3FPPA

Crystal structure of e.coli maca
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
266
structure length
266
Chain Sequence
PGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTQAVSQQDLDNAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPGQKAWFTVLGDQLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the periplasmic component of a tripartite macrolide-specific efflux pump
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Macrolide-specific efflux protein macA
total genus 52
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3fppA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fppA02
1E2ZA 2KA7A 1H9MA 1OXXK 1Q12A 3DXJC 4H13C 1G291 3M7NA 4OO1G 4TKOB 5KNBA 2NN6H 4JBWA 1TU2B 5BN4A 4KKSA 2D2CC 3PUXA 1Y69U 1CI3M 1V8QA 2L5TA 4PV1C 1EWHA 1GHKA 1CFMA 2BE5D 2A68D 1ONLA 2JXMB 3T53B 1Z6HA 3A7LA 3OOCA 3IKJA 1O7LA 1QJOA 4KI0A 1CTMA 1T5EA 1LABA 2CW0C 1Y8PB 4DK1A 1GJXA 2D62A 3MXUA 4BA2I 2AUKA 2B8FA 2EJMA 3QG1A 1GUTA 3SE0A 3VR6A 3A8IE 4KN7C 1K8OA 1Q1EA 2BA0A 2E74C 2R6GA 5K36H 2AWOA 4RCNA 2BDOA 1FYCA 1ZYRC 2EJGC 1B9NA 3I73A 2O5IC 2D5DA 5BN3A 4L8JA 1PMRA 2A6ED 4KN4C 3A7AB 2A69C 4DNRB 1SMYC 3N6RA 3BG3A 4H44C 2BE5C 4HR7B 3VR5A 3VR2A 3KLRA 1HQMC 1E2VA 4DNTB 3VR3A 2A69D 3SDZA 4OGQC 3QIAA 1H9SA 4KHZA 4G7ZC 2ZT9C 3A8KE 5C0XH 3AB9A 1GUGA 2E76C 4G7HC 3T56B 2DNEA 3PV0A 3RLFA 3EQLC 1B9MA 1LACA 2A6HC 4JK1C 2EDGA 3VR4A 4BA1I 2EVBA 1IW7D 3BDOA 2JEBI 1Y8OB 4IQZA 3ND8A 3W3AA 1DCZA 5C0XG 1IYVA 1VDZA 4XIGS 1IW7C 3QJYA 1H9JA 5K36G 2EJFC 4IFDG 2KCCA 1GHJA 1TKWB 3MFYA 5A35A 1H9KA 2BA1A 3VA7A 3FMCA 1YNNC 5JEAG 2NN6G 1VF5C 1H9SB 4H0LC 2JEAI 4IFDH 2AUJD 3GD7A 3CRLC 4KKUA 2PNRC 3U9SA 3OW7A 1OXSC 3CRKC 4LJZC 2F1MA 4XTCS 3H94A 3IFTA 2O5JC 1VF7A 3LNNA 4I7ZC 4GZYC 1DD2A 2A6HD 3D4RA 3PUZA 1GUNA 1O78A 1YNJC 3HGBA 2Q8IB 3M4YA 2LMCB 5JEAH 1VCIA 4KMUC 2K32A 2QF7A 3PUVA 3A8JE 1OXVA 3ND9A 1HCZA 2A6EC 1IYUA 1OXUA 3T51B 3P20A 4LK1C 3M85A 4DK0A 2V4DA 1FR3A 4OO1H 5KNCA 2IT1A 2DNCA 1Y8NB 3WDNA 1HTPA 2PPBC 3I72A 3D31A 4KKTA 2K33A 3PUYA 2NN6I 1K8MA 3TZUA 3L7ZC 1Q1BA 2YYZA 3LWUA 2B8GA 2A68C 1A6XA 5BN5A 1Q90A 3OPOA 2DN8A 1GUOA 1OXTA 3I4LA 3GQBA 2K7VA 3NE5B 2JE6I 1DXMA 4TQUS 2E75C 5KNDA 1E2WA 1ZKOA 3FPPA 3PUWA 4G7OC 1BDOA 1I6VC 2PCFB 1GUSA 1V43A 1Z7TA 1H9RA 1HPCA
chains in the Genus database with same CATH superfamily
2GJPA 4PC1A 1D6EC 5FLXL 4PC2A 4KY7A 3RMHA 3R8BA 2UUAQ 3RY8A 2ZTCA 2TMPA 1GO2A 4X0CA 4OEMB 5M3MH 1WOSA 3C46A 4X3TA 3CPWB 1AE2A 1I4PA 1Q7YD 2IJ0A 3IKJA 4OX9L 3CC2B 3VYRA 5CV8A 4JI7Q 1I8DA 3CB4A 2HQLA 2B2TC 4RAUC 2VUMB 3VR6A 5H59A 1PTOF 1K8AC 2EPBA 1TLLA 1BCPD 2B2WC 2K5WA 2LZJA 4DR2L 3CP8A 4GKJL 2PZTA 3CCVA 3OFNA 1WU8A 2F0WA 3K0XA 4A3JG 1LV9A 4HSPA 4B3XA 3CW2A 4H44C 4DFAA 1LTAD 1VQ8B 1PH7A 2JA5G 3RUZA 1XX8A 1KC8D 1W2BB 4KHZA 2C35B 3LQ6A 1QUQB 3IL8A 3HKZE 4JI1L 3MHBA 4LWCA 4PZ7A 5FLXc 1ASZA 3TQYA 3S2DB 5FIUA 3CCVB 2B3GA 1B9MA 5EPLA 4QUZA 3OMCA 3PIP3 2CNDA 2C5HA 1HZ9A 2R7FA 4FP5D 1C7YA 3ULJA 1LLRD 1VQ4A 4OPSA 1V1PA 1A8PA 1SE8A 2Q2TA 1YIJA 5C3EB 1TVCA 5DM63 4K6DA 3GTOB 4P3IA 5GAHC 1W87A 1VQ7B 1L1OB 1QOHA 2HIVA 1SJED 1U4MA 3R6KA 3R2TA 4XTCS 5J35A 3HOYH 2NPFA 3D4RA 3TN2A 1QVFB 4JI0Q 3K58A 2CCZA 4KMUC 5IYBG 4ME5A 4XT1B 4AH6A 3GTMH 4ODGA 1HCZA 3I91A 4LK1C 1YHAA 5C3EG 3IAYA 2DY1A 2K5NA 3K8AA 4K5WA 1BOSA 5J3OA 2BGIA 2RHSB 2Z6BA 3CXCB 3H91A 4GLAC 1WTXA 1O7YA 3TZUA 3OZUA 4XR6A 2F0QA 5BN5A 3V05A 4J0QA 3PQIA 2WSSA 2Q2IA 4LF4L 1WORA 4XQQA 4CKEA 2B2YA 2WAQG 3PUWA 4M4SA 1EZ6A 3RNUA 1Z7TA 2F4VL 1JNYA 2KA7A 3WOFA 1MBYA 2ZL5A 1G2SA 4DKAC 1EWCA 5JJLA 1PH4A 3KL9A 5KNBA 4CDCC 1SN8A 2Z4HA 1SE2A 1CQXA 4ZKBB 1HZBA 1K73D 2IHFA 5THXA 1GAQA 1JB3A 1KQSA 3BCDA 1KAWA 1O7LA 2F3WA 5EMNA 4KHPL 4ZCLA 3SVMA 1QFJA 1E24A 5ELCA 3PIPA 3T4AC 1IJEA 4BA2I 1JOQA 2B8FA 2XEXA 2EJMA 1P4MA 4QY7A 5FJ8G 4RDJA 2NVTB 1RD9D 3LVBA 5IK2A 2PZWA 2BM1A 1PH3A 1ZYRC 2YWEA 1XMOQ 2R9VA 2H1EA 1SYEA 3AVUA 2XVSA 1STBA 3QO2A 4MN3A 2JA7G 3M4PA 2CHBD 4C3JB 3ZZ0A 1LTTD 4X3SA 2BH8A 2R6HA 2FVGA 2Q2HA 2JA8B 1T6ZA 1A63A 1E3PA 4DQLA 3ONAB 1G7RA 3MXNA 3QFSA 1BNZA 1EOVA 3QWNA 3FDTA 1EP1B 1KTKA 2EOTA 4X3UA 4S3SA 1EY7A 4IUQA 5EKLA 1VHOA 1M90D 1DM0B 3KFUA 3S1RH 3JAML 2E1RA 4G7XA 1DCZA 2AQ1B 2X6XA 4XIGS 1QE6A 1IW7C 4KD4A 4LBWA 1DG1G 2ZBVA 4DR5L 1KRTA 1TKWB 4PQXA 2KHJA 1JT8A 5HZAA 5KSWB 3K5MA 4JV5Q 4ZQ3A 1NUCA 3IRBA 4OHJA 4AYBB 1S4MA 4BS9A 4LFBL 2WAQB 3BJUA 1TTTA 5IP7G 2BGJA 1O78A 1LT5D 1X9NA 1ZM9A 1PTOC 2BF4A 3P27A 1S5ED 2OBSA 4LW1A 2YU9B 2VNUD 1WSVA 1L1OC 1V1PB 5CV7A 2I0QA 3HKZB 3M85A 1IYUA 4LC0A 1MSHA 3ASQA 4JW0A 1QUFA 1W3SA 4H02A 1VQIA 2F4VQ 3CMAA 3CC2A 3H15A 4M1UB 2K04A 3LWUA 1DDIA 1WYDA 4GNXC 1IBKQ 1A6XA 2JA6H 3OPOA 2DN8A 1D1KA 4XM3A 1Q9SA 1TY2A 1GUWA 1TS3A 5AN9A 1CUKA 1JWSD 1KNEA 2XZPA 1I6VC 1V43A 1JC7A 1HJPA 1W6JA 1NAPA 5CGKA 3S17H 1BLIA 2F0MA 4B3MQ 1T9HA 4PABA 1KRSA 3FKSA 4IJLA 4KLKA 1EIFA 1KRHA 2KCMA 4KKSA 3D3RA 4YCWA 5M9OA 1XYIA 5E7NA 5D3DA 3CCMA 3TRZA 4CKCA 2X6YA 4P72A 1UD5A 2NTSA 1G6PA 2CW0C 3U6KA 5M3MB 4JBJA 5F2DA 4OIKA 1G51A 2V7TA 1WOPA 2AUKA 3MXUA 4Y9RA 2JA9A 1ENCA 2R7ZB 4LNQA 1W9XA 1SROA 2NTTA 4RD6A 3U50C 3MEHA 5C44G 1GHKA 3D6CA 4C56C 1SDFA 5M5YB 1YHBA 4HE5A 2NVQB 1F2MA 1N32Q 1ILQA 4YXWA 3Q22A 1IKMA 2E2JB 2D9UA 1UWVA 2ZJPA 3KLRA 3V2TA 2SNSA 2MHVA 1K83H 3KOJA 4XNFA 4M53A 3W2FA 5L46A 4OXPA 4G7ZC 3E5SA 3MEFA 3E9IA 2EE1A 4R9WA 1QFYA 2YWHA 1QVGA 3CTAA 2CW0D 5FLMG 4J15A 2CBXA 3HOWG 2JYOA 5DNFA 1II3A 1LACA 4YELA 2A6HC 4KJOA 4JI5Q 4DR7Q 2B63G 4NKLA 5C0XG 3GDEA 1RL2A 2B29A 3BDLA 3DM1A 3OAAA 4X7FA 5DEHA 5I6WA 3ZC3A 2QKIC 3PGZA 3I70A 3H09A 1B4OA 3HOZH 3HOUH 3R3OA 2D0OA 3J80L 5I2XA 4HCSA 4A3KG 2B2UC 5JJKA 1K3RA 3FKIB 4DN4M 2RSNA 4LJZC 1YI2A 1HNXL 1RDPD 1VF7A 4JYAQ 2O4XA 1SRUA 1YITB 4R1JA 2PI2E 5FOBB 5HURA 1W0KA 4XLCA 2F52A 1E7ZA 1RCVD 5CV4A 4GS3A 4BY1B 1JE4A 1OB0A 4UP8A 3T16A 2LS01 3T1HL 1DONA 1FD7D 3JQRA 1YIJB 4LF9L 2MPMA 3ZPNA 4Q7JB 5IP9G 4X66Q 2FMMA 4ULLA 1HTPA 4DV2L 2CVRA 1ICWA 3T1YQ 4LF6L 4C3IG 1K8MA 3NSWA 3GTJB 3OTOQ 2EZVA 1WD1A 1IKLA 2ID0A 1S72A 1JOOA 1J8IA 1SYCA 2K75A 2K5HA 5A89A 1X54A 3J7A5 4ZCMA 1ZM2A 1O7IA 1NJIC 3AVXA 2UUCQ 2RA4A 3FEWX 4RM0A 1SEBD 3UDGA 3BNWA 2G9HD 1RKNA 4KTAA 4B3SQ 4V190 5JVG3 3SK4A 4UZUA 2XOKA 1PH1A 3E1YE 3GTJH 1G291 3S16B 3CC4B 4GQNA 5J22A 4C0SA 2PQAA 4CGYB 1SXTA 3ASSA 2ZJQA 4DR4Q 2JJ1A 2BE5D 1ONLA 5F4JA 3OOCA 2B2UA 3PO3H 4BBRB 3PA2A 1QGZA 3KEWA 2EYMA 2B63H 1KXLA 3H9NA 1RHPA 2SOBA 1FDRA 1K8OA 4KN7C 3OHXC 2BPOA 4N9PA 4QFMA 1KDAA 3NUCA 4FXUA 3SLNA 1GJRA 2K6AA 5AJ3Q 4YAWA 1PFSA 2ZITA 2LXJA 2RHQB 3VYSA 3B82A 3J7ZC 1VQKB 2C9OA 3CD6A 1L0WA 2V7UA 4DR7L 4HR7B 4OWWB 3VR2A 1U5KA 4X62Q 4A3IH 2ZZFA 5IODA 3W5OA 2LXKA 1EYGA 3ASRA 1ENFA 1VQNB 4AQYQ 5HKKA 2R7DA 3BVMA 5GADC 2DOGA 2CC2A 1AH9A 2QEXB 3I4MH 2X8KA 1KJZA 1N0VC 1W34A 3T56B 1YI2B 4JI6Q 4UDUC 2OBRA 1EQRA 1Y0RA 3LGJA 5JOBA 4B48A 4Y52H 3GTKB 1KLGD 4DR5Q 3LO8A 5KGUA 4EGVA 1SYGA 3GTQH 1WCMB 4DU9A 1PYWD 1ILPA 2Q8RE 4DR1L 3U58A 4P6YA 1B1ZA 1GXDC 5LMUQ 3WNCA 1UEBA 2K03A 4WJWA 3G71A 2DEUA 4IUUA 1KK0A 1FNVA 1UD3A 2K5VA 2AUJD 3ITPA 1FNBA 3CC7A 1EQTA 2NVYB 1T5XD 4IUPA 3S14B 2O5JC 4RDKA 1TWAH 1SFOB 1SBBB 1GUNA 3P75A 4NDXA 5C3XA 2GVAA 1AFPA 1BQQT 3BQJA 2I46A 1YNJD 4ZUIA 1Q81D 3H0GB 4A3BB 1STEA 1YZ6A 5IYPA 1JICA 1I7PA 4OPOA 2F0NA 3CQZH 1IZ6A 3CESA 2B8GA 2A68C 1LO5D 4K5XA 4MTKA 4IOAA 4DV1Q 2ES2A 2JE6I 3CKIB 3ZZTA 3MVVA 1FVIA 3NTIA 3M4OB 2NVQH 1YVCA 3C3LA 1E2WA 3A3BA 3H0GG 4A3BG 4OO1I 1CSQA 3VNUA 1J5EL 5FO7B 4B3RQ 4E6IA 1EFCA 1B8AA 2F0JA 1E0BA 2BOSA 2JA7B 1WOOA 1LTLA 4MHEA 4MTNA 3HRZC 3NEMA 3PUXA 1JA0A 4B47A 1CI3M 1V8QA 3CRZA 4ZCKA 3A5ZB 4CHTB 2EY6A 3DMUA 4XDXA 3T53B 1RJTA 2X85A 5IP9H 3F2CA 4K8IA 5E4WC 1F77A 3RN2A 3K57A 1Y8PB 1IBKL 4LF6Q 1EL0A 2BH2A 1K8GA 3DLLA 1QZHA 4B08A 3I7FA 5I2YA 3ASTA 3HOVH 1IL2A 5LL6S 2LKVA 2E74C 3LX0A 1NMFA 2CQAA 2PO4A 3RZOH 2JK8A 2C77A 1HTLD 1G6ZA 4DQKA 5BN3A 1PV4A 5IGDA 1L2FA 4HAEA 4ABNA 1BO0A 4NXNL 3SK6A 2ZXHA 1L0XB 3VR3A 4EX5A 3PF5A 1TIID 1WPCA 1N33L 5EAYA 4P22A 3CCEB 1ET9A 1X3PA 1AEXA 2FMCA 1UNSA 2DNEA 2VNJA 2RC5A 2NUCA 3EQLC 3AGQA 2IX3A 2DY7A 1NE3A 1R4PB 3PCOB 1TS5A 1SYFA 2J4XA 1UD8A 4WZTA 4U9UA 2EYFA 2VQEL 4DV7Q 1VDZA 3EBEA 1IHMA 4A3KH 3ONUA 2QW7A 5K36G 1EY4A 4UP9A 1QH0A 2OWOA 1TWCH 2B7CA 1N34L 3P1HA 4JOIA 1HNWL 3VA7A 3EVQA 3ZBUA 4R4QA 1N32L 3CCJB 4ID6A 3W1BA 4ZYSA 1G7CA 1NB9A 4JCVE 2DYIA 4M2LA 3H3VC 4BY7H 2K4KA 1N33Q 4K5VA 4JI2L 3ZZUA 4PZ6A 5C5LA 2KCTA 5IGFA 1YNJC 2JQOA 2LMCB 1E1TA 4DAPA 5FLMH 2K32A 4IPCA 2D0PA 4LUOA 1YNXA 3ER0A 3F2UA 4F87A 2CF4A 2B5OA 2EXZA 2X53S 3C1EA 4DV4L 4H9GA 4MYTA 2MGSA 1XFOA 2RQXA 4B43A 5M3FG 2JJQA 2V7VA 3BU2A 1AE3A 3M3YH 4O2DA 3BY2A 4PC3A 2VY3A 4A3MG 2JA8H 1PH6A 2WACA 5FKAC 4HIKA 3WWVA 1SE4A 3GQBA 1M8AA 2JN9A 2ZM6Q 5CC4A 3WNBA 1EIHA 3K5OA 4FF2A 1ZM4A 1EFUA 1VQGA 3UDFA 2A8VA 4PMBA 1KLUD 4HIDA 1H9RA 1HPCA 1H9MA 5ELNA 5A2QE 4XQFA 1KD1C 3D4DA 4QHYA 2NVTH 2J0TD 4NPSA 1HA6A 3M7NA 1JORA 1UE1A 3GVJA 2F3IA 3W5VA 1ESRA 2WB1G 2OYNA 4LMQD 2VB2X 4CDEC 5TV2A 1PJ7A 3CP2A 2EQSA 2R92H 3SLDA 3CU7A 2BV3A 3P7JA 1S72B 1AIPA 5LMZA 1QG7A 4DV2Q 3A7LA 3T1YL 4C3HG 2N88A 3NBIA 4Y7NH 3D6WA 2C78A 2WR8A 4RGNA 3T13A 3HOXG 1YJ9A 1CTMA 1YBYA 4AYBE 1G7SA 4HMIA 4KHVA 3H6MA 3AVVA 1BCPF 1VLOA 3PO2B 4OOVA 2BA0A 5EBCA 1AZQA 1CKMA 4A3DH 1EEID 1FL0A 2JDIA 2I1LA 1HH2P 3CMEB 5CORA 1TVXA 5LL6X 2A5HA 2D5DA 4L5QA 1HR0W 5CDFA 2A6ED 4MZ9A 2UXBL 1SMYC 3GSIA 4RDLA 3JAME 4ZV4A 2OBTA 3EIVA 5CYUA 3AGPA 4A3KB 2IWHA 4B44A 3J81j 2B2YC 4A4IA 5IWAQ 3A8KE 3C2PA 4LF4Q 1NNXA 5I9PA 3Q6QA 2CWPA 4P75A 1N0UA 2K5DA 3TP7A 4JK1C 1BCPC 1LTID 2XRQD 3W5HA 1KDCA 3TS2A 1EY6A 3BDOA 4U68A 5T1GA 4Y7CA 3OZVA 2DJGC 2VZAA 1XPOA 4A3DG 4A3MB 3BDCA 4XKVA 2NZOA 2BN4A 2AQ3B 2XIWA 3JAMi 1BKBA 2UUBL 4A3EB 2EIXA 1QVCA 3M9BA 4NW2A 3NWSA 4N8X1 3CRLC 3HOXH 1X65A 2PNRC 2QEJC 2G5DA 5IWAL 4XOTA 1DYQA 3J80i 4NXNQ 4N3NA 2I07B 2VL6A 5FJ8H 3M7GA 2WB1B 3BVGA 3MFGA 5DN6A 2ASBA 1P16A 2UXCL 2NBFA 3ZIAA 2NVXH 3I72A 1IYJB 2JA7H 4LUVA 2EY2A 3ERQA 4BBRG 1Q1BA 3K7UC 3HOUG 3I4MG 4QQBX 1G8ZD 2PMDA 3HEJA 3A56A 1VQ6A 3CD6B 1VQJA 2KHSA 2Z4IA 3ICEA 1MGSA 3F1ZA 5M3FH 1TWHH 4XLFA 2I5MX 1KDBA 3DUZA 1S5CD 4G57A 4PMWA 3CCQB 4OOSA 1WFQA 2NN6H 4JG2A 1MD2D 1MJEA 3J80c 4DR3L 3GVLA 1Y1WB 3MWYW 1WTRA 1XMOL 1PH2A 4QUCA 1HRJA 1VQ6B 1DOKA 1TWAB 1SFOH 3GTPB 3E0EA 1VQKA 2Z8LA 4TSSA 5GV8A 4A3DB 5K36H 1N05A 1TWFB 4YCUA 1B9NA 5I4DA 1HNWQ 2A1AA 1PH9A 1JCKB 1SM4A 4P26A 1E3XA 4GN4B 1EYCA 1PJ6A 4Y7NB 1X55A 4IUTA 1HQMC 1I3QB 1R9TB 2XTIA 3TP6A 2A69D 5HXBA 2BCOA 3KF6A 4OGQC 4XT3B 1YJWB 4AC9A 3D8GA 2HDMA 3AB9A 3AYHB 3GTKH 2VYQA 1STHA 3TBIB 1M90C 3ASPA 4B3TL 1E63A 1N36Q 4KY5A 2VBSA 1IW7D 3DM3A 2E2IB 3CCUB 5TRDA 2RVLA 2KOLA 4J1MA 4RD3A 4X64Q 1SYDA 3N52A 1COWA 4JI8Q 2JIZA 2DJFC 2KBNA 1Q81C 2EJFC 3B8HA 4QB4A 3LQEA 1YJNB 1JWUD 2ZXPA 1VQ8A 1B70B 4IN3A 3MXNB 1L1OA 4DK3C 2QTZA 1KABA 5C4XG 3OJXA 4CKBA 1B53A 1KIXA 3I4NH 4DAVA 4FXDA 5CV5A 3OW2B 2AWNA 1K28A 3MA2B 3OW7A 1U2RA 3R93A 1MIUA 4TRDA 1TT2A 2L12A 3A3GA 4IUNA 3PUZA 4PNYA 5JPNC 3AVTA 4I7AA 5KEEA 4A3LH 3NXWA 4X65L 4Z4RA 2XRSD 5IGGA 4X7DA 4QJFA 5IP7H 2OQ0A 4OO1H 3PSIA 1EY9A 5C4XB 4DAMA 3MCAA 4XMYA 2JA5H 2PPBC 4BY7B 3WXMA 4LF5Q 3VYTA 2F0OA 3S16H 1BPLA 2ZXRA 2GVBA 2O2LD 2ALYB 5IT9E 1K3BC 3CCUA 1FJGL 2KENA 2VNIA 3ZJYC 1OB5A 1OO9B 2A73B 4P3YA 1PA6A 5C44B 3C1FA 3NE5B 1JOKA 4JI4Q 5M5XH 2V7XA 5A88A 4KD3A 4A3FH 3FPPA 1BDOA 4A76A 5IGBA 4YCVA 4WJ4A 4LBYA 1MHWC 4A93G 4TKOB 2GN5A 4Q5VA 2F4NA 4LF9Q 5EJWA 5DM73 2VJJA 3G6EA 4GKKL 5EBDA 3KYHC 2NV4A 3RZDH 3CXCA 2MUYA 1Q8IA 2L0CA 1Q82C 3JQQA 4RG1A 3FRPB 1Q7YC 1FJGQ 4A93H 4M0LA 4JYAL 1DJRD 1X3GA 1HZAA 4FF4A 1Y0YA 3BZDB 3W2IA 3I55B 4LUZA 3HG9A 1NY4A 4XLEA 5BSYA 4C2MH 3A1PA 1Y14B 1OGJA 3S1NB 1I94L 4G5GA 2ZTEA 2QDLA 4DR2Q 4L8JA 1PRTC 3A7AB 2F0UA 1JJ2B 4UAJA 3G4SA 1VQ7A 1JR0D 1HFGA 1DGSA 4IUVA 2F1LA 1ICFB 3UDXA 1PZID 5DLQE 2JA6G 4A3GH 3WNDA 1A2TA 4QVAA 2WJYA 3J7YW 3I56A 1V0FA 4A3FG 4ROXA 1PVOA 4A3LG 4BA1I 1A0IA 1H8HA 1G7TA 4CQJA 1XNRL 4YALA 3AQQA 2C5BA 3W3AA 5TSSA 1K83B 4K0KQ 1U9RA 1V5VA 5J1ZA 2RC6A 4C3IB 2PW7A 2OQKA 3RD4A 3F8TA 3MXPA 3QE2A 4TMZA 2VQFL 1CKNA 2CRVA 3J81E 5JEAG 4ZLTF 1OTCA 4NB3A 5IYCG 3T1HQ 4P2CB 4PG3A 3PO3G 1G91A 1CNFA 4CDFC 3CRKC 5IGEA 4U673 4XN3A 5ELFA 1PFMA 2EYHA 4UAIA 5EQ0A 1DD2A 4FF3A 2PE3A 1WTOA 2WPDA 1K28D 1I5FA 2D9RA 3M4YA 1LT6D 1VCIA 3ZBTA 3F2DA 3PUVA 4UZEA 1QFZA 1VQAA 3KF6B 4DV3Q 4GKJQ 1GAWA 3CMMA 3OE7A 4F7DA 3E6ZX 3TSSA 1RODA 3WDNA 1WI5A 4RCYA 3Q38A 2EYJA 1HNZL 1E64A 4WRDA 4NXML 3ZYYX 3S17B 3E0JA 4L63B 4ZGNB 3GIRA 1B23P 1SR3A 1GUOA 2WYRA 3I4LA 3WOEA 1KTVA 4XLHA 1DXMA 1VMCA 3X3MA 4C3IH 1EIYB 1R5BA 3STBC 2N78A 1GUSA 3NPPA 5HGTA 3D4WA 1JB9A 4R8IA 5LMNL 4GOPB 3PUNA 1OXXK 3HOZG 4X3KA 1MI2A 4P6VF 5KIXA 2IX1A 3I4MB 1HUMA 1BBXC 2F0TA 5AJ3L 1HNZQ 3DWPA 4O0AA 4NXMQ 5BR8Q 2D3LA 5KW9A 5E4XA 4KI0A 1TUIA 4YWMA 2KEEA 4YIJA 5I9OA 3BS1A 3K80C 2VBUA 4Z4UA 2MQHA 4RJLA 1ZUNB 3S1NH 1VMPA 2MP1A 4LBZA 1S3OA 5IT9c 4L6TB 2R6GA 3DWAA 1E62A 2OF1A 4RCNA 1VQPA 4KV6A 3E3XA 4XOPA 4ZUJA 4Y9UA 2JA5B 1PDQA 1OHHA 3AVYA 3SJZA 1PMRA 2FFKB 5GROA 2AKWB 5C0XJ 4A93B 3VR5A 4X7CA 2BE5C 3PO3B 3MAQA 1FX0A 1FNWA 2A74C 5M3MG 4HJ5A 3KBXA 1NR2A 2VXWA 1Y1VB 3QIAA 1H9SA 4QIWE 2VBVA 5BR8L 1KNAA 4PC6A 1YLOA 3NBHB 2XZOA 2WB1E 1CA5A 3ULPA 3PF4A 1NBWA 1VQPB 4HEDA 5F4MA 2RSOA 4DV0Q 3OP1A 2PMZE 3CPXA 2JEBI 1JE5A 3QFTA 4GN5A 3NQIA 2E2HB 2V7WA 1IYVA 4RHRA 3QJYA 4C3JH 1LT3D 1RQPA 1TWGB 2RKSA 2MNAA 1BF4A 5FO9B 1EZ8A 2L9HA 2AHOA 1I94Q 2KVOA 2OT2A 3J81i 3QOLA 1XXGA 2QA4A 2F0SA 3VA5A 1VQ9B 2PYKA 3AU7A 4IZ8A 1CA6A 4PC7A 4UHVA 4HN7A 1Y1WG 5IYDH 1SYBA 2Z6KA 1B2RA 3HGBA 4LF8L 4NNJA 1XPRA 2V7QA 3HKSA 4HMJA 3HAGA 1KD1D 1I4QA 1MSGA 4DK6C 3CC4A 1RTOA 2M2LA 1BCPB 1FR3A 1H95A 3W2DA 1QX4A 3KF8A 4K1XA 2HDNB 1XWEA 2RBMA 2D3NA 3VO2A 4KKTA 4K0KL 3PUYA 2NN6I 4B3RL 1QILA 3L7ZC 2KECA 4GOPC 2QN6A 3CCLB 3CAMA 3QOJA 1ASYA 1UMKA 2VNKA 1XJVA 2QMUA 1D8LA 5JAVA 5TR9A 3VMFA 4GLXA 1W6KA 4POGA 1KZLA 5JPMC 4O42A 2NYZD 3TREA 2E2IH 3RLNA 1E1OA 3I73A 1S5DD 1ZYRD 3SEBA 4FYDA 1FNDA 4Z4YA 1CHPD 2E8GA 3J81c 5EKIA 1VJSA 3GTLH 1YHQA 4TN1A 4IPDA 2QCPX 1LYLA 3PIOA 4IW3B 5H5JA 3BCFA 4L5TA 1EWHA 5DAUA 1MJCA 1CFMA 2P5ZX 4AYBG 1VQMA 3I4NG 2A68D 5IYDG 4DV3L 4ACAA 3DHQA 3GTMB 2N3SA 4LF5L 1QUQA 3GTGH 4LFAL 3K7AB 1UAPA 4J8QA 5HGQA 2OTLA 4Z4TA 1JQYD 4KJNA 1TR5A 1GUTA 3CMEA 3KF8B 3HOYB 2R61A 3R2IA 4TMWA 1HR0Q 1K9MD 1EY0A 4JPBW 2HCCA 2RF4A 1NB0A 2AWOA 5D65A 5FO8B 4A3JB 3PENA 1AZPA 4FF1A 1FYCA 1I6HB 1RIPA 5G3LD 2V1CC 3FPUB 4C3JG 2O5IC 2F43A 2C4TA 2F3VA 1D2EA 3D26A 2BVNA 2XGJA 1EP3B 2SDFA 4B9XA 1EFRA 4WZEA 1VQ9A 1VQFA 3GP7A 5IYNA 2SNMA 4QUFA 2I5HA 2QA4B 1Y1WH 4FO2A 1IJFA 3FHWA 1QVGB 4JOIC 2XNDA 1HVXA 4II3A 4BPRA 1XNRQ 4LFAQ 2ZM6L 3OJWA 2PIAA 4QVJA 3L9AX 2MO0A 4UY8C 5LMUL 2B2VA 3S24A 2VQFQ 4A3EH 1FNMA 5M3FB 1E79A 2YWGA 2IL8A 2WZPP 4A3MH 4BY7G 2H4OA 4IFDG 3CCJA 2B2VC 2UU9L 2UXBQ 1Q82D 1GKHA 1H9SB 2PNHA 1FRNA 2ZZGA 3G6EB 3KDFA 1AN8A 4PMCA 2RCFA 4DV4Q 2NVXB 1I4XA 2VBTA 1JA1A 1CQFA 4B3FX 3LNNA 4I7ZC 4GZYC 1H85A 4JVZA 2HMAA 1NJID 1B44D 1WCMG 1HUNA 2DGYA 4B9WA 4JV5L 1E22A 2QF7A 3SK8A 3PUMA 2EY5A 5HZBA 2L15A 1D5ZC 3SHLA 5IE8A 1VQBA 3T51B 1A3UA 4DR6Q 3ISXA 4IPHA 1IBLL 4TMVA 4K2LA 1NMGA 1CZGA 1WJJA 1XMQL 4A3EG 2F0DA 1PH8A 4GNXB 3HOXB 5C4JB 4XXEA 2OEOA 1IXRA 3B6YA 1DARA 1YNND 3A35A 3MMPA 4RHSA 2OTLB 2DUDA 3BH4A 4RD4A 1EY5A 1HZEA 4RD0A 1STGA 2HDLA 4F88A 1EQQA 1J5EQ 4ZK9B 3CMAB 2FHTA 3K7AH 5CR3A 4DGZA 2RDFA 3HOVG 2FX3A 2LSSA 3K5LA 4JI5L 3S1MB 4P2NA 4DV6Q 4RKLA 3K6OA 2VUMG 2VJIA 2N8NA 3GTLB 3WBJA 3HS0C 2GREA 3KJOA 5IYBH 3L0OA 4OELB 2XZLA 1TU2B 4DUYQ 4A3CG 1XMQQ 4F7XA 3CPFA 4EQPA 5H1SE 1QB5D 5A8AA 2NB0A 4HJ9A 1WTWA 1S4ZA 4IJHA 4HIMA 4AIMA 4PAAA 1X32A 4HCEA 3CCLA 3J7AF 2X0KA 3AVWA 1HQRD 3SE0A 1UUPA 5ISRA 2KCNA 1KL9A 2BSAA 3CP0A 4XYOA 4P25A 4YAUA 4BY1G 3SGIA 1VQLB 1CNEA 2R7ZG 2PQEA 1ZXTA 4IALA 3M3YB 3HP3A 1S40A 1VQMB 3OIQA 2UXCQ 3PO2H 4FDBA 4GOPA 2N49A 4RH6A 4YHHL 3P26A 4NMZA 1I18A 5IIFA 4UP7A 2Y0SE 3BG3A 1NDHA 1PYSB 1E2VA 4DNTB 4WZKA 1GVHA 4DV0L 1ELOA 2R92B 1F20A 5C0XH 2CW5A 4XONA 2UU9Q 4X6AH 3PV0A 3RLFA 2CWAA 2XSCA 3TP5A 5A2QL 2UUBQ 1EIGA 2UUCL 4JI6L 3QB3A 4BBSG 2QE7A 4HSVA 4IQZA 3ND8A 2R93H 2RDHA 1BVSA 5M5WH 1IBML 1X6OA 4B3ML 3ONYA 2L4NA 1TWGH 1I4HA 4APVA 1LTRD 4OP7A 1D5MC 3PVDA 1A62A 1XB2A 1RTNA 2E2HH 1ZEQX 1PRTF 3WQZA 4WZLA 2D74A 3U9SA 4QV2A 5IYQA 1QCBD 1EU4A 4B4DA 3J81k 1CK1A 1B2TA 4X66L 5IOCA 2G9DA 3FVQA 3FKIG 1N8RC 3JQPA 4DXFA 1VQOB 2QEXA 4Z4SA 1PKVA 3E9HA 3A8JE 4CJ2C 1OXVA 3VDYA 3ND9A 2AHOB 2PZUA 2E5LQ 1IBMQ 2BM0A 1CZWA 4TMXA 3URYA 1C9OA 4Q0FA 5I6YA 4LFCL 4JI7L 4GLVB 3U9OA 2JA8G 4WORA 3I56B 4XLAA 4PZ8A 1EFWA 4AF6A 2Z9HA 2ZJRA 1Q90A 1EFTA 4PGOA 4C43A 3GO5A 3R6JA 1WDTA 1P8LA 4DR3Q 4FNFA 1ZKOA 5FO1A 4DUZL 2PCFB 3G7LA 1NSNS 2IW3A 2CKZB 2QDBA 1SNQA 4TMTA 1F9QA 3QFCA 1JWMD 1SJHD 3STBD 4FXKC 1QZGA 1HA5A 1VHEA 3S2DH 4OO1G 1UE6A 3K5NA 2OK8A 1ZM3A 1R5NA 4A3IG 2ZL6A 1M4VA 2E1BA 5BN4A 3HZXA 4X7EA 1KK2A 4LFCQ 3CCRB 3OZWA 1J6QA 1ET6A 2F0EA 2BMWA 3A8JA 3ZUGA 3I55A 2ATWA 2JXMB 3I8ZA 3MXGA 4QCLA 1LUZA 4IOCA 1QNKA 1KC8C 1QJOA 4OONA 3M4OH 1T5EA 1PFBA 3EN2A 2DERA 2D62A 1V9PA 1WP6A 4O1NA 4ASUA 1BJKA 3Q3AA 3HKZG 4RMFA 1Q1EA 5D14A 4EQ5A 4ACBA 4XYQA 3Q8DA 2I5LX 4QL5A 5JVH3 1WTHA 2Z1CA 3EA6A 2IY5B 3FP9A 3MC0B 1V0EA 1PTOD 1Q8KA 2PW5A 4YAFA 5M5XB 1UD6A 1ENAA 1TXYA 1BX1A 1W35A 1U0LA 5FO0A 2PMZB 2M00A 4DNIA 3KBGA 3TP8A 2YTYA 1A3VA 2F0VA 2OCEA 1UE7A 1WTPA 1LTBD 4OPVA 3F2BA 1A15A 1X56A 3KUPA 1N36L 4IFDI 1GUGA 3NENA 1Y1VG 3SJPA 1W2BA 2CH4A 4R8NA 2Q2UA 5C4XH 4WJ3M 2ICIA 4XQJA 4JI1Q 3W1GA 4EQNA 1FGUA 4P9SA 1CKNB 2EVBA 3SXHA 1MABA 3LWEA 1CSPA 2HUGA 3CCSB 3H3VH 2XNCA 4R4TA 5E6TA 1F2LA 2XGTA 1XTDA 1LTSD 1HFNA 2VQEQ 4DV7L 2NWGA 3Q6SA 2X6GA 1GHJA 5A35A 1JB7A 2K1BA 1VLYA 1O80A 3AEVA 4A3CH 1J9ZA 3Q0AA 4YHBA 1VF5C 3S15B 4II2A 1K0RA 4YHHQ 1VQHA 1VQCA 2YV5A 3I4NB 3CQZB 2PI2A 1KK3A 2F1MA 3B78A 1KHIA 3IFTA 3U2QA 2OXPA 4C3HB 4NP5A 3W2GA 2KQ3A 5F4OA 4TSFA 3CPWA 5NUCA 5IYCH 1XE1A 3H0GH 3CF5A 4A3BH 5JEAH 1JJ2A 2XNJA 1I50H 2L1BA 3U4ZA 2Q6IA 4JI0L 2R93B 2A6EC 3P20A 3TEHB 3JAMc 1G2TA 4NBSA 5FA6A 4ZKCB 4FWTA 2DNCA 1Y8NB 3CCRA 4JC0A 3S14H 2BDNA 4XORA 3A0JA 2B7BA 3RN5A 2VNHA 5JBQA 1N06A 4ZCIA 1K0SA 4C2MB 1B50A 2Y0SG 3S2HB 1OXTA 3GVKA 4DV6L 1HHVA 2GJRA 4B3SL 4BBRH 3HOWH 3TZDA 3TMEA 3GTQB 3RZDB 3L2PA 4JMQA 1E2ZA 4DV1L 3V7AA 1N07A 5C4JH 3J81L 1AW7A 3JU4A 4DAYB 4JBWA 2YWFA 3NP8A 4X65Q 1GOZA 2D2CC 4K6LA 4UZFA 1H8EA 5DS0A 5C6AA 1FGBD 3RLOA 1Z6HA 1N9WA 2E2DC 1K73C 1BR9A 4GN3B 2HQEA 5C44H 3W2EA 1GJXA 1XTCD 4DA2A 2Q6KA 2ZTDA 1F2YA 4FXGC 4OL7A 1SSOA 3RR5A 3GV3A 4DXGA 1LM0A 3TS0A 3G48A 5EKKA 4DF7A 3HOYG 3KLSA 3CCQA 2EJGC 1ML0D 2NZ1D 4RWSC 4KHPQ 4RD1A 1FRQA 5CBEE 1STAA 2RCNA 3G05A 2XN9C 2A19A 5C4ZA 2HHHL 4G6IA 4XQNA 3SR1A 2F0KA 2KVMA 5K5PA 5C4HA 4DUYL 2OK7A 1STNA 4G1BA 1SNOA 3S1QH 2XWBB 2YTXA 4QGUA 5DSZA 1H42A 3PA1A 4Z4ZA 4GKKQ 4JI8L 3I3CA 5KRUA 3FKIH 2F4IA 3MHPA 2FXQA 3SEJA 4IURA 1B3AA 3WY9A 1Y8OB 1K8AD 4QF4A 2QTLA 4Z1MA 1YJNA 4JBKA 4L5RC 3KK7A 3AMUA 2WKCA 3AFPA 4RCZA 3UDIA 2RDGA 3HOZB 4X05A 4RCOA 3MFYA 1X3QA 4FN5A 2HHHQ 3UI2A 4TVAB 2KEDA 4LF8Q 1D7QA 1I6HH 2HCJB 4A3JH 4JI3Q 1DOMA 3CHBD 5J3BA 3J80E 2M9VA 1PFNA 3I2ZA 4EVOA 3A54A 2EY1A 4A75A 1YJWA 3KLSX 4FVMA 4KY6A 3NQTA 1BBWA 1NBMA 2Q8IB 4BY1H 2VW9A 1F9RA 3OW2A 1AMOA 1PZKD 1KMHA 3GTGB 1VQ5A 4LF7Q 1EUJA 3OWEB 3JC66 1SNDA 2HLDA 3QSYA 3K0YA 4LFBQ 1WTQA 3OSOA 1AP0A 4UPAA 3CW2C 1TQOA 4K2KA 2CFMA 1QUEA 1DOLA 3DEOA 4M1KA 4CJ1B 2H5XA 2HCIA 2YYZA 3I90A 4WFN3 1I4RA 3OIPA 4ZGQB 2R7ZH 2K7VA 2Q6LA 4HJAA 4V0BA 2R92G 4Z4VA 1EXMA 2E75C 5LMNQ 1NRKA 5C3WA 1SKQA 1A2UA 1Z9FA 1BXTA 3OEEA 3SKBA 2L55A 1BQEA 4XN0A 1KQSB 2K50A 3K59A 5ELOA 1E1QA 4POFA 4GNXA 2K5QA 4P74A 3X3NA 4CBVA 2L5TA 4PV1C 4RKBA 1ESFA 5B6IA 1C48A 2WKDA 1HR0L 2Z0SA 4G7WA 4RGOS 4ZAIA 4AVZA 4DK1A 2EYOA 3WYAA 1B3QA 2ZTGA 4YWKA 1BMFA 3MTSA 3OKXA 2L11A 3Q23A 4F8MA 2HT1A 2BDOA 5T1IA 2ZBUA 2R3ZA 5KNLA 4J6HA 1WTHD 4ILWA 5GAGC 1EU3A 3BYTB 4KN4C 2SEBD 4DNRB 1Q46A 1VQNA 1MRZA 1PTOH 1B7YB 2EIFA 4K14A 3EROA 3BY1A 1N08A 3QFRA 5ELEA 3SDZA 1QGAA 4YY3Q 2MFIA 2CK3A 2GK7A 3S9WA 1QG0A 1Q86D 1BUVT 1W0JA 2ZXOA 1SE3A 4RLZA 3FJOA 2NZHA 1WD0A 3UE1A 1E3ZA 2WZNA 2IPKD 1F9SA 3L3OC 1WOCA 4RA8A 1CM9A 3OWFA 5CV9A 1RQRA 1UE5A 5GQOA 2Z6KC 4X8IA 4BBSB 5D3IB 1D1NA 5E1FA 5EPJA 5TY0A 2CH4W 2ZZEA 4QMGA 5ELBA 2KCCA 2XWJB 1UD4A 1H9KA 1I4GA 2DIEA 3CCEA 2JA6B 4MYUA 3A8KA 1YNNC 1OB2A 3S1RB 4IFDH 2EYLA 1WVLA 4JI2Q 2OTJA 3MZ5A 4KKUA 2KHIA 2PLFA 4HE6A 2PQAB 1EQVA 4YAOA 1WTVA 4I65A 4IO9A 1L0YB 1C0AA 4OOXA 3ULLA 3E20A 2JJ2A 2JP1A 1PLFA 1LT4D 1T6XA 1MKHA 1Q3LA 3CCSA 2YU9H 1EYDA 2JSOA 1QVFA 1PH5A 4HJ8A 1QGYA 2V4DA 4QIWB 5KNCA 3VO1A 2GK6A 2WINB 1PRTB 4E0FA 2VB3X 5IT9L 2F0IA 1E43A 1EP2B 1YHQB 4C1NK 1JMCA 1JJGA 3HFZB 2YTVA 1HA3A 1TS4A 4RPDA 1Y1VH 2X6WA 5FL7A 5HY6A 1X3FA 3HOWB 2C4UA 1A3TA 2EXDA 4EQOA 4CDDC 4HIZA 1VQ4B 4R4CA 5KNDA 3BZCA 4BBSH 4G7OC 3BVZA 4H7BA 4G4KA 2GQFA 4JI4L 3RZOB 3DXJC 1YX2A 2ICEC 1YITA 2FJ2A 3HOVB 3W5UA 1U4LA 2ZZQA 3OYYA 3WBKA 4XKWA 5FNZA 3BZKA 5EGTA 4CJ0B 4AQYL 5BSXA 1IBLQ 1EYAA 2F03A 2FINB 3NK9A 2UXDL 1EOTA 4OWTB 1Y69U 1CT1D 1STYA 4WWVA 5J39A 4LF7L 2WJVA 2EFGA 3D0FA 2W6IA 1OGIA 2WAQE 1M1KC 1S5BD 1PTOB 1SLJA 4HIOA 3DDYA 1LABA 3A74A 2Q8TA 3V96A 2B2TA 2F0GA 3PO2G 4KK7A 2OTJB 5IY0A 4C3HH 3QG1A 4LAAA 2Q6OA 1F9PA 1D2BA 2X3UA 1U4PA 2DETA 1UEAB 5G3LF 2J7KA 4YEJA 1IB0A 2P3MA 3TDQA 2HD3A 3NHHA 5C5MA 1CKOA 4JI3L 1QWYA 1JJCB 4G1VA 1TY0A 3CC7B 1PXUA 1RF2D 1SMXA 1V1QA 1HNXQ 1VQDA 4C1NI 2JN4A 2E76C 4G7HC 2CQOA 5LMNW 1C4QA 3NTKA 5GV7A 3BYYB 1KAAA 4IPGA 3Q6RA 5ELDA 2EDGA 2B2WA 1GVPA 5JJZA 4DPGA 1S5FD 4X62L 3GTOH 3VNVA 1UD2A 1VQOA 1WSRA 1H9JA 4B3TQ 1F2ZA 1Z47A 5CBAE 2F0HA 1TWCB 1XNQQ 4RFBA 1EY8A 2GPJA 4K8JA 3OTOL 2DCUA 5KYLA 4Z4WA 2JEAI 5CMDA 1EWYA 1HZCA 1NCVA 3GD7A 4DR6L 2K52A 1E1RA 1OXSC 4ME3A 1GO3E 2E5LL 3FPKA 2EYPA 2IX0A 5AFWA 4R71A 5FLXE 3EFXD 4HTHA 1SNPA 2WP8J 3NWTA 4N3GA 1SAPA 5CV6A 5FK9C 4P1VA 1S0UA 4DV5L 4WQMA 1WCMH 1SNCA 1OXUA 1K9MC 5L37A 2R93G 2Z6BD 3NBHA 2IT1A 3PMFA 4HJ7A 4NCNA 4XL9A 4AF7A 4A3GB 1T6YA 3D31A 3ERSX 2K33A 4TT3A 2AQ2B 3G6JB 1VS0A 3V76A 4DUZQ 3W2HA 4RPBA 2K05A 4FK8A 1CHQD 1SKYB 3AFQA 5JEAJ 5C3EH 4A3FB 1FNCA 2WV6D 2Y0SB 4P71A 1VQEA 2J7ZA 2MJ8A 3K81C 4TQUS 4OWXB 4N8FA 5LHY1 4BXXG 4RGTA 4OIJA 2WIIB 3ES9A 1N8RD 4XD7A 4ALPA 1Q12A 4B3GA 4H13C 4MIUA 4RD2A 1XQBA 1VQLA 2VZLA 3U6BA 1FNUA 1O7ZA 1X3EA 1C8CA 3M4QA 4BWGB 1M1KD 4YY3L 3S1QB 3I1FA 1PJ5A 4IFDJ 2M5SA 1BX0A 2K01A 1BBUA 2C2WA 1EFID 1PHJA 4RGMA 3A8IE 4DR4L 1F60A 2KJXA 1CQVA 3NTHA 1NR4A 4P12A 1N34Q 3J7AV 2B39A 1IHZA 1KK1A 4X07A 4DR1Q 2X69A 3NELA 4JBMA 2KUMA 4OX9Q 3SK5A 2VUMH 1EWIA 1R5OA 5IYWA 3EJIA 1DZ1A 1YEZA 2A69C 2LFNA 3N6RA 2K28A 4N9TA 1VQ5B 2HIXA 5JJIA 5M5WB 2GJKA 2V31A 1V1OA 5GAEC 2ZT9C 2C5CA 1SNMA 2IHEA 2ZXIA 3KJPA 2NVYH 4X64L 3VR4A 4ZRZA 5IGCA 4BXXH 1YJ9B 3G71B 2AMCB 4R4OA 2XNAC 4L5SA 4A3GG 2GA4B 4EH1A 2K14A 1XPUA 1QNUA 3A8IA 2QGQA 3G4SB 2WFWA 3GV6A 3BC9A 1U4RA 2BA1A 3IFDA 4X06A 3S2HH 2TSSA 2F0FA 1PRTD 3FMCA 3OMGA 4P73A 4DV5Q 3I4OA 2NN6G 1TWFH 4H0LC 3DEPA 3KLWA 4M8AA 3H3VI 4Z9CB 1TS2A 5IYRA 3UE0A 2ZTNA 3GTPH 1PZJD 3H94A 3HOUB 2F0PA 1PYBA 2QDXA 1J9OA 2A6HD 2DY8A 2MO1A 1GR1A 2X6LA 3O13A 2QILA 2ENBA 3DWQA 4YWLA 3Q39A 1D8TA 2VS1A 1I50B 5C0XI 4A3IB 1GM5A 1GD7A 3QR8A 4DAYA 1DDGA 3PIO3 3Q24A 4DK0A 1SMYD 1EEFD 2UUAL 5KYIA 4MNOA 1A8VA 1IL8A 3A5UA 5COYA 4R4IA 1NTGA 1R4QB 1Q86C 3S15H 2F0LA 1XNQL 3CCMB 2ZL7A 1LTGD 3S1MH 1I3QH 1R9TH 3KDFB 5EPKA 1TWHB 3U4VA 2QGGA 2E2JH 3A55A 2W6JA 1D1IA 1HXYD 3VYUA 2B63B 3OEHA 4LBVA 1D5XC 5M5YH 5E3FA 2N55A 2UXDQ 2LY7A
chains in the Genus database with same CATH topology
2GJPA 1D6EC 5FLXL 4KY7A 3RMHA 3R8BA 2TMPA 3C46A 4X3TA 1I4PA 2IJ0A 3IKJA 3VYRA 5CV8A 1I8DA 2B2TC 4RAUC 2VUMB 3VR6A 1PTOF 2EPBA 1BCPD 2B2WC 2K5WA 2LZJA 3CP8A 2PZTA 3OFNA 2F0WA 1LV9A 4HSPA 4H44C 4DFAA 1LTAD 3RUZA 1XX8A 4KHZA 3IL8A 3MHBA 3S2DB 1B9MA 5EPLA 3OMCA 3PIP3 4FP5D 1LLRD 1V1PA 5C3EB 5DM63 4K6DA 3GTOB 1QOHA 1SJED 1U4MA 3R2TA 4XTCS 3D4RA 3TN2A 3K58A 4KMUC 4ME5A 4XT1B 4ODGA 1HCZA 3I91A 4LK1C 3IAYA 4K5WA 1BOSA 3H91A 1WTXA 1O7YA 3TZUA 4XR6A 2F0QA 5BN5A 3V05A 2WSSA 4XQQA 4CKEA 2B2YA 3PUWA 1EZ6A 1Z7TA 2KA7A 3WOFA 1MBYA 1G2SA 1EWCA 5KNBA 2Z4HA 1SE2A 4ZKBB 1JB3A 3BCDA 1O7LA 2F3WA 3SVMA 5ELCA 3T4AC 4BA2I 1JOQA 2B8FA 2EJMA 2NVTB 1RD9D 5IK2A 2PZWA 1ZYRC 2R9VA 2H1EA 1SYEA 2XVSA 1STBA 3QO2A 4MN3A 2CHBD 4C3JB 1LTTD 4X3SA 2JA8B 3ONAB 3MXNA 1BNZA 3QWNA 3FDTA 1KTKA 2EOTA 4X3UA 4S3SA 1EY7A 4IUQA 5EKLA 1DM0B 3JAML 4G7XA 1DCZA 2AQ1B 2X6XA 4XIGS 1QE6A 1IW7C 4KD4A 1TKWB 4PQXA 3K5MA 4ZQ3A 1NUCA 4OHJA 4AYBB 4BS9A 2WAQB 1O78A 1LT5D 1PTOC 1S5ED 2YU9B 2VNUD 1V1PB 5CV7A 3HKZB 3M85A 1IYUA 1MSHA 4M1UB 2K04A 3LWUA 1A6XA 3OPOA 2DN8A 1D1KA 4XM3A 1TY2A 1GUWA 1TS3A 1JWSD 1KNEA 2XZPA 1I6VC 1V43A 1JC7A 1W6JA 1NAPA 5CGKA 1BLIA 2F0MA 3FKSA 4KKSA 3D3RA 5M9OA 1XYIA 5D3DA 4CKCA 2X6YA 1UD5A 2NTSA 2CW0C 5M3MB 5F2DA 4OIKA 3MXUA 2R7ZB 2AUKA 1ENCA 1W9XA 2NTTA 3MEHA 3D6CA 4C56C 1SDFA 5M5YB 2NVQB 1F2MA 1ILQA 4YXWA 3Q22A 1IKMA 2E2JB 2D9UA 3KLRA 3V2TA 2SNSA 2MHVA 4XNFA 4G7ZC 3E5SA 4R9WA 2EE1A 2CW0D 2JYOA 5DNFA 1II3A 1LACA 4YELA 2A6HC 4KJOA 4NKLA 5C0XG 3BDLA 3DM1A 3OAAA 5DEHA 5I6WA 2QKIC 3I70A 3H09A 1B4OA 3R3OA 3J80L 5I2XA 4HCSA 2B2UC 3FKIB 4DN4M 2RSNA 4LJZC 1RDPD 1VF7A 2O4XA 5HURA 5FOBB 1W0KA 4XLCA 1RCVD 5CV4A 4BY1B 1JE4A 1OB0A 3T16A 2LS01 1DONA 1FD7D 2MPMA 3ZPNA 2FMMA 4ULLA 1HTPA 2CVRA 1ICWA 4C3IG 1K8MA 3NSWA 3GTJB 2EZVA 1WD1A 1IKLA 2ID0A 1J8IA 1JOOA 1SYCA 2RA4A 3FEWX 1SEBD 2G9HD 4KTAA 1RKNA 4V190 5JVG3 3SK4A 4UZUA 2XOKA 1G291 3S16B 4GQNA 5J22A 4CGYB 1SXTA 2JJ1A 2BE5D 1ONLA 3OOCA 2B2UA 4BBRB 3KEWA 2EYMA 1RHPA 2SOBA 1K8OA 4KN7C 3OHXC 4N9PA 3NUCA 1KDAA 4FXUA 2K6AA 3VYSA 2C9OA 4HR7B 3VR2A 2ZZFA 5IODA 1ENFA 5HKKA 3BVMA 2X8KA 3T56B 4UDUC 5JOBA 3GTKB 1KLGD 5KGUA 4EGVA 1SYGA 1WCMB 4DU9A 1PYWD 1ILPA 2Q8RE 1B1ZA 1GXDC 2K03A 4WJWA 4IUUA 1FNVA 1UD3A 2AUJD 3ITPA 1EQTA 4IUPA 2NVYB 1T5XD 3S14B 2O5JC 1SFOB 1SBBB 1GUNA 3P75A 4NDXA 5C3XA 1AFPA 1BQQT 2I46A 1YNJD 4ZUIA 3H0GB 4A3BB 1STEA 1JICA 2F0NA 3CESA 2B8GA 2A68C 1LO5D 4K5XA 2JE6I 3CKIB 3MVVA 3NTIA 3M4OB 3C3LA 1E2WA 3A3BA 4OO1I 5FO7B 4E6IA 2F0JA 1E0BA 2BOSA 2JA7B 4MHEA 3HRZC 3PUXA 1CI3M 1V8QA 4CHTB 2EY6A 3DMUA 4XDXA 3T53B 1RJTA 2X85A 4K8IA 5E4WC 1F77A 3K57A 1Y8PB 1EL0A 4B08A 5I2YA 5LL6S 2LKVA 2E74C 3LX0A 2CQAA 2PO4A 1HTLD 1G6ZA 5BN3A 5IGDA 4HAEA 4ABNA 1BO0A 3SK6A 2ZXHA 1L0XB 3VR3A 1TIID 1WPCA 4P22A 1ET9A 1X3PA 1AEXA 2FMCA 1UNSA 2DNEA 2NUCA 3EQLC 2IX3A 2DY7A 1R4PB 1TS5A 1SYFA 2J4XA 1UD8A 2EYFA 1VDZA 5K36G 1EY4A 3P1HA 3VA7A 3EVQA 4ID6A 4ZYSA 3H3VC 4K5VA 5C5LA 5IGFA 1YNJC 2LMCB 4DAPA 2K32A 3F2UA 4F87A 2EXZA 2X53S 3C1EA 2RQXA 2MGSA 2WACA 5FKAC 1SE4A 3GQBA 1M8AA 5CC4A 1EIHA 3K5OA 4FF2A 4PMBA 1KLUD 1H9RA 1HPCA 1H9MA 5A2QE 4XQFA 3D4DA 2J0TD 1HA6A 3M7NA 1JORA 3GVJA 1ESRA 4LMQD 2VB2X 3CP2A 3CU7A 3P7JA 1QG7A 3A7LA 4C3HG 2N88A 3NBIA 3D6WA 4RGNA 3T13A 1CTMA 4HMIA 4KHVA 3H6MA 1BCPF 3PO2B 2BA0A 5EBCA 1AZQA 1EEID 2JDIA 5CORA 1TVXA 5LL6X 2A5HA 2D5DA 5CDFA 2A6ED 1SMYC 3JAME 5CYUA 4A3KB 2IWHA 2B2YC 3A8KE 3C2PA 5I9PA 2K5DA 3TP7A 4JK1C 1BCPC 1LTID 2XRQD 1KDCA 1EY6A 3BDOA 4U68A 5T1GA 4A3MB 3BDCA 4XKVA 2AQ3B 2XIWA 4A3EB 4NW2A 3NWSA 3CRLC 2PNRC 2QEJC 1DYQA 4XOTA 2I07B 3M7GA 2WB1B 3BVGA 3MFGA 5DN6A 2NBFA 3ZIAA 3I72A 2EY2A 3ERQA 1Q1BA 1G8ZD 3HEJA 3A56A 2KHSA 2Z4IA 1MGSA 4XLFA 1KDBA 3DUZA 1S5CD 4G57A 4PMWA 2NN6H 1MD2D 3GVLA 1Y1WB 3MWYW 1WTRA 4QUCA 1HRJA 1DOKA 1TWAB 3GTPB 2Z8LA 4TSSA 4A3DB 5K36H 1TWFB 1B9NA 5I4DA 1JCKB 1E3XA 1EYCA 4Y7NB 4IUTA 1HQMC 1I3QB 1R9TB 3TP6A 2A69D 2BCOA 4OGQC 4XT3B 3D8GA 2HDMA 3AB9A 1STHA 3TBIB 4KY5A 1IW7D 2E2IB 2RVLA 4J1MA 2KOLA 1SYDA 3N52A 1COWA 2JIZA 2EJFC 4QB4A 1JWUD 2ZXPA 4IN3A 1KABA 4CKBA 1B53A 4DAVA 4FXDA 5CV5A 2AWNA 3R93A 3MA2B 3OW7A 4TRDA 1TT2A 2L12A 3A3GA 4IUNA 3PUZA 4PNYA 5JPNC 5KEEA 3NXWA 2XRSD 5IGGA 4OO1H 1EY9A 5C4XB 4XMYA 2PPBC 4BY7B 3VYTA 2F0OA 1BPLA 2ZXRA 2O2LD 5IT9E 1OO9B 2A73B 5C44B 3C1FA 3NE5B 1JOKA 4KD3A 3FPPA 1BDOA 5IGBA 4TKOB 4Q5VA 5EJWA 5DM73 2VJJA 5EBDA 2MUYA 1Q8IA 2L0CA 3FRPB 1DJRD 4FF4A 3BZDB 3HG9A 4XLEA 3S1NB 4L8JA 1PRTC 3A7AB 2F0UA 1JR0D 1HFGA 4IUVA 1PZID 1A2TA 2WJYA 3J7YW 1V0FA 4BA1I 1H8HA 3W3AA 5TSSA 1K83B 1U9RA 5J1ZA 4C3IB 2PW7A 3RD4A 3MXPA 3J81E 5JEAG 4ZLTF 4P2CB 1G91A 5IGEA 3CRKC 4U673 4XN3A 5ELFA 1PFMA 2EYHA 4UAIA 5EQ0A 1DD2A 4FF3A 1WTOA 2WPDA 1K28D 3M4YA 1LT6D 1VCIA 3PUVA 3CMMA 3OE7A 3E6ZX 3TSSA 1RODA 3WDNA 2EYJA 4WRDA 3ZYYX 3S17B 3E0JA 4L63B 1GUOA 3I4LA 3WOEA 4XLHA 1DXMA 1VMCA 3X3MA 1GUSA 3NPPA 5HGTA 3D4WA 4R8IA 1OXXK 4X3KA 1MI2A 5KIXA 2IX1A 3I4MB 1HUMA 1BBXC 2F0TA 3DWPA 2D3LA 5E4XA 4KI0A 2KEEA 4YIJA 5I9OA 3BS1A 1VMPA 2MP1A 4L6TB 2R6GA 3DWAA 2OF1A 4RCNA 4KV6A 2JA5B 4XOPA 4ZUJA 1PDQA 1OHHA 1PMRA 2FFKB 5C0XJ 4A93B 3VR5A 2BE5C 3PO3B 3MAQA 1FX0A 1FNWA 2A74C 3KBXA 1NR2A 2VXWA 1Y1VB 3QIAA 1H9SA 3J7AF 1KNAA 2XZOA 1CA5A 4HEDA 2RSOA 2JEBI 2E2HB 3NQIA 1IYVA 4RHRA 3QJYA 1LT3D 2RKSA 1TWGB 1BF4A 5FO9B 1EZ8A 2L9HA 2KVOA 2OT2A 3QOLA 1XXGA 2F0SA 3VA5A 2PYKA 3AU7A 4IZ8A 1CA6A 4HN7A 1SYBA 3HGBA 4NNJA 2V7QA 4HMJA 3HAGA 1I4QA 1MSGA 1RTOA 2M2LA 1BCPB 1FR3A 3W2DA 3KF8A 1XWEA 2RBMA 2D3NA 4KKTA 3PUYA 2NN6I 1QILA 3L7ZC 2KECA 3QOJA 5JAVA 1W6KA 1KZLA 5JPMC 4O42A 2NYZD 3SEBA 1S5DD 1ZYRD 3I73A 4FYDA 1CHPD 5EKIA 1VJSA 2QCPX 5DAUA 3BCFA 1GHKA 1EWHA 1CFMA 2A68D 3DHQA 3GTMB 3K7AB 1UAPA 4J8QA 1JQYD 4KJNA 1TR5A 1GUTA 3HOYB 2R61A 3R2IA 1EY0A 2HCCA 5FO8B 2AWOA 5D65A 4A3JB 4FF1A 1AZPA 1I6HB 1FYCA 5G3LD 4C3JG 3FPUB 2O5IC 2F43A 2F3VA 4B9XA 2XGJA 2SDFA 1EFRA 3GP7A 2SNMA 4QUFA 4FO2A 2XNDA 1HVXA 4II3A 3L9AX 2B2VA 5M3FB 1E79A 2IL8A 2WZPP 2H4OA 4IFDG 2B2VC 1H9SB 2ZZGA 4PMCA 1AN8A 2NVXB 1I4XA 1CQFA 4B3FX 3LNNA 4I7ZC 4GZYC 1HUNA 1B44D 4B9WA 2QF7A 3SK8A 2EY5A 1D5ZC 3SHLA 3T51B 1A3UA 4K2LA 1CZGA 2F0DA 3HOXB 5C4JB 4XXEA 2OEOA 1YNND 3A35A 4RHSA 3BH4A 1EY5A 1HZEA 2HDLA 1STGA 4F88A 4ZK9B 2FHTA 5CR3A 4DGZA 2RDFA 3K5LA 3S1MB 4RKLA 3K6OA 2VJIA 3GTLB 3HS0C 2XZLA 1TU2B 4F7XA 4EQPA 1QB5D 2NB0A 1WTWA 1S4ZA 1X32A 4HCEA 1HQRD 3SE0A 1UUPA 5ISRA 2KCNA 4XYOA 2PQEA 1ZXTA 4IALA 3M3YB 3HP3A 3OIQA 4RH6A 4NMZA 1I18A 5IIFA 3BG3A 1E2VA 4DNTB 2R92B 5C0XH 4XONA 3PV0A 3RLFA 2XSCA 3TP5A 5A2QL 1EIGA 3QB3A 2QE7A 4HSVA 4IQZA 3ND8A 2RDHA 2L4NA 1I4HA 1LTRD 1D5MC 1RTNA 1ZEQX 1PRTF 3WQZA 3U9SA 1QCBD 1EU4A 1CK1A 1B2TA 5IOCA 2G9DA 3FVQA 4DXFA 1PKVA 4CJ2C 3A8JE 1OXVA 3ND9A 2PZUA 1CZWA 3URYA 4Q0FA 5I6YA 3U9OA 4WORA 4XLAA 1Q90A 3GO5A 4FNFA 1ZKOA 2PCFB 3G7LA 1NSNS 2IW3A 2QDBA 1F9QA 1SNQA 1JWMD 1SJHD 4FXKC 1HA5A 4OO1G 3K5NA 1M4VA 2E1BA 5BN4A 3HZXA 1ET6A 2F0EA 2JXMB 3I8ZA 3MXGA 4QCLA 1QNKA 1QJOA 1T5EA 1PFBA 2D62A 4O1NA 1WP6A 4ASUA 5D14A 1Q1EA 4XYQA 5JVH3 2Z1CA 3EA6A 3MC0B 1V0EA 1PTOD 2PW5A 5M5XB 1UD6A 1ENAA 2PMZB 2M00A 3KBGA 3TP8A 1A3VA 2F0VA 1WTPA 1LTBD 1A15A 3KUPA 4IFDI 1GUGA 4R8NA 2ICIA 4XQJA 4EQNA 2EVBA 3SXHA 1MABA 3LWEA 2HUGA 1F2LA 1HFNA 1LTSD 2NWGA 3Q6SA 2X6GA 1GHJA 5A35A 2K1BA 1VLYA 1O80A 3Q0AA 1VF5C 3S15B 4II2A 3I4NB 3CQZB 2F1MA 3IFTA 2OXPA 4C3HB 4NP5A 2KQ3A 4TSFA 5NUCA 5JEAH 2L1BA 2R93B 2A6EC 3P20A 1G2TA 4ZKCB 2DNCA 1Y8NB 2BDNA 4XORA 4C2MB 1B50A 3S2HB 1OXTA 3GVKA 1HHVA 2GJRA 3TZDA 3TMEA 3GTQB 3RZDB 4JMQA 1E2ZA 3J81L 1AW7A 3JU4A 4JBWA 3NP8A 1GOZA 2D2CC 4K6LA 5C6AA 1H8EA 1FGBD 1Z6HA 2E2DC 1BR9A 2HQEA 1GJXA 1XTCD 4DA2A 4FXGC 1F2YA 4OL7A 1SSOA 3GV3A 4DXGA 5EKKA 4DF7A 3KLSA 2EJGC 1ML0D 2NZ1D 4RWSC 5CBEE 1STAA 3G05A 2XN9C 5C4ZA 4G6IA 4XQNA 3SR1A 2F0KA 2KVMA 5K5PA 5C4HA 1STNA 1SNOA 2XWBB 3I3CA 5KRUA 2F4IA 4IURA 1B3AA 1Y8OB 4QF4A 4Z1MA 3KK7A 3AMUA 2WKCA 2RDGA 3HOZB 4RCOA 3MFYA 1X3QA 3UI2A 2KEDA 1DOMA 3CHBD 3J80E 2M9VA 1PFNA 4EVOA 3A54A 2EY1A 3KLSX 4FVMA 4KY6A 3NQTA 1NBMA 2Q8IB 1F9RA 1PZKD 1KMHA 3GTGB 3OWEB 1SNDA 2HLDA 3K0YA 1WTQA 3OSOA 1AP0A 1TQOA 4K2KA 1DOLA 3DEOA 4CJ1B 2HCIA 2YYZA 3I90A 4WFN3 1I4RA 3OIPA 2K7VA 4V0BA 2E75C 1NRKA 5C3WA 1A2UA 1BXTA 3OEEA 2L55A 4XN0A 3K59A 1E1QA 2K5QA 3X3NA 4CBVA 2L5TA 4PV1C 4RKBA 1ESFA 1C48A 2WKDA 4G7WA 4RGOS 4ZAIA 4AVZA 4DK1A 2EYOA 2ZTGA 1BMFA 3MTSA 2L11A 3Q23A 4F8MA 2BDOA 5T1IA 2R3ZA 5KNLA 4J6HA 1WTHD 4ILWA 1EU3A 3BYTB 4KN4C 2SEBD 4DNRB 1PTOH 4K14A 3EROA 5ELEA 3SDZA 2CK3A 2GK7A 3S9WA 1BUVT 1W0JA 2ZXOA 1SE3A 1WD0A 1E3ZA 2IPKD 1F9SA 3L3OC 4RA8A 1CM9A 3OWFA 5CV9A 4BBSB 5D3IB 5E1FA 5EPJA 2ZZEA 4QMGA 5ELBA 2KCCA 2XWJB 1UD4A 1H9KA 1I4GA 2DIEA 2JA6B 1YNNC 3S1RB 4IFDH 2EYLA 1WVLA 3MZ5A 4KKUA 1EQVA 1WTVA 4I65A 1L0YB 2JJ2A 2JP1A 1PLFA 1LT4D 1Q3LA 1EYDA 2JSOA 2V4DA 4QIWB 5KNCA 2GK6A 2WINB 1PRTB 4E0FA 2VB3X 5IT9L 2F0IA 1E43A 4C1NK 1TS4A 2X6WA 5FL7A 3HOWB 1A3TA 4EQOA 4HIZA 5KNDA 4G7OC 3BVZA 4H7BA 4G4KA 3RZOB 3DXJC 2ICEC 2FJ2A 3HOVB 1U4LA 2ZZQA 4XKWA 5EGTA 4CJ0B 2F03A 1EYAA 2FINB 3NK9A 1EOTA 1Y69U 1CT1D 1STYA 5J39A 2WJVA 2W6IA 1S5BD 1PTOB 3DDYA 1LABA 2Q8TA 3V96A 2B2TA 2F0GA 4KK7A 3QG1A 4LAAA 1F9PA 1D2BA 1U4PA 1UEAB 5G3LF 4YEJA 3TDQA 3NHHA 5C5MA 1QWYA 1TY0A 1PXUA 1RF2D 4C1NI 2E76C 4G7HC 1C4QA 3NTKA 3BYYB 1KAAA 5ELDA 2EDGA 2B2WA 5JJZA 1S5FD 1UD2A 1H9JA 1F2ZA 1Z47A 5CBAE 2F0HA 1TWCB 4RFBA 1EY8A 4K8JA 5KYLA 2JEAI 5CMDA 1NCVA 3GD7A 1E1RA 1OXSC 2EYPA 5AFWA 2IX0A 5FLXE 3EFXD 4HTHA 1SNPA 2WP8J 3NWTA 1SAPA 5CV6A 5FK9C 1SNCA 1OXUA 2Z6BD 3NBHA 2IT1A 3PMFA 4XL9A 4A3GB 3D31A 2K33A 4TT3A 2AQ2B 3G6JB 2K05A 1CHQD 1SKYB 5JEAJ 4A3FB 2WV6D 2Y0SB 2J7ZA 2MJ8A 4TQUS 5LHY1 4RGTA 4OIJA 2WIIB 4XD7A 4B3GA 1Q12A 4H13C 4MIUA 1FNUA 1O7ZA 1C8CA 4BWGB 3S1QB 4IFDJ 2M5SA 2K01A 1EFID 4RGMA 3A8IE 2KJXA 1CQVA 3NTHA 1NR4A 3J7AV 2B39A 1IHZA 2X69A 2KUMA 3SK5A 3EJIA 1DZ1A 2A69C 2LFNA 3N6RA 2K28A 4N9TA 5M5WB 2GJKA 2V31A 1V1OA 2ZT9C 2C5CA 1SNMA 2ZXIA 3VR4A 4ZRZA 5IGCA 2XNAC 2GA4B 1QNUA 3GV6A 3BC9A 1U4RA 2BA1A 3IFDA 2TSSA 2F0FA 1PRTD 3FMCA 3OMGA 2NN6G 4H0LC 3DEPA 4M8AA 4Z9CB 1TS2A 2ZTNA 1PZJD 3H94A 3HOUB 2F0PA 2A6HD 1J9OA 2DY8A 2X6LA 3O13A 2QILA 2ENBA 3DWQA 1I50B 5C0XI 4A3IB 4DAYA 3PIO3 3Q24A 4DK0A 1SMYD 1EEFD 5KYIA 1IL8A 5COYA 1R4QB 2F0LA 1LTGD 5EPKA 1TWHB 3A55A 3VYUA 2W6JA 1D1IA 1HXYD 2B63B 3OEHA 1D5XC 5E3FA 2N55A 2LY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2Z A;  2KA7 A;  1H9M A;  1OXX K;  1Q12 A;  3DXJ C;  4H13 C;  1G29 1;  3M7N A;  4OO1 G;  4TKO B;  5KNB A;  2NN6 H;  4JBW A;  1TU2 B;  5BN4 A;  4KKS A;  2D2C C;  3PUX A;  1Y69 U;  1CI3 M;  1V8Q A;  2L5T A;  4PV1 C;  1EWH A;  1GHK A;  1CFM A;  2BE5 D;  2A68 D;  1ONL A;  2JXM B;  3T53 B;  1Z6H A;  3A7L A;  3OOC A;  3IKJ A;  1O7L A;  1QJO A;  4KI0 A;  1CTM A;  1T5E A;  1LAB A;  2CW0 C;  1Y8P B;  4DK1 A;  1GJX A;  2D62 A;  3MXU A;  4BA2 I;  2AUK A;  2B8F A;  2EJM A;  3QG1 A;  1GUT A;  3SE0 A;  3VR6 A;  3A8I E;  4KN7 C;  1K8O A;  1Q1E A;  2BA0 A;  2E74 C;  2R6G A;  5K36 H;  2AWO A;  4RCN A;  2BDO A;  1FYC A;  1ZYR C;  2EJG C;  1B9N A;  3I73 A;  2O5I C;  2D5D A;  5BN3 A;  4L8J A;  1PMR A;  2A6E D;  4KN4 C;  3A7A B;  2A69 C;  4DNR B;  1SMY C;  3N6R A;  3BG3 A;  4H44 C;  2BE5 C;  4HR7 B;  3VR5 A;  3VR2 A;  3KLR A;  1HQM C;  1E2V A;  4DNT B;  3VR3 A;  2A69 D;  3SDZ A;  4OGQ C;  3QIA A;  1H9S A;  4KHZ A;  4G7Z C;  2ZT9 C;  3A8K E;  5C0X H;  3AB9 A;  1GUG A;  2E76 C;  4G7H C;  3T56 B;  2DNE A;  3PV0 A;  3RLF A;  3EQL C;  1B9M A;  1LAC A;  2A6H C;  4JK1 C;  2EDG A;  3VR4 A;  4BA1 I;  2EVB A;  1IW7 D;  3BDO A;  2JEB I;  1Y8O B;  4IQZ A;  3ND8 A;  3W3A A;  1DCZ A;  5C0X G;  1IYV A;  1VDZ A;  4XIG S;  1IW7 C;  3QJY A;  1H9J A;  5K36 G;  2EJF C;  4IFD G;  2KCC A;  1GHJ A;  1TKW B;  3MFY A;  5A35 A;  1H9K A;  2BA1 A;  3VA7 A;  3FMC A;  1YNN C;  5JEA G;  2NN6 G;  1VF5 C;  1H9S B;  4H0L C;  2JEA I;  4IFD H;  2AUJ D;  3GD7 A;  3CRL C;  4KKU A;  2PNR C;  3U9S A;  3OW7 A;  1OXS C;  3CRK C;  4LJZ C;  2F1M A;  4XTC S;  3H94 A;  3IFT A;  2O5J C;  1VF7 A;  3LNN A;  4I7Z C;  4GZY C;  1DD2 A;  2A6H D;  3D4R A;  3PUZ A;  1GUN A;  1O78 A;  1YNJ C;  3HGB A;  2Q8I B;  3M4Y A;  2LMC B;  5JEA H;  1VCI A;  4KMU C;  2K32 A;  2QF7 A;  3PUV A;  3A8J E;  1OXV A;  3ND9 A;  1HCZ A;  2A6E C;  1IYU A;  1OXU A;  3T51 B;  3P20 A;  4LK1 C;  3M85 A;  4DK0 A;  2V4D A;  1FR3 A;  4OO1 H;  5KNC A;  2IT1 A;  2DNC A;  1Y8N B;  3WDN A;  1HTP A;  2PPB C;  3I72 A;  3D31 A;  4KKT A;  2K33 A;  3PUY A;  2NN6 I;  1K8M A;  3TZU A;  3L7Z C;  1Q1B A;  2YYZ A;  3LWU A;  2B8G A;  2A68 C;  1A6X A;  5BN5 A;  1Q90 A;  3OPO A;  2DN8 A;  1GUO A;  1OXT A;  3I4L A;  3GQB A;  2K7V A;  3NE5 B;  2JE6 I;  1DXM A;  4TQU S;  2E75 C;  5KND A;  1E2W A;  1ZKO A;  3FPP A;  3PUW A;  4G7O C;  1BDO A;  1I6V C;  2PCF B;  1GUS A;  1V43 A;  1Z7T A;  1H9R A;  1HPC A; 
#chains in the Genus database with same CATH topology
 2GJP A;  4PC1 A;  1D6E C;  5FLX L;  4PC2 A;  4KY7 A;  3RMH A;  3R8B A;  2UUA Q;  3RY8 A;  2ZTC A;  2TMP A;  1GO2 A;  4X0C A;  4OEM B;  5M3M H;  1WOS A;  3C46 A;  4X3T A;  3CPW B;  1AE2 A;  1I4P A;  1Q7Y D;  2IJ0 A;  3IKJ A;  4OX9 L;  3CC2 B;  3VYR A;  5CV8 A;  4JI7 Q;  1I8D A;  3CB4 A;  2HQL A;  2B2T C;  4RAU C;  2VUM B;  3VR6 A;  5H59 A;  1PTO F;  1K8A C;  2EPB A;  1TLL A;  1BCP D;  2B2W C;  2K5W A;  2LZJ A;  4DR2 L;  3CP8 A;  4GKJ L;  2PZT A;  3CCV A;  3OFN A;  1WU8 A;  2F0W A;  3K0X A;  4A3J G;  1LV9 A;  4HSP A;  4B3X A;  3CW2 A;  4H44 C;  4DFA A;  1LTA D;  1VQ8 B;  1PH7 A;  2JA5 G;  3RUZ A;  1XX8 A;  1KC8 D;  1W2B B;  4KHZ A;  2C35 B;  3LQ6 A;  1QUQ B;  3IL8 A;  3HKZ E;  4JI1 L;  3MHB A;  4LWC A;  4PZ7 A;  5FLX c;  1ASZ A;  3TQY A;  3S2D B;  5FIU A;  3CCV B;  2B3G A;  1B9M A;  5EPL A;  4QUZ A;  3OMC A;  3PIP 3;  2CND A;  2C5H A;  1HZ9 A;  2R7F A;  4FP5 D;  1C7Y A;  3ULJ A;  1LLR D;  1VQ4 A;  4OPS A;  1V1P A;  1A8P A;  1SE8 A;  2Q2T A;  1YIJ A;  5C3E B;  1TVC A;  5DM6 3;  4K6D A;  3GTO B;  4P3I A;  5GAH C;  1W87 A;  1VQ7 B;  1L1O B;  1QOH A;  2HIV A;  1SJE D;  1U4M A;  3R6K A;  3R2T A;  4XTC S;  5J35 A;  3HOY H;  2NPF A;  3D4R A;  3TN2 A;  1QVF B;  4JI0 Q;  3K58 A;  2CCZ A;  4KMU C;  5IYB G;  4ME5 A;  4XT1 B;  4AH6 A;  3GTM H;  4ODG A;  1HCZ A;  3I91 A;  4LK1 C;  1YHA A;  5C3E G;  3IAY A;  2DY1 A;  2K5N A;  3K8A A;  4K5W A;  1BOS A;  5J3O A;  2BGI A;  2RHS B;  2Z6B A;  3CXC B;  3H91 A;  4GLA C;  1WTX A;  1O7Y A;  3TZU A;  3OZU A;  4XR6 A;  2F0Q A;  5BN5 A;  3V05 A;  4J0Q A;  3PQI A;  2WSS A;  2Q2I A;  4LF4 L;  1WOR A;  4XQQ A;  4CKE A;  2B2Y A;  2WAQ G;  3PUW A;  4M4S A;  1EZ6 A;  3RNU A;  1Z7T A;  2F4V L;  1JNY A;  2KA7 A;  3WOF A;  1MBY A;  2ZL5 A;  1G2S A;  4DKA C;  1EWC A;  5JJL A;  1PH4 A;  3KL9 A;  5KNB A;  4CDC C;  1SN8 A;  2Z4H A;  1SE2 A;  1CQX A;  4ZKB B;  1HZB A;  1K73 D;  2IHF A;  5THX A;  1GAQ A;  1JB3 A;  1KQS A;  3BCD A;  1KAW A;  1O7L A;  2F3W A;  5EMN A;  4KHP L;  4ZCL A;  3SVM A;  1QFJ A;  1E24 A;  5ELC A;  3PIP A;  3T4A C;  1IJE A;  4BA2 I;  1JOQ A;  2B8F A;  2XEX A;  2EJM A;  1P4M A;  4QY7 A;  5FJ8 G;  4RDJ A;  2NVT B;  1RD9 D;  3LVB A;  5IK2 A;  2PZW A;  2BM1 A;  1PH3 A;  1ZYR C;  2YWE A;  1XMO Q;  2R9V A;  2H1E A;  1SYE A;  3AVU A;  2XVS A;  1STB A;  3QO2 A;  4MN3 A;  2JA7 G;  3M4P A;  2CHB D;  4C3J B;  3ZZ0 A;  1LTT D;  4X3S A;  2BH8 A;  2R6H A;  2FVG A;  2Q2H A;  2JA8 B;  1T6Z A;  1A63 A;  1E3P A;  4DQL A;  3ONA B;  1G7R A;  3MXN A;  3QFS A;  1BNZ A;  1EOV A;  3QWN A;  3FDT A;  1EP1 B;  1KTK A;  2EOT A;  4X3U A;  4S3S A;  1EY7 A;  4IUQ A;  5EKL A;  1VHO A;  1M90 D;  1DM0 B;  3KFU A;  3S1R H;  3JAM L;  2E1R A;  4G7X A;  1DCZ A;  2AQ1 B;  2X6X A;  4XIG S;  1QE6 A;  1IW7 C;  4KD4 A;  4LBW A;  1DG1 G;  2ZBV A;  4DR5 L;  1KRT A;  1TKW B;  4PQX A;  2KHJ A;  1JT8 A;  5HZA A;  5KSW B;  3K5M A;  4JV5 Q;  4ZQ3 A;  1NUC A;  3IRB A;  4OHJ A;  4AYB B;  1S4M A;  4BS9 A;  4LFB L;  2WAQ B;  3BJU A;  1TTT A;  5IP7 G;  2BGJ A;  1O78 A;  1LT5 D;  1X9N A;  1ZM9 A;  1PTO C;  2BF4 A;  3P27 A;  1S5E D;  2OBS A;  4LW1 A;  2YU9 B;  2VNU D;  1WSV A;  1L1O C;  1V1P B;  5CV7 A;  2I0Q A;  3HKZ B;  3M85 A;  1IYU A;  4LC0 A;  1MSH A;  3ASQ A;  4JW0 A;  1QUF A;  1W3S A;  4H02 A;  1VQI A;  2F4V Q;  3CMA A;  3CC2 A;  3H15 A;  4M1U B;  2K04 A;  3LWU A;  1DDI A;  1WYD A;  4GNX C;  1IBK Q;  1A6X A;  2JA6 H;  3OPO A;  2DN8 A;  1D1K A;  4XM3 A;  1Q9S A;  1TY2 A;  1GUW A;  1TS3 A;  5AN9 A;  1CUK A;  1JWS D;  1KNE A;  2XZP A;  1I6V C;  1V43 A;  1JC7 A;  1HJP A;  1W6J A;  1NAP A;  5CGK A;  3S17 H;  1BLI A;  2F0M A;  4B3M Q;  1T9H A;  4PAB A;  1KRS A;  3FKS A;  4IJL A;  4KLK A;  1EIF A;  1KRH A;  2KCM A;  4KKS A;  3D3R A;  4YCW A;  5M9O A;  1XYI A;  5E7N A;  5D3D A;  3CCM A;  3TRZ A;  4CKC A;  2X6Y A;  4P72 A;  1UD5 A;  2NTS A;  1G6P A;  2CW0 C;  3U6K A;  5M3M B;  4JBJ A;  5F2D A;  4OIK A;  1G51 A;  2V7T A;  1WOP A;  2AUK A;  3MXU A;  4Y9R A;  2JA9 A;  1ENC A;  2R7Z B;  4LNQ A;  1W9X A;  1SRO A;  2NTT A;  4RD6 A;  3U50 C;  3MEH A;  5C44 G;  1GHK A;  3D6C A;  4C56 C;  1SDF A;  5M5Y B;  1YHB A;  4HE5 A;  2NVQ B;  1F2M A;  1N32 Q;  1ILQ A;  4YXW A;  3Q22 A;  1IKM A;  2E2J B;  2D9U A;  1UWV A;  2ZJP A;  3KLR A;  3V2T A;  2SNS A;  2MHV A;  1K83 H;  3KOJ A;  4XNF A;  4M53 A;  3W2F A;  5L46 A;  4OXP A;  4G7Z C;  3E5S A;  3MEF A;  3E9I A;  2EE1 A;  4R9W A;  1QFY A;  2YWH A;  1QVG A;  3CTA A;  2CW0 D;  5FLM G;  4J15 A;  2CBX A;  3HOW G;  2JYO A;  5DNF A;  1II3 A;  1LAC A;  4YEL A;  2A6H C;  4KJO A;  4JI5 Q;  4DR7 Q;  2B63 G;  4NKL A;  5C0X G;  3GDE A;  1RL2 A;  2B29 A;  3BDL A;  3DM1 A;  3OAA A;  4X7F A;  5DEH A;  5I6W A;  3ZC3 A;  2QKI C;  3PGZ A;  3I70 A;  3H09 A;  1B4O A;  3HOZ H;  3HOU H;  3R3O A;  2D0O A;  3J80 L;  5I2X A;  4HCS A;  4A3K G;  2B2U C;  5JJK A;  1K3R A;  3FKI B;  4DN4 M;  2RSN A;  4LJZ C;  1YI2 A;  1HNX L;  1RDP D;  1VF7 A;  4JYA Q;  2O4X A;  1SRU A;  1YIT B;  4R1J A;  2PI2 E;  5FOB B;  5HUR A;  1W0K A;  4XLC A;  2F52 A;  1E7Z A;  1RCV D;  5CV4 A;  4GS3 A;  4BY1 B;  1JE4 A;  1OB0 A;  4UP8 A;  3T16 A;  2LS0 1;  3T1H L;  1DON A;  1FD7 D;  3JQR A;  1YIJ B;  4LF9 L;  2MPM A;  3ZPN A;  4Q7J B;  5IP9 G;  4X66 Q;  2FMM A;  4ULL A;  1HTP A;  4DV2 L;  2CVR A;  1ICW A;  3T1Y Q;  4LF6 L;  4C3I G;  1K8M A;  3NSW A;  3GTJ B;  3OTO Q;  2EZV A;  1WD1 A;  1IKL A;  2ID0 A;  1S72 A;  1JOO A;  1J8I A;  1SYC A;  2K75 A;  2K5H A;  5A89 A;  1X54 A;  3J7A 5;  4ZCM A;  1ZM2 A;  1O7I A;  1NJI C;  3AVX A;  2UUC Q;  2RA4 A;  3FEW X;  4RM0 A;  1SEB D;  3UDG A;  3BNW A;  2G9H D;  1RKN A;  4KTA A;  4B3S Q;  4V19 0;  5JVG 3;  3SK4 A;  4UZU A;  2XOK A;  1PH1 A;  3E1Y E;  3GTJ H;  1G29 1;  3S16 B;  3CC4 B;  4GQN A;  5J22 A;  4C0S A;  2PQA A;  4CGY B;  1SXT A;  3ASS A;  2ZJQ A;  4DR4 Q;  2JJ1 A;  2BE5 D;  1ONL A;  5F4J A;  3OOC A;  2B2U A;  3PO3 H;  4BBR B;  3PA2 A;  1QGZ A;  3KEW A;  2EYM A;  2B63 H;  1KXL A;  3H9N A;  1RHP A;  2SOB A;  1FDR A;  1K8O A;  4KN7 C;  3OHX C;  2BPO A;  4N9P A;  4QFM A;  1KDA A;  3NUC A;  4FXU A;  3SLN A;  1GJR A;  2K6A A;  5AJ3 Q;  4YAW A;  1PFS A;  2ZIT A;  2LXJ A;  2RHQ B;  3VYS A;  3B82 A;  3J7Z C;  1VQK B;  2C9O A;  3CD6 A;  1L0W A;  2V7U A;  4DR7 L;  4HR7 B;  4OWW B;  3VR2 A;  1U5K A;  4X62 Q;  4A3I H;  2ZZF A;  5IOD A;  3W5O A;  2LXK A;  1EYG A;  3ASR A;  1ENF A;  1VQN B;  4AQY Q;  5HKK A;  2R7D A;  3BVM A;  5GAD C;  2DOG A;  2CC2 A;  1AH9 A;  2QEX B;  3I4M H;  2X8K A;  1KJZ A;  1N0V C;  1W34 A;  3T56 B;  1YI2 B;  4JI6 Q;  4UDU C;  2OBR A;  1EQR A;  1Y0R A;  3LGJ A;  5JOB A;  4B48 A;  4Y52 H;  3GTK B;  1KLG D;  4DR5 Q;  3LO8 A;  5KGU A;  4EGV A;  1SYG A;  3GTQ H;  1WCM B;  4DU9 A;  1PYW D;  1ILP A;  2Q8R E;  4DR1 L;  3U58 A;  4P6Y A;  1B1Z A;  1GXD C;  5LMU Q;  3WNC A;  1UEB A;  2K03 A;  4WJW A;  3G71 A;  2DEU A;  4IUU A;  1KK0 A;  1FNV A;  1UD3 A;  2K5V A;  2AUJ D;  3ITP A;  1FNB A;  3CC7 A;  1EQT A;  2NVY B;  1T5X D;  4IUP A;  3S14 B;  2O5J C;  4RDK A;  1TWA H;  1SFO B;  1SBB B;  1GUN A;  3P75 A;  4NDX A;  5C3X A;  2GVA A;  1AFP A;  1BQQ T;  3BQJ A;  2I46 A;  1YNJ D;  4ZUI A;  1Q81 D;  3H0G B;  4A3B B;  1STE A;  1YZ6 A;  5IYP A;  1JIC A;  1I7P A;  4OPO A;  2F0N A;  3CQZ H;  1IZ6 A;  3CES A;  2B8G A;  2A68 C;  1LO5 D;  4K5X A;  4MTK A;  4IOA A;  4DV1 Q;  2ES2 A;  2JE6 I;  3CKI B;  3ZZT A;  3MVV A;  1FVI A;  3NTI A;  3M4O B;  2NVQ H;  1YVC A;  3C3L A;  1E2W A;  3A3B A;  3H0G G;  4A3B G;  4OO1 I;  1CSQ A;  3VNU A;  1J5E L;  5FO7 B;  4B3R Q;  4E6I A;  1EFC A;  1B8A A;  2F0J A;  1E0B A;  2BOS A;  2JA7 B;  1WOO A;  1LTL A;  4MHE A;  4MTN A;  3HRZ C;  3NEM A;  3PUX A;  1JA0 A;  4B47 A;  1CI3 M;  1V8Q A;  3CRZ A;  4ZCK A;  3A5Z B;  4CHT B;  2EY6 A;  3DMU A;  4XDX A;  3T53 B;  1RJT A;  2X85 A;  5IP9 H;  3F2C A;  4K8I A;  5E4W C;  1F77 A;  3RN2 A;  3K57 A;  1Y8P B;  1IBK L;  4LF6 Q;  1EL0 A;  2BH2 A;  1K8G A;  3DLL A;  1QZH A;  4B08 A;  3I7F A;  5I2Y A;  3AST A;  3HOV H;  1IL2 A;  5LL6 S;  2LKV A;  2E74 C;  3LX0 A;  1NMF A;  2CQA A;  2PO4 A;  3RZO H;  2JK8 A;  2C77 A;  1HTL D;  1G6Z A;  4DQK A;  5BN3 A;  1PV4 A;  5IGD A;  1L2F A;  4HAE A;  4ABN A;  1BO0 A;  4NXN L;  3SK6 A;  2ZXH A;  1L0X B;  3VR3 A;  4EX5 A;  3PF5 A;  1TII D;  1WPC A;  1N33 L;  5EAY A;  4P22 A;  3CCE B;  1ET9 A;  1X3P A;  1AEX A;  2FMC A;  1UNS A;  2DNE A;  2VNJ A;  2RC5 A;  2NUC A;  3EQL C;  3AGQ A;  2IX3 A;  2DY7 A;  1NE3 A;  1R4P B;  3PCO B;  1TS5 A;  1SYF A;  2J4X A;  1UD8 A;  4WZT A;  4U9U A;  2EYF A;  2VQE L;  4DV7 Q;  1VDZ A;  3EBE A;  1IHM A;  4A3K H;  3ONU A;  2QW7 A;  5K36 G;  1EY4 A;  4UP9 A;  1QH0 A;  2OWO A;  1TWC H;  2B7C A;  1N34 L;  3P1H A;  4JOI A;  1HNW L;  3VA7 A;  3EVQ A;  3ZBU A;  4R4Q A;  1N32 L;  3CCJ B;  4ID6 A;  3W1B A;  4ZYS A;  1G7C A;  1NB9 A;  4JCV E;  2DYI A;  4M2L A;  3H3V C;  4BY7 H;  2K4K A;  1N33 Q;  4K5V A;  4JI2 L;  3ZZU A;  4PZ6 A;  5C5L A;  2KCT A;  5IGF A;  1YNJ C;  2JQO A;  2LMC B;  1E1T A;  4DAP A;  5FLM H;  2K32 A;  4IPC A;  2D0P A;  4LUO A;  1YNX A;  3ER0 A;  3F2U A;  4F87 A;  2CF4 A;  2B5O A;  2EXZ A;  2X53 S;  3C1E A;  4DV4 L;  4H9G A;  4MYT A;  2MGS A;  1XFO A;  2RQX A;  4B43 A;  5M3F G;  2JJQ A;  2V7V A;  3BU2 A;  1AE3 A;  3M3Y H;  4O2D A;  3BY2 A;  4PC3 A;  2VY3 A;  4A3M G;  2JA8 H;  1PH6 A;  2WAC A;  5FKA C;  4HIK A;  3WWV A;  1SE4 A;  3GQB A;  1M8A A;  2JN9 A;  2ZM6 Q;  5CC4 A;  3WNB A;  1EIH A;  3K5O A;  4FF2 A;  1ZM4 A;  1EFU A;  1VQG A;  3UDF A;  2A8V A;  4PMB A;  1KLU D;  4HID A;  1H9R A;  1HPC A;  1H9M A;  5ELN A;  5A2Q E;  4XQF A;  1KD1 C;  3D4D A;  4QHY A;  2NVT H;  2J0T D;  4NPS A;  1HA6 A;  3M7N A;  1JOR A;  1UE1 A;  3GVJ A;  2F3I A;  3W5V A;  1ESR A;  2WB1 G;  2OYN A;  4LMQ D;  2VB2 X;  4CDE C;  5TV2 A;  1PJ7 A;  3CP2 A;  2EQS A;  2R92 H;  3SLD A;  3CU7 A;  2BV3 A;  3P7J A;  1S72 B;  1AIP A;  5LMZ A;  1QG7 A;  4DV2 Q;  3A7L A;  3T1Y L;  4C3H G;  2N88 A;  3NBI A;  4Y7N H;  3D6W A;  2C78 A;  2WR8 A;  4RGN A;  3T13 A;  3HOX G;  1YJ9 A;  1CTM A;  1YBY A;  4AYB E;  1G7S A;  4HMI A;  4KHV A;  3H6M A;  3AVV A;  1BCP F;  1VLO A;  3PO2 B;  4OOV A;  2BA0 A;  5EBC A;  1AZQ A;  1CKM A;  4A3D H;  1EEI D;  1FL0 A;  2JDI A;  2I1L A;  1HH2 P;  3CME B;  5COR A;  1TVX A;  5LL6 X;  2A5H A;  2D5D A;  4L5Q A;  1HR0 W;  5CDF A;  2A6E D;  4MZ9 A;  2UXB L;  1SMY C;  3GSI A;  4RDL A;  3JAM E;  4ZV4 A;  2OBT A;  3EIV A;  5CYU A;  3AGP A;  4A3K B;  2IWH A;  4B44 A;  3J81 j;  2B2Y C;  4A4I A;  5IWA Q;  3A8K E;  3C2P A;  4LF4 Q;  1NNX A;  5I9P A;  3Q6Q A;  2CWP A;  4P75 A;  1N0U A;  2K5D A;  3TP7 A;  4JK1 C;  1BCP C;  1LTI D;  2XRQ D;  3W5H A;  1KDC A;  3TS2 A;  1EY6 A;  3BDO A;  4U68 A;  5T1G A;  4Y7C A;  3OZV A;  2DJG C;  2VZA A;  1XPO A;  4A3D G;  4A3M B;  3BDC A;  4XKV A;  2NZO A;  2BN4 A;  2AQ3 B;  2XIW A;  3JAM i;  1BKB A;  2UUB L;  4A3E B;  2EIX A;  1QVC A;  3M9B A;  4NW2 A;  3NWS A;  4N8X 1;  3CRL C;  3HOX H;  1X65 A;  2PNR C;  2QEJ C;  2G5D A;  5IWA L;  4XOT A;  1DYQ A;  3J80 i;  4NXN Q;  4N3N A;  2I07 B;  2VL6 A;  5FJ8 H;  3M7G A;  2WB1 B;  3BVG A;  3MFG A;  5DN6 A;  2ASB A;  1P16 A;  2UXC L;  2NBF A;  3ZIA A;  2NVX H;  3I72 A;  1IYJ B;  2JA7 H;  4LUV A;  2EY2 A;  3ERQ A;  4BBR G;  1Q1B A;  3K7U C;  3HOU G;  3I4M G;  4QQB X;  1G8Z D;  2PMD A;  3HEJ A;  3A56 A;  1VQ6 A;  3CD6 B;  1VQJ A;  2KHS A;  2Z4I A;  3ICE A;  1MGS A;  3F1Z A;  5M3F H;  1TWH H;  4XLF A;  2I5M X;  1KDB A;  3DUZ A;  1S5C D;  4G57 A;  4PMW A;  3CCQ B;  4OOS A;  1WFQ A;  2NN6 H;  4JG2 A;  1MD2 D;  1MJE A;  3J80 c;  4DR3 L;  3GVL A;  1Y1W B;  3MWY W;  1WTR A;  1XMO L;  1PH2 A;  4QUC A;  1HRJ A;  1VQ6 B;  1DOK A;  1TWA B;  1SFO H;  3GTP B;  3E0E A;  1VQK A;  2Z8L A;  4TSS A;  5GV8 A;  4A3D B;  5K36 H;  1N05 A;  1TWF B;  4YCU A;  1B9N A;  5I4D A;  1HNW Q;  2A1A A;  1PH9 A;  1JCK B;  1SM4 A;  4P26 A;  1E3X A;  4GN4 B;  1EYC A;  1PJ6 A;  4Y7N B;  1X55 A;  4IUT A;  1HQM C;  1I3Q B;  1R9T B;  2XTI A;  3TP6 A;  2A69 D;  5HXB A;  2BCO A;  3KF6 A;  4OGQ C;  4XT3 B;  1YJW B;  4AC9 A;  3D8G A;  2HDM A;  3AB9 A;  3AYH B;  3GTK H;  2VYQ A;  1STH A;  3TBI B;  1M90 C;  3ASP A;  4B3T L;  1E63 A;  1N36 Q;  4KY5 A;  2VBS A;  1IW7 D;  3DM3 A;  2E2I B;  3CCU B;  5TRD A;  2RVL A;  2KOL A;  4J1M A;  4RD3 A;  4X64 Q;  1SYD A;  3N52 A;  1COW A;  4JI8 Q;  2JIZ A;  2DJF C;  2KBN A;  1Q81 C;  2EJF C;  3B8H A;  4QB4 A;  3LQE A;  1YJN B;  1JWU D;  2ZXP A;  1VQ8 A;  1B70 B;  4IN3 A;  3MXN B;  1L1O A;  4DK3 C;  2QTZ A;  1KAB A;  5C4X G;  3OJX A;  4CKB A;  1B53 A;  1KIX A;  3I4N H;  4DAV A;  4FXD A;  5CV5 A;  3OW2 B;  2AWN A;  1K28 A;  3MA2 B;  3OW7 A;  1U2R A;  3R93 A;  1MIU A;  4TRD A;  1TT2 A;  2L12 A;  3A3G A;  4IUN A;  3PUZ A;  4PNY A;  5JPN C;  3AVT A;  4I7A A;  5KEE A;  4A3L H;  3NXW A;  4X65 L;  4Z4R A;  2XRS D;  5IGG A;  4X7D A;  4QJF A;  5IP7 H;  2OQ0 A;  4OO1 H;  3PSI A;  1EY9 A;  5C4X B;  4DAM A;  3MCA A;  4XMY A;  2JA5 H;  2PPB C;  4BY7 B;  3WXM A;  4LF5 Q;  3VYT A;  2F0O A;  3S16 H;  1BPL A;  2ZXR A;  2GVB A;  2O2L D;  2ALY B;  5IT9 E;  1K3B C;  3CCU A;  1FJG L;  2KEN A;  2VNI A;  3ZJY C;  1OB5 A;  1OO9 B;  2A73 B;  4P3Y A;  1PA6 A;  5C44 B;  3C1F A;  3NE5 B;  1JOK A;  4JI4 Q;  5M5X H;  2V7X A;  5A88 A;  4KD3 A;  4A3F H;  3FPP A;  1BDO A;  4A76 A;  5IGB A;  4YCV A;  4WJ4 A;  4LBY A;  1MHW C;  4A93 G;  4TKO B;  2GN5 A;  4Q5V A;  2F4N A;  4LF9 Q;  5EJW A;  5DM7 3;  2VJJ A;  3G6E A;  4GKK L;  5EBD A;  3KYH C;  2NV4 A;  3RZD H;  3CXC A;  2MUY A;  1Q8I A;  2L0C A;  1Q82 C;  3JQQ A;  4RG1 A;  3FRP B;  1Q7Y C;  1FJG Q;  4A93 H;  4M0L A;  4JYA L;  1DJR D;  1X3G A;  1HZA A;  4FF4 A;  1Y0Y A;  3BZD B;  3W2I A;  3I55 B;  4LUZ A;  3HG9 A;  1NY4 A;  4XLE A;  5BSY A;  4C2M H;  3A1P A;  1Y14 B;  1OGJ A;  3S1N B;  1I94 L;  4G5G A;  2ZTE A;  2QDL A;  4DR2 Q;  4L8J A;  1PRT C;  3A7A B;  2F0U A;  1JJ2 B;  4UAJ A;  3G4S A;  1VQ7 A;  1JR0 D;  1HFG A;  1DGS A;  4IUV A;  2F1L A;  1ICF B;  3UDX A;  1PZI D;  5DLQ E;  2JA6 G;  4A3G H;  3WND A;  1A2T A;  4QVA A;  2WJY A;  3J7Y W;  3I56 A;  1V0F A;  4A3F G;  4ROX A;  1PVO A;  4A3L G;  4BA1 I;  1A0I A;  1H8H A;  1G7T A;  4CQJ A;  1XNR L;  4YAL A;  3AQQ A;  2C5B A;  3W3A A;  5TSS A;  1K83 B;  4K0K Q;  1U9R A;  1V5V A;  5J1Z A;  2RC6 A;  4C3I B;  2PW7 A;  2OQK A;  3RD4 A;  3F8T A;  3MXP A;  3QE2 A;  4TMZ A;  2VQF L;  1CKN A;  2CRV A;  3J81 E;  5JEA G;  4ZLT F;  1OTC A;  4NB3 A;  5IYC G;  3T1H Q;  4P2C B;  4PG3 A;  3PO3 G;  1G91 A;  1CNF A;  4CDF C;  3CRK C;  5IGE A;  4U67 3;  4XN3 A;  5ELF A;  1PFM A;  2EYH A;  4UAI A;  5EQ0 A;  1DD2 A;  4FF3 A;  2PE3 A;  1WTO A;  2WPD A;  1K28 D;  1I5F A;  2D9R A;  3M4Y A;  1LT6 D;  1VCI A;  3ZBT A;  3F2D A;  3PUV A;  4UZE A;  1QFZ A;  1VQA A;  3KF6 B;  4DV3 Q;  4GKJ Q;  1GAW A;  3CMM A;  3OE7 A;  4F7D A;  3E6Z X;  3TSS A;  1ROD A;  3WDN A;  1WI5 A;  4RCY A;  3Q38 A;  2EYJ A;  1HNZ L;  1E64 A;  4WRD A;  4NXM L;  3ZYY X;  3S17 B;  3E0J A;  4L63 B;  4ZGN B;  3GIR A;  1B23 P;  1SR3 A;  1GUO A;  2WYR A;  3I4L A;  3WOE A;  1KTV A;  4XLH A;  1DXM A;  1VMC A;  3X3M A;  4C3I H;  1EIY B;  1R5B A;  3STB C;  2N78 A;  1GUS A;  3NPP A;  5HGT A;  3D4W A;  1JB9 A;  4R8I A;  5LMN L;  4GOP B;  3PUN A;  1OXX K;  3HOZ G;  4X3K A;  1MI2 A;  4P6V F;  5KIX A;  2IX1 A;  3I4M B;  1HUM A;  1BBX C;  2F0T A;  5AJ3 L;  1HNZ Q;  3DWP A;  4O0A A;  4NXM Q;  5BR8 Q;  2D3L A;  5KW9 A;  5E4X A;  4KI0 A;  1TUI A;  4YWM A;  2KEE A;  4YIJ A;  5I9O A;  3BS1 A;  3K80 C;  2VBU A;  4Z4U A;  2MQH A;  4RJL A;  1ZUN B;  3S1N H;  1VMP A;  2MP1 A;  4LBZ A;  1S3O A;  5IT9 c;  4L6T B;  2R6G A;  3DWA A;  1E62 A;  2OF1 A;  4RCN A;  1VQP A;  4KV6 A;  3E3X A;  4XOP A;  4ZUJ A;  4Y9U A;  2JA5 B;  1PDQ A;  1OHH A;  3AVY A;  3SJZ A;  1PMR A;  2FFK B;  5GRO A;  2AKW B;  5C0X J;  4A93 B;  3VR5 A;  4X7C A;  2BE5 C;  3PO3 B;  3MAQ A;  1FX0 A;  1FNW A;  2A74 C;  5M3M G;  4HJ5 A;  3KBX A;  1NR2 A;  2VXW A;  1Y1V B;  3QIA A;  1H9S A;  4QIW E;  2VBV A;  5BR8 L;  1KNA A;  4PC6 A;  1YLO A;  3NBH B;  2XZO A;  2WB1 E;  1CA5 A;  3ULP A;  3PF4 A;  1NBW A;  1VQP B;  4HED A;  5F4M A;  2RSO A;  4DV0 Q;  3OP1 A;  2PMZ E;  3CPX A;  2JEB I;  1JE5 A;  3QFT A;  4GN5 A;  3NQI A;  2E2H B;  2V7W A;  1IYV A;  4RHR A;  3QJY A;  4C3J H;  1LT3 D;  1RQP A;  1TWG B;  2RKS A;  2MNA A;  1BF4 A;  5FO9 B;  1EZ8 A;  2L9H A;  2AHO A;  1I94 Q;  2KVO A;  2OT2 A;  3J81 i;  3QOL A;  1XXG A;  2QA4 A;  2F0S A;  3VA5 A;  1VQ9 B;  2PYK A;  3AU7 A;  4IZ8 A;  1CA6 A;  4PC7 A;  4UHV A;  4HN7 A;  1Y1W G;  5IYD H;  1SYB A;  2Z6K A;  1B2R A;  3HGB A;  4LF8 L;  4NNJ A;  1XPR A;  2V7Q A;  3HKS A;  4HMJ A;  3HAG A;  1KD1 D;  1I4Q A;  1MSG A;  4DK6 C;  3CC4 A;  1RTO A;  2M2L A;  1BCP B;  1FR3 A;  1H95 A;  3W2D A;  1QX4 A;  3KF8 A;  4K1X A;  2HDN B;  1XWE A;  2RBM A;  2D3N A;  3VO2 A;  4KKT A;  4K0K L;  3PUY A;  2NN6 I;  4B3R L;  1QIL A;  3L7Z C;  2KEC A;  4GOP C;  2QN6 A;  3CCL B;  3CAM A;  3QOJ A;  1ASY A;  1UMK A;  2VNK A;  1XJV A;  2QMU A;  1D8L A;  5JAV A;  5TR9 A;  3VMF A;  4GLX A;  1W6K A;  4POG A;  1KZL A;  5JPM C;  4O42 A;  2NYZ D;  3TRE A;  2E2I H;  3RLN A;  1E1O A;  3I73 A;  1S5D D;  1ZYR D;  3SEB A;  4FYD A;  1FND A;  4Z4Y A;  1CHP D;  2E8G A;  3J81 c;  5EKI A;  1VJS A;  3GTL H;  1YHQ A;  4TN1 A;  4IPD A;  2QCP X;  1LYL A;  3PIO A;  4IW3 B;  5H5J A;  3BCF A;  4L5T A;  1EWH A;  5DAU A;  1MJC A;  1CFM A;  2P5Z X;  4AYB G;  1VQM A;  3I4N G;  2A68 D;  5IYD G;  4DV3 L;  4ACA A;  3DHQ A;  3GTM B;  2N3S A;  4LF5 L;  1QUQ A;  3GTG H;  4LFA L;  3K7A B;  1UAP A;  4J8Q A;  5HGQ A;  2OTL A;  4Z4T A;  1JQY D;  4KJN A;  1TR5 A;  1GUT A;  3CME A;  3KF8 B;  3HOY B;  2R61 A;  3R2I A;  4TMW A;  1HR0 Q;  1K9M D;  1EY0 A;  4JPB W;  2HCC A;  2RF4 A;  1NB0 A;  2AWO A;  5D65 A;  5FO8 B;  4A3J B;  3PEN A;  1AZP A;  4FF1 A;  1FYC A;  1I6H B;  1RIP A;  5G3L D;  2V1C C;  3FPU B;  4C3J G;  2O5I C;  2F43 A;  2C4T A;  2F3V A;  1D2E A;  3D26 A;  2BVN A;  2XGJ A;  1EP3 B;  2SDF A;  4B9X A;  1EFR A;  4WZE A;  1VQ9 A;  1VQF A;  3GP7 A;  5IYN A;  2SNM A;  4QUF A;  2I5H A;  2QA4 B;  1Y1W H;  4FO2 A;  1IJF A;  3FHW A;  1QVG B;  4JOI C;  2XND A;  1HVX A;  4II3 A;  4BPR A;  1XNR Q;  4LFA Q;  2ZM6 L;  3OJW A;  2PIA A;  4QVJ A;  3L9A X;  2MO0 A;  4UY8 C;  5LMU L;  2B2V A;  3S24 A;  2VQF Q;  4A3E H;  1FNM A;  5M3F B;  1E79 A;  2YWG A;  2IL8 A;  2WZP P;  4A3M H;  4BY7 G;  2H4O A;  4IFD G;  3CCJ A;  2B2V C;  2UU9 L;  2UXB Q;  1Q82 D;  1GKH A;  1H9S B;  2PNH A;  1FRN A;  2ZZG A;  3G6E B;  3KDF A;  1AN8 A;  4PMC A;  2RCF A;  4DV4 Q;  2NVX B;  1I4X A;  2VBT A;  1JA1 A;  1CQF A;  4B3F X;  3LNN A;  4I7Z C;  4GZY C;  1H85 A;  4JVZ A;  2HMA A;  1NJI D;  1B44 D;  1WCM G;  1HUN A;  2DGY A;  4B9W A;  4JV5 L;  1E22 A;  2QF7 A;  3SK8 A;  3PUM A;  2EY5 A;  5HZB A;  2L15 A;  1D5Z C;  3SHL A;  5IE8 A;  1VQB A;  3T51 B;  1A3U A;  4DR6 Q;  3ISX A;  4IPH A;  1IBL L;  4TMV A;  4K2L A;  1NMG A;  1CZG A;  1WJJ A;  1XMQ L;  4A3E G;  2F0D A;  1PH8 A;  4GNX B;  3HOX B;  5C4J B;  4XXE A;  2OEO A;  1IXR A;  3B6Y A;  1DAR A;  1YNN D;  3A35 A;  3MMP A;  4RHS A;  2OTL B;  2DUD A;  3BH4 A;  4RD4 A;  1EY5 A;  1HZE A;  4RD0 A;  1STG A;  2HDL A;  4F88 A;  1EQQ A;  1J5E Q;  4ZK9 B;  3CMA B;  2FHT A;  3K7A H;  5CR3 A;  4DGZ A;  2RDF A;  3HOV G;  2FX3 A;  2LSS A;  3K5L A;  4JI5 L;  3S1M B;  4P2N A;  4DV6 Q;  4RKL A;  3K6O A;  2VUM G;  2VJI A;  2N8N A;  3GTL B;  3WBJ A;  3HS0 C;  2GRE A;  3KJO A;  5IYB H;  3L0O A;  4OEL B;  2XZL A;  1TU2 B;  4DUY Q;  4A3C G;  1XMQ Q;  4F7X A;  3CPF A;  4EQP A;  5H1S E;  1QB5 D;  5A8A A;  2NB0 A;  4HJ9 A;  1WTW A;  1S4Z A;  4IJH A;  4HIM A;  4AIM A;  4PAA A;  1X32 A;  4HCE A;  3CCL A;  3J7A F;  2X0K A;  3AVW A;  1HQR D;  3SE0 A;  1UUP A;  5ISR A;  2KCN A;  1KL9 A;  2BSA A;  3CP0 A;  4XYO A;  4P25 A;  4YAU A;  4BY1 G;  3SGI A;  1VQL B;  1CNE A;  2R7Z G;  2PQE A;  1ZXT A;  4IAL A;  3M3Y B;  3HP3 A;  1S40 A;  1VQM B;  3OIQ A;  2UXC Q;  3PO2 H;  4FDB A;  4GOP A;  2N49 A;  4RH6 A;  4YHH L;  3P26 A;  4NMZ A;  1I18 A;  5IIF A;  4UP7 A;  2Y0S E;  3BG3 A;  1NDH A;  1PYS B;  1E2V A;  4DNT B;  4WZK A;  1GVH A;  4DV0 L;  1ELO A;  2R92 B;  1F20 A;  5C0X H;  2CW5 A;  4XON A;  2UU9 Q;  4X6A H;  3PV0 A;  3RLF A;  2CWA A;  2XSC A;  3TP5 A;  5A2Q L;  2UUB Q;  1EIG A;  2UUC L;  4JI6 L;  3QB3 A;  4BBS G;  2QE7 A;  4HSV A;  4IQZ A;  3ND8 A;  2R93 H;  2RDH A;  1BVS A;  5M5W H;  1IBM L;  1X6O A;  4B3M L;  3ONY A;  2L4N A;  1TWG H;  1I4H A;  4APV A;  1LTR D;  4OP7 A;  1D5M C;  3PVD A;  1A62 A;  1XB2 A;  1RTN A;  2E2H H;  1ZEQ X;  1PRT F;  3WQZ A;  4WZL A;  2D74 A;  3U9S A;  4QV2 A;  5IYQ A;  1QCB D;  1EU4 A;  4B4D A;  3J81 k;  1CK1 A;  1B2T A;  4X66 L;  5IOC A;  2G9D A;  3FVQ A;  3FKI G;  1N8R C;  3JQP A;  4DXF A;  1VQO B;  2QEX A;  4Z4S A;  1PKV A;  3E9H A;  3A8J E;  4CJ2 C;  1OXV A;  3VDY A;  3ND9 A;  2AHO B;  2PZU A;  2E5L Q;  1IBM Q;  2BM0 A;  1CZW A;  4TMX A;  3URY A;  1C9O A;  4Q0F A;  5I6Y A;  4LFC L;  4JI7 L;  4GLV B;  3U9O A;  2JA8 G;  4WOR A;  3I56 B;  4XLA A;  4PZ8 A;  1EFW A;  4AF6 A;  2Z9H A;  2ZJR A;  1Q90 A;  1EFT A;  4PGO A;  4C43 A;  3GO5 A;  3R6J A;  1WDT A;  1P8L A;  4DR3 Q;  4FNF A;  1ZKO A;  5FO1 A;  4DUZ L;  2PCF B;  3G7L A;  1NSN S;  2IW3 A;  2CKZ B;  2QDB A;  1SNQ A;  4TMT A;  1F9Q A;  3QFC A;  1JWM D;  1SJH D;  3STB D;  4FXK C;  1QZG A;  1HA5 A;  1VHE A;  3S2D H;  4OO1 G;  1UE6 A;  3K5N A;  2OK8 A;  1ZM3 A;  1R5N A;  4A3I G;  2ZL6 A;  1M4V A;  2E1B A;  5BN4 A;  3HZX A;  4X7E A;  1KK2 A;  4LFC Q;  3CCR B;  3OZW A;  1J6Q A;  1ET6 A;  2F0E A;  2BMW A;  3A8J A;  3ZUG A;  3I55 A;  2ATW A;  2JXM B;  3I8Z A;  3MXG A;  4QCL A;  1LUZ A;  4IOC A;  1QNK A;  1KC8 C;  1QJO A;  4OON A;  3M4O H;  1T5E A;  1PFB A;  3EN2 A;  2DER A;  2D62 A;  1V9P A;  1WP6 A;  4O1N A;  4ASU A;  1BJK A;  3Q3A A;  3HKZ G;  4RMF A;  1Q1E A;  5D14 A;  4EQ5 A;  4ACB A;  4XYQ A;  3Q8D A;  2I5L X;  4QL5 A;  5JVH 3;  1WTH A;  2Z1C A;  3EA6 A;  2IY5 B;  3FP9 A;  3MC0 B;  1V0E A;  1PTO D;  1Q8K A;  2PW5 A;  4YAF A;  5M5X B;  1UD6 A;  1ENA A;  1TXY A;  1BX1 A;  1W35 A;  1U0L A;  5FO0 A;  2PMZ B;  2M00 A;  4DNI A;  3KBG A;  3TP8 A;  2YTY A;  1A3V A;  2F0V A;  2OCE A;  1UE7 A;  1WTP A;  1LTB D;  4OPV A;  3F2B A;  1A15 A;  1X56 A;  3KUP A;  1N36 L;  4IFD I;  1GUG A;  3NEN A;  1Y1V G;  3SJP A;  1W2B A;  2CH4 A;  4R8N A;  2Q2U A;  5C4X H;  4WJ3 M;  2ICI A;  4XQJ A;  4JI1 Q;  3W1G A;  4EQN A;  1FGU A;  4P9S A;  1CKN B;  2EVB A;  3SXH A;  1MAB A;  3LWE A;  1CSP A;  2HUG A;  3CCS B;  3H3V H;  2XNC A;  4R4T A;  5E6T A;  1F2L A;  2XGT A;  1XTD A;  1LTS D;  1HFN A;  2VQE Q;  4DV7 L;  2NWG A;  3Q6S A;  2X6G A;  1GHJ A;  5A35 A;  1JB7 A;  2K1B A;  1VLY A;  1O80 A;  3AEV A;  4A3C H;  1J9Z A;  3Q0A A;  4YHB A;  1VF5 C;  3S15 B;  4II2 A;  1K0R A;  4YHH Q;  1VQH A;  1VQC A;  2YV5 A;  3I4N B;  3CQZ B;  2PI2 A;  1KK3 A;  2F1M A;  3B78 A;  1KHI A;  3IFT A;  3U2Q A;  2OXP A;  4C3H B;  4NP5 A;  3W2G A;  2KQ3 A;  5F4O A;  4TSF A;  3CPW A;  5NUC A;  5IYC H;  1XE1 A;  3H0G H;  3CF5 A;  4A3B H;  5JEA H;  1JJ2 A;  2XNJ A;  1I50 H;  2L1B A;  3U4Z A;  2Q6I A;  4JI0 L;  2R93 B;  2A6E C;  3P20 A;  3TEH B;  3JAM c;  1G2T A;  4NBS A;  5FA6 A;  4ZKC B;  4FWT A;  2DNC A;  1Y8N B;  3CCR A;  4JC0 A;  3S14 H;  2BDN A;  4XOR A;  3A0J A;  2B7B A;  3RN5 A;  2VNH A;  5JBQ A;  1N06 A;  4ZCI A;  1K0S A;  4C2M B;  1B50 A;  2Y0S G;  3S2H B;  1OXT A;  3GVK A;  4DV6 L;  1HHV A;  2GJR A;  4B3S L;  4BBR H;  3HOW H;  3TZD A;  3TME A;  3GTQ B;  3RZD B;  3L2P A;  4JMQ A;  1E2Z A;  4DV1 L;  3V7A A;  1N07 A;  5C4J H;  3J81 L;  1AW7 A;  3JU4 A;  4DAY B;  4JBW A;  2YWF A;  3NP8 A;  4X65 Q;  1GOZ A;  2D2C C;  4K6L A;  4UZF A;  1H8E A;  5DS0 A;  5C6A A;  1FGB D;  3RLO A;  1Z6H A;  1N9W A;  2E2D C;  1K73 C;  1BR9 A;  4GN3 B;  2HQE A;  5C44 H;  3W2E A;  1GJX A;  1XTC D;  4DA2 A;  2Q6K A;  2ZTD A;  1F2Y A;  4FXG C;  4OL7 A;  1SSO A;  3RR5 A;  3GV3 A;  4DXG A;  1LM0 A;  3TS0 A;  3G48 A;  5EKK A;  4DF7 A;  3HOY G;  3KLS A;  3CCQ A;  2EJG C;  1ML0 D;  2NZ1 D;  4RWS C;  4KHP Q;  4RD1 A;  1FRQ A;  5CBE E;  1STA A;  2RCN A;  3G05 A;  2XN9 C;  2A19 A;  5C4Z A;  2HHH L;  4G6I A;  4XQN A;  3SR1 A;  2F0K A;  2KVM A;  5K5P A;  5C4H A;  4DUY L;  2OK7 A;  1STN A;  4G1B A;  1SNO A;  3S1Q H;  2XWB B;  2YTX A;  4QGU A;  5DSZ A;  1H42 A;  3PA1 A;  4Z4Z A;  4GKK Q;  4JI8 L;  3I3C A;  5KRU A;  3FKI H;  2F4I A;  3MHP A;  2FXQ A;  3SEJ A;  4IUR A;  1B3A A;  3WY9 A;  1Y8O B;  1K8A D;  4QF4 A;  2QTL A;  4Z1M A;  1YJN A;  4JBK A;  4L5R C;  3KK7 A;  3AMU A;  2WKC A;  3AFP A;  4RCZ A;  3UDI A;  2RDG A;  3HOZ B;  4X05 A;  4RCO A;  3MFY A;  1X3Q A;  4FN5 A;  2HHH Q;  3UI2 A;  4TVA B;  2KED A;  4LF8 Q;  1D7Q A;  1I6H H;  2HCJ B;  4A3J H;  4JI3 Q;  1DOM A;  3CHB D;  5J3B A;  3J80 E;  2M9V A;  1PFN A;  3I2Z A;  4EVO A;  3A54 A;  2EY1 A;  4A75 A;  1YJW A;  3KLS X;  4FVM A;  4KY6 A;  3NQT A;  1BBW A;  1NBM A;  2Q8I B;  4BY1 H;  2VW9 A;  1F9R A;  3OW2 A;  1AMO A;  1PZK D;  1KMH A;  3GTG B;  1VQ5 A;  4LF7 Q;  1EUJ A;  3OWE B;  3JC6 6;  1SND A;  2HLD A;  3QSY A;  3K0Y A;  4LFB Q;  1WTQ A;  3OSO A;  1AP0 A;  4UPA A;  3CW2 C;  1TQO A;  4K2K A;  2CFM A;  1QUE A;  1DOL A;  3DEO A;  4M1K A;  4CJ1 B;  2H5X A;  2HCI A;  2YYZ A;  3I90 A;  4WFN 3;  1I4R A;  3OIP A;  4ZGQ B;  2R7Z H;  2K7V A;  2Q6L A;  4HJA A;  4V0B A;  2R92 G;  4Z4V A;  1EXM A;  2E75 C;  5LMN Q;  1NRK A;  5C3W A;  1SKQ A;  1A2U A;  1Z9F A;  1BXT A;  3OEE A;  3SKB A;  2L55 A;  1BQE A;  4XN0 A;  1KQS B;  2K50 A;  3K59 A;  5ELO A;  1E1Q A;  4POF A;  4GNX A;  2K5Q A;  4P74 A;  3X3N A;  4CBV A;  2L5T A;  4PV1 C;  4RKB A;  1ESF A;  5B6I A;  1C48 A;  2WKD A;  1HR0 L;  2Z0S A;  4G7W A;  4RGO S;  4ZAI A;  4AVZ A;  4DK1 A;  2EYO A;  3WYA A;  1B3Q A;  2ZTG A;  4YWK A;  1BMF A;  3MTS A;  3OKX A;  2L11 A;  3Q23 A;  4F8M A;  2HT1 A;  2BDO A;  5T1I A;  2ZBU A;  2R3Z A;  5KNL A;  4J6H A;  1WTH D;  4ILW A;  5GAG C;  1EU3 A;  3BYT B;  4KN4 C;  2SEB D;  4DNR B;  1Q46 A;  1VQN A;  1MRZ A;  1PTO H;  1B7Y B;  2EIF A;  4K14 A;  3ERO A;  3BY1 A;  1N08 A;  3QFR A;  5ELE A;  3SDZ A;  1QGA A;  4YY3 Q;  2MFI A;  2CK3 A;  2GK7 A;  3S9W A;  1QG0 A;  1Q86 D;  1BUV T;  1W0J A;  2ZXO A;  1SE3 A;  4RLZ A;  3FJO A;  2NZH A;  1WD0 A;  3UE1 A;  1E3Z A;  2WZN A;  2IPK D;  1F9S A;  3L3O C;  1WOC A;  4RA8 A;  1CM9 A;  3OWF A;  5CV9 A;  1RQR A;  1UE5 A;  5GQO A;  2Z6K C;  4X8I A;  4BBS B;  5D3I B;  1D1N A;  5E1F A;  5EPJ A;  5TY0 A;  2CH4 W;  2ZZE A;  4QMG A;  5ELB A;  2KCC A;  2XWJ B;  1UD4 A;  1H9K A;  1I4G A;  2DIE A;  3CCE A;  2JA6 B;  4MYU A;  3A8K A;  1YNN C;  1OB2 A;  3S1R B;  4IFD H;  2EYL A;  1WVL A;  4JI2 Q;  2OTJ A;  3MZ5 A;  4KKU A;  2KHI A;  2PLF A;  4HE6 A;  2PQA B;  1EQV A;  4YAO A;  1WTV A;  4I65 A;  4IO9 A;  1L0Y B;  1C0A A;  4OOX A;  3ULL A;  3E20 A;  2JJ2 A;  2JP1 A;  1PLF A;  1LT4 D;  1T6X A;  1MKH A;  1Q3L A;  3CCS A;  2YU9 H;  1EYD A;  2JSO A;  1QVF A;  1PH5 A;  4HJ8 A;  1QGY A;  2V4D A;  4QIW B;  5KNC A;  3VO1 A;  2GK6 A;  2WIN B;  1PRT B;  4E0F A;  2VB3 X;  5IT9 L;  2F0I A;  1E43 A;  1EP2 B;  1YHQ B;  4C1N K;  1JMC A;  1JJG A;  3HFZ B;  2YTV A;  1HA3 A;  1TS4 A;  4RPD A;  1Y1V H;  2X6W A;  5FL7 A;  5HY6 A;  1X3F A;  3HOW B;  2C4U A;  1A3T A;  2EXD A;  4EQO A;  4CDD C;  4HIZ A;  1VQ4 B;  4R4C A;  5KND A;  3BZC A;  4BBS H;  4G7O C;  3BVZ A;  4H7B A;  4G4K A;  2GQF A;  4JI4 L;  3RZO B;  3DXJ C;  1YX2 A;  2ICE C;  1YIT A;  2FJ2 A;  3HOV B;  3W5U A;  1U4L A;  2ZZQ A;  3OYY A;  3WBK A;  4XKW A;  5FNZ A;  3BZK A;  5EGT A;  4CJ0 B;  4AQY L;  5BSX A;  1IBL Q;  1EYA A;  2F03 A;  2FIN B;  3NK9 A;  2UXD L;  1EOT A;  4OWT B;  1Y69 U;  1CT1 D;  1STY A;  4WWV A;  5J39 A;  4LF7 L;  2WJV A;  2EFG A;  3D0F A;  2W6I A;  1OGI A;  2WAQ E;  1M1K C;  1S5B D;  1PTO B;  1SLJ A;  4HIO A;  3DDY A;  1LAB A;  3A74 A;  2Q8T A;  3V96 A;  2B2T A;  2F0G A;  3PO2 G;  4KK7 A;  2OTJ B;  5IY0 A;  4C3H H;  3QG1 A;  4LAA A;  2Q6O A;  1F9P A;  1D2B A;  2X3U A;  1U4P A;  2DET A;  1UEA B;  5G3L F;  2J7K A;  4YEJ A;  1IB0 A;  2P3M A;  3TDQ A;  2HD3 A;  3NHH A;  5C5M A;  1CKO A;  4JI3 L;  1QWY A;  1JJC B;  4G1V A;  1TY0 A;  3CC7 B;  1PXU A;  1RF2 D;  1SMX A;  1V1Q A;  1HNX Q;  1VQD A;  4C1N I;  2JN4 A;  2E76 C;  4G7H C;  2CQO A;  5LMN W;  1C4Q A;  3NTK A;  5GV7 A;  3BYY B;  1KAA A;  4IPG A;  3Q6R A;  5ELD A;  2EDG A;  2B2W A;  1GVP A;  5JJZ A;  4DPG A;  1S5F D;  4X62 L;  3GTO H;  3VNV A;  1UD2 A;  1VQO A;  1WSR A;  1H9J A;  4B3T Q;  1F2Z A;  1Z47 A;  5CBA E;  2F0H A;  1TWC B;  1XNQ Q;  4RFB A;  1EY8 A;  2GPJ A;  4K8J A;  3OTO L;  2DCU A;  5KYL A;  4Z4W A;  2JEA I;  5CMD A;  1EWY A;  1HZC A;  1NCV A;  3GD7 A;  4DR6 L;  2K52 A;  1E1R A;  1OXS C;  4ME3 A;  1GO3 E;  2E5L L;  3FPK A;  2EYP A;  2IX0 A;  5AFW A;  4R71 A;  5FLX E;  3EFX D;  4HTH A;  1SNP A;  2WP8 J;  3NWT A;  4N3G A;  1SAP A;  5CV6 A;  5FK9 C;  4P1V A;  1S0U A;  4DV5 L;  4WQM A;  1WCM H;  1SNC A;  1OXU A;  1K9M C;  5L37 A;  2R93 G;  2Z6B D;  3NBH A;  2IT1 A;  3PMF A;  4HJ7 A;  4NCN A;  4XL9 A;  4AF7 A;  4A3G B;  1T6Y A;  3D31 A;  3ERS X;  2K33 A;  4TT3 A;  2AQ2 B;  3G6J B;  1VS0 A;  3V76 A;  4DUZ Q;  3W2H A;  4RPB A;  2K05 A;  4FK8 A;  1CHQ D;  1SKY B;  3AFQ A;  5JEA J;  5C3E H;  4A3F B;  1FNC A;  2WV6 D;  2Y0S B;  4P71 A;  1VQE A;  2J7Z A;  2MJ8 A;  3K81 C;  4TQU S;  4OWX B;  4N8F A;  5LHY 1;  4BXX G;  4RGT A;  4OIJ A;  2WII B;  3ES9 A;  1N8R D;  4XD7 A;  4ALP A;  1Q12 A;  4B3G A;  4H13 C;  4MIU A;  4RD2 A;  1XQB A;  1VQL A;  2VZL A;  3U6B A;  1FNU A;  1O7Z A;  1X3E A;  1C8C A;  3M4Q A;  4BWG B;  1M1K D;  4YY3 L;  3S1Q B;  3I1F A;  1PJ5 A;  4IFD J;  2M5S A;  1BX0 A;  2K01 A;  1BBU A;  2C2W A;  1EFI D;  1PHJ A;  4RGM A;  3A8I E;  4DR4 L;  1F60 A;  2KJX A;  1CQV A;  3NTH A;  1NR4 A;  4P12 A;  1N34 Q;  3J7A V;  2B39 A;  1IHZ A;  1KK1 A;  4X07 A;  4DR1 Q;  2X69 A;  3NEL A;  4JBM A;  2KUM A;  4OX9 Q;  3SK5 A;  2VUM H;  1EWI A;  1R5O A;  5IYW A;  3EJI A;  1DZ1 A;  1YEZ A;  2A69 C;  2LFN A;  3N6R A;  2K28 A;  4N9T A;  1VQ5 B;  2HIX A;  5JJI A;  5M5W B;  2GJK A;  2V31 A;  1V1O A;  5GAE C;  2ZT9 C;  2C5C A;  1SNM A;  2IHE A;  2ZXI A;  3KJP A;  2NVY H;  4X64 L;  3VR4 A;  4ZRZ A;  5IGC A;  4BXX H;  1YJ9 B;  3G71 B;  2AMC B;  4R4O A;  2XNA C;  4L5S A;  4A3G G;  2GA4 B;  4EH1 A;  2K14 A;  1XPU A;  1QNU A;  3A8I A;  2QGQ A;  3G4S B;  2WFW A;  3GV6 A;  3BC9 A;  1U4R A;  2BA1 A;  3IFD A;  4X06 A;  3S2H H;  2TSS A;  2F0F A;  1PRT D;  3FMC A;  3OMG A;  4P73 A;  4DV5 Q;  3I4O A;  2NN6 G;  1TWF H;  4H0L C;  3DEP A;  3KLW A;  4M8A A;  3H3V I;  4Z9C B;  1TS2 A;  5IYR A;  3UE0 A;  2ZTN A;  3GTP H;  1PZJ D;  3H94 A;  3HOU B;  2F0P A;  1PYB A;  2QDX A;  1J9O A;  2A6H D;  2DY8 A;  2MO1 A;  1GR1 A;  2X6L A;  3O13 A;  2QIL A;  2ENB A;  3DWQ A;  4YWL A;  3Q39 A;  1D8T A;  2VS1 A;  1I50 B;  5C0X I;  4A3I B;  1GM5 A;  1GD7 A;  3QR8 A;  4DAY A;  1DDG A;  3PIO 3;  3Q24 A;  4DK0 A;  1SMY D;  1EEF D;  2UUA L;  5KYI A;  4MNO A;  1A8V A;  1IL8 A;  3A5U A;  5COY A;  4R4I A;  1NTG A;  1R4Q B;  1Q86 C;  3S15 H;  2F0L A;  1XNQ L;  3CCM B;  2ZL7 A;  1LTG D;  3S1M H;  1I3Q H;  1R9T H;  3KDF B;  5EPK A;  1TWH B;  3U4V A;  2QGG A;  2E2J H;  3A55 A;  2W6J A;  1D1I A;  1HXY D;  3VYU A;  2B63 B;  3OEH A;  4LBV A;  1D5X C;  5M5Y H;  5E3F A;  2N55 A;  2UXD Q;  2LY7 A; 
#chains in the Genus database with same CATH homology
 2GJP A;  1D6E C;  5FLX L;  4KY7 A;  3RMH A;  3R8B A;  2TMP A;  3C46 A;  4X3T A;  1I4P A;  2IJ0 A;  3IKJ A;  3VYR A;  5CV8 A;  1I8D A;  2B2T C;  4RAU C;  2VUM B;  3VR6 A;  1PTO F;  2EPB A;  1BCP D;  2B2W C;  2K5W A;  2LZJ A;  3CP8 A;  2PZT A;  3OFN A;  2F0W A;  1LV9 A;  4HSP A;  4H44 C;  4DFA A;  1LTA D;  3RUZ A;  1XX8 A;  4KHZ A;  3IL8 A;  3MHB A;  3S2D B;  1B9M A;  5EPL A;  3OMC A;  3PIP 3;  4FP5 D;  1LLR D;  1V1P A;  5C3E B;  5DM6 3;  4K6D A;  3GTO B;  1QOH A;  1SJE D;  1U4M A;  3R2T A;  4XTC S;  3D4R A;  3TN2 A;  3K58 A;  4KMU C;  4ME5 A;  4XT1 B;  4ODG A;  1HCZ A;  3I91 A;  4LK1 C;  3IAY A;  4K5W A;  1BOS A;  3H91 A;  1WTX A;  1O7Y A;  3TZU A;  4XR6 A;  2F0Q A;  5BN5 A;  3V05 A;  2WSS A;  4XQQ A;  4CKE A;  2B2Y A;  3PUW A;  1EZ6 A;  1Z7T A;  2KA7 A;  3WOF A;  1MBY A;  1G2S A;  1EWC A;  5KNB A;  2Z4H A;  1SE2 A;  4ZKB B;  1JB3 A;  3BCD A;  1O7L A;  2F3W A;  3SVM A;  5ELC A;  3T4A C;  4BA2 I;  1JOQ A;  2B8F A;  2EJM A;  2NVT B;  1RD9 D;  5IK2 A;  2PZW A;  1ZYR C;  2R9V A;  2H1E A;  1SYE A;  2XVS A;  1STB A;  3QO2 A;  4MN3 A;  2CHB D;  4C3J B;  1LTT D;  4X3S A;  2JA8 B;  3ONA B;  3MXN A;  1BNZ A;  3QWN A;  3FDT A;  1KTK A;  2EOT A;  4X3U A;  4S3S A;  1EY7 A;  4IUQ A;  5EKL A;  1DM0 B;  3JAM L;  4G7X A;  1DCZ A;  2AQ1 B;  2X6X A;  4XIG S;  1QE6 A;  1IW7 C;  4KD4 A;  1TKW B;  4PQX A;  3K5M A;  4ZQ3 A;  1NUC A;  4OHJ A;  4AYB B;  4BS9 A;  2WAQ B;  1O78 A;  1LT5 D;  1PTO C;  1S5E D;  2YU9 B;  2VNU D;  1V1P B;  5CV7 A;  3HKZ B;  3M85 A;  1IYU A;  1MSH A;  4M1U B;  2K04 A;  3LWU A;  1A6X A;  3OPO A;  2DN8 A;  1D1K A;  4XM3 A;  1TY2 A;  1GUW A;  1TS3 A;  1JWS D;  1KNE A;  2XZP A;  1I6V C;  1V43 A;  1JC7 A;  1W6J A;  1NAP A;  5CGK A;  1BLI A;  2F0M A;  3FKS A;  4KKS A;  3D3R A;  5M9O A;  1XYI A;  5D3D A;  4CKC A;  2X6Y A;  1UD5 A;  2NTS A;  2CW0 C;  5M3M B;  5F2D A;  4OIK A;  3MXU A;  2R7Z B;  2AUK A;  1ENC A;  1W9X A;  2NTT A;  3MEH A;  3D6C A;  4C56 C;  1SDF A;  5M5Y B;  2NVQ B;  1F2M A;  1ILQ A;  4YXW A;  3Q22 A;  1IKM A;  2E2J B;  2D9U A;  3KLR A;  3V2T A;  2SNS A;  2MHV A;  4XNF A;  4G7Z C;  3E5S A;  4R9W A;  2EE1 A;  2CW0 D;  2JYO A;  5DNF A;  1II3 A;  1LAC A;  4YEL A;  2A6H C;  4KJO A;  4NKL A;  5C0X G;  3BDL A;  3DM1 A;  3OAA A;  5DEH A;  5I6W A;  2QKI C;  3I70 A;  3H09 A;  1B4O A;  3R3O A;  3J80 L;  5I2X A;  4HCS A;  2B2U C;  3FKI B;  4DN4 M;  2RSN A;  4LJZ C;  1RDP D;  1VF7 A;  2O4X A;  5HUR A;  5FOB B;  1W0K A;  4XLC A;  1RCV D;  5CV4 A;  4BY1 B;  1JE4 A;  1OB0 A;  3T16 A;  2LS0 1;  1DON A;  1FD7 D;  2MPM A;  3ZPN A;  2FMM A;  4ULL A;  1HTP A;  2CVR A;  1ICW A;  4C3I G;  1K8M A;  3NSW A;  3GTJ B;  2EZV A;  1WD1 A;  1IKL A;  2ID0 A;  1J8I A;  1JOO A;  1SYC A;  2RA4 A;  3FEW X;  1SEB D;  2G9H D;  4KTA A;  1RKN A;  4V19 0;  5JVG 3;  3SK4 A;  4UZU A;  2XOK A;  1G29 1;  3S16 B;  4GQN A;  5J22 A;  4CGY B;  1SXT A;  2JJ1 A;  2BE5 D;  1ONL A;  3OOC A;  2B2U A;  4BBR B;  3KEW A;  2EYM A;  1RHP A;  2SOB A;  1K8O A;  4KN7 C;  3OHX C;  4N9P A;  3NUC A;  1KDA A;  4FXU A;  2K6A A;  3VYS A;  2C9O A;  4HR7 B;  3VR2 A;  2ZZF A;  5IOD A;  1ENF A;  5HKK A;  3BVM A;  2X8K A;  3T56 B;  4UDU C;  5JOB A;  3GTK B;  1KLG D;  5KGU A;  4EGV A;  1SYG A;  1WCM B;  4DU9 A;  1PYW D;  1ILP A;  2Q8R E;  1B1Z A;  1GXD C;  2K03 A;  4WJW A;  4IUU A;  1FNV A;  1UD3 A;  2AUJ D;  3ITP A;  1EQT A;  4IUP A;  2NVY B;  1T5X D;  3S14 B;  2O5J C;  1SFO B;  1SBB B;  1GUN A;  3P75 A;  4NDX A;  5C3X A;  1AFP A;  1BQQ T;  2I46 A;  1YNJ D;  4ZUI A;  3H0G B;  4A3B B;  1STE A;  1JIC A;  2F0N A;  3CES A;  2B8G A;  2A68 C;  1LO5 D;  4K5X A;  2JE6 I;  3CKI B;  3MVV A;  3NTI A;  3M4O B;  3C3L A;  1E2W A;  3A3B A;  4OO1 I;  5FO7 B;  4E6I A;  2F0J A;  1E0B A;  2BOS A;  2JA7 B;  4MHE A;  3HRZ C;  3PUX A;  1CI3 M;  1V8Q A;  4CHT B;  2EY6 A;  3DMU A;  4XDX A;  3T53 B;  1RJT A;  2X85 A;  4K8I A;  5E4W C;  1F77 A;  3K57 A;  1Y8P B;  1EL0 A;  4B08 A;  5I2Y A;  5LL6 S;  2LKV A;  2E74 C;  3LX0 A;  2CQA A;  2PO4 A;  1HTL D;  1G6Z A;  5BN3 A;  5IGD A;  4HAE A;  4ABN A;  1BO0 A;  3SK6 A;  2ZXH A;  1L0X B;  3VR3 A;  1TII D;  1WPC A;  4P22 A;  1ET9 A;  1X3P A;  1AEX A;  2FMC A;  1UNS A;  2DNE A;  2NUC A;  3EQL C;  2IX3 A;  2DY7 A;  1R4P B;  1TS5 A;  1SYF A;  2J4X A;  1UD8 A;  2EYF A;  1VDZ A;  5K36 G;  1EY4 A;  3P1H A;  3VA7 A;  3EVQ A;  4ID6 A;  4ZYS A;  3H3V C;  4K5V A;  5C5L A;  5IGF A;  1YNJ C;  2LMC B;  4DAP A;  2K32 A;  3F2U A;  4F87 A;  2EXZ A;  2X53 S;  3C1E A;  2RQX A;  2MGS A;  2WAC A;  5FKA C;  1SE4 A;  3GQB A;  1M8A A;  5CC4 A;  1EIH A;  3K5O A;  4FF2 A;  4PMB A;  1KLU D;  1H9R A;  1HPC A;  1H9M A;  5A2Q E;  4XQF A;  3D4D A;  2J0T D;  1HA6 A;  3M7N A;  1JOR A;  3GVJ A;  1ESR A;  4LMQ D;  2VB2 X;  3CP2 A;  3CU7 A;  3P7J A;  1QG7 A;  3A7L A;  4C3H G;  2N88 A;  3NBI A;  3D6W A;  4RGN A;  3T13 A;  1CTM A;  4HMI A;  4KHV A;  3H6M A;  1BCP F;  3PO2 B;  2BA0 A;  5EBC A;  1AZQ A;  1EEI D;  2JDI A;  5COR A;  1TVX A;  5LL6 X;  2A5H A;  2D5D A;  5CDF A;  2A6E D;  1SMY C;  3JAM E;  5CYU A;  4A3K B;  2IWH A;  2B2Y C;  3A8K E;  3C2P A;  5I9P A;  2K5D A;  3TP7 A;  4JK1 C;  1BCP C;  1LTI D;  2XRQ D;  1KDC A;  1EY6 A;  3BDO A;  4U68 A;  5T1G A;  4A3M B;  3BDC A;  4XKV A;  2AQ3 B;  2XIW A;  4A3E B;  4NW2 A;  3NWS A;  3CRL C;  2PNR C;  2QEJ C;  1DYQ A;  4XOT A;  2I07 B;  3M7G A;  2WB1 B;  3BVG A;  3MFG A;  5DN6 A;  2NBF A;  3ZIA A;  3I72 A;  2EY2 A;  3ERQ A;  1Q1B A;  1G8Z D;  3HEJ A;  3A56 A;  2KHS A;  2Z4I A;  1MGS A;  4XLF A;  1KDB A;  3DUZ A;  1S5C D;  4G57 A;  4PMW A;  2NN6 H;  1MD2 D;  3GVL A;  1Y1W B;  3MWY W;  1WTR A;  4QUC A;  1HRJ A;  1DOK A;  1TWA B;  3GTP B;  2Z8L A;  4TSS A;  4A3D B;  5K36 H;  1TWF B;  1B9N A;  5I4D A;  1JCK B;  1E3X A;  1EYC A;  4Y7N B;  4IUT A;  1HQM C;  1I3Q B;  1R9T B;  3TP6 A;  2A69 D;  2BCO A;  4OGQ C;  4XT3 B;  3D8G A;  2HDM A;  3AB9 A;  1STH A;  3TBI B;  4KY5 A;  1IW7 D;  2E2I B;  2RVL A;  4J1M A;  2KOL A;  1SYD A;  3N52 A;  1COW A;  2JIZ A;  2EJF C;  4QB4 A;  1JWU D;  2ZXP A;  4IN3 A;  1KAB A;  4CKB A;  1B53 A;  4DAV A;  4FXD A;  5CV5 A;  2AWN A;  3R93 A;  3MA2 B;  3OW7 A;  4TRD A;  1TT2 A;  2L12 A;  3A3G A;  4IUN A;  3PUZ A;  4PNY A;  5JPN C;  5KEE A;  3NXW A;  2XRS D;  5IGG A;  4OO1 H;  1EY9 A;  5C4X B;  4XMY A;  2PPB C;  4BY7 B;  3VYT A;  2F0O A;  1BPL A;  2ZXR A;  2O2L D;  5IT9 E;  1OO9 B;  2A73 B;  5C44 B;  3C1F A;  3NE5 B;  1JOK A;  4KD3 A;  3FPP A;  1BDO A;  5IGB A;  4TKO B;  4Q5V A;  5EJW A;  5DM7 3;  2VJJ A;  5EBD A;  2MUY A;  1Q8I A;  2L0C A;  3FRP B;  1DJR D;  4FF4 A;  3BZD B;  3HG9 A;  4XLE A;  3S1N B;  4L8J A;  1PRT C;  3A7A B;  2F0U A;  1JR0 D;  1HFG A;  4IUV A;  1PZI D;  1A2T A;  2WJY A;  3J7Y W;  1V0F A;  4BA1 I;  1H8H A;  3W3A A;  5TSS A;  1K83 B;  1U9R A;  5J1Z A;  4C3I B;  2PW7 A;  3RD4 A;  3MXP A;  3J81 E;  5JEA G;  4ZLT F;  4P2C B;  1G91 A;  5IGE A;  3CRK C;  4U67 3;  4XN3 A;  5ELF A;  1PFM A;  2EYH A;  4UAI A;  5EQ0 A;  1DD2 A;  4FF3 A;  1WTO A;  2WPD A;  1K28 D;  3M4Y A;  1LT6 D;  1VCI A;  3PUV A;  3CMM A;  3OE7 A;  3E6Z X;  3TSS A;  1ROD A;  3WDN A;  2EYJ A;  4WRD A;  3ZYY X;  3S17 B;  3E0J A;  4L63 B;  1GUO A;  3I4L A;  3WOE A;  4XLH A;  1DXM A;  1VMC A;  3X3M A;  1GUS A;  3NPP A;  5HGT A;  3D4W A;  4R8I A;  1OXX K;  4X3K A;  1MI2 A;  5KIX A;  2IX1 A;  3I4M B;  1HUM A;  1BBX C;  2F0T A;  3DWP A;  2D3L A;  5E4X A;  4KI0 A;  2KEE A;  4YIJ A;  5I9O A;  3BS1 A;  1VMP A;  2MP1 A;  4L6T B;  2R6G A;  3DWA A;  2OF1 A;  4RCN A;  4KV6 A;  2JA5 B;  4XOP A;  4ZUJ A;  1PDQ A;  1OHH A;  1PMR A;  2FFK B;  5C0X J;  4A93 B;  3VR5 A;  2BE5 C;  3PO3 B;  3MAQ A;  1FX0 A;  1FNW A;  2A74 C;  3KBX A;  1NR2 A;  2VXW A;  1Y1V B;  3QIA A;  1H9S A;  3J7A F;  1KNA A;  2XZO A;  1CA5 A;  4HED A;  2RSO A;  2JEB I;  2E2H B;  3NQI A;  1IYV A;  4RHR A;  3QJY A;  1LT3 D;  2RKS A;  1TWG B;  1BF4 A;  5FO9 B;  1EZ8 A;  2L9H A;  2KVO A;  2OT2 A;  3QOL A;  1XXG A;  2F0S A;  3VA5 A;  2PYK A;  3AU7 A;  4IZ8 A;  1CA6 A;  4HN7 A;  1SYB A;  3HGB A;  4NNJ A;  2V7Q A;  4HMJ A;  3HAG A;  1I4Q A;  1MSG A;  1RTO A;  2M2L A;  1BCP B;  1FR3 A;  3W2D A;  3KF8 A;  1XWE A;  2RBM A;  2D3N A;  4KKT A;  3PUY A;  2NN6 I;  1QIL A;  3L7Z C;  2KEC A;  3QOJ A;  5JAV A;  1W6K A;  1KZL A;  5JPM C;  4O42 A;  2NYZ D;  3SEB A;  1S5D D;  1ZYR D;  3I73 A;  4FYD A;  1CHP D;  5EKI A;  1VJS A;  2QCP X;  5DAU A;  3BCF A;  1GHK A;  1EWH A;  1CFM A;  2A68 D;  3DHQ A;  3GTM B;  3K7A B;  1UAP A;  4J8Q A;  1JQY D;  4KJN A;  1TR5 A;  1GUT A;  3HOY B;  2R61 A;  3R2I A;  1EY0 A;  2HCC A;  5FO8 B;  2AWO A;  5D65 A;  4A3J B;  4FF1 A;  1AZP A;  1I6H B;  1FYC A;  5G3L D;  4C3J G;  3FPU B;  2O5I C;  2F43 A;  2F3V A;  4B9X A;  2XGJ A;  2SDF A;  1EFR A;  3GP7 A;  2SNM A;  4QUF A;  4FO2 A;  2XND A;  1HVX A;  4II3 A;  3L9A X;  2B2V A;  5M3F B;  1E79 A;  2IL8 A;  2WZP P;  2H4O A;  4IFD G;  2B2V C;  1H9S B;  2ZZG A;  4PMC A;  1AN8 A;  2NVX B;  1I4X A;  1CQF A;  4B3F X;  3LNN A;  4I7Z C;  4GZY C;  1HUN A;  1B44 D;  4B9W A;  2QF7 A;  3SK8 A;  2EY5 A;  1D5Z C;  3SHL A;  3T51 B;  1A3U A;  4K2L A;  1CZG A;  2F0D A;  3HOX B;  5C4J B;  4XXE A;  2OEO A;  1YNN D;  3A35 A;  4RHS A;  3BH4 A;  1EY5 A;  1HZE A;  2HDL A;  1STG A;  4F88 A;  4ZK9 B;  2FHT A;  5CR3 A;  4DGZ A;  2RDF A;  3K5L A;  3S1M B;  4RKL A;  3K6O A;  2VJI A;  3GTL B;  3HS0 C;  2XZL A;  1TU2 B;  4F7X A;  4EQP A;  1QB5 D;  2NB0 A;  1WTW A;  1S4Z A;  1X32 A;  4HCE A;  1HQR D;  3SE0 A;  1UUP A;  5ISR A;  2KCN A;  4XYO A;  2PQE A;  1ZXT A;  4IAL A;  3M3Y B;  3HP3 A;  3OIQ A;  4RH6 A;  4NMZ A;  1I18 A;  5IIF A;  3BG3 A;  1E2V A;  4DNT B;  2R92 B;  5C0X H;  4XON A;  3PV0 A;  3RLF A;  2XSC A;  3TP5 A;  5A2Q L;  1EIG A;  3QB3 A;  2QE7 A;  4HSV A;  4IQZ A;  3ND8 A;  2RDH A;  2L4N A;  1I4H A;  1LTR D;  1D5M C;  1RTN A;  1ZEQ X;  1PRT F;  3WQZ A;  3U9S A;  1QCB D;  1EU4 A;  1CK1 A;  1B2T A;  5IOC A;  2G9D A;  3FVQ A;  4DXF A;  1PKV A;  4CJ2 C;  3A8J E;  1OXV A;  3ND9 A;  2PZU A;  1CZW A;  3URY A;  4Q0F A;  5I6Y A;  3U9O A;  4WOR A;  4XLA A;  1Q90 A;  3GO5 A;  4FNF A;  1ZKO A;  2PCF B;  3G7L A;  1NSN S;  2IW3 A;  2QDB A;  1F9Q A;  1SNQ A;  1JWM D;  1SJH D;  4FXK C;  1HA5 A;  4OO1 G;  3K5N A;  1M4V A;  2E1B A;  5BN4 A;  3HZX A;  1ET6 A;  2F0E A;  2JXM B;  3I8Z A;  3MXG A;  4QCL A;  1QNK A;  1QJO A;  1T5E A;  1PFB A;  2D62 A;  4O1N A;  1WP6 A;  4ASU A;  5D14 A;  1Q1E A;  4XYQ A;  5JVH 3;  2Z1C A;  3EA6 A;  3MC0 B;  1V0E A;  1PTO D;  2PW5 A;  5M5X B;  1UD6 A;  1ENA A;  2PMZ B;  2M00 A;  3KBG A;  3TP8 A;  1A3V A;  2F0V A;  1WTP A;  1LTB D;  1A15 A;  3KUP A;  4IFD I;  1GUG A;  4R8N A;  2ICI A;  4XQJ A;  4EQN A;  2EVB A;  3SXH A;  1MAB A;  3LWE A;  2HUG A;  1F2L A;  1HFN A;  1LTS D;  2NWG A;  3Q6S A;  2X6G A;  1GHJ A;  5A35 A;  2K1B A;  1VLY A;  1O80 A;  3Q0A A;  1VF5 C;  3S15 B;  4II2 A;  3I4N B;  3CQZ B;  2F1M A;  3IFT A;  2OXP A;  4C3H B;  4NP5 A;  2KQ3 A;  4TSF A;  5NUC A;  5JEA H;  2L1B A;  2R93 B;  2A6E C;  3P20 A;  1G2T A;  4ZKC B;  2DNC A;  1Y8N B;  2BDN A;  4XOR A;  4C2M B;  1B50 A;  3S2H B;  1OXT A;  3GVK A;  1HHV A;  2GJR A;  3TZD A;  3TME A;  3GTQ B;  3RZD B;  4JMQ A;  1E2Z A;  3J81 L;  1AW7 A;  3JU4 A;  4JBW A;  3NP8 A;  1GOZ A;  2D2C C;  4K6L A;  5C6A A;  1H8E A;  1FGB D;  1Z6H A;  2E2D C;  1BR9 A;  2HQE A;  1GJX A;  1XTC D;  4DA2 A;  4FXG C;  1F2Y A;  4OL7 A;  1SSO A;  3GV3 A;  4DXG A;  5EKK A;  4DF7 A;  3KLS A;  2EJG C;  1ML0 D;  2NZ1 D;  4RWS C;  5CBE E;  1STA A;  3G05 A;  2XN9 C;  5C4Z A;  4G6I A;  4XQN A;  3SR1 A;  2F0K A;  2KVM A;  5K5P A;  5C4H A;  1STN A;  1SNO A;  2XWB B;  3I3C A;  5KRU A;  2F4I A;  4IUR A;  1B3A A;  1Y8O B;  4QF4 A;  4Z1M A;  3KK7 A;  3AMU A;  2WKC A;  2RDG A;  3HOZ B;  4RCO A;  3MFY A;  1X3Q A;  3UI2 A;  2KED A;  1DOM A;  3CHB D;  3J80 E;  2M9V A;  1PFN A;  4EVO A;  3A54 A;  2EY1 A;  3KLS X;  4FVM A;  4KY6 A;  3NQT A;  1NBM A;  2Q8I B;  1F9R A;  1PZK D;  1KMH A;  3GTG B;  3OWE B;  1SND A;  2HLD A;  3K0Y A;  1WTQ A;  3OSO A;  1AP0 A;  1TQO A;  4K2K A;  1DOL A;  3DEO A;  4CJ1 B;  2HCI A;  2YYZ A;  3I90 A;  4WFN 3;  1I4R A;  3OIP A;  2K7V A;  4V0B A;  2E75 C;  1NRK A;  5C3W A;  1A2U A;  1BXT A;  3OEE A;  2L55 A;  4XN0 A;  3K59 A;  1E1Q A;  2K5Q A;  3X3N A;  4CBV A;  2L5T A;  4PV1 C;  4RKB A;  1ESF A;  1C48 A;  2WKD A;  4G7W A;  4RGO S;  4ZAI A;  4AVZ A;  4DK1 A;  2EYO A;  2ZTG A;  1BMF A;  3MTS A;  2L11 A;  3Q23 A;  4F8M A;  2BDO A;  5T1I A;  2R3Z A;  5KNL A;  4J6H A;  1WTH D;  4ILW A;  1EU3 A;  3BYT B;  4KN4 C;  2SEB D;  4DNR B;  1PTO H;  4K14 A;  3ERO A;  5ELE A;  3SDZ A;  2CK3 A;  2GK7 A;  3S9W A;  1BUV T;  1W0J A;  2ZXO A;  1SE3 A;  1WD0 A;  1E3Z A;  2IPK D;  1F9S A;  3L3O C;  4RA8 A;  1CM9 A;  3OWF A;  5CV9 A;  4BBS B;  5D3I B;  5E1F A;  5EPJ A;  2ZZE A;  4QMG A;  5ELB A;  2KCC A;  2XWJ B;  1UD4 A;  1H9K A;  1I4G A;  2DIE A;  2JA6 B;  1YNN C;  3S1R B;  4IFD H;  2EYL A;  1WVL A;  3MZ5 A;  4KKU A;  1EQV A;  1WTV A;  4I65 A;  1L0Y B;  2JJ2 A;  2JP1 A;  1PLF A;  1LT4 D;  1Q3L A;  1EYD A;  2JSO A;  2V4D A;  4QIW B;  5KNC A;  2GK6 A;  2WIN B;  1PRT B;  4E0F A;  2VB3 X;  5IT9 L;  2F0I A;  1E43 A;  4C1N K;  1TS4 A;  2X6W A;  5FL7 A;  3HOW B;  1A3T A;  4EQO A;  4HIZ A;  5KND A;  4G7O C;  3BVZ A;  4H7B A;  4G4K A;  3RZO B;  3DXJ C;  2ICE C;  2FJ2 A;  3HOV B;  1U4L A;  2ZZQ A;  4XKW A;  5EGT A;  4CJ0 B;  2F03 A;  1EYA A;  2FIN B;  3NK9 A;  1EOT A;  1Y69 U;  1CT1 D;  1STY A;  5J39 A;  2WJV A;  2W6I A;  1S5B D;  1PTO B;  3DDY A;  1LAB A;  2Q8T A;  3V96 A;  2B2T A;  2F0G A;  4KK7 A;  3QG1 A;  4LAA A;  1F9P A;  1D2B A;  1U4P A;  1UEA B;  5G3L F;  4YEJ A;  3TDQ A;  3NHH A;  5C5M A;  1QWY A;  1TY0 A;  1PXU A;  1RF2 D;  4C1N I;  2E76 C;  4G7H C;  1C4Q A;  3NTK A;  3BYY B;  1KAA A;  5ELD A;  2EDG A;  2B2W A;  5JJZ A;  1S5F D;  1UD2 A;  1H9J A;  1F2Z A;  1Z47 A;  5CBA E;  2F0H A;  1TWC B;  4RFB A;  1EY8 A;  4K8J A;  5KYL A;  2JEA I;  5CMD A;  1NCV A;  3GD7 A;  1E1R A;  1OXS C;  2EYP A;  5AFW A;  2IX0 A;  5FLX E;  3EFX D;  4HTH A;  1SNP A;  2WP8 J;  3NWT A;  1SAP A;  5CV6 A;  5FK9 C;  1SNC A;  1OXU A;  2Z6B D;  3NBH A;  2IT1 A;  3PMF A;  4XL9 A;  4A3G B;  3D31 A;  2K33 A;  4TT3 A;  2AQ2 B;  3G6J B;  2K05 A;  1CHQ D;  1SKY B;  5JEA J;  4A3F B;  2WV6 D;  2Y0S B;  2J7Z A;  2MJ8 A;  4TQU S;  5LHY 1;  4RGT A;  4OIJ A;  2WII B;  4XD7 A;  4B3G A;  1Q12 A;  4H13 C;  4MIU A;  1FNU A;  1O7Z A;  1C8C A;  4BWG B;  3S1Q B;  4IFD J;  2M5S A;  2K01 A;  1EFI D;  4RGM A;  3A8I E;  2KJX A;  1CQV A;  3NTH A;  1NR4 A;  3J7A V;  2B39 A;  1IHZ A;  2X69 A;  2KUM A;  3SK5 A;  3EJI A;  1DZ1 A;  2A69 C;  2LFN A;  3N6R A;  2K28 A;  4N9T A;  5M5W B;  2GJK A;  2V31 A;  1V1O A;  2ZT9 C;  2C5C A;  1SNM A;  2ZXI A;  3VR4 A;  4ZRZ A;  5IGC A;  2XNA C;  2GA4 B;  1QNU A;  3GV6 A;  3BC9 A;  1U4R A;  2BA1 A;  3IFD A;  2TSS A;  2F0F A;  1PRT D;  3FMC A;  3OMG A;  2NN6 G;  4H0L C;  3DEP A;  4M8A A;  4Z9C B;  1TS2 A;  2ZTN A;  1PZJ D;  3H94 A;  3HOU B;  2F0P A;  2A6H D;  1J9O A;  2DY8 A;  2X6L A;  3O13 A;  2QIL A;  2ENB A;  3DWQ A;  1I50 B;  5C0X I;  4A3I B;  4DAY A;  3PIO 3;  3Q24 A;  4DK0 A;  1SMY D;  1EEF D;  5KYI A;  1IL8 A;  5COY A;  1R4Q B;  2F0L A;  1LTG D;  5EPK A;  1TWH B;  3A55 A;  3VYU A;  2W6J A;  1D1I A;  1HXY D;  2B63 B;  3OEH A;  1D5X C;  5E3F A;  2N55 A;  2LY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...