3FPPA

Crystal structure of e.coli maca
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
266
structure length
266
Chain Sequence
PGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTQAVSQQDLDNAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPGQKAWFTVLGDQLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Macrolide-specific efflux protein macA
publication title Crystal structure of the periplasmic component of a tripartite macrolide-specific efflux pump
pubmed doi rcsb
source organism Escherichia coli
total genus 52
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3fppA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fppA02
2D5DA 3H94A 5C0XH 1K8OA 4OO1G 2O5JC 3OW7A 3FMCA 3WDNA 1DXMA 3FPPA 3T53B 1Q12A 1ZYRC 1G291 4DK0A 3U9SA 1CFMA 1DD2A 1T5EA 2A69D 3DXJC 1E2WA 3MFYA 2O5IC 3PUWA 1H9SB 2D62A 2E76C 3CRLC 3GQBA 2R6GA 5JEAG 2EJFC 2NN6G 4H13C 1ONLA 4KI0A 1YNNC 1H9SA 1LACA 1VCIA 2BA1A 4G7OC 1GUGA 2KA7A 4H44C 3VA7A 2DN8A 1H9JA 3OOCA 4LJZC 2JXMB 1EWHA 4G7HC 4TKOB 2A6EC 2A68D 3P20A 1Y69U 4KKUA 2D2CC 1Q90A 2K33A 4HR7B 3SE0A 1H9MA 3L7ZC 5BN3A 1B9NA 2L5TA 1DCZA 2BE5C 2B8GA 1CTMA 3ND9A 4G7ZC 1GUNA 1SMYC 3NE5B 1GUOA 3LWUA 4TQUS 3BG3A 1GHJA 1O7LA 3VR2A 4IFDH 4GZYC 4L8JA 1PMRA 3PUYA 5A35A 1VF7A 1CI3M 3N6RA 4KMUC 2PPBC 3QIAA 1HQMC 3OPOA 1GJXA 1VF5C 3PUVA 1H9KA 3CRKC 1Q1BA 2A69C 2EJGC 2LMCB 3EQLC 4BA2I 1Y8OB 2EJMA 2NN6I 1Z6HA 1QJOA 4DNTB 3A8IE 3I4LA 1GUSA 4RCNA 1TU2B 3SDZA 3A8JE 1H9RA 3PUZA 3VR5A 2A6HD 1IYUA 3I73A 3VR6A 5C0XG 3T56B 1IW7D 5KNCA 3M4YA 1V43A 2A68C 2AWOA 4H0LC 3VR3A 2B8FA 4JBWA 1Z7TA 2BDOA 3BDOA 2F1MA 1TKWB 3HGBA 1Q1EA 3D4RA 4IQZA 2DNEA 1FR3A 3VR4A 5K36H 1YNJC 3TZUA 3KLRA 4KN7C 5BN5A 4JK1C 3LNNA 2DNCA 3IFTA 2BA0A 2KCCA 3ND8A 2JE6I 1E2ZA 1HCZA 2EDGA 3GD7A 3W3AA 2E74C 5KNDA 4DK1A 4OO1H 4I7ZC 2JEBI 2CW0C 1Y8NB 2ZT9C 2EVBA 3QG1A 4LK1C 2QF7A 2PNRC 1A6XA 1I6VC 5KNBA 1O78A 1GHKA 1V8QA 3M85A 1OXSC 4DNRB 4IFDG 4KKSA 1OXVA 5JEAH 2NN6H 3A7AB 1FYCA 2PCFB 2BE5D 1IW7C 3D31A 3M7NA 1HTPA 4KHZA 4KKTA 3AB9A 3MXUA 3T51B 2E75C 2YYZA 2K7VA 1K8MA 3A8KE 2IT1A 1OXTA 1LABA 3PV0A 4XIGS 5BN4A 3PUXA 3QJYA 1IYVA 1ZKOA 1E2VA 1OXUA 2Q8IB 4BA1I 4XTCS 1HPCA 3IKJA 2V4DA 4PV1C 2JEAI 1VDZA 3I72A 1BDOA 1Y8PB 1OXXK 3A7LA 2A6ED 4OGQC 5K36G 2A6HC 4KN4C 3RLFA 1B9MA 2K32A 1GUTA 2AUKA 2AUJD
chains in the Genus database with same CATH superfamily
4GN4B 4WRDA 2D5DA 3NQIA 3BDCA 2BN4A 4C3IH 1ZEQX 2Y0SE 4A3KB 4DXFA 1Q12A 1EY8A 3H0GB 2E1BA 3I2ZA 1KC8C 1LO5D 1PLFA 4ID6A 1RL2A 4IALA 3Q22A 3A56A 1K73C 4RCOA 4H13C 4KJOA 4OEMB 1E1QA 2WP8J 4K6LA 1DJRD 4DUZQ 1WOCA 2MO1A 5JEAJ 4HR7B 1JWMD 5BN3A 1SDFA 1IHMA 3L9AX 1JJGA 1EY0A 3WY9A 2KHSA 4DAMA 4TQUS 3GTMB 3BS1A 3BG3A 2B2UA 4G6IA 1TT2A 2J4XA 3NHHA 2XRSD 1V1QA 1PH1A 4JI0L 2OBSA 4ULLA 1UD3A 1C9OA 1EQRA 3PO2H 4AF6A 2A73B 4TMVA 2A69C 3KBXA 3KEWA 4B3XA 4X64Q 3S16B 3MHPA 3DWAA 1RTOA 5D3DA 1N07A 1EY5A 1ICWA 2ES2A 5GADC 4A3IG 4YAOA 1B23P 3HOZG 3CCQB 3G6EB 5A2QE 2XNCA 5FO7B 1R5BA 5IYBG 2R7ZH 3GTLB 2PI2E 1TKWB 3CCQA 3G6EA 2QEJC 4BY1G 3KJPA 3GP7A 2KJXA 5FLXL 4CGYB 2K04A 2KCCA 1NMGA 4TRDA 4JI8L 2KUMA 2NVQB 4GLAC 1VQAA 4A3GH 4A3CH 2QKIC 4CJ0B 5J22A 4M53A 4YWLA 4FXUA 1CZGA 1NTGA 2B2VA 1HH2P 2GQFA 1QNUA 5CGKA 1VQLA 4POGA 4DFAA 1G91A 1QNKA 4Q5VA 1RJTA 4EGVA 2BE5D 2Z4IA 3JAMc 3D31A 1E3ZA 1KMHA 3O13A 3B8HA 1BCPF 5GV7A 1SYFA 1W9XA 1JA0A 2E75C 4J1MA 3ICEA 3ISXA 2VBVA 1EL0A 1SE3A 5C3XA 5H5JA 1WTHD 2HHHQ 1OXTA 3S2DH 3PV0A 3AVYA 2F0NA 3K5LA 3JQPA 3K5OA 3SK5A 1Y0YA 1IYVA 5IY0A 3I56B 4KD4A 5F2DA 2WV6D 1GD7A 3OIPA 1G7TA 1Y8PB 3I56A 2F4VL 2NYZD 1VQIA 1YJNB 4OGQC 5F4JA 4KY5A 4A3JH 1KABA 2HCCA 3UE0A 1HUMA 2PW7A 1Q7YD 3CQZH 4YEJA 2K14A 4IUQA 3H94A 2WKCA 3MWYW 3W1BA 2RHSB 3EBEA 4OO1G 4JW0A 4MZ9A 3FPPA 1HFNA 3U4VA 4FVMA 1TWCH 4ZGQB 3C46A 5J39A 2QA4B 3CRLC 1K28A 1P4MA 3PENA 1TWAB 1GO3E 4DUYL 1BR9A 2QA4A 1YHBA 2BPOA 5FO8B 3VYRA 1SSOA 3G05A 2E2JB 3P20A 2F4NA 2PQEA 3TZDA 4QVAA 3L7ZC 4KY7A 1Q81D 2L5TA 1TY0A 2BM1A 5GROA 3F2BA 1CTMA 4YIJA 1EOVA 3G7LA 1IBML 2KVMA 2IW3A 4OO1I 4MTKA 2JA7H 1WSRA 3S1NB 3UDGA 4HJ5A 1N32Q 1SJHD 2C5CA 1Z9FA 2Y0SB 3S1QB 2K5NA 3KUPA 4DV5Q 1AZQA 3ONUA 3ERQA 3RN2A 4DF7A 4AF7A 1UEAB 2JA8G 1EY9A 4MTNA 3FKIH 1DARA 3W2DA 1M1KC 1UMKA 2GK6A 3M4YA 2AWOA 2XZOA 4JBWA 5COYA 4TMWA 3HP3A 2LKVA 2DGYA 3BJUA 1CZWA 2Q8TA 3S15B 4IQZA 1FR3A 1IBKL 1YNJC 4FXKC 4K2LA 1BUVT 4TVAB 1Q9SA 1I8DA 2R61A 4NPSA 1Q3LA 1HCZA 5A2QL 3AGQA 3K6OA 5IT9E 3DHQA 1STBA 3H0GH 4DR6L 3OW2B 2K4KA 4DR2Q 4QHYA 1YNND 4CDFC 5IWAL 2WZNA 2W6IA 3H3VH 3OW2A 1AE2A 3CW2A 2PNRC 4DUYQ 1UD2A 5BSXA 4DV3L 5F4OA 2MFIA 1F9SA 4KK7A 2AQ2B 4C3JH 4K5XA 4IFDG 4RDKA 3QFTA 1NY4A 1HNXQ 1R4PB 2PCFB 1F2YA 1XNQQ 1IW7C 1VQPB 4IPHA 5ELNA 3HOYB 1SMYD 1HUNA 4EQPA 2N8NA 5IYCG 3WBJA 1VQPA 5ELOA 3QOLA 4JI1Q 4PC7A 4HAEA 1G6PA 2QW7A 1XX8A 1VQ6B 5GAEC 1CUKA 1E0BA 1TWFH 2VB2X 4RD1A 2Q8IB 1Q8KA 1DM0B 3J81j 1VQ6A 3HOWB 3KFUA 4IJHA 3K58A 3HOVB 4AYBE 3I4MB 5HGTA 3U6KA 3I70A 3A74A 1TS3A 4R4IA 1JJCB 2YU9H 3AVXA 2EYJA 3P27A 1X55A 4YHHL 1I94L 4JYAL 3CP0A 2OTJB 3OIQA 4XL9A 3GTJB 4IFDI 1D2EA 2XTIA 1HZBA 4LUOA 5IP7G 2OTJA 3ASSA 3D26A 3STBC 3GTLH 1EYCA 3U6BA 3FMCA 4DV4L 3GTOB 2F0OA 3BY1A 2L9HA 1N8RD 1KNEA 4PQXA 1RQPA 2JQOA 1BLIA 2NVQH 1AMOA 2B29A 1EFUA 1ML0D 4DA2A 4LBYA 1B3AA 2N49A 4Y7NB 1IJEA 1NBWA 2IWHA 4A3IB 3JAMi 1N36L 5EQ0A 3ES9A 4LBWA 3HOZB 1KJZA 1FJGL 2ZJRA 1VS0A 4XLHA 1VMPA 3H91A 4M1KA 3VO1A 1C7YA 1QVFB 2X53S 3ASQA 3QIAA 1WTXA 2O4XA 4HMJA 1YHQB 2F1LA 2Z6KA 1QVFA 4X6AH 1H9KA 1EP2B 4RLZA 2DY7A 1YHQA 1W0KA 2DUDA 4OWXB 5CV5A 4LF4L 2V7UA 2B2WC 2OK8A 2PZTA 3VR5A 4B9XA 1EIFA 2AQ3B 4X62L 3VR6A 4YHHQ 2X6XA 4JYAQ 1UE1A 2C5HA 1KD1D 4DPGA 2FINB 2JN9A 1YLOA 2IX0A 2KHIA 3GIRA 1XQBA 2F1MA 3V7AA 1GM5A 2PIAA 4LF6L 3AQQA 2QGQA 3KLRA 4KN7C 4MYTA 4DV4Q 3ULPA 4JK1C 1RIPA 3CMEB 5I9PA 1QX4A 1SM4A 1WVLA 2M5SA 5FL7A 2IX1A 3CMEA 2B2TC 5KNDA 1I4RA 3IAYA 3VMFA 2EYOA 1KDAA 4BBSG 3MXNB 3RMHA 4NXML 1YX2A 1I4PA 4O1NA 1AE3A 2KENA 1TWAH 3MXNA 2PW5A 5C4JB 4C0SA 3PVDA 1YBYA 1TTTA 5IT9L 5FO9B 4XOPA 3NENA 4DR4L 2ICEC 4YCWA 2E2JH 2HLDA 2R92H 3M7NA 1E7ZA 1N36Q 3F2UA 4KKTA 1SNCA 3R93A 2HQEA 1I3QB 1GAWA 1GAQA 2AWNA 4DV2Q 4A3GG 2FXQA 4Y9UA 1SNOA 3MHBA 3Q39A 3OTOL 3PUXA 5I4DA 4X7FA 4FYDA 2EY1A 4YXWA 2HD3A 1ILPA 2JEAI 3Q6QA 1K8AC 4QIWB 2XWJB 1EWIA 5JJIA 4DN4M 2DJGC 1K9MD 4F8MA 3W2IA 3EVQA 1LT4D 1K8GA 4PAAA 4EQOA 2BGJA 2SDFA 1EYGA 3PSIA 4KJNA 1AIPA 4DV0Q 3K7UC 1UD5A 1VQOB 4RH6A 1DG1G 2OTLB 5H59A 1BOSA 3DXJC 1KIXA 3F2CA 3C3LA 1AFPA 2V7TA 1VQOA 1SKYB 4L5SA 2OTLA 1LTRD 5G3LD 3H9NA 1LACA 5C44G 2BA1A 2I46A 1PTOD 1WTHA 2NVTH 1MSGA 4YHBA 1KTKA 2D2CC 4KHPQ 1PFBA 1WTWA 2PO4A 4AH6A 1RHPA 3DDYA 2WAQE 3HOYH 2IHFA 4XMYA 3NE5B 1GUOA 4LFBL 1NB9A 3B82A 3OEHA 4GS3A 4DAYB 2E2HH 5M5WH 1I4GA 1P8LA 2BH8A 1JWSD 4UZFA 1HQMC 4DAYA 3QWNA 3M4OB 2M9VA 2YWGA 4R4QA 2D3NA 1AP0A 4A3MH 1Y8OB 4B44A 5CV6A 3HOVH 1E1TA 1VHEA 2AQ1B 5C3WA 3WQZA 5KRUA 3MAQA 1MSHA 4R8NA 3GTPB 2NBFA 4P22A 3OHXC 3KJOA 1VQ9B 2WFWA 2E2DC 3KOJA 1G2TA 1H95A 1A0IA 1VQ9A 1LYLA 4OELB 1QGYA 3F2DA 4A3LG 1CT1D 5JAVA 3CPWB 3IRBA 4A3EH 1Q82C 4OPOA 1E2ZA 2OT2A 1TIID 2M2LA 3FKIG 3CPWA 3FVQA 5C4HA 1G2SA 4LAAA 1BBXC 3MA2B 1N9WA 1GR1A 1PH4A 1JE4A 2E2IH 1OB0A 2NVXB 3G6JB 2RSNA 1DDIA 3TEHB 5FLMH 3CPFA 3I4NB 4X66Q 1LT5D 2K1BA 4Y7NH 4WZKA 3HOXB 4QVJA 1CHPD 4KHZA 1WORA 4J15A 4BBRH 3ONYA 2YYZA 4NCNA 1J8IA 1D6EC 4P1VA 1S72B 2XGTA 4PZ6A 1QFZA 2O5IC 2XZPA 1S72A 1CKNB 4RD2A 2BF4A 3BZCA 2CKZB 2VBUA 1CKNA 1F9QA 3IKJA 1BBWA 1D1IA 2Q6LA 4PV1C 4YY3Q 2DJFC 4B3GA 2Z1CA 2VNUD 4QGUA 2FHTA 4X65Q 3EFXD 2UUAL 3CHBD 1ZM4A 3W5VA 2ZTEA 4DV7Q 1W0JA 5IYRA 4YAUA 3H09A 3Q3AA 2FMCA 4KTAA 1AN8A 4XNFA 3C1EA 1QOHA 2YWFA 1K28D 2B63B 4JPBW 1RDPD 5IK2A 4Y7CA 2IPKD 3K57A 3H3VC 4ZKBB 3HG9A 2ZXPA 2N55A 1JB3A 2HCJB 4N9PA 4P2CB 5E4XA 5CBEE 3GQBA 1HVXA 2AMCB 2K5QA 5CV4A 1JNYA 4KV6A 3H15A 4ZRZA 1HTLD 3CXCB 1QUEA 1J5EQ 3CXCA 5AJ3L 1EU4A 2DEUA 4QB4A 5M3MB 1B9NA 2UXBL 2NB0A 4WZLA 5TV2A 1SE8A 4EX5A 3S17H 4HEDA 3S2HB 4C43A 2DYIA 5LL6S 2L12A 4C1NI 3JAME 1PRTF 1VF7A 4PZ7A 5BR8Q 1KK3A 1XTCD 2RBMA 5A8AA 1HZCA 2PZWA 3KYHC 3A1PA 4IUPA 3R2TA 2ZJPA 2QMUA 4WORA 2EJGC 1TUIA 4RDLA 2Q6KA 1XWEA 3SGIA 4LUVA 3A54A 3TN2A 2GREA 4EQ5A 3RZOH 1DGSA 5EKIA 1STHA 4BBSB 1SLJA 3AVTA 2KCMA 3SXHA 2X6LA 1IYUA 2ASBA 3I1FA 4HMIA 5LMNW 2C78A 5IYPA 1VQNB 5LMNQ 2VJIA 1CHQD 2EXDA 4E6IA 4QUZA 1CM9A 2F0EA 1VQNA 5K36H 1X3QA 1TWHH 5D3IB 1KC8D 4LFAL 4JVZA 4IO9A 3QB3A 1WU8A 2WB1G 4DR7L 4M4SA 4A3DB 3P75A 1G7SA 1K73D 4DV1L 4GNXB 2VNKA 4RHSA 4GNXA 4LK1C 2QF7A 4OPVA 5CYUA 1I6VC 1ASYA 3M85A 5CV9A 4DU9A 4H9GA 3HOUH 2X6WA 5AJ3Q 4RCYA 1S5ED 4IUNA 1KK2A 3L3OC 3I3CA 1SNQA 3MXUA 1H8HA 2VB3X 1NMFA 4PNYA 2KVOA 4L5TA 2FX3A 1D2BA 2JN4A 2IT1A 2DOGA 4J8QA 1LABA 2ATWA 2B3GA 4OXPA 3RLNA 1OXUA 4OOSA 2QTLA 4AC9A 2F0MA 4QUFA 3BCFA 1XPRA 3M4OH 4KHVA 1EIYB 1Y1VH 3I72A 4RWSC 4P75A 3A0JA 2OBRA 2F0VA 4RD3A 2EQSA 5LHY1 1FNBA 1QG7A 1HJPA 1I50B 1S0UA 1EYDA 1O7ZA 2R93B 3CC4B 3SK8A 1RQRA 3PO3B 1I5FA 1U4MA 2VY3A 2K5WA 3CC4A 4NBSA 4UPAA 2GA4B 2G5DA 3I8ZA 4HJ8A 4XONA 2RQXA 1P16A 1U4LA 5EPKA 5EBCA 1IXRA 4X64L 4XQFA 2I5HA 5EAYA 2DN8A 1JB9A 1PJ6A 2BMWA 1JR0D 3TS2A 4Z4ZA 4JCVE 2SOBA 3ERSX 5IYDH 3F8TA 1ILQA 3I4NH 4WJ4A 4X3SA 3CPXA 1D8TA 5CR3A 4R1JA 1KRHA 4DNIA 1PH3A 3C1FA 1G51A 1BJKA 4FNFA 3OEEA 2KEEA 1NJID 1STEA 3PUVA 4DR3Q 3GTGH 2QE7A 2Z9HA 1SYDA 4PMWA 2LMCB 5C4ZA 3JAML 2EJMA 4R4OA 1WTPA 2EY2A 1S5CD 3GV3A 1ELOA 1PV4A 3P1HA 4BY7H 4C3HH 4LFCL 3CCSB 2DY1A 2XIWA 3IFDA 2FJ2A 1JOKA 4UP7A 3BC9A 2BDNA 3CCSA 2VNHA 1DOMA 1PXUA 3MEHA 4JV5Q 3SVMA 3GTKB 4BXXG 1WOPA 1BCPC 4XQNA 4JG2A 1Q1EA 1PTOB 1IZ6A 1R9TB 1EQVA 2IJ0A 2ZXOA 4B9WA 3A3GA 1D7QA 2VUMG 4JMQA 3B6YA 2RKSA 5DEHA 1K83H 3I4OA 1KRSA 3Q24A 3J7YW 1F9RA 2HHHL 5M5YB 4A3FB 2K52A 3S1RB 2CWAA 3BVMA 2XGJA 1ESFA 1MBYA 2LSSA 4GKJQ 1WPCA 1A6XA 1R5NA 1O78A 3I90A 2EFGA 2B2YA 1X6OA 1JQYD 1V5VA 1U2RA 3A7AB 4A3EG 5M3MH 4U68A 3SLDA 1E64A 4X07A 1V0FA 1W35A 1E22A 2BV3A 4C56C 4POFA 2VZLA 3VNVA 4OONA 2CC2A 3K80C 3QJYA 4B47A 2R3ZA 3S14B 1L1OB 2AKWB 4K5VA 3A8KA 2Z6BA 1MABA 4MIUA 4RAUC 3V05A 3KLWA 5DM63 3D6WA 4IUUA 1L1OA 1V0EA 4Z1MA 2UUCL 1VQLB 1M1KD 2VZAA 1U9RA 4LFCQ 1E3XA 1LTSD 2A19A 1VQKB 1SE2A 2B7CA 3X3MA 2A1AA 2YTXA 1I4HA 1VQKA 4JBKA 4FK8A 1NDHA 1C4QA 2HIXA 3UDFA 2MUYA 5C0XH 1K8OA 1IB0A 4FWTA 3WOEA 1PHJA 5FIUA 3S24A 3WDNA 1WCMG 5KYIA 2WPDA 4DK0A 3U9SA 4P2NA 5HZAA 2MNAA 1S40A 1MD2D 2G9DA 2N78A 4P74A 1HZAA 1Y1WH 5FKAC 1YNXA 1N32L 1B2RA 3T1HL 1YITB 5EKKA 4DV5L 3M3YH 3FJOA 1G7CA 1YITA 3ZPNA 3GVJA 1PZJD 5IYNA 1YJWB 2X85A 1GOZA 1YEZA 1I6HH 3A3BA 2I5MX 3D3RA 1FD7D 4R4TA 1WD0A 1FGUA 4RHRA 1YJWA 4KKUA 4PG3A 3W5OA 2JA5H 1F20A 4Z9CB 4DQLA 3VYSA 1VQ8B 3HKSA 1X54A 1U5KA 4G5GA 1GHJA 3MCAA 1VQ8A 1SYGA 4CKBA 2WJYA 5M3FG 1NNXA 1UE6A 4LUZA 2JA6H 3R2IA 4IPDA 4KY6A 4A76A 4G7XA 1TWGB 3WWVA 2ZL6A 1GJXA 5KW9A 5GAHC 3AVUA 1DOKA 3RUZA 2WB1B 4C2MH 3KK7A 4DR2L 2I07B 1B1ZA 1IHZA 2BCOA 4OHJA 2UUCQ 2UUBQ 3A8JE 1A3TA 2VW9A 4Y52H 2JDIA 3U9OA 3ONAB 3NUCA 4L5RC 1A2TA 1HNXL 4NKLA 4HJ9A 2JIZA 2OBTA 2B8FA 4OX9Q 1XNQL 1PYBA 5M9OA 5C0XJ 1A15A 4RGTA 1X65A 1BMFA 2X6GA 2R93H 4Y9RA 1CKMA 1VQGA 5T1IA 4NW2A 3PO3H 4JI1L 5BN5A 3ZUGA 3IFTA 3FPKA 3AFQA 3GD7A 4ZGNB 5A89A 2NTSA 5CV8A 5C4XH 3DEOA 3EA6A 5E4WC 5C3EH 1TXYA 3TQYA 3V2TA 3TS0A 1PH6A 3CKIB 3T1HQ 1NBMA 2EYLA 1STYA 5I6WA 2ZJQA 2NTTA 1A3VA 2GJKA 3QOJA 3AGPA 3CMMA 4XQJA 2VJJA 1JC7A 1RTNA 1FYCA 1EFID 1I18A 1R5OA 1LLRD 4QMGA 1NRKA 5C6AA 5D65A 3AB9A 5JVH3 1B44D 2EY6A 3QFSA 3QSYA 1BX0A 2QGGA 3KDFB 4XIGS 1L0WA 3KDFA 3SHLA 4A3KH 1KXLA 4BA1I 4XLAA 1E2VA 4J0QA 1OGJA 1LTID 3ER0A 4QIWE 1F2MA 4KLKA 2KCTA 2ZZFA 1F60A 3W2HA 1VDZA 3T16A 1PZKD 2EIFA 1BDOA 2R7DA 3LVBA 3Q38A 3SLNA 5DAUA 2VNJA 4UP8A 4ZV4A 2X8KA 1WP6A 2HQLA 4QF4A 3SK6A 2GJPA 4X06A 4R9WA 4ABNA 2XOKA 5IP9H 4B3TQ 5JJKA 4YELA 4CJ2C 5TR9A 3GTKH 1EWCA 3A5UA 1PTOH 4A93B 2X3UA 1R9TH 3GTMH 5CMDA 1CKOA 5IGBA 4HJ7A 5E6TA 1G291 4RD6A 1CFMA 2RC6A 4RM0A 1DD2A 1T5EA 3MVVA 1H8EA 1SFOB 4S3SA 3ZBUA 1UE5A 3E20A 2KBNA 2MHVA 1STGA 3ZZ0A 2NN6G 4H02A 3URYA 1MIUA 5JEAG 4FF2A 1MJCA 4RJLA 5J35A 1GUGA 1N34L 3S16H 3RZDB 4LJZC 4LF9Q 4UZUA 2JK8A 1LTAD 2K5HA 3PA1A 2KEDA 1KHIA 1QE6A 3K8AA 4A3BG 5E7NA 5FJ8G 1XMQQ 2EE1A 1JT8A 3LWEA 3QFCA 4L8JA 1FGBD 3W2FA 5ELFA 5IGFA 1CI3M 4B4DA 2JYOA 3OJXA 2ZTCA 3K0XA 4BS9A 4ALPA 1YZ6A 3CF5A 2F0GA 2K6AA 2VUMB 1NSNS 1XYIA 2CW0D 4F7DA 1K8AD 4GOPC 5CC4A 3GTQB 2NN6I 3AVVA 3JU4A 1J6QA 4V0BA 1VLOA 1UD4A 3CU7A 3I55B 4C3IG 2IHEA 3A8IA 1EU3A 2MO0A 4H0LC 3DM1A 2R6HA 2XEXA 3FRPB 1WSVA 3I55A 1C8CA 1Q81C 4TMZA 2NWGA 2X0KA 4LBVA 1HNZQ 1I4QA 5LMZA 5CV7A 3K7AB 2HCIA 4DV2L 1XE1A 4BY1B 1TY2A 1N08A 4K2KA 5GV8A 4C3HG 4ZCLA 5HGQA 1IBLQ 1Z47A 2MPMA 2C4TA 2DCUA 1PH2A 1KL9A 3L0OA 2L0CA 1N34Q 4O0AA 5DNFA 4IN3A 1ESRA 5HURA 4OIJA 2LS01 3FDTA 3MXPA 3A8JA 2ZL5A 4OPSA 2L4NA 3PO2G 5GAGC 1RCVD 3K5NA 3GVLA 4ME3A 4WZTA 2HIVA 3HEJA 2SNSA 1PYWD 2JJ1A 1ZYRD 3RLOA 4Z4VA 1E3PA 4DV0L 5IGEA 1KTVA 3KL9A 2E1RA 4TSFA 2C9OA 2R7FA 3N52A 1EP3B 2ZXHA 1IL2A 1BKBA 3OAAA 1BPLA 1UD6A 4K6DA 5H1SE 2R7ZG 3VYUA 5LMUQ 5IOCA 2A6ED 1SEBD 1BBUA 4ZCIA 4KN4C 1IJFA 4JOIC 4KHPL 1HNWL 4RPDA 3PIP3 4RD4A 1ICFB 1R4QB 2EXZA 2M00A 4K8IA 1U4PA 4A3CG 1VQFA 5M3FB 4WFN3 4NDXA 2BOSA 3RR5A 3S1NH 1RODA 3RD4A 3PUWA 1VHOA 2EYHA 4TSSA 1PDQA 4FP5D 1L2FA 3S1QH 1FVIA 3PUNA 2ZZGA 1VCIA 1GKHA 1ZUNB 2F0HA 1S4ZA 3PQIA 3PIPA 4A75A 1WJJA 4DQKA 2L11A 3BZDB 1F77A 1PFSA 1SYBA 5ISRA 2TSSA 2PLFA 4HIZA 3ND9A 2L15A 1DZ1A 1GUNA 2W6JA 3DM3A 4LMQD 2ENBA 4U9UA 1VQCA 4GZYC 1JORA 3S15H 1K0RA 4LF8Q 3K0YA 3BDLA 2HDNB 1MKHA 3TDQA 2VQFQ 1NAPA 1QFJA 3H6MA 1N8RC 4IPGA 1LT3D 3J7ZC 2JA5G 5DM73 4A3JG 1ET6A 2I1LA 5FO0A 1QJOA 1Z6HA 5ELDA 4CKCA 3OYYA 4XXEA 4QV2A 4GN3B 4F7XA 1VQHA 2JA6G 5KNCA 1O7YA 2JA8B 4X66L 1HNWQ 3KBGA 1SAPA 5NUCA 1KK0A 4LW1A 1B70B 2B5OA 3TZUA 2Q6OA 4Z4UA 1ZM3A 1DDGA 1N33L 3E9HA 1SNDA 3W1GA 4A93H 1CQVA 1GVPA 1HRJA 3GO5A 4UP9A 4OOVA 3R6JA 2JEBI 2ZT9C 4YY3L 1D8LA 1LTLA 2CCZA 3HOWH 5KNBA 4X65L 2OXPA 1AH9A 5ELBA 3I4MH 3U4ZA 4FF4A 1CQFA 4MN3A 4DV7L 1NUCA 3RZDH 1A63A 4UAIA 4RGOS 3HAGA 4M0LA 2JA7G 3GTJH 5C4XG 3MZ5A 2EYPA 2Z6BD 3ULJA 4HE5A 1EXMA 3OZUA 2QTZA 3Q23A 1K3BC 2JJ2A 1YHAA 1CK1A 3BY2A 3GTOH 4QUCA 1ZKOA 2MGSA 3S1MB 2D3LA 4GKKL 4XTCS 1BX1A 3ASPA 4XLFA 5JVG3 1M4VA 5M5XB 1PH9A 4AVZA 1OB5A 4Z4TA 1J5EL 1XMOQ 2EY5A 4ZYSA 4B3MQ 5FA6A 3A35A 4A3KG 1B3QA 4A3IH 3H0GG 3HOZH 1PRTC 4A3BB 1D1NA 3SR1A 3J81c 1N33Q 3AYHB 5IYBH 5BR8L 1Q8IA 3FKSA 2A5HA 2K50A 2HDLA 4L63B 5JOBA 4C3JG 1XFOA 2C77A 4P12A 4JI5Q 2RHQB 1WYDA 4DKAC 4HSVA 3E6ZX 2QEXB 4ROXA 3VA7A 4JI6Q 3OOCA 2CBXA 1S5FD 3A55A 3LX0A 2NVYB 2A68D 2QEXA 5KSWB 1B4OA 2ZM6Q 1GJRA 1SKQA 4X8IA 3BVZA 4NNJA 3KF6B 3Q6SA 5LMNL 2B2WA 2F3IA 2GN5A 4C3IB 1Q86C 4QY7A 3KF6A 2G9HD 1WOOA 3NWSA 4FO2A 2WR8A 3ZBTA 3PUYA 1U0LA 3LO8A 2PPBC 3Q6RA 2CF4A 4YAWA 2F0FA 4IPCA 3ULLA 3H3VI 1SMXA 2F0UA 2FMMA 3ZJYC 3TBIB 4GKKQ 5JPMC 1WTRA 1E62A 1B50A 4R4CA 4GN5A 2UXCQ 1PKVA 1OGIA 1UNSA 2V7VA 5DS0A 2PMDA 1QWYA 2XVSA 2V7QA 4ME5A 4ZCKA 3SDZA 1LV9A 2ZITA 1FNMA 1W6JA 2B2TA 2JA9A 4HN7A 2DERA 4K8JA 3GVKA 5C4JH 3WXMA 5J3BA 3E1YE 4CKEA 1SN8A 4B3FX 1M90C 4CHTB 3M4QA 3BDOA 4P6VF 3PCOB 4NXNL 1FNCA 1X56A 3TREA 3CMAB 3HKZG 2J7ZA 4JI4Q 3HRZC 3CCLB 1I3QH 2BA0A 5IGDA 3CMAA 2N88A 4UY8C 3VA5A 1PJ5A 3CCLA 2YWHA 3CRZA 1WDTA 2C4UA 4OO1H 1JWUD 1SBBB 2YTYA 1Y8NB 5BSYA 3QG1A 1QVCA 3NEMA 4XORA 4XQQA 4N3NA 1S5BD 3C2PA 2F0LA 3J80c 1AEXA 5EKLA 2YV5A 1JE5A 4XT1B 4DK6C 1CSPA 2D9UA 1X3FA 1HXYD 2ID0A 4LC0A 4TN1A 4X7DA 2ALYB 5EGTA 1B7YB 4XOTA 4FXGC 1FNWA 4XN0A 3A8KE 2XSCA 2B2VC 1EIHA 3CCJB 1LT6D 3TP8A 2J0TD 3BH4A 4A3GB 1T6XA 4RA8A 1XTDA 1EQTA 2F43A 3CCJA 1K3RA 3QFRA 2GK7A 4K1XA 5IE8A 2VYQA 1H42A 2PE3A 5G3LF 4II2A 1SROA 3CCVB 3MFGA 2CQOA 1E1OA 2A6HC 1RKNA 1PTOF 3CCVA 1BCPD 1KDCA 4WZEA 1JICA 3NP8A 3UDIA 4NXNQ 1VQJA 2VXWA 1QB5D 4WJWA 3S2DB 1EY6A 2FFKB 1TS4A 2LFNA 3T53B 1WTQA 1C0AA 1EQQA 1XPOA 4EVOA 1VMCA 2A69D 4RD0A 1E2WA 3CESA 3E5SA 3EROA 3PGZA 1HA3A 5KNLA 1DYQA 2E76C 4G1VA 3JQRA 3AU7A 4RG1A 4DR3L 1ONLA 2R92G 5LL6X 1T6YA 1X3GA 1HZEA 4H44C 4XM3A 4B48A 1EWHA 1Y69U 5C44B 3CQZB 3RN5A 3P7JA 4RCZA 4G57A 1MI2A 4Z4WA 2EZVA 1SNPA 3GTPH 4JV5L 3CP8A 3VR2A 4IFDH 4XKWA 2Y0SG 1KZLA 4QL5A 4PC1A 1TWCB 2VNIA 3OPOA 2WB1E 2GVAA 3S9WA 2K75A 1Q1BA 4C1NK 2D74A 1J9ZA 3UDXA 3E3XA 4GKJL 1UE7A 3I4LA 1TU2B 1OO9B 3K81C 1KK1A 4LBZA 5GQOA 1CA5A 3J81k 3T56B 2NV4A 1XNRQ 4ZLTF 3CCEB 4DXGA 2NVXH 3V96A 1UWVA 2K01A 3CCEA 3RNUA 4ZKCB 3D4RA 3HOXH 2HUGA 4K0KL 2JA7B 1II3A 1T6ZA 3TSSA 5IP7H 3V76A 4P9SA 4ILWA 3J81i 3T1YQ 5FNZA 2NUCA 3KF8B 4I7ZC 1QILA 3KF8A 2OEOA 1JCKB 3FKIB 1EFCA 2HMAA 2F3WA 3HOYG 3NTKA 3M9BA 3PA2A 5DN6A 1IKLA 4WWVA 1WFQA 4PC6A 3X3NA 1QZHA 2NVYH 2Q2TA 2NPFA 4RDJA 1DOLA 1X3PA 1V9PA 4F87A 2BM0A 4XLEA 4IURA 4IFDJ 5EBDA 4AQYQ 3U58A 2OF1A 1OTCA 1TR5A 1BVSA 1QG0A 2KHJA 3CW2C 5IYWA 3OP1A 4A3MG 2B63H 3HOWG 1N06A 1N0VC 4ODGA 5KEEA 3HOVG 5JJLA 3I4MG 1BXTA 1PA6A 1B53A 3DMUA 2F03A 1VJSA 4DV6Q 2F0JA 2B7BA 3SJPA 4C3JB 1EEFD 3CB4A 2GJRA 2ZTGA 1UD8A 1STAA 5I2XA 2OQ0A 4UDUC 4JI7Q 4IW3B 3VNUA 2E5LQ 1LTTD 4OP7A 3S2HH 4K0KQ 1HA6A 4CJ1B 1VQBA 2OYNA 1TWFB 2NZOA 1BF4A 4DR5Q 1TS5A 1VQ7B 4H7BA 3UE1A 4HCSA 1HR0W 5FLMG 2K05A 1HR0Q 1VQ7A 2UXDQ 2PYKA 1X32A 2YU9B 2I0QA 2RSOA 2BVNA 2VBSA 2UUBL 5HY6A 4TMTA 4BBRG 2F0QA 5E1FA 3J80i 4BBSH 4FDBA 1QFYA 5A88A 3NWTA 1VLYA 3W2GA 1F2LA 1KAAA 1TVCA 4OX9L 4RGMA 3TP6A 1EEID 3ZYYX 1PYSB 2JJQA 1YNJD 2C35B 3EIVA 1O7LA 2OCEA 3P26A 1E63A 3HKZB 1X9NA 4F88A 1EFWA 3IL8A 4JI2L 3L2PA 3CRKC 3M7GA 4A3DH 4X3UA 1PVOA 4IZ8A 3A8IE 4RCNA 2LXJA 2QDXA 4B08A 2XWBB 2WIIB 4XDXA 3NPPA 3ASTA 1IW7D 3GV6A 4JI3L 1ASZA 3W5HA 1LM0A 3BYTB 2BDOA 5M5XH 3WBKA 1ZXTA 4WQMA 4LWCA 2RCFA 2Z6KC 3SJZA 4APVA 2GPJA 1WD1A 4CQJA 4JI0Q 3KLSA 3LNNA 3ND8A 3EN2A 3TP5A 2Q8RE 3MXGA 1N0UA 3NQTA 3R3OA 2CK3A 3B78A 3W3AA 2YTVA 2E74C 1NJIC 1GUWA 3CC7B 2ZTNA 3G48A 3CC7A 1I4XA 3AVWA 1RF2D 1ENCA 2WYRA 2RDHA 2ZZEA 2F0IA 4BPRA 3NTIA 5TRDA 3OWEB 4ZUJA 3OWFA 1YJNA 5C5LA 5C44H 5IYQA 3STBD 4AIMA 2CH4A 3DWPA 3MTSA 1I50H 4HIOA 1WTVA 1CQXA 4N9TA 3TP7A 4B3TL 1K0SA 4RGNA 5FK9C 3FHWA 5K5PA 3TRZA 1JA1A 1V1PB 4NB3A 3OJWA 1A8VA 4ZCMA 4JI8Q 2MQHA 4BWGB 4JI2Q 1HPCA 2TMPA 1V1PA 2D0OA 4P26A 5FLXc 4HSPA 4NMZA 2D9RA 5J1ZA 2R92B 5J3OA 4LF9L 3AEVA 1YI2B 5K36G 4HTHA 4JI3Q 3ASRA 2EIXA 1GUTA 2P3MA 1YI2A 2CWPA 3NSWA 4RKBA 2QDLA 5TSSA 1F9PA 2CH4W 1XMQL 4KD3A 3PIO3 1DXMA 1QGZA 2NZ1D 2EPBA 3WYAA 3ZZUA 5HZBA 1COWA 4RKLA 1XJVA 1BQEA 4XKVA 4A3LH 1W34A 2D62A 4DK3C 1BNZA 3MMPA 1DONA 1VQ4B 3HOUG 2F0TA 2EJFC 4AYBG 4YALA 4P6YA 2V7XA 2F4VQ 3FP9A 4X3KA 4JC0A 3VYTA 1VQ4A 2KA7A 4WJ3M 3BU2A 4HIMA 3JC66 1GXDC 3WNCA 5I9OA 2BH2A 4V190 1QVGB 1H9MA 3I7FA 3PIOA 4LNQA 1DCZA 3DLLA 2BE5C 2B8GA 1QVGA 4A4IA 1I7PA 1ENFA 2RDFA 1JB7A 3NTHA 4PGOA 3VDYA 1HNZL 4HJAA 4MHEA 4DR1L 1YJ9B 1SR3A 1Y1VG 1BCPB 3KLSX 1YJ9A 1VF5C 2O2LD 1GO2A 1IBLL 1D5XC 1UAPA 4OWTB 2V7WA 3EQLC 4CBVA 4ZK9B 5M5YH 4O42A 4A3FH 4XR6A 3S1RH 2NVTB 3OKXA 1GUSA 1EFRA 2UU9L 1JOQA 2VQEL 2C5BA 4DAPA 1LTGD 5IODA 4X7CA 4YAFA 3G4SB 4GLVB 1STNA 2E2HB 3G4SA 5M5WB 1Q7YC 1IBMQ 1QH0A 1AZPA 1PJ7A 2XNDA 1HFGA 2L55A 4N3GA 1FDRA 1CNEA 2PI2A 2CRVA 4ZQ3A 2X6YA 2AHOB 3D4WA 4A3MB 4II3A 1B2TA 3J81E 4JBJA 2AHOA 2WSSA 3OE7A 5IYDG 3WNBA 3S14H 1JMCA 5KIXA 3I4NG 2RVLA 1QUFA 1HHVA 3HOXG 3OZWA 2ZXIA 1GHKA 1OXSC 2A74C 1O80A 2WJVA 4DNRB 4M1UB 1EZ6A 5LMUL 5EJWA 2QN6A 2VL6A 5DLQE 2ZXRA 3CCMB 1Q46A 2L1BA 2CVRA 1IBKQ 3SKBA 3CCMA 4A3EB 4TMXA 1MHWC 2KOLA 4TT3A 4DR1Q 4I7AA 1UUPA 3RY8A 4B3SL 4BY7G 3ITPA 4DR6Q 5IGCA 4XN3A 5IWAQ 4XYOA 2QCPX 1ENAA 2Q6IA 2VBTA 2K03A 3AFPA 3ZC3A 2E2IB 2BGIA 1KLUD 5THXA 4DV3Q 3U50C 2UU9Q 3E9IA 2VQEQ 2WINB 2ZZQA 1NE3A 3F1ZA 2JP1A 3CC2B 1A8PA 2RCNA 2B63G 2K32A 4K14A 4BBRB 1SJED 2GVBA 1EIGA 3CC2A 1S5DD 1TQOA 3NELA 2CNDA 3PF5A 3GSIA 4QFMA 1J9OA 5D14A 4HIKA 1LTBD 5I6YA 4LF8L 4JBMA 4XD7A 4Z4SA 2FVGA 3JQQA 4PC2A 2VQFL 4B3RL 2XRQD 2XZLA 1WCMB 5KGUA 1FNUA 1TWGH 4P71A 1G6ZA 3SK4A 1YNNC 2PZUA 5CBAE 1EWYA 2F0DA 5M3MG 3HS0C 4IOCA 1FX0A 1H9JA 5L37A 3W5UA 1XPUA 1RD9D 2JXMB 1I94Q 3OZVA 3WOFA 1L0YB 3SE0A 1E24A 3Q8DA 3J80E 3EJIA 4OWWB 4O2DA 1TLLA 3MEFA 1SMYC 3LWUA 2YWEA 2P5ZX 3N6RA 1Q82D 1YIJB 1MRZA 5EPJA 4B3SQ 3D6CA 2H4OA 3BZKA 1QCBD 3MC0B 1YIJA 3NBIA 2HDMA 5C5MA 4CDDC 2OK7A 2CFMA 2HT1A 4XT3B 3LQ6A 3HZXA 3PUZA 2WZPP 1HA5A 1PH8A 4NP5A 4EH1A 5C0XG 3S17B 5B6IA 1V43A 1SRUA 1Z7TA 2A8VA 2WAQG 1C48A 1FJGQ 5JPNC 2OWOA 3HGBA 1PRTD 1NCVA 1Y1WG 4HCEA 4A3DG 1CNFA 1NR4A 3OSOA 3J7A5 2DNCA 4P3YA 4YCVA 4E0FA 3K5MA 2WKDA 3A5ZB 2H1EA 4B3RQ 4DK1A 1YVCA 2F52A 4IOAA 2EYMA 3RZOB 1O7IA 2CW0C 4LF4Q 4G4KA 4X62Q 5L46A 1EY4A 5C0XI 1PFNA 1XMOL 1XB2A 3J81L 4OL7A 3LQEA 2PMZE 4MNOA 1Q86D 1EFTA 4FN5A 1PZID 4B3ML 4RMFA 4PC3A 1HTPA 5JBQA 4LF6Q 1TWHB 4EQNA 3T51B 1OHHA 2PQAB 4XYQA 3UI2A 4GNXC 1W2BB 2PQAA 2Q2IA 1W2BA 2WACA 4LF5L 1E79A 2DETA 2V4DA 4G7WA 4NXMQ 4U673 1JJ2B 2DIEA 4JI5L 1SFOH 4XLCA 1Y14B 3HOUB 1JJ2A 4AYBB 1OXXK 4X0CA 2K28A 4JI6L 4HIDA 4M2LA 1M90D 4IUTA 2R93G 4DR4Q 1D5MC 2D0PA 1MGSA 4DAVA 3PO3G 3D4DA 1KLGD 2ZM6L 3Q0AA 1KD1C 2Z8LA 3R8BA 5C3EG 5TY0A 5IT9c 4FF3A 2O5JC 3OW7A 2F0PA 4IJLA 1W3SA 3CCUB 3OTOQ 1ZYRC 4BXXH 2IL8A 3CCUA 1Y1VB 2PNHA 3MFYA 1SE4A 2VUMH 4B43A 1X3EA 4PMCA 4Z4RA 5CDFA 2UXCL 4KI0A 1LUZA 3GTQH 1HZ9A 3BVGA 2JSOA 2RC5A 4GOPB 2A6EC 1Q90A 2MJ8A 1CSQA 4GOPA 1A62A 1D5ZC 4Q0FA 1B8AA 1EOTA 2F0KA 3FPUB 2F0WA 1F2ZA 3D8GA 4PABA 4ACBA 3E0EA 3M4PA 1PMRA 4JI4L 1VQMB 4RFBA 5A35A 4KMUC 1UEBA 3J80L 1VQMA 4X05A 2Z0SA 2EOTA 3K7AH 1W6KA 4I65A 4BY1H 4LF5Q 1IKMA 1N05A 5AFWA 4YWKA 3WNDA 3GDEA 2J7KA 1CA6A 2E8GA 1H9RA 4P73A 2A6HD 1KRTA 5IP9G 3I73A 1FNDA 1OB2A 1HQRD 3J7AV 3VR3A 5DSZA 2OQKA 2IY5B 2ICIA 4MYUA 5HXBA 4OIKA 4ZAIA 1K9MC 2XNJA 4LFBQ 2SNMA 4R8IA 3G71B 1ET9A 4A3FG 3DUZA 5KYLA 1SNMA 3CCRB 2JE6I 3G71A 4FXDA 4Z4YA 3GTGB 2Q2HA 1FNVA 3CCRA 3I91A 4BY7B 4PMBA 4C3HB 1WCMH 1G7RA 1IYJB 2EVBA 5AN9A 4CDCC 3CAMA 2Q2UA 5EMNA 3E0JA 5JJZA 2B2UC 1KNAA 1PTOC 3HFZB 1A3UA 4ZUIA 1FRQA 2B39A 4P3IA 4LF7L 3LGJA 2V1CC 1MJEA 4R71A 4QJFA 5HKKA 1K83B 2K5DA 3NBHB 2R9VA 3PO2B 4JOIA 3NBHA 5BN4A 2B2YC 4ASUA 2H5XA 1PH7A 3BQJA 5M3FH 4GQNA 1EUJA 3R6KA 1EZ8A 3T13A 1NR2A 1L0XB 2F4IA 5F4MA 1T9HA 5CORA 2QILA 3A7LA 3RLFA 2ZL7A 2R7ZB 2AUKA 3ZIAA 2BSAA 2AUJD 1SYEA 2LY7A 3PMFA 3QE2A 1M8AA 5FO1A 2PMZB 2XNAC 5E3FA 4RPBA 2LZJA 3VO2A 1L1OC 5I2YA 1KDBA 5T1GA 1ZM9A 3CP2A 1U4RA 4DGZA 2I5LX 1E43A 1SXTA 4G1BA 1XXGA 1H9SB 4IUVA 3PUMA 1E1RA 2R6GA 1PFMA 1H9SA 1FRNA 4G7OC 2UUAQ 2C2WA 1EYAA 1BO0A 5IIFA 3QR8A 4G7HC 4TKOB 1W87A 1VQ5B 2K33A 1XNRL 3U2QA 1WOSA 3T4AC 1AW7A 1S4MA 5IGGA 1VQ5A 4LF7Q 2NZHA 4G7ZC 2JA8H 4P25A 3TMEA 1TVXA 2WAQB 4QCLA 3HKZE 1Y1WB 3OFNA 3DEPA 2DY8A 4UHVA 3M3YB 3ZZTA 1KQSB 1IL8A 1SYCA 1TS2A 3T1YL 1ZM2A 2RDGA 1WI5A 1GVHA 4BA2I 1QZGA 1KQSA 1A2UA 4QQBX 2MP1A 1I6HB 4DNTB 2F0SA 4ACAA 4GLXA 2JA5B 2CQAA 3BYYB 5FLXE 4A3JB 2RF4A 2VS1A 2XN9C 4FF1A 4L6TB 2A68C 3QO2A 2UXBQ 2ZBUA 2X69A 5ELEA 1BQQT 4K5WA 4OOXA 4N8FA 5FOBB 2JA6B 4YWMA 2V31A 2DNEA 3VR4A 4AQYL 2F3VA 4N8X1 3J7AF 2IX3A 2K5VA 3CD6B 1NB0A 4C2MB 1WTOA 2EDGA 4X7EA 3BNWA 5IYCH 3CD6A 1EY7A 3SEJA 1QUQB 1D1KA 1S3OA 3S1MH 3OMGA 4DV6L 4Q7JB 1QUQA 2EYFA 4M8AA 3SEBA 1V8QA 4DUZL 1VQDA 1T5XD 1KAWA 1Y0RA 4KKSA 1EP1B 4UAJA 2CW5A 1OXVA 2NN6H 2QDBA 2ZTDA 3FEWX 4PZ8A 4L5QA 5JEAH 3AMUA 3OMCA 4JI7L 4J6HA 2Z4HA 1VQEA 3D0FA 3DWQA 2E5LL 4YCUA 1JOOA 2K7VA 3NXWA 1K8MA 3CTAA 5C3EB 4LFAQ 5C4XB 5ELCA 4DR7Q 4HE6A 2SEBD 4A3BH 2CHBD 4DV1Q 3BCDA 2KCNA 1PRTB 2KECA 2RA4A 4P72A 5FJ8H 3K59A 4DR5L 3PF4A 5EPLA 1QGAA 1V1OA 1HR0L 2LXKA 4X3TA 2UXDL 4UZEA 2N3SA 1PH5A 2KQ3A 4CDEC 3W2EA 1G8ZD 1FL0A 1B9MA 2ZBVA 3NK9A 4A93G 1H85A
chains in the Genus database with same CATH topology
4WRDA 2D5DA 3NQIA 3BDCA 1ZEQX 4A3KB 4DXFA 1Q12A 1EY8A 3H0GB 2E1BA 1LO5D 1PLFA 4ID6A 4IALA 3Q22A 3A56A 4RCOA 4H13C 4KJOA 1E1QA 2WP8J 4K6LA 1DJRD 5JEAJ 4HR7B 1JWMD 5BN3A 1SDFA 3L9AX 1EY0A 2KHSA 4TQUS 3GTMB 3BS1A 3BG3A 2B2UA 4G6IA 1TT2A 2J4XA 3NHHA 2XRSD 4ULLA 1UD3A 2A73B 2A69C 3KBXA 3KEWA 3S16B 3DWAA 1RTOA 5D3DA 1EY5A 1ICWA 5A2QE 5FO7B 3GTLB 1TKWB 2QEJC 3GP7A 2KJXA 5FLXL 4CGYB 2K04A 2KCCA 4TRDA 2NVQB 2KUMA 2QKIC 4CJ0B 5J22A 4FXUA 1CZGA 2B2VA 5CGKA 1QNUA 1G91A 4DFAA 1QNKA 4Q5VA 1RJTA 4EGVA 2BE5D 2Z4IA 3D31A 1E3ZA 1KMHA 3O13A 1BCPF 1SYFA 1W9XA 2E75C 4J1MA 1EL0A 1SE3A 5C3XA 1WTHD 1OXTA 3PV0A 2F0NA 3K5LA 3K5OA 1IYVA 3SK5A 4KD4A 5F2DA 2WV6D 3OIPA 1Y8PB 2NYZD 4OGQC 4KY5A 1KABA 2HCCA 1HUMA 2PW7A 4YEJA 4IUQA 3H94A 2WKCA 3MWYW 4OO1G 3FPPA 1HFNA 4FVMA 3C46A 5J39A 3CRLC 1TWAB 1BR9A 5FO8B 3VYRA 1SSOA 3G05A 2E2JB 3P20A 2PQEA 3TZDA 3L7ZC 4KY7A 2L5TA 1TY0A 1CTMA 4YIJA 3G7LA 2KVMA 2IW3A 4OO1I 3S1NB 1SJHD 2C5CA 2Y0SB 3S1QB 3KUPA 1AZQA 3ERQA 4DF7A 1UEAB 1EY9A 3W2DA 2GK6A 3M4YA 2AWOA 2XZOA 4JBWA 5COYA 3HP3A 2LKVA 1CZWA 2Q8TA 3S15B 4IQZA 1FR3A 1YNJC 4FXKC 4K2LA 1BUVT 1I8DA 2R61A 1Q3LA 1HCZA 5A2QL 3K6OA 5IT9E 3DHQA 1STBA 1YNND 2W6IA 2PNRC 1UD2A 1F9SA 4KK7A 2AQ2B 4K5XA 4IFDG 1R4PB 2PCFB 1F2YA 3HOYB 1IW7C 1SMYD 1HUNA 4EQPA 3QOLA 4HAEA 1XX8A 1E0BA 2VB2X 2Q8IB 1DM0B 3HOWB 3K58A 3HOVB 3I4MB 5HGTA 3I70A 1TS3A 2EYJA 3GTJB 4IFDI 3OIQA 4XL9A 1EYCA 3FMCA 3GTOB 2F0OA 2L9HA 1KNEA 4PQXA 1BLIA 1ML0D 4DA2A 1B3AA 4Y7NB 2IWHA 4A3IB 5EQ0A 3HOZB 4XLHA 1VMPA 3H91A 2X53S 3QIAA 1WTXA 2O4XA 4HMJA 1H9KA 2DY7A 1W0KA 5CV5A 2B2WC 2PZTA 3VR5A 4B9XA 2AQ3B 3VR6A 2X6XA 2FINB 2IX0A 2F1MA 3KLRA 4KN7C 4JK1C 5I9PA 1WVLA 2M5SA 5FL7A 2IX1A 2B2TC 5KNDA 1I4RA 3IAYA 2EYOA 1KDAA 3RMHA 1I4PA 4O1NA 3MXNA 2PW5A 5C4JB 5IT9L 5FO9B 4XOPA 2ICEC 2HLDA 3M7NA 3F2UA 4KKTA 1SNCA 3R93A 2HQEA 1I3QB 2AWNA 1SNOA 3MHBA 3PUXA 5I4DA 4FYDA 2EY1A 4YXWA 1ILPA 2JEAI 4QIWB 2XWJB 4DN4M 4F8MA 3EVQA 1LT4D 4EQOA 2SDFA 4KJNA 1UD5A 4RH6A 1BOSA 3DXJC 3C3LA 1AFPA 1SKYB 1LTRD 5G3LD 1LACA 2BA1A 2I46A 1PTOD 1MSGA 1KTKA 2D2CC 1PFBA 1WTWA 2PO4A 1RHPA 3DDYA 4XMYA 3NE5B 1GUOA 3OEHA 1I4GA 1JWSD 1HQMC 4DAYA 3QWNA 3M4OB 2M9VA 2D3NA 1AP0A 1Y8OB 5CV6A 2AQ1B 5C3WA 3WQZA 5KRUA 3MAQA 1MSHA 4R8NA 3GTPB 2NBFA 4P22A 3OHXC 2E2DC 1G2TA 1CT1D 5JAVA 1E2ZA 2OT2A 1TIID 2M2LA 3FVQA 5C4HA 1G2SA 4LAAA 1BBXC 3MA2B 1JE4A 1OB0A 2NVXB 3G6JB 2RSNA 3I4NB 1LT5D 2K1BA 3HOXB 1CHPD 4KHZA 2YYZA 1J8IA 1D6EC 2XZPA 1F9QA 3IKJA 1D1IA 4PV1C 2Z1CA 4B3GA 2VNUD 2FHTA 3EFXD 3CHBD 1W0JA 3H09A 2FMCA 4KTAA 1AN8A 4XNFA 3C1EA 1QOHA 1K28D 2B63B 1RDPD 5IK2A 2IPKD 3K57A 3H3VC 4ZKBB 3HG9A 2ZXPA 2N55A 1JB3A 4N9PA 4P2CB 5E4XA 5CBEE 3GQBA 1HVXA 2K5QA 5CV4A 4KV6A 4ZRZA 1HTLD 1EU4A 4QB4A 5M3MB 1B9NA 2NB0A 3S2HB 4HEDA 5LL6S 2L12A 4C1NI 3JAME 1PRTF 1VF7A 1XTCD 2RBMA 2PZWA 4IUPA 3R2TA 4WORA 2EJGC 1XWEA 3TN2A 3A54A 5EKIA 1STHA 4BBSB 3SXHA 2X6LA 1IYUA 4HMIA 2VJIA 1CHQD 4E6IA 1CM9A 2F0EA 5K36H 1X3QA 5D3IB 3QB3A 4A3DB 3P75A 4RHSA 4LK1C 2QF7A 5CYUA 1I6VC 3M85A 5CV9A 4DU9A 2X6WA 1S5ED 4IUNA 3L3OC 3I3CA 1SNQA 3MXUA 1H8HA 2VB3X 4PNYA 2KVOA 1D2BA 2IT1A 4J8QA 1LABA 1OXUA 2F0MA 4QUFA 3BCFA 4KHVA 3I72A 4RWSC 2F0VA 5LHY1 1QG7A 1I50B 1EYDA 1O7ZA 2R93B 3SK8A 3PO3B 1U4MA 2K5WA 2GA4B 3I8ZA 4XONA 2RQXA 1U4LA 5EPKA 5EBCA 4XQFA 2DN8A 1JR0D 2SOBA 1ILQA 4X3SA 5CR3A 3C1FA 4FNFA 3OEEA 2KEEA 1STEA 3PUVA 2QE7A 1SYDA 4PMWA 2LMCB 5C4ZA 3JAML 2EJMA 1WTPA 2EY2A 1S5CD 3GV3A 3P1HA 2XIWA 3IFDA 2FJ2A 1JOKA 3BC9A 2BDNA 3MEHA 1DOMA 1PXUA 3SVMA 3GTKB 1BCPC 4XQNA 1Q1EA 1PTOB 1R9TB 1EQVA 2IJ0A 2ZXOA 4B9WA 3A3GA 4JMQA 2RKSA 5DEHA 3Q24A 3J7YW 1F9RA 5M5YB 4A3FB 3S1RB 3BVMA 2XGJA 1ESFA 1MBYA 1WPCA 1A6XA 3I90A 1O78A 2B2YA 1JQYD 3A7AB 4U68A 1V0FA 4C56C 3QJYA 2R3ZA 3S14B 4K5VA 4RAUC 3V05A 1MABA 4MIUA 5DM63 3D6WA 4IUUA 1V0EA 4Z1MA 1U9RA 1E3XA 1LTSD 1SE2A 3X3MA 1I4HA 1C4QA 2MUYA 5C0XH 1K8OA 3WOEA 3WDNA 5KYIA 2WPDA 4DK0A 3U9SA 1MD2D 2G9DA 5FKAC 5EKKA 3ZPNA 3GVJA 1GOZA 1PZJD 2X85A 3A3BA 3D3RA 1FD7D 1WD0A 4RHRA 4KKUA 4Z9CB 3VYSA 1GHJA 1SYGA 4CKBA 2WJYA 3R2IA 4KY6A 4G7XA 1TWGB 1GJXA 1DOKA 3RUZA 2WB1B 3KK7A 2I07B 1B1ZA 1IHZA 2BCOA 4OHJA 3A8JE 1A3TA 2JDIA 3U9OA 3ONAB 3NUCA 1A2TA 4NKLA 2JIZA 2B8FA 5M9OA 5C0XJ 1A15A 4RGTA 1BMFA 2X6GA 5T1IA 4NW2A 5BN5A 3IFTA 3GD7A 2NTSA 5CV8A 3DEOA 3EA6A 5E4WC 3V2TA 3CKIB 1NBMA 2EYLA 1STYA 5I6WA 2NTTA 1A3VA 2GJKA 3QOJA 3CMMA 4XQJA 2VJJA 1JC7A 1RTNA 1FYCA 1EFID 1I18A 1LLRD 4QMGA 1NRKA 5C6AA 5D65A 3AB9A 5JVH3 1B44D 2EY6A 4XIGS 3SHLA 4BA1I 4XLAA 1E2VA 1LTID 1F2MA 2ZZFA 1VDZA 3T16A 1PZKD 1BDOA 5DAUA 2X8KA 1WP6A 4QF4A 3SK6A 2GJPA 4R9WA 4ABNA 2XOKA 4YELA 4CJ2C 1EWCA 1PTOH 4A93B 5CMDA 5IGBA 1G291 1CFMA 1DD2A 1T5EA 3MVVA 1H8EA 1SFOB 4S3SA 2MHVA 5JEAG 1STGA 2NN6G 3URYA 4FF2A 1GUGA 3RZDB 4LJZC 4UZUA 1LTAD 2KEDA 1QE6A 2EE1A 3LWEA 4L8JA 1FGBD 5ELFA 5IGFA 1CI3M 4BS9A 2JYOA 2F0GA 2K6AA 2VUMB 1NSNS 1XYIA 2CW0D 5CC4A 3GTQB 2NN6I 3JU4A 4V0BA 1UD4A 3CU7A 4C3IG 1EU3A 4H0LC 3DM1A 3FRPB 1C8CA 2NWGA 1I4QA 5CV7A 3K7AB 2HCIA 4BY1B 1TY2A 4K2KA 4C3HG 1Z47A 2MPMA 2L0CA 5DNFA 4IN3A 1ESRA 5HURA 4OIJA 2LS01 3FDTA 3MXPA 2L4NA 1RCVD 3K5NA 3GVLA 3HEJA 2SNSA 1PYWD 2JJ1A 1ZYRD 5IGEA 4TSFA 2C9OA 3N52A 2ZXHA 3OAAA 1BPLA 1UD6A 4K6DA 3VYUA 5IOCA 2A6ED 1SEBD 4KN4C 3PIP3 1R4QB 2EXZA 2M00A 4K8IA 1U4PA 5M3FB 4WFN3 4NDXA 2BOSA 1RODA 3RD4A 3PUWA 2EYHA 4TSSA 1PDQA 4FP5D 2ZZGA 1VCIA 2F0HA 1S4ZA 2L11A 3BZDB 1F77A 1SYBA 5ISRA 2TSSA 4HIZA 3ND9A 1DZ1A 1GUNA 2W6JA 4LMQD 2ENBA 4GZYC 1JORA 3K0YA 3BDLA 3TDQA 1NAPA 3H6MA 1LT3D 5DM73 1ET6A 1Z6HA 1QJOA 5ELDA 4CKCA 4XXEA 4F7XA 5KNCA 1O7YA 2JA8B 3KBGA 1SAPA 5NUCA 3TZUA 1SNDA 1CQVA 1HRJA 3GO5A 2JEBI 2ZT9C 5KNBA 2OXPA 5ELBA 4FF4A 1CQFA 4MN3A 1NUCA 4UAIA 4RGOS 3HAGA 3MZ5A 2EYPA 2Z6BD 3Q23A 2JJ2A 1CK1A 4QUCA 1ZKOA 2MGSA 3S1MB 2D3LA 4XTCS 5JVG3 4XLFA 1M4VA 5M5XB 4AVZA 2EY5A 4ZYSA 3A35A 1PRTC 4A3BB 3SR1A 1Q8IA 3FKSA 2A5HA 4L63B 2HDLA 5JOBA 4C3JG 4HSVA 3E6ZX 3VA7A 3OOCA 1S5FD 3A55A 3LX0A 2NVYB 2A68D 1B4OA 3BVZA 4NNJA 3Q6SA 2B2WA 4C3IB 2G9HD 3NWSA 4FO2A 3PUYA 2PPBC 2F0FA 2F0UA 2FMMA 3TBIB 5JPMC 1WTRA 1B50A 1PKVA 1UNSA 1QWYA 2XVSA 2V7QA 4ME5A 3SDZA 1LV9A 1W6JA 2B2TA 4K8JA 4HN7A 3GVKA 4CKEA 4B3FX 4CHTB 3BDOA 2J7ZA 3HRZC 2BA0A 5IGDA 2N88A 3VA5A 4OO1H 1JWUD 1SBBB 1Y8NB 3QG1A 4XORA 4XQQA 1S5BD 3C2PA 2F0LA 1AEXA 5EKLA 4XT1B 2D9UA 1HXYD 2ID0A 5EGTA 4XOTA 4FXGC 1FNWA 4XN0A 3A8KE 2XSCA 2B2VC 1EIHA 1LT6D 3TP8A 2J0TD 3BH4A 4A3GB 4RA8A 1EQTA 2F43A 2GK7A 5G3LF 4II2A 3MFGA 2A6HC 1RKNA 1PTOF 1BCPD 1KDCA 1JICA 3NP8A 2VXWA 1QB5D 4WJWA 3S2DB 1EY6A 2FFKB 1TS4A 2LFNA 3T53B 1WTQA 4EVOA 1VMCA 2A69D 3E5SA 1E2WA 3CESA 3EROA 2O5IC 5KNLA 1DYQA 2E76C 3AU7A 1ONLA 5LL6X 4H44C 1HZEA 4XM3A 1EWHA 1Y69U 5C44B 3CQZB 3P7JA 4G57A 1MI2A 2EZVA 1SNPA 3CP8A 3VR2A 4IFDH 4XKWA 1KZLA 1TWCB 3OPOA 3S9WA 1Q1BA 4C1NK 3I4LA 1TU2B 1OO9B 1CA5A 3T56B 4ZLTF 4DXGA 3V96A 2K01A 4ZKCB 3D4RA 2HUGA 2JA7B 1II3A 3TSSA 4ILWA 2NUCA 4I7ZC 1QILA 3KF8A 2OEOA 1JCKB 3FKIB 2F3WA 3NTKA 5DN6A 1IKLA 3X3NA 1DOLA 1X3PA 4F87A 4XLEA 4IURA 4IFDJ 5EBDA 2OF1A 1TR5A 4ODGA 5KEEA 1BXTA 1B53A 3DMUA 2F03A 1VJSA 2F0JA 4C3JB 1EEFD 2GJRA 2ZTGA 1UD8A 1STAA 5I2XA 4UDUC 1LTTD 1HA6A 4CJ1B 1TWFB 1BF4A 1TS5A 4H7BA 4HCSA 2K05A 2PYKA 1X32A 2YU9B 2RSOA 2F0QA 5E1FA 3NWTA 1VLYA 1F2LA 1KAAA 4RGMA 3TP6A 1EEID 3ZYYX 1YNJD 1O7LA 3HKZB 4F88A 3IL8A 3CRKC 3M7GA 4X3UA 4IZ8A 3A8IE 4RCNA 4B08A 2XWBB 2WIIB 4XDXA 3NPPA 1IW7D 3GV6A 3BYTB 2BDOA 1ZXTA 1WD1A 3KLSA 3LNNA 3ND8A 3TP5A 2Q8RE 3MXGA 3NQTA 3R3OA 2CK3A 3W3AA 2E74C 1GUWA 2ZTNA 1I4XA 1RF2D 1ENCA 2RDHA 2ZZEA 2F0IA 3NTIA 3OWEB 4ZUJA 3OWFA 5C5LA 3DWPA 3MTSA 1WTVA 4N9TA 3TP7A 4RGNA 5FK9C 5K5PA 1V1PB 4BWGB 1HPCA 2TMPA 1V1PA 4HSPA 4NMZA 5J1ZA 2R92B 5K36G 4HTHA 1GUTA 3NSWA 4RKBA 5TSSA 1F9PA 4KD3A 3PIO3 1DXMA 2NZ1D 2EPBA 1COWA 4RKLA 4XKVA 2D62A 1BNZA 1DONA 2F0TA 2EJFC 4X3KA 3VYTA 2KA7A 1GXDC 5I9OA 4V190 1H9MA 1DCZA 2BE5C 2B8GA 1ENFA 2RDFA 3NTHA 4MHEA 1BCPB 3KLSX 1VF5C 2O2LD 1D5XC 1UAPA 3EQLC 4CBVA 4ZK9B 4O42A 4XR6A 2NVTB 1GUSA 1EFRA 1JOQA 4DAPA 1LTGD 5IODA 1STNA 2E2HB 5M5WB 1AZPA 2XNDA 1HFGA 2L55A 4ZQ3A 2X6YA 3D4WA 4A3MB 4II3A 1B2TA 3J81E 2WSSA 3OE7A 5KIXA 2RVLA 1HHVA 1GHKA 2ZXIA 1OXSC 2A74C 1O80A 2WJVA 4DNRB 4M1UB 1EZ6A 5EJWA 2ZXRA 2L1BA 2CVRA 4A3EB 2KOLA 4TT3A 1UUPA 3ITPA 5IGCA 4XN3A 4XYOA 2QCPX 1ENAA 2K03A 2E2IB 1KLUD 2WINB 2ZZQA 2JP1A 2K32A 4K14A 4BBRB 1SJED 1EIGA 1S5DD 1TQOA 1J9OA 5D14A 1LTBD 5I6YA 4XD7A 2XRQD 2XZLA 1WCMB 5KGUA 1FNUA 1G6ZA 3SK4A 1YNNC 2PZUA 5CBAE 2F0DA 3HS0C 1FX0A 1H9JA 1RD9D 2JXMB 3WOFA 1L0YB 3SE0A 3J80E 3EJIA 1SMYC 3LWUA 3N6RA 5EPJA 3D6CA 2H4OA 1QCBD 3MC0B 3NBIA 2HDMA 5C5MA 4XT3B 3HZXA 3PUZA 2WZPP 1HA5A 4NP5A 5C0XG 3S17B 1V43A 1Z7TA 1C48A 5JPNC 3HGBA 1PRTD 1NCVA 4HCEA 1NR4A 3OSOA 2DNCA 4E0FA 3K5MA 2WKDA 2H1EA 4DK1A 2EYMA 3RZOB 2CW0C 4G4KA 1EY4A 5C0XI 1PFNA 3J81L 4OL7A 1PZID 1HTPA 1TWHB 4EQNA 3T51B 1OHHA 4XYQA 3UI2A 2WACA 1E79A 2V4DA 4G7WA 4U673 2DIEA 4XLCA 3HOUB 4AYBB 1OXXK 2K28A 4IUTA 1D5MC 1MGSA 4DAVA 3D4DA 1KLGD 3Q0AA 2Z8LA 3R8BA 4FF3A 2O5JC 3OW7A 2F0PA 1ZYRC 2IL8A 1Y1VB 3MFYA 1SE4A 4PMCA 5CDFA 4KI0A 3BVGA 2JSOA 2A6EC 1Q90A 2MJ8A 1D5ZC 4Q0FA 1EOTA 2F0KA 3FPUB 2F0WA 1F2ZA 3D8GA 1PMRA 5A35A 4RFBA 4KMUC 3J80L 2EOTA 1W6KA 4I65A 1IKMA 5AFWA 1CA6A 1H9RA 2A6HD 3I73A 1HQRD 3J7AV 3VR3A 2ICIA 4ZAIA 4OIKA 2SNMA 4R8IA 1ET9A 3DUZA 5KYLA 1SNMA 2JE6I 4FXDA 3GTGB 1FNVA 3I91A 4BY7B 4PMBA 4C3HB 2EVBA 3E0JA 5JJZA 2B2UC 1KNAA 1PTOC 1A3UA 4ZUIA 2B39A 5HKKA 1K83B 2K5DA 2R9VA 3PO2B 3NBHA 5BN4A 2B2YC 4ASUA 4GQNA 1EZ8A 3T13A 1NR2A 1L0XB 2F4IA 5CORA 2QILA 3A7LA 3RLFA 2R7ZB 2AUKA 3ZIAA 2AUJD 1SYEA 2LY7A 3PMFA 1M8AA 2PMZB 2XNAC 5E3FA 2LZJA 5I2YA 1KDBA 5T1GA 3CP2A 1U4RA 4DGZA 1E43A 1SXTA 1XXGA 1H9SB 4IUVA 1E1RA 2R6GA 1PFMA 1H9SA 4G7OC 1EYAA 1BO0A 5IIFA 4G7HC 4TKOB 2K33A 3T4AC 1AW7A 5IGGA 4G7ZC 3TMEA 1TVXA 2WAQB 4QCLA 1Y1WB 3OFNA 3DEPA 2DY8A 3M3YB 1IL8A 1SYCA 1TS2A 2RDGA 4BA2I 1I6HB 1A2UA 2MP1A 4DNTB 2F0SA 2JA5B 2CQAA 3BYYB 5FLXE 4A3JB 2XN9C 4FF1A 4L6TB 2A68C 3QO2A 2X69A 5ELEA 1BQQT 4K5WA 5FOBB 2JA6B 2V31A 2DNEA 3VR4A 2F3VA 3J7AF 2IX3A 4C2MB 1WTOA 2EDGA 1EY7A 1D1KA 3OMGA 2EYFA 4M8AA 3SEBA 1V8QA 1T5XD 2QDBA 3FEWX 4KKSA 1OXVA 5JEAH 2NN6H 3AMUA 3OMCA 4J6HA 2Z4HA 3DWQA 1JOOA 2K7VA 3NXWA 1K8MA 5C3EB 5C4XB 5ELCA 2SEBD 2CHBD 3BCDA 2KCNA 1PRTB 2KECA 2RA4A 3K59A 5EPLA 1V1OA 4X3TA 2KQ3A 1G8ZD 1B9MA 3NK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5D A;  3H94 A;  5C0X H;  1K8O A;  4OO1 G;  2O5J C;  3OW7 A;  3FMC A;  3WDN A;  1DXM A;  3FPP A;  3T53 B;  1Q12 A;  1ZYR C;  1G29 1;  4DK0 A;  3U9S A;  1CFM A;  1DD2 A;  1T5E A;  2A69 D;  3DXJ C;  1E2W A;  3MFY A;  2O5I C;  3PUW A;  1H9S B;  2D62 A;  2E76 C;  3CRL C;  3GQB A;  2R6G A;  5JEA G;  2EJF C;  2NN6 G;  4H13 C;  1ONL A;  4KI0 A;  1YNN C;  1H9S A;  1LAC A;  1VCI A;  2BA1 A;  4G7O C;  1GUG A;  2KA7 A;  4H44 C;  3VA7 A;  2DN8 A;  1H9J A;  3OOC A;  4LJZ C;  2JXM B;  1EWH A;  4G7H C;  4TKO B;  2A6E C;  2A68 D;  3P20 A;  1Y69 U;  4KKU A;  2D2C C;  1Q90 A;  2K33 A;  4HR7 B;  3SE0 A;  1H9M A;  3L7Z C;  5BN3 A;  1B9N A;  2L5T A;  1DCZ A;  2BE5 C;  2B8G A;  1CTM A;  3ND9 A;  4G7Z C;  1GUN A;  1SMY C;  3NE5 B;  1GUO A;  3LWU A;  4TQU S;  3BG3 A;  1GHJ A;  1O7L A;  3VR2 A;  4IFD H;  4GZY C;  4L8J A;  1PMR A;  3PUY A;  5A35 A;  1VF7 A;  1CI3 M;  3N6R A;  4KMU C;  2PPB C;  3QIA A;  1HQM C;  3OPO A;  1GJX A;  1VF5 C;  3PUV A;  1H9K A;  3CRK C;  1Q1B A;  2A69 C;  2EJG C;  2LMC B;  3EQL C;  4BA2 I;  1Y8O B;  2EJM A;  2NN6 I;  1Z6H A;  1QJO A;  4DNT B;  3A8I E;  3I4L A;  1GUS A;  4RCN A;  1TU2 B;  3SDZ A;  3A8J E;  1H9R A;  3PUZ A;  3VR5 A;  2A6H D;  1IYU A;  3I73 A;  3VR6 A;  5C0X G;  3T56 B;  1IW7 D;  5KNC A;  3M4Y A;  1V43 A;  2A68 C;  2AWO A;  4H0L C;  3VR3 A;  2B8F A;  4JBW A;  1Z7T A;  2BDO A;  3BDO A;  2F1M A;  1TKW B;  3HGB A;  1Q1E A;  3D4R A;  4IQZ A;  2DNE A;  1FR3 A;  3VR4 A;  5K36 H;  1YNJ C;  3TZU A;  3KLR A;  4KN7 C;  5BN5 A;  4JK1 C;  3LNN A;  2DNC A;  3IFT A;  2BA0 A;  2KCC A;  3ND8 A;  2JE6 I;  1E2Z A;  1HCZ A;  2EDG A;  3GD7 A;  3W3A A;  2E74 C;  5KND A;  4DK1 A;  4OO1 H;  4I7Z C;  2JEB I;  2CW0 C;  1Y8N B;  2ZT9 C;  2EVB A;  3QG1 A;  4LK1 C;  2QF7 A;  2PNR C;  1A6X A;  1I6V C;  5KNB A;  1O78 A;  1GHK A;  1V8Q A;  3M85 A;  1OXS C;  4DNR B;  4IFD G;  4KKS A;  1OXV A;  5JEA H;  2NN6 H;  3A7A B;  1FYC A;  2PCF B;  2BE5 D;  1IW7 C;  3D31 A;  3M7N A;  1HTP A;  4KHZ A;  4KKT A;  3AB9 A;  3MXU A;  3T51 B;  2E75 C;  2YYZ A;  2K7V A;  1K8M A;  3A8K E;  2IT1 A;  1OXT A;  1LAB A;  3PV0 A;  4XIG S;  5BN4 A;  3PUX A;  3QJY A;  1IYV A;  1ZKO A;  1E2V A;  1OXU A;  2Q8I B;  4BA1 I;  4XTC S;  1HPC A;  3IKJ A;  2V4D A;  4PV1 C;  2JEA I;  1VDZ A;  3I72 A;  1BDO A;  1Y8P B;  1OXX K;  3A7L A;  2A6E D;  4OGQ C;  5K36 G;  2A6H C;  4KN4 C;  3RLF A;  1B9M A;  2K32 A;  1GUT A;  2AUK A;  2AUJ D; 
#chains in the Genus database with same CATH topology
 4GN4 B;  4WRD A;  2D5D A;  3NQI A;  3BDC A;  2BN4 A;  4C3I H;  1ZEQ X;  2Y0S E;  4A3K B;  4DXF A;  1Q12 A;  1EY8 A;  3H0G B;  2E1B A;  3I2Z A;  1KC8 C;  1LO5 D;  1PLF A;  4ID6 A;  1RL2 A;  4IAL A;  3Q22 A;  3A56 A;  1K73 C;  4RCO A;  4H13 C;  4KJO A;  4OEM B;  1E1Q A;  2WP8 J;  4K6L A;  1DJR D;  4DUZ Q;  1WOC A;  2MO1 A;  5JEA J;  4HR7 B;  1JWM D;  5BN3 A;  1SDF A;  1IHM A;  3L9A X;  1JJG A;  1EY0 A;  3WY9 A;  2KHS A;  4DAM A;  4TQU S;  3GTM B;  3BS1 A;  3BG3 A;  2B2U A;  4G6I A;  1TT2 A;  2J4X A;  3NHH A;  2XRS D;  1V1Q A;  1PH1 A;  4JI0 L;  2OBS A;  4ULL A;  1UD3 A;  1C9O A;  1EQR A;  3PO2 H;  4AF6 A;  2A73 B;  4TMV A;  2A69 C;  3KBX A;  3KEW A;  4B3X A;  4X64 Q;  3S16 B;  3MHP A;  3DWA A;  1RTO A;  5D3D A;  1N07 A;  1EY5 A;  1ICW A;  2ES2 A;  5GAD C;  4A3I G;  4YAO A;  1B23 P;  3HOZ G;  3CCQ B;  3G6E B;  5A2Q E;  2XNC A;  5FO7 B;  1R5B A;  5IYB G;  2R7Z H;  3GTL B;  2PI2 E;  1TKW B;  3CCQ A;  3G6E A;  2QEJ C;  4BY1 G;  3KJP A;  3GP7 A;  2KJX A;  5FLX L;  4CGY B;  2K04 A;  2KCC A;  1NMG A;  4TRD A;  4JI8 L;  2KUM A;  2NVQ B;  4GLA C;  1VQA A;  4A3G H;  4A3C H;  2QKI C;  4CJ0 B;  5J22 A;  4M53 A;  4YWL A;  4FXU A;  1CZG A;  1NTG A;  2B2V A;  1HH2 P;  2GQF A;  1QNU A;  5CGK A;  1VQL A;  4POG A;  4DFA A;  1G91 A;  1QNK A;  4Q5V A;  1RJT A;  4EGV A;  2BE5 D;  2Z4I A;  3JAM c;  3D31 A;  1E3Z A;  1KMH A;  3O13 A;  3B8H A;  1BCP F;  5GV7 A;  1SYF A;  1W9X A;  1JA0 A;  2E75 C;  4J1M A;  3ICE A;  3ISX A;  2VBV A;  1EL0 A;  1SE3 A;  5C3X A;  5H5J A;  1WTH D;  2HHH Q;  1OXT A;  3S2D H;  3PV0 A;  3AVY A;  2F0N A;  3K5L A;  3JQP A;  3K5O A;  3SK5 A;  1Y0Y A;  1IYV A;  5IY0 A;  3I56 B;  4KD4 A;  5F2D A;  2WV6 D;  1GD7 A;  3OIP A;  1G7T A;  1Y8P B;  3I56 A;  2F4V L;  2NYZ D;  1VQI A;  1YJN B;  4OGQ C;  5F4J A;  4KY5 A;  4A3J H;  1KAB A;  2HCC A;  3UE0 A;  1HUM A;  2PW7 A;  1Q7Y D;  3CQZ H;  4YEJ A;  2K14 A;  4IUQ A;  3H94 A;  2WKC A;  3MWY W;  3W1B A;  2RHS B;  3EBE A;  4OO1 G;  4JW0 A;  4MZ9 A;  3FPP A;  1HFN A;  3U4V A;  4FVM A;  1TWC H;  4ZGQ B;  3C46 A;  5J39 A;  2QA4 B;  3CRL C;  1K28 A;  1P4M A;  3PEN A;  1TWA B;  1GO3 E;  4DUY L;  1BR9 A;  2QA4 A;  1YHB A;  2BPO A;  5FO8 B;  3VYR A;  1SSO A;  3G05 A;  2E2J B;  3P20 A;  2F4N A;  2PQE A;  3TZD A;  4QVA A;  3L7Z C;  4KY7 A;  1Q81 D;  2L5T A;  1TY0 A;  2BM1 A;  5GRO A;  3F2B A;  1CTM A;  4YIJ A;  1EOV A;  3G7L A;  1IBM L;  2KVM A;  2IW3 A;  4OO1 I;  4MTK A;  2JA7 H;  1WSR A;  3S1N B;  3UDG A;  4HJ5 A;  1N32 Q;  1SJH D;  2C5C A;  1Z9F A;  2Y0S B;  3S1Q B;  2K5N A;  3KUP A;  4DV5 Q;  1AZQ A;  3ONU A;  3ERQ A;  3RN2 A;  4DF7 A;  4AF7 A;  1UEA B;  2JA8 G;  1EY9 A;  4MTN A;  3FKI H;  1DAR A;  3W2D A;  1M1K C;  1UMK A;  2GK6 A;  3M4Y A;  2AWO A;  2XZO A;  4JBW A;  5COY A;  4TMW A;  3HP3 A;  2LKV A;  2DGY A;  3BJU A;  1CZW A;  2Q8T A;  3S15 B;  4IQZ A;  1FR3 A;  1IBK L;  1YNJ C;  4FXK C;  4K2L A;  1BUV T;  4TVA B;  1Q9S A;  1I8D A;  2R61 A;  4NPS A;  1Q3L A;  1HCZ A;  5A2Q L;  3AGQ A;  3K6O A;  5IT9 E;  3DHQ A;  1STB A;  3H0G H;  4DR6 L;  3OW2 B;  2K4K A;  4DR2 Q;  4QHY A;  1YNN D;  4CDF C;  5IWA L;  2WZN A;  2W6I A;  3H3V H;  3OW2 A;  1AE2 A;  3CW2 A;  2PNR C;  4DUY Q;  1UD2 A;  5BSX A;  4DV3 L;  5F4O A;  2MFI A;  1F9S A;  4KK7 A;  2AQ2 B;  4C3J H;  4K5X A;  4IFD G;  4RDK A;  3QFT A;  1NY4 A;  1HNX Q;  1R4P B;  2PCF B;  1F2Y A;  1XNQ Q;  1IW7 C;  1VQP B;  4IPH A;  5ELN A;  3HOY B;  1SMY D;  1HUN A;  4EQP A;  2N8N A;  5IYC G;  3WBJ A;  1VQP A;  5ELO A;  3QOL A;  4JI1 Q;  4PC7 A;  4HAE A;  1G6P A;  2QW7 A;  1XX8 A;  1VQ6 B;  5GAE C;  1CUK A;  1E0B A;  1TWF H;  2VB2 X;  4RD1 A;  2Q8I B;  1Q8K A;  1DM0 B;  3J81 j;  1VQ6 A;  3HOW B;  3KFU A;  4IJH A;  3K58 A;  3HOV B;  4AYB E;  3I4M B;  5HGT A;  3U6K A;  3I70 A;  3A74 A;  1TS3 A;  4R4I A;  1JJC B;  2YU9 H;  3AVX A;  2EYJ A;  3P27 A;  1X55 A;  4YHH L;  1I94 L;  4JYA L;  3CP0 A;  2OTJ B;  3OIQ A;  4XL9 A;  3GTJ B;  4IFD I;  1D2E A;  2XTI A;  1HZB A;  4LUO A;  5IP7 G;  2OTJ A;  3ASS A;  3D26 A;  3STB C;  3GTL H;  1EYC A;  3U6B A;  3FMC A;  4DV4 L;  3GTO B;  2F0O A;  3BY1 A;  2L9H A;  1N8R D;  1KNE A;  4PQX A;  1RQP A;  2JQO A;  1BLI A;  2NVQ H;  1AMO A;  2B29 A;  1EFU A;  1ML0 D;  4DA2 A;  4LBY A;  1B3A A;  2N49 A;  4Y7N B;  1IJE A;  1NBW A;  2IWH A;  4A3I B;  3JAM i;  1N36 L;  5EQ0 A;  3ES9 A;  4LBW A;  3HOZ B;  1KJZ A;  1FJG L;  2ZJR A;  1VS0 A;  4XLH A;  1VMP A;  3H91 A;  4M1K A;  3VO1 A;  1C7Y A;  1QVF B;  2X53 S;  3ASQ A;  3QIA A;  1WTX A;  2O4X A;  4HMJ A;  1YHQ B;  2F1L A;  2Z6K A;  1QVF A;  4X6A H;  1H9K A;  1EP2 B;  4RLZ A;  2DY7 A;  1YHQ A;  1W0K A;  2DUD A;  4OWX B;  5CV5 A;  4LF4 L;  2V7U A;  2B2W C;  2OK8 A;  2PZT A;  3VR5 A;  4B9X A;  1EIF A;  2AQ3 B;  4X62 L;  3VR6 A;  4YHH Q;  2X6X A;  4JYA Q;  1UE1 A;  2C5H A;  1KD1 D;  4DPG A;  2FIN B;  2JN9 A;  1YLO A;  2IX0 A;  2KHI A;  3GIR A;  1XQB A;  2F1M A;  3V7A A;  1GM5 A;  2PIA A;  4LF6 L;  3AQQ A;  2QGQ A;  3KLR A;  4KN7 C;  4MYT A;  4DV4 Q;  3ULP A;  4JK1 C;  1RIP A;  3CME B;  5I9P A;  1QX4 A;  1SM4 A;  1WVL A;  2M5S A;  5FL7 A;  2IX1 A;  3CME A;  2B2T C;  5KND A;  1I4R A;  3IAY A;  3VMF A;  2EYO A;  1KDA A;  4BBS G;  3MXN B;  3RMH A;  4NXM L;  1YX2 A;  1I4P A;  4O1N A;  1AE3 A;  2KEN A;  1TWA H;  3MXN A;  2PW5 A;  5C4J B;  4C0S A;  3PVD A;  1YBY A;  1TTT A;  5IT9 L;  5FO9 B;  4XOP A;  3NEN A;  4DR4 L;  2ICE C;  4YCW A;  2E2J H;  2HLD A;  2R92 H;  3M7N A;  1E7Z A;  1N36 Q;  3F2U A;  4KKT A;  1SNC A;  3R93 A;  2HQE A;  1I3Q B;  1GAW A;  1GAQ A;  2AWN A;  4DV2 Q;  4A3G G;  2FXQ A;  4Y9U A;  1SNO A;  3MHB A;  3Q39 A;  3OTO L;  3PUX A;  5I4D A;  4X7F A;  4FYD A;  2EY1 A;  4YXW A;  2HD3 A;  1ILP A;  2JEA I;  3Q6Q A;  1K8A C;  4QIW B;  2XWJ B;  1EWI A;  5JJI A;  4DN4 M;  2DJG C;  1K9M D;  4F8M A;  3W2I A;  3EVQ A;  1LT4 D;  1K8G A;  4PAA A;  4EQO A;  2BGJ A;  2SDF A;  1EYG A;  3PSI A;  4KJN A;  1AIP A;  4DV0 Q;  3K7U C;  1UD5 A;  1VQO B;  4RH6 A;  1DG1 G;  2OTL B;  5H59 A;  1BOS A;  3DXJ C;  1KIX A;  3F2C A;  3C3L A;  1AFP A;  2V7T A;  1VQO A;  1SKY B;  4L5S A;  2OTL A;  1LTR D;  5G3L D;  3H9N A;  1LAC A;  5C44 G;  2BA1 A;  2I46 A;  1PTO D;  1WTH A;  2NVT H;  1MSG A;  4YHB A;  1KTK A;  2D2C C;  4KHP Q;  1PFB A;  1WTW A;  2PO4 A;  4AH6 A;  1RHP A;  3DDY A;  2WAQ E;  3HOY H;  2IHF A;  4XMY A;  3NE5 B;  1GUO A;  4LFB L;  1NB9 A;  3B82 A;  3OEH A;  4GS3 A;  4DAY B;  2E2H H;  5M5W H;  1I4G A;  1P8L A;  2BH8 A;  1JWS D;  4UZF A;  1HQM C;  4DAY A;  3QWN A;  3M4O B;  2M9V A;  2YWG A;  4R4Q A;  2D3N A;  1AP0 A;  4A3M H;  1Y8O B;  4B44 A;  5CV6 A;  3HOV H;  1E1T A;  1VHE A;  2AQ1 B;  5C3W A;  3WQZ A;  5KRU A;  3MAQ A;  1MSH A;  4R8N A;  3GTP B;  2NBF A;  4P22 A;  3OHX C;  3KJO A;  1VQ9 B;  2WFW A;  2E2D C;  3KOJ A;  1G2T A;  1H95 A;  1A0I A;  1VQ9 A;  1LYL A;  4OEL B;  1QGY A;  3F2D A;  4A3L G;  1CT1 D;  5JAV A;  3CPW B;  3IRB A;  4A3E H;  1Q82 C;  4OPO A;  1E2Z A;  2OT2 A;  1TII D;  2M2L A;  3FKI G;  3CPW A;  3FVQ A;  5C4H A;  1G2S A;  4LAA A;  1BBX C;  3MA2 B;  1N9W A;  1GR1 A;  1PH4 A;  1JE4 A;  2E2I H;  1OB0 A;  2NVX B;  3G6J B;  2RSN A;  1DDI A;  3TEH B;  5FLM H;  3CPF A;  3I4N B;  4X66 Q;  1LT5 D;  2K1B A;  4Y7N H;  4WZK A;  3HOX B;  4QVJ A;  1CHP D;  4KHZ A;  1WOR A;  4J15 A;  4BBR H;  3ONY A;  2YYZ A;  4NCN A;  1J8I A;  1D6E C;  4P1V A;  1S72 B;  2XGT A;  4PZ6 A;  1QFZ A;  2O5I C;  2XZP A;  1S72 A;  1CKN B;  4RD2 A;  2BF4 A;  3BZC A;  2CKZ B;  2VBU A;  1CKN A;  1F9Q A;  3IKJ A;  1BBW A;  1D1I A;  2Q6L A;  4PV1 C;  4YY3 Q;  2DJF C;  4B3G A;  2Z1C A;  2VNU D;  4QGU A;  2FHT A;  4X65 Q;  3EFX D;  2UUA L;  3CHB D;  1ZM4 A;  3W5V A;  2ZTE A;  4DV7 Q;  1W0J A;  5IYR A;  4YAU A;  3H09 A;  3Q3A A;  2FMC A;  4KTA A;  1AN8 A;  4XNF A;  3C1E A;  1QOH A;  2YWF A;  1K28 D;  2B63 B;  4JPB W;  1RDP D;  5IK2 A;  4Y7C A;  2IPK D;  3K57 A;  3H3V C;  4ZKB B;  3HG9 A;  2ZXP A;  2N55 A;  1JB3 A;  2HCJ B;  4N9P A;  4P2C B;  5E4X A;  5CBE E;  3GQB A;  1HVX A;  2AMC B;  2K5Q A;  5CV4 A;  1JNY A;  4KV6 A;  3H15 A;  4ZRZ A;  1HTL D;  3CXC B;  1QUE A;  1J5E Q;  3CXC A;  5AJ3 L;  1EU4 A;  2DEU A;  4QB4 A;  5M3M B;  1B9N A;  2UXB L;  2NB0 A;  4WZL A;  5TV2 A;  1SE8 A;  4EX5 A;  3S17 H;  4HED A;  3S2H B;  4C43 A;  2DYI A;  5LL6 S;  2L12 A;  4C1N I;  3JAM E;  1PRT F;  1VF7 A;  4PZ7 A;  5BR8 Q;  1KK3 A;  1XTC D;  2RBM A;  5A8A A;  1HZC A;  2PZW A;  3KYH C;  3A1P A;  4IUP A;  3R2T A;  2ZJP A;  2QMU A;  4WOR A;  2EJG C;  1TUI A;  4RDL A;  2Q6K A;  1XWE A;  3SGI A;  4LUV A;  3A54 A;  3TN2 A;  2GRE A;  4EQ5 A;  3RZO H;  1DGS A;  5EKI A;  1STH A;  4BBS B;  1SLJ A;  3AVT A;  2KCM A;  3SXH A;  2X6L A;  1IYU A;  2ASB A;  3I1F A;  4HMI A;  5LMN W;  2C78 A;  5IYP A;  1VQN B;  5LMN Q;  2VJI A;  1CHQ D;  2EXD A;  4E6I A;  4QUZ A;  1CM9 A;  2F0E A;  1VQN A;  5K36 H;  1X3Q A;  1TWH H;  5D3I B;  1KC8 D;  4LFA L;  4JVZ A;  4IO9 A;  3QB3 A;  1WU8 A;  2WB1 G;  4DR7 L;  4M4S A;  4A3D B;  3P75 A;  1G7S A;  1K73 D;  4DV1 L;  4GNX B;  2VNK A;  4RHS A;  4GNX A;  4LK1 C;  2QF7 A;  4OPV A;  5CYU A;  1I6V C;  1ASY A;  3M85 A;  5CV9 A;  4DU9 A;  4H9G A;  3HOU H;  2X6W A;  5AJ3 Q;  4RCY A;  1S5E D;  4IUN A;  1KK2 A;  3L3O C;  3I3C A;  1SNQ A;  3MXU A;  1H8H A;  2VB3 X;  1NMF A;  4PNY A;  2KVO A;  4L5T A;  2FX3 A;  1D2B A;  2JN4 A;  2IT1 A;  2DOG A;  4J8Q A;  1LAB A;  2ATW A;  2B3G A;  4OXP A;  3RLN A;  1OXU A;  4OOS A;  2QTL A;  4AC9 A;  2F0M A;  4QUF A;  3BCF A;  1XPR A;  3M4O H;  4KHV A;  1EIY B;  1Y1V H;  3I72 A;  4RWS C;  4P75 A;  3A0J A;  2OBR A;  2F0V A;  4RD3 A;  2EQS A;  5LHY 1;  1FNB A;  1QG7 A;  1HJP A;  1I50 B;  1S0U A;  1EYD A;  1O7Z A;  2R93 B;  3CC4 B;  3SK8 A;  1RQR A;  3PO3 B;  1I5F A;  1U4M A;  2VY3 A;  2K5W A;  3CC4 A;  4NBS A;  4UPA A;  2GA4 B;  2G5D A;  3I8Z A;  4HJ8 A;  4XON A;  2RQX A;  1P16 A;  1U4L A;  5EPK A;  5EBC A;  1IXR A;  4X64 L;  4XQF A;  2I5H A;  5EAY A;  2DN8 A;  1JB9 A;  1PJ6 A;  2BMW A;  1JR0 D;  3TS2 A;  4Z4Z A;  4JCV E;  2SOB A;  3ERS X;  5IYD H;  3F8T A;  1ILQ A;  3I4N H;  4WJ4 A;  4X3S A;  3CPX A;  1D8T A;  5CR3 A;  4R1J A;  1KRH A;  4DNI A;  1PH3 A;  3C1F A;  1G51 A;  1BJK A;  4FNF A;  3OEE A;  2KEE A;  1NJI D;  1STE A;  3PUV A;  4DR3 Q;  3GTG H;  2QE7 A;  2Z9H A;  1SYD A;  4PMW A;  2LMC B;  5C4Z A;  3JAM L;  2EJM A;  4R4O A;  1WTP A;  2EY2 A;  1S5C D;  3GV3 A;  1ELO A;  1PV4 A;  3P1H A;  4BY7 H;  4C3H H;  4LFC L;  3CCS B;  2DY1 A;  2XIW A;  3IFD A;  2FJ2 A;  1JOK A;  4UP7 A;  3BC9 A;  2BDN A;  3CCS A;  2VNH A;  1DOM A;  1PXU A;  3MEH A;  4JV5 Q;  3SVM A;  3GTK B;  4BXX G;  1WOP A;  1BCP C;  4XQN A;  4JG2 A;  1Q1E A;  1PTO B;  1IZ6 A;  1R9T B;  1EQV A;  2IJ0 A;  2ZXO A;  4B9W A;  3A3G A;  1D7Q A;  2VUM G;  4JMQ A;  3B6Y A;  2RKS A;  5DEH A;  1K83 H;  3I4O A;  1KRS A;  3Q24 A;  3J7Y W;  1F9R A;  2HHH L;  5M5Y B;  4A3F B;  2K52 A;  3S1R B;  2CWA A;  3BVM A;  2XGJ A;  1ESF A;  1MBY A;  2LSS A;  4GKJ Q;  1WPC A;  1A6X A;  1R5N A;  1O78 A;  3I90 A;  2EFG A;  2B2Y A;  1X6O A;  1JQY D;  1V5V A;  1U2R A;  3A7A B;  4A3E G;  5M3M H;  4U68 A;  3SLD A;  1E64 A;  4X07 A;  1V0F A;  1W35 A;  1E22 A;  2BV3 A;  4C56 C;  4POF A;  2VZL A;  3VNV A;  4OON A;  2CC2 A;  3K80 C;  3QJY A;  4B47 A;  2R3Z A;  3S14 B;  1L1O B;  2AKW B;  4K5V A;  3A8K A;  2Z6B A;  1MAB A;  4MIU A;  4RAU C;  3V05 A;  3KLW A;  5DM6 3;  3D6W A;  4IUU A;  1L1O A;  1V0E A;  4Z1M A;  2UUC L;  1VQL B;  1M1K D;  2VZA A;  1U9R A;  4LFC Q;  1E3X A;  1LTS D;  2A19 A;  1VQK B;  1SE2 A;  2B7C A;  3X3M A;  2A1A A;  2YTX A;  1I4H A;  1VQK A;  4JBK A;  4FK8 A;  1NDH A;  1C4Q A;  2HIX A;  3UDF A;  2MUY A;  5C0X H;  1K8O A;  1IB0 A;  4FWT A;  3WOE A;  1PHJ A;  5FIU A;  3S24 A;  3WDN A;  1WCM G;  5KYI A;  2WPD A;  4DK0 A;  3U9S A;  4P2N A;  5HZA A;  2MNA A;  1S40 A;  1MD2 D;  2G9D A;  2N78 A;  4P74 A;  1HZA A;  1Y1W H;  5FKA C;  1YNX A;  1N32 L;  1B2R A;  3T1H L;  1YIT B;  5EKK A;  4DV5 L;  3M3Y H;  3FJO A;  1G7C A;  1YIT A;  3ZPN A;  3GVJ A;  1PZJ D;  5IYN A;  1YJW B;  2X85 A;  1GOZ A;  1YEZ A;  1I6H H;  3A3B A;  2I5M X;  3D3R A;  1FD7 D;  4R4T A;  1WD0 A;  1FGU A;  4RHR A;  1YJW A;  4KKU A;  4PG3 A;  3W5O A;  2JA5 H;  1F20 A;  4Z9C B;  4DQL A;  3VYS A;  1VQ8 B;  3HKS A;  1X54 A;  1U5K A;  4G5G A;  1GHJ A;  3MCA A;  1VQ8 A;  1SYG A;  4CKB A;  2WJY A;  5M3F G;  1NNX A;  1UE6 A;  4LUZ A;  2JA6 H;  3R2I A;  4IPD A;  4KY6 A;  4A76 A;  4G7X A;  1TWG B;  3WWV A;  2ZL6 A;  1GJX A;  5KW9 A;  5GAH C;  3AVU A;  1DOK A;  3RUZ A;  2WB1 B;  4C2M H;  3KK7 A;  4DR2 L;  2I07 B;  1B1Z A;  1IHZ A;  2BCO A;  4OHJ A;  2UUC Q;  2UUB Q;  3A8J E;  1A3T A;  2VW9 A;  4Y52 H;  2JDI A;  3U9O A;  3ONA B;  3NUC A;  4L5R C;  1A2T A;  1HNX L;  4NKL A;  4HJ9 A;  2JIZ A;  2OBT A;  2B8F A;  4OX9 Q;  1XNQ L;  1PYB A;  5M9O A;  5C0X J;  1A15 A;  4RGT A;  1X65 A;  1BMF A;  2X6G A;  2R93 H;  4Y9R A;  1CKM A;  1VQG A;  5T1I A;  4NW2 A;  3PO3 H;  4JI1 L;  5BN5 A;  3ZUG A;  3IFT A;  3FPK A;  3AFQ A;  3GD7 A;  4ZGN B;  5A89 A;  2NTS A;  5CV8 A;  5C4X H;  3DEO A;  3EA6 A;  5E4W C;  5C3E H;  1TXY A;  3TQY A;  3V2T A;  3TS0 A;  1PH6 A;  3CKI B;  3T1H Q;  1NBM A;  2EYL A;  1STY A;  5I6W A;  2ZJQ A;  2NTT A;  1A3V A;  2GJK A;  3QOJ A;  3AGP A;  3CMM A;  4XQJ A;  2VJJ A;  1JC7 A;  1RTN A;  1FYC A;  1EFI D;  1I18 A;  1R5O A;  1LLR D;  4QMG A;  1NRK A;  5C6A A;  5D65 A;  3AB9 A;  5JVH 3;  1B44 D;  2EY6 A;  3QFS A;  3QSY A;  1BX0 A;  2QGG A;  3KDF B;  4XIG S;  1L0W A;  3KDF A;  3SHL A;  4A3K H;  1KXL A;  4BA1 I;  4XLA A;  1E2V A;  4J0Q A;  1OGJ A;  1LTI D;  3ER0 A;  4QIW E;  1F2M A;  4KLK A;  2KCT A;  2ZZF A;  1F60 A;  3W2H A;  1VDZ A;  3T16 A;  1PZK D;  2EIF A;  1BDO A;  2R7D A;  3LVB A;  3Q38 A;  3SLN A;  5DAU A;  2VNJ A;  4UP8 A;  4ZV4 A;  2X8K A;  1WP6 A;  2HQL A;  4QF4 A;  3SK6 A;  2GJP A;  4X06 A;  4R9W A;  4ABN A;  2XOK A;  5IP9 H;  4B3T Q;  5JJK A;  4YEL A;  4CJ2 C;  5TR9 A;  3GTK H;  1EWC A;  3A5U A;  1PTO H;  4A93 B;  2X3U A;  1R9T H;  3GTM H;  5CMD A;  1CKO A;  5IGB A;  4HJ7 A;  5E6T A;  1G29 1;  4RD6 A;  1CFM A;  2RC6 A;  4RM0 A;  1DD2 A;  1T5E A;  3MVV A;  1H8E A;  1SFO B;  4S3S A;  3ZBU A;  1UE5 A;  3E20 A;  2KBN A;  2MHV A;  1STG A;  3ZZ0 A;  2NN6 G;  4H02 A;  3URY A;  1MIU A;  5JEA G;  4FF2 A;  1MJC A;  4RJL A;  5J35 A;  1GUG A;  1N34 L;  3S16 H;  3RZD B;  4LJZ C;  4LF9 Q;  4UZU A;  2JK8 A;  1LTA D;  2K5H A;  3PA1 A;  2KED A;  1KHI A;  1QE6 A;  3K8A A;  4A3B G;  5E7N A;  5FJ8 G;  1XMQ Q;  2EE1 A;  1JT8 A;  3LWE A;  3QFC A;  4L8J A;  1FGB D;  3W2F A;  5ELF A;  5IGF A;  1CI3 M;  4B4D A;  2JYO A;  3OJX A;  2ZTC A;  3K0X A;  4BS9 A;  4ALP A;  1YZ6 A;  3CF5 A;  2F0G A;  2K6A A;  2VUM B;  1NSN S;  1XYI A;  2CW0 D;  4F7D A;  1K8A D;  4GOP C;  5CC4 A;  3GTQ B;  2NN6 I;  3AVV A;  3JU4 A;  1J6Q A;  4V0B A;  1VLO A;  1UD4 A;  3CU7 A;  3I55 B;  4C3I G;  2IHE A;  3A8I A;  1EU3 A;  2MO0 A;  4H0L C;  3DM1 A;  2R6H A;  2XEX A;  3FRP B;  1WSV A;  3I55 A;  1C8C A;  1Q81 C;  4TMZ A;  2NWG A;  2X0K A;  4LBV A;  1HNZ Q;  1I4Q A;  5LMZ A;  5CV7 A;  3K7A B;  2HCI A;  4DV2 L;  1XE1 A;  4BY1 B;  1TY2 A;  1N08 A;  4K2K A;  5GV8 A;  4C3H G;  4ZCL A;  5HGQ A;  1IBL Q;  1Z47 A;  2MPM A;  2C4T A;  2DCU A;  1PH2 A;  1KL9 A;  3L0O A;  2L0C A;  1N34 Q;  4O0A A;  5DNF A;  4IN3 A;  1ESR A;  5HUR A;  4OIJ A;  2LS0 1;  3FDT A;  3MXP A;  3A8J A;  2ZL5 A;  4OPS A;  2L4N A;  3PO2 G;  5GAG C;  1RCV D;  3K5N A;  3GVL A;  4ME3 A;  4WZT A;  2HIV A;  3HEJ A;  2SNS A;  1PYW D;  2JJ1 A;  1ZYR D;  3RLO A;  4Z4V A;  1E3P A;  4DV0 L;  5IGE A;  1KTV A;  3KL9 A;  2E1R A;  4TSF A;  2C9O A;  2R7F A;  3N52 A;  1EP3 B;  2ZXH A;  1IL2 A;  1BKB A;  3OAA A;  1BPL A;  1UD6 A;  4K6D A;  5H1S E;  2R7Z G;  3VYU A;  5LMU Q;  5IOC A;  2A6E D;  1SEB D;  1BBU A;  4ZCI A;  4KN4 C;  1IJF A;  4JOI C;  4KHP L;  1HNW L;  4RPD A;  3PIP 3;  4RD4 A;  1ICF B;  1R4Q B;  2EXZ A;  2M00 A;  4K8I A;  1U4P A;  4A3C G;  1VQF A;  5M3F B;  4WFN 3;  4NDX A;  2BOS A;  3RR5 A;  3S1N H;  1ROD A;  3RD4 A;  3PUW A;  1VHO A;  2EYH A;  4TSS A;  1PDQ A;  4FP5 D;  1L2F A;  3S1Q H;  1FVI A;  3PUN A;  2ZZG A;  1VCI A;  1GKH A;  1ZUN B;  2F0H A;  1S4Z A;  3PQI A;  3PIP A;  4A75 A;  1WJJ A;  4DQK A;  2L11 A;  3BZD B;  1F77 A;  1PFS A;  1SYB A;  5ISR A;  2TSS A;  2PLF A;  4HIZ A;  3ND9 A;  2L15 A;  1DZ1 A;  1GUN A;  2W6J A;  3DM3 A;  4LMQ D;  2ENB A;  4U9U A;  1VQC A;  4GZY C;  1JOR A;  3S15 H;  1K0R A;  4LF8 Q;  3K0Y A;  3BDL A;  2HDN B;  1MKH A;  3TDQ A;  2VQF Q;  1NAP A;  1QFJ A;  3H6M A;  1N8R C;  4IPG A;  1LT3 D;  3J7Z C;  2JA5 G;  5DM7 3;  4A3J G;  1ET6 A;  2I1L A;  5FO0 A;  1QJO A;  1Z6H A;  5ELD A;  4CKC A;  3OYY A;  4XXE A;  4QV2 A;  4GN3 B;  4F7X A;  1VQH A;  2JA6 G;  5KNC A;  1O7Y A;  2JA8 B;  4X66 L;  1HNW Q;  3KBG A;  1SAP A;  5NUC A;  1KK0 A;  4LW1 A;  1B70 B;  2B5O A;  3TZU A;  2Q6O A;  4Z4U A;  1ZM3 A;  1DDG A;  1N33 L;  3E9H A;  1SND A;  3W1G A;  4A93 H;  1CQV A;  1GVP A;  1HRJ A;  3GO5 A;  4UP9 A;  4OOV A;  3R6J A;  2JEB I;  2ZT9 C;  4YY3 L;  1D8L A;  1LTL A;  2CCZ A;  3HOW H;  5KNB A;  4X65 L;  2OXP A;  1AH9 A;  5ELB A;  3I4M H;  3U4Z A;  4FF4 A;  1CQF A;  4MN3 A;  4DV7 L;  1NUC A;  3RZD H;  1A63 A;  4UAI A;  4RGO S;  3HAG A;  4M0L A;  2JA7 G;  3GTJ H;  5C4X G;  3MZ5 A;  2EYP A;  2Z6B D;  3ULJ A;  4HE5 A;  1EXM A;  3OZU A;  2QTZ A;  3Q23 A;  1K3B C;  2JJ2 A;  1YHA A;  1CK1 A;  3BY2 A;  3GTO H;  4QUC A;  1ZKO A;  2MGS A;  3S1M B;  2D3L A;  4GKK L;  4XTC S;  1BX1 A;  3ASP A;  4XLF A;  5JVG 3;  1M4V A;  5M5X B;  1PH9 A;  4AVZ A;  1OB5 A;  4Z4T A;  1J5E L;  1XMO Q;  2EY5 A;  4ZYS A;  4B3M Q;  5FA6 A;  3A35 A;  4A3K G;  1B3Q A;  4A3I H;  3H0G G;  3HOZ H;  1PRT C;  4A3B B;  1D1N A;  3SR1 A;  3J81 c;  1N33 Q;  3AYH B;  5IYB H;  5BR8 L;  1Q8I A;  3FKS A;  2A5H A;  2K50 A;  2HDL A;  4L63 B;  5JOB A;  4C3J G;  1XFO A;  2C77 A;  4P12 A;  4JI5 Q;  2RHQ B;  1WYD A;  4DKA C;  4HSV A;  3E6Z X;  2QEX B;  4ROX A;  3VA7 A;  4JI6 Q;  3OOC A;  2CBX A;  1S5F D;  3A55 A;  3LX0 A;  2NVY B;  2A68 D;  2QEX A;  5KSW B;  1B4O A;  2ZM6 Q;  1GJR A;  1SKQ A;  4X8I A;  3BVZ A;  4NNJ A;  3KF6 B;  3Q6S A;  5LMN L;  2B2W A;  2F3I A;  2GN5 A;  4C3I B;  1Q86 C;  4QY7 A;  3KF6 A;  2G9H D;  1WOO A;  3NWS A;  4FO2 A;  2WR8 A;  3ZBT A;  3PUY A;  1U0L A;  3LO8 A;  2PPB C;  3Q6R A;  2CF4 A;  4YAW A;  2F0F A;  4IPC A;  3ULL A;  3H3V I;  1SMX A;  2F0U A;  2FMM A;  3ZJY C;  3TBI B;  4GKK Q;  5JPM C;  1WTR A;  1E62 A;  1B50 A;  4R4C A;  4GN5 A;  2UXC Q;  1PKV A;  1OGI A;  1UNS A;  2V7V A;  5DS0 A;  2PMD A;  1QWY A;  2XVS A;  2V7Q A;  4ME5 A;  4ZCK A;  3SDZ A;  1LV9 A;  2ZIT A;  1FNM A;  1W6J A;  2B2T A;  2JA9 A;  4HN7 A;  2DER A;  4K8J A;  3GVK A;  5C4J H;  3WXM A;  5J3B A;  3E1Y E;  4CKE A;  1SN8 A;  4B3F X;  1M90 C;  4CHT B;  3M4Q A;  3BDO A;  4P6V F;  3PCO B;  4NXN L;  1FNC A;  1X56 A;  3TRE A;  3CMA B;  3HKZ G;  2J7Z A;  4JI4 Q;  3HRZ C;  3CCL B;  1I3Q H;  2BA0 A;  5IGD A;  3CMA A;  2N88 A;  4UY8 C;  3VA5 A;  1PJ5 A;  3CCL A;  2YWH A;  3CRZ A;  1WDT A;  2C4U A;  4OO1 H;  1JWU D;  1SBB B;  2YTY A;  1Y8N B;  5BSY A;  3QG1 A;  1QVC A;  3NEM A;  4XOR A;  4XQQ A;  4N3N A;  1S5B D;  3C2P A;  2F0L A;  3J80 c;  1AEX A;  5EKL A;  2YV5 A;  1JE5 A;  4XT1 B;  4DK6 C;  1CSP A;  2D9U A;  1X3F A;  1HXY D;  2ID0 A;  4LC0 A;  4TN1 A;  4X7D A;  2ALY B;  5EGT A;  1B7Y B;  4XOT A;  4FXG C;  1FNW A;  4XN0 A;  3A8K E;  2XSC A;  2B2V C;  1EIH A;  3CCJ B;  1LT6 D;  3TP8 A;  2J0T D;  3BH4 A;  4A3G B;  1T6X A;  4RA8 A;  1XTD A;  1EQT A;  2F43 A;  3CCJ A;  1K3R A;  3QFR A;  2GK7 A;  4K1X A;  5IE8 A;  2VYQ A;  1H42 A;  2PE3 A;  5G3L F;  4II2 A;  1SRO A;  3CCV B;  3MFG A;  2CQO A;  1E1O A;  2A6H C;  1RKN A;  1PTO F;  3CCV A;  1BCP D;  1KDC A;  4WZE A;  1JIC A;  3NP8 A;  3UDI A;  4NXN Q;  1VQJ A;  2VXW A;  1QB5 D;  4WJW A;  3S2D B;  1EY6 A;  2FFK B;  1TS4 A;  2LFN A;  3T53 B;  1WTQ A;  1C0A A;  1EQQ A;  1XPO A;  4EVO A;  1VMC A;  2A69 D;  4RD0 A;  1E2W A;  3CES A;  3E5S A;  3ERO A;  3PGZ A;  1HA3 A;  5KNL A;  1DYQ A;  2E76 C;  4G1V A;  3JQR A;  3AU7 A;  4RG1 A;  4DR3 L;  1ONL A;  2R92 G;  5LL6 X;  1T6Y A;  1X3G A;  1HZE A;  4H44 C;  4XM3 A;  4B48 A;  1EWH A;  1Y69 U;  5C44 B;  3CQZ B;  3RN5 A;  3P7J A;  4RCZ A;  4G57 A;  1MI2 A;  4Z4W A;  2EZV A;  1SNP A;  3GTP H;  4JV5 L;  3CP8 A;  3VR2 A;  4IFD H;  4XKW A;  2Y0S G;  1KZL A;  4QL5 A;  4PC1 A;  1TWC B;  2VNI A;  3OPO A;  2WB1 E;  2GVA A;  3S9W A;  2K75 A;  1Q1B A;  4C1N K;  2D74 A;  1J9Z A;  3UDX A;  3E3X A;  4GKJ L;  1UE7 A;  3I4L A;  1TU2 B;  1OO9 B;  3K81 C;  1KK1 A;  4LBZ A;  5GQO A;  1CA5 A;  3J81 k;  3T56 B;  2NV4 A;  1XNR Q;  4ZLT F;  3CCE B;  4DXG A;  2NVX H;  3V96 A;  1UWV A;  2K01 A;  3CCE A;  3RNU A;  4ZKC B;  3D4R A;  3HOX H;  2HUG A;  4K0K L;  2JA7 B;  1II3 A;  1T6Z A;  3TSS A;  5IP7 H;  3V76 A;  4P9S A;  4ILW A;  3J81 i;  3T1Y Q;  5FNZ A;  2NUC A;  3KF8 B;  4I7Z C;  1QIL A;  3KF8 A;  2OEO A;  1JCK B;  3FKI B;  1EFC A;  2HMA A;  2F3W A;  3HOY G;  3NTK A;  3M9B A;  3PA2 A;  5DN6 A;  1IKL A;  4WWV A;  1WFQ A;  4PC6 A;  3X3N A;  1QZH A;  2NVY H;  2Q2T A;  2NPF A;  4RDJ A;  1DOL A;  1X3P A;  1V9P A;  4F87 A;  2BM0 A;  4XLE A;  4IUR A;  4IFD J;  5EBD A;  4AQY Q;  3U58 A;  2OF1 A;  1OTC A;  1TR5 A;  1BVS A;  1QG0 A;  2KHJ A;  3CW2 C;  5IYW A;  3OP1 A;  4A3M G;  2B63 H;  3HOW G;  1N06 A;  1N0V C;  4ODG A;  5KEE A;  3HOV G;  5JJL A;  3I4M G;  1BXT A;  1PA6 A;  1B53 A;  3DMU A;  2F03 A;  1VJS A;  4DV6 Q;  2F0J A;  2B7B A;  3SJP A;  4C3J B;  1EEF D;  3CB4 A;  2GJR A;  2ZTG A;  1UD8 A;  1STA A;  5I2X A;  2OQ0 A;  4UDU C;  4JI7 Q;  4IW3 B;  3VNU A;  2E5L Q;  1LTT D;  4OP7 A;  3S2H H;  4K0K Q;  1HA6 A;  4CJ1 B;  1VQB A;  2OYN A;  1TWF B;  2NZO A;  1BF4 A;  4DR5 Q;  1TS5 A;  1VQ7 B;  4H7B A;  3UE1 A;  4HCS A;  1HR0 W;  5FLM G;  2K05 A;  1HR0 Q;  1VQ7 A;  2UXD Q;  2PYK A;  1X32 A;  2YU9 B;  2I0Q A;  2RSO A;  2BVN A;  2VBS A;  2UUB L;  5HY6 A;  4TMT A;  4BBR G;  2F0Q A;  5E1F A;  3J80 i;  4BBS H;  4FDB A;  1QFY A;  5A88 A;  3NWT A;  1VLY A;  3W2G A;  1F2L A;  1KAA A;  1TVC A;  4OX9 L;  4RGM A;  3TP6 A;  1EEI D;  3ZYY X;  1PYS B;  2JJQ A;  1YNJ D;  2C35 B;  3EIV A;  1O7L A;  2OCE A;  3P26 A;  1E63 A;  3HKZ B;  1X9N A;  4F88 A;  1EFW A;  3IL8 A;  4JI2 L;  3L2P A;  3CRK C;  3M7G A;  4A3D H;  4X3U A;  1PVO A;  4IZ8 A;  3A8I E;  4RCN A;  2LXJ A;  2QDX A;  4B08 A;  2XWB B;  2WII B;  4XDX A;  3NPP A;  3AST A;  1IW7 D;  3GV6 A;  4JI3 L;  1ASZ A;  3W5H A;  1LM0 A;  3BYT B;  2BDO A;  5M5X H;  3WBK A;  1ZXT A;  4WQM A;  4LWC A;  2RCF A;  2Z6K C;  3SJZ A;  4APV A;  2GPJ A;  1WD1 A;  4CQJ A;  4JI0 Q;  3KLS A;  3LNN A;  3ND8 A;  3EN2 A;  3TP5 A;  2Q8R E;  3MXG A;  1N0U A;  3NQT A;  3R3O A;  2CK3 A;  3B78 A;  3W3A A;  2YTV A;  2E74 C;  1NJI C;  1GUW A;  3CC7 B;  2ZTN A;  3G48 A;  3CC7 A;  1I4X A;  3AVW A;  1RF2 D;  1ENC A;  2WYR A;  2RDH A;  2ZZE A;  2F0I A;  4BPR A;  3NTI A;  5TRD A;  3OWE B;  4ZUJ A;  3OWF A;  1YJN A;  5C5L A;  5C44 H;  5IYQ A;  3STB D;  4AIM A;  2CH4 A;  3DWP A;  3MTS A;  1I50 H;  4HIO A;  1WTV A;  1CQX A;  4N9T A;  3TP7 A;  4B3T L;  1K0S A;  4RGN A;  5FK9 C;  3FHW A;  5K5P A;  3TRZ A;  1JA1 A;  1V1P B;  4NB3 A;  3OJW A;  1A8V A;  4ZCM A;  4JI8 Q;  2MQH A;  4BWG B;  4JI2 Q;  1HPC A;  2TMP A;  1V1P A;  2D0O A;  4P26 A;  5FLX c;  4HSP A;  4NMZ A;  2D9R A;  5J1Z A;  2R92 B;  5J3O A;  4LF9 L;  3AEV A;  1YI2 B;  5K36 G;  4HTH A;  4JI3 Q;  3ASR A;  2EIX A;  1GUT A;  2P3M A;  1YI2 A;  2CWP A;  3NSW A;  4RKB A;  2QDL A;  5TSS A;  1F9P A;  2CH4 W;  1XMQ L;  4KD3 A;  3PIO 3;  1DXM A;  1QGZ A;  2NZ1 D;  2EPB A;  3WYA A;  3ZZU A;  5HZB A;  1COW A;  4RKL A;  1XJV A;  1BQE A;  4XKV A;  4A3L H;  1W34 A;  2D62 A;  4DK3 C;  1BNZ A;  3MMP A;  1DON A;  1VQ4 B;  3HOU G;  2F0T A;  2EJF C;  4AYB G;  4YAL A;  4P6Y A;  2V7X A;  2F4V Q;  3FP9 A;  4X3K A;  4JC0 A;  3VYT A;  1VQ4 A;  2KA7 A;  4WJ3 M;  3BU2 A;  4HIM A;  3JC6 6;  1GXD C;  3WNC A;  5I9O A;  2BH2 A;  4V19 0;  1QVG B;  1H9M A;  3I7F A;  3PIO A;  4LNQ A;  1DCZ A;  3DLL A;  2BE5 C;  2B8G A;  1QVG A;  4A4I A;  1I7P A;  1ENF A;  2RDF A;  1JB7 A;  3NTH A;  4PGO A;  3VDY A;  1HNZ L;  4HJA A;  4MHE A;  4DR1 L;  1YJ9 B;  1SR3 A;  1Y1V G;  1BCP B;  3KLS X;  1YJ9 A;  1VF5 C;  2O2L D;  1GO2 A;  1IBL L;  1D5X C;  1UAP A;  4OWT B;  2V7W A;  3EQL C;  4CBV A;  4ZK9 B;  5M5Y H;  4O42 A;  4A3F H;  4XR6 A;  3S1R H;  2NVT B;  3OKX A;  1GUS A;  1EFR A;  2UU9 L;  1JOQ A;  2VQE L;  2C5B A;  4DAP A;  1LTG D;  5IOD A;  4X7C A;  4YAF A;  3G4S B;  4GLV B;  1STN A;  2E2H B;  3G4S A;  5M5W B;  1Q7Y C;  1IBM Q;  1QH0 A;  1AZP A;  1PJ7 A;  2XND A;  1HFG A;  2L55 A;  4N3G A;  1FDR A;  1CNE A;  2PI2 A;  2CRV A;  4ZQ3 A;  2X6Y A;  2AHO B;  3D4W A;  4A3M B;  4II3 A;  1B2T A;  3J81 E;  4JBJ A;  2AHO A;  2WSS A;  3OE7 A;  5IYD G;  3WNB A;  3S14 H;  1JMC A;  5KIX A;  3I4N G;  2RVL A;  1QUF A;  1HHV A;  3HOX G;  3OZW A;  2ZXI A;  1GHK A;  1OXS C;  2A74 C;  1O80 A;  2WJV A;  4DNR B;  4M1U B;  1EZ6 A;  5LMU L;  5EJW A;  2QN6 A;  2VL6 A;  5DLQ E;  2ZXR A;  3CCM B;  1Q46 A;  2L1B A;  2CVR A;  1IBK Q;  3SKB A;  3CCM A;  4A3E B;  4TMX A;  1MHW C;  2KOL A;  4TT3 A;  4DR1 Q;  4I7A A;  1UUP A;  3RY8 A;  4B3S L;  4BY7 G;  3ITP A;  4DR6 Q;  5IGC A;  4XN3 A;  5IWA Q;  4XYO A;  2QCP X;  1ENA A;  2Q6I A;  2VBT A;  2K03 A;  3AFP A;  3ZC3 A;  2E2I B;  2BGI A;  1KLU D;  5THX A;  4DV3 Q;  3U50 C;  2UU9 Q;  3E9I A;  2VQE Q;  2WIN B;  2ZZQ A;  1NE3 A;  3F1Z A;  2JP1 A;  3CC2 B;  1A8P A;  2RCN A;  2B63 G;  2K32 A;  4K14 A;  4BBR B;  1SJE D;  2GVB A;  1EIG A;  3CC2 A;  1S5D D;  1TQO A;  3NEL A;  2CND A;  3PF5 A;  3GSI A;  4QFM A;  1J9O A;  5D14 A;  4HIK A;  1LTB D;  5I6Y A;  4LF8 L;  4JBM A;  4XD7 A;  4Z4S A;  2FVG A;  3JQQ A;  4PC2 A;  2VQF L;  4B3R L;  2XRQ D;  2XZL A;  1WCM B;  5KGU A;  1FNU A;  1TWG H;  4P71 A;  1G6Z A;  3SK4 A;  1YNN C;  2PZU A;  5CBA E;  1EWY A;  2F0D A;  5M3M G;  3HS0 C;  4IOC A;  1FX0 A;  1H9J A;  5L37 A;  3W5U A;  1XPU A;  1RD9 D;  2JXM B;  1I94 Q;  3OZV A;  3WOF A;  1L0Y B;  3SE0 A;  1E24 A;  3Q8D A;  3J80 E;  3EJI A;  4OWW B;  4O2D A;  1TLL A;  3MEF A;  1SMY C;  3LWU A;  2YWE A;  2P5Z X;  3N6R A;  1Q82 D;  1YIJ B;  1MRZ A;  5EPJ A;  4B3S Q;  3D6C A;  2H4O A;  3BZK A;  1QCB D;  3MC0 B;  1YIJ A;  3NBI A;  2HDM A;  5C5M A;  4CDD C;  2OK7 A;  2CFM A;  2HT1 A;  4XT3 B;  3LQ6 A;  3HZX A;  3PUZ A;  2WZP P;  1HA5 A;  1PH8 A;  4NP5 A;  4EH1 A;  5C0X G;  3S17 B;  5B6I A;  1V43 A;  1SRU A;  1Z7T A;  2A8V A;  2WAQ G;  1C48 A;  1FJG Q;  5JPN C;  2OWO A;  3HGB A;  1PRT D;  1NCV A;  1Y1W G;  4HCE A;  4A3D G;  1CNF A;  1NR4 A;  3OSO A;  3J7A 5;  2DNC A;  4P3Y A;  4YCV A;  4E0F A;  3K5M A;  2WKD A;  3A5Z B;  2H1E A;  4B3R Q;  4DK1 A;  1YVC A;  2F52 A;  4IOA A;  2EYM A;  3RZO B;  1O7I A;  2CW0 C;  4LF4 Q;  4G4K A;  4X62 Q;  5L46 A;  1EY4 A;  5C0X I;  1PFN A;  1XMO L;  1XB2 A;  3J81 L;  4OL7 A;  3LQE A;  2PMZ E;  4MNO A;  1Q86 D;  1EFT A;  4FN5 A;  1PZI D;  4B3M L;  4RMF A;  4PC3 A;  1HTP A;  5JBQ A;  4LF6 Q;  1TWH B;  4EQN A;  3T51 B;  1OHH A;  2PQA B;  4XYQ A;  3UI2 A;  4GNX C;  1W2B B;  2PQA A;  2Q2I A;  1W2B A;  2WAC A;  4LF5 L;  1E79 A;  2DET A;  2V4D A;  4G7W A;  4NXM Q;  4U67 3;  1JJ2 B;  2DIE A;  4JI5 L;  1SFO H;  4XLC A;  1Y14 B;  3HOU B;  1JJ2 A;  4AYB B;  1OXX K;  4X0C A;  2K28 A;  4JI6 L;  4HID A;  4M2L A;  1M90 D;  4IUT A;  2R93 G;  4DR4 Q;  1D5M C;  2D0P A;  1MGS A;  4DAV A;  3PO3 G;  3D4D A;  1KLG D;  2ZM6 L;  3Q0A A;  1KD1 C;  2Z8L A;  3R8B A;  5C3E G;  5TY0 A;  5IT9 c;  4FF3 A;  2O5J C;  3OW7 A;  2F0P A;  4IJL A;  1W3S A;  3CCU B;  3OTO Q;  1ZYR C;  4BXX H;  2IL8 A;  3CCU A;  1Y1V B;  2PNH A;  3MFY A;  1SE4 A;  2VUM H;  4B43 A;  1X3E A;  4PMC A;  4Z4R A;  5CDF A;  2UXC L;  4KI0 A;  1LUZ A;  3GTQ H;  1HZ9 A;  3BVG A;  2JSO A;  2RC5 A;  4GOP B;  2A6E C;  1Q90 A;  2MJ8 A;  1CSQ A;  4GOP A;  1A62 A;  1D5Z C;  4Q0F A;  1B8A A;  1EOT A;  2F0K A;  3FPU B;  2F0W A;  1F2Z A;  3D8G A;  4PAB A;  4ACB A;  3E0E A;  3M4P A;  1PMR A;  4JI4 L;  1VQM B;  4RFB A;  5A35 A;  4KMU C;  1UEB A;  3J80 L;  1VQM A;  4X05 A;  2Z0S A;  2EOT A;  3K7A H;  1W6K A;  4I65 A;  4BY1 H;  4LF5 Q;  1IKM A;  1N05 A;  5AFW A;  4YWK A;  3WND A;  3GDE A;  2J7K A;  1CA6 A;  2E8G A;  1H9R A;  4P73 A;  2A6H D;  1KRT A;  5IP9 G;  3I73 A;  1FND A;  1OB2 A;  1HQR D;  3J7A V;  3VR3 A;  5DSZ A;  2OQK A;  2IY5 B;  2ICI A;  4MYU A;  5HXB A;  4OIK A;  4ZAI A;  1K9M C;  2XNJ A;  4LFB Q;  2SNM A;  4R8I A;  3G71 B;  1ET9 A;  4A3F G;  3DUZ A;  5KYL A;  1SNM A;  3CCR B;  2JE6 I;  3G71 A;  4FXD A;  4Z4Y A;  3GTG B;  2Q2H A;  1FNV A;  3CCR A;  3I91 A;  4BY7 B;  4PMB A;  4C3H B;  1WCM H;  1G7R A;  1IYJ B;  2EVB A;  5AN9 A;  4CDC C;  3CAM A;  2Q2U A;  5EMN A;  3E0J A;  5JJZ A;  2B2U C;  1KNA A;  1PTO C;  3HFZ B;  1A3U A;  4ZUI A;  1FRQ A;  2B39 A;  4P3I A;  4LF7 L;  3LGJ A;  2V1C C;  1MJE A;  4R71 A;  4QJF A;  5HKK A;  1K83 B;  2K5D A;  3NBH B;  2R9V A;  3PO2 B;  4JOI A;  3NBH A;  5BN4 A;  2B2Y C;  4ASU A;  2H5X A;  1PH7 A;  3BQJ A;  5M3F H;  4GQN A;  1EUJ A;  3R6K A;  1EZ8 A;  3T13 A;  1NR2 A;  1L0X B;  2F4I A;  5F4M A;  1T9H A;  5COR A;  2QIL A;  3A7L A;  3RLF A;  2ZL7 A;  2R7Z B;  2AUK A;  3ZIA A;  2BSA A;  2AUJ D;  1SYE A;  2LY7 A;  3PMF A;  3QE2 A;  1M8A A;  5FO1 A;  2PMZ B;  2XNA C;  5E3F A;  4RPB A;  2LZJ A;  3VO2 A;  1L1O C;  5I2Y A;  1KDB A;  5T1G A;  1ZM9 A;  3CP2 A;  1U4R A;  4DGZ A;  2I5L X;  1E43 A;  1SXT A;  4G1B A;  1XXG A;  1H9S B;  4IUV A;  3PUM A;  1E1R A;  2R6G A;  1PFM A;  1H9S A;  1FRN A;  4G7O C;  2UUA Q;  2C2W A;  1EYA A;  1BO0 A;  5IIF A;  3QR8 A;  4G7H C;  4TKO B;  1W87 A;  1VQ5 B;  2K33 A;  1XNR L;  3U2Q A;  1WOS A;  3T4A C;  1AW7 A;  1S4M A;  5IGG A;  1VQ5 A;  4LF7 Q;  2NZH A;  4G7Z C;  2JA8 H;  4P25 A;  3TME A;  1TVX A;  2WAQ B;  4QCL A;  3HKZ E;  1Y1W B;  3OFN A;  3DEP A;  2DY8 A;  4UHV A;  3M3Y B;  3ZZT A;  1KQS B;  1IL8 A;  1SYC A;  1TS2 A;  3T1Y L;  1ZM2 A;  2RDG A;  1WI5 A;  1GVH A;  4BA2 I;  1QZG A;  1KQS A;  1A2U A;  4QQB X;  2MP1 A;  1I6H B;  4DNT B;  2F0S A;  4ACA A;  4GLX A;  2JA5 B;  2CQA A;  3BYY B;  5FLX E;  4A3J B;  2RF4 A;  2VS1 A;  2XN9 C;  4FF1 A;  4L6T B;  2A68 C;  3QO2 A;  2UXB Q;  2ZBU A;  2X69 A;  5ELE A;  1BQQ T;  4K5W A;  4OOX A;  4N8F A;  5FOB B;  2JA6 B;  4YWM A;  2V31 A;  2DNE A;  3VR4 A;  4AQY L;  2F3V A;  4N8X 1;  3J7A F;  2IX3 A;  2K5V A;  3CD6 B;  1NB0 A;  4C2M B;  1WTO A;  2EDG A;  4X7E A;  3BNW A;  5IYC H;  3CD6 A;  1EY7 A;  3SEJ A;  1QUQ B;  1D1K A;  1S3O A;  3S1M H;  3OMG A;  4DV6 L;  4Q7J B;  1QUQ A;  2EYF A;  4M8A A;  3SEB A;  1V8Q A;  4DUZ L;  1VQD A;  1T5X D;  1KAW A;  1Y0R A;  4KKS A;  1EP1 B;  4UAJ A;  2CW5 A;  1OXV A;  2NN6 H;  2QDB A;  2ZTD A;  3FEW X;  4PZ8 A;  4L5Q A;  5JEA H;  3AMU A;  3OMC A;  4JI7 L;  4J6H A;  2Z4H A;  1VQE A;  3D0F A;  3DWQ A;  2E5L L;  4YCU A;  1JOO A;  2K7V A;  3NXW A;  1K8M A;  3CTA A;  5C3E B;  4LFA Q;  5C4X B;  5ELC A;  4DR7 Q;  4HE6 A;  2SEB D;  4A3B H;  2CHB D;  4DV1 Q;  3BCD A;  2KCN A;  1PRT B;  2KEC A;  2RA4 A;  4P72 A;  5FJ8 H;  3K59 A;  4DR5 L;  3PF4 A;  5EPL A;  1QGA A;  1V1O A;  1HR0 L;  2LXK A;  4X3T A;  2UXD L;  4UZE A;  2N3S A;  1PH5 A;  2KQ3 A;  4CDE C;  3W2E A;  1G8Z D;  1FL0 A;  1B9M A;  2ZBV A;  3NK9 A;  4A93 G;  1H85 A; 
#chains in the Genus database with same CATH homology
 4WRD A;  2D5D A;  3NQI A;  3BDC A;  1ZEQ X;  4A3K B;  4DXF A;  1Q12 A;  1EY8 A;  3H0G B;  2E1B A;  1LO5 D;  1PLF A;  4ID6 A;  4IAL A;  3Q22 A;  3A56 A;  4RCO A;  4H13 C;  4KJO A;  1E1Q A;  2WP8 J;  4K6L A;  1DJR D;  5JEA J;  4HR7 B;  1JWM D;  5BN3 A;  1SDF A;  3L9A X;  1EY0 A;  2KHS A;  4TQU S;  3GTM B;  3BS1 A;  3BG3 A;  2B2U A;  4G6I A;  1TT2 A;  2J4X A;  3NHH A;  2XRS D;  4ULL A;  1UD3 A;  2A73 B;  2A69 C;  3KBX A;  3KEW A;  3S16 B;  3DWA A;  1RTO A;  5D3D A;  1EY5 A;  1ICW A;  5A2Q E;  5FO7 B;  3GTL B;  1TKW B;  2QEJ C;  3GP7 A;  2KJX A;  5FLX L;  4CGY B;  2K04 A;  2KCC A;  4TRD A;  2NVQ B;  2KUM A;  2QKI C;  4CJ0 B;  5J22 A;  4FXU A;  1CZG A;  2B2V A;  5CGK A;  1QNU A;  1G91 A;  4DFA A;  1QNK A;  4Q5V A;  1RJT A;  4EGV A;  2BE5 D;  2Z4I A;  3D31 A;  1E3Z A;  1KMH A;  3O13 A;  1BCP F;  1SYF A;  1W9X A;  2E75 C;  4J1M A;  1EL0 A;  1SE3 A;  5C3X A;  1WTH D;  1OXT A;  3PV0 A;  2F0N A;  3K5L A;  3K5O A;  1IYV A;  3SK5 A;  4KD4 A;  5F2D A;  2WV6 D;  3OIP A;  1Y8P B;  2NYZ D;  4OGQ C;  4KY5 A;  1KAB A;  2HCC A;  1HUM A;  2PW7 A;  4YEJ A;  4IUQ A;  3H94 A;  2WKC A;  3MWY W;  4OO1 G;  3FPP A;  1HFN A;  4FVM A;  3C46 A;  5J39 A;  3CRL C;  1TWA B;  1BR9 A;  5FO8 B;  3VYR A;  1SSO A;  3G05 A;  2E2J B;  3P20 A;  2PQE A;  3TZD A;  3L7Z C;  4KY7 A;  2L5T A;  1TY0 A;  1CTM A;  4YIJ A;  3G7L A;  2KVM A;  2IW3 A;  4OO1 I;  3S1N B;  1SJH D;  2C5C A;  2Y0S B;  3S1Q B;  3KUP A;  1AZQ A;  3ERQ A;  4DF7 A;  1UEA B;  1EY9 A;  3W2D A;  2GK6 A;  3M4Y A;  2AWO A;  2XZO A;  4JBW A;  5COY A;  3HP3 A;  2LKV A;  1CZW A;  2Q8T A;  3S15 B;  4IQZ A;  1FR3 A;  1YNJ C;  4FXK C;  4K2L A;  1BUV T;  1I8D A;  2R61 A;  1Q3L A;  1HCZ A;  5A2Q L;  3K6O A;  5IT9 E;  3DHQ A;  1STB A;  1YNN D;  2W6I A;  2PNR C;  1UD2 A;  1F9S A;  4KK7 A;  2AQ2 B;  4K5X A;  4IFD G;  1R4P B;  2PCF B;  1F2Y A;  3HOY B;  1IW7 C;  1SMY D;  1HUN A;  4EQP A;  3QOL A;  4HAE A;  1XX8 A;  1E0B A;  2VB2 X;  2Q8I B;  1DM0 B;  3HOW B;  3K58 A;  3HOV B;  3I4M B;  5HGT A;  3I70 A;  1TS3 A;  2EYJ A;  3GTJ B;  4IFD I;  3OIQ A;  4XL9 A;  1EYC A;  3FMC A;  3GTO B;  2F0O A;  2L9H A;  1KNE A;  4PQX A;  1BLI A;  1ML0 D;  4DA2 A;  1B3A A;  4Y7N B;  2IWH A;  4A3I B;  5EQ0 A;  3HOZ B;  4XLH A;  1VMP A;  3H91 A;  2X53 S;  3QIA A;  1WTX A;  2O4X A;  4HMJ A;  1H9K A;  2DY7 A;  1W0K A;  5CV5 A;  2B2W C;  2PZT A;  3VR5 A;  4B9X A;  2AQ3 B;  3VR6 A;  2X6X A;  2FIN B;  2IX0 A;  2F1M A;  3KLR A;  4KN7 C;  4JK1 C;  5I9P A;  1WVL A;  2M5S A;  5FL7 A;  2IX1 A;  2B2T C;  5KND A;  1I4R A;  3IAY A;  2EYO A;  1KDA A;  3RMH A;  1I4P A;  4O1N A;  3MXN A;  2PW5 A;  5C4J B;  5IT9 L;  5FO9 B;  4XOP A;  2ICE C;  2HLD A;  3M7N A;  3F2U A;  4KKT A;  1SNC A;  3R93 A;  2HQE A;  1I3Q B;  2AWN A;  1SNO A;  3MHB A;  3PUX A;  5I4D A;  4FYD A;  2EY1 A;  4YXW A;  1ILP A;  2JEA I;  4QIW B;  2XWJ B;  4DN4 M;  4F8M A;  3EVQ A;  1LT4 D;  4EQO A;  2SDF A;  4KJN A;  1UD5 A;  4RH6 A;  1BOS A;  3DXJ C;  3C3L A;  1AFP A;  1SKY B;  1LTR D;  5G3L D;  1LAC A;  2BA1 A;  2I46 A;  1PTO D;  1MSG A;  1KTK A;  2D2C C;  1PFB A;  1WTW A;  2PO4 A;  1RHP A;  3DDY A;  4XMY A;  3NE5 B;  1GUO A;  3OEH A;  1I4G A;  1JWS D;  1HQM C;  4DAY A;  3QWN A;  3M4O B;  2M9V A;  2D3N A;  1AP0 A;  1Y8O B;  5CV6 A;  2AQ1 B;  5C3W A;  3WQZ A;  5KRU A;  3MAQ A;  1MSH A;  4R8N A;  3GTP B;  2NBF A;  4P22 A;  3OHX C;  2E2D C;  1G2T A;  1CT1 D;  5JAV A;  1E2Z A;  2OT2 A;  1TII D;  2M2L A;  3FVQ A;  5C4H A;  1G2S A;  4LAA A;  1BBX C;  3MA2 B;  1JE4 A;  1OB0 A;  2NVX B;  3G6J B;  2RSN A;  3I4N B;  1LT5 D;  2K1B A;  3HOX B;  1CHP D;  4KHZ A;  2YYZ A;  1J8I A;  1D6E C;  2XZP A;  1F9Q A;  3IKJ A;  1D1I A;  4PV1 C;  2Z1C A;  4B3G A;  2VNU D;  2FHT A;  3EFX D;  3CHB D;  1W0J A;  3H09 A;  2FMC A;  4KTA A;  1AN8 A;  4XNF A;  3C1E A;  1QOH A;  1K28 D;  2B63 B;  1RDP D;  5IK2 A;  2IPK D;  3K57 A;  3H3V C;  4ZKB B;  3HG9 A;  2ZXP A;  2N55 A;  1JB3 A;  4N9P A;  4P2C B;  5E4X A;  5CBE E;  3GQB A;  1HVX A;  2K5Q A;  5CV4 A;  4KV6 A;  4ZRZ A;  1HTL D;  1EU4 A;  4QB4 A;  5M3M B;  1B9N A;  2NB0 A;  3S2H B;  4HED A;  5LL6 S;  2L12 A;  4C1N I;  3JAM E;  1PRT F;  1VF7 A;  1XTC D;  2RBM A;  2PZW A;  4IUP A;  3R2T A;  4WOR A;  2EJG C;  1XWE A;  3TN2 A;  3A54 A;  5EKI A;  1STH A;  4BBS B;  3SXH A;  2X6L A;  1IYU A;  4HMI A;  2VJI A;  1CHQ D;  4E6I A;  1CM9 A;  2F0E A;  5K36 H;  1X3Q A;  5D3I B;  3QB3 A;  4A3D B;  3P75 A;  4RHS A;  4LK1 C;  2QF7 A;  5CYU A;  1I6V C;  3M85 A;  5CV9 A;  4DU9 A;  2X6W A;  1S5E D;  4IUN A;  3L3O C;  3I3C A;  1SNQ A;  3MXU A;  1H8H A;  2VB3 X;  4PNY A;  2KVO A;  1D2B A;  2IT1 A;  4J8Q A;  1LAB A;  1OXU A;  2F0M A;  4QUF A;  3BCF A;  4KHV A;  3I72 A;  4RWS C;  2F0V A;  5LHY 1;  1QG7 A;  1I50 B;  1EYD A;  1O7Z A;  2R93 B;  3SK8 A;  3PO3 B;  1U4M A;  2K5W A;  2GA4 B;  3I8Z A;  4XON A;  2RQX A;  1U4L A;  5EPK A;  5EBC A;  4XQF A;  2DN8 A;  1JR0 D;  2SOB A;  1ILQ A;  4X3S A;  5CR3 A;  3C1F A;  4FNF A;  3OEE A;  2KEE A;  1STE A;  3PUV A;  2QE7 A;  1SYD A;  4PMW A;  2LMC B;  5C4Z A;  3JAM L;  2EJM A;  1WTP A;  2EY2 A;  1S5C D;  3GV3 A;  3P1H A;  2XIW A;  3IFD A;  2FJ2 A;  1JOK A;  3BC9 A;  2BDN A;  3MEH A;  1DOM A;  1PXU A;  3SVM A;  3GTK B;  1BCP C;  4XQN A;  1Q1E A;  1PTO B;  1R9T B;  1EQV A;  2IJ0 A;  2ZXO A;  4B9W A;  3A3G A;  4JMQ A;  2RKS A;  5DEH A;  3Q24 A;  3J7Y W;  1F9R A;  5M5Y B;  4A3F B;  3S1R B;  3BVM A;  2XGJ A;  1ESF A;  1MBY A;  1WPC A;  1A6X A;  3I90 A;  1O78 A;  2B2Y A;  1JQY D;  3A7A B;  4U68 A;  1V0F A;  4C56 C;  3QJY A;  2R3Z A;  3S14 B;  4K5V A;  4RAU C;  3V05 A;  1MAB A;  4MIU A;  5DM6 3;  3D6W A;  4IUU A;  1V0E A;  4Z1M A;  1U9R A;  1E3X A;  1LTS D;  1SE2 A;  3X3M A;  1I4H A;  1C4Q A;  2MUY A;  5C0X H;  1K8O A;  3WOE A;  3WDN A;  5KYI A;  2WPD A;  4DK0 A;  3U9S A;  1MD2 D;  2G9D A;  5FKA C;  5EKK A;  3ZPN A;  3GVJ A;  1GOZ A;  1PZJ D;  2X85 A;  3A3B A;  3D3R A;  1FD7 D;  1WD0 A;  4RHR A;  4KKU A;  4Z9C B;  3VYS A;  1GHJ A;  1SYG A;  4CKB A;  2WJY A;  3R2I A;  4KY6 A;  4G7X A;  1TWG B;  1GJX A;  1DOK A;  3RUZ A;  2WB1 B;  3KK7 A;  2I07 B;  1B1Z A;  1IHZ A;  2BCO A;  4OHJ A;  3A8J E;  1A3T A;  2JDI A;  3U9O A;  3ONA B;  3NUC A;  1A2T A;  4NKL A;  2JIZ A;  2B8F A;  5M9O A;  5C0X J;  1A15 A;  4RGT A;  1BMF A;  2X6G A;  5T1I A;  4NW2 A;  5BN5 A;  3IFT A;  3GD7 A;  2NTS A;  5CV8 A;  3DEO A;  3EA6 A;  5E4W C;  3V2T A;  3CKI B;  1NBM A;  2EYL A;  1STY A;  5I6W A;  2NTT A;  1A3V A;  2GJK A;  3QOJ A;  3CMM A;  4XQJ A;  2VJJ A;  1JC7 A;  1RTN A;  1FYC A;  1EFI D;  1I18 A;  1LLR D;  4QMG A;  1NRK A;  5C6A A;  5D65 A;  3AB9 A;  5JVH 3;  1B44 D;  2EY6 A;  4XIG S;  3SHL A;  4BA1 I;  4XLA A;  1E2V A;  1LTI D;  1F2M A;  2ZZF A;  1VDZ A;  3T16 A;  1PZK D;  1BDO A;  5DAU A;  2X8K A;  1WP6 A;  4QF4 A;  3SK6 A;  2GJP A;  4R9W A;  4ABN A;  2XOK A;  4YEL A;  4CJ2 C;  1EWC A;  1PTO H;  4A93 B;  5CMD A;  5IGB A;  1G29 1;  1CFM A;  1DD2 A;  1T5E A;  3MVV A;  1H8E A;  1SFO B;  4S3S A;  2MHV A;  5JEA G;  1STG A;  2NN6 G;  3URY A;  4FF2 A;  1GUG A;  3RZD B;  4LJZ C;  4UZU A;  1LTA D;  2KED A;  1QE6 A;  2EE1 A;  3LWE A;  4L8J A;  1FGB D;  5ELF A;  5IGF A;  1CI3 M;  4BS9 A;  2JYO A;  2F0G A;  2K6A A;  2VUM B;  1NSN S;  1XYI A;  2CW0 D;  5CC4 A;  3GTQ B;  2NN6 I;  3JU4 A;  4V0B A;  1UD4 A;  3CU7 A;  4C3I G;  1EU3 A;  4H0L C;  3DM1 A;  3FRP B;  1C8C A;  2NWG A;  1I4Q A;  5CV7 A;  3K7A B;  2HCI A;  4BY1 B;  1TY2 A;  4K2K A;  4C3H G;  1Z47 A;  2MPM A;  2L0C A;  5DNF A;  4IN3 A;  1ESR A;  5HUR A;  4OIJ A;  2LS0 1;  3FDT A;  3MXP A;  2L4N A;  1RCV D;  3K5N A;  3GVL A;  3HEJ A;  2SNS A;  1PYW D;  2JJ1 A;  1ZYR D;  5IGE A;  4TSF A;  2C9O A;  3N52 A;  2ZXH A;  3OAA A;  1BPL A;  1UD6 A;  4K6D A;  3VYU A;  5IOC A;  2A6E D;  1SEB D;  4KN4 C;  3PIP 3;  1R4Q B;  2EXZ A;  2M00 A;  4K8I A;  1U4P A;  5M3F B;  4WFN 3;  4NDX A;  2BOS A;  1ROD A;  3RD4 A;  3PUW A;  2EYH A;  4TSS A;  1PDQ A;  4FP5 D;  2ZZG A;  1VCI A;  2F0H A;  1S4Z A;  2L11 A;  3BZD B;  1F77 A;  1SYB A;  5ISR A;  2TSS A;  4HIZ A;  3ND9 A;  1DZ1 A;  1GUN A;  2W6J A;  4LMQ D;  2ENB A;  4GZY C;  1JOR A;  3K0Y A;  3BDL A;  3TDQ A;  1NAP A;  3H6M A;  1LT3 D;  5DM7 3;  1ET6 A;  1Z6H A;  1QJO A;  5ELD A;  4CKC A;  4XXE A;  4F7X A;  5KNC A;  1O7Y A;  2JA8 B;  3KBG A;  1SAP A;  5NUC A;  3TZU A;  1SND A;  1CQV A;  1HRJ A;  3GO5 A;  2JEB I;  2ZT9 C;  5KNB A;  2OXP A;  5ELB A;  4FF4 A;  1CQF A;  4MN3 A;  1NUC A;  4UAI A;  4RGO S;  3HAG A;  3MZ5 A;  2EYP A;  2Z6B D;  3Q23 A;  2JJ2 A;  1CK1 A;  4QUC A;  1ZKO A;  2MGS A;  3S1M B;  2D3L A;  4XTC S;  5JVG 3;  4XLF A;  1M4V A;  5M5X B;  4AVZ A;  2EY5 A;  4ZYS A;  3A35 A;  1PRT C;  4A3B B;  3SR1 A;  1Q8I A;  3FKS A;  2A5H A;  4L63 B;  2HDL A;  5JOB A;  4C3J G;  4HSV A;  3E6Z X;  3VA7 A;  3OOC A;  1S5F D;  3A55 A;  3LX0 A;  2NVY B;  2A68 D;  1B4O A;  3BVZ A;  4NNJ A;  3Q6S A;  2B2W A;  4C3I B;  2G9H D;  3NWS A;  4FO2 A;  3PUY A;  2PPB C;  2F0F A;  2F0U A;  2FMM A;  3TBI B;  5JPM C;  1WTR A;  1B50 A;  1PKV A;  1UNS A;  1QWY A;  2XVS A;  2V7Q A;  4ME5 A;  3SDZ A;  1LV9 A;  1W6J A;  2B2T A;  4K8J A;  4HN7 A;  3GVK A;  4CKE A;  4B3F X;  4CHT B;  3BDO A;  2J7Z A;  3HRZ C;  2BA0 A;  5IGD A;  2N88 A;  3VA5 A;  4OO1 H;  1JWU D;  1SBB B;  1Y8N B;  3QG1 A;  4XOR A;  4XQQ A;  1S5B D;  3C2P A;  2F0L A;  1AEX A;  5EKL A;  4XT1 B;  2D9U A;  1HXY D;  2ID0 A;  5EGT A;  4XOT A;  4FXG C;  1FNW A;  4XN0 A;  3A8K E;  2XSC A;  2B2V C;  1EIH A;  1LT6 D;  3TP8 A;  2J0T D;  3BH4 A;  4A3G B;  4RA8 A;  1EQT A;  2F43 A;  2GK7 A;  5G3L F;  4II2 A;  3MFG A;  2A6H C;  1RKN A;  1PTO F;  1BCP D;  1KDC A;  1JIC A;  3NP8 A;  2VXW A;  1QB5 D;  4WJW A;  3S2D B;  1EY6 A;  2FFK B;  1TS4 A;  2LFN A;  3T53 B;  1WTQ A;  4EVO A;  1VMC A;  2A69 D;  3E5S A;  1E2W A;  3CES A;  3ERO A;  2O5I C;  5KNL A;  1DYQ A;  2E76 C;  3AU7 A;  1ONL A;  5LL6 X;  4H44 C;  1HZE A;  4XM3 A;  1EWH A;  1Y69 U;  5C44 B;  3CQZ B;  3P7J A;  4G57 A;  1MI2 A;  2EZV A;  1SNP A;  3CP8 A;  3VR2 A;  4IFD H;  4XKW A;  1KZL A;  1TWC B;  3OPO A;  3S9W A;  1Q1B A;  4C1N K;  3I4L A;  1TU2 B;  1OO9 B;  1CA5 A;  3T56 B;  4ZLT F;  4DXG A;  3V96 A;  2K01 A;  4ZKC B;  3D4R A;  2HUG A;  2JA7 B;  1II3 A;  3TSS A;  4ILW A;  2NUC A;  4I7Z C;  1QIL A;  3KF8 A;  2OEO A;  1JCK B;  3FKI B;  2F3W A;  3NTK A;  5DN6 A;  1IKL A;  3X3N A;  1DOL A;  1X3P A;  4F87 A;  4XLE A;  4IUR A;  4IFD J;  5EBD A;  2OF1 A;  1TR5 A;  4ODG A;  5KEE A;  1BXT A;  1B53 A;  3DMU A;  2F03 A;  1VJS A;  2F0J A;  4C3J B;  1EEF D;  2GJR A;  2ZTG A;  1UD8 A;  1STA A;  5I2X A;  4UDU C;  1LTT D;  1HA6 A;  4CJ1 B;  1TWF B;  1BF4 A;  1TS5 A;  4H7B A;  4HCS A;  2K05 A;  2PYK A;  1X32 A;  2YU9 B;  2RSO A;  2F0Q A;  5E1F A;  3NWT A;  1VLY A;  1F2L A;  1KAA A;  4RGM A;  3TP6 A;  1EEI D;  3ZYY X;  1YNJ D;  1O7L A;  3HKZ B;  4F88 A;  3IL8 A;  3CRK C;  3M7G A;  4X3U A;  4IZ8 A;  3A8I E;  4RCN A;  4B08 A;  2XWB B;  2WII B;  4XDX A;  3NPP A;  1IW7 D;  3GV6 A;  3BYT B;  2BDO A;  1ZXT A;  1WD1 A;  3KLS A;  3LNN A;  3ND8 A;  3TP5 A;  2Q8R E;  3MXG A;  3NQT A;  3R3O A;  2CK3 A;  3W3A A;  2E74 C;  1GUW A;  2ZTN A;  1I4X A;  1RF2 D;  1ENC A;  2RDH A;  2ZZE A;  2F0I A;  3NTI A;  3OWE B;  4ZUJ A;  3OWF A;  5C5L A;  3DWP A;  3MTS A;  1WTV A;  4N9T A;  3TP7 A;  4RGN A;  5FK9 C;  5K5P A;  1V1P B;  4BWG B;  1HPC A;  2TMP A;  1V1P A;  4HSP A;  4NMZ A;  5J1Z A;  2R92 B;  5K36 G;  4HTH A;  1GUT A;  3NSW A;  4RKB A;  5TSS A;  1F9P A;  4KD3 A;  3PIO 3;  1DXM A;  2NZ1 D;  2EPB A;  1COW A;  4RKL A;  4XKV A;  2D62 A;  1BNZ A;  1DON A;  2F0T A;  2EJF C;  4X3K A;  3VYT A;  2KA7 A;  1GXD C;  5I9O A;  4V19 0;  1H9M A;  1DCZ A;  2BE5 C;  2B8G A;  1ENF A;  2RDF A;  3NTH A;  4MHE A;  1BCP B;  3KLS X;  1VF5 C;  2O2L D;  1D5X C;  1UAP A;  3EQL C;  4CBV A;  4ZK9 B;  4O42 A;  4XR6 A;  2NVT B;  1GUS A;  1EFR A;  1JOQ A;  4DAP A;  1LTG D;  5IOD A;  1STN A;  2E2H B;  5M5W B;  1AZP A;  2XND A;  1HFG A;  2L55 A;  4ZQ3 A;  2X6Y A;  3D4W A;  4A3M B;  4II3 A;  1B2T A;  3J81 E;  2WSS A;  3OE7 A;  5KIX A;  2RVL A;  1HHV A;  1GHK A;  2ZXI A;  1OXS C;  2A74 C;  1O80 A;  2WJV A;  4DNR B;  4M1U B;  1EZ6 A;  5EJW A;  2ZXR A;  2L1B A;  2CVR A;  4A3E B;  2KOL A;  4TT3 A;  1UUP A;  3ITP A;  5IGC A;  4XN3 A;  4XYO A;  2QCP X;  1ENA A;  2K03 A;  2E2I B;  1KLU D;  2WIN B;  2ZZQ A;  2JP1 A;  2K32 A;  4K14 A;  4BBR B;  1SJE D;  1EIG A;  1S5D D;  1TQO A;  1J9O A;  5D14 A;  1LTB D;  5I6Y A;  4XD7 A;  2XRQ D;  2XZL A;  1WCM B;  5KGU A;  1FNU A;  1G6Z A;  3SK4 A;  1YNN C;  2PZU A;  5CBA E;  2F0D A;  3HS0 C;  1FX0 A;  1H9J A;  1RD9 D;  2JXM B;  3WOF A;  1L0Y B;  3SE0 A;  3J80 E;  3EJI A;  1SMY C;  3LWU A;  3N6R A;  5EPJ A;  3D6C A;  2H4O A;  1QCB D;  3MC0 B;  3NBI A;  2HDM A;  5C5M A;  4XT3 B;  3HZX A;  3PUZ A;  2WZP P;  1HA5 A;  4NP5 A;  5C0X G;  3S17 B;  1V43 A;  1Z7T A;  1C48 A;  5JPN C;  3HGB A;  1PRT D;  1NCV A;  4HCE A;  1NR4 A;  3OSO A;  2DNC A;  4E0F A;  3K5M A;  2WKD A;  2H1E A;  4DK1 A;  2EYM A;  3RZO B;  2CW0 C;  4G4K A;  1EY4 A;  5C0X I;  1PFN A;  3J81 L;  4OL7 A;  1PZI D;  1HTP A;  1TWH B;  4EQN A;  3T51 B;  1OHH A;  4XYQ A;  3UI2 A;  2WAC A;  1E79 A;  2V4D A;  4G7W A;  4U67 3;  2DIE A;  4XLC A;  3HOU B;  4AYB B;  1OXX K;  2K28 A;  4IUT A;  1D5M C;  1MGS A;  4DAV A;  3D4D A;  1KLG D;  3Q0A A;  2Z8L A;  3R8B A;  4FF3 A;  2O5J C;  3OW7 A;  2F0P A;  1ZYR C;  2IL8 A;  1Y1V B;  3MFY A;  1SE4 A;  4PMC A;  5CDF A;  4KI0 A;  3BVG A;  2JSO A;  2A6E C;  1Q90 A;  2MJ8 A;  1D5Z C;  4Q0F A;  1EOT A;  2F0K A;  3FPU B;  2F0W A;  1F2Z A;  3D8G A;  1PMR A;  5A35 A;  4RFB A;  4KMU C;  3J80 L;  2EOT A;  1W6K A;  4I65 A;  1IKM A;  5AFW A;  1CA6 A;  1H9R A;  2A6H D;  3I73 A;  1HQR D;  3J7A V;  3VR3 A;  2ICI A;  4ZAI A;  4OIK A;  2SNM A;  4R8I A;  1ET9 A;  3DUZ A;  5KYL A;  1SNM A;  2JE6 I;  4FXD A;  3GTG B;  1FNV A;  3I91 A;  4BY7 B;  4PMB A;  4C3H B;  2EVB A;  3E0J A;  5JJZ A;  2B2U C;  1KNA A;  1PTO C;  1A3U A;  4ZUI A;  2B39 A;  5HKK A;  1K83 B;  2K5D A;  2R9V A;  3PO2 B;  3NBH A;  5BN4 A;  2B2Y C;  4ASU A;  4GQN A;  1EZ8 A;  3T13 A;  1NR2 A;  1L0X B;  2F4I A;  5COR A;  2QIL A;  3A7L A;  3RLF A;  2R7Z B;  2AUK A;  3ZIA A;  2AUJ D;  1SYE A;  2LY7 A;  3PMF A;  1M8A A;  2PMZ B;  2XNA C;  5E3F A;  2LZJ A;  5I2Y A;  1KDB A;  5T1G A;  3CP2 A;  1U4R A;  4DGZ A;  1E43 A;  1SXT A;  1XXG A;  1H9S B;  4IUV A;  1E1R A;  2R6G A;  1PFM A;  1H9S A;  4G7O C;  1EYA A;  1BO0 A;  5IIF A;  4G7H C;  4TKO B;  2K33 A;  3T4A C;  1AW7 A;  5IGG A;  4G7Z C;  3TME A;  1TVX A;  2WAQ B;  4QCL A;  1Y1W B;  3OFN A;  3DEP A;  2DY8 A;  3M3Y B;  1IL8 A;  1SYC A;  1TS2 A;  2RDG A;  4BA2 I;  1I6H B;  1A2U A;  2MP1 A;  4DNT B;  2F0S A;  2JA5 B;  2CQA A;  3BYY B;  5FLX E;  4A3J B;  2XN9 C;  4FF1 A;  4L6T B;  2A68 C;  3QO2 A;  2X69 A;  5ELE A;  1BQQ T;  4K5W A;  5FOB B;  2JA6 B;  2V31 A;  2DNE A;  3VR4 A;  2F3V A;  3J7A F;  2IX3 A;  4C2M B;  1WTO A;  2EDG A;  1EY7 A;  1D1K A;  3OMG A;  2EYF A;  4M8A A;  3SEB A;  1V8Q A;  1T5X D;  2QDB A;  3FEW X;  4KKS A;  1OXV A;  5JEA H;  2NN6 H;  3AMU A;  3OMC A;  4J6H A;  2Z4H A;  3DWQ A;  1JOO A;  2K7V A;  3NXW A;  1K8M A;  5C3E B;  5C4X B;  5ELC A;  2SEB D;  2CHB D;  3BCD A;  2KCN A;  1PRT B;  2KEC A;  2RA4 A;  3K59 A;  5EPL A;  1V1O A;  4X3T A;  2KQ3 A;  1G8Z D;  1B9M A;  3NK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...