4RD2A

Structure of aif2-gamma h97a variant from sulfolobus solfataricus bound to gdpnp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGAEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 108
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd2A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd2A01
4C0HA 1J8YF 4EJSC 2GXSA 4HSEA 2FFBA 2YVUA 2BMFA 5UKDA 3AVYA 2FSIA 3RS5A 1W49A 4OKSA 4RZ2A 3F5FA 1XMIA 1IAQA 2G1KA 1G5RA 3SI7A 3SQWA 1T8UA 1XTKA 5EXSA 4G5RA 4M21A 4JLMA 4NBSA 5EXXA 5BN3A 2EFEB 4HAVA 4L5BA 3LNCA 3DOEA 1LW7A 5FOSA 2ATXA 3U7HB 4LJ5A 3FFBA 2JLVA 1Z0DA 1FQKA 1W5SA 2WIAA 4MYCA 4B33A 4E09A 5JCZA 1WBBA 1WF3A 2NZJA 1CJUC 3OEHD 2WMOB 2Y8EA 4NL4H 3VNVA 3UATA 4DLRA 1K5DA 1G17A 1GRRA 4Q5IA 4U9UA 3EG5A 3BC1A 1JR6A 2ZJ2A 3GLFE 4RKFA 1AA9A 2HYDA 3RS2A 2ODNA 3QQ5A 1TQ2A 5HCIA 2QT0A 2RGNA 1LV7A 4HDCA 1E1RD 4O25A 5FUXA 3UWOA 3JQRA 2V6IA 1AQUA 1XEWY 4HDOB 1XMJA 3OEHA 4OQLA 1DBSA 2IWHA 3WRXC 2IF0A 1DDGA 1MRSA 3P1JA 1IJEA 3EASA 1ZVQA 2BCJQ 4BLTA 4NHOA 5JS8A 1GNPA 1LY1A 1VQMB 1NMXA 2FZLA 1Q44A 2RGDA 5E4FA 4C30A 1RKBA 2WSSD 2D62A 4M8NE 5JEEA 121PA 2RGEA 4W7SA 3VO2A 3T1OA 2XEXA 4V0OA 1GUAA 4AKHA 1E1RA 1TPZA 1T6NA 3GFPA 4RZXA 4TQ9A 4BFTA 4G5SA 3JVUA 5GVSA 3HJNA 5CIWA 4BFYA 3HWSA 1KMQA 3Q3JB 3FMPB 3QG5A 5DE3A 5J40A 1A8PA 2P0EA 3KUDA 1S9HA 2Z6VA 2ZVQX 4GFDA 1D2MA 3VNUA 1RFLA 2NO9A 1XF9A 1DAKA 4KLZA 3A58B 2ZITA 4BPRA 2REOA 4IFEA 3R8FA 3WY9A 1E2DA 3MSXA 1NBMD 1N6OA 2QTVB 3CNLA 1AGPA 3DHWC 4Q4HA 1U2RA 3SHFA 4LJYA 2E9SA 3BB3A 4LYAA 2UZIR 4BFSA 3FKQA 4Q21A 1E62A 5KSWB 1VIYA 1CEEA 2OBLA 1YI2B 1XX6A 3CCQB 4TL8A 1VQ6B 1H65A 3SFVA 2V6JA 1YU9A 3FHOA 4KO8A 4Q1FA 5HE8A 1YJ5A 4LGMA 4TL6A 4NYIR 3AV0B 4QGGA 2AKYA 3NH6A 4TLBA 5DN6D 1JECA 1S1CA 1U81A 3CCUB 3B7GA 4KSCA 4GBMA 5EE1A 3I8SA 4CW7A 4B3XA 2C77A 4YMTA 1EWYA 1OXTA 4TZ0A 5A0FA 2JLRA 5FA6A 2OTLB 4B34A 5CM9C 2YJTD 3KQKA 3KDSE 3KXIA 3Q7PA 2ZSEA 1WMSA 2Q9BA 1Z29A 4AD8A 4DC9A 1SVSA 1IXZA 4R9UC 3QPVA 2ZRJA 1UBEA 1FNBA 1BH2A 3CCSB 2QU8A 5H8WA 3R9IA 1XB2A 5DN6A 3U3KA 3GLGE 2QSZA 1DG3A 2ZRIA 1M90D 4KFRA 1KZ7B 1ZINA 1W35A 2J1LA 5LBIA 3K70B 1ZM4A 1KI1A 2CDNA 4DBLC 1NN0A 2GNOA 4AG6A 4K46A 1W47A 1W36C 2ZRHA 4A6PA 2QTFA 4GOKA 1T0JB 2O8EA 1XD9A 1CLUA 1R0YA 2BEKA 5BYJA 4D81A 4M1MA 4XWAA 2GJKA 4MQBA 1D9XA 2GJSA 2QA4B 2GAOA 1YKSA 1E2EA 4CYMA 4DQKA 1NRJB 2QN6A 1AK2A 3AVWA 3TMKA 4X8HA 1VQ4B 1T3SA 2VHUA 4XIGS 1FNNA 2YOGA 521PA 4QHSA 1N0WA 1E9CA 4KFSA 1D2NA 3OZUA 4DUGD 2X77A 2GJ8A 2DPXA 4HB2A 4AG5A 4PO9A 2WOJA 5CLLA 3VHXA 5KSOA 4C2UA 2BMDA 1OXVA 1NG9A 2H5EA 2OAQ1 5KSZA 2H8KA 3ND9A 4D4LA 1Y3AA 3I5YA 1O87A 2FU5C 5AJWA 2P6RA 3T1QA 4UNNA 1RJ9A 5D3MA 1ZM2A 1S8FA 1KI4A 4IXMA 1XD2A 3VKWA 1NSFA 4QNRA 3G4SB 3BIFA 2W58A 4B76A 2VO1A 2X19A 2NMVA 1GR1A 1OKKA 2ZYWX 1RVDA 1XJQA 4DUGA 3MAAC 1P73A 2J0VA 5KHOC 1XCMA 3A4LA 2WAYA 3GEIA 4TWZA 2D2FA 2WJHA 3U6KA 5CITA 2IS1A 2HT1A 4TQUS 2FOLA 4TTPA 3DOFA 3BFXA 4ZI2A 1XMVA 4X8MA 1E2PA 2XB4A 2ZE6A 1MRNA 3CH4B 2A9KA 4HUTA 1SVIA 2ZR7A 1XTSA 1EFHA 2D7DA 5HPYB 2VNKA 1W4RA 6Q21A 1H85A 1P2TA 1HTWA 4IOMA 4GRAA 3TK1A 2P3SA 3P4XA 2BBWA 2WBLC 2ODBA 1GWNA 3ZC3A 1NBME 3L2OB 5DNYB 1FX0B 3WMGA 3LY5A 5H70A 2VA8A 1N25A 3P27A 3JQPA 2PZFA 1EGAA 2CEAA 4F93B 3SQXA 1NF3A 2R6GA 3IO5A 4JS0A 4AKGA 1D5CA 1E6CA 2QAGA 1F2TA 2GHIA 1G3RA 4AIIA 1OLOA 3L82B 4ON9A 3PQCA 2IYRA 4OQXA 4F4IA 4JIMA 1XXHE 1GJRA 2CHQA 3QXXA 1KMHA 2WMNB 1Z0AA 2GXUA 2XITA 1F48A 3U61B 4D82A 4OQNA 1V5WA 1YRBA 1RRGA 1NMZA 3D31A 3ETLA 5FR1A 1FUUA 1GNRA 3HR8A 2ORIA 3RS3A 1P2SA 1E2QA 3L8YA 2OEPA 1SKYB 4CEJB 1N5LA 2W2TA 3KFXA 2NO0A 3C7KA 2J46A 1QFZA 4ITRC 5KNCA 1U9IA 3LXRA 2VRWA 3NG1A 2DETA 2WIBA 4XWOA 1A5TA 3OIVA 2FDCA 3BORA 3U7FB 1QHXA 3WMFA 1ZNZA 4Z1MA 4US2R 2GWHA 3THWB 4PXAA 2EW1A 1FUKA 1JPJA 3QENA 3KJEA 3U5ZB 3UG7A 3ZIAD 1QHHB 3EIQA 3KKQA 4URXR 1JEEA 2BM0A 4RD3A 1MO5A 3NC1C 3QVUA 4A0GA 1KI6A 1KAGA 3U4QA 5E7IA 2R6HA 4OK3A 1RZ3A 3G6EB 2ANCA 1KC8D 1VQKB 4KAXA 1W7AA 3DKPA 3HYTA 4JT4A 4AYWA 4MKIA 3ASZA 2QMEA 2YYZA 4QC2A 4WA7A 5F2EA 2BC9A 3HP1A 4O2LA 2H92A 3KQHA 4FWTA 1CJMA 2GEVA 3CRW1 4Q7JB 4BZPA 1TU3A 5DI9A 3BRWD 3KTAB 1W0JD 2H17A 2OE2A 3QBVA 2DR3A 3ZIAA 2GRJA 2FPLA 621PA 2GETA 2JLUA 1ZIOA 4JMPA 2ZU0C 1GKUB 1ONBA 1A2BA 4Q4JA 1KNQA 1R8SA 3W5VA 4EPYA 1SXJC 1L7VC 1UEIA 5J47A 1R5OA 2NO1A 1LFDB 1IJFA 4DKXA 1GVNB 1VECA 5FUWA 4EPVA 5FPHA 2VNIA 1W0JA 4JZKA 3I32A 2PLFA 2IYXA 4LDJA 3HR7A 5EP3A 3NC0C 4Q4HB 1BKDR 2ONKA 4Q01A 1CR4A 3EWAA 4EDHA 2TMKA 4XSGA 4B2PA 1Z22A 1EFRD 2QMOA 4IHQA 4F91B 1U99A 2JJ1D 2B5OA 4WZBE 2GZDA 3BFKA 5F3WB 2VTKA 3ICEA 3Q5EA 2DWOA 5EZ6B 5FOWA 1Z5ZA 4DT1B 1E99A 2VSXA 5C2JB 4PHTA 2QDXA 2YHSA 1MV5A 3TE6A 2BHRA 2IUSA 3FDIA 4PPNA 5K8LA 2AWOA 1VHTA 1ZD9A 3SOPA 3K1JA 4QGAA 3EPHA 3W2IA 2ZS8A 3TIFA 5J5CA 2J3EA 3H1TA 4M4SA 1E9SA 1G3MA 1ZD1A 4D25A 2CNWA 1HUQA 2ZJAA 2JJ1A 3MGCA 3SFZA 2VF8A 3FMOB 3IGFA 2GBLA 4Y9RA 2QP3A 4RZUA 4Q9LA 3FB4A 3WYGA 3AQ4A 4O0MA 4JBWA 4IKEA 2RCNA 2OV2A 1C4OA 2R9VA 2ZUDA 4IOKA 3UG6A 4GPTA 4N0DA 1YZGA 4JBXA 3AF3A 1CP2A 3R9XA 1IB0A 1NI3A 1ZIPA 4J0QA 1F60A 1CR1A 4QJ4A 1BX0A 5BWMA 2UVQA 1WE2A 4QFMA 3CCEB 2WV9A 4D0LB 2Z5FA 4I1UA 1OFTA 1XRJA 1HE8B 4RD0A 1K5GA 1KO4A 1X6VA 2FN4A 3A1SA 4UQOA 1RC8A 1CULC 5AJZA 4XD7D 4I1VA 3TQCA 1OGIA 3TVTA 4NMMA 1UMKA 1DELA 3A1WA 5E3HA 1R7RA 2IK8A 3CPEA 2IXEA 1L2TA 5FH9A 3CR8A 4PC3A 2ZRGA 1S3GA 1KQSB 2R6FA 4A36A 3IIKA 1DO0A 1OFUX 4LYFA 5JHHB 1QGZA 2YZ2A 1PLKA 3GQBA 3TJZA 1H42A 1AKEA 3CCRB 3BS4A 4QOSA 4RZ3A 4E07A 3OIYA 2BN4A 5KTYA 5KPJA 5CK5A 3CO5A 4A15A 4LUCA 3WHKA 5SZJA 5FL7D 1W87A 2QEQA 3AGQA 1GIAA 4DRZA 5FL3A 3TNFA 2PJRA 2GPJA 2FV8A 1W34A 4BWYA 1Q3TA 4M9QA 1IBRA 2VH5R 2F9MA 4HAZA 2WPDD 1DAGA 2BCGY 3SJBA 3GEEA 1XU4A 4PHFA 1R2QA 1UJ2A 3PUZA 3I55B 1QHIA 5AK0A 1NVXQ 3TW4A 4GL2A 4NCKA 1VQOB 2BSAA 1ZJ6A 2D7CA 2ERYA 3NBFA 1Q82D 1S2MA 4A92A 3ZZ0A 5FL7A 2AL7A 4QBGB 2O8FA 1Z6XA 1OW3B 1DVRA 2MSEB 2RGXA 3FVQA 3THOA 4D4JA 3QE2A 2JLWA 1QVGB 2C95A 1KIMA 1TQ4A 2PCLA 4QJ5A 4PHHA 5KO2A 4TLEA 2RC6A 1II8B 2WPDA 3Q9LA 4US0R 3AKDA 3ONWA 4QGFA 1WDTA 3A1UA 1HV8A 2QGZA 5K8TA 3NEJA 1EFCA 4PZZA 4XTCS 3DZ8A 2OLKA 2C03A 1S4QA 2ZRBA 3QE0A 2HCJB 1Q20A 1CJTC 2FG5A 4NYJQ 2ZXUA 4JSTA 4GMDA 2JIZD 4GMXA 2WJJA 4JVNA 5EZ5A 5FI0B 5HCNA 1JB1A 3FE2A 3ZVMA 4YDHB 3TAUA 5G41A 1KMHB 1NJFA 2JLZA 5EP1A 1G41A 821PA 3L0IB 1N8RD 3JQQA 3VR6A 1NY5A 5JRJA 5KDOA 3CC2B 3VO1A 1FP6A 1QH0A 2ZI4A 4TMTA 1OXSC 4CRWB 3QF7A 1CR2A 2IYLD 1E2GA 2C9YA 1M2OB 2QMUA 2KWIA 1H8ED 3VFDA 5CIQA 4D6PA 4A8JB 1YZKA 4ZKDA 1TLLA 5EMNA 4BQSA 2QP4A 2QAJA 2ZI6A 3HYRA 2RC5A 3CRRA 2QL6A 3B1ZA 2BBTA 3KX2A 4UNPA 2D4HA 4YXWA 1B2RA 1SVMA 4RD2A 5JECA 1E4YA 2CHVA 3K9GA 5CLQA 4DIEA 3THYA 2PX3A 3MWKA 4TYYA 3LX5A 1D8TA 1GZSA 3K70D 3B8HA 2I3BA 1NVVQ 3CX7A 4MRSA 1TU4A 5EE0A 3U7EB 3OIUA 3VHLB 4ZCMA 2F7SA 1J9ZA 1B23P 3BWDD 2BKEA 4JKYA 1H8EA 1LS6A 3UMFA 3B9PA 5DI3A 4PAOA 5FR2A 3WNBA 1KI6B 3ZVLA 1YHQB 2G1JA 1DAHA 2ZJYA 4MYUA 2FF7A 1ZYUA 1Z63A 3REFA 3IIMA 4I99A 3GEHA 2RGNC 2H57A 2ZRKA 1ZM3A 1KK3A 1OB2A 3EA0A 4C3ZA 4LK2A 2PZEA 3Q72A 3ZVNA 1G4AE 5J4YA 3PUXA 3K9LA 2YC4C 2FGJA 3O47A 3KQLA 1KOFA 2J41A 3BB1A 4PZYA 4MDFA 2OCBA 1E94E 3ADBA 3KKMA 4Q4JB 1IOZA 4R2HA 2X8AA 2O5VA 5FTKA 1KDTA 1CNFA 3OESA 1U0LA 5BN4A 3AVXA 2BBOA 4GOXA 5DIFA 2HCBA 4DDWA 1E64A 4DLUA 4MRVA 3U3OA 3TSOA 3EIEA 4LYJA 2XZLA 4G5OA 4Q1AA 2R6DA 1NG1A 2CCKA 3MD0A 4LRWA 3LV8A 1ZRHA 4K8OA 1E2NA 1IN7A 3B5JA 2F1IA 3EC2A 2JDID 3CIOA 1E9RA 1XBTA 3QG1A 1YZTA 5KSYA 3MHPA 2VHTA 2FJUA 3QXJA 4URZR 2QTLA 2CVHA 4HAUA 2DYKA 2DBYA 1N6RA 3DPUA 4LBZA 2QPOA 2WKPA 4C0LA 3U7GA 2ZI7A 1GSIA 1NN5A 3WRYC 4CZ2A 4YMVA 1HT2E 4UNRA 4GDFA 4ZIRA 1Z47A 4RFSB 2O8CB 4WOPA 2F6RA 2HEIA 1GAWA 2IX3A 1S3SA 5JHGB 3BBPA 3I61A 2JJ2D 2XZPA 1ZP6A 2JDIA 1ESMA 2WSMA 4E03A 1ZD8A 2XSZD 4PTLA 4Y9UA 2A78A 4M9ZA 4V0ME 1IY0A 1VQ7B 4YAUA 1LF5A 4IEEA 4KBFA 4YC7A 2P67A 4D4KA 4B48A 1NDHA 2ZRMA 1FRQA 3IBYA 1VQPB 3CBQA 2QENA 5JWOA 4M1SA 3CMEB 3BB4A 2HLDA 1IY1A 4OQMA 2E1RA 3QFSA 5JBQA 2OT3B 4F4JA 2EFCB 4JLOA 4ZDJA 2BDTA 1TEVA 2JJ2A 2NIPA 1Q22A 1UDXA 3VAAA 2BIFA 3X1DA 1P60A 2ORVA 3TGPA 1BS1A 5FOVA 4QHYA 4DSTA 1ZU5A 2ZSAA 4QBFA 3K0CA 1KDPA 1JI0A 3MFYA 4C7OA 4C0JA 3GLIE 1NL3A 4RFVA 4W5HA 1G3QA 4BFZA 2OAP1 2Q3FA 3P20A 3RRNA 2O8BB 3OEED 4DVGA 4NP6A 3X1ZA 2YWFA 4PFSA 5IHPA 1T3LA 1XNJA 3LQQA 3TUZC 5E95A 1GKIA 1DG1G 3L8ZA 3B82A 3AVUA 2GDJA 1OYYA 1XZPA 2GEUA 3LXXA 1EFTA 3AF0A 3CNOA 3THXB 4OI1A 1JA1A 3CZPA 2ZM5A 4CEJA 1W1WA 4PO1A 4DLVA 4DIDA 3LWNA 3CCJB 3EIHA 1JAHA 3M6AA 4BLPA 3OEEA 1IN6A 2WJVA 2PL3A 4D4MA 5KU1A 2DCUA 2QP9X 1T0HB 1Q1EA 1SZPA 3OE7D 4TLCA 4BRWA 2ZI5A 3M4YA 1UBFA 4B6FA 1GILA 4LWZA 4JLNA 3KXLA 3BH7A 4KI0A 2B7BA 1YZQA 3CLVA 3THWA 2Z83A 1OIWA 2I4IA 1YZLA 4B75A 4C0QC 1KKLA 1QHHA 3V4RA 2O8FB 3OIWA 4PC6A 1VHLA 2ZANA 3SBEA 4CF7A 1U94A 5IF9A 4BZQA 4PC7A 3DM5A 3LVQE 2EFDB 2XNDD 4LHWA 4HLQB 1XJ0A 1AMOA 2GVZC 2ODWA 3PUYA 3CUEF 1CF4A 4HI0E 3K0FA 4L15A 3DM9B 2QRNA 4HATA 4KU4A 4QNMA 2RGAA 3OE7A 1KD1D 3W2GA 1FMLA 1Q21A 2ERXA 3NHBA 3QOFA 1EG7A 2Q6TA 5AJYA 3W6PA 2IS2A 1E4VA 3VR1A 2ZJ8A 3KZ1E 1A82A 4Q1BA 1M7GA 1DAIA 1ODFA 4YAFA 2OILA 2HUPA 3GJ4A 3FGNA 3KTAA 3I73A 1E9BA 2N42A 5EUMA 1AS3A 1VCOA 1OFIA 1VYVA 4PAMA 4R98A 1Q1ZA 4LYHA 3CRQA 2VP0A 5L3SA 2XNDA 2BJWA 1NJGA 3R8CA 4A82A 1DDIA 5LD2B 4WIAA 3O8CA 3TLXA 1ESNA 1J2JA 1G7RA 3OZVA 3RDPA 4I4LA 2CL7X 1P9NA 2F55A 1JJVA 4OHWA 2V3CC 1MO6A 4P32A 2R2AA 2WAXA 4AC9A 3Q7QA 2IC5A 3K9HA 1M1KD 1IM2A 1KKMA 2O0HA 3LLUA 5DLQC 5GJBA 4CIDA 3NEYA 2QAGC 4LJ6A 2VHCA 3FJOA 2I1QA 1ZMXA 1NLZA 2FGKA 2OBMA 1AIPA 5TR9A 1Z2CA 4LV6A 1U8ZA 4KYIB 4IVRA 5ANRB 3WBKA 3SYKA 3QKUA 3NBXX 4LOAA 3SZRA 4M0LA 2P6UA 2PIAA 3BFVA 4DT1A 4AKIA 4FK8A 3AB3A 3THYB 1AS0A 2ORWA 3K53A 3D6TB 4EPWA 3GJ3A 3ECCA 4EUNA 4HB0A 1OSNA 3OFND 1U9IC 4GZMA 4ZO4A 3T12A 5ELXA 3C8UA 2PH1A 1RRCA 2DFLA 5DI3B 1M34E 5B58C 1Z83A 1HQCA 2RHDA 4BFWA 1M8PA 1XMSA 1A4RA 2RAPA 2R62A 1IN4A 3W5HA 1COWA 2QM7A 2QA5A 2MMCA 2N46A 1ZU4A 2G6BA 3PUVA 2ZE5A 2CE2X 2F1HA 3IPYA 3OZWA 1Z0KA 3TUIC 2GZHA 1EP3B 3NWJA 5FTLA 5EUQB 3X1YA 4LV5B 1S72B 1MO4A 4ZI3A 4BASA 4TSFD 5AN9A 2X2FA 2BVNA 2IS6A 4ZDWA 1W2BB 1HE1C 3EC1A 5EE9A 4ACBA 5TXGA 2ZYUX 5JS7A 4LPKA 3OFNA 3QUSA 4IVPA 3SJAA 4C2TA 1S96A 1RIFA 4YAOA 3OAAD 1KSJA 1VG0B 1CBUA 3QFTA 1QHSA 4LJ7A 2WKQA 1MT0A 2V8OA 4PQRA 3QFCA 1W2GA 1Q3HA 1P62B 3P32A 4NYJR 5H59A 4Y0AA 4NCHA 2IHYA 1PUJA 3UWKA 3I3SR 1AN0A 3LDAA 4S2EA 4TSFA 1DO2A 4B2LA 1XZQA 5EE5B 5EP2A 4LC0A 4WVFA 4IOLA 3X1XA 1OKKD 2OFOA 3EXAA 3OAAA 5FOUA 1U8YA 4M1YA 4HE5A 1P2VA 2I1VB 2ZRCA 2DERA 2QUZA 3ADKA 4FWIB 5AUNB 3AP1A 5H1YA 5G53C 2QPAA 5KNBA 4B3FX 1MOZA 2PX0A 2WVJA 4YALA 1E1QA 3K0SA 4H9GA 4KV9A 2IXFA 2J0QA 1FMJA 2REBA 1VYTA 1BX1A 5DYGA 1E9FA 3RNLA 1EP2B 3FPKA 2B6HA 3CC4B 2HXYA 4RVCA 1KZGB 4DLWA 3FMIA 3LRPA 4EFNA 4ZIRB 1FZQA 3KQNA 2ZSDA 3KXKA 1EWQA 4ESHA 1QFYA 2GVDC 2EYQA 1XWIA 3L0PA 1ANKA 1NVVR 5HZKA 2KE5A 2VSFA 4FD2A 4KITB 3D8BA 4TT3A 2AN9A 3QBTA 3SS8A 2RGBA 3I5XA 3B1VA 1WQ1R 3BOSA 3M0EA 2HYIC 1HQYE 1W44A 1EP1B 3W2HA 1BYIA 4HAYA 5G3YA 2NO7A 1E69A 2A5JA 5JJLA 2GBLC 1II8A 2R44A 3KJGA 3GLHA 3WMEA 4MGIR 5TMPA 2MSCB 2OFXA 2QY9A 3IQXA 4W5WA 4B32A 1FL9A 4I81A 1SM4A 4LCBA 1NY6A 3FOZA 4WAUA 1Q1QA 5EP4A 2YINC 2VHQA 1F3OA 2JLQA 2IT1A 4Q1CA 4P6VF 1JR3D 5AUQA 1W5TA 1R0WA 2HV8A 4C7OB 3O8DA 2DHRA 4GSYA 4N1AA 1P9WA 1OF1A 5KDDA 4BLQA 1N2CE 1XE1A 1XCPA 3D3QA 5AR1A 4IOJA 1AS2A 1E2LA 3L43A 2PEYA 4HLUA 2BKUA 3IEUA 4TTRA 3QI2A 4ARZB 4Z1MD 5EXTA 2ZUCA 4XVUA 4PQFA 1XEXB 1SVLA 2YWGA 2B8WA 2ZROA 2HT6A 1IXSB 2ANBA 3CKLA 2VSOA 1JR3A 3C15C 5FBVB 3GFTA 5KOYA 4MDEA 4XSHA 4A8JA 4CT5A 3TUJC 3T34A 4DWJA 4QBHA 4G0NA 4XWKA 4URVR 1PLLA 1G1MA 2ZUBA 1WA5A 4HE6A 1WXQA 3NXSA 3IQWA 3T61A 2O8DA 2WWHA 2CCGA 2QT1A 3LBNA 1VCIA 4Q03A 1VG1A 4IXNA 4KFUA 3AKEA 3RRMA 1JB9A 4B3DA 4C9BA 2BGJA 3M1IA 4LJ8A 3D7MA 2FEMA 3GLGB 4V02A 4ZPXA 1QX4A 3GJ6A 2OK7A 3IHWA 4FIDA 4QHTA 2P6NA 4MRPA 4UNQA 3G82C 4EPTA 4BEBA 4C4PA 4O2RA 1KHTA 3K0FB 2OESA 3GPLA 2FE4A 4A1FA 4RSGA 2IA5A 3A6PC 1Y63A 3RC8A 3QKSB 1G6OA 3REGA 3B2EA 3CX6A 3N2IA 5CJPA 1OIVA 4G1BA 3CF2A 3I62A 2HF9A 3VKHA 2WHXA 4U5XA 4IFBA 1SKQA 2OZEA 3HDTA 1T5IA 2DWPA 3RWMB 2IHBA 2CXXA 721PA 5L3SB 1YJ9B 2Q3MA 1GVHA 2F3TA 3LFUA 3W5UA 1KY2A 1QFJA 2B21A 3E70C 5GV8A 1IQPA 3FWYA 3V76A 2J45A 4LPSA 2J0SA 4DLYA 2G0NA 5JSZB 4NZYA 2FFAA 2J87A 5EQTA 1D6JA 5AWFC 2ZI3A 3EZ7A 1NN3A 3ES9A 4GT1A 2RH5A 2FFQA 4IRUB 4A0FA 3AEZA 5LD2C 2REXB 3CF0A 1RPZA 4WBSA 2QBYB 3FTQA 4MRRA 2CNWD 2VEDA 4U02A 3CWZA 1M7BA 3CPHA 4LJ9A 3VR4A 2IYTA 4JKIA 3VQTA 4DEYA 3UIEA 1IHUA 2EVWX 1OH6A 1K9MD 3A1TA 2Q21A 5JZVA 1XEWX 4B4DA 2AD1A 1UADA 1TAGA 2ZRPA 4Q4AA 2CK3A 5EE3A 1KI7A 5AUOB 2XZOA 1SHKA 1AKYA 1G8PA 2GXQA 2WWWA 3HU2A 3AVTA 4O3MA 2O8CA 4RFSA 1LB1B 1Z6TA 4TL9A 3LQRA 1VPLA 4Q1EA 3HPRA 4BEJA 3O8BA 4WZAE 2NO6A 2WJGA 4LHYA 1ZM9A 5A5GA 2GJ9A 3QPUA 1VQ5B 4YLGA 4DSNA 4UXJA 2WOOA 5FPSA 5FBQB 4M1KA 2QI9C 3RSOA 1NSTA 3AKYA 2D06A 4HB3A 2OTJB 1ZUIA 4IEIA 4LY6A 4D0NA 2QE7D 3MJHA 3BD9A 5TB5A 2ZR0A 2AKAB 4R7ZA 3OHMA 2CL6X 2CE7A 5AJXA 1NVUQ 1IY2A 5C46F 2JJ8A 4BGDA 3C41J 5FPKA 1Q57A 2QROA 4A0RA 1J8MF 1OIXA 1KGDA 1MABB 1GM5A 4OI0A 2XTNA 4KBGA 2VP4A 2BOVA 2FEOA 2OM2A 2PT7A 4GNKA 1UAAA 3PEYA 1XXHB 2F9LA 4Z8XA 3K70C 2B92A 2ZIAA 2LKDA 4B43A 4OQFA 5B64A 3I1FA 2FA9A 4ZDIA 2EWWA 2QE7A 2AD5A 5CB6A 1BYUA 1QVRA 2JEOA 1RRFA 3B1XA 4ESVA 2O8BA 1F20A 1H8HD 5KSPA 2J5XA 4PGOA 5J4HA 3H2YA 4BLSA 2FZ4A 2OG2A 4EJSB 4B44A 1ZW6A 4RD4A 4HB4A 4R71A 3CF6R 1KNXA 2JASA 1CR0A 5J4LA 4NONA 1W4BA 3EPLA 1QGAA 2A3RA 2IL1A 3H84A 2XXAB 3G0HA 2FPMA 4EQ6B 4P31A 5CDFA 1YZNA 1OXUA 4XTRA 3THXA 3IPXA 3RS7A 3BH0A 1BO6A 3AM1A 3EA5A 2BMEA 1E9AA 1WCV1 1C9KA 2BV3A 1H8HA 1G8HA 4PX9A 4Q48A 1QVAA 3AGPA 1OE0A 4A4DA 4PC1A 1T91A 1BQEA 2ZJOA 4NPHA 4HLCA 4M1WA 3UANA 4G5QA 4YMWA 4Q02A 2WM9B 3ZLJA 3ZVRA 3KKPA 1HH4A 1W46A 1KO8A 2QG6A 4A2PA 1RYFA 4V0LA 5JJIA 1ZNYA 3K0AB 2A2ZA 1N0UA 2XOKD 3PVSA 3QXSA 5HZHA 4F7WA 1OV4A 3BK7A 3NH9A 1P5ZB 4ZGNB 1NN1A 3CNNA 3ND8A 3WP0A 3KB2A 2NZ8A 3OJXA 2BMWA 1N6IA 4HDQB 1UKZA 2IYUA 3GLHB 5CYOA 4UXIA 5DHAA 4F4CA 1WB9A 2MMGA 2A5DA 3LVRE 2W0SA 1E2FA 4PO8A 1SVKA 1CS4C 5FI1B 1TX4B 4N0EA 3CR7A 2OUKA 2GQFA 5FBLB 2DY1A 1G21E 4MUAA 3SBDA 4LBYA 2NTYC 1FP7A 2VHJA 2XOKA 3I8XA 2ZEJA 4UJ5A 3MUFA 2F1RA 4F38A 5BYKA 1GITA 1XTQA 3ZBTA 2LCFA 4W5JA 3EARA 2WWIA 4GZLA 2VP2A 4KVGA 1Z8FA 4KSBA 3BJIC 1FQJA 1J7KA 4PQYA 4P3YA 2BF4A 1T4GA 1M1YE 3K0CC 4YXWD 3B60A 1TTTA 4EFLA 3ADDA 4TMWA 5K8IA 1P75A 3GJ7A 5GVRA 3TR5A 4B2IA 4GP7A 1D1NA 2WWFA 4YAWA 1QVFB 2G0TA 4M22A 2PMKA 1YHNA 2O0KA 4M9XA 3RSLA 1II0A 2IWRA 1NNEA 2VYQA 1N0VC 2A5YB 1XJCA 2P2LA 1E79D 3ZS9A 4EPRA 4QXAA 5M04A 3BAFA 2DFNA 5FOTA 1VG9B 1HEIA 4X8LA 1MKYA 2FFHA 2Z43A 1GOTA 3H4MA 3W8NA 4D80A 2O8DB 1Q81D 4IDQA 1KSHA 4YONB 1VQLB 2ZTSA 1DE0A 3K09A 4HUQB 5B2ZA 3CCLB 2VLIA 3AF4A 3PENA 1CJVC 4B74A 4U7DA 1G9XA 2C96A 1P6XA 5L3VA 4IW3B 2WJYA 1DAFA 1E79A 1XD8A 1XTRA 2XGJA 2P5TB 4EPXA 5CDFE 1Z2AA 4C43A 4DCNA 1YJWB 2ZRFA 3TW8B 1GFIA 1R0XA 3C14C 5KYKA 1NJID 4F7DA 3QJYA 4B6EA 1KAOA 3FPAA 4JLPA 1GO2A 1NVWQ 5DGXA 1TUEA 3KUCA 4URUR 3W34A 4KVAA 1MO3A 4YDSA 3DMDA 3A8TA 2XJ4A 2BM1A 1W36B 1MH1A 4BZXA 3PJRA 3IEVA 3CRZA 2OXRA 2L0XA 1Z06A 2QM8A 3OF5A 1QGYA 2ZI9A 2C9CA 3K8YA 2W83A 5E7MA 1DARA 1KO1A 2GK7A 1VTKA 4D26A 2G77B 3LBIA 1L8QA 2HJGA 3X2SA 1YE8A 1G8GA 2EIXA 4V0KA 5HTKA 2OCPA 2VNHA 2CHGA 5D3QA 1JJ7A 1GDDA 5IRCD 2OK8A 4MH0R 4P4UA 5DYIA 3FHCB 3PR1A 4BLRA 2GK6A 3QEOA 2ZS9A 4RKEA 2QTZA 1OXXK 1BIFA 1U0JA 4POAA 4EAQA 3KQUA 2V1UA 3PIRA 1WRBA 4TL7A 4JYBA 3UXMA 1GNQA 3GJXC 4DZZA 1ETUA 3GLFA 2AFHE 4Q4AB 5K8UA 3SDZA 1LNZA 3WNDA 2Q0HA 5FPYA 5CJ2A 4TMKA 2HLDD 4G1UC 2ZYTX 4MYHA 3W8RA 5C1BA 2X3UA 2JLSA 4ILEA 2GTPA 2ZSBA 1FW6A 3PITA 2V4ZA 3WNCA 3RC3A 2K5UA 1X1SA 3CCMB 1P4SA 2V55B 5E7JA 3G71B 2DEUA 1B0UA 2ZAMA 5LB4A 4JVMA 5AJVB 3MG9A 4FCWA 1KK2A 5L3QA 5H5JA 1E0KA 4G01B 2ZR9A 1QUEA 2BMJA 3F0TA 1DTSA 1Z28A 1K8AD 2C8VA 3LBHA 2WWGA 4TMXA 2FPKA 3QNUA 1ZC4A 4IVQA 1JA0A 1YZUA 5LB2A 1ZCBA 1CJKC 1BMFD 1X86B 3B9QA 3T1VA 1ZBDA 3TRFA 2OCAA 4L8GA 1OH5A 3J81k 4RCZA 3JZAA 3PEVA 1XP8A 1EX7A 3AVOA 1EK0A 1SGWA 4Q4LA 4HEJA 1US8A 3PFIA 2DFKB 2NG1A 4FMBB 2EQBA 4A0HA 4LHVA 3QKTA 1FNDA 3VR3A 2YKGA 1PV4A 2GXAA 4DJTA 4DEXA 1OPXA 2P5SA 3F3YA 3LLMA 4B35A 1QG2A 2OSBA 4Q66C 4C0AC 2CRVA 2B8TA 4PPFA 4JLAA 4NYMQ 2SHKA 1BMFA 1W4CA 2QMHA 4Q7KA 4OHYA 4ARZA 2EWVA 4Q00A 2E87A 4Q9HA 4ZCIA 1E0AA 1XEXA 5F9FA 2C78A 2LKCA 2KBEA 1FRNA 4OHXA 1YRAA 2C98A 3LW7A 5GJWC 1N5JA 3SN6A 5FOXA 4ZGQB 1E98A 4FN5A 1Z07A 4HZUA 2IBMA 2JA1A 3T35A 2HF8A 4I1SA 4LX0A 4TYWA 4GP6A 1T5LA 4B73A 3GD7A 3QF4B 3H0KA 4M9SA 2IUTA 3RLFA 4TZ6A 4QL3A 2ZE8A 3W5IA 1A1VA 1E3MA 1HA3A 1G3UA 2IW3A 4QM6A 1GRNA 5HKKA 1X8LA 3IIJA 1ELOA 1I2MA 4MA4A 3Q5DA 2ZJZA 1JEDA 4CEIB 4KYUA 3E2IA 1QBKC 4KJZA 1UKYA 1T8TA 2GESA 3KKOA 1ZCAA 2O0JA 4OBEA 5DH9A 3SE0A 1G7SA 3PG5A 1J90A 1P3JA 3A36A 4JL6A 1YVDA 3GLGA 2AWNA 3DVLA 4E22A 3NBYC 2ASEA 1N6HA 4HAWA 3BERA 1HYQA 1OFHA 4JLJA 2DFTA 1CNEA 1QRAA 5SZHB 4B3GA 1GRQA 2R65A 3MWLA 4DXAA 3QKSA 4CEHB 2CBZA 5JI2E 2OO7A 2CVFA 5CB8A 1I4TD 3RWOA 4TYPA 4FMCB 3OW2B 3N2EA 3QKRB 3DEFA 1YQTA 2CJWB 5LPNA 3RS4A 3T15A 4Y0VA 3R7WB 4PC2A 1DAEA 1U8AA 3RRZA 4N3GA 1D9ZA 3ZS8A 3IKJA 4JLKA 4KXFB 4P4TA 2G3YA 4JJKA 2F43B 2PLRA 3AVPA 3LH5A 3ZZUA 2IEZA 2IYQA 3UKDA 4OK6A 2YC2C 5JSZA 4ASUD 2UZ3A 3F8TA 1KJYA 1SXJB 2A5FA 4YMSA 3ICQB 2WKRA 1TL7C 4P4SA 4DSUA 4V03A 3O8RA 1EESA 4L16A 1ZUHA 1SVOA 4DCTA 1FPMA 3UPUA 2J7KA 1PUIA 2PT5A 3KFVA 2QBYA 2Q9AA 3MJRA 1OJLA 4OHZA 2RMKA 3AVVA 4FCTA 4HLUC 1BJKA 1COWD 3QFRA 1K8RA 4U00A 4QM7A 2OCYC 1P61B 4II7A 1DS6A 1QHYA 1P2UA 3EZ6A 4ASUA 2NPIA 5JJKA 2H7VA 4B71A 2WSSA 3PUWA 2FSFA 1UDWA 1G7TA 5J4VA 4C0BA 2Z0MA 4BFXA 2WZQA 4R2IA 1KJWA 4A8JC 2GCNA 4QJ3A 1G8FA 3Q85A 2F1JA 3I72A 3MWYW 4RY2A 3PEWA 2ZREA 3HU1A 2WWYA 3QXCA 3TQFA 2W6JD 3FHTA 4WZ6A 3FYHA 4HZIA 3KJHA 2PMDA 4ZV4A 1PLJA 4KFTA 1AJEA 1X1RA 5KUTA 2IXGA 2CCJA 4D0GA 4LC1A 2GEDA 2QZ4A 2JLXA 1ZUNB 1R8QA 1G5PA 2N1BA 1SKYE 1TMKA 5CYPA 3NKVA 3PEUA 1RE0A 1NBMA 3PV0A 5FTNA 5L3RA 3VTKA 1S1MA 3DZDA 4FMCF 3GLIB 1W2HA 2W6JA 3IUYA 3E20A 2RGCA 4IJMA 2AFIE 3BH6A 1MABA 3LA6A 1NLFA 4YQFA 4XVRA 5BXQC 3GCGA 2V7QD 1BOFA 1PZNA 1XXHA 2GF9A 3SYNA 3UMSA 1F6BA 1DEKA 3B1WA 4S35A 2ZSFA 1QHGA 4XVQA 1Q7YD 1E1QD 4XOIA 1Z0JA 4ZCLA 1JNYA 4NE2A 2WTUA 4IDPA 2ZETA 3B1YA 3IO3A 3QPWA 3A4MA 3UMRA 3W5JA 2G83A 1Q1BA 3EZ2A 3L0OA 4WQMA 3GJ0A 4DCVA 4G3XA 2ZRLA 4EJSA 4FCVA 5IDVA 2GAAA 1N6KA 3TAHA 3W6NA 1XCGB 1VMAA 2KB0A 2V7QA 3RANA 4GOJA 1E2JA 2XXAA 1KI3A 4TT3D 4EQ6A 4ZDKA 2XX3A 4Z51A 1FOEB 3S1AB 3GLFB 1WBDA 1I2DA 1II9A 5TY0A 1CU1A 1P72A 1YR7A 1E9DA 2D2EA 2QNRA 4MGYR 1CQXA 4MKGA 3ZD6A 4RD6A 2KSQA 3G5UA 1JQJC 2J0UB 2HJVA 3RHFA 5L8VA 3ZD7A 3NVAA 3VKGA 4EKDA 4A2WA 3NHAA 3IILA 2D3WA 3V9PA 3W3ZB 4B3CA 1C1YA 2CL0X 1AM4D 4FW9A 4LJ4A 1FTNA 4A2QA 3GJ5A 4QBIA 3K0AA 1G291 1QZXA 3EW9A 1JJ2B 3DDCA 1HT1E 1TF5A 2G88A 4PSKA 3RYTC 3T06B 4B3BA 5L3QB 3E1SA 4WXRA 2NGRA 2AK2A 1CRPA 1K6MA 3U44B 2UKDA 5C18A 3AP3A 5THXA 2EFGA 4ERNA 2BEJA 3NIBA 1F2UB 4JLBA 3R9WA 3X1WA 2FMXA 3CRMA 1OH8A 2GZAA 2ZS7A 2JCSA 2YOHA 4Q18A 4BRUA 4RD1A 4KODA 4PPGA 3N70A 3JZMA 1IN8A 3B78A 4L9SA 1TF7A 1US8B 1M6NA 4M2LA 2KJQA 3CZQA 1GTVA 3I92A 3AF1A 2W2VA 2AXPA 2W6ID 3OJWA 3P26A 2FX3A 1TF2A 4XH9B 5G3ZA 3U6BA 2W0MA 4OL0A 4WW0A 3TSZA 1HURA 1VKJA 3HU3A 2J9RA 1ZC3A 1XFAA 4G1VA 2A5GA 2DWQA 2ZE7A 4LZZA 2W2XA 3ZQJA 2VNJA 3GP8A 1U0HC 1LS1A 2WJIA 4UJ3A 4BUJA 3VR5A 2ZRAA 4AF6A 1KO7A 1RYHA 1Z6YA 3RAPR 1GAQA 2QORA 3CMAB 2VZLA 1OYWA 2W6IA 3AP2A 4HZUB 2H1LA 3TH5A 2P65A 2PCJA 3CONA 1I4DD 2ZU6A 2B7CA 2VP9A 2NOAA 2IF2A 1X3SA 4Q9IA 5JFGA 1EX6A 1AQYA 3RRYA 1IXRC 3VX3A 4CVNA 5EXPA 1TVCA 2R6CA 5DO9A 5JLJA 4UXHA 3LD9A 1E2IA 3C16C 3DO6A 1LF0A 1IN5A 2YV5A 3AKCA 4OHVA 3AUYA 4DB4A 1MR3F 1KTVA 1JALA 4HUQA 2OFWA 2OLJA 1R10A 4TLDA 3KKNA 3HPQA 421PA 4P33A 1OT3A 4DCUA 1V43A 2IYSA 1KSFX 3ASYA 1W36D 4LI0A 1O3YA 1TADA 1UKEA 1PJRA 4FXPA 1L4YA 4YHBA 3WYAA 2QQEA 3AH8A 3SR0A 3T5DA 3ZZTA 3CPWB 2ATVA 4DLXA 2VIIA 1GKYA 1XPRA 4MUBA 2XJ9A 3U3RA 1A7JA 3WHLA 1NKSA 2FSHA 4BECA 1E0JA 2XNJA 1XTIA 2A7QA 1VG8A 3CC7B 4HLDA 5JI3E 4DQLA 1YIJB 1U90A 1Z3IX 1Q86D 1X8JA 3WYFA 4OJQA 4FI3C 1ZNWA 3L0SA 2RGGA 4TTQA 1XDBA 1XPUA 3ZBUA 2OHFA 2CNDA 4HAXA 5TDHA 1W0KD 3V4FA 4X8OA 3B85A 1S0UA 1NIPA 1J99A 3BGWA 3R20A 4D2IA 2CLDX 2CK3D 2AK3A 4P4SB 1EFUA 3EPKA 1GL7A 4NYMR 2ZJBA 2W00A 2OXCA 3SNHA 3V00A 3QXHA 4W9MC 1TEXA 5FPTA 4CGZA 3PCRB 3GLHE 2CLCX 4LSGA 1AGRA 1IONA 5IK2D 4EH1A 1G3IA 3WBJA 1E2HA 4JVLA 4LHXA 4PSAA 4JBYA 3MMPA 1G7CA 1DADA 4C0SA 4NU0A 1W0KA 3TR0A 2KI5A 3GFOA 2Q9CA 1LVGA 3P4YA 2QQ0A 1SQ5A 2QGNA 3CCVB 3Q8XB 3CD6B 4OK5A 1CTQA 3DKVA 5BW8A 3K9NA 3MLEA 4AF7A 3T1TA 3FMFA 1E96A 2X1VA 2XTZA 3NDBB 4M53A 1S9DA 4JL5A 2ONJA 1KYIA 4TQAA 2HXSA 5IK2A 1G4UR 2ODEA 4Q47A 5FBRB 3DL0A 1Z6GA 4LBVA 2IYWA 3I4LA 2X2EA 3A1VA 2GILA 3BE4A 1ZAKA 4TMVA 2V9PA 3K09C 4NCIA 1JR3E 1Z0IA 2J59A 4JT2A 4JYCA 4B47A 1Q12A 2VF7A 3MWJA 4AYTA 1W4AA 4US1R 1RRPA 5HXBA 2YWHA 4DDVA 4IDHA 4DDTA 5EJEA 4RJLA 2GF0A 2GCOA 4A6XA 2EU8A 1J70A 2V1XA 2YNMA 4OI2A 1G64A 3CX8A 4UAJA 1EFRA 1DPFA 1GL9B 3VU9A 4LJAA 3B6EA 2RHMA 1KRHA 2EYUA 1KI8A 5CM8B 4AK9A 4UNSA 5J4KA 3W2FA 4JVSB 2BJVA 1UFQA 1K73D 1HY3A 4K81B 2MSDB 2VBCA 2ZRDA 5JWRA 2V54A 3NBZC 3EPJA 3FKSD 4KHZA 3QEJA 5B57C 4JLDA 4PANA 5DISB 2C9OA 2VL7A 1DOAA 3QIAA 4MRNA 3TKLA 3ZH9B 4C0KA 3C5CA 1Z6AA 2QTHA 3K0EA 3SYLA 4Z8YA 2O8EB 1F5NA 5LDDC 2AXNA 3W90A 2D74A 3C4JA 2QSYA 1T9HA 2HMAA 4H1UA 1GP2A 1CRQA 2OBNA 2YOFA 5GADl 3TSWA 3FKSA 5FTJA 5CK4A 4CDGA 5FTMA 4I1OA 5C4GB 4G5GA 2NPFA 4RCYA 1SHZA 1P7CA 2O52A 3SJCA 2XB2A 1L4UA 4A9AA 3QF4A 2C04A 2JGNA 2XNCA 2GCPA 4GI7A 3ZYCA 3PXGA 4Q19A 2VP6A 2G9NA 4HYYA 1E2MA 1KI9A 2WWXA 3LO8A 3WP1B 5SZIA 3TVDA 4N3NA 3LVBA 3IHLA 4QKQA 3QVVA 3W9YA 5HR5A 2XNSA 4CEIA 2LWIA 1NIJA 3EAQA 1AZSC 4XD7A 3ZQ6A 2PJZA 2BPOA 3ADCA 1RJ9B 3LX8A 3CRVA 5D3MB 5A4JA 3QY0A 4NYIQ 5G40A 5F9HA 2AR7A 4NKRA 1XD2B 3CH5A 5IT5A 3RVBA 4ZKEA 2ZAOA 1TNDA 4IDNA 2ZVPX 3WXMA 1R5BA 1VQ8B 1FDRA 4CEHA 4PPQA 1JXMA 2RB4A 1G6HA 1SXJD 1P9RA 4XJXA 3RS0A 1YR6A 1ZM7A 1VDZA 2QRZA 4JSYA 1VIAA 3QKRA 3CM0A 4JLVA 4KCGA 3U2QA 1D2EA 2CJWA 3E5HA 3SU8A 4UKDA 4BFUA 3R7WA 4EFMA 2PZGA 1GG2A 1FNMA 1M7HA 5FUYA 1E0SA 2F43A 3EZFA 4LV8B 2ZQ5A 4CT4B 5KPDA 1PVOA 5TARA 5GJVC 1Z0FA 4M1TA 5JRZA 2GA8A 4Q7MB 4TN1A 1SXJA 1R4AA 3EX7C 4AY2A 4OYHA 1A2KC 3U60B 3ZGXA 1NP6A 3RABA 4DB2A 2AHOA 2ECKA 1QHNA 4PR0A 1G20E 5TVKA 3SJZA 1G16A 3IDQA 5DHFA 5F98A 2QAGB 4TLAA 3LO5A 1F2TB 4OJKA 3SC3A 3VX4A 1FNCA 5B30A 1KO5A 3A4NA 4L4UA 2FH5B 2H18A 2C5LA 2IYZA 2PEZA 4K1XA 4PSVA 1JBKA 2A30A 2IYYA 1KK1A 1UBGA 1Z08A 2VYFA 4URWR 1N6LA 2VQSA 4PAQA 1ZNXA 4AWXA 3MCAA 3H86A 4QRHA 4Q9JA 4V0MA 2GKSA 4OI4A 3MRSA 4DHEA 4URYR 4FMDB 1OGJA 1U98A 1RW4A 4DLTA 3OZXA 1M74A 4H1VA 4QG7A 2ZRNA 2JIZA 1TQDA 2Z4RA 5KNDA 1SULA 2IYVA 3ZDQA 1I7PA 1E9EA 4MYTA 4P0TA 3CXCB 1QF9A 3BXZA 4TYNA 1TUIA 2DB3A 4MITA 4JL8A 5JWHA 3AUXA 3B13B 2FWRA 3AF2A 1R0ZA 4AURA 1N5IA 1R5NA 3DMNA 1QG0A 4TMZA 3W2EA 2C99A 2H16A 1KDRA 5FUVA 3VMFA 4ACAA 1OH7A 3N5CA 3GLIA 2NQ2C 3JVVA 4IDOA 1NMYA 4NCNA 3CWQA 4DSOA 1YR9A 3T5GA 2JLYA 3U4QB 3NDPA 1XEFA 3EZ9A 5KDLA 2QEXB 1XTJA 5GJCA 2FSGA 2WICA 5BN5A 1KY3A 2ZYVX 4Q7LA 4AYXA 1UEJA 4Y7CA 5TV2A 3U3MA 1CIPA 1Q0UA 4AI6A 3IBGA 3CPJB 2JAQA 1YITB 1VCNA 4AKEA 1E2KA 2IEYA 5AUPB 3CB4A 4NDZA 4NCJA 2Z4SA 3GMTA 1N6NA 4MKHA 3QSYA 4ABYA 3GJ8A 1KJZA 1KK0A 1AZTA 4MGKR 5JCPA 4DLZA 2RKOA 4Q1DA 2IS4A 3KL4A 3U3JA 2J7PD 1JQLB 5DSZA 4LBWA 1YR8A 3S1AA 1YJNB 4FINA 1VCMA 1QDEA 1QUFA 3A37A 3W6OA 5C4MA 1E32A 1E63A 2AX4A 1G8YA 1N6PA 3TBKA 3LAWA 2YWEA 1OHHD 2J0UA 4BFVA 3NTUA 5JMTA 1I4LD 1JXOA 2J7PA 2QPTA 1SXJE 3ZJYA 4MKFA 4FMDF 1UKVY 2EFHB 1XPOA 4EIWA 1VQ9B 1FFHA 1UPTA 1W48A 2Q3HA 1R6BX 4DLSA 3W3AA 5JEDA 1KDOA 1VQNB 2XTMA 1NKTA 2R6AA 2R8RA 5P21A 1OB5A 2CLSA 1UF9A 4NTZA 2BWJA 3U44A 1UM8A 4MGZR 1N5KA 4DCSA 2FNAA 1OHHA 2XAUA 2KBFA 5FBWB 1N3BA 1KSGA 1G5TA 1GL6A 2GCOB 2IUUA 3C5HA 4BE7B 2HDNB 3SEAA 4Q9KA 4L9WA 4KLNA 5FFMA 4Z54A 1EXMA 1F2UA 4WXPA 1LTQA 2GJAA 3CW2A 3VU9B 3KJIA 3KB1A 1UBCA 1WP9A 4DDUA 1X8KA 4LHZA 3FFAA 4BLOA 2ZPTX 1QG4A 1TQ6A 2CMKA 2F3RA 4JJZA 3I56B 1EWRA 3AVQA 2BGIA 1CKEA 1SVWA 2PBRA 1JPNA 2VP5A 4PHGA 8OHMA 5H68A 1KI2A 2JATA 5BQ5A 3UK6A 1VYUA 1CXZA 3VR2A 2VPPA 4QGHA 5HE9A 1JAIA 1G18A 3E1YE 1NLYA 4NH0A 5HKKD 4YMUA 4M1OA 3SHWA 1T3HA 1GAJA 2BBSA 2XSZA 1FTSA 221PA 5SZKB 4PZLA 2ZJ5A 1FX0A 3EWSA 4F92B 4V0NA 3LW8A 1DAMA 4BPBA 4E5UA 2C2HA 1G19A 4TYQA 5GV7A
chains in the Genus database with same CATH superfamily
2A6PA 2Y2UA 1M2VA 3SVTA 1UXKA 1CQWA 4J9VA 4O4IB 3T53B 1MW8X 2YVUA 3U13A 5IHXA 3M7IA 3A8IA 1BA2A 1S3FA 4RLZA 4RZ2A 3F5FA 3GCDA 5DMHA 5IUKC 3L1UA 1V3TA 3HVUA 4FGWA 1M34A 1N9ZA 1XTKA 3GDHA 1OGYA 5HYVA 4M21A 4MWSA 3SQWA 4HADA 1IJKA 3GAFA 2EFEB 2NADA 4G1CA 1EE1A 3TIXB 2WHPB 1H4VB 5ESXA 4MYCA 5JCZA 3I9KA 1DAOA 3NGXA 5HDBB 1WBBA 2WHEA 3I9V6 1YB7A 1JWBB 1PTKA 3BZBA 4BJ1A 3NJ4A 3OEHD 4NL4H 1E3ZA 1K5PA 1SOVA 3ESQA 4DLRA 1DEHA 1YS2X 1DJMA 1K0UA 4Y2YA 4U9UA 1DTWA 2EF1A 1VSVA 4FOTA 3R44A 3BCFA 3TB6A 4ALIA 5JV5A 4RKFA 1KQFA 1AA9A 2HYDA 2O07A 4C22A 2ODNA 4QYIA 1TQ2A 3TI9A 4M76B 1X92A 2VQEB 1AOXA 2P41A 1LV7A 3H04A 3THSA 1FS5A 4HDCA 3LSTA 1YVPA 3FD8A 1UM9B 1TRKA 2YR0A 5AI9A 5FUXA 1QK5A 2V6IA 3CC8A 1XEWY 4HDOB 1RBQA 3K72B 3I1IA 4M99A 4OQLA 3C5WP 2IWHA 3WRXC 2IF0A 1QZUA 2JIRA 4J0IA 4FJ1A 2FZVA 5IJXA 2DYIA 3EASA 4WXYB 1ZVQA 2BCJQ 4GM0A 4WFQA 4NHOA 2VNSA 4WWVA 2EBHX 4Y98A 1F7VA 1PJ5A 1SPBS 1EM8B 2CNNA 2Z2IA 4I19A 1Y8ZA 1THGA 1Z36A 3GNQA 4K03A 2D59A 121PA 1J21A 3PP8A 2P4UA 3VO2A 2XWBF 4MQLA 1OILA 2Q0XA 4W7SA 1LPNA 1GUAA 1E1RA 3GFPA 4RZXA 2AH5A 3Q3HA 4TQ9A 1Y89A 2XW6A 3ILYA 3HRKA 3JVUA 4FEEA 4IGFA 2IOYA 1KMQA 4IWNA 3FMPB 3QG5A 4EB0A 2H2FA 3KZKA 2R1VA 2SNIE 3AHIA 3H13A 2F4NA 4IIDA 3FTNA 3WWEA 4YMHA 2X7XA 3W3AH 4ARVA 3C7TA 4GFDA 1D2MA 3FRJA 3GMSA 3A3KA 3KB6A 2F3QA 2X5JO 4NRDA 2NO9A 2B4QA 2HO4A 2AT1A 1D4ZA 3HUEA 1PS9A 1J5EB 5AI6A 1IVYA 1E2DA 2E4AA 3C3MA 3PGXA 2QTVB 2QDKA 2PS0A 1XL0A 3JYNA 4GUDA 4A6EA 4Q4HA 5DNDA 4KRFA 1UR5A 4YJHB 3BB3A 4BRSA 2UZIR 1W9MA 4BFSA 3FKQA 1E62A 1B74A 5KSWB 3JQBC 3OIDA 4MV4A 4N6GA 5KYXB 1L5HB 1JH9A 5CEFA 2FXVA 2D0DA 3SFVA 2XE4A 5HE8A 1SO8A 4LGMA 1M2FA 2Y77A 2I1WA 1IQRA 3AV0B 3D6UA 3E4CA 3I05A 3ML1A 2AKYA 1D2GA 3N5KA 5LQNA 1JECA 1S1CA 3ME5A 2YX1A 4MUJA 4GBMA 2J3DA 3RV3A 3U49A 4TZ0A 3QBEA 2JLRA 3UJDA 4BU0A 5FBZA 5JAQA 4BV8A 5CDHA 4TTTS 3KQKA 4AZTA 3KDSE 4NATA 5E9JA 1A8UA 1EB8A 2ZSEA 4NARA 5CFQA 4DR4B 5I47A 1KMCA 1AQNA 3SM3A 3E03A 2RKWA 4AD8A 1DSSG 4G37A 4RL4A 3I39X 3ETNA 4ZI5A 3ZV7A 1YFLA 3GGPA 3IUQA 3X44A 1FNBA 3FGPA 5BN5B 4EI7A 1BH2A 2QU8A 2OCKA 4WXMA 3EA4A 1NONA 3EZLA 1QU2A 5P8WA 2QSZA 2ZRIA 3OG9A 4RZIA 1TCBA 2DJIA 3A6ZA 3I2IA 1RU3A 1DEXA 1JRLA 2D4AA 1T2AA 2J1LA 2Z3VA 3NORA 1ZM4A 5LBIA 1LLUA 1U80A 4DBLC 5JFOA 1RFGE 4ZTZB 4LZPA 1M6WA 3WC4A 4AG6A 1O5TA 3SXUA 4BZZA 3A6DA 3SQMA 5K8JB 1WD5A 2R87A 2J3JA 3ZBQA 2O8EA 5BSMA 4OH7A 5C3MA 1QFSA 2NUPA 4ZQHA 1R0YA 2BEKA 3FWZA 5D3KA 1JR4A 4HRVA 3VZSA 3IE0A 1TJYA 5BN4B 1K28D 5BPFA 1RCTE 5MGBA 4A6DA 2FW1A 2GD6A 3OZIA 4MWCA 4DQKA 1OB0A 4FHDA 4ZT5A 2P6MA 5TGTA 3SFTA 1LQ2A 1XVLA 5JZ9A 4MPJA 3VH2A 3AVWA 2IHTA 4K2HA 4XIGS 1M5TA 2ZZGA 2YOGA 3FTPA 3PKZA 1R0KA 1E1NA 1W59A 3QVTA 5A9RA 3E0XA 3O93A 1N0WA 1OBFO 4C6TB 4HDKA 1D2NA 2W5UA 3OZUA 1M6VB 2X42A 5LZ4A 4YI3A 4N01A 2DPXA 2H2IA 4KN9S 1IQUA 2WOJA 3FOBA 4YYZA 4BE9A 5B3JC 3QEMA 5KSOA 4IVNA 4MJ3A 2H5EA 3IUJA 2H8KA 3CFYA 4D4LA 1Y3AA 2PPVA 2FU5C 1DCMA 3A1NA 3IVMA 3HKCB 4RETA 5HFNA 1GAEO 2RD2A 2VZ8A 2I66A 1N2IA 1NXVA 1N5MA 2JK0A 4KQ1A 4L3OA 2JI7A 4WI1A 2HU7A 1RYZA 4UUQA 1JFFB 2QS9A 2VO1A 3PR2B 4KPUA 2DQ4A 4MHTA 2NMVA 2Z8YM 5IDWA 1OKKA 1PYOA 1XQ9A 1R6VA 1XJQA 2D8AA 3HY4A 1U3WA 4DUGA 3ONNA 1EWKA 2LCQA 5C5CA 5JU6A 2FQWA 3A4LA 1HT0A 3PWSA 4JI6B 2WAYA 1CETA 1M1NA 1V39A 4NVRA 5DW0A 4N7MA 4LWOA 1C30A 1LVUA 3I09A 4OMFG 2IS1A 5AW7A 1J07A 2BY4A 2WRZA 3NUGA 4TQUS 2HT1A 2FOLA 4ZI2A 2XHZA 2Y6VA 5HEKA 4MK4A 3A2NA 3ZJ4A 4ZRMA 1F8GA 2ZE6A 4YK7A 2YNMC 4MVJD 4NMWA 4EG0A 3QYFA 5JS2A 2ZR7A 2FPWA 2ZWIA 3AR7A 2FETA 1QIKA 1JXQA 3GI1A 1F2DA 1GG8A 1W4RA 2ZXFA 3AXTA 5HF6A 1P2TA 2RHHA 2VTEA 1IHOA 3TK1A 1KTIA 3MQFA 1E3EA 3B3GA 3L0CA 1DC3A 1EVJA 1U3FA 2NVUB 1COZA 2BM8A 3M6LA 5C1OA 3MTEA 3INGA 4DLNA 4IIFA 4G5YA 1BCRB 1O5IA 1XTZA 1FVOA 3LY5A 3WLHA 1ECFA 1MB9A 1N25A 2HK6A 5I7RA 1YO6A 2PZFA 1EGAA 2ENUA 2O2CA 1OLUA 1P9LA 4JS0A 1D5CA 3GPDG 3ZCPA 2GHIA 1RHMA 4E70A 2AN5A 5LQCA 4JHXA 2WFLA 1OLOA 1SG6A 2POCA 4K0RA 5KNCD 1C5KA 3PYLA 2CHQA 3PFCA 2EKLA 3LCRA 3ENKA 1YWGO 2BHLA 2WMNB 4FP9A 2XITA 4BKQA 4YLYA 5LOVB 2N47A 4D82A 1W88B 2XUOA 2GCEA 3QX7A 3I5MA 3MC1A 3PXUA 3I2JA 2HA7A 4I66A 1DBWA 3JQ6A 1FUUA 1ORHA 5FJIA 5ALYA 2C5SA 3UMJA 1SU6A 5EHZA 4DMFA 2JCYA 1NYQA 1E2QA 1Z34A 5AVYA 1M2OA 3L8YA 4W4TA 3JAKB 1HZJA 2E82A 1N5LA 4JASB 4JU9A 4XX0B 4COKA 5IF3A 1MLDA 1X9GA 2HL6A 2X8BA 4DN6A 5T64A 4UDYX 2GYVA 3DV0B 4XWOA 4FHGA 1CHDA 4CKBA 3R8FA 2VCYA 3OIVA 4PRLA 5K3SA 3QHAA 4AY3A 2C7GA 4KXLA 1ADJA 3UHFA 2FDCA 1O8CA 1G9TA 2NZWA 3K7EA 2AFIB 1LJLA 4U7TB 5CT4A 3W8EA 3R5KA 4KTTE 3GRUA 3THWB 1D2HA 3LDFA 3CEAA 4JYPA 3QENA 3C3AA 3KJEA 3QY9A 3UG7A 4Z4QA 1QHHB 2DSTA 5BP7A 1D1SA 1MO5A 3EH1A 1P2DA 4DMRA 1G2PA 4MEJA 4A0GA 1TA9A 4MTLA 5JSKA 2DUUA 1KAGA 4L9RA 4YMGA 1VPWA 2VC2B 4KB5A 4OK3A 3GAAA 4RTMA 4XQFA 2GBCA 4FTWA 4KAXA 1SXGA 1Q0LA 3DKPA 3HYTA 4JT4A 4YEDA 5FJJA 1W7AA 1M33A 2YJGA 3GRYA 2QMEA 3ZWDA 2H3HA 3RQIA 3HP1A 4O2LA 1OWLA 1Q1GA 3CX4A 1N2ZA 2Q7OE 4RZSA 1CJMA 1ZXBA 4PQEA 3ZDDA 3GG9A 5CW1A 4OTZA 2OE2A 2C97A 1GPNA 3QFHA 3ANTA 3SX0A 1YIAA 3T3GA 2A9JA 2RHGB 1E5XA 2PSSA 2X9GA 4KE8A 4O4HA 4FLFA 3U1BA 1KU0A 1NW6A 2J08A 2IIVA 1SXJC 2PUJA 4NHEA 3EE6A 4QUHA 1E89A 2HU2A 4K9SA 2NZVG 1YH3A 4R8VA 2NO1A 1LFDB 2C9BA 4QDXA 1ECBA 1GVNB 1FRZA 2BFCB 3IPRA 4WVLA 3LL4A 1U02A 1DG9A 3I32A 2IYXA 5SY4A 2X0EA 4HV4A 5EP3A 3T3IA 1WCYA 2C59A 4NOKA 1QAOA 3EWAA 1I10A 4QV2A 5A8AA 2QMOA 1LLDA 3EBPA 4F91B 2IH2A 5CDGA 3PRKE 2B5OA 1AKRA 1XTTA 1N77A 5F3WB 2B4RO 3N05A 4EGJA 3N07A 2ZUFA 2G08A 3FYUB 1CP3A 1GN9A 4BNVA 2CBXA 5IYZA 1Z6ZA 1QPBA 4WK0B 2YHSA 1QYDA 1M2NA 1YI1A 1Z13A 5K8LA 2AWOA 1VHTA 2ZB7A 3FA2A 1EVIA 4IX1A 4O4JA 2JFZA 3EGCA 4HDSA 3JWIA 4TKVB 1Q0ZA 3W2IA 3COWA 3VH4A 1OYVA 3EDCA 4JLWA 4ER7A 2Q1YA 1J5XA 3BJMA 4QUJA 4ZZIA 2ZSHA 2ZJAA 1NJ2A 2NUTB 3KYBA 3SFZA 2QX6A 1JHYA 1UXOA 2OL4A 4WLOA 3FMOB 5DFAA 1AQLA 3SKBA 2GBLA 2QP3A 3OP1A 4FMPA 5TNXA 3EFEA 3FB4A 1WMAA 2BI7A 2RK6A 4C5BA 4JBWA 1NUPA 4IKEA 1JTEA 1M1YA 1P1RA 4QXQA 2E2WA 5C37A 5EJGA 3AU9A 1PV2A 2G63A 2VBGA 4N0DA 3EYAA 3AF3A 3N75A 4E30A 4LFAB 1M73E 1UD8A 3Q4GA 3EGEA 1YK0A 4J0QA 1F60A 2YJ5A 5K3DA 3LC0A 4QJ4A 4RDHA 2YV2A 2E4ZA 3A9RA 4JUDX 2UVQA 5HBGA 1BDHA 1NYRA 3VR0A 2YV3A 2IYOA 2LTAA 2L2QA 1PF7E 2Z5FA 4ZCQA 4OQEA 1XRJA 1TTHA 3HUTA 2WD7B 3GGGA 1PZEA 3O8LA 4O4LB 3VNSA 3A1SA 4IGAA 4YT8A 3W06A 1YGYA 1PDWA 2QLBA 2R00A 2QZSA 4GR4A 1A8IA 1CB0A 4NMMA 1DELA 2SICE 3ANSA 2P9HA 2YIDA 5CHEA 5LA6A 4DA6A 1GTL1 4PC3A 4OP3A 4GEGA 2PLAA 1J23A 1X7YB 2GFHA 2R6FA 1I7LA 2RHWA 3V55A 1P44A 2JD1A 2OCIA 2YZ2A 4TXMA 4MARA 4BXOB 1QWSA 1WR8A 2QRVA 4F2PA 2Q2OA 3CCRB 4E07A 3VO8A 2DY0A 3DL2A 4LJRA 5GIPE 5IJZA 3CO5A 2JAHA 3T9DA 4FB5A 2G0AA 3LKDA 4AO7A 4JGBA 4LUCA 5SZJA 4OXQA 2QEQA 5TQ2A 4V24A 1DC5A 3AGQA 3MJ4A 4U6SA 4DRZA 1PJ3A 3UXHA 2ZIVB 1KJNA 5LBTA 5JAIA 2PJRA 2O2SA 2QE6A 1ETHA 1ZUD1 4TV8F 4EA9A 1W34A 2DPYA 4YRIA 3EPJA 1FB5A 4NBWA 4J16A 2GD1O 4M9QA 1D5WA 1IBRA 5FI3A 4C4TA 4HAZA 1JQKA 2RCYA 1YA8A 1IUPA 3CP2A 1RPAA 1W19A 2BCGY 4PYJA 1UJ2A 2CVZA 3GRZA 4N3AA 4XARA 4I9HA 3K71B 4HT3B 2DWCA 2IU6A 4NCKA 2BSAA 1ZJ6A 3L4EA 3NBFA 1RAAA 3ZZ0A 1C0PA 1K7YA 5FLKA 5EESA 2HA3A 2Z56A 3U0BA 4DV0B 1Y0YA 4CMBA 2RGXA 2I8AA 2MSEB 2E4UA 2C5FA 3DMGA 1QVGB 1DBIA 1LX7A 2C95A 4FW8A 1PJCA 2P9EA 4E0FA 4QJ5A 4EY7A 2FLWA 1CQPA 3GVKA 5K3FB 3WVNA 4BCDA 3ICPA 2ISQA 2WPDA 3Q9LA 5BT9A 2UZAA 3AKDA 4PS0A 3RKUA 4XN3A 3MTQA 3IAHA 1SQ0A 2I4OA 2QGZA 4TS3A 5K8TA 3NEJA 1VE7A 3FAKA 4PZZA 1Y33E 1JTFA 2WMYA 4J7XA 1GGJA 8AT1A 2VF2A 1HDIA 2VDWB 3AUFA 2OFFA 2HCJB 1B7GO 3L4JA 1H23A 2FEAA 4R0NA 5B2EA 2HPHA 1OA1A 1A2OA 3L8EA 3ROGA 1H4QA 4JEUA 4WH0A 4JSTA 3BMOB 1JB1A 2DUWA 2G9QA 3FE2A 5K4HA 3ZVMA 1NXTA 4YDHB 1FYVA 4U4AA 4QPNA 2UYQA 2ZL5A 3JWGA 3JU4A 2IP4A 4LDPA 3VPHA 5EP1A 1G41A 4BIMA 5IP5A 2JFNA 4KRYA 4EHNA 3VR6A 1A76A 4LF4B 4LQCA 3IPLA 3CC2B 2CT8A 1OI2A 3NRCA 1WM1A 1PJ8A 4H16A 3LSYA 3V2HA 3MELA 3EQ6A 5AD1A 3ZE7A 1RJGA 2VCEA 1E2GA 2BGWA 5KMGB 1QYVA 3EZYA 3O4IA 3A0RB 3WL5A 2OYSA 5CIQA 4D6PA 1OROA 3CN7A 4BQSA 4K6GA 4ID9A 2QAJA 5G1NA 1BCSB 2RC5A 4JQYA 3QU7A 4CMIB 1VC2A 4DM3A 1GFSA 1L3IA 3PPYA 3CB2A 4YFVA 1KJQA 3N28A 1I7QB 5JECA 3CZ5A 2V3WA 3K9GA 4LK3A 1WVIA 2PX3A 4TXNA 1MAUA 1WHTB 4TYYA 1JLMA 1P0PA 3LX5A 4HWPA 1DIHA 1MJ5A 3ZLVA 4GR5A 4OLHA 4WKNA 2QN7A 5JS6A 3OIUA 4KACA 3PE3A 4Z4EA 1J9ZA 2BKEA 1H8EA 1LS6A 1Z4NA 3WK7A 5DI3A 4GOOD 3GLUA 3F6RA 2OC9A 1YHQB 1SJ9A 4F2WA 4MI6A 3KUUA 4ADSG 2OB1A 4MIKA 2L19A 3MN1A 1WETA 2EKBA 4RK7A 1Z63A 2W2NA 4I99A 3GEHA 4WEOA 2ZRKA 3P2IA 3QW2A 2NUAA 2WJ4A 3Q72A 1KRWA 1G4AE 3N6VA 3WHIA 1PWEA 5J4YA 3L41A 1CX9B 2YC4C 3DD5A 3HS3A 3NYIA 4H1TA 4RS4A 3L0BA 1C1HA 5CB4F 5CT9A 3P9SA 4YGYA 4PZYA 4O02B 3BSSA 1U3TA 3EGIA 5L3ZA 2MHCA 1UPAA 1U4OA 2A57A 3TSYA 2O5VA 4GKVA 1CD5A 5SY9A 4XYGA 5FNVF 3A8JA 4GOXA 3QWAA 3HFJA 1IH8A 2UAGA 3T3MB 5IAGA 2XKAA 3DBOB 1E64A 3BQMB 3TRHA 2FZWA 4ZP1A 3VXKA 4CV3A 2SCUA 2WYWA 3UC5A 2AUTA 3QSGA 2P40A 1HE2A 4G5OA 4Q1AA 5F21A 4C21A 3K8ZA 3MQ4A 1QDLB 5K0JA 3RG2A 3MD0A 4LRWA 3FTFA 2Z4TA 1E3SA 1IN7A 2QN9A 5L51A 3ZZMA 1BFUA 1U8UA 1XHFA 2O3QA 3U9LA 1XBTA 3QG1A 4CMEA 1YZTA 5KSYA 1CT9A 4P92A 4N76A 3QXJA 3KR1A 3WJ1A 4GRIA 1Y9JA 1FFCA 2GA9A 4HAUA 4MWGA 4Y1RB 1YB4A 4D44A 5C8VA 5IVPA 5KBYA 4LBZA 1KEKA 2QPOA 5DM4A 2ZI7A 1GSIA 1NN5A 1T1RA 1XAHA 2H48A 4ZT7A 3ZE9A 4DABA 4CMEC 2ZM6B 2IV7A 1DRKA 2Y0DA 4YMVA 3E9RA 3G6KA 4GDFA 3OPYI 4GXRA 2EEZA 3F5MA 3P0JA 4FDAA 3WSWA 1WDLA 3QJ5A 5L6MB 1XJWA 4D3SA 2O8CB 4J43A 1YOVB 2IX3A 1L4GA 1V26A 1Z2EA 3OPYB 1ZP6A 2XGSA 2WSMA 3PXBA 3T7CA 4PTLA 4Y9UA 4DDHA 4M9RA 3WA7A 2ZVDA 4FZRA 1IY0A 5HSGA 1MIOA 1DQNA 4EYOA 1NDHA 2V5VA 3ADOA 4B0PA 1PAUA 2JFUA 2QENA 3CBQA 5JWOA 1STOA 1MC1A 3BB4A 4OQMA 5JBQA 3ZE6A 2OT3B 5AT1A 2EFCB 1K9SA 3D4IA 4YRJA 1LJ8A 3PC7A 3HY6A 3VAAA 1UDXA 2Y0CA 4P36A 3VR6H 3H05A 4X9XA 2X22A 1GQOA 3K9FC 1OD6A 5KTMA 4JYZA 5FOVA 4CGYA 5AJUA 1ZU5A 3F7MA 1NNUA 3LF1A 1QV9A 1FEZA 4I55A 9ABPA 1KOLA 4PLVA 2C7RA 1QK3A 1P33A 4C0JA 2II6A 4K9KA 4RFVA 5B37A 4RJJA 4W5HA 5BORA 2Q3FA 1SOUA 3P20A 3LA8A 2XF8A 1XVIA 3DE3X 3LOPA 4QUDA 5FP0A 4WE3A 3RRNA 2F8LA 4GQNA 2V03A 3VTZA 1HNWB 2O8BB 2X8WA 4HC4A 1M10A 1Q19A 1NJ5A 4LDZA 5WRFA 3TNDA 3DOJA 3GQBB 3HRHA 3X1ZA 4BP8A 4E5VA 3UUWA 3FBTA 3N8IA 4LWQA 3Q98A 4PFSA 4HMOA 2WWVD 4EMTA 3LQQA 3TUZC 4KX5A 1UC8A 4RH0A 3TCNA 3A14A 1EFTA 3TXXA 3LDUA 3CNOA 5CFPA 5B1EA 1U2SA 1GRVA 4DIUA 1T9ZA 3OKXA 1W1WA 4OCZA 4TLLB 4WASA 4DLVA 1D0SA 4N4AA 3UA3A 2VDOB 1RAHA 5CVVA 3EIHA 3STTA 5KW9A 5B7GA 3AUKA 3JYOA 3OEEA 5KU1A 2DCUA 3M4JA 3KB8A 4NAUA 1SZPA 3OE7D 5FRDA 4F9GA 4JI3B 1U28A 3H2HA 2CL5A 1SWVA 1I5OA 4JLNA 4KMSA 1I18A 4PYRA 1SG9A 2EQ5A 4BZWA 3J7AC 3CLVA 5F7OA 2Z83A 1WP4A 3SZOA 4B75A 1K4YA 3Q9SA 3BWMA 2MYTA 3OLWA 3A4TA 3D9QX 1SC6A 3V4RA 1VHLA 1XKXA 1V8OA 4KL8S 1XMPA 2B4TO 2X9LA 4UUBA 5DLPA 5GONA 5AW9A 4Z4ZA 1Q84A 1GDHA 1XKLA 3LVQE 4INJA 4WUVA 4R69A 2FW8A 2GBPA 1OTHA 3S2ZA 4EUSA 1AMOA 2ODWA 4RANA 3TN7A 3CLUD 3CUEF 2A9VA 4MO2A 2W70A 2QRNA 3PQ8A 3BZUA 3AHHA 1F0KA 3BX1A 3MCWA 4KU4A 3W6PA 1J25A 1ADBA 2Q6TA 5G0WA 3A3NA 1E4VA 4UREA 3VR1A 3KZ1E 1M7GA 1A27A 1ODFA 4KKSA 1OLXB 2HUPA 2OILA 2WNIA 3GJ4A 3I73A 2FPGB 3KCNA 4QJIA 3RM3A 4EFDA 5JG7A 4AJIA 1OFIA 4F86A 2BFBB 1Q1ZA 1VHEA 4MUMA 5EKXA 3CRQA 3L40A 2PUBA 2VP0A 2AFHB 3IQFA 1TT5B 4NLLA 2XNDA 2OBFA 3H6GA 3ZJ5A 4X90A 1EK2A 1NU8A 1BZYA 1VSQA 3IQHX 3LS2A 1V25A 1J2JA 3TLXA 1G7RA 4CMKA 2QM3A 2CL7X 3AT1A 3DBRA 4RM3A 5E6RA 1JJVA 4JCCA 1ITZA 3SKXA 4EO9A 4XUEA 3SY8A 2R2AA 3H11A 3T3DA 2WAXA 4WOJA 5ARCA 5A4AA 1DC6A 2NZYA 3I6BA 2IC5A 3IBCA 4BNWA 5BNWA 1IM2A 5BWBA 5IUNC 5DLQC 5ALRA 5GJBA 4CIDA 4F11A 2QAGC 5TJHA 3T12A 4L51A 2H08A 1XYGA 5ELXA 3WIBA 1JV2B 2FGKA 2EWMA 1V45E 3OY2A 5KVQA 2OBMA 5BR7A 5ICCA 2YIVX 4PAGA 2QLFA 1BHJA 4DJ5X 3SKVA 1U8ZA 4YQZA 4Z7QB 5ANRB 2H6EA 3M4XA 4G5XA 4NBUA 3PQ2A 1Y3HA 3NBXX 3NTXA 4QYXA 3CLSD 4Z0PA 1RC0A 1CY7A 2PX2A 3B70A 1V5VA 1SA0A 3BFVA 4FK8A 3DEAA 4MWOA 3UJAA 4DT1A 5I51A 4AKIA 2FUCA 1N2BA 4L28A 5M3BA 5IYPA 4M87A 5LFAA 3GJ3A 4MR7A 3ECCA 2K4MA 4U2BA 2PWAA 1Z68A 3ORQA 4ZU1X 5I7VA 1OSNA 1RWXA 1U9IC 1RZVA 3M5CA 2PJUA 2BGKA 3AY3A 1M34E 1T15A 5CU7A 1M8PA 1NVFA 4BFWA 1A4RA 1GD1O 3D7RA 4BNIA 2GPAA 4BO0A 1COWA 3SF8B 4EHAA 5FORA 3E81A 2CJXA 2CE2X 2H2AA 1AC5A 1H0SA 1Z0KA 1JE1A 4IH4A 2WB2A 5EUQB 1XZHA 2X40A 4LV5B 5DNWA 2ACWA 4ZI3A 1O94A 3F90A 4BASA 4MAFA 3ENWA 2W4MA 3ETHA 4KGXA 2IS6A 1BFDA 1W2BB 4P83A 2PZ8A 4LE0A 4IXDA 5TXGA 4XLEA 2WW8A 3BGOS 4LPKA 2QMQA 3CTPA 5A6SA 1NQVA 2J33A 3B52X 4G81A 1DKOA 2XY4A 1Y3BE 2GEFA 2VHZA 2AMYA 2I33A 1RIFA 4ENRA 5M5BA 1TIPA 1A9XB 2Y1FA 4N8SA 1CBUA 5MFZA 2H1OA 4LJ7A 1Y7TA 1MT0A 2JFQA 4PQRA 1QR6A 2ZIXB 3QFCA 4UATA 3AHEA 3DBHA 3QA3E 4LDNA 1V9LA 4NYJR 2ZJ4A 1ATZA 5A3QA 1ST2A 3UWKA 1XV5A 1NLUA 1AN0A 1BFKA 3E58A 3LDAA 4V39A 5LYJF 2UXCB 3OWOA 2QD1A 5K6AA 5BVHB 5AW0A 2X6WA 2CUNA 3OTWA 1GZDA 4L75A 1JR2A 1C9JA 3QOXA 4JQZA 3JV7A 4CXMA 2DQYA 3AR4A 4AJKA 4JXJA 3EXAA 1HQDA 4WN9B 4EY4A 4OPSA 5T8KC 1E3IA 3KSUA 5SY6A 3SZLA 3VKVA 4OJTA 4HE5A 2FDXA 3L0ZA 1WB6A 3VI4B 3CW8X 4CL2A 4FWIB 5TPZD 4NAHA 1LWNA 1JHZA 5L4LA 3OCUA 1T3ZA 4DRYA 4J0JA 5KNBA 1MOZA 2WVJA 3S3TA 5DLYA 3W1VA 4KV9A 4MLCA 2J0QA 1FMJA 1VYTA 1FDWA 3VHLB 1CC1S 2HXYA 3WYEA 3E9CA 3B48A 5K3BA 2V7PA 1R15A 2IEIA 2J9FB 4IDEA 2ZSDA 3E27A 5IARA 4A8TA 3NRBA 2X0JA 4ESHA 2GVDC 2O7VA 2OBYA 1ANKA 1E6KA 3EGXB 4QG3A 2ZBDA 2XE6A 4YR9A 3FUTA 3WAKA 1Q6ZA 4KITB 3ZGLA 3D8BA 3DTNA 3S68A 3OMLA 1VIMA 3SS8A 3DLBA 4N7BA 1QH8B 2CV0A 5C5IA 4ROXA 1CY1A 3M0EA 3O31A 1ONSA 1HQYE 1CJSA 2Q6OA 2C88A 2PZKA 2I8CA 5LLTA 4RHFA 1EP1B 5EMMA 1BTOA 3N0VA 4NAVA 1A1SA 3HXKA 1GGEA 1CDZA 5H83A 2NV2B 1JEJA 1II8A 3SQDA 4N5LA 3KFLA 3TDNA 2OFXA 3SLNA 3ZY2A 2FMUA 2RSLA 1V11A 4CN8A 4LF8B 1FDUA 4LCBA 1NY6A 4MLDA 2ZKLA 4E1AA 1Q1QA 1VIDA 3O9VA 4NV0A 4F3YA 4UTPA 4BNFA 2IT1A 2HGZA 2VQ6A 4P6VF 4Q1CA 2AMLA 2ABWA 1W5TA 3G5MA 4HGPA 4MYSA 2XYRA 2FKNA 2AF4C 2REQB 1GUBA 1OF1A 3TS1A 4O08A 3CSDA 3OUZA 1XE1A 1L7DA 2JHAA 2Y67A 4G07A 3D3QA 5AR1A 1M5UA 4BQFA 3TLKA 2R86A 3O9ZA 3KEQA 3G7SA 4I5DA 3QOWA 2BUBA 3SYRA 2PT9A 4B83A 3IEUA 3NO4A 4AG3A 4MAMA 2J67A 5HJ7A 2ZUCA 4XVUA 1HG0A 4ROSA 3M1YA 5I7UA 2YWGA 2B8WA 3OCXA 3UN1A 5LQKA 1Z5NA 1EHIA 3S29A 4FGJA 2ZROA 3Q6IA 2HT6A 3AEQB 4FFPA 3CKLA 5C1IA 3T38A 5FBVB 1D2AA 2C1XA 3RLIA 3MCTA 3RYHA 2D5CA 5KOYA 1AZLA 4CT0A 4AMBA 4MDEA 1QTNA 4XSHA 4A8JA 1F4VA 4PO3X 4QUGA 3OZSA 4QBHA 1GPBA 4MCIA 6REQA 3IUEA 4BB5A 3COZA 1RI3A 5ITZA 2OBSA 1G1MA 1SPXA 1KHHA 1D8AA 2A33A 3A05A 4V1CA 2G4VA 5AVSA 3AM4A 3PFNA 1TJ3A 3IQWA 3EDMA 2O8DA 2AJDA 2WWHA 2HEGA 1KOGA 1O97C 2QT1A 3L0YA 1VL1A 3V8EA 4H3SA 2PV0A 2QUJA 3AKEA 1XT6A 4IXNA 2XUQA 3M1IA 4LJ8A 3VYUB 1JEAA 3GMIA 1V7PC 2JRLA 2QLMA 4C04A 5I7SA 5KHLB 3GLGB 1PEAA 2UYOA 5JAZA 2F4VB 1YNOA 3H1GA 3IHWA 3CLKA 3MWEB 4RSMA 3MXTA 1RXCA 1FVFA 2HU5A 1ZOOA 4QHTA 4J2OA 4UNQA 4ZPJA 4EPTA 1FXWF 4NBLA 2B1RA 1SBZA 3SX4A 4ZOLF 2PUEA 2ONYA 2YWXA 1C1DB 3MNFA 1LPOA 4D79A 4KZPA 3MPOA 1Z2OX 3K0FB 1MO2A 5ERGB 1M8GA 2GBFA 1DJOA 4MV5A 2XRZA 3LKVA 1I0ZA 5F1OA 2JJYA 5B5SA 4MCHA 4LXQA 5CJPA 1BVRA 2FSUA 3OI7A 1WU7A 3G2NA 2ZYIA 4BBAA 3CF2A 2ZKIA 4GGPA 3I62A 2A86A 3VH1A 2FMHA 1ZCJA 2OC4A 3JWJA 4R54A 2ZYDA 2IHBA 1BXKA 1CUHA 2HPVA 3GZTB 4CF6A 4N41A 4L5YA 1YJ9B 4C0WA 2WYUA 3DOHA 4MZXA 4ZAFA 2Q3MA 3K9BA 5DNVA 4CR8A 1YUBA 1SHJA 2LUOA 4MRMA 3RV4A 1RPTA 3JAWB 1T2FA 5KNBH 3FWYA 1O9HA 1WZNA 3JARA 2G0NA 1T2VA 1T1SA 2DKNA 3FPEA 3ITEA 1VL6A 2ON6A 4NZYA 3RHTA 4F9TA 3ORFA 1SQGA 2FUG1 3FPSA 3OE4A 3VSCA 1KWKA 2X53S 3V42A 1OYOA 3PZBA 4WBNA 1I0LA 2HBQA 3Q2IA 4A0FA 4LNUA 4WCFA 3AEZA 4C7JA 5FWDA 4EO4A 1G5QA 1QFMA 3CF0A 4HWRA 1RPZA 4YFYA 1GSAA 1GTMA 1OX5A 4FE3A 4AMYA 1V7QA 3FTQA 2CNWD 3E8SA 1VE5A 1T9DA 2B4YA 2FCRA 1M7BA 1H2XA 2G5GX 2VEDA 3KR9A 4G4SO 4MR9A 4IV8A 4IF4A 2YL2A 2NU7A 3G2MA 2A9OA 2XVMA 4DEYA 3F9RA 2AYXA 2EVWX 1AXRA 1K9MD 2Q21A 3H97A 2P8JA 4U39A 3ACDA 1LLCA 3K20A 3VPXA 1UADA 1TAGA 4Q4AA 1AGXA 4LMRA 4RPLA 3FFXA 4FJ0A 3QV1A 4GXQA 4Z2YA 3NAMA 3TNYA 3VU0A 4YYEA 4ETMA 4QU9A 3OFSA 1AKYA 2WWWA 4YUWA 1GZUA 1X0XA 1N3YA 4YCLA 4HXEB 1AK9A 2GJ4A 1CY6A 1ICIA 5KYUA 3HZOA 4HX2A 1SFRA 4TKUA 1USIA 4BEJA 2BFDB 3H42B 4EDFA 4PR3A 4FM9A 2OCLA 4ITUA 5K0GA 1E1MA 3PC4A 5A5GA 3KVRA 2HMYB 1EU1A 2VOEA 3P9ZA 1T10A 2X2PA 1VQ5B 3QVXA 1P4GA 4YLGA 3R6GA 5HFJA 1XZBA 4D0RA 3RADC 5IJWA 1GZ6A 3CTAA 5E8RA 4GH5A 1C8KA 3EGVA 1QGDA 4M1KA 3R3YA 4O2AA 1MVOA 1D0VA 2IXAA 3KQSA 4CKEB 1QB7A 3I12A 3A1CA 4MQ5A 3WJ2A