4RD2A

Structure of aif2-gamma h97a variant from sulfolobus solfataricus bound to gdpnp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGAEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 108
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd2A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd2A01
4XH9B 1XTKA 5JCZA 1JECA 1VKJA 1CLUA 1OT3A 3B1YA 2KE5A 4Z1MD 2QPAA 2FWRA 5L3QA 3BB3A 3SN6A 4P31A 1D2NA 1UBCA 4I1UA 1P9NA 3DDCA 1CJMA 4EFLA 3CX7A 3JZAA 1I7PA 4A1FA 1YZQA 1GAWA 4AF7A 1N6OA 2CHGA 2JEOA 2V7QD 3DEFA 4FD2A 1X6VA 1J8MF 3EA5A 3L0SA 1Z83A 2FSFA 3LXRA 2OLJA 4FINA 3TJZA 4MDEA 3MAAC 1JI0A 4URXR 2ERXA 4UNQA 3ZVLA 2W2VA 4A6XA 1FTNA 2BJVA 2W6JA 1KD1D 1XZQA 1JEEA 1L2TA 1XTSA 5FUVA 1UPTA 1Z0AA 3KQLA 1GUAA 1UFQA 2WJHA 2WWFA 1RVDA 4HB2A 5JI3E 3TKLA 3CZQA 3KJIA 1R4AA 3U60B 4FMBB 4LWZA 1NDHA 4HAXA 1IAQA 1N0WA 1NY6A 5CK5A 2B7CA 1QVGB 5FPKA 5G3YA 3PV0A 2JIZD 5FL7D 1F2UA 3T35A 2QGZA 1GVNB 1Q57A 2YOGA 5L3SB 1N6KA 2GTPA 5BN5A 5KUTA 1O3YA 2EFGA 1E0KA 3L0OA 5DYIA 4TT3A 1NVXQ 3AVVA 1GNQA 1L8QA 4TN1A 5TVKA 5A5GA 2OO7A 4DDWA 4XWKA 3LBHA 2FFQA 4C0JA 5CIWA 4FI3C 4DLYA 2ZYUX 4V0KA 4YMTA 1Q20A 4EAQA 4XTCS 3WHLA 5AUPB 5SZIA 3GLIA 3DHWC 2RH5A 3HPQA 3ONWA 3GCGA 4M22A 2GJSA 2DFLA 3QEOA 4B4DA 4PPFA 2R6GA 3G6EB 2H17A 3A6PC 3ZDQA 1B2RA 4B35A 3CONA 4Q1AA 1KTVA 1BQEA 4ZI3A 1R0XA 3CCEB 1TQDA 1EFRD 2WWGA 1VYUA 3CW2A 1I2MA 3AKDA 3BFXA 4K8OA 4TLBA 1GNPA 3ZQJA 2PJZA 1FX0B 1N8RD 2BVNA 2IA5A 3ZVRA 1XPUA 1FP6A 3L0IB 1M90D 1KI9A 1JB9A 5G40A 3OIWA 4G1VA 4U00A 1R2QA 2F43B 1CXZA 3ICQB 1Z6YA 3UXMA 1GL6A 1P9WA 1YZKA 1F2TA 3VR3A 4JKYA 4NYMR 3BAFA 1RJ9B 4DWJA 2ZSDA 4DCUA 2CK3A 4OHZA 5FPTA 5DGXA 4US0R 1XEWY 3G4SB 1G1MA 5HE8A 5GJBA 1EX6A 1MABB 2XNDD 1S8FA 3ZBUA 3GFTA 3OZUA 4KU4A 1KNXA 1XP8A 4YAFA 4Z54A 4BLSA 2GJKA 2IBMA 1BOFA 3EPJA 2ZVPX 2XSZA 5AWFC 3QBTA 1E4VA 3DVLA 5FL3A 4IHQA 1X1SA 1X3SA 4IOLA 4JSYA 4MUAA 2G77B 2WJYA 3JZMA 2AD1A 4Q9LA 3P4YA 2R6AA 3DOEA 2H7VA 2V1UA 1U90A 1ZC4A 2C5LA 5TDHA 2BMDA 4DIEA 1VQMB 2QUZA 2ZE8A 2VO1A 3MUFA 3CUEF 1VDZA 4LC0A 1NN0A 2FE4A 3BWDD 2A5FA 5L3RA 4NZYA 5C4MA 4UNPA 3R20A 1NG1A 2YJTD 3KUCA 4YMUA 1KK0A 2BMWA 2H16A 2ZAMA 2Q9BA 1GJRA 2ZE5A 3CO5A 3VU9B 1OLOA 1TPZA 1NMZA 3W2EA 2CHVA 3MSXA 3QY0A 3I4LA 3X1YA 1QGYA 3QXSA 3QI2A 2QSZA 2GF0A 3ZS9A 4DDUA 1XD9A 1TTTA 1YR7A 3B1ZA 1S0UA 1W4CA 3THOA 4OKSA 3WP0A 1Z6TA 1TF5A 2QT1A 5DO9A 2DB3A 3HWSA 2C77A 2DERA 3WMEA 4RJLA 1Q1BA 5FTNA 4PHFA 3BC1A 1IM2A 2BIFA 4BFWA 3ZJYA 5JS7A 4AD8A 3AF1A 3AVTA 1QHGA 1UBFA 2EW1A 4NL4H 5FPHA 1G3QA 1AGRA 4O25A 1T3HA 1DG3A 2P65A 4DLWA 4QRHA 1XCGB 2FJUA 1W44A 1ZMXA 1ZCBA 4DUGD 3TLXA 1VPLA 1SVWA 4DZZA 4JLJA 3FGNA 2ODWA 3C41J 2CCGA 3GD7A 4IFBA 2ZRKA 3A8TA 3E20A 1A2BA 2WKRA 2ZAOA 1XX6A 3QKRB 1KI7A 2OK8A 2C04A 4IKEA 4NCHA 2GILA 4YHBA 1OIVA 2QMHA 4HE5A 4ZGQB 2O8FB 2FZLA 4BFVA 2IUUA 2FSIA 2Q3FA 4RSGA 3Q7QA 2FU5C 2GAOA 5SZHB 3ZD7A 3AP1A 3GLFE 4OQNA 3WMFA 1QG2A 3GQBA 5KPDA 1W0KD 1E9BA 5CIQA 5IF9A 2XZPA 3H2YA 4HZUB 1GVHA 3JQPA 2DETA 2AKYA 4V0LA 1II8B 3VKWA 2VH5R 1IXZA 4IW3B 3IIKA 4W5HA 1Q0UA 4QKQA 1YRAA 5LBIA 1N0VC 2MSEB 1ZIOA 4AF6A 2BMFA 1D8TA 1P72A 5CJ2A 4AWXA 1II9A 1E2PA 3QBVA 5TB5A 1G8YA 1AKEA 1EWQA 2O8CA 4IDOA 4I99A 2RGBA 1G7TA 4MGKR 3GFOA 2HV8A 2JLQA 1AS2A 3NC1C 1BIFA 3QKUA 3KUDA 4UKDA 2JDIA 1FOEB 2QQEA 4WXPA 3KB2A 2ZI3A 3OFNA 2WMNB 5JECA 5GVRA 1KO4A 1OB2A 4C0HA 2VP9A 4U5XA 3U3KA 4P4SA 4X8HA 3AB3A 3I3SR 3R8CA 3CD6B 1GL7A 1QHSA 1ZBDA 1KSJA 2OCBA 4MGIR 4NYIR 3AVUA 2YOFA 3B82A 2PZGA 1MO3A 3U5ZB 4RD4A 3SE0A 4JT4A 1HE8B 1KZGB 2I3BA 2VHUA 2ZSBA 3PCRB 4V0MA 4PPNA 4ZDWA 5C1BA 4BGDA 3KQNA 1E2QA 2OFWA 2YVUA 2BEJA 2XOKA 1XBTA 1VQLB 1R5BA 4HATA 5HE9A 4A9AA 4AK9A 1LNZA 2VA8A 2C99A 2NQ2C 2XTNA 1LF0A 2QMEA 1AQYA 1F2UB 1KZ7B 4E22A 1HURA 4V03A 2ZJBA 4DC9A 1HT1E 2JJ2D 5B57C 2GCNA 1FUKA 3PUZA 4HYYA 3RDPA 1Z0JA 2W0SA 3ZZTA 3TQFA 2HF8A 4QC2A 4LJ8A 4F7DA 3CB4A 4A92A 2ZJZA 4TLCA 1COWD 1BYIA 3DL0A 5K8IA 4B47A 4TMVA 2ZSFA 5A0FA 3OJWA 3GP8A 2I1QA 2F3RA 1SKYE 3OE7D 4I1OA 1Z6GA 5SZKB 3GLIB 3CRVA 3BIFA 3B8HA 3LQRA 3ZQ6A 2D7DA 4TYYA 3VQTA 2E87A 3CCRB 4B43A 3KXKA 2FPLA 4Q9IA 2YWFA 2VBCA 4C2TA 4QHYA 3RS7A 4G1UC 1ZNYA 4JBYA 1RE0A 4IJMA 1E9FA 3THWA 3CCJB 5FTLA 3M1IA 2KBEA 3KB1A 5AUOB 1HA3A 2VNJA 3LY5A 4XD7D 4B33A 4KSCA 1EESA 5F2EA 4C4PA 1S3GA 4E07A 5J47A 2ZM5A 2JLUA 2REBA 1KJWA 3PG5A 2C78A 3X2SA 2O8DA 4N3NA 1KI2A 2ZRDA 4A2QA 1XMSA 2CLSA 3CKLA 2OESA 3KXIA 1QZXA 2R6HA 4B74A 4R2IA 2D2FA 3GJ4A 3NWJA 1EFRA 2OCAA 4TYWA 3VO1A 4BLOA 4LRWA 1F2TB 1R8QA 3KKOA 2X3UA 3LBNA 1TVCA 4HZIA 4JLVA 5JFGA 1DAFA 1UKYA 5ANRB 1VQ7B 1OH6A 3U6BA 4EFMA 1DDGA 1CULC 1E94E 1XEXA 3RRYA 2UKDA 3D3QA 3NHBA 4GT1A 1J99A 4DIDA 5LDDC 5B30A 2WJVA 2JLYA 1LS6A 1E69A 4LBZA 1HV8A 1XXHB 1US8A 5AN9A 4US1R 1FQKA 3TW4A 4BEBA 3HR8A 2QI9C 4C0SA 2F7SA 1HYQA 1UKEA 4LI0A 1BH2A 2VQSA 3IBGA 1E9SA 4P33A 3W8RA 4LOAA 3LVBA 5AUQA 1TU4A 1H85A 3SJAA 1KKMA 1NJID 4EUNA 1JNYA 1WMSA 3KJHA 3IO3A 1IB0A 1BS1A 2CL6X 4GI7A 4M1TA 5KDLA 5ELXA 4H1UA 3MWJA 3UKDA 3KL4A 3B9QA 2C95A 2BBOA 2A30A 4JLOA 3AVOA 2OUKA 2LCFA 2XNDA 1D2MA 4BFUA 4F4CA 1M1YE 4PO9A 3T1QA 4PQFA 1C1YA 3K0CA 4QBHA 4NDZA 2BBWA 3X1DA 4WZBE 2XNSA 1OKKA 1CRPA 3QSYA 5AJXA 1N0UA 1D5CA 3GLGB 1Z8FA 3JVVA 2W6JD 1XB2A 2ZS7A 3RS5A 4GSYA 1XZPA 4WOPA 3AKEA 2QNRA 3HU3A 4I1SA 1G7SA 2PLRA 3W5UA 1NKSA 3RNLA 2ZI7A 1XDBA 3K0SA 1IY2A 1M34E 1E32A 1QVAA 621PA 6Q21A 4WZ6A 3O8BA 4QGFA 2QMUA 3DKPA 1SXJA 1RRPA 5K8UA 2EVWX 4D4LA 2WWIA 2J46A 2YYZA 3ZVNA 1E2IA 1VQNB 4OI0A 1E0SA 1BMFA 1P75A 3EAQA 4A0HA 4PGOA 4OBEA 4DLRA 3SJCA 3WMGA 1DG1G 2AXPA 4C7OA 1WB9A 1E2GA 1W34A 2V1XA 4BRWA 2JASA 1LW7A 1GKUB 4AI6A 4KBGA 2FFBA 1KQSB 2WHXA 1D9XA 5L3SA 3GMTA 4TTPA 2ZRGA 4QFMA 1U9IA 1CRQA 1I2DA 2FG5A 2ZTSA 3W2IA 1VCIA 3C4JA 4LC1A 4YMWA 5FBQB 3O47A 2A2ZA 2PCLA 2ORIA 1P60A 2J9RA 4TL6A 4DUGA 4GP6A 1BO6A 4ESHA 4ZI2A 4BUJA 2QROA 4NCKA 1YRBA 3EIEA 2PLFA 1NMXA 5DLQC 5FOVA 2V54A 3N2EA 3W6NA 3EZ6A 1E3MA 3QE2A 4RFVA 2RGGA 4L9WA 2QQ0A 1Q21A 4ABYA 1MR3F 3SBDA 2IW3A 4LY6A 5BQ5A 2BBTA 2X77A 2CLCX 3BOSA 2HYIC 3THYB 3I8XA 3OEHA 2PBRA 4D0GA 1LF5A 2VF7A 2CVFA 2ZJ8A 1FX0A 1SXJC 3FMPB 5K8LA 1KY3A 2OAQ1 5HR5A 3NBZC 4HI0E 2CK3D 1OFUX 4OHYA 1QVFB 2B5OA 1SULA 4EQ6A 4KXFB 3BERA 1T5LA 2V55B 4MRRA 4WZAE 1ZM2A 2DEUA 2FGJA 3K0FB 3RVBA 3TUIC 4LUCA 1N5LA 2FF7A 1VG9B 2R6CA 4JMPA 5FOUA 1RFLA 2JLSA 4TYNA 3SQWA 2FSHA 2CXXA 4RD0A 5JRJA 2J87A 3ZIAA 2QE7A 3W5JA 1Z5ZA 1RJ9A 4QHTA 2XSZD 4EKDA 2HT1A 1U9IC 1ZNWA 3A4MA 4ON9A 3CLVA 1Q81D 1OH7A 5KNDA 5GVSA 2DY1A 2OFOA 4XIGS 3BRWD 4ASUA 3LLMA 1WCV1 2WM9B 4DJTA 4RZ3A 3W3ZB 4DHEA 1CQXA 5E7MA 3QEJA 4LHYA 2KWIA 1RZ3A 4G01B 2G0NA 3HYRA 4DB4A 3VHXA 1W4AA 2VHJA 2XNJA 4A8JA 3AV0B 3LD9A 5FI1B 1P73A 3CPWB 3PIRA 5CM9C 1VG1A 1VQ6B 3EIQA 2SHKA 2REOA 4BFSA 2QTLA 4YAOA 2G1JA 3ADCA 5BYJA 1XCMA 5EXXA 2DCUA 4TLDA 3FVQA 1EK0A 1TU3A 2ECKA 3IUYA 1YIJB 1E9DA 1E2EA 2GZAA 4JVSB 3VNVA 4XVQA 1TQ6A 2P5SA 1YHQB 1S9HA 1ELOA 1FNNA 5DI3B 5FBLB 4DLZA 2QTHA 2BOVA 3RYTC 3FKQA 4YC7A 1Z0KA 5CYPA 4KYUA 2HJVA 5DISB 3LVQE 5HCNA 3R8FA 3TGPA 1W7AA 1G16A 1OXXK 3TIFA 3IQXA 2IWRA 1NN3A 2F1RA 3REFA 1J70A 3KFXA 1QDEA 2RCNA 4TLAA 2JJ2A 3NG1A 4QGHA 4M9XA 2ZANA 4Q1EA 5EP1A 4QNMA 4MKHA 1SVSA 3T5GA 1GO2A 1J90A 1L4UA 1OIWA 1YR9A 4HEJA 1VCMA 4IVQA 4EIWA 2Q0HA 1P5ZB 5IT5A 3F5FA 2O0KA 2O0HA 4ACAA 1E6CA 2ANBA 2CNWA 3SR0A 4RD3A 4B2LA 2P0EA 5EMNA 3IEUA 2QRNA 4N0EA 2J1LA 4MYCA 1RRFA 1DAHA 2LKDA 3EG5A 4OJQA 3V76A 2O8DB 4EPWA 1Z22A 2ORVA 2VRWA 2CVHA 3GLIE 4PC6A 3B13B 3U7EB 4DCVA 5JEDA 2GXUA 1JA1A 5E95A 3IKJA 1Z2CA 2EFEB 3UG7A 3WP1B 3WNCA 3ICEA 1G291 1CF4A 4A8JC 3NTUA 1VQPB 1OXVA 3M4YA 4OQMA 5FR1A 3V4FA 3G82C 4DDTA 4ZKDA 2W6IA 4D82A 3QKRA 2QA4B 1NBME 4JL8A 4NPHA 4LSGA 4RY2A 3D31A 4POAA 2QAGB 4N0DA 2NZ8A 1T91A 5HPYB 2ZITA 4D0NA 2IS6A 1EFTA 1R5OA 2GXAA 3VR2A 2A5YB 2G88A 1P4SA 4AKHA 1W4BA 4FMCF 4P0TA 1E2DA 4GOXA 5G3ZA 1Q82D 5CITA 1TQ2A 3IHLA 2R44A 4LYHA 2XITA 4RFSB 1Z2AA 3U44A 1GRRA 1FUUA 4KFTA 2P5TB 2BDTA 3BH0A 3VR1A 3K9NA 4NBSA 1II8A 4OJKA 1N6PA 1PVOA 4GMXA 2JDID 1JPJA 1FPMA 2XB2A 3OFND 2IWHA 2JLRA 1ZP6A 2OTLB 3A37A 1TUIA 2H92A 2IEYA 5CDFE 3F8TA 4AKIA 2C9CA 3KKNA 1XXHE 3BH6A 1N5JA 4XVUA 3A4LA 4PR0A 4S2EA 2GK7A 2G83A 5AK0A 1EP1B 1VG8A 2R8RA 1ZIPA 2BWJA 1RYFA 3RSLA 1EFCA 4GBMA 1S72B 2XOKD 3AF4A 2NGRA 2Z4SA 2WICA 5JCPA 2BM0A 3I5XA 2LKCA 1G8FA 2QEQA 1YU9A 1SVIA 4IDHA 2RC6A 4HUTA 4R98A 1L7VC 3CPEA 1SXJB 4JVLA 2WPDA 4JYCA 5THXA 2AR7A 4MGYR 2UZIR 2NO9A 3RC8A 1T0HB 1P2SA 1P2TA 3EZFA 3V00A 5IHPA 3ADDA 1F20A 2ONKA 2X2EA 1KRHA 1SKYB 2BBSA 2ZQ5A 4M1OA 4WAUA 5JWOA 1LTQA 1T0JB 3IILA 5A4JA 3GLGE 1GWNA 4C7OB 4NTZA 2ZUDA 5H8WA 1TQ4A 1XMJA 3K9HA 1O87A 1RIFA 3C8UA 1TADA 2V4ZA 5KYKA 1N3BA 3Q7PA 2NO6A 2A78A 1JQJC 3HYTA 4LJ6A 821PA 3VTKA 1G5RA 3MWKA 4QOSA 4G3XA 4BECA 4OHWA 3MJHA 1R0WA 1YHNA 1E2LA 1UDXA 1YE8A 3I56B 3AVPA 3TSWA 4KBFA 2ZRJA 2WSSD 3W90A 5LD2B 1W2HA 3B1VA 2RKOA 1NSTA 1YR6A 4HLCA 4MUBA 5EP3A 1H8EA 2D62A 1JJVA 1OYYA 2NO1A 4IRUB 3ES9A 1Q12A 2D74A 4JYBA 3SHWA 4C30A 1A82A 1NLZA 3EIHA 3UWKA 4QBIA 4CGZA 1MKYA 3CWQA 1Q3TA 3FMFA 1GG2A 2WMOB 1A2KC 1DS6A 1OIXA 4IDPA 4YLGA 3CH4B 3VAAA 3T61A 3PQCA 4RCZA 5H59A 1JBKA 1NBMA 1U98A 4YXWA 4B32A 4DSUA 3CRZA 5C18A 1C9KA 2F55A 1YQTA 1Q1QA 3GJ8A 3ND8A 4OL0A 4A2WA 2FMXA 5JMTA 2EIXA 3VR4A 3VX4A 3CMEB 1TF7A 3FHTA 3K70C 1XJ0A 4EQ6B 4TYQA 4BZXA 2RGXA 1T3LA 3CCUB 4LJ7A 2KSQA 2HJGA 1DELA 2CHQA 4P3YA 1XJCA 4DCSA 1JQLB 2QU8A 1XCPA 3P4XA 3ASZA 4BFYA 3CIOA 1EP3B 3FDIA 1NVWQ 4EPTA 4ZPXA 4ESVA 4HAYA 2XGJA 2KJQA 4DBLC 1DBSA 2AX4A 2GPJA 3SYLA 5GJWC 1E1RA 3LH5A 4QXAA 2MMCA 3PUVA 3QXXA 3A58B 5FPYA 1LFDB 5CDFA 2EYUA 2Q3MA 4JIMA 1RPZA 3ZC3A 3B60A 1XXHA 5AJYA 1YR8A 4TLEA 1K73D 2NZJA 4KAXA 3DOFA 1E99A 3NIBA 2VYQA 5CB6A 2ZSAA 3Q3JB 5JLJA 1K5GA 2G0TA 4D0LB 1LY1A 4A8JB 1TUEA 4DLSA 1OKKD 3K0AB 1Z0FA 1N6RA 4LBVA 4LCBA 1G9XA 3DKVA 3AF0A 3SU8A 2R9VA 4FN5A 4Q1CA 4PO1A 1VCNA 1HE1C 5DN6A 4AYWA 2CLDX 2EYQA 4TZ0A 1CKEA 3F3YA 2B21A 4HLUA 5J40A 4DQKA 1SXJD 3IPXA 1NN5A 4LPSA 4V0ME 4ARZB 3SC3A 2FDCA 4RKFA 4RZXA 4L16A 4OI1A 2GBLA 4YALA 1VIAA 2Z5FA 4GDFA 3GLGA 3AEZA 3J81k 4M0LA 1U8YA 4KHZA 1Y3AA 1NVVR 1QFZA 1KC8D 1EWRA 1G3MA 3RS2A 5CK4A 1BMFD 1NJFA 2IS1A 3EWAA 5DE3A 1YZUA 1DO2A 3LWNA 4QBGB 5FA6A 2GQFA 2IYXA 2EFHB 3E5HA 1E9RA 3CXCB 1II0A 2PZFA 1DAMA 4KITB 3K09A 3PEUA 1YKSA 4IDQA 4LV8B 3EW9A 3E1YE 4O2RA 4CEJB 1XD8A 4D4MA 4P32A 1KO5A 1B0UA 1R8SA 3MG9A 3P27A 3AF3A 3CCSB 2B7BA 2RHMA 5BN3A 1GKIA 2XX3A 1YVDA 3AKYA 3KJEA 4ZIRB 4TL9A 4NCNA 3KX2A 3N2IA 4B2IA 1OXSC 1XRJA 1DPFA 2YZ2A 4W5WA 4YDSA 1W49A 4FXPA 2RAPA 3V4RA 2J0UA 4L15A 4TMTA 2HF9A 3MJRA 3KFVA 5EUMA 2B8WA 1YI2B 1U81A 1ESNA 2DWOA 3A4NA 4LJ4A 1GP2A 4C9BA 2MMGA 1OHHA 1SVOA 3L8YA 2BF4A 1X86B 3EPKA 2JLZA 2WKPA 3OEHD 2C96A 2YWEA 3RC3A 4HLUC 4PSVA 2DFTA 3KXLA 4Q1FA 2BGIA 1CR1A 4CEIB 3VKGA 1IONA 2IYQA 3AVYA 4IEEA 4WBSA 1XU4A 2GEVA 2GBLC 1NLFA 3U44B 4JT2A 5JJKA 2OZEA 1PJRA 1NI3A 3LA6A 4RD6A 1E9CA 1K5DA 1EFUA 1A7JA 1H42A 2EWWA 4Y9RA 1V5WA 4B73A 2WJJA 3BGWA 3OW2B 3AVWA 3VR6A 4A2PA 3THYA 4LHVA 1S1MA 5KSZA 2WWWA 3KKQA 1W4RA 2GNOA 2ZROA 5GJCA 4LZZA 2EFDB 1ANKA 3T1TA 2QT0A 4PXAA 2QE7D 3ZIAD 4JLMA 3D7MA 1FP7A 1KDPA 2HXSA 3K09C 1YJ5A 3KJGA 3K9LA 5DI9A 4DB2A 3HR7A 3MMPA 4ASUD 4WQMA 4J0QA 2BMEA 3K0FA 3IPYA 3SYKA 4QM7A 1OB5A 3CNOA 2Y8EA 1G8PA 2PEZA 2F1IA 2ZRNA 2IF0A 1F48A 4MRVA 2OBMA 4BQSA 1Z3IX 1VQ5B 2B8TA 4URZR 2EWVA 4KYIB 1KY2A 2ZVQX 4BWYA 1KMHB 3LO8A 2HLDD 2XZLA 2AK2A 1D6JA 4JLAA 1U99A 4Q7KA 3C14C 5M04A 2GJAA 5KDOA 4LBWA 3GJ7A 2NPIA 1QHXA 3NVAA 1W0JA 3K70B 1JXOA 4LJYA 4X8OA 4LK2A 4CRWB 2ZJAA 1GILA 3GPLA 1CP2A 5EXTA 5GV8A 1DO0A 3FPAA 3I73A 4JJZA 4PC3A 3QKSB 2J59A 4QGGA 3S1AB 3W3AA 3QXCA 3UMSA 1VIYA 1HUQA 1KI6A 1VQ4B 2OILA 1GRQA 4QGAA 1R10A 1CR4A 4Q4HB 1M7GA 1J9ZA 1G8GA 1W2GA 3SFZA 1SXJE 1KYIA 1YZLA 2VF8A 5FBRB 3KQUA 4RD2A 3MHPA 3FMIA 4KODA 3TSZA 1N25A 3L2OB 3PEWA 5DI3A 1UDWA 4MDFA 3LXXA 2F1JA 3OAAA 2CNWD 4YQFA 3MCAA 4L9SA 4NE2A 1UEJA 5L8VA 2KI5A 1ZNXA 4GZMA 1S1CA 1WBDA 3WNDA 1RYHA 2FGKA 3I32A 4F7WA 2XNCA 1JEDA 2QP9X 1E79A 2IXEA 3DZ8A 4MRSA 3NBXX 5F3WB 4N1AA 2XJ4A 4EPVA 1DAIA 5KPJA 2BJWA 2IEZA 4PHTA 3QJYA 2XTMA 3PFIA 3WRXC 1XF9A 4NHOA 4PC2A 4NCJA 3UMFA 3UANA 3VFDA 2WSSA 1NKTA 1WDTA 3GJ0A 2BKUA 2W6ID 4A4DA 1AS3A 4FMDF 2H1LA 4UQOA 2GXSA 4Y0AA 1OGIA 2J5XA 2OE2A 3CC4B 2ZYTX 4HDQB 4Q7MB 4ZCMA 3GJ5A 3TW8B 3K53A 2QRZA 1JJ2B 4YAUA 2WJIA 4JLKA 4QL3A 2JLXA 1AGPA 2P6RA 2QL6A 3EASA 3ZZ0A 1PLLA 5BW8A 1G6HA 4M21A 1VYTA 5FOSA 1DDIA 1YJ9B 3EWSA 4AURA 3EARA 1PLJA 4M1SA 2BMJA 3L43A 1S96A 3QE0A 3QNUA 3LAWA 1WF3A 1MRSA 2QAGA 4XJXA 3L8ZA 1ZUHA 4OI4A 4Q01A 3A1SA 3V9PA 4XWOA 4M8NE 2AWNA 1FNCA 4KJZA 1ZM3A 2BCGY 4I4LA 1PLKA 1W5SA 4C0BA 2BN4A 2IYYA 4RFSA 1W36C 4CEHA 4PC1A 3C5HA 3CMAB 2QA5A 1QGZA 2Q6TA 2ZI6A 2CE2X 4HAWA 4PFSA 3X1ZA 4F38A 1XFAA 3I61A 1N6HA 2BEKA 1DOAA 2ZU6A 3NH6A 2VNHA 3AGQA 4HB4A 3H4MA 5CLQA 1SQ5A 5JI2E 4ZV4A 1MO5A 3RANA 3QF7A 3JVUA 2N1BA 1VG0B 2HDNB 5GV7A 4K81B 3W9YA 5BXQC 1K9MD 3NH9A 3O8RA 1TLLA 3NBYC 5D3QA 2WPDD 2HXYA 5H70A 1KK2A 2QZ4A 2L0XA 2ZRFA 2VNIA 5L3VA 2YC4C 1M7HA 1I4TD 1UKVY 2PT7A 3QIAA 1G18A 3K70D 4UXJA 4CZ2A 2IX3A 4HAVA 2AXNA 3N70A 4US2R 1XTJA 4HAZA 2C9OA 2AFIE 3AUXA 3CRW1 4Q1DA 3PVSA 1P62B 3ZZUA 4UAJA 1N5KA 3OZXA 3AKCA 3LX8A 1ZU5A 2ZU0C 2J0VA 5DNYB 2VP2A 1OFHA 2V9PA 5JSZB 2IHYA 1KAGA 1X8LA 2PL3A 3QOFA 4Q9HA 5KSWB 1OJLA 2QAGC 4MQBA 4TTRA 2GJ9A 4X8MA 4QJ3A 1T8TA 4B3DA 1CS4C 3WYGA 2VSFA 4NYMQ 4MGZR 1KO8A 5HZHA 1S2MA 1KO7A 2FEMA 2QM8A 3OF5A 2E1RA 3JQQA 3BORA 3BFVA 2GF9A 3KKMA 4EPYA 1H8ED 3OIVA 2J0UB 4JZKA 1Q44A 3SJBA 2WAYA 2GCOB 1G17A 4LYFA 2RGEA 3F0TA 1S9DA 3IIJA 1K8AD 2Z83A 1FMJA 4RD1A 1P3JA 4L4UA 4ZO4A 2QTFA 4YXWD 1NBMD 1DVRA 2QPTA 1E0JA 2R6DA 4DLVA 4Q9JA 2IUTA 1MH1A 1KDRA 3LFUA 2F9LA 4Q4AB 2HCBA 2WWHA 3AQ4A 5IK2A 4E5UA 4Q47A 5CJPA 3EZ9A 5EP4A 1U2RA 3TUJC 1XD2A 2C9YA 5FBWB 3UG6A 5LB4A 2CCJA 2ODBA 1C4OA 2DWQA 5DYGA 4B3CA 2B6HA 4KO8A 2OCPA 721PA 1F5NA 3CCQB 4IXMA 1X8JA 2IK8A 5JRZA 4KSBA 1M74A 4ZCLA 2YHSA 1E1RD 5EUQB 3DMNA 1BJKA 5D3MA 1OXUA 1PV4A 2NG1A 4LJ5A 1KSGA 5J5CA 3RRNA 1DTSA 2A5GA 1AZTA 3LVRE 2GVZC 3CNLA 4B75A 3VKHA 4JBXA 4Q18A 2VHQA 1Z6AA 4ACBA 4TSFA 1A4RA 1U94A 2O5VA 3FFAA 1Z47A 2GA8A 4EFNA 1E62A 5TY0A 1TAGA 5TXGA 2GZDA 3GLHB 2AFHE 2XTZA 2ZRBA 3W5HA 4F4IA 1HY3A 5KNBA 3P32A 3UMRA 1LB1B 2I1VB 4G5GA 3CNNA 4P4UA 2VNKA 2W00A 1KJZA 1WP9A 2KB0A 3KKPA 3TNFA 3ETLA 4DLXA 2RC5A 3U2QA 4GL2A 1ZUNB 1A8PA 3CRRA 3DO6A 4S35A 5DN6D 4Q4LA 1R5NA 1D2EA 3QXJA 4KCGA 1PUJA 1KK3A 2F9MA 5LD2C 4GFDA 4LHXA 1YJNB 4PSAA 4C0KA 4DSNA 4RKEA 3OHMA 1E2HA 2BM1A 4KLZA 4NCIA 2PZEA 3B1XA 2HLDA 4FMCB 4RCYA 3FHOA 3MWLA 4U02A 1XNJA 5E3HA 4AIIA 4Z51A 3K0AA 3AVXA 4ZGNB 5H68A 3EC2A 1KI6B 3HU1A 1GNRA 4A36A 2A5DA 1CNFA 1OXTA 3HU2A 2FX3A 3B78A 1K6MA 2E9SA 5G41A 4TZ6A 3CWZA 5TR9A 3GEHA 4DEXA 1N6LA 4AY2A 4V0OA 3TAUA 1NIPA 1XTQA 5AJZA 2O52A 2OK7A 1J2JA 2WSMA 3CC7B 3IO5A 2CL0X 2Q9AA 3CX8A 3WYFA 3IDQA 1RC8A 4ARZA 1KK1A 3B2EA 3EA0A 5CB8A 1KDOA 1W36B 4W7SA 2QBYB 1E2MA 4EPRA 5FPSA 1SKQA 1QHYA 4C0AC 1BYUA 3ZGXA 3T5DA 4JLPA 2BHRA 1T3SA 4TMXA 3QUSA 3REGA 2JLVA 1T5IA 4IOMA 4B44A 1LVGA 3T1VA 2IUSA 4OHXA 2QORA 1GOTA 1NNEA 5FUYA 1XMIA 1OPXA 3K9GA 3PUYA 4FWIB 5P21A 5F98A 3WY9A 3G71B 1FNMA 2A3RA 3FOZA 1L4YA 4KFUA 4DSTA 2JCSA 1QUEA 3B5JA 1KJYA 1KSHA 4XOIA 2Z4RA 1YITB 3AVQA 3L0PA 1JR3A 4CEJA 4DCTA 5KNCA 1UEIA 3QF4B 1OHHD 5BYKA 2XXAA 1FDRA 2IXFA 1ZD8A 3ZLJA 1EP2B 4Q66C 2ZRLA 2YV5A 1JR6A 4ZIRA 1QFYA 3A1TA 4NYIQ 4A6PA 5EE9A 2AD5A 5FTJA 3W2FA 3NHAA 2X2FA 4W9MC 3FHCB 3WBJA 3A1WA 2JGNA 4FCTA 3QKTA 4KV9A 1QHHA 1CR2A 4KFSA 5KSPA 2YC2C 3QENA 2EQBA 4BZQA 4EDHA 4M9SA 3RHFA 1ONBA 2A5JA 3ZBTA 4CYMA 3E2IA 1IBRA 2BKEA 2R6FA 2QP3A 5JS8A 5JJIA 3RSOA 3RWMB 3I72A 1NL3A 2CEAA 5BN4A 4G5RA 4CEIA 1HTWA 1DADA 1WQ1R 2J7PA 2NTYC 2X19A 4M1WA 4X8LA 5UKDA 2DFKB 4IDNA 3EZ7A 5KTYA 1M7BA 2QAJA 2YKGA 4CEHB 2O8EA 1HT2E 1SHZA 5JZVA 2ZR9A 1N6NA 3LLUA 3O8CA 1NRJB 2JJ8A 2QPOA 1IJFA 4JL6A 1IQPA 3FKSA 3QQ5A 3TE6A 3A36A 3PITA 4XSGA 3BBPA 3OEEA 4PHGA 4BE7B 1QG0A 1NSFA 2AHOA 2WWXA 1VHLA 4B6FA 1NIJA 2P3SA 1CNEA 2DWPA 2GAAA 2RGNA 5C4GB 4D81A 4WIAA 1YJWB 1VECA 1ZD9A 2Q3HA 4LPKA 2RB4A 8OHMA 3D6TB 3VHLB 1AM4D 2QSYA 1S4QA 2F6RA 5DSZA 1NY5A 4R7ZA 3U4QB 3OJXA 1W0JD 2OT3B 4OHVA 1QG4A 4P6VF 2PIAA 1VCOA 1A1VA 2JLWA 2NIPA 5EZ5A 4QBFA 4LGMA 2A7QA 1XWIA 2GRJA 2ZYWX 3R7WB 1IY0A 2HYDA 4W5JA 4Q5IA 2V6JA 1KMHA 4JSTA 3TVTA 4NONA 4OQFA 1FQJA 3Q9LA 3TVDA 4A0GA 1SVKA 3UIEA 2ZE7A 2D3WA 4EH1A 2J3EA 4GMDA 3VO2A 3QFSA 1FRQA 1TEXA 5CLLA 4Q4JB 5HCIA 1QRAA 2IS4A 3QKSA 1G7RA 1LS1A 3OAAD 3S1AA 4JKIA 5C46F 1W36D 2ATXA 3W5VA 1DAKA 3Q85A 2TMKA 1AK2A 4Q4HA 1E79D 3LBIA 1VHTA 5FI0B 3SEAA 3K0EA 3WHKA 2DHRA 5JHHB 3I5YA 3M6AA 3C16C 3DM9B 2ZR0A 3DZDA 3BK7A 1FZQA 2GDJA 2RGNC 2O8BA 4C43A 3HP1A 4NP6A 3RRZA 2AWOA 3Q5EA 3QPUA 2BC9A 4JJKA 4PTLA 1GRNA 5C2JB 2JA1A 2DYKA 4BFTA 1Q1EA 2WOJA 3IBYA 4DDVA 3TK1A 3SZRA 3WYAA 1G4AE 1N2CE 2G1KA 1VMAA 3VX3A 1XD2B 2GEUA 2QTVB 4AYXA 1MRNA 1Z07A 1Z0DA 2ZEJA 3AH8A 2CE7A 2AN9A 1P2VA 2Z0MA 2NOAA 4ZDIA 1EX7A 4LYJA 2PX3A 4LHWA 1N5IA 5JEEA 1G8HA 2HMAA 3C7KA 2OCYC 1W35A 2WVJA 2ZRMA 3T1OA 4M1KA 4O3MA 4KI0A 4HSEA 1ZAKA 4XWAA 3W5IA 1E98A 2WJGA 2OG2A 5D3MB 5HKKA 2OSBA 3MFYA 4FWTA 5KU1A 1OH8A 2EFCB 1SVMA 3OESA 2ANCA 4BZPA 2V3CC 4Y7CA 1Q86D 3D8BA 1CR0A 4Q21A 3G5UA 2VEDA 3NEJA 4HLQB 3DMDA 2N46A 1E0AA 1J7KA 1W1WA 5EE5B 3BD9A 2ORWA 2RGCA 2J0QA 1KDTA 3NEYA 5J4YA 3EZ2A 5TARA 5EZ6B 2DR3A 4YMVA 2ASEA 121PA 4URYR 3IQWA 4PANA 1G19A 1IOZA 1GITA 4IVPA 1H65A 4CT4B 1RKBA 2DBYA 1ODFA 4ZDJA 1XPRA 1UM8A 2FH5B 2RGDA 3B85A 2QY9A 4HB0A 4TQUS 3PEYA 4O2LA 4Z8YA 4BLRA 4C0QC 3WXMA 5EE0A 4BEJA 3SQXA 4E09A 1OF1A 3W2HA 1DE0A 4TTQA 1IXRC 1ZD1A 3GLHE 2PH1A 5F9HA 2FV8A 3MGCA 4MRNA 4CW7A 1CIPA 3GJ3A 3P20A 3CCLB 4BPBA 4QJ5A 4HUQB 1ZU4A 3LW8A 2IXGA 3EXAA 1JA0A 2GEDA 1R0ZA 1KI8A 3KDSE 1SGWA 2HT6A 4IFEA 1VQOB 1CEEA 2W0MA 1GTVA 4Y9UA 3IEVA 1E4YA 3W6OA 3BJIC 3MWYW 3BB4A 3EC1A 3FJOA 2CDNA 3T12A 1CJKC 1P6XA 2V8OA 3FYHA 2P2LA 1FW6A 3X1XA 4DQLA 1KSFX 3QVUA 1UKZA 2Q21A 1UBGA 3QVVA 1RRCA 2WIBA 3LDAA 1I4DD 1WBBA 1JXMA 2FPKA 3BXZA 4EJSA 1OW3B 4IVRA 2FPMA 3X1WA 1QFJA 1OSNA 2GJ8A 5JSZA 3SS8A 1D1NA 3ZVMA 2BPOA 4QG7A 2CMKA 2ZI5A 3NKVA 1G4UR 1W46A 1Q1ZA 4LJ9A 4F93B 2IS2A 1G41A 1GM5A 3TR0A 4G5OA 4LBYA 3VR5A 3U7GA 4Q7LA 1FNBA 2XXAB 4BLTA 1YZTA 2GCPA 2CL7X 2PMKA 4OK5A 2VTKA 4PZZA 1SM4A 1T9HA 2PX0A 3T34A 5J4LA 2VSXA 1JAIA 3U3MA 2C2HA 2OXRA 2ZUCA 1YZNA 2C03A 1X8KA 4AG6A 1SZPA 5IK2D 1EWYA 1QHHB 4D4JA 1AA9A 3TAHA 1W87A 3AP2A 2GCOA 1GIAA 4IOJA 1U8AA 2AL7A 2VHTA 1ZC3A 5DH9A 2LWIA 4PZLA 3RWOA 3LQQA 1CJVC 2R65A 5FUXA 4V0NA 1IY1A 3H84A 2VLIA 4AKGA 5B64A 4LV5B 3Q72A 4CF7A 5J4HA 3HPRA 4HE6A 2MSCB 4PX9A 2NO0A 4Q4AA 3GFPA 4U7DA 4C2UA 2YOHA 5JWRA 1WRBA 2O8EB 4PHHA 1KOFA 3FMOB 4TMZA 4F91B 3HDTA 2D06A 5HZKA 4C3ZA 4XVRA 4HDOB 2JJ1A 5EXSA 2FN4A 3U7HB 2QDXA 3CF2A 4Q02A 4TSFD 4FK8A 1NJGA 1ZJ6A 5FH9A 5KSOA 4EJSC 2PJRA 4DKXA 4Q7JB 1BX1A 2ZPTX 4G1BA 3AF2A 2J0SA 4PO8A 2BV3A 1H8HA 2OAP1 2WOOA 4JVMA 1GDDA 2QMOA 4CIDA 4TMWA 5AR1A 2ZR7A 4V02A 3TQCA 4FMDB 1IN6A 1W47A 1TNDA 1UMKA 4FCWA 1KI4A 4NYJR 3SOPA 4M9QA 3FB4A 3FPKA 2J7KA 5DHAA 3CH5A 4FIDA 1UJ2A 4ZKEA 2J41A 2IYUA 2W58A 1SVLA 1M2OB 1CJTC 1E9AA 3C15C 5LB2A 1QHIA 1XE1A 1JJ7A 2CJWA 1NF3A 1OFTA 2FA9A 3B9PA 3GLHA 4R2HA 4UXHA 2OM2A 1CBUA 1WA5A 3LRPA 1E2FA 5DHFA 4B2PA 1ZM9A 4BFZA 1IJEA 3I55B 4JLNA 5FUWA 4CVNA 3HJNA 3ADKA 4GNKA 2VZLA 3CM0A 1VQ9B 4OYHA 1AMOA 1KI3A 2G9NA 3THXA 3TR5A 2QM7A 4DCNA 4Q19A 4MRPA 3W8NA 2QENA 1IHUA 2OTJB 2DPXA 1ZM7A 1QGAA 5JWHA 1YZGA 2ZE6A 3UATA 4B76A 1NG9A 4CDGA 5L3QB 3LO5A 4RVCA 1ZCAA 4JVNA 3ND9A 4TL8A 5GADl 4B6EA 1KO1A 4ERNA 4PQYA 3R9WA 4ILEA 5TMPA 4L5BA 5J4VA 3AP3A 4B48A 1VQKB 2ONJA 3Q8XB 3K1JA 1E9EA 4TYPA 3ADBA 4XSHA 1MO4A 3BS4A 3RS0A 2ZRHA 2FFAA 4BLPA 4K46A 2BCJQ 4PQRA 2QN6A 4JL5A 4Z1MA 4Y0VA 5TV2A 3CCMB 4YONB 1XMVA 2OXCA 1JPNA 2FOLA 4MKFA 3W2GA 4BLQA 2O8BB 4TQAA 2P67A 2ZREA 3A1UA 3TRFA 2V7QA 4QHSA 2OBNA 3PUWA 1F60A 4DSOA 2QBYA 5IDVA 5K8TA 2OEPA 4QJ4A 1FFHA 2HUPA 2R62A 3ECCA 1JR3D 1FTSA 1M1KD 3R9IA 1I4LD 2IF2A 2K5UA 4TL7A 1G3IA 1IN7A 2XZOA 3B7GA 1Z63A 1G5PA 4G0NA 2GWHA 5KO2A 1GZSA 2ZSEA 1QH0A 1GL9B 3CR8A 1ZYUA 1E1QD 1TEVA 3UWOA 2NO7A 2RMKA 4TWZA 1Z06A 3W6PA 1U0JA 1DEKA 1TX4B 2CCKA 3EX7C 1P61B 2F3TA 4JLBA 3KTAA 3G0HA 1GAQA 1XPOA 2W2XA 5FL7A 2JIZA 4TQ9A 2C98A 3NDPA 4AG5A 3QF4A 2I4IA 3FFBA 4XTRA 2QP4A 1DAGA 3GEIA 4Q00A 3NXSA 521PA 1HH4A 2CRVA 1VTKA 4C0LA 4NKRA 1G6OA 1KKLA 2JAQA 1LV7A 3LNCA 1VQ8B 1Q22A 3TUZC 2J7PD 4A0FA 5FR2A 5EP2A 1A5TA 1MV5A 4RZ2A 3TSOA 3H0KA 3UK6A 3H1TA 1J8YF 2OHFA 5FOWA 2ZRIA 1XEWX 1E2KA 1AN0A 2OLKA 3T06B 2QG6A 1F3OA 3FKSD 3SHFA 2OFXA 3GLFA 3RS3A 2IT1A 3OEED 1SHKA 3QG5A 3TMKA 3E70C 3CF6R 4B3BA 2WKQA 2ZS9A 2R2AA 5FBVB 1UAAA 2V6IA 4HAUA 3KZ1E 2H5EA 4JBWA 1G64A 5H5JA 2QGNA 4NMMA 4Z8XA 5FTKA 3CR7A 1KI1A 4WW0A 4LJAA 3ZD6A 1HQCA 4LV6A 3SFVA 2IYTA 4UNSA 4UJ5A 4URWR 4M2LA 1AIPA 2YWHA 4MH0R 2BGJA 3B1WA 3BE4A 1R0YA 4FW9A 5F9FA 2RGAA 1W48A 3AGPA 5KOYA 3SNHA 1ZM4A 1ZINA 2BSAA 2PMDA 3PXGA 3MD0A 1E63A 1FMLA 1GAJA 4KVGA 1V43A 4WVFA 2ATVA 1UBEA 4DXAA 3GEEA 4PC7A 3RS4A 5B2ZA 3NDBB 1Q3HA 2ZI4A 3WBKA 3U3RA 2ZUBA 1KIMA 3ZYCA 4UNRA 1Z0IA 1WXQA 5E4FA 4KFRA 3SYNA 2WZQA 1FNDA 3LV8A 1E2NA 4OK6A 5FTMA 3U4QA 4A15A 4YMSA 3TH5A 3AM1A 1U0LA 4UNNA 4F92B 1BX0A 2IYRA 3SDZA 4R71A 5EE3A 4DT1A 4A82A 3R7WA 3SJZA 3M0EA 3E1SA 3OIYA 4WXRA 2WAXA 2GESA 1U8ZA 4EJSB 3GJXC 1QVRA 4MITA 2ZYVX 2GHIA 3P1JA 3QXHA 5KHOC 2UVQA 2FFHA 3FE2A 3I8SA 4MKIA 2VP5A 1S3SA 3DPUA 4RZUA 4U9UA 1R7RA 2YNMA 4KVAA 4PZYA 1KAOA 1QF9A 4KLNA 4Q4JA 4AKEA 2H8KA 4LHZA 5CYOA 3OZWA 1EG7A 5EJEA 1IN8A 3I1FA 4Q48A 4Q9KA 2OV2A 3L82B 3NC0C 3PENA 4JS0A 4D80A 2CBZA 1IXSB 1AKYA 2P6UA 2VP6A 1K8RA 1G20E 4HDCA 1M8PA 2ODEA 4DEYA 2ZXUA 4MYHA 1AZSC 1ETUA 4H1VA 4PSKA 3FTQA 1D9ZA 4HB3A 5B58C 5FOXA 4TT3D 4I1VA 3QPWA 2AK3A 3IHWA 1PZNA 4B3XA 1Y63A 1JR3E 5FOTA 3I92A 2XB4A 2EU8A 2ZJYA 3EPHA 2ZRAA 1Z28A 2GK6A 1NLYA 3C5CA 4LX0A 1XEFA 2UZ3A 1KHTA 2WV9A 2ZRPA 4DRZA 3R9XA 2G3YA 1GKYA 5HXBA 1Z08A 4P4TA 3PJRA 3QFTA 1R6BX 3U6KA 2JATA 5HKKD 2IC5A 4M53A 3U61B 4LDJA 2D2EA 2X8AA 4YAWA 3IIMA 1OGJA 2DFNA 4DLTA 3PR1A 5JBQA 4BFXA 4BRUA 1Q7YD 4NU0A 3K0CC 2N42A 2J45A 4OQXA 1JB1A 2PT5A 3EPLA 1KNQA 1NVVQ 5J4KA 1ZRHA 1W2BB 2Q9CA 3JQRA 1OYWA 1WE2A 2ERYA 2WIAA 1RRGA 1EFHA 4IEIA 2XJ9A 4G5QA 1JALA 3CCVB 4MYUA 4R9UC 1MO6A 4BASA 3SI7A 4GP7A 2REXB 1ESMA 5E7JA 4AYTA 4ITRC 2CJWB 4LYAA 1W5TA 2F1HA 3MRSA 3QFRA 3TBKA 1QHNA 2GVDC 221PA 2VYFA 1OV4A 1VYVA 3THXB 4MA4A 3OIUA 2YWGA 3LW7A 4Q1BA 4II7A 1W0KA 2ZI9A 5KDDA 3P26A 1XJQA 3BH7A 4N3GA 1NP6A 4B71A 2O8CB 3DM5A 4NH0A 1GFIA 2F43A 4B3GA 2GZHA 3KQKA 4PAQA 3BB1A 4HLDA 3IGFA 1OH5A 1ZUIA 2P6NA 4EPXA 4D2IA 2IYVA 3MLEA 1MT0A 1Z6XA 4M9ZA 2WWYA 4YDHB 2RHDA 2HEIA 4P4SB 5JJLA 3OZVA 2ZRCA 3N5CA 1DAEA 5CM8B 1GR1A 421PA 1E96A 1P2UA 2FZ4A 4A0RA 4D25A 5LPNA 2KBFA 3GJ6A 4HUQA 3VMFA 1T6NA 5AJVB 4B3FX 1MABA 2W2TA 2VSOA 3ASYA 4BPRA 4UJ3A 1OE0A 3CRQA 2VIIA 5GJVC 3CBQA 2D7CA 2NPFA 2ZIAA 1QUFA 3QFCA 4DLUA 1CTQA 4PAMA 1AQUA 1HQYE 3RAPR 3KQHA 3B6EA 2NMVA 5JHGB 4GRAA 3CF0A 4E03A 1P9RA 2GETA 1G3RA 4JLDA 5BWMA 5EE1A 3PUXA 1E2JA 2B92A 2IYSA 1B23P 1X1RA 3CRMA 2FSGA 3FWYA 1UADA 3AUYA 1AS0A 4PPQA 4GPTA 2X1VA 2ZETA 1DARA 1FL9A 1QBKC 4B34A 4NYJQ 2A9KA 2MSDB 2WBLC 3KTAB 4UXIA 5G53C 1IN4A 4MKGA 4QM6A 1QX4A 1N6IA 1XTRA 4OK3A 4TMKA 3I62A 3VU9A 4I81A 3UPUA 3O8DA 3CX6A 2ZS8A 3T15A 1AJEA 3NBFA 4D26A 4PAOA 4ZDKA 1KMQA 1M6NA 4PPGA 2PEYA 1U0HC 4K1XA 5AJWA 5EXPA 4M4SA 1E1QA 1F6BA 3RABA 1T4GA 1JAHA 1COWA 3W34A 3QPVA 4M1YA 3THWB 4GOKA 1EXMA 1G7CA 1NMYA 1UF9A 3OE7A 2VL7A 1ZVQA 4G5SA 2IYWA 4OI2A 1TMKA 2FEOA 2JJ1D 4Q03A 1CU1A 3LX5A 3U3OA 3GLFB 3CPHA 3QG1A 3PEVA 2CNDA 2Z43A 4GZLA 5DIFA 1E64A 3SBEA 3A1VA 3CZPA 1IN5A 2IYZA 3CC2B 3U3JA 3ZH9B 2ZJ5A 3RLFA 4CT5A 2IYLD 2VP4A 4AC9A 2GKSA 3RRMA 2ZJOA 1H8HD 5KSYA 1HEIA 2W83A 1G5TA 4XD7A 1PUIA 4H9GA 1XEXB 2QEXB 1FRNA 1ZW6A 4QNRA 5H1YA 3WRYC 1EGAA 4OQLA 4DVGA 4F4JA 2O8FA 1G3UA 2ODNA 2OBLA 1TL7C 1NVUQ 2H18A 2XEXA 1KGDA 5AUNB 4O0MA 1US8B 1NN1A 2YINC 1XTIA 1MOZA 4WA7A 4L8GA 2VP0A 1Z29A 3U7FB 2QTZA 3BFKA 4D4KA 3K8YA 2WTUA 2IL1A 2IHBA 3VNUA 2HCJB 4HZUA 1G21E 2FNAA 2D4HA 4D6PA 1RW4A 2XAUA 4MYTA 5SZJA 2PCJA 1CJUC 2Z6VA 4IOKA 4M1MA 2VHCA 2O0JA 4FCVA 1T8UA 4URVR 2C8VA 1P7CA 5E7IA 5EQTA 2H57A 2VPPA 4DT1B 3Q5DA 3H86A 2ZJ2A 3CPJB 3WNBA 1ZNZA 5FFMA 4GOJA 5HTKA 1OFIA 3ZS8A 1GSIA 4URUR 1TF2A 2G6BA 4IXNA 2GXQA 2AKAB 5IRCD 1BKDR 4ZCIA
chains in the Genus database with same CATH superfamily
4XH9B 1JHVA 1CLUA 4M76B 2MR5A 5AK4A 3EWIA 3H1FA 5L3QA 2YYAA 2FWRA 4ECEA 1TZKA 4PAAA 1BQ3A 3BB3A 1RE1A 1OX4B 5KOHB 3S5JA 2A9JA 4EFLA 3ZDEA 4DGSA 3ETHA 4H1WA 3NAMA 4TKZA 3JZAA 3EAFA 4EZIA 4ENRA 3DMPA 4WK4B 1GYQA 3EOAI 4NXMB 1N6OA 2FDRA 2JEOA 2V7QD 1G42A 3FZQA 4IICA 3K9BA 3NWPA 5IS2A 5IASA 1QZZA 3L7DA 3MAAC 4XVHA 3V7UA 1T9DA 3OMXA 3BCUA 1JI0A 4KGXA 3D8UA 5IUNC 2P68A 5G0SA 1NOJA 2J32A 3MK31 5IPFA 1VLZA 2W6JA 1FTNA 1ZN7A 3QYJA 2M6KA 1KD1D 1Z16A 1L6IA 1L2TA 1THTA 2H4XA 1UPTA 4IQ4A 1GUAA 1RC1A 2C88A 1NQAO 2WWFA 3K6RA 4RS3A 3TKLA 1AV6A 3EIXA 2QPLA 3KJIA 3OLQA 1R4AA 3UJ7A 4DS3A 2Q6LA 1SOVA 4FMBB 2A94A 2P7HA 1NDHA 4FYMA 4KQEA 1Y8RA 3JRNA 4QUBA 2Q46A 3PK0A 1F2UA 3PZBA 1N1DA 1Z5UA 2X0JA 1K8ZB 1O5IA 3RU9A 3CLHA 3BX1A 1ZMRA 4YHHB 4LDNA 4CR8A 5KUTA 1UXOA 4AAYA 4NEQA 4BFLA 4MVJF 3ICVA 2RE8A 4ZCQA 4OGKA 1VLOA 1MXHA 3L07A 2GMWA 1X7HA 4BVHA 4YV1A 1GNQA 1L8QA 1Q1NA 1T5SA 2H63A 3TFOA 5A5GA 2OO7A 3WIUA 5ALFA 4X0CA 2C1EA 3I1JA 5CIWA 5K0TA 4FI3C 4BTVA 1Q7EA 4NICA 2Q2VA 3CJTA 1GPWB 3ZV3A 3AUKA 3IUBA 5AUPB 3WHLA 1MVLA 5SZIA 3GLIA 1DC4A 2RH5A 3HPQA 3OMLA 3AY3A 4NZNA 2JF0A 2QDKA 2GJSA 4GOND 5AH0A 2DFLA 3QEOA 4MICA 4WBNB 1UD2A 2H7XA 2HK6A 2XMZA 4RYLA 4BN4A 3ZDQA 2XQIA 2QRJA 3GA7A 3CONA 3K7EA 3VYTB 4X7FA 2C0QA 3EGOA 3ABZA 3HA5A 3KJXA 3GFFA 5MGNA 3P0RA 5TS2A 2O7NA 2ZT7A 3W9BA 2ZIVB 4B17A 5AVXA 4D41A 1TQDA 1Q7CA 2EIHA 3ELDA 2WWGA 3H3FA 5TX7A 1VYUA 3WGIA 4E2WA 4QEDA 1PAUA 4HEHA 3WLFA 2PJZA 3AJAA 1FX0B 4BAGA 1AK9A 2CLEB 4KWEA 1N8RD 2DBRA 1JDUA 1IQ0A 4PZDA 3UOWA 2BVNA 3WSTA 1JV2B 4YCBA 2C20A 1FP6A 2WD7B 2V7VA 4KZPA 1M90D 2IPNA 3D4IA 1EFDN 4FOSA 1Y8QB 4GBGA 3WFZA 1C2YA 3FLMA 4HQ6A 4MQFA 4FYJA 3P0FA 4QRIA 4YRDA 2EZTA 2R8XA 5T4HA 3PEFA 1UQRA 4AN1A 4D99A 5EUBA 1Z6YA 5KYXB 2BP7A 4JCCA 4KNYA 3BKXA 2Y05A 3EVBA 1G21A 3KUUA 4N82A 1YZKA 4U8GA 4CJXA 2GSWA 3F7NA 3L8GA 4KAJA 1U8TA 4R3UC 2IYEA 1NW3A 1Z13A 1TJPB 1ZBQA 3FYUA 4REMA 2B4TO 4DCUA 5DB4A 2L69A 3D8RA 4OHZA 5FPTA 5HF6A 4BO0A 3IAM6 3EVZA 1IHMA 5DGXA 1XZJA 1MDBA 1R16A 3DUWA 2VF2A 5AVQA 2WTXA 4X1KA 1JDNA 3H4VA 1FU4A 3KG2A 3V9AA 4E6PA 5GJBA 3GRZA 1KAHA 3ZBUA 4WEQA 3OZUA 2A1TR 1XP8A 2BEVB 4KU4A 4MPTA 3NBUA 1VRWA 2CVQA 3GT0A 2ZTHA 1J9GA 4RPJA 4X7DA 4UHFA 2IBMA 4FR0A 1Z73A 2IY9A 5AWFC 1P2GA 4IHQA 2O8NA 1IMJA 1PZFA 1WMEA 3W5SA 1X3SA 1IQUA 1U3VA 1VL6A 1K8YB 2WJYA 3JZMA 3OOJA 4IOLA 1RTKA 1N3LA 1XN1A 2H4HA 3BRWA 1K7XB 2Z2XA 5JU6A 4C7VA 1ZC4A 5CT6A 2BMDA 4O4LA 4NU8X 3ADPA 1QO0D 3H65A 1WORA 1VQMB 1Y4SA 4RKWA 3A27A 2Y1LA 4CM8A 1G59A 2PG3A 2YZ7A 3QTBA 5F51A 3W4JA 1VDZA 4LC0A 1NN0A 2FWMX 2A5FA 2V03A 3GEDA 1NXXA 4QOEA 1KK0A 1DBIA 4CKBA 2ZAMA 3KPVA 4R3WA 2W6CX 3CO5A 5D87A 1SB9A 3VU9B 4C3UA 1P5JA 2Q4TA 3ECAA 4G0UA 3OHSX 4IX1A 4EEXA 1PG5A 1YB2A 3RAEC 4LHEA 4BEWA 2P6MA 1B43A 1UC5B 3ZS9A 1TTTA 1ACJA 1FRFS 3B1ZA 3EF1A 1W4CA 4YUZA 2QVCA 3TCXB 4RNCA 4BV2A 2IUFA 3OE5A 4UCXA 5DO9A 2DB3A 3HWSA 2DERA 1MEOA 2E37A 3DE7X 2H3HA 4PHFA 5FTNA 3WMEA 5A4AA 4QPNA 2VUUA 4C05A 3BTVA 2HLNA 2FVXA 5IKEA 3D7SA 2Y3IA 3BRCA 1XU7A 3A2KA 2EW1A 5CFLA 4O25A 1AGRA 1X80A 5A71A 3Q15C 1DG3A 4UDYX 4LDAA 4EP1A 4QRHA 3GCWA 3GY0A 1EWVA 4HMQA 2IH4A 4DZZA 4CU5A 3FGNA 1MAUA 3D3EA 4PZCA 3Q10A 1FXSA 2ZRKA 1UD8A 5LC1A 1O94C 3T99A 4IKEA 4AZWA 2C04A 4ZANA 5IVHA 3DZGA 2D2VA 4YHBA 5A4KA 1PFWA 1Y6JA 3JZDA 2O8FB 5HUQA 4P8RA 2NSYA 3I83A 2IUUA 3VOBA 3ZOZA 2AG1A 1IY9A 3FOBA 1UK6A 1VHQA 1ZJJA 4L0DA 1TEZA 3O2JA 3AP1A 3GLFE 4RETA 1VLMA 2L17A 2SNIE 3HACA 3NWOA 5F64A 5EJ8A 1NVDA 1QV7A 3WMFA 3GQBA 1QG2A 4V3BA 1FEZA 2BZ0A 3FPBA 4Q16A 3ZCSA 4FLFA 1W0KD 1E9BA 4CFSA 4EA8A 2XZPA 1DFIA 4M54A 4MAAA 4A8TA 3H2YA 5IFLA 1IMOA 4DKJA 1KZ1A 2BM9A 2Y6VA 3VKWA 4CCSA 2BFPA 5EJ7A 1DC7A 2VH5R 5M2QA 2RHGB 3IIKA 2DTXA 4RZQA 3LQ2A 1GPKA 5CYGA 5EIEA 4RMNA 2YIVX 2LV8A 5G4KB 5E6TA 1EP9A 4GC5A 5B37A 5K01A 1K5PA 5CR9A 1SUAA 1D8TA 1YE3A 1E60A 1II9A 4E21A 1IY8A 1E9VA 1LXCA 3HBNA 1G55A 1YK0A 4UU8A 1AKEA 1X9GA 2ZWOA 2Y71A 2OGZA 5CG2A 5CH5A 1QOQB 1EWQA 2BI7A 4I99A 3CUWA 4FJ2A 5E1BA 5G2OA 3GRUA 4ZC1A 4C5AA 4DRXB 1NXVA 4R81A 3MJEA 4PZAA 4QATA 4HVAA 5WRFA 2ZI3A 3DYIA 1SJ9A 4J9VA 4Y2SA 4IP0A 1OB2A 3BFPA 1UBSB 3S2ZA 4F5EA 1NV9A 4U5XA 1Q95A 3VC3A 3U3KA 4OFWA 3UAVA 4X63A 1FB5A 2YASA 2QJRA 1KSJA 4FOTA 2JL1A 4R3NA 7YASA 3HK2A 2YOFA 3B82A 5IZCA 3VV2A 2EATA 1B74A 3AFHA 4KR9A 1KZGB 1GPH1 1MC4A 2HY7A 1Y5MA 3CPSA 3GEMA 3JZFA 3OOSA 3PCRB 4XFJA 4AMVA 4UE3S 3F6PA 1Q16A 3JQCA 3NV7A 5EAIA 5BMVB 4NH4A 2QD4A 4PSUA 5DBHX 1XBTA 5FAXA 1R5BA 3EDYA 3OZEA 3EQ7A 2WB4A 1Z5PA 1Z4NA 4U4AA 4X20B 1ZH0A 2C99A 2NQ2C 8AT1A 1XZDA 4CLEA 3R6WA 1P4AA 1GQSA 5JYBA 1I3CA 5GP1A 1T9AA 2A88A 5DZSA 3RTAA 4ALIA 4D3YA 1F2UB 4IQGA 2NP7A 1P7PA 1HURA 3JQFA 1T4MA 3M9WA 3WMWA 2JZCA 1HT1E 1ZK3A 2W37A 4UVDA 1IZ8A 1FUKA 1I0LA 2ZVDA 4R5HA 3RDPA 5B6PA 3ZDXB 3HJFA 4QC2A 5EHZA 1F7VA 1JHZA 3CB4A 2CGEA 4X7CA 3UB4A 3DL0A 3SSNA 3IKTA 1YBFA 1XKLA 2YYSA 5A0FA 2Q3EA 1CZOA 2BI8A 2GZ1A 3A6GA 2F3RA 2YV1A 3D43A 3QWAA 1Z6GA 4L0QA 4QSMA 5SZKB 5LNK1 3GLIB 3BIFA 3L6OO 3MMZA 3RU3A 3VVBA 2GA9A 3USCS 3FXAA 1PFQA 5A4MS 1ZQ1A 2J3HA 4LECA 4LI3X 4LXGA 2E87A 5LYYA 5CB4A 1U1FA 3CCRB 5I4BA 4AF8A 2I4TA 4ENSA 1HR0B 2YWFA 2ONZA 2HRBA 3ERCA 4QHYA 3RS7A 2WJ4A 4JBYA 1YHZA 1VPWA 4BO8A 4FBGA 3PHIA 5FTLA 1T8SA 1PL8A 2RHLA 4RADA 4M1QA 3LY5A 1PJ4A 1EG2A 3R3HA 4D9HA 1M5UA 1JDVA 4MP3A 1KJWA 4F3TA 2O8DA 1MAHA 1KI2A 3ITEA 3C6ZA 4Z4WA 1CFZA 2OY0A 1XMSA 2H0AA 2WVAA 2R6HA 4ND5A 3TTTA 1PO7A 3NWJA 1P5RA 2FAXA 4JWTA 1EFRA 1HXHA 1ML4A 3N05A 1WLSA 4TYWA 3H2JA 3TLKA 1U0OC 3NJ8A 2X3UA 3X1JA 1UODA 5JOQA 5ANRB 1VQ7B 2G4CA 4DG9A 1CULC 4LRXA 3BXFA 3FWKA 5C80A 3NHBA 1AH2A 4UMEA 3ZGVA 5LQSA 5D7NA 1P77A 4ITVA 1UBHS 2WJVA 1FS5A 2Y4OA 4XLHA 1HDOA 1LS6A 1E69A 2HZBA 2ODTX 3DHVA 2JLYA 4LBZA 2GUGA 1TGYA 1Y1PA 3IDSA 3K31A 2YXPX 1GSHA 1XXHB 1GV0A 1FQKA 2AOXA 3DMGA 3O95A 3TW4A 3HR8A 1MD9A 5AXBA 4LXTA 2DHCA 4WXEA 4LOAA 1T5EA 1T0UA 3LVBA 4ZRNA 1TU4A 4UHJA 4E0FA 1NJID 1LSSA 2BTOA 4EUNA 3H4TA 1JNYA 2VUHB 1V5VA 4KR7A 3IO3A 2W6PA 4GI7A 2CL6X 1UINA 3C3EA 3LQ4A 2OFFA 5L4LA 4ISBA 4S1NA 3CVYA 3PUNA 3B9QA 1SK9A 3O0TA 4O5OA 4UUAA 2BBOA 5A88A 3AVOA 1OV6A 4HHEA 5HK9A 3HKCB 2XNDA 2A59A 1P0CA 1VGQA 2CJXA 2CZCA 2GK4A 2GM5A 1OTHA 2OXEA 3L8MA 4JJAA 1M1YE 1VIVA 4PO9A 3T1QA 3K0CA 1R50A 3MMXA 4L4ZA 1H0KA 5AYVA 4RABA 1I36A 3GUZA 4L72A 4U3JA 1AOXA 1ZGJA 4WZBE 2BELA 1EDDA 4EG8A 4CKBB 4NZZA 4B80A 1T1IA 2GI4A 2J6IA 4IZHA 4Z86A 2HPVA 5DM4A 1G7SA 1NKSA 2ZI7A 1NBAA 3QIVA 4XIYA 2X4LA 3UH0A 4YUAA 5BSUA 2I34A 3VJLA 4EFDA 3WKBA 3K5HA 4U6NA 4MUHA 4WZ6A 3IR7A 5LZ5A 3MERA 3ZHZA 1GLNA 1FPQA 1R0RE 1RRPA 1SXJA 2OECA 3CNQS 4JUIA 2ZIUB 4Q37A 3QPAA 1RM3A 2XADA 3WK5A 5IYZB 3DZKA 1CIJA 4MA0A 4RVSA 4UVIA 3FHLA 5AHKA 1MAVA 3QPDA 4RLSA 3ZVNA 4ZYLA 3ZGZA 4WGFA 1QPZA 2Q29A 5EMKA 4DY6A 3GPCA 2ZUSA 4UQPA 1MU0A 1RJWA 1P75A 1R88A 4PGOA 3I9NA 3FHJA 4EFMA 1K86A 2AXPA 3I37X 3VNBA 2VDPB 1A9OA 1GPUA 3AU8A 2V1XA 3VYRB 4UZFA 5TPWA 4L28A 4IZIA 3UBTA 1K66A 1NRIA 1U7TA 4KBGA 4LJLA 5D5PA 5DNWA 2JS7A 2CW5A 2V97A 3TKYA 3TNDA 4IRXA 4Z9XA 4QFMA 1CRQA 1I2DA 1U9IA 2FG5A 2G09A 3W2IA 1VCIA 2Y4NA 4FUTA 3H2GA 1SHTX 4N5NA 2REQA 3DL2A 1OILA 2JI4A 2UUPA 2ORIA 3H9BA 4XDHA 1P60A 2FW6A 4KQ9A 2J5KA 5AM2A 4OP3A 3NCHA 4HNAA 4PG6A 2HHHB 1CUSA 4GP6A 1BO6A 4ZI2A 2J30A 2POQX 2QROA 4NCKA 4D5EA 5KOHA 3N2EA 4F3RA 3EZ6A 3GQBB 1Y1QA 2GYYA 4RFVA 1KP9A 4CR6A 2MOKA 1Q21A 4C4ZA 1VHJA 3GLVA 1VOTA 2VJJA 2F62A 4IKPA 1JGTA 4LY6A 2GCGA 1K08A 2WVHA 4MHSA 4WPGA 2P6PA 3LC0A 1BD3A 2VYVD 2WQ6A 2NNLD 1RTTA 2IU3A 3THYB 5BQ3A 3OEHA 3HXOA 2CYAA 3DE6X 1WHSA 4MVJG 3FAKA 3NHFA 4X1IA 2ZZMA 4J7XA 3JX9A 4F9EA 5I7OA 2J6HA 4BE4A 3FMPB 4GLOA 5HR5A 1HC7A 1OFGA 2V9ZA 3NHLA 3KYDA 5EG5A 5ULLA 2CK3D 1OFUX 2BUBA 2QRHA 4HFMA 4NFLA 1NQOA 4ZD6A 3U39A 1AF4A 1EM8A 4IIJB 3TZLA 1BFUA 1T5LA 1Y37A 4IIUA 1KYYA 2HX1A 3FIUA 4P2BA 4RZHA 4Y6PA 1FRVA 2VWHA 3FI0A 3SQWA 1VYHA 5LKAA 4UBLA 2CXXA 3O26A 5JRJA 2C7OA 2G07A 5EMLA 1RKQA 2J87A 3TB6A 5AW0A 4MV5A 2QE7A 4YFYA 1RJ9A 3DP9A 5ALEA 3JQ8B 1GQRA 3ELBA 2XSZD 4QHTA 2ZL5A 2HT1A 1EGMB 2QVYX 3WLNA 4ON9A 2ACVA 3ZTYA 4M1EA 1OH7A 1KS2A 4UW9A 1L6RA 3GDWA 2FJPA 2DY1A 5KJCA 4XIGS 1UJCA 3S44A 3LLMA 1GYRA 4BMXA 4RZ3A 1VRVA 2PX2A 3FUUA 4EEKA 1U6KA 4YAEA 1RZ3A 3WWDA 2IY7A 3BSYA 1GV1A 2C2GA 3HYRA 3VHXA 1W4AA 3VU8A 1Q7RA 3EXG2 5FPPA 1GFZA 2I91A 4A8JA 3T54A 3AV0B 3KQYA 4ZT4A 1YB5A 4LVCA 3PIRA 3CPWB 1B0ZA 4P38A 5CM9C 3MT0A 3WI7A 1VQ6B 1ZGHA 2SHKA 3K4QA 4BFSA 2HBYA 4Y2RA 3ADCA 3SP1A 5JR3A 2WHQA 1JHYA 4TLDA 1EK0A 1J97A 4PRKA 1FMFA 1XZHA 1VFPA 5A3VA 1E2EA 4XA8A 2WF7A 4BIMA 3V80A 1RRKA 5KREA 4ZXPA 4GR5A 1E61A 5SV2A 1DBQA 2RB5A 1KR5A 5THQA 1DUVG 1ELOA 1FNNA 5FBLB 2C0PA 1KMMA 3ETCA 3RYTC 4YC7A 1X8XA 4WK0B 5DISB 2F64A 1P1JA 3R8FA 2D59A 1R8XA 1MHTA 3TFQA 1FZTA 2SKCA 4EJFA 1ZL0A 3KFXA 1DJNA 4TLAA 2BE7A 3PNKA 4CNBA 3JZIA 2O3QA 4QGHA 1CUZA 5AVTA 3EXHC 3RVSA 4QNMA 2R97A 4CF5A 1J90A 4IVQA 2G17A 3I52A 2Q0HA 4KIJA 4EY5A 1E6CA 2PUWA 4B2LA 4RD3A 1PD1A 4EA6A 4MMZB 2NZWA 1DQZA 2ZLBA 1WUHS 3GOQA 1YFKA 4HP8A 2XMRA 3OT5A 2J1LA 2ZAIA 1RRFA 4GWKA 3DQQA 4HXYA 1V3VA 3EG5A 4OJQA 1BG6A 1L5GB 4EITA 4H7DA 4EPWA 2O8DB 3JVDA 2EQ5A 3B13B 3PSHA 1K1EA 2Z2IA 3IERA 1JFTA 2R1ZA 2ADFA 2W2MA 3ENNA 3UG7A 2ESRA 4BMSA 3VSEA 3OWHA 2A58A 3IP8A 3WNCA 4HY3A 1G291 2ROQA 4KKXB 3U81A 4BB6A 1CF4A 1NT4A 3V4FA 3G82C 1SXGA 5EZSA 2W6IA 2X14A 2BSXA 3N2ZB 3JTMA 3T7IA 3BMQB 3GYGA 2Q7XA 3D31A 1G63A 2VAVA 4NOJA 4N0DA 5K6AA 5SYAA 2XQFA 4WUTA 1K9VF 5FOQA 2ZZNA 1J00A 5HF5A 1L7XA 5E8RA 3V8PA 5A03A 5K6TA 1WLYA 1ECFA 2AR9A 2R48A 2PKEA 4MKXA 1HWYA 1W4BA 4C3OB 5BRJA 3D6FA 5D84A 1Q82D 5I4IA 3TEJA 2IZ5A 1TQ2A 1Y1RA 4XIJA 5CITA 1KA9H 3CHYA 1FU7A 2WKWA 1LGYA 4MTLA 2J3LA 1SELA 3CIFA 3QBJA 5KTPA 1FUUA 5TQ0A 4ETIA 4AWAA 4KFTA 1NJSA 3P2YA 3BH0A 3VR1A 3RARA 4R1SA 4Z4RA 1P7WA 4N5HX 3KEMA 4OJKA 1N6PA 1K2WA 4DPKA 4ILKA 2A1UA 3O4FA 3AFIA 2B94A 3OFND 2WWRA 2IWHA 5JPIA 1WP4A 1DP4A 2R7LA 5JATA 5JC1A 1E3ZA 2B5VA 4RESA 3UHJA 1JDZA 1UXKA 2FN3A 1ZPDA 5CDFE 1U1DA 3WL4A 2YVLA 4TQGA 4AKIA 1O0SA 1T2CA 3B3GA 4U3JB 2NT3A 2D1SA 4G0XA 3JQ7A 1PNQA 4DMRA 3BCDA 4S2EA 3I12A 2G83A 3B6IA 3K5IA 4X1YA 2JI6A 3KT3A 5HMMA 5U4QA 3DDNA 4GBMA 7ABPA 3WADA 3AF4A 3F90A 2WICA 4FGJA 5JCPA 2VJQA 3STWA 5IMBA 2LKCA 1JWAB 2QEQA 3CLSC 4IDHA 3J80A 2RC6A 4NSNA 4QV2A 2RD2A 4R98A 1L7VC 3CPEA 1SXJB 4BQQA 5J2TA 4YY3B 1V3TA 4DIBA 1NE2A 4MGYR 1BCRA 4J29A 4TRMA 2IKQA 1P2SA 4DA9A 1P2TA 5FV4A 3V00A 2X0NA 3LF1A 4FFBA 2FMKA 4EUSA 3PQDA 5IHPA 4Z9FA 2X2EA 5C5CA 1KRHA 3SLKA 4WAUA 4COOA 5JWOA 1LTQA 5A4JA 3D5TA 3IILA 3RBAA 4P2NA 2AYZA 1I9CA 1HDGO 3VC1A 2GM3A 5JQGA 1O87A 4ER0A 2M6LA 1RIFA 3DFUA 5HGJA 1J25A 1D09A 1R0KA 3MCVA 2NO6A 1UANA 1XL0A 821PA 2WUDA 3VTKA 3MWKA 2E7ZA 5FWNA 3KLOA 3CV3A 2G67A 3L3BA 1JIXA 4CIAA 1PTKA 1RYZA 2C4VA 3OJLA 5LA6B 4G3XA 2RAVA 1ACMA 2YYYA 5BSXA 4HS4A 3WLQA 3P52A 1L5WA 1R0WA 2B3TA 4HNAB 4Y2YA 1TD1A 3I56B 5LD2B 4KBFA 2ZRJA 4B5LA 5C34B 1AKQA 3B1VA 3ZDAA 3M2TA 4HLCA 1YR6A 2R25B 3LC7O 4MUBA 4NS4A 5EP3A 1H8EA 2D62A 2LDBA 1OYYA 2G8NA 2NO1A 3O8QA 1Q12A 2D74A 2Y1EA 4IRUB 2L82A 3P2OA 4JYBA 4MP6A 4OHPA 5BMOA 5HZMA 1A82A 1G4HA 1NLZA 2IPXA 3EIHA 4X65B 1CSEE 1BA2A 1NGSA 2WD9A 2VZ9A 1X7YB 3FOFC 3FMFA 1OIXA 3CZ5A 3VAAA 2HA5A 3T61A 5CXQA 2NUTA 5C18A 1NBMA 1WHSB 1Z2PX 2IIPA 3GSIA 2WHRA 4HRXA 4RL4A 3NXKA 1YOVB 4X1IB 2I6FA 3NASA 4HWSA 1YQTA 5TQ2A 2AFVA 4DLLA 3L8HA 4ZICA 4BB5A 1X2EA 1HZZC 2FMXA 5JMTA 3KYDB 1TUBA 5FI5A 3VR4A 4ZI5A 13PKA 2MDTA 1QWOA 3MD9A 1U6JA 1YQQA 2JHAA 4TYQA 3DBOB 3RK4A 1PJTA 1WPCA 1P0MA 1QP0A 5ITSA 1RBZA 4LJ7A 4CETA 1EXWA 3I9JA 2Q1TA 5ABPA 1XKXA 1XCPA 1FCJA 1HM5A 1EP3B 3QWFA 4GW3A 3U9LA 5AM1A 4ZPXA 4BVEA 1U28A 4RIGA 1KQNA 4DBLC 4UTOA 4JX9A 4JKOA 4CL8A 3BHIA 5DHQA 5GJWC 4AI6A 4B6RA 3H13A 1GZUA 1EJ6A 3CG4A 4M8KA 4ZQBA 1JLRA 2A84A 2G72A 2JH3A 4V1CA 1RPZA 4D0RA 2XCRB 1XI2A 4MNTA 1YR8A 3PIIA 3DMRA 4TLEA 5JQGF 1MOSA 3OG9A 4LVNA 4WLNA 1FDIA 1KBQA 1OAAA 5CB6A 2ZSAA 1DCKA 3PFHA 3RVJA 4D0LB 4A8JB 1X13A 4E5MA 4LSMA 2PWZA 4KTVE 2X58A 4P0PB 4MZXA 8GPBA 3K0AB 1Z0FA 1CZLA 1SWVA 1QGOA 4LCBA 4ZO6A 3TQSA 2FHPA 2VWGA 1BLIA 4QYXA 3SU8A 3UXYA 5ECDA 3GJQA 5I7UA 4PO1A 3COSA 2D9RA 1VCNA 1I2ZA 3GLUA 1TA0A 4EAAA 1T5HX 4IDGA 2QNIA 3KDAA 4WKBA 3ZI7A 2OP0A 3EZLA 2WEKA 4B84A 2B21A 1T4DA 2QYTA 4HLUA 1UKBA 2G9VA 2P2DA 3EYAA 5CTJA 3WLTA 3IPXA 1NN5A 2PGLA 4DQVA 4HD8A 3SC3A 1GKLA 1U8FO 1YDMA 2FDCA 4L16A 2CUZA 4JGGA 4YBRA 3RVDA 1L7NA 1VIAA 1WTHD 4B40A 3GLGA 4R41A 3J81k 1I7DA 4M0LA 4W1SA 3WK9A 4J4HA 4BMZA 2Y6UA 3PC8C 1V4BA 1U8XX 3KEWA 1EWRA 3E15A 4UD6A 3RFFA 5ADVA 4L8LA 2DIEA 1T10A 4MR8A 5CK4A 2VDQB 3TVYA 4X84A 3FPEA 4FJ0A 1USGA 5DE3A 2GR9A 4JJ8A 4CU2A 4Y18A 4YXFA 5FA6A 4KTTE 2HAEA 2IYXA 2EFHB 3E5HA 1E9RA 3CXCB 1II0A 2X53S 4KITB 2MYNA 2OVBA 1QFXA 3NKLA 1RYNA 1S2OA 3PGA1 1CETA 4XFKA 4CEJB 1AKMA 2XRMA 4C07A 4D4MA 3LCUA 1V25A 3EH2A 3LXMA 4DMUB 1R8SA 1YB4A 3P27A 2NQTA 3CCSB 3MQ2A 3ENZA 3WAGA 5DCLA 3BMOA 3E0XA 4D3XA 3AKYA 2PT9A 3KJEA 5EQFA 4TL9A 1DXOA 2V0CA 5K3CA 4UPEA 3A0RB 5IABA 2PQ2A 1CY8A 1XRJA 5F1PA 4QTYA 1ORTA 3PYLA 1D0IA 3A6JA 1AUQA 1W9XA 3QLUA 1GG9A 2HF9A 3MJRA 3HCNA 3KFVA 4I1RA 1YIAA 2M32A 1ESNA 2HRQA 1GP2A 3OBIA 2MMGA 2YCLA 3V6LA 1Z8DA 2BF4A 4I8XA 1QONA 2HPAA 3KQQA 3EPKA 1XQ9A 2C96A 5C8XA 3UJ8A 3WA6A 2YWEA 1WDMA 5AVOA 4BQRA 1TJ4A 2DFTA 1R4MA 2BGIA 3FPFA 2VDRB 1BSVA 3SHOA 1GNLA 2W8ZA 4W5OA 4CEIB 5CLGA 3AVYA 2D1FA 4DNRB 2E4AA 2WYHA 3E5RA 4K88A 4WBSA 2GBLC 2I71A 2O2IA 2Y9PB 4MUYA 4MWBA 4EX7A 1PJRA 5TQ0B 3N8IA 5BSGA 5JJKA 2NW6A 3VYVA 4M0EA 1EFUA 1A7JA 1MIOA 2DTDA 2EWWA 4Y9RA 4LF6B 2WJJA 3G2OA 4YRSA 3UMMA 3OW2B 4EDFA 3VR6A 4KRXA 3RKUA 4RVDA 3FGZA 1OASA 3EQ6A 5T3YA 2OHOA 4EJ2A 3EEOA 1ZKDA 2FEKA 4R9VA 3T0IA 5LP1A 1NNLA 4QJBA 5CBPA 4PXAA 3NANA 3T1TA 1T2FA 4G0PA 2CT8A 2IU4A 1Z36A 4XJTA 3P7MA 3K09C 4WOBA 4XKWA 3E84A 3OT1B 3ZWBA 4H08A 3CG0A 1FXWA 3AI1A 3TRDA 1QPBA 3RASA 3WRWA 2ZB3A 3JQ7B 3HR7A 3R3UA 2JGDA 4DJEC 3ZNPA 1ZG3A 1MX1A 2I78A 2Z98A 3I2KA 4CHTA 2XA1A 3CNOA 3C5EA 3PQFA 4RPCA 2YH2A 4GM4A 4RZSA 1O8CA 4X1YB 1L1RA 3SZOA 3ZXSA 2PEZA 3G0OA 3SXPA 4DMFA 3T0FA 4IDAA 5B2EA 5AI0A 4L27A 1Z3IX 1VQ5B 2BR3A 4WWHA 3WRXA 4E4TA 2ZVQX 2AXEA 1RQ2A 2EERA 4M38A 1P1FA 4FD3A 2XZLA 5J2TB 3QI7A 3DCIA 2QYOA 1RMQA 2AK2A 1D6JA 2PGDA 4IJKA 3OW7A 1BCRB 1H2ZA 2Y1WA 1EK5A 4Q7KA 1P19A 1VLQA 2ACWA 3NRBA 4LBWA 4LYGA 2FRDC 1TJYA 2O14A 1W0JA 1IOLA 1G8SA 3IAS1 3ISVA 4J0FA 1JXOA 1SUBA 4BWVA 1EFPA 5CNJA 2QJFA 4HRVA 4LK2A 2ZJAA 2PLWA 1CP2A 5EXTA 1T5TA 2WR8A 3Q38A 1DO0A 4MW2A 5DM2A 4JJZA 5DW0A 1IHOA 4PC3A 1JLMA 2B0JA 2XMPA 3QKSB 2IEDA 1C4KA 3GVLA 4G0QA 3RREA 4CCYA 3S1AB 2ZIXA 4BBAA 3KBOA 5JQGB 2FX5A 3ZGOA 2QSUA 3CF4G 4JQOA 1GRQA 1MB0A 2WZCA 4QGAA 5KVSA 2C5SA 3B12A 4R8LA 2AOUA 4K9MA 4KXLA 4X0EA 3RFVA 1VBKA 3DBVO 3DZBA 4B8ZA 4DWVA 5T6MA 2JHFA 1AZLA 2VF8A 3KVRA 4YJ3B 4EVRA 5EPOA 4RD2A 3KQUA 4X3CA 3MHPA 4B45A 4JU8A 4J7AA 4AQDA 3E22A 4KODA 2C84A 3VNSA 1UDWA 1NR7A 3LXXA 2XUKA 3OAAA 4WZZA 1G1AA 1VMIA 3MCAA 4LVOA 2HMUA 1UEJA 2PSJA 3NB0A 5HKAA 4GZMA 5GIOE 1XQ6A 1OB0A 1FFSA 3DBRB 3O8QB 3KKZA 2XD9A 4KIUA 4AUKA 4F7WA 4KDFA 4F60A 5JH7A 2PD4A 1MORA 2IIBA 1KHHA 2I4OA 5F3WB 4XYBA 5KPJA 4H6VA 1P4MA 4PHTA 4RTPA 1ZI9A 4ZOAA 3QJYA 2XH8A 2DY0A 3CRNA 3QY9A 2Z1DA 4ER6A 5LSAA 1JMYA 3IE1A 1M1ZA 1XF9A 1GGEA 2J9FB 2F17A 2VWQA 4NHOA 3UMFA 3AF5A 3VFDA 2WSSA 1NKTA 1WX1A 1WDTA 3M1LA 1KDYA 4BP8A 1TC2A 3GJ0A 5FNZA 3IEIA 4QU5A 4FMDF 1OBCA 1XK6A 2VBFA 3TTXA 4LWPA 1VC2A 3BE8A 5KHLB 1A7AA 2J5XA 4EHBA 4U2DA 4P0QB 1Y8AA 2FW1A 3GJ5A 4F96A 3QYAA 1XDWA 3AUUA 4S2UA 3G0BA 3N3AC 4P1ZA 4XZ3A 2JGAA 3G9TA 3I0MA 2QIPA 3C6BA 4QL3A 2DLCX 2Q5HA 1AGPA 5H3CA 2I2FA 1TI7A 4CI9A 4F5YA 1JDTA 4HJXA 4B3SB 3CCBA 3G8DA 2BFFA 1G6HA 1XZFA 5JSUA 4P1VA 5CHEA 1Z8NA 3JD0A 4HH4A 5GONA 3QNUA 4EO9A 3DO8A 1IHPA 2QAGA 4XJXA 1V11A 5A5EA 1C8BA 2HQOA 4FLMA 5EERA 4V1CB 1JU9A 3DDWA 3A1SA 5BUQA 1YRWA 4XWOA 1N7IA 1W75A 4OHKA 7ADHA 4RHFA 4AS3A 4KJZA 5K45A 1U0EA 2ECQA 3QEKA 3PRHA 5L53A 1FY2A 4X6LA 1P81A 2F3UA 3CLUC 1Q1GA 4ZAGA 2NPOA 5CT9A 4D96A 4PY2A 2BN4A 2IYYA 2TECE 4E2ZA 4KIFA 1RBMA 2UV8A 1YZ3A 3PIDA 3EGXB 4CDRA 3C5HA 1SFRA 3ND7A 4PFSA 1PGNA 2PSHA 2CE2X 1Y5NA 1N0HA 3JD1A 4I3FA 4TTVA 1XFAA 2UAGA 2UUCB 2JCBA 2BEKA 1XYVA 2ZU6A 3BREA 3NH6A 3RIMA 4KEAA 2E2WA 4JA0A 1KXJA 4ND8A 3BMCA 4RQBA 4ZV4A 2NT4A 4X41A 1H2WA 1TZ2A 3FZGA 1F9EA 1VG0B 3K16A 3W9YA 3ESCA 3G2IA 4X61A 1K9MD 5ADUS 1NE7A 3NH9A 4XWWA 2CJFA 5EHQA 1VRCA 2C4HA 2RSLA 2V6MA 1JH9A