3FPPA

Crystal structure of e.coli maca
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
266
structure length
266
Chain Sequence
PGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTQAVSQQDLDNAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPGQKAWFTVLGDQLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrolide-specific efflux protein macA
publication title Crystal structure of the periplasmic component of a tripartite macrolide-specific efflux pump
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 52
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3fppA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fppA02
4OO1H 2E75C 5KNCA 4KKSA 1H9MA 1IW7C 1TKWB 1V8QA 3PUWA 3BG3A 4KKUA 1E2VA 2A69D 2BA0A 3L7ZC 3A8JE 3T53B 1GUSA 5BN5A 3W3AA 1H9JA 1ONLA 1H9SB 3A8IE 3VR2A 5KNBA 3VA7A 4JBWA 2A6HC 1K8OA 3IFTA 4L8JA 3QG1A 4BA2I 3N6RA 1BDOA 1HQMC 3TZUA 3I72A 1OXUA 3M85A 2K33A 1ZYRC 4KN7C 5K36H 3PUVA 5BN3A 1Y8NB 1QJOA 1VF5C 2D5DA 2DN8A 1OXTA 2JEBI 1B9MA 3ND9A 4XTCS 1E2ZA 2PNRC 1IYUA 5K36G 3A7LA 1VCIA 4KHZA 3U9SA 1Z7TA 2KA7A 3D4RA 3FPPA 2F1MA 2A69C 3I4LA 2A68D 3RLFA 5JEAH 3OOCA 1OXVA 1Y69U 1GUNA 1Z6HA 2A6ED 3MXUA 1Q1EA 2PCFB 3SDZA 3CRLC 3NE5B 5JEAG 1EWHA 1CI3M 1DCZA 2NN6H 3GQBA 1CFMA 2E76C 3FMCA 4KN4C 5A35A 4DK0A 2O5IC 4G7OC 1GHJA 3MFYA 1IYVA 2BE5D 1VDZA 3PUXA 4TKOB 2V4DA 1A6XA 2NN6G 1TU2B 1O7LA 2EJFC 3CRKC 4I7ZC 3AB9A 3EQLC 4IFDH 2JXMB 3VR6A 2K32A 3QIAA 1K8MA 5KNDA 1Y8PB 2AUKA 3WDNA 3T51B 2Q8IB 2O5JC 1H9SA 1SMYC 2DNEA 4HR7B 2R6GA 2B8GA 1YNJC 4IQZA 4IFDG 2A68C 1PMRA 4G7ZC 2D2CC 2A6EC 1FYCA 1V43A 1GUGA 4PV1C 4RCNA 3VR5A 4BA1I 3LNNA 2A6HD 5C0XH 1FR3A 2AUJD 1HTPA 4JK1C 4KKTA 1H9RA 3P20A 4DK1A 2PPBC 3T56B 2B8FA 1GJXA 2CW0C 1H9KA 3IKJA 3LWUA 2EJGC 5C0XG 2EDGA 1T5EA 1OXSC 3VR3A 2BE5C 4LK1C 2BA1A 3D31A 2IT1A 3ND8A 1GUTA 4TQUS 2AWOA 1LABA 1GUOA 3A8KE 4GZYC 4G7HC 2NN6I 2DNCA 2ZT9C 3HGBA 1B9NA 3PUYA 4OO1G 2L5TA 1VF7A 4H44C 2EJMA 1Q12A 1YNNC 2JE6I 1IW7D 4H0LC 2BDOA 3A7AB 1DXMA 3BDOA 4XIGS 1GHKA 3PUZA 4KI0A 1E2WA 3SE0A 2E74C 1DD2A 3OW7A 4LJZC 1G291 2YYZA 3PV0A 3KLRA 2JEAI 1ZKOA 3VR4A 3M4YA 1HPCA 1CTMA 2D62A 4H13C 3OPOA 3QJYA 3M7NA 2K7VA 1Q1BA 1I6VC 3I73A 4DNRB 1Q90A 1OXXK 3GD7A 4OGQC 4KMUC 1O78A 1LACA 2QF7A 1HCZA 1Y8OB 4DNTB 3H94A 2LMCB 2KCCA 2EVBA 5BN4A 3DXJC
chains in the Genus database with same CATH superfamily
5ELFA 4FF4A 3ZZUA 3NENA 3WYAA 2K5QA 2QMUA 4LBWA 1ML0D 4ZKCB 5C3WA 3FKIG 5HXBA 5KNBA 3VR2A 3HOZB 1DGSA 1SNPA 2XTIA 4X65Q 4DR2L 4RD3A 4X3TA 5E3FA 4WZKA 2KHSA 2IY5B 1ELOA 3D4WA 3TZUA 1BDOA 1II3A 3PO2G 1K0RA 3H6MA 2E2HH 1EFRA 1QJOA 4A75A 5FJ8G 3S2HB 4X0CA 1VQ5A 1L1OC 5FIUA 3K5OA 4V190 1I5FA 4CKCA 1CA5A 4B3GA 1N36Q 3JU4A 4XD7A 1SYBA 3EJIA 3OWFA 2JA8H 1EOTA 3K8AA 2QGQA 2UU9Q 1YHQB 4HJ8A 1BQQT 2B3GA 2KBNA 2WZPP 1ILQA 3SDZA 4OO1I 3K7UC 4RCZA 4C3HH 1CI3M 1PFSA 3A56A 3IFDA 3P1HA 5A35A 5C3XA 3DLLA 1MJEA 3CCEA 3S17B 2FMCA 1PLFA 3TP5A 1IBML 3ERQA 2BE5D 4HSPA 3KF6A 5JPNC 4I7ZC 1VQAA 4EQOA 3AFPA 3KJPA 4BPRA 4B3ML 4A3CH 1B3QA 1VQJA 2R7ZH 3IAYA 1EY0A 4L6TB 1JICA 1KIXA 1FX0A 1CSPA 1D5MC 2K50A 3WDNA 1XMQQ 2OEOA 2HHHQ 3DM3A 4GN5A 3K0XA 1R5NA 2ZTCA 1J5EL 1FRQA 2C2WA 4CGYB 4BWGB 4DAMA 1UE5A 1G91A 2HMAA 1Q81D 3K5MA 2VB2X 1GJXA 1PZJD 1QGZA 5C0XG 5C4XB 4JBJA 5JJIA 2K5WA 3BY1A 3QFRA 4HJ9A 4NNJA 2JN4A 2RDHA 1TY2A 2QA4A 4HJ5A 1HJPA 4G7HC 1VQPA 2ZM6L 1K73C 2F0QA 5GV7A 4M4SA 2YV5A 2UXCQ 5H5JA 1VQ5B 1FVIA 2JP1A 3Q8DA 4LF8L 2OBRA 4MZ9A 1PKVA 2UUAL 1WFQA 1GXDC 3WY9A 4HTHA 5C3EB 4OWTB 1A63A 4XIGS 1U2RA 4NXNQ 1E2WA 1YHBA 2E74C 2Z1CA 4L5QA 5BR8L 3A35A 2X6WA 3PV0A 2R92B 3HZXA 1R4PB 3SK6A 2HLDA 3HOVB 4DV0L 3EIVA 2UUBQ 1EY6A 4X07A 4JV5L 4M0LA 4X3UA 4CBVA 1M1KD 1I6VC 2DY7A 4KMUC 4DV5L 4R8NA 3S1QH 1QH0A 3S1NH 3W2DA 1E22A 5CV4A 5LMNW 4C1NI 1V0FA 1HH2P 3GTKH 3ONAB 2X85A 1VQOA 4A3GB 3DUZA 2K6AA 1KTKA 1G6ZA 2BN4A 1BQEA 2G5DA 3DEOA 4ROXA 1YITA 3BJUA 2EYFA 4JBWA 3K7AH 4FP5D 3H3VH 4XN3A 3NEMA 5JVH3 1Q8IA 2EIXA 3TQYA 1S5CD 4K6DA 3QSYA 1CK1A 1E2ZA 4XONA 4GLVB 1NUCA 1XMOL 3X3MA 2K03A 4XT1B 3Q6RA 2F0PA 3D4RA 4UP7A 2CQOA 5GAEC 2OBTA 3Q6SA 5JEAH 1C8CA 4FDBA 1HZCA 3MXUA 4FF2A 2EXZA 2E76C 3CCSA 1MABA 1KNAA 2CVRA 1ESRA 2LXJA 4A3MH 1GVPA 3CCMA 1TU2B 1KZLA 2F4VQ 4IFDH 3QR8A 2B2UC 4R71A 1T6ZA 1TUIA 1K73D 1X3GA 1WSRA 1GAWA 4DAPA 1C9OA 4KLKA 1HTLD 1D5ZC 3B78A 2K4KA 3NK9A 2D0OA 1PMRA 3PUMA 1E0BA 2HIVA 4F88A 5IP9H 3JAME 3L2PA 3CC7A 5C6AA 4NXMQ 4WZTA 5IP7H 3DWQA 3F2BA 3C1EA 1H9RA 4J6HA 1KTVA 1K8GA 3I56A 1HUMA 5GV8A 1WCMG 3W5OA 1XNRQ 1I4PA 1NBMA 1YITB 3OE7A 1UAPA 3KBGA 5I6YA 4LNQA 3OKXA 5M3MH 4YWKA 3TN2A 4PMCA 2PO4A 4QMGA 5EPLA 2SEBD 3E5SA 3D31A 3J80L 1IHMA 2NN6I 3AVYA 3HGBA 5JPMC 3R8BA 1N34L 3QO2A 2L5TA 2Q8TA 2KOLA 1YNNC 5JJZA 3PIOA 4B3SQ 2VNJA 1GR1A 2F3WA 2RA4A 2WR8A 1GUWA 2BV3A 5KIXA 3MFGA 3PO3B 2XSCA 3G48A 2EY2A 4FF3A 1FJGQ 1STYA 3OSOA 4Y9UA 1G291 4X66L 2IL8A 3D3RA 4RCOA 2BOSA 3OTOQ 5IYBG 1N32Q 1CKNB 2HUGA 2X6XA 3PUNA 2BMWA 3I73A 4OIJA 4Z4VA 1OXXK 1JQYD 1TT2A 4DR1L 1O78A 4ZGNB 1TWFB 4DV3L 1R9TH 1EIYB 3HOUH 4Z4TA 4JI8Q 3HOWG 1C48A 5GAGC 5KSWB 3CCMB 2P3MA 4DKAC 1IHZA 2N78A 3TRZA 3K58A 4ID6A 4U9UA 3CC4B 1STEA 1PTOC 3WNDA 4UP8A 1ASZA 1X3QA 4K14A 1PTOH 4XT3B 1K83B 2CRVA 5KRUA 3CC7B 3HOXG 3QFCA 4BBRB 4O1NA 5BN3A 4J8QA 3J80i 4P6VF 5JBQA 1DM0B 3I56B 1DYQA 1TWAB 2R3ZA 3S1MB 3Q23A 1VJSA 2Z9HA 4G4KA 5I2YA 3MEFA 3BYTB 4P25A 5M9OA 2NZOA 3QFSA 1HR0L 4A3EB 1Z7TA 4Y9RA 1JE4A 2F0MA 1BBUA 1ZXTA 3AGPA 3GV3A 3U4ZA 4Z4YA 2VY3A 3K6OA 1SNDA 4A3DB 2GN5A 4P9SA 5FLMH 1YI2A 3H0GH 1G8ZD 4CJ1B 3BY2A 4XM3A 3T1HQ 4EQPA 1HVXA 2N88A 4YCWA 5IIFA 2Z4HA 4LWCA 1VQMA 3PUXA 2IWHA 3S2DB 3IRBA 4WJ3M 2VNKA 4YHHQ 2C4UA 1CNEA 1ET6A 1Q9SA 1WDTA 5IYCH 4GOPB 1YNND 2RCNA 3ZZ0A 1BBWA 5ELDA 3GTJB 2HQLA 4RDJA 1SYCA 1EY7A 2SNMA 3GTLH 2D2CC 3WBKA 3NP8A 3DHQA 2R6HA 3VR5A 4RDLA 1BNZA 3IL8A 2ZXRA 3S24A 2EY6A 2E2JH 5EBDA 3P20A 3TP8A 1RDPD 1BCPF 2JA7B 2OYNA 3S15B 1H9KA 1DG1G 4B43A 1JOKA 1EEFD 5M5WB 2F0KA 1WTHA 2QGGA 5L46A 5CV8A 4JI1L 2F03A 3ND8A 1DOLA 1X3PA 4TQUS 2AWOA 5DLQE 1GUOA 1J9OA 2WJVA 2NBFA 1KNEA 2ZT9C 1VF7A 5IGCA 2LXKA 3RLOA 3GTGH 1JA0A 2BDOA 2C4TA 4A3IG 4A3KH 1PTOD 1YJ9A 1ENCA 4B9WA 1A3VA 1I3QB 3U2QA 1DARA 2R93G 3ER0A 1S0UA 2ALYB 3BQJA 1N8RD 4DN4M 2K5HA 1YI2B 4DK3C 4IURA 2AWNA 1SKQA 4AYBG 1WTOA 1WD0A 3AVUA 2D0PA 5M5XH 1DDIA 5JVG3 1VQMB 1VHOA 4DR6Q 3M3YB 4XXEA 2F0DA 3S1RH 4K5XA 1SMYD 1Q3LA 2B2WA 5EKIA 5ISRA 4U673 4R4IA 1P16A 3L7ZC 3FKIB 4TMZA 4N9PA 4HN7A 2DCUA 1UD8A 1MD2D 3A8IE 3U58A 1VQ4B 5DM73 1SYFA 2W6IA 1HQMC 2F0OA 1X3FA 3AYHB 4DR5L 3PO2B 2VQEQ 2VZLA 4DV4Q 3I8ZA 1IBKL 5K36H 4B4DA 1EWIA 4QUCA 1S5ED 1A15A 3I4MG 2UXDQ 4JI4L 1NMGA 3BDCA 1H42A 4B9XA 5IWAL 2Q8RE 1KMHA 4N3GA 2VQFQ 4M53A 3PMFA 1C4QA 3TDQA 2XZOA 2ASBA 1BJKA 2EIFA 1Y0YA 1EIGA 4EQ5A 2JA6H 4WORA 1XNQQ 1LUZA 1I18A 2WACA 3MZ5A 2EYLA 1HNXQ 2JIZA 4G1BA 1YJNB 3RY8A 1ZM9A 4ZK9B 5NUCA 3JQQA 1F9PA 3AB9A 4P2CB 3M4OB 3WNBA 4JOIA 3GTMB 4XQFA 2C5CA 4O42A 1TWCB 5FO0A 2IJ0A 2WAQG 1BR9A 2BH2A 1HFNA 3W5VA 4II2A 4PC3A 2C78A 2EY1A 2F0LA 4BA1I 4LF6L 1VQEA 1CM9A 1WD1A 1U4MA 1F9RA 2L9HA 3FVQA 1BLIA 2B8FA 5D3IB 3IKJA 1QGAA 1NJIC 3HAGA 1FNVA 3LO8A 2V1CC 4ULLA 1G2TA 4HJAA 2JDIA 3RUZA 3UE1A 1UEBA 1KJZA 3FP9A 2I5MX 1SRUA 4JYAL 2IHEA 3PGZA 4LF5L 2KENA 1W6KA 1MI2A 1E3ZA 1Q12A 1D1IA 4BY1G 1E3PA 4DV1Q 1PXUA 1PA6A 3M9BA 1BKBA 2Q2IA 2WKDA 4Z4WA 1OGJA 1SAPA 4WJ4A 2DIEA 3DEPA 2V7QA 2IX0A 3OEHA 4RD1A 2W6JA 4B44A 4U68A 4CDFC 5THXA 3R6KA 2EYMA 2F0GA 2X0KA 4X7DA 4X65L 2D62A 3OPOA 3RZDH 3D26A 3H15A 2EE1A 3PIP3 1Q90A 1EFTA 1FL0A 1E64A 4OIKA 1UD4A 4ME3A 4XR6A 1PRTC 2XZLA 4CDEC 1VQKA 1TY0A 3ULLA 1KRSA 3CMAA 5BN4A 4DV6Q 1B1ZA 5DN6A 3CCVB 2E75C 4QL5A 4QJFA 3GTOH 3FHWA 2I46A 1HRJA 4CKEA 1I6HH 3SJPA 1S40A 4B3TQ 1N36L 1Y1WH 2R9VA 5TY0A 4ZV4A 1VQ8B 4RGTA 3A3BA 1RTOA 5IGFA 4QIWE 3PO3G 1KDBA 1KABA 5CBAE 5CC4A 2UU9L 4L5SA 5FA6A 4DAVA 2VXWA 2P5ZX 3F1ZA 1BF4A 3KF8A 2YU9H 5KYIA 1X6OA 2PMDA 4XTCS 2VNHA 1HZEA 4Z9CB 1O7IA 3MA2B 5HGTA 1RODA 1LV9A 2QDXA 1YVCA 3SJZA 1QVGB 1H8HA 1YZ6A 1TWHB 5D65A 2F1MA 2E8GA 1EQRA 2RBMA 4RGOS 4RFBA 4X6AH 4LUZA 5LMUQ 2GVBA 3GV6A 1ZUNB 2B2TA 5ELOA 4B08A 3ULPA 3J7A5 2CQAA 1CFMA 1XPRA 3D6CA 1JOQA 4PNYA 3A3GA 4WZLA 1NJID 1J6QA 1F2LA 4XQJA 1STAA 3OAAA 1A6XA 4AYBE 2E2IB 4C3JG 1EFCA 3BCDA 5KNDA 3OMCA 1JR0D 4B3FX 1EXMA 2HDMA 1U0LA 3M4QA 5J22A 1VQKB 2ZXHA 3CMAB 5J1ZA 2V7UA 4QVJA 4H02A 3RZOH 4JG2A 3GTQH 2GVAA 2KCTA 1Q82C 2NB0A 1S4MA 2V7WA 2X3UA 4NXNL 1W9XA 4YAWA 3SEBA 4Y7CA 5A88A 2GREA 4Y7NB 1PH7A 4N3NA 1H95A 2IT1A 2UUBL 1ICWA 2L15A 2CNDA 1XQBA 2FVGA 1PRTD 3E9HA 3HRZC 4QB4A 2ZZFA 3EA6A 4XNFA 2VB3X 5JJKA 3MTSA 3K80C 3VA5A 1WOCA 4A3FG 1E7ZA 1DOMA 1SBBB 3HOYG 5IYWA 3R6JA 1F9SA 1IL2A 3GTKB 2WFWA 1D1NA 2F0NA 1I4QA 2GJRA 3FPKA 4LF7Q 4X7EA 1PH4A 2H4OA 1SE3A 1VQBA 5FKAC 1CKMA 2Z6BA 1NCVA 1CTMA 3CCRB 1XTDA 3OZUA 5C0XI 3F2UA 1DOKA 1YIJA 1HNZQ 2VUMH 3TZDA 1N33Q 3NPPA 2K52A 3HOWB 2XVSA 1HA6A 1UD2A 2BM0A 4PMBA 2HD3A 1W2BA 1OTCA 3FJOA 1YNJD 4DV7L 4KKUA 2ZTGA 3P26A 2FFKB 2PLFA 1KHIA 2L12A 2QDLA 2WAQE 3A8JE 4HE5A 2N55A 1D5XC 1GUSA 4HSVA 1H9JA 1ONLA 4HMIA 2NVTH 2B2YA 1JC7A 1NR4A 3B8HA 1GD7A 3QG1A 3HOXB 3S14B 4IPHA 1QGYA 3BZKA 4IUQA 2IX3A 5M5YB 2VBUA 4A93B 3G6EB 4ABNA 4XLFA 5CV6A 2E5LL 1B9MA 2MO1A 5EGTA 3PF4A 5G3LD 1GM5A 1SROA 4BY7H 4DV2Q 1TQOA 3H09A 4X7CA 2B2VA 1KLUD 1CZGA 5J3BA 4K2KA 3CC2B 1LTSD 4JI2Q 1I4XA 4C3IH 5KYLA 5FOBB 2CCZA 4EVOA 4E6IA 3V76A 1B50A 2F0WA 1Q82D 2ICIA 1DCZA 1STGA 4K0KQ 1OO9B 5LMZA 4MIUA 4UAJA 2YTXA 1KD1C 4LF9L 1VQFA 1HNWQ 3NBHB 5HZAA 1M1KC 1XNRL 2MQHA 2B63H 4RKBA 4ZKBB 2NPFA 3W2EA 3UDXA 5IYDH 1NAPA 1E1OA 1YIJB 2RSNA 4JPBW 3VO2A 3SEJA 4RA8A 4POFA 4YELA 2DNEA 4YCVA 3LWEA 2QEJC 4AQYL 4N8FA 1W2BB 5CV7A 3I4NH 1L2FA 4QIWB 1W6JA 5EKKA 3CPWA 3CCLA 4B3SL 2A6EC 4BBSG 2OF1A 1B2TA 2BF4A 1B3AA 2CWAA 3VYRA 5AJ3Q 4RJLA 2HDLA 2RC5A 1MKHA 1I50B 2LKVA 3V05A 1HHVA 2GQFA 1WTHD 1CHQD 1B4OA 1SFOH 4XQNA 2NVXB 2EDGA 1XXGA 1BUVT 1T6YA 4QVAA 1CQXA 2J7KA 1JWSD 1IBLL 2V7TA 5I9PA 4IJHA 5G3LF 1LABA 3OTOL 2E1BA 1Y1VH 2DNCA 3GDEA 1N07A 1YLOA 1DJRD 2KUMA 2DY8A 1PH6A 4R8IA 2H1EA 3J80c 3I70A 3I55A 3E3XA 4B48A 1MHWC 4JI8L 1N0VC 4PQXA 1P8LA 3Q38A 4C56C 1WTXA 1HUNA 4A3IB 2F0VA 1PFBA 2EOTA 2BCOA 5C4JH 5LL6S 1WTQA 2R93B 5CGKA 4JI5Q 5EBCA 2JEAI 3HKSA 3S16H 1CNFA 2RDFA 1UD3A 4AYBB 3MVVA 4FO2A 4XLEA 2FJ2A 4A3JG 2LMCB 1LTAD 2K5VA 1XPUA 4OO1H 2DOGA 4GNXB 5KNCA 3QWNA 4PGOA 1E2VA 2K5NA 5DSZA 2D3NA 4LF4Q 5FLXL 1EYAA 2ZZGA 3PQIA 2A5HA 1KRHA 2NZ1D 2QN6A 1EQTA 5AN9A 1S5BD 3J81E 3CCLB 3CPWB 2B7BA 2XZPA 2KJXA 4MHEA 3N52A 1I7PA 2OTJB 1KD1D 1ZYRC 1WTRA 4JI0Q 1EY5A 3H3VI 3T1HL 3HG9A 4X64L 2WP8J 3I4MB 5IGBA 4IUUA 3DMUA 1PZID 5IE8A 3CHBD 3W5HA 3O13A 4KHZA 4YHHL 3PCOB 2BGIA 1C7YA 2A69C 4UDUC 1K0SA 2YWGA 2NVYB 5F4JA 3I55B 4ILWA 1W3SA 4KTAA 1I4HA 4E0FA 2A6ED 2RF4A 1B23P 1Y14B 4XDXA 4P6YA 3CRLC 1AW7A 4DR3Q 1PDQA 2JA8G 1J8IA 5BSXA 4UP9A 1WTPA 1X65A 1QVCA 2PW5A 5C44H 2RSOA 3RLNA 4A3BH 3VMFA 4ZCIA 4IPDA 4C3HG 3ITPA 1I94Q 4XKWA 4C2MB 4QY7A 3M7GA 4EX5A 3A5UA 4DUYQ 4IO9A 2B39A 3ONUA 1CQFA 2NVQH 1K9MC 1QFJA 2B7CA 3P7JA 3J81k 1LT5D 3TMEA 2C5HA 1F2ZA 2WAQB 5ELEA 4HR7B 1K28D 4A3CG 2B8GA 2R7ZG 4GKJQ 4OP7A 4RD6A 5I9OA 2B2TC 3ZPNA 2MJ8A 1V43A 4IZ8A 2WYRA 4IPCA 1RJTA 1LTLA 1VHEA 2GJKA 1CKNA 1BCPC 2EFGA 1PH5A 1FNBA 3KL9A 2QDBA 3S9WA 3PA2A 2PIAA 2PW7A 2IHFA 4OL7A 5E4WC 2ZBUA 2F3IA 1TIID 3D6WA 3CMEA 3CCQA 3RNUA 2KVMA 2CH4A 4KJOA 4BY1B 3CC4A 4AIMA 3G4SB 4G6IA 3WBJA 4M2LA 4R4CA 4Z4SA 3MEHA 1Q7YD 3WWVA 4DR6L 3S1RB 1OHHA 2VJJA 4DFAA 4X05A 4X62Q 4YAUA 3QB3A 4I65A 4F87A 4TMWA 4LFBQ 1BX0A 4Z4ZA 1EWYA 3NHHA 2Q6KA 2XWBB 2F0UA 2I5LX 3M4YA 4OOSA 2ZL5A 1FNCA 2WB1G 2BM1A 1WSVA 1LM0A 1QCBD 1ZYRD 4RMFA 1DDGA 3M7NA 1KC8C 1EYCA 3ERSX 5B6IA 2VQEL 4DV4L 4K8IA 1Y8OB 4DNTB 5IT9E 3CQZB 2EVBA 4IUPA 5J39A 1JORA 3DXJC 4WFN3 3HOZH 2A73B 1JJGA 4DR2Q 2UXDL 3BG3A 4RM0A 4JCVE 2A69D 2RHSB 1SSOA 2F0SA 2AKWB 4IPGA 1CZWA 1E1TA 2RDGA 3W3AA 2OCEA 5BSYA 1WOSA 4CHTB 2VQFL 4YHBA 4HIOA 1AZQA 4XOTA 1PH9A 3S2HH 1OXUA 1EZ6A 4OXPA 4YCUA 3MMPA 4KD3A 2ID0A 1JWMD 3CCUB 1XNQL 3I2ZA 1HNXL 5C0XJ 1K9MD 4MYTA 4KY6A 3CMEB 1LTGD 3CCQB 1XE1A 3FPPA 3VO1A 3ZC3A 3LQEA 1M4VA 1EQVA 2JQOA 1GUNA 4HJ7A 4TSFA 1COWA 3S17H 1WU8A 2PCFB 4LW1A 2EXDA 5JEAG 2NN6H 4ZCKA 3WOFA 3LGJA 4DPGA 2O5IC 1BCPD 1SM4A 1IXRA 4B3MQ 3V2TA 1GHJA 2DGYA 1N8RC 2ZJPA 1U5KA 1A3UA 4B3RL 2K05A 1KRTA 4CJ0B 5GAHC 2JXMB 4C3JB 3ULJA 2QILA 4X7FA 3UE0A 4A3MG 2NWGA 2KCNA 3KUPA 1H9SA 5F4MA 1SMYC 2OT2A 1GJRA 4P1VA 4IFDG 4POGA 4YEJA 4DV1L 3AVTA 5C4XH 1ET9A 4DK1A 5M3FH 3QFTA 5IP9G 4X8IA 2HCCA 2KEDA 2DJFC 3JAML 5IP7G 1KXLA 2RKSA 1KC8D 2BA1A 2Q2TA 1QFYA 4LF8Q 1TVXA 1TS4A 3MXGA 3PUYA 5M3MG 3OJWA 4PG3A 5C3EH 2EJMA 1GO3E 2HCJB 3GTPH 4A3FB 1VQDA 5BR8Q 3HOYB 1FNUA 1LTRD 2CFMA 1E79A 1RKNA 1SNCA 5FO1A 1QB5D 3BS1A 5JAVA 3NXWA 3I91A 4DV6L 1VQ4A 1PH8A 2R92H 3GTOB 3C1FA 4CDDC 3HP3A 3HOVH 1I6HB 4JV5Q 4B3TL 4P2NA 2Z6BD 4LJZC 4DV5Q 5DAUA 2VNIA 1D2BA 1HPCA 3HKZG 3G05A 4UZEA 1EFID 3TEHB 2VNUD 5C4HA 5LMNL 1DONA 1I4RA 5FO7B 1IL8A 2QF7A 4A3GH 1EYGA 2K01A 1X56A 3PIO3 1MBYA 1A8PA 1W34A 3Q22A 1X3EA 4WJWA 4KKSA 2SNSA 1MRZA 5A2QE 2Z6KA 3HOUG 4YIJA 1AP0A 2GJPA 2I1LA 4KV6A 2F0HA 2Q6IA 1H9SB 4P3IA 1V1PA 4O2DA 5EPJA 3IFTA 3T1YL 4BA2I 1YJNA 5LHY1 5LMUL 1SJED 3JAMi 3KDFA 2K33A 4ZGQB 4HCSA 4OWWB 2D5DA 4JI6L 4IOAA 4P74A 4WQMA 5HY6A 3SHLA 1KK0A 3AQQA 4GOPA 3OFNA 4OPOA 2PNRC 3G7LA 4JBMA 1VCIA 3R93A 3CPXA 3WQZA 1STBA 1EZ8A 1A2TA 5EJWA 3KEWA 3K59A 4KY7A 4K5VA 1ILPA 5A8AA 1LT6D 1NDHA 4QUFA 4TT3A 3AGQA 4GLAC 2XRSD 4P75A 4LFCL 1CQVA 3SXHA 2RQXA 3FMCA 3W5UA 4JI3L 1EOVA 2LY7A 4GN3B 5C4ZA 3SLNA 1WYDA 4A4IA 3K5LA 5FLMG 2WB1E 3CRKC 1UEAB 3H0GG 1QFZA 3PIPA 1TWGB 4QHYA 2Q2HA 5DS0A 1WVLA 5I2XA 5F4OA 3TBIB 1JE5A 2DEUA 3STBC 3UDFA 5EAYA 2F3VA 1QILA 4BS9A 3EFXD 1S72B 2F1LA 4FXUA 1YJWA 2WZNA 2JK8A 5IYCG 4BBSB 3Q24A 3BC9A 4XOPA 4RCNA 3B82A 3AEVA 2AUJD 3H9NA 3RN5A 3KYHC 4KJNA 3J7AF 1LT3D 4ZUIA 4DR4L 4LC0A 1HFGA 4R9WA 2VL6A 1G51A 4QF4A 1JB9A 4AF6A 5DM63 4LF7L 1V1PB 2ZJQA 4LK1C 1N34Q 4PC7A 3CCJA 2AHOA 4Z4UA 4QCLA 3KDFB 1E3XA 3CCVA 2D74A 3A8KE 4GZYC 1SNOA 4YALA 2NYZD 1L1OA 1M90C 2ICEC 1N33L 1TVCA 1MSHA 1VQ8A 4A3LH 1T5XD 3G71A 1EY8A 3J7YW 4TSSA 3NTIA 3NQIA 5KGUA 2M2LA 1Q86D 1CSQA 1A2UA 2PQAB 4PABA 4DR1Q 2AQ1B 3FKSA 5K5PA 2YTYA 4P26A 4A3KG 2ATWA 2NVTB 1TWFH 2AMCB 1KAWA 5EQ0A 1Q1BA 4DNRB 2PQEA 2LZJA 4OGQC 3R3OA 3QOLA 4XYOA 4F7XA 4A3JB 5TV2A 1SJHD 2K5DA 3HFZB 2UUCQ 3ES9A 3CKIB 4PC1A 1QVGA 2A8VA 2KCCA 3NTHA 4S3SA 2EYOA 3NWTA 3KK7A 3UDIA 4JI7Q 2VJIA 3TS2A 4BXXH 2XNCA 2ZBVA 4XKVA 3PUWA 1CKOA 4ASUA 4QFMA 3CD6A 4BBRH 3GIRA 4C3IB 1D6EC 4YWMA 2JA5H 1YJWB 3L3OC 4R4TA 3S1MH 1TWAH 3N6RA 2L0CA 2A19A 3BVGA 1CA6A 2YWFA 1G7CA 3CP2A 1VF5C 2DN8A 3CRZA 1K8AC 1OXTA 4K0KL 1HR0Q 3ND9A 1VQNA 4NBSA 2E2HB 4JBKA 4M1KA 2ZL7A 3OHXC 1FRNA 1HNWL 1HZBA 1PFNA 5K36G 3FRPB 5D14A 3CCJB 3A8IA 2AHOB 2N3SA 1KQSA 3STBD 4KY5A 2OK8A 1I8DA 1L1OB 3D0FA 4A3DH 2PMZE 5CV9A 4ZCLA 5FNZA 2ZXOA 3VNVA 1IJEA 1Q1EA 3G71B 2JA8B 3AFQA 3Q0AA 3OW2A 3S2DH 3GQBA 1AFPA 3ASRA 1NBWA 3UI2A 5IODA 1NE3A 5AJ3L 5TR9A 4GOPC 5C5MA 1VDZA 2XRQD 4N9TA 3K81C 4C3HB 2JA6G 1JMCA 3HKZE 2EJFC 2QE7A 3GTJH 1D7QA 2L4NA 4DUZQ 4RLZA 2K32A 2K28A 2I5HA 1M90D 1QNUA 1NSNS 1EWCA 2O5JC 1NR2A 2VS1A 2R7ZB 4ME5A 1A62A 1YNJC 5I6WA 3TS0A 4Y52H 4OPSA 4H7BA 2JA7H 2C35B 3S15H 4PV1C 1EY9A 1XMQL 2HHHL 2A6HD 1FR3A 1IJFA 1OB2A 4KKTA 5M5WH 1HA3A 3CCRA 3W2FA 4JI1Q 3CD6B 3OIQA 3KLWA 4YY3Q 2CC2A 1OXSC 2E2DC 5IYPA 2VZAA 4OOXA 4JI5L 3CESA 4DU9A 1EIFA 1AE3A 2DUDA 3LX0A 4YXWA 1VQ6A 1PJ7A 3W1GA 2Y0SG 2IX1A 4J1MA 4IALA 1QZHA 4HAEA 2MO0A 1VQNB 3R2TA 4LUOA 3PF5A 1I3QH 1KDAA 1QE6A 1HXYD 1AMOA 1MSGA 1KQSB 2B5OA 2UXCL 1GHKA 1MJCA 1V1QA 4K6LA 4KK7A 3W2HA 1NMFA 4G57A 4LF4L 3G6EA 1SE8A 1LTID 4RCYA 2WB1B 2JA5G 1EYDA 3OW2B 4FK8A 3M3YH 4KD4A 1K8AD 4ZQ3A 4PC6A 1EU4A 3BCFA 4G5GA 1PYWD 1TS3A 2V7XA 1XWEA 5EKLA 1W0JA 3CC2A 1GO2A 3OZVA 2XGJA 3FKIH 3RN2A 3S1QB 2B2UA 2MP1A 4ALPA 3S1NB 5JJLA 1W87A 2B29A 2X6GA 1PVOA 4HE6A 5ELNA 2ZZQA 2MGSA 2FINB 1G7TA 3PO2H 2EZVA 3SK8A 1UMKA 4MYUA 5FLXc 5FJ8H 3NBHA 4NP5A 2F0TA 1TLLA 1Y1WG 2WINB 1OGIA 4FXGC 4DR7Q 4DR3L 3K7AB 4KN7C 1LTTD 3MAQA 1LLRD 4FN5A 4LFAQ 2OTLB 4WZEA 5IWAQ 3U6KA 4X3KA 4L5RC 4HIKA 3LQ6A 2CBXA 5KNLA 3TP6A 3G6JB 4DUYL 1VQ6B 1T9HA 4RGMA 3U9SA 1EFUA 3FEWX 1SKYB 1QUQB 4FXDA 1PV4A 4GQNA 5E4XA 1B2RA 4OELB 3W1BA 1BOSA 3JC66 4GKJL 3CTAA 2DY1A 3ASPA 1WI5A 2JSOA 1J9ZA 1EFWA 4FWTA 2KVOA 1Q8KA 3M4OH 4HIZA 1K3BC 4FNFA 4FVMA 1U9RA 4IN3A 2X69A 1V0EA 2JA9A 4P72A 3GTMH 4YAOA 2PZTA 3H91A 1TWCH 3EQLC 5ELCA 2WSSA 2EY5A 2X6YA 3D4DA 5GADC 5C5LA 2B2WC 4A3MB 2EPBA 2XOKA 2A1AA 1Z9FA 1VQGA 2F4VL 4TRDA 1TTTA 2IW3A 2Q6OA 1XPOA 2A68C 4HCEA 4Q0FA 1SYEA 3EROA 4UZUA 3E6ZX 3T13A 1GUGA 4GS3A 5C0XH 2EYPA 2XEXA 1HTPA 3BDLA 3HS0C 4X62L 3V96A 4DAYA 2EJGC 1JJCB 4ZRZA 4NXML 1T5EA 3RR5A 3AVWA 1XX8A 3BVZA 4TMTA 2HQEA 4IUNA 1K3RA 1FNMA 3V7AA 2RHQB 4DF7A 4F7DA 4GNXA 5IYNA 3GP7A 5M3MB 4KHPQ 4QUZA 3A54A 1V1OA 3MXNA 4HEDA 4CJ2C 3GVJA 1QUEA 2I07B 2PMZB 2HIXA 3TSSA 3E20A 5H1SE 1WOOA 4RGNA 1O7ZA 2F0JA 1HZAA 1DXMA 2D9RA 3GVLA 3ASSA 3FDTA 5FL7A 3SE0A 1DD2A 3TREA 3QE2A 3Q6QA 5AFWA 4DK6C 2OTJA 3BNWA 2L11A 2PZWA 3VR4A 3L9AX 1AIPA 3HKZB 1FJGL 4H13C 1VQHA 4L5TA 5KEEA 1UE6A 3GSIA 1S3OA 4JOIC 1VQ7A 3RMHA 3CXCB 5EMNA 4QV2A 1N32L 3J81c 4IW3B 3SK5A 1R9TB 2VUMG 3HOUB 1R5BA 1V8QA 3GO5A 4X3SA 3PSIA 3KBXA 1V9PA 4TVAB 4ZAIA 1PFMA 5IGEA 4AC9A 3W2GA 2EYHA 4GKKQ 3M85A 1PTOB 1EIHA 1BO0A 2QKIC 2DERA 4K5WA 1KAAA 2FX3A 2M5SA 4PC2A 4DAYB 5CBEE 1TWHH 4TMXA 4XYQA 3A8JA 1JJ2B 3ZBTA 5CMDA 1B44D 1U4PA 4OONA 4ZLTF 2Y0SE 2X6LA 2ES2A 1EP3B 1HR0W 4JVZA 1QUFA 1HZ9A 4BY7G 1Q7YC 2A68D 3MXNB 2GK6A 4L63B 1GKHA 1WPCA 1Z6HA 4GLXA 3J7ZC 3PA1A 4G1VA 3BH4A 4C3IG 3NE5B 5E1FA 1UUPA 1N08A 1AN8A 2PNHA 1IB0A 2K14A 2SDFA 1RCVD 4TMVA 4J15A 3MFYA 2OXPA 5M3FB 1BBXC 2E2IH 4OX9Q 2NV4A 3H0GB 1FD7D 1S5DD 3G4SA 3T16A 2UXBQ 1SE4A 1EUJA 1K8MA 2OWOA 2B63G 4QGUA 1VQ7B 2OK7A 1X32A 1TXYA 2R6GA 5IYDG 3NTKA 1ZM3A 1WCMH 3GTPB 5FK9C 1FYCA 3J80E 3LNNA 4OHJA 2M00A 4Y7NH 2BDNA 3P27A 3I4NG 1QOHA 3GTLB 4XLAA 2F4IA 1AEXA 4RD0A 3VR3A 2E2JB 2R7FA 3CCEB 4R4QA 4Q5VA 5GQOA 2MPMA 3JAMc 3KF6B 4B47A 4XORA 2XNAC 1BX1A 1AE2A 1ENFA 2CKZB 2M9VA 3CW2A 1Y1VG 2NTTA 3A7AB 3BDOA 3I3CA 3MHBA 1TS2A 1WJJA 1W0KA 2QTLA 3H3VC 1H8EA 4NB3A 4IFDI 5CORA 4C43A 5IYBH 3GTGB 1ASYA 2ZXIA 2PZUA 5IT9c 4A3KB 1X54A 1PYSB 3CCUA 3HOWH 1F60A 1UD6A 3VNUA 3VDYA 5HGQA 3JQPA 5IYRA 3GD7A 4MTNA 3ISXA 1ESFA 4MNOA 3WOEA 1U4RA 4P3YA 4DV7Q 4KHVA 2KECA 2X8KA 2XN9C 4Q7JB 2A74C 2QA4B 1QX4A 4P12A 1VQPB 1JWUD 5M5XB 2CW5A 5E7NA 2BA0A 3HOXH 3S14H 1PYBA 1QVFA 4OO1G 5M5YH 1K8OA 4A93H 4II3A 2E5LQ 4IJLA 1RQPA 1X55A 1VLYA 3UDGA 2XWJB 4V0BA 1VQIA 4QQBX 1NRKA 5GROA 2WKCA 4RWSC 2XNDA 1RD9D 1A0IA 2NTSA 2F0EA 1RL2A 3J81L 1QG0A 4R4OA 4RD2A 3A7LA 1UWVA 4J0QA 1L0XB 1T6XA 1KK2A 2KA7A 2TSSA 1WTWA 2LS01 4Z4RA 3RLFA 2Q2UA 1Y69U 1VQOB 3RD4A 4DNIA 2K75A 2MUYA 2O2LD 5HURA 4FXKC 2WJYA 4LF9Q 1ZEQX 4K2LA 4WRDA 4DQKA 2RVLA 1QNKA 4AF7A 1PJ5A 4I7AA 4DK0A 3ZZTA 4APVA 3ICEA 2HCIA 2JA6B 3CAMA 2OQKA 5LL6X 4XLCA 1FGUA 2HDNB 3ZUGA 1A3TA 4AQYQ 5C44G 4LBZA 4ZCMA 1PJ6A 4LMQD 4A3BG 5CR3A 4P71A 2N49A 2O4XA 4XN0A 1STHA 2JN9A 3GVKA 1I50H 3C3LA 3MCAA 2B2YC 4G7ZC 3EVQA 2NVXH 3A1PA 3CMMA 2F4NA 1JNYA 5IGGA 1XJVA 5E6TA 1IBMQ 3Q39A 2GA4B 1MGSA 1IBLQ 3T56B 1QVFB 5TRDA 1DZ1A 4XL9A 1SEBD 1E62A 3A5ZB 3CU7A 3BYYB 3ZIAA 3CCSB 3ZBUA 1XTCD 3J81i 3KFUA 3CB4A 2FHTA 3WXMA 2G9HD 2Y0SB 2B2VC 1B9NA 4A3IH 1J5EQ 1HA5A 3W2IA 2UUCL 1RHPA 1EEID 1G6PA 4CKBA 2R93H 2JJ2A 4JI7L 3MC0B 3ONYA 3KOJA 1S4ZA 1WORA 4EH1A 3NBIA 2QTZA 2YYZA 3KLRA 2FXQA 1OB0A 3U6BA 2BGJA 1ZKOA 4M1UB 1B8AA 5I4DA 3K5NA 2JA5B 3EN2A 1LT4D 2F43A 1E1RA 3NUCA 3QJYA 2WV6D 2ZM6Q 4GNXC 5ELBA 2BVNA 4RHRA 1LACA 2AQ2B 1FNWA 3ZYYX 3H94A 4PZ6A 4AH6A 4EQNA 1PH1A 3RZDB 2UUAQ 1TR5A 1PH2A 5FO9B 3VYTA 3AU7A 1EQQA 1LYLA 2ZTEA 1OB5A 4OWXB 1IW7C 3DDYA 1N0UA 3F2DA 1PRTB 4LBYA 5IT9L 5BN5A 1XFOA 3E1YE 3HOZG 4DV0Q 2VBSA 2ZXPA 2OQ0A 5CYUA 3AMUA 2JJQA 1Y1WB 3U50C 3AVVA 3R2IA 2F52A 3FPUB 4X64Q 1LTBD 3I4MH 3ZJYC 4ZYSA 1KL9A 1Y8NB 2L55A 3KJOA 3KLSX 3BVMA 4NCNA 2C9OA 2OBSA 2CWPA 1SDFA 3P75A 3MHPA 4ACAA 1S72A 1W35A 2NVYH 2YU9B 4YAFA 1CHPD 4RG1A 1SN8A 4DUZL 4ACBA 3F2CA 4DA2A 1OXVA 3AVXA 4XLHA 2BH8A 3VYSA 2YTVA 2JYOA 1Q86C 2ZTNA 1N05A 1SR3A 3L0OA 3I4OA 4LBVA 4PMWA 2K04A 4C2MH 1E63A 1KLGD 4A76A 4TN1A 3BU2A 3PVDA 1G7SA 1RIPA 1NNXA 2NN6G 4YY3L 1O7LA 1XMOQ 1SLJA 1E1QA 3QIAA 2J7ZA 1D2EA 4H9GA 1Y8PB 1L0WA 1PHJA 2Q8IB 4RDKA 4IUVA 2EYJA 4XQQA 4IOCA 2Z8LA 2V7VA 2PQAA 1C0AA 2R7DA 1IYJB 1N9WA 3D8GA 1YNXA 1HQRD 1NB9A 1VQCA 1SE2A 2CK3A 2PPBC 2CW0C 3RZOB 2MNAA 3GTQB 2PI2E 5H59A 1KK1A 5C4XG 3OWEB 4BY1H 5M3FG 3SLDA 5HKKA 1B7YB 1GUTA 2KCMA 5TSSA 4ZUJA 4HIDA 4CQJA 2PE3A 2WIIB 3WNCA 1R5OA 1SYGA 4H44C 2JE6I 2V31A 1JB7A 4JW0A 3K57A 4P22A 1IW7D 5J35A 2EQSA 1P4MA 1I4GA 3URYA 2QEXA 2LSSA 5C3EG 3OW7A 1PZKD 1UE7A 1UD5A 3LVBA 1BPLA 1QWYA 2R92G 2J0TD 2VYQA 3HOVG 4R1JA 3SGIA 2ENBA 5T1IA 3CQZH 2K7VA 3SVMA 5A89A 4JMQA 5JEAJ 4DR7L 1JT8A 1HCZA 1A8VA 3SR1A 1E24A 5F2DA 3CW2C 4LFAL 1XB2A 2VUMB 1HNZL 2CHBD 2FMMA 3PO3H 1TKWB 5IGDA 4OEMB 4A3GG 1RTNA 1PTOF 4K8JA 3T53B 2KEEA 4X66Q 2QW7A 3VA7A 1D1KA 5T1GA 2A6HC 3DWPA 3B6YA 3ASTA 1GVHA 1YJ9B 2AQ3B 1NB0A 5A2QL 1G2SA 4IFDJ 1IZ6A 4DV3Q 1GOZA 3OYYA 2R61A 1N06A 3Q3AA 2MFIA 2JEBI 1XYIA 1VQ9A 2NUCA 1L0YB 3EBEA 1BXTA 4DXFA 1IYUA 1EY4A 1Q46A 4RPBA 3ASQA 1RF2D 2VBTA 1CUKA 4N8X1 1MIUA 4P73A 2F0FA 4BY7B 1O80A 4DV2L 4NKLA 1K28A 2CF4A 1K83H 3A55A 5J3OA 5KW9A 3CF5A 1BVSA 5CDFA 1IKLA 4JI2L 4X06A 1UE1A 2QEXB 1EWHA 2QCPX 4KN4C 5CV5A 2CW0D 5FO8B 4FF1A 4B3RQ 1V5VA 5D3DA 1G7RA 1AZPA 4C1NK 4UHVA 4C3JH 2H5XA 2N8NA 4O0AA 4PZ8A 4A3EH 3J81j 1PH3A 4NPSA 1Z47A 2B63B 3T51B 1NTGA 1F9QA 1B53A 4RHSA 4KHPL 1YBYA 1QG7A 1JOOA 3BZDB 5IK2A 2Q6LA 4HMJA 2PI2A 1CT1D 4DXGA 2ZITA 4PAAA 1SYDA 3I4NB 4PZ7A 5L37A 2ZL6A 1KK3A 1ZM2A 3X3NA 3SKBA 2SOBA 4NDXA 4XMYA 2VW9A 1FNDA 4G7WA 1SFOB 1IKMA 4A3FH 2DYIA 3NQTA 3HOYH 1ICFB 2XIWA 2C5BA 2MHVA 3CP0A 2C77A 4OOVA 1TS5A 1VQ9B 1YHAA 4JC0A 4MN3A 3OJXA 2WPDA 2J4XA 4LUVA 4NMZA 1FGBD 1Y1VB 4H0LC 1EU3A 1VMCA 1VMPA 5HZBA 2IPKD 4KI0A 3CPFA 1VLOA 4A3LG 3VYUA 1QZGA 3A8KA 1EL0A 5LMNQ 1SMXA 4UPAA 5C4JB 1GAQA 3NSWA 2OTLA 4UZFA 1VS0A 2L1BA 4HIMA 4GKKL 4M8AA 2DETA 3S16B 1UNSA 1M8AA 1STNA 4G7XA 2NZHA 4LAAA 1QUQA 4DGZA 1H9MA 1B70B 3T1YQ 2ZTDA 3CP8A 2F0IA 1LO5D 4RKLA 2X53S 1D8LA 2I0QA 4BXXG 4MTKA 4L8JA 4JI6Q 3OP1A 3E0EA 2GPJA 3I72A 4RPDA 3U4VA 4BBRG 1F77A 3PUVA 1R4QB 2E1RA 2PYKA 3NWSA 5DNFA 1SXTA 1WTVA 2D9UA 3HEJA 3F8TA 4OX9L 1JB3A 2KHIA 3I7FA 4JI0L 1KDCA 3A74A 4RAUC 1YEZA 4A3EG 2UXBL 1VQLA 1BMFA 4YWLA 3I4LA 2Z0SA 4LFCQ 4ODGA 3OOCA 4FYDA 4DR5Q 3DWAA 4JI3Q 1X9NA 4RD4A 1U4LA 1FDRA 1F2MA 1IBKQ 1F20A 1WCMB 1F2YA 4A3DG 5DEHA 3OZWA 5IYQA 3TP7A 1JA1A 1TWGH 4G7OC 1ZM4A 1NY4A 1IYVA 3OIPA 1WP6A 2XNJA 4JI4Q 4TKOB 1H85A 2V4DA 2RCFA 5C44B 3KF8B 3VR6A 5COYA 1Y0RA 1SNQA 4A3BB 3OMGA 2Z6KC 2VBVA 4UY8C 1AH9A 2AUKA 4BBSH 3C2PA 1I94L 3M4PA 3C46A 2NVQB 3JQRA 4IQZA 3T4AC 4DR4Q 1D8TA 4B3XA 2K1BA 2RC6A 3U9OA 2D3LA 4JK1C 1RQRA 1SNMA 4GN4B 4F8MA 2JA7G 2BSAA 3LWUA 3E0JA 4NW2A 3OEEA 2BE5C 3A0JA 3PENA 1ENAA 3CXCA 2CH4W 3DM1A 3MWYW 2HT1A 3I1FA 1BCPB 3E9IA 1YX2A 2Z4IA 4CDCC 4DQLA 2YWHA 1YHQA 4LF6Q 4C0SA 4WWVA 2YWEA 2XGTA 3BZCA 2GK7A 3QOJA 3K0YA 1S5FD 2TMPA 2BPOA 3PUZA 4RH6A 1O7YA 2KQ3A 1VQLB 1JCKB 4UAIA 1E43A 1WOPA 3I90A 3NELA 1Q81C 4OPVA 4EGVA 3SK4A 3J7AV 1EP1B 4AVZA 5IOCA 4A3JH 4LFBL 4A93G 4JYAQ 4LF5Q 2ZZEA 5EPKA 1JJ2A 1PRTF 3KLSA 2LFNA 1EP2B 5FLXE 2JJ1A 3MXPA 5JOBA 2G9DA 4K1XA 5IY0A 2DJGC 2ZJRA 4IUTA 2KHJA 4Z1MA
chains in the Genus database with same CATH topology
5ELFA 4FF4A 2K5QA 1ML0D 4ZKCB 5C3WA 5KNBA 3HOZB 3VR2A 1SNPA 4X3TA 5E3FA 2KHSA 3D4WA 3TZUA 1BDOA 1II3A 3H6MA 1EFRA 1QJOA 3S2HB 3K5OA 4V190 4CKCA 1CA5A 4B3GA 3JU4A 4XD7A 1SYBA 3EJIA 3OWFA 1EOTA 1BQQT 2WZPP 1ILQA 3SDZA 4OO1I 1CI3M 3A56A 3IFDA 3P1HA 5A35A 5C3XA 3S17B 2FMCA 1PLFA 3TP5A 3ERQA 2BE5D 4HSPA 5JPNC 4I7ZC 4EQOA 3IAYA 1EY0A 4L6TB 1JICA 1FX0A 1D5MC 3WDNA 2OEOA 4CGYB 4BWGB 1G91A 3K5MA 2VB2X 1GJXA 1PZJD 5C0XG 5C4XB 2K5WA 4NNJA 2RDHA 1TY2A 4G7HC 2F0QA 2JP1A 1PKVA 1GXDC 4HTHA 5C3EB 4XIGS 1E2WA 2E74C 2Z1CA 3A35A 2X6WA 3PV0A 2R92B 3HZXA 1R4PB 3SK6A 2HLDA 3HOVB 1EY6A 4X3UA 4CBVA 1I6VC 2DY7A 4KMUC 4R8NA 3W2DA 5CV4A 4C1NI 1V0FA 3ONAB 2X85A 4A3GB 3DUZA 2K6AA 1KTKA 1G6ZA 3DEOA 2EYFA 4JBWA 4FP5D 4XN3A 5JVH3 1Q8IA 1S5CD 4K6DA 1CK1A 1E2ZA 4XONA 1NUCA 3X3MA 2K03A 4XT1B 2F0PA 3D4RA 3Q6SA 5JEAH 1C8CA 3MXUA 4FF2A 2EXZA 2E76C 1MABA 1KNAA 2CVRA 1ESRA 1TU2B 1KZLA 4IFDH 2B2UC 4DAPA 1HTLD 1D5ZC 3NK9A 4F88A 1PMRA 1E0BA 3JAME 5C6AA 3DWQA 3C1EA 1H9RA 4J6HA 1HUMA 1I4PA 1NBMA 3OE7A 1UAPA 3KBGA 5I6YA 3TN2A 4PMCA 2PO4A 4QMGA 5EPLA 2SEBD 3E5SA 3D31A 3J80L 2NN6I 3HGBA 5JPMC 3R8BA 3QO2A 2L5TA 2Q8TA 2KOLA 1YNNC 5JJZA 2F3WA 2RA4A 1GUWA 5KIXA 3MFGA 3PO3B 2XSCA 2EY2A 4FF3A 1STYA 3OSOA 1G291 2IL8A 3D3RA 4RCOA 2BOSA 2HUGA 2X6XA 4OIJA 3I73A 1OXXK 1TT2A 1JQYD 1O78A 1TWFB 1C48A 1IHZA 3K58A 4ID6A 1STEA 1PTOC 1X3QA 4K14A 1PTOH 4XT3B 1K83B 5KRUA 4BBRB 4O1NA 5BN3A 4J8QA 1DYQA 2R3ZA 1DM0B 1TWAB 3S1MB 3Q23A 1VJSA 4G4KA 5I2YA 3BYTB 5M9OA 4A3EB 1Z7TA 1JE4A 2F0MA 1ZXTA 3GV3A 3K6OA 1SNDA 4A3DB 1G8ZD 4CJ1B 4XM3A 4EQPA 1HVXA 2N88A 5IIFA 2Z4HA 3PUXA 2IWHA 3S2DB 1ET6A 1YNND 5ELDA 3GTJB 1SYCA 1EY7A 2SNMA 2D2CC 3NP8A 3DHQA 3VR5A 1BNZA 3IL8A 2ZXRA 2EY6A 5EBDA 3P20A 3TP8A 1RDPD 1BCPF 2JA7B 3S15B 1H9KA 1JOKA 1EEFD 5M5WB 2F0KA 5CV8A 2F03A 3ND8A 1DOLA 1X3PA 4TQUS 2AWOA 1GUOA 1J9OA 2WJVA 2NBFA 1KNEA 2ZT9C 1VF7A 5IGCA 2BDOA 1PTOD 1ENCA 4B9WA 1A3VA 1I3QB 4DN4M 4IURA 2AWNA 1WTOA 1WD0A 5JVG3 3M3YB 4XXEA 2F0DA 4K5XA 1SMYD 1Q3LA 2B2WA 5EKIA 5ISRA 4U673 3L7ZC 3FKIB 4N9PA 4HN7A 1UD8A 1MD2D 3A8IE 5DM73 1SYFA 2W6IA 1HQMC 2F0OA 3PO2B 3I8ZA 5K36H 4QUCA 1S5ED 1A15A 3BDCA 4B9XA 2Q8RE 1KMHA 3PMFA 1C4QA 3TDQA 2XZOA 1EIGA 4WORA 1I18A 2WACA 3MZ5A 2EYLA 2JIZA 4ZK9B 5NUCA 1F9PA 3AB9A 4P2CB 3M4OB 3GTMB 4XQFA 2C5CA 4O42A 1TWCB 2IJ0A 1BR9A 1HFNA 4II2A 2EY1A 2F0LA 4BA1I 1CM9A 1WD1A 1U4MA 1F9RA 2L9HA 3FVQA 1BLIA 2B8FA 5D3IB 3IKJA 3HAGA 1FNVA 4ULLA 1G2TA 2JDIA 3RUZA 1W6KA 1MI2A 1E3ZA 1Q12A 1D1IA 1PXUA 2WKDA 1SAPA 2DIEA 3DEPA 2V7QA 2IX0A 3OEHA 2W6JA 4U68A 2EYMA 2F0GA 2D62A 3OPOA 2EE1A 3PIP3 1Q90A 4OIKA 1UD4A 4XR6A 1PRTC 2XZLA 1TY0A 5BN4A 1B1ZA 5DN6A 2E75C 1HRJA 2I46A 4CKEA 2R9VA 4RGTA 3A3BA 1RTOA 5IGFA 1KDBA 1KABA 5CBAE 5CC4A 4DAVA 2VXWA 1BF4A 3KF8A 5KYIA 4XTCS 1HZEA 4Z9CB 3MA2B 5HGTA 1RODA 1LV9A 1H8HA 1TWHB 5D65A 2F1MA 2RBMA 4RGOS 4RFBA 3GV6A 2B2TA 4B08A 2CQAA 1CFMA 3D6CA 1JOQA 4PNYA 3A3GA 1F2LA 4XQJA 1STAA 3OAAA 1A6XA 2E2IB 4C3JG 3BCDA 5KNDA 3OMCA 1JR0D 4B3FX 2HDMA 5J22A 2ZXHA 5J1ZA 2NB0A 1W9XA 3SEBA 4Y7NB 2IT1A 1ICWA 1PRTD 3HRZC 4QB4A 2ZZFA 3EA6A 4XNFA 2VB3X 3MTSA 3VA5A 1DOMA 1SBBB 1F9SA 3GTKB 2F0NA 1I4QA 2GJRA 2H4OA 5FKAC 1SE3A 1NCVA 1CTMA 5C0XI 3F2UA 1DOKA 3TZDA 3NPPA 3HOWB 2XVSA 1HA6A 1UD2A 4PMBA 1YNJD 4KKUA 2ZTGA 2FFKB 2L12A 3A8JE 2N55A 1D5XC 1GUSA 4HSVA 1H9JA 1ONLA 4HMIA 2B2YA 1JC7A 1NR4A 3QG1A 3HOXB 3S14B 4IUQA 2IX3A 5M5YB 4A93B 4ABNA 4XLFA 5CV6A 1B9MA 5EGTA 5G3LD 1TQOA 3H09A 2B2VA 1KLUD 1CZGA 4K2KA 1LTSD 5KYLA 1I4XA 5FOBB 4EVOA 4E6IA 1B50A 2F0WA 2ICIA 1DCZA 1STGA 1OO9B 4MIUA 4RKBA 4ZKBB 1NAPA 2RSNA 4RA8A 4YELA 2DNEA 3LWEA 2QEJC 5CV7A 4QIWB 1W6JA 5EKKA 2A6EC 1B2TA 2OF1A 1B3AA 3VYRA 2HDLA 2LKVA 1I50B 3V05A 1HHVA 1WTHD 1CHQD 1B4OA 4XQNA 2NVXB 2EDGA 1XXGA 1BUVT 1JWSD 5I9PA 5G3LF 1LABA 2E1BA 2DNCA 1DJRD 2KUMA 2DY8A 4R8IA 2H1EA 3I70A 4PQXA 4C56C 1WTXA 1HUNA 4A3IB 2F0VA 1PFBA 2EOTA 2BCOA 5LL6S 1WTQA 2R93B 5CGKA 5EBCA 2JEAI 2RDFA 1UD3A 4AYBB 3MVVA 4FO2A 4XLEA 2FJ2A 2LMCB 1LTAD 4OO1H 5KNCA 3QWNA 1E2VA 2D3NA 5FLXL 1EYAA 2ZZGA 2A5HA 2NZ1D 1EQTA 1S5BD 3J81E 2XZPA 2KJXA 4MHEA 3N52A 1ZYRC 1WTRA 1EY5A 3HG9A 2WP8J 3I4MB 5IGBA 4IUUA 3DMUA 1PZID 3CHBD 3O13A 4KHZA 2A69C 4UDUC 2NVYB 4ILWA 4KTAA 1I4HA 4E0FA 2A6ED 4XDXA 3CRLC 1AW7A 1PDQA 1J8IA 1WTPA 2PW5A 2RSOA 4C3HG 3ITPA 4XKWA 4C2MB 3M7GA 2B39A 1CQFA 3P7JA 1LT5D 3TMEA 1F2ZA 2WAQB 5ELEA 4HR7B 1K28D 2B8GA 5I9OA 2B2TC 3ZPNA 2MJ8A 1V43A 4IZ8A 1RJTA 2GJKA 1BCPC 2QDBA 3S9WA 4OL7A 2PW7A 5E4WC 3D6WA 1TIID 2KVMA 4KJOA 4BY1B 4G6IA 3MEHA 3S1RB 1OHHA 2VJJA 4DFAA 3QB3A 4I65A 4F87A 3NHHA 2XWBB 2F0UA 3M4YA 1QCBD 1ZYRD 3M7NA 1EYCA 4K8IA 1Y8OB 4DNTB 5IT9E 3CQZB 2EVBA 4IUPA 5J39A 1JORA 3DXJC 4WFN3 2A73B 3BG3A 2A69D 1SSOA 2F0SA 1CZWA 2RDGA 3W3AA 4CHTB 1AZQA 4XOTA 1OXUA 1EZ6A 4KD3A 2ID0A 1JWMD 5C0XJ 4KY6A 1LTGD 3FPPA 1EQVA 1M4VA 1GUNA 4TSFA 1COWA 2PCFB 5JEAG 2NN6H 3WOFA 2O5IC 1BCPD 3V2TA 1GHJA 1A3UA 2K05A 4CJ0B 2JXMB 4C3JB 2QILA 2NWGA 2KCNA 3KUPA 1H9SA 1SMYC 2OT2A 4IFDG 4YEJA 1ET9A 4DK1A 2HCCA 2KEDA 3JAML 2RKSA 2BA1A 1TVXA 1TS4A 3MXGA 3PUYA 2EJMA 4A3FB 3HOYB 1FNUA 1LTRD 1E79A 1RKNA 1SNCA 1QB5D 3BS1A 5JAVA 3NXWA 3I91A 3GTOB 3C1FA 1I6HB 3HP3A 2Z6BD 4LJZC 5DAUA 1D2BA 1HPCA 3G05A 1EFID 2VNUD 1DONA 5C4HA 1I4RA 5FO7B 1IL8A 2QF7A 2K01A 3PIO3 1MBYA 3Q22A 4WJWA 4KKSA 2SNSA 5A2QE 1AP0A 4YIJA 2GJPA 4KV6A 2F0HA 1H9SB 1V1PA 5EPJA 3IFTA 4BA2I 5LHY1 1SJED 2K33A 4HCSA 2D5DA 3SHLA 3OFNA 2PNRC 3G7LA 1VCIA 3R93A 3WQZA 1STBA 1EZ8A 1A2TA 5EJWA 3KEWA 3K59A 4KY7A 4K5VA 1ILPA 1LT6D 4QUFA 4TT3A 2XRSD 1CQVA 3SXHA 2RQXA 3FMCA 2LY7A 5C4ZA 3K5LA 3CRKC 1UEAB 1TWGB 1WVLA 5I2XA 3TBIB 2F3VA 1QILA 4BS9A 3EFXD 4FXUA 4BBSB 3Q24A 3BC9A 4XOPA 4RCNA 2AUJD 4KJNA 3J7AF 1LT3D 4ZUIA 1HFGA 4R9WA 4QF4A 5DM63 1V1PB 4LK1C 4QCLA 1E3XA 3A8KE 4GZYC 1SNOA 2NYZD 2ICEC 1MSHA 1T5XD 1EY8A 3J7YW 4TSSA 3NTIA 3NQIA 5KGUA 2M2LA 1A2UA 2AQ1B 3FKSA 5K5PA 2NVTB 5EQ0A 1Q1BA 4DNRB 2PQEA 2LZJA 4OGQC 3R3OA 3QOLA 4XYOA 4F7XA 4A3JB 1SJHD 2K5DA 3CKIB 2KCCA 3NTHA 4S3SA 2EYOA 3NWTA 3KK7A 2VJIA 3PUWA 4XKVA 4ASUA 4C3IB 1D6EC 3L3OC 3N6RA 2L0CA 3BVGA 1CA6A 3CP2A 1VF5C 2DN8A 1OXTA 3ND9A 2E2HB 3OHXC 1PFNA 5K36G 3FRPB 5D14A 4KY5A 1I8DA 5CV9A 2ZXOA 1Q1EA 2JA8B 3Q0AA 1AFPA 3GQBA 3UI2A 5IODA 5C5MA 1VDZA 2XRQD 4N9TA 4C3HB 2EJFC 2QE7A 2L4NA 2K32A 2K28A 1QNUA 1NSNS 1EWCA 2O5JC 1NR2A 2R7ZB 4ME5A 1YNJC 5I6WA 4H7BA 4PV1C 1EY9A 2A6HD 1FR3A 4KKTA 3OIQA 1OXSC 2E2DC 3CESA 4DU9A 3LX0A 4YXWA 2IX1A 4J1MA 4IALA 4HAEA 3R2TA 1KDAA 1QE6A 1HXYD 1MSGA 1GHKA 4K6LA 4KK7A 4G57A 1LTID 2WB1B 1EYDA 4KD4A 4ZQ3A 1EU4A 3BCFA 1PYWD 1TS3A 1XWEA 5EKLA 1W0JA 2XGJA 3S1QB 2B2UA 2MP1A 3S1NB 2X6GA 2ZZQA 2MGSA 2FINB 2EZVA 3SK8A 3NBHA 4NP5A 2F0TA 2WINB 4FXGC 3K7AB 4KN7C 1LTTD 3MAQA 1LLRD 4X3KA 5KNLA 3TP6A 3G6JB 4RGMA 3U9SA 3FEWX 1SKYB 4FXDA 4GQNA 5E4XA 1BOSA 2JSOA 2KVOA 4HIZA 4FNFA 4FVMA 1U9RA 4IN3A 2X69A 1V0EA 2PZTA 3H91A 5ELCA 3EQLC 2WSSA 2EY5A 2X6YA 3D4DA 5C5LA 2B2WC 4A3MB 2EPBA 2XOKA 4TRDA 2IW3A 2A68C 4HCEA 4Q0FA 1SYEA 3EROA 4UZUA 3E6ZX 3T13A 1GUGA 5C0XH 2EYPA 1HTPA 3BDLA 3HS0C 3V96A 4DAYA 2EJGC 4ZRZA 1T5EA 1XX8A 3BVZA 2HQEA 4IUNA 4DF7A 3GP7A 5M3MB 3A54A 1V1OA 3MXNA 4HEDA 4CJ2C 3GVJA 2I07B 2PMZB 3TSSA 4RGNA 1O7ZA 2F0JA 1DXMA 3GVLA 3FDTA 5FL7A 3SE0A 1DD2A 5AFWA 2L11A 2PZWA 3VR4A 3L9AX 3HKZB 4H13C 5KEEA 3RMHA 3SK5A 1R9TB 3HOUB 3GO5A 1V8QA 4X3SA 3KBXA 4ZAIA 1PFMA 5IGEA 2EYHA 3M85A 1PTOB 1EIHA 1BO0A 2QKIC 4K5WA 1KAAA 5CBEE 2M5SA 4XYQA 5CMDA 1B44D 1U4PA 4ZLTF 2X6LA 2A68D 2GK6A 4L63B 1Z6HA 1WPCA 3BH4A 4C3IG 3NE5B 5E1FA 1UUPA 1AN8A 2SDFA 1RCVD 3MFYA 2OXPA 5M3FB 1BBXC 3H0GB 1FD7D 1S5DD 3T16A 1SE4A 1K8MA 1X32A 2R6GA 3NTKA 3GTPB 5FK9C 1FYCA 3J80E 3LNNA 4OHJA 2M00A 2BDNA 1QOHA 3GTLB 4XLAA 2F4IA 1AEXA 3VR3A 2E2JB 4Q5VA 2MPMA 4XORA 2XNAC 1ENFA 2M9VA 2NTTA 3A7AB 3MHBA 3I3CA 3BDOA 1TS2A 1W0KA 3H3VC 1H8EA 4IFDI 5CORA 3GTGB 2ZXIA 2PZUA 4A3KB 1UD6A 3GD7A 1ESFA 3WOEA 1U4RA 4KHVA 2KECA 2X8KA 2XN9C 2A74C 1JWUD 5M5XB 2BA0A 4OO1G 1K8OA 4II3A 1VLYA 2XWJB 4V0BA 1NRKA 2WKCA 4RWSC 2XNDA 1RD9D 2NTSA 2F0EA 3J81L 3A7LA 1L0XB 2KA7A 2TSSA 1WTWA 2LS01 3RLFA 1Y69U 3RD4A 2MUYA 2O2LD 5HURA 4FXKC 2WJYA 1ZEQX 4K2LA 4WRDA 2RVLA 1QNKA 4DK0A 2HCIA 2JA6B 5LL6X 4XLCA 1A3TA 4LMQD 5CR3A 2O4XA 4XN0A 1STHA 3GVKA 3C3LA 2B2YC 4G7ZC 3EVQA 3CMMA 5IGGA 2GA4B 1MGSA 3T56B 1DZ1A 4XL9A 1SEBD 3CU7A 3BYYB 3ZIAA 1XTCD 2FHTA 2G9HD 2Y0SB 2B2VC 1B9NA 1HA5A 1RHPA 1EEID 4CKBA 2JJ2A 3MC0B 1S4ZA 3NBIA 2YYZA 3KLRA 1OB0A 4M1UB 3K5NA 1ZKOA 5I4DA 2JA5B 1LT4D 2F43A 1E1RA 3NUCA 3QJYA 2WV6D 5ELBA 4RHRA 1LACA 2AQ2B 1FNWA 3ZYYX 3H94A 4EQNA 3RZDB 1TR5A 5FO9B 3VYTA 3AU7A 1IW7C 3DDYA 1PRTB 5IT9L 5BN5A 2ZXPA 5CYUA 3AMUA 1Y1WB 3R2IA 3FPUB 1LTBD 4ZYSA 1Y8NB 2L55A 3KLSX 3BVMA 2C9OA 1SDFA 3P75A 2YU9B 1CHPD 4DA2A 1OXVA 4XLHA 3VYSA 2JYOA 2ZTNA 4PMWA 2K04A 1KLGD 2NN6G 1O7LA 1E1QA 3QIAA 2J7ZA 1Y8PB 2Q8IB 4IUVA 2EYJA 4XQQA 2Z8LA 3D8GA 1HQRD 2PPBC 1SE2A 2CK3A 2CW0C 3RZOB 3GTQB 3OWEB 5HKKA 1GUTA 5TSSA 4ZUJA 2WIIB 1SYGA 4H44C 2JE6I 2V31A 3K57A 4P22A 1IW7D 1I4GA 3URYA 3OW7A 1PZKD 1UD5A 1QWYA 1BPLA 2J0TD 2ENBA 5T1IA 2K7VA 3SVMA 4JMQA 5JEAJ 1HCZA 3SR1A 5F2DA 2VUMB 2CHBD 2FMMA 1TKWB 5IGDA 1RTNA 4K8JA 1PTOF 3T53B 2KEEA 3VA7A 1D1KA 5T1GA 2A6HC 3DWPA 2AQ3B 4IFDJ 5A2QL 1G2SA 1GOZA 2R61A 2JEBI 1XYIA 2NUCA 1L0YB 1BXTA 4DXFA 1IYUA 1EY4A 1RF2D 2F0FA 4BY7B 1O80A 4NKLA 3A55A 5CDFA 1IKLA 1EWHA 2QCPX 4KN4C 5CV5A 2CW0D 5FO8B 4FF1A 5D3DA 1AZPA 4C1NK 1Z47A 2B63B 3T51B 1F9QA 1B53A 4RHSA 1QG7A 1JOOA 3BZDB 5IK2A 4HMJA 1CT1D 4DXGA 1SYDA 3I4NB 3X3NA 4NDXA 2SOBA 4XMYA 4G7WA 1SFOB 1IKMA 3NQTA 2XIWA 2MHVA 1TS5A 4MN3A 2J4XA 2WPDA 4NMZA 1FGBD 1Y1VB 4H0LC 1EU3A 1VMCA 1VMPA 2IPKD 4KI0A 3VYUA 1EL0A 5C4JB 3NSWA 2L1BA 4M8AA 3S16B 1UNSA 1M8AA 1STNA 4G7XA 4LAAA 4DGZA 1H9MA 3CP8A 2F0IA 1LO5D 4RKLA 2X53S 4L8JA 3I72A 1F77A 3PUVA 1R4QB 2PYKA 3NWSA 5DNFA 1SXTA 1WTVA 2D9UA 3HEJA 1JB3A 1KDCA 4RAUC 1BMFA 3I4LA 4ODGA 3OOCA 4FYDA 3DWAA 1U4LA 1F2MA 1WCMB 1F2YA 5DEHA 3TP7A 4G7OC 1IYVA 3OIPA 1WP6A 4TKOB 2V4DA 5C44B 3VR6A 5COYA 1SNQA 4A3BB 3OMGA 2AUKA 3C2PA 3C46A 2NVQB 4IQZA 3T4AC 2K1BA 3U9OA 2D3LA 4JK1C 1SNMA 4F8MA 3LWUA 3E0JA 4NW2A 3OEEA 2BE5C 1ENAA 3DM1A 3MWYW 1BCPB 2Z4IA 2GK7A 3QOJA 3K0YA 1S5FD 2TMPA 3PUZA 4RH6A 1O7YA 4UAIA 2KQ3A 1JCKB 1E43A 3I90A 4EGVA 3SK4A 3J7AV 4AVZA 5IOCA 2ZZEA 5EPKA 1PRTF 3KLSA 2LFNA 5FLXE 2JJ1A 3MXPA 5JOBA 2G9DA 4IUTA 4Z1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 H;  2E75 C;  5KNC A;  4KKS A;  1H9M A;  1IW7 C;  1TKW B;  1V8Q A;  3PUW A;  3BG3 A;  4KKU A;  1E2V A;  2A69 D;  2BA0 A;  3L7Z C;  3A8J E;  3T53 B;  1GUS A;  5BN5 A;  3W3A A;  1H9J A;  1ONL A;  1H9S B;  3A8I E;  3VR2 A;  5KNB A;  3VA7 A;  4JBW A;  2A6H C;  1K8O A;  3IFT A;  4L8J A;  3QG1 A;  4BA2 I;  3N6R A;  1BDO A;  1HQM C;  3TZU A;  3I72 A;  1OXU A;  3M85 A;  2K33 A;  1ZYR C;  4KN7 C;  5K36 H;  3PUV A;  5BN3 A;  1Y8N B;  1QJO A;  1VF5 C;  2D5D A;  2DN8 A;  1OXT A;  2JEB I;  1B9M A;  3ND9 A;  4XTC S;  1E2Z A;  2PNR C;  1IYU A;  5K36 G;  3A7L A;  1VCI A;  4KHZ A;  3U9S A;  1Z7T A;  2KA7 A;  3D4R A;  3FPP A;  2F1M A;  2A69 C;  3I4L A;  2A68 D;  3RLF A;  5JEA H;  3OOC A;  1OXV A;  1Y69 U;  1GUN A;  1Z6H A;  2A6E D;  3MXU A;  1Q1E A;  2PCF B;  3SDZ A;  3CRL C;  3NE5 B;  5JEA G;  1EWH A;  1CI3 M;  1DCZ A;  2NN6 H;  3GQB A;  1CFM A;  2E76 C;  3FMC A;  4KN4 C;  5A35 A;  4DK0 A;  2O5I C;  4G7O C;  1GHJ A;  3MFY A;  1IYV A;  2BE5 D;  1VDZ A;  3PUX A;  4TKO B;  2V4D A;  1A6X A;  2NN6 G;  1TU2 B;  1O7L A;  2EJF C;  3CRK C;  4I7Z C;  3AB9 A;  3EQL C;  4IFD H;  2JXM B;  3VR6 A;  2K32 A;  3QIA A;  1K8M A;  5KND A;  1Y8P B;  2AUK A;  3WDN A;  3T51 B;  2Q8I B;  2O5J C;  1H9S A;  1SMY C;  2DNE A;  4HR7 B;  2R6G A;  2B8G A;  1YNJ C;  4IQZ A;  4IFD G;  2A68 C;  1PMR A;  4G7Z C;  2D2C C;  2A6E C;  1FYC A;  1V43 A;  1GUG A;  4PV1 C;  4RCN A;  3VR5 A;  4BA1 I;  3LNN A;  2A6H D;  5C0X H;  1FR3 A;  2AUJ D;  1HTP A;  4JK1 C;  4KKT A;  1H9R A;  3P20 A;  4DK1 A;  2PPB C;  3T56 B;  2B8F A;  1GJX A;  2CW0 C;  1H9K A;  3IKJ A;  3LWU A;  2EJG C;  5C0X G;  2EDG A;  1T5E A;  1OXS C;  3VR3 A;  2BE5 C;  4LK1 C;  2BA1 A;  3D31 A;  2IT1 A;  3ND8 A;  1GUT A;  4TQU S;  2AWO A;  1LAB A;  1GUO A;  3A8K E;  4GZY C;  4G7H C;  2NN6 I;  2DNC A;  2ZT9 C;  3HGB A;  1B9N A;  3PUY A;  4OO1 G;  2L5T A;  1VF7 A;  4H44 C;  2EJM A;  1Q12 A;  1YNN C;  2JE6 I;  1IW7 D;  4H0L C;  2BDO A;  3A7A B;  1DXM A;  3BDO A;  4XIG S;  1GHK A;  3PUZ A;  4KI0 A;  1E2W A;  3SE0 A;  2E74 C;  1DD2 A;  3OW7 A;  4LJZ C;  1G29 1;  2YYZ A;  3PV0 A;  3KLR A;  2JEA I;  1ZKO A;  3VR4 A;  3M4Y A;  1HPC A;  1CTM A;  2D62 A;  4H13 C;  3OPO A;  3QJY A;  3M7N A;  2K7V A;  1Q1B A;  1I6V C;  3I73 A;  4DNR B;  1Q90 A;  1OXX K;  3GD7 A;  4OGQ C;  4KMU C;  1O78 A;  1LAC A;  2QF7 A;  1HCZ A;  1Y8O B;  4DNT B;  3H94 A;  2LMC B;  2KCC A;  2EVB A;  5BN4 A;  3DXJ C; 
#chains in the Genus database with same CATH topology
 5ELF A;  4FF4 A;  3ZZU A;  3NEN A;  3WYA A;  2K5Q A;  2QMU A;  4LBW A;  1ML0 D;  4ZKC B;  5C3W A;  3FKI G;  5HXB A;  5KNB A;  3VR2 A;  3HOZ B;  1DGS A;  1SNP A;  2XTI A;  4X65 Q;  4DR2 L;  4RD3 A;  4X3T A;  5E3F A;  4WZK A;  2KHS A;  2IY5 B;  1ELO A;  3D4W A;  3TZU A;  1BDO A;  1II3 A;  3PO2 G;  1K0R A;  3H6M A;  2E2H H;  1EFR A;  1QJO A;  4A75 A;  5FJ8 G;  3S2H B;  4X0C A;  1VQ5 A;  1L1O C;  5FIU A;  3K5O A;  4V19 0;  1I5F A;  4CKC A;  1CA5 A;  4B3G A;  1N36 Q;  3JU4 A;  4XD7 A;  1SYB A;  3EJI A;  3OWF A;  2JA8 H;  1EOT A;  3K8A A;  2QGQ A;  2UU9 Q;  1YHQ B;  4HJ8 A;  1BQQ T;  2B3G A;  2KBN A;  2WZP P;  1ILQ A;  3SDZ A;  4OO1 I;  3K7U C;  4RCZ A;  4C3H H;  1CI3 M;  1PFS A;  3A56 A;  3IFD A;  3P1H A;  5A35 A;  5C3X A;  3DLL A;  1MJE A;  3CCE A;  3S17 B;  2FMC A;  1PLF A;  3TP5 A;  1IBM L;  3ERQ A;  2BE5 D;  4HSP A;  3KF6 A;  5JPN C;  4I7Z C;  1VQA A;  4EQO A;  3AFP A;  3KJP A;  4BPR A;  4B3M L;  4A3C H;  1B3Q A;  1VQJ A;  2R7Z H;  3IAY A;  1EY0 A;  4L6T B;  1JIC A;  1KIX A;  1FX0 A;  1CSP A;  1D5M C;  2K50 A;  3WDN A;  1XMQ Q;  2OEO A;  2HHH Q;  3DM3 A;  4GN5 A;  3K0X A;  1R5N A;  2ZTC A;  1J5E L;  1FRQ A;  2C2W A;  4CGY B;  4BWG B;  4DAM A;  1UE5 A;  1G91 A;  2HMA A;  1Q81 D;  3K5M A;  2VB2 X;  1GJX A;  1PZJ D;  1QGZ A;  5C0X G;  5C4X B;  4JBJ A;  5JJI A;  2K5W A;  3BY1 A;  3QFR A;  4HJ9 A;  4NNJ A;  2JN4 A;  2RDH A;  1TY2 A;  2QA4 A;  4HJ5 A;  1HJP A;  4G7H C;  1VQP A;  2ZM6 L;  1K73 C;  2F0Q A;  5GV7 A;  4M4S A;  2YV5 A;  2UXC Q;  5H5J A;  1VQ5 B;  1FVI A;  2JP1 A;  3Q8D A;  4LF8 L;  2OBR A;  4MZ9 A;  1PKV A;  2UUA L;  1WFQ A;  1GXD C;  3WY9 A;  4HTH A;  5C3E B;  4OWT B;  1A63 A;  4XIG S;  1U2R A;  4NXN Q;  1E2W A;  1YHB A;  2E74 C;  2Z1C A;  4L5Q A;  5BR8 L;  3A35 A;  2X6W A;  3PV0 A;  2R92 B;  3HZX A;  1R4P B;  3SK6 A;  2HLD A;  3HOV B;  4DV0 L;  3EIV A;  2UUB Q;  1EY6 A;  4X07 A;  4JV5 L;  4M0L A;  4X3U A;  4CBV A;  1M1K D;  1I6V C;  2DY7 A;  4KMU C;  4DV5 L;  4R8N A;  3S1Q H;  1QH0 A;  3S1N H;  3W2D A;  1E22 A;  5CV4 A;  5LMN W;  4C1N I;  1V0F A;  1HH2 P;  3GTK H;  3ONA B;  2X85 A;  1VQO A;  4A3G B;  3DUZ A;  2K6A A;  1KTK A;  1G6Z A;  2BN4 A;  1BQE A;  2G5D A;  3DEO A;  4ROX A;  1YIT A;  3BJU A;  2EYF A;  4JBW A;  3K7A H;  4FP5 D;  3H3V H;  4XN3 A;  3NEM A;  5JVH 3;  1Q8I A;  2EIX A;  3TQY A;  1S5C D;  4K6D A;  3QSY A;  1CK1 A;  1E2Z A;  4XON A;  4GLV B;  1NUC A;  1XMO L;  3X3M A;  2K03 A;  4XT1 B;  3Q6R A;  2F0P A;  3D4R A;  4UP7 A;  2CQO A;  5GAE C;  2OBT A;  3Q6S A;  5JEA H;  1C8C A;  4FDB A;  1HZC A;  3MXU A;  4FF2 A;  2EXZ A;  2E76 C;  3CCS A;  1MAB A;  1KNA A;  2CVR A;  1ESR A;  2LXJ A;  4A3M H;  1GVP A;  3CCM A;  1TU2 B;  1KZL A;  2F4V Q;  4IFD H;  3QR8 A;  2B2U C;  4R71 A;  1T6Z A;  1TUI A;  1K73 D;  1X3G A;  1WSR A;  1GAW A;  4DAP A;  1C9O A;  4KLK A;  1HTL D;  1D5Z C;  3B78 A;  2K4K A;  3NK9 A;  2D0O A;  1PMR A;  3PUM A;  1E0B A;  2HIV A;  4F88 A;  5IP9 H;  3JAM E;  3L2P A;  3CC7 A;  5C6A A;  4NXM Q;  4WZT A;  5IP7 H;  3DWQ A;  3F2B A;  3C1E A;  1H9R A;  4J6H A;  1KTV A;  1K8G A;  3I56 A;  1HUM A;  5GV8 A;  1WCM G;  3W5O A;  1XNR Q;  1I4P A;  1NBM A;  1YIT B;  3OE7 A;  1UAP A;  3KBG A;  5I6Y A;  4LNQ A;  3OKX A;  5M3M H;  4YWK A;  3TN2 A;  4PMC A;  2PO4 A;  4QMG A;  5EPL A;  2SEB D;  3E5S A;  3D31 A;  3J80 L;  1IHM A;  2NN6 I;  3AVY A;  3HGB A;  5JPM C;  3R8B A;  1N34 L;  3QO2 A;  2L5T A;  2Q8T A;  2KOL A;  1YNN C;  5JJZ A;  3PIO A;  4B3S Q;  2VNJ A;  1GR1 A;  2F3W A;  2RA4 A;  2WR8 A;  1GUW A;  2BV3 A;  5KIX A;  3MFG A;  3PO3 B;  2XSC A;  3G48 A;  2EY2 A;  4FF3 A;  1FJG Q;  1STY A;  3OSO A;  4Y9U A;  1G29 1;  4X66 L;  2IL8 A;  3D3R A;  4RCO A;  2BOS A;  3OTO Q;  5IYB G;  1N32 Q;  1CKN B;  2HUG A;  2X6X A;  3PUN A;  2BMW A;  3I73 A;  4OIJ A;  4Z4V A;  1OXX K;  1JQY D;  1TT2 A;  4DR1 L;  1O78 A;  4ZGN B;  1TWF B;  4DV3 L;  1R9T H;  1EIY B;  3HOU H;  4Z4T A;  4JI8 Q;  3HOW G;  1C48 A;  5GAG C;  5KSW B;  3CCM B;  2P3M A;  4DKA C;  1IHZ A;  2N78 A;  3TRZ A;  3K58 A;  4ID6 A;  4U9U A;  3CC4 B;  1STE A;  1PTO C;  3WND A;  4UP8 A;  1ASZ A;  1X3Q A;  4K14 A;  1PTO H;  4XT3 B;  1K83 B;  2CRV A;  5KRU A;  3CC7 B;  3HOX G;  3QFC A;  4BBR B;  4O1N A;  5BN3 A;  4J8Q A;  3J80 i;  4P6V F;  5JBQ A;  1DM0 B;  3I56 B;  1DYQ A;  1TWA B;  2R3Z A;  3S1M B;  3Q23 A;  1VJS A;  2Z9H A;  4G4K A;  5I2Y A;  3MEF A;  3BYT B;  4P25 A;  5M9O A;  2NZO A;  3QFS A;  1HR0 L;  4A3E B;  1Z7T A;  4Y9R A;  1JE4 A;  2F0M A;  1BBU A;  1ZXT A;  3AGP A;  3GV3 A;  3U4Z A;  4Z4Y A;  2VY3 A;  3K6O A;  1SND A;  4A3D B;  2GN5 A;  4P9S A;  5FLM H;  1YI2 A;  3H0G H;  1G8Z D;  4CJ1 B;  3BY2 A;  4XM3 A;  3T1H Q;  4EQP A;  1HVX A;  2N88 A;  4YCW A;  5IIF A;  2Z4H A;  4LWC A;  1VQM A;  3PUX A;  2IWH A;  3S2D B;  3IRB A;  4WJ3 M;  2VNK A;  4YHH Q;  2C4U A;  1CNE A;  1ET6 A;  1Q9S A;  1WDT A;  5IYC H;  4GOP B;  1YNN D;  2RCN A;  3ZZ0 A;  1BBW A;  5ELD A;  3GTJ B;  2HQL A;  4RDJ A;  1SYC A;  1EY7 A;  2SNM A;  3GTL H;  2D2C C;  3WBK A;  3NP8 A;  3DHQ A;  2R6H A;  3VR5 A;  4RDL A;  1BNZ A;  3IL8 A;  2ZXR A;  3S24 A;  2EY6 A;  2E2J H;  5EBD A;  3P20 A;  3TP8 A;  1RDP D;  1BCP F;  2JA7 B;  2OYN A;  3S15 B;  1H9K A;  1DG1 G;  4B43 A;  1JOK A;  1EEF D;  5M5W B;  2F0K A;  1WTH A;  2QGG A;  5L46 A;  5CV8 A;  4JI1 L;  2F03 A;  3ND8 A;  1DOL A;  1X3P A;  4TQU S;  2AWO A;  5DLQ E;  1GUO A;  1J9O A;  2WJV A;  2NBF A;  1KNE A;  2ZT9 C;  1VF7 A;  5IGC A;  2LXK A;  3RLO A;  3GTG H;  1JA0 A;  2BDO A;  2C4T A;  4A3I G;  4A3K H;  1PTO D;  1YJ9 A;  1ENC A;  4B9W A;  1A3V A;  1I3Q B;  3U2Q A;  1DAR A;  2R93 G;  3ER0 A;  1S0U A;  2ALY B;  3BQJ A;  1N8R D;  4DN4 M;  2K5H A;  1YI2 B;  4DK3 C;  4IUR A;  2AWN A;  1SKQ A;  4AYB G;  1WTO A;  1WD0 A;  3AVU A;  2D0P A;  5M5X H;  1DDI A;  5JVG 3;  1VQM B;  1VHO A;  4DR6 Q;  3M3Y B;  4XXE A;  2F0D A;  3S1R H;  4K5X A;  1SMY D;  1Q3L A;  2B2W A;  5EKI A;  5ISR A;  4U67 3;  4R4I A;  1P16 A;  3L7Z C;  3FKI B;  4TMZ A;  4N9P A;  4HN7 A;  2DCU A;  1UD8 A;  1MD2 D;  3A8I E;  3U58 A;  1VQ4 B;  5DM7 3;  1SYF A;  2W6I A;  1HQM C;  2F0O A;  1X3F A;  3AYH B;  4DR5 L;  3PO2 B;  2VQE Q;  2VZL A;  4DV4 Q;  3I8Z A;  1IBK L;  5K36 H;  4B4D A;  1EWI A;  4QUC A;  1S5E D;  1A15 A;  3I4M G;  2UXD Q;  4JI4 L;  1NMG A;  3BDC A;  1H42 A;  4B9X A;  5IWA L;  2Q8R E;  1KMH A;  4N3G A;  2VQF Q;  4M53 A;  3PMF A;  1C4Q A;  3TDQ A;  2XZO A;  2ASB A;  1BJK A;  2EIF A;  1Y0Y A;  1EIG A;  4EQ5 A;  2JA6 H;  4WOR A;  1XNQ Q;  1LUZ A;  1I18 A;  2WAC A;  3MZ5 A;  2EYL A;  1HNX Q;  2JIZ A;  4G1B A;  1YJN B;  3RY8 A;  1ZM9 A;  4ZK9 B;  5NUC A;  3JQQ A;  1F9P A;  3AB9 A;  4P2C B;  3M4O B;  3WNB A;  4JOI A;  3GTM B;  4XQF A;  2C5C A;  4O42 A;  1TWC B;  5FO0 A;  2IJ0 A;  2WAQ G;  1BR9 A;  2BH2 A;  1HFN A;  3W5V A;  4II2 A;  4PC3 A;  2C78 A;  2EY1 A;  2F0L A;  4BA1 I;  4LF6 L;  1VQE A;  1CM9 A;  1WD1 A;  1U4M A;  1F9R A;  2L9H A;  3FVQ A;  1BLI A;  2B8F A;  5D3I B;  3IKJ A;  1QGA A;  1NJI C;  3HAG A;  1FNV A;  3LO8 A;  2V1C C;  4ULL A;  1G2T A;  4HJA A;  2JDI A;  3RUZ A;  3UE1 A;  1UEB A;  1KJZ A;  3FP9 A;  2I5M X;  1SRU A;  4JYA L;  2IHE A;  3PGZ A;  4LF5 L;  2KEN A;  1W6K A;  1MI2 A;  1E3Z A;  1Q12 A;  1D1I A;  4BY1 G;  1E3P A;  4DV1 Q;  1PXU A;  1PA6 A;  3M9B A;  1BKB A;  2Q2I A;  2WKD A;  4Z4W A;  1OGJ A;  1SAP A;  4WJ4 A;  2DIE A;  3DEP A;  2V7Q A;  2IX0 A;  3OEH A;  4RD1 A;  2W6J A;  4B44 A;  4U68 A;  4CDF C;  5THX A;  3R6K A;  2EYM A;  2F0G A;  2X0K A;  4X7D A;  4X65 L;  2D62 A;  3OPO A;  3RZD H;  3D26 A;  3H15 A;  2EE1 A;  3PIP 3;  1Q90 A;  1EFT A;  1FL0 A;  1E64 A;  4OIK A;  1UD4 A;  4ME3 A;  4XR6 A;  1PRT C;  2XZL A;  4CDE C;  1VQK A;  1TY0 A;  3ULL A;  1KRS A;  3CMA A;  5BN4 A;  4DV6 Q;  1B1Z A;  5DN6 A;  3CCV B;  2E75 C;  4QL5 A;  4QJF A;  3GTO H;  3FHW A;  2I46 A;  1HRJ A;  4CKE A;  1I6H H;  3SJP A;  1S40 A;  4B3T Q;  1N36 L;  1Y1W H;  2R9V A;  5TY0 A;  4ZV4 A;  1VQ8 B;  4RGT A;  3A3B A;  1RTO A;  5IGF A;  4QIW E;  3PO3 G;  1KDB A;  1KAB A;  5CBA E;  5CC4 A;  2UU9 L;  4L5S A;  5FA6 A;  4DAV A;  2VXW A;  2P5Z X;  3F1Z A;  1BF4 A;  3KF8 A;  2YU9 H;  5KYI A;  1X6O A;  2PMD A;  4XTC S;  2VNH A;  1HZE A;  4Z9C B;  1O7I A;  3MA2 B;  5HGT A;  1ROD A;  1LV9 A;  2QDX A;  1YVC A;  3SJZ A;  1QVG B;  1H8H A;  1YZ6 A;  1TWH B;  5D65 A;  2F1M A;  2E8G A;  1EQR A;  2RBM A;  4RGO S;  4RFB A;  4X6A H;  4LUZ A;  5LMU Q;  2GVB A;  3GV6 A;  1ZUN B;  2B2T A;  5ELO A;  4B08 A;  3ULP A;  3J7A 5;  2CQA A;  1CFM A;  1XPR A;  3D6C A;  1JOQ A;  4PNY A;  3A3G A;  4WZL A;  1NJI D;  1J6Q A;  1F2L A;  4XQJ A;  1STA A;  3OAA A;  1A6X A;  4AYB E;  2E2I B;  4C3J G;  1EFC A;  3BCD A;  5KND A;  3OMC A;  1JR0 D;  4B3F X;  1EXM A;  2HDM A;  1U0L A;  3M4Q A;  5J22 A;  1VQK B;  2ZXH A;  3CMA B;  5J1Z A;  2V7U A;  4QVJ A;  4H02 A;  3RZO H;  4JG2 A;  3GTQ H;  2GVA A;  2KCT A;  1Q82 C;  2NB0 A;  1S4M A;  2V7W A;  2X3U A;  4NXN L;  1W9X A;  4YAW A;  3SEB A;  4Y7C A;  5A88 A;  2GRE A;  4Y7N B;  1PH7 A;  4N3N A;  1H95 A;  2IT1 A;  2UUB L;  1ICW A;  2L15 A;  2CND A;  1XQB A;  2FVG A;  1PRT D;  3E9H A;  3HRZ C;  4QB4 A;  2ZZF A;  3EA6 A;  4XNF A;  2VB3 X;  5JJK A;  3MTS A;  3K80 C;  3VA5 A;  1WOC A;  4A3F G;  1E7Z A;  1DOM A;  1SBB B;  3HOY G;  5IYW A;  3R6J A;  1F9S A;  1IL2 A;  3GTK B;  2WFW A;  1D1N A;  2F0N A;  1I4Q A;  2GJR A;  3FPK A;  4LF7 Q;  4X7E A;  1PH4 A;  2H4O A;  1SE3 A;  1VQB A;  5FKA C;  1CKM A;  2Z6B A;  1NCV A;  1CTM A;  3CCR B;  1XTD A;  3OZU A;  5C0X I;  3F2U A;  1DOK A;  1YIJ A;  1HNZ Q;  2VUM H;  3TZD A;  1N33 Q;  3NPP A;  2K52 A;  3HOW B;  2XVS A;  1HA6 A;  1UD2 A;  2BM0 A;  4PMB A;  2HD3 A;  1W2B A;  1OTC A;  3FJO A;  1YNJ D;  4DV7 L;  4KKU A;  2ZTG A;  3P26 A;  2FFK B;  2PLF A;  1KHI A;  2L12 A;  2QDL A;  2WAQ E;  3A8J E;  4HE5 A;  2N55 A;  1D5X C;  1GUS A;  4HSV A;  1H9J A;  1ONL A;  4HMI A;  2NVT H;  2B2Y A;  1JC7 A;  1NR4 A;  3B8H A;  1GD7 A;  3QG1 A;  3HOX B;  3S14 B;  4IPH A;  1QGY A;  3BZK A;  4IUQ A;  2IX3 A;  5M5Y B;  2VBU A;  4A93 B;  3G6E B;  4ABN A;  4XLF A;  5CV6 A;  2E5L L;  1B9M A;  2MO1 A;  5EGT A;  3PF4 A;  5G3L D;  1GM5 A;  1SRO A;  4BY7 H;  4DV2 Q;  1TQO A;  3H09 A;  4X7C A;  2B2V A;  1KLU D;  1CZG A;  5J3B A;  4K2K A;  3CC2 B;  1LTS D;  4JI2 Q;  1I4X A;  4C3I H;  5KYL A;  5FOB B;  2CCZ A;  4EVO A;  4E6I A;  3V76 A;  1B50 A;  2F0W A;  1Q82 D;  2ICI A;  1DCZ A;  1STG A;  4K0K Q;  1OO9 B;  5LMZ A;  4MIU A;  4UAJ A;  2YTX A;  1KD1 C;  4LF9 L;  1VQF A;  1HNW Q;  3NBH B;  5HZA A;  1M1K C;  1XNR L;  2MQH A;  2B63 H;  4RKB A;  4ZKB B;  2NPF A;  3W2E A;  3UDX A;  5IYD H;  1NAP A;  1E1O A;  1YIJ B;  2RSN A;  4JPB W;  3VO2 A;  3SEJ A;  4RA8 A;  4POF A;  4YEL A;  2DNE A;  4YCV A;  3LWE A;  2QEJ C;  4AQY L;  4N8F A;  1W2B B;  5CV7 A;  3I4N H;  1L2F A;  4QIW B;  1W6J A;  5EKK A;  3CPW A;  3CCL A;  4B3S L;  2A6E C;  4BBS G;  2OF1 A;  1B2T A;  2BF4 A;  1B3A A;  2CWA A;  3VYR A;  5AJ3 Q;  4RJL A;  2HDL A;  2RC5 A;  1MKH A;  1I50 B;  2LKV A;  3V05 A;  1HHV A;  2GQF A;  1WTH D;  1CHQ D;  1B4O A;  1SFO H;  4XQN A;  2NVX B;  2EDG A;  1XXG A;  1BUV T;  1T6Y A;  4QVA A;  1CQX A;  2J7K A;  1JWS D;  1IBL L;  2V7T A;  5I9P A;  4IJH A;  5G3L F;  1LAB A;  3OTO L;  2E1B A;  1Y1V H;  2DNC A;  3GDE A;  1N07 A;  1YLO A;  1DJR D;  2KUM A;  2DY8 A;  1PH6 A;  4R8I A;  2H1E A;  3J80 c;  3I70 A;  3I55 A;  3E3X A;  4B48 A;  1MHW C;  4JI8 L;  1N0V C;  4PQX A;  1P8L A;  3Q38 A;  4C56 C;  1WTX A;  1HUN A;  4A3I B;  2F0V A;  1PFB A;  2EOT A;  2BCO A;  5C4J H;  5LL6 S;  1WTQ A;  2R93 B;  5CGK A;  4JI5 Q;  5EBC A;  2JEA I;  3HKS A;  3S16 H;  1CNF A;  2RDF A;  1UD3 A;  4AYB B;  3MVV A;  4FO2 A;  4XLE A;  2FJ2 A;  4A3J G;  2LMC B;  1LTA D;  2K5V A;  1XPU A;  4OO1 H;  2DOG A;  4GNX B;  5KNC A;  3QWN A;  4PGO A;  1E2V A;  2K5N A;  5DSZ A;  2D3N A;  4LF4 Q;  5FLX L;  1EYA A;  2ZZG A;  3PQI A;  2A5H A;  1KRH A;  2NZ1 D;  2QN6 A;  1EQT A;  5AN9 A;  1S5B D;  3J81 E;  3CCL B;  3CPW B;  2B7B A;  2XZP A;  2KJX A;  4MHE A;  3N52 A;  1I7P A;  2OTJ B;  1KD1 D;  1ZYR C;  1WTR A;  4JI0 Q;  1EY5 A;  3H3V I;  3T1H L;  3HG9 A;  4X64 L;  2WP8 J;  3I4M B;  5IGB A;  4IUU A;  3DMU A;  1PZI D;  5IE8 A;  3CHB D;  3W5H A;  3O13 A;  4KHZ A;  4YHH L;  3PCO B;  2BGI A;  1C7Y A;  2A69 C;  4UDU C;  1K0S A;  2YWG A;  2NVY B;  5F4J A;  3I55 B;  4ILW A;  1W3S A;  4KTA A;  1I4H A;  4E0F A;  2A6E D;  2RF4 A;  1B23 P;  1Y14 B;  4XDX A;  4P6Y A;  3CRL C;  1AW7 A;  4DR3 Q;  1PDQ A;  2JA8 G;  1J8I A;  5BSX A;  4UP9 A;  1WTP A;  1X65 A;  1QVC A;  2PW5 A;  5C44 H;  2RSO A;  3RLN A;  4A3B H;  3VMF A;  4ZCI A;  4IPD A;  4C3H G;  3ITP A;  1I94 Q;  4XKW A;  4C2M B;  4QY7 A;  3M7G A;  4EX5 A;  3A5U A;  4DUY Q;  4IO9 A;  2B39 A;  3ONU A;  1CQF A;  2NVQ H;  1K9M C;  1QFJ A;  2B7C A;  3P7J A;  3J81 k;  1LT5 D;  3TME A;  2C5H A;  1F2Z A;  2WAQ B;  5ELE A;  4HR7 B;  1K28 D;  4A3C G;  2B8G A;  2R7Z G;  4GKJ Q;  4OP7 A;  4RD6 A;  5I9O A;  2B2T C;  3ZPN A;  2MJ8 A;  1V43 A;  4IZ8 A;  2WYR A;  4IPC A;  1RJT A;  1LTL A;  1VHE A;  2GJK A;  1CKN A;  1BCP C;  2EFG A;  1PH5 A;  1FNB A;  3KL9 A;  2QDB A;  3S9W A;  3PA2 A;  2PIA A;  2PW7 A;  2IHF A;  4OL7 A;  5E4W C;  2ZBU A;  2F3I A;  1TII D;  3D6W A;  3CME A;  3CCQ A;  3RNU A;  2KVM A;  2CH4 A;  4KJO A;  4BY1 B;  3CC4 A;  4AIM A;  3G4S B;  4G6I A;  3WBJ A;  4M2L A;  4R4C A;  4Z4S A;  3MEH A;  1Q7Y D;  3WWV A;  4DR6 L;  3S1R B;  1OHH A;  2VJJ A;  4DFA A;  4X05 A;  4X62 Q;  4YAU A;  3QB3 A;  4I65 A;  4F87 A;  4TMW A;  4LFB Q;  1BX0 A;  4Z4Z A;  1EWY A;  3NHH A;  2Q6K A;  2XWB B;  2F0U A;  2I5L X;  3M4Y A;  4OOS A;  2ZL5 A;  1FNC A;  2WB1 G;  2BM1 A;  1WSV A;  1LM0 A;  1QCB D;  1ZYR D;  4RMF A;  1DDG A;  3M7N A;  1KC8 C;  1EYC A;  3ERS X;  5B6I A;  2VQE L;  4DV4 L;  4K8I A;  1Y8O B;  4DNT B;  5IT9 E;  3CQZ B;  2EVB A;  4IUP A;  5J39 A;  1JOR A;  3DXJ C;  4WFN 3;  3HOZ H;  2A73 B;  1JJG A;  4DR2 Q;  2UXD L;  3BG3 A;  4RM0 A;  4JCV E;  2A69 D;  2RHS B;  1SSO A;  2F0S A;  2AKW B;  4IPG A;  1CZW A;  1E1T A;  2RDG A;  3W3A A;  2OCE A;  5BSY A;  1WOS A;  4CHT B;  2VQF L;  4YHB A;  4HIO A;  1AZQ A;  4XOT A;  1PH9 A;  3S2H H;  1OXU A;  1EZ6 A;  4OXP A;  4YCU A;  3MMP A;  4KD3 A;  2ID0 A;  1JWM D;  3CCU B;  1XNQ L;  3I2Z A;  1HNX L;  5C0X J;  1K9M D;  4MYT A;  4KY6 A;  3CME B;  1LTG D;  3CCQ B;  1XE1 A;  3FPP A;  3VO1 A;  3ZC3 A;  3LQE A;  1M4V A;  1EQV A;  2JQO A;  1GUN A;  4HJ7 A;  4TSF A;  1COW A;  3S17 H;  1WU8 A;  2PCF B;  4LW1 A;  2EXD A;  5JEA G;  2NN6 H;  4ZCK A;  3WOF A;  3LGJ A;  4DPG A;  2O5I C;  1BCP D;  1SM4 A;  1IXR A;  4B3M Q;  3V2T A;  1GHJ A;  2DGY A;  1N8R C;  2ZJP A;  1U5K A;  1A3U A;  4B3R L;  2K05 A;  1KRT A;  4CJ0 B;  5GAH C;  2JXM B;  4C3J B;  3ULJ A;  2QIL A;  4X7F A;  3UE0 A;  4A3M G;  2NWG A;  2KCN A;  3KUP A;  1H9S A;  5F4M A;  1SMY C;  2OT2 A;  1GJR A;  4P1V A;  4IFD G;  4POG A;  4YEJ A;  4DV1 L;  3AVT A;  5C4X H;  1ET9 A;  4DK1 A;  5M3F H;  3QFT A;  5IP9 G;  4X8I A;  2HCC A;  2KED A;  2DJF C;  3JAM L;  5IP7 G;  1KXL A;  2RKS A;  1KC8 D;  2BA1 A;  2Q2T A;  1QFY A;  4LF8 Q;  1TVX A;  1TS4 A;  3MXG A;  3PUY A;  5M3M G;  3OJW A;  4PG3 A;  5C3E H;  2EJM A;  1GO3 E;  2HCJ B;  3GTP H;  4A3F B;  1VQD A;  5BR8 Q;  3HOY B;  1FNU A;  1LTR D;  2CFM A;  1E79 A;  1RKN A;  1SNC A;  5FO1 A;  1QB5 D;  3BS1 A;  5JAV A;  3NXW A;  3I91 A;  4DV6 L;  1VQ4 A;  1PH8 A;  2R92 H;  3GTO B;  3C1F A;  4CDD C;  3HP3 A;  3HOV H;  1I6H B;  4JV5 Q;  4B3T L;  4P2N A;  2Z6B D;  4LJZ C;  4DV5 Q;  5DAU A;  2VNI A;  1D2B A;  1HPC A;  3HKZ G;  3G05 A;  4UZE A;  1EFI D;  3TEH B;  2VNU D;  5C4H A;  5LMN L;  1DON A;  1I4R A;  5FO7 B;  1IL8 A;  2QF7 A;  4A3G H;  1EYG A;  2K01 A;  1X56 A;  3PIO 3;  1MBY A;  1A8P A;  1W34 A;  3Q22 A;  1X3E A;  4WJW A;  4KKS A;  2SNS A;  1MRZ A;  5A2Q E;  2Z6K A;  3HOU G;  4YIJ A;  1AP0 A;  2GJP A;  2I1L A;  4KV6 A;  2F0H A;  2Q6I A;  1H9S B;  4P3I A;  1V1P A;  4O2D A;  5EPJ A;  3IFT A;  3T1Y L;  4BA2 I;  1YJN A;  5LHY 1;  5LMU L;  1SJE D;  3JAM i;  3KDF A;  2K33 A;  4ZGQ B;  4HCS A;  4OWW B;  2D5D A;  4JI6 L;  4IOA A;  4P74 A;  4WQM A;  5HY6 A;  3SHL A;  1KK0 A;  3AQQ A;  4GOP A;  3OFN A;  4OPO A;  2PNR C;  3G7L A;  4JBM A;  1VCI A;  3R93 A;  3CPX A;  3WQZ A;  1STB A;  1EZ8 A;  1A2T A;  5EJW A;  3KEW A;  3K59 A;  4KY7 A;  4K5V A;  1ILP A;  5A8A A;  1LT6 D;  1NDH A;  4QUF A;  4TT3 A;  3AGQ A;  4GLA C;  2XRS D;  4P75 A;  4LFC L;  1CQV A;  3SXH A;  2RQX A;  3FMC A;  3W5U A;  4JI3 L;  1EOV A;  2LY7 A;  4GN3 B;  5C4Z A;  3SLN A;  1WYD A;  4A4I A;  3K5L A;  5FLM G;  2WB1 E;  3CRK C;  1UEA B;  3H0G G;  1QFZ A;  3PIP A;  1TWG B;  4QHY A;  2Q2H A;  5DS0 A;  1WVL A;  5I2X A;  5F4O A;  3TBI B;  1JE5 A;  2DEU A;  3STB C;  3UDF A;  5EAY A;  2F3V A;  1QIL A;  4BS9 A;  3EFX D;  1S72 B;  2F1L A;  4FXU A;  1YJW A;  2WZN A;  2JK8 A;  5IYC G;  4BBS B;  3Q24 A;  3BC9 A;  4XOP A;  4RCN A;  3B82 A;  3AEV A;  2AUJ D;  3H9N A;  3RN5 A;  3KYH C;  4KJN A;  3J7A F;  1LT3 D;  4ZUI A;  4DR4 L;  4LC0 A;  1HFG A;  4R9W A;  2VL6 A;  1G51 A;  4QF4 A;  1JB9 A;  4AF6 A;  5DM6 3;  4LF7 L;  1V1P B;  2ZJQ A;  4LK1 C;  1N34 Q;  4PC7 A;  3CCJ A;  2AHO A;  4Z4U A;  4QCL A;  3KDF B;  1E3X A;  3CCV A;  2D74 A;  3A8K E;  4GZY C;  1SNO A;  4YAL A;  2NYZ D;  1L1O A;  1M90 C;  2ICE C;  1N33 L;  1TVC A;  1MSH A;  1VQ8 A;  4A3L H;  1T5X D;  3G71 A;  1EY8 A;  3J7Y W;  4TSS A;  3NTI A;  3NQI A;  5KGU A;  2M2L A;  1Q86 D;  1CSQ A;  1A2U A;  2PQA B;  4PAB A;  4DR1 Q;  2AQ1 B;  3FKS A;  5K5P A;  2YTY A;  4P26 A;  4A3K G;  2ATW A;  2NVT B;  1TWF H;  2AMC B;  1KAW A;  5EQ0 A;  1Q1B A;  4DNR B;  2PQE A;  2LZJ A;  4OGQ C;  3R3O A;  3QOL A;  4XYO A;  4F7X A;  4A3J B;  5TV2 A;  1SJH D;  2K5D A;  3HFZ B;  2UUC Q;  3ES9 A;  3CKI B;  4PC1 A;  1QVG A;  2A8V A;  2KCC A;  3NTH A;  4S3S A;  2EYO A;  3NWT A;  3KK7 A;  3UDI A;  4JI7 Q;  2VJI A;  3TS2 A;  4BXX H;  2XNC A;  2ZBV A;  4XKV A;  3PUW A;  1CKO A;  4ASU A;  4QFM A;  3CD6 A;  4BBR H;  3GIR A;  4C3I B;  1D6E C;  4YWM A;  2JA5 H;  1YJW B;  3L3O C;  4R4T A;  3S1M H;  1TWA H;  3N6R A;  2L0C A;  2A19 A;  3BVG A;  1CA6 A;  2YWF A;  1G7C A;  3CP2 A;  1VF5 C;  2DN8 A;  3CRZ A;  1K8A C;  1OXT A;  4K0K L;  1HR0 Q;  3ND9 A;  1VQN A;  4NBS A;  2E2H B;  4JBK A;  4M1K A;  2ZL7 A;  3OHX C;  1FRN A;  1HNW L;  1HZB A;  1PFN A;  5K36 G;  3FRP B;  5D14 A;  3CCJ B;  3A8I A;  2AHO B;  2N3S A;  1KQS A;  3STB D;  4KY5 A;  2OK8 A;  1I8D A;  1L1O B;  3D0F A;  4A3D H;  2PMZ E;  5CV9 A;  4ZCL A;  5FNZ A;  2ZXO A;  3VNV A;  1IJE A;  1Q1E A;  3G71 B;  2JA8 B;  3AFQ A;  3Q0A A;  3OW2 A;  3S2D H;  3GQB A;  1AFP A;  3ASR A;  1NBW A;  3UI2 A;  5IOD A;  1NE3 A;  5AJ3 L;  5TR9 A;  4GOP C;  5C5M A;  1VDZ A;  2XRQ D;  4N9T A;  3K81 C;  4C3H B;  2JA6 G;  1JMC A;  3HKZ E;  2EJF C;  2QE7 A;  3GTJ H;  1D7Q A;  2L4N A;  4DUZ Q;  4RLZ A;  2K32 A;  2K28 A;  2I5H A;  1M90 D;  1QNU A;  1NSN S;  1EWC A;  2O5J C;  1NR2 A;  2VS1 A;  2R7Z B;  4ME5 A;  1A62 A;  1YNJ C;  5I6W A;  3TS0 A;  4Y52 H;  4OPS A;  4H7B A;  2JA7 H;  2C35 B;  3S15 H;  4PV1 C;  1EY9 A;  1XMQ L;  2HHH L;  2A6H D;  1FR3 A;  1IJF A;  1OB2 A;  4KKT A;  5M5W H;  1HA3 A;  3CCR A;  3W2F A;  4JI1 Q;  3CD6 B;  3OIQ A;  3KLW A;  4YY3 Q;  2CC2 A;  1OXS C;  2E2D C;  5IYP A;  2VZA A;  4OOX A;  4JI5 L;  3CES A;  4DU9 A;  1EIF A;  1AE3 A;  2DUD A;  3LX0 A;  4YXW A;  1VQ6 A;  1PJ7 A;  3W1G A;  2Y0S G;  2IX1 A;  4J1M A;  4IAL A;  1QZH A;  4HAE A;  2MO0 A;  1VQN B;  3R2T A;  4LUO A;  3PF5 A;  1I3Q H;  1KDA A;  1QE6 A;  1HXY D;  1AMO A;  1MSG A;  1KQS B;  2B5O A;  2UXC L;  1GHK A;  1MJC A;  1V1Q A;  4K6L A;  4KK7 A;  3W2H A;  1NMF A;  4G57 A;  4LF4 L;  3G6E A;  1SE8 A;  1LTI D;  4RCY A;  2WB1 B;  2JA5 G;  1EYD A;  3OW2 B;  4FK8 A;  3M3Y H;  4KD4 A;  1K8A D;  4ZQ3 A;  4PC6 A;  1EU4 A;  3BCF A;  4G5G A;  1PYW D;  1TS3 A;  2V7X A;  1XWE A;  5EKL A;  1W0J A;  3CC2 A;  1GO2 A;  3OZV A;  2XGJ A;  3FKI H;  3RN2 A;  3S1Q B;  2B2U A;  2MP1 A;  4ALP A;  3S1N B;  5JJL A;  1W87 A;  2B29 A;  2X6G A;  1PVO A;  4HE6 A;  5ELN A;  2ZZQ A;  2MGS A;  2FIN B;  1G7T A;  3PO2 H;  2EZV A;  3SK8 A;  1UMK A;  4MYU A;  5FLX c;  5FJ8 H;  3NBH A;  4NP5 A;  2F0T A;  1TLL A;  1Y1W G;  2WIN B;  1OGI A;  4FXG C;  4DR7 Q;  4DR3 L;  3K7A B;  4KN7 C;  1LTT D;  3MAQ A;  1LLR D;  4FN5 A;  4LFA Q;  2OTL B;  4WZE A;  5IWA Q;  3U6K A;  4X3K A;  4L5R C;  4HIK A;  3LQ6 A;  2CBX A;  5KNL A;  3TP6 A;  3G6J B;  4DUY L;  1VQ6 B;  1T9H A;  4RGM A;  3U9S A;  1EFU A;  3FEW X;  1SKY B;  1QUQ B;  4FXD A;  1PV4 A;  4GQN A;  5E4X A;  1B2R A;  4OEL B;  3W1B A;  1BOS A;  3JC6 6;  4GKJ L;  3CTA A;  2DY1 A;  3ASP A;  1WI5 A;  2JSO A;  1J9Z A;  1EFW A;  4FWT A;  2KVO A;  1Q8K A;  3M4O H;  4HIZ A;  1K3B C;  4FNF A;  4FVM A;  1U9R A;  4IN3 A;  2X69 A;  1V0E A;  2JA9 A;  4P72 A;  3GTM H;  4YAO A;  2PZT A;  3H91 A;  1TWC H;  3EQL C;  5ELC A;  2WSS A;  2EY5 A;  2X6Y A;  3D4D A;  5GAD C;  5C5L A;  2B2W C;  4A3M B;  2EPB A;  2XOK A;  2A1A A;  1Z9F A;  1VQG A;  2F4V L;  4TRD A;  1TTT A;  2IW3 A;  2Q6O A;  1XPO A;  2A68 C;  4HCE A;  4Q0F A;  1SYE A;  3ERO A;  4UZU A;  3E6Z X;  3T13 A;  1GUG A;  4GS3 A;  5C0X H;  2EYP A;  2XEX A;  1HTP A;  3BDL A;  3HS0 C;  4X62 L;  3V96 A;  4DAY A;  2EJG C;  1JJC B;  4ZRZ A;  4NXM L;  1T5E A;  3RR5 A;  3AVW A;  1XX8 A;  3BVZ A;  4TMT A;  2HQE A;  4IUN A;  1K3R A;  1FNM A;  3V7A A;  2RHQ B;  4DF7 A;  4F7D A;  4GNX A;  5IYN A;  3GP7 A;  5M3M B;  4KHP Q;  4QUZ A;  3A54 A;  1V1O A;  3MXN A;  4HED A;  4CJ2 C;  3GVJ A;  1QUE A;  2I07 B;  2PMZ B;  2HIX A;  3TSS A;  3E20 A;  5H1S E;  1WOO A;  4RGN A;  1O7Z A;  2F0J A;  1HZA A;  1DXM A;  2D9R A;  3GVL A;  3ASS A;  3FDT A;  5FL7 A;  3SE0 A;  1DD2 A;  3TRE A;  3QE2 A;  3Q6Q A;  5AFW A;  4DK6 C;  2OTJ A;  3BNW A;  2L11 A;  2PZW A;  3VR4 A;  3L9A X;  1AIP A;  3HKZ B;  1FJG L;  4H13 C;  1VQH A;  4L5T A;  5KEE A;  1UE6 A;  3GSI A;  1S3O A;  4JOI C;  1VQ7 A;  3RMH A;  3CXC B;  5EMN A;  4QV2 A;  1N32 L;  3J81 c;  4IW3 B;  3SK5 A;  1R9T B;  2VUM G;  3HOU B;  1R5B A;  1V8Q A;  3GO5 A;  4X3S A;  3PSI A;  3KBX A;  1V9P A;  4TVA B;  4ZAI A;  1PFM A;  5IGE A;  4AC9 A;  3W2G A;  2EYH A;  4GKK Q;  3M85 A;  1PTO B;  1EIH A;  1BO0 A;  2QKI C;  2DER A;  4K5W A;  1KAA A;  2FX3 A;  2M5S A;  4PC2 A;  4DAY B;  5CBE E;  1TWH H;  4TMX A;  4XYQ A;  3A8J A;  1JJ2 B;  3ZBT A;  5CMD A;  1B44 D;  1U4P A;  4OON A;  4ZLT F;  2Y0S E;  2X6L A;  2ES2 A;  1EP3 B;  1HR0 W;  4JVZ A;  1QUF A;  1HZ9 A;  4BY7 G;  1Q7Y C;  2A68 D;  3MXN B;  2GK6 A;  4L63 B;  1GKH A;  1WPC A;  1Z6H A;  4GLX A;  3J7Z C;  3PA1 A;  4G1V A;  3BH4 A;  4C3I G;  3NE5 B;  5E1F A;  1UUP A;  1N08 A;  1AN8 A;  2PNH A;  1IB0 A;  2K14 A;  2SDF A;  1RCV D;  4TMV A;  4J15 A;  3MFY A;  2OXP A;  5M3F B;  1BBX C;  2E2I H;  4OX9 Q;  2NV4 A;  3H0G B;  1FD7 D;  1S5D D;  3G4S A;  3T16 A;  2UXB Q;  1SE4 A;  1EUJ A;  1K8M A;  2OWO A;  2B63 G;  4QGU A;  1VQ7 B;  2OK7 A;  1X32 A;  1TXY A;  2R6G A;  5IYD G;  3NTK A;  1ZM3 A;  1WCM H;  3GTP B;  5FK9 C;  1FYC A;  3J80 E;  3LNN A;  4OHJ A;  2M00 A;  4Y7N H;  2BDN A;  3P27 A;  3I4N G;  1QOH A;  3GTL B;  4XLA A;  2F4I A;  1AEX A;  4RD0 A;  3VR3 A;  2E2J B;  2R7F A;  3CCE B;  4R4Q A;  4Q5V A;  5GQO A;  2MPM A;  3JAM c;  3KF6 B;  4B47 A;  4XOR A;  2XNA C;  1BX1 A;  1AE2 A;  1ENF A;  2CKZ B;  2M9V A;  3CW2 A;  1Y1V G;  2NTT A;  3A7A B;  3BDO A;  3I3C A;  3MHB A;  1TS2 A;  1WJJ A;  1W0K A;  2QTL A;  3H3V C;  1H8E A;  4NB3 A;  4IFD I;  5COR A;  4C43 A;  5IYB H;  3GTG B;  1ASY A;  2ZXI A;  2PZU A;  5IT9 c;  4A3K B;  1X54 A;  1PYS B;  3CCU A;  3HOW H;  1F60 A;  1UD6 A;  3VNU A;  3VDY A;  5HGQ A;  3JQP A;  5IYR A;  3GD7 A;  4MTN A;  3ISX A;  1ESF A;  4MNO A;  3WOE A;  1U4R A;  4P3Y A;  4DV7 Q;  4KHV A;  2KEC A;  2X8K A;  2XN9 C;  4Q7J B;  2A74 C;  2QA4 B;  1QX4 A;  4P12 A;  1VQP B;  1JWU D;  5M5X B;  2CW5 A;  5E7N A;  2BA0 A;  3HOX H;  3S14 H;  1PYB A;  1QVF A;  4OO1 G;  5M5Y H;  1K8O A;  4A93 H;  4II3 A;  2E5L Q;  4IJL A;  1RQP A;  1X55 A;  1VLY A;  3UDG A;  2XWJ B;  4V0B A;  1VQI A;  4QQB X;  1NRK A;  5GRO A;  2WKC A;  4RWS C;  2XND A;  1RD9 D;  1A0I A;  2NTS A;  2F0E A;  1RL2 A;  3J81 L;  1QG0 A;  4R4O A;  4RD2 A;  3A7L A;  1UWV A;  4J0Q A;  1L0X B;  1T6X A;  1KK2 A;  2KA7 A;  2TSS A;  1WTW A;  2LS0 1;  4Z4R A;  3RLF A;  2Q2U A;  1Y69 U;  1VQO B;  3RD4 A;  4DNI A;  2K75 A;  2MUY A;  2O2L D;  5HUR A;  4FXK C;  2WJY A;  4LF9 Q;  1ZEQ X;  4K2L A;  4WRD A;  4DQK A;  2RVL A;  1QNK A;  4AF7 A;  1PJ5 A;  4I7A A;  4DK0 A;  3ZZT A;  4APV A;  3ICE A;  2HCI A;  2JA6 B;  3CAM A;  2OQK A;  5LL6 X;  4XLC A;  1FGU A;  2HDN B;  3ZUG A;  1A3T A;  4AQY Q;  5C44 G;  4LBZ A;  4ZCM A;  1PJ6 A;  4LMQ D;  4A3B G;  5CR3 A;  4P71 A;  2N49 A;  2O4X A;  4XN0 A;  1STH A;  2JN9 A;  3GVK A;  1I50 H;  3C3L A;  3MCA A;  2B2Y C;  4G7Z C;  3EVQ A;  2NVX H;  3A1P A;  3CMM A;  2F4N A;  1JNY A;  5IGG A;  1XJV A;  5E6T A;  1IBM Q;  3Q39 A;  2GA4 B;  1MGS A;  1IBL Q;  3T56 B;  1QVF B;  5TRD A;  1DZ1 A;  4XL9 A;  1SEB D;  1E62 A;  3A5Z B;  3CU7 A;  3BYY B;  3ZIA A;  3CCS B;  3ZBU A;  1XTC D;  3J81 i;  3KFU A;  3CB4 A;  2FHT A;  3WXM A;  2G9H D;  2Y0S B;  2B2V C;  1B9N A;  4A3I H;  1J5E Q;  1HA5 A;  3W2I A;  2UUC L;  1RHP A;  1EEI D;  1G6P A;  4CKB A;  2R93 H;  2JJ2 A;  4JI7 L;  3MC0 B;  3ONY A;  3KOJ A;  1S4Z A;  1WOR A;  4EH1 A;  3NBI A;  2QTZ A;  2YYZ A;  3KLR A;  2FXQ A;  1OB0 A;  3U6B A;  2BGJ A;  1ZKO A;  4M1U B;  1B8A A;  5I4D A;  3K5N A;  2JA5 B;  3EN2 A;  1LT4 D;  2F43 A;  1E1R A;  3NUC A;  3QJY A;  2WV6 D;  2ZM6 Q;  4GNX C;  5ELB A;  2BVN A;  4RHR A;  1LAC A;  2AQ2 B;  1FNW A;  3ZYY X;  3H94 A;  4PZ6 A;  4AH6 A;  4EQN A;  1PH1 A;  3RZD B;  2UUA Q;  1TR5 A;  1PH2 A;  5FO9 B;  3VYT A;  3AU7 A;  1EQQ A;  1LYL A;  2ZTE A;  1OB5 A;  4OWX B;  1IW7 C;  3DDY A;  1N0U A;  3F2D A;  1PRT B;  4LBY A;  5IT9 L;  5BN5 A;  1XFO A;  3E1Y E;  3HOZ G;  4DV0 Q;  2VBS A;  2ZXP A;  2OQ0 A;  5CYU A;  3AMU A;  2JJQ A;  1Y1W B;  3U50 C;  3AVV A;  3R2I A;  2F52 A;  3FPU B;  4X64 Q;  1LTB D;  3I4M H;  3ZJY C;  4ZYS A;  1KL9 A;  1Y8N B;  2L55 A;  3KJO A;  3KLS X;  3BVM A;  4NCN A;  2C9O A;  2OBS A;  2CWP A;  1SDF A;  3P75 A;  3MHP A;  4ACA A;  1S72 A;  1W35 A;  2NVY H;  2YU9 B;  4YAF A;  1CHP D;  4RG1 A;  1SN8 A;  4DUZ L;  4ACB A;  3F2C A;  4DA2 A;  1OXV A;  3AVX A;  4XLH A;  2BH8 A;  3VYS A;  2YTV A;  2JYO A;  1Q86 C;  2ZTN A;  1N05 A;  1SR3 A;  3L0O A;  3I4O A;  4LBV A;  4PMW A;  2K04 A;  4C2M H;  1E63 A;  1KLG D;  4A76 A;  4TN1 A;  3BU2 A;  3PVD A;  1G7S A;  1RIP A;  1NNX A;  2NN6 G;  4YY3 L;  1O7L A;  1XMO Q;  1SLJ A;  1E1Q A;  3QIA A;  2J7Z A;  1D2E A;  4H9G A;  1Y8P B;  1L0W A;  1PHJ A;  2Q8I B;  4RDK A;  4IUV A;  2EYJ A;  4XQQ A;  4IOC A;  2Z8L A;  2V7V A;  2PQA A;  1C0A A;  2R7D A;  1IYJ B;  1N9W A;  3D8G A;  1YNX A;  1HQR D;  1NB9 A;  1VQC A;  1SE2 A;  2CK3 A;  2PPB C;  2CW0 C;  3RZO B;  2MNA A;  3GTQ B;  2PI2 E;  5H59 A;  1KK1 A;  5C4X G;  3OWE B;  4BY1 H;  5M3F G;  3SLD A;  5HKK A;  1B7Y B;  1GUT A;  2KCM A;  5TSS A;  4ZUJ A;  4HID A;  4CQJ A;  2PE3 A;  2WII B;  3WNC A;  1R5O A;  1SYG A;  4H44 C;  2JE6 I;  2V31 A;  1JB7 A;  4JW0 A;  3K57 A;  4P22 A;  1IW7 D;  5J35 A;  2EQS A;  1P4M A;  1I4G A;  3URY A;  2QEX A;  2LSS A;  5C3E G;  3OW7 A;  1PZK D;  1UE7 A;  1UD5 A;  3LVB A;  1BPL A;  1QWY A;  2R92 G;  2J0T D;  2VYQ A;  3HOV G;  4R1J A;  3SGI A;  2ENB A;  5T1I A;  3CQZ H;  2K7V A;  3SVM A;  5A89 A;  4JMQ A;  5JEA J;  4DR7 L;  1JT8 A;  1HCZ A;  1A8V A;  3SR1 A;  1E24 A;  5F2D A;  3CW2 C;  4LFA L;  1XB2 A;  2VUM B;  1HNZ L;  2CHB D;  2FMM A;  3PO3 H;  1TKW B;  5IGD A;  4OEM B;  4A3G G;  1RTN A;  1PTO F;  4K8J A;  3T53 B;  2KEE A;  4X66 Q;  2QW7 A;  3VA7 A;  1D1K A;  5T1G A;  2A6H C;  3DWP A;  3B6Y A;  3AST A;  1GVH A;  1YJ9 B;  2AQ3 B;  1NB0 A;  5A2Q L;  1G2S A;  4IFD J;  1IZ6 A;  4DV3 Q;  1GOZ A;  3OYY A;  2R61 A;  1N06 A;  3Q3A A;  2MFI A;  2JEB I;  1XYI A;  1VQ9 A;  2NUC A;  1L0Y B;  3EBE A;  1BXT A;  4DXF A;  1IYU A;  1EY4 A;  1Q46 A;  4RPB A;  3ASQ A;  1RF2 D;  2VBT A;  1CUK A;  4N8X 1;  1MIU A;  4P73 A;  2F0F A;  4BY7 B;  1O80 A;  4DV2 L;  4NKL A;  1K28 A;  2CF4 A;  1K83 H;  3A55 A;  5J3O A;  5KW9 A;  3CF5 A;  1BVS A;  5CDF A;  1IKL A;  4JI2 L;  4X06 A;  1UE1 A;  2QEX B;  1EWH A;  2QCP X;  4KN4 C;  5CV5 A;  2CW0 D;  5FO8 B;  4FF1 A;  4B3R Q;  1V5V A;  5D3D A;  1G7R A;  1AZP A;  4C1N K;  4UHV A;  4C3J H;  2H5X A;  2N8N A;  4O0A A;  4PZ8 A;  4A3E H;  3J81 j;  1PH3 A;  4NPS A;  1Z47 A;  2B63 B;  3T51 B;  1NTG A;  1F9Q A;  1B53 A;  4RHS A;  4KHP L;  1YBY A;  1QG7 A;  1JOO A;  3BZD B;  5IK2 A;  2Q6L A;  4HMJ A;  2PI2 A;  1CT1 D;  4DXG A;  2ZIT A;  4PAA A;  1SYD A;  3I4N B;  4PZ7 A;  5L37 A;  2ZL6 A;  1KK3 A;  1ZM2 A;  3X3N A;  3SKB A;  2SOB A;  4NDX A;  4XMY A;  2VW9 A;  1FND A;  4G7W A;  1SFO B;  1IKM A;  4A3F H;  2DYI A;  3NQT A;  3HOY H;  1ICF B;  2XIW A;  2C5B A;  2MHV A;  3CP0 A;  2C77 A;  4OOV A;  1TS5 A;  1VQ9 B;  1YHA A;  4JC0 A;  4MN3 A;  3OJX A;  2WPD A;  2J4X A;  4LUV A;  4NMZ A;  1FGB D;  1Y1V B;  4H0L C;  1EU3 A;  1VMC A;  1VMP A;  5HZB A;  2IPK D;  4KI0 A;  3CPF A;  1VLO A;  4A3L G;  3VYU A;  1QZG A;  3A8K A;  1EL0 A;  5LMN Q;  1SMX A;  4UPA A;  5C4J B;  1GAQ A;  3NSW A;  2OTL A;  4UZF A;  1VS0 A;  2L1B A;  4HIM A;  4GKK L;  4M8A A;  2DET A;  3S16 B;  1UNS A;  1M8A A;  1STN A;  4G7X A;  2NZH A;  4LAA A;  1QUQ A;  4DGZ A;  1H9M A;  1B70 B;  3T1Y Q;  2ZTD A;  3CP8 A;  2F0I A;  1LO5 D;  4RKL A;  2X53 S;  1D8L A;  2I0Q A;  4BXX G;  4MTK A;  4L8J A;  4JI6 Q;  3OP1 A;  3E0E A;  2GPJ A;  3I72 A;  4RPD A;  3U4V A;  4BBR G;  1F77 A;  3PUV A;  1R4Q B;  2E1R A;  2PYK A;  3NWS A;  5DNF A;  1SXT A;  1WTV A;  2D9U A;  3HEJ A;  3F8T A;  4OX9 L;  1JB3 A;  2KHI A;  3I7F A;  4JI0 L;  1KDC A;  3A74 A;  4RAU C;  1YEZ A;  4A3E G;  2UXB L;  1VQL A;  1BMF A;  4YWL A;  3I4L A;  2Z0S A;  4LFC Q;  4ODG A;  3OOC A;  4FYD A;  4DR5 Q;  3DWA A;  4JI3 Q;  1X9N A;  4RD4 A;  1U4L A;  1FDR A;  1F2M A;  1IBK Q;  1F20 A;  1WCM B;  1F2Y A;  4A3D G;  5DEH A;  3OZW A;  5IYQ A;  3TP7 A;  1JA1 A;  1TWG H;  4G7O C;  1ZM4 A;  1NY4 A;  1IYV A;  3OIP A;  1WP6 A;  2XNJ A;  4JI4 Q;  4TKO B;  1H85 A;  2V4D A;  2RCF A;  5C44 B;  3KF8 B;  3VR6 A;  5COY A;  1Y0R A;  1SNQ A;  4A3B B;  3OMG A;  2Z6K C;  2VBV A;  4UY8 C;  1AH9 A;  2AUK A;  4BBS H;  3C2P A;  1I94 L;  3M4P A;  3C46 A;  2NVQ B;  3JQR A;  4IQZ A;  3T4A C;  4DR4 Q;  1D8T A;  4B3X A;  2K1B A;  2RC6 A;  3U9O A;  2D3L A;  4JK1 C;  1RQR A;  1SNM A;  4GN4 B;  4F8M A;  2JA7 G;  2BSA A;  3LWU A;  3E0J A;  4NW2 A;  3OEE A;  2BE5 C;  3A0J A;  3PEN A;  1ENA A;  3CXC A;  2CH4 W;  3DM1 A;  3MWY W;  2HT1 A;  3I1F A;  1BCP B;  3E9I A;  1YX2 A;  2Z4I A;  4CDC C;  4DQL A;  2YWH A;  1YHQ A;  4LF6 Q;  4C0S A;  4WWV A;  2YWE A;  2XGT A;  3BZC A;  2GK7 A;  3QOJ A;  3K0Y A;  1S5F D;  2TMP A;  2BPO A;  3PUZ A;  4RH6 A;  1O7Y A;  2KQ3 A;  1VQL B;  1JCK B;  4UAI A;  1E43 A;  1WOP A;  3I90 A;  3NEL A;  1Q81 C;  4OPV A;  4EGV A;  3SK4 A;  3J7A V;  1EP1 B;  4AVZ A;  5IOC A;  4A3J H;  4LFB L;  4A93 G;  4JYA Q;  4LF5 Q;  2ZZE A;  5EPK A;  1JJ2 A;  1PRT F;  3KLS A;  2LFN A;  1EP2 B;  5FLX E;  2JJ1 A;  3MXP A;  5JOB A;  2G9D A;  4K1X A;  5IY0 A;  2DJG C;  2ZJR A;  4IUT A;  2KHJ A;  4Z1M A; 
#chains in the Genus database with same CATH homology
 5ELF A;  4FF4 A;  2K5Q A;  1ML0 D;  4ZKC B;  5C3W A;  5KNB A;  3HOZ B;  3VR2 A;  1SNP A;  4X3T A;  5E3F A;  2KHS A;  3D4W A;  3TZU A;  1BDO A;  1II3 A;  3H6M A;  1EFR A;  1QJO A;  3S2H B;  3K5O A;  4V19 0;  4CKC A;  1CA5 A;  4B3G A;  3JU4 A;  4XD7 A;  1SYB A;  3EJI A;  3OWF A;  1EOT A;  1BQQ T;  2WZP P;  1ILQ A;  3SDZ A;  4OO1 I;  1CI3 M;  3A56 A;  3IFD A;  3P1H A;  5A35 A;  5C3X A;  3S17 B;  2FMC A;  1PLF A;  3TP5 A;  3ERQ A;  2BE5 D;  4HSP A;  5JPN C;  4I7Z C;  4EQO A;  3IAY A;  1EY0 A;  4L6T B;  1JIC A;  1FX0 A;  1D5M C;  3WDN A;  2OEO A;  4CGY B;  4BWG B;  1G91 A;  3K5M A;  2VB2 X;  1GJX A;  1PZJ D;  5C0X G;  5C4X B;  2K5W A;  4NNJ A;  2RDH A;  1TY2 A;  4G7H C;  2F0Q A;  2JP1 A;  1PKV A;  1GXD C;  4HTH A;  5C3E B;  4XIG S;  1E2W A;  2E74 C;  2Z1C A;  3A35 A;  2X6W A;  3PV0 A;  2R92 B;  3HZX A;  1R4P B;  3SK6 A;  2HLD A;  3HOV B;  1EY6 A;  4X3U A;  4CBV A;  1I6V C;  2DY7 A;  4KMU C;  4R8N A;  3W2D A;  5CV4 A;  4C1N I;  1V0F A;  3ONA B;  2X85 A;  4A3G B;  3DUZ A;  2K6A A;  1KTK A;  1G6Z A;  3DEO A;  2EYF A;  4JBW A;  4FP5 D;  4XN3 A;  5JVH 3;  1Q8I A;  1S5C D;  4K6D A;  1CK1 A;  1E2Z A;  4XON A;  1NUC A;  3X3M A;  2K03 A;  4XT1 B;  2F0P A;  3D4R A;  3Q6S A;  5JEA H;  1C8C A;  3MXU A;  4FF2 A;  2EXZ A;  2E76 C;  1MAB A;  1KNA A;  2CVR A;  1ESR A;  1TU2 B;  1KZL A;  4IFD H;  2B2U C;  4DAP A;  1HTL D;  1D5Z C;  3NK9 A;  4F88 A;  1PMR A;  1E0B A;  3JAM E;  5C6A A;  3DWQ A;  3C1E A;  1H9R A;  4J6H A;  1HUM A;  1I4P A;  1NBM A;  3OE7 A;  1UAP A;  3KBG A;  5I6Y A;  3TN2 A;  4PMC A;  2PO4 A;  4QMG A;  5EPL A;  2SEB D;  3E5S A;  3D31 A;  3J80 L;  2NN6 I;  3HGB A;  5JPM C;  3R8B A;  3QO2 A;  2L5T A;  2Q8T A;  2KOL A;  1YNN C;  5JJZ A;  2F3W A;  2RA4 A;  1GUW A;  5KIX A;  3MFG A;  3PO3 B;  2XSC A;  2EY2 A;  4FF3 A;  1STY A;  3OSO A;  1G29 1;  2IL8 A;  3D3R A;  4RCO A;  2BOS A;  2HUG A;  2X6X A;  4OIJ A;  3I73 A;  1OXX K;  1TT2 A;  1JQY D;  1O78 A;  1TWF B;  1C48 A;  1IHZ A;  3K58 A;  4ID6 A;  1STE A;  1PTO C;  1X3Q A;  4K14 A;  1PTO H;  4XT3 B;  1K83 B;  5KRU A;  4BBR B;  4O1N A;  5BN3 A;  4J8Q A;  1DYQ A;  2R3Z A;  1DM0 B;  1TWA B;  3S1M B;  3Q23 A;  1VJS A;  4G4K A;  5I2Y A;  3BYT B;  5M9O A;  4A3E B;  1Z7T A;  1JE4 A;  2F0M A;  1ZXT A;  3GV3 A;  3K6O A;  1SND A;  4A3D B;  1G8Z D;  4CJ1 B;  4XM3 A;  4EQP A;  1HVX A;  2N88 A;  5IIF A;  2Z4H A;  3PUX A;  2IWH A;  3S2D B;  1ET6 A;  1YNN D;  5ELD A;  3GTJ B;  1SYC A;  1EY7 A;  2SNM A;  2D2C C;  3NP8 A;  3DHQ A;  3VR5 A;  1BNZ A;  3IL8 A;  2ZXR A;  2EY6 A;  5EBD A;  3P20 A;  3TP8 A;  1RDP D;  1BCP F;  2JA7 B;  3S15 B;  1H9K A;  1JOK A;  1EEF D;  5M5W B;  2F0K A;  5CV8 A;  2F03 A;  3ND8 A;  1DOL A;  1X3P A;  4TQU S;  2AWO A;  1GUO A;  1J9O A;  2WJV A;  2NBF A;  1KNE A;  2ZT9 C;  1VF7 A;  5IGC A;  2BDO A;  1PTO D;  1ENC A;  4B9W A;  1A3V A;  1I3Q B;  4DN4 M;  4IUR A;  2AWN A;  1WTO A;  1WD0 A;  5JVG 3;  3M3Y B;  4XXE A;  2F0D A;  4K5X A;  1SMY D;  1Q3L A;  2B2W A;  5EKI A;  5ISR A;  4U67 3;  3L7Z C;  3FKI B;  4N9P A;  4HN7 A;  1UD8 A;  1MD2 D;  3A8I E;  5DM7 3;  1SYF A;  2W6I A;  1HQM C;  2F0O A;  3PO2 B;  3I8Z A;  5K36 H;  4QUC A;  1S5E D;  1A15 A;  3BDC A;  4B9X A;  2Q8R E;  1KMH A;  3PMF A;  1C4Q A;  3TDQ A;  2XZO A;  1EIG A;  4WOR A;  1I18 A;  2WAC A;  3MZ5 A;  2EYL A;  2JIZ A;  4ZK9 B;  5NUC A;  1F9P A;  3AB9 A;  4P2C B;  3M4O B;  3GTM B;  4XQF A;  2C5C A;  4O42 A;  1TWC B;  2IJ0 A;  1BR9 A;  1HFN A;  4II2 A;  2EY1 A;  2F0L A;  4BA1 I;  1CM9 A;  1WD1 A;  1U4M A;  1F9R A;  2L9H A;  3FVQ A;  1BLI A;  2B8F A;  5D3I B;  3IKJ A;  3HAG A;  1FNV A;  4ULL A;  1G2T A;  2JDI A;  3RUZ A;  1W6K A;  1MI2 A;  1E3Z A;  1Q12 A;  1D1I A;  1PXU A;  2WKD A;  1SAP A;  2DIE A;  3DEP A;  2V7Q A;  2IX0 A;  3OEH A;  2W6J A;  4U68 A;  2EYM A;  2F0G A;  2D62 A;  3OPO A;  2EE1 A;  3PIP 3;  1Q90 A;  4OIK A;  1UD4 A;  4XR6 A;  1PRT C;  2XZL A;  1TY0 A;  5BN4 A;  1B1Z A;  5DN6 A;  2E75 C;  1HRJ A;  2I46 A;  4CKE A;  2R9V A;  4RGT A;  3A3B A;  1RTO A;  5IGF A;  1KDB A;  1KAB A;  5CBA E;  5CC4 A;  4DAV A;  2VXW A;  1BF4 A;  3KF8 A;  5KYI A;  4XTC S;  1HZE A;  4Z9C B;  3MA2 B;  5HGT A;  1ROD A;  1LV9 A;  1H8H A;  1TWH B;  5D65 A;  2F1M A;  2RBM A;  4RGO S;  4RFB A;  3GV6 A;  2B2T A;  4B08 A;  2CQA A;  1CFM A;  3D6C A;  1JOQ A;  4PNY A;  3A3G A;  1F2L A;  4XQJ A;  1STA A;  3OAA A;  1A6X A;  2E2I B;  4C3J G;  3BCD A;  5KND A;  3OMC A;  1JR0 D;  4B3F X;  2HDM A;  5J22 A;  2ZXH A;  5J1Z A;  2NB0 A;  1W9X A;  3SEB A;  4Y7N B;  2IT1 A;  1ICW A;  1PRT D;  3HRZ C;  4QB4 A;  2ZZF A;  3EA6 A;  4XNF A;  2VB3 X;  3MTS A;  3VA5 A;  1DOM A;  1SBB B;  1F9S A;  3GTK B;  2F0N A;  1I4Q A;  2GJR A;  2H4O A;  5FKA C;  1SE3 A;  1NCV A;  1CTM A;  5C0X I;  3F2U A;  1DOK A;  3TZD A;  3NPP A;  3HOW B;  2XVS A;  1HA6 A;  1UD2 A;  4PMB A;  1YNJ D;  4KKU A;  2ZTG A;  2FFK B;  2L12 A;  3A8J E;  2N55 A;  1D5X C;  1GUS A;  4HSV A;  1H9J A;  1ONL A;  4HMI A;  2B2Y A;  1JC7 A;  1NR4 A;  3QG1 A;  3HOX B;  3S14 B;  4IUQ A;  2IX3 A;  5M5Y B;  4A93 B;  4ABN A;  4XLF A;  5CV6 A;  1B9M A;  5EGT A;  5G3L D;  1TQO A;  3H09 A;  2B2V A;  1KLU D;  1CZG A;  4K2K A;  1LTS D;  5KYL A;  1I4X A;  5FOB B;  4EVO A;  4E6I A;  1B50 A;  2F0W A;  2ICI A;  1DCZ A;  1STG A;  1OO9 B;  4MIU A;  4RKB A;  4ZKB B;  1NAP A;  2RSN A;  4RA8 A;  4YEL A;  2DNE A;  3LWE A;  2QEJ C;  5CV7 A;  4QIW B;  1W6J A;  5EKK A;  2A6E C;  1B2T A;  2OF1 A;  1B3A A;  3VYR A;  2HDL A;  2LKV A;  1I50 B;  3V05 A;  1HHV A;  1WTH D;  1CHQ D;  1B4O A;  4XQN A;  2NVX B;  2EDG A;  1XXG A;  1BUV T;  1JWS D;  5I9P A;  5G3L F;  1LAB A;  2E1B A;  2DNC A;  1DJR D;  2KUM A;  2DY8 A;  4R8I A;  2H1E A;  3I70 A;  4PQX A;  4C56 C;  1WTX A;  1HUN A;  4A3I B;  2F0V A;  1PFB A;  2EOT A;  2BCO A;  5LL6 S;  1WTQ A;  2R93 B;  5CGK A;  5EBC A;  2JEA I;  2RDF A;  1UD3 A;  4AYB B;  3MVV A;  4FO2 A;  4XLE A;  2FJ2 A;  2LMC B;  1LTA D;  4OO1 H;  5KNC A;  3QWN A;  1E2V A;  2D3N A;  5FLX L;  1EYA A;  2ZZG A;  2A5H A;  2NZ1 D;  1EQT A;  1S5B D;  3J81 E;  2XZP A;  2KJX A;  4MHE A;  3N52 A;  1ZYR C;  1WTR A;  1EY5 A;  3HG9 A;  2WP8 J;  3I4M B;  5IGB A;  4IUU A;  3DMU A;  1PZI D;  3CHB D;  3O13 A;  4KHZ A;  2A69 C;  4UDU C;  2NVY B;  4ILW A;  4KTA A;  1I4H A;  4E0F A;  2A6E D;  4XDX A;  3CRL C;  1AW7 A;  1PDQ A;  1J8I A;  1WTP A;  2PW5 A;  2RSO A;  4C3H G;  3ITP A;  4XKW A;  4C2M B;  3M7G A;  2B39 A;  1CQF A;  3P7J A;  1LT5 D;  3TME A;  1F2Z A;  2WAQ B;  5ELE A;  4HR7 B;  1K28 D;  2B8G A;  5I9O A;  2B2T C;  3ZPN A;  2MJ8 A;  1V43 A;  4IZ8 A;  1RJT A;  2GJK A;  1BCP C;  2QDB A;  3S9W A;  4OL7 A;  2PW7 A;  5E4W C;  3D6W A;  1TII D;  2KVM A;  4KJO A;  4BY1 B;  4G6I A;  3MEH A;  3S1R B;  1OHH A;  2VJJ A;  4DFA A;  3QB3 A;  4I65 A;  4F87 A;  3NHH A;  2XWB B;  2F0U A;  3M4Y A;  1QCB D;  1ZYR D;  3M7N A;  1EYC A;  4K8I A;  1Y8O B;  4DNT B;  5IT9 E;  3CQZ B;  2EVB A;  4IUP A;  5J39 A;  1JOR A;  3DXJ C;  4WFN 3;  2A73 B;  3BG3 A;  2A69 D;  1SSO A;  2F0S A;  1CZW A;  2RDG A;  3W3A A;  4CHT B;  1AZQ A;  4XOT A;  1OXU A;  1EZ6 A;  4KD3 A;  2ID0 A;  1JWM D;  5C0X J;  4KY6 A;  1LTG D;  3FPP A;  1EQV A;  1M4V A;  1GUN A;  4TSF A;  1COW A;  2PCF B;  5JEA G;  2NN6 H;  3WOF A;  2O5I C;  1BCP D;  3V2T A;  1GHJ A;  1A3U A;  2K05 A;  4CJ0 B;  2JXM B;  4C3J B;  2QIL A;  2NWG A;  2KCN A;  3KUP A;  1H9S A;  1SMY C;  2OT2 A;  4IFD G;  4YEJ A;  1ET9 A;  4DK1 A;  2HCC A;  2KED A;  3JAM L;  2RKS A;  2BA1 A;  1TVX A;  1TS4 A;  3MXG A;  3PUY A;  2EJM A;  4A3F B;  3HOY B;  1FNU A;  1LTR D;  1E79 A;  1RKN A;  1SNC A;  1QB5 D;  3BS1 A;  5JAV A;  3NXW A;  3I91 A;  3GTO B;  3C1F A;  1I6H B;  3HP3 A;  2Z6B D;  4LJZ C;  5DAU A;  1D2B A;  1HPC A;  3G05 A;  1EFI D;  2VNU D;  1DON A;  5C4H A;  1I4R A;  5FO7 B;  1IL8 A;  2QF7 A;  2K01 A;  3PIO 3;  1MBY A;  3Q22 A;  4WJW A;  4KKS A;  2SNS A;  5A2Q E;  1AP0 A;  4YIJ A;  2GJP A;  4KV6 A;  2F0H A;  1H9S B;  1V1P A;  5EPJ A;  3IFT A;  4BA2 I;  5LHY 1;  1SJE D;  2K33 A;  4HCS A;  2D5D A;  3SHL A;  3OFN A;  2PNR C;  3G7L A;  1VCI A;  3R93 A;  3WQZ A;  1STB A;  1EZ8 A;  1A2T A;  5EJW A;  3KEW A;  3K59 A;  4KY7 A;  4K5V A;  1ILP A;  1LT6 D;  4QUF A;  4TT3 A;  2XRS D;  1CQV A;  3SXH A;  2RQX A;  3FMC A;  2LY7 A;  5C4Z A;  3K5L A;  3CRK C;  1UEA B;  1TWG B;  1WVL A;  5I2X A;  3TBI B;  2F3V A;  1QIL A;  4BS9 A;  3EFX D;  4FXU A;  4BBS B;  3Q24 A;  3BC9 A;  4XOP A;  4RCN A;  2AUJ D;  4KJN A;  3J7A F;  1LT3 D;  4ZUI A;  1HFG A;  4R9W A;  4QF4 A;  5DM6 3;  1V1P B;  4LK1 C;  4QCL A;  1E3X A;  3A8K E;  4GZY C;  1SNO A;  2NYZ D;  2ICE C;  1MSH A;  1T5X D;  1EY8 A;  3J7Y W;  4TSS A;  3NTI A;  3NQI A;  5KGU A;  2M2L A;  1A2U A;  2AQ1 B;  3FKS A;  5K5P A;  2NVT B;  5EQ0 A;  1Q1B A;  4DNR B;  2PQE A;  2LZJ A;  4OGQ C;  3R3O A;  3QOL A;  4XYO A;  4F7X A;  4A3J B;  1SJH D;  2K5D A;  3CKI B;  2KCC A;  3NTH A;  4S3S A;  2EYO A;  3NWT A;  3KK7 A;  2VJI A;  3PUW A;  4XKV A;  4ASU A;  4C3I B;  1D6E C;  3L3O C;  3N6R A;  2L0C A;  3BVG A;  1CA6 A;  3CP2 A;  1VF5 C;  2DN8 A;  1OXT A;  3ND9 A;  2E2H B;  3OHX C;  1PFN A;  5K36 G;  3FRP B;  5D14 A;  4KY5 A;  1I8D A;  5CV9 A;  2ZXO A;  1Q1E A;  2JA8 B;  3Q0A A;  1AFP A;  3GQB A;  3UI2 A;  5IOD A;  5C5M A;  1VDZ A;  2XRQ D;  4N9T A;  4C3H B;  2EJF C;  2QE7 A;  2L4N A;  2K32 A;  2K28 A;  1QNU A;  1NSN S;  1EWC A;  2O5J C;  1NR2 A;  2R7Z B;  4ME5 A;  1YNJ C;  5I6W A;  4H7B A;  4PV1 C;  1EY9 A;  2A6H D;  1FR3 A;  4KKT A;  3OIQ A;  1OXS C;  2E2D C;  3CES A;  4DU9 A;  3LX0 A;  4YXW A;  2IX1 A;  4J1M A;  4IAL A;  4HAE A;  3R2T A;  1KDA A;  1QE6 A;  1HXY D;  1MSG A;  1GHK A;  4K6L A;  4KK7 A;  4G57 A;  1LTI D;  2WB1 B;  1EYD A;  4KD4 A;  4ZQ3 A;  1EU4 A;  3BCF A;  1PYW D;  1TS3 A;  1XWE A;  5EKL A;  1W0J A;  2XGJ A;  3S1Q B;  2B2U A;  2MP1 A;  3S1N B;  2X6G A;  2ZZQ A;  2MGS A;  2FIN B;  2EZV A;  3SK8 A;  3NBH A;  4NP5 A;  2F0T A;  2WIN B;  4FXG C;  3K7A B;  4KN7 C;  1LTT D;  3MAQ A;  1LLR D;  4X3K A;  5KNL A;  3TP6 A;  3G6J B;  4RGM A;  3U9S A;  3FEW X;  1SKY B;  4FXD A;  4GQN A;  5E4X A;  1BOS A;  2JSO A;  2KVO A;  4HIZ A;  4FNF A;  4FVM A;  1U9R A;  4IN3 A;  2X69 A;  1V0E A;  2PZT A;  3H91 A;  5ELC A;  3EQL C;  2WSS A;  2EY5 A;  2X6Y A;  3D4D A;  5C5L A;  2B2W C;  4A3M B;  2EPB A;  2XOK A;  4TRD A;  2IW3 A;  2A68 C;  4HCE A;  4Q0F A;  1SYE A;  3ERO A;  4UZU A;  3E6Z X;  3T13 A;  1GUG A;  5C0X H;  2EYP A;  1HTP A;  3BDL A;  3HS0 C;  3V96 A;  4DAY A;  2EJG C;  4ZRZ A;  1T5E A;  1XX8 A;  3BVZ A;  2HQE A;  4IUN A;  4DF7 A;  3GP7 A;  5M3M B;  3A54 A;  1V1O A;  3MXN A;  4HED A;  4CJ2 C;  3GVJ A;  2I07 B;  2PMZ B;  3TSS A;  4RGN A;  1O7Z A;  2F0J A;  1DXM A;  3GVL A;  3FDT A;  5FL7 A;  3SE0 A;  1DD2 A;  5AFW A;  2L11 A;  2PZW A;  3VR4 A;  3L9A X;  3HKZ B;  4H13 C;  5KEE A;  3RMH A;  3SK5 A;  1R9T B;  3HOU B;  3GO5 A;  1V8Q A;  4X3S A;  3KBX A;  4ZAI A;  1PFM A;  5IGE A;  2EYH A;  3M85 A;  1PTO B;  1EIH A;  1BO0 A;  2QKI C;  4K5W A;  1KAA A;  5CBE E;  2M5S A;  4XYQ A;  5CMD A;  1B44 D;  1U4P A;  4ZLT F;  2X6L A;  2A68 D;  2GK6 A;  4L63 B;  1Z6H A;  1WPC A;  3BH4 A;  4C3I G;  3NE5 B;  5E1F A;  1UUP A;  1AN8 A;  2SDF A;  1RCV D;  3MFY A;  2OXP A;  5M3F B;  1BBX C;  3H0G B;  1FD7 D;  1S5D D;  3T16 A;  1SE4 A;  1K8M A;  1X32 A;  2R6G A;  3NTK A;  3GTP B;  5FK9 C;  1FYC A;  3J80 E;  3LNN A;  4OHJ A;  2M00 A;  2BDN A;  1QOH A;  3GTL B;  4XLA A;  2F4I A;  1AEX A;  3VR3 A;  2E2J B;  4Q5V A;  2MPM A;  4XOR A;  2XNA C;  1ENF A;  2M9V A;  2NTT A;  3A7A B;  3MHB A;  3I3C A;  3BDO A;  1TS2 A;  1W0K A;  3H3V C;  1H8E A;  4IFD I;  5COR A;  3GTG B;  2ZXI A;  2PZU A;  4A3K B;  1UD6 A;  3GD7 A;  1ESF A;  3WOE A;  1U4R A;  4KHV A;  2KEC A;  2X8K A;  2XN9 C;  2A74 C;  1JWU D;  5M5X B;  2BA0 A;  4OO1 G;  1K8O A;  4II3 A;  1VLY A;  2XWJ B;  4V0B A;  1NRK A;  2WKC A;  4RWS C;  2XND A;  1RD9 D;  2NTS A;  2F0E A;  3J81 L;  3A7L A;  1L0X B;  2KA7 A;  2TSS A;  1WTW A;  2LS0 1;  3RLF A;  1Y69 U;  3RD4 A;  2MUY A;  2O2L D;  5HUR A;  4FXK C;  2WJY A;  1ZEQ X;  4K2L A;  4WRD A;  2RVL A;  1QNK A;  4DK0 A;  2HCI A;  2JA6 B;  5LL6 X;  4XLC A;  1A3T A;  4LMQ D;  5CR3 A;  2O4X A;  4XN0 A;  1STH A;  3GVK A;  3C3L A;  2B2Y C;  4G7Z C;  3EVQ A;  3CMM A;  5IGG A;  2GA4 B;  1MGS A;  3T56 B;  1DZ1 A;  4XL9 A;  1SEB D;  3CU7 A;  3BYY B;  3ZIA A;  1XTC D;  2FHT A;  2G9H D;  2Y0S B;  2B2V C;  1B9N A;  1HA5 A;  1RHP A;  1EEI D;  4CKB A;  2JJ2 A;  3MC0 B;  1S4Z A;  3NBI A;  2YYZ A;  3KLR A;  1OB0 A;  4M1U B;  3K5N A;  1ZKO A;  5I4D A;  2JA5 B;  1LT4 D;  2F43 A;  1E1R A;  3NUC A;  3QJY A;  2WV6 D;  5ELB A;  4RHR A;  1LAC A;  2AQ2 B;  1FNW A;  3ZYY X;  3H94 A;  4EQN A;  3RZD B;  1TR5 A;  5FO9 B;  3VYT A;  3AU7 A;  1IW7 C;  3DDY A;  1PRT B;  5IT9 L;  5BN5 A;  2ZXP A;  5CYU A;  3AMU A;  1Y1W B;  3R2I A;  3FPU B;  1LTB D;  4ZYS A;  1Y8N B;  2L55 A;  3KLS X;  3BVM A;  2C9O A;  1SDF A;  3P75 A;  2YU9 B;  1CHP D;  4DA2 A;  1OXV A;  4XLH A;  3VYS A;  2JYO A;  2ZTN A;  4PMW A;  2K04 A;  1KLG D;  2NN6 G;  1O7L A;  1E1Q A;  3QIA A;  2J7Z A;  1Y8P B;  2Q8I B;  4IUV A;  2EYJ A;  4XQQ A;  2Z8L A;  3D8G A;  1HQR D;  2PPB C;  1SE2 A;  2CK3 A;  2CW0 C;  3RZO B;  3GTQ B;  3OWE B;  5HKK A;  1GUT A;  5TSS A;  4ZUJ A;  2WII B;  1SYG A;  4H44 C;  2JE6 I;  2V31 A;  3K57 A;  4P22 A;  1IW7 D;  1I4G A;  3URY A;  3OW7 A;  1PZK D;  1UD5 A;  1QWY A;  1BPL A;  2J0T D;  2ENB A;  5T1I A;  2K7V A;  3SVM A;  4JMQ A;  5JEA J;  1HCZ A;  3SR1 A;  5F2D A;  2VUM B;  2CHB D;  2FMM A;  1TKW B;  5IGD A;  1RTN A;  4K8J A;  1PTO F;  3T53 B;  2KEE A;  3VA7 A;  1D1K A;  5T1G A;  2A6H C;  3DWP A;  2AQ3 B;  4IFD J;  5A2Q L;  1G2S A;  1GOZ A;  2R61 A;  2JEB I;  1XYI A;  2NUC A;  1L0Y B;  1BXT A;  4DXF A;  1IYU A;  1EY4 A;  1RF2 D;  2F0F A;  4BY7 B;  1O80 A;  4NKL A;  3A55 A;  5CDF A;  1IKL A;  1EWH A;  2QCP X;  4KN4 C;  5CV5 A;  2CW0 D;  5FO8 B;  4FF1 A;  5D3D A;  1AZP A;  4C1N K;  1Z47 A;  2B63 B;  3T51 B;  1F9Q A;  1B53 A;  4RHS A;  1QG7 A;  1JOO A;  3BZD B;  5IK2 A;  4HMJ A;  1CT1 D;  4DXG A;  1SYD A;  3I4N B;  3X3N A;  4NDX A;  2SOB A;  4XMY A;  4G7W A;  1SFO B;  1IKM A;  3NQT A;  2XIW A;  2MHV A;  1TS5 A;  4MN3 A;  2J4X A;  2WPD A;  4NMZ A;  1FGB D;  1Y1V B;  4H0L C;  1EU3 A;  1VMC A;  1VMP A;  2IPK D;  4KI0 A;  3VYU A;  1EL0 A;  5C4J B;  3NSW A;  2L1B A;  4M8A A;  3S16 B;  1UNS A;  1M8A A;  1STN A;  4G7X A;  4LAA A;  4DGZ A;  1H9M A;  3CP8 A;  2F0I A;  1LO5 D;  4RKL A;  2X53 S;  4L8J A;  3I72 A;  1F77 A;  3PUV A;  1R4Q B;  2PYK A;  3NWS A;  5DNF A;  1SXT A;  1WTV A;  2D9U A;  3HEJ A;  1JB3 A;  1KDC A;  4RAU C;  1BMF A;  3I4L A;  4ODG A;  3OOC A;  4FYD A;  3DWA A;  1U4L A;  1F2M A;  1WCM B;  1F2Y A;  5DEH A;  3TP7 A;  4G7O C;  1IYV A;  3OIP A;  1WP6 A;  4TKO B;  2V4D A;  5C44 B;  3VR6 A;  5COY A;  1SNQ A;  4A3B B;  3OMG A;  2AUK A;  3C2P A;  3C46 A;  2NVQ B;  4IQZ A;  3T4A C;  2K1B A;  3U9O A;  2D3L A;  4JK1 C;  1SNM A;  4F8M A;  3LWU A;  3E0J A;  4NW2 A;  3OEE A;  2BE5 C;  1ENA A;  3DM1 A;  3MWY W;  1BCP B;  2Z4I A;  2GK7 A;  3QOJ A;  3K0Y A;  1S5F D;  2TMP A;  3PUZ A;  4RH6 A;  1O7Y A;  4UAI A;  2KQ3 A;  1JCK B;  1E43 A;  3I90 A;  4EGV A;  3SK4 A;  3J7A V;  4AVZ A;  5IOC A;  2ZZE A;  5EPK A;  1PRT F;  3KLS A;  2LFN A;  5FLX E;  2JJ1 A;  3MXP A;  5JOB A;  2G9D A;  4IUT A;  4Z1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...