3W2HA

Crystal structure of oxidation intermediate (1min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
271
structure length
271
Chain Sequence
TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
total genus 75
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2hA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2hA02
3VNVA 4UAJA 4Y9RA 2BSAA 5H59A 1B23P 3MHPA 3LVBA 3CCMB 3ZZTA 4NCNA 1YI2B 4M2LA 1DARA 3CC4B 1KTVA 4RD2A 1BJKA 1ZM2A 1N0VC 1K73D 4HE6A 2XEXA 4LBYA 1QUEA 2HMAA 4TMWA 3OZVA 1QVFB 1NJID 2RC5A 3G4SB 2QTLA 3W2EA 2PLFA 3V76A 3WBJA 3I56B 3CPWB 2QDXA 3ES9A 3WNDA 3QFTA 4P6VF 2GPJA 2YWHA 3QFSA 4QFMA 1SKQA 4M0LA 1VQOB 1VQ7B 1EP2B 1Q7YD 4PC1A 2VYQA 3WNCA 1ZUNB 3P26A 2NPFA 4NBSA 3SJZA 3W5HA 1EFCA 1YJ9B 4AC9A 2VZLA 3G71B 1JB9A 1QX4A 1K9MD 1N8RD 4FK8A 3WNBA 2PIAA 4ZV4A 2PMDA 3QFRA 2CNDA 4ZCIA 1QG0A 4Q7JB 2ZITA 3ZBTA 3ZBUA 1BX1A 3WBKA 3OZWA 4B4DA 3CCVB 2VNIA 1KD1D 1D1NA 3A1FA 3AVXA 3W5UA 1GR1A 1IJEA 1U2RA 2DY1A 2B7BA 4MYTA 1R5OA 2BVNA 2BM0A 1F60A 2XNJA 1E63A 3CMEB 2VNHA 3J81k 1N0UA 4TMXA 1VQLB 4ZGNB 1JJ2B 3W2FA 4B43A 3CXCB 1YHQB 1EFTA 2BGIA 1Q81D 1FNBA 1A8PA 4TMZA 3CC7B 2EIXA 1FDRA 3WYAA 3MMPA 1FNMA 1Q86D 3VO1A 3AVTA 5FA6A 2BM1A 1VQ8B 2HDNB 1GO2A 4B44A 4FN5A 4TMTA 1WDTA 2E1RA 1KK0A 3JQQA 1BX0A 4YAFA 1Q82D 4P3YA 2BPOA 1VQPB 1GAWA 4H9GA 5DSZA 4BPRA 5GV7A 1DDIA 3VO2A 4RJLA 5AN9A 3CCUB 1VQ4B 1E62A 3I1FA 3W2IA 2OTLB 1OGJA 1AMOA 1K8AD 3OJXA 1QGZA 2OK8A 3MCAA 2DCUA 2XNCA 4YAOA 4TN1A 1IJFA 2C77A 2QN6A 4B3XA 1G7SA 5H5JA 4PGOA 1OB5A 1G7CA 1QUFA 2J7KA 2VNJA 4PC2A 3ZC3A 1G7TA 3LO8A 3OJWA 3QE2A 1YJWB 4G1BA 3QSYA 2OTJB 5KSWB 1G7RA 3VNUA 3OW2B 1AIPA 1NDHA 1CNEA 1SM4A 3AVUA 1TTTA 1M1KD 4ZCMA 1H85A 1JNYA 2QA4B 5THXA 3ZZ0A 1EWYA 1QVGB 2B5OA 2YWEA 2EFGA 4YAUA 1JA0A 1GJRA 1ZM4A 3CB4A 1QFJA 3CMAB 4M1KA 3W5VA 1BQEA 3E20A 1HA3A 2DETA 4RCYA 2DERA 1I7PA 4B47A 2VNKA 1B2RA 2R6HA 3U6BA 4N3GA 3LRXA 3W2HA 3W2GA 1GAQA 3CCLB 1EFUA 1IB0A 3FJOA 4M4SA 4ZGQB 2QMUA 1QGAA 1ZM9A 1VQ5B 5TV2A 2GQFA 4F7DA 1QH0A 1R5NA 3P27A 1TVCA 1S72B 1KK3A 1KK2A 4RCZA 1TLLA 4U9UA 4YALA 3CW2A 4YAWA 2X3UA 4YHBA 4AF7A 1E64A 1KK1A 3U2QA 3I55B 4G1VA 3CCSB 2YWFA 3CRZA 4ACBA 3VMFA 5JBQA 1QGYA 4FWTA 1EXMA 1VQMB 1OGIA 2BF4A 1R5BA 4G5GA 2D74A 4EH1A 4PC3A 1FNCA 1M90D 1XE1A 3FPKA 1EP3B 2HCJB 3WY9A 1D8TA 2FX3A 3JQRA 3LYUA 3JQPA 5HXBA 1W35A 4PC7A 1ELOA 3AVVA 2C78A 4LBVA 2OK7A 1DG1G 1CQXA 1VQ9B 3G6EB 3AGQA 1JA1A 4Y7CA 3AGPA 1FRNA 3OZUA 4LBZA 1S0UA 4DQLA 2QTZA 1VQ6B 1YITB 1W2BB 3QFCA 4C0SA 4HE5A 4LBWA 4RD6A 3AVWA 1J9ZA 4Y9UA 5TR9A 1OB2A 4AF6A 3ZZUA 1FNDA 1ZM3A 4B48A 1YIJB 1CNFA 3U6KA 1VQKB 1W87A 4R71A 4IW3B 1W34A 1YJNB 1F20A 1EP1B 5GV8A 3CD6B 4TMVA 1KQSB 4J0QA 1QFZA 2RC6A 2BV3A 4LC0A 4WQMA 3CCEB 4RD1A 2YWGA 4C43A 4K1XA 3CCRB 3CCJB 2QEXB 4PC6A 2BMWA 2B7CA 3CC2B 3B78A 2CRVA 5TY0A 1VQNB 4RD4A 4DQKA 2AHOA 3E1YE 1FRQA 4RD0A 3WXMA 1UMKA 4RD3A 1D2EA 1QFYA 3B8HA 2DEUA 3PENA 5EMNA 1KJZA 2BN4A 1KRHA 1KC8D 4QHYA 3AVYA 4N3NA 1XB2A 4MYUA 1GVHA 1DDGA 2BGJA 1H42A 3CCQB 4ACAA 4M53A 3B82A 1TUIA 4ZCLA
chains in the Genus database with same CATH superfamily
4RADA 3QKRA 5I7SA 4UAJA 2FU5C 4D9EA 1CY6A 1FXWF 3DMRA 3ABQB 1M6VB 1X3SA 1Z4JA 3KALA 3M2TA 1MFPA 2O7NA 1YQTA 2WUDA 1V35A 3DNMA 3F1KA 4RDHA 4UTNA 4KXQA 1WU8A 3NKFA 3IRUA 1MMFB 4RV4A 2ZJ5A 6REQA 1H23A 4CF4A 3B6MA 5BMVB 4PLGA 4WGFA 5AVXA 4JYZA 2OCIA 5H83A 4NF2A 1IWPB 2WD7B 3NBQA 3FNGA 4ZVQA 2GF2A 4BMOB 4ZDKA 5GZ6A 3CJTA 1G8YA 2QUJA 1WXIA 5IP5A 3GMSA 4E13A 2XMDA 1ZM2A 1FRVA 3AHDA 3TKYA 2IBSA 1EFKA 3ZZ1A 2Y1LA 3OJOA 3WRWA 1JWAB 1TA0A 2EDAA 2ZSDA 4DDKA 2HUNA 5TQ0B 1VRVA 3DAPA 2PGLA 4LBYA 3ZKAA 3ASPA 2ZSFA 3B7WA 3DMPA 5FNVB 1NJID 4P2GA 2AVNA 3G4SB 1MAWA 1YS2X 1DAMA 2IEZA 1A4RA 1Q7GA 3BYZA 3D81A 1PTJC 2H9IA 4IO1A 1NRWA 4XIGS 1N1GA 1DXHA 1DPFA 4HDNA 3W2EA 1ZOOA 1CRZA 4UD6A 2R1ZA 4XR9A 1U0JA 2G76A 1X7DA 2WHPA 3RNOA 4HXGA 4RZQA 2FXVA 3A6DA 5ALVA 5ESRA 4OLHA 2RGAA 4PYQA 1Q7EA 3N5CA 1TL7C 4J6FA 3DPUA 5FA8A 4DC1A 3HK2A 1ETUA 1VKHA 4OHRA 4BYGA 2CL5A 3B1FA 4HYYA 3EBLA 3IE2A 3ZJTA 4FNMA 3TDNA 4YV1A 3GEHA 1SC1A 1CZLA 2B36A 3SIPA 4X60A 2X22A 4G0UA 1PQWA 1WZCA 2ZSAA 4MGKR 4O4HB 2WTNA 4CODB 2A5DA 4Y2RA 2Q1YA 5AM4A 6REQB 4I1PA 2BFDA 4M8LA 4H1UA 1DSSG 4ALLA 2OXCA 4FQ7A 4LISA 3S3TA 1OD6A 5BSUA 2FMTA 1RTKA 1RYDA 4UVHA 1YCDA 3OCYA 1DC4A 1Y4DE 2K4MA 3HJRA 1RP7A 4K8RB 4WI1A 5H70A 3ZYCA 1PLKA 1X42A 2XH8A 1SURA 3EY9A 2XBMA 5CNMA 1D6SA 2Q8PA 5HBGA 2PBZA 3Q15C 4A16A 5LFAA 1JSRA 2WUEA 1YQEA 1C80A 1THTA 3OAAD 4H1VA 1Y7TA 4RVCA 3T3PB 3D3WB 2CFTA 1N8RD 2XKAA 2PIAA 1DP4A 4WL0A 5T4HA 3SG0A 3A2KA 4C4PA 4P25A 3H5NA 5CYGA 2WVAA 4RHEA 2OUIA 3WICA 1Z25A 1GUZA 1JPUA 3QE0A 1QG0A 1UH5A 4MVWA 4YCLA 3KJXA 4XIJA 2W6CX 4EX6A 1KU6A 2AJCA 3IEKA 3OU7A 1ORHA 1WOSA 2CVHA 1IG0A 3EYWA 4KE9A 4WHMA 4CXMA 5E9JA 2HZBA 2XVZA 3K0HA 4NV3A 4JBNA 1X39A 2ZKLA 4WJZA 5GPBA 3NIBA 1XZPA 2JHFA 3VR5H 1ZDMA 2O2XA 3CCCA 3C87A 1Q57A 2PDAA 1XWIA 2DYIA 2WHPB 2ZBVA 4WEOA 3CVUA 3RIGA 5FUWA 3ZDEA 1XMPA 2AN1A 3AFOA 1GR1A 3OEHA 1YFJA 5JG7A 2FWMX 1I4LD 1RI5A 2JIZD 5ILQA 1T24A 3RODA 1TMOA 2PG3A 2UYOA 1C7ZA 4GZLA 4KZPA 1APBA 2FQWA 1XA0A 3ZJVA 3CMEB 3PKJA 4GOOD 3U1TA 4G5SA 4PIVA 5B64A 1EUZA 1S2OA 5B4TA 1RBMA 1J20A 2MHCA 3PHBE 1N0UA 1AB6A 1B74A 1BEUB 4WY5A 1BMTA 1BE0A 4HDCA 4PQEA 4DYDA 2PRSA 3GHHA 4BJHB 4C0HA 3SC3A 3KJZA 1MOPA 3OG9A 1U94A 5MGBA 1Y5NA 2OUKA 3L0DA 1A2BA 1J2YA 2BFDB 1D0SA 2FFBA 2ID9A 1SCBA 3A1VA 3C74A 5CX4A 5AOVA 3I12A 4YIHA 5AH0A 2JW5A 1KMNA 5CA0B 1Q81D 2NIPA 3EAQA 5IXYA 3E5MA 4OMFG 1NSTA 4WKGA 1EVYA 5JMPA 5I9BA 1YV9A 2C07A 3DM9B 4PANA 4ROXA 3MMPA 1Z4KA 1XRPA 1FY2A 1SUSA 4P54A 4J7UA 5ICCA 4JC8A 1OXKB 3C1TA 4CQLB 2UYCA 1T6XA 4JL8A 4TXJA 4L4YA 1KAOA 3BMCA 5EJAA 2PE3A 4G4GA 4QHTA 1N4AA 4IEFB 4E5YA 1E7MA 1P19A 2EGGA 4O5OA 1YCGA 5KUTA 3U16A 2W5UA 4G0XA 4HTAA 4KXWA 1TEHA 2JFNA 3DE3X 2R62A 4G07A 2NVOA 3AZPA 4J16A 4KW7A 4WESA 4UDYX 4RPKA 4YAFA 1Q82D 4AJ2A 3DBHA 2IPOA 4B85A 4ENPA 5E3HA 5CFLA 5JEEA 2OQVA 1WSVA 3AEUA 4F96A 1D04A 1GZ4A 5GIOE 1W9MA 1RU3A 4C1BA 2F8SA 2M32A 2EFYA 3OVMA 1WUHS 4BP3A 1GT91 2BKAA 3GJ6A 4J07A 1QAMA 1UKZA 3F2VA 4XOUA 3UV3A 5JROA 3QKUA 2BSQA 2QD5A 2YXNA 1OZ0A 3HZHA 1KJYA 3HO6A 1KBOA 2IQIA 3JR3A 4NXNB 1NVTA 3OCUA 3GJYA 2HAEA 3W6PA 5AD1A 1T0JB 3GXBA 4CIDA 2J0SA 1KE1A 1NX9A 1GU7A 3RSGA 1L9XA 3AWDA 5ER6A 1MR3F 4C5AA 3LLSA 2Q4TA 3FAZA 4EGCB 1P5JA 1UD4A 4XGIA 4HFMA 2WTAA 4D9FA 2A8YA 3D6NB 5H02A 2LCFA 4YUWA 1HZZA 1T0BA 2OCLA 5JAMA 1YIOA 5CM8B 1YZ3A 5A5VA 4YWHA 5LQDA 3D1LA 2A5LA 3ER8A 1MCZA 1ZONA 3H2KA 3GPBA 1VSUA 3KHUA 3M6UA 3PHIA 4WNAA 1EVKA 4Y8VA 1N2BA 4KXNA 4C01A 2DUJA 1JQKA 2G5TA 4UFNA 3BD7A 4Y7DA 4G7XA 4AICA 4HNAB 5EIEA 4EB8A 1Z88A 3PXXA 1WA5A 4MW2A 1FMFA 4E1BA 4NEGA 2QK4A 1BHO1 1ECGA 5DSXA 1T1EA 4W5RA 1QIFA 1O58A 2Y6UA 4OQLA 4OI2A 2PXCA 2FPPB 1TTQB 3AUSA 4KSYA 2XEDA 5CLHA 4KQFA 2HMUA 4AUEA 3DYBA 2X53S 1D0IA 3K73O 5C7IO 5LXTA 2V0GA 4JR1A 1Y34E 1MVNA 2C84A 5FUBA 4LIPD 4BATA 1P91A 1MDFA 4CN9A 1R9JA 3CVWA 2AJBA 2OYRA 3OIYA 1ID1A 5G3ZA 3AOEC 2ZB2A 3H3FA 1A9RA 2I33A 5DEIA 1N0IA 3Q39A 2GO1A 4JA2A 1P9WA 1GN8A 2FWRA 3AEUB 4MV1A 4QTUB 1L1FA 4ZZ3A 3CMCO 1DJQA 1GLNA 2ZRAA 3L6OO 4M49A 4RK1A 3HN2A 1G6HA 3G5LA 2BI4A 1XZKA 2WAAA 2HCBA 2ZAGA 1N9GA 3DH0A 4ID9A 4EGSA 3MBIA 2PMEA 3EZ2A 3QF4A 4GPZA 2G83A 4Z0PA 3T5BA 3U4HA 3ZHOA 4XN0A 4I9FA 3JQFC 2BZ1A 4RJIA 1C8VB 4RDXA 3AZQA 4MKGA 3CFYA 3LUGA 2W98A 3FDZA 4F92B 3OFKA 2ZRKA 4G4IA 4IEIA 1DKNA 3ZZ0A 3AYZB 3OETA 5CHEA 2CXNA 1X0VA 2JGKA 1AMNA 3AZOA 3HP1A 1Q7RA 1HQYE 2FEAA 2Z9CA 1Z83A 2AWOA 3D3QA 4OBXA 2Y9MB 1T3LA 3BXXA 4RL4A 3ASTA 1NRKA 3CMAB 2LXNA 1XX6A 3AF1A 2ACWA 3IJ5A 2F3SA 4GBMA 3NV7A 3MA0A 3PRHA 4G23A 1KVUA 1JFFA 1JQDA 3WWZA 5BSEA 4QXPA 3LPAA 3FYUA 2JLAA 3G68A 3NIDB 4LZOA 5H7XA 4DIOA 2G0NA 3OKPA 4K3VA 4MJ7A 1P61B 1D0VA 5G4KB 4IMPA 2GAIA 1NUHA 5B2EA 4LJ4A 1KO5A 2IDKA 2DAPA 3V3KA 1Z7YA 4UHHA 4H7HA 2ODEA 4XNFA 2GN2A 4KIWA 2XSZD 4TQUS 4BV9A 3WSWA 4MEAA 5TV2A 4RXTA 2QR2A 1PX2A 3NVKI 4P7KA 2V6JA 2ZWAA 2J7PA 3AO0B 5LA6A 2VPYA 3Q7RA 1G5IA 2AZXA 1Y5MA 3QPAA 5CXUA 2R5WA 1RBYA 1LH0A 2Z04A 1TVCA 3HFRA 4P4UA 3MGAA 4MVJP 4BNMA 3E3NA 3VHXA 3VH2A 1EGHA 4KGZA 3W9SA 2BRUA 2IEBA 3MCUA 4R2HA 4YALA 1NVVR 1AUQA 3AP2A 3E58A 5IN5A 5AUNB 4P83A 3EDRA 1RMTA 4OPMA 5K1ZA 2JARA 5H82A 2W9XA 4Z99A 5EQDA 3RIMA 1A5SB 3FDZB 4HRXA 1NBME 3TCKA 4CG1A 1J23A 1ZU4A 1JHDA 2I7VA 4BMYA 4D8WA 4DIDA 1CT9A 4E3WA 3DFUA 4CV0A 1W49A 5L53A 2WHEA 1YZUA 2X4IA 3KAKA 4G36A 5JAHA 2XZTA 3AI7A 3VMFA 3SEFA 4FWTA 1NA5A 5FFFA 1XEFA 4B7AA 1VYTA 3E61A 4OM7A 3NH6A 1RWQA 4LF9B 1GWNA 2HQBA 3HWSA 3L0ZA 4XQCA 3VKHA 1Z0UA 3PNYA 1JSCA 1JFFB 1RLIA 1UFOA 2BMFA 3IEIA 4LRXA 1C1YA 3B8EA 4JBYA 2UZ4A 2DGDA 4AUNA 4LYHA 4BP8A 3HV0A 2OMKA 3LVQE 4PQYA 3CU5A 4CCWA 1TO6A 3EHDA 3R8FA 3UJHA 1DJPA 3E27A 4KR9A 4RE5A 3TZLA 2GASA 2OFOA 2OL4A 4Z4QA 4ON9A 5IVKA 1F4VA 3CT4A 3SSAA 3ZBPA 3E9NA 3JQPA 1NYLA 5A88A 1B8NA 3M5PA 4FE7A 4AY4A 3T3NA 2FW7A 4ENTA 1VLOA 4HDKA 3WAJA 4MITA 1USWA 3FE2A 2X23A 5L7YA 2JLUA 4LE2A 5LA6B 4P3IA 3ROTA 3TLJA 1GRVA 2NQ2C 1A95A 1S4QA 1XU7A 3P96A 5DHPA 2E37A 3DQQA 3P4YA 1JA1A 1N8SA 4YMLA 1I24A 1K98A 2XA2A 4B6JA 4Z53A 2DQYA 3P71T 2CY0A 3AVOA 3OZUA 3IA2A 4I8XA 3TB6A 4DLRA 3H65A 1YVRA 3BSSA 5KNDD 4S04A 1IY2A 3MCTA 4KPUA 1NF8A 4AJIA 3K5PA 2OD9A 4CGZA 4AN4A 3KXKA 2Q2QA 5DGXA 3KJNA 5AVRA 2IXEA 4C0SA 3CLTC 4YJ3A 3AJAA 1YL6A 8AT1A 1Y8RA 3V4RA 1SZJG 1OJLA 5F21A 1U0OC 1ICEA 3DOOA 2ENWA 4QXRA 4Y6GB 4LF6B 3DCNA 1ZPDA 4MVJF 3DDYA 1R0WA 1YQQA 5JATA 5EXTA 1D1QA 3NDPA 4R05A 3I2FA 2OHIA 3IVRA 4RFSA 1UDBA 4LS3A 4ZVSA 1A8IA 1L3BA 2L18A 1E2NA 3SR3A 4C0JA 1HG1A 1N2IA 2PKXA 3KSZO 4B82A 4BBAA 3WDSA 1CNFA 4MCJA 2W2XA 2NUTA 3V1YA 1MQAA 1P8JA 4FR5A 1L5GB 5BYKA 5IFKA 4ZYYA 3JWIA 1NXTA 2ZIFA 3O3CA 4LUCA 4QPZA 1T3GA 4IJ6A 5TPZD 3RAPR 1ADYA 4IQ8A 3NW9A 5IAEA 4BO8A 5JH7A 1ZL0A 2JA2A 2PWZA 3HN6A 4MIOA 2VKTA 1KFJB 2ZR7A 1MV8A 1JKIA 2CC2A 1MX9A 5IEBA 1UIRA 2QTTA 4JX8A 4ARAA 1L5VA 2E6KA 2AXNA 2R8ZA 2X0FA 1WDWB 3Q98A 1E8NA 3GAAA 4FHFA 5C1DA 2GGSA 4OJNA 4W1RA 3T9EA 3N0WA 3Q5EA 2ZAIA 1EFPA 3NP7A 3ZD7A 3SSMA 4IOKA 2XQJA 4G6ZA 4CBVA 1LWNA 4ZU6X 5HXAA 2HBQA 2QIOA 4YRPA 5FWXB 1FTSA 1E3IA 5CXXA 1RZVA 2Q3HA 2R8YA 4RKEA 4YMWA 5D3ZA 1KDPA 2WYWA 4TYMA 3F3YA 3G8CA 1RPJA 3KOZA 4P5PA 4DWOA 1KI6B 1M8PA 3R40A 5KNLA 2NZYA 4LSMA 1C1XA 5TQVA 3T7TA 1OREA 2IGBA 3S7TA 3ITEA 1OKKA 3I64A 1VLMA 3I05A 3F6YA 4IDQA 5FB3A 4Q39A 5HK9A 2KMLA 2B30A 1EVIA 3PCTA 5FL7D 3FCSB 4RD4A 3D4OA 2J3KA 3QUSA 2GBFA 2P7IA 4B2LA 1LQTA 2YY7A 2I3DA 3KOMA 4YJ3B 4ARZA 2PV0A 1O0CA 1H2AS 3O93A 2CN1A 2Z8YM 4GR9A 4E2ZA 5D8DA 3FHLA 5HM6A 1BH2A 1SUPA 4YCSA 4KR6A 4M37A 1C3OA 1FFCA 4RFSB 3UJ7A 1TYBE 3FHJA 3MG9A 5JISA 2BCEA 2HDHA 3CLTD 1Z28A 5DB4A 5JAPA 5U4QA 2YNMC 5B6IA 4RIGA 2NUTB 4ZVPA 1U6KA 4MRVA 3F46A 2FHPA 3H4MA 4B3SB 3RUFA 4X6YA 4RPDA 4G85A 1D6NA 1P74A 2CHEA 3MWYW 3CCBA 2Q41A 5KNCH 2BGLA 3DLBA 3O4JA 1H42A 2C3MA 1FFWA 3F5QA 4IGEA 5A6SB 3FUXA 3BH4A 1YDMA 2ZBFA 3CG4A 3DVSX 3G0DA 3RT9A 3VTZA 4ZCLA 2CNNA 1AV7A 3S2ZA 1EFPB 4XD7D 1LNZA 2ZXUA 1XDBA 3MRVA 2CFRA 4R5HA 5DBGA 5MHTA 3BRWA 2ZYTX 2GHQA 5C1OA 4ND7A 3GFFA 1FUUA 3P0HA 5IDXA 3CUTA 3ZPNA 5T6MA 4ZZ0A 4MA4A 3RCBA 3VR6D 4FC7A 3N2GB 1W46A 1A4UA 1E89A 1EG2A 1ZGAA 1GQRA 2B4YA 2FFAA 3CUVA 3HYCA 1E3ZA 4HNRA 3TOSA 3UT5A 3QOYA 4UM9B 2I3AA 4G7WA 6LDHA 3VFDA 1M7GA 2OZPA 3G59A 1U1IA 1OZGA 4M7OA 4M2LA 3C6BA 4TLAA 5AHOA 3ITKA 5J4YA 1BDMA 2CDCA 5C4GB 3STXA 1G4UR 4XASA 4DQDA 1EJ6A 1UBCA 3BZBA 1C9YA 4YEJA 3FHOA 3K71B 2W37A 4UE3S 4CL3A 1U11A 1Y9DA 5IUJC 1KQFA 2Q1UA 3HM9A 1JFSA 3BBPA 5GM1A 3L7JA 1DS6A 2WJZB 4LHXA 2QLNA 1D1PA 1LLFA 1VIVA 2FK8A 4OJKA 3WYGA 3U7HB 2CF6A 5I3ZA 1WV0A 4PRZA 4TMWA 4UBJA 1GKYA 2IKQA 5CDTA 4L08A 3H9CA 1HETA 1C3OB 1BD4A 3PFFA 1V9LA 5ALWA 3ZDRA 4AMGA 3OCZA 3DTNA 4DQVA 3A35A 1FVOA 4EF6A 2C9CA 1J70A 3ZXSA 4R1MA 2QPTA 1WMEA 3MTQA 2BBTA 1T5DX 1A7JA 1UBNA 2HKIA 1KXZA 4EUSA 2Q6OA 3HTXA 1PJBA 3EDCA 1HLGA 2ZFUA 3DBOB 2OESA 5IEJA 1NB0A 3WNDA 4FFNA 2WQZA 5K0GA 3LPNA 5K3BA 1E1CA 4NCIA 3WA7A 1G63A 3LXUX 3RDPA 4C03A 2JCXA 4JFRA 2YNMD 4IIXA 5EMJA 5DH9A 3TUJC 4KAFA 3WQQA 1L5HB 1RMYA 3VDNB 2OBBA 2HXSA 2OQRA 5AHRA 3AXTA 2R0QC 2QHXA 2QSJA 3UICA 4MP6A 5JXWA 3AI3A 2EGHA 4Y18A 4EOGA 4F3KA 4IZHA 4UHFA 2IY7A 5IBPA 2AFVA 1KVQA 4NDNE 1OIWA 4QTTB 3W6OA 3RFTA 2V0CA 3TFQA 4A8JB 1W85A 1Z4PX 4MKZA 2B34A 1UKBA 2PX5A 2YVKA 5HF8A 3WRXA 2VYND 2XT6A 4Q93A 4D3FA 4Q4CA 5FBWB 1POWA 1YC5A 1DQNA 2PT9A 2W83A 2FQQA 2J0UB 4GQIA 3RREA 3ZY2A 2CDNA 3PTLA 4J2OA 4P22A 1EDBA 1L7EA 2BELA 2BKEA 2Y8EA 3FMIA 4O1MA 5CVUA 5KPJA 2HFKA 1YQWA 2GAOA 2LP4Y 4Q02A 3I32A 4G0ZA 3VU3A 4AJKA 2WHXA 2H4YA 1Y6JA 4N18A 5HMMA 3MWEB 2R1VB 1ZH0A 1DC5A 2R7KA 5ICGA 3ZWKA 3FXAA 2NAFA 5IH7A 4H3SA 4FHDA 4DUGA 4I5GA 2FZ5A 4Q4LA 3AEKB 1XZLA 3M34A 4UVDA 4FONA 4IWXA 4OJYA 4YDRA 5MFZA 5EINA 4ZT7A 4D25A 4RKRA 4YRNA 3KXDA 1JDTA 3M1AA 2DTEA 3NBAA 1FUEA 1RAAA 3ORSA 2E3JA 1F2VA 5H3CA 1TYZA 4ER6A 1J2TA 4K9SA 1W19A 3HXPA 2BONA 4DQ0A 2SHKA 1B73A 5BR4A 1WZ2A 3WKEA 4RGQA 2FPGB 4A15A 1E1CB 3NJRA 3ABZA 1IJEA 1TRHA 2B7BA 4DIKA 3IP6A 2BM0A 3M4NA 2PUGA 1VIMA 1HRDA 1JKXA 1GV0A 2O2ZA 5B3JC 1ZK2A 5EQFA 2VNHA 3QU2A 1SXHA 1PYGA 2ZQYA 3Q6IA 4KK3A 4PFQA 5E0OA 3UIEA 1WDLA 2RKOA 2ZTHA 4LMRA 4Z4FA 2B7LA 1SOVA 1UKVY 3IVXA 2FPOA 4FBLA 2ZI9A 1Q2UA 4ZGNB 2OOSA 4RM0A 4ZRMA 3VSAA 3E18A 2QG6A 4CLOA 1HYQA 1OFTA 2ECFA 1EVLA 2AFHE 4GBJA 4UU0A 1Y3FE 4X8OA 2WYRA 4QBTA 1K68A 5F3RA 4GM1A 1W85B 4FILA 3TQQA 1JDVA 1FNBA 3QMMA 1LA2A 3HHPA 4XLAA 2YRFA 2HA2A 1T36B 2ZYHA 1E2QA 3K3PA 2EIXA 1CQWA 1N2ZA 4HAZA 3UJ3X 4ZJYA 1Y0BA 4H3KB 1WXEA 3GEEA 4WA7A 2C20A 4MWCA 5BNTA 2BM1A 3I9JA 2W7TA 1EZ4A 1KPHA 2BTOA 4JEMA 1FLDA 4GECA 4Q1BA 3AR3A 1JFVA 2AQ8A 2I87A 2O4CA 2Q3LA 2IF0A 1P80A 2VF2A 3IT1A 1KEUA 3HDQA 3MCZA 4YT5A 3ZWMA 1H8EA 1KK0A 1SU8A 2UYYA 1OZHA 2E49A 3TQRA 4BKQA 4ZO6A 3COVA 4BQIA 4Y0NA 3CRMA 4FLEA 3OLVA 3OPNA 4OYYA 4WINA 4CM3A 3RC2A 1EWKA 3UMJA 4OGLA 1M33A 4EG8A 1Z9BA 3DFMA 4BJ5A 2VTVA 2VK8A 3D43A 1IY1A 4H9GA 1N8TA 1OYWA 3NHUA 4JSRA 4NBUA 3GVHA 1K7SN 3ZIUA 1JEEA 4YJHB 1IMJA 3NDIA 3QQ5A 1Y6QA 4HNHA 2EFHB 4E5DA 4YTEA 3E9MA 1VECA 4XLEA 1DLIA 4JJKA 4RVNA 1CUDA 3TE6A 3I5AA 4DDUA 1YFLA 4RZSA 4JELA 4DYHA 1M0SA 1O3YA 3K0FB 2H0RA 1M8KA 4HX2A 1UPXA 2ZYDA 3CLVA 2XQIA 3P9RA 2HHAA 1CJMA 2DTXA 2QP3A 3DE5X 4E2WA 4U7DA 2Q5QA 2ATCA 4PZAA 2Q9CA 1Y8ZA 2EWMA 4NYIQ 4NYMR 3T99A 3N39C 3Q38A 3IL2A 1T1GA 4AKTA 2JIMA 3BREA 2VJDA 5AHXA 5BV2P 2VDMB 2O1XA 3E22A 1C8LA 3PJGA 3BH6A 4CLOB 3EUWA 1T5HX 1XTVA 3HU5A 1LF0A 1Q3HA 1WMBA 4S24A 4WLOA 3O4GA 4HLDA 4YT8A 2XDYA 4I99A 1Y9ZA 3DO5A 4I9NA 4ODIA 1KDYA 2XDQA 3LVRE 3C3WA 3L40A 3V1KA 3TG2A 4BFLA 1Y5IA 1ZN8A 4MAAA 4QBGB 3U4MA 2JAXA 4RZ3A 1SEPA 1OB5A 1Y6RA 3DO8A 1UM8A 4HUJA 5FD8A 5HJ5A 3I62A 4R1SA 3ONEA 2MT9A 3HYLA 2VZ9A 3OEWA 3FWPA 1PUJA 3IXQA 1H4SA 1Z3CA 3TCNA 2ZBQA 5DNAA 3RC1A 4C1NA 3ZHCA 2PX6A 5IHXA 3THYB 2PU5A 4N7JA 2J9RA 1YJWB 2PQ2A 1UJ2A 5HDBB 4MZXA 3R77A 4J0KA 3RVSA 3DV9A 4PN3A 2WFAA 1KHHA 1FJ2A 4GBED 3MINA 4DDWA 2VHTA 1JQLB 2QJFA 1VLYA 1NQXA 3N07A 1WP4A 2MYTA 4F93B 2J8ZA 1C30A 5KSWB 3N7TA 1LK5A 5K2OA 1Q16A 4IF4A 5AHKA 2ZJ4A 3OO0A 4I9HA 4MV7A 5CIQA 3TBHA 3V6LA 2O23A 2OBTA 5LNK1 1J22A 1I36A 1GPJA 2X5XA 3B60A 3PEVA 4MTLA 1UKCA 4R3NA 1ORRA 2B37A 4E94A 5K0SA 4YRGA 2R6R1 1SM4A 2NNWB 2HGZA 3QPVA 3SFZA 5BOSA 1OCEA 1MZVA 4X44A 4LJSA 4KLAA 4XM2A 2O0HA 5J3OA 2W4MA 4QYXA 1G2QA 3TLAA 5MDHA 1G2PA 4RQTA 1FFXA 4D6PA 3EIFA 1P1CA 2ZS9A 4IXWA 1R15A 4P0QB 4P98A 2Q9AA 2Y71A 3BEDA 1ZUD1 3BOSA 3IDQA 2BDUA 2GEKA 3GGSA 3PG5A 4MLPA 3RYHA 1O6ZA 2J33A 1RXSA 3NP9A 1T5IA 4G1UC 4QQ8A 4RCYA 1M6WA 1O54A 1TK3A 1VXOA 3G2IA 1KQ3A 3HWRA 3LQYA 4FD2A 3AJEA 1GRQA 5DCWA 2IEIA 3DLCA 2N75A 5HQJA 2VNKA 1MP0A 1JEDA 1OFUA 3HM2A 1CUYA 2HMYB 2A9QA 1OT3A 5T64A 3U6BA 1EDOA 4OOFA 2BE9A 3K09C 1V2HE 1DIBA 1VLZA 3KJQA 4HV4A 7GPBA 2F48A 4BX9A 3H9JA 3G0IA 1ZK3A 3COPA 3OE4A 2X9NA 4E6EA 1PL7A 2O14A 3PUMA 4RDJA 5I4IA 3DEYX 4DR6B 1DO2A 1IHYA 4BXOA 5DP2A 3BAZA 1G9SA 3CR3C 1AE1A 4WK6A 4M7PA 2GBLA 1ODFA 3ROMA 3W9BA 4BVAA 3H1EA 4JZKA 1AN0A 2KHZA 5JAIA 1CUAA 4CM8B 2NAPA 3VC7A 5FLEX 4C08A 4J7CA 3DZ8A 2B8WA 3V4SA 1LDEA 1C30B 1LSSA 2AXQA 4M1TA 1B2LA 2JBAB 4QLBA 5L7WA 1XLWA 1VL5A 1M2EA 2X0NA 1PYDA 3FMPB 3FRJA 5IJ0B 3NJ4A 4MIKA 2VT6A 5AKXA 4N76A 2PS3A 3VR5D 1KHTA 5BOSB 4G1VA 4HAUA 4NAVA 5EIWA 5HGXA 1MO3A 2PKQP 5JXGA 2YR0A 2YXDA 3RRJA 1FFXB 5DN6A 3IVCA 3QIVA 4JODA 4L8VA 4PZCA 3KEOA 3W2TA 4C20A 1UD8A 2DWQA 4DEYA 1OLUA 1A5BB 1ZJYA 16PKA 1YQXA 5DW0A 1ISIA 1N2JA 3AEQA 2HRCA 2JHCA 4OG2A 2VDQB 4CHTA 1QGYA 1NLZA 1W2WB 2V4DA 1NBMD 3RYHB 2CB9A 2H4HA 4TKZA 4KNYA 1ZCFA 1K7YA 4ESOA 3ZQKA 5AVTA 4KKUA 3N2EA 9LDTA 2XWSA 1UXKA 1NKTA 1P5RA 1QTRA 1YQUA 3G2QA 3I28A 3LT1A 1NNSA 2CXRA 3NYWA 4P8RA 4V0LA 3V2GA 2QRLA 1ECJA 1FSSA 3SHTA 1DE0A 2XKKA 3PQFA 2VIIA 5ECGC 1A7KA 3EPJA 2HCJB 1D8TA 2WF5A 4N5DA 2WB4A 1GNTA 1MQ8B 4RV5A 4X7BA 3B89A 1V26A 5HXBA 5AI5A 5E3JA 1HMPA 3JQGB 5B1HA 4BXOB 4B7ZA 3O6VA 4NZPA 5K0BA 1FP1D 5LB2A 3KPYA 4YROA 1MH9A 1M6EX 5H81A 3HKDB 4L75A 2POCA 3LVFO 3AV0B 3GZ4A 1L4HA 2ROQA 4RBNA 4J1TA 4WXHA 2XW6A 4AP5A 2G8LA 1V4NA 4EB6A 3FGPA 2OZKA 1H65A 1BRTA 3JVUA 4YRTA 2HDOA 2A1UB 4G1CA 1ONOA 4A6PA 3A1WA 3WLHA 1T6YA 3HG7A 1BS1A 4UNPA 3KQHA 4EY7A 4NQRA 3QFCA 3PRKE 2B8TA 5B1DA 4LJ5A 1VHDA 4M99A 4UATA 2NU8B 2V97A 3ASQA 1NU8A 5AKZA 3WXBA 3C7AA 3OZFA 3NHLA 1J9ZA 2ZSBA 4PAOA 2F3RA 3ENZA 4PSDA 3IGFA 4IDOA 5TR9A 3CRNA 1OE0A 1Y1RA 2O7SA 1IUNA 4FB4A 3MMSA 1GV1A 1SOAA 1CR4A 2YZNA 5J4HA 2O0KA 3FNHA 3DZDA 3ISJA 4JQOA 1Q15A 3GFSA 3ZW8A 4ARBA 5FWYA 4IEEA 3D5EA 3E9YA 4S12A 4EECA 1RYNA 3GQBB 2E1BA 2DLDA 4ZKEA 1YIJB 1E77A 2R1UA 4I4NA 1GARA 4XDYA 4DLWA 3N6RA 5BSGA 5IKMA 3IQHX 4A8TA 3FOBA 1DI0A 2ZROA 4L76A 2RHGB 1E1DA 3BXPA 4URXR 1ZCZA 4XJSA 4H7FA 3I8XA 3QVUA 4LNAA 1BXGA 2HTFA 2PKWA 4NMLA 4TRNA 3DOIA 3BFPA 4GD3Q 3RTBA 1WPCA 1QKKA 1ZD8A 1NSYA 1EINA 3TW0A 1WVGA 3FMGA 3L7AA 5J2UA 4WQMA 1U2PA 3EK2A 1SH7A 4QVAA 1TJ4A 3A6GA 1OXMA 4DUPA 2G25A 4DPLA 3PXGA 1CJBA 1FDUA 4RKYA 1HE8B 2YWRA 1ST3A 2E2WA 2VPXA 2ZIXA 3E9CA 3M4YA 4KU4A 5IDVA 3UEOA 2I80A 1T2FA 3BEOA 3ND7A 4NC9A 4OI1A 3H2GA 1R64A 3ICPA 4FKBA 2B7CA 5IJAA 1JG4A 3CN7A 2X9GA 1YGPA 3E9EA 2ODAA 4YWJA 4EB6B 4PLCA 2I76A 3NLLA 3RAEC 2P2NA 3LCUA 4QOIA 1CF9A 2CJXA 2FMFA 5ERYA 2ZL7A 2WU0A 3HB5X 3JASB 1D5CA 1GPDG 4ZT4A 3SBXA 1YNSA 4BWYA 4GI3A 3RJTA 1NN5A 1JR6A 5KCZA 1AO3A 1GNPA 1SC6A 1V7PC 5DGIA 1XDUA 3DLTA 3EGEA 1ZRNA 3FY4A 3EMBA 3LO5A 5AK6A 2PCLA 3EVZA 1D8AA 7REQA 3H84A 2JPDA 3K5HA 5F78A 6ADHA 3KTOA 1ZJ6A 5HUHA 2E5WA 1TJ3A 5GWXA 1QFYA 1MO2A 2FZLA 1XTKA 3DYIA 4CKEA 3AM4A 4IRUB 5FYDA 1RYEA 3B1WA 3JU4A 1KJZA 1E6UA 4IFBA 1BVUA 1TJ5A 2D59A 4B74A 3FJ1A 1QTQA 2Q45A 3WL7A 5JNRA 3H2BA 2H2IA 3FETA 3P9IA 4UU8A 4WNCA 1SQGA 1Y6FA 3PZRA 1TNDA 4HDQB 2G3YA 3J81A 1M0WA 2IXGA 1UT5A 2JAQA 2NXWA 2OCBA 3G0CA 3EVAA 3TJMA 5CCBA 4EY6A 2W0SA 4LQ4A 3ZCXA 3EC1A 2XUAA 3U17A 5HIMA 4Z4RA 2BL4A 3PQDA 2LIPA 2PPLA 2AZ4A 4Z4TA 2J67A 3HJHA 4N0PA 4ZHQA 3Q8KA 3ON5A 5CG2A 3F3KA 3T41A 3I9NA 1V6SA 1MTZA 5F1OA 2QXYA 1K6EA 2C4HA 4YXFA 3RUCA 1SU7A 4QG7A 4EMSA 1N34B 1UWVA 3TLZA 4NENB 2CGEA 2VO1A 4QBIA 3RRFA 3TJZA 1XVTA 3OKXA 3E1KA 2AG6A 4A82A 4U02A 4E5SA 2JFXA 4LTNA 1MOZA 4MVXA 2JFVA 1SPBS 5E3IA 3WV5A 3R6KA 1SPXA 5BUSA 2WTMA 4WJKB 1M1UA 4G5FA 4ZAYA 2I3BA 1WE2A 3OD5A 3P2MA 3W78A 3D2CA 4YPFA 2PYZA 2I71A 3FOEC 1DAGA 2VWPA 5EYPB 5JQGA 1Y5LA 1SBTA 3RVBA 3WNZA 3MHTA 5K9ZA 4NCJA 4WDQA 1K88A 1ETHA 4PFKA 4EPRA 4D96A 2XXBA 4QBHA 4EGQA 3EMKA 1OZAA 3TB4A 2C0QA 2PUVA 1Z26A 1IOZA 4CNBA 5M2QA 3SHVA 1VP3A 3OH8A 5TVGA 5T3YA 4P12A 1XALA 2D0IA 4GOND 4HZIA 2ETXA 1ZG3A 5EWLA 3OT1B 2PL1A 3ZDBA 3DL7A 3BGSA 3PTAA 3L4EA 4X9XA 3H1AA 3B12A 3Q72A 1ZEJA 2CMFA 2VOJA 4D81A 3TWOA 2MMGA 4M54A 4W6QA 4BKPA 4CEIA 4UFPA 1HGXA 2HL6A 3N86A 3A9RA 2HYIC 3VPSA 4AYXA 1ZL2A 5E7JA 4F2DA 1WXQA 3FPLA 2PUEA 4ESEA 1RWKA 5LN1A 4C76A 2C8LA 1Y9AA 5IBRA 3VC3A 1GYRA 4URZR 5ADUS 3RJMA 1E99A 3MILA 2GQ0A 4HQ0A 4YR7A 3CUSA 3QWAA 2WF7A 5LXTF 2VJLA 3BWCA 3LP8A 3BPSA 3MELA 4GE3A 3WB9A 4ZKDA 3HBNA 1SKQA 4E0FA 2ZB7A 3BXGA 1EBBA 3NAGA 4ZV9A 3SYNA 1CP2A 4QFBA 3KU4A 2GJ9A 2XCIA 3KR9A 2OBRA 1Y3DE 2LGJA 2OWDA 1PJTA 3WYFA 4PSCA 3TR0A 3ZD9A 3OTIA 1MV5A 1RP1A 3FR8A 4HWTA 5JNSA 4W5OA 4TLEA 1H94A 2JB9A 2PZFA 1JQJC 2CXTA 3OUTA 4A5SA 3UUFA 4Y6LA 4J0GA 3HNPA 4J0FA 1Z73A 3ABOB 1H66A 3C3XA 2JFPA 3QWBA 1SIUA 3WQZA 5AQ1A 1E7QA 1BRMA 1EFCA 3U81A 1IWOA 3LFTA 1FTWA 4WBNA 1PWXA 1VCHA 2GD0A 4NZNA 4EI9A 2ZIVB 3I1IA 3TBFA 1U0BB 5DHFA 4KIFA 2FP4B 1GUFA 2JGNA 4MQ6A 4UE2A 5AKKA 1K89A 1NW9B 4BB5A 1SCUB 2CNDA 1RHUA 4DANA 5I48A 1HL3A 2GXAA 3BE4A 4DVGA 3DNPA 4K9OA 3UVEA 3M70A 3VZQA 2DPLA 4GYJA 5JLAA 2P1ZA 1U4SA 3GFOA 5SZHB 2PRIA 2E4AA 1OXBB 5G40A 3RFXA 4B4DA 5G0SA 2TSYB 4DA6A 4OP1A 4FYIA 4UXHA 1N2SA 2R65A 1BKYA 3TECE 2WYOA 4KUEA 4U7FA 2JIBA 3EIUA 4YQYA 4RIFA 4AD8A 3SWWA 5CIYA 4LHVA 2TMYA 4N82A 3UB2A 5CDHA 3NDBB 1U2RA 2EFDB 3CIFA 2YHSA 4BO2A 1XPUA 1AV6A 2IS2A 1F60A 2XNJA 1K75A 1MJGM 2JFWA 2R60A 3EGDB 3NKVA 1Q50A 1QG2A 3R0IA 5CAEB 3IBGA 5BNIA 4N5HX 3G2MA 3KKKA 3T9FA 1O5IA 2WAMA 4XJXA 1CETA 3S7ZA 4BO5A 3H2HA 2JIQA 3FVWA 3TGWA 2X6XA 4QM6A 1AKMA 1OMOA 1S8FA 4MWOA 1EAMA 1JJ2B 4Q01A 2X0JA 5AHWA 3QVGA 1MZPA 3W2FA 1V5IA 2GBCA 5JSZB 3M4XA 1A04A 3C4VA 1RD4A 2FE4A 3H1FA 1OA0A 4H4CA 4RLFA 4KODA 4BN5A 5HW0A 4B6PA 4GSKA 3G0HA 5EP2A 3RV3A 3AR7A 3KVVA 1PZHA 3IP1A 4IG9A 3WDKA 2FFHA 4BQNA 3A3OA 2X0RA 4FDUA 3U1BA 1HKHA 3UJCA 1TVKA 1VLQA 1AUXA 3GI1A 2RHRA 4XSVA 1Q86D 1D4OA 1UPFA 3AVTA 2JGFA 4IAOA 1UBOS 5F4MA 2J9ZB 2LRHA 2YASA 3KYCA 3M81A 3NCHA 4INPA 4PF1A 5D3MA 5AJXA 1FP7A 4LV6A 1E5DA 4MYSA 4NPCA 4B83A 5JZVA 3OKFA 3P2OA 1PSZA 3CX7A 3GVLA 5DBFA 1HQKA 3IAEA 3OEYA 1XZIA 1ZZGA 2OYNA 1SUEA 2WJJA 4BP9A 3SY8A 5BQXA 4XJTA 4YMTA 5F5NA 2WUGA 1MA0A 4YV7A 4HB3A 4ES6A 3GIDA 1AQ6A 4EA6A 1O6BA 1OYVA 1PNTA 1EDZA 2GM5A 5KVSA 2WP8J 3QVLA 2QRJA 5JJIA 1GD1O 2E9SA 4P58A 1O97D 1Y3CE 4KPGA 4RELA 5AJWA 1SG6A 1RKUA 2F3QA 2PMCA 5GV7A 1B4DA 3DTVD 5HCNA 1I2BA 2I8LA 1LVHA 5IYRA 3BSYA 3GLFA 3SF0A 1M1ZA 3EOBI 3A0RB 4KE8A 3FWYA 3VO2A 5AK4A 5ISMA 2Q4RA 2W2NA 2A5GA 1Z45A 1KSFX 1KZLA 3LOUA 4Z3DA 1DX6A 4P80A 4JUAA 3PLRA 1BPLA 1SXJE 3AEXA 3TNLA 2C95A 4MDHA 1OGJA 4UBNA 4WXMA 4PS0A 1NXVA 3BWVA 2OQIA 4QE3A 5AJHA 5E6SB 3U1VA 5KNCD 1RTTA 1MO6A 3E9RA 4KH1A 1Q74A 1VA4A 1K8ZB 4BO3A 4BVGA 2BFNA 3EULA 5KYNA 3AF5A 1QB8A 2KI5A 2HMTA 3PQ6A 4BTEA 3OO1A 4X3OA 4TTAA 3FWZA 3HMKA 2XAAA 2I8CA 3RTAA 4MO9A 3D6HA 1TM1E 2XDWA 1GQQA 1CHDA 5A9TA 3TNFA 4DZZA 521PA 1NMYA 3WVNA 3C98A 1ZAKA 1QF7A 2IUEA 3CH5A 3FSRA 4OBBA 1Z37A 4MS1A 5LBUA 5IYWA 1N8NA 1C7RA 1WY5A 5KYYB 3KQSA 1JL3A 4EY4A 2H7VA 4QYWA 3TCXB 1A98A 3O8QA 3PXCX 1E3XA 1X7WB 1R50A 4EHLA 5L8VA 2QM3A 4RDCA 1MRNA 3DXZA 5JJLA 1QH8A 1U3DA 2YHAA 3QEMA 3ZBQA 4DLPA 4QEZA 1FB5A 3V9AA 4EKNB 2SECE 5A2GA 3I52A 1EXVA 1A8UA 2NUPA 3R9KA 5J4LA 3U5TA 4KQJA 3QLTA 1X8XA 3SBOA 3RAFC 4OK3A 3UJ8A 1RAIA 5CDYA 4HVAA 5FO0A 4IP0A 1PJCA 3P94A 3KB8A 3RVQA 1GGHA 2JDIA 1E1MA 1PG0A 4QPPA 2AZMA 3FYHA 5EKXA 3GLFB 3SJUA 4PAGA 2BFOA 2ZUBA 3HH8A 1PSDA 4C7XA 4LYEA 1SVUA 5JCJD 1XSEA 1QPGA 4HH4A 5KC8A 1PWEA 3L1IA 1EUCB 4F97A 5KYTA 3LXRA 2Z5GA 2FF7A 3FCYA 2WWGA 2R6ZA 3KOWA 5GGYA 1PT7A 4ZTBA 3SCZA 5BYAA 3GROA 4JLSA 5EHXA 4BCDA 3OCVA 4GXQA 4G56A 4DCTA 5AOAA 1QS0B 1V5FA 1QVGB 5I7UA 1G5PA 3F7MA 2PLRA 1MLDA 3E3MA 1WCIA 3I0MA 3OPYI 3ZV4A 5EUBA 3OIDA 1SBZA 3L6RA 1QO0A 4FTWA 1ZM4A 5HJ7A 3QX7A 1LPBB 2CXSA 3F9CA 1ESEA 2GJSA 2ZRCA 4GFDA 4L8FA 3OWHA 4JYPA 3LQQA 1XXHB 4HGPA 2W48A 4REQB 4S1PA 2PUDA 2GCNA 1UEXC 3VVBA 4DLTA 5KNBA 4M83A 1H2EA 4U7JA 3T94A 4Z8XA 3O8QB 1A8HA 4RZXA 3ROEA 2RGYA 3K8OE 1K08A 1EK1A 5L4LA 1PI3A 2ZRBA 2V9ZA 1Y8QB 4H7KA 2C59A 5MN5A 1CC1S 1QH8B 4HDAA 4NCXA 4XTCS 3I61A 3Q87B 5GONF 3U4CA 2V54A 2XUOA 3RS8A 4G24A 4DV2B 1RWWA 4RHYA 4KN8A 2NSYA 3T7SA 3IQGX 1RIIA 1HFWA 4BWFB 4OPVA 3ND9A 2M6KA 5D6OA 3TN7A 2CW5A 2BOVA 4XVQA 3A4NA 2BWJA 1DBVO 2RGXA 2VG8A 3ASZA 3JYLA 1R27A 3OE7A 1HTBA 1XCPA 1PV2A 1Q1BA 1NTRA 1QC5A 2XGSA 1KK2A 3JARB 3VSCA 2B2CA 2CEKA 2WNSA 3S44A 5L6MB 4TWIA 5E2BA 4QL3A 3SLNA 1MC4A 4H0NA 4D9CA 2PVSA 2R1TA 2NSLA 3PHJA 4PU0A 1J00A 3UANA 3ABSB 5MFPA 2P9ZA 1XG5A 3PDHA 4I50F 1VCNA 4EF5A 3G17A 2D0OB 3V4FA 4X6UA 4TKUB 2WYHA 3L6EA 2OKGA 3HFSA 1UK9A 1YR8A 2O8NA 2GJAA 3R7AA 1ZWLA 4G5XA 2PRJA 3ND6A 2VRBA 3OC6A 1IZZA 3PHLA 3LC7O 3L02A 4HLCA 1DRVA 4RA6A 5TT0A 2JJ1A 1KI2A 1AG9A 1YU9A 3KUDA 3U49A 5JBQA 3WYEA 4M1ZA 4QSMA 2YYAA 4UUBA 3LLMA 3GVIA 3F6EX 4YH1A 5KB3A 1ULSA 3D64A 3FKJA 4IOMA 5IN4A 1HNWB 2WU3A 1R5BA 4G5GA 1YZHA 4P92A 4RZUA 4Y1EA 3W8EA 3H9UA 3FPBA 2YN0A 3QJ5A 2GEVA 2XLBA 1I7SB 2B0CA 1U0LA 1KOLA 2ZAMA 2VBFA 1R5JA 2H54A 3UMFA 4WZTA 1CY1A 2FX3A 2I1LA 2VNSA 3PUZA 1IBLB 2B82A 1VCOA 2IYXA 1U04A 3Q6QA 4RSHA 1NUTA 5C51B 5FTKA 2BMVA 1FBTA 1ZICA 3ABIA 3EVEA 1PWZA 4NJOA 4A27A 5FUXA 1RC8A 2FSVC 2H2HA 5JVDA 3Q6RA 2EF1A 2W4QA 4PGMA 2DOGA 3QLEA 2H3HA 5FT9A 4KX3A 2GCOA 4FCTA 4OXNA 1HKUA 1PJZA 3COWA 1D4FA 1FA9A 3LLUA 4E6PA 1CQXA 3AW9A 4EF4A 3E8SA 3KWLA 5A6VA 2VQEB 3DB2A 4MHOA 1WIWA 2E21A 2XGOA 5DOVA 3RTCA 3UAWA 4YCMA 1OOEA 4HQKA 2XMGA 2A9PA 1UJ6A 3WL5A 4UEOA 1E79A 3P0JA 1J1UA 4MWGA 1E5TA 4FMCF 4IDEA 1O57A 1G3IA 1NVVQ 1ATZA 2C5EA 5EHNA 1QPZA 1X1QA 3BFKA 4GGPA 4HE5A 4D9BA 2Q5HA 1I1HA 1N2EA 1KORA 4UHCA 3HNRA 4ENWA 1E7YA 3FIJA 3RHFA 1JFRA 3EGCA 1WZNA 3ZE8A 4W5TA 1PW7A 1QH1A 2HBYA 3W1WA 2DC1A 4KQHA 3ZU3A 2Z8YA 2XCQA 1JJFA 3O2SB 3RS4A 3SIXA 1QHHB 2XUPA 4ZAFA 1Z6AA 1E92A 2REQB 3LM8A 3PPIA 4PCLA 4WV3A 1DQYA 4R8RA 1W1IA 4XI9A 3BB3A 3IP8A 2WYVA 2GFQA 1WXXA 3LBAA 3V32A 5H1YA 3VKGA 4NHOA 3WWYA 3GJ0A 1M3SA 2I6GA 3D6AA 1M1YE 2HWWA 4Q4HB 5DCUA 4DRXA 4AQ7A 2QU7A 5JZBA 2LD4A 3IAAA 1PFVA 3DA8A 2Q3CA 5ED4A 2GRAA 1WPXA 3ORQA 2O3TA 3LQKA 4R1NA 3CEMA 3EZ9A 5F1KA 5K4AA 4JYBA 2XUGA 3DKIA 1B1AA 5EXXA 1VE3A 3TE7A 2EV9A 1U65A 2P6NA 3U9TA 1TD1A 2PFSA 3HXKA 2QS9A 4CG0A 5A8AA 3CKYA 1K7XB 4YV2A 4MUGA 1DINA 3IR7A 4A1FA 4OY3A 4EAAA 1O4VA 5FADA 3Q7PA 4KWCA 5KTRA 5E7QA 2QTGA 1DIAA 2J3MA 3BXFA 5HKKD 3TIVA 1JTVA 1OVGA 1XZHA 2QP4A 4JLPA 5ALUA 4TM8A 3EMDA 1CYDA 1LSUA 2BZSA 1J24A 4PG6A 3L4KA 1YE5A 2C94A 2ZTSA 1VQ1A 2CE2X 1I5OA 1QGUA 2DULA 4MKIA 4LSZA 4AZVA 5BQFA 3VZCA 1RHJA 2F59A 1K6IA 5CVCA 3DVRX 1GT6A 2OHFA 2AEMA 1KMHA 2X3FA 3MRXA 3OPYA 4Y2JA 3R76A 1PVVA 2WWIA 1YVDA 2HY7A 3QLUA 4YMSA 4N5IX 3RABA 2AIRA 3PGXA 2X5OA 2ZWVA 3ANMA 3HA7A 4Q0MA 2O2IA 3VSEA 1A7AA 5T41A 2A9OA 4EG5A 1ND6A 2C57A 1R6XA 1MO5A 3SLGA 5ENZA 4FI3C 4AULA 4YRRA 1XZFA 1NDUA 1Z0IA 2DR3A 5ED0A 3GRZA 5C8YA 1LPNA 4WMLA 5KWEA 1L6RA 1MNAA 2QX8A 3ZVNA 2ZVJA 3KLOA 3ZHUA 3QIAA 3FWNA 2W8BB 4JKOA 2I55A 2AKAB 1ECPA 1YKFA 2P2ZA 3JTMA 1NVUQ 4H31A 2GM4A 1OXXK 1Q84A 3GBPA 4KI7A 4DCJA 1YR9A 4RVFA 2OHJA 3LWBA 4TPKA 5I47A 4UBLA 4P81A 3TZEA 2JAWA 1XP8A 2GK7A 3N1UA 1A71A 1JLLB 1OX5A 2CJWA 2QVCA 3R0XA 2E4UA 4HNQA 1I80A 1TIBA 1L7PA 1R6TA 1EE2A 2BEVB 1HORA 3EVDA 1EMDA 1L7MA 2VP9A 4KQ2A 5I4BA 2FQXA 3BH7A 2B6NA 5BN3B 3GT0A 5A9SB 2N46A 3K8QA 1IN5A 1VGQA 3QYPA 4ZGWA 4GZ5A 1JKJA 5FP0A 5KCMA 3TTSA 1CEEA 1GVNB 4ECEA 2NU9B 2I8AA 1V7QA 3OX1A 4TUYA 3MS7A 4RYDA 1MB2A 2G28A 4ESHA 3QU5A 2IDZA 2V6BA 4MPPA 2QZZA 3B36A 4QXAA 2R85A 3BJRA 3C3BA 2WKSA 3LY7A 3R3WA 1H5QA 1NGSA 4AZWA 3EPPA 5DJ5A 6YASA 3PVDA 2ZRGA 3L8DA 5LQJA 4YAEA 2R79A 4HUQB 3I4CA 4J3FA 2XZPA 3SJPA 3EF0A 3MT7A 4RD2A 1Q0LA 1W6RA 3PNVA 3PNKA 3JAKB 4HTFB 4RH3A 4A2PA 4YCJA 1N0VC 1EDEA 1UWCA 5SZIA 1VYHA 3L7DA 1ADCA 2AUTA 2I6QA 2WU4A 4N0QA 1VE1A 2JI8A 4ZYUA 3RI3A 4J03A 4CKWA 1JJBA 1B8VA 2BW0A 1QUEA 1WSWA 1YJCA 2DBRA 4MQBA 2AX4A 4R8VA 2HMAA 3TL2A 3AU8A 2FSPA 5CB6A 4LF8B 2ZCUA 1JHUA 2EDCA 3BHJA 2G8NA 4AKSA 4DSUA 5IJWA 1E3MA 2EYUA 2W6QA 4G8BA 1H3NA 5ETJA 4EQ6B 5LP6A 1TYCA 3IUQA 3DV2A 4CDGA 2GVZC 2HNBA 4CTOA 4P4TA 4F46A 5IFLA 5JR3A 3ZUPA 5I7EA 2QAGB 3F5MA 3L05A 4AUKA 3TQFA 2JGJA 4GT1A 3K0AA 1X1RA 2Y0EA 2G1AA 4K6MA 5CPFA 3QLJA 4R01A 3GP5A 2O8BA 3NIGB 3M89A 4F5YA 4UARA 2WMOB 1N32B 4MYRA 4KREA 3SIRA 1SJ9A 4XGNA 4II2A 1DXYA 3V3TA 4RC9A 5B55A 2VPIA 4FP9A 1KP3A 2D0DA 3KELA 5HDQA 5C46F 5AVQA 4BLOA 3ZZNA 1PV1A 1TAHA 2RKWA 5D84A 1A9SA 3K9BA 1TT5A 1VQOB 2IYLD 2AYYA 4MI1A 5FIUA 2I5PO 4DCUA 4L2IB 6NULA 2DWCA 2F7SA 1AHPA 2O57A 5ALGA 4D8UA 3MLEA 3L0PA 3SZGA 5IANA 3AR5A 5JJ5A 2MYNA 3JYPA 4OFXA 1FVFA 4IJUA 2ZSJA 3DC7A 2P5SA 3OAAA 3G9XA 3Q7QA 4CR6A 3KDPA 4ZPJA 1Z6YA 3DTTA 1OHHD 3ZCQA 5DSTA 3D7LA 2O6HA 1P5ZB 2HLNA 3QY0A 4P7FA 3RWBA 4LC9A 5KDDA 1MOQA 2AI2A 3FNQA 4QWMA 1J0DA 3KEQA 3K9FC 2AC2A 4JS0A 2NO6A 2FKNA 2WZQA 1K9MD 2C97A 4JGBA 1FMLA 1GL7A 1R0CA 2EATA 2Q5JA 4CKWB 4DXHA 3G3EA 1B6GA 3MYYA 4X06A 5IAGA 1K6JA 1UKEA 3ACBA 4YRZA 4B3FX 4C4OA 3MJCA 3ZBUA 3IBTA 1DAIA 3SSOA 2OY0A 2LR0A 2OAP1 1R9MA 3JPWA 1TFRA 4QHSA 4QNRA 2BEUB 2HCFA 5AVSA 2FUG1 1WTAA 4BGDA 2BMJA 3K0AB 4TVSA 2VNIA 1L7AA 1MU0A 1RAHA 1VG8A 2Z4RA 5E1OA 1TLTA 4JC5A 1SAYA 5K20A 2DJ5A 3KP1A 1Q95A 5DM4A 2OO5A 1SXJC 4FYKA 1KL7A 4LQCA 3NORA 5J1SB 1A8QA 1A77A 4YP6A 1VJDA 3NH9A 4M1OA 3ROFA 4DN6A 2FKAA 3Q5DA 2CJPA 5TNXA 4BX2A 1FSPA 1JLKA 5FFNA 3IERA 3VPBA 1JHVA 1FXUA 4Q9AA 2JLYA 1TT5B 3SKVA 3FBGA 3SP1A 4F4JA 4QV2A 1NXQA 1P5FA 2IPAB 1WVIA 5F51A 3H9NA 2JJQA 1AHNA 1B14A 1N6LA 3L8CA 1PEAA 3UGJA 3PQ5A 3CISA 3X1YA 5A62A 4QODA 1LSOA 3V48A 2RGWA 3THXB 1E1LA 3WGOA 2IV7A 1P1RA 5DW3A 3SZLA 3G5UA 3K0KA 1JYFA 3L84A 1K3FA 3OZRA 4CTNA 2JH3A 4EYQA 1M2JA 2BM9A 2D3NA 2CLFB 3EMVA 5BQPA 2JZCA 1K6MA 2FNAA 2C9YA 5BY2A 5JV5A 5LYJA 4U9HS 1GG9A 3GGDA 1OROA 3I9FA 3NDJA 2WA2A 3L82B 4MKFA 1ZKDA 3GUYA 3IEUA 4MLZA 1RHMA 1Z3IX 2ZUDA 4FYHA 2RGUA 4DG8A 1GRNA 4YRLA 4BYMA 4LJ8A 4LOLA 4NV1A 4CUJA 2DT8A 2NSJA 3ECCA 3THWA 3F71A 1R6AA 4NOJA 5J5AA 2Q8QA 3L1UA 4WZAB 2ZT8A 5E2AA 2E0IA 4LYJA 3IPRA 2GCIA 4GICA 4XGKA 4NLLA 3NWPA 1DDIA 2H7YA 2EJTA 1TC1A 3LBHA 2OHXA 3HR8A 4BAUA 4DLXA 5EL0A 3ZLJA 1OQAA 3NTVA 2SICE 5ERGB 1XJ0A 2F9MA 4P0TA 5COQA 4WKBA 3FUTA 3HV2A 4JI8B 1S02A 3MQ4A 4CT0A 3MJTA 1YJAA 1EUDB 1G8PA 2OTLB 1IHPA 1KBZA 1HVXA 1NQAO 2X8JA 3HWWA 4RH0A 1G5RA 5IX8A 2PZJA 4QO8A 4Z4CA 3BQ9A 1NKVA 2OVBA 1PK9A 3NKLA 3WGNA 3KQLA 1SXJD 3TMKA 3ZGXA 4J29A 3B48A 5THQA 1C3EA 1NUAA 1K4KA 5A2QA 2FEWB 5HF5A 3U19A 2VQFB 1WKCA 1NTOA 2X8BA 1P1IA 4DSZA 5JBNA 2DWOA 2QSUA 3O26A 5K8VA 4REMA 1RPZA 3GZJA 2B1JA 3H6GA 4ZP1A 1Q1NA 4Q4DA 1TPZA 3SS8A 3H13A 4O0MA 2LPMA 4EL0A 3PJFA 2AK2A 1A9TA 2CXHA 3HCNA 4J91A 3T0IA 3VDXA 5KJ1A 2B4AA 4W5NA 5F9FA 1Q83A 1WQ3A 2UVPB 1EQAA 3CP8A 4GUAA 3QVTA 4XUEA 5AM5A 3HU2A 1M74A 1VHTA 1U80A 4EGJA 1FTQA 4PRLA 4BLQA 3ICEA 1F7VA 3OJ0A 3H2IA 3KVYA 2WSLA 3CVJA 4ENQA 5KVAA 3LDUA 1FFYA 1LX7A 2O1SA 3THWB 1KO7A 1PKEA 1RM3A 5TGDA 3LDHA 3IKLA 3R3UA 4JQSA 1L5FA 1MH1A 4OHKA 4UCFA 2XCSB 4EDHA 2O5CA 1YRYE 2VJMA 3TEMA 4JT4A 3AC0A 3EUAA 4DM3A 4F9TA 1PL6A 2C8KA 4OM8A 5CU7A 4LGYA 2VDNB 3W77A 1G7RA 3TAXA 4OB7A 5DGDA 1XNGA 2VSXA 4H6XA 3FKSD 4TV8F 2WF8A 2R00A 4ZCTA 1H1LA 4AO6A 4BNIA 1Y1PA 1BVYF 4J3JA 4H1HA 1NVGA 1CR1A 1R4MB 5AJTA 1F6WA 1EK0A 3IQEA 3I3SR 4FHCA 1XEWY 4G8DA 5LBTA 5HOQA 4ZCMA 4XR4A 4XCQA 2P6PA 5JY6A 5KTPA 1CS0B 1E2PA 3ZX4A 3PC6A 1KZ7B 4Z1OA 3F98A 4IDDA 2OLKA 4NYMQ 3WMWA 2FUCA 4FWBA 2G9QA 3RLIA 4Q3BA 4LOIA 4LTDA 5U9CA 1PJSA 2GMWA 3Q3CA 3GIWA 4JI3B 2H57A 1LGYA 1TCUA 3X3HA 4XQGA 3UA3A 4CR7A 1N92A 1EGAA 3KNZA 5CH3A 3ZHYA 4CNQA 4F2GA 2WIFA 2XX3A 4WK4B 2YW9A 4Q9LA 5B6JA 1YZGA 5KQRA 3CKMA 3FVQA 4N3GA 1KPGA 1O7JA 4U7GA 4XXHA 3W5IA 1HT1E 1I3NA 2HMWA 2PGJA 2UZ1B 4KV9A 4B6FA 3OLCX 1F7UA 5CGZA 2OORC 3UTDA 1I7QB 2Z6VA 4KJZA 1EWVA 1U5BA 3L01A 1PWYE 1K92A 4V3BA 2HV8A 3SVZA 2P2DA 1KS9A 1M1NA 3OZTA 2I99A 1W8DA 3FZYA 2CWDA 3AF2A 3DE0X 3IR5A 4LXXA 4ME6A 3RBXA 4BQOA 4MV6A 2YMLA 5TRDA 2NYRA 4BQPA 1Y6GA 1EHYA 3L0BA 4WERA 5F73A 1GOTA 3GRAA 4ZFNA 4TYWA 2GK3A 3I45A 13PKA 2F64A 4IIHA 1VPDA 4ZANA 2HH9A 3A4TA 1ONPA 2D2FA 4WEQA 2PQ6A 1QHEA 5JWHA 3RS9A 3C7KA 3IHKA 1Z39A 1ULUA 3R7BA 1F5NA 3UFXA 2RHJA 2QJTA 3QLVC 4GXNA 4R1QA 3GCDA 4YHBA 4D4LA 1A9PA 3QA9A 2WJVA 2Q7DA 4L8WB 1Y4ZA 4TL6A 4POOA 1NI3A 1TUEA 3OU2A 5JEDA 5I8ZA 1RRMA 1V48A 2A4MA 1Z2NX 3T9AA 1KKLA 1A2KC 3T7RA 2ACEA 2P41A 1F6DA 1B6SA 2Z4TA 3FPEA 3PR1A 1N4DA 4C4YA 4C7BA 4ZXFA 3Q8MA 4LOAA 3BM5A 1J8FA 1MW9X 3KOXA 3OWXA 2OBSA 4PZUA 1H2XA 4FSHA 1OGIA 4E5PA 1C4OA 1T8SA 1KDZA 4F5WA 1SD5A 3ONYA 5G1OA 5JCOA 1LZKA 1N5KA 4BZZA 3ILHA 4TWRA 4HVTA 4JY7A 5JCZA 3FRIA 1JYSA 4RVOA 1R10A 3F7NA 1I51A 3ELBA 5JQGF 2J6IA 5I6DA 5IZ4A 2BBOA 3WGUA 2A86A 2ONCA 4LY6A 3DKPA 2UYQA 4IIJB 3ICVA 4H3VA 4Q7LA 3OQ1A 2X40A 2IUYA 1ESCA 2RARA 2VP2A 3AESB 3EH2A 4G9EA 4JBXA 5IHPA 2OZVA 1AGRA 5FTJA 1E4OA 1M1NB 2YV2A 3HCEA 4TTJA 4LCEA 2XVMA 1QRTA 2QLTA 3DDZX 1C3JA 3O8RA 1JLHA 4AJ1A 3DXFA 4GPBA 3ANXA 4BQSA 1AM4D 1FFEA 2YWCA 2ZL6A 3EIWA 4I50B 5CYPA 2NU7B 4UNSA 1QV6A 1CR6A 3B52X 1DG1G 2CXOA 2ZJ3A 1ZNYA 4Q5IA 1N7HA 1PFYA 4X95A 5CJPA 1G2OA 3K70C 1V8DA 3ASVA 4Y6QA 3TRHA 1ZQ9A 4XLZA 3URKA 1V4BA 4BY9E 3NWJA 3RRZA 2HREA 2WLSA 3AOGA 2EEZA 4LWOA 4L95C 1FUKA 1W8IA 1S0UA 1SVIA 3EEIA 3PUYA 4PO3X 3UHOA 3ZVLA 4ZT3A 3UFXB 3REOA 4C2TA 1YITB 3TGLA 3BGOS 5ALMA 3AR9A 3LKVA 2VKQA 3FZQA 1ENPA 2H52A 5GJCA 2A67A 2JFBA 1UEIA 2WR8A 4LBWA 3VU9A 5CBKA 2WYUA 4GDMA 2C98A 3FOAA 3OFJA 4JDUA 2Z2KA 2QUAA 3LCMA 3T5TA 3AK4A 3CF2A 2EGUA 4UEQA 5IK2D 1Q2XA 5J47A 2WE8A 2XUZA 1P2UA 2R4TA 5TPZA 2IY8A 3WTCA 4D0GA 1UMCA 4YMGA 2GREA 1MC8A 4A8HA 2VQ3A 3SFVA 4CYMA 3A8JA 3IBSA 1XTPA 3JTEA 3JQ9C 4FMBB 5DI3A 4BMSA 5KSOA 1XTQA 3NBFA 1SCIA 2ZAOA 2F4NA 5AW9A 5JDIA 3DBIA 5I7RA 3P8ZA 4Q9DA 1OPXA 2QT9A 1DIOB 1X1EA 3WIVA 4FFLA 1UC5B 3DDSA 5KREA 5JT1A 1ZI8A 2I4LA 1RRPA 2RJOA 3AIOA 3IELA 1C1DB 3LFHA 5DNEA 5HFAA 2QQ5A 3SDSA 1DZ3A 2HMSA 1FYWA 3AY0A 1B76A 2CV0A 1U0NA 2QX6A 2Z0MA 4P32A 4RMNA 1OLXB 4X0EA 3QXJA 2W90A 2XNDD 3I6YA 1UBGA 2NZ8A 2VI5A 3BK1A 1CUSA 2OV2A 4CIXA 2YWGA 4URFA 4X7MA 1C0LA 1FS6A 1UIMA 1E4EB 1ODJA 2OHVA 1Z5PA 2ZLBA 3B1VA 3FB1A 3CW9A 3H0EA 4MJLA 2X2OA 2INGX 3FYTA 4ID3A 4D46A 2BMWA 4GOKA 2VCEA 2EP8A 3UJBA 3O91A 3X43A 1AU9A 3ZDQA 1L4UA 1ZSYA 2WVJA 4S3MA 1MC1A 5K3FB 5FL7A 3GA5A 4AZ3A 4DR1B 4IDHA 1AUVA 3C1UA 4PBTA 2F55A 1WSRA 3OKCA 4NMXB 1VQNB 2GTHA 2PVPA 2WV9A 4DM7A 2NLOA 2P11A 3ELYA 3VJKA 4WAUA 3QTLA 2A1IA 3TK1A 2QN8A 2YMMA 1UPBA 2ZI5A 4OHZA 2JGDB 2WUVA 3SYLA 2YIDA 3DE1X 3VU9B 4JGGA 1OC2A 4D45A 3WXMA 2MINA 4KO2S 4BMXA 4CI9A 1U2DA 5DTRA 4O2BA 5TF4A 3I4LA 2BDEA 3DLPX 3ABRB 1IAQA 2QL7A 3L41A 4YEDA 4E51A 1REQB 4B31A 2V6IA 5ABPA 5KOJA 4BKOA 1JHAA 1UMCB 3D8BA 5BO5A 4XWTA 4EMUA 4PG8A 4DNOA 4G9BA 3PGA1 1X74A 4MSUA 1XQWA 1RPNA 2P3SA 3BAFA 5EWJB 3FYDA 2DMRA 4WN9A 1I5EA 2VH2A 1J0AA 2UVDA 1QM5A 1Q22A 1BX3A 2J3QA 1NN3A 2M98A 2XXAA 4AWBA 1U8CB 1YO6A 3T0FA 4CI0B 3EODA 4UQLA 4UOEA 1ZLYA 2Y99A 3L9XA 1JB1A 4EA9A 4YAGA 4IMRA 3SKBA 3CLHA 3KQTA 5G41A 1A9XA 1U2GC 4V0NA 5F2OA 4AW9A 3HB4X 4Q7MB 1N6HA 1OTHA 3I9V1 3WSTA 4KPYA 3HB9A 4C0BA 1BQ3A 4DLKA 4XA8A 5I7WA 1JN0A 6PFKA 2W2KA 4EFKA 2AFIA 1W2GA 3I2HA 4LJ7A 1XKQA 4C0QC 3DOJA 1DKQA 4EHKA 1YI2B 2QTWB 4LY0A 3W4JA 4EQZA 3J7TA 5B58T 3PVZA 5HR5A 1J8VA 5DM70 3GRUA 1ZR2A 5K3CA 3JSXA 2CZGA 2ZBEA 2GBIA 4L0CA 4CL8A 3D6UA 4AJNA 3D8TA 3HRIA 4WKOA 3S1SA 1TZ2A 3RANA 2P9FA 4HE6A 5LQAA 1DTWA 1JTFA 3CZRA 1KYIA 2H1LA 1PKXA 2FUEA 3WMXA 5EIOA 4Q9KA 3OZ7A 1KYXA 3UJ9A 3GBSA 3BB1A 3WL6A 3OHSX 5CB4B 1RE0A 4YVFA 1QVFB 4XUGB 2I78A 4QVGA 2CF4A 1T2EA 5ALIA 3T5CA 2ZPAA 3UGKA 2NZJA 1LU9A 1T0PA 4DCSA 2I1QA 4GLJA 3U39A 2DPXA 5TQ2B 3I56B 3V76A 2O3SA 4N48A 2ZIZA 1HFEL 1NNLA 2ZIAA 4PLYA 2JI7A 3PC2A 5DP1A 5HFJA 4RK5A 3ENVA 1W1WA 2ZS8A 3HJCA 1LBQA 4NAHA 4GRAA 2XXAB 4FJ2A 3VVMA 4LYYA 2V7QD 2XB6A 1G291 5T8KC 3G7SA 4FFBA 5CR9A 5AKEA 5ERXA 4RV9A 1JWBB 3AUKA 1OAAA 1XKTA 2AXPA 4RW0A 1KZ4A 3X1DA 4B6RA 1G21B 4F71A 3ONUA 4KVAA 3EIEA 4HPJB 3CN9A 4C7OB 2CEAA 2IZOA 1F3OA 4IMJB 1LB1B 5A04A 4G37A 3IIKA 3X2SA 2ZAYA 4CEJA 4EHFA 2C3YA 5JS8A 2V0NA 4QVIA 2RB4A 1DRJA 1KVRA 2VJPA 2VYNA 4IFIA 4MQFB 2ZZNA 1Z29A 2BAGA 1YZQA 4V0KA 1KZHA 3QE3A 3MRTA 1W36C 3GNSA 5FXMA 2XRFA 2WDZA 3RBVA 1A7UA 1NPYA 1PJ4A 1YCHA 2BZGA 2D2IA 2O2EA 3F97A 1KAQA 3MB5A 3UGQA 4A8PA 4DB2A 4E7OA 4E31A 4PABA 2EARA 2F8TA 1W48A 2OPBA 3SLRA 1V5WA 4XVUA 3NONA 1E3JA 1FX0A 3KV3O 5TPWA 3RVJA 1IPHA 2PFKA 1JVBA 2R7LA 3HKEA 3WBFA 3IS3A 5HK8A 4B2IA 5KTNA 4CMEA 2QENA 3NUZA 4KXYA 5GIPE 2G67A 4UCWA 5FOUA 4CRWB 3B6ZA 3AFNA 3NHRA 2NZVG 3VXKA 2WAOA 4YDSA 4EW2A 3GCXA 4OUKX 1BFKA 3LSYA 3AJDA 4X0CA 1XHLA 2Y2UA 3ESAA 2XI4A 4P5DA 1CXZA 1YZYA 2HO4A 3PGVA 3OZWA 1NW7A 1EXDA 4MUFA 2R84A 4DDTA 1TKAA 4Y6OA 4H08A 2M6LA 4BFSA 4ZGBA 3SXUA 1KD1D 3A3BA 2RMKA 1EIWA 1ISHA 4L16A 2XYHA 4BO9A 2HU8A 1A82A 1UAGA 3A2LA 3DHEA 4KAXA 1W29A 1N78A 3VR3D 1LCIA 2Z5FA 4XDHA 1XVIA 2BJWA 4QA9A 3FPSA 1R5OA 1Y8CA 1J39A 2FPMA 4OFWA 1TEVA 3LLVA 1QJ4A 1JXQA 1JG3A 1F4PA 2QE7A 1S3GA 2P4UA 2XA9A 3K2QA 4X3CA 4DNTB 4MVJG 2P9JA 3WJ7A 1BKSB 1ZGHA 3N2LA 5EFOA 1ZMOA 1DIRA 3GYBA 1VHQA 1R00A 3RUIA 4NJEA 1ZN2A 3OSZA 2NSHA 4N65A 1XDZA 1GKIA 4B43A 2HXGA 2X5JO 1N6KA 3BCHA 4RZIA 4D4GA 3MXTA 4CETA 4F45A 2H4ZA 4TYPA 2EP7A 2ZYUX 4J2HA 1B7GO 1M34A 1V0JA 3H75A 3WLAA 4BCCA 5IZCC 3KJIA 2CYAA 2GHRA 1RAFA 1EESA 2GD1O 3B3JA 3VO1A 1SUAA 1K8RA 3W9UA 2NPOA 2OCYC 5A1TA 3QE4A 1GO2A 4IIDA 3MTAA 4TKVB 3HCAA 5CLLA 1OV6A 5JPCA 5B2ZA 4D99A 4BBJA 1SCNE 3PJRA 4U6QA 1G8JA 1XZNA 3B5IA 4MYCA 5L3SB 2JFUA 1SBQA 3DAOA 1UMBB 4OV6B 3ZHTA 1I4OA 3ZJ4A 3T95A 4H7JA 4Y6SA 1PQYA 4FFPA 1U0EA 1Z6GA 4D6XA 1VPWA 4Y2TA 2BPOA 2X3YA 2B8NA 2Z6AA 3DJFA 5JZ9A 2O0JA 2VWHA 2AI3A 3SLKA 2W6OA 1PR4A 3B1KA 3O5AA 3PE6A 2X14A 1RZRD 4EATA 2YQZA 3T53B 4C5CA 1JEQB 3NT4A 2ZYAA 1KVTA 1LDGA 1DKPA 2ACVA 1TO2E 2FVYA 4PX5A 1LS6A 5JMWA 3PA2A 2J4CA 2CVOA 4YLGA 1UJ5A 3KKLA 3A4VA 3DVQX 1DCMA 4ND3A 5AOBA 1VQ4B 5BNFA 4DUYB 3EDQA 3WQSB 2OGZA 4QRHA 4HJRA 2CLOB 4NV0A 2GKOA 4IF6A 4JUCA 3A9TA 3UCEA 4XKJA 1YI0A 2QL5A 4F5EA 5FOXA 1YAHA 1QP8A 2R3SA 4J1QA 5FBLB 1M8JA 5BWMA 3BMQA 5AW2A 3FTNA 3A3KA 5GAJA 4N5MA 3B6JA 1WP6A 3ESYA 4W1QA 4QDKA 2KQUA 1JHPA 1UZUA 1WM1A 3AIMA 4JGIA 3WNQA 2YFKA 2JLBA 3KT0A 3T1NA 4F3YA 2CBXA 4FDLA 3EOZA 1EXWA 3MLAA 1C81A 4LTMA 2QN7A 2XNCA 4CN8A 4PO8A 4G5YA 4YMIA 1IN7A 3DG9A 2PJRA 1RHRA 4ZYWA 5HOEA 3DE2X 4W5QA 4Z4VA 2VEOA 2GAFA 3DT6A 1TADA 1XRRA 3P5SA 1VLJA 4FZRA 5T4BA 1ZYUA 1HSZA 3AHEA 4UVEA 1I8TA 2QRKA 3HO1A 4YP1A 1Q0UA 4FFSA 5SYAA 3DD5A 3I5MA 2J7KA 4KNVA 5I7FA 4B5KA 1J99A 1UD3A 1TJYA 4LN1A 1X8JA 4DCNA 3BJIC 5CEJA 1QF9A 2PD3A 4HG2A 1DUVG 2SBTA 4KGVA 4ZDWA 3NM6B 2IH5A 1U9ZA 3QE2A 1H0RA 2ZR9A 4R2IA 5KVCA 1KFKB 3VKVA 2BGMA 4NQZA 1MDBA 3V5NA 3ZWBA 5HZHA 2GS9A 4Q18A 1BIFA 3G8DA 3QYAA 4BNGA 4EUHA 4QBFA 1CZUA 2J4FA 4E2FA 5H80A 3QX3A 4HGYA 2VAMA 5FTWA 2HF2A 1NXXA 5JPIA 1J9EA 1GNVA 5L3QB 3RK4A 1EJ0A 3FOWA 3WBBA 1UM9A 4D3SA 2WJ6A 3M4JA 2EZ4A 2B78A 1NNEA 1PSWA 4YGXB 1KTIA 4BVEA 4MEJA 1CDZA 1F2DA 1GKKA 1WD5A 2OZLB 2CUTA 2QRPA 4ABYA 4C5BA 3T1HB 1AGPA 1T5OA 1JNYA 5E0KB 3WKAA 3LC1O 1XLVA 1X7ZB 3TSCA 4ZU3A 4K9LA 5FPTA 4G8JA 4FS3A 3JU3A 3OOJA 2ZRNA 1KFEB 3PFHA 4WFJA 4C3UA 5E1DA 2CNWD 4OQQA 5KX5F 2C3OA 1OI7A 2VH5R 4QWWA 1RPTA 2EWVA 4R8MA 2O52A 3IV6A 4DXAA 1XTJA 3IEXA 3PXBA 1AD2A 1OAOC 3N0TA 2W6ID 4IO0A 1RAGA 3JZIA 1GTL1 4Q3NA 5LBIA 4GYYA 4CLHA 2E5LB 2XZDA 1SBCA 3D59A 3NV9A 1QWSA 3RS2A 3ZWWA 2Z6BD 1MA3A 2QNRA 2QGGA 2IE8A 3IFSA 4OKSA 4BGEA 3CCLB 4BWVA 2DQ4A 4IUYA 3UY4A 5ESDA 2IODA 2ZQ5A 3TIIA 1VIYA 2IZ1A 3Q9SA 1GAEO 1LLQA 1ZUWA 4L27A 5LB4A 4BO1A 3HMQA 3D6VA 5EQJB 2I4NA 4TV8B 4CCYA 1P45A 2EJBA 2PS1A 3SMQA 2GQFA 1JHYA 2WM3A 4LJKA 5K8UA 1UBKS 3HLYA 1WG8A 1BDJA 1BWPA 2HF9A 1J06A 2P40A 2XGGA 3F47A 4XYMA 1K86A 4DE5A 1LK7A 1SIBE 1WTCA 3CVXA 1CBUA 3PFGA 3K1TA 2WINI 1G1MA 1Z8DA 3HJBA 4PQRA 3EZFA 4G3XA 5DGHA 4LXUA 4BO0A 3IUPA 3LS2A 4HT3B 3CRW1 3QEJA 1GXSB 3K1AB 3VR5A 3NAMA 3HEMA 1TLLA 4UCQA 3RIEA 4I1SA 4LJ9A 1VL1A 1P9NA 5EP1A 4FCCA 3WWCA 5LMNB 1HYHA 1UM9B 2ZRJA 2WZDA 2ZIGA 4PG4A 4W7SA 2YWXA 1M2OA 4RABA 1VP9A 2FZ4A 3PDIB 1XAHA 4XORA 4O5AA 5I9TA 5K6RA 2DUUA 1XA3A 3U5ZB 1DHRA 1NBMA 4OREX 4I9GA 1Z0KA 2JL1A 2YQ5A 5EJ8A 4ZAGA 4N47A 8ATCA 1QHIA 3CZPA 2QJRA 2GRUA 5ARBA 2P6OA 3HRKA 4TUYF 5EE5B 3ZEIA 4AB1A 4QGSA 1VLLA 1SVOA 2NVUA 4KRFA 5JD3A 3MT9A 3STYA 5A7FA 1UP4A 3EPKA 4LG1A 1N6PA 3EPLA 1JIJA 1KKMA 1OBHA 1E58A 1SVLA 4K2HA 1JHOA 3KDSE 4KDCA 4CHGA 1DWQA 1N3LA 4GDFA 2AOTA 2BMEA 1C8BA 1BZYA 4PC3A 1WOMA 2SCUA 5FLKA 2H4JA 2MTBA 2Y4OA 3A1SA 3DE4X 5D5PA 1ADBA 2R11A 421PA 4PZDA 1KAMA 2X86A 3JQ8B 2VYFA 4CMIA 4J76A 2WWTA 3GCZA 3DWGA 4F38A 5C18A 3EGVA 4YCBA 1ICIA 2RK3A 2O2HA 2ZDHA 4RTQA 1EGQA 2XJ4A 4IOLA 1ZSVA 2JVIA 2PGXA 2L17A 4JEUA 1PZXA 2IIPA 4PC7A 1G3UA 1LPMA 2RHBA 1XNHA 3C6YA 4BZQA 4X61A 4UEKA 1T5LA 1GTG1 2V7EA 5EKTA 1J5EB 2M1XA 3UMBA 1QO7A 2GVDC 3ISXA 1KF0A 3B1YA 1E3DA 4FMDF 1MIOA 3WOVA 1EBFA 3T0GA 2GZ3A 1A2QA 4J0IA 3RSHA 4RPHA 4GG1A 2ZI3A 5EHQA 3DFKA 2HJRA 4IRMA 4EG1A 1PV4A 4JIGA 3VKFA 3ZWVA 1TF7A 1L8XA 3WLFA 3ZS9A 1CRWG 3H5LA 1O94C 3KUUA 4RMIA 1KOFA 2CMDA 2WJAA 4K0RA 1ZR4A 5IVHA 3SXJA 5EJGA 2WD9A 2GZ1A 4AJHA 3TIXB 4Y2SA 1HYEA 1U6JA 3ICOA 4O1HA 3WK8A 1KSJA 1E32A 3OQNA 5CFQA 2HK9A 4DR2B 1Q0TA 3B9BA 1X38A 3UAGA 1USGA 1VCMA 4AXXA 4YRJA 2F67A 1N5RA 5J23A 1CE8A 2VDRB 4KR3A 3ZVKA 3SR4A 4ALNA 1X70A 3PFCA