2X0KA

Crystal structure of modular fad synthetase from corynebacterium ammoniagenes
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
338
structure length
338
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Oligomeric State in the Crystal Structure of Modular Fad Synthetase Provides Insights Into its Sequential Catalysis in Prokaryotes
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
total genus 102
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2x0kA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2x0kA01
3SYTA 4EG5A 1OBHA 3CLRD 2DLCX 2D5BA 3DPIA 3P0IA 3D6VA 1HYBA 4R0NA 4MUHA 1PFYA 4MW4A 1KH1A 2HMAA 1KP3A 1OWMA 1O95C 1U7XA 2XRZA 1NUTA 4HPWA 4L2IB 4AS1A 3PNVA 4MWEA 3ISJA 1NURA 3IVCA 1VBNA 4R2LA 2DEUA 4R2MA 2A1TS 1J70A 1PFUA 1PG0A 2PFSA 3MMXA 2NSYA 1WQ3A 3CVYA 2E89A 4TS1A 3IVGA 4PBSA 4YBRA 4DDKA 1OWPA 1EJ2A 4EFKA 5FO1A 2JANA 4JZYA 1LI5A 4RPIA 2WB2A 5DK4A 1DNPA 2CT8A 4MUKA 5KCMA 3TZLA 2DERA 3OTWA 3A2KA 1JZQA 2DPLA 5A8AA 2VXOA 3RK0A 1U0BB 1H1TA 4DJAA 1GZUA 1X8XA 3AG5A 3ND7A 2CUZA 5BNZA 3GLVA 3QTTA 3ND6A 1EFVB 3IMEA 2PZBA 3SDBA 2AZXA 1N05A 4DDHA 2WQ7A 3A04A 4MUFA 1P7PA 3TQOA 2HGZA 5KHAA 3LE8A 2ZP1A 3C8ZA 4DDMA 1EFPB 1MAUA 3N05A 3MUEA 3CLSC 1GTRA 3VU8A 3FHJA 4MVYA 1I6KA 3SEQA 1NSYA 1GAXA 1MOPA 3D6UA 3HV0A 1ILEA 1MBZA 1FFYA 4I6JA 1KQOA 1EUYA 2VTBB 4I6GA 2D13A 2X1MA 4ARCA 1K97A 4J76A 2A7XA 2DUMA 4EG6A 1R6XA 2QJFA 2HZ7A 1PFWA 2EL7A 2A84A 1H3FA 3K32A 3N9IA 1V8FA 3H9CA 1T6ZA 1NB9A 1Q11A 2PIDA 3MLBA 3P52A 1NUPA 3TQIA 1MB9A 4J75A 4MUJA 1TYAE 2P3MA 4XFJA 1O95D 1N2BA 2A88A 4DE5A 1GPMA 4MWCA 1YUMA 1MB2A 3UC5A 2J5BA 3NBKA 4YMIA 3FI0A 2R5WA 5TS2A 3CVVA 1M8KA 1K4KA 4YP6A 4I6EA 5AHWA 1WKBA 3E27A 4NAHA 1OWNA 5KWVA 1ULHA 4XFDA 4ZCQA 1OWOA 1O97C 2IJGX 1MRZA 4MW2A 3H97A 2PZ8A 2V0CA 3G6KA 1T9GR 3HL4A 3IUBA 3CLUC 1JIIA 2E21A 2Z09A 3F3MA 1OWLA 2ZUEA 1M83A 1IQ0A 4QRDA 1JZSA 3ILVA 1N06A 1M8FA 1NYLA 1NB0A 1M8PA 3NBAA 4WSOA 4Q16A 1QRSA 4UZEA 1XJQA 2C5SA 1MC1A 3G59A 2GM3A 4H3SA 2E0IA 4WNYA 1Q19A 3A05A 3VRHA 1ZJWA 3GUZA 3P0HA 4CT0A 5JBNA 5LFAA 1IFXA 1QU2A 4EG4A 3SZGA 1G8FA 1TYCA 2A4MA 2IELA 1N2IA 3FY4A 1QRTA 3QTBA 2X3FA 1JEDA 2X0KA 1WXGA 2CV0A 2O5RA 3ELBA 2AG6A 1FYDA 1T6YA 2YXNA 1NUSA 1TQ8A 3RHSA 1U3CA 4HJRA 3ZIUA 4XSVA 5IHXA 1U7DA 1YIDA 2ZUFA 3HMQA 1M8GA 3HFJA 1QJCA 1V47A 4OJMX 4MW7A 3COZA 3CVUA 1B6TA 1YIAA 3TS1A 3FDXA 3SEZA 3ZJVA 1QQTA 1QTQA 3OP1A 2NZ2A 3H99A 3AIIA 1O94D 3IODA 1XNJA 4NDAA 4NATA 3AG6A 4ZT6A 5TEVA 3PNYA 5FO0A 4PY2A 1MAWA 3U1VA 1R6UA 1COZA 1O96B 4NZPA 1IH8A 1NP7A 1TEZA 2DXIA 4CDMA 3L93A 1P4MA 3ZXSA 3GMIA 5DEOA 4GU5A 3X1MA 4GRIA 4ZCTA 3FH0A 1X6VA 1G59A 4JFAA 3CLRC 5J58A 2RD2A 2O8VA 1G8HA 3RK1A 1N2OA 1J20A 1N08A 1JMVA 1J1ZA 3ZXIA 3Q10A 3AFHA 5LM3A 1F9AA 3RJZA 1J1UA 2H29A 3H9BA 3FETA 3CTAA 1YUNA 1JGTA 2A86A 1WXEA 3FNRA 5DASA 3KT6A 4U8HA 3HZRA 3IMCA 1ZH0A 1NUUA 1UFVA 4ZT2A 3ZJUA 5K0TA 2YWCA 4KR6A 1QNFA 1J21A 3IUEA 4U7JA 1O0BA 1T6XA 4F4HA 2CV1A 3IDFA 4KPUA 4ND7A 4A91A 4EG1A 2J07A 1IVSA 5DB4A 1KAMA 3UMVA 3ZJTA 4MW9A 1EE1A 1G8GA 1WOYA 2IP1A 3UOWA 5HUHA 3PNBA 2YY5A 3N2YA 4BWVA 4AQ7A 4EG7A 2YWBA 3CLTC 4K0RA 5A88A 2CYAA 2CYBA 1H3EA 2QTNA 2A1UA 1O6BA 1KQPA 1F7VA 1QU3A 1JIKA 3LCJA 3BNWA 1JEEA 3AKZA 3IVXA 1N07A 3N8HA 2XRYA 1KAQA 4HJXA 2B7LA 1N1DA 1N77A 2OYNA 1KP2A 4MUIA 2JAXA 1JILA 3IOBA 4OUDA 2VBVA 4K03A 4NX2A 5H7XA 3M5WA 2QJTA 1LI7A 3MLAA 1M8JA 2GOYA 4MLPA 1KKUA 3LOQA 4EG3A 3IOCA 3CVXA 2BYTA 1O5TA 1LW7A 4ZT3A 2J08A 2A1TR 3KT8A 4Q93A 1ZH6A 2TS1A 4UZFA 3Q12A 2AKEA 5TRDA 4MW0A 1GTSA 2BTEA 2DR2A 2CYCA 1O0CA 3COVA 1SURA 1KH3A 2VTBA 1TYDE 3DLAA 1VBMA 2H2AA 1CT9A 3CA8A 4MUEA 1WXHA 3L92A 4QBTA 2QTMA 3UY4A 3S3TA 5FNZA 3CLSD 5HUJA 1IHOA 2QTRA 1T9GS 1GLNA 2WSIA 2G36A 4MVWA 3FG9A 4QREA 1U3DA 4MQ6A 3PXUA 3RFFA 3IH5A 3AL0C 4EF6A 4MWBA 1OBCA 1WY5A 3NV7A 1K92A 2CV2A 4ND6A 2PXHA 4MUGA 2QUHA 2D54A 5HG0A 4ZT5A 3ZUGA 5F23A 1PFVA 2QJOA 4ZCRA 5H16A 2E18A 1N2GA 1ZUNA 3FWKA 4G5YA 1MJHA 4MULA 2PZAA 3QE4A 2DETA 4KPUB 1Q9SA 1EXDA 2V0GA 1N2JA 2PG3A 1RQGA 3COWA 3PRHA 1N3LA 1N2EA 1NZJA 4DLPA 5J59A 1NUQA 3TZEA 1A8HA 1KORA 3FOCA 4MVCA 1PG2A 3G5AA 2QUIA 1XNHA 3I05A 2QUJA 3KFLA 1Q15A 2VBSA 2QUKA 3X1KA 1I6MA 1J09A 1I2DA 1NI5A 1VBKA 3A4IA 4MW1A 3CR8A 3CLTD 3FIUA 2A1UB 1F7UA 4EG8A 3X1JA 1TYBE 4ZCPA 4U63A 1KQNA 4MW5A 5LLTA 1XNGA 3TNJA 1EUQA 1O97D 4HK4A 1IQUA 4NAUA 1GN8A 5A89A 3P0JA 1WQ4A 4DNXA 3CLUD 3MXTA 4KKVA 3UK2A 2Z08A 4OUDB 5TGTA 3KT0A 2WQ6A 4L2IA 4G5FA 3RBAA 3IOEA 4MUNA 1BS2A 2VBTA 4RUKA 2OQ2A 2EJCA 3JXEA 5J5AA 2I1LA 4X0EA 3SZ3A 3KT3A 1VLHA 1K4MA 1F4LA 2J4DA 4ZT4A 4MAFA 2RE8A 5TEWA 4ZCSA 1WXIA 3CVWA 4FZJA 1JIJA 4KR7A 1IRXA 1Q77A 4CDNA 1QRUA 1N2HA 3COYA 3IMGA 4KR9A 3VGJA 1R6TA 4ZT7A 4S1OA 4CQNA 4YP5A 1WJGA 4JXZA 4JXXA 2JA2A 1JHDA 2CFOA 3DV2A 1H3NA 4PBRA 2GKSA 2CSXA 3DO8A 3BL5A 4MWDA 1WXFA 3K9WA 4MVXA 3ND5A 4P2BA 1O94C 1N78A 2Z3VA 1EFVA 3INNA 1S4MA 1O96A 1D2RA 4JYZA 1WZ2A 1VL2A 2OV4A 1YI8A 4ARIA 1OD6A 3Q4GA 1TFUA 1Y42X 2VBUA 1I6LA 4YP7A 1EFPA 1M1ZA 3HGMA 5IJXA 4F3RA 1KR2A 3H05A 2X1LA 1IQRA 5EKDA 4PBTA 1JECA 1KH2A 4E1AA 1N75A 4EGAA 3SP1A 2J09A 5K0SA 4MW6A 1YULA 3ZGZA 4G6ZA
chains in the Genus database with same CATH superfamily
1HEYA 5LQSA 3HK2A 1LVUA 1IJBA 1T9KA 3AVQA 3DTVD 4I1IA 4JJZA 4BRSA 2GHIA 4EW3A 2VOJA 2QN3A 3QPCA 4U0KA 2HF8A 1QXSA 1CJMA 4J1NA 4MA0A 1PF7E 1U0HC 3HM2A 4DRZA 5CM2Z 5C8ZA 5LOVF 1OB5A 3OLVA 3C3PA 1ZNQO 3HKDA 1FTNA 5AHRA 3G9XA 4GO1A 1RE1A 1TRKA 3U40A 2OO5C 1WVGA 4H0CA 1KP3A 4OSOA 4OBEA 4MWGA 5CNMA 1SOVA 2GPAA 4AY3A 2PKRA 2H1LA 1OX5A 5JXGA 2J5RA 2B2NA 5LOVB 1UC5B 3AEZA 3JQAB 2JZNA 2BZSA 4ABTA 1RYBA 1PHPA 1W29A 4B3CA 3P26A 1U9JA 2QVGA 2JIRA 2VNKA 1HG1A 2EKQA 2QAJA 4TRMA 2JIMA 5IDYA 4CQLA 2MINA 3OUTA 3CNEA 1T36A 1MT3A 1QZTA 3S1AA 2UVPB 1KBQA 3PB3A 4X20A 4CIAA 3GCGA 2UYGA 3W9BA 1PG0A 3QEKA 2HTFA 5CP8A 5TVGA 4ZOLF 2OPBA 3WLNA 4LWZA 2JZCA 4MO9A 2W0MA 1N6KA 1E1NA 1QWSA 2JLSA 4EFLA 2AG0A 1KXZA 3GJ5A 1XJWA 2F9MA 3JZAA 3LUPA 4OFZA 5IWAB 2BFEA 2WHEA 4BWYA 5KHLB 1A2OA 4C2AA 1X42A 1Z7YA 1G3RA 2G80A 1MX9A 4ZO4A 1ISSA 4CF4A 4GKKB 4KUHA 1XKTA 1N0HA 4MJ3A 4ZOLB 3MJCA 3JTMA 1LJ8A 3HR4A 1NTOA 1ZJ5A 1T5IA 5AI4A 4TSFA 1SD2A 1SELA 4EB0A 3P32A 1MTZA 5EJ6A 1B8UA 2DUNA 1RQXA 3OBBA 8ATCA 4AAYA 4MV7A 4D25A 1XIVA 2NUBA 5AUQA 1J9ZA 1M5TA 1LSSA 2VNIA 5F4MA 1K0UA 1TAHA 2QR3A 3DG9A 1KJWA 1LY1A 3LKDA 5JQWA 2ZWOA 4ISCA 4CTKA 3GVXA 1M2KA 4JUDX 3MCAA 3DT9A 5H82A 4H9GA 1LRJA 2PKCA 2FPUA 2VJQA 5LJIA 3BSFA 2OQVA 1TM7E 3PK0A 3S29A 5JPDA 2IWHA 5K6TA 1DG9A 4WVLA 2UXDB 1UKCA 4MDFA 3AR9A 3GSIA 3L7YA 2BMVA 5AJVB 2WWHA 1EP3B 2AI3A 4H4DA 3RUCA 5B3JC 3Q1KA 2Q1SA 2GJAA 3UATA 5AVOA 1CJUC 5EUBA 4BVEA 3FI9A 4RPHA 3LO8A 2Z1DA 1UJ6A 2UYQA 3K8OE 3OEED 2L82A 3SHFA 2WILA 1FSSA 2OCXA 1HETA 2Z9DA 1EIWA 4WY5A 3I64A 4YLYA 2QJFA 3VR6A 3OZTA 3QF7A 4CPDA 2BI4A 2XBLA 1E4EB 1I4DD 3G0CA 5HJEA 4RK1A 2UKDA 2BVNA 4B47A 1TK2A 2NSJA 1FS4A 5FP0A 2OFPA 3JWGA 5FA6A 1QX4A 1AD2A 3LLMA 2JEOA 3H6GA 1FYFA 3T7IA 3WLTA 4BIMA 4UD6A 4E31A 4WKCA 2P3MA 1RKQA 1RT9A 4MKXA 4JUBA 2ZRDA 1HTTA 4DKJA 1P74A 3OKFA 3R3SA 2PDAA 5TPWA 1CNEA 1NKSA 1T8PA 1H1LA 1PJ2A 4JT9A 4IRXA 5AW5A 1QH8A 4B7XA 3PPIA 3TJRA 3CVVA 1EJBA 1NW7A 4FHCA 2C61A 4I0WB 4YP6A 5HIAA 3QX7A 4ZVRA 3KSBC 3U4QA 4JJ8A 1OWNA 4JXKA 3VMFA 1JQKA 3QE0A 4ROXA 3KQTA 4KPFC 2OSVA 1N9GB 1IJFA 1VI5A 4P3IA 2DR0A 1EHCA 2ADMA 5UKDA 2BMJA 3GPCA 3UK0A 2ZSBA 2DM6A 1NF8A 2G88A 2H1FA 4NFYA 2GK3A 1CR6A 4F6CA 2FN7A 3CZAA 4GQAA 5JCOC 3MQFA 1DVRA 2JFYA 4HNAB 1H93A 1R10A 1AQYA 4XEUA 3NTUA 1TYZA 2GD6A 3PQDA 4WZZA 4B87A 1CX9B 2WE7A 2WYUA 4XEHA 1HDZA 2B21A 5CW2A 1S3SA 2YWEA 1IQ0A 3UT5A 2E5LB 3MHTA 4CG2A 1WU8A 4GI1A 3FTFA 2G06A 2NPIA 1KJZA 1E7WA 3ILVA 4TQUS 1L5YA 4QDKA 1GGVA 4TTAA 5ALXA 1K88A 4UPEA 4EHJA 4LDAA 4NZYA 4TXJA 3ZDCA 1UM8A 3CF6R 5J5CA 4DXAA 3RTGA 4RMJA 2OUKA 5EJFA 1MC1A 4HRYA 3QVWA 3NHZA 1N3BA 2NYRA 2ZYTX 5IFLA 3JVDA 4R98A 5KVCA 5IJ0B 4WNYA 2CJYA 2AXQA 1OPXA 3FTNA 3U62A 3HABA 3JQGA 4IIGA 4YNBA 5ED4A 1Z38A 3O4FA 1M2OA 4YRAA 1V16B 3P0HA 4NCNA 1LTQA 2X6RA 3K70D 1FL9A 4PO8A 1B26A 4MYDA 1BE1A 1SVNA 2R7KA 2Q2WA 2F2TA 3PQ4A 1E98A 2AJBA 3LX6A 2P2GA 4D9FA 3E1YE 1GPAA 1EEHA 3LA6A 3OM8A 4K9SA 4HNVA 3DFFA 2NP6A 5CCEA 4UC0A 1OZ0A 2VK2A 4WRRA 1NZDA 1YB2A 3UWDA 2O5RA 5BOSB 5C8YF 1GWNA 1W96A 3DCYA 2RGUA 4P6VF 3O92A 4TQGA 2JBAB 3STWA 5K3SA 3EC1A 1Y98A 4H6XA 2B0CA 4FGWA 1Z39A 5ALIA 1EUDB 3Q3AA 5FOUA 5JSYA 4L27A 2BFBB 2J30A 1THTA 1W4AA 3DMDA 3QVOA 2DWPA 2ZL5A 3JQ9C 3PFKA 4U3JB 3G9ZA 3SLNA 4ZVQA 4CUZA 1VHTA 1VSTA 3NANA 3A6DA 4QBKA 4RMGA 4S24A 3LX5A 5C8YB 3PI7A 3CY6A 4B2PA 4CI9A 4LY3A 5E4JA 4BKMA 4Z2AA 5BUQA 4CEIB 4FFVA 2WWYA 2A58A 2FWNA 3FDXA 2UXBB 2HSZA 5BT8A 3B53X 3EEFA 4QQFA 3ZW8A 4NPCA 1O57A 4Q21A 4F3YA 2LW7A 3HXQA 3OQPA 2D59A 3ZHUA 4G84A 1CUIA 2YVLA 1W8IA 2IHVA 3KSMA 3HO1A 3WFJA 4WAUA 3UJ8A 1JHRA 1EAYA 4QWWA 3Q5EA 5CNKA 4YONB 5KYKA 1PR6A 2D00A 1UOOA 5K51A 1LPNA 2OCAA 3JARB 3R0JA 1JWAB 3ESDA 3MJTA 3OVMA 4J16C 3TE6A 5JFGA 3OF3A 1U7WA 3HJUA 2Q6IA 5FUVA 3OZ7A 4XKWA 3WXBA 5C81A 1N2OA 5DULA 1KMMA 1N08A 2PYZA 3AR6A 3C8UA 3AFHA 3EXG2 5KAMA 2ZUWA 1K9MD 1NF9A 1T9DA 3G8CA 3GV0A 4JI1B 4EMSA 5BYKA 2Y93A 1J1UA 3RC9A 2PUDA 3FLAA 5DYYA 5F35A 5JIBA 2UUCB 1M6YA 3SY8A 3B5JA 3VFDA 3K94A 1SG0A 4OP3A 3I56B 1ZH0A 1G8MA 4ZC1A 4OHRA 3CWCA 3N2LA 5LNK6 1T3LA 5DI3B 1E3DA 1GU1A 4HRXA 2ENWA 2AIRA 2XB2A 3NRCA 4F2GA 5JD5A 4HQ6A 3CXUA 3L6BA 4Y98A 4JJGA 1FX0B 1WDKA 1XRQA 4BNDB 5KZMB 2P3QA 2WHPB 3NW9A 1Y8QA 4KPUA 4RIFA 1AXRA 1PI3A 1X7ZB 3VTKA 4DIOA 4H08A 2ETXA 5FL7D 5JJLA 4EG1A 1CF4A 1XEWY 4MR8A 2GYWA 3Q98A 3JVUA 1BE8A 3AFNA 3LA8A 3ZWYA 1A7UA 1OQAA 4TKVB 4QDOA 4PO3X 4PGMA 2DQSA 2X22A 3DE0X 3TZQA 4L4YA 1FTWA 2SNIE 5FIUA 3IBCA 1TZBA 2JD2A 4J9UE 4L57A 5CVVA 3SJAA 1Z68A 1AUOA 2ZI4A 1KSJA 3BERA 3ER6A 4KKXB 4FMPA 4UHFA 2F59A 3ZWNA 3U7FB 1Q20A 1GRQA 3ACDA 5EAIA 4OHYA 2O2YA 1U99A 3KC2A 4XTRA 1DFGA 3AOGA 4JCCA 3OQJA 4XA8A 1R15A 4D8XA 2RHMA 4RTQA 4L0MA 1RC1A 4B73A 3AKZA 2ATEA 2B1JA 3PVZA 4OG2A 1TLFA 4WEOA 5DXAA 5CB6A 2ZIFA 4IUCS 4URVR 2ZVJA 1JILA 5CYOA 3SQNA 1FFXB 4BBAA 3FROA 2Z30A 4R2WA 2M6LA 3LUCA 3AERA 5L8VA 5JMPA 1ZX1A 3M3DA 3HEBA 2AR7A 5A04A 1NBMD 3VH3A 3FGPA 1L6RA 1K7SN 2AA3A 3AV3A 3O4IA 3R6WA 4M0FA 1JTEA 3PUJA 2LR0A 3WBBA 2JAWA 3ZWXA 5DYWA 3BVPA 4N3BA 1AVTA 3G2QA 2ZBQA 3PEEA 1L5KA 5AW2A 4UOQA 2E4ZA 2XCLA 2Q9CA 4B4KA 2A2ZA 5AW4A 4XXHA 3I6IA 2Z8YM 3TTVA 1GKLA 1ZC4A 3MPUA 4RV9A 2FW0A 4BNKA 5GV7A 3ZZTA 3EQ9A 3MW8A 4JJKA 4Z6KA 5B7GA 3AEQB 2WIAA 1NJ6A 4WK6A 2GUWA 4HSEA 5TNXA 3T9DA 1NNLA 3P5BA 1QIGA 2R1VA 3QXJA 1AZWA 3SKYA 4N54A 4MVJD 4O1HA 5E1OA 5DXFA 1QO0D 4FEYA 1X7WA 4Q1FA 5C1OA 2VTBA 3OSZA 1P8AA 3X1XA 2CBXA 4DMKA 1DBSA 5CB0A 4CF7A 2BY4A 3TI9A 1XLUA 1YC5A 3EHEA 4JLNA 5FBVB 5I7WA 1MG5A 3OZEA 3OJWA 2ASVA 3HL0A 4BWFB 1UZLA 5C7LO 2XCOA 4LC1A 1MQAA 1NVVR 2GN6A 3S3TA 4CR6A 4EA9A 4GGPA 1WZUA 1ULBA 1VL1A 3S7ZA 2WWFA 3PENA 1Y6QA 3AEUA 3L7AA 4PSUA 3BQ9A 4BKUA 2C29D 1FFHA 4G8JA 2IF0A 3WFZA 1BN7A 1NBHA 2ORIA 2FWIA 4OH7A 4BQRA 4NG5A 2AS0A 5CG1A 1J9GA 1JDZA 3GBVA 1GTZA 3EMDA 3S5JA 2QW8A 4MS4B 2CV2A 2QRZA 1P5FA 2OYRA 4Y6PA 4GBGA 3ZI7A 2ZI6A 4YQYA 5HG0A 1KZGB 1VHLA 1CY1A 1MF7A 1Z33A 3H19A 5JALA 1ORIA 3BK1A 2YBDA 4DV2B 5BW5A 3FWKA 4FNOA 5JY1A 4DR1B 3AVVA 3WJ7A 5JAHA 1MJHA 3B1YA 2PZAA 4ZXFA 4YAIA 1Q9SA 5JE8A 4H7HA 1ZSNA 2V7EA 1XLTC 4ZVTA 4UEWA 4N7JA 3S99A 4D0GA 3LQ6A 4DSZA 2LIVA 1BD3A 1QBKC 4CMIA 1Z45A 4QFBA 5IZCA 1NQVA 3KUCA 2KS6A 1HK7A 1CZKA 1ZY2A 4U39A 4LFCB 1L9KA 1O1YA 3PUNA 1SH7A 3BIFA 4AXXA 1Q2UA 2AFHB 2R11A 3PNOA 2YZMA 3PE4A 1F1BA 2C2KA 4HYYA 4J49A 1ABEA 1NBEA 2RB5A 1P3DA 2WU1A 3Q38A 4EY3A 3RIHA 4TTSA 3TEMA 3GEHA 1FFCA 2IKQA 4OMUA 4EARA 1SY7A 1ONSA 2OV6A 2VK1A 3GJZA 1TZKA 1RZRD 2BJVA 5KAPA 3EBOA 1RACA 2JASA 1E2DA 2GJ9A 3NVDA 2C5EA 2ZBUA 4HX9A 4AN4A 2I9PA 3OF2A 2HH9A 1CUVA 1L8AA 2ILVA 1AMUA 3QNWA 3W6PA 1ECGA 4AI6A 3QKSA 2M5SA 1A77A 1WABA 4CG3A 2Q4TA 1RZVA 2QMOA 3C3XA 3IXLA 2ZIAA 1MJGA 4BXOA 3EXG1 1AZLA 2FEKA 2Q0HA 5TGTA 1JEJA 3DV0A 3T9AA 1W0KD 5HRUA 5A4MS 2PANA 3ZLVA 4URHA 4CT5A 1IZZA 2GNPA 1BU8A 2MSKA 3SZ3A 1ODTC 4X0EA 1M1YA 1HTBA 4QU8A 1EWRA 1K4MA 3WK4A 2I4IA 4J3FA 1RQLA 4KFRA 1MO5A 1VE3A 4MAFA 4DYDA 2ZT6A 4W5OA 5LSAA 2WSYB 4RA9B 3ETEA 3UJNA 4R41A 3WLIA 1RTTA 2J3QA 1NXPA 1UANA 3TD2A 4N3CA 4JLWA 1RKVA 2VAPA 3RASA 3BUSA 1Q77A 5LN1A 2HDOA 4IKOA 1MV8A 4HZGA 4KXQA 1UWVA 4MQMA 5EMMA 4EQ6B 5B57C 3FOFC 5ALGA 3HA7A 4PTYA 1U4SA 3RRXA 3BWEA 3OCJA 4C4YA 1SK8A 3AVOA 1NFFA 3OIFA 2YHIA 1TUBA 3KP1A 5ELMA 3LPMA 2P3LA 2Q49A 1KYXA 1Z3IX 3AONB 2OZLA 2ZR8A 4BTLA 5DNWA 2GKSA 2YW9A 3ETNA 5B1IA 1CB7A 3UHFA 1D2GA 3KJGA 1P5JA 1JIQA 4RJLA 2I1VB 4HR7A 2ZXUA 1E77A 2C98A 5KVQA 2A94A 3WWZA 5JNLA 1MX3A 2V55B 3IQZA 3WK7A 4GWGA 5GOZA 1GNPA 2ZDHA 5AQ1A 1K6EA 5F2EA 3G0GA 1JEAA 1EGQA 1Z7BA 4BC1A 2XMDA 5KJCA 3R7BA 3DXYA 2DTXA 1S4MA 3ABRB 3G17A 2B4YA 3DHYA 4P12A 4UVDA 1OYOA 2X0NA 4PHFA 1AGRA 5EIFA 3NE5B 3SM3A 1LNSA 2VRNA 2EX1A 3D6JA 3W8NA 1IY2A 2V59A 4AD8A 3FPPA 3G89A 4OIMA 2OBTA 1AQIA 3MWKA 5TPZA 1DT5A 1VCMA 1YR9A 4HS4A 2F90A 1I3CA 3VGPA 2SHKA 1Z5ZA 5LJLA 3ZZMA 3JD0A 1UDCA 5D7BA 1E9CA 2HRRA 3E4CA 3OG9A 1BMFD 1FTGA 1H65A 4TGLA 4EGAA 2PUEA 1V1MA 3UKJA 2IY9A 3AU8A 1G2OA 1PJ6A 3I2FA 3BWXA 3FYUB 2HF9A 3M6VA 4XZ3A 3VYSB 2DQKA 4CRWB 2X19A 3WWDA 5BY2A 4B34A 1F20A 1IK4A 5LXTF 3ZWDA 4EG5A 1P33A 4GVPA 2D5BA 1VYTA 2HHAA 4RNDB 3RS0A 1RNLA 3GP8A 2D7JA 3HCWA 5IKEA 1ENPA 1RWWA 4Y18A 5DM70 1L3BA 5G0VA 1O0CA 3DEAA 1S01A 3DFKA 3U4DA 1WMDA 2JIDA 5GONF 3UB3A 4BUJA 2P11A 2C3OA 3N8IA 4TZKA 3V7FA 5LXTB 5AOCA 4ILEA 1EB9A 1FEZA 1JIUA 3LW8A 4NYMQ 3OJXA 3G71B 2H92A 1VQ8B 1GLGA 2KJQA 1EMDA 3P5SA 5A6SB 2UZ0A 3UB4A 3KQHA 1YC2A 3E1SA 3HP4A 5GAJA 5T4HA 4CKZA 2ORYA 4IOLA 4NONA 4D9NA 5GONB 3WAKA 3C7DB 4I3GA 4R2MA 1QH1B 4B4DA 5AXBA 4AKIA 3FKJA 5KB3A 1IMOA 2E49A 2QA4B 2NYAA 3I28A 3B3JA 1EA7A 3OLCX 4I9FA 4PLGA 3UJ6A 2QTWB 3QE3A 5B3AA 2E89A 2I22A 2JD0A 3IRUA 1JG6A 2VPWA 3R9IA 3S5UA 4B81A 4URFA 1RRCA 4DDKA 5T8KA 1D2HA 5IUNC 2I3BA 1WMBA 1XTJA 5FO1A 3P20A 3L06A 4IGFA 4G0OA 1T5SA 4M8SA 3PPXA 1KO8A 3KSUA 2EJBA 4XUDA 3R5JA 3EH1A 1JQJC 4PR3A 2PZMA 2A3RA 3D0OA 4MUKA 3ASRA 3NIGB 4IIUA 2Y1DA 3SYRA 5FFFA 4NXMB 4O08A 3I83A 3I8OA 4G85A 1I5EA 4WNCA 2P7HA 4JL8A 5KOHA 1V0FA 3I01A 2DBVO 4BVHA 4BLQA 4DJAA 4DLYA 5GINE 1X8XA 4X6XA 2CUZA 4ER5A 1HYQA 1L7MA 1TO6A 5A3RA 1CY6A 1GUFA 2QL5A 1VKHA 4LJYA 4BVFA 3BTOA 5LWQA 4OH1A 4RC9A 3QIAA 3UOGA 2H63A 2PKQP 5AVJA 5AVKA 1A9RA 3OMXA 2XVYA 5CCBA 1J23A 2WQ7A 1I24A 1P7PA 4JBWA 3K70C 1RI3A 1SBIA 4DLNA 4PG8A 4ED9A 2ATCA 1ECCA 2WSMA 5HF6A 2HM7A 4MX8A 3KBBA 1WPRA 3WNCA 1AHNA 5DVZA 2XXBA 1A88A 1NBOA 1O95A 4JYBA 2X9NA 4NVRA 3W2FA 3U4HA 1E6MA 1MAUA 4XFKA 3EPKA 2VP2A 1T3TA 4PINA 2J59A 1JAYA 2YMLA 3GL9A 1NYRA 1UBMS 2MHCA 3P9RA 3PEUA 3ZLJA 1WPXA 4RTLA 2FFJA 3NAQA 1MOPA 5EQDA 2IUEA 1GPBA 2O0LA 2WUDA 3T1VA 3UT6A 2C58A 2PK3A 4LF5B 2ZZMA 2VPPA 1CYDA 4U7HA 4JGGA 2CJPA 2BLLA 1W88B 4BMOB 3KHKA 1UAGA 4I6GA 2D13A 2ZB8A 1E0JA 2HI0A 4W5WA 5TR9A 3PGLA 3H4IA 1VQ6B 4P26A 3IAS1 1Z26A 1T0IA 1PEDA 4ZVVA 4HB0A 4XIFA 1UFOA 1RLJA 2FMUA 4WZAE 4DT1B 1PW7A 3GYBA 3ZE6A 1RI5A 5IVHA 1COWA 2HBQA 3C6ZA 2WI8A 4J7AA 1DUVG 1KK1A 1PZHA 2VDVE 5SICE 4IYRA 3U0BA 4BN4A 1WTCA 5K0GA 3LIIA 4H4EA 5C8VA 4DE5A 5MN6A 1EK6A 1R9GA 2BGLA 1VI6A 4PC2A 3UQYS 5BN3B 3D7MA 2IE0A 1DE0A 3SN6A 4UTVA 5DSZA 2V7GA 1M74A 2FX5A 3OCCA 4ARAA 5LMUB 4PX9A 2CFIA 4RIIA 4WUTA 1T2AA 4Y0VA 4CTOA 5EIEA 2DY0A 4NZMA 2IYXA 3NYQA 3BA6A 1V96A 2AQIA 2YWJA 1KZ6A 3IUYA 5H0IA 3WHPA 5B6JA 1Z15A 4M83A 3DZFA 5D3MB 4QVIA 3G6KA 1ZUD1 4CDGA 2PRKA 3QFCA 5ALEA 1ZN7A 2IOFA 3WK6A 4C0JA 4CZ2A 5EI5A 3WICA 1I5RA 3F3MA 5GVRA 2LVBA 1S2MA 5BW4A 1W6RA 3CW9A 4EY4A 2QMQA 3OUUA 4KQEA 3T95A 1SKYE 3DPSA 4BLVA 3OURA 4UATA 1JZSA 2VCEA 4KO8A 4M60A 3CUUA 3VI3B 4O2AF 1KQSB 5TF4A 2CVQA 1T9AA 2G7ZA 1ZA2A 5AW9A 3IC5A 5M34A 1XEFA 3O8LA 3FOAA 3TUZC 5FPHA 3UJ9A 1V11B 1Z74A 1JDVA 2V7QD 2CNDA 4M2LA 1X0XA 3Q40A 3LPCA 1UJBA 3FM9A 4LN1A 2ONCA 4M89A 4TWIA 1Y0BA 3TLBA 3NVMB 1T1JA 4O2AB 3INTA 2Z2IA 2OG2A 1IN7A 3W5SA 1MVOA 2WP0A 4A10A 1XZKA 3MSXA 3BKWA 3AB7A 3DNMA 3Q5GA 4C3ZA 5JANA 3ET5A 2E4AA 3K8ZA 1KFEB 3IKJA 3LZCA 3NDJA 3QTBA 4NCJA 2X0KA 1CKEA 1KFJB 5CVDA 2BPOA 1NVGA 4JJ6A 1JIXA 3OKAA 1NXSA 3GQVA 2WFMA 3TVDA 2LWIA 3D4BA 3MGKA 1IHPA 4RQAA 4BE7B 5EINA 1N6PA 3VR6H 2VJOA 3JU4A 4DQVA 2ZCVA 1Y4ZA 3GRYA 3VDXA 1L4BA 2IEGA 1V3TA 5BUSA 5IF3A 1P7CA 2IY8A 2AE2A 2Q1TA 2VJPA 3I9NA 3OQIA 3I0ZA 2Q1WA 4U2KA 4D4JA 1TTTA 1FF9A 1NU6A 4ZIRA 1K66A 3RV3A 4RXUA 3O1IC 5HF9A 2OKCA 1WL8A 3EYWA 1H5QA 3GO4A 3KJQA 2FEMA 4BJ3A 3KKKA 4M4SA 2EJVA 3AIIA 2Z5GA 1RRKA 2ZBGA 3JQ8B 3ZNOA 1LI4A 1XNJA 1GNVA 2BFWA 3WQBA 2Q4DA 1SK9A 2Q5OA 3PX7A 3RY8A 2XNHA 1PSZA 3MIZA 4TV9F 1CZUA 1G2IA 3RSZA 1R6UA 1W1WA 1ZGJA 4HZIA 4M6WB 4BVKA 4E21A 1IH8A 1UBNA 5LLDA 5J23A 1GCIA 2F8SA 3VO1A 1A7KA 1N6IA 2VBIA 3EYAA 3GMIA 1EXNA 2H5IA 1WUTA 2KLBA 2QPLA 4GRIA 5FUYA 5B4VA 1R8JA 5BR1A 3CLRC 2H00A 3UA3A 3KO8A 2O8VA 2VZ8A 2PMFA 3L7KA 3O3OB 4JSYA 4QYTA 1EM8A 1BDJA 1JMVA 1QQ7A 5BYBA 1JE1A 4LHYA 3V00A 3C3WA 3D3WA 4L7QA 4W6QA 3LDFA 3E0XA 1T4MA 5EIAA 5IYWA 2XQIA 3MG9A 3TINA 5A4AA 1N4DA 5JC8A 2MMGA 1JG2A 2D5CA 2YV3A 3GN2A 3SEFA 3I58A 4DJTA 1Z6AA 2Q27A 4G56A 4MUMA 3NIWA 2X58A 4AG3A 1ZRMA 3ADKA 2NU6B 1SULA 2ZRLA 4YRMA 4D74A 4KG7A 2G04A 1P0MA 2GMWA 4B5LA 4D8YA 4Z9FA 1IZ0A 4DRXB 2IP4A 3HBFA 4F4HA 1Z5VA 3O0TA 4QUIA 3SE0A 5A0VA 2I2XB 3AB8A 5JDIA 4IZHA 4ND7A 1XCOA 1ZFNA 3N7UA 2YCBA 3R5XA 4KUEA 1LWNA 2A9KA 1SOWA 4G63A 4RKYA 1ZSVA 5DWDA 4ZA2A 3LVBA 1J5EB 5A02A 2GFIA 3HO8A 3UMVA 4RAQA 4C4RA 1ODLA 4L78A 4M54A 4FXUA 1JEOA 5FPSA 1C29B 5EWJA 4QRIA 2C3PA 4H7IA 1RAHA 1GA4A 3O74A 4AQ7A 2PSFA 1NRJB 1UXOA 4K9RA 4RVDA 5C4GB 4OGKA 3CPJB 4NCIA 1ZIXA 4NRDA 4KLRA 4BX8A 4LYYA 2ZKLA 3OZWA 2RJ3A 4R1PA 3UV7A 3SVTA 4EABA 1RHUA 2QS9A 1DTEA 1QPZA 1ZEJA 5AKLA 3IEXA 1KMHA 3OOSA 3D31A 4K9LA 4OFXA 3U56A 1C4XA 2PGIA 4P3KA 1JLMA 1M72A 4GXRA 1XCJA 4GC5A 5FBHA 1UDWA 3RNOA 4M7PA 1FDWA 1T15A 4BQOA 2E5FA 2J87A 4CKWB 1IBSA 3TX2A 1EFCA 3WNBA 2EQ5A 4NJMB 4IG9A 4AWBA 4FQ7A 4ND1A 2C3UA 4E30A 4DDUA 4UNRA 1N57A 3AWIA 3E4DA 4KAXA 2WTNA 3IA2A 4NOKA 2PRZA 3T0FA 4F04A 1H85A 2JCSA 4UMEA 2A1TR 1JVSA 3H5LA 5C80A 1QG0A 2Z9BA 3VH2A 1ZKDA 1QVRA 1KSFX 1XVLA 2GJ8A 3BH7A 3ROQA 5DWQA 1Q1NA 1VQLB 2P68A 1P62B 4HVAA 3NKLA 2WE8A 1PL6A 2GPJA 3D54D 4KI7A 2YHBA 4QUJA 5K9ZA 1ORDA 1OV4A 3Q6IA 1YJ8A 1UPXA 4ZMSA 2ZRKA 3OCYA 3AR4A 4G0QA 3HP1A 4HDKB 4KMRA 4ZJPA 4DUZB 3H18A 3SSMA 2XXJA 2Z2JA 4GNRA 2OILA 4P53A 3J81A 4ROSA 4KDFA 4OGGA 3N7TA 2WKWA 1QCDA 4LVNA 5ITWA 1VJSA 3DPUA 4CQMB 1OA0A 1RWVA 3R6TA 2DBZA 5DM1A 3EXHC 1OREA 4CYMA 1FFSA 3GH1A 4F3NA 2BFNA 1XU7A 3LCMA 1GNQA 4GLLA 1QHXA 2YJGA 4YJ2A 3U48A 1BC5A 3GJTA 4LF4B 3EZYA 4YAJA 4C4OA 2PXHA 1YBAA 1V37A 3CRNA 3WDKA 2CHFA 4H7PA 3FJ1A 1WDLA 2HMYB 4OI4A 2QJOA 1R9MA 1CP2A 2FWMX 2XWQA 4XCVA 3H1GA 2CXTA 1QV7A 4Q0MA 1YKFA 4IW3B 1Y6FA 3N5KA 3P4UA 4MV6A 2AT1A 4XYMA 3GVCA 2NMVA 2LGJA 4QGAA 3PA2A 2VYND 3N6RA 3COWA 4TV9A 4LOJA 4GPIB 3M6LA 2D8MA 4DQDA 1EK5A 4W1SA 3TQQA 3E2IA 4RK4A 1AN9A 4AW9A 5KX5F 2PY6A 1Z2OX 1P2TA 1YOVA 4XR9A 3WYFA 2VEDA 4F12A 1V9LA 4JP5A 2H4JA 3CZ5A 1X7HA 2Z6VA 2P27A 4HBGA 5JXIA 4ER3A 3HJHA 1U3WA 5AVWA 3Q0IA 4PLPA 3I76A 1SC3A 1HBJA 3U3ZA 3DLTA 1NVTA 3IAM1 3OPMA 3G8DA 3DT6A 3ENZA 4WH0A 4TUYF 1CEXA 2DPHA 4HEJA 4PVCA 4F2HA 2MR6A 5J4VA 3HDQA 3IB6A 4CEJA 3BE5A 3OJFA 2PXAA 2HB6A 1KVRA 3FVVA 5JVDA 2REQA 4LI3X 2RHJA 2PBRA 5CMLA 4KTTE 5F64A 1JN0A 2CXXA 1G60A 2CXOA 4ARBA 2I91A 3CLUD 2HLDD 1N5IA 4WA8A 4UXIA 1VFNA 1EFTA 4OATA 2C4KA 4TUYB 3QMPA 5EIWA 2NUAB 3I5YA 4RWEA 3VZRA 4G25A 3E0QA 2ZWPA 4CCSA 4HGNA 2PYDA 4RUKA 1Y33E 2LD4A 5FPPA 1JDPA 4BVBA 3NOVA 5F5XA 5COQA 3WDMA 5F9FA 4B32A 4B6FA 3F8SA 2B2CA 4D9KA 3EZ7A 1U8AA 2QDKA 2ZSKA 3IAXA 4RHEA 5LP6F 4NMLA 1J0CA 5EXEA 4ZCSA 4OOFA 2D8AA 4X06A 2X77A 2GRAA 2JCXA 2WVHA 3A1NA 1B1AA 2GPWA 4O25A 2QVBA 5KWIA 1EUDA 1Q0ZA 1XRLA 4RIEA 4TTVA 5EXPA 4N40A 1SBYA 3U0VA 3O8OB 4DRYA 1DS6A 2WAMA 5THQA 3LC1O 1LDMA 2ZPTX 3RFTA 3W7VA 5LP6B 1AM4D 1XZ8A 1F17A 4QT4A 2YXBA 2ZRNA 1QHHA 3OLXA 5I9IA 2GYUA 4GRAA 2H4XA 3IP9A 3TLAA 1E1RA 2YR0A 3EZ2A 5A7HA 4P31A 5FWYB 4YT5A 2YQ4A 3VAYA 3FVTA 4EFMA 1HL7A 4QC2A 1QTNA 1RQ7A 3ZIAD 4D92A 3B3GA 4R8RA 2FR8A 5K8LA 3GUCA 3KG2A 3K9WA 3P9IA 4XDGA 2Q0QA 1O94C 1V1RA 3ILHA 3ME5A 3SX0A 1J97A 4BO4A 4RM2A 1AQLA 3B5IA 1EUQA 5D6OA 1PQYA 2FRDA 3WV4A 5EUQB 4RTMA 3CPEA 2YRWA 3OOJA 4I46A 3IALA 1UXGA 4QEKA 3QU5A 3OZDA 1VL2A 3JYNA 4HE5A 5FTKA 3EC2A 4MR7B 4R0MA 1OD6A 3CIOA 3N86A 2B1IA 3ZDXB 4PCUA 2IZ6A 4D43A 3HKCB 1WX1A 1TFUA 4FCVA 1PLKA 3VYUB 2WAYA 1XZDA 1SVKA 2AJTA 4IJKA 3BS4A 2I4TA 3DCNA 2ZQ5A 1JW9B 4C7KA 3GAFA 5IJXA 4CFSA 5L9AA 4DV0B 3QXHA 4MR9A 1Y8AA 4DUYB 1OX4B 2WMNB 2AL7A 1SC6A 3A27A 3MUNA 3RYCB 2WMOB 1G8YA 2R1TB 3IULA 3K15A 3C3AA 3MWEB 2KSQA 5BSGA 1EP1B 3HFGA 2B1GA 4KGXA 4NJEA 2CXNA 4XB1A 1SRRA 2I1WA 3TYXA 3ZCXA 4BMNA 5C2JB 1PJCA 2CV1A 3HY6A 1R6BX 3FLEA 5D51S 2QLNA 2ZYVX 3RIYA 2P5YA 2JIBA 4HGRA 4R31A 5EWLB 3AFGA 4E70A 3GD5A 4H6PA 3CQ9A 3DAPA 2WF8A 3TLGA 5HEKA 1LB1B 3H6KA 1C0LA 3TIVA 1YJXA 3ETGA 5ITZA 3QGMA 1GCOA 5FTLA 5B3LA 1IULA 1U28C 2BGNA 5EJ9A 4QG3A 1G9XA 5CDFA 1KH1A 5KI6A 1L5SA 1YCHA 2VOEA 2ZYAA 1E2IA 4WESB 5DM60 5JXWA 1KPHA 1GFZA 4RY8A 5GJBA 2BFOA 3L6EA 1GU7A 2W98A 3LQEA 1XTUA 1U7XA 1RXWA 2QE6A 1DG1G 1GN9A 1NUTA 2GN0A 3VU9A 4J0IA 3VX4A 1J0DA 5LUBA 4BNLA 1USGA 4EOGA 2DPGA 3QWAA 1NDQA 1PEKE 3CX3A 3CN7A 1IMJA 2W6JA 1NHWA 3PUKA 3NDBB 5E3JA 2ZAYA 4UUBA 2BFFA 1DOZA 4LBZA 2R66A 4GI2A 3F1LA 3TNYA 1TZCA 3QXGA 1NN5A 5AUNB 3AVXA 1HDEA 1GY8A 3I3OA 1X74A 5FCDA 3FDZB 1U3VA 1PX0A 4JMPA 4MKGA 4XB6B 2HCTA 3SC2A 1DINA 1AK2A 3KOZA 3TSCA 2ACWA 4GLFA 1CRLA 3HCEA 4OHPA 1QZUA 2GEJA 2Y1XA 2H1HA 4EF5A 1NT4A 3GOQA 3KPUA 4OL9A 4PQYA 1PGPA 4DQKA 3AHGA 3SI7A 3BHIA 2OXRA 1KAGA 4LE2A 2GEDA 3CEHA 4RVFA 5TIIA 4F46A 1GZVA 4HN4B 1DO2A 4ZHQF 4B8WA 2HU7A 3C97A 4KWTA 2DSNA 5EZYF 4BY9E 5B2EA 2RK3A 1T5TA 3R44A 4XYLA 3RADC 2F9LA 3IEKA 1SB8A 3H65A 2FPGB 3AG5A 3HADA 3JD2A 3N2EA 3PRKE 4Q05A 4GM0A 1P77A 1CZHA 3GLVA 5L45A 5KOJA 4XDYA 1R18A 1RKUA 2PZBA 5BWCA 1TUEA 4ZHQB 4IFIA 3S8MA 5EZYB 1CG6A 3DBRB 4UVEA 3KWLA 4YJFA 3CMMA 1ISPA 1I4EB 3WP1B 2W2XA 2ZSJA 3HDTA 4MP3A 2I2DA 4QDTA 3KQPA 3OJ0A 1JP7A 3PHLA 4XQCA 3KQSA 3PA1A 1KDPA 1KGDA 1RXEA 3AP3A 3ABZA 3IOMA 4KYUA 5FLEX 4DSAA 2VRBA 4RE5A 2C31A 3WVNA 4JI5B 4DWJA 3T0IA 2YYSA 1W6UA 5EEGA 4DR2B 2GSWA 4MV8A 4WK0B 3AUJB 1D6JA 1IOVA 4FE4A 1GZ4A 2ZXHA 3D59A 4RY2A 4TSFD 3BMQA 1QRRA 4QU0A 4Z7NB 1X77A 1ZPDA 3K6SA 3MSCA 3FVQA 4X8LA 1EDEA 2ID7A 1PW5A 3BAFA 3VVBA 4ZVNA 4BGDA 4L8FA 4ND2A 3LUGA 1ZK2A 2V7UA 3EGDA 3ANNA 4ARCA 3FCYA 2DUMA 1QNLA 5L7TA 4RACA 1G7TA 2WM2A 4MOWA 3AVWA 4LQCA 3PUZA 3LGXA 1C0KA 3RK4A 4EX7A 3WY9A 5JT1A 3RVNA 1OROA 5CVCA 4AMBA 3Q7PA 5ELXA 3TQIA 1A5TA 2V9PA 2OBRA 3HVKA 4C4SA 2WIKA 3GT0A 4XFJA 5HKLA 2J3JA 2K5UA 1ETHA 4Y2GA 3UNXA 2VHVA 2IU6A 1YUMA 1ZM2A 3D3NA 4RH0A 1E2NA 1DX4A 5CGZA 4YIKA 1YGYA 4QEDA 3TSAA 3AHIA 5JSZB 1QO9A 1WD5A 1LEHA 3UUWA 3CXRA 4J07A 5IYQA 5FKJA 3VNSA 4GH5A 3ONDA 4RABA 7MDHA 1NSFA 1L0BA 1QHEA 1STOA 1TUIA 4L9SA 3STVA 1XKQA 5FV4A 4BZPA 4EY6A 3LT4A 3RKRA 3ZHRA 4X0CA 1T9CA 1MU0A 1RJDA 4P3PA 4C22A 4H1VA 1ZZEA 4K3VA 3RUEA 4EJSC 1IB6A 1RE0A 5HS4A 2GPYA 4HIZA 4KYVA 4UNSA 2A35A 3JZMA 4ZZ2A 5ALPA 5JPIA 3VR6D 1ZHHA 1ZM9A 5F78A 5LP6A 1D8AA 2E6UX 1YIJB 4YLGA 1KVSA 1RYYA 2O07A 2ZSFA 3K4HA 2J3HA 3QVTA 4MZXA 4O4HA 4QOSA 4D97A 2XUQA 1E3ZA 4WLUA 5C1DA 2Q6VA 5IJ9B 3KOYA 4FR5A 3T4EA 4ZXPA 4G81A 4QRDA 3ZGNA 1EZ1A 1RI1A 4EVRA 1ZRHA 2GZRA 4K86A 5E7QA 4KQCA 2R00A 1N06A 2O2IA 2WA2A 4CV1A 5JAUA 1LFAA 2AUMA 2PWYA 4RQTA 3K5HA 4HQRA 1CVLA 2HQSA 1SIWA 2BRUA 3WQQA 2VXBA 1FXSA 4D82A 1NY5A 4D3FA 4E07A 4XLCA 1IWBB 4XDHA 2PNJA 2H3EA 2HY7A 2Z56A 3GCDA 4YLEA 2C00A 2AJ8A 5A0TA 5CD1A 2ZZNA 1CY7A 2W00A 1VKZA 2J85A 2A59A 1N3IA 2HMSA 3T1OA 3U3MA 3F5FA 1SZCA 1E5XA 2W6NA 1E1DA 4CKEA 2E4WA 3QLVC 3GF4A 1WD7A 4G2NA 4L95C 4TXMA 4TM8A 1F2TB 1OZFA 1YR2A 2PQ6A 2EOAA 1Q2XA 2ZSHA 3QV2A 3UKOA 1HE3A 1PR2A 1YI1A 4P7GA 5HJ5A 2IIBA 4A1OA 1GAWA 3DBHB 3JYHA 2Q0SA 2HWUA 3LKBA 2TMKA 2YXNA 3WOHA 3TJZA 1H0SA 1N6OA 2VCHA 4CMKA 2HSJA 2FFBA 3NQ41 2CLHB 4HH3C 4LJAA 2UZ4A 1RWQA 3E18A 4XJTA 2ZUFA 2EKPA 2C2XA 2VUSA 5B2ZA 2ZBRA 3T9EA 4HDNA 5DTMA 4OJMX 4D44A 4FW8A 4NSNA 3OQ1A 3CVUA 4FD3A 1A5SB 1T1GA 2AKYA 3VV2A 3VTAA 3ZJVA 3N58A 3WO1A 1IOWA 3AR2A 3KFXA 2Q5LA 1UBJS 4WCFC 2Z4SA 1DZ3A 1NJGA 1QTQA 2PSEA 4XIIA 3W7BA 1VMIA 4PC6A 4H77A 3BZUA 4GPZA 4TYQA 2VJMB 4MQEA 2P9HA 4UAVA 5CX1A 5JCZA 3QKUA 5BOVA 5L95A 5FULA 3EGWA 1UBRS 2B1RA 5FR2A 3ELYA 3GT3A 4Q9DA 3TDMA 3IA7A 4R01A 2J0UB 3ACCA 4FYIA 3HC7A 5SYNA 2J6IA 4CM8A 3R4CA 2P1ZA 2P2NA 5DN9A 1BXGB 5DEOA 1S8AA 2IEAA 1TT5A 1J8VA 3FUXA 3LHKA 4LBWA 2FZKA 4RZ2A 1VKRA 1JKJA 1QIJA 1V0EA 1H2AS 4JVSB 4D26A 3ASTA 5IM4F 3ZXIA 1YK0A 1H5UA 1W2HA 2HBZA 3OY2A 1DBWA 1MRSA 2VH5R 2W2KA 4I1VA 1SM4A 4F4JA 1L5FA 3W8DA 1Z4PX 5E1BA 4X1YB 5B55A 1WOMA 5AMXA 1WXEA 4XOTA 3BGVA 4OFWA 5JYDA 4DGSA 1X1TA 2H4HA 1E7MA 3DULA 4KVZA 5DW0A 4BC0A 1G21E 3PV0A 4JLKA 2FDCA 1DKPA 4N5DA 1U9IA 1U0SY 4JBYA 3DDUA 3FCSB 4JYMA 3EGVA 1ZMTA 2YWCA 2FFAA 4DW8A 3BL8A 2PVPA 4UM9D 4Q9LA 4KPGA 4A92A 4AMVA 3F0TA 2PEZA 1HI9A 3BWBA 1PJLA 3D2BA 4YUZA 2WB4A 4H7DA 1UMCB 2EAUA 4UMFA 5IAEA 3BEDA 1GILA 2NXNA 4M1YA 5IX8A 3AEYA 4N6OA 2XTNA 4P5DA 3FCCA 3D7RA 3BIWA 2IYTA 2EHDA 3NCTA 4Z4YA 3T56B 5HVNA 1UBOS 4E88A 5M04A 2AR9A 3KR1A 1PYOA 5HUHA 1K75A 4ITVA 1RBMA 1AGNA 4UCXA 3E3AA 2ERXA 2QZ9A 4D3DA 4QFCA 3GQBA 4CM3A 1HUQA 3AIMA 4XUGB 3QXXA 2HKIA 1TMKA 4GSYA 3GH3A 3SXPA 1EWKA 1KQPA 5B30A 1V4VA 3DNFA 4WDRA 1X87A 2QROA 4GMDA 4TROA 4M0MA 4F9EA 1XDSA 3WNZA 2CFTA 2WOOA 3A4MA 3LUAA 1F5NA 2FSFA 1V48A 2FPRA 4KN9S 1Y89A 1GTL1 2LKCA 4RFLA 1WBBA 2HBYA 5IBCA 5AR1A 2CCKA 2KQUA 4EBFA 3IPCA 4TRJA 1ZD3A 3RSHA 3HYRA 4K03A 5GVSA 2XGJA 2WJGA 3AQ4A 3SD7A 1WCXA 1US8B 4AIRA 5BMVF 2CLEB 5EMLA 4TLCA 1C3OB 3PUIA 2PVCA 2MSLA 4RYDA 4C7OB 1DIRA 1DBVO 3AW8A 3FOBA 1ATZA 4YAGA 3GAMA 4B6PA 1TRHA 3IQHX 3KJFA 1KVQA 1ZVJA 3N2NA 4CE6A 3I3SR 3KD3A 4UZFA 3JQCA 3EFEA 1YZLA 4NYJQ 3TDKA 3WI7A 5BMVB 2LUOA 1FSPA 4D6PA 4B3SB 5BORA 5JPCA 1L7DA 1EWVA 2JL1A 3WP0A 4FGJA 3PDUA 3ZEIA 4DOMA 3Q15C 2XWJI 3EEYA 2VT2A 4Q9HA 3C1OA 4YCAA 3DLAA 4JBNA 1QF6A 3LC7O 3NHRA 4BNYA 1I3NA 3VR0A 1MAHA 1CT9A 5TQJA 4ZAWA 3A1WA 3H42B 2H9AA 1JBQA 4NCKA 3WRVA 2R4QA 3H7IA 2O54A 1PQWA 2BFCA 2FU5C 1XZGA 2YX1A 3O2QB 1OXXK 5CU7A 2X0DA 3CX8A 3ZD9A 1NMQA 4D7AA 4ALLA 4JT8A 3T5CA 1E2BA 2P9YA 2QTRA 3ETLA 3OQHA 4Q7MB 3QPVA 4IHKA 4XDZA 4MVWA 1SBQA 4PYLA 1NI4A 4DMUB 1JXOA 1N92A 2GRUA 3I2JA 5J2TF 3TW8B 4F9GA 1OBCA 2F3UA 4L5YA 2O8DB 1RIFA 4E5UA 1CUGA 2CNLA 5DCWA 1BD4A 2FR1A 3O94A 2Z2KA 3LZ6A 1EGVB 3MVEA 5KNBA 2JGDB 1R4NB 2BONA 2WM9B 4WZBA 1SUPA 4EB3A 3W5HA 4EUNA 3ZUGA 1F3LA 3GVHA 1L8QA 3WLOA 5F23A 1Z25A 1ZGGA 1N2GA 1R8SA 3Q1LA 3OFVA 3CPSA 1KYWA 1G8AA 3JWHA 4KRXA 4LHEA 4MMXB 5DBOA 1UCFA 2HIHA 1NQWA 1RLIA 5ILGA 3RFVA 4BO6A 1DEXA 4O2RA 3MB8A 4QNRA 3KWFA 7MHTA 1OT3A 1B41A 1AX9A 4OOSA 3HCCA 4HDRA 2FMXA 3UGTA 2KB0A 3WL5A 4DLPA 2C07A 5ALDA 3EBLA 3ED5A 2FPXA 2OECA 5FD8A 3SZLA 2L19A 1SPXA 4FK8A 2FEWB 2C42A 1GEGA 2Y92A 4NS1A 3RHZA 1R0KA 4BV8A 5JEDA 5KWSA 2XT0A 2PTGA 2FN8A 3O8RA 1QH0A 3L8YA 3LY5A 1VA5A 2IDJA 4L6CA 5ALMA 1T5HX 5AM0A 4JQYA 1DPFA 3G9TA 2JC3A 4Y6OA 1JR3E 2P79A 4OK3A 4UNPA 3ZWBA 4MS3B 3G9QA 2BEUB 3FPHA 1KQNA 1RWBA 3ENQA 4ACAA 2SECE 3M82A 3DDCA 1YT5A 5I8PA 3NDRA 3P9XA 3U7HB 4TKUB 3VHLB 3R7LA 1V11A 4W7SA 4C04A 4U02A 2JIQA 4GX1A 4I1PA 3NUZA 3FRHA 3E7DA 3HXPA 3VSAA 2YZKA 3B20A 3P94A 2O3RA 3TLYA 4M9SA 4P4SA 5E9AA 4F96A 4E4YA 1UDRA 2N42A 5DRTA 3AOEC 5H3CA 1F8XA 5EHIA 1QMGA 2AEJA 4X95A 1EA5A 2QVCA 3MTAA 1E3LA 5J9FA 3ZN2A 4S04A 3I4CA 5E6RA 3RODA 1R1DA 2P30A 3PDIA 4HL6A 1I13A 2RE8A 1VMDA 2CWDA 5TEWA 4E6PA 4Y9TA 2O5EA 5IG2A 1Y3BE 2JFQA 3TDNA 2ZI9A 1EX9A 4HUTA 4KR3A 3OPXA 3BGDA 4FZJA 3L05A 4BMPB 1JIJA 2CHVA 3BCRA 4WJLA 1F8GA 2B30A 2XYGA 1B2RA 2PKQO 5CLHA 4A2CA 1PEYA 1M1NA 3PLRA 4MO2A 4YUYA 4C5CA 2IDMA 1Y1SA 3LYAA 4F4UA 3AKCA 4F5ZA 1WJGA 1EYZA 4U7DA 2J45A 3PT9A 2HWYA 2HHCA 2ZBDA 4JC5A 4XWGA 5IYZF 4CU2A 3FA2A 1XA0A 3C16C 3H3FA 4Y7DA 4PS0A 4KQ1A 3B85A 3MOGA 4L6AA 5WRFA 3V8BA 1U1IA 3ZU5A 1MG0A 1Q3KA 4TWZA 5TC4A 4KGVA 2FHPA 4RJ2A 5AFSA 3MCZA 3B7WA 5JS8A 1Z4QA 4YPFA 3JQ7A 4H6VA 1BDHA 3ND5A 1NF3A 3A1UA 3SHOA 2IUYA 5IYZB 2WMYA 3K73O 4TMZA 1USKA 2P4HX 2QSZA 3AUKA 1FBTA 1M0WA 1L4KA 3K2IA 4UTZA 1D2RA 1XK6A 3BE4A 3GFVA 1WLYA 5DYGA 5E9QA 2C77A 3L18A 4HS9A 2CHEA 3HSSA 4K2AA 3CKKA 2ZIWB 2NQTA 1Q86D 2NT4A 1IUPA 3KKZA 3ANTA 3F71A 1Y42X 3HJCA 1JB9A 4OOVA 4YP7A 2PTHA 2V4MA 1IWPB 2CDNA 1A71A 1FP7A 4HRVA 4AICA 4B9AA 2BHSA 4MRSA 4AWXA 1E9DA 1PAUA 3OKCA 3PFIA 3ESRA 4KXWA 4WGFA 2WIFA 5FDFA 2BBTA 4PQRA 3EF0A 3DFUA 3DNPA 4R9RA 2YWHA 5KTTA 3ESQA 4AULA 4BNNA 1JI0A 1N7IA 3EVGA 5F1YA 1UKAA 2GN2A 3DBOB 4TYMA 1KKMA 1KSHA 1YFLA 1L7PA 1OH7A 4G0ZA 4UDXX 4QPDA 2D0IA 1N6LA 1G5TA 4R7GA 1P4HA 4DYVA 1JSXA 2J09A 3MQ2A 4Y2VA 2E4UA 4BMCA 1XTBA 2NU6A 3EIEA 3GG9A 3K7EA 3RKUA 1XEAA 4GE0A 3VR2A 1TTQB 1A97A 3ZU6A 1KK0A 3OCUA 4L5CA 3PITA 2BGWA 5BSEA 3TFOA 2H7VA 3WWEA 2I2AA 3AUAA 2QQGA 5GZ3A 5K4GA 4ADSG 3AJDA 3E61A 4YRFA 5H02A 1G7SA 1RRPA 5AKXA 5J40A 1LH0A 1BNCA 1JEQA 1G20A 4JLBA 3IV6A 3B6JA 4FKMA 3MB5A 4XAQA 1GVNB 3L1HA 2FPMA 4BVAA 5ICSA 2BMDA 1VE7A 3B6IA 4AS3A 1O8BA 5TPZD 2GCIA 2QT1A 3C7KA 3GEPA 4D4IA 4DSNA 1D5CA 4YCSA 2VSFA 5DBEX 3CTPA 5B7NA 2IK8A 3KXPA 6CHYA 3RKSA 3HJFA 1J6UA 3GB9A 1TFRA 5JO9A 3GGCA 2NU7A 4GEGA 4BDTA 2WJHA 1T1RA 2Y1WA 4O59O 4PLTA 3OFNA 2NU9A 1D0SA 3RTBA 3W90A 2TYSB 1KEPA 1S8FA 2QG4A 3IE0A 4L9AA 2QAGA 5FOVA 4B3JA 5JISA 3A8IA 1A96A 2O2XA 3MF4A 3U17A 4N0PA 4PBSA 3M81A 1DKNA 2QR2A 3JVEA 4N03A 1DOAA 2O3SA 4K40A 3HNOA 1ZD2P 2W90A 3D02A 4JZYA 3EZLA 3BFKA 2DHRA 4LQ4A 4QVGA 3TPFA 2R2GA 3AESA 3KAJA 2C8JA 4CCYB 5EWMB 2AOTA 4BGUA 1QGED 4FT4A 1ZICA 2GN9A 4CCAA 3GRAA 3CCRB 2DERA 1G3UA 2JH8A 1VQKB 3GIWA 2AD1A 3HQ4O 1JZQA 4NBTA 4XQFA 5GGXA 4HEQA 2WJYA 2YS7A 3KV3O 4PC1A 1CQIB 1H1TA 3DLPX 3O8QB 3LF2A 3Q7IA 4FZ5A 1I10A 1OAOA 4WKOA 3T9FA 1I3LA 4NBUA 4DAOA 3DTVB 3ZKAA 2C7GA 3CNLA 3AVPA 4NBKA 2A9FA 2ZRGA 5CYFA 2AUTA 2HJ9A 3AM4A 3GJRA 3IMEA 1UMBB 2W2NA 4ZGWA 2NTEA 2P2ZA 2KWIA 4LDRA 4PLZA 5TF0A 3TBFA 2KYRA 2F1MA 3CUEF 3LCUA 1F1JA 3AHDA 4MYTA 1QFMA 2P4UA 1QG4A 3IBTA 4HGOA 4QOEA 5BV7A 3EXEB 3IKLA 4IDFA 3GJ0A 4P4NA 7GPBA 1R4AA 2PNFA 5CD9A 3FHJA 3QUSA 5AP9A 2BEKA 4QOHA 1VKNA 1F8FA 2MYNA 4MCIA 4QHSA 2YFYA 1EEXB 1XZAA 3WKCA 5TT1A 3HNPA 5ALLA 1Q50A 3HMKA 1YDGA 2H2DA 2PJZA 1FVOA 1XAIA 2RAUA 2I03A 5DBGA 1QF9A 2JEYA 1VE9A 2KX7A 1WO8A 1PN3A 2XUHA 4G7XA 1ESMA 3FZEA 3ODPA 4BAGA 3IR5A 4OP1A 2X15A 1F8UA 2P2YA 1P2VA 4G26A 2LIPA 4ZN6A 4QVAA 3WX0A 4TMTA 3I52A 4L8JA 4B3IA 3EN0A 4EEKA 1KTIA 2ZCJA 4IDQA 4KE7A 3H9CA 4WOPA 4RWZA 4M8NE 4EAQA 1U0NA 2WQZA 5J35A 3AHEA 3HJTA 4LKRA 1N32B 2GK7A 5CXXA 2CLKB 3RYFB 1M3SA 1FP4A 2DHDA 3Q6QA 2BP7A 4J75A 3REFA 3GLGE 3UF0A 4N7MA 4IHJF 4ZZ0A 1O95D 3EX7C 5JEEA 2ZGVA 2BF7A 3G0BA 2VWQA 3MS2A 4BNMA 2F62A 2G0TA 4X1KA 4PFJA 4B2IA 1Z75A 1L1FA 1CC1S 3DONA 2YV5A 1XZBA 3GD7A 3OZCA 4NYJR 4C4AA 1FW6A 3LNTA 3PF8A 3C3CA 4PRZA 3BD7A 1AMNA 1PFKA 2Y76A 1DBQA 3G1WA 4IHJB 2EQAA 3C3YA 4A5OA 2R96A 2H9YA 5KWVA 2Q6TA 3A06A 4YJ3A 5DPMA 3EAGA 2DKNA 4F4IA 4XFDA 5EFOA 4BX9A 2VN8A 1C9EA 1SU8A 1ZN8A 2CL0X 4UULA 1SHJA 2E1BA 3SIRA 3GELA 1U04A 3V4FA 5F4ZA 2YJTD 4KLAA 1EVEA 4W5TA 2CLIB 4TYWA 1EGHA 1MJFA 1M6WA 1PWHA 1DKRA 1COWD 2UUOA 3JRNA 1EXMA 1HRKA 1G3IA 1F2UA 4BCCA 1XTRA 1JHAA 4FU0A 2HLNA 4PSAA 1IUNA 3F74A 1VQ1A 1OSNA 4I66A 2OESA 4ZVPA 3OOYA 2NU8A 4AYXA 4ZYWA 3TNDA 1JU9A 3U6KA 5EJ2A 4ANFA 3BXGA 1XQ1A 2D7DA 2ZK7A 3FNHA 1XJQA 3AJRA 3MRTA 1HL3A 3DD5A 3TZBA 5MF6A 2PL9A 4XSGA 2Q1UA 2PS9A 4YP0A 5DYNA 3PA6A 5BWMA 2SKEA 4FN4A 5GTDA 3LPLA 4JD5A 3T3OA 4IS2A 4P81A 5LFAA 1Q7CA 3DOFA 1DSSG 1DC8A 3DKIA 4G1MB 5FRDA 3ROEA 3K9NA 1DJMA 1PTKA 4C1NA 3H1EA 2E3JA 1SRQA 2CMGA 3EPRA 2EX4A 4LXUA 3QLTA 3UXHA 3JZIA 3A8KA 3ISTA 5A7FA 1QORA 5BV1A 1QS0B 1GG5A 5H81A 2JLVA 1Y9EA 3W5VA 2OGWA 3OOCA 1J8QA 2NV4A 2BR3A 1AKYA 2GEFA 4FIZA 4ENUA 4NARA 3JAWA 4Y0AA 5CX4A 3VOTA 4QQRA 4S2EA 3GLFE 4M1QA 2RHLA 2C92A 1NBAA 3EVCA 4IS3A 4MRPA 5ISMA 1UMDA 2BKLA 3FBGA 4LRSB 3IHKA 3MYYA 2I54A 2Q4EA 5AI8A 1KL7A 3MZ0A 5ICCA 1IEWA 1Z0KA 3TS1A 3PBKA 5KWJA 1KEUA 3CTMA 3WB9A 3FWHA 1I4OA 3CISA 4CUKA 2J4FA 2VDWB 1Y80A 2OAEA 4JI6B 1V5FA 4XR6A 1W0CA 1FDIA 3GP3A 1U8TA 4RO0A 4OV6B 1KI9A 1TCAA 1RJ9A 1YZFA 3GLQA 2CVHA 4PY2A 3U1VA 2IGTA 1CIPA 1CUZA 4P58A 4QXAA 3VXKA 1C2YA 4V2UA 3IUJA 3KCNA 3KZCA 1AKVA 3IQIX 4MHSA 1OH5A 2R6AA 2C1ZA 3DE1X 4D8WA 2C94A 3GAZA 4L02A 3RABA 4D6YA 2WFLB 4ZOQI 3LHDA 1V5VA 1TVMA 4XPZA 1XV5A 2C8LA 1PKVA 3E70C 3HVIA 5I5GA 4OKIA 4A8JC 3NC4A 3FRJA 4DC0A 1KTVA 3G2OA 4NZZA 3MWGA 1PUXA 1NATA 1II0A 2XYHA 2JI4A 1LX7A 3SLGA 3K70B 3AMVA 3HB1A 5AJUA 2BCJQ 3TE7A 4BE9A 3ADBA 3GFPA 3V6MA 4J8PA 4ENVA 4LC0A 1SCJA 1TJYA 4BTEA 1D1SA 5JHGB 2YFQA 3WA6A 3ZBPA 1SQ5A 1Z2AA 5F1PA 3U9SA 3FCXA 5CXSA 3L7MA 4F6RB 1E5TA 1MOZA 2OM2A 1NMXA 4QUBA 1R9NA 5GWXA 4NAVA 3DLCA 1C8LA 2OB2A 2PFKA 1POXA 3O3MB 3V7AA 2XNSA 4G5SA 2ZB3A 2B4RO 2JJ1A 1CUSA 3HU1A 4F21A 4H31A 1RWMA 4UE6A 4QFMA 3KB2A 3R7DA 1R66A 4CQJA 1P5HA 1HA3A 2O7QA 1N0VC 3MTJA 1YVDA 3PPYA 2O0JA 2ON6A 2AMLA 4CG0A 2I3AA 4Q4DA 3PNBA 4V0NA 1NPYA 2C84A 3PKJA 1U8UA 3N2YA 4K6KA 5DK6A 3SNKA 1TD1A 4K6OA 4MGZR 3CF2A 3CRRA 5C3UA 2WLTA 3PTAA 4XW2A 2VS1A 5A88A 2VF5X 3AHHA 4WFKA 2QTNA 4DJJA 3INYA 3VU3A 3NGXA 1UIRA 3RRMA 1D2EA 1GA6A 2JLWA 1DLJA 1QTIA 1TJNA 4HXEB 3V9AA 5EMHA 2CFCA 3UGJA 3V2HA 3SKVA 3VYWA 3UOAB 4DMHA 1AKTA 4IF4A 3EK2A 5I7EA 3VR3A 4OXKA 3D6MA 1FA9A 3DBLA 3E3OA 2BGRA 3EZXA 5CT6A 3IYLW 4DZTA 1OI2A 3OQMA 1ANKA 3VDRA 5DNYB 4NQZA 4CI0B 1G55A 1LBEA 2CD9A 4D3ZA 1OYYA 1ORWA 5LA6A 2G40A 2ZT8A 4RVUA 3BFXA 5KSPA 4E4TA 3L9XA 1N2XA 4C7XA 4H3KB 4G24A 3AETB 1XLVA 2D0DA 3CP2A 3B12A 3W3AA 3ROZA 4KAFA 5FPTA 3DAYA 1VG0B 1W4BA 4WZLA 4KE9A 4EEZA 3VC1A 3FPJA 5AIBA 3UCXA 2QY6A 3CB4A 2ZPUA 3E23A 4FINA 4OB8A 5DISB 4I4TA 4B74A 1PNVA 4I55F 1GPKA 2QORA 2BCEA 2LDXA 4N01A 2ZM5A 1FYWA 1WB6A 4RCYA 2GGSA 2IKSA 3H11A 2PS1A 2X53S 4KH1A 1ZR2A 4B8YA 4QXQA 5ER9A 1JJIA 3AEXA 4KBYA 1KDZA 3AKYA 3NAGA 4MPTA 5FTNA 3UY4A 2GXQA 4I55B 4WXYB 3L4JA 2EXXA 3HUDA 1H9CA 2P9BA 4C08A 2I8CA 2O2DA 3TXAA 4QUZA 3MTEA 3CPXA 4WADA 3I72A 5KSOA 1E60A 1SXJC 1GLNA 2AK3A 2G36A 2M1ZA 4P4UA 4LF9B 5IM5A 3RU9A 3SZRA 5LKAA 5KTSA 1ORTA 2CL5A 3MIIA 4FPXA 3K35A 1G5PA 1KEEB 4K87A 3VU0A 1K92A 3HU5A 2BSQA 3GNTA 3TSZA 3EZNA 3ASZA 4RHTA 4LHVA 5DNEA 1P81A 3K0BA 3P19A 4MUGA 4RMHA 3WNVA 4U9HS 1LVHA 4DLZA 1CFZA 1YHZA 4IMPA 1KC8D 2CXUA 5HKKA 3BB4A 3D4PA 4Q03A 5DLYA 3QF4B 3H0EA 1JJ2B 1VMKA 2XIJA 2F1KA 1KK2A 2Q28A 4ZREA 3U44B 1VJRA 4PGHA 1CPYA 3FSJX 3M4YA 3QVJA 3WLAA 4HT3B 2RH5A 1EHYA 2VP9A 5IKXA 1IU9A 4CEHA 1D5WA 2QSUA 2FG7C 4QHTA 4NENA 2DHCA 4CL0A 2PQMA 1E1CA 2DBRA 4MQ5A 4OYHA 3I9KA 4R3WA 1XEXA 1DFHA 1XK7A 3C6XA 1N2CE 4MVJF 4NDZA 4L8LA 5FWAA 2PX3A 5F2KA 3UMRA 1I6MA 2AC4A 5L6MB 5F98A 2O19A 1EQ2A 1PJ5A 1YCGA 2X0JA 5CITA 2ZJ1A 2FMIA 3BTVA 1MOQA 2ALJA 4L4ZA 4NE2A 4YYEA 4UUPA 3FIUA 2HXYA 3FSRA 3LQFA 4K2HA 1Y1PA 3UGQA 1S7GA 1KK3A 3FTQA 3JALB 4FYKA 4XGRA 5K45A 4D4KA 4DIKA 1KDTA 4R7TA 1A2BA 1Q82D 1U0GA 3LVFO 4MHOA 4BEBA 3H3XA 1DWUA 4KLZA 1GGFA 3NC1C 4EB6B 2J31A 4KDCA 4V0KA 3VNRA 2ZSUA 5CR9A 1HLPA 4DNXA 1WQ4A 5FBZA 3TTXA 1CRWG 2PR2A 3C85A 5EA2A 3ILXA 4OUDB 3RS5A 4GUDA 3CF4A 4CN8A 1EQUA 4QOJA 3ZWWA 1JR6A 1N5MA 4I8IA 4P35A 4ZTZB 4DMFA 3S1SA 1Q22A 1S2NA 1P4AA 1PT6A 5DHPA 1F12A 3D4OA 1NNUA 1TKBA 2OK8A 3NRJA 3T41A 2JPDA 3CC7B 2M1XA 2MOKA 4QAJA 4W82A 4M46A 5AUPB 1G5IA 2PS3A 1O9BA 1Q1BA 2BM9A 1T6BY 2I99A 1XCPA 3LHSA 5E0KB 4X07A 3K0CA 5ICGA 2O4CA 1WUIS 2OM6A 3E9YA 3ZGOA 4QEZA 1M75A 4Y1EA 1QRUA 1ZIYA 3F6SA 2EFDB 4JYPA 5REQB 1UD4A 4JQCA 4LXYA 1CVIA 3KSAC 4OJTA 5SY9A 4ENWA 1QFSA 4BBPA 4N41A 3LTEA 3K8YA 3U4GA 3BL6A 1D9ZA 2C5GA 2D4HA 2DU8A 3EXFB 3HCRA 3NHPA 3NM6B 3ESAA 1MQ8B 3ZHCA 3DV2A 1P1HA 1L5HB 2Y0EA 4YGYA 1G291 1AY0A 2G08A 2PBLA 2I87A 2VYVA 3FYTA 2WTXA 3P2OA 4FHEA 4BQQA 3B82A 4PG6A 3E7WA 3IIKA 2QYTA 4RFSA 4IH4A 5EIHA 1TJ5A 2IPMA 3A70A 2Q5IA 5G1NA 4C3UA 2A9OA 4CUJA 1MTOA 3Q41A 4JJEA 4JYZA 4EW2A 1WZ2A 4J2HA 4HH4A 2YWDA 3I2HA 3CZ4A 3LDHA 1K8QA 4RTSA 3WL8A 5T8KC 1M2VA 3R9XA 2P77A 1KS9A 1L5LA 1JQLB 4DNFA 4WBNF 4Y9UA 4GD3Q 2QBYA 2BD0A 3UJCA 1P45A 4HO1X 3A6EA 2WJ4A 2VPTA 4WASA 2R8PA 5K3EA 2XXAB 4Q4CA 2X1LA 1Z6GA 3CSSA 5CT4A 4QZVA 4Q1EA 2FPIA 2NSDA 3FF4A 2IYRA 3C14C 4RAOA 5FI3A 1E1RD 3DZJA 3LK7A 4P36A 1KH2A 3EFOA 5FL3A 1T8UA 1Z83A 4DJEC 1GUZA 3HCNA 1ST3A 1GFSA 4WBNB 3B3FA 4V0OA 4ZGBA 4JEHA 4NZNA 4NU5A 4YMWA 1T1IA 3WA7A 1RXYA 3D2CA 1M76A 3G85A 2WF7A 3P2KA 4OA5A 1I80A 1BFDA 3BWCA 4KH0A 3DLIA 4B8ZA 2R6R1 5AVRA 2G4LA 1WOOA 1CE8A 2XDQA 3DMGA 5E4TA 2DLCX 2WAOA 2WHRA 3O1LA 4G4IA 2XLCA 4UU7A 2Q4RA 3G2LA 4FMBB 4KQHA 1LDBA 5KYWA 3ZD8A 1RCUA 3MD0A 1XAGA 3MMPA 4WY2A 3RFCA 4GLJA 1O95C 1I32A 1UWLA 4RLHA 1ZQ1A 2EZ9A 3L4EA 5LCXA 4A2WA 4MP6A 3N07A 2FLVA 2XA1A 3P9SA 1JA0A 3E7XA 3SIWA 3TLJA 2QZZA 3MEQA 1XMJA 4Y9RA 1VLMA 2J5KA 4I50F 2EZTA 3EXHB 3ZV5A 2WZPP 4KX5A 4TQ9A 4OHVA 1U5AA 1PJ3A 4LYDA 4YB8A 1D1PA 3SDZA 4AJNA 4FBLA 3DA8A 2Y1OA 1OH6A 4RETA 1R16A 4C01A 1WQ3A 3MFYA 2QP3A 2P8SA 1JAHA 3GGOA 5KTKA 4KDEA 2CVPA 5BN4B 4EI2A 1I3KA 1XZEA 5KX5B 3B9PA 2VA9A 2V3WA 5BVGA 4ZCIA 3HYTA 4UKDA 1LI5A 3QVXA 3V32A 2UVDA 3MMSA 4KFUA 3OKPA 4PGGA 3DOCA 1US8A 1UZNA 3LSYA 4MRMA 2BEJA 2PH3A 4RHFA 5KCMA 4PLCA 3L7BA 3A6ZA 4BN0A 1B6RA 5H3LA 1I9CA 4DF3A 2OHIA 3WGVA 3KL4A 2DR3A 1IY1A 1FMJA 2FEXA 2RFLA 4EJ2A 2DPLA 2SICE 3BDAA 3DOUA 5IK2A 4X1OA 1LPSA 4PO1A 5GZ1A 2YL2A 1QQ5A 1P7WA 4KO3S 4P3NA 1L7BA 1M7HA 3SOZA 2O8FB 4ZAZA 1IPHA 5EKTA 1EVQA 1GKYA 2QN2A 2YYYA 3LBNA 2EFYA 1NVUQ 3ND7A 4RH1A 3USES 3ET4A 2NXEA 2W6JD 4D5EA 2PE3A 4IX1A 2X6TA 3I9JA 4X54A 2CDBA 5C35A 5I7SA 3RSOA 4DDHA 5F7XA 4WXMA 1XD2A 5MFPA 3GCXA 2IFTA 3DKVA 5B6PA 2YFHA 1CIVA 3R74A 3EDCA 1ZH4A 3AT1A 2FE1A 4KU4A 4LK2A 1A3CA 4GDFA 1KY5A 2YS6A 3WHIA 3LHFA 3UJHA 3NYIA 4GYJA 3PRYA 1RYZA 4N39A 1UKEA 4P7BA 2RARA 4PN3A 4X5OA 1DO0A 2QDXA 3F2IA 3NIFB 3GFGA 4QSMA 3NHLA 4HQFA 2BUCA 2DQZA 1XFOA 1TMGE 2H5LA 3R3JA 5AVYA 3D6UA 1GPNA 4RD3A 2QG9A 1E4YA 2WTUA 4O3MA 4I6JA 4CKCA 1P7ZA 4ZVSA 4NMMA 5EQTA 3KTFA 1P18A 3UMMA 2WSSA 4TXHA 4BASA 4D5GA 4RDLA 4XOIA 3LM8A 4PABA 3ZC3A 4S05A 2C9OA 5I4CA 5F2OA 1BQ4A 2X1MA 4LF8B 4IIBA 4HAYA 1MABB 1HR0B 1FS5A 5J2TA 3ILYA 3MTQA 3Q6NA 1V8FA 2RJNA 2VUUA 3DE6X 3V97A 1M34E 1N34B 3JZFA 3T94A 1XALA 3DZDA 3JRXA 4FILA 4H1UA 4HRAA 2QD5A 2YWGA 3ZE2B 4ZRMA 1V43A 3TM4A 1FTQA 1N9ZA 3MTBA 5FUXA 3UBMA 1WSRA 2OAGA 2ZR0A 3GFTA 5FQNA 3FBTA 4ML3A 4WOKA 1L4YA 2F3TA 3PL5A 1Y4SA 4X7MA 3W05A 1N5LA 4TS4A 4AO7A 4B31A 4KNYA 1YE8A 2VJAA 4C06A 2R0QC 1KYQA 4EJFA 3JPWA 3CD6B 3PHJA 2O52A 3NWPA 1M6HA 2ZS9A 1IBRA 1QX3A 1UH5A 2HADA 2D2FA 3RVSA 2Y1EA 1JFFB 1RLOA 4TKUA 2HIMA 1X3LA 2JCBA 4HG2A 4JLOA 5KJEA 2PT6A 5BSRA 2OZEA 4CMEA 4FC6A 4PV7A 4RW0A 4C4XA 3GA0A 2C2BA 4UBIA 2E21A 3OT5A 1RI4A 3CUSA 2QTBA 2PUJA 3QWBA 3AUFA 4AT1A 3DKKA 1OWLA 3N1UA 5CG2A 4FHDA 1CJTC 2X8JA 1F38A 3M4JA 3DP7A 2HMWA 1CY8A 3B1WA 4X8OA 2OG1A 1P2SA 3ZHYA 5EJ5A 3CJTA 3WAGA 3JATA 4WN9B 1CP3A 3A9WA 3TD6A 1KR5A 2Z1NA 1OZHA 4D57A 3WIDA 3KR0A 2NT3A 2FPPB 4Q47A 3W8EA 1A9XA 1NW4A 2B8EA 3PHIA 4GPEA 4BO1A 4GFDA 1OB0A 4UZEA 1ITZA 2CXPA 2WKPA 3BZBA 2ZT5A 3FPEA 2WD7B 3R3UA 3LT5A 4AZ3A 4ZCLA 2JAPA 3CURA 4MHTA 1XRPA 2HAEA 4ODIA 2BKUA 2O50A 3GDOA 2JIOA 4ICIA 3RHFA 4AJ9A 1AA6A 1O03A 1IM8A 2FZ5A 3KQKA 2Y1CA 3FD8A 3ER8A 3PPWA 4A1FA 1QOPB 4TVBA 1J33A 2ZJ0A 2PJDA 4YREA 1RABA 2WZBA 1G4AE 1N7HA 1D8TA 3EF1A 3FUWA 2IELA 3ORHA 2ZXIA 2A4MA 4IFEA 3DYBA 5K5EA 1CHDA 2XODA 4PLVA 3NWBA 1O6CA 4D42A 4A15A 1R37A 3V80A 1X80B 4GP7A 1KI1A 1N8TA 5J5VA 3NCHA 4IV8A 3SJ7A 3DEZA 1KOJA 4N65A 4LYEA 2PIAA 1B73A 1MGPA 2AI1A 1U3CA 3LAWA 1DX6A 4RDKA 4ATNA 5JDIC 2B98A 4MI6A 1I3MA 3QWFA 1PR3A 2UUBB 3ZCVA 1CS0B 4DZRA 3T51B 1GYQA 3V4RA 4S0XA 1J1IA 1L6IA 3DSRA 5FAKA 3J81k 1KA9H 1R0BA 2RHTA 4IEEA 1DRUA 3SU8A 2I55A 1CHNA 5CPBA 2FUNB 1B6TA 2H8GA 6ABPA 2YIVX 3LLSA 3SS9X 3B38A 1QK5A 1XQWA 1LGYA 1OUMA 1U0LA 2D2VA 2Z8XA 1QDUA 3A4LA 3FWNA 3H87A 3M4ZA 4O2BA 5KOJB 4BNWA 1WCIB 4PSVA 4YJGB 2ZJAA 1CY0A 4CKBB 2VQFB 1TQ2A 2OZKA 5EXXA 5GY7A 3QKTA 4P3YA 1ZMBA 1ZU5A 5FO0A 1MAWA 4AFNA 5EZ6B 3PHCA 3FMFA 2DXIA 4R69A 1YQXA 3L1IA 1VCOA 4AN0A 2Z8ZA 4V1CA 3CEMA 2GDJA 2Q45A 3OT1A 3DXZA 1ZOIA 1KZ7B 5PNTA 1GAEO 4JFAA 1WHSB 3PCXA 4AWAA 4KR2A 1PT5A 5BSMA 2OYCA 5IDXA 4EW1A 1J20A 3F5SA 3E2PA 3VPDA 3IUQA 2O2GA 3S27A 2K7FA 2NUPB 3QBVA 4I99A 4D0LB 4AKHA 4Z99A 3P7MA 3WGQA 1KSGA 3W2GA 1P61B 3LPNA 4XX0A 2JVKA 2B92A 3WK9A 1M0SA 3O1JC 4O3FA 1YX2A 1JGTA 3KYDA 4YUXA 1SVLA 1BW9B 1N5RA 2CXSA 3CGWA 3IAM6 4E22A 4HADA 2ZS8A 4RNCA 3VU1A 3ZJUA 1ZIDA 2ZUCA 1GR1A 1CW2B 3ZTYA 1RJFA 1R8QA 2B4QA 2W6PA 3MAGA 3N2IA 1E99A 4QFDA 4QODA 1NQUA 3WLFA 3KIPA 2QMEA 4PPYA 1HDRA 1E7SA 2E82A 2W5UA 1A98A 4MRNA 1P17A 2OAQ1 3S6JA 1QE5A 4KREA 1KEWA 3K1ZA 2C9YA 2BLNA 2I7VA 4JX9A 2VWGA 4HEA1 2P9QA 2WIJA 1FYXA 2VDPB 2WSLA 3MILA 3WGYA 3HKEB 5DCLA 3PNSA 4BKOA 5JBIA 4QLAA 1LBHA 4HVTA 1U7ZA 5JQGF 4MW9A 4KXFB 3RNLA 2OGZA 3RU7A 3VKGA 1WY7A 3M6FA 1LA2A 1ZMRA 2I2CA 2JNWA