2X0KA

Crystal structure of modular fad synthetase from corynebacterium ammoniagenes
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
338
structure length
338
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Oligomeric State in the Crystal Structure of Modular Fad Synthetase Provides Insights Into its Sequential Catalysis in Prokaryotes
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 102
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2x0kA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2x0kA01
1VBKA 2IP1A 3H05A 1N3LA 3H99A 1F7VA 3QTBA 3GLVA 4MVCA 3PNVA 1WOYA 1WXHA 1JHDA 2AZXA 1ULHA 1N08A 5TEVA 2RD2A 1VL2A 3H97A 3SEZA 3C8ZA 2C5SA 1K4MA 1OWLA 3IOEA 4ZT5A 3ZXIA 1O95D 4OUDB 2GOYA 3FH0A 3FHJA 1HYBA 4EG3A 4F4HA 3N8HA 1TYDE 1JECA 3H9BA 1NUPA 2QTRA 3PNBA 2CYAA 1N06A 2JA2A 3RJZA 3MLAA 5A8AA 3FDXA 4HJRA 1N1DA 3CA8A 3FETA 3UK2A 3PRHA 3MLBA 1ILEA 1B6TA 2J4DA 4DDHA 4JYZA 3IVGA 4WNYA 3HMQA 1PG2A 3K9WA 3ND5A 4MVYA 4S1OA 4MW0A 4NAUA 3SYTA 1P7PA 1QNFA 2CYBA 1WJGA 1CT9A 1LI5A 4MUJA 3Q10A 1NUTA 2VBTA 4P2BA 1JIIA 4GRIA 3HL4A 3SZGA 4EG4A 4PY2A 3HZRA 3IODA 4MUIA 3FNRA 2D54A 3CLUC 1QTQA 4G5FA 3INNA 2GKSA 1F7UA 1MRZA 1J70A 2Z09A 3IDFA 5TRDA 1JIJA 4ZT6A 4E1AA 3LCJA 1EFVB 2J08A 3LOQA 2AG6A 1WY5A 4X0EA 1N2EA 1YUMA 3N2YA 4EG1A 2E18A 1N2IA 1WZ2A 4MW1A 5LLTA 5LFAA 2NZ2A 3GUZA 3MXTA 2EJCA 2V0CA 1TYAE 1NZJA 2PFSA 2I1LA 4KR9A 1R6TA 5FO1A 3DLAA 5HUHA 2D13A 3CLUD 4J76A 4R2LA 1PG0A 3ILVA 3UY4A 2PIDA 2CFOA 2A86A 1H3FA 1LI7A 3P0JA 1MB2A 4NZPA 5FO0A 4ZCPA 3NBKA 5KWVA 2G36A 3KT6A 1GZUA 3KT3A 1U7DA 3ND7A 1T9GS 2X0KA 1YIAA 2X1MA 2DXIA 1O5TA 4DE5A 3FWKA 4ZT3A 1NUSA 5J58A 4NATA 1DNPA 5EKDA 2ZP1A 5FNZA 2B7LA 4QREA 1R6XA 2E21A 5DEOA 2D5BA 1IH8A 3TQOA 4U8HA 3NBAA 3BNWA 3UMVA 3N9IA 5DK4A 1Q15A 1PFVA 3A04A 1VLHA 5TGTA 1KAMA 5H16A 2PZAA 1ZH6A 1WXIA 2WQ7A 4XFDA 1JEDA 3P0HA 3Q12A 4GU5A 3UC5A 2CV2A 3K32A 2WSIA 4ARCA 2DR2A 1J09A 2EL7A 1KH3A 4KR6A 1OBHA 4CDMA 2QTNA 2CV1A 3HV0A 4MWBA 4DLPA 3IVCA 4NDAA 2VTBA 1H3EA 1MAWA 2HMAA 4YMIA 1T6XA 4YP6A 2OYNA 5TS2A 3TZLA 3QTTA 3DV2A 1MAUA 2A88A 5AHWA 3FIUA 2PZBA 1EFVA 3X1MA 2J5BA 4RPIA 1OWOA 2QJFA 1WXGA 3RBAA 1Q11A 3RK1A 3M5WA 4KKVA 2YWCA 1EJ2A 1KP3A 1VBNA 3X1KA 4JXXA 2AKEA 3KT0A 4A91A 2HZ7A 3FI0A 2YY5A 2YWBA 4DDKA 2J09A 1J20A 1N2OA 2JANA 2CT8A 1YI8A 1ZJWA 2TS1A 3HGMA 1M83A 4UZFA 4FZJA 1T6ZA 1F4LA 4NX2A 4EG5A 1KP2A 2PG3A 2A1UA 5H7XA 4ND6A 2O8VA 1O6BA 3G5AA 1JIKA 1O0BA 3CVVA 3U1VA 4MWCA 1NI5A 1Q19A 2CV0A 1N2JA 5TEWA 1U7XA 3DO8A 3TNJA 4JZYA 1R6UA 4KPUB 3AL0C 1O96B 1KORA 4PBSA 1G8FA 4JFAA 1Q77A 4OJMX 4I6JA 2H29A 1MC1A 1N77A 3TZEA 1Q9SA 2P3MA 2DPLA 4MW9A 1U3DA 4CDNA 1WXFA 3IUEA 1MOPA 4HJXA 3AFHA 4MVWA 1EFPA 4G5YA 3DPIA 4JXZA 1I6MA 1PFUA 3TS1A 2DLCX 1TQ8A 2QJOA 4EG6A 3SDBA 4MUHA 2X3FA 1TYCA 3IH5A 4EFKA 4ZCSA 1I2DA 4Q93A 5LM3A 4MW7A 2X1LA 4YP7A 2ZUFA 1IQ0A 1H1TA 1TFUA 5A88A 1F9AA 4PBTA 5K0TA 4MAFA 3ZGZA 1LW7A 1TYBE 3CVXA 4L2IB 1QQTA 3RFFA 1XNGA 3BL5A 1N75A 4OUDA 1X6VA 4HPWA 1QRTA 5K0SA 1N05A 3D6UA 4MVXA 1M8PA 4MUKA 1J21A 4I6GA 2QUHA 2A1TR 4U7JA 2CUZA 1GLNA 1M8GA 1JGTA 2CYCA 1P4MA 1QRSA 1KR2A 3OP1A 1IHOA 3G59A 4MWDA 4ZT7A 3A2KA 1OBCA 3P0IA 5J5AA 3ISJA 4PBRA 4ARIA 3IMGA 1YUNA 1JMVA 5DB4A 3SP1A 4QRDA 4WSOA 1PFWA 4YBRA 4ZCQA 2CSXA 3FY4A 1D2RA 3CLSC 4F3RA 1SURA 2Z08A 1M8KA 1IRXA 3ZIUA 4EG7A 1I6LA 3H9CA 4MUGA 1K4KA 1S4MA 3ZUGA 3TQIA 4MW6A 2VBVA 1EUYA 1WQ4A 3CVWA 1M8JA 1G8GA 2WB2A 3SEQA 3VRHA 3L92A 1N07A 1IQUA 1WXEA 3IUBA 1JZSA 3CLSD 1KQOA 1N2GA 3X1JA 3PNYA 3COWA 4DNXA 2QUJA 1J1UA 1NB0A 5JBNA 4Q16A 4R2MA 1X8XA 1COZA 3COVA 3CR8A 1TEZA 4ZT4A 2IJGX 4BWVA 3D6VA 4MWEA 3ND6A 3ZJTA 1JEEA 1O94C 2A1TS 2NSYA 2QJTA 4J75A 3GMIA 1IQRA 2RE8A 2Z3VA 5A89A 3ZJUA 2DUMA 4MW2A 1A8HA 2V0GA 1M8FA 2R5WA 1JZQA 5F23A 3L93A 4QBTA 1QJCA 1H3NA 3SZ3A 1KAQA 2E0IA 4XFJA 1KH2A 1GPMA 1ZH0A 1OD6A 2QUIA 1T6YA 2GM3A 2HGZA 3AG5A 4L2IA 1K97A 4MQ6A 1O94D 4R0NA 4MULA 1G59A 3AKZA 2DEUA 1KKUA 4MUFA 4ND7A 1OWPA 2QTMA 3FOCA 3ZXSA 3OTWA 3CVYA 3FG9A 3NV7A 3RHSA 1FFYA 2DERA 2A84A 1I6KA 1PFYA 3A4IA 2QUKA 1Y42X 4DDMA 1RQGA 3ELBA 1GAXA 2OV4A 3AIIA 3HFJA 4HK4A 4UZEA 5KHAA 3E27A 3QE4A 1IVSA 2OQ2A 1IFXA 1WQ3A 4CQNA 1J1ZA 2VBSA 4TS1A 3IOCA 1T9GR 2BYTA 1U0BB 1K92A 4K0RA 2VBUA 4DJAA 4NAHA 1FYDA 1GN8A 1O97C 3F3MA 2ZUEA 2VTBB 1KQNA 3S3TA 4G6ZA 3COYA 3IMEA 2PXHA 3ZJVA 3MMXA 4AQ7A 3UOWA 4AS1A 2JAXA 4ZCTA 1NB9A 4MLPA 1XNJA 4EG8A 1KQPA 1OWMA 1NP7A 1YULA 5KCMA 1WKBA 3G6KA 3N05A 1NYLA 1G8HA 2J07A 4MW4A 4MUNA 1N78A 1NSYA 4YP5A 1O97D 2O5RA 2E89A 3I05A 3CLRC 3AG6A 2DETA 3LE8A 4EF6A 5DASA 1EUQA 1QU3A 1NURA 1MBZA 1EE1A 1KH1A 1M1ZA 3COZA 4I6EA 3IVXA 3Q4GA 1NUUA 4RUKA 2PZ8A 1GTSA 5HUJA 4KR7A 4CT0A 3IMCA 3MUEA 1OWNA 2A1UB 3CVUA 2XRYA 1MB9A 4K03A 1MJHA 2WQ6A 4MUEA 2XRZA 3JXEA 3PXUA 3CLRD 3KT8A 5HG0A 3RK0A 1O0CA 1EXDA 1ZUNA 1UFVA 3P52A 1QRUA 4KPUA 3VU8A 3A05A 1O96A 4ZT2A 2BTEA 3CLTC 5IHXA 5J59A 1NUQA 2H2AA 3CTAA 3VGJA 1QU2A 4H3SA 5BNZA 1N2BA 4XSVA 1JILA 2VXOA 4U63A 1N2HA 1XNHA 5IJXA 1EFPB 1GTRA 1V47A 2IELA 2A7XA 4EGAA 2YXNA 2A4MA 3KFLA 1BS2A 1V8FA 1O95C 1XJQA 4ZCRA 1VBMA 1U3CA 1YIDA 3CLTD 3IOBA 4MW5A
chains in the Genus database with same CATH superfamily
2FJPA 2IP1A 2OHIA 4LWZA 4R31A 5FR1A 3ESAA 3IP3A 3VDNB 4AVYA 4L8GA 4LVCA 1SIOA 5BW8A 2HA4A 2HNBA 1E3TA 5LYJB 3KTAB 4JS0A 2GJPA 3WE7A 2HK6A 3W2EA 2BHLA 4RPHA 1EUCB 3ITKA 2QRGA 4HYTA 3SF8B 4V24A 4B7CA 1GLGA 3OKAA 4OUDB 4Z4CA 4MV3A 3JQ7A 3O8CA 4LDZA 1QHHB 1I4DD 3D3WB 3K16A 4HH3C 4TM8A 2X0IA 2YASA 3OQIB 4DCGA 1AKTA 4CIWA 4C0QC 1GSOA 1HYBA 4G5RA 2GEJA 1JECA 1SIUA 1QH1A 4L7VA 2HRRA 4IOLA 1G8MA 4W6QA 2ZUDA 3LCCA 2X0DA 2WUGA 2N9UA 2K6GA 5LC1A 5HMMA 2CYAA 5FWYB 5L3QA 5A8AA 1SU7A 1UM8A 2VQDA 3L0PA 4HLDA 5G0TA 3RS5A 4U0JA 1EESA 1KZGB 1OFUX 3SZOA 1FMCA 5EIHA 5EG5A 1U1EA 4RDIA 2IKSA 4U9HS 4FB4A 1LQ2A 1A9XB 4JR1A 2V97A 1XN1A 4FWTA 3NU1A 4OOSA 3KBBA 3CPJB 2JIQA 1BCRB 4NWIA 3SVLA 2JLWA 4Q7QA 1MT3A 1AF7A 5KZMB 1C5KA 2JFXA 4LXGA 5DXAA 2VRWA 1O7JA 1U0LA 1EFDN 1V37A 3EK2A 3TXYA 4H6WA 2VBTA 3HMKA 1JL3A 1RAHA 1JIIA 2JHPA 5EPUA 1SHKA 4DRXB 4TROA 2F3QA 5CB0A 2YBEA 2Y1FA 2W6JA 2BI7A 1B00A 3DC2A 2HPHA 3NC4A 5HZAA 4LZZA 4PY2A 2JVIA 3F4BA 3K2EA 4RVGA 3SF0A 3VMMA 3NALA 3B48A 5E4TA 1QIIA 1DE0A 4HSGA 4ZVSA 3NNNA 3HC7A 4UU8A 1DEHA 2HK9A 3HCAA 4BAZA 1BMDA 1OIXA 1SBTA 2FY8A 1JQ3A 4GKKB 5TRDA 3PL5A 4EKNB 1DIGA 3NAZA 3FTDA 3V80A 4EX7A 3N2YA 5FLXA 1T9HA 1V5FA 4BGVA 1NVXQ 3PGJA 4BRUA 1DEKA 4TL8A 2OWDA 1YHZA 2ASEA 1Z4IA 4I9FA 2VJBA 5KBYA 3I73A 1CYEA 4R01A 2ZTLA 2XNDA 4DA7A 1FVHA 2Z57A 3F5DA 2OO5A 4HNAA 1NVKA 2ODNA 3EFEA 2XVMA 3OO1A 4MS1A 5HGJA 3EODA 5HUHA 4A15A 1X14A 4B4VA 5EIEA 2BF4A 2VI5A 4EHJA 4FR5A 3RTBA 4KXUA 3VJRA 1E2KA 2HCFA 1T9AA 1DAEA 4Y6PA 3D1JA 3Q41A 3Q1KA 1XF1A 1IHPA 1QX3A 3Q7RA 2RBKA 1SU8A 2Q7OE 3ZBPA 4QU5A 2H1HA 1FU8A 3AERA 3WL7A 5JYBA 2CVPA 1XCBA 2ONKA 3G2JA 5JH7F 3WY9A 2WPDD 4B75A 3OMWA 4EARA 4FYHA 3NRJA 1HLPA 4HDKA 2Q6VA 2DWPA 3BBLA 1R8YA 2GF0A 3ZE2B 3ZWNA 3M8KA 3ZU5A 2P79A 1LX7A 3ONNA 4G5OA 2ZP1A 3OURA 4Q3EA 2FE1A 2VXBA 4EMBA 5H80A 4YEDA 4ER5A 3N8DA 1Z8HA 1EGAA 2ZQZA 4HQNA 5CYOA 5F4JA 3UMVA 3AVTA 3SGLA 4NYMQ 2P9CA 1SHTX 4JDUA 2UYCA 3M4JA 2GJRA 3OJXA 3BFKA 2XXJA 5DNWA 1L4HA 2YDXA 2ZAIA 2HX1A 4F3YA 2HEIA 4XGQA 5DFAA 3BWBA 2D2XA 4QATA 5LKAA 2IY8A 1F2TB 5JCOA 4BFXA 4Z4IA 3V1KA 3NWBA 3SVTA 4RY2A 1PSDA 1LBTA 1BQ4A 2G40A 3NFRA 5IRCD 2BH2A 3WDLA 2AFHB 2F1OA 4O5AA 1YONA 2ZJ3A 5KSPA 4EEZA 2H2WA 1JDVA 2FOLA 3FOBA 3FPHA 2PRZA 3LZCA 4MARA 1LPOA 3CMCO 3FTPA 4GLOA 2CB9A 4W5QA 4HXFB 1KH3A 3JD1A 2YQ5A 3FNGA 3OMLA 2PMEA 3IQXA 2QTZA 4I1YA 3Q7IA 1U2QA 4QG7A 2ZWPA 4YDSA 1HE1C 2GFIA 3PQFA 4ZZIA 1NR1A 3ETEA 3V8BA 2NP7A 3DOHA 5A1TA 2G9VA 3TZLA 2SCUA 1W2WB 3FE2A 1SKYE 3OZIA 3QTTA 1ZHHA 4BVEA 4HE5A 3IXLA 4W8OA 3PNSA 2Y1DA 4KO8A 4DG5A 4HPJB 5CAEA 4JC4A 5FYDA 4RANA 3AHCA 2WWFA 1IG0A 5ES3A 2JEZA 2EJWA 5AN9A 2ZJFA 1WY7A 3AESB 3EMDA 3H9UA 4EW2A 4YT4A 4CKYA 4CF3A 5JMOA 1KR5A 2LPMA 4KR2A 1GY8A 4JXXA 1SD5A 4JCCA 2VDOB 4CTKA 2HU5A 2NZXA 1YKFA 5ALUA 1TCBA 4M9ZA 1RXIA 3UAXA 4JOCA 4AQYB 4UZUA 2XNKA 5IYQA 3FI0A 3P9RA 1XEAA 4AXXA 3GIWA 4DNRB 1A7AA 2ZITA 1CIJA 2VBFA 4FU0A 5LCXA 1E9CA 3HGMA 1FUYB 1USUA 2OOKA 2OT3B 2GEFA 5FULA 3JQFC 4MIOA 1YQDA 2YRFA 4W4TA 4YAIA 4Z8XA 4JQZA 4ND5A 3VVLA 2PG3A 3QVXA 1KPHA 3RM3A 5GJVC 4C4AA 5BWCA 2XSZD 2AZ4A 4WBNA 1MX5A 4KO4S 1UBSB 4DZRA 2ZPUA 3A4MA 3CVVA 3UQZA 1LA2A 4RQAA 4EB0A 1E0AA 1GGFA 2Q3CA 3NHAA 1N2JA 1WAMA 3HA7A 4D8UA 1XVVA 1W36C 3O95A 4C1NA 4NK5A 3GEHA 1F1JA 4LZPA 3UJ6A 4A92A 2CXPA 3CFYA 3CF2A 1SVLA 1E2DA 4O63O 3FSRA 3GRYA 3T12A 2XY4A 2AB0A 4P54A 1GHTA 1U6JA 3VH3A 2PM8A 1YZLA 4EY4A 1I3MA 2Q4RA 4G4GA 4RLFA 1V1MB 2G8LA 3EQ9A 4I1VA 4IDGA 4ZVTA 4EEXA 1BXRB 2WNIA 1NNI1 4C0JA 2VPXA 1T2FA 2QK4A 2L18A 1Z08A 1QDEA 4NU0A 4KN5A 3Q6MA 2CEAA 1WSBA 1GTG1 2O4CA 4HDNA 4WJKB 1VZ2A 3LKZA 1KPGA 2WRZA 4EG6A 1U8ZA 2GJKA 3DDSA 5TE9A 1F9EA 3C85A 4ZCSA 1USIA 2ZAGA 1MO2A 4AF8A 2DPMA 4GQNA 4FDMA 2J31A 4LY9A 1JHAA 1LSUA 3KAQA 3QG1A 5TS3A 5FOWA 4QG3A 3EZFA 4M0DA 2JIZA 1QKIA 3GNSA 3OCJA 1YTUA 5D3ZA 2JGLA 3EXIB 4Y0AA 4L2IB 4H7FA 2VP2A 5EXSA 5L6MB 1Q7YD 4H15A 2CDRA 2F48A 4DLKA 4EQ6B 4ZEOA 3LFUA 2Z95A 1OHHD 1V3QE 3HWSA 2OSBA 4HPWA 2AG0A 3ZV6A 2Y0DA 1GWNA 5KHLB 3MRSA 3ZH9B 4S1TA 2OXEA 3L05A 1HFJA 4YROA 5BWMA 1X3LA 2ZE8A 3KZXA 4FW9A 3WRXC 2J59A 4Q3BA 1PVVA 3G0GA 3MTBA 4DEYA 4L74A 1J9ZA 1IM8A 3VR4H 2Z3ZA 3IPYA 3AH8A 1C3OB 4OSEA 1L5GB 3CEHA 5EIOA 5I9NA 5KSYA 3A2KA 2R25B 3L01A 3WKEA 4AZ3B 2AOUA 3PFCA 3SLNA 1XQ1A 2CXUA 2GRUA 5TPZA 4C4OA 4DJFC 5KSZA 5F12A 1EFLA 3STHA 4RDJA 1DKOA 2EL9A 4F3RA 2PUGA 4RLSA 3EEOA 1CF4A 2IYWA 1IZ7A 2FCRA 2C3UA 4RPGA 4H9GA 1VGQA 4MYCA 3ZIUA 3F97A 3E8XA 1IBSA 3U9TA 1EP3B 3A10A 3EIXA 5CXUA 3MGBA 3N53A 1PW7A 3BXXA 1SUFA 1COWD 4FCVA 3ZIDA 5HXAA 1I4LD 1K68A 3H8WA 3RANA 3TCKA 4XLAA 3V00A 2R6FA 1QYRA 2OR3A 2HO5A 1CZRA 1Z68A 4QE3A 2XGOA 4GL2A 2DFLA 4UU7A 1V3VA 3TM5A 1G8GA 3CEJA 3TRIA 5AVRA 2KLHA 3VPAA 4NZYA 1TW2A 2XKJE 1ZD5A 4EHLA 3ABRB 1F2UA 2BZGA 1CY7A 1GA1A 1YL6A 2G4VA 2QN1A 3BIJA 5FA5A 4YPFA 1KDYA 3UCFA 1KJWA 3FCYA 4AAYA 3AEZA 3ZXXA 3ROGA 4AJ2A 4JU8A 4EHDA 2VSXA 2PQ0A 2HUPA 3B2QA 4L76A 2PD6A 1PG5A 4R1MA 2QXYA 3KQUA 4MWEA 3ND6A 1C3EA 5I9SA 3OP4A 3PWKA 1BS1A 4W8HA 2ZETA 2WHQA 4IILA 1JDBB 1OE0A 5A89A 3H6HA 4G1CA 3UT6A 1T29A 3ELWA 1TVMA 3HU2A 4R98A 2TYSB 4ZGGA 3AP1A 1WMEA 2QRJA 3D3JA 3QXCA 2MCFA 3EUAA 1JX6A 1PQWA 2NZ8A 3B9BA 1B26A 3TW8A 4AXBA 2B83A 1IOZA 1YWGO 2RGWA 3SHFA 1GCOA 4MUAA 2AIRA 4R71A 5SZHB 1NOKA 4EFMA 1S9DA 1I13A 2QYOA 2ZREA 3I8OA 1B6RA 2WE8A 4BMVA 4YRGA 2QUIA 2X0FA 3TVTA 5DLYA 4I9HA 4RD6A 1KOGA 3D3KA 3G82C 2WZNA 5TMDA 5JTTA 5AVJA 2OCLA 4CCYB 3HVUA 3RHTA 1EP1B 1Q16A 3AUKA 5GQSA 2IEAA 1FUIA 3OD5A 1YACA 1DLJA 1U02A 2ORWA 1LK7A 3DZIA 2CUKA 2QYHA 4H4EA 5FWDA 3RYCB 1UD2A 2C2KA 3L46A 2WNSA 1J24A 121PA 5DCUA 4UHFA 1FFYA 2A9FA 2O7RA 5AK3A 2DERA 2D1SA 1EA5A 1XZ8A 2JW5A 3H18A 2RIPA 4H4DA 3OC0A 2VRCD 1QE3A 1TJPB 4KU4A 5DHFA 1DAOA 2W6QA 1G21B 2WYVA 3G89A 2VP9A 1K6XA 2O2EA 4LJ7A 3FAKA 3RFUA 1RI2A 3VISA 2KJQA 2GD2A 1LK0A 1KNXA 3DFKA 3E22A 5B53A 3TPZA 1AY0A 1JFFA 3TLCA 3V32A 4DILA 1FUUA 1RWKA 3AEKA 5E6UB 4DGQA 3ZCRA 3OJLA 5LA6F 4RLZA 3ANXA 1QIHA 4O5OA 4UD6A 4BDTA 2BYTA 2FK7A 4RV5A 3L1VA 1CJKC 1YE3A 2DHRA 4X97A 5EIFA 3L40A 1YMUA 3B1FA 2PWPA 1LEHA 3FROA 3IJRA 4RVOA 5SV2A 3CW2A 5THQA 1DFIA 3I0NA 2ZK7A 4KCGA 1F2VA 2JCXA 4QO8A 1U7TA 4LE0A 4M7PA 1Q0HA 1ZGAA 1N3YA 2WY2D 3I9V6 2ISCA 2ZRDA 3FCEA 4UFNA 1XT6A 5GWXA 2BGUA 4CIVA 3UAGA 2HJWA 4MJXA 5CBPA 3LF1A 3WLLA 4ZD6A 1SB9A 4M1QA 4RE5A 3ZGOA 4E7OA 3GJRA 3O8DA 4YRAA 4BVLA 3RG2A 3G2LA 1C9EA 2J07A 4D4GA 1R4NA 4RPBA 4GS5A 4KMMA 1Z83A 5EPOA 3GN2A 4F5DA 4QOIA 1DXYA 1Z2NX 1E4EB 4M1YA 5AVYA 3P2YA 5LP6B 4JYAB 1YS4A 1WUIS 1E8NA 4HCJA 2I3AA 1A7KA 3T51B 3AG6A 1BVRA 2FJUA 2D74A 1XJCA 3I92A 1OXBB 1T9ZA 3Q8XB 3C8DA 2MSEB 4JBGA 1FMTA 1GTJ1 4LJAA 4ZXPA 4I6EA 3UT0A 1TC2A 3GP3A 4GPIB 4N47A 5CD1A 3CCQB 3MS2A 3A1VA 4P7GA 1GCUA 3OOJA 3HB7A 2J5RA 2PL9A 3I9OA 3KB6A 2LTAA 4AS2A 2VF2A 4KRYA 1XRSB 3CVUA 1P4HA 2YIVX 3EIHA 2YCLA 4OSPA 3I76A 4XLLA 4E07A 1KYXA 3MTJA 3KQKA 1IWPB 1R9NA 4HT3B 4IIGA 4L28A 3SS9X 4BNNA 3OPYB 3QE2A 3JQEA 3SQLA 3U16A 3F5MA 4HEA1 4P32A 3RS8A 4IJ5A 1ZR4A 1K4YA 4CM7A 4DLAA 2VYCA 1J0XO 1H05A 2HF8A 3UPTA 1UK9A 4A16A 4BV3A 4JLBA 2BUAA 4CMEA 1SKUA 1IMJA 3RF6A 3AR5A 3AI2A 3AP2A 4MRVA 2M6SA 2C94A 2VJAA 1FVFA 2PA0A 3NRBA 1U2GC 4O02B 5IHXA 1C81A 4DMLA 4RQTA 3A37A 2FI1A 1E2FA 1RD4A 5BRAA 4XSVA 3UN1A 3VI4B 3ZEAA 2AYZA 3OPOA 3CX3A 2F17A 2FB9A 2PKWA 3B3AA 4IUDS 1TK3A 1SXJE 4RHYA 1V47A 2B69A 3EZLA 1CG6A 4QUDA 4DEVA 3OIDA 5JU6A 1ATZA 3PC8A 1POWA 1M10A 3VR6A 2W8ZA 1B41A 1KHTA 3E18A 1FRFS 3NANA 3RKSA 1F8YA 3R0IA 4EY6A 3C15C 3ZDZB 3AVUA 2V96A 4B7AA 1E20A 2X2PA 1VXOA 5BWBA 1A5SB 1GZVA 3PA2A 1PR4A 1F4VA 2NZUG 3WRYA 4OSOA 3L0ZA 3DO5A 4Z2AA 4U6QA 4CLEA 3BGDA 4I50B 3RT7A 5J3OA 4MK4A 4ZYLA 2X85A 5JE8A 1H2ZA 2YJ3A 3EF0A 3OM8A 1R6AA 1B8OA 1VL2A 3AFNA 3GAAA 3COJA 2ZJZA 2H31A 4OOXA 1E64A 4BO7A 2GUGA 4MB2A 3WIBA 4B4WA 2LKDA 3LKVA 1NJ6A 3AF5A 4KUEA 5EQFA 1BIFA 4HUQB 4IGEA 4L95C 4MCAA 4ER6A 1LGYA 5I4IA 3PJFA 1DQRA 1Y4ZA 3GLFA 4DV2B 1TYDE 3RW9A 2GCOA 2I54A 2PMCA 4F5WA 4R3NA 1E94E 2PUTA 1BU5A 4Y0NA 5DLPA 5TT1A 4ABTA 4IIVA 5EIAA 1FSSA 1C2TA 5EWMA 1P9LA 3IAUA 4RA9B 2QX8A 3O84A 1Q22A 1QOPB 4GF5A 1FXUA 4ZYZA 1VI2A 1R10A 2YIMA 1Q2XA 2V9ZA 2ZSAA 3WZLA 3DGEC 3DYIA 1Y7LA 3RBXA 1JBQA 3LGSA 3LC1O 3NHYA 4E4YA 1S2DA 4UHBA 1WP9A 2F43B 1RWMA 5DM0A 2XWJI 4H60A 1G63A 3AF3A 3U60B 1NC3A 2ADMA 1D9ZA 3USES 5TGDA 4X6XA 5ALVA 4AYTA 3OOHA 4J0IA 3ZHOA 4R5MA 4FWBA 5LYJF 3OC6A 2CLFB 3VTZA 5KB3A 1WSDA 1N4AA 4Q03A 5DRTA 1JV2B 2C8LA 3PFBA 5AVOA 3SC2A 1HYGA 4P98A 1NUTA 3II6X 1Z56C 1QHGA 4P3YA 2RHTA 4XEUA 3AGQA 1FDSA 3HZRA 4L73A 1WB4A 1B1AA 2VHVA 3FWHA 4LX0A 1ENPA 3GBSA 2NNLD 4UE6A 1XZDA 3AUXA 1X7XB 4W7SA 1WP6A 1U9IA 4J2TA 2ZSUA 3ZQJA 3IDFA 2J7PA 3AKEA 1JT9A 4QOGA 3SC3A 4DN6A 1ZICA 4Y9UA 3H5RA 4XOIA 3ELDA 3O47A 4YCJA 5KVVA 1LVHA 1T5HX 4EG1A 4O2AB 1Z5WA 1NQAO 1TB4A 3QJGA 4W82A 1QR6A 2X9LA 3F6CA 3DEZA 3GDWA 3OM0A 4MW1A 3OECA 3GUZA 5FTLA 4BVHA 2JJ1A 2W2VA 2H2DA 3T5BA 4HWKA 1XA4A 2Q3HA 1ZD4A 1J9EA 2WAMA 1NQUA 2ZJBA 1F2DA 2DM6A 4BWYA 4C0BA 4UUAA 5CA1B 4YLYA 5IH7A 4YRTA 5A4IS 2R8ZA 1VQ5B 2E55A 3CXRA 3Q98A 4ADSG 4WASA 1E5VA 1GZUA 2CLEB 1PJTA 2B2NA 4Z4ZA 4WESA 3IIJA 5AKKA 3RUFA 3WRWA 4GDFA 3UFXA 3A0UA 1BEUB 3FYUB 1X80A 4E6PA 5JATA 1DMRA 4OX9B 3B1ZA 5H9VA 1LPSA 4M9CA 2XAAA 1WR8A 4DPLA 3RVKA 3HWRA 1EWVA 1Z2CA 4F3KA 5F3WB 4UM9B 3I4CA 4WLVA 2OBBA 2FE4A 1O57A 3P9KA 1T5LA 5I9TA 2XCLA 5GGYA 1E3WB 1R5NA 3DVSX 4Z4FA 4DJDC 3GEBA 2D5BA 3KVRA 1Q7EA 4OAPA 1LLUA 4AZSA 1DBPA 2FSVC 1ZI8A 3DO6A 1Q6ZA 4K2AA 2PZLA 1JAIA 1EFRD 3NDJA 1I4WA 2QUAA 3IIMA 1JXQA 2MYNA 4EJ2A 3GSIA 4RKQA 1KAOA 1QS0B 3V8QA 1WZNA 5IAGA 1IYZA 4OQMA 2HRDA 1N0WA 2Z5VA 4YP0A 4HYYA 4EB6A 4TZ6A 1WKVA 1Z6YA 2RHBA 2G71A 2CV2A 1N5KA 2Q5QA 2VJMA 4FUQA 4I1IA 1K28D 2XYVA 3M70A 5HBGA 2WU3A 2FMHA 4FEAA 3AW9A 4R1OA 3T3PB 1E7RA 4ARCA 3I23A 4CE6A 1TIBA 3C7AA 4LYAA 4ZAZA 2DR2A 2R5FA 3H83A 4TUYA 2J85A 4JUAA 4XQ9A 5KOIA 1XPOA 1ZITA 1VE1A 4NJMA 1SY7A 2CXHA 3EFBA 3L0CA 3PEVA 3EA0A 2QTNA 4KLZA 5G0UA 3S2UA 3SHWA 3V7NA 4DTCA 3AM5A 2H2HA 1Q14A 2B1GA 4TLEA 2O6LA 2VTBA 1DOAA 3AI3A 2UUCB 5IJAA 4YMIA 1DQZA 4MRMA 1I2AA 1WETA 3SD7A 3KCNA 3PQCA 1KE2A 4E94A 2EYQA 3IEKA 3W4JA 3A1UA 1PGJA 4JJKA 3MTDA 3T3EA 3THOA 5BVGA 2J5BA 1J2YA 1JRLA 1OZGA 3DMDA 2WUWE 4V3BA 3BGWA 4MVJM 1ZX1A 3CPSA 1WKCA 1G9TA 3OZRA 5FOTA 3CWZA 1KO5A 4X91A 4HTFA 3ZTTA 1P2FA 3LCUA 1WSWA 3OJEA 3RIGA 4IJQA 1PK7A 2C03A 4FJ0A 4BBJA 1ZJYA 4RIFA 1PCXA 1TMGE 4ZMRA 2VRBA 4AJLA 4JEHA 4RSGA 1L5QA 5AKHA 5CDSA 2NU9A 2PTGA 3N2GB 1HQYE 3PC7A 1L7XA 1W5BA 3M49A 5CH8A 5HIMA 4GM0A 3R7WA 4QEDA 3FFWA 2FFQA 1G18A 3RUEA 3WB1A 1W1IA 3W6NA 4RCVA 1O0BA 5C1IA 3N0WA 1T6ZA 1EWKA 4HLUC 2AJLI 4IEIA 2E82A 4RX1A 1J7KA 4GP9A 3UF0A 4ND6A 2PXCA 1KE1A 2O8VA 5B57C 4F7WA 2R8XA 2HWKA 2WU4A 3BCUA 2WYWA 1U0HC 2YCBA 3LVRE 3Q3IA 3U1VA 1BD4A 1MJNA 4R1QA 1EIWA 5FB3A 3AF1A 2KVOA 3ZVKA 2HWWA 5HF8A 3G0IA 1FC0A 1ZJZA 2C3YA 5FFNA 2RH4A 3S7ZA 4GOKA 3NBYC 4F72A 2OD7A 2DG2A 1KMHB 1SBZA 4PC3A 2DTDA 3VHQA 5IT5A 2OVFA 2CJYA 4CN9A 3KWFA 4M46A 3BCDA 1EVQA 4OJMX 2GYWA 3GVKA 1X42A 2C8VA 3TZEA 2AVDA 6AT1A 3AX6A 3SSNA 5FORA 4LFBB 1UP7A 1HC7A 4CG2A 2RB4A 4BJ3A 1L3IA 3VKUA 1MOPA 4QEZA 1UWVA 2H92A 1RXWA 2ZBFA 1AGRA 2V9PA 1XLTC 5B2EA 3RC7A 2BSQA 3TCXB 2DLCX 3QLUC 1KFJB 1UC5B 1XCPA 3CRQA 4D9JA 1F4PA 2HW8A 1NXTA 2XUZA 2BSAA 1S5PA 2F00A 1SOUA 4WOJA 1T0IA 1AKUA 1H2XA 1P6QA 2Q1SA 2EFDB 2WKWA 3G0CA 1VP3A 3FPFA 3HXKA 3WFIA 1BDIA 3EX7C 1BKSB 1T2AA 3UAVA 3WQQA 2PN1A 1KY4A 2OHVA 3NP9A 4OK3A 2ZUFA 1TFUA 3EGWA 4L1KA 4V39A 5JC8A 3ZDBA 3MMNA 3TFOA 4IDAA 1LW7A 2SHKA 3ON5A 3RODA 4BLTA 3KJGA 2B5WA 4EWLA 2A67A 3S29A 1E59A 3QUTA 2IZ7A 2YZ7A 5CT9A 1KEPA 3LF2A 3NVDA 2KE5A 2P91A 3OOSA 1P2VA 3OZFA 1STOA 4IM7A 2JZOA 4M8NE 1XZIA 3IGFA 2Q4EA 2XMBA 4LV8B 3A4NA 4P5PA 4OU4A 3PR2B 4JBIA 2XDQA 4M54A 3A8IA 3M3PA 3VTKA 5DULA 2MSKA 2Q1XA 2IHJA 3Q15C 2XYRA 1XTBA 4Z4QA 3LG2A 2CUZA 1OU0A 1L4MA 2ID7A 3DFFA 3HADA 5T4BA 2HHHB 3P1JA 1B73A 5AW0A 3ZS9A 2RGNA 2GDJA 3OP1A 2H11A 1J25A 4RM3A 1ZMOA 3L18A 4BMCA 2F2TA 3T1TA 2GH1A 4KXNA 1I10A 4RD1A 1Q7RA 2ILTA 3Q2KA 4UE3S 4JY7A 4AZTA 1CY0A 1C3LA 1GP2A 1Z7BA 4QU0A 5DB4A 3WYCA 5JASA 4LF4B 4JLWA 2D6FA 1Y9ZA 3KAPA 3HB4X 3HG7A 4I1PA 3WWPA 5AXBA 3DFMA 3R7SA 3FPGA 3B89A 1WUHS 4B81A 3R74A 4F4IA 4FM9A 1CR6A 4IRUB 5EIXA 2PWBA 3UAZA 3TGLA 3QMWA 4RJJA 5JS7A 5EP2A 4MQFA 3VR0A 4MUGA 1D1QA 4DBLE 5DSXA 5CJJA 1SBIA 1EGHA 1MB3A 1N6IA 1HX7A 2D4HA 2J87A 1XYYA 3TB4A 1NYRA 4LV5B 4DDTA 3UGJA 2AH5A 3EDQA 3L92A 4AZ0B 1VP9A 5DGCA 1DWPA 3CZ4A 5KKAA 1JZSA 3GIRA 3DMYA 3R77A 4UEKA 4C04A 5B58C 1N6OA 5K1ZA 2C1XA 3WRVA 2QP4A 2VR1A 1JIXA 3V4LA 1N8RD 1O89A 4HWSA 4JVSB 3CR8A 3IQEA 3ZWYA 1EH5A 3AONB 4CKXA 1AF4A 2IYAA 1EEXB 1SKQA 4H7IA 2MU1A 4L8YA 3HCCA 3RD5A 3EW9A 1DTSA 2YFHA 1K63A 1XTVA 4NNJA 2EF0A 4V0SA 4CV1A 1M75A 5HQTA 2LXNA 1ZNXA 2PH1A 2QVXX 1GG9A 1FYVA 3QKRB 2P6PA 4JBHA 4QFMA 1I2CA 2G4CA 3QNWA 4UBOA 3L93A 4CG3A 1QJCA 2HJHA 3RRZA 5D84A 3ZLTA 1A5TA 1W6UA 2R3SA 2NIPA 3L8HA 2CZCA 2Q45A 1E9AA 1JT2A 1AX9A 2CHEA 5KX5B 4YQEA 5F4MA 1K8XB 2YNMD 2WYRA 1KSFX 4U8GA 4Q0MA 1VHTA 4XAQA 1NVUQ 2Q5OA 4DCTA 1WCIB 5C52B 2FFRA 2BC9A 3D8RA 1E7SA 2AK3A 2CDAA 1C8LA 3T1OA 3OPYI 1TO2E 1ZLYA 2EDCA 1NJFA 3HA5A 3P2KA 5CX1A 3ZV5A 1YS2X 2GX6A 1SUWA 4PV7A 5BQOA 1H9AA 2XPCA 1FNBA 2WG0A 2HD4A 3IBCA 3OE4A 1X1RA 1QRAA 1DAKA 3F5FA 4QSHA 1GL6A 4MWZA 3WLAA 3CE9A 3OQJA 3ZKWB 1WHSA 1YB1A 3MWYW 1FSPA 4DSUA 2X76A 1UD5A 5U1PA 2PGJA 2NNWB 2O6HA 4V0KA 3D7LA 3TIFA 4Q1CA 2IGTA 4L7QA 2BE7A 5EA2A 2A57A 2FRDA 2JFNA 1NC1A 1XZEA 4CQNA 3RFVA 3EEYA 4ZVOA 3FTNA 2RK4A 1X15A 1PWXA 2ZUUA 4BCCA 1DT5A 4XLHA 3AUTA 1XKTA 1HQKA 3LYUA 3OZVA 2PS9A 2Y99A 5TXGA 1CF9A 2BFWA 1DGQA 1ZM2A 1S2IA 4ANFA 1GN8A 1NG1A 3HEBA 1W47A 3TRHA 2X23A 4BO0A 3NBXX 4QXAA 4JYMA 4OXRA 2R11A 3OZEA 4NF2A 3UHFA 3PQ5A 2XE4A 2XVYA 2IX9A 4UHKA 3K92A 4US1R 2XCTB 1D8TA 1JQAA 2ECQA 4BKQA 1HE4A 4FHDA 2D1FA 3OQPA 1IEVA 4ZCTA 5K20A 3R5KA 2CJFA 2OG2A 1EJBA 2ZIXA 3HCWA 5KUTA 2BY4A 1OGIA 1J6UA 2R60A 2POQX 3I01M 2QTGA 3KM0A 4Q7KA 3LLMA 3M82A 3D2LA 4HDCA 4INOA 1U1IA 3EVBA 4OYYA 2Q8NA 1RW4A 2BBWA 2B3TA 2KM1A 3PXCX 1NGSA 4RVNA 3NVKI 4XDHA 2Q2QA 3WQRA 3AW8A 3PK0A 2VYQA 3EC2A 4GPAA 5FBKA 3MGGA 4XR9A 4B3HA 5KPDA 1H2YA 3E0QA 4NZMA 4TMXA 4E1BA 3ND8A 1ODLA 3ZGVA 1J5PA 3KDPA 2PSSA 5DASA 3SJUA 5DNYB 1Z22A 5CK4A 4WZBE 1FU4A 5KWIA 3Q2IA 2XADA 5AI4A 5DX8A 2W5UA 3COZA 3Q4GA 4WFQA 4EO7A 5GTDA 4F8YA 2ZRLA 3HA2A 1GL7A 1P39A 4X61A 5L6LB 1AHNA 1KYQA 2H5LA 2QQEA 4NARA 5CX4A 5DZSA 3DZDA 5T41A 1LZKA 5CUQA 2I8LA 3T9FA 2O8EA 1R0BA 1CUDA 3HXMA 3PDIB 2CW5A 3SJBA 2J9RA 3IRVA 2J3IA 1GPLA 4AROA 3JXEA 4XIJA 4C29A 3WNZA 4R8LA 3AB8A 3LY5A 3Q1LA 3QU7A 5ECGC 1IHDA 1DCFA 1A1SA 3PUKA 2KW5A 1HDOA 2XUOA 5IAKA 1ZMBA 3PVDA 2O50A 3CD6B 1WV1A 4KPUA 4RK5A 5A9SB 1L3CA 3FPJA 4HQOA 1UKEA 3IAFA 3K73O 4LZOA 5G53C 4II3A 2OZPA 2HNAA 3VNRA 2BTEA 4OFWA 5FBLB 3L7NA 1ZCJA 3ID6C 5LP6F 1FNNA 3VGJA 3EYWA 2X0JA 2ODQA 2JASA 2X5JO 4FYYA 4R1NA 1JWAB 5K8VA 3ONYA 4B32A 5CT4A 1TAHA 1DRWA 1VRWA 2QIOA 4GUDA 4ZEWA 4F3NA 2UXCB 3RT1A 4CW7A 2ZJ7A 2QA4B 1XE3A 1QHFA 1XKQA 1U1FA 3OLWA 1DZ3A 1E69A 4L5CA 1ISMA 4MUBA 4URHA 1Q95A 3ZHZA 2IYVA 1W85A 1GUBA 3CRMA 5LOVA 3HH8A 4XGKA 2VQ6A 2Y9PB 4XKVA 3NQ41 3B6ZA 4NOJA 4P1VA 2YHSA 3H99A 4A9AA 4AL4A 3ZXUB 4HNTA 2MR5A 7REQB 2WPNA 1JHDA 3ZE8A 1E92A 2WSYB 3M89A 3S8EA 3FCSB 1T5BA 4CCSA 4LHXA 3UJ3X 1RXSA 4YP9A 4OP3A 2FP4A 3BFJA 3CNEA 1H0KA 3O8BA 4G26A 4Q05A 2YZKA 1K4MA 5T3YA 2W42A 2QHXA 1C41A 3BKWA 4YCCA 1WL8A 1PT9A 1P19A 4NFHA 2R66A 1IZ8A 2BFFA 1ES9A 2OHFA 4FMDB 1M0TA 3P5BA 3NTVA 3Q9SA 2XJ9A 4LNUA 4YT8A 5B58T 1NATA 4HMQA 4Z7QB 3RYHA 1E1QD 5B4UA 2ZBGA 4HB3A 1SC3A 4G56A 1A8QA 3Q6RA 4X7DA 3BJRA 3O26A 4UHCA 4AO6A 2WT4A 2IUYA 3BS4A 5C3UA 5EJ5A 3WYDA 1NQTA 2I1VB 3MLAA 4QDKA 3T53B 1TT7A 1W4RA 2D0IA 3PC3A 5JZMA 1H5NA 2OEPA 2C2MA 5I9BA 4MYRA 4DLBA 1FP2A 2GQ0A 4ESEA 1Y6ZA 3PRHA 3KJZA 3HABA 2FPGB 3FVRA 5JV5A 1AQ6A 1ABFA 4M87A 4C4SA 2H18A 2RGEA 3OWHA 4D3YA 4AF6A 4QUKA 3B9RA 3DOFA 4CEIA 4I50F 2PKCA 4IFIA 5EIBD 2W98A 4R3UC 5F1PA 1MDFA 2C2OA 1KRHA 3I9JA 3K6KA 5BQPA 2C4KA 5B2ZA 1TPYA 2QD1A 3IKJA 3UB4A 5JDCA 4WDQA 3S2EA 4X1IB 1LI5A 1E2LA 1QH8B 1UBJS 3DDHA 3MWDB 4PFSA 3EWNA 4YGYA 2QJRA 2F8SA 2LKCA 2O8NA 1P91A 3DD1A 2CLKB 4ZIRB 4UQOA 1J8FA 2Z58A 3E35A 1MTZA 3IYLW 4ZDWA 4HFMA 5FUWA 1I7PA 5C35A 3WLNA 1OI7A 4WCVA 4E88A 2FMIA 1CS0A 1ZQ1A 4B43A 1FLDA 1BMFD 2B25A 1EUZA 3CLUC 4G5FA 1XI2A 4RIGA 3W5VA 3QTLA 4M0UA 3VNSA 4X20B 1EVYA 3R9KA 5K0NA 1H6BA 4RTJA 1E6LA 2IUFA 4RJLA 1E66A 1IUNA 3QKTA 3EGEA 4EEKA 3K09A 1E32A 2RSLA 2ZSBA 3HDVA 4OHPA 4TV9B 5JMWA 4HDRA 1JJFA 4IDDA 1XF9A 2JD0A 3G5UA 3NDIA 2HLPA 2V0CA 1TYAE 1OROA 5J4KA 3AY3A 3ASZA 4OQXA 2PBFA 4A0FA 3NEYA 4C0AC 1RNLA 4FNAA 1S3SA 1KGDA 2O0HA 5BR1A 4ZO9A 4XIGS 1PG0A 4HZIA 3V48A 3VZRA 1TL7C 2O54A 1VLQA 3MBIA 3ZE0B 1DO0A 4HIZA 4K6MA 4Q18A 2HLNA 3O74A 4IJMA 4Q66C 3LX8A 1F3LA 2D62A 3PA8A 4QL3A 4QWWA 5LLSA 1M2EA 1LDBA 2QZZA 4V03A 5FBQB 1QE5A 4UATA 1VYTA 2OC4A 4P7FA 3ILSA 5HR5A 4Q37A 1GPUA 1FJHA 1PNVA 1U7DA 3ND7A 1E62A 3Q87B 2O8DA 3DUFA 5HCUA 2DXIA 1I9GA 1H2RS 4D9KA 4ABYA 5EI5A 4HN4B 1IM2A 4YUWA 4YALA 4LW8A 2ICAA 4O2AF 5JHGB 2PSHA 3HEMA 1QJ4A 4PANA 5FI1B 4P12A 4CKWB 1LB1B 4QREA 1R6XA 4JJAA 3TSCA 4ENTA 2PJZA 2C59A 3FJOA 3BNWA 2PO7A 3JAKB 4FX5A 4KWTA 4L07A 4MQLA 5AKIA 4C4YA 1D1TA 2WD7A 3KYCA 4UU0A 3D1VA 1Y9JA 3HDTA 3LXUX 2B0CA 1KDTA 1U0JA 1Q0UA 1V2GA 3HNPA 2C77A 1L5SA 2TMYA 1GZSA 3ICPA 1BDMA 5CA1F 1RI1A 2WUVA 4NBTA 3W05A 4OQNA 3DEIA 5GIOE 4IXWA 4LVUA 3WJ1A 3PX3A 4L5AA 4X93A 1QVZA 2F9FA 1DKPA 2E6UX 3ZW8A 2J4CA 2X77A 3M9WA 2YMLA 4G89A 3LT0A 3MTEA 5NLLA 4Q12A 4C0KA 4M1TA 4YJHA 4ARBA 1VJGA 2IYXA 1ZRSA 1R4MA 3PGA1 4ERNA 1L4YA 1YX2A 1JU4A 3D5TA 4W9RA 4XPIB 3TX2A 4BNUA 1CY6A 1XTQA 3STXA 4ZMBA 5CFLA 4Y2SA 4X8MA 3WYEA 4C0XA 1SFRA 1R00A 2XTNA 3WK6A 3GC6A 4J3NA 3V1TC 3ZIAA 1M0EA 3IQHX 4HLNA 2OLKA 1V45E 1I7NA 1VSBA 3RFTA 3HTXA 2OD9A 5KNBA 4HQRA 4YCAA 3RBAA 3SZMA 4AJKA 3C5EA 5GJWC 3FYDA 4YPVA 2B6NA 1U2TA 3PGXA 3JWPA 3HXQA 1BE6A 3SS7X 4BXOB 1UFOA 3WLOA 4WZBA 4DY4A 4NSNA 1V4VA 3OWOA 4PQRA 5AK0A 3KVYA 3W8NA 3JYNA 2GKOA 2OQRA 2C5HA 4FEYA 4NLLA 4MCJA 1LPAB 2WTNA 3CWCA 2QRHA 3QQPA 3SIWA 5B3LA 4NNOA 3A7DA 4GVPA 2R9VA 5GZ3A 1G17A 1JLKA 1ZJWA 3F2IA 3M1IA 4EPXA 2JG3A 4X7EA 4E70A 4DQVA 4TKOB 3PI7A 3BB1A 3I9LA 3ZLJA 1URPA 4K9RA 1UZNA 3BH7A 5AYVA 5FWNA 5HRUA 2NO5A 3ONDA 3ADDA 3DLCA 1UAAA 1K08A 4EL0A 5BWOA 2RHJA 1DSSG 2QP9X 4ZWNA 2O0JA 1QQAA 2RJOA 2VQSA 4LY3A 4QDUA 1SU4A 4RFVA 3U26A 5DE3A 4B6FA 2FPIB 4F2GA 4X66B 1BHO1 4Y2PA 3MGKA 4JA0A 4GPD1 3TNJA 1NE7A 4X8HA 1RQNA 4ZOLB 1R3UA 2P2YA 1RBQA 1T8PA 2GN9A 2HN9A 1YOVB 3IAEA 3HJHA 2IITA 4ZODA 1QDLB 2B8TA 1WF3A 4OXQA 5DBGA 3TOCA 1MO6A 2CL0X 3CJTA 5CB6A 1QOQB 2HSZA 3LV8A 2QXTA 4IVPA 4MLZA 2XA1A 5FL7A 1NHGA 1PFKA 2P1ZA 3WP0A 1UOEA 5A06A 1CY8A 4J0KA 3GRKA 3DTVB 6YASA 3DHWC 5JALA 4FILA 3W34A 1HEIA 2Q6TA 3QPVA 4CLRB 2Q5IA 2PK3A 4DIOA 3HB5X 4QYIA 4LJ9A 3RREA 4ZDKA 3L7DA 3SE7A 2HRQA 1VPDA 3B53X 2Y8EA 3DF7A 1PNTA 3NPAA 4XD2A 3LDHA 2Q6IA 2A8YA 4UVHA 3SKXA 4ARSA 4UTVA 1DIOB 3PC8C 2GHIA 3MHPA 5EZ5A 3U1BA 4MGYR 3OIFA 4KB5A 4GICA 2WTUA 1OPXA 1G3MA 4A2PA 5KQSA 1QCZA 1KWKA 1MA3A 1Y9AA 3AJEA 1ZIDA 3QSGA 5TSDA 3GVJA 4BIMA 4ZGBA 4PPFA 4YP7A 1G3RA 2I9KA 1BD3A 4KMSA 1PQUA 3WRYC 3IAS6 5K0BA 2J3MA 2GO1A 4PBTA 2P5SA 2Z4RA 1C0PA 4FYVA 5C4GB 2W6IA 1RJ9B 4MNTA 5EHGA 1G2QA 1KK1A 1X38A 4J1TA 4R51A 2CXRA 2XB8A 3Q72A 4PU0A 4GE3A 4TTTS 1UR5A 4FGKA 2NQ2C 3AV3A 3H86A 2F1HA 3GN1A 1TRHA 1HH4A 1X2EA 2FN3A 5DM70 2JLAA 3JTEA 1NXVA 1ODKA 1J21A 2YWXA 3DWFA 5K99A 4QDTA 3PX7A 5KTPA 1X7YB 3JQ9A 4BX3A 1X3SA 5G0WA 1LPNA 2CYCA 3D4BA 4I1OA 1P4MA 1K7FB 1P29A 3IDOA 1QRSA 4GLBA 2X8JB 1YQUA 3U44B 3FOZA 3E1SA 1D2GA 2CFTA 3H94A 1DL5A 2WU1A 4BN5A 2IS2A 4KRXA 1HURA 1MFZA 5FUMA 1Q0ZA 3TMKA 2XODA 1JHUA 5IW8A 1KIAA 3N8NA 1GUYA 1BTOA 1RSZA 2DPYA 3QEBZ 3UM9A 1Y6FA 1DIBA 5HIIA 1CZOA 4X64B 3RWBA 3OFND 2ZZMA 5LWHA 1BKYA 2IE0A 5AW6A 1J5EB 2Q07A 4KN6A 4U3JB 4P36A 1AO0A 1IRIA 1TLLA 3FVTA 1MPXA 2JVKA 2VEDA 3THRA 4NPHA 3ITDA 3GLUA 5CFMA 1GSHA 2XBUA 3RGWS 3T1NA 2AX4A 2WZBA 3PUWA 3THYA 1DC8A 3JRXA 2C61A 3Q9LA 4BAGA 5KYWA 2X4DA 3H2ZA 3O2SB 4DR2B 3TNFA 2FW7A 1SUDA 5D85A 2MOKA 5AM4A 1DAMA 1RRMA 3I30X 4DNXA 2NM0A 5TVGA 4YBZA 1NB0A 2LD4A 1U9IC 2E85A 2IEYA 2VF4X 5BT9A 1CLEA 2B94A 2YOFA 2CN1A 3N87A 4E4RA 3VZQA 4MV8A 4HN2A 5I7FA 1W34A 1E3MA 3UV7A 2ONZA 5TY0A 2BN4A 4G0NA 3T9CA 1SK8A 4S0XA 1VQMB 4RCYA 1G6HA 3EZ6A 5ESXA 1SG9A 5C1OA 2X4IA 3WHIA 3S2SA 4AO7A 4KDCA 3Q7PA 4KSYA 2DC1A 4F5EA 2NZWA 3KZVA 3DVAA 2PAFA 4EPVA 3F1KA 1JZQA 4HEQA 4QBTA 2VK4A 3CTPA 3FNFA 4Z0TA 2E0IA 4HS4A 4YUAA 5BSVA 2JCGA 4EJ0A 1OBFO 5DNEA 5K03A 4M1KA 2M1ZA 3L8FA 2YJZA 1L5LA 4PSAA 2IV7A 2OGZA 3I56B 2NQTA 4E5SA 1X7DA 4E5KA 2Q46A 3DOJA 1J5XA 1SPBS 2A35A 3EG5A 1YVRA 3P94A 4M22A 4Y30A 2G9NA 3ZGYA 2B35A 1K97A 1KO4A 2QJWA 2WFAA 4GLJA 4R0NA 3TF5A 2FZGA 2R6DA 2X8BA 3ITNA 1PO7A 2BGJA 3TTYA 2H0RA 5TGZA 1CD5A 3GZNB 4PZUA 5EIWA 4WKPA 3UWSA 1OFTA 2GEKA 4GVLA 3PE4A 3AO0B 3QLJA 5HZBA 3N07A 2NW6A 4OOEA 4HVCA 3Q0TA 4BFSA 4WNAA 7ABPA 1GZHB 1YQ9A 2GCPA 4AJJA 2B8NA 4P33A 2A84A 2RGYA 3G02A 1ZCBA 3VQTA 1O87A 4GSKA 3L7MA 4DDMA 1ZUWA 3M4NA 4A6DA 3I9V1 5FI5A 1PR2A 1S3GA 2HMSA 1CJSA 5A4KA 3HL0A 4U00A 5IJ0A 3AKYA 1Z29A 4RPJA 4P4SA 3MRVA 3E27A 5KHAA 1Q82D 3HKDA 2XIQA 2YZNA 2V7VA 1LWOA 3ICVA 1IFXA 3LLUA 4IGIA 4RTNA 5KX5F 2P9ZA 2NXEA 2ZIGA 5IVDA 3KYBA 2AMFA 4L0MA 4PX3A 4TS1A 4FMPA 5IPFA 2JBAA 4WLOA 4Y8VA 4V0QA 1LUAA 3WIUA 2WTEA 4F6CA 1U0BB 2BCJQ 2NUBA 4JX9A 3HN6A 1U1GA 4KE9A 2ZYAA 2W0MA 1GUAA 1PWYE 2EW1A 1M34E 1OB0A 3MM4A 4JHXA 3C3WA 4ND8B 5F35A 3CCVB 1II8A 1W52X 2QAGB 2WOOA 3M6WA 3P9NA 5IUKC 1FEZA 1ZG3A 2P67A 3H1EA 3V1YA 3UBTA 3MMXA 1P62B 4H59A 5EMJA 4PXSA 5J5CA 5HWSA 3ZZNA 3ETLA 1NVEA 5TIIA 2FLVA 4AS1A 1ZWLA 4Y6SA 3R40A 2I7XA 3AILA 3OIVA 2IBSA 4D26A 2ACVA 5TQ2A 1NI4A 3VYSB 4BB0A 2I66A 5B7NA 3ZDDA 3R23A 4W7HA 4KK3A 1HOXA 1UBLS 3HXPA 1TRKA 2F7SA 2FVYA 4CMHA 2GFQA 5CT8A 4W1SA 2I4TA 1PL0A 1ZLXA 1X0VA 1ZVQA 4PYKA 1UXGA 3DEHA 3FB1A 2VLBA 3PNMA 1DDOA 3T3MB 4AJ1A 3URKA 1YJCA 5E3HA 1SCNE 2G76A 1SKMA 4ZAFA 3ZI4A 2O3QA 1H2AS 5AVZA 3CZCA 1ZI9A 4UTRA 1Z2PX 1ZN9A 3LO5A 4LJLA 4RJTA 2E1PA 4MCHA 5IM4A 4UAVA 1Z18A 2ZJ2A 5AKEA 1XVLA 1GGHA 5MFZA 3MFYA 3FRJA 4B5KA 3L5OA 4DC1A 3UWMA 3U7QA 1FDTA 3S28A 2GRJA 4NV0A 1K3TA 4JI5B 3SQDA 3TD9A 2JGDA 3BD9A 4JNKA 4FLEA 4E3WA 1RYBA 3MW8A 3BXFA 1TX4B 3RAPR 1MB9A 3WK4A 1DRJA 2BHTA 5GONF 1I51A 5HOEA 4BFVA 3NVMB 4B3SB 4LA4A 1PR5A 3KFVA 3PPYA 2PT7A 3THSA 5IKMA 4EMTA 5SZIA 3QLTA 4TXMA 4LNHA 4RMIA 4AN1A 2FWJA 5IAOA 2QT1A 1SWVA 1E7YA 4KAJA 5E6SA 3AWIA 1CF2O 2DFDA 5KNCD 2IS6A 4UCXA 3VBEA 5EN4A 3IKLA 5FBZA 2QPAA 4HWPA 5REQA 3SQWA 3GLRA 2QMYA 3HP4A 4WW0A 3RASA 4FOSA 2VN8A 3K31A 3RUIA 4OJNA 1GGKA 2OM6A 1OT3A 2V8OA 1TLFA 2ZSDA 4HEJA 3CNOA 1B42A 3IL2A 4UE2A 4ZRDA 4C03A 3DLBA 2Z2ZA 4QVAA 5E0KB 1JAHA 3GGJA 1I3KA 1BC5A 4KGZA 3H7IA 2DFPA 3TECE 2EKZA 1EP9A 2A78A 2IZ6A 2OAQ1 2ZWAA 3D8UA 5DHUA 5ALYA 1EFPB 4KODA 5LQJA 4KX3A 2J9XB 2HJVA 4Q4JB 3ZQ6A 1KI8A 1UJMA 1AKMA 3EXHA 1ONSA 3KFLA 4GOJA 3MT8A 4NIMA 4RELA 3OHMA 3UB3A 3UQYS 3PFGA 3N0TA 3D7RA 4MO9A 5GAJA 2PRIA 5C5IA 5JSQA 3HDHA 1YNOA 1S8FA 1EKXA 2YFYA 3C1TA 3EOZA 2IZZA 4C88A 4YACA 4B3TB 1C30B 3O8QA 2XMQA 3PDWA 4YC7A 3HRIA 4BX0A 3GW8A 3JZMA 2P6UA 1EA7A 1MB0A 1PKVA 1C0LA 1YTLA 2I78A 3ORRA 3ZV3A 1Z0DA 2IU6A 1VFNA 1ORDA 2R7MA 1CZUA 3E5NA 4KRFA 1JLLA 1HG0A 3VR5A 1CZKA 3WL6A 1O08A 5TEVA 2IZOA 2QX6A 3JQGA 4QQRA 4TKMA 3SYKA 4TLLB 5DO9A 5EJ4A 3IOEA 4DLXA 2OGWA 1N9GA 3GRRA 4QOEA 3FHCB 3PS9A 3UT5B 4IINA 4JI6B 2QU8A 4IGAA 1SRQA 2H51A 5HZMA 1JS1X 3GP5A 3U62A 4M0EA 2H57A 3UG6A 3EEFA 1YR2A 1YDWA 2COEA 1PEYA 2OCDA 3EXG2 1Y5MA 1Y8CA 3JWGA 3AOGA 3ZHXA 5HIKA 2C9DA 3NUQA 1UP4A 2WUEA 4QO7A 4DPMA 2TSYB 3LA8A 1HNZB 1OA1A 2ZE6A 1ZL2A 4I5EA 4EJ6A 3FDZA 5LQMA 4XIYA 1CB7A 2R84A 3E5HA 3VR4A 4ZYWA 3OQBA 4G85A 4GWGA 4IDQA 1T1IA 4ILEA 4L50A 3NAGA 4ZJYA 1SB8A 1OCEA 2AZDA 3A6GA 4ZVPA 1QX4A 4DDHA 5B3KA 2C2GA 4HXYA 4OGFA 1Z34A 2CLHB 4R2XA 3WLQA 5ER9A 3IBSA 3LBFA 3F8TA 5LQSA 7GPBA 5CB4A 2XRMA 2IU0A 3P7MA 3EVZA 2N3ZA 3A8TA 1YH3A 4LI0A 3MJTA 1JN0A 1HKUA 3DT9A 3KHSA 4QNMA 4YI3A 3D4LA 1L5NA 4E33A 3C6BA 2XB9A 3V6LA 2BKXA 3OAAA 4C01A 5EEGA 5HJ7A 3EYAA 1E98A 1PT6A 4GT1A 2A9JA 2B34A 4HO1X 3ETGA 4FMDF 1OXSC 1LLDA 2CBXA 1U0SY 1YAJA 1BX1A 5EVJA 4TKVA 1ZUD1 1G8KA 1WXDA 3V1NA 5HOQA 1Z17A 1TTPB 1IPHA 3RSOA 3IJEB 1JG6A 2AFIE 1VPWA 4ICIA 1S3IA 1VE3A 1DCKA 5L4NA 1QFZA 4OYRA 2WJHA 2NZYA 4E1AA 3G2NA 3TJMA 1EFVB 4A0QA 5BY2A 5KYGA 1L9XA 3DEFA 2H4ZA 5E3IA 3CNHA 2HCTA 3DE5X 2IODA 3RV3A 4CIBA 5HJ5A 4TYWA 4RWZA 5I01A 4L9RA 2VWQA 4NL4H 1N2IA 2C7BA 3BERA 4Z4HA 3CUEF 5JXWA 1MQAA 2MSCB 2ZDGA 5LBUA 1ZD3A 1R0WA 2FP3A 3C39A 4PINA 3WWOA 1GAJA 3KZ1E 5BSHA 4KR9A 1O6CA 1YQWA 3PGKA 5FWXB 1JJAA 1XO1A 2WF5A 3CLUD 3CUUA 1BN6A 4KFUA 3GZ4A 3E0XA 3AVVA 4I5GA 4XGIA 2XE8A 1I5RA 1H3FA 1PWZA 2AN9A 2B98A 2GJ8A 3FLMA 1QVAA 1NLMA 1Z06A 3MYYA 5IAJA 4PO3X 1XN4A 2J9FA 4LOJA 4XRRA 1CLUA 4DCSA 1ETUA 3NBKA 4LN1A 4OY3A 4EITA 3JQCA 2X53S 2C9MA 1NBME 1BVHA 1X1TA 3BYZA 1PR9A 5JD4A 1JDJA 3UPUA 4FZVA 5F76A 1AHPA 4TPKA 4B6QA 3MTQA 2X1MA 3VC1A 4AKEA 3L8MA 5FYQA 3BY1A 5JQGB 2ZBUA 5MF6A 3KJEA 1KWGA 1EFUA 5JZ9A 1TEVA 2C5FA 2BFMA 1EBUA 3PCTA 1N33B 1U8FO 3G9UA 4QXOA 4TV9F 4WXYB 3T4UA 1G5RA 5B3JC 5F9HA 3KKZA 3NBAA 3OCYA 4RKRA 4JQSA 5DK4A 1RQPA 1M2FA 1R66A 2WSSD 4HMOA 3O8OB 4RM2A 2IX3A 2G5GX 3N5KA 1QYCA 3DFZA 4P4UA 3PUMA 4PC6A 2ZCVA 3ZBQA 1PJ6A 1VG8A 3ICCA 4P9SA 4OXNA 4I1RA 3NHRA 2VKQA 1TM7E 2UXBB 2VDPB 2PJUA 5DTIA 3EPLA 2CVHA 1TI7A 2LGJA 4GI2A 4WJZA 1RLMA 1EVLA 5GV8A 2GYVA 3VA7A 1XVTA 1M34A 2FRDC 1OXUA 3DL4A 1KEVA 1NYQA 3LHKA 2YINC 1WUJS 3JWJA 4A27A 2DJIA 1T3ZA 1ZIPA 3GFFA 4J49A 4JEUA 2XGSA 1AVTA 3K5IA 1WBJB 2ADFA 3KV3O 4MOWA 1NW9B 1T36A 1SOVA 4B6EA 5KINB 3KQSA 1XZCA 3KOOA 4MWBA 4F93B 3MF4A 1E61A 1DADA 1SVUA 5EYPB 1HPLA 5ALZA 4QYXA 1JR6A 2CZGA 1M9NA 4JLKA 5E38A 1TJNA 3KU1A 3TW0A 4KGXA 3G88A 1JDPA 1RKBA 5HUQA 2IYRA 2V6JA 4O4JA 1P0CA 2AOWA 2RB5A 2R6GA 2QBYA 4LBVA 1K3FA 1RABA 3RV4A 4PZ9A 3HZZA 2V4DA 2Z6UA 4KI7A 3IQDB 4FEEA 2G6TA 2Q5JA 1WO8A 3R9WA 1T9KA 2EARA 5LJLA 4HNRA 4MV4A 4PZAA 1MABA 2PS3A 1Z35A 2BI8A 4FHGA 3AR3A 4MRSA 4D9CA 2N1MA 1E9SA 3NOXA 1V4BA 4Z4EA 2ZYWX 1YZHA 3QFFA 1I0ZA 1S96A 5DBEX 3K0CA 5BSTA 3K6SA 4LX8A 3HKEB 4XIIA 3W6PA 1WCWA 3OJOA 4YREA 1M5TA 3LHIA 2BJWA 3T9BA 5IDVA 3K1TA 1SIBE 5AESA 1WSAA 1U0OC 1ZMXA 1QTIA 4J16A 4TTPA 2NVUB 5IAAA 2WDPA 2GTIA 2UYGA 2ZTSA 4MKGA 5ALFA 5J2UB 2W9XA 1Z0IA 4DV4B 5GIPE 2QDXA 2BRUC 4HQLA 4NBRA 3ZVNA 1JJ2B 4E6EA 1UPFA 4GDMA 4LTMA 3DO8A 3IAXA 3KQVA 3VPSA 5KTRA 1V96A 4DLZA 1J2TA 2DQZA 1K75A 1G4UR 1T2VA 2OXRA 3DLIA 1KORA 1TVEA 3QI2A 4IUYA 5JXJA 3WAKA 5SY9A 4AJ9A 4C5BA 3NDBB 3SEAA 1EYZA 3GL9A 1VQ4B 1R0LA 4J7XA 1NDHA 2GVZC 2ZVQX 5BMVB 2PLRA 1OI3A 1XPUA 3F8SA 3VDXA 1CUUA 4QBIA 4XA8A 3QITA 5IKEA 5HQ3A 1JHQA 2QMOA 1VI5A 5J4VA 1SUEA 4LXQA 1DAPA 4DOMA 1G64A 4NBSA 2EJTA 3QQ5A 1D5WA 3VKVA 4AY3A 4LTDA 1M76A 4FFBA 3K94A 3L4SO 2HBYA 1GU7A 4OPMA 2DFNA 5DI3A 3NEPX 5EWJB 3L79A 3TLMA 2N47A 5JI2E 3BQJA 4JXZA 2PZJA 2IEZA 4FBLA 5A3VA 1QQBA 5MHTA 1Q50A 2BKUA 5FHQA 4FK8A 3ZHRA 3FOEC 3T3DA 3DP9A 1EM6A 3INYA 2GBFA 3QKSA 4HADA 4PAMA 1FK8A 2PGXA 4HWGA 5IP5A 5DWDA 3MXOA 1OYVA 1WPXA 4GR5A 3RJ9A 1TVKB 3UANA 4NECA 5IYZA 4CHGA 2IE8A 1L4LA 1BXKA 1DBIA 4ZOLF 4KFCA 1QHIA 3HV2A 4MAFA 1TYBE 1UDBA 3CJQA 2FXVA 3S8MA 4E51A 2WHPB 1CRZA 3N39C 3LTEA 3DE4X 5BN3A 4D9HA 4UD2A 1SCAA 1Q1NA 2YKGA 3DG9A 1ECFA 3E9DA 1KY3A 3PRKE 1GU1A 3VR6D 4OHMA 3LT1A 2O1XA 1QM5A 5EEHA 3D64A 4WBSA 5AW7A 3FOWA 1V5VA 2VHYA 3ABZA 5IK2A 2BKAA 4JOSA 4EY5A 4MQBA 1AMNA 1DX4A 1IOVA 1T13A 1QK5A 4RK7A 1XZNA 3R6DA 5FEMA 4AD8A 2FX3A 3EIFA 2Q41A 3GJ0A 4RD0A 2HV9A 3OUUA 1ZUIA 4QJBA 4ZT7A 1H1LB 3F74A 3WK8A 4UNRA 4OHZA 2IPLA 1LLCA 3I64A 4KAAA 2GD1O 5B7GA 1K9VF 1RYHA 1T5IA 1M5UA 2A4KA 2YVAA 2JFUA 4POOA 4OHUA 5JYDA 1QZXA 1RC0A 2GQFA 2ZIAA 5BYKA 2PUFA 4G9EA 5LWQA 1G1AA 3MBKA 4JJ4A 1FS5A 3IKMB 4LRXA 4MI1A 1UMKA 2AG1A 2ZDQA 4JXKA 2BMEA 5KVSA 1XMVA 1IN7A 2JFOA 3QV2A 1AKQA 2I34A 4BNDB 4WZAA 1ORWA 5BSFA 1NW7A 2VJCA 1JA9A 2WM3A 3AETA 1JSZA 2ZUBA 1L5OA 2AFIA 3E3AA 5CU7A 1GGJA 5JDCC 5TPWA 1PHPA 3PRJA 2YIDA 4BGIA 3CVWA 3CX8A 4NBLA 4OG2A 4QXMA 1IPFA 3VX4A 3RC1A 2WWYA 4RXMA 2I7VA 3U09A 5DBFA 3X1JA 3AZOA 1XP8A 2XUJA 5JBNA 3HU1A 3NH9A 3NX4A 4B17A 1WUTA 5CDUA 3PGVA 4E12A 3X1YA 3TMAA 1U2ZA 1NBEA 4HRVA 3GRAA 5HHTA 3C3KA 3I9NA 1C1DA 5E0OA 3LM8A 3ZWWA 1VF7A 3PNKA 2IHYA 4V1CA 2A1TS 2V1UA 4O0MA 3K09C 4NDNE 1NI3A 4ZANA 4ARZB 4HH1A 3PGLA 2Z8YM 3ZJUA 4BRSA 1A8HA 2H1IA 3FB4A 3V97A 1QFJA 1KZ7B 1YJ8A 5KJ6A 1CY2A 1AK9A 3CN9A 4US0R 3QA9A 3GT4A 2W70A 1AQLA 1NBMA 1RPNA 1Z0UA 2G5TA 1K9SA 2Q50A 2QR2A 3KK0A 4QBHA 4XFJA 1TMKA 5DI9A 5BWNA 4TYPA 4Z0NA 1B3BA 1Z0AA 2J7PD 3CEPB 4F7DA 1B74A 3FFTA 3HSYA 4B6JA 1V11B 4ECAA 5H9WA 1SHZA 5KIAA 3JQ6A 5E1OA 3KX2A 2PQMA 2HZBA 1DXOA 2RAFA 3GLGE 3ST7A 1VLYA 3W79A 1KI9A 3GPCA 3RJMA 3NHKA 2R8EA 4ND7A 4MWTA 4G67A 1QG0A 5KTKA 5T57A 3KELA 1AKRA 1U0EA 2MSDB 2QG4A 2RBGA 1EVIA 1OPRA 1WCYA 3R9IA 3RYTC 4B79A 3W2TA 4EUKA 3T9DA 3HKCA 1FL9A 3KQNA 4MV5A 1JKFA 2Q7DA 4RPCA 4PTLA 2C84A 1VG0B 3A4IA 1VQ1A 5FV7A 1TAGA 2P5TB 3HUTA 3SIXA 1ITZA 3SLGA 1VDZA 3G0BA 3UJBA 5E6TA 4LWPA 1L8AA 2QRQA 1J2UA 3X1DA 3CF6R 1R0ZA 2RAPA 3P9PA 3MVEA 4C30A 3W9UA 4XR6A 1ZZEA 2FUG6 4KYTA 4KSBA 2NP6A 4F71A 3IP5A 3UHAA 1T91A 4N65A 4ZRNA 1VQ8B 4ZAXA 5BSMA 2FMFA 4POAA 1A9OA 1CJTC 2R6ZA 2XQGA 3CM0A 1K88A 2VIIA 2XX3A 2IU4A 2XWSA 5KNLA 4J1NA 1FP6A 4EJSB 3PC6A 3KZNA 2JH9A 2D8AA 1XTJA 3O4RA 5DRYA 4ZC8A 4KMOA 4ES6A 4DM7A 4GQAA 3T3IA 4EW3A 4ZYUA 3COYA 1NBOA 2PXHA 2PDAA 3KFXA 2IHVA 1YFLA 2JDID 2QZSA 3AM1A 1UK6A 1I4OA 2FLWA 1J0AA 1E9DA 3OEED 4UASA 4W1PA 1JDTA 2J6IA 5FFMA 4EG8A 3C3JA 1YULA 3R3SA 4CEHA 1NVVR 4HDSA 1SG6A 2QVBA 3BMXA 4MMYB 1S7CA 4V02A 2C96A 5A02A 5HKKA 3LNCA 4TZ0A 1S72B 3IBTA 5H3CA 3OU7A 4M8LA 3STTA 3JS5A 3OEWA 5E8RA 1ID1A 1VG9B 3C48A 1RM0A 3MQ2A 3I05A 1RQRA 1E8DA 4HC4A 3CLRC 2R2GA 3MWLA 4BO1A 1EJ0A 1CUCA 1U9JA 4Y2JA 1CE8A 5LJIA 1EUQA 3AJ8A 1T4CA 1NURA 1U7ZA 1Y4SA 1Z5VA 2G4LA 5KEIA 1KH1A 1M1ZA 2GFHA 1RXEA 4M1WA 2ES4A 2H3EA 1Q21A 3H87A 5HUJA 4H3VA 4MGEA 2DZDA 2P77A 3GJ4A 3EIUA 1YZVA 4R2JA 3SM9A 1RWPA 3WLSA 1IDOA 3I01A 1TYEB 1DQSA 2GK6A 2BBOA 4Q7LA 3ROKA 3TEFA 4DLYA 5TVKA 1TXGA 5ALQA 5HPYB 3S1SA 3L9WA 2XT0A 1Z45A 4E15A 4FYKA 3VU9A 4CEJA 4L3VA 5CVCA 3QMMA 4XRGA 2J6HA 3P9YA 2FRXA 721PA 3O75A 4G0QA 5C81A 2X6WA 4KYVA 1CERA 3VHLB 1CIPA 2OMEA 3CH7A 3EY9A 3IUJA 3SM3A 3CZRA 5F2OA 3R09A 3L7OA 4CZ2A 1ZJ5A 3VKGA 2M1XA 2O2CA 2CJXA 4G0YA 1G20B 1RPTA 2FFJA 2E49A 2YN0A 4DNFA 3OVMA 1C14A 4IMRA 3SN6A 4BPBA 1QO7A 3LWBA 5BNZA 5DTMA 3AFIA 2D3NA 4ENUA 4CQMB 4RF3A 1SU6A 3DHEA 1YDFA 1LC0A 3IA2A 4FQ8A 5EZQA 3K9FC 2GLTA 4FJ1A 2ENUA 4KOEC 2JH8A 1MV8A 5JLJA 4HFJA 4UEJA 4V0ME 3EVAA 4FSHA 1TQDA 4N3NA 2ZZQA 1CVIA 3C6KA 3EC1A 3FHLA 2X9NA 4Y6OA 1AQNA 4KGDA 3JALA 2IPOA 2VHUA 3INGA 3EG9A 3KYDB 1Q1AA 4TMKA 1ZCFA 4HNAB 4XDGA 3PXBA 3FUVA 4FFVA 3U40A 3WAJA 4CKZA 3X0DA 4TRMA 1D2AA 2PCLA 2B4YA 1F7VA 1ABBA 1OR8A 1GT91 3U4QA 3QY9A 3DVRX 1US8A 4RTKA 4G5XA 1VCOA 2ZGVA 2ZAYA 3GBVA 1DJNA 1VLMA 3BIFA 4L15A 4NU5A 4Q4HB 1E3EA 2P6MA 2Q21A 4ZI7A 1D2HA 4MINA 3C8ZA 1PNRA 3PHBE 3H11A 3WL8A 4PHTA 4DYDA 4CODB 4UDYX 4L6AA 1XDBA 4PLPA 3RNLA 1A3CA 1YL7A 1E1YA 1MX1A 2WVJA 3GIDA 1V25A 4INZA 1Z62A 3KPUA 1KARA 2WHRA 1HM5A 3PDHA 3E7WA 5B1YA 2X7XA 1Y8ZA 1BAPA 2HJSA 1I33A 3G2KA 3LRXA 1HE8B 4FIDA 1D03A 3RSGA 3TTSA 1N06A 5B30A 2V4ZA 4ZVMA 3RJZA 5GVSA 4FFNA 3I8XA 4EGCB 2VHJA 5EL0A 4CL0A 4PG5A 5BN5A 1B0ZA 5FF9A 3JQ9C 2QZJA 4DF3A 5H4GA 1NJ8A 4YLEA 5FWAA 1PJSA 4AJNA 1OUMA 4ZZ0A 4TWAA 1ZIXA 3ZQUA 4HHEA 3A7EA 2BEUA 2ZZKA 5LB4A 2A92A 1PG2A 1NN3A 4GOMD 4DBZA 2BF7A 2FLKA 3LQEA 4RSHA 4IYRA 4IHKA 4LQ4A 4BQNA 1SA0B 1LVUA 4HB2A 3U4IA 3A9RA 4CIDA 4JYCA 3OT5A 2BKEA 5FPPA 2VA9A 4Y9SA 5E7QA 2NTEA 3RGGA 5JCZA 2CCGA 3S4YA 2H0QA 1P4AA 1OIWA 1DX6A 3ETHA 5IEBA 3HDJA 2G1UA 3C5HA 4F4DA 2V1XA 1P1CA 2A0YA 3MD0A 3QX7A 3GGOA 5KYXA 1GUZA 2D54A 4LDPA 3H4MA 3VZPA 3TQTA 1WWKA 2QLLA 1CULC 3CSDA 3EE6A 1JH9A 4FKMA 2PWAA 1EWYA 1XDDA 2DP4E 6REQB 2O8BB 3LIIA 3WJAA 3BSFA 1TMYA 1VPVA 5ALDA 1P1IA 1BFDA 4EHIA 3W8DA 2LE0A 3QSYA 5HK8A 5A0VA 4R81A 3ASQA 2XJ4A 2JFQA 5LFAA 4HAZA 2IVZA 2Q1WA 2OILA 2OECA 2UVPA 1YVDA 5IWAB 2VPQA 3EGDA 4Z4TA 1YGPA 4EUHA 1PS9A 1GG8A 3GNTA 2FX5A 3G8AA 3OCWA 3QXGA 1M2GA 4G0PA 2XR1A 3RU3A 4JLNA 1RBMA 2I6TA 3V8EA 1D9XA 2YWJA 3R9XA 4D7AA 3QLVA 4DABA 2A86A 2ZBDA 5DGXA 4WFKA 5ITWA 3WYNA 3GLGA 1ZXBA 2HJ9A 5JD6A 1IVYA 3NHSA 4C21A 5TQ0B 3E9RA 3CESA 3P26A 3Q9NA 1U98A 1V16B 2CE7A 2LR0A 2EZ9A 3B9PA 3ZR4B 1G8PA 1PDVA 4KWCA 2ZI9A 3LW8A 3KD2A 4WBNB 2C9ZA 4XYMA 1QMPA 3C8UA 4OI4A 5FQNA 3PQ2A 4ZQHA 3FWKA 1W2HA 1F6WA 2POCA 3S55A 5JS1A 2GASA 1NUSA 4U9IS 1KJ8A 3HRHA 4JVNA 1M66A 4Z6KA 1V5GA 1KI2A 4CLOB 4CMGA 3B3FA 3PVCA 1W35A 1LJLA 4P81A 1DNPA 5B1EA 5J47A 5LMNB 1QK3A 5BSXA 2PLNA 3GXBA 4DIEA 4KKTA 1KEWA 3IURA 4L0DA 3QPAA 5AVXA 1XXLA 3M6XA 4TM7A 4GI1A 1HFKA 3RYFA 3OQ6A 4JUBA 3Q85A 1ZM7A 2BLLA 3DMNA 5TF0A 4ML3A 3LKDA 4KQXA 2WJ3A 3C2QA 4M0CA 5NULA 3NJ4A 3LOPA 4AMBA 4R0VA 2IS1A 3EFOA 3E9CA 5L3RA 1ZHOA 2PBRA 2X5OA 9ATCA 3K32A 3VOTA 5LMZA 5IF3A 4CG1A 1RRVA 2W2TA 2ZRAA 2HHJA 1JG7A 1UJ6A 4MR8B 1XA3A 4B85A 1L1FA 1PQYA 1N6PA 3U4AA 5JXIA 2EL7A 4WT7A 3SIRA 2EWVA 1AN0A 1BVUA 2ID9A 1L8XA 3JQBA 1F0YA 2ON6A 3L06A 2QN8A 4U7GA 4X7BA 3W7VA 5JQGF 2PZEA 4UCQA 3TUJC 1YDEA 4Z0HO 1UBGA 1T8UA 3WFZA 2I0FA 2PH3A 3CY6A 4EIWA 5K3CA 5I7SA 1EIZA 3MEQA 3STWA 4LC9A 3DV2A 1A1VA 4V0RA 1VL0A 3PFNA 2JAPA 4MV1A 1OH6A 4XOPA 1SQSA 2AWOA 3NR2A 4F5YA 1OH8A 1J33A 1OWOA 5JT1A 3O4VA 5FR2A 1AH2A 1AK1A 2VCEA 5AKXA 3QF4A 5T3UA 3D31A 3I2KA 3A1NA 2XXBA 3DH0A 4H7EA 4L5IA 4QVKA 4QULA 5L3VA 2XLBA 3R4CA 2QRKA 1AT1A 4J0JA 4RZQA 1E5DA 1TUBA 5CK5A 1G7SA 1NIJA 2Q4BA 2OTJB 2BDEA 1XTZA 2FZWA 2BGLA 2HJGA 4FI3F 4LOHA 2HI0A 5ANRB 1QCCA 1XZPA 4E5DA 3C97A 3LUKA 3BHJA 2BDTA 4L0CA 3TRKA 3CLKA 3L02A 2Z4SA 5ER6A 3F67A 4CMJA 3CP8A 3QUBA 1V8ZA 2VS1A 4K3VA 3GFSA 4KWHA 1E1CA 1UMDA 2QLBA 4M8KA 2CD9A 4RZUA 1V5EA 3HSKA 4CL8A 4Z4SA 4A8JA 1UQUA 4NS4A 2FZ5A 2R7AA 2W00A 1KEKA 4Q7EA 4CM8B 1UWCA 2A5DA 3G5AA 3GUYA 4YY3B 4GGMX 4FGWA 4TSFD 2Q49A 1T3HA 4K6FA 4Q9KA 4A03A 2PKQP 4GXNA 1RDFA 2XKAA 2TECE 1E2UA 4KBFA 4RS4A 4CKBA 1NV8A 2VJYA 2L19A 3PJGA 1Z5NA 3CGWA 3Q3HA 4U5XA 1N92A 1O96B 2OE2A 4UTZA 4CV0A 5HKBA 2MR6A 1A2KC 1E2NA 3FWYA 3IUMA 5IAEA 4BBPA 4OU5A 1Q77A 2W4MA 2NVWA 3GUUA 4B5LA 2PRYA 2DULA 3UBMA 4QLOA 3VDRA 3TLGA 4IDOA 4C4RA 1XD8A 1DC6A 1P8JA 3SZUA 5JDIA 1Y8AA 1NLUA 2Q9BA 3E70C 4URWR 3O3CA 5PNTA 5JEEA 3FWZA 2WJYA 4KP7A 1AS0A 4X9XA 3ROEA 2C31A 5K8UA 1ND6A 1PZFA 2D7JA 4OF4A 3EFHA 3BMCB 2GZDA 1MPTA 4OHFA 5CTAA 4ZU1X 3U3DA 1P60A 1K7XB 4F6RA 1WTHD 1VMIA 2ZATA 3R3JA 5D87A 5JAPA 2RMKA 2QJOA 3QYJA 3DXZA 4FGZA 1I8DA 2PX6A 3EXHC 2BFCA 3GO4A 3IIKA 4E0BA 5J2UF 1U04A 1C9DB 2OCIA 1R4AA 3UW3A 1XJ5A 4F9EA 3FKQA 2ANCA 4YR9A 1JXMA 5AUNB 5C5EA 1FFCA 3WDSA 4IDHA 3BA6A 4GC9A 4EFLA 1T1GA 4EJMA 5JSFA 1K73D 5MGNA 1UKAA 4G65A 1Q7BA 4NH4A 4C2BA 2Z9CA 2HIHA 2OPBA 3ZGZA 2EFJA 5HFJA 1XXHE 3U4CA 1RWWA 3AVPA 5DIZA 1L5YA 4CYMA 3G9XA 3I2YX 5CVDA 2B9VA 2OGUA 4XYGA 4ZKEA 2NU8A 5CLGA 5K0ZA 5BMVF 3ETNA 3ESCA 3DE3X 4ZO6A 1R6VA 4YAKA 1M8PA 3BBPA 1GDHA 5EQDA 1REQA 2GJ4A 2LV8A 4H0FA 5FQOA 3BSYA 3RTDA 2C5EA 4YCSA 4ZJZA 3U0BA 5FOVA 3I1IA 3FMVA 2OD2A 3ADPA 2P6NA 2I8AA 421PA 4UXJA 3U3ZA 2RCYA 4PFJA 1LRJA 4U7JA 5AW9A 1FYEA 3BL8A 3LFHA 3I2GA 4C7MA 1T9BA 1GZ5A 1XALA 1QOZA 2ECKA 3N2ZB 3W90A 1OA0A 1N0HA 1JIQA 4C0WA 2EV9A 4L6CA 1AXGA 4XSHA 1J97A 1KDOA 2ENWA 1TM2A 3L49A 2H9AA 3N0VA 5BQFA 1GPJA 2JIDA 2HHAA 4EH1A 1IHYA 5FV4A 1JFFB 5JYCA 1Z37A 2PX0A 3LGXA 3JRNA 3JAWB 5ADVA 2P4EA 3E7FA 2BSXA 3AEKB 2DLNA 4QUIA 2OORA 5DK6A 5U4XA 4HVAA 1FDWA 5KCZA 2G1AA 2GWHA 2VLIA 1FU7A 1JVBA 2X6TA 1FTSA 1YFZA 3LT5A 5CTJA 4E2ZA 3L4JA 4MPRA 5KREA 4RPLA 5M2QA 4BV8A 3D81A 1BH2A 5BV2P 1U1DA 5BSKA 1TEXA 4K1LA 1SKYB