3KL9A

Crystal structure of pepa from streptococcus pneumoniae
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
355
structure length
340
Chain Sequence
b'SMTTLFSKIKEVTELAAVSGHEAPVRAYLREKLTPHVDEVVTDGLGGIFGIKHSEAVDAPRVLVASHMDEVGFMVSEIKPDGTFRVVEIGGWNPMVVSSQRFKLLTRDGHEIPVISGPAIADIVFDGGFADKAEAESFGIRPGDTIVPDSSAILTANEKNIISKAWDNRYGVLMVSELAEALSGQKLGNELYLGSNVQEEVGLRGAHTSTTKFDPEVFLAVDCSPAGDVYGGQGKIGDGTLIRFYDPGHLLLPGMKDFLLTTAEEAGIKYQYYCGKGGTDAGAAHLKNGGVPSTTIGVCARYIHSHQTLYAMDDFLEAQAFLQALVKKLDRSTVDLIKHY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl aminopeptidase
publication title Structural basis for the substrate specificity of PepA from Streptococcus pneumoniae, a dodecameric tetrahedral protease
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 107
structure length 340
sequence length 355
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.7: Glutamyl aminopeptidase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3kl9A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kl9A01
3KASA 4NGTA 1UWYA 5IB9A 5CPAA 1ZG7A 4UEEA 5HVGA 1F2PA 1ZG9A 3CT9A 3VH9A 3QNVA 4MHPA 1VHEA 1OBRA 2C6GA 3PFEA 4ZI6A 3BI0A 4YWYA 4PPZA 2O4HA 3IO1A 4P6YA 2PJ0A 2PJBA 1VGYA 2RFHA 2QVPA 4ONWA 2V8VA 2PJ6A 6CPAA 1TF9A 4K3NA 2OR4A 4O23A 5K8OA 2ZOGA 2AFSA 7CPAA 5HXDA 4JYWA 4OKOA 3FF3A 2AFXA 2IQ6A 2ZEGA 5K8MA 3TC8A 3CPAA 3KQZA 4UEZA 1CPXA 4P44A 4MHYA 3PFOA 4JZ0A 3FVLA 4IHMA 1LAPA 1Z5RA 5LYIA 5LYFA 2QYVA 4DUKA 2AFUA 2PVWA 1TKHA 3S9MA 4A94A 4ZY2A 1QMUA 2PVVA 1LOKA 4WWVA 1XBUA 2V8GA 2O53A 1Y0YA 4ZX8A 3H8FA 4DYOA 4ZY0A 3KR4A 2ZELA 2NYQA 3D7HA 4DJLA 4PXBA 1Q7LA 4X2TA 3VARA 4F8ZA 3WC7A 4NJQA 4NGMA 1LFWA 2WYRA 3MN8A 3NA6A 1CX8A 4ZY1A 2ZEEA 2C6CA 1PYTB 3B3SA 3D7DA 4PXEA 2AFWA 3T8WA 4UIBA 1NSAA 3NFZA 3KGQA 4ZX9A 3KZWA 4P45A 2ANPA 2EK9A 2CF4A 4A39A 3KHXA 4AXVA 4NGQA 3SJFA 2CTCA 4X8IA 1PCAA 3D4UA 1H8LA 4KSIA 2PJ9A 3N5FA 4EWTA 1M4LA 2AFOA 5K8NA 2XEFA 2ZEPA 2HB6A 4Q7AA 4CPAA 2WZNA 3B3CA 1HDUA 2ZEHA 2EWBA 3KQXA 3NH8A 1BPNA 2V8DA 4FBEA 5JM6A 3NH4A 3WABA 3KI9A 4GM5A 4NGNA 3B3WA 4EMEA 2GREA 1F57A 1CP6A 4ZYQA 4P4FA 1AMPA 1TXRA 4Z65A 2XEGA 1XFOA 1XRYA 4OMEA 1CBXA 2AFZA 3FJUA 3CDXA 3B3TA 4F9UA 3ISXA 3D7GA 3GB0A 3B7IA 5LRGA 1IGBA 4R7MA 4MCSA 3FECA 4P4IA 2PJ2A 4YU9A 4OIDA 1LCPA 3BHXA 2ZEOA 3SJXA 4OC5A 3H8EA 3KHZA 2F8HA 3L2NA 3CPXA 4MXUA 2PCUA 5D8NA 2POKA 3FEDA 5THWA 1BLLE 4NGRA 2Q4ZA 3B3VA 4G1PA 3HLPA 2GU2A 4UEFA 1Z8LA 3DLJA 4MCRA 2BOAA 3DGVA 3IJ3A 3KL9A 2ZENA 2AFMA 1LAMA 3D68A 2PE3A 4R8FA 3IFEA 3PB7X 4UIAA 3D7FA 1YSJA 5CBMA 1CG2A 4P4JA 2BO9A 4OC4A 4OP4A 2PJAA 1YLOA 2V77A 3IC1A 3PB4X 4P4EA 1TKJA 4W9YA 1IY7A 4MRIA 2FVGA 4MCQA 2V8HA 2PJCA 3B2YA 3BI1A 1CPSA 1FNOA 4PXDA 3D67A 1ELMP 4OC2A 3IEHA 1ARLA 2I3CA 4A38A 3RZAA 3FEEA 2J9AA 1XMBA 1Y7EA 5LYDA 2ABZA 1R43A 1F2OA 4B6ZA 4BD9A 3K2KA 3B35A 3GLJA 4P4DA 3SI1A 2PJ7A 2PJ4A 2BCOA 3LWUA 2PJ1A 1VHOA 4TNUA 2JBKA 1DE4C 3BXMA 3JRUA 4X3RA 2GLFA 2PJ8A 5JH9A 2C6PA 5HVFA 1BPMA 4OIWA 3WC5A 1GYTA 1JQGA 1EE3P 1VIXA 1ZLHA 3SI2A 4WJBA 4IK2A 3IIBA 5D29A 4UF4A 4NFRA 2ZEFA 2CTBA 2QJ8A 3K9TA 1HDQA 5ELYA 2JBJA 5I4MA 4FWUA 2JEWA 2CIJA 2NSMA 1BAVA 1TF8A 5DS0A 3V7ZA 3KR5A 3SJGA 3FX6A 3MRUA 5F09A 3FH4A 3PBBA 4NGPA 2VL1A 4PQAA 1ARMA 3RBUA 4NJRA 4MHNA 2ZOFA 3FMCA 1CP7A 4MHZA 2HC9A 1ZLIA 5LRJA 5LYLA 1DTDA 2Q51A 1Y0RA 2G9DA 2ZEDA 4OC3A 1YW4A 2PRQA 4EFDA 4OC0A 4RUHA 1ELLP 2GLJA 5JGFA 2EK8A 2Q43A 3D66A 3VATA 3WC6A 2F7VA 3IWWA 1Z2LA 1KWMA 2IMOA 8CPAA 4PXCA 3S9LA 4TWEA 2RB7A 2PJ5A 4FUUA 3SI0A 2C1CA 4FAIA 3TX8A 1XJOA 1ZG8A 1AYEA 4R76A 3LMSA 4A37A 2ZEMA 1LANA 2IJZA 2PIYA 4OC1A 1RTQA 1FT7A 4P4BA 4P10A 3PB8X 3PB6X 3PBEA 2DEAA 2PJ3A 4IAVA 4R6TA 4H2KA 3WT4A 3PRTA 4LQGA 1QQ9A 2OOTA 3I1UA 3V38A 4MCPA 4NGSA 1YMEA 3H8GA 3HUVA 3SJEA 1HEEA 5HVHA 2PIZA 5K8PA 1YW6A 3S9NA 2XEIA 3PB9X 3RAMA 3GUXA 5J1QA 3ISZA 1TKFA 3PEIA 4MMOA 4F9VA 5LRKA 3NH5A 1R3NA 2XEJA
chains in the Genus database with same CATH superfamily
3KASA 2F1LA 3R96A 3TO6A 1DARA 4XKVA 1UWYA 4LQ6A 1H8HA 5CPAA 2Q7SA 2FT0A 4RDKA 4PC6A 4X06A 3BQJA 5A8AA 3QFCA 4ZGQB 2ARHA 3CD6B 1VHEA 5EMIA 4YAUA 2ZW7A 3EFAA 5C88A 3H94A 1SKYB 1W0JA 4UZUA 4FK8A 4Z1MA 3BI0A 3EC4A 2V7UA 3AVWA 4KLVA 2O4HA 4UBRA 4Z4TA 1Q82D 1N08A 2P6GA 5JQ4A 4F0XA 1VGYA 2RFHA 3LVBA 1WP6A 1QSTA 1TF9A 3S6GA 4O23A 1MJ9A 3ASTA 2J8RA 2AFXA 2IQ6A 2ZEGA 2ZTNA 3CPAA 1CPXA 2R98A 3JQQA 1BOBA 5FIUA 2RC6A 4JZ0A 1ELOA 4Y49C 3E20A 5LYFA 3VO1A 2AFUA 2WJYA 2HDNB 3AGQA 4A94A 2BPOA 4MFJA 1S60A 4WWVA 1BJKA 4R3LA 4XL9A 2O53A 5F4JA 4C2XA 3VNUA 4QVJA 3D7HA 3T9YA 3B8GA 3A3BA 1XQBA 3NH5A 4X2TA 2BSAA 2ZXHA 1MJAA 4F8ZA 4P6VF 2H5MA 2OZGA 5IYPA 1CX8A 1Y9WA 4ZY1A 4A33A 4CGNA 1YR0A 3I55B 4NEXA 1YK3A 2PC1A 4PXEA 1HA3A 1YQEA 4UCMA 3CCUB 1NSAA 2Q6IA 4B3FX 3KZWA 5B6IA 4Y49B 4AXVA 1WU8A 1K8AD 4Z4WA 1YREA 3ZZIA 3CCSB 2CTCA 3OZWA 1H8LA 1PJ6A 3JVNA 5BWAB 4EWTA 4B47A 5K8NA 1RXTA 2C2WA 4CPAA 4YAWA 2VZYA 1M1KD 3B3CA 2PIAA 3KQXA 1VQKB 1BPNA 4K30A 1KUYA 5JM6A 4R57A 2OYNA 2B4DA 4GM5A 4M2LA 4NNJA 2VXKA 5AG5A 2GREA 1UD3A 2VZZA 3W2FA 1AMPA 1FNBA 4YAOA 2NV4A 2XEGA 3CXPA 4Z65A 4R9MA 2OU2A 4OMEA 4CYPA 3Q3AA 4Z4YA 3CDXA 1QSMA 4F9UA 2R9VA 3ISXA 1EFCA 4AB7A 4XN0A 1S5KA 3B7IA 1OHHA 2FX3A 3AGPA 2J8NA 2B5GB 4U9ZA 2VNHA 3FECA 2PMDA 4P4IA 2VJJA 4TT3A 1ZM2A 1E43A 1WSVA 3SJXA 2B5OA 3P2HA 2I00A 1XIXA 3I56B 2OBSA 4E0AA 4MXUA 4B43A 5DWMA 3U6BA 5F49A 4AVZA 3CW2A 4UCNA 2DIEA 1BLLE 2Q4ZA 5FNZA 1J9ZA 4RD3A 3B3VA 3HLPA 3QAYA 2PDOA 1Z8LA 1YI2B 1EP1B 5AG4A 3KL9A 3DNSA 1EWYA 3RYOA 1OB2A 2XNJA 3PB7X 2GK6A 1W9XA 3VNVA 3D7FA 1YSJA 3CP8A 2E1RA 2PJAA 4OP4A 4B3GA 4JD6A 2DPTA 2YNCA 4W9YA 1F20A 1S7FA 4OPSA 3TT2A 1VLYA 5BSXA 2V8HA 1XE1A 2WPWA 4RCZA 3JQPA 2V31A 4C2YA 4KUBA 4LBVA 2X85A 3OZUA 3CC2B 1ARLA 4KSAA 3PP9A 4A38A 3FEEA 2J9AA 1JNYA 3SLDA 4B44A 5LYDA 2ABZA 1R43A 5J8CA 2OB0A 3K2KA 1T6ZA 2DY1A 1FRNA 1Z9UA 2DXQA 3GLJA 4MY3A 3SI1A 3OWCA 2CBXA 2YNDA 4R71A 3B78A 1EXMA 4II2A 2V4DA 3CMMA 3JRUA 2BV3A 3ZC3A 5CNPA 1NMTA 4XLAA 1WDTA 1GYTA 1GR1A 1KRHA 1QGZA 1UD6A 4WJBA 1E79A 4MY0A 3H9NA 2X0KA 4NFRA 2C27A 2ZEFA 3WXMA 2D4OA 2YGWA 3BC9A 1Z8XA 4FWUA 4LBYA 1NB9A 3SJGA 1M4GA 2R8VA 3CRZA 4RD6A 1YX2A 4K1XA 4ZV4A 1IU8A 3KEWA 3RBUA 1UFHA 2X6YA 3V76A 1GJRA 1CP7A 4OLLA 1QH0A 1OB0A 2OK7A 2QDXA 2HC9A 4MHZA 1BO4A 1GHEA 2AJ6A 1ZLIA 1CNFA 3GIRA 1R5NA 2VBTA 4OC3A 2PRQA 4WZLA 2ZPAA 3G3SA 4RI1A 2B4DB 4RUHA 4WZTA 2X6WA 2GLJA 1FY7A 5BSYA 3OP1A 2EK8A 3D66A 2HCJB 4MYTA 1IIDA 4QFMA 3BNWA 1UMKA 2BF4A 1WOSA 4M0LA 8CPAA 4PXCA 3S9LA 1E64A 2A4NA 1A2ZA 1YLEA 4RPDA 4PSXA 4A37A 1LANA 3AVUA 3U6KA 2PIYA 3F8KA 4RCYA 4XPLA 3W5UA 3T51B 1MRZA 4P10A 3R6KA 3PBEA 2PJ3A 4IAVA 3WT4A 4H2KA 3FPPA 4JXRA 2LZJA 3E1YE 2GK7A 4LQGA 2OOTA 4AVBA 1KK2A 4XD7A 4MCPA 2WJVA 2GJRA 3LQ6A 4UFWA 1TTTA 5HVHA 2PIZA 1S7LA 3JTKA 4R3KA 3RAMA 5TV2A 3WBKA 3P26A 3ISZA 5I0CA 1BX1A 4DNRB 4MMOA 3K9UA 4F9VA 1EFTA 2AFZA 1E1QA 1PJ7A 1R3NA 3JUWA 2XEJA 4RD1A 2QGGA 1QFZA 3OW2B 2EBJA 5IB9A 1E62A 3G8WA 2B7BA 3I3GA 3CT9A 4LUAA 1JWQA 5FVJA 4A31A 4MHPA 4CAXA 5EC4A 3NE8A 4XOPA 3P2FA 3Q39A 4ZI6A 4PPZA 2JJ1A 4LC0A 1K4JA 4P6YA 2QIRA 3OJXA 1PU9A 4Y7CA 4DNTB 1A8PA 2Q6OA 5IX3A 1Z4EA 1QX4A 2OR4A 3TFYA 2EUIA 5A89A 5HXDA 3FF3A 1VQNB 3KQZA 3GY9A 1KZFA 3GQBA 1H8EA 4II3A 4XONA 3CC4B 2AHOA 1E3XA 3BJ7A 4PC1A 4UFVA 4YHBA 4MHYA 3PFOA 3F5BA 3FVLA 1QGAA 2FXFA 1JA1A 4FWTA 2VBUA 2QYVA 2QMLA 2Z3KA 4DUKA 3GVLA 4KORA 3TOBA 3S9MA 4ZY2A 1TVCA 1QMUA 2ZW6A 1LOKA 4CQJA 4CGLA 4KOSA 5JBQA 5IB0A 4F6AA 3DR8A 4ZX8A 5J35A 1D1NA 3KR4A 4XNHC 2ZELA 2WSAA 4RDJA 4WQMA 1IB1E 1Q7LA 3QFRA 4Z4SA 5FO1A 3AVTA 5HZAA 1LFWA 2WYRA 3OPOA 4P3IA 3MN8A 1Q2DA 4KVME 3W2EA 2C6CA 2XNCA 3NE7A 4UIBA 1K28D 3VMFA 3OAAA 5DSZA 5KTDA 2Z6BD 2VNKA 5AGEA 3N7ZA 1NE9A 3PUNA 4P45A 4G7XA 2EK9A 2CF4A 3G71B 2ATRA 4F0YA 5H84A 3W6SA 2DERA 4NGQA 1W35A 4X8IA 1I7PA 4AG7A 1PCAA 1JA0A 3N5FA 3OKXA 1WTHD 4TMZA 2XEFA 2HB6A 1B87A 1R5BA 2EWBA 3SJZA 3CCLB 4FBEA 5IV0A 3BLNA 2BN4A 1D2EA 4C2ZA 4RJLA 4EMEA 1F57A 4M6IA 1UD4A 1XRYA 1KTVA 4RN7A 2Y0MA 2YWEA 3GVKA 3B3TA 1Z8WA 1S7NA 5GCNA 1QGYA 2Z0ZA 3PA2A 1YVOA 3FJOA 4R7MA 3DDYA 4X07A 2EIXA 2PJ2A 4OPVA 2XGJA 1BX0A 4H6UA 1KUXA 4YU9A 4OIDA 4PGOA 4P3YA 1V5VA 3PENA 2CXAA 4Q36A 2PCUA 3WR7A 3H5ZA 2Q6KA 4P1VA 1KQSB 3FEDA 3OJWA 5THWA 1NJID 4X7FA 4NGRA 4Y9RA 4C7IA 4FD4A 4HKFA 1P0HA 4HE5A 4CYOA 4UEFA 2ZZQA 4C0SA 4PSWA 1ZO0A 3IJ3A 2G0BA 3D68A 2XEXA 4R8FA 5FL7A 1N05A 4P4JA 3IWGA 1WWZA 3IC1A 4RD0A 1QSOA 4FN5A 1E63A 5TY0A 1SQHA 5IYRA 1M44A 3B2YA 4Z4RA 4EH1A 1VF7A 4PK2A 1FNOA 2FL4A 4FD5A 4L89A 4OC2A 3ZUGA 2QN6A 4MI4A 4ZCLA 2KCWA 3MHPA 3TO7A 3RNZA 3FRMA 1Y7EA 5F4MA 1S4MA 3BY1A 3V8IA 2F43A 1ZUNB 1F2OA 1IJFA 4B6ZA 3W2GA 4BD9A 2PJ4A 3Q6RA 1QFYA 3EY5A 4QC6A 4XKWA 4G7WA 3G05A 4C7HA 1NDHA 2JBKA 3ASQA 1DE4C 2PJ8A 2X53S 2PSWA 1LRZA 4YELA 4OIWA 2BGJA 5G21A 3G6EB 1EE3P 2JJ2A 1W34A 1S72B 5D29A 4UF4A 4ZGNB 2CTBA 2QJ8A 3TCVA 2ZZFA 1HDQA 3PVDA 2JBJA 1JB9A 4Z4ZA 1YIJB 4B12A 5IYWA 4FD6A 1BAVA 4P26A 1TF8A 5JPHA 1CM0A 3OE7A 2OBTA 4ZCMA 4JJXA 3MRUA 1GAQA 4A32A 5F09A 2JDCA 4LBWA 3HAGA 5KW9A 3ZBTA 2YNEA 4II9A 3ZJ0A 2DEUA 1B23P 5FA6A 4MHNA 1W87A 2Z3OA 2ZOFA 2VJIA 4B3XA 3CXCB 4B48A 2OZHA 3TOAA 3UY5A 1QVFB 2CC2A 1E1RA 5LYLA 4PK3A 3F0AA 2Q51A 2QA4B 2OTLB 4H6ZA 3ONYA 1H85A 4NCNA 1HVXA 4B11A 4EFDA 4OC0A 3LD2A 2AE6A 3IGRA 2GJKA 3JQRA 2Q43A 2BUEA 3WC6A 4A95A 4U9UA 1KWMA 4J3GA 4TWEA 2JEVA 2PJ5A 2G3TA 4I49A 3GSIA 1S3ZA 2C1CA 1N0VC 2ZTGA 4FAIA 3TX8A 2ZL5A 4RD4A 4BMHA 3PGPA 1ZM9A 1WORA 3LMSA 4B13A 2ZEMA 1VLOA 2WPXA 3W5VA 4B5OA 3S6HA 3ES9A 1N71A 2ZXVA 1QUEA 1FT7A 1IICA 2DEAA 1WPCA 1G7SA 2FE7A 3PRTA 2P3MA 1QQ9A 3BY2A 4XLHA 3I1UA 4KLWA 1YMEA 3HUVA 3W5HA 5KSWB 3SJEA 3SJPA 1KZLA 1WK4A 1YW6A 2XEIA 4GQNA 1K9MD 4M3SA 5DN6A 3WNBA 2OK8A 1N07A 2HMAA 4MYUA 4OAEA 5KTCA 4XLFA 1B6BA 3EO4A 4NGTA 4RPBA 1QVGB 2JIZA 1VQ6B 1I21A 4CAEA 2BMWA 2V7TA 5HVGA 5G1ZA 1F2PA 2YWHA 3ASPA 3R9FA 1ZG9A 1ZM3A 4HNWB 4CAFA 5F4OA 1YJWB 3VH9A 4MJ8A 1G7TA 4KKUA 1OBRA 2C6GA 4KSFA 3PFEA 4L8AA 3CTAA 1Y7RA 3GKRA 2PJBA 4X7EA 2V8VA 6CPAA 2P6EA 5HMNA 4K3NA 2QE7A 3ZIAA 5K8OA 2VNIA 2AFSA 4PABA 7CPAA 4FD7A 3OEEA 4JYWA 3DDDA 3TC8A 3CCEB 1YHQB 1I12A 4P44A 1QG0A 3DR6A 4TSFA 1BLIA 4R87A 5A28A 2DETA 4GS4A 4IUSA 1LAPA 1Z5RA 4KKTA 4HNXB 4L8JA 3CCMB 2RC4A 2YNCC 5H86A 2DCUA 1TKHA 4A2ZA 2PVVA 4YRHA 3D2PA 1XBUA 4MFKA 2V8GA 5GV8A 3ZZUA 2ZZGA 2PR1A 4CAVA 2Z10A 5EBVA 2Z3LA 4A30A 4DJLA 1KK3A 2HUZA 4X7CA 2PR8A 4OADA 1OGIA 2C77A 4PXBA 4B5PA 1I8DA 3ZZ0A 3VO2A 3FPKA 2F5IA 5THXA 1IOFA 3VARA 1N0UA 4NJQA 2X6XA 3EXNA 3OOCA 3FKSA 3SKBA 2VNJA 1PYTB 4QV2A 2REFA 3D7DA 1EP2B 2AFWA 4PC3A 3VWEA 1UD8A 1YVKA 3A1PA 3D2MA 2C4UA 1VQMB 4RS2A 1VQOB 4U5YA 2JDDA 3KHXA 4RDLA 3FXTA 3D4UA 2PJ9A 2QTLA 2D9RA 4C43A 2QMUA 2WZNA 4HNYB 2ZEHA 3NE5B 3NH8A 2FS5A 4XPDC 4PC2A 2BM0A 4JMQA 4ZBGA 1BQEA 3NH4A 3LO8A 4ASUA 2VBSA 4NGNA 4YXWA 4P22A 1FX0A 1CP6A 1S0UA 2VBQA 3WBJA 4P4FA 4ONUA 4Z4UA 1TXRA 1XB2A 4TMVA 1XFOA 1VQ9B 4CAWA 3FJUA 1VKCA 4B14A 1G7CA 4YGOA 5LMZA 3D7GA 4ROXA 4RLZA 2F4NA 5LRGA 1IGBA 3U2QA 4J0QA 4MCSA 4CRYB 3CP2A 4DK0A 2WUUA 1GVHA 1FDRA 1M1DA 4ZCIA 4BPRA 3DSBA 4UA3A 2V7WA 2V7VA 3KHZA 2F8HA 3CPXA 3FBUA 2QTZA 5D8NA 4OOSA 2DPSA 1V0FA 1P4NA 2VI7A 1NB0A 1T6YA 4Q7JB 1VQLB 3R95A 1NSLA 4G1PA 4XPDB 2GU2A 4AVCA 4MCRA 2BOAA 1G7RA 5TRDA 1J4JA 2AFMA 1LAMA 1DDGA 4KUAA 2BGIA 1XF8A 1KUVA 2C5BA 1TIQA 2WR8A 1PUAA 2BO9A 1OGJA 3W91A 1YLOA 1EFRA 4XLEA 2V77A 4ACAA 3PB4X 1P4MA 1IY7A 4CGMA 4MRIA 2FVGA 4MCQA 4N3GA 4DK1A 5J3OA 1CPSA 3R9GA 1FRQA 4PXDA 3D67A 1ELMP 2B3UA 1Q2YA 1RQPA 3IEHA 2X3UA 4KOXA 3GYAA 5A27A 1W2BB 3KKWA 5E6TA 3CCQB 4B4DA 3BH4A 1XMBA 1RQRA 1KD1D 5G20A 3B35A 4P4DA 1ON0A 1BMFA 2PJ1A 2GE3A 3Q6QA 1VHOA 1KJZA 4TNUA 1Y9KA 4X3RA 3BXMA 1E3ZA 4JWPA 2Q4YA 4B10A 5HVFA 3B8HA 1DDIA 2K5TA 4XNHB 2JLMA 1B2RA 5F48A 3RO0A 5HH1A 3SI2A 4DNCA 1PJ5A 3SEJA 4KVXA 3OEHA 3IIBA 1MK4A 1W0KA 3K9TA 3R6JA 5J8FA 4QBJA 3ASRA 2C78A 2JEWA 3WY9A 4YFJA 4X05A 3D8PA 4OP7A 5DS0A 3VWDA 3V7ZA 1UD5A 3LNNA 4OOVA 4XLCA 4QUSA 5TR9A 3E0KA 3FX6A 1Q7YD 5KNLA 3FH4A 3A9LA 4IW3B 2YWFA 3WQZA 1F60A 4NGPA 1EP3B 4PQAA 4BINA 1DG1G 3RY8A 2D3NA 3FMCA 4QB9A 4G1BA 4RM0A 3SHPA 1FNDA 3CC7B 4NBSA 3BCDA 1KC8D 2GPJA 2WZPP 1IYLA 2G9DA 2ZEDA 2PLFA 5IK2A 4TKOB 2YWGA 2E1BA 4CYNA 2GQFA 1XE4A 2WPDA 2CNSA 2QECA 1X10A 1ELLP 2GJPA 2CNDA 1M4DA 2CNTA 1VJSA 5JGFA 5F46A 1N06A 1COWA 3CPWB 1YX0A 4YALA 2IMOA 2RB7A 4QHYA 1NRKA 1XEBA 4JXQA 3ZPNA 2Q4VA 1XJOA 4XN3A 1ZG8A 2J7KA 1AMOA 3CCJB 1YJ9B 3G4SB 4N3NA 4M85A 4OC1A 4G6IA 3JU4A 4P4BA 2KVOA 2OH1A 2B58A 4AF7A 5C82A 2GFQA 1RO5A 1I18A 1VHSA 3B82A 2ZL6A 4M6GA 1OZPA 4Z4VA 2W6IA 3QE2A 1HEEA 5K8PA 3S9NA 1TLLA 4UWJA 3LQEA 3T56B 3A35A 5ISVA 5LRKA 2X8KA 3AVXA 3D26A 2EO8A 3W6XA 1VQ7B 4G5GA 1KMHA 4KOTA 1ZG7A 4UEEA 4XPKA 1TUIA 1YITB 3P27A 4HE6A 2NPFA 2W6JA 4KOVA 4PC7A 1WOPA 3ZZTA 1IJEA 2VQYA 3QNVA 2Z3MA 4OOXA 4X7DA 1I1DA 2ZW4A 4QVAA 4YWYA 2BL1A 1IB0A 3IO1A 2PJ0A 2F1MA 4ACBA 2QVPA 2DF5A 4EVYA 4ONWA 2R7HA 2PJ6A 2VZLA 2C5HA 2EVNA 5HXBA 2HLDA 2R1IA 2ZOGA 3OZVA 1GAWA 4CGPA 4OKOA 3A3GA 1CQXA 2ZBUA 5K8MA 4UEZA 2CY2A 5G22A 1KK0A 1JJ2B 2ZXIA 2BVNA 2I1LA 5KTAA 4IHMA 4MFLA 5LYIA 2P6FA 2Q04A 4XMYA 1M90D 3I9SA 2PVWA 5CDFA 3CMAB 4CS0B 2PQ8A 2CW5A 3J81k 2ZL7A 1Y0YA 1CJWA 3QB8A 3S6KA 4DYOA 3H8FA 4ZY0A 2NYQA 1UD2A 1SM4A 2JN9A 2D74A 4LBZA 4DQLA 1L0CA 3A8JA 3WC7A 1AUGA 5IYNA 2HV2A 4XNFA 4NGMA 3NA6A 4LX9A 4MFPA 2ZEEA 2Q44A 2OZUA 4BBHA 2OBRA 4XOTA 3B3SA 4QUZA 3T8WA 3CXQA 3NFZA 3SXOA 4XQFA 3KGQA 4ZX9A 5AG7A 3QSYA 3D3SA 3TO9A 2ANPA 2P0WA 5IYQA 4A39A 1MABA 4WZEA 2BEIA 3IWEA 3SXNA 3PUMA 3SJFA 1T5EA 2B7CA 4KSIA 4H89A 4AG9A 2M5SA 1M4LA 2AFOA 3R1KA 2X7BA 2ZEPA 4KKSA 2WSSA 4Q7AA 3CMEB 4AVAA 1HDUA 4CGOA 4DQKA 2V8DA 3W2IA 3Q38A 3WABA 5FO0A 3KI9A 3B3WA 2DYIA 4KZTA 4ZYQA 1WSRA 3FIXA 1U2RA 4AC9A 2VYQA 2JDIA 3GVJA 4GXHA 5GV7A 1CBXA 1QFJA 2ODFA 4MHDA 1Q9SA 3GB0A 3TE4A 1YGHA 1MJBA 4UCPA 3ASSA 1LCPA 4TMXA 3BHXA 2ZEOA 4OC5A 3H8EA 2HQYA 3A8IA 3OFNA 3S6FA 3A8KA 3L2NA 2FCKA 1IYKA 2POKA 4E2AA 2BM1A 4CRZB 4PV6A 2B4BA 5F47A 2CRVA 3LACA 5H59A 4NXYA 3DLJA 3GIUA 3DGVA 3W2HA 2XZPA 5H5JA 2ZENA 1VQPB 4AF6A 1Z4RA 2Q7BA 4UAJA 2PE3A 4UZFA 1GO2A 4TMTA 3WYAA 1QSRA 2FIAA 3IFEA 4UIAA 1VQ5B 2R6HA 4FXUA 4RD2A 1CG2A 5CBMA 4OC4A 4ORFA 3FYNA 4P4EA 2ZZEA 1TKJA 2V7QA 2GIVA 4KS9A 2VBVA 1XMTA 3FNCA 3FB3A 2O28A 2PJCA 4Y9UA 2G3AA 3BI1A 4KOYA 4M6HA 3LODA 5EMNA 2QEXB 1Q2CA 1QSNA 3V7AA 2I3CA 2D3LA 3MCAA 3CCVB 3RZAA 2Q6LA 4P9SA 3OW7A 2FIWA 3IU1A 4HIZA 5AN9A 3WNDA 1R57A 2RC5A 1V0EA 2PJ7A 3QFTA 2BCOA 3LWUA 4NF1A 3PZJA 2Q0YA 4UFXA 2GLFA 2ZBVA 4MFZA 5JH9A 3QAHA 2C6PA 1Q86D 1BPMA 4CYQA 4X0CA 3TTHA 4IF5A 3PA1A 3WC5A 1SKQA 1AIPA 1JQGA 2OTJB 3VR6A 4P12A 3CB4A 1FNMA 1VIXA 4TMWA 1ZLHA 2EFGA 4NSQA 4U9YA 4IK2A 1ZM4A 4ZGYB 1N8RD 4WZKA 3ZBUA 4P2NA 2IL4A 1WOOA 1IHMA 2I79A 5ELYA 2D4PA 3R9EA 2Z3NA 5I4MA 2CNMA 5A88A 5AG6A 2CIJA 2ZW5A 1V0CA 1QUFA 4OPOA 2NMTA 2NSMA 3CZXA 3C26A 3KR5A 4KOUA 4UZEA 1PKVA 4XM3A 4C68A 1Z8TA 1KK1A 1K73D 3PBBA 3I1FA 2VL1A 2VEZA 4KVOE 1ARMA 4TN1A 2GANA 4NJRA 2Z11A 1S7KA 4F7DA 4G1VA 4XORA 3AVVA 1H42A 2REEA 2V7XA 3IU2A 3ONUA 3MMPA 3CESA 4M4SA 3CCRB 3T90A 5LRJA 1DTDA 1VQ8B 4X5KA 4P25A 1Y0RA 1X12A 4NCZA 5L46A 4UWIA 1YW4A 5DWNA 3BCFA 3AVYA 4M53A 3VATA 1HZEA 2C4TA 1VQ4B 2F7VA 3IWWA 1OB5A 1Z2LA 2B3VA 1U6MA 1BPLA 4YAFA 2XZLA 4FUUA 4Q38A 1XOVA 3SI0A 2ZITA 4JLYA 1Q81D 1AYEA 2CK3A 4KOWA 4R76A 1EFUA 2BSWA 3CXSA 2IJZA 2XZOA 5HZBA 4PAAA 3SLNA 1RTQA 2XNDA 4H9GA 2Z3PA 3PB8X 4M1KA 3PB6X 3WNCA 1M4IA 1IOIA 2FSRA 4E8OA 1R5OA 4YEJA 4R6TA 3T53B 2XOKA 2PRBA 3V38A 4NGSA 4QVTA 3H8GA 4XR6A 5HKKA 2B5GA 1T6XA 4HPSA 1FNCA 1D8TA 3PB9X 2DOGA 3GUXA 5E96A 5J1QA 3MGDA 1TKFA 3QFSA 2J8MA 1NBMA 3PEIA 1YJNB 3BJ8A 3H4QA 4MFQA 4MBUA 4E0FA 1CNEA 4B5PB
chains in the Genus database with same CATH topology
3KASA 4NGTA 1UWYA 5IB9A 5CPAA 1ZG7A 4UEEA 5HVGA 1F2PA 1ZG9A 3CT9A 3VH9A 3QNVA 4MHPA 1VHEA 1OBRA 2C6GA 3PFEA 4ZI6A 3BI0A 4YWYA 4PPZA 2O4HA 3IO1A 4P6YA 2PJ0A 2PJBA 1VGYA 2RFHA 2QVPA 4ONWA 2V8VA 2PJ6A 6CPAA 1TF9A 4K3NA 2OR4A 4O23A 5K8OA 2ZOGA 2AFSA 7CPAA 5HXDA 4JYWA 4OKOA 3FF3A 2AFXA 2IQ6A 2ZEGA 5K8MA 3TC8A 3CPAA 3KQZA 4UEZA 1CPXA 4P44A 4MHYA 3PFOA 4JZ0A 3FVLA 4IHMA 1LAPA 1Z5RA 5LYIA 5LYFA 2QYVA 4DUKA 2AFUA 2PVWA 1TKHA 3S9MA 4A94A 4ZY2A 1QMUA 2PVVA 1LOKA 4WWVA 1XBUA 2V8GA 2O53A 1Y0YA 4ZX8A 3H8FA 4DYOA 4ZY0A 3KR4A 2ZELA 2NYQA 3D7HA 4DJLA 4PXBA 1Q7LA 4X2TA 3VARA 4F8ZA 3WC7A 4NJQA 4NGMA 1LFWA 2WYRA 3MN8A 3NA6A 1CX8A 4ZY1A 2ZEEA 2C6CA 1PYTB 3B3SA 3D7DA 4PXEA 2AFWA 3T8WA 4UIBA 1NSAA 3NFZA 3KGQA 4ZX9A 3KZWA 4P45A 2ANPA 2EK9A 2CF4A 4A39A 3KHXA 4AXVA 4NGQA 3SJFA 2CTCA 4X8IA 1PCAA 3D4UA 1H8LA 4KSIA 2PJ9A 3N5FA 4EWTA 1M4LA 2AFOA 5K8NA 2XEFA 2ZEPA 2HB6A 4Q7AA 4CPAA 2WZNA 3B3CA 1HDUA 2ZEHA 2EWBA 3KQXA 3NH8A 1BPNA 2V8DA 4FBEA 5JM6A 3NH4A 3WABA 3KI9A 4GM5A 4NGNA 3B3WA 4EMEA 2GREA 1F57A 1CP6A 4ZYQA 4P4FA 1AMPA 1TXRA 4Z65A 2XEGA 1XFOA 1XRYA 4OMEA 1CBXA 2AFZA 3FJUA 3CDXA 3B3TA 4F9UA 3ISXA 3D7GA 3GB0A 3B7IA 5LRGA 1IGBA 4R7MA 4MCSA 3FECA 4P4IA 2PJ2A 4YU9A 4OIDA 1LCPA 3BHXA 2ZEOA 3SJXA 4OC5A 3H8EA 3KHZA 2F8HA 3L2NA 3CPXA 4MXUA 2PCUA 5D8NA 2POKA 3FEDA 5THWA 1BLLE 4NGRA 2Q4ZA 3B3VA 4G1PA 3HLPA 2GU2A 4UEFA 1Z8LA 3DLJA 4MCRA 2BOAA 3DGVA 3IJ3A 3KL9A 2ZENA 2AFMA 1LAMA 3D68A 2PE3A 4R8FA 3IFEA 3PB7X 4UIAA 3D7FA 1YSJA 5CBMA 1CG2A 4P4JA 2BO9A 4OC4A 4OP4A 2PJAA 1YLOA 2V77A 3IC1A 3PB4X 4P4EA 1TKJA 4W9YA 1IY7A 4MRIA 2FVGA 4MCQA 2V8HA 2PJCA 3B2YA 3BI1A 1CPSA 1FNOA 4PXDA 3D67A 1ELMP 4OC2A 3IEHA 1ARLA 2I3CA 4A38A 3RZAA 3FEEA 2J9AA 1XMBA 1Y7EA 5LYDA 2ABZA 1R43A 1F2OA 4B6ZA 4BD9A 3K2KA 3B35A 3GLJA 4P4DA 3SI1A 2PJ7A 2PJ4A 2BCOA 3LWUA 2PJ1A 1VHOA 4TNUA 2JBKA 1DE4C 3BXMA 3JRUA 4X3RA 2GLFA 2PJ8A 5JH9A 2C6PA 5HVFA 1BPMA 4OIWA 3WC5A 1GYTA 1JQGA 1EE3P 1VIXA 1ZLHA 3SI2A 4WJBA 4IK2A 3IIBA 5D29A 4UF4A 4NFRA 2ZEFA 2CTBA 2QJ8A 3K9TA 1HDQA 5ELYA 2JBJA 5I4MA 4FWUA 2JEWA 2CIJA 2NSMA 1BAVA 1TF8A 5DS0A 3V7ZA 3KR5A 3SJGA 3FX6A 3MRUA 5F09A 3FH4A 3PBBA 4NGPA 2VL1A 4PQAA 1ARMA 3RBUA 4NJRA 4MHNA 2ZOFA 3FMCA 1CP7A 4MHZA 2HC9A 1ZLIA 5LRJA 5LYLA 1DTDA 2Q51A 1Y0RA 2G9DA 2ZEDA 4OC3A 1YW4A 2PRQA 4EFDA 4OC0A 4RUHA 1ELLP 2GLJA 5JGFA 2EK8A 2Q43A 3D66A 3VATA 3WC6A 2F7VA 3IWWA 1Z2LA 1KWMA 2IMOA 8CPAA 4PXCA 3S9LA 4TWEA 2RB7A 2PJ5A 4FUUA 3SI0A 2C1CA 4FAIA 3TX8A 1XJOA 1ZG8A 1AYEA 4R76A 3LMSA 4A37A 2ZEMA 1LANA 2IJZA 2PIYA 4OC1A 1RTQA 1FT7A 4P4BA 4P10A 3PB8X 3PB6X 3PBEA 2DEAA 2PJ3A 4IAVA 4R6TA 4H2KA 3WT4A 3PRTA 4LQGA 1QQ9A 2OOTA 3I1UA 3V38A 4MCPA 4NGSA 1YMEA 3H8GA 3HUVA 3SJEA 1HEEA 5HVHA 2PIZA 5K8PA 1YW6A 3S9NA 2XEIA 3PB9X 3RAMA 3GUXA 5J1QA 3ISZA 1TKFA 3PEIA 4MMOA 4F9VA 5LRKA 3NH5A 1R3NA 2XEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAS A;  4NGT A;  1UWY A;  5IB9 A;  5CPA A;  1ZG7 A;  4UEE A;  5HVG A;  1F2P A;  1ZG9 A;  3CT9 A;  3VH9 A;  3QNV A;  4MHP A;  1VHE A;  1OBR A;  2C6G A;  3PFE A;  4ZI6 A;  3BI0 A;  4YWY A;  4PPZ A;  2O4H A;  3IO1 A;  4P6Y A;  2PJ0 A;  2PJB A;  1VGY A;  2RFH A;  2QVP A;  4ONW A;  2V8V A;  2PJ6 A;  6CPA A;  1TF9 A;  4K3N A;  2OR4 A;  4O23 A;  5K8O A;  2ZOG A;  2AFS A;  7CPA A;  5HXD A;  4JYW A;  4OKO A;  3FF3 A;  2AFX A;  2IQ6 A;  2ZEG A;  5K8M A;  3TC8 A;  3CPA A;  3KQZ A;  4UEZ A;  1CPX A;  4P44 A;  4MHY A;  3PFO A;  4JZ0 A;  3FVL A;  4IHM A;  1LAP A;  1Z5R A;  5LYI A;  5LYF A;  2QYV A;  4DUK A;  2AFU A;  2PVW A;  1TKH A;  3S9M A;  4A94 A;  4ZY2 A;  1QMU A;  2PVV A;  1LOK A;  4WWV A;  1XBU A;  2V8G A;  2O53 A;  1Y0Y A;  4ZX8 A;  3H8F A;  4DYO A;  4ZY0 A;  3KR4 A;  2ZEL A;  2NYQ A;  3D7H A;  4DJL A;  4PXB A;  1Q7L A;  4X2T A;  3VAR A;  4F8Z A;  3WC7 A;  4NJQ A;  4NGM A;  1LFW A;  2WYR A;  3MN8 A;  3NA6 A;  1CX8 A;  4ZY1 A;  2ZEE A;  2C6C A;  1PYT B;  3B3S A;  3D7D A;  4PXE A;  2AFW A;  3T8W A;  4UIB A;  1NSA A;  3NFZ A;  3KGQ A;  4ZX9 A;  3KZW A;  4P45 A;  2ANP A;  2EK9 A;  2CF4 A;  4A39 A;  3KHX A;  4AXV A;  4NGQ A;  3SJF A;  2CTC A;  4X8I A;  1PCA A;  3D4U A;  1H8L A;  4KSI A;  2PJ9 A;  3N5F A;  4EWT A;  1M4L A;  2AFO A;  5K8N A;  2XEF A;  2ZEP A;  2HB6 A;  4Q7A A;  4CPA A;  2WZN A;  3B3C A;  1HDU A;  2ZEH A;  2EWB A;  3KQX A;  3NH8 A;  1BPN A;  2V8D A;  4FBE A;  5JM6 A;  3NH4 A;  3WAB A;  3KI9 A;  4GM5 A;  4NGN A;  3B3W A;  4EME A;  2GRE A;  1F57 A;  1CP6 A;  4ZYQ A;  4P4F A;  1AMP A;  1TXR A;  4Z65 A;  2XEG A;  1XFO A;  1XRY A;  4OME A;  1CBX A;  2AFZ A;  3FJU A;  3CDX A;  3B3T A;  4F9U A;  3ISX A;  3D7G A;  3GB0 A;  3B7I A;  5LRG A;  1IGB A;  4R7M A;  4MCS A;  3FEC A;  4P4I A;  2PJ2 A;  4YU9 A;  4OID A;  1LCP A;  3BHX A;  2ZEO A;  3SJX A;  4OC5 A;  3H8E A;  3KHZ A;  2F8H A;  3L2N A;  3CPX A;  4MXU A;  2PCU A;  5D8N A;  2POK A;  3FED A;  5THW A;  1BLL E;  4NGR A;  2Q4Z A;  3B3V A;  4G1P A;  3HLP A;  2GU2 A;  4UEF A;  1Z8L A;  3DLJ A;  4MCR A;  2BOA A;  3DGV A;  3IJ3 A;  3KL9 A;  2ZEN A;  2AFM A;  1LAM A;  3D68 A;  2PE3 A;  4R8F A;  3IFE A;  3PB7 X;  4UIA A;  3D7F A;  1YSJ A;  5CBM A;  1CG2 A;  4P4J A;  2BO9 A;  4OC4 A;  4OP4 A;  2PJA A;  1YLO A;  2V77 A;  3IC1 A;  3PB4 X;  4P4E A;  1TKJ A;  4W9Y A;  1IY7 A;  4MRI A;  2FVG A;  4MCQ A;  2V8H A;  2PJC A;  3B2Y A;  3BI1 A;  1CPS A;  1FNO A;  4PXD A;  3D67 A;  1ELM P;  4OC2 A;  3IEH A;  1ARL A;  2I3C A;  4A38 A;  3RZA A;  3FEE A;  2J9A A;  1XMB A;  1Y7E A;  5LYD A;  2ABZ A;  1R43 A;  1F2O A;  4B6Z A;  4BD9 A;  3K2K A;  3B35 A;  3GLJ A;  4P4D A;  3SI1 A;  2PJ7 A;  2PJ4 A;  2BCO A;  3LWU A;  2PJ1 A;  1VHO A;  4TNU A;  2JBK A;  1DE4 C;  3BXM A;  3JRU A;  4X3R A;  2GLF A;  2PJ8 A;  5JH9 A;  2C6P A;  5HVF A;  1BPM A;  4OIW A;  3WC5 A;  1GYT A;  1JQG A;  1EE3 P;  1VIX A;  1ZLH A;  3SI2 A;  4WJB A;  4IK2 A;  3IIB A;  5D29 A;  4UF4 A;  4NFR A;  2ZEF A;  2CTB A;  2QJ8 A;  3K9T A;  1HDQ A;  5ELY A;  2JBJ A;  5I4M A;  4FWU A;  2JEW A;  2CIJ A;  2NSM A;  1BAV A;  1TF8 A;  5DS0 A;  3V7Z A;  3KR5 A;  3SJG A;  3FX6 A;  3MRU A;  5F09 A;  3FH4 A;  3PBB A;  4NGP A;  2VL1 A;  4PQA A;  1ARM A;  3RBU A;  4NJR A;  4MHN A;  2ZOF A;  3FMC A;  1CP7 A;  4MHZ A;  2HC9 A;  1ZLI A;  5LRJ A;  5LYL A;  1DTD A;  2Q51 A;  1Y0R A;  2G9D A;  2ZED A;  4OC3 A;  1YW4 A;  2PRQ A;  4EFD A;  4OC0 A;  4RUH A;  1ELL P;  2GLJ A;  5JGF A;  2EK8 A;  2Q43 A;  3D66 A;  3VAT A;  3WC6 A;  2F7V A;  3IWW A;  1Z2L A;  1KWM A;  2IMO A;  8CPA A;  4PXC A;  3S9L A;  4TWE A;  2RB7 A;  2PJ5 A;  4FUU A;  3SI0 A;  2C1C A;  4FAI A;  3TX8 A;  1XJO A;  1ZG8 A;  1AYE A;  4R76 A;  3LMS A;  4A37 A;  2ZEM A;  1LAN A;  2IJZ A;  2PIY A;  4OC1 A;  1RTQ A;  1FT7 A;  4P4B A;  4P10 A;  3PB8 X;  3PB6 X;  3PBE A;  2DEA A;  2PJ3 A;  4IAV A;  4R6T A;  4H2K A;  3WT4 A;  3PRT A;  4LQG A;  1QQ9 A;  2OOT A;  3I1U A;  3V38 A;  4MCP A;  4NGS A;  1YME A;  3H8G A;  3HUV A;  3SJE A;  1HEE A;  5HVH A;  2PIZ A;  5K8P A;  1YW6 A;  3S9N A;  2XEI A;  3PB9 X;  3RAM A;  3GUX A;  5J1Q A;  3ISZ A;  1TKF A;  3PEI A;  4MMO A;  4F9V A;  5LRK A;  3NH5 A;  1R3N A;  2XEJ A; 
#chains in the Genus database with same CATH topology
 3KAS A;  2F1L A;  3R96 A;  3TO6 A;  1DAR A;  4XKV A;  1UWY A;  4LQ6 A;  1H8H A;  5CPA A;  2Q7S A;  2FT0 A;  4RDK A;  4PC6 A;  4X06 A;  3BQJ A;  5A8A A;  3QFC A;  4ZGQ B;  2ARH A;  3CD6 B;  1VHE A;  5EMI A;  4YAU A;  2ZW7 A;  3EFA A;  5C88 A;  3H94 A;  1SKY B;  1W0J A;  4UZU A;  4FK8 A;  4Z1M A;  3BI0 A;  3EC4 A;  2V7U A;  3AVW A;  4KLV A;  2O4H A;  4UBR A;  4Z4T A;  1Q82 D;  1N08 A;  2P6G A;  5JQ4 A;  4F0X A;  1VGY A;  2RFH A;  3LVB A;  1WP6 A;  1QST A;  1TF9 A;  3S6G A;  4O23 A;  1MJ9 A;  3AST A;  2J8R A;  2AFX A;  2IQ6 A;  2ZEG A;  2ZTN A;  3CPA A;  1CPX A;  2R98 A;  3JQQ A;  1BOB A;  5FIU A;  2RC6 A;  4JZ0 A;  1ELO A;  4Y49 C;  3E20 A;  5LYF A;  3VO1 A;  2AFU A;  2WJY A;  2HDN B;  3AGQ A;  4A94 A;  2BPO A;  4MFJ A;  1S60 A;  4WWV A;  1BJK A;  4R3L A;  4XL9 A;  2O53 A;  5F4J A;  4C2X A;  3VNU A;  4QVJ A;  3D7H A;  3T9Y A;  3B8G A;  3A3B A;  1XQB A;  3NH5 A;  4X2T A;  2BSA A;  2ZXH A;  1MJA A;  4F8Z A;  4P6V F;  2H5M A;  2OZG A;  5IYP A;  1CX8 A;  1Y9W A;  4ZY1 A;  4A33 A;  4CGN A;  1YR0 A;  3I55 B;  4NEX A;  1YK3 A;  2PC1 A;  4PXE A;  1HA3 A;  1YQE A;  4UCM A;  3CCU B;  1NSA A;  2Q6I A;  4B3F X;  3KZW A;  5B6I A;  4Y49 B;  4AXV A;  1WU8 A;  1K8A D;  4Z4W A;  1YRE A;  3ZZI A;  3CCS B;  2CTC A;  3OZW A;  1H8L A;  1PJ6 A;  3JVN A;  5BWA B;  4EWT A;  4B47 A;  5K8N A;  1RXT A;  2C2W A;  4CPA A;  4YAW A;  2VZY A;  1M1K D;  3B3C A;  2PIA A;  3KQX A;  1VQK B;  1BPN A;  4K30 A;  1KUY A;  5JM6 A;  4R57 A;  2OYN A;  2B4D A;  4GM5 A;  4M2L A;  4NNJ A;  2VXK A;  5AG5 A;  2GRE A;  1UD3 A;  2VZZ A;  3W2F A;  1AMP A;  1FNB A;  4YAO A;  2NV4 A;  2XEG A;  3CXP A;  4Z65 A;  4R9M A;  2OU2 A;  4OME A;  4CYP A;  3Q3A A;  4Z4Y A;  3CDX A;  1QSM A;  4F9U A;  2R9V A;  3ISX A;  1EFC A;  4AB7 A;  4XN0 A;  1S5K A;  3B7I A;  1OHH A;  2FX3 A;  3AGP A;  2J8N A;  2B5G B;  4U9Z A;  2VNH A;  3FEC A;  2PMD A;  4P4I A;  2VJJ A;  4TT3 A;  1ZM2 A;  1E43 A;  1WSV A;  3SJX A;  2B5O A;  3P2H A;  2I00 A;  1XIX A;  3I56 B;  2OBS A;  4E0A A;  4MXU A;  4B43 A;  5DWM A;  3U6B A;  5F49 A;  4AVZ A;  3CW2 A;  4UCN A;  2DIE A;  1BLL E;  2Q4Z A;  5FNZ A;  1J9Z A;  4RD3 A;  3B3V A;  3HLP A;  3QAY A;  2PDO A;  1Z8L A;  1YI2 B;  1EP1 B;  5AG4 A;  3KL9 A;  3DNS A;  1EWY A;  3RYO A;  1OB2 A;  2XNJ A;  3PB7 X;  2GK6 A;  1W9X A;  3VNV A;  3D7F A;  1YSJ A;  3CP8 A;  2E1R A;  2PJA A;  4OP4 A;  4B3G A;  4JD6 A;  2DPT A;  2YNC A;  4W9Y A;  1F20 A;  1S7F A;  4OPS A;  3TT2 A;  1VLY A;  5BSX A;  2V8H A;  1XE1 A;  2WPW A;  4RCZ A;  3JQP A;  2V31 A;  4C2Y A;  4KUB A;  4LBV A;  2X85 A;  3OZU A;  3CC2 B;  1ARL A;  4KSA A;  3PP9 A;  4A38 A;  3FEE A;  2J9A A;  1JNY A;  3SLD A;  4B44 A;  5LYD A;  2ABZ A;  1R43 A;  5J8C A;  2OB0 A;  3K2K A;  1T6Z A;  2DY1 A;  1FRN A;  1Z9U A;  2DXQ A;  3GLJ A;  4MY3 A;  3SI1 A;  3OWC A;  2CBX A;  2YND A;  4R71 A;  3B78 A;  1EXM A;  4II2 A;  2V4D A;  3CMM A;  3JRU A;  2BV3 A;  3ZC3 A;  5CNP A;  1NMT A;  4XLA A;  1WDT A;  1GYT A;  1GR1 A;  1KRH A;  1QGZ A;  1UD6 A;  4WJB A;  1E79 A;  4MY0 A;  3H9N A;  2X0K A;  4NFR A;  2C27 A;  2ZEF A;  3WXM A;  2D4O A;  2YGW A;  3BC9 A;  1Z8X A;  4FWU A;  4LBY A;  1NB9 A;  3SJG A;  1M4G A;  2R8V A;  3CRZ A;  4RD6 A;  1YX2 A;  4K1X A;  4ZV4 A;  1IU8 A;  3KEW A;  3RBU A;  1UFH A;  2X6Y A;  3V76 A;  1GJR A;  1CP7 A;  4OLL A;  1QH0 A;  1OB0 A;  2OK7 A;  2QDX A;  2HC9 A;  4MHZ A;  1BO4 A;  1GHE A;  2AJ6 A;  1ZLI A;  1CNF A;  3GIR A;  1R5N A;  2VBT A;  4OC3 A;  2PRQ A;  4WZL A;  2ZPA A;  3G3S A;  4RI1 A;  2B4D B;  4RUH A;  4WZT A;  2X6W A;  2GLJ A;  1FY7 A;  5BSY A;  3OP1 A;  2EK8 A;  3D66 A;  2HCJ B;  4MYT A;  1IID A;  4QFM A;  3BNW A;  1UMK A;  2BF4 A;  1WOS A;  4M0L A;  8CPA A;  4PXC A;  3S9L A;  1E64 A;  2A4N A;  1A2Z A;  1YLE A;  4RPD A;  4PSX A;  4A37 A;  1LAN A;  3AVU A;  3U6K A;  2PIY A;  3F8K A;  4RCY A;  4XPL A;  3W5U A;  3T51 B;  1MRZ A;  4P10 A;  3R6K A;  3PBE A;  2PJ3 A;  4IAV A;  3WT4 A;  4H2K A;  3FPP A;  4JXR A;  2LZJ A;  3E1Y E;  2GK7 A;  4LQG A;  2OOT A;  4AVB A;  1KK2 A;  4XD7 A;  4MCP A;  2WJV A;  2GJR A;  3LQ6 A;  4UFW A;  1TTT A;  5HVH A;  2PIZ A;  1S7L A;  3JTK A;  4R3K A;  3RAM A;  5TV2 A;  3WBK A;  3P26 A;  3ISZ A;  5I0C A;  1BX1 A;  4DNR B;  4MMO A;  3K9U A;  4F9V A;  1EFT A;  2AFZ A;  1E1Q A;  1PJ7 A;  1R3N A;  3JUW A;  2XEJ A;  4RD1 A;  2QGG A;  1QFZ A;  3OW2 B;  2EBJ A;  5IB9 A;  1E62 A;  3G8W A;  2B7B A;  3I3G A;  3CT9 A;  4LUA A;  1JWQ A;  5FVJ A;  4A31 A;  4MHP A;  4CAX A;  5EC4 A;  3NE8 A;  4XOP A;  3P2F A;  3Q39 A;  4ZI6 A;  4PPZ A;  2JJ1 A;  4LC0 A;  1K4J A;  4P6Y A;  2QIR A;  3OJX A;  1PU9 A;  4Y7C A;  4DNT B;  1A8P A;  2Q6O A;  5IX3 A;  1Z4E A;  1QX4 A;  2OR4 A;  3TFY A;  2EUI A;  5A89 A;  5HXD A;  3FF3 A;  1VQN B;  3KQZ A;  3GY9 A;  1KZF A;  3GQB A;  1H8E A;  4II3 A;  4XON A;  3CC4 B;  2AHO A;  1E3X A;  3BJ7 A;  4PC1 A;  4UFV A;  4YHB A;  4MHY A;  3PFO A;  3F5B A;  3FVL A;  1QGA A;  2FXF A;  1JA1 A;  4FWT A;  2VBU A;  2QYV A;  2QML A;  2Z3K A;  4DUK A;  3GVL A;  4KOR A;  3TOB A;  3S9M A;  4ZY2 A;  1TVC A;  1QMU A;  2ZW6 A;  1LOK A;  4CQJ A;  4CGL A;  4KOS A;  5JBQ A;  5IB0 A;  4F6A A;  3DR8 A;  4ZX8 A;  5J35 A;  1D1N A;  3KR4 A;  4XNH C;  2ZEL A;  2WSA A;  4RDJ A;  4WQM A;  1IB1 E;  1Q7L A;  3QFR A;  4Z4S A;  5FO1 A;  3AVT A;  5HZA A;  1LFW A;  2WYR A;  3OPO A;  4P3I A;  3MN8 A;  1Q2D A;  4KVM E;  3W2E A;  2C6C A;  2XNC A;  3NE7 A;  4UIB A;  1K28 D;  3VMF A;  3OAA A;  5DSZ A;  5KTD A;  2Z6B D;  2VNK A;  5AGE A;  3N7Z A;  1NE9 A;  3PUN A;  4P45 A;  4G7X A;  2EK9 A;  2CF4 A;  3G71 B;  2ATR A;  4F0Y A;  5H84 A;  3W6S A;  2DER A;  4NGQ A;  1W35 A;  4X8I A;  1I7P A;  4AG7 A;  1PCA A;  1JA0 A;  3N5F A;  3OKX A;  1WTH D;  4TMZ A;  2XEF A;  2HB6 A;  1B87 A;  1R5B A;  2EWB A;  3SJZ A;  3CCL B;  4FBE A;  5IV0 A;  3BLN A;  2BN4 A;  1D2E A;  4C2Z A;  4RJL A;  4EME A;  1F57 A;  4M6I A;  1UD4 A;  1XRY A;  1KTV A;  4RN7 A;  2Y0M A;  2YWE A;  3GVK A;  3B3T A;  1Z8W A;  1S7N A;  5GCN A;  1QGY A;  2Z0Z A;  3PA2 A;  1YVO A;  3FJO A;  4R7M A;  3DDY A;  4X07 A;  2EIX A;  2PJ2 A;  4OPV A;  2XGJ A;  1BX0 A;  4H6U A;  1KUX A;  4YU9 A;  4OID A;  4PGO A;  4P3Y A;  1V5V A;  3PEN A;  2CXA A;  4Q36 A;  2PCU A;  3WR7 A;  3H5Z A;  2Q6K A;  4P1V A;  1KQS B;  3FED A;  3OJW A;  5THW A;  1NJI D;  4X7F A;  4NGR A;  4Y9R A;  4C7I A;  4FD4 A;  4HKF A;  1P0H A;  4HE5 A;  4CYO A;  4UEF A;  2ZZQ A;  4C0S A;  4PSW A;  1ZO0 A;  3IJ3 A;  2G0B A;  3D68 A;  2XEX A;  4R8F A;  5FL7 A;  1N05 A;  4P4J A;  3IWG A;  1WWZ A;  3IC1 A;  4RD0 A;  1QSO A;  4FN5 A;  1E63 A;  5TY0 A;  1SQH A;  5IYR A;  1M44 A;  3B2Y A;  4Z4R A;  4EH1 A;  1VF7 A;  4PK2 A;  1FNO A;  2FL4 A;  4FD5 A;  4L89 A;  4OC2 A;  3ZUG A;  2QN6 A;  4MI4 A;  4ZCL A;  2KCW A;  3MHP A;  3TO7 A;  3RNZ A;  3FRM A;  1Y7E A;  5F4M A;  1S4M A;  3BY1 A;  3V8I A;  2F43 A;  1ZUN B;  1F2O A;  1IJF A;  4B6Z A;  3W2G A;  4BD9 A;  2PJ4 A;  3Q6R A;  1QFY A;  3EY5 A;  4QC6 A;  4XKW A;  4G7W A;  3G05 A;  4C7H A;  1NDH A;  2JBK A;  3ASQ A;  1DE4 C;  2PJ8 A;  2X53 S;  2PSW A;  1LRZ A;  4YEL A;  4OIW A;  2BGJ A;  5G21 A;  3G6E B;  1EE3 P;  2JJ2 A;  1W34 A;  1S72 B;  5D29 A;  4UF4 A;  4ZGN B;  2CTB A;  2QJ8 A;  3TCV A;  2ZZF A;  1HDQ A;  3PVD A;  2JBJ A;  1JB9 A;  4Z4Z A;  1YIJ B;  4B12 A;  5IYW A;  4FD6 A;  1BAV A;  4P26 A;  1TF8 A;  5JPH A;  1CM0 A;  3OE7 A;  2OBT A;  4ZCM A;  4JJX A;  3MRU A;  1GAQ A;  4A32 A;  5F09 A;  2JDC A;  4LBW A;  3HAG A;  5KW9 A;  3ZBT A;  2YNE A;  4II9 A;  3ZJ0 A;  2DEU A;  1B23 P;  5FA6 A;  4MHN A;  1W87 A;  2Z3O A;  2ZOF A;  2VJI A;  4B3X A;  3CXC B;  4B48 A;  2OZH A;  3TOA A;  3UY5 A;  1QVF B;  2CC2 A;  1E1R A;  5LYL A;  4PK3 A;  3F0A A;  2Q51 A;  2QA4 B;  2OTL B;  4H6Z A;  3ONY A;  1H85 A;  4NCN A;  1HVX A;  4B11 A;  4EFD A;  4OC0 A;  3LD2 A;  2AE6 A;  3IGR A;  2GJK A;  3JQR A;  2Q43 A;  2BUE A;  3WC6 A;  4A95 A;  4U9U A;  1KWM A;  4J3G A;  4TWE A;  2JEV A;  2PJ5 A;  2G3T A;  4I49 A;  3GSI A;  1S3Z A;  2C1C A;  1N0V C;  2ZTG A;  4FAI A;  3TX8 A;  2ZL5 A;  4RD4 A;  4BMH A;  3PGP A;  1ZM9 A;  1WOR A;  3LMS A;  4B13 A;  2ZEM A;  1VLO A;  2WPX A;  3W5V A;  4B5O A;  3S6H A;  3ES9 A;  1N71 A;  2ZXV A;  1QUE A;  1FT7 A;  1IIC A;  2DEA A;  1WPC A;  1G7S A;  2FE7 A;  3PRT A;  2P3M A;  1QQ9 A;  3BY2 A;  4XLH A;  3I1U A;  4KLW A;  1YME A;  3HUV A;  3W5H A;  5KSW B;  3SJE A;  3SJP A;  1KZL A;  1WK4 A;  1YW6 A;  2XEI A;  4GQN A;  1K9M D;  4M3S A;  5DN6 A;  3WNB A;  2OK8 A;  1N07 A;  2HMA A;  4MYU A;  4OAE A;  5KTC A;  4XLF A;  1B6B A;  3EO4 A;  4NGT A;  4RPB A;  1QVG B;  2JIZ A;  1VQ6 B;  1I21 A;  4CAE A;  2BMW A;  2V7T A;  5HVG A;  5G1Z A;  1F2P A;  2YWH A;  3ASP A;  3R9F A;  1ZG9 A;  1ZM3 A;  4HNW B;  4CAF A;  5F4O A;  1YJW B;  3VH9 A;  4MJ8 A;  1G7T A;  4KKU A;  1OBR A;  2C6G A;  4KSF A;  3PFE A;  4L8A A;  3CTA A;  1Y7R A;  3GKR A;  2PJB A;  4X7E A;  2V8V A;  6CPA A;  2P6E A;  5HMN A;  4K3N A;  2QE7 A;  3ZIA A;  5K8O A;  2VNI A;  2AFS A;  4PAB A;  7CPA A;  4FD7 A;  3OEE A;  4JYW A;  3DDD A;  3TC8 A;  3CCE B;  1YHQ B;  1I12 A;  4P44 A;  1QG0 A;  3DR6 A;  4TSF A;  1BLI A;  4R87 A;  5A28 A;  2DET A;  4GS4 A;  4IUS A;  1LAP A;  1Z5R A;  4KKT A;  4HNX B;  4L8J A;  3CCM B;  2RC4 A;  2YNC C;  5H86 A;  2DCU A;  1TKH A;  4A2Z A;  2PVV A;  4YRH A;  3D2P A;  1XBU A;  4MFK A;  2V8G A;  5GV8 A;  3ZZU A;  2ZZG A;  2PR1 A;  4CAV A;  2Z10 A;  5EBV A;  2Z3L A;  4A30 A;  4DJL A;  1KK3 A;  2HUZ A;  4X7C A;  2PR8 A;  4OAD A;  1OGI A;  2C77 A;  4PXB A;  4B5P A;  1I8D A;  3ZZ0 A;  3VO2 A;  3FPK A;  2F5I A;  5THX A;  1IOF A;  3VAR A;  1N0U A;  4NJQ A;  2X6X A;  3EXN A;  3OOC A;  3FKS A;  3SKB A;  2VNJ A;  1PYT B;  4QV2 A;  2REF A;  3D7D A;  1EP2 B;  2AFW A;  4PC3 A;  3VWE A;  1UD8 A;  1YVK A;  3A1P A;  3D2M A;  2C4U A;  1VQM B;  4RS2 A;  1VQO B;  4U5Y A;  2JDD A;  3KHX A;  4RDL A;  3FXT A;  3D4U A;  2PJ9 A;  2QTL A;  2D9R A;  4C43 A;  2QMU A;  2WZN A;  4HNY B;  2ZEH A;  3NE5 B;  3NH8 A;  2FS5 A;  4XPD C;  4PC2 A;  2BM0 A;  4JMQ A;  4ZBG A;  1BQE A;  3NH4 A;  3LO8 A;  4ASU A;  2VBS A;  4NGN A;  4YXW A;  4P22 A;  1FX0 A;  1CP6 A;  1S0U A;  2VBQ A;  3WBJ A;  4P4F A;  4ONU A;  4Z4U A;  1TXR A;  1XB2 A;  4TMV A;  1XFO A;  1VQ9 B;  4CAW A;  3FJU A;  1VKC A;  4B14 A;  1G7C A;  4YGO A;  5LMZ A;  3D7G A;  4ROX A;  4RLZ A;  2F4N A;  5LRG A;  1IGB A;  3U2Q A;  4J0Q A;  4MCS A;  4CRY B;  3CP2 A;  4DK0 A;  2WUU A;  1GVH A;  1FDR A;  1M1D A;  4ZCI A;  4BPR A;  3DSB A;  4UA3 A;  2V7W A;  2V7V A;  3KHZ A;  2F8H A;  3CPX A;  3FBU A;  2QTZ A;  5D8N A;  4OOS A;  2DPS A;  1V0F A;  1P4N A;  2VI7 A;  1NB0 A;  1T6Y A;  4Q7J B;  1VQL B;  3R95 A;  1NSL A;  4G1P A;  4XPD B;  2GU2 A;  4AVC A;  4MCR A;  2BOA A;  1G7R A;  5TRD A;  1J4J A;  2AFM A;  1LAM A;  1DDG A;  4KUA A;  2BGI A;  1XF8 A;  1KUV A;  2C5B A;  1TIQ A;  2WR8 A;  1PUA A;  2BO9 A;  1OGJ A;  3W91 A;  1YLO A;  1EFR A;  4XLE A;  2V77 A;  4ACA A;  3PB4 X;  1P4M A;  1IY7 A;  4CGM A;  4MRI A;  2FVG A;  4MCQ A;  4N3G A;  4DK1 A;  5J3O A;  1CPS A;  3R9G A;  1FRQ A;  4PXD A;  3D67 A;  1ELM P;  2B3U A;  1Q2Y A;  1RQP A;  3IEH A;  2X3U A;  4KOX A;  3GYA A;  5A27 A;  1W2B B;  3KKW A;  5E6T A;  3CCQ B;  4B4D A;  3BH4 A;  1XMB A;  1RQR A;  1KD1 D;  5G20 A;  3B35 A;  4P4D A;  1ON0 A;  1BMF A;  2PJ1 A;  2GE3 A;  3Q6Q A;  1VHO A;  1KJZ A;  4TNU A;  1Y9K A;  4X3R A;  3BXM A;  1E3Z A;  4JWP A;  2Q4Y A;  4B10 A;  5HVF A;  3B8H A;  1DDI A;  2K5T A;  4XNH B;  2JLM A;  1B2R A;  5F48 A;  3RO0 A;  5HH1 A;  3SI2 A;  4DNC A;  1PJ5 A;  3SEJ A;  4KVX A;  3OEH A;  3IIB A;  1MK4 A;  1W0K A;  3K9T A;  3R6J A;  5J8F A;  4QBJ A;  3ASR A;  2C78 A;  2JEW A;  3WY9 A;  4YFJ A;  4X05 A;  3D8P A;  4OP7 A;  5DS0 A;  3VWD A;  3V7Z A;  1UD5 A;  3LNN A;  4OOV A;  4XLC A;  4QUS A;  5TR9 A;  3E0K A;  3FX6 A;  1Q7Y D;  5KNL A;  3FH4 A;  3A9L A;  4IW3 B;  2YWF A;  3WQZ A;  1F60 A;  4NGP A;  1EP3 B;  4PQA A;  4BIN A;  1DG1 G;  3RY8 A;  2D3N A;  3FMC A;  4QB9 A;  4G1B A;  4RM0 A;  3SHP A;  1FND A;  3CC7 B;  4NBS A;  3BCD A;  1KC8 D;  2GPJ A;  2WZP P;  1IYL A;  2G9D A;  2ZED A;  2PLF A;  5IK2 A;  4TKO B;  2YWG A;  2E1B A;  4CYN A;  2GQF A;  1XE4 A;  2WPD A;  2CNS A;  2QEC A;  1X10 A;  1ELL P;  2GJP A;  2CND A;  1M4D A;  2CNT A;  1VJS A;  5JGF A;  5F46 A;  1N06 A;  1COW A;  3CPW B;  1YX0 A;  4YAL A;  2IMO A;  2RB7 A;  4QHY A;  1NRK A;  1XEB A;  4JXQ A;  3ZPN A;  2Q4V A;  1XJO A;  4XN3 A;  1ZG8 A;  2J7K A;  1AMO A;  3CCJ B;  1YJ9 B;  3G4S B;  4N3N A;  4M85 A;  4OC1 A;  4G6I A;  3JU4 A;  4P4B A;  2KVO A;  2OH1 A;  2B58 A;  4AF7 A;  5C82 A;  2GFQ A;  1RO5 A;  1I18 A;  1VHS A;  3B82 A;  2ZL6 A;  4M6G A;  1OZP A;  4Z4V A;  2W6I A;  3QE2 A;  1HEE A;  5K8P A;  3S9N A;  1TLL A;  4UWJ A;  3LQE A;  3T56 B;  3A35 A;  5ISV A;  5LRK A;  2X8K A;  3AVX A;  3D26 A;  2EO8 A;  3W6X A;  1VQ7 B;  4G5G A;  1KMH A;  4KOT A;  1ZG7 A;  4UEE A;  4XPK A;  1TUI A;  1YIT B;  3P27 A;  4HE6 A;  2NPF A;  2W6J A;  4KOV A;  4PC7 A;  1WOP A;  3ZZT A;  1IJE A;  2VQY A;  3QNV A;  2Z3M A;  4OOX A;  4X7D A;  1I1D A;  2ZW4 A;  4QVA A;  4YWY A;  2BL1 A;  1IB0 A;  3IO1 A;  2PJ0 A;  2F1M A;  4ACB A;  2QVP A;  2DF5 A;  4EVY A;  4ONW A;  2R7H A;  2PJ6 A;  2VZL A;  2C5H A;  2EVN A;  5HXB A;  2HLD A;  2R1I A;  2ZOG A;  3OZV A;  1GAW A;  4CGP A;  4OKO A;  3A3G A;  1CQX A;  2ZBU A;  5K8M A;  4UEZ A;  2CY2 A;  5G22 A;  1KK0 A;  1JJ2 B;  2ZXI A;  2BVN A;  2I1L A;  5KTA A;  4IHM A;  4MFL A;  5LYI A;  2P6F A;  2Q04 A;  4XMY A;  1M90 D;  3I9S A;  2PVW A;  5CDF A;  3CMA B;  4CS0 B;  2PQ8 A;  2CW5 A;  3J81 k;  2ZL7 A;  1Y0Y A;  1CJW A;  3QB8 A;  3S6K A;  4DYO A;  3H8F A;  4ZY0 A;  2NYQ A;  1UD2 A;  1SM4 A;  2JN9 A;  2D74 A;  4LBZ A;  4DQL A;  1L0C A;  3A8J A;  3WC7 A;  1AUG A;  5IYN A;  2HV2 A;  4XNF A;  4NGM A;  3NA6 A;  4LX9 A;  4MFP A;  2ZEE A;  2Q44 A;  2OZU A;  4BBH A;  2OBR A;  4XOT A;  3B3S A;  4QUZ A;  3T8W A;  3CXQ A;  3NFZ A;  3SXO A;  4XQF A;  3KGQ A;  4ZX9 A;  5AG7 A;  3QSY A;  3D3S A;  3TO9 A;  2ANP A;  2P0W A;  5IYQ A;  4A39 A;  1MAB A;  4WZE A;  2BEI A;  3IWE A;  3SXN A;  3PUM A;  3SJF A;  1T5E A;  2B7C A;  4KSI A;  4H89 A;  4AG9 A;  2M5S A;  1M4L A;  2AFO A;  3R1K A;  2X7B A;  2ZEP A;  4KKS A;  2WSS A;  4Q7A A;  3CME B;  4AVA A;  1HDU A;  4CGO A;  4DQK A;  2V8D A;  3W2I A;  3Q38 A;  3WAB A;  5FO0 A;  3KI9 A;  3B3W A;  2DYI A;  4KZT A;  4ZYQ A;  1WSR A;  3FIX A;  1U2R A;  4AC9 A;  2VYQ A;  2JDI A;  3GVJ A;  4GXH A;  5GV7 A;  1CBX A;  1QFJ A;  2ODF A;  4MHD A;  1Q9S A;  3GB0 A;  3TE4 A;  1YGH A;  1MJB A;  4UCP A;  3ASS A;  1LCP A;  4TMX A;  3BHX A;  2ZEO A;  4OC5 A;  3H8E A;  2HQY A;  3A8I A;  3OFN A;  3S6F A;  3A8K A;  3L2N A;  2FCK A;  1IYK A;  2POK A;  4E2A A;  2BM1 A;  4CRZ B;  4PV6 A;  2B4B A;  5F47 A;  2CRV A;  3LAC A;  5H59 A;  4NXY A;  3DLJ A;  3GIU A;  3DGV A;  3W2H A;  2XZP A;  5H5J A;  2ZEN A;  1VQP B;  4AF6 A;  1Z4R A;  2Q7B A;  4UAJ A;  2PE3 A;  4UZF A;  1GO2 A;  4TMT A;  3WYA A;  1QSR A;  2FIA A;  3IFE A;  4UIA A;  1VQ5 B;  2R6H A;  4FXU A;  4RD2 A;  1CG2 A;  5CBM A;  4OC4 A;  4ORF A;  3FYN A;  4P4E A;  2ZZE A;  1TKJ A;  2V7Q A;  2GIV A;  4KS9 A;  2VBV A;  1XMT A;  3FNC A;  3FB3 A;  2O28 A;  2PJC A;  4Y9U A;  2G3A A;  3BI1 A;  4KOY A;  4M6H A;  3LOD A;  5EMN A;  2QEX B;  1Q2C A;  1QSN A;  3V7A A;  2I3C A;  2D3L A;  3MCA A;  3CCV B;  3RZA A;  2Q6L A;  4P9S A;  3OW7 A;  2FIW A;  3IU1 A;  4HIZ A;  5AN9 A;  3WND A;  1R57 A;  2RC5 A;  1V0E A;  2PJ7 A;  3QFT A;  2BCO A;  3LWU A;  4NF1 A;  3PZJ A;  2Q0Y A;  4UFX A;  2GLF A;  2ZBV A;  4MFZ A;  5JH9 A;  3QAH A;  2C6P A;  1Q86 D;  1BPM A;  4CYQ A;  4X0C A;  3TTH A;  4IF5 A;  3PA1 A;  3WC5 A;  1SKQ A;  1AIP A;  1JQG A;  2OTJ B;  3VR6 A;  4P12 A;  3CB4 A;  1FNM A;  1VIX A;  4TMW A;  1ZLH A;  2EFG A;  4NSQ A;  4U9Y A;  4IK2 A;  1ZM4 A;  4ZGY B;  1N8R D;  4WZK A;  3ZBU A;  4P2N A;  2IL4 A;  1WOO A;  1IHM A;  2I79 A;  5ELY A;  2D4P A;  3R9E A;  2Z3N A;  5I4M A;  2CNM A;  5A88 A;  5AG6 A;  2CIJ A;  2ZW5 A;  1V0C A;  1QUF A;  4OPO A;  2NMT A;  2NSM A;  3CZX A;  3C26 A;  3KR5 A;  4KOU A;  4UZE A;  1PKV A;  4XM3 A;  4C68 A;  1Z8T A;  1KK1 A;  1K73 D;  3PBB A;  3I1F A;  2VL1 A;  2VEZ A;  4KVO E;  1ARM A;  4TN1 A;  2GAN A;  4NJR A;  2Z11 A;  1S7K A;  4F7D A;  4G1V A;  4XOR A;  3AVV A;  1H42 A;  2REE A;  2V7X A;  3IU2 A;  3ONU A;  3MMP A;  3CES A;  4M4S A;  3CCR B;  3T90 A;  5LRJ A;  1DTD A;  1VQ8 B;  4X5K A;  4P25 A;  1Y0R A;  1X12 A;  4NCZ A;  5L46 A;  4UWI A;  1YW4 A;  5DWN A;  3BCF A;  3AVY A;  4M53 A;  3VAT A;  1HZE A;  2C4T A;  1VQ4 B;  2F7V A;  3IWW A;  1OB5 A;  1Z2L A;  2B3V A;  1U6M A;  1BPL A;  4YAF A;  2XZL A;  4FUU A;  4Q38 A;  1XOV A;  3SI0 A;  2ZIT A;  4JLY A;  1Q81 D;  1AYE A;  2CK3 A;  4KOW A;  4R76 A;  1EFU A;  2BSW A;  3CXS A;  2IJZ A;  2XZO A;  5HZB A;  4PAA A;  3SLN A;  1RTQ A;  2XND A;  4H9G A;  2Z3P A;  3PB8 X;  4M1K A;  3PB6 X;  3WNC A;  1M4I A;  1IOI A;  2FSR A;  4E8O A;  1R5O A;  4YEJ A;  4R6T A;  3T53 B;  2XOK A;  2PRB A;  3V38 A;  4NGS A;  4QVT A;  3H8G A;  4XR6 A;  5HKK A;  2B5G A;  1T6X A;  4HPS A;  1FNC A;  1D8T A;  3PB9 X;  2DOG A;  3GUX A;  5E96 A;  5J1Q A;  3MGD A;  1TKF A;  3QFS A;  2J8M A;  1NBM A;  3PEI A;  1YJN B;  3BJ8 A;  3H4Q A;  4MFQ A;  4MBU A;  4E0F A;  1CNE A;  4B5P B; 
#chains in the Genus database with same CATH homology
 3KAS A;  4NGT A;  1UWY A;  5IB9 A;  5CPA A;  1ZG7 A;  4UEE A;  5HVG A;  1F2P A;  1ZG9 A;  3CT9 A;  3VH9 A;  3QNV A;  4MHP A;  1VHE A;  1OBR A;  2C6G A;  3PFE A;  4ZI6 A;  3BI0 A;  4YWY A;  4PPZ A;  2O4H A;  3IO1 A;  4P6Y A;  2PJ0 A;  2PJB A;  1VGY A;  2RFH A;  2QVP A;  4ONW A;  2V8V A;  2PJ6 A;  6CPA A;  1TF9 A;  4K3N A;  2OR4 A;  4O23 A;  5K8O A;  2ZOG A;  2AFS A;  7CPA A;  5HXD A;  4JYW A;  4OKO A;  3FF3 A;  2AFX A;  2IQ6 A;  2ZEG A;  5K8M A;  3TC8 A;  3CPA A;  3KQZ A;  4UEZ A;  1CPX A;  4P44 A;  4MHY A;  3PFO A;  4JZ0 A;  3FVL A;  4IHM A;  1LAP A;  1Z5R A;  5LYI A;  5LYF A;  2QYV A;  4DUK A;  2AFU A;  2PVW A;  1TKH A;  3S9M A;  4A94 A;  4ZY2 A;  1QMU A;  2PVV A;  1LOK A;  4WWV A;  1XBU A;  2V8G A;  2O53 A;  1Y0Y A;  4ZX8 A;  3H8F A;  4DYO A;  4ZY0 A;  3KR4 A;  2ZEL A;  2NYQ A;  3D7H A;  4DJL A;  4PXB A;  1Q7L A;  4X2T A;  3VAR A;  4F8Z A;  3WC7 A;  4NJQ A;  4NGM A;  1LFW A;  2WYR A;  3MN8 A;  3NA6 A;  1CX8 A;  4ZY1 A;  2ZEE A;  2C6C A;  1PYT B;  3B3S A;  3D7D A;  4PXE A;  2AFW A;  3T8W A;  4UIB A;  1NSA A;  3NFZ A;  3KGQ A;  4ZX9 A;  3KZW A;  4P45 A;  2ANP A;  2EK9 A;  2CF4 A;  4A39 A;  3KHX A;  4AXV A;  4NGQ A;  3SJF A;  2CTC A;  4X8I A;  1PCA A;  3D4U A;  1H8L A;  4KSI A;  2PJ9 A;  3N5F A;  4EWT A;  1M4L A;  2AFO A;  5K8N A;  2XEF A;  2ZEP A;  2HB6 A;  4Q7A A;  4CPA A;  2WZN A;  3B3C A;  1HDU A;  2ZEH A;  2EWB A;  3KQX A;  3NH8 A;  1BPN A;  2V8D A;  4FBE A;  5JM6 A;  3NH4 A;  3WAB A;  3KI9 A;  4GM5 A;  4NGN A;  3B3W A;  4EME A;  2GRE A;  1F57 A;  1CP6 A;  4ZYQ A;  4P4F A;  1AMP A;  1TXR A;  4Z65 A;  2XEG A;  1XFO A;  1XRY A;  4OME A;  1CBX A;  2AFZ A;  3FJU A;  3CDX A;  3B3T A;  4F9U A;  3ISX A;  3D7G A;  3GB0 A;  3B7I A;  5LRG A;  1IGB A;  4R7M A;  4MCS A;  3FEC A;  4P4I A;  2PJ2 A;  4YU9 A;  4OID A;  1LCP A;  3BHX A;  2ZEO A;  3SJX A;  4OC5 A;  3H8E A;  3KHZ A;  2F8H A;  3L2N A;  3CPX A;  4MXU A;  2PCU A;  5D8N A;  2POK A;  3FED A;  5THW A;  1BLL E;  4NGR A;  2Q4Z A;  3B3V A;  4G1P A;  3HLP A;  2GU2 A;  4UEF A;  1Z8L A;  3DLJ A;  4MCR A;  2BOA A;  3DGV A;  3IJ3 A;  3KL9 A;  2ZEN A;  2AFM A;  1LAM A;  3D68 A;  2PE3 A;  4R8F A;  3IFE A;  3PB7 X;  4UIA A;  3D7F A;  1YSJ A;  5CBM A;  1CG2 A;  4P4J A;  2BO9 A;  4OC4 A;  4OP4 A;  2PJA A;  1YLO A;  2V77 A;  3IC1 A;  3PB4 X;  4P4E A;  1TKJ A;  4W9Y A;  1IY7 A;  4MRI A;  2FVG A;  4MCQ A;  2V8H A;  2PJC A;  3B2Y A;  3BI1 A;  1CPS A;  1FNO A;  4PXD A;  3D67 A;  1ELM P;  4OC2 A;  3IEH A;  1ARL A;  2I3C A;  4A38 A;  3RZA A;  3FEE A;  2J9A A;  1XMB A;  1Y7E A;  5LYD A;  2ABZ A;  1R43 A;  1F2O A;  4B6Z A;  4BD9 A;  3K2K A;  3B35 A;  3GLJ A;  4P4D A;  3SI1 A;  2PJ7 A;  2PJ4 A;  2BCO A;  3LWU A;  2PJ1 A;  1VHO A;  4TNU A;  2JBK A;  1DE4 C;  3BXM A;  3JRU A;  4X3R A;  2GLF A;  2PJ8 A;  5JH9 A;  2C6P A;  5HVF A;  1BPM A;  4OIW A;  3WC5 A;  1GYT A;  1JQG A;  1EE3 P;  1VIX A;  1ZLH A;  3SI2 A;  4WJB A;  4IK2 A;  3IIB A;  5D29 A;  4UF4 A;  4NFR A;  2ZEF A;  2CTB A;  2QJ8 A;  3K9T A;  1HDQ A;  5ELY A;  2JBJ A;  5I4M A;  4FWU A;  2JEW A;  2CIJ A;  2NSM A;  1BAV A;  1TF8 A;  5DS0 A;  3V7Z A;  3KR5 A;  3SJG A;  3FX6 A;  3MRU A;  5F09 A;  3FH4 A;  3PBB A;  4NGP A;  2VL1 A;  4PQA A;  1ARM A;  3RBU A;  4NJR A;  4MHN A;  2ZOF A;  3FMC A;  1CP7 A;  4MHZ A;  2HC9 A;  1ZLI A;  5LRJ A;  5LYL A;  1DTD A;  2Q51 A;  1Y0R A;  2G9D A;  2ZED A;  4OC3 A;  1YW4 A;  2PRQ A;  4EFD A;  4OC0 A;  4RUH A;  1ELL P;  2GLJ A;  5JGF A;  2EK8 A;  2Q43 A;  3D66 A;  3VAT A;  3WC6 A;  2F7V A;  3IWW A;  1Z2L A;  1KWM A;  2IMO A;  8CPA A;  4PXC A;  3S9L A;  4TWE A;  2RB7 A;  2PJ5 A;  4FUU A;  3SI0 A;  2C1C A;  4FAI A;  3TX8 A;  1XJO A;  1ZG8 A;  1AYE A;  4R76 A;  3LMS A;  4A37 A;  2ZEM A;  1LAN A;  2IJZ A;  2PIY A;  4OC1 A;  1RTQ A;  1FT7 A;  4P4B A;  4P10 A;  3PB8 X;  3PB6 X;  3PBE A;  2DEA A;  2PJ3 A;  4IAV A;  4R6T A;  4H2K A;  3WT4 A;  3PRT A;  4LQG A;  1QQ9 A;  2OOT A;  3I1U A;  3V38 A;  4MCP A;  4NGS A;  1YME A;  3H8G A;  3HUV A;  3SJE A;  1HEE A;  5HVH A;  2PIZ A;  5K8P A;  1YW6 A;  3S9N A;  2XEI A;  3PB9 X;  3RAM A;  3GUX A;  5J1Q A;  3ISZ A;  1TKF A;  3PEI A;  4MMO A;  4F9V A;  5LRK A;  3NH5 A;  1R3N A;  2XEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...