2X0KA

Crystal structure of modular fad synthetase from corynebacterium ammoniagenes
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
338
structure length
338
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Oligomeric State in the Crystal Structure of Modular Fad Synthetase Provides Insights Into its Sequential Catalysis in Prokaryotes
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 102
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2x0kA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2x0kA01
2C5SA 1N2OA 1FYDA 1NUSA 2JA2A 3SP1A 1O97C 3DO8A 4MW1A 3KFLA 5FO1A 4WSOA 2A1UB 2QUHA 3RFFA 2V0GA 1Q77A 1NUPA 1TFUA 3COWA 5IJXA 2PZAA 4RPIA 3PRHA 1NZJA 4JFAA 1WY5A 4DE5A 2OV4A 1M8JA 1T6ZA 3K32A 3COYA 3D6UA 2X3FA 1IFXA 1N05A 2IP1A 1BS2A 2XRYA 3G5AA 4YP5A 3CVVA 2GOYA 2NSYA 2QUIA 1MAUA 3HMQA 3CR8A 5F23A 1VLHA 2X1LA 4KPUA 2A1TR 1NI5A 3OTWA 2CV2A 4MUIA 1HYBA 2E0IA 1X8XA 4ZCPA 3H05A 1T9GS 3CA8A 4PBRA 1I2DA 3IVCA 3FY4A 1QQTA 3K9WA 1YIAA 5DK4A 3CTAA 4KKVA 2CUZA 4OUDA 4CDNA 1NB0A 2B7LA 3LE8A 2RD2A 1EXDA 4RUKA 1N07A 1IHOA 2DPLA 4CDMA 1F9AA 4OJMX 2PZBA 2TS1A 5TEVA 1TYCA 2CYCA 1OWPA 4GRIA 1YUNA 1ZH6A 1H3EA 3UC5A 2V0CA 4MW6A 1PFWA 1J1ZA 4MUKA 1GAXA 3N05A 4EGAA 2DEUA 2QTMA 3CLUD 3ILVA 1FFYA 2R5WA 1TYDE 1EUQA 4HK4A 1KKUA 4HJRA 3SZGA 1PFUA 1YIDA 1O96B 4U63A 3MMXA 3TZLA 3ZXIA 3SEZA 1ZJWA 3BNWA 2WQ7A 1O95C 1WXGA 1ZH0A 3DV2A 2ZUFA 4I6GA 4ND6A 2CYAA 5LFAA 2DETA 3FH0A 2Z3VA 3IUBA 1JILA 3G6KA 1Q9SA 1ILEA 3FDXA 5BNZA 2BTEA 2QUKA 4L2IA 2VBSA 3I05A 1MB2A 3IDFA 3H97A 3AFHA 1QTQA 5DB4A 3GUZA 1H3FA 1MOPA 1VBNA 1KAQA 4EG3A 1O94D 1KQPA 1VBMA 1KORA 4MUFA 1F7UA 4DDKA 4ND7A 3DLAA 1T6YA 3Q4GA 5J58A 1I6LA 1WXIA 1IQUA 3RHSA 1G8GA 4G5YA 1TYBE 3AIIA 4KR7A 3TQIA 2QTRA 1KR2A 3P0IA 4EG4A 2YXNA 1Q15A 3G59A 1QRUA 1JGTA 1P7PA 1IRXA 4NAHA 3IH5A 1GTRA 2J07A 1I6KA 2QUJA 1KH2A 2A1TS 1F7VA 3ZJVA 1J1UA 1O96A 4P2BA 3COVA 4ZT2A 4ZT6A 1NURA 1R6TA 4ZCTA 3TZEA 2J5BA 1KP2A 4DDMA 4JYZA 3ND7A 1M83A 3CVXA 2X0KA 4ZT3A 1F4LA 1N3LA 1JZQA 3SDBA 3FG9A 3MLBA 1UFVA 1NSYA 1K92A 4NATA 4YMIA 4U8HA 4NZPA 1PFYA 1Q11A 4EF6A 1N78A 2D54A 5JBNA 2PIDA 2RE8A 4MAFA 2A7XA 3COZA 4EG5A 3SEQA 2YY5A 2CT8A 1M1ZA 4BWVA 2XRZA 1DNPA 1M8FA 2DERA 1OWOA 3INNA 4XSVA 1WZ2A 5H16A 1JZSA 4KR6A 3Q10A 1U3CA 3RK0A 3U1VA 3IOBA 3CLRD 1S4MA 3PXUA 4H3SA 1U7DA 3IMEA 5AHWA 1XNHA 1G8FA 1J20A 4K03A 4K0RA 2Z08A 3UY4A 1EJ2A 1QU3A 1XNGA 1KQNA 1MRZA 1V8FA 2GM3A 1PFVA 2EJCA 1H1TA 3ELBA 3KT0A 1EFVA 1IQRA 3GMIA 1LI7A 1TYAE 1N2IA 2Z09A 2PXHA 1MAWA 5TEWA 1B6TA 2GKSA 3CLSD 1I6MA 4MVWA 1ZUNA 3CLTC 3M5WA 4QREA 1O97D 5LM3A 3N2YA 5TRDA 5K0TA 1JHDA 3PNVA 5J5AA 3N8HA 3UMVA 1MC1A 2OQ2A 3FETA 2A1UA 4ZT4A 1KH1A 3IMCA 4ARIA 1JEDA 3ZUGA 2YWBA 4ZT5A 1WKBA 5DASA 5EKDA 2D13A 5KWVA 1OD6A 2QJOA 4YBRA 3ZIUA 2BYTA 3D6VA 1WXFA 1V47A 4I6EA 3P52A 2E18A 2E89A 3JXEA 3H9BA 4X0EA 1EUYA 1CT9A 2CYBA 3UK2A 1IVSA 1NB9A 3A4IA 1R6XA 1N06A 1O6BA 1QJCA 3TS1A 4F4HA 4MUGA 3KT3A 2AKEA 2QTNA 4MUNA 1U3DA 1A8HA 1N1DA 4MWBA 4EFKA 1WQ3A 3HGMA 3L93A 3OP1A 4HJXA 1EFPB 4CT0A 3ZJTA 3IOEA 3VRHA 3P0JA 2DXIA 3FNRA 1K97A 3CVYA 1COZA 5K0SA 4DNXA 2PFSA 1TEZA 2IELA 1J70A 1XNJA 4MW2A 2OYNA 4MW4A 2PZ8A 2VXOA 1N2BA 2I1LA 3AL0C 1TQ8A 3VGJA 4MLPA 4UZEA 1QNFA 1OWNA 2O8VA 3VU8A 4FZJA 2D5BA 1M8PA 1XJQA 3RK1A 2O5RA 2DLCX 1GN8A 3RBAA 3ZXSA 1Q19A 3A2KA 1MB9A 3FI0A 2A86A 3IOCA 1GPMA 4Q93A 4QBTA 4EG6A 2WQ6A 4JZYA 1JECA 3ZGZA 2AZXA 4MULA 3C8ZA 4GU5A 1N2JA 4ZCQA 3ND6A 5A88A 4CQNA 4J75A 3S3TA 4A91A 5A8AA 1SURA 1ULHA 3RJZA 4PBSA 4KR9A 4ZCRA 3NBKA 5TS2A 1U7XA 1WQ4A 1RQGA 5FNZA 1GTSA 1LI5A 4MW7A 1J09A 2CSXA 1N75A 4MWDA 1K4KA 1VL2A 1YULA 2A4MA 4HPWA 4MW5A 4QRDA 5IHXA 3MLAA 4TS1A 4WNYA 1H3NA 2HZ7A 1R6UA 2HGZA 1NYLA 4MUJA 5TGTA 3CLSC 1N2GA 2A84A 4MQ6A 4OUDB 5DEOA 3PNBA 2CV1A 1T6XA 4XFJA 3TNJA 3QTTA 1KQOA 5KHAA 4MW0A 1G59A 1U0BB 4UZFA 2AG6A 1IH8A 1VBKA 5A89A 5HG0A 3F3MA 1NUUA 3L92A 1IQ0A 3FWKA 1OWLA 2YWCA 3TQOA 4EG7A 3P0HA 5H7XA 1QRTA 2PG3A 1OBHA 3IMGA 3MUEA 4MVXA 4NX2A 2G36A 1N2EA 2WB2A 3DPIA 4MVCA 4MWCA 3KT8A 3CLUC 2H29A 3A05A 1O5TA 1KP3A 4MWEA 1JIJA 3MXTA 4MW9A 2EL7A 2X1MA 4U7JA 4DDHA 4JXZA 1PG0A 5HUHA 1JIIA 3HV0A 4YP6A 3CVWA 2CV0A 4AQ7A 5LLTA 2QJFA 4L2IB 3SYTA 1M8GA 3X1KA 1YI8A 2VBTA 2IJGX 3ISJA 3QE4A 3SZ3A 2WSIA 4JXXA 4F3RA 1GZUA 3N9IA 1OWMA 2VBUA 2J4DA 3A04A 1O94C 1M8KA 3CLTD 1N77A 2VBVA 3HL4A 1G8HA 3FHJA 3HFJA 2J08A 3IVGA 4G5FA 4YP7A 2H2AA 1O0BA 1JEEA 3IVXA 4R0NA 2P3MA 4R2MA 4J76A 2A88A 1QRSA 2VTBB 3FIUA 2E21A 1NUQA 3X1JA 1Y42X 3X1MA 2NZ2A 3NBAA 3AG5A 4MUHA 4MVYA 4MUEA 3AKZA 3IODA 3HZRA 2QJTA 4ZCSA 3H99A 5HUJA 1NP7A 1WOYA 4PBTA 1T9GR 3ND5A 1QU2A 4E1AA 4AS1A 3AG6A 1MJHA 1NUTA 3BL5A 4NAUA 4Q16A 1O95D 3NV7A 1JMVA 4S1OA 2DUMA 1OBCA 4ARCA 4DLPA 2ZUEA 1N08A 4EG1A 1PG2A 3E27A 1X6VA 1KAMA 3Q12A 4NDAA 2HMAA 1K4MA 3UOWA 3GLVA 1KH3A 5FO0A 3QTBA 4R2LA 2JANA 1N2HA 1YUMA 3LOQA 1WXHA 1EFPA 4DJAA 1EE1A 2ZP1A 3LCJA 3IUEA 4ZT7A 4EG8A 1MBZA 1D2RA 2J09A 2VTBA 3CLRC 3PNYA 3CVUA 1JIKA 3FOCA 3ZJUA 1LW7A 4I6JA 4PY2A 5KCMA 1O0CA 4KPUB 1EFVB 1WJGA 2CFOA 3H9CA 4XFDA 1GLNA 2DR2A 1J21A 1WXEA 2JAXA 4G6ZA 5J59A 1P4MA 3KT6A
chains in the Genus database with same CATH superfamily
5E7QA 1NUSA 3HCRA 3I58A 1NP6A 3EXFB 3VYTB 3AY0A 4FGUA 5L53A 2C1ZA 2XNDD 2N75A 1M2VA 4BJ6A 2J7PA 3E3AA 3U4MA 5FIUA 3QEMB 4IS2A 1KMCA 5EIHA 4MUXA 4IDHA 1E9RA 4NQZA 1EA5A 5AOAA 3AFOA 1H2ZA 3TJZA 4JKOA 3HYCA 3LKDA 1SQ5A 3K6JA 4G24A 2YKGA 4ZGNB 4A6DA 4EAQA 3PRHA 5ANRB 3TTYA 2XXAB 2DHDA 3HC7A 1YIJB 3RS5A 2E3JA 3WIUA 4JJAA 3TLGB 5GTDA 1VL6A 2VJYA 2ATXA 3NE5B 4IO1A 4YAWA 1OV4A 3E4DA 3DGFC 1WOSA 3FYHA 4FYXA 5CB4A 4M1SA 1SUPA 3CR8A 5FCDA 3NKFA 1KKLA 1C0PA 1PSWA 1YACA 3IBSA 1GDTA 4KPUA 1U0HC 1G6Q1 1ZH8A 1Y3BE 3B82A 4EO7A 16PKA 1JR3A 3H05A 3GAMA 4PQRA 5IXJA 3IVCA 3TRKA 4AZSA 1Y1RA 2GBGA 4LK2A 5DK4A 5LWQA 1SOUA 4F38A 2NV0A 1IZ8A 1GGFA 1VMAA 1Z8NA 2ANCA 1O7JA 2AEJA 1NOIA 4DLWA 1MHTA 3ZZUA 1FUKA 5BN3B 1PNRA 1U1FA 3DZJA 1Y7PA 2O0JA 4B75A 1F2UA 1LX6A 1PQYA 4NOMA 4CM9D 5C81A 3TRFA 3K6SA 1XQYA 1KTVA 3OH8A 4LVUA 3SLRA 2AFRA 3VO1A 2TS1A 1H2HA 3FYCA 3OQPA 1B7GO 4QFCA 4ZOEA 4AUKA 5KNBA 3I55B 2W2QA 1XZJA 2PS0A 3K4PA 3BVPA 3EFOA 5LLDA 4ABTA 2V0CA 3VTZA 5AW9A 4BE7B 4G5GA 4N4AA 3I4LA 3K0AB 4B3SB 2G3YA 5JOQA 1ODSA 5I8ZA 2C2GA 4AAYA 1Z5OA 2EGUA 2V3VA 3PQ4A 2WDPA 3LV8A 4IS3A 4C14A 1RI3A 5SYNA 5ENVA 2YZMA 1USIA 3FLBA 1IN8A 3OX4A 4BWYA 3UA3A 3H2GA 4XYBA 4PG6A 3LDUA 3UAOA 4A26A 5BW8A 3EGIA 4TZTA 5AJHA 2NU6A 3VYWA 1UDAA 2J9YB 1KHHA 1P39A 2G5CA 3SLNA 4RGVA 5CPFA 3I34X 3SR3A 2XUIA 3LT1A 5K3SA 2GYUA 2I87A 1OVMA 3JRXA 4X71A 4TKLA 1C2TA 4FFSA 1NAIA 3WWDA 4MA0A 3UICA 2GEDA 4AO8A 2A3RA 1RAHA 2JFPA 1QGZA 2OBRA 2WHPA 3E2MA 4B3TB 3RBVA 1EWTA 2ZI3A 4LQDA 4B6RA 4EY3A 4DSNA 4URVR 4LBZA 1W9XA 3AJ8A 5DTMA 3TZHA 1C3OB 3O4JA 4G26A 2VNJA 2ZULA 2C4MA 5BORA 3N0TA 1P5FA 2YNMD 1NZDA 3KAPA 3DZKA 1IM2A 5CVTA 1FJGB 2O8CA 4NBRA 4NESA 4CN8A 3PC8C 5C5DA 1YI2B 1C30B 3QUSA 4JC5A 3K0FA 1KU0A 5KQRA 4IDNA 4P6VF 1CZOA 2YJ6A 4R1SA 4TUYA 5IWCA 4KR7A 1ZU4A 3C7TA 2ASVA 2ZREA 2LCFA 3U7HB 1Q15A 5B2EA 5JHHB 5CYFA 1X7ZB 2A3NA 3OFVA 2HUNA 3OPYI 4MR7A 1JGTA 3WOVA 4D45A 4DADA 2YIMA 3EDRA 5FOQA 3WZLA 1PX0A 1WMEA 4J4HA 2IIVA 3BIOA 1PKXA 3V8PA 1E3EA 3CRMA 1Q0LA 5DHFA 2DKFA 1C0KA 3O74A 1YU6A 2X40A 1WLYA 2X8JA 3BYZA 4OHZA 2Y99A 5HQ3B 5KWJA 1R9NA 2QTAA 4JWTA 2P9JA 1TJNA 2GCNA 2PMBA 3KLBA 1I7SB 3D81A 3A6HA 3TZEA 4DDMA 1OMOA 4R5MA 3P9SA 2PKRA 3FFAA 3QMPA 3CVXA 4TN1A 4REOA 5ELLA 4NNOA 1XV5A 4C88A 5CA1A 1TAQA 1JZQA 4G8BA 3AUAA 4WBNA 1YD7A 1PR3A 3BQJA 5BR8B 3GARA 3NH9A 3HKCA 4B44A 1MABB 2ACWA 2XKBA 4HQKA 4EHLA 5DNAA 1RJWA 3DHWC 1BJRE 1FP4A 2IZ6A 4QUGA 4G4SP 1I14A 3Q0TA 4F9FA 2MJLA 4CMEA 3ETGA 1VQLB 1E7YA 3B3GA 1PZXA 3S8EA 4OPOA 3NPMA 1ZSNA 4K1XA 2DP4E 2GK7A 4HBGA 2O1EA 4XCXA 4B6FA 1WCYA 2OHGA 4JK3A 3W4JA 1VJ1A 5I7RA 2W2MA 1YDEA 1IOZA 4R2HA 1BMDA 1EIWA 4X3PA 2VAMA 3PRKE 4DRYA 3EXIA 4N5IX 2VUTA 1HT2E 3WL4A 3EPJA 3HBNA 1J22A 4Y7DA 3ZZNA 2NU8B 2FSVC 2QORA 3C6XA 1J9GA 1HOTA 1KJQA 1VL5A 3UAGA 5JWOA 3PXUA 4FKMA 5LL6P 1EFDN 4BMCA 5ECDA 4K0RA 2O7NA 5BSKA 3FPFA 4Z5XA 2H5IA 5K3AA 1E61A 1LLUA 1M6WA 4CKBA 2OB1A 3I5MA 1YHYA 2MSWA 3VNSA 3MTEA 1KAEA 3P9RA 2FFJA 3KT0A 3TNFA 3AHHA 3G8CA 1V7ZA 2HTFA 1W4AA 2HZBA 2KQUA 2PXHA 3MB8A 4FYPA 3STWA 1DTWB 3OP4A 3BB4A 3OKCA 4LXXA 1ZUNA 4H0NA 1CXZA 4OK5A 4TTIA 3R0IA 5EWMA 3H84A 3ZDAA 1E5VA 2W6JD 3HGTA 4NOJA 1O97D 2OYRA 2HWYA 4ASUA 5C5EA 2O1WA 3H4IA 1VPTA 2XD4A 2XGOA 4HRYA 4IJKA 1T8SA 3TR6A 2AOXA 3P4XA 1RM0A 4JOSA 1POWA 1XQ1A 4H7JA 1MTOA 1K75A 2H8GA 3NR2A 4F85A 5KEIA 3CD6B 4KRFA 4NTZA 1E5DA 2IS1A 5E1OA 5CCBA 4CF3A 1E7RA 1YDWA 4BO0A 3CCQB 1DJMA 1AKEA 1J2UA 2Z58A 1WKBA 1YONA 3BH6A 5FQOA 5TC4A 1Z74A 2WE7A 2ZSFA 2P9ZA 3IAM6 3TBFA 1HQYE 5ENDA 3LBHA 5JMPA 5F51A 4XORA 1I9GA 2GN1A 3G85A 4KO2S 5CGZA 1S2IA 2ZCUA 2VYCA 1I2CA 3BDVA 3FNEA 3L4JA 2J0QA 2ZUBA 1QHNA 2X2FA 3PPVA 2RHCA 4WLOA 3O93A 3TXYA 1UPCA 1ZXXA 2HCFA 3O94A 1KIFA 1VL1A 4L6AA 4Q82A 4X0EA 4D9CA 1M2GA 4BVKA 5BWBA 4I3GA 4D56A 2DQKA 1YR6A 2X4IA 3GT3A 1GPDG 3HJAA 4LCEA 4CM8A 5HTOA 1KYVA 3CUKA 2VWHA 5DBFA 5C7YA 1CC1S 4OL0A 3I62A 2DIEA 3DKVA 2A9QA 4DUGA 2IBSA 1P33A 2EXXA 3K92A 4HZUB 2ZBEA 5ALIA 1DDGA 1XL0A 1K63A 1XGKA 1XZCA 1BE1A 4QOFA 4WPGA 5KAMA 2LV8A 1T8UA 1E2UA 3RIMA 2XCSB 1CUEA 1KGDA 1W0CA 1ZINA 4XQFA 3UJ8A 3T5GA 3OM0A 1KZ7B 1QSGA 4TSFD 1EFPB 4KWEA 4O4LA 4BFYA 3WLAA 4N9WA 3EG5A 2F3QA 2OFXA 4Z7OB 3EDCA 3H9UA 4XVQA 3TZBA 3GAFA 5F4ZA 2DXIA 3E8SA 2OL4A 2B4AA 1ZD8A 2ODWA 5IRCD 3V00A 3DMTA 2J32A 1QAMA 4K6HA 4EAAA 2X76A 4OB8A 5HIKA 5D6OA 3H4VA 2WZCA 4Q1VA 4BB0A 1WBJB 1MDBA 1UCFA 1VHLA 4BFUA 4IYRA 5LD2C 4R9RA 5AM0A 4AXXA 1VKNA 5I7FA 2XYHA 3K2QA 1PZGA 4ZZ1A 3K0BA 4OGWA 2UZ3A 5E7IA 2ORWA 4D5GA 1AH2A 1OCEA 2DC1A 3MLEA 1VQKB 1MT3A 2YWFA 4YQZA 4XWGA 5D86A 2QM7A 4DIBA 1JLLA 1U2DC 1D04A 2REBA 4QBTA 3KXKA 4EG6A 3WYCA 3LPNA 1ICIA 4XARA 3NHRA 4I50B 1TM2A 4QU0A 3WDKA 3ZGZA 3FR8A 3ANLA 1RBZA 2ZIFA 1EP9A 3KE8A 2P40A 1DZ3A 1TNDA 1HL3A 1REQA 3LQYA 1NQVA 4B87A 3EEIA 2CXPA 3LCRA 1Y5IA 5G3YA 1Q44A 2WOOA 4PCLA 5JNTA 4ZCRA 3BGDA 3GVCA 2HRCA 2PH7A 1WW3A 1YAJA 3I9LA 1T43A 3IE0A 5KYNA 2PX2A 4F5YA 4FFPA 1EUCA 2J4CA 4M1WA 4TPKA 2C57A 1UWLA 1ZNZA 3O9VA 4NV3A 4IGFA 4Q34A 3KSZO 3Q5GA 3D4BA 3WLLA 1QCCA 5IAAA 1G291 1TZ2A 4QE3A 1ZNWA 1XQ6A 4BATA 2NZJA 3DR3A 3ZNPA 2ZU0C 3EVTA 3LDAA 1J0AA 4GWKA 3FPSA 2ZJ6A 3FGOA 2H2DA 1N0IA 2ZI6A 4P8RA 4F96A 1T8TA 3WLQA 1FS5A 4DEYA 4J3NA 3ETLA 1JEOA 1XDGA 4JT8A 1RPAA 2HGZA 5KC9A 1JPNA 3Q39A 1WUKS 1NFQA 1GTMA 2W71A 5B7PA 4BNWA 2HLDA 3KKZA 4PN3A 2O8EB 3OUUA 3RNLA 4DMFA 4HF7A 3ADDA 1F8GA 1FZQA 1EVKA 1QH9A 1I7PA 3QTTA 3SNHA 2XB2A 1QOZA 4P36A 1PUXA 3JVVA 3AUTA 5KI6A 1RAIA 3DMGA 1R16A 1C1XB 2L17A 3MUOA 4WFIA 5IDQA 4PLFA 4C4RA 1U31A 4DANA 3LUHA 1GWNA 3NT2A 2DKOA 3QVMA 4XLLA 1R50A 4YLEA 3LT4A 2Y0EA 3WLSA 4Z2AA 3CNBA 1ECJA 2VL7A 4FYKA 4PPFA 3H9NA 4OH7A 1PN3A 3UW3A 4UE3S 3NWEA 5K9ZA 1LSJA 5C9ZA 5F5XA 1K68A 2ECKA 3H1TA 2IW3A 4XKWA 4ZOAA 1NLMA 3EFHA 2BKEA 1FNNA 1XB2A 1U8TA 4HXEB 4X91A 3SJAA 1RJEA 4QQFA 5CLGA 1Z2EA 5DK6A 3BCHA 3PWZA 4M1QA 3FVRA 4KGVA 1JA1A 1SHUX 2VPWA 5IYNA 5ALUA 3ZX5A 5IYZB 4FLEA 2RG1A 2YOGA 4GEGA 1I7NA 1TJPB 4NECA 4AJPA 4HWTA 4ARAA 4LCJA 3GHHA 4U7JA 1WVGA 1QHSA 3Q7SA 3OEYA 4A8TA 1UBUS 3RG8A 1Z3IX 2HQSA 2RH4A 4K26A 3U7GA 3ESCA 3WP0A 2CV0A 5LLTA 4MWTA 3A4MA 5FL7D 3HUUA 1M8GA 3SYTA 4EHFA 2WHXA 1EAMA 1ZMOA 3I0MA 2VBTA 1MP0A 2RB4A 3OT1A 1ND5A 4F9EA 1HNWB 3BWEA 5I48A 4XGQA 1AS0A 1I0ZA 4MIEA 4QJBA 1SXQA 1C3JA 5ESDA 5GP1A 1C3XA 2PFGA 3GEHA 3OZGA 2Y0BA 4R54A 2WKPA 1DT3A 2VBUA 4Z1MD 3NC0C 4LY9A 4P4SA 3BSSA 3TJRA 3ZDYB 1HZEA 1II9A 4EABA 2NUAA 4KPEC 5F5NA 4HNRA 2HREA 3GRAA 3PQEA 3IAM1 4L08A 4I0WB 3IIKA 5E6UA 4B31A 6GPBA 3IEMA 2HBQA 4WCDA 3UPUA 4HYQA 4L9WA 3UJHA 1N9KA 5LDDC 3THWA 3CMEB 2IXEA 2CD9A 1U6JA 3T4EA 4XN0A 1SXJA 1NXTA 4J8PA 1XKTA 1AHNA 2PO7A 3DL7A 1CUAA 3UFXB 2DOGA 3A3GA 1S3FA 4LYDA 4L3VA 4G5XA 4ENWA 1KJZA 1KMIY 1LPMA 1F20A 4WZAA 1F3OA 4ZA2A 1JIUA 2M1XA 1XZNA 2ISCA 4TTJA 4X8MA 4L3WA 1BQ4A 3ENZA 4YC7A 1JLKA 1M0WA 3FCEA 4JL8A 3MRSA 5EMJA 3UHFA 1A3CA 1ORIA 2X7XA 2XMBA 2PRYA 3NRBA 3C4VA 2YV1A 3KEQA 3KUUA 4DCSA 3ZY2A 4B7XA 4TVSA 5KPDA 2R6JA 2LW7A 4M4SA 1WOYA 2XYPA 5DRYA 3TG2A 2CXNA 4GOXA 3HM9A 4EYOA 3PGVA 2B82A 2CN1A 5SYMA 1CNFA 3O1IC 1R4NB 2DG2A 2IVZA 2OO5A 3D1LA 3S2FA 3RIYA 2XUJA 3FPKA 2UZAA 4KVZA 2NYAA 3FPGA 2HYDA 2X4DA 3F6BX 2BEJA 4LRXA 1ZCFA 3WWPA 2QROA 2D0DA 3MGKA 4Y9SA 1SH7A 1DEXA 1UEXC 2Q0XA 1RCUA 3P9IA 4NIMA 5EIFA 3FUXA 1PG2A 3RSLA 3R8FA 2AJ8A 1DQPA 1OX6A 5CM8B 4FC6A 5ALLA 4PQGA 5HEKA 1GRVA 3D9QX 3MAAC 3EQ2A 3OJFA 1INLA 3GNQA 4P3PA 5KUTA 5LZ9A 4C0AC 4DLVA 2IDMA 1B76A 4KXLA 4IIBA 4Y2YA 4Y18A 1VCMA 1Q1AA 2HH9A 3UH0A 1N7IA 3CCRB 3DC2A 3KFXA 4FGZA 5DW0A 1RWKA 1XTJA 3UATA 4B2IA 1XWIA 1G9SA 1U2ZA 1ZY2A 2C61A 2W6CX 5L9AA 2FMUA 3T9AA 1QG4A 4DTIA 2PRJA 5KTYA 3OY7A 2H00A 4PNZA 1SVMA 3G9QA 3QYAA 3BE5A 2QM0A 4G25A 4B71A 1WDKA 4XFDA 3QXXA 4QUEA 1F9EA 4AG3A 4BLSA 1KMHB 5KTOA 1Q50A 1W4BA 1AQIA 1F14A 1TOAA 1UMBA 2Q4EA 2QGZA 3C5VA 1P8JA 1X14A 1ZOPA 2PRZA 3KEMA 3WGTA 3T1TA 3LL4A 4EL5A 3T12A 4WZEA 2HA0A 4R3WA 3AKYA 1QGOA 2HXYA 4RL6A 4EY8A 3AF6A 4W5NA 1J5XA 1PJRA 4CKYA 3NM5A 4OHBA 3ASRA 2WWVD 2JAQA 3ZWBA 1VYUA 1TCUA 1NE7A 2Y6VA 1I10A 1B4DA 3NJRA 4KIGA 2YVKA 1HNZB 4Y2HA 4LVCA 3ZGVA 4BHTA 5JSZA 1FA9A 1RMTA 3IEPA 2GJPA 5KB3A 2X42A 1F0NA 3KVRA 1X86B 1GADO 3D7MA 1OYWA 1WVIA 3QJYA 1JHPA 1CQJB 2AHRA 1E62A 2CZQA 2HNKA 2W6PA 3C8DA 3LWDA 5IDYA 1GZ5A 3RYFA 2NU7B 2DPYA 3A3KA 4B35A 2GSWA 3EW9A 4XM0A 1HVXA 1ZQ1A 1CHNA 4YR7A 4B0PA 2OV4A 4MV5A 3W5DA 2DWUA 4B7CA 2I7DA 2PUVA 2HIHA 1Q7EA 2JLQA 3WNDA 1XMPA 2GZSA 3QVXA 4XIJA 3QY0A 3ZD7A 4AKIA 4YUXA 2ZT6A 4Q4DA 1AS3A 1E6LA 3E6AA 4OOVA 2VPYA 3HWWA 5F1KA 1UJ4A 5FDFA 3GDHA 2C9MA 5SZHB 2ES4A 3L7CA 1VLHA 3I61A 2VQEB 3VFDA 1Q22A 3WYAA 1K98A 4KI7A 3IEVA 2VK2A 4LNAA 1XCOA 3UG7A 1J0BA 1T9GS 5KSWB 1PG5A 3B1ZA 4JROA 1XO1A 3QLJA 5ALVA 1CEQA 1IWPB 2GD0A 2Q62A 2YHBA 3K9WA 4NH0A 1Q3TA 1Y9EA 3TD2A 2QI9F 3DOHA 4TX1A 2QXUA 4P3IA 2XOEA 3GRZA 3VNQA 5L3ZA 4RPHA 4D8YA 1G16A 1CY7A 1LBEA 1B6SA 1WCV1 4UEWA 4WLFA 1YQEA 5EKXA 4B6QA 1H5NA 1XDBA 1YCDA 4TMTA 1EBBA 5B5SA 1PL8A 4FFBB 3AESA 3JWIA 4A1FA 4BKOA 4CL0A 5ITVA 3CPEA 5IBCA 4XB2A 3EZYA 2ZVPX 3DDSA 4WHMA 1A9PA 2AE1A 1AUOA 1Y33E 5L3SA 9ABPA 3CSSA 1QZXA 4JX8A 1DOZA 4C0KA 1W52X 2HCBA 1GDHA 4MI1A 2COUA 3K1YA 4TSKA 3GJ8A 4AMVA 3R40A 2JJ2A 3EVEA 4BTVA 3OQ6A 5C46F 3HQ4O 3VPHA 5CRIA 4EFLA 2V74B 2W6ID 4CXMA 5F4BA 4I99A 5MN4A 3M5DA 3KOZA 4WA8A 5FOWA 5CDYA 4R1UA 3M9XA 4WBXC 3TZLA 1FW6A 1U0LA 2PXCA 2PMDA 1DBSA 3OJXA 2ONKA 3N8IA 2R44A 1J5PA 4MO9A 3D4LA 1JEYB 3QWBA 5ECYA 2B35A 4JMQA 1FDTA 4FI3F 1OB5A 4BFVA 5HZAA 2CYAA 2Z3VA 5DHAA 1T29A 3FM9A 3X0DA 4EH1A 2LIPA 5ITSA 3E3OA 3HP1A 3I09A 3UYLA 2JGKA 2VBSA 2VT6A 4LGVA 1DAOA 3LRTA 4PHTA 4PICA 3ZXYA 1E3XA 1B8NA 4Z9YA 4XX0A 2VVTA 3HHPA 3WGQA 2FVGA 2XBLA 1BA3A 1BO6A 4ZEMA 1TC2A 1PVOA 2VZEA 2ZR0A 3LWBA 4MKRA 5EE5B 1MDFA 3LTNC 1IQUA 1KPHA 1P17A 3A2MA 4L5AA 1EVQA 2H17A 3COSA 2IRWA 5HJ2A 2GZMA 2Q6KA 1ISMA 4QTTB 1SKUA 2XUGA 1HR0B 4ZVSA 2CB0A 2FEXA 4HYEA 3SHVA 1AE1A 3WK7A 5B6IA 3DE0X 4RPKA 2HSJA 1TCAA 1Z28A 4E5YA 3IMKA 2Q5JA 1M0EA 4URXR 1VQMB 1A5AB 2PCLA 4FEGA 3VAZA 3C1OA 1N2XA 1F7VA 2Q2VA 4JSYA 2POQX 4MI6A 1NNSA 1I2BA 5FUBA 4C7XA 4YALA 1KMQA 2YIJA 3MCVA 2W7TA 2OMKA 1XKQA 3RHTA 1AD2A 2WM8A 2RONA 2J5BA 5FOSA 2VC2B 5ALNA 5I9IA 2C4UA 3ZE8A 3DKIA 1QIFA 4IR7A 1QHXA 2ZATA 3HEMA 2W8ZA 2ODEA 4NATA 2FEAA 2XDYA 5ALDA 1Q11A 4UQOA 3FXAA 4UUQA 2QNIA 3DVAA 1P4HA 3B2NA 3SC4A 1IHXA 1UKZA 4RXMA 4AYWA 4ZRMA 4BMYA 1P5HA 5EWLB 2D62A 3IV6A 4CCSA 1BLIA 1IN7A 3WLNA 2CT8A 2F90A 2V1UA 3OZCA 4QQ8A 3ZWNA 4DABA 4DR3B 2X53S 1IHMA 1YB1A 2QTWB 4TKMA 1XD9A 4MR8A 5AM1A 4YYZA 2QVYX 4EA7A 4U8GA 3INNA 5IVHA 5DM0A 3FMGA 1ESEA 4LMRA 3VU1A 1D7OA 1OI7A 2FFRA 4QUAA 3FGPA 1JKJB 3H4MA 2TRSB 4LZPA 5KYWB 3EPHA 4P34A 1Y6FA 5E3IA 2I6TA 5L46A 3TGPA 4Y9TA 5LZ2A 2Q5QA 5KMGB 4GECA 2ZBFA 2DPHA 3M4ZA 4JT9A 2J9XB 4OREX 3C2QA 5ECGC 4BO8A 5GZ3A 5HOQA 2YUTA 1SVLA 2Q4BA 3L6OO 3DLCA 4OBEA 1PYGA 2XNCA 4RD1A 2QTGA 1GPAA 4HNAA 4UM9B 1V96A 3OOCA 1G5HA 2IH4A 1QJ4A 5D85A 3L4EA 3PJGA 1KVRA 2Y27A 5F3WB 5L4SA 4U2FA 4JLUA 1XYVA 1G8KA 5EXPA 2ZWVA 1I1NA 3X2SA 2C2ZA 6LDHA 4YV1A 4GNKA 5ALQA 4KR0A 3BCSA 4RK7A 1PEYA 2Q9AA 4M76B 2C1XA 3KR1A 3WB1A 3FYSA 3FFWA 4UARA 3R7FA 1FTQA 1U0GA 3TAHA 1PSZA 1VIYA 2PMWB 2JI4A 4LYHA 3PSAA 4Q47A 2XF8A 1UD2A 4IDAA 5T4FA 3U7QA 4FU0A 3JALB 1LTHR 1OXUA 2I4RA 4PX9A 1E6UA 4F12A 4LY3A 1FNCA 2XCOA 5D1NA 3ZV5A 1M5UA 3WGUA 3M6XA 4UXIA 1ESCA 1GILA 1P8AA 1Q7TA 2HIGA 1XVLA 1EINA 3A4TA 3ZU2A 2V7PA 2V4UA 3D3WA 1JFVA 5K3FA 1VHTA 2D00A 1ZG3A 2HHCA 4ZJUA 5FUYA 4R8KA 1UWVA 3IP8A 3V7AA 2X4GA 5KNCA 5K0NA 3DJYA 4MQUA 3T95A 1FLNA 4IHJB 3UKJA 3RYCB 1RBYA 1ZMXA 3AU8A 1KZ4A 1N8TA 3DEAA 4NP6A 4OP1A 4DN6A 4F4IA 3KQWA 4X1KB 1J9EA 3OT4A 3C4QA 2GS9A 3O90A 4G1UC 4LXYA 4PGGA 4C6SA 4ZTZB 1T0PA 4KMMA 1N1DA 4P5DA 1DMRA 4DQ0A 1U65A 2JKYA 3AR2A 1H65A 1ODFA 1UQUA 2B4RO 1EKXA 2COKA 1H22A 2R2AA 2DQZA 3WBKA 3NU1A 1MPXA 2VG8A 4E0BA 4ROSA 1JQJC 1XMXA 1T2FA 4K2AA 2BM9A 2G4LA 4X00A 4D9BA 5CFQA 1WWKA 1D1PA 4HAIA 3EOZA 3RRZA 1GEEA 4AB1A 5IASA 1TUGA 1N2CB 3ASTA 4LTDA 5H02A 3KKQA 2K2WA 1Y1TA 2FSFA 1C9EA 1O4VA 5AW6A 1T8RA 3STTA 4JI2B 1A76A 3ZHRA 4ZOQI 2B3DA 3MJSA 2MU1A 1HORA 4N41A 1FJHA 3Q8XB 3KD2A 3L8EA 3NWJA 1NY5A 1UKYA 3DDZX 3NRJA 4PNPA 1FQWA 3IP9A 4KH0A 4R7GA 3I04A 1ULSA 2JFZA 5FT9A 4WMLA 3T15A 1J2EA 2CK3A 3MJFA 4GICA 5DYGA 4ENVA 4W5TA 2GFIA 5CBKA 3GJZA 4JITA 5GIPE 2ZSBA 1M2OA 3DZBA 2F4NA 4LXUA 5F3RA 2AZXA 3FCOA 4W5WA 2QRVB 4J0QA 2PT9A 4BFLA 2IYVA 1GQYA 4IV5A 1HC7A 1MX9A 1ULHA 4E13A 4XVUA 1DAGA 4Z3KA 3O2NA 2NSHA 3CCEB 2IHKA 3R23A 1NKSA 4TKUB 4TLCA 4QDZA 3TO5A 4Y1FA 4A8JB 1IJFA 4P7BA 4UM7A 4Y9DA 1HMPA 1QFYA 2OA0A 4XLZA 1SJ9A 2DUWA 4LYGA 3ZWOA 4B7UA 4EPYA 2HC9A 3TF5A 5IX8A 4O08A 3GJSA 3TSCA 1E9DA 3OQMA 5BN5A 3HBFA 1RACA 2OZEA 2ZQYA 2WMYA 3LBFA 1U2GC 2IYSA 3ZU6A 5GONB 4EUKA 3EVAA 3AP1A 4KK3A 2AJDA 5LN1A 3U56A 4C7OB 1F60A 1HE8B 3PXGA 1C81A 2W93A 2NPFA 5DYIA 2VJKA 3DEHA 1A2OA 1RLOA 4IHJF 4LAFA 2ODPA 1RHUA 2AG5A 2VJBA 4MQMA 1A9OA 4MWOA 3WIDA 1CLUA 2F3UA 2FW6A 2Z2ZA 4WXHA 3HZHA 5EQDA 3PPXA 5BYBA 1GUDA 3VO2A 1W44A 4JQOA 5IN5A 4WDRA 4O29A 3P26A 1YMVA 3H5VA 3PNBA 4LTNA 2FJUA 4HDAA 3ILSA 3ITDA 3IR5A 1H8HD 5HKLA 2PPLA 1OLSB 1GGEA 4BBZA 2AG6A 4TL7A 2IIBA 3GUHA 4FYWA 3UWKA 2PE5A 1IQ0A 3T7IA 4HADA 2YWCA 5U4QA 1CY2A 4UMEA 3U5TA 5P8WA 4ZOLA 3QLUA 2F67A 4IFBA 2AMFA 3ZDCA 1E3MA 1QDUA 1TZBA 4OLHA 4RE5A 221PA 2TMGA 5CHYA 1N2EA 3LHFA 5DP2A 2RIPA 1T34A 2LDXA 2X0IA 3QFRA 1ENZA 2WYOA 1GZ6A 2HO4A 3CPJB 3GLHB 2G0NA 2XTNA 2H1LA 2IA5A 4XSGA 1HYGA 1OU4A 1Q84A 3ZR4B 4A0SA 2NXEA 3OZTA 4JI0B 3N8GA 3A7EA 3CW8X 4NV1A 3K0CC 2UXBB 5HUQA 1GTJ1 3DEIA 5IP5A 1VE5A 1MX1A 4Q3DA 1PJZA 1OKKD 2V03A 3G0GA 4BO5A 4JJKA 1FUIA 1Q6ZA 1BA2A 1GKLA 2BGNA 1XIVA 1YRAA 2XUPA 4DM7A 5K7SA 2YR0A 3RTEA 3GEPA 3WAJA 2PKEA 3NW9A 4U2GA 2Z2JA 4L0MA 4WL0A 1IOLA 1QH0A 1CQWA 1O94A 1RPTA 3VI4B 5EPEA 1QQBA 3EGCA 3IYLW 3KYDA 1WBBA 2YQ5A 1CB7A 2VPZA 1EFRD 4LZJA 3DKRA 1M1UA 2XUAA 3ITEA 1UD3A 4JLMA 5SV2A 1EK5A 3Q8WA 5IYRA 4WCFA 5F1YA 3UHPA 1IB0A 5KOHA 2YRWA 1LRJA 2NV4A 3GAAA 1O9HA 4ZD6A 3KKMA 2HD4A 4G5FA 3NETA 5GMOA 5KVQA 2DWQA 5I5EA 2IYNA 1CEXA 5DN9A 3E9DA 2H2AA 1CJCA 3VNUA 1PWYE 3JR7A 3P71T 4CTNA 1M10A 5L3QB 1PZNA 3AVOA 4JLNA 5B6PA 3O8OA 1KSGA 1E3LA 2VHXA 2ZZKA 3BFPA 4NZMA 3R5HA 3DOUA 3VR3D 3AF5A 3CUWA 3WSVA 1BTOA 1GAJA 1GY8A 2EJTA 3KOWA 4FGJA 3L82B 1L5HA 3O8DA 3WHPA 5KX5F 4KE7A 4PFKA 3A1PA 3PWSA 3KB6A 3QF4A 5JCJD 2PLFA 2NZXA 2NV6A 3R5TA 4IXMA 4PAAA 2I29A 3CQ9A 3MA0A 1U5AA 4ENQA 4HMQA 3RYHB 5B30A 2WJZB 1N9GB 1KPGA 3IA2A 2PD3A 4DNQA 4ZICA 4LSGA 3NT4A 4ZYYA 2IOFK 4NFYA 4E6PA 4XLCA 4X7RA 4QU8A 4LJYA 4L78A 3WFJA 1SXPA 3KJHA 1UPTA 2A58A 4QRIA 4AF8A 1GGMA 5C8YB 5JXIA 4ZI7F 4ARCA 3AR9A 1J0EA 2G83A 3ZI4A 5KIAA 3TINA 4EG1A 5LP6B 2NTVA 1Z4QA 3D8HA 2CXQA 2J4FA 4MQLA 4LGMA 1G38A 1RPZA 1A0OA 1HDXA 2MDTA 3LU1A 3RLFA 3U1TA 2FETA 3OX3A 1YO6A 1YZ3A 3G9UA 3HR8A 1CUWA 4X6UA 1Q7RA 3VH2A 4CG1A 5E8RA 5A5FA 1AURA 4LZWA 3LNCA 3S1AA 3WMFA 3VTAA 1LC0A 4AY2A 1MGPA 1P6QA 1YZTA 3Q0EA 1KEUA 3JW8A 4QYIB 2M2IA 3F3SA 3KQMA 1EDBA 3BBPA 5J4LA 4MICA 4RLZA 3C7KA 4JS0A 3NIGB 2ZU6A 3DXFA 3FB4A 5KCMA 3TSOA 1XAIA 1Y3IA 3SXPA 3CNQS 3K9CA 1ZK3A 3N59A 2CFOA 4UHHA 4E14A 2VDUE 5FI1B 1S72B 2EWWA 4D41A 4D57A 3SC3A 4DUZB 3GJ0A 5PNTA 2C96A 4TYYA 3LKZA 2LZJA 5A0FA 1AVTA 3KUCA 3EXG2 1EK6A 2EFHB 2H4YA 4R41A 4YDSA 2HMUA 1K86A 2O7QA 2ZPAA 3B9PA 1M6YA 3H1AA 1T36A 2AKYA 2G1KA 2I3DA 3BZUA 4EQ6B 3LF2A 3GLUA 1YS4A 1XZQA 3SQNA 3N2GA 2RH9B 3RW9A 2I1WA 1FTGA 3KFLA 2QP9X 3LZCA 1Z16A 5L3VA 2JVJA 1DOHA 5AWFC 3HV2A 1AK1A 4MRPA 5BN4A 2GWHA 2XQGA 1XLTC 4WT7A 1PNOA 4P80A 2R6CA 2RDMA 3P9NA 3PIIA 5IYQA 3VU9A 1SVOA 3AM1A 4KRYA 4DBZA 4WINA 4M8IA 1WY5A 2Y1KA 5EXSA 4CLDA 2J3QA 2KBEA 1CZKA 4J0FA 4RTLA 5IKXA 3NDRA 3PX2A 3RS7A 3ZK9A 1XCGB 1H6BA 1KOFA 2YWJA 1UWKA 3ACDA 5FV7A 2VQDA 3BILA 2ONZA 2GK3A 5ALYA 1U8XX 3ZZTA 3TSZA 3J81k 3VXKA 3CO0S 3F1KA 5F23A 4I55A 4R1LA 1WUHS 4V0RA 5JATA 1N92A 4KFTA 2V7VA 2I4OA 4NC9A 4K6GA 1M1NB 2V5AA 3UB4A 1P1KA 3HL0A 1X8XA 4ZI3A 3ER8A 2BGRA 1U3FA 2JCSA 5C8YF 4OGKA 1EGMB 1GGKA 1PWXA 3HJRA 1WTHD 2YDXA 4NZYA 5CXXA 3ITNA 2X2EA 3WYGA 1SEPA 2EHDA 2EP7A 2ZJ1A 4Z4SA 3D4NA 3CP2A 1XQ9A 4O2AA 4UU0A 3OLQA 4YGYA 3GWZA 4RV5A 4YRTA 4YHHB 3KETA 3PXDA 5LD2B 3CWQA 4KO8A 2V7QA 1NXQA 1UXJA 3KKOA 5THKA 2JGNA 1DAIA 1UWCA 3AHFA 4ZKDA 1I36A 5C52B 2RD2A 2Q6OA 1GHTA 4ZGWA 1VHEA 1U2SA 3BH0A 1GGJA 3BDAA 3EF0A 3I8SA 4O2BB 3C43A 1F9AA 2YW2A 1JHZA 1S5PA 2HRZA 4ZZ0A 2OTLB 1B3BA 2M98A 3OY2A 4BQNA 2R1ZA 2XYGA 5IDVA 1KZGB 4N8DA 1RRPA 4B3BA 3VR5H 2FG7C 3AJEA 1GAXA 2AF3C 4MI3A 1KI1A 4FIDA 4FFWA 1R0KA 4MYHA 5K09A 1IEVA 5I51A 4XYLA 1I18A 4PO8A 3ZLVA 2OLKA 2P2LA 4AY3A 2V4MA 1KSHA 5B4UA 1KKUA 1CQPA 5EHGA 4QUHA 4GKJB 1V2GA 2P9HA 3AUFA 3D59A 3GJQA 4DDUA 1O96B 4A0QA 4V1CI 4KREA 3AV3A 1KR5A 5DM4A 1ZJWA 2IHNA 3SS8A 1Y6ZA 4I66A 4UQLA 1DEAA 4G01B 3HSSA 4N8EA 4DPMA 3H17A 3MGCA 4KDEA 3MINB 4BV3A 1CS0B 1I2ZA 1DU4A 3B6IA 1JHAA 3G9ZA 3W2HA 1VI2A 2D0OB 5DHTA 5IAOA 1JILA 2JATA 3VR2D 1I4EB 1ZLYA 1OOEA 4Q7QA 1KMMA 3DL4A 2DSNA 3IBCA 4TV9A 3DVSX 2QUKA 4RSMA 1Y0YA 1WPXA 2QXTA 4BQOA 2H4ZA 3IDFA 1G1AA 1FYFA 1YA4A 3AHCA 4PG4A 1VBNA 2C4VA 1S3IA 2IYPA 3IKLA 3P19A 3HNPA 5DTJA 5J2TB 3EAGA 1NRIA 1QQ6A 1UZAA 1WB9A 3H8VA 3LA6A 1A7UA 3BS4A 3L6EA 3H5IA 4KN8A 4RMHA 2H2FA 2IU3A 3RHSA 5FPYA 2PUDA 1ZJJA 3BRQA 4K6FA 3BY2A 2FEOA 2EC5A 2VPPA 4XXHA 5F2EA 3ADPA 1AT1A 2YXNA 4EG4A 5E2IA 4GGMX 4OKIA 1K06A 5ESRA 2PMFA 2A57A 3E1KA 3K1TA 4B3RB 3FHTA 1CEYA 2H59A 3GJTA 1U7ZA 6REQB 2DM6A 4BRSA 4IQGA 2KB0A 2FP4B 4B5LA 2WIAA 1BMQA 3AHJA 3MBIA 4EJMA 3D2CA 4INPA 4GM1A 1YCHA 4ARZA 3X2EA 2XZTA 3W2GA 3OTGA 4AJ9A 4ZT2A 4ZTUB 5EZYA 1B0PA 1U4NA 4MV1A 2WJJA 3JD3A 3RUHA 1BG6A 4IFEA 1XPJA 1FYWA 3M1AA 4PNHA 3OO1A 5T5QA 1ZM4A 3U9TA 5KYXB 3IXQA 4UPDA 2JHPA 5IS2A 3KEWA 1HETA 4CR6A 1SQSA 1ILEA 2CCGA 2I2XB 3RADC 2EKQA 4KYIB 5LQMA 4LDNA 2OBSA 3F96A 4HE5A 3H2JA 1RE0A 5ELXA 2D54A 2QIOA 2ZTVA 3E2PA 1VJ5A 2V9PA 3JWJA 2WIJA 1E1DA 1DPGA 1XRLA 3ROFA 2JS7A 4KKUA 2Z6QA 4RCYA 4ZZ3A 1MC8A 1M0SA 3HMKA 3EEYA 5B3KA 3P2EA 2QU7A 4FOLA 2BHTA 1NLYA 1RYBA 4B3XA 5EIWA 5HBGA 1CUSA 4UHDA 4XDGA 3N8NA 4GI3A 2EIHA 1QHEA 3L3BA 3RVOA 5H80A 3ZE0B 5KYGA 2VJAA 1VCOA 4L0CA 3I8XA 1M7HA 1EU1A 1G17A 1TAGA 1QB8A 1JQDA 2X22A 2VJLA 2WZNA 1KDPA 2FZ4A 3Q9LA 3WMWA 1R6BX 3NAQA 1EZ4A 3ADOA 2VAWA 2XUZA 3FNQA 4P93A 2A35A 1UBLS 3I4FA 4OJTA 4W5HA 4WKCA 1H42A 1G8FA 3AGQA 1Y1SA 2X5JO 3KL9A 4NDNE 4P0QB 2H92A 1K9VF 1KAHA 4TXLA 2UDPA 3EVBA 3KD3A 3ZVMA 4RH0A 1R0BA 2B6HA 4BCBA 2XXJA 2FZKA 4JP1A 5IABA 3KKNA 1Y3CE 4Q9NA 2FPSA 5D87A 3HZOA 3UMJA 4X6LA 3VR6H 1TPZA 2AOVA 2CDAA 1CE8B 2IXGA 2CKDA 1ITZA 3LGAA 4Q4HA 1UBTS 3ZWDA 4BBAA 3GRKA 1ID8A 2GKGA 4TRMA 3CZRA 1TEHA 1UR5A 4PLTA 1J2JA 2BGIA 2JLAA 2IYFA 5AKYA 5F7JA 5K3OA 4HAVA 2QMYA 1R9GA 3LUKA 4TM7A 4ZPJA 4KL8S 4CRWB 1L8AA 1B0UA 2G82A 3O4GA 3VSDA 2GLXA 3DT9A 4G0WA 1W96A 2H85A 2MMGA 1E3SA 3EXFA 3B60A 3OQIB 1MC1A 4BCDA 4DLTA 1XTKA 3LK6A 1NVXQ 2HEGA 4XSHA 2CLOB 1YB2A 2I66A 4IQ4A 4MVJD 1R3UA 2H2IA 4JJZA 4ND4A 5ETJA 3IKMB 4WFQA 4CIXA 1UBFA 4ZJPA 3KOXA 1D9XA 2HEIA 4FJ2A 2E4WA 1BDMA 2Q6TA 3IQIX 3JPWA 2XD9A 2QN9A 3WKDA 4COOA 3CHYA 4F8EA 4YT4A 3QYPA 3LXXA 1DVRA 2FZVA 2YWGA 1RQXA 1JHOA 3GQBB 3TLGA 4U7WA 3WWCA 4J7AA 4DW8A 4TMYA 3Q88A 1XUOA 2XMGA 2YV4A 3ZHZA 2ZBDA 2J0UB 3ZS9A 4BX2A 4ER3A 1Q7YD 1EP1B 3GQVA 2DU8A 3ICPA 1ZJ6A 1T8WA 3QOWA 3JQDA 4TYQA 5CPBA 3BHNA 3N2EA 1WM1A 1VGQA 4FS8A 3CF6R 3LBYA 3GZJA 4N6GA 4F5EA 1DAFA 1ESDA 5H1YA 1XLUA 3DMRA 3EPKA 4IQ8A 2VK4A 4P22A 2GRAA 1WXQA 1RZUA 1V95A 4LN1A 4P31A 1MO4A 3M0EA 4DSOA 1BRMA 4CTMA 1RYFA 4MV0A 4ZYVA 2JZCA 3IOYA 1PEKE 1H1DA 3OZVA 1A9YA 3KZCA 4K2HA 2AOTA 3NHSA 2YOHA 4XMYA 3SIXA 4H9GA 3ELDA 5BN3A 2B83A 3VHLB 3MIIA 4AJEA 4BNZA 3MJDA 3PC2A 3LI2A 2BMWA 2O3SA 3C3AA 1MQSA 1Z83A 5LQDA 1DAHA 1KY4A 4BVAA 3CVYA 1N4DA 3T5MA 4TT3D 5FTJA 3GVKA 3K20A 4BO1A 5ALWA 3U9SA 1EVLA 3CM0A 3C45A 3SMVA 3H94A 2DCMA 4IXWA 3LCUA 5CMLA 3R0JA 3SIWA 4WOBA 1NJGA 1Z5PA 2HN9A 3K0SA 3W8FA 1YX2A 1ISFA 3K0AA 1G3QA 5HQJA 1Q0SA 3E22B 1U28C 2JFOA 1W4RA 1TO6A 1A5SB 1OVGA 2XNDA 1OE0A 2Z5LA 5KYKA 1RQRA 1U80A 1GN8A 4WWHA 3KX2A 1LC3A 3ZXSA 1E98A 5AW5A 1V0JA 1MB9A 3H9JA 1FUEA 2NT4A 3R4CA 1K5GA 5L45A 3S1LA 1DBQA 3IPXA 2IHBA 5HJEA 3WK9A 1VKHA 4EA6A 5AESA 4CF7A 1ZWLA 4JUFA 4EKGA 4MDEA 1N2JA 3KL4A 4JASB 4JLWA 3B12A 3DXZA 5CTAA 4RLSA 5J63A 1L7XA 3BWXA 5CNIA 3SS9X 5IMSA 5CBPB 2VNKA 2OBMA 3OCYA 1J8VA 4JLOA 2O2XA 3RJZA 4F2GA 4PBSA 1KERA 4DFDA 4PQFA 3WYNA 1XD8A 3NB0A 1JR6A 4E03A 3AVYA 3O4HA 3NBKA 2D5IA 4QXAA 5TS2A 3PNOA 1FP2A 4G4IA 4C7VA 4MS3B 3G82C 4O59O 4OPMA 1B16A 5J2UB 4D3YA 2VSXA 1S2GA 5IF3A 3V1LA 4OFWA 1C3OA 3ZCQA 3ESQA 3CX6A 5BNTA 4F8YA 4NMWA 8AT1A 5B53A 3UZUA 3I1JA 2HJ9A 3ESXA 2MSNA 8LDHA 4MW5A 1AO0A 4WX2B 5MDHA 1FSPA 2CJXA 4P4UA 1J5EB 2MR5A 2PZGA 1BXZA 1R0WA 6Q21A 2VZ0A 2IOFA 3ZGYA 5TDHA 1EXMA 3DL0A 3TMYA 4KW7A 3LL7A 2CNNA 2VFAA 1X7ZA 1NJ2A 4B6PA 4HNQA 1JYFA 1YZGA 1SU7A 3HCFA 521PA 2CMFA 4IX1A 4CM9A 3D26A 4AJLA 2RI0A 1HXHA 5LZ5A 4D9NA 3IKVA 4FT4A 3R6JA 2QRLA 4B80A 5HQ3A 1JWBB 2I6XA 4A8PA 2G88A 5J3JA 1HT1E 2OFOA 4XJTA 2B92A 1S9HA 2FMKA 1IUNA 2XTZA 5AFSA 2P9BA 1HYQA 5DYTA 3RFXA 1A8PA 4H1WA 1SKYB 3P0HA 4F4FA 3Q8LA 3LQ1A 4QTUB 1QX3A 1II8B 5LVAA 3JY6A 5AXCA 5BPHA 4KFRA 4K3VA 4XQGA 1NVUQ 2NTEA 3OO0A 4FUTA 1JDVA 4FT2A 1CIVA 1Q3HA 1ETUA 1JJVA 2R84A 1MABA 3I2YX 3JVIA 5E4FA 5T4BA 3TLAA 3O1JC 3B3AA 4OG2A 2AUNA 4JP2A 2QZPA 1YVDA 3CLUC 4LJ8A 5HJ5A 1BDHA 1TZMA 1AF7A 3WHIA 4ZQBA 4QJ3A 2SNIE 3HDYA 3B6MA 5KO2A 5GV8A 3A37A 3R0QA 4MVJF 3K2IA 2OORC 3TKYA 2B6NA 1RYNA 3O75A 4BVFA 1FFBA 2G77B 3T56B 3WGVA 3IJRA 3BKXA 2JJYA 2L2QA 2NU8A 2EARA 3IRVA 3PEFA 1P1FA 1HE2A 1P4GA 2CRVA 4XJXA 1YI8A 3QP9A 4B7AA 2YNMA 4X95A 4W8OA 4Q3LA 1IK6A 1E2KA 1RCFA 3HFSA 4X45A 2FFBA 5L6LB 2JDID 4MTCA 4P3NA 1NW3A 3P94A 1M1XB 4CIWA 2ODBA 3BE8A 2EEPA 1QIHA 5BSYA 1M8KA 2GX6A 1ZI9A 1WPQA 2VBVA 3FHJA 3IVGA 1EH5A 1DTWA 1XJWA 5JDIC 4WN9B 1Z63A 2JASA 2ZAGA 1SHTX 2BGTA 4RELA 3K6RA 4YP7A 3RIGA 3QUTA 1JPVA 1XWFA 2WYUA 4B1FA 1V9CA 4UTNA 2RGUA 3DE1X 3JASB 2O20A 2P3MA 2WHRA 1T9DA 2G9QA 4RULA 4ERXA 1QQ5A 3PQ8A 4L7QA 3UOAB 2VTBB 2OAGA 4BLVA 2GZ3A 3T3IA 1FXWF 2OR3A 3ETJA 5FWNA 1G2OA 2MMCA 2QLFA 3RC7A 3PL5A 2ECPA 2D6FA 5JWRA 3NBAA 4DCVA 1G8SA 3DL2A 4EJ0A 4HDOB 4BKPA 5IT5A 3IQGX 2ZRCA 3QEAZ 1RMYA 4JSRA 1C7FA 2RBEA 1P7YA 2HQ1A 3QPWA 1KNXA 4JUDX 1L4MA 5FPHA 3T9FA 3HZRA 1F2DA 3RI3A 4XM3A 3I5XA 5BSVA 3I9OA 3KFVA 5HUJA 1YRBA 3ZH9B 3VC3A 3TVYA 1NVFA 1XZ8A 1ZJ5A 2J5RA 3DH0A 3AC0A 2F55A 4AS1A 2B21A 1H0SA 1RXCA 1JP7A 2PL3A 3F9CA 4CE6A 5FUQA 4RY9A 3BSFA 3DEYX 4DKXA 2Q7DA 3ZV4A 4NG5A 3GFFA 5H81A 1RHJA 4TMZA 3CCSB 2IYYA 3ACBA 1FE8A 2HBRA 1A9XB 2WZQA 2XT9A 4EK9A 3T1OA 1GVNB 1U7UA 3AUYA 4E0FA 3HRKA 4N0PA 3K2BA 4HZUA 3VR6D 3I5YA 4WOJA 1BOFA 4ZC1A 4YWHA 1RC8A 4IW3B 3R3UA 2HK7A 1SKMA 2BFFA 1G8AA 4JGIA 4QULA 1H9CA 3J81A 5I9SA 5A4DA 4ZPXA 1GZDA 3C97A 3HSYA 1DIGA 2WFAA 2XMQA 1L5NA 4DYVA 3FYTA 1EFPA 2HWXA 3AP2A 1K66A 4AW9A 1NW7A 2ZP1A 1WCIB 2ZR9A 3ENQA 1D2RA 1SVSA 2OAQ1 2R25B 4G84A 1V4NA 1K8ZB 3G2NA 1A7AA 1RRMA 2CBGA 5DF1A 4O3FA 2GF2A 3V9PA 3EWNA 3PGLA 2OAP1 3LM8A 2QY6A 1W5FA 4LKRA 3OPXA 4Q9AA 1HK7A 5GVSA 4H3VA 4LTMA 3H1EA 3W6PA 2W6JA 1AKTA 1N2CE 4MUYA 1FZTA 1A5BB 3WK6A 4NCNA 3F4LA 5DT9A 2OC4A 3QVSA 2B4KA 2VJQA 1DAPA 1O2DA 4BGEA 1GQQA 2WSYB 3MG9A 1XTQA 3E9QA 4MB6A 3QA3E 3WNCA 2EFGA 3EXHC 3SKBA 3KQKA 2CNKA 4C5CA 1EI9A 2W2LD 1FFXA 1UC4B 4CT5A 3KQUA 2AZMA 3NDPA 5T6BA 3KJIA 3EX7C 2YVLA 3SJUA 3TRJA 2O54A 3EULA 2BGJA 4MJLA 4UBMA 4YRRA 5DYWA 5FPTA 4PABA 4LBYA 3RFFA 3IMFA 4I50A 4QT4A 2IV3A 3E5NA 1BGWA 1WDWB 4DZZA 4QPZA 2HPZA 2Z83A 3PTAA 4CKWB 2C7PA 2PZAA 4I9GA 2CHGA 1SWWA 2YMMA 3CSUA 1XRQA 2XV1A 2UZ0A 4AWBA 3KZNA 1ZVMA 2ZCJA 5IANA 4WLUA 2ZQZA 3D6UA 3GDOA 5JXJA 5EMNA 1JEQB 3MSCA 1NWCA 3BORA 2ZQ5A 3WICA 2IEIA 1BX3A 1SBTA 3GB9A 2VATA 3V4LA 1NN5A 2V45A 4TGLA 2A9VA 3OEWA 2C97A 4PEVA 4LE2A 4D92A 4UBLA 3R76A 3W9YA 2G6BA 3FLMA 3Q0IA 3A4YA 4L75A 5BMVB 3KXIA 2G67A 3A1UA 1W5EA 2WKRA 1VQOB 1RPJA 5K8IA 2J8ZA 1PGOA 3O8BA 1JPUA 1LLFA 2XA1A 3QIAA 4XTCS 3T06B 4TSFA 3FY4A 1S8OA 3T9CA 1X87A 1FCJA 2CZGA 3NBXX 1UXHA 4KIJA 1M5RA 1KI8A 4YMWA 4DIMA 1JJBA 1BDBA 4RD6A 4LS3A 2O8EA 2EX0A 4ATNA 3C6YA 5EJAA 4WUVA 2Y1WA 5HFAA 1DUVG 4OU4A 2YJTD 1ENYA 1OXSC 3H0KA 4N03A 4R01A 4G89A 2ZJ3A 4C1BA 4GKAA 2Y77A 3I5UA 3IX7A 3Q3IA 2ZBUA 1C1XA 3QXHA 5E4JA 2PZBA 2V7WA 5TEVA 5CDTA 4J0DA 1YDFA 4WTOA 5JQGF 3FKSD 4QC2A 4U6SA 3GCDA 1Z7EA 1FLDA 2WU3A 4PZUA 2HA3A 1JAZA 5JNLA 1U81A 2IEGA 1G98A 4FBLA 5FADA 5LB4A 1BDJA 1XALA 4TRRA 1L7NA 3UJ6A 3OM1A 2XAUA 4MGYR 4QBKA 5GJCA 1DZIA 1OJLA 1C80A 1C7JA 4FJ1A 4PHGA 5JC1A 3W2EA 2ZB2A 1Z68A 3DPSA 3G0IA 2GPWA 3RRMA 1X19A 1Z0AA 4GX1A 4HGOA 3ZXIA 3I8OA 2R62A 4QOGA 1J07A 5BOVA 3GEEA 1JBKA 4CM4B 1SU8A 1HFWA 1P3JA 1RKQA 3L0SA 2I99A 3UGTA 1ZHHA 1U8FO 2WNIA 4XGNA 3UTDA 1CQIB 2H5EA 3IDOA 2DETA 1JLHA 1O89A 1WZNA 1YKSA 3LXMA 2H11A 2BKLA 3EG9B 2ZL5A 1DINA 2WYHA 2NSLA 3RUPA 1SGWA 3TGWA 5I4BA 4HDSB 2CLDX 4HDNB 1QTQA 2DFPA 2GA8A 4RDJA 3KQQA 4PZ9A 3S29A 3WK5A 1VBMA 5H59A 3ILHA 3PD7A 4QVAA 4MVJM 2P2CA 1EAYA 4ND7A 4P92A 1XQWA 2KM1A 1ABFA 5JH7B 3WKCA 4EVRA 2RHLA 5DLEA 4ESVA 4N0MA 1QO7A 1JTEA 4DR1B 1VQPB 3ESZA 1NYTA 2QTRA 4JV5B 1CS4C 4ZI2A 4M53A 4TRNA 4Z4HA 2FTKE 2D2FA 3BH7A 3LSTA 1D6MA 5BMVF 1V8PA 1QHHB 3IV9A 4JCOA 4NCBA 3C6KA 3N58A 4HAUA 4LJ4A 5AKZA 3ASQA 1NSFA 3KWMA 1I6KA 2V4ZA 4DVGA 2Y0PA 2ETXA 4CMHA 1WEKA 1S2DA 1KK0A 2BV3A 2XZPA 1LBTA 3P7MA 1GXSB 3SY8A 1LUAA 1YGYA 3UFXA 2O07A 3BXGA 2WAYA 1XBTA 3NV9A 3SZUA 2OGWA 2ONCA 2VIIA 1E92A 1R6TA 5FOVA 4BB6A 4DK1A 2QE7D 3GH3A 3L49A 1KDYA 3TCXB 2GLTA 4IM7A 2GXAA 3LY8A 1K8XB 3Q7EA 4Y2JA 3SDBA 2VH1A 2WWRA 2VS1A 5JNSA 3OQNA 1UFVA 2M6RA 3V4OA 1LLCA 1PR2A 4YMIA 1YTLA 1UPXA 4U8HA 2O3RA 4HXYA 4V2IA 3BCUA 1KA9H 1T3LA 3L6RA 3NHYA 3OT5A 4O4IB 1R4NA 4UXJA 3EPPA 2P2YA 2ZIEA 4YREA 1I1HA 2E4UA 4D6XA 3LP8A 1OXBB 1OREA 3GGCA 1QHYA 1ABEA 3PHBE 4QKQA 3JZFA 1UBKS 1AQJA 1G6OA 4XD7D 4P53A 5ICCA 2OQRA 3FVQA 2OM2A 3OQBA 5MGBA 1E4OA 5EJ9A 3PGJA 2JEOA 2QBYB 1G5PA 3NVAA 5AW4A 3AHDA 1P9OA 1L4BA 2RGGA 4RFSA 2WIFA 1KJIA 3QQPA 4OMCA 3IMEA 4POAA 1GUZA 1XNHA 4Z1MA 4YAKA 3I1FA 4JB2A 1JWAB 2J31A 4L8GA 3AL3A 3OM9A 4HWPA 4HAYA 2DUJA 1V1RB 2YASA 1XDSA 1M34B 4DA6A 3DTYA 3HS3A 4ODIA 3GMIA 4FEEA 1BX1A 4X0CA 1DLJA 4M86A 2CLIB 3P5BA 3S2SA 3FSGD 5FR2A 4PIPA 1HE3A 1R00A 5BWOA 2Q1YA 3BIJA 4P32A 4XE5A 3VJKA 5L7WA 5LM3A 1PX2A 2H7XA 4XZ3A 2HU5A 4PSUA 2G0AA 4TYPA 4YO8A 4FYJA 3THXB 3MS4A 3DMFA 5DCUA 3GV0A 4HDMB 3NHFA 4EBFA 3I64A 5I7VA 4NV0A 2H54A 2IBTA 2V7TA 2HT6A 1ESMA 1R0LA 1ZW1A 1MVNA 2RHTA 2VP4A 1KH1A 4Y0AA 4DT1A 4DXDA 5LJIA 5DM60 3OPNA 1UPAA 4MI9A 2WPDA 1MNAA 2X9GA 3EQ7A 2BFMA 1QDLB 4ZT5A 1XG5A 4AICA 2AK2A 4TXNA 2Q6VA 4GE3A 2QY9A 3KALA 5EKDA 2PH5A 1CQJA 4DV4B 4OHMA 1YVRA 1UMCB 2NU7A 1DCTA 5IJ0B 1KQSB 5TMBA 3GUVA 4RJ2A 1DP4A 3ONWA 4NCJA 2IODA 2KLBA 3AI3A 3KZVA 4Z9AA 3U80A 4JBNA 1P0QA 4L9SA 2MYTA 5JAOA 3AEZA 1U2RA 4M99A 2ZJ8A 2OQIA 3V76A 1SUCA 3UK2A 4UTXA 2YFKA 3O7MA 3V7WA 2GASA 2AVNA 3A4IA 4ICIA 4XVRA 2PWPA 2O19A 4JJGA 3L9WA 4X7EA 1DRJA 4O4IF 4PC7A 3U39A 4UC0A 2YWDA 1XVTA 2N1MA 1UJ6A 1T6BY 3IQDB 4ZYZA 1MGOA 2XCRB 2QVGA 2ONYA 3MYRA 2WIGA 2IUUA 3MWYW 3HO1A 4H4EA 1RQ7A 2XNJA 1QRDA 1YBMA 2O50A 3PVZA 4Q1CA 2FPWA 4RABA 5CR9A 5ADWA 1I4LD 1L8XA 2P27A 1YMUA 1ISIA 3PU6A 3VRHA 4D74A 5KQSA 3V1MA 1D8TA 3E53A 5AJZA 3LX6A 4UOZA 1HLPA 4FFBA 4QPCA 1PR9A 3LQFA 3QVTA 1U2QA 2I65A 1KC1A 2Q8NA 3RS3A 3ML1A 3AI1A 3U4CA 4DIOA 2XY4A 1L6IA 3O7WA 3U3OA 1KZ9A 4E5VA 2O0KA 4UMVA 4DBLC 1NV8A 4TSRA 4LF9B 5CFMA 1WKVA 3AL0C 4OOEA 1YCFA 1VXOA 3D3EA 3NX4A 1Y5MA 3PKIA 3U09A 2YN4A 4FZJA 4Q3CA 1F0YA 1JYEA 4J03A 3F8WA 4I46A 4QQRA 5JLJA 1C8VB 3GNTA 3UPTA 1G7TA 5JBQA 1XJQA 2ZYDA 4FZ3A 3L5KA 4KJXA 2VRCD 1IVYA 3N7UA 4N48A 3GCWA 4R0MA 2I4IA 4X64B 3WGIA 4J94A 1OXMA 4LX8A 1PWZA 1KJ8A 1JECA 2EEZA 2PYZA 3AEXA 1GIAA 3M1LA 2O7SA 4B17A 2HA2A 1HRKA 1U11A 3CVJA 5A88A 2WJHA 4IDOA 2PXXA 4A91A 4K1LA 4NRDA 1T5OA 2FP3A 5E1DA 5JW6A 1VQ4B 3OURA 4L8FA 2JLZA 3CONA 1ZDMA 4H6VA 4BKQA 4F86A 5FNZA 1R10A 2EJWA 3VSEA 1SA0B 1K73D 4ER5A 4PO3X 4D9JA 3UMMA 1UC9A 4HFRA 1FQJA 3VVLA 5EPOA 4E5NA 2NXCA 3PF8A 3VNVA 1MW9X 4QRDA 1VL2A 3IQWA 5LZ4A 1GTVA 2JLWA 2OZVA 4LCBA 4DARA 6NULA 3ICWA 4OO3A 3A28A 4UCWA 3N7TA 3OLZA 1EM8A 4JJFA 3SYKA 1JDJA 1FOEB 1MC5A 2VCEA 5F4JA 3NTLA 4FHGA 5TJ9A 4BU1A 2FOIA 4DVJA 1GPWB 5SZJA 3GL9A 3CLSC 5FLYA 3WGMA 4BQQA 5IYWA 4EJ6A 8ABPA 3F5MA 4S0XA 2GFQA 8ATCA 4B46A 5GIOE 4DDVA 2ET6A 1P3DA 1YL7A 2YV5A 4OOFA 2Z04A 1G4HA 3PUYA 2QA4B 3RIEA 4JYBA 4K28A 4TLDA 4UBJA 5HG0A 2RI1A 2F2TA 3F3MA 3ILXA 3F3KA 3C3WA 3ME5A 4IH9A 1ZP6A 4PHHA 4LPKA 1SD1A 1VLJA 1JHVA 2PVPA 4AK9A 2PG3A 1XCMA 1L5MA 5H9VA 1V8ZA 2W6IA 2QRJA 2FPOA 2WF9A 2NGRA 3FMFA 4FK8A 4JD5A 4LYYA 4PHFA 4TTAA 4UTOA 5BUCA 5DNDA 1I6WA 2P2ZA 2A6PA 2GTPA 4OHPA 2OY0A 4YPFA 2YY6A 2H29A 3HCDA 2XDQB 4HH3C 3BAZA 3UGKA 3KWFA 4CV0A 1DQNA 1AUVA 2XHEA 2ZBQA 4G2TA 5EWLA 3P45A 1GTG1 4C3VA 1J23A 1HZJA 3HACA 2OHIA 2WRZA 3E9RA 4QAQA 2EL7A 1C9NA 2X1MA 3CGWA 4HYTA 2RC5A 1AOXA 3D5TA 1ADBA 1IWOA 2JD2A 3GBPA 3I9V1 4C5AA 3DFFA 3JCZA 3SZOA 1FVOA 1OW3B 1BKYA 3P8ZA 2R1UA 7YASA 1IULA 5E0KB 4EL0A 2QJFA 1X80B 4U9IS 4L2IB 4V1CB 5KYWA 4FHCA 3UFBA 3THYB 1BH2A 2P11A 4WK6A 4BNTA 3O3MB 5KMGA 4EW1A 3DFUA 1DI0A 3DW1X 3JWPA 1Q86D 3MQ4A 2XBUA 1ZA1A 4I1VA 4IDCA 1T5DX 3EIEA 5C4IA 1H9AA 1FJ2A 2BKVA 2QN7A 3OI7A 2ZRGA 3HP4A 1LK0A 2J5XA 1UQTA 3OPOA 2Q3FA 3KWJA 3BOSA 4IILA 2ZSDA 4B3GA 5REQB 3T54A 3RCBA 3TB4A 4PYJA 4X85A 4JH0A 3F4KA 3H18A 4IY1A 1P2VA 3IQHX 4JZKA 1VPEA 4IIVA 1DKPA 4MRAA 3JU3A 4QXRA 3KHTA 3ZS8A 3KUKA 1JU9A 1KFCB 5AYVA 3RVDA 3QEJA 2C03A 1Z4IA 2XA9A 2R5FA 3L7OA 1M1YB 2FRDC 1NUQA 3X1JA 1E8NA 1VSQA 3PC4A 1GL9B 1QGUB 5E6RB 2GREA 1N6PA 4ZALA 1J8DA 1SHJA 4RO0A 3JALA 2G8LA 2UAGA 1VIMA 3UXYA 4UOEA 2PUJA 3ANYB 4LSZA 1D2EA 1PJ6A 1I3LA 5JSQA 3OOWA 3G2KA 1NI4B 4DCCA 4QJ5A 1PAUA 3R1IA 2LP4Y 2G4VA 3KPWA 3W2TA 4AM8A 3RT1A 5DS0A 1A8QA 2KLHA 1R4MB 1Y4AE 4AJOA 4KPYA 4A10A 2XVZA 3ZV7A 1NUTA 2OO7A 3TQCA 1P77A 4D3XA 3NV7A 5LYJF 1MA0A 3ANXA 3PC7A 4IHJA 3RYCA 4KXWA 1W6UA 3GPCA 1SB9A 1PLKA 3B5JA 4XEHA 3HK2A 3RFUA 3PENA 5LB2A 2QTVB 4EUHA 4KBFA 4DDTA 1F5SA 4RMJA 2ZRIA 3WYDA 1FFGA 1JVSA 1JU4A 3JARA 1KAMA 2XLCA 3M83A 3HDGA 4X1KA 3KKKA 2X9NA 4FKBA 4IPTA 5KOJB 1QANA 5PGMA 5ILOA 4DV3B 1XZEA 3M7IA 3MTIA 3PT5A 4G1VA 1KH3A 1EHCA 3DCYA 4WESA 2HJSA 3QTBA 5LKRA 3ND9A 1E3TA 4YVFA 5FYQA 3HNRA 5ER9A 4O1IA 1P5JA 3KSRA 4ZT7A 1CJKC 2VHZA 3T6KA 3VBCA 4D8WA 5EXDA 5KDOA 2DECA 2Q46A 3NTVA 2JHFA 5FPSA 2TYSB 4Y1GA 1JE1A 1N2CA 5E7JA 2AHOA 1UDWA 1WJGA 3C48A 3JQEA 4A7PA 2JAPA 1NPYA 4H1HA 3CRW1 3BG5A 4F5DA 3KB8A 1DKRA 2FWBA 3HJCA 2Q4RA 1Z4NA 1OZHA 2V1XA 4RAOA 4WZBB 5SICE 4BRZA 2PBZA 2W58A 1Q0QA 1A71A 1LPOA 4MX8A 5IVIA 1H69A 2GBFA 2OCPA 3ZGXA 4BFXA 1W75A 2YJNA 1BD3A 4WLEA 4XYMA 2C0PA 1E0DA 2MT9A 1X2EA 1AKNA 2BCJQ 4EMBA 2HY7A 1SMKA 1WPGA 2R3SA 3Q6RA 1AG9A 1UXGA 3UUWA 3JQBC 1GL3A 2FUG6 2W2NA 2BL4A 4MVJE 4Z9BA 4ZVNA 4U5QA 3VISA 2WUDA 4M0MA 4PVDA 2YRXA 2JLYA 4WJZA 4JLVA 5EPUA 4LNHA 5K0GA 1Q77A 3B9QA 4MLZA 2IXFA 1JDPA 1MXHA 2BKUA 4MJ3A 4XUCA 1XYYA 4I3HA 1LF5A 4IINA 3PCXA 1C1HA 1LD3A 1D6SA 3H83A 5LU8A 2JI8A 2WJGA 2X58A 3QFCA 1X8KA 1XZBA 1Z8FA 4IDGA 3CEJA 3VH3A 1P4SA 1ADFA 2V6BA 4GR9A 2X3FA 4X94A 3PXAA 1KI3A 1SC1A 4OHKA 1M90D 3LECA 3UT5B 3CKYA 4NS4A 4YUZA 5IPFA 4FYMA 4I1IA 1GN9A 3ORRA 3HMQA 3FMOB 3GU3A 1OH8A 1X7XB 4Y0NA 5GONA 2JAWA 3UMYA 2MTBA 4IICA 2K6GA 1YZUA 4C7OA 5CEEA 1RDFA 2AFIB 4ZCPA 1HG1A 4JBWA 5FULA 2F1MA 1J25A 1I2DA 4JC0A 4KWHA 3BMOA 5DSXA 5AR1A 3RUIA 4AZTA 2DZDA 1ZU5A 3GBSA 4BZQA 3GSIA 1O08A 4RQBA 2MCFA 3WA6A 3IKTA 1PEDA 4FINA 1P2BA 2FSHA 4FD2A 3C1AA 4HDRB 4BY9E 3EJWA 4YACA 2ZKIA 5CNJA 2B7LA 1DARA 1UFKA 3DHEA 3UJ9A 5FI0B 3WRYC 4AY5A 3RASA 2Q3CA 4D6PA 1OLSA 1JHUA 4Q02A 4HAWA 2YIDA 1NULA 2I2WA 4Q4LA 4FUQA 4WEOA 3AHEA 1NQOA 5JJKA 4GSKA 1BHSA 3FX2A 2H9IA 2VQFB 1C7RA 1ZH6A 3WX0A 5AXAA 3OZRA 4D9FA 4ED9A 1CUGA 2ZJ0A 1Y3DE 4DJ5X 1X42A 3BD6A 4FSHA 5KQMA 5IZCA 1SKYE 1VMEA 3IA7A 1W94A 3CLUD 1EP3B 2FEPA 4ZI7A 2JA1A 2PAAA 3GF4A 3MOIA 4NEQA 3ZKWB 2Y2UA 3LUJA 3HYTA 6PFKA 5ES3A 2QYSA 3OWXA 3VJRA 1PVDA 4M1YA 2G8NA 3OE1A 3MMXA 1RRKA 4OAPA 2YYAA 5IARA 3NQ41 2Y93A 1JDBC 2JK1A 1XHLA 3DEJA 1GV0A 1ADCA 1UBOS 2JI6A 3HUDA 5DLPA 1LK7A 1XRSB 4IAOA 2OO3A 5ALKA 1RXVA 2DUUA 5JPDA 3N0RA 3AJAA 4ND6A 3WK4A 4DZRA 5EJFA 3FH0A 4EB8A 3G6KA 1RWOA 2ZUCA 3DP7A 3TDNA 1RYZA 4F3TA 3MVEA 4PC3A 4M7WA 4X1IB 3PC8A 1OUMA 1Q0ZA 2RK4A 4W9RA 4RPCA 1LY1A 3JTEA 4DREA 4A03A 5GM1A 1LPPA 2PK3A 4EG3A 4L76A 5ALOA 1P18A 1EFTA 1RQLA 4YFVA 1K08A 3TAXA 1F7UA 1I5RA 5M3BA 1W1WA 4LFCB 3DLAA 2I54A 2IXTA 3EN0A 1XP8A 3OIFA 2IX3A 4PSVA 2JF0A 3H5OA 5JG7A 1D03A 4RVOA 3T7CA 5HZHA 1QZUA 3I73A 1OX4A 4Z4UA 1L9XA 2HA6A 2EGGA 2R68A 4MHOA 3LPDA 4R1MA 4WKOA 5T4EA 5J47A 4QXOA 4Z8YA 1RWWA 5FTLA 2IEBA 3HI4A 2GPBA 1S8AA 1RLMA 4HLUC 5KNBD 1K28D 1W85B 2H3EA 1BX0A 1IM8A 5ALZA 1TVKB 4ZYXA 3LDFA 3IH5A 1H8HA 2J07A 3BFKA 1VJRA 3ZXXA 4UNRA 3TRIA 5L3QA 4JX9A 4OOSA 3MPUA 4N1AA 1L7VC 2QUJA 3KKEA 3DB2A 3RYIB 4E08A 1KL7A 4BB9A 3JQ9C 1QO0D 4XI9A 2QRUA 2Q3LA 4GUDA 4OXKA 1R8SA 4IIJB 3OFJA 1E3QA 1L5LA 1BWQA 2R00C 3HADA 3EC1A 1PT5A 5SZIA 1QYVA 1YJNB 3W0LB 5BYKA 3ELUA 3JAKB 3PYXA 1PJAA 3EVCA 1KP2A 1IEXA 4PANA 1K7FB 5BQ5A 1KS2A 5FAKA 2A0XA 5TXGA 1CIPA 2AJTA 4YRNA 2C8VA 1ARZA 5EP4A 3GA7A 4UBNA 1ZIOA 2BFEB 3FA2A 4L5CA 4PAGA 4P6YA 3T7DA 3X3HA 4JUAA 3D4OA 1EDEA 1N9GA 2XMCA 4BNLA 2AMYA 3QW2A 3DAGA 2BM0A 3CEHA 5I9NA 5SZKB 3SR0A 3EYWA 1OKKA 3QA9A 4XGIA 4YUWA 2FN9A 3FCYA 3Q9NA 4ZC8A 1BN7A 1FNSA 1YH3A 5C8YA 2WJ4A 3HBLA 3PUVA 4A15A 1V25A 2F8SA 3NEJA 3WLTA 2H1OA 1M8FA 3ZWVA 3AIKA 3TIFA 2L0XA 1SHLA 1GKKA 1YRHA 3CNNA 4S1WA 4YAEA 5L7YA 4RKYA 5KSOA 2DERA 1MIOB 4FXPA 4NBUA 4RF2A 3SQOA 5DI9A 3TEMA 4BAUA 5EUBA 1Z82A 1NF3A 3Q2OA 4ARBA 1WUIS 3RK0A 3U1VA 3LY7A 4BLTA 1EFRA 2BEVB 1CVIA 4M1EA 4HUTA 2G7MC 1P75A 2IX9A 3PNQA 5HE8A 1J20A 4WZLA 4HH1A 2AG1A 1E1KA 3P9CA 4DCNA 3TQFA 2E37A 2FUG1 2GM3A 1SPBS 1Y4ZA 1NN0A 2IW1A 2ZEJA 3NKLA 4QIHA 3ELBA 3QI2A 5FUWA 6ABPA 4ALJA 4B45A 5DXFA 3BXXA 5H3CA 3T7SA 1LQUA 4L51A 3PA2A 2J5QA 2X0RA 4AJNA 4DTCA 3M82A 3FTQA 1H2FA 3T9DA 1SXHA 4MVWA 4EUEA 4F3NA 3CLTC 1FNMA 3DE2X 3CR3C 2QV0A 3NJ8A 1K5HA 4EHJA 2FDCA 3ZJYA 4D4MA 4KWTA 3VR3A 3O4IA 3U7IA 3W90A 3NPAA 3WLHA 1KYTA 4C7MA 3T5PA 3K70B 3V8NA 4S05A 1AQLA 4EQ6A 2JBAA 2MSKA 3Q1KA 1OTXA 1MVLA 5BSUA 3ZV6A 2H4WA 5DNVA 1ID1A 5JCJA 4BNIA 2BRUA 2PA0A 2KYRA 1Y1LA 3QLUC 3DXXA 4NSNA 1J06A 1RZRD 4A0FA 1IZZA 4JT2A 3I9FA 1HURA 4NU6A 3TLZA 4AZWA 5ELMA 1L4LA 1WW2A 2YWBA 4D0SA 3S81A 1EEHA 2BFAA 4YJ3B 1TQHA 5DASA 2QEXB 1SY7A 3OQJA 2BTQB 4IIJF 3ZHCA 2IUTA 4K05A 2W90A 4MB0A 3WRWA 3Q3VA 4XIFA 5JIBA 3M6LA 3L8MA 1PNTA 3B6KA 4FZVA 1XTUA 1NXOA 2W2VA 3A8JA 1CNMA 5I7OA 1V11B 1Z0JA 5B6JA 4Q7LA 1VLOA 1I4WA 1U04A 2CVZA 2GN2A 2YZNA 3VZSA 4DMLA 2IZOA 2BGWA 2VDWB 4ZAVA 3WYEA 1NLFA 4F46A 5K0FA 2Q2QA 1JFLA 2YXLA 1ULAA 2RFLA 4DC0A 3EPRA 1WV1A 3BA1A 4J0EA 1LTQA 3T1NA 3TRDA 2WG2A 2ZVQX 3RS9A 5GZ6A 5TV2A 4GW3A 4ZMRA 4EM6A 3TNYA 3O82A 4HFJA 5F3DA 4LF4B 3C3XA 2GJKA 3UENA 3WISA 3LQ4A 5FLKA 2JLSA 1IJBA 2AN9A 2X41A 2ZYVX 3M9LA 2ZWPA 4L0QA 4WCFC 4AYTA 2OXTA 1AO3A 1XRJA 3OUZA 2F48A 2X5OA 5F77A 5HF8A 5G4LA 3ZVLA 4DB2A 2BVNA 4UE2A 10MHA 3P0JA 4NONA 1SVIA 3P0EA 1MUUA 2I6SA 5T8KC 5FBWB 1A96A 2FMXA 1NDHA 3EXAA 3WL5A 1E2NA 1YR1A 2BFPA 1ZIPA 4PN7A 3WA7A 4ZMSA 2Z98A 4XX1A 4KR2A 3QWFA 5THXA 1ZUHA 2QJRA 2QUBA 3EXHB 3NOVA 1XROA 3JQGB 3SZLA 4Z4EA 2QMOA 3HP7A 4RPDA 2VXOA 1JS1X 5KQGA 1F8UA 1U2DA 4NZNA 4Q37A 3RSCA 3O3CA 4YRQA 5IXSA 3BXPA 2P69A 1U6KA 3K0HA 3P0RA 3TWOA 5K0JA 4KSCA 1XPOA 5LQUA 5BW5A 2HLPA 1F3LA 5J2TF 1T4BA 3BE6A 1H5QA 2ZYIA 3BQNB 1GGHA 1TMGE 2D4AA 5IAGA 3RBAA 1CF4A 4Z4ZA 1VHOA 1E8MA 2AI1A 2OENG 3K72B 3N3BC 4PGOA 4EYKA 1AQ6A 1DE0A 4N18A 1E3ZA 2DCUA 4TMKA 1J24A 2G76A 3MILA 1XFDA 4MYTA 3MWGA 4I14A 4R2KA 3ENVA 2D1TA 3N2LA 5AOBA 5LBUA 3TLYA 1W9HA 1M72A 3KJQA 4NBLA 2WZPP 1G1MA 3MINA