3KL9A

Crystal structure of pepa from streptococcus pneumoniae
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
355
structure length
340
Chain Sequence
SMTTLFSKIKEVTELAAVSGHEAPVRAYLREKLTPHVDEVVTDGLGGIFGIKHSEAVDAPRVLVASHMDEVGFMVSEIKPDGTFRVVEIGGWNPMVVSSQRFKLLTRDGHEIPVISGPAIADIVFDGGFADKAEAESFGIRPGDTIVPDSSAILTANEKNIISKAWDNRYGVLMVSELAEALSGQKLGNELYLGSNVQEEVGLRGAHTSTTKFDPEVFLAVDCSPAGDVYGGQGKIGDGTLIRFYDPGHLLLPGMKDFLLTTAEEAGIKYQYYCGKGGTDAGAAHLKNGGVPSTTIGVCARYIHSHQTLYAMDDFLEAQAFLQALVKKLDRSTVDLIKHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl aminopeptidase
publication title Structural basis for the substrate specificity of PepA from Streptococcus pneumoniae, a dodecameric tetrahedral protease
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 107
structure length 340
sequence length 355
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.7: Glutamyl aminopeptidase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3kl9A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kl9A01
2CTCA 4P6YA 1XFOA 4EFDA 3IIBA 3TX8A 5LYFA 1KWMA 3KGQA 2QJ8A 3KR5A 2HC9A 5K8NA 1ZG7A 4A39A 4P4JA 5ELYA 4UEFA 4UIBA 3S9NA 1ARMA 1TKHA 2PJ5A 1CP6A 2PJ2A 3FX6A 1F2PA 2PIZA 2PE3A 1H8LA 1XMBA 4OC2A 3WC7A 5LRJA 4ONWA 4R76A 3KZWA 2PJ1A 2OR4A 4H2KA 4UF4A 7CPAA 2IMOA 3KASA 3ISZA 1TKJA 3IJ3A 4GM5A 1EE3P 3HUVA 1YSJA 4R8FA 4UEEA 5F09A 1XBUA 3T8WA 1CPXA 4NJQA 3FH4A 4X8IA 3H8FA 4G1PA 4MCPA 3BI0A 2PJ8A 1LFWA 2C1CA 3CDXA 3B3TA 3SJGA 4NGQA 1CP7A 1YMEA 1DE4C 4YWYA 1Z8LA 3SI2A 4UEZA 2CIJA 2IJZA 3MN8A 2ZEGA 4PXEA 2DEAA 1Z5RA 2Q4ZA 5K8OA 4TNUA 5I4MA 1TXRA 5IB9A 2I3CA 4EMEA 5LYIA 3BHXA 1JQGA 4A38A 4NGPA 3K9TA 2PJCA 2EK8A 2BOAA 2XEIA 3D7HA 4DYOA 2PJ9A 2CTBA 3SJXA 3SI0A 1QQ9A 4MXUA 4PQAA 4A94A 1YW4A 4IK2A 2POKA 3S9MA 5K8PA 3BI1A 1CPSA 2ZEEA 1ARLA 3KQZA 3KHZA 2BO9A 3JRUA 1Y0RA 2IQ6A 2QYVA 4MMOA 2V8VA 3TC8A 3CPAA 1LOKA 2ZEFA 3GUXA 2PVVA 4NGNA 3B7IA 4NJRA 2CF4A 3VARA 4P4IA 3QNVA 3WC6A 2C6GA 3B35A 2GLFA 4W9YA 1BPMA 3FVLA 1ZG9A 3FJUA 3VATA 3FEEA 1TF9A 3N5FA 5D8NA 4IAVA 1BLLE 4MHYA 5J1QA 1NSAA 2AFUA 2V77A 5JH9A 5HVFA 2XEJA 2C6CA 1ZLIA 5HVGA 3D68A 4OC5A 4B6ZA 3B2YA 4X2TA 2WZNA 4A37A 2WYRA 1F2OA 1LAPA 4ZY1A 3PB9X 3SJEA 1ZG8A 2Q43A 2GLJA 2NSMA 3K2KA 4P44A 4WWVA 3NH4A 4OC0A 4FUUA 4PXDA 4ZYQA 3BXMA 2F7VA 3B3WA 3WC5A 4ZY0A 4MCRA 2RFHA 4P4EA 3I1UA 4FAIA 4OIWA 4O23A 2HB6A 1UWYA 3GB0A 3V38A 2PJBA 3VH9A 1LCPA 2V8GA 2AFSA 3PBEA 3D7DA 2PIYA 3RAMA 1IY7A 4NGMA 3NA6A 4MHZA 1R3NA 3H8GA 3MRUA 3D67A 3CT9A 1RTQA 5D29A 4P4FA 2QVPA 4F8ZA 1GYTA 4NGTA 2PVWA 2V8HA 4PXBA 2PJ4A 1ELMP 1HDUA 3FEDA 4PXCA 5HVHA 1FNOA 1Y0YA 4JYWA 3V7ZA 1OBRA 2ZEOA 2ZENA 2EWBA 4DUKA 3PRTA 3WABA 1Y7EA 5HXDA 4ZX9A 4FBEA 4LQGA 3KQXA 1YW6A 1HDQA 2C6PA 4MHPA 1ZLHA 4F9VA 2PJ7A 1VHEA 3RBUA 3IEHA 3FECA 4AXVA 5JGFA 1VHOA 4OC4A 3ISXA 4R6TA 1LANA 2AFZA 4RUHA 3GLJA 4NFRA 2F8HA 4P4DA 3KHXA 3L2NA 1Z2LA 2BCOA 3IWWA 5LYDA 1PCAA 4MCQA 1HEEA 3PB6X 2ANPA 4IHMA 5LYLA 1VGYA 3B3VA 4CPAA 2RB7A 1IGBA 3LWUA 2VL1A 1AYEA 3KR4A 2JBJA 5DS0A 4MRIA 1TF8A 1CX8A 2AFXA 4P45A 4TWEA 2AFOA 3D4UA 4K3NA 4R7MA 1XRYA 5THWA 1Q7LA 2PJ0A 4F9UA 5LRKA 2ZOFA 4JZ0A 2EK9A 3IO1A 1LAMA 3PFEA 1R43A 4OIDA 3CPXA 2XEGA 4ZX8A 2JEWA 2O4HA 3D7FA 4PPZA 2G9DA 2AFWA 3KL9A 2OOTA 1ELLP 3PB4X 2V8DA 3IC1A 1BPNA 2NYQA 3SI1A 4OC1A 3IFEA 2GU2A 2J9AA 3HLPA 3B3SA 3NFZA 4P10A 1M4LA 4WJBA 4ZI6A 4BD9A 3FF3A 3NH5A 2JBKA 4P4BA 4DJLA 1DTDA 2PRQA 3SJFA 1CBXA 3DGVA 3PBBA 3PFOA 5CBMA 4OMEA 3D7GA 3RZAA 3FMCA 3S9LA 1QMUA 8CPAA 2O53A 3KI9A 4Q7AA 1TKFA 2PJ6A 2PJAA 1CG2A 3DLJA 4KSIA 4OP4A 1XJOA 2ZOGA 1BAVA 4UIAA 1F57A 1PYTB 4MCSA 5CPAA 4Z65A 1FT7A 3H8EA 3PEIA 2AFMA 2GREA 4YU9A 2Q51A 3D66A 2ZEDA 4EWTA 4NGSA 1VIXA 1YLOA 4NGRA 2ZEPA 4OC3A 2ZELA 4X3RA 3LMSA 4OKOA 4FWUA 1AMPA 2FVGA 3B3CA 3PB8X 3WT4A 2ZEHA 6CPAA 2XEFA 5LRGA 5K8MA 2PJ3A 5JM6A 4MHNA 4ZY2A 2PCUA 3NH8A 2ZEMA 2ABZA 3PB7X
chains in the Genus database with same CATH superfamily
1N07A 2CTCA 4YXWA 1XFOA 2Z0ZA 3CXPA 5IV0A 1CNEA 5TV2A 2QJ8A 5K8NA 3AVYA 5AG6A 4QUSA 3ONUA 2Q0YA 1VQMB 4LBWA 1TKHA 1WPCA 1CP6A 3ZBUA 2BN4A 1XMBA 3GVKA 3UY5A 5LRJA 4HIZA 4R76A 2Q6OA 3KZWA 3VNUA 1D1NA 3BLNA 4UF4A 3GY9A 2ZITA 4AVCA 3RY8A 1TKJA 1R57A 1G7CA 2KVOA 3AVWA 3K9UA 4TN1A 3A8IA 1MJBA 4R8FA 4QV2A 5F09A 4RPDA 4EVYA 1CPXA 2NPFA 2V4DA 4NJQA 5IB0A 1YVOA 2B3VA 3QFSA 2C1CA 1GO2A 2WJVA 4UEZA 2X7BA 4M4SA 2IJZA 3MN8A 2ZEGA 1S7KA 1EWYA 2Q4ZA 1G7RA 1K28D 3VMFA 1QGAA 3TTHA 1E62A 5B6IA 3LACA 3GVLA 1IIDA 3CD6B 3P2HA 2GK7A 2WZPP 2OK8A 5KNLA 1IHMA 2ZXHA 2YNCC 2OH1A 2PJ9A 3P2FA 4U9YA 2DXQA 2OZGA 2VQYA 3P26A 4MXUA 5H5JA 3GKRA 2ZXIA 4OP7A 2POKA 4NBSA 3E1YE 2NMTA 2I79A 1WTHD 3VWDA 1YJ9B 4F6AA 1R5OA 4E8OA 5GV8A 1H42A 2IQ6A 2QYVA 4MFLA 1MRZA 3OFNA 2V8VA 4KKSA 1QFYA 3GUXA 3J81k 4R9MA 4RD1A 3B7IA 2PSWA 1VQOB 4KOWA 1NDHA 5KTDA 2BUEA 1RXTA 2AJ6A 4CAVA 2QTZA 1YQEA 2C4UA 1D8TA 1WSVA 3WNDA 1ZG9A 1PUAA 3FJUA 4CGPA 5FNZA 1EFRA 2X85A 4G7WA 4NCZA 1JA1A 2DY1A 5D8NA 4XLFA 3ZUGA 4IAVA 4KUBA 4Q7JB 3QAHA 3NE8A 1N8RD 1W2BB 2XEJA 4OC5A 3T90A 2QMLA 4X2TA 3G3SA 2JDDA 2YWGA 4UZEA 2WYRA 1HZEA 1F2OA 4RCZA 1LAPA 3CCRB 2BM0A 3BC9A 5G20A 4KUAA 4LQ6A 4ZY1A 3SJEA 1A2ZA 1FY7A 2NSMA 4RDKA 3K2KA 2KCWA 4WWVA 3IWEA 1UD2A 3EY5A 4FUUA 3BXMA 2VBSA 3B3WA 1E3XA 2VI7A 2VBVA 3FXTA 4ZY0A 2B4BA 1KK2A 1Q2YA 2FS5A 4X5KA 4B3XA 4OIWA 4O23A 2HB6A 3GB0A 1ZM2A 3SXOA 3VH9A 1N0VC 2BVNA 3GYAA 4YELA 3A8JA 4BINA 2QIRA 3RAMA 2D74A 1IY7A 3NA6A 3ASTA 1W0JA 3D67A 5THXA 4I49A 1VQNB 4P4FA 1YREA 1M44A 4M2LA 2BEIA 4UFVA 4B48A 1S7FA 2X6YA 3OKXA 3Q38A 2PVWA 4CGMA 3CMMA 2E1RA 5F47A 4UFWA 3CRZA 4PXCA 2AHOA 2QMUA 3QSYA 4YFJA 4F0XA 2FCKA 1W34A 1CQXA 3V7ZA 3TT2A 4PC6A 3OZWA 4OOVA 2EWBA 1K9MD 3WABA 2WJYA 4ZX9A 2Z6BD 4UAJA 2C6PA 4MHPA 4XL9A 1MABA 1ZLHA 2CXAA 4B5OA 1CNFA 5BSYA 3CPWB 2PJ7A 3BCDA 3E20A 4UCMA 3FYNA 2HMAA 3ISXA 2E1BA 3SLNA 4QB9A 4YRHA 2Q4VA 4R6TA 5HZAA 2OB0A 4A32A 2F8HA 3CESA 5AG4A 4RPBA 1YJNB 4X0CA 1ZM9A 2QEXB 3PB6X 2JDIA 5IK2A 2RC4A 4YEJA 3RYOA 2CC2A 2EFGA 3LWUA 3PVDA 5DWMA 2EO8A 5DN6A 1B87A 3TO9A 1U2RA 4MRIA 1KUYA 4C2ZA 5JBQA 2OBTA 1EFTA 1YITB 1Q7LA 4F9UA 4IW3B 5IYRA 1T6ZA 1LAMA 2D4PA 3PFEA 2ZTNA 4PPZA 5H86A 2WPWA 2OOTA 2AFWA 3KL9A 1MJAA 1ELLP 5HXBA 2C5HA 2QTLA 3PB4X 2V8DA 2HQYA 3OE7A 3IC1A 1BPNA 4PK3A 5A89A 1YR0A 3CXSA 3G6EB 2OZUA 3HLPA 4M53A 3IGRA 4HPSA 1M4LA 4BD9A 3FF3A 3NH5A 4P4BA 5G21A 1DTDA 1Z4EA 2PRQA 3HAGA 3SJFA 1KZFA 3DGVA 4M6IA 3R96A 2XGJA 2OBRA 4P12A 1YI2B 4MHDA 4XNFA 4KSAA 4BMHA 4JXQA 1KK0A 2I00A 4UCPA 5J8CA 1QSTA 2C5BA 2Q44A 4NXYA 1P4MA 3ASSA 4K30A 1FT7A 3H8EA 4B11A 4RD6A 2XZPA 3F0AA 4OADA 1YVKA 2GREA 3W2HA 2Q51A 3U6BA 3H94A 4RDJA 4NGSA 4RS2A 4WZKA 3ZZ0A 4X05A 3N7ZA 2JJ1A 2VZYA 4OC3A 2JIZA 4X3RA 3LVBA 2V31A 3ASRA 3BNWA 2OYNA 1JA0A 2CNSA 4KOXA 1Q7YD 2B4DB 3AVXA 2R9VA 3GIRA 1ELOA 4H6ZA 1S72B 6CPAA 4JLYA 2B3UA 4PV6A 1QFZA 4Y49B 2CNDA 5K8MA 2PJ3A 4ACAA 5JM6A 3T9YA 3A35A 3OZUA 2ZEMA 3PB7X 4ZBGA 3JUWA 4YAFA 2VZZA 5IYQA 3CCSB 4XLHA 4EFDA 3TX8A 3PENA 4DNCA 2B4DA 4RN7A 3KGQA 5I0CA 3MGDA 4NF1A 4L89A 3Q3AA 1ZG7A 4PC2A 1AMOA 1NMTA 1YX2A 4P3IA 1H8HA 5EBVA 3S9NA 2XZLA 2PJ5A 1QUFA 4CAWA 1R5BA 1F2PA 4Z1MA 3H4QA 3G05A 3WC7A 1QSRA 2VJIA 3CP8A 2J8NA 5DSZA 2J8MA 2OR4A 2Q6KA 4A30A 4B4DA 3BCFA 4QVTA 2Z3OA 3W2IA 2F4NA 2PR8A 4GM5A 1EE3P 1JB9A 4CAFA 4CGLA 4G7XA 4II9A 4OPSA 4RCYA 1XBUA 3T8WA 2PR1A 3WNBA 2FIWA 3VNVA 3H5ZA 5F4OA 3BI0A 3V76A 1S0UA 3SKBA 1LFWA 1DE4C 1Z8LA 3SI2A 1RO5A 4KLVA 5F49A 2DEAA 4AVAA 3ES9A 4KOYA 1I7PA 4KKUA 5K8OA 2XNCA 4XMYA 2XNDA 1XE4A 3DNSA 2J8RA 3JQPA 2ODFA 4EMEA 5LYIA 1JQGA 4UZUA 4B14A 3C26A 2DOGA 3D7HA 4DYOA 2CTBA 3SI0A 2DERA 3D3SA 4QC6A 2ZTGA 4GS4A 4P2NA 4PQAA 1EP3B 4A94A 1QSOA 2G0BA 1WOOA 1YW4A 4TMZA 4IK2A 3S9MA 3EXNA 3CP2A 2XNJA 2RC5A 1CPSA 3KQZA 4N3NA 3VR6A 4FN5A 1W35A 3BJ7A 5FVJA 1Y0RA 3ZZIA 3I55B 3TC8A 3CPAA 2PVVA 4NGNA 3FJOA 4QFMA 4YGOA 4XM3A 1YGHA 4NJRA 2CF4A 2HLDA 2X53S 3ZZTA 4P4IA 2OU2A 3WC6A 3CCJB 1BLIA 3JU4A 2FE7A 3JQRA 1FNCA 3FVLA 1VQ9B 3IWGA 1FNDA 3VATA 1QG0A 1TF9A 4U9UA 4MHYA 2VBTA 2AFUA 2V77A 5G22A 5HVFA 1ZLIA 3D68A 4B6ZA 4WZEA 5HZBA 2VZLA 1NBMA 4RD2A 2QDXA 4EH1A 1Q9SA 2JLMA 3D8PA 4XLAA 4A37A 4IUSA 1WWZA 1BMFA 3IU2A 1KUVA 3D2PA 4OOSA 5F4JA 1KZLA 3R95A 4XPKA 4P44A 1RQPA 1Y9KA 2C2WA 4FXUA 4OC0A 3TOBA 3BY1A 1VJSA 3QB8A 4JD6A 3LQEA 2ZZFA 2AE6A 3Q6QA 2RFHA 2Z11A 2VNJA 4XPLA 3OEHA 2PRBA 2X8KA 4C2YA 3A3BA 1FNMA 1IB0A 3OPOA 1LCPA 2WPDA 2O28A 5HH1A 1KQSB 2V8GA 4ZCMA 3PGPA 2PIYA 3AGQA 1TIQA 4MHZA 1R3NA 4ASUA 2OBSA 2RC6A 4PSXA 1RTQA 5D29A 1DDIA 2QVPA 3E0KA 4U9ZA 4F8ZA 4ZGNB 3SHPA 5J35A 1M1KD 3SXNA 2F1LA 4PXBA 1N71A 2R6HA 4KORA 3LQ6A 2YNCA 5C82A 1VLYA 2Z3MA 3BH4A 4AC9A 3CCLB 4Z4YA 4XD7A 1E63A 2ZL5A 2ZENA 4AF6A 3A9LA 4B3FX 3KQXA 1YW6A 1HDQA 4MYTA 1SKYB 1S7NA 4PGOA 3LD2A 1I12A 3DDDA 4RD3A 3RBUA 4OC4A 4CGOA 1IJEA 4TMXA 3GQBA 4OPVA 2AFZA 4RUHA 4P4DA 3L2NA 4MCQA 4CYQA 4Z4SA 1HEEA 4QHYA 1VQ6B 5LYLA 1VGYA 5C88A 4CPAA 4KZTA 1KK3A 3B8HA 2RB7A 2WPXA 4P22A 1AYEA 5F46A 2BMWA 4TMTA 3SEJA 2JBJA 3KR4A 5DS0A 1I21A 4MI4A 1Y7RA 4AG7A 1VQ7B 2AFOA 3D4UA 2ZBVA 1XIXA 4LUAA 5THWA 2PJ0A 2ZOFA 3TE4A 3ZC3A 4NNJA 5FO1A 4M85A 4Q38A 4ZX8A 2O4HA 3D7FA 4PAAA 1I1DA 1QH0A 2OTJB 4XPDB 1IYLA 2FT0A 1K4JA 3IU1A 3OJWA 4CAEA 3R1KA 4Z4ZA 1W9XA 4B43A 2GJPA 1EXMA 4XNHB 4YAWA 3WQZA 1E3ZA 4ACBA 2PDOA 4ZI6A 2VEZA 2JBKA 1NJID 2YNDA 1KTVA 1WK4A 1CBXA 3PBBA 1FNBA 3LODA 4U5YA 1XF8A 4C2XA 4OMEA 3FMCA 3S9LA 1QMUA 4RM0A 1VF7A 3VWEA 1TKFA 4P26A 2XZOA 2PJAA 2F5IA 1ZUNB 3DLJA 4KSIA 2JN9A 1PKVA 1GJRA 1BAVA 1QGYA 1F57A 1MJ9A 2XOKA 4MCSA 3S6FA 4Z65A 2ZBUA 2EUIA 2G3AA 3WNCA 5J8FA 3PP9A 4AF7A 3QE2A 1F20A 3KKWA 5A8AA 1Z8WA 3D66A 3RO0A 1VQPB 2H5MA 3AVTA 4H89A 4B5PB 4X06A 4NGRA 1E1QA 5GV7A 3CCVB 1YLEA 1PJ7A 1EFCA 3TO7A 4CYNA 3OW2B 4OKOA 4FWUA 3WXMA 1AMPA 4ZGQB 3B3CA 3PB8X 3ZZUA 1I8DA 3WT4A 4BPRA 3SLDA 3FB3A 1XB2A 1SQHA 2DPTA 2FIAA 1M1DA 1BPLA 3G71B 3KEWA 2XEFA 4BBHA 4B5PA 4MFQA 5E6TA 4RD0A 2ZZGA 4N3GA 1TTTA 4C7IA 2I1LA 4P6YA 1V5VA 2D3LA 4M3SA 1H85A 4P9SA 1Q2CA 2X0KA 3RNZA 4TMWA 3KR5A 5LMZA 2HC9A 4UCNA 1OB5A 2D3NA 2ZW5A 2HDNB 5ELYA 4B44A 5A28A 2DYIA 3W2EA 1ARMA 4X07A 2PJ2A 4OC2A 3FIXA 4XN3A 1S3ZA 3CXCB 4CRYB 2GIVA 2GE3A 2PJ1A 5EC4A 1LRZA 7CPAA 1WU8A 2R1IA 3ISZA 3IJ3A 3W2GA 2GPJA 3HUVA 3BQJA 1IICA 2ZPAA 1WOPA 4CRZB 4WQMA 1YSJA 2QECA 4UEEA 3FH4A 4X8IA 2OK7A 2G3TA 4GXHA 4G1PA 4E2AA 1Q81D 2PJ8A 3I3GA 4P6VF 3ASQA 3CDXA 3SJGA 1CP7A 1YMEA 2GJRA 2GQFA 3ASPA 2CIJA 2X6XA 4QUZA 4MFPA 1Z5RA 2P6FA 4TNUA 5I4MA 1R5NA 3W5HA 1TXRA 5IB9A 3BHXA 4RDLA 2VYQA 3WR7A 3K9TA 4XKVA 2PJCA 2BOAA 3T56B 1AUGA 3ONYA 2XEIA 4K1XA 4HKFA 1QSMA 1QQ9A 2D9RA 2XEXA 1P4NA 4X7CA 4MY3A 2YWHA 2ZEEA 1ARLA 1HVXA 3W5UA 1S5KA 5A27A 2HCJB 2BO9A 1BX0A 3B8GA 4UWIA 5TRDA 2CY2A 2JJ2A 3OJXA 4XR6A 4KSFA 4ZCLA 4MMOA 2DF5A 2R8VA 2ZL7A 4H6UA 4PABA 4QVAA 3VARA 3Q39A 4Q36A 2C6GA 4C68A 1TUIA 4MFZA 2GLFA 4X7EA 5JQ4A 1BPMA 4H9GA 4KKTA 3W6SA 1GHEA 1EP1B 5CNPA 3DSBA 2ARHA 3N5FA 3R6JA 2QN6A 1BLLE 3W91A 1TLLA 1NSAA 5JH9A 4Z4WA 2C6CA 1N08A 5HVGA 4P25A 2P6GA 2WUUA 2ZW6A 3A1PA 4R3KA 2X6WA 3MCAA 2WZNA 5A88A 2Z3LA 5FL7A 3CC2B 3PA1A 3P27A 2EBJA 2ZL6A 1VQ5B 4B47A 4Z4TA 2Q43A 2C78A 2IL4A 2X3UA 3ZBTA 3NH4A 4E0FA 5HMNA 1K8AD 1Z8XA 3QFCA 3I1FA 4ZYQA 2F7VA 1OGIA 4CAXA 2V7UA 1KC8D 3WC5A 2VBUA 1OB2A 4P4EA 2QGGA 4ZCIA 3CCQB 3W6XA 1V0EA 3V38A 4TMVA 1FRQA 1X12A 4MJ8A 1PU9A 3D7DA 3FPPA 4B13A 4HNWB 3CZXA 3D26A 3NE5B 3H8GA 3MRUA 2VBQA 3CT9A 1T6YA 3NE7A 2YWEA 1GYTA 4X7FA 5EMIA 4JJXA 1HA3A 3WYAA 4UA3A 2V8HA 5H59A 2PJ4A 1ELMP 1FX0A 2BGIA 3FEDA 4NSQA 2HV2A 4XN0A 1V0FA 3A3GA 1D2EA 5HVHA 4G6IA 1OBRA 3ZIAA 4KVME 3T51B 4DUKA 3AVVA 5HXDA 4FBEA 1PJ6A 4LQGA 2PQ8A 1YX0A 4CGNA 1CJWA 1XEBA 2B7BA 3OP1A 1W87A 5HKKA 3IEHA 3FECA 5JGFA 1VHOA 1VLOA 4UWJA 1IU8A 3W2FA 2ZW4A 2PIAA 1LANA 1Z8TA 1G7TA 3KHXA 1KUXA 3TCVA 3PUMA 2BCOA 4KOUA 4TKOB 3IWWA 2Z10A 5LYDA 1PCAA 2ANPA 4IHMA 2DCUA 3B3VA 2BPOA 3GSIA 4AVZA 1WSRA 1FDRA 4Y7CA 1IGBA 3PUNA 1S60A 1NSLA 4YAOA 1TF8A 1CX8A 2AFXA 3V8IA 4YHBA 1Z4RA 5LRKA 4JZ0A 4KVOE 2EK9A 4Y9RA 1BOBA 4G1BA 1KK1A 1OHHA 5J3OA 3CPXA 2C27A 2XEGA 1QUEA 2C77A 2G9DA 3SJZA 2CRVA 1OB0A 1OGJA 4FK8A 4KS9A 2NYQA 5AG7A 1J9ZA 5AGEA 4OC1A 4MYUA 4DK1A 3T53B 4P10A 1FRNA 2CNTA 1NB0A 4WJBA 1V0CA 4DJLA 3B78A 3CW2A 3FBUA 4KVXA 3PFOA 4FD4A 1AIPA 1KRHA 3D7GA 2VNIA 4J3GA 8CPAA 3FPKA 4MFJA 1KJZA 1A8PA 4Q7AA 3CXQA 1K73D 5IYWA 5KTAA 1SKQA 1WP6A 2Q4YA 1CG2A 4RLZA 3VO1A 1XJOA 3WY9A 4OP4A 3A8KA 3H9NA 3VO2A 4OLLA 2V7WA 1PYTB 1G7SA 4RD4A 1S7LA 3PEIA 2V7XA 3D2MA 3U2QA 2DEUA 4LX9A 1VIXA 1CM0A 1Q82D 5KSWB 3G8WA 2ZW7A 1UMKA 1YLOA 3EO4A 3OW7A 2FSRA 5G1ZA 1QX4A 1NRKA 2ZELA 4M6HA 2V7TA 5AN9A 1TVCA 1B23P 3CMAB 2ZEHA 1W0KA 2J7KA 1WOSA 4CYPA 2BV3A 4OAEA 3R6KA 5LRGA 2D4OA 4ZY2A 4Y9UA 2PCUA 1UD6A 2ABZA 2GANA 1E79A 1GR1A 4MBUA 3IIBA 4TSFA 4F0YA 5LYFA 3AGPA 1KWMA 1XQBA 2YWFA 4ZV4A 2PLFA 4QBJA 1T6XA 2Q6IA 5ISVA 5TR9A 3GIUA 4A39A 4NCNA 1E64A 4XONA 1VQ8B 4P4JA 4FWTA 4UEFA 4UIBA 1DARA 1KD1D 2EIXA 3FX6A 4HE5A 2PIZA 2PE3A 1H8LA 4R87A 3TFYA 4TT3A 4ONWA 3EC4A 1UD5A 3CCEB 4B10A 1BQEA 1RQRA 4ORFA 4H2KA 1BX1A 2VJJA 1Q2DA 1J4JA 5IX3A 2CK3A 2IMOA 3KASA 5F48A 1IB1E 4B3GA 4XQFA 1YJWB 2DETA 3AVUA 2P6EA 1XE1A 2QA4B 2YNEA 3H8FA 5JPHA 4MCPA 4LBVA 3DR8A 1KMHA 3OOCA 1VKCA 2OZHA 3B3TA 2Y0MA 4NGQA 4CS0B 4YWYA 2DIEA 4XPDC 2W6JA 3MMPA 3JQQA 4PXEA 2OTLB 4HE6A 5L46A 1BO4A 2I3CA 4XNHC 2R7HA 2V7VA 3DDYA 2REEA 4NGPA 4A38A 5CDFA 3LO8A 2EK8A 4QVJA 1M4GA 3SJXA 4YAUA 4PC3A 4C7HA 4JWPA 1VQKB 4AVBA 5TY0A 5K8PA 3BI1A 3WBJA 3U6KA 1UFHA 1P0HA 1JJ2B 3KHZA 2B5GB 3JRUA 1IYKA 3QFRA 2FXFA 1COWA 3TO6A 1GAQA 1LOKA 1YHQB 2ZEFA 5GCNA 1Y9WA 3JTKA 1Q86D 2P3MA 4R71A 4JMQA 3QNVA 3WBKA 3B35A 1WORA 1E1RA 4W9YA 3I56B 2B5GA 1ZM4A 4WZTA 5FA6A 1YIJB 3OEEA 3FEEA 2ATRA 2GJKA 3PZJA 1JWQA 3TOAA 4XOTA 5H84A 1VHSA 5J1QA 2EVNA 2VNHA 4PK2A 4KOTA 5AG5A 1OZPA 3FRMA 4Z4RA 1QFJA 4UBRA 3B2YA 2QE7A 2P0WA 5IYNA 3S6HA 1ZO0A 2B58A 1N0UA 4GQNA 3PB9X 3G4SB 1M4IA 1ZG8A 2GLJA 3Q6RA 4WZLA 2YGWA 3OAAA 1NB9A 4PXDA 2ZXVA 4G1VA 4MCRA 2FX3A 4FAIA 3I1UA 1UWYA 2BL1A 2Z3NA 4KLWA 4II3A 2PJBA 1M4DA 1U6MA 1DG1G 4DNRB 4KOSA 1UD3A 2AFSA 1DDGA 2JEVA 3PBEA 3S6KA 1GAWA 4NGMA 1IJFA 4FD5A 5EMNA 2Q7SA 2B5OA 4A31A 4KOVA 1F60A 5BSXA 4NGTA 1PJ5A 3CCUB 1BJKA 4II2A 4P3YA 4CQJA 1HDUA 1SM4A 3F8KA 4RJLA 4HNYB 4MY0A 1ZM3A 3V7AA 1QVFB 5E96A 4YALA 5F4MA 1FNOA 3MHPA 1QVGB 4UZFA 1UD4A 1Y0YA 4JYWA 3SJPA 3ZPNA 2WSSA 2ZEOA 1B2RA 4R3LA 4M0LA 2BSWA 3PRTA 2VNKA 3DR6A 3F5BA 3BJ8A 1Y7EA 2DPSA 3R9GA 4F9VA 1VHEA 4MFKA 4AXVA 2PC1A 3FNCA 3OWCA 1H8EA 4M1KA 2R98A 4M6GA 5BWAB 2GK6A 1NE9A 3GLJA 1XMTA 4NFRA 4RI1A 1Z2LA 2Q7BA 2W6IA 2NV4A 2B7CA 1B6BA 4IF5A 1N06A 2VXKA 3CB4A 2C4TA 4Z4UA 2VL1A 3CTAA 3JVNA 1XOVA 3I9SA 1E43A 1N05A 4Y49C 4P45A 3CCMB 2JDCA 4TWEA 4K3NA 4R7MA 1M90D 3W5VA 1IOIA 1XRYA 4R57A 4JXRA 3OZVA 5KW9A 2BM1A 3QFTA 2WSAA 2Q04A 3IO1A 3BY2A 4OIDA 1R43A 4CYOA 2M5SA 1EFUA 2JEWA 3ZJ0A 4ZGYB 4LC0A 3CMEB 1VQLB 1WDTA 3S6GA 1S4MA 1GVHA 4OPOA 3R9EA 1EP2B 1I18A 2A4NA 3SI1A 3B82A 1MK4A 3LNNA 3IFEA 2GU2A 4NEXA 2J9AA 4G5GA 4C43A 2V7QA 3B3SA 3NFZA 1YK3A 4PSWA 3PA2A 2CNMA 2HUZA 4LBZA 4XORA 4F7DA 2Z3PA 4A2ZA 5CBMA 2F1MA 4XLCA 4ONUA 3RZAA 4E0AA 4UFXA 2O53A 3KI9A 4AG9A 2PJ6A 2ZZEA 4Z4VA 4A95A 4C0SA 4XLEA 2BF4A 4P1VA 4LBYA 4A33A 2ZOGA 4UIAA 3CC4B 2PMDA 4PC1A 3R9FA 2Q6LA 2CW5A 1JNYA 2BSAA 4B12A 5CPAA 4L8JA 3GVJA 4DQKA 2F43A 1ON0A 1QGZA 2AFMA 4YU9A 2ZEDA 4EWTA 4PC7A 5FO0A 3QAYA 5IYPA 1X10A 1QSNA 5KTCA 2LZJA 5FIUA 2CBXA 4L8AA 2ZEPA 2Z3KA 4HNXB 4OOXA 3FKSA 5DWNA 2GFQA 4DK0A 3CC7B 4XOPA 3LMSA 4AB7A 4ROXA 2BGJA 2FVGA 2K5TA 2FL4A 4XKWA 2WR8A 1L0CA 1Z9UA 1IOFA 4DQLA 1VQ4B 4X7DA 4FD7A 2REFA 1T5EA 4DNTB 4J0QA 4FD6A 4MHNA 3NH8A 3EFAA 2ZZQA 1UD8A
chains in the Genus database with same CATH topology
2CTCA 4P6YA 1XFOA 4EFDA 3IIBA 3TX8A 5LYFA 1KWMA 3KGQA 2QJ8A 3KR5A 2HC9A 5K8NA 1ZG7A 4A39A 4P4JA 5ELYA 4UEFA 4UIBA 3S9NA 1ARMA 1TKHA 2PJ5A 1CP6A 2PJ2A 3FX6A 1F2PA 2PIZA 2PE3A 1H8LA 1XMBA 4OC2A 3WC7A 5LRJA 4ONWA 4R76A 3KZWA 2PJ1A 2OR4A 4H2KA 4UF4A 7CPAA 2IMOA 3KASA 3ISZA 1TKJA 3IJ3A 4GM5A 1EE3P 3HUVA 1YSJA 4R8FA 4UEEA 5F09A 1XBUA 3T8WA 1CPXA 4NJQA 3FH4A 4X8IA 3H8FA 4G1PA 4MCPA 3BI0A 2PJ8A 1LFWA 2C1CA 3CDXA 3B3TA 3SJGA 4NGQA 1CP7A 1YMEA 1DE4C 4YWYA 1Z8LA 3SI2A 4UEZA 2CIJA 2IJZA 3MN8A 2ZEGA 4PXEA 2DEAA 1Z5RA 2Q4ZA 5K8OA 4TNUA 5I4MA 1TXRA 5IB9A 2I3CA 4EMEA 5LYIA 3BHXA 1JQGA 4A38A 4NGPA 3K9TA 2PJCA 2EK8A 2BOAA 2XEIA 3D7HA 4DYOA 2PJ9A 2CTBA 3SJXA 3SI0A 1QQ9A 4MXUA 4PQAA 4A94A 1YW4A 4IK2A 2POKA 3S9MA 5K8PA 3BI1A 1CPSA 2ZEEA 1ARLA 3KQZA 3KHZA 2BO9A 3JRUA 1Y0RA 2IQ6A 2QYVA 4MMOA 2V8VA 3TC8A 3CPAA 1LOKA 2ZEFA 3GUXA 2PVVA 4NGNA 3B7IA 4NJRA 2CF4A 3VARA 4P4IA 3QNVA 3WC6A 2C6GA 3B35A 2GLFA 4W9YA 1BPMA 3FVLA 1ZG9A 3FJUA 3VATA 3FEEA 1TF9A 3N5FA 5D8NA 4IAVA 1BLLE 4MHYA 5J1QA 1NSAA 2AFUA 2V77A 5JH9A 5HVFA 2XEJA 2C6CA 1ZLIA 5HVGA 3D68A 4OC5A 4B6ZA 3B2YA 4X2TA 2WZNA 4A37A 2WYRA 1F2OA 1LAPA 4ZY1A 3PB9X 3SJEA 1ZG8A 2Q43A 2GLJA 2NSMA 3K2KA 4P44A 4WWVA 3NH4A 4OC0A 4FUUA 4PXDA 4ZYQA 3BXMA 2F7VA 3B3WA 3WC5A 4ZY0A 4MCRA 2RFHA 4P4EA 3I1UA 4FAIA 4OIWA 4O23A 2HB6A 1UWYA 3GB0A 3V38A 2PJBA 3VH9A 1LCPA 2V8GA 2AFSA 3PBEA 3D7DA 2PIYA 3RAMA 1IY7A 4NGMA 3NA6A 4MHZA 1R3NA 3H8GA 3MRUA 3D67A 3CT9A 1RTQA 5D29A 4P4FA 2QVPA 4F8ZA 1GYTA 4NGTA 2PVWA 2V8HA 4PXBA 2PJ4A 1ELMP 1HDUA 3FEDA 4PXCA 5HVHA 1FNOA 1Y0YA 4JYWA 3V7ZA 1OBRA 2ZEOA 2ZENA 2EWBA 4DUKA 3PRTA 3WABA 1Y7EA 5HXDA 4ZX9A 4FBEA 4LQGA 3KQXA 1YW6A 1HDQA 2C6PA 4MHPA 1ZLHA 4F9VA 2PJ7A 1VHEA 3RBUA 3IEHA 3FECA 4AXVA 5JGFA 1VHOA 4OC4A 3ISXA 4R6TA 1LANA 2AFZA 4RUHA 3GLJA 4NFRA 2F8HA 4P4DA 3KHXA 3L2NA 1Z2LA 2BCOA 3IWWA 5LYDA 1PCAA 4MCQA 1HEEA 3PB6X 2ANPA 4IHMA 5LYLA 1VGYA 3B3VA 4CPAA 2RB7A 1IGBA 3LWUA 2VL1A 1AYEA 3KR4A 2JBJA 5DS0A 4MRIA 1TF8A 1CX8A 2AFXA 4P45A 4TWEA 2AFOA 3D4UA 4K3NA 4R7MA 1XRYA 5THWA 1Q7LA 2PJ0A 4F9UA 5LRKA 2ZOFA 4JZ0A 2EK9A 3IO1A 1LAMA 3PFEA 1R43A 4OIDA 3CPXA 2XEGA 4ZX8A 2JEWA 2O4HA 3D7FA 4PPZA 2G9DA 2AFWA 3KL9A 2OOTA 1ELLP 3PB4X 2V8DA 3IC1A 1BPNA 2NYQA 3SI1A 4OC1A 3IFEA 2GU2A 2J9AA 3HLPA 3B3SA 3NFZA 4P10A 1M4LA 4WJBA 4ZI6A 4BD9A 3FF3A 3NH5A 2JBKA 4P4BA 4DJLA 1DTDA 2PRQA 3SJFA 1CBXA 3DGVA 3PBBA 3PFOA 5CBMA 4OMEA 3D7GA 3RZAA 3FMCA 3S9LA 1QMUA 8CPAA 2O53A 3KI9A 4Q7AA 1TKFA 2PJ6A 2PJAA 1CG2A 3DLJA 4KSIA 4OP4A 1XJOA 2ZOGA 1BAVA 4UIAA 1F57A 1PYTB 4MCSA 5CPAA 4Z65A 1FT7A 3H8EA 3PEIA 2AFMA 2GREA 4YU9A 2Q51A 3D66A 2ZEDA 4EWTA 4NGSA 1VIXA 1YLOA 4NGRA 2ZEPA 4OC3A 2ZELA 4X3RA 3LMSA 4OKOA 4FWUA 1AMPA 2FVGA 3B3CA 3PB8X 3WT4A 2ZEHA 6CPAA 2XEFA 5LRGA 5K8MA 2PJ3A 5JM6A 4MHNA 4ZY2A 2PCUA 3NH8A 2ZEMA 2ABZA 3PB7X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTC A;  4P6Y A;  1XFO A;  4EFD A;  3IIB A;  3TX8 A;  5LYF A;  1KWM A;  3KGQ A;  2QJ8 A;  3KR5 A;  2HC9 A;  5K8N A;  1ZG7 A;  4A39 A;  4P4J A;  5ELY A;  4UEF A;  4UIB A;  3S9N A;  1ARM A;  1TKH A;  2PJ5 A;  1CP6 A;  2PJ2 A;  3FX6 A;  1F2P A;  2PIZ A;  2PE3 A;  1H8L A;  1XMB A;  4OC2 A;  3WC7 A;  5LRJ A;  4ONW A;  4R76 A;  3KZW A;  2PJ1 A;  2OR4 A;  4H2K A;  4UF4 A;  7CPA A;  2IMO A;  3KAS A;  3ISZ A;  1TKJ A;  3IJ3 A;  4GM5 A;  1EE3 P;  3HUV A;  1YSJ A;  4R8F A;  4UEE A;  5F09 A;  1XBU A;  3T8W A;  1CPX A;  4NJQ A;  3FH4 A;  4X8I A;  3H8F A;  4G1P A;  4MCP A;  3BI0 A;  2PJ8 A;  1LFW A;  2C1C A;  3CDX A;  3B3T A;  3SJG A;  4NGQ A;  1CP7 A;  1YME A;  1DE4 C;  4YWY A;  1Z8L A;  3SI2 A;  4UEZ A;  2CIJ A;  2IJZ A;  3MN8 A;  2ZEG A;  4PXE A;  2DEA A;  1Z5R A;  2Q4Z A;  5K8O A;  4TNU A;  5I4M A;  1TXR A;  5IB9 A;  2I3C A;  4EME A;  5LYI A;  3BHX A;  1JQG A;  4A38 A;  4NGP A;  3K9T A;  2PJC A;  2EK8 A;  2BOA A;  2XEI A;  3D7H A;  4DYO A;  2PJ9 A;  2CTB A;  3SJX A;  3SI0 A;  1QQ9 A;  4MXU A;  4PQA A;  4A94 A;  1YW4 A;  4IK2 A;  2POK A;  3S9M A;  5K8P A;  3BI1 A;  1CPS A;  2ZEE A;  1ARL A;  3KQZ A;  3KHZ A;  2BO9 A;  3JRU A;  1Y0R A;  2IQ6 A;  2QYV A;  4MMO A;  2V8V A;  3TC8 A;  3CPA A;  1LOK A;  2ZEF A;  3GUX A;  2PVV A;  4NGN A;  3B7I A;  4NJR A;  2CF4 A;  3VAR A;  4P4I A;  3QNV A;  3WC6 A;  2C6G A;  3B35 A;  2GLF A;  4W9Y A;  1BPM A;  3FVL A;  1ZG9 A;  3FJU A;  3VAT A;  3FEE A;  1TF9 A;  3N5F A;  5D8N A;  4IAV A;  1BLL E;  4MHY A;  5J1Q A;  1NSA A;  2AFU A;  2V77 A;  5JH9 A;  5HVF A;  2XEJ A;  2C6C A;  1ZLI A;  5HVG A;  3D68 A;  4OC5 A;  4B6Z A;  3B2Y A;  4X2T A;  2WZN A;  4A37 A;  2WYR A;  1F2O A;  1LAP A;  4ZY1 A;  3PB9 X;  3SJE A;  1ZG8 A;  2Q43 A;  2GLJ A;  2NSM A;  3K2K A;  4P44 A;  4WWV A;  3NH4 A;  4OC0 A;  4FUU A;  4PXD A;  4ZYQ A;  3BXM A;  2F7V A;  3B3W A;  3WC5 A;  4ZY0 A;  4MCR A;  2RFH A;  4P4E A;  3I1U A;  4FAI A;  4OIW A;  4O23 A;  2HB6 A;  1UWY A;  3GB0 A;  3V38 A;  2PJB A;  3VH9 A;  1LCP A;  2V8G A;  2AFS A;  3PBE A;  3D7D A;  2PIY A;  3RAM A;  1IY7 A;  4NGM A;  3NA6 A;  4MHZ A;  1R3N A;  3H8G A;  3MRU A;  3D67 A;  3CT9 A;  1RTQ A;  5D29 A;  4P4F A;  2QVP A;  4F8Z A;  1GYT A;  4NGT A;  2PVW A;  2V8H A;  4PXB A;  2PJ4 A;  1ELM P;  1HDU A;  3FED A;  4PXC A;  5HVH A;  1FNO A;  1Y0Y A;  4JYW A;  3V7Z A;  1OBR A;  2ZEO A;  2ZEN A;  2EWB A;  4DUK A;  3PRT A;  3WAB A;  1Y7E A;  5HXD A;  4ZX9 A;  4FBE A;  4LQG A;  3KQX A;  1YW6 A;  1HDQ A;  2C6P A;  4MHP A;  1ZLH A;  4F9V A;  2PJ7 A;  1VHE A;  3RBU A;  3IEH A;  3FEC A;  4AXV A;  5JGF A;  1VHO A;  4OC4 A;  3ISX A;  4R6T A;  1LAN A;  2AFZ A;  4RUH A;  3GLJ A;  4NFR A;  2F8H A;  4P4D A;  3KHX A;  3L2N A;  1Z2L A;  2BCO A;  3IWW A;  5LYD A;  1PCA A;  4MCQ A;  1HEE A;  3PB6 X;  2ANP A;  4IHM A;  5LYL A;  1VGY A;  3B3V A;  4CPA A;  2RB7 A;  1IGB A;  3LWU A;  2VL1 A;  1AYE A;  3KR4 A;  2JBJ A;  5DS0 A;  4MRI A;  1TF8 A;  1CX8 A;  2AFX A;  4P45 A;  4TWE A;  2AFO A;  3D4U A;  4K3N A;  4R7M A;  1XRY A;  5THW A;  1Q7L A;  2PJ0 A;  4F9U A;  5LRK A;  2ZOF A;  4JZ0 A;  2EK9 A;  3IO1 A;  1LAM A;  3PFE A;  1R43 A;  4OID A;  3CPX A;  2XEG A;  4ZX8 A;  2JEW A;  2O4H A;  3D7F A;  4PPZ A;  2G9D A;  2AFW A;  3KL9 A;  2OOT A;  1ELL P;  3PB4 X;  2V8D A;  3IC1 A;  1BPN A;  2NYQ A;  3SI1 A;  4OC1 A;  3IFE A;  2GU2 A;  2J9A A;  3HLP A;  3B3S A;  3NFZ A;  4P10 A;  1M4L A;  4WJB A;  4ZI6 A;  4BD9 A;  3FF3 A;  3NH5 A;  2JBK A;  4P4B A;  4DJL A;  1DTD A;  2PRQ A;  3SJF A;  1CBX A;  3DGV A;  3PBB A;  3PFO A;  5CBM A;  4OME A;  3D7G A;  3RZA A;  3FMC A;  3S9L A;  1QMU A;  8CPA A;  2O53 A;  3KI9 A;  4Q7A A;  1TKF A;  2PJ6 A;  2PJA A;  1CG2 A;  3DLJ A;  4KSI A;  4OP4 A;  1XJO A;  2ZOG A;  1BAV A;  4UIA A;  1F57 A;  1PYT B;  4MCS A;  5CPA A;  4Z65 A;  1FT7 A;  3H8E A;  3PEI A;  2AFM A;  2GRE A;  4YU9 A;  2Q51 A;  3D66 A;  2ZED A;  4EWT A;  4NGS A;  1VIX A;  1YLO A;  4NGR A;  2ZEP A;  4OC3 A;  2ZEL A;  4X3R A;  3LMS A;  4OKO A;  4FWU A;  1AMP A;  2FVG A;  3B3C A;  3PB8 X;  3WT4 A;  2ZEH A;  6CPA A;  2XEF A;  5LRG A;  5K8M A;  2PJ3 A;  5JM6 A;  4MHN A;  4ZY2 A;  2PCU A;  3NH8 A;  2ZEM A;  2ABZ A;  3PB7 X; 
#chains in the Genus database with same CATH topology
 1N07 A;  2CTC A;  4YXW A;  1XFO A;  2Z0Z A;  3CXP A;  5IV0 A;  1CNE A;  5TV2 A;  2QJ8 A;  5K8N A;  3AVY A;  5AG6 A;  4QUS A;  3ONU A;  2Q0Y A;  1VQM B;  4LBW A;  1TKH A;  1WPC A;  1CP6 A;  3ZBU A;  2BN4 A;  1XMB A;  3GVK A;  3UY5 A;  5LRJ A;  4HIZ A;  4R76 A;  2Q6O A;  3KZW A;  3VNU A;  1D1N A;  3BLN A;  4UF4 A;  3GY9 A;  2ZIT A;  4AVC A;  3RY8 A;  1TKJ A;  1R57 A;  1G7C A;  2KVO A;  3AVW A;  3K9U A;  4TN1 A;  3A8I A;  1MJB A;  4R8F A;  4QV2 A;  5F09 A;  4RPD A;  4EVY A;  1CPX A;  2NPF A;  2V4D A;  4NJQ A;  5IB0 A;  1YVO A;  2B3V A;  3QFS A;  2C1C A;  1GO2 A;  2WJV A;  4UEZ A;  2X7B A;  4M4S A;  2IJZ A;  3MN8 A;  2ZEG A;  1S7K A;  1EWY A;  2Q4Z A;  1G7R A;  1K28 D;  3VMF A;  1QGA A;  3TTH A;  1E62 A;  5B6I A;  3LAC A;  3GVL A;  1IID A;  3CD6 B;  3P2H A;  2GK7 A;  2WZP P;  2OK8 A;  5KNL A;  1IHM A;  2ZXH A;  2YNC C;  2OH1 A;  2PJ9 A;  3P2F A;  4U9Y A;  2DXQ A;  2OZG A;  2VQY A;  3P26 A;  4MXU A;  5H5J A;  3GKR A;  2ZXI A;  4OP7 A;  2POK A;  4NBS A;  3E1Y E;  2NMT A;  2I79 A;  1WTH D;  3VWD A;  1YJ9 B;  4F6A A;  1R5O A;  4E8O A;  5GV8 A;  1H42 A;  2IQ6 A;  2QYV A;  4MFL A;  1MRZ A;  3OFN A;  2V8V A;  4KKS A;  1QFY A;  3GUX A;  3J81 k;  4R9M A;  4RD1 A;  3B7I A;  2PSW A;  1VQO B;  4KOW A;  1NDH A;  5KTD A;  2BUE A;  1RXT A;  2AJ6 A;  4CAV A;  2QTZ A;  1YQE A;  2C4U A;  1D8T A;  1WSV A;  3WND A;  1ZG9 A;  1PUA A;  3FJU A;  4CGP A;  5FNZ A;  1EFR A;  2X85 A;  4G7W A;  4NCZ A;  1JA1 A;  2DY1 A;  5D8N A;  4XLF A;  3ZUG A;  4IAV A;  4KUB A;  4Q7J B;  3QAH A;  3NE8 A;  1N8R D;  1W2B B;  2XEJ A;  4OC5 A;  3T90 A;  2QML A;  4X2T A;  3G3S A;  2JDD A;  2YWG A;  4UZE A;  2WYR A;  1HZE A;  1F2O A;  4RCZ A;  1LAP A;  3CCR B;  2BM0 A;  3BC9 A;  5G20 A;  4KUA A;  4LQ6 A;  4ZY1 A;  3SJE A;  1A2Z A;  1FY7 A;  2NSM A;  4RDK A;  3K2K A;  2KCW A;  4WWV A;  3IWE A;  1UD2 A;  3EY5 A;  4FUU A;  3BXM A;  2VBS A;  3B3W A;  1E3X A;  2VI7 A;  2VBV A;  3FXT A;  4ZY0 A;  2B4B A;  1KK2 A;  1Q2Y A;  2FS5 A;  4X5K A;  4B3X A;  4OIW A;  4O23 A;  2HB6 A;  3GB0 A;  1ZM2 A;  3SXO A;  3VH9 A;  1N0V C;  2BVN A;  3GYA A;  4YEL A;  3A8J A;  4BIN A;  2QIR A;  3RAM A;  2D74 A;  1IY7 A;  3NA6 A;  3AST A;  1W0J A;  3D67 A;  5THX A;  4I49 A;  1VQN B;  4P4F A;  1YRE A;  1M44 A;  4M2L A;  2BEI A;  4UFV A;  4B48 A;  1S7F A;  2X6Y A;  3OKX A;  3Q38 A;  2PVW A;  4CGM A;  3CMM A;  2E1R A;  5F47 A;  4UFW A;  3CRZ A;  4PXC A;  2AHO A;  2QMU A;  3QSY A;  4YFJ A;  4F0X A;  2FCK A;  1W34 A;  1CQX A;  3V7Z A;  3TT2 A;  4PC6 A;  3OZW A;  4OOV A;  2EWB A;  1K9M D;  3WAB A;  2WJY A;  4ZX9 A;  2Z6B D;  4UAJ A;  2C6P A;  4MHP A;  4XL9 A;  1MAB A;  1ZLH A;  2CXA A;  4B5O A;  1CNF A;  5BSY A;  3CPW B;  2PJ7 A;  3BCD A;  3E20 A;  4UCM A;  3FYN A;  2HMA A;  3ISX A;  2E1B A;  3SLN A;  4QB9 A;  4YRH A;  2Q4V A;  4R6T A;  5HZA A;  2OB0 A;  4A32 A;  2F8H A;  3CES A;  5AG4 A;  4RPB A;  1YJN B;  4X0C A;  1ZM9 A;  2QEX B;  3PB6 X;  2JDI A;  5IK2 A;  2RC4 A;  4YEJ A;  3RYO A;  2CC2 A;  2EFG A;  3LWU A;  3PVD A;  5DWM A;  2EO8 A;  5DN6 A;  1B87 A;  3TO9 A;  1U2R A;  4MRI A;  1KUY A;  4C2Z A;  5JBQ A;  2OBT A;  1EFT A;  1YIT B;  1Q7L A;  4F9U A;  4IW3 B;  5IYR A;  1T6Z A;  1LAM A;  2D4P A;  3PFE A;  2ZTN A;  4PPZ A;  5H86 A;  2WPW A;  2OOT A;  2AFW A;  3KL9 A;  1MJA A;  1ELL P;  5HXB A;  2C5H A;  2QTL A;  3PB4 X;  2V8D A;  2HQY A;  3OE7 A;  3IC1 A;  1BPN A;  4PK3 A;  5A89 A;  1YR0 A;  3CXS A;  3G6E B;  2OZU A;  3HLP A;  4M53 A;  3IGR A;  4HPS A;  1M4L A;  4BD9 A;  3FF3 A;  3NH5 A;  4P4B A;  5G21 A;  1DTD A;  1Z4E A;  2PRQ A;  3HAG A;  3SJF A;  1KZF A;  3DGV A;  4M6I A;  3R96 A;  2XGJ A;  2OBR A;  4P12 A;  1YI2 B;  4MHD A;  4XNF A;  4KSA A;  4BMH A;  4JXQ A;  1KK0 A;  2I00 A;  4UCP A;  5J8C A;  1QST A;  2C5B A;  2Q44 A;  4NXY A;  1P4M A;  3ASS A;  4K30 A;  1FT7 A;  3H8E A;  4B11 A;  4RD6 A;  2XZP A;  3F0A A;  4OAD A;  1YVK A;  2GRE A;  3W2H A;  2Q51 A;  3U6B A;  3H94 A;  4RDJ A;  4NGS A;  4RS2 A;  4WZK A;  3ZZ0 A;  4X05 A;  3N7Z A;  2JJ1 A;  2VZY A;  4OC3 A;  2JIZ A;  4X3R A;  3LVB A;  2V31 A;  3ASR A;  3BNW A;  2OYN A;  1JA0 A;  2CNS A;  4KOX A;  1Q7Y D;  2B4D B;  3AVX A;  2R9V A;  3GIR A;  1ELO A;  4H6Z A;  1S72 B;  6CPA A;  4JLY A;  2B3U A;  4PV6 A;  1QFZ A;  4Y49 B;  2CND A;  5K8M A;  2PJ3 A;  4ACA A;  5JM6 A;  3T9Y A;  3A35 A;  3OZU A;  2ZEM A;  3PB7 X;  4ZBG A;  3JUW A;  4YAF A;  2VZZ A;  5IYQ A;  3CCS B;  4XLH A;  4EFD A;  3TX8 A;  3PEN A;  4DNC A;  2B4D A;  4RN7 A;  3KGQ A;  5I0C A;  3MGD A;  4NF1 A;  4L89 A;  3Q3A A;  1ZG7 A;  4PC2 A;  1AMO A;  1NMT A;  1YX2 A;  4P3I A;  1H8H A;  5EBV A;  3S9N A;  2XZL A;  2PJ5 A;  1QUF A;  4CAW A;  1R5B A;  1F2P A;  4Z1M A;  3H4Q A;  3G05 A;  3WC7 A;  1QSR A;  2VJI A;  3CP8 A;  2J8N A;  5DSZ A;  2J8M A;  2OR4 A;  2Q6K A;  4A30 A;  4B4D A;  3BCF A;  4QVT A;  2Z3O A;  3W2I A;  2F4N A;  2PR8 A;  4GM5 A;  1EE3 P;  1JB9 A;  4CAF A;  4CGL A;  4G7X A;  4II9 A;  4OPS A;  4RCY A;  1XBU A;  3T8W A;  2PR1 A;  3WNB A;  2FIW A;  3VNV A;  3H5Z A;  5F4O A;  3BI0 A;  3V76 A;  1S0U A;  3SKB A;  1LFW A;  1DE4 C;  1Z8L A;  3SI2 A;  1RO5 A;  4KLV A;  5F49 A;  2DEA A;  4AVA A;  3ES9 A;  4KOY A;  1I7P A;  4KKU A;  5K8O A;  2XNC A;  4XMY A;  2XND A;  1XE4 A;  3DNS A;  2J8R A;  3JQP A;  2ODF A;  4EME A;  5LYI A;  1JQG A;  4UZU A;  4B14 A;  3C26 A;  2DOG A;  3D7H A;  4DYO A;  2CTB A;  3SI0 A;  2DER A;  3D3S A;  4QC6 A;  2ZTG A;  4GS4 A;  4P2N A;  4PQA A;  1EP3 B;  4A94 A;  1QSO A;  2G0B A;  1WOO A;  1YW4 A;  4TMZ A;  4IK2 A;  3S9M A;  3EXN A;  3CP2 A;  2XNJ A;  2RC5 A;  1CPS A;  3KQZ A;  4N3N A;  3VR6 A;  4FN5 A;  1W35 A;  3BJ7 A;  5FVJ A;  1Y0R A;  3ZZI A;  3I55 B;  3TC8 A;  3CPA A;  2PVV A;  4NGN A;  3FJO A;  4QFM A;  4YGO A;  4XM3 A;  1YGH A;  4NJR A;  2CF4 A;  2HLD A;  2X53 S;  3ZZT A;  4P4I A;  2OU2 A;  3WC6 A;  3CCJ B;  1BLI A;  3JU4 A;  2FE7 A;  3JQR A;  1FNC A;  3FVL A;  1VQ9 B;  3IWG A;  1FND A;  3VAT A;  1QG0 A;  1TF9 A;  4U9U A;  4MHY A;  2VBT A;  2AFU A;  2V77 A;  5G22 A;  5HVF A;  1ZLI A;  3D68 A;  4B6Z A;  4WZE A;  5HZB A;  2VZL A;  1NBM A;  4RD2 A;  2QDX A;  4EH1 A;  1Q9S A;  2JLM A;  3D8P A;  4XLA A;  4A37 A;  4IUS A;  1WWZ A;  1BMF A;  3IU2 A;  1KUV A;  3D2P A;  4OOS A;  5F4J A;  1KZL A;  3R95 A;  4XPK A;  4P44 A;  1RQP A;  1Y9K A;  2C2W A;  4FXU A;  4OC0 A;  3TOB A;  3BY1 A;  1VJS A;  3QB8 A;  4JD6 A;  3LQE A;  2ZZF A;  2AE6 A;  3Q6Q A;  2RFH A;  2Z11 A;  2VNJ A;  4XPL A;  3OEH A;  2PRB A;  2X8K A;  4C2Y A;  3A3B A;  1FNM A;  1IB0 A;  3OPO A;  1LCP A;  2WPD A;  2O28 A;  5HH1 A;  1KQS B;  2V8G A;  4ZCM A;  3PGP A;  2PIY A;  3AGQ A;  1TIQ A;  4MHZ A;  1R3N A;  4ASU A;  2OBS A;  2RC6 A;  4PSX A;  1RTQ A;  5D29 A;  1DDI A;  2QVP A;  3E0K A;  4U9Z A;  4F8Z A;  4ZGN B;  3SHP A;  5J35 A;  1M1K D;  3SXN A;  2F1L A;  4PXB A;  1N71 A;  2R6H A;  4KOR A;  3LQ6 A;  2YNC A;  5C82 A;  1VLY A;  2Z3M A;  3BH4 A;  4AC9 A;  3CCL B;  4Z4Y A;  4XD7 A;  1E63 A;  2ZL5 A;  2ZEN A;  4AF6 A;  3A9L A;  4B3F X;  3KQX A;  1YW6 A;  1HDQ A;  4MYT A;  1SKY B;  1S7N A;  4PGO A;  3LD2 A;  1I12 A;  3DDD A;  4RD3 A;  3RBU A;  4OC4 A;  4CGO A;  1IJE A;  4TMX A;  3GQB A;  4OPV A;  2AFZ A;  4RUH A;  4P4D A;  3L2N A;  4MCQ A;  4CYQ A;  4Z4S A;  1HEE A;  4QHY A;  1VQ6 B;  5LYL A;  1VGY A;  5C88 A;  4CPA A;  4KZT A;  1KK3 A;  3B8H A;  2RB7 A;  2WPX A;  4P22 A;  1AYE A;  5F46 A;  2BMW A;  4TMT A;  3SEJ A;  2JBJ A;  3KR4 A;  5DS0 A;  1I21 A;  4MI4 A;  1Y7R A;  4AG7 A;  1VQ7 B;  2AFO A;  3D4U A;  2ZBV A;  1XIX A;  4LUA A;  5THW A;  2PJ0 A;  2ZOF A;  3TE4 A;  3ZC3 A;  4NNJ A;  5FO1 A;  4M85 A;  4Q38 A;  4ZX8 A;  2O4H A;  3D7F A;  4PAA A;  1I1D A;  1QH0 A;  2OTJ B;  4XPD B;  1IYL A;  2FT0 A;  1K4J A;  3IU1 A;  3OJW A;  4CAE A;  3R1K A;  4Z4Z A;  1W9X A;  4B43 A;  2GJP A;  1EXM A;  4XNH B;  4YAW A;  3WQZ A;  1E3Z A;  4ACB A;  2PDO A;  4ZI6 A;  2VEZ A;  2JBK A;  1NJI D;  2YND A;  1KTV A;  1WK4 A;  1CBX A;  3PBB A;  1FNB A;  3LOD A;  4U5Y A;  1XF8 A;  4C2X A;  4OME A;  3FMC A;  3S9L A;  1QMU A;  4RM0 A;  1VF7 A;  3VWE A;  1TKF A;  4P26 A;  2XZO A;  2PJA A;  2F5I A;  1ZUN B;  3DLJ A;  4KSI A;  2JN9 A;  1PKV A;  1GJR A;  1BAV A;  1QGY A;  1F57 A;  1MJ9 A;  2XOK A;  4MCS A;  3S6F A;  4Z65 A;  2ZBU A;  2EUI A;  2G3A A;  3WNC A;  5J8F A;  3PP9 A;  4AF7 A;  3QE2 A;  1F20 A;  3KKW A;  5A8A A;  1Z8W A;  3D66 A;  3RO0 A;  1VQP B;  2H5M A;  3AVT A;  4H89 A;  4B5P B;  4X06 A;  4NGR A;  1E1Q A;  5GV7 A;  3CCV B;  1YLE A;  1PJ7 A;  1EFC A;  3TO7 A;  4CYN A;  3OW2 B;  4OKO A;  4FWU A;  3WXM A;  1AMP A;  4ZGQ B;  3B3C A;  3PB8 X;  3ZZU A;  1I8D A;  3WT4 A;  4BPR A;  3SLD A;  3FB3 A;  1XB2 A;  1SQH A;  2DPT A;  2FIA A;  1M1D A;  1BPL A;  3G71 B;  3KEW A;  2XEF A;  4BBH A;  4B5P A;  4MFQ A;  5E6T A;  4RD0 A;  2ZZG A;  4N3G A;  1TTT A;  4C7I A;  2I1L A;  4P6Y A;  1V5V A;  2D3L A;  4M3S A;  1H85 A;  4P9S A;  1Q2C A;  2X0K A;  3RNZ A;  4TMW A;  3KR5 A;  5LMZ A;  2HC9 A;  4UCN A;  1OB5 A;  2D3N A;  2ZW5 A;  2HDN B;  5ELY A;  4B44 A;  5A28 A;  2DYI A;  3W2E A;  1ARM A;  4X07 A;  2PJ2 A;  4OC2 A;  3FIX A;  4XN3 A;  1S3Z A;  3CXC B;  4CRY B;  2GIV A;  2GE3 A;  2PJ1 A;  5EC4 A;  1LRZ A;  7CPA A;  1WU8 A;  2R1I A;  3ISZ A;  3IJ3 A;  3W2G A;  2GPJ A;  3HUV A;  3BQJ A;  1IIC A;  2ZPA A;  1WOP A;  4CRZ B;  4WQM A;  1YSJ A;  2QEC A;  4UEE A;  3FH4 A;  4X8I A;  2OK7 A;  2G3T A;  4GXH A;  4G1P A;  4E2A A;  1Q81 D;  2PJ8 A;  3I3G A;  4P6V F;  3ASQ A;  3CDX A;  3SJG A;  1CP7 A;  1YME A;  2GJR A;  2GQF A;  3ASP A;  2CIJ A;  2X6X A;  4QUZ A;  4MFP A;  1Z5R A;  2P6F A;  4TNU A;  5I4M A;  1R5N A;  3W5H A;  1TXR A;  5IB9 A;  3BHX A;  4RDL A;  2VYQ A;  3WR7 A;  3K9T A;  4XKV A;  2PJC A;  2BOA A;  3T56 B;  1AUG A;  3ONY A;  2XEI A;  4K1X A;  4HKF A;  1QSM A;  1QQ9 A;  2D9R A;  2XEX A;  1P4N A;  4X7C A;  4MY3 A;  2YWH A;  2ZEE A;  1ARL A;  1HVX A;  3W5U A;  1S5K A;  5A27 A;  2HCJ B;  2BO9 A;  1BX0 A;  3B8G A;  4UWI A;  5TRD A;  2CY2 A;  2JJ2 A;  3OJX A;  4XR6 A;  4KSF A;  4ZCL A;  4MMO A;  2DF5 A;  2R8V A;  2ZL7 A;  4H6U A;  4PAB A;  4QVA A;  3VAR A;  3Q39 A;  4Q36 A;  2C6G A;  4C68 A;  1TUI A;  4MFZ A;  2GLF A;  4X7E A;  5JQ4 A;  1BPM A;  4H9G A;  4KKT A;  3W6S A;  1GHE A;  1EP1 B;  5CNP A;  3DSB A;  2ARH A;  3N5F A;  3R6J A;  2QN6 A;  1BLL E;  3W91 A;  1TLL A;  1NSA A;  5JH9 A;  4Z4W A;  2C6C A;  1N08 A;  5HVG A;  4P25 A;  2P6G A;  2WUU A;  2ZW6 A;  3A1P A;  4R3K A;  2X6W A;  3MCA A;  2WZN A;  5A88 A;  2Z3L A;  5FL7 A;  3CC2 B;  3PA1 A;  3P27 A;  2EBJ A;  2ZL6 A;  1VQ5 B;  4B47 A;  4Z4T A;  2Q43 A;  2C78 A;  2IL4 A;  2X3U A;  3ZBT A;  3NH4 A;  4E0F A;  5HMN A;  1K8A D;  1Z8X A;  3QFC A;  3I1F A;  4ZYQ A;  2F7V A;  1OGI A;  4CAX A;  2V7U A;  1KC8 D;  3WC5 A;  2VBU A;  1OB2 A;  4P4E A;  2QGG A;  4ZCI A;  3CCQ B;  3W6X A;  1V0E A;  3V38 A;  4TMV A;  1FRQ A;  1X12 A;  4MJ8 A;  1PU9 A;  3D7D A;  3FPP A;  4B13 A;  4HNW B;  3CZX A;  3D26 A;  3NE5 B;  3H8G A;  3MRU A;  2VBQ A;  3CT9 A;  1T6Y A;  3NE7 A;  2YWE A;  1GYT A;  4X7F A;  5EMI A;  4JJX A;  1HA3 A;  3WYA A;  4UA3 A;  2V8H A;  5H59 A;  2PJ4 A;  1ELM P;  1FX0 A;  2BGI A;  3FED A;  4NSQ A;  2HV2 A;  4XN0 A;  1V0F A;  3A3G A;  1D2E A;  5HVH A;  4G6I A;  1OBR A;  3ZIA A;  4KVM E;  3T51 B;  4DUK A;  3AVV A;  5HXD A;  4FBE A;  1PJ6 A;  4LQG A;  2PQ8 A;  1YX0 A;  4CGN A;  1CJW A;  1XEB A;  2B7B A;  3OP1 A;  1W87 A;  5HKK A;  3IEH A;  3FEC A;  5JGF A;  1VHO A;  1VLO A;  4UWJ A;  1IU8 A;  3W2F A;  2ZW4 A;  2PIA A;  1LAN A;  1Z8T A;  1G7T A;  3KHX A;  1KUX A;  3TCV A;  3PUM A;  2BCO A;  4KOU A;  4TKO B;  3IWW A;  2Z10 A;  5LYD A;  1PCA A;  2ANP A;  4IHM A;  2DCU A;  3B3V A;  2BPO A;  3GSI A;  4AVZ A;  1WSR A;  1FDR A;  4Y7C A;  1IGB A;  3PUN A;  1S60 A;  1NSL A;  4YAO A;  1TF8 A;  1CX8 A;  2AFX A;  3V8I A;  4YHB A;  1Z4R A;  5LRK A;  4JZ0 A;  4KVO E;  2EK9 A;  4Y9R A;  1BOB A;  4G1B A;  1KK1 A;  1OHH A;  5J3O A;  3CPX A;  2C27 A;  2XEG A;  1QUE A;  2C77 A;  2G9D A;  3SJZ A;  2CRV A;  1OB0 A;  1OGJ A;  4FK8 A;  4KS9 A;  2NYQ A;  5AG7 A;  1J9Z A;  5AGE A;  4OC1 A;  4MYU A;  4DK1 A;  3T53 B;  4P10 A;  1FRN A;  2CNT A;  1NB0 A;  4WJB A;  1V0C A;  4DJL A;  3B78 A;  3CW2 A;  3FBU A;  4KVX A;  3PFO A;  4FD4 A;  1AIP A;  1KRH A;  3D7G A;  2VNI A;  4J3G A;  8CPA A;  3FPK A;  4MFJ A;  1KJZ A;  1A8P A;  4Q7A A;  3CXQ A;  1K73 D;  5IYW A;  5KTA A;  1SKQ A;  1WP6 A;  2Q4Y A;  1CG2 A;  4RLZ A;  3VO1 A;  1XJO A;  3WY9 A;  4OP4 A;  3A8K A;  3H9N A;  3VO2 A;  4OLL A;  2V7W A;  1PYT B;  1G7S A;  4RD4 A;  1S7L A;  3PEI A;  2V7X A;  3D2M A;  3U2Q A;  2DEU A;  4LX9 A;  1VIX A;  1CM0 A;  1Q82 D;  5KSW B;  3G8W A;  2ZW7 A;  1UMK A;  1YLO A;  3EO4 A;  3OW7 A;  2FSR A;  5G1Z A;  1QX4 A;  1NRK A;  2ZEL A;  4M6H A;  2V7T A;  5AN9 A;  1TVC A;  1B23 P;  3CMA B;  2ZEH A;  1W0K A;  2J7K A;  1WOS A;  4CYP A;  2BV3 A;  4OAE A;  3R6K A;  5LRG A;  2D4O A;  4ZY2 A;  4Y9U A;  2PCU A;  1UD6 A;  2ABZ A;  2GAN A;  1E79 A;  1GR1 A;  4MBU A;  3IIB A;  4TSF A;  4F0Y A;  5LYF A;  3AGP A;  1KWM A;  1XQB A;  2YWF A;  4ZV4 A;  2PLF A;  4QBJ A;  1T6X A;  2Q6I A;  5ISV A;  5TR9 A;  3GIU A;  4A39 A;  4NCN A;  1E64 A;  4XON A;  1VQ8 B;  4P4J A;  4FWT A;  4UEF A;  4UIB A;  1DAR A;  1KD1 D;  2EIX A;  3FX6 A;  4HE5 A;  2PIZ A;  2PE3 A;  1H8L A;  4R87 A;  3TFY A;  4TT3 A;  4ONW A;  3EC4 A;  1UD5 A;  3CCE B;  4B10 A;  1BQE A;  1RQR A;  4ORF A;  4H2K A;  1BX1 A;  2VJJ A;  1Q2D A;  1J4J A;  5IX3 A;  2CK3 A;  2IMO A;  3KAS A;  5F48 A;  1IB1 E;  4B3G A;  4XQF A;  1YJW B;  2DET A;  3AVU A;  2P6E A;  1XE1 A;  2QA4 B;  2YNE A;  3H8F A;  5JPH A;  4MCP A;  4LBV A;  3DR8 A;  1KMH A;  3OOC A;  1VKC A;  2OZH A;  3B3T A;  2Y0M A;  4NGQ A;  4CS0 B;  4YWY A;  2DIE A;  4XPD C;  2W6J A;  3MMP A;  3JQQ A;  4PXE A;  2OTL B;  4HE6 A;  5L46 A;  1BO4 A;  2I3C A;  4XNH C;  2R7H A;  2V7V A;  3DDY A;  2REE A;  4NGP A;  4A38 A;  5CDF A;  3LO8 A;  2EK8 A;  4QVJ A;  1M4G A;  3SJX A;  4YAU A;  4PC3 A;  4C7H A;  4JWP A;  1VQK B;  4AVB A;  5TY0 A;  5K8P A;  3BI1 A;  3WBJ A;  3U6K A;  1UFH A;  1P0H A;  1JJ2 B;  3KHZ A;  2B5G B;  3JRU A;  1IYK A;  3QFR A;  2FXF A;  1COW A;  3TO6 A;  1GAQ A;  1LOK A;  1YHQ B;  2ZEF A;  5GCN A;  1Y9W A;  3JTK A;  1Q86 D;  2P3M A;  4R71 A;  4JMQ A;  3QNV A;  3WBK A;  3B35 A;  1WOR A;  1E1R A;  4W9Y A;  3I56 B;  2B5G A;  1ZM4 A;  4WZT A;  5FA6 A;  1YIJ B;  3OEE A;  3FEE A;  2ATR A;  2GJK A;  3PZJ A;  1JWQ A;  3TOA A;  4XOT A;  5H84 A;  1VHS A;  5J1Q A;  2EVN A;  2VNH A;  4PK2 A;  4KOT A;  5AG5 A;  1OZP A;  3FRM A;  4Z4R A;  1QFJ A;  4UBR A;  3B2Y A;  2QE7 A;  2P0W A;  5IYN A;  3S6H A;  1ZO0 A;  2B58 A;  1N0U A;  4GQN A;  3PB9 X;  3G4S B;  1M4I A;  1ZG8 A;  2GLJ A;  3Q6R A;  4WZL A;  2YGW A;  3OAA A;  1NB9 A;  4PXD A;  2ZXV A;  4G1V A;  4MCR A;  2FX3 A;  4FAI A;  3I1U A;  1UWY A;  2BL1 A;  2Z3N A;  4KLW A;  4II3 A;  2PJB A;  1M4D A;  1U6M A;  1DG1 G;  4DNR B;  4KOS A;  1UD3 A;  2AFS A;  1DDG A;  2JEV A;  3PBE A;  3S6K A;  1GAW A;  4NGM A;  1IJF A;  4FD5 A;  5EMN A;  2Q7S A;  2B5O A;  4A31 A;  4KOV A;  1F60 A;  5BSX A;  4NGT A;  1PJ5 A;  3CCU B;  1BJK A;  4II2 A;  4P3Y A;  4CQJ A;  1HDU A;  1SM4 A;  3F8K A;  4RJL A;  4HNY B;  4MY0 A;  1ZM3 A;  3V7A A;  1QVF B;  5E96 A;  4YAL A;  5F4M A;  1FNO A;  3MHP A;  1QVG B;  4UZF A;  1UD4 A;  1Y0Y A;  4JYW A;  3SJP A;  3ZPN A;  2WSS A;  2ZEO A;  1B2R A;  4R3L A;  4M0L A;  2BSW A;  3PRT A;  2VNK A;  3DR6 A;  3F5B A;  3BJ8 A;  1Y7E A;  2DPS A;  3R9G A;  4F9V A;  1VHE A;  4MFK A;  4AXV A;  2PC1 A;  3FNC A;  3OWC A;  1H8E A;  4M1K A;  2R98 A;  4M6G A;  5BWA B;  2GK6 A;  1NE9 A;  3GLJ A;  1XMT A;  4NFR A;  4RI1 A;  1Z2L A;  2Q7B A;  2W6I A;  2NV4 A;  2B7C A;  1B6B A;  4IF5 A;  1N06 A;  2VXK A;  3CB4 A;  2C4T A;  4Z4U A;  2VL1 A;  3CTA A;  3JVN A;  1XOV A;  3I9S A;  1E43 A;  1N05 A;  4Y49 C;  4P45 A;  3CCM B;  2JDC A;  4TWE A;  4K3N A;  4R7M A;  1M90 D;  3W5V A;  1IOI A;  1XRY A;  4R57 A;  4JXR A;  3OZV A;  5KW9 A;  2BM1 A;  3QFT A;  2WSA A;  2Q04 A;  3IO1 A;  3BY2 A;  4OID A;  1R43 A;  4CYO A;  2M5S A;  1EFU A;  2JEW A;  3ZJ0 A;  4ZGY B;  4LC0 A;  3CME B;  1VQL B;  1WDT A;  3S6G A;  1S4M A;  1GVH A;  4OPO A;  3R9E A;  1EP2 B;  1I18 A;  2A4N A;  3SI1 A;  3B82 A;  1MK4 A;  3LNN A;  3IFE A;  2GU2 A;  4NEX A;  2J9A A;  4G5G A;  4C43 A;  2V7Q A;  3B3S A;  3NFZ A;  1YK3 A;  4PSW A;  3PA2 A;  2CNM A;  2HUZ A;  4LBZ A;  4XOR A;  4F7D A;  2Z3P A;  4A2Z A;  5CBM A;  2F1M A;  4XLC A;  4ONU A;  3RZA A;  4E0A A;  4UFX A;  2O53 A;  3KI9 A;  4AG9 A;  2PJ6 A;  2ZZE A;  4Z4V A;  4A95 A;  4C0S A;  4XLE A;  2BF4 A;  4P1V A;  4LBY A;  4A33 A;  2ZOG A;  4UIA A;  3CC4 B;  2PMD A;  4PC1 A;  3R9F A;  2Q6L A;  2CW5 A;  1JNY A;  2BSA A;  4B12 A;  5CPA A;  4L8J A;  3GVJ A;  4DQK A;  2F43 A;  1ON0 A;  1QGZ A;  2AFM A;  4YU9 A;  2ZED A;  4EWT A;  4PC7 A;  5FO0 A;  3QAY A;  5IYP A;  1X10 A;  1QSN A;  5KTC A;  2LZJ A;  5FIU A;  2CBX A;  4L8A A;  2ZEP A;  2Z3K A;  4HNX B;  4OOX A;  3FKS A;  5DWN A;  2GFQ A;  4DK0 A;  3CC7 B;  4XOP A;  3LMS A;  4AB7 A;  4ROX A;  2BGJ A;  2FVG A;  2K5T A;  2FL4 A;  4XKW A;  2WR8 A;  1L0C A;  1Z9U A;  1IOF A;  4DQL A;  1VQ4 B;  4X7D A;  4FD7 A;  2REF A;  1T5E A;  4DNT B;  4J0Q A;  4FD6 A;  4MHN A;  3NH8 A;  3EFA A;  2ZZQ A;  1UD8 A; 
#chains in the Genus database with same CATH homology
 2CTC A;  4P6Y A;  1XFO A;  4EFD A;  3IIB A;  3TX8 A;  5LYF A;  1KWM A;  3KGQ A;  2QJ8 A;  3KR5 A;  2HC9 A;  5K8N A;  1ZG7 A;  4A39 A;  4P4J A;  5ELY A;  4UEF A;  4UIB A;  3S9N A;  1ARM A;  1TKH A;  2PJ5 A;  1CP6 A;  2PJ2 A;  3FX6 A;  1F2P A;  2PIZ A;  2PE3 A;  1H8L A;  1XMB A;  4OC2 A;  3WC7 A;  5LRJ A;  4ONW A;  4R76 A;  3KZW A;  2PJ1 A;  2OR4 A;  4H2K A;  4UF4 A;  7CPA A;  2IMO A;  3KAS A;  3ISZ A;  1TKJ A;  3IJ3 A;  4GM5 A;  1EE3 P;  3HUV A;  1YSJ A;  4R8F A;  4UEE A;  5F09 A;  1XBU A;  3T8W A;  1CPX A;  4NJQ A;  3FH4 A;  4X8I A;  3H8F A;  4G1P A;  4MCP A;  3BI0 A;  2PJ8 A;  1LFW A;  2C1C A;  3CDX A;  3B3T A;  3SJG A;  4NGQ A;  1CP7 A;  1YME A;  1DE4 C;  4YWY A;  1Z8L A;  3SI2 A;  4UEZ A;  2CIJ A;  2IJZ A;  3MN8 A;  2ZEG A;  4PXE A;  2DEA A;  1Z5R A;  2Q4Z A;  5K8O A;  4TNU A;  5I4M A;  1TXR A;  5IB9 A;  2I3C A;  4EME A;  5LYI A;  3BHX A;  1JQG A;  4A38 A;  4NGP A;  3K9T A;  2PJC A;  2EK8 A;  2BOA A;  2XEI A;  3D7H A;  4DYO A;  2PJ9 A;  2CTB A;  3SJX A;  3SI0 A;  1QQ9 A;  4MXU A;  4PQA A;  4A94 A;  1YW4 A;  4IK2 A;  2POK A;  3S9M A;  5K8P A;  3BI1 A;  1CPS A;  2ZEE A;  1ARL A;  3KQZ A;  3KHZ A;  2BO9 A;  3JRU A;  1Y0R A;  2IQ6 A;  2QYV A;  4MMO A;  2V8V A;  3TC8 A;  3CPA A;  1LOK A;  2ZEF A;  3GUX A;  2PVV A;  4NGN A;  3B7I A;  4NJR A;  2CF4 A;  3VAR A;  4P4I A;  3QNV A;  3WC6 A;  2C6G A;  3B35 A;  2GLF A;  4W9Y A;  1BPM A;  3FVL A;  1ZG9 A;  3FJU A;  3VAT A;  3FEE A;  1TF9 A;  3N5F A;  5D8N A;  4IAV A;  1BLL E;  4MHY A;  5J1Q A;  1NSA A;  2AFU A;  2V77 A;  5JH9 A;  5HVF A;  2XEJ A;  2C6C A;  1ZLI A;  5HVG A;  3D68 A;  4OC5 A;  4B6Z A;  3B2Y A;  4X2T A;  2WZN A;  4A37 A;  2WYR A;  1F2O A;  1LAP A;  4ZY1 A;  3PB9 X;  3SJE A;  1ZG8 A;  2Q43 A;  2GLJ A;  2NSM A;  3K2K A;  4P44 A;  4WWV A;  3NH4 A;  4OC0 A;  4FUU A;  4PXD A;  4ZYQ A;  3BXM A;  2F7V A;  3B3W A;  3WC5 A;  4ZY0 A;  4MCR A;  2RFH A;  4P4E A;  3I1U A;  4FAI A;  4OIW A;  4O23 A;  2HB6 A;  1UWY A;  3GB0 A;  3V38 A;  2PJB A;  3VH9 A;  1LCP A;  2V8G A;  2AFS A;  3PBE A;  3D7D A;  2PIY A;  3RAM A;  1IY7 A;  4NGM A;  3NA6 A;  4MHZ A;  1R3N A;  3H8G A;  3MRU A;  3D67 A;  3CT9 A;  1RTQ A;  5D29 A;  4P4F A;  2QVP A;  4F8Z A;  1GYT A;  4NGT A;  2PVW A;  2V8H A;  4PXB A;  2PJ4 A;  1ELM P;  1HDU A;  3FED A;  4PXC A;  5HVH A;  1FNO A;  1Y0Y A;  4JYW A;  3V7Z A;  1OBR A;  2ZEO A;  2ZEN A;  2EWB A;  4DUK A;  3PRT A;  3WAB A;  1Y7E A;  5HXD A;  4ZX9 A;  4FBE A;  4LQG A;  3KQX A;  1YW6 A;  1HDQ A;  2C6P A;  4MHP A;  1ZLH A;  4F9V A;  2PJ7 A;  1VHE A;  3RBU A;  3IEH A;  3FEC A;  4AXV A;  5JGF A;  1VHO A;  4OC4 A;  3ISX A;  4R6T A;  1LAN A;  2AFZ A;  4RUH A;  3GLJ A;  4NFR A;  2F8H A;  4P4D A;  3KHX A;  3L2N A;  1Z2L A;  2BCO A;  3IWW A;  5LYD A;  1PCA A;  4MCQ A;  1HEE A;  3PB6 X;  2ANP A;  4IHM A;  5LYL A;  1VGY A;  3B3V A;  4CPA A;  2RB7 A;  1IGB A;  3LWU A;  2VL1 A;  1AYE A;  3KR4 A;  2JBJ A;  5DS0 A;  4MRI A;  1TF8 A;  1CX8 A;  2AFX A;  4P45 A;  4TWE A;  2AFO A;  3D4U A;  4K3N A;  4R7M A;  1XRY A;  5THW A;  1Q7L A;  2PJ0 A;  4F9U A;  5LRK A;  2ZOF A;  4JZ0 A;  2EK9 A;  3IO1 A;  1LAM A;  3PFE A;  1R43 A;  4OID A;  3CPX A;  2XEG A;  4ZX8 A;  2JEW A;  2O4H A;  3D7F A;  4PPZ A;  2G9D A;  2AFW A;  3KL9 A;  2OOT A;  1ELL P;  3PB4 X;  2V8D A;  3IC1 A;  1BPN A;  2NYQ A;  3SI1 A;  4OC1 A;  3IFE A;  2GU2 A;  2J9A A;  3HLP A;  3B3S A;  3NFZ A;  4P10 A;  1M4L A;  4WJB A;  4ZI6 A;  4BD9 A;  3FF3 A;  3NH5 A;  2JBK A;  4P4B A;  4DJL A;  1DTD A;  2PRQ A;  3SJF A;  1CBX A;  3DGV A;  3PBB A;  3PFO A;  5CBM A;  4OME A;  3D7G A;  3RZA A;  3FMC A;  3S9L A;  1QMU A;  8CPA A;  2O53 A;  3KI9 A;  4Q7A A;  1TKF A;  2PJ6 A;  2PJA A;  1CG2 A;  3DLJ A;  4KSI A;  4OP4 A;  1XJO A;  2ZOG A;  1BAV A;  4UIA A;  1F57 A;  1PYT B;  4MCS A;  5CPA A;  4Z65 A;  1FT7 A;  3H8E A;  3PEI A;  2AFM A;  2GRE A;  4YU9 A;  2Q51 A;  3D66 A;  2ZED A;  4EWT A;  4NGS A;  1VIX A;  1YLO A;  4NGR A;  2ZEP A;  4OC3 A;  2ZEL A;  4X3R A;  3LMS A;  4OKO A;  4FWU A;  1AMP A;  2FVG A;  3B3C A;  3PB8 X;  3WT4 A;  2ZEH A;  6CPA A;  2XEF A;  5LRG A;  5K8M A;  2PJ3 A;  5JM6 A;  4MHN A;  4ZY2 A;  2PCU A;  3NH8 A;  2ZEM A;  2ABZ A;  3PB7 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...