4M7OA 1GCGA 5H59A 1VSBA 5FI5A 3CB2A 4DLSA 1MX3A 2XAAA 4Y9DA 4G36A 4BRWA 1VLMA 4K86A 1NJ8A 2GTPA 3RFVA 3UATA 4DA8A 1Q7TA 4DSZA 3AWDA 4XLFA 5DX0A 4J1SA 4E1AA 2D6FA 2PZGA 2D8AA 3I9LA 1I0IA 1RWMA 2VDLB 2H9IA 3R44A 4L75A 4MINA 4B2YA 4I2VA 3IOBA 5IFLA 1H3NA 1NBIA 1C4XA 1VYHA 4OAQA 4RKWA 3HKCA 1RTKA 4G84A 3AERA 4PQGA 2ID8A 3UA3A 1NTOA 2VT2A 2W8ZA 1AMOA 3PD0A 1T43A 2QMOA 4LIPD 4DIMA 1QRAA 4F0JA 4XIIA 1LNQA 4FFDA 3ZDYB 4OX9Y 1NNUA 2UDPA 3IAAA 2AW5A 4TV9A 5U1PA 5HX7A 1DWPA 1JTFA 4H0NA 4M98A 1WF6A 4Q15A 1NBOA 1WCIB 4RA6B 3F4KA 3ROMA 3OJCA 5HKKA 1P4JA 1UC9A 1ULSA 2IZ6A 2V5VA 4X7PA 1FDIA 3UA4A 3UMRA 3CUKA 3GLVA 3AF5A 2FZKA 2FP3A 1VL1A 2K2WA 1IDOA 3RS8A 1GCUA 3H84A 2Y4NA 3FWZA 3C7TA 4JL5A 1I3MA 3WLAA 1UFQA 3MTGA 5BMVB 4C4XA 5CH5A 2WUDA 4NCBA 3E7DA 4XYEA 1D0VA 1RLTA 2CZCA 3R76A 1OH5A 5JBQA 2NM0A 4YNBA 1OXTA 4PLYA 2DHEA 1N2BA 4K0KB 4MPJA 4O29A 4CLEA 2XCOA 3ZWPA 3A1NA 4BNMA 1RZRA 4TTIA 3UWKA 1MF7A 1W75A 1DJNA 3F3KA 4OU4A 1KE2A 4HDSB 3A70A 2R8PA 3EQZA 3QV2A 3OOSA 1FNBA 4E2WA 3DZGA 4IDEA 2B35A 1V16B 4KO3S 4WACA 4LYDA 1I01A 2HU7A 1M3SA 1AMNA 1YUNA 2EV9A 2P40A 4XIFA 3NM4A 4K3VA 4F84A 2C78A 5AO9A 4QHYA 4BIIA 1OKKD 1P80A 2OL4A 3JAWA 3PGXA 2VG8A 2P78A 4ZDJA 3SG0A 1UMBB 2R8EA 3CRVA 5H81A 1OX4A 3RFFA 1E3WA 3DE4X 4R2KA 4BFLA 1GL7A 4YY3B 1G20E 5DNEA 2CHGA 1CY6A 1Q17A 1W94A 2ECQA 2YOHA 3KJQA 4WK4B 3RYHA 1O54A 2BKEA 3PBKA 1PUJA 1ECGA 4F9FA 4DEYA 5AQEA 1I4LD 3EVCA 4G26A 1ZN7A 4H17A 3WKAA 1Y8RA 1L8XA 4LX8A 5IVHA 4BQEA 3JAKA 1O6ZA 2VWQA 3D0RA 3L6OO 1JFFB 3QYAA 1CUUA 4QPZA 3QU4A 2C5HA 5C31A 1H6CA 4C2UA 2EJBA 2PV7A 1GN9A 3CX6A 4I5DA 3SVTA 2OC9A 3E9NA 3OD1A 1F5NA 4ZZIA 2H2WA 1YDEA 1ONNA 1GQYA 3NORA 4TL9A 5CM2Z 2PK3A 2IKQA 4DZZA 1EJ2A 3ZGYA 1EXDA 1YS4A 4QLAA 3CCMB 1RP1A 3L41A 4LHWA 4BV3A 3G0HA 2QSJA 3RVBA 1S0UA 1W48A 1IQRA 4L07A 4BVGA 2XD4A 3CIFA 3UH0A 3R4VA 4FCCA 1RKBA 1LVUA 4WKPA 3RJZA 2P3OA 3TQCA 3TFQA 2WF5A 1LPSA 2C4MA 1CF2O 2PBZA 4H7DA 4DJAA 2PGIA 4UM9B 1XTSA 4ZANA 3GU3A 5LIRA 3GZNB 3ROPA 3GUYA 1MNQA 3QUAA 3S2ZA 4DR7B 3OCWA 1CUBA 2PIAA 4FMDB 4M0DA 4FT2A 4U7HA 3UK6A 3ZWAA 3H1FA 3QBDA 4E12A 4Z5XA 3PL5A 1WTHD 1WSDA 5JSYA 3X0DA 2GFIA 4CJXA 3DFIA 1KAMA 5L3SB 3BGOS 2VZ8A 5J35A 3LP5A 3DBIA 3PR2B 2JKYA 4PXAA 3C6QA 2GHRA 1NJFA 1H5UA 1U9IA 4AB1A 4YRGA 1ESZA 2P4SA 1X7YB 4NECA 4XGIA 3LP8A 1SO8A 2AR0A 5UKDA 4FYJA 4DMUB 4EI2A 3OM0A 3RKSA 1Y6QA 2NQ8A 4JJ4A 4P26A 3FVRA 4KQGA 2OSVA 2MYPA 1MRZA 4D4MA 2WIGA 4PQRA 3NDRA 2W83A 3SSAA 3T9BA 5JSUA 1C4OA 5FBRB 1XNJA 1A5AB 3DAYA 1WCV1 5CGZA 4AJIA 1XZAA 1VQLB 4HOYA 4IIJB 4UMVA 3DWFA 1KI7A 4DR1B 2Y4OA 4YC7A 2D5IA 3OJWA 1QKKA 3DCYA 3DZFA 4O4HB 4ZRDA 5FA5A 3NMUF 1T15A 2EZ9A 5BR7A 3U3XA 4EUNA 3R7WA 3UWSA 4RIEA 1CZNA 4I50A 1G5RA 2I5PO 5U9CA 2Q07A 5CX4A 1EJ0A 3UFXA 4D8TA 2B0JA 2ZKIA 1Z4KA 4XE5A 4EUKA 2V1UA 3PEVA 1GKKA 4FINA 3GD7A 2PH3A 2Q27A 2R96A 3RREA 4UVHA 4Y1RB 1WSVA 3KJEA 3H5IA 4E46A 2PVPA 3AM5A 1H9BA 1PT5A 1GDDA 3C41J 5CNIA 4PINA 1BTOA 2E18A 4TTTS 4E1VA 4J94A 3E1YE 4X1IB 3KPVA 4IJVA 3X1XA 2FRDC 3JQ6A 1BA3A 1SA0A 3HA5A 3SHFA 5K0EA 4D96A 3D1VA 3VX3A 1XO1A 3L4KA 1GAJA 1FOEB 4Y2XA 1VPLA 3WNZA 2VL7A 3FNGA 1K7FB 3RHZA 1YCDA 2XUKA 1CIVA 1ZOSA 2J30A 1LPPA 3A8TA 3IAS1 2JLAA 3IVGA 4MW7A 1OIWA 2AI3A 5TDHA 5B4TA 4QARA 1F2VA 2FPUA 5HE9A 5LJIA 4W5JA 1KEPA 4DRXB 1US8A 3CZMA 3LE8A 2ZUEA 1P7VA 2ZI7A 4W8OA 3ZJTA 3BWMA 2MYNA 1VSUA 3CLUD 4HYEA 5EXPA 3RYCB 3SF8A 1CUEA 1O97D 4PY2A 1OJ7A 1SG6A 4F4DA 5FLEX 1YWGO 4IX9A 1GPBA 2COKA 3CA8A 3OLVA 4U6QA 3ASSA 1Z5PA 3EXHA 2FVYA 3NZEA 3ZV5A 4J3JA 2V1XA 3SQNA 4S04A 3ZCQA 1V4NA 2VN8A 4A92A 4AX8A 2P5UA 1JB9A 1K5DA 2O8VA 1YH3A 3GGCA 2CMKA 3Q0IA 5K7SA 2GAFA 3IAS6 4S1VA 3ZHSA 1MMFB 1YU9A 2FGJA 4K3UA 4ER5A 5CA0F 2WB2A 2XUZA 1AD2A 3ZCTA 1ABEA 3UUEA 4INJA 1BVHA 3PWKA 3QMMA 4IGAA 2QD5A 4CIBA 4YJKA 3L0BA 3L6EA 3K96A 2QW1A 1ZN9A 2ZR0A 1WPCA 2C04A 2WICA 3M1AA 1SELA 4INPA 1I24A 1G8GA 2ZK7A 4MUFA 3UMSA 3ZK7A 2DFTA 1XZQA 2LNDA 3RS3A 4CDRA 4HPXB 3T5AA 3G6WA 3IUMA 1DDOA 2RIPA 3JSAA 4RQTA 1YACA 1QYWA 3OZCA 4BNHA 3AF6A 3V7FA 4PQFA 2FFHA 3BVPA 1PBNA 2ZR9A 3KZCA 3UWPA 1WOSA 1KU6A 4O2AB 5F23A 1V4BA 5JXGA 5DYYA 5LZ7A 1HDIA 5L7TA 1VP9A 4L5YA 2ATCA 5E6RB 1GO2A 1R0ZA 4RPJA 1NGSA 2OP0A 2YOGA 4ZAFA 2VCHA 2Y1FA 3DE1X 1C7FA 2WIAA 3S99A 2CDAA 1GTG1 4WFQA 1DUVG 3KL2A 2CK3A 3H1PA 3SS7X 5KYNA 2I2FA 3LLMA 3MC1A 3FNBA 4FHFA 4L2IB 1ZD4A 5JS6A 4QVJA 3K2IA 4FFOA 2J4DA 2C2BA 1A2BA 2PAFA 1RRGA 1AC5A 4RK7A 2QP9X 2PL9A 3C8MA 2ONKA 2PMBA 1XCLA 2ZAMA 3BXGA 3D6TB 4L8VA 4P2GA 4GC9A 4IP0A 3CX4A 4RMGA 5EVJA 1Q3HA 1A1VA 4XPZA 3A9RA 4Z9XA 2QDXA 2G8NA 3PLNA 5ALKA 1N2IA 1NPTO 4JQOA 2CJFA 2CE2X 2OGWA 1B16A 1NA5A 2HMYB 3B2NA 3DOUA 4ZOLB 1CUHA 5HHTA 2HF7A 5IAGA 5A03A 3M4JA 2VZEA 3PNMA 2ZS7A 3FNRA 1HDOA 1ODIA 1X14A 2Z3ZA 5AXBA 1HG0A 3MK31 3RUPA 3Q8LA 2EX4A 5M3BA 2D62A 2QUHA 4G89A 3DXZA 2FCAA 1OW3B 1K7XB 5BOVA 3BE4A 3AJAA 4V0NA 1DFGA 1R10A 4CMEC 2VSOA 2GN4A 4D6XA 3IOCA 2PMDA 3ZQUA 1B8OA 1NMXA 1AK9A 4EY5A 4RH3A 4YT8A 2VUSA 2VP5A 4IGKA 1PFYA 3V00A 4GSYA 1XZCA 1A9ZA 2XECA 3NFRA 2F1OA 1GHTA 2N47A 3HCNA 2FOLA 2YWBA 3Q39A 4J2TA 4K0RA 1FEZA 4BNLA 2RGXA 2MINA 2REBA 1EUDB 2OESA 2X6RA 1LDEA 2PPVA 4UTVA 1NQWA 1UOPA 1OV6A 1XB2A 4ON9A 3I58A 2V6IA 4F8YA 1CNEA 1JDNA 3O8QB 2DFVA 4PGOA 3BB3A 3DM5A 4KQIA 1ZL0A 3Q8WA 1HNNA 1KDRA 4IFEA 4ZYXA 4JVNA 4XVRA 3G49A 4P3YA 1VSVA 1IATA 1Z2EA 1NE7A 1AXGA 2VSYA 3K1AB 4RHFA 4CTKA 3ICEA 1MP0A 4G1VA 5A4FS 4RNCA 2ECKA 5IXJA 3X2SA 1A9YA 2LXNA 5DHAA 3RVRA 2UUAB 3AQIA 3V2GA 4B40A 3S7TA 3KSMA 2L18A 4DVGA 4CF5A 5KX5B 2V7EA 4NBKA 1TGYA 2JFVA 3DHYA 1L7AA 4LYHA 3URKA 5KYWB 3CXCB 5FKJA 3DE0X 3D0QA 1SVSA 2WABA 3FIJA 3FLAA 4IYJA 1P5FA 4DMKA 2X0EA 5E7MA 3BMCA 3K2BA 3WA6A 3T4PA 1F51E 2I1VB 3VOTA 3LDAA 1RQXA 1U6JA 1CS0B 2WVGA 3ESCA 1OB0A 3I39X 3QOXA 2JLVA 1HQKA 1PN3A 3QBVA 4FUQA 3I83A 3Q9SA 2PSSA 1IEXA 3M4YA 3WL6A 2O0MA 4P7BA 1NXQA 3LUBA 1XTIA 1QDUA 4A8JA 1C3EA 4FU0A 4LKRA 4JI3B 1Q5PA 4KVZA 5JRDS 1U65A 1HZZC 2ES4A 2R44A 3FPEA 3HPQA 1CZOA 1MBZA 3LLSA 1C0PA 3KTAA 1E4OA 3N87A 4J0IA 4KL8S 1FFEA 3KS9A 1NT2A 5DF1A 1GM5A 3BICA 4ZIRA 1RRKA 1V1MA 3FNEA 1E7SA 1I9CA 3WWYA 4BFUA 2DHQA 3TXAA 5BSFA 3JARA 1QVVA 5EUQB 1J0CA 2HA4A 1YL5A 2HA2A 4FLFA 4UTXA 2HRCA 3MUEA 5AOBA 4ROSA 4Z4FA 4Q3LA 4EY4A 3O2QB 4QDTA 4ARUA 2Q2NA 3ZS8A 1WXWA 4EJ6A 2W71A 5YASA 2X2EA 3SZGA 4F1KA 2V6BA 3FAZA 5LQRA 4Q9AA 2NSJA 3EY4A 4ZJZA 3AX6A 3I2FA 3DMTA 3IESA 3OX4A 2WTXA 2C4VA 1RM4A 4UEKA 2E4XA 2QD3A 4PIMA 3OCYA 3B9BA 5LA6F 1UMKA 1I6LA 4RTMA 3ONWA 1AHNA 1TYAE 3E5NA 3L1KA 4WBNB 4F6RA 4GQNA 1SVMA 1PNTA 4LOJA 4OHRA 3GB9A 1EWVA 4KITB 3FLBA 1B1CA 1SCNE 3P2MA 5K4GA 1Y3BE 3C87A 2Z2IA 4DADA 4XWYA 2PUCA 4J16C 5LDGA 3BH6A 1SXQA 2QAGB 1H3EA 3PGA1 5EKUA 1JW9B 2XT0A 2H1RA 3EH2A 1HGXA 3OWHA 2AOTB 4QGBA 3T56B 4WGGA 2PSHA 4G86A 5BT9A 4F6LA 2ZUVA 4MVJH 5A4MS 1GNSA 1ENYA 2BGUA 3DTVD 1CUJA 3FDZB 4GR5A 4KMOA 1MIHA 4OXKA 3P4UA 1Z8NA 4ZMRA 1ABBA 1HKUA 2JHCA 3MTQA 5KYXB 4L4XA 1XQBA 2WHQA 3KVVA 5IZCA 3K05A 4X7MA 1C1YA 1WVIA 1IM5A 2O7SA 1YZNA 3WZMA 3QLVA 3TIFA 1UQRA 1JJ7A 2C7RA 5H3LA 2QK4A 3W5CA 1BEUB 3B12A 1Q0SA 3MGKA 3HNOA 3PVCA 4DHWA 4YRMA 2I6QA 5JAOA 1MC4A 2UKDA 4XDGA 2J07A 4GOKA 5P8WA 2ZPTX 2OFFA 4D3SA 2YWJA 2ZXUA 2ZWIA 5BRNA 3RG2A 1X1SA 4H9GA 1JEQA 3YASA 4A5SA 2FDXA 3LYLA 3OA2A 5EJ7A 3U3ZA 2IIVA 4F97A 5KKCA 3ZHQA 5I9MA 4BIMA 2BH2A 1NG1A 1VZ3A 1P6UA 2JGKA 3G8CA 4A3SA 3P52A 1QYDA 3CE6A 2AFIB 4UKDA 1IK6A 4B81A 1TM7E 6ADHA 2C9MA 1XI2A 5JSZB 1W46A 2QTGA 3I8OA 2O2GA 1ZA2A 4K6KA 5D3QA 5FAXA 4TVKA 3WLSA 2WPDD 4I2NA 4W5RA 4H7EA 4Q24A 1GPKA 2FPMA 3DOCA 3O31A 3R24A 4X9XA 3O93A 2JA2A 5BN3B 3JVEA 4RTOA 4L08A 4DLYA 5IM4A 4BNJA 1E8MA 4R4JA 4KUGA 1JU4A 2A4KA 1KFBB 2Z1MA 1XVLA 4PPYA 5DO9A 1NONA 1SVNA 1L6RA 1VJCA 5KNLA 2CKDA 3E9MA 3EOZA 3DJFA 1W96A 1QB7A 3N0WA 1BHJA 4M3NA 4ZVVA 2HJGA 4B87A 4W82A 1W93A 1ZI8A 4UCQA 5C8VA 3TVTA 3ESXA 3F1LA 1V6SA 3IERA 3C4VA 2LIVA 2FZ4A 2O2YA 4D0SA 3WGYA 3P9RA 5IHPA 3A04A 2O5CA 7REQA 1CQZA 3FLMA 4FEYA 2ZI5A 4CBVA 4WLEA 2IYAA 1MV8A 1W5BA 4J7XA 2O6HA 3NHWA 2OVBA 3ENVA 4XOIA 3O1HB 4G0XA 5EZYB 2WMOB 4BP1A 5I7SA 4GBMA 4J4TA 1GR0A 4WA7A 1IBKB 1N5KA 1P5JA 1PTJA 1U3UA 4N7MA 1X7WA 1KJ8A 2SKEA 3KPJA 3MWDB 4H59A 3TVDA 1R4AA 1IC6A 1Q3KA 3GLFE 4H08A 2IZ5A 3R6GA 3BWXA 5C1OA 2IUUA 3W6UA 3CNLA 3OZEA 3PNOA 1SQGA 4R8MA 3ZG6A 4BPRA 5I7EA 5HDQA 5FBVB 1O0SA 5JMTA 4G6IA 5J23A 5GADl 3MB5A 4K9RA 2OTJB 2WIBA 4KQCA 4UU8A 4CTJA 1ZIOA 4MO9A 3W1VA 4Z4VA 2ZZMA 4X8MA 3K9FC 3IVRA 2UZIR 3RW9A 3A0RB 1QNFA 4CKZA 2HBRA 2B6HA 2CJWB 5FIUA 1UADA 3PR3A 1E2DA 4HRAA 2B9VA 4JB3A 4MUKA 2IXBA 3AKEA 5TPZA 1VYTA 4IIVA 3N86A 4BNGA 2OXTA 2H2HA 4ZOLA 2CL7X 4ZVKA 2WAOA 3MPUA 5F1PA 4DA6A 3FBGA 2D2FA 4LE1A 1SUBA 4A36A 4C0KA 3K0AA 4FK8A 2OYCA 1P1CA 4RPGA 5AXDA 3QNUA 4WXHA 5JCOA 3A37A 2F1MA 3HDVA 1QHFA 1GA1A 2VJLA 4AMYA 1SG0A 5I7UA 4YS6A 3JY6A 1KARA 2B0CA 2O5EA 2CVZA 3MCWA 1EIWA 4QECA 5J9FA 4GDMA 2I54A 4RZXA 2ZE6A 4OHPA 5M34A 2WSMA 3WLRA 2G7ZA 4MQ6A 4LBVA 3TCXB 1Z13A 4TKVA 4NDNE 1AVTA 1NY5A 2AG8A 3QKRB 5DGDA 5HZGA 2DZDA 4LY0A 4NLLA 5B53A 1WA5A 4QBGB 1NY6A 3WBKA 1MG0A 2QP3A 1KI2A 1E9FA 4NCIA 3RM3A 4BQPA 1QMPA 2CUNA 2JIPA 5KOHB 1XMVA 1K6JA 1MQSA 5KVVA 4ZMSA 4YQEA 3O92A 3U1BA 4DG5A 4PYNA 4CIDA 2OHXA 4WSOA 1XD8A 1IOZA 2HWXA 4IV5A 1YJ8A 1W2GA 1Z9BA 1DBWA 2ZYUX 1RRFA 1FQKA 1JDSA 2CDNA 3OPYB 5EMHA 1INLA 5LC1A 4I4TF 2X22A 4DQDA 4X7CA 1H2AS 4N41A 1UDWA 4BNWA 3NJRA 4EFLA 3D2AA 4PZYA 4Z6KA 1BCSB 3GLIA 1RS0A 4DDUA 2IYQA 2YMMA 4MYHA 1PVVA 5H16A 2A9QA 2B8TA 4OPMA 4G0WA 2DJ5A 1UC5B 2O3UA 3EH1A 1C1HA 2OCAA 2Y76A 3ODPA 4J1QA 2JN9A 3CESA 2VATA 4P54A 2F6RA 5ALZA 1KYIA 1B2RA 3R5HA 2HNAA 1HTWA 3ZHVA 5A04A 5JEDA 4L6CA 3L8YA 2BM8A 2J0EA 2FDRA 4FVTA 6CHYA 1ZG3A 4RYLA 2WY2D 4UQLA 3DTNA 4MYUA 3FNIA 1XHLA 4BHTA 4KR2A 1P2UA 3E70C 1YI1A 2CC2A 3EMBA 3G8AA 3L49A 3NWEA 1GUDA 4EATA 1TFRA 2P0AA 2YXPX 4M9SA 5IASA 2RH4A 3KCQA 5G4LA 1SXJE 4HUJA 4QA9A 2AXQA 4NZ9A 2DFKB 2PTGA 2GZDA 2QN9A 3P45A 4D0NA 2HNBA 4R1NA 1T36B 3UBMA 4DT1B 3KX2A 4Q9IA 1PR5A 4A2QA 4IMRA 1Y80A 5KS2A 3FTFA 3SNHA 3ZD9A 5J5CA 3IT2A 4BQOA 2AMJA 4BL5A 5JS8A 5JTUA 1OH6A 3Q6QA 1N6LA 2WQ6A 2E5LB 2WKRA 4RZUA 1SVWA 5IRCD 3AI3A 4BNDA 2Q9BA 1FUIA 4KE6A 2IYUA 1N3LA 1UPTA 4MR7A 3U4DA 3U5ZB 3Q40A 4DIEA 3O6VA 4FOOA 4O3FA 2X1LA 2PWAA 1LBQA 4H7FA 3GG2A 5CLGA 3LX5A 1QIEA 4IKPA 1PKVA 2NADA 3A7DA 2GZHA 3PVSA 4ZKDA 5CITA 2ZRLA 5L3VA 4J9UE 4H4EA 3DW1X 4UD6A 1AZTA 2V7VA 1S2IA 3FFAA 4MVXA 4JV5B 4A1OA 1X7XB 1OREA 4X5OA 5KQGA 4RJLA 1XRQA 1E3SA 1M7HA 2PY6A 2QE7D 3QSGA 4GD3Q 4WKGA 4CL8A 1XKXA 4ZFNA 1CERA 3L05A 5FWAA 4OB7A 3QX7A 3R5TA 2B21A 4Q9NA 1SUSA 4KO4S 4TMKA 2HDOA 2GEKA 3SIRA 5T67A 5ERXA 4MWSA 4WECA 1FW8A 1H0KA 2IIQA 4FWBA 3DXFA 2H11A 4ZAZA 3BWYA 3GEIA 4MRSA 3KJZA 1WSAA 1NATA 2C2ZA 4P7GA 1L4GA 1QO0A 3D7MA 2QVZX 3FI9A 4U02A 2F43A 1SUCA 4B09A 3ZBQA 3GRYA 3IUJA 4EGCB 1HNZB 1XF1A 3WK6A 4KQ2A 1CDDA 3HJHA 3T9AA 1S6YA 4CR8A 4E5YA 3KJIA 3WRWA 1DZ3A 2D1YA 2I3ZA 3BAFA 4QOSA 5JBNA 1OLSB 1OROA 2AW3A 2HPZA 3A1UA 2C99A 4IQ4A 1IWPB 3GI1A 1ODLA 4REQB 2MCFA 2WUEA 1Z06A 1LI5A 4N4AA 3WP1B 5B7NA 5KYYA 2ZRJA 4Y2SA 3UXHA 1BRTA 5BSMA 4BEVA 1C9EA 1P1FA 1TT5A 3ZBUA 5KYXA 2CLKB 4HIZA 3BCFA 5IXYA 4KJZA 3RVDA 4EKIA 2NZUG 4P2NA 3A6EA 4IH1A 3AUUA 1I0ZA 3OPYI 3N5CA 1N92A 1CF9A 2VYCA 3TL6A 1VQPB 5T41A 1QHYA 2DFLA 2Y6UA 4G1UC 4IEIA 4Q1BA 2ZROA 3DYBA 3M2TA 4BYGA 2NUAB 2OBTA 1MIOB 3DV0B 1E64A 4FCWA 4CN8A 4M1MA 4AO8A 4FIZA 4TS9A 4L28A 3BCDA 4BCBA 3WGOA 1S7CA 5CFNA 2JDID 4MLPA 2Q2OA 1EB9A 3NKFA 1G16A 4RKQA 3HKBB 2CMGA 2DM6A 4MGHA 2WJWA 1VPWA 2PT9A 2NAFA 3PP8A 3ASQA 4A1FA 1TZBA 3ZZMA 3MOIA 5HQTA 4OKSA 1Q83A 2VOEA 1A9XA 4V1CB 5AUPB 2FDCA 3N0TA 3TIGA 4DXHA 5I9SA 2H59A 2P2DA 1TX4B 3OZAA 4NI5A 5D51S 1M6WA 5BSUA 4AUMA 1MVNA 1I4WA 3QLTA 9LDBA 3KJGA 1SFRA 2ZJBA 3SZLA 4A0HA 5MN4A 3K9QO 4JUDX 2GJ8A 3D4PA 5DHTA 3VSEA 4N49A 2B2XA 1SKMA 3CQ9A 4QM6A 1BVUA 1X9GA 3CBGA 4UBJA 1MUUA 1GGEA 2A3RA 3I5XA 3GVLA 4NBUA 2MYTA 2Z5GA 1E18A 2VHYA 3H0EA 3P9SA 4RHEA 2Z0MA 3UMCA 1S2OA 4TXJA 2J3MA 2M6RA 2YQZA 3KV1A 4UTZA 4M9QA 1WETA 1U7PA 3Q87B 1CLEA 2ZR8A 5EQFA 4RDKA 2GQ0A 4WZKA 3U1TA 2VDWB 3AY0A 1FFXB 2YVUA 1BE6A 2EZTA 1UZNA 1XLVA 1E3XA 4N7JA 2R1TB 3UK2A 4I46A 2W70A 1NU8A 2W43A 4R1TA 1HLFA 1CY7A 1A2OA 1VI2A 2HEIA 3OJFA 1K8ZB 3TNDA 3K0CA 3GRCA 2QEQA 4L3WA 4YMIA 1D2AA 3SXUA 5CBPA 3O3OB 4GIBA 4DDVA 3QE2A 5KAMA 4KTVE 3KUKA 2YYSA 2CF6A 4CIWA 2IXFA 4HN2A 4N03A 2LTAA 1K06A 4KN9S 5CAEA 1UH5A 3U56A 3I6ZA 4I1UA 3I55B 1XROA 1JMYA 1ZSNA 2NAPA 1WMFA 1JIQA 2QLJA 2HX1A 3F5FA 1DIRA 1NUTA 1J25A 4CL2A 2ORVA 2V7PA 4PZPA 1YB2A 1T3SA 2H0RA 2O6LA 3WGMA 3N0XA 2PJZA 2RGRA 4R0NA 3K5HA 1XZPA 3O38A 2WZPP 4WEQA 2WFMA 2H7XA 3TJZA 2D5LA 2B7CA 1M34A 1P0IA 3EXFA 5THXA 4HPJB 4DCCA 3GEBA 2AFVA 1O6GA 2V7XA 3L0OA 4LYEA 1PSDA 4MYRA 2IUSA 4FTWA 4HDNA 4BKPA 3TLXA 5IFKA 4DUZB 4CHTA 2BMAA 3H94A 2OV6A 4ZEMA 1TCCA 2CJWA 3WK8A 1W0JD 3LI2A 4O4JB 3H7IA 1SZDA 2F2TA 1PX2A 3BULA 3KSBC 1ONPA 2WD7A 1WXGA 3JZAA 5EHQA 1T8UA 2CLCX 2PO7A 4NZPA 5E7JA 1BHSA 3EVZA 3EEFA 2ODNA 1YCFA 1CR1A 1N2OA 3DB1A 4TLMB 2ODBA 4LJ7A 1L8OA 4LOAA 3THXA 2IOQA 5G0SA 1XE3A 3UCFA 1HDXA 7MDHA 3U17A 4ETMA 1B00A 3QVTA 2QLLA 2ZRQA 2ZDQA 2IDZA 2BMJA 1WZNA 2Z9BA 4Q7KA 1FUKA 5JO0A 1TVKA 1VLLA 2OSBA 3DEIA 1JXQA 4BLOA 1WUHS 4Q4HB 3B8EA 2GD6A 3PC8C 1XDBA 5AVJA 2FG6C 4QX6A 4LISA 3QI2A 4QEZA 5EJ4A 2C7BA 3HR8A 4F5ZA 1J0BA 2CXSA 2DC1A 3AY6A 2OGUA 5KDLA 2QMHA 2BSAA 4CWAA 2XXAB 1WP4A 4TX1A 1WZ2A 4YAUA 3R6WA 4UD2A 4WESA 5FHRA 4XCVA 5HUQA 4FM9A 1JYEA 1RPZA 3EXEA 4V1CI 5CHYA 3ZXXA 2WZQA 4A9AA 2YXEA 2VHCA 2GSDA 3DFUA 4YCSA 4R81A 1SEVA 3K16A 4PSDA 3WGIA 1KZ9A 1P1RA 3BF7A 4MB0A 1ZGBA 2HJSA 3DTTA 1GEGA 2GCNA 3IPLA 1UBHS 4X45A 4Q93A 2FOXA 4GPIB 1JEAA 3EQ6A 4O2BA 1YL6A 4EVSA 2CXRA 3IIIA 3OU6A 5C2JB 3K70C 3QFHA 3V3KA 5GIOE 4NNPA 3PUYA 2P5TB 1ZK0A 1J42A 1FBNA 2FX2A 5LU8A 3QHPA 1D4FA 2DPGA 3EMVA 1YCHA 3HVIA 4RZIA 4XVQA 1RYYA 5JE8A 5AJHA 4Q6BA 1O1YA 3EQ8A 3QHQA 3T4EA 2RJ3A 3CZ9A 2H2IA 4PTZA 4X7DA 1USKA 2BEUA 2ZXFA 1E59A 2XXJA 1BEZA 3EISA 3NHPA 1O0BA 2CLFB 2Q50A 3A6LA 3N2ZB 2J09A 1ZXLA 2ZIUB 3BTOA 4LZOA 4QUKA 3G9ZA 2NQTA 2J33A 3P7MA 3PQ7A 3V4SA 2PMEA 4ADSG 3OY7A 1W29A 3ZPXA 5IT5A 2JIOA 3PPWA 2VJJA 1T36A 1Y34E 4KQJA 4RFSA 3NIGB 1M5UA 3GPDG 1ZCZA 3ANLA 4G0PA 4QEKA 4KKSA 1RQGA 1N7IA 2EFHB 2O3RA 4YGXB 4PO8A 5HJ5A 5KNCD 1P5HA 1F8GA 2NUBA 3GAZA 3GN2A 2VRCA 1PR2A 2DPYA 3CLHA 3IPCA 1F9AA 3LO5A 4WY5A 3Q3IA 1E2NA 4ZQHA 1YQGA 1UP6A 3OU2A 4LDQA 3VR5H 1I30A 1URPA 3IO3A 4AJ1A 2VAVA 1XLTC 2D5BA 2PWZA 4JLPA 3U16A 5GJCA 3NETA 5AVYA 2WR8A 4F6RB 1MORA 2WF7A 1H2WA 1E99A 3G89A 3ROEA 4F5YA 4FKZA 2C88A 1U0BB 2B4YA 2Y71A 1NDQA 2C4WA 1HE8B 4P1ZA 3HFRA 4FDAA 3A1WA 4M1ZA 4ESEA 1PWEA 3JCZA 3DEYX 1M8JA 2C94A 5JJLA 2Y3IA 3P2OA 3B1YA 3PFFA 4H27A 3BREA 1YDWA 3JALB 3KV3O 5ESRA 5FTKA 5K4HA 1L4UA 3KFVA 1JR3E 3HXTA 2HJ9A 3P2JA 3NE5B 4G67A 4IZIA 3ORHA 3RJMA 3B3GA 4PAGA 2DBVO 3U7RA 1CJCA 1D04A 1V96A 1J99A 3E05A 3QE3A 4RL6A 2UYYA 2BSQA 2G04A 4O8ZA 2PCLA 3LQ6A 2BMVA 3EN0A 3GEHA 3R7LA 1IBSA 3MBIA 4U7DA 1VQ7B 3MOSA 2M2IA 3TD6A 2KYRA 4EJSC 5BWOA 1BMTA 2W2XA 1NKTA 2F3TA 3IDAA 2ZSHA 3QNWA 1EXWA 1GIAA 1H4VB 3I3OA 2OWDA 4Q7JB 3IV9A 4YMUA 1PFQA 1DHTA 1OPRA 3F9RA 3AQ4A 3BS4A 3NHBA 4KEAA 5JCJA 3TAHA 2VYNA 4BN5A 2B82A 3ELYA 5L95A 1YGYA 2BE7A 1SU4A 3T1OA 1TECE 2ZIXA 4HDKB 3ULKA 4H3HB 3WLKX 1NQTA 3GZ4A 2SKCA 3B7PA 4LHSA 4E14A 4RBNA 4RU1A 1ZITA 2VWGA 2XITA 3RFCA 3UJ6A 1PJ4A 1UP4A 2G36A 3NHAA 2E6UX 3INGA 2P0YA 1FVHA 3F7OA 4B3XA 2EKDA 3BD8A 3AHJA 4RS3A 3W3AD 4EX6A 1EXVA 1DX9A 1GZUA 4ND3A 5IYZA 4QZVA 1F06A 1N7HA 2G0AA 3CC7B 4KKUA 3JD2A 5CX1B 5I8ZA 3BMQB 2B99A 1AT1A 2C9BA 3RU2A 4CXMA 3JYQA 1EDZA 3ZQ6A 1PJLA 1L7RA 1YJAA 2XOKD 2ANBA 1TMGE 1G21E 1IB6A 4UEQA 4DWWA 4E4TA 4FMCB 1G3MA 2XKJE 1HTBA 3LL4A 1LSUA 4HH1A 4I55B 1F20A 1YRLA 2C03A 1UK8A 1AB5A 3DT8A 5B2EA 1RC0A 4JI2B 2VHWA 3COWA 4KTTE 3M6LA 2EJCA 1BOOA 4KWIA 3OFNA 5CM9C 3GLGA 5KSWB 3CX8A 5FXMA 3DMNA 3CINA 2YQ5A 4K9LA 1ZGGA 2AFHB 1GRQA 2V98A 3A9WA 4P82A 4U2KA 5KNBD 5J2UA 2JJMA 3GZTB 5FV4A 2BMEA 2QM7A 2F3QA 5K45A 4XCXA 3D64A 1EVYA 5M04A 4AL4A 4MUAA 1JF8A 3GELA 3P2YA 4UE6A 3TZ6A 3OTHA 5CEFA 3TTXA 3EEOA 3LRXA 2DMRA 4IGFA 2HIHA 3H3FA 1I4DD 4C04A 2J8ZA 4LZJA 3WJ1A 1F48A 1L4LA 5AXAA 2AKAB 3DH0A 2BEWA 2ZBVA 1DB3A 4HX9A 1U7OA 1UM9A 1R66A 2Q0HA 4MGEA 5JDIA 2G4LA 5IVKA 3FH0A 3O82A 4D3ZA 4E5VA 2GAJA 2HLDA 1NI4A 4BO1A 4R1LA 2D4AA 5KKAA 1QO9A 2CB0A 4MRMB 5G1OA 4B6QA 4RD2A 2VJDA 3FMPB 4Z3OA 3CMCO 1QH1A 2WTAA 5D2CA 1IZZA 3LLCA 3MJEA 4L8YA 3TWOA 3AILA 4MPTA 1H8ED 2FSGA 2WU3A 1LK7A 2YZKA 5L7WA 1IIRA 2BR4A 1MV5A 3MFQA 3U9TA 2Q3JA 2QRMA 3REGA 1JKIA 1W8IA 1NW8A 3HACA 1XCGB 4DGSA 3K0SA 3IHWA 1LQUA 4W6QA 4CW7A 3U7HB 2I29A 4Q9DA 5FTJA 2C9DA 2IX3A 2QPOA 3Q6IA 1D1QA 1KS2A 3ENWA 4HEHA 4KIGA 5CNMA 1D2NA 4U5QA 3VZCA 4AMZA 1P5ZB 1SG9A 2AOXA 1OTYA 3IMGA 5CPBA 3UNXA 4M7RA 3V4PB 4L3VA 2XY4A 2YV3A 3FR8A 4MWDA 4R9NA 1H9AA 5EHXA 4KSYA 1B6RA 3CFYA 3OPMA 1P18A 5KU7A 1WMAA 4OI4A 5AHOA 5ALYA 1ZVKA 2WNIA 5L46A 5JNLA 4MS1B 2EX0A 4TQUS 5HFNA 1EDDA 1AXEA 1LDBA 2G1AA 1SWWA 2NU9A 4HDOB 4RABA 2DOKA 2JIBA 3I64A 4FEGA 1TQ6A 4KXNA 3VJMA 4DQUA 5A9SB 1IHMA 3TBHA 5JZ9A 1IJBA 5IH3A 5AI8A 2VBFA 3BMOB 3HRIA 1ILWA 2A0FA 2BDEA 5SYMA 4D4IA 1CVRA 4DCJA 2BHTA 3ZNOA 5EY5B 2HQRA 2IPOA 4BNVA 5C8XA 3AHHA 1I7SB 3IMCA 2HU5A 3U7EB 1E58A 1J1ZA 4EHFA 3GEGA 1KMHB 2XA1A 4UMFA 5F9FA 4Q1FA 1DDGA 1H4TA 1YOVB 4FYWA 1A1SA 4HMPA 4IXTA 1DC3A 2C4UA 3JPYA 3OFVA 4RNDB 3PV0A 2I3BA 3ZHZA 4B7AA 3C3DA 3MGAA 3JZFA 1YL7A 3AGQA 2OYRA 1YK1A 4E15A 2GJ9A 1A76A 1X8KA 1JFLA 4CR7A 1WUKS 1YZTA 4FMDF 4LRWA 1YUMA 1A2QA 3OQIB 3P9IA 4G2TA 4KFRA 4ZV4A 5EIFA 5B1IA 4DY6A 1YQEA 2P77A 3CKMA 1CR6A 2WJVA 5JH7B 5I7AA 1ZCJA 3UHAA 5C4MA 4B3FX 4AWXA 3W05A 3DE3X 4YJHB 5KSOA 2GO1A 4YWHA 1EE9A 1E63A 1ZHHA 1VHDA 3UHPA 4A91A 2J41A 3D7LA 2VPXA 2ZYRA 1SHLA 3TNLA 1NAHA 3HY4A 3K53A 1OILA 2HRDA 2X1HA 4ETWA 3FNHA 5LD2C 2NQ2C 3DV2A 3EOAI 1CW2B 2P9HA 3RSOA 4Z7OB 2I8AA 1LUAA 3EVTA 3KLNA 1P0PA 1H6DA 1QE5A 1MHPA 1NZDA 4O4HF 1M90D 3K70D 3C3EA 1EFDN 2JBWA 4NJEA 3GDGA 3DLAA 1C8VB 2WJ6A 3L5KA 1YS7A 2O2XA 1K2WA 1T1RA 2WV9A 2E9SA 3IV6A 4EA8A 1F3OA 2P6RA 1QO7A 1N2XA 4NFHA 2PXCA 3DLHA 3UV3A 4E11A 1KWGA 4QIHA 5HOQA 4P5EA 1ZJWA 5F52A 4LZZA 1JJVA 1JQJC 2X6YA 2VSFA 4KGVA 4C6TA 3U44A 3TRDA 2DEUA 3OZUA 2JZNA 1KEEB 1TC2A 2YH2A 1ZOPA 4HFNA 1FP4B 4CV2A 3L3BA 2TS1A 4KGDA 2GYUA 3IEUA 1EFVB 4EM6A 3ZGZA 1RVV1 2GD1O 2VDRB 4Q3DA 4TSFD 2V6JA 1DIAA 4OO3A 4DIKA 1KJZA 1CJKC 4JVLA 1THMA 3GFOA 1PFKA 2HRQA 2C4HA 1MC1A 1VKHA 3KZOA 3OIYA 3W1EA 4YECA 1BFDA 4KYTA 1Y8QB 1XRLA 1XVAA 1JG2A 2YVQA 2EGHA 4YWJA 3UUWA 2QA4B 1CY0A 2P9CA 1Q7YD 3JQ9C 1JDJA 4BAUA 2WP8J 4OVKA 2WG1A 4MV7A 4YP7A 4BV8A 3EGWA 5LFAA 3SJ7A 3BQNB 1CRWG 2B2NA 2D0PB 2VBIA 4PLHA 1E62A 2OHJA 3GCXA 4JIGA 1NVBA 4HAVA 1WULS 4TUYA 1QV6A 3KQVA 4AKGA 1DNPA 3BJIC 5JS1A 1VHOA 1NLUA 1YJCA 5ALIA 3T1HB 2HA7A 5ICGA 3EF1A 3OE5A 1WXFA 4GR4A 4KNWA 4UHBA 4RHTA 3PA6A 4MROA 3ZXSA 2GERA 2GN2A 1MJFA 3OE1A 4RMHA 1AX9A 1K5HA 1XU7A 1F0YA 3STXA 3GOQA 5IMSA 2FWRA 3I1YA 3M6FA 1IVSA 3K9GA 1NUPA 1FP6A 2CEAA 2WJIA 3DLTA 3IP5A 5EKDA 4B4WA 2DSNA 1USWA 3QOWA 3G0IA 5JNTA 3WP0A 3L9WA 3T9EA 3AFMA 4XYBA 2R8BA 2GDZA 3GEEA 1N0WA 3GGPA 1ZIYA 4JJEA 5DTRA 4EW6A 4J6EA 1P91A 2HJHA 5DNAA 3NJ4A 4E5MA 1BHO1 3FUXA 3JYOA 1T1JA 2CYAA 5K0NA 4PTLA 1SBHA 1F38A 4DG8A 1NOKA 1SHJA 2RI0A 3JXEA 4GMDA 1JVNA 3A1CA 4WKBA 4HYQA 4LC9A 1J0XO 2JS7A 3RBVA 4KGZA 4AUKA 1DGQA 1N2SA 1W0CA 5EWLA 1NFQA 4R01A 5A3SA 5B57C 3CY6A 1SCJA 4B34A 5I5GA 5FA8A 3TSYA 2OV2A 4P36A 4WNIA 1BDBA 1LZKA 4DJJA 3DG9A 3A4TA 4BMCA 1E1RD 2VHZA 2W2MA 1RZVA 3N74A 5A02A 4LPSA 10MHA 2AJTA 2QGFA 1REQA 3S2YA 2VA9A 4Q3AA 3RSFA 3ML1A 4WINA 5G0UA 3BXFA 3UG6A 3VKHA 1HDRA 1Y4AE 1J49A 2CCJA 3FPHA 1AUVA 1W30A 3H1AA 4O2AF 4XLZA 4CDNA 1J2TA 4U2DA 3BK2A 3CF4G 2ZZNA 1KKLA 4HL6A 2O2SA 1T8WA 2RKBA 4EWLA 3ETDA 5CX1A 4Q21A 1RYFA 4IUYA 3EVEA 1NJ2A 1T25A 4I1YA 2Y0DA 3OVMA 1SK8A 1SU6A 1WW3A 3FCYA 1R8QA 4YCJA 3IVCA 2D1FA 4ZYZA 4K2HA 5KDOA 1AS3A 3FZQA 4MWTA 2I6TA 4BMZA 5JW6A 4U7GA 4EY3A 2AE2A 4FI3F 5LP6C 4BU1A 2CNLA 2F4VB 1W9MA 1NF2A 1B41A 1NN5A 3N8GA 3QTBA 1ZR4A 1BE0A 1U9ZA 2H08A 3E5MA 4NAHA 2YCLA 4Z9BA 2CW5A 3LVBA 1I32A 5IW8A 5EIEA 2WF8A 4BWFB 4OBXA 4PICA 5DJ5A 1KAQA 3WFIA 5AKZA 4XVHA 5GWXA 2AD1A 4YRDA 4WADA 4O4IA 1U1GA 4R5MA 4ZOLF 3SLKA 2CHQA 2XB6A 4KNVA 2FU5C 4DREA 3TOXA 1KGSA 3BC1A 4LJLA 1CQIA 1C3XA 4QTTB 2VJYA 3LGXA 3RRYA 1P9LA 2JKVA 2B6NA 3GHYA 3RKRA 2I4OA 5K6RA 3ZD6A 2ZQ5A 2JRCA 4X92A 1O4WA 4HD8A 3EIEA 3NANA 2V3WA 4CT0A 1EB8A 5IYRA 4EHDA 3KXLA 4KQWA 3EZ2A 3ESBA 2GZ1A 3HUUA 4HGNA 5A05A 2IHZA 1A8SA 4Z9AA 5HBGA 1ZM9A 5ALOA 2XMSA 1V3UA 3VQTA 3LGSA 1KMQA 5AOVA 4IHJA 4JBNA 5KMGA 1NYTA 3TUIC 1DAMA 5K2MA 4JC0A 4OIMA 1U2SA 4C4PA 3EGOA 3IS3A 5G41A 4XH9B 3C3JA 5CB4B 4C0SA 2EFGA 1P9RA 5EZQA 2JW5A 3RSSA 3QBEA 2AMFA 5CT4A 2ORWA 5I47A 1DADA 2YIVX 3KB1A 4IH4A 1MEJA 4PM4A 4XDYA 4BX0A 5FA6A 5JR3A 4GLOA 4KQXA 3L82B 4P0PB 3EGXA 1ZH8A 4YRRA 1ENZA 3B38A 4CETA 2BVNA 2V9ZA 1VIAA 4H1UA 3CNBA 3AFOA 1UBSB 5BURA 1SBCA 4RUKA 3IMFA 4WN9A 4JX8A 3ELBA 2HBYA 2GAAA 2EYQA 3MD9A 4BLTA 4HAOA 5A3RA 5C8ZA 3U4IA 3BDVA 1NSFA 2VDUE 2TSYB 4YAJA 3ZUGA 2UYCA 5JISA 1EJBA 1NVUQ 4TWRA 3BBPA 1H4QA 3RS9A 1J2YA 3NCHA 5KX5F 3DTVB 4X54A 1WU8A 5DOZA 1UXGA 4IOKA 2EU8A 1G3QA 1XQ1A 3ENQA 1CD5A 5ALHA 2UZ0A 3EXAA 4RHXA 4F85A 5HKAA 1GU0A 1KAGA 1PZEA 3WGUA 3LFUA 3IP8A 4NCHA 5FUMA 1HR0B 3DNMA 2P6PA 4YLYA 4CZ2A 1OBHA 2BEVB 4MS3A 4MEJA 1KQOA 1EUZA 1TF2A 3CLKA 5A9SA 3EBPA 3TRKA 4C5BA 2PA3A 4H4DA 4I1OA 4A6DA 4ANFA 1J33A 2Z56A 4ZI7B 4G8DA 3ADOA 5AVQA 1JLLB 5KOJB 2F1KA 3LF1A 4QQNA 1OYVA 4OGGA 4DWVA 1NJID 1HL3A 1IIBA 5KREA 2G9ZA 2FSSA 4UUPA 1BPLA 5EKXA 4DGQA 3K6SB 3ZNPA 4XD7A 2J9FA 2PRJA 3GVJA 1T3ZA 4S35A 1K7SN 1Z7WA 1WUTA 1BU8A 2XBMA 2WM9B 3U3DA 3PRKE 3T3NA 2F9MA 2X40A 1GA6A 4FYXA 4RD6A 4IIUA 1KR2A 4ZVNA 3VHXB 2EDAA 1L4BA 1N4DA 5D3MB 3MJVA 2B3DA 5A71A 3QF7A 3ZX4A 3KLBA 4M1OA 3L18A 2IU3A 2OHOA 1HRKA 3X1WA 2UZ4A 2UUOA 1ZMBA 3KWFA 4RPHA 5FUYA 4RK1A 4X1KA 1R4MA 3PNQA 3CO0S 1CY1A 2ZITA 3I9V1 1XTJA 5JHGB 3G6EB 3ZU4A 1M67A 1FDWA 3KSRA 1MX5A 1O4VA 1T6YA 3GGJA 1PZMA 2XIQA 3KSDO 1ZH0A 1U9JA 3TYXA 4RZ2A 1E43A 2YY7A 3I6QA 2MMGA 1TCBA 4UZEA 1N0UA 2WTUA 2GJ4A 4JBHA 3RC7A 2IITA 4WBNF 5J3JA 2FTKE 1DMRA 1R6XA 3DC7A 4P12A 3ADPA 3ILXA 4MW5A 3OTIA 4PSUA 5KTRA 1CETA 1K8YB 1CTQA 3G9XA 3REFA 4D9BA 3B51X 1KZHA 5IJWA 3NDBB 3ROZA 5CFLA 4QGFA 4BLUA 4CLOA 4RULA 5G4KB 1YVPA 5G1NA 1RJDA 4H4CA 3WSVA 3SXJA 2DH6A 2X15A 2R7AA 3HCEA 1ADBA 4KPUB 3Q8KA 3E9EA 2XMBA 1SKYB 3NAQA 1E92A 1ZJJA 1GPWB 1KJWA 4QXMA 4XCQA 1EFVA 3QFCA 1SJ9A 4Q7QA 1IBLB 2A0UA 3MRXA 4TKUB 2GVZC 2RHCA 3I01M 4NBRA 4NCJA 3ZHXA 1KVUA 3VR3A 1W4LA 2WUVA 3H2GA 2M5SA 4KBGA 2QM8A 1DPGA 3PHLA 4FQ5A 4JU9A 2V7WA 1XU4A 1NSYA 1TLFA 2HWUA 3HBNA 1RMTA 2XVAA 4XR4A 1AQYA 4ZKEA 2JH9A 5DYGA 1JR3D 4TWAA 1GKLA 3LX6A 1SOWA 5D8DA 3AIMA 2O8FA 2HJVA 4QPPA 5AW2A 3H8SA 3HN2A 1XFOA 1YQUA 2XWJI 4R1PA 4P7JA 2HJWA 4OJTA 4KU4A 1SCUA 2NWQA 1E9DA 4TT8A 3O4IA 4GC5A 1XTUA 3SYTA 3S8EA 4QUHA 2J0QA 1T1IA 5JNUA 2O8DA 2HIMA 3HYNA 4RJIA 4RF5A 1YDHA 4CUKA 1VE3A 2YWEA 1UOOA 3ZZ1A 3BBLA 4B5LA 3B82A 3U4QA 1KI4A 4D4LA 2VBVA 4WRRA 3SD7A 2ZUWA 4EB0A 3ZUPA 3GDWA 4JP3A 3KEFA 3C43A 3M83A 5CYPA 4AZTA 3VDMA 1DQRA 2OV8A 3Q88A 4NCKA 4Z7NB 3R3SA 4KR9A 5CYOA 4LOLA 5HCNA 4X1YA 3J80A 1WVMA 1JU9A 4QGGA 1H2EA 3H2HA 3AT1A 3B1ZA 2VF7A 2XKKA 1O57A 2J6IA 5B7QA 3S0JA 3HY6A 4BB6A 4I4CA 3RC2A 4NS4A 3O2NA 2RC5A 2E2WA 13PKA 3ACDA 1TFUA 3MT7A 3GJYA 4XSGA 3CPJB 2CXXA 3I6IA 4IJUA 4IWYA 3TIXB 4RTLA 1FXUA 3M5CA 1XZBA 3ZVMA 1POWA 3JPWA 2C2HA 2ID7A 2KS6A 3G5MA 5JV5A 2WU8A 4IGIA 3R0QA 5A8AA 2V4UA 4GX1A 1E0KA 1DBVO 5JMOA 4WE3A 2C1EA 3E8SA 2XYPA 5LQSA 3FX2A 3NHLA 4EB6A 3RV4A 1JIUA 3HAGA 2C0CA 2KE5A 2QTRA 2SCUB 3QKWA 1VHQA 2Y2VA 1T3LA 3NRCA 2QV7A 3NOXA 4X93A 3O4RA 4BN4A 1M2OB 1M2WA 1VHLA 3B2QA 5E6UA 4DS3A 1GTZA 1NHGA 1Q1QA 2J4CA 3COSA 3I8SA 4KFUA 5EZYF 2P5YA 1L4YA 3K9WA 1JHXA 5F1OA 2ZIAA 2ZB3A 3DVAB 4EGFA 4M0EA 1AM4D 1OA0A 1R9MA 2GFHA 4JS0A 1V8OA 3UIEA 4BO0A 1IQUA 4ZVMA 2PFSA 3FCCA 3TLGA 4EJ2A 2AVNA 4LYAA 4WFJA 3FR7A 2DRIA 2D4HA 4KWCA 1ONBA 1CX9B 4JJKA 1XC7A 2RGDA 5ER6A 3RNOA 4Z53A 1N6NA 5DNVA 4BFCA 1J7KA 1FTNA 2DHDA 3L46A 1C9NA 1O8CA 1U1FA 4BVHA 3CZPA 5ADVA 1PLJA 4UUBA 1UD5A 2PU5A 2D13A 4GYYA 4MUJA 4V39A 3E48A 3ZWVA 4OOXA 1L0BA 1EH5A 1M72A 2G28A 4NYJR 1PWXA 3I92A 3TLZA 3B1VA 1QR6A 2C29D 3DBRB 4WLFA 1UXOA 2ZVDA 4LEIA 2OCIA 2BZ0A 1PS8A 2XSZD 2XZOA 1RDFA 5T4FA 3R5JA 4DWJA 5IDQA 3GRAA 1L5SA 3QPAA 1VL6A 2WYOA 1SXIA 5KYGA 5DM2A 4PYKA 4M1SA 1BXGA 2Y1DA 3PE6A 1LX6A 3DNPA 1EFPA 2IPMA 1JR2A 4OOFA 4MSUA 5DHSA 2FMFA 2Q6LA 3COJA 5LBIA 1JDUA 4HEA1 2QXYA 4IIYA 3OG9A 4QUBA 3RT1A 1D3AA 3RJ5A 2L69A 2BFFA 2QLMA 1CZLA 2BF4A 2AYYA 2XGGA 2B4TO 3BZWA 3HI6A 4IJWA 9GPBA 2NG1A 3D4IA 1GZDA 3IKLA 2AFRA 5AKGA 3RT7A 4BO7A 1GR1A 3VZBA 2ZFUA 4L4ZA 2HDHA 1AS0A 4B84A 5EL0A 4PZ0A 2QGGA 2IYFA 4MQFB 4BEBA 2QYOA 3T1YB 4L9AA 1D8AA 2XF2A 3DOIA 3EF0A 5EESA 4KYVA 4RDHA 1ISPA 3AV3A 1PJZA 3CCCA 2X77A 3BA1A 3FDIA 4J4BA 8ABPA 4CM4B 1A96A 1SOAA 4HEA6 3C6MA 4PSVA 1UBCA 2WFLB 3I9OA 5IKMA 3VFDA 4RD4A 3LY8A 4F1WA 4PONA 4E2XA 1XN4A 1XQVA 1SCQA 2I2CA 4YMHA 4MHSA 1JZTA 3CC8A 4W63A 4Y2UA 1ZY2A 3QX3A 2JEYA 4X6YA 5BWCA 1NR5A 4L5AA 1JEJA 1HOXA 2XW6A 2IEZA 3KBOA 1HK7A 1RABA 4LQ4A 4JBWA 3STUA 3V33A 3AKZA 1LRKA 4CM8B 4DVJA 4LFAB 2F3SA 2YMPA 1TCAA 1BWQA 4AFNA 4AY3A 1H8HA 1KDZA 2QY9A 3L7CA 1RQRA 4DV1B 4MGKR 4TLBA 2EVWX 4UHHA 3ZZTA 4J0CA 4NEGA 2H1FA 4EHJA 2BEVA 4AWBA 1Y0RA 3T9FA 4DV6B 4PHCA 1E2PA 1D6NA 1R0BA 4OREX 1BDMA 4UBMA 4PPNA 3VVBA 1Z6GA 3USZA 3VSBA 3GRKA 4IEFB 1KYQA 1U8YA 4WZTA 3QFSA 4ZT3A 3S70A 3T0IA 1EWKA 1ZOIA 2H00A 2HO4A 2V54A 3DJYA 3FYCA 4Z86A 1KJIA 4OUKX 1E3TA 5E1OA 2ZTNA 1VQNB 1Y9EA 1Y8CA 2HYIC 3HU5A 1Q11A 1RAHA 2WD8A 4AYWA 4RS4A 3TR0A 4DLPA 1L5ZA 2BRUC 3I6BA 1M2VB 2EAUA 2CNDA 1P1KA 4L6IA 2WPDA 1L5KA 1H6AA 1T2VA 1TEXA 2GTHA 2NXWA 2PX4A 4J07A 4Y2TA 2BYTA 4W5QA 1QQBA 4QUEA 4ZMBA 2E55A 1E2JA 5AKJA 3SYKA 3W6NA 1JN0A 1AKMA 2B1QA 2XD9A 3EAFA 5LKAA 1RKVA 2QVYX 2ZIVB 2X7HA 3SIXA 1FFBA 1JPJA 3VI3B 3ZHTA 1FNDA 5FI3A 2Y1OA 1Z74A 3K8YA 4CTOA 4INOA 4U9UA 1C7JA 4BQIA 2YJ3A 3BHIA 1IULA 3M5PA 4QO7A 7AT1A 5JLJA 3G88A 3AR5A 3EG5A 4G7XA 5K0CA 4DIBA 2Z83A 1XCPA 3ZWOA 4HRYA 3QM1A 2QRZA 1I3CA 3TRFA 3UGQA 1XTQA 3RT9A 1VBKA 4DARA 1IQ0A 3ZE9A 5A3QA 4C87A 2ADFA 2RFLA 3I2HA 3WLMA 3RVJA 1Z25A 4PQYA 3TO5A 2ZJ2A 3UK7A 1V8DA 5ABPA 3ED1A 4ZQIA 1T6NA 2GKOA 5CEJA 1OU0A 4UATA 4ZRNA 2KWIA 5GQSA 1WXQA 1VGVA 2YJ4A 3HFJA 1D1SA 3UAYA 2BP7B 4MYCA 2QTLA 4PLFA 4QPNA 1H1DA 2OORA 2NZ2A 3MQFA 4F3TA 3IUNA 1DWOA 1E1CA 4LYJA 3AR8A 1L5RA 3M4ZA 1V1RB 4YJ3A 2V6FA 1X77A 3BUSA 3E5HA 3VU8A 1S1CA 3IDZA 5FOTA 3UICA 3L1IA 1KEUA 3QX9A 4LHXA 2OBSA 1IN1A 2A6PA 3ISTA 3SVLA 3L1VA 3HUDA 2PT6A 4OQPA 4ZT2A 3S1AB 4EARA 1BCRB 1Q0RA 2Y0EA 2Y99A 3NUGA 4N18A 3QPCA 2KLHA 4IJ6A 3W8FA 1P3DA 2QRPA 3UOAB 2ZSEA 2EW8A 2GBLA 2QSYA 3DKIA 1DS6A 4LGMA 3FNQA 1SUWA 3DKVA 4B3BA 1K2VN 4H0CA 1Y5IA 4OG2A 3T7RA 1K0FA 1LC3A 3GPCA 2Z3VA 4Y6PA 2NU8A 3VR4D 3WQBA 1W87A 2Z58A 2GR9A 3A6ZA 1YFLA 2Z6QA 1D4OA 2R60A 1IUNA 4H1TA 4XM3A 1RCUA 2IHBA 4IJ5A 3RG8A 1V35A 1KJYA 2G17A 4E6EA 2R7MA 1ZC4A 2YDXA 3IHLA 4FDMA 1HQYE 2VPZA 2JA