3FPPA

Crystal structure of e.coli maca
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
266
structure length
266
Chain Sequence
b'PGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTQAVSQQDLDNAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPGQKAWFTVLGDQLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrolide-specific efflux protein macA
publication title Crystal structure of the periplasmic component of a tripartite macrolide-specific efflux pump
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 52
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3fppA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fppA02
1GJXA 2D2CC 1LABA 3PUZA 3T53B 5JEAG 2DNEA 4G7HC 5JEAH 4H0LC 1VF5C 4JBWA 3PUWA 3I4LA 1TU2B 1IYVA 1A6XA 1K8OA 2NN6G 5A35A 2NN6H 3DXJC 2AWOA 4DK0A 1T5EA 4XIGS 3IFTA 5BN4A 4LJZC 1Y69U 3D31A 1O78A 2B8GA 1OXTA 1E2VA 3BDOA 2PPBC 5KNBA 2KA7A 4TQUS 3SE0A 2IT1A 3VR5A 4KN4C 3VR2A 4G7ZC 2K33A 5K36G 2D5DA 3PV0A 2DNCA 3T56B 1H9RA 3GD7A 3SDZA 5C0XG 3P20A 3VR6A 1IW7D 5C0XH 4GZYC 3NE5B 4KKTA 3ND9A 3N6RA 1CTMA 2EJFC 1Q12A 3BG3A 2BDOA 1CFMA 1GHJA 1O7LA 2R6GA 3AB9A 3VA7A 3QG1A 2O5JC 3PUXA 1G291 5BN5A 2BE5D 3A8JE 2PCFB 1BDOA 1HQMC 1IYUA 1H9SA 2E74C 1ZKOA 4DK1A 1VCIA 3KLRA 2PNRC 4I7ZC 3WDNA 1B9MA 4L8JA 3PUVA 1YNNC 3OW7A 2O5IC 3CRLC 2BE5C 1GUOA 4RCNA 3HGBA 4H44C 1GUTA 3OOCA 1VDZA 2EJGC 4KI0A 1Z6HA 4BA2I 3LWUA 3MXUA 3M4YA 3VR3A 3D4RA 1OXUA 2V4DA 2JE6I 2A69D 3PUYA 2QF7A 1VF7A 2JXMB 1Q1BA 1I6VC 1GUNA 2YYZA 3I72A 2KCCA 2CW0C 4DNRB 1EWHA 3A8IE 2B8FA 4HR7B 3A7LA 2E75C 2Q8IB 1IW7C 1OXXK 1H9KA 2A68D 1Q90A 4OGQC 3M7NA 3A8KE 1GHKA 1GUSA 2D62A 3FMCA 4PV1C 5BN3A 1E2ZA 4IQZA 3LNNA 1E2WA 4H13C 4XTCS 2NN6I 2K32A 3QIAA 1V8QA 1Y8PB 3H94A 1H9MA 3TZUA 3L7ZC 2BA1A 1LACA 2EVBA 3FPPA 2AUJD 1DXMA 3M85A 1HCZA 1SMYC 1Y8NB 2AUKA 2K7VA 1K8MA 1ZYRC 3VR4A 4BA1I 4DNTB 1H9JA 4JK1C 1Y8OB 4KKUA 1OXSC 1Q1EA 1YNJC 2ZT9C 4IFDG 1FR3A 2BA0A 1PMRA 5KNCA 4IFDH 3ND8A 1QJOA 2A69C 1V43A 2A6ED 2L5TA 5KNDA 4OO1G 4KN7C 4OO1H 4KKSA 1OXVA 2JEBI 1TKWB 3OPOA 2LMCB 4KMUC 3CRKC 2A6HD 3RLFA 1DD2A 2JEAI 3T51B 1ONLA 3GQBA 3W3AA 2EJMA 1Z7TA 2A6EC 3A7AB 1B9NA 1HTPA 3QJYA 2DN8A 2A68C 4LK1C 5K36H 4KHZA 3U9SA 2A6HC 1CI3M 4TKOB 1DCZA 1GUGA 1HPCA 2E76C 1FYCA 2F1MA 1H9SB 3IKJA 3I73A 4G7OC 3EQLC 3MFYA 2EDGA
chains in the Genus database with same CATH superfamily
1KQSB 2XWBB 1B8AA 1GVHA 1PJ6A 2WYRA 4PMBA 3LWEA 2OWOA 2R7DA 1YI2A 4ZCMA 5TR9A 4YAFA 3L2PA 1RIPA 4XOPA 1A6XA 5GV8A 1E3ZA 5C44B 3HOYB 2AWOA 1Y69U 3IFTA 5J3OA 3OWEB 2F0JA 2F0SA 1X56A 2I5MX 1VLOA 3EIVA 3K7AH 1QVFA 2R93B 2V7VA 2VBSA 4ZKBB 2XGJA 1QWYA 2IX0A 1X6OA 3GTGB 2HDNB 1TVXA 3BNWA 3PV0A 3VNVA 2C35B 2GREA 5FLMG 1IYVA 2J4XA 3V05A 1G91A 1BX0A 1QGAA 4LFBQ 4FO2A 1G8ZD 2EPBA 1N36Q 4R4QA 4DV6L 4FYDA 2F3WA 3K6OA 2DOGA 2QTZA 3PUNA 1EWCA 5DAUA 1Y1WG 3JC66 2JA8G 1STEA 1YJWA 4JC0A 3WNCA 4A75A 4H44C 4C1NI 1TT2A 1QFZA 1R9TB 3H9NA 2XNAC 1NUCA 3T1HL 4LFAQ 3CCRA 4NCNA 1XTDA 4WORA 3QE2A 1VQ4B 4BPRA 4DAMA 4JI4Q 4N8FA 3OHXC 4X7FA 2NPFA 2QEXB 1ILQA 3H3VI 1C0AA 4RD0A 1IL2A 4HR7B 1SE8A 3WYAA 1HTLD 3M7NA 1VQ8B 3GTOB 4GOPA 1VQEA 1S40A 5G3LD 1VHEA 2VBVA 2BPOA 2WB1G 2PLFA 1E2WA 4XONA 1LTSD 2LXKA 4JI7Q 4XDXA 2LFNA 1LTGD 4N3GA 1EOTA 4YAOA 2I5LX 2UU9L 5BR8Q 1AEXA 1Y14B 2XOKA 1DDIA 4RPBA 2BH8A 2ZJPA 3HOVG 1QG0A 2HMAA 3HOXB 4C1NK 2K7VA 3S14H 4K5VA 3CCEB 4CDFC 2H4OA 2JN9A 4OOXA 4BA1I 1EFWA 3OKXA 3S15H 4P6YA 2HT1A 2K14A 5HXBA 1YJ9B 5C4XH 1JOKA 2A1AA 3TEHB 2CBXA 5C4JB 4DV4Q 3D4WA 4RCYA 2PYKA 3CKIB 4HJAA 2CHBD 2ZXHA 2EJMA 1WORA 3KDFA 3G6EA 1ICWA 3VO2A 2A68C 2K6AA 2RDFA 2A6HC 1WTHA 3HOYG 4OPOA 1HRJA 3G4SA 4BXXH 5IYPA 4DV7Q 1PZJD 3GV6A 1TWCH 3KF8A 1A0IA 2R93G 2D2CC 1EQVA 4B4DA 1LT6D 1QH0A 1VQKB 2MUYA 2VUMH 4XKVA 1LTID 1ENCA 3CF5A 4AQYQ 2MJ8A 4IJLA 4Z4TA 4C43A 2HDMA 5BN4A 1EZ8A 1TS4A 4DQKA 3I4NH 1F9QA 3L9AX 5LMUL 4C3IB 5C0XJ 1OXTA 4QF4A 1K8AD 4ZCKA 3S24A 1M90C 3BS1A 2MHVA 3SE0A 1SE3A 5L46A 3WNDA 3KK7A 3R6KA 5A2QL 3HOUH 4DU9A 3G71A 1Q8KA 2XSCA 2F0FA 1JOQA 1XB2A 1PTOC 2Q6IA 4HSVA 4GZYC 2E2IB 1WI5A 4J15A 4XMYA 3I55B 4P71A 4TN1A 3I3CA 1UD8A 3BYYB 1K0SA 5GAHC 4ZKCB 1W87A 3E6ZX 2PCFB 1W9XA 3HKZB 2X6XA 3AQQA 5B6IA 5LHY1 1GOZA 1B9MA 4ACBA 1WU8A 4PC1A 2CCZA 5JVH3 2NB0A 2PI2A 4P2CB 3HKZE 3KFUA 3Q6RA 3ASSA 1A2UA 5JVG3 3CMEA 3RR5A 4DV3Q 4DR2L 3W2FA 1S5FD 3LWUA 1VQIA 2V4DA 1YLOA 1FNWA 3STBC 2Z1CA 4E6IA 1Q82C 5EPLA 3ONYA 4ASUA 3CPWA 4B3TQ 5TSSA 1DYQA 4G6IA 1I5FA 4UY8C 2AHOA 2N55A 2XIWA 2F0HA 2XNCA 4B43A 2KCTA 5I2XA 4RFBA 1S0UA 1F2LA 1P16A 2X6GA 2XRSD 1FNUA 4XYQA 2D62A 3GTKB 4IFDI 3CCVB 2VQEL 2GJPA 1EY7A 4IO9A 3PGZA 3RZDH 5IYNA 2AMCB 3H94A 1ET9A 4DV0L 2UUCL 2FX3A 4P9SA 4Z1MA 2K03A 4IURA 4CDCC 5LL6S 3FPPA 2L4NA 5ELFA 5IP9H 2PW7A 1OB2A 4UZUA 1MSHA 4IUVA 1CK1A 5JPMC 1SM4A 4J0QA 1SYEA 2PIAA 2W6JA 2V7XA 4AIMA 3MHPA 1YITB 1YNJC 1WCMG 2WACA 3I1FA 4GNXA 4LF6L 3KUPA 3RLFA 2Z6BA 3PO3G 2DY1A 2R6HA 2C4UA 1ZM2A 1UEAB 4LK1C 2V7TA 1PH5A 4K2KA 3E20A 4P3IA 4A3JB 3WBKA 5M5YB 4Y7NH 3OWFA 3W5HA 2KVOA 4Z4UA 1KD1D 1YJNA 3H0GB 2ASBA 2KCNA 5D3DA 5F4MA 1IBKQ 1X3FA 2QE7A 2RDGA 1HNXL 2OT2A 1KC8D 2KJXA 3Q38A 4X62Q 4RAUC 4JBWA 4GKKL 2KVMA 3T4AC 4X3SA 3AYHB 2OK7A 2F4VL 5HKKA 4F7XA 5I9OA 4GKJQ 4XLAA 3I8ZA 2F0KA 2QW7A 4M53A 3VR5A 2PZTA 5FLXc 1UD2A 5CR3A 3HKZG 3QR8A 2RC6A 1Y1VH 1X9NA 1CZWA 2BCOA 1XNQL 4G57A 2PZUA 5E4WC 5F4JA 3T56B 2K01A 1AP0A 3P20A 1BJKA 3HFZB 3NE5B 1FNDA 2F0NA 3BG3A 2KHSA 2WJYA 3S1RH 1K73C 3NTHA 3MMPA 4ZUIA 2BV3A 3CPXA 2RA4A 4WJWA 3RNUA 1EYGA 1DZ1A 1ZKOA 1HR0L 1X3QA 4L6TB 3MEHA 1VQOA 1KQSA 3CCUB 2LSSA 1VQBA 5IYCH 3TP7A 1I7PA 1KDAA 4B3MQ 2JJ2A 5IGFA 2EQSA 4P1VA 2SNSA 4LAAA 3H3VC 4JV5L 5CDFA 1BO0A 1B3QA 1WJJA 1KK1A 2HIVA 3VR3A 3OEEA 4UAJA 3GSIA 1EQTA 2JDIA 4LW1A 1VF7A 4Z4YA 3OTOL 4YELA 2CF4A 1XMOQ 1RJTA 2IJ0A 4P72A 4JI8L 3B6YA 3J80i 4DV2L 2VZAA 4IUNA 5EAYA 1QCBD 4OGQC 1WOCA 1RD9D 4FVMA 1GUSA 3ZC3A 3M4QA 4K1XA 1XXGA 5M3FB 2L15A 3BZCA 5JJIA 3JQPA 5C6AA 4ZCIA 1TXYA 1HUMA 1E3XA 3VYTA 4H02A 4KV6A 4U68A 4DR4Q 2DIEA 5C5MA 4YHBA 1K8MA 1LT3D 1PFMA 2F0PA 4A3MG 4WFN3 3WNBA 4IZ8A 1KTVA 3LQ6A 1OGJA 1QUFA 1BMFA 1SNQA 2BA0A 4HMJA 1PMRA 4H9GA 4OP7A 4A3JG 1VQ4A 1FNMA 4OO1G 3MEFA 4RH6A 4KKSA 2Y0SB 5KIXA 1D6EC 2K05A 3OPOA 4TMWA 2EE1A 1TS2A 2QEXA 4KMUC 1MD2D 3H0GG 1O7YA 1ONLA 2VQFQ 5FO8B 3J80L 4LUVA 4QVAA 2KOLA 2GQFA 1VQJA 1VQ8A 3N52A 4P3YA 4U9UA 1VQMB 3UDIA 4WZEA 2YU9B 2IL8A 1I6HB 2F1MA 1Q7YD 2GVBA 2I1LA 4HSPA 3MFYA 2F0LA 1GO2A 5LMZA 1EOVA 4HCEA 2I0QA 5E4XA 1WTXA 3OSOA 3TMEA 1TU2B 3FDTA 4TMZA 4PABA 1NRKA 2NN6H 1LUZA 3CCEA 1EFRA 2BMWA 3GTLB 4GQNA 3CCLB 3D31A 5HGQA 2BH2A 5IYWA 4IUQA 2EIFA 1NJID 1TWCB 2NUCA 1YJ9A 4FWTA 1TWFB 3GVLA 2E1BA 1ZM3A 2FVGA 3AGPA 1PH6A 5C3EB 2Z9HA 4RKLA 2JK8A 5C0XH 3ZYYX 1MJEA 3MXNB 3ND9A 1CTMA 2YV5A 3TP5A 2L1BA 3I4NB 4GLAC 1O7LA 1E24A 4JI5Q 4M1KA 3KYHC 3M7GA 1JOOA 4QUZA 2OEOA 1BCPB 3S1QH 3UDXA 3NP8A 5A2QE 1OTCA 2CVRA 3CXCA 2R7ZH 2B2UA 3NQIA 4QMGA 5GQOA 5L37A 1VQKA 1YX2A 1ZYRD 1G6ZA 1IBMQ 2LXJA 3DEPA 4FDBA 1EFTA 2Z6KC 2QDBA 2F3IA 2PMZB 2HQLA 5M3FG 4XL9A 3ASRA 3K57A 4CDDC 2NYZD 5M5WB 1PTOH 1KZLA 3AVXA 3NWTA 2B3GA 1PH7A 2MGSA 3I55A 1HR0W 5BN3A 4XTCS 3U50C 1KDBA 2UUBL 2F52A 1X65A 3GP7A 2TSSA 1JE5A 1H9MA 1NR4A 5J1ZA 5IWAL 4YWLA 2Y0SG 3FJOA 1F20A 2Q8RE 4IFDJ 3QFTA 4A3EB 3SJZA 3DMUA 3ZJYC 4DXGA 2WZPP 4LF8L 5HZAA 1STHA 3QB3A 4HE6A 3FHWA 3PO2B 4OEMB 2DERA 1PRTB 1OXSC 4CJ1B 4X06A 4Y52H 4YEJA 1Q81C 5C4XG 5EMNA 4ME5A 5CV9A 1F9RA 1TKWB 3HOZH 4G7XA 4KY7A 4TSFA 5ELCA 5E6TA 1DD2A 1MABA 4K6DA 3CC2B 1Z7TA 4KY6A 1ESRA 1HTPA 2AQ2B 4A3BH 3C1EA 4YCVA 2XGTA 5C5LA 4PMWA 1FJGL 3GTQH 3NHHA 3CCVA 4OOSA 4BXXG 1PRTD 2CC2A 3U9OA 4B48A 4F7DA 3I73A 3IKJA 3CMMA 1JB9A 1S4ZA 2R92B 3E1YE 3T53B 1JB3A 1RDPD 2N3SA 4C3JH 2F03A 2VUMG 3A74A 5EKIA 3TN2A 4CJ0B 3TSSA 4XIGS 4X07A 4TMVA 1PTOF 4N9PA 3I4NG 2A73B 3I90A 4BWGB 2CNDA 1VQFA 3H09A 4DR1L 3J81E 4N8X1 3ZZ0A 3RLNA 1YITA 1M1KC 1C4QA 4XR6A 4WRDA 5JJLA 3NXWA 3DWAA 2D74A 2CW0D 3HOUG 1HFNA 3A5UA 4AYBB 3MVVA 3FKIH 3RN5A 1YHQB 4CJ2C 2E2HB 1WOPA 1VQLB 1UNSA 3J80c 1N08A 1D5ZC 1UD4A 3NBHB 3WOFA 4RA8A 4KKTA 2ZJRA 4DUYL 2XWJB 3N6RA 3OW2B 1STAA 5JOBA 2BDOA 4DR7Q 3JAML 2KBNA 4B3SQ 1I4HA 1JA0A 5E7NA 3VYUA 1R5OA 5IP7G 1HQMC 3D6CA 1F2ZA 4QUFA 1Z47A 3SKBA 3I4MB 1KJZA 1VQCA 4IUPA 5M3MB 4L63B 1STNA 2K5HA 1Q3LA 4CHTB 2KQ3A 1EY8A 2JA7H 3SK6A 2B2YA 3T13A 5IGBA 3M4YA 1STGA 2A74C 2L11A 2E1RA 3GVKA 1MIUA 4DR6L 4UHVA 3G7LA 1CKOA 4A3CH 4YY3Q 1EU4A 2HQEA 3BYTB 5K5PA 3K59A 4GOPC 1K0RA 1ASYA 1K28D 4A3IH 3CP2A 5C4ZA 3NQTA 1K3RA 2Q8IB 1OXXK 3PQIA 4A3EG 4OX9Q 1B53A 2MO1A 3FMCA 1B2TA 4B47A 3GTPH 4Y7CA 4RDKA 2GN5A 2MQHA 3R93A 5IYDG 1WTRA 4TSSA 1Y0RA 2MPMA 3MZ5A 1N07A 4JI1L 1SN8A 5HGTA 5IP9G 3E0EA 3CCUA 3EJIA 3R2IA 4A3DH 4P12A 5HY6A 4DAYB 2WINB 3S17B 1R4PB 3I4OA 1JT8A 4NXMQ 1Y1WB 3R8BA 3B78A 3V96A 1UAPA 3J7A5 2JA8B 1G7RA 2VXWA 1IJFA 3ISXA 4RPDA 3ICEA 4LMQD 2QCPX 1H95A 3EVQA 3L0OA 2RCFA 1FNVA 2O4XA 3BZDB 4X65Q 3CRKC 5GADC 1J5EL 2WZNA 4A3FH 2A6EC 1T6XA 1HA6A 2F0TA 2UUAL 2LY7A 1KK2A 1LV9A 4K8IA 4RD3A 1N34L 1XNRL 2EDGA 3M4OH 1I4QA 1SNMA 2CW5A 1KDCA 1C7YA 2K5QA 4K8JA 4AYBG 2JJQA 4NW2A 4BY1H 5AN9A 1SMXA 4PC6A 1LT4D 3HOVB 4CKBA 4DPGA 2ZTDA 2WPDA 1SXTA 1QE6A 2XN9C 4OWXB 3V7AA 1EQRA 1IHMA 1MI2A 3SLNA 1KRHA 4WZKA 1Y1VG 1JCKB 2QDXA 4X7DA 4K5WA 1DM0B 1EY9A 5CMDA 1PYSB 1UE5A 1PXUA 1CM9A 5M3MG 2X8KA 4PQXA 2DYIA 1CT1D 2D0PA 3RMHA 4DV5L 1GHJA 1VQMA 1I3QH 2O5JC 4RG1A 4JPBW 4ROXA 2I07B 2MNAA 4J6HA 1IYUA 3CW2A 2R7FA 5AJ3L 4RLZA 1VCIA 5KGUA 4IW3B 2V7UA 4PZ8A 4C2MH 3A55A 4PC7A 2O5IC 1HHVA 5IYCG 2PO4A 1GUOA 3UI2A 4YHHL 2ZXPA 3QOLA 4PC2A 4APVA 2K1BA 1W0KA 1JQYD 1TS3A 3O13A 2N88A 3G6JB 3CCLA 1G51A 5FOBB 4K5XA 1CA5A 4R4CA 3I91A 3ONAB 2B2VA 2G9DA 1GUNA 3ULJA 1UE1A 1GR1A 1EYDA 1YIJB 2PNHA 5BSYA 1D2BA 1RL2A 4PGOA 3MXNA 1HXYD 2A68D 4IN3A 3VYSA 2NVYB 1CQVA 4XQQA 2UXDL 5THXA 5IK2A 4XLHA 4GN4B 1A8PA 5EGTA 2BGJA 4NDXA 4TRDA 4GS3A 2EVBA 2ZM6L 4JI0L 3Q24A 1HCZA 1DOMA 2ZTCA 4HTHA 5IT9E 1EU3A 1PH1A 1TVCA 3HKSA 5F4OA 4DR2Q 3GO5A 4ALPA 4DNTB 4GNXC 4JK1C 5C4HA 1CKNA 4JG2A 3SXHA 4IFDH 4O0AA 1EUJA 5IOCA 2L5TA 3TQYA 3VYRA 1SFOB 3PSIA 4X7CA 2C5BA 2JEAI 2V31A 5EKKA 2LKVA 3W3AA 3A7AB 3TDQA 1MSGA 2ATWA 1IKMA 3A54A 4XOTA 2VQEQ 2N49A 3CCSB 3S1MH 5IGEA 4JI2L 1HQRD 2DJFC 3OFNA 4X66L 1FYCA 3LVBA 1II3A 1G7SA 5D65A 4DV0Q 2KENA 2HD3A 1N32Q 1Q86C 2HUGA 5FKAC 1SAPA 4UP9A 3M9BA 4F8MA 4K0KQ 3HOWH 1SJHD 4ODGA 1UE6A 2ZBVA 3E0JA 4HIDA 3TRZA 4B3RQ 3I4LA 2VNUD 2NN6G 3GTQB 4K2LA 2WAQB 4DK0A 1QVGB 2HCCA 3PCOB 4OONA 4KHPL 3STBD 2PPBC 1TIID 4MNOA 1KHIA 1JJ2B 4GLXA 3SK8A 3S16H 2C78A 4J8QA 1WCMB 1LTLA 1S3OA 3GD7A 3A0JA 5C0XG 4DGZA 3CC2A 3R6JA 3A35A 1YNND 2HHHL 3PO3B 2FMCA 2VZLA 4JOIA 1K3BC 2RDHA 2BE5D 5BN5A 2E5LL 1EYCA 1F9PA 2QEJC 1PVOA 1B3AA 2Q2IA 3J81j 2VNIA 3FKIB 3NSWA 2K5NA 1HNXQ 1E22A 1ESFA 1QILA 1U9RA 4II3A 3DWPA 2R7ZG 2ZZEA 4PZ7A 4GKKQ 2GVAA 1CNFA 1OB5A 1JWSD 1L1OB 1GUWA 4QHYA 3AVYA 1WSRA 3T1YQ 1GXDC 2F4VQ 1YHAA 3JAME 1Z6HA 2Q2TA 4DK6C 5JBQA 2F0OA 4XQNA 1SJED 5J39A 1TS5A 1VMPA 1YHQA 1D1KA 1EWHA 1VQLA 2GK6A 4QJFA 2M2LA 3NBHA 3MTSA 1EIGA 3OW2A 1F9SA 2LS01 4JYAQ 2AWNA 4AF6A 1I50B 4P73A 2E2JH 4IUUA 3S1NH 3TZUA 1LO5D 1DARA 2VW9A 1K28A 4DNIA 4RWSC 2BF4A 4LFBL 1CHPD 1GVPA 3KBXA 4X3UA 1C48A 1RTOA 4CKCA 4TVAB 4JCVE 3U4ZA 5KYLA 2ZZQA 1Y8NB 4FP5D 4Z4WA 4LBYA 2K75A 4OXPA 1T6YA 1VMCA 2M00A 4X8IA 3FVQA 3R2TA 1ZEQX 2M9VA 5KNDA 5DS0A 3OTOQ 5FA6A 1Y0YA 4EQ5A 3HOZG 4F88A 5CV5A 4LFAL 1OB0A 4DV2Q 3KBGA 3DM3A 4HEDA 3J81i 3QFCA 5FJ8G 4JI4L 4A3BG 1W3SA 5I6YA 3OZVA 1K73D 2WAQG 4X64Q 2NVQB 1K9MD 1N8RC 5FO0A 4P26A 1SDFA 4C3HH 4C3JG 3MWYW 3TBIB 4JI7L 4G7HC 2QA4B 5IGGA 1JJCB 3PUWA 1PKVA 3FKSA 4DAYA 3CC4B 1AZQA 3Q3AA 5TY0A 4EGVA 1HJPA 1NB9A 4YWMA 3HAGA 3P75A 4R4TA 3ULPA 4A3MB 1VHOA 3NUCA 2B63H 3PF4A 4RKBA 5K36G 3FKIG 2SOBA 3W2HA 1K8AC 4X05A 1CUKA 4Q7JB 1BCPF 1N05A 3J81L 1CNEA 1Q12A 4YALA 2JA6H 4Y9RA 1YBYA 2IHFA 3VA7A 3ERSX 4DV4L 4KK7A 2F4IA 1K83B 1BKBA 1G291 4IPDA 2B2UC 4LC0A 1EZ6A 1E1RA 1EWYA 3KLRA 4U673 3MAQA 2X6YA 3GIRA 4L8JA 4QFMA 3W2DA 1HNWQ 3AGQA 3OW7A 1JR0D 4A3GH 1SYCA 1BOSA 1VQ5A 4BBSH 1A2TA 1QVCA 4NMZA 4DV7L 1PH3A 4XNFA 2JA7G 4CGYB 3CCMB 2RSOA 3AEVA 4O2DA 3P1HA 2EYHA 1OXUA 3AU7A 1I4PA 3NBIA 4MYUA 1GAWA 4NB3A 4A3CG 5CBEE 4AQYL 2OXPA 4XN3A 2MO0A 4II2A 4G1VA 2HCIA 4A3IG 1EEID 2ICIA 3GTMH 3K7AB 1C8CA 4TMXA 2YWEA 3SEJA 1X3PA 1IW7C 3MA2B 1GHKA 2XNDA 1TWAH 4XT3B 2Q6OA 5FL7A 2V7QA 3BVZA 4NXNQ 4A3LH 5GAGC 3W2GA 1KL9A 4P22A 4RDLA 2ZITA 1H8EA 2IHEA 5NUCA 1AFPA 2C9OA 4BBRH 2JA9A 3TS0A 4QQBX 5DN6A 1PV4A 2ZTGA 1SMYC 1UD6A 2ID0A 1BXTA 4BY7H 4DXFA 1EFCA 3PIPA 3ZUGA 5E1FA 2GJKA 1BVSA 2QGQA 4AVZA 4QIWB 2B7CA 4ACAA 1OHHA 3X3NA 5CC4A 2WKCA 3S2HH 2NVXH 2LMCB 4DV3L 4RD1A 4RJLA 3ULLA 4QIWE 1YEZA 4A3FG 5EJWA 2X3UA 1V1PB 2F0WA 2Q2HA 3ES9A 4HJ5A 4B3TL 3EFXD 4JBKA 2UUBQ 1QB5D 5JEAJ 2ZXIA 3JU4A 2F0EA 1U0LA 4LF9Q 4RHRA 3D8GA 3WQZA 4KY5A 1LTTD 4B08A 2YWGA 1COWA 1WTQA 1KK0A 1D5MC 1OO9B 1IBLQ 2CRVA 5T1IA 3KJOA 3F2CA 1X3GA 3RN2A 1I8DA 4H0LC 1AIPA 2YWHA 4ZGNB 4LUZA 1O80A 2VBTA 3W1BA 2TMPA 1SYFA 1PLFA 2KEDA 3ERQA 4RMFA 5JAVA 1A15A 2RVLA 3S14B 3K58A 2B2TA 2Q2UA 1A63A 3OIQA 3PMFA 2Z4IA 4LF7L 1EP2B 3FEWX 3S15B 2Y0SE 1QGZA 2OBTA 1S72B 2RC5A 3VMFA 1B1ZA 1EP3B 2DY8A 3K0XA 2JA5H 3VDYA 4JBMA 2J7ZA 4DR5L 4X6AH 3BVGA 5C4XB 1TWHH 2VS1A 1CQFA 4JI3Q 1F2MA 1FJGQ 4X3KA 3PIP3 1LYLA 1CFMA 1GD7A 4UDUC 4DV1Q 3OAAA 3CCSA 2ES2A 4YWKA 1ZUNB 5JPNC 3IFDA 4KD3A 2IX3A 2PNRC 4YAWA 3Q6QA 4OOVA 3C3LA 1UD3A 4DAPA 4DAVA 3NPPA 2B2YC 4Q5VA 4MHEA 1PH4A 2B2WA 3OIPA 3PENA 4F87A 4A93H 2R9VA 4DR1Q 1QVGA 2UXBQ 2HDLA 2VUMB 4YAUA 3E9IA 1Q81D 4QUCA 5FLXE 1BNZA 4YIJA 3PA2A 1F60A 1XX8A 3WWVA 2F0GA 1TWGH 1JJ2A 4LNQA 1MKHA 3BC9A 1S5ED 3DM1A 3KJPA 1BF4A 4GKJL 1PH8A 3L3OC 3J81c 4O42A 4PG3A 4NNJA 1Q90A 1NAPA 3CQZH 3QOJA 3HOUB 4X0CA 1UMKA 1ASZA 3U2QA 4MYTA 3QIAA 5D3IB 1IJEA 1E0BA 2VB3X 1N06A 1V1OA 4JBJA 4MTKA 1VJSA 1V5VA 2UXCL 5IGDA 4X7EA 5C44H 3HOYH 1VQHA 3M85A 2L0CA 3CB4A 1L1OA 1HZAA 5LL6X 3OMCA 2R93H 1SRUA 4P25A 4OPVA 1HH2P 3ZZUA 2E2JB 4IFDG 3GTGH 4XKWA 2PMZE 4B3ML 5IT9L 1STYA 1WTVA 1QNUA 4M2LA 1BUVT 1D8TA 2BVNA 3VNUA 1OXVA 5J22A 2BSAA 2EXDA 1RCVD 2YWFA 4WZLA 1S5BD 1NY4A 4JVZA 3FPKA 4ID6A 4C0SA 4HJ8A 2EIXA 1KNEA 2D9UA 3KL9A 1XMOL 1ET6A 1EY0A 1HPCA 3D4DA 3J7ZC 1MRZA 1T5XD 1FL0A 3HP3A 1NMFA 1W2BB 1R9TH 2YTVA 3EQLC 1SSOA 1HNZL 3ZBTA 3HRZC 3TREA 3RZDB 1KRSA 1NCVA 2HIXA 4LBWA 1TR5A 4POGA 1KNAA 1SBBB 2Q6KA 2QGGA 2EFGA 4YCWA 5CV7A 1T5EA 1B70B 3H91A 1YZ6A 3NWSA 1R4QB 5I9PA 1RF2D 4DR4L 1PJ7A 1EY5A 3HS0C 1QFJA 4YXWA 3VR2A 3JAMi 3P7JA 1UEBA 3B8HA 3K5MA 3I7FA 4LFCL 4XORA 2DNCA 2ZTEA 2D3LA 5TRDA 1G2SA 1S5CD 3PUMA 4Q0FA 2WP8J 4IALA 3K8AA 4CBVA 3CW2C 5GROA 1AE2A 3KLSA 3PIOA 5LMNQ 2OQKA 3FP9A 4P6VF 1V9PA 3A8JE 3Q8DA 1HZBA 4EX5A 1UE7A 2VQFL 3HOXH 2FMMA 2BDNA 3U6KA 2EYLA 4DK1A 4DUZQ 4OIKA 5ELBA 4Y7NB 3MXPA 2JA6B 2QA4A 2KCMA 1BQEA 1XMQL 3CC4A 5KRUA 1BBXC 1EFUA 1U2RA 2VYQA 2B2VC 3ZBUA 2QTLA 1JE4A 1PA6A 5C4JH 4RDJA 1N9WA 3F1ZA 2VB2X 2CFMA 5IYRA 2V1CC 4XYOA 1X32A 5IE8A 2A19A 1FRQA 4AYBE 2QILA 3K5NA 5G3LF 2B8FA 2D0OA 4FF3A 3A7LA 1H9KA 1Y1VB 4DV5Q 4ZAIA 1WD1A 5A88A 2GPJA 1EWIA 2IPKD 4B9XA 3LNNA 4PAAA 1BCPC 5I6WA 2NN6I 2EYFA 4G1BA 4DQLA 4XLFA 3J7YW 1VQ7B 2EY1A 4DKAC 2BN4A 3S1RB 2VNKA 2M5SA 3GTMB 1F77A 4G7WA 2LZJA 1DXMA 4QY7A 3SR1A 3UE1A 3TS2A 3E5SA 4C3IH 1G7CA 4RD4A 2I46A 1NTGA 2B29A 2L12A 1QGYA 4R8IA 3K5LA 3PIO3 3CCMA 1WTWA 2EXZA 1P8LA 3I2ZA 3BVMA 1QJOA 2A69C 3ASTA 3ND8A 2E8GA 1BBWA 4AF7A 3QO2A 2OQ0A 4B44A 4XT1B 2XNJA 4DV6Q 4HIOA 2AQ3B 3T51B 4JI6L 2WFWA 1H42A 4ZLTF 4L5SA 4K14A 3IL8A 4KTAA 4KJNA 4FXDA 3GTJH 3KLWA 3S2HB 1VQPB 1MBYA 2NVXB 2ZL5A 1GJRA 1BQQT 1EYAA 1SLJA 1AN8A 4FF2A 3T1HQ 3H3VH 4OHJA 1KMHA 4Z4RA 2BM0A 1LABA 3TP8A 2FHTA 1MGSA 2BGIA 1JWMD 1PRTC 4EQPA 3BY2A 5JEAH 1GKHA 1SNOA 2H1EA 5TV2A 2KUMA 1UD5A 1VQ6B 2AKWB 1ML0D 3TP6A 2EYMA 5KNBA 4TQUS 5IYBH 2O2LD 2B63G 3P26A 3AVVA 1T6ZA 3GTKH 1NE3A 2D5DA 3A3BA 1A3UA 3GV3A 1N33L 4JOIC 1LTAD 1JA1A 1V1PA 1W34A 4DR3L 5J35A 2JA6G 2C5HA 4XQJA 2UU9Q 1IXRA 2IW3A 2R6GA 3QG1A 3DLLA 3A5ZB 3ZIAA 2ZL6A 1VQ9B 5I4DA 2NVTH 1JICA 2PW5A 3CU7A 3CRLC 1DOLA 2ICEC 4UPAA 4BBSG 1I4GA 1KTKA 1LTRD 3R3OA 1PDQA 1I94L 4BA2I 1I4RA 1XPUA 2KHIA 2HLDA 2VJIA 3ITPA 2FXQA 2QF7A 1IKLA 3AFPA 4UP8A 3V2TA 2F4NA 3AVUA 1I6VC 2NTTA 1A8VA 2KCCA 1OGIA 1S72A 2WIIB 4DNRB 3PVDA 2MFIA 3KLSX 2X85A 3A8IE 1PFNA 2JP1A 4A3JH 3DWQA 2E75C 3AVTA 2P5ZX 3EA6A 5M5YH 2ZXRA 1PHJA 1RODA 4PV1C 3RUZA 5E3FA 1Q8IA 3H0GH 5DLQE 4A3LG 1P4MA 2X0KA 4A3KH 2E5LQ 3W2IA 3CAMA 4BBRG 1Q86D 4EQNA 4B3FX 4R1JA 1LT5D 3J81k 4PNYA 2PQAB 4DR7L 2HCJB 1J9ZA 5LMUQ 3WY9A 4B3SL 3DUZA 4Z9CB 2AUKA 3S1QB 4I7AA 1SYGA 4L5QA 2R7ZB 5CV6A 1BX1A 2CH4W 3CTAA 2DETA 3CHBD 2ZT9C 1U5KA 4LF4L 1G6PA 1SEBD 3S9WA 3SGIA 5FK9C 5EPKA 2FINB 1NBWA 3UE0A 3JAMc 4OPSA 1O7IA 3NK9A 2A6HD 2BM1A 3BY1A 4AH6A 3AMUA 5FO7B 2VNJA 3SJPA 2DN8A 4RGMA 4YY3L 3F2DA 1PTOB 4HJ7A 1GUGA 1EQQA 1SYBA 2SNMA 1F2YA 4OX9L 3OZUA 3GDEA 3BZKA 3NELA 3BH4A 4G5GA 1IYJB 3F2UA 3Q23A 1D8LA 1M90D 4OELB 3UDGA 4LF5L 4L5TA 4G4KA 2GA4B 2N78A 1K8GA 4HJ9A 4ZCLA 1E2VA 1PTOD 4XXEA 1SNPA 3CRZA 4NXML 4QCLA 2NTSA 1YHBA 1JWUD 4GLVB 2JA5G 4XLEA 2NZ1D 3SHLA 5M3FH 3CPFA 1H9RA 4FN5A 2UUCQ 4XQFA 3HOZB 2EY2A 3K81C 2JN4A 1BPLA 3Q6SA 4X65L 1EY4A 3WBJA 4LUOA 2JIZA 2ZBUA 3MCAA 1O7ZA 4A3BB 5M9OA 2ZZFA 1W2BA 3PUVA 1ZXTA 2X53S 4WJ4A 1XQBA 3F8TA 1TTTA 2Z0SA 1Q82D 4A93G 2N8NA 4LF6Q 4B9WA 2WAQE 4C3JB 2V7WA 4DN4M 3KEWA 2F0VA 3ASPA 3QSYA 2IX1A 5IIFA 1TY0A 2R61A 4DK3C 3WXMA 3PA1A 1D5XC 1EIYB 4M4SA 4MTNA 2XZLA 4M0LA 1D1IA 1HFGA 2YU9H 3A8JA 3BCDA 5FLXL 1Q46A 1I6HH 3A8KA 1SNDA 2FFKB 4M1UB 1D7QA 1E2ZA 1C9OA 2K5VA 1WPCA 1QNKA 4OO1I 2RBMA 1N8RD 5JJKA 2BA1A 1KXLA 5C44G 1NSNS 2Q6LA 1G2TA 3GTLH 1AH9A 1YNJD 2SEBD 5LMNW 3VR4A 3Q0AA 3CXCB 1H9JA 1TWFH 1XNQQ 5DSZA 4WZTA 2EOTA 5KNCA 5C3EH 1XJVA 1LLRD 2JA7B 1H8HA 1RKNA 1VS0A 2L55A 5FO1A 2PZWA 3GQBA 2B5OA 2VJJA 3TZDA 4POFA 1HR0Q 3QJYA 4RM0A 1IL8A 2EY6A 4KHZA 1UWVA 4A3IB 1CI3M 4LBVA 2VY3A 2F0QA 1CSQA 1N36L 4WWVA 5ELOA 4JV5Q 1VQ7A 2J7KA 1U4PA 1JB7A 1W0JA 3GTPB 2SDFA 1GJXA 4KLKA 3MC0B 4GN5A 1ELOA 2DY7A 2Z8LA 5IP7H 2XVSA 5KEEA 1WD0A 3AVWA 2KEEA 2B2TC 3GTJB 4JI8Q 5CV8A 4TMTA 5M5WH 4A3DB 2OTLB 4QVJA 2B8GA 4A76A 3OMGA 4ZV4A 2OTJB 1PYWD 1VQNB 2VNHA 5C3WA 4CKEA 3U6BA 1TQOA 1XWEA 3E3XA 4I65A 2B7BA 1XE1A 3JQRA 2RSNA 4PC3A 1IW7D 2EY5A 4XD7A 2RHSB 1B50A 4QV2A 2NWGA 4V0BA 2Q8TA 2QMUA 2Z4HA 4A3FB 3IRBA 1XTCD 4N9TA 3LQEA 1HVXA 3HOXG 4A3EH 1VQPA 4P75A 4B3GA 2B2WC 4I7ZC 3C2PA 1B4OA 1YNNC 2VL6A 3PO2H 3VO1A 3BDLA 5BR8L 5IYDH 2BE5C 1G7TA 2P3MA 3HGBA 1VQAA 1SMYD 3KF6B 1LM0A 3DEOA 1VDZA 3FRPB 1FRNA 1ICFB 2EJGC 1N32L 3CP0A 4KI0A 3M4OB 3I70A 1IZ6A 4RD2A 3BCFA 2WKDA 4K0KL 3ASQA 1VQ5B 3CMAB 4BY1B 1SNCA 1VQ6A 1TUIA 4LF7Q 2NVTB 4B3RL 4RCZA 2DEUA 2JXMB 4N3NA 4EQOA 5F2DA 4M8AA 5M5XH 4FF4A 1UUPA 4DR5Q 1RQPA 1D1NA 3CCJB 3SVMA 1DONA 1WFQA 3W5VA 1EIFA 4LBZA 4P2NA 2R92H 4H13C 3EROA 2ZXOA 1Y8PB 1WP6A 1HZ9A 1B2RA 4FK8A 4EVOA 3M4PA 1TLLA 1CA6A 3L7ZC 1L1OC 1DJRD 1LACA 2CWPA 1I3QB 1VQ9A 3M3YH 2RF4A 4C3IG 2QKIC 2OBSA 1W6JA 4IOCA 2RHQB 4C2MB 1JJGA 3D26A 4A3KB 1YVCA 4RD6A 4KKUA 1BBUA 1CKMA 2X69A 3NENA 3K5OA 2OK8A 2PE3A 2E2HH 1ZM9A 3A8IA 2CQOA 3T1YL 2JEBI 1L0YB 3RY8A 1W6KA 1I4XA 1KRTA 4HE5A 2JSOA 3OZWA 1PRTF 1QX4A 3S2DH 3SLDA 3I4MH 4P74A 3X3MA 4A3DG 5M3MH 5T1GA 3RZOH 1NDHA 1H9SB 3CCQB 2UXCQ 3EBEA 3OE7A 2W6IA 2EYOA 3ZPNA 2PQAA 2EYJA 5BSXA 5JEAG 1DG1G 1QUQB 2DNEA 4JYAL 5CV4A 1K9MC 3DDYA 1K8OA 3RD4A 3DXJC 5CYUA 1PFSA 4LJZC 2RCNA 3DHQA 3K80C 2ZL7A 1I18A 5ISRA 1YIJA 4Z4SA 1AZPA 4KN4C 5IYBG 3CESA 1STBA 3Q39A 5H59A 2K28A 3MHBA 2KECA 2MP1A 4IUTA 4ZGQB 3SDZA 3QFRA 1SE4A 4QL5A 3VR6A 1S5DD 5FLMH 1WYDA 2F43A 5IWAQ 3AB9A 5DEHA 4JMQA 2OF1A 2IY5B 3PUXA 3C46A 5HZBA 3I56B 3CD6B 5EQ0A 4LF8Q 3T16A 2R3ZA 2C5CA 1FVIA 4BY1G 1HNZQ 3S17H 3WOEA 1KD1C 3S1MB 1KIXA 4R4OA 4XN0A 1Y1WH 1HZEA 4ZRZA 2JA8H 3A1PA 1KC8C 5KSWB 3A3GA 4X64L 3K0YA 1JC7A 3HOWB 5EBDA 4KJOA 1IB0A 5KYIA 3PF5A 2X6LA 1PH9A 3H6MA 2JE6I 2ZTNA 2CWAA 4NKLA 2ZJQA 4WJ3M 5KNLA 2K52A 1Q1BA 4Y9UA 4IOAA 4IPHA 3G48A 1EIHA 1PYBA 4LFCQ 3H15A 1QFYA 1XYIA 1U4LA 5ELDA 4FXGC 2RKSA 1WDTA 1QG7A 2QDLA 3E9HA 3S16B 4MZ9A 5EPJA 4IQZA 1GAQA 3F2BA 4A3KG 5IY0A 1FNCA 1V8QA 3CC7B 2E2DC 1S4MA 1CQXA 1GM5A 4HN7A 1PFBA 4LWCA 3U4VA 2IWHA 3RLOA 1YI2B 3BDCA 1V0EA 4XLCA 4DF7A 1IBKL 3HOVH 1XMQQ 1XFOA 4X62L 4TT3A 1VQGA 4ZQ3A 3U58A 1HNWL 1TY2A 1Y8OB 2I5HA 4OIJA 1CZGA 2F0MA 2DGYA 1QVFB 1EP1B 5ELEA 4DUYQ 4KN7C 1KLUD 3D3RA 2OYNA 2YTXA 1WTOA 4ZYSA 2WR8A 4Z4VA 4K6LA 5J3BA 2XTIA 1E3PA 1E62A 4ZK9B 2D9RA 2CH4A 4NBSA 1XPRA 4PZ6A 3SEBA 3FPUB 3LX0A 1SR3A 1ZM4A 3VA5A 5A89A 4G7OC 2F0UA 1SKQA 1NBMA 4ZUJA 1YJWB 3PUZA 1B7YB 1WVLA 1R5NA 1ENAA 1DOKA 1M1KD 1VF5C 4NXNL 4DR6Q 3S1NB 2XZPA 3EN2A 5A35A 4WQMA 3CCRB 2OCEA 2JQOA 4CDEC 3GVJA 3HG9A 3SK4A 5H1SE 1RQRA 2AQ1B 1IHZA 1HA5A 1QZHA 4OWWB 2EZVA 1DDGA 2DCUA 2IT1A 3AFQA 4RGNA 1AW7A 1PJ5A 1CKNB 4GN3B 4R8NA 2K33A 2NVYH 4JI6Q 3HZXA 4HIKA 1N0VC 1NB0A 2DUDA 1DGSA 3ONUA 4GOPB 4ABNA 3ZZTA 4JI1Q 1J8IA 1RTNA 1X54A 1NMGA 1BCPD 1HUNA 1X3EA 3HOWG 1MJCA 5ELNA 2ZZGA 3OEHA 5DNFA 2F0IA 4FXKC 1R5BA 5FNZA 2B39A 1Q7YC 4V190 1D2EA 2RQXA 1MHWC 5FO9B 3J7AV 4HMIA 4B3XA 3URYA 2KHJA 1Q9SA 4QGUA 1WTPA 1NR2A 3OOCA 3NTKA 2K04A 4LF9L 1L0XB 3OYYA 5KW9A 1YNXA 4EH1A 1BLIA 4C3HB 1EXMA 1SFOH 1IBLL 3GTOH 1W35A 5IYQA 2BOSA 3D4RA 1J5EQ 2OTLA 3KOJA 3ER0A 2A69D 3OJXA 3PUYA 5CGKA 1Z9FA 2OTJA 1NJIC 1VQNA 1FGUA 2G5DA 2YYZA 1B23P 4S3SA 2UUAQ 1N33Q 2XEXA 2YTYA 4DR3Q 3KDFB 3J7AF 3G6EB 1N34Q 3D6WA 2VBUA 1NNXA 2B63B 1XNRQ 3A8KE 2NZOA 4YCUA 5A8AA 4ILWA 3MFGA 4FF1A 2A8VA 4RCOA 1M4VA 1FD7D 3G4SB 4BS9A 1ILPA 2GK7A 5FJ8H 1WOOA 3D0FA 3V76A 2J0TD 5M5XB 3OP1A 3KF8B 4PMCA 1SKYB 2A5HA 4JI3L 4X3TA 4R4IA 1KAAA 1SE2A 4DV1L 4R9WA 1KK3A 3KF6A 4DFAA 1I94Q 1ZYRC 1WSVA 4A3GB 3BQJA 1V1QA 1JNYA 1Q1EA 2D3NA 1QUEA 5C3EG 4UAIA 5CORA 1WTHD 1WCMH 1FDRA 5EKLA 3CMAA 1VQDA 2A6ED 1PH2A 4BBSB 1L2FA 2CQAA 3M3YB 2WJVA 2CK3A 3G71B 2K4KA 5C3XA 2UXBL 2ALYB 1LTBD 1SROA 3PO3H 2EYPA 3CCJA 2K5DA 5AJ3Q 1CSPA 2H5XA 5K36H 4RGTA 4IJHA 2F1LA 1KABA 4JW0A 1DCZA 4JI5L 2E76C 4YHHQ 2QN6A 1TWAB 3OJWA 3Q22A 1BR9A 5IGCA 5GV7A 1PZKD 4UZEA 3K7UC 5C0XI 5CBAE 1A62A 4HAEA 3W1GA 3NEMA 3QWNA 1L0WA 4BBRB 4NP5A 1E1TA 4RGOS 4C56C 4MN3A 2F3VA 3CMEB 3S2DB 2E2IH 5FIUA 1IBML 2C2WA 3QFSA 3JQQA 2PI2E 4DA2A 4LF4Q 3RZOB 1O78A 4BY7B 3CP8A 1QOHA 4O1NA 2C77A 3BDOA 5DM63 1E64A 3CPWB 2KA7A 4ME3A 1B44D 5DM73 2UXDQ 1J9OA 4G7ZC 4HCSA 2AHOB 4IPCA 3C1FA 1U4MA 4NPSA 1RHPA 1I50H 2EJFC 2C4TA 3IAYA 1J6QA 2ZM6Q 4JI0Q 2XZOA 1E1QA 4C3HG 1SYDA 1A3VA 1FNBA 1BDOA 3NTIA 1E63A 1H9SA 2E74C 3CCQA 4Z4ZA 3WDNA 1JMCA 4XM3A 2NV4A 1FGBD 3PO2G 4IPGA 4RCNA 1VLYA 1QUQA 1X55A 1GUTA 4LF5Q 4H7BA 5IT9c 4MIUA 4A4IA 2WSSA 1KAWA 3BJUA 4HIMA 3MXUA 5EBCA 2ENBA 2OBRA 1H85A 2NZHA 4KHVA 1EFID 3HEJA 4GNXB 3I72A 5COYA 2Z6KA 4E0FA 2CW0C 5HURA 3W5UA 4JI2Q 4X66Q 1PZID 1EY6A 1HA3A 4FNFA 4J1MA 4L5RC 1QZGA 3SK5A 1CHQD 2NVQH 1JORA 1KLGD 2DJGC 4OL7A 2JA5B 1FX0A 4KD4A 1EL0A 4AC9A 1M8AA 2PMDA 4CQJA 1T9HA 2R92G 5D14A 4A3GG 1TWHB 2K32A 2XRQD 2K50A 1E79A 3I56A 3CD6A 1YJNB 1HZCA 3LO8A 5IODA 2AUJD 4KHPQ 5LMNL 3MXGA 1GO3E 2Z6BD 4RHSA 2JYOA 3B82A 2FJ2A 2GJRA 2X6WA 2WB1B 4UZFA 5H5JA 4ULLA 4A3MH 4DUZL 4QB4A 5JJZA 1N0UA 4OWTB 3J80E 1E43A 4UP7A 1EEFD 1FR3A 2K5WA 5AFWA 1XPOA 3W2EA 5GAEC 1V43A 4A93B 3G05A 4OO1H 2NBFA 2WB1E 4HIZA 2L9HA 2HHHQ 2F0DA 1AMOA 1V0FA 2WV6D 1AE3A 1K83H 3W5OA 2PQEA 2JJ1A 1B9NA 1TWGB 3UDFA 1E1OA 1U4RA 3A56A 4R71A 1WOSA 3P27A 3U9SA 1E7ZA 5I2YA 3I4MG 4TKOB 1A3TA 2G9HD 3LGJA 1ENFA 3BU2A 3CC7A 4BY7G 4FXUA 3CQZB 1VQOB 2CKZB
chains in the Genus database with same CATH topology
2XWBB 4PMBA 3LWEA 4XOPA 1A6XA 1E3ZA 5C44B 3HOYB 2AWOA 1Y69U 3IFTA 3OWEB 2F0JA 2F0SA 2R93B 4ZKBB 2XGJA 1QWYA 2IX0A 3GTGB 3PV0A 1TVXA 1IYVA 2J4XA 3V05A 1G91A 4FO2A 1G8ZD 2EPBA 4FYDA 2F3WA 3K6OA 1EWCA 5DAUA 1STEA 4H44C 4C1NI 1TT2A 1R9TB 2XNAC 1NUCA 4WORA 3OHXC 1ILQA 4HR7B 1HTLD 3M7NA 3GTOB 5G3LD 1E2WA 4XONA 1LTSD 4XDXA 2LFNA 1LTGD 1EOTA 1AEXA 2XOKA 3HOXB 4C1NK 2K7VA 4K5VA 2H4OA 4BA1I 1JOKA 5C4JB 3D4WA 2PYKA 3CKIB 2CHBD 2ZXHA 2EJMA 1ICWA 2A68C 2K6AA 2RDFA 2A6HC 1HRJA 1PZJD 3GV6A 3KF8A 2D2CC 1EQVA 1LT6D 2MUYA 4XKVA 1LTID 1ENCA 2MJ8A 2HDMA 5BN4A 1EZ8A 1TS4A 1F9QA 3L9AX 4C3IB 5C0XJ 1OXTA 4QF4A 3BS1A 2MHVA 3SE0A 1SE3A 3KK7A 5A2QL 4DU9A 2XSCA 2F0FA 1JOQA 1PTOC 4HSVA 4GZYC 2E2IB 4XMYA 3I3CA 1UD8A 3BYYB 4ZKCB 3E6ZX 2PCFB 1W9XA 3HKZB 2X6XA 5LHY1 1GOZA 1B9MA 5JVH3 2NB0A 4P2CB 1A2UA 5JVG3 1S5FD 3LWUA 2V4DA 1FNWA 2Z1CA 4E6IA 5EPLA 4ASUA 5TSSA 1DYQA 4G6IA 2N55A 2XIWA 2F0HA 5I2XA 4RFBA 1F2LA 2X6GA 2XRSD 1FNUA 4XYQA 2D62A 3GTKB 4IFDI 2GJPA 1EY7A 3H94A 1ET9A 4Z1MA 2K03A 4IURA 5LL6S 3FPPA 2L4NA 5ELFA 2PW7A 4UZUA 1MSHA 4IUVA 1CK1A 5JPMC 1SYEA 2W6JA 1YNJC 2WACA 3KUPA 3RLFA 1UEAB 4LK1C 4K2KA 4A3JB 5M5YB 3OWFA 2KVOA 3H0GB 2KCNA 5D3DA 2RDGA 2QE7A 2OT2A 2KJXA 4RAUC 4JBWA 2KVMA 3T4AC 4X3SA 5HKKA 4F7XA 5I9OA 4XLAA 3I8ZA 2F0KA 3VR5A 2PZTA 1UD2A 5CR3A 1CZWA 2BCOA 4G57A 2PZUA 5E4WC 2K01A 3T56B 1AP0A 3P20A 3NE5B 2F0NA 3BG3A 2KHSA 2WJYA 3NTHA 4ZUIA 2RA4A 4WJWA 1DZ1A 1ZKOA 1X3QA 4L6TB 3MEHA 3TP7A 1KDAA 2JJ2A 5IGFA 2SNSA 3H3VC 4LAAA 5CDFA 1BO0A 3VR3A 3OEEA 1EQTA 2JDIA 1VF7A 4YELA 1RJTA 2IJ0A 4IUNA 1QCBD 4OGQC 1RD9D 4FVMA 1GUSA 1XXGA 5M3FB 5C6AA 1HUMA 1E3XA 3VYTA 4KV6A 4U68A 2DIEA 5C5MA 1K8MA 1LT3D 1PFMA 2F0PA 4WFN3 4IZ8A 1BMFA 1SNQA 2BA0A 4HMJA 1PMRA 4OO1G 5KIXA 4RH6A 4KKSA 2Y0SB 1D6EC 2K05A 3OPOA 2EE1A 1TS2A 4KMUC 1MD2D 1O7YA 1ONLA 5FO8B 3J80L 2KOLA 3N52A 2YU9B 2IL8A 1I6HB 2F1MA 4HSPA 3MFYA 2F0LA 4HCEA 5E4XA 1WTXA 3OSOA 3TMEA 1TU2B 3FDTA 1NRKA 2NN6H 1EFRA 3GTLB 4GQNA 3D31A 4IUQA 1TWCB 2NUCA 1TWFB 3GVLA 2E1BA 5C3EB 4RKLA 5C0XH 3ZYYX 3ND9A 1CTMA 3TP5A 3I4NB 2L1BA 1O7LA 3M7GA 1JOOA 2OEOA 1BCPB 5A2QE 3NP8A 2CVRA 2B2UA 3NQIA 4QMGA 1ZYRD 1G6ZA 3DEPA 2QDBA 2PMZB 4XL9A 3K57A 2NYZD 5M5WB 1PTOH 1KZLA 3NWTA 2MGSA 5BN3A 4XTCS 1KDBA 3GP7A 2TSSA 1H9MA 1NR4A 5J1ZA 2Q8RE 4IFDJ 4A3EB 3DMUA 4DXGA 2WZPP 1STHA 3QB3A 3PO2B 1PRTB 1OXSC 4CJ1B 4YEJA 4ME5A 5CV9A 1F9RA 1TKWB 4G7XA 4KY7A 4TSFA 5ELCA 1DD2A 1MABA 4K6DA 1Z7TA 4KY6A 1ESRA 1HTPA 2AQ2B 3C1EA 5C5LA 4PMWA 3NHHA 1PRTD 3U9OA 3IKJA 3I73A 3CMMA 1S4ZA 2R92B 3T53B 1JB3A 1RDPD 2F03A 5EKIA 3TN2A 4CJ0B 3TSSA 4XIGS 1PTOF 4N9PA 2A73B 3I90A 4BWGB 3H09A 3J81E 1C4QA 4XR6A 4WRDA 3NXWA 3DWAA 2CW0D 1HFNA 4AYBB 3MVVA 4CJ2C 2E2HB 1UNSA 1D5ZC 1UD4A 3WOFA 4RA8A 4KKTA 2XWJB 3N6RA 1STAA 5JOBA 2BDOA 3JAML 1I4HA 3VYUA 1HQMC 3D6CA 1F2ZA 4QUFA 1Z47A 3I4MB 4IUPA 5M3MB 4L63B 1STNA 1Q3LA 4CHTB 2KQ3A 1EY8A 3SK6A 2B2YA 3T13A 5IGBA 3M4YA 1STGA 2A74C 2L11A 3GVKA 3G7LA 1EU4A 2HQEA 3BYTB 5K5PA 3K59A 1K28D 3CP2A 5C4ZA 3NQTA 2Q8IB 1OXXK 1B53A 3FMCA 1B2TA 3R93A 1WTRA 4TSSA 2MPMA 3MZ5A 5HGTA 3EJIA 3R2IA 2WINB 3S17B 1R4PB 1Y1WB 3R8BA 2JA8B 3V96A 1UAPA 2VXWA 4LMQD 2QCPX 3EVQA 1FNVA 2O4XA 3BZDB 3CRKC 2A6EC 1HA6A 2F0TA 2LY7A 1LV9A 4K8IA 2EDGA 1I4QA 1SNMA 1KDCA 2K5QA 4K8JA 4NW2A 1LT4D 3HOVB 4CKBA 2WPDA 1SXTA 1QE6A 2XN9C 1MI2A 1JCKB 4K5WA 1DM0B 1EY9A 5CMDA 1PXUA 1CM9A 2X8KA 4PQXA 1CT1D 3RMHA 1GHJA 2O5JC 2I07B 4J6HA 1IYUA 1VCIA 5KGUA 3A55A 2O5IC 1HHVA 2PO4A 1GUOA 3UI2A 2ZXPA 3QOLA 2K1BA 1W0KA 1JQYD 1TS3A 3O13A 2N88A 3G6JB 5FOBB 4K5XA 1CA5A 3I91A 3ONAB 2B2VA 2G9DA 1GUNA 1EYDA 1D2BA 3MXNA 1HXYD 2A68D 4IN3A 3VYSA 2NVYB 1CQVA 4XQQA 5IK2A 4XLHA 5EGTA 4NDXA 4TRDA 2EVBA 3Q24A 1HCZA 1DOMA 4HTHA 5IT9E 1EU3A 3GO5A 4DNTB 4JK1C 5C4HA 3SXHA 4IFDH 5IOCA 2L5TA 3VYRA 1SFOB 2JEAI 2V31A 5EKKA 2LKVA 3W3AA 3A7AB 3TDQA 1MSGA 1IKMA 3A54A 4XOTA 5IGEA 1HQRD 3OFNA 1FYCA 1II3A 5D65A 2HUGA 5FKAC 1SAPA 4F8MA 1SJHD 4ODGA 3E0JA 3I4LA 2VNUD 2NN6G 3GTQB 4K2LA 2WAQB 4DK0A 2HCCA 2PPBC 1TIID 3SK8A 4J8QA 1WCMB 3GD7A 5C0XG 4DGZA 3A35A 1YNND 3PO3B 2FMCA 2RDHA 2BE5D 5BN5A 1EYCA 1F9PA 2QEJC 1B3AA 3FKIB 3NSWA 1ESFA 1QILA 1U9RA 4II3A 3DWPA 2ZZEA 1JWSD 1GUWA 1GXDC 3JAME 1Z6HA 2F0OA 4XQNA 1SJED 5J39A 1TS5A 1VMPA 1D1KA 1EWHA 2GK6A 2M2LA 3NBHA 3MTSA 1EIGA 1F9SA 2LS01 2AWNA 1I50B 4IUUA 3TZUA 1LO5D 4RWSC 1CHPD 3KBXA 4X3UA 4CKCA 1C48A 1RTOA 5KYLA 2ZZQA 1Y8NB 4FP5D 3FVQA 1VMCA 2M00A 3R2TA 1ZEQX 2M9VA 5KNDA 4F88A 5CV5A 1OB0A 3KBGA 4HEDA 5I6YA 2NVQB 1SDFA 4C3JG 3MWYW 3TBIB 4G7HC 5IGGA 3PUWA 1PKVA 3FKSA 4DAYA 1AZQA 4EGVA 3HAGA 3P75A 4A3MB 3NUCA 4RKBA 5K36G 2SOBA 1BCPF 3J81L 1Q12A 3VA7A 4KK7A 2F4IA 1K83B 1G291 2B2UC 1EZ6A 1E1RA 3KLRA 4U673 3MAQA 2X6YA 4L8JA 3W2DA 3OW7A 1JR0D 1SYCA 1BOSA 1A2TA 4NMZA 4XNFA 4CGYB 2RSOA 3P1HA 2EYHA 1OXUA 3AU7A 1I4PA 3NBIA 5CBEE 2OXPA 4XN3A 4II2A 2HCIA 1EEID 2ICIA 3K7AB 1C8CA 1X3PA 1IW7C 3MA2B 1GHKA 2XNDA 4XT3B 5FL7A 2V7QA 3BVZA 5NUCA 4P22A 1H8EA 1AFPA 2C9OA 5DN6A 2ZTGA 1SMYC 1UD6A 2ID0A 1BXTA 4DXFA 5E1FA 2GJKA 4AVZA 4QIWB 1OHHA 3X3NA 5CC4A 2WKCA 2LMCB 5EJWA 1V1PB 2F0WA 3EFXD 1QB5D 5JEAJ 2ZXIA 3JU4A 2F0EA 4RHRA 3D8GA 3WQZA 4KY5A 1LTTD 4B08A 1COWA 1WTQA 1D5MC 1OO9B 5T1IA 1I8DA 4H0LC 1O80A 2TMPA 1SYFA 1PLFA 2KEDA 3ERQA 5JAVA 1A15A 2RVLA 3S14B 3K58A 2B2TA 3OIQA 3PMFA 2Z4IA 3S15B 3FEWX 1B1ZA 2DY8A 2J7ZA 3BVGA 5C4XB 1CQFA 1F2MA 4X3KA 3PIP3 1CFMA 4UDUC 3OAAA 5JPNC 3IFDA 4KD3A 2IX3A 2PNRC 3C3LA 1UD3A 4DAPA 4DAVA 3NPPA 2B2YC 4Q5VA 4MHEA 2B2WA 3OIPA 4F87A 2R9VA 2HDLA 2VUMB 5FLXE 4QUCA 1BNZA 4YIJA 1XX8A 2F0GA 3BC9A 1S5ED 3DM1A 1BF4A 3L3OC 4O42A 4NNJA 1Q90A 1NAPA 3QOJA 3HOUB 3QIAA 5D3IB 1E0BA 2VB3X 1V1OA 1VJSA 5IGDA 3M85A 2L0CA 5LL6X 3OMCA 2E2JB 4IFDG 4XKWA 5IT9L 1STYA 1WTVA 1OXVA 1BUVT 1QNUA 5J22A 1RCVD 1S5BD 4ID6A 1KNEA 2D9UA 1ET6A 1EY0A 1HPCA 3D4DA 1T5XD 3HP3A 3EQLC 1SSOA 3HRZC 3RZDB 1NCVA 1TR5A 1KNAA 1SBBB 5CV7A 1T5EA 3H91A 3NWSA 1R4QB 5I9PA 1RF2D 1EY5A 3HS0C 4YXWA 3VR2A 3P7JA 3K5MA 4XORA 2DNCA 2D3LA 4Q0FA 1G2SA 1S5CD 4CBVA 2WP8J 4IALA 3KLSA 3A8JE 2FMMA 2BDNA 2EYLA 4DK1A 4OIKA 5ELBA 4Y7NB 3MXPA 2JA6B 4V190 5KRUA 1BBXC 2B2VC 1JE4A 2VB2X 4XYOA 1X32A 2QILA 3K5NA 5G3LF 2B8FA 4FF3A 3A7LA 1H9KA 1Y1VB 4ZAIA 1WD1A 2IPKD 5I6WA 4B9XA 3LNNA 1BCPC 2NN6I 2EYFA 4XLFA 3J7YW 2EY1A 3S1RB 2M5SA 3GTMB 1F77A 4G7WA 2LZJA 1DXMA 3SR1A 3E5SA 2I46A 2L12A 4R8IA 3K5LA 3PIO3 1WTWA 2EXZA 3BVMA 1QJOA 2A69C 3ND8A 3QO2A 4XT1B 2AQ3B 3T51B 4ZLTF 4K14A 3IL8A 4KTAA 4KJNA 4FXDA 3S2HB 1MBYA 2NVXB 1BQQT 1EYAA 1AN8A 4FF2A 4OHJA 1KMHA 1LABA 3TP8A 2FHTA 1MGSA 1PRTC 1JWMD 4EQPA 5JEAH 1SNOA 2H1EA 2KUMA 1UD5A 1ML0D 3TP6A 2EYMA 5KNBA 4TQUS 2O2LD 2D5DA 3A3BA 1A3UA 3GV3A 1LTAD 1V1PA 4XQJA 2IW3A 2R6GA 3QG1A 3ZIAA 5I4DA 1JICA 2PW5A 3CU7A 3CRLC 1DOLA 2ICEC 1I4GA 1KTKA 1LTRD 3R3OA 1PDQA 4BA2I 1I4RA 2HLDA 2VJIA 3ITPA 2QF7A 1IKLA 3V2TA 1I6VC 2NTTA 2KCCA 2WIIB 4DNRB 3KLSX 2X85A 3A8IE 1PFNA 2JP1A 3DWQA 2E75C 3EA6A 2ZXRA 1RODA 4PV1C 3RUZA 5E3FA 1Q8IA 4EQNA 4B3FX 1LT5D 4PNYA 3DUZA 4Z9CB 2AUKA 3S1QB 1SYGA 2R7ZB 5CV6A 3CHBD 2ZT9C 1SEBD 3S9WA 5FK9C 5EPKA 2FINB 3NK9A 3AMUA 2A6HD 5FO7B 2DN8A 4RGMA 1PTOB 1GUGA 1SYBA 2SNMA 1F2YA 3BH4A 3F2UA 3Q23A 4G4KA 2GA4B 1E2VA 1PTOD 4XXEA 1SNPA 4QCLA 2NTSA 1JWUD 4XLEA 2NZ1D 3SHLA 1H9RA 4XQFA 3HOZB 2EY2A 1BPLA 3Q6SA 1EY4A 2JIZA 1O7ZA 4A3BB 5M9OA 2ZZFA 3PUVA 1ZXTA 2X53S 4B9WA 4C3JB 4DN4M 3KEWA 2F0VA 2IX1A 5IIFA 1TY0A 2R61A 1D5XC 2XZLA 1D1IA 1HFGA 3BCDA 5FLXL 1SNDA 2FFKB 4M1UB 1E2ZA 1WPCA 1QNKA 4OO1I 2RBMA 2BA1A 1NSNS 1G2TA 1YNJD 2SEBD 3VR4A 3Q0AA 1H9JA 2EOTA 5KNCA 1LLRD 2JA7B 1H8HA 1RKNA 2L55A 2PZWA 3GQBA 2VJJA 3TZDA 3QJYA 1IL8A 2EY6A 4KHZA 4A3IB 1CI3M 2F0QA 1U4PA 1W0JA 3GTPB 2SDFA 1GJXA 3MC0B 2DY7A 2Z8LA 2XVSA 5KEEA 1WD0A 2KEEA 2B2TC 3GTJB 5CV8A 4A3DB 2B8GA 3OMGA 1PYWD 5C3WA 4CKEA 1TQOA 1XWEA 4I65A 2RSNA 1IW7D 2EY5A 4XD7A 1B50A 4V0BA 2NWGA 2Q8TA 2Z4HA 4A3FB 1XTCD 4N9TA 1HVXA 4B3GA 2B2WC 4I7ZC 3C2PA 1B4OA 1YNNC 3BDLA 2BE5C 3HGBA 1SMYD 3DEOA 1VDZA 3FRPB 2EJGC 3M4OB 4KI0A 3I70A 3BCFA 2WKDA 4BY1B 1SNCA 2NVTB 2JXMB 4EQOA 5F2DA 4M8AA 4FF4A 1UUPA 1DONA 3SVMA 4H13C 3EROA 2ZXOA 1Y8PB 1WP6A 4EVOA 1CA6A 3L7ZC 1DJRD 1LACA 1I3QB 4C3IG 2QKIC 1W6JA 4C2MB 4A3KB 4KKUA 2X69A 3K5OA 2JEBI 1L0YB 1W6KA 1I4XA 2JSOA 1PRTF 3X3MA 5T1GA 1H9SB 3OE7A 2W6IA 2EYOA 3ZPNA 2EYJA 5JEAG 2DNEA 5CV4A 3DDYA 1K8OA 3RD4A 3DXJC 5CYUA 4LJZC 3DHQA 1I18A 1AZPA 5ISRA 4KN4C 3CESA 1STBA 2K28A 3MHBA 2KECA 2MP1A 4IUTA 3SDZA 1SE4A 3VR6A 1S5DD 2F43A 3AB9A 5DEHA 4JMQA 2OF1A 3PUXA 3C46A 5EQ0A 3T16A 2R3ZA 2C5CA 3WOEA 3S1MB 4XN0A 1HZEA 4ZRZA 3A3GA 3K0YA 1JC7A 3HOWB 5EBDA 4KJOA 5KYIA 2X6LA 3H6MA 2JE6I 2ZTNA 4NKLA 5KNLA 1Q1BA 1EIHA 1XYIA 1U4LA 5ELDA 4FXGC 2RKSA 1QG7A 3S16B 5EPJA 4IQZA 1V8QA 2E2DC 4HN7A 1PFBA 2IWHA 3BDCA 1V0EA 4XLCA 4DF7A 4TT3A 4ZQ3A 1TY2A 1Y8OB 4OIJA 1CZGA 2F0MA 5ELEA 4KN7C 1KLUD 3D3RA 1WTOA 4ZYSA 4K6LA 4ZK9B 3SEBA 3FPUB 3LX0A 3VA5A 4G7OC 2F0UA 1NBMA 4ZUJA 3PUZA 1WVLA 1ENAA 1DOKA 1VF5C 3S1NB 2XZPA 5A35A 3GVJA 3HG9A 3SK4A 2AQ1B 1IHZA 1HA5A 2EZVA 2IT1A 4RGNA 1AW7A 4R8NA 2K33A 3HZXA 4ABNA 1J8IA 1RTNA 1BCPD 1HUNA 2ZZGA 3OEHA 5DNFA 2F0IA 4FXKC 2B39A 2RQXA 5FO9B 3J7AV 4HMIA 3URYA 1WTPA 1NR2A 3OOCA 3NTKA 2K04A 1L0XB 1BLIA 4C3HB 2BOSA 3D4RA 5CGKA 2A69D 3PUYA 2YYZA 4S3SA 3J7AF 3D6WA 2B63B 3A8KE 4ILWA 3MFGA 4FF1A 4RCOA 1M4VA 1FD7D 4BS9A 1ILPA 2GK7A 2J0TD 5M5XB 4PMCA 1SKYB 2A5HA 4X3TA 1KAAA 1SE2A 4R9WA 4DFAA 1ZYRC 4A3GB 1Q1EA 2D3NA 4UAIA 5CORA 1WTHD 5EKLA 4BBSB 2A6ED 2CQAA 3M3YB 2WJVA 2CK3A 5C3XA 1LTBD 2EYPA 2K5DA 5K36H 4RGTA 1KABA 1DCZA 2E76C 1TWAB 3Q22A 1BR9A 5IGCA 1PZKD 5C0XI 5CBAE 4HAEA 3QWNA 4BBRB 4NP5A 4RGOS 4C56C 4MN3A 2F3VA 3S2DB 4DA2A 3RZOB 1O78A 4BY7B 3CP8A 1QOHA 4O1NA 3BDOA 5DM63 2KA7A 1B44D 5DM73 1J9OA 4G7ZC 4HCSA 3C1FA 1U4MA 1RHPA 2EJFC 3IAYA 2XZOA 1E1QA 4C3HG 1SYDA 1A3VA 1BDOA 3NTIA 1H9SA 2E74C 3WDNA 4XM3A 1FGBD 4RCNA 1VLYA 1GUTA 4H7BA 4MIUA 2WSSA 3MXUA 5EBCA 2ENBA 4KHVA 1EFID 3HEJA 3I72A 5COYA 4E0FA 2CW0C 5HURA 1PZID 1EY6A 4FNFA 4J1MA 3SK5A 1CHQD 1JORA 1KLGD 4OL7A 2JA5B 1FX0A 4KD4A 1EL0A 1M8AA 5D14A 1TWHB 2K32A 2XRQD 1E79A 5IODA 2AUJD 3MXGA 2Z6BD 4RHSA 2JYOA 2FJ2A 2GJRA 2X6WA 2WB1B 4ULLA 4QB4A 5JJZA 3J80E 1E43A 1EEFD 1FR3A 2K5WA 5AFWA 4A93B 1V43A 3G05A 4OO1H 2NBFA 4HIZA 2L9HA 2F0DA 1V0FA 2WV6D 2PQEA 2JJ1A 1B9NA 1TWGB 3A56A 1U4RA 3U9SA 5I2YA 4TKOB 1A3TA 2G9HD 1ENFA 4FXUA 3CQZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJX A;  2D2C C;  1LAB A;  3PUZ A;  3T53 B;  5JEA G;  2DNE A;  4G7H C;  5JEA H;  4H0L C;  1VF5 C;  4JBW A;  3PUW A;  3I4L A;  1TU2 B;  1IYV A;  1A6X A;  1K8O A;  2NN6 G;  5A35 A;  2NN6 H;  3DXJ C;  2AWO A;  4DK0 A;  1T5E A;  4XIG S;  3IFT A;  5BN4 A;  4LJZ C;  1Y69 U;  3D31 A;  1O78 A;  2B8G A;  1OXT A;  1E2V A;  3BDO A;  2PPB C;  5KNB A;  2KA7 A;  4TQU S;  3SE0 A;  2IT1 A;  3VR5 A;  4KN4 C;  3VR2 A;  4G7Z C;  2K33 A;  5K36 G;  2D5D A;  3PV0 A;  2DNC A;  3T56 B;  1H9R A;  3GD7 A;  3SDZ A;  5C0X G;  3P20 A;  3VR6 A;  1IW7 D;  5C0X H;  4GZY C;  3NE5 B;  4KKT A;  3ND9 A;  3N6R A;  1CTM A;  2EJF C;  1Q12 A;  3BG3 A;  2BDO A;  1CFM A;  1GHJ A;  1O7L A;  2R6G A;  3AB9 A;  3VA7 A;  3QG1 A;  2O5J C;  3PUX A;  1G29 1;  5BN5 A;  2BE5 D;  3A8J E;  2PCF B;  1BDO A;  1HQM C;  1IYU A;  1H9S A;  2E74 C;  1ZKO A;  4DK1 A;  1VCI A;  3KLR A;  2PNR C;  4I7Z C;  3WDN A;  1B9M A;  4L8J A;  3PUV A;  1YNN C;  3OW7 A;  2O5I C;  3CRL C;  2BE5 C;  1GUO A;  4RCN A;  3HGB A;  4H44 C;  1GUT A;  3OOC A;  1VDZ A;  2EJG C;  4KI0 A;  1Z6H A;  4BA2 I;  3LWU A;  3MXU A;  3M4Y A;  3VR3 A;  3D4R A;  1OXU A;  2V4D A;  2JE6 I;  2A69 D;  3PUY A;  2QF7 A;  1VF7 A;  2JXM B;  1Q1B A;  1I6V C;  1GUN A;  2YYZ A;  3I72 A;  2KCC A;  2CW0 C;  4DNR B;  1EWH A;  3A8I E;  2B8F A;  4HR7 B;  3A7L A;  2E75 C;  2Q8I B;  1IW7 C;  1OXX K;  1H9K A;  2A68 D;  1Q90 A;  4OGQ C;  3M7N A;  3A8K E;  1GHK A;  1GUS A;  2D62 A;  3FMC A;  4PV1 C;  5BN3 A;  1E2Z A;  4IQZ A;  3LNN A;  1E2W A;  4H13 C;  4XTC S;  2NN6 I;  2K32 A;  3QIA A;  1V8Q A;  1Y8P B;  3H94 A;  1H9M A;  3TZU A;  3L7Z C;  2BA1 A;  1LAC A;  2EVB A;  3FPP A;  2AUJ D;  1DXM A;  3M85 A;  1HCZ A;  1SMY C;  1Y8N B;  2AUK A;  2K7V A;  1K8M A;  1ZYR C;  3VR4 A;  4BA1 I;  4DNT B;  1H9J A;  4JK1 C;  1Y8O B;  4KKU A;  1OXS C;  1Q1E A;  1YNJ C;  2ZT9 C;  4IFD G;  1FR3 A;  2BA0 A;  1PMR A;  5KNC A;  4IFD H;  3ND8 A;  1QJO A;  2A69 C;  1V43 A;  2A6E D;  2L5T A;  5KND A;  4OO1 G;  4KN7 C;  4OO1 H;  4KKS A;  1OXV A;  2JEB I;  1TKW B;  3OPO A;  2LMC B;  4KMU C;  3CRK C;  2A6H D;  3RLF A;  1DD2 A;  2JEA I;  3T51 B;  1ONL A;  3GQB A;  3W3A A;  2EJM A;  1Z7T A;  2A6E C;  3A7A B;  1B9N A;  1HTP A;  3QJY A;  2DN8 A;  2A68 C;  4LK1 C;  5K36 H;  4KHZ A;  3U9S A;  2A6H C;  1CI3 M;  4TKO B;  1DCZ A;  1GUG A;  1HPC A;  2E76 C;  1FYC A;  2F1M A;  1H9S B;  3IKJ A;  3I73 A;  4G7O C;  3EQL C;  3MFY A;  2EDG A; 
#chains in the Genus database with same CATH topology
 1KQS B;  2XWB B;  1B8A A;  1GVH A;  1PJ6 A;  2WYR A;  4PMB A;  3LWE A;  2OWO A;  2R7D A;  1YI2 A;  4ZCM A;  5TR9 A;  4YAF A;  3L2P A;  1RIP A;  4XOP A;  1A6X A;  5GV8 A;  1E3Z A;  5C44 B;  3HOY B;  2AWO A;  1Y69 U;  3IFT A;  5J3O A;  3OWE B;  2F0J A;  2F0S A;  1X56 A;  2I5M X;  1VLO A;  3EIV A;  3K7A H;  1QVF A;  2R93 B;  2V7V A;  2VBS A;  4ZKB B;  2XGJ A;  1QWY A;  2IX0 A;  1X6O A;  3GTG B;  2HDN B;  1TVX A;  3BNW A;  3PV0 A;  3VNV A;  2C35 B;  2GRE A;  5FLM G;  1IYV A;  2J4X A;  3V05 A;  1G91 A;  1BX0 A;  1QGA A;  4LFB Q;  4FO2 A;  1G8Z D;  2EPB A;  1N36 Q;  4R4Q A;  4DV6 L;  4FYD A;  2F3W A;  3K6O A;  2DOG A;  2QTZ A;  3PUN A;  1EWC A;  5DAU A;  1Y1W G;  3JC6 6;  2JA8 G;  1STE A;  1YJW A;  4JC0 A;  3WNC A;  4A75 A;  4H44 C;  4C1N I;  1TT2 A;  1QFZ A;  1R9T B;  3H9N A;  2XNA C;  1NUC A;  3T1H L;  4LFA Q;  3CCR A;  4NCN A;  1XTD A;  4WOR A;  3QE2 A;  1VQ4 B;  4BPR A;  4DAM A;  4JI4 Q;  4N8F A;  3OHX C;  4X7F A;  2NPF A;  2QEX B;  1ILQ A;  3H3V I;  1C0A A;  4RD0 A;  1IL2 A;  4HR7 B;  1SE8 A;  3WYA A;  1HTL D;  3M7N A;  1VQ8 B;  3GTO B;  4GOP A;  1VQE A;  1S40 A;  5G3L D;  1VHE A;  2VBV A;  2BPO A;  2WB1 G;  2PLF A;  1E2W A;  4XON A;  1LTS D;  2LXK A;  4JI7 Q;  4XDX A;  2LFN A;  1LTG D;  4N3G A;  1EOT A;  4YAO A;  2I5L X;  2UU9 L;  5BR8 Q;  1AEX A;  1Y14 B;  2XOK A;  1DDI A;  4RPB A;  2BH8 A;  2ZJP A;  3HOV G;  1QG0 A;  2HMA A;  3HOX B;  4C1N K;  2K7V A;  3S14 H;  4K5V A;  3CCE B;  4CDF C;  2H4O A;  2JN9 A;  4OOX A;  4BA1 I;  1EFW A;  3OKX A;  3S15 H;  4P6Y A;  2HT1 A;  2K14 A;  5HXB A;  1YJ9 B;  5C4X H;  1JOK A;  2A1A A;  3TEH B;  2CBX A;  5C4J B;  4DV4 Q;  3D4W A;  4RCY A;  2PYK A;  3CKI B;  4HJA A;  2CHB D;  2ZXH A;  2EJM A;  1WOR A;  3KDF A;  3G6E A;  1ICW A;  3VO2 A;  2A68 C;  2K6A A;  2RDF A;  2A6H C;  1WTH A;  3HOY G;  4OPO A;  1HRJ A;  3G4S A;  4BXX H;  5IYP A;  4DV7 Q;  1PZJ D;  3GV6 A;  1TWC H;  3KF8 A;  1A0I A;  2R93 G;  2D2C C;  1EQV A;  4B4D A;  1LT6 D;  1QH0 A;  1VQK B;  2MUY A;  2VUM H;  4XKV A;  1LTI D;  1ENC A;  3CF5 A;  4AQY Q;  2MJ8 A;  4IJL A;  4Z4T A;  4C43 A;  2HDM A;  5BN4 A;  1EZ8 A;  1TS4 A;  4DQK A;  3I4N H;  1F9Q A;  3L9A X;  5LMU L;  4C3I B;  5C0X J;  1OXT A;  4QF4 A;  1K8A D;  4ZCK A;  3S24 A;  1M90 C;  3BS1 A;  2MHV A;  3SE0 A;  1SE3 A;  5L46 A;  3WND A;  3KK7 A;  3R6K A;  5A2Q L;  3HOU H;  4DU9 A;  3G71 A;  1Q8K A;  2XSC A;  2F0F A;  1JOQ A;  1XB2 A;  1PTO C;  2Q6I A;  4HSV A;  4GZY C;  2E2I B;  1WI5 A;  4J15 A;  4XMY A;  3I55 B;  4P71 A;  4TN1 A;  3I3C A;  1UD8 A;  3BYY B;  1K0S A;  5GAH C;  4ZKC B;  1W87 A;  3E6Z X;  2PCF B;  1W9X A;  3HKZ B;  2X6X A;  3AQQ A;  5B6I A;  5LHY 1;  1GOZ A;  1B9M A;  4ACB A;  1WU8 A;  4PC1 A;  2CCZ A;  5JVH 3;  2NB0 A;  2PI2 A;  4P2C B;  3HKZ E;  3KFU A;  3Q6R A;  3ASS A;  1A2U A;  5JVG 3;  3CME A;  3RR5 A;  4DV3 Q;  4DR2 L;  3W2F A;  1S5F D;  3LWU A;  1VQI A;  2V4D A;  1YLO A;  1FNW A;  3STB C;  2Z1C A;  4E6I A;  1Q82 C;  5EPL A;  3ONY A;  4ASU A;  3CPW A;  4B3T Q;  5TSS A;  1DYQ A;  4G6I A;  1I5F A;  4UY8 C;  2AHO A;  2N55 A;  2XIW A;  2F0H A;  2XNC A;  4B43 A;  2KCT A;  5I2X A;  4RFB A;  1S0U A;  1F2L A;  1P16 A;  2X6G A;  2XRS D;  1FNU A;  4XYQ A;  2D62 A;  3GTK B;  4IFD I;  3CCV B;  2VQE L;  2GJP A;  1EY7 A;  4IO9 A;  3PGZ A;  3RZD H;  5IYN A;  2AMC B;  3H94 A;  1ET9 A;  4DV0 L;  2UUC L;  2FX3 A;  4P9S A;  4Z1M A;  2K03 A;  4IUR A;  4CDC C;  5LL6 S;  3FPP A;  2L4N A;  5ELF A;  5IP9 H;  2PW7 A;  1OB2 A;  4UZU A;  1MSH A;  4IUV A;  1CK1 A;  5JPM C;  1SM4 A;  4J0Q A;  1SYE A;  2PIA A;  2W6J A;  2V7X A;  4AIM A;  3MHP A;  1YIT B;  1YNJ C;  1WCM G;  2WAC A;  3I1F A;  4GNX A;  4LF6 L;  3KUP A;  3RLF A;  2Z6B A;  3PO3 G;  2DY1 A;  2R6H A;  2C4U A;  1ZM2 A;  1UEA B;  4LK1 C;  2V7T A;  1PH5 A;  4K2K A;  3E20 A;  4P3I A;  4A3J B;  3WBK A;  5M5Y B;  4Y7N H;  3OWF A;  3W5H A;  2KVO A;  4Z4U A;  1KD1 D;  1YJN A;  3H0G B;  2ASB A;  2KCN A;  5D3D A;  5F4M A;  1IBK Q;  1X3F A;  2QE7 A;  2RDG A;  1HNX L;  2OT2 A;  1KC8 D;  2KJX A;  3Q38 A;  4X62 Q;  4RAU C;  4JBW A;  4GKK L;  2KVM A;  3T4A C;  4X3S A;  3AYH B;  2OK7 A;  2F4V L;  5HKK A;  4F7X A;  5I9O A;  4GKJ Q;  4XLA A;  3I8Z A;  2F0K A;  2QW7 A;  4M53 A;  3VR5 A;  2PZT A;  5FLX c;  1UD2 A;  5CR3 A;  3HKZ G;  3QR8 A;  2RC6 A;  1Y1V H;  1X9N A;  1CZW A;  2BCO A;  1XNQ L;  4G57 A;  2PZU A;  5E4W C;  5F4J A;  3T56 B;  2K01 A;  1AP0 A;  3P20 A;  1BJK A;  3HFZ B;  3NE5 B;  1FND A;  2F0N A;  3BG3 A;  2KHS A;  2WJY A;  3S1R H;  1K73 C;  3NTH A;  3MMP A;  4ZUI A;  2BV3 A;  3CPX A;  2RA4 A;  4WJW A;  3RNU A;  1EYG A;  1DZ1 A;  1ZKO A;  1HR0 L;  1X3Q A;  4L6T B;  3MEH A;  1VQO A;  1KQS A;  3CCU B;  2LSS A;  1VQB A;  5IYC H;  3TP7 A;  1I7P A;  1KDA A;  4B3M Q;  2JJ2 A;  5IGF A;  2EQS A;  4P1V A;  2SNS A;  4LAA A;  3H3V C;  4JV5 L;  5CDF A;  1BO0 A;  1B3Q A;  1WJJ A;  1KK1 A;  2HIV A;  3VR3 A;  3OEE A;  4UAJ A;  3GSI A;  1EQT A;  2JDI A;  4LW1 A;  1VF7 A;  4Z4Y A;  3OTO L;  4YEL A;  2CF4 A;  1XMO Q;  1RJT A;  2IJ0 A;  4P72 A;  4JI8 L;  3B6Y A;  3J80 i;  4DV2 L;  2VZA A;  4IUN A;  5EAY A;  1QCB D;  4OGQ C;  1WOC A;  1RD9 D;  4FVM A;  1GUS A;  3ZC3 A;  3M4Q A;  4K1X A;  1XXG A;  5M3F B;  2L15 A;  3BZC A;  5JJI A;  3JQP A;  5C6A A;  4ZCI A;  1TXY A;  1HUM A;  1E3X A;  3VYT A;  4H02 A;  4KV6 A;  4U68 A;  4DR4 Q;  2DIE A;  5C5M A;  4YHB A;  1K8M A;  1LT3 D;  1PFM A;  2F0P A;  4A3M G;  4WFN 3;  3WNB A;  4IZ8 A;  1KTV A;  3LQ6 A;  1OGJ A;  1QUF A;  1BMF A;  1SNQ A;  2BA0 A;  4HMJ A;  1PMR A;  4H9G A;  4OP7 A;  4A3J G;  1VQ4 A;  1FNM A;  4OO1 G;  3MEF A;  4RH6 A;  4KKS A;  2Y0S B;  5KIX A;  1D6E C;  2K05 A;  3OPO A;  4TMW A;  2EE1 A;  1TS2 A;  2QEX A;  4KMU C;  1MD2 D;  3H0G G;  1O7Y A;  1ONL A;  2VQF Q;  5FO8 B;  3J80 L;  4LUV A;  4QVA A;  2KOL A;  2GQF A;  1VQJ A;  1VQ8 A;  3N52 A;  4P3Y A;  4U9U A;  1VQM B;  3UDI A;  4WZE A;  2YU9 B;  2IL8 A;  1I6H B;  2F1M A;  1Q7Y D;  2GVB A;  2I1L A;  4HSP A;  3MFY A;  2F0L A;  1GO2 A;  5LMZ A;  1EOV A;  4HCE A;  2I0Q A;  5E4X A;  1WTX A;  3OSO A;  3TME A;  1TU2 B;  3FDT A;  4TMZ A;  4PAB A;  1NRK A;  2NN6 H;  1LUZ A;  3CCE A;  1EFR A;  2BMW A;  3GTL B;  4GQN A;  3CCL B;  3D31 A;  5HGQ A;  2BH2 A;  5IYW A;  4IUQ A;  2EIF A;  1NJI D;  1TWC B;  2NUC A;  1YJ9 A;  4FWT A;  1TWF B;  3GVL A;  2E1B A;  1ZM3 A;  2FVG A;  3AGP A;  1PH6 A;  5C3E B;  2Z9H A;  4RKL A;  2JK8 A;  5C0X H;  3ZYY X;  1MJE A;  3MXN B;  3ND9 A;  1CTM A;  2YV5 A;  3TP5 A;  2L1B A;  3I4N B;  4GLA C;  1O7L A;  1E24 A;  4JI5 Q;  4M1K A;  3KYH C;  3M7G A;  1JOO A;  4QUZ A;  2OEO A;  1BCP B;  3S1Q H;  3UDX A;  3NP8 A;  5A2Q E;  1OTC A;  2CVR A;  3CXC A;  2R7Z H;  2B2U A;  3NQI A;  4QMG A;  5GQO A;  5L37 A;  1VQK A;  1YX2 A;  1ZYR D;  1G6Z A;  1IBM Q;  2LXJ A;  3DEP A;  4FDB A;  1EFT A;  2Z6K C;  2QDB A;  2F3I A;  2PMZ B;  2HQL A;  5M3F G;  4XL9 A;  3ASR A;  3K57 A;  4CDD C;  2NYZ D;  5M5W B;  1PTO H;  1KZL A;  3AVX A;  3NWT A;  2B3G A;  1PH7 A;  2MGS A;  3I55 A;  1HR0 W;  5BN3 A;  4XTC S;  3U50 C;  1KDB A;  2UUB L;  2F52 A;  1X65 A;  3GP7 A;  2TSS A;  1JE5 A;  1H9M A;  1NR4 A;  5J1Z A;  5IWA L;  4YWL A;  2Y0S G;  3FJO A;  1F20 A;  2Q8R E;  4IFD J;  3QFT A;  4A3E B;  3SJZ A;  3DMU A;  3ZJY C;  4DXG A;  2WZP P;  4LF8 L;  5HZA A;  1STH A;  3QB3 A;  4HE6 A;  3FHW A;  3PO2 B;  4OEM B;  2DER A;  1PRT B;  1OXS C;  4CJ1 B;  4X06 A;  4Y52 H;  4YEJ A;  1Q81 C;  5C4X G;  5EMN A;  4ME5 A;  5CV9 A;  1F9R A;  1TKW B;  3HOZ H;  4G7X A;  4KY7 A;  4TSF A;  5ELC A;  5E6T A;  1DD2 A;  1MAB A;  4K6D A;  3CC2 B;  1Z7T A;  4KY6 A;  1ESR A;  1HTP A;  2AQ2 B;  4A3B H;  3C1E A;  4YCV A;  2XGT A;  5C5L A;  4PMW A;  1FJG L;  3GTQ H;  3NHH A;  3CCV A;  4OOS A;  4BXX G;  1PRT D;  2CC2 A;  3U9O A;  4B48 A;  4F7D A;  3I73 A;  3IKJ A;  3CMM A;  1JB9 A;  1S4Z A;  2R92 B;  3E1Y E;  3T53 B;  1JB3 A;  1RDP D;  2N3S A;  4C3J H;  2F03 A;  2VUM G;  3A74 A;  5EKI A;  3TN2 A;  4CJ0 B;  3TSS A;  4XIG S;  4X07 A;  4TMV A;  1PTO F;  4N9P A;  3I4N G;  2A73 B;  3I90 A;  4BWG B;  2CND A;  1VQF A;  3H09 A;  4DR1 L;  3J81 E;  4N8X 1;  3ZZ0 A;  3RLN A;  1YIT A;  1M1K C;  1C4Q A;  4XR6 A;  4WRD A;  5JJL A;  3NXW A;  3DWA A;  2D74 A;  2CW0 D;  3HOU G;  1HFN A;  3A5U A;  4AYB B;  3MVV A;  3FKI H;  3RN5 A;  1YHQ B;  4CJ2 C;  2E2H B;  1WOP A;  1VQL B;  1UNS A;  3J80 c;  1N08 A;  1D5Z C;  1UD4 A;  3NBH B;  3WOF A;  4RA8 A;  4KKT A;  2ZJR A;  4DUY L;  2XWJ B;  3N6R A;  3OW2 B;  1STA A;  5JOB A;  2BDO A;  4DR7 Q;  3JAM L;  2KBN A;  4B3S Q;  1I4H A;  1JA0 A;  5E7N A;  3VYU A;  1R5O A;  5IP7 G;  1HQM C;  3D6C A;  1F2Z A;  4QUF A;  1Z47 A;  3SKB A;  3I4M B;  1KJZ A;  1VQC A;  4IUP A;  5M3M B;  4L63 B;  1STN A;  2K5H A;  1Q3L A;  4CHT B;  2KQ3 A;  1EY8 A;  2JA7 H;  3SK6 A;  2B2Y A;  3T13 A;  5IGB A;  3M4Y A;  1STG A;  2A74 C;  2L11 A;  2E1R A;  3GVK A;  1MIU A;  4DR6 L;  4UHV A;  3G7L A;  1CKO A;  4A3C H;  4YY3 Q;  1EU4 A;  2HQE A;  3BYT B;  5K5P A;  3K59 A;  4GOP C;  1K0R A;  1ASY A;  1K28 D;  4A3I H;  3CP2 A;  5C4Z A;  3NQT A;  1K3R A;  2Q8I B;  1OXX K;  3PQI A;  4A3E G;  4OX9 Q;  1B53 A;  2MO1 A;  3FMC A;  1B2T A;  4B47 A;  3GTP H;  4Y7C A;  4RDK A;  2GN5 A;  2MQH A;  3R93 A;  5IYD G;  1WTR A;  4TSS A;  1Y0R A;  2MPM A;  3MZ5 A;  1N07 A;  4JI1 L;  1SN8 A;  5HGT A;  5IP9 G;  3E0E A;  3CCU A;  3EJI A;  3R2I A;  4A3D H;  4P12 A;  5HY6 A;  4DAY B;  2WIN B;  3S17 B;  1R4P B;  3I4O A;  1JT8 A;  4NXM Q;  1Y1W B;  3R8B A;  3B78 A;  3V96 A;  1UAP A;  3J7A 5;  2JA8 B;  1G7R A;  2VXW A;  1IJF A;  3ISX A;  4RPD A;  3ICE A;  4LMQ D;  2QCP X;  1H95 A;  3EVQ A;  3L0O A;  2RCF A;  1FNV A;  2O4X A;  3BZD B;  4X65 Q;  3CRK C;  5GAD C;  1J5E L;  2WZN A;  4A3F H;  2A6E C;  1T6X A;  1HA6 A;  2F0T A;  2UUA L;  2LY7 A;  1KK2 A;  1LV9 A;  4K8I A;  4RD3 A;  1N34 L;  1XNR L;  2EDG A;  3M4O H;  1I4Q A;  1SNM A;  2CW5 A;  1KDC A;  1C7Y A;  2K5Q A;  4K8J A;  4AYB G;  2JJQ A;  4NW2 A;  4BY1 H;  5AN9 A;  1SMX A;  4PC6 A;  1LT4 D;  3HOV B;  4CKB A;  4DPG A;  2ZTD A;  2WPD A;  1SXT A;  1QE6 A;  2XN9 C;  4OWX B;  3V7A A;  1EQR A;  1IHM A;  1MI2 A;  3SLN A;  1KRH A;  4WZK A;  1Y1V G;  1JCK B;  2QDX A;  4X7D A;  4K5W A;  1DM0 B;  1EY9 A;  5CMD A;  1PYS B;  1UE5 A;  1PXU A;  1CM9 A;  5M3M G;  2X8K A;  4PQX A;  2DYI A;  1CT1 D;  2D0P A;  3RMH A;  4DV5 L;  1GHJ A;  1VQM A;  1I3Q H;  2O5J C;  4RG1 A;  4JPB W;  4ROX A;  2I07 B;  2MNA A;  4J6H A;  1IYU A;  3CW2 A;  2R7F A;  5AJ3 L;  4RLZ A;  1VCI A;  5KGU A;  4IW3 B;  2V7U A;  4PZ8 A;  4C2M H;  3A55 A;  4PC7 A;  2O5I C;  1HHV A;  5IYC G;  2PO4 A;  1GUO A;  3UI2 A;  4YHH L;  2ZXP A;  3QOL A;  4PC2 A;  4APV A;  2K1B A;  1W0K A;  1JQY D;  1TS3 A;  3O13 A;  2N88 A;  3G6J B;  3CCL A;  1G51 A;  5FOB B;  4K5X A;  1CA5 A;  4R4C A;  3I91 A;  3ONA B;  2B2V A;  2G9D A;  1GUN A;  3ULJ A;  1UE1 A;  1GR1 A;  1EYD A;  1YIJ B;  2PNH A;  5BSY A;  1D2B A;  1RL2 A;  4PGO A;  3MXN A;  1HXY D;  2A68 D;  4IN3 A;  3VYS A;  2NVY B;  1CQV A;  4XQQ A;  2UXD L;  5THX A;  5IK2 A;  4XLH A;  4GN4 B;  1A8P A;  5EGT A;  2BGJ A;  4NDX A;  4TRD A;  4GS3 A;  2EVB A;  2ZM6 L;  4JI0 L;  3Q24 A;  1HCZ A;  1DOM A;  2ZTC A;  4HTH A;  5IT9 E;  1EU3 A;  1PH1 A;  1TVC A;  3HKS A;  5F4O A;  4DR2 Q;  3GO5 A;  4ALP A;  4DNT B;  4GNX C;  4JK1 C;  5C4H A;  1CKN A;  4JG2 A;  3SXH A;  4IFD H;  4O0A A;  1EUJ A;  5IOC A;  2L5T A;  3TQY A;  3VYR A;  1SFO B;  3PSI A;  4X7C A;  2C5B A;  2JEA I;  2V31 A;  5EKK A;  2LKV A;  3W3A A;  3A7A B;  3TDQ A;  1MSG A;  2ATW A;  1IKM A;  3A54 A;  4XOT A;  2VQE Q;  2N49 A;  3CCS B;  3S1M H;  5IGE A;  4JI2 L;  1HQR D;  2DJF C;  3OFN A;  4X66 L;  1FYC A;  3LVB A;  1II3 A;  1G7S A;  5D65 A;  4DV0 Q;  2KEN A;  2HD3 A;  1N32 Q;  1Q86 C;  2HUG A;  5FKA C;  1SAP A;  4UP9 A;  3M9B A;  4F8M A;  4K0K Q;  3HOW H;  1SJH D;  4ODG A;  1UE6 A;  2ZBV A;  3E0J A;  4HID A;  3TRZ A;  4B3R Q;  3I4L A;  2VNU D;  2NN6 G;  3GTQ B;  4K2L A;  2WAQ B;  4DK0 A;  1QVG B;  2HCC A;  3PCO B;  4OON A;  4KHP L;  3STB D;  2PPB C;  1TII D;  4MNO A;  1KHI A;  1JJ2 B;  4GLX A;  3SK8 A;  3S16 H;  2C78 A;  4J8Q A;  1WCM B;  1LTL A;  1S3O A;  3GD7 A;  3A0J A;  5C0X G;  4DGZ A;  3CC2 A;  3R6J A;  3A35 A;  1YNN D;  2HHH L;  3PO3 B;  2FMC A;  2VZL A;  4JOI A;  1K3B C;  2RDH A;  2BE5 D;  5BN5 A;  2E5L L;  1EYC A;  1F9P A;  2QEJ C;  1PVO A;  1B3A A;  2Q2I A;  3J81 j;  2VNI A;  3FKI B;  3NSW A;  2K5N A;  1HNX Q;  1E22 A;  1ESF A;  1QIL A;  1U9R A;  4II3 A;  3DWP A;  2R7Z G;  2ZZE A;  4PZ7 A;  4GKK Q;  2GVA A;  1CNF A;  1OB5 A;  1JWS D;  1L1O B;  1GUW A;  4QHY A;  3AVY A;  1WSR A;  3T1Y Q;  1GXD C;  2F4V Q;  1YHA A;  3JAM E;  1Z6H A;  2Q2T A;  4DK6 C;  5JBQ A;  2F0O A;  4XQN A;  1SJE D;  5J39 A;  1TS5 A;  1VMP A;  1YHQ A;  1D1K A;  1EWH A;  1VQL A;  2GK6 A;  4QJF A;  2M2L A;  3NBH A;  3MTS A;  1EIG A;  3OW2 A;  1F9S A;  2LS0 1;  4JYA Q;  2AWN A;  4AF6 A;  1I50 B;  4P73 A;  2E2J H;  4IUU A;  3S1N H;  3TZU A;  1LO5 D;  1DAR A;  2VW9 A;  1K28 A;  4DNI A;  4RWS C;  2BF4 A;  4LFB L;  1CHP D;  1GVP A;  3KBX A;  4X3U A;  1C48 A;  1RTO A;  4CKC A;  4TVA B;  4JCV E;  3U4Z A;  5KYL A;  2ZZQ A;  1Y8N B;  4FP5 D;  4Z4W A;  4LBY A;  2K75 A;  4OXP A;  1T6Y A;  1VMC A;  2M00 A;  4X8I A;  3FVQ A;  3R2T A;  1ZEQ X;  2M9V A;  5KND A;  5DS0 A;  3OTO Q;  5FA6 A;  1Y0Y A;  4EQ5 A;  3HOZ G;  4F88 A;  5CV5 A;  4LFA L;  1OB0 A;  4DV2 Q;  3KBG A;  3DM3 A;  4HED A;  3J81 i;  3QFC A;  5FJ8 G;  4JI4 L;  4A3B G;  1W3S A;  5I6Y A;  3OZV A;  1K73 D;  2WAQ G;  4X64 Q;  2NVQ B;  1K9M D;  1N8R C;  5FO0 A;  4P26 A;  1SDF A;  4C3H H;  4C3J G;  3MWY W;  3TBI B;  4JI7 L;  4G7H C;  2QA4 B;  5IGG A;  1JJC B;  3PUW A;  1PKV A;  3FKS A;  4DAY A;  3CC4 B;  1AZQ A;  3Q3A A;  5TY0 A;  4EGV A;  1HJP A;  1NB9 A;  4YWM A;  3HAG A;  3P75 A;  4R4T A;  3ULP A;  4A3M B;  1VHO A;  3NUC A;  2B63 H;  3PF4 A;  4RKB A;  5K36 G;  3FKI G;  2SOB A;  3W2H A;  1K8A C;  4X05 A;  1CUK A;  4Q7J B;  1BCP F;  1N05 A;  3J81 L;  1CNE A;  1Q12 A;  4YAL A;  2JA6 H;  4Y9R A;  1YBY A;  2IHF A;  3VA7 A;  3ERS X;  4DV4 L;  4KK7 A;  2F4I A;  1K83 B;  1BKB A;  1G29 1;  4IPD A;  2B2U C;  4LC0 A;  1EZ6 A;  1E1R A;  1EWY A;  3KLR A;  4U67 3;  3MAQ A;  2X6Y A;  3GIR A;  4L8J A;  4QFM A;  3W2D A;  1HNW Q;  3AGQ A;  3OW7 A;  1JR0 D;  4A3G H;  1SYC A;  1BOS A;  1VQ5 A;  4BBS H;  1A2T A;  1QVC A;  4NMZ A;  4DV7 L;  1PH3 A;  4XNF A;  2JA7 G;  4CGY B;  3CCM B;  2RSO A;  3AEV A;  4O2D A;  3P1H A;  2EYH A;  1OXU A;  3AU7 A;  1I4P A;  3NBI A;  4MYU A;  1GAW A;  4NB3 A;  4A3C G;  5CBE E;  4AQY L;  2OXP A;  4XN3 A;  2MO0 A;  4II2 A;  4G1V A;  2HCI A;  4A3I G;  1EEI D;  2ICI A;  3GTM H;  3K7A B;  1C8C A;  4TMX A;  2YWE A;  3SEJ A;  1X3P A;  1IW7 C;  3MA2 B;  1GHK A;  2XND A;  1TWA H;  4XT3 B;  2Q6O A;  5FL7 A;  2V7Q A;  3BVZ A;  4NXN Q;  4A3L H;  5GAG C;  3W2G A;  1KL9 A;  4P22 A;  4RDL A;  2ZIT A;  1H8E A;  2IHE A;  5NUC A;  1AFP A;  2C9O A;  4BBR H;  2JA9 A;  3TS0 A;  4QQB X;  5DN6 A;  1PV4 A;  2ZTG A;  1SMY C;  1UD6 A;  2ID0 A;  1BXT A;  4BY7 H;  4DXF A;  1EFC A;  3PIP A;  3ZUG A;  5E1F A;  2GJK A;  1BVS A;  2QGQ A;  4AVZ A;  4QIW B;  2B7C A;  4ACA A;  1OHH A;  3X3N A;  5CC4 A;  2WKC A;  3S2H H;  2NVX H;  2LMC B;  4DV3 L;  4RD1 A;  4RJL A;  3ULL A;  4QIW E;  1YEZ A;  4A3F G;  5EJW A;  2X3U A;  1V1P B;  2F0W A;  2Q2H A;  3ES9 A;  4HJ5 A;  4B3T L;  3EFX D;  4JBK A;  2UUB Q;  1QB5 D;  5JEA J;  2ZXI A;  3JU4 A;  2F0E A;  1U0L A;  4LF9 Q;  4RHR A;  3D8G A;  3WQZ A;  4KY5 A;  1LTT D;  4B08 A;  2YWG A;  1COW A;  1WTQ A;  1KK0 A;  1D5M C;  1OO9 B;  1IBL Q;  2CRV A;  5T1I A;  3KJO A;  3F2C A;  1X3G A;  3RN2 A;  1I8D A;  4H0L C;  1AIP A;  2YWH A;  4ZGN B;  4LUZ A;  1O80 A;  2VBT A;  3W1B A;  2TMP A;  1SYF A;  1PLF A;  2KED A;  3ERQ A;  4RMF A;  5JAV A;  1A15 A;  2RVL A;  3S14 B;  3K58 A;  2B2T A;  2Q2U A;  1A63 A;  3OIQ A;  3PMF A;  2Z4I A;  4LF7 L;  1EP2 B;  3FEW X;  3S15 B;  2Y0S E;  1QGZ A;  2OBT A;  1S72 B;  2RC5 A;  3VMF A;  1B1Z A;  1EP3 B;  2DY8 A;  3K0X A;  2JA5 H;  3VDY A;  4JBM A;  2J7Z A;  4DR5 L;  4X6A H;  3BVG A;  5C4X B;  1TWH H;  2VS1 A;  1CQF A;  4JI3 Q;  1F2M A;  1FJG Q;  4X3K A;  3PIP 3;  1LYL A;  1CFM A;  1GD7 A;  4UDU C;  4DV1 Q;  3OAA A;  3CCS A;  2ES2 A;  4YWK A;  1ZUN B;  5JPN C;  3IFD A;  4KD3 A;  2IX3 A;  2PNR C;  4YAW A;  3Q6Q A;  4OOV A;  3C3L A;  1UD3 A;  4DAP A;  4DAV A;  3NPP A;  2B2Y C;  4Q5V A;  4MHE A;  1PH4 A;  2B2W A;  3OIP A;  3PEN A;  4F87 A;  4A93 H;  2R9V A;  4DR1 Q;  1QVG A;  2UXB Q;  2HDL A;  2VUM B;  4YAU A;  3E9I A;  1Q81 D;  4QUC A;  5FLX E;  1BNZ A;  4YIJ A;  3PA2 A;  1F60 A;  1XX8 A;  3WWV A;  2F0G A;  1TWG H;  1JJ2 A;  4LNQ A;  1MKH A;  3BC9 A;  1S5E D;  3DM1 A;  3KJP A;  1BF4 A;  4GKJ L;  1PH8 A;  3L3O C;  3J81 c;  4O42 A;  4PG3 A;  4NNJ A;  1Q90 A;  1NAP A;  3CQZ H;  3QOJ A;  3HOU B;  4X0C A;  1UMK A;  1ASZ A;  3U2Q A;  4MYT A;  3QIA A;  5D3I B;  1IJE A;  1E0B A;  2VB3 X;  1N06 A;  1V1O A;  4JBJ A;  4MTK A;  1VJS A;  1V5V A;  2UXC L;  5IGD A;  4X7E A;  5C44 H;  3HOY H;  1VQH A;  3M85 A;  2L0C A;  3CB4 A;  1L1O A;  1HZA A;  5LL6 X;  3OMC A;  2R93 H;  1SRU A;  4P25 A;  4OPV A;  1HH2 P;  3ZZU A;  2E2J B;  4IFD G;  3GTG H;  4XKW A;  2PMZ E;  4B3M L;  5IT9 L;  1STY A;  1WTV A;  1QNU A;  4M2L A;  1BUV T;  1D8T A;  2BVN A;  3VNU A;  1OXV A;  5J22 A;  2BSA A;  2EXD A;  1RCV D;  2YWF A;  4WZL A;  1S5B D;  1NY4 A;  4JVZ A;  3FPK A;  4ID6 A;  4C0S A;  4HJ8 A;  2EIX A;  1KNE A;  2D9U A;  3KL9 A;  1XMO L;  1ET6 A;  1EY0 A;  1HPC A;  3D4D A;  3J7Z C;  1MRZ A;  1T5X D;  1FL0 A;  3HP3 A;  1NMF A;  1W2B B;  1R9T H;  2YTV A;  3EQL C;  1SSO A;  1HNZ L;  3ZBT A;  3HRZ C;  3TRE A;  3RZD B;  1KRS A;  1NCV A;  2HIX A;  4LBW A;  1TR5 A;  4POG A;  1KNA A;  1SBB B;  2Q6K A;  2QGG A;  2EFG A;  4YCW A;  5CV7 A;  1T5E A;  1B70 B;  3H91 A;  1YZ6 A;  3NWS A;  1R4Q B;  5I9P A;  1RF2 D;  4DR4 L;  1PJ7 A;  1EY5 A;  3HS0 C;  1QFJ A;  4YXW A;  3VR2 A;  3JAM i;  3P7J A;  1UEB A;  3B8H A;  3K5M A;  3I7F A;  4LFC L;  4XOR A;  2DNC A;  2ZTE A;  2D3L A;  5TRD A;  1G2S A;  1S5C D;  3PUM A;  4Q0F A;  2WP8 J;  4IAL A;  3K8A A;  4CBV A;  3CW2 C;  5GRO A;  1AE2 A;  3KLS A;  3PIO A;  5LMN Q;  2OQK A;  3FP9 A;  4P6V F;  1V9P A;  3A8J E;  3Q8D A;  1HZB A;  4EX5 A;  1UE7 A;  2VQF L;  3HOX H;  2FMM A;  2BDN A;  3U6K A;  2EYL A;  4DK1 A;  4DUZ Q;  4OIK A;  5ELB A;  4Y7N B;  3MXP A;  2JA6 B;  2QA4 A;  2KCM A;  1BQE A;  1XMQ L;  3CC4 A;  5KRU A;  1BBX C;  1EFU A;  1U2R A;  2VYQ A;  2B2V C;  3ZBU A;  2QTL A;  1JE4 A;  1PA6 A;  5C4J H;  4RDJ A;  1N9W A;  3F1Z A;  2VB2 X;  2CFM A;  5IYR A;  2V1C C;  4XYO A;  1X32 A;  5IE8 A;  2A19 A;  1FRQ A;  4AYB E;  2QIL A;  3K5N A;  5G3L F;  2B8F A;  2D0O A;  4FF3 A;  3A7L A;  1H9K A;  1Y1V B;  4DV5 Q;  4ZAI A;  1WD1 A;  5A88 A;  2GPJ A;  1EWI A;  2IPK D;  4B9X A;  3LNN A;  4PAA A;  1BCP C;  5I6W A;  2NN6 I;  2EYF A;  4G1B A;  4DQL A;  4XLF A;  3J7Y W;  1VQ7 B;  2EY1 A;  4DKA C;  2BN4 A;  3S1R B;  2VNK A;  2M5S A;  3GTM B;  1F77 A;  4G7W A;  2LZJ A;  1DXM A;  4QY7 A;  3SR1 A;  3UE1 A;  3TS2 A;  3E5S A;  4C3I H;  1G7C A;  4RD4 A;  2I46 A;  1NTG A;  2B29 A;  2L12 A;  1QGY A;  4R8I A;  3K5L A;  3PIO 3;  3CCM A;  1WTW A;  2EXZ A;  1P8L A;  3I2Z A;  3BVM A;  1QJO A;  2A69 C;  3AST A;  3ND8 A;  2E8G A;  1BBW A;  4AF7 A;  3QO2 A;  2OQ0 A;  4B44 A;  4XT1 B;  2XNJ A;  4DV6 Q;  4HIO A;  2AQ3 B;  3T51 B;  4JI6 L;  2WFW A;  1H42 A;  4ZLT F;  4L5S A;  4K14 A;  3IL8 A;  4KTA A;  4KJN A;  4FXD A;  3GTJ H;  3KLW A;  3S2H B;  1VQP B;  1MBY A;  2NVX B;  2ZL5 A;  1GJR A;  1BQQ T;  1EYA A;  1SLJ A;  1AN8 A;  4FF2 A;  3T1H Q;  3H3V H;  4OHJ A;  1KMH A;  4Z4R A;  2BM0 A;  1LAB A;  3TP8 A;  2FHT A;  1MGS A;  2BGI A;  1JWM D;  1PRT C;  4EQP A;  3BY2 A;  5JEA H;  1GKH A;  1SNO A;  2H1E A;  5TV2 A;  2KUM A;  1UD5 A;  1VQ6 B;  2AKW B;  1ML0 D;  3TP6 A;  2EYM A;  5KNB A;  4TQU S;  5IYB H;  2O2L D;  2B63 G;  3P26 A;  3AVV A;  1T6Z A;  3GTK H;  1NE3 A;  2D5D A;  3A3B A;  1A3U A;  3GV3 A;  1N33 L;  4JOI C;  1LTA D;  1JA1 A;  1V1P A;  1W34 A;  4DR3 L;  5J35 A;  2JA6 G;  2C5H A;  4XQJ A;  2UU9 Q;  1IXR A;  2IW3 A;  2R6G A;  3QG1 A;  3DLL A;  3A5Z B;  3ZIA A;  2ZL6 A;  1VQ9 B;  5I4D A;  2NVT H;  1JIC A;  2PW5 A;  3CU7 A;  3CRL C;  1DOL A;  2ICE C;  4UPA A;  4BBS G;  1I4G A;  1KTK A;  1LTR D;  3R3O A;  1PDQ A;  1I94 L;  4BA2 I;  1I4R A;  1XPU A;  2KHI A;  2HLD A;  2VJI A;  3ITP A;  2FXQ A;  2QF7 A;  1IKL A;  3AFP A;  4UP8 A;  3V2T A;  2F4N A;  3AVU A;  1I6V C;  2NTT A;  1A8V A;  2KCC A;  1OGI A;  1S72 A;  2WII B;  4DNR B;  3PVD A;  2MFI A;  3KLS X;  2X85 A;  3A8I E;  1PFN A;  2JP1 A;  4A3J H;  3DWQ A;  2E75 C;  3AVT A;  2P5Z X;  3EA6 A;  5M5Y H;  2ZXR A;  1PHJ A;  1ROD A;  4PV1 C;  3RUZ A;  5E3F A;  1Q8I A;  3H0G H;  5DLQ E;  4A3L G;  1P4M A;  2X0K A;  4A3K H;  2E5L Q;  3W2I A;  3CAM A;  4BBR G;  1Q86 D;  4EQN A;  4B3F X;  4R1J A;  1LT5 D;  3J81 k;  4PNY A;  2PQA B;  4DR7 L;  2HCJ B;  1J9Z A;  5LMU Q;  3WY9 A;  4B3S L;  3DUZ A;  4Z9C B;  2AUK A;  3S1Q B;  4I7A A;  1SYG A;  4L5Q A;  2R7Z B;  5CV6 A;  1BX1 A;  2CH4 W;  3CTA A;  2DET A;  3CHB D;  2ZT9 C;  1U5K A;  4LF4 L;  1G6P A;  1SEB D;  3S9W A;  3SGI A;  5FK9 C;  5EPK A;  2FIN B;  1NBW A;  3UE0 A;  3JAM c;  4OPS A;  1O7I A;  3NK9 A;  2A6H D;  2BM1 A;  3BY1 A;  4AH6 A;  3AMU A;  5FO7 B;  2VNJ A;  3SJP A;  2DN8 A;  4RGM A;  4YY3 L;  3F2D A;  1PTO B;  4HJ7 A;  1GUG A;  1EQQ A;  1SYB A;  2SNM A;  1F2Y A;  4OX9 L;  3OZU A;  3GDE A;  3BZK A;  3NEL A;  3BH4 A;  4G5G A;  1IYJ B;  3F2U A;  3Q23 A;  1D8L A;  1M90 D;  4OEL B;  3UDG A;  4LF5 L;  4L5T A;  4G4K A;  2GA4 B;  2N78 A;  1K8G A;  4HJ9 A;  4ZCL A;  1E2V A;  1PTO D;  4XXE A;  1SNP A;  3CRZ A;  4NXM L;  4QCL A;  2NTS A;  1YHB A;  1JWU D;  4GLV B;  2JA5 G;  4XLE A;  2NZ1 D;  3SHL A;  5M3F H;  3CPF A;  1H9R A;  4FN5 A;  2UUC Q;  4XQF A;  3HOZ B;  2EY2 A;  3K81 C;  2JN4 A;  1BPL A;  3Q6S A;  4X65 L;  1EY4 A;  3WBJ A;  4LUO A;  2JIZ A;  2ZBU A;  3MCA A;  1O7Z A;  4A3B B;  5M9O A;  2ZZF A;  1W2B A;  3PUV A;  1ZXT A;  2X53 S;  4WJ4 A;  1XQB A;  3F8T A;  1TTT A;  2Z0S A;  1Q82 D;  4A93 G;  2N8N A;  4LF6 Q;  4B9W A;  2WAQ E;  4C3J B;  2V7W A;  4DN4 M;  3KEW A;  2F0V A;  3ASP A;  3QSY A;  2IX1 A;  5IIF A;  1TY0 A;  2R61 A;  4DK3 C;  3WXM A;  3PA1 A;  1D5X C;  1EIY B;  4M4S A;  4MTN A;  2XZL A;  4M0L A;  1D1I A;  1HFG A;  2YU9 H;  3A8J A;  3BCD A;  5FLX L;  1Q46 A;  1I6H H;  3A8K A;  1SND A;  2FFK B;  4M1U B;  1D7Q A;  1E2Z A;  1C9O A;  2K5V A;  1WPC A;  1QNK A;  4OO1 I;  2RBM A;  1N8R D;  5JJK A;  2BA1 A;  1KXL A;  5C44 G;  1NSN S;  2Q6L A;  1G2T A;  3GTL H;  1AH9 A;  1YNJ D;  2SEB D;  5LMN W;  3VR4 A;  3Q0A A;  3CXC B;  1H9J A;  1TWF H;  1XNQ Q;  5DSZ A;  4WZT A;  2EOT A;  5KNC A;  5C3E H;  1XJV A;  1LLR D;  2JA7 B;  1H8H A;  1RKN A;  1VS0 A;  2L55 A;  5FO1 A;  2PZW A;  3GQB A;  2B5O A;  2VJJ A;  3TZD A;  4POF A;  1HR0 Q;  3QJY A;  4RM0 A;  1IL8 A;  2EY6 A;  4KHZ A;  1UWV A;  4A3I B;  1CI3 M;  4LBV A;  2VY3 A;  2F0Q A;  1CSQ A;  1N36 L;  4WWV A;  5ELO A;  4JV5 Q;  1VQ7 A;  2J7K A;  1U4P A;  1JB7 A;  1W0J A;  3GTP B;  2SDF A;  1GJX A;  4KLK A;  3MC0 B;  4GN5 A;  1ELO A;  2DY7 A;  2Z8L A;  5IP7 H;  2XVS A;  5KEE A;  1WD0 A;  3AVW A;  2KEE A;  2B2T C;  3GTJ B;  4JI8 Q;  5CV8 A;  4TMT A;  5M5W H;  4A3D B;  2OTL B;  4QVJ A;  2B8G A;  4A76 A;  3OMG A;  4ZV4 A;  2OTJ B;  1PYW D;  1VQN B;  2VNH A;  5C3W A;  4CKE A;  3U6B A;  1TQO A;  1XWE A;  3E3X A;  4I65 A;  2B7B A;  1XE1 A;  3JQR A;  2RSN A;  4PC3 A;  1IW7 D;  2EY5 A;  4XD7 A;  2RHS B;  1B50 A;  4QV2 A;  2NWG A;  4V0B A;  2Q8T A;  2QMU A;  2Z4H A;  4A3F B;  3IRB A;  1XTC D;  4N9T A;  3LQE A;  1HVX A;  3HOX G;  4A3E H;  1VQP A;  4P75 A;  4B3G A;  2B2W C;  4I7Z C;  3C2P A;  1B4O A;  1YNN C;  2VL6 A;  3PO2 H;  3VO1 A;  3BDL A;  5BR8 L;  5IYD H;  2BE5 C;  1G7T A;  2P3M A;  3HGB A;  1VQA A;  1SMY D;  3KF6 B;  1LM0 A;  3DEO A;  1VDZ A;  3FRP B;  1FRN A;  1ICF B;  2EJG C;  1N32 L;  3CP0 A;  4KI0 A;  3M4O B;  3I70 A;  1IZ6 A;  4RD2 A;  3BCF A;  2WKD A;  4K0K L;  3ASQ A;  1VQ5 B;  3CMA B;  4BY1 B;  1SNC A;  1VQ6 A;  1TUI A;  4LF7 Q;  2NVT B;  4B3R L;  4RCZ A;  2DEU A;  2JXM B;  4N3N A;  4EQO A;  5F2D A;  4M8A A;  5M5X H;  4FF4 A;  1UUP A;  4DR5 Q;  1RQP A;  1D1N A;  3CCJ B;  3SVM A;  1DON A;  1WFQ A;  3W5V A;  1EIF A;  4LBZ A;  4P2N A;  2R92 H;  4H13 C;  3ERO A;  2ZXO A;  1Y8P B;  1WP6 A;  1HZ9 A;  1B2R A;  4FK8 A;  4EVO A;  3M4P A;  1TLL A;  1CA6 A;  3L7Z C;  1L1O C;  1DJR D;  1LAC A;  2CWP A;  1I3Q B;  1VQ9 A;  3M3Y H;  2RF4 A;  4C3I G;  2QKI C;  2OBS A;  1W6J A;  4IOC A;  2RHQ B;  4C2M B;  1JJG A;  3D26 A;  4A3K B;  1YVC A;  4RD6 A;  4KKU A;  1BBU A;  1CKM A;  2X69 A;  3NEN A;  3K5O A;  2OK8 A;  2PE3 A;  2E2H H;  1ZM9 A;  3A8I A;  2CQO A;  3T1Y L;  2JEB I;  1L0Y B;  3RY8 A;  1W6K A;  1I4X A;  1KRT A;  4HE5 A;  2JSO A;  3OZW A;  1PRT F;  1QX4 A;  3S2D H;  3SLD A;  3I4M H;  4P74 A;  3X3M A;  4A3D G;  5M3M H;  5T1G A;  3RZO H;  1NDH A;  1H9S B;  3CCQ B;  2UXC Q;  3EBE A;  3OE7 A;  2W6I A;  2EYO A;  3ZPN A;  2PQA A;  2EYJ A;  5BSX A;  5JEA G;  1DG1 G;  1QUQ B;  2DNE A;  4JYA L;  5CV4 A;  1K9M C;  3DDY A;  1K8O A;  3RD4 A;  3DXJ C;  5CYU A;  1PFS A;  4LJZ C;  2RCN A;  3DHQ A;  3K80 C;  2ZL7 A;  1I18 A;  5ISR A;  1YIJ A;  4Z4S A;  1AZP A;  4KN4 C;  5IYB G;  3CES A;  1STB A;  3Q39 A;  5H59 A;  2K28 A;  3MHB A;  2KEC A;  2MP1 A;  4IUT A;  4ZGQ B;  3SDZ A;  3QFR A;  1SE4 A;  4QL5 A;  3VR6 A;  1S5D D;  5FLM H;  1WYD A;  2F43 A;  5IWA Q;  3AB9 A;  5DEH A;  4JMQ A;  2OF1 A;  2IY5 B;  3PUX A;  3C46 A;  5HZB A;  3I56 B;  3CD6 B;  5EQ0 A;  4LF8 Q;  3T16 A;  2R3Z A;  2C5C A;  1FVI A;  4BY1 G;  1HNZ Q;  3S17 H;  3WOE A;  1KD1 C;  3S1M B;  1KIX A;  4R4O A;  4XN0 A;  1Y1W H;  1HZE A;  4ZRZ A;  2JA8 H;  3A1P A;  1KC8 C;  5KSW B;  3A3G A;  4X64 L;  3K0Y A;  1JC7 A;  3HOW B;  5EBD A;  4KJO A;  1IB0 A;  5KYI A;  3PF5 A;  2X6L A;  1PH9 A;  3H6M A;  2JE6 I;  2ZTN A;  2CWA A;  4NKL A;  2ZJQ A;  4WJ3 M;  5KNL A;  2K52 A;  1Q1B A;  4Y9U A;  4IOA A;  4IPH A;  3G48 A;  1EIH A;  1PYB A;  4LFC Q;  3H15 A;  1QFY A;  1XYI A;  1U4L A;  5ELD A;  4FXG C;  2RKS A;  1WDT A;  1QG7 A;  2QDL A;  3E9H A;  3S16 B;  4MZ9 A;  5EPJ A;  4IQZ A;  1GAQ A;  3F2B A;  4A3K G;  5IY0 A;  1FNC A;  1V8Q A;  3CC7 B;  2E2D C;  1S4M A;  1CQX A;  1GM5 A;  4HN7 A;  1PFB A;  4LWC A;  3U4V A;  2IWH A;  3RLO A;  1YI2 B;  3BDC A;  1V0E A;  4XLC A;  4DF7 A;  1IBK L;  3HOV H;  1XMQ Q;  1XFO A;  4X62 L;  4TT3 A;  1VQG A;  4ZQ3 A;  3U58 A;  1HNW L;  1TY2 A;  1Y8O B;  2I5H A;  4OIJ A;  1CZG A;  2F0M A;  2DGY A;  1QVF B;  1EP1 B;  5ELE A;  4DUY Q;  4KN7 C;  1KLU D;  3D3R A;  2OYN A;  2YTX A;  1WTO A;  4ZYS A;  2WR8 A;  4Z4V A;  4K6L A;  5J3B A;  2XTI A;  1E3P A;  1E62 A;  4ZK9 B;  2D9R A;  2CH4 A;  4NBS A;  1XPR A;  4PZ6 A;  3SEB A;  3FPU B;  3LX0 A;  1SR3 A;  1ZM4 A;  3VA5 A;  5A89 A;  4G7O C;  2F0U A;  1SKQ A;  1NBM A;  4ZUJ A;  1YJW B;  3PUZ A;  1B7Y B;  1WVL A;  1R5N A;  1ENA A;  1DOK A;  1M1K D;  1VF5 C;  4NXN L;  4DR6 Q;  3S1N B;  2XZP A;  3EN2 A;  5A35 A;  4WQM A;  3CCR B;  2OCE A;  2JQO A;  4CDE C;  3GVJ A;  3HG9 A;  3SK4 A;  5H1S E;  1RQR A;  2AQ1 B;  1IHZ A;  1HA5 A;  1QZH A;  4OWW B;  2EZV A;  1DDG A;  2DCU A;  2IT1 A;  3AFQ A;  4RGN A;  1AW7 A;  1PJ5 A;  1CKN B;  4GN3 B;  4R8N A;  2K33 A;  2NVY H;  4JI6 Q;  3HZX A;  4HIK A;  1N0V C;  1NB0 A;  2DUD A;  1DGS A;  3ONU A;  4GOP B;  4ABN A;  3ZZT A;  4JI1 Q;  1J8I A;  1RTN A;  1X54 A;  1NMG A;  1BCP D;  1HUN A;  1X3E A;  3HOW G;  1MJC A;  5ELN A;  2ZZG A;  3OEH A;  5DNF A;  2F0I A;  4FXK C;  1R5B A;  5FNZ A;  2B39 A;  1Q7Y C;  4V19 0;  1D2E A;  2RQX A;  1MHW C;  5FO9 B;  3J7A V;  4HMI A;  4B3X A;  3URY A;  2KHJ A;  1Q9S A;  4QGU A;  1WTP A;  1NR2 A;  3OOC A;  3NTK A;  2K04 A;  4LF9 L;  1L0X B;  3OYY A;  5KW9 A;  1YNX A;  4EH1 A;  1BLI A;  4C3H B;  1EXM A;  1SFO H;  1IBL L;  3GTO H;  1W35 A;  5IYQ A;  2BOS A;  3D4R A;  1J5E Q;  2OTL A;  3KOJ A;  3ER0 A;  2A69 D;  3OJX A;  3PUY A;  5CGK A;  1Z9F A;  2OTJ A;  1NJI C;  1VQN A;  1FGU A;  2G5D A;  2YYZ A;  1B23 P;  4S3S A;  2UUA Q;  1N33 Q;  2XEX A;  2YTY A;  4DR3 Q;  3KDF B;  3J7A F;  3G6E B;  1N34 Q;  3D6W A;  2VBU A;  1NNX A;  2B63 B;  1XNR Q;  3A8K E;  2NZO A;  4YCU A;  5A8A A;  4ILW A;  3MFG A;  4FF1 A;  2A8V A;  4RCO A;  1M4V A;  1FD7 D;  3G4S B;  4BS9 A;  1ILP A;  2GK7 A;  5FJ8 H;  1WOO A;  3D0F A;  3V76 A;  2J0T D;  5M5X B;  3OP1 A;  3KF8 B;  4PMC A;  1SKY B;  2A5H A;  4JI3 L;  4X3T A;  4R4I A;  1KAA A;  1SE2 A;  4DV1 L;  4R9W A;  1KK3 A;  3KF6 A;  4DFA A;  1I94 Q;  1ZYR C;  1WSV A;  4A3G B;  3BQJ A;  1V1Q A;  1JNY A;  1Q1E A;  2D3N A;  1QUE A;  5C3E G;  4UAI A;  5COR A;  1WTH D;  1WCM H;  1FDR A;  5EKL A;  3CMA A;  1VQD A;  2A6E D;  1PH2 A;  4BBS B;  1L2F A;  2CQA A;  3M3Y B;  2WJV A;  2CK3 A;  3G71 B;  2K4K A;  5C3X A;  2UXB L;  2ALY B;  1LTB D;  1SRO A;  3PO3 H;  2EYP A;  3CCJ A;  2K5D A;  5AJ3 Q;  1CSP A;  2H5X A;  5K36 H;  4RGT A;  4IJH A;  2F1L A;  1KAB A;  4JW0 A;  1DCZ A;  4JI5 L;  2E76 C;  4YHH Q;  2QN6 A;  1TWA B;  3OJW A;  3Q22 A;  1BR9 A;  5IGC A;  5GV7 A;  1PZK D;  4UZE A;  3K7U C;  5C0X I;  5CBA E;  1A62 A;  4HAE A;  3W1G A;  3NEM A;  3QWN A;  1L0W A;  4BBR B;  4NP5 A;  1E1T A;  4RGO S;  4C56 C;  4MN3 A;  2F3V A;  3CME B;  3S2D B;  2E2I H;  5FIU A;  1IBM L;  2C2W A;  3QFS A;  3JQQ A;  2PI2 E;  4DA2 A;  4LF4 Q;  3RZO B;  1O78 A;  4BY7 B;  3CP8 A;  1QOH A;  4O1N A;  2C77 A;  3BDO A;  5DM6 3;  1E64 A;  3CPW B;  2KA7 A;  4ME3 A;  1B44 D;  5DM7 3;  2UXD Q;  1J9O A;  4G7Z C;  4HCS A;  2AHO B;  4IPC A;  3C1F A;  1U4M A;  4NPS A;  1RHP A;  1I50 H;  2EJF C;  2C4T A;  3IAY A;  1J6Q A;  2ZM6 Q;  4JI0 Q;  2XZO A;  1E1Q A;  4C3H G;  1SYD A;  1A3V A;  1FNB A;  1BDO A;  3NTI A;  1E63 A;  1H9S A;  2E74 C;  3CCQ A;  4Z4Z A;  3WDN A;  1JMC A;  4XM3 A;  2NV4 A;  1FGB D;  3PO2 G;  4IPG A;  4RCN A;  1VLY A;  1QUQ A;  1X55 A;  1GUT A;  4LF5 Q;  4H7B A;  5IT9 c;  4MIU A;  4A4I A;  2WSS A;  1KAW A;  3BJU A;  4HIM A;  3MXU A;  5EBC A;  2ENB A;  2OBR A;  1H85 A;  2NZH A;  4KHV A;  1EFI D;  3HEJ A;  4GNX B;  3I72 A;  5COY A;  2Z6K A;  4E0F A;  2CW0 C;  5HUR A;  3W5U A;  4JI2 Q;  4X66 Q;  1PZI D;  1EY6 A;  1HA3 A;  4FNF A;  4J1M A;  4L5R C;  1QZG A;  3SK5 A;  1CHQ D;  2NVQ H;  1JOR A;  1KLG D;  2DJG C;  4OL7 A;  2JA5 B;  1FX0 A;  4KD4 A;  1EL0 A;  4AC9 A;  1M8A A;  2PMD A;  4CQJ A;  1T9H A;  2R92 G;  5D14 A;  4A3G G;  1TWH B;  2K32 A;  2XRQ D;  2K50 A;  1E79 A;  3I56 A;  3CD6 A;  1YJN B;  1HZC A;  3LO8 A;  5IOD A;  2AUJ D;  4KHP Q;  5LMN L;  3MXG A;  1GO3 E;  2Z6B D;  4RHS A;  2JYO A;  3B82 A;  2FJ2 A;  2GJR A;  2X6W A;  2WB1 B;  4UZF A;  5H5J A;  4ULL A;  4A3M H;  4DUZ L;  4QB4 A;  5JJZ A;  1N0U A;  4OWT B;  3J80 E;  1E43 A;  4UP7 A;  1EEF D;  1FR3 A;  2K5W A;  5AFW A;  1XPO A;  3W2E A;  5GAE C;  1V43 A;  4A93 B;  3G05 A;  4OO1 H;  2NBF A;  2WB1 E;  4HIZ A;  2L9H A;  2HHH Q;  2F0D A;  1AMO A;  1V0F A;  2WV6 D;  1AE3 A;  1K83 H;  3W5O A;  2PQE A;  2JJ1 A;  1B9N A;  1TWG B;  3UDF A;  1E1O A;  1U4R A;  3A56 A;  4R71 A;  1WOS A;  3P27 A;  3U9S A;  1E7Z A;  5I2Y A;  3I4M G;  4TKO B;  1A3T A;  2G9H D;  3LGJ A;  1ENF A;  3BU2 A;  3CC7 A;  4BY7 G;  4FXU A;  3CQZ B;  1VQO B;  2CKZ B; 
#chains in the Genus database with same CATH homology
 2XWB B;  4PMB A;  3LWE A;  4XOP A;  1A6X A;  1E3Z A;  5C44 B;  3HOY B;  2AWO A;  1Y69 U;  3IFT A;  3OWE B;  2F0J A;  2F0S A;  2R93 B;  4ZKB B;  2XGJ A;  1QWY A;  2IX0 A;  3GTG B;  3PV0 A;  1TVX A;  1IYV A;  2J4X A;  3V05 A;  1G91 A;  4FO2 A;  1G8Z D;  2EPB A;  4FYD A;  2F3W A;  3K6O A;  1EWC A;  5DAU A;  1STE A;  4H44 C;  4C1N I;  1TT2 A;  1R9T B;  2XNA C;  1NUC A;  4WOR A;  3OHX C;  1ILQ A;  4HR7 B;  1HTL D;  3M7N A;  3GTO B;  5G3L D;  1E2W A;  4XON A;  1LTS D;  4XDX A;  2LFN A;  1LTG D;  1EOT A;  1AEX A;  2XOK A;  3HOX B;  4C1N K;  2K7V A;  4K5V A;  2H4O A;  4BA1 I;  1JOK A;  5C4J B;  3D4W A;  2PYK A;  3CKI B;  2CHB D;  2ZXH A;  2EJM A;  1ICW A;  2A68 C;  2K6A A;  2RDF A;  2A6H C;  1HRJ A;  1PZJ D;  3GV6 A;  3KF8 A;  2D2C C;  1EQV A;  1LT6 D;  2MUY A;  4XKV A;  1LTI D;  1ENC A;  2MJ8 A;  2HDM A;  5BN4 A;  1EZ8 A;  1TS4 A;  1F9Q A;  3L9A X;  4C3I B;  5C0X J;  1OXT A;  4QF4 A;  3BS1 A;  2MHV A;  3SE0 A;  1SE3 A;  3KK7 A;  5A2Q L;  4DU9 A;  2XSC A;  2F0F A;  1JOQ A;  1PTO C;  4HSV A;  4GZY C;  2E2I B;  4XMY A;  3I3C A;  1UD8 A;  3BYY B;  4ZKC B;  3E6Z X;  2PCF B;  1W9X A;  3HKZ B;  2X6X A;  5LHY 1;  1GOZ A;  1B9M A;  5JVH 3;  2NB0 A;  4P2C B;  1A2U A;  5JVG 3;  1S5F D;  3LWU A;  2V4D A;  1FNW A;  2Z1C A;  4E6I A;  5EPL A;  4ASU A;  5TSS A;  1DYQ A;  4G6I A;  2N55 A;  2XIW A;  2F0H A;  5I2X A;  4RFB A;  1F2L A;  2X6G A;  2XRS D;  1FNU A;  4XYQ A;  2D62 A;  3GTK B;  4IFD I;  2GJP A;  1EY7 A;  3H94 A;  1ET9 A;  4Z1M A;  2K03 A;  4IUR A;  5LL6 S;  3FPP A;  2L4N A;  5ELF A;  2PW7 A;  4UZU A;  1MSH A;  4IUV A;  1CK1 A;  5JPM C;  1SYE A;  2W6J A;  1YNJ C;  2WAC A;  3KUP A;  3RLF A;  1UEA B;  4LK1 C;  4K2K A;  4A3J B;  5M5Y B;  3OWF A;  2KVO A;  3H0G B;  2KCN A;  5D3D A;  2RDG A;  2QE7 A;  2OT2 A;  2KJX A;  4RAU C;  4JBW A;  2KVM A;  3T4A C;  4X3S A;  5HKK A;  4F7X A;  5I9O A;  4XLA A;  3I8Z A;  2F0K A;  3VR5 A;  2PZT A;  1UD2 A;  5CR3 A;  1CZW A;  2BCO A;  4G57 A;  2PZU A;  5E4W C;  2K01 A;  3T56 B;  1AP0 A;  3P20 A;  3NE5 B;  2F0N A;  3BG3 A;  2KHS A;  2WJY A;  3NTH A;  4ZUI A;  2RA4 A;  4WJW A;  1DZ1 A;  1ZKO A;  1X3Q A;  4L6T B;  3MEH A;  3TP7 A;  1KDA A;  2JJ2 A;  5IGF A;  2SNS A;  3H3V C;  4LAA A;  5CDF A;  1BO0 A;  3VR3 A;  3OEE A;  1EQT A;  2JDI A;  1VF7 A;  4YEL A;  1RJT A;  2IJ0 A;  4IUN A;  1QCB D;  4OGQ C;  1RD9 D;  4FVM A;  1GUS A;  1XXG A;  5M3F B;  5C6A A;  1HUM A;  1E3X A;  3VYT A;  4KV6 A;  4U68 A;  2DIE A;  5C5M A;  1K8M A;  1LT3 D;  1PFM A;  2F0P A;  4WFN 3;  4IZ8 A;  1BMF A;  1SNQ A;  2BA0 A;  4HMJ A;  1PMR A;  4OO1 G;  5KIX A;  4RH6 A;  4KKS A;  2Y0S B;  1D6E C;  2K05 A;  3OPO A;  2EE1 A;  1TS2 A;  4KMU C;  1MD2 D;  1O7Y A;  1ONL A;  5FO8 B;  3J80 L;  2KOL A;  3N52 A;  2YU9 B;  2IL8 A;  1I6H B;  2F1M A;  4HSP A;  3MFY A;  2F0L A;  4HCE A;  5E4X A;  1WTX A;  3OSO A;  3TME A;  1TU2 B;  3FDT A;  1NRK A;  2NN6 H;  1EFR A;  3GTL B;  4GQN A;  3D31 A;  4IUQ A;  1TWC B;  2NUC A;  1TWF B;  3GVL A;  2E1B A;  5C3E B;  4RKL A;  5C0X H;  3ZYY X;  3ND9 A;  1CTM A;  3TP5 A;  3I4N B;  2L1B A;  1O7L A;  3M7G A;  1JOO A;  2OEO A;  1BCP B;  5A2Q E;  3NP8 A;  2CVR A;  2B2U A;  3NQI A;  4QMG A;  1ZYR D;  1G6Z A;  3DEP A;  2QDB A;  2PMZ B;  4XL9 A;  3K57 A;  2NYZ D;  5M5W B;  1PTO H;  1KZL A;  3NWT A;  2MGS A;  5BN3 A;  4XTC S;  1KDB A;  3GP7 A;  2TSS A;  1H9M A;  1NR4 A;  5J1Z A;  2Q8R E;  4IFD J;  4A3E B;  3DMU A;  4DXG A;  2WZP P;  1STH A;  3QB3 A;  3PO2 B;  1PRT B;  1OXS C;  4CJ1 B;  4YEJ A;  4ME5 A;  5CV9 A;  1F9R A;  1TKW B;  4G7X A;  4KY7 A;  4TSF A;  5ELC A;  1DD2 A;  1MAB A;  4K6D A;  1Z7T A;  4KY6 A;  1ESR A;  1HTP A;  2AQ2 B;  3C1E A;  5C5L A;  4PMW A;  3NHH A;  1PRT D;  3U9O A;  3IKJ A;  3I73 A;  3CMM A;  1S4Z A;  2R92 B;  3T53 B;  1JB3 A;  1RDP D;  2F03 A;  5EKI A;  3TN2 A;  4CJ0 B;  3TSS A;  4XIG S;  1PTO F;  4N9P A;  2A73 B;  3I90 A;  4BWG B;  3H09 A;  3J81 E;  1C4Q A;  4XR6 A;  4WRD A;  3NXW A;  3DWA A;  2CW0 D;  1HFN A;  4AYB B;  3MVV A;  4CJ2 C;  2E2H B;  1UNS A;  1D5Z C;  1UD4 A;  3WOF A;  4RA8 A;  4KKT A;  2XWJ B;  3N6R A;  1STA A;  5JOB A;  2BDO A;  3JAM L;  1I4H A;  3VYU A;  1HQM C;  3D6C A;  1F2Z A;  4QUF A;  1Z47 A;  3I4M B;  4IUP A;  5M3M B;  4L63 B;  1STN A;  1Q3L A;  4CHT B;  2KQ3 A;  1EY8 A;  3SK6 A;  2B2Y A;  3T13 A;  5IGB A;  3M4Y A;  1STG A;  2A74 C;  2L11 A;  3GVK A;  3G7L A;  1EU4 A;  2HQE A;  3BYT B;  5K5P A;  3K59 A;  1K28 D;  3CP2 A;  5C4Z A;  3NQT A;  2Q8I B;  1OXX K;  1B53 A;  3FMC A;  1B2T A;  3R93 A;  1WTR A;  4TSS A;  2MPM A;  3MZ5 A;  5HGT A;  3EJI A;  3R2I A;  2WIN B;  3S17 B;  1R4P B;  1Y1W B;  3R8B A;  2JA8 B;  3V96 A;  1UAP A;  2VXW A;  4LMQ D;  2QCP X;  3EVQ A;  1FNV A;  2O4X A;  3BZD B;  3CRK C;  2A6E C;  1HA6 A;  2F0T A;  2LY7 A;  1LV9 A;  4K8I A;  2EDG A;  1I4Q A;  1SNM A;  1KDC A;  2K5Q A;  4K8J A;  4NW2 A;  1LT4 D;  3HOV B;  4CKB A;  2WPD A;  1SXT A;  1QE6 A;  2XN9 C;  1MI2 A;  1JCK B;  4K5W A;  1DM0 B;  1EY9 A;  5CMD A;  1PXU A;  1CM9 A;  2X8K A;  4PQX A;  1CT1 D;  3RMH A;  1GHJ A;  2O5J C;  2I07 B;  4J6H A;  1IYU A;  1VCI A;  5KGU A;  3A55 A;  2O5I C;  1HHV A;  2PO4 A;  1GUO A;  3UI2 A;  2ZXP A;  3QOL A;  2K1B A;  1W0K A;  1JQY D;  1TS3 A;  3O13 A;  2N88 A;  3G6J B;  5FOB B;  4K5X A;  1CA5 A;  3I91 A;  3ONA B;  2B2V A;  2G9D A;  1GUN A;  1EYD A;  1D2B A;  3MXN A;  1HXY D;  2A68 D;  4IN3 A;  3VYS A;  2NVY B;  1CQV A;  4XQQ A;  5IK2 A;  4XLH A;  5EGT A;  4NDX A;  4TRD A;  2EVB A;  3Q24 A;  1HCZ A;  1DOM A;  4HTH A;  5IT9 E;  1EU3 A;  3GO5 A;  4DNT B;  4JK1 C;  5C4H A;  3SXH A;  4IFD H;  5IOC A;  2L5T A;  3VYR A;  1SFO B;  2JEA I;  2V31 A;  5EKK A;  2LKV A;  3W3A A;  3A7A B;  3TDQ A;  1MSG A;  1IKM A;  3A54 A;  4XOT A;  5IGE A;  1HQR D;  3OFN A;  1FYC A;  1II3 A;  5D65 A;  2HUG A;  5FKA C;  1SAP A;  4F8M A;  1SJH D;  4ODG A;  3E0J A;  3I4L A;  2VNU D;  2NN6 G;  3GTQ B;  4K2L A;  2WAQ B;  4DK0 A;  2HCC A;  2PPB C;  1TII D;  3SK8 A;  4J8Q A;  1WCM B;  3GD7 A;  5C0X G;  4DGZ A;  3A35 A;  1YNN D;  3PO3 B;  2FMC A;  2RDH A;  2BE5 D;  5BN5 A;  1EYC A;  1F9P A;  2QEJ C;  1B3A A;  3FKI B;  3NSW A;  1ESF A;  1QIL A;  1U9R A;  4II3 A;  3DWP A;  2ZZE A;  1JWS D;  1GUW A;  1GXD C;  3JAM E;  1Z6H A;  2F0O A;  4XQN A;  1SJE D;  5J39 A;  1TS5 A;  1VMP A;  1D1K A;  1EWH A;  2GK6 A;  2M2L A;  3NBH A;  3MTS A;  1EIG A;  1F9S A;  2LS0 1;  2AWN A;  1I50 B;  4IUU A;  3TZU A;  1LO5 D;  4RWS C;  1CHP D;  3KBX A;  4X3U A;  4CKC A;  1C48 A;  1RTO A;  5KYL A;  2ZZQ A;  1Y8N B;  4FP5 D;  3FVQ A;  1VMC A;  2M00 A;  3R2T A;  1ZEQ X;  2M9V A;  5KND A;  4F88 A;  5CV5 A;  1OB0 A;  3KBG A;  4HED A;  5I6Y A;  2NVQ B;  1SDF A;  4C3J G;  3MWY W;  3TBI B;  4G7H C;  5IGG A;  3PUW A;  1PKV A;  3FKS A;  4DAY A;  1AZQ A;  4EGV A;  3HAG A;  3P75 A;  4A3M B;  3NUC A;  4RKB A;  5K36 G;  2SOB A;  1BCP F;  3J81 L;  1Q12 A;  3VA7 A;  4KK7 A;  2F4I A;  1K83 B;  1G29 1;  2B2U C;  1EZ6 A;  1E1R A;  3KLR A;  4U67 3;  3MAQ A;  2X6Y A;  4L8J A;  3W2D A;  3OW7 A;  1JR0 D;  1SYC A;  1BOS A;  1A2T A;  4NMZ A;  4XNF A;  4CGY B;  2RSO A;  3P1H A;  2EYH A;  1OXU A;  3AU7 A;  1I4P A;  3NBI A;  5CBE E;  2OXP A;  4XN3 A;  4II2 A;  2HCI A;  1EEI D;  2ICI A;  3K7A B;  1C8C A;  1X3P A;  1IW7 C;  3MA2 B;  1GHK A;  2XND A;  4XT3 B;  5FL7 A;  2V7Q A;  3BVZ A;  5NUC A;  4P22 A;  1H8E A;  1AFP A;  2C9O A;  5DN6 A;  2ZTG A;  1SMY C;  1UD6 A;  2ID0 A;  1BXT A;  4DXF A;  5E1F A;  2GJK A;  4AVZ A;  4QIW B;  1OHH A;  3X3N A;  5CC4 A;  2WKC A;  2LMC B;  5EJW A;  1V1P B;  2F0W A;  3EFX D;  1QB5 D;  5JEA J;  2ZXI A;  3JU4 A;  2F0E A;  4RHR A;  3D8G A;  3WQZ A;  4KY5 A;  1LTT D;  4B08 A;  1COW A;  1WTQ A;  1D5M C;  1OO9 B;  5T1I A;  1I8D A;  4H0L C;  1O80 A;  2TMP A;  1SYF A;  1PLF A;  2KED A;  3ERQ A;  5JAV A;  1A15 A;  2RVL A;  3S14 B;  3K58 A;  2B2T A;  3OIQ A;  3PMF A;  2Z4I A;  3S15 B;  3FEW X;  1B1Z A;  2DY8 A;  2J7Z A;  3BVG A;  5C4X B;  1CQF A;  1F2M A;  4X3K A;  3PIP 3;  1CFM A;  4UDU C;  3OAA A;  5JPN C;  3IFD A;  4KD3 A;  2IX3 A;  2PNR C;  3C3L A;  1UD3 A;  4DAP A;  4DAV A;  3NPP A;  2B2Y C;  4Q5V A;  4MHE A;  2B2W A;  3OIP A;  4F87 A;  2R9V A;  2HDL A;  2VUM B;  5FLX E;  4QUC A;  1BNZ A;  4YIJ A;  1XX8 A;  2F0G A;  3BC9 A;  1S5E D;  3DM1 A;  1BF4 A;  3L3O C;  4O42 A;  4NNJ A;  1Q90 A;  1NAP A;  3QOJ A;  3HOU B;  3QIA A;  5D3I B;  1E0B A;  2VB3 X;  1V1O A;  1VJS A;  5IGD A;  3M85 A;  2L0C A;  5LL6 X;  3OMC A;  2E2J B;  4IFD G;  4XKW A;  5IT9 L;  1STY A;  1WTV A;  1OXV A;  1BUV T;  1QNU A;  5J22 A;  1RCV D;  1S5B D;  4ID6 A;  1KNE A;  2D9U A;  1ET6 A;  1EY0 A;  1HPC A;  3D4D A;  1T5X D;  3HP3 A;  3EQL C;  1SSO A;  3HRZ C;  3RZD B;  1NCV A;  1TR5 A;  1KNA A;  1SBB B;  5CV7 A;  1T5E A;  3H91 A;  3NWS A;  1R4Q B;  5I9P A;  1RF2 D;  1EY5 A;  3HS0 C;  4YXW A;  3VR2 A;  3P7J A;  3K5M A;  4XOR A;  2DNC A;  2D3L A;  4Q0F A;  1G2S A;  1S5C D;  4CBV A;  2WP8 J;  4IAL A;  3KLS A;  3A8J E;  2FMM A;  2BDN A;  2EYL A;  4DK1 A;  4OIK A;  5ELB A;  4Y7N B;  3MXP A;  2JA6 B;  4V19 0;  5KRU A;  1BBX C;  2B2V C;  1JE4 A;  2VB2 X;  4XYO A;  1X32 A;  2QIL A;  3K5N A;  5G3L F;  2B8F A;  4FF3 A;  3A7L A;  1H9K A;  1Y1V B;  4ZAI A;  1WD1 A;  2IPK D;  5I6W A;  4B9X A;  3LNN A;  1BCP C;  2NN6 I;  2EYF A;  4XLF A;  3J7Y W;  2EY1 A;  3S1R B;  2M5S A;  3GTM B;  1F77 A;  4G7W A;  2LZJ A;  1DXM A;  3SR1 A;  3E5S A;  2I46 A;  2L12 A;  4R8I A;  3K5L A;  3PIO 3;  1WTW A;  2EXZ A;  3BVM A;  1QJO A;  2A69 C;  3ND8 A;  3QO2 A;  4XT1 B;  2AQ3 B;  3T51 B;  4ZLT F;  4K14 A;  3IL8 A;  4KTA A;  4KJN A;  4FXD A;  3S2H B;  1MBY A;  2NVX B;  1BQQ T;  1EYA A;  1AN8 A;  4FF2 A;  4OHJ A;  1KMH A;  1LAB A;  3TP8 A;  2FHT A;  1MGS A;  1PRT C;  1JWM D;  4EQP A;  5JEA H;  1SNO A;  2H1E A;  2KUM A;  1UD5 A;  1ML0 D;  3TP6 A;  2EYM A;  5KNB A;  4TQU S;  2O2L D;  2D5D A;  3A3B A;  1A3U A;  3GV3 A;  1LTA D;  1V1P A;  4XQJ A;  2IW3 A;  2R6G A;  3QG1 A;  3ZIA A;  5I4D A;  1JIC A;  2PW5 A;  3CU7 A;  3CRL C;  1DOL A;  2ICE C;  1I4G A;  1KTK A;  1LTR D;  3R3O A;  1PDQ A;  4BA2 I;  1I4R A;  2HLD A;  2VJI A;  3ITP A;  2QF7 A;  1IKL A;  3V2T A;  1I6V C;  2NTT A;  2KCC A;  2WII B;  4DNR B;  3KLS X;  2X85 A;  3A8I E;  1PFN A;  2JP1 A;  3DWQ A;  2E75 C;  3EA6 A;  2ZXR A;  1ROD A;  4PV1 C;  3RUZ A;  5E3F A;  1Q8I A;  4EQN A;  4B3F X;  1LT5 D;  4PNY A;  3DUZ A;  4Z9C B;  2AUK A;  3S1Q B;  1SYG A;  2R7Z B;  5CV6 A;  3CHB D;  2ZT9 C;  1SEB D;  3S9W A;  5FK9 C;  5EPK A;  2FIN B;  3NK9 A;  3AMU A;  2A6H D;  5FO7 B;  2DN8 A;  4RGM A;  1PTO B;  1GUG A;  1SYB A;  2SNM A;  1F2Y A;  3BH4 A;  3F2U A;  3Q23 A;  4G4K A;  2GA4 B;  1E2V A;  1PTO D;  4XXE A;  1SNP A;  4QCL A;  2NTS A;  1JWU D;  4XLE A;  2NZ1 D;  3SHL A;  1H9R A;  4XQF A;  3HOZ B;  2EY2 A;  1BPL A;  3Q6S A;  1EY4 A;  2JIZ A;  1O7Z A;  4A3B B;  5M9O A;  2ZZF A;  3PUV A;  1ZXT A;  2X53 S;  4B9W A;  4C3J B;  4DN4 M;  3KEW A;  2F0V A;  2IX1 A;  5IIF A;  1TY0 A;  2R61 A;  1D5X C;  2XZL A;  1D1I A;  1HFG A;  3BCD A;  5FLX L;  1SND A;  2FFK B;  4M1U B;  1E2Z A;  1WPC A;  1QNK A;  4OO1 I;  2RBM A;  2BA1 A;  1NSN S;  1G2T A;  1YNJ D;  2SEB D;  3VR4 A;  3Q0A A;  1H9J A;  2EOT A;  5KNC A;  1LLR D;  2JA7 B;  1H8H A;  1RKN A;  2L55 A;  2PZW A;  3GQB A;  2VJJ A;  3TZD A;  3QJY A;  1IL8 A;  2EY6 A;  4KHZ A;  4A3I B;  1CI3 M;  2F0Q A;  1U4P A;  1W0J A;  3GTP B;  2SDF A;  1GJX A;  3MC0 B;  2DY7 A;  2Z8L A;  2XVS A;  5KEE A;  1WD0 A;  2KEE A;  2B2T C;  3GTJ B;  5CV8 A;  4A3D B;  2B8G A;  3OMG A;  1PYW D;  5C3W A;  4CKE A;  1TQO A;  1XWE A;  4I65 A;  2RSN A;  1IW7 D;  2EY5 A;  4XD7 A;  1B50 A;  4V0B A;  2NWG A;  2Q8T A;  2Z4H A;  4A3F B;  1XTC D;  4N9T A;  1HVX A;  4B3G A;  2B2W C;  4I7Z C;  3C2P A;  1B4O A;  1YNN C;  3BDL A;  2BE5 C;  3HGB A;  1SMY D;  3DEO A;  1VDZ A;  3FRP B;  2EJG C;  3M4O B;  4KI0 A;  3I70 A;  3BCF A;  2WKD A;  4BY1 B;  1SNC A;  2NVT B;  2JXM B;  4EQO A;  5F2D A;  4M8A A;  4FF4 A;  1UUP A;  1DON A;  3SVM A;  4H13 C;  3ERO A;  2ZXO A;  1Y8P B;  1WP6 A;  4EVO A;  1CA6 A;  3L7Z C;  1DJR D;  1LAC A;  1I3Q B;  4C3I G;  2QKI C;  1W6J A;  4C2M B;  4A3K B;  4KKU A;  2X69 A;  3K5O A;  2JEB I;  1L0Y B;  1W6K A;  1I4X A;  2JSO A;  1PRT F;  3X3M A;  5T1G A;  1H9S B;  3OE7 A;  2W6I A;  2EYO A;  3ZPN A;  2EYJ A;  5JEA G;  2DNE A;  5CV4 A;  3DDY A;  1K8O A;  3RD4 A;  3DXJ C;  5CYU A;  4LJZ C;  3DHQ A;  1I18 A;  1AZP A;  5ISR A;  4KN4 C;  3CES A;  1STB A;  2K28 A;  3MHB A;  2KEC A;  2MP1 A;  4IUT A;  3SDZ A;  1SE4 A;  3VR6 A;  1S5D D;  2F43 A;  3AB9 A;  5DEH A;  4JMQ A;  2OF1 A;  3PUX A;  3C46 A;  5EQ0 A;  3T16 A;  2R3Z A;  2C5C A;  3WOE A;  3S1M B;  4XN0 A;  1HZE A;  4ZRZ A;  3A3G A;  3K0Y A;  1JC7 A;  3HOW B;  5EBD A;  4KJO A;  5KYI A;  2X6L A;  3H6M A;  2JE6 I;  2ZTN A;  4NKL A;  5KNL A;  1Q1B A;  1EIH A;  1XYI A;  1U4L A;  5ELD A;  4FXG C;  2RKS A;  1QG7 A;  3S16 B;  5EPJ A;  4IQZ A;  1V8Q A;  2E2D C;  4HN7 A;  1PFB A;  2IWH A;  3BDC A;  1V0E A;  4XLC A;  4DF7 A;  4TT3 A;  4ZQ3 A;  1TY2 A;  1Y8O B;  4OIJ A;  1CZG A;  2F0M A;  5ELE A;  4KN7 C;  1KLU D;  3D3R A;  1WTO A;  4ZYS A;  4K6L A;  4ZK9 B;  3SEB A;  3FPU B;  3LX0 A;  3VA5 A;  4G7O C;  2F0U A;  1NBM A;  4ZUJ A;  3PUZ A;  1WVL A;  1ENA A;  1DOK A;  1VF5 C;  3S1N B;  2XZP A;  5A35 A;  3GVJ A;  3HG9 A;  3SK4 A;  2AQ1 B;  1IHZ A;  1HA5 A;  2EZV A;  2IT1 A;  4RGN A;  1AW7 A;  4R8N A;  2K33 A;  3HZX A;  4ABN A;  1J8I A;  1RTN A;  1BCP D;  1HUN A;  2ZZG A;  3OEH A;  5DNF A;  2F0I A;  4FXK C;  2B39 A;  2RQX A;  5FO9 B;  3J7A V;  4HMI A;  3URY A;  1WTP A;  1NR2 A;  3OOC A;  3NTK A;  2K04 A;  1L0X B;  1BLI A;  4C3H B;  2BOS A;  3D4R A;  5CGK A;  2A69 D;  3PUY A;  2YYZ A;  4S3S A;  3J7A F;  3D6W A;  2B63 B;  3A8K E;  4ILW A;  3MFG A;  4FF1 A;  4RCO A;  1M4V A;  1FD7 D;  4BS9 A;  1ILP A;  2GK7 A;  2J0T D;  5M5X B;  4PMC A;  1SKY B;  2A5H A;  4X3T A;  1KAA A;  1SE2 A;  4R9W A;  4DFA A;  1ZYR C;  4A3G B;  1Q1E A;  2D3N A;  4UAI A;  5COR A;  1WTH D;  5EKL A;  4BBS B;  2A6E D;  2CQA A;  3M3Y B;  2WJV A;  2CK3 A;  5C3X A;  1LTB D;  2EYP A;  2K5D A;  5K36 H;  4RGT A;  1KAB A;  1DCZ A;  2E76 C;  1TWA B;  3Q22 A;  1BR9 A;  5IGC A;  1PZK D;  5C0X I;  5CBA E;  4HAE A;  3QWN A;  4BBR B;  4NP5 A;  4RGO S;  4C56 C;  4MN3 A;  2F3V A;  3S2D B;  4DA2 A;  3RZO B;  1O78 A;  4BY7 B;  3CP8 A;  1QOH A;  4O1N A;  3BDO A;  5DM6 3;  2KA7 A;  1B44 D;  5DM7 3;  1J9O A;  4G7Z C;  4HCS A;  3C1F A;  1U4M A;  1RHP A;  2EJF C;  3IAY A;  2XZO A;  1E1Q A;  4C3H G;  1SYD A;  1A3V A;  1BDO A;  3NTI A;  1H9S A;  2E74 C;  3WDN A;  4XM3 A;  1FGB D;  4RCN A;  1VLY A;  1GUT A;  4H7B A;  4MIU A;  2WSS A;  3MXU A;  5EBC A;  2ENB A;  4KHV A;  1EFI D;  3HEJ A;  3I72 A;  5COY A;  4E0F A;  2CW0 C;  5HUR A;  1PZI D;  1EY6 A;  4FNF A;  4J1M A;  3SK5 A;  1CHQ D;  1JOR A;  1KLG D;  4OL7 A;  2JA5 B;  1FX0 A;  4KD4 A;  1EL0 A;  1M8A A;  5D14 A;  1TWH B;  2K32 A;  2XRQ D;  1E79 A;  5IOD A;  2AUJ D;  3MXG A;  2Z6B D;  4RHS A;  2JYO A;  2FJ2 A;  2GJR A;  2X6W A;  2WB1 B;  4ULL A;  4QB4 A;  5JJZ A;  3J80 E;  1E43 A;  1EEF D;  1FR3 A;  2K5W A;  5AFW A;  4A93 B;  1V43 A;  3G05 A;  4OO1 H;  2NBF A;  4HIZ A;  2L9H A;  2F0D A;  1V0F A;  2WV6 D;  2PQE A;  2JJ1 A;  1B9N A;  1TWG B;  3A56 A;  1U4R A;  3U9S A;  5I2Y A;  4TKO B;  1A3T A;  2G9H D;  1ENF A;  4FXU A;  3CQZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...