3KL9A

Crystal structure of pepa from streptococcus pneumoniae
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
355
structure length
340
Chain Sequence
SMTTLFSKIKEVTELAAVSGHEAPVRAYLREKLTPHVDEVVTDGLGGIFGIKHSEAVDAPRVLVASHMDEVGFMVSEIKPDGTFRVVEIGGWNPMVVSSQRFKLLTRDGHEIPVISGPAIADIVFDGGFADKAEAESFGIRPGDTIVPDSSAILTANEKNIISKAWDNRYGVLMVSELAEALSGQKLGNELYLGSNVQEEVGLRGAHTSTTKFDPEVFLAVDCSPAGDVYGGQGKIGDGTLIRFYDPGHLLLPGMKDFLLTTAEEAGIKYQYYCGKGGTDAGAAHLKNGGVPSTTIGVCARYIHSHQTLYAMDDFLEAQAFLQALVKKLDRSTVDLIKHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the substrate specificity of PepA from Streptococcus pneumoniae, a dodecameric tetrahedral protease
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords Glutamyl aminopeptidase
total genus 107
structure length 340
sequence length 355
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.7: Glutamyl aminopeptidase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3kl9A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kl9A01
2AFZA 3WC7A 3B35A 3HUVA 1XRYA 2JBKA 4PQAA 3D68A 4B6ZA 3NA6A 1HDQA 3SI2A 2GLFA 5CPAA 4DYOA 3I1UA 1VGYA 4OP4A 4A94A 4MCPA 4R76A 1Z5RA 3PB6X 4TNUA 1CP7A 3SI1A 1RTQA 1CX8A 4NJRA 1HDUA 3JRUA 4R8FA 4F8ZA 3D7GA 3NH4A 4GM5A 5LRKA 3TC8A 4OKOA 2HB6A 1TKFA 3D7DA 2C6CA 4UEZA 2PJ0A 4NJQA 2O53A 2PJ8A 4PXDA 1IGBA 4F9UA 4NFRA 4WWVA 2PE3A 2XEJA 3H8FA 4DJLA 3FF3A 3DGVA 1CPXA 1ZLIA 2PJ3A 2PJ1A 4A39A 1DTDA 3V7ZA 3KASA 4X2TA 5I4MA 2F8HA 2VL1A 1BPMA 3FH4A 2POKA 3IIBA 3SI0A 3FX6A 1Y7EA 2ZELA 2RB7A 4NGPA 3RBUA 4OIWA 3WABA 3S9NA 3B7IA 3CPXA 2NSMA 1LANA 3LMSA 3NFZA 3CT9A 4UEEA 4EWTA 3L2NA 4OC2A 3RAMA 4P4IA 1Q7LA 5K8NA 3BI0A 2XEFA 4A38A 4P44A 3ISZA 5D29A 4FUUA 3K2KA 1PYTB 1TXRA 3PB7X 1KWMA 1ZG8A 2JBJA 1YSJA 1Y0YA 2CTCA 3BI1A 3KHZA 4PPZA 4H2KA 2F7VA 4MCRA 3VATA 1TKHA 3GB0A 3D66A 2PIYA 4JYWA 1LOKA 3IWWA 2C1CA 2IMOA 3D67A 4R7MA 2GREA 4UEFA 3GLJA 1YW4A 1F2OA 1QQ9A 2XEGA 2AFXA 2AFOA 5HVHA 4NGSA 2AFWA 4NGRA 2EWBA 2V8HA 3PB9X 4KSIA 2RFHA 4P4BA 2BCOA 3SJGA 4MHPA 3B3VA 4K3NA 2IJZA 3IJ3A 1FNOA 1HEEA 4A37A 3KR5A 4FWUA 4UIBA 4P4EA 5LYLA 1XMBA 4NGTA 1LCPA 4ZY1A 3H8EA 2G9DA 4PXBA 4UF4A 2IQ6A 4CPAA 3H8GA 5K8MA 4AXVA 4FAIA 1XFOA 2DEAA 1CG2A 5F09A 2ZEDA 3FEEA 1Y0RA 1XJOA 3PB8X 2ZEPA 2ANPA 1FT7A 2WZNA 3CDXA 3KI9A 2PJAA 1M4LA 3KR4A 2J9AA 4EFDA 3HLPA 3KL9A 2PJ4A 4PXEA 5LYDA 1R43A 4W9YA 1OBRA 5K8OA 2OR4A 1PCAA 4OC4A 4EMEA 5JGFA 1DE4C 4ZX8A 4P4DA 3T8WA 1VHEA 1AYEA 4P4FA 2QYVA 1Z8LA 1BPNA 5DS0A 4LQGA 2V8GA 1EE3P 3KGQA 4FBEA 2QJ8A 1TF9A 1GYTA 2XEIA 1ZG9A 4IHMA 1AMPA 3PFEA 2ZEMA 2PJ7A 2OOTA 3IFEA 5HXDA 4ZY0A 1ARLA 4OC0A 4TWEA 1ARMA 4MCSA 1LAMA 3V38A 3WC6A 2Q51A 1YLOA 5HVFA 5THWA 1YMEA 1JQGA 4UIAA 1F57A 2JEWA 2ZEGA 4ZX9A 1ELMP 3FEDA 2PCUA 2ZEOA 4MHYA 2QVPA 2BOAA 3B3SA 3IEHA 3LWUA 4R6TA 3D4UA 5K8PA 2GLJA 3MN8A 3SJXA 2AFSA 2ZOFA 3BXMA 4DUKA 3FJUA 3IC1A 4NGNA 4ONWA 1TKJA 2V77A 3PBBA 5LRJA 2EK8A 4NGQA 2PVVA 2AFMA 3PEIA 8CPAA 2ZEEA 2V8DA 1NSAA 1VHOA 5LYIA 3SJEA 2C6PA 3RZAA 4F9VA 2O4HA 3PBEA 2ZEHA 2EK9A 2PVWA 4X8IA 4JZ0A 2ZEFA 5IB9A 1TF8A 2ZOGA 4YU9A 3N5FA 2Q4ZA 3QNVA 3FMCA 1BLLE 4OIDA 1H8LA 1LAPA 5LRGA 3CPAA 2V8VA 2ZENA 2Q43A 4OC5A 3GUXA 3VH9A 3D7HA 4BD9A 5LYFA 3B2YA 4YWYA 7CPAA 5D8NA 1ZG7A 4PXCA 1Z2LA 2PJ2A 4OC3A 3IO1A 2WYRA 4IAVA 2C6GA 3D7FA 4OMEA 4IK2A 2NYQA 1CP6A 5JH9A 2PJBA 1F2PA 1IY7A 2PJ5A 3FVLA 3MRUA 4Q7AA 1LFWA 1VIXA 4P10A 3KQXA 3S9MA 1CBXA 4P6YA 3SJFA 1CPSA 5JM6A 4MHZA 4Z65A 4OC1A 3PFOA 3BHXA 4MHNA 3S9LA 4MCQA 2PJ9A 4MMOA 3PRTA 2I3CA 4P45A 4ZYQA 1YW6A 3NH5A 1UWYA 3WT4A 3B3TA 1BAVA 2PJ6A 4X3RA 2ABZA 2FVGA 2AFUA 4ZY2A 2PRQA 3ISXA 5CBMA 3NH8A 3WC5A 1QMUA 1ELLP 3TX8A 1R3NA 2PIZA 5ELYA 4MRIA 3B3CA 3VARA 4MXUA 4NGMA 6CPAA 3B3WA 4O23A 1ZLHA 4G1PA 4RUHA 4WJBA 2CTBA 3K9TA 3PB4X 3KHXA 4P4JA 1XBUA 4ZI6A 5J1QA 3DLJA 3KQZA 2HC9A 2CF4A 2PJCA 2BO9A 3KZWA 2GU2A 3FECA 5HVGA 2CIJA
chains in the Genus database with same CATH superfamily
2XZLA 1JWQA 3B35A 4KUBA 5JPHA 3D68A 3R6KA 4NF1A 4E0AA 1QGYA 3SI2A 4B47A 4DYOA 2B7CA 4X05A 1BOBA 4MCPA 2J8NA 2R9VA 1QSRA 2B3UA 1Z5RA 2OBTA 2JJ2A 5IK2A 2CNTA 3PB6X 2CNMA 3FPPA 1CP7A 3I56B 5LRKA 3TC8A 4AVAA 1QFYA 1LRZA 2YWGA 4G5GA 2X7BA 4ZV4A 1RO5A 1Y7RA 4KZTA 4UEZA 4FXUA 3TOBA 2PJ0A 2G0BA 2PJ8A 1JA1A 1IGBA 4A30A 2PMDA 4WWVA 3GSIA 2D4PA 2QE7A 3R96A 3SEJA 1A8PA 3ONUA 2ZW4A 3DGVA 1VQ6B 4DK1A 3OZWA 2QGGA 2VBUA 3SLDA 2QN6A 1S3ZA 2F8HA 4X0CA 4X7CA 4MFJA 4WQMA 4AB7A 1OGIA 3DR8A 2JDDA 1Y7EA 5E6TA 4C43A 4C7IA 5IYRA 1Y9WA 1KUXA 1N08A 2NSMA 4KUAA 3GKRA 2FE7A 3T51B 5G21A 4E0FA 2RC5A 1PUAA 4Z4ZA 5K8NA 5GCNA 1NJID 1QG0A 2GK6A 3NE7A 2Z10A 3OWCA 3VO1A 4L89A 4XORA 4P2NA 3ISZA 5D29A 4B3GA 4KSAA 4PSXA 3CMEB 1TXRA 3TO6A 1ZG8A 4XOPA 4U5YA 3DR6A 1NB0A 3N7ZA 3PVDA 1D2EA 2BEIA 4J3GA 2D74A 3BCFA 4MCRA 1GAWA 1TKHA 3OJWA 2VYQA 5FL7A 3IWWA 4KOVA 4KOXA 2R98A 1WOSA 2IMOA 1KUVA 4Y7CA 3GLJA 1WPCA 2Q6OA 1YW4A 4QUZA 1MABA 2GK7A 3QFCA 4NGSA 2AFWA 2EWBA 1IOFA 2RFHA 4P4BA 2BCOA 1CQXA 2DYIA 4ACBA 4RDJA 3B3VA 3VWDA 3IJ3A 2PSWA 3WY9A 4FWUA 4YALA 1YVOA 3H8EA 1OB0A 1Q2YA 1GR1A 4JMQA 1R5OA 3S6GA 2DEAA 2YWEA 2V31A 2DERA 4PSWA 5F09A 3B82A 3FEEA 1Y0RA 2HLDA 1XJOA 1SKYB 2OBSA 2ZEPA 4LBVA 1FT7A 1NSLA 3CDXA 2C5HA 4X06A 1F20A 4CGMA 2Z6BD 2YGWA 4B5OA 2ZW7A 4YELA 3WBKA 4Z4RA 2ZXHA 2Z3PA 1OBRA 4JXQA 1IYLA 4OOXA 1PCAA 2YNDA 5DWMA 2Q04A 4AVCA 1FNBA 4XLHA 1WOPA 4M85A 5JGFA 3WQZA 1DE4C 4MY3A 1XB2A 4NEXA 1VHSA 4P4FA 2V7WA 4HE6A 3WNBA 2G3AA 2QYVA 1SKQA 2WPDA 4PC2A 1BPNA 4RD3A 1AIPA 5DS0A 4BMHA 3T56B 1EE3P 3KGQA 2OU2A 4Y9RA 4KOSA 3W2IA 4FBEA 2Q7SA 1GYTA 2B7BA 2V4DA 3IFEA 2QMUA 2WSSA 1FY7A 4OC0A 2XZPA 1ZM4A 3Q39A 1IJFA 4LBWA 1H42A 5EMIA 1E63A 1UD3A 3VR6A 1YMEA 3BQJA 2JEWA 2ZEGA 2QTZA 3FEDA 4MFQA 2ZEOA 1M4IA 2DXQA 2BOAA 4M0LA 5TRDA 1M4GA 2GLJA 4GXHA 3ZZIA 3MN8A 2P3MA 3F0AA 5HH1A 4XLAA 1S72B 2ZOFA 5F4MA 3IC1A 2XGJA 2V77A 3PBBA 5J8CA 1VQ5B 1FNMA 2EK8A 4JWPA 1X12A 3BJ7A 2AFMA 4G1BA 8CPAA 4KVME 1NRKA 2C78A 4RLZA 1YHQB 1DDGA 2ZZGA 1NB9A 3BC9A 4E8OA 1TF8A 2ZOGA 4GS4A 4OOVA 4AVZA 4R87A 3QNVA 2BSAA 4MYUA 5E96A 1YVKA 1LAPA 2C2WA 3CPAA 2V8VA 4CGLA 2REFA 3GUXA 1TVCA 3B2YA 3EY5A 4XR6A 2BV3A 2FXFA 1JJ2B 3PUNA 4Z4UA 3AVVA 4IAVA 2C6GA 3OAAA 5JH9A 5HZBA 2PJBA 1F2PA 3C26A 2Z3LA 2P0WA 3G3SA 4MY0A 2PJ5A 4CGOA 3KEWA 3MRUA 1DG1G 1WTHD 3CTAA 4QVAA 1LFWA 1VIXA 4C0SA 3JTKA 3HAGA 4HNWB 3SJFA 4MHZA 1Z9UA 2OZUA 1VKCA 1DDIA 4XKWA 3PFOA 4MHNA 3NE8A 2VBVA 4RN7A 4II2A 4RCZA 2WUUA 1YJWB 3DNSA 2Q0YA 1KTVA 2HCJB 4X07A 1NDHA 1N0UA 2PJ6A 1IYKA 4CAXA 3QFTA 2FVGA 1Q82D 4CYNA 2ZL6A 4HIZA 4Z4WA 2GE3A 4QC6A 4TMVA 3ISXA 5CBMA 2KVOA 2F4NA 3U6KA 2VEZA 1QMUA 4IF5A 4UFWA 2ZZEA 3CPWB 4FD7A 4G7XA 2DOGA 1ZLHA 1MRZA 4RUHA 4WJBA 2A4NA 1DARA 4FK8A 1YJNB 5H84A 1XBUA 1N05A 3TTHA 1TUIA 4M6HA 3PUMA 2I79A 1VLOA 4R57A 1ZM2A 4UWJA 1XRYA 5BSXA 2JBKA 4PQAA 3AVTA 4M1KA 2F5IA 2YWFA 1QGZA 1VF7A 1E79A 1FNDA 1ZM9A 3IWGA 1KJZA 3V76A 3W2EA 1ZO0A 5A28A 1M1KD 3Q3AA 4XONA 5H59A 4TNUA 4PC1A 1YR0A 1RTQA 3SLNA 1CX8A 2JDCA 3JRUA 2PRBA 1M1DA 3D8PA 1FRQA 3WBJA 4GM5A 2BGIA 5AN9A 4XKVA 3W6XA 4KVOE 4RDKA 4XLEA 2C4TA 3OZVA 4YXWA 1Q9SA 2HB6A 4TMXA 1TKFA 3D7DA 2C6CA 3AVYA 4NJQA 1UD2A 3CCEB 4PXDA 4F9UA 5GV8A 2X3UA 1YREA 5IX3A 4LC0A 2XZOA 2XEJA 3H8FA 4DJLA 5FNZA 1OZPA 1CPXA 2XNCA 3LQEA 1ZLIA 3FYNA 2PJ1A 4AVBA 3A3BA 4B13A 1FX0A 3KASA 2YWHA 1COWA 4JLYA 3AVXA 1BPMA 3FH4A 2VJJA 3W6SA 3IIBA 3FX6A 2RB7A 2QTLA 3MMPA 3CB4A 4OIWA 3A8JA 3WABA 1EFCA 3B7IA 4RS2A 2CNDA 4F6AA 1SM4A 3CT9A 4UEEA 4MJ8A 4EWTA 3CCRB 3CCJB 4Z1MA 3BLNA 4L8AA 4ASUA 3BI0A 3CXPA 3JUWA 1XQBA 3EO4A 1XE1A 1Q81D 4KLVA 4ZCLA 4CAEA 2VXKA 1KWMA 2JBJA 1EP2B 1UD4A 1YSJA 2CTCA 3KHZA 5F46A 1HVXA 1KUYA 4MFKA 4JXRA 4DQLA 3D66A 1E3XA 2VNHA 2Q6IA 1W87A 1Z8WA 1F2OA 1E64A 1QQ9A 2AFOA 2XNDA 2OBRA 1IIDA 5AGEA 4NGRA 2B4DA 3ASRA 2Z3NA 3SJGA 2DEUA 4MHPA 1CNFA 4K3NA 2OZGA 1XE4A 3GVKA 3SJZA 4FD5A 4P4EA 4LBZA 4C2XA 4X7EA 4QFMA 2HUZA 4UF4A 4CPAA 5K8MA 1ON0A 4AXVA 1MJBA 5FVJA 3LNNA 3EFAA 1G7RA 4XNFA 1XEBA 4EH1A 2DY1A 2ZTNA 1PJ7A 2HV2A 2OB0A 3ZBUA 1N0VC 3Q38A 2V7QA 3DDDA 3PA1A 3PB8X 1P0HA 1K9MD 1KQSB 2ANPA 4KKUA 1IU8A 1N71A 2E1BA 2Q6KA 2PJAA 3KR4A 4EFDA 1TTTA 1A2ZA 4DNCA 4OPSA 3T9YA 3VNUA 4OADA 4PXEA 1UD5A 4QB9A 2FX3A 5LYDA 2F1MA 2X6YA 4YAFA 1EFUA 3B78A 5A89A 2REEA 1AMOA 4WZEA 1M44A 3TCVA 4DNTB 3E0KA 3R6JA 4P4DA 3U2QA 4ZX8A 4FD4A 2D4OA 4H6ZA 1M90D 3GYAA 4FWTA 4Q38A 3OW2B 1D8TA 5KSWB 3WNCA 4U9ZA 4UBRA 4N3NA 1TIQA 3TE4A 4B11A 4J0QA 2QJ8A 3IGRA 2XEIA 4PC3A 4CQJA 1AMPA 2ZEMA 2PJ7A 2OOTA 1UMKA 1E1RA 4YFJA 1ARLA 1ELOA 1XIXA 3WC6A 1ZM3A 3EXNA 1YLOA 4HNXB 4RD2A 4TSFA 2G3TA 5THWA 4L8JA 2VNJA 2VZYA 3EC4A 5H5JA 2ZZFA 3CXQA 4ZX9A 4KOYA 2B4BA 4PV6A 5KNLA 2QVPA 3B3SA 3IEHA 4Z4SA 1V0EA 3ZZ0A 1OGJA 5FA6A 1U2RA 1KRHA 4IW3B 1YX2A 2VBTA 5TY0A 4CAWA 1P4NA 4II9A 1Q7YD 2GANA 1BPLA 4B43A 4UZFA 3LD2A 4NGQA 2PVVA 4QVJA 4QBJA 4LBYA 3PEIA 2X85A 2ZEEA 2V8DA 4UZEA 2GPJA 1VHOA 2C6PA 3RZAA 2O4HA 5IV0A 5A27A 1L0CA 1XMTA 1BLLE 4M3SA 1H8LA 1EWYA 2RC6A 1Z4EA 5LRGA 2WPWA 2Z3KA 4PC6A 4C2YA 5THXA 2BSWA 3VH9A 1VQNB 3CC4B 3Q6RA 4XPDC 2JLMA 2I00A 2J8RA 4PXCA 2DETA 3CMAB 3PENA 1Z2LA 2PJ2A 4OC3A 1YITB 2WYRA 4Y9UA 3D7FA 4Z4VA 1Q86D 3OKXA 5CNPA 4X7DA 3FVLA 1W0JA 2W6JA 3DSBA 4P10A 2V7VA 3KQXA 3S9MA 4P6YA 2DF5A 4WZLA 4XLCA 1CPSA 3CXCB 1VQKB 4BPRA 4X5KA 3S9LA 2JJ1A 4MCQA 2PLFA 2VZZA 3FIXA 4MMOA 3PRTA 3G71B 2BM1A 1EP3B 2I3CA 1T6YA 3FJOA 3QSYA 2GJRA 2BGJA 4OLLA 2K5TA 3NH5A 5C88A 4R71A 3D2PA 3B3TA 1M4DA 3U6BA 4XQFA 1S60A 2ABZA 5I0CA 3R95A 1S5KA 2GFQA 5G20A 2B5GA 4MFPA 3WC5A 2FS5A 1R3NA 2PIZA 2VI7A 5ELYA 4YAOA 4MRIA 4RD4A 4XMYA 2EIXA 4O23A 2PR1A 1YI2B 1CJWA 4M6IA 1OHHA 1EXMA 5AG6A 1MJ9A 3K9TA 2ODFA 1IHMA 1WSRA 4DNRB 2NMTA 3CCSB 5IYQA 1RXTA 2C5BA 2PJCA 2V7XA 3RY8A 2BO9A 1TLLA 2LZJA 4QVTA 4TMZA 2AFZA 3HUVA 1AUGA 4Y49C 3GVJA 2BPOA 5AG5A 1GAQA 1T5EA 2E1RA 1CNEA 2JDIA 4QHYA 2OK7A 2Q44A 3OP1A 5L46A 3NA6A 4CS0B 3JQPA 3R9GA 2GLFA 5CPAA 4KKTA 5F4OA 1K28D 5DN6A 3I1FA 1X10A 3T90A 1S0UA 3SI1A 4NJRA 4A31A 1W34A 3LVBA 1HDUA 4UFVA 4R8FA 4F8ZA 2BN4A 1KD1D 3CP8A 4AG9A 2D3LA 2ZL7A 3BH4A 4OKOA 4II3A 3LQ6A 3GIRA 3AGQA 5IB0A 1YGHA 3TO7A 1F60A 1BMFA 5GV7A 3CP2A 2O53A 5DSZA 4NFRA 1OB5A 2PE3A 4P1VA 2QDXA 1PKVA 1I8DA 3FF3A 1EP1B 3ONYA 3PP9A 1G7SA 2ZZQA 2OTJB 3CZXA 5KTAA 4RJLA 1DTDA 3FB3A 1QSOA 3V7ZA 4C68A 2XEXA 4X2TA 1VQLB 1KK2A 1PJ5A 4XPKA 4A33A 4MFLA 1V0CA 4JD6A 3I9SA 1W0KA 2WR8A 4K1XA 3V8IA 2BVNA 4NNJA 1S7KA 3CC2B 3RBUA 5TR9A 3CPXA 1QX4A 1LANA 1RQPA 1WU8A 3I3GA 2OYNA 3FXTA 3A8IA 4M2LA 4OC2A 4P4IA 3RAMA 1Q7LA 3ASSA 2AE6A 3GVLA 4A38A 3AGPA 4A32A 1UD8A 4B3XA 4P22A 2YNCC 3ZIAA 1UD6A 2BF4A 3K2KA 4FUUA 3PGPA 1PYTB 3K9UA 5KW9A 1R57A 1S7LA 2B58A 2FSRA 3D3SA 3BI1A 4PPZA 3MCAA 1IOIA 4H2KA 1QGAA 1FRNA 4KOWA 4MI4A 3TT2A 3VATA 1T6ZA 4ZCIA 2WJYA 1D1NA 1LOKA 4U9UA 3ASTA 3CW2A 5G1ZA 4R7MA 4UEFA 2GIVA 2JEVA 4DQKA 2AFXA 1V0FA 3WNDA 4PC7A 3PB9X 4KSIA 1VLYA 3FPKA 3ZC3A 1FNOA 3OPOA 4PGOA 3KR5A 3RO0A 4ONUA 5DWNA 2VJIA 5LYLA 1XMBA 4MHDA 4B4DA 1KK3A 3H8GA 2VBSA 2EO8A 2V7UA 1BLIA 3NE5B 1WORA 2J7KA 1YLEA 3JQRA 4ZGQB 4FAIA 1K8AD 3OFNA 4NXYA 2P6FA 2ATRA 5HZAA 1CG2A 2YNEA 2ZEDA 2XNJA 5ISVA 5BWAB 4NCNA 1KZLA 4XD7A 3G4SB 2I1LA 2EUIA 2CRVA 2DCUA 4TKOB 4M53A 1GJRA 3ZZTA 4NSQA 5A8AA 4LQ6A 4CGPA 4YHBA 5FO0A 4AC9A 4UFXA 2PR8A 3HLPA 3S6KA 3W91A 2B5OA 1R43A 4W9YA 3VO2A 1PJ6A 2DPTA 4Z4TA 4EMEA 4WZKA 1T6XA 4C2ZA 2FL4A 4HE5A 1BO4A 1JNYA 1QH0A 4ZGYB 2QECA 3QE2A 1E43A 4P3IA 3OEEA 1Z8LA 1E3ZA 3G8WA 4LQGA 4TN1A 4B3FX 3FBUA 1G7TA 1YQEA 3R9EA 1QVFB 4LX9A 3W5UA 2DPSA 3GY9A 2HMAA 3TO9A 2CK3A 1TF9A 4C7HA 3G05A 3KKWA 1ZG9A 1Q2CA 2OH1A 1K4JA 3PFEA 3LODA 4ZY0A 3OW7A 4TWEA 1ARMA 4P3YA 1RQRA 2Q51A 5G22A 5HVFA 2EVNA 4PAAA 3FKSA 1JQGA 4UIAA 1W2BB 3T53B 3AVUA 4P12A 3CCLB 1EFRA 2PCUA 2RC4A 2JN9A 4MHYA 5J35A 3LWUA 4R6TA 3D4UA 3OE7A 5K8PA 4B10A 2PC1A 3CXSA 3SJXA 1S4MA 4A2ZA 5EMNA 4AF6A 4DUKA 3BY1A 3FJUA 2KCWA 3CCVB 4ONWA 3Q6QA 5LRJA 4AF7A 3CCMB 1VQ8B 4ZCMA 1WK4A 4UCMA 2QA4B 4KOTA 5LYIA 3SJEA 4F9VA 2ZEHA 2EK9A 4YAWA 3H5ZA 1WSVA 4JZ0A 1Z8XA 2Q4ZA 3FMCA 2ZITA 1S7FA 4UWIA 1P4MA 4OC5A 2X6WA 2ZL5A 2F1LA 3IWEA 4ZBGA 7CPAA 3VWEA 5D8NA 1I18A 2F43A 1WWZA 4IK2A 2CXAA 2Q4VA 1KK1A 4G6IA 4UA3A 4Q7AA 1VJSA 3ZPNA 2PDOA 4B5PB 5A88A 4AG7A 4TMWA 4N3GA 5KTCA 4OC1A 4R3KA 3BHXA 3CCUB 3OJXA 1JB9A 1KK0A 4XNHC 4CRYB 2PJ9A 5J3OA 1GVHA 4ZYQA 1YW6A 1N8RD 2VNIA 3WT4A 1WDTA 2VNKA 4XN0A 1YK3A 2Q6LA 3P27A 1W9XA 4OPVA 1BAVA 2PQ8A 3BCDA 1J9ZA 4K30A 3RNZA 3WR7A 3ASPA 4B48A 2AFUA 3W2GA 1FNCA 3NH8A 4XLFA 4B5PA 1K73D 1MK4A 1GO2A 2IL4A 4KOUA 4Q36A 6CPAA 3B3WA 5FIUA 1H85A 2P6EA 4G1PA 2M5SA 4RPBA 4TT3A 4F0XA 1B23P 2VBQA 1E1QA 3IU1A 4MYTA 3CD6B 2CTBA 4P4JA 5F49A 1KMHA 4ORFA 4R3LA 5J1QA 3DLJA 4PK2A 2HC9A 3A8KA 2P6GA 5JBQA 3KZWA 2BUEA 4P25A 1BJKA 4DK0A 3WC7A 1JA0A 4EVYA 1XF8A 5CDFA 3JVNA 4LUAA 5F47A 2D3NA 1OB2A 4B6ZA 3BJ8A 3SHPA 3SXOA 4E2AA 1H8HA 4OP7A 2WSAA 2C4UA 4RPDA 1HDQA 2OTLB 2GQFA 1QUFA 3I1UA 1VGYA 4OP4A 4CAVA 3VMFA 2JIZA 3WXMA 2VZLA 4A94A 3B8HA 3FRMA 4MBUA 4R76A 1EFTA 4NBSA 3V7AA 2ZXIA 2CY2A 1QSMA 1SQHA 4H6UA 3F5BA 4QV2A 4XNHB 2GJPA 4ROXA 3J81k 1VQOB 3D7GA 3NH4A 2DIEA 1I12A 4PK3A 1H8EA 1QUEA 4UCNA 3E1YE 2B3VA 4KLWA 4YGOA 1W35A 2FT0A 5HKKA 1XOVA 3R9FA 4R9MA 2ZW6A 4F7DA 3F8KA 1FDRA 3H9NA 4OPOA 2Z3OA 4P9SA 2OZHA 4M6GA 2PJ3A 3IU2A 3PZJA 1B6BA 1ZUNB 4A39A 3CESA 2V7TA 5I4MA 1E62A 2VL1A 2POKA 5C82A 4ZGNB 1NMTA 2X0KA 3SI0A 2ZELA 4G7WA 1QFZA 1VQ7B 4NGPA 4XL9A 1J4JA 1Y9KA 3TOAA 3S9NA 3D2MA 4WZTA 4RM0A 4Q7JB 2ZBVA 3LMSA 3NFZA 2Q4YA 3CCQB 1KZFA 5B6IA 3CC7B 3L2NA 2R8VA 3GIUA 2XEFA 1IB1E 4PABA 4P44A 4UCPA 3PB7X 5KTDA 3ASQA 1HZEA 1Y0YA 5H86A 3P2FA 5LMZA 1R5BA 2F7VA 4CYPA 2H5MA 2CBXA 1IICA 2BM0A 3GB0A 1BQEA 2PIYA 4JYWA 5IYPA 2C1CA 3D67A 2J8MA 2GREA 2XEGA 2R6HA 1I1DA 4B44A 1VQ9B 5HVHA 5AG4A 4RD6A 3GQBA 2V8HA 1U6MA 3ZBTA 2IJZA 4U9YA 1BX1A 3VNVA 4KSFA 1HEEA 4A37A 3H94A 4KORA 4QUSA 4UIBA 1VQMB 4F0YA 3S6FA 2C27A 4IUSA 4NGTA 1LCPA 4ZY1A 2G9DA 2WPXA 4PXBA 2IQ6A 3MHPA 2OK8A 2FIAA 1QFJA 2WJVA 3W2FA 1XFOA 4CYOA 4HKFA 1YX0A 4RDLA 4UAJA 4M4SA 1Z8TA 1Q2DA 2R1IA 1QSNA 4I49A 3D26A 2WZNA 2QMLA 4YRHA 3KI9A 3W5VA 1M4LA 4KS9A 2J9AA 3KL9A 5EBVA 2PJ4A 4B12A 1MJAA 2O28A 2B4DB 1VQPB 5K8OA 2OR4A 3B8GA 4H9GA 4OC4A 3DDYA 4KKSA 3RYOA 4ACAA 5F48A 3T8WA 3FNCA 2FIWA 4RD1A 1VHEA 1AYEA 4P6VF 4NCZA 5HMNA 3ES9A 3QB8A 4RI1A 4YEJA 4UZUA 4CAFA 2HQYA 2VQYA 2V8GA 3QAHA 4Y49B 4FN5A 2XOKA 1VQ4B 3OEHA 3W2HA 2W6IA 4GQNA 1WOOA 5BSYA 4IHMA 4XM3A 3BNWA 2QIRA 5HXDA 3QAYA 4RCYA 2ZPAA 3A1PA 4MCSA 3V38A 1LAMA 1N07A 3OZUA 3WYAA 1R5NA 1GHEA 2X8KA 4RD0A 3LO8A 1F57A 3BY2A 1ELMP 1NE9A 4MFZA 3W5HA 3CMMA 1IJEA 5HXBA 3AVWA 4HPSA 1B2RA 2BL1A 2CC2A 2AFSA 1PU9A 3MGDA 2WZPP 3BXMA 3SXNA 4NGNA 1TKJA 3E20A 2EBJA 1NBMA 4FD6A 2CW5A 4YAUA 3QFRA 1WP6A 3A3GA 1NSAA 3A35A 2AJ6A 2ZBUA 3PBEA 2PVWA 4X8IA 2ZEFA 2R7HA 5IB9A 2Q7BA 4YU9A 4X7FA 3TFYA 3N5FA 4OIDA 4G1VA 2Q43A 2ZENA 2QEXB 3ZZUA 3D7HA 4BD9A 2AHOA 5LYFA 2Z3MA 2NPFA 4YWYA 5IYWA 1ZG7A 5FO1A 3CRZA 1UFHA 3IO1A 2NV4A 3SKBA 4OMEA 2NYQA 1CP6A 1V5VA 1N06A 1IY7A 3P2HA 4XN3A 2D9RA 1QVGB 2B5GB 3LACA 2X53S 5IYNA 1CBXA 5J8FA 5TV2A 2PIAA 5JM6A 4Z65A 4A95A 5AG7A 4P26A 2Z11A 4BINA 4OOSA 2X6XA 2ZW5A 4CYQA 1KC8D 2HDNB 3ZUGA 2C77A 4CRZB 1CM0A 1Z4RA 4B14A 4HNYB 3UY5A 4P45A 4JJXA 4XPLA 1UWYA 1QSTA 3JQQA 3R1KA 1I7PA 1HA3A 2CNSA 1B87A 4X3RA 1YIJB 2GJKA 3A9LA 2ARHA 5JQ4A 2Y0MA 4ZY2A 3ZJ0A 2PRQA 3P26A 2ZXVA 1IB0A 3QFSA 2FCKA 4XOTA 4OAEA 3I55B 1ELLP 3TX8A 3OOCA 3B3CA 4XPDB 3VARA 4MXUA 4NGMA 1I21A 1YJ9B 3JU4A 3PA2A 4KVXA 3S6HA 3H4QA 1G7CA 4Z4YA 4BBHA 5F4JA 2YNCA 3PB4X 1S7NA 3SJPA 3KHXA 2Z0ZA 4CGNA 5EC4A 4H89A 4TMTA 3G6EB 4ZI6A 3KQZA 2EFGA 2ZTGA 2CF4A 1BX0A 2GU2A 3FECA 2BMWA 5HVGA 2CIJA
chains in the Genus database with same CATH topology
2AFZA 3WC7A 3B35A 3HUVA 1XRYA 2JBKA 4PQAA 3D68A 4B6ZA 3NA6A 1HDQA 3SI2A 2GLFA 5CPAA 4DYOA 3I1UA 1VGYA 4OP4A 4A94A 4MCPA 4R76A 1Z5RA 3PB6X 4TNUA 1CP7A 3SI1A 1RTQA 1CX8A 4NJRA 1HDUA 3JRUA 4R8FA 4F8ZA 3D7GA 3NH4A 4GM5A 5LRKA 3TC8A 4OKOA 2HB6A 1TKFA 3D7DA 2C6CA 4UEZA 2PJ0A 4NJQA 2O53A 2PJ8A 4PXDA 1IGBA 4F9UA 4NFRA 4WWVA 2PE3A 2XEJA 3H8FA 4DJLA 3FF3A 3DGVA 1CPXA 1ZLIA 2PJ3A 2PJ1A 4A39A 1DTDA 3V7ZA 3KASA 4X2TA 5I4MA 2F8HA 2VL1A 1BPMA 3FH4A 2POKA 3IIBA 3SI0A 3FX6A 1Y7EA 2ZELA 2RB7A 4NGPA 3RBUA 4OIWA 3WABA 3S9NA 3B7IA 3CPXA 2NSMA 1LANA 3LMSA 3NFZA 3CT9A 4UEEA 4EWTA 3L2NA 4OC2A 3RAMA 4P4IA 1Q7LA 5K8NA 3BI0A 2XEFA 4A38A 4P44A 3ISZA 5D29A 4FUUA 3K2KA 1PYTB 1TXRA 3PB7X 1KWMA 1ZG8A 2JBJA 1YSJA 1Y0YA 2CTCA 3BI1A 3KHZA 4PPZA 4H2KA 2F7VA 4MCRA 3VATA 1TKHA 3GB0A 3D66A 2PIYA 4JYWA 1LOKA 3IWWA 2C1CA 2IMOA 3D67A 4R7MA 2GREA 4UEFA 3GLJA 1YW4A 1F2OA 1QQ9A 2XEGA 2AFXA 2AFOA 5HVHA 4NGSA 2AFWA 4NGRA 2EWBA 2V8HA 3PB9X 4KSIA 2RFHA 4P4BA 2BCOA 3SJGA 4MHPA 3B3VA 4K3NA 2IJZA 3IJ3A 1FNOA 1HEEA 4A37A 3KR5A 4FWUA 4UIBA 4P4EA 5LYLA 1XMBA 4NGTA 1LCPA 4ZY1A 3H8EA 2G9DA 4PXBA 4UF4A 2IQ6A 4CPAA 3H8GA 5K8MA 4AXVA 4FAIA 1XFOA 2DEAA 1CG2A 5F09A 2ZEDA 3FEEA 1Y0RA 1XJOA 3PB8X 2ZEPA 2ANPA 1FT7A 2WZNA 3CDXA 3KI9A 2PJAA 1M4LA 3KR4A 2J9AA 4EFDA 3HLPA 3KL9A 2PJ4A 4PXEA 5LYDA 1R43A 4W9YA 1OBRA 5K8OA 2OR4A 1PCAA 4OC4A 4EMEA 5JGFA 1DE4C 4ZX8A 4P4DA 3T8WA 1VHEA 1AYEA 4P4FA 2QYVA 1Z8LA 1BPNA 5DS0A 4LQGA 2V8GA 1EE3P 3KGQA 4FBEA 2QJ8A 1TF9A 1GYTA 2XEIA 1ZG9A 4IHMA 1AMPA 3PFEA 2ZEMA 2PJ7A 2OOTA 3IFEA 5HXDA 4ZY0A 1ARLA 4OC0A 4TWEA 1ARMA 4MCSA 1LAMA 3V38A 3WC6A 2Q51A 1YLOA 5HVFA 5THWA 1YMEA 1JQGA 4UIAA 1F57A 2JEWA 2ZEGA 4ZX9A 1ELMP 3FEDA 2PCUA 2ZEOA 4MHYA 2QVPA 2BOAA 3B3SA 3IEHA 3LWUA 4R6TA 3D4UA 5K8PA 2GLJA 3MN8A 3SJXA 2AFSA 2ZOFA 3BXMA 4DUKA 3FJUA 3IC1A 4NGNA 4ONWA 1TKJA 2V77A 3PBBA 5LRJA 2EK8A 4NGQA 2PVVA 2AFMA 3PEIA 8CPAA 2ZEEA 2V8DA 1NSAA 1VHOA 5LYIA 3SJEA 2C6PA 3RZAA 4F9VA 2O4HA 3PBEA 2ZEHA 2EK9A 2PVWA 4X8IA 4JZ0A 2ZEFA 5IB9A 1TF8A 2ZOGA 4YU9A 3N5FA 2Q4ZA 3QNVA 3FMCA 1BLLE 4OIDA 1H8LA 1LAPA 5LRGA 3CPAA 2V8VA 2ZENA 2Q43A 4OC5A 3GUXA 3VH9A 3D7HA 4BD9A 5LYFA 3B2YA 4YWYA 7CPAA 5D8NA 1ZG7A 4PXCA 1Z2LA 2PJ2A 4OC3A 3IO1A 2WYRA 4IAVA 2C6GA 3D7FA 4OMEA 4IK2A 2NYQA 1CP6A 5JH9A 2PJBA 1F2PA 1IY7A 2PJ5A 3FVLA 3MRUA 4Q7AA 1LFWA 1VIXA 4P10A 3KQXA 3S9MA 1CBXA 4P6YA 3SJFA 1CPSA 5JM6A 4MHZA 4Z65A 4OC1A 3PFOA 3BHXA 4MHNA 3S9LA 4MCQA 2PJ9A 4MMOA 3PRTA 2I3CA 4P45A 4ZYQA 1YW6A 3NH5A 1UWYA 3WT4A 3B3TA 1BAVA 2PJ6A 4X3RA 2ABZA 2FVGA 2AFUA 4ZY2A 2PRQA 3ISXA 5CBMA 3NH8A 3WC5A 1QMUA 1ELLP 3TX8A 1R3NA 2PIZA 5ELYA 4MRIA 3B3CA 3VARA 4MXUA 4NGMA 6CPAA 3B3WA 4O23A 1ZLHA 4G1PA 4RUHA 4WJBA 2CTBA 3K9TA 3PB4X 3KHXA 4P4JA 1XBUA 4ZI6A 5J1QA 3DLJA 3KQZA 2HC9A 2CF4A 2PJCA 2BO9A 3KZWA 2GU2A 3FECA 5HVGA 2CIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFZ A;  3WC7 A;  3B35 A;  3HUV A;  1XRY A;  2JBK A;  4PQA A;  3D68 A;  4B6Z A;  3NA6 A;  1HDQ A;  3SI2 A;  2GLF A;  5CPA A;  4DYO A;  3I1U A;  1VGY A;  4OP4 A;  4A94 A;  4MCP A;  4R76 A;  1Z5R A;  3PB6 X;  4TNU A;  1CP7 A;  3SI1 A;  1RTQ A;  1CX8 A;  4NJR A;  1HDU A;  3JRU A;  4R8F A;  4F8Z A;  3D7G A;  3NH4 A;  4GM5 A;  5LRK A;  3TC8 A;  4OKO A;  2HB6 A;  1TKF A;  3D7D A;  2C6C A;  4UEZ A;  2PJ0 A;  4NJQ A;  2O53 A;  2PJ8 A;  4PXD A;  1IGB A;  4F9U A;  4NFR A;  4WWV A;  2PE3 A;  2XEJ A;  3H8F A;  4DJL A;  3FF3 A;  3DGV A;  1CPX A;  1ZLI A;  2PJ3 A;  2PJ1 A;  4A39 A;  1DTD A;  3V7Z A;  3KAS A;  4X2T A;  5I4M A;  2F8H A;  2VL1 A;  1BPM A;  3FH4 A;  2POK A;  3IIB A;  3SI0 A;  3FX6 A;  1Y7E A;  2ZEL A;  2RB7 A;  4NGP A;  3RBU A;  4OIW A;  3WAB A;  3S9N A;  3B7I A;  3CPX A;  2NSM A;  1LAN A;  3LMS A;  3NFZ A;  3CT9 A;  4UEE A;  4EWT A;  3L2N A;  4OC2 A;  3RAM A;  4P4I A;  1Q7L A;  5K8N A;  3BI0 A;  2XEF A;  4A38 A;  4P44 A;  3ISZ A;  5D29 A;  4FUU A;  3K2K A;  1PYT B;  1TXR A;  3PB7 X;  1KWM A;  1ZG8 A;  2JBJ A;  1YSJ A;  1Y0Y A;  2CTC A;  3BI1 A;  3KHZ A;  4PPZ A;  4H2K A;  2F7V A;  4MCR A;  3VAT A;  1TKH A;  3GB0 A;  3D66 A;  2PIY A;  4JYW A;  1LOK A;  3IWW A;  2C1C A;  2IMO A;  3D67 A;  4R7M A;  2GRE A;  4UEF A;  3GLJ A;  1YW4 A;  1F2O A;  1QQ9 A;  2XEG A;  2AFX A;  2AFO A;  5HVH A;  4NGS A;  2AFW A;  4NGR A;  2EWB A;  2V8H A;  3PB9 X;  4KSI A;  2RFH A;  4P4B A;  2BCO A;  3SJG A;  4MHP A;  3B3V A;  4K3N A;  2IJZ A;  3IJ3 A;  1FNO A;  1HEE A;  4A37 A;  3KR5 A;  4FWU A;  4UIB A;  4P4E A;  5LYL A;  1XMB A;  4NGT A;  1LCP A;  4ZY1 A;  3H8E A;  2G9D A;  4PXB A;  4UF4 A;  2IQ6 A;  4CPA A;  3H8G A;  5K8M A;  4AXV A;  4FAI A;  1XFO A;  2DEA A;  1CG2 A;  5F09 A;  2ZED A;  3FEE A;  1Y0R A;  1XJO A;  3PB8 X;  2ZEP A;  2ANP A;  1FT7 A;  2WZN A;  3CDX A;  3KI9 A;  2PJA A;  1M4L A;  3KR4 A;  2J9A A;  4EFD A;  3HLP A;  3KL9 A;  2PJ4 A;  4PXE A;  5LYD A;  1R43 A;  4W9Y A;  1OBR A;  5K8O A;  2OR4 A;  1PCA A;  4OC4 A;  4EME A;  5JGF A;  1DE4 C;  4ZX8 A;  4P4D A;  3T8W A;  1VHE A;  1AYE A;  4P4F A;  2QYV A;  1Z8L A;  1BPN A;  5DS0 A;  4LQG A;  2V8G A;  1EE3 P;  3KGQ A;  4FBE A;  2QJ8 A;  1TF9 A;  1GYT A;  2XEI A;  1ZG9 A;  4IHM A;  1AMP A;  3PFE A;  2ZEM A;  2PJ7 A;  2OOT A;  3IFE A;  5HXD A;  4ZY0 A;  1ARL A;  4OC0 A;  4TWE A;  1ARM A;  4MCS A;  1LAM A;  3V38 A;  3WC6 A;  2Q51 A;  1YLO A;  5HVF A;  5THW A;  1YME A;  1JQG A;  4UIA A;  1F57 A;  2JEW A;  2ZEG A;  4ZX9 A;  1ELM P;  3FED A;  2PCU A;  2ZEO A;  4MHY A;  2QVP A;  2BOA A;  3B3S A;  3IEH A;  3LWU A;  4R6T A;  3D4U A;  5K8P A;  2GLJ A;  3MN8 A;  3SJX A;  2AFS A;  2ZOF A;  3BXM A;  4DUK A;  3FJU A;  3IC1 A;  4NGN A;  4ONW A;  1TKJ A;  2V77 A;  3PBB A;  5LRJ A;  2EK8 A;  4NGQ A;  2PVV A;  2AFM A;  3PEI A;  8CPA A;  2ZEE A;  2V8D A;  1NSA A;  1VHO A;  5LYI A;  3SJE A;  2C6P A;  3RZA A;  4F9V A;  2O4H A;  3PBE A;  2ZEH A;  2EK9 A;  2PVW A;  4X8I A;  4JZ0 A;  2ZEF A;  5IB9 A;  1TF8 A;  2ZOG A;  4YU9 A;  3N5F A;  2Q4Z A;  3QNV A;  3FMC A;  1BLL E;  4OID A;  1H8L A;  1LAP A;  5LRG A;  3CPA A;  2V8V A;  2ZEN A;  2Q43 A;  4OC5 A;  3GUX A;  3VH9 A;  3D7H A;  4BD9 A;  5LYF A;  3B2Y A;  4YWY A;  7CPA A;  5D8N A;  1ZG7 A;  4PXC A;  1Z2L A;  2PJ2 A;  4OC3 A;  3IO1 A;  2WYR A;  4IAV A;  2C6G A;  3D7F A;  4OME A;  4IK2 A;  2NYQ A;  1CP6 A;  5JH9 A;  2PJB A;  1F2P A;  1IY7 A;  2PJ5 A;  3FVL A;  3MRU A;  4Q7A A;  1LFW A;  1VIX A;  4P10 A;  3KQX A;  3S9M A;  1CBX A;  4P6Y A;  3SJF A;  1CPS A;  5JM6 A;  4MHZ A;  4Z65 A;  4OC1 A;  3PFO A;  3BHX A;  4MHN A;  3S9L A;  4MCQ A;  2PJ9 A;  4MMO A;  3PRT A;  2I3C A;  4P45 A;  4ZYQ A;  1YW6 A;  3NH5 A;  1UWY A;  3WT4 A;  3B3T A;  1BAV A;  2PJ6 A;  4X3R A;  2ABZ A;  2FVG A;  2AFU A;  4ZY2 A;  2PRQ A;  3ISX A;  5CBM A;  3NH8 A;  3WC5 A;  1QMU A;  1ELL P;  3TX8 A;  1R3N A;  2PIZ A;  5ELY A;  4MRI A;  3B3C A;  3VAR A;  4MXU A;  4NGM A;  6CPA A;  3B3W A;  4O23 A;  1ZLH A;  4G1P A;  4RUH A;  4WJB A;  2CTB A;  3K9T A;  3PB4 X;  3KHX A;  4P4J A;  1XBU A;  4ZI6 A;  5J1Q A;  3DLJ A;  3KQZ A;  2HC9 A;  2CF4 A;  2PJC A;  2BO9 A;  3KZW A;  2GU2 A;  3FEC A;  5HVG A;  2CIJ A; 
#chains in the Genus database with same CATH topology
 2XZL A;  1JWQ A;  3B35 A;  4KUB A;  5JPH A;  3D68 A;  3R6K A;  4NF1 A;  4E0A A;  1QGY A;  3SI2 A;  4B47 A;  4DYO A;  2B7C A;  4X05 A;  1BOB A;  4MCP A;  2J8N A;  2R9V A;  1QSR A;  2B3U A;  1Z5R A;  2OBT A;  2JJ2 A;  5IK2 A;  2CNT A;  3PB6 X;  2CNM A;  3FPP A;  1CP7 A;  3I56 B;  5LRK A;  3TC8 A;  4AVA A;  1QFY A;  1LRZ A;  2YWG A;  4G5G A;  2X7B A;  4ZV4 A;  1RO5 A;  1Y7R A;  4KZT A;  4UEZ A;  4FXU A;  3TOB A;  2PJ0 A;  2G0B A;  2PJ8 A;  1JA1 A;  1IGB A;  4A30 A;  2PMD A;  4WWV A;  3GSI A;  2D4P A;  2QE7 A;  3R96 A;  3SEJ A;  1A8P A;  3ONU A;  2ZW4 A;  3DGV A;  1VQ6 B;  4DK1 A;  3OZW A;  2QGG A;  2VBU A;  3SLD A;  2QN6 A;  1S3Z A;  2F8H A;  4X0C A;  4X7C A;  4MFJ A;  4WQM A;  4AB7 A;  1OGI A;  3DR8 A;  2JDD A;  1Y7E A;  5E6T A;  4C43 A;  4C7I A;  5IYR A;  1Y9W A;  1KUX A;  1N08 A;  2NSM A;  4KUA A;  3GKR A;  2FE7 A;  3T51 B;  5G21 A;  4E0F A;  2RC5 A;  1PUA A;  4Z4Z A;  5K8N A;  5GCN A;  1NJI D;  1QG0 A;  2GK6 A;  3NE7 A;  2Z10 A;  3OWC A;  3VO1 A;  4L89 A;  4XOR A;  4P2N A;  3ISZ A;  5D29 A;  4B3G A;  4KSA A;  4PSX A;  3CME B;  1TXR A;  3TO6 A;  1ZG8 A;  4XOP A;  4U5Y A;  3DR6 A;  1NB0 A;  3N7Z A;  3PVD A;  1D2E A;  2BEI A;  4J3G A;  2D74 A;  3BCF A;  4MCR A;  1GAW A;  1TKH A;  3OJW A;  2VYQ A;  5FL7 A;  3IWW A;  4KOV A;  4KOX A;  2R98 A;  1WOS A;  2IMO A;  1KUV A;  4Y7C A;  3GLJ A;  1WPC A;  2Q6O A;  1YW4 A;  4QUZ A;  1MAB A;  2GK7 A;  3QFC A;  4NGS A;  2AFW A;  2EWB A;  1IOF A;  2RFH A;  4P4B A;  2BCO A;  1CQX A;  2DYI A;  4ACB A;  4RDJ A;  3B3V A;  3VWD A;  3IJ3 A;  2PSW A;  3WY9 A;  4FWU A;  4YAL A;  1YVO A;  3H8E A;  1OB0 A;  1Q2Y A;  1GR1 A;  4JMQ A;  1R5O A;  3S6G A;  2DEA A;  2YWE A;  2V31 A;  2DER A;  4PSW A;  5F09 A;  3B82 A;  3FEE A;  1Y0R A;  2HLD A;  1XJO A;  1SKY B;  2OBS A;  2ZEP A;  4LBV A;  1FT7 A;  1NSL A;  3CDX A;  2C5H A;  4X06 A;  1F20 A;  4CGM A;  2Z6B D;  2YGW A;  4B5O A;  2ZW7 A;  4YEL A;  3WBK A;  4Z4R A;  2ZXH A;  2Z3P A;  1OBR A;  4JXQ A;  1IYL A;  4OOX A;  1PCA A;  2YND A;  5DWM A;  2Q04 A;  4AVC A;  1FNB A;  4XLH A;  1WOP A;  4M85 A;  5JGF A;  3WQZ A;  1DE4 C;  4MY3 A;  1XB2 A;  4NEX A;  1VHS A;  4P4F A;  2V7W A;  4HE6 A;  3WNB A;  2G3A A;  2QYV A;  1SKQ A;  2WPD A;  4PC2 A;  1BPN A;  4RD3 A;  1AIP A;  5DS0 A;  4BMH A;  3T56 B;  1EE3 P;  3KGQ A;  2OU2 A;  4Y9R A;  4KOS A;  3W2I A;  4FBE A;  2Q7S A;  1GYT A;  2B7B A;  2V4D A;  3IFE A;  2QMU A;  2WSS A;  1FY7 A;  4OC0 A;  2XZP A;  1ZM4 A;  3Q39 A;  1IJF A;  4LBW A;  1H42 A;  5EMI A;  1E63 A;  1UD3 A;  3VR6 A;  1YME A;  3BQJ A;  2JEW A;  2ZEG A;  2QTZ A;  3FED A;  4MFQ A;  2ZEO A;  1M4I A;  2DXQ A;  2BOA A;  4M0L A;  5TRD A;  1M4G A;  2GLJ A;  4GXH A;  3ZZI A;  3MN8 A;  2P3M A;  3F0A A;  5HH1 A;  4XLA A;  1S72 B;  2ZOF A;  5F4M A;  3IC1 A;  2XGJ A;  2V77 A;  3PBB A;  5J8C A;  1VQ5 B;  1FNM A;  2EK8 A;  4JWP A;  1X12 A;  3BJ7 A;  2AFM A;  4G1B A;  8CPA A;  4KVM E;  1NRK A;  2C78 A;  4RLZ A;  1YHQ B;  1DDG A;  2ZZG A;  1NB9 A;  3BC9 A;  4E8O A;  1TF8 A;  2ZOG A;  4GS4 A;  4OOV A;  4AVZ A;  4R87 A;  3QNV A;  2BSA A;  4MYU A;  5E96 A;  1YVK A;  1LAP A;  2C2W A;  3CPA A;  2V8V A;  4CGL A;  2REF A;  3GUX A;  1TVC A;  3B2Y A;  3EY5 A;  4XR6 A;  2BV3 A;  2FXF A;  1JJ2 B;  3PUN A;  4Z4U A;  3AVV A;  4IAV A;  2C6G A;  3OAA A;  5JH9 A;  5HZB A;  2PJB A;  1F2P A;  3C26 A;  2Z3L A;  2P0W A;  3G3S A;  4MY0 A;  2PJ5 A;  4CGO A;  3KEW A;  3MRU A;  1DG1 G;  1WTH D;  3CTA A;  4QVA A;  1LFW A;  1VIX A;  4C0S A;  3JTK A;  3HAG A;  4HNW B;  3SJF A;  4MHZ A;  1Z9U A;  2OZU A;  1VKC A;  1DDI A;  4XKW A;  3PFO A;  4MHN A;  3NE8 A;  2VBV A;  4RN7 A;  4II2 A;  4RCZ A;  2WUU A;  1YJW B;  3DNS A;  2Q0Y A;  1KTV A;  2HCJ B;  4X07 A;  1NDH A;  1N0U A;  2PJ6 A;  1IYK A;  4CAX A;  3QFT A;  2FVG A;  1Q82 D;  4CYN A;  2ZL6 A;  4HIZ A;  4Z4W A;  2GE3 A;  4QC6 A;  4TMV A;  3ISX A;  5CBM A;  2KVO A;  2F4N A;  3U6K A;  2VEZ A;  1QMU A;  4IF5 A;  4UFW A;  2ZZE A;  3CPW B;  4FD7 A;  4G7X A;  2DOG A;  1ZLH A;  1MRZ A;  4RUH A;  4WJB A;  2A4N A;  1DAR A;  4FK8 A;  1YJN B;  5H84 A;  1XBU A;  1N05 A;  3TTH A;  1TUI A;  4M6H A;  3PUM A;  2I79 A;  1VLO A;  4R57 A;  1ZM2 A;  4UWJ A;  1XRY A;  5BSX A;  2JBK A;  4PQA A;  3AVT A;  4M1K A;  2F5I A;  2YWF A;  1QGZ A;  1VF7 A;  1E79 A;  1FND A;  1ZM9 A;  3IWG A;  1KJZ A;  3V76 A;  3W2E A;  1ZO0 A;  5A28 A;  1M1K D;  3Q3A A;  4XON A;  5H59 A;  4TNU A;  4PC1 A;  1YR0 A;  1RTQ A;  3SLN A;  1CX8 A;  2JDC A;  3JRU A;  2PRB A;  1M1D A;  3D8P A;  1FRQ A;  3WBJ A;  4GM5 A;  2BGI A;  5AN9 A;  4XKV A;  3W6X A;  4KVO E;  4RDK A;  4XLE A;  2C4T A;  3OZV A;  4YXW A;  1Q9S A;  2HB6 A;  4TMX A;  1TKF A;  3D7D A;  2C6C A;  3AVY A;  4NJQ A;  1UD2 A;  3CCE B;  4PXD A;  4F9U A;  5GV8 A;  2X3U A;  1YRE A;  5IX3 A;  4LC0 A;  2XZO A;  2XEJ A;  3H8F A;  4DJL A;  5FNZ A;  1OZP A;  1CPX A;  2XNC A;  3LQE A;  1ZLI A;  3FYN A;  2PJ1 A;  4AVB A;  3A3B A;  4B13 A;  1FX0 A;  3KAS A;  2YWH A;  1COW A;  4JLY A;  3AVX A;  1BPM A;  3FH4 A;  2VJJ A;  3W6S A;  3IIB A;  3FX6 A;  2RB7 A;  2QTL A;  3MMP A;  3CB4 A;  4OIW A;  3A8J A;  3WAB A;  1EFC A;  3B7I A;  4RS2 A;  2CND A;  4F6A A;  1SM4 A;  3CT9 A;  4UEE A;  4MJ8 A;  4EWT A;  3CCR B;  3CCJ B;  4Z1M A;  3BLN A;  4L8A A;  4ASU A;  3BI0 A;  3CXP A;  3JUW A;  1XQB A;  3EO4 A;  1XE1 A;  1Q81 D;  4KLV A;  4ZCL A;  4CAE A;  2VXK A;  1KWM A;  2JBJ A;  1EP2 B;  1UD4 A;  1YSJ A;  2CTC A;  3KHZ A;  5F46 A;  1HVX A;  1KUY A;  4MFK A;  4JXR A;  4DQL A;  3D66 A;  1E3X A;  2VNH A;  2Q6I A;  1W87 A;  1Z8W A;  1F2O A;  1E64 A;  1QQ9 A;  2AFO A;  2XND A;  2OBR A;  1IID A;  5AGE A;  4NGR A;  2B4D A;  3ASR A;  2Z3N A;  3SJG A;  2DEU A;  4MHP A;  1CNF A;  4K3N A;  2OZG A;  1XE4 A;  3GVK A;  3SJZ A;  4FD5 A;  4P4E A;  4LBZ A;  4C2X A;  4X7E A;  4QFM A;  2HUZ A;  4UF4 A;  4CPA A;  5K8M A;  1ON0 A;  4AXV A;  1MJB A;  5FVJ A;  3LNN A;  3EFA A;  1G7R A;  4XNF A;  1XEB A;  4EH1 A;  2DY1 A;  2ZTN A;  1PJ7 A;  2HV2 A;  2OB0 A;  3ZBU A;  1N0V C;  3Q38 A;  2V7Q A;  3DDD A;  3PA1 A;  3PB8 X;  1P0H A;  1K9M D;  1KQS B;  2ANP A;  4KKU A;  1IU8 A;  1N71 A;  2E1B A;  2Q6K A;  2PJA A;  3KR4 A;  4EFD A;  1TTT A;  1A2Z A;  4DNC A;  4OPS A;  3T9Y A;  3VNU A;  4OAD A;  4PXE A;  1UD5 A;  4QB9 A;  2FX3 A;  5LYD A;  2F1M A;  2X6Y A;  4YAF A;  1EFU A;  3B78 A;  5A89 A;  2REE A;  1AMO A;  4WZE A;  1M44 A;  3TCV A;  4DNT B;  3E0K A;  3R6J A;  4P4D A;  3U2Q A;  4ZX8 A;  4FD4 A;  2D4O A;  4H6Z A;  1M90 D;  3GYA A;  4FWT A;  4Q38 A;  3OW2 B;  1D8T A;  5KSW B;  3WNC A;  4U9Z A;  4UBR A;  4N3N A;  1TIQ A;  3TE4 A;  4B11 A;  4J0Q A;  2QJ8 A;  3IGR A;  2XEI A;  4PC3 A;  4CQJ A;  1AMP A;  2ZEM A;  2PJ7 A;  2OOT A;  1UMK A;  1E1R A;  4YFJ A;  1ARL A;  1ELO A;  1XIX A;  3WC6 A;  1ZM3 A;  3EXN A;  1YLO A;  4HNX B;  4RD2 A;  4TSF A;  2G3T A;  5THW A;  4L8J A;  2VNJ A;  2VZY A;  3EC4 A;  5H5J A;  2ZZF A;  3CXQ A;  4ZX9 A;  4KOY A;  2B4B A;  4PV6 A;  5KNL A;  2QVP A;  3B3S A;  3IEH A;  4Z4S A;  1V0E A;  3ZZ0 A;  1OGJ A;  5FA6 A;  1U2R A;  1KRH A;  4IW3 B;  1YX2 A;  2VBT A;  5TY0 A;  4CAW A;  1P4N A;  4II9 A;  1Q7Y D;  2GAN A;  1BPL A;  4B43 A;  4UZF A;  3LD2 A;  4NGQ A;  2PVV A;  4QVJ A;  4QBJ A;  4LBY A;  3PEI A;  2X85 A;  2ZEE A;  2V8D A;  4UZE A;  2GPJ A;  1VHO A;  2C6P A;  3RZA A;  2O4H A;  5IV0 A;  5A27 A;  1L0C A;  1XMT A;  1BLL E;  4M3S A;  1H8L A;  1EWY A;  2RC6 A;  1Z4E A;  5LRG A;  2WPW A;  2Z3K A;  4PC6 A;  4C2Y A;  5THX A;  2BSW A;  3VH9 A;  1VQN B;  3CC4 B;  3Q6R A;  4XPD C;  2JLM A;  2I00 A;  2J8R A;  4PXC A;  2DET A;  3CMA B;  3PEN A;  1Z2L A;  2PJ2 A;  4OC3 A;  1YIT B;  2WYR A;  4Y9U A;  3D7F A;  4Z4V A;  1Q86 D;  3OKX A;  5CNP A;  4X7D A;  3FVL A;  1W0J A;  2W6J A;  3DSB A;  4P10 A;  2V7V A;  3KQX A;  3S9M A;  4P6Y A;  2DF5 A;  4WZL A;  4XLC A;  1CPS A;  3CXC B;  1VQK B;  4BPR A;  4X5K A;  3S9L A;  2JJ1 A;  4MCQ A;  2PLF A;  2VZZ A;  3FIX A;  4MMO A;  3PRT A;  3G71 B;  2BM1 A;  1EP3 B;  2I3C A;  1T6Y A;  3FJO A;  3QSY A;  2GJR A;  2BGJ A;  4OLL A;  2K5T A;  3NH5 A;  5C88 A;  4R71 A;  3D2P A;  3B3T A;  1M4D A;  3U6B A;  4XQF A;  1S60 A;  2ABZ A;  5I0C A;  3R95 A;  1S5K A;  2GFQ A;  5G20 A;  2B5G A;  4MFP A;  3WC5 A;  2FS5 A;  1R3N A;  2PIZ A;  2VI7 A;  5ELY A;  4YAO A;  4MRI A;  4RD4 A;  4XMY A;  2EIX A;  4O23 A;  2PR1 A;  1YI2 B;  1CJW A;  4M6I A;  1OHH A;  1EXM A;  5AG6 A;  1MJ9 A;  3K9T A;  2ODF A;  1IHM A;  1WSR A;  4DNR B;  2NMT A;  3CCS B;  5IYQ A;  1RXT A;  2C5B A;  2PJC A;  2V7X A;  3RY8 A;  2BO9 A;  1TLL A;  2LZJ A;  4QVT A;  4TMZ A;  2AFZ A;  3HUV A;  1AUG A;  4Y49 C;  3GVJ A;  2BPO A;  5AG5 A;  1GAQ A;  1T5E A;  2E1R A;  1CNE A;  2JDI A;  4QHY A;  2OK7 A;  2Q44 A;  3OP1 A;  5L46 A;  3NA6 A;  4CS0 B;  3JQP A;  3R9G A;  2GLF A;  5CPA A;  4KKT A;  5F4O A;  1K28 D;  5DN6 A;  3I1F A;  1X10 A;  3T90 A;  1S0U A;  3SI1 A;  4NJR A;  4A31 A;  1W34 A;  3LVB A;  1HDU A;  4UFV A;  4R8F A;  4F8Z A;  2BN4 A;  1KD1 D;  3CP8 A;  4AG9 A;  2D3L A;  2ZL7 A;  3BH4 A;  4OKO A;  4II3 A;  3LQ6 A;  3GIR A;  3AGQ A;  5IB0 A;  1YGH A;  3TO7 A;  1F60 A;  1BMF A;  5GV7 A;  3CP2 A;  2O53 A;  5DSZ A;  4NFR A;  1OB5 A;  2PE3 A;  4P1V A;  2QDX A;  1PKV A;  1I8D A;  3FF3 A;  1EP1 B;  3ONY A;  3PP9 A;  1G7S A;  2ZZQ A;  2OTJ B;  3CZX A;  5KTA A;  4RJL A;  1DTD A;  3FB3 A;  1QSO A;  3V7Z A;  4C68 A;  2XEX A;  4X2T A;  1VQL B;  1KK2 A;  1PJ5 A;  4XPK A;  4A33 A;  4MFL A;  1V0C A;  4JD6 A;  3I9S A;  1W0K A;  2WR8 A;  4K1X A;  3V8I A;  2BVN A;  4NNJ A;  1S7K A;  3CC2 B;  3RBU A;  5TR9 A;  3CPX A;  1QX4 A;  1LAN A;  1RQP A;  1WU8 A;  3I3G A;  2OYN A;  3FXT A;  3A8I A;  4M2L A;  4OC2 A;  4P4I A;  3RAM A;  1Q7L A;  3ASS A;  2AE6 A;  3GVL A;  4A38 A;  3AGP A;  4A32 A;  1UD8 A;  4B3X A;  4P22 A;  2YNC C;  3ZIA A;  1UD6 A;  2BF4 A;  3K2K A;  4FUU A;  3PGP A;  1PYT B;  3K9U A;  5KW9 A;  1R57 A;  1S7L A;  2B58 A;  2FSR A;  3D3S A;  3BI1 A;  4PPZ A;  3MCA A;  1IOI A;  4H2K A;  1QGA A;  1FRN A;  4KOW A;  4MI4 A;  3TT2 A;  3VAT A;  1T6Z A;  4ZCI A;  2WJY A;  1D1N A;  1LOK A;  4U9U A;  3AST A;  3CW2 A;  5G1Z A;  4R7M A;  4UEF A;  2GIV A;  2JEV A;  4DQK A;  2AFX A;  1V0F A;  3WND A;  4PC7 A;  3PB9 X;  4KSI A;  1VLY A;  3FPK A;  3ZC3 A;  1FNO A;  3OPO A;  4PGO A;  3KR5 A;  3RO0 A;  4ONU A;  5DWN A;  2VJI A;  5LYL A;  1XMB A;  4MHD A;  4B4D A;  1KK3 A;  3H8G A;  2VBS A;  2EO8 A;  2V7U A;  1BLI A;  3NE5 B;  1WOR A;  2J7K A;  1YLE A;  3JQR A;  4ZGQ B;  4FAI A;  1K8A D;  3OFN A;  4NXY A;  2P6F A;  2ATR A;  5HZA A;  1CG2 A;  2YNE A;  2ZED A;  2XNJ A;  5ISV A;  5BWA B;  4NCN A;  1KZL A;  4XD7 A;  3G4S B;  2I1L A;  2EUI A;  2CRV A;  2DCU A;  4TKO B;  4M53 A;  1GJR A;  3ZZT A;  4NSQ A;  5A8A A;  4LQ6 A;  4CGP A;  4YHB A;  5FO0 A;  4AC9 A;  4UFX A;  2PR8 A;  3HLP A;  3S6K A;  3W91 A;  2B5O A;  1R43 A;  4W9Y A;  3VO2 A;  1PJ6 A;  2DPT A;  4Z4T A;  4EME A;  4WZK A;  1T6X A;  4C2Z A;  2FL4 A;  4HE5 A;  1BO4 A;  1JNY A;  1QH0 A;  4ZGY B;  2QEC A;  3QE2 A;  1E43 A;  4P3I A;  3OEE A;  1Z8L A;  1E3Z A;  3G8W A;  4LQG A;  4TN1 A;  4B3F X;  3FBU A;  1G7T A;  1YQE A;  3R9E A;  1QVF B;  4LX9 A;  3W5U A;  2DPS A;  3GY9 A;  2HMA A;  3TO9 A;  2CK3 A;  1TF9 A;  4C7H A;  3G05 A;  3KKW A;  1ZG9 A;  1Q2C A;  2OH1 A;  1K4J A;  3PFE A;  3LOD A;  4ZY0 A;  3OW7 A;  4TWE A;  1ARM A;  4P3Y A;  1RQR A;  2Q51 A;  5G22 A;  5HVF A;  2EVN A;  4PAA A;  3FKS A;  1JQG A;  4UIA A;  1W2B B;  3T53 B;  3AVU A;  4P12 A;  3CCL B;  1EFR A;  2PCU A;  2RC4 A;  2JN9 A;  4MHY A;  5J35 A;  3LWU A;  4R6T A;  3D4U A;  3OE7 A;  5K8P A;  4B10 A;  2PC1 A;  3CXS A;  3SJX A;  1S4M A;  4A2Z A;  5EMN A;  4AF6 A;  4DUK A;  3BY1 A;  3FJU A;  2KCW A;  3CCV B;  4ONW A;  3Q6Q A;  5LRJ A;  4AF7 A;  3CCM B;  1VQ8 B;  4ZCM A;  1WK4 A;  4UCM A;  2QA4 B;  4KOT A;  5LYI A;  3SJE A;  4F9V A;  2ZEH A;  2EK9 A;  4YAW A;  3H5Z A;  1WSV A;  4JZ0 A;  1Z8X A;  2Q4Z A;  3FMC A;  2ZIT A;  1S7F A;  4UWI A;  1P4M A;  4OC5 A;  2X6W A;  2ZL5 A;  2F1L A;  3IWE A;  4ZBG A;  7CPA A;  3VWE A;  5D8N A;  1I18 A;  2F43 A;  1WWZ A;  4IK2 A;  2CXA A;  2Q4V A;  1KK1 A;  4G6I A;  4UA3 A;  4Q7A A;  1VJS A;  3ZPN A;  2PDO A;  4B5P B;  5A88 A;  4AG7 A;  4TMW A;  4N3G A;  5KTC A;  4OC1 A;  4R3K A;  3BHX A;  3CCU B;  3OJX A;  1JB9 A;  1KK0 A;  4XNH C;  4CRY B;  2PJ9 A;  5J3O A;  1GVH A;  4ZYQ A;  1YW6 A;  1N8R D;  2VNI A;  3WT4 A;  1WDT A;  2VNK A;  4XN0 A;  1YK3 A;  2Q6L A;  3P27 A;  1W9X A;  4OPV A;  1BAV A;  2PQ8 A;  3BCD A;  1J9Z A;  4K30 A;  3RNZ A;  3WR7 A;  3ASP A;  4B48 A;  2AFU A;  3W2G A;  1FNC A;  3NH8 A;  4XLF A;  4B5P A;  1K73 D;  1MK4 A;  1GO2 A;  2IL4 A;  4KOU A;  4Q36 A;  6CPA A;  3B3W A;  5FIU A;  1H85 A;  2P6E A;  4G1P A;  2M5S A;  4RPB A;  4TT3 A;  4F0X A;  1B23 P;  2VBQ A;  1E1Q A;  3IU1 A;  4MYT A;  3CD6 B;  2CTB A;  4P4J A;  5F49 A;  1KMH A;  4ORF A;  4R3L A;  5J1Q A;  3DLJ A;  4PK2 A;  2HC9 A;  3A8K A;  2P6G A;  5JBQ A;  3KZW A;  2BUE A;  4P25 A;  1BJK A;  4DK0 A;  3WC7 A;  1JA0 A;  4EVY A;  1XF8 A;  5CDF A;  3JVN A;  4LUA A;  5F47 A;  2D3N A;  1OB2 A;  4B6Z A;  3BJ8 A;  3SHP A;  3SXO A;  4E2A A;  1H8H A;  4OP7 A;  2WSA A;  2C4U A;  4RPD A;  1HDQ A;  2OTL B;  2GQF A;  1QUF A;  3I1U A;  1VGY A;  4OP4 A;  4CAV A;  3VMF A;  2JIZ A;  3WXM A;  2VZL A;  4A94 A;  3B8H A;  3FRM A;  4MBU A;  4R76 A;  1EFT A;  4NBS A;  3V7A A;  2ZXI A;  2CY2 A;  1QSM A;  1SQH A;  4H6U A;  3F5B A;  4QV2 A;  4XNH B;  2GJP A;  4ROX A;  3J81 k;  1VQO B;  3D7G A;  3NH4 A;  2DIE A;  1I12 A;  4PK3 A;  1H8E A;  1QUE A;  4UCN A;  3E1Y E;  2B3V A;  4KLW A;  4YGO A;  1W35 A;  2FT0 A;  5HKK A;  1XOV A;  3R9F A;  4R9M A;  2ZW6 A;  4F7D A;  3F8K A;  1FDR A;  3H9N A;  4OPO A;  2Z3O A;  4P9S A;  2OZH A;  4M6G A;  2PJ3 A;  3IU2 A;  3PZJ A;  1B6B A;  1ZUN B;  4A39 A;  3CES A;  2V7T A;  5I4M A;  1E62 A;  2VL1 A;  2POK A;  5C82 A;  4ZGN B;  1NMT A;  2X0K A;  3SI0 A;  2ZEL A;  4G7W A;  1QFZ A;  1VQ7 B;  4NGP A;  4XL9 A;  1J4J A;  1Y9K A;  3TOA A;  3S9N A;  3D2M A;  4WZT A;  4RM0 A;  4Q7J B;  2ZBV A;  3LMS A;  3NFZ A;  2Q4Y A;  3CCQ B;  1KZF A;  5B6I A;  3CC7 B;  3L2N A;  2R8V A;  3GIU A;  2XEF A;  1IB1 E;  4PAB A;  4P44 A;  4UCP A;  3PB7 X;  5KTD A;  3ASQ A;  1HZE A;  1Y0Y A;  5H86 A;  3P2F A;  5LMZ A;  1R5B A;  2F7V A;  4CYP A;  2H5M A;  2CBX A;  1IIC A;  2BM0 A;  3GB0 A;  1BQE A;  2PIY A;  4JYW A;  5IYP A;  2C1C A;  3D67 A;  2J8M A;  2GRE A;  2XEG A;  2R6H A;  1I1D A;  4B44 A;  1VQ9 B;  5HVH A;  5AG4 A;  4RD6 A;  3GQB A;  2V8H A;  1U6M A;  3ZBT A;  2IJZ A;  4U9Y A;  1BX1 A;  3VNV A;  4KSF A;  1HEE A;  4A37 A;  3H94 A;  4KOR A;  4QUS A;  4UIB A;  1VQM B;  4F0Y A;  3S6F A;  2C27 A;  4IUS A;  4NGT A;  1LCP A;  4ZY1 A;  2G9D A;  2WPX A;  4PXB A;  2IQ6 A;  3MHP A;  2OK8 A;  2FIA A;  1QFJ A;  2WJV A;  3W2F A;  1XFO A;  4CYO A;  4HKF A;  1YX0 A;  4RDL A;  4UAJ A;  4M4S A;  1Z8T A;  1Q2D A;  2R1I A;  1QSN A;  4I49 A;  3D26 A;  2WZN A;  2QML A;  4YRH A;  3KI9 A;  3W5V A;  1M4L A;  4KS9 A;  2J9A A;  3KL9 A;  5EBV A;  2PJ4 A;  4B12 A;  1MJA A;  2O28 A;  2B4D B;  1VQP B;  5K8O A;  2OR4 A;  3B8G A;  4H9G A;  4OC4 A;  3DDY A;  4KKS A;  3RYO A;  4ACA A;  5F48 A;  3T8W A;  3FNC A;  2FIW A;  4RD1 A;  1VHE A;  1AYE A;  4P6V F;  4NCZ A;  5HMN A;  3ES9 A;  3QB8 A;  4RI1 A;  4YEJ A;  4UZU A;  4CAF A;  2HQY A;  2VQY A;  2V8G A;  3QAH A;  4Y49 B;  4FN5 A;  2XOK A;  1VQ4 B;  3OEH A;  3W2H A;  2W6I A;  4GQN A;  1WOO A;  5BSY A;  4IHM A;  4XM3 A;  3BNW A;  2QIR A;  5HXD A;  3QAY A;  4RCY A;  2ZPA A;  3A1P A;  4MCS A;  3V38 A;  1LAM A;  1N07 A;  3OZU A;  3WYA A;  1R5N A;  1GHE A;  2X8K A;  4RD0 A;  3LO8 A;  1F57 A;  3BY2 A;  1ELM P;  1NE9 A;  4MFZ A;  3W5H A;  3CMM A;  1IJE A;  5HXB A;  3AVW A;  4HPS A;  1B2R A;  2BL1 A;  2CC2 A;  2AFS A;  1PU9 A;  3MGD A;  2WZP P;  3BXM A;  3SXN A;  4NGN A;  1TKJ A;  3E20 A;  2EBJ A;  1NBM A;  4FD6 A;  2CW5 A;  4YAU A;  3QFR A;  1WP6 A;  3A3G A;  1NSA A;  3A35 A;  2AJ6 A;  2ZBU A;  3PBE A;  2PVW A;  4X8I A;  2ZEF A;  2R7H A;  5IB9 A;  2Q7B A;  4YU9 A;  4X7F A;  3TFY A;  3N5F A;  4OID A;  4G1V A;  2Q43 A;  2ZEN A;  2QEX B;  3ZZU A;  3D7H A;  4BD9 A;  2AHO A;  5LYF A;  2Z3M A;  2NPF A;  4YWY A;  5IYW A;  1ZG7 A;  5FO1 A;  3CRZ A;  1UFH A;  3IO1 A;  2NV4 A;  3SKB A;  4OME A;  2NYQ A;  1CP6 A;  1V5V A;  1N06 A;  1IY7 A;  3P2H A;  4XN3 A;  2D9R A;  1QVG B;  2B5G B;  3LAC A;  2X53 S;  5IYN A;  1CBX A;  5J8F A;  5TV2 A;  2PIA A;  5JM6 A;  4Z65 A;  4A95 A;  5AG7 A;  4P26 A;  2Z11 A;  4BIN A;  4OOS A;  2X6X A;  2ZW5 A;  4CYQ A;  1KC8 D;  2HDN B;  3ZUG A;  2C77 A;  4CRZ B;  1CM0 A;  1Z4R A;  4B14 A;  4HNY B;  3UY5 A;  4P45 A;  4JJX A;  4XPL A;  1UWY A;  1QST A;  3JQQ A;  3R1K A;  1I7P A;  1HA3 A;  2CNS A;  1B87 A;  4X3R A;  1YIJ B;  2GJK A;  3A9L A;  2ARH A;  5JQ4 A;  2Y0M A;  4ZY2 A;  3ZJ0 A;  2PRQ A;  3P26 A;  2ZXV A;  1IB0 A;  3QFS A;  2FCK A;  4XOT A;  4OAE A;  3I55 B;  1ELL P;  3TX8 A;  3OOC A;  3B3C A;  4XPD B;  3VAR A;  4MXU A;  4NGM A;  1I21 A;  1YJ9 B;  3JU4 A;  3PA2 A;  4KVX A;  3S6H A;  3H4Q A;  1G7C A;  4Z4Y A;  4BBH A;  5F4J A;  2YNC A;  3PB4 X;  1S7N A;  3SJP A;  3KHX A;  2Z0Z A;  4CGN A;  5EC4 A;  4H89 A;  4TMT A;  3G6E B;  4ZI6 A;  3KQZ A;  2EFG A;  2ZTG A;  2CF4 A;  1BX0 A;  2GU2 A;  3FEC A;  2BMW A;  5HVG A;  2CIJ A; 
#chains in the Genus database with same CATH homology
 2AFZ A;  3WC7 A;  3B35 A;  3HUV A;  1XRY A;  2JBK A;  4PQA A;  3D68 A;  4B6Z A;  3NA6 A;  1HDQ A;  3SI2 A;  2GLF A;  5CPA A;  4DYO A;  3I1U A;  1VGY A;  4OP4 A;  4A94 A;  4MCP A;  4R76 A;  1Z5R A;  3PB6 X;  4TNU A;  1CP7 A;  3SI1 A;  1RTQ A;  1CX8 A;  4NJR A;  1HDU A;  3JRU A;  4R8F A;  4F8Z A;  3D7G A;  3NH4 A;  4GM5 A;  5LRK A;  3TC8 A;  4OKO A;  2HB6 A;  1TKF A;  3D7D A;  2C6C A;  4UEZ A;  2PJ0 A;  4NJQ A;  2O53 A;  2PJ8 A;  4PXD A;  1IGB A;  4F9U A;  4NFR A;  4WWV A;  2PE3 A;  2XEJ A;  3H8F A;  4DJL A;  3FF3 A;  3DGV A;  1CPX A;  1ZLI A;  2PJ3 A;  2PJ1 A;  4A39 A;  1DTD A;  3V7Z A;  3KAS A;  4X2T A;  5I4M A;  2F8H A;  2VL1 A;  1BPM A;  3FH4 A;  2POK A;  3IIB A;  3SI0 A;  3FX6 A;  1Y7E A;  2ZEL A;  2RB7 A;  4NGP A;  3RBU A;  4OIW A;  3WAB A;  3S9N A;  3B7I A;  3CPX A;  2NSM A;  1LAN A;  3LMS A;  3NFZ A;  3CT9 A;  4UEE A;  4EWT A;  3L2N A;  4OC2 A;  3RAM A;  4P4I A;  1Q7L A;  5K8N A;  3BI0 A;  2XEF A;  4A38 A;  4P44 A;  3ISZ A;  5D29 A;  4FUU A;  3K2K A;  1PYT B;  1TXR A;  3PB7 X;  1KWM A;  1ZG8 A;  2JBJ A;  1YSJ A;  1Y0Y A;  2CTC A;  3BI1 A;  3KHZ A;  4PPZ A;  4H2K A;  2F7V A;  4MCR A;  3VAT A;  1TKH A;  3GB0 A;  3D66 A;  2PIY A;  4JYW A;  1LOK A;  3IWW A;  2C1C A;  2IMO A;  3D67 A;  4R7M A;  2GRE A;  4UEF A;  3GLJ A;  1YW4 A;  1F2O A;  1QQ9 A;  2XEG A;  2AFX A;  2AFO A;  5HVH A;  4NGS A;  2AFW A;  4NGR A;  2EWB A;  2V8H A;  3PB9 X;  4KSI A;  2RFH A;  4P4B A;  2BCO A;  3SJG A;  4MHP A;  3B3V A;  4K3N A;  2IJZ A;  3IJ3 A;  1FNO A;  1HEE A;  4A37 A;  3KR5 A;  4FWU A;  4UIB A;  4P4E A;  5LYL A;  1XMB A;  4NGT A;  1LCP A;  4ZY1 A;  3H8E A;  2G9D A;  4PXB A;  4UF4 A;  2IQ6 A;  4CPA A;  3H8G A;  5K8M A;  4AXV A;  4FAI A;  1XFO A;  2DEA A;  1CG2 A;  5F09 A;  2ZED A;  3FEE A;  1Y0R A;  1XJO A;  3PB8 X;  2ZEP A;  2ANP A;  1FT7 A;  2WZN A;  3CDX A;  3KI9 A;  2PJA A;  1M4L A;  3KR4 A;  2J9A A;  4EFD A;  3HLP A;  3KL9 A;  2PJ4 A;  4PXE A;  5LYD A;  1R43 A;  4W9Y A;  1OBR A;  5K8O A;  2OR4 A;  1PCA A;  4OC4 A;  4EME A;  5JGF A;  1DE4 C;  4ZX8 A;  4P4D A;  3T8W A;  1VHE A;  1AYE A;  4P4F A;  2QYV A;  1Z8L A;  1BPN A;  5DS0 A;  4LQG A;  2V8G A;  1EE3 P;  3KGQ A;  4FBE A;  2QJ8 A;  1TF9 A;  1GYT A;  2XEI A;  1ZG9 A;  4IHM A;  1AMP A;  3PFE A;  2ZEM A;  2PJ7 A;  2OOT A;  3IFE A;  5HXD A;  4ZY0 A;  1ARL A;  4OC0 A;  4TWE A;  1ARM A;  4MCS A;  1LAM A;  3V38 A;  3WC6 A;  2Q51 A;  1YLO A;  5HVF A;  5THW A;  1YME A;  1JQG A;  4UIA A;  1F57 A;  2JEW A;  2ZEG A;  4ZX9 A;  1ELM P;  3FED A;  2PCU A;  2ZEO A;  4MHY A;  2QVP A;  2BOA A;  3B3S A;  3IEH A;  3LWU A;  4R6T A;  3D4U A;  5K8P A;  2GLJ A;  3MN8 A;  3SJX A;  2AFS A;  2ZOF A;  3BXM A;  4DUK A;  3FJU A;  3IC1 A;  4NGN A;  4ONW A;  1TKJ A;  2V77 A;  3PBB A;  5LRJ A;  2EK8 A;  4NGQ A;  2PVV A;  2AFM A;  3PEI A;  8CPA A;  2ZEE A;  2V8D A;  1NSA A;  1VHO A;  5LYI A;  3SJE A;  2C6P A;  3RZA A;  4F9V A;  2O4H A;  3PBE A;  2ZEH A;  2EK9 A;  2PVW A;  4X8I A;  4JZ0 A;  2ZEF A;  5IB9 A;  1TF8 A;  2ZOG A;  4YU9 A;  3N5F A;  2Q4Z A;  3QNV A;  3FMC A;  1BLL E;  4OID A;  1H8L A;  1LAP A;  5LRG A;  3CPA A;  2V8V A;  2ZEN A;  2Q43 A;  4OC5 A;  3GUX A;  3VH9 A;  3D7H A;  4BD9 A;  5LYF A;  3B2Y A;  4YWY A;  7CPA A;  5D8N A;  1ZG7 A;  4PXC A;  1Z2L A;  2PJ2 A;  4OC3 A;  3IO1 A;  2WYR A;  4IAV A;  2C6G A;  3D7F A;  4OME A;  4IK2 A;  2NYQ A;  1CP6 A;  5JH9 A;  2PJB A;  1F2P A;  1IY7 A;  2PJ5 A;  3FVL A;  3MRU A;  4Q7A A;  1LFW A;  1VIX A;  4P10 A;  3KQX A;  3S9M A;  1CBX A;  4P6Y A;  3SJF A;  1CPS A;  5JM6 A;  4MHZ A;  4Z65 A;  4OC1 A;  3PFO A;  3BHX A;  4MHN A;  3S9L A;  4MCQ A;  2PJ9 A;  4MMO A;  3PRT A;  2I3C A;  4P45 A;  4ZYQ A;  1YW6 A;  3NH5 A;  1UWY A;  3WT4 A;  3B3T A;  1BAV A;  2PJ6 A;  4X3R A;  2ABZ A;  2FVG A;  2AFU A;  4ZY2 A;  2PRQ A;  3ISX A;  5CBM A;  3NH8 A;  3WC5 A;  1QMU A;  1ELL P;  3TX8 A;  1R3N A;  2PIZ A;  5ELY A;  4MRI A;  3B3C A;  3VAR A;  4MXU A;  4NGM A;  6CPA A;  3B3W A;  4O23 A;  1ZLH A;  4G1P A;  4RUH A;  4WJB A;  2CTB A;  3K9T A;  3PB4 X;  3KHX A;  4P4J A;  1XBU A;  4ZI6 A;  5J1Q A;  3DLJ A;  3KQZ A;  2HC9 A;  2CF4 A;  2PJC A;  2BO9 A;  3KZW A;  2GU2 A;  3FEC A;  5HVG A;  2CIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...