3FPPA

Crystal structure of e.coli maca
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
266
structure length
266
Chain Sequence
PGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTQAVSQQDLDNAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPGQKAWFTVLGDQLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the periplasmic component of a tripartite macrolide-specific efflux pump
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Macrolide-specific efflux protein macA
total genus 52
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3fppA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fppA02
3DXJC 2KA7A 1HTPA 2YYZA 3QJYA 2A6HD 2AUKA 5KNDA 1Z7TA 2EJFC 3QG1A 3VR2A 3OW7A 3LWUA 2KCCA 1I6VC 3IKJA 1IW7D 5KNCA 3PUYA 2IT1A 2K7VA 2NN6H 1ZKOA 2A69C 1T5EA 2B8GA 1YNJC 2BE5D 2PCFB 1ONLA 2A69D 4KI0A 1E2ZA 1CFMA 2A6EC 2JEAI 4IFDG 1Z6HA 1Q90A 3IFTA 1VF7A 3GQBA 1HQMC 3NE5B 1CI3M 3M4YA 2JE6I 3AB9A 1GUOA 2O5JC 1O7LA 3D31A 3T53B 1VF5C 3VA7A 4DNRB 1SMYC 3ND8A 2Q8IB 2EJGC 1IYUA 1V8QA 3BG3A 2EVBA 4LK1C 1LACA 1GUSA 2BA0A 3PUWA 1HPCA 4TKOB 1H9KA 2JXMB 1K8OA 2K32A 4RCNA 3PUZA 1GHJA 4G7OC 5BN5A 1Q1BA 3A8IE 2NN6I 1YNNC 1HCZA 1Q1EA 1TU2B 2A68D 1OXTA 2D5DA 3A8KE 3MFYA 1TKWB 4H13C 2A68C 4OGQC 1Y8PB 3I72A 3A7AB 1GJXA 2LMCB 1OXXK 1A6XA 1G291 3N6RA 4BA2I 4DNTB 2AWOA 2NN6G 3SE0A 1B9MA 3W3AA 1DD2A 2BA1A 2EJMA 3I4LA 4IQZA 4TQUS 3T51B 4BA1I 3D4RA 1V43A 5BN4A 3LNNA 3BDOA 1LABA 1OXVA 1Y69U 5K36G 3HGBA 3M85A 4OO1G 1OXSC 4I7ZC 1DCZA 1E2WA 2BDOA 3PV0A 3EQLC 2A6HC 5C0XG 5KNBA 3I73A 4XIGS 1Y8OB 2AUJD 1QJOA 1IW7C 1GUGA 2BE5C 2R6GA 2D62A 1GUTA 1OXUA 2DNEA 2V4DA 1BDOA 3FPPA 2B8FA 4OO1H 4KKTA 3VR6A 3GD7A 3OOCA 4L8JA 3U9SA 2O5IC 5JEAH 4KN4C 2A6ED 2E76C 2EDGA 1Y8NB 4KN7C 4KKSA 2ZT9C 4DK1A 3P20A 1K8MA 4H0LC 1VCIA 1FYCA 4XTCS 2D2CC 1Q12A 1E2VA 1PMRA 4G7HC 1H9MA 3A7LA 4JK1C 3TZUA 5BN3A 4IFDH 3RLFA 5JEAG 3M7NA 3VR4A 1H9JA 1CTMA 4H44C 1FR3A 1GUNA 1H9SB 3FMCA 2DN8A 3MXUA 4JBWA 4KMUC 3QIAA 2QF7A 2PNRC 4KHZA 3L7ZC 4HR7B 1B9NA 1EWHA 2L5TA 3A8JE 3OPOA 2F1MA 3T56B 2CW0C 3CRKC 3VR3A 5K36H 2DNCA 4GZYC 4KKUA 5A35A 1IYVA 3SDZA 2PPBC 3H94A 1DXMA 1O78A 1GHKA 3VR5A 1H9RA 2JEBI 3PUVA 4LJZC 4G7ZC 1VDZA 2E75C 3CRLC 1H9SA 3PUXA 2K33A 5C0XH 3WDNA 1ZYRC 4PV1C 4DK0A 3KLRA 3ND9A 2E74C
chains in the Genus database with same CATH superfamily
2C4UA 5LL6S 2MO0A 5IYDG 2NZOA 2EJFC 1KNEA 3MXNA 3R6KA 5KIXA 3M4QA 1F2YA 3PF4A 3I4NH 2JA6H 4RCYA 5KNCA 4A76A 1QUEA 1I94Q 1K8GA 1SJHD 4RD1A 3K5OA 4RAUC 3J80E 4BPRA 4ZKBB 5D14A 5LMNQ 2ZXOA 5IP7G 2K5NA 1NBMA 4R8IA 1YLOA 4ULLA 3LQ6A 3CXCB 3EFXD 4CJ2C 5B6IA 1QGYA 3HOWH 4K14A 5IGFA 2P3MA 3D31A 3GTGB 2XNDA 1S72B 2ZXPA 2NB0A 4PQXA 1D5MC 1QVFA 1HNWQ 4B3FX 3CMMA 5IP9G 3VO2A 1LT5D 3STBD 2R7DA 3NTHA 4Z4YA 1V0FA 2M2LA 4WORA 2PQAA 1PJ7A 2YWHA 2WR8A 1S0UA 3SK4A 5M5YH 3ICEA 3A35A 3MFYA 4H13C 4ASUA 2A68C 3A7AB 2Q8TA 4TN1A 3GTMB 3AQQA 1E62A 1G291 4TMWA 1W6KA 4BY1G 3WOFA 3JQQA 1J5EQ 5G3LF 1ZYRD 3B6YA 1B9MA 4S3SA 3CP8A 1JB3A 1JCKB 3LO8A 3HOXH 1GM5A 1P16A 2HDLA 4GN5A 2WSSA 4M1KA 2W6JA 2I46A 5I9PA 2LS01 4EVOA 4X65Q 2YTXA 4CKBA 4OWXB 1H42A 2GK6A 1EP2B 3KLSA 4FXGC 2R6GA 1M4VA 3BNWA 2F0MA 1RKNA 1DOLA 2KVOA 3PO3H 2V4DA 2VNKA 3GD7A 3ASSA 4DUYL 3P20A 2WKDA 2CC2A 1MIUA 4RD4A 5IYCH 1VQ6A 2N55A 4JG2A 2Q2HA 1SYCA 3HKZG 1H9MA 3ZZUA 2B2VC 5CV9A 1EY0A 4A3KB 2E1BA 1GUNA 1JA1A 2Q2IA 4DV7Q 4DAYB 1TS5A 2QDBA 4DUZQ 3IRBA 2WP8J 1PV4A 3EJIA 1SRUA 3GV3A 2JA6B 3I56B 1LTGD 3K57A 4DR2Q 4TMVA 3X3NA 1G6ZA 3V76A 2R7ZH 1EU3A 3FKIB 3A8IA 3MA2B 4MTKA 4K5WA 1JT8A 2VBVA 4DAYA 2OT2A 2JEBI 4G7ZC 1UE1A 2Y0SE 4GLAC 4FXKC 1VQ9A 1TR5A 5M5WB 2XZOA 4UAJA 2O2LD 2AKWB 2QMUA 3Q6SA 1VQNB 1NE3A 2YYZA 1N36Q 1D5ZC 3QG1A 3KLWA 2KCCA 2B5OA 2C35B 1WYDA 3OZUA 2EYHA 4HTHA 4LF4Q 4DR7Q 1QFJA 2NN6H 1XNRL 1HNXL 2JDIA 1EU4A 1UD8A 3S1MB 4IALA 5IWAL 4R9WA 5TSSA 4Z4WA 3PVDA 3KJOA 2F43A 3N52A 5JOBA 4FF1A 3DEOA 1M1KC 1A0IA 1TS4A 1BX1A 1VF5C 4XR6A 2ID0A 1CZWA 1FNUA 2MNAA 4JI3Q 1VQIA 2XWBB 4LK1C 1TS3A 4A3GB 4X8IA 1H9KA 1GOZA 1T6YA 2X0KA 1IJFA 1WU8A 1XFOA 3CCMB 2VBSA 1CQVA 1Q1BA 2NN6I 5I9OA 4K5VA 5BR8L 5DEHA 2A8VA 5I2XA 3PUNA 1KXLA 3W2IA 5HXBA 1UE5A 5I6YA 1ZUNB 4R1JA 4RLZA 2K1BA 4B44A 2E1RA 2J4XA 2R7FA 4DN4M 4C3JG 3ZZTA 1UWVA 1WOPA 1QUQA 4NDXA 2RA4A 3CCEB 2CH4A 4B9WA 1DD2A 2WB1G 1IBKQ 1UD3A 4J15A 1HA3A 4UP7A 2EFGA 2RSOA 3CW2A 5T1IA 1H8EA 1VQ5B 3U4ZA 1AEXA 3PO2B 3I2ZA 1Y1VB 1CM9A 4U68A 2QGGA 4IW3B 4XKWA 5F4JA 3QSYA 2MP1A 3L2PA 5KYLA 1SYEA 2X6WA 3FPPA 3SK6A 1PFMA 4JI1L 1I6HH 2Z6BA 3FEWX 2F0IA 3C46A 3BZDB 3WY9A 2F0NA 2H1EA 2IWHA 2MQHA 4X64Q 4B3SL 5ELOA 2RQXA 3BQJA 4JYAQ 1S5ED 5EPLA 2F0VA 1PXUA 2JA5B 5LMUL 2ZTDA 3A8KA 4II3A 1I3QB 2QN6A 5NUCA 1F60A 2PZWA 1BPLA 3TP8A 2NPFA 4DV2Q 2F1MA 3T56B 3W5UA 1QNUA 2RKSA 3K5MA 1O7IA 3DWQA 1PRTB 2B2UA 1NJID 2B39A 4LF9L 4PZ7A 1AH9A 3KBGA 4YCUA 1A3TA 2JQOA 2SDFA 3TQYA 1EYCA 5CMDA 4BY7G 3V96A 1J8IA 1PHJA 1F9QA 3PIP3 1EUJA 1GJRA 2VNHA 4MNOA 1MBYA 2JP1A 1K28D 1ZEQX 4UAIA 4ZUIA 3OTOL 4KJOA 5I4DA 2R93H 3C3LA 1OHHA 1CUKA 1I50H 4P6VF 4YHHQ 1N0UA 1W0JA 4B08A 2OK7A 2F1LA 3P26A 4P12A 2OXPA 1B44D 2CBXA 3G48A 3MFGA 1HQRD 3J81k 4IPGA 3IFTA 4KJNA 5FOBB 3KF8B 1IBLQ 1YJNA 4PZ8A 4WZEA 1SDFA 4XN3A 2WJYA 3MXGA 4PG3A 3BZKA 1YIJA 4DR3L 4HIMA 1EIHA 3CW2C 2I0QA 5ELDA 5FLMG 3STBC 4WJ3M 1QX4A 3G71B 2KBNA 3CKIB 4APVA 4JI2L 5HGTA 4RA8A 5IT9L 5A89A 2Z8LA 1NJIC 3W1GA 4QB4A 4AYBG 1OXTA 4FXDA 1YIJB 2CH4W 3Q8DA 1FX0A 3OZVA 3NEMA 2CF4A 1F9PA 1O7YA 2CVRA 3TP5A 1A6XA 1VMCA 1H85A 1WCMB 3PO3B 1F2LA 3HOUG 4ZK9B 2F0SA 1PH3A 5FO8B 4XORA 2R7ZG 3ASRA 1AW7A 2QILA 3BDOA 5K36G 4C3IH 2GQFA 1QILA 5M3FH 1OXSC 3TMEA 3Q6RA 3W2FA 2VXWA 4Q5VA 1MKHA 1G91A 5FLXc 3I73A 3E0EA 3JAML 4PZ6A 4A3KH 3I70A 1BQEA 2XTIA 2ICIA 4RMFA 1QGZA 1I4GA 2Q6KA 2FVGA 1R5BA 2UUBL 4HMIA 2HIXA 1VQHA 5ELCA 4Z4ZA 1TUIA 2I5MX 1GO2A 3WOEA 1FYCA 4DV6L 2EY6A 2KHJA 4QVJA 3IAYA 2K01A 4YCVA 1E2VA 1WFQA 1UE6A 3H6MA 1KAAA 4X3TA 2F4VL 2EYFA 2XVSA 3NBHA 1H9JA 4N9TA 1CTMA 1PH9A 4IUQA 3GIRA 1X3FA 1CSQA 1WSVA 4MYTA 3E5SA 2HCJB 4YY3Q 2F4IA 1OB5A 3OPOA 3V7AA 3VR3A 3AU7A 3VNUA 3TZDA 2B2UC 5C4JH 1YVCA 4G1BA 4DA2A 4QGUA 4JBJA 5C3EH 2OBSA 1EEID 1LTRD 2QEJC 4CDDC 5DS0A 4L5SA 4QF4A 4ZKCB 2OQ0A 2UUBQ 1EP3B 1W2BB 1HNZQ 5A88A 2DYIA 3F2DA 1EY7A 1W6JA 3VA5A 1Y1VG 1BBXC 4B3GA 4UPAA 4PC1A 2OYNA 4XLCA 3SJPA 3PMFA 1PH5A 3OSOA 2K5QA 1QVGB 5BR8Q 4KY7A 3CTAA 1YJWB 1Y1WH 3NWSA 3H3VC 3W2EA 1QFYA 5JJLA 1FD7D 1Q8IA 1W2BA 3PA2A 1N06A 1HZAA 1K28A 1PYWD 4L5QA 3TP7A 2R9VA 2R92G 2Z4HA 4IFDG 1VLYA 2VYQA 4JI4L 2KUMA 4CBVA 3BS1A 5EPJA 2DOGA 2JE6I 4R4TA 3CQZH 3KDFA 5IP7H 1D2EA 2EIXA 4IZ8A 2JA5G 1R5NA 2B29A 1HPCA 3F2UA 4RPBA 3G6JB 4XN0A 4LFAL 2JA7B 2EY1A 3WBKA 4O1NA 1SFOH 2NVQB 1UUPA 2JN4A 3UDFA 1Y8PB 5E7NA 1VQMA 1WP6A 1S72A 3R6JA 3HRZC 1ICWA 3OIQA 4HN7A 1EIFA 4YY3L 5C3EB 4JI6L 2NN6G 4XD7A 3KOJA 2UUAQ 4JMQA 4RDKA 4YAUA 3FHWA 4IQZA 4TQUS 3BY2A 4DKAC 3S1QB 1G7RA 4BA1I 3T1YQ 1V43A 1SKYB 1EFCA 2J0TD 1ILPA 3KFUA 1T6XA 2F0TA 1KNAA 4OO1G 4Z4RA 3B8HA 1IYJB 2WAQG 1WI5A 2BDOA 4HMJA 4P22A 3PV0A 4BY7H 2BSAA 1KABA 3AGQA 2Z4IA 3GV6A 2WJVA 2KOLA 4C3JB 1GUGA 2PIAA 4TMZA 1E22A 1GUTA 1LTID 3S9WA 1ASYA 2E2DC 1BDOA 4UP8A 3J81i 3OWEB 1PH1A 4LF6Q 1MD2D 1V1PA 3IL8A 1PRTC 1KRTA 2R93B 4DK1A 1QB5D 1BF4A 4A75A 1SFOB 3HKZE 3G4SB 1V1QA 1EIYB 3J7AV 4H0LC 1CNEA 5M5XB 2K14A 5GAEC 2XIWA 3SXHA 3BCFA 3A7LA 4LUOA 1SMYD 4GKJL 2H5XA 3RLFA 4A3LG 1F77A 1N8RC 4OOXA 3I56A 2DGYA 2RVLA 5GAGC 3A5ZB 1PZJD 2BGJA 5D3IB 1SYGA 4R4IA 1PZKD 2C5CA 2LKVA 1PRTF 4IUVA 3TBIB 1C9OA 3FP9A 4AF7A 1KL9A 4C1NI 3H0GH 2K50A 5JJKA 1PJ5A 4R71A 3BY1A 2VNJA 3DMUA 3GDEA 5A35A 4HJ9A 4OX9Q 2A5HA 5FO1A 1JOQA 4CKEA 3GTOH 2UXCQ 1KAWA 2JJQA 4OIKA 2LSSA 5JBQA 5JEAJ 4IFDJ 4ME5A 2Z0SA 1WCMG 2C78A 4MTNA 2V1CC 3E0JA 3CPWA 1XPOA 4OONA 1A3UA 1VQ4B 1YITB 2VS1A 3A1PA 3ER0A 4XYQA 2DY1A 3HAGA 3MEHA 5KNDA 4R4CA 3P27A 5C4XH 4JI6Q 4POGA 1MJCA 4X3UA 2C9OA 4QUFA 2IT1A 3BDLA 4P26A 4BY1H 4OPVA 4LFBL 4P73A 2PLFA 4DK3C 1JR0D 1BCPB 1E2ZA 1PRTD 4PMWA 4QHYA 1IHMA 4ZGQB 2KCMA 3JU4A 1SXTA 4G4KA 1VHEA 4GOPA 1JB7A 3K7AH 4UHVA 1V8QA 3TS0A 3I4MB 2V7XA 1VQKA 4XMYA 3AVVA 5FIUA 2PZTA 2BA0A 3MAQA 2B63H 4DR1L 1ENFA 4IO9A 1VHOA 3KF6B 2ZTCA 2K32A 2XGTA 5M9OA 4DR6Q 1JE4A 2QGQA 3HOWG 3G4SA 1NB9A 3I91A 4Z1MA 2X53S 3F2CA 1TKWB 5EMNA 3CCSB 4RGOS 1I4RA 3M9BA 4BA2I 4DNTB 1F2ZA 3ULLA 2F0LA 3I4NB 1EY9A 1EYAA 1WPCA 5LMUQ 2LXJA 4YIJA 4POFA 1SAPA 4XOTA 3HGBA 1ESFA 3HOUH 2HDMA 4YAFA 2PW5A 4KLKA 1E79A 4JI4Q 1CKMA 2KCTA 1QJOA 2KEDA 1LTBD 2NVYB 2KECA 3U6KA 1BUVT 2BN4A 1N36L 4UP9A 3H0GB 4DR6L 1FNMA 3E1YE 1OTCA 1Y8NB 4KN7C 4NXML 2RHQB 3ZBTA 1M1KD 3CF5A 3CD6B 5ELNA 4PNYA 4JV5L 3MMPA 4ROXA 4XKVA 4IUPA 3SK8A 1PMRA 2BDNA 1RHPA 2XSCA 4KY5A 2MJ8A 3M7NA 4AH6A 3CCRA 3QWNA 1BCPC 2UXBL 1CQXA 1UD2A 1HHVA 5THXA 1II3A 3CCVA 3ZBUA 3WXMA 1VQOA 5K36H 2DERA 2SNMA 1YNND 2ZJQA 2EYOA 4R4OA 1FRNA 1IYVA 2PPBC 2NZHA 4I7AA 2I5HA 5IIFA 1C0AA 4PMCA 3PUXA 1XYIA 4MN3A 2EZVA 5LMZA 1YITA 5KGUA 1I8DA 3WNBA 2WAQB 2RCFA 1UD5A 1SBBB 1L0YB 1ELOA 2A74C 3CD6A 4HE5A 1DYQA 4JCVE 1I6VC 1JE5A 3GTLB 3CMAA 1VQGA 2DY8A 1E1QA 1STNA 4FP5D 5CGKA 5M5WH 1T5EA 1FNBA 1OGJA 1YJNB 1PJ6A 3G7LA 1SROA 3HEJA 5IGEA 2HD3A 1IKLA 2RC6A 1QUFA 5FLXE 4DV5L 2CW5A 1NR4A 1HJPA 4H9GA 4G7XA 4M0LA 4B3XA 2JA8G 5C4ZA 3PO3G 1WD0A 3J81E 2I07B 4X05A 3S17H 2CWAA 4F87A 1X3PA 2B63B 4FDBA 3FPKA 4DR3Q 3S1MH 1HFNA 1XTCD 1VQCA 2NZ1D 3CC4A 3I90A 4TMXA 4LF9Q 1R9TB 4LBYA 1SNDA 1TXYA 2ZXRA 1BQQT 4NXNQ 4LC0A 2EXZA 2ICEC 2HUGA 4V0BA 4DV1L 4PC3A 1X56A 5BN5A 4BY7B 1YNNC 2QA4B 3ASQA 2N78A 3I1FA 4RH6A 1VQDA 4RGMA 4X65L 2EXDA 3NP8A 5JVG3 5GV8A 2ZL5A 1WJJA 3HZXA 2A73B 2TSSA 2DJFC 3W3AA 3R2TA 4RGNA 2GA4B 5C0XI 3FKIH 1RD9D 1LUZA 5FO0A 1UD6A 1Q7YD 1VQKB 3SGIA 4HIOA 2K5WA 1JOOA 3OMGA 3M85A 4GNXA 1W0KA 2UUAL 1L1OB 1D1KA 3TS2A 2VZLA 1KK2A 3EQLC 4PABA 5C0XG 5FA6A 4XIGS 2BOSA 4XQJA 3DUZA 1OB0A 1N32L 1MJEA 2NBFA 2V7UA 4FO2A 4KKTA 4YHHL 4FNFA 1E0BA 4LFAQ 3U9SA 2NYZD 3DM3A 5DNFA 4RCOA 4KKSA 3OW2A 4B3MQ 4NNJA 1NBWA 3CMEB 1ZM4A 3RLNA 5C44B 1EFUA 2HCIA 1CT1D 2KCNA 2YV5A 1NMGA 3CPWB 4KD3A 1SM4A 2IL8A 5IYPA 3M3YB 4V190 3UI2A 2H4OA 2XRQD 5LMNL 5JAVA 2CW0D 2WAQE 1LTSD 4QVAA 2P5ZX 4X06A 4C2MB 3S1NB 4E0FA 2LY7A 3HOWB 1T6ZA 1EQVA 4Q7JB 3L3OC 5ELFA 1CHPD 5K5PA 1TWFH 2HHHL 4LF8Q 1SNPA 4DU9A 4C1NK 4PAAA 3OAAA 3WQZA 1YJWA 1VQ9B 1WOSA 1E3PA 1NR2A 5CBEE 5JJIA 4DPGA 2F0QA 4NW2A 4PV1C 1K3RA 3KLRA 4N8X1 4X7DA 5DM63 3QJYA 2RSNA 3U50C 1Q86D 3VR2A 2XN9C 4WQMA 4K2LA 1R9TH 3CCVB 2IX1A 3ZYYX 4DF7A 4CDEC 1GVPA 1Y1VH 3CU7A 4OL7A 3SVMA 3FKIG 5AFWA 2YWFA 3M4OH 1IB0A 2L9HA 1Q90A 3H15A 4LNQA 1Q3LA 1HR0Q 5EAYA 2ATWA 1F9RA 1VMPA 2VY3A 4X62Q 2EYJA 1IKMA 3T53B 4U9UA 1S40A 2NWGA 1C8CA 3GTMH 2GJKA 2IHFA 1QFZA 4PC6A 1GUSA 5IYBG 3S14H 4DR2L 3RZOB 3EROA 4ZCMA 5EJWA 3FJOA 2GVAA 2YTVA 3RR5A 3ONYA 1SYDA 2KEEA 3A8IE 1EL0A 5FO7B 4PC2A 1C4QA 4RFBA 4L63B 1DG1G 2D5DA 1R4PB 2G9DA 3J81j 1X55A 1PZID 1YZ6A 2R6HA 3BC9A 4WZTA 3AFQA 4QMGA 2QW7A 1FDRA 1EFTA 4DV0Q 3T51B 4HIDA 3FKSA 4DV4Q 5J22A 1NY4A 5IK2A 2WV6D 2Y0SG 1LABA 5ELEA 3SHLA 1T5XD 3SLDA 2VZAA 1STHA 4HJAA 1Q7YC 5ELBA 1EFID 2N8NA 4ZCLA 2KJXA 1SKQA 3I4OA 3J7ZC 2OTLA 1TQOA 3ASTA 3TSSA 1JWUD 3K81C 3CCJB 2AUJD 3S1QH 4CGYB 3ONUA 2VQFQ 1QZHA 3S14B 3D6WA 2WINB 3KF8A 4X3KA 5M3FG 2ZZEA 4TMTA 4QIWE 4CJ0B 3B78A 4DUZL 4FF2A 4ID6A 4QUCA 3PO2G 3ZPNA 1V1OA 3S15B 3I7FA 2YU9H 4A3DH 1K8MA 1K9MC 4XTCS 2I1LA 3D0FA 2EQSA 3MXPA 3IFDA 1J5EL 2CRVA 3A3GA 1RQPA 5E1FA 1HA5A 3PO2H 2VUMG 1JA0A 1BCPD 1L1OC 1MRZA 2FMMA 3Q0AA 3HOVH 1RDPD 2JA8H 1G2TA 2Z6KA 1VQOB 3D6CA 4TSFA 1K0RA 2CWPA 1AE3A 3MC0B 2D9RA 1FJGQ 2CW0C 4WZLA 4DK6C 4OIJA 1S4MA 2GK7A 3D3RA 4OWWB 1LTLA 4NMZA 1MI2A 3CB4A 1JWSD 4Z4UA 1CHQD 2CQOA 3A8JA 4YCWA 1WVLA 1I4QA 1K3BC 4AC9A 3OW2B 2E75C 2E5LL 1NSNS 2DJGC 2PQAB 2RCNA 2B2VA 2F0FA 5M5XH 1YHAA 1HTPA 5DSZA 1PH2A 1G7TA 1Q86C 1TWCB 2V7VA 3P75A 1LLRD 1KLUD 4ILWA 4RD6A 1J9ZA 3I4MG 4FYDA 1YI2A 3H91A 3G6EB 1YNJC 3HG9A 4RWSC 4KI0A 3CXCA 1BJKA 1JORA 4GNXC 1PFSA 2AMCB 2F0HA 4ZRZA 3OZWA 3NQIA 1I18A 3NE5B 2L55A 2QTZA 1CKOA 1PTOB 3TN2A 4B9XA 4JYAL 1F20A 4G7WA 1JWMD 1SMYC 4BBSG 4IFDI 2DIEA 1N8RD 3KUPA 3CCSA 4R4QA 4HIZA 1M90D 1SEBD 1UEBA 3BDCA 5FKAC 4JI1Q 2JA8B 3PUMA 3CMAB 3ERQA 4RKLA 3GTKH 3AVTA 4YALA 3TEHB 4Y7NB 4GLXA 3DLLA 4HCEA 5EPKA 1QNKA 1I94L 4OGQC 2C5HA 1GJXA 2LMCB 1FL0A 1OXXK 2F3WA 1KLGD 2R61A 5KNLA 3WNDA 3BJUA 1HZEA 2HT1A 3SE0A 1E64A 1DOKA 1BO0A 1XMQL 2KQ3A 2UU9Q 5BN4A 5CDFA 1IJEA 1C7YA 1MHWC 3ULPA 2KHIA 5KEEA 4RG1A 4EQPA 1YNJD 3J80c 3SJZA 5KYIA 2EE1A 4AIMA 1IL2A 4YEJA 1PYBA 4LF5L 2CNDA 2AWNA 5M3MH 4Z4SA 4L8JA 1D6EC 4C2MH 1Y1WB 5BSYA 2BGIA 3PIO3 2CFMA 2A6ED 4CHTB 4JI8Q 1EWIA 4MHEA 3QB3A 2SOBA 2FHTA 3R3OA 4DR5L 1XTDA 1SLJA 1YNXA 2PMZE 4K0KQ 3FRPB 1B3AA 1KK1A 1YHBA 2G9HD 4NB3A 3G6EA 4DR5Q 5EQ0A 3Q23A 3A74A 3OIPA 4RD2A 1JICA 2HHHQ 5KSWB 2DY7A 4LF8L 3JAME 1B53A 4P9SA 1B9NA 4EQOA 2XOKA 5IGBA 2NVTB 3J7YW 1KRHA 1QVGA 1NTGA 1E1TA 1ENCA 4A3MB 1Q82D 2WZNA 1GHKA 5HGQA 5C4XG 4GLVB 4LJZC 4OP7A 5IYDH 1VDZA 3CRZA 2EYPA 2N88A 4ZLTF 4A3CG 4F7XA 4M2LA 3Q39A 1TWCH 2QA4A 3H0GG 3VYSA 4BXXH 1B70B 2AUKA 2GN5A 4ZGNB 4LBVA 1LV9A 5FJ8G 1BLIA 2DEUA 2VBUA 1PA6A 1EWCA 2BMWA 2ZBVA 3O13A 3NWTA 3VDYA 3TREA 2DUDA 1T9HA 1RTOA 2B8GA 1EYGA 2PCFB 1XJVA 1YBYA 1VQ8B 2A19A 4Z4TA 2GJRA 1HZCA 1PTOH 1Z6HA 3CCQA 1WORA 5IYQA 3CC7B 4BWGB 1SMXA 3BVGA 3HS0C 1BKBA 3M4YA 4H02A 4KHPL 3Q38A 1W35A 3LQEA 3J7A5 1B23P 3T4AC 3VA7A 1X3EA 5E3FA 1KQSA 3GTPH 3GTGH 1GD7A 3OJXA 4KK7A 5EBCA 1AIPA 3F2BA 4KTAA 3HFZB 1WCMH 4M53A 2JJ2A 1SNQA 3W2GA 1I3QH 1QZGA 1STYA 1SJED 1OB2A 1HCZA 1Q1EA 1TU2B 3RUZA 4JI0L 3ZJYC 2TMPA 2YWEA 5IYWA 2EPBA 3I72A 4ODGA 1N07A 3NELA 5EKLA 1U4RA 2F0DA 3WNCA 5TRDA 1B2RA 1K73C 1LYLA 2QCPX 1MSHA 5FK9C 3HOYG 3LNNA 2NVXH 3J81c 1C48A 2UXCL 4Z4VA 1U4MA 1U4LA 2IJ0A 5AJ3L 3ASPA 2F3VA 4KHVA 2JJ1A 4XLFA 3CP0A 1XE1A 2PI2E 4LF7Q 2UUCQ 3OEEA 4RDJA 1BOSA 3EVQA 2ZTNA 4OELB 5KNBA 1IW7C 4RHSA 3EA6A 3HOZG 4A3BB 1B4OA 2KENA 4X7CA 1PH7A 3BH4A 4MIUA 2DNEA 1J6QA 4NXNL 4EGVA 1FJGL 2IHEA 2E2JH 3BVMA 5LHY1 3A5UA 3URYA 1N32Q 3EBEA 2DCUA 1W34A 3VO1A 4GKJQ 2V7QA 3K5LA 1TWGH 3CC2B 5IODA 3I8ZA 5A2QE 4BBSB 3M4PA 3CPXA 1VQNA 5C0XJ 1U4PA 3ZUGA 3K8AA 5F4MA 3ERSX 5JPNC 3FDTA 1HRJA 1X3QA 1S5FD 4KMUC 1X32A 2DN8A 5J39A 2QF7A 5EBDA 1VQPA 1S5DD 1A8PA 2GREA 5J3OA 3F1ZA 3NUCA 1STBA 2BVNA 4BXXG 2R7ZB 4LW1A 4KKUA 4ZYSA 3NTIA 3M3YH 1TWHH 3W5VA 4WFN3 2OQKA 3SEJA 5KRUA 1JQYD 2R93G 3V05A 1DZ1A 3VR5A 1CKNB 3G71A 3GTKB 3QFSA 4P3IA 2GPJA 2XNCA 1O80A 1OO9B 4NXMQ 2CCZA 1YHQA 3ND9A 1QCBD 4P71A 5IGDA 3Q22A 2KA7A 1QE6A 3PGZA 3RMHA 1HVXA 4J6HA 1X3GA 2XEXA 1VQLB 4A3GH 2A1AA 4C3IG 4RGTA 4HSVA 1FNWA 3UE1A 2Z1CA 1KC8C 2VNIA 4RPDA 2VNUD 5CR3A 3OP1A 1PTOF 1VF7A 1TWFB 1Y1WG 2RDGA 4XL9A 3S2DH 3U9OA 4AF6A 5C5MA 4JBMA 2EJGC 5M3MG 4K8IA 2X6LA 4K5XA 4A3JB 2EVBA 1PH6A 4X62L 3CCUB 5FL7A 1VQJA 2K28A 2MFIA 3BYYB 3HOXG 2QKIC 3CCRB 1BBWA 1G7SA 1I4PA 5EKIA 2VL6A 4QUZA 3KDFB 1SR3A 4TT3A 2V7TA 4P1VA 1TWAB 1VQLA 1TWGB 1D2BA 2WIIB 4ME3A 1D1NA 4GOPC 3I4LA 2QDXA 2L1BA 1QUQB 5IY0A 5H59A 1F9SA 4DQLA 1CQFA 1DM0B 2X6GA 2PE3A 1E2WA 3H3VI 1Q81C 3P7JA 4JV5Q 3AVWA 4LFBQ 2A6HC 4RDLA 2K52A 3BYTB 1EY8A 4F88A 4AQYQ 3OFNA 1I4XA 4K6LA 3HOXB 2D3NA 1U5KA 5C5LA 3KBXA 3RZOH 1X65A 2D62A 3KL9A 2PMDA 1XNQL 3OHXC 2D3LA 1RIPA 4OO1H 2JK8A 1JOKA 5E6TA 3NBHB 4E6IA 1WD1A 2O5IC 2EDGA 2HIVA 3PIPA 1SE4A 4AYBE 4OXPA 3K58A 1TY0A 1BCPF 1GR1A 1V1PB 3OJWA 2B2WA 5D65A 3D4DA 2R92H 3QR8A 5CC4A 4MYUA 3WBJA 3ISXA 4X7EA 3TZUA 1MSGA 2XRSD 4N3GA 4GNXB 1VQ6B 1EY5A 4OOSA 1GAWA 3FMCA 4A3JH 1SNCA 3QIAA 1ASZA 4WRDA 1QG7A 2AHOB 1JNYA 2ZBUA 1EWHA 5HY6A 5AN9A 1AZPA 1TWHB 1MGSA 2OTJA 1IZ6A 2F0WA 2Z6KC 2B2YC 2Z9HA 1XWEA 3K80C 4LBWA 3K7AB 1Q82C 4HE6A 1YJ9A 1QVFB 3DDYA 1DXMA 2RDFA 4DAMA 3ONAB 4BY1B 2K05A 1H8HA 4A3EH 3CESA 1CA5A 2QE7A 3DXJC 1Q81D 2E5LQ 1P4MA 2A6HD 4X66L 2OWOA 1N33Q 3IKJA 5D3DA 2ZJRA 3PUYA 1ZKOA 3LX0A 2BE5D 4UY8C 4A3BG 2KHSA 4ALPA 2WYRA 3QO2A 4OHJA 3HOVG 1PKVA 1KC8D 4RCZA 1K8AD 3W5OA 1COWA 1SE8A 1K9MD 5HKKA 3UDXA 3HOUB 3MTSA 4DXFA 1UEAB 4YELA 1O7LA 2E2IB 3ND8A 2EYMA 1YHQB 5C3XA 3TDQA 4DAVA 4C3HG 1LACA 4IPHA 1EQRA 2PQEA 1WOOA 5DAUA 4DFAA 3RN5A 3DHQA 3CAMA 2VQEL 1NMFA 5COYA 1PVOA 4G7OC 2ZXHA 1LTAD 1VQ8A 2C5BA 2EOTA 4A93H 3K7UC 1EZ6A 3OTOQ 3PQIA 2I5LX 2RDHA 4Y9UA 2IX0A 3NXWA 4DV1Q 2C4TA 1VQ7B 4IPCA 1K73D 4X0CA 1JJGA 3S17B 1FGBD 3D4RA 2ZTEA 3R8BA 5TY0A 3SEBA 4KHPQ 1X9NA 2ENBA 3G05A 4MZ9A 4C3JH 4B3TQ 2WFWA 1NB0A 2F3IA 3GVJA 1LO5D 2HLDA 4II2A 4NCNA 1CSPA 1QOHA 5DN6A 3E9HA 2Q6OA 2BE5C 1BX0A 4LWCA 4IURA 2PYKA 3RZDH 5IYBH 1HFGA 1JC7A 4C3HH 2ZITA 3VR6A 4P3YA 2E2JB 4IOCA 1CK1A 4GKKL 2E76C 3A3BA 2X6YA 3DM1A 5IOCA 1HNZL 4J0QA 1WTPA 2FX3A 4WJ4A 4B3SQ 3S16H 4Y9RA 4WJWA 5M3MB 3MCAA 1QVCA 1Z9FA 2M9VA 1M90C 1EY4A 3GSIA 1R5OA 2V7WA 4A3MH 1HR0L 4JBWA 4UDUC 4TRDA 1DOMA 1B50A 3S15H 1GO3E 4ZQ3A 2X6XA 1VQPB 3LWEA 4IUTA 2NUCA 2IY5B 3MHPA 1HZBA 4NPSA 4XT1B 1D8TA 1EEFD 5IYCG 2VBTA 2CK3A 3ULJA 5M5YB 4A3IG 1IHZA 5LL6X 2JIZA 5IE8A 4DV3L 2CKZB 5C0XH 3D8GA 2M00A 2K33A 1EYDA 5H1SE 5GV7A 2F0OA 4WWVA 4DV3Q 4A3FG 2XZLA 4IUNA 1GAQA 3W2HA 2ALYB 4UZUA 1YI2B 2X85A 1JJ2B 3RY8A 4P2NA 2PMZB 4JW0A 2SNSA 3CPFA 5L37A 3PCOB 2A69D 2CQAA 4DAPA 5J35A 1VQMB 2A6EC 3RN2A 3GO5A 5J3BA 3OKXA 5C44H 1PH4A 1ET9A 1IBML 2F4VQ 3J81L 5IGGA 1U0LA 4XQQA 1X6OA 4G5GA 2Q6LA 5IYRA 3RLOA 5L46A 3T16A 3AEVA 2LFNA 4K8JA 1KDCA 3SKBA 4A3FB 2E2HH 4XXEA 1E24A 2QEXA 4BBRH 4GKKQ 2OEOA 5CV8A 2ZJPA 2WKCA 3W2DA 4GS3A 4JI7Q 1TY2A 2BH8A 2F03A 1D8LA 1L0WA 2BPOA 2IPKD 1GHJA 4PC7A 2JA7H 1P8LA 1WTHD 4TSSA 2VJIA 5C4HA 4A3CH 3A8KE 4CQJA 1IL8A 4B3TL 4HIKA 1NCVA 2D9UA 3FVQA 2ZL6A 4A3GG 2BV3A 1N34L 4DR1Q 1Y14B 3AGPA 1SNOA 3GVKA 1VQFA 1KDAA 3HKZB 3CCQB 4ZCKA 2QTLA 1RODA 4I7ZC 4IN3A 1O7ZA 4C0SA 1D1IA 3JC66 4DR4L 3PA1A 4OX9L 1GVHA 3KEWA 4EQNA 1HXYD 5CV6A 3K0YA 2B63G 1OXUA 5KW9A 2NTTA 2B8FA 1GKHA 1NNXA 4X66Q 2VW9A 3UDGA 1X54A 1DARA 4GQNA 4QCLA 4ZUJA 3DWPA 1A62A 4A3BH 1VCIA 3L0OA 4Y7NH 1Q12A 3GTOB 4XM3A 2WACA 3GTJH 4IPDA 5T1GA 1RL2A 1FGUA 5EGTA 1FR3A 5I6WA 2B2TA 2BM0A 2E2HB 4IJLA 3SR1A 1J9OA 4LAAA 3L7ZC 4DV2L 4DV5Q 3S24A 2E2IH 4C56C 1V5VA 1TT2A 3EN2A 1Q9SA 1KK3A 4JI7L 5ISRA 4PMBA 3GTQB 4TVAB 4QFMA 1XX8A 2L0CA 3QOLA 3SLNA 1O78A 2VQEQ 2KVMA 4RD0A 2Q8RE 2VB2X 2B2WC 3DEPA 4JI2Q 1XB2A 3F8TA 3CRLC 4QIWB 4L6TB 3K0XA 4A4IA 3WDNA 1AN8A 2K5DA 3HOZB 1B7YB 5JJZA 3OWFA 2YTYA 3QE2A 1VQ4A 2FFKB 3OW7A 3LWUA 4JVZA 3CCMA 4O42A 1IW7D 5C3WA 4QV2A 3BZCA 3PSIA 4O0AA 3K5NA 1PDQA 3KYHC 4HAEA 1H95A 3J80i 4A3LH 3JAMi 5DLQE 1DDGA 4GN4B 1G7CA 3UDIA 5H5JA 2HQLA 2MUYA 3AYHB 4CDFC 5C4JB 4DR4Q 4KY6A 4NKLA 1N33L 2M5SA 3I4NG 2J7ZA 2WB1E 1XMOL 4N9PA 3HKSA 4K2KA 1RCVD 1A63A 3I4MH 1SE2A 1JMCA 3AMUA 2MPMA 2MHVA 2EYLA 3A0JA 2F4NA 1N34Q 1KK0A 3S2DB 1A2UA 1IBMQ 1K83H 4H7BA 2MO1A 3MHBA 2JA5H 5LMNW 3C1FA 4A3DB 1WTQA 5GQOA 4A3IB 4P25A 3QFTA 2AQ3B 1N08A 1I6HB 3J7AF 4C3HB 1WSRA 3RZDB 1WTOA 2K6AA 1WTRA 3OEHA 3U2QA 4FK8A 1GUWA 3UE0A 5FJ8H 3E20A 4FVMA 1OXVA 1Y69U 2E8GA 4AYBB 1DCZA 2C77A 1STEA 4XLEA 3BU2A 5CV4A 3D4WA 4YWLA 1KHIA 2VUMH 3VYTA 1Y0RA 1MABA 3K6OA 2B7BA 1WTXA 1HR0W 2R92B 1UE7A 1WDTA 1I50B 3GTPB 1CNFA 5HZAA 5JEAH 3CCEA 2ZT9C 4J1MA 4RKBA 2OTJB 1E7ZA 2Q2TA 2RHSB 1FNDA 1BBUA 2XWJB 4C43A 1ET6A 2OF1A 4QJFA 1XMOQ 1QG0A 4AVZA 4G57A 4JK1C 4DV6Q 2K5VA 1QWYA 3CHBD 1H9SB 3MXUA 3NQTA 4N8FA 1A3VA 2CHBD 1BR9A 1HH2P 5A8AA 3S1NH 4XYOA 1WTHA 2F0PA 1IXRA 4B3RQ 2F0JA 3SDZA 4J8QA 1KD1D 3S1RB 3HOZH 2OCEA 4FN5A 1JJCB 2F0EA 1AMOA 1H9RA 2B2TC 1H9SA 1YJ9B 1Y0YA 3A56A 1KDBA 3X3MA 4DUYQ 1UMKA 1HUNA 1E3XA 2XNJA 1Z7TA 3HOYH 3GTLH 4B43A 2Q2UA 1ZM2A 5A2QL 4A3EB 2K7VA 5C4XB 5HZBA 4F8MA 2A69C 1S3OA 4OOVA 1VQAA 5AJ3Q 1CFMA 3PF5A 5CORA 1NUCA 2VUMB 1XNRQ 3GVLA 4X3SA 1PH8A 1RQRA 3I55B 4HCSA 3VYUA 5DM73 2SEBD 4HJ7A 1YX2A 2IW3A 2C2WA 3CC7A 2YU9B 1UAPA 3VNVA 2O5JC 4JOIC 5CV5A 4DNRB 1EY6A 3AFPA 2Q8IB 4DGZA 1IYUA 4XOPA 4FF4A 2ZTGA 1HUMA 1EFRA 4FWTA 1KJZA 2BCOA 4Z9CB 4Y52H 3H3VH 2N49A 4X07A 4B4DA 1XQBA 1PTOD 1IBLL 3A55A 4RCNA 2ZZGA 3I55A 1EFWA 4LF6L 3E3XA 1WTVA 4LUZA 3LGJA 1ZM3A 1HNWL 1L0XB 1LT3D 4N3NA 1A8VA 3N6RA 1N0VC 2V31A 4X64L 1DJRD 3KF6A 1AE2A 2K75A 1DDIA 3MZ5A 2AHOA 3S2HB 4CKCA 4RD3A 1DGSA 1EXMA 3HP3A 3T1YL 4ABNA 3M7GA 3HOVB 3KJPA 2EY2A 5FO9B 2EY5A 4IOAA 2X69A 4G6IA 5E4XA 2F0UA 2L4NA 1XNQQ 2HCCA 3VYRA 2QDLA 3WWVA 1A2TA 3GP7A 5C6AA 1B8AA 1HTLD 3FPUB 5IYNA 5C3EG 4AQYL 3CCLA 3S16B 4OEMB 1AP0A 5I2YA 4L5RC 4OO1I 1W3SA 5FLMH 2D74A 1K8AC 5CBAE 1VQEA 3CCLB 3J80L 4OPSA 3RD4A 3SK5A 4L5TA 2NVTH 1UD4A 3VMFA 3PENA 2K04A 2UUCL 1G51A 1ZM9A 2WPDA 1M8AA 4IFDH 5JEAG 2GVBA 3R93A 2PO4A 1I7PA 1PFBA 3ITPA 4HR7B 2L5TA 2VQFL 4A3DG 3CRKC 4I65A 2DNCA 4IJHA 1RF2D 4K6DA 1QGAA 4YWMA 1JJ2A 2HDNB 4OWTB 4XNFA 1EZ8A 1CZGA 1PFNA 4A3KG 3JQRA 2JYOA 4QQBX 2DETA 3CMEA 2X8KA 2VB3X 1B3QA 4NP5A 5E4WC 4M4SA 4YHBA 2JA6G 1KTVA 3NSWA 4DK0A 4JPBW 4RHRA 2LZJA 4JI8L 2E74C 1EQQA 2PI2A 2ES2A 4UZFA 3CCUA 1NDHA 5TV2A 1L2FA 1Q46A 4LFCL 2JSOA 5GROA 5IT9E 1PLFA 1VQBA 1SNMA 3MXNB 3OE7A 4K1XA 2NVYH 3L9AX 1KIXA 4DR7L 1V9PA 4DNIA 1TVXA 4F7DA 1S5BD 3K59A 1N05A 5GADC 3WYAA 1SE3A 2JEAI 4ZV4A 1CA6A 2JA7G 4YAOA 1HQMC 3QFRA 1CI3M 3C1EA 4P6YA 2B3GA 2K03A 3AB9A 4KD4A 1SSOA 2ZM6L 1JB9A 4JI3L 4OPOA 3D26A 3NPPA 2Y0SB 3BG3A 1LT4D 3I3CA 5TR9A 3PUWA 4P2CB 2JXMB 1K8OA 1LT6D 3KK7A 3C2PA 2ZZQA 4JI5Q 3PUZA 4HJ5A 1PTOC 1I5FA 1K83B 1STGA 1EQTA 5IWAQ 3T1HQ 3AVXA 3H09A 4A3MG 1VQ7A 4X6AH 5M3FB 4XQFA 3P1HA 3RNUA 4LF4L 1KTKA 1W87A 1NRKA 2ZL7A 1VS0A 2BM1A 3S2HH 2B7CA 2L11A 1BVSA 2AWOA 4FXUA 1B2TA 1BXTA 1G2SA 1NAPA 3NK9A 3E9IA 1FNVA 2MGSA 2JN9A 4JOIA 1EIGA 4A93B 2YWGA 4Q0FA 1EOTA 4A3EG 3U6BA 5J1ZA 4JBKA 4BBSH 1XPRA 2ZZFA 1Y8OB 1D5XC 1Q8KA 1A15A 1E1RA 3EIVA 2UXDL 5F2DA 2XZPA 2WB1B 1XPUA 4LF5Q 1FVIA 3B82A 4EH1A 4R8NA 4IUUA 4EX5A 1V0EA 2O4XA 1DONA 1FNCA 2FINB 3U4VA 2FMCA 4CJ1B 2JA9A 1TLLA 3OYYA 4UZEA 1XMQQ 2UU9L 1EWYA 4H44C 4A93G 2B2YA 3CCJA 2HMAA 3Q6QA 3OMCA 2PNRC 2OTLB 2K4KA 2RF4A 3CQZB 3A8JE 1ENAA 1KZLA 2G5DA 3HOYB 1TTTA 2J7KA 2XNAC 4G1VA 1L1OA 1KD1C 2AQ2B 3MWYW 2QEXB 4M8AA 1I4HA 4LF7L 3AVYA 3PUVA 4DV7L 3W5HA 1ESRA 1EP1B 4YAWA 2OK8A 3ZC3A 1WOCA 3U58A 2EIFA 4B48A 2NVQH 1ZXTA 1YEZA 2K5HA 2NV4A 1TIID 1TVCA 3NBIA 5CV7A 1HZ9A 3BVZA 2IX3A 2F52A 2OBRA 2W6IA 1E3ZA 4NBSA 5BSXA 4XDXA 2AQ1B 1VLOA 2GJPA 3ES9A 1TWAH 3T13A 5IGCA 3CP2A 1CKNA 2RC5A 3Q3AA 2BH2A 1ONLA 3H9NA 3ZZ0A 4X7FA 3CC4B 2OBTA 1R4QB 4BBRG 3TRZA 3GQBA 2L12A 3GTQH 4Y7CA 2WZPP 4ACAA 1GUOA 1W9XA 1B1ZA 4JI0Q 1HA6A 1OGIA 5CYUA 4DXGA 1E63A 3NENA 1F2MA 4XLHA 1BNZA 5C44G 3QOJA 3BCDA 4TKOB 3KLSX 4O2DA 1QH0A 3JQPA 3E6ZX 1FRQA 4ACBA 1S5CD 4FF3A 1K0SA 5JPMC 2Q6IA 4ZCIA 3CC2A 1E43A 4JI5L 1G6PA 2A68D 1UNSA 3M4OB 2XGJA 5FNZA 4BBRB 2NVXB 4YXWA 5GAHC 4K0KL 4A3FH 4DQKA 2ZM6Q 4HSPA 4DV4L 2BA1A 1KMHA 2EJMA 1E1OA 4GOPB 3NHHA 1VQ5A 3R2IA 1STAA 1KRSA 3QFCA 1ML0D 4HEDA 2NTSA 4QL5A 4A3IH 3Q24A 1IBKL 3AVUA 2Z6BD 4GN3B 3A54A 4KV6A 1AFPA 1G8ZD 4B47A 1BMFA 4B3RL 1SYFA 4P74A 3DWAA 4XT3B 3T1HL 2RBMA 2L15A 2PZUA 2PW7A 5IP9H 3NTKA 4C3IB 1WTWA 2FJ2A 4RM0A 4LFCQ 5JVH3 4A3JG 1RTNA 1SN8A 2UXBQ 3OOCA 5IT9c 1N9WA 3TP6A 3MEFA 2UXDQ 1D7QA 4KN4C 4P75A 1ICFB 4YWKA 4JC0A 4RJLA 1RJTA 4LMQD 2D2CC 5F4OA 2F0KA 2F0GA 2N3SA 4U673 4G7HC 2ASBA 1Z47A 4ZAIA 5BN3A 4WZKA 1XXGA 1U2RA 1TS2A 3VR4A 2FXQA 1GXDC 1SYBA 4BS9A 4DV0L 1KQSB 2LXKA 4CDCC 2ZXIA 2D0OA 4M1UB 4KHZA 2PNHA 1EOVA 3LVBA 5G3LD 3ZIAA 4LUVA 4LBZA 4GZYC 4XONA 5FLXL 1LM0A 5HURA 1HNXQ 3JAMc 4HJ8A 2D0PA 3H94A 1U9RA 3MVVA 1PYSB 5EKKA 3GTJB 4PGOA 1ILQA 3W1BA 2X3UA 3V2TA 1VJSA 2BF4A 4EQ5A 2R3ZA 1AZQA 1ZYRC 4XLAA 3PIOA 1S4ZA 4QY7A 4B3ML 4P72A 3S1RH 4XQNA 2HQEA 2VJJA 1LTTD
chains in the Genus database with same CATH topology
5LL6S 2EJFC 1KNEA 3MXNA 5KIXA 1F2YA 5KNCA 1SJHD 3K5OA 4RAUC 3J80E 4ZKBB 5D14A 2ZXOA 1NBMA 4R8IA 4ULLA 3EFXD 4CJ2C 4K14A 5IGFA 3D31A 3GTGB 2XNDA 2ZXPA 2NB0A 4PQXA 1D5MC 4B3FX 3CMMA 1LT5D 3NTHA 1V0FA 2M2LA 4WORA 3SK4A 3A35A 3MFYA 4H13C 4ASUA 2A68C 3A7AB 2Q8TA 3GTMB 1G291 1W6KA 3WOFA 5G3LF 1ZYRD 1B9MA 4S3SA 3CP8A 1JB3A 1JCKB 2HDLA 2WSSA 2W6JA 2I46A 5I9PA 2LS01 4EVOA 4CKBA 2GK6A 3KLSA 4FXGC 2R6GA 1M4VA 2F0MA 1RKNA 1DOLA 2KVOA 2V4DA 3GD7A 3P20A 2WKDA 2N55A 1SYCA 1H9MA 2B2VC 5CV9A 1EY0A 4A3KB 2E1BA 1GUNA 1TS5A 2QDBA 2WP8J 3EJIA 3GV3A 2JA6B 1LTGD 3K57A 3X3NA 1G6ZA 1EU3A 3FKIB 3MA2B 4K5WA 4DAYA 2OT2A 2JEBI 4G7ZC 4FXKC 1TR5A 5M5WB 2XZOA 2O2LD 3Q6SA 2YYZA 1D5ZC 3QG1A 2KCCA 2EYHA 4HTHA 2NN6H 2JDIA 1EU4A 1UD8A 3S1MB 4IALA 4R9WA 5TSSA 2F43A 3N52A 5JOBA 4FF1A 3DEOA 1TS4A 1VF5C 4XR6A 2ID0A 1CZWA 1FNUA 2XWBB 4LK1C 1TS3A 4A3GB 1H9KA 1GOZA 1CQVA 1Q1BA 2NN6I 5I9OA 4K5VA 5DEHA 5I2XA 5I6YA 2K1BA 2J4XA 4DN4M 4C3JG 4NDXA 2RA4A 4B9WA 1DD2A 1UD3A 2RSOA 5T1IA 1H8EA 1AEXA 3PO2B 1Y1VB 1CM9A 4U68A 4XKWA 2MP1A 5KYLA 1SYEA 2X6WA 3FPPA 3SK6A 1PFMA 3FEWX 2F0IA 3C46A 3BZDB 2F0NA 2H1EA 2IWHA 2RQXA 1S5ED 5EPLA 2F0VA 1PXUA 2JA5B 4II3A 1I3QB 5NUCA 2PZWA 1BPLA 3TP8A 2F1MA 3T56B 2RKSA 1QNUA 3K5MA 3DWQA 1PRTB 2B2UA 2B39A 3KBGA 1A3TA 2SDFA 1EYCA 5CMDA 3V96A 1J8IA 1F9QA 3PIP3 1MBYA 2JP1A 1K28D 1ZEQX 4UAIA 4ZUIA 4KJOA 5I4DA 3C3LA 1OHHA 1W0JA 4B08A 2OXPA 1B44D 3MFGA 1HQRD 5FOBB 3IFTA 4KJNA 1SDFA 4XN3A 2WJYA 3MXGA 1EIHA 5ELDA 3CKIB 5HGTA 4RA8A 5IT9L 2Z8LA 4QB4A 1OXTA 4FXDA 1FX0A 2CVRA 1F9PA 1O7YA 3TP5A 1A6XA 1VMCA 1WCMB 3PO3B 1F2LA 4ZK9B 2F0SA 5FO8B 4XORA 1AW7A 2QILA 3BDOA 5K36G 1QILA 1OXSC 3TMEA 2VXWA 4Q5VA 1G91A 3I73A 3JAML 3I70A 2ICIA 1I4GA 4HMIA 5ELCA 3WOEA 1FYCA 2EY6A 3IAYA 2K01A 1E2VA 3H6MA 1KAAA 4X3TA 2EYFA 2XVSA 3NBHA 1H9JA 4N9TA 1CTMA 4IUQA 3E5SA 2F4IA 3OPOA 3VR3A 3AU7A 3TZDA 2B2UC 4DA2A 1EEID 1LTRD 2QEJC 4QF4A 4ZKCB 1EY7A 1W6JA 3VA5A 1BBXC 4B3GA 4XLCA 3PMFA 3OSOA 2K5QA 4KY7A 3NWSA 3H3VC 1FD7D 1Q8IA 1PYWD 3TP7A 2R9VA 2Z4HA 4IFDG 1VLYA 2KUMA 4CBVA 3BS1A 5EPJA 2JE6I 4IZ8A 1HPCA 3F2UA 3G6JB 4XN0A 2JA7B 2EY1A 4O1NA 2NVQB 1UUPA 1Y8PB 1WP6A 3HRZC 4HN7A 1ICWA 3OIQA 5C3EB 2NN6G 4XD7A 4JMQA 4IQZA 4TQUS 3S1QB 4BA1I 1V43A 1SKYB 2J0TD 1ILPA 2F0TA 1KNAA 4OO1G 4HMJA 2BDOA 4P22A 3PV0A 1KABA 2Z4IA 3GV6A 2WJVA 2KOLA 4C3JB 1GUGA 1GUTA 3S9WA 1LTID 2E2DC 1BDOA 3OWEB 1MD2D 1V1PA 3IL8A 1PRTC 2R93B 4DK1A 1QB5D 1BF4A 1SFOB 3J7AV 4H0LC 5M5XB 2XIWA 3SXHA 3BCFA 3A7LA 1SMYD 3RLFA 1F77A 2RVLA 1PZJD 5D3IB 1SYGA 1PZKD 2C5CA 2LKVA 1PRTF 4IUVA 3TBIB 4C1NI 5A35A 3DMUA 2A5HA 1JOQA 4CKEA 4OIKA 5JEAJ 4IFDJ 4ME5A 3E0JA 1A3UA 4XYQA 3HAGA 3MEHA 5KNDA 4X3UA 2C9OA 4QUFA 2IT1A 3BDLA 1JR0D 1BCPB 1E2ZA 1PRTD 4PMWA 3JU4A 1SXTA 4G4KA 1V8QA 3I4MB 4XMYA 2PZTA 2BA0A 3MAQA 1ENFA 2K32A 5M9OA 1JE4A 3I91A 4Z1MA 2X53S 1TKWB 4RGOS 1I4RA 4BA2I 4DNTB 1F2ZA 2F0LA 3I4NB 1EY9A 1EYAA 1WPCA 4YIJA 1SAPA 4XOTA 3HGBA 1ESFA 2HDMA 2PW5A 1E79A 2KEDA 1QJOA 1LTBD 2NVYB 2KECA 1BUVT 3H0GB 1Y8NB 4KN7C 4PNYA 4XKVA 4IUPA 3SK8A 1PMRA 2BDNA 1RHPA 2XSCA 4KY5A 2MJ8A 3M7NA 3QWNA 1BCPC 1UD2A 1HHVA 1II3A 5K36H 2SNMA 1YNND 2EYOA 1IYVA 2PPBC 5IIFA 4PMCA 3PUXA 1XYIA 4MN3A 2EZVA 5KGUA 1I8DA 2WAQB 1UD5A 1SBBB 1L0YB 2A74C 1DYQA 1I6VC 3GTLB 2DY8A 1E1QA 1STNA 4FP5D 5CGKA 1T5EA 3HEJA 3G7LA 5IGEA 1IKLA 5FLXE 1NR4A 4G7XA 5C4ZA 1WD0A 3J81E 2I07B 2B63B 4F87A 1X3PA 1HFNA 1XTCD 2NZ1D 3I90A 1R9TB 1SNDA 2ZXRA 1BQQT 2EXZA 2ICEC 2HUGA 4V0BA 5BN5A 4BY7B 1YNNC 4RH6A 4RGMA 3NP8A 5JVG3 3HZXA 2A73B 2TSSA 3W3AA 4RGNA 3R2TA 2GA4B 5C0XI 1RD9D 1UD6A 2K5WA 1JOOA 3OMGA 3M85A 1W0KA 1D1KA 3EQLC 5C0XG 4XIGS 2BOSA 4XQJA 3DUZA 1OB0A 2NBFA 4FO2A 4KKTA 4FNFA 1E0BA 3U9SA 2NYZD 5DNFA 4RCOA 4KKSA 4NNJA 5C44B 2HCIA 1CT1D 2KCNA 4KD3A 2IL8A 3M3YB 4V190 3UI2A 2H4OA 2XRQD 5JAVA 2CW0D 1LTSD 4C2MB 3S1NB 4E0FA 2LY7A 3HOWB 1EQVA 3L3OC 5ELFA 5K5PA 1CHPD 1SNPA 4DU9A 4C1NK 3OAAA 3WQZA 1NR2A 5CBEE 2F0QA 4NW2A 4PV1C 3KLRA 5DM63 3QJYA 2RSNA 3VR2A 2XN9C 4K2LA 2IX1A 3ZYYX 4DF7A 3CU7A 4OL7A 3SVMA 5AFWA 2L9HA 1Q90A 1Q3LA 1F9RA 1VMPA 2EYJA 1IKMA 3T53B 2NWGA 1C8CA 2GJKA 1GUSA 3RZOB 3EROA 5EJWA 1SYDA 2KEEA 3A8IE 1EL0A 5FO7B 1C4QA 4RFBA 4L63B 2D5DA 1R4PB 2G9DA 1PZID 3BC9A 4QMGA 3T51B 3FKSA 5J22A 5IK2A 2WV6D 5ELEA 1LABA 3SHLA 1T5XD 1STHA 5ELBA 1EFID 2KJXA 1TQOA 3TSSA 1JWUD 2AUJD 4CGYB 3S14B 3D6WA 2WINB 3KF8A 4X3KA 2ZZEA 4CJ0B 4FF2A 4ID6A 4QUCA 3ZPNA 1V1OA 3S15B 1K8MA 4XTCS 3MXPA 3IFDA 3A3GA 5E1FA 1HA5A 1BCPD 2FMMA 3Q0AA 1RDPD 1G2TA 3D6CA 4TSFA 3MC0B 2CW0C 4OIJA 2GK7A 3D3RA 4NMZA 1MI2A 1JWSD 1CHQD 1WVLA 1I4QA 2E75C 1NSNS 2B2VA 2F0FA 1HTPA 1TWCB 3P75A 1KLUD 1LLRD 4ILWA 4FYDA 3H91A 1YNJC 3HG9A 4RWSC 4KI0A 1JORA 2F0HA 4ZRZA 3NQIA 1I18A 3NE5B 2L55A 3TN2A 1PTOB 4B9XA 4G7WA 1JWMD 1SMYC 4IFDI 2DIEA 3KUPA 4HIZA 1SEBD 3BDCA 5FKAC 2JA8B 4RKLA 3ERQA 4Y7NB 4HCEA 5EPKA 1QNKA 4OGQC 1GJXA 2LMCB 1OXXK 2F3WA 2R61A 1KLGD 5KNLA 1HZEA 3SE0A 1DOKA 1BO0A 2KQ3A 5BN4A 5CDFA 5KEEA 4EQPA 1YNJD 5KYIA 2EE1A 4YEJA 2AWNA 4L8JA 1D6EC 1Y1WB 3PIO3 2A6ED 4CHTB 4MHEA 3QB3A 2SOBA 2FHTA 3R3OA 3FRPB 1B3AA 2G9HD 5EQ0A 3Q23A 3OIPA 1JICA 2DY7A 3JAME 1B53A 1B9NA 4EQOA 2XOKA 5IGBA 2NVTB 3J7YW 1ENCA 4A3MB 1GHKA 4LJZC 1VDZA 2EYPA 2N88A 4ZLTF 4F7XA 3VYSA 2AUKA 1LV9A 1BLIA 1EWCA 3O13A 3NWTA 2B8GA 1RTOA 2PCFB 2GJRA 1PTOH 1Z6HA 4BWGB 3BVGA 3HS0C 3M4YA 3VA7A 3T4AC 5E3FA 4KK7A 5EBCA 4KTAA 2JJ2A 1SNQA 1STYA 1SJED 1HCZA 1Q1EA 1TU2B 3RUZA 2TMPA 2EPBA 3I72A 4ODGA 5EKLA 1U4RA 2F0DA 2QCPX 1MSHA 5FK9C 3LNNA 1C48A 1U4MA 1U4LA 2IJ0A 4KHVA 2F3VA 2JJ1A 4XLFA 3OEEA 1BOSA 3EVQA 5KNBA 2ZTNA 1IW7C 4RHSA 3EA6A 4A3BB 1B4OA 3BH4A 4MIUA 2DNEA 4EGVA 3BVMA 5LHY1 3URYA 2V7QA 3K5LA 5IODA 3I8ZA 5A2QE 4BBSB 5C0XJ 1U4PA 5JPNC 3FDTA 1HRJA 1X3QA 1S5FD 4KMUC 1X32A 2DN8A 5J39A 2QF7A 5EBDA 1S5DD 3NUCA 1STBA 2R7ZB 4KKUA 4ZYSA 3NTIA 4WFN3 5KRUA 1JQYD 3V05A 1DZ1A 3VR5A 3GTKB 1O80A 1OO9B 3ND9A 1QCBD 5IGDA 3Q22A 2KA7A 1QE6A 3RMHA 1HVXA 4J6HA 4C3IG 4RGTA 4HSVA 1FNWA 2Z1CA 2VNUD 5CR3A 1PTOF 1VF7A 1TWFB 2RDGA 4XL9A 3U9OA 5C5MA 2EJGC 4K8IA 2X6LA 4K5XA 4A3JB 2EVBA 5FL7A 2K28A 3BYYB 2QKIC 1I4PA 5EKIA 4TT3A 1TWAB 1TWGB 1D2BA 2WIIB 3I4LA 2L1BA 1F9SA 1CQFA 1DM0B 2X6GA 1E2WA 3P7JA 2A6HC 3BYTB 1EY8A 4F88A 3HOXB 1I4XA 3OFNA 4K6LA 2D3NA 5C5LA 3KBXA 2D62A 3OHXC 2D3LA 4OO1H 1JOKA 4E6IA 1WD1A 2O5IC 2EDGA 1SE4A 3K58A 1TY0A 1BCPF 1V1PB 5D65A 2B2WA 3D4DA 5CC4A 3TZUA 1MSGA 2XRSD 1EY5A 3FMCA 1SNCA 3QIAA 4WRDA 1QG7A 1EWHA 1AZPA 1TWHB 1MGSA 2F0WA 2B2YC 1XWEA 3K7AB 3DDYA 1DXMA 2RDFA 3ONAB 4BY1B 2K05A 1H8HA 3CESA 1CA5A 2QE7A 3DXJC 2A6HD 3IKJA 5D3DA 3PUYA 1ZKOA 3LX0A 2BE5D 2KHSA 3QO2A 4OHJA 1PKVA 1COWA 5HKKA 3HOUB 3MTSA 4DXFA 1UEAB 4YELA 1O7LA 2E2IB 3ND8A 2EYMA 5C3XA 3TDQA 4DAVA 4C3HG 1LACA 2PQEA 5DAUA 4DFAA 3DHQA 5COYA 4G7OC 2ZXHA 1LTAD 2EOTA 1EZ6A 2RDHA 2IX0A 3NXWA 3S17B 1FGBD 3D4RA 3R8BA 3SEBA 2ENBA 3G05A 3GVJA 1LO5D 2HLDA 4II2A 1QOHA 5DN6A 2BE5C 4IURA 2PYKA 1HFGA 1JC7A 3VR6A 2E2JB 1CK1A 2E76C 3A3BA 2X6YA 3DM1A 5IOCA 1WTPA 4WJWA 5M3MB 2M9VA 1EY4A 4JBWA 4UDUC 4TRDA 1DOMA 1B50A 4ZQ3A 2X6XA 3LWEA 4IUTA 2NUCA 4XT1B 1EEFD 2CK3A 5M5YB 1IHZA 5LL6X 2JIZA 5C0XH 3D8GA 2M00A 2K33A 1EYDA 2F0OA 2XZLA 4IUNA 4UZUA 2X85A 2PMZB 2SNSA 2A69D 2CQAA 4DAPA 2A6EC 3GO5A 1ET9A 3J81L 5IGGA 4XQQA 3T16A 2LFNA 4K8JA 1KDCA 4A3FB 4XXEA 2OEOA 5CV8A 2WKCA 3W2DA 1TY2A 2F03A 2IPKD 1GHJA 1WTHD 4TSSA 2VJIA 5C4HA 3A8KE 1IL8A 1NCVA 2D9UA 3FVQA 1SNOA 3GVKA 1KDAA 3HKZB 1RODA 4I7ZC 4IN3A 1O7ZA 1D1IA 3KEWA 4EQNA 1HXYD 5CV6A 3K0YA 1OXUA 2NTTA 2B8FA 4QCLA 4GQNA 4ZUJA 3DWPA 1VCIA 1Q12A 3GTOB 4XM3A 2WACA 5T1GA 5EGTA 1FR3A 5I6WA 2B2TA 2E2HB 3SR1A 1J9OA 4LAAA 3L7ZC 4C56C 1TT2A 5ISRA 4PMBA 3GTQB 1XX8A 2L0CA 3QOLA 1O78A 2KVMA 2Q8RE 2VB2X 3DEPA 2B2WC 3CRLC 4QIWB 4L6TB 3WDNA 1AN8A 2K5DA 3HOZB 5JJZA 3OWFA 2FFKB 3OW7A 3LWUA 4O42A 1IW7D 5C3WA 3K5NA 1PDQA 4HAEA 2MUYA 5C4JB 4KY6A 4NKLA 2M5SA 2J7ZA 4N9PA 4K2KA 1RCVD 1SE2A 3AMUA 2MPMA 2MHVA 2EYLA 3S2DB 1A2UA 4H7BA 3MHBA 4A3DB 3C1FA 1WTQA 4A3IB 2AQ3B 1I6HB 3J7AF 4C3HB 3RZDB 1WTOA 2K6AA 1WTRA 3OEHA 1GUWA 4FVMA 1OXVA 1Y69U 4AYBB 1DCZA 1STEA 5CV4A 4XLEA 3D4WA 3VYTA 1MABA 3K6OA 1WTXA 2R92B 1I50B 3GTPB 5JEAH 2ZT9C 4J1MA 4RKBA 2XWJB 1ET6A 2OF1A 4AVZA 4G57A 4JK1C 1QWYA 3CHBD 1H9SB 3MXUA 3NQTA 1A3VA 2CHBD 1BR9A 4XYOA 2F0PA 2F0JA 3SDZA 4J8QA 3S1RB 2F0EA 1H9RA 2B2TC 1H9SA 3A56A 1KDBA 3X3MA 1HUNA 1E3XA 1Z7TA 5A2QL 4A3EB 2K7VA 5C4XB 4F8MA 2A69C 1CFMA 5CORA 1NUCA 2VUMB 3GVLA 4X3SA 4HCSA 3VYUA 5DM73 2SEBD 2IW3A 2YU9B 1UAPA 2O5JC 5CV5A 4DNRB 1EY6A 2Q8IB 4DGZA 1IYUA 4XOPA 4FF4A 2ZTGA 1HUMA 1EFRA 2BCOA 4Z9CB 1PTOD 3A55A 4RCNA 2ZZGA 1WTVA 1L0XB 1LT3D 3N6RA 2V31A 1DJRD 3MZ5A 3S2HB 4CKCA 3HP3A 4ABNA 3M7GA 3HOVB 2EY2A 5FO9B 2EY5A 2X69A 5E4XA 4G6IA 2F0UA 2L4NA 2HCCA 3VYRA 1A2TA 3GP7A 5C6AA 1HTLD 3FPUB 3S16B 1AP0A 5I2YA 4OO1I 5CBAE 3J80L 3RD4A 3SK5A 1UD4A 2K04A 2WPDA 1M8AA 4IFDH 5JEAG 3R93A 2PO4A 1PFBA 3ITPA 4HR7B 2L5TA 3CRKC 4I65A 2DNCA 1RF2D 4K6DA 4XNFA 1EZ8A 1CZGA 1PFNA 2JYOA 2X8KA 2VB3X 4NP5A 5E4WC 3NSWA 4DK0A 4RHRA 2LZJA 2E74C 2JSOA 5IT9E 1PLFA 1SNMA 3OE7A 3L9AX 1TVXA 1S5BD 3K59A 1SE3A 2JEAI 1CA6A 1HQMC 1CI3M 3C1EA 3AB9A 2K03A 4KD4A 1SSOA 3NPPA 2Y0SB 3BG3A 1LT4D 3I3CA 3PUWA 4P2CB 2JXMB 1K8OA 1LT6D 3KK7A 3C2PA 2ZZQA 3PUZA 1PTOC 1STGA 1K83B 1EQTA 3H09A 5M3FB 4XQFA 3P1HA 1KTKA 1NRKA 2L11A 2AWOA 4FXUA 1B2TA 1BXTA 1G2SA 1NAPA 3NK9A 1FNVA 2MGSA 1EIGA 4A93B 4Q0FA 1EOTA 5J1ZA 2ZZFA 1Y8OB 1D5XC 1A15A 1E1RA 5F2DA 2XZPA 2WB1B 4R8NA 4IUUA 1V0EA 2O4XA 1DONA 2FINB 2FMCA 4CJ1B 4H44C 2B2YA 3OMCA 2PNRC 3CQZB 3A8JE 1ENAA 1KZLA 3HOYB 2XNAC 2AQ2B 3MWYW 4M8AA 1I4HA 3PUVA 1ESRA 1ZXTA 1TIID 3NBIA 5CV7A 3BVZA 2IX3A 2W6IA 1E3ZA 4XDXA 2AQ1B 2GJPA 5IGCA 3T13A 3CP2A 1ONLA 1R4QB 3GQBA 2L12A 2WZPP 1GUOA 1W9XA 1B1ZA 1HA6A 5CYUA 4DXGA 1F2MA 4XLHA 1BNZA 3QOJA 3BCDA 4TKOB 3KLSX 3E6ZX 1S5CD 4FF3A 5JPMC 1E43A 2A68D 1UNSA 3M4OB 2XGJA 4BBRB 2NVXB 4YXWA 4HSPA 2BA1A 1KMHA 2EJMA 3NHHA 3R2IA 1STAA 1ML0D 4HEDA 2NTSA 3Q24A 2Z6BD 3A54A 4KV6A 1AFPA 1G8ZD 1BMFA 1SYFA 3DWAA 4XT3B 2RBMA 2PZUA 2PW7A 3NTKA 4C3IB 1WTWA 2FJ2A 5JVH3 1RTNA 3OOCA 3TP6A 4KN4C 1RJTA 4LMQD 2D2CC 2F0KA 2F0GA 4U673 4G7HC 1Z47A 4ZAIA 5BN3A 1XXGA 1TS2A 3VR4A 4BS9A 1GXDC 1SYBA 2ZXIA 4M1UB 4KHZA 5G3LD 3ZIAA 4GZYC 4XONA 5FLXL 5HURA 3H94A 1U9RA 3MVVA 5EKKA 3GTJB 1ILQA 3V2TA 1VJSA 1AZQA 2R3ZA 1ZYRC 4XLAA 1S4ZA 4XQNA 2HQEA 2VJJA 1LTTD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXJ C;  2KA7 A;  1HTP A;  2YYZ A;  3QJY A;  2A6H D;  2AUK A;  5KND A;  1Z7T A;  2EJF C;  3QG1 A;  3VR2 A;  3OW7 A;  3LWU A;  2KCC A;  1I6V C;  3IKJ A;  1IW7 D;  5KNC A;  3PUY A;  2IT1 A;  2K7V A;  2NN6 H;  1ZKO A;  2A69 C;  1T5E A;  2B8G A;  1YNJ C;  2BE5 D;  2PCF B;  1ONL A;  2A69 D;  4KI0 A;  1E2Z A;  1CFM A;  2A6E C;  2JEA I;  4IFD G;  1Z6H A;  1Q90 A;  3IFT A;  1VF7 A;  3GQB A;  1HQM C;  3NE5 B;  1CI3 M;  3M4Y A;  2JE6 I;  3AB9 A;  1GUO A;  2O5J C;  1O7L A;  3D31 A;  3T53 B;  1VF5 C;  3VA7 A;  4DNR B;  1SMY C;  3ND8 A;  2Q8I B;  2EJG C;  1IYU A;  1V8Q A;  3BG3 A;  2EVB A;  4LK1 C;  1LAC A;  1GUS A;  2BA0 A;  3PUW A;  1HPC A;  4TKO B;  1H9K A;  2JXM B;  1K8O A;  2K32 A;  4RCN A;  3PUZ A;  1GHJ A;  4G7O C;  5BN5 A;  1Q1B A;  3A8I E;  2NN6 I;  1YNN C;  1HCZ A;  1Q1E A;  1TU2 B;  2A68 D;  1OXT A;  2D5D A;  3A8K E;  3MFY A;  1TKW B;  4H13 C;  2A68 C;  4OGQ C;  1Y8P B;  3I72 A;  3A7A B;  1GJX A;  2LMC B;  1OXX K;  1A6X A;  1G29 1;  3N6R A;  4BA2 I;  4DNT B;  2AWO A;  2NN6 G;  3SE0 A;  1B9M A;  3W3A A;  1DD2 A;  2BA1 A;  2EJM A;  3I4L A;  4IQZ A;  4TQU S;  3T51 B;  4BA1 I;  3D4R A;  1V43 A;  5BN4 A;  3LNN A;  3BDO A;  1LAB A;  1OXV A;  1Y69 U;  5K36 G;  3HGB A;  3M85 A;  4OO1 G;  1OXS C;  4I7Z C;  1DCZ A;  1E2W A;  2BDO A;  3PV0 A;  3EQL C;  2A6H C;  5C0X G;  5KNB A;  3I73 A;  4XIG S;  1Y8O B;  2AUJ D;  1QJO A;  1IW7 C;  1GUG A;  2BE5 C;  2R6G A;  2D62 A;  1GUT A;  1OXU A;  2DNE A;  2V4D A;  1BDO A;  3FPP A;  2B8F A;  4OO1 H;  4KKT A;  3VR6 A;  3GD7 A;  3OOC A;  4L8J A;  3U9S A;  2O5I C;  5JEA H;  4KN4 C;  2A6E D;  2E76 C;  2EDG A;  1Y8N B;  4KN7 C;  4KKS A;  2ZT9 C;  4DK1 A;  3P20 A;  1K8M A;  4H0L C;  1VCI A;  1FYC A;  4XTC S;  2D2C C;  1Q12 A;  1E2V A;  1PMR A;  4G7H C;  1H9M A;  3A7L A;  4JK1 C;  3TZU A;  5BN3 A;  4IFD H;  3RLF A;  5JEA G;  3M7N A;  3VR4 A;  1H9J A;  1CTM A;  4H44 C;  1FR3 A;  1GUN A;  1H9S B;  3FMC A;  2DN8 A;  3MXU A;  4JBW A;  4KMU C;  3QIA A;  2QF7 A;  2PNR C;  4KHZ A;  3L7Z C;  4HR7 B;  1B9N A;  1EWH A;  2L5T A;  3A8J E;  3OPO A;  2F1M A;  3T56 B;  2CW0 C;  3CRK C;  3VR3 A;  5K36 H;  2DNC A;  4GZY C;  4KKU A;  5A35 A;  1IYV A;  3SDZ A;  2PPB C;  3H94 A;  1DXM A;  1O78 A;  1GHK A;  3VR5 A;  1H9R A;  2JEB I;  3PUV A;  4LJZ C;  4G7Z C;  1VDZ A;  2E75 C;  3CRL C;  1H9S A;  3PUX A;  2K33 A;  5C0X H;  3WDN A;  1ZYR C;  4PV1 C;  4DK0 A;  3KLR A;  3ND9 A;  2E74 C; 
#chains in the Genus database with same CATH topology
 2C4U A;  5LL6 S;  2MO0 A;  5IYD G;  2NZO A;  2EJF C;  1KNE A;  3MXN A;  3R6K A;  5KIX A;  3M4Q A;  1F2Y A;  3PF4 A;  3I4N H;  2JA6 H;  4RCY A;  5KNC A;  4A76 A;  1QUE A;  1I94 Q;  1K8G A;  1SJH D;  4RD1 A;  3K5O A;  4RAU C;  3J80 E;  4BPR A;  4ZKB B;  5D14 A;  5LMN Q;  2ZXO A;  5IP7 G;  2K5N A;  1NBM A;  4R8I A;  1YLO A;  4ULL A;  3LQ6 A;  3CXC B;  3EFX D;  4CJ2 C;  5B6I A;  1QGY A;  3HOW H;  4K14 A;  5IGF A;  2P3M A;  3D31 A;  3GTG B;  2XND A;  1S72 B;  2ZXP A;  2NB0 A;  4PQX A;  1D5M C;  1QVF A;  1HNW Q;  4B3F X;  3CMM A;  5IP9 G;  3VO2 A;  1LT5 D;  3STB D;  2R7D A;  3NTH A;  4Z4Y A;  1V0F A;  2M2L A;  4WOR A;  2PQA A;  1PJ7 A;  2YWH A;  2WR8 A;  1S0U A;  3SK4 A;  5M5Y H;  3ICE A;  3A35 A;  3MFY A;  4H13 C;  4ASU A;  2A68 C;  3A7A B;  2Q8T A;  4TN1 A;  3GTM B;  3AQQ A;  1E62 A;  1G29 1;  4TMW A;  1W6K A;  4BY1 G;  3WOF A;  3JQQ A;  1J5E Q;  5G3L F;  1ZYR D;  3B6Y A;  1B9M A;  4S3S A;  3CP8 A;  1JB3 A;  1JCK B;  3LO8 A;  3HOX H;  1GM5 A;  1P16 A;  2HDL A;  4GN5 A;  2WSS A;  4M1K A;  2W6J A;  2I46 A;  5I9P A;  2LS0 1;  4EVO A;  4X65 Q;  2YTX A;  4CKB A;  4OWX B;  1H42 A;  2GK6 A;  1EP2 B;  3KLS A;  4FXG C;  2R6G A;  1M4V A;  3BNW A;  2F0M A;  1RKN A;  1DOL A;  2KVO A;  3PO3 H;  2V4D A;  2VNK A;  3GD7 A;  3ASS A;  4DUY L;  3P20 A;  2WKD A;  2CC2 A;  1MIU A;  4RD4 A;  5IYC H;  1VQ6 A;  2N55 A;  4JG2 A;  2Q2H A;  1SYC A;  3HKZ G;  1H9M A;  3ZZU A;  2B2V C;  5CV9 A;  1EY0 A;  4A3K B;  2E1B A;  1GUN A;  1JA1 A;  2Q2I A;  4DV7 Q;  4DAY B;  1TS5 A;  2QDB A;  4DUZ Q;  3IRB A;  2WP8 J;  1PV4 A;  3EJI A;  1SRU A;  3GV3 A;  2JA6 B;  3I56 B;  1LTG D;  3K57 A;  4DR2 Q;  4TMV A;  3X3N A;  1G6Z A;  3V76 A;  2R7Z H;  1EU3 A;  3FKI B;  3A8I A;  3MA2 B;  4MTK A;  4K5W A;  1JT8 A;  2VBV A;  4DAY A;  2OT2 A;  2JEB I;  4G7Z C;  1UE1 A;  2Y0S E;  4GLA C;  4FXK C;  1VQ9 A;  1TR5 A;  5M5W B;  2XZO A;  4UAJ A;  2O2L D;  2AKW B;  2QMU A;  3Q6S A;  1VQN B;  1NE3 A;  2YYZ A;  1N36 Q;  1D5Z C;  3QG1 A;  3KLW A;  2KCC A;  2B5O A;  2C35 B;  1WYD A;  3OZU A;  2EYH A;  4HTH A;  4LF4 Q;  4DR7 Q;  1QFJ A;  2NN6 H;  1XNR L;  1HNX L;  2JDI A;  1EU4 A;  1UD8 A;  3S1M B;  4IAL A;  5IWA L;  4R9W A;  5TSS A;  4Z4W A;  3PVD A;  3KJO A;  2F43 A;  3N52 A;  5JOB A;  4FF1 A;  3DEO A;  1M1K C;  1A0I A;  1TS4 A;  1BX1 A;  1VF5 C;  4XR6 A;  2ID0 A;  1CZW A;  1FNU A;  2MNA A;  4JI3 Q;  1VQI A;  2XWB B;  4LK1 C;  1TS3 A;  4A3G B;  4X8I A;  1H9K A;  1GOZ A;  1T6Y A;  2X0K A;  1IJF A;  1WU8 A;  1XFO A;  3CCM B;  2VBS A;  1CQV A;  1Q1B A;  2NN6 I;  5I9O A;  4K5V A;  5BR8 L;  5DEH A;  2A8V A;  5I2X A;  3PUN A;  1KXL A;  3W2I A;  5HXB A;  1UE5 A;  5I6Y A;  1ZUN B;  4R1J A;  4RLZ A;  2K1B A;  4B44 A;  2E1R A;  2J4X A;  2R7F A;  4DN4 M;  4C3J G;  3ZZT A;  1UWV A;  1WOP A;  1QUQ A;  4NDX A;  2RA4 A;  3CCE B;  2CH4 A;  4B9W A;  1DD2 A;  2WB1 G;  1IBK Q;  1UD3 A;  4J15 A;  1HA3 A;  4UP7 A;  2EFG A;  2RSO A;  3CW2 A;  5T1I A;  1H8E A;  1VQ5 B;  3U4Z A;  1AEX A;  3PO2 B;  3I2Z A;  1Y1V B;  1CM9 A;  4U68 A;  2QGG A;  4IW3 B;  4XKW A;  5F4J A;  3QSY A;  2MP1 A;  3L2P A;  5KYL A;  1SYE A;  2X6W A;  3FPP A;  3SK6 A;  1PFM A;  4JI1 L;  1I6H H;  2Z6B A;  3FEW X;  2F0I A;  3C46 A;  3BZD B;  3WY9 A;  2F0N A;  2H1E A;  2IWH A;  2MQH A;  4X64 Q;  4B3S L;  5ELO A;  2RQX A;  3BQJ A;  4JYA Q;  1S5E D;  5EPL A;  2F0V A;  1PXU A;  2JA5 B;  5LMU L;  2ZTD A;  3A8K A;  4II3 A;  1I3Q B;  2QN6 A;  5NUC A;  1F60 A;  2PZW A;  1BPL A;  3TP8 A;  2NPF A;  4DV2 Q;  2F1M A;  3T56 B;  3W5U A;  1QNU A;  2RKS A;  3K5M A;  1O7I A;  3DWQ A;  1PRT B;  2B2U A;  1NJI D;  2B39 A;  4LF9 L;  4PZ7 A;  1AH9 A;  3KBG A;  4YCU A;  1A3T A;  2JQO A;  2SDF A;  3TQY A;  1EYC A;  5CMD A;  4BY7 G;  3V96 A;  1J8I A;  1PHJ A;  1F9Q A;  3PIP 3;  1EUJ A;  1GJR A;  2VNH A;  4MNO A;  1MBY A;  2JP1 A;  1K28 D;  1ZEQ X;  4UAI A;  4ZUI A;  3OTO L;  4KJO A;  5I4D A;  2R93 H;  3C3L A;  1OHH A;  1CUK A;  1I50 H;  4P6V F;  4YHH Q;  1N0U A;  1W0J A;  4B08 A;  2OK7 A;  2F1L A;  3P26 A;  4P12 A;  2OXP A;  1B44 D;  2CBX A;  3G48 A;  3MFG A;  1HQR D;  3J81 k;  4IPG A;  3IFT A;  4KJN A;  5FOB B;  3KF8 B;  1IBL Q;  1YJN A;  4PZ8 A;  4WZE A;  1SDF A;  4XN3 A;  2WJY A;  3MXG A;  4PG3 A;  3BZK A;  1YIJ A;  4DR3 L;  4HIM A;  1EIH A;  3CW2 C;  2I0Q A;  5ELD A;  5FLM G;  3STB C;  4WJ3 M;  1QX4 A;  3G71 B;  2KBN A;  3CKI B;  4APV A;  4JI2 L;  5HGT A;  4RA8 A;  5IT9 L;  5A89 A;  2Z8L A;  1NJI C;  3W1G A;  4QB4 A;  4AYB G;  1OXT A;  4FXD A;  1YIJ B;  2CH4 W;  3Q8D A;  1FX0 A;  3OZV A;  3NEM A;  2CF4 A;  1F9P A;  1O7Y A;  2CVR A;  3TP5 A;  1A6X A;  1VMC A;  1H85 A;  1WCM B;  3PO3 B;  1F2L A;  3HOU G;  4ZK9 B;  2F0S A;  1PH3 A;  5FO8 B;  4XOR A;  2R7Z G;  3ASR A;  1AW7 A;  2QIL A;  3BDO A;  5K36 G;  4C3I H;  2GQF A;  1QIL A;  5M3F H;  1OXS C;  3TME A;  3Q6R A;  3W2F A;  2VXW A;  4Q5V A;  1MKH A;  1G91 A;  5FLX c;  3I73 A;  3E0E A;  3JAM L;  4PZ6 A;  4A3K H;  3I70 A;  1BQE A;  2XTI A;  2ICI A;  4RMF A;  1QGZ A;  1I4G A;  2Q6K A;  2FVG A;  1R5B A;  2UUB L;  4HMI A;  2HIX A;  1VQH A;  5ELC A;  4Z4Z A;  1TUI A;  2I5M X;  1GO2 A;  3WOE A;  1FYC A;  4DV6 L;  2EY6 A;  2KHJ A;  4QVJ A;  3IAY A;  2K01 A;  4YCV A;  1E2V A;  1WFQ A;  1UE6 A;  3H6M A;  1KAA A;  4X3T A;  2F4V L;  2EYF A;  2XVS A;  3NBH A;  1H9J A;  4N9T A;  1CTM A;  1PH9 A;  4IUQ A;  3GIR A;  1X3F A;  1CSQ A;  1WSV A;  4MYT A;  3E5S A;  2HCJ B;  4YY3 Q;  2F4I A;  1OB5 A;  3OPO A;  3V7A A;  3VR3 A;  3AU7 A;  3VNU A;  3TZD A;  2B2U C;  5C4J H;  1YVC A;  4G1B A;  4DA2 A;  4QGU A;  4JBJ A;  5C3E H;  2OBS A;  1EEI D;  1LTR D;  2QEJ C;  4CDD C;  5DS0 A;  4L5S A;  4QF4 A;  4ZKC B;  2OQ0 A;  2UUB Q;  1EP3 B;  1W2B B;  1HNZ Q;  5A88 A;  2DYI A;  3F2D A;  1EY7 A;  1W6J A;  3VA5 A;  1Y1V G;  1BBX C;  4B3G A;  4UPA A;  4PC1 A;  2OYN A;  4XLC A;  3SJP A;  3PMF A;  1PH5 A;  3OSO A;  2K5Q A;  1QVG B;  5BR8 Q;  4KY7 A;  3CTA A;  1YJW B;  1Y1W H;  3NWS A;  3H3V C;  3W2E A;  1QFY A;  5JJL A;  1FD7 D;  1Q8I A;  1W2B A;  3PA2 A;  1N06 A;  1HZA A;  1K28 A;  1PYW D;  4L5Q A;  3TP7 A;  2R9V A;  2R92 G;  2Z4H A;  4IFD G;  1VLY A;  2VYQ A;  4JI4 L;  2KUM A;  4CBV A;  3BS1 A;  5EPJ A;  2DOG A;  2JE6 I;  4R4T A;  3CQZ H;  3KDF A;  5IP7 H;  1D2E A;  2EIX A;  4IZ8 A;  2JA5 G;  1R5N A;  2B29 A;  1HPC A;  3F2U A;  4RPB A;  3G6J B;  4XN0 A;  4LFA L;  2JA7 B;  2EY1 A;  3WBK A;  4O1N A;  1SFO H;  2NVQ B;  1UUP A;  2JN4 A;  3UDF A;  1Y8P B;  5E7N A;  1VQM A;  1WP6 A;  1S72 A;  3R6J A;  3HRZ C;  1ICW A;  3OIQ A;  4HN7 A;  1EIF A;  4YY3 L;  5C3E B;  4JI6 L;  2NN6 G;  4XD7 A;  3KOJ A;  2UUA Q;  4JMQ A;  4RDK A;  4YAU A;  3FHW A;  4IQZ A;  4TQU S;  3BY2 A;  4DKA C;  3S1Q B;  1G7R A;  4BA1 I;  3T1Y Q;  1V43 A;  1SKY B;  1EFC A;  2J0T D;  1ILP A;  3KFU A;  1T6X A;  2F0T A;  1KNA A;  4OO1 G;  4Z4R A;  3B8H A;  1IYJ B;  2WAQ G;  1WI5 A;  2BDO A;  4HMJ A;  4P22 A;  3PV0 A;  4BY7 H;  2BSA A;  1KAB A;  3AGQ A;  2Z4I A;  3GV6 A;  2WJV A;  2KOL A;  4C3J B;  1GUG A;  2PIA A;  4TMZ A;  1E22 A;  1GUT A;  1LTI D;  3S9W A;  1ASY A;  2E2D C;  1BDO A;  4UP8 A;  3J81 i;  3OWE B;  1PH1 A;  4LF6 Q;  1MD2 D;  1V1P A;  3IL8 A;  1PRT C;  1KRT A;  2R93 B;  4DK1 A;  1QB5 D;  1BF4 A;  4A75 A;  1SFO B;  3HKZ E;  3G4S B;  1V1Q A;  1EIY B;  3J7A V;  4H0L C;  1CNE A;  5M5X B;  2K14 A;  5GAE C;  2XIW A;  3SXH A;  3BCF A;  3A7L A;  4LUO A;  1SMY D;  4GKJ L;  2H5X A;  3RLF A;  4A3L G;  1F77 A;  1N8R C;  4OOX A;  3I56 A;  2DGY A;  2RVL A;  5GAG C;  3A5Z B;  1PZJ D;  2BGJ A;  5D3I B;  1SYG A;  4R4I A;  1PZK D;  2C5C A;  2LKV A;  1PRT F;  4IUV A;  3TBI B;  1C9O A;  3FP9 A;  4AF7 A;  1KL9 A;  4C1N I;  3H0G H;  2K50 A;  5JJK A;  1PJ5 A;  4R71 A;  3BY1 A;  2VNJ A;  3DMU A;  3GDE A;  5A35 A;  4HJ9 A;  4OX9 Q;  2A5H A;  5FO1 A;  1JOQ A;  4CKE A;  3GTO H;  2UXC Q;  1KAW A;  2JJQ A;  4OIK A;  2LSS A;  5JBQ A;  5JEA J;  4IFD J;  4ME5 A;  2Z0S A;  1WCM G;  2C78 A;  4MTN A;  2V1C C;  3E0J A;  3CPW A;  1XPO A;  4OON A;  1A3U A;  1VQ4 B;  1YIT B;  2VS1 A;  3A1P A;  3ER0 A;  4XYQ A;  2DY1 A;  3HAG A;  3MEH A;  5KND A;  4R4C A;  3P27 A;  5C4X H;  4JI6 Q;  4POG A;  1MJC A;  4X3U A;  2C9O A;  4QUF A;  2IT1 A;  3BDL A;  4P26 A;  4BY1 H;  4OPV A;  4LFB L;  4P73 A;  2PLF A;  4DK3 C;  1JR0 D;  1BCP B;  1E2Z A;  1PRT D;  4PMW A;  4QHY A;  1IHM A;  4ZGQ B;  2KCM A;  3JU4 A;  1SXT A;  4G4K A;  1VHE A;  4GOP A;  1JB7 A;  3K7A H;  4UHV A;  1V8Q A;  3TS0 A;  3I4M B;  2V7X A;  1VQK A;  4XMY A;  3AVV A;  5FIU A;  2PZT A;  2BA0 A;  3MAQ A;  2B63 H;  4DR1 L;  1ENF A;  4IO9 A;  1VHO A;  3KF6 B;  2ZTC A;  2K32 A;  2XGT A;  5M9O A;  4DR6 Q;  1JE4 A;  2QGQ A;  3HOW G;  3G4S A;  1NB9 A;  3I91 A;  4Z1M A;  2X53 S;  3F2C A;  1TKW B;  5EMN A;  3CCS B;  4RGO S;  1I4R A;  3M9B A;  4BA2 I;  4DNT B;  1F2Z A;  3ULL A;  2F0L A;  3I4N B;  1EY9 A;  1EYA A;  1WPC A;  5LMU Q;  2LXJ A;  4YIJ A;  4POF A;  1SAP A;  4XOT A;  3HGB A;  1ESF A;  3HOU H;  2HDM A;  4YAF A;  2PW5 A;  4KLK A;  1E79 A;  4JI4 Q;  1CKM A;  2KCT A;  1QJO A;  2KED A;  1LTB D;  2NVY B;  2KEC A;  3U6K A;  1BUV T;  2BN4 A;  1N36 L;  4UP9 A;  3H0G B;  4DR6 L;  1FNM A;  3E1Y E;  1OTC A;  1Y8N B;  4KN7 C;  4NXM L;  2RHQ B;  3ZBT A;  1M1K D;  3CF5 A;  3CD6 B;  5ELN A;  4PNY A;  4JV5 L;  3MMP A;  4ROX A;  4XKV A;  4IUP A;  3SK8 A;  1PMR A;  2BDN A;  1RHP A;  2XSC A;  4KY5 A;  2MJ8 A;  3M7N A;  4AH6 A;  3CCR A;  3QWN A;  1BCP C;  2UXB L;  1CQX A;  1UD2 A;  1HHV A;  5THX A;  1II3 A;  3CCV A;  3ZBU A;  3WXM A;  1VQO A;  5K36 H;  2DER A;  2SNM A;  1YNN D;  2ZJQ A;  2EYO A;  4R4O A;  1FRN A;  1IYV A;  2PPB C;  2NZH A;  4I7A A;  2I5H A;  5IIF A;  1C0A A;  4PMC A;  3PUX A;  1XYI A;  4MN3 A;  2EZV A;  5LMZ A;  1YIT A;  5KGU A;  1I8D A;  3WNB A;  2WAQ B;  2RCF A;  1UD5 A;  1SBB B;  1L0Y B;  1ELO A;  2A74 C;  3CD6 A;  4HE5 A;  1DYQ A;  4JCV E;  1I6V C;  1JE5 A;  3GTL B;  3CMA A;  1VQG A;  2DY8 A;  1E1Q A;  1STN A;  4FP5 D;  5CGK A;  5M5W H;  1T5E A;  1FNB A;  1OGJ A;  1YJN B;  1PJ6 A;  3G7L A;  1SRO A;  3HEJ A;  5IGE A;  2HD3 A;  1IKL A;  2RC6 A;  1QUF A;  5FLX E;  4DV5 L;  2CW5 A;  1NR4 A;  1HJP A;  4H9G A;  4G7X A;  4M0L A;  4B3X A;  2JA8 G;  5C4Z A;  3PO3 G;  1WD0 A;  3J81 E;  2I07 B;  4X05 A;  3S17 H;  2CWA A;  4F87 A;  1X3P A;  2B63 B;  4FDB A;  3FPK A;  4DR3 Q;  3S1M H;  1HFN A;  1XTC D;  1VQC A;  2NZ1 D;  3CC4 A;  3I90 A;  4TMX A;  4LF9 Q;  1R9T B;  4LBY A;  1SND A;  1TXY A;  2ZXR A;  1BQQ T;  4NXN Q;  4LC0 A;  2EXZ A;  2ICE C;  2HUG A;  4V0B A;  4DV1 L;  4PC3 A;  1X56 A;  5BN5 A;  4BY7 B;  1YNN C;  2QA4 B;  3ASQ A;  2N78 A;  3I1F A;  4RH6 A;  1VQD A;  4RGM A;  4X65 L;  2EXD A;  3NP8 A;  5JVG 3;  5GV8 A;  2ZL5 A;  1WJJ A;  3HZX A;  2A73 B;  2TSS A;  2DJF C;  3W3A A;  3R2T A;  4RGN A;  2GA4 B;  5C0X I;  3FKI H;  1RD9 D;  1LUZ A;  5FO0 A;  1UD6 A;  1Q7Y D;  1VQK B;  3SGI A;  4HIO A;  2K5W A;  1JOO A;  3OMG A;  3M85 A;  4GNX A;  1W0K A;  2UUA L;  1L1O B;  1D1K A;  3TS2 A;  2VZL A;  1KK2 A;  3EQL C;  4PAB A;  5C0X G;  5FA6 A;  4XIG S;  2BOS A;  4XQJ A;  3DUZ A;  1OB0 A;  1N32 L;  1MJE A;  2NBF A;  2V7U A;  4FO2 A;  4KKT A;  4YHH L;  4FNF A;  1E0B A;  4LFA Q;  3U9S A;  2NYZ D;  3DM3 A;  5DNF A;  4RCO A;  4KKS A;  3OW2 A;  4B3M Q;  4NNJ A;  1NBW A;  3CME B;  1ZM4 A;  3RLN A;  5C44 B;  1EFU A;  2HCI A;  1CT1 D;  2KCN A;  2YV5 A;  1NMG A;  3CPW B;  4KD3 A;  1SM4 A;  2IL8 A;  5IYP A;  3M3Y B;  4V19 0;  3UI2 A;  2H4O A;  2XRQ D;  5LMN L;  5JAV A;  2CW0 D;  2WAQ E;  1LTS D;  4QVA A;  2P5Z X;  4X06 A;  4C2M B;  3S1N B;  4E0F A;  2LY7 A;  3HOW B;  1T6Z A;  1EQV A;  4Q7J B;  3L3O C;  5ELF A;  1CHP D;  5K5P A;  1TWF H;  2HHH L;  4LF8 Q;  1SNP A;  4DU9 A;  4C1N K;  4PAA A;  3OAA A;  3WQZ A;  1YJW A;  1VQ9 B;  1WOS A;  1E3P A;  1NR2 A;  5CBE E;  5JJI A;  4DPG A;  2F0Q A;  4NW2 A;  4PV1 C;  1K3R A;  3KLR A;  4N8X 1;  4X7D A;  5DM6 3;  3QJY A;  2RSN A;  3U50 C;  1Q86 D;  3VR2 A;  2XN9 C;  4WQM A;  4K2L A;  1R9T H;  3CCV B;  2IX1 A;  3ZYY X;  4DF7 A;  4CDE C;  1GVP A;  1Y1V H;  3CU7 A;  4OL7 A;  3SVM A;  3FKI G;  5AFW A;  2YWF A;  3M4O H;  1IB0 A;  2L9H A;  1Q90 A;  3H15 A;  4LNQ A;  1Q3L A;  1HR0 Q;  5EAY A;  2ATW A;  1F9R A;  1VMP A;  2VY3 A;  4X62 Q;  2EYJ A;  1IKM A;  3T53 B;  4U9U A;  1S40 A;  2NWG A;  1C8C A;  3GTM H;  2GJK A;  2IHF A;  1QFZ A;  4PC6 A;  1GUS A;  5IYB G;  3S14 H;  4DR2 L;  3RZO B;  3ERO A;  4ZCM A;  5EJW A;  3FJO A;  2GVA A;  2YTV A;  3RR5 A;  3ONY A;  1SYD A;  2KEE A;  3A8I E;  1EL0 A;  5FO7 B;  4PC2 A;  1C4Q A;  4RFB A;  4L63 B;  1DG1 G;  2D5D A;  1R4P B;  2G9D A;  3J81 j;  1X55 A;  1PZI D;  1YZ6 A;  2R6H A;  3BC9 A;  4WZT A;  3AFQ A;  4QMG A;  2QW7 A;  1FDR A;  1EFT A;  4DV0 Q;  3T51 B;  4HID A;  3FKS A;  4DV4 Q;  5J22 A;  1NY4 A;  5IK2 A;  2WV6 D;  2Y0S G;  1LAB A;  5ELE A;  3SHL A;  1T5X D;  3SLD A;  2VZA A;  1STH A;  4HJA A;  1Q7Y C;  5ELB A;  1EFI D;  2N8N A;  4ZCL A;  2KJX A;  1SKQ A;  3I4O A;  3J7Z C;  2OTL A;  1TQO A;  3AST A;  3TSS A;  1JWU D;  3K81 C;  3CCJ B;  2AUJ D;  3S1Q H;  4CGY B;  3ONU A;  2VQF Q;  1QZH A;  3S14 B;  3D6W A;  2WIN B;  3KF8 A;  4X3K A;  5M3F G;  2ZZE A;  4TMT A;  4QIW E;  4CJ0 B;  3B78 A;  4DUZ L;  4FF2 A;  4ID6 A;  4QUC A;  3PO2 G;  3ZPN A;  1V1O A;  3S15 B;  3I7F A;  2YU9 H;  4A3D H;  1K8M A;  1K9M C;  4XTC S;  2I1L A;  3D0F A;  2EQS A;  3MXP A;  3IFD A;  1J5E L;  2CRV A;  3A3G A;  1RQP A;  5E1F A;  1HA5 A;  3PO2 H;  2VUM G;  1JA0 A;  1BCP D;  1L1O C;  1MRZ A;  2FMM A;  3Q0A A;  3HOV H;  1RDP D;  2JA8 H;  1G2T A;  2Z6K A;  1VQO B;  3D6C A;  4TSF A;  1K0R A;  2CWP A;  1AE3 A;  3MC0 B;  2D9R A;  1FJG Q;  2CW0 C;  4WZL A;  4DK6 C;  4OIJ A;  1S4M A;  2GK7 A;  3D3R A;  4OWW B;  1LTL A;  4NMZ A;  1MI2 A;  3CB4 A;  1JWS D;  4Z4U A;  1CHQ D;  2CQO A;  3A8J A;  4YCW A;  1WVL A;  1I4Q A;  1K3B C;  4AC9 A;  3OW2 B;  2E75 C;  2E5L L;  1NSN S;  2DJG C;  2PQA B;  2RCN A;  2B2V A;  2F0F A;  5M5X H;  1YHA A;  1HTP A;  5DSZ A;  1PH2 A;  1G7T A;  1Q86 C;  1TWC B;  2V7V A;  3P75 A;  1LLR D;  1KLU D;  4ILW A;  4RD6 A;  1J9Z A;  3I4M G;  4FYD A;  1YI2 A;  3H91 A;  3G6E B;  1YNJ C;  3HG9 A;  4RWS C;  4KI0 A;  3CXC A;  1BJK A;  1JOR A;  4GNX C;  1PFS A;  2AMC B;  2F0H A;  4ZRZ A;  3OZW A;  3NQI A;  1I18 A;  3NE5 B;  2L55 A;  2QTZ A;  1CKO A;  1PTO B;  3TN2 A;  4B9X A;  4JYA L;  1F20 A;  4G7W A;  1JWM D;  1SMY C;  4BBS G;  4IFD I;  2DIE A;  1N8R D;  3KUP A;  3CCS A;  4R4Q A;  4HIZ A;  1M90 D;  1SEB D;  1UEB A;  3BDC A;  5FKA C;  4JI1 Q;  2JA8 B;  3PUM A;  3CMA B;  3ERQ A;  4RKL A;  3GTK H;  3AVT A;  4YAL A;  3TEH B;  4Y7N B;  4GLX A;  3DLL A;  4HCE A;  5EPK A;  1QNK A;  1I94 L;  4OGQ C;  2C5H A;  1GJX A;  2LMC B;  1FL0 A;  1OXX K;  2F3W A;  1KLG D;  2R61 A;  5KNL A;  3WND A;  3BJU A;  1HZE A;  2HT1 A;  3SE0 A;  1E64 A;  1DOK A;  1BO0 A;  1XMQ L;  2KQ3 A;  2UU9 Q;  5BN4 A;  5CDF A;  1IJE A;  1C7Y A;  1MHW C;  3ULP A;  2KHI A;  5KEE A;  4RG1 A;  4EQP A;  1YNJ D;  3J80 c;  3SJZ A;  5KYI A;  2EE1 A;  4AIM A;  1IL2 A;  4YEJ A;  1PYB A;  4LF5 L;  2CND A;  2AWN A;  5M3M H;  4Z4S A;  4L8J A;  1D6E C;  4C2M H;  1Y1W B;  5BSY A;  2BGI A;  3PIO 3;  2CFM A;  2A6E D;  4CHT B;  4JI8 Q;  1EWI A;  4MHE A;  3QB3 A;  2SOB A;  2FHT A;  3R3O A;  4DR5 L;  1XTD A;  1SLJ A;  1YNX A;  2PMZ E;  4K0K Q;  3FRP B;  1B3A A;  1KK1 A;  1YHB A;  2G9H D;  4NB3 A;  3G6E A;  4DR5 Q;  5EQ0 A;  3Q23 A;  3A74 A;  3OIP A;  4RD2 A;  1JIC A;  2HHH Q;  5KSW B;  2DY7 A;  4LF8 L;  3JAM E;  1B53 A;  4P9S A;  1B9N A;  4EQO A;  2XOK A;  5IGB A;  2NVT B;  3J7Y W;  1KRH A;  1QVG A;  1NTG A;  1E1T A;  1ENC A;  4A3M B;  1Q82 D;  2WZN A;  1GHK A;  5HGQ A;  5C4X G;  4GLV B;  4LJZ C;  4OP7 A;  5IYD H;  1VDZ A;  3CRZ A;  2EYP A;  2N88 A;  4ZLT F;  4A3C G;  4F7X A;  4M2L A;  3Q39 A;  1TWC H;  2QA4 A;  3H0G G;  3VYS A;  4BXX H;  1B70 B;  2AUK A;  2GN5 A;  4ZGN B;  4LBV A;  1LV9 A;  5FJ8 G;  1BLI A;  2DEU A;  2VBU A;  1PA6 A;  1EWC A;  2BMW A;  2ZBV A;  3O13 A;  3NWT A;  3VDY A;  3TRE A;  2DUD A;  1T9H A;  1RTO A;  2B8G A;  1EYG A;  2PCF B;  1XJV A;  1YBY A;  1VQ8 B;  2A19 A;  4Z4T A;  2GJR A;  1HZC A;  1PTO H;  1Z6H A;  3CCQ A;  1WOR A;  5IYQ A;  3CC7 B;  4BWG B;  1SMX A;  3BVG A;  3HS0 C;  1BKB A;  3M4Y A;  4H02 A;  4KHP L;  3Q38 A;  1W35 A;  3LQE A;  3J7A 5;  1B23 P;  3T4A C;  3VA7 A;  1X3E A;  5E3F A;  1KQS A;  3GTP H;  3GTG H;  1GD7 A;  3OJX A;  4KK7 A;  5EBC A;  1AIP A;  3F2B A;  4KTA A;  3HFZ B;  1WCM H;  4M53 A;  2JJ2 A;  1SNQ A;  3W2G A;  1I3Q H;  1QZG A;  1STY A;  1SJE D;  1OB2 A;  1HCZ A;  1Q1E A;  1TU2 B;  3RUZ A;  4JI0 L;  3ZJY C;  2TMP A;  2YWE A;  5IYW A;  2EPB A;  3I72 A;  4ODG A;  1N07 A;  3NEL A;  5EKL A;  1U4R A;  2F0D A;  3WNC A;  5TRD A;  1B2R A;  1K73 C;  1LYL A;  2QCP X;  1MSH A;  5FK9 C;  3HOY G;  3LNN A;  2NVX H;  3J81 c;  1C48 A;  2UXC L;  4Z4V A;  1U4M A;  1U4L A;  2IJ0 A;  5AJ3 L;  3ASP A;  2F3V A;  4KHV A;  2JJ1 A;  4XLF A;  3CP0 A;  1XE1 A;  2PI2 E;  4LF7 Q;  2UUC Q;  3OEE A;  4RDJ A;  1BOS A;  3EVQ A;  2ZTN A;  4OEL B;  5KNB A;  1IW7 C;  4RHS A;  3EA6 A;  3HOZ G;  4A3B B;  1B4O A;  2KEN A;  4X7C A;  1PH7 A;  3BH4 A;  4MIU A;  2DNE A;  1J6Q A;  4NXN L;  4EGV A;  1FJG L;  2IHE A;  2E2J H;  3BVM A;  5LHY 1;  3A5U A;  3URY A;  1N32 Q;  3EBE A;  2DCU A;  1W34 A;  3VO1 A;  4GKJ Q;  2V7Q A;  3K5L A;  1TWG H;  3CC2 B;  5IOD A;  3I8Z A;  5A2Q E;  4BBS B;  3M4P A;  3CPX A;  1VQN A;  5C0X J;  1U4P A;  3ZUG A;  3K8A A;  5F4M A;  3ERS X;  5JPN C;  3FDT A;  1HRJ A;  1X3Q A;  1S5F D;  4KMU C;  1X32 A;  2DN8 A;  5J39 A;  2QF7 A;  5EBD A;  1VQP A;  1S5D D;  1A8P A;  2GRE A;  5J3O A;  3F1Z A;  3NUC A;  1STB A;  2BVN A;  4BXX G;  2R7Z B;  4LW1 A;  4KKU A;  4ZYS A;  3NTI A;  3M3Y H;  1TWH H;  3W5V A;  4WFN 3;  2OQK A;  3SEJ A;  5KRU A;  1JQY D;  2R93 G;  3V05 A;  1DZ1 A;  3VR5 A;  1CKN B;  3G71 A;  3GTK B;  3QFS A;  4P3I A;  2GPJ A;  2XNC A;  1O80 A;  1OO9 B;  4NXM Q;  2CCZ A;  1YHQ A;  3ND9 A;  1QCB D;  4P71 A;  5IGD A;  3Q22 A;  2KA7 A;  1QE6 A;  3PGZ A;  3RMH A;  1HVX A;  4J6H A;  1X3G A;  2XEX A;  1VQL B;  4A3G H;  2A1A A;  4C3I G;  4RGT A;  4HSV A;  1FNW A;  3UE1 A;  2Z1C A;  1KC8 C;  2VNI A;  4RPD A;  2VNU D;  5CR3 A;  3OP1 A;  1PTO F;  1VF7 A;  1TWF B;  1Y1W G;  2RDG A;  4XL9 A;  3S2D H;  3U9O A;  4AF6 A;  5C5M A;  4JBM A;  2EJG C;  5M3M G;  4K8I A;  2X6L A;  4K5X A;  4A3J B;  2EVB A;  1PH6 A;  4X62 L;  3CCU B;  5FL7 A;  1VQJ A;  2K28 A;  2MFI A;  3BYY B;  3HOX G;  2QKI C;  3CCR B;  1BBW A;  1G7S A;  1I4P A;  5EKI A;  2VL6 A;  4QUZ A;  3KDF B;  1SR3 A;  4TT3 A;  2V7T A;  4P1V A;  1TWA B;  1VQL A;  1TWG B;  1D2B A;  2WII B;  4ME3 A;  1D1N A;  4GOP C;  3I4L A;  2QDX A;  2L1B A;  1QUQ B;  5IY0 A;  5H59 A;  1F9S A;  4DQL A;  1CQF A;  1DM0 B;  2X6G A;  2PE3 A;  1E2W A;  3H3V I;  1Q81 C;  3P7J A;  4JV5 Q;  3AVW A;  4LFB Q;  2A6H C;  4RDL A;  2K52 A;  3BYT B;  1EY8 A;  4F88 A;  4AQY Q;  3OFN A;  1I4X A;  4K6L A;  3HOX B;  2D3N A;  1U5K A;  5C5L A;  3KBX A;  3RZO H;  1X65 A;  2D62 A;  3KL9 A;  2PMD A;  1XNQ L;  3OHX C;  2D3L A;  1RIP A;  4OO1 H;  2JK8 A;  1JOK A;  5E6T A;  3NBH B;  4E6I A;  1WD1 A;  2O5I C;  2EDG A;  2HIV A;  3PIP A;  1SE4 A;  4AYB E;  4OXP A;  3K58 A;  1TY0 A;  1BCP F;  1GR1 A;  1V1P B;  3OJW A;  2B2W A;  5D65 A;  3D4D A;  2R92 H;  3QR8 A;  5CC4 A;  4MYU A;  3WBJ A;  3ISX A;  4X7E A;  3TZU A;  1MSG A;  2XRS D;  4N3G A;  4GNX B;  1VQ6 B;  1EY5 A;  4OOS A;  1GAW A;  3FMC A;  4A3J H;  1SNC A;  3QIA A;  1ASZ A;  4WRD A;  1QG7 A;  2AHO B;  1JNY A;  2ZBU A;  1EWH A;  5HY6 A;  5AN9 A;  1AZP A;  1TWH B;  1MGS A;  2OTJ A;  1IZ6 A;  2F0W A;  2Z6K C;  2B2Y C;  2Z9H A;  1XWE A;  3K80 C;  4LBW A;  3K7A B;  1Q82 C;  4HE6 A;  1YJ9 A;  1QVF B;  3DDY A;  1DXM A;  2RDF A;  4DAM A;  3ONA B;  4BY1 B;  2K05 A;  1H8H A;  4A3E H;  3CES A;  1CA5 A;  2QE7 A;  3DXJ C;  1Q81 D;  2E5L Q;  1P4M A;  2A6H D;  4X66 L;  2OWO A;  1N33 Q;  3IKJ A;  5D3D A;  2ZJR A;  3PUY A;  1ZKO A;  3LX0 A;  2BE5 D;  4UY8 C;  4A3B G;  2KHS A;  4ALP A;  2WYR A;  3QO2 A;  4OHJ A;  3HOV G;  1PKV A;  1KC8 D;  4RCZ A;  1K8A D;  3W5O A;  1COW A;  1SE8 A;  1K9M D;  5HKK A;  3UDX A;  3HOU B;  3MTS A;  4DXF A;  1UEA B;  4YEL A;  1O7L A;  2E2I B;  3ND8 A;  2EYM A;  1YHQ B;  5C3X A;  3TDQ A;  4DAV A;  4C3H G;  1LAC A;  4IPH A;  1EQR A;  2PQE A;  1WOO A;  5DAU A;  4DFA A;  3RN5 A;  3DHQ A;  3CAM A;  2VQE L;  1NMF A;  5COY A;  1PVO A;  4G7O C;  2ZXH A;  1LTA D;  1VQ8 A;  2C5B A;  2EOT A;  4A93 H;  3K7U C;  1EZ6 A;  3OTO Q;  3PQI A;  2I5L X;  2RDH A;  4Y9U A;  2IX0 A;  3NXW A;  4DV1 Q;  2C4T A;  1VQ7 B;  4IPC A;  1K73 D;  4X0C A;  1JJG A;  3S17 B;  1FGB D;  3D4R A;  2ZTE A;  3R8B A;  5TY0 A;  3SEB A;  4KHP Q;  1X9N A;  2ENB A;  3G05 A;  4MZ9 A;  4C3J H;  4B3T Q;  2WFW A;  1NB0 A;  2F3I A;  3GVJ A;  1LO5 D;  2HLD A;  4II2 A;  4NCN A;  1CSP A;  1QOH A;  5DN6 A;  3E9H A;  2Q6O A;  2BE5 C;  1BX0 A;  4LWC A;  4IUR A;  2PYK A;  3RZD H;  5IYB H;  1HFG A;  1JC7 A;  4C3H H;  2ZIT A;  3VR6 A;  4P3Y A;  2E2J B;  4IOC A;  1CK1 A;  4GKK L;  2E76 C;  3A3B A;  2X6Y A;  3DM1 A;  5IOC A;  1HNZ L;  4J0Q A;  1WTP A;  2FX3 A;  4WJ4 A;  4B3S Q;  3S16 H;  4Y9R A;  4WJW A;  5M3M B;  3MCA A;  1QVC A;  1Z9F A;  2M9V A;  1M90 C;  1EY4 A;  3GSI A;  1R5O A;  2V7W A;  4A3M H;  1HR0 L;  4JBW A;  4UDU C;  4TRD A;  1DOM A;  1B50 A;  3S15 H;  1GO3 E;  4ZQ3 A;  2X6X A;  1VQP B;  3LWE A;  4IUT A;  2NUC A;  2IY5 B;  3MHP A;  1HZB A;  4NPS A;  4XT1 B;  1D8T A;  1EEF D;  5IYC G;  2VBT A;  2CK3 A;  3ULJ A;  5M5Y B;  4A3I G;  1IHZ A;  5LL6 X;  2JIZ A;  5IE8 A;  4DV3 L;  2CKZ B;  5C0X H;  3D8G A;  2M00 A;  2K33 A;  1EYD A;  5H1S E;  5GV7 A;  2F0O A;  4WWV A;  4DV3 Q;  4A3F G;  2XZL A;  4IUN A;  1GAQ A;  3W2H A;  2ALY B;  4UZU A;  1YI2 B;  2X85 A;  1JJ2 B;  3RY8 A;  4P2N A;  2PMZ B;  4JW0 A;  2SNS A;  3CPF A;  5L37 A;  3PCO B;  2A69 D;  2CQA A;  4DAP A;  5J35 A;  1VQM B;  2A6E C;  3RN2 A;  3GO5 A;  5J3B A;  3OKX A;  5C44 H;  1PH4 A;  1ET9 A;  1IBM L;  2F4V Q;  3J81 L;  5IGG A;  1U0L A;  4XQQ A;  1X6O A;  4G5G A;  2Q6L A;  5IYR A;  3RLO A;  5L46 A;  3T16 A;  3AEV A;  2LFN A;  4K8J A;  1KDC A;  3SKB A;  4A3F B;  2E2H H;  4XXE A;  1E24 A;  2QEX A;  4BBR H;  4GKK Q;  2OEO A;  5CV8 A;  2ZJP A;  2WKC A;  3W2D A;  4GS3 A;  4JI7 Q;  1TY2 A;  2BH8 A;  2F03 A;  1D8L A;  1L0W A;  2BPO A;  2IPK D;  1GHJ A;  4PC7 A;  2JA7 H;  1P8L A;  1WTH D;  4TSS A;  2VJI A;  5C4H A;  4A3C H;  3A8K E;  4CQJ A;  1IL8 A;  4B3T L;  4HIK A;  1NCV A;  2D9U A;  3FVQ A;  2ZL6 A;  4A3G G;  2BV3 A;  1N34 L;  4DR1 Q;  1Y14 B;  3AGP A;  1SNO A;  3GVK A;  1VQF A;  1KDA A;  3HKZ B;  3CCQ B;  4ZCK A;  2QTL A;  1ROD A;  4I7Z C;  4IN3 A;  1O7Z A;  4C0S A;  1D1I A;  3JC6 6;  4DR4 L;  3PA1 A;  4OX9 L;  1GVH A;  3KEW A;  4EQN A;  1HXY D;  5CV6 A;  3K0Y A;  2B63 G;  1OXU A;  5KW9 A;  2NTT A;  2B8F A;  1GKH A;  1NNX A;  4X66 Q;  2VW9 A;  3UDG A;  1X54 A;  1DAR A;  4GQN A;  4QCL A;  4ZUJ A;  3DWP A;  1A62 A;  4A3B H;  1VCI A;  3L0O A;  4Y7N H;  1Q12 A;  3GTO B;  4XM3 A;  2WAC A;  3GTJ H;  4IPD A;  5T1G A;  1RL2 A;  1FGU A;  5EGT A;  1FR3 A;  5I6W A;  2B2T A;  2BM0 A;  2E2H B;  4IJL A;  3SR1 A;  1J9O A;  4LAA A;  3L7Z C;  4DV2 L;  4DV5 Q;  3S24 A;  2E2I H;  4C56 C;  1V5V A;  1TT2 A;  3EN2 A;  1Q9S A;  1KK3 A;  4JI7 L;  5ISR A;  4PMB A;  3GTQ B;  4TVA B;  4QFM A;  1XX8 A;  2L0C A;  3QOL A;  3SLN A;  1O78 A;  2VQE Q;  2KVM A;  4RD0 A;  2Q8R E;  2VB2 X;  2B2W C;  3DEP A;  4JI2 Q;  1XB2 A;  3F8T A;  3CRL C;  4QIW B;  4L6T B;  3K0X A;  4A4I A;  3WDN A;  1AN8 A;  2K5D A;  3HOZ B;  1B7Y B;  5JJZ A;  3OWF A;  2YTY A;  3QE2 A;  1VQ4 A;  2FFK B;  3OW7 A;  3LWU A;  4JVZ A;  3CCM A;  4O42 A;  1IW7 D;  5C3W A;  4QV2 A;  3BZC A;  3PSI A;  4O0A A;  3K5N A;  1PDQ A;  3KYH C;  4HAE A;  1H95 A;  3J80 i;  4A3L H;  3JAM i;  5DLQ E;  1DDG A;  4GN4 B;  1G7C A;  3UDI A;  5H5J A;  2HQL A;  2MUY A;  3AYH B;  4CDF C;  5C4J B;  4DR4 Q;  4KY6 A;  4NKL A;  1N33 L;  2M5S A;  3I4N G;  2J7Z A;  2WB1 E;  1XMO L;  4N9P A;  3HKS A;  4K2K A;  1RCV D;  1A63 A;  3I4M H;  1SE2 A;  1JMC A;  3AMU A;  2MPM A;  2MHV A;  2EYL A;  3A0J A;  2F4N A;  1N34 Q;  1KK0 A;  3S2D B;  1A2U A;  1IBM Q;  1K83 H;  4H7B A;  2MO1 A;  3MHB A;  2JA5 H;  5LMN W;  3C1F A;  4A3D B;  1WTQ A;  5GQO A;  4A3I B;  4P25 A;  3QFT A;  2AQ3 B;  1N08 A;  1I6H B;  3J7A F;  4C3H B;  1WSR A;  3RZD B;  1WTO A;  2K6A A;  1WTR A;  3OEH A;  3U2Q A;  4FK8 A;  1GUW A;  3UE0 A;  5FJ8 H;  3E20 A;  4FVM A;  1OXV A;  1Y69 U;  2E8G A;  4AYB B;  1DCZ A;  2C77 A;  1STE A;  4XLE A;  3BU2 A;  5CV4 A;  3D4W A;  4YWL A;  1KHI A;  2VUM H;  3VYT A;  1Y0R A;  1MAB A;  3K6O A;  2B7B A;  1WTX A;  1HR0 W;  2R92 B;  1UE7 A;  1WDT A;  1I50 B;  3GTP B;  1CNF A;  5HZA A;  5JEA H;  3CCE A;  2ZT9 C;  4J1M A;  4RKB A;  2OTJ B;  1E7Z A;  2Q2T A;  2RHS B;  1FND A;  1BBU A;  2XWJ B;  4C43 A;  1ET6 A;  2OF1 A;  4QJF A;  1XMO Q;  1QG0 A;  4AVZ A;  4G57 A;  4JK1 C;  4DV6 Q;  2K5V A;  1QWY A;  3CHB D;  1H9S B;  3MXU A;  3NQT A;  4N8F A;  1A3V A;  2CHB D;  1BR9 A;  1HH2 P;  5A8A A;  3S1N H;  4XYO A;  1WTH A;  2F0P A;  1IXR A;  4B3R Q;  2F0J A;  3SDZ A;  4J8Q A;  1KD1 D;  3S1R B;  3HOZ H;  2OCE A;  4FN5 A;  1JJC B;  2F0E A;  1AMO A;  1H9R A;  2B2T C;  1H9S A;  1YJ9 B;  1Y0Y A;  3A56 A;  1KDB A;  3X3M A;  4DUY Q;  1UMK A;  1HUN A;  1E3X A;  2XNJ A;  1Z7T A;  3HOY H;  3GTL H;  4B43 A;  2Q2U A;  1ZM2 A;  5A2Q L;  4A3E B;  2K7V A;  5C4X B;  5HZB A;  4F8M A;  2A69 C;  1S3O A;  4OOV A;  1VQA A;  5AJ3 Q;  1CFM A;  3PF5 A;  5COR A;  1NUC A;  2VUM B;  1XNR Q;  3GVL A;  4X3S A;  1PH8 A;  1RQR A;  3I55 B;  4HCS A;  3VYU A;  5DM7 3;  2SEB D;  4HJ7 A;  1YX2 A;  2IW3 A;  2C2W A;  3CC7 A;  2YU9 B;  1UAP A;  3VNV A;  2O5J C;  4JOI C;  5CV5 A;  4DNR B;  1EY6 A;  3AFP A;  2Q8I B;  4DGZ A;  1IYU A;  4XOP A;  4FF4 A;  2ZTG A;  1HUM A;  1EFR A;  4FWT A;  1KJZ A;  2BCO A;  4Z9C B;  4Y52 H;  3H3V H;  2N49 A;  4X07 A;  4B4D A;  1XQB A;  1PTO D;  1IBL L;  3A55 A;  4RCN A;  2ZZG A;  3I55 A;  1EFW A;  4LF6 L;  3E3X A;  1WTV A;  4LUZ A;  3LGJ A;  1ZM3 A;  1HNW L;  1L0X B;  1LT3 D;  4N3N A;  1A8V A;  3N6R A;  1N0V C;  2V31 A;  4X64 L;  1DJR D;  3KF6 A;  1AE2 A;  2K75 A;  1DDI A;  3MZ5 A;  2AHO A;  3S2H B;  4CKC A;  4RD3 A;  1DGS A;  1EXM A;  3HP3 A;  3T1Y L;  4ABN A;  3M7G A;  3HOV B;  3KJP A;  2EY2 A;  5FO9 B;  2EY5 A;  4IOA A;  2X69 A;  4G6I A;  5E4X A;  2F0U A;  2L4N A;  1XNQ Q;  2HCC A;  3VYR A;  2QDL A;  3WWV A;  1A2T A;  3GP7 A;  5C6A A;  1B8A A;  1HTL D;  3FPU B;  5IYN A;  5C3E G;  4AQY L;  3CCL A;  3S16 B;  4OEM B;  1AP0 A;  5I2Y A;  4L5R C;  4OO1 I;  1W3S A;  5FLM H;  2D74 A;  1K8A C;  5CBA E;  1VQE A;  3CCL B;  3J80 L;  4OPS A;  3RD4 A;  3SK5 A;  4L5T A;  2NVT H;  1UD4 A;  3VMF A;  3PEN A;  2K04 A;  2UUC L;  1G51 A;  1ZM9 A;  2WPD A;  1M8A A;  4IFD H;  5JEA G;  2GVB A;  3R93 A;  2PO4 A;  1I7P A;  1PFB A;  3ITP A;  4HR7 B;  2L5T A;  2VQF L;  4A3D G;  3CRK C;  4I65 A;  2DNC A;  4IJH A;  1RF2 D;  4K6D A;  1QGA A;  4YWM A;  1JJ2 A;  2HDN B;  4OWT B;  4XNF A;  1EZ8 A;  1CZG A;  1PFN A;  4A3K G;  3JQR A;  2JYO A;  4QQB X;  2DET A;  3CME A;  2X8K A;  2VB3 X;  1B3Q A;  4NP5 A;  5E4W C;  4M4S A;  4YHB A;  2JA6 G;  1KTV A;  3NSW A;  4DK0 A;  4JPB W;  4RHR A;  2LZJ A;  4JI8 L;  2E74 C;  1EQQ A;  2PI2 A;  2ES2 A;  4UZF A;  3CCU A;  1NDH A;  5TV2 A;  1L2F A;  1Q46 A;  4LFC L;  2JSO A;  5GRO A;  5IT9 E;  1PLF A;  1VQB A;  1SNM A;  3MXN B;  3OE7 A;  4K1X A;  2NVY H;  3L9A X;  1KIX A;  4DR7 L;  1V9P A;  4DNI A;  1TVX A;  4F7D A;  1S5B D;  3K59 A;  1N05 A;  5GAD C;  3WYA A;  1SE3 A;  2JEA I;  4ZV4 A;  1CA6 A;  2JA7 G;  4YAO A;  1HQM C;  3QFR A;  1CI3 M;  3C1E A;  4P6Y A;  2B3G A;  2K03 A;  3AB9 A;  4KD4 A;  1SSO A;  2ZM6 L;  1JB9 A;  4JI3 L;  4OPO A;  3D26 A;  3NPP A;  2Y0S B;  3BG3 A;  1LT4 D;  3I3C A;  5TR9 A;  3PUW A;  4P2C B;  2JXM B;  1K8O A;  1LT6 D;  3KK7 A;  3C2P A;  2ZZQ A;  4JI5 Q;  3PUZ A;  4HJ5 A;  1PTO C;  1I5F A;  1K83 B;  1STG A;  1EQT A;  5IWA Q;  3T1H Q;  3AVX A;  3H09 A;  4A3M G;  1VQ7 A;  4X6A H;  5M3F B;  4XQF A;  3P1H A;  3RNU A;  4LF4 L;  1KTK A;  1W87 A;  1NRK A;  2ZL7 A;  1VS0 A;  2BM1 A;  3S2H H;  2B7C A;  2L11 A;  1BVS A;  2AWO A;  4FXU A;  1B2T A;  1BXT A;  1G2S A;  1NAP A;  3NK9 A;  3E9I A;  1FNV A;  2MGS A;  2JN9 A;  4JOI A;  1EIG A;  4A93 B;  2YWG A;  4Q0F A;  1EOT A;  4A3E G;  3U6B A;  5J1Z A;  4JBK A;  4BBS H;  1XPR A;  2ZZF A;  1Y8O B;  1D5X C;  1Q8K A;  1A15 A;  1E1R A;  3EIV A;  2UXD L;  5F2D A;  2XZP A;  2WB1 B;  1XPU A;  4LF5 Q;  1FVI A;  3B82 A;  4EH1 A;  4R8N A;  4IUU A;  4EX5 A;  1V0E A;  2O4X A;  1DON A;  1FNC A;  2FIN B;  3U4V A;  2FMC A;  4CJ1 B;  2JA9 A;  1TLL A;  3OYY A;  4UZE A;  1XMQ Q;  2UU9 L;  1EWY A;  4H44 C;  4A93 G;  2B2Y A;  3CCJ A;  2HMA A;  3Q6Q A;  3OMC A;  2PNR C;  2OTL B;  2K4K A;  2RF4 A;  3CQZ B;  3A8J E;  1ENA A;  1KZL A;  2G5D A;  3HOY B;  1TTT A;  2J7K A;  2XNA C;  4G1V A;  1L1O A;  1KD1 C;  2AQ2 B;  3MWY W;  2QEX B;  4M8A A;  1I4H A;  4LF7 L;  3AVY A;  3PUV A;  4DV7 L;  3W5H A;  1ESR A;  1EP1 B;  4YAW A;  2OK8 A;  3ZC3 A;  1WOC A;  3U58 A;  2EIF A;  4B48 A;  2NVQ H;  1ZXT A;  1YEZ A;  2K5H A;  2NV4 A;  1TII D;  1TVC A;  3NBI A;  5CV7 A;  1HZ9 A;  3BVZ A;  2IX3 A;  2F52 A;  2OBR A;  2W6I A;  1E3Z A;  4NBS A;  5BSX A;  4XDX A;  2AQ1 B;  1VLO A;  2GJP A;  3ES9 A;  1TWA H;  3T13 A;  5IGC A;  3CP2 A;  1CKN A;  2RC5 A;  3Q3A A;  2BH2 A;  1ONL A;  3H9N A;  3ZZ0 A;  4X7F A;  3CC4 B;  2OBT A;  1R4Q B;  4BBR G;  3TRZ A;  3GQB A;  2L12 A;  3GTQ H;  4Y7C A;  2WZP P;  4ACA A;  1GUO A;  1W9X A;  1B1Z A;  4JI0 Q;  1HA6 A;  1OGI A;  5CYU A;  4DXG A;  1E63 A;  3NEN A;  1F2M A;  4XLH A;  1BNZ A;  5C44 G;  3QOJ A;  3BCD A;  4TKO B;  3KLS X;  4O2D A;  1QH0 A;  3JQP A;  3E6Z X;  1FRQ A;  4ACB A;  1S5C D;  4FF3 A;  1K0S A;  5JPM C;  2Q6I A;  4ZCI A;  3CC2 A;  1E43 A;  4JI5 L;  1G6P A;  2A68 D;  1UNS A;  3M4O B;  2XGJ A;  5FNZ A;  4BBR B;  2NVX B;  4YXW A;  5GAH C;  4K0K L;  4A3F H;  4DQK A;  2ZM6 Q;  4HSP A;  4DV4 L;  2BA1 A;  1KMH A;  2EJM A;  1E1O A;  4GOP B;  3NHH A;  1VQ5 A;  3R2I A;  1STA A;  1KRS A;  3QFC A;  1ML0 D;  4HED A;  2NTS A;  4QL5 A;  4A3I H;  3Q24 A;  1IBK L;  3AVU A;  2Z6B D;  4GN3 B;  3A54 A;  4KV6 A;  1AFP A;  1G8Z D;  4B47 A;  1BMF A;  4B3R L;  1SYF A;  4P74 A;  3DWA A;  4XT3 B;  3T1H L;  2RBM A;  2L15 A;  2PZU A;  2PW7 A;  5IP9 H;  3NTK A;  4C3I B;  1WTW A;  2FJ2 A;  4RM0 A;  4LFC Q;  5JVH 3;  4A3J G;  1RTN A;  1SN8 A;  2UXB Q;  3OOC A;  5IT9 c;  1N9W A;  3TP6 A;  3MEF A;  2UXD Q;  1D7Q A;  4KN4 C;  4P75 A;  1ICF B;  4YWK A;  4JC0 A;  4RJL A;  1RJT A;  4LMQ D;  2D2C C;  5F4O A;  2F0K A;  2F0G A;  2N3S A;  4U67 3;  4G7H C;  2ASB A;  1Z47 A;  4ZAI A;  5BN3 A;  4WZK A;  1XXG A;  1U2R A;  1TS2 A;  3VR4 A;  2FXQ A;  1GXD C;  1SYB A;  4BS9 A;  4DV0 L;  1KQS B;  2LXK A;  4CDC C;  2ZXI A;  2D0O A;  4M1U B;  4KHZ A;  2PNH A;  1EOV A;  3LVB A;  5G3L D;  3ZIA A;  4LUV A;  4LBZ A;  4GZY C;  4XON A;  5FLX L;  1LM0 A;  5HUR A;  1HNX Q;  3JAM c;  4HJ8 A;  2D0P A;  3H94 A;  1U9R A;  3MVV A;  1PYS B;  5EKK A;  3GTJ B;  4PGO A;  1ILQ A;  3W1B A;  2X3U A;  3V2T A;  1VJS A;  2BF4 A;  4EQ5 A;  2R3Z A;  1AZQ A;  1ZYR C;  4XLA A;  3PIO A;  1S4Z A;  4QY7 A;  4B3M L;  4P72 A;  3S1R H;  4XQN A;  2HQE A;  2VJJ A;  1LTT D; 
#chains in the Genus database with same CATH homology
 5LL6 S;  2EJF C;  1KNE A;  3MXN A;  5KIX A;  1F2Y A;  5KNC A;  1SJH D;  3K5O A;  4RAU C;  3J80 E;  4ZKB B;  5D14 A;  2ZXO A;  1NBM A;  4R8I A;  4ULL A;  3EFX D;  4CJ2 C;  4K14 A;  5IGF A;  3D31 A;  3GTG B;  2XND A;  2ZXP A;  2NB0 A;  4PQX A;  1D5M C;  4B3F X;  3CMM A;  1LT5 D;  3NTH A;  1V0F A;  2M2L A;  4WOR A;  3SK4 A;  3A35 A;  3MFY A;  4H13 C;  4ASU A;  2A68 C;  3A7A B;  2Q8T A;  3GTM B;  1G29 1;  1W6K A;  3WOF A;  5G3L F;  1ZYR D;  1B9M A;  4S3S A;  3CP8 A;  1JB3 A;  1JCK B;  2HDL A;  2WSS A;  2W6J A;  2I46 A;  5I9P A;  2LS0 1;  4EVO A;  4CKB A;  2GK6 A;  3KLS A;  4FXG C;  2R6G A;  1M4V A;  2F0M A;  1RKN A;  1DOL A;  2KVO A;  2V4D A;  3GD7 A;  3P20 A;  2WKD A;  2N55 A;  1SYC A;  1H9M A;  2B2V C;  5CV9 A;  1EY0 A;  4A3K B;  2E1B A;  1GUN A;  1TS5 A;  2QDB A;  2WP8 J;  3EJI A;  3GV3 A;  2JA6 B;  1LTG D;  3K57 A;  3X3N A;  1G6Z A;  1EU3 A;  3FKI B;  3MA2 B;  4K5W A;  4DAY A;  2OT2 A;  2JEB I;  4G7Z C;  4FXK C;  1TR5 A;  5M5W B;  2XZO A;  2O2L D;  3Q6S A;  2YYZ A;  1D5Z C;  3QG1 A;  2KCC A;  2EYH A;  4HTH A;  2NN6 H;  2JDI A;  1EU4 A;  1UD8 A;  3S1M B;  4IAL A;  4R9W A;  5TSS A;  2F43 A;  3N52 A;  5JOB A;  4FF1 A;  3DEO A;  1TS4 A;  1VF5 C;  4XR6 A;  2ID0 A;  1CZW A;  1FNU A;  2XWB B;  4LK1 C;  1TS3 A;  4A3G B;  1H9K A;  1GOZ A;  1CQV A;  1Q1B A;  2NN6 I;  5I9O A;  4K5V A;  5DEH A;  5I2X A;  5I6Y A;  2K1B A;  2J4X A;  4DN4 M;  4C3J G;  4NDX A;  2RA4 A;  4B9W A;  1DD2 A;  1UD3 A;  2RSO A;  5T1I A;  1H8E A;  1AEX A;  3PO2 B;  1Y1V B;  1CM9 A;  4U68 A;  4XKW A;  2MP1 A;  5KYL A;  1SYE A;  2X6W A;  3FPP A;  3SK6 A;  1PFM A;  3FEW X;  2F0I A;  3C46 A;  3BZD B;  2F0N A;  2H1E A;  2IWH A;  2RQX A;  1S5E D;  5EPL A;  2F0V A;  1PXU A;  2JA5 B;  4II3 A;  1I3Q B;  5NUC A;  2PZW A;  1BPL A;  3TP8 A;  2F1M A;  3T56 B;  2RKS A;  1QNU A;  3K5M A;  3DWQ A;  1PRT B;  2B2U A;  2B39 A;  3KBG A;  1A3T A;  2SDF A;  1EYC A;  5CMD A;  3V96 A;  1J8I A;  1F9Q A;  3PIP 3;  1MBY A;  2JP1 A;  1K28 D;  1ZEQ X;  4UAI A;  4ZUI A;  4KJO A;  5I4D A;  3C3L A;  1OHH A;  1W0J A;  4B08 A;  2OXP A;  1B44 D;  3MFG A;  1HQR D;  5FOB B;  3IFT A;  4KJN A;  1SDF A;  4XN3 A;  2WJY A;  3MXG A;  1EIH A;  5ELD A;  3CKI B;  5HGT A;  4RA8 A;  5IT9 L;  2Z8L A;  4QB4 A;  1OXT A;  4FXD A;  1FX0 A;  2CVR A;  1F9P A;  1O7Y A;  3TP5 A;  1A6X A;  1VMC A;  1WCM B;  3PO3 B;  1F2L A;  4ZK9 B;  2F0S A;  5FO8 B;  4XOR A;  1AW7 A;  2QIL A;  3BDO A;  5K36 G;  1QIL A;  1OXS C;  3TME A;  2VXW A;  4Q5V A;  1G91 A;  3I73 A;  3JAM L;  3I70 A;  2ICI A;  1I4G A;  4HMI A;  5ELC A;  3WOE A;  1FYC A;  2EY6 A;  3IAY A;  2K01 A;  1E2V A;  3H6M A;  1KAA A;  4X3T A;  2EYF A;  2XVS A;  3NBH A;  1H9J A;  4N9T A;  1CTM A;  4IUQ A;  3E5S A;  2F4I A;  3OPO A;  3VR3 A;  3AU7 A;  3TZD A;  2B2U C;  4DA2 A;  1EEI D;  1LTR D;  2QEJ C;  4QF4 A;  4ZKC B;  1EY7 A;  1W6J A;  3VA5 A;  1BBX C;  4B3G A;  4XLC A;  3PMF A;  3OSO A;  2K5Q A;  4KY7 A;  3NWS A;  3H3V C;  1FD7 D;  1Q8I A;  1PYW D;  3TP7 A;  2R9V A;  2Z4H A;  4IFD G;  1VLY A;  2KUM A;  4CBV A;  3BS1 A;  5EPJ A;  2JE6 I;  4IZ8 A;  1HPC A;  3F2U A;  3G6J B;  4XN0 A;  2JA7 B;  2EY1 A;  4O1N A;  2NVQ B;  1UUP A;  1Y8P B;  1WP6 A;  3HRZ C;  4HN7 A;  1ICW A;  3OIQ A;  5C3E B;  2NN6 G;  4XD7 A;  4JMQ A;  4IQZ A;  4TQU S;  3S1Q B;  4BA1 I;  1V43 A;  1SKY B;  2J0T D;  1ILP A;  2F0T A;  1KNA A;  4OO1 G;  4HMJ A;  2BDO A;  4P22 A;  3PV0 A;  1KAB A;  2Z4I A;  3GV6 A;  2WJV A;  2KOL A;  4C3J B;  1GUG A;  1GUT A;  3S9W A;  1LTI D;  2E2D C;  1BDO A;  3OWE B;  1MD2 D;  1V1P A;  3IL8 A;  1PRT C;  2R93 B;  4DK1 A;  1QB5 D;  1BF4 A;  1SFO B;  3J7A V;  4H0L C;  5M5X B;  2XIW A;  3SXH A;  3BCF A;  3A7L A;  1SMY D;  3RLF A;  1F77 A;  2RVL A;  1PZJ D;  5D3I B;  1SYG A;  1PZK D;  2C5C A;  2LKV A;  1PRT F;  4IUV A;  3TBI B;  4C1N I;  5A35 A;  3DMU A;  2A5H A;  1JOQ A;  4CKE A;  4OIK A;  5JEA J;  4IFD J;  4ME5 A;  3E0J A;  1A3U A;  4XYQ A;  3HAG A;  3MEH A;  5KND A;  4X3U A;  2C9O A;  4QUF A;  2IT1 A;  3BDL A;  1JR0 D;  1BCP B;  1E2Z A;  1PRT D;  4PMW A;  3JU4 A;  1SXT A;  4G4K A;  1V8Q A;  3I4M B;  4XMY A;  2PZT A;  2BA0 A;  3MAQ A;  1ENF A;  2K32 A;  5M9O A;  1JE4 A;  3I91 A;  4Z1M A;  2X53 S;  1TKW B;  4RGO S;  1I4R A;  4BA2 I;  4DNT B;  1F2Z A;  2F0L A;  3I4N B;  1EY9 A;  1EYA A;  1WPC A;  4YIJ A;  1SAP A;  4XOT A;  3HGB A;  1ESF A;  2HDM A;  2PW5 A;  1E79 A;  2KED A;  1QJO A;  1LTB D;  2NVY B;  2KEC A;  1BUV T;  3H0G B;  1Y8N B;  4KN7 C;  4PNY A;  4XKV A;  4IUP A;  3SK8 A;  1PMR A;  2BDN A;  1RHP A;  2XSC A;  4KY5 A;  2MJ8 A;  3M7N A;  3QWN A;  1BCP C;  1UD2 A;  1HHV A;  1II3 A;  5K36 H;  2SNM A;  1YNN D;  2EYO A;  1IYV A;  2PPB C;  5IIF A;  4PMC A;  3PUX A;  1XYI A;  4MN3 A;  2EZV A;  5KGU A;  1I8D A;  2WAQ B;  1UD5 A;  1SBB B;  1L0Y B;  2A74 C;  1DYQ A;  1I6V C;  3GTL B;  2DY8 A;  1E1Q A;  1STN A;  4FP5 D;  5CGK A;  1T5E A;  3HEJ A;  3G7L A;  5IGE A;  1IKL A;  5FLX E;  1NR4 A;  4G7X A;  5C4Z A;  1WD0 A;  3J81 E;  2I07 B;  2B63 B;  4F87 A;  1X3P A;  1HFN A;  1XTC D;  2NZ1 D;  3I90 A;  1R9T B;  1SND A;  2ZXR A;  1BQQ T;  2EXZ A;  2ICE C;  2HUG A;  4V0B A;  5BN5 A;  4BY7 B;  1YNN C;  4RH6 A;  4RGM A;  3NP8 A;  5JVG 3;  3HZX A;  2A73 B;  2TSS A;  3W3A A;  4RGN A;  3R2T A;  2GA4 B;  5C0X I;  1RD9 D;  1UD6 A;  2K5W A;  1JOO A;  3OMG A;  3M85 A;  1W0K A;  1D1K A;  3EQL C;  5C0X G;  4XIG S;  2BOS A;  4XQJ A;  3DUZ A;  1OB0 A;  2NBF A;  4FO2 A;  4KKT A;  4FNF A;  1E0B A;  3U9S A;  2NYZ D;  5DNF A;  4RCO A;  4KKS A;  4NNJ A;  5C44 B;  2HCI A;  1CT1 D;  2KCN A;  4KD3 A;  2IL8 A;  3M3Y B;  4V19 0;  3UI2 A;  2H4O A;  2XRQ D;  5JAV A;  2CW0 D;  1LTS D;  4C2M B;  3S1N B;  4E0F A;  2LY7 A;  3HOW B;  1EQV A;  3L3O C;  5ELF A;  5K5P A;  1CHP D;  1SNP A;  4DU9 A;  4C1N K;  3OAA A;  3WQZ A;  1NR2 A;  5CBE E;  2F0Q A;  4NW2 A;  4PV1 C;  3KLR A;  5DM6 3;  3QJY A;  2RSN A;  3VR2 A;  2XN9 C;  4K2L A;  2IX1 A;  3ZYY X;  4DF7 A;  3CU7 A;  4OL7 A;  3SVM A;  5AFW A;  2L9H A;  1Q90 A;  1Q3L A;  1F9R A;  1VMP A;  2EYJ A;  1IKM A;  3T53 B;  2NWG A;  1C8C A;  2GJK A;  1GUS A;  3RZO B;  3ERO A;  5EJW A;  1SYD A;  2KEE A;  3A8I E;  1EL0 A;  5FO7 B;  1C4Q A;  4RFB A;  4L63 B;  2D5D A;  1R4P B;  2G9D A;  1PZI D;  3BC9 A;  4QMG A;  3T51 B;  3FKS A;  5J22 A;  5IK2 A;  2WV6 D;  5ELE A;  1LAB A;  3SHL A;  1T5X D;  1STH A;  5ELB A;  1EFI D;  2KJX A;  1TQO A;  3TSS A;  1JWU D;  2AUJ D;  4CGY B;  3S14 B;  3D6W A;  2WIN B;  3KF8 A;  4X3K A;  2ZZE A;  4CJ0 B;  4FF2 A;  4ID6 A;  4QUC A;  3ZPN A;  1V1O A;  3S15 B;  1K8M A;  4XTC S;  3MXP A;  3IFD A;  3A3G A;  5E1F A;  1HA5 A;  1BCP D;  2FMM A;  3Q0A A;  1RDP D;  1G2T A;  3D6C A;  4TSF A;  3MC0 B;  2CW0 C;  4OIJ A;  2GK7 A;  3D3R A;  4NMZ A;  1MI2 A;  1JWS D;  1CHQ D;  1WVL A;  1I4Q A;  2E75 C;  1NSN S;  2B2V A;  2F0F A;  1HTP A;  1TWC B;  3P75 A;  1KLU D;  1LLR D;  4ILW A;  4FYD A;  3H91 A;  1YNJ C;  3HG9 A;  4RWS C;  4KI0 A;  1JOR A;  2F0H A;  4ZRZ A;  3NQI A;  1I18 A;  3NE5 B;  2L55 A;  3TN2 A;  1PTO B;  4B9X A;  4G7W A;  1JWM D;  1SMY C;  4IFD I;  2DIE A;  3KUP A;  4HIZ A;  1SEB D;  3BDC A;  5FKA C;  2JA8 B;  4RKL A;  3ERQ A;  4Y7N B;  4HCE A;  5EPK A;  1QNK A;  4OGQ C;  1GJX A;  2LMC B;  1OXX K;  2F3W A;  2R61 A;  1KLG D;  5KNL A;  1HZE A;  3SE0 A;  1DOK A;  1BO0 A;  2KQ3 A;  5BN4 A;  5CDF A;  5KEE A;  4EQP A;  1YNJ D;  5KYI A;  2EE1 A;  4YEJ A;  2AWN A;  4L8J A;  1D6E C;  1Y1W B;  3PIO 3;  2A6E D;  4CHT B;  4MHE A;  3QB3 A;  2SOB A;  2FHT A;  3R3O A;  3FRP B;  1B3A A;  2G9H D;  5EQ0 A;  3Q23 A;  3OIP A;  1JIC A;  2DY7 A;  3JAM E;  1B53 A;  1B9N A;  4EQO A;  2XOK A;  5IGB A;  2NVT B;  3J7Y W;  1ENC A;  4A3M B;  1GHK A;  4LJZ C;  1VDZ A;  2EYP A;  2N88 A;  4ZLT F;  4F7X A;  3VYS A;  2AUK A;  1LV9 A;  1BLI A;  1EWC A;  3O13 A;  3NWT A;  2B8G A;  1RTO A;  2PCF B;  2GJR A;  1PTO H;  1Z6H A;  4BWG B;  3BVG A;  3HS0 C;  3M4Y A;  3VA7 A;  3T4A C;  5E3F A;  4KK7 A;  5EBC A;  4KTA A;  2JJ2 A;  1SNQ A;  1STY A;  1SJE D;  1HCZ A;  1Q1E A;  1TU2 B;  3RUZ A;  2TMP A;  2EPB A;  3I72 A;  4ODG A;  5EKL A;  1U4R A;  2F0D A;  2QCP X;  1MSH A;  5FK9 C;  3LNN A;  1C48 A;  1U4M A;  1U4L A;  2IJ0 A;  4KHV A;  2F3V A;  2JJ1 A;  4XLF A;  3OEE A;  1BOS A;  3EVQ A;  5KNB A;  2ZTN A;  1IW7 C;  4RHS A;  3EA6 A;  4A3B B;  1B4O A;  3BH4 A;  4MIU A;  2DNE A;  4EGV A;  3BVM A;  5LHY 1;  3URY A;  2V7Q A;  3K5L A;  5IOD A;  3I8Z A;  5A2Q E;  4BBS B;  5C0X J;  1U4P A;  5JPN C;  3FDT A;  1HRJ A;  1X3Q A;  1S5F D;  4KMU C;  1X32 A;  2DN8 A;  5J39 A;  2QF7 A;  5EBD A;  1S5D D;  3NUC A;  1STB A;  2R7Z B;  4KKU A;  4ZYS A;  3NTI A;  4WFN 3;  5KRU A;  1JQY D;  3V05 A;  1DZ1 A;  3VR5 A;  3GTK B;  1O80 A;  1OO9 B;  3ND9 A;  1QCB D;  5IGD A;  3Q22 A;  2KA7 A;  1QE6 A;  3RMH A;  1HVX A;  4J6H A;  4C3I G;  4RGT A;  4HSV A;  1FNW A;  2Z1C A;  2VNU D;  5CR3 A;  1PTO F;  1VF7 A;  1TWF B;  2RDG A;  4XL9 A;  3U9O A;  5C5M A;  2EJG C;  4K8I A;  2X6L A;  4K5X A;  4A3J B;  2EVB A;  5FL7 A;  2K28 A;  3BYY B;  2QKI C;  1I4P A;  5EKI A;  4TT3 A;  1TWA B;  1TWG B;  1D2B A;  2WII B;  3I4L A;  2L1B A;  1F9S A;  1CQF A;  1DM0 B;  2X6G A;  1E2W A;  3P7J A;  2A6H C;  3BYT B;  1EY8 A;  4F88 A;  3HOX B;  1I4X A;  3OFN A;  4K6L A;  2D3N A;  5C5L A;  3KBX A;  2D62 A;  3OHX C;  2D3L A;  4OO1 H;  1JOK A;  4E6I A;  1WD1 A;  2O5I C;  2EDG A;  1SE4 A;  3K58 A;  1TY0 A;  1BCP F;  1V1P B;  5D65 A;  2B2W A;  3D4D A;  5CC4 A;  3TZU A;  1MSG A;  2XRS D;  1EY5 A;  3FMC A;  1SNC A;  3QIA A;  4WRD A;  1QG7 A;  1EWH A;  1AZP A;  1TWH B;  1MGS A;  2F0W A;  2B2Y C;  1XWE A;  3K7A B;  3DDY A;  1DXM A;  2RDF A;  3ONA B;  4BY1 B;  2K05 A;  1H8H A;  3CES A;  1CA5 A;  2QE7 A;  3DXJ C;  2A6H D;  3IKJ A;  5D3D A;  3PUY A;  1ZKO A;  3LX0 A;  2BE5 D;  2KHS A;  3QO2 A;  4OHJ A;  1PKV A;  1COW A;  5HKK A;  3HOU B;  3MTS A;  4DXF A;  1UEA B;  4YEL A;  1O7L A;  2E2I B;  3ND8 A;  2EYM A;  5C3X A;  3TDQ A;  4DAV A;  4C3H G;  1LAC A;  2PQE A;  5DAU A;  4DFA A;  3DHQ A;  5COY A;  4G7O C;  2ZXH A;  1LTA D;  2EOT A;  1EZ6 A;  2RDH A;  2IX0 A;  3NXW A;  3S17 B;  1FGB D;  3D4R A;  3R8B A;  3SEB A;  2ENB A;  3G05 A;  3GVJ A;  1LO5 D;  2HLD A;  4II2 A;  1QOH A;  5DN6 A;  2BE5 C;  4IUR A;  2PYK A;  1HFG A;  1JC7 A;  3VR6 A;  2E2J B;  1CK1 A;  2E76 C;  3A3B A;  2X6Y A;  3DM1 A;  5IOC A;  1WTP A;  4WJW A;  5M3M B;  2M9V A;  1EY4 A;  4JBW A;  4UDU C;  4TRD A;  1DOM A;  1B50 A;  4ZQ3 A;  2X6X A;  3LWE A;  4IUT A;  2NUC A;  4XT1 B;  1EEF D;  2CK3 A;  5M5Y B;  1IHZ A;  5LL6 X;  2JIZ A;  5C0X H;  3D8G A;  2M00 A;  2K33 A;  1EYD A;  2F0O A;  2XZL A;  4IUN A;  4UZU A;  2X85 A;  2PMZ B;  2SNS A;  2A69 D;  2CQA A;  4DAP A;  2A6E C;  3GO5 A;  1ET9 A;  3J81 L;  5IGG A;  4XQQ A;  3T16 A;  2LFN A;  4K8J A;  1KDC A;  4A3F B;  4XXE A;  2OEO A;  5CV8 A;  2WKC A;  3W2D A;  1TY2 A;  2F03 A;  2IPK D;  1GHJ A;  1WTH D;  4TSS A;  2VJI A;  5C4H A;  3A8K E;  1IL8 A;  1NCV A;  2D9U A;  3FVQ A;  1SNO A;  3GVK A;  1KDA A;  3HKZ B;  1ROD A;  4I7Z C;  4IN3 A;  1O7Z A;  1D1I A;  3KEW A;  4EQN A;  1HXY D;  5CV6 A;  3K0Y A;  1OXU A;  2NTT A;  2B8F A;  4QCL A;  4GQN A;  4ZUJ A;  3DWP A;  1VCI A;  1Q12 A;  3GTO B;  4XM3 A;  2WAC A;  5T1G A;  5EGT A;  1FR3 A;  5I6W A;  2B2T A;  2E2H B;  3SR1 A;  1J9O A;  4LAA A;  3L7Z C;  4C56 C;  1TT2 A;  5ISR A;  4PMB A;  3GTQ B;  1XX8 A;  2L0C A;  3QOL A;  1O78 A;  2KVM A;  2Q8R E;  2VB2 X;  3DEP A;  2B2W C;  3CRL C;  4QIW B;  4L6T B;  3WDN A;  1AN8 A;  2K5D A;  3HOZ B;  5JJZ A;  3OWF A;  2FFK B;  3OW7 A;  3LWU A;  4O42 A;  1IW7 D;  5C3W A;  3K5N A;  1PDQ A;  4HAE A;  2MUY A;  5C4J B;  4KY6 A;  4NKL A;  2M5S A;  2J7Z A;  4N9P A;  4K2K A;  1RCV D;  1SE2 A;  3AMU A;  2MPM A;  2MHV A;  2EYL A;  3S2D B;  1A2U A;  4H7B A;  3MHB A;  4A3D B;  3C1F A;  1WTQ A;  4A3I B;  2AQ3 B;  1I6H B;  3J7A F;  4C3H B;  3RZD B;  1WTO A;  2K6A A;  1WTR A;  3OEH A;  1GUW A;  4FVM A;  1OXV A;  1Y69 U;  4AYB B;  1DCZ A;  1STE A;  5CV4 A;  4XLE A;  3D4W A;  3VYT A;  1MAB A;  3K6O A;  1WTX A;  2R92 B;  1I50 B;  3GTP B;  5JEA H;  2ZT9 C;  4J1M A;  4RKB A;  2XWJ B;  1ET6 A;  2OF1 A;  4AVZ A;  4G57 A;  4JK1 C;  1QWY A;  3CHB D;  1H9S B;  3MXU A;  3NQT A;  1A3V A;  2CHB D;  1BR9 A;  4XYO A;  2F0P A;  2F0J A;  3SDZ A;  4J8Q A;  3S1R B;  2F0E A;  1H9R A;  2B2T C;  1H9S A;  3A56 A;  1KDB A;  3X3M A;  1HUN A;  1E3X A;  1Z7T A;  5A2Q L;  4A3E B;  2K7V A;  5C4X B;  4F8M A;  2A69 C;  1CFM A;  5COR A;  1NUC A;  2VUM B;  3GVL A;  4X3S A;  4HCS A;  3VYU A;  5DM7 3;  2SEB D;  2IW3 A;  2YU9 B;  1UAP A;  2O5J C;  5CV5 A;  4DNR B;  1EY6 A;  2Q8I B;  4DGZ A;  1IYU A;  4XOP A;  4FF4 A;  2ZTG A;  1HUM A;  1EFR A;  2BCO A;  4Z9C B;  1PTO D;  3A55 A;  4RCN A;  2ZZG A;  1WTV A;  1L0X B;  1LT3 D;  3N6R A;  2V31 A;  1DJR D;  3MZ5 A;  3S2H B;  4CKC A;  3HP3 A;  4ABN A;  3M7G A;  3HOV B;  2EY2 A;  5FO9 B;  2EY5 A;  2X69 A;  5E4X A;  4G6I A;  2F0U A;  2L4N A;  2HCC A;  3VYR A;  1A2T A;  3GP7 A;  5C6A A;  1HTL D;  3FPU B;  3S16 B;  1AP0 A;  5I2Y A;  4OO1 I;  5CBA E;  3J80 L;  3RD4 A;  3SK5 A;  1UD4 A;  2K04 A;  2WPD A;  1M8A A;  4IFD H;  5JEA G;  3R93 A;  2PO4 A;  1PFB A;  3ITP A;  4HR7 B;  2L5T A;  3CRK C;  4I65 A;  2DNC A;  1RF2 D;  4K6D A;  4XNF A;  1EZ8 A;  1CZG A;  1PFN A;  2JYO A;  2X8K A;  2VB3 X;  4NP5 A;  5E4W C;  3NSW A;  4DK0 A;  4RHR A;  2LZJ A;  2E74 C;  2JSO A;  5IT9 E;  1PLF A;  1SNM A;  3OE7 A;  3L9A X;  1TVX A;  1S5B D;  3K59 A;  1SE3 A;  2JEA I;  1CA6 A;  1HQM C;  1CI3 M;  3C1E A;  3AB9 A;  2K03 A;  4KD4 A;  1SSO A;  3NPP A;  2Y0S B;  3BG3 A;  1LT4 D;  3I3C A;  3PUW A;  4P2C B;  2JXM B;  1K8O A;  1LT6 D;  3KK7 A;  3C2P A;  2ZZQ A;  3PUZ A;  1PTO C;  1STG A;  1K83 B;  1EQT A;  3H09 A;  5M3F B;  4XQF A;  3P1H A;  1KTK A;  1NRK A;  2L11 A;  2AWO A;  4FXU A;  1B2T A;  1BXT A;  1G2S A;  1NAP A;  3NK9 A;  1FNV A;  2MGS A;  1EIG A;  4A93 B;  4Q0F A;  1EOT A;  5J1Z A;  2ZZF A;  1Y8O B;  1D5X C;  1A15 A;  1E1R A;  5F2D A;  2XZP A;  2WB1 B;  4R8N A;  4IUU A;  1V0E A;  2O4X A;  1DON A;  2FIN B;  2FMC A;  4CJ1 B;  4H44 C;  2B2Y A;  3OMC A;  2PNR C;  3CQZ B;  3A8J E;  1ENA A;  1KZL A;  3HOY B;  2XNA C;  2AQ2 B;  3MWY W;  4M8A A;  1I4H A;  3PUV A;  1ESR A;  1ZXT A;  1TII D;  3NBI A;  5CV7 A;  3BVZ A;  2IX3 A;  2W6I A;  1E3Z A;  4XDX A;  2AQ1 B;  2GJP A;  5IGC A;  3T13 A;  3CP2 A;  1ONL A;  1R4Q B;  3GQB A;  2L12 A;  2WZP P;  1GUO A;  1W9X A;  1B1Z A;  1HA6 A;  5CYU A;  4DXG A;  1F2M A;  4XLH A;  1BNZ A;  3QOJ A;  3BCD A;  4TKO B;  3KLS X;  3E6Z X;  1S5C D;  4FF3 A;  5JPM C;  1E43 A;  2A68 D;  1UNS A;  3M4O B;  2XGJ A;  4BBR B;  2NVX B;  4YXW A;  4HSP A;  2BA1 A;  1KMH A;  2EJM A;  3NHH A;  3R2I A;  1STA A;  1ML0 D;  4HED A;  2NTS A;  3Q24 A;  2Z6B D;  3A54 A;  4KV6 A;  1AFP A;  1G8Z D;  1BMF A;  1SYF A;  3DWA A;  4XT3 B;  2RBM A;  2PZU A;  2PW7 A;  3NTK A;  4C3I B;  1WTW A;  2FJ2 A;  5JVH 3;  1RTN A;  3OOC A;  3TP6 A;  4KN4 C;  1RJT A;  4LMQ D;  2D2C C;  2F0K A;  2F0G A;  4U67 3;  4G7H C;  1Z47 A;  4ZAI A;  5BN3 A;  1XXG A;  1TS2 A;  3VR4 A;  4BS9 A;  1GXD C;  1SYB A;  2ZXI A;  4M1U B;  4KHZ A;  5G3L D;  3ZIA A;  4GZY C;  4XON A;  5FLX L;  5HUR A;  3H94 A;  1U9R A;  3MVV A;  5EKK A;  3GTJ B;  1ILQ A;  3V2T A;  1VJS A;  1AZQ A;  2R3Z A;  1ZYR C;  4XLA A;  1S4Z A;  4XQN A;  2HQE A;  2VJJ A;  1LTT D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...