3FPPA

Crystal structure of e.coli maca
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
266
structure length
266
Chain Sequence
PGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTQAVSQQDLDNAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPGQKAWFTVLGDQLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the periplasmic component of a tripartite macrolide-specific efflux pump
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Macrolide-specific efflux protein macA
total genus 52
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3fppA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fppA02
4KHZA 3HGBA 3P20A 4KN4C 2F1MA 1H9SA 2A68C 2A68D 2DNEA 1H9SB 2JEBI 1E2VA 4H0LC 3WDNA 5A35A 1HPCA 4JBWA 4DNTB 2PPBC 2A6HC 2EVBA 3GD7A 1Y8PB 2KA7A 2QF7A 5JEAG 2AWOA 2ZT9C 2K7VA 3FPPA 2A69C 2BDOA 1GUTA 4DK1A 3OPOA 3D31A 4TQUS 3AB9A 2A6ED 2A6EC 1VDZA 2AUJD 2E75C 2EDGA 5JEAH 4G7OC 1V8QA 1Q1BA 1Y8OB 3M85A 2D2CC 1QJOA 4OO1G 4IFDG 3T51B 1LABA 2NN6H 2B8GA 3D4RA 2EJMA 1Z6HA 3PUVA 1O7LA 2NN6G 4PV1C 1DXMA 5KNBA 4G7ZC 3A7LA 1HQMC 5KNCA 1K8MA 4KKSA 1O78A 1GJXA 3QJYA 3CRLC 1G291 2A69D 2K32A 3BG3A 1HCZA 2D5DA 2B8FA 1E2ZA 2IT1A 3PUXA 1OXVA 2DN8A 4H44C 2E74C 4I7ZC 4BA1I 4IFDH 2PCFB 2R6GA 3N6RA 1H9JA 3MXUA 1GHJA 4LK1C 3KLRA 4OGQC 3LNNA 2Q8IB 1H9KA 1H9MA 4IQZA 2EJGC 2PNRC 1Q90A 4OO1H 1Q12A 1E2WA 1TU2B 3L7ZC 1IW7D 3PUWA 1DCZA 2DNCA 3I4LA 3TZUA 1CTMA 1H9RA 2KCCA 3VR5A 2O5JC 2O5IC 5KNDA 3I72A 2CW0C 1VCIA 5BN3A 1SMYC 3M4YA 2BA0A 3SE0A 1IYUA 1GUNA 3VA7A 3VR2A 1Z7TA 3PUZA 5BN4A 3I73A 1ZYRC 5K36H 3IFTA 1B9NA 3H94A 1PMRA 3A8JE 5C0XH 4TKOB 1Y8NB 4KN7C 1VF5C 1GUOA 2K33A 3U9SA 3OOCA 3ND9A 2NN6I 3A7AB 1B9MA 1CI3M 3DXJC 4KKUA 2BA1A 3RLFA 1V43A 1OXUA 1T5EA 1OXXK 2BE5C 4RCNA 4DNRB 2LMCB 3FMCA 1A6XA 2JE6I 2BE5D 1FYCA 2E76C 3QIAA 3T56B 2JXMB 3A8KE 3SDZA 3VR3A 2D62A 4HR7B 1CFMA 4G7HC 2YYZA 2AUKA 3VR4A 3M7NA 3QG1A 4KKTA 4BA2I 2EJFC 1K8OA 1VF7A 3MFYA 3PUYA 4XTCS 1GHKA 3OW7A 4DK0A 1GUGA 3BDOA 1EWHA 4H13C 3PV0A 1DD2A 5K36G 1IW7C 4L8JA 3A8IE 2L5TA 1ZKOA 3IKJA 3W3AA 3VR6A 5C0XG 4KMUC 3T53B 3EQLC 3GQBA 3CRKC 1Q1EA 2JEAI 3ND8A 1IYVA 1OXTA 5BN5A 3LWUA 1BDOA 1I6VC 3NE5B 1OXSC 4LJZC 1YNNC 4XIGS 1ONLA 1YNJC 2V4DA 1FR3A 1HTPA 1LACA 1TKWB 4JK1C 4KI0A 4GZYC 2A6HD 1GUSA 1Y69U
chains in the Genus database with same CATH superfamily
3P20A 4MYUA 1QVGA 4XYQA 1NBWA 1VQAA 2F0QA 4B47A 1S5CD 3OP1A 2MNAA 4GQNA 5J22A 3JAMc 4JW0A 5GROA 1L0WA 4DQLA 3LO8A 3PCOB 1UE1A 3EFXD 3T1HL 1F2ZA 1L0XB 4B3SL 1P16A 2IY5B 3BY1A 3WXMA 2DYIA 1CNEA 1I3QH 2C4UA 1QUFA 1XYIA 1IYJB 3FPPA 2BDOA 5ELBA 1YVCA 4WRDA 5EBDA 1KDAA 2Z8LA 1Q7YD 5M3MB 1TQOA 3PF5A 2K03A 1XNRQ 1T6XA 4L5QA 2KOLA 1H8HA 2KECA 1OB0A 4A3CH 3ZBTA 3I4MB 2EJMA 4ACAA 2QEJC 3HKZB 4P25A 2CK3A 1EIYB 1TWFB 5DAUA 3A5ZB 4PQXA 3AVTA 1Y0YA 4Y7NH 4GKKL 2YWHA 1VQHA 2QEXB 2K5HA 4JI0L 1EWCA 5IGCA 1E2ZA 3CPWA 5DNFA 4IJHA 1AIPA 1XTCD 2VQFQ 4O0AA 4C3HG 3BCFA 2IPKD 2KHSA 4A3LH 4M4SA 4CQJA 4MHEA 5CV7A 2ATWA 4EX5A 3VYRA 4CJ0B 3DEOA 4PZ6A 4KV6A 4WZLA 2RHSB 1Q90A 2DERA 1UMKA 3FP9A 3M3YB 2NBFA 4K6DA 1PZJD 4UY8C 4A3EB 5IYNA 2L15A 1EL0A 1PH8A 2RDHA 4GNXC 3KF6B 5EJWA 2NVQH 3J7AF 2CW0C 2Y0SE 1VCIA 3S14B 4ZUJA 3CC4B 3E5SA 2C9OA 2XGTA 3KDFA 4ME5A 4JI7L 1FX0A 2QILA 4A3FG 1YITB 5LMNL 3A0JA 4Y7NB 1ZM9A 1IZ6A 1KRHA 1G7CA 1EFTA 4TKOB 3OKXA 5J3OA 4LF9Q 1A15A 3T13A 1VF5C 2ZXOA 2C35B 1IKLA 4A3MG 4A3JB 1OXUA 3E3XA 1FRQA 1BX1A 1GXDC 1NTGA 1KMHA 3FKIH 2RC5A 2MO0A 3NENA 4DR5Q 2C78A 1FNCA 3U9OA 2CCZA 1JB7A 1EY9A 3T56B 2JA5G 1TS2A 3ZZTA 3C2PA 2AHOB 2K75A 4ZK9B 4HIDA 2AQ1B 2Z0SA 4HIZA 3MXNB 2I5LX 1EWHA 2MP1A 1T6ZA 4RPBA 3CCSA 4ZQ3A 5GAGC 1F2MA 2EYHA 3RZOH 2OWOA 2L5TA 1MJCA 1WTWA 1ILPA 2UUAL 4FYDA 4Y7CA 2OF1A 4XIGS 3ZBUA 2VBSA 3EVQA 1QG7A 3LVBA 1YHQB 2UUBQ 1BVSA 2UUCL 1KLGD 4R4IA 4B3MQ 3CTAA 1BQEA 1E1TA 1YHAA 4K8JA 4QL5A 1LO5D 4A3JG 1UD6A 3CP0A 1RIPA 1QE6A 2F0TA 3EBEA 3TBIB 2A68C 2A68D 1TWCH 2JEBI 2PO4A 3WY9A 1HNWL 4MTNA 2VQEQ 1XNQQ 4O1NA 1VQPA 3PUMA 3A54A 1RHPA 3SK5A 3D3RA 1Y8PB 4LF7L 2V7TA 2RCFA 1NMGA 4UP8A 3AYHB 2I07B 4RD3A 2FJ2A 3K7AH 4R4CA 5HY6A 3ITPA 2IHFA 1MSHA 1EY4A 4LF8L 1DZ1A 1HZCA 3H0GB 3PIO3 3CQZH 1V8QA 4J6HA 5FIUA 1NCVA 4LBYA 2B3GA 4B43A 5JEAJ 5IT9c 4UP7A 4LF4L 1E63A 1LABA 2Q6IA 2QTZA 2B8GA 1LTID 4B9XA 3CCUA 1O7LA 1TWFH 1SYEA 1DXMA 5KNBA 3F2BA 4DXFA 3J80i 3QJYA 1YNXA 4X05A 4C3HB 2B2VC 4DV1Q 2F0EA 1SE4A 2WIIB 4P74A 4FXKC 4LFAL 1JJ2A 3HG9A 1HFNA 3STBC 2VB2X 3K59A 1F9PA 1AP0A 1A8PA 4A3BB 5C0XJ 1T9HA 4Q5VA 3G6JB 4XORA 1II3A 2OBTA 1WSRA 3LNNA 2NUCA 2Z9HA 2Q8IB 3W2IA 4TRDA 2CC2A 5JVG3 4DR6L 3NWTA 2HD3A 4IPCA 1WPCA 2RDFA 4XYOA 2RQXA 1EU4A 2CKZB 3ULLA 1TUIA 5DS0A 2OTLA 3N52A 1VQ4B 3MHPA 1SMYC 4RJLA 2BA0A 4QUFA 5C4HA 3T16A 4IO9A 2R3ZA 2GJKA 2XIWA 1EP2B 3P26A 3NXWA 5CMDA 4A3MB 3S1NB 3H3VI 1B9NA 1ZM4A 5JJIA 1CM9A 4H7BA 2UXCQ 2K33A 2ZBVA 1EOTA 2KEEA 2R7FA 4BXXH 3A8KA 4M1KA 1SE2A 1PLFA 3W2EA 4KKUA 2BA1A 3MTSA 2KENA 2D62A 2EOTA 3CCUB 3NTKA 1F9QA 4O42A 3M7NA 1F77A 1Y1VH 1E79A 4BA2I 1CZWA 1KDCA 5M5YH 5FLXE 4DF7A 2WP8J 4H13C 5A8AA 4ZCKA 4C3JH 1PYBA 5GV8A 2QCPX 3F2UA 1HR0L 5IE8A 3Q6SA 2GJPA 1Y1WG 4QQBX 1EUJA 5CR3A 5EGTA 4QIWE 1VQ9A 2D3LA 4LNQA 1FNDA 4LUOA 5IYDH 5TSSA 4EQ5A 3JQPA 5G3LF 1W0JA 4AQYL 2VBVA 1BKBA 2K04A 1FR3A 1LACA 3CAMA 3JC66 5LMUQ 1NSNS 4IUTA 1B44D 1O7IA 4KTAA 2HDLA 1KK1A 4GS3A 2KVMA 3D6CA 1JR0D 4PGOA 3WDNA 4K0KQ 4JBWA 3SEBA 4RG1A 4B4DA 4LF6Q 1D5XC 5CV4A 4POFA 5C3WA 2FXQA 2E2HH 4JI2L 2Y0SG 5LL6X 3U2QA 4P72A 4R9WA 2UXBQ 4DK1A 4QMGA 1CHPD 4P9SA 1SE8A 4TQUS 4XQNA 2X85A 3I55B 4EQPA 2R92H 4P22A 3CU7A 4LUZA 4QGUA 1N36Q 4A75A 3M4OB 4CJ1B 4R4QA 3KBXA 1X56A 1PHJA 1EFCA 1DDIA 3B78A 1QFYA 1HQMC 4NW2A 5KNCA 4BY1B 2F52A 2AMCB 2K50A 2MPMA 1TWAB 3F1ZA 4P2NA 1WP6A 2D5DA 4IPHA 5I6WA 1JT8A 1Q46A 2X6LA 1QVCA 3S1NH 5J3BA 3CMMA 1DM0B 1F9RA 1XPOA 1HNXQ 3PQIA 1VQ7B 2BOSA 1RTNA 4K5VA 2LY7A 3FHWA 3SLDA 5FLMH 4FK8A 1E2WA 1W3SA 5I2XA 4UHVA 1LTTD 2F0NA 1GJRA 3R6KA 5NUCA 3J81k 1MGSA 3EJIA 4K2KA 1HNZQ 1W34A 3BNWA 1PFSA 4RLZA 2R93B 1IYUA 4A3KH 2ZL7A 2JA7B 3CPFA 1SSOA 1PRTB 2PI2A 3I73A 3HOVH 3VO1A 4A3BH 4UZEA 3VYTA 3A8JE 3B6YA 4PG3A 1GD7A 4RFBA 3Q0AA 4RDJA 2B2WA 2ZZQA 1A63A 5FJ8H 5IP9G 2K52A 1HJPA 3P75A 2D3NA 1LLRD 1V9PA 3SGIA 3RLFA 1M90D 4G1VA 4ALPA 4X7CA 1W0KA 4U9UA 2NZOA 5F4MA 5M5YB 4A3KG 1TVXA 2C5HA 2C2WA 1SJHD 2IL8A 1DOLA 1VHEA 2BM1A 1CFMA 5IIFA 3SVMA 2WJYA 2NB0A 1K73C 1VQBA 1VF7A 2YWFA 4CGYB 5C3EG 1TWHH 5E4XA 5FA6A 1WOSA 2UU9Q 4Z4ZA 1I94Q 4HSPA 3BH4A 1PJ6A 1NY4A 4XOTA 4RMFA 3W3AA 5IGEA 5TV2A 2F43A 4DAYA 1AW7A 1FD7D 4OIJA 1BLIA 1KTKA 2EY5A 1BDOA 2R7ZB 1ONLA 5GQOA 1QH0A 2ZL6A 4NB3A 4JV5L 2NVYH 4R8IA 1KC8C 4X3UA 1STNA 1MRZA 4Y52H 5EPJA 4M53A 4JI7Q 1NUCA 5LMNQ 2CVRA 5IYDG 1FJGQ 1PA6A 1O7YA 3RLOA 4LF9L 4GN3B 4Z4TA 4ME3A 2YWGA 4NBSA 1HPCA 4A3GH 2EYLA 2ZJPA 3DMUA 3MXPA 2HQLA 3G7LA 4KJOA 4K0KL 2AWNA 3A5UA 2RA4A 4A3IH 1G8ZD 2ZTDA 3A55A 2YU9H 3OPOA 4YCVA 2BCOA 3J7ZC 4OOVA 1QGAA 1WCMH 3TP5A 1JOQA 2ZTGA 2ZBUA 1OGIA 3CXCB 1RCVD 1OGJA 3T51B 2NN6H 1A2UA 3W2HA 4KD4A 4PV1C 3Q3AA 1V1OA 1VLOA 1EEID 4HTHA 5IWAQ 4A3DH 3CP2A 2NV4A 4Z4UA 2B2WC 4NCNA 3AQQA 2LXKA 1EXMA 1G51A 2MHVA 4A3BG 4A4IA 3H0GH 4PMBA 2VYQA 2FX3A 2EQSA 1VQOA 3U4VA 2NVQB 4B3ML 3PENA 4N9TA 1YNJD 1WTQA 1QG0A 1SNCA 3HOZG 5FO1A 1SEBD 2B29A 4J15A 2CRVA 2VB3X 1AMOA 1A0IA 2ENBA 4P73A 2ZXPA 4HMIA 1Q86D 1Q86C 1I4PA 4JI1L 2YV5A 1B3QA 4DV1L 1E7ZA 1IL2A 2OBRA 1VQNB 5IYBG 2DGYA 4LF8Q 2MJ8A 1CKOA 4KJNA 3ZUGA 3KL9A 2I1LA 2EYFA 1TWHB 4GN4B 2BMWA 1X32A 4LF4Q 1RJTA 3W2FA 4LF5Q 3BU2A 3D26A 4ZCLA 2JA5H 2NZHA 2XGJA 4XQQA 1A62A 2BE5C 2F0MA 5HGTA 2XWJB 5FKAC 5BR8Q 2VUMH 4BPRA 4FVMA 2ZITA 1U5KA 3I4MH 1XFOA 4RKBA 1SYBA 4HR7B 1Y1VG 1PKVA 2RVLA 2YYZA 1UUPA 3PUYA 2FMCA 3BJUA 3GV6A 4MZ9A 3QFSA 3GTKB 3DWAA 3PV0A 4RCOA 5C4XB 1ENCA 1U0LA 5C0XG 4TMVA 4KMUC 1L1OC 4DXGA 3T53B 1VQKB 3CCJB 3EQLC 4RKLA 4CDCC 3CMAA 1ESRA 5GV7A 3M9BA 4LJZC 1E64A 1B50A 5HZBA 1M1KD 2PMDA 1FDRA 1OO9B 4XMYA 1NRKA 4JK1C 1ZM2A 3LWEA 1QUEA 3PMFA 4C1NK 3ASTA 1SNPA 2X3UA 1KC8D 4OL7A 5EQ0A 3K80C 2RF4A 4YCUA 1TR5A 1PH4A 3S17B 1VQPB 1KD1D 2CH4A 1N32Q 5HKKA 1PTOB 1TLLA 1TWAH 5DLQE 4MTKA 4A3GG 4JI0Q 3SLNA 4A3FB 5FOBB 3K0YA 3TEHB 1GVHA 4HEDA 4E6IA 1LUZA 1BCPC 1JICA 1K3BC 3P7JA 4K5XA 2E75C 5JEAH 4A93B 5LMUL 1K83H 3HAGA 2OK8A 5IT9L 2O2LD 3W5UA 4X66L 4RCYA 1WCMG 1JOKA 4AYBG 3A3GA 2VNUD 2Z6KA 4ZGNB 2F3IA 2V7VA 1WVLA 1N9WA 3P27A 1M90C 4AYBE 4N3NA 2NWGA 3HP3A 2Q2IA 4U673 4GKJL 1I4GA 2A69D 3ONAB 1I50H 1W6JA 4JI2Q 3GTLB 5FO7B 1RF2D 3HOWG 1SJED 1VQ6A 4RD6A 4AQYQ 4BA1I 5CC4A 1XXGA 2F4VQ 4X07A 2WPDA 1CQFA 1G6PA 1N36L 4A3KB 3QR8A 2CNDA 1EQVA 1IJFA 3I4NG 2BSAA 3ULJA 4DR3L 4IUQA 4B44A 3TP7A 3I4LA 4Z9CB 4DR5L 1UAPA 2V31A 2KUMA 1QILA 4F88A 3E9HA 1QVFA 3J81L 5BN3A 1E3XA 5IYWA 4JPBW 4R4TA 4HIKA 5FLXL 4C2MH 4O2DA 4RHRA 1SXTA 1ZYRC 2HUGA 4DGZA 3NHHA 5EKKA 2GK7A 3M4QA 3L3OC 4MN3A 3JAME 2B2VA 1S5FD 1HQRD 1E1RA 5CBAE 1X54A 4RDKA 3I2ZA 4OOXA 3DHQA 1AZQA 5HURA 1JQYD 3DWPA 1K0RA 1QB5D 1JWUD 2EE1A 5D3DA 2UUBL 1KL9A 5C5LA 1W2BA 1KXLA 1SYCA 3SJPA 3KUPA 4FN5A 1CKNA 4KKTA 3GDEA 1JNYA 1D5MC 2M9VA 4GOPA 1HUNA 1WOCA 2Z4HA 3BDOA 4JI4Q 3I3CA 2K28A 4A76A 4L8JA 3OEHA 2SOBA 1H95A 2F0HA 1KHIA 1QUQB 4PC1A 1QX4A 3ND8A 5BN5A 1M4VA 3G48A 4RHSA 4C43A 4C56C 1N33Q 1UD2A 2V4DA 4GZYC 4KY7A 4C1NI 2EFGA 2FINB 2B2UC 1WOOA 5M9OA 3VO2A 1E1OA 1MBYA 2UU9L 2HDNB 2BPOA 1S4MA 1EP3B 1W9XA 1HZBA 3CPXA 2QGQA 4JBJA 2VXWA 5DSZA 3CC2B 1JA1A 2M5SA 4A3IG 3W5HA 1N34Q 2UXDL 2D0OA 2AWOA 2G9HD 3J80L 1IB0A 2K5NA 3I90A 3OSOA 1PJ5A 4IUPA 3AB9A 4XDXA 2K14A 4RGNA 2A6EC 2ICEC 1YJ9B 1IBKL 3GTLH 2A74C 4Y9UA 3KYHC 1Q1BA 1HRJA 1TWGB 1X9NA 2OTJA 2QMUA 1IL8A 2KCMA 4YIJA 2QDXA 1SR3A 3CRLC 4MYTA 3RLNA 3G4SB 1FNVA 1K3RA 4HCEA 3DDYA 5GAHC 1KIXA 4NXML 1VQGA 4DAYB 4X7FA 2XWBB 2QA4A 2KBNA 3ULPA 1I5FA 1STYA 4HN7A 4DPGA 2JA6G 1FJGL 2OT2A 3OIPA 3IRBA 1V1PA 1T5XD 1EQTA 5KRUA 2OXPA 1OTCA 2XEXA 3OWEB 2AQ2B 4YY3Q 1H9MA 1I4RA 2HIVA 4IQZA 3TN2A 1X3QA 4OELB 3QE2A 4PC3A 3KDFB 2VNIA 1NJID 3MFGA 1HZ9A 1QCBD 2ZL5A 3CW2C 3KF6A 1CKMA 2GK6A 4FF3A 4TMWA 4JMQA 1B1ZA 2PW7A 1E1QA 2WZNA 2N49A 3KJOA 2SEBD 5IP9H 1Q82C 1N8RC 1CQVA 4ZUIA 3GTKH 3V76A 2JA8B 3STBD 3T4AC 1S72B 3K5MA 1SM4A 5EPLA 1GUOA 1MD2D 2AQ3B 4X7EA 2YWEA 1S3OA 1WTPA 3C46A 3CRZA 5IWAL 5C4XH 2NPFA 1BMFA 3OTOQ 1OXXK 2N3SA 4P1VA 3K0XA 4JI1Q 3MCAA 1S0UA 3NSWA 1SKYB 2F1LA 5H1SE 3GTOH 3HOUH 4XLFA 3VYSA 1SDFA 1PH5A 3PA1A 1VQOB 1GHKA 1KK3A 3FKSA 3AVWA 4X06A 4A3GB 4XM3A 3G4SA 1IW7C 4L6TB 4OONA 3SKBA 2Q2TA 4FP5D 3W1BA 5EMNA 3DUZA 4LFCL 4M2LA 4LUVA 1X65A 3EA6A 3LWUA 2XZPA 4XONA 1G2SA 3Q23A 3I1FA 1YJWB 3SEJA 2KQ3A 1SMXA 5A88A 4FWTA 2K5QA 3A74A 3S1QB 1GUSA 1TS3A 1WFQA 4JI8L 1H9SA 4P6VF 4LF5L 3JAMi 3BCDA 4YALA 4DNTB 1L1OA 1L1OB 1PZID 5C3EH 5C44B 2EYJA 2MGSA 2P5ZX 4KY5A 3SK4A 2B63G 3TMEA 2QF7A 1CK1A 1IXRA 1E3PA 3RZOB 1FL0A 4EGVA 1RDPD 5JPMC 4DR2L 3AVUA 1EY5A 1VDZA 3I70A 2JYOA 2X53S 4LBZA 1HNXL 1VQMB 4YAFA 2JDIA 3NP8A 3GTJH 2I0QA 4EH1A 3D4RA 1NBMA 1BBUA 1Z6HA 5EPKA 4X65L 1PH9A 4A3DB 1N0VC 1QZGA 4ZAIA 4RCZA 3TSSA 1VMPA 3K58A 1K0SA 2F0GA 3GTJB 1EY0A 3AGQA 1F2LA 3G6EA 4OX9L 2RC6A 4XL9A 2K6AA 3BDCA 4XT1B 2VS1A 2EPBA 4FF2A 1XWEA 3D6WA 1KK2A 2MFIA 4H44C 1EIFA 3MXUA 2D0PA 1GO3E 2XNJA 1K9MD 2OCEA 2QEXA 3HOXB 2F0SA 2A19A 3JQRA 1WI5A 1VQ8A 5HXBA 1WOPA 1N0UA 1AN8A 2E1BA 4X7DA 2F0KA 2WJVA 4B3FX 4Z4WA 2YTYA 3C1FA 5I9PA 1YIJA 2V7UA 1VQEA 1N32L 3OZWA 3WNCA 4XLAA 1G7RA 1H9RA 2O5IC 5KNDA 1LT5D 3CCEB 1F2YA 3F2CA 2FHTA 1NE3A 3MWYW 4WORA 4K6LA 1Z7TA 1Y1WB 2C77A 1GM5A 1U4RA 5D14A 1K28D 1PMRA 2Z4IA 1PH6A 2EIFA 1Y8NB 4KN7C 3RD4A 4IUUA 3U9SA 4LFBL 3V96A 5JPNC 2PIAA 2X6WA 1JJCB 3A7AB 2HT1A 1TWGH 2X8KA 1WDTA 4V0BA 1JWMD 1CZGA 5EKLA 4ZCIA 5A2QL 3NTIA 2PI2E 3SDZA 5A2QE 2TMPA 2B2TC 4ZV4A 4IALA 2IHEA 1K8OA 2EJFC 5AJ3Q 1HTLD 4MNOA 2RSNA 1Q7YC 1UD5A 4WWVA 1PFNA 3WOFA 3J81i 1KNAA 4XLHA 5IGFA 2JA7H 3IKJA 3SJZA 2AKWB 1YBYA 4YELA 2F0UA 4RD1A 3OJWA 2B5OA 2BH2A 4BY7H 2B7CA 4B3RQ 1KQSB 2CWPA 4HIOA 1WTXA 3UDFA 1V0FA 1VQJA 3QOJA 4DAVA 2Z1CA 1A2TA 2J7KA 5A35A 3OHXC 4P3YA 1N05A 3OAAA 4DUZQ 1SKQA 1Y0RA 1KLUD 4B3TQ 5IYRA 3KLSA 3NQIA 5LHY1 3LQ6A 3H91A 3UDGA 4CBVA 1DARA 5KIXA 1A8VA 4JG2A 4P12A 4ULLA 2L0CA 2Z6BA 2EDGA 2QE7A 4QV2A 2M2LA 1KTVA 2Z6KC 3A56A 3KLSX 4IFDG 3M4OH 5E6TA 3OW2A 4Q0FA 2PQEA 4HSVA 4DV3L 4JI4L 1FNUA 2R92G 2NZ1D 3A3BA 3HOZH 4KHPQ 5KGUA 3S2DB 4P75A 3J81c 4DR1Q 3GTMH 3NELA 1S5DD 2F0VA 4J0QA 3S1MH 4TVAB 2I46A 1EYCA 1XPUA 1QGZA 3V05A 1C4QA 4AH6A 4DV4Q 1N33L 2F0IA 2CH4W 5ELEA 4DV6Q 2R6GA 2R93G 1R5BA 2JSOA 3HEJA 4X62Q 1CA6A 2H5XA 3GSIA 1KDBA 1STAA 2HHHQ 1B2RA 1JB3A 4A3DG 4TSFA 1STEA 4Z4VA 1VQ9B 1QZHA 3OZUA 3I7FA 1FGUA 3K57A 4IN3A 2VJJA 4HE5A 1NNXA 2EYMA 2R7DA 2XSCA 5ELFA 4DKAC 3TS2A 1WSVA 2UXDQ 3GO5A 4I7AA 1VLYA 4YEJA 1UNSA 3HKSA 4G6IA 1K8AD 1SLJA 1GO2A 5TRDA 2XNCA 5A89A 4XQJA 3H94A 3NBHB 5ELNA 2F03A 4LC0A 2CQOA 3NTHA 4TMXA 4OO1I 1C0AA 2KHJA 2L12A 4RPDA 1KAWA 5CV8A 4KLKA 4AVZA 2OEOA 5FJ8G 2LMCB 4NXMQ 3F2DA 1EY8A 5JBQA 3TZDA 1D2EA 3VR3A 1BUVT 3ZC3A 4XQFA 1I6HB 1QFJA 3E1YE 1JCKB 2QA4B 4DUYL 1ASZA 4JI5Q 4ZKBB 2E2JH 2RSOA 4PC6A 3X3NA 2IW3A 1Y1WH 1TIID 1CKNB 1PYWD 1Q1EA 3TREA 4YAWA 2B39A 2PW5A 4A3MH 2Q2HA 3NE5B 2GPJA 4OP7A 1EQRA 4X64Q 4C2MB 2DY7A 4NPSA 1H42A 2GVAA 1YITA 2RDGA 1HTPA 3AFQA 2BM0A 2WAQE 1A3TA 3C1EA 4OWXB 3CC4A 3VNUA 3GTPH 1LTLA 4P26A 1F9SA 1UEBA 2P3MA 1UE5A 3W1GA 1EIHA 3DEPA 1GVPA 1JORA 2K01A 1SBBB 2N55A 3UDIA 4CKEA 1EFID 3S1RH 5I2YA 1J5EQ 3OTOL 4JVZA 3CXCA 2J4XA 3HZXA 3CCVB 2I5HA 3CCVA 3KF8B 3DWQA 2VBUA 4DU9A 3FPUB 1BOSA 3GTQH 4DNIA 4FNFA 1HZEA 1U4PA 2TSSA 3FDTA 3HOWH 1N06A 3CMEA 4C3HH 3J7AV 3S2HH 4CDEC 4B48A 1NR4A 1Q81C 4R1JA 2EY1A 4DR3Q 3OWFA 1NB9A 2WV6D 4DV7Q 3MAQA 3I4NH 4YHHQ 4C0SA 1G291 3BG3A 1B7YB 1JMCA 1ENAA 3SHLA 3ER0A 5LL6S 1J9ZA 2ID0A 2IX3A 1SNDA 4Q7JB 3K5OA 4TSSA 1TWCB 4P71A 3IAYA 3CW2A 2DJFC 2EY2A 4OGQC 4JI8Q 1O7ZA 4DA2A 3WBKA 2GA4B 4X65Q 4JI6Q 3D0FA 2HIXA 2Q6LA 4UZUA 3RNUA 4HAEA 2E5LQ 4B3SQ 4J1MA 4FXDA 2UUAQ 3S15H 2BV3A 5IY0A 3PF4A 4QJFA 3MMPA 3SE0A 1ET9A 1X3GA 3VA7A 3HOXH 4QUCA 2SDFA 1XE1A 1PTOD 1IJEA 3U6KA 5C0XH 2A8VA 2F0LA 3NK9A 3J81j 3OOCA 4HMJA 2JA6H 2VQEL 3BZCA 3B82A 4FF1A 3URYA 2QKIC 1I8DA 4GKKQ 3W5VA 1WCMB 4LF7Q 5M3MH 4DNRB 3CC2A 4OX9Q 3GVLA 3PO2B 1FYCA 1BNZA 3T1YQ 4YCWA 1XTDA 1Q8KA 3G71B 3AVYA 5D65A 1BF4A 3G71A 2YU9B 3RN5A 3Q22A 2Q6OA 2VZAA 4JC0A 4LW1A 4XTCS 2B2YC 5IGBA 4QVJA 4A3JH 3VR6A 2PQAA 4X8IA 5M3FB 3CRKC 1N34L 2G5DA 4IZ8A 4DN4M 1VQ8B 2NVYB 1NJIC 1ESFA 4CHTB 5TR9A 1MI2A 2XTIA 4J8QA 4X3SA 2WAQB 3S14H 5ELCA 3ZIAA 2A6HD 3J7A5 1Y69U 2DY1A 1H85A 1JE5A 4KHZA 4H0LC 4A3EH 4DR6Q 2R7ZH 2A6HC 3Q39A 3ZYYX 4G5GA 3I56B 3HKZE 3ONYA 2K7VA 4II3A 1PFBA 4L5RC 1ICWA 4B9WA 2F4NA 4WZKA 2NTSA 5BSXA 1K28A 1KRTA 3S2HB 4IPDA 1XMOL 4RD2A 1VHOA 5DM63 2NN6G 2HCIA 4RGOS 3KK7A 4TMTA 2CF4A 3ONUA 1EZ6A 1BPLA 1K8MA 3P1HA 1STBA 2VNKA 4C3IH 4CKCA 2C5CA 1HCZA 4FXUA 2BDNA 4E0FA 1B23P 4B3RL 4IURA 1WD0A 1F60A 3JQQA 1PH3A 1BCPB 4A3IB 3GTPB 1Q9SA 1RL2A 1YNND 1D7QA 2R93H 1BX0A 3D4DA 1B70B 3CB4A 5IOCA 4DV3Q 2CWAA 5HZAA 4A3LG 3FKIG 4DUZL 1HR0Q 2F0WA 1YJNA 1PFMA 4B3TL 4C3IG 1PYSB 2NVXH 3GTGH 3RUZA 4A93G 1HA6A 4UAJA 2FFKB 3R6JA 2HQEA 1FNBA 4JBMA 5H5JA 3OZVA 1QVFB 5AFWA 3PGZA 2EIXA 4OPVA 4PC7A 1RTOA 3FPKA 3PUZA 1YHQA 3GP7A 2OBSA 5K36H 2V7XA 1OB2A 3BY2A 5CDFA 2VY3A 2PE3A 1PRTF 5FL7A 4XD7A 4LBVA 5FO9B 2CHBD 4RAUC 3HKZG 3OEEA 4DV5Q 1CI3M 2X69A 2VZLA 4L63B 4LFCQ 1I4HA 2R92B 1X3EA 2E76C 3ASPA 3E0JA 4LFAQ 5I9OA 2FVGA 3TS0A 2VUMG 1ILQA 3A8IA 4DV6L 4N8X1 3QG1A 2FMMA 5M5WB 1L2FA 1WTOA 1D1KA 4F8MA 3CD6A 5CV5A 2W6JA 1W87A 2OYNA 1QOHA 4DAMA 1T6YA 3UDXA 3CCRB 2QGGA 2JEAI 3KFUA 4NXNL 4KK7A 3MEFA 5F2DA 4CJ2C 1IBML 4B3GA 1YNNC 2L55A 4JBKA 4G57A 2YTVA 1UE7A 1BJKA 4CKBA 1HH2P 1X6OA 3DM3A 3W2GA 5BSYA 3L0OA 5J39A 1BO0A 4C3JG 3HGBA 4KN4C 1WORA 4HCSA 2YTXA 3K6OA 4JI5L 4DUYQ 2UXCL 1BXTA 1WTVA 3HS0C 2HLDA 1SFOH 2BH8A 3K5NA 1VQ5B 1PRTD 3NPPA 1LTBD 2KA7A 1I50B 3QWNA 4YAOA 4QB4A 2A69C 4FO2A 5CGKA 2Z6BD 2OTJB 3GTMB 2H1EA 5THXA 3AU7A 3BQJA 3CCEA 4G7OC 1YJ9A 2RCNA 4IFDI 4FXGC 5IP7H 4IW3B 4JI3L 2ZZGA 3U50C 3PIPA 1U4LA 4BY1H 4A93H 1PH1A 4K1XA 2DY8A 1UD8A 2B63H 3EROA 3HOYB 4IPGA 3O13A 5B6IA 3AVVA 4IOAA 1GJXA 1XJVA 1WTHD 1YJWA 2XRSD 1BBXC 2VNHA 5AN9A 1KD1C 2B8FA 4I7ZC 3MEHA 4R71A 4GLVB 4K2LA 5KYLA 2XOKA 3GTGB 2NVXB 4LK1C 3PO2G 4RA8A 5C4XG 2X6YA 1WTHA 1E43A 4DR7L 4AIMA 2B2UA 3E0EA 3WWVA 4LF6L 2VNJA 1P4MA 2HCCA 1J5EL 5IYQA 1GKHA 4XLCA 1XMQQ 3E9IA 1EQQA 1STGA 2UXBL 1LT4D 1UEAB 3S16B 3A35A 5IYCG 3NBHA 1VQCA 4F87A 1EY6A 1OHHA 2XZLA 4DV0L 3UE1A 1X3PA 5KYIA 4JI6L 4C3JB 5L37A 4GOPC 3I4MG 3DXJC 1D8TA 4DV7L 2RKSA 3CQZB 2E5LL 2VUMB 1A6XA 3SK6A 2BE5D 1JWSD 1PTOC 1EIGA 3A8KE 3MC0B 4BY7G 3NBIA 4ABNA 1FVIA 2F0PA 2HMAA 4RD0A 3QO2A 1JJGA 4DR4L 4POGA 4DK0A 2QW7A 1N07A 1GUGA 5M3FG 1C7YA 4LAAA 1YIJB 1Z9FA 5FK9C 2BVNA 1GAQA 3R3OA 3W5OA 5D3IB 1FRNA 1J8IA 1E24A 1KNEA 2KJXA 4PMWA 1SNQA 4RGMA 5E7NA 3CKIB 1HNZL 4Z4SA 2R61A 1D1IA 2GJRA 3AFPA 4ODGA 1TKWB 3VDYA 1XB2A 3CC7B 1QGYA 2R7ZG 2WKDA 3H09A 1TY2A 4BBSG 1E2VA 4RD4A 1LTGD 3PO3G 3J7YW 4P2CB 1LTRD 4GLXA 1CNFA 3BVGA 3EIVA 3AMUA 1W35A 2EVBA 5K5PA 3FVQA 4IJLA 3H9NA 1A3UA 1BQQT 5JEAG 1QVGB 2ZT9C 1VQMA 3T1YL 3KF8A 3KEWA 2CFMA 1HZAA 1YHBA 2B2TA 3CCMA 3PO2H 3PVDA 4KHVA 1M8AA 2GQFA 1LT3D 3BS1A 2N78A 4X62L 5KEEA 4ZLTF 2C5BA 1AE3A 3S24A 4QUZA 1WTRA 3BVZA 2L1BA 1I94L 2O4XA 4G7WA 3OYYA 1PTOF 1LT6D 4OPOA 4YXWA 5KW9A 3A1PA 3MXNA 4B08A 1O78A 2VJIA 3CP8A 2X0KA 3V7AA 1YI2B 1AEXA 4B3XA 5IGDA 1CA5A 3MXGA 4JV5Q 1TXYA 4OEMB 3E20A 4IFDH 4X0CA 2JN9A 3UE0A 5FLXc 1AH9A 4EQNA 1SYFA 4Z4YA 3KLRA 3QFTA 3MZ5A 3S1QH 3WQZA 5C44H 1RODA 4N8FA 1HHVA 5C3EB 4OO1H 1Q12A 2KEDA 1DYQA 4ID6A 3R2IA 5IK2A 3RZDH 1CTMA 3WOEA 3VR5A 5C4ZA 3DLLA 1IBLL 1R5NA 5JVH3 4YWKA 3M4YA 4M1UB 1KABA 5BN4A 3K7UC 4WQMA 3G05A 1PH7A 1XMOQ 2F0FA 1Q3LA 2F0OA 3HOVG 4XKWA 3JU4A 1K9MC 3GTOB 3VA5A 1AE2A 1ML0D 1PDQA 2WFWA 2IX1A 2E2DC 3CCMB 4BXXG 2JN4A 2PZWA 5JOBA 1HR0W 3FMCA 2LS01 4JOIC 2DETA 4X64L 3CCLA 1SYGA 3QIAA 2EXDA 4QIWB 3HOUB 1K8AC 4PZ7A 4JOIA 3ZJYC 1FNWA 3MFYA 3ZPNA 3BC9A 4L5TA 4XLEA 2Y0SB 1VQLA 1YI2A 1ICFB 2JK8A 2R6HA 2AHOA 3I8ZA 1KQSA 1DDGA 3GQBA 2PMZB 4GKJQ 3RN2A 1HA5A 1IYVA 2DCUA 3U4ZA 2ZM6L 3L2PA 3FEWX 1I6VC 1OXSC 2JA8H 5DEHA 2JJ2A 3RY8A 4M0LA 4XOPA 2E8GA 1AZPA 3AGPA 2SNMA 4UDUC 4U68A 1GAWA 2F4VL 2MO1A 5FO8B 4TMZA 2F1MA 3BYTB 3MHBA 2WINB 1HFGA 5C0XI 2E2JB 3KBGA 2PPBC 1ZXTA 3LQEA 3I56A 1I4QA 2ZJRA 5CV6A 1SROA 3PO3H 4OWTB 3OW2B 3BZDB 2WACA 4BS9A 4PMCA 2PZTA 1FNMA 1KK0A 1I6HH 1SAPA 4P6YA 1QFZA 3M85A 4OO1G 3SR1A 5IP7G 4OOSA 2MUYA 3I4NB 5J35A 2JP1A 3OFNA 4RH6A 1G6ZA 4JYAQ 4G7ZC 1QWYA 2WB1B 3V2TA 1BBWA 3AEVA 4PC2A 3TDQA 4BBRH 3LGJA 2K32A 1HVXA 3WYAA 4NXNQ 2E2HB 1R9TH 4NNJA 4LBWA 1UD3A 1ENFA 4HJ5A 4HJ7A 4FF4A 1CSQA 4AF7A 2DN8A 3OMCA 1G7SA 5CBEE 3J80E 2EY6A 1D5ZC 3ZZ0A 1WYDA 1JJ2B 2EZVA 1E3ZA 4NMZA 2L4NA 5FLMG 5E4WC 4IUVA 4IFDJ 3CCSB 1E0BA 3PUWA 1TU2B 4ASUA 1LM0A 2DNCA 5CYUA 3TZUA 3R8BA 3CCJA 1PXUA 1PZKD 3PIOA 3GIRA 3F8TA 2OTLB 4XXEA 4F7DA 1DONA 2BF4A 1GUNA 2XRQD 5IYCH 2VQFL 5JAVA 2QDBA 3TP6A 1B2TA 2C4TA 2ZZEA 5E3FA 3QFCA 1VMCA 4X66Q 1EWYA 4TT3A 2H4OA 3W2DA 1TVCA 1NAPA 1D1NA 2JA8G 1VQFA 4OHJA 4AYBB 4HIMA 3HOUG 3HOYH 5JJZA 4KY6A 1UE6A 3HOXG 3CHBD 4NKLA 1TT2A 1W2BB 2ES2A 1B3AA 4QCLA 1LTAD 1IBKQ 4QVAA 4IOCA 3TRZA 2ZTNA 4YHBA 3GV3A 1DD2A 3UI2A 1TS4A 5K36G 1SNMA 1VQIA 3A8IE 4ROXA 1G91A 1HXYD 3ISXA 2D74A 4G1BA 3B8HA 1DOMA 2ZTEA 1SMYD 3BYYB 1PRTC 4RGTA 3U58A 5M5XH 3CC7A 2HDMA 3D4WA 5EAYA 4GN5A 2K5DA 4UZFA 4ACBA 1KZLA 1NDHA 2EYOA 4KD3A 4BY7B 4P3IA 5I6YA 2N8NA 5LMNW 4BBSH 3KOJA 4LWCA 2ZZFA 2JIZA 2DNEA 3OJXA 1GOZA 2Q8RE 1E62A 1Q8IA 1NMFA 1EP1B 3GD7A 3FJOA 3RR5A 4ZCMA 3BVMA 1EYDA 1RKNA 2B2YA 3PSIA 1PV4A 3CMEB 4DFAA 4BBRB 2DEUA 2UUCQ 2AUJD 3QOLA 1Y1VB 1R9TB 3A8JA 4A3EG 1NR2A 1Y8OB 2JA5B 4DR4Q 3NUCA 2F0JA 1K83B 2PQAB 1TS5A 2EXZA 2XNAC 2E2IB 4Z1MA 2KHIA 3CPWB 2HCJB 4N9PA 5IT9E 4JCVE 1F20A 3MA2B 4WJ4A 3K7AB 4UP9A 2ZXHA 1PTOH 1ELOA 4RWSC 3I91A 3M7GA 1YX2A 1VS0A 4DV2Q 1R5OA 4AF6A 1OXVA 3RZDB 1EOVA 1AFPA 1SN8A 4DK6C 3ES9A 2RBMA 1V1PB 4AC9A 4M8AA 2JJ1A 1BCPF 2PMZE 4H02A 1FGBD 4DV5L 3HOYG 2EJGC 1U9RA 2PNRC 3S17H 3S15B 3PIP3 4APVA 3L7ZC 1IW7D 5F4OA 1DCZA 1LV9A 1P8LA 3H15A 1Y14B 3CCRA 1Z47A 5IYBH 1K8GA 2V7WA 1WJJA 5J1ZA 1WU8A 2JQOA 2M00A 1N08A 2EYPA 2F3VA 3CCLB 5ELOA 4QFMA 4C3IB 3MVVA 2GREA 5EKIA 5HGQA 2ZXRA 2F0DA 1VQ5A 3E6ZX 1IBMQ 1JE4A 1JA0A 1I7PA 2CBXA 3TQYA 2VL6A 4ZGQB 1Q82D 4DR2Q 1N8RD 2W6IA 4G7HC 3H6MA 2IWHA 2ZTCA 3VR4A 3H3VH 2XNDA 4YAUA 5C4JB 4IUNA 1JC7A 1C8CA 4X3TA 1V0EA 3HFZB 1GR1A 1YJNB 4YY3L 5L46A 1DJRD 2IX0A 4PNYA 4R8NA 2KCTA 5CORA 3T1HQ 1SYDA 2LXJA 3R2TA 3Q24A 1BCPD 4XNFA 3AVXA 2CW0D 2PYKA 3ERQA 5C5MA 2L11A 1G2TA 2PZUA 1O80A 1VQ4A 1IBLQ 1R4PB 2BGJA 2K5WA 2V1CC 5COYA 1U2RA 2QDLA 1XNRL 4KI0A 3M4PA 4JI3Q 3VMFA 2VBTA 1MHWC 4CDDC 2DUDA 1H9SB 4I65A 1EWIA 4QY7A 4HE6A 1IKMA 4X6AH 5C4JH 2F4IA 5M3FH 2KVOA 2ZXIA 1M1KC 2JA7G 2J0TD 2ZM6Q 1GUTA 3SXHA 1S5ED 1ASYA 3I4OA 2Q2UA 4EQOA 4L5SA 3R93A 2A6ED 3X3MA 1IHMA 2OQKA 2BGIA 4XN0A 1HUMA 2G9DA 1QNKA 2OQ0A 4A3CG 2D2CC 1QJOA 1XX8A 3QSYA 4DAPA 4ZKCB 1YLOA 4DQKA 4DR7Q 3PUVA 3GTQB 1BR9A 3K8AA 1B53A 3FKIB 1VJSA 1G7TA 1DGSA 1E22A 2XN9C 5FO0A 3IL8A 5H59A 4KKSA 2A73B 3WNDA 5T1GA 1MJEA 1XMQL 4Z4RA 4BBRG 1I3QB 2JA6B 2CW5A 5C6AA 4GNXB 2ASBA 4WJ3M 3FRPB 5C3XA 2K4KA 1VQKA 4WZTA 3OIQA 4NDXA 4X3KA 1CUKA 1QNUA 4GLAC 1NB0A 2PCFB 3JAML 1EFWA 5C44G 1S5BD 5AJ3L 4ZYSA 2BN4A 2F3WA 1IHZA 4BWGB 4DV0Q 2V7QA 2WR8A 2I5MX 2N88A 3J81E 1DG1G 1TY0A 4G7XA 1ZUNB 1JOOA 3K5LA 2A5HA 3M3YH 1R4QB 4K5WA 2LZJA 2VW9A 2O5JC 2WAQG 2Q6KA 3I55A 1S40A 2PLFA 4Y9RA 1VQNA 1ZEQX 1KAAA 5KNLA 4LMQD 1C48A 4WFN3 5IGGA 3IFTA 3ASSA 5GADC 3VNVA 2D9RA 2E2IH 4OWWB 1HNWQ 1EFUA 3KJPA 2E1RA 2NN6I 4JYAL 4PABA 3U6BA 4UAIA 1V43A 1T5EA 4RCNA 2WKCA 5IYPA 1VQDA 1Q81D 2JE6I 1UWVA 2GN5A 3NEMA 1PVOA 1EU3A 3CD6B 2ZJQA 1LTSD 1X55A 1D6EC 1ZYRD 1MKHA 1XQBA 2J7ZA 2ICIA 3HOWB 2WZPP 4OXPA 3OE7A 1EYGA 2K5VA 3HRZC 1VQ6B 1DOKA 3H3VC 2SNSA 1VQLB 2QTLA 1V5VA 3WBJA 3G6EB 1V1QA 2PNHA 3HOVB 1XNQL 3D8GA 3ICEA 3S16H 5ELDA 4BBSB 1A3VA 4YWLA 5E1FA 2NYZD 1OXTA 1J6QA 4XT3B 1COWA 4RDLA 1D2BA 1J9OA 5DN6A 2JA9A 3GVKA 4GNXA 4DV4L 4N3GA 3BZKA 4BY1G 4H9GA 1SRUA 3LX0A 4DK3C 2OK7A 1S4ZA 2B7BA 1PH2A 1STHA 1EZ8A 2DOGA 1CT1D 1LYLA 1WD1A 1PJ7A 3IFDA 4LFBQ 3ZZUA 5M5XB 3Q6RA 4QF4A 5M5WH 2DIEA 1TTTA 4WZEA 5JJLA 1X3FA 2ALYB 3D31A 3PA2A 1MIUA 1L0YB 2LKVA 2WSSA 2B63B 2XVSA 1YZ6A 1CSPA 5KSWB 2DJGC 3DM1A 3Q6QA 2R9VA 4MIUA 3NQTA 1H8EA 2WB1G 5JJKA 4UPAA 2XZOA 1SE3A 4GOPB 1K73D 3A7LA 4PAAA 1CHQD 2NVTH 3K81C 1OB5A 5CV9A 3EN2A 5G3LD 4V190 1EEFD 3CCQA 3CF5A 1YEZA 2A1AA 4II2A 1MSGA 2IT1A 5I4DA 1KJZA 2IJ0A 3PUXA 3RMHA 1B4OA 2E74C 3Q38A 1XPRA 2D9UA 3N6RA 1H9JA 3QB3A 1MABA 1GHJA 5F4JA 1I18A 1SNOA 1ZM3A 5DM73 1HA3A 3NWSA 2LFNA 4ZRZA 1H9KA 3KLWA 4K8IA 1VQ7A 1GUWA 1SFOB 4QHYA 4OPSA 4FDBA 1RQRA 2MQHA 3SK8A 3OMGA 4OIKA 3TP8A 3H0GG 4TN1A 3BDLA 1W6KA 4XKVA 2Q8TA 1KRSA 2KCCA 3ERSX 3CMAB 1B8AA 1S72A 3I72A 4XN3A 4XR6A 3J80c 4S3SA 2L9HA 4PZ8A 3ASQA 5FNZA 2LSSA 4ILWA 3VR2A 1UD4A 2KCNA 4YWMA 4HJAA 4CDFC 3S1RB 3ND9A 3S1MB 4KHPL 1B9MA 1RQPA 1ET6A 3S9WA 2X6XA 4HJ9A 2NVTB 2K05A 4DR1L 1D8LA 3GVJA 3S2DH 4G4KA 3HOZB 1C9OA 1JB9A 1I4XA 5TY0A 4WJWA 2JJQA 2JXMB 4F7XA 4DV2L 5ISRA 4NP5A 4RM0A 4R4OA 2AUKA 3QFRA 3L9AX 4EVOA 3WNBA 2WB1E 3OW7A 2HHHL 3C3LA 2X6GA 2CQAA 2NTTA 5LMZA 4A3FH 4K14A 3Q8DA 4HJ8A 2QN6A 3PO3B 1ZKOA 3PUNA 2RHQB 5IODA 1EFRA 2GVBA 1CQXA 4YHHL 2K1BA 1EYAA 1EY7A 1U4MA 5BR8L 1RD9D 3CESA 1YNJC 3CCQB 5M3MG 5T1IA 1QUQA 5GAEC 2WYRA 5EBCA 3ASRA 3VYUA
chains in the Genus database with same CATH topology
3P20A 4XYQA 2F0QA 1S5CD 4GQNA 5J22A 3EFXD 1F2ZA 1L0XB 1XYIA 3FPPA 2BDOA 5ELBA 4WRDA 5EBDA 1KDAA 2Z8LA 5M3MB 1TQOA 2K03A 2KOLA 1H8HA 2KECA 1OB0A 3I4MB 2EJMA 2QEJC 3HKZB 2CK3A 1TWFB 5DAUA 4PQXA 1EWCA 5IGCA 1E2ZA 5DNFA 1XTCD 4C3HG 3BCFA 2IPKD 2KHSA 4MHEA 5CV7A 3VYRA 4CJ0B 3DEOA 4KV6A 1Q90A 3M3YB 2NBFA 4K6DA 1PZJD 4A3EB 1EL0A 2RDHA 5EJWA 3J7AF 2CW0C 1VCIA 3S14B 4ZUJA 3E5SA 2C9OA 4ME5A 1FX0A 2QILA 4Y7NB 4TKOB 3T13A 1A15A 1VF5C 2ZXOA 1IKLA 4A3JB 1OXUA 1GXDC 1KMHA 3U9OA 1EY9A 3T56B 1TS2A 3C2PA 4ZK9B 2AQ1B 4HIZA 2MP1A 1EWHA 4ZQ3A 1F2MA 2EYHA 2L5TA 1WTWA 1ILPA 4FYDA 2OF1A 4XIGS 3EVQA 1QG7A 1KLGD 4K8JA 1LO5D 1UD6A 1QE6A 2F0TA 3TBIB 2A68C 2A68D 2JEBI 2PO4A 4O1NA 3A54A 3SK5A 1RHPA 3D3RA 1Y8PB 2I07B 2FJ2A 3ITPA 1MSHA 1EY4A 1DZ1A 3H0GB 3PIO3 1V8QA 4J6HA 1NCVA 5JEAJ 1LABA 2B8GA 1LTID 4B9XA 1O7LA 1SYEA 1DXMA 5KNBA 4DXFA 3QJYA 4C3HB 2B2VC 2F0EA 1SE4A 2WIIB 4FXKC 1HFNA 3HG9A 2VB2X 3K59A 1F9PA 1AP0A 4A3BB 5C0XJ 4Q5VA 3G6JB 4XORA 1II3A 3S1RB 3LNNA 2NUCA 2Q8IB 5JVG3 4TRDA 3NWTA 1WPCA 2RDFA 4XYOA 2RQXA 1EU4A 3N52A 1SMYC 4QUFA 2BA0A 5C4HA 3T16A 2R3ZA 2GJKA 2XIWA 3NXWA 5CMDA 4A3MB 3S1NB 1B9NA 1CM9A 4H7BA 2K33A 1EOTA 2KEEA 1SE2A 1PLFA 4KKUA 2BA1A 3MTSA 2D62A 2EOTA 3NTKA 1F9QA 4O42A 3M7NA 1F77A 4BA2I 1E79A 1CZWA 1KDCA 5FLXE 4DF7A 2WP8J 4H13C 2QCPX 3F2UA 3Q6SA 2GJPA 5CR3A 5EGTA 2D3LA 5TSSA 5G3LF 1W0JA 2K04A 1FR3A 1LACA 1NSNS 4IUTA 1B44D 4KTAA 2HDLA 2KVMA 3D6CA 1JR0D 3WDNA 4JBWA 3SEBA 1D5XC 5CV4A 5C3WA 5LL6X 4R9WA 4DK1A 4QMGA 1CHPD 4TQUS 4XQNA 2X85A 4EQPA 4P22A 3CU7A 3M4OB 4CJ1B 3KBXA 1HQMC 4NW2A 5KNCA 4BY1B 2MPMA 1TWAB 1WP6A 2D5DA 5I6WA 2X6LA 3CMMA 1DM0B 1F9RA 2BOSA 1RTNA 4K5VA 2LY7A 1E2WA 5I2XA 1LTTD 2F0NA 5NUCA 1MGSA 3EJIA 4K2KA 2R93B 1IYUA 2JA7B 1SSOA 1PRTB 3I73A 3VYTA 3A8JE 4RFBA 3Q0AA 2B2WA 2ZZQA 3P75A 2D3NA 1LLRD 3RLFA 1W0KA 5M5YB 1TVXA 1SJHD 2IL8A 1DOLA 1CFMA 5IIFA 3SVMA 2WJYA 2NB0A 1VF7A 4CGYB 5E4XA 4HSPA 3BH4A 4XOTA 3W3AA 5IGEA 2F43A 4DAYA 1AW7A 1FD7D 4OIJA 1BLIA 1KTKA 2EY5A 1BDOA 2R7ZB 1ONLA 4R8IA 4X3UA 1STNA 5EPJA 1NUCA 2CVRA 1O7YA 1HPCA 2EYLA 3DMUA 3MXPA 3G7LA 4KJOA 2AWNA 2RA4A 1G8ZD 3A55A 3OPOA 2BCOA 3TP5A 1JOQA 2ZTGA 1RCVD 3T51B 2NN6H 1A2UA 4KD4A 4PV1C 1V1OA 1EEID 4HTHA 3CP2A 2B2WC 2MHVA 4PMBA 2NVQB 4N9TA 1YNJD 1WTQA 1SNCA 1SEBD 2VB3X 2ENBA 2ZXPA 4HMIA 1I4PA 2MJ8A 4KJNA 2EYFA 1TWHB 1X32A 1RJTA 2XGJA 4XQQA 2BE5C 2F0MA 5HGTA 2XWJB 5FKAC 4FVMA 4RKBA 1SYBA 4HR7B 1PKVA 2RVLA 2YYZA 1UUPA 3PUYA 2FMCA 3GV6A 3GTKB 3DWAA 3PV0A 4RCOA 5C4XB 1ENCA 5C0XG 4KMUC 4DXGA 3T53B 4RKLA 3EQLC 1ESRA 4LJZC 1B50A 1OO9B 4XMYA 1NRKA 4JK1C 3LWEA 3PMFA 4C1NK 1SNPA 4OL7A 5EQ0A 1TR5A 3S17B 5HKKA 1PTOB 4A3FB 5FOBB 3K0YA 4HEDA 4E6IA 1BCPC 1JICA 3P7JA 4K5XA 2E75C 5JEAH 4A93B 3HAGA 5IT9L 2O2LD 1JOKA 3A3GA 2VNUD 1WVLA 2NWGA 3HP3A 4U673 1I4GA 2A69D 3ONAB 1W6JA 3GTLB 5FO7B 1RF2D 1SJED 4BA1I 5CC4A 1XXGA 2WPDA 1CQFA 4A3KB 1EQVA 4IUQA 3TP7A 3I4LA 4Z9CB 1UAPA 2V31A 2KUMA 1QILA 4F88A 3J81L 5BN3A 1E3XA 5FLXL 4RHRA 1SXTA 1ZYRC 2HUGA 4DGZA 3NHHA 5EKKA 2GK7A 3L3OC 4MN3A 3JAME 2B2VA 1S5FD 1HQRD 1E1RA 5CBAE 3DHQA 1AZQA 5HURA 1JQYD 3DWPA 5D3DA 1QB5D 1JWUD 2EE1A 5C5LA 1SYCA 3KUPA 4KKTA 1D5MC 2M9VA 1HUNA 2Z4HA 3BDOA 3I3CA 2K28A 4L8JA 3OEHA 2SOBA 2F0HA 3ND8A 5BN5A 1M4VA 4RHSA 4C56C 1UD2A 2V4DA 4GZYC 4KY7A 4C1NI 2FINB 2B2UC 5M9OA 1MBYA 1W9XA 2VXWA 2M5SA 2G9HD 2AWOA 3J80L 3I90A 3OSOA 4IUPA 3AB9A 4XDXA 4RGNA 2A6EC 2ICEC 2A74C 1Q1BA 1HRJA 1TWGB 1IL8A 4YIJA 3CRLC 1FNVA 4HCEA 3DDYA 2XWBB 1STYA 4HN7A 2OT2A 3OIPA 1V1PA 1T5XD 1EQTA 5KRUA 2OXPA 3OWEB 2AQ2B 1H9MA 1I4RA 4IQZA 3TN2A 1X3QA 3MFGA 1QCBD 2GK6A 4FF3A 4JMQA 1B1ZA 2PW7A 1E1QA 2SEBD 1CQVA 4ZUIA 2JA8B 3T4AC 3K5MA 5EPLA 1GUOA 1MD2D 2AQ3B 1WTPA 3C46A 1BMFA 1OXXK 3NSWA 1SKYB 4XLFA 3VYSA 1SDFA 1GHKA 3FKSA 4A3GB 4XM3A 1IW7C 4L6TB 4FP5D 3DUZA 3EA6A 3LWUA 2XZPA 4XONA 1G2SA 3Q23A 2KQ3A 2K5QA 3S1QB 1GUSA 1TS3A 1H9SA 3BCDA 4DNTB 1PZID 5C44B 2EYJA 2MGSA 3SK4A 4KY5A 3TMEA 2QF7A 1CK1A 3RZOB 4EGVA 1RDPD 5JPMC 1EY5A 1VDZA 3I70A 2JYOA 2X53S 3NP8A 2JDIA 3D4RA 1NBMA 1Z6HA 5EPKA 4A3DB 4ZAIA 3TSSA 1VMPA 3K58A 2F0GA 3GTJB 1EY0A 1F2LA 4XL9A 2K6AA 3BDCA 4XT1B 2EPBA 4FF2A 1XWEA 3D6WA 4H44C 3MXUA 3HOXB 2F0SA 2F0KA 3S15B 1AN8A 2E1BA 2WJVA 4B3FX 3C1FA 5I9PA 4XLAA 1H9RA 2O5IC 5KNDA 1LT5D 1F2YA 2FHTA 3MWYW 4WORA 4K6LA 1Z7TA 1Y1WB 1U4RA 5D14A 1K28D 1PMRA 2Z4IA 1Y8NB 4KN7C 3RD4A 4IUUA 3U9SA 3V96A 5JPNC 2X6WA 3A7AB 2X8KA 4V0BA 1JWMD 1CZGA 5EKLA 5A2QL 3NTIA 3SDZA 5A2QE 2TMPA 2B2TC 4IALA 1K8OA 2EJFC 1HTLD 2RSNA 1UD5A 1PFNA 3WOFA 1KNAA 4XLHA 5IGFA 3IKJA 4YELA 2F0UA 1WTXA 1V0FA 3QOJA 4DAVA 2Z1CA 1A2TA 5A35A 3OHXC 3OAAA 1KLUD 3KLSA 3NQIA 5LHY1 3H91A 4CBVA 5KIXA 4ULLA 2L0CA 2EDGA 2QE7A 2M2LA 3KLSX 3A56A 4IFDG 4Q0FA 2PQEA 4HSVA 1FNUA 2NZ1D 3A3BA 5KGUA 3S2DB 1S5DD 2F0VA 2I46A 1EYCA 3V05A 1C4QA 2F0IA 5ELEA 2R6GA 3HEJA 2JSOA 1CA6A 1KDBA 1STAA 1JB3A 4TSFA 1STEA 3K57A 4IN3A 2VJJA 2EYMA 2XSCA 5ELFA 3GO5A 1VLYA 4YEJA 1UNSA 4G6IA 4XQJA 3H94A 2F03A 3NTHA 4OO1I 2L12A 5CV8A 4AVZA 2OEOA 2LMCB 1EY8A 3TZDA 3VR3A 1BUVT 4XQFA 1I6HB 1JCKB 4ZKBB 2RSOA 3X3NA 2IW3A 1TIID 1PYWD 1Q1EA 2B39A 2PW5A 3NE5B 4C2MB 2DY7A 2RDGA 1HTPA 1A3TA 3C1EA 1F9SA 1EIHA 3DEPA 1JORA 2K01A 1SBBB 2N55A 4CKEA 1EFID 5I2YA 2J4XA 3HZXA 3DWQA 4DU9A 3FPUB 1BOSA 4FNFA 1HZEA 1U4PA 2TSSA 3FDTA 3J7AV 1NR4A 2EY1A 3OWFA 2WV6D 3MAQA 1G291 3BG3A 1ENAA 3SHLA 5LL6S 2ID0A 2IX3A 1SNDA 3K5OA 4TSSA 1TWCB 3IAYA 2EY2A 4OGQC 1O7ZA 4DA2A 2GA4B 4UZUA 4HAEA 4J1MA 4FXDA 3SE0A 1ET9A 3VA7A 4QUCA 2SDFA 1PTOD 5C0XH 2F0LA 3NK9A 3OOCA 4HMJA 4FF1A 3URYA 2QKIC 1I8DA 1WCMB 4DNRB 3GVLA 3PO2B 1FYCA 1BNZA 2YU9B 1BF4A 5D65A 3Q22A 4XTCS 2B2YC 5IGBA 3VR6A 5M3FB 3CRKC 4IZ8A 4DN4M 2NVYB 1ESFA 4CHTB 4J8QA 1MI2A 4X3SA 2WAQB 5ELCA 3ZIAA 2A6HD 1Y69U 4KHZA 4H0LC 2A6HC 3ZYYX 2K7VA 4II3A 1PFBA 1ICWA 4B9WA 2NTSA 3S2HB 5DM63 2NN6G 2HCIA 4RGOS 3KK7A 1EZ6A 1BPLA 1K8MA 3P1HA 1STBA 4CKCA 2C5CA 1HCZA 4FXUA 2BDNA 4E0FA 4IURA 1WD0A 1BCPB 4A3IB 3GTPB 1YNND 3D4DA 5IOCA 2F0WA 1PFMA 4C3IG 3RUZA 1HA6A 2FFKB 2HQEA 5AFWA 1RTOA 3PUZA 3GP7A 5K36H 5CDFA 1PRTF 5FL7A 4XD7A 5FO9B 2CHBD 4RAUC 3OEEA 1CI3M 2X69A 4L63B 1I4HA 2R92B 2E76C 3E0JA 5I9OA 1ILQA 3QG1A 2FMMA 5M5WB 1WTOA 1D1KA 4F8MA 5CV5A 2W6JA 1QOHA 2JEAI 4KK7A 5F2DA 4CJ2C 4B3GA 1YNNC 2L55A 4G57A 4CKBA 5J39A 1BO0A 4C3JG 3HGBA 4KN4C 4HCSA 3K6OA 1BXTA 1WTVA 3HS0C 2HLDA 3K5NA 1PRTD 3NPPA 1LTBD 2KA7A 1I50B 3QWNA 4QB4A 2A69C 4FO2A 5CGKA 2Z6BD 3GTMB 2H1EA 3AU7A 4G7OC 4IFDI 4FXGC 2ZZGA 1U4LA 2DY8A 1UD8A 3EROA 3HOYB 3O13A 1GJXA 1WTHD 2XRSD 1BBXC 2B8FA 4I7ZC 3MEHA 4K2LA 5KYLA 2XOKA 3GTGB 2NVXB 4LK1C 4RA8A 2X6YA 1E43A 2B2UA 2HCCA 4XLCA 1STGA 1LT4D 1UEAB 3S16B 3A35A 3NBHA 4F87A 1EY6A 1OHHA 2XZLA 1X3PA 5KYIA 4C3JB 3DXJC 2RKSA 3CQZB 2VUMB 1A6XA 3SK6A 2BE5D 1JWSD 1PTOC 1EIGA 3A8KE 3MC0B 3NBIA 4ABNA 2F0PA 3QO2A 4DK0A 1GUGA 4LAAA 5FK9C 3R3OA 5D3IB 1J8IA 1KNEA 2KJXA 4PMWA 1SNQA 4RGMA 3CKIB 2R61A 1D1IA 2GJRA 4ODGA 1TKWB 2WKDA 3H09A 1TY2A 1E2VA 1LTGD 3J7YW 4P2CB 1LTRD 3BVGA 3AMUA 2EVBA 5K5PA 3FVQA 1A3UA 1BQQT 5JEAG 2ZT9C 3KF8A 3KEWA 2B2TA 4KHVA 1M8AA 1LT3D 3BS1A 5KEEA 4ZLTF 1WTRA 3BVZA 2L1BA 2O4XA 4G7WA 1PTOF 1LT6D 4YXWA 3MXNA 4B08A 1O78A 2VJIA 3CP8A 1AEXA 1CA5A 5IGDA 3MXGA 4IFDH 4EQNA 1SYFA 3KLRA 3MZ5A 3WQZA 1HHVA 1RODA 5C3EB 4OO1H 1Q12A 2KEDA 1DYQA 4ID6A 3R2IA 5IK2A 1CTMA 3WOEA 3VR5A 5C4ZA 5JVH3 3M4YA 4M1UB 1KABA 5BN4A 3G05A 2F0FA 1Q3LA 2F0OA 4XKWA 3JU4A 3GTOB 3VA5A 1ML0D 1PDQA 2IX1A 2E2DC 2PZWA 5JOBA 3FMCA 2LS01 1SYGA 3QIAA 4QIWB 3HOUB 1FNWA 3MFYA 3ZPNA 3BC9A 4XLEA 2Y0SB 3I8ZA 3GQBA 2PMZB 1HA5A 1IYVA 3FEWX 1I6VC 1OXSC 5DEHA 2JJ2A 4XOPA 1AZPA 2SNMA 4UDUC 4U68A 5FO8B 2F1MA 3BYTB 3MHBA 2WINB 1HFGA 5C0XI 2E2JB 3KBGA 2PPBC 1ZXTA 1I4QA 5CV6A 3BZDB 2WACA 4BS9A 4PMCA 2PZTA 1SAPA 3M85A 4OO1G 3SR1A 2MUYA 3I4NB 2JP1A 3OFNA 4RH6A 1G6ZA 4G7ZC 1QWYA 2WB1B 3V2TA 3TDQA 2K32A 1HVXA 2E2HB 4NNJA 1ENFA 1UD3A 4FF4A 2DN8A 3OMCA 5CBEE 3J80E 2EY6A 1D5ZC 2EZVA 1E3ZA 4NMZA 2L4NA 5E4WC 4IUVA 4IFDJ 1E0BA 3PUWA 1TU2B 4ASUA 2DNCA 5CYUA 3TZUA 3R8BA 1PXUA 1PZKD 4XXEA 1DONA 1GUNA 2XRQD 5JAVA 2QDBA 3TP6A 1B2TA 2ZZEA 5E3FA 1VMCA 4TT3A 2H4OA 3W2DA 1NAPA 4OHJA 4AYBB 5JJZA 4KY6A 3CHBD 4NKLA 1TT2A 4QCLA 1B3AA 1LTAD 2ZTNA 3GV3A 1DD2A 3UI2A 1TS4A 5K36G 1SNMA 3A8IE 1G91A 1HXYD 1DOMA 3BYYB 1SMYD 4RGTA 1PRTC 2HDMA 3D4WA 2K5DA 1KZLA 2EYOA 4KD3A 4BY7B 5I6YA 2ZZFA 2JIZA 2DNEA 1GOZA 2Q8RE 1Q8IA 3GD7A 3BVMA 1EYDA 1RKNA 2B2YA 4DFAA 4BBRB 2AUJD 3QOLA 1Y1VB 1R9TB 1NR2A 1Y8OB 2JA5B 3NUCA 2F0JA 1K83B 1TS5A 2EXZA 2XNAC 2E2IB 4Z1MA 4N9PA 5IT9E 3MA2B 3K7AB 2ZXHA 1PTOH 4RWSC 3I91A 3M7GA 1OXVA 3RZDB 1AFPA 2RBMA 1V1PB 4M8AA 2JJ1A 1BCPF 1FGBD 2EJGC 1U9RA 2PNRC 3PIP3 3L7ZC 1IW7D 1DCZA 1LV9A 1Z47A 5J1ZA 2M00A 2EYPA 2F3VA 4C3IB 3MVVA 5EKIA 2ZXRA 2F0DA 3E6ZX 1JE4A 2W6IA 4G7HC 3H6MA 2IWHA 3VR4A 2XNDA 5C4JB 4IUNA 1JC7A 1C8CA 4X3TA 1V0EA 1DJRD 2IX0A 5CORA 4PNYA 4R8NA 1SYDA 3R2TA 3Q24A 1BCPD 4XNFA 2PYKA 2CW0D 3ERQA 5C5MA 2L11A 1G2TA 2PZUA 1O80A 1R4PB 2K5WA 5COYA 4KI0A 1H9SB 4I65A 1IKMA 2F4IA 2KVOA 2ZXIA 2J0TD 1GUTA 3SXHA 1S5ED 4EQOA 3R93A 2A6ED 3X3MA 4XN0A 1HUMA 2G9DA 1QNKA 2D2CC 1QJOA 1XX8A 4DAPA 4ZKCB 3PUVA 3GTQB 1BR9A 1B53A 3FKIB 1VJSA 2XN9C 3IL8A 4KKSA 2A73B 5T1GA 1I3QB 2JA6B 5C6AA 3FRPB 5C3XA 3OIQA 4NDXA 4X3KA 1QNUA 2PCFB 3JAML 1S5BD 4ZYSA 2F3WA 1IHZA 4BWGB 2V7QA 3J81E 2N88A 1TY0A 4G7XA 1JOOA 3K5LA 2A5HA 1R4QB 4K5WA 2LZJA 2O5JC 1ZEQX 1KAAA 5KNLA 4LMQD 1C48A 4WFN3 5IGGA 3IFTA 2NN6I 4UAIA 1V43A 1T5EA 4RCNA 2WKCA 2JE6I 1EU3A 1LTSD 1D6EC 1ZYRD 2J7ZA 2ICIA 3HOWB 2WZPP 3OE7A 3HRZC 1DOKA 3H3VC 2SNSA 3HOVB 3D8GA 5ELDA 4BBSB 1A3VA 5E1FA 2NYZD 1OXTA 4XT3B 1COWA 1D2BA 1J9OA 5DN6A 3GVKA 3LX0A 1S4ZA 1STHA 1EZ8A 1WD1A 1CT1D 3IFDA 5M5XB 4QF4A 2DIEA 3D31A 1L0YB 2LKVA 2WSSA 2B63B 2XVSA 3DM1A 2R9VA 4MIUA 3NQTA 1H8EA 2XZOA 1SE3A 3A7LA 1CHQD 5CV9A 5G3LD 4V190 1EEFD 5I4DA 4II2A 1MSGA 2IT1A 2IJ0A 3PUXA 3RMHA 1B4OA 2E74C 2D9UA 3N6RA 1H9JA 3QB3A 1MABA 1GHJA 1I18A 1SNOA 5DM73 3NWSA 2LFNA 4ZRZA 1H9KA 4K8IA 1GUWA 1SFOB 3SK8A 3OMGA 4OIKA 3TP8A 3BDLA 1W6KA 4XKVA 2Q8TA 2KCCA 3I72A 4XN3A 4XR6A 4S3SA 2L9HA 4ILWA 3VR2A 1UD4A 2KCNA 3ND9A 3S1MB 1B9MA 1ET6A 3S9WA 2X6XA 2NVTB 2K05A 3GVJA 4G4KA 3HOZB 1I4XA 4WJWA 2JXMB 4F7XA 5ISRA 4NP5A 2AUKA 3L9AX 4EVOA 3OW7A 3C3LA 2X6GA 2CQAA 2NTTA 4K14A 3PO3B 1ZKOA 5IODA 1EFRA 2K1BA 1EYAA 1EY7A 1U4MA 1RD9D 3CESA 1YNJC 5T1IA 5EBCA 3VYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHZ A;  3HGB A;  3P20 A;  4KN4 C;  2F1M A;  1H9S A;  2A68 C;  2A68 D;  2DNE A;  1H9S B;  2JEB I;  1E2V A;  4H0L C;  3WDN A;  5A35 A;  1HPC A;  4JBW A;  4DNT B;  2PPB C;  2A6H C;  2EVB A;  3GD7 A;  1Y8P B;  2KA7 A;  2QF7 A;  5JEA G;  2AWO A;  2ZT9 C;  2K7V A;  3FPP A;  2A69 C;  2BDO A;  1GUT A;  4DK1 A;  3OPO A;  3D31 A;  4TQU S;  3AB9 A;  2A6E D;  2A6E C;  1VDZ A;  2AUJ D;  2E75 C;  2EDG A;  5JEA H;  4G7O C;  1V8Q A;  1Q1B A;  1Y8O B;  3M85 A;  2D2C C;  1QJO A;  4OO1 G;  4IFD G;  3T51 B;  1LAB A;  2NN6 H;  2B8G A;  3D4R A;  2EJM A;  1Z6H A;  3PUV A;  1O7L A;  2NN6 G;  4PV1 C;  1DXM A;  5KNB A;  4G7Z C;  3A7L A;  1HQM C;  5KNC A;  1K8M A;  4KKS A;  1O78 A;  1GJX A;  3QJY A;  3CRL C;  1G29 1;  2A69 D;  2K32 A;  3BG3 A;  1HCZ A;  2D5D A;  2B8F A;  1E2Z A;  2IT1 A;  3PUX A;  1OXV A;  2DN8 A;  4H44 C;  2E74 C;  4I7Z C;  4BA1 I;  4IFD H;  2PCF B;  2R6G A;  3N6R A;  1H9J A;  3MXU A;  1GHJ A;  4LK1 C;  3KLR A;  4OGQ C;  3LNN A;  2Q8I B;  1H9K A;  1H9M A;  4IQZ A;  2EJG C;  2PNR C;  1Q90 A;  4OO1 H;  1Q12 A;  1E2W A;  1TU2 B;  3L7Z C;  1IW7 D;  3PUW A;  1DCZ A;  2DNC A;  3I4L A;  3TZU A;  1CTM A;  1H9R A;  2KCC A;  3VR5 A;  2O5J C;  2O5I C;  5KND A;  3I72 A;  2CW0 C;  1VCI A;  5BN3 A;  1SMY C;  3M4Y A;  2BA0 A;  3SE0 A;  1IYU A;  1GUN A;  3VA7 A;  3VR2 A;  1Z7T A;  3PUZ A;  5BN4 A;  3I73 A;  1ZYR C;  5K36 H;  3IFT A;  1B9N A;  3H94 A;  1PMR A;  3A8J E;  5C0X H;  4TKO B;  1Y8N B;  4KN7 C;  1VF5 C;  1GUO A;  2K33 A;  3U9S A;  3OOC A;  3ND9 A;  2NN6 I;  3A7A B;  1B9M A;  1CI3 M;  3DXJ C;  4KKU A;  2BA1 A;  3RLF A;  1V43 A;  1OXU A;  1T5E A;  1OXX K;  2BE5 C;  4RCN A;  4DNR B;  2LMC B;  3FMC A;  1A6X A;  2JE6 I;  2BE5 D;  1FYC A;  2E76 C;  3QIA A;  3T56 B;  2JXM B;  3A8K E;  3SDZ A;  3VR3 A;  2D62 A;  4HR7 B;  1CFM A;  4G7H C;  2YYZ A;  2AUK A;  3VR4 A;  3M7N A;  3QG1 A;  4KKT A;  4BA2 I;  2EJF C;  1K8O A;  1VF7 A;  3MFY A;  3PUY A;  4XTC S;  1GHK A;  3OW7 A;  4DK0 A;  1GUG A;  3BDO A;  1EWH A;  4H13 C;  3PV0 A;  1DD2 A;  5K36 G;  1IW7 C;  4L8J A;  3A8I E;  2L5T A;  1ZKO A;  3IKJ A;  3W3A A;  3VR6 A;  5C0X G;  4KMU C;  3T53 B;  3EQL C;  3GQB A;  3CRK C;  1Q1E A;  2JEA I;  3ND8 A;  1IYV A;  1OXT A;  5BN5 A;  3LWU A;  1BDO A;  1I6V C;  3NE5 B;  1OXS C;  4LJZ C;  1YNN C;  4XIG S;  1ONL A;  1YNJ C;  2V4D A;  1FR3 A;  1HTP A;  1LAC A;  1TKW B;  4JK1 C;  4KI0 A;  4GZY C;  2A6H D;  1GUS A;  1Y69 U; 
#chains in the Genus database with same CATH topology
 3P20 A;  4MYU A;  1QVG A;  4XYQ A;  1NBW A;  1VQA A;  2F0Q A;  4B47 A;  1S5C D;  3OP1 A;  2MNA A;  4GQN A;  5J22 A;  3JAM c;  4JW0 A;  5GRO A;  1L0W A;  4DQL A;  3LO8 A;  3PCO B;  1UE1 A;  3EFX D;  3T1H L;  1F2Z A;  1L0X B;  4B3S L;  1P16 A;  2IY5 B;  3BY1 A;  3WXM A;  2DYI A;  1CNE A;  1I3Q H;  2C4U A;  1QUF A;  1XYI A;  1IYJ B;  3FPP A;  2BDO A;  5ELB A;  1YVC A;  4WRD A;  5EBD A;  1KDA A;  2Z8L A;  1Q7Y D;  5M3M B;  1TQO A;  3PF5 A;  2K03 A;  1XNR Q;  1T6X A;  4L5Q A;  2KOL A;  1H8H A;  2KEC A;  1OB0 A;  4A3C H;  3ZBT A;  3I4M B;  2EJM A;  4ACA A;  2QEJ C;  3HKZ B;  4P25 A;  2CK3 A;  1EIY B;  1TWF B;  5DAU A;  3A5Z B;  4PQX A;  3AVT A;  1Y0Y A;  4Y7N H;  4GKK L;  2YWH A;  1VQH A;  2QEX B;  2K5H A;  4JI0 L;  1EWC A;  5IGC A;  1E2Z A;  3CPW A;  5DNF A;  4IJH A;  1AIP A;  1XTC D;  2VQF Q;  4O0A A;  4C3H G;  3BCF A;  2IPK D;  2KHS A;  4A3L H;  4M4S A;  4CQJ A;  4MHE A;  5CV7 A;  2ATW A;  4EX5 A;  3VYR A;  4CJ0 B;  3DEO A;  4PZ6 A;  4KV6 A;  4WZL A;  2RHS B;  1Q90 A;  2DER A;  1UMK A;  3FP9 A;  3M3Y B;  2NBF A;  4K6D A;  1PZJ D;  4UY8 C;  4A3E B;  5IYN A;  2L15 A;  1EL0 A;  1PH8 A;  2RDH A;  4GNX C;  3KF6 B;  5EJW A;  2NVQ H;  3J7A F;  2CW0 C;  2Y0S E;  1VCI A;  3S14 B;  4ZUJ A;  3CC4 B;  3E5S A;  2C9O A;  2XGT A;  3KDF A;  4ME5 A;  4JI7 L;  1FX0 A;  2QIL A;  4A3F G;  1YIT B;  5LMN L;  3A0J A;  4Y7N B;  1ZM9 A;  1IZ6 A;  1KRH A;  1G7C A;  1EFT A;  4TKO B;  3OKX A;  5J3O A;  4LF9 Q;  1A15 A;  3T13 A;  1VF5 C;  2ZXO A;  2C35 B;  1IKL A;  4A3M G;  4A3J B;  1OXU A;  3E3X A;  1FRQ A;  1BX1 A;  1GXD C;  1NTG A;  1KMH A;  3FKI H;  2RC5 A;  2MO0 A;  3NEN A;  4DR5 Q;  2C78 A;  1FNC A;  3U9O A;  2CCZ A;  1JB7 A;  1EY9 A;  3T56 B;  2JA5 G;  1TS2 A;  3ZZT A;  3C2P A;  2AHO B;  2K75 A;  4ZK9 B;  4HID A;  2AQ1 B;  2Z0S A;  4HIZ A;  3MXN B;  2I5L X;  1EWH A;  2MP1 A;  1T6Z A;  4RPB A;  3CCS A;  4ZQ3 A;  5GAG C;  1F2M A;  2EYH A;  3RZO H;  2OWO A;  2L5T A;  1MJC A;  1WTW A;  1ILP A;  2UUA L;  4FYD A;  4Y7C A;  2OF1 A;  4XIG S;  3ZBU A;  2VBS A;  3EVQ A;  1QG7 A;  3LVB A;  1YHQ B;  2UUB Q;  1BVS A;  2UUC L;  1KLG D;  4R4I A;  4B3M Q;  3CTA A;  1BQE A;  1E1T A;  1YHA A;  4K8J A;  4QL5 A;  1LO5 D;  4A3J G;  1UD6 A;  3CP0 A;  1RIP A;  1QE6 A;  2F0T A;  3EBE A;  3TBI B;  2A68 C;  2A68 D;  1TWC H;  2JEB I;  2PO4 A;  3WY9 A;  1HNW L;  4MTN A;  2VQE Q;  1XNQ Q;  4O1N A;  1VQP A;  3PUM A;  3A54 A;  1RHP A;  3SK5 A;  3D3R A;  1Y8P B;  4LF7 L;  2V7T A;  2RCF A;  1NMG A;  4UP8 A;  3AYH B;  2I07 B;  4RD3 A;  2FJ2 A;  3K7A H;  4R4C A;  5HY6 A;  3ITP A;  2IHF A;  1MSH A;  1EY4 A;  4LF8 L;  1DZ1 A;  1HZC A;  3H0G B;  3PIO 3;  3CQZ H;  1V8Q A;  4J6H A;  5FIU A;  1NCV A;  4LBY A;  2B3G A;  4B43 A;  5JEA J;  5IT9 c;  4UP7 A;  4LF4 L;  1E63 A;  1LAB A;  2Q6I A;  2QTZ A;  2B8G A;  1LTI D;  4B9X A;  3CCU A;  1O7L A;  1TWF H;  1SYE A;  1DXM A;  5KNB A;  3F2B A;  4DXF A;  3J80 i;  3QJY A;  1YNX A;  4X05 A;  4C3H B;  2B2V C;  4DV1 Q;  2F0E A;  1SE4 A;  2WII B;  4P74 A;  4FXK C;  4LFA L;  1JJ2 A;  3HG9 A;  1HFN A;  3STB C;  2VB2 X;  3K59 A;  1F9P A;  1AP0 A;  1A8P A;  4A3B B;  5C0X J;  1T9H A;  4Q5V A;  3G6J B;  4XOR A;  1II3 A;  2OBT A;  1WSR A;  3LNN A;  2NUC A;  2Z9H A;  2Q8I B;  3W2I A;  4TRD A;  2CC2 A;  5JVG 3;  4DR6 L;  3NWT A;  2HD3 A;  4IPC A;  1WPC A;  2RDF A;  4XYO A;  2RQX A;  1EU4 A;  2CKZ B;  3ULL A;  1TUI A;  5DS0 A;  2OTL A;  3N52 A;  1VQ4 B;  3MHP A;  1SMY C;  4RJL A;  2BA0 A;  4QUF A;  5C4H A;  3T16 A;  4IO9 A;  2R3Z A;  2GJK A;  2XIW A;  1EP2 B;  3P26 A;  3NXW A;  5CMD A;  4A3M B;  3S1N B;  3H3V I;  1B9N A;  1ZM4 A;  5JJI A;  1CM9 A;  4H7B A;  2UXC Q;  2K33 A;  2ZBV A;  1EOT A;  2KEE A;  2R7F A;  4BXX H;  3A8K A;  4M1K A;  1SE2 A;  1PLF A;  3W2E A;  4KKU A;  2BA1 A;  3MTS A;  2KEN A;  2D62 A;  2EOT A;  3CCU B;  3NTK A;  1F9Q A;  4O42 A;  3M7N A;  1F77 A;  1Y1V H;  1E79 A;  4BA2 I;  1CZW A;  1KDC A;  5M5Y H;  5FLX E;  4DF7 A;  2WP8 J;  4H13 C;  5A8A A;  4ZCK A;  4C3J H;  1PYB A;  5GV8 A;  2QCP X;  3F2U A;  1HR0 L;  5IE8 A;  3Q6S A;  2GJP A;  1Y1W G;  4QQB X;  1EUJ A;  5CR3 A;  5EGT A;  4QIW E;  1VQ9 A;  2D3L A;  4LNQ A;  1FND A;  4LUO A;  5IYD H;  5TSS A;  4EQ5 A;  3JQP A;  5G3L F;  1W0J A;  4AQY L;  2VBV A;  1BKB A;  2K04 A;  1FR3 A;  1LAC A;  3CAM A;  3JC6 6;  5LMU Q;  1NSN S;  4IUT A;  1B44 D;  1O7I A;  4KTA A;  2HDL A;  1KK1 A;  4GS3 A;  2KVM A;  3D6C A;  1JR0 D;  4PGO A;  3WDN A;  4K0K Q;  4JBW A;  3SEB A;  4RG1 A;  4B4D A;  4LF6 Q;  1D5X C;  5CV4 A;  4POF A;  5C3W A;  2FXQ A;  2E2H H;  4JI2 L;  2Y0S G;  5LL6 X;  3U2Q A;  4P72 A;  4R9W A;  2UXB Q;  4DK1 A;  4QMG A;  1CHP D;  4P9S A;  1SE8 A;  4TQU S;  4XQN A;  2X85 A;  3I55 B;  4EQP A;  2R92 H;  4P22 A;  3CU7 A;  4LUZ A;  4QGU A;  1N36 Q;  4A75 A;  3M4O B;  4CJ1 B;  4R4Q A;  3KBX A;  1X56 A;  1PHJ A;  1EFC A;  1DDI A;  3B78 A;  1QFY A;  1HQM C;  4NW2 A;  5KNC A;  4BY1 B;  2F52 A;  2AMC B;  2K50 A;  2MPM A;  1TWA B;  3F1Z A;  4P2N A;  1WP6 A;  2D5D A;  4IPH A;  5I6W A;  1JT8 A;  1Q46 A;  2X6L A;  1QVC A;  3S1N H;  5J3B A;  3CMM A;  1DM0 B;  1F9R A;  1XPO A;  1HNX Q;  3PQI A;  1VQ7 B;  2BOS A;  1RTN A;  4K5V A;  2LY7 A;  3FHW A;  3SLD A;  5FLM H;  4FK8 A;  1E2W A;  1W3S A;  5I2X A;  4UHV A;  1LTT D;  2F0N A;  1GJR A;  3R6K A;  5NUC A;  3J81 k;  1MGS A;  3EJI A;  4K2K A;  1HNZ Q;  1W34 A;  3BNW A;  1PFS A;  4RLZ A;  2R93 B;  1IYU A;  4A3K H;  2ZL7 A;  2JA7 B;  3CPF A;  1SSO A;  1PRT B;  2PI2 A;  3I73 A;  3HOV H;  3VO1 A;  4A3B H;  4UZE A;  3VYT A;  3A8J E;  3B6Y A;  4PG3 A;  1GD7 A;  4RFB A;  3Q0A A;  4RDJ A;  2B2W A;  2ZZQ A;  1A63 A;  5FJ8 H;  5IP9 G;  2K52 A;  1HJP A;  3P75 A;  2D3N A;  1LLR D;  1V9P A;  3SGI A;  3RLF A;  1M90 D;  4G1V A;  4ALP A;  4X7C A;  1W0K A;  4U9U A;  2NZO A;  5F4M A;  5M5Y B;  4A3K G;  1TVX A;  2C5H A;  2C2W A;  1SJH D;  2IL8 A;  1DOL A;  1VHE A;  2BM1 A;  1CFM A;  5IIF A;  3SVM A;  2WJY A;  2NB0 A;  1K73 C;  1VQB A;  1VF7 A;  2YWF A;  4CGY B;  5C3E G;  1TWH H;  5E4X A;  5FA6 A;  1WOS A;  2UU9 Q;  4Z4Z A;  1I94 Q;  4HSP A;  3BH4 A;  1PJ6 A;  1NY4 A;  4XOT A;  4RMF A;  3W3A A;  5IGE A;  5TV2 A;  2F43 A;  4DAY A;  1AW7 A;  1FD7 D;  4OIJ A;  1BLI A;  1KTK A;  2EY5 A;  1BDO A;  2R7Z B;  1ONL A;  5GQO A;  1QH0 A;  2ZL6 A;  4NB3 A;  4JV5 L;  2NVY H;  4R8I A;  1KC8 C;  4X3U A;  1STN A;  1MRZ A;  4Y52 H;  5EPJ A;  4M53 A;  4JI7 Q;  1NUC A;  5LMN Q;  2CVR A;  5IYD G;  1FJG Q;  1PA6 A;  1O7Y A;  3RLO A;  4LF9 L;  4GN3 B;  4Z4T A;  4ME3 A;  2YWG A;  4NBS A;  1HPC A;  4A3G H;  2EYL A;  2ZJP A;  3DMU A;  3MXP A;  2HQL A;  3G7L A;  4KJO A;  4K0K L;  2AWN A;  3A5U A;  2RA4 A;  4A3I H;  1G8Z D;  2ZTD A;  3A55 A;  2YU9 H;  3OPO A;  4YCV A;  2BCO A;  3J7Z C;  4OOV A;  1QGA A;  1WCM H;  3TP5 A;  1JOQ A;  2ZTG A;  2ZBU A;  1OGI A;  3CXC B;  1RCV D;  1OGJ A;  3T51 B;  2NN6 H;  1A2U A;  3W2H A;  4KD4 A;  4PV1 C;  3Q3A A;  1V1O A;  1VLO A;  1EEI D;  4HTH A;  5IWA Q;  4A3D H;  3CP2 A;  2NV4 A;  4Z4U A;  2B2W C;  4NCN A;  3AQQ A;  2LXK A;  1EXM A;  1G51 A;  2MHV A;  4A3B G;  4A4I A;  3H0G H;  4PMB A;  2VYQ A;  2FX3 A;  2EQS A;  1VQO A;  3U4V A;  2NVQ B;  4B3M L;  3PEN A;  4N9T A;  1YNJ D;  1WTQ A;  1QG0 A;  1SNC A;  3HOZ G;  5FO1 A;  1SEB D;  2B29 A;  4J15 A;  2CRV A;  2VB3 X;  1AMO A;  1A0I A;  2ENB A;  4P73 A;  2ZXP A;  4HMI A;  1Q86 D;  1Q86 C;  1I4P A;  4JI1 L;  2YV5 A;  1B3Q A;  4DV1 L;  1E7Z A;  1IL2 A;  2OBR A;  1VQN B;  5IYB G;  2DGY A;  4LF8 Q;  2MJ8 A;  1CKO A;  4KJN A;  3ZUG A;  3KL9 A;  2I1L A;  2EYF A;  1TWH B;  4GN4 B;  2BMW A;  1X32 A;  4LF4 Q;  1RJT A;  3W2F A;  4LF5 Q;  3BU2 A;  3D26 A;  4ZCL A;  2JA5 H;  2NZH A;  2XGJ A;  4XQQ A;  1A62 A;  2BE5 C;  2F0M A;  5HGT A;  2XWJ B;  5FKA C;  5BR8 Q;  2VUM H;  4BPR A;  4FVM A;  2ZIT A;  1U5K A;  3I4M H;  1XFO A;  4RKB A;  1SYB A;  4HR7 B;  1Y1V G;  1PKV A;  2RVL A;  2YYZ A;  1UUP A;  3PUY A;  2FMC A;  3BJU A;  3GV6 A;  4MZ9 A;  3QFS A;  3GTK B;  3DWA A;  3PV0 A;  4RCO A;  5C4X B;  1ENC A;  1U0L A;  5C0X G;  4TMV A;  4KMU C;  1L1O C;  4DXG A;  3T53 B;  1VQK B;  3CCJ B;  3EQL C;  4RKL A;  4CDC C;  3CMA A;  1ESR A;  5GV7 A;  3M9B A;  4LJZ C;  1E64 A;  1B50 A;  5HZB A;  1M1K D;  2PMD A;  1FDR A;  1OO9 B;  4XMY A;  1NRK A;  4JK1 C;  1ZM2 A;  3LWE A;  1QUE A;  3PMF A;  4C1N K;  3AST A;  1SNP A;  2X3U A;  1KC8 D;  4OL7 A;  5EQ0 A;  3K80 C;  2RF4 A;  4YCU A;  1TR5 A;  1PH4 A;  3S17 B;  1VQP B;  1KD1 D;  2CH4 A;  1N32 Q;  5HKK A;  1PTO B;  1TLL A;  1TWA H;  5DLQ E;  4MTK A;  4A3G G;  4JI0 Q;  3SLN A;  4A3F B;  5FOB B;  3K0Y A;  3TEH B;  1GVH A;  4HED A;  4E6I A;  1LUZ A;  1BCP C;  1JIC A;  1K3B C;  3P7J A;  4K5X A;  2E75 C;  5JEA H;  4A93 B;  5LMU L;  1K83 H;  3HAG A;  2OK8 A;  5IT9 L;  2O2L D;  3W5U A;  4X66 L;  4RCY A;  1WCM G;  1JOK A;  4AYB G;  3A3G A;  2VNU D;  2Z6K A;  4ZGN B;  2F3I A;  2V7V A;  1WVL A;  1N9W A;  3P27 A;  1M90 C;  4AYB E;  4N3N A;  2NWG A;  3HP3 A;  2Q2I A;  4U67 3;  4GKJ L;  1I4G A;  2A69 D;  3ONA B;  1I50 H;  1W6J A;  4JI2 Q;  3GTL B;  5FO7 B;  1RF2 D;  3HOW G;  1SJE D;  1VQ6 A;  4RD6 A;  4AQY Q;  4BA1 I;  5CC4 A;  1XXG A;  2F4V Q;  4X07 A;  2WPD A;  1CQF A;  1G6P A;  1N36 L;  4A3K B;  3QR8 A;  2CND A;  1EQV A;  1IJF A;  3I4N G;  2BSA A;  3ULJ A;  4DR3 L;  4IUQ A;  4B44 A;  3TP7 A;  3I4L A;  4Z9C B;  4DR5 L;  1UAP A;  2V31 A;  2KUM A;  1QIL A;  4F88 A;  3E9H A;  1QVF A;  3J81 L;  5BN3 A;  1E3X A;  5IYW A;  4JPB W;  4R4T A;  4HIK A;  5FLX L;  4C2M H;  4O2D A;  4RHR A;  1SXT A;  1ZYR C;  2HUG A;  4DGZ A;  3NHH A;  5EKK A;  2GK7 A;  3M4Q A;  3L3O C;  4MN3 A;  3JAM E;  2B2V A;  1S5F D;  1HQR D;  1E1R A;  5CBA E;  1X54 A;  4RDK A;  3I2Z A;  4OOX A;  3DHQ A;  1AZQ A;  5HUR A;  1JQY D;  3DWP A;  1K0R A;  1QB5 D;  1JWU D;  2EE1 A;  5D3D A;  2UUB L;  1KL9 A;  5C5L A;  1W2B A;  1KXL A;  1SYC A;  3SJP A;  3KUP A;  4FN5 A;  1CKN A;  4KKT A;  3GDE A;  1JNY A;  1D5M C;  2M9V A;  4GOP A;  1HUN A;  1WOC A;  2Z4H A;  3BDO A;  4JI4 Q;  3I3C A;  2K28 A;  4A76 A;  4L8J A;  3OEH A;  2SOB A;  1H95 A;  2F0H A;  1KHI A;  1QUQ B;  4PC1 A;  1QX4 A;  3ND8 A;  5BN5 A;  1M4V A;  3G48 A;  4RHS A;  4C43 A;  4C56 C;  1N33 Q;  1UD2 A;  2V4D A;  4GZY C;  4KY7 A;  4C1N I;  2EFG A;  2FIN B;  2B2U C;  1WOO A;  5M9O A;  3VO2 A;  1E1O A;  1MBY A;  2UU9 L;  2HDN B;  2BPO A;  1S4M A;  1EP3 B;  1W9X A;  1HZB A;  3CPX A;  2QGQ A;  4JBJ A;  2VXW A;  5DSZ A;  3CC2 B;  1JA1 A;  2M5S A;  4A3I G;  3W5H A;  1N34 Q;  2UXD L;  2D0O A;  2AWO A;  2G9H D;  3J80 L;  1IB0 A;  2K5N A;  3I90 A;  3OSO A;  1PJ5 A;  4IUP A;  3AB9 A;  4XDX A;  2K14 A;  4RGN A;  2A6E C;  2ICE C;  1YJ9 B;  1IBK L;  3GTL H;  2A74 C;  4Y9U A;  3KYH C;  1Q1B A;  1HRJ A;  1TWG B;  1X9N A;  2OTJ A;  2QMU A;  1IL8 A;  2KCM A;  4YIJ A;  2QDX A;  1SR3 A;  3CRL C;  4MYT A;  3RLN A;  3G4S B;  1FNV A;  1K3R A;  4HCE A;  3DDY A;  5GAH C;  1KIX A;  4NXM L;  1VQG A;  4DAY B;  4X7F A;  2XWB B;  2QA4 A;  2KBN A;  3ULP A;  1I5F A;  1STY A;  4HN7 A;  4DPG A;  2JA6 G;  1FJG L;  2OT2 A;  3OIP A;  3IRB A;  1V1P A;  1T5X D;  1EQT A;  5KRU A;  2OXP A;  1OTC A;  2XEX A;  3OWE B;  2AQ2 B;  4YY3 Q;  1H9M A;  1I4R A;  2HIV A;  4IQZ A;  3TN2 A;  1X3Q A;  4OEL B;  3QE2 A;  4PC3 A;  3KDF B;  2VNI A;  1NJI D;  3MFG A;  1HZ9 A;  1QCB D;  2ZL5 A;  3CW2 C;  3KF6 A;  1CKM A;  2GK6 A;  4FF3 A;  4TMW A;  4JMQ A;  1B1Z A;  2PW7 A;  1E1Q A;  2WZN A;  2N49 A;  3KJO A;  2SEB D;  5IP9 H;  1Q82 C;  1N8R C;  1CQV A;  4ZUI A;  3GTK H;  3V76 A;  2JA8 B;  3STB D;  3T4A C;  1S72 B;  3K5M A;  1SM4 A;  5EPL A;  1GUO A;  1MD2 D;  2AQ3 B;  4X7E A;  2YWE A;  1S3O A;  1WTP A;  3C46 A;  3CRZ A;  5IWA L;  5C4X H;  2NPF A;  1BMF A;  3OTO Q;  1OXX K;  2N3S A;  4P1V A;  3K0X A;  4JI1 Q;  3MCA A;  1S0U A;  3NSW A;  1SKY B;  2F1L A;  5H1S E;  3GTO H;  3HOU H;  4XLF A;  3VYS A;  1SDF A;  1PH5 A;  3PA1 A;  1VQO B;  1GHK A;  1KK3 A;  3FKS A;  3AVW A;  4X06 A;  4A3G B;  4XM3 A;  3G4S A;  1IW7 C;  4L6T B;  4OON A;  3SKB A;  2Q2T A;  4FP5 D;  3W1B A;  5EMN A;  3DUZ A;  4LFC L;  4M2L A;  4LUV A;  1X65 A;  3EA6 A;  3LWU A;  2XZP A;  4XON A;  1G2S A;  3Q23 A;  3I1F A;  1YJW B;  3SEJ A;  2KQ3 A;  1SMX A;  5A88 A;  4FWT A;  2K5Q A;  3A74 A;  3S1Q B;  1GUS A;  1TS3 A;  1WFQ A;  4JI8 L;  1H9S A;  4P6V F;  4LF5 L;  3JAM i;  3BCD A;  4YAL A;  4DNT B;  1L1O A;  1L1O B;  1PZI D;  5C3E H;  5C44 B;  2EYJ A;  2MGS A;  2P5Z X;  4KY5 A;  3SK4 A;  2B63 G;  3TME A;  2QF7 A;  1CK1 A;  1IXR A;  1E3P A;  3RZO B;  1FL0 A;  4EGV A;  1RDP D;  5JPM C;  4DR2 L;  3AVU A;  1EY5 A;  1VDZ A;  3I70 A;  2JYO A;  2X53 S;  4LBZ A;  1HNX L;  1VQM B;  4YAF A;  2JDI A;  3NP8 A;  3GTJ H;  2I0Q A;  4EH1 A;  3D4R A;  1NBM A;  1BBU A;  1Z6H A;  5EPK A;  4X65 L;  1PH9 A;  4A3D B;  1N0V C;  1QZG A;  4ZAI A;  4RCZ A;  3TSS A;  1VMP A;  3K58 A;  1K0S A;  2F0G A;  3GTJ B;  1EY0 A;  3AGQ A;  1F2L A;  3G6E A;  4OX9 L;  2RC6 A;  4XL9 A;  2K6A A;  3BDC A;  4XT1 B;  2VS1 A;  2EPB A;  4FF2 A;  1XWE A;  3D6W A;  1KK2 A;  2MFI A;  4H44 C;  1EIF A;  3MXU A;  2D0P A;  1GO3 E;  2XNJ A;  1K9M D;  2OCE A;  2QEX A;  3HOX B;  2F0S A;  2A19 A;  3JQR A;  1WI5 A;  1VQ8 A;  5HXB A;  1WOP A;  1N0U A;  1AN8 A;  2E1B A;  4X7D A;  2F0K A;  2WJV A;  4B3F X;  4Z4W A;  2YTY A;  3C1F A;  5I9P A;  1YIJ A;  2V7U A;  1VQE A;  1N32 L;  3OZW A;  3WNC A;  4XLA A;  1G7R A;  1H9R A;  2O5I C;  5KND A;  1LT5 D;  3CCE B;  1F2Y A;  3F2C A;  2FHT A;  1NE3 A;  3MWY W;  4WOR A;  4K6L A;  1Z7T A;  1Y1W B;  2C77 A;  1GM5 A;  1U4R A;  5D14 A;  1K28 D;  1PMR A;  2Z4I A;  1PH6 A;  2EIF A;  1Y8N B;  4KN7 C;  3RD4 A;  4IUU A;  3U9S A;  4LFB L;  3V96 A;  5JPN C;  2PIA A;  2X6W A;  1JJC B;  3A7A B;  2HT1 A;  1TWG H;  2X8K A;  1WDT A;  4V0B A;  1JWM D;  1CZG A;  5EKL A;  4ZCI A;  5A2Q L;  3NTI A;  2PI2 E;  3SDZ A;  5A2Q E;  2TMP A;  2B2T C;  4ZV4 A;  4IAL A;  2IHE A;  1K8O A;  2EJF C;  5AJ3 Q;  1HTL D;  4MNO A;  2RSN A;  1Q7Y C;  1UD5 A;  4WWV A;  1PFN A;  3WOF A;  3J81 i;  1KNA A;  4XLH A;  5IGF A;  2JA7 H;  3IKJ A;  3SJZ A;  2AKW B;  1YBY A;  4YEL A;  2F0U A;  4RD1 A;  3OJW A;  2B5O A;  2BH2 A;  4BY7 H;  2B7C A;  4B3R Q;  1KQS B;  2CWP A;  4HIO A;  1WTX A;  3UDF A;  1V0F A;  1VQJ A;  3QOJ A;  4DAV A;  2Z1C A;  1A2T A;  2J7K A;  5A35 A;  3OHX C;  4P3Y A;  1N05 A;  3OAA A;  4DUZ Q;  1SKQ A;  1Y0R A;  1KLU D;  4B3T Q;  5IYR A;  3KLS A;  3NQI A;  5LHY 1;  3LQ6 A;  3H91 A;  3UDG A;  4CBV A;  1DAR A;  5KIX A;  1A8V A;  4JG2 A;  4P12 A;  4ULL A;  2L0C A;  2Z6B A;  2EDG A;  2QE7 A;  4QV2 A;  2M2L A;  1KTV A;  2Z6K C;  3A56 A;  3KLS X;  4IFD G;  3M4O H;  5E6T A;  3OW2 A;  4Q0F A;  2PQE A;  4HSV A;  4DV3 L;  4JI4 L;  1FNU A;  2R92 G;  2NZ1 D;  3A3B A;  3HOZ H;  4KHP Q;  5KGU A;  3S2D B;  4P75 A;  3J81 c;  4DR1 Q;  3GTM H;  3NEL A;  1S5D D;  2F0V A;  4J0Q A;  3S1M H;  4TVA B;  2I46 A;  1EYC A;  1XPU A;  1QGZ A;  3V05 A;  1C4Q A;  4AH6 A;  4DV4 Q;  1N33 L;  2F0I A;  2CH4 W;  5ELE A;  4DV6 Q;  2R6G A;  2R93 G;  1R5B A;  2JSO A;  3HEJ A;  4X62 Q;  1CA6 A;  2H5X A;  3GSI A;  1KDB A;  1STA A;  2HHH Q;  1B2R A;  1JB3 A;  4A3D G;  4TSF A;  1STE A;  4Z4V A;  1VQ9 B;  1QZH A;  3OZU A;  3I7F A;  1FGU A;  3K57 A;  4IN3 A;  2VJJ A;  4HE5 A;  1NNX A;  2EYM A;  2R7D A;  2XSC A;  5ELF A;  4DKA C;  3TS2 A;  1WSV A;  2UXD Q;  3GO5 A;  4I7A A;  1VLY A;  4YEJ A;  1UNS A;  3HKS A;  4G6I A;  1K8A D;  1SLJ A;  1GO2 A;  5TRD A;  2XNC A;  5A89 A;  4XQJ A;  3H94 A;  3NBH B;  5ELN A;  2F03 A;  4LC0 A;  2CQO A;  3NTH A;  4TMX A;  4OO1 I;  1C0A A;  2KHJ A;  2L12 A;  4RPD A;  1KAW A;  5CV8 A;  4KLK A;  4AVZ A;  2OEO A;  5FJ8 G;  2LMC B;  4NXM Q;  3F2D A;  1EY8 A;  5JBQ A;  3TZD A;  1D2E A;  3VR3 A;  1BUV T;  3ZC3 A;  4XQF A;  1I6H B;  1QFJ A;  3E1Y E;  1JCK B;  2QA4 B;  4DUY L;  1ASZ A;  4JI5 Q;  4ZKB B;  2E2J H;  2RSO A;  4PC6 A;  3X3N A;  2IW3 A;  1Y1W H;  1TII D;  1CKN B;  1PYW D;  1Q1E A;  3TRE A;  4YAW A;  2B39 A;  2PW5 A;  4A3M H;  2Q2H A;  3NE5 B;  2GPJ A;  4OP7 A;  1EQR A;  4X64 Q;  4C2M B;  2DY7 A;  4NPS A;  1H42 A;  2GVA A;  1YIT A;  2RDG A;  1HTP A;  3AFQ A;  2BM0 A;  2WAQ E;  1A3T A;  3C1E A;  4OWX B;  3CC4 A;  3VNU A;  3GTP H;  1LTL A;  4P26 A;  1F9S A;  1UEB A;  2P3M A;  1UE5 A;  3W1G A;  1EIH A;  3DEP A;  1GVP A;  1JOR A;  2K01 A;  1SBB B;  2N55 A;  3UDI A;  4CKE A;  1EFI D;  3S1R H;  5I2Y A;  1J5E Q;  3OTO L;  4JVZ A;  3CXC A;  2J4X A;  3HZX A;  3CCV B;  2I5H A;  3CCV A;  3KF8 B;  3DWQ A;  2VBU A;  4DU9 A;  3FPU B;  1BOS A;  3GTQ H;  4DNI A;  4FNF A;  1HZE A;  1U4P A;  2TSS A;  3FDT A;  3HOW H;  1N06 A;  3CME A;  4C3H H;  3J7A V;  3S2H H;  4CDE C;  4B48 A;  1NR4 A;  1Q81 C;  4R1J A;  2EY1 A;  4DR3 Q;  3OWF A;  1NB9 A;  2WV6 D;  4DV7 Q;  3MAQ A;  3I4N H;  4YHH Q;  4C0S A;  1G29 1;  3BG3 A;  1B7Y B;  1JMC A;  1ENA A;  3SHL A;  3ER0 A;  5LL6 S;  1J9Z A;  2ID0 A;  2IX3 A;  1SND A;  4Q7J B;  3K5O A;  4TSS A;  1TWC B;  4P71 A;  3IAY A;  3CW2 A;  2DJF C;  2EY2 A;  4OGQ C;  4JI8 Q;  1O7Z A;  4DA2 A;  3WBK A;  2GA4 B;  4X65 Q;  4JI6 Q;  3D0F A;  2HIX A;  2Q6L A;  4UZU A;  3RNU A;  4HAE A;  2E5L Q;  4B3S Q;  4J1M A;  4FXD A;  2UUA Q;  3S15 H;  2BV3 A;  5IY0 A;  3PF4 A;  4QJF A;  3MMP A;  3SE0 A;  1ET9 A;  1X3G A;  3VA7 A;  3HOX H;  4QUC A;  2SDF A;  1XE1 A;  1PTO D;  1IJE A;  3U6K A;  5C0X H;  2A8V A;  2F0L A;  3NK9 A;  3J81 j;  3OOC A;  4HMJ A;  2JA6 H;  2VQE L;  3BZC A;  3B82 A;  4FF1 A;  3URY A;  2QKI C;  1I8D A;  4GKK Q;  3W5V A;  1WCM B;  4LF7 Q;  5M3M H;  4DNR B;  3CC2 A;  4OX9 Q;  3GVL A;  3PO2 B;  1FYC A;  1BNZ A;  3T1Y Q;  4YCW A;  1XTD A;  1Q8K A;  3G71 B;  3AVY A;  5D65 A;  1BF4 A;  3G71 A;  2YU9 B;  3RN5 A;  3Q22 A;  2Q6O A;  2VZA A;  4JC0 A;  4LW1 A;  4XTC S;  2B2Y C;  5IGB A;  4QVJ A;  4A3J H;  3VR6 A;  2PQA A;  4X8I A;  5M3F B;  3CRK C;  1N34 L;  2G5D A;  4IZ8 A;  4DN4 M;  1VQ8 B;  2NVY B;  1NJI C;  1ESF A;  4CHT B;  5TR9 A;  1MI2 A;  2XTI A;  4J8Q A;  4X3S A;  2WAQ B;  3S14 H;  5ELC A;  3ZIA A;  2A6H D;  3J7A 5;  1Y69 U;  2DY1 A;  1H85 A;  1JE5 A;  4KHZ A;  4H0L C;  4A3E H;  4DR6 Q;  2R7Z H;  2A6H C;  3Q39 A;  3ZYY X;  4G5G A;  3I56 B;  3HKZ E;  3ONY A;  2K7V A;  4II3 A;  1PFB A;  4L5R C;  1ICW A;  4B9W A;  2F4N A;  4WZK A;  2NTS A;  5BSX A;  1K28 A;  1KRT A;  3S2H B;  4IPD A;  1XMO L;  4RD2 A;  1VHO A;  5DM6 3;  2NN6 G;  2HCI A;  4RGO S;  3KK7 A;  4TMT A;  2CF4 A;  3ONU A;  1EZ6 A;  1BPL A;  1K8M A;  3P1H A;  1STB A;  2VNK A;  4C3I H;  4CKC A;  2C5C A;  1HCZ A;  4FXU A;  2BDN A;  4E0F A;  1B23 P;  4B3R L;  4IUR A;  1WD0 A;  1F60 A;  3JQQ A;  1PH3 A;  1BCP B;  4A3I B;  3GTP B;  1Q9S A;  1RL2 A;  1YNN D;  1D7Q A;  2R93 H;  1BX0 A;  3D4D A;  1B70 B;  3CB4 A;  5IOC A;  4DV3 Q;  2CWA A;  5HZA A;  4A3L G;  3FKI G;  4DUZ L;  1HR0 Q;  2F0W A;  1YJN A;  1PFM A;  4B3T L;  4C3I G;  1PYS B;  2NVX H;  3GTG H;  3RUZ A;  4A93 G;  1HA6 A;  4UAJ A;  2FFK B;  3R6J A;  2HQE A;  1FNB A;  4JBM A;  5H5J A;  3OZV A;  1QVF B;  5AFW A;  3PGZ A;  2EIX A;  4OPV A;  4PC7 A;  1RTO A;  3FPK A;  3PUZ A;  1YHQ A;  3GP7 A;  2OBS A;  5K36 H;  2V7X A;  1OB2 A;  3BY2 A;  5CDF A;  2VY3 A;  2PE3 A;  1PRT F;  5FL7 A;  4XD7 A;  4LBV A;  5FO9 B;  2CHB D;  4RAU C;  3HKZ G;  3OEE A;  4DV5 Q;  1CI3 M;  2X69 A;  2VZL A;  4L63 B;  4LFC Q;  1I4H A;  2R92 B;  1X3E A;  2E76 C;  3ASP A;  3E0J A;  4LFA Q;  5I9O A;  2FVG A;  3TS0 A;  2VUM G;  1ILQ A;  3A8I A;  4DV6 L;  4N8X 1;  3QG1 A;  2FMM A;  5M5W B;  1L2F A;  1WTO A;  1D1K A;  4F8M A;  3CD6 A;  5CV5 A;  2W6J A;  1W87 A;  2OYN A;  1QOH A;  4DAM A;  1T6Y A;  3UDX A;  3CCR B;  2QGG A;  2JEA I;  3KFU A;  4NXN L;  4KK7 A;  3MEF A;  5F2D A;  4CJ2 C;  1IBM L;  4B3G A;  1YNN C;  2L55 A;  4JBK A;  4G57 A;  2YTV A;  1UE7 A;  1BJK A;  4CKB A;  1HH2 P;  1X6O A;  3DM3 A;  3W2G A;  5BSY A;  3L0O A;  5J39 A;  1BO0 A;  4C3J G;  3HGB A;  4KN4 C;  1WOR A;  4HCS A;  2YTX A;  3K6O A;  4JI5 L;  4DUY Q;  2UXC L;  1BXT A;  1WTV A;  3HS0 C;  2HLD A;  1SFO H;  2BH8 A;  3K5N A;  1VQ5 B;  1PRT D;  3NPP A;  1LTB D;  2KA7 A;  1I50 B;  3QWN A;  4YAO A;  4QB4 A;  2A69 C;  4FO2 A;  5CGK A;  2Z6B D;  2OTJ B;  3GTM B;  2H1E A;  5THX A;  3AU7 A;  3BQJ A;  3CCE A;  4G7O C;  1YJ9 A;  2RCN A;  4IFD I;  4FXG C;  5IP7 H;  4IW3 B;  4JI3 L;  2ZZG A;  3U50 C;  3PIP A;  1U4L A;  4BY1 H;  4A93 H;  1PH1 A;  4K1X A;  2DY8 A;  1UD8 A;  2B63 H;  3ERO A;  3HOY B;  4IPG A;  3O13 A;  5B6I A;  3AVV A;  4IOA A;  1GJX A;  1XJV A;  1WTH D;  1YJW A;  2XRS D;  1BBX C;  2VNH A;  5AN9 A;  1KD1 C;  2B8F A;  4I7Z C;  3MEH A;  4R71 A;  4GLV B;  4K2L A;  5KYL A;  2XOK A;  3GTG B;  2NVX B;  4LK1 C;  3PO2 G;  4RA8 A;  5C4X G;  2X6Y A;  1WTH A;  1E43 A;  4DR7 L;  4AIM A;  2B2U A;  3E0E A;  3WWV A;  4LF6 L;  2VNJ A;  1P4M A;  2HCC A;  1J5E L;  5IYQ A;  1GKH A;  4XLC A;  1XMQ Q;  3E9I A;  1EQQ A;  1STG A;  2UXB L;  1LT4 D;  1UEA B;  3S16 B;  3A35 A;  5IYC G;  3NBH A;  1VQC A;  4F87 A;  1EY6 A;  1OHH A;  2XZL A;  4DV0 L;  3UE1 A;  1X3P A;  5KYI A;  4JI6 L;  4C3J B;  5L37 A;  4GOP C;  3I4M G;  3DXJ C;  1D8T A;  4DV7 L;  2RKS A;  3CQZ B;  2E5L L;  2VUM B;  1A6X A;  3SK6 A;  2BE5 D;  1JWS D;  1PTO C;  1EIG A;  3A8K E;  3MC0 B;  4BY7 G;  3NBI A;  4ABN A;  1FVI A;  2F0P A;  2HMA A;  4RD0 A;  3QO2 A;  1JJG A;  4DR4 L;  4POG A;  4DK0 A;  2QW7 A;  1N07 A;  1GUG A;  5M3F G;  1C7Y A;  4LAA A;  1YIJ B;  1Z9F A;  5FK9 C;  2BVN A;  1GAQ A;  3R3O A;  3W5O A;  5D3I B;  1FRN A;  1J8I A;  1E24 A;  1KNE A;  2KJX A;  4PMW A;  1SNQ A;  4RGM A;  5E7N A;  3CKI B;  1HNZ L;  4Z4S A;  2R61 A;  1D1I A;  2GJR A;  3AFP A;  4ODG A;  1TKW B;  3VDY A;  1XB2 A;  3CC7 B;  1QGY A;  2R7Z G;  2WKD A;  3H09 A;  1TY2 A;  4BBS G;  1E2V A;  4RD4 A;  1LTG D;  3PO3 G;  3J7Y W;  4P2C B;  1LTR D;  4GLX A;  1CNF A;  3BVG A;  3EIV A;  3AMU A;  1W35 A;  2EVB A;  5K5P A;  3FVQ A;  4IJL A;  3H9N A;  1A3U A;  1BQQ T;  5JEA G;  1QVG B;  2ZT9 C;  1VQM A;  3T1Y L;  3KF8 A;  3KEW A;  2CFM A;  1HZA A;  1YHB A;  2B2T A;  3CCM A;  3PO2 H;  3PVD A;  4KHV A;  1M8A A;  2GQF A;  1LT3 D;  3BS1 A;  2N78 A;  4X62 L;  5KEE A;  4ZLT F;  2C5B A;  1AE3 A;  3S24 A;  4QUZ A;  1WTR A;  3BVZ A;  2L1B A;  1I94 L;  2O4X A;  4G7W A;  3OYY A;  1PTO F;  1LT6 D;  4OPO A;  4YXW A;  5KW9 A;  3A1P A;  3MXN A;  4B08 A;  1O78 A;  2VJI A;  3CP8 A;  2X0K A;  3V7A A;  1YI2 B;  1AEX A;  4B3X A;  5IGD A;  1CA5 A;  3MXG A;  4JV5 Q;  1TXY A;  4OEM B;  3E20 A;  4IFD H;  4X0C A;  2JN9 A;  3UE0 A;  5FLX c;  1AH9 A;  4EQN A;  1SYF A;  4Z4Y A;  3KLR A;  3QFT A;  3MZ5 A;  3S1Q H;  3WQZ A;  5C44 H;  1ROD A;  4N8F A;  1HHV A;  5C3E B;  4OO1 H;  1Q12 A;  2KED A;  1DYQ A;  4ID6 A;  3R2I A;  5IK2 A;  3RZD H;  1CTM A;  3WOE A;  3VR5 A;  5C4Z A;  3DLL A;  1IBL L;  1R5N A;  5JVH 3;  4YWK A;  3M4Y A;  4M1U B;  1KAB A;  5BN4 A;  3K7U C;  4WQM A;  3G05 A;  1PH7 A;  1XMO Q;  2F0F A;  1Q3L A;  2F0O A;  3HOV G;  4XKW A;  3JU4 A;  1K9M C;  3GTO B;  3VA5 A;  1AE2 A;  1ML0 D;  1PDQ A;  2WFW A;  2IX1 A;  2E2D C;  3CCM B;  4BXX G;  2JN4 A;  2PZW A;  5JOB A;  1HR0 W;  3FMC A;  2LS0 1;  4JOI C;  2DET A;  4X64 L;  3CCL A;  1SYG A;  3QIA A;  2EXD A;  4QIW B;  3HOU B;  1K8A C;  4PZ7 A;  4JOI A;  3ZJY C;  1FNW A;  3MFY A;  3ZPN A;  3BC9 A;  4L5T A;  4XLE A;  2Y0S B;  1VQL A;  1YI2 A;  1ICF B;  2JK8 A;  2R6H A;  2AHO A;  3I8Z A;  1KQS A;  1DDG A;  3GQB A;  2PMZ B;  4GKJ Q;  3RN2 A;  1HA5 A;  1IYV A;  2DCU A;  3U4Z A;  2ZM6 L;  3L2P A;  3FEW X;  1I6V C;  1OXS C;  2JA8 H;  5DEH A;  2JJ2 A;  3RY8 A;  4M0L A;  4XOP A;  2E8G A;  1AZP A;  3AGP A;  2SNM A;  4UDU C;  4U68 A;  1GAW A;  2F4V L;  2MO1 A;  5FO8 B;  4TMZ A;  2F1M A;  3BYT B;  3MHB A;  2WIN B;  1HFG A;  5C0X I;  2E2J B;  3KBG A;  2PPB C;  1ZXT A;  3LQE A;  3I56 A;  1I4Q A;  2ZJR A;  5CV6 A;  1SRO A;  3PO3 H;  4OWT B;  3OW2 B;  3BZD B;  2WAC A;  4BS9 A;  4PMC A;  2PZT A;  1FNM A;  1KK0 A;  1I6H H;  1SAP A;  4P6Y A;  1QFZ A;  3M85 A;  4OO1 G;  3SR1 A;  5IP7 G;  4OOS A;  2MUY A;  3I4N B;  5J35 A;  2JP1 A;  3OFN A;  4RH6 A;  1G6Z A;  4JYA Q;  4G7Z C;  1QWY A;  2WB1 B;  3V2T A;  1BBW A;  3AEV A;  4PC2 A;  3TDQ A;  4BBR H;  3LGJ A;  2K32 A;  1HVX A;  3WYA A;  4NXN Q;  2E2H B;  1R9T H;  4NNJ A;  4LBW A;  1UD3 A;  1ENF A;  4HJ5 A;  4HJ7 A;  4FF4 A;  1CSQ A;  4AF7 A;  2DN8 A;  3OMC A;  1G7S A;  5CBE E;  3J80 E;  2EY6 A;  1D5Z C;  3ZZ0 A;  1WYD A;  1JJ2 B;  2EZV A;  1E3Z A;  4NMZ A;  2L4N A;  5FLM G;  5E4W C;  4IUV A;  4IFD J;  3CCS B;  1E0B A;  3PUW A;  1TU2 B;  4ASU A;  1LM0 A;  2DNC A;  5CYU A;  3TZU A;  3R8B A;  3CCJ A;  1PXU A;  1PZK D;  3PIO A;  3GIR A;  3F8T A;  2OTL B;  4XXE A;  4F7D A;  1DON A;  2BF4 A;  1GUN A;  2XRQ D;  5IYC H;  2VQF L;  5JAV A;  2QDB A;  3TP6 A;  1B2T A;  2C4T A;  2ZZE A;  5E3F A;  3QFC A;  1VMC A;  4X66 Q;  1EWY A;  4TT3 A;  2H4O A;  3W2D A;  1TVC A;  1NAP A;  1D1N A;  2JA8 G;  1VQF A;  4OHJ A;  4AYB B;  4HIM A;  3HOU G;  3HOY H;  5JJZ A;  4KY6 A;  1UE6 A;  3HOX G;  3CHB D;  4NKL A;  1TT2 A;  1W2B B;  2ES2 A;  1B3A A;  4QCL A;  1LTA D;  1IBK Q;  4QVA A;  4IOC A;  3TRZ A;  2ZTN A;  4YHB A;  3GV3 A;  1DD2 A;  3UI2 A;  1TS4 A;  5K36 G;  1SNM A;  1VQI A;  3A8I E;  4ROX A;  1G91 A;  1HXY D;  3ISX A;  2D74 A;  4G1B A;  3B8H A;  1DOM A;  2ZTE A;  1SMY D;  3BYY B;  1PRT C;  4RGT A;  3U58 A;  5M5X H;  3CC7 A;  2HDM A;  3D4W A;  5EAY A;  4GN5 A;  2K5D A;  4UZF A;  4ACB A;  1KZL A;  1NDH A;  2EYO A;  4KD3 A;  4BY7 B;  4P3I A;  5I6Y A;  2N8N A;  5LMN W;  4BBS H;  3KOJ A;  4LWC A;  2ZZF A;  2JIZ A;  2DNE A;  3OJX A;  1GOZ A;  2Q8R E;  1E62 A;  1Q8I A;  1NMF A;  1EP1 B;  3GD7 A;  3FJO A;  3RR5 A;  4ZCM A;  3BVM A;  1EYD A;  1RKN A;  2B2Y A;  3PSI A;  1PV4 A;  3CME B;  4DFA A;  4BBR B;  2DEU A;  2UUC Q;  2AUJ D;  3QOL A;  1Y1V B;  1R9T B;  3A8J A;  4A3E G;  1NR2 A;  1Y8O B;  2JA5 B;  4DR4 Q;  3NUC A;  2F0J A;  1K83 B;  2PQA B;  1TS5 A;  2EXZ A;  2XNA C;  2E2I B;  4Z1M A;  2KHI A;  3CPW B;  2HCJ B;  4N9P A;  5IT9 E;  4JCV E;  1F20 A;  3MA2 B;  4WJ4 A;  3K7A B;  4UP9 A;  2ZXH A;  1PTO H;  1ELO A;  4RWS C;  3I91 A;  3M7G A;  1YX2 A;  1VS0 A;  4DV2 Q;  1R5O A;  4AF6 A;  1OXV A;  3RZD B;  1EOV A;  1AFP A;  1SN8 A;  4DK6 C;  3ES9 A;  2RBM A;  1V1P B;  4AC9 A;  4M8A A;  2JJ1 A;  1BCP F;  2PMZ E;  4H02 A;  1FGB D;  4DV5 L;  3HOY G;  2EJG C;  1U9R A;  2PNR C;  3S17 H;  3S15 B;  3PIP 3;  4APV A;  3L7Z C;  1IW7 D;  5F4O A;  1DCZ A;  1LV9 A;  1P8L A;  3H15 A;  1Y14 B;  3CCR A;  1Z47 A;  5IYB H;  1K8G A;  2V7W A;  1WJJ A;  5J1Z A;  1WU8 A;  2JQO A;  2M00 A;  1N08 A;  2EYP A;  2F3V A;  3CCL B;  5ELO A;  4QFM A;  4C3I B;  3MVV A;  2GRE A;  5EKI A;  5HGQ A;  2ZXR A;  2F0D A;  1VQ5 A;  3E6Z X;  1IBM Q;  1JE4 A;  1JA0 A;  1I7P A;  2CBX A;  3TQY A;  2VL6 A;  4ZGQ B;  1Q82 D;  4DR2 Q;  1N8R D;  2W6I A;  4G7H C;  3H6M A;  2IWH A;  2ZTC A;  3VR4 A;  3H3V H;  2XND A;  4YAU A;  5C4J B;  4IUN A;  1JC7 A;  1C8C A;  4X3T A;  1V0E A;  3HFZ B;  1GR1 A;  1YJN B;  4YY3 L;  5L46 A;  1DJR D;  2IX0 A;  4PNY A;  4R8N A;  2KCT A;  5COR A;  3T1H Q;  1SYD A;  2LXJ A;  3R2T A;  3Q24 A;  1BCP D;  4XNF A;  3AVX A;  2CW0 D;  2PYK A;  3ERQ A;  5C5M A;  2L11 A;  1G2T A;  2PZU A;  1O80 A;  1VQ4 A;  1IBL Q;  1R4P B;  2BGJ A;  2K5W A;  2V1C C;  5COY A;  1U2R A;  2QDL A;  1XNR L;  4KI0 A;  3M4P A;  4JI3 Q;  3VMF A;  2VBT A;  1MHW C;  4CDD C;  2DUD A;  1H9S B;  4I65 A;  1EWI A;  4QY7 A;  4HE6 A;  1IKM A;  4X6A H;  5C4J H;  2F4I A;  5M3F H;  2KVO A;  2ZXI A;  1M1K C;  2JA7 G;  2J0T D;  2ZM6 Q;  1GUT A;  3SXH A;  1S5E D;  1ASY A;  3I4O A;  2Q2U A;  4EQO A;  4L5S A;  3R93 A;  2A6E D;  3X3M A;  1IHM A;  2OQK A;  2BGI A;  4XN0 A;  1HUM A;  2G9D A;  1QNK A;  2OQ0 A;  4A3C G;  2D2C C;  1QJO A;  1XX8 A;  3QSY A;  4DAP A;  4ZKC B;  1YLO A;  4DQK A;  4DR7 Q;  3PUV A;  3GTQ B;  1BR9 A;  3K8A A;  1B53 A;  3FKI B;  1VJS A;  1G7T A;  1DGS A;  1E22 A;  2XN9 C;  5FO0 A;  3IL8 A;  5H59 A;  4KKS A;  2A73 B;  3WND A;  5T1G A;  1MJE A;  1XMQ L;  4Z4R A;  4BBR G;  1I3Q B;  2JA6 B;  2CW5 A;  5C6A A;  4GNX B;  2ASB A;  4WJ3 M;  3FRP B;  5C3X A;  2K4K A;  1VQK A;  4WZT A;  3OIQ A;  4NDX A;  4X3K A;  1CUK A;  1QNU A;  4GLA C;  1NB0 A;  2PCF B;  3JAM L;  1EFW A;  5C44 G;  1S5B D;  5AJ3 L;  4ZYS A;  2BN4 A;  2F3W A;  1IHZ A;  4BWG B;  4DV0 Q;  2V7Q A;  2WR8 A;  2I5M X;  2N88 A;  3J81 E;  1DG1 G;  1TY0 A;  4G7X A;  1ZUN B;  1JOO A;  3K5L A;  2A5H A;  3M3Y H;  1R4Q B;  4K5W A;  2LZJ A;  2VW9 A;  2O5J C;  2WAQ G;  2Q6K A;  3I55 A;  1S40 A;  2PLF A;  4Y9R A;  1VQN A;  1ZEQ X;  1KAA A;  5KNL A;  4LMQ D;  1C48 A;  4WFN 3;  5IGG A;  3IFT A;  3ASS A;  5GAD C;  3VNV A;  2D9R A;  2E2I H;  4OWW B;  1HNW Q;  1EFU A;  3KJP A;  2E1R A;  2NN6 I;  4JYA L;  4PAB A;  3U6B A;  4UAI A;  1V43 A;  1T5E A;  4RCN A;  2WKC A;  5IYP A;  1VQD A;  1Q81 D;  2JE6 I;  1UWV A;  2GN5 A;  3NEM A;  1PVO A;  1EU3 A;  3CD6 B;  2ZJQ A;  1LTS D;  1X55 A;  1D6E C;  1ZYR D;  1MKH A;  1XQB A;  2J7Z A;  2ICI A;  3HOW B;  2WZP P;  4OXP A;  3OE7 A;  1EYG A;  2K5V A;  3HRZ C;  1VQ6 B;  1DOK A;  3H3V C;  2SNS A;  1VQL B;  2QTL A;  1V5V A;  3WBJ A;  3G6E B;  1V1Q A;  2PNH A;  3HOV B;  1XNQ L;  3D8G A;  3ICE A;  3S16 H;  5ELD A;  4BBS B;  1A3V A;  4YWL A;  5E1F A;  2NYZ D;  1OXT A;  1J6Q A;  4XT3 B;  1COW A;  4RDL A;  1D2B A;  1J9O A;  5DN6 A;  2JA9 A;  3GVK A;  4GNX A;  4DV4 L;  4N3G A;  3BZK A;  4BY1 G;  4H9G A;  1SRU A;  3LX0 A;  4DK3 C;  2OK7 A;  1S4Z A;  2B7B A;  1PH2 A;  1STH A;  1EZ8 A;  2DOG A;  1CT1 D;  1LYL A;  1WD1 A;  1PJ7 A;  3IFD A;  4LFB Q;  3ZZU A;  5M5X B;  3Q6R A;  4QF4 A;  5M5W H;  2DIE A;  1TTT A;  4WZE A;  5JJL A;  1X3F A;  2ALY B;  3D31 A;  3PA2 A;  1MIU A;  1L0Y B;  2LKV A;  2WSS A;  2B63 B;  2XVS A;  1YZ6 A;  1CSP A;  5KSW B;  2DJG C;  3DM1 A;  3Q6Q A;  2R9V A;  4MIU A;  3NQT A;  1H8E A;  2WB1 G;  5JJK A;  4UPA A;  2XZO A;  1SE3 A;  4GOP B;  1K73 D;  3A7L A;  4PAA A;  1CHQ D;  2NVT H;  3K81 C;  1OB5 A;  5CV9 A;  3EN2 A;  5G3L D;  4V19 0;  1EEF D;  3CCQ A;  3CF5 A;  1YEZ A;  2A1A A;  4II2 A;  1MSG A;  2IT1 A;  5I4D A;  1KJZ A;  2IJ0 A;  3PUX A;  3RMH A;  1B4O A;  2E74 C;  3Q38 A;  1XPR A;  2D9U A;  3N6R A;  1H9J A;  3QB3 A;  1MAB A;  1GHJ A;  5F4J A;  1I18 A;  1SNO A;  1ZM3 A;  5DM7 3;  1HA3 A;  3NWS A;  2LFN A;  4ZRZ A;  1H9K A;  3KLW A;  4K8I A;  1VQ7 A;  1GUW A;  1SFO B;  4QHY A;  4OPS A;  4FDB A;  1RQR A;  2MQH A;  3SK8 A;  3OMG A;  4OIK A;  3TP8 A;  3H0G G;  4TN1 A;  3BDL A;  1W6K A;  4XKV A;  2Q8T A;  1KRS A;  2KCC A;  3ERS X;  3CMA B;  1B8A A;  1S72 A;  3I72 A;  4XN3 A;  4XR6 A;  3J80 c;  4S3S A;  2L9H A;  4PZ8 A;  3ASQ A;  5FNZ A;  2LSS A;  4ILW A;  3VR2 A;  1UD4 A;  2KCN A;  4YWM A;  4HJA A;  4CDF C;  3S1R B;  3ND9 A;  3S1M B;  4KHP L;  1B9M A;  1RQP A;  1ET6 A;  3S9W A;  2X6X A;  4HJ9 A;  2NVT B;  2K05 A;  4DR1 L;  1D8L A;  3GVJ A;  3S2D H;  4G4K A;  3HOZ B;  1C9O A;  1JB9 A;  1I4X A;  5TY0 A;  4WJW A;  2JJQ A;  2JXM B;  4F7X A;  4DV2 L;  5ISR A;  4NP5 A;  4RM0 A;  4R4O A;  2AUK A;  3QFR A;  3L9A X;  4EVO A;  3WNB A;  2WB1 E;  3OW7 A;  2HHH L;  3C3L A;  2X6G A;  2CQA A;  2NTT A;  5LMZ A;  4A3F H;  4K14 A;  3Q8D A;  4HJ8 A;  2QN6 A;  3PO3 B;  1ZKO A;  3PUN A;  2RHQ B;  5IOD A;  1EFR A;  2GVB A;  1CQX A;  4YHH L;  2K1B A;  1EYA A;  1EY7 A;  1U4M A;  5BR8 L;  1RD9 D;  3CES A;  1YNJ C;  3CCQ B;  5M3M G;  5T1I A;  1QUQ A;  5GAE C;  2WYR A;  5EBC A;  3ASR A;  3VYU A; 
#chains in the Genus database with same CATH homology
 3P20 A;  4XYQ A;  2F0Q A;  1S5C D;  4GQN A;  5J22 A;  3EFX D;  1F2Z A;  1L0X B;  1XYI A;  3FPP A;  2BDO A;  5ELB A;  4WRD A;  5EBD A;  1KDA A;  2Z8L A;  5M3M B;  1TQO A;  2K03 A;  2KOL A;  1H8H A;  2KEC A;  1OB0 A;  3I4M B;  2EJM A;  2QEJ C;  3HKZ B;  2CK3 A;  1TWF B;  5DAU A;  4PQX A;  1EWC A;  5IGC A;  1E2Z A;  5DNF A;  1XTC D;  4C3H G;  3BCF A;  2IPK D;  2KHS A;  4MHE A;  5CV7 A;  3VYR A;  4CJ0 B;  3DEO A;  4KV6 A;  1Q90 A;  3M3Y B;  2NBF A;  4K6D A;  1PZJ D;  4A3E B;  1EL0 A;  2RDH A;  5EJW A;  3J7A F;  2CW0 C;  1VCI A;  3S14 B;  4ZUJ A;  3E5S A;  2C9O A;  4ME5 A;  1FX0 A;  2QIL A;  4Y7N B;  4TKO B;  3T13 A;  1A15 A;  1VF5 C;  2ZXO A;  1IKL A;  4A3J B;  1OXU A;  1GXD C;  1KMH A;  3U9O A;  1EY9 A;  3T56 B;  1TS2 A;  3C2P A;  4ZK9 B;  2AQ1 B;  4HIZ A;  2MP1 A;  1EWH A;  4ZQ3 A;  1F2M A;  2EYH A;  2L5T A;  1WTW A;  1ILP A;  4FYD A;  2OF1 A;  4XIG S;  3EVQ A;  1QG7 A;  1KLG D;  4K8J A;  1LO5 D;  1UD6 A;  1QE6 A;  2F0T A;  3TBI B;  2A68 C;  2A68 D;  2JEB I;  2PO4 A;  4O1N A;  3A54 A;  3SK5 A;  1RHP A;  3D3R A;  1Y8P B;  2I07 B;  2FJ2 A;  3ITP A;  1MSH A;  1EY4 A;  1DZ1 A;  3H0G B;  3PIO 3;  1V8Q A;  4J6H A;  1NCV A;  5JEA J;  1LAB A;  2B8G A;  1LTI D;  4B9X A;  1O7L A;  1SYE A;  1DXM A;  5KNB A;  4DXF A;  3QJY A;  4C3H B;  2B2V C;  2F0E A;  1SE4 A;  2WII B;  4FXK C;  1HFN A;  3HG9 A;  2VB2 X;  3K59 A;  1F9P A;  1AP0 A;  4A3B B;  5C0X J;  4Q5V A;  3G6J B;  4XOR A;  1II3 A;  3S1R B;  3LNN A;  2NUC A;  2Q8I B;  5JVG 3;  4TRD A;  3NWT A;  1WPC A;  2RDF A;  4XYO A;  2RQX A;  1EU4 A;  3N52 A;  1SMY C;  4QUF A;  2BA0 A;  5C4H A;  3T16 A;  2R3Z A;  2GJK A;  2XIW A;  3NXW A;  5CMD A;  4A3M B;  3S1N B;  1B9N A;  1CM9 A;  4H7B A;  2K33 A;  1EOT A;  2KEE A;  1SE2 A;  1PLF A;  4KKU A;  2BA1 A;  3MTS A;  2D62 A;  2EOT A;  3NTK A;  1F9Q A;  4O42 A;  3M7N A;  1F77 A;  4BA2 I;  1E79 A;  1CZW A;  1KDC A;  5FLX E;  4DF7 A;  2WP8 J;  4H13 C;  2QCP X;  3F2U A;  3Q6S A;  2GJP A;  5CR3 A;  5EGT A;  2D3L A;  5TSS A;  5G3L F;  1W0J A;  2K04 A;  1FR3 A;  1LAC A;  1NSN S;  4IUT A;  1B44 D;  4KTA A;  2HDL A;  2KVM A;  3D6C A;  1JR0 D;  3WDN A;  4JBW A;  3SEB A;  1D5X C;  5CV4 A;  5C3W A;  5LL6 X;  4R9W A;  4DK1 A;  4QMG A;  1CHP D;  4TQU S;  4XQN A;  2X85 A;  4EQP A;  4P22 A;  3CU7 A;  3M4O B;  4CJ1 B;  3KBX A;  1HQM C;  4NW2 A;  5KNC A;  4BY1 B;  2MPM A;  1TWA B;  1WP6 A;  2D5D A;  5I6W A;  2X6L A;  3CMM A;  1DM0 B;  1F9R A;  2BOS A;  1RTN A;  4K5V A;  2LY7 A;  1E2W A;  5I2X A;  1LTT D;  2F0N A;  5NUC A;  1MGS A;  3EJI A;  4K2K A;  2R93 B;  1IYU A;  2JA7 B;  1SSO A;  1PRT B;  3I73 A;  3VYT A;  3A8J E;  4RFB A;  3Q0A A;  2B2W A;  2ZZQ A;  3P75 A;  2D3N A;  1LLR D;  3RLF A;  1W0K A;  5M5Y B;  1TVX A;  1SJH D;  2IL8 A;  1DOL A;  1CFM A;  5IIF A;  3SVM A;  2WJY A;  2NB0 A;  1VF7 A;  4CGY B;  5E4X A;  4HSP A;  3BH4 A;  4XOT A;  3W3A A;  5IGE A;  2F43 A;  4DAY A;  1AW7 A;  1FD7 D;  4OIJ A;  1BLI A;  1KTK A;  2EY5 A;  1BDO A;  2R7Z B;  1ONL A;  4R8I A;  4X3U A;  1STN A;  5EPJ A;  1NUC A;  2CVR A;  1O7Y A;  1HPC A;  2EYL A;  3DMU A;  3MXP A;  3G7L A;  4KJO A;  2AWN A;  2RA4 A;  1G8Z D;  3A55 A;  3OPO A;  2BCO A;  3TP5 A;  1JOQ A;  2ZTG A;  1RCV D;  3T51 B;  2NN6 H;  1A2U A;  4KD4 A;  4PV1 C;  1V1O A;  1EEI D;  4HTH A;  3CP2 A;  2B2W C;  2MHV A;  4PMB A;  2NVQ B;  4N9T A;  1YNJ D;  1WTQ A;  1SNC A;  1SEB D;  2VB3 X;  2ENB A;  2ZXP A;  4HMI A;  1I4P A;  2MJ8 A;  4KJN A;  2EYF A;  1TWH B;  1X32 A;  1RJT A;  2XGJ A;  4XQQ A;  2BE5 C;  2F0M A;  5HGT A;  2XWJ B;  5FKA C;  4FVM A;  4RKB A;  1SYB A;  4HR7 B;  1PKV A;  2RVL A;  2YYZ A;  1UUP A;  3PUY A;  2FMC A;  3GV6 A;  3GTK B;  3DWA A;  3PV0 A;  4RCO A;  5C4X B;  1ENC A;  5C0X G;  4KMU C;  4DXG A;  3T53 B;  4RKL A;  3EQL C;  1ESR A;  4LJZ C;  1B50 A;  1OO9 B;  4XMY A;  1NRK A;  4JK1 C;  3LWE A;  3PMF A;  4C1N K;  1SNP A;  4OL7 A;  5EQ0 A;  1TR5 A;  3S17 B;  5HKK A;  1PTO B;  4A3F B;  5FOB B;  3K0Y A;  4HED A;  4E6I A;  1BCP C;  1JIC A;  3P7J A;  4K5X A;  2E75 C;  5JEA H;  4A93 B;  3HAG A;  5IT9 L;  2O2L D;  1JOK A;  3A3G A;  2VNU D;  1WVL A;  2NWG A;  3HP3 A;  4U67 3;  1I4G A;  2A69 D;  3ONA B;  1W6J A;  3GTL B;  5FO7 B;  1RF2 D;  1SJE D;  4BA1 I;  5CC4 A;  1XXG A;  2WPD A;  1CQF A;  4A3K B;  1EQV A;  4IUQ A;  3TP7 A;  3I4L A;  4Z9C B;  1UAP A;  2V31 A;  2KUM A;  1QIL A;  4F88 A;  3J81 L;  5BN3 A;  1E3X A;  5FLX L;  4RHR A;  1SXT A;  1ZYR C;  2HUG A;  4DGZ A;  3NHH A;  5EKK A;  2GK7 A;  3L3O C;  4MN3 A;  3JAM E;  2B2V A;  1S5F D;  1HQR D;  1E1R A;  5CBA E;  3DHQ A;  1AZQ A;  5HUR A;  1JQY D;  3DWP A;  5D3D A;  1QB5 D;  1JWU D;  2EE1 A;  5C5L A;  1SYC A;  3KUP A;  4KKT A;  1D5M C;  2M9V A;  1HUN A;  2Z4H A;  3BDO A;  3I3C A;  2K28 A;  4L8J A;  3OEH A;  2SOB A;  2F0H A;  3ND8 A;  5BN5 A;  1M4V A;  4RHS A;  4C56 C;  1UD2 A;  2V4D A;  4GZY C;  4KY7 A;  4C1N I;  2FIN B;  2B2U C;  5M9O A;  1MBY A;  1W9X A;  2VXW A;  2M5S A;  2G9H D;  2AWO A;  3J80 L;  3I90 A;  3OSO A;  4IUP A;  3AB9 A;  4XDX A;  4RGN A;  2A6E C;  2ICE C;  2A74 C;  1Q1B A;  1HRJ A;  1TWG B;  1IL8 A;  4YIJ A;  3CRL C;  1FNV A;  4HCE A;  3DDY A;  2XWB B;  1STY A;  4HN7 A;  2OT2 A;  3OIP A;  1V1P A;  1T5X D;  1EQT A;  5KRU A;  2OXP A;  3OWE B;  2AQ2 B;  1H9M A;  1I4R A;  4IQZ A;  3TN2 A;  1X3Q A;  3MFG A;  1QCB D;  2GK6 A;  4FF3 A;  4JMQ A;  1B1Z A;  2PW7 A;  1E1Q A;  2SEB D;  1CQV A;  4ZUI A;  2JA8 B;  3T4A C;  3K5M A;  5EPL A;  1GUO A;  1MD2 D;  2AQ3 B;  1WTP A;  3C46 A;  1BMF A;  1OXX K;  3NSW A;  1SKY B;  4XLF A;  3VYS A;  1SDF A;  1GHK A;  3FKS A;  4A3G B;  4XM3 A;  1IW7 C;  4L6T B;  4FP5 D;  3DUZ A;  3EA6 A;  3LWU A;  2XZP A;  4XON A;  1G2S A;  3Q23 A;  2KQ3 A;  2K5Q A;  3S1Q B;  1GUS A;  1TS3 A;  1H9S A;  3BCD A;  4DNT B;  1PZI D;  5C44 B;  2EYJ A;  2MGS A;  3SK4 A;  4KY5 A;  3TME A;  2QF7 A;  1CK1 A;  3RZO B;  4EGV A;  1RDP D;  5JPM C;  1EY5 A;  1VDZ A;  3I70 A;  2JYO A;  2X53 S;  3NP8 A;  2JDI A;  3D4R A;  1NBM A;  1Z6H A;  5EPK A;  4A3D B;  4ZAI A;  3TSS A;  1VMP A;  3K58 A;  2F0G A;  3GTJ B;  1EY0 A;  1F2L A;  4XL9 A;  2K6A A;  3BDC A;  4XT1 B;  2EPB A;  4FF2 A;  1XWE A;  3D6W A;  4H44 C;  3MXU A;  3HOX B;  2F0S A;  2F0K A;  3S15 B;  1AN8 A;  2E1B A;  2WJV A;  4B3F X;  3C1F A;  5I9P A;  4XLA A;  1H9R A;  2O5I C;  5KND A;  1LT5 D;  1F2Y A;  2FHT A;  3MWY W;  4WOR A;  4K6L A;  1Z7T A;  1Y1W B;  1U4R A;  5D14 A;  1K28 D;  1PMR A;  2Z4I A;  1Y8N B;  4KN7 C;  3RD4 A;  4IUU A;  3U9S A;  3V96 A;  5JPN C;  2X6W A;  3A7A B;  2X8K A;  4V0B A;  1JWM D;  1CZG A;  5EKL A;  5A2Q L;  3NTI A;  3SDZ A;  5A2Q E;  2TMP A;  2B2T C;  4IAL A;  1K8O A;  2EJF C;  1HTL D;  2RSN A;  1UD5 A;  1PFN A;  3WOF A;  1KNA A;  4XLH A;  5IGF A;  3IKJ A;  4YEL A;  2F0U A;  1WTX A;  1V0F A;  3QOJ A;  4DAV A;  2Z1C A;  1A2T A;  5A35 A;  3OHX C;  3OAA A;  1KLU D;  3KLS A;  3NQI A;  5LHY 1;  3H91 A;  4CBV A;  5KIX A;  4ULL A;  2L0C A;  2EDG A;  2QE7 A;  2M2L A;  3KLS X;  3A56 A;  4IFD G;  4Q0F A;  2PQE A;  4HSV A;  1FNU A;  2NZ1 D;  3A3B A;  5KGU A;  3S2D B;  1S5D D;  2F0V A;  2I46 A;  1EYC A;  3V05 A;  1C4Q A;  2F0I A;  5ELE A;  2R6G A;  3HEJ A;  2JSO A;  1CA6 A;  1KDB A;  1STA A;  1JB3 A;  4TSF A;  1STE A;  3K57 A;  4IN3 A;  2VJJ A;  2EYM A;  2XSC A;  5ELF A;  3GO5 A;  1VLY A;  4YEJ A;  1UNS A;  4G6I A;  4XQJ A;  3H94 A;  2F03 A;  3NTH A;  4OO1 I;  2L12 A;  5CV8 A;  4AVZ A;  2OEO A;  2LMC B;  1EY8 A;  3TZD A;  3VR3 A;  1BUV T;  4XQF A;  1I6H B;  1JCK B;  4ZKB B;  2RSO A;  3X3N A;  2IW3 A;  1TII D;  1PYW D;  1Q1E A;  2B39 A;  2PW5 A;  3NE5 B;  4C2M B;  2DY7 A;  2RDG A;  1HTP A;  1A3T A;  3C1E A;  1F9S A;  1EIH A;  3DEP A;  1JOR A;  2K01 A;  1SBB B;  2N55 A;  4CKE A;  1EFI D;  5I2Y A;  2J4X A;  3HZX A;  3DWQ A;  4DU9 A;  3FPU B;  1BOS A;  4FNF A;  1HZE A;  1U4P A;  2TSS A;  3FDT A;  3J7A V;  1NR4 A;  2EY1 A;  3OWF A;  2WV6 D;  3MAQ A;  1G29 1;  3BG3 A;  1ENA A;  3SHL A;  5LL6 S;  2ID0 A;  2IX3 A;  1SND A;  3K5O A;  4TSS A;  1TWC B;  3IAY A;  2EY2 A;  4OGQ C;  1O7Z A;  4DA2 A;  2GA4 B;  4UZU A;  4HAE A;  4J1M A;  4FXD A;  3SE0 A;  1ET9 A;  3VA7 A;  4QUC A;  2SDF A;  1PTO D;  5C0X H;  2F0L A;  3NK9 A;  3OOC A;  4HMJ A;  4FF1 A;  3URY A;  2QKI C;  1I8D A;  1WCM B;  4DNR B;  3GVL A;  3PO2 B;  1FYC A;  1BNZ A;  2YU9 B;  1BF4 A;  5D65 A;  3Q22 A;  4XTC S;  2B2Y C;  5IGB A;  3VR6 A;  5M3F B;  3CRK C;  4IZ8 A;  4DN4 M;  2NVY B;  1ESF A;  4CHT B;  4J8Q A;  1MI2 A;  4X3S A;  2WAQ B;  5ELC A;  3ZIA A;  2A6H D;  1Y69 U;  4KHZ A;  4H0L C;  2A6H C;  3ZYY X;  2K7V A;  4II3 A;  1PFB A;  1ICW A;  4B9W A;  2NTS A;  3S2H B;  5DM6 3;  2NN6 G;  2HCI A;  4RGO S;  3KK7 A;  1EZ6 A;  1BPL A;  1K8M A;  3P1H A;  1STB A;  4CKC A;  2C5C A;  1HCZ A;  4FXU A;  2BDN A;  4E0F A;  4IUR A;  1WD0 A;  1BCP B;  4A3I B;  3GTP B;  1YNN D;  3D4D A;  5IOC A;  2F0W A;  1PFM A;  4C3I G;  3RUZ A;  1HA6 A;  2FFK B;  2HQE A;  5AFW A;  1RTO A;  3PUZ A;  3GP7 A;  5K36 H;  5CDF A;  1PRT F;  5FL7 A;  4XD7 A;  5FO9 B;  2CHB D;  4RAU C;  3OEE A;  1CI3 M;  2X69 A;  4L63 B;  1I4H A;  2R92 B;  2E76 C;  3E0J A;  5I9O A;  1ILQ A;  3QG1 A;  2FMM A;  5M5W B;  1WTO A;  1D1K A;  4F8M A;  5CV5 A;  2W6J A;  1QOH A;  2JEA I;  4KK7 A;  5F2D A;  4CJ2 C;  4B3G A;  1YNN C;  2L55 A;  4G57 A;  4CKB A;  5J39 A;  1BO0 A;  4C3J G;  3HGB A;  4KN4 C;  4HCS A;  3K6O A;  1BXT A;  1WTV A;  3HS0 C;  2HLD A;  3K5N A;  1PRT D;  3NPP A;  1LTB D;  2KA7 A;  1I50 B;  3QWN A;  4QB4 A;  2A69 C;  4FO2 A;  5CGK A;  2Z6B D;  3GTM B;  2H1E A;  3AU7 A;  4G7O C;  4IFD I;  4FXG C;  2ZZG A;  1U4L A;  2DY8 A;  1UD8 A;  3ERO A;  3HOY B;  3O13 A;  1GJX A;  1WTH D;  2XRS D;  1BBX C;  2B8F A;  4I7Z C;  3MEH A;  4K2L A;  5KYL A;  2XOK A;  3GTG B;  2NVX B;  4LK1 C;  4RA8 A;  2X6Y A;  1E43 A;  2B2U A;  2HCC A;  4XLC A;  1STG A;  1LT4 D;  1UEA B;  3S16 B;  3A35 A;  3NBH A;  4F87 A;  1EY6 A;  1OHH A;  2XZL A;  1X3P A;  5KYI A;  4C3J B;  3DXJ C;  2RKS A;  3CQZ B;  2VUM B;  1A6X A;  3SK6 A;  2BE5 D;  1JWS D;  1PTO C;  1EIG A;  3A8K E;  3MC0 B;  3NBI A;  4ABN A;  2F0P A;  3QO2 A;  4DK0 A;  1GUG A;  4LAA A;  5FK9 C;  3R3O A;  5D3I B;  1J8I A;  1KNE A;  2KJX A;  4PMW A;  1SNQ A;  4RGM A;  3CKI B;  2R61 A;  1D1I A;  2GJR A;  4ODG A;  1TKW B;  2WKD A;  3H09 A;  1TY2 A;  1E2V A;  1LTG D;  3J7Y W;  4P2C B;  1LTR D;  3BVG A;  3AMU A;  2EVB A;  5K5P A;  3FVQ A;  1A3U A;  1BQQ T;  5JEA G;  2ZT9 C;  3KF8 A;  3KEW A;  2B2T A;  4KHV A;  1M8A A;  1LT3 D;  3BS1 A;  5KEE A;  4ZLT F;  1WTR A;  3BVZ A;  2L1B A;  2O4X A;  4G7W A;  1PTO F;  1LT6 D;  4YXW A;  3MXN A;  4B08 A;  1O78 A;  2VJI A;  3CP8 A;  1AEX A;  1CA5 A;  5IGD A;  3MXG A;  4IFD H;  4EQN A;  1SYF A;  3KLR A;  3MZ5 A;  3WQZ A;  1HHV A;  1ROD A;  5C3E B;  4OO1 H;  1Q12 A;  2KED A;  1DYQ A;  4ID6 A;  3R2I A;  5IK2 A;  1CTM A;  3WOE A;  3VR5 A;  5C4Z A;  5JVH 3;  3M4Y A;  4M1U B;  1KAB A;  5BN4 A;  3G05 A;  2F0F A;  1Q3L A;  2F0O A;  4XKW A;  3JU4 A;  3GTO B;  3VA5 A;  1ML0 D;  1PDQ A;  2IX1 A;  2E2D C;  2PZW A;  5JOB A;  3FMC A;  2LS0 1;  1SYG A;  3QIA A;  4QIW B;  3HOU B;  1FNW A;  3MFY A;  3ZPN A;  3BC9 A;  4XLE A;  2Y0S B;  3I8Z A;  3GQB A;  2PMZ B;  1HA5 A;  1IYV A;  3FEW X;  1I6V C;  1OXS C;  5DEH A;  2JJ2 A;  4XOP A;  1AZP A;  2SNM A;  4UDU C;  4U68 A;  5FO8 B;  2F1M A;  3BYT B;  3MHB A;  2WIN B;  1HFG A;  5C0X I;  2E2J B;  3KBG A;  2PPB C;  1ZXT A;  1I4Q A;  5CV6 A;  3BZD B;  2WAC A;  4BS9 A;  4PMC A;  2PZT A;  1SAP A;  3M85 A;  4OO1 G;  3SR1 A;  2MUY A;  3I4N B;  2JP1 A;  3OFN A;  4RH6 A;  1G6Z A;  4G7Z C;  1QWY A;  2WB1 B;  3V2T A;  3TDQ A;  2K32 A;  1HVX A;  2E2H B;  4NNJ A;  1ENF A;  1UD3 A;  4FF4 A;  2DN8 A;  3OMC A;  5CBE E;  3J80 E;  2EY6 A;  1D5Z C;  2EZV A;  1E3Z A;  4NMZ A;  2L4N A;  5E4W C;  4IUV A;  4IFD J;  1E0B A;  3PUW A;  1TU2 B;  4ASU A;  2DNC A;  5CYU A;  3TZU A;  3R8B A;  1PXU A;  1PZK D;  4XXE A;  1DON A;  1GUN A;  2XRQ D;  5JAV A;  2QDB A;  3TP6 A;  1B2T A;  2ZZE A;  5E3F A;  1VMC A;  4TT3 A;  2H4O A;  3W2D A;  1NAP A;  4OHJ A;  4AYB B;  5JJZ A;  4KY6 A;  3CHB D;  4NKL A;  1TT2 A;  4QCL A;  1B3A A;  1LTA D;  2ZTN A;  3GV3 A;  1DD2 A;  3UI2 A;  1TS4 A;  5K36 G;  1SNM A;  3A8I E;  1G91 A;  1HXY D;  1DOM A;  3BYY B;  1SMY D;  4RGT A;  1PRT C;  2HDM A;  3D4W A;  2K5D A;  1KZL A;  2EYO A;  4KD3 A;  4BY7 B;  5I6Y A;  2ZZF A;  2JIZ A;  2DNE A;  1GOZ A;  2Q8R E;  1Q8I A;  3GD7 A;  3BVM A;  1EYD A;  1RKN A;  2B2Y A;  4DFA A;  4BBR B;  2AUJ D;  3QOL A;  1Y1V B;  1R9T B;  1NR2 A;  1Y8O B;  2JA5 B;  3NUC A;  2F0J A;  1K83 B;  1TS5 A;  2EXZ A;  2XNA C;  2E2I B;  4Z1M A;  4N9P A;  5IT9 E;  3MA2 B;  3K7A B;  2ZXH A;  1PTO H;  4RWS C;  3I91 A;  3M7G A;  1OXV A;  3RZD B;  1AFP A;  2RBM A;  1V1P B;  4M8A A;  2JJ1 A;  1BCP F;  1FGB D;  2EJG C;  1U9R A;  2PNR C;  3PIP 3;  3L7Z C;  1IW7 D;  1DCZ A;  1LV9 A;  1Z47 A;  5J1Z A;  2M00 A;  2EYP A;  2F3V A;  4C3I B;  3MVV A;  5EKI A;  2ZXR A;  2F0D A;  3E6Z X;  1JE4 A;  2W6I A;  4G7H C;  3H6M A;  2IWH A;  3VR4 A;  2XND A;  5C4J B;  4IUN A;  1JC7 A;  1C8C A;  4X3T A;  1V0E A;  1DJR D;  2IX0 A;  5COR A;  4PNY A;  4R8N A;  1SYD A;  3R2T A;  3Q24 A;  1BCP D;  4XNF A;  2PYK A;  2CW0 D;  3ERQ A;  5C5M A;  2L11 A;  1G2T A;  2PZU A;  1O80 A;  1R4P B;  2K5W A;  5COY A;  4KI0 A;  1H9S B;  4I65 A;  1IKM A;  2F4I A;  2KVO A;  2ZXI A;  2J0T D;  1GUT A;  3SXH A;  1S5E D;  4EQO A;  3R93 A;  2A6E D;  3X3M A;  4XN0 A;  1HUM A;  2G9D A;  1QNK A;  2D2C C;  1QJO A;  1XX8 A;  4DAP A;  4ZKC B;  3PUV A;  3GTQ B;  1BR9 A;  1B53 A;  3FKI B;  1VJS A;  2XN9 C;  3IL8 A;  4KKS A;  2A73 B;  5T1G A;  1I3Q B;  2JA6 B;  5C6A A;  3FRP B;  5C3X A;  3OIQ A;  4NDX A;  4X3K A;  1QNU A;  2PCF B;  3JAM L;  1S5B D;  4ZYS A;  2F3W A;  1IHZ A;  4BWG B;  2V7Q A;  3J81 E;  2N88 A;  1TY0 A;  4G7X A;  1JOO A;  3K5L A;  2A5H A;  1R4Q B;  4K5W A;  2LZJ A;  2O5J C;  1ZEQ X;  1KAA A;  5KNL A;  4LMQ D;  1C48 A;  4WFN 3;  5IGG A;  3IFT A;  2NN6 I;  4UAI A;  1V43 A;  1T5E A;  4RCN A;  2WKC A;  2JE6 I;  1EU3 A;  1LTS D;  1D6E C;  1ZYR D;  2J7Z A;  2ICI A;  3HOW B;  2WZP P;  3OE7 A;  3HRZ C;  1DOK A;  3H3V C;  2SNS A;  3HOV B;  3D8G A;  5ELD A;  4BBS B;  1A3V A;  5E1F A;  2NYZ D;  1OXT A;  4XT3 B;  1COW A;  1D2B A;  1J9O A;  5DN6 A;  3GVK A;  3LX0 A;  1S4Z A;  1STH A;  1EZ8 A;  1WD1 A;  1CT1 D;  3IFD A;  5M5X B;  4QF4 A;  2DIE A;  3D31 A;  1L0Y B;  2LKV A;  2WSS A;  2B63 B;  2XVS A;  3DM1 A;  2R9V A;  4MIU A;  3NQT A;  1H8E A;  2XZO A;  1SE3 A;  3A7L A;  1CHQ D;  5CV9 A;  5G3L D;  4V19 0;  1EEF D;  5I4D A;  4II2 A;  1MSG A;  2IT1 A;  2IJ0 A;  3PUX A;  3RMH A;  1B4O A;  2E74 C;  2D9U A;  3N6R A;  1H9J A;  3QB3 A;  1MAB A;  1GHJ A;  1I18 A;  1SNO A;  5DM7 3;  3NWS A;  2LFN A;  4ZRZ A;  1H9K A;  4K8I A;  1GUW A;  1SFO B;  3SK8 A;  3OMG A;  4OIK A;  3TP8 A;  3BDL A;  1W6K A;  4XKV A;  2Q8T A;  2KCC A;  3I72 A;  4XN3 A;  4XR6 A;  4S3S A;  2L9H A;  4ILW A;  3VR2 A;  1UD4 A;  2KCN A;  3ND9 A;  3S1M B;  1B9M A;  1ET6 A;  3S9W A;  2X6X A;  2NVT B;  2K05 A;  3GVJ A;  4G4K A;  3HOZ B;  1I4X A;  4WJW A;  2JXM B;  4F7X A;  5ISR A;  4NP5 A;  2AUK A;  3L9A X;  4EVO A;  3OW7 A;  3C3L A;  2X6G A;  2CQA A;  2NTT A;  4K14 A;  3PO3 B;  1ZKO A;  5IOD A;  1EFR A;  2K1B A;  1EYA A;  1EY7 A;  1U4M A;  1RD9 D;  3CES A;  1YNJ C;  5T1I A;  5EBC A;  3VYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...