3KL9A

Crystal structure of pepa from streptococcus pneumoniae
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
355
structure length
340
Chain Sequence
SMTTLFSKIKEVTELAAVSGHEAPVRAYLREKLTPHVDEVVTDGLGGIFGIKHSEAVDAPRVLVASHMDEVGFMVSEIKPDGTFRVVEIGGWNPMVVSSQRFKLLTRDGHEIPVISGPAIADIVFDGGFADKAEAESFGIRPGDTIVPDSSAILTANEKNIISKAWDNRYGVLMVSELAEALSGQKLGNELYLGSNVQEEVGLRGAHTSTTKFDPEVFLAVDCSPAGDVYGGQGKIGDGTLIRFYDPGHLLLPGMKDFLLTTAEEAGIKYQYYCGKGGTDAGAAHLKNGGVPSTTIGVCARYIHSHQTLYAMDDFLEAQAFLQALVKKLDRSTVDLIKHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glutamyl aminopeptidase
publication title Structural basis for the substrate specificity of PepA from Streptococcus pneumoniae, a dodecameric tetrahedral protease
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 107
structure length 340
sequence length 355
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.7: Glutamyl aminopeptidase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3kl9A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kl9A01
8CPAA 2C6CA 1VGYA 4NJRA 1R43A 3IFEA 2F7VA 3D66A 3PB9X 2IQ6A 2POKA 4K3NA 1PYTB 5JH9A 1ZLIA 2XEJA 2CTCA 4JZ0A 3SJEA 4F8ZA 2HC9A 3PB4X 1Z8LA 4MCQA 4OKOA 1PCAA 4P44A 3PBEA 1HDQA 5LRGA 2AFWA 3CPXA 2O53A 5K8NA 1LAMA 4P4EA 3K9TA 1IGBA 1VIXA 3PB6X 1BPNA 5JGFA 2PJ7A 2V8DA 4MCPA 3WT4A 4KSIA 1M4LA 3BI0A 2XEGA 2V77A 5J1QA 4OIDA 4P4FA 1LOKA 4NGQA 3D7GA 3LWUA 3PEIA 3DLJA 3HLPA 3KGQA 4OC3A 4X3RA 2QYVA 2Q4ZA 2DEAA 2PVVA 3RBUA 5F09A 3CPAA 2PJ3A 4OC1A 3FEEA 1DTDA 3RZAA 1LANA 1HEEA 4R8FA 4ZY0A 2F8HA 5LYFA 2ZEFA 3D7HA 2JBJA 5THWA 3QNVA 4ZX9A 3FEDA 2PJ1A 5LYLA 1Y0YA 2RB7A 3TX8A 4PXCA 3MN8A 5LYIA 5HVFA 2BOAA 1AMPA 3SI1A 3H8GA 4ZYQA 1YLOA 1GYTA 4EMEA 1NSAA 4R76A 2CIJA 2PJ4A 1H8LA 3B3WA 3D4UA 4O23A 4F9UA 1TF8A 3KR4A 2Q43A 2PJ9A 1CP6A 2PJ0A 1IY7A 2Q51A 2ZENA 5D29A 4NGNA 5K8MA 4WJBA 1RTQA 1BLLE 4AXVA 1VHEA 3WABA 4DJLA 2PJ5A 4B6ZA 2AFOA 1BPMA 4OC2A 2G9DA 2EK8A 4Q7AA 4MHZA 2EWBA 1BAVA 2JBKA 2ZELA 3PFOA 2AFMA 2ZOFA 3IJ3A 3KHZA 4Z65A 1YW4A 2BO9A 3SJXA 3RAMA 1CBXA 2V8HA 5LYDA 4W9YA 3KHXA 1TKJA 3B3TA 4NJQA 4ZI6A 2PJ6A 5LRJA 3FJUA 1YMEA 4P4IA 3NH4A 5I4MA 1ELMP 4MRIA 2ZEOA 4DUKA 1Z5RA 2FVGA 5HVGA 3B3CA 4PXEA 4A37A 4NGMA 1R3NA 1FNOA 1Z2LA 1Y0RA 4FWUA 3D7FA 3NH8A 4UF4A 3FF3A 1CPXA 1EE3P 2GLJA 3SJGA 4X2TA 2PJCA 3TC8A 2OR4A 3NFZA 3I1UA 2EK9A 4G1PA 5LRKA 2RFHA 2XEFA 4IAVA 4OP4A 2IMOA 5IB9A 2ZEEA 1ARMA 4PPZA 3HUVA 3H8FA 3IEHA 3B35A 3FMCA 2QJ8A 4X8IA 4IHMA 3FVLA 3B3SA 3IO1A 3T8WA 4LQGA 4P4DA 1ZG8A 1CPSA 4FUUA 2NYQA 4YWYA 1XMBA 2IJZA 4GM5A 3SI0A 1UWYA 3IC1A 4RUHA 1CX8A 3LMSA 1ZLHA 1VHOA 1ZG9A 3D68A 5ELYA 4CPAA 1F2PA 4NGTA 3WC5A 1QMUA 2C1CA 3S9LA 3H8EA 3PFEA 2O4HA 4JYWA 3BHXA 4H2KA 4F9VA 2I3CA 4ZX8A 1FT7A 3FECA 4MMOA 4PXBA 4P10A 4YU9A 3WC6A 4P6YA 4PQAA 3GLJA 3VATA 3KQXA 2BCOA 5CPAA 3V7ZA 2ANPA 3PB7X 1F57A 4MHPA 4OMEA 4A94A 4FAIA 3S9NA 1LCPA 4MHYA 3BI1A 3CDXA 3NA6A 6CPAA 3IWWA 2QVPA 2C6PA 4TWEA 1KWMA 2PCUA 4IK2A 4MHNA 1LAPA 5K8OA 2C6GA 4ZY1A 1TF9A 1ELLP 3K2KA 4NGSA 1F2OA 2V8VA 5JM6A 3GB0A 1TKHA 2ZOGA 4A38A 2PJBA 2WZNA 3CT9A 3D67A 3SI2A 2JEWA 4BD9A 3DGVA 7CPAA 2GU2A 1ZG7A 1OBRA 1YSJA 2PJ2A 4ZY2A 3ISXA 4R7MA 2J9AA 3KZWA 2PJAA 3KL9A 2CTBA 3KR5A 1XJOA 4UEEA 2OOTA 2GLFA 3VARA 3KQZA 4R6TA 1QQ9A 5K8PA 4NGPA 3VH9A 1XFOA 4A39A 1HDUA 3BXMA 3JRUA 2AFSA 3N5FA 4UEFA 1XRYA 4WWVA 1CG2A 3IIBA 4MCRA 4OC0A 2PJ8A 2ZEMA 1Q7LA 2CF4A 4UIBA 3B7IA 3MRUA 4FBEA 3ISZA 3KI9A 4PXDA 2WYRA 2ZEGA 4UIAA 5HVHA 1TXRA 2HB6A 4P4JA 4UEZA 3S9MA 4NFRA 1XBUA 3B2YA 1AYEA 4EWTA 3D7DA 2PIZA 1DE4C 1TKFA 1JQGA 3PB8X 1LFWA 5DS0A 3PBBA 3WC7A 4ONWA 4TNUA 3NH5A 3GUXA 2PRQA 3PRTA 5HXDA 3SJFA 2ZEDA 1YW6A 3B3VA 4P45A 1ARLA 4MCSA 5CBMA 2AFUA 3L2NA 2VL1A 4MXUA 2ZEHA 4DYOA 2PE3A 2AFZA 2ABZA 2GREA 2V8GA 5D8NA 2NSMA 4NGRA 1CP7A 4P4BA 4OC5A 4OIWA 3FX6A 2ZEPA 2PVWA 3KASA 1Y7EA 2XEIA 3V38A 2AFXA 3FH4A 2PIYA 4OC4A 4EFDA
chains in the Genus database with same CATH superfamily
2PR8A 3E1YE 2Y0MA 3RO0A 1EWYA 2VJIA 1VGYA 3A3BA 1T6ZA 4C68A 3OEEA 2BGIA 4RN7A 3QFSA 2POKA 4UFVA 1PYTB 2XEJA 4II3A 2K5TA 4OOXA 4F0YA 4UCPA 4Q36A 1VJSA 2V7UA 4F8ZA 3CXPA 4RD1A 4AC9A 1Z8LA 4MCQA 1PCAA 4P44A 3ZIAA 3VR6A 4B4DA 2F1MA 3CTAA 1XB2A 3ONUA 2B3UA 4U9UA 1LAMA 4P4EA 4ZBGA 4LQ6A 2W6IA 2XGJA 4X05A 2ZXHA 2BF4A 4X7EA 4RD3A 4OADA 1XE4A 4P12A 3WT4A 2VNIA 3VMFA 4JXQA 1KK2A 4B3GA 2XNCA 3FYNA 4ZCIA 3LODA 5J1QA 2ZL5A 3SXOA 1IJFA 3I55B 3G8WA 3HLPA 1CNEA 3U6BA 4R3KA 3KGQA 3OEHA 4TMTA 4X3RA 2QYVA 2DEAA 2PVVA 5F09A 2BM1A 1MJ9A 2FSRA 3TOAA 1IJEA 1AIPA 2BM0A 2B58A 1BO4A 4DNCA 2J8RA 3WR7A 1LANA 4R8FA 1ZO0A 1VQOB 4TKOB 3CCQB 3QNVA 1QSOA 4XQFA 5TR9A 3T51B 4BINA 1S3ZA 5LYLA 1Y0YA 4LX9A 4B5PB 4QFMA 2RB7A 3JQPA 3TX8A 4R57A 2C78A 2B4BA 5DN6A 4Q38A 4RJLA 2BOAA 1OGIA 1T6YA 4OP7A 5IB0A 3A8KA 1I1DA 4R76A 1EP2B 2OYNA 4P3YA 4XNHC 2D9RA 3D26A 1Q2CA 5C88A 4O23A 4F9UA 4UCNA 3FXTA 1NB9A 2Z3OA 2Q51A 4WJBA 1G7CA 2QA4B 4CGMA 2ZXVA 3WABA 1QUFA 4B6ZA 1M4IA 1X10A 4GS4A 4OC2A 2EK8A 2VBQA 4Q7AA 2VEZA 3PFOA 3IJ3A 3W6SA 3IWEA 3CCLB 2CXAA 1ZM2A 3G3SA 2VI7A 3RAMA 3TOBA 1CBXA 5AG7A 2ZBVA 4KS9A 3B3TA 3DDYA 4FWTA 4ZI6A 3SHPA 3FJUA 4PC1A 1A2ZA 5HXBA 5HMNA 4J3GA 3GSIA 5I4MA 1ELMP 2PR1A 4MRIA 4DUKA 1VQ9B 4X06A 1TLLA 1K9MD 3WNBA 1CNFA 1FNDA 4NGMA 1P4MA 2C27A 5LMZA 4UZEA 1B6BA 3ASQA 4CRYB 3BNWA 1XE1A 5FO1A 2FXFA 3NH8A 3I1FA 4UF4A 1W34A 1CPXA 1U6MA 3CW2A 3LQ6A 4YEJA 2G3TA 1IU8A 2KVOA 2ZL6A 2PJCA 2O28A 4ACAA 4HKFA 2OR4A 4G1PA 2DETA 2P6FA 4Y49C 2XEFA 3OKXA 2DY1A 2XNJA 2ZEEA 5A28A 1ARMA 4HPSA 2DXQA 4KKSA 2PMDA 1Y9KA 3H5ZA 4CAXA 4X8IA 4YAFA 3FVLA 3B3SA 4M0LA 4JJXA 2ZITA 4HE5A 4WZLA 4FUUA 1OB0A 2GFQA 2OZGA 2NYQA 4I49A 4PSWA 4BPRA 2QGGA 2V7TA 2VBSA 1YHQB 1VQPB 1U2RA 3IC1A 3CC4B 2C5HA 2PDOA 4RUHA 4ROXA 4XONA 2ZW7A 1OB5A 2C1CA 3H8EA 3NE7A 3PFEA 3A9LA 3P27A 2O4HA 2YGWA 4QV2A 4H2KA 1BX1A 2F43A 4KZTA 4CAEA 1QFYA 3ZZUA 4P10A 3WC6A 5KTCA 2ZZFA 3OZWA 5JBQA 4KSFA 4Z4WA 4PQAA 3GLJA 5CPAA 1GVHA 3V7ZA 5AN9A 1F57A 3DSBA 4L8JA 3I3GA 4CYOA 4OOSA 1KUVA 6CPAA 3IWWA 4A33A 4G7XA 2R9VA 4PSXA 1IB0A 5C82A 5K8OA 3B78A 1ZUNB 4NF1A 3G71B 4CRZB 4NGSA 3QFTA 1QGAA 1YGHA 3GB0A 2ZOGA 4C0SA 3OJWA 2WZNA 1FDRA 2QE7A 1T6XA 2B4DA 1IYKA 4IF5A 3HAGA 5KTAA 1S7FA 1ZG7A 1YSJA 4TSFA 4LC0A 4RM0A 3ISXA 4R9MA 2GANA 2VYQA 1GHEA 2R98A 4WZEA 3TO6A 1COWA 1Q2YA 1XJOA 2HLDA 4M6GA 3ONYA 2GLFA 2WZPP 4A95A 2AHOA 3A8IA 3W2EA 3VARA 5FNZA 4R6TA 3CCJB 3NE5B 2QMLA 4A39A 3BXMA 1N07A 4UBRA 3JU4A 2AFSA 5G1ZA 2ARHA 3ES9A 4DNTB 5AGEA 4Z1MA 1W2BB 1QX4A 4KOXA 2FL4A 3TTHA 3KI9A 2WYRA 3S6HA 1TXRA 4Z4UA 2ODFA 4MFQA 4LBZA 4UEZA 3S9MA 2GJRA 1GJRA 2OTLB 2G3AA 1FNMA 4EWTA 1EP3B 4MFLA 1XIXA 1SQHA 1NDHA 3OFNA 1IICA 3S6FA 1BQEA 1HA3A 4RLZA 2WUUA 2DCUA 4KVXA 1LFWA 4B5PA 4XKVA 4ZCLA 4ONWA 2Z10A 1JB9A 2V7XA 4TNUA 2FIWA 1SKQA 2V7VA 3KEWA 3NH5A 2ATRA 4AVZA 4XPDB 4K1XA 2OBRA 1KJZA 3SJFA 2Q6OA 5H86A 2DF5A 4QHYA 1ARLA 4MCSA 3FKSA 1CQXA 2AFUA 3L2NA 3CCMB 1G7SA 4X07A 4KSAA 3CCUB 2CNTA 3JQRA 2ZEHA 5ISVA 2CNMA 3OZVA 3DR6A 2FE7A 1BMFA 4YAOA 4NGRA 1NRKA 1KK3A 5IK2A 1EFCA 4F6AA 1M90D 4ZV4A 3DR8A 2ZEPA 2ZXIA 4PC3A 3CCSB 1Y7EA 3FIXA 5EBVA 1VQ5B 3V38A 2RC4A 3FH4A 3R6JA 3GY9A 1Y7RA 4Y49B 2HCJB 3RNZA 3EFAA 4NJRA 4X5KA 2F7VA 3GVJA 2VXKA 3VNVA 2IQ6A 2OK7A 4Y7CA 1YI2B 3BY1A 2OTJB 3T90A 5J8CA 3CPWB 3QE2A 4CYNA 1R5BA 2Q0YA 4P2NA 4DK1A 3CB4A 4PC7A 4MYTA 1E1RA 1BOBA 2Z3LA 1FNBA 3WNDA 4RDJA 4FD6A 4KOSA 2FIAA 4YRHA 3A8JA 3K9TA 1VIXA 3PB6X 3QB8A 3SXNA 2VJJA 5E6TA 3LVBA 2X8KA 3FNCA 4MCPA 3WBJA 5I0CA 4C2YA 1E62A 2F4NA 2V4DA 2VNJA 2ZBUA 3BI0A 1B2RA 3UY5A 4QUZA 1OZPA 4NSQA 1LOKA 1RXTA 2VBUA 4C7IA 1VQMB 4NGQA 3PEIA 3DLJA 4PC6A 5HZAA 2H5MA 3T56B 2DPSA 5AG6A 3QAHA 4NNJA 5KW9A 4KVOE 3V76A 4CAFA 2B7CA 3AVYA 3FPKA 3BH4A 2PJ3A 3KKWA 2QN6A 3RZAA 1WORA 1BLIA 2BVNA 3CZXA 4R87A 3CRZA 3ZBUA 3ZC3A 2JBJA 3TFYA 3GIUA 4XOTA 4YAUA 2HMAA 4ZX9A 1QFJA 1VHSA 1QSRA 3FJOA 4G6IA 3D2PA 3Q6RA 5LYIA 5HVFA 4JWPA 4B11A 5G22A 1M44A 3H8GA 1EXMA 4UA3A 1D2EA 2HQYA 4BMHA 1CM0A 2ZZGA 2PJ4A 4KOWA 2C4TA 2D4OA 1H8LA 2VNHA 2JDCA 1R57A 1V5VA 1J9ZA 1TF8A 3KR4A 2Q43A 2LZJA 2PJ0A 2J8MA 2ZENA 5D29A 5K8MA 1BLLE 4AXVA 4OPVA 1KQSB 4UFXA 1SKYB 2PJ5A 2AFOA 2DPTA 1IHMA 2KCWA 3WNCA 5DWNA 2EWBA 1KRHA 2ZELA 1DDGA 3KHZA 5KNLA 3SJXA 2Q7SA 2CBXA 2XNDA 2NPFA 5JPHA 1N0VC 4RD6A 1FY7A 4G1BA 1UD2A 2W6JA 4WQMA 1PKVA 1YMEA 3A35A 1VQ7B 4HE6A 4GXHA 2OB0A 1HZEA 1R5NA 1P0HA 2FVGA 3N7ZA 4PXEA 4PC2A 1FNOA 1MABA 1Z2LA 1Y0RA 1GO2A 4NCZA 3CCVB 1EFUA 4KOUA 1QFZA 2E1BA 2GLJA 2Z0ZA 1R5OA 3PP9A 3TC8A 3TO7A 4TT3A 3I1UA 3QFRA 5GV8A 3Q38A 2RFHA 4OP4A 1OHHA 4UCMA 1SM4A 1YJNB 5IB9A 1Z4RA 3CP8A 4C43A 4X7DA 4LUAA 4ZGQB 3HUVA 1YJWB 3FMCA 2QJ8A 1NMTA 5BWAB 4LQGA 4P4DA 4Y9UA 1CPSA 4XLAA 3TCVA 3TO9A 3H4QA 1VLOA 3G4SB 1S5KA 4MY0A 2ZL7A 1XMBA 2IJZA 4GM5A 2JLMA 3SI0A 1WSRA 2QECA 1CX8A 3D68A 3ASSA 1ZG9A 1YR0A 1F2PA 1KC8D 3WC5A 2B5GB 1WP6A 3BHXA 4F9VA 2I3CA 1AMOA 4MMOA 3U2QA 1EFRA 5B6IA 2OU2A 4B44A 4QC6A 1KK0A 5F47A 1N71A 3KQXA 1Z8TA 3EO4A 3PB7X 4OMEA 3SJZA 1VQNB 3S9NA 4MI4A 4MHYA 1VQ8B 4RD4A 3CDXA 3NA6A 1XQBA 4NEXA 2QMUA 4PABA 2PCUA 5EMIA 4M6IA 1LAPA 3JVNA 2CW5A 2CY2A 1MJBA 4TMZA 2V8VA 5G20A 4RDKA 2PJBA 3CT9A 2OBTA 5GV7A 2Z3NA 2JEWA 3P2HA 2Q7BA 1WU8A 3DGVA 4X7FA 7CPAA 1N08A 1KZLA 4PK3A 4U9ZA 2GU2A 4XLCA 1I12A 1OBRA 3BC9A 2PJ2A 3I56B 1WDTA 4ZY2A 4UZFA 1Z8WA 4U5YA 4R7MA 4B13A 2J9AA 4RI1A 5HH1A 1Q2DA 4KOVA 2CTBA 1E43A 2BV3A 4UEEA 3F0AA 2OOTA 4P26A 5F46A 3W5VA 1H85A 3JQQA 4HNXB 3SKBA 4KUAA 4NGPA 2J8NA 2FX3A 1XFOA 1HDUA 1Q7YD 3OWCA 3WXMA 1ZM9A 1VLYA 5FIUA 2ZPAA 1CG2A 2Q6KA 3OJXA 2PJ8A 5TV2A 5F4JA 1M4DA 3MCAA 4XR6A 2WPXA 4FBEA 3B7IA 4X0CA 4P25A 2X6XA 2Q4VA 3H9NA 1S7KA 1UFHA 2BSWA 3W2HA 3PGPA 1W35A 3CXSA 3U6KA 4TMVA 4XOPA 3R1KA 1BJKA 2PIZA 1DE4C 1TKFA 3PB8X 3BJ7A 4MFJA 3VWEA 3PUNA 1Q9SA 1PUAA 5IV0A 5DS0A 3T53B 4YAWA 5IYRA 3R9EA 4AVCA 1TVCA 5HXDA 4QVTA 3OAAA 2Z6BD 5IYPA 1YW6A 5CBMA 4KUBA 4HNWB 2ZZEA 2VL1A 3ASRA 3CP2A 3C26A 1M4GA 4NXYA 2Q6LA 3W91A 2D74A 4DYOA 1KUYA 2PSWA 1KZFA 2ABZA 2C77A 1VQ6B 2QIRA 4RCYA 2NSMA 4ONUA 2BUEA 3LNNA 2G0BA 3W5HA 4P4BA 1WPCA 3V7AA 4OC5A 3FX6A 1S0UA 2PVWA 3DNSA 4PK2A 3KASA 2X3UA 4E2AA 2XEIA 2R1IA 1QSNA 2QTLA 2C6CA 4CQJA 4XM3A 5A8AA 2DOGA 2YNCA 1WSVA 4OAEA 1R43A 2A4NA 3IFEA 3D66A 5J3OA 1QVGB 1NB0A 1ZLIA 4XMYA 2CTCA 3LD2A 4JZ0A 1ELOA 4M6HA 1QGYA 2HC9A 4MHDA 4PGOA 4JMQA 1Q82D 4UFWA 2XZPA 5DSZA 1HDQA 3PBEA 2YNDA 3K9UA 4Z4YA 2AFWA 3P2FA 3CPXA 4UZUA 5K8NA 2OZHA 1PJ7A 3ZPNA 1BPLA 1BPNA 1S60A 2PJ7A 1CJWA 4KSIA 3TE4A 3SLDA 1M4LA 2XEGA 3H94A 4A31A 4B48A 3BCFA 4OIDA 4XNHB 1WK4A 4G5GA 1F60A 4P4FA 4A32A 3D8PA 3R6KA 3CC2B 2I00A 3D7GA 4EVYA 4P1VA 2CC2A 2B5OA 4OC3A 4ZGNB 4XLEA 4B47A 3LO8A 1ZM3A 3CPAA 3W2FA 1IOFA 2EUIA 1KTVA 4OC1A 2Q44A 2D4PA 3PVDA 1S72B 2F8HA 1N06A 3D7HA 3Q6QA 3IWGA 1JNYA 3QSYA 3FEDA 3AVWA 1D1NA 1H8HA 3CC7B 1NJID 2BSAA 4PXCA 3MN8A 2VZLA 4YELA 3SI1A 4QUSA 1HVXA 4B10A 4C7HA 1YLOA 4EMEA 1NSAA 2ZTNA 2CIJA 2Z3MA 4CS0B 1I7PA 2PJ9A 4B12A 1IY7A 5G21A 2VQYA 4NGNA 1RTQA 1VHEA 5F4OA 4TMXA 1FRQA 1K73D 1X12A 4XN3A 4M4SA 1BPMA 2JDIA 4MHZA 2JBKA 2REFA 2AFMA 4Z65A 4C2XA 2V8HA 5A27A 4B3FX 4W9YA 5TRDA 3KHXA 3A3GA 5CDFA 2HUZA 1PJ6A 2X85A 1OGJA 3CXQA 3BJ8A 2ZEOA 3CXCB 4XLFA 4II2A 5GCNA 4QVJA 4H6UA 4RPBA 1TIQA 2PIAA 4MYUA 2VZZA 2V7WA 2FS5A 3D7FA 3ZBTA 4CGPA 5TY0A 3WQZA 1VQKB 2D3LA 4F7DA 1EE3P 4IUSA 3W2IA 3Q3AA 4RPDA 2GK7A 4Y9RA 4HNYB 2EK9A 3JUWA 2Z3KA 4AG7A 4M53A 4IAVA 2X6YA 3G6EB 4XKWA 4PPZA 2OZUA 3R9FA 4IW3B 1W9XA 1TTTA 3H8FA 1Z8XA 3IEHA 1WWZA 3I9SA 3B35A 4JLYA 3R9GA 2C5BA 1YIJB 4XN0A 4OOVA 4CGNA 3R95A 3IO1A 3T8WA 2WJYA 1Q81D 2ZW5A 4QVAA 5IYNA 4FN5A 1S7LA 1KUXA 2IL4A 1QSTA 2Z3PA 2ZZQA 4H9GA 4RD2A 4FD5A 3LACA 5J35A 5EMNA 5ELYA 4CPAA 4E0FA 5H59A 2EVNA 1QVFB 4NGTA 3WY9A 4CAWA 1LRZA 2F5IA 3IGRA 4ZX8A 1FT7A 4PXBA 1G7RA 3ZZ0A 4XNFA 5L46A 2PRBA 3WBKA 2PQ8A 3GQBA 3VATA 3BLNA 1GR1A 4XPKA 4YFJA 4MHPA 4C2ZA 4FAIA 1LCPA 2GPJA 4XL9A 3BI1A 2C4UA 5EC4A 4P22A 4QBJA 2QVPA 2C6PA 4TWEA 1KWMA 4MHNA 3OZUA 2C6GA 4ZY1A 1TF9A 2XEXA 1ELLP 4H89A 4CYQA 4KOTA 3K2KA 1UD6A 1F2OA 1JA1A 2BPOA 3R96A 2P3MA 1TKHA 1S4MA 2RC5A 4AG9A 3ASTA 4XLHA 2FT0A 2REEA 4YGOA 1FNCA 5IYQA 4R71A 4AVBA 4P3IA 2EBJA 2GQFA 1M1DA 3E20A 3KR5A 3CMMA 2B4DB 1JWQA 4PAAA 4M3SA 3ZUGA 4OPSA 1UD3A 4NBSA 3VH9A 4KKUA 3GKRA 1EP1B 1F20A 2CNSA 4KOYA 1QG0A 1VQ4B 1Y9WA 1XRYA 4MCRA 2ZEMA 1RQPA 1FRNA 1NE9A 3MMPA 3MRUA 4PXDA 2ZEGA 4UIAA 1QH0A 2HB6A 4HIZA 3IU1A 4P4JA 4F0XA 4NFRA 2CRVA 1AYEA 2DEUA 3D7DA 4AF6A 2JN9A 2QTZA 1JQGA 3OE7A 1QSMA 2EO8A 3AGPA 2GJPA 3WC7A 1UD8A 1G7TA 4U9YA 2P6EA 3P26A 1N8RD 2X6WA 3PRTA 4GQNA 4JXRA 4FXUA 4ZCMA 2ZEDA 3B3VA 4Q7JB 4ACBA 3B82A 4P9SA 1YVOA 1YK3A 2I79A 4TN1A 3DDDA 3PA1A 4MXUA 4KVME 4J0QA 2AFZA 4KLWA 2GREA 1YQEA 4CGOA 5D8NA 3B8HA 2WPWA 1CP7A 1KK1A 3VO2A 4OIWA 2F1LA 1UMKA 1WOSA 1T5EA 2C2WA 2OBSA 3CMEB 1DG1G 2P6GA 1I18A 4N3NA 3VWDA 4X7CA 4OC4A 5F48A 4EFDA 8CPAA 3GVLA 3BQJA 1UD4A 2R7HA 2OH1A 3AVUA 3PB9X 4DK0A 4XPDC 4K3NA 5JH9A 3CESA 5A89A 4MY3A 3SJEA 4AB7A 3OP1A 1YITB 3S6GA 2XOKA 2WJVA 3PB4X 3LQEA 1DDIA 3SJPA 4OKOA 2D3NA 5FO0A 2Z11A 1W87A 3W2GA 1ZM4A 5LRGA 3VO1A 2PC1A 3EXNA 2O53A 5DWMA 2WSSA 3CCEB 2P0WA 1IGBA 1TUIA 1W0KA 5JGFA 5A88A 3RYOA 2V8DA 1B87A 4B5OA 2Q4YA 4K30A 4MFPA 3B8GA 5HZBA 4R3LA 3QFCA 4M1KA 4KLVA 2V77A 4WZKA 1A8PA 1YX2A 4DNRB 3GYAA 1JA0A 4Z4VA 2Q04A 3LWUA 4KORA 1VKCA 2B3VA 1RO5A 1NSLA 3T9YA 2Q4ZA 5H84A 3A1PA 4EH1A 2NV4A 3RBUA 4KKTA 1YX0A 4LBWA 4LBVA 2I1LA 1KMHA 3FEEA 1DTDA 3OPOA 1NBMA 2R8VA 2VNKA 1HEEA 3FBUA 4G1VA 4ZY0A 1AUGA 5LYFA 2ZEFA 1N05A 4L89A 5THWA 1QGZA 1PU9A 2ZW4A 5KSWB 2PJ1A 5CNPA 1GAQA 1K4JA 2M5SA 1Q86D 1WOPA 3OW7A 1WTHD 2QDXA 3FPPA 1AMPA 1XEBA 1XMTA 2OK8A 4ZYQA 1GYTA 2JEVA 4AVAA 4LBYA 5FL7A 1I21A 3ASPA 3B3WA 3D4UA 2QEXB 4XD7A 2JJ2A 1FX0A 4Z4SA 1B23P 3ZZTA 1CP6A 5FVJA 4BBHA 3EY5A 1V0FA 4MFZA 3WYAA 2BL1A 4DJLA 2AE6A 3GIRA 4NCNA 3F5BA 2G9DA 2ZTGA 1BAVA 2WSAA 2ZOFA 3Q39A 4A30A 1YW4A 2BO9A 5BSYA 3S6KA 5LYDA 3SLNA 3AVTA 1TKJA 4NJQA 3IU2A 1IOIA 2PJ6A 5LRJA 4RCZA 4P4IA 3FB3A 1RQRA 3NH4A 4WZTA 3VNUA 4MBUA 3D2MA 1Z5RA 4E8OA 4TMWA 1Z9UA 5HVGA 3B3CA 3SEJA 4A37A 1R3NA 1IB1E 2X0KA 1Z4EA 4FWUA 1W0JA 4FD7A 2EIXA 1V0EA 4Z4RA 1PJ5A 2YWEA 1N0UA 3FF3A 2DERA 2XZLA 2X7BA 3SJGA 4X2TA 2YWGA 5AG5A 4M2LA 1BX0A 3NFZA 2V7QA 2DYIA 5LRKA 3PUMA 2IMOA 1OB2A 1QUEA 1VQLB 3F8KA 2ZW6A 3D3SA 2V31A 3TT2A 2B5GA 4IHMA 2BMWA 4OPOA 1ZG8A 2JJ1A 1WOOA 2Q6IA 4YWYA 2YNCC 3W6XA 4L8AA 1YLEA 1UWYA 3LMSA 2EFGA 1ZLHA 1VHOA 4ASUA 1E1QA 3NE8A 1QMUA 3GVKA 3S9LA 1YREA 1I8DA 4DQLA 4JYWA 2XZOA 1D8TA 2FCKA 1M1KD 2HV2A 2JDDA 2GK6A 1L0CA 3FECA 5IX3A 4CGLA 1MK4A 4YU9A 1E3XA 4P6YA 4RDLA 2R6HA 1KD1D 3J81k 4B43A 2BCOA 1GAWA 1EFTA 2ANPA 2CNDA 4A94A 3AVVA 3CMAB 1H42A 2PLFA 1XOVA 5IYWA 5THXA 2BGJA 4IK2A 4CYPA 3CD6B 3ZJ0A 3AVXA 3AGQA 5JM6A 5JQ4A 4A38A 1S7NA 4G7WA 1E63A 2AJ6A 2WR8A 4FD4A 4QB9A 4RD0A 3D67A 2YWFA 3SI2A 2GJKA 4BD9A 4AF7A 4N3GA 4FK8A 3BCDA 3RY8A 5J8FA 4PV6A 3CCRB 5F49A 4YALA 1P4NA 2JIZA 5H5JA 3KZWA 2PJAA 3KL9A 5F4MA 2J7KA 3MHPA 4JD6A 1E79A 1YJ9B 1JJ2B 2GIVA 3KQZA 1QQ9A 3EC4A 5K8PA 2RC6A 5BSXA 3JRUA 4YHBA 3N5FA 5E96A 3G05A 4UEFA 4II9A 4WWVA 3BY2A 4CAVA 1XF8A 4Z4ZA 4A2ZA 4UWJA 3IIBA 4OC0A 1MRZA 1Q7LA 2NMTA 4XPLA 1J4JA 2CF4A 4UIBA 3ISZA 3JTKA 1MJAA 5HVHA 4B14A 4H6ZA 4M85A 4MFKA 2B7BA 1XBUA 3B2YA 2YWHA 5AG4A 3OOCA 1K8AD 3E0KA 2YNEA 2VBVA 4OLLA 4Z4TA 1ON0A 2X53S 2CK3A 3PBBA 4DQKA 5FA6A 3V8IA 1YVKA 3GUXA 2PRQA 3PA2A 4UWIA 1V0CA 2E1RA 3W5UA 3QAYA 1UD5A 2WPDA 4P45A 1IYLA 4XORA 3PENA 4RS2A 4MJ8A 1E3ZA 1K28D 4E0AA 2PE3A 1IIDA 3MGDA 1H8EA 5HKKA 2V8GA 2HDNB 4UAJA 1VF7A 3FRMA 4P6VF 4ORFA 1DARA 4YXWA 1E64A 3PZJA 5KTDA 4B3XA 2GE3A 3ZZIA 2BEIA 4ZGYB 2DIEA 2VZYA 2VBTA 2AFXA 3OW2B 2PIYA 2BN4A
chains in the Genus database with same CATH topology
8CPAA 2C6CA 1VGYA 4NJRA 1R43A 3IFEA 2F7VA 3D66A 3PB9X 2IQ6A 2POKA 4K3NA 1PYTB 5JH9A 1ZLIA 2XEJA 2CTCA 4JZ0A 3SJEA 4F8ZA 2HC9A 3PB4X 1Z8LA 4MCQA 4OKOA 1PCAA 4P44A 3PBEA 1HDQA 5LRGA 2AFWA 3CPXA 2O53A 5K8NA 1LAMA 4P4EA 3K9TA 1IGBA 1VIXA 3PB6X 1BPNA 5JGFA 2PJ7A 2V8DA 4MCPA 3WT4A 4KSIA 1M4LA 3BI0A 2XEGA 2V77A 5J1QA 4OIDA 4P4FA 1LOKA 4NGQA 3D7GA 3LWUA 3PEIA 3DLJA 3HLPA 3KGQA 4OC3A 4X3RA 2QYVA 2Q4ZA 2DEAA 2PVVA 3RBUA 5F09A 3CPAA 2PJ3A 4OC1A 3FEEA 1DTDA 3RZAA 1LANA 1HEEA 4R8FA 4ZY0A 2F8HA 5LYFA 2ZEFA 3D7HA 2JBJA 5THWA 3QNVA 4ZX9A 3FEDA 2PJ1A 5LYLA 1Y0YA 2RB7A 3TX8A 4PXCA 3MN8A 5LYIA 5HVFA 2BOAA 1AMPA 3SI1A 3H8GA 4ZYQA 1YLOA 1GYTA 4EMEA 1NSAA 4R76A 2CIJA 2PJ4A 1H8LA 3B3WA 3D4UA 4O23A 4F9UA 1TF8A 3KR4A 2Q43A 2PJ9A 1CP6A 2PJ0A 1IY7A 2Q51A 2ZENA 5D29A 4NGNA 5K8MA 4WJBA 1RTQA 1BLLE 4AXVA 1VHEA 3WABA 4DJLA 2PJ5A 4B6ZA 2AFOA 1BPMA 4OC2A 2G9DA 2EK8A 4Q7AA 4MHZA 2EWBA 1BAVA 2JBKA 2ZELA 3PFOA 2AFMA 2ZOFA 3IJ3A 3KHZA 4Z65A 1YW4A 2BO9A 3SJXA 3RAMA 1CBXA 2V8HA 5LYDA 4W9YA 3KHXA 1TKJA 3B3TA 4NJQA 4ZI6A 2PJ6A 5LRJA 3FJUA 1YMEA 4P4IA 3NH4A 5I4MA 1ELMP 4MRIA 2ZEOA 4DUKA 1Z5RA 2FVGA 5HVGA 3B3CA 4PXEA 4A37A 4NGMA 1R3NA 1FNOA 1Z2LA 1Y0RA 4FWUA 3D7FA 3NH8A 4UF4A 3FF3A 1CPXA 1EE3P 2GLJA 3SJGA 4X2TA 2PJCA 3TC8A 2OR4A 3NFZA 3I1UA 2EK9A 4G1PA 5LRKA 2RFHA 2XEFA 4IAVA 4OP4A 2IMOA 5IB9A 2ZEEA 1ARMA 4PPZA 3HUVA 3H8FA 3IEHA 3B35A 3FMCA 2QJ8A 4X8IA 4IHMA 3FVLA 3B3SA 3IO1A 3T8WA 4LQGA 4P4DA 1ZG8A 1CPSA 4FUUA 2NYQA 4YWYA 1XMBA 2IJZA 4GM5A 3SI0A 1UWYA 3IC1A 4RUHA 1CX8A 3LMSA 1ZLHA 1VHOA 1ZG9A 3D68A 5ELYA 4CPAA 1F2PA 4NGTA 3WC5A 1QMUA 2C1CA 3S9LA 3H8EA 3PFEA 2O4HA 4JYWA 3BHXA 4H2KA 4F9VA 2I3CA 4ZX8A 1FT7A 3FECA 4MMOA 4PXBA 4P10A 4YU9A 3WC6A 4P6YA 4PQAA 3GLJA 3VATA 3KQXA 2BCOA 5CPAA 3V7ZA 2ANPA 3PB7X 1F57A 4MHPA 4OMEA 4A94A 4FAIA 3S9NA 1LCPA 4MHYA 3BI1A 3CDXA 3NA6A 6CPAA 3IWWA 2QVPA 2C6PA 4TWEA 1KWMA 2PCUA 4IK2A 4MHNA 1LAPA 5K8OA 2C6GA 4ZY1A 1TF9A 1ELLP 3K2KA 4NGSA 1F2OA 2V8VA 5JM6A 3GB0A 1TKHA 2ZOGA 4A38A 2PJBA 2WZNA 3CT9A 3D67A 3SI2A 2JEWA 4BD9A 3DGVA 7CPAA 2GU2A 1ZG7A 1OBRA 1YSJA 2PJ2A 4ZY2A 3ISXA 4R7MA 2J9AA 3KZWA 2PJAA 3KL9A 2CTBA 3KR5A 1XJOA 4UEEA 2OOTA 2GLFA 3VARA 3KQZA 4R6TA 1QQ9A 5K8PA 4NGPA 3VH9A 1XFOA 4A39A 1HDUA 3BXMA 3JRUA 2AFSA 3N5FA 4UEFA 1XRYA 4WWVA 1CG2A 3IIBA 4MCRA 4OC0A 2PJ8A 2ZEMA 1Q7LA 2CF4A 4UIBA 3B7IA 3MRUA 4FBEA 3ISZA 3KI9A 4PXDA 2WYRA 2ZEGA 4UIAA 5HVHA 1TXRA 2HB6A 4P4JA 4UEZA 3S9MA 4NFRA 1XBUA 3B2YA 1AYEA 4EWTA 3D7DA 2PIZA 1DE4C 1TKFA 1JQGA 3PB8X 1LFWA 5DS0A 3PBBA 3WC7A 4ONWA 4TNUA 3NH5A 3GUXA 2PRQA 3PRTA 5HXDA 3SJFA 2ZEDA 1YW6A 3B3VA 4P45A 1ARLA 4MCSA 5CBMA 2AFUA 3L2NA 2VL1A 4MXUA 2ZEHA 4DYOA 2PE3A 2AFZA 2ABZA 2GREA 2V8GA 5D8NA 2NSMA 4NGRA 1CP7A 4P4BA 4OC5A 4OIWA 3FX6A 2ZEPA 2PVWA 3KASA 1Y7EA 2XEIA 3V38A 2AFXA 3FH4A 2PIYA 4OC4A 4EFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8CPA A;  2C6C A;  1VGY A;  4NJR A;  1R43 A;  3IFE A;  2F7V A;  3D66 A;  3PB9 X;  2IQ6 A;  2POK A;  4K3N A;  1PYT B;  5JH9 A;  1ZLI A;  2XEJ A;  2CTC A;  4JZ0 A;  3SJE A;  4F8Z A;  2HC9 A;  3PB4 X;  1Z8L A;  4MCQ A;  4OKO A;  1PCA A;  4P44 A;  3PBE A;  1HDQ A;  5LRG A;  2AFW A;  3CPX A;  2O53 A;  5K8N A;  1LAM A;  4P4E A;  3K9T A;  1IGB A;  1VIX A;  3PB6 X;  1BPN A;  5JGF A;  2PJ7 A;  2V8D A;  4MCP A;  3WT4 A;  4KSI A;  1M4L A;  3BI0 A;  2XEG A;  2V77 A;  5J1Q A;  4OID A;  4P4F A;  1LOK A;  4NGQ A;  3D7G A;  3LWU A;  3PEI A;  3DLJ A;  3HLP A;  3KGQ A;  4OC3 A;  4X3R A;  2QYV A;  2Q4Z A;  2DEA A;  2PVV A;  3RBU A;  5F09 A;  3CPA A;  2PJ3 A;  4OC1 A;  3FEE A;  1DTD A;  3RZA A;  1LAN A;  1HEE A;  4R8F A;  4ZY0 A;  2F8H A;  5LYF A;  2ZEF A;  3D7H A;  2JBJ A;  5THW A;  3QNV A;  4ZX9 A;  3FED A;  2PJ1 A;  5LYL A;  1Y0Y A;  2RB7 A;  3TX8 A;  4PXC A;  3MN8 A;  5LYI A;  5HVF A;  2BOA A;  1AMP A;  3SI1 A;  3H8G A;  4ZYQ A;  1YLO A;  1GYT A;  4EME A;  1NSA A;  4R76 A;  2CIJ A;  2PJ4 A;  1H8L A;  3B3W A;  3D4U A;  4O23 A;  4F9U A;  1TF8 A;  3KR4 A;  2Q43 A;  2PJ9 A;  1CP6 A;  2PJ0 A;  1IY7 A;  2Q51 A;  2ZEN A;  5D29 A;  4NGN A;  5K8M A;  4WJB A;  1RTQ A;  1BLL E;  4AXV A;  1VHE A;  3WAB A;  4DJL A;  2PJ5 A;  4B6Z A;  2AFO A;  1BPM A;  4OC2 A;  2G9D A;  2EK8 A;  4Q7A A;  4MHZ A;  2EWB A;  1BAV A;  2JBK A;  2ZEL A;  3PFO A;  2AFM A;  2ZOF A;  3IJ3 A;  3KHZ A;  4Z65 A;  1YW4 A;  2BO9 A;  3SJX A;  3RAM A;  1CBX A;  2V8H A;  5LYD A;  4W9Y A;  3KHX A;  1TKJ A;  3B3T A;  4NJQ A;  4ZI6 A;  2PJ6 A;  5LRJ A;  3FJU A;  1YME A;  4P4I A;  3NH4 A;  5I4M A;  1ELM P;  4MRI A;  2ZEO A;  4DUK A;  1Z5R A;  2FVG A;  5HVG A;  3B3C A;  4PXE A;  4A37 A;  4NGM A;  1R3N A;  1FNO A;  1Z2L A;  1Y0R A;  4FWU A;  3D7F A;  3NH8 A;  4UF4 A;  3FF3 A;  1CPX A;  1EE3 P;  2GLJ A;  3SJG A;  4X2T A;  2PJC A;  3TC8 A;  2OR4 A;  3NFZ A;  3I1U A;  2EK9 A;  4G1P A;  5LRK A;  2RFH A;  2XEF A;  4IAV A;  4OP4 A;  2IMO A;  5IB9 A;  2ZEE A;  1ARM A;  4PPZ A;  3HUV A;  3H8F A;  3IEH A;  3B35 A;  3FMC A;  2QJ8 A;  4X8I A;  4IHM A;  3FVL A;  3B3S A;  3IO1 A;  3T8W A;  4LQG A;  4P4D A;  1ZG8 A;  1CPS A;  4FUU A;  2NYQ A;  4YWY A;  1XMB A;  2IJZ A;  4GM5 A;  3SI0 A;  1UWY A;  3IC1 A;  4RUH A;  1CX8 A;  3LMS A;  1ZLH A;  1VHO A;  1ZG9 A;  3D68 A;  5ELY A;  4CPA A;  1F2P A;  4NGT A;  3WC5 A;  1QMU A;  2C1C A;  3S9L A;  3H8E A;  3PFE A;  2O4H A;  4JYW A;  3BHX A;  4H2K A;  4F9V A;  2I3C A;  4ZX8 A;  1FT7 A;  3FEC A;  4MMO A;  4PXB A;  4P10 A;  4YU9 A;  3WC6 A;  4P6Y A;  4PQA A;  3GLJ A;  3VAT A;  3KQX A;  2BCO A;  5CPA A;  3V7Z A;  2ANP A;  3PB7 X;  1F57 A;  4MHP A;  4OME A;  4A94 A;  4FAI A;  3S9N A;  1LCP A;  4MHY A;  3BI1 A;  3CDX A;  3NA6 A;  6CPA A;  3IWW A;  2QVP A;  2C6P A;  4TWE A;  1KWM A;  2PCU A;  4IK2 A;  4MHN A;  1LAP A;  5K8O A;  2C6G A;  4ZY1 A;  1TF9 A;  1ELL P;  3K2K A;  4NGS A;  1F2O A;  2V8V A;  5JM6 A;  3GB0 A;  1TKH A;  2ZOG A;  4A38 A;  2PJB A;  2WZN A;  3CT9 A;  3D67 A;  3SI2 A;  2JEW A;  4BD9 A;  3DGV A;  7CPA A;  2GU2 A;  1ZG7 A;  1OBR A;  1YSJ A;  2PJ2 A;  4ZY2 A;  3ISX A;  4R7M A;  2J9A A;  3KZW A;  2PJA A;  3KL9 A;  2CTB A;  3KR5 A;  1XJO A;  4UEE A;  2OOT A;  2GLF A;  3VAR A;  3KQZ A;  4R6T A;  1QQ9 A;  5K8P A;  4NGP A;  3VH9 A;  1XFO A;  4A39 A;  1HDU A;  3BXM A;  3JRU A;  2AFS A;  3N5F A;  4UEF A;  1XRY A;  4WWV A;  1CG2 A;  3IIB A;  4MCR A;  4OC0 A;  2PJ8 A;  2ZEM A;  1Q7L A;  2CF4 A;  4UIB A;  3B7I A;  3MRU A;  4FBE A;  3ISZ A;  3KI9 A;  4PXD A;  2WYR A;  2ZEG A;  4UIA A;  5HVH A;  1TXR A;  2HB6 A;  4P4J A;  4UEZ A;  3S9M A;  4NFR A;  1XBU A;  3B2Y A;  1AYE A;  4EWT A;  3D7D A;  2PIZ A;  1DE4 C;  1TKF A;  1JQG A;  3PB8 X;  1LFW A;  5DS0 A;  3PBB A;  3WC7 A;  4ONW A;  4TNU A;  3NH5 A;  3GUX A;  2PRQ A;  3PRT A;  5HXD A;  3SJF A;  2ZED A;  1YW6 A;  3B3V A;  4P45 A;  1ARL A;  4MCS A;  5CBM A;  2AFU A;  3L2N A;  2VL1 A;  4MXU A;  2ZEH A;  4DYO A;  2PE3 A;  2AFZ A;  2ABZ A;  2GRE A;  2V8G A;  5D8N A;  2NSM A;  4NGR A;  1CP7 A;  4P4B A;  4OC5 A;  4OIW A;  3FX6 A;  2ZEP A;  2PVW A;  3KAS A;  1Y7E A;  2XEI A;  3V38 A;  2AFX A;  3FH4 A;  2PIY A;  4OC4 A;  4EFD A; 
#chains in the Genus database with same CATH topology
 2PR8 A;  3E1Y E;  2Y0M A;  3RO0 A;  1EWY A;  2VJI A;  1VGY A;  3A3B A;  1T6Z A;  4C68 A;  3OEE A;  2BGI A;  4RN7 A;  3QFS A;  2POK A;  4UFV A;  1PYT B;  2XEJ A;  4II3 A;  2K5T A;  4OOX A;  4F0Y A;  4UCP A;  4Q36 A;  1VJS A;  2V7U A;  4F8Z A;  3CXP A;  4RD1 A;  4AC9 A;  1Z8L A;  4MCQ A;  1PCA A;  4P44 A;  3ZIA A;  3VR6 A;  4B4D A;  2F1M A;  3CTA A;  1XB2 A;  3ONU A;  2B3U A;  4U9U A;  1LAM A;  4P4E A;  4ZBG A;  4LQ6 A;  2W6I A;  2XGJ A;  4X05 A;  2ZXH A;  2BF4 A;  4X7E A;  4RD3 A;  4OAD A;  1XE4 A;  4P12 A;  3WT4 A;  2VNI A;  3VMF A;  4JXQ A;  1KK2 A;  4B3G A;  2XNC A;  3FYN A;  4ZCI A;  3LOD A;  5J1Q A;  2ZL5 A;  3SXO A;  1IJF A;  3I55 B;  3G8W A;  3HLP A;  1CNE A;  3U6B A;  4R3K A;  3KGQ A;  3OEH A;  4TMT A;  4X3R A;  2QYV A;  2DEA A;  2PVV A;  5F09 A;  2BM1 A;  1MJ9 A;  2FSR A;  3TOA A;  1IJE A;  1AIP A;  2BM0 A;  2B58 A;  1BO4 A;  4DNC A;  2J8R A;  3WR7 A;  1LAN A;  4R8F A;  1ZO0 A;  1VQO B;  4TKO B;  3CCQ B;  3QNV A;  1QSO A;  4XQF A;  5TR9 A;  3T51 B;  4BIN A;  1S3Z A;  5LYL A;  1Y0Y A;  4LX9 A;  4B5P B;  4QFM A;  2RB7 A;  3JQP A;  3TX8 A;  4R57 A;  2C78 A;  2B4B A;  5DN6 A;  4Q38 A;  4RJL A;  2BOA A;  1OGI A;  1T6Y A;  4OP7 A;  5IB0 A;  3A8K A;  1I1D A;  4R76 A;  1EP2 B;  2OYN A;  4P3Y A;  4XNH C;  2D9R A;  3D26 A;  1Q2C A;  5C88 A;  4O23 A;  4F9U A;  4UCN A;  3FXT A;  1NB9 A;  2Z3O A;  2Q51 A;  4WJB A;  1G7C A;  2QA4 B;  4CGM A;  2ZXV A;  3WAB A;  1QUF A;  4B6Z A;  1M4I A;  1X10 A;  4GS4 A;  4OC2 A;  2EK8 A;  2VBQ A;  4Q7A A;  2VEZ A;  3PFO A;  3IJ3 A;  3W6S A;  3IWE A;  3CCL B;  2CXA A;  1ZM2 A;  3G3S A;  2VI7 A;  3RAM A;  3TOB A;  1CBX A;  5AG7 A;  2ZBV A;  4KS9 A;  3B3T A;  3DDY A;  4FWT A;  4ZI6 A;  3SHP A;  3FJU A;  4PC1 A;  1A2Z A;  5HXB A;  5HMN A;  4J3G A;  3GSI A;  5I4M A;  1ELM P;  2PR1 A;  4MRI A;  4DUK A;  1VQ9 B;  4X06 A;  1TLL A;  1K9M D;  3WNB A;  1CNF A;  1FND A;  4NGM A;  1P4M A;  2C27 A;  5LMZ A;  4UZE A;  1B6B A;  3ASQ A;  4CRY B;  3BNW A;  1XE1 A;  5FO1 A;  2FXF A;  3NH8 A;  3I1F A;  4UF4 A;  1W34 A;  1CPX A;  1U6M A;  3CW2 A;  3LQ6 A;  4YEJ A;  2G3T A;  1IU8 A;  2KVO A;  2ZL6 A;  2PJC A;  2O28 A;  4ACA A;  4HKF A;  2OR4 A;  4G1P A;  2DET A;  2P6F A;  4Y49 C;  2XEF A;  3OKX A;  2DY1 A;  2XNJ A;  2ZEE A;  5A28 A;  1ARM A;  4HPS A;  2DXQ A;  4KKS A;  2PMD A;  1Y9K A;  3H5Z A;  4CAX A;  4X8I A;  4YAF A;  3FVL A;  3B3S A;  4M0L A;  4JJX A;  2ZIT A;  4HE5 A;  4WZL A;  4FUU A;  1OB0 A;  2GFQ A;  2OZG A;  2NYQ A;  4I49 A;  4PSW A;  4BPR A;  2QGG A;  2V7T A;  2VBS A;  1YHQ B;  1VQP B;  1U2R A;  3IC1 A;  3CC4 B;  2C5H A;  2PDO A;  4RUH A;  4ROX A;  4XON A;  2ZW7 A;  1OB5 A;  2C1C A;  3H8E A;  3NE7 A;  3PFE A;  3A9L A;  3P27 A;  2O4H A;  2YGW A;  4QV2 A;  4H2K A;  1BX1 A;  2F43 A;  4KZT A;  4CAE A;  1QFY A;  3ZZU A;  4P10 A;  3WC6 A;  5KTC A;  2ZZF A;  3OZW A;  5JBQ A;  4KSF A;  4Z4W A;  4PQA A;  3GLJ A;  5CPA A;  1GVH A;  3V7Z A;  5AN9 A;  1F57 A;  3DSB A;  4L8J A;  3I3G A;  4CYO A;  4OOS A;  1KUV A;  6CPA A;  3IWW A;  4A33 A;  4G7X A;  2R9V A;  4PSX A;  1IB0 A;  5C82 A;  5K8O A;  3B78 A;  1ZUN B;  4NF1 A;  3G71 B;  4CRZ B;  4NGS A;  3QFT A;  1QGA A;  1YGH A;  3GB0 A;  2ZOG A;  4C0S A;  3OJW A;  2WZN A;  1FDR A;  2QE7 A;  1T6X A;  2B4D A;  1IYK A;  4IF5 A;  3HAG A;  5KTA A;  1S7F A;  1ZG7 A;  1YSJ A;  4TSF A;  4LC0 A;  4RM0 A;  3ISX A;  4R9M A;  2GAN A;  2VYQ A;  1GHE A;  2R98 A;  4WZE A;  3TO6 A;  1COW A;  1Q2Y A;  1XJO A;  2HLD A;  4M6G A;  3ONY A;  2GLF A;  2WZP P;  4A95 A;  2AHO A;  3A8I A;  3W2E A;  3VAR A;  5FNZ A;  4R6T A;  3CCJ B;  3NE5 B;  2QML A;  4A39 A;  3BXM A;  1N07 A;  4UBR A;  3JU4 A;  2AFS A;  5G1Z A;  2ARH A;  3ES9 A;  4DNT B;  5AGE A;  4Z1M A;  1W2B B;  1QX4 A;  4KOX A;  2FL4 A;  3TTH A;  3KI9 A;  2WYR A;  3S6H A;  1TXR A;  4Z4U A;  2ODF A;  4MFQ A;  4LBZ A;  4UEZ A;  3S9M A;  2GJR A;  1GJR A;  2OTL B;  2G3A A;  1FNM A;  4EWT A;  1EP3 B;  4MFL A;  1XIX A;  1SQH A;  1NDH A;  3OFN A;  1IIC A;  3S6F A;  1BQE A;  1HA3 A;  4RLZ A;  2WUU A;  2DCU A;  4KVX A;  1LFW A;  4B5P A;  4XKV A;  4ZCL A;  4ONW A;  2Z10 A;  1JB9 A;  2V7X A;  4TNU A;  2FIW A;  1SKQ A;  2V7V A;  3KEW A;  3NH5 A;  2ATR A;  4AVZ A;  4XPD B;  4K1X A;  2OBR A;  1KJZ A;  3SJF A;  2Q6O A;  5H86 A;  2DF5 A;  4QHY A;  1ARL A;  4MCS A;  3FKS A;  1CQX A;  2AFU A;  3L2N A;  3CCM B;  1G7S A;  4X07 A;  4KSA A;  3CCU B;  2CNT A;  3JQR A;  2ZEH A;  5ISV A;  2CNM A;  3OZV A;  3DR6 A;  2FE7 A;  1BMF A;  4YAO A;  4NGR A;  1NRK A;  1KK3 A;  5IK2 A;  1EFC A;  4F6A A;  1M90 D;  4ZV4 A;  3DR8 A;  2ZEP A;  2ZXI A;  4PC3 A;  3CCS B;  1Y7E A;  3FIX A;  5EBV A;  1VQ5 B;  3V38 A;  2RC4 A;  3FH4 A;  3R6J A;  3GY9 A;  1Y7R A;  4Y49 B;  2HCJ B;  3RNZ A;  3EFA A;  4NJR A;  4X5K A;  2F7V A;  3GVJ A;  2VXK A;  3VNV A;  2IQ6 A;  2OK7 A;  4Y7C A;  1YI2 B;  3BY1 A;  2OTJ B;  3T90 A;  5J8C A;  3CPW B;  3QE2 A;  4CYN A;  1R5B A;  2Q0Y A;  4P2N A;  4DK1 A;  3CB4 A;  4PC7 A;  4MYT A;  1E1R A;  1BOB A;  2Z3L A;  1FNB A;  3WND A;  4RDJ A;  4FD6 A;  4KOS A;  2FIA A;  4YRH A;  3A8J A;  3K9T A;  1VIX A;  3PB6 X;  3QB8 A;  3SXN A;  2VJJ A;  5E6T A;  3LVB A;  2X8K A;  3FNC A;  4MCP A;  3WBJ A;  5I0C A;  4C2Y A;  1E62 A;  2F4N A;  2V4D A;  2VNJ A;  2ZBU A;  3BI0 A;  1B2R A;  3UY5 A;  4QUZ A;  1OZP A;  4NSQ A;  1LOK A;  1RXT A;  2VBU A;  4C7I A;  1VQM B;  4NGQ A;  3PEI A;  3DLJ A;  4PC6 A;  5HZA A;  2H5M A;  3T56 B;  2DPS A;  5AG6 A;  3QAH A;  4NNJ A;  5KW9 A;  4KVO E;  3V76 A;  4CAF A;  2B7C A;  3AVY A;  3FPK A;  3BH4 A;  2PJ3 A;  3KKW A;  2QN6 A;  3RZA A;  1WOR A;  1BLI A;  2BVN A;  3CZX A;  4R87 A;  3CRZ A;  3ZBU A;  3ZC3 A;  2JBJ A;  3TFY A;  3GIU A;  4XOT A;  4YAU A;  2HMA A;  4ZX9 A;  1QFJ A;  1VHS A;  1QSR A;  3FJO A;  4G6I A;  3D2P A;  3Q6R A;  5LYI A;  5HVF A;  4JWP A;  4B11 A;  5G22 A;  1M44 A;  3H8G A;  1EXM A;  4UA3 A;  1D2E A;  2HQY A;  4BMH A;  1CM0 A;  2ZZG A;  2PJ4 A;  4KOW A;  2C4T A;  2D4O A;  1H8L A;  2VNH A;  2JDC A;  1R57 A;  1V5V A;  1J9Z A;  1TF8 A;  3KR4 A;  2Q43 A;  2LZJ A;  2PJ0 A;  2J8M A;  2ZEN A;  5D29 A;  5K8M A;  1BLL E;  4AXV A;  4OPV A;  1KQS B;  4UFX A;  1SKY B;  2PJ5 A;  2AFO A;  2DPT A;  1IHM A;  2KCW A;  3WNC A;  5DWN A;  2EWB A;  1KRH A;  2ZEL A;  1DDG A;  3KHZ A;  5KNL A;  3SJX A;  2Q7S A;  2CBX A;  2XND A;  2NPF A;  5JPH A;  1N0V C;  4RD6 A;  1FY7 A;  4G1B A;  1UD2 A;  2W6J A;  4WQM A;  1PKV A;  1YME A;  3A35 A;  1VQ7 B;  4HE6 A;  4GXH A;  2OB0 A;  1HZE A;  1R5N A;  1P0H A;  2FVG A;  3N7Z A;  4PXE A;  4PC2 A;  1FNO A;  1MAB A;  1Z2L A;  1Y0R A;  1GO2 A;  4NCZ A;  3CCV B;  1EFU A;  4KOU A;  1QFZ A;  2E1B A;  2GLJ A;  2Z0Z A;  1R5O A;  3PP9 A;  3TC8 A;  3TO7 A;  4TT3 A;  3I1U A;  3QFR A;  5GV8 A;  3Q38 A;  2RFH A;  4OP4 A;  1OHH A;  4UCM A;  1SM4 A;  1YJN B;  5IB9 A;  1Z4R A;  3CP8 A;  4C43 A;  4X7D A;  4LUA A;  4ZGQ B;  3HUV A;  1YJW B;  3FMC A;  2QJ8 A;  1NMT A;  5BWA B;  4LQG A;  4P4D A;  4Y9U A;  1CPS A;  4XLA A;  3TCV A;  3TO9 A;  3H4Q A;  1VLO A;  3G4S B;  1S5K A;  4MY0 A;  2ZL7 A;  1XMB A;  2IJZ A;  4GM5 A;  2JLM A;  3SI0 A;  1WSR A;  2QEC A;  1CX8 A;  3D68 A;  3ASS A;  1ZG9 A;  1YR0 A;  1F2P A;  1KC8 D;  3WC5 A;  2B5G B;  1WP6 A;  3BHX A;  4F9V A;  2I3C A;  1AMO A;  4MMO A;  3U2Q A;  1EFR A;  5B6I A;  2OU2 A;  4B44 A;  4QC6 A;  1KK0 A;  5F47 A;  1N71 A;  3KQX A;  1Z8T A;  3EO4 A;  3PB7 X;  4OME A;  3SJZ A;  1VQN B;  3S9N A;  4MI4 A;  4MHY A;  1VQ8 B;  4RD4 A;  3CDX A;  3NA6 A;  1XQB A;  4NEX A;  2QMU A;  4PAB A;  2PCU A;  5EMI A;  4M6I A;  1LAP A;  3JVN A;  2CW5 A;  2CY2 A;  1MJB A;  4TMZ A;  2V8V A;  5G20 A;  4RDK A;  2PJB A;  3CT9 A;  2OBT A;  5GV7 A;  2Z3N A;  2JEW A;  3P2H A;  2Q7B A;  1WU8 A;  3DGV A;  4X7F A;  7CPA A;  1N08 A;  1KZL A;  4PK3 A;  4U9Z A;  2GU2 A;  4XLC A;  1I12 A;  1OBR A;  3BC9 A;  2PJ2 A;  3I56 B;  1WDT A;  4ZY2 A;  4UZF A;  1Z8W A;  4U5Y A;  4R7M A;  4B13 A;  2J9A A;  4RI1 A;  5HH1 A;  1Q2D A;  4KOV A;  2CTB A;  1E43 A;  2BV3 A;  4UEE A;  3F0A A;  2OOT A;  4P26 A;  5F46 A;  3W5V A;  1H85 A;  3JQQ A;  4HNX B;  3SKB A;  4KUA A;  4NGP A;  2J8N A;  2FX3 A;  1XFO A;  1HDU A;  1Q7Y D;  3OWC A;  3WXM A;  1ZM9 A;  1VLY A;  5FIU A;  2ZPA A;  1CG2 A;  2Q6K A;  3OJX A;  2PJ8 A;  5TV2 A;  5F4J A;  1M4D A;  3MCA A;  4XR6 A;  2WPX A;  4FBE A;  3B7I A;  4X0C A;  4P25 A;  2X6X A;  2Q4V A;  3H9N A;  1S7K A;  1UFH A;  2BSW A;  3W2H A;  3PGP A;  1W35 A;  3CXS A;  3U6K A;  4TMV A;  4XOP A;  3R1K A;  1BJK A;  2PIZ A;  1DE4 C;  1TKF A;  3PB8 X;  3BJ7 A;  4MFJ A;  3VWE A;  3PUN A;  1Q9S A;  1PUA A;  5IV0 A;  5DS0 A;  3T53 B;  4YAW A;  5IYR A;  3R9E A;  4AVC A;  1TVC A;  5HXD A;  4QVT A;  3OAA A;  2Z6B D;  5IYP A;  1YW6 A;  5CBM A;  4KUB A;  4HNW B;  2ZZE A;  2VL1 A;  3ASR A;  3CP2 A;  3C26 A;  1M4G A;  4NXY A;  2Q6L A;  3W91 A;  2D74 A;  4DYO A;  1KUY A;  2PSW A;  1KZF A;  2ABZ A;  2C77 A;  1VQ6 B;  2QIR A;  4RCY A;  2NSM A;  4ONU A;  2BUE A;  3LNN A;  2G0B A;  3W5H A;  4P4B A;  1WPC A;  3V7A A;  4OC5 A;  3FX6 A;  1S0U A;  2PVW A;  3DNS A;  4PK2 A;  3KAS A;  2X3U A;  4E2A A;  2XEI A;  2R1I A;  1QSN A;  2QTL A;  2C6C A;  4CQJ A;  4XM3 A;  5A8A A;  2DOG A;  2YNC A;  1WSV A;  4OAE A;  1R43 A;  2A4N A;  3IFE A;  3D66 A;  5J3O A;  1QVG B;  1NB0 A;  1ZLI A;  4XMY A;  2CTC A;  3LD2 A;  4JZ0 A;  1ELO A;  4M6H A;  1QGY A;  2HC9 A;  4MHD A;  4PGO A;  4JMQ A;  1Q82 D;  4UFW A;  2XZP A;  5DSZ A;  1HDQ A;  3PBE A;  2YND A;  3K9U A;  4Z4Y A;  2AFW A;  3P2F A;  3CPX A;  4UZU A;  5K8N A;  2OZH A;  1PJ7 A;  3ZPN A;  1BPL A;  1BPN A;  1S60 A;  2PJ7 A;  1CJW A;  4KSI A;  3TE4 A;  3SLD A;  1M4L A;  2XEG A;  3H94 A;  4A31 A;  4B48 A;  3BCF A;  4OID A;  4XNH B;  1WK4 A;  4G5G A;  1F60 A;  4P4F A;  4A32 A;  3D8P A;  3R6K A;  3CC2 B;  2I00 A;  3D7G A;  4EVY A;  4P1V A;  2CC2 A;  2B5O A;  4OC3 A;  4ZGN B;  4XLE A;  4B47 A;  3LO8 A;  1ZM3 A;  3CPA A;  3W2F A;  1IOF A;  2EUI A;  1KTV A;  4OC1 A;  2Q44 A;  2D4P A;  3PVD A;  1S72 B;  2F8H A;  1N06 A;  3D7H A;  3Q6Q A;  3IWG A;  1JNY A;  3QSY A;  3FED A;  3AVW A;  1D1N A;  1H8H A;  3CC7 B;  1NJI D;  2BSA A;  4PXC A;  3MN8 A;  2VZL A;  4YEL A;  3SI1 A;  4QUS A;  1HVX A;  4B10 A;  4C7H A;  1YLO A;  4EME A;  1NSA A;  2ZTN A;  2CIJ A;  2Z3M A;  4CS0 B;  1I7P A;  2PJ9 A;  4B12 A;  1IY7 A;  5G21 A;  2VQY A;  4NGN A;  1RTQ A;  1VHE A;  5F4O A;  4TMX A;  1FRQ A;  1K73 D;  1X12 A;  4XN3 A;  4M4S A;  1BPM A;  2JDI A;  4MHZ A;  2JBK A;  2REF A;  2AFM A;  4Z65 A;  4C2X A;  2V8H A;  5A27 A;  4B3F X;  4W9Y A;  5TRD A;  3KHX A;  3A3G A;  5CDF A;  2HUZ A;  1PJ6 A;  2X85 A;  1OGJ A;  3CXQ A;  3BJ8 A;  2ZEO A;  3CXC B;  4XLF A;  4II2 A;  5GCN A;  4QVJ A;  4H6U A;  4RPB A;  1TIQ A;  2PIA A;  4MYU A;  2VZZ A;  2V7W A;  2FS5 A;  3D7F A;  3ZBT A;  4CGP A;  5TY0 A;  3WQZ A;  1VQK B;  2D3L A;  4F7D A;  1EE3 P;  4IUS A;  3W2I A;  3Q3A A;  4RPD A;  2GK7 A;  4Y9R A;  4HNY B;  2EK9 A;  3JUW A;  2Z3K A;  4AG7 A;  4M53 A;  4IAV A;  2X6Y A;  3G6E B;  4XKW A;  4PPZ A;  2OZU A;  3R9F A;  4IW3 B;  1W9X A;  1TTT A;  3H8F A;  1Z8X A;  3IEH A;  1WWZ A;  3I9S A;  3B35 A;  4JLY A;  3R9G A;  2C5B A;  1YIJ B;  4XN0 A;  4OOV A;  4CGN A;  3R95 A;  3IO1 A;  3T8W A;  2WJY A;  1Q81 D;  2ZW5 A;  4QVA A;  5IYN A;  4FN5 A;  1S7L A;  1KUX A;  2IL4 A;  1QST A;  2Z3P A;  2ZZQ A;  4H9G A;  4RD2 A;  4FD5 A;  3LAC A;  5J35 A;  5EMN A;  5ELY A;  4CPA A;  4E0F A;  5H59 A;  2EVN A;  1QVF B;  4NGT A;  3WY9 A;  4CAW A;  1LRZ A;  2F5I A;  3IGR A;  4ZX8 A;  1FT7 A;  4PXB A;  1G7R A;  3ZZ0 A;  4XNF A;  5L46 A;  2PRB A;  3WBK A;  2PQ8 A;  3GQB A;  3VAT A;  3BLN A;  1GR1 A;  4XPK A;  4YFJ A;  4MHP A;  4C2Z A;  4FAI A;  1LCP A;  2GPJ A;  4XL9 A;  3BI1 A;  2C4U A;  5EC4 A;  4P22 A;  4QBJ A;  2QVP A;  2C6P A;  4TWE A;  1KWM A;  4MHN A;  3OZU A;  2C6G A;  4ZY1 A;  1TF9 A;  2XEX A;  1ELL P;  4H89 A;  4CYQ A;  4KOT A;  3K2K A;  1UD6 A;  1F2O A;  1JA1 A;  2BPO A;  3R96 A;  2P3M A;  1TKH A;  1S4M A;  2RC5 A;  4AG9 A;  3AST A;  4XLH A;  2FT0 A;  2REE A;  4YGO A;  1FNC A;  5IYQ A;  4R71 A;  4AVB A;  4P3I A;  2EBJ A;  2GQF A;  1M1D A;  3E20 A;  3KR5 A;  3CMM A;  2B4D B;  1JWQ A;  4PAA A;  4M3S A;  3ZUG A;  4OPS A;  1UD3 A;  4NBS A;  3VH9 A;  4KKU A;  3GKR A;  1EP1 B;  1F20 A;  2CNS A;  4KOY A;  1QG0 A;  1VQ4 B;  1Y9W A;  1XRY A;  4MCR A;  2ZEM A;  1RQP A;  1FRN A;  1NE9 A;  3MMP A;  3MRU A;  4PXD A;  2ZEG A;  4UIA A;  1QH0 A;  2HB6 A;  4HIZ A;  3IU1 A;  4P4J A;  4F0X A;  4NFR A;  2CRV A;  1AYE A;  2DEU A;  3D7D A;  4AF6 A;  2JN9 A;  2QTZ A;  1JQG A;  3OE7 A;  1QSM A;  2EO8 A;  3AGP A;  2GJP A;  3WC7 A;  1UD8 A;  1G7T A;  4U9Y A;  2P6E A;  3P26 A;  1N8R D;  2X6W A;  3PRT A;  4GQN A;  4JXR A;  4FXU A;  4ZCM A;  2ZED A;  3B3V A;  4Q7J B;  4ACB A;  3B82 A;  4P9S A;  1YVO A;  1YK3 A;  2I79 A;  4TN1 A;  3DDD A;  3PA1 A;  4MXU A;  4KVM E;  4J0Q A;  2AFZ A;  4KLW A;  2GRE A;  1YQE A;  4CGO A;  5D8N A;  3B8H A;  2WPW A;  1CP7 A;  1KK1 A;  3VO2 A;  4OIW A;  2F1L A;  1UMK A;  1WOS A;  1T5E A;  2C2W A;  2OBS A;  3CME B;  1DG1 G;  2P6G A;  1I18 A;  4N3N A;  3VWD A;  4X7C A;  4OC4 A;  5F48 A;  4EFD A;  8CPA A;  3GVL A;  3BQJ A;  1UD4 A;  2R7H A;  2OH1 A;  3AVU A;  3PB9 X;  4DK0 A;  4XPD C;  4K3N A;  5JH9 A;  3CES A;  5A89 A;  4MY3 A;  3SJE A;  4AB7 A;  3OP1 A;  1YIT B;  3S6G A;  2XOK A;  2WJV A;  3PB4 X;  3LQE A;  1DDI A;  3SJP A;  4OKO A;  2D3N A;  5FO0 A;  2Z11 A;  1W87 A;  3W2G A;  1ZM4 A;  5LRG A;  3VO1 A;  2PC1 A;  3EXN A;  2O53 A;  5DWM A;  2WSS A;  3CCE B;  2P0W A;  1IGB A;  1TUI A;  1W0K A;  5JGF A;  5A88 A;  3RYO A;  2V8D A;  1B87 A;  4B5O A;  2Q4Y A;  4K30 A;  4MFP A;  3B8G A;  5HZB A;  4R3L A;  3QFC A;  4M1K A;  4KLV A;  2V77 A;  4WZK A;  1A8P A;  1YX2 A;  4DNR B;  3GYA A;  1JA0 A;  4Z4V A;  2Q04 A;  3LWU A;  4KOR A;  1VKC A;  2B3V A;  1RO5 A;  1NSL A;  3T9Y A;  2Q4Z A;  5H84 A;  3A1P A;  4EH1 A;  2NV4 A;  3RBU A;  4KKT A;  1YX0 A;  4LBW A;  4LBV A;  2I1L A;  1KMH A;  3FEE A;  1DTD A;  3OPO A;  1NBM A;  2R8V A;  2VNK A;  1HEE A;  3FBU A;  4G1V A;  4ZY0 A;  1AUG A;  5LYF A;  2ZEF A;  1N05 A;  4L89 A;  5THW A;  1QGZ A;  1PU9 A;  2ZW4 A;  5KSW B;  2PJ1 A;  5CNP A;  1GAQ A;  1K4J A;  2M5S A;  1Q86 D;  1WOP A;  3OW7 A;  1WTH D;  2QDX A;  3FPP A;  1AMP A;  1XEB A;  1XMT A;  2OK8 A;  4ZYQ A;  1GYT A;  2JEV A;  4AVA A;  4LBY A;  5FL7 A;  1I21 A;  3ASP A;  3B3W A;  3D4U A;  2QEX B;  4XD7 A;  2JJ2 A;  1FX0 A;  4Z4S A;  1B23 P;  3ZZT A;  1CP6 A;  5FVJ A;  4BBH A;  3EY5 A;  1V0F A;  4MFZ A;  3WYA A;  2BL1 A;  4DJL A;  2AE6 A;  3GIR A;  4NCN A;  3F5B A;  2G9D A;  2ZTG A;  1BAV A;  2WSA A;  2ZOF A;  3Q39 A;  4A30 A;  1YW4 A;  2BO9 A;  5BSY A;  3S6K A;  5LYD A;  3SLN A;  3AVT A;  1TKJ A;  4NJQ A;  3IU2 A;  1IOI A;  2PJ6 A;  5LRJ A;  4RCZ A;  4P4I A;  3FB3 A;  1RQR A;  3NH4 A;  4WZT A;  3VNU A;  4MBU A;  3D2M A;  1Z5R A;  4E8O A;  4TMW A;  1Z9U A;  5HVG A;  3B3C A;  3SEJ A;  4A37 A;  1R3N A;  1IB1 E;  2X0K A;  1Z4E A;  4FWU A;  1W0J A;  4FD7 A;  2EIX A;  1V0E A;  4Z4R A;  1PJ5 A;  2YWE A;  1N0U A;  3FF3 A;  2DER A;  2XZL A;  2X7B A;  3SJG A;  4X2T A;  2YWG A;  5AG5 A;  4M2L A;  1BX0 A;  3NFZ A;  2V7Q A;  2DYI A;  5LRK A;  3PUM A;  2IMO A;  1OB2 A;  1QUE A;  1VQL B;  3F8K A;  2ZW6 A;  3D3S A;  2V31 A;  3TT2 A;  2B5G A;  4IHM A;  2BMW A;  4OPO A;  1ZG8 A;  2JJ1 A;  1WOO A;  2Q6I A;  4YWY A;  2YNC C;  3W6X A;  4L8A A;  1YLE A;  1UWY A;  3LMS A;  2EFG A;  1ZLH A;  1VHO A;  4ASU A;  1E1Q A;  3NE8 A;  1QMU A;  3GVK A;  3S9L A;  1YRE A;  1I8D A;  4DQL A;  4JYW A;  2XZO A;  1D8T A;  2FCK A;  1M1K D;  2HV2 A;  2JDD A;  2GK6 A;  1L0C A;  3FEC A;  5IX3 A;  4CGL A;  1MK4 A;  4YU9 A;  1E3X A;  4P6Y A;  4RDL A;  2R6H A;  1KD1 D;  3J81 k;  4B43 A;  2BCO A;  1GAW A;  1EFT A;  2ANP A;  2CND A;  4A94 A;  3AVV A;  3CMA B;  1H42 A;  2PLF A;  1XOV A;  5IYW A;  5THX A;  2BGJ A;  4IK2 A;  4CYP A;  3CD6 B;  3ZJ0 A;  3AVX A;  3AGQ A;  5JM6 A;  5JQ4 A;  4A38 A;  1S7N A;  4G7W A;  1E63 A;  2AJ6 A;  2WR8 A;  4FD4 A;  4QB9 A;  4RD0 A;  3D67 A;  2YWF A;  3SI2 A;  2GJK A;  4BD9 A;  4AF7 A;  4N3G A;  4FK8 A;  3BCD A;  3RY8 A;  5J8F A;  4PV6 A;  3CCR B;  5F49 A;  4YAL A;  1P4N A;  2JIZ A;  5H5J A;  3KZW A;  2PJA A;  3KL9 A;  5F4M A;  2J7K A;  3MHP A;  4JD6 A;  1E79 A;  1YJ9 B;  1JJ2 B;  2GIV A;  3KQZ A;  1QQ9 A;  3EC4 A;  5K8P A;  2RC6 A;  5BSX A;  3JRU A;  4YHB A;  3N5F A;  5E96 A;  3G05 A;  4UEF A;  4II9 A;  4WWV A;  3BY2 A;  4CAV A;  1XF8 A;  4Z4Z A;  4A2Z A;  4UWJ A;  3IIB A;  4OC0 A;  1MRZ A;  1Q7L A;  2NMT A;  4XPL A;  1J4J A;  2CF4 A;  4UIB A;  3ISZ A;  3JTK A;  1MJA A;  5HVH A;  4B14 A;  4H6Z A;  4M85 A;  4MFK A;  2B7B A;  1XBU A;  3B2Y A;  2YWH A;  5AG4 A;  3OOC A;  1K8A D;  3E0K A;  2YNE A;  2VBV A;  4OLL A;  4Z4T A;  1ON0 A;  2X53 S;  2CK3 A;  3PBB A;  4DQK A;  5FA6 A;  3V8I A;  1YVK A;  3GUX A;  2PRQ A;  3PA2 A;  4UWI A;  1V0C A;  2E1R A;  3W5U A;  3QAY A;  1UD5 A;  2WPD A;  4P45 A;  1IYL A;  4XOR A;  3PEN A;  4RS2 A;  4MJ8 A;  1E3Z A;  1K28 D;  4E0A A;  2PE3 A;  1IID A;  3MGD A;  1H8E A;  5HKK A;  2V8G A;  2HDN B;  4UAJ A;  1VF7 A;  3FRM A;  4P6V F;  4ORF A;  1DAR A;  4YXW A;  1E64 A;  3PZJ A;  5KTD A;  4B3X A;  2GE3 A;  3ZZI A;  2BEI A;  4ZGY B;  2DIE A;  2VZY A;  2VBT A;  2AFX A;  3OW2 B;  2PIY A;  2BN4 A; 
#chains in the Genus database with same CATH homology
 8CPA A;  2C6C A;  1VGY A;  4NJR A;  1R43 A;  3IFE A;  2F7V A;  3D66 A;  3PB9 X;  2IQ6 A;  2POK A;  4K3N A;  1PYT B;  5JH9 A;  1ZLI A;  2XEJ A;  2CTC A;  4JZ0 A;  3SJE A;  4F8Z A;  2HC9 A;  3PB4 X;  1Z8L A;  4MCQ A;  4OKO A;  1PCA A;  4P44 A;  3PBE A;  1HDQ A;  5LRG A;  2AFW A;  3CPX A;  2O53 A;  5K8N A;  1LAM A;  4P4E A;  3K9T A;  1IGB A;  1VIX A;  3PB6 X;  1BPN A;  5JGF A;  2PJ7 A;  2V8D A;  4MCP A;  3WT4 A;  4KSI A;  1M4L A;  3BI0 A;  2XEG A;  2V77 A;  5J1Q A;  4OID A;  4P4F A;  1LOK A;  4NGQ A;  3D7G A;  3LWU A;  3PEI A;  3DLJ A;  3HLP A;  3KGQ A;  4OC3 A;  4X3R A;  2QYV A;  2Q4Z A;  2DEA A;  2PVV A;  3RBU A;  5F09 A;  3CPA A;  2PJ3 A;  4OC1 A;  3FEE A;  1DTD A;  3RZA A;  1LAN A;  1HEE A;  4R8F A;  4ZY0 A;  2F8H A;  5LYF A;  2ZEF A;  3D7H A;  2JBJ A;  5THW A;  3QNV A;  4ZX9 A;  3FED A;  2PJ1 A;  5LYL A;  1Y0Y A;  2RB7 A;  3TX8 A;  4PXC A;  3MN8 A;  5LYI A;  5HVF A;  2BOA A;  1AMP A;  3SI1 A;  3H8G A;  4ZYQ A;  1YLO A;  1GYT A;  4EME A;  1NSA A;  4R76 A;  2CIJ A;  2PJ4 A;  1H8L A;  3B3W A;  3D4U A;  4O23 A;  4F9U A;  1TF8 A;  3KR4 A;  2Q43 A;  2PJ9 A;  1CP6 A;  2PJ0 A;  1IY7 A;  2Q51 A;  2ZEN A;  5D29 A;  4NGN A;  5K8M A;  4WJB A;  1RTQ A;  1BLL E;  4AXV A;  1VHE A;  3WAB A;  4DJL A;  2PJ5 A;  4B6Z A;  2AFO A;  1BPM A;  4OC2 A;  2G9D A;  2EK8 A;  4Q7A A;  4MHZ A;  2EWB A;  1BAV A;  2JBK A;  2ZEL A;  3PFO A;  2AFM A;  2ZOF A;  3IJ3 A;  3KHZ A;  4Z65 A;  1YW4 A;  2BO9 A;  3SJX A;  3RAM A;  1CBX A;  2V8H A;  5LYD A;  4W9Y A;  3KHX A;  1TKJ A;  3B3T A;  4NJQ A;  4ZI6 A;  2PJ6 A;  5LRJ A;  3FJU A;  1YME A;  4P4I A;  3NH4 A;  5I4M A;  1ELM P;  4MRI A;  2ZEO A;  4DUK A;  1Z5R A;  2FVG A;  5HVG A;  3B3C A;  4PXE A;  4A37 A;  4NGM A;  1R3N A;  1FNO A;  1Z2L A;  1Y0R A;  4FWU A;  3D7F A;  3NH8 A;  4UF4 A;  3FF3 A;  1CPX A;  1EE3 P;  2GLJ A;  3SJG A;  4X2T A;  2PJC A;  3TC8 A;  2OR4 A;  3NFZ A;  3I1U A;  2EK9 A;  4G1P A;  5LRK A;  2RFH A;  2XEF A;  4IAV A;  4OP4 A;  2IMO A;  5IB9 A;  2ZEE A;  1ARM A;  4PPZ A;  3HUV A;  3H8F A;  3IEH A;  3B35 A;  3FMC A;  2QJ8 A;  4X8I A;  4IHM A;  3FVL A;  3B3S A;  3IO1 A;  3T8W A;  4LQG A;  4P4D A;  1ZG8 A;  1CPS A;  4FUU A;  2NYQ A;  4YWY A;  1XMB A;  2IJZ A;  4GM5 A;  3SI0 A;  1UWY A;  3IC1 A;  4RUH A;  1CX8 A;  3LMS A;  1ZLH A;  1VHO A;  1ZG9 A;  3D68 A;  5ELY A;  4CPA A;  1F2P A;  4NGT A;  3WC5 A;  1QMU A;  2C1C A;  3S9L A;  3H8E A;  3PFE A;  2O4H A;  4JYW A;  3BHX A;  4H2K A;  4F9V A;  2I3C A;  4ZX8 A;  1FT7 A;  3FEC A;  4MMO A;  4PXB A;  4P10 A;  4YU9 A;  3WC6 A;  4P6Y A;  4PQA A;  3GLJ A;  3VAT A;  3KQX A;  2BCO A;  5CPA A;  3V7Z A;  2ANP A;  3PB7 X;  1F57 A;  4MHP A;  4OME A;  4A94 A;  4FAI A;  3S9N A;  1LCP A;  4MHY A;  3BI1 A;  3CDX A;  3NA6 A;  6CPA A;  3IWW A;  2QVP A;  2C6P A;  4TWE A;  1KWM A;  2PCU A;  4IK2 A;  4MHN A;  1LAP A;  5K8O A;  2C6G A;  4ZY1 A;  1TF9 A;  1ELL P;  3K2K A;  4NGS A;  1F2O A;  2V8V A;  5JM6 A;  3GB0 A;  1TKH A;  2ZOG A;  4A38 A;  2PJB A;  2WZN A;  3CT9 A;  3D67 A;  3SI2 A;  2JEW A;  4BD9 A;  3DGV A;  7CPA A;  2GU2 A;  1ZG7 A;  1OBR A;  1YSJ A;  2PJ2 A;  4ZY2 A;  3ISX A;  4R7M A;  2J9A A;  3KZW A;  2PJA A;  3KL9 A;  2CTB A;  3KR5 A;  1XJO A;  4UEE A;  2OOT A;  2GLF A;  3VAR A;  3KQZ A;  4R6T A;  1QQ9 A;  5K8P A;  4NGP A;  3VH9 A;  1XFO A;  4A39 A;  1HDU A;  3BXM A;  3JRU A;  2AFS A;  3N5F A;  4UEF A;  1XRY A;  4WWV A;  1CG2 A;  3IIB A;  4MCR A;  4OC0 A;  2PJ8 A;  2ZEM A;  1Q7L A;  2CF4 A;  4UIB A;  3B7I A;  3MRU A;  4FBE A;  3ISZ A;  3KI9 A;  4PXD A;  2WYR A;  2ZEG A;  4UIA A;  5HVH A;  1TXR A;  2HB6 A;  4P4J A;  4UEZ A;  3S9M A;  4NFR A;  1XBU A;  3B2Y A;  1AYE A;  4EWT A;  3D7D A;  2PIZ A;  1DE4 C;  1TKF A;  1JQG A;  3PB8 X;  1LFW A;  5DS0 A;  3PBB A;  3WC7 A;  4ONW A;  4TNU A;  3NH5 A;  3GUX A;  2PRQ A;  3PRT A;  5HXD A;  3SJF A;  2ZED A;  1YW6 A;  3B3V A;  4P45 A;  1ARL A;  4MCS A;  5CBM A;  2AFU A;  3L2N A;  2VL1 A;  4MXU A;  2ZEH A;  4DYO A;  2PE3 A;  2AFZ A;  2ABZ A;  2GRE A;  2V8G A;  5D8N A;  2NSM A;  4NGR A;  1CP7 A;  4P4B A;  4OC5 A;  4OIW A;  3FX6 A;  2ZEP A;  2PVW A;  3KAS A;  1Y7E A;  2XEI A;  3V38 A;  2AFX A;  3FH4 A;  2PIY A;  4OC4 A;  4EFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...