3KL9A

Crystal structure of pepa from streptococcus pneumoniae
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
355
structure length
340
Chain Sequence
SMTTLFSKIKEVTELAAVSGHEAPVRAYLREKLTPHVDEVVTDGLGGIFGIKHSEAVDAPRVLVASHMDEVGFMVSEIKPDGTFRVVEIGGWNPMVVSSQRFKLLTRDGHEIPVISGPAIADIVFDGGFADKAEAESFGIRPGDTIVPDSSAILTANEKNIISKAWDNRYGVLMVSELAEALSGQKLGNELYLGSNVQEEVGLRGAHTSTTKFDPEVFLAVDCSPAGDVYGGQGKIGDGTLIRFYDPGHLLLPGMKDFLLTTAEEAGIKYQYYCGKGGTDAGAAHLKNGGVPSTTIGVCARYIHSHQTLYAMDDFLEAQAFLQALVKKLDRSTVDLIKHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl aminopeptidase
publication title Structural basis for the substrate specificity of PepA from Streptococcus pneumoniae, a dodecameric tetrahedral protease
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 107
structure length 340
sequence length 355
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.7: Glutamyl aminopeptidase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3kl9A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kl9A01
4Z65A 3PBBA 3WC6A 1YLOA 2EWBA 1H8LA 5D29A 2ZELA 4MHPA 1AMPA 5JGFA 2AFUA 4R8FA 4X8IA 2ZEEA 1M4LA 2F8HA 1VHOA 5LRJA 1HDUA 3IIBA 1Q7LA 1ELLP 3PFEA 2PJ3A 4FBEA 1LANA 1XRYA 4IHMA 2VL1A 1CX8A 1VHEA 4KSIA 4MCRA 5HVFA 2ABZA 4NGMA 3D7DA 5I4MA 2AFOA 3WABA 5K8PA 1F57A 4P4EA 3LMSA 2GLJA 3DLJA 2CIJA 2AFMA 4YU9A 1TKJA 3FVLA 4UEEA 4X3RA 4OMEA 4JYWA 2PJ2A 4UIAA 4DUKA 2FVGA 2AFXA 4MCPA 3PB8X 2CTCA 3B7IA 4ZY2A 4K3NA 1QMUA 4A38A 4OC4A 1YW6A 2GREA 4OIWA 4UF4A 1IGBA 2Q43A 5DS0A 1R3NA 3WC7A 1QQ9A 4LQGA 3S9LA 3PFOA 4FAIA 1ZG8A 2GU2A 3NFZA 2O53A 4MHYA 3GLJA 1Z5RA 1ZLHA 4MXUA 2HC9A 2JEWA 3I1UA 3NH5A 2IQ6A 2ZEPA 2V77A 2G9DA 4P45A 2ZEOA 4MHNA 3LWUA 1PCAA 5LYFA 3HLPA 1XFOA 2AFWA 2DEAA 2EK8A 3JRUA 4IAVA 2CTBA 3IEHA 2C6GA 7CPAA 1FT7A 2V8DA 4R6TA 5HVGA 4UEFA 3BHXA 1DTDA 3CT9A 4NJRA 4TWEA 3IWWA 4OC5A 2RB7A 4ZX8A 1PYTB 2ZEDA 1LOKA 2QVPA 1HEEA 3GUXA 1F2OA 2XEJA 4Q7AA 3IJ3A 4OP4A 4DYOA 4EMEA 3RBUA 1LCPA 1TKHA 4UIBA 4TNUA 5LRKA 4NGRA 4JZ0A 5K8NA 2C1CA 3V7ZA 1R43A 4NGQA 3VH9A 3BI0A 3RZAA 4MCSA 4PPZA 3D7HA 1FNOA 1ZLIA 3B35A 3WT4A 2PRQA 4PXDA 2PJ9A 2AFZA 5F09A 3VATA 2I3CA 3KGQA 5J1QA 2C6CA 4R76A 3TX8A 3FEEA 4P44A 1VGYA 4DJLA 1EE3P 1VIXA 3PB9X 4NGSA 5D8NA 4IK2A 3D68A 4FWUA 3D66A 3FX6A 2XEIA 3D7GA 3B3VA 3PB4X 3PBEA 2PJ1A 3B3CA 5K8MA 1BPNA 3D67A 2Q51A 3FMCA 1ELMP 2C6PA 2QJ8A 2HB6A 2PJ0A 1TF8A 4P4DA 4MRIA 1XMBA 1CBXA 2PJ7A 3PEIA 2CF4A 1F2PA 3TC8A 4O23A 1Y7EA 2ZEMA 4F9UA 3FEDA 4W9YA 3FH4A 1BPMA 4NGNA 3N5FA 3BI1A 3KR4A 2F7VA 1RTQA 1AYEA 2PJCA 1TKFA 3KHZA 3K9TA 1IY7A 1ARLA 4ZX9A 2PJBA 2ZOGA 3KHXA 1CG2A 1HDQA 4OC2A 6CPAA 1NSAA 4OKOA 1CP7A 1LAPA 3KI9A 4ONWA 4MMOA 4P4JA 2AFSA 1BLLE 4EWTA 3FF3A 4R7MA 1CPXA 1ARMA 2EK9A 5CPAA 5LYDA 1KWMA 2RFHA 4F9VA 4RUHA 3KQZA 3DGVA 1ZG9A 1YMEA 4G1PA 2ZEGA 5IB9A 1DE4C 3SJGA 1JQGA 2Q4ZA 2PVVA 3MRUA 2POKA 3KASA 4X2TA 4YWYA 5THWA 3B3TA 2PJ8A 3SJEA 4P6YA 2BO9A 5LYLA 3FJUA 4OC1A 4F8ZA 1TXRA 3SI2A 1GYTA 4AXVA 4CPAA 1CPSA 1Y0YA 3IO1A 4ZI6A 5CBMA 3ISXA 3NH4A 3GB0A 3H8GA 3KL9A 3B3SA 3VARA 3T8WA 1BAVA 4NJQA 1Y0RA 3FECA 3CDXA 2QYVA 2NYQA 1XBUA 4A94A 3H8FA 3KZWA 3PRTA 3KQXA 4MHZA 2JBJA 2OR4A 4UEZA 3SI1A 3D7FA 5HVHA 5ELYA 4NGTA 4ZY1A 1YW4A 3H8EA 4NFRA 4P4BA 2J9AA 3CPXA 2IMOA 3B2YA 3V38A 3NA6A 4GM5A 4OIDA 1ZG7A 1Z2LA 2PIYA 2ZOFA 4EFDA 2V8HA 2PE3A 2PIZA 1CP6A 2ANPA 1YSJA 2PCUA 3SI0A 2BCOA 2BOAA 2NSMA 5HXDA 2XEFA 4OC0A 5JM6A 2PVWA 1TF9A 3BXMA 3SJFA 4PQAA 4P4FA 2GLFA 4ZYQA 4MCQA 3PB6X 1UWYA 1LAMA 4WWVA 3NH8A 3WC5A 4ZY0A 2XEGA 1OBRA 2OOTA 3S9MA 1Z8LA 3SJXA 2ZEHA 4BD9A 4A39A 2O4HA 3RAMA 2ZENA 3PB7X 3IC1A 2V8VA 1LFWA 4A37A 3L2NA 4PXCA 3ISZA 4WJBA 2V8GA 3HUVA 4P4IA 4NGPA 4FUUA 2WZNA 3B3WA 2WYRA 3S9NA 3CPAA 2IJZA 2PJ4A 5JH9A 2PJAA 3QNVA 4H2KA 5LRGA 4PXBA 4OC3A 2PJ6A 4B6ZA 5K8OA 4PXEA 3IFEA 3D4UA 2ZEFA 3K2KA 5LYIA 8CPAA 1XJOA 2PJ5A 3KR5A 3MN8A 2JBKA 4P10A
chains in the Genus database with same CATH superfamily
4Z65A 3W2FA 2GFQA 5B6IA 4UBRA 1H8LA 4QB9A 1UD5A 5JGFA 3QFCA 5IYPA 3CTAA 2F8HA 4ONUA 5LRJA 1ELLP 4X0CA 1FNBA 4L89A 4MCRA 4PC3A 4P4EA 3EC4A 4Q36A 4M2LA 5IK2A 2YWFA 3LACA 4YU9A 5FIUA 4KOSA 3Q3AA 2R98A 4OMEA 1YITB 2PJ2A 5DWNA 1JWQA 3W2EA 2FVGA 4OOVA 3BH4A 2ZTNA 4MCPA 1I21A 4G1BA 3PB8X 2CTCA 3B7IA 4MFKA 1QMUA 2GPJA 4OOSA 4MFPA 4OC4A 3R96A 4U9YA 4OIWA 3TO7A 4GQNA 4H6UA 3CXSA 3CD6B 1G7SA 3PFOA 1ZG8A 2HCJB 5EMNA 3A3GA 1PU9A 3GLJA 2J8MA 4P2NA 1ZLHA 4MXUA 4IF5A 3SJPA 1BX1A 2ZEOA 4M6HA 4KUBA 3ZJ0A 2PC1A 1TVCA 2PIAA 3A35A 2DETA 1EFTA 1IYKA 3G05A 4IAVA 2FS5A 1NJID 3CCQB 2C6GA 4ZGNB 1D1NA 1X10A 4ZCLA 1DARA 2Z3LA 4LC0A 1I8DA 1VQ6B 4RDJA 1Q7YD 3BHXA 4WZTA 1GAQA 3JQPA 4R57A 3A3BA 4TWEA 3R1KA 5CNPA 1XEBA 2RB7A 4C7HA 1WK4A 2ZEDA 3R6JA 1B2RA 3OEHA 2WR8A 5F46A 2CY2A 4UWJA 2PDOA 2QVPA 1JNYA 5IB0A 2JIZA 3E20A 1F2OA 4P25A 1OB2A 4OAEA 4KOXA 3T90A 1UD6A 3QE2A 3TE4A 2C5HA 3IWGA 2GANA 2PRBA 1LCPA 1TKHA 4UIBA 2DERA 1AIPA 4NGRA 2C1CA 1R43A 3BI0A 4II3A 4MCSA 1BOBA 4OP7A 4PPZA 4QVTA 2OU2A 2CNSA 4Z4VA 3JTKA 1EP2B 2PJ9A 1OGIA 2AFZA 3VATA 3GKRA 1DDIA 3KGQA 4KLWA 2C4UA 4CS0B 1S7FA 3S6FA 4N3NA 4DJLA 4H89A 3OP1A 1EE3P 2EUIA 1VIXA 4M3SA 3U6BA 4YFJA 3PB9X 4PC6A 4NGSA 2CBXA 2B4BA 4FWUA 3S6KA 3B3VA 3OZUA 4XPKA 1YGHA 3ASTA 4Z1MA 2J8RA 1VQNB 5K8MA 2QIRA 2BF4A 4UCMA 1M90D 2Q51A 2XGJA 2X3UA 1ELMP 2PJ0A 3FPPA 1U2RA 3ONUA 4XONA 1RO5A 2PJ7A 4JXQA 2CF4A 3FB3A 1VQ7B 4G5GA 4Z4UA 4W9YA 3FH4A 1BPMA 3N5FA 1ZM9A 2F7VA 5H86A 4KKSA 4OOXA 1TKFA 2Z11A 3CCEB 1TTTA 3OE7A 1IY7A 4B14A 1ARLA 1WDTA 2WPWA 2HUZA 2D4PA 3TT2A 4TSFA 3T56B 3GYAA 5HMNA 1HDQA 4OC2A 1NSAA 2FIWA 1CP7A 3BJ7A 4CAEA 4XLFA 4R7MA 3JQRA 4KORA 1CNEA 2EO8A 1CPXA 1W9XA 5CPAA 4B47A 1KWMA 3H4QA 1IOFA 4PC2A 2RFHA 3SLDA 2Q0YA 4F9VA 3KQZA 1NDHA 5KNLA 1KUVA 1EP1B 4R3KA 2P3MA 4KOWA 1VJSA 4HNWB 1DE4C 4P22A 3SJGA 1JQGA 1S3ZA 1N0VC 2POKA 4X2TA 4YWYA 3SJEA 4AVAA 2JEVA 2BO9A 4OC1A 4KKUA 3SI2A 3S6GA 4CPAA 1F20A 1CPSA 4PK2A 1Y0YA 2FE7A 3CC2B 4KKTA 3KL9A 2VNJA 1BAVA 1S7NA 1IIDA 2G0BA 1Y0RA 4LBZA 5FO1A 4RI1A 3ZZTA 4AG7A 1SKQA 2R9VA 4A94A 3H8FA 4FD7A 1SKYB 2AJ6A 2HV2A 1KK0A 4NCNA 1IYLA 4OPOA 2QMLA 4NGTA 2F43A 3UY5A 2WJVA 4LQ6A 1H42A 1BLIA 4XOPA 2DEUA 3OKXA 4Y9UA 3T9YA 2J9AA 3CPXA 2IMOA 4A30A 2B3VA 4XR6A 3AVXA 1BQEA 2PIYA 3AGQA 4DQKA 3ZIAA 1VQLB 2ZOFA 3D2MA 2VQYA 2Q4YA 4OPSA 4RDKA 3SI0A 3G8WA 2NSMA 3P2FA 2ZW6A 5H84A 1M4GA 2PVWA 3SJFA 2Q44A 3DDDA 3OZVA 1GVHA 4P4FA 3CRZA 2GLFA 4ZYQA 4MCQA 2ZBUA 1UWYA 2VBUA 4WWVA 1ZM2A 3PUNA 1OB0A 4RD1A 3CB4A 4CYQA 2YNDA 1G7TA 2OOTA 2OBTA 1Y9WA 4TT3A 1JA1A 3IC1A 5E6TA 4YAFA 1QVGB 1E63A 3FKSA 4M4SA 3SKBA 4DNTB 4QC6A 3CXQA 1FNMA 3L2NA 3SXOA 4X7DA 4LUAA 3HUVA 4CGNA 1QVFB 5AG4A 2ZPAA 3BJ8A 1BX0A 4QUZA 2EFGA 2V4DA 2VYQA 5FA6A 4XMYA 5JH9A 4C0SA 1QSTA 2BSWA 2PJAA 5TY0A 4XPLA 3CC7B 2ATRA 2V7XA 4B6ZA 4QBJA 4AB7A 5J3OA 2ZEFA 5LYIA 1QGAA 1E43A 4ZGYB 1M1DA 3PBBA 2JLMA 3G4SB 3K9UA 2O28A 1XOVA 5D29A 4QVJA 4HIZA 3PUMA 3B78A 2AFUA 2GJKA 4P9SA 3CCLB 1GAWA 1PJ7A 2X53S 3E1YE 4RS2A 1Q7LA 3PFEA 2NV4A 4YAUA 2ABZA 3AVVA 3OW7A 1U6MA 1F57A 4QHYA 5K8PA 3B8GA 5J35A 2BM1A 4Z4WA 3LMSA 4A31A 3W5VA 2CK3A 4WQMA 4X3RA 2OB0A 1G7CA 1W35A 2VNKA 4DUKA 1WSRA 3QAHA 4C2XA 2OZGA 3FNCA 1T5EA 1S72B 2AFXA 5J8FA 4CGPA 4ZY2A 1YW6A 3CXPA 3G6EB 2Z10A 3D2PA 1R5OA 3CCVB 1QQ9A 2YNEA 4LQGA 3S9LA 2ZL6A 5EC4A 3F8KA 2O53A 1QUEA 2X6YA 3I9SA 1Z8TA 1V5VA 1QFZA 3WBJA 2QTZA 3JQQA 4P45A 4MHNA 1HVXA 4B5PB 5LYFA 1XFOA 2V7UA 1RQRA 5F48A 1CNFA 1V0EA 2EK8A 2PR1A 3U2QA 3F0AA 2CTBA 2VBTA 3IEHA 1FNDA 2Y0MA 2XZLA 3ZBUA 4B13A 4UEFA 2YGWA 4NJRA 4UZEA 2NPFA 3IWWA 4Y9RA 2YWGA 2QN6A 3PZJA 1JJ2B 2Z0ZA 1NE9A 1LOKA 3NE8A 2X8KA 4ZGQB 3GUXA 1UFHA 3QAYA 1UD8A 4Q7AA 2QECA 2JDCA 1W0JA 4DYOA 3RBUA 3ZBTA 3WNCA 1K9MD 3V7ZA 2RC6A 4JD6A 4NGQA 4YHBA 2Q6OA 3RZAA 4EH1A 3SLNA 2BGJA 4M53A 2XEXA 1ZLIA 3B35A 4JJXA 4RCYA 2P6FA 2XZOA 4PXDA 1V0CA 2WJYA 1VQ9B 2I3CA 2P0WA 5J1QA 3ZUGA 1KZLA 2BVNA 3H5ZA 3A8JA 4R76A 4XD7A 3ONYA 2F4NA 1VGYA 3ASQA 5F4MA 1JA0A 1QSMA 1Z8WA 1VQPB 5D8NA 1JB9A 2F1LA 4IK2A 5AG7A 2W6JA 4PK3A 2GJPA 3D66A 3FX6A 2XEIA 3PB4X 1FRNA 1R5BA 2FT0A 5KTCA 4ASUA 2PJ1A 3B3CA 1IOIA 3FMCA 3P27A 4X7CA 2C6PA 4MRIA 2HLDA 4GXHA 4YALA 3DR6A 4QUSA 4O23A 4C2YA 1Y7EA 3FEDA 3SXNA 5KTDA 1K28D 1M4IA 1EFCA 3J81k 1W34A 4M1KA 1VQ8B 2OYNA 1AYEA 4PAAA 2PJCA 2OH1A 4G6IA 3K9TA 2OZUA 4TMWA 5AG5A 1FDRA 3JUWA 3WBKA 1CG2A 4AVZA 2X6WA 4FD4A 4PSWA 3FJOA 4OKOA 5IYQA 1LAPA 2HDNB 4B12A 4ONWA 3S6HA 1BLLE 4RD6A 2DIEA 1P4MA 1M4DA 1KMHA 1EFUA 2EK9A 5EBVA 1QFJA 1NB9A 2Z3PA 3MHPA 3ES9A 1B6BA 1YVOA 5HH1A 4KSAA 5G21A 3GQBA 1VQ5B 3LODA 4XOTA 2R6HA 4RD3A 4Z4ZA 4BBHA 5H5JA 4DNRB 3BQJA 2XZPA 2PVVA 5L46A 4RD4A 3KASA 2JN9A 2GK7A 3B3TA 2K5TA 5C88A 4P6YA 3EFAA 1HA3A 4P26A 1EXMA 3PA2A 3TOAA 5CBMA 4ZI6A 5IYRA 3JU4A 3VWEA 2JJ1A 5DN6A 3NH4A 4MI4A 3H8GA 4AC9A 2B5GA 4G7XA 5TR9A 5F4OA 4RM0A 2NYQA 1XBUA 4ROXA 2QMUA 3AGPA 2JBJA 4PSXA 3I55B 3EXNA 1N71A 2P6GA 3SI1A 3D7FA 5HVHA 3GVJA 5ELYA 1BO4A 4ZY1A 4P12A 1CM0A 5G1ZA 2VZZA 1OHHA 4FXUA 3PVDA 3V38A 5J8CA 3FPKA 3OZWA 1ZG7A 5ISVA 4NSQA 2CNDA 4RPBA 2V8HA 1KD1D 2PIZA 4MFJA 5BWAB 1CP6A 2ANPA 4LBYA 4A32A 2M5SA 4TMTA 2PCUA 1K8AD 4HNXB 5HXDA 3OEEA 1Z4RA 4OC0A 2CNMA 1Q2YA 5I0CA 1D2EA 4HKFA 1TF9A 4UWIA 4XNHB 4E0AA 2DYIA 3PA1A 5JPHA 3BCDA 2D4OA 2ZZEA 2C77A 2H5MA 1QUFA 4XLHA 1KRHA 1XF8A 3V7AA 4ZCMA 2XEGA 3CCRB 3S9MA 4RCZA 3NE5B 3SJXA 2Z3OA 2ZEHA 2VJJA 3CCUB 2O4HA 3RAMA 2ZENA 1UD2A 1MRZA 3CC4B 2V8VA 1LFWA 4PGOA 1IJFA 4DQLA 3E0KA 1NSLA 2QEXB 1D8TA 4WJBA 4XLAA 3ZZUA 2A4NA 1YQEA 2WZNA 2Z3MA 3B3WA 1KZFA 4CYNA 2WYRA 5JBQA 3CPAA 1VQ4B 1QX4A 3QNVA 4LX9A 1SM4A 5HKKA 3W2HA 2ZTGA 1MJBA 5LRGA 4FK8A 4WZEA 4P1VA 2WSAA 2QDXA 2VJIA 1FX0A 3VNUA 2BSAA 3WR7A 5K8OA 4PXEA 1OGJA 8CPAA 1XJOA 3VMFA 4B11A 1J9ZA 2PJ5A 5JQ4A 3W2GA 4P10A 5A88A 1YLOA 2C78A 2ZELA 1AMPA 4XN3A 1I18A 1XIXA 4R8FA 2ZEEA 1XE4A 3W5UA 1M4LA 4Q38A 3W6SA 3OWCA 4R3LA 1HDUA 2B58A 1LANA 2D3NA 2VL1A 5HVFA 1VHEA 4NGMA 3D7DA 5I4MA 2AFOA 1KK3A 5HZBA 2B5GB 4IUSA 1UMKA 1VHSA 3U6KA 2OK8A 2E1RA 3IGRA 2GLJA 4ZCIA 3DLJA 3WYAA 2BPOA 4II9A 1N0UA 4AVBA 1E3ZA 3AVUA 1PKVA 1IB0A 4UIAA 2DXQA 4JWPA 1COWA 2AHOA 4QVAA 1CJWA 4C43A 2VEZA 3ZPNA 3BNWA 1N07A 4RDLA 4U9UA 4B5PA 5DSZA 4K3NA 2C4TA 5EMIA 2VBVA 2GREA 1NMTA 4R71A 4UF4A 3TOBA 2Q43A 5DS0A 2VI7A 1HZEA 4CGMA 1NRKA 4P3IA 1BPLA 1LRZA 3TCVA 2CW5A 2GU2A 3NFZA 1ZM3A 3RNZA 1Z5RA 2HC9A 2LZJA 1G7RA 2IQ6A 2ZEPA 2V77A 3BLNA 2G9DA 2XNCA 4WZLA 3LWUA 1PCAA 2B7CA 4J3GA 4ZV4A 4KSFA 1Q2CA 4WZKA 3RY8A 3WNDA 1RQPA 3LQEA 1YHQB 2PMDA 2ZXIA 3R9EA 7CPAA 1FT7A 5G20A 2FCKA 5HVGA 2J8NA 4DK1A 2HMAA 1IU8A 1QGYA 2Q7BA 3OAAA 3CT9A 2JJ2A 4I49A 1NBMA 2YWEA 4OC5A 3OPOA 1XMTA 1PUAA 1X12A 2R7HA 1WORA 4BPRA 3OJXA 2QGGA 3LNNA 1N8RD 4XPDB 3IJ3A 1A8PA 2FIAA 4EMEA 3CCMB 3AVYA 4NCZA 2ODFA 3GIUA 4L8JA 2DPSA 1KTVA 1WPCA 5K8NA 1E64A 3CMEB 2DPTA 2VBSA 2AE6A 3OOCA 4YAOA 1FNOA 1VF7A 2PRQA 3PENA 5F09A 1QFYA 3P26A 1BJKA 4E8OA 2DCUA 3R9FA 3A8IA 3R6KA 2C6CA 3TX8A 4F7DA 4E2AA 2GE3A 4UFXA 1ELOA 2I1LA 4P6VF 4KVME 5KW9A 3PBEA 4KLVA 1E62A 1EFRA 3FXTA 4M0LA 3LO8A 1BPNA 1PJ5A 3T51B 2VNIA 2QJ8A 4C2ZA 4TMZA 4P4DA 4L8AA 3BC9A 1S0UA 4U5YA 4PC1A 3PEIA 1IHMA 4B44A 5F47A 5GV7A 3T53B 1F2PA 2ZEMA 1Q81D 3NE7A 3VO2A 3A8KA 4X07A 4NGNA 2QE7A 3BI1A 1H8EA 2Q6IA 2CC2A 4KVOE 3B82A 2EIXA 1GO2A 3V8IA 3KHZA 4Y49B 3C26A 1E3XA 2BN4A 4ZX9A 4U9ZA 3H9NA 3I1FA 3KHXA 1QGZA 4UFWA 4XLCA 6CPAA 1TUIA 1Q82D 1YLEA 2E1BA 3KI9A 2REFA 2EVNA 2AFSA 4RLZA 3LD2A 4KS9A 4RPDA 1Z8XA 4P4JA 1E1QA 4EWTA 3R9GA 3TO6A 1ARMA 4CGOA 2G3AA 1NB0A 1YX2A 1J4JA 4HE6A 2V7WA 1XQBA 4M6IA 2X7BA 1L0CA 3TFYA 5E96A 1ZM4A 2WUUA 4RUHA 1T6YA 3DGVA 2XNDA 1ZG9A 4X5KA 3ASPA 4KOUA 1YJNB 1P0HA 2XOKA 3G3SA 3W5HA 1Y9KA 2Q4ZA 1W87A 2Q7SA 3B8HA 2GQFA 3MRUA 5THWA 2V31A 3Q6QA 5LYLA 4F8ZA 2PQ8A 1GYTA 4AXVA 4F6AA 4B48A 4A2ZA 4KOTA 3ISXA 4XLEA 1YR0A 3GB0A 3D8PA 1I12A 3B3SA 3T8WA 3CMMA 4NJQA 3QB8A 4F0XA 3FECA 1GHEA 2QYVA 5BSYA 2ZZQA 2EBJA 3KQXA 4MHZA 4XN0A 4JMQA 2OR4A 3D26A 3OW2B 3FYNA 4HNYB 2Q04A 2ZITA 3H8EA 2XNJA 2JDIA 2C2WA 3IU1A 4DNCA 1VQKB 1ZO0A 4GM5A 2B4DA 4CQJA 4B3GA 3IWEA 1AMOA 2R8VA 1Z2LA 4JLYA 4OIDA 4EFDA 2PE3A 4KUAA 3CCJB 4N3GA 4XKWA 4G1VA 2BL1A 1YSJA 4NEXA 2BCOA 2F1MA 4PABA 5A89A 1YJ9B 3ASRA 2DY1A 2FX3A 3P2HA 1R57A 5JM6A 5AGEA 3H94A 4MY0A 4X06A 1KK1A 2V7VA 2P6EA 4CYOA 4Z4RA 4Q7JB 2CNTA 3WC5A 2Q6KA 4ZY0A 5FVJA 1OBRA 1KC8D 1WWZA 1Z8LA 2F5IA 4BD9A 4X7EA 3W6XA 3FIXA 4UCPA 2ZL5A 1W2BB 4PXCA 3WXMA 2PSWA 5IYWA 4P4IA 1T6ZA 4NGPA 5IX3A 3LVBA 4FUUA 3LQ6A 2REEA 2D9RA 5HZAA 4R9MA 2PLFA 4B43A 2FXFA 3S9NA 2IJZA 1RXTA 3GIRA 4A95A 4FN5A 3CZXA 1KUXA 1OB5A 4PXBA 3QFRA 2CRVA 1ON0A 4ACAA 2RC5A 2Q6LA 3SHPA 2CXAA 2Z6BD 4UAJA 1N05A 2KVOA 3TTHA 3IFEA 4C7IA 4B3XA 4E0FA 5HXBA 2BUEA 3CMAB 2GK6A 2HQYA 2OTLB 4C68A 3KR5A 2GIVA 3MN8A 4FD6A 4B3FX 2DEAA 3AVWA 5C82A 3WC6A 4KOYA 3DNSA 3JVNA 2EWBA 2Q4VA 1S60A 4AF7A 1E1RA 3F5BA 4MHPA 2V7QA 4X8IA 1VQOB 4YEJA 2FL4A 2BV3A 1VHOA 4CRZB 3VR6A 3IIBA 4PV6A 4CYPA 2PJ3A 4FBEA 1Y7RA 1XRYA 3OJWA 4B4DA 4IHMA 1CX8A 1IJEA 1W0KA 2BGIA 4KSIA 2I79A 3CP2A 4XNHC 3WABA 3CESA 3MCAA 4PC7A 1F60A 2X85A 5F49A 1B23P 3KKWA 2PR8A 4QFMA 1KUYA 2CIJA 2AFMA 2FSRA 1TKJA 1A2ZA 2WPXA 3FVLA 4UEEA 1EP3B 3I3GA 2VXKA 1WP6A 3VNVA 5KTAA 4JYWA 3CP8A 1VLOA 2WPDA 4X7FA 4K30A 3QFTA 4AVCA 4MFLA 3V76A 4XNFA 4M85A 4LBVA 3DSBA 4A38A 3FBUA 4G7WA 3MGDA 4ACBA 1IGBA 1R3NA 3WC7A 2B4DB 4CAVA 1S7LA 4MFZA 4YGOA 2OK7A 2WSSA 4DK0A 4FAIA 1OZPA 4MHYA 4EVYA 1Q9SA 2I00A 4CGLA 1SQHA 3GVKA 2JEWA 3I1UA 3NH5A 4XM3A 1M44A 1WOOA 2OBSA 4B10A 4MYTA 4P3YA 5AN9A 3HLPA 4XKVA 2AFWA 2C5BA 3CXCB 2BMWA 2C27A 3JRUA 4NBSA 2J7KA 1FNCA 1K73D 4RJLA 5CDFA 1Q2DA 3MMPA 2V8DA 1WOPA 4R6TA 1QH0A 4Z4YA 4UA3A 3SEJA 3ASSA 4TMVA 4XORA 1N06A 1VQMB 1DTDA 3OFNA 3W2IA 3HAGA 4ZX8A 3ZZIA 1PYTB 4MJ8A 3VWDA 1HEEA 2X6XA 2XEJA 1UD4A 4OP4A 5BSXA 2YNCA 1H85A 1QSNA 5IYNA 5TV2A 3CW2A 3W91A 2V7TA 1WOSA 4TNUA 5LRKA 4JZ0A 4RD2A 1MJAA 1H8HA 4II2A 3VH9A 1DG1G 3D7HA 1XE1A 3WT4A 3WQZA 2DF5A 3RYOA 3FEEA 3GSIA 4CAXA 4P44A 4BINA 4MBUA 5G22A 3FRMA 2ZW7A 1GJRA 1FY7A 2BEIA 4KZTA 1WSVA 1QSOA 3ZC3A 2VNHA 3D68A 1VLYA 2D74A 2B5OA 4OPVA 1QG0A 3D7GA 1I7PA 1WTHD 4GS4A 3D67A 2R1IA 1YJWB 5KSWB 2Z3KA 2W6IA 3VO1A 3EO4A 3PP9A 2HB6A 1TF8A 3PGPA 1XMBA 1EWYA 3N7ZA 1CBXA 3RO0A 2YWHA 3KEWA 2B7BA 4CAWA 2ZBVA 2ZL7A 1R5NA 4XQFA 3TC8A 3G71B 4F9UA 2VBQA 4FD5A 4MY3A 5A8AA 2VZYA 4UZFA 5TRDA 3KR4A 1RTQA 1KJZA 2X0KA 4CRYB 3I56B 3CPWB 2ZZFA 3AVTA 4XPDC 3BCFA 2PJBA 2ZOGA 4MHDA 4HE5A 3DR8A 4F0YA 4YELA 3CCSB 1KK2A 2WZPP 2OZHA 4MMOA 1E79A 2DOGA 3FF3A 1MJ9A 1CQXA 4A33A 5LYDA 3QSYA 1FRQA 4R87A 1TLLA 2YNCC 1DDGA 1TIQA 1YX0A 5A27A 1GR1A 1YMEA 4H6ZA 4G1PA 1IB1E 2ZEGA 2G3TA 4OADA 4J0QA 1YVKA 5IB9A 5FO0A 2QA4B 4NXYA 2OBRA 4FWTA 1YIJB 1S7KA 2PJ8A 5F4JA 4UFVA 3FJUA 1TXRA 4Z4TA 5GV8A 4AG9A 4HPSA 4RD0A 4H9GA 3IO1A 2QTLA 4ZBGA 2Z3NA 3WNBA 3VARA 2BM0A 3WY9A 4MYUA 2ZXVA 4XL9A 3CDXA 3Q38A 4BMHA 3BY1A 3BY2A 4IW3B 3KZWA 1Q86D 3PRTA 5THXA 4K1XA 4X05A 4UEZA 3EY5A 4OLLA 4UCNA 1T6XA 3QFSA 5GCNA 1YW4A 4Y49C 4KOVA 4NFRA 4NNJA 4P4BA 1KQSB 4MFQA 1UD3A 3B2YA 3NA6A 1B87A 2GJRA 5IV0A 1V0FA 3A9LA 5FNZA 4KVXA 3ZZ0A 1P4NA 2ZW5A 2BOAA 2XEFA 3Q39A 2ZXHA 2IL4A 5LMZA 3BXMA 4YRHA 4LBWA 4TMXA 4PQAA 4NF1A 4CAFA 1PJ6A 4Y7CA 3PB6X 4YAWA 1LAMA 4UZUA 1XB2A 5FL7A 3NH8A 4QV2A 1MABA 4RN7A 4B5OA 4JXRA 1YI2B 1I1DA 4A39A 2ZZGA 3A1PA 3PB7X 2OTJB 3DDYA 1QSRA 1WU8A 3IU2A 4A37A 2B3UA 2KCWA 3ISZA 1Z9UA 4M6GA 2V8GA 2D3LA 2RC4A 1ZUNB 2ZW4A 2ARHA 2NMTA 3GVLA 3R95A 2PJ4A 1Z4EA 3Q6RA 1YREA 1N08A 4H2KA 1M1KD 1MK4A 1AUGA 5AG6A 4YXWA 4Z4SA 4TKOB 3GY9A 4OC3A 2PJ6A 1K4JA 4AF6A 5H59A 1VKCA 3D3SA 1YK3A 3D4UA 3K2KA 1S5KA 5DWMA 5A28A 4ORFA 2VZLA 2JDDA 4TN1A 1IICA 3TO9A 1BMFA 2JBKA 3SJZA 1S4MA
chains in the Genus database with same CATH topology
4Z65A 3PBBA 3WC6A 1YLOA 2EWBA 1H8LA 5D29A 2ZELA 4MHPA 1AMPA 5JGFA 2AFUA 4R8FA 4X8IA 2ZEEA 1M4LA 2F8HA 1VHOA 5LRJA 1HDUA 3IIBA 1Q7LA 1ELLP 3PFEA 2PJ3A 4FBEA 1LANA 1XRYA 4IHMA 2VL1A 1CX8A 1VHEA 4KSIA 4MCRA 5HVFA 2ABZA 4NGMA 3D7DA 5I4MA 2AFOA 3WABA 5K8PA 1F57A 4P4EA 3LMSA 2GLJA 3DLJA 2CIJA 2AFMA 4YU9A 1TKJA 3FVLA 4UEEA 4X3RA 4OMEA 4JYWA 2PJ2A 4UIAA 4DUKA 2FVGA 2AFXA 4MCPA 3PB8X 2CTCA 3B7IA 4ZY2A 4K3NA 1QMUA 4A38A 4OC4A 1YW6A 2GREA 4OIWA 4UF4A 1IGBA 2Q43A 5DS0A 1R3NA 3WC7A 1QQ9A 4LQGA 3S9LA 3PFOA 4FAIA 1ZG8A 2GU2A 3NFZA 2O53A 4MHYA 3GLJA 1Z5RA 1ZLHA 4MXUA 2HC9A 2JEWA 3I1UA 3NH5A 2IQ6A 2ZEPA 2V77A 2G9DA 4P45A 2ZEOA 4MHNA 3LWUA 1PCAA 5LYFA 3HLPA 1XFOA 2AFWA 2DEAA 2EK8A 3JRUA 4IAVA 2CTBA 3IEHA 2C6GA 7CPAA 1FT7A 2V8DA 4R6TA 5HVGA 4UEFA 3BHXA 1DTDA 3CT9A 4NJRA 4TWEA 3IWWA 4OC5A 2RB7A 4ZX8A 1PYTB 2ZEDA 1LOKA 2QVPA 1HEEA 3GUXA 1F2OA 2XEJA 4Q7AA 3IJ3A 4OP4A 4DYOA 4EMEA 3RBUA 1LCPA 1TKHA 4UIBA 4TNUA 5LRKA 4NGRA 4JZ0A 5K8NA 2C1CA 3V7ZA 1R43A 4NGQA 3VH9A 3BI0A 3RZAA 4MCSA 4PPZA 3D7HA 1FNOA 1ZLIA 3B35A 3WT4A 2PRQA 4PXDA 2PJ9A 2AFZA 5F09A 3VATA 2I3CA 3KGQA 5J1QA 2C6CA 4R76A 3TX8A 3FEEA 4P44A 1VGYA 4DJLA 1EE3P 1VIXA 3PB9X 4NGSA 5D8NA 4IK2A 3D68A 4FWUA 3D66A 3FX6A 2XEIA 3D7GA 3B3VA 3PB4X 3PBEA 2PJ1A 3B3CA 5K8MA 1BPNA 3D67A 2Q51A 3FMCA 1ELMP 2C6PA 2QJ8A 2HB6A 2PJ0A 1TF8A 4P4DA 4MRIA 1XMBA 1CBXA 2PJ7A 3PEIA 2CF4A 1F2PA 3TC8A 4O23A 1Y7EA 2ZEMA 4F9UA 3FEDA 4W9YA 3FH4A 1BPMA 4NGNA 3N5FA 3BI1A 3KR4A 2F7VA 1RTQA 1AYEA 2PJCA 1TKFA 3KHZA 3K9TA 1IY7A 1ARLA 4ZX9A 2PJBA 2ZOGA 3KHXA 1CG2A 1HDQA 4OC2A 6CPAA 1NSAA 4OKOA 1CP7A 1LAPA 3KI9A 4ONWA 4MMOA 4P4JA 2AFSA 1BLLE 4EWTA 3FF3A 4R7MA 1CPXA 1ARMA 2EK9A 5CPAA 5LYDA 1KWMA 2RFHA 4F9VA 4RUHA 3KQZA 3DGVA 1ZG9A 1YMEA 4G1PA 2ZEGA 5IB9A 1DE4C 3SJGA 1JQGA 2Q4ZA 2PVVA 3MRUA 2POKA 3KASA 4X2TA 4YWYA 5THWA 3B3TA 2PJ8A 3SJEA 4P6YA 2BO9A 5LYLA 3FJUA 4OC1A 4F8ZA 1TXRA 3SI2A 1GYTA 4AXVA 4CPAA 1CPSA 1Y0YA 3IO1A 4ZI6A 5CBMA 3ISXA 3NH4A 3GB0A 3H8GA 3KL9A 3B3SA 3VARA 3T8WA 1BAVA 4NJQA 1Y0RA 3FECA 3CDXA 2QYVA 2NYQA 1XBUA 4A94A 3H8FA 3KZWA 3PRTA 3KQXA 4MHZA 2JBJA 2OR4A 4UEZA 3SI1A 3D7FA 5HVHA 5ELYA 4NGTA 4ZY1A 1YW4A 3H8EA 4NFRA 4P4BA 2J9AA 3CPXA 2IMOA 3B2YA 3V38A 3NA6A 4GM5A 4OIDA 1ZG7A 1Z2LA 2PIYA 2ZOFA 4EFDA 2V8HA 2PE3A 2PIZA 1CP6A 2ANPA 1YSJA 2PCUA 3SI0A 2BCOA 2BOAA 2NSMA 5HXDA 2XEFA 4OC0A 5JM6A 2PVWA 1TF9A 3BXMA 3SJFA 4PQAA 4P4FA 2GLFA 4ZYQA 4MCQA 3PB6X 1UWYA 1LAMA 4WWVA 3NH8A 3WC5A 4ZY0A 2XEGA 1OBRA 2OOTA 3S9MA 1Z8LA 3SJXA 2ZEHA 4BD9A 4A39A 2O4HA 3RAMA 2ZENA 3PB7X 3IC1A 2V8VA 1LFWA 4A37A 3L2NA 4PXCA 3ISZA 4WJBA 2V8GA 3HUVA 4P4IA 4NGPA 4FUUA 2WZNA 3B3WA 2WYRA 3S9NA 3CPAA 2IJZA 2PJ4A 5JH9A 2PJAA 3QNVA 4H2KA 5LRGA 4PXBA 4OC3A 2PJ6A 4B6ZA 5K8OA 4PXEA 3IFEA 3D4UA 2ZEFA 3K2KA 5LYIA 8CPAA 1XJOA 2PJ5A 3KR5A 3MN8A 2JBKA 4P10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z65 A;  3PBB A;  3WC6 A;  1YLO A;  2EWB A;  1H8L A;  5D29 A;  2ZEL A;  4MHP A;  1AMP A;  5JGF A;  2AFU A;  4R8F A;  4X8I A;  2ZEE A;  1M4L A;  2F8H A;  1VHO A;  5LRJ A;  1HDU A;  3IIB A;  1Q7L A;  1ELL P;  3PFE A;  2PJ3 A;  4FBE A;  1LAN A;  1XRY A;  4IHM A;  2VL1 A;  1CX8 A;  1VHE A;  4KSI A;  4MCR A;  5HVF A;  2ABZ A;  4NGM A;  3D7D A;  5I4M A;  2AFO A;  3WAB A;  5K8P A;  1F57 A;  4P4E A;  3LMS A;  2GLJ A;  3DLJ A;  2CIJ A;  2AFM A;  4YU9 A;  1TKJ A;  3FVL A;  4UEE A;  4X3R A;  4OME A;  4JYW A;  2PJ2 A;  4UIA A;  4DUK A;  2FVG A;  2AFX A;  4MCP A;  3PB8 X;  2CTC A;  3B7I A;  4ZY2 A;  4K3N A;  1QMU A;  4A38 A;  4OC4 A;  1YW6 A;  2GRE A;  4OIW A;  4UF4 A;  1IGB A;  2Q43 A;  5DS0 A;  1R3N A;  3WC7 A;  1QQ9 A;  4LQG A;  3S9L A;  3PFO A;  4FAI A;  1ZG8 A;  2GU2 A;  3NFZ A;  2O53 A;  4MHY A;  3GLJ A;  1Z5R A;  1ZLH A;  4MXU A;  2HC9 A;  2JEW A;  3I1U A;  3NH5 A;  2IQ6 A;  2ZEP A;  2V77 A;  2G9D A;  4P45 A;  2ZEO A;  4MHN A;  3LWU A;  1PCA A;  5LYF A;  3HLP A;  1XFO A;  2AFW A;  2DEA A;  2EK8 A;  3JRU A;  4IAV A;  2CTB A;  3IEH A;  2C6G A;  7CPA A;  1FT7 A;  2V8D A;  4R6T A;  5HVG A;  4UEF A;  3BHX A;  1DTD A;  3CT9 A;  4NJR A;  4TWE A;  3IWW A;  4OC5 A;  2RB7 A;  4ZX8 A;  1PYT B;  2ZED A;  1LOK A;  2QVP A;  1HEE A;  3GUX A;  1F2O A;  2XEJ A;  4Q7A A;  3IJ3 A;  4OP4 A;  4DYO A;  4EME A;  3RBU A;  1LCP A;  1TKH A;  4UIB A;  4TNU A;  5LRK A;  4NGR A;  4JZ0 A;  5K8N A;  2C1C A;  3V7Z A;  1R43 A;  4NGQ A;  3VH9 A;  3BI0 A;  3RZA A;  4MCS A;  4PPZ A;  3D7H A;  1FNO A;  1ZLI A;  3B35 A;  3WT4 A;  2PRQ A;  4PXD A;  2PJ9 A;  2AFZ A;  5F09 A;  3VAT A;  2I3C A;  3KGQ A;  5J1Q A;  2C6C A;  4R76 A;  3TX8 A;  3FEE A;  4P44 A;  1VGY A;  4DJL A;  1EE3 P;  1VIX A;  3PB9 X;  4NGS A;  5D8N A;  4IK2 A;  3D68 A;  4FWU A;  3D66 A;  3FX6 A;  2XEI A;  3D7G A;  3B3V A;  3PB4 X;  3PBE A;  2PJ1 A;  3B3C A;  5K8M A;  1BPN A;  3D67 A;  2Q51 A;  3FMC A;  1ELM P;  2C6P A;  2QJ8 A;  2HB6 A;  2PJ0 A;  1TF8 A;  4P4D A;  4MRI A;  1XMB A;  1CBX A;  2PJ7 A;  3PEI A;  2CF4 A;  1F2P A;  3TC8 A;  4O23 A;  1Y7E A;  2ZEM A;  4F9U A;  3FED A;  4W9Y A;  3FH4 A;  1BPM A;  4NGN A;  3N5F A;  3BI1 A;  3KR4 A;  2F7V A;  1RTQ A;  1AYE A;  2PJC A;  1TKF A;  3KHZ A;  3K9T A;  1IY7 A;  1ARL A;  4ZX9 A;  2PJB A;  2ZOG A;  3KHX A;  1CG2 A;  1HDQ A;  4OC2 A;  6CPA A;  1NSA A;  4OKO A;  1CP7 A;  1LAP A;  3KI9 A;  4ONW A;  4MMO A;  4P4J A;  2AFS A;  1BLL E;  4EWT A;  3FF3 A;  4R7M A;  1CPX A;  1ARM A;  2EK9 A;  5CPA A;  5LYD A;  1KWM A;  2RFH A;  4F9V A;  4RUH A;  3KQZ A;  3DGV A;  1ZG9 A;  1YME A;  4G1P A;  2ZEG A;  5IB9 A;  1DE4 C;  3SJG A;  1JQG A;  2Q4Z A;  2PVV A;  3MRU A;  2POK A;  3KAS A;  4X2T A;  4YWY A;  5THW A;  3B3T A;  2PJ8 A;  3SJE A;  4P6Y A;  2BO9 A;  5LYL A;  3FJU A;  4OC1 A;  4F8Z A;  1TXR A;  3SI2 A;  1GYT A;  4AXV A;  4CPA A;  1CPS A;  1Y0Y A;  3IO1 A;  4ZI6 A;  5CBM A;  3ISX A;  3NH4 A;  3GB0 A;  3H8G A;  3KL9 A;  3B3S A;  3VAR A;  3T8W A;  1BAV A;  4NJQ A;  1Y0R A;  3FEC A;  3CDX A;  2QYV A;  2NYQ A;  1XBU A;  4A94 A;  3H8F A;  3KZW A;  3PRT A;  3KQX A;  4MHZ A;  2JBJ A;  2OR4 A;  4UEZ A;  3SI1 A;  3D7F A;  5HVH A;  5ELY A;  4NGT A;  4ZY1 A;  1YW4 A;  3H8E A;  4NFR A;  4P4B A;  2J9A A;  3CPX A;  2IMO A;  3B2Y A;  3V38 A;  3NA6 A;  4GM5 A;  4OID A;  1ZG7 A;  1Z2L A;  2PIY A;  2ZOF A;  4EFD A;  2V8H A;  2PE3 A;  2PIZ A;  1CP6 A;  2ANP A;  1YSJ A;  2PCU A;  3SI0 A;  2BCO A;  2BOA A;  2NSM A;  5HXD A;  2XEF A;  4OC0 A;  5JM6 A;  2PVW A;  1TF9 A;  3BXM A;  3SJF A;  4PQA A;  4P4F A;  2GLF A;  4ZYQ A;  4MCQ A;  3PB6 X;  1UWY A;  1LAM A;  4WWV A;  3NH8 A;  3WC5 A;  4ZY0 A;  2XEG A;  1OBR A;  2OOT A;  3S9M A;  1Z8L A;  3SJX A;  2ZEH A;  4BD9 A;  4A39 A;  2O4H A;  3RAM A;  2ZEN A;  3PB7 X;  3IC1 A;  2V8V A;  1LFW A;  4A37 A;  3L2N A;  4PXC A;  3ISZ A;  4WJB A;  2V8G A;  3HUV A;  4P4I A;  4NGP A;  4FUU A;  2WZN A;  3B3W A;  2WYR A;  3S9N A;  3CPA A;  2IJZ A;  2PJ4 A;  5JH9 A;  2PJA A;  3QNV A;  4H2K A;  5LRG A;  4PXB A;  4OC3 A;  2PJ6 A;  4B6Z A;  5K8O A;  4PXE A;  3IFE A;  3D4U A;  2ZEF A;  3K2K A;  5LYI A;  8CPA A;  1XJO A;  2PJ5 A;  3KR5 A;  3MN8 A;  2JBK A;  4P10 A; 
#chains in the Genus database with same CATH topology
 4Z65 A;  3W2F A;  2GFQ A;  5B6I A;  4UBR A;  1H8L A;  4QB9 A;  1UD5 A;  5JGF A;  3QFC A;  5IYP A;  3CTA A;  2F8H A;  4ONU A;  5LRJ A;  1ELL P;  4X0C A;  1FNB A;  4L89 A;  4MCR A;  4PC3 A;  4P4E A;  3EC4 A;  4Q36 A;  4M2L A;  5IK2 A;  2YWF A;  3LAC A;  4YU9 A;  5FIU A;  4KOS A;  3Q3A A;  2R98 A;  4OME A;  1YIT B;  2PJ2 A;  5DWN A;  1JWQ A;  3W2E A;  2FVG A;  4OOV A;  3BH4 A;  2ZTN A;  4MCP A;  1I21 A;  4G1B A;  3PB8 X;  2CTC A;  3B7I A;  4MFK A;  1QMU A;  2GPJ A;  4OOS A;  4MFP A;  4OC4 A;  3R96 A;  4U9Y A;  4OIW A;  3TO7 A;  4GQN A;  4H6U A;  3CXS A;  3CD6 B;  1G7S A;  3PFO A;  1ZG8 A;  2HCJ B;  5EMN A;  3A3G A;  1PU9 A;  3GLJ A;  2J8M A;  4P2N A;  1ZLH A;  4MXU A;  4IF5 A;  3SJP A;  1BX1 A;  2ZEO A;  4M6H A;  4KUB A;  3ZJ0 A;  2PC1 A;  1TVC A;  2PIA A;  3A35 A;  2DET A;  1EFT A;  1IYK A;  3G05 A;  4IAV A;  2FS5 A;  1NJI D;  3CCQ B;  2C6G A;  4ZGN B;  1D1N A;  1X10 A;  4ZCL A;  1DAR A;  2Z3L A;  4LC0 A;  1I8D A;  1VQ6 B;  4RDJ A;  1Q7Y D;  3BHX A;  4WZT A;  1GAQ A;  3JQP A;  4R57 A;  3A3B A;  4TWE A;  3R1K A;  5CNP A;  1XEB A;  2RB7 A;  4C7H A;  1WK4 A;  2ZED A;  3R6J A;  1B2R A;  3OEH A;  2WR8 A;  5F46 A;  2CY2 A;  4UWJ A;  2PDO A;  2QVP A;  1JNY A;  5IB0 A;  2JIZ A;  3E20 A;  1F2O A;  4P25 A;  1OB2 A;  4OAE A;  4KOX A;  3T90 A;  1UD6 A;  3QE2 A;  3TE4 A;  2C5H A;  3IWG A;  2GAN A;  2PRB A;  1LCP A;  1TKH A;  4UIB A;  2DER A;  1AIP A;  4NGR A;  2C1C A;  1R43 A;  3BI0 A;  4II3 A;  4MCS A;  1BOB A;  4OP7 A;  4PPZ A;  4QVT A;  2OU2 A;  2CNS A;  4Z4V A;  3JTK A;  1EP2 B;  2PJ9 A;  1OGI A;  2AFZ A;  3VAT A;  3GKR A;  1DDI A;  3KGQ A;  4KLW A;  2C4U A;  4CS0 B;  1S7F A;  3S6F A;  4N3N A;  4DJL A;  4H89 A;  3OP1 A;  1EE3 P;  2EUI A;  1VIX A;  4M3S A;  3U6B A;  4YFJ A;  3PB9 X;  4PC6 A;  4NGS A;  2CBX A;  2B4B A;  4FWU A;  3S6K A;  3B3V A;  3OZU A;  4XPK A;  1YGH A;  3AST A;  4Z1M A;  2J8R A;  1VQN B;  5K8M A;  2QIR A;  2BF4 A;  4UCM A;  1M90 D;  2Q51 A;  2XGJ A;  2X3U A;  1ELM P;  2PJ0 A;  3FPP A;  1U2R A;  3ONU A;  4XON A;  1RO5 A;  2PJ7 A;  4JXQ A;  2CF4 A;  3FB3 A;  1VQ7 B;  4G5G A;  4Z4U A;  4W9Y A;  3FH4 A;  1BPM A;  3N5F A;  1ZM9 A;  2F7V A;  5H86 A;  4KKS A;  4OOX A;  1TKF A;  2Z11 A;  3CCE B;  1TTT A;  3OE7 A;  1IY7 A;  4B14 A;  1ARL A;  1WDT A;  2WPW A;  2HUZ A;  2D4P A;  3TT2 A;  4TSF A;  3T56 B;  3GYA A;  5HMN A;  1HDQ A;  4OC2 A;  1NSA A;  2FIW A;  1CP7 A;  3BJ7 A;  4CAE A;  4XLF A;  4R7M A;  3JQR A;  4KOR A;  1CNE A;  2EO8 A;  1CPX A;  1W9X A;  5CPA A;  4B47 A;  1KWM A;  3H4Q A;  1IOF A;  4PC2 A;  2RFH A;  3SLD A;  2Q0Y A;  4F9V A;  3KQZ A;  1NDH A;  5KNL A;  1KUV A;  1EP1 B;  4R3K A;  2P3M A;  4KOW A;  1VJS A;  4HNW B;  1DE4 C;  4P22 A;  3SJG A;  1JQG A;  1S3Z A;  1N0V C;  2POK A;  4X2T A;  4YWY A;  3SJE A;  4AVA A;  2JEV A;  2BO9 A;  4OC1 A;  4KKU A;  3SI2 A;  3S6G A;  4CPA A;  1F20 A;  1CPS A;  4PK2 A;  1Y0Y A;  2FE7 A;  3CC2 B;  4KKT A;  3KL9 A;  2VNJ A;  1BAV A;  1S7N A;  1IID A;  2G0B A;  1Y0R A;  4LBZ A;  5FO1 A;  4RI1 A;  3ZZT A;  4AG7 A;  1SKQ A;  2R9V A;  4A94 A;  3H8F A;  4FD7 A;  1SKY B;  2AJ6 A;  2HV2 A;  1KK0 A;  4NCN A;  1IYL A;  4OPO A;  2QML A;  4NGT A;  2F43 A;  3UY5 A;  2WJV A;  4LQ6 A;  1H42 A;  1BLI A;  4XOP A;  2DEU A;  3OKX A;  4Y9U A;  3T9Y A;  2J9A A;  3CPX A;  2IMO A;  4A30 A;  2B3V A;  4XR6 A;  3AVX A;  1BQE A;  2PIY A;  3AGQ A;  4DQK A;  3ZIA A;  1VQL B;  2ZOF A;  3D2M A;  2VQY A;  2Q4Y A;  4OPS A;  4RDK A;  3SI0 A;  3G8W A;  2NSM A;  3P2F A;  2ZW6 A;  5H84 A;  1M4G A;  2PVW A;  3SJF A;  2Q44 A;  3DDD A;  3OZV A;  1GVH A;  4P4F A;  3CRZ A;  2GLF A;  4ZYQ A;  4MCQ A;  2ZBU A;  1UWY A;  2VBU A;  4WWV A;  1ZM2 A;  3PUN A;  1OB0 A;  4RD1 A;  3CB4 A;  4CYQ A;  2YND A;  1G7T A;  2OOT A;  2OBT A;  1Y9W A;  4TT3 A;  1JA1 A;  3IC1 A;  5E6T A;  4YAF A;  1QVG B;  1E63 A;  3FKS A;  4M4S A;  3SKB A;  4DNT B;  4QC6 A;  3CXQ A;  1FNM A;  3L2N A;  3SXO A;  4X7D A;  4LUA A;  3HUV A;  4CGN A;  1QVF B;  5AG4 A;  2ZPA A;  3BJ8 A;  1BX0 A;  4QUZ A;  2EFG A;  2V4D A;  2VYQ A;  5FA6 A;  4XMY A;  5JH9 A;  4C0S A;  1QST A;  2BSW A;  2PJA A;  5TY0 A;  4XPL A;  3CC7 B;  2ATR A;  2V7X A;  4B6Z A;  4QBJ A;  4AB7 A;  5J3O A;  2ZEF A;  5LYI A;  1QGA A;  1E43 A;  4ZGY B;  1M1D A;  3PBB A;  2JLM A;  3G4S B;  3K9U A;  2O28 A;  1XOV A;  5D29 A;  4QVJ A;  4HIZ A;  3PUM A;  3B78 A;  2AFU A;  2GJK A;  4P9S A;  3CCL B;  1GAW A;  1PJ7 A;  2X53 S;  3E1Y E;  4RS2 A;  1Q7L A;  3PFE A;  2NV4 A;  4YAU A;  2ABZ A;  3AVV A;  3OW7 A;  1U6M A;  1F57 A;  4QHY A;  5K8P A;  3B8G A;  5J35 A;  2BM1 A;  4Z4W A;  3LMS A;  4A31 A;  3W5V A;  2CK3 A;  4WQM A;  4X3R A;  2OB0 A;  1G7C A;  1W35 A;  2VNK A;  4DUK A;  1WSR A;  3QAH A;  4C2X A;  2OZG A;  3FNC A;  1T5E A;  1S72 B;  2AFX A;  5J8F A;  4CGP A;  4ZY2 A;  1YW6 A;  3CXP A;  3G6E B;  2Z10 A;  3D2P A;  1R5O A;  3CCV B;  1QQ9 A;  2YNE A;  4LQG A;  3S9L A;  2ZL6 A;  5EC4 A;  3F8K A;  2O53 A;  1QUE A;  2X6Y A;  3I9S A;  1Z8T A;  1V5V A;  1QFZ A;  3WBJ A;  2QTZ A;  3JQQ A;  4P45 A;  4MHN A;  1HVX A;  4B5P B;  5LYF A;  1XFO A;  2V7U A;  1RQR A;  5F48 A;  1CNF A;  1V0E A;  2EK8 A;  2PR1 A;  3U2Q A;  3F0A A;  2CTB A;  2VBT A;  3IEH A;  1FND A;  2Y0M A;  2XZL A;  3ZBU A;  4B13 A;  4UEF A;  2YGW A;  4NJR A;  4UZE A;  2NPF A;  3IWW A;  4Y9R A;  2YWG A;  2QN6 A;  3PZJ A;  1JJ2 B;  2Z0Z A;  1NE9 A;  1LOK A;  3NE8 A;  2X8K A;  4ZGQ B;  3GUX A;  1UFH A;  3QAY A;  1UD8 A;  4Q7A A;  2QEC A;  2JDC A;  1W0J A;  4DYO A;  3RBU A;  3ZBT A;  3WNC A;  1K9M D;  3V7Z A;  2RC6 A;  4JD6 A;  4NGQ A;  4YHB A;  2Q6O A;  3RZA A;  4EH1 A;  3SLN A;  2BGJ A;  4M53 A;  2XEX A;  1ZLI A;  3B35 A;  4JJX A;  4RCY A;  2P6F A;  2XZO A;  4PXD A;  1V0C A;  2WJY A;  1VQ9 B;  2I3C A;  2P0W A;  5J1Q A;  3ZUG A;  1KZL A;  2BVN A;  3H5Z A;  3A8J A;  4R76 A;  4XD7 A;  3ONY A;  2F4N A;  1VGY A;  3ASQ A;  5F4M A;  1JA0 A;  1QSM A;  1Z8W A;  1VQP B;  5D8N A;  1JB9 A;  2F1L A;  4IK2 A;  5AG7 A;  2W6J A;  4PK3 A;  2GJP A;  3D66 A;  3FX6 A;  2XEI A;  3PB4 X;  1FRN A;  1R5B A;  2FT0 A;  5KTC A;  4ASU A;  2PJ1 A;  3B3C A;  1IOI A;  3FMC A;  3P27 A;  4X7C A;  2C6P A;  4MRI A;  2HLD A;  4GXH A;  4YAL A;  3DR6 A;  4QUS A;  4O23 A;  4C2Y A;  1Y7E A;  3FED A;  3SXN A;  5KTD A;  1K28 D;  1M4I A;  1EFC A;  3J81 k;  1W34 A;  4M1K A;  1VQ8 B;  2OYN A;  1AYE A;  4PAA A;  2PJC A;  2OH1 A;  4G6I A;  3K9T A;  2OZU A;  4TMW A;  5AG5 A;  1FDR A;  3JUW A;  3WBK A;  1CG2 A;  4AVZ A;  2X6W A;  4FD4 A;  4PSW A;  3FJO A;  4OKO A;  5IYQ A;  1LAP A;  2HDN B;  4B12 A;  4ONW A;  3S6H A;  1BLL E;  4RD6 A;  2DIE A;  1P4M A;  1M4D A;  1KMH A;  1EFU A;  2EK9 A;  5EBV A;  1QFJ A;  1NB9 A;  2Z3P A;  3MHP A;  3ES9 A;  1B6B A;  1YVO A;  5HH1 A;  4KSA A;  5G21 A;  3GQB A;  1VQ5 B;  3LOD A;  4XOT A;  2R6H A;  4RD3 A;  4Z4Z A;  4BBH A;  5H5J A;  4DNR B;  3BQJ A;  2XZP A;  2PVV A;  5L46 A;  4RD4 A;  3KAS A;  2JN9 A;  2GK7 A;  3B3T A;  2K5T A;  5C88 A;  4P6Y A;  3EFA A;  1HA3 A;  4P26 A;  1EXM A;  3PA2 A;  3TOA A;  5CBM A;  4ZI6 A;  5IYR A;  3JU4 A;  3VWE A;  2JJ1 A;  5DN6 A;  3NH4 A;  4MI4 A;  3H8G A;  4AC9 A;  2B5G A;  4G7X A;  5TR9 A;  5F4O A;  4RM0 A;  2NYQ A;  1XBU A;  4ROX A;  2QMU A;  3AGP A;  2JBJ A;  4PSX A;  3I55 B;  3EXN A;  1N71 A;  2P6G A;  3SI1 A;  3D7F A;  5HVH A;  3GVJ A;  5ELY A;  1BO4 A;  4ZY1 A;  4P12 A;  1CM0 A;  5G1Z A;  2VZZ A;  1OHH A;  4FXU A;  3PVD A;  3V38 A;  5J8C A;  3FPK A;  3OZW A;  1ZG7 A;  5ISV A;  4NSQ A;  2CND A;  4RPB A;  2V8H A;  1KD1 D;  2PIZ A;  4MFJ A;  5BWA B;  1CP6 A;  2ANP A;  4LBY A;  4A32 A;  2M5S A;  4TMT A;  2PCU A;  1K8A D;  4HNX B;  5HXD A;  3OEE A;  1Z4R A;  4OC0 A;  2CNM A;  1Q2Y A;  5I0C A;  1D2E A;  4HKF A;  1TF9 A;  4UWI A;  4XNH B;  4E0A A;  2DYI A;  3PA1 A;  5JPH A;  3BCD A;  2D4O A;  2ZZE A;  2C77 A;  2H5M A;  1QUF A;  4XLH A;  1KRH A;  1XF8 A;  3V7A A;  4ZCM A;  2XEG A;  3CCR B;  3S9M A;  4RCZ A;  3NE5 B;  3SJX A;  2Z3O A;  2ZEH A;  2VJJ A;  3CCU B;  2O4H A;  3RAM A;  2ZEN A;  1UD2 A;  1MRZ A;  3CC4 B;  2V8V A;  1LFW A;  4PGO A;  1IJF A;  4DQL A;  3E0K A;  1NSL A;  2QEX B;  1D8T A;  4WJB A;  4XLA A;  3ZZU A;  2A4N A;  1YQE A;  2WZN A;  2Z3M A;  3B3W A;  1KZF A;  4CYN A;  2WYR A;  5JBQ A;  3CPA A;  1VQ4 B;  1QX4 A;  3QNV A;  4LX9 A;  1SM4 A;  5HKK A;  3W2H A;  2ZTG A;  1MJB A;  5LRG A;  4FK8 A;  4WZE A;  4P1V A;  2WSA A;  2QDX A;  2VJI A;  1FX0 A;  3VNU A;  2BSA A;  3WR7 A;  5K8O A;  4PXE A;  1OGJ A;  8CPA A;  1XJO A;  3VMF A;  4B11 A;  1J9Z A;  2PJ5 A;  5JQ4 A;  3W2G A;  4P10 A;  5A88 A;  1YLO A;  2C78 A;  2ZEL A;  1AMP A;  4XN3 A;  1I18 A;  1XIX A;  4R8F A;  2ZEE A;  1XE4 A;  3W5U A;  1M4L A;  4Q38 A;  3W6S A;  3OWC A;  4R3L A;  1HDU A;  2B58 A;  1LAN A;  2D3N A;  2VL1 A;  5HVF A;  1VHE A;  4NGM A;  3D7D A;  5I4M A;  2AFO A;  1KK3 A;  5HZB A;  2B5G B;  4IUS A;  1UMK A;  1VHS A;  3U6K A;  2OK8 A;  2E1R A;  3IGR A;  2GLJ A;  4ZCI A;  3DLJ A;  3WYA A;  2BPO A;  4II9 A;  1N0U A;  4AVB A;  1E3Z A;  3AVU A;  1PKV A;  1IB0 A;  4UIA A;  2DXQ A;  4JWP A;  1COW A;  2AHO A;  4QVA A;  1CJW A;  4C43 A;  2VEZ A;  3ZPN A;  3BNW A;  1N07 A;  4RDL A;  4U9U A;  4B5P A;  5DSZ A;  4K3N A;  2C4T A;  5EMI A;  2VBV A;  2GRE A;  1NMT A;  4R71 A;  4UF4 A;  3TOB A;  2Q43 A;  5DS0 A;  2VI7 A;  1HZE A;  4CGM A;  1NRK A;  4P3I A;  1BPL A;  1LRZ A;  3TCV A;  2CW5 A;  2GU2 A;  3NFZ A;  1ZM3 A;  3RNZ A;  1Z5R A;  2HC9 A;  2LZJ A;  1G7R A;  2IQ6 A;  2ZEP A;  2V77 A;  3BLN A;  2G9D A;  2XNC A;  4WZL A;  3LWU A;  1PCA A;  2B7C A;  4J3G A;  4ZV4 A;  4KSF A;  1Q2C A;  4WZK A;  3RY8 A;  3WND A;  1RQP A;  3LQE A;  1YHQ B;  2PMD A;  2ZXI A;  3R9E A;  7CPA A;  1FT7 A;  5G20 A;  2FCK A;  5HVG A;  2J8N A;  4DK1 A;  2HMA A;  1IU8 A;  1QGY A;  2Q7B A;  3OAA A;  3CT9 A;  2JJ2 A;  4I49 A;  1NBM A;  2YWE A;  4OC5 A;  3OPO A;  1XMT A;  1PUA A;  1X12 A;  2R7H A;  1WOR A;  4BPR A;  3OJX A;  2QGG A;  3LNN A;  1N8R D;  4XPD B;  3IJ3 A;  1A8P A;  2FIA A;  4EME A;  3CCM B;  3AVY A;  4NCZ A;  2ODF A;  3GIU A;  4L8J A;  2DPS A;  1KTV A;  1WPC A;  5K8N A;  1E64 A;  3CME B;  2DPT A;  2VBS A;  2AE6 A;  3OOC A;  4YAO A;  1FNO A;  1VF7 A;  2PRQ A;  3PEN A;  5F09 A;  1QFY A;  3P26 A;  1BJK A;  4E8O A;  2DCU A;  3R9F A;  3A8I A;  3R6K A;  2C6C A;  3TX8 A;  4F7D A;  4E2A A;  2GE3 A;  4UFX A;  1ELO A;  2I1L A;  4P6V F;  4KVM E;  5KW9 A;  3PBE A;  4KLV A;  1E62 A;  1EFR A;  3FXT A;  4M0L A;  3LO8 A;  1BPN A;  1PJ5 A;  3T51 B;  2VNI A;  2QJ8 A;  4C2Z A;  4TMZ A;  4P4D A;  4L8A A;  3BC9 A;  1S0U A;  4U5Y A;  4PC1 A;  3PEI A;  1IHM A;  4B44 A;  5F47 A;  5GV7 A;  3T53 B;  1F2P A;  2ZEM A;  1Q81 D;  3NE7 A;  3VO2 A;  3A8K A;  4X07 A;  4NGN A;  2QE7 A;  3BI1 A;  1H8E A;  2Q6I A;  2CC2 A;  4KVO E;  3B82 A;  2EIX A;  1GO2 A;  3V8I A;  3KHZ A;  4Y49 B;  3C26 A;  1E3X A;  2BN4 A;  4ZX9 A;  4U9Z A;  3H9N A;  3I1F A;  3KHX A;  1QGZ A;  4UFW A;  4XLC A;  6CPA A;  1TUI A;  1Q82 D;  1YLE A;  2E1B A;  3KI9 A;  2REF A;  2EVN A;  2AFS A;  4RLZ A;  3LD2 A;  4KS9 A;  4RPD A;  1Z8X A;  4P4J A;  1E1Q A;  4EWT A;  3R9G A;  3TO6 A;  1ARM A;  4CGO A;  2G3A A;  1NB0 A;  1YX2 A;  1J4J A;  4HE6 A;  2V7W A;  1XQB A;  4M6I A;  2X7B A;  1L0C A;  3TFY A;  5E96 A;  1ZM4 A;  2WUU A;  4RUH A;  1T6Y A;  3DGV A;  2XND A;  1ZG9 A;  4X5K A;  3ASP A;  4KOU A;  1YJN B;  1P0H A;  2XOK A;  3G3S A;  3W5H A;  1Y9K A;  2Q4Z A;  1W87 A;  2Q7S A;  3B8H A;  2GQF A;  3MRU A;  5THW A;  2V31 A;  3Q6Q A;  5LYL A;  4F8Z A;  2PQ8 A;  1GYT A;  4AXV A;  4F6A A;  4B48 A;  4A2Z A;  4KOT A;  3ISX A;  4XLE A;  1YR0 A;  3GB0 A;  3D8P A;  1I12 A;  3B3S A;  3T8W A;  3CMM A;  4NJQ A;  3QB8 A;  4F0X A;  3FEC A;  1GHE A;  2QYV A;  5BSY A;  2ZZQ A;  2EBJ A;  3KQX A;  4MHZ A;  4XN0 A;  4JMQ A;  2OR4 A;  3D26 A;  3OW2 B;  3FYN A;  4HNY B;  2Q04 A;  2ZIT A;  3H8E A;  2XNJ A;  2JDI A;  2C2W A;  3IU1 A;  4DNC A;  1VQK B;  1ZO0 A;  4GM5 A;  2B4D A;  4CQJ A;  4B3G A;  3IWE A;  1AMO A;  2R8V A;  1Z2L A;  4JLY A;  4OID A;  4EFD A;  2PE3 A;  4KUA A;  3CCJ B;  4N3G A;  4XKW A;  4G1V A;  2BL1 A;  1YSJ A;  4NEX A;  2BCO A;  2F1M A;  4PAB A;  5A89 A;  1YJ9 B;  3ASR A;  2DY1 A;  2FX3 A;  3P2H A;  1R57 A;  5JM6 A;  5AGE A;  3H94 A;  4MY0 A;  4X06 A;  1KK1 A;  2V7V A;  2P6E A;  4CYO A;  4Z4R A;  4Q7J B;  2CNT A;  3WC5 A;  2Q6K A;  4ZY0 A;  5FVJ A;  1OBR A;  1KC8 D;  1WWZ A;  1Z8L A;  2F5I A;  4BD9 A;  4X7E A;  3W6X A;  3FIX A;  4UCP A;  2ZL5 A;  1W2B B;  4PXC A;  3WXM A;  2PSW A;  5IYW A;  4P4I A;  1T6Z A;  4NGP A;  5IX3 A;  3LVB A;  4FUU A;  3LQ6 A;  2REE A;  2D9R A;  5HZA A;  4R9M A;  2PLF A;  4B43 A;  2FXF A;  3S9N A;  2IJZ A;  1RXT A;  3GIR A;  4A95 A;  4FN5 A;  3CZX A;  1KUX A;  1OB5 A;  4PXB A;  3QFR A;  2CRV A;  1ON0 A;  4ACA A;  2RC5 A;  2Q6L A;  3SHP A;  2CXA A;  2Z6B D;  4UAJ A;  1N05 A;  2KVO A;  3TTH A;  3IFE A;  4C7I A;  4B3X A;  4E0F A;  5HXB A;  2BUE A;  3CMA B;  2GK6 A;  2HQY A;  2OTL B;  4C68 A;  3KR5 A;  2GIV A;  3MN8 A;  4FD6 A;  4B3F X;  2DEA A;  3AVW A;  5C82 A;  3WC6 A;  4KOY A;  3DNS A;  3JVN A;  2EWB A;  2Q4V A;  1S60 A;  4AF7 A;  1E1R A;  3F5B A;  4MHP A;  2V7Q A;  4X8I A;  1VQO B;  4YEJ A;  2FL4 A;  2BV3 A;  1VHO A;  4CRZ B;  3VR6 A;  3IIB A;  4PV6 A;  4CYP A;  2PJ3 A;  4FBE A;  1Y7R A;  1XRY A;  3OJW A;  4B4D A;  4IHM A;  1CX8 A;  1IJE A;  1W0K A;  2BGI A;  4KSI A;  2I79 A;  3CP2 A;  4XNH C;  3WAB A;  3CES A;  3MCA A;  4PC7 A;  1F60 A;  2X85 A;  5F49 A;  1B23 P;  3KKW A;  2PR8 A;  4QFM A;  1KUY A;  2CIJ A;  2AFM A;  2FSR A;  1TKJ A;  1A2Z A;  2WPX A;  3FVL A;  4UEE A;  1EP3 B;  3I3G A;  2VXK A;  1WP6 A;  3VNV A;  5KTA A;  4JYW A;  3CP8 A;  1VLO A;  2WPD A;  4X7F A;  4K30 A;  3QFT A;  4AVC A;  4MFL A;  3V76 A;  4XNF A;  4M85 A;  4LBV A;  3DSB A;  4A38 A;  3FBU A;  4G7W A;  3MGD A;  4ACB A;  1IGB A;  1R3N A;  3WC7 A;  2B4D B;  4CAV A;  1S7L A;  4MFZ A;  4YGO A;  2OK7 A;  2WSS A;  4DK0 A;  4FAI A;  1OZP A;  4MHY A;  4EVY A;  1Q9S A;  2I00 A;  4CGL A;  1SQH A;  3GVK A;  2JEW A;  3I1U A;  3NH5 A;  4XM3 A;  1M44 A;  1WOO A;  2OBS A;  4B10 A;  4MYT A;  4P3Y A;  5AN9 A;  3HLP A;  4XKV A;  2AFW A;  2C5B A;  3CXC B;  2BMW A;  2C27 A;  3JRU A;  4NBS A;  2J7K A;  1FNC A;  1K73 D;  4RJL A;  5CDF A;  1Q2D A;  3MMP A;  2V8D A;  1WOP A;  4R6T A;  1QH0 A;  4Z4Y A;  4UA3 A;  3SEJ A;  3ASS A;  4TMV A;  4XOR A;  1N06 A;  1VQM B;  1DTD A;  3OFN A;  3W2I A;  3HAG A;  4ZX8 A;  3ZZI A;  1PYT B;  4MJ8 A;  3VWD A;  1HEE A;  2X6X A;  2XEJ A;  1UD4 A;  4OP4 A;  5BSX A;  2YNC A;  1H85 A;  1QSN A;  5IYN A;  5TV2 A;  3CW2 A;  3W91 A;  2V7T A;  1WOS A;  4TNU A;  5LRK A;  4JZ0 A;  4RD2 A;  1MJA A;  1H8H A;  4II2 A;  3VH9 A;  1DG1 G;  3D7H A;  1XE1 A;  3WT4 A;  3WQZ A;  2DF5 A;  3RYO A;  3FEE A;  3GSI A;  4CAX A;  4P44 A;  4BIN A;  4MBU A;  5G22 A;  3FRM A;  2ZW7 A;  1GJR A;  1FY7 A;  2BEI A;  4KZT A;  1WSV A;  1QSO A;  3ZC3 A;  2VNH A;  3D68 A;  1VLY A;  2D74 A;  2B5O A;  4OPV A;  1QG0 A;  3D7G A;  1I7P A;  1WTH D;  4GS4 A;  3D67 A;  2R1I A;  1YJW B;  5KSW B;  2Z3K A;  2W6I A;  3VO1 A;  3EO4 A;  3PP9 A;  2HB6 A;  1TF8 A;  3PGP A;  1XMB A;  1EWY A;  3N7Z A;  1CBX A;  3RO0 A;  2YWH A;  3KEW A;  2B7B A;  4CAW A;  2ZBV A;  2ZL7 A;  1R5N A;  4XQF A;  3TC8 A;  3G71 B;  4F9U A;  2VBQ A;  4FD5 A;  4MY3 A;  5A8A A;  2VZY A;  4UZF A;  5TRD A;  3KR4 A;  1RTQ A;  1KJZ A;  2X0K A;  4CRY B;  3I56 B;  3CPW B;  2ZZF A;  3AVT A;  4XPD C;  3BCF A;  2PJB A;  2ZOG A;  4MHD A;  4HE5 A;  3DR8 A;  4F0Y A;  4YEL A;  3CCS B;  1KK2 A;  2WZP P;  2OZH A;  4MMO A;  1E79 A;  2DOG A;  3FF3 A;  1MJ9 A;  1CQX A;  4A33 A;  5LYD A;  3QSY A;  1FRQ A;  4R87 A;  1TLL A;  2YNC C;  1DDG A;  1TIQ A;  1YX0 A;  5A27 A;  1GR1 A;  1YME A;  4H6Z A;  4G1P A;  1IB1 E;  2ZEG A;  2G3T A;  4OAD A;  4J0Q A;  1YVK A;  5IB9 A;  5FO0 A;  2QA4 B;  4NXY A;  2OBR A;  4FWT A;  1YIJ B;  1S7K A;  2PJ8 A;  5F4J A;  4UFV A;  3FJU A;  1TXR A;  4Z4T A;  5GV8 A;  4AG9 A;  4HPS A;  4RD0 A;  4H9G A;  3IO1 A;  2QTL A;  4ZBG A;  2Z3N A;  3WNB A;  3VAR A;  2BM0 A;  3WY9 A;  4MYU A;  2ZXV A;  4XL9 A;  3CDX A;  3Q38 A;  4BMH A;  3BY1 A;  3BY2 A;  4IW3 B;  3KZW A;  1Q86 D;  3PRT A;  5THX A;  4K1X A;  4X05 A;  4UEZ A;  3EY5 A;  4OLL A;  4UCN A;  1T6X A;  3QFS A;  5GCN A;  1YW4 A;  4Y49 C;  4KOV A;  4NFR A;  4NNJ A;  4P4B A;  1KQS B;  4MFQ A;  1UD3 A;  3B2Y A;  3NA6 A;  1B87 A;  2GJR A;  5IV0 A;  1V0F A;  3A9L A;  5FNZ A;  4KVX A;  3ZZ0 A;  1P4N A;  2ZW5 A;  2BOA A;  2XEF A;  3Q39 A;  2ZXH A;  2IL4 A;  5LMZ A;  3BXM A;  4YRH A;  4LBW A;  4TMX A;  4PQA A;  4NF1 A;  4CAF A;  1PJ6 A;  4Y7C A;  3PB6 X;  4YAW A;  1LAM A;  4UZU A;  1XB2 A;  5FL7 A;  3NH8 A;  4QV2 A;  1MAB A;  4RN7 A;  4B5O A;  4JXR A;  1YI2 B;  1I1D A;  4A39 A;  2ZZG A;  3A1P A;  3PB7 X;  2OTJ B;  3DDY A;  1QSR A;  1WU8 A;  3IU2 A;  4A37 A;  2B3U A;  2KCW A;  3ISZ A;  1Z9U A;  4M6G A;  2V8G A;  2D3L A;  2RC4 A;  1ZUN B;  2ZW4 A;  2ARH A;  2NMT A;  3GVL A;  3R95 A;  2PJ4 A;  1Z4E A;  3Q6R A;  1YRE A;  1N08 A;  4H2K A;  1M1K D;  1MK4 A;  1AUG A;  5AG6 A;  4YXW A;  4Z4S A;  4TKO B;  3GY9 A;  4OC3 A;  2PJ6 A;  1K4J A;  4AF6 A;  5H59 A;  1VKC A;  3D3S A;  1YK3 A;  3D4U A;  3K2K A;  1S5K A;  5DWM A;  5A28 A;  4ORF A;  2VZL A;  2JDD A;  4TN1 A;  1IIC A;  3TO9 A;  1BMF A;  2JBK A;  3SJZ A;  1S4M A; 
#chains in the Genus database with same CATH homology
 4Z65 A;  3PBB A;  3WC6 A;  1YLO A;  2EWB A;  1H8L A;  5D29 A;  2ZEL A;  4MHP A;  1AMP A;  5JGF A;  2AFU A;  4R8F A;  4X8I A;  2ZEE A;  1M4L A;  2F8H A;  1VHO A;  5LRJ A;  1HDU A;  3IIB A;  1Q7L A;  1ELL P;  3PFE A;  2PJ3 A;  4FBE A;  1LAN A;  1XRY A;  4IHM A;  2VL1 A;  1CX8 A;  1VHE A;  4KSI A;  4MCR A;  5HVF A;  2ABZ A;  4NGM A;  3D7D A;  5I4M A;  2AFO A;  3WAB A;  5K8P A;  1F57 A;  4P4E A;  3LMS A;  2GLJ A;  3DLJ A;  2CIJ A;  2AFM A;  4YU9 A;  1TKJ A;  3FVL A;  4UEE A;  4X3R A;  4OME A;  4JYW A;  2PJ2 A;  4UIA A;  4DUK A;  2FVG A;  2AFX A;  4MCP A;  3PB8 X;  2CTC A;  3B7I A;  4ZY2 A;  4K3N A;  1QMU A;  4A38 A;  4OC4 A;  1YW6 A;  2GRE A;  4OIW A;  4UF4 A;  1IGB A;  2Q43 A;  5DS0 A;  1R3N A;  3WC7 A;  1QQ9 A;  4LQG A;  3S9L A;  3PFO A;  4FAI A;  1ZG8 A;  2GU2 A;  3NFZ A;  2O53 A;  4MHY A;  3GLJ A;  1Z5R A;  1ZLH A;  4MXU A;  2HC9 A;  2JEW A;  3I1U A;  3NH5 A;  2IQ6 A;  2ZEP A;  2V77 A;  2G9D A;  4P45 A;  2ZEO A;  4MHN A;  3LWU A;  1PCA A;  5LYF A;  3HLP A;  1XFO A;  2AFW A;  2DEA A;  2EK8 A;  3JRU A;  4IAV A;  2CTB A;  3IEH A;  2C6G A;  7CPA A;  1FT7 A;  2V8D A;  4R6T A;  5HVG A;  4UEF A;  3BHX A;  1DTD A;  3CT9 A;  4NJR A;  4TWE A;  3IWW A;  4OC5 A;  2RB7 A;  4ZX8 A;  1PYT B;  2ZED A;  1LOK A;  2QVP A;  1HEE A;  3GUX A;  1F2O A;  2XEJ A;  4Q7A A;  3IJ3 A;  4OP4 A;  4DYO A;  4EME A;  3RBU A;  1LCP A;  1TKH A;  4UIB A;  4TNU A;  5LRK A;  4NGR A;  4JZ0 A;  5K8N A;  2C1C A;  3V7Z A;  1R43 A;  4NGQ A;  3VH9 A;  3BI0 A;  3RZA A;  4MCS A;  4PPZ A;  3D7H A;  1FNO A;  1ZLI A;  3B35 A;  3WT4 A;  2PRQ A;  4PXD A;  2PJ9 A;  2AFZ A;  5F09 A;  3VAT A;  2I3C A;  3KGQ A;  5J1Q A;  2C6C A;  4R76 A;  3TX8 A;  3FEE A;  4P44 A;  1VGY A;  4DJL A;  1EE3 P;  1VIX A;  3PB9 X;  4NGS A;  5D8N A;  4IK2 A;  3D68 A;  4FWU A;  3D66 A;  3FX6 A;  2XEI A;  3D7G A;  3B3V A;  3PB4 X;  3PBE A;  2PJ1 A;  3B3C A;  5K8M A;  1BPN A;  3D67 A;  2Q51 A;  3FMC A;  1ELM P;  2C6P A;  2QJ8 A;  2HB6 A;  2PJ0 A;  1TF8 A;  4P4D A;  4MRI A;  1XMB A;  1CBX A;  2PJ7 A;  3PEI A;  2CF4 A;  1F2P A;  3TC8 A;  4O23 A;  1Y7E A;  2ZEM A;  4F9U A;  3FED A;  4W9Y A;  3FH4 A;  1BPM A;  4NGN A;  3N5F A;  3BI1 A;  3KR4 A;  2F7V A;  1RTQ A;  1AYE A;  2PJC A;  1TKF A;  3KHZ A;  3K9T A;  1IY7 A;  1ARL A;  4ZX9 A;  2PJB A;  2ZOG A;  3KHX A;  1CG2 A;  1HDQ A;  4OC2 A;  6CPA A;  1NSA A;  4OKO A;  1CP7 A;  1LAP A;  3KI9 A;  4ONW A;  4MMO A;  4P4J A;  2AFS A;  1BLL E;  4EWT A;  3FF3 A;  4R7M A;  1CPX A;  1ARM A;  2EK9 A;  5CPA A;  5LYD A;  1KWM A;  2RFH A;  4F9V A;  4RUH A;  3KQZ A;  3DGV A;  1ZG9 A;  1YME A;  4G1P A;  2ZEG A;  5IB9 A;  1DE4 C;  3SJG A;  1JQG A;  2Q4Z A;  2PVV A;  3MRU A;  2POK A;  3KAS A;  4X2T A;  4YWY A;  5THW A;  3B3T A;  2PJ8 A;  3SJE A;  4P6Y A;  2BO9 A;  5LYL A;  3FJU A;  4OC1 A;  4F8Z A;  1TXR A;  3SI2 A;  1GYT A;  4AXV A;  4CPA A;  1CPS A;  1Y0Y A;  3IO1 A;  4ZI6 A;  5CBM A;  3ISX A;  3NH4 A;  3GB0 A;  3H8G A;  3KL9 A;  3B3S A;  3VAR A;  3T8W A;  1BAV A;  4NJQ A;  1Y0R A;  3FEC A;  3CDX A;  2QYV A;  2NYQ A;  1XBU A;  4A94 A;  3H8F A;  3KZW A;  3PRT A;  3KQX A;  4MHZ A;  2JBJ A;  2OR4 A;  4UEZ A;  3SI1 A;  3D7F A;  5HVH A;  5ELY A;  4NGT A;  4ZY1 A;  1YW4 A;  3H8E A;  4NFR A;  4P4B A;  2J9A A;  3CPX A;  2IMO A;  3B2Y A;  3V38 A;  3NA6 A;  4GM5 A;  4OID A;  1ZG7 A;  1Z2L A;  2PIY A;  2ZOF A;  4EFD A;  2V8H A;  2PE3 A;  2PIZ A;  1CP6 A;  2ANP A;  1YSJ A;  2PCU A;  3SI0 A;  2BCO A;  2BOA A;  2NSM A;  5HXD A;  2XEF A;  4OC0 A;  5JM6 A;  2PVW A;  1TF9 A;  3BXM A;  3SJF A;  4PQA A;  4P4F A;  2GLF A;  4ZYQ A;  4MCQ A;  3PB6 X;  1UWY A;  1LAM A;  4WWV A;  3NH8 A;  3WC5 A;  4ZY0 A;  2XEG A;  1OBR A;  2OOT A;  3S9M A;  1Z8L A;  3SJX A;  2ZEH A;  4BD9 A;  4A39 A;  2O4H A;  3RAM A;  2ZEN A;  3PB7 X;  3IC1 A;  2V8V A;  1LFW A;  4A37 A;  3L2N A;  4PXC A;  3ISZ A;  4WJB A;  2V8G A;  3HUV A;  4P4I A;  4NGP A;  4FUU A;  2WZN A;  3B3W A;  2WYR A;  3S9N A;  3CPA A;  2IJZ A;  2PJ4 A;  5JH9 A;  2PJA A;  3QNV A;  4H2K A;  5LRG A;  4PXB A;  4OC3 A;  2PJ6 A;  4B6Z A;  5K8O A;  4PXE A;  3IFE A;  3D4U A;  2ZEF A;  3K2K A;  5LYI A;  8CPA A;  1XJO A;  2PJ5 A;  3KR5 A;  3MN8 A;  2JBK A;  4P10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...