2DEUA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
364
structure length
364
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA
total genus 85
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2deuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2deuA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2deuA01
3E20A 1U3DA 1ZM4A 1XJQA 3PXUA 1D1NA 1AIPA 1K9MD 3FOCA 4EG5A 1UMKA 1EXDA 3X1JA 1OWNA 2GKSA 3DO8A 3D6UA 1H85A 1AMOA 4G1BA 1KQSB 4M1KA 1O95D 3RHSA 4M2LA 4QHYA 4Y9UA 1YJWB 2PG3A 3FDXA 2Z08A 3NBAA 1R5OA 2VTBB 5TY0A 4MWDA 1FNBA 1GAQA 2PZAA 4ZT7A 3SEQA 4XFJA 2HDNB 1QFYA 4QFMA 1YULA 2YXNA 2WB2A 4B47A 3CMAB 1EP2B 4PBSA 3OW2B 4MW2A 3BL5A 1XB2A 1A8PA 4RD2A 3QFSA 1KAQA 1N2HA 1NUSA 5J5AA 3CVYA 1OBHA 2GQFA 1ULHA 1OWOA 3CXCB 1IQ0A 1CQXA 3AVYA 1WOYA 1VBMA 4FZJA 4JZYA 4MVYA 1F9AA 3VO2A 3LOQA 4PC1A 2XRYA 4EF6A 1K73D 3PNBA 1K4KA 1GJRA 1GR1A 4R0NA 3IVCA 3B82A 3IMEA 1QRSA 1VQMB 1M8FA 2YWCA 2BVNA 1SM4A 1M8GA 4DDKA 4M4SA 5H7XA 2XEXA 2QUKA 1GO2A 1UFVA 1QQTA 1N2OA 4Y7CA 1QTQA 4OUDB 3HFJA 5IJXA 1G8HA 1KP2A 4G5GA 2AZXA 1IHOA 3N05A 1LW7A 4MUJA 3CB4A 2ZUEA 1TTTA 1YIDA 1S0UA 1YI8A 4PY2A 3TNJA 1ZJWA 2E21A 4TMWA 2BPOA 2X1LA 2IP1A 1VQLB 3C8ZA 4AQ7A 1M8JA 2QTZA 4ZGQB 2DUMA 1MAWA 1WY5A 3CMEB 1J70A 1U2RA 3P52A 3I56B 1JZSA 3OZWA 1VQKB 2G36A 5BNZA 5LM3A 2DETA 4RD6A 1TYDE 4RCYA 1TUIA 4J76A 3CCRB 5TEVA 1HYBA 1KQPA 4RD4A 1JHDA 1N0VC 1QRUA 3W5HA 1W87A 1G8GA 1N2JA 1GLNA 3P0IA 3CR8A 4NDAA 4MW6A 3CVVA 1EFPB 1H3NA 4C0SA 3ZUGA 3ZXIA 3E1YE 3IOCA 2NZ2A 3Q12A 2B7BA 4YHBA 1M83A 5EMNA 5FO0A 2OK8A 2RE8A 2E18A 3PNYA 1DARA 5IHXA 3IOEA 4R2MA 4ZT6A 3H99A 4WSOA 3MMXA 4AS1A 4TMTA 3CCVB 3U6BA 4OUDA 3SP1A 4MUEA 3FI0A 4JFAA 3QFTA 1M90D 3QFCA 1ILEA 2DY1A 3OJWA 2OV4A 4MWEA 2IJGX 1E64A 1MJHA 2VNJA 1NSYA 2PFSA 1IVSA 2VYQA 4ZCSA 1D2RA 1EFTA 2BV3A 3W5UA 3CCEB 3AVUA 1A8HA 1MBZA 4PC6A 2AG6A 3G4SB 3SZ3A 3ZBTA 1YHQB 1NP7A 1X6VA 1T9GR 2E1RA 4U8HA 4PC3A 3VO1A 1QUEA 1QJCA 2A1UA 4GU5A 2PLFA 1QVFB 2R6HA 2PXHA 3FNRA 4B48A 4JXXA 1F7UA 1RQGA 2X3UA 1T9GS 3Q10A 3MXTA 2BYTA 3ZJVA 1Q82D 4ACAA 1WXEA 4TN1A 1I6LA 4CDNA 3CLRC 2QA4B 4NAUA 3LVBA 1G8FA 1KR2A 2CV2A 1R5BA 1IFXA 1YJNB 3AFHA 1EFPA 2JAXA 3Q4GA 1QGAA 1D2EA 1M8KA 2AHOA 4HJRA 3CVWA 1O94C 3COVA 1K92A 2QTMA 2Z3VA 4YP7A 3SYTA 4MVCA 1R6XA 1BJKA 1G7TA 4MUNA 3JQPA 1M1KD 1N2IA 2J5BA 3INNA 1XNHA 2RD2A 2D13A 3P26A 3SEZA 2GOYA 4KR6A 1H3EA 1G7RA 4XFDA 2D5BA 4LBVA 3VGJA 4EG8A 1W35A 3W5VA 1QVGB 1OD6A 2DERA 2GM3A 2XNCA 5H5JA 4J75A 4ZCQA 5KCMA 3U1VA 3FY4A 5FO1A 2AKEA 2HCJB 2QUHA 5K0TA 2VNIA 1FNCA 4HE5A 1T6XA 2PIDA 4ARCA 1F4LA 1M1ZA 4Q16A 3X1KA 4PC7A 1S4MA 1O97C 1IH8A 2YWHA 1MRZA 2BF4A 2QMUA 3JQRA 4U63A 1GVHA 3CC4B 1QG0A 3U6KA 1NYLA 1QNFA 1I6KA 3H9CA 4NX2A 1NUQA 2BM0A 4MW5A 3WBKA 1DNPA 1T6ZA 3FPKA 2VZLA 2A1UB 3A05A 4K03A 3QTTA 3PENA 1ZUNA 4EGAA 1DDGA 2OQ2A 4ZT2A 4TMVA 1FRNA 2PIAA 1VQOB 2PZ8A 3DPIA 4MWCA 4EFKA 4B44A 4JXZA 4WQMA 2A1TS 3P0HA 4TMXA 1WXGA 1IJEA 1MAUA 3HL4A 1G7SA 4LBWA 1JIIA 3ND7A 4MW4A 4Q93A 4CDMA 2QTNA 1J21A 3I05A 2BN4A 1MB9A 3ZZ0A 1TFUA 4YAOA 1XNGA 3N8HA 1ZM3A 1B6TA 1E62A 4ZGNB 3MHPA 4UAJA 1VBKA 4X0EA 2QJTA 4ND7A 2FX3A 4ZT3A 3AVVA 2ZP1A 4AC9A 2OTLB 2X3FA 1S72B 2QUIA 3B78A 1JIJA 4DLPA 4ZCTA 4B43A 1O97D 3GMIA 2X1MA 1N1DA 1Q7YD 2QJOA 1N77A 1EFVA 1PG0A 4G1VA 4EG7A 4PBRA 1EE1A 3PRHA 2RC5A 4G6ZA 2GPJA 2WQ7A 3ES9A 1PFYA 1KQNA 3CC7B 4YAUA 1H42A 4KPUB 3COYA 1TLLA 2CFOA 3IODA 4ZCLA 4A91A 1Q15A 1JA1A 4TS1A 1WKBA 4ZCRA 3ISJA 3AG5A 1I2DA 1KRHA 3ND5A 4MYTA 4DQKA 1J09A 4MQ6A 4NZPA 2CYCA 1QH0A 1OBCA 4KR9A 4C43A 4I6GA 1PG2A 3CRZA 3IVGA 4LC0A 3MMPA 5HG0A 1WQ4A 3FWKA 1OWPA 3WNBA 1MOPA 4S1OA 3CCQB 1PFUA 3G6KA 3W2EA 3OJXA 4QBTA 3W2FA 3SZGA 1U0BB 2CSXA 4B3XA 4ZV4A 4DJAA 1OGJA 3U2QA 3CD6B 2HGZA 4QRDA 4R71A 1NI5A 4BPRA 5DB4A 2C5SA 2A4MA 4WNYA 1D8TA 5TV2A 4FWTA 1DDIA 3HMQA 2EFGA 4RPIA 1CNFA 3JQQA 1N2GA 3H05A 3OZUA 5TEWA 1WXIA 3AGQA 4YAWA 1VQ5B 3TS1A 1QU2A 3QE4A 4EG6A 3WBJA 3X1MA 3AL0C 2J7KA 4PGOA 3B8HA 1JIKA 5DEOA 1ZH0A 4MLPA 4ACBA 4MUGA 1VL2A 1GTRA 1W34A 3CCUB 4ZCPA 5JBNA 1YITB 1PFWA 2BMWA 3CVXA 2ZUFA 1EUQA 2A1TR 3CCSB 4K1XA 2QUJA 3G71B 1O94D 1YIJB 1QRTA 1TYCA 3RK0A 5F23A 3UC5A 3CA8A 3DV2A 1NUUA 4JYZA 1EFVB 1KH1A 4HK4A 3S3TA 2YY5A 4MUFA 5EKDA 2XRZA 3CLRD 2BGIA 1QX4A 1O6BA 1R6UA 1MB2A 2IELA 4RCZA 4BWVA 1EWYA 1M8PA 2V0CA 1I7PA 5JBQA 1KD1D 1B2RA 2HZ7A 3QE2A 3N2YA 1NDHA 2J09A 1JECA 3AVTA 1U7XA 4HE6A 3COWA 3GUZA 4MVWA 2PZBA 4XSVA 1O0BA 1OWMA 1XNJA 1Q81D 1HA3A 2QJFA 1NUTA 1YI2B 2OTJB 4GRIA 4FN5A 4CQNA 1SURA 1H3FA 3V76A 1KORA 3H97A 2WQ6A 1GAXA 3COZA 4EH1A 1Q86D 1GPMA 2JA2A 1TYBE 5GV7A 4G5FA 1J1UA 1E63A 1BX0A 2BGJA 3ZZTA 3TZEA 1EXMA 1O96A 1KK2A 4L2IB 3RJZA 4RUKA 1KH2A 1JEEA 1BS2A 1YUMA 4EG3A 3VNVA 4N3GA 3W2GA 3G59A 4RD3A 1EP3B 1YIAA 1IQRA 3I1FA 4M0LA 1NJID 5FNZA 2B5OA 4NAHA 3W2IA 1JZQA 2CUZA 3FIUA 3IH5A 1TYAE 2ZITA 1KTVA 3CLSC 1U7DA 1NZJA 3CC2B 2E0IA 4MW9A 4MULA 3MLAA 1JEDA 1N8RD 3ZIUA 1CT9A 2E89A 3CCMB 1JMVA 3A04A 3ELBA 3H9BA 3AGPA 2VNKA 3JXEA 4ZCIA 4F4HA 1EUYA 1KH3A 2J4DA 1LI7A 3AVWA 3AIIA 3CLUD 3HV0A 2OK7A 4M53A 5KHAA 1KK1A 1VQ8B 4DQLA 3IMGA 4LBYA 3UK2A 1F7VA 5AN9A 3AG6A 3MLBA 2CYBA 2H2AA 2B7CA 1TVCA 1VQ6B 3MUEA 4KR7A 1WDTA 4P3YA 2QDXA 4YALA 1VQPB 2A86A 3HZRA 5KWVA 3A2KA 3ZXSA 1GTSA 3GLVA 2D54A 4PBTA 2J08A 2O5RA 4MAFA 4I6JA 1IQUA 3IUEA 3VRHA 5GV8A 3OP1A 4NBSA 5THXA 1TQ8A 1WXHA 1TEZA 1VBNA 2V0GA 2EIXA 4B4DA 1T6YA 5DASA 1N78A 3ZJTA 1CNEA 2YWBA 2PMDA 3A4IA 1OGIA 4HJXA 2CNDA 5TR9A 4MVXA 2B7LA 4QREA 4TMZA 4R2LA 4CT0A 3ZGZA 4J0QA 1FDRA 1FNMA 3MCAA 1NURA 3E27A 1QU3A 1VQNB 3KT0A 3NBKA 3N9IA 1GAWA 1WZ2A 1IB0A 3K32A 1KK3A 3P0JA 4DE5A 1DG1G 3CLTD 3IUBA 1QFZA 5DK4A 5K0SA 4AF6A 1J20A 4EG4A 2DXIA 3ZJUA 3LE8A 4NATA 4MUIA 3LCJA 1QFJA 4AF7A 1FYDA 1NUPA 1EFCA 1KQOA 3WXMA 1SKQA 2RC6A 3CPWB 3RK1A 3LO8A 2DR2A 3ILVA 5J59A 1O95C 1QGZA 3HGMA 3KFLA 3ZC3A 3M5WA 4YAFA 1VQ4B 3G5AA 3UOWA 2XNJA 4MW1A 2CV1A 2WSIA 1ELOA 1KP3A 3WYAA 2HMAA 1LI5A 3TQOA 5HUHA 1G7CA 1BQEA 3ZZUA 4MW7A 3FJOA 3KT3A 4YBRA 1JJ2B 1OWLA 4LBZA 2R5WA 1K97A 1KKUA 2NSYA 3F3MA 5TS2A 3CW2A 1KK0A 1FRQA 3QSYA 1B23P 1JB9A 2BSAA 1X8XA 2Z09A 2DPLA 4U7JA 4DDHA 4RD0A 1EP1B 4MWBA 1WJGA 2A84A 3AKZA 1FFYA 4PC2A 1W2BB 1N2EA 1VQ7B 3VMFA 1O96B 3NV7A 1YUNA 4L2IA 3L93A 4ZCMA 2H29A 3CLSD 1FNDA 4MYUA 5HUJA 1IRXA 1Q19A 4YP5A 3QTBA 4U9UA 1N3LA 3J81k 4HPWA 4RD1A 2D74A 3KT8A 2BM1A 1J1ZA 5J58A 2QTRA 2QEXB 4F7DA 1KJZA 1I6MA 1OB2A 2QN6A 3VU8A 1ZM9A 1V47A 4G5YA 2X0KA 2CV0A 4P6VF 3RBAA 1ZH6A 3D6VA 3IMCA 4EG1A 4MUHA 4KPUA 4I6EA 5AHWA 2I1LA 1O5TA 1YJ9B 4MUKA 1U3CA 3IDFA 1G59A 3AVXA 1OB5A 3CLTC 4H9GA 1JNYA 3CVUA 3FH0A 3WY9A 2A7XA 3UY4A 4Y9RA 4DDMA 5FA6A 2JANA 5H16A 4NCNA 5KSWB 1J9ZA 1O0CA 2O8VA 3SJZA 4YP6A 2CRVA 1N0UA 2C78A 1H1TA 1GN8A 2VTBA 1VLHA 1F60A 2QTLA 1JA0A 3CLUC 3KT6A 1Q77A 1EJ2A 3QFRA 3OTWA 4UZFA 4ARIA 2VNHA 3W2HA 4RJLA 1Q11A 4K0RA 1KC8D 3IOBA 2VXOA 4ZT5A 2DLCX 1V8FA 2CYAA 3CCLB 2EJCA 4E1AA 2DEUA 3TQIA 2DCUA 4N3NA 1XE1A 4MW0A 2C77A 1WXFA 3SDBA 3FHJA 3CCJB 1ZM2A 4ZT4A 2J07A 3RFFA 2YWGA 1ZUNB 3WNCA 4UZEA 5H59A 3DLAA 2YWFA 3IVXA 4P2BA 3K9WA 3G6EB 5HXBA 1JILA 1N2BA 1R5NA 1N75A 1MC1A 3TZLA 2EL7A 1QGYA 1JGTA 4YMIA 3WNDA 4IW3B 1EFUA 1Y42X 4DNXA 4KKVA 3UMVA 2NPFA 1K8AD 5DSZA 4FK8A 1VQ9B 1IJFA 3FG9A 3OZVA 1QUFA 3VNUA 1F20A 1P7PA 4Q7JB 2TS1A 4H3SA 2BTEA 3I55B 4OJMX 1K4MA 2YWEA 3FETA 4F3RA 1R6TA 1WQ3A 2CT8A 1BX1A 2A88A 1PFVA 3L92A 3PNVA 1GZUA 5TGTA 5LFAA 3P27A 3ND6A 4ND6A 5LLTA 1COZA 1KAMA 3ZBUA
chains in the Genus database with same CATH superfamily
2J87A 1QYVA 4PQFA 1YBAA 1R6AA 2COEA 4RLSA 3R6GA 4D4JA 1UPUA 1K9MD 2ZJ1A 3KAJA 3TLZA 1BN6A 1G8XA 3LAWA 1MP0A 2HDHA 4IEIA 2RJ3A 4KKUA 1GT6A 3IMKA 4L72A 4OJQA 1FFWA 3VTAA 5AVUA 1MUUA 1L5SA 1MOSA 4OGLA 3OQ6A 2PV7A 3P2MA 2C1XA 4NEQA 3ZQ6A 4JHXA 2BBOA 2N0SA 1HDCA 1DGQA 3SF0A 3T06B 2QS9A 1ACLA 3IHWA 4AFZC 4LYJA 2X0IA 1DDOA 3FJPA 1RAIA 3BILA 4HLCA 4PBSA 3RVLA 4EHJA 5GTDA 2HC9A 3WL3A 3BQJA 1ZY2A 4BEJA 1UBLS 3NCHA 5AW9A 4DCCA 5ICMA 2FW9A 2LRHA 1IHYA 1WNTA 4TS9A 4O4JB 4QUIA 3RVRA 3FYUC 3RHZA 4JZYA 2D0OB 1VJGA 1F9AA 2DD5A 2IUFA 2HEGA 4DEVA 4AMYA 3CNNA 3BGVA 4UM7A 1ECGA 5I7HA 1RYDA 4A2PA 2V8JA 3HB1A 5DGTA 4J1SA 1H5UA 4DDKA 4ZAFA 2CSQA 3VSCA 3JU3A 2KNBB 1QONA 1UFVA 3NBYC 2YS7A 1L7RA 1YO6A 1CUCA 1T8PA 2OJ2A 3OSVA 4YO8A 2WSEE 1TUEA 1E9AA 3BMOB 4HNUA 4NI5A 1NZFA 1K98A 1KP2A 2HRRA 3U61B 4M75D 3T3MB 3T1VA 5I21A 1RACA 1XYGA 2FKAA 4LHXA 4R05A 3S99A 4BMPB 2Z57A 4K9QA 3DCJA 4L3OA 3O5ZA 2VK8A 3FGPA 4FFSA 4KHZA 3T3IA 2VT7A 4AQ7A 3RRBA 1N7HA 3K20A 3S1SA 4Z88A 4NKRA 1C5KA 1WY5A 3CTAA 4M1ZA 4P86A 4RKWA 3KEOA 1CSKA 1VQKB 2G36A 4KBGA 5EE9A 3IUJA 1MC8A 5FBRB 2F3QA 5FR1A 5LA6A 4FX5A 4BMDA 4RY9A 3TFOA 2DHRA 3GUUA 2DL5A 3ZWAA 2B25A 2WHEA 3K1JA 4R8VA 1FOEB 4K2HA 1IREB 5CLGA 3WIDA 4MZMA 2GZAA 1ZUHA 3PT9A 3KC2A 1VF7A 1HE2A 3LX5A 4BMVA 1N2JA 1YOBA 2DM6A 2J9FA 2D1SA 2M51A 4IX9A 3GLFB 2GK4A 5COBA 5BN5B 3PL5A 3NGMA 1XJWA 4ZYUA 2ROQA 5FOWA 3ZKWA 2VQEB 3D6JA 4GNKA 2IKSA 1QDEA 2CK3D 4GUDA 3L1UA 5E6UA 1DAFA 4C92E 2OZPA 2R6CA 2WIAA 1DARA 2X23A 2YINC 2FVYA 1WXWA 2KLHA 4R2MA 1ISSA 3U3JA 1O87A 3DNFA 4TL7A 3ZG6A 3KWFA 2VHXA 2ZJZA 3QO3A 3P5BA 4M76B 4NC9A 3NUQA 4B5KA 3H6ZA 3U7EB 1Z5WA 3D7RA 3DBHA 2B94A 3NIFB 4MKGA 1HDYA 2G77B 3E03A 3KUXA 4WZBB 1QMPA 2E4UA 2QV7A 3ZD9A 3PEWA 3SZMA 5DZSA 4I46A 4RHCA 3LX8A 1SB9A 2HXGA 2QQGA 3I2FA 3OUZA 4TRRA 4XXHA 3MYYA 3EG9B 3Q2IA 4KK4A 4MCJA 4U4AA 3G4SB 4O4HA 5A9SB 2VUHB 4LXYA 3DOFA 4QATA 3I12A 1V2GA 1Z5ZA 1W4SA 2AE2A 2FG0A 3FNRA 3HXQA 5FORA 4GXTA 3H0HA 1P9NA 4KR0A 1IOWA 5MN5A 1VPTA 3E35A 2AFRA 1Q82D 4MS4B 1W5TA 1P61B 1XCPA 2O2JA 2HOQA 3H5WA 1CUIA 2J6FA 5GJWB 4H7EA 4XRRA 3ZGNA 4UTPA 1W85B 5GAMh 5L6LB 1SXJD 2CVOA 1JDUA 1FUEA 3CCJQ 1IG0A 1SUPA 2JAXA 4IMRA 4Q1FA 3VU1A 4CMJA 1IBLB 4MX8A 2XXBA 1NJ2A 1OLOA 3LHDA 4YREA 3ASSA 3PQ3A 3R7WB 3UMJA 4E09A 5HSGA 4X1YA 2FF7A 5DS0A 4Y2HA 2JIOA 2OPBA 2C9YA 3N5CA 4N76A 2HNKA 1SEMA 1D6JA 2O2YA 1Z34A 3B5IA 5GOZA 4NNOA 4QEZA 3RC2A 3ZVRA 3T7IA 1DG9A 3UMFA 4EG8A 1II8A 1YB6A 1DQSA 4DUGA 2GM3A 2ZTMA 3F7TA 1JPUA 4H6PA 4F91B 3GJ4A 4C0XA 3PP8A 4JL6A 4P5EA 5A2QA 1Y82A 2PPLA 4M1YA 1FNCA 4RU1A 4D3DA 3NTHA 4KXQA 1Z25A 3HKDA 4QBFA 5L40A 4D4LA 1YJNQ 2IV3A 2HW8A 3PDHA 4IIHA 2RQVA 1T4MA 3WL7A 4ESOA 5ICSA 3BCHA 3GT3A 3OPMA 4MKFA 4OU4A 4BNNA 3BWDD 2BUCA 4XQCA 1D0SA 2O1XA 4BX8A 2OBSA 1PNTA 2XB4A 1I6KA 2ZI4A 3AVQA 4OXIA 2NVUB 1XTSA 1OI1A 1NBOA 5K3CA 3NB0A 1BKBA 1N6LA 4UTNA 2P69A 4X8LA 1JHRA 4F2HA 1CHDA 1OMOA 4J3FA 4M7AA 3ZCRA 5AVRA 1M2EA 5DNWA 5TIIA 5G41A 4BE2A 5JVDF 2A1TS 1H1DA 1CV2A 4AYXA 3QEKA 2FLVA 2BZXA 5GAJA 4OJTA 4LCJA 1EAMA 2GPNA 1E3DA 3TE7A 2NU7A 1OAOC 2K3XA 2FE4A 4FR2A 3OOSA 4J07A 4FB4A 1XNGA 4OB1B 4TROA 3PI7A 1KGSA 4YJFA 1VE3A 4KIGA 2GQVA 1D4FA 4YRJA 4IEFB 4BMYA 2CNKA 1IBRA 3HNRA 4IQ8A 1QIEA 5L46A 3ZKWB 4OPOA 3UPTA 3Q0EA 4FMDF 2HBPA 3BIJA 3I2KA 2DZDA 5AW6A 1EFVA 2IY7A 4L6CA 3X1ZA 4W5QA 2O8EA 3H7AA 4M77B 3H5LA 4D9IA 3BMNB 2GGRA 1KHCA 3AVOA 1Y34E 4UVHA 1JQAA 3F49S 3VPSA 4E5NA 3E1SA 2V1UA 4PZAA 3EXG1 3H19A 1RAIB 4K9RA 4P5PA 3RIGA 1VECA 2MAMA 1YITA 2PMBA 2PFGA 4RNCA 4RSRA 5CP8A 2QTGA 2X3XD 1TQ4A 4D4GA 1XMPA 5TMPA 2AN9A 1DL5A 5TB5A 4ID9A 1WKBA 1XRNA 2FETA 2IXFA 2IZ6A 4B2IA 1EGAA 3DQZA 2AW3A 1I4DD 3VI4B 1TD1A 3I53A 3EBLA 4JT4A 1Z5VA 2QE7A 4ZEOA 2RHDA 3K73O 3PU6A 3EIOA 1OKKD 2OCBA 3IVGA 2P9JA 3V8MA 2FWJA 2J0SA 2ZR7A 1Y6ZA 2SKEA 3KIPA 2FPKA 3ENQA 4KWEA 1Q1NA 5EZ5A 1ZN8A 3V2IA 5CFLA 4N48A 2QVYX 1KFJB 1N5DA 4S1OA 3SLGA 5KJFA 4G85A 3AQ4A 3UMMA 4C4OA 2HJ9A 4LYFA 5B7NA 4M4ZA 3R75A 5CH3A 2Q1YA 5EIAA 2D1QA 1E7OA 2HGZA 4FFLA 1LJOA 4UTOA 2F2XA 1S2IA 5DB4A 5K2OA 5ALXA 2H7YA 2P0QA 4FWTA 1ZUYA 1LSSA 1L5RA 3EXFB 1NBEA 5K3BA 4OI1A 2XTZA 4H6VA 1OA1A 1GIAA 2CH4W 3DB4A 4YA6A 4XM0A 5JG7A 2I3DA 2YZ7A 4L9AA 4Y2YA 4DQDA 1MMDA 1L8LA 5C34B 3S28A 1M76A 5A3RA 1QU2A 2XI9A 5A0GA 1W2BP 1AKEA 3CT4A 5BWCA 1NTOA 2QLTA 3X1DA 3V8RA 2JFBA 1VL2A 5AW0A 1QKIA 4YPVA 1AKTA 1B4DA 1SUEA 3OX2A 4AZVA 4ZI3A 5LPNA 5EJFA 4RKFA 4WCDA 4G0QA 1WQ1R 3FWPA 1PR6A 4JU8A 1BRTA 3W5IA 2N1MA 3OYNA 4N7RA 1KMHA 2CWWA 1R6BX 2JB9A 2W5UA 1JDTA 1KH1A 3VGPA 5JADA 4XGNA 1M8VA 1FFSA 2Q62A 5TE9A 4I4TB 2WWIA 2J30A 4GZ3A 2YNMA 1J0EA 4WKOA 3O3CA 3KZOA 4IGAA 3OAAD 1ZPDA 3CJQA 5C81A 1KD1D 4M8LA 4Q4HA 5F9HA 1HYEA 3HDHA 3COWA 3MJRA 4M7AG 1QPBA 3ODGA 4IHQA 4XCXA 2NSLA 3EG3A 4C92D 5BRJA 2O2CA 4QX6A 5LP6B 4FXPA 3VJMA 4HXFB 3SU8A 3SQXA 1UFQA 3NLLA 1Z29A 2XK0A 1Y3CE 1JR3A 4JYBA 4LRSB 3FSGD 5U1PA 1DJLA 1OZFA 2W2XA 4D9NA 3VSBA 1GKUB 1HJDA 4WY2A 1KI3A 2C82A 5DT9A 4QQDA 3JQ8B 4XQ0A 5KOYA 2BMDA 3GAMA 5CRIA 3ERCA 3A28A 1QQ5A 2CNOA 1B7GO 5EIHA 1XDZA 2R9VA 2VPWA 1ABFA 5JJLA 2DBMA 4LNHA 4DJ5X 1BIFA 1IQRA 4D9GA 3DOUA 1BCMA 1C3XA 1J7JA 3CNEA 4HNHA 4P4LA 2QIOA 3S1AA 5I4BA 5BSXA 2B8TA 2R6AA 5CJPA 4OMMA 1GA1A 1X7WA 2SHKA 3AFGA 1GGJA 2PX3A 3EDOA 4ZU3A 1MRNA 4EK9A 4ETMA 5KUTA 3JZIA 3Q3AA 1CUFA 3H1AA 1HZZC 1N2XA 5CW2A 2W8ZA 3JD2A 4UXIA 4TKZA 1I0CA 5ECGC 2WIBA 3WLMA 3ELBA 1YZYA 3REQA 3QBVA 2QQSA 2FOIA 2AL7A 3C3MA 1XXHA 1LI7A 3BD9A 1SCAA 3CLUD 5D1NA 2VPTA 4P81A 2FVUA 5GAMd 1NLMA 2X2FA 4X00A 1XZGA 4QD3A 5KOJA 4EY5A 1FXXA 3EUFA 4U9HS 2FJPA 5H68A 3PGKA 2FSIA 3WL4A 2KQWA 1XCLA 4YDRA 3A58B 1HNWB 1P73A 2ONKA 2QMYA 2VT3A 2H4YA 2JNWA 2ZRNA 2RHBA 4B7UA 1WBBA 4RPCA 1GG9A 2MTBA 4F5ZA 4PBTA 4ADSG 5CMLA 4J7FA 5C1OA 2BKEA 5DHAA 4EFDA 4QOSA 3I76A 4AXXA 2GF0A 1QAMA 1GNQA 5GV8A 1OLXB 1XMJA 1LVHA 2OD9A 4NBSA 5THXA 2HHLA 2XTNA 1AGXA 3H2GA 4HC4A 4HQ6A 3FR8A 3WADA 4JIMA 3PEUA 2AXPA 5HJ5A 2JNGA 2ZYWX 3C41J 4YJGA 1U2EA 1FEZA 2RJEA 2KPOA 1UINA 3KKEA 2YR0A 1FDRA 2I2DA 2RDMA 3L7DA 3E8XA 3VC2A 2JCGA 4D80A 2RJDA 4GR9A 2DL4A 2HNIA 1GHTA 1FTYA 2YX1A 1VQNB 3BMCB 3GRCA 3ECAA 3OZAA 4RAOA 4LWQA 3BZUA 4MIEA 1MMGA 3GGGA 1YTUA 4IWXA 1KK3A 1AC5A 3LIPA 3OF5A 3EWIA 1P3DA 5EUCA 4KI7A 2DU8A 2FKNA 3B1JA 1VQ6A 3WWOA 2P7HA 3QXXA 1W48A 1QIGA 2XKOC 4M77A 1D1CA 2C3OA 1BZYA 2HA3A 3BMNA 4QYWA 1U2TA 2QL9A 3FTNA 2Q7XA 2VKQA 1F2DA 3ILVA 2WIFA 2J7PA 4K9SA 2PMEA 1VHQA 1Z88A 1W4RA 2PQMA 2VRCD 2XF8A 2UUAB 3WAGA 4G8BA 3L7CA 5DOVA 1A9RA 1W4LA 1TUBA 3B5EA 4IRMA 4MW7A 3RIHA 4DNFA 2C9OA 4ZRDA 1FLNA 2BZYA 4PL6A 2ZUVA 3FIJA 3M6VA 4XAQA 3D3KA 4HNGA 5F78A 5FWDA 1DJMA 3KHKA 4O2AF 1EEXB 1O9HA 1Q95A 4G5OA 3QSYA 2A35A 1P75A 1TKRA 4RZ3A 1TUDA 1ZHIA 5JWOA 2XDQB 5EP3A 1NONA 1JQJC 2JL1A 2VUTA 3FJ1A 3PXCX 1HD3A 1W52X 3R3JA 4MWZA 2IQ5A 4PR3A 4W82A 5DNVA 1L4HA 3BE6A 4O3FA 4Q03A 1RBMA 3OE7A 2P2ZA 2Q45A 1JH8A 1E9DA 1V1MB 4PAQA 2H8KA 3QEMA 2G28A 2PZJA 1DAGA 3B38A 2Z1MA 3CR3C 2QPAA 4TWIA 2GQIA 2BM1A 1TC1A 3INZA 2EOAA 1PJLA 2IITA 5TXGA 3THSA 4X62B 1S2OA 1B34B 1FS4A 3WFIA 2VGNA 2G1UA 2XH8A 3EGXB 1VE1A 1XE3A 5IT9E 1ZH6A 3IMCA 1UMDA 4LMPA 5TPWB 1T1JA 1V6CA 4PJMA 1Z08A 2C2GA 2HLDA 2ONYA 2BRUC 3G8DA 1U94A 5LYJB 2C7OA 4B76A 2AKKA 4MR7A 5ALLA 4ISBA 3UY4A 4S1NA 1CE8A 2IHBA 1R0YA 2WHPB 4J7XA 3E7XA 3FCSB 4YRQA 2VXEA 3KUKA 3UCXA 4DFDA 4TLBA 1M7HA 4KI0A 1XMQB 1B6RA 2EGGA 2FMIA 2HAXA 4A8JA 3GEEA 2V98A 3FMVA 3Q6QA 1H2ZA 2RH2A 1MPTA 1U2SA 2PSEA 4PZEA 1JWLA 1GZ6A 1P31A 3WO1A 2RIRA 3FYUA 2YY6A 1UOQA 1ST3A 2HK7A 3RFTA 2EQBA 2JAPA 3IDZA 1XEAA 1VL5A 1KJQA 4I4TA 4PV7A 4KFCA 3HFRA 8AT1B 3WHPA 4I99A 1QVFA 3S3NA 2H06A 3R20A 3UV6A 1GXIE 3A26A 3NASA 2AXNA 4KH0B 2CYAA 3LPMA 4ZU6X 5CDGA 5HPYB 4E5DA 2RAUA 4GX5A 3QNMA 3UJAA 4M21A 3AOEC 1DO0A 1MCZA 4HFJA 4CFSA 3CZRA 3ZDEA 3V8JA 1JXAA 1L5GB 1DEHA 3DLAA 5B3LA 2XE7A 1RXWA 5CTJA 1B8NA 3QBDA 2E4XA 4ZAVA 1KZYC 3EODA 4GIBA 1W93A 1XD8A 4IH1A 4ZTZB 4BB7A 1EJ0A 1AHNA 2F9FA 1O9SA 1QGYA 1YKGA 2CZ1B 2HI0A 2XMPA 1F1BA 3KKOA 1KQ2A 3KLBA 1NV9A 4HBGA 1OX8A 3GT7A 5CJJA 1LXCA 2W98A 3HVUA 3O9VA 1F5NA 3WKDA 5BMVB 4EIWA 5IS2A 3LBNA 3SD7A 3USZA 4DIBA 4HNQA 2B6HA 2K6DA 1NLFA 2ZR8A 1QUFA 1PRMC 2GPSA 3LFTA 1AZLA 2XIDA 1O08A 5LNK6 5KNBA 3KBOA 3ZVMA 1RHKA 4Z2YA 4M46A 3ASRA 3RBZA 4CF5A 4BQEA 3HKEB 4JB2A 1I2BA 3G1WA 2MYSA 2PX6A 2XA2A 4R9RA 5IXBA 1YQDA 2CVZA 3DGFC 2ZPFB 3SNKA 3JQ9C 3AHHA 1GRQA 1OOEA 1OSNA 4XVQA 1H65A 2VPPA 3BAZA 2ZUUA 3PA8A 4ER0A 2GASA 1GRCA 3LT1A 2PWPA 3I6IA 4GGOA 4EY4A 1IMJA 2OCPA 1AMOA 1XXHB 1ZBQA 1O95D 1ZIPA 2F48A 3BIWA 2IHJA 2F43A 3G2KA 1YJWB 2DO3A 3OO0A 4JP2A 4UNRA 5GAOr 2HHHB 4TYPA 2X8JA 4EWLA 2Y3IA 1NT2A 2PZAA 1P1CA 3OUTA 3OT1B 1TJPB 1IY8A 2L18A 2R60A 3MXOA 4W99A 2HIGA 3ORRA 2GZ3A 4CM5A 3VISA 3H8JA 4LQ4A 4YI5A 1E2NA 3BL5A 5GAN6 2XBLA 4J90A 1G2IA 3U4QB 4RD2A 2WI8A 4CG1A 2IZ7A 3I5AA 4A0HA 2WE8A 1BC5A 3NHMA 3IKMB 1WOYA 1ZLXA 1R4NA 4M78G 2KSSA 2XIJA 3GRZA 4BJ3A 4EB6B 2JLUA 1ZNWA 2JCVA 4J16A 5IN4A 3QU5A 4JHLA 4RM0A 3UDCA 2I2AA 1M1YA 2XMBA 4Q9LA 1T8WA 2G6TA 2LCQA 4EB8A 5FCDA 1AKWA 4C29A 3PA1A 1E77A 1LSOA 3O8DA 1WE2A 5LYJA 4BLRA 1W29A 3EGEA 3PC6A 1QZXA 5GMKe 1HTWA 1PQPA 2R7AA 3KHUA 3B1XA 1CY6A 1JA9A 2WSSD 1HSOA 4I0WB 4K6OA 2QVBA 1NFQA 3T1QA 1X1CA 3FN4A 4FYMA 5E4TA 3TRIA 4R31A 3O8QA 3JQDA 1SK8A 4B3TB 2VHVA 1YA6A 3ZR4B 2HSEB 2E6UX 2VCHA 1BI3A 1M66A 3FYUB 4B7ZA 2K5FA 3GEBA 1YCSB 4HT8A 1BW9B 3AUJB 4FDUA 3H0FA 1RU3A 4Y7DA 1L5NA 3HH8A 4G5SA 2DUMA 2G9ZA 1MVNA 5HYVA 3GF5A 1PK8A 3NHSA 2OXRA 1JYSA 1NE2A 3O93A 1E3WB 1GFCA 1WSRA 5I48A 3OFSA 4RJTA 4X7BA 4D81A 5TNXA 2GM4A 5PGMA 3URMA 2XMSA 1OFUA 1P9WA 2MINB 2PGDA 4NZ9A 2XA9A 4Y2JA 3RS4A 3V8VA 2Y77A 1UK9A 4ARVA 1MKYA 3KKNA 3WMXA 3EC1A 2PU7A 4J91A 5JFTA 3PQ4A 2IIPA 3ONWA 4JBXA 2GCOA 4HLDA 4Q9IA 2WK1A 4P8RA 3AF5A 3IOCA 4JLOA 3N6XA 3ZEHA 4GAEA 4UTVA 4PS0A 5CDSA 3KSBC 3AR3A 1RRGA 1X39A 1NJIC 2O50A 3RVNA 4J0KA 1G3UA 3EA5A 4RTXA 4ZT6A 1PU2A 4JOCA 4ZI2A 1H92A 1O6ZA 3MOGA 2VJIA 3MUNA 2F8MA 2OP0A 3CG4A 3IALA 1XOVA 2VL7A 2H1LA 4H7HA 4IILA 4NY1A 4AZTA 4DOMA 2AUTA 1W4AA 2MYPA 3KNZA 4UBJA 3K9FC 3H2SA 1KQFA 4D56A 2XUHA 5I7FA 5JRJA 4F06A 1HNZB 3CCQT 4EUHA 2I6FA 3WGNA 4H6WA 5AUPB 3VUZA 2Z5VA 1WDKA 3E9ZA 3ZD7A 1RWNA 4WTOA 3GPCA 4JKOA 4BGIA 4BECA 4CYMA 1ZSNA 4JEHA 3RI3A 3UB3A 3CC4A 3TPCA 4CTJA 4DPKA 4R83A 3OCWA 1C8VB 2GK7A 3DVLA 1IDN1 1WB4A 3KEQA 3CC4T 5AO9A 3SLRA 5I4KA 1N32B 4JOQA 2FSUA 1EX1A 4BNYA 4Y1FA 1WPRA 3TRDA 2YUQA 2OWEA 4AD8A 2QSJA 2G1PA 1PM3A 3V8LA 3TPFA 3UK1A 2G8NA 1CQZA 1OLUA 2BKAA 1Z6ZA 2K5UA 3CO0S 3IO5A 3AL0C 3DDSA 3SS7X 2Q2OA 4NHEA 3TN7A 2QDKA 1KDYA 4DSUA 4TWJA 5LP6C 3TW4A 1NBHA 3QW4B 2A5JA 1E2IA 1UBHS 1IEXA 3C6ZA 3ODPA 3V42A 4TYWA 3P9QA 1JRLA 5BV7A 1UKVY 2I2CA 2JAUA 1JAHA 1YX2A 2G72A 5ADWA 5DGDA 4ZKDA 4DWOA 1PZMA 1YZUA 1N33B 4G56A 1PRYA 1XNHA 3K31A 3NGPA 1JBEA 3DF9A 1X1TA 3FMFA 4FDMA 4PJOC 1LC3A 1NBIA 4N0MA 4RACA 1BS9A 2LNDA 3C15C 3G7NA 2CT3A 1G20B 1QVGB 1TKBA 1M30A 2JVJA 2P3QA 1N5ZA 1RXSA 1QFSA 1Y6QA 4GRAA 3MWEB 4CUKA 2CC2A 1SHLA 2YUNA 4XN0A 1EDOA 3S2YA 4KP7A 4LOHA 4P4UA 4EI8A 1IY0A 1K7EB 2QTXA 1QPZA 2FPRA 3LD9A 2R8OA 2R8PA 2VYCA 2WVGA 3L0OA 4FMCF 1KZGB 1P60A 3ONDA 1EX4A 4CPDA 5JAIA 5DX1A 2BF4A 5HOEA 3PLAE 1TKAA 2BGRA 3R0JA 4ROTA 2R6GA 1B2LA 2VJKA 3L4EA 4US0R 4Q7LA 5BW4A 4NF2A 4RDXA 2AD1A 2CUTA 4JVNA 2PDAA 2HSEA 3EJ6A 3PCRB 2BFAA 4DG9A 4L4YA 3FPKA 1Z6AA 3FKSA 3B6IA 4E5SA 3RS8A 1E20A 4EGAA 3PFHA 4WN9A 4TMVA 3O94A 4RH0A 1SZCA 3P2IA 4DQVA 3NYRA 3BH0A 4A6XA 3T7JA 1WXGA 3FE2A 1RQNA 3HL4A 4Q1AA 3DKKA 4FQ7A 5GANe 5AW3A 4N0PA 3HM9A 1G55A 1AKRA 1HOXA 2IF0A 4C0KA 4HCZA 4F7UF 5IT5A 4NBKA 1U7HA 2WZPP 4TSKA 5YASA 2D5CA 3TKAA 2KHZA 4XL9A 2AJ8A 1XEWX 4CLOA 5KYNA 2I2WA 5HUQA 1IXYA 4LXIA 1NI3A 2GSWA 2LT1A 1ESMA 2VJMA 1L4FA 1V5IA 4E7ZA 2FK7A 5AKJA 1YJWA 3Q39A 2VZ0A 4M7AE 5KCOA 3M33A 3NTRA 5IK2A 4BNDB 4RTQA 3HDYA 5GMKm 4PBRA 3UXEA 2FPLA 1NR1A 2CH4A 2JIPA 2YDXA 1CKAA 3ANLA 1HQKA 3E5MA 1NVUQ 1NYQA 1IN1A 1WHJA 2A08A 3I01A 4JT8A 1KOGA 5AKGA 2QY6A 1VLVA 1ZWLA 3QSGA 4HATA 4A2WA 4RHXA 4PLLA 1SY7A 3AJRA 3HL0A 3GGPA 5CFMA 1E2PA 1QO0D 2JJ2A 1LB1B 1U5BA 4H77A 1UADA 3UV3A 4DIOA 4PYJA 5CEEA 1KEKA 3H0IA 3TTXA 2G82A 1J09A 1RXEA 3OIYA 4URYR 3L7KA 4DM4A 4YAKA 2Y4YA 3NRJA 2E5FA 4FHFA 4QGSA 2NG1A 3MMSA 5IXYA 3AEKB 4REQB 3PFGA 1AM4D 1UZNA 1UE9A 2BTOA 2ZTLA 3A6EA 2VC8A 4CG0A 5I9SA 2HJHA 2ZYAA 1VYHA 3ANMA 3WLSA 1VP9A 4GP6A 4IUCS 2RI6A 4RZIA 3L79A 3H04A 1IHMA 1F14A 1WUJS 2A5LA 3OBBA 4TL8A 2W2VA 4XWYA 5AOVA 3RIMA 3SKVA 5B58C 1E6LA 2C8KA 1J23A 2UZIR 3QPAA 3ZK8A 2ZRLA 5IH2A 2DKOA 3O8QB 2OCKA 2Q0HA 4QDJA 4XH9B 3LUKA 4XD7D 4BPRA 1UEIA 1FMTA 4JI0B 3UAOA 2Q0QA 3ENNA 5AM3A 5DM70 2OOSA 3IKTA 1YR1A 1KRXA 3ILSA 1CIPA 1Z4MA 1WL8A 3C3BA 1K9SA 4NYIR 4O2LA 1YR6A 3VPXA 4FDVA 3CG0A 3LGFA 3K2BA 2RGNA 4GXQA 2RB6A 3A3GA 1SQ0A 4HDCA 4DTIA 2XCSB 2ZVQX 4F7UE 3BWYA 4VUBA 1KJ9A 2COYA 1ZJYA 3PZBA 4JASB 1MAHA 4PGFA 2BTQB 4UBMA 1JTFA 3HTRA 3SC2A 1ZH0A 4ACBA 1ULBA 1LX6A 5C37A 4MAMA 3A6PC 4F3CA 2A1TR 2W6OA 4ODIA 5HIAA 2WPDA 2ZZMA 4EHKA 2FJ0A 1WSVA 1J97A 1GXSB 2GVZC 5FL3A 4S24A 3I4CA 2BRUA 1T2CA 2GCOB 1O5IA 2GN9A 4QQ6A 4RMHA 1P4AA 2BEUB 4ZVMA 4YXWD 4F84A 5JFOA 4JYZA 1I8DA 4B8WA 1XP8A 3HR8A 4I5EA 4AY6A 4B6EA 2HB6A 3SMQA 1Q3TA 5C8YF 5DISB 2QRZA 5JU6A 1VQ5Q 2TRSB 4BFYA 4C1BA 1JHVA 1VMIA 4MEAA 4L22A 4RVFA 2IWRA 3CC7Q 1MG5A 4I55A 1LEHA 3AESB 3GGDA 2GTHA 1E5XA 2H1OA 4DLUA 1R2QA 3NRCA 4LX8A 4X92A 5J9FA 5ELLA 5LJLA 2MOXA 4URXR 2EQKA 2QA4T 4LMAA 1JHOA 3RJTA 3ZW9A 1E58A 1F8UA 4NCXA 3I35A 2HF9A 2QG9A 2XJ9A 4UBIA 4WKGA 1RPJA 3HACA 1YK1A 3I73A 5IHNA 2YCBA 3TDKA 1KWGA 1H4TA 4P84A 4ZALA 1EXMA 4YVFA 2IK8A 2FPPA 5LJ3f 3OIWA 4NBNA 4RIHA 1B43A 1P3JA 3CIFA 3RJZA 3FTCA 2V74B 2WZDA 1D2HA 3H9QA 4S2UA 3P9PA 2CFRA 2GR9A 2H1RA 4C0WA 1H8HA 4HH0A 4LUDA 5I9IA 3RV3A 2IU0A 3I1FA 1Z2PX 5JAUA 4LYYA 2L19A 4BNDA 2CZ6B 1H0HA 1YRQA 5J2UF 4TS4A 3CCMT 2QVLA 1W4ZA 3VR4D 2C0OA 4J43A 4MCIA 3CQ9A 3Q11A 4DADA 4URVR 3ROKA 4Z9BA 1B0PA 2ZI3A 2DHDA 1NP6A 3HE3A 2Z3WA 2E87A 1NZJA 3WDLA 3QUBA 3TX2A 1XQXA 3DCNA 4EX7A 4GYKA 5T6MA 4XLZA 1RRPA 3JYPA 4NYMQ 2R57A 1U5BB 3MCZA 4I2VA 4IDBA 2XEDA 3UMGA 1XVIA 1B8VA 4JC4A 4XD7A 1ISFA 1BHSA 1NLZA 2ZSEA 1K08A 3HV0A 1KQSA 4L95C 4BX9A 5KHAA 3OQIB 4IRXA 4F4HA 3AI7A 1G20A 4BP1A 1JP7A 2Z5GA 3WBFA 1AQNA 3MLBA 1EGMB 5BT9A 5EY5B 2B7CA 4C7BA 1T3HA 2WJHA 5GAN2 5CD1A 2QMEA 4KEAA 4X1IA 1MD9A 4CHTA 5HW0A 4B3CA 1XWIA 4KKSA 1XL0A 4WCFB 3P2YA 2IXAA 3C4SA 4JLGA 1BGVA 5LQRA 2EIFA 3K0BA 2QUBA 2O5RA 5LBUA 2RM4A 4IUUA 2WF8A 3K05A 4EDFA 5I7RA 2PWZA 2DYBA 4WZEA 4I5IA 4MKZA 1D6MA 3QNWA 1Y8QB 5AXCA 3I5RA 3NETA 3KCNA 4LN1A 4QFDA 1R15A 5D51S 3A3NA 4IDOA 4WN9B 2GBGA 2CHVA 5TPZA 4M78E 4BE1A 3RD5A 2AEFA 4MDFA 1QHYA 2AFIE 3HJAA 2FW7A 1XHLA 3JB9D 3IFSA 3LRPA 2JI4A 5KVQA 4DPLA 5DCYA 3FTFA 1JPVA 1YVRA 7YASA 3BTSA 1WUIS 3AP3A 5DYIA 2OR3A 2YIMA 3WSTA 4JSTA 1GA6A 3GRRA 3QHAA 3ZS9A 1L4UA 4OJKA 4JUCA 4WXYB 3IUBA 3KYCA 2K7ZA 1J20A 3JCZA 5IN1A 4EYOA 2RQUA 2KLBA 4G0VA 3CCUQ 2BEUA 4PJOE 2KSQA 2JI8A 4OP7A 2FPFA 2OHIA 3DJYA 1VLLA 4XLCA 1Z4LA 2YRCA 4XLAA 3RK1A 1B0AA 4MGIR 2ZSUA 1IUNA 3RYCA 1F7UA 3NGLA 1KYTA 2B86A 2HSPA 3T5AA 4L8YA 3ENVA 3EIEA 3PNLA 2G5GX 2Y1GA 4F6RB 2WJVA 4CMGA 5KWIA 5GAOm 2WWGA 4J03A 2VTBB 2FK8A 1MV5A 1O4VA 1OHHD 1X7ZB 2DBRA 2J59A 2JVIA 4OKSA 2BZSA 2MYNA 4QO7A 1G66A 2AQ8A 3PNPA 2XMRA 1QCNA 3G05A 1K97A 4LZOA 2FRDA 1PT7A 5TS2A 3WWYA 3B2QA 5L8VA 4AKSA 1RAHB 1P44A 3R9IA 2CZGA 3IIIA 1WLSA 3E0XA 4I50B 5MFZA 3NTOA 3FD8A 4D97A 1QK5A 3T4EA 3OQ1A 3HMKA 1VQ7B 4QSHA 3PFBA 2XD9A 4J9BA 4DBFA 4FZRA 2JGLA 1GKLA 2PQ6A 3AC0A 1Z5GA 1OZ0A 1Q3HA 3LK6A 3NAZA 3WLPA 4AMUA 2NP7A 1NKSA 1IHDA 4QECA 1QVGP 3NHFA 2EYXA 3CS3A 3L9WA 3QXSA 4HDNA 4YJ2F 4BNMA 1T2VA 3ETJA 2VIIA 4RGVA 5ALIA 4CM7A 3DUFA 3VPFA 4LX0A 4D7AA 1OYOA 1NIPA 1I6MA 3FWNA 3GU3A 3I28A 3TGLA 1ODJA 3IAHA 2VHEA 1SBIA 2VSXA 2X22A 3EXHC 3R7LA 3OAAA 1T2FA 3D6VA 1THZA 2YFYA 5DI3A 2XKKA 1CQJA 2JJYA 2A9KA 4GQIA 1FIUA 3TEMA 1JR3D 1QOPB 3PG5A 1KDPA 2IGTA 3IAEA 1WAMA 4JBNA 1H6DA 4II1A 3ZI7A 2DIGA 4DDMA 1U8TA 4EJFA 2GFAA 4C2UA 1ZQ1A 2RCNA 5CQYA 3OWOA 3V4SA 5JQWA 4U2GA 1Q1GA 2Q7DA 3AY0A 2VJLA 3S8EA 2QENA 2Z4TA 3CMMA 3OTWA 3EDRA 3WVNA 3AFMA 4X7EA 1VM6A 4EA8A 2L3SA 1OVGA 3OM0A 4GOOD 3RIRA 5B7GA 1RYNA 4HGNA 2EFIA 3UKJA 1BE0A 4QUKA 4YV2A 2DLCX 2JFPA 1J8MF 1HG1A 2X4GA 3MZ0A 3A8HB 1Z7GA 2BR5A 3SQNA 1RDFA 4DCJA 2VHWA 2E3IA 3F46A 1S02A 3LUHA 1EJ6A 1DEXA 5FOQA 5ITZB 4LD9K 2H9AA 4UZEA 1TOAA 2UKDA 1CEYA 5FF9A 3RT1A 1I3KA 2Y0EA 2VA8A 3KALA 4PRKA 5KWEA 2LJ1A 3UT0A 9ABPA 1Q0LA 5K99A 1W25A 3I4FA 5M2QA 4L4RA 2KY9A 5ED0A 4M78C 4ALMA 1EFUA 1G8YA 2JW4A 2NO6A 3N0WA 1ST2A 5AM1A 4YRBA 4Z1MD 5ITWA 3H4IA 4DV6B 5JJKA 2L69A 3QELA 5HKKD 4FK8A 1BWPA 3DBVO 1YCHA 1JDBB 1NMXA 2Z3ZA 1L7MA 4IS2A 2NQTA 3KZKA 5CVEA 1US8B 4GNRA 2HXSA 4RVHA 5HM6A 3HJHA 4FYWA 4V0SA 3PNVA 3ULKA 2GVNA 3HPQA 4PHHA 4JELA 2HR1A 1NVBA 1RJEA 4LXQA 2OBMA 4B9EA 3ND6A 1RI3A 3TEEA 4S1WA 5D3KA 1JDSA 2ODEA 5H9WA 3G0IA 2YJ6A 1N2SA 1RXVA 1QGUB 1XQWA 4WDRA 1BVRA 3HLYA 5BOSB 4C5EA 5CIUA 1KAGA 2Y27A 4L7VA 2NQ2C 1SBTA 1UKEA 2BFEA 4PG5A 4WZBE 2ZB2A 3V5NA 1YHNA 2ZCJA 1VZ3A 2QZJA 4IDPA 1LW6E 2F7SA 3PDIB 3AXTA 3CCJA 1QK3A 4KE8A 4LE1A 1V8BA 3K0FA 3JCMP 4MJXA 4Y6SA 4BUZA 1KQSB 2GGSA 4P22A 2HSZA 3BSSA 2XB9A 4M2LA 3TKLA 3PC7A 1DG3A 3NHBA 4KW7A 3THOA 3W2TA 2JT4A 4AS2A 5JISA 1ZIDA 4I08A 4Y2RA 1JDPA 2GHRA 4ZI7F 1TD9A 4YQEA 4E46A 3ZGLA 1VL1A 4KNWA 4UUPA 4BPBA 3M3DA 3SLDA 4EPCA 1SUBA 5CX1A 5SY4A 1R9GA 4D4IA 4B47A 3ME5A 4JDUA 4LOLA 1NA5A 2ZANA 4LRQA 3P9YA 2DQKA 3TGWA 2EZTA 5J26A 4FVTA 5J5AA 3LWHA 1U3TA 1Y89A 3GFOA 3OF2A 3E15A 4C2BA 9ATCB 5HK9A 5CCBA 1B1AA 3MB8A 2B8EA 2WSBA 3LUAA 3T3GA 1RABA 1I5LA 1YAJA 4MVYA 3JZFA 2UXDB 2VP6A 1HLPA 3C4JA 1YWGO 2X5NA 2RK6A 4FNAA 3P9CA 4M37A 4YFVA 3T3HA 4BO0A 4A63B 1OBOA 4YDHB 4E1VA 2BFWA 4ATNA 1RQPA 3KXLA 3IR5A 3H75A 4UEWA 3FNGA 4ZO7A 3A6HA 3G2OA 2XEXA 4ZQBA 3FOBA 3T61A 5F9FA 2YOGA 4WK4B 1OH6A 1GSHA 1N2OA 2P9FA 4J0IA 2ZQYA 3DTVD 5JYDA 2GXAA 4DVJA 4J8PA 2PUTA 3LECA 4GMGA 3T4PA 2ZUEA 1M9NA 2EEPA 2Q5OA 3TINA 4GC5A 2KRMA 4F17A 5B37A 4E5VA 3KXPA 5HRUA 4OQ4A 2NTYC 2W2PA 2X5OA 1SIUA 1T25A 3V1YA 3WGZA 2IEIA 1S8NA 2RHWA 4EW1A 2IEGA 3D3NA 3R6TA 2W9XA 2QTZA 4WLOA 1NJ1A 1TQ6A 1Z3CA 2B69A 4ZVUA 2RAPA 4NULA 1ODKA 3HB4X 4EB0A 2YCLA 4GSYA 4F3TA 2VYNA 3CF4G 1UBTS 4LJSA 2VB6A 3CUVA 3GJZA 3JCMh 1EA5A 3EBOA 3MWGA 2VH5R 4KWCA 4RQTA 3R5HA 4F6RA 1ZGAA 3GOQA 1HYBA 3ZIAA 3AIOA 3IUSA 2EG9A 3OCZA 4P7BA 4UE6A 5KAMA 4FBGA 4IIFA 3IILA 1X7ZA 2DT5A 4GKVA 3TRKA 1EWKA 4I5GA 1W36B 3AUKA 3MJCA 4ILEA 2M5SA 1HGXA 5EHZA 5COQA 3WLEA 1Z2OX 1PVDA 4QTUB 5EMNA 3NEJA 1Y33E 4D9JA 2FE1A 5I11A 1U81A 3AR2A 4IUPA 2WM3A 1QIMA 3SGLA 2QUZA 2ZPGB 5EZSA 3OHSX 3IOEA 2JZ2A 2V7QD 1OFGA 1C0EA 4LUEA 1YI2T 3CEMA 3CVOA 4X94A 3OOWA 3EG0A 3ICOA 5DK4A 1M90D 3CCRQ 1YI2A 1EB8A 3KJFA 4W6ZA 3WRYA 1N3IA 5E3HA 1VIYA 3MM4A 4G4SO 3DUFB 3L0ZA 3T7AA 2VYQA 2A0KA 1K06A 4OL9A 3P19A 5E8RA 1FTWA 1CUAA 2BV3A 2R6R1 3B2NA 3S2IA 1ONPA 2OUIA 4QHSA 1V43A 1G42A 4WZAB 1XWFA 1YS9A 2RG1A 1RC8A 3CX7A 3K94A 3KYBA 1I1NA 1USVA 2FWAA 2FSPA 4WLVA 4CW7A 1ZH4A 3KPJA 3QG5A 2JD2A 3MJTA 2E3HA 1NJSA 5KTSA 5KTYA 3FWZA 2ZXFA 1VJSA 1Q1ZA 2YY7A 3BWCA 3RVOA 3VAZA 1JTVA 4C7XA 4Z4QA 1N5JA 3GH3A 3Q10A 3MP8A 1R0BG 2DFVA 1O54A 4TN1A 2D0DA 2ZXEA 3E5NA 3O74A 1OIXA 2J5QA 1TEVA 3E3NA 3A7EA 3H1TA 3MAGA 1IN5A 2WB4A 3LLVA 2A28A 4XN3A 4HEA6 3T5TA 3VKVA 4AMVA 3FM9A 5I45A 2KB0A 3I32A 3KFVA 3GPIA 5H4HA 2NACA 2WTMA 4UNIA 1DXHA 2ZSHA 4QDKA 3TSWA 3X1XA 4EGQA 1NC3A 1CDZA 4C8QE 1XDUA 3JQPA 4A73A 4CCYA 1E2DA 4X0CA 3PIIA 4UTRA 3SQWA 1QYXA 4A9AA 2PH1A 2XADA 4K88A 1C14A 1GZ4A 3DH0A 3PUYA 4QKUA 2E9SA 2Z58A 3PQ6A 5CLLA 1W35A 1DBSA 2GBIA 3I09A 1KE2A 1SC4A 2DWCA 3A9CA 3HYSA 3GJTA 1BO6A 3OJEA 4UNQA 5DT2A 3PHJA 5FO1A 4GSLA 4DLXA 4C5CA 3ZCQA 2AKEA 4NE9A 3E3LA 2QTAA 4OIFA 4Y9DA 3M1LA 3PI6A 5AW8A 4JUFA 2DFTA 3SX2A 3B7GA 2RHJA 5T64A 4X9CA 4AF8A 1XQ9A 3G9UA 4GXNA 2MMCA 5AK0A 2JGFA 1RKXA 5CXSA 3IA2A 4B1FA 4OQDA 4YV7A 1OZAA 2G71A 3DEHA 2M6RA 4JJBA 1T6ZA 4MW5A 2A1UB 3F4LA 5EAIA 2OXIA 4YMTA 1A5SB 3R9KA 5A4AA 2ZTGA 1LRKA 1P4SA 1WKCA 2JFVA 2ZWVA 1EFRA 1U28A 3PPVA 1WIWA 1E5LA 1N8SA 1T6NA 4UUMA 3EEFA 3I9FA 4AWXA 3M2TA 4F0JA 1G7SA 3KSZO 3E82A 4HNRA 1DSSG 3HYNA 4QUEA 2B4QA 5FAXA 3TM5A 4MO2A 5DHSA 1WOSA 5E95A 2A9QA 5CB4B 3KD3A 4HCJA 2XCTB 2QR3A 2FW1A 3JD4A 4HAWA 3ER9A 1E2EA 1SXGA 3DVAB 1VQ4A 4X0EA 5D7BA 2ZZQA 3HA7A 4YMHA 4TXMA 1G5HA 1PYDA 1FW6A 2KK4A 4LE0A 4QVCA 4TLMB 4MDEA 3D2CA 4GBGA 4WPGA 5DNYB 2W2TA 4L75A 1KI4A 3KPUA 2DHEA 3DKRA 1VYUA 1PNVA 3R8CA 3M1YA 2JLBA 5DYGA 1LD3A 4ZPJA 2MSNA 1RXIA 1EWTA 1O75A 4KGVA 2APJA 2VP3A 4KO3S 5F1OA 2NU8A 2JDIA 4E5YA 5IC6A 2R85A 4EF5A 4TZ0A 3IEUA 2OBRA 5EWMA 5HIIA 3U16A 4XWKA 4MUBA 1IVYA 5JAOA 1TVEA 4PFKA 1P1RA 4BZWA 4CETA 2PSJA 2ZBUA 3ISJA 3AG5A 1KRHA 1UXHA 4YV1A 4OBEA 1EX9A 2EU8A 4YRGA 3AEQA 1TJ3A 3ED1A 3OQ5A 2H5LA 2JF0A 4MV4A 4KR9A 3VOTA 2RHMA 3L02A 4OXXA 4PZLA 3OB9A 3BJIC 1XMXA 4YRDA 2PS3A 2O3TA 2QRJA 2HV9A 3R5JA 5JAMA 4LC0A 2ZIGA 4OQZA 3ZTYA 4R1UA 4ZJZA 2K57A 2OGZA 2WWVD 4R0MA 2PSSA 5IAAA 4QYSA 5KI6A 4FFOA 3GJRA 3FBWA 1EE9A 2JBHA 4P08A 1SELA 5AM5A 1H6BA 4RLFA 4JS0A 3U2QA 4YY3B 4F86A 2WMDA 2QP4A 2ENMA 2PGOA 4QRDA 1KI6B 1UR5A 3OBYA 2HRBA 1U06A 3HU1A 1NQWA 1NQXA 3ND8A 1J5PA 2UXCB 1ZH8A 1DAPA 1ZJ5A 4IG9A 4AP9A 4GZMA 2VAWA 3A31A 3AT1B 4M7DC 1A7UA 1H23A 3K30A 4C2TA 3FTPA 1XVUA 4KN5A 2RKBA 1P4MA 2GLUA 3H2JA 4OHWA 1KOFA 4ZV9A 2Q3BA 1MT0A 3PUMA 2Q5LA 2VBIA 4U0KA 2O8EB 3WBJA 3H8ZA 4YB8A 1OXXK 1SCIA 4HXYA 1WXQA 4LZAA 2QD2A 4HFNA 4X1KB 2GFIA 2HQ1A 1HL7A 3B9PA 5T8KA 1OXTA 1P0CA 3N75A 4HS4A 1ZSGA 2DX1A 4JJ4A 5ALDA 4EBBA 2PBRA 2I22A 3MNFA 1SG9A 4Y6LA 5K05A 4O4HF 1TOVA 4WLEA 4AKTA 4OHYA 2OI3A 1YKSA 1PL0A 2WJZB 3K8OE 4JGIA 1WMBA 1B00A 1NQUA 3DMDA 5DTMA 1YZTA 1Z73A 4HK4A 4WECA 3A6GA 4Q48A 2WBLC 5CT4A 3EWSA 3CLRD 4FHEA 3LC1O 2BGIA 3PIOA 3C16C 1PP4A 3TQHA 4RE6A 3CCEA 1PHRA 1K0XA 1VI2A 2X0RA 3LA8A 4FGUA 3I92A 3BCSA 5JBIA 1YJWT 4OGGA 4QELA 2VC2B 4IIGA 4MVWA 1U7XA 1RCTE 4QGBA 4ND8A 4OMFG 1RMTA 2P9QA 4M75F 4WOCA 4LMBA 3DT6A 4D5EA 1YI2B 1NMSA 4RPJA 2HQRA 1QVZA 3MGKA 4AT1A 3Q3EA 3JZMA 4JSRA 3UAXA 1H3FA 5LOVF 2WC1A 2GCPA 1NVKA 4AY4A 4JX8A 3K6SA 1GPMA 5ICEA 5E1DA 5GV7A 1TL7C 4LOKA 2XOKD 1ZP6A 2JFGA 4EEZA 3ZZTA 3BGSA 1AQLA 1JEQB 4NCKA 4I36A 4QGAA 2NU9A 1V9CA 4OG2A 4FCTA 1H9CA 1F2UA 1KH2A 3V7WA 2J6IA 2FO0A 1UG1A 2YXBA 3DSRA 2OCXA 3ROGA 3BE8A 2KX7A 2B2XA 1EP3B 1EUCB 1GQSA 3E9QA 3PE3A 4NMHA 2O0JA 3L2ZA 4Y1RB 4LI3X 5LJ5g 4XM3A 1Q2XA 1SHZA 2G67A 4JQSA 4UOQA 2FZGB 3W2IA 4WNIA 5GONF 1SZDA 4KUGA 3UATA 4G23A 4MARA 1L5MA 4M78A 1WI7A 2IEYA 3UKOA 5G2OA 4A2QA 2VV5A 3ABSB 1EHYA 2V5VA 3DQQA 3DUWA 5AYVA 2DWQA 1DELA 4OB2B 2Z1NA 4PYMA 5FRMA 3ZYZA 5JNSA 3UCEA 3U60B 1N8RD 1ESEA 2WG0A 1U2ZA 3I61A 4E5KA 4JZ4A 3FKJA 3NHLA 3CF4A 4L8FA 4X8HA 5D2CA 1AVTA 1DADA 4X60A 2Z5FA 2G1AA 5JW6A 2YC4C 3LCVB 1T8UA 1ITZA 1XP5A 3OT4A 2EGAA 2J4DA 3JCMX 3VKFA 1LV8A 4MP8A 3CONA 5BNWA 2XW6A 1AN9A 4PN3A 4RULA 3N2GA 1CY4A 5AN9A 4GEKA 5CA0F 3RUHA 3ANYB 1XK7A 3PKZA 4UFPA 2QDXA 4FTWA 1MHTA 4R1LA 3P9RA 5EQFA 3W9SA 2R8BA 4LKOA 1G5PA 3ADOA 1NVMB 4XAXB 4N40A 4YEDA 1IU9A 5EIEA 2PWYA 3RADC 5D3QA 3L5KA 1IQUA 2WU0A 1M1KU 1Z38A 3JRWA 1ZOSA 4O4IB 3OD1A 4TTSA 4RTLA 3M6FA 2Q99A 4BE0A 4QNMA 3AT1A 1ADJA 4WGFA 4H4CA 5GAOp 1TNDA 1BIBA 5HFNA 3IS3A 3ZI0A 4F97A 4EJ6A 1AHJB 1WPYA 5ALZA 1JN0A 4KC0A 3ZJ4A 3F3SA 1EBFA 1OFUX 4FNMA 2AFHA 2A0UA 2ZQ5A 4KSBA 4TQAA 5B7QA 2O9SA 1AE1A 1BOFA 2P91A 4O8CA 3OEEA 1PJ6A 3QKSB 5BNFA 1SCKA 4CM4A 3U9TA 2PX0A 3F8WA 2VJQA 3BS4A 2C4KA 4OHPA 3M6WA 3QJYA 3HR4A 3HCPA 4MHSA 5A04A 5JMTA 2H1HA 4IXTA 4QU8A 4DQXA 1G8JA 2ZE5A 3RVJA 1C7IA 3LYHA 4NZMA 1JJ7A 2X5JO 3DMTA 4GH5A 2QRUA 3WXMA 3K70C 3HNPA 3BK7A 4IKEA 4JB8A 4MWOA 4QXPA 5CVJA 3NVMB 3B48A 4C2AA 3B2EA 2Q5IA 1RHMA 2CKKA 3CX6A 4DLNA 4Z49A 2G83A 1RHQA 5HOQA 4JROA 1CKBA 4OY3A 1JU4A 1WHGA 3CCMA 2VWPA 3TQOA 3LO5A 1C0PA 2LCCA 1LI5A 3DOEA 5AVQA 1LVGA 1W0CA 2OVBA 3I3OA 4ND1A 1DMSA 2OY0A 2M32A 1BE6A 2QQEA 4B6OA 2EBFX 1PEAA 1WHHA 1O9GA 5GAN5 3NBZC 4IIEA 2ZAEA 3HA3A 4KVGA 3I39X 3O7MA 3R0IA 1CUXA 1ZJJA 1AUQA 2AQIA 3PHHA 4OXKA 4QUHA 5J1TB 5A03A 2G5TA 5AIBA 1N2EA 3FSJX 3VMFA 1YQTA 3A6ZA 2MOKA 4BGVA 1HY3A 2WILA 1XMSA 1YGYA 3IO3A 3L42A 3U23A 6CHYA 2OBBA 5AYFA 2WLTA 2ZCFB 2C2YA 3JAKB 4CMHA 5C5DA 5IAEA 3A6DA 5SV2A 3ZV4A 3TECE 2DA9A 1IHWA 3SLNA 1Z35A 1HWYA 2FZGA 2DFUA 3F6PA 1B07A 4C92A 3X0DA 3K2EA 4F7DA 1KI6A 5F5LA 4GPD1 2GS9A 5IAYA 3DA8A 4M83A 4OHKA 5E6UB 1H0KA 4ZWNA 4BMXA 5CA0A 4DUPA 1N36B 5IX8A 2XKJE 1KBQA 2ZYRA 4DCOA 2V8BA 3LPAA 4FYXA 1XKTA 2ZTNA 1BXGB 1AT1A 1X8KA 2EP5A 2CXQA 2WD8A 3LW8A 2A92A 3JRXA 4PG7A 4NU5A 3WR5A 1FX7A 1G59A 1RSZA 2CXXA 2CJFA 3A36A 1IPHA 1FSSA 3A4LA 4QICA 4RIIA 4NCNA 3WGQA 1XQ1A 1AA6A 4OCZA 3TB6A 4WFJA 5GANh 4JPBW 3PQ8A 4V0ME 5EMHA 3QX9A 1NNEA 4MGZR 5JD3A 1ADGA 1JALA 1EJ2A 1Q77A 1T36A 4GMKA 6AT1A 4TZ6A 3A4TA 4L8VA 1NM7A 3JWIA 3OWXA 2OYNA 1VSTA 1U0GA 4IICA 3T5MA 2CY0A 4EEKA 3OYJA 4JP8A 4RENA 3N7AA 2X51A 3MUOA 3U7FB 3CCUT 2CNBA 4NABA 4LNUA 1AB6A 3OOJA 3EHEA 4FILA 3I5UA 4L8LA 5LQCA 3BWBA 4DA6A 4IIJF 1R9MA 1BU1A 1U04A 4B85A 1U1DA 2Y1KA 1UBKS 3F78A 1S3IA 1RLPC 3V7AA 2CXRA 3I2IA 4YJHA 3C12A 3WNCA 3ZHRA 1G8SA 2DUWA 4WXEA 5HZHA 3RWOA 4NHOA 3JD1A 1J0BA 2W4QA 2Y0BA 1ZUIA 3PHBE 1M0EA 4JYPA 1E1DA 4FW8A 3RTCA 1H6CA 5E7QA 1LDNA 4CGZA 5IC4A 1KFZA 4KRYA 3BNWA 5K45A 2QRPA 1ENPA 1GQRA 4HQRA 2OQVA 4A0RA 2CL7X 2XU8A 4RMOA 4BRSA 4KKVA 1KAEA 4B9WA 2EDAA 3UMVA 3UJBA 2G25A 4TQGA 3HK2A 3PITA 3EUAA 3B3QA 3R3ZA 1F20A 3HKBA 4Q7JB 3OUUA 3KWMA 4BXOB 3H86A 4NICA 1PS0A 2P9HA 2A88A 2BEKA 2Q49A 1GGEA 2ZWIA 4OQQA 5B6PA 1MOZA 1ZN2A 2VAXA 3GIDA 4U2FA 4U5XA 5DWVA 4PINA 5LFAA 3PVDA 1M1FA 3A8OB 4N0AA 3H16A 4LVOA 3DOIA 3GFGA 1AGPA 4GGPA 5LBTA 5KWSA 1COZA 4X7CA 4I1YA 3SIRA 3LUFA 5DBGA 4REOA 5IYZA 2DRMA 3U44B 3W0LB 1HT0A 3DZGA 3BULA 1FW8A 4J0CA 5TLSA 1H85A 4G1BA 3ROFA 4EQZA 5C8ZA 2PG3A 3TEFA 2KGTA 4MWDA 4RDCA 5AKEA 3U7RA 4Y6PA 5GAN4 5FBKA 3SEQA 4FYHA 1E9EA 3PDCA 2HDNB 1T2DA 4XVRA 4NS1A 4EPVA 2ORYA 1KY3A 2IU6A 5HKOA 1YULA 2P27A 2H65A 1P2VA 3C4VA 4LZLA 5FAKA 4YJFB 2EATA 5DN6A 3BPSA 2YIDA 4II3A 3QIIA 3JCMW 1B93A 2A7QA 4ZODA 2A2ZA 3GLGB 1GZHB 2GRAA 2XUAA 2G08A 2GQFA 2JK1A 1ZOPA 3K0CC 1Z6YA 4H2DA 5CKBA 3VJPA 3PTAA 3RTAA 1KNXA 4OHZA 3GY0A 2MSEB 3JPYA 4WNCA 4C6HA 4NJOA 3OQMA 2C9ZA 5F7XA 2KR3A 2E55A 1NRKA 1N8TA 3C3YA 4PRYA 3UNXA 2M9UA 4ZO6A 3WISA 2WUEA 2B1RA 1DAKA 2QZSA 3ADDA 2I6SA 2Z95A 2PLNA 3F73A 2IZ1A 4RTTA 2JZOA 1NXOA 4MVJG 2DXCA 1Z39A 4O1IA 4WNAA 1UD5A 1KQ3A 4ZQFA 3UN1A 1SKYB 2BIFA 4K9NA 1MX9A 1NY6A 5BQFA 1TXGA 1I9GA 3FNEA 2RF0A 1RLUA 3DO6A 3VDNB 1OXUA 2I4LA 1Y8RA 3FOWA 3FW1A 4LRTB 2G9NA 4LOJA 3JQCA 4MYRA 1E4EA 2DX7A 2H07A 2PSFA 2SICE 3B36A 3K7EA 4H16A 3RIEA 1KQ1A 2C3PA 3TNJA 3ZE6A 2F43B 3DM9B 5C46F 4K6HA 2W22A 3M53A 5LNK1 2DAPA 1T36B 1AF7A 1IZ8A 4YUYA 2X8JB 1QG6A 2GK6A 1RYFA 4ESVA 3TQFA 2IBSA 3ICPA 5EQTA 5EIXA 2N46A 2QYHA 4QPZA 2DQ4A 2P9BA 2P0PA 3CMEB 3V8PA 3ICEA 1DKNA 2H59A 2ONCA 4KQXA 5IT9A 2ZYTX 4NE7A 3UF0A 1SUSA 3TTUA 4QT4A 1CY1A 2GA9A 1Y4ZA 3V2HA 1ZSZA 3CCRB 5E3JA 2P2CA 2I2LA 2W0SA 1LBHA 1PLLA 1A76A 3QBYA 3FZEA 4U1RA 5K5EA 4XWWA 2Z9CA 1V11A 5AM0A 4DS3A 1GKKA 1T2EA 2BHSA 2JW5A 2X14A 2Z2IA 1M73E 2JARA 3LQ2A 4L3VA 1MV8A 3L1IA 2NVBA 4Q4LA 3TZCA 4WBNA 1ISJA 3OJCA 1QDLB 3PWKA 5JCXA 3CNBA 1DVRA 2IYLD 4J0JA 4XWAA 3ZLBA 3GZ4A 6ADHA 4XFKA 4DCVA 2I67A 1M6VB 2C06A 3DDUA 3UH1A 4PG8A 5JATA 5GMKh 1QIJA 3ONYA 2FR0A 2G4CA 3QENA 2KBTA 4HRYA 2GJRA 1K9VF 4WHMA 1OFVA 3FPGA 2ZL6A 1URPA 2FDXA 2JFZA 3H1BA 3MT7A 5JJBA 4AY2A 2DY1A 2IZ5A 2O6LA 4D26A 3WQZA 1ZD5A 4DMHA 3OHPA 2I34A 3MGCA 5DX0A 3FWHA 1VSBA 1D2RA 5EG2A 4G0WA 4DY4A 4F72A 3DEIA 4HLUC 4L9RA 2EAYA 3ESBA 4DLTA 4FYXB 3WVDB 2K3YA 2IYYA 1X92A 2RQWA 1N9RA 2HV8A 1Y07A 3LDFA 2D1TA 3Q5GA 3QIAA 3IT2A 1SU6A 3UB2A 1RQGA 1M2WA 3DS8A 1G3MA 1I7SB 4RWEA 1E7SA 1N1GA 3TR5A 3DMTC 4ZOLA 5JYBA 4UVGA 2QLMA 1I6LA 5FPQA 4CDNA 3UHFA 4DIUA 5J5VA 2L3PA 2HWUA 3A0UA 3C8MA 2JN0A 4EABA 1O1YA 1E3LA 1K8QA 2C4VA 1DMRA 1T3GA 4HJRA 3CVWA 3FFXA 521PA 3FPLA 5JOQA 3O8RA 1QQ6A 1YITQ 1X9IA 4YP7A 1N1MA 2WFLA 5ALQA 2QRKA 3D4PA 3WGJA 1KRWA 1AO3A 1XCJA 3HDGA 3ESRA 4ZAXA 3ZU3A 2FZCA 2PZMA 5EZYA 1SG5A 4JJ6A 1IJKA 1HVXA 2DERA 3EZ2A 3NTUA 5H5JA 3CY6A 3UBMA 4FOPA 2CSIA 4ZCQA 3FB4A 3MYRA 4LF6B 2QUHA 4E2YA 3SKBA 3MS2A 2OD7A 5AR1A 4WNAB 2Q2QA 5ULLA 3VSEA 4YLYA 1EUYA 1B6GA 3VDXA 1KFCB 2HNBA 4PC7A 3DE3X 4PLCA 5JD4A 3HCFA 1E0KA 2V3WA 2YWHA 1JDJA 1GUBA 3MJSA 4FDLA 3TLMA 1K3TA 1V29B 4F96A 1E89A 4CNBA 4TRMA 2ZT7A 4MI9A 1E5TA 4NONA 1QNFA 4J29A 4Y1EA 2YDLA 2WJ6A 4PXSA 4Q3KA 4IS3A 4UHKA 3PENA 3TLKA 4DV1B 1N3YA 2ZVJA 2FEXA 1Q12A 4Z7NB 4BXOA 2O31A 2HT6A 2V6BA 3JQBA 1IBSA 1X01A 1JFSA 2W6NA 4WQMA 1DXQA 1X1AA 4OSPA 4EL0A 3TL3A 1EKXA 3RR6A 2PUJA 4IDFA 1UT8A 2BR4A 3VSDA 4ARZB 4AP5A 1ZHOA 2XUOA 3B3GA 4FGWA 2KXCA 2GJ9A 3ZZ0A 3U81A 3H0EA 4GBMA 4R6WA 2CWDA 4RG2A 3BG5A 4Y2QA 1NN0A 1LCKA 2YMPA 2MWOA 2EZ9A 2PT7A 1NB0A 2Y92A 3DT8A 3JZDA 3UJDA 1JIJA 2BFBB 4B43A 3X25B 1RWMA 2H8GA 2Q8NA 1BJTA 3GMIA 4JV5B 4UPDA 2Y0CA 3UMCA 1ULUA 1N1DA 4AN4A 4B79A 3CEYA 1Q17A 1ZQ9A 2DKFA 1QF9A 3JQ6A 5K8LA 1BYMA 2PANA 1N78A 1EE1A 4IDCA 3NX4A 2RH8A 1ZD4A 4BKUA 2RC5A 4G6ZA 5E3IA 3GLIE 2CD7A 4GL2A 3D81A 4EJSB 3ELUA 5CD9A 3PRKE 1U0LA 3EUEA 1ZZEA 3GUCA 3NHRA 2E10A 1E0DA 3QY9A 4TVKA 4UQLA 3I37X 4HSEA 3M1AA 2OYSA 4KN6A 2AJBA 4L74A 4OVKA 3T9EA 5KNBD 3W34A 1XCBA 3FVWA 1PJSA 1TM5E 1U8ZA 3KQQA 1RWKA 4JH0A 4P26A 5HMLA 1T0IA 3MT9A 1OBCA 3B6JA 4KXYA 2KI5A 1MMNA 2HUNA 2P4EA 2YICA 2GKGA 3OEHD 5BSMA 5A7GA 1UHFA 3VU9B 1B41A 2Q9CA 4U7PB 1WB5A 4OGFA 4TXHA 2HCFA 3SKYA 2W2MA 2L3RA 1V7QA 3QTLA 4LGVA 5AVYA 3AF1A 1CP3A 2Y66A 3AEZA 3BGIA 5I9MA 5DIZA 2HDOA 3CMEQ 3RUPA 1FE8A 1GITA 1U0BB 2YWRA 1JT2A 3B1WA 1KFKB 4V39A 4TGLA 3WP1B 4PLVA 3BWEA 3KQLA 3HQ4O 1FU4A 4UFOA 1U8YA 3QVOA 4YNBA 3FHLA 3GLTA 4N1AA 2BLLA 1NHWA 3ZIAD 1U63A 4BNLA 1D8TA 2XD0A 1TF7A 4JA2A 1DRUA 1T0PA 1X0VA 4UVDA 3IURA 3I8OA 5KTNA 2WFLB 4CWAA 1S3FA 2NNWB 2NXCA 3HWWA 4PFOA 5A0VA 3MBKA 2WU8A 2XLCA 2FZCB 4K40A 3VU3C 4H3HB 4W5RA 2WVHA 2Y1DA 4RJ2A 3SDSA 5L7TA 1PHTA 3PHLA 3CCQQ 2R1VB 1ZSZB 3CCRA 4JJNK 4IX1A 4LJ7A 1TEXA 3KSMA 4JKYA 2X4JA 4GLMA 3AJAA 1DB3A 3CCRT 4RK5A 3KQTA 1KP9A 3LZ6A 4GQAA 4EKEA 2JFXA 2O4XB 2XYPA 2AMLA 1VQ4T 4U7FA 4W1PA 2HPZA 2X3WD 3QXJA 2Q2WA 4AJ4A 4LI0A 4M6WB 4M7DB 1Q7CA 2WAXA 3QE0A 4ZVLA 1FC0A 1PUIA 1MB2A 4LRXA 1IXRC 2R48A 1EWYA 3I0ZA 1V48A 3KPVA 1Y0BA 5CVUA 3RU9A 3WLHA 4F2DA 4PNOA 3M49A 2E6NA 1JECA 3NALA 5D00A 1TW3A 1Q86U 3GGCA 2PZBA 4LYEA 1D2CA 5IKPA 1AHHA 2H5IA 1PL8A 3DXYA 3DWFA 3LL7A 1TMYA 1NY5A 4MR8B 2DTIA 1NJ8A 2YOFA 3WG9A 3ZLTA 4C4AA 3EGIA 3M70A 3PV0A 3BB1A 3ET5A 3ICVA 3LNNA 1RW4A 1FLDA 1XX6A 2VG8A 1J1UA 3IQXA 4F8YA 3F9RA 4DOVA 3FPFA 4HMPA 2B8AA 5ESDA 5D01A 3ZN2A 3JQAD 2ZBRA 4DW8A 4YT4A 4R1SA 4PJOD 2D1FA 3ZCTA 4B81A 5KC8A 2HL5C 1FYNA 3SNHA 2R8RA 5KTKA 1E3EA 5IXFA 2H08A 3KE8A 2I9KA 1KC3A 1PTJA 3W2GA 2QW8A 1YF3A 3OU2A 3LY7A 2F17A 4P2GA 3IPYA 1AG9A 3M6AA 4NAHA 3NOOA 2I65A 2GD2A 1VL0A 2GM9A 2REBA 1EH5A 5BSUA 2NZXA 2YS6A 4CE6A 3LWBA 4A0GA 4XLEA 1GCIA 1WSDA 2Q6TA 1BTOA 3EWAA 4LTMA 1JBQA 2D0IA 4C0GA 3B85A 3UGTA 3AFIA 5AHKA 3R6NA 4QUZA 4RVDA 3ZIUA 4I19A 5H81A 3I55Q 1C9DB 3HZZA 4I55B 2PH7A 1FXUA 1XTQA 2O20A 3ZCPA 5BQOA 3I64A 4BEWA 4DYVA 2RHUA 5GAOl 4DQLA 1CK4A 1U1TA 3PNQA 2M98A 4RK6A 1D8AA 3W4KA 2YVQA 4KT0E 1E5QA 3ZDBA 3V6LA 1VQPB 2I7TA 3HZRA 1RYMA 1LPNA 3E2UA 1YB7A 2D5AA 5CKEA 1A7KA 4BNGA 4G36A 1FQOA 2REXB 3CPFA 3IQFA 1EHIA 3MIIA 2VHTA 1YJ5A 2WPDD 2WUWE 1WTHD 3WYBA 1I1OA 2VHZA 2HA5A 2RNAA 4BDZA 1VJRA 1WXHA 2IXTA 2PGAA 3G0GA 3OJ0A 3Q98A 1N8RR 2GXQA 2WWFA 5DSTA 2GBLA 4B4DA 1GEEA 4EZIA 4R98A 4ZIRA 5JXIA 1CNEA 3TIIA 1KQSP 3TCNA 4RY8A 2G9QA 1RBZA 4BTEA 1YFKA 5HGJA 5M04A 3U4QA 3N7TA 3E27A 1E3QA 1NURA 1X1RA 4QQNA 4WJKB 1AH2A 3Q7TA 3DBIA 4GO1A 4WXRA 1SRQA 3GB9A 3VR5A 1FDTA 2ZSBA 2X4IA 3P0JA 3TEJA 3FLGA 3CLTD 3IE0A 1FP4A 2PRKA 3B9BA 1YUBA 1DLJA 1NHGA 1U7UA 3NHZA 4N6OA 2ZSKA 1Q1AA 3OESA 4C92F 3FGOA 2YRDA 1QHNA 4C4RA 2VJJA 5LQMA 4M6WA 2YJ4A 5DNAA 4JT9A 3CCST 1LNSA 3LHKA 4IJUA 3EFEA 2ZDGA 4OHVA 3DDYA 4FI3C 3BCDA 1U3WA 4CCAA 1FLVA 2NAPA 1G0NA 3RR2A 1VPEA 3H2IA 3JTEA 4CKBA 5KNDD 3GA7A 1DWOA 5AI8A 4AZWA 5CM8B 3GLHB 2OG2A 2YRFA 3ZWWA 3PF9A 1NG1A 2PNJA 2V9CA 1QWSA 1QTIA 4FMDB 2WYIA 5TQ2B 3MCUA 4BVLA 3DYBA 4RVSA 2PS9A 4KUEA 3KTDA 5CYFA 2O2EA 3WYEA 3G1JA 1SWVA 2QGNA 1T9AA 2J3KA 4PNHA 4Q4DA 5KNCA 1A72A 3DEAA 3KKMA 4JR2A 5HS6A 4DQ0A 3M8KA 4UCWA 4DLVA 1S1NA 2X4XA 2HK8A 3F67A 3GLQA 2GN6A 5L6MB 1FDWA 2VT2A 5BWBA 4LRWA 3KYCB 4H35A 2MPXC 4RKEA 4V1CI 3C87A 4Z9AA 5L3SB 2AI1A 2HMSA 1W36D 2WUGA 5CVIA 1U0RA 1WHSB 2HTEA 3AHEA 5CNKA 1H2RS 5G1PA 1CJCA 3NE5B 3O2JA 1OB2A 2QN6A 4Q05A 1U0NA 3KU4A 1D4OA 4IVQA 3TVYA 1VBFA 4HWPA 1JQEA 1NXVA 3B53X 3ZCUA 3CT6A 2NO4A 2QXUA 3VR6D 3ZWYA 4UE2A 3L4KA 5GMKl 3Q8LA 3GN2A 4TLLB 4YWJA 3VR5H 3V8BA 1DE0A 1PUJA 4P35A 1U0EA 1U8CB 5GANf 1R5JA 1Q82R 2IA5A 5FA6A 3BQ9A 4HGYA 3O8LA 1A2BA 2RK2A 3V3KA 5KB3A 3TMYA 1NG2A 2DT8A 1Z5PA 2WF9A 4EQ6A 2XR1A 4Z7JA 4ZGWA 4LC9A 4M86A 4PCLA 1BEUB 4OO3A 4Q6BA 2Z6AA 4MQFA 2G70A 2Q9AA 1ABQA 3OCCA 4R1QA 4EPYA 1E7YA 2V6GA 3OPXA 3QIVA 4F46A 4BO4A 1NVAA 2D8MA 4NG5A 3GFRA 1ZJ6A 2VDMB 1FFHA 3PLNA 4WOKA 1ZGZA 5EUBA 3RJ9A 4QXQA 2WYUA 3EVGA 4IDDA 3UWPA 5I9BA 2OHOA 1YJ9T 2DCUA 5FADA 1QYCA 1EVIA 3OE4A 3QKJA 4AICA 1FFGA 2ANCA 2AYYA 1WXFA 3OY2A 4LYAA 4ZT4A 3AHJA 5H59A 1M27C 4ZEWA 1QHHA