3FPPA

Crystal structure of e.coli maca
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
266
structure length
266
Chain Sequence
PGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTQAVSQQDLDNAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPGQKAWFTVLGDQLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the periplasmic component of a tripartite macrolide-specific efflux pump
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Macrolide-specific efflux protein macA
total genus 52
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3fppA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fppA02
4GZYC 3VA7A 5K36G 2AUKA 2E74C 2LMCB 1O7LA 3T56B 3T53B 3LWUA 1GUGA 4XIGS 4G7OC 3A8JE 1B9MA 2BE5C 3I73A 1HTPA 4KKTA 3BG3A 2E76C 1E2VA 4DNTB 1H9JA 1PMRA 3OOCA 4JBWA 1GJXA 1T5EA 1OXVA 2BDOA 2Q8IB 4TKOB 1YNNC 1VCIA 2PCFB 1VF7A 3BDOA 1B9NA 2KA7A 2D5DA 2AUJD 4DNRB 1H9SA 3I4LA 1DD2A 4XTCS 1OXUA 3PUXA 4LJZC 2PPBC 2V4DA 4G7ZC 4KI0A 3PUVA 1VF5C 4H13C 1GUSA 3GD7A 1Q1EA 1TKWB 3ND9A 3M85A 4RCNA 4BA2I 3OPOA 4KKUA 1I6VC 2R6GA 1Y8PB 4H0LC 4KHZA 2BA1A 3A8IE 1G291 2DN8A 2EVBA 1GUOA 1ONLA 2E75C 2D2CC 5BN4A 2A68C 4L8JA 3VR6A 1K8MA 1OXTA 3PUWA 4HR7B 4KKSA 3CRLC 3VR4A 2JXMB 1IW7C 1HQMC 2K7VA 1O78A 4OGQC 3U9SA 2BA0A 2A6EC 3D31A 3MXUA 2QF7A 4I7ZC 3VR2A 1Z7TA 1YNJC 3QG1A 2A69C 4IQZA 1E2WA 1TU2B 1LACA 2EJGC 3IKJA 4G7HC 3N6RA 1Q90A 1Y69U 3RLFA 1ZKOA 5JEAG 1IYUA 5C0XH 4OO1H 2A6HC 1H9RA 1H9SB 5BN5A 1K8OA 1A6XA 3D4RA 1DCZA 2IT1A 3A7LA 3TZUA 1FYCA 2A6HD 3KLRA 2KCCA 1Y8NB 4TQUS 3MFYA 2B8GA 4LK1C 3VR3A 2EJFC 1H9KA 3PV0A 5K36H 1IW7D 2JEAI 2AWOA 3SDZA 1CTMA 2A6ED 4KN7C 1V8QA 2DNEA 5KNBA 1OXXK 3H94A 1SMYC 4KMUC 2CW0C 5JEAH 4DK0A 3M7NA 1OXSC 3M4YA 4BA1I 1EWHA 3ND8A 3A7AB 2L5TA 3W3AA 4JK1C 2K33A 2D62A 1BDOA 2NN6H 1FR3A 2B8FA 3QIAA 1VDZA 2ZT9C 1GHKA 1HCZA 2NN6G 3PUYA 3IFTA 2A69D 2DNCA 3PUZA 4H44C 1GUNA 4IFDH 2NN6I 1H9MA 5C0XG 4OO1G 4DK1A 3FMCA 2EJMA 1IYVA 1Y8OB 4KN4C 3T51B 3A8KE 4IFDG 2EDGA 2O5IC 3CRKC 1DXMA 3GQBA 2JE6I 1E2ZA 3P20A 1GUTA 1V43A 3OW7A 1GHJA 2F1MA 2BE5D 2A68D 3NE5B 5KNDA 2YYZA 3HGBA 5BN3A 3DXJC 3WDNA 3AB9A 3L7ZC 3VR5A 1Q12A 1QJOA 4PV1C 2PNRC 1CFMA 2JEBI 1Q1BA 5A35A 5KNCA 3FPPA 2O5JC 3LNNA 1HPCA 3QJYA 3I72A 3EQLC 2K32A 1ZYRC 1CI3M 1LABA 1Z6HA 3SE0A
chains in the Genus database with same CATH superfamily
2F1LA 3MAQA 5IGGA 2RQXA 4DR3Q 1E62A 4BY7H 1CUKA 5IWAQ 4O42A 4HCSA 1A15A 1PXUA 5IT9L 4JMQA 5IE8A 2JA5H 3C1FA 1G6ZA 2H5XA 2PE3A 1JOOA 1LV9A 3TP7A 3QFRA 2NWGA 5GQOA 3BVGA 1OXVA 4DV6L 2RHSB 2BM0A 5C3WA 4OONA 4U673 5IYPA 3PUXA 1VHOA 4UP8A 2PPBC 4L5SA 3J80L 1AH9A 3PUVA 4PMBA 1D6EC 1FNCA 3V76A 5C3EG 2F0GA 2L11A 1LTAD 4A3FB 1Q86D 3I70A 1I6VC 3GTKB 2FMMA 3PF5A 1A2UA 3UI2A 1EUJA 2V7UA 3L0OA 4LC0A 2HCJB 4ZGQB 3KJOA 3CC2A 3UDIA 1G2SA 3CRLC 3CCLA 1RIPA 1DZ1A 1YNXA 1CA6A 3K57A 2K7VA 2MNAA 4N8X1 4DR5L 1S0UA 4HTHA 1KNEA 1E24A 2KBNA 1Y1WG 3A8KA 1L1OB 2ZZEA 4IUUA 2PIAA 4NXMQ 2WYRA 3L9AX 3Q23A 3LGJA 2HQEA 5DSZA 4DV0L 5E7NA 3I56A 3BYTB 1FX0A 2B63H 4QB4A 2V1CC 1QB5D 3M3YB 3TDQA 3KLWA 3VO2A 1Y8NB 2DCUA 2VS1A 2WACA 3MFYA 2PNHA 1MSHA 3QFSA 1PRTF 1IW7D 3V96A 1WSRA 3IFDA 1SJED 3LQ6A 4WJ4A 4NNJA 4RA8A 4EQ5A 1SFOH 4Y7CA 5JJIA 3MHPA 1TWCH 4X3TA 2P5ZX 1ZEQX 4YALA 4LF5L 1ET6A 1EU3A 3F1ZA 5EBDA 1R9TB 1PFSA 4R8NA 4P75A 2A69D 4DV4Q 3D8GA 2OK8A 1H8HA 4XR6A 1I4RA 1JMCA 1NY4A 4KN4C 1J5EL 4HEDA 3GQBA 4CDCC 2JE6I 4TT3A 1E2ZA 1K3RA 1GXDC 1MI2A 2IJ0A 3D3RA 2ZM6L 4V190 1NUCA 1GHJA 2ALYB 2HD3A 2K5NA 1NBWA 1IHMA 2E2IH 2Q6OA 2MQHA 4G4KA 3QOJA 2JJ2A 3FPPA 3U4VA 3LNNA 4MYTA 4U68A 4UY8C 3M3YH 3EQLC 4UPAA 1CI3M 1QVCA 1PTOD 3TEHB 5M5WB 3I4MH 1V1PB 4XORA 1N33L 2BN4A 2AUKA 2HMAA 4ODGA 4A3KG 1U4LA 2EYOA 1VQ7A 4L5QA 4WJWA 5IGEA 3A8JE 4AC9A 1VQDA 3FHWA 4DN4M 1PFMA 4HIKA 1EYDA 4A3GG 2E76C 4JI3Q 5T1GA 4FP5D 4ID6A 1IYJB 1VQOA 2BDOA 4TKOB 1QX4A 1W9XA 4LF9Q 1CSPA 3ER0A 4DNRB 2B39A 1HVXA 4FWTA 4GQNA 3PO2G 2DOGA 3OSOA 2JA6G 2V7TA 2XNJA 3S2DH 3PCOB 3SK4A 4RM0A 3SVMA 4ZCKA 2QTZA 5M3FH 5BSXA 1GUWA 2EIXA 4K8JA 4UAJA 1TLLA 3HOVB 3A8IE 1CHPD 3OP1A 2WB1G 3DM1A 1PHJA 4AQYQ 5HZAA 5TR9A 2D2CC 2LY7A 4C3IH 4A3MH 4L8JA 3MEFA 3CCQA 2ZBUA 1QVGB 1B8AA 1QUEA 2HQLA 1MSGA 2WAQG 4A4IA 5GAGC 1PZID 5L46A 3D31A 4MN3A 1EEID 4GOPC 3E1YE 3OMGA 1E2WA 2B2VC 2WAQE 4JI4Q 1Q90A 2QTLA 3D4WA 3GVJA 1K8OA 1VQJA 1M4VA 3LO8A 1FGBD 2KQ3A 3G6JB 4A3LG 2MHVA 2R3ZA 1E3ZA 3CP0A 1TWFB 2QKIC 2BM1A 4K6LA 2HUGA 2JDIA 2ENBA 1PFNA 3P75A 3BVZA 5C3XA 2ZZQA 2F4NA 3W2EA 1B70B 3FEWX 4DR5Q 1C0AA 1S72B 2J4XA 1CKNB 4XLCA 3CB4A 1HXYD 1WYDA 4A3FH 2V31A 2Z0SA 4ABNA 1CSQA 4X3KA 3S2HB 4AF7A 2UU9L 4NXML 4HCEA 5I9PA 1I4PA 4GKKL 1ML0D 4YWMA 3S1MB 5C4HA 2R7DA 3E0EA 5I4DA 1KRTA 1NR2A 4A3GB 5IYCG 2EE1A 4GN3B 3GP7A 4DFAA 4NCNA 4X66Q 2EYFA 2BH8A 1DJRD 3DWAA 4G1VA 1SE8A 1JWMD 4B9XA 4QY7A 4UDUC 1GAQA 3VYUA 3V05A 1E7ZA 1DXMA 1KDAA 2Y0SE 1GUTA 2RBMA 3NE5B 3PA1A 2XZLA 3BZKA 5FO7B 2GQFA 1X3PA 1EP2B 3FKIG 2X8KA 4N3GA 3Q0AA 1L0XB 3SEJA 5EKIA 3CMAB 4OL7A 5F4JA 2IHEA 1UD6A 4DUYL 1BCPD 3RUZA 4IPGA 2XIWA 5K36G 1YJWB 2E74C 2I0QA 2F52A 1IL8A 5IGDA 1B2TA 2NVTH 2L55A 4N9PA 1M1KD 3I90A 3WNDA 1K9MC 4Z4RA 1KL9A 3NBHA 5IGBA 4RJLA 3IAYA 2D9RA 1GOZA 1UD4A 2VBUA 1TUIA 3WNCA 2J7ZA 3CC4B 1JJ2A 4A3GH 4A3DH 4X62L 1G8ZD 2PQEA 3KBXA 1XFOA 1E64A 1JA1A 3T1HL 1YHAA 2A74C 1SNDA 1A8VA 1XTDA 2PO4A 2B29A 3PO2H 3HOZB 1GUSA 2R93H 3QFCA 4AQYL 5FOBB 2GJPA 4H0LC 4PGOA 1B4OA 2SNMA 4KHZA 2TMPA 2Q2UA 5LL6S 4QIWB 4HJ8A 1ZM2A 3A35A 3B82A 3E3XA 1IKMA 1GJRA 2AQ1B 1O7IA 1KK3A 3A0JA 4CKCA 4HR7B 2F3IA 2MO0A 4RD3A 1X32A 2VB3X 3B8HA 2DIEA 1ICFB 2A6EC 3AQQA 3DEOA 3ZBTA 5EKLA 3QO2A 1I4QA 2EY5A 4YHHQ 1I94L 1G6PA 3VNVA 1STNA 2OQKA 1WDTA 3NPPA 4R4TA 3S16H 3Q3AA 1IBKL 1H9SB 2CWAA 1HJPA 1NDHA 1HFNA 1U2RA 2EOTA 4RGNA 1N36Q 2KVMA 4XD7A 3C2PA 1WORA 2YTXA 1D5MC 4LUZA 4X3UA 2EQSA 3J80c 2AWOA 1S5CD 3RN2A 4FXUA 4XLFA 3EBEA 1KK1A 2ZXOA 3OAAA 1EIGA 2QA4A 1SMYC 4K0KL 5KIXA 3FP9A 2FX3A 2WJVA 1RQPA 4P1VA 1F2YA 2XNDA 3Q22A 2EYMA 4XQQA 1R5OA 4L5RC 1VDZA 2ZT9C 1HCZA 3K5LA 2DNCA 3PUZA 3U6BA 1JB3A 1V9PA 2XEXA 4B3ML 4L63B 3TZDA 2E2HH 4B3RQ 2ICEC 2HIXA 2EDGA 3H9NA 1Q46A 4BPRA 4OOSA 5IP9G 3OW7A 2EFGA 2ZJQA 5KNDA 1N0UA 4RGMA 5M5WH 3J81k 5IK2A 2JA8G 5AFWA 3SK6A 1QH0A 4YXWA 1D8TA 4C2MH 3I1FA 2CK3A 3ASTA 3Q39A 5GV7A 1CFMA 3CCUA 5E3FA 5JOBA 4YCUA 1BPLA 2A5HA 1WOPA 1SR3A 2CVRA 2L1BA 4R4IA 4YAFA 4YY3L 2AQ3B 2RSOA 3QE2A 1YHBA 1JE4A 1RL2A 5ELDA 5CBEE 1WPCA 4II2A 4QV2A 2WB1B 3EFXD 1EYGA 3I4MB 4LFBL 1E43A 1XNQQ 1YI2B 3A56A 1VQ5A 1D5XC 4DR4Q 1VQ8A 1QFYA 4DNTB 5IYNA 5CV4A 4DR6Q 1VQ9B 5JAVA 1JWSD 1K28D 1GAWA 4RDLA 4M8AA 3I4NH 3GV6A 3S17H 2RCNA 1XPRA 2VQFL 4A3EG 3TP5A 3AVXA 4AIMA 1NB0A 1Q7YD 2NB0A 4OWXB 3HOVH 1AZPA 3D0FA 3K59A 2I46A 1BQQT 5DAUA 4LJZC 2V4DA 3BQJA 2M00A 4G7ZC 1K73C 3G7LA 2K04A 2VL6A 3FKSA 3MA2B 4K5VA 1BBUA 3ND9A 1V1QA 3I55A 1P8LA 4B4DA 4RGTA 4KKUA 3CPWB 4IJLA 2MPMA 4C3IG 4DNIA 3AVVA 1KDCA 4GLAC 3ES9A 1NJIC 1GUOA 1KD1D 4TMVA 2B2YC 2QW7A 3NWTA 3TSSA 5BN4A 1WOSA 3M4PA 3K7AH 2G5DA 4CDDC 1HQMC 1X6OA 2PQAA 2RCFA 3U9SA 4H7BA 3ZZTA 1V0EA 1Z7TA 1WSVA 1TY2A 4G7HC 3IKJA 2BGJA 4DV2L 1YHQA 3HOUH 1STBA 4P2NA 5C0XH 4LF7Q 2YU9H 4MTNA 1WD0A 1A6XA 2OCEA 3U58A 2B2TC 3A7LA 5E4WC 3CESA 2CF4A 1B3AA 2A6HD 1H95A 4IUVA 4C56C 1SMYD 4JI0Q 1HA3A 5LMUL 1EIHA 3S1QB 4WZTA 4QL5A 5BR8Q 1E22A 2A6ED 4QVJA 1EWYA 4DAMA 1PYSB 4Z4SA 1Z47A 4AYBG 3RR5A 5JEAH 1TS2A 1VQNB 2CW0C 3IL8A 4LFBQ 3M4YA 1TWGB 2C5CA 3UDFA 1TQOA 2L5TA 1STGA 2PYKA 5C44B 1FL0A 2GN5A 4LFCL 4Z4ZA 3T1YQ 2NN6G 1VQFA 4X0CA 5IODA 1KJZA 4JVZA 4R71A 4H44C 1WTVA 2ICIA 3HFZB 1IYVA 4G7WA 3R2TA 1G91A 1VQLB 1J6QA 5FJ8H 4LW1A 2D9UA 1DOLA 2JQOA 3VDYA 2JA8H 4QF4A 3NTIA 3SGIA 4GOPB 2WZNA 3RNUA 4RLZA 2B5OA 4Q5VA 1MD2D 4Y7NB 4JBKA 1Q12A 4BY1G 4LBVA 1WU8A 3U9OA 1SRUA 5A35A 5IT9c 1N36L 4DV5L 3G71A 4KLKA 3VA5A 4B48A 4G1BA 4QGUA 4IPDA 2YWEA 4HMJA 5FLMH 3GTMB 5CBAE 2XNCA 3K81C 1EOVA 4P2CB 1EYAA 2ZTNA 4Z4VA 2B2YA 1N33Q 2XWJB 5F2DA 4DR3L 4EQNA 4ACBA 2XGTA 4A3FG 1HNXL 2X6YA 5C3EB 3BZCA 4XYOA 5A2QE 4PAAA 3S1QH 4O0AA 4HJAA 4ZCMA 1QE6A 5JJLA 1I4XA 4X7FA 1VQ6B 3QB3A 1CKMA 4OX9Q 1H8EA 2X69A 2KHJA 2GVBA 5CV5A 3V7AA 1PH9A 1FRNA 5TY0A 1W0JA 1HZBA 1Q1EA 2DY8A 5HY6A 2JA8B 4TMWA 2CFMA 2WB1E 2HDLA 3PIP3 2BH2A 4KHPL 1Y8PB 4LFCQ 1N06A 1TWHB 1NB9A 1KNAA 4OIJA 2EVBA 3ISXA 4FNFA 2OTJB 1FVIA 2CWPA 4FVMA 1RCVD 2NUCA 3TRZA 4DV4L 4BBSH 4K1XA 1EU4A 2AWNA 3CCMB 4P71A 1P16A 4G7XA 3SLNA 1SSOA 2CH4A 5C4XG 1BJKA 2KUMA 1E3XA 3K5MA 3JC66 2QF7A 4DAPA 1XMOQ 2VQEL 4ZQ3A 3P7JA 3QG1A 4ZKBB 1XQBA 2YWGA 4C3JB 2HCIA 3ZPNA 4O1NA 1DOMA 2I5HA 3DM3A 3H0GH 1CK1A 3HKZE 1Q86C 1F20A 1B3QA 1W6KA 2WP8J 4RWSC 1F9SA 3G4SB 5A2QL 4A93B 4LF6L 1GKHA 4TQUS 2X6XA 5FLXE 4XKVA 4DUZQ 4LK1C 2F0EA 5EAYA 4JI8L 1JICA 2NZHA 3PV0A 4NDXA 1XMQL 1PA6A 4FF4A 2EIFA 4CDEC 1G7RA 4Z4TA 2QILA 1K83H 2QE7A 5M3MB 1HR0Q 1UD5A 3ND8A 5LHY1 4DR4L 4DR6L 2HHHL 1I50B 1EZ8A 1WOCA 2F3VA 4R4CA 4J0QA 4LF5Q 1BX1A 2ID0A 3N52A 5GAHC 4X62Q 1WCMB 2GK6A 4A3JH 3NHHA 2UXDQ 2H4OA 3MEHA 5CV9A 1JWUD 2F0TA 1HZEA 1GUNA 2BGIA 2OT2A 4OO1I 4IFDG 3JQQA 2FMCA 3K7UC 2AHOA 3KDFA 4A3IB 1FJGL 1HNZL 3EIVA 4QUFA 3PMFA 1KLUD 3ONYA 3VNUA 5FL7A 1ESFA 4JI1Q 2CHBD 4C3JH 5IYBG 3ULPA 2K14A 4EQPA 1PJ6A 4J6HA 2X6GA 1OTCA 4AYBE 1KDBA 4F8MA 2IWHA 4M0LA 1HPCA 2D3LA 1JNYA 2N55A 1LO5D 4L5TA 4M1UB 1XMQQ 2ZXPA 4FO2A 5J22A 1TWGH 1UE5A 3VA7A 2CRVA 2QGQA 1IJFA 2FFKB 2LMCB 2QDBA 1Y1VG 2ZJPA 2L9HA 4KTAA 3U4ZA 3OW2B 4FYDA 1SYFA 2KEEA 1HTPA 2CH4W 3GTOH 1E2VA 3CP8A 1XNQL 2KCMA 4A93G 1YNNC 4HSPA 2RHQB 2F0IA 1T6ZA 3CCLB 2LFNA 5DEHA 2M2LA 2B63G 4CDFC 3I4NG 1T6YA 3R6JA 3VYTA 4OP7A 1SKQA 3UDGA 5A89A 1YJ9B 2UU9Q 1EQTA 3H15A 3SJZA 3ZC3A 2IX3A 1Y0YA 2HIVA 3I56B 4KHPQ 2X6WA 1ONLA 1MHWC 3I7FA 4GLXA 3QSYA 3CCEB 3U50C 1RODA 3VR6A 1N34L 3AMUA 1E1OA 4DAYA 2E2JB 2BA0A 1D8LA 4WZKA 2UUAQ 2ATWA 3OIQA 1VQMA 2VUMB 3S14B 3OZVA 1SYCA 1FJGQ 3S2HH 2KCTA 4IJHA 3ULJA 1MRZA 2OK7A 4UZEA 5BN5A 2F3WA 4JI5Q 1CHQD 3HEJA 3R6KA 2KECA 1FYCA 2GJRA 1KC8D 3J7YW 5CYUA 4LAAA 1H9KA 4YELA 3MXNA 4DUZL 5DN6A 3KF6A 1Y14B 4JI6L 1UEBA 4RD1A 1Q82D 2OBTA 4A3CG 3ONUA 3KF8B 4Y9RA 4N9TA 1IBLL 4DK0A 2K05A 1HNWL 2F4VQ 2Q6IA 3M9BA 2D62A 3GTJB 2K52A 4OPSA 1RQRA 5HZBA 1QWYA 1IXRA 3QIAA 1AEXA 1BNZA 4C3JG 4A3KH 2L12A 5FLXc 2RVLA 3NK9A 4PQXA 2R9VA 1NAPA 5EQ0A 5CR3A 2JA5G 2CQOA 4JV5Q 2UUCL 4WFN3 1KIXA 3K80C 4FF2A 3T51B 1V1PA 2WPDA 1U4RA 1KRHA 4OHJA 4ILWA 4P25A 4LUOA 1KC8C 2DUDA 4LNQA 2HT1A 1KHIA 3W2HA 1QZGA 3GSIA 1K8AD 4LF4L 2BE5D 3VMFA 3AB9A 1GVPA 5CDFA 2X3UA 3SEBA 2QEXA 4PABA 1VQIA 4PV1C 2R6HA 1U4MA 2JA5B 4M2LA 3JU4A 3M4OH 4OOXA 3BDCA 4S3SA 5KNLA 2MJ8A 4LFAL 1LABA 4FXGC 5JPMC 4ROXA 3A8JA 1CA5A 2UXBQ 2ZM6Q 1F2ZA 3ERSX 4RPBA 3TBIB 3RY8A 1B9MA 3WWVA 1ET9A 4GKJQ 3AVUA 1QUFA 5BSYA 3R2IA 4HSVA 2SNSA 2ES2A 3OOCA 4X05A 1E63A 3BVMA 3V2TA 2ZTCA 4ZRZA 1DOKA 5J1ZA 3HOYB 1DD2A 1RHPA 2RC5A 3OZWA 2F0DA 2R93G 4LBWA 3NXWA 1VLOA 1JQYD 4IUNA 4K2KA 4BBRG 1WTPA 1KRSA 4H13C 2UUBL 1CZGA 4RCNA 2CCZA 3ZBUA 1S3OA 1YZ6A 4B43A 4HJ9A 1WFQA 3TP6A 4XLHA 1SNPA 4YAUA 1S5FD 2A68C 4IUQA 1NR4A 2QEJC 1I8DA 3VO1A 3HS0C 1COWA 1XNRQ 1ENCA 5FO8B 2NVXB 1G7TA 1S72A 2NZOA 4IFDI 4BBRB 3H0GG 2AMCB 4ME5A 3JAMi 3CCSA 1F77A 1IBMQ 3S1RH 1EZ6A 1ZKOA 4OO1H 3UE1A 4DA2A 4B3RL 2I07B 1DCZA 2IL8A 1EXMA 1E0BA 5M3MG 3HKZB 4CBVA 2F03A 3F2UA 4A3MB 3I4NB 1EP1B 2YTYA 4IUPA 2PZUA 3WYAA 2K5DA 1CTMA 4FXDA 2DNEA 5F4MA 1O80A 2ZBVA 3CC2B 1OXSC 2G9HD 2UUBQ 4X07A 1DM0B 3OWEB 3NQTA 3DMUA 1ESRA 1I6HH 2EY1A 4WQMA 2K75A 1A63A 2K1BA 5K5PA 2R92H 2UXCL 2O4XA 1H9MA 4OO1G 2XZPA 3SK8A 3FMCA 4Y7NH 4RD4A 2PLFA 3MMPA 3CMMA 4KY6A 4P73A 2SEBD 5IP7H 5M5XH 1YBYA 3CPXA 1C8CA 2JA7H 2PI2A 4C3HH 5KW9A 5LL6X 4R4OA 2ZXHA 1PZJD 3S1NH 4B08A 1Q8KA 5M3FG 4FF3A 1V5VA 3KEWA 1SDFA 2JEBI 2GPJA 2XOKA 4XNFA 1B23P 1LYLA 1X54A 1FNBA 4JBMA 4HJ5A 3E6ZX 2VQEQ 1SJHD 1ZYRC 4XYQA 2B2WC 3RZDB 1Z6HA 5FK9C 5C4JB 1OB0A 4GZYC 2BV3A 1VQKB 3OTOQ 4DR2Q 3LWUA 1GUGA 4HE6A 1PLFA 1OGIA 1D1KA 1S40A 1K8AC 4B3XA 4ZK9B 4XOPA 4ZKCB 3CQZH 1CQXA 1GJXA 3AEVA 2BF4A 1W34A 1PH3A 2JA6H 1AE3A 3MWYW 1Q82C 2G9DA 4V0BA 5CV8A 5HKKA 3PUMA 3OEHA 4DXGA 3AU7A 4P6VF 1O7ZA 4JI4L 4F87A 1EY9A 2R7ZG 2LSSA 3HOWB 1E1QA 2OWOA 3CRZA 1SMXA 3W5VA 4GNXB 1BXTA 1D5ZC 3PQIA 3U2QA 1U9RA 4A3EH 4LF9L 3ITPA 4A3DB 1RF2D 2MFIA 4H02A 4Q0FA 3TREA 2CBXA 3EN2A 1PH4A 1JC7A 3MXUA 3I8ZA 4I7ZC 4OELB 4K6DA 4X6AH 3OMCA 2JA7B 3DEPA 3C1EA 3SHLA 3HOZH 1LTBD 5THXA 3CCJB 2VJIA 4BY7B 3Q6SA 1LT6D 3MCAA 2E1BA 1IZ6A 4IZ8A 2LXJA 2VXWA 3GTQH 1JJCB 1TVXA 3RZOB 1UE7A 1JJGA 2K50A 4UHVA 3CMEB 3PO3H 2BPOA 2PW5A 4XONA 3HG9A 3DLLA 1V8QA 2XN9C 4DV5Q 4KMUC 2QN6A 3CCQB 4Y52H 1XE1A 4PG3A 1QVGA 1B53A 4CQJA 2E1RA 2FINB 5B6IA 5E6TA 2Z8LA 1WD1A 1GHKA 2F43A 4P3IA 4TMXA 2B2WA 2WR8A 1W87A 3RN5A 1DARA 4PC1A 2F0HA 5ELBA 3K0YA 5C3EH 2EJMA 2F0KA 1VQPB 2SOBA 1XNRL 3LVBA 1SXTA 4I7AA 5JVG3 2DY7A 1O7YA 2UUCQ 4IALA 2VW9A 4HN7A 4OWWB 5IYQA 1PDQA 1YI2A 1SN8A 4RKLA 4A3IG 4ZAIA 4NPSA 1VQ8B 2R92G 4RGOS 2PW7A 3VR5A 2VUMG 4Y9UA 4A3BH 2UXCQ 1NBMA 2O5JC 1TT2A 3QJYA 1PJ7A 1RJTA 3H3VI 5I2YA 2JK8A 2GREA 3SE0A 1WP6A 1VQ4A 4DUYQ 4NB3A 3O13A 2F0FA 1HNZQ 3PIO3 1WI5A 4XIGS 1CM9A 4G7OC 5CMDA 1YNND 3CPWA 3RD4A 4JC0A 4P72A 4U9UA 1L0WA 4B3SQ 3HOYH 1HH2P 1LTTD 5E4XA 3U6KA 3LWEA 1T5EA 4BBSB 1BCPF 2Q8RE 1WTXA 2JJQA 2K03A 2B63B 1P4MA 1B9NA 4X3SA 4DV2Q 2HLDA 1W2BA 2CKZB 5AN9A 4EH1A 3BS1A 1YNJD 3D6CA 3W5UA 4DV0Q 2OTLB 2C5BA 3CD6A 1E79A 2I1LA 3CMAA 1YHQB 1E3PA 1SROA 4BY1H 3TN2A 3GIRA 3KK7A 5LMNW 1ZXTA 4IURA 1SFOB 3S14H 1N9WA 1G2TA 3K5NA 1QUQA 2C9OA 1QVFA 2L15A 1FNUA 2K5HA 3I3CA 1Y1WB 4XQJA 2B3GA 2B2VA 3HKZG 3EA6A 4RD2A 3PA2A 5ELCA 5CGKA 3S17B 3FJOA 4DV6Q 4KJNA 4KD4A 1PH8A 1OB5A 2Z1CA 1TWFH 1R5BA 3H3VH 3KLSA 1SE4A 1X55A 2HHHQ 1PV4A 1JJ2B 1LACA 3CC4A 3OEEA 3W2IA 2F0QA 1PYWD 4DK6C 5M5YH 2UXDL 1EFUA 1KAWA 1K8GA 2AKWB 4A76A 1A62A 1TTTA 1ASZA 1EWIA 2C4UA 1S4MA 4E6IA 4PC7A 3BU2A 4RCZA 3A55A 4CJ0B 3K7AB 2B8GA 3S24A 4LF6Q 2EJFC 2NTTA 5KGUA 1N32Q 4FN5A 2B2UC 4YY3Q 1QFJA 2V7WA 5K36H 5JPNC 4OPVA 2F0JA 3BYYB 4YWKA 4X06A 2QDLA 1K3BC 3W2GA 2C5HA 1VQEA 5IOCA 1QCBD 4KY5A 2GVAA 2X0KA 4NXNQ 2JP1A 1UD2A 2OQ0A 3HOYG 3A8IA 4FXKC 1W35A 5HGTA 3Q38A 3CU7A 3CTAA 4G57A 1U5KA 5DNFA 5EBCA 3G48A 1I7PA 3TS0A 3NENA 4XLAA 3RLOA 1KXLA 1A2TA 3TP8A 4DV1Q 2XZOA 5G3LD 3G6EB 2WZPP 3RMHA 3S15H 1X3EA 4C43A 1Q8IA 1HNXQ 3OFNA 4M53A 2N88A 2F4VL 1SNMA 1BQEA 1TWCB 3H3VC 3ASPA 2WAQB 2DYIA 2NVTB 4XQNA 2VUMH 3I4OA 1LT5D 2QMUA 1XXGA 2J0TD 3AVYA 2V7VA 3EVQA 1HUMA 1TR5A 1UMKA 4EGVA 3S1NB 1NTGA 3I72A 1W3SA 3J7AV 2NV4A 1Q7YC 3KYHC 2SDFA 1HA5A 2X85A 1EOTA 4XT1B 5JBQA 2ZTEA 4TVAB 5C44G 2D74A 2F0VA 2FXQA 1LTLA 1XTCD 4G6IA 4PZ7A 1MGSA 4X64Q 1DDIA 4GKJL 4Z4YA 1NJID 1WCMH 3OHXC 4HMIA 5JJKA 3WBKA 4EVOA 2KA7A 2D5DA 1MKHA 1A3VA 1EWCA 1ZYRD 4XTCS 1OB2A 1YJNA 4A3IH 2F0PA 4PZ6A 4OX9L 4QUZA 1N05A 1OGJA 2DY1A 2JA9A 1SKYB 1S5BD 4HAEA 4F7XA 1J9ZA 5I6YA 4C0SA 3CCUB 4K5XA 4MHEA 4UAIA 1GM5A 1ELOA 5CV7A 3S16B 1U4PA 1F9PA 1HZCA 4RD0A 3P1HA 3FKIB 4ZYSA 5FLMG 3SJPA 4NP5A 3PUWA 1YIJB 1SM4A 2WJYA 1GD7A 1N34Q 3QWNA 4DV3L 2YWHA 1VQ5B 1XPUA 3GTQB 1OO9B 4GKKQ 1X65A 5JJZA 2A69C 4O2DA 5M3FB 3T16A 2QCPX 3CCRB 5LMNQ 2F0SA 2RDGA 2IW3A 4OOVA 2QGGA 2K5VA 3HOUG 3M4QA 1YITA 1UWVA 1H85A 1EFWA 1GO2A 2K5QA 2BDNA 3ZZUA 3CC7B 5I9OA 3HOXH 3JAMc 4KN7C 3JAME 2F4IA 4RH6A 4XQFA 1Q9SA 1II3A 5BR8L 3M7NA 1LTRD 5DLQE 3FDTA 4ZUJA 1EWHA 3FRPB 4RMFA 3K58A 1KABA 3UDXA 1NMGA 2GJKA 3J7ZC 4AF6A 3W5HA 5A88A 2K4KA 5J39A 5A8AA 3PUYA 3IFTA 3QR8A 4J1MA 3B6YA 1BMFA 3PENA 3HOWG 3AYHB 1Y1VB 2KCNA 4NMZA 4OXPA 1QGAA 4X66L 3J7A5 1KK0A 1FNWA 3A8KE 3A74A 3G05A 3PF4A 1BR9A 4OEMB 3BCFA 3OW2A 5G3LF 3HOVG 2RA4A 2JJ1A 4FDBA 2NVQH 2L0CA 3J81E 4ZLTF 4NBSA 5BN3A 1BX0A 2D0OA 5H59A 2JA7G 1VJSA 1VQNA 1FD7D 3NWSA 3AGQA 3MVVA 2MUYA 3BNWA 3CCVB 3BZDB 1EY4A 2VB2X 3CQZB 1HA6A 2WSSA 4ZCIA 2OXPA 1HHVA 3FVQA 4RDJA 1HZAA 3K0XA 1WTRA 1LUZA 4B47A 1QOHA 5HURA 4KKTA 2DERA 2LS01 1S4ZA 5C6AA 1E1RA 1ZUNB 4II3A 3K5OA 4JBJA 4JI8Q 1L1OA 2K6AA 4QUCA 1BBWA 1CZWA 2AUJD 1BOSA 4DAYB 5LMNL 1NNXA 5IP9H 2VNJA 3ERQA 1PRTB 5EPKA 2Z6KA 4XXEA 4RKBA 3NP8A 2B2UA 3SR1A 1EY7A 1AP0A 3PUNA 1FNVA 1TKWB 3G71B 2E8GA 3NQIA 3OPOA 3CXCA 1K0RA 3CKIB 4BXXH 1CNFA 1GVHA 3GVKA 1JE5A 4CHTB 4R1JA 1OXTA 2XVSA 5H1SE 1RKNA 5C44H 1QG0A 4JYAQ 3GTKH 5D65A 2OYNA 1C4QA 2Z6BA 3KF8A 4A75A 4PC3A 4C1NK 4NKLA 3J81L 3A5UA 4B3MQ 1TU2B 4CJ2C 2C2WA 4JPBW 1F2MA 1QZHA 3L3OC 4ZCLA 5C4XB 4DV7Q 3ZUGA 1VQGA 4YIJA 1SNCA 1HQRD 1I3QH 3KLRA 1FRQA 1EQRA 2A1AA 1PH7A 2JA6B 3OE7A 2BOSA 3MC0B 4C1NI 1AZQA 2V7QA 3SDZA 2R7ZH 2YV5A 4A3JB 1VQCA 5KNBA 2OTJA 3H0GB 3WQZA 2XTIA 4M1KA 1PTOF 3CCMA 4HIZA 4ZUIA 3OKXA 4K14A 3NTKA 4A3LH 2K33A 1PZKD 1R5NA 4TSFA 2F0LA 1PRTD 3T4AC 2B8FA 2QEXB 1EEFD 3F8TA 2Z9HA 1TXYA 3JQPA 2GA4B 1G7CA 3ASQA 5TRDA 3OTOL 1YVCA 1VQ7B 4YAOA 1DGSA 1GO3E 2RKSA 3J80i 5FIUA 4QQBX 1ICWA 1QGYA 1STAA 1W0KA 4RFBA 1QG7A 1YLOA 1SYEA 3P20A 3BCDA 3HOUB 2K01A 1KD1C 4DK3C 3CW2A 2CQAA 2A68D 1UD8A 4PMWA 3H6MA 5C5LA 3WDNA 1S5DD 3I91A 3L7ZC 4WJ3M 1MJCA 2X53S 1C7YA 1Q1BA 4KHVA 4XKWA 2Q8TA 3E9IA 2NVYH 4B3FX 3GTJH 1JOKA 4UP9A 4RAUC 2O5IC 3A5ZB 3T1HQ 4DR7Q 1L0YB 1F9QA 4PZ8A 5C4XH 2IPKD 3T53B 1X3GA 2I5MX 1PYBA 1AW7A 2BE5C 2L4NA 4PNYA 3I73A 3GTPB 4P22A 1SAPA 2VNKA 2OBSA 2ZXIA 1KQSA 2C78A 4JBWA 1N08A 4ZV4A 4LF8L 3PSIA 4IW3B 1QFZA 3QFTA 1UEAB 3HKSA 5C5MA 4ASUA 1PTOC 1VQAA 2NTSA 3I4MG 4ACAA 3W1BA 4WZEA 1SBBB 4A3DG 5H5JA 5JEAJ 2Q2TA 2XRQD 1TY0A 4P9SA 2R6GA 1SNOA 2BA1A 3KLSX 5IYCH 1DYQA 2DEUA 1TWAH 1ENAA 4TN1A 1IHZA 5IGCA 4MYUA 1M90C 5IYWA 1R9TH 4JI0L 3PO3B 4P6YA 1KMHA 1SYBA 2WV6D 1O78A 2ASBA 3PGZA 1PFBA 2W6JA 3WY9A 1BCPC 4Q7JB 4IQZA 4BWGB 4WRDA 4X65L 2F0OA 1X3QA 3HRZC 2QDXA 5GAEC 5M3MH 1IYUA 4MIUA 4K5WA 1JA0A 3SLDA 1YEZA 3IRBA 4EX5A 4A3BG 5EPJA 1FNDA 4UP7A 4FK8A 2ZL7A 4RD6A 3OYYA 2E2JH 1YJ9A 4B44A 4PMCA 4TMTA 2B7BA 2OEOA 5DS0A 1MABA 1T6XA 2VBSA 1E1TA 2CW0D 3C3LA 2JEAI 1N8RC 1ZM3A 2VY3A 2WKCA 4A3KB 1JB9A 3H94A 1SLJA 2C4TA 3OJWA 1NMFA 4GN4B 2FHTA 4BA1I 4JOIC 4XL9A 3EROA 1JOQA 2PZWA 3Q6QA 5KSWB 4B3SL 1FR3A 4RCOA 3STBD 2DETA 4Z4UA 1Y1VH 1A0IA 1Y1WH 2KENA 3NTHA 1TWAB 2NN6I 1EFTA 4RHRA 2IX1A 2PMZE 4LBYA 4DK1A 1Y8OB 4BY1B 4LFAQ 1FDRA 4P12A 4LWCA 1VQKA 2NVQB 3E9HA 4XM3A 1PH6A 4J15A 5TSSA 1QILA 3MXNB 4WORA 3KF6B 1BF4A 3PO3G 4IFDJ 5CV6A 1EY0A 3MXPA 3WNBA 2A73B 5FO9B 3A54A 3HGBA 4YWLA 2D3NA 2KJXA 2Q2IA 3GVLA 1J9OA 3VYRA 2W6IA 1NE3A 3F2CA 5C4ZA 1RTOA 1PH1A 4KK7A 1V0FA 3HOZG 4CKEA 2IX0A 5I2XA 1MJEA 4A3MG 4KD3A 1KAAA 1HR0W 1CNEA 5HXBA 3F2BA 3T56B 4B3TQ 2R61A 3RLNA 1RD9D 1LTGD 1J5EQ 2Z4IA 1AMOA 4QCLA 4GNXA 3E20A 1L1OC 1SEBD 2TSSA 3AVWA 2PCFB 3BDOA 3R93A 5IYDH 4DR1L 1H9SA 1JR0D 4RDKA 3KJPA 4UZUA 2AQ2B 1KLGD 1A3TA 3HOWH 4AYBB 4LMQD 3GTGH 3HZXA 4QMGA 4JI6Q 1CT1D 5KEEA 1HFGA 3CCJA 3GTLH 3M85A 1WTHA 1B44D 4QFMA 2Q6KA 4Z1MA 1S5ED 1XJVA 1VQOB 3A3GA 4QHYA 1WJJA 2BSAA 1VMCA 3S1MH 3VR4A 4DQLA 3ZZ0A 1IW7C 3OWFA 4OGQC 4RHSA 1STEA 3A3BA 5IP7G 1AFPA 3BH4A 1AE2A 1YNJC 2K5WA 3GTPH 4GN5A 1I4GA 1K83B 4B3TL 1K0SA 4I65A 5GROA 1WTHD 4X7EA 3S15B 2IT1A 2M5SA 1J8IA 2KCCA 5CORA 3X3NA 1IJEA 3W2FA 2WIIB 1EYCA 1JB7A 1A8PA 2Z6KC 4KV6A 1DDGA 3OJXA 1VLYA 3ASSA 1I3QB 1SYGA 1CQVA 2BMWA 3KL9A 3KOJA 4DR2L 3TMEA 1ENFA 1VQPA 3WOFA 5AJ3Q 3DWPA 2B2TA 4XT3B 3UE0A 1N07A 5IY0A 4F88A 2F0MA 2LXKA 4JK1C 2ZL6A 1VHEA 2N49A 3CCSB 1LTID 3FKIH 2YTVA 2EYJA 3AGPA 2EYPA 3AFQA 3GV3A 1AN8A 4RPDA 1BKBA 1X56A 3J7AF 4JOIA 4DXFA 2J7KA 4HE5A 1LM0A 4IN3A 4X7DA 1CKNA 2E5LL 5M5YB 4LUVA 4AVZA 1C48A 4XDXA 3S2DB 1SE3A 1TS4A 4OWTB 3AFPA 5ISRA 4BY7G 1EIFA 2YYZA 1Z9FA 3RZDH 3DXJC 1D1IA 2XNAC 5C0XJ 4JI1L 3STBC 1HR0L 4RCYA 5D3DA 2MP1A 1HRJA 3I55B 1XX8A 2KHIA 2JN9A 4XMYA 2EPBA 5EPLA 1STHA 1UNSA 4PC2A 3J80E 5GV8A 1EP3B 3BDLA 4DPGA 3PO2B 3PIOA 3TS2A 4H9GA 3BY1A 3QOLA 3CHBD 1L2FA 3BG3A 1QVFB 1QUQB 4ALPA 2NVXH 3CP2A 3ZIAA 3CF5A 1PJ5A 5J35A 2DJFC 3A1PA 3F2DA 1VF7A 1ASYA 1B1ZA 1N8RD 3I4LA 5TV2A 4LF8Q 1EIYB 4M4SA 3MFGA 4JI2Q 1ZM4A 1OXUA 1VMPA 2KEDA 1EY6A 3PVDA 5KYIA 3WXMA 4CKBA 1YJWA 1XWEA 5FNZA 3GD7A 4JG2A 1D1NA 4BA2I 5ELFA 3MZ5A 3AVTA 4F7DA 2JSOA 5KYLA 4MZ9A 3NBHB 1QNKA 2EXZA 3GTMH 1R4QB 3D4DA 2RC6A 2OBRA 1VQHA 3NEMA 2JXMB 4POGA 1YX2A 5FA6A 3DDYA 1TS5A 2JN4A 4L6TB 5EJWA 5ELOA 3VR2A 4C3HG 2C35B 1KTVA 3JAML 5JEAG 1H9RA 1LTSD 3R8BA 2VNUD 3E5SA 5IYRA 1BO0A 3D4RA 2ZITA 2RDFA 3TZUA 1BVSA 4BBSG 1VQLA 4HJ7A 3OIPA 4YHBA 4B3GA 1WOOA 2FVGA 3NUCA 3VR3A 3T1YL 1EQQA 1DG1G 4MNOA 1HTLD 4HIMA 2KVOA 1TWHH 4YCWA 4DR1Q 2ZJRA 5DM63 4G5GA 2YU9B 1XB2A 4QIWE 4A3CH 5J3OA 2ZL5A 4WZLA 4XN3A 2JYOA 2H1EA 2DJGC 2VYQA 1EQVA 1PKVA 5C4JH 4OPOA 4GLVB 2RF4A 1PVOA 2LKVA 1UE6A 4EQOA 3Q24A 1PH2A 2YWFA 2UXBL 4C3IB 2NPFA 1C9OA 2EYLA 4JV5L 1NCVA 1ILQA 1I18A 4IOCA 2QA4B 3NELA 1MBYA 3CMEA 3S1RB 2CW5A 3R3OA 5ELEA 4BXXG 4X7CA 2OF1A 1RDPD 2P3MA 1KK2A 5D3IB 4R8IA 1VQ6A 1EFRA 2ZXRA 1UD3A 2WFWA 1N32L 4WWVA 1B2RA 3X3MA 5JVH3 3BJUA 2PZTA 3GDEA 2Q6LA 1B7YB 3SXHA 4HIDA 2Y0SG 4IPHA 4TRDA 1ZM9A 4QVAA 1I50H 2K32A 2F1MA 1YJNB 2WKDA 3KBGA 4DU9A 1T5XD 3B78A 2VZAA 1M90D 3EJIA 2IY5B 4BBRH 1U0LA 4GS3A 1A3UA 5FO1A 2PI2E 2R7FA 3ULLA 1X9NA 4PC6A 1VS0A 2KOLA 4X64L 4DV1L 3CW2C 4LF7L 1EL0A 4MTKA 3D26A 3HAGA 3KUPA 2EZVA 5FJ8G 1VCIA 3GO5A 5EMNA 3P27A 5M9OA 4A3EB 4DKAC 5LMZA 5GADC 5D14A 2UUAL 1NSNS 2WINB 4KI0A 3G4SA 1QGZA 1IBML 3CCRA 1VF5C 2F0UA 5FKAC 1QNUA 5FO0A 3J81j 1XYIA 2KHSA 2ZTDA 1H42A 2Q2HA 2HDMA 3J81c 2CC2A 2VNHA 1YITB 2EXDA 1G291 1VQ4B 2DN8A 2XSCA 3W1GA 5NUCA 2E75C 1VQ9A 1FNMA 3M4OB 5IGFA 2Z6BD 1UE1A 1K8MA 5IYBH 1KZLA 4LBZA 2EY6A 3RZOH 3CC7A 1K9MD 1M1KC 4OIKA 1W6JA 4JI2L 4DV3Q 4POFA 1HUNA 3E0JA 3NBIA 4IO9A 1ILPA 2VQFQ 1GR1A 1JORA 1Y69U 3LX0A 1R4PB 4ME3A 2A6HC 1W2BB 2BVNA 2Z4HA 2PMZB 2CNDA 4TSSA 2OTLA 3CD6B 3HOXB 5IIFA 3FPUB 2AHOB 2B7CA 1PTOH 3KDFB 1FGUA 2I5LX 4C2MB 2PQAB 1LT3D 1OXXK 2VZLA 1HZ9A 5IYDG 4P26A 4Z9CB 4YEJA 3T13A 5IWAL 4N3NA 4TMZA 5AJ3L 2BCOA 4R9WA 3A7AB 4ULLA 2MGSA 3NSWA 4YCVA 1UAPA 5I6WA 4HIOA 3D6WA 4FF1A 2NYZD 1JT8A 2ZTGA 5T1IA 1XPOA 4XN0A 4IPCA 4DR7L 3WOEA 4IUTA 3CCVA 1D2EA 1EY8A 4DGZA 3HP3A 4KY7A 2RDHA 1IBKQ 5HGQA 2EY2A 4P3YA 3CRKC 2M9VA 3H91A 4R4QA 3ZYYX 4DAVA 2R93B 2ZZFA 1Q3LA 5FLXL 1KTKA 1F9RA 3Q8DA 4UZFA 3K6OA 1AIPA 3CPFA 4X8IA 1QJOA 4KJOA 2PNRC 1WTOA 5F4OA 1BBXC 3GTOB 3ICEA 2N3SA 2E2IB 2JIZA 2ZZGA 4GNXC 1IKLA 1SE2A 1UUPA 5DM73 3OZUA 1I6HB 3W5OA 4XOTA 3CCEA 4YAWA 1O7LA 4K8IA 3Q6RA 1DONA 4JI3L 4GOPA 3CXCB 2C77A 2N78A 3J81i 1BUVT 3G6EA 2E2HB 4RG1A 1H9JA 1VQMB 1G7SA 1PMRA 4CGYB 2VBVA 3KFUA 2VNIA 5E1FA 4CJ1B 5IT9E 2Q8IB 2XWBB 2N8NA 3MHBA 3SKBA 5ELNA 4BS9A 4N8FA 3DUZA 3S9WA 4A93H 3W2DA 1WVLA 4JW0A 1D2BA 4LF4Q 2X6LA 4C3HB 5J3BA 1IL2A 1G51A 2A8VA 3ZJYC 1Q81C 2F0WA 3ASRA 2EYHA 3JQRA 1I4HA 3H09A 3PIPA 1WTWA 1T9HA 4IOAA 4E0FA 5COYA 1WCMG 2HCCA 4AH6A 4NXNL 1VQBA 1CKOA 5CC4A 2R92B 2GK7A 1IB0A 1I5FA 2FJ2A 1V1OA 5EGTA 4KKSA 1M8AA 5C0XI 2Y0SB 4YHHL 3K8AA 4J8QA 1EY5A 1LLRD 3DHQA 1XMOL 4JI7Q 4JYAL 3URYA 1F60A 2V7XA 3DWQA 2EJGC 3LQEA 3N6RA 5M5XB 1IBLQ 3RLFA 1HNWQ 1OHHA 1STYA 1TIID 4DF7A 4K0KQ 1BCPB 2O2LD 5KRUA 3BC9A 1PTOB 4DV7L 2NZ1D 1K73D 5LMUQ 1B50A 2NBFA 4A3JG 1EFID 4Z4WA 2VBTA 1K28A 1D7QA 1F2LA 4JCVE 1MIUA 4K2LA 1LT4D 1TS3A 4NW2A 1CQFA 4P74A 3HOXG 4X65Q 1RTNA 3GTLB 1YIJA 3TQYA 2E2DC 3FPKA 3GTGB 3W3AA 1Y0RA 1BDOA 2NN6H 5L37A 4APVA 3I2ZA 1SNQA 2VJJA 1N0VC 3VYSA 4A3BB 1PRTC 3MTSA 3ONAB 3CAMA 3L2PA 2HDNB 4ZGNB 4IFDH 5C0XG 1PH5A 4QJFA 2DGYA 2A19A 2D0PA 4JI7L 3SK5A 2IHFA 4DQKA 1NRKA 2XRSD 1V43A 2K28A 2E5LQ 1BLIA 1I94Q 3P26A 2RSNA 1EFCA 2LZJA 2PMDA 4XLEA 1X3FA 1WTQA 2R7ZB 3WBJA 2MO1A 1KQSB 4JI5L 3MXGA 4B9WA 2NVYB 3BY2A 5KNCA 1Q81D 1SYDA 5EKKA 2XGJA 3M7GA 3C46A 1JCKB 1TVCA 2F0NA
chains in the Genus database with same CATH topology
3MAQA 5IGGA 2RQXA 4O42A 4HCSA 1A15A 1PXUA 5IT9L 4JMQA 3C1FA 1G6ZA 1JOOA 1LV9A 3TP7A 2NWGA 3BVGA 1OXVA 5C3WA 4U673 3PUXA 2PPBC 3J80L 3PUVA 4PMBA 1D6EC 2F0GA 2L11A 1LTAD 4A3FB 3I70A 1I6VC 3GTKB 2FMMA 1A2UA 3UI2A 1G2SA 3CRLC 1DZ1A 1CA6A 3K57A 2K7VA 4HTHA 1KNEA 2ZZEA 4IUUA 3L9AX 3Q23A 2HQEA 3BYTB 1FX0A 4QB4A 1QB5D 3M3YB 3TDQA 1Y8NB 2WACA 3MFYA 1MSHA 1PRTF 1IW7D 3V96A 3IFDA 1SJED 4NNJA 4RA8A 4X3TA 1ZEQX 1ET6A 1EU3A 5EBDA 1R9TB 4R8NA 2A69D 3D8GA 1H8HA 4XR6A 1I4RA 4KN4C 4HEDA 3GQBA 2JE6I 4TT3A 1E2ZA 2IJ0A 1GXDC 1MI2A 3D3RA 4V190 1NUCA 1GHJA 4G4KA 3QOJA 2JJ2A 3FPPA 3LNNA 4U68A 3EQLC 1CI3M 1PTOD 5M5WB 1V1PB 4XORA 2AUKA 4ODGA 1U4LA 2EYOA 4WJWA 5IGEA 3A8JE 4DN4M 1PFMA 1EYDA 2E76C 5T1GA 4FP5D 4ID6A 2BDOA 4TKOB 1W9XA 4DNRB 2B39A 1HVXA 4GQNA 3OSOA 3SK4A 3SVMA 1GUWA 4K8JA 3HOVB 3A8IE 1CHPD 3DM1A 2D2CC 2LY7A 4L8JA 1MSGA 1PZID 3D31A 4MN3A 1EEID 3OMGA 1E2WA 2B2VC 1Q90A 3D4WA 3GVJA 1K8OA 1M4VA 1FGBD 2KQ3A 3G6JB 2MHVA 2R3ZA 1E3ZA 1TWFB 2QKIC 4K6LA 2HUGA 2JDIA 2ENBA 1PFNA 3P75A 3BVZA 5C3XA 2ZZQA 3FEWX 2J4XA 4XLCA 1HXYD 2V31A 4ABNA 4X3KA 3S2HB 4HCEA 5I9PA 1I4PA 1ML0D 3S1MB 5C4HA 5I4DA 1NR2A 4A3GB 2EE1A 3GP7A 4DFAA 2EYFA 1DJRD 3DWAA 1JWMD 4B9XA 3VYUA 4UDUC 3V05A 1DXMA 1KDAA 1GUTA 2RBMA 3NE5B 2XZLA 5FO7B 1X3PA 2X8KA 3Q0AA 1L0XB 5EKIA 4OL7A 1UD6A 1BCPD 3RUZA 2XIWA 5K36G 2E74C 1IL8A 5IGDA 1B2TA 2L55A 4N9PA 3I90A 3NBHA 5IGBA 3IAYA 1GOZA 1UD4A 2J7ZA 1G8ZD 2PQEA 3KBXA 2A74C 1SNDA 2PO4A 3HOZB 1GUSA 5FOBB 2GJPA 4H0LC 1B4OA 2SNMA 4KHZA 2TMPA 5LL6S 4QIWB 3A35A 1IKMA 2AQ1B 4CKCA 4HR7B 1X32A 2VB3X 2DIEA 2A6EC 3DEOA 5EKLA 3QO2A 1I4QA 2EY5A 1STNA 3NPPA 1H9SB 1HFNA 2EOTA 4RGNA 2KVMA 4XD7A 3C2PA 1D5MC 4X3UA 2AWOA 1S5CD 4FXUA 4XLFA 2ZXOA 3OAAA 1EIGA 1SMYC 5KIXA 2WJVA 3Q22A 1F2YA 2XNDA 2EYMA 4XQQA 1VDZA 2ZT9C 1HCZA 3K5LA 2DNCA 3PUZA 1JB3A 4L63B 3TZDA 2ICEC 2EDGA 3OW7A 5KNDA 4RGMA 5IK2A 5AFWA 3SK6A 4YXWA 2CK3A 1CFMA 5E3FA 5JOBA 1BPLA 2A5HA 2CVRA 2L1BA 2AQ3B 2RSOA 1JE4A 5CBEE 5ELDA 1WPCA 4II2A 2WB1B 3EFXD 3I4MB 1E43A 3A56A 1D5XC 4DNTB 5CV4A 5JAVA 1JWSD 1K28D 4M8AA 3GV6A 3TP5A 2NB0A 1AZPA 3K59A 2I46A 1BQQT 5DAUA 4LJZC 2V4DA 2M00A 4G7ZC 3G7LA 2K04A 3FKSA 3MA2B 4K5VA 3ND9A 4C3IG 4RGTA 4KKUA 2MPMA 1KDCA 1GUOA 2B2YC 3NWTA 3TSSA 5BN4A 1HQMC 3U9SA 4H7BA 1V0EA 1Z7TA 1TY2A 4G7HC 3IKJA 1STBA 5C0XH 1WD0A 1A6XA 2B2TC 3A7LA 5E4WC 3CESA 1B3AA 2A6HD 4IUVA 4C56C 1SMYD 1EIHA 3S1QB 2A6ED 1Z47A 5JEAH 1TS2A 2CW0C 3IL8A 3M4YA 1TWGB 2C5CA 1TQOA 2L5TA 1STGA 2PYKA 5C44B 2NN6G 5IODA 1WTVA 4H44C 2ICIA 1IYVA 4G7WA 3R2TA 1G91A 2D9UA 1DOLA 4QF4A 3NTIA 4Q5VA 1MD2D 4Y7NB 1Q12A 3U9OA 5A35A 3VA5A 4HMJA 3GTMB 5CBAE 4P2CB 1EYAA 2ZTNA 2B2YA 2XWJB 5F2DA 4EQNA 2X6YA 5C3EB 4XYOA 5A2QE 1QE6A 1I4XA 3QB3A 1H8EA 2X69A 5CV5A 1W0JA 2DY8A 1Q1EA 2JA8B 2HDLA 3PIP3 1Y8PB 1TWHB 1KNAA 4OIJA 2EVBA 4FNFA 4FVMA 1RCVD 2NUCA 1EU4A 2AWNA 4G7XA 1SSOA 2KUMA 1E3XA 3K5MA 2QF7A 4DAPA 4ZQ3A 3P7JA 3QG1A 4ZKBB 4C3JB 2HCIA 3ZPNA 4O1NA 1DOMA 1CK1A 1W6KA 2WP8J 4RWSC 1F9SA 5A2QL 4A93B 4TQUS 2X6XA 5FLXE 4XKVA 4LK1C 2F0EA 1JICA 3PV0A 4NDXA 4FF4A 2QILA 2QE7A 5M3MB 1UD5A 3ND8A 5LHY1 1I50B 1EZ8A 2F3VA 2ID0A 3N52A 1WCMB 2GK6A 3NHHA 2H4OA 3MEHA 5CV9A 1JWUD 2F0TA 1HZEA 1GUNA 2OT2A 4OO1I 4IFDG 2FMCA 4A3IB 4QUFA 3PMFA 1KLUD 1ESFA 5FL7A 2CHBD 4EQPA 4J6HA 2X6GA 1KDBA 4F8MA 2IWHA 1HPCA 2D3LA 2N55A 1LO5D 4M1UB 2ZXPA 4FO2A 5J22A 3VA7A 2FFKB 2LMCB 2QDBA 2L9HA 4KTAA 4FYDA 1SYFA 2KEEA 1HTPA 1E2VA 3CP8A 1YNNC 4HSPA 2F0IA 2LFNA 5DEHA 2M2LA 3VYTA 1EQTA 2IX3A 2X6WA 1ONLA 1RODA 3VR6A 3AMUA 4DAYA 2E2JB 2BA0A 3OIQA 2VUMB 3S14B 1SYCA 5BN5A 2F3WA 1CHQD 3HEJA 2KECA 1FYCA 2GJRA 3J7YW 5CYUA 4LAAA 1H9KA 4YELA 3MXNA 5DN6A 4N9TA 4DK0A 2K05A 2D62A 3GTJB 1QWYA 1BNZA 3QIAA 1AEXA 4C3JG 2L12A 2RVLA 3NK9A 4PQXA 2R9VA 1NAPA 5EQ0A 5CR3A 4WFN3 4FF2A 3T51B 1V1PA 2WPDA 1U4RA 4OHJA 4ILWA 2BE5D 3AB9A 5CDFA 3SEBA 4PV1C 1U4MA 2JA5B 3JU4A 3BDCA 4S3SA 5KNLA 2MJ8A 1LABA 4FXGC 5JPMC 1CA5A 1F2ZA 3TBIB 1B9MA 1ET9A 3R2IA 4HSVA 2SNSA 3OOCA 3BVMA 3V2TA 3HOYB 4ZRZA 1DOKA 5J1ZA 1DD2A 1RHPA 2F0DA 3NXWA 1JQYD 4IUNA 4K2KA 1WTPA 4H13C 1CZGA 4RCNA 3TP6A 4XLHA 1SNPA 1S5FD 2A68C 4IUQA 1NR4A 2QEJC 1I8DA 3HS0C 1COWA 1ENCA 5FO8B 2NVXB 4IFDI 4BBRB 4ME5A 1F77A 1EZ6A 1ZKOA 4OO1H 4DA2A 2I07B 1DCZA 2IL8A 1E0BA 3HKZB 4CBVA 2F03A 3F2UA 4A3MB 3I4NB 4IUPA 2PZUA 2K5DA 1CTMA 4FXDA 2DNEA 1O80A 1OXSC 2G9HD 1DM0B 3OWEB 3NQTA 3DMUA 1ESRA 2EY1A 2K1BA 5K5PA 2O4XA 1H9MA 4OO1G 2XZPA 3SK8A 3FMCA 3CMMA 4KY6A 2SEBD 1C8CA 5LL6X 2ZXHA 1PZJD 4B08A 4FF3A 3KEWA 1SDFA 2JEBI 2XOKA 4XNFA 3E6ZX 1SJHD 1ZYRC 4XYQA 2B2WC 3RZDB 1Z6HA 5FK9C 5C4JB 1OB0A 4GZYC 3LWUA 1GUGA 1PLFA 1D1KA 4ZK9B 4XOPA 4ZKCB 1GJXA 3MWYW 2G9DA 4V0BA 5CV8A 5HKKA 3OEHA 4DXGA 3AU7A 1O7ZA 4F87A 1EY9A 3HOWB 1E1QA 1BXTA 1D5ZC 1U9RA 3ITPA 4A3DB 1RF2D 4Q0FA 1JC7A 3MXUA 3I8ZA 4I7ZC 4K6DA 3OMCA 2JA7B 3DEPA 3C1EA 3SHLA 1LTBD 2VJIA 4BY7B 3Q6SA 1LT6D 2E1BA 4IZ8A 2VXWA 1TVXA 3RZOB 2PW5A 4XONA 3HG9A 1V8QA 2XN9C 4KMUC 1B53A 2FINB 2Z8LA 1WD1A 1GHKA 2F43A 2B2WA 2F0HA 5ELBA 3K0YA 2EJMA 2F0KA 2SOBA 1SXTA 5JVG3 2DY7A 1O7YA 4IALA 4HN7A 1PDQA 4RKLA 4ZAIA 4RGOS 2PW7A 3VR5A 1NBMA 2O5JC 1TT2A 3QJYA 1RJTA 5I2YA 3SE0A 1WP6A 3O13A 2F0FA 3PIO3 4XIGS 1CM9A 4G7OC 5CMDA 1YNND 3RD4A 1LTTD 5E4XA 3LWEA 1T5EA 4BBSB 1BCPF 2Q8RE 1WTXA 2K03A 2B63B 1B9NA 4X3SA 2HLDA 3BS1A 1YNJD 3D6CA 1E79A 3TN2A 3KK7A 1ZXTA 4IURA 1SFOB 1G2TA 3K5NA 2C9OA 1Y1WB 1FNUA 3I3CA 4XQJA 2B2VA 3EA6A 5ELCA 5CGKA 3S17B 4KJNA 4KD4A 2Z1CA 3KLSA 1SE4A 1LACA 3OEEA 2F0QA 1PYWD 4E6IA 3A55A 4CJ0B 3K7AB 2B8GA 2EJFC 2NTTA 5KGUA 2B2UC 5K36H 5JPNC 2F0JA 3BYYB 5IOCA 1QCBD 4KY5A 2JP1A 1UD2A 5HGTA 4FXKC 3CU7A 4G57A 5DNFA 5EBCA 4XLAA 1A2TA 3TP8A 2XZOA 5G3LD 2WZPP 3RMHA 1Q8IA 3OFNA 2N88A 1SNMA 3H3VC 1TWCB 2WAQB 2NVTB 4XQNA 1LT5D 1XXGA 2J0TD 3EVQA 1HUMA 1TR5A 4EGVA 3S1NB 3I72A 3J7AV 2SDFA 1HA5A 2X85A 1EOTA 4XT1B 2F0VA 1XTCD 4G6IA 1MGSA 3OHXC 4HMIA 4EVOA 2KA7A 2D5DA 1A3VA 1EWCA 1ZYRD 4XTCS 2F0PA 4HAEA 1SKYB 1S5BD 4F7XA 5I6YA 4K5XA 4MHEA 4UAIA 3S16B 5CV7A 1U4PA 1F9PA 3P1HA 3FKIB 4ZYSA 4NP5A 3PUWA 2WJYA 3QWNA 3GTQB 1OO9B 5JJZA 2A69C 5M3FB 3T16A 2QCPX 2F0SA 2RDGA 2IW3A 2K5QA 2BDNA 5I9OA 4KN7C 3JAME 2F4IA 4RH6A 4XQFA 1II3A 3M7NA 1LTRD 3FDTA 4ZUJA 1EWHA 3FRPB 3K58A 1KABA 2GJKA 5J39A 3PUYA 3IFTA 4J1MA 1BMFA 1Y1VB 2KCNA 4NMZA 1FNWA 3A8KE 3G05A 1BR9A 3BCFA 5G3LF 2RA4A 2JJ1A 2L0CA 3J81E 4ZLTF 5BN3A 1VJSA 1FD7D 3NWSA 3MVVA 2MUYA 3BZDB 3CQZB 1EY4A 2VB2X 1HA6A 2WSSA 2OXPA 1HHVA 3FVQA 1WTRA 1QOHA 5HURA 4KKTA 2LS01 1S4ZA 5C6AA 1E1RA 4II3A 3K5OA 2K6AA 4QUCA 1CZWA 2AUJD 1BOSA 3ERQA 1PRTB 5EPKA 4XXEA 4RKBA 3NP8A 2B2UA 3SR1A 1EY7A 1AP0A 1FNVA 1TKWB 3NQIA 3OPOA 3CKIB 3GVKA 4CHTB 1OXTA 2XVSA 1RKNA 5D65A 1C4QA 3KF8A 4C1NK 4NKLA 3J81L 1TU2B 4CJ2C 1F2MA 3L3OC 5C4XB 4YIJA 1SNCA 1HQRD 3KLRA 2JA6B 3OE7A 2BOSA 3MC0B 4C1NI 1AZQA 2V7QA 3SDZA 4A3JB 5KNBA 3H0GB 3WQZA 1PTOF 4HIZA 4ZUIA 4K14A 3NTKA 2K33A 1PZKD 4TSFA 3T4AC 2F0LA 1PRTD 2B8FA 1EEFD 2GA4B 2RKSA 1ICWA 1STAA 1W0KA 4RFBA 1QG7A 1SYEA 3P20A 3BCDA 3HOUB 2K01A 2CQAA 2A68D 1UD8A 4PMWA 3H6MA 5C5LA 3WDNA 1S5DD 3I91A 3L7ZC 2X53S 1Q1BA 4KHVA 4XKWA 2Q8TA 4B3FX 1JOKA 4RAUC 2O5IC 1L0YB 1F9QA 2IPKD 3T53B 4PNYA 1AW7A 2BE5C 2L4NA 3I73A 3GTPB 4P22A 1SAPA 2ZXIA 4JBWA 1UEAB 5C5MA 4ASUA 1PTOC 2NTSA 1SBBB 5JEAJ 2XRQD 1TY0A 2R6GA 1SNOA 2BA1A 3KLSX 1DYQA 1ENAA 1IHZA 5IGCA 3PO3B 1KMHA 1SYBA 2WV6D 1O78A 1PFBA 2W6JA 1BCPC 4IQZA 4BWGB 4WRDA 2F0OA 1X3QA 3HRZC 1IYUA 4MIUA 4K5WA 5EPJA 4PMCA 2OEOA 1MABA 2CW0D 3C3LA 2JEAI 2WKCA 4A3KB 3H94A 2FHTA 4BA1I 4XL9A 3EROA 1JOQA 2PZWA 1FR3A 4RCOA 3NTHA 1TWAB 2NN6I 4RHRA 2IX1A 4DK1A 1Y8OB 4BY1B 2NVQB 4XM3A 5TSSA 1QILA 4WORA 4IFDJ 1BF4A 5CV6A 1EY0A 3MXPA 5FO9B 2A73B 3A54A 3HGBA 2D3NA 2KJXA 3GVLA 1J9OA 3VYRA 2W6IA 5C4ZA 1RTOA 4KK7A 1V0FA 4CKEA 2IX0A 5I2XA 4KD3A 1KAAA 3T56B 2R61A 1RD9D 1LTGD 2Z4IA 4QCLA 1SEBD 2TSSA 2PCFB 3BDOA 3R93A 1H9SA 1JR0D 4UZUA 2AQ2B 1KLGD 1A3TA 4AYBB 4LMQD 3HZXA 4QMGA 1CT1D 5KEEA 1HFGA 3M85A 1B44D 4Z1MA 1S5ED 3A3GA 1VMCA 3VR4A 1IW7C 3OWFA 4OGQC 4RHSA 1STEA 3A3BA 1AFPA 3BH4A 1YNJC 2K5WA 1I4GA 1K83B 4I65A 1WTHD 3S15B 2IT1A 2M5SA 1J8IA 2KCCA 5CORA 3X3NA 2WIIB 1EYCA 4KV6A 1VLYA 1I3QB 1SYGA 1CQVA 3TMEA 1ENFA 3WOFA 3DWPA 2B2TA 4XT3B 4F88A 2F0MA 4JK1C 1LTID 2EYJA 2EYPA 3GV3A 1AN8A 3J7AF 4DXFA 4IN3A 5M5YB 4AVZA 1C48A 4XDXA 3S2DB 1SE3A 1TS4A 5ISRA 2YYZA 3DXJC 1D1IA 2XNAC 5C0XJ 5D3DA 2MP1A 1HRJA 1XX8A 4XMYA 2EPBA 5EPLA 1STHA 1UNSA 3J80E 3BDLA 3PO2B 3QOLA 3CHBD 3BG3A 3CP2A 3ZIAA 1VF7A 1B1ZA 3I4LA 3MFGA 1OXUA 1VMPA 2KEDA 1EY6A 5KYIA 4CKBA 1XWEA 3GD7A 4BA2I 5ELFA 3MZ5A 2JSOA 5KYLA 1QNKA 2EXZA 1R4QB 3D4DA 2JXMB 3DDYA 1TS5A 4L6TB 5EJWA 3VR2A 4C3HG 3JAML 5JEAG 1H9RA 1LTSD 3R8BA 2VNUD 3E5SA 1BO0A 3D4RA 2RDFA 3TZUA 3OIPA 4B3GA 3NUCA 3VR3A 1HTLD 2KVOA 5DM63 2YU9B 4XN3A 2JYOA 2H1EA 1EQVA 1PKVA 2LKVA 4EQOA 3Q24A 4C3IB 2EYLA 1NCVA 1ILQA 1I18A 1MBYA 3S1RB 3R3OA 5ELEA 2OF1A 1RDPD 5D3IB 4R8IA 1EFRA 2ZXRA 1UD3A 3X3MA 5JVH3 2PZTA 3SXHA 4TRDA 2K32A 2F1MA 2WKDA 3KBGA 4DU9A 1T5XD 3EJIA 1A3UA 2KOLA 1EL0A 3HAGA 3KUPA 2EZVA 1VCIA 3GO5A 5M9OA 4A3EB 5D14A 1NSNS 2WINB 4KI0A 1VF5C 2F0UA 5FKAC 1QNUA 1XYIA 2KHSA 2HDMA 2XSCA 1G291 2DN8A 5NUCA 2E75C 3M4OB 5IGFA 2Z6BD 1K8MA 1KZLA 2EY6A 4OIKA 1W6JA 1HUNA 3E0JA 3NBIA 1ILPA 1JORA 1Y69U 3LX0A 1R4PB 2A6HC 2Z4HA 2PMZB 4TSSA 3HOXB 5IIFA 3FPUB 1PTOH 4C2MB 1LT3D 1OXXK 4Z9CB 4YEJA 3T13A 2BCOA 4R9WA 3A7AB 4ULLA 2MGSA 3NSWA 1UAPA 5I6WA 3D6WA 4FF1A 2NYZD 2ZTGA 5T1IA 4XN0A 3WOEA 4IUTA 1EY8A 4DGZA 3HP3A 4KY7A 2RDHA 2EY2A 3CRKC 2M9VA 3H91A 3ZYYX 4DAVA 2R93B 2ZZFA 1Q3LA 5FLXL 1KTKA 1F9RA 3K6OA 1QJOA 4KJOA 2PNRC 1WTOA 1BBXC 3GTOB 2E2IB 2JIZA 2ZZGA 1IKLA 1SE2A 1UUPA 5DM73 1I6HB 4XOTA 4K8IA 1O7LA 1DONA 1BUVT 2E2HB 1H9JA 1PMRA 4CGYB 5E1FA 4CJ1B 5IT9E 2Q8IB 2XWBB 3MHBA 4BS9A 3DUZA 3S9WA 3W2DA 1WVLA 1D2BA 2X6LA 4C3HB 2F0WA 2EYHA 1I4HA 3H09A 1WTWA 4E0FA 5COYA 2HCCA 2R92B 5CC4A 2GK7A 2FJ2A 1V1OA 5EGTA 4KKSA 1M8AA 5C0XI 2Y0SB 4J8QA 1EY5A 1LLRD 3DHQA 3URYA 3DWQA 2EJGC 3N6RA 5M5XB 3RLFA 1OHHA 1STYA 1TIID 4DF7A 1BCPB 2O2LD 5KRUA 3BC9A 1PTOB 2NZ1D 1B50A 2NBFA 1EFID 1F2LA 4K2LA 1LT4D 1TS3A 4NW2A 1CQFA 1RTNA 3GTLB 2E2DC 3GTGB 3W3AA 1BDOA 2NN6H 1SNQA 2VJJA 3VYSA 4A3BB 1PRTC 3MTSA 3ONAB 4IFDH 5C0XG 3SK5A 1NRKA 2XRSD 1V43A 2K28A 1BLIA 2RSNA 4XLEA 2LZJA 1WTQA 2R7ZB 3MXGA 4B9WA 2NVYB 5KNCA 1SYDA 5EKKA 2XGJA 3M7GA 3C46A 1JCKB 2F0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZY C;  3VA7 A;  5K36 G;  2AUK A;  2E74 C;  2LMC B;  1O7L A;  3T56 B;  3T53 B;  3LWU A;  1GUG A;  4XIG S;  4G7O C;  3A8J E;  1B9M A;  2BE5 C;  3I73 A;  1HTP A;  4KKT A;  3BG3 A;  2E76 C;  1E2V A;  4DNT B;  1H9J A;  1PMR A;  3OOC A;  4JBW A;  1GJX A;  1T5E A;  1OXV A;  2BDO A;  2Q8I B;  4TKO B;  1YNN C;  1VCI A;  2PCF B;  1VF7 A;  3BDO A;  1B9N A;  2KA7 A;  2D5D A;  2AUJ D;  4DNR B;  1H9S A;  3I4L A;  1DD2 A;  4XTC S;  1OXU A;  3PUX A;  4LJZ C;  2PPB C;  2V4D A;  4G7Z C;  4KI0 A;  3PUV A;  1VF5 C;  4H13 C;  1GUS A;  3GD7 A;  1Q1E A;  1TKW B;  3ND9 A;  3M85 A;  4RCN A;  4BA2 I;  3OPO A;  4KKU A;  1I6V C;  2R6G A;  1Y8P B;  4H0L C;  4KHZ A;  2BA1 A;  3A8I E;  1G29 1;  2DN8 A;  2EVB A;  1GUO A;  1ONL A;  2E75 C;  2D2C C;  5BN4 A;  2A68 C;  4L8J A;  3VR6 A;  1K8M A;  1OXT A;  3PUW A;  4HR7 B;  4KKS A;  3CRL C;  3VR4 A;  2JXM B;  1IW7 C;  1HQM C;  2K7V A;  1O78 A;  4OGQ C;  3U9S A;  2BA0 A;  2A6E C;  3D31 A;  3MXU A;  2QF7 A;  4I7Z C;  3VR2 A;  1Z7T A;  1YNJ C;  3QG1 A;  2A69 C;  4IQZ A;  1E2W A;  1TU2 B;  1LAC A;  2EJG C;  3IKJ A;  4G7H C;  3N6R A;  1Q90 A;  1Y69 U;  3RLF A;  1ZKO A;  5JEA G;  1IYU A;  5C0X H;  4OO1 H;  2A6H C;  1H9R A;  1H9S B;  5BN5 A;  1K8O A;  1A6X A;  3D4R A;  1DCZ A;  2IT1 A;  3A7L A;  3TZU A;  1FYC A;  2A6H D;  3KLR A;  2KCC A;  1Y8N B;  4TQU S;  3MFY A;  2B8G A;  4LK1 C;  3VR3 A;  2EJF C;  1H9K A;  3PV0 A;  5K36 H;  1IW7 D;  2JEA I;  2AWO A;  3SDZ A;  1CTM A;  2A6E D;  4KN7 C;  1V8Q A;  2DNE A;  5KNB A;  1OXX K;  3H94 A;  1SMY C;  4KMU C;  2CW0 C;  5JEA H;  4DK0 A;  3M7N A;  1OXS C;  3M4Y A;  4BA1 I;  1EWH A;  3ND8 A;  3A7A B;  2L5T A;  3W3A A;  4JK1 C;  2K33 A;  2D62 A;  1BDO A;  2NN6 H;  1FR3 A;  2B8F A;  3QIA A;  1VDZ A;  2ZT9 C;  1GHK A;  1HCZ A;  2NN6 G;  3PUY A;  3IFT A;  2A69 D;  2DNC A;  3PUZ A;  4H44 C;  1GUN A;  4IFD H;  2NN6 I;  1H9M A;  5C0X G;  4OO1 G;  4DK1 A;  3FMC A;  2EJM A;  1IYV A;  1Y8O B;  4KN4 C;  3T51 B;  3A8K E;  4IFD G;  2EDG A;  2O5I C;  3CRK C;  1DXM A;  3GQB A;  2JE6 I;  1E2Z A;  3P20 A;  1GUT A;  1V43 A;  3OW7 A;  1GHJ A;  2F1M A;  2BE5 D;  2A68 D;  3NE5 B;  5KND A;  2YYZ A;  3HGB A;  5BN3 A;  3DXJ C;  3WDN A;  3AB9 A;  3L7Z C;  3VR5 A;  1Q12 A;  1QJO A;  4PV1 C;  2PNR C;  1CFM A;  2JEB I;  1Q1B A;  5A35 A;  5KNC A;  3FPP A;  2O5J C;  3LNN A;  1HPC A;  3QJY A;  3I72 A;  3EQL C;  2K32 A;  1ZYR C;  1CI3 M;  1LAB A;  1Z6H A;  3SE0 A; 
#chains in the Genus database with same CATH topology
 2F1L A;  3MAQ A;  5IGG A;  2RQX A;  4DR3 Q;  1E62 A;  4BY7 H;  1CUK A;  5IWA Q;  4O42 A;  4HCS A;  1A15 A;  1PXU A;  5IT9 L;  4JMQ A;  5IE8 A;  2JA5 H;  3C1F A;  1G6Z A;  2H5X A;  2PE3 A;  1JOO A;  1LV9 A;  3TP7 A;  3QFR A;  2NWG A;  5GQO A;  3BVG A;  1OXV A;  4DV6 L;  2RHS B;  2BM0 A;  5C3W A;  4OON A;  4U67 3;  5IYP A;  3PUX A;  1VHO A;  4UP8 A;  2PPB C;  4L5S A;  3J80 L;  1AH9 A;  3PUV A;  4PMB A;  1D6E C;  1FNC A;  3V76 A;  5C3E G;  2F0G A;  2L11 A;  1LTA D;  4A3F B;  1Q86 D;  3I70 A;  1I6V C;  3GTK B;  2FMM A;  3PF5 A;  1A2U A;  3UI2 A;  1EUJ A;  2V7U A;  3L0O A;  4LC0 A;  2HCJ B;  4ZGQ B;  3KJO A;  3CC2 A;  3UDI A;  1G2S A;  3CRL C;  3CCL A;  1RIP A;  1DZ1 A;  1YNX A;  1CA6 A;  3K57 A;  2K7V A;  2MNA A;  4N8X 1;  4DR5 L;  1S0U A;  4HTH A;  1KNE A;  1E24 A;  2KBN A;  1Y1W G;  3A8K A;  1L1O B;  2ZZE A;  4IUU A;  2PIA A;  4NXM Q;  2WYR A;  3L9A X;  3Q23 A;  3LGJ A;  2HQE A;  5DSZ A;  4DV0 L;  5E7N A;  3I56 A;  3BYT B;  1FX0 A;  2B63 H;  4QB4 A;  2V1C C;  1QB5 D;  3M3Y B;  3TDQ A;  3KLW A;  3VO2 A;  1Y8N B;  2DCU A;  2VS1 A;  2WAC A;  3MFY A;  2PNH A;  1MSH A;  3QFS A;  1PRT F;  1IW7 D;  3V96 A;  1WSR A;  3IFD A;  1SJE D;  3LQ6 A;  4WJ4 A;  4NNJ A;  4RA8 A;  4EQ5 A;  1SFO H;  4Y7C A;  5JJI A;  3MHP A;  1TWC H;  4X3T A;  2P5Z X;  1ZEQ X;  4YAL A;  4LF5 L;  1ET6 A;  1EU3 A;  3F1Z A;  5EBD A;  1R9T B;  1PFS A;  4R8N A;  4P75 A;  2A69 D;  4DV4 Q;  3D8G A;  2OK8 A;  1H8H A;  4XR6 A;  1I4R A;  1JMC A;  1NY4 A;  4KN4 C;  1J5E L;  4HED A;  3GQB A;  4CDC C;  2JE6 I;  4TT3 A;  1E2Z A;  1K3R A;  1GXD C;  1MI2 A;  2IJ0 A;  3D3R A;  2ZM6 L;  4V19 0;  1NUC A;  1GHJ A;  2ALY B;  2HD3 A;  2K5N A;  1NBW A;  1IHM A;  2E2I H;  2Q6O A;  2MQH A;  4G4K A;  3QOJ A;  2JJ2 A;  3FPP A;  3U4V A;  3LNN A;  4MYT A;  4U68 A;  4UY8 C;  3M3Y H;  3EQL C;  4UPA A;  1CI3 M;  1QVC A;  1PTO D;  3TEH B;  5M5W B;  3I4M H;  1V1P B;  4XOR A;  1N33 L;  2BN4 A;  2AUK A;  2HMA A;  4ODG A;  4A3K G;  1U4L A;  2EYO A;  1VQ7 A;  4L5Q A;  4WJW A;  5IGE A;  3A8J E;  4AC9 A;  1VQD A;  3FHW A;  4DN4 M;  1PFM A;  4HIK A;  1EYD A;  4A3G G;  2E76 C;  4JI3 Q;  5T1G A;  4FP5 D;  4ID6 A;  1IYJ B;  1VQO A;  2BDO A;  4TKO B;  1QX4 A;  1W9X A;  4LF9 Q;  1CSP A;  3ER0 A;  4DNR B;  2B39 A;  1HVX A;  4FWT A;  4GQN A;  3PO2 G;  2DOG A;  3OSO A;  2JA6 G;  2V7T A;  2XNJ A;  3S2D H;  3PCO B;  3SK4 A;  4RM0 A;  3SVM A;  4ZCK A;  2QTZ A;  5M3F H;  5BSX A;  1GUW A;  2EIX A;  4K8J A;  4UAJ A;  1TLL A;  3HOV B;  3A8I E;  1CHP D;  3OP1 A;  2WB1 G;  3DM1 A;  1PHJ A;  4AQY Q;  5HZA A;  5TR9 A;  2D2C C;  2LY7 A;  4C3I H;  4A3M H;  4L8J A;  3MEF A;  3CCQ A;  2ZBU A;  1QVG B;  1B8A A;  1QUE A;  2HQL A;  1MSG A;  2WAQ G;  4A4I A;  5GAG C;  1PZI D;  5L46 A;  3D31 A;  4MN3 A;  1EEI D;  4GOP C;  3E1Y E;  3OMG A;  1E2W A;  2B2V C;  2WAQ E;  4JI4 Q;  1Q90 A;  2QTL A;  3D4W A;  3GVJ A;  1K8O A;  1VQJ A;  1M4V A;  3LO8 A;  1FGB D;  2KQ3 A;  3G6J B;  4A3L G;  2MHV A;  2R3Z A;  1E3Z A;  3CP0 A;  1TWF B;  2QKI C;  2BM1 A;  4K6L A;  2HUG A;  2JDI A;  2ENB A;  1PFN A;  3P75 A;  3BVZ A;  5C3X A;  2ZZQ A;  2F4N A;  3W2E A;  1B70 B;  3FEW X;  4DR5 Q;  1C0A A;  1S72 B;  2J4X A;  1CKN B;  4XLC A;  3CB4 A;  1HXY D;  1WYD A;  4A3F H;  2V31 A;  2Z0S A;  4ABN A;  1CSQ A;  4X3K A;  3S2H B;  4AF7 A;  2UU9 L;  4NXM L;  4HCE A;  5I9P A;  1I4P A;  4GKK L;  1ML0 D;  4YWM A;  3S1M B;  5C4H A;  2R7D A;  3E0E A;  5I4D A;  1KRT A;  1NR2 A;  4A3G B;  5IYC G;  2EE1 A;  4GN3 B;  3GP7 A;  4DFA A;  4NCN A;  4X66 Q;  2EYF A;  2BH8 A;  1DJR D;  3DWA A;  4G1V A;  1SE8 A;  1JWM D;  4B9X A;  4QY7 A;  4UDU C;  1GAQ A;  3VYU A;  3V05 A;  1E7Z A;  1DXM A;  1KDA A;  2Y0S E;  1GUT A;  2RBM A;  3NE5 B;  3PA1 A;  2XZL A;  3BZK A;  5FO7 B;  2GQF A;  1X3P A;  1EP2 B;  3FKI G;  2X8K A;  4N3G A;  3Q0A A;  1L0X B;  3SEJ A;  5EKI A;  3CMA B;  4OL7 A;  5F4J A;  2IHE A;  1UD6 A;  4DUY L;  1BCP D;  3RUZ A;  4IPG A;  2XIW A;  5K36 G;  1YJW B;  2E74 C;  2I0Q A;  2F52 A;  1IL8 A;  5IGD A;  1B2T A;  2NVT H;  2L55 A;  4N9P A;  1M1K D;  3I90 A;  3WND A;  1K9M C;  4Z4R A;  1KL9 A;  3NBH A;  5IGB A;  4RJL A;  3IAY A;  2D9R A;  1GOZ A;  1UD4 A;  2VBU A;  1TUI A;  3WNC A;  2J7Z A;  3CC4 B;  1JJ2 A;  4A3G H;  4A3D H;  4X62 L;  1G8Z D;  2PQE A;  3KBX A;  1XFO A;  1E64 A;  1JA1 A;  3T1H L;  1YHA A;  2A74 C;  1SND A;  1A8V A;  1XTD A;  2PO4 A;  2B29 A;  3PO2 H;  3HOZ B;  1GUS A;  2R93 H;  3QFC A;  4AQY L;  5FOB B;  2GJP A;  4H0L C;  4PGO A;  1B4O A;  2SNM A;  4KHZ A;  2TMP A;  2Q2U A;  5LL6 S;  4QIW B;  4HJ8 A;  1ZM2 A;  3A35 A;  3B82 A;  3E3X A;  1IKM A;  1GJR A;  2AQ1 B;  1O7I A;  1KK3 A;  3A0J A;  4CKC A;  4HR7 B;  2F3I A;  2MO0 A;  4RD3 A;  1X32 A;  2VB3 X;  3B8H A;  2DIE A;  1ICF B;  2A6E C;  3AQQ A;  3DEO A;  3ZBT A;  5EKL A;  3QO2 A;  1I4Q A;  2EY5 A;  4YHH Q;  1I94 L;  1G6P A;  3VNV A;  1STN A;  2OQK A;  1WDT A;  3NPP A;  4R4T A;  3S16 H;  3Q3A A;  1IBK L;  1H9S B;  2CWA A;  1HJP A;  1NDH A;  1HFN A;  1U2R A;  2EOT A;  4RGN A;  1N36 Q;  2KVM A;  4XD7 A;  3C2P A;  1WOR A;  2YTX A;  1D5M C;  4LUZ A;  4X3U A;  2EQS A;  3J80 c;  2AWO A;  1S5C D;  3RN2 A;  4FXU A;  4XLF A;  3EBE A;  1KK1 A;  2ZXO A;  3OAA A;  1EIG A;  2QA4 A;  1SMY C;  4K0K L;  5KIX A;  3FP9 A;  2FX3 A;  2WJV A;  1RQP A;  4P1V A;  1F2Y A;  2XND A;  3Q22 A;  2EYM A;  4XQQ A;  1R5O A;  4L5R C;  1VDZ A;  2ZT9 C;  1HCZ A;  3K5L A;  2DNC A;  3PUZ A;  3U6B A;  1JB3 A;  1V9P A;  2XEX A;  4B3M L;  4L63 B;  3TZD A;  2E2H H;  4B3R Q;  2ICE C;  2HIX A;  2EDG A;  3H9N A;  1Q46 A;  4BPR A;  4OOS A;  5IP9 G;  3OW7 A;  2EFG A;  2ZJQ A;  5KND A;  1N0U A;  4RGM A;  5M5W H;  3J81 k;  5IK2 A;  2JA8 G;  5AFW A;  3SK6 A;  1QH0 A;  4YXW A;  1D8T A;  4C2M H;  3I1F A;  2CK3 A;  3AST A;  3Q39 A;  5GV7 A;  1CFM A;  3CCU A;  5E3F A;  5JOB A;  4YCU A;  1BPL A;  2A5H A;  1WOP A;  1SR3 A;  2CVR A;  2L1B A;  4R4I A;  4YAF A;  4YY3 L;  2AQ3 B;  2RSO A;  3QE2 A;  1YHB A;  1JE4 A;  1RL2 A;  5ELD A;  5CBE E;  1WPC A;  4II2 A;  4QV2 A;  2WB1 B;  3EFX D;  1EYG A;  3I4M B;  4LFB L;  1E43 A;  1XNQ Q;  1YI2 B;  3A56 A;  1VQ5 A;  1D5X C;  4DR4 Q;  1VQ8 A;  1QFY A;  4DNT B;  5IYN A;  5CV4 A;  4DR6 Q;  1VQ9 B;  5JAV A;  1JWS D;  1K28 D;  1GAW A;  4RDL A;  4M8A A;  3I4N H;  3GV6 A;  3S17 H;  2RCN A;  1XPR A;  2VQF L;  4A3E G;  3TP5 A;  3AVX A;  4AIM A;  1NB0 A;  1Q7Y D;  2NB0 A;  4OWX B;  3HOV H;  1AZP A;  3D0F A;  3K59 A;  2I46 A;  1BQQ T;  5DAU A;  4LJZ C;  2V4D A;  3BQJ A;  2M00 A;  4G7Z C;  1K73 C;  3G7L A;  2K04 A;  2VL6 A;  3FKS A;  3MA2 B;  4K5V A;  1BBU A;  3ND9 A;  1V1Q A;  3I55 A;  1P8L A;  4B4D A;  4RGT A;  4KKU A;  3CPW B;  4IJL A;  2MPM A;  4C3I G;  4DNI A;  3AVV A;  1KDC A;  4GLA C;  3ES9 A;  1NJI C;  1GUO A;  1KD1 D;  4TMV A;  2B2Y C;  2QW7 A;  3NWT A;  3TSS A;  5BN4 A;  1WOS A;  3M4P A;  3K7A H;  2G5D A;  4CDD C;  1HQM C;  1X6O A;  2PQA A;  2RCF A;  3U9S A;  4H7B A;  3ZZT A;  1V0E A;  1Z7T A;  1WSV A;  1TY2 A;  4G7H C;  3IKJ A;  2BGJ A;  4DV2 L;  1YHQ A;  3HOU H;  1STB A;  4P2N A;  5C0X H;  4LF7 Q;  2YU9 H;  4MTN A;  1WD0 A;  1A6X A;  2OCE A;  3U58 A;  2B2T C;  3A7L A;  5E4W C;  3CES A;  2CF4 A;  1B3A A;  2A6H D;  1H95 A;  4IUV A;  4C56 C;  1SMY D;  4JI0 Q;  1HA3 A;  5LMU L;  1EIH A;  3S1Q B;  4WZT A;  4QL5 A;  5BR8 Q;  1E22 A;  2A6E D;  4QVJ A;  1EWY A;  4DAM A;  1PYS B;  4Z4S A;  1Z47 A;  4AYB G;  3RR5 A;  5JEA H;  1TS2 A;  1VQN B;  2CW0 C;  3IL8 A;  4LFB Q;  3M4Y A;  1TWG B;  2C5C A;  3UDF A;  1TQO A;  2L5T A;  1STG A;  2PYK A;  5C44 B;  1FL0 A;  2GN5 A;  4LFC L;  4Z4Z A;  3T1Y Q;  2NN6 G;  1VQF A;  4X0C A;  5IOD A;  1KJZ A;  4JVZ A;  4R71 A;  4H44 C;  1WTV A;  2ICI A;  3HFZ B;  1IYV A;  4G7W A;  3R2T A;  1G91 A;  1VQL B;  1J6Q A;  5FJ8 H;  4LW1 A;  2D9U A;  1DOL A;  2JQO A;  3VDY A;  2JA8 H;  4QF4 A;  3NTI A;  3SGI A;  4GOP B;  2WZN A;  3RNU A;  4RLZ A;  2B5O A;  4Q5V A;  1MD2 D;  4Y7N B;  4JBK A;  1Q12 A;  4BY1 G;  4LBV A;  1WU8 A;  3U9O A;  1SRU A;  5A35 A;  5IT9 c;  1N36 L;  4DV5 L;  3G71 A;  4KLK A;  3VA5 A;  4B48 A;  4G1B A;  4QGU A;  4IPD A;  2YWE A;  4HMJ A;  5FLM H;  3GTM B;  5CBA E;  2XNC A;  3K81 C;  1EOV A;  4P2C B;  1EYA A;  2ZTN A;  4Z4V A;  2B2Y A;  1N33 Q;  2XWJ B;  5F2D A;  4DR3 L;  4EQN A;  4ACB A;  2XGT A;  4A3F G;  1HNX L;  2X6Y A;  5C3E B;  3BZC A;  4XYO A;  5A2Q E;  4PAA A;  3S1Q H;  4O0A A;  4HJA A;  4ZCM A;  1QE6 A;  5JJL A;  1I4X A;  4X7F A;  1VQ6 B;  3QB3 A;  1CKM A;  4OX9 Q;  1H8E A;  2X69 A;  2KHJ A;  2GVB A;  5CV5 A;  3V7A A;  1PH9 A;  1FRN A;  5TY0 A;  1W0J A;  1HZB A;  1Q1E A;  2DY8 A;  5HY6 A;  2JA8 B;  4TMW A;  2CFM A;  2WB1 E;  2HDL A;  3PIP 3;  2BH2 A;  4KHP L;  1Y8P B;  4LFC Q;  1N06 A;  1TWH B;  1NB9 A;  1KNA A;  4OIJ A;  2EVB A;  3ISX A;  4FNF A;  2OTJ B;  1FVI A;  2CWP A;  4FVM A;  1RCV D;  2NUC A;  3TRZ A;  4DV4 L;  4BBS H;  4K1X A;  1EU4 A;  2AWN A;  3CCM B;  4P71 A;  1P16 A;  4G7X A;  3SLN A;  1SSO A;  2CH4 A;  5C4X G;  1BJK A;  2KUM A;  1E3X A;  3K5M A;  3JC6 6;  2QF7 A;  4DAP A;  1XMO Q;  2VQE L;  4ZQ3 A;  3P7J A;  3QG1 A;  4ZKB B;  1XQB A;  2YWG A;  4C3J B;  2HCI A;  3ZPN A;  4O1N A;  1DOM A;  2I5H A;  3DM3 A;  3H0G H;  1CK1 A;  3HKZ E;  1Q86 C;  1F20 A;  1B3Q A;  1W6K A;  2WP8 J;  4RWS C;  1F9S A;  3G4S B;  5A2Q L;  4A93 B;  4LF6 L;  1GKH A;  4TQU S;  2X6X A;  5FLX E;  4XKV A;  4DUZ Q;  4LK1 C;  2F0E A;  5EAY A;  4JI8 L;  1JIC A;  2NZH A;  3PV0 A;  4NDX A;  1XMQ L;  1PA6 A;  4FF4 A;  2EIF A;  4CDE C;  1G7R A;  4Z4T A;  2QIL A;  1K83 H;  2QE7 A;  5M3M B;  1HR0 Q;  1UD5 A;  3ND8 A;  5LHY 1;  4DR4 L;  4DR6 L;  2HHH L;  1I50 B;  1EZ8 A;  1WOC A;  2F3V A;  4R4C A;  4J0Q A;  4LF5 Q;  1BX1 A;  2ID0 A;  3N52 A;  5GAH C;  4X62 Q;  1WCM B;  2GK6 A;  4A3J H;  3NHH A;  2UXD Q;  2H4O A;  3MEH A;  5CV9 A;  1JWU D;  2F0T A;  1HZE A;  1GUN A;  2BGI A;  2OT2 A;  4OO1 I;  4IFD G;  3JQQ A;  2FMC A;  3K7U C;  2AHO A;  3KDF A;  4A3I B;  1FJG L;  1HNZ L;  3EIV A;  4QUF A;  3PMF A;  1KLU D;  3ONY A;  3VNU A;  5FL7 A;  1ESF A;  4JI1 Q;  2CHB D;  4C3J H;  5IYB G;  3ULP A;  2K14 A;  4EQP A;  1PJ6 A;  4J6H A;  2X6G A;  1OTC A;  4AYB E;  1KDB A;  4F8M A;  2IWH A;  4M0L A;  1HPC A;  2D3L A;  1JNY A;  2N55 A;  1LO5 D;  4L5T A;  4M1U B;  1XMQ Q;  2ZXP A;  4FO2 A;  5J22 A;  1TWG H;  1UE5 A;  3VA7 A;  2CRV A;  2QGQ A;  1IJF A;  2FFK B;  2LMC B;  2QDB A;  1Y1V G;  2ZJP A;  2L9H A;  4KTA A;  3U4Z A;  3OW2 B;  4FYD A;  1SYF A;  2KEE A;  1HTP A;  2CH4 W;  3GTO H;  1E2V A;  3CP8 A;  1XNQ L;  2KCM A;  4A93 G;  1YNN C;  4HSP A;  2RHQ B;  2F0I A;  1T6Z A;  3CCL B;  2LFN A;  5DEH A;  2M2L A;  2B63 G;  4CDF C;  3I4N G;  1T6Y A;  3R6J A;  3VYT A;  4OP7 A;  1SKQ A;  3UDG A;  5A89 A;  1YJ9 B;  2UU9 Q;  1EQT A;  3H15 A;  3SJZ A;  3ZC3 A;  2IX3 A;  1Y0Y A;  2HIV A;  3I56 B;  4KHP Q;  2X6W A;  1ONL A;  1MHW C;  3I7F A;  4GLX A;  3QSY A;  3CCE B;  3U50 C;  1ROD A;  3VR6 A;  1N34 L;  3AMU A;  1E1O A;  4DAY A;  2E2J B;  2BA0 A;  1D8L A;  4WZK A;  2UUA Q;  2ATW A;  3OIQ A;  1VQM A;  2VUM B;  3S14 B;  3OZV A;  1SYC A;  1FJG Q;  3S2H H;  2KCT A;  4IJH A;  3ULJ A;  1MRZ A;  2OK7 A;  4UZE A;  5BN5 A;  2F3W A;  4JI5 Q;  1CHQ D;  3HEJ A;  3R6K A;  2KEC A;  1FYC A;  2GJR A;  1KC8 D;  3J7Y W;  5CYU A;  4LAA A;  1H9K A;  4YEL A;  3MXN A;  4DUZ L;  5DN6 A;  3KF6 A;  1Y14 B;  4JI6 L;  1UEB A;  4RD1 A;  1Q82 D;  2OBT A;  4A3C G;  3ONU A;  3KF8 B;  4Y9R A;  4N9T A;  1IBL L;  4DK0 A;  2K05 A;  1HNW L;  2F4V Q;  2Q6I A;  3M9B A;  2D62 A;  3GTJ B;  2K52 A;  4OPS A;  1RQR A;  5HZB A;  1QWY A;  1IXR A;  3QIA A;  1AEX A;  1BNZ A;  4C3J G;  4A3K H;  2L12 A;  5FLX c;  2RVL A;  3NK9 A;  4PQX A;  2R9V A;  1NAP A;  5EQ0 A;  5CR3 A;  2JA5 G;  2CQO A;  4JV5 Q;  2UUC L;  4WFN 3;  1KIX A;  3K80 C;  4FF2 A;  3T51 B;  1V1P A;  2WPD A;  1U4R A;  1KRH A;  4OHJ A;  4ILW A;  4P25 A;  4LUO A;  1KC8 C;  2DUD A;  4LNQ A;  2HT1 A;  1KHI A;  3W2H A;  1QZG A;  3GSI A;  1K8A D;  4LF4 L;  2BE5 D;  3VMF A;  3AB9 A;  1GVP A;  5CDF A;  2X3U A;  3SEB A;  2QEX A;  4PAB A;  1VQI A;  4PV1 C;  2R6H A;  1U4M A;  2JA5 B;  4M2L A;  3JU4 A;  3M4O H;  4OOX A;  3BDC A;  4S3S A;  5KNL A;  2MJ8 A;  4LFA L;  1LAB A;  4FXG C;  5JPM C;  4ROX A;  3A8J A;  1CA5 A;  2UXB Q;  2ZM6 Q;  1F2Z A;  3ERS X;  4RPB A;  3TBI B;  3RY8 A;  1B9M A;  3WWV A;  1ET9 A;  4GKJ Q;  3AVU A;  1QUF A;  5BSY A;  3R2I A;  4HSV A;  2SNS A;  2ES2 A;  3OOC A;  4X05 A;  1E63 A;  3BVM A;  3V2T A;  2ZTC A;  4ZRZ A;  1DOK A;  5J1Z A;  3HOY B;  1DD2 A;  1RHP A;  2RC5 A;  3OZW A;  2F0D A;  2R93 G;  4LBW A;  3NXW A;  1VLO A;  1JQY D;  4IUN A;  4K2K A;  4BBR G;  1WTP A;  1KRS A;  4H13 C;  2UUB L;  1CZG A;  4RCN A;  2CCZ A;  3ZBU A;  1S3O A;  1YZ6 A;  4B43 A;  4HJ9 A;  1WFQ A;  3TP6 A;  4XLH A;  1SNP A;  4YAU A;  1S5F D;  2A68 C;  4IUQ A;  1NR4 A;  2QEJ C;  1I8D A;  3VO1 A;  3HS0 C;  1COW A;  1XNR Q;  1ENC A;  5FO8 B;  2NVX B;  1G7T A;  1S72 A;  2NZO A;  4IFD I;  4BBR B;  3H0G G;  2AMC B;  4ME5 A;  3JAM i;  3CCS A;  1F77 A;  1IBM Q;  3S1R H;  1EZ6 A;  1ZKO A;  4OO1 H;  3UE1 A;  4DA2 A;  4B3R L;  2I07 B;  1DCZ A;  2IL8 A;  1EXM A;  1E0B A;  5M3M G;  3HKZ B;  4CBV A;  2F03 A;  3F2U A;  4A3M B;  3I4N B;  1EP1 B;  2YTY A;  4IUP A;  2PZU A;  3WYA A;  2K5D A;  1CTM A;  4FXD A;  2DNE A;  5F4M A;  1O80 A;  2ZBV A;  3CC2 B;  1OXS C;  2G9H D;  2UUB Q;  4X07 A;  1DM0 B;  3OWE B;  3NQT A;  3DMU A;  1ESR A;  1I6H H;  2EY1 A;  4WQM A;  2K75 A;  1A63 A;  2K1B A;  5K5P A;  2R92 H;  2UXC L;  2O4X A;  1H9M A;  4OO1 G;  2XZP A;  3SK8 A;  3FMC A;  4Y7N H;  4RD4 A;  2PLF A;  3MMP A;  3CMM A;  4KY6 A;  4P73 A;  2SEB D;  5IP7 H;  5M5X H;  1YBY A;  3CPX A;  1C8C A;  2JA7 H;  2PI2 A;  4C3H H;  5KW9 A;  5LL6 X;  4R4O A;  2ZXH A;  1PZJ D;  3S1N H;  4B08 A;  1Q8K A;  5M3F G;  4FF3 A;  1V5V A;  3KEW A;  1SDF A;  2JEB I;  2GPJ A;  2XOK A;  4XNF A;  1B23 P;  1LYL A;  1X54 A;  1FNB A;  4JBM A;  4HJ5 A;  3E6Z X;  2VQE Q;  1SJH D;  1ZYR C;  4XYQ A;  2B2W C;  3RZD B;  1Z6H A;  5FK9 C;  5C4J B;  1OB0 A;  4GZY C;  2BV3 A;  1VQK B;  3OTO Q;  4DR2 Q;  3LWU A;  1GUG A;  4HE6 A;  1PLF A;  1OGI A;  1D1K A;  1S40 A;  1K8A C;  4B3X A;  4ZK9 B;  4XOP A;  4ZKC B;  3CQZ H;  1CQX A;  1GJX A;  3AEV A;  2BF4 A;  1W34 A;  1PH3 A;  2JA6 H;  1AE3 A;  3MWY W;  1Q82 C;  2G9D A;  4V0B A;  5CV8 A;  5HKK A;  3PUM A;  3OEH A;  4DXG A;  3AU7 A;  4P6V F;  1O7Z A;  4JI4 L;  4F87 A;  1EY9 A;  2R7Z G;  2LSS A;  3HOW B;  1E1Q A;  2OWO A;  3CRZ A;  1SMX A;  3W5V A;  4GNX B;  1BXT A;  1D5Z C;  3PQI A;  3U2Q A;  1U9R A;  4A3E H;  4LF9 L;  3ITP A;  4A3D B;  1RF2 D;  2MFI A;  4H02 A;  4Q0F A;  3TRE A;  2CBX A;  3EN2 A;  1PH4 A;  1JC7 A;  3MXU A;  3I8Z A;  4I7Z C;  4OEL B;  4K6D A;  4X6A H;  3OMC A;  2JA7 B;  3DEP A;  3C1E A;  3SHL A;  3HOZ H;  1LTB D;  5THX A;  3CCJ B;  2VJI A;  4BY7 B;  3Q6S A;  1LT6 D;  3MCA A;  2E1B A;  1IZ6 A;  4IZ8 A;  2LXJ A;  2VXW A;  3GTQ H;  1JJC B;  1TVX A;  3RZO B;  1UE7 A;  1JJG A;  2K50 A;  4UHV A;  3CME B;  3PO3 H;  2BPO A;  2PW5 A;  4XON A;  3HG9 A;  3DLL A;  1V8Q A;  2XN9 C;  4DV5 Q;  4KMU C;  2QN6 A;  3CCQ B;  4Y52 H;  1XE1 A;  4PG3 A;  1QVG A;  1B53 A;  4CQJ A;  2E1R A;  2FIN B;  5B6I A;  5E6T A;  2Z8L A;  1WD1 A;  1GHK A;  2F43 A;  4P3I A;  4TMX A;  2B2W A;  2WR8 A;  1W87 A;  3RN5 A;  1DAR A;  4PC1 A;  2F0H A;  5ELB A;  3K0Y A;  5C3E H;  2EJM A;  2F0K A;  1VQP B;  2SOB A;  1XNR L;  3LVB A;  1SXT A;  4I7A A;  5JVG 3;  2DY7 A;  1O7Y A;  2UUC Q;  4IAL A;  2VW9 A;  4HN7 A;  4OWW B;  5IYQ A;  1PDQ A;  1YI2 A;  1SN8 A;  4RKL A;  4A3I G;  4ZAI A;  4NPS A;  1VQ8 B;  2R92 G;  4RGO S;  2PW7 A;  3VR5 A;  2VUM G;  4Y9U A;  4A3B H;  2UXC Q;  1NBM A;  2O5J C;  1TT2 A;  3QJY A;  1PJ7 A;  1RJT A;  3H3V I;  5I2Y A;  2JK8 A;  2GRE A;  3SE0 A;  1WP6 A;  1VQ4 A;  4DUY Q;  4NB3 A;  3O13 A;  2F0F A;  1HNZ Q;  3PIO 3;  1WI5 A;  4XIG S;  1CM9 A;  4G7O C;  5CMD A;  1YNN D;  3CPW A;  3RD4 A;  4JC0 A;  4P72 A;  4U9U A;  1L0W A;  4B3S Q;  3HOY H;  1HH2 P;  1LTT D;  5E4X A;  3U6K A;  3LWE A;  1T5E A;  4BBS B;  1BCP F;  2Q8R E;  1WTX A;  2JJQ A;  2K03 A;  2B63 B;  1P4M A;  1B9N A;  4X3S A;  4DV2 Q;  2HLD A;  1W2B A;  2CKZ B;  5AN9 A;  4EH1 A;  3BS1 A;  1YNJ D;  3D6C A;  3W5U A;  4DV0 Q;  2OTL B;  2C5B A;  3CD6 A;  1E79 A;  2I1L A;  3CMA A;  1YHQ B;  1E3P A;  1SRO A;  4BY1 H;  3TN2 A;  3GIR A;  3KK7 A;  5LMN W;  1ZXT A;  4IUR A;  1SFO B;  3S14 H;  1N9W A;  1G2T A;  3K5N A;  1QUQ A;  2C9O A;  1QVF A;  2L15 A;  1FNU A;  2K5H A;  3I3C A;  1Y1W B;  4XQJ A;  2B3G A;  2B2V A;  3HKZ G;  3EA6 A;  4RD2 A;  3PA2 A;  5ELC A;  5CGK A;  3S17 B;  3FJO A;  4DV6 Q;  4KJN A;  4KD4 A;  1PH8 A;  1OB5 A;  2Z1C A;  1TWF H;  1R5B A;  3H3V H;  3KLS A;  1SE4 A;  1X55 A;  2HHH Q;  1PV4 A;  1JJ2 B;  1LAC A;  3CC4 A;  3OEE A;  3W2I A;  2F0Q A;  1PYW D;  4DK6 C;  5M5Y H;  2UXD L;  1EFU A;  1KAW A;  1K8G A;  2AKW B;  4A76 A;  1A62 A;  1TTT A;  1ASZ A;  1EWI A;  2C4U A;  1S4M A;  4E6I A;  4PC7 A;  3BU2 A;  4RCZ A;  3A55 A;  4CJ0 B;  3K7A B;  2B8G A;  3S24 A;  4LF6 Q;  2EJF C;  2NTT A;  5KGU A;  1N32 Q;  4FN5 A;  2B2U C;  4YY3 Q;  1QFJ A;  2V7W A;  5K36 H;  5JPN C;  4OPV A;  2F0J A;  3BYY B;  4YWK A;  4X06 A;  2QDL A;  1K3B C;  3W2G A;  2C5H A;  1VQE A;  5IOC A;  1QCB D;  4KY5 A;  2GVA A;  2X0K A;  4NXN Q;  2JP1 A;  1UD2 A;  2OQ0 A;  3HOY G;  3A8I A;  4FXK C;  1W35 A;  5HGT A;  3Q38 A;  3CU7 A;  3CTA A;  4G57 A;  1U5K A;  5DNF A;  5EBC A;  3G48 A;  1I7P A;  3TS0 A;  3NEN A;  4XLA A;  3RLO A;  1KXL A;  1A2T A;  3TP8 A;  4DV1 Q;  2XZO A;  5G3L D;  3G6E B;  2WZP P;  3RMH A;  3S15 H;  1X3E A;  4C43 A;  1Q8I A;  1HNX Q;  3OFN A;  4M53 A;  2N88 A;  2F4V L;  1SNM A;  1BQE A;  1TWC B;  3H3V C;  3ASP A;  2WAQ B;  2DYI A;  2NVT B;  4XQN A;  2VUM H;  3I4O A;  1LT5 D;  2QMU A;  1XXG A;  2J0T D;  3AVY A;  2V7V A;  3EVQ A;  1HUM A;  1TR5 A;  1UMK A;  4EGV A;  3S1N B;  1NTG A;  3I72 A;  1W3S A;  3J7A V;  2NV4 A;  1Q7Y C;  3KYH C;  2SDF A;  1HA5 A;  2X85 A;  1EOT A;  4XT1 B;  5JBQ A;  2ZTE A;  4TVA B;  5C44 G;  2D74 A;  2F0V A;  2FXQ A;  1LTL A;  1XTC D;  4G6I A;  4PZ7 A;  1MGS A;  4X64 Q;  1DDI A;  4GKJ L;  4Z4Y A;  1NJI D;  1WCM H;  3OHX C;  4HMI A;  5JJK A;  3WBK A;  4EVO A;  2KA7 A;  2D5D A;  1MKH A;  1A3V A;  1EWC A;  1ZYR D;  4XTC S;  1OB2 A;  1YJN A;  4A3I H;  2F0P A;  4PZ6 A;  4OX9 L;  4QUZ A;  1N05 A;  1OGJ A;  2DY1 A;  2JA9 A;  1SKY B;  1S5B D;  4HAE A;  4F7X A;  1J9Z A;  5I6Y A;  4C0S A;  3CCU B;  4K5X A;  4MHE A;  4UAI A;  1GM5 A;  1ELO A;  5CV7 A;  3S16 B;  1U4P A;  1F9P A;  1HZC A;  4RD0 A;  3P1H A;  3FKI B;  4ZYS A;  5FLM G;  3SJP A;  4NP5 A;  3PUW A;  1YIJ B;  1SM4 A;  2WJY A;  1GD7 A;  1N34 Q;  3QWN A;  4DV3 L;  2YWH A;  1VQ5 B;  1XPU A;  3GTQ B;  1OO9 B;  4GKK Q;  1X65 A;  5JJZ A;  2A69 C;  4O2D A;  5M3F B;  3T16 A;  2QCP X;  3CCR B;  5LMN Q;  2F0S A;  2RDG A;  2IW3 A;  4OOV A;  2QGG A;  2K5V A;  3HOU G;  3M4Q A;  1YIT A;  1UWV A;  1H85 A;  1EFW A;  1GO2 A;  2K5Q A;  2BDN A;  3ZZU A;  3CC7 B;  5I9O A;  3HOX H;  3JAM c;  4KN7 C;  3JAM E;  2F4I A;  4RH6 A;  4XQF A;  1Q9S A;  1II3 A;  5BR8 L;  3M7N A;  1LTR D;  5DLQ E;  3FDT A;  4ZUJ A;  1EWH A;  3FRP B;  4RMF A;  3K58 A;  1KAB A;  3UDX A;  1NMG A;  2GJK A;  3J7Z C;  4AF6 A;  3W5H A;  5A88 A;  2K4K A;  5J39 A;  5A8A A;  3PUY A;  3IFT A;  3QR8 A;  4J1M A;  3B6Y A;  1BMF A;  3PEN A;  3HOW G;  3AYH B;  1Y1V B;  2KCN A;  4NMZ A;  4OXP A;  1QGA A;  4X66 L;  3J7A 5;  1KK0 A;  1FNW A;  3A8K E;  3A74 A;  3G05 A;  3PF4 A;  1BR9 A;  4OEM B;  3BCF A;  3OW2 A;  5G3L F;  3HOV G;  2RA4 A;  2JJ1 A;  4FDB A;  2NVQ H;  2L0C A;  3J81 E;  4ZLT F;  4NBS A;  5BN3 A;  1BX0 A;  2D0O A;  5H59 A;  2JA7 G;  1VJS A;  1VQN A;  1FD7 D;  3NWS A;  3AGQ A;  3MVV A;  2MUY A;  3BNW A;  3CCV B;  3BZD B;  1EY4 A;  2VB2 X;  3CQZ B;  1HA6 A;  2WSS A;  4ZCI A;  2OXP A;  1HHV A;  3FVQ A;  4RDJ A;  1HZA A;  3K0X A;  1WTR A;  1LUZ A;  4B47 A;  1QOH A;  5HUR A;  4KKT A;  2DER A;  2LS0 1;  1S4Z A;  5C6A A;  1E1R A;  1ZUN B;  4II3 A;  3K5O A;  4JBJ A;  4JI8 Q;  1L1O A;  2K6A A;  4QUC A;  1BBW A;  1CZW A;  2AUJ D;  1BOS A;  4DAY B;  5LMN L;  1NNX A;  5IP9 H;  2VNJ A;  3ERQ A;  1PRT B;  5EPK A;  2Z6K A;  4XXE A;  4RKB A;  3NP8 A;  2B2U A;  3SR1 A;  1EY7 A;  1AP0 A;  3PUN A;  1FNV A;  1TKW B;  3G71 B;  2E8G A;  3NQI A;  3OPO A;  3CXC A;  1K0R A;  3CKI B;  4BXX H;  1CNF A;  1GVH A;  3GVK A;  1JE5 A;  4CHT B;  4R1J A;  1OXT A;  2XVS A;  5H1S E;  1RKN A;  5C44 H;  1QG0 A;  4JYA Q;  3GTK H;  5D65 A;  2OYN A;  1C4Q A;  2Z6B A;  3KF8 A;  4A75 A;  4PC3 A;  4C1N K;  4NKL A;  3J81 L;  3A5U A;  4B3M Q;  1TU2 B;  4CJ2 C;  2C2W A;  4JPB W;  1F2M A;  1QZH A;  3L3O C;  4ZCL A;  5C4X B;  4DV7 Q;  3ZUG A;  1VQG A;  4YIJ A;  1SNC A;  1HQR D;  1I3Q H;  3KLR A;  1FRQ A;  1EQR A;  2A1A A;  1PH7 A;  2JA6 B;  3OE7 A;  2BOS A;  3MC0 B;  4C1N I;  1AZQ A;  2V7Q A;  3SDZ A;  2R7Z H;  2YV5 A;  4A3J B;  1VQC A;  5KNB A;  2OTJ A;  3H0G B;  3WQZ A;  2XTI A;  4M1K A;  1PTO F;  3CCM A;  4HIZ A;  4ZUI A;  3OKX A;  4K14 A;  3NTK A;  4A3L H;  2K33 A;  1PZK D;  1R5N A;  4TSF A;  2F0L A;  1PRT D;  3T4A C;  2B8F A;  2QEX B;  1EEF D;  3F8T A;  2Z9H A;  1TXY A;  3JQP A;  2GA4 B;  1G7C A;  3ASQ A;  5TRD A;  3OTO L;  1YVC A;  1VQ7 B;  4YAO A;  1DGS A;  1GO3 E;  2RKS A;  3J80 i;  5FIU A;  4QQB X;  1ICW A;  1QGY A;  1STA A;  1W0K A;  4RFB A;  1QG7 A;  1YLO A;  1SYE A;  3P20 A;  3BCD A;  3HOU B;  2K01 A;  1KD1 C;  4DK3 C;  3CW2 A;  2CQA A;  2A68 D;  1UD8 A;  4PMW A;  3H6M A;  5C5L A;  3WDN A;  1S5D D;  3I91 A;  3L7Z C;  4WJ3 M;  1MJC A;  2X53 S;  1C7Y A;  1Q1B A;  4KHV A;  4XKW A;  2Q8T A;  3E9I A;  2NVY H;  4B3F X;  3GTJ H;  1JOK A;  4UP9 A;  4RAU C;  2O5I C;  3A5Z B;  3T1H Q;  4DR7 Q;  1L0Y B;  1F9Q A;  4PZ8 A;  5C4X H;  2IPK D;  3T53 B;  1X3G A;  2I5M X;  1PYB A;  1AW7 A;  2BE5 C;  2L4N A;  4PNY A;  3I73 A;  3GTP B;  4P22 A;  1SAP A;  2VNK A;  2OBS A;  2ZXI A;  1KQS A;  2C78 A;  4JBW A;  1N08 A;  4ZV4 A;  4LF8 L;  3PSI A;  4IW3 B;  1QFZ A;  3QFT A;  1UEA B;  3HKS A;  5C5M A;  4ASU A;  1PTO C;  1VQA A;  2NTS A;  3I4M G;  4ACA A;  3W1B A;  4WZE A;  1SBB B;  4A3D G;  5H5J A;  5JEA J;  2Q2T A;  2XRQ D;  1TY0 A;  4P9S A;  2R6G A;  1SNO A;  2BA1 A;  3KLS X;  5IYC H;  1DYQ A;  2DEU A;  1TWA H;  1ENA A;  4TN1 A;  1IHZ A;  5IGC A;  4MYU A;  1M90 C;  5IYW A;  1R9T H;  4JI0 L;  3PO3 B;  4P6Y A;  1KMH A;  1SYB A;  2WV6 D;  1O78 A;  2ASB A;  3PGZ A;  1PFB A;  2W6J A;  3WY9 A;  1BCP C;  4Q7J B;  4IQZ A;  4BWG B;  4WRD A;  4X65 L;  2F0O A;  1X3Q A;  3HRZ C;  2QDX A;  5GAE C;  5M3M H;  1IYU A;  4MIU A;  4K5W A;  1JA0 A;  3SLD A;  1YEZ A;  3IRB A;  4EX5 A;  4A3B G;  5EPJ A;  1FND A;  4UP7 A;  4FK8 A;  2ZL7 A;  4RD6 A;  3OYY A;  2E2J H;  1YJ9 A;  4B44 A;  4PMC A;  4TMT A;  2B7B A;  2OEO A;  5DS0 A;  1MAB A;  1T6X A;  2VBS A;  1E1T A;  2CW0 D;  3C3L A;  2JEA I;  1N8R C;  1ZM3 A;  2VY3 A;  2WKC A;  4A3K B;  1JB9 A;  3H94 A;  1SLJ A;  2C4T A;  3OJW A;  1NMF A;  4GN4 B;  2FHT A;  4BA1 I;  4JOI C;  4XL9 A;  3ERO A;  1JOQ A;  2PZW A;  3Q6Q A;  5KSW B;  4B3S L;  1FR3 A;  4RCO A;  3STB D;  2DET A;  4Z4U A;  1Y1V H;  1A0I A;  1Y1W H;  2KEN A;  3NTH A;  1TWA B;  2NN6 I;  1EFT A;  4RHR A;  2IX1 A;  2PMZ E;  4LBY A;  4DK1 A;  1Y8O B;  4BY1 B;  4LFA Q;  1FDR A;  4P12 A;  4LWC A;  1VQK A;  2NVQ B;  3E9H A;  4XM3 A;  1PH6 A;  4J15 A;  5TSS A;  1QIL A;  3MXN B;  4WOR A;  3KF6 B;  1BF4 A;  3PO3 G;  4IFD J;  5CV6 A;  1EY0 A;  3MXP A;  3WNB A;  2A73 B;  5FO9 B;  3A54 A;  3HGB A;  4YWL A;  2D3N A;  2KJX A;  2Q2I A;  3GVL A;  1J9O A;  3VYR A;  2W6I A;  1NE3 A;  3F2C A;  5C4Z A;  1RTO A;  1PH1 A;  4KK7 A;  1V0F A;  3HOZ G;  4CKE A;  2IX0 A;  5I2X A;  1MJE A;  4A3M G;  4KD3 A;  1KAA A;  1HR0 W;  1CNE A;  5HXB A;  3F2B A;  3T56 B;  4B3T Q;  2R61 A;  3RLN A;  1RD9 D;  1LTG D;  1J5E Q;  2Z4I A;  1AMO A;  4QCL A;  4GNX A;  3E20 A;  1L1O C;  1SEB D;  2TSS A;  3AVW A;  2PCF B;  3BDO A;  3R93 A;  5IYD H;  4DR1 L;  1H9S A;  1JR0 D;  4RDK A;  3KJP A;  4UZU A;  2AQ2 B;  1KLG D;  1A3T A;  3HOW H;  4AYB B;  4LMQ D;  3GTG H;  3HZX A;  4QMG A;  4JI6 Q;  1CT1 D;  5KEE A;  1HFG A;  3CCJ A;  3GTL H;  3M85 A;  1WTH A;  1B44 D;  4QFM A;  2Q6K A;  4Z1M A;  1S5E D;  1XJV A;  1VQO B;  3A3G A;  4QHY A;  1WJJ A;  2BSA A;  1VMC A;  3S1M H;  3VR4 A;  4DQL A;  3ZZ0 A;  1IW7 C;  3OWF A;  4OGQ C;  4RHS A;  1STE A;  3A3B A;  5IP7 G;  1AFP A;  3BH4 A;  1AE2 A;  1YNJ C;  2K5W A;  3GTP H;  4GN5 A;  1I4G A;  1K83 B;  4B3T L;  1K0S A;  4I65 A;  5GRO A;  1WTH D;  4X7E A;  3S15 B;  2IT1 A;  2M5S A;  1J8I A;  2KCC A;  5COR A;  3X3N A;  1IJE A;  3W2F A;  2WII B;  1EYC A;  1JB7 A;  1A8P A;  2Z6K C;  4KV6 A;  1DDG A;  3OJX A;  1VLY A;  3ASS A;  1I3Q B;  1SYG A;  1CQV A;  2BMW A;  3KL9 A;  3KOJ A;  4DR2 L;  3TME A;  1ENF A;  1VQP A;  3WOF A;  5AJ3 Q;  3DWP A;  2B2T A;  4XT3 B;  3UE0 A;  1N07 A;  5IY0 A;  4F88 A;  2F0M A;  2LXK A;  4JK1 C;  2ZL6 A;  1VHE A;  2N49 A;  3CCS B;  1LTI D;  3FKI H;  2YTV A;  2EYJ A;  3AGP A;  2EYP A;  3AFQ A;  3GV3 A;  1AN8 A;  4RPD A;  1BKB A;  1X56 A;  3J7A F;  4JOI A;  4DXF A;  2J7K A;  4HE5 A;  1LM0 A;  4IN3 A;  4X7D A;  1CKN A;  2E5L L;  5M5Y B;  4LUV A;  4AVZ A;  1C48 A;  4XDX A;  3S2D B;  1SE3 A;  1TS4 A;  4OWT B;  3AFP A;  5ISR A;  4BY7 G;  1EIF A;  2YYZ A;  1Z9F A;  3RZD H;  3DXJ C;  1D1I A;  2XNA C;  5C0X J;  4JI1 L;  3STB C;  1HR0 L;  4RCY A;  5D3D A;  2MP1 A;  1HRJ A;  3I55 B;  1XX8 A;  2KHI A;  2JN9 A;  4XMY A;  2EPB A;  5EPL A;  1STH A;  1UNS A;  4PC2 A;  3J80 E;  5GV8 A;  1EP3 B;  3BDL A;  4DPG A;  3PO2 B;  3PIO A;  3TS2 A;  4H9G A;  3BY1 A;  3QOL A;  3CHB D;  1L2F A;  3BG3 A;  1QVF B;  1QUQ B;  4ALP A;  2NVX H;  3CP2 A;  3ZIA A;  3CF5 A;  1PJ5 A;  5J35 A;  2DJF C;  3A1P A;  3F2D A;  1VF7 A;  1ASY A;  1B1Z A;  1N8R D;  3I4L A;  5TV2 A;  4LF8 Q;  1EIY B;  4M4S A;  3MFG A;  4JI2 Q;  1ZM4 A;  1OXU A;  1VMP A;  2KED A;  1EY6 A;  3PVD A;  5KYI A;  3WXM A;  4CKB A;  1YJW A;  1XWE A;  5FNZ A;  3GD7 A;  4JG2 A;  1D1N A;  4BA2 I;  5ELF A;  3MZ5 A;  3AVT A;  4F7D A;  2JSO A;  5KYL A;  4MZ9 A;  3NBH B;  1QNK A;  2EXZ A;  3GTM H;  1R4Q B;  3D4D A;  2RC6 A;  2OBR A;  1VQH A;  3NEM A;  2JXM B;  4POG A;  1YX2 A;  5FA6 A;  3DDY A;  1TS5 A;  2JN4 A;  4L6T B;  5EJW A;  5ELO A;  3VR2 A;  4C3H G;  2C35 B;  1KTV A;  3JAM L;  5JEA G;  1H9R A;  1LTS D;  3R8B A;  2VNU D;  3E5S A;  5IYR A;  1BO0 A;  3D4R A;  2ZIT A;  2RDF A;  3TZU A;  1BVS A;  4BBS G;  1VQL A;  4HJ7 A;  3OIP A;  4YHB A;  4B3G A;  1WOO A;  2FVG A;  3NUC A;  3VR3 A;  3T1Y L;  1EQQ A;  1DG1 G;  4MNO A;  1HTL D;  4HIM A;  2KVO A;  1TWH H;  4YCW A;  4DR1 Q;  2ZJR A;  5DM6 3;  4G5G A;  2YU9 B;  1XB2 A;  4QIW E;  4A3C H;  5J3O A;  2ZL5 A;  4WZL A;  4XN3 A;  2JYO A;  2H1E A;  2DJG C;  2VYQ A;  1EQV A;  1PKV A;  5C4J H;  4OPO A;  4GLV B;  2RF4 A;  1PVO A;  2LKV A;  1UE6 A;  4EQO A;  3Q24 A;  1PH2 A;  2YWF A;  2UXB L;  4C3I B;  2NPF A;  1C9O A;  2EYL A;  4JV5 L;  1NCV A;  1ILQ A;  1I18 A;  4IOC A;  2QA4 B;  3NEL A;  1MBY A;  3CME A;  3S1R B;  2CW5 A;  3R3O A;  5ELE A;  4BXX G;  4X7C A;  2OF1 A;  1RDP D;  2P3M A;  1KK2 A;  5D3I B;  4R8I A;  1VQ6 A;  1EFR A;  2ZXR A;  1UD3 A;  2WFW A;  1N32 L;  4WWV A;  1B2R A;  3X3M A;  5JVH 3;  3BJU A;  2PZT A;  3GDE A;  2Q6L A;  1B7Y B;  3SXH A;  4HID A;  2Y0S G;  4IPH A;  4TRD A;  1ZM9 A;  4QVA A;  1I50 H;  2K32 A;  2F1M A;  1YJN B;  2WKD A;  3KBG A;  4DU9 A;  1T5X D;  3B78 A;  2VZA A;  1M90 D;  3EJI A;  2IY5 B;  4BBR H;  1U0L A;  4GS3 A;  1A3U A;  5FO1 A;  2PI2 E;  2R7F A;  3ULL A;  1X9N A;  4PC6 A;  1VS0 A;  2KOL A;  4X64 L;  4DV1 L;  3CW2 C;  4LF7 L;  1EL0 A;  4MTK A;  3D26 A;  3HAG A;  3KUP A;  2EZV A;  5FJ8 G;  1VCI A;  3GO5 A;  5EMN A;  3P27 A;  5M9O A;  4A3E B;  4DKA C;  5LMZ A;  5GAD C;  5D14 A;  2UUA L;  1NSN S;  2WIN B;  4KI0 A;  3G4S A;  1QGZ A;  1IBM L;  3CCR A;  1VF5 C;  2F0U A;  5FKA C;  1QNU A;  5FO0 A;  3J81 j;  1XYI A;  2KHS A;  2ZTD A;  1H42 A;  2Q2H A;  2HDM A;  3J81 c;  2CC2 A;  2VNH A;  1YIT B;  2EXD A;  1G29 1;  1VQ4 B;  2DN8 A;  2XSC A;  3W1G A;  5NUC A;  2E75 C;  1VQ9 A;  1FNM A;  3M4O B;  5IGF A;  2Z6B D;  1UE1 A;  1K8M A;  5IYB H;  1KZL A;  4LBZ A;  2EY6 A;  3RZO H;  3CC7 A;  1K9M D;  1M1K C;  4OIK A;  1W6J A;  4JI2 L;  4DV3 Q;  4POF A;  1HUN A;  3E0J A;  3NBI A;  4IO9 A;  1ILP A;  2VQF Q;  1GR1 A;  1JOR A;  1Y69 U;  3LX0 A;  1R4P B;  4ME3 A;  2A6H C;  1W2B B;  2BVN A;  2Z4H A;  2PMZ B;  2CND A;  4TSS A;  2OTL A;  3CD6 B;  3HOX B;  5IIF A;  3FPU B;  2AHO B;  2B7C A;  1PTO H;  3KDF B;  1FGU A;  2I5L X;  4C2M B;  2PQA B;  1LT3 D;  1OXX K;  2VZL A;  1HZ9 A;  5IYD G;  4P26 A;  4Z9C B;  4YEJ A;  3T13 A;  5IWA L;  4N3N A;  4TMZ A;  5AJ3 L;  2BCO A;  4R9W A;  3A7A B;  4ULL A;  2MGS A;  3NSW A;  4YCV A;  1UAP A;  5I6W A;  4HIO A;  3D6W A;  4FF1 A;  2NYZ D;  1JT8 A;  2ZTG A;  5T1I A;  1XPO A;  4XN0 A;  4IPC A;  4DR7 L;  3WOE A;  4IUT A;  3CCV A;  1D2E A;  1EY8 A;  4DGZ A;  3HP3 A;  4KY7 A;  2RDH A;  1IBK Q;  5HGQ A;  2EY2 A;  4P3Y A;  3CRK C;  2M9V A;  3H91 A;  4R4Q A;  3ZYY X;  4DAV A;  2R93 B;  2ZZF A;  1Q3L A;  5FLX L;  1KTK A;  1F9R A;  3Q8D A;  4UZF A;  3K6O A;  1AIP A;  3CPF A;  4X8I A;  1QJO A;  4KJO A;  2PNR C;  1WTO A;  5F4O A;  1BBX C;  3GTO B;  3ICE A;  2N3S A;  2E2I B;  2JIZ A;  2ZZG A;  4GNX C;  1IKL A;  1SE2 A;  1UUP A;  5DM7 3;  3OZU A;  1I6H B;  3W5O A;  4XOT A;  3CCE A;  4YAW A;  1O7L A;  4K8I A;  3Q6R A;  1DON A;  4JI3 L;  4GOP A;  3CXC B;  2C77 A;  2N78 A;  3J81 i;  1BUV T;  3G6E A;  2E2H B;  4RG1 A;  1H9J A;  1VQM B;  1G7S A;  1PMR A;  4CGY B;  2VBV A;  3KFU A;  2VNI A;  5E1F A;  4CJ1 B;  5IT9 E;  2Q8I B;  2XWB B;  2N8N A;  3MHB A;  3SKB A;  5ELN A;  4BS9 A;  4N8F A;  3DUZ A;  3S9W A;  4A93 H;  3W2D A;  1WVL A;  4JW0 A;  1D2B A;  4LF4 Q;  2X6L A;  4C3H B;  5J3B A;  1IL2 A;  1G51 A;  2A8V A;  3ZJY C;  1Q81 C;  2F0W A;  3ASR A;  2EYH A;  3JQR A;  1I4H A;  3H09 A;  3PIP A;  1WTW A;  1T9H A;  4IOA A;  4E0F A;  5COY A;  1WCM G;  2HCC A;  4AH6 A;  4NXN L;  1VQB A;  1CKO A;  5CC4 A;  2R92 B;  2GK7 A;  1IB0 A;  1I5F A;  2FJ2 A;  1V1O A;  5EGT A;  4KKS A;  1M8A A;  5C0X I;  2Y0S B;  4YHH L;  3K8A A;  4J8Q A;  1EY5 A;  1LLR D;  3DHQ A;  1XMO L;  4JI7 Q;  4JYA L;  3URY A;  1F60 A;  2V7X A;  3DWQ A;  2EJG C;  3LQE A;  3N6R A;  5M5X B;  1IBL Q;  3RLF A;  1HNW Q;  1OHH A;  1STY A;  1TII D;  4DF7 A;  4K0K Q;  1BCP B;  2O2L D;  5KRU A;  3BC9 A;  1PTO B;  4DV7 L;  2NZ1 D;  1K73 D;  5LMU Q;  1B50 A;  2NBF A;  4A3J G;  1EFI D;  4Z4W A;  2VBT A;  1K28 A;  1D7Q A;  1F2L A;  4JCV E;  1MIU A;  4K2L A;  1LT4 D;  1TS3 A;  4NW2 A;  1CQF A;  4P74 A;  3HOX G;  4X65 Q;  1RTN A;  3GTL B;  1YIJ A;  3TQY A;  2E2D C;  3FPK A;  3GTG B;  3W3A A;  1Y0R A;  1BDO A;  2NN6 H;  5L37 A;  4APV A;  3I2Z A;  1SNQ A;  2VJJ A;  1N0V C;  3VYS A;  4A3B B;  1PRT C;  3MTS A;  3ONA B;  3CAM A;  3L2P A;  2HDN B;  4ZGN B;  4IFD H;  5C0X G;  1PH5 A;  4QJF A;  2DGY A;  2A19 A;  2D0P A;  4JI7 L;  3SK5 A;  2IHF A;  4DQK A;  1NRK A;  2XRS D;  1V43 A;  2K28 A;  2E5L Q;  1BLI A;  1I94 Q;  3P26 A;  2RSN A;  1EFC A;  2LZJ A;  2PMD A;  4XLE A;  1X3F A;  1WTQ A;  2R7Z B;  3WBJ A;  2MO1 A;  1KQS B;  4JI5 L;  3MXG A;  4B9W A;  2NVY B;  3BY2 A;  5KNC A;  1Q81 D;  1SYD A;  5EKK A;  2XGJ A;  3M7G A;  3C46 A;  1JCK B;  1TVC A;  2F0N A; 
#chains in the Genus database with same CATH homology
 3MAQ A;  5IGG A;  2RQX A;  4O42 A;  4HCS A;  1A15 A;  1PXU A;  5IT9 L;  4JMQ A;  3C1F A;  1G6Z A;  1JOO A;  1LV9 A;  3TP7 A;  2NWG A;  3BVG A;  1OXV A;  5C3W A;  4U67 3;  3PUX A;  2PPB C;  3J80 L;  3PUV A;  4PMB A;  1D6E C;  2F0G A;  2L11 A;  1LTA D;  4A3F B;  3I70 A;  1I6V C;  3GTK B;  2FMM A;  1A2U A;  3UI2 A;  1G2S A;  3CRL C;  1DZ1 A;  1CA6 A;  3K57 A;  2K7V A;  4HTH A;  1KNE A;  2ZZE A;  4IUU A;  3L9A X;  3Q23 A;  2HQE A;  3BYT B;  1FX0 A;  4QB4 A;  1QB5 D;  3M3Y B;  3TDQ A;  1Y8N B;  2WAC A;  3MFY A;  1MSH A;  1PRT F;  1IW7 D;  3V96 A;  3IFD A;  1SJE D;  4NNJ A;  4RA8 A;  4X3T A;  1ZEQ X;  1ET6 A;  1EU3 A;  5EBD A;  1R9T B;  4R8N A;  2A69 D;  3D8G A;  1H8H A;  4XR6 A;  1I4R A;  4KN4 C;  4HED A;  3GQB A;  2JE6 I;  4TT3 A;  1E2Z A;  2IJ0 A;  1GXD C;  1MI2 A;  3D3R A;  4V19 0;  1NUC A;  1GHJ A;  4G4K A;  3QOJ A;  2JJ2 A;  3FPP A;  3LNN A;  4U68 A;  3EQL C;  1CI3 M;  1PTO D;  5M5W B;  1V1P B;  4XOR A;  2AUK A;  4ODG A;  1U4L A;  2EYO A;  4WJW A;  5IGE A;  3A8J E;  4DN4 M;  1PFM A;  1EYD A;  2E76 C;  5T1G A;  4FP5 D;  4ID6 A;  2BDO A;  4TKO B;  1W9X A;  4DNR B;  2B39 A;  1HVX A;  4GQN A;  3OSO A;  3SK4 A;  3SVM A;  1GUW A;  4K8J A;  3HOV B;  3A8I E;  1CHP D;  3DM1 A;  2D2C C;  2LY7 A;  4L8J A;  1MSG A;  1PZI D;  3D31 A;  4MN3 A;  1EEI D;  3OMG A;  1E2W A;  2B2V C;  1Q90 A;  3D4W A;  3GVJ A;  1K8O A;  1M4V A;  1FGB D;  2KQ3 A;  3G6J B;  2MHV A;  2R3Z A;  1E3Z A;  1TWF B;  2QKI C;  4K6L A;  2HUG A;  2JDI A;  2ENB A;  1PFN A;  3P75 A;  3BVZ A;  5C3X A;  2ZZQ A;  3FEW X;  2J4X A;  4XLC A;  1HXY D;  2V31 A;  4ABN A;  4X3K A;  3S2H B;  4HCE A;  5I9P A;  1I4P A;  1ML0 D;  3S1M B;  5C4H A;  5I4D A;  1NR2 A;  4A3G B;  2EE1 A;  3GP7 A;  4DFA A;  2EYF A;  1DJR D;  3DWA A;  1JWM D;  4B9X A;  3VYU A;  4UDU C;  3V05 A;  1DXM A;  1KDA A;  1GUT A;  2RBM A;  3NE5 B;  2XZL A;  5FO7 B;  1X3P A;  2X8K A;  3Q0A A;  1L0X B;  5EKI A;  4OL7 A;  1UD6 A;  1BCP D;  3RUZ A;  2XIW A;  5K36 G;  2E74 C;  1IL8 A;  5IGD A;  1B2T A;  2L55 A;  4N9P A;  3I90 A;  3NBH A;  5IGB A;  3IAY A;  1GOZ A;  1UD4 A;  2J7Z A;  1G8Z D;  2PQE A;  3KBX A;  2A74 C;  1SND A;  2PO4 A;  3HOZ B;  1GUS A;  5FOB B;  2GJP A;  4H0L C;  1B4O A;  2SNM A;  4KHZ A;  2TMP A;  5LL6 S;  4QIW B;  3A35 A;  1IKM A;  2AQ1 B;  4CKC A;  4HR7 B;  1X32 A;  2VB3 X;  2DIE A;  2A6E C;  3DEO A;  5EKL A;  3QO2 A;  1I4Q A;  2EY5 A;  1STN A;  3NPP A;  1H9S B;  1HFN A;  2EOT A;  4RGN A;  2KVM A;  4XD7 A;  3C2P A;  1D5M C;  4X3U A;  2AWO A;  1S5C D;  4FXU A;  4XLF A;  2ZXO A;  3OAA A;  1EIG A;  1SMY C;  5KIX A;  2WJV A;  3Q22 A;  1F2Y A;  2XND A;  2EYM A;  4XQQ A;  1VDZ A;  2ZT9 C;  1HCZ A;  3K5L A;  2DNC A;  3PUZ A;  1JB3 A;  4L63 B;  3TZD A;  2ICE C;  2EDG A;  3OW7 A;  5KND A;  4RGM A;  5IK2 A;  5AFW A;  3SK6 A;  4YXW A;  2CK3 A;  1CFM A;  5E3F A;  5JOB A;  1BPL A;  2A5H A;  2CVR A;  2L1B A;  2AQ3 B;  2RSO A;  1JE4 A;  5CBE E;  5ELD A;  1WPC A;  4II2 A;  2WB1 B;  3EFX D;  3I4M B;  1E43 A;  3A56 A;  1D5X C;  4DNT B;  5CV4 A;  5JAV A;  1JWS D;  1K28 D;  4M8A A;  3GV6 A;  3TP5 A;  2NB0 A;  1AZP A;  3K59 A;  2I46 A;  1BQQ T;  5DAU A;  4LJZ C;  2V4D A;  2M00 A;  4G7Z C;  3G7L A;  2K04 A;  3FKS A;  3MA2 B;  4K5V A;  3ND9 A;  4C3I G;  4RGT A;  4KKU A;  2MPM A;  1KDC A;  1GUO A;  2B2Y C;  3NWT A;  3TSS A;  5BN4 A;  1HQM C;  3U9S A;  4H7B A;  1V0E A;  1Z7T A;  1TY2 A;  4G7H C;  3IKJ A;  1STB A;  5C0X H;  1WD0 A;  1A6X A;  2B2T C;  3A7L A;  5E4W C;  3CES A;  1B3A A;  2A6H D;  4IUV A;  4C56 C;  1SMY D;  1EIH A;  3S1Q B;  2A6E D;  1Z47 A;  5JEA H;  1TS2 A;  2CW0 C;  3IL8 A;  3M4Y A;  1TWG B;  2C5C A;  1TQO A;  2L5T A;  1STG A;  2PYK A;  5C44 B;  2NN6 G;  5IOD A;  1WTV A;  4H44 C;  2ICI A;  1IYV A;  4G7W A;  3R2T A;  1G91 A;  2D9U A;  1DOL A;  4QF4 A;  3NTI A;  4Q5V A;  1MD2 D;  4Y7N B;  1Q12 A;  3U9O A;  5A35 A;  3VA5 A;  4HMJ A;  3GTM B;  5CBA E;  4P2C B;  1EYA A;  2ZTN A;  2B2Y A;  2XWJ B;  5F2D A;  4EQN A;  2X6Y A;  5C3E B;  4XYO A;  5A2Q E;  1QE6 A;  1I4X A;  3QB3 A;  1H8E A;  2X69 A;  5CV5 A;  1W0J A;  2DY8 A;  1Q1E A;  2JA8 B;  2HDL A;  3PIP 3;  1Y8P B;  1TWH B;  1KNA A;  4OIJ A;  2EVB A;  4FNF A;  4FVM A;  1RCV D;  2NUC A;  1EU4 A;  2AWN A;  4G7X A;  1SSO A;  2KUM A;  1E3X A;  3K5M A;  2QF7 A;  4DAP A;  4ZQ3 A;  3P7J A;  3QG1 A;  4ZKB B;  4C3J B;  2HCI A;  3ZPN A;  4O1N A;  1DOM A;  1CK1 A;  1W6K A;  2WP8 J;  4RWS C;  1F9S A;  5A2Q L;  4A93 B;  4TQU S;  2X6X A;  5FLX E;  4XKV A;  4LK1 C;  2F0E A;  1JIC A;  3PV0 A;  4NDX A;  4FF4 A;  2QIL A;  2QE7 A;  5M3M B;  1UD5 A;  3ND8 A;  5LHY 1;  1I50 B;  1EZ8 A;  2F3V A;  2ID0 A;  3N52 A;  1WCM B;  2GK6 A;  3NHH A;  2H4O A;  3MEH A;  5CV9 A;  1JWU D;  2F0T A;  1HZE A;  1GUN A;  2OT2 A;  4OO1 I;  4IFD G;  2FMC A;  4A3I B;  4QUF A;  3PMF A;  1KLU D;  1ESF A;  5FL7 A;  2CHB D;  4EQP A;  4J6H A;  2X6G A;  1KDB A;  4F8M A;  2IWH A;  1HPC A;  2D3L A;  2N55 A;  1LO5 D;  4M1U B;  2ZXP A;  4FO2 A;  5J22 A;  3VA7 A;  2FFK B;  2LMC B;  2QDB A;  2L9H A;  4KTA A;  4FYD A;  1SYF A;  2KEE A;  1HTP A;  1E2V A;  3CP8 A;  1YNN C;  4HSP A;  2F0I A;  2LFN A;  5DEH A;  2M2L A;  3VYT A;  1EQT A;  2IX3 A;  2X6W A;  1ONL A;  1ROD A;  3VR6 A;  3AMU A;  4DAY A;  2E2J B;  2BA0 A;  3OIQ A;  2VUM B;  3S14 B;  1SYC A;  5BN5 A;  2F3W A;  1CHQ D;  3HEJ A;  2KEC A;  1FYC A;  2GJR A;  3J7Y W;  5CYU A;  4LAA A;  1H9K A;  4YEL A;  3MXN A;  5DN6 A;  4N9T A;  4DK0 A;  2K05 A;  2D62 A;  3GTJ B;  1QWY A;  1BNZ A;  3QIA A;  1AEX A;  4C3J G;  2L12 A;  2RVL A;  3NK9 A;  4PQX A;  2R9V A;  1NAP A;  5EQ0 A;  5CR3 A;  4WFN 3;  4FF2 A;  3T51 B;  1V1P A;  2WPD A;  1U4R A;  4OHJ A;  4ILW A;  2BE5 D;  3AB9 A;  5CDF A;  3SEB A;  4PV1 C;  1U4M A;  2JA5 B;  3JU4 A;  3BDC A;  4S3S A;  5KNL A;  2MJ8 A;  1LAB A;  4FXG C;  5JPM C;  1CA5 A;  1F2Z A;  3TBI B;  1B9M A;  1ET9 A;  3R2I A;  4HSV A;  2SNS A;  3OOC A;  3BVM A;  3V2T A;  3HOY B;  4ZRZ A;  1DOK A;  5J1Z A;  1DD2 A;  1RHP A;  2F0D A;  3NXW A;  1JQY D;  4IUN A;  4K2K A;  1WTP A;  4H13 C;  1CZG A;  4RCN A;  3TP6 A;  4XLH A;  1SNP A;  1S5F D;  2A68 C;  4IUQ A;  1NR4 A;  2QEJ C;  1I8D A;  3HS0 C;  1COW A;  1ENC A;  5FO8 B;  2NVX B;  4IFD I;  4BBR B;  4ME5 A;  1F77 A;  1EZ6 A;  1ZKO A;  4OO1 H;  4DA2 A;  2I07 B;  1DCZ A;  2IL8 A;  1E0B A;  3HKZ B;  4CBV A;  2F03 A;  3F2U A;  4A3M B;  3I4N B;  4IUP A;  2PZU A;  2K5D A;  1CTM A;  4FXD A;  2DNE A;  1O80 A;  1OXS C;  2G9H D;  1DM0 B;  3OWE B;  3NQT A;  3DMU A;  1ESR A;  2EY1 A;  2K1B A;  5K5P A;  2O4X A;  1H9M A;  4OO1 G;  2XZP A;  3SK8 A;  3FMC A;  3CMM A;  4KY6 A;  2SEB D;  1C8C A;  5LL6 X;  2ZXH A;  1PZJ D;  4B08 A;  4FF3 A;  3KEW A;  1SDF A;  2JEB I;  2XOK A;  4XNF A;  3E6Z X;  1SJH D;  1ZYR C;  4XYQ A;  2B2W C;  3RZD B;  1Z6H A;  5FK9 C;  5C4J B;  1OB0 A;  4GZY C;  3LWU A;  1GUG A;  1PLF A;  1D1K A;  4ZK9 B;  4XOP A;  4ZKC B;  1GJX A;  3MWY W;  2G9D A;  4V0B A;  5CV8 A;  5HKK A;  3OEH A;  4DXG A;  3AU7 A;  1O7Z A;  4F87 A;  1EY9 A;  3HOW B;  1E1Q A;  1BXT A;  1D5Z C;  1U9R A;  3ITP A;  4A3D B;  1RF2 D;  4Q0F A;  1JC7 A;  3MXU A;  3I8Z A;  4I7Z C;  4K6D A;  3OMC A;  2JA7 B;  3DEP A;  3C1E A;  3SHL A;  1LTB D;  2VJI A;  4BY7 B;  3Q6S A;  1LT6 D;  2E1B A;  4IZ8 A;  2VXW A;  1TVX A;  3RZO B;  2PW5 A;  4XON A;  3HG9 A;  1V8Q A;  2XN9 C;  4KMU C;  1B53 A;  2FIN B;  2Z8L A;  1WD1 A;  1GHK A;  2F43 A;  2B2W A;  2F0H A;  5ELB A;  3K0Y A;  2EJM A;  2F0K A;  2SOB A;  1SXT A;  5JVG 3;  2DY7 A;  1O7Y A;  4IAL A;  4HN7 A;  1PDQ A;  4RKL A;  4ZAI A;  4RGO S;  2PW7 A;  3VR5 A;  1NBM A;  2O5J C;  1TT2 A;  3QJY A;  1RJT A;  5I2Y A;  3SE0 A;  1WP6 A;  3O13 A;  2F0F A;  3PIO 3;  4XIG S;  1CM9 A;  4G7O C;  5CMD A;  1YNN D;  3RD4 A;  1LTT D;  5E4X A;  3LWE A;  1T5E A;  4BBS B;  1BCP F;  2Q8R E;  1WTX A;  2K03 A;  2B63 B;  1B9N A;  4X3S A;  2HLD A;  3BS1 A;  1YNJ D;  3D6C A;  1E79 A;  3TN2 A;  3KK7 A;  1ZXT A;  4IUR A;  1SFO B;  1G2T A;  3K5N A;  2C9O A;  1Y1W B;  1FNU A;  3I3C A;  4XQJ A;  2B2V A;  3EA6 A;  5ELC A;  5CGK A;  3S17 B;  4KJN A;  4KD4 A;  2Z1C A;  3KLS A;  1SE4 A;  1LAC A;  3OEE A;  2F0Q A;  1PYW D;  4E6I A;  3A55 A;  4CJ0 B;  3K7A B;  2B8G A;  2EJF C;  2NTT A;  5KGU A;  2B2U C;  5K36 H;  5JPN C;  2F0J A;  3BYY B;  5IOC A;  1QCB D;  4KY5 A;  2JP1 A;  1UD2 A;  5HGT A;  4FXK C;  3CU7 A;  4G57 A;  5DNF A;  5EBC A;  4XLA A;  1A2T A;  3TP8 A;  2XZO A;  5G3L D;  2WZP P;  3RMH A;  1Q8I A;  3OFN A;  2N88 A;  1SNM A;  3H3V C;  1TWC B;  2WAQ B;  2NVT B;  4XQN A;  1LT5 D;  1XXG A;  2J0T D;  3EVQ A;  1HUM A;  1TR5 A;  4EGV A;  3S1N B;  3I72 A;  3J7A V;  2SDF A;  1HA5 A;  2X85 A;  1EOT A;  4XT1 B;  2F0V A;  1XTC D;  4G6I A;  1MGS A;  3OHX C;  4HMI A;  4EVO A;  2KA7 A;  2D5D A;  1A3V A;  1EWC A;  1ZYR D;  4XTC S;  2F0P A;  4HAE A;  1SKY B;  1S5B D;  4F7X A;  5I6Y A;  4K5X A;  4MHE A;  4UAI A;  3S16 B;  5CV7 A;  1U4P A;  1F9P A;  3P1H A;  3FKI B;  4ZYS A;  4NP5 A;  3PUW A;  2WJY A;  3QWN A;  3GTQ B;  1OO9 B;  5JJZ A;  2A69 C;  5M3F B;  3T16 A;  2QCP X;  2F0S A;  2RDG A;  2IW3 A;  2K5Q A;  2BDN A;  5I9O A;  4KN7 C;  3JAM E;  2F4I A;  4RH6 A;  4XQF A;  1II3 A;  3M7N A;  1LTR D;  3FDT A;  4ZUJ A;  1EWH A;  3FRP B;  3K58 A;  1KAB A;  2GJK A;  5J39 A;  3PUY A;  3IFT A;  4J1M A;  1BMF A;  1Y1V B;  2KCN A;  4NMZ A;  1FNW A;  3A8K E;  3G05 A;  1BR9 A;  3BCF A;  5G3L F;  2RA4 A;  2JJ1 A;  2L0C A;  3J81 E;  4ZLT F;  5BN3 A;  1VJS A;  1FD7 D;  3NWS A;  3MVV A;  2MUY A;  3BZD B;  3CQZ B;  1EY4 A;  2VB2 X;  1HA6 A;  2WSS A;  2OXP A;  1HHV A;  3FVQ A;  1WTR A;  1QOH A;  5HUR A;  4KKT A;  2LS0 1;  1S4Z A;  5C6A A;  1E1R A;  4II3 A;  3K5O A;  2K6A A;  4QUC A;  1CZW A;  2AUJ D;  1BOS A;  3ERQ A;  1PRT B;  5EPK A;  4XXE A;  4RKB A;  3NP8 A;  2B2U A;  3SR1 A;  1EY7 A;  1AP0 A;  1FNV A;  1TKW B;  3NQI A;  3OPO A;  3CKI B;  3GVK A;  4CHT B;  1OXT A;  2XVS A;  1RKN A;  5D65 A;  1C4Q A;  3KF8 A;  4C1N K;  4NKL A;  3J81 L;  1TU2 B;  4CJ2 C;  1F2M A;  3L3O C;  5C4X B;  4YIJ A;  1SNC A;  1HQR D;  3KLR A;  2JA6 B;  3OE7 A;  2BOS A;  3MC0 B;  4C1N I;  1AZQ A;  2V7Q A;  3SDZ A;  4A3J B;  5KNB A;  3H0G B;  3WQZ A;  1PTO F;  4HIZ A;  4ZUI A;  4K14 A;  3NTK A;  2K33 A;  1PZK D;  4TSF A;  3T4A C;  2F0L A;  1PRT D;  2B8F A;  1EEF D;  2GA4 B;  2RKS A;  1ICW A;  1STA A;  1W0K A;  4RFB A;  1QG7 A;  1SYE A;  3P20 A;  3BCD A;  3HOU B;  2K01 A;  2CQA A;  2A68 D;  1UD8 A;  4PMW A;  3H6M A;  5C5L A;  3WDN A;  1S5D D;  3I91 A;  3L7Z C;  2X53 S;  1Q1B A;  4KHV A;  4XKW A;  2Q8T A;  4B3F X;  1JOK A;  4RAU C;  2O5I C;  1L0Y B;  1F9Q A;  2IPK D;  3T53 B;  4PNY A;  1AW7 A;  2BE5 C;  2L4N A;  3I73 A;  3GTP B;  4P22 A;  1SAP A;  2ZXI A;  4JBW A;  1UEA B;  5C5M A;  4ASU A;  1PTO C;  2NTS A;  1SBB B;  5JEA J;  2XRQ D;  1TY0 A;  2R6G A;  1SNO A;  2BA1 A;  3KLS X;  1DYQ A;  1ENA A;  1IHZ A;  5IGC A;  3PO3 B;  1KMH A;  1SYB A;  2WV6 D;  1O78 A;  1PFB A;  2W6J A;  1BCP C;  4IQZ A;  4BWG B;  4WRD A;  2F0O A;  1X3Q A;  3HRZ C;  1IYU A;  4MIU A;  4K5W A;  5EPJ A;  4PMC A;  2OEO A;  1MAB A;  2CW0 D;  3C3L A;  2JEA I;  2WKC A;  4A3K B;  3H94 A;  2FHT A;  4BA1 I;  4XL9 A;  3ERO A;  1JOQ A;  2PZW A;  1FR3 A;  4RCO A;  3NTH A;  1TWA B;  2NN6 I;  4RHR A;  2IX1 A;  4DK1 A;  1Y8O B;  4BY1 B;  2NVQ B;  4XM3 A;  5TSS A;  1QIL A;  4WOR A;  4IFD J;  1BF4 A;  5CV6 A;  1EY0 A;  3MXP A;  5FO9 B;  2A73 B;  3A54 A;  3HGB A;  2D3N A;  2KJX A;  3GVL A;  1J9O A;  3VYR A;  2W6I A;  5C4Z A;  1RTO A;  4KK7 A;  1V0F A;  4CKE A;  2IX0 A;  5I2X A;  4KD3 A;  1KAA A;  3T56 B;  2R61 A;  1RD9 D;  1LTG D;  2Z4I A;  4QCL A;  1SEB D;  2TSS A;  2PCF B;  3BDO A;  3R93 A;  1H9S A;  1JR0 D;  4UZU A;  2AQ2 B;  1KLG D;  1A3T A;  4AYB B;  4LMQ D;  3HZX A;  4QMG A;  1CT1 D;  5KEE A;  1HFG A;  3M85 A;  1B44 D;  4Z1M A;  1S5E D;  3A3G A;  1VMC A;  3VR4 A;  1IW7 C;  3OWF A;  4OGQ C;  4RHS A;  1STE A;  3A3B A;  1AFP A;  3BH4 A;  1YNJ C;  2K5W A;  1I4G A;  1K83 B;  4I65 A;  1WTH D;  3S15 B;  2IT1 A;  2M5S A;  1J8I A;  2KCC A;  5COR A;  3X3N A;  2WII B;  1EYC A;  4KV6 A;  1VLY A;  1I3Q B;  1SYG A;  1CQV A;  3TME A;  1ENF A;  3WOF A;  3DWP A;  2B2T A;  4XT3 B;  4F88 A;  2F0M A;  4JK1 C;  1LTI D;  2EYJ A;  2EYP A;  3GV3 A;  1AN8 A;  3J7A F;  4DXF A;  4IN3 A;  5M5Y B;  4AVZ A;  1C48 A;  4XDX A;  3S2D B;  1SE3 A;  1TS4 A;  5ISR A;  2YYZ A;  3DXJ C;  1D1I A;  2XNA C;  5C0X J;  5D3D A;  2MP1 A;  1HRJ A;  1XX8 A;  4XMY A;  2EPB A;  5EPL A;  1STH A;  1UNS A;  3J80 E;  3BDL A;  3PO2 B;  3QOL A;  3CHB D;  3BG3 A;  3CP2 A;  3ZIA A;  1VF7 A;  1B1Z A;  3I4L A;  3MFG A;  1OXU A;  1VMP A;  2KED A;  1EY6 A;  5KYI A;  4CKB A;  1XWE A;  3GD7 A;  4BA2 I;  5ELF A;  3MZ5 A;  2JSO A;  5KYL A;  1QNK A;  2EXZ A;  1R4Q B;  3D4D A;  2JXM B;  3DDY A;  1TS5 A;  4L6T B;  5EJW A;  3VR2 A;  4C3H G;  3JAM L;  5JEA G;  1H9R A;  1LTS D;  3R8B A;  2VNU D;  3E5S A;  1BO0 A;  3D4R A;  2RDF A;  3TZU A;  3OIP A;  4B3G A;  3NUC A;  3VR3 A;  1HTL D;  2KVO A;  5DM6 3;  2YU9 B;  4XN3 A;  2JYO A;  2H1E A;  1EQV A;  1PKV A;  2LKV A;  4EQO A;  3Q24 A;  4C3I B;  2EYL A;  1NCV A;  1ILQ A;  1I18 A;  1MBY A;  3S1R B;  3R3O A;  5ELE A;  2OF1 A;  1RDP D;  5D3I B;  4R8I A;  1EFR A;  2ZXR A;  1UD3 A;  3X3M A;  5JVH 3;  2PZT A;  3SXH A;  4TRD A;  2K32 A;  2F1M A;  2WKD A;  3KBG A;  4DU9 A;  1T5X D;  3EJI A;  1A3U A;  2KOL A;  1EL0 A;  3HAG A;  3KUP A;  2EZV A;  1VCI A;  3GO5 A;  5M9O A;  4A3E B;  5D14 A;  1NSN S;  2WIN B;  4KI0 A;  1VF5 C;  2F0U A;  5FKA C;  1QNU A;  1XYI A;  2KHS A;  2HDM A;  2XSC A;  1G29 1;  2DN8 A;  5NUC A;  2E75 C;  3M4O B;  5IGF A;  2Z6B D;  1K8M A;  1KZL A;  2EY6 A;  4OIK A;  1W6J A;  1HUN A;  3E0J A;  3NBI A;  1ILP A;  1JOR A;  1Y69 U;  3LX0 A;  1R4P B;  2A6H C;  2Z4H A;  2PMZ B;  4TSS A;  3HOX B;  5IIF A;  3FPU B;  1PTO H;  4C2M B;  1LT3 D;  1OXX K;  4Z9C B;  4YEJ A;  3T13 A;  2BCO A;  4R9W A;  3A7A B;  4ULL A;  2MGS A;  3NSW A;  1UAP A;  5I6W A;  3D6W A;  4FF1 A;  2NYZ D;  2ZTG A;  5T1I A;  4XN0 A;  3WOE A;  4IUT A;  1EY8 A;  4DGZ A;  3HP3 A;  4KY7 A;  2RDH A;  2EY2 A;  3CRK C;  2M9V A;  3H91 A;  3ZYY X;  4DAV A;  2R93 B;  2ZZF A;  1Q3L A;  5FLX L;  1KTK A;  1F9R A;  3K6O A;  1QJO A;  4KJO A;  2PNR C;  1WTO A;  1BBX C;  3GTO B;  2E2I B;  2JIZ A;  2ZZG A;  1IKL A;  1SE2 A;  1UUP A;  5DM7 3;  1I6H B;  4XOT A;  4K8I A;  1O7L A;  1DON A;  1BUV T;  2E2H B;  1H9J A;  1PMR A;  4CGY B;  5E1F A;  4CJ1 B;  5IT9 E;  2Q8I B;  2XWB B;  3MHB A;  4BS9 A;  3DUZ A;  3S9W A;  3W2D A;  1WVL A;  1D2B A;  2X6L A;  4C3H B;  2F0W A;  2EYH A;  1I4H A;  3H09 A;  1WTW A;  4E0F A;  5COY A;  2HCC A;  2R92 B;  5CC4 A;  2GK7 A;  2FJ2 A;  1V1O A;  5EGT A;  4KKS A;  1M8A A;  5C0X I;  2Y0S B;  4J8Q A;  1EY5 A;  1LLR D;  3DHQ A;  3URY A;  3DWQ A;  2EJG C;  3N6R A;  5M5X B;  3RLF A;  1OHH A;  1STY A;  1TII D;  4DF7 A;  1BCP B;  2O2L D;  5KRU A;  3BC9 A;  1PTO B;  2NZ1 D;  1B50 A;  2NBF A;  1EFI D;  1F2L A;  4K2L A;  1LT4 D;  1TS3 A;  4NW2 A;  1CQF A;  1RTN A;  3GTL B;  2E2D C;  3GTG B;  3W3A A;  1BDO A;  2NN6 H;  1SNQ A;  2VJJ A;  3VYS A;  4A3B B;  1PRT C;  3MTS A;  3ONA B;  4IFD H;  5C0X G;  3SK5 A;  1NRK A;  2XRS D;  1V43 A;  2K28 A;  1BLI A;  2RSN A;  4XLE A;  2LZJ A;  1WTQ A;  2R7Z B;  3MXG A;  4B9W A;  2NVY B;  5KNC A;  1SYD A;  5EKK A;  2XGJ A;  3M7G A;  3C46 A;  1JCK B;  2F0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...