3W2HA

Crystal structure of oxidation intermediate (1min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
271
structure length
271
Chain Sequence
TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 75
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2hA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2hA02
1TLLA 1ZM3A 1Q7YD 4PC7A 4MYUA 2BGJA 1VQPB 4RD2A 2B5OA 2CRVA 1OGJA 3MMPA 3CCUB 3AGQA 4B48A 2QMUA 1H85A 3WNDA 3CMAB 1G7CA 1G7TA 2BSAA 1NDHA 1FNDA 1Q86D 1FDRA 2BGIA 1IB0A 4IW3B 3WXMA 3CRZA 2YWHA 4YAWA 1R5NA 1VQ8B 1ELOA 2PLFA 4TMVA 4RD4A 1Q82D 2QTLA 2RC6A 4RD3A 2BM0A 2B7BA 4M53A 1QX4A 1YITB 3W2GA 4WQMA 3CCEB 2XNCA 2BF4A 5H5JA 1GVHA 2RC5A 4R71A 1JJ2B 2QDXA 4QFMA 3AVXA 1QGYA 1VQLB 3VNVA 2YWGA 3OJXA 2EIXA 3CW2A 4TN1A 4DQLA 1KTVA 2DERA 4RCZA 3W5UA 4G1VA 3E1YE 2VYQA 1QVFB 3QE2A 4YAFA 1S0UA 3B82A 4HE6A 1Q81D 3W2EA 4PC1A 2HDNB 3I1FA 1YHQB 1BJKA 1ZM2A 1YJ9B 2QEXB 4RD6A 1W35A 5THXA 1BX0A 4ZV4A 4N3NA 1GR1A 3P27A 1DG1G 2BM1A 1YIJB 1VQ7B 1FRNA 4PC3A 3A1FA 4M0LA 2DETA 2AHOA 4B43A 2BMWA 3WNCA 3I55B 3LRXA 3AVYA 4LBYA 4LBZA 1D8TA 3QFRA 3AVTA 4H9GA 4EH1A 3W5VA 3LVBA 3CB4A 1EWYA 4P6VF 5HXBA 1KJZA 1K8AD 1DDGA 1VQOB 3ZZUA 1IJFA 5TR9A 1EFTA 4QHYA 2ZITA 3JQPA 2YWEA 4BPRA 3OW2B 1JB9A 2X3UA 1AMOA 4AC9A 1W2BB 1JNYA 1KK2A 4ZGQB 5DSZA 1E63A 1FNMA 4N3GA 1VQ4B 1ZM9A 5TY0A 5TV2A 1D1NA 2C77A 3JQQA 1EP1B 1YJNB 2C78A 4UAJA 1QFJA 1QFYA 1G7SA 2BN4A 2XEXA 1A8PA 4C0SA 1K73D 4RJLA 4YHBA 3J81k 4ZCIA 3P26A 3CCQB 4F7DA 1J9ZA 2GPJA 3QFCA 1TVCA 2YWFA 3WBKA 4FK8A 4PC2A 1FNBA 4TMZA 4YAOA 3W2HA 3W5HA 3WY9A 5H59A 1OGIA 1M90D 3U2QA 4ACBA 1G7RA 3OZVA 2QTZA 3OZWA 2PIAA 1E62A 1QUFA 1FRQA 2E1RA 2OTJB 3ZZ0A 1EP2B 2OK8A 3CCSB 1ZM4A 3G4SB 4RCYA 1OB2A 3OZUA 2VNJA 1XE1A 3B78A 4ACAA 5JBQA 3ZBUA 4ZGNB 2B7CA 3ZZTA 3G6EB 1NJID 1H42A 3CPWB 1JA0A 3CMEB 3G71B 1KK0A 4J0QA 1KD1D 2OK7A 1ZUNB 1IJEA 2EFGA 2VNHA 4RD0A 1N0VC 5FA6A 3QSYA 3FJOA 1VQ5B 1BX1A 5EMNA 1M1KD 1SKQA 2XNJA 3LYUA 2DY1A 1KQSB 3CCRB 1DDIA 3MCAA 3CC2B 3W2IA 3CC4B 1R5BA 3CCMB 3U6KA 3ES9A 4TMWA 1VQMB 2CNDA 2QA4B 1QGAA 3FPKA 4B47A 1EFUA 3I56B 1KK1A 1YJWB 2BVNA 1AIPA 2GQFA 3U6BA 3CCVB 1VQKB 3CCLB 1N0UA 4MYTA 1F20A 4B3XA 4M1KA 4Q7JB 1K9MD 4K1XA 1GO2A 4ZCLA 3VNUA 1D2EA 4HE5A 1CNEA 1UMKA 2HCJB 2QN6A 3VO1A 1EFCA 2J7KA 1QH0A 5AN9A 4RD1A 1TTTA 1QFZA 1W87A 4Y7CA 4LBVA 2BV3A 1W34A 1F60A 4LBWA 1B23P 1I7PA 3CXCB 1VQ9B 4FWTA 1S72B 2OTLB 3WYAA 1QG0A 1DARA 3ZBTA 1JA1A 2R6HA 4TMXA 1HA3A 5KSWB 2VNKA 1KK3A 3CD6B 4YALA 3OJWA 4ZCMA 3AGPA 2NPFA 3QFTA 1GAQA 3WBJA 3VO2A 4M2LA 3WNBA 3CCJB 5GV8A 1CQXA 1WDTA 1VQNB 4Y9RA 3B8HA 4YAUA 1YI2B 2PMDA 2BPOA 1E64A 1EXMA 4AF7A 5GV7A 1KC8D 3VMFA 2VNIA 4AF6A 4NCNA 1SM4A 1QGZA 3QFSA 4DQKA 1EP3B 4LC0A 3ZC3A 4G5GA 1GAWA 3V76A 3AVWA 3E20A 1QVGB 4B44A 1N8RD 4P3YA 2VZLA 4C43A 3AVVA 2FX3A 4NBSA 2DEUA 4G1BA 3MHPA 4Y9UA 1QUEA 1XB2A 3JQRA 1KRHA 3SJZA 3AVUA 2HMAA 1CNFA 1VQ6B 1R5OA 4U9UA 1B2RA 1U2RA 1OB5A 4PGOA 1GJRA 1BQEA 2DCUA 4B4DA 3PENA 1TUIA 3W2FA 4FN5A 4TMTA 2D74A 3LO8A 3CC7B 4M4SA 4PC6A 1FNCA
chains in the Genus database with same CATH superfamily
5HRAA 1TLLA 3OLWA 2EP5A 2GLUA 2AKYA 4QREA 4YP9A 4IIGA 3V2UA 4MPPA 4E5UA 2JATA 3AF6A 1QTNA 3CCUB 2XDWA 3ADOA 3OLXA 4BMVA 4TT3A 3O8BA 4B48A 4RK0A 4HNTA 3WA6A 2Y99A 4KQ6A 2TS1A 4QFCA 1KZHA 1UBUS 1OVMA 3K8QA 4RKFA 1AQ6A 2W6ID 5CVUA 3AOEC 1GYRA 4ASUA 2GWHA 1UFRA 2VCEA 3F71A 4HLUA 1XL0A 2AX4A 1F4VA 4JENA 4RV9A 2BY4A 4KIJA 3GFOA 1GZ6A 3S5JA 3PC8C 4B6EA 1NLYA 3ZIAA 1ZK0A 2RHRA 3C1OA 4O4HF 4OO3A 3ZWKA 2CE2X 2RGWA 3H0EA 4JLJA 3PJEA 5HMMA 3T9EA 3QBDA 4TYMA 3ZH2A 1IXYA 3ZJVA 5K7SA 1Z18A 1T9CA 1KVUA 1QO0D 4GKAA 3MINB 1FW8A 1V5EA 1A8IA 1RCUA 3SE7A 2VZEA 1CS0A 1GITA 1YITB 3OO1A 4ARCA 4WWVA 4KLNA 3ZDAA 4L4XA 1XQVA 2NNLD 3CX7A 3MF4A 1B3BA 1NOJA 3D6AA 1VHWA 5HGXA 1G55A 4FNAA 3DS8A 5H5JA 4B0OA 4G0XA 2RC5A 4R71A 6REQB 3MS4A 2WA1A 4EPYA 4GRIA 1VQLB 4Z51A 2O2GA 3OIWA 4CDRA 1E79A 4UARA 4QBHA 2JFNA 4AJLA 1I51A 1DIBA 5AVTA 4YRIA 1OY1A 2XYRA 4ZCSA 1DZIA 1XLUA 1UAAA 1KKUA 1YONA 2IOFA 2ZIVB 2ZKIA 4ADSG 4YRNA 3W7AA 2XHZA 2X19A 4L15A 4ZO6A 1E4VA 3P2EA 1LVUA 4MW9A 4AZ3A 3CWZA 5CHYA 1XXHA 5H9VA 4UVEA 1Q81D 2IEYA 1THGA 3FVTA 3LTNC 2OE2A 3G5AA 2HDNB 3ZHYA 1YHQB 1ZXBA 2GQ0A 3C48A 2C7VA 4ZD6A 3RS8A 2O7NA 5FDFA 5KPDA 3JRWA 1UOOA 1XVUA 1P61B 2W6IA 5THXA 1J2TA 4IUYA 1HYEA 1D5WA 1L4UA 2B82A 3A1TA 1WTAA 1VMKA 5CX4A 4F9FA 1UMDA 2RI0A 4M21A 2DH5A 4DSOA 2E4VA 2P62A 5E3IA 3D26A 2V9PA 5CAEB 4RHFA 1KEPA 2Y1GA 3U4DA 4BNIA 2YZ7A 1DO0A 4NG4A 4P2GA 1VE9A 4N9QA 4P7JA 1S9DA 2IP4A 5JRJA 2VG8A 2C5HA 1PU2A 4X62B 1S9HA 4YRRA 1F7UA 4KHPB 1UKYA 4W5NA 4ZEXA 1YS6A 1RYFA 3GBPA 4EPWA 3GVIA 5BW4A 2I29A 2VHJA 1K92A 3BKWA 2CDBA 3E5MA 3H8WA 1P73A 3FYDA 5LWQA 1S4MA 3QIAA 1HTWA 3PE3A 2E49A 3AVTA 1OW3B 4HSEA 1WMSA 3E2PA 5A6VA 3UW1A 3IUPA 3GA7A 3TLJA 2EFDB 3PA6A 1DIRA 5HIIA 4URFA 2W2OA 3OLYA 2O59A 3S1AA 1NVEA 2O2SA 2FW1A 1OKKD 1YV9A 2RKWA 2ZBRA 3FSGA 4OYRA 2X1LA 4BVGA 1XAJA 4J03A 2BFMA 4NBUA 5AVJA 1JZQA 3DEFA 3NALA 3NMUF 1WWKA 2OBFA 4B8YA 1WCWA 3AM4A 3U3MA 1I2AA 4FIDA 5I7VA 1DTWB 5CLGA 4EUFA 1LB1B 1Y3HA 1YRLA 2WWIA 4YT8A 2JA2A 1DUSA 4MQEA 4B3FX 4RE6A 4JUAA 1V4BA 4ZYXA 2P3LA 2H9IA 4K03A 5JISA 4XOUA 4PPNA 1EXVA 1PVOA 2IXGA 4NU0A 5ED0A 1R9MA 4L9WA 5JNSA 4MVWA 2CV2A 1DLJA 3NH9A 1OTXA 3O6VA 4B8ZA 2ZJ2A 5KWSA 1Y0BA 2UUOA 4C2BA 2I4RA 3AL2A 1RWQA 3TL6A 3SLGA 1V6CA 1O6CA 2IYYA 4GPIB 3VO9A 4GO1A 5JHGB 1D2CA 2QJFA 2PAFA 1AMOA 2REQB 2ZI6A 3BIXA 2QTRA 3PR3A 1U0TA 4NFSA 3V42A 1KH3A 2PGXA 1FDSA 1EVZA 1JX6A 4K88A 4OPOA 4XKWA 3HY6A 1I7NA 4RDCA 4P58A 5K0SA 1TECE 2VHYA 4N3GA 4DDTA 4X07A 3VH4A 4X20A 5B2FA 3NUQA 1IN8A 3DC2A 1ORHA 1E3XA 4NDNE 5KU1A 3WA7A 1W9XA 2A1TR 2QYSA 3AG6A 5EWLB 3LCRA 2XUAA 1OC4A 4F4UA 4L8WB 1NPTO 3JAWB 4BQPA 1AG9A 4P4TA 3QXGA 3ADCA 1K8XB 1SR8A 2FPKA 2OFOA 4NAHA 3WLRA 5JJIA 4GP7A 1N5KA 4KKSA 2PGIA 1QO7A 2DHDA 1ST3A 4ND1A 3FF1A 2IV7A 1WS6A 4YAKA 1XU4A 1Y81A 4O63O 2PZJA 3WISA 2WJIA 1UDBA 2IX3A 3GZNA 1JU9A 1OKKA 1H6CA 1WXIA 3FWHA 1QRSA 3UFXB 3ZW9A 1LWOA 4R41A 4FNGA 1A50B 1JKXA 1C1DB 1FP2A 3GRZA 1R9GA 3VSAA 1K28D 1RMTA 5HJ5A 4A73A 3FPSA 5HS4A 1Y82A 2HZBA 3M2PA 3CIOA 3OW7A 1XZ8A 1E6LA 1F2TA 1IK6A 1UJ5A 2ODAA 4N48A 1VLJA 5IDWA 1CIJA 1TRHA 2JFVA 1P0MA 1FNBA 2FE4A 3BK7A 3NP7A 3RF6A 1X7WA 1WBBA 1XTQA 1A5AB 2C7QA 1NC1A 1NWCA 4RSGA 4EHLA 2GRAA 4UVGA 4CM9A 4YLYA 1LY1A 1ZK2A 4RQTA 5CU7A 1YFZA 4IFIA 4CM4A 2CNWD 3ZNQA 2N46A 2RMKA 3C24A 1WB4A 4CFZA 3QEBZ 4PYQA 1DAGA 3M6XA 4HDKA 1AKTA 4EJSA 3BCDA 5I7UA 2IW3A 3ABZA 2RH9B 3HJBA 5EESA 1ODCA 1T26A 3GFSA 2QX6A 3TRFA 1NV8A 4H59A 3W06A 1GQQA 1LPAB 1NW6A 3U7GA 2GZSA 1UPXA 1FP6A 3BN3A 4HLNA 4NS1A 3FJ1A 4XL9A 4NENA 4RZQA 3UUGA 4KXUA 1Z4IA 5HOQA 4KO2S 5C34B 2XB8A 2JZNA 3K0CC 3W8DA 1VE7A 3UHAA 5JFOA 2ECFA 1P62B 1Y5LA 1OB2A 2C3PA 2Q3MA 2ZJFA 4PG7A 2JC3A 1EYZA 3K3PA 2WAAA 4PZDA 3S68A 3WGZA 4Q4AA 4E51A 1XF9A 2B4TO 3JR3A 2C95A 4OOXA 4H6VA 3TECE 3ZBUA 1G8PA 2ZTSA 1P0CA 3OCXA 1GN9A 3O92A 5A0FA 4ZT2A 4MIEA 4Y18A 2TMKA 3RAPR 1E0JA 1JDZA 2VFAA 3EXFA 3SGLA 1J6UA 4F38A 1C0EA 1N7HA 2X8JA 5J59A 4FXPA 3WDKA 3R7WB 3K71B 1D07A 3GAZA 2TMDA 2CKMA 3LA6A 3TCXB 4ZVPA 2PKQP 1G21B 2ADFA 4YAGA 3U48A 2EFCB 3DV9A 4OH1A 1NSFA 5B1EA 4ZICA 4BN5A 4Q18A 4XLHA 2J46A 2AA3A 2QV7A 2BR4A 2GEBA 4DSZA 1K86A 2YXLA 4LPSA 2RHBA 5JMWA 5I7EA 3C87A 2ZPAA 3TX2A 1VLHA 2CY0A 4JL5A 4J0IA 1Y3DE 1EXDA 3CPXA 4EFLA 4ER6A 3H87A 3EVTA 3WJ1A 2W6CX 1JNXX 4Q82A 4XUCA 5DHTA 1J06A 1OT5A 4LZNA 4XJXA 2HM7A 2WWVD 3RGGA 2BUBA 2CNWA 4TV9B 4DPMA 3HJUA 3OFKA 1IOLA 2QRMA 5L3RA 2H54A 1H0SA 2JDID 3V46A 4PX3A 3UXHA 2UXDB 3OZIA 1HFWA 3VVCA 3FIJA 1M7GA 2AMJA 4PCUA 1ZH8A 4E5MA 1OJ7A 2NO7A 4G26A 1GUDA 1AB6A 1JJIA 4P98A 5EQFA 4OQFA 3RCBA 5CDUA 2R1VA 4OYHA 1W5BA 3L4SO 5EE3A 1MU0A 4K9QA 5ICFA 3VH1A 4S04A 3F4BA 1PJ2A 3ZWXA 5F3DA 4KBFA 2FPRA 2PH5A 2ORIA 3T7JA 3R9XA 1H2ZA 4RWZA 3A6JA 2AN9A 3DR3A 1ZH0A 1N2BA 3COPA 1U2SA 3HBNA 4JR1A 2K2WA 1VMAA 4DM7A 2DRIA 4MS4B 4ZTUB 1BGXT 1JVSA 3ASSA 2CF6A 1VLMA 5D1HA 1AKRA 4TMWA 4PFSA 2XMRA 2Q4TA 2ZTUA 1HYHA 1ENZA 1NT4A 2BFWA 2ZBQA 1USKA 3D8SA 4JLPA 4MAFA 3S7ZA 3WFZA 1GRVA 2Y67A 3CF6R 2N1BA 3I56B 4FEYA 4RIEA 3ZK7A 3HTXA 2PRIA 4CF3A 2WJ6A 4C6RA 2V7QD 4PGMA 3VU8A 5JDIC 5JH7B 1TM2A 2P30A 4OOFA 1KO7A 1X77A 1WTHD 3V1LA 4NHOA 4YMUA 2CZGA 1O6GA 4GI3A 2NYRA 5KMGB 3U37A 3SJCA 3OJEA 2HK9A 4JI5B 5IVPA 2ZRGA 3RFXA 1U1CA 2V31A 4GM0A 5K45A 1UPFA 4DLYA 4C2TA 1L4MA 1GSOA 3K0KA 3ENKA 3OT4A 1ENYA 5I8PA 4LJSA 3EH2A 3MA0A 1FYFA 2XJ9A 1OCEA 3DWGA 1WORA 1FS5A 4O1IA 2QI9C 5FBHA 3DB1A 3GD7A 4K1XA 3P96A 1Z12A 2CDAA 1AX9A 4ZCLA 2IYUA 4WH0A 3RG8A 3E3NA 2JVIA 5K0ZA 3IAUA 3TTSA 4OFWA 1RDFA 3B20A 3X1KA 2OXRA 1NVUQ 2Q49A 4MPJA 4XIGS 4HY3A 2WVGA 2CLLB 3K6SB 3V34A 4CT0A 2NTVA 2F90A 1X15A 1HE8B 2I2FA 5JXHA 1A5TA 4LXGA 2QI9F 5F1PA 1XZMA 3IIIA 4IXNA 3KXIA 3T7CA 1LF0A 4KAFA 3BGWA 2GJ9A 1W34A 1K5GA 2P5TB 1F60A 3IDSA 2WT8A 1ZW6A 1OYVA 2O4CA 3EF3A 3PL1A 2Q6VA 4GGMX 3NM6B 5DHFA 1KOFA 2W7TA 3BREA 4RZ3A 4PTLA 3WV4A 1O94C 1WVGA 4FGUA 4YJFB 3UMCA 2Z3VA 3ZEIA 2B1RA 1EK0A 2OTLB 1V6SA 4P12A 2ZEJA 3I6YA 3KZ1E 3WYAA 2IHUA 1HBJA 1Q7BA 2FZEA 1XNRB 2ES4A 3INRA 4N65A 3A4TA 3ZWDA 2WVAA 3BEOA 5ALWA 2OHGA 2SNIE 1G19A 1F0KA 4JJFA 2B5VA 1CNMA 3B53X 2VBVA 1G42A 1HRKA 3FCCA 1DOZA 4DCOA 2W2MA 4O1HA 4PYNA 2V7QA 4HPWA 3TQOA 3BFKA 4EZEA 1D6JA 3AEUA 1DWQA 3EOBI 4MS1A 1NYTA 1UT5A 2OQVA 3EFHA 3EGOA 2ZVJA 2V7BA 3EQZA 4QRHA 2J09A 5DM4A 3IX7A 2RGEA 1UM9A 1LDGA 3CZMA 3FMFA 1PSWA 4TL7A 4YCJA 4W82A 3UJ7A 5LMUB 3V8MA 5HE8A 1W29A 3PS9A 3DTNA 3GEHA 2GEJA 1QGUB 2IVFA 4W7HA 5CVVA 5KVCA 1JRLA 1RFGE 2AK3A 3EGEA 3QEOA 5DRYA 3UQYS 3UIEA 4PRKA 2VK8A 3HU5A 1GCOA 4Y9SA 5LXTA 1F5SA 2IV3A 3K7EA 2YQ5A 3JALA 4URZR 2BISA 4D8UA 3AFGA 1ISFA 4TTRA 1I6LA 3IALA 1R4MB 1CQXA 3ORQA 1IB6A 3N07A 3VZBA 5CB4B 3HO8A 1PYGA 1M74A 1MTZA 2B0JA 2WUGA 2AN1A 3B8HA 1T2DA 1K3TA 3GVPA 2BTQB 1F6BA 2P2LA 4KGDA 4LY3A 5CA0A 5K5EA 3V4ZA 3IVXA 2QRNA 3F5SA 5CMLA 4RGVA 3OFSA 4LV8B 5AI9A 3AV0B 1DKPA 3TTXA 3LNNA 5GV7A 3PGJA 3GJ0A 1SOAA 3T52A 5TVGA 1KR5A 3ROQA 2QA5A 4W9RA 2OKGA 2ZS8A 3LQQA 4YXWD 4JC8A 2GCEA 1L3BA 1Y3BE 2HA7A 1WB6A 2RHMA 3AFIA 5EUMA 3K15A 4LYEA 1XCJA 4ZXPA 4FYJA 2RHJA 3ZGYA 1XN4A 3L92A 1GXSA 4ZWNA 1YDWA 2AVDA 1B6SA 2AW3A 3FLMA 1T5LA 3U19A 1OT3A 4I55A 4FOSA 4U7JA 4AZTA 4HGQA 2FR0A 4I1OA 3WMGA 1CC1S 2BZ0A 2I54A 1C9DB 1CR2A 3PHBE 4XDGA 3ANNA 3ETLA 4RAQA 1E9FA 5JXJA 1PJTA 3FCEA 3PCXA 3FJYA 3P9PA 1NBAA 4CR8A 1ZWLA 5I7RA 1UQUA 3VA7A 1I1HA 2P0EA 3I9JA 1U90A 2QJRA 1NMYA 1NVTA 3L7LA 1JQAA 2RGDA 4LKRA 3GFBA 2OHHA 2F3TA 3PGMA 2ZJ3A 4MHOA 4E12A 2QLFA 2ZB3A 4B3BA 3GLIE 3EVNA 3F6YA 4RKWA 1HMPA 2EFHB 4JT8A 3A1UA 1Q91A 1ZKMA 4HV4A 1NZDA 5IT4A 1SURA 1GTSA 4BEVA 5HJ2A 1XG5A 3RFTA 1PKVA 1Z47A 4TPKA 3KYIB 4K28A 1N8TA 1TFRA 1QIDA 3HXKA 1PWXA 2W11A 3HY3A 2YVLA 2VHTA 3IKJA 4PLZA 4R68A 4FD3A 4RACA 1JIXA 2B1GA 4N5IX 5A5EA 4TQAA 4MAAA 3ESDA 4QO7A 4JI7B 2EW1A 1J1ZA 2IZ0A 3K1JA 1TUIA 1QFXA 5EJFA 1YDHA 5I45A 1QXSA 2CEAA 4RF3A 1A5SB 4E5SA 4L75A 2FOLA 1YJXA 2GK7A 2H17A 2OD2A 3C3WA 1CEXA 3L5KA 3QMPA 5ALEA 4BKUA 1LCIA 1F9AA 1PTJA 1DQNA 1Y37A 5BR1A 4OQPA 2A33A 2Q6KA 1EDZA 3KVVA 2R8OA 3LPNA 1PJZA 2R60A 4KU4A 1YFLA 4PC7A 4EUKA 1QV7A 3Q3EA 1PWZA 4O4LA 4F93B 2B5WA 1K4KA 4B84A 4CKWB 1E7SA 1W0KD 4E2ZA 4E5VA 1CT9A 1M2GA 3N53A 4YTEA 1PUXA 1H2EA 1L4GA 3SC6A 1YXMA 4KDEA 1VYHA 2FGJA 3AGQA 4K9RA 4LXQA 4N8SA 5COAA 2Y4OA 4ARZB 4D99A 4ZGGA 3R5JA 3FRHA 2X0IA 1A5ZA 5MGBA 3CMAB 3ER6A 4O4HB 4KQJA 2FDXA 3P0EA 2JCSA 1JEYB 1NYLA 3ZLBA 3JVDA 3HKCA 4B7UA 2PSFA 2ZI7A 2YXPX 4FQ8A 1NX9A 1GQSA 3RAJA 2M5SA 1ZVVA 4FDTA 4JLNA 2BDEA 4NU8X 4Y2QA 3ZWOA 2CBZA 3QV1A 1RPTA 2YY7A 1SZDA 2A94A 2BONA 3E58A 4YAWA 1NI5A 3C8MA 3TW8A 4PNEA 4PXYA 3MOIA 3ZHXA 4DAOA 1O95D 1Q82D 2ZBUA 2OG2A 3R09A 2VEOA 4D0NA 2PX4A 1IZ9A 3DLBA 2N9UA 4RD3A 4ZAWA 5CT4A 1H6DA 4ZCQA 4UOQA 4R8KA 2LCFA 4JHXA 3LECA 4ZHQF 1F0YA 3CX6A 4Z1OA 2FFBA 2FMUA 5KYTA 3QVXA 5ERXA 1GU1A 1HV8A 3HZHA 4H08A 3E4CA 4KMMA 4D43A 5KUTA 3S4YA 3DA8A 2QTFA 2L69A 3PJGA 4FFRA 3ZWMA 4C87A 2FWJA 2YV5A 2WZPP 1J7JA 1UEJA 1ECBA 2RJ3A 5BNTA 3PSHA 1T34A 2ZYHA 2GJPA 3AVXA 3KNZA 3BB1A 3L0YA 5HK9A 4YNBA 5L4NA 5ENVA 5F9HA 3BCHA 3OJXA 3BIWA 3RABA 1YDEA 4B3IA 4WXRA 1L4EA 3DGEC 5E8RA 1Y8AA 3L7CA 5E8JA 4Z7NB 3ZY3A 1NA5A 1T3LA 4MLDA 3WOVA 1OLUB 4MNTA 3CRRA 4HRVA 4LSZA 1LBQA 2I5PO 3MPUA 4FCCA 2X7JA 5BYJA 4ZMBA 3IAM6 2BFCB 5ICMA 2YJGA 2XB2A 1W0KA 1LSUA 3PZBA 3CT4A 3T7TA 4BC1A 3RUHA 4DMFA 1ZWKA 1ML4A 1YCDA 2IK8A 4GG1A 4CQNA 4PXSA 3TS1A 3GW8A 2HK8A 2NVUB 4MUGA 5HA5A 2FPPA 1T6NA 4CNQA 2C4WA 2D3WA 1SC3A 4J1SA 1ZLYA 3OZGA 4DR1B 1TQ8A 2VKQA 1ZZEA 1PGOA 2VJDA 1YMUA 1GR1A 2VJNA 3CUWA 4W8GA 4ZT6A 3SFVA 4BNKA 1BMFD 1NXTA 4MV1A 3C1UA 4GNKA 5IC5A 4KR9A 1FUEA 5EE1A 2ZYAA 2WSMA 4KQGA 3CLSC 5ED4A 4FMBB 3WV5A 1GZ3A 1W36D 3PQ7A 1O95A 1W581 2FQYA 3JS5A 3QE0A 3REGA 2AI3A 1SD5A 4EGSA 1RYEA 2IS6A 5DM2A 2M9MA 2Z9BA 5FHRA 1H2YA 4EGJA 3KPUA 2M1XA 1E6EA 3PXXA 3GP3A 4MDYA 2JIBA 4WXYB 4DIFA 3RUCA 4PPGA 1QIHA 1QVAA 4NMWA 4Q9LA 3X1XA 4HF7A 3OY7A 1NG1A 1Q44A 3MSCA 1M2JA 1WXDA 3EWIA 3ITNA 3PCRB 3OHMA 2PSDA 2QUBA 2Z5GA 3INGA 3MTAA 4FOLA 4D8XA 5KTTA 4UVHA 1HZEA 3IIEA 3PHGA 3EGDB 2FVYA 1G8FA 1VZ2A 1QHXA 2OUKA 5JZMA 2XT9A 5M04A 3GLKA 2QJOA 2VTDA 1XTBA 1QIMA 2LBPA 3MJSA 3TPCA 3I2KA 1RPAA 3KTAB 1KJZA 4ND4A 1PDOA 1MLDA 3ZZUA 3WGOA 1T6BY 2BLLA 3KR1A 2PNFA 2PS3A 1H5NA 1DAEA 3QXSA 3EW7A 3ONVA 3V00A 1KEVA 5HF5A 3N76A 2O07A 3DBLB 3T51B 1G6Q1 3KUCA 3DOUA 3NM5A 5HRUA 1Y9AA 4NYIR 5GY7A 3H5OA 5JI3E 4BPRA 1BHO1 1U8CB 2IY9A 3PT5A 4ZCTA 3LX8A 5A5DA 4LFAB 3USES 2VH5R 3G0HA 5DLYA 1KFEB 4LOIA 3ECSA 4EHHA 1USIA 1AGXA 3QRWA 4TWRA 2O7QA 2XBLA 4D98A 2A2ZA 2BFEA 3JX9A 4MQBA 4Q4HB 3WLIA 3GN1A 1X9HA 1BMFA 2H2IA 2LPMA 2X2OA 5HZBA 4HBGA 1GUFA 2J9XB 2VP4A 4I36A 4QLOA 2PGLA 4LX0A 3VBEA 4B9EA 4HVTA 2UUPA 3BGVA 1UWVA 3Q2IA 5KJEA 1Y8RB 4X1YA 5BQOA 2VZ0A 2ZYGA 3ESAA 4ENUA 5TY0A 2QVYX 1REQA 3LPAA 1WP6A 2HH9A 2W2KA 2ZRJA 4DKJA 3IL2A 2NO4A 5FOVA 2PGNA 5EPOA 2ASEA 2WD7B 3ABQB 1YJNB 5TB5A 3BHJA 3L05A 3MFQA 1KZGB 1YDGA 4QUZA 1C0KA 3A4LA 3OD1A 2VP9A 3A2LA 3ASRA 4GMDA 2I8AA 4OP3A 5IP5A 5K4GA 1JZTA 1TT5B 2C57A 2POCA 4I9GA 2UXCB 1Y6FA 3STWA 4X90A 5TXGA 5B7QA 3DBHA 2IUYA 4LW8A 1FLNA 1PR5A 2BEWB 1RWWA 2BHSA 3HJNA 2JFQA 1MOQA 2OO7A 4G3XA 3OG9A 3T34A 3Q15C 1VI5A 3NU1A 2FPUA 4R3UC 5JD4A 3LLSA 4ZCIA 3EIXA 1CRWG 3A9VA 3DNFA 4X9XA 3QFCA 4Q9HA 3G13A 1IZZA 1F9EA 4IIFA 1R4AA 4MUKA 4X1KB 3N2GA 4JD5A 3TQRA 2Q28A 5B37A 1Z8NA 2C3OA 3UFBA 2KLBA 3PG5A 4I8IA 2OL4A 1RXUA 4EMUA 4RIGA 4BFTA 3W2HA 4QKQA 1ZY2A 5ITZB 5EQDA 4D9GA 4F96A 3M1LA 2XKKA 3ZDXB 3AR2A 3M5PA 3H11A 3LGSA 5C1DA 3DXXA 4I19A 3U2QA 2XUOA 1HZZC 5EMJA 3IQXA 3HJGA 3DTVB 3WLHA 2PKQO 3H83A 1NF9A 1JHYA 5BSWA 3WK6A 3LY7A 2WKRA 3OZWA 2EARA 4HYTA 1TI7A 4NU5A 4BOYA 4UUOA 5F77A 4UOZA 1QP4A 1QYWA 4YUVA 2Z56A 1NW7A 3TCKA 1VYTA 3JTEA 1JDPA 3GNTA 2DMRA 4X8HA 3SR4A 3ZW8A 1FUIA 2CHVA 5KTNA 3AHFA 1DCTA 2ZIEA 2I66A 4BQRA 5KTMA 1L7VC 4C06A 1NW8A 1I2BA 1WP4A 1VL2A 3SHFA 4C07A 4F97A 3L7MA 1BLIA 2BKXA 2EIHA 4ND5A 5U4XA 4DTCA 1FFXB 5F1YA 5BMVF 1AUPA 5H16A 1OX5A 2C4MA 3M9WA 3TYXA 4G5QA 4W5QA 1VJ5A 3G2LA 1DKOA 1RRMA 2RGBA 3BGIA 4D96A 4IZ6A 4Z4RA 2AMVA 5ENDA 3BMCA 4QNRA 1G5FA 1KY2A 5AOCA 3WMRA 4D57A 3O2SB 2IT1A 2ZBPA 2GEVA 3Q98A 5G0WA 3GBSA 4BX0A 1X19A 3R6DA 1SXJC 3K05A 2PRZA 2K7FA 4CM8A 3FZNA 1RWOA 2W6MA 3UVEA 1HDYA 2KB0A 4GSYA 4BVAA 3OZEA 3SBOA 1SKYB 4R83A 3FUCA 1WKCA 5E6SA 2XUQA 4MR8A 2AFHB 2RI6A 2CFSA 3C3CA 4URHA 3UV3A 3ROMA 1DLIA 4EOGA 4QQ8A 3UV7A 5F7OA 1GTRA 4JS0A 2CL0X 2J0UB 2OZVA 5GVRA 1LDMA 1M2KA 2Q3DA 2XYHA 2ZUDA 3CGGA 4XIIA 4BZXA 2YUTA 4C0XA 1IJEA 2LKCA 2RBKA 4UU7A 4UJ3A 5DH9A 2Q0SA 1CV2A 1L7PA 4OXKA 4ZJZA 6AT1A 2KW5A 4CEJA 3QE9Y 3WI7A 1G20A 3TM4A 1QP7A 1WPGA 5FA6A 3FUTA 1SOVA 1W52X 1BE8A 4DG5A 3NTXA 2HF8A 3VPDA 2Z4RA 2ZRBA 5JDCA 2LE0A 4ZVRA 4N0EA 1G41A 4OOVA 5KDLA 2I1QA 3NAGA 2P4SA 4PF1A 3EVZA 4IEFB 1NFQA 2YICA 2A59A 2PNJA 1C1XB 3BF8A 2UYCA 1PQPA 5B6PA 1SBHA 1DDIA 2XMSA 1ODSA 3A25A 4JBHA 3NGXA 5E2BA 3HP7A 2B30A 4BMXA 3DUWA 1JIKA 3QY0A 3KSAC 3TLYA 2R00A 1WNTA 1RP1A 3LUJA 1CF9A 3PQ4A 3Q11A 2VF2A 3KQOA 4G65A 2JLAA 5FWDA 1YI1A 2ZTMA 1VKNA 4FUTA 5AD1A 1Q0HA 2C98A 2V5UA 5JZOA 4CDMA 4JT4A 4O3MA 4QGFA 1YZQA 4BPBA 2ADMA 1CVRA 2YS7A 3D4LA 4R5MA 1C30A 1NBHA 3KHUA 4AMGA 3P32A 1UC4B 3QU9A 3DQZA 1BO6A 3CLHA 4BN4A 1FFSA 3K35A 3BJRA 5H4GA 4MRVA 1KK1A 1GU0A 3A14A 4EKDA 5F4ZA 1NFFA 1T35A 3RUEA 2P90A 1WD5A 1ADCA 4JQCA 4ENWA 1U0GA 2Y27A 1Q22A 3CLTC 2MMGA 4D3FA 2BKUA 4HYQA 5ADVA 1UPAA 3QENA 1WF6A 4QPJC 2EKDA 1QQ5A 3GVCA 1PKXA 1MNQA 1Z16A 2I2XB 1T8UA 3FUUA 4NESA 5FUVA 4L8GA 3CCLB 1ODLA 4UCXA 3SSNA 4V0SA 4WFKA 2C54A 2DSTA 1QV9A 4KIGA 2R6GA 3I6QA 3KXDA 1UEIA 1V43A 1JFVA 2VLBA 1OYOA 3E9MA 2A5DA 4QELA 1CUIA 2PTGA 4BWVA 2O5RA 4L27A 4NULA 4JI3B 4EELA 2H4HA 2Y0PA 2RHOA 4E15A 4OGWA 1BOFA 1L7XA 1Y1LA 2BFBB 2GCGA 3N9IA 3OIGA 2H65A 2HQSA 4FLMA 1KZ6A 2Z6BD 5F52A 3I5AA 1N9ZA 3HDHA 4CL0A 1SZPA 3EXG2 4HXFB 4RD1A 3FM9A 5ALQA 3IQHX 2YVKA 1ID8A 1Q2UA 3V55A 4EEKA 2QVLA 2EKQA 3QYFA 2ZPTX 1CD5A 1LLDA 3HEBA 1V7QA 4QODA 4ZQHA 1I4DD 3HVJA 4CBVA 3PD7A 1G8YA 5JVDA 3OM0A 5EMHA 2CLSA 2G71A 3BE8A 5JRDS 1RXVA 3DOCA 2PFKA 2BEUB 2IYXA 4C5BA 1M2OB 4OLFA 3VSCA 4AFNA 3W5IA 2HWXA 8ATCA 2QORA 1NLMA 3HFSA 3ISJA 2PX2A 1Z2PX 5EXSA 3HXTA 4CM6A 1PK7A 3KDSE 3AV3A 1TUBB 1Q7TA 1UWKA 3DPSA 2CMDA 4U5QA 2C94A 3GPDG 3O2NA 3WADA 3OZDA 1H2BA 4RFVA 1YJQA 5C8VA 1ARZA 3VU3A 2OBRA 3KQTA 5EXTA 2GM4A 1ZXLA 3B3JA 1V1RA 2FVXA 4RTSA 4UHBA 5DHSA 2BUCA 2CNBA 1VMEA 1J33A 1E77A 3G8BA 3K9HA 3LOQA 4PQGA 1E1YA 3TLGA 3ML1A 1K1EA 4MW1A 4XN0A 5GJVC 3HPQA 4I6EA 5L3ZA 1BDJA 1WZEA 2DT5A 2PS0A 3ELUA 3KXLA 4NFLA 5ITVA 1XPOA 4NG5A 4KXLA 1S2DA 1YDMA 2HAEA 2F1KA 3HB0A 4ZI5A 1UC8A 5AXDA 4HWGA 5B36A 5GM2A 4QU9A 1GD1O 3BICA 4WOCA 1OBCA 1M9NA 3D5EA 1KJQA 1NG9A 1G291 5DLQC 3WZ2A 2ZYVX 3E81A 2EHJA 3UXMA 1Z07A 3N28A 3QEKA 2G5PA 5IDYA 1ETUA 2W6JD 4CCYB 4U7HA 4Q9KA 4L5AA 3ZQJA 1ZU4A 4O6VA 3L0SA 5E0OA 4NAVA 1ISHA 4ZOEA 2VF4X 1OASA 1ZGBA 1VBNA 2DWOA 4WBSA 1SM4A 3RASA 4YMGA 4IHAA 3OZCA 4HTFB 4MW2A 3KEFA 4G1EB 3LD9A 1EUQA 2X7HA 3HCRA 3FHJA 4K87A 3SY8A 3UC9A 1GAWA 1QNFA 2WLSA 1M1NA 3LQFA 5CDYA 2AOXA 2LDBA 1E9DA 3LQ6A 3I64A 2WM9B 3UYKA 2NQ8A 1FFYA 3NRCA 4EHNA 5LWHA 2J30A 2WABA 4KYUA 1XJCA 3WQZA 4LVCA 3N59A 2GEFA 5JMTA 3CE9A 1F51E 1KGSA 2RHCA 2AXNA 1W4LA 2FMFA 2VLIA 1RWVA 3AO0B 3BJIC 3C1TA 4HDNA 4WLFA 3T0GA 4BYMA 1A9ZA 3FDFA 1CUEA 5DT9A 2ZKLA 4EI9A 4KR2A 1NQXA 3D3WA 4Y0NA 4HMQA 3AKYA 3FMPB 4G0VA 1R9JA 3CG4A 4X0CA 1MO3A 1P5HA 5EMMA 5BUQA 1OWLA 1X1TA 5KOHA 1RRGA 2QT0A 2QS9A 3A3OA 2FYTA 4XI9A 3ED5A 1CRZA 4AJ1A 3ZXIA 1AO0A 3LUBA 2BP7B 5AIBA 3R6KA 1KARA 1W85B 4M54A 3DVLA 4QBTA 4WZAB 4AAYA 2TYSB 2HA4A 4IG4A 4DS3A 2R11A 4HPJB 1BWQA 1CY8A 4BJ3A 4DE5A 3W2FA 2GFHA 4K9SA 5LZ7A 4HSGA 5KVVA 2AEJA 4PC6A 1GG8A 5IUNC 2B98A 3UCFA 1FPMA 4EY3A 2D06A 1XYGA 5L3SB 1C1YA 3GIRA 4KPFC 1QZTA 1Q1QA 1AGRA 1OBOA 2OBSA 2W6JA 1GPKA 5HJEA 5BUZA 1NV9A 3QVJA 2V59A 3MC1A 1U99A 4I14A 5AVSA 3JSXA 2VCHA 1EFVB 3RK4A 5L3QA 1CERA 2B3TA 3D3KA 4TRMA 4X0EA 1ZS9A 1G0NA 1KAGA 2QBYB 2KBEA 2R9VA 3MERA 1HX7A 4MI1A 3CVOA 2RARA 4FHEA 1VDMA 3AETB 4IWYA 4DLPA 3I42A 5LP6C 4JBXA 2HRCA 2ACEA 3SDSA 4NZOA 1Z6AA 3LK7A 4FW9A 1I6MA 5JQGF 2HU5A 4N0MA 4DCNA 2PX0A 3TZCA 4QOSA 4XPZA 1AGPA 3G7NA 5DB4A 1KQFA 4A8PA 1P6UA 3EGVA 4CLOA 4HHEA 2XRYA 1WHSB 4KVFA 3R7AA 4R6WA 4ZHQB 4ZV9A 4KN8A 1SC9A 5BN1A 5LP6F 1ZD5A 4DILA 4MQFB 2P6NA 4OOEA 1AXEA 5TGTA 4DK0A 4KKXB 1EK6A 3DD5A 4NONA 5G40A 4GKKB 4BFWA 1QV6A 4ECEA 3MJ4A 2QTLA 1C2YA 1MBZA 2RC6A 3MMSA 1E3JA 1YJCA 2JN9A 1LLUA 1Z2CA 2M6RA 3CH7A 4O2AA 2OORA 4KXWA 2W8BA 5FXMA 1S2IA 2IZ6A 3OCJA 4YMSA 3PIDA 1PSDA 4CKXA 3C2QA 1I2ZA 1HTBA 3PHIA 3RVSA 1CK4A 4EMSA 4DJDC 2IGBA 3OF3A 4ZVTA 3QELB 1QE0A 2B6HA 2ARKA 1W6RA 5IZCC 3U3RA 2XD9A 3UXYA 2H1IA 1RQXA 3DE7X 1ZNXA 2CLMB 3S3TA 3STUA 4QG3A 5LOVB 5EI5A 1ZGCA 1G1AA 4LWOA 1X1DA 4QQNA 1Q1ZA 3HRKA 4DUGD 5KB3A 2YXNA 2CLHB 3K1YA 5CH5A 5L7WA 2HHHB 3ANSA 3NYRA 4NZZA 4C22A 2B4KA 4FYXA 4IJKA 4QTXA 3O3MB 1H94A 1OLSB 3PIRA 3NBZC 5FAKA 1QQ6A 3W5UA 4B3CA 1P2TA 2G40A 1AK1A 1U4OA 2HFKA 4GR9A 4YDQA 1JVNA 2ZSJA 1FU4A 4XRRA 4JXZA 4RZIA 1MDBA 5KWJA 1XRNA 1CY0A 5KYKA 1VHOA 1IQPA 3AVOA 4DBVO 1KH2A 2HCRA 2J8ZA 2HQOA 1M6VB 1SQFA 1DTEA 2WHYA 1RZRD 1MB9A 3LK6A 3TLKA 3W3ZB 3A37A 4MQLA 1SCAA 3DVQX 2NUPA 4IFEA 1CHNA 4IMRA 4WKCA 1VHEA 2VUSA 4LC9A 3L04A 3QYJA 4FZ3A 3TSCA 3AUKA 5F98A 2QTBA 1BXRA 4M98A 2W4IA 4N3NA 1B0AA 3PEUA 4M22A 5FI1B 3MYRA 1U80A 4CR7A 1I7QB 4I3GA 4BMPB 1PFWA 2OECA 3ENQA 1VIVA 3A1FA 3RQIA 1QIGA 3L1JA 5C37A 4IGKA 4MW0A 1Z08A 3FKJA 4FLFA 2P4UA 3FSRA 3TNJA 1WXWA 2Z2XA 4M8IA 3LTEA 4DYDA 1Y80A 1PHPA 4Z9AA 3O93A 3G6WA 3FPAA 3L6OO 4PX2A 4BTEA 1ZAYA 2I55A 2V55B 3IBFA 1L6RA 4EAAA 2JNWA 1PJ4A 4IJ6A 2FRXA 4NEGA 4P34A 4EW6A 4DDUA 4WXPA 2H1CA 4AZ0A 3EFOB 3ZHOA 4B2PA 4BKRA 5LD2C 1PJ6A 1T36B 1A8SA 4PHGA 1DC4A 3WLSA 2ZM6B 2WG1A 4WRRA 1XTKA 4RVOA 2NV0A 4DUGA 4XIYA 3NJ4A 5ILQA 1WAMA 4X8OA 1X0VA 2H1HA 4YEJA 3NTLA 2E6KA 3UWDA 2BD0A 1G6HA 3GHHA 2IPNA 4G0ZA 2WU4A 5KYNA 3CLRC 1OLXA 3AI1A 2EJUA 1LRLA 1D09A 3CRW1 1L4BA 1IJFA 3ZWVA 2GTIA 2W37A 3V8PA 1IHYA 1EA5A 5JCOC 3E53A 1CPYA 3OWXA 4WFIA 4IDBA 5CA1F 4HGRA 4AKEA 1TE2A 3HN2A 4GXQA 1QRUA 2YWEA 3KR2A 1P4GA 1P8AA 1TYEB 1ZMXA 1BE6A 3NV7A 3ODPA 3CPEA 2FMHA 3AI2A 3HVHA 3KV1A 4OXYA 2GZMA 2NYVA 1I5RA 4QOHA 1KH1A 1DJLA 4LN1A 4AICA 4WUVA 1M2VB 7MDHA 3RIMA 3HL0A 4LWZA 4Y7DA 1YO6A 2C88A 1IHXA 1RVDA 3BTOA 5DRTA 4XLCA 1MR3F 4CIWA 2ALJA 1PNRA 1PVVA 3H2KA 2GEUA 1R18A 4IIJA 4D0GA 3FMGA 2AJCA 4WDRA 5SYNA 3R7FA 1CJUC 1QZUA 1T3TA 2EX0A 4NF2A 3TIXB 1N2EA 3WB9A 2QD3A 3L7JA 5IAAA 5ALUA 1J22A 2C61A 2PBLA 1FS4A 1JB1A 1U9JA 2FEXA 1LQTA 2JI7A 1OFVA 4H0FA 4H4CA 4OH7A 4YIKA 5DISB 1G8AA 3BXXA 5ECGC 3B1VA 4Q3OA 1K5DA 3MS2A 1JAZA 2ILVA 2OGZA 8GPBA 1NASA 2OESA 4CU5A 2QU8A 3KWLA 1XEAA 3QG5A 4N8EA 2TECE 3T3DA 4YXFA 1QHHB 4D9CA 4R1NA 1Z13A 2IE8A 2ZAIA 4AKGA 1O6BA 4MRSA 4KVGA 5G4KA 3GLTA 4H77A 1W73A 3BEDA 1CFJA 2GRUA 2I1VB 2ZDHA 1U7ZA 4JXKA 5K8UA 4BLTA 4UM7A 5FTLA 3PFBA 1PZFA 2BDUA 1NNSA 2VCYA 3SF0A 1SBQA 2L82A 4DIDA 4S12A 1EFLA 4EW1A 4RSRA 2Q41A 5I7SA 3WTCA 1BYIA 5BO5A 4BGEA 3GAAA 4BNXA 4L22A 4ME6A 1D1SA 4JLDA 1D1PA 4WERA 1JQ5A 5AIAA 3FDJA 3C3MA 5A1TA 2O4UX 3PXDA 5B12A 3IUNA 2QRVA 2J48A 3RIGA 4C04A 2ZXIA 2F8TA 4LF6B 1KVTA 1VKHA 3TKAA 4X66B 5CURA 3M7IA 1ZMBA 2DP4E 5F7JA 3DUFB 3FCAA 3GI1A 5BMVB 3LW7A 4WKNA 4DV6B 2W6OA 3RWBA 2FUG1 2XTNA 3UPTA 2ACVA 4FXUA 3GEPA 2BBTA 4RELA 4JZKA 2VRNA 4FOOA 1FUUA 1GGHA 1YA4A 2XI4A 3LPDA 2OTJB 3DGFC 1U0NA 3B89A 5GIPE 5HNKA 4YRQA 1E3SA 4BVEA 1P77A 1D0VA 3X3HA 3ZX5A 1NMEA 1TK9A 3CF2A 4I3HA 3FFXA 3BHMA 1OQAA 1S2OA 4DG9A 4D0RA 3B60A 1HG1A 3QPWA 2FZKA 3KEOA 1E5XA 2JFPA 4L50A 2B0CA 2ZYRA 3FOEC 4B31A 2R751 2RB5A 2V4ZA 5AW1A 1OFTA 4QXPA 2XSZD 2RIPA 4AMZA 4RTJA 1ONPA 1PT7A 3KYCA 5JEDA 1E5VA 1EWVA 2XQFA 3L46A 5FUYA 4D6XA 5KINB 1B73A 1SXJB 4Q4DA 3D3QA 4DIBA 3J7AC 1H42A 5F4OA 5EN4A 4DA7A 1I4WA 2ONZA 1Q83A 5C1IA 4YCBA 3U44B 5DBGA 3BKXA 1C8KA 4XQEA 4HGOA 4YREA 4G86A 2UZ1A 1OXUA 1SEVA 4GLBA 3ZGOA 3FD8A 1C8BA 3ZKWB 3VR0A 1D2MA 3G05A 2E9SA 3Q85A 1E69A 3WGKA 1P31A 4G67A 1TU0A 4S0ZA 3LSYA 1EE1A 3GQBA 2DECA 3IBTA 3K9BA 1Z36A 4M38A 3WIVA 4AULA 4EPTA 1VLOA 3DEKA 4LXHA 2DQKA 3V1TC 3VOSA 2O8EA 1FJHA 3A3BA 3CUVA 3HSYA 4ZRMA 5GINE 4XGRA 5AKZA 3RT1A 3PVCA 2JVJA 2WIAA 3FUVA 4C7XA 2E3JA 2CKDA 2XBUA 3DT8A 1IHPA 3IVAA 3EB9A 1U2QA 3N0VA 3PD1A 1FE8A 4OXIA 4RPLA 3SC3A 5CDGA 5TS3A 1CUBA 3Q7IA 5L7TA 1RQNA 1RKBA 2JFOA 2IBTA 1E3WB 5I8ZA 3E05A 5E9AA 1VHJA 2GZ1A 2HT6A 2Q3HA 2SBTA 3GOHA 3M89A 3FKSD 2DTDA 2DY1A 1IY8A 2G7MC 2YCLA 4PCLA 3ZXSA 2HHAA 3C16C 5AXCA 3UB4A 4TKLA 5JXIA 4KPYA 1KC1A 1NTOA 2O1EA 2ZIGA 4M1ZA 3R74A 5A4DA 2OAP1 1DWOA 1UWCA 3KO8A 4I9NA 5KOIA 1HEUA 4CM3A 1O4VA 1R12A 3KTDA 5HUQA 2A7QA 1A8UA 4G23A 3EXG1 1VRVA 4IVPA 3ICOA 4MGEA 4PHTA 3NANA 4GX5A 1ULUA 5JAUA 4Y0AA 1VPWA 4BXOB 3BGDA 1WZNA 1B8NA 4MPTA 4D6PA 1II8B 1MAUA 1Y6RA 4NU6A 3SKYA 3VPCA 3W5SA 1CE8A 1PIWA 1NVMB 1G2IA 1WPXA 3D4PA 2CNDA 3KZOA 4XWGA 4GD3Q 2QA4B 1O3YA 4JELA 2EBHX 2X9VA 2XSZA 3HJAA 4RCVA 4PEVA 2OEPA 4J16A 5K51A 1TLFA 3CVYA 1C3VA 3JQBA 1E92A 2F1LA 5KOJB 1ZYUA 2J9FA 4BBPA 3CCVB 1ZRNA 4GEGA 1I2MA 1M1UA 2Y76A 4PICA 5BSGA 3KJQA 4WCVA 3P52A 2QTTA 1I5EA 2IUSA 3R77A 2XJ4A 4UUAA 1JQEA 3CLKA 4GMKA 2IYFA 3T4UA 2JGDA 3KJGA 4DQDA 4E2WA 1W46A 1RLIA 2YYSA 5KWEA 4IOJA 4GYJA 4X54A 3EWAA 2ZP1A 3ZE0B 2ZDQA 1GAEO 1GZDA 1VXOA 2R5WA 4JP1A 2EC5A 3CG0A 1G5HA 1CS4C 1UDAA 2JFHA 3MWGA 4EECA 2Q62A 1T5DX 1QH0A 2GPWA 5HQJA 4WD3A 2AUNA 4FJ2A 2PO5A 2H52A 3WDMA 1R8YA 2XRMA 4QGAA 2HRQA 3DEJA 5CT8A 3HXLA 2L17A 4IQ4A 1VE1A 1YS4A 4JQOA 5AM5A 5ULLA 4GR5A 3CMMA 2G5CA 3FKSA 1UMCB 3P0JA 1H1LA 2E5WA 2RGUA 3P19A 4G0PA 4ZDIA 3S2IA 4GVPA 1XROA 4TQ9A 3CXCB 2FEPA 1MOSA 3GJTA 5TRTA 4Z49A 5KQGA 3MHTA 2VJYA 2YZ2A 1JKFA 3ZY4A 1U28C 2BDTA 3T0FA 1HT1E 2QYTA 3MAJA 5IJ9B 4I55B 4BQQA 3I9KA 2EYUA 3ZBTA 3N2KA 4EBBA 1WDWB 1RXCA 5GM1A 4BQFA 1DXYA 2QN8A 1VRWA 2OLKA 3NCTA 3U0BA 3Q9LA 1UKAA 4XM1A 3F6CA 3JD3A 1ODJA 4UXIA 3OMXA 5KNDD 5LIPA 3CXRA 3A3KA 3TOZA 1GNQA 3DHYA 2R25B 4BP9A 2EJVA 4E5DA 3OJWA 1BGVA 1YHYA 1D0IA 1SIBE 1XTZA 2W9XA 1EZZA 3SG0A 1KI9A 2WTNA 4KDCA 4X93A 1UANA 4NV3A 1N2SA 4IDHA 3L7OA 1HNNA 3NHFA 4R51A 5DJ5A 4ZDWA 4E2YA 2A9PA 2AI2A 3PFGA 4X6XA 5BMOA 4NDZA 5C8YA 3DBOB 4LV5B 2MSWA 3VO2A 1U3CA 4I2VA 5DIZA 3EYWA 1EFPB 4G9EA 3ZIDA 2MIIA 2ABWA 3TTWA 3LUGA 3QVKA 4JOQA 1TCUA 1Z5NA 2I3GA 2QR3A 2F3PA 1O0SA 1V41E 2HA3A 3OE1A 2H1VA 5EUCA 2YFKA 5G0UA 5BN3A 5LIRA 3FAKA 3CNLA 4QQKA 5C8ZA 1VQNB 2KM1A 4BWYA 1Y4AE 2FPIA 4RSMA 4LXUA 2DXIA 2R4QA 4MW5A 2WFLA 3SD7A 2EQ5A 3C74A 1ILWA 4M7OA 1U2GA 2RBGA 4IDPA 4YV1A 4YDHB 4DLSA 3LZCA 4B6FA 1Q1BA 4ZI7F 5EUQB 2JJ2A 5AM3A 4WXHA 1H2AS 3WXBA 3O8CA 4LC0A 3KOMA 2X6YA 1SXQA 2IFTA 3ENNA 3IDQA 1UM8A 4BGIA 2I6XA 1ACLA 1M6HA 2YINC 3DFZA 2I6UA 1Z8FA 2G17A 5CD9A 2DFVA 5KBYA 2XUDA 4UM9B 3D0KA 2ZWMA 3OPYI 3TEFA 1NVVQ 1BHSA 2D2IA 1U11A 3SFTA 1CLEA 2EW2A 4C0KA 4HN4B 3THXB 2GO7A 1SIWA 4OQ4A 4GNRA 4PQRA 1I2CA 3VR4D 5JZSA 2HA2A 4Q00A 3KCNA 2QTGA 4NBLA 1WY7A 4B6GA 5IMSA 4OUDA 1I6KA 2ZE5A 2X0DA 3ESBA 4A8TA 1N6RA 1XPUA 1R0WA 3NT2A 5KNDA 3JQRA 1JXAA 1FP4A 1VIMA 2NO0A 1NPYA 4C30A 3WQBA 4XRGA 4UEKA 5K99A 5LSAA 4MQ4A 5E3HA 4Q7MB 2CJWB 1U0OC 2UZAA 3QWHA 4OMFG 1K6MA 4BLQA 1SXPA 1CNFA 2IF0A 4KFCA 4NY1A 2Z9CA 4BO2A 2O3SA 3F97A 3SC2A 4RTPA 3RTBA 4Z6KA 4PLWA 2FSFA 3BXGA 3HYLA 3HFGA 3IQDB 1U63A 1X7ZB 2QAJA 5DYTA 1VSQA 4KH0A 2UVQA 4PZ0A 4R05A 4DA6A 2Q29A 1B43A 2G3YA 1DEOA 4H6XA 4JH0A 1XMPA 3OM8A 4PSKA 5CBPA 1EGAA 1TOAA 2AFIA 2QZSA 3D7RA 4IHJF 5BOSB 3BMOA 1YI0A 2PZKA 3O82A 4IF4A 4BJHB 1Z63A 1XNJA 1A82A 2K2QB 3DCIA 3ZHRA 1PL8A 1ML3A 1P0QA 5LZ8A 1QJCA 2WZCA 2DHEA 3QF7A 5DTIA 4WZLA 4MYUA 1NQAO 4G09A 5WRFA 2RBEA 2B92A 1DADA 1N2CE 1G4UR 2ODTX 3BL5A 5DNWA 5K8TA 1JQ3A 3EEBA 2JBAA 3C6KA 4MUXA 5BSMA 4WZBA 5JQGB 1GM5A 2BRUA 3LDGA 3TW4A 5JY6A 2PSHA 5C80A 4BZWA 4UBOA 2GN4A 2KYRA 3CVUA 1M72A 2EGUA 3UKJA 3M9LA 2B3DA 1PNVA 1TM3E 1NUPA 2GN0A 3AJAA 1H85A 4UDYX 5EMLA 2D3NA 1FTQA 1QS0A 1NQUA 1XU9A 4RPIA 1YU6A 2X7XA 1G5PA 3L1VA 3LQ2A 1S2LA 5LP6B 3O1LA 1KXZA 2QT1A 3E3LA 4P92A 1NVXQ 1N6HA 4EL5A 2EKZA 2ZE7A 4N6OA 2CF5A 3HSKA 1IB0A 5A3VA 3VR4A 1KR2A 3CB2A 4B6RA 5BVGA 1WU7A 2XVXA 3BZUA 4BCBA 2X0FA 2PJUA 3HWRA 3OPOA 3B1WA 4HLUC 2PTHA 3FFAA 1NHWA 3AM5A 3NTVA 4CIYA 1R6BX 5B4UA 9ABPA 1SHLA 4OX9Y 5MDHA 1SQ0A 3AZPA 1B1CA 1X14A 2C96A 3MWKA 3OOEA 4HQRA 4BNHA 4DGSA 4EGFA 1U0FA 3CFYA 3UT5A 3EIWA 2I91A 2W6NA 4F06A 4EK9A 2LZ0A 1NJSA 1C7QA 4ZFNA 1D1QA 3ZVNA 3IBGA 2FE1A 3EC7A 4XGNA 5HFAA 3E4DA 4GYYA 1AUQA 3AUSA 3F5MA 1RI4A 2B20A 3QKRB 4W63A 2FFHA 5FL7D 4I5GA 2Z57A 4JDPA 1AQYA 1D4AA 1DC6A 4M0MA 3Q3CA 5CDTA 5DNYB 3K72B 3N2NA 4HLCA 1T91A 4MI3A 1FMLA 4MIOA 2CMHA 5JG7A 4BB9A 2W90A 4DDVA 4B5LA 4H6PA 2JK0A 3DULA 1GQRA 2MINA 2QY9A 1F0NA 4NH4A 1EVJA 1O4WA 5DYYA 2QRQA 5LDGA 3W5JA 2J9ZB 3S8YA 1KJYA 1VMDA 4PU0A 1BVUA 1WG8A 5ALZA 4X00A 2E89A 1LW7A 2V6IA 4PN3A 2BCEA 2ETVA 3CR7A 4GAEA 3JRXA 3PUYA 4BL5A 3JQDA 1TDJA 3T61A 4HDSB 3U56A 3G59A 5K0FA 2IU6A 1TZBA 1QIJA 3DAHA 3DOFA 5E1MA 4G2NA 3RJTA 1KEEA 1MZPA 3OCCA 2HHJA 2C8VA 1JKJA 4MKRA 3QWAA 2AWNA 2C7PA 1M73E 4RXMA 4GPEA 3NAQA 2ANBA 2NNWB 4FJ1A 1WBJB 4B6OA 2FW9A 4X6LA 3BULA 1X7XB 4RM2A 1DG1G 5KTYA 3HBLA 3FHOA 2WZQA 3RVNA 3DDOA 2IODA 3R44A 4JHLA 5J4HA 5IZ4A 2AR0A 3EEOA 4UUBA 1CUHA 2WYVA 4KHZA 4NS4A 2P0YA 1K6XA 5T4HA 1EP9A 4XR9A 3MAAC 3JQAB 3P94A 3WGTA 2B9EA 4EG3A 4JB8A 3I4FA 4E1BA 1WDMA 4GECA 5AO9A 1SK9A 2YN0A 5EZYA 2OFPA 3PRYA 1GQ2A 1S7CA 3HA5A 3LCJA 4QVKA 2F43A 1EE2A 3N6XA 1SHJA 2BI4A 4NJMB 4XW2A 3C5WP 1CBUA 3RV3A 4BNTA 4I66A 4AKIA 4M76B 1L0BA 1E3TA 5FL7A 1R3UA 2P2CA 3T7DA 2A5FA 4EHDA 3BA1A 4EW2A 2YHIB 4TGLA 3VTFA 5E3JA 4PCVA 5T67A 5ELXA 5DGXA 4C4ZA 4H3SA 5B7PA 4QXQA 1YAJA 3WJAA 4F6LA 3AIOA 1CZHA 3IERA 4EB3A 2VDWB 3Q88A 5DWDA 2Y92A 3SM3A 1MX5A 4DJEC 3A6GA 2F1JA 3CZRA 3IELA 5CYFA 5CA1B 4KJZA 2V1UA 4KO8A 4E3ZA 3CTPA 2HN9A 3WG9A 3WIUA 4XEUA 4C1NA 4A6DA 1LEHA 1Y8QA 5DWVA 3JQGA 1OTYA 2D13A 2DBYA 2P9ZA 1PN3A 4CIBA 3VU1A 3SBEA 1ISJA 4D92A 4LJRA 2FX5A 2I4NA 1IOWA 4RSHA 3CESA 1IPEA 3HB5X 4P3KA 1L8LA 4RH1A 2HLHA 3A9WA 4RGQA 1SCJA 3ASVA 4P08A 4RW0A 2O2XA 5EP1A 3K0SA 1DFIA 1HNXB 3QX3A 1RMQA 1AGNA 2C5GA 2Q8NA 3O4JA 4E7OA 1QK4A 4UNQA 4J91A 4KQ9A 3LLUA 2HWKA 4M9SA 2QL5A 1QVRA 1H9AA 4G2TA 3HHPA 3BHIA 2R87A 3TLXA 4GZ5A 3WJ2A 4U4AA 3PDIB 5TF0A 3K1AA 4ZAFA 4DXDA 3VR3D 3GRRA 6CHYA 2VBSA 1USGA 2XNKA 2PS9A 1W9HA 3PF9A 2VVTA 3PUMA 1OWNA 1T4GA 1W4CA 4V24A 1BYUA 1B93A 5D7BA 2BN4A 3G7SA 3RC8A 5GVSA 1XRQA 4PZYA 3UJAA 4F3YA 2FP4B 2QZPA 1Q0LA 3IBCA 3HO6A 4UU8A 3JV7A 2QTMA 4Q39A 5FTKA 4MKFA 1BA3A 3DKIA 3ZV6A 5KYYA 3K70C 1CUSA 3DBVO 3IPXA 4KWEA 4IVQA 1NXOA 3WKBA 3SEJA 4AZVA 1C1HA 3O8OB 2A5GA 4W8OA 5CR9A 3RAFC 3JATA 4FGLA 2QM3A 2DKOA 2ZR7A 2QAGA 2UYOA 4FIZA 5F3RA 4WECA 3OKXA 3HP4A 4RFLA 5JUWA 5KTKA 2R6R1 3PUNA 2QLTA 4FK8A 4PC2A 2P11A 2D1SA 2ZRQA 2ZYTX 4KI0A 5IAEA 1JHVA 2YVQA 4RGBA 1FL9A 4V1CI 3F3KA 5BVHB 3H42B 5A4AA 1KI6B 1PG0A 1HE4A 1XV5A 1WP9A 3WYBA 2UU9B 2EAUA 1V8OA 1VLVA 3IPCA 3QEMA 5HRCA 5IFLA 4IHKA 2B61A 3WY9A 1GKYA 1WTCA 3GXOA 3O1JC 3ZXUB 4B4UA 2ATVA 1FDWA 1U3FA 4QVJA 5EYPA 4JITA 3TQHA 1XTJA 2YC4C 3BF7A 3HCBA 4X05A 1PR6A 3I32A 4RY8A 4UCWA 1F38A 3H4TA 4X1OA 5DFAA 1AT1A 4LYJA 1PJRA 1JEQB 2IY8A 3ISVA 1IEWA 1G3MA 1O97D 4OM7A 3FTNA 5LR6A 1R88A 3UK0A 4EJSC 3K09A 1FRQA 3NQ41 2CBXA 4TV8F 4MWZA 4ATNA 2CMGA 4X7CA 3ZHVA 1IBMB 3MPOA 3VR3A 1ORTA 2J41A 5TLSA 1SIOA 1FFCA 5D85A 3GT3A 4GKBA 3TJZA 1ZPDA 3LC0A 3NHBA 4P4SB 2H7XA 1W47A 2UZ4A 1XE1A 4J7XA 4WK4B 4WK6A 1YS2X 4EZBA 5JBQA 1LVHA 4NP6A 3QJYA 3ZJTA 3LNTA 3NX4A 5CFOA 1IRXA 3BXOA 3PNMA 2JLYA 2ISQA 3C7KA 5BYAA 2WWTA 3ZZTA 3OC0A 1YR3A 2QV0A 3HDVA 3RKRA 3KKEA 4KGZA 4ARVA 4DNPA 1T0PA 3R9IA 4RM0A 1L4LA 3H2YA 1ZRSA 1ZUNA 4WJKB 4CFYA 2AG6A 3RVOA 3EUFA 2YJ5A 1MOZA 4I5DA 3A6ZA 3I8XA 3R6WA 4J0QA 3B70A 4LMPA 1RBQA 1PGNA 1V16B 5I8WA 3K6RA 3FB4A 4MVJM 3G9QA 3TE6A 1Z4QA 1N2CA 2WK1A 2J45A 3MELA 1I6WA 1ZN9A 2CLKB 3TUZC 5D00A 1O9GA 1Z73A 3EA0A 4G36A 5CTJA 3WLMA 4AS3A 4Q1EA 3L84A 4PAOA 5J1TB 1M76A 5L40A 4B4OA 4ECAA 2AC7A 4IIYA 5GAJA 2JKYA 2BEVA 4OSPA 3K8YA 5IH7A 1TC1A 2ZAGA 5BN4B 4X71A 4YAJA 5AVVA 5TMPA 4YRZA 3X1YA 2JI6A 3M8KA 2HCFA 5GGXA 4ZVQA 4BX8A 4ZVMA 2BM8A 3NHAA 1GGKA 3CVXA 1FX0B 3AUXA 4XQCA 2HSGA 4KE6A 2YN2A 1T5BA 3R3JA 1PS9A 1C9YA 1RC0A 2TMGA 3A26A 1V5FA 5AK0A 3DFUA 2ZI3A 1RXYA 2G7ZA 4MGYR 5L7YA 4XYBA 4DUYB 3WL8A 4K6CA 3I9FA 2J9YB 5A6SB 3R3VA 4G89A 3GARA 3LY5A 3DO6A 4BB0A 4JJGA 1VTKA 4CTJA 4JVSB 5B64A 3CJRA 3OT1B 1JYEA 3V4OA 2Z2KA 4KFTA 4DUZB 4XQFA 2PLAA 1EFUA 1PS8A 4DQXA 4DLTA 1R1DA 1WX1A 2R96A 2V3WA 2OAEA 4F6RB 4NV0A 4ARSA 1YJWB 1JHQA 1X3SA 1A9YA 2H3EA 2RI1A 4MA5A 3A2NA 1YQDA 1MAAA 4HRYA 2XMGA 2W70A 3PCTA 3NOQA 4F4FA 5JNWA 4RIHA 5IBQA 1VIDA 5JFTA 4M86A 4DR3B 3ABOB 2BGTA 1WJGA 4OI4A 3WE7A 1M34E 1N92A 1AHIA 2HX1A 2YZKA 4O4JA 4ON9A 1CG6A 1Y3CE 2WM2A 1NAIA 1V47A 1UUFA 3FW1A 3FZGA 3ILXA 4IXTA 3LUDA 4MV8A 5FWAA 3TRHA 5EJ9A 4FYVA 3FNQA 1GO2A 3ZI7A 2VRBA 2Y1KA 3NHPA 2GUGA 3PZRA 3PUWA 4IDOA 3ROZA 3KE9A 3V7FA 2JLUA 4LVOA 3GLHE 3AEKA 3V7YA 1L1RA 1N3YA 3W6ZA 4EKIA 1YUNA 1CJCA 1CDDA 3EAGA 2GZ2A 1S2NA 2OV8A 4UPDA 1A88A 5A4MS 1M2NA 1HDOA 4J7UA 3U4QA 2PG3A 3LS2A 1JE1A 4JI1B 3AIKA 4G0NA 5K9ZA 1B8OA 3LL7A 3NDJA 4WZZA 5EQJB 2YV4A 1FQWA 5ADWA 3CT6A 3ZR4B 2HWUA 1YL5A 1CHDA 5IBCA 2RE8A 3OY2A 4MCAA 1RW4A 2OHFA 2XMCA 1YMVA 2GKSA 1KAMA 3OI7A 1DEXA 1R4NB 3EAQA 2HB6A 4JT9A 3TFWA 2YJ6A 1TYAE 4HWSA 2QD4A 3LZDA 1IWPB 5E7MA 4B74A 1YJBA 4LYAA 3JPWA 2X6WA 3U4CA 4OQXA 1E4EA 4OB8A 3AHJA 4D3ZA 3W34A 2XUJA 1BU5A 1XA3A 4R1MA 3AGPA 1DKQA 1YL6A 4V39A 4BMYA 2J07A 5FT9A 3TLAA 3W9YA 4TZ0A 3QFTA 2O8CA 5BYKA 1NU8A 1KFJB 4PX5A 4X3OA 1U8TA 2EJCA 5EOVA 1XA0A 4DVGA 1ZJZA 1VIYA 2CZCA 3EEIA 4KIWA 5JZVA 1Z9BA 4HWOA 1OOEA 5JCPA 2JZOA 2ZSBA 4O8CA 1GZHB 4M9UA 4LF4B 3MIIA 5EJAA 3FCXA 4L95C 3GV0A 1QO9A 2EW8A 2VR1A 3AFHA 1EX9A 4JCCA 4RXUA 5ALRA 3RBVA 1T5HX 1EZ4A 3RROA 4UU1A 1R7RA 3T1NA 2DPXA 2DLNA 4EVRA 5C52B 1Y5IA 1U0SY 5LM3A 1S8FA 3DVAB 4ZI7B 1T3SA 2J59A 2DBVO 4TM8A 3V6MA 4C4SA 1W88B 2QRGA 3B12A 4JOBA 5KHLB 2ZBGA 2FCRA 4XCQA 3SZMA 4UATA 4BJ1A 4LI0A 3COZA 2QLMA 4H4DA 3Q6RA 3E48A 1OV6A 4LNHA 4N5MA 2XWPA 1UK7A 4P4LA 1BDBA 1JWLA 3QTLA 5LXTF 4MRPA 1S3IA 3GX1A 1TT7A 4G5GA 1RJWA 4QU0A 4KLZA 5EP3A 4I1UA 2VRWA 1TKBA 4JR0A 4M83A 1R0LA 3TRDA 1JYSA 2J3QA 4XCVA 3AERA 1NBMD 3EGXA 3MWJA 5CA0F 1ZO8A 4P3YA 1V8BA 3WHLA 4A6PA 1PW7A 2A0YA 3TM5A 1FVXA 1MT0A 3KQVA 4OGGA 1X94A 5A8AA 3UK6A 3IV9A 1P4RA 4G1CA 1W4BA 1RJ9B 4DHWA 5KYWB 1ULTA 3EAFA 2WJGA 4RAOA 1ACMA 4ZPXA 4ZZ2A 1OVGA 4JYAB 3DFKA 4OREX 4DKXA 5EHXA 1YOVA 2G06A 1RWMA 1I3MA 2DH6A 1L5HA 4I55F 3VFDA 3GDFA 2C92A 3GJQA 4IHJB 3W9SA 4UMVA 5K0LA 4ESEA 3FYCA 5K3OA 1EQUA 4WK2B 2HDOA 4ZIRB 3D4OA 2X2EA 1GARA 1K63A 3BFXA 1IN7A 1V48A 2W22A 5K8IA 2E6UX 2D74A 3LO8A 4M4SA 1P1BA 2MR6A 2QTVB 2HDHA 2ODWA 3F1LA 4EHAA 2YL2A 2Q6TA 4LMRA 4LPKA 1NLUA 3VYRB 1V96A 4YMIA 3IESA 1UQTA 1WQ4A 4JOCA 4PZEA 3EEFA 4MDHA 3ILSA 5JBNA 3O8QA 4J4BA 5ELMA 4UUNA 1M6NA 1Q7YD 1Z6XA 1JPJA 3GCGA 1QF7A 4P31A 2HW8A 1PTJC 3VMMA 4NX2A 4WOPA 3ZZ1A 2Z9DA 3NBYC 4L4UA 2WWHA 3FYUA 3ZVMA 2B5OA 3ANTA 4JVOA 3VX3A 4ZOLA 3ZHQA 4IIHA 3J81A 1J9EA 1MFZA 1GSAA 4RKEA 5F2KA 1V0EA 4YRTA 4AO7A 3PDWA 1B6RA 2FFRA 3PLNA 3QVSA 2DSNA 3U4IA 3U31A 3CEJA 1TQDA 4B87A 5COBA 3F8SA 1Z5UA 1G7TA 5K3DA 4AJJA 5KREA 5LD2B 1NBMA 4K40A 3INTA 2D9RA 2VSOA 3NOXA 5JD6A 4WOJA 4ALIA 6ADHA 1ND6A 3K73O 4O4LF 4A1OA 4PNHA 1ORDA 2E0IA 3USZA 2CV1A 3D31A 3D1LA 3BAZA 2DQ4A 1E6KA 2G4LA 1VECA 3DLTA 4C4TA 4LMBA 1I9CA 2WIFA 1UP6A 3I09A 4YQEA 2FLKA 2O2ZA 1XCPA 2JJMA 3NVDA 4CCSA 3MRVA 4ZZIA 2R84A 2OC4A 1H65A 1B0UA 3P9YA 2QRJA 2HOQA 1GWNA 4RZHA 5FOWA 1K5PA 2BH2A 3W5DA 2XDQA 4PG5A 3N3AC 2C5LA 3DD1A 2VJBA 2WWRA 1A2OA 3MRSA 3WGYA 1CS0B 1LI5A 2WTMA 3PT9A 5C9ZA 2B8NA 2VJLA 3THYA 1EINA 4JSRA 1RHKA 5EPUA 3EVEA 1T24A 1JHPA 4DL9A 4HZUA 4WADA 2X0KA 1E58A 2DWQA 1RM4A 3E03A 3HLYA 1U2DA 3KKQA 3O3NB 4HH1A 4I4TA 1YLOA 4NVRA 1UBNA 1U1FA 1HMYA 1NXVA 5H3CA 1MGPA 1JH8A 5BOVA 3UMYA 1EGVB 3B2QA 2JGMA 4KYVA 1IATA 2QE6A 1Z0FA 1ZSVA 2XGOA 3ND7A 1R6VA 4RMJA 5A1JA 4G1VA 4LJ6A 2HMYB 3DKVA 2VYQA 3E9CA 4X44A 5G0TA 4D1YA 2HRDA 1P7ZA 1Y63A 1Y6JA 4Q3KA 4TWBA 5KC9A 1S0UA 2X2PA 3R5XA 4AJHA 1VPDA 3RIEA 3B82A 4HE6A 4L5YA 4B83A 1W0CA 4PC1A 1IY2A 3MUEA 1Y4DE 4IJMA 3JQ6A 4JQSA 4E30A 1K9VF 1FB5A 4IZHA 4C4OA 3KEWA 3IAEA 2W6PA 2H00A 3O73A 4AZ3B 4RWEA 1XXHB 1TZJA 3MGAA 4N5DA 1N5OX 2CCJA 2I3DA 3SXUA 1KP2A 4GQBA 1UKZA 2X2FA 1DDOA 2IHKA 2QZ4A 4WN9A 2EGGA 2GKOA 3H7AA 5E6UA 4P9NA 4D3DA 2NXEA 4WMLA 2WWYA 4G4GA 4JLUA 1FSZA 4PRYA 2JIZD 3RGWS 1NLFA 1UMDB 2NV2B 5H1YA 1JU3A 3L0CA 3IAS6 4AN1A 1I18A 2DLDA 1SB9A 4P1ZA 1RLOA 3LYHA 4PM4A 3IOMA 4UHEA 5HKAA 1QRRA 4B7XA 1SBNE 2P91A 4HZIA 1O95C 3RHFA 5K6RA 3AVYA 1XXLA 2PA0A 3V7UA 3GEEA 5DOVA 1Y7HA 2ZJ1A 3WSTA 1CJTC 4N7MA 5I9MA 2ISCA 2ZJ0A 1TEVA 5T3UA 1WKBA 3M70A 4KACA 3IDZA 4UHKA 3TIFA 4M1SA 1JFLA 1VYVA 3DXZA 2XAAA 5BP7A 4UNNA 4YN3A 3T35A 3CUUA 3TVYA 1AV7A 4YQYA 1G6KA 1DRUA 3WK9A 3CH4B 2P4EA 2MHCA 2QX4A 2H1FA 1PTKA 1X2EA 1XCOA 1GU7A 4JY7A 5DDIP 3TLBA 4RVGA 1KRWA 5DX1A 4BQEA 3RS4A 4B0PA 5M5BA 4ZAYA 3S1AB 4KB5A 4H7IA 4EDFA 2F8MA 4JJAA 4X3PA 1MO2A 3IVGA 4UAVA 3BSYA 4TTTS 3CX3A 1EFTA 2YV1A 1YCHA 3CPJB 4ROSA 4FUQA 3H9QA 2C2OA 4I1VA 2CLOB 4F86A 5JS7A 1IN5A 4PYJA 1PWHA 1BEUB 4MQEB 4MEAA 4WBNA 2VPTA 1Q77A 4NLLA 3QZUA 3SQXA 3G5TA 3R76A 4AX8A 4W7SA 4D4JA 4IJVA 1TMGE 2G25A 3IR6A 1DSSG 2PKXA 4BLVA 3S70A 2ODEA 4PPQA 3REQA 2QGNA 1EK1A 2DFPA 2AXQA 2OZEA 4PIPA 2M6SA 3FTCA 5EIWA 1XD2A 1RCFA 5GJBA 4PZCA 2JIZA 1KQ3A 3PTLA 4R2JA 3ZDYB 3I2FA 3QGMA 5K3SA 1QAOA 4OLHA 1MABA 4H1HA 2OXEA 2Z6VA 3D6TB 3MUFA 4MVJI 5LMCA 1RAAA 1VA5A 4JN6B 5FFMA 2GD2A 4X20B 1HWYA 3LWZA 3DJFA 4UUPA 1F2UA 3NFRA 4P83A 4OXQA 1EX7A 1XX6A 1S6YA 3HVIA 5CUQA 5BYBA 2XEXA 1B2LA 1BS1A 3ZHSA 3OICA 1NVKA 2YC2C 1FY2A 1MVOA 3CINA 4PAGA 1I7DA 1KI1A 3A4YA 3WGNA 4C9BA 3K70B 1K9SA 5AKYA 3FH0A 2Q2OA 1E1RD 3NNDA 3R41A 3R7BA 4EARA 1L7DA 1UDCA 2YVUA 5DF1A 2VF8A 5TPZD 3B85A 1IE3A 2NM0A 3GZNB 3B1FA 4W5RA 2ORYA 1MDFA 2LV8A 3NWPA 4COKA 2QJTA 1H69A 2NWQA 3V9PA 1U9CA 2IEBA 4J6FA 2HSDA 1F3LA 2XR1A 4A10A 4ENPA 3C6ZA 4BNZA 1Q0QA 4P35A 2WMOB 1MT3A 4KL8S 2Y9PB 2Z2ZA 3Q0IA 5C53B 3I4CA 1F2TB 2HLPA 4KN6A 4RDIA 1J8DA 1AF7A 1O89A 3MT9A 2Q0QA 4KPUA 1U0BB 1EJ6A 4U39A 4P7BA 2I03A 1RI5A 3AWIA 3UK2A 1X1CA 2BKVA 2C8KA 1QE3A 1X7WB 4B71A 1BSVA 3VPGA 1NVWQ 1P2UA 3ZUPA 2L2QA 4TV8B 2GPBA 4A0RA 1KQPA 1U0JA 3EDOA 1BRTA 4BGVA 1HLDA 3HCOA 3A11A 3SX4A 3I45A 3PX2A 3L7DA 4XSVA 1BMDA 4BUZA 4CM4B 1CQJA 1XMXA 1IUKA 2D4AA 2DM6A 1IQRA 2PZBA 2ONJA 3TINA 3LF1A 2GAFA 3T6KA 2C20A 4B17A 4N3BA 4HDKB 4EJSB 1JIVA 1TK2A 4W1QA 4ZQFA 4YCMA 3U9TA 1W49A 1Y9EA 2J4FA 4Y2JA 1J0DA 5F4BA 2NT3A 2ZIXA 1WUYA 3SJPA 4KTTE 1YGPA 3P9ZA 1OYYA 3VQTA 3PFKA 1HXHA 1OU0A 4MV6A 1T1SA 3WDLA 4NENB 5DBIA 3DLHA 4FWBA 1H6AA 4BMDA 1PFGA 3E35A 3I9LA 4RK7A 2FQXA 4BNWA 4ZGNB 4FZJA 5AUPB 3WSVA 1DBQA 2QZJA 1E7WA 2H2WA 1ISSA 1E7MA 1NMZA 4LMAA 3SYKA 4Q4AB 4WX2B 1XTUA 2ANCA 4PZUA 3EF1A 3G6EB 2DC1A 2WNHA 1E1RA 2IXFA 4CIAA 1JMYA 4R3WA 4TRJA 5JNVA 4B3JA 3EXFB 5TPZA 1O6ZA 5I3ZA 1EDEA 4OQLA 3FPFA 3PJDA 3KOUA 5LOVA 2X8JB 1X6VA 3ZOKA 4RF2A 3S8MA 5KKCA 1WB9A 1OZGA 2R5FA 1NZJA 2OENG 3OKAA 4XWOA 5J63A 3MTDA 5AKKA 2O8FA 2CN1A 1Q6ZA 1N0IA 1J0EA 1WUIS 4YO8A 1X87A 5TGZA 2YOGA 3BD7A 3D1VA 1FFEA 3NIDB 4MLZA 3GCXA 1NW4A 3I6BA 4PTZA 1XKQA 3KSMA 1EDOA 3HBAA 1ZD9A 1L7EA 3IEIA 4L4SA 2B25A 1L5NA 2DR3A 4JFRA 1IG3A 4ED9A 1EIWA 2NPIA 5JSQA 2MYPA 4BEBA 4E4YA 1RHQA 3TB4A 5BV7A 2ERYA 1VBKA 3EIOA 1XK7A 5DHAA 5JDCC 4HG2A 4UTXA 1KQSB 4WW0A 3Q7PA 4M99A 4XE5A 3QUTA 2FKNA 1TMOA 4JLMA 1Z5VA 3AR9A 1OB0A 2PEZA 3KL2A 3UOAB 5KS2A 2JEYA 2QRUA 3LUPA 2SKCA 1DG3A 1VL1A 3M5DA 4RHEA 1JJAA 1P5RA 2ZTVA 3QPCA 2WV7A 3CC4B 4FHFA 3C1AA 5B53A 5LA6A 1LPMA 1PR2A 3FGZA 4ZAVA 5JNRA 2QM7A 3U6KA 2R1VB 2R00C 3KVNA 1P60A 1YZKA 2WQ7A 1HDZA 3VUFA 2PKCA 2C9CA 2VHQA 3CCCA 2MSLA 2PWBA 5CNIA 1KBOA 4UMEA 1PZNA 3SHQA 3R9XB 4BO5A 4WKOA 4N0QA 4EPVA 2C7GA 1KYWA 3UT6A 2HCTA 4NABA 4IWXA 1OAKA 4EG7A 2AS0A 4JBIA 1CUVA 4R7ZA 3PPIA 3PNVA 2O5EA 1U7XA 3TPFA 5ALFA 2VBFA 3L1IA 2GK3A 5H7XA 3WAGA 1SO8A 2XOEA 3T5CA 2BCJQ 4GMGA 3O0TA 2VHEA 5YASA 2D0DA 3LHSA 3P2MA 1ABBA 4INAA 2ZJBA 2BELA 4BU0A 4J2TA 1YZFA 4X7PA 1E6CA 3ZDEA 3KD3A 1AHHA 3WGUA 4YRCA 2UZIR 1JL3A 3EY9A 5FPTA 1A71A 2H07A 3FUWA 4INOA 4EEZA 4R4JA 5HM6A 1CSEE 1KY3A 4OQEA 1FDOA 5AOAA 3RODA 3MGBA 3ASPA 1CNEA 4Z4TA 2O1SA 5K6AA 1CUUA 2Z5VA 1HY3A 2Q7XA 1ST2A 3DXYA 2X9NA 1DT5A 4S1TA 2ZBEA 1CX9B 4AVZA 5AJXA 1UD5A 3TI7A 2D6FA 3DFFA 5AW5A 5DCUA 4XQ0A 4QM6A 2V6FA 5FUXA 3SR3A 4GMHA 1T8PA 4F12A 4MGKR 3I2JA 4LECA 1Z3CA 3L8YA 1BD3A 4X7EA 1TTQB 2PFSA 3EUWA 4L07A 1G8SA 3NV9A 5GZ6A 4AUKA 4EIWA 5JAOA 5JSZA 1SUAA 4N7JA 1TA4A 3IQZA 4EVQA 4PAQA 1SWVA 2VO1A 3Q3GE 4FWTA 1KSHA 1DXOA 1IXRC 3RIHA 3ZOZA 4D80A 1A1SA 5ALKA 4XX0A 3IO3A 4QX6A 3L6EA 5THKA 2WSSD 2BFNA 3LUHA 1APBA 2B35A 1D4ZA 3ABIA 2ZB2A 1RYBA 2NZVG 3NBKA 4M9ZA 4QTZA 3T12A 5JVDF 1ODKA 5ADHA 1IDN1 3K0AA 4FC7A 5F23A 1NULA 3RS7A 4KWCA 4FVTA 1ZHFA 4HVLA 1HDCA 3EPRA 4A92A 3PTAA 2BR3A 2VSXA 2RGCA 3F2IA 4QZVA 2CT8A 3PE6A 4JR2A 1XO1A 3E0XA 4BVHA 1KP9A 1XQYA 2ZG6A 2NPFA 4OEHA 4I9UA 4GI7A 1W5AA 3FI0A 2V0GA 4MI9A 3P2JA 1QYXA 5HX7A 4Q6WA 5AW7A 5K05A 4JC4A 3WBJA 2PXAA 2QLJA 3GAFA 3JZAA 1Q6YA 2O2EA 3GMSA 3IT1A 4GMXA 4JWKA 4OA8A 1K8QA 4B7AA 1YFJA 3AEUB 2GA9A 4I5FA 1XVIA 4MS1B 2OV6A 5TEVA 1IAQA 2V65A 3FKQA 1CQZA 5JCXA 4KITB 4DNRB 1UM9B 3P9NA 3CO0S 1JEEA 4R7GA 2DB3A 2AQKA 1IJKA 4RF4A 4Y6QA 3LOUA 5C46F 2GEKA 2P27A 1RYNA 4FZRA 5D84A 3OZSA 3SQWA 2C0PA 2IITA 4QVIA 2HQRA 4MMYB 2FN3A 1I4OA 5LXTB 3L82B 2GHQA 4PZLA 2FH5B 3JALB 5CPBA 2WSYB 2O2YA 1RNLA 4AF7A 3M1IA 1BDIA 4HMOA 2H92A 2ZROA 3RHZA 3H0CA 1DQSA 3KKPA 2VP6A 5K3CA 3SQDA 1QGZA 1QG4A 4G5HA 4BFCA 4YDRA 1XRMA 2IZ1A 5DK6A 5CA0B 3W4IA 2NU9A 3O4GA 3M4ZA 3E7PA 3ONWA