3W2HA

Crystal structure of oxidation intermediate (1min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
271
structure length
271
Chain Sequence
TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 75
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2hA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2hA02
3I56B 3JQPA 2R6HA 1N0UA 3OZWA 3U2QA 2QEXB 1M90D 4HE6A 2RC5A 3WNBA 1IB0A 3CCRB 1A8PA 4H9GA 3CPWB 4N3NA 3AVWA 2EIXA 3CRZA 4M1KA 5H5JA 4RD6A 3SJZA 4UAJA 2BM1A 3CC4B 3VO2A 1VQ7B 4QHYA 1VQ4B 1KC8D 2AHOA 1IJEA 4LBWA 1JA0A 1H42A 4ACAA 2VZLA 4B43A 1NDHA 3WXMA 1G7RA 2B7BA 1JJ2B 3QSYA 4C43A 1UMKA 1R5NA 2C78A 4ZCLA 3CMAB 3OZUA 2BN4A 4M0LA 1CNFA 1D1NA 3CC7B 1KJZA 2YWEA 4FK8A 2OTLB 4RD1A 3P27A 1ZM3A 1W2BB 1EFTA 1EP3B 3JQRA 2PMDA 4G1VA 2BM0A 4AC9A 4TMWA 3CC2B 1CQXA 3JQQA 2QTLA 1Q81D 3VMFA 4P3YA 4K1XA 5GV7A 1QFJA 1EFCA 1YIJB 1J9ZA 1K9MD 1ZM2A 3U6BA 3ZZTA 1QGZA 1U2RA 2BSAA 4G1BA 1BQEA 3J81k 3CCLB 2D74A 1N8RD 3FPKA 4M53A 4AF7A 1XE1A 2C77A 3CCMB 3VNUA 1AIPA 2CRVA 3LYUA 1D2EA 5THXA 4YAUA 3OJXA 1OB2A 2HMAA 1EP1B 4QFMA 4R71A 1B2RA 3I55B 4TMTA 1FNBA 4ZCIA 1VQ9B 1VQOB 1GO2A 2FX3A 3WNDA 1OGIA 2DETA 3AVYA 1JA1A 5GV8A 3B8HA 2YWFA 2VNHA 3QFRA 3P26A 4IW3B 4B4DA 1GJRA 4YAWA 1DDIA 3W2HA 4RCZA 1W34A 4TN1A 3CMEB 2YWGA 1YHQB 4DQLA 3CD6B 4WQMA 1G7CA 1Q82D 3ES9A 1VQLB 4PC2A 3G6EB 4Q7JB 3OW2B 4LC0A 1XB2A 4C0SA 2J7KA 1JNYA 2EFGA 4LBYA 2HDNB 4Y7CA 4FWTA 4TMVA 4YALA 1KQSB 1EWYA 1ZUNB 1VQKB 2PIAA 4MYTA 2DY1A 4PC1A 3W5VA 1DARA 1YI2B 2PLFA 3MCAA 1GVHA 3LO8A 3WYAA 3W2IA 4G5GA 1QFZA 2CNDA 4B44A 1QUEA 3QFTA 4PGOA 1KD1D 1G7SA 4DQKA 1DDGA 3AGQA 2X3UA 2VNJA 1K8AD 1VQ8B 1YJ9B 3CW2A 4N3GA 3CCQB 1SM4A 1OGJA 3W5UA 3MMPA 1FNMA 3WNCA 1W87A 5JBQA 1QVFB 4HE5A 4LBVA 3QFSA 5AN9A 1QX4A 2BGIA 3VO1A 1YITB 4ZGQB 3ZBTA 1GAQA 1BJKA 1FNDA 4TMXA 1QH0A 1EP2B 1KK2A 1EXMA 1H85A 3CCUB 1BX0A 1K73D 1M1KD 1FDRA 3MHPA 4YHBA 4B47A 3AVUA 2OK7A 1G7TA 3FJOA 1E63A 2BF4A 3LVBA 3ZBUA 4U9UA 1VQNB 3W2GA 3WBKA 4PC6A 2BMWA 1FNCA 1SKQA 2E1RA 4RJLA 3CB4A 4NCNA 4F7DA 5TY0A 1TUIA 1E64A 4RCYA 4RD3A 2HCJB 3WY9A 3U6KA 2QMUA 4M2LA 5FA6A 1QGYA 5EMNA 1YJNB 1S72B 2QDXA 4YAOA 3CCJB 3OZVA 1FRNA 3B82A 2GPJA 1GR1A 3B78A 4MYUA 4TMZA 5DSZA 1KK0A 4Y9RA 3W2EA 2VYQA 3V76A 2DCUA 1F60A 1HA3A 1QVGB 1YJWB 2B5OA 1Q7YD 1GAWA 3W5HA 3AVTA 5KSWB 1VQPB 1NJID 1D8TA 4EH1A 2RC6A 4P6VF 2NPFA 2XEXA 1OB5A 1CNEA 4BPRA 4B3XA 4ZGNB 3QE2A 4J0QA 1I7PA 5HXBA 5TV2A 1WDTA 1TLLA 2DERA 3ZZ0A 1AMOA 1F20A 1QFYA 2VNKA 2XNJA 1TVCA 4RD4A 3AVVA 4NBSA 2QTZA 5H59A 1FRQA 3LRXA 3A1FA 1VQ5B 2BVNA 2BPOA 3E20A 1S0UA 1ZM4A 1KRHA 3CCVB 1QGAA 4YAFA 1IJFA 3ZC3A 4B48A 1VQ6B 2BV3A 1R5OA 4ZCMA 4M4SA 4Y9UA 1TTTA 2VNIA 3AVXA 1Q86D 4ZV4A 1VQMB 2B7CA 3WBJA 4PC3A 1ELOA 2QA4B 2XNCA 3OJWA 3QFCA 3W2FA 3CCSB 4PC7A 4AF6A 2ZITA 1KTVA 4FN5A 3G71B 4LBZA 1EFUA 1QUFA 1ZM9A 4RD2A 1B23P 5TR9A 3VNVA 1E62A 3CXCB 1JB9A 2DEUA 1BX1A 2BGJA 1KK3A 1R5BA 3G4SB 3E1YE 2QN6A 2GQFA 1W35A 1N0VC 2OK8A 3CCEB 4RD0A 4ACBA 3I1FA 2YWHA 3PENA 3ZZUA 1KK1A 1DG1G 3AGPA 2OTJB 1QG0A
chains in the Genus database with same CATH superfamily
1IYZA 2HL6A 4EEZA 5CM9C 2K2WA 4REQB 1YS9A 4WN9B 1CT9A 4FINA 4UHDA 4TL7A 2FVXA 2ZT6A 2O2GA 4XQCA 3TMYA 2YL2A 2ZB7A 3O4VA 3OQHA 1ENZA 3RVOA 1D6NA 1X1RA 1VPTA 5K3AA 1WY7A 3UJ6A 2JLUA 2WYRA 5KWSA 1UFQA 3O4IA 1EA5A 4ALKA 1CP3A 2X13A 4E5UA 2J3QA 1QRAA 4C2AA 3CCRB 1HWYA 4QHSA 3PHCA 3ND7A 4RE6A 5HS6A 1VHEA 2PH3A 3U3OA 2OBTA 3L92A 3CRZA 4XH9B 5KHAA 3OC6A 1JG1A 1AUQA 1KO5A 1P62B 4WESA 3LQEA 4JP2A 4REOA 4C5CA 1IPHA 1JB1A 1CJTC 4MB6A 3QHPA 4UAJA 3DC7A 4W5QA 2BM1A 1PAUA 1WDKA 2GAOA 3CBQA 1S8NA 2XSZD 3ECCA 4WZLA 3MJCA 1D9XA 4KMOA 3NAMA 2QYSA 1HTBA 3VU0A 2VXBA 2P9TA 1CB0A 3OQPA 4XXHA 3R6DA 2QROA 1C3XA 5FUBA 4D98A 4IFBA 5HKKA 4CKWB 5DE3A 1Z75A 4KK3A 2VAXA 2Y2VA 4M49A 2F7SA 2ZYIA 3EODA 4N03A 4M0CA 3GFOA 1X8KA 2PT9A 1Q0RA 2XIJA 3N0RA 2H51A 3ET5A 4K86A 2IXFA 2WFAA 1KI9A 3FCXA 4MQEA 3IBFA 4WKPA 2HBRA 5FI3A 1SXQA 2GBLA 4NEGA 3T1OA 2JGDB 5FI1B 1IHUA 4PNEA 1UADA 1PF7E 1C4XA 5DISB 3FHCB 2YBDA 5JQGA 2JAOA 2NXCA 1UBUS 2H2DA 3RYCA 4ZK6A 4JJ6A 5AVRA 3MTIA 4YNBA 4BP8A 2W83A 3CX7A 3F2VA 5DHQA 3S27A 3T7DA 4WWHA 4OB6A 4NOKA 5FWYA 2WQZA 1Z5UA 1G19A 4XM3A 4N1AA 5C46F 5KYXA 1KE2A 4B2LA 1V3TA 5B2FA 1Q7GA 2V6GA 5JSZA 3UK7A 1E9CA 3PICA 2C4TA 2ZB4A 3DEAA 4L1KA 1E3SA 1GNSA 1I8DA 4RVCA 3SS9X 3VAAA 4DIDA 1JKIA 3BF7A 1R1DA 3D6JA 3ZU6A 1KSFX 3JD0A 4XZ3A 1SVUA 1FS4A 3LI2A 3ORFA 5DCLA 1Q81D 1P0QA 1QH9A 4G86A 5I9SA 4DG5A 2LNDA 4NV0A 3ACDA 3VGPA 1O97D 3B9BA 4R54A 4LOIA 3W1VA 2Q2WA 1QB7A 3KT8A 3PC8A 5E2IA 1PLKA 4C0HA 2YY6A 3HB1A 3SNHA 4AMBA 1YFZA 2FPGA 1K28D 2OORA 2WI8A 4ZQHA 3PYMA 1CNMA 1DCKA 4FW9A 3AEUB 3RRXA 4DRZA 1BDHA 1LWOA 1VG8A 1V3VA 1CVLA 2PCJA 4FQ8A 1NQTA 3N2ZB 5AMXA 5JAHA 4CUJA 3GVIA 1U8YA 4BFLA 5BNZA 3N6XA 2EJWA 4G1BA 3A32A 3QVTA 5AVYA 1WQ1R 4D8YA 2C61A 2OO5A 5IRCD 2QUHA 2HFKA 2PX4A 2NX2A 2XIQA 4YDSA 4PLFA 5DRYA 5B55A 4ZIRA 3KG2A 4QATA 3H99A 3WGNA 1SWVA 4MVWA 1ZQ1A 5MDHA 1DMRA 1KQ3A 3G9QA 3R3WA 1P2UA 2CBXA 4G63A 4ERNA 2IYEA 1B2RA 1S01A 4PNPA 4I50B 1WW3A 4WKCA 3EA5A 1T3GA 1UK6A 2PD3A 4HGNA 5EG5A 5C52B 2ZKLA 1FNBA 1NU6A 2WHPA 4WE3A 2C4WA 1QK5A 2P2GA 1AHPA 3G79A 2YYSA 1Q7RA 5BV7A 3HCRA 3P2KA 3MWDB 5E1DA 1NG1A 3EMDA 3EZYA 4FYPA 1XQ6A 4XVQA 3FOFC 2GM4A 1NXWA 1RLOA 3BWXA 4YMSA 1IC6A 1C3LA 1U31A 5JDCC 3HABA 2XB9A 3QLUC 4YP6A 3B1WA 4QUDA 4E08A 2ON6A 1UWVA 5BNWA 4EYOA 3GLQA 4EF4A 1H94A 4HNQA 1DDIA 3M89A 4MAAA 4H59A 3K30A 2ZR9A 1RE1A 4BVLA 4AKSA 4D56A 4D0RA 3IUNA 3PEUA 4DK0A 3JQCA 3U17A 4PG8A 3R6JA 4NZMA 1U8FO 1GT91 1VQ1A 1MAUA 2HA7A 2ODNA 1FLVA 3JQGB 4X1YA 4EGJA 4LVUA 4R4JA 3EMVA 1A97A 2EZTA 5L40A 3KKNA 4C0SA 3DKRA 4B5LA 5IXSA 2A5GA 1DDOA 1QGED 4R98A 4ETMA 3L7OA 4LMPA 3FLBA 1YI8A 4ZVTA 4BO2A 2JAUA 4TMVA 3ONWA 4LY3A 2FSUA 4E30A 2BP7A 2FOIA 1VQKB 1A7UA 1UPAA 3C16C 4M7OA 5BVHB 2RSLA 2CZQA 1DARA 1J2JA 2F9LA 1YQXA 3IVAA 2AC4A 2AN3A 2F9FA 4WJLA 2J9GA 3GFFA 2PCLA 1F0KA 5CFZA 5JMWA 4I6JA 2GM9A 1FQOA 4DMUB 2ZUVA 5TEWA 3IP9A 4AAYA 2IA5A 3DL4A 3N3BC 3OX2A 4KLZA 5A05A 1GZDA 1V6CA 1UBTS 2HQBA 4N6NA 2LVBA 1X7HA 1BGXT 2CFIA 1LC0A 1UWLA 1QOPB 3DW3X 1NTRA 5JEEA 4QXAA 2VK8A 4X91A 1HZZC 1XZLA 2C2GA 1NY6A 3QOYA 2YXEA 3O2JA 4BBPA 4E5DA 4LGMA 5LM3A 4GM1A 4BMDA 4PZYA 5B1SA 1SBIA 1KD1D 1KI6B 1V1MA 2AQ8A 5BMVF 3OD5A 5C18A 2P8SA 4FW8A 1ZU5A 4KFTA 4TWRA 3I2YX 3V1LA 2YNMD 4E21A 3BJEA 4KQ9A 5LU8A 5DYIA 4LF5B 1XRNA 4PINA 3WZLA 1E2BA 4PLGA 1E6CA 3BG5A 4N7RA 4NZ9A 5GM1A 3CW2A 1KZ6A 2ASEA 3SCZA 1TTPB 1OGJA 2J5RA 4MIKA 4DLSA 4WDQA 2CNWA 4B3JA 4NK5A 1AH2A 3SLNA 2W22A 3GN1A 1SU6A 1MLDA 4QGFA 3RAEC 3S1SA 2E4AA 5LP6C 3IH5A 1FW6A 1SKMA 5AW1A 3IUQA 2J3LA 4PW0A 4W6ZA 3RV4A 3L1IA 2C5BA 2FW9A 1ZRSA 3DTVA 3EYWA 2Q4BA 3RRYA 1P2GA 1TW2A 1MA0A 1OC4A 3D8SA 5DP2A 4DC9A 2V3VA 1AMNA 2VYFA 1MJGA 5DGHA 4CJXA 1A4UA 1JSRA 4AZ3A 2CLLB 3AK4A 4J0EA 1ZD5A 4QO7A 1FOEB 1L4GA 3HLKA 2CFRA 2RB5A 1RJWA 1YBHA 2GOYA 2JN9A 3CTAA 1L4NA 3PI7A 5KYWB 4BLQA 2QXYA 5IF3A 2FK7A 1X1TA 3ONFA 1DJNA 3OT4A 2WFLB 3N2KA 4UZUA 1OLUA 4JVMA 1O2DA 2IZ1A 3AI3A 3FKSA 2BFEB 3KPYA 3QQ5A 2LIPA 2HZBA 1A77A 4J4BA 4NY1A 4AROA 1M1KD 4KV9A 1X39A 2I8AA 1H6BA 2IK8A 4KAJA 1YE5A 4GOJA 2PZGA 4OLAA 3KEOA 4LJRA 3KIPA 3N76A 2C9DA 3QMWA 3AY6A 2I2AA 3W2TA 3TDKA 4R8RA 2ICAA 5HGXA 3FZEA 1GLVA 2X2EA 3LGAA 2BJHA 1YA4A 2XV1A 4NH4A 3T7AA 1YQUA 3O26A 1GA6A 3JX9A 2R6FA 3JALA 3KTOA 4P36A 3B3AA 5FR1A 3VR3D 1BU5A 3N74A 3N7AA 1CIJA 4CR6A 1FNCA 1YUBA 1KJ8A 1GYPA 3H4TA 1Z4LA 2DY0A 2HNAA 2JGFA 3CV3A 2PBRA 3O1HB 4JJAA 4RETA 4E03A 2P0EA 4KQJA 1RQPA 3JU3A 1Z4QA 4JUBA 1Y48E 2FOLA 4J1QA 1P75A 4AY6A 2QTFA 1P5RA 3SIXA 1QRRA 2K4MA 3IB6A 1NVGA 1RXYA 1T4GA 1HNNA 4GI3A 5J2TA 4B3RB 3QMMA 1DQYA 2HPVA 4PLWA 3OIDA 4DV5B 2W00A 1NW8A 4HS4A 1DXHA 4OM7A 4B4WA 3W04A 4XYLA 2H31A 1EFKA 2XMRA 5JSKA 2XA2A 3DMTA 3EWNA 1GZ5A 4U39A 4X7RA 1QKJA 3LDFA 4V39A 3USZA 1XT6A 4M0FA 3GCWA 1NW5A 2FF7A 1U0TA 2I1QA 2MT9A 1UXIA 2QZ4A 5AKJA 1P9NA 4DBVO 2B34A 2IKQA 4WDRA 4M2LA 3HY6A 3Q1LA 2HX1A 5F23A 4EGQA 5SZJA 1FK8A 1V71A 5AVSA 1RXWA 3THWB 4GPD1 4AN0A 4YAOA 2IHKA 1RI4A 4HLCA 1TK9A 1GR1A 3M9WA 2VYCA 3W3AH 2CXPA 1Y1RA 3ZS9A 4D46A 4YRTA 4ZK2A 3BXPA 3M6AA 4CG2A 2OB2A 2IYUA 1ZGAA 2HA6A 3CZ9A 3E05A 1NRJB 4HUQB 3BIWA 2K87A 5KUTA 4MVYA 3W2EA 4JMPA 4CMAA 3FR7A 1FBTA 2FR1A 3KOMA 1L3IA 4R1MA 2P6MA 2E18A 2H7YA 5FOQA 3H0KA 2WABA 3HBAA 3FTFA 4XL9A 2PSEA 1XJ0A 4NPHA 5IYQA 3QPVA 1CUIA 5A0VA 2PN1A 4L0DA 4OAPA 1YIAA 1LZLA 3QV2A 4K03A 5P8WA 2IH5A 1VKZA 2JCVA 3GLVA 4IIGA 3AINA 1YJWB 8OHMA 4D41A 4UTRA 1JT9A 3DEIA 3QEOA 2C1XA 2OVFA 4TV9F 3EZNA 2DHRA 2DKNA 2QTBA 3LPDA 1PS8A 2OP1A 2Q5OA 5FWXA 4DDMA 3HCNA 3F6SA 3TTVA 3KT0A 2WUFA 3LGXA 1CQIB 2XCIA 3GP8A 2LPMA 4JFAA 4OPVA 3FROA 1NURA 3EFOA 3ZVMA 5LMNB 2C2XA 1GILA 4EH1A 1A7AA 2RC6A 3OF3A 1TQ8A 2O2DA 2PVPA 3TIIA 3VBEA 4AMYA 4CFZA 1PK9A 3BREA 3CYFA 2BFPA 2SKDA 4IFTA 4TXNA 4X20B 5FLEX 4D4JA 5KJ6A 2J0SA 4J16A 4M8LA 2G0TA 1OB5A 2WAXA 2VJLA 1FCJA 3DBVO 5L3QB 1IU9A 1KMCA 2RBEA 3QUCA 3E70C 1AQJA 1ACJA 3AEKA 1XA4A 1SUIA 3X2SA 1LPAB 3LJKA 2HRCA 4H1HA 4YQFA 3T3GA 4PIMA 5EJ2A 4FE7A 2FZGA 1E4EA 2GXAA 2AFHB 4BNDA 2ZJ4A 1QV9A 4EW6A 4YCDA 1UODA 4B3CA 3CXRA 4CV3A 1AF4A 3QWAA 1NRXA 5HE9A 5HRAA 1LSUA 1X13A 4YJGA 4BEJA 3WGKA 3Q6MA 3RVMA 1KI2A 2NYAA 1LS6A 1ZX1A 1KA9H 3IPAA 1PYOA 2WK1A 3LLUA 2CSUA 4RWEA 1PGNA 1VL2A 3CNEA 4W1SA 4MB0A 3AF6A 3LUKA 2QN1A 3C3DA 4P4SB 1AURA 1Q5PA 2QTZA 2H07A 5D3MA 3EOBI 3VKHA 1SEVA 2PT7A 3K0EA 4HAZA 3G05A 3TX6A 3SNKA 4UHCA 1WXXA 3O9ZA 4BNYA 1Z0SA 3HSSA 4LTMA 4YLEA 3ZY2A 4E7PA 2IOHA 3H1TA 4CGZA 5AW9A 1G1AA 4QC2A 4YB8A 5M5BA 2DYKA 3W05A 3PUNA 3MJHA 2W11A 1ZNZA 1AKWA 4DR5B 2GF9A 2Q8PA 3R3ZA 2BMAA 2OM2A 1WCYA 2C8KA 2H1LA 1RQNA 1DRVA 2IHJA 1G3MA 3D7KA 3OTHA 1YS6A 4G4SP 2EZ9A 4WXEA 4CU5A 3PQ5A 1HDZA 1JTEA 1R6UA 2GCOB 1TGVA 3DE6X 3PGXA 4QQRA 3UENA 4BGIA 3VOBA 3CVXA 4MVJM 3A05A 2VNIA 4ZTZB 4DLZA 3INTA 3VHQA 3ZE9A 1JN0A 1U7XA 3AHIA 4F3KA 4DRXB 4NEHB 3URKA 1S1CA 2AEFA 1NHGA 2IY7A 5SY6A 3L8YA 3Q7PA 4KNYA 2ZYTX 1Q3KA 1NPDA 4ZXFA 1AA9A 1TF2A 3STVA 3B2NA 4HMQA 4NENA 1UDBA 1XZBA 3P0FA 1B73A 1CUWA 1FRVA 1Y89A 2D0OB 2EXXA 1Y1SA 2Q0HA 3OJOA 4FYIA 4MYRA 3ENQA 3IGFA 3SHWA 3WJ7A 2GZ2A 1DBQA 1ICEA 3A28A 5K09A 5HW0A 1R0SA 4EMSA 1O95D 4HZIA 5AUOB 1ECCA 4AWBA 2FN4A 1KE1A 4IJMA 1L5VA 2W2QA 5LCXA 1KJWA 4MW6A 3VUEA 4YUAA 4KITB 4NX2A 4ZTUB 1TMGE 1O0CA 1AKNA 2FUCA 2HJSA 3SLRA 3F78A 5KPJA 1FTWA 5JSYA 4LRUA 3UUEA 2E85A 3EC7A 5DNVA 3MWEB 1PW5A 2NTEA 5HTKA 2AXQA 1KFKB 4JHLA 4JLJA 3WHLA 2FU5C 4DYHA 1QDEA 4UFNA 4G7WA 4HQ6A 4Q24A 3HR8A 1DOHA 3A4TA 3ED1A 4B85A 1R12A 2Q4OA 2Q4DA 1ECLA 3JRWA 3H86A 3EPPA 4GOND 3KOWA 5DYTA 1IZ9A 1HNXB 2X85A 5D7BA 1LRLA 3K9BA 4C3UA 4IEIA 2V9CA 1G4HA 1OYOA 4M9QA 4Y6PA 4R41A 3TL6A 1JIIA 3I1FA 3GLUA 4R51A 5I4CA 3IDOA 1FFCA 5FD8A 5IWCA 2P9YA 1G8FA 3NV7A 2Y93A 1CF9A 4Q21A 2DWUA 2FSSA 3TB4A 1EBFA 2YV5A 2H9YA 4GQNA 5FUQA 1SJ9A 2J6CA 1HF3A 2AFRA 2EL7A 2Q9CA 2D06A 3KJFA 3TI9A 4KQIA 3AP3A 4PFKA 3UG6A 5IFKA 5F7XA 3ZR4B 1E43A 4PHGA 1N0UA 1M90D 1OASA 4PXAA 3SXUA 4DUGA 3MXOA 3UMCA 1W88A 3OOHA 1V9CA 3NETA 4W99A 1KU0A 5EPUA 4ENTA 1ZISA 4Q7KA 3S29A 3UUGA 2UUCB 1J20A 3DNMA 1ACLA 2JBAA 3CLSC 3N0TA 2JDIA 4FCTA 3A35A 4HDNA 2X7XA 2P5YA 1UDWA 4MIOA 3WNBA 2ZZGA 3LYHA 4GZ5A 3G49A 2CV1A 4EPVA 3DXFA 3NYRA 4N3NA 2PYDA 1PWHA 4IMJB 1YZUA 2GCGA 1H0KA 1CFZA 1CR2A 1GXSA 5TQJA 3CUYA 1Y6GA 1CDDA 4UNSA 1PR2A 2PANA 3QOWA 1IOWA 5F7JA 1OXVA 5D51S 4EB8A 5A5VA 2XB6A 3NP7A 1D3AA 2VCEA 4ZI2A 4TTRA 5LKRA 2WTEA 1TM5E 3PLAE 1WL8A 2W98A 3HBJA 2MMCA 5SZHB 4CMHA 4HNRA 1R10A 1TVEA 1PKVA 2COUA 2F1HA 3HBNA 4LWQA 1BJTA 4YRGA 4MS1A 3WG9A 4FGZA 4LK3A 3GLGE 3Q7RA 4KPUB 3CRMA 2OV3A 2MYNA 3SZUA 5EP2A 4A6XA 1A8IA 3TLJA 4DLVA 4DDVA 4ZVSA 2MSDB 1E9SA 4XQ0A 1NUTA 1PJAA 1N07A 4UQOA 3OP4A 3UAOA 3LE8A 1EZ4A 2QBYB 2HV8A 2C96A 3EVDA 1XQ1A 4QBGB 3TNLA 2NSDA 3MC1A 3K0SA 4C43A 4AKGA 1PO7A 4AULA 1E0SA 5AVUA 4O4LF 1UZUA 3ZLUA 1RRFA 2WE8A 3NHPA 4YP1A 1BMFD 2QGFA 4J94A 2NU7A 3ZOZA 3RSFA 4M0LA 1J0CA 3EBOA 4OY3A 2CMGA 2Q2OA 3LBYA 5EXSA 1WNFA 1YR9A 2YW2A 3OEWA 3T54A 821PA 1PG5A 1QMGA 1BXGB 3FPEA 3V55A 2HSDA 2WLTA 4BN0A 3WHKA 1W2BB 5TVKA 4BO0A 3CH7A 4EF6A 3UPUA 3BXZA 1UMDB 2ANBA 4IZ6A 3VA7A 4GF5A 1B8OA 4XA8A 3L0ZA 4EA7A 1YZLA 4AC9A 1Z2CA 1WOOA 3UJNA 3UXEA 3UZUA 2IXTA 1TK2A 3G3EA 4ILKA 4I19A 4QFDA 3U9LA 1KTIA 5DFAA 4RDLA 1W76A 3LP8A 4ZEMA 1UBLS 2QTLA 2DAPA 2HH9A 4FFSA 3VMFA 4J76A 4GZMA 3U7QB 4W8OA 3FDZA 1NQWA 2IZZA 1FFDA 3NHAA 1A9PA 2HHAA 1LVGA 4E15A 1ZA2A 5M2QA 2GTPA 3KAPA 2VJCA 2HA2A 4JDPA 3EZ7A 2C2KA 4J2TA 3HXPA 4UTNA 1WNTA 1IXKA 4IWYA 2DQYA 4NIMA 3SC3A 3PGLA 1XDWA 3CPEA 1IQRA 2NU9A 4O2AA 3R7NA 2FA9A 4Z53A 2AK2A 2ZZNA 3GUUA 4Y1GA 3AF3A 1RRCA 1UKYA 3QNUA 4OCZA 3SYKA 1LNSA 4OQPA 4GL2A 1BQEA 3HB9A 2WVAA 3QVOA 3LU1A 4JIGA 2VUTA 1W36C 2P5TB 2R47A 4IV5A 4ZQFA 3PC6A 1W1WA 1K8QA 3DBRA 3GFBA 1K4YA 3GDOA 1J8YF 3P8ZA 1QU2A 3NHBA 4PLYA 2NG1A 1C3EA 2MYTA 4YK7A 5BSEA 1PQ4A 1V8FA 3HWX1 1EK5A 3ETEA 3LUDA 3ZWWA 5MN6A 3I6YA 2D7JA 4C5BA 2NZUG 2O8BA 1L4LA 4XIIA 3GRPA 5F4ZA 4ZAZA 1NMXA 3G5UA 1AUOA 4GDMA 3G2NA 4CQMA 3CCCA 3WLLA 4JT4A 3FSJX 2ECQA 3BIJA 4GBED 4EYEA 2VNHA 3LUCA 4R84A 1VCNA 5T57A 3AOEA 1RRGA 2QD1A 4ZT6A 5LZ4A 1Z0AA 3JAKA 1GUAA 1N75A 1YL6A 1Z47A 3P26A 2ZBPA 3SQOA 2I87A 3AU8A 2JH3A 5CA0B 1A4RA 5F7OA 4RKFA 2H1CA 5IANA 1B6TA 3HUFA 1XTVA 1IONA 3CMEB 3DE3X 5SYNA 3TL3A 1YJBA 4LXGA 3PUJA 3PZRA 4P2NA 3QYAA 2I2DA 3WIVA 1CS4C 2DB3A 4OQLA 2V7WA 2YBEA 3ZH9B 7MHTA 4MW2A 1TJPB 5CVVA 4DZTA 2ZE8A 3EGOA 4OP3A 2FMIA 1AQIA 3C41J 3DYVA 4QTXA 5ALYA 5FHRA 5DI3A 4B17A 4EECA 2I4TA 1XFAA 3E27A 4P31A 4U2CA 2J7KA 3AUXA 1D7OA 1M1NA 1U11A 2NOAA 1XZHA 3PQ8A 3ZXYA 4DLRA 1L5KA 5JDIA 2QTAA 1QKIA 4EY6A 3BFXA 3PQFA 3G17A 2HU7A 3HQ4O 3QU7A 3T3IA 1H6CA 3FWNA 3TIGA 2FN8A 4HEQA 5JNWA 4OP2A 4YUVA 1YJ5A 3G2HA 2P4UA 5LMCA 4IQ4A 3DKPA 2DZDA 5EVJA 3C48A 2DBQA 1I6LA 3QVGA 3IAXA 5ECDA 1X8JA 3C6QA 4CQLA 2F64A 3IMFA 2XQJA 4DRYA 3PFKA 2R7NA 1LBHA 4XN3A 1T25A 3HGQA 4WCVA 5EMHA 2OZEA 1NULA 4HRXA 4EARA 5ALUA 2ZYSA 1RKXA 4M9SA 1LNQA 3F6YA 5BUCA 5ILOA 1W44A 2O9JA 3CR7A 1C0PA 4GMKA 1F6WA 2CNDA 2F43A 4E11A 1V8DA 2G25A 3W9SA 2OYCA 2DVMA 2NTYC 2LXNA 3RM3A 4LJ4A 3R5HA 3LVQE 1BKDR 3TIVA 2WM9B 4OMCA 3ITEA 2BEWA 4Q6WA 4Y9TA 5CFQA 1QF9A 3GOHA 3K0CC 3B36A 4ZXPA 1DIBA 5TIIA 1KJ9A 2CJYA 2AF4C 1WVMA 1SCDA 4MR7A 1WVIA 3N8HA 3VNRA 5IKXA 3CJQA 3HUUA 3NC4A 4OQQA 1XZQA 5AI9A 4N3GA 4LTNA 3T56B 1PTJC 3G0IA 3IP1A 1Z6TA 2YN4A 3DLIA 3NXSA 2WKRA 5E6TA 3EVFA 3JXEA 4HY3A 4IQGA 1GTSA 4TSRA 1G98A 1KL7A 3GNQA 5FO0A 1RVV1 2PYIA 5CYGA 4NE2A 3DFZA 3R9IA 4GOMD 5FOWA 3VHXA 1QX4A 1EGQA 3E3LA 3OIVA 2C20A 1P4HA 2XUPA 2ZIZA 4G5OA 4OD0A 2IHTA 2ATVA 4I81A 3RABA 3S2GA 1YKFA 5JS6A 2DGDA 1KMHB 3QUTA 3LLVA 2PZEA 1NSFA 1SURA 3IE0A 2W93A 2X4DA 3ZBTA 5KTRA 4Q5IA 4NNJA 3ZY5A 4ND4A 4MVJE 2GJAA 1ZN9A 2DLCX 2FSIA 1G66A 2IYNA 3GDHA 3EG9B 5EZSA 4F2WA 2I91A 2ERYA 4JZYA 3K7EA 4MKHA 1DKUA 4WY5A 5FEUA 1J0EA 2AJ8A 5CRIA 3QKWA 2I22A 4L8LA 1L3BA 4KIJA 1G20A 4HRVA 3BIFA 4MINA 1EA7A 2LWIA 3FAZA 2I2FA 1MB0A 1V5VA 1Q44A 3NWEA 4LYYA 1PTKA 2OK7A 1OKKD 2ZTMA 3I1YA 3V7YA 4E2FA 2BYTA 3DP9A 1VL5A 4F8EA 4EHNA 1U3CA 2GPSA 4G85A 3J80A 1Y4SA 2IKSA 4CLRA 3F7MA 3K1AA 2BF4A 1QG4A 1QOZA 1O1YA 1USKA 4JBXA 3W1WA 4AY5A 3DWIA 3MD9A 4G01B 1WMBA 1AKRA 1VQNB 1U9IC 3GA0A 2HDHA 1CR0A 3V32A 2DYIA 5K6AC 1MVOA 5AK6A 2W4MA 2HO4A 1Q6ZA 2DOGA 4MUNA 5CDFE 4MLDA 2WJIA 5DW3A 4XVCA 1Y6FA 4CM8B 2JS7A 2Z2YA 3B5IA 4LOAA 5EZ6B 5K8LA 2F3SA 2R8BA 2Q62A 2JAHA 1CY2A 4OA5A 1C3JA 4A0RA 5B6IA 1PZXA 2Q5IA 1C4WA 2OCLA 4ZJUA 5EE3A 1SCQA 1VIYA 2C5FA 3OPQA 4QYIA 1BMQA 1JX6A 2ASVA 3CZRA 4BU0A 4Q39A 4ZGGA 3WGQA 5ALHA 4F0JA 4KSBA 3RRFA 1LCIA 2YV4A 3IIIA 3JRXA 3RFCA 4MS4B 1L1QA 2ISSD 2R6DA 4XIFA 5JJIA 3G7SA 2YIMA 4JN6B 4A8TA 5K3OA 3GRZA 3T61A 2HCJB 1D6SA 4NDZA 1Y3FE 1XZDA 2JD1A 1DC6A 2CL0X 4EJSC 1LQTA 1QIDA 2C7GA 2FMFA 1FL9A 3D7SA 4AVZA 3EMKA 3N59A 4MCIA 4M98A 1IHDA 1QR6A 1E3JA 2OENG 4R69A 1D4OA 1YNOA 3GVXA 3WJAA 2FEKA 4RXUA 2V6JA 1W8DA 1ABFA 5J23A 1XPUA 4JUCA 4F46A 5A5DA 5TMBA 1MO5A 3OU7A 1WF6A 1SCKA 2BHTA 2PS9A 4H0CA 5IZCA 4MVJD 4RYDA 5K20A 4A26A 2CWWA 1JVNA 3UMRA 4AZ3B 3DZGA 2AYZA 3OE1A 2PMWB 3ZZ1A 1B16A 1T4DA 1RMTA 1U0EA 2WU4A 2ZUBA 4JEIA 4P3KA 3H18A 5E4TA 4U5XA 2BOVA 3E18A 1XWFA 4U3JA 4ZHQB 3DOOA 3KXIA 1SRQA 2GXQA 3GEHA 4OOFA 5FTKA 2NN3C 2BD0A 2JASA 4GSYA 1OLUB 1XMJA 2ATXA 3FNHA 3OT1B 1O87A 1RU3A 1YVEI 3KAJA 4IUYA 4TWBA 5BPFA 4JMLA 4OB7A 1TU0A 1G8AA 3OM9A 4ZANA 1J21A 3W5BA 3U56A 4C0LA 1Q7YD 2JAXA 2XADA 4D3YA 3F5MA 4LFAB 3A0UA 5T3UA 1MF7A 1Z3CA 3UNXA 4XRGA 4A27A 3SHFA 2X3FA 4F1JA 3I9LA 3QLEA 5JR3A 2WV9A 3PUYA 4P4LA 5GQSA 3INGA 1J8DA 4RDJA 3IEPA 2PE3A 1N6IA 4MRRA 3ZWCA 5G0VA 3H2BA 3VH2A 3S68A 1YAHA 1H3NA 4QREA 5EUCA 2A5YB 1U4SA 3NWOA 4E70A 3M1AA 3D6TB 1NM5C 2P3SA 1LPBB 1P29A 3Q7EA 2VOEA 4G37A 4EYSA 3JALB 1BXKA 1OBFO 1UC5B 3WR5A 4YRFA 1JXMA 1KFBB 1L5HA 3SQNA 4NKRA 4RK4A 1E3TA 5G4KA 3UWKA 4TMFA 1MH1A 4XM2A 4AMVA 2DOKA 5JSQA 1F9EA 3ZVNA 5T41A 3N2LA 3DHNA 3QYPA 3STHA 2CXUA 4OUDA 1KZGB 2IOQA 1EHIA 3I3SR 4FMCB 4RVSA 3JQBC 4A5OA 3BXHA 3RKUA 5A0TA 2VS1A 3UWPA 3G6WA 2PUAA 2VTVA 3OECA 1MX1A 4WZBA 1H4TA 4PGGA 4AJKA 3ZXIA 2P2LA 1ISJA 2P6PA 3GK3A 3H8SA 4U2GA 3A31A 1NQVA 5LUBA 3WMFA 4LDPA 1L0BA 4S12A 4YMVA 5BSGA 2P11A 1UDAA 1DQSA 5BN5A 4PAGA 3D3KA 5JRDS 4PN3A 4OMDA 2IDKA 5GONA 4AF8A 4Q15A 2KWIA 2MOKA 4EMBA 3E22B 5AVQA 3FTEA 1R74A 3M4NA 3MLBA 3N5KA 4IIJA 5EJIA 4ZAWA 3ZZMA 1V5WA 3MGKA 1UM9A 2BMJA 1U28C 4X44A 2HLNA 4E46A 2BWJA 1VQ5B 1R0WA 2D3LA 4DT1B 4NSNA 2JIOA 1LPPA 1NF3A 2MSEB 3C7TA 3IMGA 3DGFC 4I1SA 3E20A 4TTQA 1Y3BE 3IR7A 4I4CA 4OJMX 1X7DA 4OLHA 1R8JA 3E9EA 3TNJA 5ELXA 5FL7D 4D9JA 4DLWA 5AOVA 3GFQA 4BXOB 1K98A 1NNSA 1WMAA 221PA 3L8DA 5DP1A 3FWKA 4XLLA 4P86A 4TZ0A 3OEHD 3ENWA 1B76A 1JQLB 1TTHA 3OTGA 4JVNA 3T52A 2YWRA 2INGX 1FUYB 1KETA 4NCIA 4TVBA 3REOA 1PZEA 4AYXA 2YIJA 5AM3A 3UEOA 2X2PA 4H6XA 3WWEA 1TM1E 3PWSA 4RA9A 3OPYA 3JQFA 4ZDKA 2XB8A 1TYBE 1UC9A 1GTZA 5CPBA 2QIPA 3D8HA 5JZVA 2WIGA 3V5NA 4D0SA 1BZYA 3K2QA 2WRZA 2WZPP 4ERXA 1APBA 1DMSA 4RTJA 3G0HA 4OU4A 3L7IA 4NS1A 5D3ZA 5FWXB 2JJMA 3MWJA 4HL6A 4M1WA 1T1RA 1HFWA 3K9GA 3RVKA 1C8BA 5HWSA 2B9VA 1CERA 1JBQA 1B8VA 1KP2A 3K9HA 2R6ZA 1GYQA 3OZAA 3QF4B 4IDQA 4PY2A 5F73A 3KM0A 2QXTA 1JEYA 1LLUA 4AJ1A 1NKTA 1RZRA 3BERA 1MB4A 3WFJA 3WKBA 3GCXA 4BFVA 1BG6A 4ZVRA 4WJZA 3PUXA 3N3AC 7GPBA 2AWNA 4QTZA 2OOSA 4WBXC 1P2TA 3TTYA 5J1TB 4ARAA 5DN6A 3ZWQA 2H8KA 1DCFA 3AEKB 4NPAA 4V2IA 1ZD8A 3UHJA 3GLTA 1PR1A 1QG6A 3AF1A 1VJTA 4BMYA 4EPRA 1M2VA 2VLBA 3AV3A 1K2WA 4Z4QA 1QC5A 3EF0A 1E4EB 2C5LA 1O96A 4PSAA 2BIFA 5IKOA 4BNDB 4GC5A 4NBKA 2GS9A 3SF0A 5IYWA 2GF0A 2CWDA 4AURA 4DA8A 5BOSB 2B5VA 2PSHA 4BBZA 5K7SA 3A6HA 4GDFA 2AKEA 3NZEA 4J1SA 1I24A 2FXIA 3OPYI 5B4VA 4XSHA 4LHVA 4C0JA 1VHTA 4DDUA 2G1JA 2ZSAA 4E0FA 1V7ZA 2OC4A 3QPWA 4CCYB 3VPXA 2IYAA 5CUQA 4HNHA 1L5MA 2ZSBA 1ZNQO 3A6DA 3DMPA 4JEMA 1XLWA 4X1KA 6AT1A 1BS1A 1PT6A 1W59A 2UDPA 3ZWMA 4CIAA 2R6HA 2CJPA 4S04A 2EIHA 3UVEA 1JQ3A 1GHTA 5KTPA 2H18A 2XCTB 3RANA 1QO0A 4Z4SA 4JB2A 3U1TA 3OQMA 1VJRA 4HVLA 3RWOA 5IJXA 3UFBA 1JHPA 3AX6A 1AKMA 4CM1A 1WUYA 4F38A 5JARA 1IB0A 4K8RB 2IT1A 4H9GA 1XROA 2JD2A 2WWHA 3SK0A 1TQDA 4LHXA 2HMTA 3IILA 3PFNA 2EIXA 3UFXA 1D2MA 2JIDA 3OOEA 4BNJA 3ZE1B 3VC7A 5KMGA 1Z0ZA 1RT9A 1NBAA 2D1QA 3GGDA 5JMTA 2NQ2C 3UJ7A 2YY7A 4F3TA 5I9IA 2IW3A 3L8HA 3Q6IA 4O4JB 1PQYA 1SUEA 4E0BA 1U1EA 3R44A 4RVUA 1WOPA 1M7HA 4X3PA 2GEDA 2J87A 4IF6A 1LW6E 1I32A 3RD5A 3ZWNA 3A8JA 2F8TA 1G9XA 2W5UA 1G9TA 3NI2A 4J0IA 1Q20A 3TVTA 1CQJA 4IVRA 4EX7A 4UUMA 2ZJ3A 1JECA 1EX9A 1P6QA 5DWDA 4X8LA 4XD2A 2DF8A 3VVMA 4I99A 3E3OA 3FYHA 3GNSA 1G42A 3ZGOA 1PFWA 1U9ZA 2PTHA 2IH2A 1KPIA 2QSUA 4Q1FA 2JATA 1V39A 3LTEA 2XUHA 3NBUA 4PYKA 4O4HA 3RUEA 4Z0PA 4BYGA 4D9MA 5CCEA 5EIEA 2AFHE 4JYZA 2CLCX 3PXAA 3G2QA 4EYGA 5F4MA 2AN4A 1CR1A 3HJRA 1KEWA 2O59A 3PC8C 4BB6A 3TG2A 1YZNA 4BDSA 1E9FA 3FGNA 2GX6A 3I2GA 1JAIA 3RKRA 2OORC 3D8TA 3QK7A 2O8FA 1NF2A 5EXTA 4A2CA 1PE0A 2EX1A 4RJ2A 4L9WA 2Z43A 1LTHR 1D6JA 2ZKIA 4LZWA 5FB3A 3T4PA 4PN7A 5KZMB 5KTYA 5EZYF 3R3HA 1GRQA 1Z6QA 1H0HA 4B6SA 1ISRA 1ARZA 1HI9A 3H8WA 5JVDA 3TXAA 3CC2B 5CBKA 2XRZA 2OXIA 1M10A 4PCUA 1RP7A 2OO5C 3TM5A 4P9SA 3RF6A 3WQHA 1AF7A 3I04M 1U0LA 5CIWA 5D01A 1SVOA 4UEQA 1BE0A 2WSBA 4PQGA 1NJ6A 1E9VA 4EUNA 2ES4A 3ONNA 4BKOA 1O58A 3EAFA 4J9UE 3V6MA 1JPJA 4AKHA 2QM0A 3GJ0A 2FUEA 2C0QA 2X9GA 3LA8A 3Q9SA 4Y6GB 2QPLA 4E3WA 4OLBA 3PNPA 3EXAA 5DO9A 3QWIA 2HHHB 4PYQA 1GSOA 2W6IA 5CW2A 1W88B 5KOIA 1REQA 2ZAMA 4II3A 3RVDA 1J9ZA 2W2LA 2V1UA 1GUDA 1GPAA 5LMUB 2NP7A 2H54A 3MQ2A 3MWGA 5FFFA 5CFMA 3HL4A 1HH4A 4F5DA 1JNXX 4AO8A 1DAKA 2A9FA 3RIXA 3IHWA 3P96A 3KQUA 1XQ9A 1GXSB 3L4SO 4L76A 1WXFA 2J07A 3BWCA 1Y5IA 1E5DA 3VU9B 2HU5A 2GD6A 1J33A 2EP8A 4MUXA 4RY0A 13PKA 1RC8A 3RG8A 2QAGA 1JEQA 3LFHA 4BKUA 3HP7A 1T10A 2GPYA 3FY4A 3QX8A 4KWHA 4NAVA 4RLSA 4ZZ3A 1K0UA 4FILA 3RC2A 3TKLA 3WK6A 5CLFA 4HS9A 4QBFA 1GQOA 3KZKA 5L3ZA 5DRTA 2ZZMA 2I78A 3UT5B 1DKRA 1PJSA 2BR4A 2G9UA 4OVKA 3X2FA 4DNXA 3WNDA 1VJ1A 2GZMA 4KGXA 3VQTA 1H9AA 4E6EA 5BR8B 2PRZA 3HG7A 4YDHB 1QRDA 4OHUA 5GV8A 1ZSNA 3GLFA 4PQRA 3JARA 3SX2A 3QHAA 1IATA 3E4DA 2EFJA 3M81A 1Q0TA 1IHXA 5ICMA 2EFHB 1CVIA 1NGSA 1U2TA 3K9LA 4L2IB 4LKOA 3T1YB 4KREA 4E1VA 2EFYA 3RWBA 3D8RA 1YK0A 4FGLA 1EAMA 2FFAA 5EE5B 4KRYA 4EJFA 4JBIA 2BFCA 3EMBA 1HE4A 4MP6A 2WU0A 3KE9A 3VKFA 4ZAGA 3WQQA 3DE0X 4OXYA 4RL4A 2AXEA 3PC4A 1H6DA 4K9SA 5LKAA 1BEEA 5MHTA 3WKDA 4BP1A 4BHTA 3OCWA 4P26A 3V6LA 4ZJYA 3CURA 1XRMA 4QOIA 1FYVA 1QHEA 2RHTA 3UMSA 3QWFA 4EW3A 2F1RA 3PTAA 3CSUA 3GNLA 1A9ZA 1EWYA 2YS6A 4X71A 1ZSVA 1RQRA 3ZTTA 4PC1A 3RVQA 1E2QA 4PEVA 2G71A 4DAEA 1Z0FA 5REQB 1B6RA 2BGTA 2Y1KA 3SMVA 4DN6A 2EFCB 3OWHA 4ZOLF 4F4FA 3M4XA 4IIXA 1KS2A 3ZHBA 2A30A 2KM1A 3R3YA 3GA7A 2NXJA 4ZI7F 3NXKA 5FCDA 4ZYVA 2ZTGA 3EC1A 3WGTA 2H7CA 4FFOA 3W2IA 2R5WA 1HG1A 1T8PA 1E6EA 3TEJA 4KQ1A 5HZBA 3VYRB 4HLDA 2NU9B 5IM4F 2O8VA 4B44A 2LE0A 1LX7A 1XK6A 5B6PA 4RZ2A 1TB4A 3KVOA 3BRWA 3LUPA 3GH3A 2HLDA 4X1IB 4YJ2F 3ZKWA 3N0XA 2FP4A 1A2QA 1TUGA 1W96A 1JJIA 2B30A 5AO9A 4NYIQ 1VHOA 4NJMA 3ZV3A 5EJ5A 3DBRB 3T41A 1WIWA 3IKTA 3OJEA 3NS7A 2Q3DA 1MIHA 3GR6A 3GRKA 2VWPA 3AV0B 2N9UA 1H2FA 3U4MA 1NVMB 1KEEB 4PRKA 2CF6A 2HI0A 3E1GA 3TBHA 1LLDA 4QOHA 4BEVA 5HUQA 5KNDA 3HDYA 4QE3A 1JHVA 1T6ZA 5DM0A 4ICIA 5TRTA 2FQYA 3DDHA 2O8BB 1GCAA 1VKNA 2PSJA 4LRSB 9ABPA 4FYHA 3A4MA 2XOKD 2SKCA 4XDGA 4CQMB 1N9GA 3HRIA 1BH2A 1GR0A 1TI7A 1J8QA 2R7KA 2XYGA 1GD1O 3OF5A 4PYMA 3MRSA 2C97A 3GJXC 1EWKA 1FTSA 5TPWB 5JBIA 1D1QA 1I51A 1WXWA 3EY4A 3WOHA 3JAKB 4YACA 5AVJA 4EFKA 1YU9A 3WK7A 1IBCA 1XZEA 3TQOA 2YJ3A 1OLSA 2E37A 2Q3MA 4C01A 3ZVRA 1IMOA 1ZL0A 3FLMA 4LXXA 1GAJA 3V1NA 2WAAA 1EXMA 4XOUA 3T3HA 2HPZA 3QPAA 5KQPA 1BX0A 2AYYA 3M0EA 2ZBRA 3L0CA 2QNBA 2YH2A 3U7HB 2AOXA 2HSEA 3NYWA 4RVNA 1PKEA 3TAHA 2C7RA 2HQSA 2RH5A 3ZE2B 1DIAA 2OAQ1 3E48A 2I6GA 1M1NB 5I7FA 3TZEA 2QQ5A 1N2ZA 1TZJA 3CPHA 3WP0A 4C3VA 4JLAA 1VPWA 5JJKA 3JCZA 3LXUX 4BQSA 1KMQA 2OYSA 1GGJA 2AK3A 3QELB 5JCOA 2CF4A 3IR6A 4ZREA 3ON5A 4HBZA 2CK3D 3FN4A 3S2FA 1VG0B 4AZWA 4WZTA 3WB1A 1ZVVA 2OFFA 5BXQC 3WE7A 4DSNA 4YXFA 3AM3A 1NASA 4MCAA 1WVGA 3GLHA 1TUBB 3HVRA 3SYMA 3UANA 1XTRA 3M1IA 3E2IA 3JQ8A 4IYRA 1M8KA 2FTKE 4UPDA 1N3YA 4D92A 4YMGA 2Q5CA 2ZWMA 1FFXA 3IDQA 1MW8X 1AU9A 4V0KA 3I2IA 4XLTA 2EX0A 1SD2A 3HJAA 3PUKA 5ENDA 4K6MA 3G2JA 2QT9A 2BM9A 3HO8A 2RG7A 1C1XA 4JSRA 4KN5A 4RVOA 3ZHYA 1YTUA 5EESA 5D6OA 3VYWA 1SG9A 2WNSA 3H3FA 3C6YA 4GC9A 4EI8A 2GAAA 4MR7B 1OFUX 1JU9A 3BMQB 4TKUB 4UXJA 4DB4A 2NIPA 1Q16A 4X7BA 4EVRA 1XA0A 2ZFUA 5LA6F 5DYNA 1TEHA 5AXBA 4QXOA 4BQIA 3HAGA 1Y33E 2LUOA 2RGNA 3FFWA 1OH6A 2IYSA 4I66A 1B42A 4RDCA 3KOOA 2AOUB 2DE0X 2JJ8A 3AJAA 4IRUB 2OXTA 3BRSA 1K88A 3WLNA 4MWEA 1W4LA 5IUKC 1T5IA 3P97A 1NRWA 4Z3DA 1QAMA 3AM4A 1T34A 5J3OA 1A5ZA 2W9XA 4OI4A 3CF4G 3B1ZA 4Y9RA 5A89A 2JL1A 3VVLA 3BJMA 2ORWA 3EC2A 3EWIA 5F9FA 3ZJTA 2JK1A 2VRCA 3WJ1A 4BNNA 3L06A 4H1UA 4D3ZA 5B58C 1LRJA 4F7WA 3PXXA 1TC1A 2IY9A 3A9UA 1XEXA 3O47A 5TQ0B 1LLQA 4J16C 4P0PB 3SZ3A 3ZHQA 2V31A 1HLDA 4EVIA 4HAUA 2HWKA 4IQ8A 4K6FA 4EEXA 3KPWA 1KAQA 3UJAA 4E2WA 4GLJA 1MX5A 2VPXA 2W8BA 3R6LA 3F8WA 4MIEA 4MUIA 4Q0MA 4ZT3A 3S4YA 3GAMA 1M5RA 5FJJA 4ARUA 2R1UA 5D87A 4BO4A 3HV2A 2BLNA 1W49A 2VPYA 3BNWA 4HYTA 1WEHA 1QIHA 1X0XA 2L42A 5AH0A 5KYUA 4D80A 4DABA 4ZYWA 1XXHA 1NJID 4I3HA 4CLRB 1PFQA 2PZ8A 4PG6A 3A9SA 1AGXA 3RODA 5CAEB 3FUTA 1P2DA 4DR6B 1WBDA 1J99A 1I1NA 2B3TA 2ZIGA 1CUYA 3JQ9A 3K92A 1R7RA 3OM0A 4RKRA 3QPCA 3ZWPA 5AVXA 3BJRA 1YTLA 1KGSA 2PD6A 2IWHA 4PFSA 3ADCA 1TZ2A 1AN9A 2WIFA 1G8JA 2GJSA 4CMIA 4QUHA 4M8KA 1Y7IA 3WMXA 4MICA 2A1UA 3QHQA 1ZHFA 3BMOB 3N87A 4LCJA 3SZGA 3ZYCA 2XBUA 4F1KA 2UVPB 2J33A 2XDQA 2ZRJA 3NBQA 3Q6NA 3TH5A 4C78A 1LKZA 1TTQB 3KVNA 4PYIA 5TV2A 1UANA 3CH4B 2V54A 1WETA 1E79D 1M1YA 5FF9A 1AD2A 4KDRA 1G18A 5F98A 1SB8A 4ID9A 3ZZ0A 1AMOA 4AY3A 3DWGA 3TLYA 1QFYA 3L1HA 4YJFA 2ZCVA 1RABA 4G9BA 5TARA 3ZX5A 4D9IA 2HYIC 2PMEA 1U8ZA 2ZQYA 3I39X 5EMMA 3OJLA 3F9RA 2Q0SA 1XRJA 1GRRA 4GZ6A 1ZW6A 2FXVA 1IVNA 4JP8A 1N57A 3AVVA 2ESRA 4NV1A 2PFGA 2JGIA 2VHTA 5AOCA 3GOQA 1I2ZA 3EEIA 4OXQA 1EYZA 2P4EA 2WVGA 3Q9UA 5B12A 3U3KA 1KYZA 2ST1A 1SR8A 4RIFA 5FTJA 1XG5A 5HIIA 2NUTA 1HOTA 3EF3A 1DJMA 3II6X 2ZUSA 3AFIA 3H2IA 4HZUB 2QGGA 3U60B 3NHLA 2XT0A 2CMFA 1IG3A 2WF5A 2XDAA 1R9MA 2XGSA 3ME5A 4RPLA 1WXDA 2PUJA 1PBTA 5H1YA 2D5CA 3FUUA 4FB4A 3RASA 2EDCA 3JYLA 1M6WA 2AUNA 3QVWA 3DMYA 1KFJB 4RCVA 4UQPA 4A36A 1KJNA 4K6HA 2HF7A 5C1BA 1GPUA 4EUFA 4IXTA 3K05A 2YKGA 4DCGA 5D8DA 1L1RA 3OJWA 1SA0A 2EGUA 3K1ZA 2ZJ5A 2D1TA 1Z0UA 2WP0A 3DEZA 1VLYA 4DNOA 5ICSA 4URHA 4Y2GA 4YFYA 4HCJA 1BOFA 1Y1LA 4JC8A 4XSGA 3A7EA 3RAPR 5MF6A 1QKKA 1JHXA 4LBZA 5KSZA 2YCBA 1C9JA 4RD2A 1DAHA 3SKVA 5HMMA 3WL7A 4RTQA 1FYXA 4X45A 3GEMA 3PNOA 1M2HA 4MO9A 3GPLA 4OGKA 1TW3A 3R7DA 2XMCA 5JUWA 1QTIA 3OFSA 2WP8J 2ACKA 2V4MA 2P1ZA 2AW5A 4OL9A 1JKJA 9GPBA 3CIFA 3SQLA 4OI2A 5BWNA 3IUYA 1XVIA 3MB8A 5TS2A 1K7YA 1QIJA 3TAXA 4BV9A 3FLEA 1BO6A 3KJZA 4PNZA 1PEKE 1SAYA 3JWEA 1GPWB 4QL3A 3O8LA 2Z0MA 3A9TA 3BJIC 3G0BA 2ODWA 1MQAA 1PJ8A 4F2GA 1GL6A 2J09A 3Q3GE 3RY8A 1J70A 2V58A 4UHJA 2ZAYA 2B78A 1GDHA 1N2CB 3CCEB 3VM6A 1QIFA 2BTOA 4ACBA 1N8NA 1V8OA 4BUZA 1LJUA 2UVQA 2FEXA 3F8TA 3AVPA 3ASSA 4CIDA 2PLWA 4C6TB 3S2SA 4DSUA 2GAFA 1HLGA 3Q5EA 3ZZUA 2AX4A 2HCBA 3HP1A 2QRHA 3IP8A 5BN5B 1L7DA 3WGJA 4Y6OA 5GONB 2M9MA 2YASA 4CKCA 2WBLC 1KMIY 4Z54A 1A2OA 2RGDA 2VHCA 4A2QA 1U90A 3HHEA 3O74A 2KB0A 1MGPA 4HKTA 3WHIA 2JI6A 5ESWA 2ZSJA 3R41A 3BY2A 1S2OA 1FP2A 3BSSA 3TGLA 2A9QA 5ULLA 4CGYA 4K88A 3FRHA 2RC5A 2ZZQA 1PV2A 1NB0A 2ZAOA 4N0MA 2XD4A 1N33B 5EIXA 3IJRA 4V02A 3PNMA 4M1KA 2Z9DA 1GL3A 1UP6A 1J2YA 2Z5FA 4CU2A 1U5BB 1YB4A 4WOJA 4WWVA 4IV8A 1IZZA 2Y0CA 1A9RA 4C14A 1KFCB 1QLHA 1RXIA 3A6LA 3G0CA 1NMYA 5FWDA 1KSGA 2P5UA 3CNLA 3PXCX 2PWBA 4JOSA 4NJOA 4OQNA 1M5TA 3BHNA 4RM2A 5CNIA 4L8YA 3LOPA 3WTCA 5LU9A 1Y37A 2F3PA 4FFBA 2CMHA 2AHOA 2CXRA 4UBMA 3ID6C 3OX1A 2P3MA 2YZGA 2EV9A 1JA0A 5GZ3A 4HBGA 2Z04A 3LOUA 2P3LA 5BPHA 3UJ3X 2O2XA 4QNRA 4Q1BA 5E6UB 2Q99A 2CXTA 2RAUA 3JPWA 5IT4A 3JVEA 3MZ0A 4YCLA 3CY6A 1YQEA 4ISBA 5L3SA 3DJYA 3QKSA 4KPGA 4YMTA 5AJVB 1GKKA 2CDAA 3KOXA 2ZI9A 3V4OA 8AT1A 4E31A 4X07A 1TKRA 1E92A 4E4YA 3RSOA 4TKVA 2B7BA 2C2YA 1I8TA 3TCKA 3PXDA 1TD9A 5GMOA 4F5ZA 4HDMB 1GG8A 4EP1A 2JAWA 5BY2A 5LZ7A 4KHPB 4CLEA 2B37A 2WJPA 3IAAA 5EAIA 1VA4A 4UNPA 2A5DA 4KBGA 1T9KA 3DPSA 3L0DA 5HPYB 1YK1A 3QXSA 2MCFA 1V0FA 2AKYA 3ZD9A 3O4RA 2WSIA 3K6SB 1H93A 3NC1C 4JMQA 2FPOA 4GFDA 1T29A 4TS1A 1ZN2A 2J67A 2YW9A 4ARZB 1QC5B 2NO7A 3JYQA 5D5PA 4NLLA 5KC8A 3DCIA 4MKGA 4EFMA 3RVJA 4E94A 1OH5A 4YDQA 2C92A 3BILA 5HCNA 3SE0A 1TCAA 3EBPA 3P2EA 2OBBA 1ZIDA 4NQRA 1LWNA 3AEQB 3D3EA 3EE6A 4G5RA 4KE6A 4R05A 3RR2A 3WWCA 1GPMA 2OR3A 1G2OA 3H1EA 2G7ZA 4Y2PA 3IIKA 1E8DA 1DJPA 3DUWA 1NNEA 1MMFB 3G5AA 4HLQB 3Q3IA 5HF6A 5L45A 4D0LB 5GV7A 2ZR8A 5FWAA 1XGKA 4J43A 4IG4A 4P3PA 1YIJB 4EI2A 3GJTA 5CVTA 3VR4H 2YR0A 3QKRA 1AS0A 3BWBA 1SBTA 1UOOA 2G17A 4INAA 2Q9UA 2ZUDA 1L7PA 1NA5A 3DB1A 3GEGA 1OFTA 4G41A 1KIFA 1X0VA 2VDLB 4JEHA 3A27A 1H9BA 4NFYA 3GSIA 5F9HA 1QGZA 4QUKA 2GNPA 3Q15C 2XGOA 4WZAB 1Z0DA 4JJFA 2VUSA 3UQZA 3V3KA 3CCLB 2AUMA 4TLMB 1BC5A 1TYAE 2DKOA 2H9AA 4NU8X 1TT5B 1MC4A 2ZVQX 4ID3A 4OK3A 4QEKA 5KMGB 3GT3A 1A9QA 3V8BA 4EHBA 3WI7A 1Z7EA 3ZW8A 1P33A 3KEFA 3LYUA 1D2EA 4J07A 5KAPA 5T4FA 5THXA 3RYIB 3CZAA 4XOTA 3L9XA 4DLTA 4YMLA 1R3DA 1WMEA 2O5EA 4QFMA 3LC1O 3T9BA 1NN1A 2WAYA 3KXKA 1UDCA 4MRMA 4EMTA 1EVLA 1IN5A 4TMTA 3KXPA 1QH1A 2KI5A 4HDQB 3RV3A 2ZIEA 4ZHSA 1VQOB 1DU4A 3I4CA 3PGMA 1MRZA 1EPUA 5A6SA 3L6BA 2QP3A 2GRAA 1MT0A 4EB6A 4M36A 3KQKA 2XKAA 4XNFA 4FYVA 4WK4B 2E6UX 1W7AA 4M55A 2VQDA 2F8SA 4C7JA 1XFDA 3DZCA 1YDWA 5LD2B 1VRVA 2FWBA 1VJ5A 2RHCA 4H77A 1JI0A 1XMXA 3VI3B 4L5BA 1XCOA 1U7TA 1H2HA 2P2ZA 4B4DA 1FQKA 2G8LA 2IEBA 2Z2IA 2VK2A 3PNVA 3IA2A 5EJEA 4XD7D 2G0NA 1UJ5A 4PPGA 3NBMA 2GJKA 2YWGA 3O1JC 3ZGZA 1XVVA 2E7ZA 3PITA 2ZWPA 1ORIA 1SGWA 3KUKA 1Q82D 5HFAA 1D03A 3M83A 1R0BA 4S2UA 3PLNA 1M83A 2H2FA 1P1CA 2GCIA 4LC1A 1LTKA 2WIJA 1UUFA 2DFPA 2LV8A 2G1PA 1JJBA 2A35A 1XR3A 2G4LA 3KQNA 4Y7CA 2AVDA 4PSUA 4R81A 4HLNA 1ZOOA 4WADA 1MHTA 4HYQA 1DIHA 2CW5A 1RLIA 3GGOA 2PLAA 4RY9A 3LHKA 2HZ7A 2IDJA 4IVPA 4QPCA 4DDHA 2BSQA 3W5VA 1QJ4A 1YFKA 3ELYA 5HUHA 3WA7A 5JS7A 1OUMA 3MM4A 4N4AA 4YCSA 5TC4A 3F5FA 5E2AA 3ECAA 1SVMA 5JANA 5KBYA 2NSJA 1W9XA 1FMTA 1Z4MA 3QG1A 5JCPA 1C7ZA 3DZ8A 3TR0A 4Z4IA 2ZSIA 1SB9A 5FBKA 3IALA 3DLAA 2Q8NA 3PEFA 2YWBA 1QFZA 3IMKA 4MA4A 2XXJA 5L9AA 2DTXA 4IS3A 3BX1A 3OQ6A 4KXQA 3SS8A 2JFOA 1KC1A 5BUZA 5K8UA 3M6XA 4OM8A 2ZJ2A 1E4VA 4J9VA 4DQKA 4LCBA 5H83A 1XV5A 4YP9A 2XCLA 3E7XA 3AGQA 4CR8A 4GKVA 3D4OA 3PUHA 4H15A 3SYRA 1U63A 3HDTA 1T9GS 3NM4A 3I73A 1IQPA 1IY8A 2CZCA 4D3SA 2VYNA 4MMZB 2JIRA 3BK1A 1PR6A 4TT3A 3DV0B 3PB3A 1GVNB 3TFQA 4DR4B 3RT9A 1NAIA 3K4QA 3UXHA 1PNQA 4MHTA 5BV8A 2VJDA 2YUIA 3JZDA 1G59A 1NXSA 4F4HA 2VQFB 2C54A 1X3SA 3OJ0A 4JXKA 1W87A 4ESVA 3EXG2 3HB5X 3KJHA 4AXXA 4GPAA 1OTHA 2AN9A 5JD6A 4M21A 1VE3A 1JIUA 2C29D 1G6HA 1BNCA 2W2TA 3TR5A 3ACBA 1G291 1RXUA 3A04A 3NQ41 4R0VA 3GP3A 3HM9A 2WSSA 1I3KA 3EASA 1K08A 1XTQA 3EZGA 3NDRA 1O4WA 2D4AA 3CG4A 3NBZC 1LUAA 1VECA 2ORED 4FKBA 5BSHA 5I7OA 3THYB 3GMDA 2IV2X 4URVR 4KG7A 4WPGA 1BOOA 3CUWA 3MRXA 3TX2A 2XCQA 3QFHA 1JHUA 4B3IA 1JGTA 2FPPB 1U5CA 1F51E 4KU4A 4MULA 4DZRA 2BFCB 1RAHA 3CCUB 2LIVA 1DIRA 2NAFA 1A71A 2QRGA 2Z58A 3WLMA 2OKCA 5JT1A 1WMFA 3SJ7A 5B7NA 4W8HA 4BJ5A 4EIWA 1I4WA 2AB0A 1BN7A 1WHTA 1Z33A 4FXPA 4KW7A 4MV4A 4Y8VA 4G09A 1SBZA 3BXGA 2PD4A 1OPRA 2R3SA 1F6BA 2XYVA 2XT9A 1QIEA 3V4ZA 4U6SA 5KVSA 2LGJA 2VWQA 3MOSA 4OQEA 2OGTA 1X9IA 4XMYA 1PLJA 5C8VA 4AWAA 1FFYA 4AP6A 2C31A 5JNLA 1HBJA 4N54A 5F3DA 4X97A 2DR0A 1P4MA 1Y1QA 3G9TA 2AGVA 2DJ5A 4RFVA 2W6NA 1TM7E 5A7HA 4PC6A 1PSZA 3O4JA 3OAAD 3L1KA 5K6RA 2OV1A 2WHQA 3QMPA 2R8EA 1QCCA 2B1QA 2OPBA 1CUUA 3IT0A 3PT5A 4EKIA 3B7PA 3OM8A 3BH6A 3SVLA 1EVQA 4HTFB 1CS0A 4DNFA 4GRDA 4LZAA 4N3BA 4QDTA 4Y2TA 2CLDX 3DOUA 5HZKA 2B25A 1RFLA 5IK2D 3S8MA 5FH9A 3MINA 4J90A 5TY0A 1HYGA 1Y3IA 5EXXA 4L0MA 5IZCC 3BB3A 3FM9A 1JVSA 2ECPA 4NAHA 4F6CA 5EKDA 2W2KA 4UNNA 1TLFA 3K72B 2B82A 4J0JA 2J6BA 4J6FA 2BR5A 4X3CA 2BFAA 3A25A 4Q1VA 2CHEA 1WOMA 2JIMA 2WB4A 5BURA 1VYVA 1V3UA 3GVLA 5KEIA 2ZIAA 5T5QA 4BLVA 1NI4A 4J29A 5F76A 4RTOA 4ECEA 1YRAA 4LSGA 5A5EA 1YMVA 3NOQA 3CO5A 1XDUA 1R4AA 2D62A 2ZI3A 4JX8A 5BV0A 3IEIA 5BRNA 1Z2EA 4DEVA 1LVUA 1L8LA 3F6CA 2PSFA 5F78A 3KLNA 3B78A 2FPKA 3AHJA 1CYEA 4Q7EA 1ZD4A 3R9KA 2PWAA 2VTEA 3GLKA 4H1WA 5ITZA 1R66A 3DCJA 2RJOA 1URPA 1C0LA 3D3JA 1NP7A 3M3PA 4L5CA 4MUAA 2QTTA 3VGJA 4CG1A 4V1CB 2Q5QA 4OI0A 3QA3E 1TKBA 2GTHA 5BSKA 4MUBA 4IGKA 1JDSA 4BTLA 2K6GA 3OJFA 1DINA 3OPNA 2CVZA 5FV7A 3IEVA 3OTQA 3NVKI 2GESA 3GLIA 1OWLA 4XR9A 3OE5A 1CZNA 4L0QA 1QFXA 1TVKA 2ZTHA 1KEZA 3P0HA 4GECA 3X0DA 2XEDA 3EXHA 3QIAA 4ZVQA 3DLBA 3I5MA 2Z6QA 3N2IA 4HDAA 2WSMA 3ZXSA 1CEYA 1G60A 2AI2A 4FZ3A 4RJKA 5FA8A 1I01A 4UASA 3T7CA 4LJSA 3UICA 3EFBA 3TPFA 3E23A 4F4JA 5J2UF 2IEDA 2WYUA 1U0OC 2GXUA 2WZDA 5LXTB 1KZ7B 4MVXA 2H52A 3FFBA 2HTEA 3B9QA 1BXRA 4L22A 4X92A 2A7QA 3MMSA 4YRJA 1WSDA 4PHTA 3HCFA 2AIRA 3P9NA 3EQ9A 4JD5A 1FP6A 4EY8A 4IMIB 3BTVA 2VDJA 5TQVA 4AJPA 4MV8A 2WZBA 3IAS1 1XJCA 1XZNA 2JLVA 3VZCA 1K8XB 4TVSA 1GNLA 4N0DA 2RGGA 3JS5A 1MP0A 4J1NA 2GHRA 4RE5A 4XKJA 1PJBA 3OUTA 1ZK3A 3IQHX 4EJ0A 3SHOA 3H3XA 4PAOA 4BNVA 2PRSA 4HNTA 4FJ0A 4EQ6A 3T3EA 1R50A 2JI7A 1O7JA 4EDFA 5KOJA 1FFXB 1BFUA 1XALA 2I1WA 1X8XA 4RSRA 1QMPA 1FW8A 2RONA 3RBVA 2FN9A 2ODAA 3GG9A 1QE0A 1QHIA 2OLKA 1P6UA 2QB5A 2TMKA 2XVAA 1L5SA 2VNKA 4GX5A 3CNNA 4P9NA 3FPGA 2PH5A 4C2UA 3ASUA 2FPXA 5ERGB 4YUWA 1UINA 4E2ZA 1E2EA 3D4NA 4XLHA 2OHIA 2VC2B 3E7PA 4R9SA 5DH9A 3UMJA 3N75A 4ETIA 4DV0B 5BYAA 3FKQA 5KIAA 2VJNA 3QXHA 4R2WA 2H2WA 3OE7D 4XX0A 3GJ3A 3T3MB 5A4MS 1SBHA 1BE8A 4A6PA 3B60A 2AVNA 3OLWA 2HUNA 2BH9A 5FPTA 3GCDA 5DT9A 3RSZA 2B0CA 2QMYA 3KYBA 1QS0B 2A0YA 1FYFA 1KEUA 4IGIA 1H3FA 1ISHA 3CCVB 2HCTA 3DHWC 4FJ1A 2J45A 3OVMA 2BLLA 3GJYA 2R79A 5JH7A 1KP3A 3RU3A 4I9FA 2HRQA 4RHYA 3B7WA 5DOZA 1VQ6B 3ORQA 4RZUA 4MUJA 3G6KA 3PQ6A 4JNKA 4PZPA 1FFSA 1K5GA 1ZXBA 4MEAA 3WDMA 1GDTA 3LFTA 1VQMB 2H9IA 5AI0A 4PC3A 1A9YA 1SK8A 4CUKA 5KSPA 2CE2X 5TLSA 5CM2Z 2XT6A 4CT0A 3AKYA 5ALQA 4LJLA 4ZOBA 3HMKA 3N7UA 2ZI5A 2HF8A 4QRHA 1VPDA 2GHQA 3NB0A 3PPWA 4ATNA 4BBJA 3M2PA 4AF6A 2O3RA 4RV5A 2MJLA 1EFHA 3FD8A 3T4XA 4ZDJA 421PA 2ZJAA 1GNRA 4GSKA 2IYFA 2XA1A 5KYUB 2O0KA 3U0VA 1GEEA 3OKPA 1XXHB 4N9QA 1WD5A 4G0UA 2WM3A 4KFSA 4PCLA 3BCHA 3L7AA 2R1VB 1EFVB 1N1GA 1PZHA 4FFVA 3EYAA 1CEXA 2BRUA 4BZWA 1WOYA 1I80A 5IYPA 2DH5A 2NYVA 2ZYWX 4W63A 5EVCA 3RRBA 3TLKA 1T6XA 3H5OA 4L0CA 1NDUA 2OSBA 3U7IA 1V11B 5CA1A 1FUEA 3JQAA 4N47A 3OIUA 4BFZA 3KB8A 4RNCA 1ESMA 4FHZA 1M5UA 3T7JA 3H9GA 5IT5A 4IF4A 2JJ1A 4HUJA 1IY1A 2FE1A 4IS2A 3SF8A 3T5BA 3K6RA 2H1IA 4QG7A 3W6ZA 3FJ1A 4GMGA 3E1YE 2HCFA 1L8QA 2AFIE 1I6WA 1WF3A 4E51A 2NPOA 4HPXB 3VTZA 1XL0A 3ZH2A 4FC6A 4RD0A 2NUPA 5MFPA 1E3EA 3GZNA 4XLFA 2AG8A 3PDWA 3V3TA 1Q14A 3ZCTA 3ZZNA 5BQ3A 2GT1A 4P7GA 2DPGA 3IAEA 3W8RA 1E3LA 4YRNA 1E58A 2JGNA 4BQQA 3HKEB 1M7GA 4Q4JB 3KKQA 1ZSYA 1N05A 4G65A 3MQ4A 1H5QA 1QG0A 4FTWA 2JKVA 4NBWA 2WJ3A 3I56B 2ABWA 3I23A 4OGGA 4B7CA 4J0GA 1S2DA 4DW8A 5J1SB 1B3BA 3C5HA 4NBRA 2ZYDA 3IBSA 4D82A 2SHKA 3KWMA 4Q3AA 3GQVA 4RGBA 3CW8X 3V2HA 1NVBA 2P9JA 1JDVA 3RC9A 3SIWA 1IXRC 1PJRA 4AS1A 4CMEA 1W0JD 1U3UA 2NUTB 2P9EA 3I58A 3IELA 3M6FA 1QB8A 1Q11A 4KIFA 2BCJQ 4V0LA 1QRTA 3MJ4A 2XSZA 5JJBA 5C35A 1M0SA 2FX2A 5LOVA 2XDYA 1YHYA 1RM3A 1T4CA 3VZPA 4U7HA 5I7WA 1RR6A 1E5LA 2J4FA 3U3ZA 4JVLA 1HNWB 1PL6A 5JBNA 4CBVA 1J90A 3RVPA 4DLAA 2ZJ1A 4US2R 1UKVY 1CJKC 2VBGA 3G88A 2VF7A 4LSZA 4W82A 1L7RA 5ER9A 5FDFA 5I48A 3HGMA 1H2YA 1P74A 3FCUB 2B1IA 2ZAGA 4G5YA 5CXUA 3WYNA 3TJMA 1KJQA 3RROA 5JTTA 4K3VA 2O2JA 1O3YA 3O2NA 4NBVA 4RZ3A 5K0EA 3V4VB 1YR7A 4FDTA 1V26A 1D4FA 4OHWA 3W79A 1JH9A 5AXDA 2ET6A 2R1ZA 2WIAA 4GLLA 1FY2A 1KOFA 3QU9A 2ZRAA 4OHOA 4Z2YA 3AXTA 2XBMA 1AE1A 1V47A 2IX9A 4B43A 2XTAA 4G0ZA 4EQZA 2RCNA 3WXMA 2AA3A 3H5IA 4OQFA 1DO2A 4KXWA 4EY7A 3QX3A 5DEOA 4RADA 3TRKA 4F86A 2HCRA 1WR8A 4DR3B 3MCVA 4LE1A 5DM60 1NLYA 4RC9A 4GKKB 1NW7A 5CB4F 1YB2A 3SDSA 3MAAC 4IH1A 4FUTA 1K5PA 4EHDA 1HC7A 1JKJB 2C9ZA 2VXYA 3I9MA 1OYWA 1L5RA 1SN7A 4FFWA 4GGOA 1MXHA 3BGDA 4P4TA 3RNOA 1AKYA 2PMKA 1WQ3A 3M9LA 5CT8A 3WLOA 2HGZA 1TZMA 3OUZA 1D1NA 4Q9NA 2XCUA 2IWRA 4ZYZA 5IMSA 2UUPA 3K70D 2OTLB 3KTAA 1YS7A 4QTTB 3BFKA 4KBFA 2GN8A 1ZM3A 5HBRA 3VKVA 2I4NA 1QORA 4RA6A 3JQRA 2W70A 2EBWA 3NHSA 5J40A 4HDRB 4FS8A 2WMYA 3AJEA 5DNYB 1N2EA 3L02A 2C99A 3D7RA 3TVYA 2AN5A 3FW1A 3QBEA 1QO7A 3D3QA 5AHOA 3T1VA 1AK2A 3MTDA 4MYCA 4ESOA 1JEDA 2IE8A 4KQFA 4BVKA 1HORA 2VF4X 5HILA 3TN7A 4HNAA 4IY1A 1P19A 1VFNA 2IPLA 2OXCA 2QAGC 2WW8A 4KKTA 1XSEA 2XMDA 4X8IA 3QG5A 4HR7A 4PBRA 1P4JA 3RO7A 3RU9A 4WZ6A 4ER7A 1GOTA 1PP4A 3GYBA 1NMSA 1YQGA 4R1SA 4R1TA 5EXPA 3TLEA 1EFRD 2OP0A 1BROA 1B8UA 2YFKA 5E7MA 2GNOA 2EVWX 4WA8A 4ZVOA 3BZUA 3DHEA 4OFWA 4DJAA 3BH7A 4LTDA 1L1EA 2B83A 1KOGA 1FSGA 2FUG1 3D4BA 3FPAA 2WWIA 3KT3A 3I32A 1FSFA 3QYFA 4MK4A 2OQVA 4ARSA 2O3SA 2HB6A 2PXXA 1RHUA 5BV1A 3RS7A 3LHDA 4J4TA 3T9EA 3V7UA 4XIYA 5BRAA 4S3MA 5DMXA 1FUKA 1C3OA 4DSTA 2BSAA 3RIYA 1KI7A 5CIYA 3UT6A 1PSDA 2JFHA 3GZTB 1P9LA 3V8EA 4C0XA 2IZ0A 3JYNA 4HJXA 5JHHB 1U1GA 5G0UA 2C77A 2VHYA 4MA0A 1X80B 4PGAA 3WO1A 3DZFA 3TDNA 1CRPA 1B8NA 5FOTA 4O3MA 4G9GA 4K5QA 4XCQA 1RYMA 2JB9A 1D2RA 1FU8A 1T9HA 1JG7A 1MABB 2WF6A 1RM5A 3QP9A 3SP1A 4E13A 4HV4A 4DA9A 3PHLA 4Q82A 2RHGB 5DTJA 1E3WA 3IV7A 3QEKA 1USGA 3C5CA 4HP8A 4W7SA 3PZBA 5EJ9A 4RH1A 2DQ4A 1GZ4A 2EBFX 5B3JA 4BE4A 1ATZA 1ECBA 1Z5ZA 2I4MA 4RO0A 3CINA 4EK9A 4XGIA 5DNEA 2LZ0A 1E8MA 2QRPA 2RIPA 4TT8A 1G8KA 2JIZD 3QKSB 5F35A 3WGHA 2A3RA 3EQZA 1PK8A 5AI8A 2JARA 5EXEA 3K4HA 2REQB 4DCPA 2O06A 2QRMA 4CLOB 3IAM1 1GJRA 3W2HA 2IXGA 4ALLA 2P30A 1ISMA 2BFFA 3JVVA 4Y6SA 3X1MA 2QJTA 4ODIA 1SVKA 1EDZA 1Y1KE 2ZXIA 3Q5DA 2CLMB 3RHTA 5CDUA 1OXSC 4NICA 1N2CE 4BVEA 4RHEA 3HR7A 1IBSA 3D8NA 3T38A 1F4PA 5BSXA 3PKIA 4A82A 3KSRA 2YMQA 3T3OA 4M87A 4BL5A 4MWTA 5BR7A 2XQKA 5AXCA 5HIAA 3ESZA 3L7KA 2HQ1A 1SPXA 5JCJD 4EUKA 3E9DA 5LDDC 2EFGA 3VPSA 2WJHA 3ZY6A 1CXZA 2ZR7A 3F73A 4OJTA 4R9UC 3SQXA 3OF2A 1VGVA 1RWVA 3C3AA 1E9BA 1ZK4A 3JR7A 1UJ2A 4MYDA 3RFUA 3T7SA 3ZKAA 4M1QA 1WAMA 5BWMA 3KAQA 4CN9A 2JLXA 3KTDA 2G80A 3C6KA 3HFSA 1XRRA 1ESNA 4FHGA 3NANA 4EVQA 4JVSB 5BMVB 3HU5A 3GI1A 4NU0A 1C80A 1EK6A 1RSZA 3DV9A 4ALIA 2QUJA 2QIOA 3VR5D 2POCA 4IHKA 1L4KA 3CG0A 5DYGA 4CDGA 1LK0A 2VSNA 5E7JA 3WK5A 4U7PB 3FSGD 1Z5OA 1T5LA 1T2FA 2J9YB 3EXFA 1PL8A 2YNMA 3TZQA 3F4LA 2PXHA 3FUWA 3LX4A 3B6JA 4C7KA 3ER9A 4OQ4A 5ARCA 10MHA 4PGOA 2X9NA 4A16A 1T5OA 3OCXA 3QLTA 1XPRA 3RYTC 4BY9E 2DX7A 5B3KA 4DR1B 5IBRA 4Q3LA 4Q6BA 4CKYA 1MDFA 2ONZA 3ZE7A 3FVVA 1CUFA 3W7BA 3ZW9A 3ZY3A 1EFAA 3DOEA 3AOGA 3WAKA 4YELA 1VQ8B 1K7CA 2J8ZA 4KXVA 4BQNA 5K0TA 1N25A 2XZLA 1WUHS 4Q9LA 3WWOA 2G9QA 1IXYA 2O5CA 4QLAA 3C98A 1LFAA 1K5HA 2CV0A 1ADJA 1VDMA 5JTUA 3FNEA 1T6BY 2QUBA 4QO8A 3E58A 3JAWB 1H2RS 2F6RA 1TAHA 4TTVA 1JT2A 1HDEA 1SC9A 3OZBA 5FPHA 1E2NA 1GQSA 1H65A 2IPNA 2PFSA 3CF6R 5A6SB 3QFSA 4IGFA 4EB6B 4MJ7A 4C0BA 4A3SA 5J4KA 1BDMA 2BGIA 2AEEA 2HSJA 2YXPX 2QM7A 2QU8A 4P4UA 5H4GA 3ETNA 5C8YA 2DUUA 3E82A 4OHZA 3VNQA 2CHVA 3H83A 1GKLA 3TLAA 1GAQA 4AO6A 4GPZA 4B6EA 5CMLA 1EX1A 2VG8A 4JR1A 5CD9A 3H42B 3HCWA 5HJ7A 3L6UA 2HXSA 2WUEA 5FQOA 1GFZA 4B81A 1A8HA 4L8WB 5EGNA 4G26A 4P2GA 1JEEA 2XTNA 2WKQA 4CEJA 3QWHA 2RHJA 2B8WA 3MMNA 5IAAA 1A04A 2VNSA 3F7TA 4DZZA 4HRAA 4CF3A 2PPLA 1E60A 3I5AA 1U8AA 3CH6A 4LHYA 1OW3B 1XD8A 4Y2YA 5DF1A 5FI0B 3O8OA 4ITVA 3TCXB 3L7YA 3IQWA 3JVIA 1YF3A 2JHAA 2EW8A 4U63A 2WWRA 3VR3A 4YV0A 2A84A 1VI6A 1PJTA 5ED4A 3NWPA 4C08A 3IFSA 1QFMA 4CG0A 3GFGA 5HZHA 1S02A 4BLUA 3PSAA 1QHGA 2JIQA 2WR8A 1MRNA 2BUBA 1WUIS 3GZJA 2GK7A 1YZKA 4JI2B 3X43A 1JQEA 4E1AA 1HFEL 3V7AA 5HVNA 3BWYA 4GI1A 3OIFA 1JHOA 2RGNC 3IVRA 1OZ0A 3I1JA 3VKGA 1U4OA 1F38A 3E7FA 3JZFA 1SKQA 3OPXA 4AG3A 1IBMB 4AJJA 4XGRA 4BLPA 1YZQA 5FUMA 1ESZA 4BIMA 3H13A 2FZWA 4JKOA 4JROA 2J5KA 3D5TA 2NT4A 1AUPA 4AQDA 4YJHA 4F7DA 4W1QA 3ERCA 3UH1A 3DBLA 4KJXA 1LFDB 4AXBA 1D4AA 3M6IA 4ONEA 4YA6A 1Z6AA 1I4OA 3KL4A 2H59A 4I8XA 3V00A 4G6ZA 4L73A 1NBWB 1WEKA 1ZWKA 3AB7A 3RU2A 5IXYA 2A4KA 2ZIVB 4RPHA 3O84A 3VC2A 3WY9A 1VJ0A 2BTQB 1E9EA 1SXGA 2G04A 4WJKB 3GD7A 4G0MA 4PG7A 2BZGA 4D3XA 1EESA 2HTFA 4NR0A 1YJNB 1V16B 3RK0A 1GCGA 3CCJB 3I9OA 4DY4A 1EM8B 5IYZF 3DVLA 5ECWA 3RIHA 1GCUA 1Z5VA 5T4HA 1H0RA 5KOYA 2O6LA 3CGGA 2I0FA 3WGGA 2GRUA 4TV9B 3EVTA 5C5EA 3FYUA 3DSRA 1VLLA 4HLUA 3LNNA 1T4MA 1BPLA 1ZD3A 2D2XA 1WPCA 3DG9A 3V76A 4FIDA 3OLQA 4BFXA 1BVHA 1Z07A 3JQ9C 4ZEOA 1P6XA 2QQ0A 3FXAA 2AG1A 1UEIA 3L5KA 1GITA 4DJJA 3ED5A 4GW3A 4KVFA 4J75A 1DOZA 2HKIA 1DPFA 3UJDA 1CP2A 5TQ2A 3X1DA 4YROA 5TEVA 1WCXA 1U0SY 1CVRA 1VKOA 1UKZA 1U81A 1PVOA 3LD9A 4ZWNA 3ZD8A 1E4OA 1U4NA 5BSMA 4HDSB 1WHTB 2L19A 1XVUA 3FMGA 1UAYA 3MWLA 3Q7QA 2V5UA 4FE3A 4I5EA 5G3YA 5CYPA 2R6CA 1YFLA 3K70C 3C15C 3N28A 2VUHB 3I4FA 1R00A 4GQAA 2GEVA 2OTCA 4B3GA 5CGZA 2A5FA 3R0ZA 4BCCA 4TMKA 5LR6A 2D2EA 2BBSA 1TE2A 2ZBFA 3H9UA 3R7WB 3GJ4A 1A2KC 3LL4A 3AWIA 4FHCA 4D8TA 5K4GA 1JRLA 4G4IA 2PVCA 3IXMA 4H7DA 4HDOB 4P5EA 1NX6A 4L95C 3LG2A 4YASA 4B6FA 5K0SA 1Q7EA 3H2HA 1SELA 1X87A 2Q07A 4OH1A 2R4TA 4M8NE 4BU1A 4ZRMA 2HOQA 3S8EA 3ILVA 2QZ9A 3RFVA 1OJLA 2RAPA 2JRLA 2QK4A 3Q3CA 4B7ZA 2JHCA 3KDPA 4P93A 4AKEA 4GWGA 4ENVA 2PKQP 2KVOA 4MW7A 4WLVA 2RJ3A 1PFGA 2O05A 2QRKA 1RJ9A 2C9OA 5ILQA 4MQBA 4R8LA 1M8PA 2GZSA 5EI5A 3AIKA 3RIEA 3AEYA 2X6QA 4RESA 5HYVA 2CT8A 1KORA 3DT9A 4IEEA 2QA5A 1XKTA 2DWPA 2IHZA 3TLZA 2QD4A 2TMGA 3TO5A 4DLLA 4XUEA 3FFAA 4IJUA 4NV3A 1KKLA 1O54A 1ZBDA 2XUDA 4RLZA 5HQJA 1GN8A 4LNUA 1RZVA 1ZMOA 4IDCA 1V4VA 3H2GA 1GLNA 3TQCA 1RJEA 3IDAA 1I3CA 1LJLA 1JJFA 4DC0A 1QQ6A 2XR1A 4AK9A 4BZQA 3ZJUA 2FCRA