2DEUA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
364
structure length
364
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
total genus 85
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2deuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2deuA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2deuA01
2BN4A 4TMWA 1SKQA 2QUJA 1QRUA 1GJRA 3J81k 2JANA 3FDXA 2Z3VA 3RJZA 1EWYA 1O95D 4EG8A 5EMNA 1NUTA 4PC2A 4MUJA 1N2IA 2NSYA 5GV7A 1U2RA 1OGJA 4EH1A 1O97D 3TNJA 1WXHA 5LLTA 1GR1A 3P52A 3CW2A 1EFPA 5J58A 2E1RA 1J09A 4F4HA 4A91A 1U3DA 3GLVA 2OTLB 4HE6A 1OWPA 4MUKA 1VQPB 1YI2B 4S1OA 4ZV4A 1G8GA 3FPKA 3WNCA 3ZBTA 3QTTA 3HV0A 4NCNA 1GLNA 1QQTA 2BMWA 2VNHA 2A7XA 4JFAA 1N2BA 1QVGB 3ZJTA 1KH2A 3I56B 1MJHA 4DQKA 1AMOA 3LOQA 1QG0A 5HG0A 2CV2A 1MB2A 3NBKA 1HYBA 3IH5A 3IOCA 1EP3B 2I1LA 3ZIUA 1O5TA 4AF7A 1KAMA 2IJGX 4NX2A 4XFDA 1G7CA 1YUNA 4B3XA 2VTBB 2CSXA 4ACAA 3ES9A 3H05A 1M1KD 3ISJA 4L2IB 1ZM9A 2AHOA 4NBSA 4KR7A 4ZT6A 1VQOB 1JJ2B 3CVYA 1Q81D 3M5WA 1WJGA 2O5RA 1KQNA 4DDHA 2GM3A 1JMVA 2YXNA 1G8FA 1QGYA 3RK0A 1IB0A 4LBVA 1VQKB 1JIJA 3FWKA 1BJKA 2YY5A 3IUEA 2VNJA 4B43A 1JZSA 2QTNA 2A4MA 4DLPA 1EJ2A 3N9IA 4YHBA 1I6MA 2VNKA 2OTJB 4R71A 1Q77A 4G1VA 1EFUA 3I1FA 2A88A 1D1NA 3CCUB 3FNRA 3IMGA 1F7VA 3SEZA 2Z08A 1NUUA 1T6XA 4EG1A 4FZJA 3AVTA 1PFUA 2QMUA 4YAFA 3ND7A 3PRHA 2H29A 4U63A 3COZA 3AIIA 4ZT4A 2BYTA 3CCQB 1TVCA 1X8XA 3MUEA 2B7LA 2A1TS 4Y7CA 1T6YA 1OWOA 1QGAA 2RD2A 2B7CA 2H2AA 3LCJA 3F3MA 2A1UB 3U1VA 1EUQA 3N8HA 1JEEA 3AKZA 2PIAA 3FIUA 1VQMB 1KD1D 4ZCLA 1O96B 2VNIA 1K73D 1IQUA 3GMIA 3ZXSA 3COVA 3FI0A 4NAUA 3JQQA 3PNBA 3FETA 2BM1A 4RD3A 3U6BA 4U8HA 1GTSA 3ZJVA 2CT8A 1O97C 1BQEA 4MW1A 2DERA 4RD6A 1KP3A 4L2IA 4RUKA 1EFVB 1O0CA 3H9BA 1TYCA 1V8FA 2A1TR 2J09A 2BSAA 3IVXA 1WXEA 3E20A 1YHQB 4ARCA 2XNCA 1VQ5B 1KJZA 4B48A 1JA0A 4C43A 1M8GA 1B6TA 1M8JA 1JA1A 1KORA 2AZXA 1XE1A 2BTEA 4PC6A 1T6ZA 2GPJA 1ZM2A 1YIDA 2VXOA 3AVXA 2IELA 4HE5A 2J7KA 2XEXA 1G8HA 4ZCRA 3CA8A 1T9GR 2PFSA 2ZITA 1O94D 4CT0A 4KPUA 1HA3A 3QE4A 2HDNB 3W5UA 1TLLA 2RC5A 5FA6A 1CQXA 1N77A 1ZUNB 3QE2A 2QJOA 4JZYA 2OK8A 3ZZUA 3INNA 4MQ6A 2X0KA 1ZJWA 3UOWA 4Y9UA 1VBMA 2QEXB 4RPIA 1XNHA 4I6GA 3WYAA 3RBAA 5TR9A 3Q10A 3G71B 5TEVA 5F23A 4M0LA 2BGJA 4N3NA 3VNVA 1PG0A 2X1MA 4EGAA 4WSOA 1ELOA 2QUKA 1WXIA 1QGZA 4M1KA 3Q4GA 3COYA 4LBWA 1F60A 2AKEA 4MUFA 1JIIA 1O6BA 3KT3A 4ZCMA 1I6KA 2PIDA 3OZUA 3QFCA 4YP7A 1S4MA 1Q86D 2QTZA 4YAUA 1QNFA 1B23P 1ZM3A 4QHYA 1GAQA 2X3FA 4MW2A 5LFAA 4ZT2A 1KC8D 1EFVA 5TS2A 3FOCA 3H97A 1VQ8B 4MW9A 4MVXA 4BWVA 1NYLA 1NP7A 3AG5A 1FNCA 1JEDA 1JIKA 1I2DA 3HL4A 4ND7A 4XSVA 3TZLA 2CV1A 4DQLA 5J59A 2PG3A 4P2BA 1KQOA 1M8KA 4LBYA 1JZQA 1K92A 4JYZA 2Z09A 1QFZA 4MUHA 4RD0A 3W5VA 1EE1A 1Q11A 2GOYA 2TS1A 2BM0A 3Q12A 1EFTA 4HPWA 3CC2B 2D5BA 3W2IA 3UMVA 2DETA 4CDMA 1FDRA 3CR8A 3OP1A 4H9GA 1TUIA 3MLAA 1WKBA 2ZP1A 3IMCA 1K4MA 1OBCA 5H5JA 3VU8A 3PXUA 4HK4A 3A04A 1R5NA 1QU3A 3AVUA 3ND6A 3DO8A 4Q7JB 1H85A 1GN8A 2YWGA 4TMZA 3G6KA 3CVVA 4PC3A 1S0UA 2OQ2A 2DEUA 1OWMA 3C8ZA 1QVFB 3X1MA 4MW0A 4MWBA 3IODA 2V0GA 2YWHA 3HZRA 1M83A 1WOYA 2JA2A 4DNXA 3DLAA 1EUYA 3WXMA 1MB9A 5THXA 1N2OA 1O94C 1DDGA 3CLRD 3WBJA 3D6UA 4B4DA 3FHJA 3ND5A 3CCVB 4P6VF 4X0EA 3CCSB 1R6UA 3SZ3A 1VBKA 2CUZA 1CNFA 4K1XA 5DB4A 1IJFA 3OTWA 1NUSA 2PXHA 3FY4A 4B47A 3ZC3A 1TYAE 4JXXA 5H16A 1R5OA 4MW6A 1MBZA 3SP1A 2YWFA 3N2YA 1BX1A 1TYBE 4MLPA 2B7BA 2ZUFA 2D13A 3MXTA 4U9UA 4Q93A 1H3FA 4MVYA 4EG6A 3VO1A 2YWCA 1U0BB 3OJWA 2QUHA 1QRTA 4CDNA 1K9MD 1I7PA 5KHAA 1GO2A 3HMQA 3L92A 2DPLA 5LM3A 3MCAA 1JHDA 3JXEA 4QREA 1N8RD 5KWVA 3DPIA 4EG7A 3OJXA 4G5GA 2PZAA 1J70A 1OB5A 1JGTA 1U7DA 1XB2A 4RJLA 4FWTA 3AFHA 2PLFA 1BX0A 2RE8A 1WQ4A 3IDFA 3CCMB 3FG9A 1B2RA 1J20A 3AL0C 1UMKA 2C78A 3V76A 4GRIA 5FO0A 1FYDA 4Y9RA 1MAWA 4K03A 1H3EA 3ZZ0A 4AC9A 1IFXA 3GUZA 1O95C 1FNMA 1M8PA 5FO1A 1MOPA 4EG5A 2QJTA 1KRHA 3ZUGA 1COZA 4MAFA 2VTBA 5BNZA 1T9GS 1K97A 5IHXA 4MWDA 1KTVA 4EF6A 1F9AA 3B8HA 3G59A 3LVBA 1KK1A 5AN9A 4MVCA 4TS1A 1D2RA 3L93A 3CMAB 4MWEA 1MAUA 1FRQA 1IQRA 3MMPA 2DLCX 1F20A 4OUDB 2CV0A 2J08A 3ZBUA 2XRYA 4QFMA 3QFTA 1R6XA 2NPFA 3SEQA 4MW4A 4AS1A 3WNBA 3P0IA 2EJCA 1ZH0A 2EFGA 4TMTA 4YMIA 1VL2A 1K4KA 2IP1A 4AF6A 3DV2A 3WY9A 1OB2A 1NUQA 4ARIA 4ZT5A 2BF4A 4PY2A 3A05A 3KT0A 4MUGA 2HGZA 1QFJA 2EL7A 1FNDA 1N3LA 3I05A 4MVWA 4PBRA 5AHWA 3RK1A 4PC7A 2RC6A 4NZPA 1GTRA 3AVYA 4NATA 4I6EA 1N75A 3CCRB 1PFVA 2A1UA 1YIJB 1N2JA 5DK4A 4DE5A 1UFVA 2NZ2A 1EXMA 3COWA 4ACBA 5DEOA 2AG6A 4ZT7A 5KCMA 4NDAA 3AVVA 1O96A 4MUNA 4YP6A 2CRVA 2WQ7A 1N0VC 1F7UA 2D54A 3KFLA 3I55B 1MRZA 3TQOA 4BPRA 1U3CA 4GU5A 1VQ4B 1TFUA 2J07A 1QRSA 2G36A 4HJXA 3QFRA 1EFPB 1N2HA 3AG6A 4YBRA 2DR2A 4JXZA 5JBNA 1JB9A 1OGIA 4YP5A 5HUHA 1GAXA 1AIPA 4M53A 3CXCB 3CCJB 5DSZA 4LC0A 3IOEA 3IOBA 3MMXA 4PBTA 2OV4A 1M1ZA 1KH3A 3PNVA 4R2MA 3JQRA 3W2FA 1SURA 4OUDA 2R5WA 2X3UA 4FN5A 4PC1A 2QA4B 3X1JA 3RHSA 2X1LA 1JNYA 3CLUD 4K0RA 3CB4A 3NV7A 1N2EA 4I6JA 3H99A 1K8AD 1VQLB 4EFKA 1J1ZA 4FK8A 5IJXA 1EP2B 1ZUNA 1IVSA 1NI5A 1KK0A 4M4SA 3WBKA 1WDTA 3CD6B 3ZGZA 3ZZTA 3HGMA 1W87A 2BGIA 3E1YE 3VNUA 4PGOA 4TN1A 1H42A 4EG3A 2WQ6A 5HUJA 2B5OA 1TQ8A 3ZXIA 3AGQA 4PBSA 3UY4A 4ND6A 2DXIA 3FH0A 3IUBA 3P0HA 4MULA 4NAHA 5DASA 2QUIA 2DCUA 4RD1A 1JECA 2GKSA 4TMXA 4J0QA 1Y42X 4ZCSA 1D8TA 1OBHA 5K0TA 4MW7A 1E63A 1W2BB 2E18A 4P3YA 1EP1B 2ZUEA 2J5BA 1YITB 4ZCIA 3QFSA 1W35A 5J5AA 4ZGNB 3TZEA 1GAWA 4B44A 2GQFA 2E0IA 1CNEA 3PNYA 1WZ2A 1R5BA 1G7SA 4MYUA 1N1DA 3D6VA 2E21A 3H9CA 3TQIA 3G4SB 3ILVA 1I6LA 2YWEA 5KSWB 2PMDA 1ZM4A 1KQPA 1Q19A 1TEZA 1VQ6B 2DUMA 3OZWA 1PFYA 3A4IA 1KR2A 3WNDA 3W2HA 4MUIA 4KR9A 4MUEA 4XFJA 1RQGA 1Q7YD 3IMEA 1KAQA 1N2GA 2JAXA 1N78A 2BPOA 5TEWA 3CRZA 4EG4A 3CLSD 2CYBA 4E1AA 1ILEA 1WQ3A 4ZGQB 4HJRA 4UZEA 4KKVA 3VMFA 2C5SA 4MW5A 4RCYA 1QUFA 2QTMA 2VYQA 3NBAA 3W2EA 3LE8A 3S3TA 4R2LA 1QUEA 3CC4B 1P7PA 4MWCA 5H7XA 5H59A 1OD6A 4QRDA 1J1UA 1X6VA 1FNBA 3FJOA 3E27A 3CPWB 3TS1A 3U6KA 1DG1G 1QH0A 1FRNA 3UK2A 1IQ0A 2DY1A 4M2LA 1OWLA 4RD4A 3CLUC 3JQPA 3K9WA 4U7JA 3CLTD 4N3GA 1V47A 2YWBA 4KPUB 4WNYA 3CVWA 3OW2B 1NJID 3P26A 1XNJA 3VRHA 5GV8A 1NZJA 1XNGA 3MLBA 1EFCA 1R6TA 5HXBA 4YAWA 2WSIA 1GVHA 2A86A 1ZH6A 1WY5A 4H3SA 1SM4A 1DARA 3W5HA 1E62A 1PG2A 3QTBA 1LW7A 4KR6A 1KQSB 3AGPA 4J75A 4J76A 3CVUA 1QTQA 2HCJB 5TV2A 4RD2A 3HFJA 3N05A 3SYTA 2XRZA 3G6EB 3QSYA 1QX4A 3CVXA 4G5FA 1D2EA 2XNJA 4R0NA 1A8PA 5JBQA 1QFYA 3X1KA 3KT8A 1MC1A 1IRXA 2D74A 5EKDA 2BV3A 1O0BA 1OWNA 3CLRC 3CC7B 1N0UA 2E89A 1F4LA 1CT9A 3RFFA 3PENA 4C0SA 1M90D 1KP2A 1LI5A 4G1BA 2BVNA 4UAJA 1WXGA 1VQ7B 2QDXA 4WQMA 3CCEB 1S72B 1NURA 4G6ZA 1Q15A 2WB2A 3SJZA 2C77A 2CYAA 4G5YA 1EXDA 1KH1A 2HMAA 2FX3A 2PZBA 4MYTA 3G5AA 1KK2A 2QJFA 5TGTA 2OK7A 3SZGA 4ZCTA 1H3NA 5K0SA 4AQ7A 4UZFA 3VGJA 1VLHA 4F3RA 1E64A 2R6HA 3B78A 2CFOA 4IW3B 4QBTA 1KK3A 1TYDE 4Q16A 2J4DA 3OZVA 3W2GA 1VQ9B 3VO2A 2CNDA 1NUPA 1XJQA 5TY0A 1FFYA 1NDHA 3CLSC 3K32A 4ZCPA 4DDMA 3UC5A 3ZJUA 5FNZA 1QU2A 1IHOA 2EIXA 3P27A 1W34A 1TTTA 1GPMA 1A8HA 1QJCA 1YULA 1IJEA 1VQNB 3U2QA 1H1TA 1DNPA 3IVCA 1G7RA 1Q82D 1YUMA 4RCZA 3AVWA 1KKUA 4OJMX 1YJWB 1LI7A 4YAOA 1M8FA 3KT6A 1WXFA 1J21A 4DDKA 2VZLA 3A2KA 1J9ZA 4ZT3A 3IVGA 4CQNA 3CMEB 1ULHA 1JILA 1VBNA 3CLTC 3CCLB 2CYCA 2O8VA 4TMVA 2QTLA 3SDBA 2V0CA 4F7DA 3LO8A 1BS2A 2PZ8A 1GZUA 1U7XA 2A84A 3MHPA 2QTRA 1G59A 1DDIA 4LBZA 1YJNB 1YIAA 1G7TA 4YALA 1YJ9B 4ZCQA 2HZ7A 4DJAA 3P0JA 3ELBA 2QN6A 3BL5A 1NSYA 3B82A 1PFWA 1IH8A 1YI8A
chains in the Genus database with same CATH superfamily
4KODA 4Q1FA 1QHGA 4KRXA 2GBLC 4ZXPA 2XE6A 1WQWA 2HHCA 2GPTA 4F4HA 1YLOA 2PU5A 3X1WA 1Z12A 2VCHA 4M7RA 3TD2A 1C41A 5LZ5A 3HV0A 1QQTA 5K8CA 4MVJA 5FBKA 1COWA 3R3JA 5G2OA 3HDVA 4UBJA 3DJFA 3LUFA 1DJMA 4N5HX 1G21A 2E4HA 2XDQA 4P4SA 1GUDA 3LECA 4D45A 4CUKA 5E7JA 3FNRA 1OI4A 1LJLA 1EK6A 1TTHA 1QWSA 2PDAA 1GL3A 2OTJT 4RHXA 3SZRA 2ON6A 1XZPA 3LZ6A 3PNBA 2YRCA 3L07A 4UAUA 3PA2A 4KUGA 4Z4IA 5K5EA 5LWQA 5KDLA 3DW1X 2FDXA 2VSXA 4KFTA 2BTEA 4WIAA 1Q0RA 1BRTA 4MGIR 1EVLA 2X0KA 3WQSB 1KJJA 2AK5A 2ZT8A 5BOVA 1XU7A 1JSLA 1S3IA 1VQMA 4FS3A 4TS3A 4E30A 1ARZA 1R0CA 1VHTA 3ZGYA 4WJKB 1SFRA 1MA0A 1XZGA 1L2TA 4M9XA 2QL6A 4M21A 4JASB 2YMLA 3ESBA 4JYZA 4LWZA 3R1IA 4H9GA 2JJYA 4OI1A 2ZTMA 4LRUA 2Q3JA 1PC0A 4MV1A 3G71A 1Q12A 1JEYA 4HWGA 3UK6A 5AK3A 1V71A 4MZTA 2MR6A 1LSUA 2I2FA 4P6VF 5K7SA 4PLGA 3HCRA 1TF2A 1K5HA 2PQMA 3DKPA 4OP7A 1JG2A 5H70A 1GNVA 3BJZA 1PLKA 3IPXA 4XDZA 4PPYA 4XPZA 4AJOA 2QYZA 3L92A 1TUDA 3NBFA 4P7BA 4JC8A 2PX2A 4QWWA 1FP6A 4WHMA 5JNTA 2DJZA 2G9RA 3DBIA 4TWAA 2JEZA 4IIDA 2DR0A 3RUCA 1PFQA 4HUTA 1AU9A 2IPNA 4UOQA 3KZ1E 4DA7A 2YVLA 8GPBA 3K0AA 4IX1A 4TTPA 4NOKA 3ZEAA 2XCIA 5LJ5f 4XD2A 3SEQA 3EG1A 4CQMA 2M1HA 2EATA 4FYIA 4ROTA 4P83A 4PC7A 3H87A 1VQPQ 2IOQA 3N2GA 1UJYA 5DNDA 3ECSA 4FN4A 3RH0A 1NJIU 1UXKA 3IIEA 3RPEA 1GPUA 4OCZA 4IWNA 4B1FA 2PGDA 5DTIA 1XTTA 1T35A 3CNBA 2XI9A 4P54A 5AOCA 1EBUA 3I1IA 4LRXA 2IYNA 3TQSA 1JNYA 3FDZB 5DBHX 3R0QA 1ZC3A 3QV2A 2WVHA 4RVHA 4NL4H 3TRIA 2YIVX 2V5UA 1PR5A 1DFHA 2ZRMA 2BKDN 5ESRA 2I2DA 3EGIA 3NGPA 2EAUA 4YX9A 4R41A 1O8CA 4JQCA 4DV3B 3CD6T 1A1VA 2E70A 1USKA 5DM0A 3MN1A 1U2SA 1TZKA 3IV6A 1HRKA 3K2QA 2ZJ5A 1XRLA 2PWBA 3EEFA 3CLSD 1MJFA 4XOUA 421PA 3GLGB 3ZE0B 3NBAA 3EC2A 3SC2A 3AINA 1K27A 1VGQA 3KNZA 4UTPA 3Q88A 4BBAA 1T6BY 4EY4A 2QK4A 5B5SA 1PKTA 2FP3A 2X6WA 3BE3A 3OQOA 3L8DA 4IM7A 4KR6A 4EB6A 2HCJB 3N05A 3ZWYA 3GA0A 2IDKA 2O3SA 1G1MA 2XYHA 4FOLA 1TOVA 2AQ8A 5L3SA 1NURA 5KTTA 4PZLA 2WNHA 1KSWA 3AWIA 1ZOLA 4PG5A 1Y48E 3JASA 3PX2A 4LE1A 3TIIA 5GADl 4OREX 2HLNA 1G42A 1YQQA 3PYXA 4C3OB 1OPKA 2H9YA 4HSGA 4IDPA 3UVEA 4EBBA 1RBZA 4OXIA 1SCIA 2OPHA 1O94A 3TZ6A 1MDFA 2YUQA 4NV3A 2W8BA 1IU9A 1PV4A 3OZIA 2CZ6B 2G1PA 5LMCA 4PFJA 2KBFA 2VDNB 3CIFA 3MJSA 3KLNA 2CBZA 4CFZA 3O2JA 1F3OA 2H08A 2AOXA 3IKJA 1KSHA 3H2GA 2ZSDA 5C37A 4NCHA 1YQWA 4F4FA 1YL5A 3J80A 1JDNA 4GQNA 3Q8XB 4X64B 2KY9A 3OIUA 2GKGA 5K1ZA 3IKTA 1WJGA 2I2CA 3AYXB 4WZBB 2GM3A 4MWTA 1G8FA 3HXLA 4YIKA 4MVJE 2YY5A 4LC1A 1KBZA 1E6LA 1FSZA 9ATCA 3B9BA 1WD5A 1TM5E 3H6HA 1R74A 3P2JA 2V4DA 4PO9A 2PX8A 2NPIA 1JJFA 4O8CA 3MBIA 3SLKA 3HBAA 4FYXA 3BFJA 2HPZA 2ZUDA 4UE2A 3WK8A 3D4LA 1NW9B 3KL4A 4CE6A 3SC6A 2FK8A 3O8QA 4ZYZA 1I51A 4P3XA 1AK9A 2EX1A 1PE0A 5LYJF 3QVUA 4YMUA 2HLDD 5GANd 5IVPA 1ZNQO 2Y1EA 3LNCA 3FXAA 5AWFC 2R6FA 3UWMA 3HVRA 1B76A 4ZCMA 3N2ZB 5BQFA 3THWB 4HYEA 1SQSA 3BK7A 2P6PA 3UG6A 1TNDA 1CDOA 2FFAA 4GYKA 3F4KA 4IQGA 3MCAB 2QTCA 3ND6A 1M34A 3L6EA 3VSBA 5DHAA 3RC3A 1W6RA 3WLFA 5DW3A 3GEHA 4C05A 2ERCA 2FZWA 3TW4A 3UJCA 4L5YA 4DZTA 4PPNA 3PA6A 2OAGA 4G8DA 3SZUA 1UPUA 2VHQA 3M8KA 3G2KA 3DPSA 4TSFA 4S2UA 3DOIA 3FSEA 3HCPA 4R8MA 1X80A 2RHXA 4YAIA 2V7TA 2XNDD 3QZ9B 3LAWA 3OSUA 5AUNB 3RVSA 3DC7A 2RGGA 4JCOA 4YDQA 2V9ZA 5EXPA 1TPZA 2RJCA 4Z0TA 4EF6A 1BYIA 4FFDA 5BNFA 3HSBA 2A28A 3F3SA 1KRXA 1WW3A 2JFWA 2WSBA 2P6OA 4MLZA 4EK9A 3ZY5A 1P72A 3ZBDA 2YIMA 3PT9A 4PX2A 4B33A 4DR7B 3E81A 4CDGA 5H81A 5IW8A 3K4PA 2FKAA 4XCQA 1W46A 1O03A 5IEJA 3KZCA 4HAVA 4JZKA 2EJFA 1GDTA 5D3KA 1YF3A 3VOTA 4HLUC 5C32A 1QRAA 4BVHA 2LJ0A 4I5IA 4UVIA 2OAEA 4YV7A 3H99A 4X1IA 1HE5A 2O8CA 4Q7LA 4D9GA 2QMEA 4AXXA 1QVWA 3RLIA 4YP0A 4FMPA 4E4TA 1QHNA 2C5FA 4DA8A 3ZWBA 1WE2A 5EMHA 5AICA 4GC9A 3CY6A 3AHJA 4XH9B 2ZS8A 2Q4DA 4F4IA 5IM4A 3TINA 4H7KA 4RMIA 4NK5A 4JBLA 1G7SA 2FPSA 2HJ9A 2ED1A 3BGVA 3ZWPA 1A3CA 2CHFA 3IX7A 1Q86C 2FG6C 1J06A 3HCWA 3OYHA 3GGCA 4Y92A 4DLVA 1EX1A 4P7GA 4JI7B 3KQHA 4D6XA 3G1JA 4I5EA 1CY7A 3C45A 4P33A 3OYBA 3D26A 4JLPA 3CNQS 4IUUA 2VYVA 3ZHUA 4CG1A 2PE3A 4MYTA 3VR6A 2RKWA 1B7TA 1GU1A 2MR5A 1DC4A 3W5SA 3ZTTA 4OM7A 2YUNA 4BNJA 3QPUA 3DEZA 1VSTA 3EVBA 1LLUA 1FMKA 4OJMX 1R0WA 4QXRA 4DMLA 3ZNQA 3DLIA 4LX0A 3QVMA 3O93A 3AJDA 4M78G 4TTVA 1SC1A 2YFKA 5AJTA 2V6GA 4UVGA 5CXUA 3IBYA 2QNIA 3EFBA 1ZSZA 2FPUA 1KDYA 2B36A 3EZ7A 2UYHA 2C8JA 4JODA 4TKOB 3MJXA 4RV9A 1Q0PA 4JDUA 3M3DA 2DTOA 4M77B 2W4IA 1HDZA 2HWYA 1L5FA 4OBXA 2AOTA 2ZJYA 4R2HA 2K2MA 3F7NA 4XU1A 4TXNA 5J4KA 4P5PA 1T4CA 4M7DD 2OTJB 5LP1A 5D3MB 3M4ZA 3IUNA 2MJLA 1F8UA 3HCDA 4U2EA 4H0FA 2O6HA 3KXLA 2JGDB 2A4KA 1IYZA 2NZJA 3ZXSA 2OZLA 5B3LA 4UPVA 1W29A 4GWKA 2C2ZA 5AVTA 4IGFA 1TLTA 3PIDA 2Z4SA 2YQ4A 2FF7A 1NYFA 4TT3A 1EAMA 3P9CA 2DVEA 1NY6A 3I42A 3GPIA 3U0BA 1JFLA 1XQXA 3N8DA 1JA1A 1Z4JA 2W2LA 2CZ0B 4PSUA 4UU0A 3TIVA 3G1UA 4KXLA 3QRWA 1C1XA 4JK3A 4L8FA 3R6DA 1ECCA 3IBTA 4JEHA 4C3UA 1E9SA 4E14A 1WXBA 2I33A 2GQ0A 4AQYB 3NHWA 2W2NA 3LZCA 1NPTO 4ENQA 1RKBA 1WF6A 5LOVA 1KI6A 5IXJA 8LDHA 3RKUA 3VPHA 5KVQA 5BQ5A 2GXAA 4AS3A 5SY4A 1L5WA 5SYMA 3VX4A 1PNOA 4RGBA 1X7YA 3IJ5A 2WTMA 5AFSA 4KK4A 3U7JA 1XKXA 1DKUA 1M90C 1A8QA 1OBCA 4OHXA 2VDWA 1MZVA 4BVKA 2ZR7A 2Z3WA 2D0OB 4YQFA 1SOWA 3EYWA 4LOJA 4RVCA 1M34E 5KMGB 3R9KA 4JUIA 3Q72A 1D1CA 1Q95G 3KJIA 2YINC 5HK8A 3MQFA 4E7SA 2IIQA 4BNDA 4Z4TA 4E47A 2XQVA 2CCGA 5A06A 2UVDA 4M7AF 3CR7A 3LXUX 1WVGA 3A7DA 2I3BA 1J20A 5JAZA 1CUFA 4MV3A 8ABPA 1C9KA 5LIPA 5KVCA 4HQNA 1RLMA 1US8A 4Z89A 2XZPA 4C0WA 2EYXA 3AM1A 2JFNA 4D74A 4YT5A 3S2ZA 1IONA 4B3FX 1ZD8A 2LP4Y 4L3VA 5J3JA 2IITA 1R6XA 2YBEA 3LNTA 3RUIA 3U3OA 3M5PA 4YUAA 1RJGA 2N0SA 4QVKA 5F7ZA 1V8BA 1B2LA 2QW1A 2ZT7A 3LGFA 1UOQA 1WCWA 4NJMB 2PMFA 4OUDA 2BJVA 3I9KA 1UC4B 5IHNA 1PBNA 3DZGA 4BB5A 3CD6B 4MKRA 3DAOA 2B3TA 5HUJA 1Z4PX 3VR2D 2GCGA 3I8OA 1RJ9A 4YGYA 2YLBA 1W94A 1ZK0A 4YXWA 2E18A 3Q5GA 4TVRA 1SCAA 1I2CA 4GX2A 3T3HA 1Q19A 4A4HA 4F92B 1DBSA 4LUCA 4CRIA 4MW5A 4TWBA 3Q0TA 2ID9A 4QU0A 3T3IA 4DBLC 4LJKA 1WKVA 2QTFA 3SLNA 1VP3A 1JHPA 3I5RA 2Z0WA 3NRCA 1BX3A 5GV8A 4OYHA 3X44A 3MS7A 1U2TA 3SF8B 2PV0A 3TNYA 1HSQA 3LUAA 4E5UA 1L4FA 2IEYA 1KI7A 1FMFA 4MMXB 1KJIA 3O9MA 4C5IA 4NMXB 3D2LA 3BGDA 1IHVA 4QYMA 1GTG1 2YWXA 5MF6A 4ER0A 2NU9A 3CXUA 1A0NB 2J9YB 1EWKA 2VQSA 2OP0A 4HNUA 3LYUA 5F3DA 6NULA 3NE5B 3X2EA 1UAGA 3Q1JA 3AETA 4OMUA 3KEWA 4FW2A 3U48A 2V1RA 1TC1A 3L1JA 5HOQA 1S72T 3PCTA 5DNAA 1PR0A 1RHMA 3NT4A 2ZUCA 1E5VA 3A9RA 4X7EA 4PX5A 5AESA 1KZ7B 3CCBA 4G1EB 2CFTA 1NTRA 1U9YA 1VRVA 1PTKA 2HSZA 2CUDA 4IVNA 4URHA 3IPLA 3I12A 4G26A 2GCNA 2R96A 4JEIA 5A0DA 2QEQA 5HCNA 4Q4DA 3QTTA 3CCJA 3MF4A 1GPJA 1IWPB 4N4IA 3JRZA 4HXYA 1U8RA 3QUIA 4R3WA 3OBBA 3K35A 1H9CA 2D5IA 1XE3A 5CBPA 4A5OA 3U7GA 2HU7A 4QGGA 4GZMA 3UXYA 3FOAA 4CMJA 5EZQA 1L6RA 3OPNA 3IB6A 2BH9A 3HI6A 3N3BC 4M7AC 3HUTA 1QGAA 3E1KA 4F6CA 4J4HA 3AU9A 3CCUT 2IY7A 4QRHA 2FPXA 1WNFA 1RHRA 4XKWA 1JWLA 2G4LA 4WINA 3D5EA 1RZUA 3VQTA 1DT5A 5EJGA 1N07A 4KGDA 3VVBA 2X0IA 1VJDA 3QE2A 5TF0A 4HVLA 4C2BA 3DD5A 3N7TA 1BHSA 1XTUA 4N82A 4AIIA 3J7TA 4FMCF 3R3SA 1P73A 3PDIA 5DO9A 1L9XA 3MD9A 2O23A 2XTJA 1B23P 2W0MA 3EUEA 4N4AA 2JA1A 1P5HA 4DQLA 2FZCA 2DWCA 4D8VA 1ECGA 5JYDA 5J43A 1V3TA 1J25A 5T4FA 1NXQA 5DYIA 3CWQA 2I4LA 2RJOA 1I01A 4KIFA 1W70A 2I66A 2EKPA 2Z8XA 4XU3A 4XQ3A 3CRNA 2POQX 3CCLA 1ONPA 2HPAA 1R6UA 4YEJA 2VK8A 1HFJA 2K5UA 3S6WA 3FY4A 1PDOA 1IHUA 1NMEA 1VQ5Q 5FWYA 1ZU5A 1BAPA 1WP6A 1KBQA 2FGKA 3OD5A 1NZ9A 4L4ZA 4Z7QB 2QGFA 4L0QA 5LCXA 3PQEA 3R6NA 4B7ZA 4Y30A 5G0VA 2NSJA 4FCWA 5IMSA 2XOEA 3QWIA 2FSVA 2V55B 1PKVA 4ENUA 4EG0A 4D6WA 3HJUA 3ANMA 2LTAA 1G4AE 4ZI7F 3NMUF 1ZH0A 4GDMA 4TMTA 4BNLA 3IA2A 4E5DA 1C0LA 5ICGA 3U7RA 2ZW9A 5AHWA 3RK1A 3UCFA 4QELA 1VCIA 4BKOA 2GFHA 3QUTA 6ADHA 3S1SA 2DQZA 5BNTA 1JDTA 8MHTA 4RGYA 4YTLA 3AF6A 2O0JA 5PNTA 5GM2A 5F7XA 4PQEA 3CBMA 2PUGA 2DRIA 4DVJA 1V5GA 4R1MA 4DBHA 3CB4A 1L8LA 2P41A 1QLJA 3G7SA 3R0VA 2ONJA 4UC4A 3ZX4A 1G20A 2WYHA 1N6LA 3NDJA 4PBSA 5C8YB 1TJ3A 3FNBA 2H3JA 3TRJA 4H4CA 2XWBF 4CL2A 5UKDA 3L0ZA 4FHFA 1AF7A 4LYYA 2GD0A 2PMDA 3KR0A 5M3BA 2B9VA 2DTEA 3CEJA 2ASEA 4HBZA 4LE2A 3LT5A 5T4BA 4PXYA 5FROA 3FMIA 3CZQA 5G1OA 4OU4A 1RXSA 1XWWA 4GSYA 4IG9A 2ZKIA 3O31A 1W5TA 4NR0A 3PWZA 5EHXA 4CMBA 3M53A 2CBXA 1A8PA 2DPYA 1BSVA 4BVBA 2GBCA 3RFFA 2QPLA 2YZMA 3QX7A 2K3BA 5U4XA 2BTQA 3CRW1 4HDMB 3FGZA 2ATCA 4LDXA 4L73A 5FLXA 3I23A 1U2DC 3MJEA 1DGQA 1PNQA 5TY0A 4XI9A 5LLDA 2HIHA 2CUTA 3MWEB 2IVFA 4MUBA 1KR5A 3L1KA 1JAZA 4K87A 1PX0A 1X3LA 1XN1A 2ZQYA 4Z0HO 3K9NA 2CZGA 1UC5B 4CHGA 3M0RA 2B2NA 3SU8A 4EB3A 1H4QA 3OD1A 4ZICA 4WOBA 4ALMA 4DQXA 2XDWA 2CLOB 5FI5A 4FUQA 1CR6A 4JXKA 2BD0A 3QOFA 3HJGA 4UBMA 1Q82U 2PWZA 5DM1A 2P65A 5JQGA 1NVXQ 3L06A 2ZSUA 4TQ9A 3OY2A 4NQRA 4X05A 2AK2A 1O3YA 1EEHA 3L1HA 4ICIA 1E1LA 2IA5A 2WIAA 3W8NA 3B85A 2R97A 4L75A 4H2DA 1K3TA 4DLSA 3IIJA 4M1SA 3UV7A 2E6KA 2B7LA 3G1WA 4W9MC 3JYQA 1DAIA 2YDLA 1IQUA 4UOZA 3TTSA 3FPLA 2WJYA 3NPFA 3VOSA 1F48A 4PAWA 4OI2A 5IABA 3V9PA 4JBGA 3CN9A 4U7WA 4BO5A 1QGDA 2DRKA 4MB2A 3CA8A 3CNLA 1KNQA 1N77A 4UAVA 1UFFA 3S0JA 3ZZUA 3VUFA 5T41A 1G2PA 2IF0A 4PN3A 3RNLA 2IPMA 4M0DA 1IM5A 4C76A 1USGA 3GBPA 1Q86D 3OAAD 1IBLB 3EHQA 3Q9LA 2V7PA 1QIIA 3M81A 4A36A 4RM2A 5F78A 4EO7A 1IJKA 1YJCA 2KMTA 3L7CA 1JQJC 1K1EA 2ECQA 5ESDA 1P4GA 2FG0A 1AT1A 1H85A 4KIWA 3U4GA 2YWGA 1ONBA 1E4OA 3T3EA 1HF3A 5K6AA 3PUNA 3RC2A 3DTVB 1MB9A 3NB0A 2PBRA 5CG1A 4BUZA 3AW8A 1FVHA 4EPCA 2YWFA 4AU1A 3T15A 2C0IA 2IX3A 2J4FA 3SQXA 1FFAA 1D5WA 5FJIA 3CZ4A 4AK9A 2XDDA 2HOQA 2J45A 4E2FA 1N2CA 3C3CA 3ENVA 4JGBA 1KK7A 2FYKA 2I2WA 4FKBA 2W11A 3ZJ4A 4D44A 5IHXA 2VHTA 2P5TB 2QL9A 4MLDA 1AQYA 2YVAA 1BBZA 5CCEA 4PLIA 2LWIA 1TT5B 2XV1A 4AFSC 2SCUB 5DM60 3HDQA 5JDCC 3WQBA 3BHIA 3L0SA 4JYMA 2CKKA 1AZTA 4E6EA 3OZAA 1LV8A 2XPCA 2Q7OE 2EEPA 3ZI4A 4A27A 4PU0A 2WFMA 2WF7A 1UFVA 2FQYA 3OT1B 1SCKA 3B7WA 4W99A 2NSLA 1F7UA 5L4SA 4O2AF 3DT6A 2Z8YM 2PX0A 4C7OA 4BX9A 2R58A 2GREA 2KLHA 4KGVA 4ZOLB 3PJRA 3TB4A 1E2MA 1AX9A 2OTJQ 4OOFA 1AK2A 1J7JA 3OZEA 1WHTB 3HBFA 4FD2A 5F1KA 1U3TA 4A0RA 2ZRKA 3FYSA 5JNVA 5DBGA 1XEXB 1UBGA 4N39A 1BE1A 5KQPA 4JPBW 2NXWA 5DOZA 1X27A 1AKMA 4RY0A 3I73A 3OURA 1OGYA 1ETHA 3LY9A 4YRLA 1SVSA 1XKTA 3CTMA 1M30A 5B64A 3PGMA 1U0NA 4L15A 2X2PA 1G3MA 1E79A 2YFHA 1GA1A 4KQKA 4TM8A 2JJ1A 1OD6A 2ZR9A 1CDZA 3UH0A 3QWBA 5JNLA 2WACA 4NS1A 2YNMD 1P29A 5CB0A 4YXFA 3RJ5A 4KAJA 4KQFA 3GRFA 2CFIA 3Q3EA 1JJ7A 2BBTA 4X85A 1GLGA 3NXKA 2C7VA 1QHHA 3JYLA 3VDNB 3NEPX 3G2IA 5F5LA 1CJVC 4OKIA 5BMOA 5B2ZA 1ZX1A 1M90D 2AJDA 4FGKA 3GEGA 1XFDA 1SOAA 2E4XA 4X9CA 1S72B 2QD4A 1MO3A 2XYRA 1V7PC 1ZGJA 4G4SO 4FTWA 3HJAA 2KWIA 3CLSC 1LTKA 1C1HA 4MQLA 3OM9A 1TUGA 1MHPA 1TO2E 4EMBA 3C2QA 1QO7A 1KMIY 1LQ2A 3PIPA 1WPCA 4W5TA 2PUDA 4Q18A 2C3OA 5TS3A 1P1JA 1JBMA 1RHUA 2D0DA 3IHLA 5C8DA 2INGX 4XU0A 1YJWT 2QV0A 2JCXA 2QM7A 3O8NA 3KKZA 4PG6A 2Z4RA 3ZDFA 3GK3A 3CCRA 4AECA 4CV1A 4JWKA 2PJRA 1TO6A 2F1HA 3ICPA 1KOLA 2JKYA 2JLCA 1ONOA 2WZCA 1UXOA 3F2IA 2X0EA 1A7UA 1DAHA 3NTXA 2PZLA 2V9CA 1OYYA 4ZZ0A 5JY1A 4CTJA 5KKNB 2HYDA 1BO6A 1Z83A 2QTNA 5CNJA 2EGGA 5ERGB 2OV8A 3CCUB 5C7YA 1TKCA 3OQ1A 3M0EA 3RQSA 2QMUA 1BMFD 5IYQA 1XLVA 2WAOA 4Y7CA 5DBEX 3DW3X 4OP2A 1GILA 3RYFB 3ODPA 4C0JA 3HACA 2H3EA 5IYPA 2J1LA 1DKLA 2WD7B 2L19A 4BLVA 5DLYA 1M1KU 4L9SA 2IEGA 5FOXA 1PSWA 3CD6Q 1K7CA 1WYXA 1M8GA 3N75A 3SDZA 4A2CA 2DIEA 4DGQA 1QYVA 2Y4YA 1G8XA 3KE8A 1PRYA 1MGQA 1YIDA 4ZCRA 1HZZA 1OAAA 3RWMB 1O57A 3BAZA 1GRRA 2I8CA 3OMWA 1QP7A 1EINA 1VHEA 4R1TA 1RKVA 3FNQA 3CINA 3JR7A 3F6YA 2JK0A 3A27A 1GGMA 3SVZA 4CM8B 5ALUA 5JG7A 4YPOA 2PT5A 4ML3A 1LZKA 3OQIA 1Z5GA 3TLMA 3IPAA 3F6PA 4M54A 4FXUA 5ALDA 4GXTA 2LR0A 1KO5A 1MJNA 3PD7A 5IS2A 2BHLA 4BTEA 3WK5A 1TM4E 1Z7GA 5A05A 4IS3A 5GAN8 2XQKA 1KHTA 3ETGA 3ONDA 2D8HA 1SUEA 2O2YA 5HKCA 4ZVLA 3I2KA 2DL8A 2RHIA 3OIYA 2RHUA 1USUA 4ITVA 2X4YA 4JC5A 2RAUA 3KEGA 5KSPA 5HUQA 4U4AA 3MTJA 3NDRA 1ZW6A 4MAFA 3LQ6A 1N2CE 3WR5A 2WJ4A 4Z49A 3Q5EA 2GETA 1KQFA 4D0LB 4NONA 4R51A 2BKXA 2EJVA 1E1RD 1N3IA 2G0NA 3PRKE 3Q9SA 4TRMA 2J87A 1VL2A 2OEPA 2WWGA 1Q0SA 1U4NA 4YJ2B 2XLBA 2FB9A 1N2JA 2HNBA 3G0DA 3C0CA 4WDQA 3JCMh 1A4UA 3QPCA 4BPRA 4BDZA 2ONKA 4JXZA 4AZ3A 3GT7A 4GXQA 4M53A 4DEXA 1FFXB 2KSQA 4NNOA 3WGZA 3M2PA 5BNIA 2OOSA 1U1EA 4ZYLA 4DABA 2XIJA 1JMYA 4AN4A 4GMKA 4M7AD 4EZBA 4TN1A 1YIJA 1FLAA 1UT8A 1RNLA 4H3HB 3PJGA 1C9NA 2IOFA 2WJHA 3IDSA 2HJVA 3RAPR 4OQFA 4RZHA 2XODA 1WZ2A 3R24A 3G13A 4C2AA 4ND1A 4F6RA 2DYBA 1Q7YD 4GL2A 3AEKA 2JT4A 4IILA 1ZD4A 2X3XD 4RSGA 2NTEA 4BEJA 3LQFA 4EGCB 3PKZA 2VYQA 3W2EA 1BDHA 1Z0ZA 4CLRB 2Y3IA 2MOKA 2C92A 2Q1TA 3GFBA 3V34A 4M2LA 3GEBA 1PS9A 4AS2A 2KVQG 3LM8A 1WUIS 4GYWA 5D86A 1ESEA 2V4ZA 4AD8A 2BE7D 3HJTA 3QSYA 2P0PA 4O63O 1PI3A 4XIJA 4EBFA 3G0BA 1QS0A 3OG9A 3UB2A 4J6XA 4CM1A 1HK7A 3KXDA 1A7KA 1H6DA 2FKNA 2P9EA 3RS2A 3BF8A 1CF4A 3O74A 5EUBA 3OETA 3RBVA 2P2NA 3G5AA 5K0SA 2FL7A 1O4WA 3PQFA 3EXFB 3NDIA 3NR2A 3C3EA 2A9QA 1NDHA 4G3XA 2H11A 1EFNA 3IP1A 2AG0A 3IXQA 2ISQA 3EGCA 2WWIA 4RS3A 3HYRA 3EK2A 2OILA 2WWVD 1FZTA 5K99A 3O9ZA 3ANYB 1HOTA 1D4OA 1BI0A 1Y7LA 1RI4A 3DEAA 1R9MA 3RUPA 2VDOB 2HSEA 4MGZR 3B3AA 3QBJA 3OOCA 5GAOn 4MI3A 2CF6A 3EVCA 3LCRA 2KYMA 1GZ5A 3TDNA 4BFYA 2X41A 3HU5A 1SPKA 2ECZA 4MP8A 2HPVA 3AWDA 1RHJA 2MAMA 1Q81D 1RDFA 2ILTA 3JYHA 4X97A 1QYXA 4D3ZA 2HQXA 2WJAA 2HWWA 3UGJA 4MB0A 5IVKA 3LQ4A 5AW6A 3AVTA 2G8LA 3U16A 2D8JA 4YAFA 3H1TA 4YRFA 4XIIA 3VVCA 3NBQA 2G08A 3Q8KA 1ZUWA 3ZK8A 1VQ6A 4PS0A 2BFAA 4RG2A 3ACCA 5IRCD 1U0OC 2GF9A 1M1NB 1YJNQ 1D2MA 2WJVA 4HN2A 4CF3A 4DSNA 1IULA 2DPMA 4EW6A 4Y9DA 1WABA 1VKZA 1YS9A 2X4JA 3WYNA 4WJLA 2RCYA 4DSTA 1ABQA 5BN3B 1E89A 1XI2A 3UYKA 5FWNA 1Z6TA 1V7CA 2JF0A 3DEIA 3PZBA 1L4HA 4LBYA 3CN7A 3WKEA 2Y71A 2LQWA 4UU7A 1C30B 5ALOA 1SA0A 5IHPA 2PY6A 1UUFA 3R9XB 4MTLA 4ABTA 2V65A 5FU7B 2GTJA 4A16A 3L8GA 1XGKA 2COKA 4YRRA 4Y2YA 3JB9H 4GRAA 1FMVA 4HVVA 3CPXA 3EIWA 4RTUA 1W36B 4HNAA 3A9CA 3NASA 2BMDA 1IK6A 1KYIA 3AR2A 2SNIE 1QZZA 4EG7A 1H3ZA 3B3JA 5L45A 4DAEA 1BX0A 2F1RA 1B2RA 1PJ7A 1LS1A 1RP7A 1L8AA 5FL7A 1CZUA 3QKUA 4KL8S 2J0UA 1AKEA 2HIAA 1CHDA 3CONA 4B3SB 1UJ6A 4C30A 1KK1A 3ZHOA 2LCFA 1F6BA 2NX2A 3UJ7A 1E96A 3FNFA 3A9VA 5BQXA 1CQIA 2L69A 2HRZA 4G36A 4IFBA 2AT1B 2HRDA 3RS9A 3KEQA 2AHJB 4H1WA 1E9VA 2DXTA 3VPAA 2ATXA 1AN0A 4ZO6A 4G24A 1TF5A 4QO7A 4YP6A 1PFKA 1KXJA 2QYTA 1QVRA 2FSGA 1DIGA 1QW1A 4NE7A 4O0LA 1V5EA 1QNLA 1KEKA 3OC0A 3SBDA 4PJOA 1RABA 3SE0A 5JYEA 4NOJA 1QIFA 5JROA 3NCTA 1KXZA 1P9RA 4GKAA 2Q3DA 1WDTA 5IUJC 3TZBA 4AVYA 3AJ8A 3RBZA 4B3JA 2BMAA 1ESNA 4ZCSA 3GN1A 4B76A 4LNPA 3RYIB 2GF0A 4PPQA 1FUYB 5CLFA 3ER8A 4QE3A 3R3HA 2JAXA 2ZRCA 1JVSA 3EF0A 1FTQA 2X6YA 2ZRNA 4MVJI 3PTZA 1T8RA 2DU8A 5JSQA 3CRMA 1V9LA 4AMBA 2EX4A 3ENNA 3D6FA 2IWHA 4NZ9A 1RWOA 4JD5A 3T1HB 2E1PA 1PW7A 3JQPA 1IJBA 1NZJA 3L1VA 3HO6A 4WTOA 2FVYA 1M2NA 3M9QA 4M9SA 2YJZA 2X3WD 1SU6A 2JEYA 3U19A 1IXKA 3FMGA 1POWA 4ORZA 1CUWA 2TYSB 4IJKA 2GRAA 3JRXA 1Y96B 4CM4B 4Z4YA 2QJFA 4BE1A 2IOFK 5CEFA 2PU7A 3TFOA 4Q16A 2XD9A 4ENWA 3TG8A 2QLJA 3I35A 3TCNA 4HAXA 2WNSA 1RIFA 1MG5A 1ZY2A 1O7JA 4YYZA 2G1AA 1SIOA 1YJWB 4BQFA 1VQ9T 5F2NA 3LPDA 1DC7A 1BHO1 1FP4B 4B85A 3G02A 3TF5A 1YRWA 4I19A 5CA0A 1H2YA 5F4JA 1MRNA 4OQXA 2BLNA 4OBBA 2QN8A 2VFAA 4OJTA 1DAOA 3W7BA 2LX9A 2BC9A 4JP5A 3A5ZB 2C9ZA 1WMDA 2K2WA 2CJWA 3JQ7B 3TNJA 3ROPA 1N6OA 1WPXA 4KWEA 5AI9A 2QK0A 1KEWA 4KN5A 4GM4A 2G28A 2COWA 4WLVA 1LK7A 2R66A 1WF3A 4F3YA 3K31A 4IV8A 3HWX1 5B1DA 2ZATA 3CCEQ 5MGBA 2B9EA 1VSVA 4F60A 5EKXA 4B7UA 3UMFA 2J3IA 4X7PA 3U39A 5CIWA 4TN5A 5BV1A 1XTQA 4U7PB 1P0IA 1C3OA 4NNJA 4E5VA 3SOZA 2NQ2C 4GLLA 2JFZA 3EXEB 4UBLA 3GBSA 4KUIA 1VHQA 2WFLA 3BAFA 2EFJA 1I24A 4KT0E 2RH4A 4IAOA 2E4VA 3VKFA 2ZSBA 3AKYA 4M77F 4OHPA 3WHPA 1K8YB 4QUZA 1C9JA 2JH3A 1YQTA 5I8PA 3NUZA 4Y2VA 5DNCA 4MYCA 3N8KA 2OHJA 5BP7A 2ZYUX 4EMKA 1WXQA 3NP7A 1A7AA 3TZQA 1ZPDA 5EJ9A 4HXGA 2P5SA 3UT5A 2AMJA 4RENA 2XNSA 4PPFA 2EFDB 3IXMA 4ZVRA 3GXOA 1I2DA 2PQWA 5FPQA 2ZT6A 4CM5A 5CKDA 2CP7A 2B8EA 5CQYA 2O4CA 4PXAA 3WIEA 4X07A 3B9PA 3IPYA 2CLLB 3RFVA 1P6UA 4MA0A 3CJRA 4CLOB 1DOAA 1JSXA 4QTUB 2DSNA 4PJMA 2RHMA 4D41A 1WUKS 3WLAA 1S72Q 3MRXA 4TUYF 2JRCA 4V3CA 3IDQA 4RQAA 4MQEA 2H54A 3D1VA 2M1ZA 3NG1A 2FMUA 4LCBA 4KZKA 2BFCA 1ZI6A 4ZOEA 1USVA 2VYTA 4N5MA 3QLVA 3AF2A 2XITA 2Z2XA 3EZYA 3U13A 3CVOA 4YRGA 2J0VA 4DM4A 3P96A 4KYVA 1T0UA 1Z16A 1P7WA 5H80A 2HCRA 3D4NA 1L9KA 4RFSB 3OCYA 4GQIA 3CC2Q 2C1ZA 2VH2A 4CM3A 3CEMA 1SVOA 1SK9A 3ZK9A 5TVGA 2WHEA 3QEJA 1GSAA 2MI6A 3CCCA 4IUDS 2UVQA 3SLGA 4XUEA 1WAMA 3DV0A 3ZH2A 4OL9A 4FHZA 3ZYCA 3QYGB 4HFNA 3QJ5A 1OROA 1PTJC 4RVSA 2WICA 1GAXA 2PR2A 3WLKX 3PI6A 1PR9A 4M78B 3CCUQ 2V9PA 4KXVA 1MX9A 4PJOE 1RXYA 5EZSA 1CSKA 3ETEA 2Q2OA 1Y80A 9ABPA 4NOYA 5A89A 3K70B 4D0RA 2QB5A 4OB2B 3G0HA 3OX2A 1N9GB 3I55A 3OZTA 3EXHB 1OFIA 4WKBA 3UJ6A 4BJHB 5HR5A 2R5NA 4J0EA 2FI1A 4AULA 1HDIA 4PSVA 4UTXA 3HB4X 4XFJA 1UOEA 1LB1B 2ZVQX 1U7PA 5B36A 1ABEA 4OHYA 4RCYA 3PC4A 1KJYA 1YOBA 4NL3A 3FJOA 2HRCA 2ZI4A 4DCPA 1G21E 2WQZA 3G9UA 4RHCA 2GJKA 4BNNA 7REQA 2O8FA 1MV8A 5ALLA 3IURA 2VAMA 4B82A 1D0IA 4OQMA 3TB6A 1N0UA 4XW2A 4R16A 3GUHA 4NBRA 4CLEA 4PCUA 1Z73A 3AHIA 1NRXA 3NTLA 3EEOA 5B53A 2IZ5A 2L5QA 4ONEA 4HMOA 1RS0A 2JNWA 1G2OA 4B6OA 1U90A 2W2KA 3F5FA 4I4TB 2HPHA 1YUMA 3I4CA 1TW2A 4A7PA 3WSWA 3SLDA 4MGKR 1SSFA 3SWNA 1V6SA 3C7DB 2DTIA 1NBEB 3C6MA 2AKLA 4XTYA 4C0AC 2NO1A 3BHMA 1AHJB 1A7JA 2B34A 1XMJA 1B42A 1IH8A 1SKQA 4OPMA 3MWYW 2WVGA 1YSCA 1UD4A 1O8BA 3ISVA 4R6XA 1TCVA 3TJRA 2VUIB 2AK3A 2BW0A 1PZXA 2IV3A 4CG3A 2J3DA 3JX9A 1XIVA 5B6IA 1Z0FA 5DH9A 3CC7Q 1LLCA 1AJEA 5BYKA 3KBOA 1UMDA 1ZOIA 1BA2A 2ZYAA 3BEOA 3DEJA 3BE4A 5HOEA 4M83A 3UA4A 2P30A 3FD8A 2GCEA 2Z95A 2OD7A 4GLBA 5J5CA 1EUQA 5EIHA 4YRSA 4CMEA 2ADOA 5K6TA 4ZEXA 3COVA 3IE1A 3D3WB 1X94A 3FLEA 3K2IA 1Y3AA 1I13A 4H59A 5HFJA 3E7DA 3HXMA 3K09A 3L4BC 4BVLA 3CRQA 1PQ4A 3TTUA 1GG2A 2IYQA 1VCHA 1V45E 4FYHA 1SXGA 1FBTA 4NY1A 1YS1X 2WD8A 4CODB 3HFGA 2CKDA 3UW3A 2F9FA 2FG5A 4TTSA 2QTZA 2G25A 2WTNA 4Z7NB 1M7HA 1TD9A 2I54A 5JIBA 2ZUWA 3AXSA 4K3VA 3WWPA 4WZEA 1T3SA 4D98A 4DM7A 2B8WA 4YR7A 3HUUA 1YFLA 3PV0A 3NGMA 3T7TA 2YHUA 1TC2A 1JQLB 2I4MA 2ODQA 4UULA 1IPHA 4MKHA 3PNSA 2J0EA 3TMAA 2PXHA 3UWPA 1AS0A 2F48A 3OU2A 2R7NA 2QOEA 1ZJYA 1KTIA 3GLTA 1I7PA 5KHAA 3T4EA 3QOWA 1RYEA 4X1KA 4X71A 1RWXA 3DPIA 1JYEA 2P1ZA 1Y9DA 2HSDA 2QGGA 4IJVA 3VAYA 4PQRA 5CAEA 5LJIA 2NUAB 2GILA 10MHA 2CW5A 1FFSA 3WICA 1C3XA 1YACA 1W4SA 3D0KA 5AN9A 4IS2A 4WZ6A 2XXAA 3LBHA 2P7IA 2CZ1B 4O2BA 4TRJA 4B34A 1IOVA 4A0SA 4KO3S 3SQLA 4KKTA 3O4JA 1JIUA 1PJCA 2PKEA 3AI7A 2FN7A 3I01A 4RMJA 1Q5PA 4FKMA 4UCWA 5CA1B 4WKPA 4D97A 2VPWA 4JP3A 3EXIA 1ZKDA 3GZJA 1TFUA 3ZCPA 3VR5A 4TTRA 1A9SA 4YP5A 1JPNA 4L6IA 1GDDA 1SXJA 3T0GA 5J3BA 3KTAA 4AAYA 2XUDA 2W10A 3UKOA 4X8LA 3ZL7C 1I2ZA 4CCWA 2D8AA 2EKLA 3HL8A 1JV2B 3A0UA 3NM5A 1TUBA 4HWRA 4XNFA 1U0LA 2CMGA 2JLZA 5I7EA 2A57A 3AUSA 1GA6A 3V4LA 4JI3B 4LDZA 1L3CA 2Q29A 3N28A 1HYGA 1UQRA 5DRYA 1OI3A 2P7HA 1Z6ZA 4GBED 3WLEA 4Y6RA 1UJ0A 4WF2A 5BV8A 1HI9A 1F1BA 4L0CA 5JXIA 3B5IA 1WHKA 3JCMP 1OULA 5FEMA 2G0TA 4D6PA 4TKLA 2GZ1A 4UHJA 5L4LA 3J80E 1B0PA 2IKQA 1VHWA 4AUEA 5MN6A 1YZGA 4E4RA 3JRNA 4XAQA 1FMTA 4A0HA 4BZWA 3D5QA 1Q50A 1KG1A 1LBEA 1DC6A 1JG3A 2J9FA 2ECPA 2W6NA 3PE0A 2NT3A 1O6GA 2EFHB 1DBRA 3GJZA 5K4HA 5C8YF 3GAMA 4QOGA 1T9CA 4RY9A 4UU1A 1QVAA 1SQFA 4UARA 1PS0A 2WTAA 3ZOKA 4GECA 4IW3B 5FR2A 3V8VA 3SQDA 1VQ9B 3NIFB 1DE0A 2CNDA 2AD1A 4Q5IA 1A77A 2C4MA 1C3VA 1EHCA 2DTDA 1R8SA 1WBJB 4RVDA 1SHTX 3Q8MA 1T6NA 1Y4ZA 2PNJA 2BMJA 4LHYA 2YNMC 4A73A 4F7DA 2R8ZA 1XV5A 5CVEA 4Y1RA 4DBQA 5AQ1A 3T9AA 3CGGA 4C7MA 5B7NA 4LY3A 3WWDA 5LU9A 3A2NA 1XWFA 1Z0DA 3A1WA 3IVAA 4MZXA 1J1IA 1C4OA 1BN7A 3DAYA 4L22A 5MHTA 5HW0A 4NCNA 4BX0A 2J9GA 5MFZA 3N7UA 1UP4A 2FN3A 2VTBB 4YRMA 3M4YA 1A5ZA 4L5BA 4Q9DA 2F4NA 1Y8RA 3LK7A 1H4VB 1YU9A 3JQ8B 2VNJA 3M70A 4LNUA 4HCCA 3K0CC 3FUTA 2E4UA 2DSTA 3U4AA 1BB9A 2HSGA 5KWIA 3HC7A 1QHEA 1XZJA 3E5HA 2YJTD 1Z9BA 2WUFA 1X8XA 3KQVA 3IPRA 2WOOA 2GMWA 5ECYA 4INZA 4LQLA 3T12A 1N6NA 3EIFA 3JQQA 2V6FA 3B1FA 3BIXA 1X6GA 3IGFA 1ZVVA 2NTYC 1JEGA 5FOVA 1K6EA 2BR3A 4DR1B 1UMBB 5A2QA 4JS0A 5A3SA 3V46A 1T0IA 5JO0A 3WGNA 4ZQCB 2NO7A 2UYOA 1EGMB 4OY3A 4RK1A 3RC8A 2FMXA 2GPYA 3C12A 2V4UA 2V6MA 3U7IA 2X7HA 3RU7A 3H18A 1CUBA 3JD1A 1UDLA 5JANA 1ZICA 4CCAA 1EK0A 1K92A 4RWZA 3IQZA 2OO5C 5B7QA 1BGVA 4U3JB 5CCBA 4WCFA 2W6ID 4BPBA 2E5FA 3K0FA 2EARA 1F8GA 2BGLA 5D6OA 3WWZA 3X1MA 3V1UA 1TQ4A 3OW2P 5TQ2A 1KY4A 2O4XB 4EJSB 1KQSP 1Q0ZA 4ETNA 3MS2A 2EKDA 4F7UB 3C6BA 3COPA 2BFDA 3FYHA 1CIJA 2C3YA 3KVYA 4IL5A 4NBNA 3D7LA 3MEWA 3KV1A 3PHCA 4OHVA 2C2OA 4LHEA 3DSRA 3IDFA 1YJWQ 3RESA 2K3YA 6PFKA 4B6GA 2RQVA 4LXIA 1VTKA 2RI3A 2ARKA 5IHIA 4BE4A 2ZSIA 3CUEF 2DWUA 1J0EA 2HFJA 3E7WA 3LPMA 2ZYIA 2EFGA 4ARIA 1ONNA 1VPDA 1X9HA 1NLPC 2QQEA 1ESZA 3Q7EA 3OU6A 3H4MA 4PABA 4DUYB 5KNCD 2J33A 2Y9PB 1EJBA 4HTFA 3N53A 4B4OA 2DJ5A 1VDZA 4M99A 5C4IA 1UBNA 1KEPA 3IOBA 1L4GA 2BE9B 3OIGA 1L5GB 2QA4B 3O4VA 1XZQA 2EQBA 4FCTA 4ESOA 3C8MA 3FTCA 3L1AA 1HEYA 3G17A 3ZWVA 3ESCA 3F5MA 1GN9A 2PRIA 3JCMe 1DDOA 4PGOA 2VATA 3KAKA 3L0DA 3VXKA 5BN5B 4GMFA 4XLFA 5DW0A 4MR7A 1VQ4A 2R1TB 4AUNA 1BEEA 1UXGA 5LNK1 4IV0A 2B6NA 5EIEA 5KZMB 2K5IA 1UF9A 5DU2A 3T1YB 3RT7A 1Z2OX 4I66A 1P7PA 5CT4A 4ZOLF 3VR4A 3F9RA 3TS1A 1S8FA 3QLUA 4XZ3A 4D8WA 1VRWA 5CFMA 1LXCA 4LCEA 1JS1X 5M9OA 1INLA 2I22A 3RSGA 1UBSB 1EXWA 5IKXA 2MIIA 5TVKA 2XUHA 1GSHA 4K9NA 3EY9A 5A0TA 3TRDA 3CLRC 4OGLA 1Z4IA 2DFVA 2YXBA 3A1CA 5I9NA 2P4EA 1LBQA 1ZGCA 5KYVA 1R6AA 5DRTA 1VLHA 4BQEA 4J9UE 5I9SA 1Q7YC 5JFGA 5FTMA 5BWMA 3IT0A 4R8KA 3Q3IA 3COSA 1OB0A 2P0YA 2IEBA 4NXMB 3NIBA 2XGOA 3M1YA 1BI3A 4TKZA 2Q4OA 4AJ1A 1CKEA 4ZN1A 3L2WA 1ZNYA 4UBNA 1ISJA 2H1LA 3SDBA 2IYSA 1JAYA 1C0IA 4E07A 2C5LA 1ESDA 1MC5A 1WZOA 1J39A 3SFMA 2QE7D 3JARA 2VJNA 2ZWPA 4DJEC 4KAAA 3RO7A 5T6MA 3W4IA 4B73A 2GJ8A 3AIKA 1O5TA 4LMPA 1KAMA 2D9RA 1M6VA 3QVWA 4E5SA 2D1QA 2O2SA 5E6UB 1RADB 4OMQA 3I56T 3PVZA 4AL4A 3KETA 5H9WA 2EW3A 3ICCA 4L57A 1RAAA 2D0IA 1TIPA 4OHMA 4FFVA 4RXMA 2W2OA 2FWJA 3A8LB 2QSJA 3K0HA 4RJKA 4PJOG 1QBGA 4AJ2A 2Y4OA 2HA6A 5E4YA 4RD3A 2QM0A 3ROZA 2NYAA 2YRFA 4I2NA 3B5EA 1GQSA 3FGOA 3JAKA 1WOOA 1LK0A 1W75A 2GPJA 1X7ZB 3RKRA 2HNIA 1WS6A 1Q81C 4QTXA 4WLEA 4RGQA 4BOYA 1WXIA 4OQDA 3GG2A 1F60A 2AKEA 2BMVA 4MVJG 1RR6A 2BZ0A 4J90A 4TLDA 3CT4A 4LPKA 4ITUA 4JL8A 1P7YA 5LB2A 2HTFA 4Q21A 5JS2A 4K6KA 1RAFB 4LE9A 4YS6A 2XNKA 2QQ5A 2Y1WA 4DWWA 5IZCC 2NQTA 3S1AA 2FPIA 5D5HA 1RXUA 5FOSA 3BICA 3GVIA 1QGED 3FGNA 2L2QA 3C6QA 1SRLA 3VNQA 2C2XA 2X4XA 3RF7A 3MEVA 2PZGA 3O47A 4N3BA 1XF1A 3S4YA 1XEWX 1R9GA 4M77D 2K57A 5IJ0B 5CKBA 3GZ4A 2ZPEB 1N7HA 5EXEA 3FG9A 3V76A 3U81A 3WVEB 1DAMA 2ZE6A 1V8OA 3HPWA 2JAOA 2QU8A 4FYYA 4L3OA 1SQ0A 1AV7A 1MH1A 2XZDA 5ALFA 4MROA 3O82A 1S5PA 1PN3A 3V8EA 3X0DA 4J49A 4J0HA 3BD7A 4RDHA 3JS5A 1I5OB 3E70C 4MDYA 3V7AA 1PFVA 5AKIA 1WMSA 3GT0A 3ZY2A 4NS5A 2CVOA 4EARA 3TN7A 1C0PA 1E1QD 2QRVB 4PYMA 5AI0A 1KH3A 5HIAA 4KFSA 3UGTA 1EM6A 4IOLA 3CZCA 4KB5A 3S3OA 4KQWA 4P84A 1J42A 1SZJG 1FLVA 4DARA 4PJLA 3WBKA 1OX8A 3G3EA 4JAVC 3NYQA 5CH3A 2CT4A 2V6BA 3OJLA 4UUOA 1DKQA 4RPJA 1X1RA 3U1TA 2EG9A 3EOBI 4YJ2F 1JI3A 3KYDB 4EW3A 3OCZA 4TVOA 2AN3A 3GQBB 1C7EA 3TCKA 1TMOA 1KC8R 5AW2A 1FXUA 1OLXB 4YJHB 2BPOA 4OH1A 1WQ3A 5LNK6 2WIBA 1XJ0A 5D85A 3IUMA 4WBNA 4DCSA 1DG1G 2J6HA 1Q22A 2IIBA 3T1OA 4KPUB 5EQTA 1YL7A 4GGMX 2NP7A 1W2BA 4WXMA 5DSTA 1SKAA 3GCXA 5JDIC 1UZUA 1TG0A 3F9CA 3A70A 1ML3A 4HOYA 1DINA 4RXUA 2ZBPA 4F56A 3RTEA 3DBHA 1JG6A 1XMIA 1ZN2A 3QHSA 1TYDE 3EF3A 3NVDA 5M29A 1EB9A 2XE7A 2GXSA 2GN6A 4MWGA 1L1EA 3KP1A 4ZXFA 1K7FB 1RI5A 1UDWA 1Y0MA 3F1KA 3DLHA 2QDLA 2ZE5A 2ZQ5A 2IXAA 1TJ4A 1VKRA 1I5EA 2O1WA 2HZ7A 3HGQA 1ZU4A 1SVWA 1PT7A 3H19A 1BWPA 4UPEA 4ZMSA 1U8EA 5CFLA 3KWMA 4L0MA 1X13A 2BZXA 5EP1A 2ANBA 2O07A 8AT1A 3ZS9A 5BV7A 2W0SA 1NX9A 1W88A 5A88A 2FQQA 1BKBA 3O8CA 1ENPA 3FWKA 4QXOA 3DZJA 1KE1A 3ADBA 3G9QA 5BN4B 2YFQA 1QH8A 5EPOA 5INTA 4G1VA 3O8OA 3I1FA 2R1ZA 3OWXA 4EEZA 3OPOA 2DHQA 5A9SA 4RLHA 4BGEA 3OIVA 5JS6A 4B5LA 2ZJ1A 1WG8A 4HNGA 1VQKT 3G79A 3GU3A 3IAAA 1K63A 4XPIB 2GYYA 4IDGA 3WFJA 2PIAA 4QQKA 2ZUUA 4G0YA 2EWVA 2CLIB 1OXVA 2APJA 5HBGA 2NOAA 4DIMA 1YRHA 5GJVB 4L74A 1T29A 4O0MA 1E3IA 1MH9A 4HE5A 2O2IA 2KW5A 1JBKA 2ZYVX 5IYZB 2VJBA 3N87A 3W1WA 5HQJA 1E58A 2GCOA 4M0LA 2KE5A 5BVGA 1NJIR 1KEEB 3ANTA 2IXEA 4UQPA 1DUVG 1M2OA 4X8HA 1RACA 2X51A 1A0OA 2WYIA 3LF2A 5DLDA 1YS7A 4RFVA 3I4FA 3QELB 4B87A 1WSAA 4PL6A 2AQIA 2EJGA 1I2AA 1A5AB 5A3JA 3VSEA 2R8RA 2P91A 1SXIA 5THXA 1WB9A 2GNCA 1P3JA 1NUSA 1Y3BE 1G20E 2Z98A 4L8LA 5EJFA 1NB0A 1FJ2A 4PSKA 1GRQA 2IHZA 3IOMA 4Q93A 2KBTA 5B7GA 1ZESA 2FZLA 1ZGBA 3PC2A 2V74B 3ZLBA 3OPMA 2F5TX 1JLRA 3AZOA 1Z5OA 4B2PA 3QWAA 3JATA 4F2PA 1QVGA 2VTDA 2FFRA 1C81A 2D1YA 2NYSA 1HYHA 1UBRS 2JN0A 4K6HA 4AJLA 4KAFA 2FPWA 4CG2A 2YWDA 5HRUA 4DJJA 4C22A 3P0IA 5KTKA 4RJJA 3PNQA 1V48A 4V0SA 4IHQA 1MW9X 1C7RA 1LJ8A 1TS9A 1X9IA 5TPZA 3AVYA 1F4VA 1YCGA 5JS1A 2X2EA 4IO0A 4Q9AA 2ALJA 4AW9A 4AO8A 3AVVA 2JLSA 4MR8A 3ZCXA 2PVCA 1JFFA 1Q14A 3TI9A 4DLNA 4O4JB 2GYVA 1GRCA 4LF4B 3UB3A 5HQTA 5FLXE 3N5KA 2BL4A 3MAGA 4BTVA 1NNI1 2UYYA 3UUFA 2DQYA 5FNVA 4I6JA 4S12A 3BWDD 1H2EA 4WOPA 3TLGB 3OQNA 2BGGA 5F3WB 3QLTA 3UF0A 2EQIA 4ZGGA 5IT4A 5FCDA 3W5JA 1NJ2A 1XXLA 2WV9A 2ETXA 1HRDA 2VDPB 5L8RE 1FZQA 4EPWA 2F1JA 4WFQA 4BN5A 1O87A 3GJXC 1RQGA 5JRZA 1GTZA 5E7IA 2R60A 2FMIA 5TEWA 2AMVA 3WRVA 3CFYA 1M67A 4EHFA 1XCPA 4K28A 5LLSA 4RA6A 1EFRD 4HDOB 1HTWA 5A9RA 1USWA 2PU9B 4IIOA 2SKCA 3G05A 1SD5A 4RLSA 3BL8A 2I7DA 3RT9A 4HT8A 5HZMA 1RBMA 3TVTA 1JDSA 3E15A 2PMCA 1CRQA 3FDRA 3R3ZA 3NOOA 3RK4A 4MRNA 3ASRA 2A08A 2YX1A 4BFXA 1Y0BA 1W9XA 2YIDA 3C87A 5C3UA 4IIHA 4WEQA 2QDXA 4C0FA 3L0YA 4EI2A 4TWIA 3V2IA 5GJBA 2VVTA 1JH8A 4N0PA 2FUEA 4OOXA 3OZVA 2CZ7B 2ZKLA 1P6XA 5E7QA 4A3SA 2Y92A 3WNZA 2O3RA 2ZIUB 1T25A 3K92A 1FL9A 1JG1A 4UFPA 2PZKA 1WDLA 2XW6A 1NT4A 1C3EA 2EZ8A 2VRCD 3U3RA 3R0ZA 1EBBA 4YJFA 2LP5A 2A84A 2OP1A 3DF9A 1NV8A 2V26A 1V11A 2OV2A 2L8DA 3EQ8A 2AXPA 4DRXA 2GF2A 3NEAA 1JBEA 4MVJM 3NFYA 2OECA 3LF1A 2OLJA 4TTJA 1XAJA 1JR6A 5CAIA 2VWQA 3JVUA 4HGRA 2PZEA 4YYEA 3I56B 1SVLA 1H22A 3JALA 1MB3A 3WMRA 1HMPA 3DJYA 1WHJA 1AG9A 3IP5A 4NKRA 5A4KA 1TXQA 3OH8A 2PSFA 5LWHA 4JMPA 2PUFA 2RJNA 1D0ZA 4D9KA 4EHBA 5EZYB 1DB3A 1YCSB 2IPXA 4MZPA 2BRUA 4B6EA 3E9ZA 3MJDA 3ND7A 5ALIA 2OBFA 1HSZA 2A1TS 3MHTA 3LWHA 4LA4A 4KQXA 2NYVA 1SHKA 2WWTA 5K3OA 4YDHB 3O7WA 4HGYA 3B5JA 4Q00A 3SFTA 4X6XA 3PHJA 3CXCP 2MYUA 4AY6A 4AT1A 2QMOA 5DN6A 3FFWA 4HNSA 4OHFA 1ZINA 1HFEL 1Q92A 4RZ2A 1TO1E 3GIBA 5GAN5 5BN1A 5FF9A 1KMHA 1VBMA 4DDVA 4MCAA 1IUOA 4MCHA 3ZU2A 3X3HA 4RLQA 3AP2A 2DVJA 2J6BA 2Q99A 3DXZA 3S2GA 3NOVA 3SFVA 5F2OA 4LSGA 3GROA 1RE1A 1K0XA 5CM2Z 1KGSA 1XQ6A 3D8TA 4J9GA 1IZ0A 4RD0A 2Q0HA 3UHJA 4HRAA 1HDRA 2DHRA 1PO7A 4RZIA 2ZP1A 6AT1B 4V39A 3WGKA 3WXBA 3JCMb 1F14A 3RMSA 4DC0A 3OPVA 4DYHA 4CETA 1QAQA 5ALMA 3PNWC 2OFXA 4GXRA 4D8UA 4EI9A 5DEIA 4DQUA 3CLRD 4MRMA 3VM6A 3WZMA 3D1LA 1RXEA 1CR2A 3IUYA 2QT9A 1QIJA 3PGJA 4Y2TA 3WJ1A 4DJTA 2WHYA 3BFVA 1K8AU 3M1IA 2PV7A 3BJMA 4P4NA 1GG8A 3NHRA 2WIGA 3P1JA 3TSOA 5I5EA 2YY6A 1OFUX 1ODCA 2VP6A 3GNGA 1II0A 5JCXA 1R2QA 3ED1A 4KMMA 3WMFA 3HPRA 1GFZA 4BU0A 1LSJA 2BKLA 3G59A 2BUCA 1Z8FA 3EUWA 2R0QC 1PL7A 3HUFA 1Z29A 4FZ5A 4YACA 2G6FX 3CUWA 2OC4A 5BWLA 3QDRB 3FUXA 4NP6A 4OSOA 1WHGA 2W4QA 1RBYA 3RNJA 1P4RA 3ANLA 4RPCA 1DIBA 2WSSD 2CRVA 3AV3A 4AY4A 2YASA 4RTYA 1QRSA 1S8NA 3I9V1 1JYFA 3GCZA 4UUBA 2AIRA 3ZDAA 2C1XA 3FCCA 2J9RA 3U61B 1IRIA 4C88A 4EFNA 3OJCA 4KXWA 1XA4A 4YRAA 3TNLA 4WK4B 4WN9A 1MVNA 2Q7XA 3QPBA 3HCCA 3C1TA 1ECJA 3PEEA 1LPOA 1VJTA 1A4XA 3CBPA 4M7PA 4HRVA 4KMOA 4MULA 5EHZA 1Z82A 3IYLW 4MDWA 1I0IA 1EP1B 3UYLA 3RQIA 4OD0A 2ZTUA 3BD6A 4RAOA 4M0UA 1PT6A 1OZHA 4V0NA 4PLTA 2PVOB 4Q7EA 5KE2A 2RHHA 2XICA 2X7XA 3DTVD 3OFJA 3CQ9A 3S2SA 1ILEA 3AOEC 1XQWA 4QFDA 4P25A 3P9KA 4DWVA 3EMVA 1X6VA 3U6KA 1KDVA 2Y6VA 2C5HA 1I3OA 1T4BA 4NZOA 1W2BS 3BREA 1PVDA 4J9CA 3FMOB 2LE0A 1JHVA 2DFDA 5A5GA 1A9XB 2C61A 3RNOA 1UHFA 4DIOA 4YLEA 3U7QA 2AOUA 4LQDA 1VA5A 1ZBDA 3PVDA 4PN7A 5HF5A 1L7MA 1OC4A 3D81A 5ITWA 3BGOS 1UGSB 1NZFA 1AGXA 4US0R 4HG2A 4QSMA 3A6ZA 5A04A 2IV2X 1UPBA 4ZI3A 3E82A 5H3LA 3VC3A 2AOWA 2ONYA 2PJZA 1GCOA 1VSBA 3KR9A 3NIDB 5KH6A 3AP3A 1CKAA 2IDJA 3X2FA 3V5NA 3CBOA 1ULTA 1Z35A 1DKPA 2C7RA 1AH2A 1NWCA 4LXTA 2OYNA 3RRMA 2YHSA 3W5IA 5ELLA 1VG8A 3ZGNA 5F4ZA 3RS4A 1VL1A 1U9IA 2FN4A 2Z1MA 4MI6A 3E03A 4MYRA 3RAFC 2G88A 3E7PA 3OC6A 5EQDA 4KOAA 1A96A 3SMVA 4I4TF 5JR3A 1KQNA 2Q8PA 1M54A 1VQKB 1NOKA 4L50A 2RBEA 1E1CB 4UEOA 3RDVA 4YJDA 2QLMA 1I9GA 1JAIA 1X70A 2JZCA 4TTTS 2FRWA 2P68A 1ZL2A 2ZJ8A 3H3FA 2MCNA 8ATCA 1E60A 3U1VA 4EGSA 3EIHA 1YZ3A 3ZPXA 1T2CA 1U3FA 4CC3A 6CHYA 4M7OA 3A6GA 1YRAA 2FSIA 5HM6A 3KCNA 2WE7A 1Y6JA 1UD8A 3DE3X 5TXGA 3W5UA 1DAGA 221PA 4JSRA 4Z86A 1SVMA 3FUWA 2ID7A 3AL2A 2OYRA 3DHVA 3UMCA 4E5NA 2GHRA 3W0LB 3TIGA 2P1RA 3IBCA 3ZQ6A 3HXQA 5FPHA 1UBOS 4P08A 3RWBA 4L7QA 3GJTA 5GAN4 4HYQA 1BCSA 2K5LA 1UBUS 1U28A 13PKA 2NUBA 5ELXA 2K7AA 2JFHA 2F7SA 2Y4XA 4CKCB 3KJQA 2OAQ1 4PZCA 2JA2A 4DJFC 3I9MA 2E6ZA 3N2LA 1RPJA 2RI1A 4HQFA 4K1XA 1Q44A 5DCYA 1M8VA 2CE7A 1UT6A 3ZUPA 4J0IA 1GNRA 2QTHA 5TRTA 3CCVT 3Q9NA 3SLRA 1R66A 5JNWA 1RZRA 3JXEA 3BTSA 2DBKA 4JJIA 1J70A 1IHYA 3DWIA 2QW0X 1NYGA 4YCSA 2RIRA 4BQRA 4IIEA 1T9DA 2X2FA 3ZDDA 3CH5A 3GUZA 4EQZA 4NZMA 3H94A 1E66A 3AYZB 2J8ZA 3M58A 1MB4A 4K9PA 2BZ1A 5CUQA 3BIWA 2VBCA 5CB4B 3MMPA 2AJBA 3B6ZA 2GTIA 1P5ZB 2JN9A 2BFNA 3K70C 3VTAA 2IP1A 3OFND 3VH4A 3QF4A 4DDUA 4D81A 3EXHC 1QR2A 3M33A 5HDBB 4QUAA 3MIIA 3VO9A 2XQFA 1W5AA 5JU6A 2HJHA 3QHPA 3M6XA 2WMOB 1A8UA 4Z4EA 1IZ6A 4IXTA 4QGSA 4FC6A 5JJ5A 3RR6A 1ODIA 2Q2QA 2FP4B 1DAPA 4HAUA 5KOYA 3BJEA 3VKIA 3ZDZB 1LNSA 4PVCA 2XKAA 4QYTA 1FU8A 4DUGD 3OCXA 1UKEA 4GSKA 3HGMA 1LCKA 2FWIA 3TECE 3LBFA 1JPUA 3SYNA 1T15A 2EZ4A 1G41A 3FHTA 1JEAA 1H93A 1ZHOA 1FFGA 1BMTA 1Z2EA 3PNMA 3T5MA 4OBWA 2XH8A 4EKIA 5CA1F 1LPBB 4PEVA 2AYXA 3ME5A 3MRTA 1I36A 1ZMTA 1CTQA 4KTVE 3RREA 3G85A 4N9QA 3OYMA 5KYXA 2EWMA 3VU1A 1RZVA 3GT4A 1N7IA 1SCBA 3LPAA 4L85A 3P26A 1GLVA 3A3YA 5TGDA 4ZQHA 5JSZB 4L8GA 3LX7A 4PFSA 3TLEA 5LB4A 4PLPA 4A0QA 1T5EA 5AO9A 2ZYRA 1K8QA 3C70A 2REQB 4EHHA 4F5WA 2FX3A 1PVVA 2J31A 4J29A 3GJ4A 4JOSA 1Z47A 5IYNA 3VZRA 4HH3C 3PJDA 4PRKA 1I4TD 3UC5A 1NEGA 4E7KA 1YXMA 4P1ZA 1V3QE 1XD2B 2PKYX 3NZEA 4HGPA 4WA8A 2PRSA 1E77A 4PQYA 3EGWA 2X40A 4KQHA 2CYCA 3L40A 3UAYA 1X69A 4MQFB 3D3NA 4OQQA 4ZVQA 2SICE 1MAAA 1T0HB 4Q03A 4DJAA 5CX1B 4M36A 4EW2A 3EGXA 3CX3A 4JA2A 4Z6KA 3RTDA 1RLQC 2EP7A 2PVDB 4X1YB 5EMNA 1MC8A 2DFLA 1RXVA 4W6ZA 2VYNA 2PR7A 4P7KA 3VMMA 3NHNA 3CB2A 4BLWA 5JHGB 3RE1A 4AKHA 4S1OA 3LVFO 3GJQA 2ZVPX 4ASUA 4J1TC 3VI4B 1QO0D 4D8DA 3CVYA 2HLPA 3GYBA 3MVEA 3GNQA 3C7TA 5BT8A 2AWOA 1F6WA 4WNIA 2ERXA 3HKEB 3AIOA 4PKCC 2PX5A 1NY5A 1NLMA 3O4HA 5JZ9A 1SCUB 4YRQA 2NUPB 1VOTA 3A8TA 3H1AA 3HRHA 5E8JA 3SSMA 3ICQB 1Q84A 3MCWA 2RM4A 1P62B 2ZIXA 5TT0A 3WLNA 5ADVA 4JJEA 3ZIAA 4G1FA 4D9JA 3WRWA 3E9QA 4R01A 4M1ZA 4NCKA 4YRIA 1LSOA 1Z36A 2AC2A 2QVBA 5BXQC 4Z9FA 4A8TA 3IAS1 1C1DB 4RHEA 4J1NA 1UCFA 2QD3A 4W9RA 1ZKMA 4AKSA 1LF5A 4MQ6A 1E3MA 2P4TA 3QPAA 2E3IA 4HI0E 5B3JA 1E3WB 3WVDB 3FRJA 4LV8B 4HWSA 4C0BA 3C48A 3JSCA 3G71T 1D09A 2YMPA 2JFPA 3QV1A 4IZ6A 4LKRA 3IKMB 2RHGB 3RG2A 3ZCSA 4C29A 5KKAA 2RHYA 3P2OA 1W581 1T8TA 3O38A 2OENG 5CK5A 4P2NA 1E9DA 2QA4T 1Z34A 4D92A 4WXRA 3K6RA 4MW0A 4CC2A 1N2SA 3L49A 3E19A 3K9HA 1ZISA 3GD7A 3DVLA 1W8IA 2Y0BA 2HUPA 4BD3A 5JLAA 4NYJR 2FRVA 2X0DA 2OC9A 3UHOA 2JNGA 2RH2A 4C7KA 1D2NA 5AOBA 1ZA2A 3KYCA 2I1QA 4V0QA 4RJLA 4KV7A 2FVGA 4Y2PA 3LGAA 3ZZ0A 3NXSA 4N9WA 4EHJA 4D4HA 1E6WA 2J48A 1MABA 1U7ZA 3SC4A 2G4VA 2BBOA 1YE3A 1VIAA 4QXQA 2YHTA 1JFSA 4E1BA 2GA8A 3GVXA 3JZAA 3B6KA 1LS6A 3VV0A 3P9ZA 3DV2A 3EJ6A 4KXYA 4Z9XA 5JW6A 5KSYA 2EL7A 1YVEI 5I7AA 4U7GA 3WJ2A 4F7UF 1VA7A 3CCMA 4RMGA 4L8JA 2JI6A 2P9ZA 2A0XA 5JALA 4M77C 4JQZA 2WQ7A 5BMVA 2PZJA 4ESEA 4XLZA 1PV2A 1XCBA 4DV2B 2C8VA 3PVLA 3OYFA 2ZB8A 4BDYA 4L6AA 2IPOB 1N1MA 1TL7C 3PC8A 2YV3A 4JLUA 1PHTA 2YL2A 2YZKA 4QGFA 3AM5A 2QHXA 1X75C 1RXIA 4Y6OA 3AHHA 2JBHA 1XRPA 2I4TA 1YBMA 1C3JA 2XVYA 2NU8A 4JKYA 2FNAA 2L2PA 4ZCIA 3I52A 4FDLA 1YB4A 4K8OA 4YR9A 1J3TA 4TMYA 2KT1A 4GR5A 3IL2A 3TU4K 5TPWA 2R62A 1YR2A 2BEUA 4UZEA 1KC8C 5KYUB 1J0DA 2VF8A 2ZJAA 1W48A 3PHIA 1OH5A 1X1EA 1IBRA 4FNAA 4EYKA 4EX6A 5KWSA 1W36D 4IQ4A 3MJVA 3WQQA 2D0NA 1N08A 3REOA 4MPDA 4MEJA 2WDZA 4ZKEA 4XM2A 2XUOA 4CKWB 3EVEA 2PL9A 5K8JB 5TX7A 1CT9A 2CJYA 2ZWMA 4TLCA 2H6EA 2ZRJA 5KPJA 1N36B 2LRHA 4C6TB 1GQFA 3M57A 4KQ2A 2FRYA 5G4LA 4UZSA 3CPWA 4P5EA 5JSHA 3QEMB 5BQ3A 1L5HB 2VHJA 1TSFA 1N8SA 2BM8A 4BO9A 5JLJA 3VX3A 3FB1A 3K6SB 2R8YA 1J8YF 5K3BA 5B12A 5CLGA 2AS0A 1QK5A 2I7XA 4ALIA 1SZCA 1FRVA 3LO8A 3NYIA 2VXCA 1BS2A 2P9GA 3VR3D 4TV8B 2Y1FA 1V43A 1QAMA 1N7JA 3SM3A 3PIOA 1BU5A 4LJ6A 3T9BA 721PA 1XZHA 3FJ5A 5AW3A 1UQTA 2JJMA 5U9CA 2ZBRA 4G0MA 4HNRA 1L4UA 4N18A 2IJGX 1P2DA 2C2GA 3TFQA 1N6RA 3AOGA 3LRPA 3KKLA 2REOA 1ZH2A 4IRXA 3BZWA 3CHYA 5L3QA 2QTGA 1HBJA 3D4OA 3JAWA 2JKZA 4PFPA 4A4GA 1DO2A 1GIAA 2AFHA 4DCCA 3HNPA 4QFBA 5FA5A 4NYJQ 4HFRA 1AWXA 4L8WB 1T6XA 5ULLA 4HVCA 3HN2A 3YASA 2RI0A 2BGNA 3MD0A 2FETA 1YI2A 3M0QA 2QAGA 2CDCA 1EQUA 2H48A 1M3BA 4KP7A 2B4RO 3G0OA 5JWRA 5LJ3j 3ZH9B 2VPIA 3KOMA 4XLHA 3FOEC 1GCIA 1RHKA 3IE2A 3H8JA 2IIPA 4JUFA 2FSHA 1P1CA 4TV9B 2QQ0A 3WRXC 3D2CA 4EJSC 3DE1X 4QQGA 1UJBA 5FWBA 3ASTA