4BPRA

Ferredoxin-nadp reductase mutant with tyr 79 replaced by phe (y79f)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
291
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLFSIASTRHGDDVDDKTISLCVRQLEYKHPTVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Hydrogen Bond Network in the Active Site of Anabaena Ferredoxin-Nadp(+) Reductase Modulates its Catalytic Efficiency.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
total genus 90
structure length 291
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4bprA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4bprA02
3W5HA 4AC9A 1M90D 3VO1A 3A1FA 1FRQA 2FX3A 3CD6B 3VNUA 3MCAA 1JA0A 5GV7A 2NPFA 2R6HA 2B7CA 3B8HA 1DDGA 2RC6A 4RD3A 2D74A 1VQ9B 3OJXA 2DETA 2BVNA 2BGIA 1G7RA 3LRXA 3ZBUA 1E64A 4HE6A 1GJRA 2QA4B 3CCQB 1K9MD 3VO2A 1GO2A 3G6EB 4HE5A 2BGJA 3ZZ0A 5HXBA 2RC5A 4C43A 3CCRB 1GAWA 4YALA 3MHPA 3VNVA 4FN5A 3CMAB 2VNKA 1DARA 3W5VA 1QUFA 2VNIA 5TR9A 3P27A 4P6VF 3WY9A 4ZCMA 1D2EA 1YJWB 1W35A 1Q86D 2XNJA 1EP1B 3WBKA 3AVXA 2XEXA 4M0LA 3ZZUA 1ZM3A 2DCUA 1QVGB 1QX4A 1BJKA 3W2HA 4PC6A 4B4DA 1K8AD 3CRZA 4YAUA 2YWEA 4NCNA 3CC7B 3I55B 1CNFA 3JQPA 3G4SB 1Q81D 1TTTA 2QMUA 2X3UA 5AN9A 1BX1A 4FWTA 5H5JA 1CNEA 4TMVA 4RCZA 2J7KA 1ZUNB 3JQRA 1EFCA 4YAOA 1VQLB 3CCJB 1NDHA 4DQLA 1KJZA 1KD1D 1VQ4B 4G5GA 3QSYA 1M1KD 3OZWA 1H42A 2XNCA 2E1RA 2B5OA 1QGZA 1OGJA 4G1VA 3W5UA 1YHQB 4PC2A 1B23P 4PC3A 1JB9A 3W2GA 1R5NA 1FNCA 4LBWA 4M1KA 1OB2A 1TVCA 4QHYA 5TY0A 1ZM4A 2VZLA 1EP2B 3FJOA 2DY1A 2PIAA 1BX0A 2CNDA 1D1NA 1VQ6B 5FA6A 1DDIA 1NJID 3OZUA 4TMWA 1W87A 1SM4A 3E1YE 2AHOA 3WYAA 1AMOA 2OK8A 4RD6A 1XE1A 2HMAA 2BV3A 1E63A 2B7BA 3I56B 2OK7A 2VNHA 3U6KA 3QFRA 1E62A 1G7TA 2HDNB 4QFMA 3ZZTA 1VQKB 3LYUA 1K73D 1IJFA 4IW3B 2QDXA 1UMKA 4YAFA 2C77A 3CMEB 2ZITA 4YAWA 1G7SA 4Q7JB 1N0UA 1JJ2B 4ZGQB 3WNCA 1F60A 1Q7YD 4B47A 1VQ8B 2QTLA 4F7DA 2PLFA 4ACBA 4P3YA 5JBQA 4J0QA 3ZBTA 2YWFA 3SJZA 4RD0A 4B44A 1EFUA 3ES9A 4RJLA 4RD4A 4DQKA 2GQFA 1QVFB 2EFGA 1YJ9B 4G1BA 4M2LA 1EFTA 4M53A 4ZV4A 4ZGNB 1KC8D 1S72B 1F20A 3B82A 2HCJB 3CW2A 4Y9UA 4ZCLA 2BPOA 2BF4A 1QFZA 1VQ7B 4M4SA 1U2RA 3CCEB 3CCLB 1N8RD 2OTLB 2BMWA 3CC2B 1QGAA 5H59A 4TMTA 4PC7A 1QGYA 1G7CA 4RCYA 1B2RA 5DSZA 3VMFA 3CCSB 4EH1A 3AVWA 3CCMB 1ZM2A 5TV2A 1GR1A 1QH0A 3OZVA 1OB5A 4C0SA 4BPRA 2YWGA 4LC0A 2OTJB 5EMNA 4R71A 4PC1A 3AGQA 3QFSA 4UAJA 2YWHA 1KK1A 3OW2B 1FNMA 1JNYA 1KRHA 5KSWB 3AGPA 1I7PA 3CPWB 1N0VC 1VQ5B 3AVVA 4Y9RA 1EWYA 1YIJB 4MYUA 1AIPA 4WQMA 1EXMA 1JA1A 1W2BB 4PGOA 3E20A 1R5OA 1VQOB 1YJNB 3V76A 3LVBA 3U6BA 2QN6A 2DEUA 1IJEA 1R5BA 3W2EA 1D8TA 2GPJA 3CB4A 1TLLA 3G71B 4Y7CA 2VYQA 2BSAA 4TMXA 1QFYA 3OJWA 4B3XA 2BN4A 1A8PA 3WXMA 1KK0A 1DG1G 5THXA 1KK2A 1KTVA 4TMZA 1VQMB 3AVUA 2BM1A 4YHBA 3U2QA 1W34A 3PENA 3B78A 3QFCA 1FRNA 3CCVB 1YI2B 4LBZA 2QEXB 2BM0A 4K1XA 3WBJA 4H9GA 2C78A 3CXCB 2QTZA 3I1FA 1HA3A 3W2FA 1IB0A 1OGIA 3AVTA 3QFTA 1FNDA 4TN1A 1FDRA 4RD2A 3WNDA 1VQNB 1YITB 3MMPA 3AVYA 4ACAA 4LBYA 1XB2A 1CQXA 1FNBA 3LO8A 4MYTA 4RD1A 1ELOA 4NBSA 4LBVA 4B48A 3WNBA 4AF7A 3FPKA 3ZC3A 1Q82D 1SKQA 1VQPB 2EIXA 1GAQA 2DERA 2VNJA 4U9UA 1EP3B 2PMDA 3J81k 1KK3A 4FK8A 1S0UA 3P26A 4N3GA 4N3NA 1QFJA 3QE2A 1BQEA 2CRVA 3JQQA 4ZCIA 1QG0A 1QUEA 1GVHA 1TUIA 3CCUB 3W2IA 1ZM9A 1H85A 1J9ZA 1WDTA 1KQSB 4B43A 4AF6A 3CC4B 5GV8A
chains in the Genus database with same CATH superfamily
1KQPA 3DVRX 1QVAA 3IT0A 3K9GA 1U0RA 1X80B 3DO5A 4YUZA 2IEGA 5J2UF 1MXHA 3KC2A 4AMVA 5F77A 4CG0A 1UPTA 1ZSYA 5AJZA 4CMGA 4M60A 2HIAA 3ADKA 5K3CA 3NFRA 4WJLA 2P0YA 5I3ZA 1XAIA 2IPMA 2NW6A 3C6KA 1Y80A 2WQ6A 1Q44A 2Q2QA 1AG9A 1JJBA 2FN9A 5I01A 4KRFA 3OW7A 4INJA 4U6NA 3SM3A 2D74A 3CZQA 3OHSX 3O9ZA 3DC2A 1CR4A 2OE2A 2UUPA 4H7HA 2P9TA 1MOPA 4ALJA 4C5BA 1TQHA 1E3MA 2C5SA 3KSUA 2MINB 3IP3A 5ALLA 2GNAA 1W36D 1Q57A 1MT3A 3N58A 5L3RA 4BV2A 2QGNA 4YRDA 1DQPA 4NOMA 3SHWA 3N59A 1W47A 2J7PD 1OBHA 4LDQA 3DOOA 4OGGA 4H60A 5F9FA 1FBTA 2CJXA 4ZDWA 2D2VA 1JLHA 1SOWA 4I6EA 4DDUA 4D8YA 1QIJA 4LZZA 4RSRA 2A0WA 1L4FA 3B8EA 4CMAA 2BF7A 4UU8A 3VMMA 1F2TA 2RBKA 3IJPA 3LECA 1ZSNA 5AKXA 3RIMA 1Y81A 2XF8A 3BICA 5KW9A 5GQSA 4N3CA 1A9YA 1K9MD 1ZD3A 3K2QA 4FT4A 3TE7A 4ESOA 1T9ZA 4FBMA 1CCWA 1EM8A 3OKFA 2ERCA 2GVNA 4ANFA 4CYMA 2JDID 3EEYA 4TTQA 4DARA 3AFNA 1LS1A 1Q6ZA 2ODPA 5TB5A 5K0EA 2VP5A 2ZL6A 5BXYA 1Y6GA 2R1TB 4ZIRB 1R8JA 3U7FB 1V5VA 2OAEA 1IQUA 1T5TA 1WXFA 1KGDA 1CRPA 3A70A 4HXEB 4FT2A 2X4DA 3P9CA 1KBQA 3ZDQA 1G6Q1 3ETEA 3M3HA 1T91A 3KLOA 2CFRA 1BGXT 1FL9A 1WS6A 4EHFA 2IIBA 2AB0A 1CKEA 3SIXA 3ENWA 3OQ1A 1O08A 2HFJA 5BQ5A 1ZLYA 4DV5B 3P27A 1M2FA 3L7BA 4MIKA 4O63O 5F76A 3ICQB 3UC9A 1GGJA 1TMYA 3CLUD 3FA2A 1NB0A 1JG7A 3GHHA 4G0XA 4BKRA 4C01A 2ATIA 2GPBA 4URUR 1WNTA 4NKRA 2ZYIA 4FYXA 5DTMA 1CERA 5ALVA 3RTBA 4UHKA 4P3KA 1JQLB 2C42A 2Z2JA 1W35A 3FPCA 2ZUDA 4MPTA 3STXA 1GTRA 2HF9A 3Q3AA 4DANA 4HOYA 2B9EA 3IB6A 3WP0A 3DLBA 4HB3A 4N54A 2WAYA 4EHLA 2XEXA 3RQSA 1COWA 4PYJA 1TM3E 1TZJA 4EBFA 5K4GA 4UUPA 3HU3A 4FZRA 2DCUA 3KNZA 4FMBB 3HJBA 2QRGA 5TQ2B 1IOVA 4C0JA 4GI3A 4K8OA 2H07A 4CUKA 1V8BA 1N7JA 5F9HA 2WHYA 3WICA 1KH3A 1V48A 3ZW9A 3DYIA 4B6OA 4G7XA 2ZSAA 4MS3B 1Y37A 1TTPB 1M2NA 2IEBA 2YWEA 1UEIA 1N8TA 2DQ4A 3VR4H 4GF5A 3R75A 5HRAA 1PR2A 3CC7B 3GFOA 4IJWA 3I55B 1E9CA 8ABPA 3EA0A 1EAMA 1CNFA 3CSSA 3GIWA 3W8DA 2VPZA 2J4CA 1B26A 4YR7A 4PZZA 3VJMA 3AOGA 1U1IA 1P29A 3Q3HA 1Y1KE 4AZWA 4MV4A 1ORWA 4DJ5X 4BV3A 4KYVA 4U7DA 1ZMBA 1NVUQ 3JVVA 5BNTA 4J16A 4AWXA 4TMVA 3FX2A 2V4ZA 3RGWS 2C4TA 4ZAVA 3TIFA 3JQ8B 5E1DA 4PTYA 5JWOA 2IV2X 2W58A 3RVDA 2XQIA 1JTFA 1Q16A 3D7MA 2X86A 2YFYA 3IQXA 4PX5A 3E48A 1RBYA 2DYKA 1ISRA 3SC6A 5K8IA 3IAS1 4QWWA 5FLXA 2ASEA 1ZWLA 2GXSA 4TL8A 1PZNA 4ZV9A 1IAQA 5FA5A 2JFZA 2UZ1B 3EGWA 3I30X 5D3ZA 1AUVA 2ZUBA 1RI1A 1V6AA 3PEUA 4RQUA 4GGOA 5KHAA 1AGXA 3JYLA 3NDBB 1DX9A 4G8BA 3CH5A 4G5GA 4JUIA 4NEQA 4E7OA 1EHCA 3ND7A 1M1KD 4HDAA 4Y0VA 4RUKA 4COKA 4YCLA 3ILHA 1PK8A 5H82A 2R97A 2EVWX 1E6LA 1IZ7A 2QLLA 3N8NA 4ZO6A 1USVA 5I48A 5K8UA 2RHGB 1SXJA 3OP1A 1TPZA 5MGNA 1NBMD 3IRVA 1G60A 1XL0A 1XMSA 2QG9A 2HSZA 4B6FA 3PC7A 1B23P 1IHXA 1BFKA 1U5BB 1UOPA 4MRAA 3FPHA 4RM2A 2O1WA 3T9BA 1DEKA 1K6IA 2FRDC 2ZB7A 4XWTA 4LJLA 3Q72A 4OHWA 3K94A 4V02A 1YRBA 1LW7A 4M1KA 5EVJA 1OB2A 3IEMA 2R8BA 2XMCA 3FNRA 1KO1A 3PD7A 1QK3A 2WUDA 3ZI7A 2FLKA 2AIRA 4R1TA 3RJMA 4WN9A 2IF0A 4E31A 2VDVE 3GG9A 1U3DA 2Z3VA 3PDIA 5HIMA 4EG3A 3HXMA 1JFTA 5COBA 5EYPB 2MWMA 1CUDA 2OV3A 2IY7A 3DULA 3TCKA 4PNEA 2XSZD 4Q34A 3QVSA 4J0HA 2GASA 5FBQB 2CKDA 2Y6UA 3A58B 3LTEA 4L76A 4RFVA 4DJTA 1Y8AA 4YJ2A 1SM4A 1H93A 1CJTC 3BIWA 4K26A 4L2IB 5ALRA 5LYJF 2GK4A 2J46A 3L9WA 1YV9A 3VHXB 2DFKB 4P5PA 1P5HA 1UBUS 3QA9A 4KWEA 1CE8A 1VJCA 4BB0A 3L04A 5LQJA 3H4VA 4L85A 2HTEA 5JAQA 3RSLA 5B4TA 2Q4BA 6PFKA 1IXZA 2VAWA 2AHOA 4FZ3A 2IPAB 3WAGA 1VE6A 3GRUA 4RDIA 2ZUUA 1T0BA 5KJCA 4TQUS 2DWPA 1AXRA 1V5WA 2O8BB 3MOGA 3HJHA 1UODA 4CKEB 1RHUA 3ETNA 4NBVA 3VHLB 2VF2A 3MAAC 2QPOA 3D8BA 2CEAA 3L4BC 4A03A 2ZRBA 3IBYA 3LPDA 1BHO1 3H6GA 4JCOA 5CD9A 1QYIA 2RHOA 3CUYA 3OPNA 4FDLA 3C8MA 2OMEA 3UAOA 2WU3A 3CNHA 5AW8A 1KOGA 1I2AA 1JI0A 2H1HA 5B7QA 2TECE 3ZHOA 2HY7A 3FZYA 1NA5A 3ETCA 5DHSA 3L41A 5GM1A 1U9YA 3AYXB 3TO5A 3EIQA 4B8YA 1H4QA 2FFQA 5IDQA 1TCAA 2W2MA 3I6BA 1BSVA 1GUFA 4DQVA 2MYNA 2XNDD 4S24A 2E48A 1LLUA 2VCYA 1D4AA 3WA6A 1UBEA 4FUTA 1I6MA 5TARA 1G38A 4NCAA 3BBLA 3G89A 1MZVA 3AEQA 1Y42X 1M0SA 1ZIYA 4L8WB 3AINA 3UWSA 4G25A 4ZI7F 1HFEL 3WV4A 1BE6A 2BGRA 4B2YA 3NUQA 1J42A 2DHQA 4GW3A 4JOSA 5AW9A 3P9ZA 5DH9A 3FHTA 2N1MA 1HQYE 1Z75A 3WNCA 4D9CA 2UYCA 3BTSA 1YDEA 3PPIA 1F60A 4ONEA 1QLWA 4PCUA 4PHTA 1TYBE 3PE6A 1M54A 4CNBA 3THXB 1BVUA 1WNFA 2YHSA 4FTWA 1KZYC 1T35A 4JFAA 3W9UA 1G5QA 3HMKA 1HTWA 3F6YA 4R98A 1BDMA 2Z83A 2REXB 4KX3A 5AESA 5AW0A 4QVIA 1T8TA 2BKLA 2HFKA 4MGKR 4YCJA 2QVGA 1G6KA 1ZMOA 3R0IA 1HC7A 4B6JA 2B4AA 2O5RA 1QRAA 2A88A 1QVFB 2CFIA 3A1DA 3EEOA 4HAVA 3GSIA 2R48A 1GEEA 1YKSA 5I9MA 3AUFA 4LY3A 4W9NA 1V4VA 1MAVA 3O8NA 1R0CA 4G1FA 1EZ4A 3FSJX 3KPJA 4B5LA 1YVUA 2LIPA 3NFYA 1SBHA 3QJGA 4RHYA 4TMKA 5ITVA 2XUIA 4I81A 1RLOA 2QMQA 1JKJB 3CPEA 3G2OA 4HIZA 4ARZB 3BB3A 3HN7A 2CB9A 3FAZA 2JFOA 3M82A 4I1IA 4Q9LA 5G1PA 1DNPA 3M6FA 3UJHA 3UAWA 4OY3A 2QX8A 2ZUWA 2PYDA 1AD2A 4I5EA 4LA4A 1SA0A 5BWBA 1OUMA 4JDUA 1W5FA 2ZZGA 2CHGA 4JOCA 5BN1A 3FWZA 2AMVA 1ODSA 1YBFA 5AIBA 2OPBA 5EMMA 3OFNA 3H11B 2CJYA 3QXHA 4TMTA 4HNAA 3R20A 3DFFA 4R8KA 4PC7A 5JY6A 3EG5A 2CLSA 4RCYA 3CCSB 1P7YA 3NHAA 4WZLA 1PFUA 4EH1A 2JFNA 3QVMA 4KQHA 4HBZA 5FADA 4GOKA 1M2OB 3DW3X 3R6LA 1VJGA 3FNHA 2JEYA 4PWZA 1XEXA 1SVNA 5B1EA 1QGED 1SZDA 5EJMA 3TQCA 1KQNA 4CGYA 3ODPA 2VRCD 3CN7A 3A8KA 2ZJ8A 3K4HA 1DO2A 1ZNWA 4B73A 5DRTA 3NBKA 1A7AA 3O26A 3H9QA 2OTJB 2OCAA 3TLYA 1IDOA 3D8HA 2W6IA 3EDMA 4KQ1A 4BBAA 3HA7A 2M2IA 1AQIA 4B2IA 4UAJA 2BFFA 4KXVA 3LGXA 3EZLA 4E15A 2DY0A 4DLRA 1IOZA 3I2YX 1J1IA 1WMAA 3D6MA 3HCEA 2JGMA 3KWMA 2E0IA 2MYTA 4E0BA 5C7LO 5EWLB 4WIAA 5CDHA 3GUUA 1OI4A 1PZXA 2AJBA 4D9NA 1KVTA 1I7PA 1U2ZA 3DGFC 4X94A 5E38A 2YBDA 5DK6A 2F1IA 1JHYA 1VPTA 1WHSB 1Z9BA 2E4VA 3G8BA 5ERYA 2I1QA 2YFHA 5LDGA 2YQ4A 1VOTA 2QG4A 1V96A 4WZAE 5EJ5A 2I6GA 3OFVA 4OJTA 4IXTA 2CXQA 1NB9A 3OX4A 1UBLS 2HHHB 1AHPA 1EXMA 2YJNA 1NI4A 4BLRA 3KPYA 4F4CA 3N7TA 3CONA 4G8DA 4IP0A 2XUDA 4UOEA 1SUIA 2P69A 4BGEA 2BMEA 4X1IA 3GUHA 5EE0A 5HW0A 2ZYAA 1EB8A 3N8HA 1ISGA 1GV0A 1FQWA 1RVV1 3GFPA 1ID8A 3PDHA 3C4VA 4JIGA 1Y63A 3A4LA 3LKDA 4RDCA 3T4XA 4YJFB 3AOEC 5IUNC 3JZDA 2GPJA 1UBFA 5JRDS 1FXSA 1TLLA 1BIFA 1PBTA 2QT1A 3OFND 3G71B 1O9GA 3TMAA 1V47A 2Z56A 1QQBA 3T15A 4EP1A 2FUG6 4C29A 1A7UA 5GJCA 4CQLB 1F2TB 4M1MA 1Z63A 2JLYA 4JP3A 2IXFA 3JD1A 3IULA 3F4BA 3CNLA 1E0SA 1W34A 4JP8A 4CV3A 3UO8B 1DKPA 3AIOA 3DTVB 1V5FA 1TXGA 4BVHA 3Q5GA 4TL9A 4Y2PA 1G6HA 1P2SA 4N48A 1MJGM 2IYLD 5FI5A 5IVDA 4CLHA 5IBCA 4BPBA 1PFGA 2QEXB 2L18A 4XH9B 4FE7A 1U1CA 1NRWA 4UQPA 4Q24A 3HBFA 4K1XA 4XZ3A 1XCMA 1EIWA 3EVGA 5FL7D 1B6SA 2NQ2C 3MCZA 1DRKA 3OJEA 4R8SA 4IPTA 3U3JA 3ZZMA 1RRFA 3IMFA 5SZHB 3CP2A 3R7SA 1XCGB 1KAMA 2NPOA 1S4MA 1M2VB 4C30A 1H4VB 1GQSA 1T15A 3JZAA 2IK8A 1ABFA 4ODIA 4G6IA 1IJBA 1LPSA 3QBVA 4U7GA 1L8XA 5BMVF 3ZY3A 2O7NA 5JUWA 3SKBA 4HQFA 1FNDA 4M98A 1AKTA 4UTXA 3EK2A 3RVLA 3WNDA 2AFIA 4MDHA 3PR2B 4LYGA 1HDZA 4TS3A 4US0R 2NVUA 3A4TA 3ZOKA 4ZYVA 3L4SO 3AVYA 2GBPA 3CR8A 2OCPA 5F5XA 4O08A 5I8WA 5BQFA 4P7FA 1NJ5A 1E1CB 2BEVA 4LBVA 3HCWA 1I0ZA 3GFVA 3A2NA 2I29A 3DZKA 1F7UA 1CZOA 5CXSA 5GIPE 1YOBA 1H65A 1FE8A 3U9TA 1U80A 4KQCA 2X0FA 4M89A 4WK0B 3WGGA 1SVMA 4P3NA 2O8EB 4CKWB 1Z35A 1J8QA 2ICAA 4HQRA 4KDFA 1IAVA 5AK0A 5CPBA 4CM1A 3NC1C 4LV6A 4INZA 1RIIA 1ZLXA 4U9UA 3FMOB 3QIAA 4JI8B 2ZXHA 2I2CA 3QU4A 4LY9A 4DLSA 1UMBB 1S0UA 2YV3A 4R16A 4DNPA 4DNRB 4XASA 2NUTA 1AX9A 5KYKA 3DHYA 1Y8QB 4X44A 3QE2A 1A04A 4FCVA 1HT3A 4R1QA 1P4GA 2CJFA 5FI1B 1JIQA 4YAGA 2CL0X 1AGPA 1E3TA 2CZQA 3ZV7A 2WB2A 3A8JA 1BXRA 1TMOA 2Q4DA 3GFRA 4Q4LA 1JXOA 3BMOB 3UBMA 3KYJB 4MA5A 2WU4A 2B1RA 3MBKA 4X07A 1AKEA 4O1HA 2ZTUA 2MU1A 3C3BA 4HCJA 4I5IA 2MSEB 4LRWA 4B7UA 1ISPA 1ZU4A 2ADMA 3OZSA 3KOWA 3FSGA 2QR2A 5EAIA 5CA0A 2ZT8A 1O94C 1QV7A 3LKVA 1G5IA 2AK3A 2ECOA 2Z8XA 3ONWA 3ZLBA 1PG5A 4KRYA 5K7SA 2WJAA 1SN7A 2GFHA 3JQ9C 2RE8A 1XJWA 2L0XA 3HUUA 1CY7A 4NS1A 5KWVA 1X3LA 3GOQA 4GZ6A 3RNOA 1SQ0A 1XMVA 3W78A 2VTEA 5B1YA 1AK1A 1PX2A 4QU0A 2C3YA 2CNBA 2R6DA 1IG0A 3D7KA 3I37X 1MQAA 4JMLA 4RENA 3GJQA 5AKKA 2BFEB 3ROFA 3OT1B 5A5DA 1I2DA 3G2HA 2BFWA 1UK6A 1X1EA 4U02A 2VG8A 3TUJC 2PMFA 2OESA 5KDOA 3RIHA 2IWRA 3URKA 1KI6A 4RD3A 3D8NA 3EZXA 3MILA 4MKXA 1WP4A 4MICA 5AWFC 4TZ0A 4D9BA 4PLGA 1I33A 4OAQA 4R9NA 4UOZA 2J6BA 2BY4A 3EDQA 2WWTA 2OHXA 3WWOA 1QIEA 2Y05A 4UDXX 4E03A 4R81A 2DETA 1EM6A 2ZJ3A 4Y2JA 3WGYA 5LP6F 3Q8MA 3KYDB 4TRNA 5IH7A 2AC4A 1XK7A 4Q39A 1CQIA 1DG3A 1ZO8A 2OZLA 3JQ9A 3P97A 4WWVA 1GFZA 1N2OA 1M10A 4QXAA 1JKMA 3B89A 3RSHA 2XOKA 1YNSA 4JZKA 2I5PO 1E9VA 5DULA 3C3DA 5CFLA 4FW8A 2VCHA 4TLBA 4D56A 4R1NA 4HGQA 5CH5A 2DUNA 2FE1A 3M6MD 1YDWA 2XUJA 4FHZA 1ZI6A 3AETB 1RKUA 1TTHA 1OW3B 3G2IA 4RLHA 2WICA 4MJ7A 2ONZA 3RU2A 3S29A 1E6EA 4P53A 2PVPA 8GPBA 1FUYB 4HPXB 3HCNA 1RCTE 2DWUA 4HC4A 2AF3C 2B4TO 1F6BA 3ASZA 3S8EA 3NH6A 3G6EB 2R62A 1JA9A 4KIJA 2E4XA 1WCWA 4K87A 3T1VA 3HVIA 1U9IC 5EJIA 1FW6A 2Z1NA 3LWZA 1P9WA 4L5BA 2HW8A 2QVCA 1JDTA 3PNYA 4CCYA 1T9GR 2WF9A 2ZRCA 1ZC3A 3NCTA 3AR2A 2TS1A 1NPYA 4IS2A 4IY1A 1I4DD 5CLQA 3G9QA 4RQBA 1ZEJA 1P1JA 3PE3A 1DARA 2O3JA 2R0QC 1DRUA 1E5QA 1R88A 3AR3A 4WLOA 3VR5H 4D7AA 3AFHA 4LFAB 2BD0A 2CXPA 4IIUA 3LHFA 1U9JA 3VFDA 1BE1A 1EXWA 1I1OA 1NVVR 4OQQA 3DE0X 2QTGA 5F35A 3KR9A 4JLDA 4QYWA 3S8YA 1KJ8A 2QPTA 1FJXA 1P1BA 4CETA 1PFQA 3HMQA 4PYQA 5GIOE 1QANA 3DE1X 3RIGA 6YASA 5ICCA 2AEEA 3GMIA 3FHOA 5AD1A 4GNRA 5NLLA 1GTG1 3RTAA 4DV7B 4FEEA 3PC3A 3H3XA 1D2EA 4S3MA 1QYVA 5DZSA 2BHSA 2YOFA 2WNSA 1PNOA 3JPWA 4RPDA 3FNBA 4Q3OA 1P8JA 3A8IA 2HC9A 1R66A 2FGJA 2W2PA 1PNRA 4PO9A 1TAHA 2BEWA 3KJGA 1UQUA 3NYWA 4D6YA 2RSLA 1TF2A 1Q17A 1Q7RA 2ZG6A 1LB1B 3ORYA 4F9TA 5JMPA 1U0EA 3R5SA 5U9CA 1Z6XA 4B3GA 3K15A 2Q6OA 1CY6A 3G8AA 4HAXA 2ZBGA 4JI3B 5JYDA 4AULA 3PGA1 3THXA 1NSFA 1RAAA 2F9LA 4QOHA 5LWHA 1PQPA 2A59A 2XITA 2C9BA 5CFPA 4P9SA 2DCMA 2PX8A 3EGDB 4ZJYA 4RNCA 3D2LA 1ES9A 2HYIC 3HBJA 4IDHA 2V7GA 1NDUA 3H17A 1C14A 4NCKA 2X6TA 1YNOA 1FFXA 5FI3A 3D2BA 3AHEA 4JR0A 2OENG 1D2RA 2OAP1 2VBIA 5E1OA 3IYLW 3SR4A 5I7SA 4OMFG 4MWTA 2APJA 2WG1A 5A5VA 4RCZA 1EWTA 2IUTA 2GM4A 5A5GA 2FU5C 5I7OA 1KFKB 4OLBA 3G59A 2REQB 1GGKA 2P4SA 2ZB8A 3MJDA 4KJZA 5ITZA 3JZFA 2JLUA 4R5HA 3UJNA 2AOUB 1N7IA 2QL7A 2MJLA 3CRRA 1G2IA 1G8MA 2YNMC 4UDNA 1BWPA 3OPMA 4D3FA 5IRCD 3BJMA 3IL2A 1E6CA 2PS0A 1UBMS 3AETA 1E1NA 4AJ1A 1Q3HA 3X1DA 1KFCB 3H2HA 3EW9A 1NDHA 4IQ0A 4TKVB 5BN5B 3R9KA 4D81A 4DDMA 4DQLA 1HL3A 3JQ6A 3AY0A 1P5FA 3F8SA 3FOFC 4JHLA 3UATA 4QVKA 2FF7A 4BNGA 3AJEA 3GLTA 3ER9A 4UZUA 1T26A 1CRLA 1MG5A 3KTOA 4KE9A 1LDEA 5DN6D 1R4MA 2X0IA 2DUJA 2C57A 3H5OA 5KVQA 2VWHA 2BR5A 2VL7A 1UZMA 5LQAA 5MGBA 1J9EA 2WEKA 2VZ9A 2HU5A 2WRZA 2Q6VA 2Q3HA 2RHHA 2GBGA 1H23A 3QVTA 5IMBA 2GN1A 4EHHA 1MW8X 4TTSA 1EJ6A 4BQIA 4XGQA 3FBGA 5EVCA 3GGDA 2RGWA 5CP8A 3UANA 1F9AA 2YNMA 2QUIA 1ZD4A 1NRJB 5E95A 4V2IA 5LQSA 3H94A 1RTTA 4FSXA 4HK4A 4KWIA 4KWHA 3RC3A 4EF4A 3T7IA 4PX2A 1NF8A 1T0HB 1NJID 2P4QA 4RCVA 4W5WA 2AZMA 2PR7A 4OOSA 4PAAA 2ZS7A 5D86A 1EINA 5DGTA 3DTTA 3M33A 4FZ5A 1FFBA 1H2EA 4D57A 4U00A 4TYYA 1YCFA 2JBAA 4PONA 4R1UA 3BHNA 4CR7A 2DHDA 2QJTA 1UDWA 3CPHA 4NCBA 4OHCA 1YRHA 3A3YA 4ZT3A 1RJ9A 2WR8A 1SQSA 4AJEA 2V4UA 4PE5B 3KEWA 1LJLA 2XUOA 4A73A 2HT6A 3G6WA 4XLFA 2QSJA 3L46A 1I30A 1NY6A 4WESA 2C2XA 3MFQA 3UWDA 4ZGBA 1UFRA 5KYTA 1O6BA 2AD1A 1TJPB 4ZRDA 4NMMA 1ECLA 2O6HA 4TWBA 3SX4A 2IELA 3W3AH 3KSAC 3ZCVA 4KH1A 2ZR0A 3ELBA 3UT5A 2XOXA 2WZNA 2HTFA 3AJDA 1OH5A 5B7PA 1SGWA 1OX5A 4C0QC 5KJ6A 2DECA 3CMMA 4FGSA 1Z4MA 3GARA 3STYA 5HG0A 4DCMA 3PJRA 4HH4A 4P84A 3ANXA 2WF5A 3S0JA 1F7VA 4Q4HA 3JVUA 1KEUA 2RHBA 4QYTA 1WXHA 2W43A 5HCUA 2Z6UA 2WTBA 3BK7A 3N9IA 3UMYA 4R2JA 5G1OA 1S8AA 4PAQA 3UBTA 3SBEA 2VPTA 4NHEA 4IDOA 1U3VA 4HZIA 4LJ4A 4M8NE 4CF4A 5ADWA 3IJ5A 4YREA 4F6CA 1JHUA 1E5TA 3R4VA 2ZI7A 3TINA 1ZN9A 1RHJA 1CY0A 4L4XA 5J5VA 2ZULA 2VNAA 4ARCA 1ZA2A 2ST1A 3BSWA 2X76A 3PUYA 4IVPA 4MDEA 1ADYA 4NOJA 4DNQA 1U2GA 1FDSA 2AUMA 3LPMA 5CH8A 3UWKA 2BONA 1XXHE 2F3PA 2QX6A 4OHBA 4IV8A 4RS3A 1N0HA 4UHEA 5KYUB 4EEZA 4UHCA 2ZZFA 3KYBA 3P2KA 4LRXA 2AI2A 4M8IA 2NP6A 4XOPA 3ZHCA 4CEJA 5CNKA 3GFTA 2VTDA 1IHOA 1M2VA 4ACBA 2HPHA 1QONA 1RW4A 2QV7A 3A26A 2V6BA 4MEJA 1SKUA 4DEYA 5J4HA 2BDEA 1K5HA 3DEZA 3A1VA 3FYCA 4FKBA 1TO6A 1FCJA 1T2VA 1XTTA 2G8NA 1A98A 2P0EA 3EXFA 4HDSB 5FHRA 1G1AA 4CUJA 1HE1C 4CIBA 4MYCA 3GLHB 2P2LA 3L7LA 1PZFA 2UAGA 2ZJYA 3JSXA 4KGVA 4L8LA 3SS9X 1T5DX 2C7VA 2GGSA 5T3YA 2XMPA 2ADFA 2ISQA 2WF7A 4TN5A 1Q1AA 3H16A 1KC8D 2HNBA 2Z5LA 5KSPA 5C8ZA 4FR5A 4MX8A 2Z1DA 2O23A 3CUWA 3RW9A 1N6KA 4GXQA 3C3EA 1ABEA 4CI9A 4EYQA 1IC6A 2J9FA 4WLNA 4ENQA 4UQOA 3VR4A 2ZCVA 3NEYA 5D5HA 1OWMA 4HDCA 4C0XA 4FFNA 3ZK7A 2RK6A 4P5EA 4U2FA 3OLWA 2VT3A 1XXHB 4X60A 5AH0A 5F33A 4D74A 5JHGB 2WKWA 2DQKA 1WEHA 1EH5A 3A9SA 3V00A 4QEZA 3OCJA 2OPHA 1T4CA 3ULKA 4HQOA 1E79D 1NUPA 1T5OA 1IPFA 2PJDA 3D59A 3EIHA 1FFGA 3MWKA 4UUMA 2W22A 1WMEA 3GT3A 4IWXA 2ZB3A 4BP8A 4Z3DA 2QM7A 4REMA 3K2BA 3EFEA 1MGOA 2EXXA 3TTYA 2FMFA 3O03A 4FJ1A 4EI2A 2X0KA 4YV1A 4KYTA 5JJCA 3UWMA 3DONA 1U0FA 3INRA 4I1OA 4DIOA 1V4BA 2AXEA 5KQMA 3ZY5A 3ZZNA 4B79A 2OD2A 4OA5A 4AIIA 2V31A 1RKVA 1VLZA 3DLPX 2I99A 3BZBA 3TPFA 5G2OA 2UKDA 2A5DA 1WZIA 2JGKA 3HADA 3LXMA 1CETA 1KEWA 3GLGB 2ECQA 3LWDA 3OW2B 5HDQA 2WP0A 2Q7DA 4FXOA 4QD3A 3JV7A 4LF5B 1N06A 3IESA 1XALA 1SZCA 1YUMA 3QHQA 3H9GA 1DT3A 3OPYA 3Q7RA 2IS6A 2HOQA 5EWJA 2P2CA 4ZU1X 2AG0A 4EW6A 1ECBA 4HF7A 2ZI9A 4HTFA 1L5MA 3E3NA 1D2CA 2GM3A 4FYYA 4QTYA 4ME6A 1HSZA 4FX2A 2A67A 2ZYUX 4UFPA 1R6BX 5FULA 3JYHA 4XN0A 4BATA 4DQ0A 2JHGA 3AEKB 4FC7A 1F1JA 2CFOA 3A2LA 4R2IA 1W7AA 1MUUA 2QZSA 1B6GA 2BEKA 2HGSA 1N6PA 1SUWA 2V5UA 2VF8A 4W8OA 1V0FA 1P8AA 2EYQA 1L5GB 4O5OA 4UVDA 4JQYA 2DT8A 5YASA 4XUEA 3MMSA 2Q4OA 3S2UA 4QO7A 5JADA 2C4WA 3IR7A 3QPDA 1C0IA 3WOHA 5HBRA 5JD3A 2PX2A 1JEQB 2GF0A 1OFTA 1RHMA 1CUFA 2FEMA 1EGQA 1NYTA 2P3SA 2RIPA 3A3OA 1Q15A 3QVKA 4Q21A 4QUBA 4RVSA 3TVTA 5CBPB 3U4MA 4AKIA 2JJ1D 2Q9CA 5I9NA 1DMRA 1TK9A 4DGSA 4Y6PA 1I2MA 4F3CA 3SKYA 4FXUA 5FV7A 4YRPA 3BQMB 2W71A 1C0EA 1U90A 5KVSA 3PJFA 5I7EA 5GGYA 1Q84A 2C4KA 4YHBA 3K8QA 3PQCA 2PUDA 1CNMA 3MXOA 3MTIA 1F14A 1UWCA 2JDIA 4NESA 3VDQA 4B76A 3EAGA 4AO8A 2FEPA 221PA 3MGKA 3MJSA 4LHZA 2EWVA 1VL6A 4CIYA 2H4WA 4LRTB 4PCLA 4OVKA 5CLIA 1E1RA 3UJ7A 1D7AA 2ATXA 3ODGA 1BO6A 1ESNA 5ECDA 4QXMA 5C2JB 5AP9A 4LYHA 5E7QA 4NPAA 3W9YA 2PKXA 3KOMA 2ZE8A 4KV9A 4WXHA 4IQGA 3NATA 2XMBA 3KZ1E 4NNJA 1YJXA 2Y9PB 1O95C 1WIWA 5LLDA 3NOOA 1GSIA 5J9FA 1XDWA 4NMXB 1YRLA 4C4YA 4EO7A 2J5RA 2C3PA 2GAAA 3L07A 4MYDA 1A5AB 2OHIA 4LRSB 3IBTA 1O6ZA 3I8SA 2QTFA 1H8EA 1BWSA 3MK31 1EPUA 2FGKA 3JD4A 5MHTA 1JR6A 1PKVA 1THGA 4LK2A 4DMFA 3MIIA 2NV4A 4U7FA 1E7WA 1C2YA 4TTJA 5LDDC 1BDJA 4JVSB 3EZYA 1JPUA 1GPH1 2PUJA 5FPHA 2I34A 1L5NA 5H70A 5EJ8A 1G3MA 2FSIA 2WJ6A 3QLEA 1HZEA 1BD4A 3TPCA 1LLFA 3EY4A 2CGEA 4WBNB 1X7YA 2OYSA 1E5LA 4B33A 5T7BA 2WSSA 3UJAA 1N1MA 4CHTA 1JI3A 5C0OE 5IDWA 3AW8A 1ESDA 3C8ZA 2SCUA 4KXXA 2GCOB 5HE8A 1LI5A 2XB9A 2NWQA 3HRIA 3W06A 3LZ6A 2H4XA 4GIBA 5EE5B 3AEUB 4QU9A 3HNPA 3L1JA 3LGSA 4AJIA 4UTNA 5EJ6A 2C8LA 3RSZA 1R0LA 5K0ZA 1OLOA 1T8WA 3LKBA 1NC3A 4LXUA 4C1NA 4GWKA 5LNK6 4WOCA 1KK3A 2LXNA 3DKKA 3K16A 3PT9A 4YH1A 2YHAA 5HS6A 3P26A 1XMPA 1N3LA 1OIVA 3H19A 2I2FA 1U7OA 2B1GA 5IYPA 3HR8A 3UV3A 2HJHA 2P5TB 4W82A 4CR6A 3K31A 4XFKA 1K9VF 1M1NB 3JYNA 4CIDA 3SICE 4D80A 2DOGA 3NKFA 3UTCA 1GAXA 4AJLA 3IMCA 1NSYA 3DB2A 3W1EA 3HTXA 2B4YA 1QG0A 3IC5A 1WMFA 3A6PC 2IEIA 1M34E 4L15A 3TGLA 3GX1A 1TUIA 1LC3A 2YQ5A 2H2IA 3QENA 1YB2A 3WFZA 5K20A 2LZ0A 2II6A 3UMVA 3W2IA 3IPRA 5U4XA 2OBSA 2F3RA 4IICA 2BFBB 4YXWD 5E0OA 1ZHHA 3BIJA 1KRXA 3BMXA 3EXG1 3WC4A 5ARBA 3C1OA 4IDNA 3TGPA 1GRVA 4QKQA 3SZ3A 4DZZA 1FOEB 4CV1A 5HP4A 1EUCA 4OM7A 1E2PA 2G88A 1DXQA 4FYKA 4X90A 3GJ7A 2GX6A 3R7NA 3AUJB 1ENPA 3CCCA 2XI4A 3MCWA 5GV7A 4G4JA 4YIHA 4KPFC 2Y1WA 1XAHA 1M33A 3LAWA 3VSCA 3K0KA 1HY3A 3DFKA 1VHWA 3EVCA 3QUBA 2QVBA 5K6TA 2WTEA 1FSGA 4KDRA 1RZRA 2G4VA 1LQ2A 2VT2A 4FMDF 4YT5A 4TPKA 2VTBB 1CBUA 1G1MA 5IWAB 1UM9A 2H85A 1ORDA 3WBBA 4BDTA 1R0BA 4AF8A 1RE1A 2B1IA 3PDWA 2DQZA 2Y99A 4TM7A 3VR0A 2M9MA 1Q0ZA 1OAKA 1WZUA 1CP2A 4Y2RA 1P4HA 1AS3A 3AUUA 4MPPA 3TYXA 1G8AA 1LK5A 4EB6B 4ZVVA 1AB6A 4JLMA 1QNLA 4JVOA 4WOBA 5DIZA 4LPSA 2FETA 1E3SA 4C05A 4DJEC 1Y3IA 3PFHA 1LPOA 3OIGA 3LY8A 2CSUA 4EARA 1J2RA 4QFBA 5CYOA 1GA1A 1T24A 1UPFA 3BRQA 3HC7A 4RAOA 3DTNA 2C5AA 1SKMA 1DRJA 1PE0A 5BVGB 2LNDA 1VHTA 4QGGA 1OA0A 4PAOA 1JHMA 4XGRA 2P8JA 4BO9A 4PGMA 2CDAA 4HLQB 4Q4JB 1XZQA 4CXMA 2IYPA 5IYQA 1E96A 3LP8A 4WESB 2DIEA 5AJWA 1DQNA 5E1BA 1W44A 5TF0A 2HJGA 4OL9A 1QCZA 4C2TA 3CMAB 4W1RA 1TTQB 2W6JA 1X86B 1HDXA 2ZSBA 1Y8RA 3LK6A 1DQYA 2VRBA 1YK1A 2PSEA 1OJ7A 4BJ5A 5KYWB 1A8IA 2ZWIA 4CLXA 3U3ZA 2DHRA 3W8RA 4F92B 5HCIA 1UIRA 2FEWB 2IOFA 2BFPA 1E3JA 3KEOA 4V24A 2E2WA 3TB6A 3JARA 2X6QA 4B6QA 4Z4FA 2YJ3A 4LSMA 2GPSA 3CT6A 4YI3A 5JPDA 3CZ9A 5JZMA 4DADA 4PXSA 1A9XB 1UD2A 3CG0A 2FQQA 1NR5A 4U0JA 1M5TA 4IXMA 5G4KA 4ZI5A 3AVXA 3SQMA 1Q7BA 1E4VA 2YJTD 3CA8A 4NXNB 2XUZA 4A36A 2OO3A 4RS4A 1DIAA 3QEBZ 3WWYA 3WL4A 4ZRMA 1QX4A 1QP7A 3G2NA 2X9GA 3EIOA 4J0IA 2VATA 2YMQA 3SC2A 3WLOA 3W2HA 4B4DA 3EOAI 4BB6A 3ND5A 4Q3CA 3FUWA 3L6DA 3TNYA 3DLIA 3IDSA 1RMTA 1CIVA 5ITWA 2QTTA 3CRZA 2J3HA 2RK3A 4HFMA 2N46A 4R8VA 3GQBA 5ER6A 3VI4B 1Z62A 1ZQ1A 4NCNA 1PKEA 1DAMA 1RQNA 2O2GA 3B20A 4E2XA 1QPGA 4OUDA 3F73A 3WO0A 5A89A 1M74A 2RBEA 3CVXA 2TRSB 3KXDA 1KI8A 5KOHA 3JQPA 3Q87B 5C5CA 4CEIA 2XRMA 3LUAA 2VP6A 1CS0B 5HCNA 5TNXA 4A26A 3A14A 4FHCA 1RBQA 3I9V1 3BE5A 5H02A 5A9TA 2H59A 4O2AB 2K4MA 1IUPA 2JK1A 2I80A 1LU9A 1UEJA 3VPGA 1U28C 1IY9A 1X1RA 4JT2A 1QCDA 2AMFA 3DQPA 3FR7A 1PSDA 1SCAA 3X43A 2C1ZA 4XDZA 1NMQA 3I76A 1RDFA 3HPRA 4HNQA 1BYIA 1JNXX 2EC5A 3KKLA 4WN3A 2UZ4A 1R9MA 5JO0A 1CY1A 3C4JA 3DMTC 5GPBA 1X9HA 4GKVA 3PC8C 4UTVA 4DRYA 1CVLA 1KOJA 1NW7A 3CF6R 4IIDA 4OFBA 4OMUA 5T6BA 3VSAA 4B4KA 1RQLA 3ZCTA 1REQA 4ESVA 3CLHA 1GL9B 3THYB 4MCIA 1YX2A 4U2CA 2C9CA 3T56B 2ZQZA 2QAIA 3HDTA 2HXSA 3N2KB 4A8HA 1XO1A 4BRSA 3AEYA 1E2IA 1XNQB 4GQNA 3MWJA 4HI0E 1Z73A 3HV2A 3HB5X 4IQ8A 4REQA 1F8YA 4NZOA 1BXKA 5CJ2A 1GXSB 3AERB 3EPKA 1YHQB 4P4GA 1YR8A 4WCFA 4C87A 1TQ2A 2XDYA 2L69A 1HRDA 5L45A 1ZJWA 2HHJA 1LLQA 4M1EA 5HUQA 2WT4A 1KKMA 3HG7A 3KE8A 2AUNA 2HYDA 2F1KA 3OZEA 4IG4A 4MVJM 4X41A 4Y6OA 2CL5A 3I9LA 3UK0A 4RHXA 1Y1RA 5T4HA 3EPJA 1ZM4A 1P9RA 2V0CA 3I2KA 4NZPA 3SYTA 1G8HA 1N2GA 1YZVA 3PRYA 4MQBA 4O0MA 1Y33E 4QV2A 3IR5A 3LC0A 1RQ7A 3T5AA 3UG7A 1O4WA 3NHJA 5DBHX 4HTFB 1I6LA 2ON6A 2XMSA 3E27A 1M2OA 5JT1A 4D3ZA 4DV2B 2QN1A 3MB5A 2AV6A 1QRRA 4QWMA 5TEWA 1TW3A 3TZBA 4GUAA 3TFOA 4FONA 2CNWA 3HA5A 1HSOA 2QX4A 1H2HA 1ZBDA 4HWGA 1EBFA 1W19A 1ISHA 2NSHA 4PR0A 1MQSA 2IEYA 2O3QA 2NXWA 2QMYA 4PXAA 2ZUTA 1U3TA 5AFSA 2G63A 3IOBA 3FHJA 1W88B 5EJ7A 2DR0A 2IDZA 4LOKA 2E82A 3LUPA 1FFDA 4RVHA 3TTXA 3K0CA 3VU9B 4C06A 4C4PA 2VPQA 3SXUB 4IJUA 3U7RA 1EVLA 3C5CA 4JVMA 2GERA 3ZDXB 3NKVA 5FJJA 4DPKA 5IN5A 1JEQA 3LQRA 3HNOA 4LHXA 2ZKLA 3JQ7A 2IOHA 1L4LA 3RFFA 4ZHQF 4LRUA 3TQQA 3I56B 5ICGA 5EP1A 2DU8A 2ORWA 2JGAA 3LX5A 3KHSA 3KLPX 3ZHRA 4KDCA 4IDFA 5IM5A 2O59A 1FP2A 1L4GA 1PQYA 1QR6A 4TSFD 3EEQA 1ESMA 3HFGA 4FE3A 4K0RA 5E2BA 3TK1A 3L5KA 3ICEA 1XYGA 4R6WA 2CFCA 3JRXA 3MJTA 4DLUA 1ZKDA 4C3UA 3KSRA 5A02A 4QFMA 1T5IA 1OPRA 4LYJA 4XJTA 1ZDMA 4WKGA 4CL0A 2X0JA 3L6CA 3BWMA 4FFOA 1TCBA 4H7FA 3JQAA 1RYEA 3S2IA 4WK4B 3VC7A 4BIMA 1H0HA 2BE7A 2JK0A 3GFBA 3EPLA 1UMKA 3GRCA 3SC4A 4ENSA 3DDUA 1GTJ1 1PL8A 1RVDA 3IBCA 4GRDA 4KN9S 4NONA 1X70A 4Y2SA 3V8MA 3ZIUA 2C1EA 5B7NA 3FFTA 5BSFA 1G291 2FQ1A 4EI8A 3RT9A 1UXKA 5BVHB 3ZU3A 3MMXA 4B83A 4TTVA 1JXAA 1U1DA 4HUJA 1WF6A 1W4BA 4V0MA 2QI9C 5BSMA 4DCNA 3BXHA 1C0PA 1LF0A 2ZUFA 1WCV1 4DR6B 3ROTA 3STWA 4XDHA 4EQ6B 5HQTA 5CX1A 3QU7A 1FJHA 2EG5A 2HDOA 1FXWA 2BSQA 2C58A 3A4NA 3GZNB 3OBBA 3VI3B 4J0QA 4C0BA 1TYZA 2FPRA 4REQB 4J7AA 3DNFA 2NAFA 4E0FA 3EG9A 4XCQA 1Z17A 2M1ZA 3LZDA 2C5BA 4FOTA 4RLQA 3U09A 4HRAA 2Q5LA 4RTMA 4HFJA 3FE2A 2EW8A 1LWOA 3N53A 2ZXEA 2GQFA 1P2FA 5A3VA 4EABA 3GVXA 5H80A 2R44A 3AEQB 1LD3A 3G3EA 4W6ZA 4GAEA 1KGSA 5FKJA 4GSYA 3SJBA 1G3RA 3WE7A 3S1SA 4BNTA 4EGAA 4HS9A 3QUAA 3Q12A 5HJ2A 4BX8A 1U5BA 2A0KA 3K4QA 2HCJB 4RELA 3UIEA 4ZT6A 3RIEA 3O2QB 2ZYTX 3PUZA 5IJ9B 5KOJA 1OWLA 1MOSA 2FW0A 5H9WA 4DHWA 1KPIA 4GWGA 1C7JA 1RZUA 1K97A 1L5OA 4LF9B 2XVXA 1QR2A 4DVJA 4C03A 2QZZA 3A1UA 2GEUA 4FD3A 3LG2A 2ZETA 5F1PA 1D4ZA 1FS4A 3BQNB 4WOJA 2C0PA 4GP7A 1K3TA 1PFWA 1O95D 2CBXA 2FG5A 2Q3BA 3LBYA 3I72A 5DSZA 2VJCA 1UXOA 2PLAA 2X8WA 3T1OA 1LFDB 3VJKA 1CB7A 5HE9A 1N9GB 3BRSA 3COSA 5IAOA 4BMOB 3R9XA 5CDFA 1CUCA 2JD1A 4MULA 4G0UA 3KJZA 5HTOA 3IXMA 2IX9A 4MV3A 1QRUA 2ZKIA 4HB2A 1SUPA 1G17A 3TNLA 4BB9A 4YRCA 1ODFA 2GI4A 2YFKA 1YB5A 4J2TA 2FP4A 4YJ3A 4QNMA 2XGSA 3K8OE 2RKWA 4B4UA 5FUYA 1GGVA 2BFBA 5KTYA 3WZLA 1HE4A 1WCYA 5JXJA 2WWVD 3TLEA 4FYVA 5LMCA 1XVIA 2C7QA 3AMVA 1ZGAA 1ZRSA 1NQOA 1VIVA 3UH0A 4GNKA 1K8QA 2RGEA 4Y8VA 1XA0A 3TUIC 2OHVA 2HCRA 3D3NA 5DN6A 3ET5A 4PZYA 5DMHA 2F7SA 4FFBB 4K9OA 5JFOA 2WVGA 2Q1YA 3WRXA 3U60B 1G6OA 4GLLA 5DNDA 1OREA 1C7RA 3IMKA 3KL4A 4HYTA 1SXJC 1AIPA 2CYBA 3IT3A 2HNKA 3ASSA 4G4SP 4HVAA 1ZGCA 4HO1X 1YJBA 3BH0A 1KC3A 2ZQ5A 4MINA 4CQNA 3EGOA 1KZ9A 3VVLA 1FDUA 4F1KA 5B6PA 3FSEA 2JN9A 2RIRA 3OOEA 1SULA 1E1YA 2TSYB 3BFJA 2LKCA 1Q7CA 4GVXA 4HT3B 1TO2E 1AZWA 4PLWA 3WSTA 5CA0B 2P1ZA 4Q05A 2BIFA 1BVYF 1YVRA 2P9JA 4OOEA 6ABPA 4OLHA 1MFZA 3AX6A 4KR7A 2IU6A 4CF6A 1GN9A 2V1XA 3PSHA 1R5BA 2F1JA 4XEUA 3JALB 4CLEA 2G1AA 3GRFA 2QV0A 7MDHA 2FWPA 2AN9A 3PKIA 5JBIA 2V6GA 2O0LA 1JILA 1ICEA 2PT7A 2ROQA 2RHDA 2PMKA 2VYQA 2EW1A 4Z5XA 4TMXA 3KJXA 5DNCA 3FPBA 3OJWA 3H5AA 5K99A 1NKTA 2XA2A 2W2LA 3OT1A 2VP0A 5LP6C 1ADGA 3JWIA 4BKMA 5J5AA 3CVWA 1TI7A 1X77A 4MTLA 3I4FA 3PPVA 4NZZA 4YJKA 1B15A 5B3AA 4EO4A 3SSOA 3HGQA 4FGJA 5DM1A 5GZ1A 4BMNA 4BBZA 4YRRA 1RYNA 4I1UA 4BNWA 2EHJA 3ORHA 3AO0B 4HL6A 1QHXA 4L6AA 3RT1A 4CTKA 1YI2B 4NULA 2OXTA 4LBZA 5EWMB 4WXMA 4GGPA 5TQVA 1NLUA 1H2WA 5AQEA 2O19A 3LBIA 1ZNYA 5FBWB 1XMQB 4Q6WA 5IF9A 3L18A 5F4JA 3OJLA 4HVTA 1FYWA 4ZN6A 2YDYA 3A1NA 4JELA 3V4FA 4LXTA 4P7KA 3H0CA 2BSXA 3EOZA 3H65A 2PXXA 4J16C 1QBGA 1I9CA 2HU8A 3OZDA 3CS3A 4IIEA 4MRMB 4V0ME 5AKEA 1XF9A 5EIFA 3W2FA 4OHKA 4YWHA 1FK8A 2OXEA 4NU0A 3BNWA 2WMYA 2BBWA 5HUHA 4RH1A 2EERA 4DZTA 2XECA 3NTVA 1GILA 2GR9A 2ILVA 3KVNA 3O3OB 1R50A 4L5AA 4EX7A 3PXCX 2P3LA 4M7OA 1KBOA 1T43A 1W1IA 1S7GA 4CHGA 4ETMA 4F3RA 3IE1A 1R6DA 2K6GA 3DDCA 3NU1A 1LDGA 2CNLA 4WE3A 2XDAA 5B3LA 4RTRA 3MQ4A 4MMXB 5KWEA 1H4TA 1T0JB 2QGZA 3H5VA 5F51A 3F5DA 3QMMA 4UCQA 4YGXB 4EFKA 4E3ZA 1AA6A 1SVOA 3BN3A 4RV4A 2EWWA 4XX0B 2ZDGA 4QYMA 3FMGA 4TVSA 2IEAA 1YASA 2XD4A 5EINA 3FRJA 3HXTA 4DAEA 3ZDDA 4OI2A 5B1DA 1EE9A 5FA8A 3TQFA 3UT0A 3ISTA 1JMKC 1VYVA 2PAAA 1SZPA 2W0SA 2ZBUA 3E23A 4IUDS 1WLSA 2YUTA 3B1XA 3NAMA 4ROTA 5ELMA 1N2CA 2AJLI 3EFOA 2DTEA 5FBZA 1AUOA 3NVKI 2P2NA 3KAQA 3Q0EA 4G0YA 3PEVA 2F4NA 2Z6VA 3SSNA 3RRBA 2MSDB 3QA3E 5IVIA 1J0XO 4R9SA 4H1VA 1AGNA 4EPWA 1Z6ZA 4EY6A 1ZICA 4JUFA 4GEGA 5HIIA 1ECPA 3TLJA 4M46A 5C5EA 2WSLA 4CZ2A 5TT0A 3ASPA 1NI3A 1QUEA 2JFQA 4RA6A 5C4IA 1KO5A 4JN6B 4XAQA 4P4UA 4C4SA 1OAOA 3RYHB 4HX2A 1TD9A 1X94A 3QNWA 2KWIA 1LPBB 4EYEA 5AK5A 1NQUA 2V0GA 1DSSG 1HK7A 2AGVA 3FSGD 4EJ0A 3H0EA 3IOYA 1GGNA 4KZKA 3IE0A 4CMKA 3U1BA 3HU1A 3BERA 2PUEA 5FWYB 3ZQKA 4DDWA 4B43A 5TPWA 4XVHA 3CC4B 4GOXA 2OHJA 4EDFA 2ZDHA 2PKYX 3TQSA 1NU6A 2V45A 4QJ5A 1YKGA 5BSXA 5ECYA 1R74A 4F4DA 4YRQA 1T4MA 4BVAA 4MLZA 1DUVG 1EUDA 1YZLA 1X7DA 2OCBA 1N1GA 3CD6B 2P4UA 3B53X 1HETA 1W4AA 3M6IA 1E8DA 2GLTA 2NPFA 1CV2A 2XD9A 2P8SA 1KC1A 1N5LA 1NIJA 3CBGA 2WIFA 1TLTA 4PGGA 4PU0A 5FNVA 1GU0A 2JA1A 4B17A 1PL7A 3ANTA 4EUEA 3ANNA 4ID9A 1VG0B 4UTZA 3KPWA 5FAKA 1DDGA 2RC6A 3H9NA 3C6QA 4LZLA 1DKQA 2EWMA 4NK4A 1QSGA 1TX4B 3SLGA 4F4HA 4Q16A 3IKTA 1WMDA 3LLCA 1ZC4A 3OWHA 4HDNA 4WCFB 1AXGA 3LU1A 2BJWA 2O7QA 2QMHA 1KEEB 1NW8A 3TTSA 2A78A 5ALKA 1BRTA 4DM4A 1VJDA 4KQ6A 1I4WA 4L8YA 1JAIA 1JG1A 1F8UA 4QTTB 3VZPA 3C8HA 4PYOA 4UEWA 1BGVA 3C3MA 4WACA 3CVJA 3G2MA 3I5MA 4GZMA 1SD5A 3ZD6A 3RE1A 3RDPA 1OFUX 2XE6A 1QK4A 4IFEA 5ERGB 3DKRA 3OKXA 3M5DA 5JNRA 2XQJA 4JBYA 2XUAA 1MZPA 2YV2A 4YV0A 2Y71A 4QC2A 1F6DA 5K4HA 4D6XA 2F8SA 5JEEA 3QPCA 4KI0A 4QPJC 2QY9A 5BSTA 1RR6A 2NZVG 2O8BA 1Y3BE 3DPUA 1TK3A 5LYJB 2QD4A 2GZ3A 4KXFB 3T5DA 4EW1A 1DQRA 3FFAA 4MEAA 1VJ1A 1ZJJA 2WYIA 4Y2XA 1GZVA 4FDUA 5ED0A 1YU9A 3QH4A 5BV7A 4M1SA 5KYXB 1CUUA 1YLOA 4KNVA 2R60A 1SXJE 1XQXA 3GJ5A 1B6TA 2IYNA 2OFFA 3SXUA 5K3FA 4UXJA 2GYYA 1UZAA 1J4AA 1X74A 5CYFA 1YE5A 1CUGA 2FR8A 2NO5A 2XGGA 3PL1A 1RWPA 3FTPA 1E20A 2ZIUB 1IN7A 1CQIB 2OZLB 5B6IA 1R0ZA 2YXLA 2ZIVB 2R7NA 1CXZA 2QRKA 2XYGA 3NGMA 3JVDA 2ZRQA 4JI6B 4Y1EA 1FMJA 3A6EA 2GWRA 4MQFA 1LDNA 3RB8A 1YDHA 3AUYA 3VC1A 3OQIA 2FUCA 3WY9A 2AEJA 3AHDA 3WNVA 1TM5E 1C9EA 4R0NA 4CJXA 2ISSD 2WJ3A 3LHIA 4Y2GA 2P9BA 4UU1A 2VDUE 5FBRB 1M0WA 3C6BA 4BVKA 2XNJA 4GPD1 3K6RA 4OXXA 4ND2A 3RBVA 1T2NA 4PHFA 4OK6A 4DCSA 3WBKA 1WXXA 4OHFA 4ZMRA 4CGZA 3M1AA 5GVRA 3QOYA 1GSHA 4XM1A 2KQUA 3DZCA 3Q5DA 2F55A 1SOUA 2Q3MA 3MS2A 2WD9A 2EEZA 2I6FA 2Y27A 4HWTA 4YI5A 3MTJA 5F9MA 2Q6KA 3DEYX 5AJTA 4CDGA 1N9ZA 1P4MA 4BVLA 3QVVA 3GDGA 1BC5A 4CQMB 1BE8A 5CVUA 1Z6PA 1W5EA 1Q1NA 2QE7D 1QHFA 4JUBA 1KKLA 4S1OA 3TR6A 3TS1A 4E4RA 3KTFA 2BCEA 3VX4A 1JU9A 4MTCA 1Q92A 4ZAXA 2B6HA 3REGA 3TMKA 4NHOA 4LY6A 4H1UA 4DCTA 5FYDA 3GLRA 2GO1A 4EUKA 2XWSA 4TSFA 3M6UA 2F1OA 4YROA 3D6TB 1NF2A 3HN6A 3O4VA 3R3HA 1U2TA 4FGUA 4G5RA 4QTUB 1JEEA 2EBUA 2GEBA 1M6EX 2H0AA 2N47A 3BXFA 3K9WA 4NI5A 4DMCA 1RBMA 1ULZA 2Z04A 8LDHA 1Z5GA 2XJ4A 5J2TF 1GZ4A 4DEVA 2XZPA 2H3EA 3QGMA 1S5PA 1V7QA 2HA5A 3A05A 3O8OB 1NW6A 1TUEA 2A0UA 5CCDA 2Y76A 1A8QA 2EP5A 2Y66A 1UBJS 3OA0A 4JKIA 4WKPA 4I50B 4B8WA 3DP9A 2GA9A 3GEGA 3PQ4A 4BYGA 2FVYA 1NJ1A 4ESEA 1K7CA 4E5DA 1ZJ5A 2BBTA 4D42A 1YR3A 4X1IB 1R6AA 4PZAA 1GNTA 3VJLA 3F46A 3L0DA 1LJUA 1D9ZA 4MYHA 2GSWA 1K0FA 3QLVC 4Z8XA 3ASRA 4LJSA 2XUQA 5CMLA 1KD1D 2IY9A 4G07A 4DLTA 5AUPB 3BWDD 4XIFA 1XPRA 3GR6A 1VBFA 2Q2OA 4KSBA 1YI1A 4L5CA 1EFDN 1ODJA 1PK9A 3QEJA 1KWKA 2GAFA 4KTVE 4TS4A 3A1SA 4D41A 3F0TA 2FUG1 3Q3EA 4M37A 4ER6A 1QHEA 1N2ZA 3TQIA 3U7QB 5JAHA 4G1VA 4UVEA 3OX2A 4GKBA 4Q19A 4M8KA 2PBLA 2JCVA 4Y1FA 1MN6A 5AKGA 3BSSA 3REQA 1H66A 2Z6QA 1U4OA 1V8FA 2Q3CA 1D2GA 3GNTA 4JT9A 4R9RA 1W4CA 1W36B 4YJ3B 4B3MB 3Q2KA 5F98A 4GVLA 5DB4A 4IZHA 4BMSA 3WLFA 4CV2A 3M83A 3M70A 1TVCA 2MYPA 5TY0A 5E6UA 3ETJA 1U81A 5KU1A 3LUCA 2WWWA 2A35A 2XKBA 3OJOA 4M7PA 4MS1A 5EUQB 3MPUA 3INYA 5FTWA 4AVYA 2GK7A 3BXGA 4PNHA 1C8VB 3GHYA 1NASA 1DDIA 4DUYB 5HZBA 3VPSA 1HBJA 2H1VA 1K86A 3AI2A 1IONA 5LD2C 5JJIA 4MAFA 1XZPA 1MIOA 2F62A 3JX9A 3D0KA 2PUGA 4D97A 3AZQA 5JCZA 4MWBA 3DVAB 1EA5A 4LTNA 1M2WA 5L9AA 3S81A 4P25A 2VZ8A 4H6PA 1RBZA 3V1KA 4ND8B 5FOSA 5H3CA 3BX1A 5IF3A 5IJ0A 2PL1A 5CH3A 1ULHA 3UJ8A 4GR5A 4BLSA 3P9QA 1XHEA 3EEIA 2GARA 3RRJA 5L3SB 5AI9A 1XP8A 1KAQA 3R4CA 4IIGA 4EL0A 5JD6A 4QZVA 3BFVA 2QNBA 1UL1X 4EUNA 2WWIA 2IUYA 3Q8KA 2ET6A 2H9YA 1Z0UA 5FOTA 1VKNA 2FWAA 2VNHA 3AV0B 3D6HA 2VYNA 5H4GA 2K5UA 2ZEJA 2JIPA 1B16A 4BU0A 1ZZGA 3G17A 4KBGA 2Y6VA 4NAUA 3H5TA 1K68A 2YINC 3NRJA 1JIUA 3H5RA 3KJEA 3AY3A 5F2NA 3ZX5A 4IHJA 1YZQA 1Q3TA 3RVPA 2I3BA 1I7SB 4J4BA 1W96A 1TC2A 1WY5A 4OBEA 4BX2A 3AKYA 4ZGGA 4DNTB 3UUWA 1VBNA 1CB0A 5JECA 4EGSA 1V43A 2CVOA 421PA 4CM9D 4IWNA 3T5BA 1DV2A 4EG1A 1HDRA 3X2SA 4CMCA 4TZ6A 1NSTA 4Q7JB 2QD2A 4WBNF 2DFDA 3QU2A 1FDTA 1KIFA 2E21A 2XRFA 1ODKA 3LZCA 4HEA6 1U7TA 1CYDA 3BPSA 3UWOA 2FZCA 1DEHA 2GCNA 2YIDA 5HF5A 4A27A 4CI0B 3HO6A 1KDOA 1M66A 4F5WA 5IBPA 1C7IA 4B47A 2CMGA 1PGNA 2B82A 2PN1A 2XNHA 2PBRA 4DY6A 3LQ6A 2SNIE 4NFLA 5GWXA 1PS9A 3DFMA 2PMWB 4N7BA 4CDNA 3EVFA 3DG9A 5JBQA 3HI6A 2JIMA 5A7FA 3GVHA 2ZW9A 4FMCF 3ZBTA 2R84A 3ASYA 4EO9A 3KQWA 2I8LA 1E0JA 4R7TA 1UKAA 3VZSA 4KQXA 3CH6A 3ELYA 4DE5A 1NPDA 2FDXA 2WFLB 4RJLA 3ONEA 2V3WA 3ACBA 3C39A 4MW0A 1IIBA 2J5QA 3QEMB 4KUEA 1JN0A 4W5RA 2IDJA 1KKUA 4M53A 4JLAA 2FDRA 1B8UA 2DQSA 2G1JA 3W79A 5TGTA 3KWJA 3RF6A 2I7DA 4RSHA 2Z9DA 3FGZA 4GS5A 2DM6A 1H05A 1ML4A 3CPSA 1W5TA 2H92A 3LCVB 2BPOA 2ZVQX 1CPYA 1LZKA 5H3HA 1FFAA 4KLRA 3TXAA 3QWFA 1NG1A 2Q5OA 1YVEI 3STVA 4U1RA 3T38A 4XX1A 3CCLB 4B6EA 3K0AA 1IQPA 1GZUA 1N2CB 4UASA 4DUGA 4RA9A 2YUIA 1I6WA 3CC2B 4WFKA 2QYOA 4OMDA 5EKXA 4ZWNA 1UBHS 2JLQA 4MS4A 5LBIA 1I4LD 2F8TA 1VSVA 2OBFA 4BNNA 5JDIA 4A5SA 2D2IA 3FWPA 2XMGA 4U9IS 1ZH2A 3OURA 4J7XA 1DO0A 4G24A 1KAEA 4GPZA 1EMDA 4I5FA 3O82A 3D4NA 2GYWA 2FH5B 4QJ3A 4KGDA 3DT8A 3HY4A 3G7UA 3KQQA 5A0FA 2QMOA 4S0XA 3LDFA 3UXHA 3O8LA 3PI6A 1EFPA 5L3SA 4BQQA 1QU3A 3LDHA 3QKIA 1HT1E 2ONYA 4WA8A 2C1XA 3VYUB 2B92A 4S1NA 2CMFA 3TW8A 4M22A 2IY8A 3ZTTA 4PC1A 1UCFA 2QQ5A 3SZRA 5L3QB 3B85A 4YK7A 4RTPA 3EC2A 1Z16A 1Y9EA 1Z56C 3GJSA 3TRHA 4EJ6A 1FS6A 5BOSB 2AE1A 3TQTA 3TNDA 3KO8A 1FSSA 1JBQA 2G70A 2GJSA 4EY5A 2Q9UA 4I66A 2BEUA 4Q9JA 4X6YA 3N8IA 4ZU6X 3ZWVA 3ZY4A 4F11A 4DBLE 1ZBQA 4I9UA 1Z13A 1M7GA 1IWPB 1NJ8A 2W48A 4JP5A 5IC6A 3GMDA 2QU8A 2IUFA 3AESB 2QTBA 3L2OB 4P36A 5J2TA 4BXOB 1W5BA 3BGWA 3ECAA 2IUSA 3JQDA 4IOMA 4RIFA 3VM6A 2QVZX 2W2OA 5M5BA 3SX0A 5AJUA 4X05A 2NZXA 3KSMA 4MYRA 4Q3DA 4C4TA 1T13A 2UYYA 2RGCA 3ESBA 1P1RA 2W4QA 3BWBA 3F90A 3Q5EA 1RRCA 1OMOA 4I4TF 4N8EA 1GAEO 2H1SA 1XOIA 2Q50A 1ZD5A 3MUNA 4DRZA 1COWD 3SZLA 1U31A 3D7LA 3QBDA 1L6IA 3W2EA 2IHKA 2ONKA 4AIRA 4DMHA 4ED9A 3PVZA 3EVNA 3L7NA 4JENA 2YS6A 2OV4A 2NTVA 2LCIA 3VAZA 2GJ4A 5LCXA 1CK4A 1WBBA 1TU3A 3KHTA 3M1YA 4OQEA 2HU7A 1SG0A 3G88A 1P3Y1 2VUIB 2AJCA 2HGZA 1A8PA 1GPAA 1JPJA 2MSWA 2PKRA 1RT9A 1WOSA 1HQCA 1KBZA 3KKOA 1LPPA 1O5TA 1P18A 3FUXA 3PHGA 4KXWA 2YWCA 3B2EA 3GRAA 4GEKA 4LI3X 2AR0A 1X1AA 1WXWA 3RU7A 2VBUA 2HRQA 3U9SA 1XT6A 3PQDA 3U7GA 2R68A 1RP1A 2JEZA 2QSYA 3DF9A 2FPPA 1AK2A 3AEKA 5CB8A 1J5XA 1ZZEA 2EKBA 3FMFA 1ADJA 1UP6A 5IAAA 4OQNA 1OA1A 2PV7A 3KSZO 2FPOA 4QDXA 3UV6A 4CKZA 2G82A 4WV3A 2FN4A 3NUZA 4ZOCA 2IYYA 3FSRA 5H16A 5HMMA 2HR1A 4EJSC 2ZRJA 1N75A 3QV1A 3ED1A 2O2HA 3CZMA 5DTIA 1BRMA 4R69A 3IVMA 5LBUA 2D7JA 2B2XA 2QRNA 3G0CA 1KNXA 4N5LA 3V1MA 3ON5A 4UHFA 3WK5A 1NFRA 2OUIA 3O4RA 4MKHA 3RUEA 1OGIA 4AL4A 2DPXA 2PBZA 4C3OB 1H1LB 3LL4A 1PEAA 3T3OA 1G63A 1C3OA 5FLEX 5I45A 1WTCA 3T51B 4OBWA 1ZGJA 3HK2A 2CCJA 3V32A 4CQJA 1J00A 4D5EA 1ECFA 2FUEA 1MNQA 2PQ2A 3H4TA 3RIXA 3MHTA 4AZVA 5CVCA 3LO8A 3R09A 4MYTA 4N8DA 3LIPA 3M6XA 4QBFA 5IEBA 1NFQA 1RYDA 4D9MA 1UOEA 3GELA 5HILA 3A6HA 3B13B 3O0TA 2Z5VA 3ZC3A 1F0NA 1YQEA 2YY7A 4YUXA 5CEJA 4NECA 3N05A 1FUIA 5AVZA 1DOZA 1UT8A 1T9CA 4DDKA 1AUXA 4EPTA 2V7UA 4EUSA 2J3IA 4I6GA 4QGSA 2SKDA 2AMJA 4MLPA 1ZVJA 3SLNA 1SZJG 1KDRA 2FXVA 4PGHA 3TEFA 4MV7A 4DCOA 3Q7PA 3ZCQA 1GKUB 2R85A 3ABZA 2CY0A 2HUNA 3AUKA 3CX6A 4BZQA 3P9XA 2WYUA 1BCRB 2GFQA 4F0JA 4QBTA 1AKWA 2C96A 2O9JA 1MVNA 4L3VA 4D0NA 4R3NA 3EE6A 3OUZA 1IULA 2WJZB 3G49A 1XEWY 4MZXA 3ZJ5A 4IFBA 4JLUA 2VDNB 1CJCA 1XLTA 2P65A 1E9DA 1W49A 2FP3A 5EMHA 3R41A 1U2QA 1M6NA 3Q2IA 4BNFA 2IJGX 3SIRA 4JR2A 4PO8A 4AMUA 4YQFA 1KP9A 3K5HA 3N07A 1AO0A 2ECKA 3L4BA 4YPVA 1YZUA 5IM4A 1UJMA 1GLNA 2AJ8A 3U3RA 4C2BA 5KNCD 1WDTA 1KQSB 1FDIA 2ZI5A 1GU1A 3CCEB 1Y4UA 4OKSA 2Q28A 2X1HA 5HSGA 4W5NA 2CHVA 1ARZA 1E6KA 2Z57A 4UCFA 3QVWA 2ETVA 4P92A 5AQ1A 3A1FA 4ZZ0A 1UJBA 3QX3A 3W5JA 4D2IA 3TG2A 2JJ2D 4FYPA 4KG7A 4LHEA 5L95A 4J75A 1VDMA 3MCVA 4IJ6A 1KAHA 1HLDA 1Y3HA 5CUQA 5B12A 5DT9A 2JGDA 3FTQA 3NBMA 4G86A 1FX0B 1ZCAA 4IGAA 4RXMA 3VR1A 4BS9A 3U5TA 1EVIA 3C6ZA 2LP4Y 3NKLA 3A1PA 2GWHA 4ECEA 4L5IA 4OHVA 3LSTA 4MNTA 3WGHA 2IRWA 3P1JA 4E2YA 3L8YA 5DNUA 5J4VA 2OGSA 1WP9A 1CEYA 3MT8A 3M4ZA 1LZLA 1MW9X 1WDWB 3G5TA 1H0SA 2X2EA 4XYGA 1UOQA 4EHKA 5E6TA 1JUDA 4HNHA 3B9QA 1EBBA 4MS1B 1YBMA 4ZAFA 2YV5A 2WIJA 3MTAA 2IX3A 4J1SA 3FAKA 2VXCA 4D4MA 2OBRA 1U9ZA 4TM8A 4QRDA 1NOIA 4P3OA 2H1CA 4EPVA 3WL3A 3M4YA 3K9LA 2F64A 4JZYA 5ALNA 4O8CA 1KDTA 1G16A 5AJYA 2QA4B 1DTWB 4E22A 3W9SA 4K7JA 5TRDA 2QMEA 1I3OA 3GFSA 3PQFA 3T4UA 4UHJA 4Z8YA 3L8GA 2XADA 3THOA 2W6CX 4PSVA 1JHZA 5IH3A 5JSHA 3MJCA 1Z8DA 1Y7PA 3SOZA 2CWWA 1K7YA 3L0BA 2ADOA 3LW8A 4JJKA 5A7HA 1UKYA 3TLBA 3N7UA 3WDSA 2EAUA 4FN5A 2J09A 3CRMA 3TSCA 5JNWA 3KLMX 5ALHA 3SQLA 1DB3A 3COVA 1M9NA 4BLWA 2GCOA 3EPPA 4MCHA 2PUCA 4QSMA 3IDOA 1WABA 3N6RA 4FBLA 3R6JA 4A10A 1T6BY 2QM8A 1MC5A 3WGTA 1KYYA 4UUBA 5JAPA 4PINA 4EB6A 5JANA 1GT91 5BWOA 1FPQA 3L8ZA 2NMVA 1AUPA 2PT5A 1MA0A 3FGPA 4QUGA 5CFMA 5CPFA 1W76A 1Y7LA 2Q1SA 3BAFA 3GLFB 1JR2A 3MFYA 1KMCA 1L4BA 1GNQA 3BYZA 4CG2A 4XVUA 1M6HA 3FNIA 4H6WA 1T4DA 5BORA 1SFRA 4KVGA 3OM0A 3PLRA 3OZ7A 4QUKA 2VRNA 4N40A 1W0KD 2E4AA 2JRLA 2RK4A 1ADBA 2OOKA 1G4HA 4NY1A 4P08A 2VHUA 3OOJA 1JFRA 1XWWA 9LDBA 4A6DA 4DM3A 1MOQA 5FXMA 1KARA 2QP9X 2OFOA 3TZEA 1MAUA 3I5AA 1YK0A 4LK3A 5BPHA 5IASA 5LKAA 2JAUA 3VX3A 2HRZA 1ABBA 1JF8A 1KEPA 4EGFA 5LBTA 5ALMA 5EZ6B 2OLKA 5AVWA 3DJFA 4N12A 3Q15C 3EZNA 2B8TA 3OLCX 2D13A 3LP6A 3SQNA 1QH9A 4EYGA 2WC1A 1GNVA 2NSYA 2X42A 1E98A 4OHUA 3RI3A 3CE9A 4OXRA 1V16A 5E7MA 1RWVA 4R7GA 4B4VA 3GVJA 4F2WA 3NTOA 3L0IB 5JTTA 4QVAA 2CDCA 2WSIA 2H1RA 2QM3A 1U0LA 2YOGA 1E5DA 4MW7A 4FD2A 5HQ3B 5LLTA 2DMRA 2I4TA 3A25A 1ZW6A 1MH1A 3FTNA 4HKTA 4PBSA 3UFXB 1YSCA 4LWOA 4PGFA 4QX6A 5AO9A 3IE2A 4V3CA 1SC9A 2MDTA 3L0PA 3BD9A 3I01M 4YASA 2UZ3A 4UM9D 4C76A 5DWQA 4D8UA 4K9RA 5LFAA 1X7HA 1P9OA 2PU5A 3RYIB 2CK3A 5FF9A 3KTDA 3GNSA 4DMUB 4YP1A 2EFYA 2OBNA 3KZOA 3PUVA 1YHYA 3UMFA 1GFSA 4MUYA 3TWOA 3UXMA 4CLOA 4Q1FA 2WY2D 1ORTA 3OTIA 3P0HA 4G7WA 1G5FA 4CMEA 4CLRA 5AI8A 4RPJA 5AVSA 2WJWA 3DMHA 3V80A 1IDN1 2EARA 4J1QA 4ZO4A 3R7BA 2X1MA 3V48A 2QQEA 4FWBA 5DTEA 1KQFA 2C2OA 5CX1B 3UYLA 1J0DA 4YBZA 2W6NA 2XBLA 1E2EA 4QSHA 1O6CA 3OCYA 4EY7A 2EKQA 3W3AA 2B4QA 1VQ4B 5BSYA 5AYVA 2WIKA 1ORIA 2VYCA 4Z9XA 5TT1A 3OAAD 2O48X 2Q8NA 4K1LA 3B70A 3ZVRA 2JFXA 3EW7A 1UBCA 3H2KA 3LCUA 5AXAA 1ZH8A 2B3TA 1X1TA 3AF1A 2PUHA 3FN4A 1WXGA 1RSZA 1Z5OA 3UNXA 2BTOA 4UPVA 4CTNA 5E7JA 3VA7A 4XXHA 4PSCA 1P0CA 2YRFA 1BA2A 4YJHA 3INGA 3U4DA 4C7MA 3GLGA 5ISMA 2O7VA 2YTZA 3ZWXA 2OECA 2G83A 2NTJA 1OAAA 2OFPA 5AW1A 1X6VA 2GCIA 2GN6A 1Z6AA 1IM8A 1YB6A 2DUUA 1R5NA 1X1BA 4MCAA 5EPEA 3RS9A 3NT4A 5H3LA 3A10A 3IQFA 2Y93A 3B6ZA 3NO4A 1GZ6A 1DJLA 3KQKA 1M8PA 1M8FA 1NC1A 3LF2A 1YS7A 2RI0A 1KETA 1K0UA 2LWIA 1WD7A 3E2MA 3MT9A 4M9SA 3EPHA 2XQFA 2BEUB 2XW6A 5KTMA 1A82A 4HAUA 4F93B 4DV0B 2R8OA 2JAHA 4EVSA 3N28A 4DJJA 1C7ZA 5J4KA 4IKPA 2QE6A 2IOFK 5JARA 3HL0A 1UF9A 1CJBA 1AH2A 3SQOA 2EZTA 1IZ0A 1UXGA 4V0KA 2VK8A 3W90A 3Q85A 4MVJI 2C2GA 4HMQA 2OEPA 1H2RS 2J3QA 4Y0AA 5C1IA 2ZU6A 2RG7A 4L16A 3FD8A 2PPVA 4LDPA 2IIVA 1VZ2A 3EN0A 4I1VA 3O4JA 4CLDA 1V9LA 1IXYA 1ZMXA 3CWQA 2QNRA 1E2FA 5LU9A 1YZGA 4LFBB 2R79A 1NZDA 3O4GA 4RPLA 4LWZA 3AP3A 4FLFA 1V3QE 2A92A 2F43A 1GQOA 1GRRA 4H7IA 4IV5A 2VP4A 2AT1A 2YWRA 4X5OA 2ZU0C 3PC6A 2O3SA 4JLOA 1DGQA 3U49A 1B74A 2ODTX 2D8AA 2MMGA 2J0VA 3FCOA 1CT9A 4GXRA 5A03A 2R751 3K5IA 4LZOA 4Q3KA 5JFTA 1E2QA 3U5ZB 3ZV5A 3MRSA 1E62A 5F7JA 4JGBA 3JAWA 3JTMA 5AUQA 4ZDJA 4Z54A 3JCZA 1TDJA 1T1EA 1CVIA 3RRZA 5EFZA 2CXNA 2ECFA 1JFVA 2EKLA 1JTVA 1QS0B 1Z7YA 3B5JA 3QPUA 4CG3A 1KEEA 1ZHOA 4J1NA 3S40A 3K73O 1AE1A 2XB4A 1PT9A 3QXGA 1QHHB 1SBCA 3DEFA 4EUHA 3QUQA 2YXDA 3HAGA 3DHWC 4JJ8A 1U8FO 4LOJA 4R54A 1IVYA 2BUCA 8MHTA 2GILA 2W6OA 4KODA 1DIRA 2EQAA 2IPNA 2PQMA 4PSAA 2X40A 4LRYA 1W36C 4ZCPA 1TOAA 2G08A 3FB4A 4LYEA 1BW9A 3F6CA 4ZZ1A 3OQHA 1ZGBA 4IIBA 1M5RA 3ZDAA 3ZDCA 3BH4A 3MYYA 3PNOA 1G9XA 1WR8A 1VQ8B 1YZNA 2P1DA 3IEPA 3LT2A 5HF8A 4XLZA 1PJSA 5AXCA 5IT4A 1KYIA 5M29A 3WL8A 3WWPA 4C4AA 2GPNA 3H2GA 1UANA 2YZNA 3H4IA 2Z6AA 1S2NA 1GTMA 2YASA 1I0LA 4V0OA 1X7YB 1X1CA 1O96B 3N2KA 3UMJA 1KEVA 2C82A 4LG1A 2ONCA 2R5WA 4HX9A 1EE2A 2ATEA 3M7IA 2XMQA 1C0KA 3HSSA 1PJ2A 2WQZA 1VLHA 3EXIA 5BV8A 2Q3EA 2FZWA 4TKLA 2J0UA 2H2AA 1EDBA 4L73A 4UVIA 3ZPXA 4IIFA 3INTA 4B3SB 5FOWA 4JV5B 3DUFB 3KCQA 1JQEA 1MDFA 3ISVA 5GP1A 4RACA 3BDAA 4CMJA 1GOTA 4YP7A 1CSEE 2RJNA 2Q3JA 2QLMA 4EJFA 1CEXA 1JIXA 4G3XA 5IULC 3TQRA 4GL2A 1A9SA 4O4JF 1W73A 1ZCBA 2FWNA 2OMKA 1MRZA 3I09A 1BDHA 4Y67A 3RVNA 2YH2A 2H4YA 4P3IA 1WMSA 1F0PA 1JHPA 2L17A 2X5KO 2ZS8A 3BB1A 2QLJA 3D1LA 4L4YA 3UGTA 1NJGA 3E5NA 3WG9A 2AEMA 1UOOA 2EKDA 3QKUA 5H59A 5K8LA 2O4CA 4L6IA 4W7IA 5JDCA 5CB4B 5T4FA 4RSMA 2YIVX 2PRKA 3G9TA 3AVWA 2J5BA 4PHCA 2GXAA 3IUYA 5F64A 4DF3A 2VJMA 2C61A 2WE7A 4IX1A 2XJ9A 3GGOA 1AN9A 1DINA 1LBQA 3O7WA 4UZEA 1GG8A 3E1GA 3P45A 4HR7A 1S01A 1OB0A 2OP1A 1Z0SA 3WYGA 3Q1KA 3NRBA 4A23A 3L40A 4AY6A 4GZ3A 4CR8A 2YWGA 1CEEA 2V7TA 2GZ1A 1CQJB 1C81A 4P86A 4PQYA 2A5LA 4FDVA 4I9FA 4WGGA 3TAUA 5KNDH 1C30A 5DM2A 3PHBE 3G9UA 1E3DA 4TLCA 4M1YA 2FXIA 1D2AA 1FTSA 2C0CA 4WUTA 3H42B 4RE6A 3TH5A 2P67A 5KSWB 4RK0A 3AGPA 2C03A 5TMEA 2X8JA 4HWRA 1W59A 3AHCA 2J9ZB 4EMUA 1DAFA 1O94A 4OXKA 2W2TA 3IPLA 4GKAA 2V5VA 2IP1A 2SICE 3R5FA 1XTSA 3T3IA 1YIJB 3E03A 3UUGA 3G0GA 4Z7QB 4KDEA 3PUIA 3AKDA 1JLMA 4OTZA 2XGOA 2ZSKA 3F9RA 4Z4EA 2AUTA 2YWXA 3EUWA 2IWHA 4IWYA 2XZDA 1RJFA 4IZ6A 4Q7KA 5FOVA 4B7AA 3V76A 5HNKA 3AQIA 3IERA 2QT9A 2OV8A 5BW4A 2FHSA 2JLZA 3L6UA 1QYXA 5DX8A 5BSEA 5DHPA 3DE3X 1MB3A 1YU6A 3GAZA 4TS9A 4Z9FA 5FWYA 4N5HX 3UMBA 2QG6A 3DBLB 3A28A 1EZ1A 1ETHA 1IJEA 1CR6A 1H69A 1LGYA 3F3MA 4OQLA 3WQRA 3UPTA 4LJRA 4WRRA 4TRJA 4DYHA 3K96A 2WZCA 4ALLA 2KI5A 2AL7A 3CNBA 3ZH9B 1TYDE 1A5BB 4RGBA 4CIAA 1E6WA 5B58C 1I14A 3Q0TA 4O8ZA 1L5HA 4FUQA 3U3MA 1KYZA 3ZKWA 3ZQ4A 2J9XB 1I3LA 1UXIA 1DKRA 3H1AA 4L28A 3TRDA 3MWYW 1V8DA 1XPOA 1DKLA 1M1ZA 1RRKA 2Z2IA 1FMTA 4BVEA 4DLPA 3NMUF 4IM7A 3TBHA 3T9CA 2VAVA 1NT2A 2O8CB 4GR4A 4UJ3A 2UVQA 4DV1B 3B6IA 3FWNA 1U0HC 2MCFA 4AG5A 1D0SA 1DIHA 1L7RA 1E1KA 3AWDA 1ACMA 4NNPA 9ABPA 4RAQA 1W85A 4RTJA 1PJ6A 5HZMA 1VE7A 3PQEA 1POWA 2VKTA 2IYVA 3EGXB 4FPXA 5CVEA 5DX0A 4Z0PA 2CT8A 2HNAA 4ZIRA 3BD8A 1VPWA 3HS3A 2W2VA 2AC2A 4A0SA 2DGDA 3CIFA 4GDMA 3OKPA 1NQWA 4FCWA 4K88A 4PLFA 5EIEA 1JDUA 3VAYA 5EEGA 2GJ9A 2NU6A 8AT1A 4RJIA 1Z25A 1V1JA 2J3JA 2M6RA 2W00A 1R4ZA 2RGDA 2HLNA 2HSGA <