2X0KA

Crystal structure of modular fad synthetase from corynebacterium ammoniagenes
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
338
structure length
338
Chain Sequence
b'MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Oligomeric State in the Crystal Structure of Modular Fad Synthetase Provides Insights Into its Sequential Catalysis in Prokaryotes
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 102
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2x0kA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2x0kA01
5TEVA 5A8AA 4EG4A 4CDMA 2Z09A 2DXIA 3FOCA 3TS1A 2VBUA 1O95D 3Q4GA 3IUBA 3SDBA 1PG2A 1IVSA 1NSYA 1P7PA 3VRHA 3A4IA 3LCJA 2B7LA 4JXXA 3NBAA 4NDAA 5A89A 5J58A 4ZCRA 2WQ7A 3TNJA 5K0TA 1MAUA 2QJOA 2D5BA 3CLTC 1IHOA 2ZUFA 1XNGA 4R2LA 1LW7A 1MB9A 1TYDE 3DV2A 3AL0C 1P4MA 4L2IA 1BS2A 5K0SA 1M8PA 1N1DA 1NUSA 2Z3VA 1O0BA 2A88A 3FETA 2YWBA 4U8HA 1TYAE 3IUEA 3H9CA 3FI0A 4ZCSA 1R6XA 5JBNA 1N77A 1N07A 3SP1A 5LLTA 4DDMA 1KH2A 3M5WA 2AKEA 2GM3A 2JAXA 3NV7A 4DJAA 2CSXA 3ZJTA 2HGZA 3FWKA 3FH0A 3ND6A 4YMIA 4EG8A 2YY5A 1ZH0A 3UOWA 4ZT7A 2PZAA 4MVYA 2AZXA 4QRDA 3RFFA 3PXUA 1PG0A 3P52A 2VTBA 4FZJA 1K4MA 4MW2A 1O96A 1MC1A 1T6ZA 3SZ3A 4MW6A 3CVVA 2DR2A 2CV0A 4CQNA 1OWPA 5IJXA 1O97C 2C5SA 4ND7A 4RUKA 4CT0A 1A8HA 1H3NA 1N75A 2ZUEA 4MUIA 2OYNA 3HFJA 1GN8A 3LE8A 3KT6A 5TRDA 4K0RA 4NX2A 3L92A 3X1KA 2VBTA 2RE8A 2QUJA 3PNBA 4G5FA 1QJCA 1H3FA 5DASA 1X8XA 2OV4A 4OUDB 4MUHA 4MW9A 2PZ8A 1GTSA 1JHDA 1PFYA 4YP5A 3X1JA 1Y42X 5HG0A 4MW7A 1O94D 3KT8A 4JXZA 1K4KA 1N2EA 1OBHA 1WOYA 5HUJA 1YUMA 1UFVA 1N2GA 2WB2A 3HMQA 4P2BA 3PNYA 5TS2A 4ZT3A 1MB2A 1PFVA 4QBTA 1CT9A 2NSYA 3PNVA 3DPIA 5H7XA 3ZJUA 1F7UA 4G5YA 3MLBA 1F4LA 3RBAA 1F7VA 1N2IA 1JIJA 1T9GR 2JA2A 4ARCA 4NATA 3E27A 5LFAA 2ZP1A 3QTTA 4KR7A 4MWEA 1H3EA 3HL4A 2DLCX 1K92A 3CR8A 1NUPA 3IVGA 1QU3A 4L2IB 1JZSA 1K97A 3KT3A 2E0IA 3U1VA 1WY5A 5FO1A 1WZ2A 1NI5A 1KAMA 2JANA 3UK2A 3RHSA 3SEQA 1DNPA 5KCMA 4TS1A 1IH8A 1N2BA 4PBTA 2IELA 2XRYA 3CLTD 1VLHA 4XFJA 1Q19A 1JMVA 2A84A 4UZEA 1XNHA 3IVXA 3QE4A 3FNRA 1QNFA 1Q15A 4MVXA 2O5RA 4QREA 5H16A 1Q9SA 1V47A 2X0KA 1OD6A 3IMGA 1KQNA 2H2AA 1M8FA 2IP1A 3GLVA 2J5BA 4MQ6A 4XSVA 2VTBB 5KWVA 4Q16A 1QRUA 4KR6A 1O96B 1MRZA 3OP1A 2VBSA 1U3DA 3VGJA 4ZCPA 4I6GA 3MXTA 3UY4A 4F3RA 3D6UA 4NAHA 3IODA 2GOYA 2YXNA 3COYA 3IOEA 2D54A 1QQTA 3X1MA 3NBKA 4WNYA 3TQOA 1GLNA 4GU5A 3HGMA 1NUQA 1WXEA 1NUUA 1HYBA 3ZUGA 1GPMA 4UZFA 2J08A 1F9AA 1PFUA 4H3SA 3KT0A 2QTNA 2QUKA 1ZUNA 3AIIA 2A1TS 2QUHA 4U7JA 4R2MA 4J75A 2DPLA 3TQIA 2CV1A 1J21A 1R6UA 4ARIA 1WXIA 1O97D 2OQ2A 3COWA 1WXHA 3VU8A 1OBCA 3K9WA 1G8FA 1WQ3A 3N8HA 4PY2A 5AHWA 2DERA 1I6KA 1KR2A 2QJFA 1NZJA 4MW4A 3ZXIA 3PRHA 3Q12A 3P0JA 4HK4A 4MW1A 4MWCA 4F4HA 5FNZA 4PBSA 3MUEA 4MWDA 1WXFA 3ZXSA 2E21A 1WXGA 1JECA 3GMIA 2E18A 2H29A 3MLAA 1U3CA 3QTBA 4HPWA 3SEZA 4ND6A 1N08A 3L93A 2G36A 1MBZA 2P3MA 4MVWA 4ZT4A 1TEZA 1TYCA 3KFLA 1JIKA 3A04A 4AS1A 3BL5A 2A1TR 4EF6A 4NAUA 3FG9A 3AG6A 1I6LA 1QRTA 4PBRA 1O0CA 4MVCA 1NYLA 2QTRA 2DEUA 2PXHA 4KR9A 2Z08A 3SYTA 5LM3A 2I1LA 1MOPA 1U7DA 5IHXA 3CLUC 3OTWA 1GZUA 3TZEA 3AG5A 1IFXA 4MUJA 2X1MA 2EL7A 1G59A 1ZH6A 1VBKA 4KKVA 3Q10A 2E89A 1NP7A 3H99A 3N05A 3A05A 1J1UA 1FFYA 1ILEA 5TEWA 4I6EA 4EG5A 1TFUA 4DE5A 3CLSC 3HZRA 2NZ2A 1D2RA 1T6XA 4MW0A 4JYZA 1WQ4A 3GUZA 3ZGZA 3JXEA 1EFPA 1G8HA 3AKZA 1KH3A 5DEOA 3H9BA 3INNA 3ELBA 2A1UB 2PG3A 4DLPA 1EFVA 4Q93A 5DB4A 1N78A 4I6JA 2AG6A 1J70A 1M8KA 1PFWA 1U7XA 4JFAA 3ND7A 5J5AA 3UC5A 1JIIA 1I6MA 5A88A 1EE1A 4NZPA 2IJGX 4WSOA 1R6TA 2V0GA 3BNWA 3G5AA 1EJ2A 3F3MA 3CLRC 1NUTA 4EGAA 3RJZA 3RK1A 1KP2A 1RQGA 4U63A 1YULA 1O5TA 3S3TA 4EFKA 2QJTA 4KPUA 3FY4A 4MUFA 4R0NA 3N9IA 4MLPA 4CDNA 1TQ8A 1ZJWA 1OWOA 1N06A 1YIAA 5BNZA 2CT8A 5TGTA 1VL2A 1KORA 3COVA 2BTEA 3DLAA 3IVCA 1JZQA 2WQ6A 4YP6A 2A1UA 1KAQA 1JILA 3H05A 3P0HA 2CYAA 5F23A 2DETA 2RD2A 3ILVA 4MWBA 4X0EA 4MUGA 1QU2A 4G6ZA 2CYBA 1IQUA 1JEDA 1LI7A 1O95C 2O8VA 2QTMA 3IOCA 1WJGA 3LOQA 3ND5A 4MAFA 4MULA 4EG7A 1T6YA 2A7XA 1J20A 1VBNA 1GTRA 1Q77A 1YUNA 1IQRA 3FIUA 5DK4A 2XRZA 3FHJA 1M83A 1VBMA 2V0CA 2PFSA 2DUMA 1COZA 4MUKA 5J59A 1J09A 2X3FA 4MUEA 3CVYA 1IQ0A 4JZYA 2CFOA 1FYDA 2CUZA 3H97A 1S4MA 4XFDA 1EXDA 3COZA 5HUHA 3AFHA 4EG3A 3A2KA 3UMVA 3N2YA 1YI8A 3P0IA 3CTAA 1M1ZA 1O6BA 1ULHA 3DO8A 3TZLA 3CVXA 1B6TA 2PZBA 4K03A 4ZCQA 1MAWA 1OWMA 3SZGA 1JGTA 2WSIA 4ZT5A 1M8GA 4HJXA 3MMXA 3HV0A 3ISJA 3CLUD 1XJQA 4ZT2A 1N05A 1EFPB 4AQ7A 2J4DA 2CYCA 3IH5A 2HMAA 3G6KA 2A86A 1KKUA 4MW5A 5EKDA 1T9GS 3I05A 1TYBE 1EFVB 4RPIA 1V8FA 3K32A 4OJMX 1GAXA 5KHAA 2GKSA 5FO0A 3G59A 1N2JA 1KP3A 1M8JA 4ZT6A 2D13A 2X1LA 4DDHA 2BYTA 1SURA 2J09A 3CLSD 1OWLA 4A91A 4GRIA 1KQPA 4J76A 2PIDA 3D6VA 2R5WA 3IOBA 4KPUB 1JEEA 3CA8A 4MUNA 1QRSA 4YP7A 1U0BB 3IDFA 4HJRA 4BWVA 1N3LA 2QUIA 2A4MA 1H1TA 4EG1A 1O94C 1NURA 1OWNA 3CLRD 3C8ZA 3CVWA 4EG6A 3ZJVA 1YIDA 1Q11A 3CVUA 1KQOA 1KH1A 2EJCA 3IMEA 3ZIUA 2VXOA 3IMCA 1WKBA 1NB9A 2YWCA 4YBRA 1MJHA 1XNJA 1N2HA 1I2DA 3FDXA 2CV2A 1J1ZA 4OUDA 1G8GA 1LI5A 1EUYA 3RK0A 4E1AA 2VBVA 4DDKA 2TS1A 2HZ7A 4S1OA 1X6VA 1EUQA 1N2OA 4DNXA 1NB0A 1QTQA 4ZCTA 1IRXA 2J07A
chains in the Genus database with same CATH superfamily
1C9NA 1OR8A 2YWJA 4NQRA 1EVQA 4BO3A 1FDIA 3A1FA 1T8WA 1ABBA 1XHFA 1GRNA 1OXMA 2XWQA 4ZO7A 1N7HA 5FWXB 3KKZA 4BV9A 1Z74A 2WWIA 4P7JA 1FIUA 1VA5A 3MPUA 3OF3A 1D2CA 1X7GA 1TUEA 3AUTA 4LWPA 4E5VA 5C5DA 3AWIA 5FPKA 1WMFA 1NRXA 1TK2A 2X0NA 2B4TO 1V8PA 1X86B 3KPUA 4V02A 1G7RA 3WX0A 4RHXA 4DCJA 4HZIA 3L82B 1ID8A 3FYHA 3Q3GE 5AI6A 3KSZO 4RVOA 3KDSE 1LTKA 4R2LA 4MO9A 1HNZB 3IJEB 3QXCA 1R66A 1AGRA 2D0IA 3RG2A 3VZBA 5LP6A 3ONVA 1NJ2A 2R68A 5KTNA 5A4FS 4YFYA 3R0QA 5ALWA 3M4XA 4W99A 5EC8A 3RG8A 1N1DA 4D46A 1N6LA 4PQYA 3H9UA 5DHTA 5K2MA 2HYIC 4CTOA 3JPWA 1HFKA 1BRMA 3RLFA 4CEIB 1OLSA 2VWHA 3HJTA 4QA9A 3TNLA 2QE7D 2I4LA 3CEPB 1R6XA 4BVKA 1N57A 2UYYA 4XOPA 1P2BA 4C0XA 4L6CA 5K3FB 2D0PB 4GOJA 1VGQA 3DE7X 1IBKB 5JDCC 3DZDA 4XVHA 1AKRA 4AD8A 5EIXA 1V0FA 1L1QA 4G1FA 5I7RA 1CZLA 3NV7A 1K8YB 3PT9A 3OJXA 2QKYA 4IHJB 4YVFA 3ME5A 3LUPA 1E2FA 3ER9A 4GYJA 3TB4A 4NCJA 4OX9B 2R8ZA 1UC5B 1SHJA 1NC1A 1Z7EA 4QDXA 5JQWA 3EQ8A 5IJAA 5KNCA 1RTKA 2P4QA 4RETA 1PG0A 2PJRA 2RBEA 4XA8A 3RUPA 4BJ3A 1T2VA 4NNPA 1J0XO 4FFMA 3RY8A 3WK7A 1KVUA 1U8TA 3FTQA 1KDPA 4IRUB 2E4ZA 3GGCA 1GKYA 1XRQA 3FBTA 3OZXA 4C1BA 2WDPA 4YJ3B 1OWPA 5AXDA 1I0IA 1K7XB 3FA2A 5LJLA 3H5RA 1A8HA 3E58A 5CLLA 1KWGA 1UCFA 4ZP1A 3I9NA 1W2WB 1H2HA 1ESEA 4WESA 2RHWA 1XRLA 3SNKA 2BEJA 1UK8A 2C99A 4GI1A 4PLYA 5CVUA 4BL5A 3V8RA 2JKVA 1X19A 4OQXA 1BXRB 2RHGB 2CMGA 1ML4A 1YZNA 2Z8YM 3L92A 3B82A 1KZHA 2W90A 3WSTA 5L7TA 3SX0A 4HLNA 3CO0S 4FMCF 4XE5A 3UXYA 5EYPA 1UBHS 3KYIB 2QLBA 1Z25A 2H4WA 3HYNA 5THXA 4XJXA 3TLEA 4KXXA 4FEYA 2GBLA 4BECA 1ZBDA 4DZRA 3WQSB 2XD4A 1X8XA 2BKEA 3U3OA 1VG8A 2PZ8A 1NULA 3C3XA 2JLBA 2B4AA 3H2SA 2F2TA 3BMNB 1UIMA 4BFZA 4KAJA 2N42A 3KOYA 3Q9UA 4URYR 3VKWA 1O4VA 1RZ3A 3IUMA 1SIOA 2NYAA 2WOJA 1A88A 5HUJA 2D1SA 3DOEA 4X7PA 3BK1A 4MGZR 3D7SA 3K1AA 3AF6A 2HRCA 4EVSA 1J9ZA 1IEWA 1YZVA 3P97A 4H08A 4OXKA 5HFJA 4DNRB 2X6RA 3VYWA 5E38A 3PD1A 1CT9A 4IGKA 4O1HA 3DPIA 3O7WA 1RWOA 3BHIA 4XASA 1BXZA 2ZR9A 4QELA 4ZYXA 4NZYA 4PCUA 1Y6JA 2BEUB 1ZHOA 2GYWA 1O9BA 5CX4A 4H2DA 2P2GA 4G86A 1EP2B 2I34A 1E3TA 4PPGA 4RVNA 4IH4A 1E2MA 4WBNB 3D6JA 1JB9A 3EGWA 2WHRA 3SEFA 3HM9A 4B1FA 5HTKA 3E27A 3TAHA 4ZI7F 2GM9A 2JKYA 4LWZA 2Q50A 3TOZA 3TZQA 2Z3WA 1WXDA 4DIBA 1H8HD 1Z8NA 2AW5A 4V0OA 2WZCA 2ZK7A 3OZAA 2FEWB 3KRTA 4GXNA 2Z6UA 1HZZC 3IPYA 3TW6A 2LWIA 3AP3A 3CNNA 4HRYA 4C89A 1YHZA 2C2MA 2PT5A 1Y4SA 3ENVA 2XWJI 3I23A 2O2ZA 3GU3A 4DZTA 2XY4A 5EP4A 4GOOD 3T5PA 3H86A 3WL4A 5CLIA 1T2DA 4MO2A 4LIPD 4HY3A 4LXUA 2I54A 4U2DA 5TARA 2F8SA 1T10A 1A9XB 1VLOA 3G0DA 5IJZA 2QRKA 3LGSA 4E08A 3RUIA 5KCMA 1JJ2B 4F11A 1WB4A 4CXMA 4XLTA 5JQGF 3JYHA 1V25A 9ABPA 2FG7C 3GFSA 3PUJA 4FE4A 1AMOA 1RJ9B 4MUBA 3KZXA 2OGSA 4GBMA 4P1VA 2VPPA 1OILA 1KZ9A 4X92A 2IU4A 4AP5A 3HVHA 3EVBA 3MCWA 5JV5A 5FAKA 1V4NA 4PLFA 2ZU6A 2I03A 2XNDD 4ALNA 3KQVA 1WTHD 3AY6A 3FN4A 3BH0A 3V4SA 3H2HA 2WFAA 1MN6A 1P8JA 2ZUBA 5JAUA 4KHPB 4AICA 1YR1A 3FWNA 2XWPA 2B5WA 3I3OA 2DC1A 5I4CA 3MS4A 4X3CA 4NAHA 1TAGA 3I5MA 5CFQA 3LPCA 1EXNA 3L9WA 5F9HA 1ZD3A 3A4NA 3IOEA 3OOSA 2ZYDA 4CJXA 5HJ5A 4B76A 5AICA 2OP0A 3O92A 1LSUA 4RDIA 1VJ1A 4PCLA 1QB7A 2YHAA 1F9AA 3MGCA 4OXQA 2M6KA 1ORTA 1ISRA 3AI3A 3DLPX 2XNCA 3ABIA 4FC6A 3NHWA 4E7OA 3MS2A 1SEVA 2GTIA 3VPHA 1MTZA 4UD6A 3LXUX 4W5TA 3WXMA 4GLJA 4O4JF 1SIWA 5EZYA 4HYYA 3OEHD 4BBZA 4KW7A 3T0FA 4NTZA 5FI0B 1YZFA 2GN9A 5A05A 4A8JA 5KBYA 2IYZA 3GGPA 2LZJA 4ZOLF 4C78A 4HE6A 4OQEA 1E58A 1C9JA 5EJMA 4FINA 3B2NA 2PT7A 3QVSA 4BJ6A 4F72A 3G2MA 4INPA 5KC8A 3KU1A 4OMCA 4RXMA 5K8JB 1EINA 3U17A 2NSHA 3U56A 3T34A 5DHPA 2VK1A 1W4CA 2CUKA 3D6NB 1QQ6A 3EC2A 3PQ7A 3QHAA 4MITA 5GWXA 2I6GA 2BFCA 3PRHA 4HK4A 1T5DX 2WVGA 1GGNA 1VSQA 2BEWA 4PBSA 2L0XA 2NGRA 5EP1A 5HKAA 5CT4A 1EHCA 3EISA 5CX1B 1WXGA 1GCUA 2ZSUA 4IIGA 2H29A 1KEPA 3U3XA 3L93A 1DAMA 4HQ0A 3OCWA 4D2IA 1CP2A 1YL6A 1PK8A 4QDUA 4O0MA 4RK6A 4W1SA 1UBNA 3RFVA 5ISMA 1UC9A 3PLRA 2YKGA 5FA5A 3S1AB 1V0JA 1VZ3A 2R6AA 3JYOA 2C7RA 5PGMA 1I2MA 5CVTA 4M0EA 2EEZA 3DHYA 1C29B 4EY8A 4GBJA 4MRSA 2ZJZA 4IDHA 1V11B 4UDYX 3PFBA 2AN3A 2O14A 4C01A 3IAAA 3GW8A 4G26A 1K0UA 1L7OA 2DPMA 2B99A 3R5HA 3SG0A 3RTEA 4C5CA 4DN6A 1HI9A 4TT8A 3V8PA 4BQRA 4ITUA 5AW4A 1C0LA 4OP2A 4UCWA 2OESA 3CD6B 2WYWA 5KNBA 1IBRA 1E2QA 1L7QA 3IRUA 3JAWB 8AT1A 1JA1A 4I4TA 1NNUA 4KGXA 4GI2A 3GGGA 3AVYA 1G7TA 1MV5A 1RPJA 1UBEA 1VOTA 2BP7B 2HUNA 1V48A 1H94A 4BAZA 3KQHA 4WEQA 3C3MA 1R8XA 5ABPA 4CM3A 3V32A 2RGWA 1N3IA 3ZNNA 1MH1A 4A0QA 1T4MA 1YK0A 2VPIA 3HRHA 3H99A 5B1IA 5M29A 4MVJG 5CM2Z 4RIIA 3H2YA 4MQMA 1RFGE 3RYHA 1ORRA 3QMVA 5FDFA 5LN1A 3PC3A 1VQMB 3ZGYA 4ZRMA 5K3SA 4UTVA 1Y8ZA 1ND6A 4KK4A 4Z6KA 1KVTA 2Q4TA 3DV0A 5DTEA 5JS2A 1E99A 1C1XB 2NACA 2Y1FA 4NAVA 4OKIA 3AFGA 1MJGA 5HXBA 1WQ4A 5FXMA 1KI3A 2PLFA 2CWDA 1KH3A 2BHRA 4HYEA 3LS2A 2DX7A 3KVYA 1P4RA 3E48A 4TM7A 1C4KA 1XJWA 2FQ1A 1JLLA 1NBOA 1CTQA 2XGOA 2NO9A 2Y1WA 2YV3A 4HDOB 4PF1A 1JJFA 1NLMA 5KSPA 4UM9B 2WMDA 1K98A 1P7CA 4X6UA 3IBCA 2AG6A 5J5AA 2P5YA 1DQYA 3ND7A 4FZRA 1VYHA 5AJZA 4B3XA 1SCKA 721PA 2FX2A 3S70A 4TMTA 4IOMA 1IY1A 3ACBA 4Q66C 2VSFA 3VJLA 4WFKA 2NV4A 4EUSA 4S2UA 1PJ6A 2DG2A 4KVGA 1BKYA 2P3SA 3AF4A 2YY6A 1ADFA 1IDOA 1UKBA 3PL1A 2JN9A 4MUFA 3SQDA 2AKYA 4AG6A 1RPAA 3HLTA 1C9YA 2NXCA 3N9IA 4F3CA 1Y1TA 5F64A 5BVGB 3UJ3X 4G8JA 2AV6A 3H6KA 1JX6A 1MQ9A 2R84A 3FGNA 5DBOA 2NUAB 4H9GA 2JFBA 1JQ3A 4IF6A 4LHZA 1RWVA 1VL2A 3CLHA 1KORA 3LHDA 4K46A 4LISA 4ZVMA 2YWGA 2B9VA 1BMFD 2RHLA 2UZ3A 4DMCA 2YIDA 2WIDA 4JBLA 4RWZA 4RA9A 2ARKA 3DD5A 5AW5A 1XZNA 3HBJA 4DA9A 1AO0A 2F59A 4XD7D 1ZONA 5JVDB 3VC7A 4C88A 3FMGA 1IOVA 4K28A 3VHRA 3FBGA 4X3PA 1O95C 5ILOA 2W5UA 2B1GA 2ZSEA 1KGSA 3N2IA 3PI7A 1GNTA 3OAAA 1PU2A 1QFMA 4TYPA 3DHWC 2QLNA 4I4IA 2NZ8A 5BSTA 4BMCA 2JI8A 5K8LA 2VK4A 3H04A 2RB4A 4R3NA 1XFOA 2VZ9A 2ATEA 2VA8A 4P3OA 3GFFA 4MS3A 4XGIA 2OFPA 5ITZA 1G0OA 2IXAA 2H4XA 2P67A 3JQ9A 1C7IA 4L50A 4X1OA 3VR2D 1R8QA 1RLIA 1JT2A 3IBFA 1ZC3A 2PKEA 5IVDA 4LF4B 1N3YA 4P86A 4CMAA 1BJTA 4DLWA 4QNRA 3E8MA 3TLAA 2PWYA 4JIGA 4YQZA 4E5DA 1R18A 2PUDA 5JJLA 2H7VA 3IAS6 3AQIA 4OHPA 5B1HA 5H68A 4G4SP 1EKXA 5EEHA 4CW7A 2H4ZA 3N8NA 3RVSA 5ITVA 2GESA 2WFMA 3F98A 5ECYA 1YVDA 3DO8A 4IINA 1PTKA 2HBYA 2VP6A 4JLWA 4Y67A 3ZBTA 4YONB 5L45A 1W73A 5ALHA 3EG5A 3BWYA 4WKOA 3ZTYA 5K4GA 1LJLA 1BNCA 1WMBA 4TKZA 4E46A 3EXAA 3FUUA 1SXGA 5FQNA 5BSWA 1V5EA 3L8MA 5KYTA 3EVZA 1DWUA 4L95C 1Z33A 2DHRA 1XN1A 4QUBA 5GONB 1GAEO 2GAIA 2C7BA 1QH1A 2FRDC 2O0JA 1BCRB 1F60A 1I51A 4O5OA 4P33A 4B44A 1Y8AA 3VPCA 1V0EA 4DG8A 1HDZA 2D1RA 2JL1A 1KJWA 1L5LA 3N0RA 1QDLB 1TJ4A 2JARA 1P0PA 3D5QA 3DT8A 3EEYA 3OPYA 5DFAA 4XN3A 2A5DA 3ZBUA 2JIOA 3L6CA 5KYYA 4H7DA 2YZNA 1PX2A 5IC6A 1R8YA 3IOYA 1PLLA 3Q9NA 2PYDA 4IV0A 4LGYA 3TQSA 1HYQA 3RU3A 1SBQA 2XXBA 1AE1A 3M1AA 4LWOA 1XDWA 1NIJA 4RZ2A 5IK2D 4ARUA 3N0XA 1UD4A 3L0SA 4J43A 1ECBA 4DSOA 4LI3X 3K9FC 2DQKA 4HD8A 3MELA 1JP7A 1Y6GA 1J22A 3EC1A 5HCIA 2R47A 2ZZGA 4LDRA 1VP3A 4GNKA 2H1RA 2Z8ZA 1XTRA 3L4EA 4RDXA 4XKVA 3EEIA 4WK0B 3OKCA 4WLOA 2O7VA 4PN3A 2XUFA 2WUDA 4PLTA 3WWPA 3F78A 4XPZA 3W6OA 3F7MA 1N3LA 2XUDA 4QOGA 4M1EA 1XQ1A 4R31A 1QOPB 1S8NA 1UXKA 4ISCA 5CB4A 2Q6VA 3LM8A 1ZJJA 4IDQA 4P1ZA 4DCMA 3CZ9A 3F6SA 3QRWA 5F5NA 5C18A 2R6FA 5EZYF 1BDJA 3IBTA 4BRSA 4AMZA 1EM8B 3RBXA 4MPRA 5K0NA 3OIUA 4YRZA 4JLDA 2FOIA 2XQGA 1CWUA 3WXBA 4OLBA 3M8KA 5ITWA 2Q0HA 5KPJA 5L9AA 3M3DA 1G3RA 2VXOA 5ICCA 4PO1A 4AQYB 3U2QA 3OVMA 1E96A 4FUQA 5A5EA 5FLXA 1D5WA 2PL1A 3K5PA 3NX4A 2QPAA 3UGKA 2WU0A 2CV2A 4D8WA 3JATA 1QZZA 3LPLA 4RQTA 4TOIA 2IHBA 3LQQA 5ECGC 4JI5B 3UQYS 1OTYA 3MSXA 3VC1A 2GN2A 5BN3B 5A3QA 4HLUA 1Q0SA 4WN3A 2RAFA 4ZPJA 3CCBA 3N7TA 3EG9B 5FWYA 4Z4HA 5F9FA 1R15A 1BOOA 3QLTA 1QOQB 4I2VA 4NEQA 2AA3A 1IBLB 1L5RA 3TO5A 3X0DA 1T0UA 2ZLBA 4QU5A 3F6BX 3I6BA 3L6EA 3NTQA 2X2PA 4IJVA 4PGAA 4WVFA 1GJRA 2HSZA 3VU9A 2X8KA 4EG4A 5JH7F 4TZ6A 2DXIA 2BHLA 1P8AA 2O5CA 4HFMA 1NP6A 1URPA 3MGKA 4HXFB 3CCJB 4KXUA 4WY8A 3PXAA 2L17A 2Q2NA 1IVSA 1C1DA 2I6XA 2VS1A 1JI0A 2IV2X 4CKWB 2JI7A 3DMNA 3MUFA 4L8VA 4PAQA 4PZAA 5SZIA 1XAGA 1PJBA 2NT4A 3CZAA 3H65A 1T3TA 1VECA 2RGBA 3ESXA 5FL7A 3L7BA 4BQFA 3HCOA 4ZCRA 5K0JA 3MWJA 1NJGA 1DKUA 1MKYA 3ABOB 4ZMBA 3RYCA 2HSWA 3AIMA 2EFEB 1T0PA 2Q0XA 3DWIA 4I4TF 2Y9MB 2I3ZA 1C1HA 3NHPA 3Q3VA 2WDZA 4Y3UA 5IYPA 2ZRBA 2X4GA 4L2IA 2O2EA 2BFEB 4ZCMA 1M8PA 5FEUA 4YUAA 4HH4A 4CMIB 4MB0A 2VQSA 4RA6B 3GQVA 2O8CA 4BVEA 3NVAA 1HFWA 2ZTGA 1TYAE 1YI0A 2VBFA 2YQZA 2OFWA 1SU8A 2JFFA 3CXUA 2JK0A 3GXOA 5JBNA 2VF7A 1BH2A 4AKSA 3CRQA 4BEBA 3SP1A 5ALGA 3T1HB 4G1CA 1UDWA 3AUSA 4TWJA 3QEOA 4O1IA 1QF6A 1WU7A 3E3MA 2YCLA 4U1RA 4XLZA 5E7JA 5BRJA 2ZTLA 4BQSA 3MZ0A 1HR0B 2KPOA 2GM3A 3LPMA 1F48A 5D87A 4GDMA 1HK7A 5JANA 5AK0A 2W6PA 3ND6A 3OTQA 4HEHA 1ULZA 2VRBA 1EK6A 2FEXA 3SSOA 1PWZA 2A9KA 4KN5A 2CLHB 1GGJA 1RWKA 4NOLA 3E35A 1F12A 2WKQA 3WISA 2PS9A 1SUFA 2G0TA 2XZDA 3GP3A 4XDYA 4EHDA 3A3OA 4YAUA 3N2LA 3OE7D 4L57A 3G0CA 2V6IA 3N28A 3BS4A 2VH5R 5EPEA 1EIZA 2PWBA 5T4FA 3TOVA 4X20B 2R8EA 4KXMA 4TMXA 3RGWS 1OLXA 1CZOA 3EZ6A 3LUFA 4NMWA 3P5SA 1RWWA 1XXHA 3RS2A 3TLBA 3X3HA 3X1KA 3GLHE 1TEZA 4GPAA 5FH9A 1Q1GA 2ZULA 4J8PA 5DNYB 3KU4A 1CUHA 1SCUA 3MF4A 1ZK4A 5HZMA 2GETA 6Q21A 1U3WA 1H4QA 2Q8NA 4GMHA 4JR1A 3L77A 2R7KA 3WQHA 2WYRA 2DWPA 1Y42X 5ESWA 5JDIC 5JJIA 4BP1A 3D4IA 1T9HA 1A27A 2OL4A 1CULC 4MRPA 2CSUA 3UWPA 3THYA 1RYNA 1HUQA 4DS3A 3V3TA 3OE4A 3I5YA 5CK5A 5A04A 3HY4A 2O3TA 3PDUA 3V7NA 3QBDA 4EEKA 1TIPA 4U2KA 1PEAA 3G6WA 2I2CA 2MSLA 4JB2A 2X5XA 2OCDA 2IBSA 3BX1A 4J6FA 3JTEA 3T3PB 2ENUA 1IQPA 4MVJM 3WLJA 4B80A 1WCIB 3LPNA 2FMUA 4HDRB 4RVGA 4LN1A 4TXLA 2GA9A 1ONOA 4DREA 2JGDA 5L3SB 3IERA 1H9CA 3WNQA 3II6X 2OXCA 2YBEA 5DXAA 5EFZA 4RPBA 1NMQA 2FZ4A 1SJ9A 2VJPA 2CXRA 2VT3A 1EFKA 3HA5A 4MQ4A 3BTUA 5AJWA 1KEEA 4J90A 3TTYA 5GIPE 5DNDA 1JEJA 1YS6A 3H1GA 1CY6A 1X77A 1RQLA 3EH1A 3HABA 4EI2A 2WTUA 2QGFA 1XZ8A 3OLYA 3E9QA 2VF8A 4LQDA 1YQXA 3GD7A 3Q9LA 4JP5A 4PQRA 4OF4A 1YT5A 3R0VA 3H9NA 4H3KB 2OOKA 3PX2A 3EDCA 2JHPA 2GPSA 1TVKA 1ML3A 2AK3A 4YH1A 5JI3E 1YI2B 5F78A 5FO1A 1B1CA 1G2IA 2ZVQX 4BJ1A 4AAYA 5JADA 3T9EA 1WZ2A 1KVQA 1W93A 3DC7A 3K9LA 1XYVA 1L5NA 3SEQA 3A9VA 4JNKA 3QVGB 1EDEA 1IJKA 2X0DA 1UEJA 1HLFA 2R96A 4BBAA 4IX9A 4F2PA 2JF0A 3G5TA 1YVEI 2I4TA 1Z18A 2V7WA 3Q6IA 4YUWA 2EDCA 1OA1A 1FNBA 2Q6KA 1RKVA 1DX4A 2FUCA 1KNXA 2XDWA 4WKGA 3SQNA 4CFSA 1Q9SA 1V47A 1NW6A 2BFNA 2GBIA 1WPGA 2WPDA 2CLDX 2DHDA 3A27A 3KKNA 3LIIA 3PUKA 4IDEA 5FI3A 4Z4TA 2VTBB 4GG1A 4EPVA 4Q16A 4XUEA 2BIFA 3VNQA 1F2TA 1MRZA 4B9AA 2B8EA 2PV0A 3K0HA 3R7AA 3DE6X 4CIDA 4DL9A 3KALA 1A4XA 2NZUG 1MT3A 4MGEA 3ZD9A 4KCGA 4W63A 4ZU3A 5JSZA 3CO5A 2A78A 1H23A 2QIPA 4FMPA 4S1TA 4L08A 3ON5A 1YS1X 2GOYA 4CQLA 3ZZTA 3VPAA 4MQEB 1RAFA 3IRVA 5I3CA 4UUNA 4Z4FA 1W49A 3UAOA 1P81A 2I5PO 3V1YA 5B1DA 1NOIA 2O3QA 2GDJA 3AETB 3DBVO 3PG5A 3H8WA 1H1DA 3NHRA 2VHJA 4IIHA 3UAZA 3WGMA 1II8B 4QM7A 3BSSA 3V5NA 3ZUGA 5MDHA 4RYDA 5EJ9A 2VRCD 5ALPA 1XL1A 4XSGA 5AKXA 1DZ3A 4H6VA 5DXJA 5EHIA 2FA9A 4MV1A 2A1TS 3E9NA 3N2KA 1E5VA 3W6UA 2XVAA 3IEVA 5FI5A 1T29A 3LZ6A 1KC1A 4JUFA 1XDSA 4FD3A 2JLWA 3KAJA 3O38A 1NUAA 1WD5A 3OM0A 4A8HA 2YN4A 2R8RA 1PZGA 5CB4F 5L95A 5EMNA 1XVTA 4CUZA 4ER7A 2Q28A 3DL4A 3NS7A 6NULA 2FW6A 3G0BA 2HF9A 4IXWA 4XLFA 1WOMA 2HQOA 3MJSA 4QGBA 1V1RB 2D62A 4AT1A 4LYYA 4MRMB 4OH7A 1XZGA 4ZICA 1YDWA 4MQLA 5FLKA 2QX6A 2SHKA 4REQA 5BR8B 1KAOA 1YGPA 2JJYA 4W5QA 2H17A 2P2ZA 5HCNA 1MD9A 1OREA 4F60A 3L4JA 3FTNA 4PC2A 2SICE 1HEIA 3D4NA 4HGQA 4F04A 2EBFX 5EXDA 4TWIA 2QP4A 4C04A 5I4BA 2QWXA 3C6BA 4WZAB 4PVDA 5LU8A 1T13A 3R5JA 1MABB 2GVNA 1II9A 3U62A 1NMZA 2RK4A 4B2IA 1FSGA 3I32A 4IXDA 2XVMA 4G8CA 3AOGA 4E15A 5J4HA 2C3OA 3ICQB 4MIYA 1DEXA 1Z45A 5ED0A 3KFXA 1P6QA 3PNMA 2A1TR 4IZIA 2BLLA 2W2VA 1E7SA 4US0R 1QRTA 3CCCA 3NH6A 3G9QA 1ZA1A 2PEZA 2ZBFA 3WGVA 1NYLA 1P60A 3AU9A 3LUBA 3NBUA 1FPMA 4UD2A 3BN3A 3G7UA 1GPKA 3MVEA 1L5HB 1X9HA 5HQJA 3B38A 3QMPA 4BDTA 1KK1A 5D1NA 1DEKA 4ZAVA 3UM9A 1K5HA 2O06A 2F8LA 3PNOA 5HPYB 3JYLA 3DBOB 3RSFA 1KZ7B 1SM4A 2I6TA 4J16A 4W1QA 4B5LA 4K9SA 4Z0PA 2ZJ0A 4B7UA 4EB3A 1OYVA 4L75A 1QVWA 3VDNB 3G0HA 3HPRA 3OWOA 2Q5EA 4HEQA 3M4JA 4PW0A 3ILYA 3G2OA 1TKAA 4XJTA 3AHGA 4UU1A 4C4SA 4CKXA 4QC2A 1J07A 1VPEA 2HEIA 4E94A 1NWCA 4NDNE 3UAVA 1XB2A 3EZ9A 4JI1B 3G5UA 1YONA 5BQFA 4BFTA 5BN5B 3GAZA 1QOZA 1UDXA 1NFFA 2Y67A 5HVNA 3E0QA 4D74A 1AV7A 1GQQA 1ZD5A 3ZI7A 1X1SA 2NO7A 2V7QA 2WWTA 4WD3A 4B09A 4MYUA 4FEAA 3B7PA 4O02B 4NICA 3ZHBA 1E92A 2EW1A 2WWRA 3HEBA 2V31A 4UCXA 4UEQA 4GZMA 4PGMA 5CT6A 2QSZA 3AGPA 4LDQA 1XTZA 1EFVA 2JAQA 4OHMA 1D2GA 5F35A 1M8KA 4J2OA 2LZ0A 3DBLB 3UC5A 4IO0A 5EZSA 3UJDA 1JIIA 4F5DA 5H4GA 5JJ5A 1SB8A 3CEMA 3D1JA 2RJOA 1Z5OA 5BR1A 3TLXA 1EJ2A 3GPCA 4R69A 3SN6A 3KX2A 3BHNA 3TIIA 4V2IA 5LUAA 1FB5A 1ES9A 2O4UX 2WWVD 4EKIA 2GCIA 4KTVE 1WHSB 3R5TA 1W44A 3OESA 3R9KA 1O5TA 1GU1A 3MJDA 1BPLA 4MCAA 7GPBA 2IHTA 3F97A 3ETHA 5B2FA 3VVLA 5FFNA 3H9EO 2Y1KA 3AY3A 4CDNA 3QVMA 3U7QA 2QTHA 4FYVA 4RTSA 4EMUA 4OXXA 1NN5A 1JQEA 2BJHA 4Q3LA 1Q44A 1R0LA 2I66A 3L02A 2ZE8A 1HLPA 1SUSA 4IZOA 4JNCA 4R1NA 4XIIA 3V2UA 3VNBA 2O8NA 1U2TA 3T7TA 3UW1A 3IVCA 1XBTA 1D8TA 3MWFA 4HADA 1KAQA 5DP1A 4XD2A 3AZOA 3FDFA 3VNUA 4Z4RA 2CYAA 2YMLA 4UVEA 4TZ0A 1REQB 3WLSA 3U16A 1YJNB 1FSSA 3CF6R 2JFUA 2WUFA 4GVXA 3KPWA 5D3ZA 2XNSA 1XXLA 1XVIA 3QPBA 3GB9A 4P5EA 2JZCA 3PIRA 1JEDA 3W3ZB 3RTCA 4DHEA 4CT4B 2W2KA 3GPIA 1U3FA 1DJPA 4MAFA 2CHGA 4YRBA 6ADHA 2IIBA 4B6PA 2VNHA 1UDRA 3ZR4B 2OM2A 2VUSA 4G56A 1G21E 1FPQA 4ZOAA 2WG2A 3UWMA 4FYJA 2NUTB 4EB0A 3R3ZA 1IXKA 1YQUA 3CESA 1MIOB 4KMMA 4E07A 2NYVA 1QSGA 2O05A 1RRKA 2I55A 1ZIYA 5DBEX 5LUBA 4KMSA 2QGGA 1MO2A 5F1OA 4D5GA 3QLUA 3V80A 1W2GA 3CCQB 1GFWA 2WWWA 4M1OA 2I3BA 3R3HA 4FHDA 2ZCJA 5LJIA 3ASTA 3ESQA 1EG2A 3E82A 3KJIA 4YMLA 3KTDA 4H1HA 2GJ4A 3OLQA 3I83A 2A5YB 1ONSA 4HUQB 3DTYA 4Y2TA 3VR4D 3IMFA 5BQXA 4O1MA 2P2YA 1Q2UA 1JAHA 1JWBB 1EZ4A 4P0QB 1DO8A 2ES4A 1NXOA 4EQZA 3DHNA 1YJQA 5CA0F 4GT1A 4PNZA 3HA7A 3HKBA 5JAIA 1APBA 2O7QA 5JJCA 3ONNA 3IB3A 3R8CA 4BY9E 1KOJA 3BB1A 3MFYA 1CEYA 3CVJA 4BMPB 1S89A 3UB2A 4YAOA 1OZFA 4GMFA 2JFYA 2R6ZA 4N82A 2AG8A 4D3ZA 5KQSA 1ICEA 1W36C 4RCZA 3E05A 5IAJA 1YX2A 2O20A 1UADA 3ANSA 4G5QA 4F96A 4QTZA 3H2IA 4XN0A 4UNRA 2RCYA 1UFOA 2CYCA 2GZDA 3MCZA 1XWIA 2PUEA 5ESXA 1Q17A 1R6BX 2VZ8A 1WPRA 3TZ6A 3KYCB 2XLBA 3HVKA 3ONUA 2R1VB 4JMPA 3EJWA 4MUXA 2V0NA 4OYRA 2YW2A 4J94A 2W4MA 3I1YA 1IONA 4UVDA 2A9OA 5BRNA 1ZJYA 1WF6A 1P17A 3A1DA 3U7IA 2NO1A 2WAYA 3FOBA 9MHTA 3IIKA 2ZUSA 4EECA 2D13A 1T5EA 2BM0A 1I13A 1LH0A 2OECA 2UVPA 2F17A 2GZ3A 3OJ0A 4XMYA 4V0RA 3QLJA 1EFUA 3JD4A 4B83A 1OAOA 1PJ5A 1RACA 2BGUA 3KD2A 1JDSA 3A1TA 2A0UA 1XR3A 1JYSA 1I14A 5FX2A 2XUZA 3OC6A 2LR0A 5TQ0A 4OGFA 2G6BA 1NN3A 1N8SA 3UUFA 4AX4A 2C7OA 1CY8A 1WX1A 1UC8A 3VOAA 4UUPA 3HB9A 4M3NA 1VGVA 1BDBA 1FF9A 4HJRA 4FSXA 3FNGA 1E1QA 3A7EA 3MJTA 4QTYA 1TE2A 1SFRA 2Y92A 1Q0UA 4LKOA 2PRZA 4UPDA 5FPPA 4WLFA 1F6BA 4Y2PA 5TPWB 1VGRA 2QM3A 2Q6LA 2OV3A 3QWAA 4LY0A 4JI3B 4OLHA 4BE9A 1JS1X 2AEEA 1T8UA 2JJ2A 2DE0X 3GAFA 1QANA 3HYRA 2QRPA 3ZJVA 4RK0A 4LY3A 3IT1A 1DJMA 2UZ1A 4L0QA 1QHXA 2VDOB 3LRPA 5AKJA 4R84A 5E0OA 3PPVA 3VR5A 4LF9B 2ZR0A 2B4QA 4D3SA 4D6XA 1SBCA 1G6Q1 4ZQIA 1T2EA 5TF0A 3ZG6A 4FP9A 2XMQA 4GSKA 1TJPB 3I1FA 2ZANA 2ZZKA 4MRRA 5GV8A 2YY7A 3B3QA 5GVRA 2FOXA 5ETJA 1Q0PA 1C8VB 1JXQA 4TGLA 3IQXA 3T4EA 5LXTA 4N48A 3QUCA 2JGIA 3NLLA 5A03A 2WU3A 2FEPA 1PS9A 4YCDA 4MAMA 4BJHB 2WU8A 2DKOA 1K5GA 4EPTA 1EDDA 1PT6A 4KXVA 4LOJA 5BT8A 2OZPA 2IBMA 4KZKA 1IAVA 3W8NA 1UODA 2Q1YA 1EWRA 2HFKA 4F97A 1YZTA 3PTZA 3D2LA 4RSGA 3GFRA 4EPYA 3TOCA 1XTUA 3GJ7A 3TMAA 1CR4A 1U4SA 3HBLA 4WZTA 2CE7A 2BMDA 1Y1PA 2XB4A 3JQAD 3CT6A 4JAVC 5FOUA 3HDJA 3VX3A 3W8DA 3JQBC 4RJIA 4XQCA 2GPYA 3BGDA 1L8XA 5DSZA 4LRYA 5GZ3A 4QXRA 4MDFA 2BFFA 5CDFA 2EU8A 3O4VA 2FMTA 3I6QA 1HC7A 1ZNZA 4ME6A 1ISFA 2CB9A 3LVFO 2RI1A 4Q39A 1GKKA 5ADWA 5B7QA 1KFEB 3WJ7A 2DUWA 2WJAA 4TWRA 3QELA 3OI7A 3T6KA 4EYGA 3DLTA 3UK6A 5ICMA 1E1CB 2OC9A 3VHLB 3USES 1RYEA 2OBYA 4MJLA 2A88A 4OK5A 3R24A 4NCHA 2Q2QA 2VHXA 1K75A 2DFKB 2JNWA 3JASA 1S7GA 5BO5A 5G53C 4KDEA 3RABA 4YT4A 4LYEA 3QYJA 1RS0A 3HR4A 3HGQA 4U7PB 3DTTA 4BQIA 4ZRDA 2XUHA 1Z8HA 3BDVA 2W7TA 2Q07A 3M9LA 1DAFA 2ZYGA 3BXZA 4IZHA 4G5GA 3HJFA 3AL2A 4C0KA 1MB3A 4HDSA 1XT6A 2FGJA 3FWKA 4GWLA 4Q12A 4ZVPA 2EX0A 4Z51A 1BDIA 3N8IA 4NOMA 5AMXA 1YACA 2C83A 3KWJA 4J7XA 4X84A 4RKFA 1OX5A 4ZXFA 3DDHA 3R76A 3ZBQA 3RS3A 2VQ6A 2XUJA 4IKPA 3VYVA 1U0SY 3DKPA 1WUHS 2FWRA 4X07A 1ZEJA 4D57A 3OQJA 5CRIA 1P9OA 3DOOA 1I4DD 5DN9A 4KB5A 4TTRA 3QMWA 4XAQA 3EGVA 3OPNA 3O2JA 1ZKDA 1NRJB 4GW3A 5KKCA 2HWXA 1ZMRA 3ENQA 1DKRA 3GT4A 4PFSA 4A0GA 4B33A 3JQ8A 3MCTA 2YZGA 1E5XA 1KJYA 4JLPA 1WHTA 1HYHA 1KQ3A 2PT9A 5TMEA 3E1GA 4XCVA 1U3UA 5JXWA 4NZOA 2XTAA 3Q0TA 1DXQA 5D84A 2BJVA 3DLCA 4FCWA 4N5IX 4UXJA 4AUEA 2F64A 2GBFA 2QUJA 1DOAA 4Y6PA 4ZHSA 2HQ1A 3WZLA 2NVOA 3H1PA 2D1QA 3W6PA 3PC7A 1EA7A 4E31A 1OT3A 1U0FA 3N7AA 2D9RA 2HSEA 2PBZA 3P9RA 1QJCA 1VMKA 2X5NA 1UJNA 2ACVA 3H4VA 5CH5A 4BNJA 4F8EA 1E3MA 2YVLA 3A2NA 1SC3A 3DNMA 4I4NA 5K99A 3TUZC 5AR1A 2J7KA 3OD5A 1L2TA 3NG1A 1M76A 4L4RA 2AHRA 3TUJC 3CPSA 4JXZA 1VJGA 4GC9A 5AXBA 4V0QA 1XNQB 2H48A 1PQUA 1Y8QB 2OCBA 1XZIA 2N9UA 2MT9A 3MGBA 3RRYA 4JX9A 3GZJA 4WXHA 2Q8PA 1NLUA 2ZR8A 4MH0R 5AI5A 3DT6A 2A0KA 3V1LA 1OHHD 2NXNA 1R0YA 1MO3A 4U6NA 3RFCA 4MYTA 2NSYA 1RHKA 2AWNA 4YJKA 1LS1A 3OLCX 5DDIP 2MIIA 3CUTA 4ENPA 3LQFA 4QICA 1UD2A 2ZSKA 1ECCA 3AGQA 4Y1EA 1GR1A 4JZKA 3RBAA 1JIJA 3C43A 2EZ9A 1YJXA 3OZRA 2UYHA 1EG7A 4WLNA 2X0JA 4ECAA 5LFAA 2WZPP 1HDXA 1NJ8A 2AOTB 1JJAA 2IYVA 3BWXA 3C45A 3DC2A 3ODGA 1ZEMA 3BM5A 4MWEA 4BAGA 4YT5A 3E7PA 1QTIA 2CVFA 4B4WA 3C3BA 2WBLC 2M32A 4KQ9A 4NVRA 2AX3A 3OEED 4U6QA 4YCJA 1AKUA 1SUAA 4WEOA 5EIHA 3G2QA 1DXOA 3PPYA 2PIAA 1EEXB 1CY0A 4FDLA 2ECFA 3HEAA 1N8TA 2ZDQA 2CK3A 1MV8A 3A35A 4KQXA 4RACA 5DGCA 1F8GA 3RT1A 1T2UA 2K6GA 4EJSA 4HB3A 4P83A 5COQA 3NGLA 2A0WA 1W4ZA 4KKXB 4OU5A 3ZY3A 4C3OB 4EHBA 4F6CA 3R9XA 5GJBA 1IYZA 2A33A 5WRFA 3CQ9A 5GOTA 5JT1A 4G65A 4O2BA 4DDUA 1PV2A 5JRJA 1TU0A 1MC5A 2VH2A 3B52X 3D8HA 1NF8A 1E2UA 1UWCA 2OBNA 1QPZA 3OZFA 3RSZA 2QE7A 4EA7A 4LOHA 4QODA 1Q20A 1V16B 5I9TA 2G8LA 4OSEA 4E3WA 2CKDA 3VOSA 5H16A 1L4FA 2O2GA 5LQUA 3OPQA 4CNQA 1EX9A 2P6UA 1OF1A 1P9NA 2P7IA 2IODA 1NXWA 2PZFA 4TLBA 5FB3A 5AXAA 5C1PA 3ELWA 3KHKA 4RZ3A 4BKRA 4ARAA 3C2QA 1ZIDA 1KBOA 2XDAA 3VTZA 3LA8A 1O96B 3PC8A 3TXXA 4A16A 3CW8X 4KIWA 4ZVTA 2J3QA 3B7WA 3UNXA 1W30A 5IBRA 4DXDA 4NS4A 3MD9A 2PQ0A 4GI7A 4XM0A 4YLEA 4QHTA 5TPZD 2OHVA 2VSYA 1CUYA 1U0LA 2Q0QA 3IVAA 3HSSA 2QXUA 3F67A 4E1BA 1YFJA 3WR5A 1QB8A 1Q91A 3FMPB 3Q8KA 1S2GA 2ZRKA 1WXEA 1EYZA 2G72A 1QIEA 3OOYA 3VO8A 5I7VA 3B1JA 2GPBA 3GO4A 2FPGB 4FFSA 1PYGA 2Z8YA 1OFUX 4B4OA 3L07A 1NNLA 3C48A 2JBHA 2PUHA 2J3HA 4M0FA 4FLFA 3TR0A 5IF3A 1Z0IA 4XQ0A 1JR6A 2OV6A 1CFJA 4LTNA 3T0IA 2JLYA 2V7UA 2HHLA 2IXGA 2WJJA 1OV4A 4LRQA 4RKWA 4X8OA 4F9TA 1L1FA 3K73O 4N5LA 1VIVA 2EFDB 2HZBA 2XMBA 3T94A 1DLJA 1L6RA 2ZWMA 3BYZA 4Q37A 1J0EA 4WKNA 1OBCA 3MCAA 3NYQA 3O75A 2COUA 1G8FA 4RGBA 2O3SA 4RS3A 2RIPA 5KHOC 3BK2A 4K6GA 1KRWA 3L6DA 4RH3A 5JYBA 3RF7A 1MDFA 2QJRA 3G17A 3G7SA 2I62A 2QTVA 3EIHA 1G38A 3NHAA 4XWYA 1E8MA 4GUAA 3C3PA 5FYDA 2Q1UA 4TKMA 5LXTF 4Z2AA 1RQNA 5DCWA 2UYQA 5JXIA 2I9KA 2NO0A 1E2LA 3C3WA 1LPPA 1J99A 3F49S 3KIPA 1T8SA 2XCLA 4JGIA 1UQTA 4ND6A 3ZIDA 1IZ8A 3RVPA 1E7MA 4U7DA 5D3MB 3SQOA 2QPLA 2VL7A 3S2FA 5AO9A 4X66B 2II6A 4M9RA 4FDAA 2X7HA 10MHA 4BTEA 4HQFA 4JYBA 3DMDA 1EP3B 3ED1A 2FCAA 1H1LB 2HLNA 1MJFA 4YMGA 2OK7A 1GAWA 2X8AA 1JEQA 3GRKA 2Z6QA 5B6JA 2D5AA 2PYZA 2PAFA 3B89A 3G2IA 2E1BA 4CMEC 1NN0A 5A4MS 2V65A 1EUCB 1H8HA 1VCOA 3FPKA 1Z4LA 2J1LA 1OI2A 4R81A 3SZLA 4ZIRA 2VBIA 1I2BA 3JU4A 5KREA 3WY9A 4H7PA 4UEWA 4WMLA 4XVRA 4HC4A 3HB0A 4F4UA 1YZYA 1ZINA 3QH4A 1KYQA 3LP5A 3QUSA 4BVHA 5DHAA 1PWEA 1TVEA 3EMDA 3OFND 1L5MA 4FHZA 1ZH6A 2RGNC 1WUIS 3FX2A 1A7UA 3ICWA 5DIFA 4BNIA 4TVKA 5CX1A 4LJ5A 4P81A 1IN5A 3FW1A 1HMPA 1Y0RA 1QIGA 1ZHHA 3N05A 2G04A 2OMEA 5ES4B 2IYRA 4ZODA 2GI4A 5ADVA 1J1UA 4E4TA 4DCTA 2DY0A 1QYWA 3F7OA 3SYMA 1A69A 3KHSA 3S1AA 5JWOA 5F21A 2Q3BA 1J8DA 1NQ5A 2GCGA 3LHIA 4KX5A 4CKBA 2PUWA 1D2RA 3GDFA 4LXGA 3FGOA 1ULTA 3EVNA 4C06A 2WSBA 3W5BA 1W36B 1RIIA 4R4JA 1A04A 4NCKA 1KI7A 1N8NA 1RD4A 3FTPA 5ICFA 1Q16A 1GYRA 1N7JA 3DBRB 2J0VA 4GSYA 1PGJA 4GBGA 4V1CB 2EBWA 2IHNA 2ORYA 4D44A 3ND9A 3UAGA 1QC5A 1UDBA 2VTVA 1CDEA 4OLFA 1GTVA 4ZREA 4TL9A 1D2EA 3TOXA 2GCNA 5DWQA 1U3VA 2ISQA 4O59O 5FV7A 5KUTA 4G1BA 1FBNA 4IGIA 2DFLA 3EF3A 2ACWA 4DCUA 1ATZA 5EWLA 3H2ZA 1B6SA 2JFZA 3VXKA 1YGYA 3DT9A 1AUOA 4D43A 4W9MC 1G9TA 1CC1S 5TLSA 3CC7B 1NRIA 2FPWA 3QX7A 4V1CI 3DEIA 3O1HB 1SKYB 2O1WA 2VT6A 3D6MA 3SJ7A 4ETMA 1PF7E 3Q1KA 4LZPA 4DLAA 3W3AA 2WF9A 1XQWA 2PLAA 3AY7A 3DOHA 4RD3A 3W8RA 2ZL6A 4YIKA 1NVBA 2PZEA 1RJDA 2YC2C 3A26A 4YCCA 1C1XA 2DWCA 2AN1A 3P9XA 1U0TA 1AK1A 1WE2A 3JVVA 3W9YA 3ACDA 5FR2A 3R3WA 4G0PA 3FCOA 3BL6A 1H2RS 2Z1MA 2PH5A 3OCJA 2G08A 5EEGA 2OZKA 4HVTA 1HZEA 4D0RA 1A5ZA 2P4HX 3L1VA 1DIBA 2JJ1A 2AN4A 2AFIB 3EHEA 2B82A 2HXYA 4M8SA 1KXJA 4BVJA 4YMVA 5BN1A 3GLIB 4EUNA 1GGEA 5IC4A 4BMSA 2ZAGA 3PK0A 3F7NA 5LLSA 1G3IA 3TEJA 5FA8A 3F5SA 3O4HA 4FC7A 2ZRIA 4YMSA 2ZB2A 1BFDA 3RNOA 1AXGA 3HDVA 3GEBA 2QTMA 5IW8A 2IL1A 2JA1A 3MTDA 2QGZA 3NRJA 4LDPA 1T6YA 2IZ6A 2M6RA 3ZWVA 4DC1A 4QVJA 4Z9BA 4XM2A 4PLVA 4R5HA 1CD5A 1A76A 1CUZA 4X7BA 1NBHA 2AS0A 3WYEA 4CU5A 1GTRA 4I5DA 3DFZA 1YCFA 3EULA 3BZWA 5BUQA 4Y6QA 1BXGA 2B0JA 4DM7A 4LTDA 1NQTA 4G0OA 3DM9B 2GPAA 2Q4DA 2PFSA 5GIOE 3VPXA 2XTMA 4CQMB 1DKPA 4NBNA 3CG0A 1UPAA 2YOFA 5CFOA 3WGLA 2JLRA 4IQ0A 2A9QA 3RKUA 1Q1AA 2QP9X 2X8WA 4G1VA 1A0OA 2HF2A 4YHHB 1FYDA 1VL6A 2K5UA 2PCJA 2CUZA 3C1UA 4LDAA 4X1KB 1BD3A 3H97A 3KCQA 1VG1A 5CCEA 1CF9A 5H83A 1CFZA 2QRVA 3ZV6A 1SBZA 4HPXB 3G71B 5EKSA 1I1HA 1S01A 4IDBA 3QOXA 4N8SA 4AO7A 1AZWA 4K26A 1NZFA 1HG0A 1U31A 4WLEA 2FAXA 1JKJA 3HB7A 1SIUA 4EJ6A 3T38A 4E2ZA 3VJRA 4PX2A 2OYRA 2I7DA 3OT1B 1J06A 1D2AA 1P33A 3A9SA 4J4HA 5COAA 3ZZNA 5J1TB 3KETA 1ZL0A 1CS4C 3HK2A 1O89A 1ZOSA 4LY9A 5CHYA 1OB5A 4PPQA 2E1PA 4MKIA 4XARA 4IQ4A 4OQ4A 4M53A 2W93A 3K9QO 1X9GA 3KOWA 5H9WA 4O2BF 3HS3A 1DQRA 2VUHB 2HA5A 2OCXA 4PG6A 4D8VA 2IS6A 2RH8A 2VEOA 1Q86D 2GNPA 2JC3A 4IQFA 3T35A 2EZ4A 1GZ5A 4L5YA 1KKUA 4JB3A 4W9NA 5EKDA 3ZGLA 2JDID 3W6NA 4EKNB 4WBNF 4Z54A 1XZMA 2FPPB 3DDZX 2FFHA 1HDRA 2Z83A 5T64A 3W9SA 1C0PA 2BMEA 2HMUA 1QV7A 1YIJB 4YAFA 4B6SA 2DLNA 2NU9A 3P9YA 2WNSA 1N2CB 1LTHR 1KXZA 1YDHA 3EVAA 4FDVA 4XYLA 1BMQA 1CY2A 1KSJA 3UCFA 4KRGA 2PZKA 3SE0A 4TKVA 1FVFA 4ES6A 5IJ9A 4P2NA 3HL0A 2PSDA 2GAJA 4I3GA 3EQ6A 2IU6A 4INOA 3D3JA 3ORHA 4A91A 4C3ZA 1A96A 1Z5VA 4XOTA 2QMOA 3KVRA 5F2KA 1H66A 4E0FA 4TT3A 1C3XA 5C80A 2OSVA 1NP3A 1KSGA 4ND5A 3ZK7A 3PFFA 2FVGA 3B60A 1KMHB 2D59A 5ICGA 5IAOA 2J6BA 1CJTC 2XOXA 3PIIA 5I4IA 1JJ7A 5GONA 2V54A 4G0YA 4BWVA 4DEXA 1J33A 2PRSA 1R64A 1MW9X 1C5KA 5C5CA 3WAJA 3ROZA 4F2DA 1P2UA 4Q1AA 1RKBA 3Q6QA 2HWWA 2OB1A 1YOVA 2ODPA 4P38A 5JSYA 5JXHA 4OI2A 1RAHA 4X45A 3TDNA 2RKBA 3C8ZA 5F5LA 3ZGNA 3IAS1 2EKPA 2HBQA 1A5SB 3MUNA 4TKUB 1DC6A 5CBPB 1RVDA 1BXKA 2BI8A 1QGZA 1Q3KA 2XT0A 5FLEX 4BO2A 1RKUA 3UJAA 2VYFA 2B83A 3TSWA 1XZLA 5JDCA 2BZ1A 2G06A 4M83A 4BTLA 3HB5X 1E6EA 1S2MA 3VNRA 4D4GA 4ED9A 2B8NA 1JV2B 4D96A 1CQIB 1AKTA 1DE0A 1LX7A 1TEXA 3RNLA 4J29A 2RHJA 3WK6A 4Z9AA 2I2WA 4I99A 3QVKA 5FBKA 4UHJA 3BE4A 3VUEA 3GRYA 4QX6A 5AVOA 3ASQA 1Y3FE 2QN2A 1AMUA 1B74A 3O4GA 4N54A 4JUIA 2OBFA 2CVQA 3CZ4A 3SSMA 1MHTA 2V1UA 3KM0A 4XGNA 1YF3A 2OZEA 3BMCB 3V1TC 3T3MB 5IARA 2M1ZA 5JS7A 1USKA 2R1TB 3UKJA 3FOCA 2PJZA 3L6UA 2XMCA 5KYGA 2GREA 5J2TA 1N4DA 2HU7A 3DEHA 3K0BA 1SPBS 2B3DA 1JQBA 2VP2A 5AJUA 3VSAA 5KHLB 4L9WA 4RE5A 1F9EA 4N1AA 4NBKA 2C2GA 3B7GA 3KZNA 4J1QA 3VRHA 2BR5A 5C4MA 2OFOA 2ACEA 3LCJA 1P72A 2Q7XA 3FRJA 3FVWA 1YJ5A 1X1QA 3D64A 5A89A 4ZOEA 3KUXA 1AKVA 4K9PA 2KSQA 2C7VA 2J3EA 2VNSA 2FF7A 3CY6A 3GJTA 1WNTA 3NWOA 3PXBA 3TMYA 4BNZA 2P35A 5BXQC 3S8EA 4XLCA 2CMFA 1BOFA 1TZ2A 1GPJA 2W8BB 3FTCA 3LW8A 1VDZA 2D5BA 4H27A 4BWYA 4Z7OB 2NP7A 3M4YA 1ZAKA 4U2GA 4JL5A 1X0XA 3BCHA 4HGYA 4MHSA 4NP6A 4EPWA 3AL0C 5BN3A 1BAPA 1O6GA 2WHQA 1R0KA 2UUPA 3EG9A 1SUDA 3I55B 2JLZA 1P3DA 2QN8A 3QBEA 1YK1A 4OSOA 4DSAA 5D7NA 1JNYA 1MHPA 5AKYA 2R8BA 4JJFA 5T41A 5IFKA 5JYCA 1GDHA 2C54A 2GN4A 5LP1A 1U2DA 4PNHA 3H9CA 4S1VA 3A3GA 5JNTA 1K68A 4BFLA 2OWDA 4LV5B 4HH0A 4AM8A 5B5SA 4UHDA 5IABA 1F2UA 1HGXA 1GUFA 3NOVA 3HJRA 3SJZA 4E5NA 2EP5A 4OTZA 3OFKA 4ICIA 3ZJTA 3PGLA 4HHEA 5AM2A 3ZK8A 1EVJA 4E12A 1ZVVA 3ELDA 1N6PA 3A0RB 3P7MA 4X95A 3ZPXA 3UOWA 1T4GA 3V6MA 1AA9A 1XQVA 2CVHA 2Q8QA 3B1XA 2XZOA 1W76A 1E4VA 3S81A 7ADHA 5EZQA 4QQKA 1Z22A 5C37A 3D6HA 2X6YA 3U49A 1UOEA 3U9LA 2O5VA 3FI9A 3HY3A 4GOND 3C15C 3ET4A 4O3FA 4RU1A 3BGOS 2E2WA 1B0AA 2G5GX 1HZZA 4CV1A 2FSGA 1Q74A 3E9YA 3FPEA 1CHNA 3AI1A 2BFEA 3D7RA 3M34A 2R65A 4RUKA 5ANRB 2YZ2A 2P9CA 2CLIB 3PR3A 1SZJG 1G5QA 3VZDA 4BNGA 1PDVA 4RFSB 2VWGA 5IZCA 2CNKA 4JMLA 5IAKA 1RWQA 4PLHA 2GWRA 5TV2A 1JU9A 3KWLA 4IMRA 4K0RA 4FILA 5I6DA 1DWQA 1NVWQ 3ZWOA 4NX2A 2GZHA 2C8LA 2GSDA 5FBWB 2GF0A 4IQ8A 4YAJA 4B8YA 2H52A 3EVCA 1VJ5A 1W1WA 1Q82D 1BW9B 4UFPA 4XX1A 4YV0A 1E3DA 4CL8A 3NHFA 3G1UA 3DKRA 2BZSA 3BQMB 2EWMA 4KNVA 2D74A 1V3VA 3PQ3A 2XYVA 3WJ2A 1DFGA 5IXYA 1LCIA 2DQYA 3WK4A 3RB8A 3V7FA 1P2FA 4MUHA 1UWVA 1JA0A 4I36A 3RTAA 4EUHA 1GTSA 3MM4A 2PEYA 3BTOA 5DBGA 5JS1A 4V39A 1QCYA 2R6CA 5CFRA 3C4QA 2UXBB 4HNSA 2JI6A 3GLSA 3MERA 3ZHCA 4DY6A 1MOZA 2H8GA 3OH8A 2HOQA 2JEOA 3CM0A 4YEJA 2C8JA 4FD2A 4XKJA 4ZQEA 4W7SA 1K5PA 1GPWB 3QWFA 1C7QA 1FX0B 4OFXA 5FNVB 1PFVA 3ZXUB 4C3UA 1E2GA 1FZTA 2Q9BA 2GBPA 1Z62A 2B8TA 3PLNA 4X20A 1M6VB 3GV0A 1M2VA 3KD3A 3FKJA 3BT7A 1DBWA 1RMQA 4FQ5A 4ZYTA 1FFCA 3H5IA 4I8DA 4YJ2B 3U9SA 4Q7QA 2PBFA 1RFLA 3KK0A 4ZTZB 2PKWA 4BVBA 3NOQA 1FLDA 1D4FA 4OBXA 1DIGA 2EJUA 2FK8A 3HL4A 2FRVA 1FEZA 4QT4A 2XADA 3AF1A 2WOOA 4LEIA 4A9AA 5IEJA 4IHQA 3EXEA 4M0DA 5CJPA 3VH1A 1U0NA 4IDPA 1KRXA 4CM4A 3KB2A 4KQ2A 3HZOA 2H1CA 4MTCA 2QN9A 3PXCX 3VU3A 1Z5NA 4U7WA 2QW1A 4PFQA 4HAYA 2H7XA 1RC1A 3QJGA 4IR7A 3LUCA 3JQDA 4WWVA 3MGGA 4HFNA 4CV3A 2I99A 4JJEA 5KIAA 3RHSA 3AJDA 3WP0A 3PJDA 4TYYA 4I4LA 4F3KA 4QGSA 1VQ1A 1UKAA 1CEXA 3AUFA 4HG2A 4HNVA 1QU2A 1JMVA 4GEKA 4D4HA 3QUQA 4C21A 1QRRA 4HDRA 3FNRA 5DSTA 1LS6A 4MVXA 1X7WA 4Y2RA 2ZSAA 3VR0A 1PL0A 3BICA 3KUKA 3HLYA 1ZXXA 1V3TA 4JGBA 2WU4A 1ZR4A 2A4KA 3TG2A 1E4EB 3GHYA 4N0MA 5EMMA 3K9NA 3QUTA 3JAKB 4ER3A 3A3BA 2Y1EA 2XKBA 3QYAA 5HMMA 4URWR 1R88A 1W5EA 5KJEA 3M7IA 4OMDA 1E0AA 4OHRA 2VIIA 3G2KA 1E3XA 4D98A 3NEPX 1YOBA 2GVZC 3NHUA 1QHSA 2FQWA 3R3UA 4DMHA 4F3RA 3MAAC 2VHTA 5JROA 4WOPA 3F5FA 2ZTVA 4YC7A 1DTWB 3FSGD 3AUKA 3NOXA 2PPVA 5JC1A 4X7DA 4MAAA 2VG8A 4KRXA 1NUQA 2JAOA 1NXVA 1Y3DE 5LKRA 3C85A 4E2YA 1IZ9A 4C0LA 3QVGA 3FFAA 3L1IA 3E9ZA 3ZE9A 4LQLA 4WA7A 3DG9A 3UO8B 5GONF 3WLAA 1XPRA 5F1KA 1YQWA 1G60A 4MIEA 5CYOA 4LSGA 1ZCFA 3TDMA 1FE8A 2CBZA 4PCVA 3X2FA 2Z0MA 3FCXA 1TMOA 1GPBA 3F47A 4ARIA 5CM9C 2P4EA 4M21A 3E9DA 2C5EA 4EJ2A 2VP3A 4U02A 3PQFA 3OIWA 1JLMA 1OTHA 1XKLA 3AFIA 5AW7A 5KO2A 3CCLB 2HB6A 3C16C 1JG6A 2HJSA 4IDGA 1KR2A 4XWTA 2UYCA 3NR2A 1HNWB 3E5HA 1PVDA 2CHQA 1QWOA 4MEJA 4PYMA 2QT0A 5KVQA 1VG9B 3WKDA 4JYCA 1GG9A 2E21A 3THRA 3ZZ1A 4DZZA 2HU5A 3GAMA 2WWYA 4J1SA 4P0TA 3UKOA 2VO1A 2AN9A 1SB9A 2ZI4A 3EJ6A 2XJ4A 3QPWA 3JQEA 4V0MA 3TKYA 4NSNA 5JWRA 1II8A 2MMCA 3GDHA 3B2QA 5GGYA 4R8RA 5LA6B 4MVJA 3I8OA 1IEQA 1PFQA 2AOWA 3TW8B 4N0EA 1NBEA 2L18A 5J5VA 2DWUA 4BC0A 1UPFA 2YJTD 1ZISA 2GTPA 3FBWA 1SOVA 2W6ID 5T8KA 4MUMA 2ZRFA 3EFBA 4ZI5A 1MX5A 1SUCA 5J2TF 2AG5A 1NW7A 1P61B 5EJAA 1WOSA 4XM1A 4P4NA 2JGKA 2ATVA 4KLAA 4FYKA 2JVIA 1I6LA 2VKTA 3JS5A 1DBIA 4RVHA 2Q6TA 1ACJA 221PA 4KR9A 4B4KA 3G0OA 4MQ5A 3SYTA 4NNOA 1N25A 2BCJQ 1LVGA 2BFBA 2PBLA 5KTSA 2F1HA 2VDNB 3FLEA 3H2KA 2EEPA 1N6RA 1RKQA 2K2WA 4Q4AB 4HNAA 5CP8A 2IYNA 2V58A 1P5ZB 4LYJA 4NPCA 4X93A 4DCSA 3TZKA 3EGIA 4QKQA 2OOSA 4KKVA 1BE1A 1Q92A 1V7PC 3H4IA 2VZEA 3UFBA 1I7PA 1ZVMA 4WGGA 2JBWA 4WZAA 1UJCA 3ELUA 4DMMA 5K1ZA 3VSEA 5CLHA 3IV6A 3GP5A 2ID8A 3CR3C 4RKEA 4HATA 1N1GA 3B53X 2ZJYA 1I5EA 1QX3A 1SOUA 3WO0A 2FJ0A 4EAQA 4TYWA 4DWVA 1WU8A 1DPGA 3HZRA 1S3GA 4D1YA 4F2WA 1Z6QA 2FSHA 4DWWA 1EX6A 4TSFD 1XKTA 3HVJA 4LQCA 4LNUB 3A1UA 4QYMA 1HTWA 1D8AA 2JGRA 4J03A 1KYVA 1LPOA 5A3VA 5KJFA 5MGBA 3GFGA 1ZGHA 2D3NA 2CMDA 2H1FA 5EN4A 2J6CA 4EEZA 1JG3A 1UDCA 2VT2A 3AR2A 2X9GA 2WWGA 4Q82A 5G3YA 3TQQA 1KGDA 1IWBB 1PI3A 4C6HA 3QP9A 2ZATA 1EE1A 4X8HA 3E1SA 3OJCA 3EGXB 1EBFA 2NW6A 4NRDA 4QPNA 4WSOA 4ZAXA 4DJTA 4DR7B 1CB7A 1H0HA 3BD9A 1KMQA 3CLRC 3RLIA 1I3KA 4KXFB 2O2SA 4EBBA 1M2GA 4ERNA 4J0IA 4XM3A 5B2ZA 1GCAA 2FEMA 4TN5A 3VVMA 4IPTA 3UHFA 1IVNA 3QQPA 3HXQA 4DK0A 4W7HA 2DOGA 1PEYA 2P6MA 5DK6A 4A0RA 1WS6A 1OGYA 1B76A 2NVWA 2V9PA 4F7DA 4IUCS 4F9FA 4OI1A 3PUXA 4UUAA 5F3RA 2FYTA 4OKSA 3CEAA 4XX0A 5CDSA 1B16A 2GQ0A 1JMYA 3KQNA 3HKEB 2CC2A 1OKKA 2ORWA 3ONWA 1R37A 1RCTE 2EF0A 2WV9A 1DEAA 4LNAA 1TPZA 2Q41A 5SICE 2CT8A 3AJRA 16PKA 1IPFA 2BY4A 5D01A 1A7JA 1AM4D 2FRDA 2FW7A 1T5HX 1JZQA 1QM5A 3UXEA 2HIAA 4BYGA 2VJBA 1UD8A 5AI0A 1EUDB 4PG4A 5JCOC 1FZQA 4G8BA 2CLSA 1WETA 3DBLA 4P54A 3D81A 3HP7A 2FE1A 4OYLA 4GZ6A 3MWKA 2C2BA 1QE3A 4WECA 4B3FX 4G6ZA 2CYBA 2C77A 2R7AA 4FOOA 3LOQA 5KOJA 4V03A 5DNWA 1A9QA 4I1IA 1O08A 5HKOA 3A6ZA 1MU0A 3HJNA 1J20A 1WOPA 4EW2A 2W8ZA 2VJJA 3T1TA 1FFBA 4FQ7A 5A5DA 4ZI2A 4QBGB 5T4BA 3MHTA 3DYBA 2O52A 2YCBA 3OQPA 3JR7A 1TOAA 3IAEA 2KX7A 3NALA 1CYEA 1WQ1R 4G5XA 5C0OE 3ICCA 2BN4A 1UAAA 4F6RB 2VQEB 1E6KA 1XXHE 1ZUIA 2AG0A 3FKSA 3I73A 1XVVA 2FHPA 1PWYE 2CFOA 2IKQA 5IN5A 4GOXA 1TZMA 3V97A 2Q1WA 2W2LD 4G07A 2R60A 4P9SA 2QUBA 5LQKA 3WGNA 5HUHA 4J3JA 3M6FA 3WYCA 3PX3A 4EG3A 3H3XA 3A2KA 2UYOA 2B7CA 3DWFA 1ISMA 3U4MA 3P19A 4RD1A 4JJ6A 3W5UA 1MC8A 1CJSA 3C4JA 3G1TA 3JQRA 4RZHA 4XR4A 2C82A 4MKHA 3D8UA 4UHEA 4LOLA 3HXOA 4KEAA 4GH5A 2WZDA 2IE0A 5BV7A 4KQCA 3SF8A 1E43A 3R3SA 3B5IA 1R2QA 2WSIA 1NVTA 3SIXA 1VQ7B 1T1JA 4AY2A 3MHPA 5T4HA 2OM6A 1W46A 3MMXA 1E9DA 4LJRA 2ZJ2A 3AR3A 4U6SA 4RDKA 5ESRA 1MIOA 2X5JO 2YDXA 3KL2A 5C5EA 2IH4A 3FSEA 2GAOA 1QHGA 3ZU4A 4ZYLA 3TZBA 4Q15A 1S9HA 2NUBA 1A71A 3DUFB 1SCJA 3DCYA 3UXHA 3TKLA 4BN4A 3U44A 1XG5A 3G6KA 3G0IA 1TM5E 4QBFA 2QD3A 3A8TA 3UVEA 3GCZA 1Q0ZA 2HHHB 3AR7A 1VHQA 1XDBA 4HNGA 1E66A 4E70A 1I7SB 3E81A 3LTNC 3O8NA 3TRKA 3JCZA 4OJMX 1L8AA 1Y7HA 4TROA 2FSSA 5FO0A 1Z2NX 1KL7A 3B2EA 1DRUA 3G59A 1EQAA 2JLSA 1Z28A 3LY5A 2B37A 4DQKA 1OBVA 1ZD9A 1EZZA 3LYUA 4BO8A 4JUCA 1ESDA 1D0SA 4DJ5X 4QASA 5K05A 1E69A 1SVWA 4Q9AA 3D6VA 1OBOA 2BUBA 1YRWA 2NPFA 1DX6A 3T99A 2QSJA 4JLBA 4W4TA 1AUQA 1WF3A 2HLHA 1QCCA 3SYLA 3PGXA 3WZMA 3E2MA 3EY9A 1DBVO 2PKQP 4R1MA 2CCGA 3MINA 3D8RA 4P7FA 1IMOA 4RY8A 5KYVA 1YQEA 3I6MA 4H1VA 4WK2B 4EMTA 5DI9A 4UULA 2D5IA 3SC4A 1GNPA 3FPCA 3DYIA 1X1BA 1Z4QA 2FCRA 2GPNA 4MINA 2YVAA 4H0FA 3DDOA 1VQ5B 1SKUA 2DIEA 1BE6A 2BKUA 1R5NA 3EQ7A 3KYCA 4Z8YA 4AIIA 4ZKDA 1GGFA 1X2EA 1Q11A 1CHDA 2ODEA 2VYND 1N5JA 4ETNA 2H65A 3LQKA 4WOJA 2J3MA 1RTTA 4DT1B 4W5RA 2YIVX 4MMXB 4U3JB 2JFXA 2EX4A 3NWEA 3VPSA 2VP4A 3OP4A 1AK2A 4YBRA 2NMVA 3GNLA 3DVQX 5JMPA 1BC5A 2AF3C 1GCIA 1ODIA 5JO9A 3QE2A 1JALA 1XDUA 2SCUA 4HDMB 4LE0A 3ZV7A 4KQJA 4EM6A 3GLGB 4XUGB 3G2NA 1TJ3A 3DM5A 5BSGA 1H93A 2AFHA 2J33A 2W00A 4IH9A 1NB0A 3GRCA 1WDLA 3SS7X 4LE2A 4CI9A 4ZCTA 3PQDA 1E3LA 4JLVA 3DHVA 4MVJF 5A8AA 3RBVA 3F71A 4NOKA 5LZ5A 4B79A 5C8YB 1CUFA 1ONPA 3SZOA 1PL8A 4F8YA 2QBYB 2VAXA 3SDBA 1IXYA 4BO1A 4Q9NA 2QPOA 2WJWA 3S2EA 1WPXA 2HLPA 1NDHA 1ZM9A 3GOHA 1PR6A 2A35A 3A4IA 3NHBA 1YS2X 3CURA 3PVCA 3IUSA 2J6HA 3QF4A 4M1TA 3RSSA 5HS4A 4RZXA 4CUJA 3QWBA 2YHIB 3DR3A 1FOEB 1G55A 1XA0A 3ZWQA 3O90A 4CIYA 3VR4A 1DAKA 4KFCA 2IF2A 3ZZ0A 3IPXA 4R8MA 3JWIA 2IYXA 4JI6B 1L4LA 1TK9A 3GUCA 5BW5A 2EW8A 3VX4A 2I4RA 4B7AA 3L0BA 4GLOA 1W2HA 2J48A 1LW7A 3HV2A 4JP1A 5C1OA 1NV8A 1QP0A 2QEXB 4HAOA 1CUXA 4D41A 3NP7A 5D3QA 3E7FA 1TL7C 1ZAYA 3WKAA 1F38A 2PCLA 1PW5A 2BELA 3LNCA 1FW8A 5JDIA 2R6GA 4AO8A 1ZM7A 4PG5A 1Y98A 1N92A 3STWA 3T56B 1IUPA 1QF9A 3V55A 3FI0A 1SC9A 4ZCSA 2D2FA 4CM1A 1UK7A 4KYUA 1RM5A 3Q11A 1CF2O 5AOAA 4LF6B 3H1TA 5JTUA 2ZPTX 3DE3X 3ZH9B 3QENA 1IBSA 2NU7B 3L8EA 3QLVC 3LD9A 4RK7A 2ERXA 2JAXA 3OQHA 2YMPA 2VZ0A 3KDAA 4JASB 5DGXA 3VZRA 1D4ZA 1KMMA 1P1JA 2PGIA 2WLTA 2OAGA 3KB6A 3JAMA 4ACBA 2JATA 5IT4A 1NA5A 1VL5A 3SCZA 4LC0A 2GJ8A 4R1SA 2Y1GA 2AZXA 5IASA 4CPDA 2WP8J 4FZJA 2VNJA 1JE1A 3KVOA 5AHKA 4NV0A 3OPOA 2XXAA 4J9VA 2MYTA 1FL9A 4QYWA 4E32A 1BCSB 1RQ7A 1B8NA 4TWAA 4DILA 3RDPA 5BOVA 5JAHA 4HQKA 4LFBB 1RAEA 4ZZ3A 1E1CA 4IWYA 1H3NA 2DUJA 2XDQA 2YWDA 4FNGA 3OBIA 3I9KA 2DJIA 1KHTA 2I0FA 2QM7A 2X8BA 3A3NA 3HZHA 1K9MD 1E7RA 2XUKA 3IJRA 4PAOA 2GB4A 3KT6A 3BA1A 4LHSA 3JZMA 4V0KA 3V7YA 6CHYA 1H2EA 1B42A 3S2UA 2O8DB 4LC1A 3QYFA 1QVRA 3K70C 2C58A 1CJCA 1NPDA 4G1MB 3RV4A 4GRDA 4G5FA 4NBRA 3PTAA 4BPRA 3QVVA 3PHGA 4OLJA 4MV7A 1NMXA 3DEAA 1E32A 3B1YA 4MWSA 1D03A 1Z39A 3TAUA 4CR6A 2WD7B 5K0LA 2JD2A 2OV4A 1QPBA 4MW9A 3DOJA 5BURA 1OI7A 2HWUA 2OKCA 1SNYA 3GWZA 2VEDA 3ICVA 2G1AA 3OX4A 1UWLA 4E6EA 1KBZA 1R3DA 1SH7A 2QT9A 3VBCA 4CEJB 4MWZA 1ZM2A 4DVJA 3WYDA 2WF8A 3R44A 4DQ0A 5A3RA 2FZVA 2VBCA 3ZDZB 5AM3A 3SI7A 2HM7A 3A9UA 4FFOA 5G0VA 2PMEA 4G4GA 1DIOB 4ZT3A 5KQLA 2E4YA 4IHKA 1SC4A 1ESNA 2VCEA 1AS2A 3PUZA 4UNQA 3H5WA 1DG9A 1WVGA 1T5OA 2VT7A 5DGHA 3NTRA 3ZOZA 4LOIA 5TT1A 2QVBA 4BB0A 3EXIB 3AUXA 4PM4A 3SMQA 3TM5A 5KJ6A 1UK6A 2C0PA 5JJKA 4IHAA 1UAGA 2ZTHA 1F7UA 4KE9A 5A5VA 4R8SA 2GMWA 3M6XA 4JEUA 1G41A 4ROXA 1U3TA 1H8EA 2HHCA 2QF7A 1W94A 3DQZA 3DQQA 3IHWA 3MN1A 4WACA 5HIIA 5KVVA 1ICIA 1Z2EA 3KKQA 3PQ8A 4UVGA 3E70C 2XIJA 2B3TA 3QEAZ 2K7ZA 1H3EA 3T1QA 1ST2A 1GVNB 4E5KA 1I3LA 1AB6A 1AZSC 3IVRA 2H2DA 1Y7TA 1IM8A 5I8WA 4RF2A 1Z68A 3VHQA 3P8ZA 3ML1A 4BLUA 4Y1FA 1H9AA 2R2AA 2AT1A 4YK7A 2J46A 3GP8A 1WBDA 2VTKA 2W98A 4YY3B 3ZD7A 1ORIA 3HCNA 3NDIA 1VI6A 4UUBA 5GMOA 5LQMA 2W4IA 1TF7A 4IV5A 1FNCA 5AI8A 1G5RA 3IILA 5LB4A 3MILA 4ZI3A 1JKXA 5D85A 5GP1A 3UK2A 5E6RB 2XIQA 5CGQB 4TMVA 1OFGA 5AM4A 1VQ8B 4I08A 4N76A 4DC0A 5IJ0B 2FPSA 4K8RB 5JZMA 2OPHA 1VLHA 3SHWA 1KVSA 3IEMA 3KE8A 1UPCA 2X7XA 5E7IA 2UVQA 1L1RA 4IW3B 4ENQA 5I7OA 2Q5FA 2CB0A 2HW8A 4G7WA 3EUWA 2HCTA 4BVLA 1E18A 2J0SA 3PP8A 1QQBA 4M1SA 3AEQB 5BV8A 5A9TA 1R5JA 2C3YA 2J5BA 2M6LA 1W7AA 4ARZB 1P74A 3F9IA 1TK3A 5E4YA 2H00A 3KR9A 4KR6A 1U3DA 2JGLA 3CZMA 1Z3IX 1AGXA 1T34A 2DHQA 2ENWA 2WD9A 3ZCRA 1VHJA 4C4PA 4CCSA 3KXIA 4CKEB 2VA9A 1XFDA 3CV3A 3CRMA 1DS6A 1OXKB 2Y99A 3AR6A 1M3SA 4HSGA 1W52X 2BZ0A 1SULA 3J81k 1FBTA 2PR7A 3H18A 3UHOA 1RABA 1HQCA 4JBHA 3DE2X 2XA9A 3K2IA 3KKEA 4Q9KA 3PR2B 5E6UB 3EZ2A 1GEEA 2Y1DA 3DCNA 5BN4B 1C30B 4Z2YA 3V7WA 1T8PA 1ZXLA 1NXSA 2PX3A 2YV1A 2ZFUA 1Z5PA 2QTNA 1ZRHA 2QT1A 3K0EA 1VE7A 1L3BA 2HMSA 5BWMA 4MKFA 1X1AA 1X7ZB 2E3JA 3BAZA 3BILA 3E3AA 1RMYA 4HNRA 2UDPA 5I8ZA 4EB6A 5LWHA 2IZOA 3KL4A 3G0GA 5EINA 1T2FA 5KDDA 3KZCA 3RPEA 4DSNA 3T5GA 1VM6A 1O0SA 1WTCA 2IPMA 4LK3A 5FV4A 1RWNA 2WPNA 1QORA 1G2PA 4MA4A 4ZVOA 2V7GA 2WINI 2XOKD 4J0HA 2G67A 4C0QC 1OSNA 2REQB 5LBIA 4HWPA 1SWWA 4CG0A 1NASA 4P35A 3EGDB 1I6KA 1SXJD 5F7OA 4AFNA 1U5CA 3OM9A 2PTHA 5EQDA 1E3WA 4JEHA 1YU6A 1G3UA 5EESA 3V8MA 3VTFA 2CL7X 4EHNA 1VIAA 3VPBA 2EFGA 1FS6A 1V1MA 4KQEA 3MQ2A 4IRMA 1G8PA 2YMMA 5AH0A 3OHSX 1N08A 1NXPA 1PGQA 4QGGA 1JVSA 1I32A 3DULA 3OF5A 4D9HA 2FPGA 4D4KA 4RULA 1A8SA 4KQIA 3H4MA 4L9SA 4Y2QA 1HF3A 1PJ2A 1T35A 3CPJB 2ODBA 4J3NA 3KFLA 4C5BA 4D0GA 1E8NA 2ODQA 2VSXA 5CFPA 4FYIA 4F91B 2O7RA 3NAZA 4N3NA 4B3GA 1IMJA 1JFSA 2O2JA 1QYRA 3FHLA 4J0DA 4A8PA 2OEPA 3DVLA 3O9ZA 3WWCA 4GF5A 1GZDA 1LBSA 2YW9A 2C3UA 5LM3A 3DPUA 1TXGA 4UEOA 3SNHA 3LLCA 1GTL1 1LPMA 3WYFA 1J4AA 1U8FO 3W5IA 4ZAFA 4MKZA 2X86A 1I4OA 4R68A 4ZK2A 3UK0A 3QKWA 3MT0A 3E2PA 2LBPA 3IP7A 2PUCA 3WL5A 2Q21A 2ZB8A 3T5BA 5J2UB 2ONYA 4MEBA 1K89A 5KNCD 1EBUA 1GARA 1LQTA 3JD1A 5FUBA 1C1YA 1DG3A 4M0CA 1VBKA 1VI2A 3WGGA 4DB4A 3P9CA 4MYHA 1GL3A 4PLZA 5C32A 2QRNA 3K8OE 3QEKA 4PE5B