2DEUA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
364
structure length
364
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA
total genus 85
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2deuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2deuA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2deuA01
3MXTA 2QTLA 1NUSA 2PIDA 3SYTA 1W35A 3IVGA 1WXHA 4G5FA 2CYCA 5TY0A 2E1RA 2JA2A 4U7JA 1GAWA 3SEQA 4CDMA 3W2EA 3CCJB 1EFVA 4GU5A 3KT8A 2DPLA 4QFMA 1FNMA 1QUEA 4Q16A 3FNRA 1JA0A 5AN9A 2BV3A 4LBWA 1JEEA 3N2YA 3ZIUA 4B43A 1M8PA 4B3XA 1FNBA 1QGZA 1JIKA 4M2LA 3DV2A 3LOQA 4LC0A 3WYAA 1IFXA 1GO2A 2E89A 1IJEA 1FDRA 5EKDA 2QMUA 4DNXA 4NAHA 3OP1A 4PBTA 3VRHA 1NSYA 3H9BA 2NZ2A 2XRYA 1AIPA 4I6EA 5JBNA 1EFVB 5THXA 5KHAA 3ZGZA 2E21A 5TEWA 1J70A 1VLHA 1TYCA 2AHOA 3ZC3A 3CCMB 1G7SA 3VO2A 1OWOA 3CR8A 4JYZA 4B48A 3GUZA 1QH0A 1WDTA 3FJOA 4FWTA 4YMIA 4RCZA 1YULA 3N05A 4Q93A 3VGJA 3WBKA 2AZXA 3A4IA 3CVYA 1U0BB 1H3FA 1SKQA 5GV8A 1FYDA 2ZUFA 4KR6A 3OJXA 2OQ2A 3CLUC 3INNA 3WXMA 3MMPA 3G4SB 4Y7CA 1Q15A 1OB2A 1TYDE 1YI8A 3CCQB 3WBJA 1KD1D 2QN6A 2X3FA 1ZM2A 1CT9A 2QUJA 4G1VA 3SZGA 1OWPA 4PC6A 1JIIA 1R5NA 3WNDA 3AG6A 1KC8D 2RD2A 1FRQA 1CNEA 1N0UA 2OV4A 3ZBTA 3RK1A 3OZVA 2A1UB 1N0VC 2PXHA 2VXOA 2GKSA 3IDFA 1J21A 1MC1A 4P3YA 1U2RA 4M0LA 4TMWA 1N2IA 3AL0C 1D1NA 4ZT2A 1Q7YD 1N2GA 3PXUA 3VU8A 3RJZA 2DLCX 4EG8A 4UZEA 2WB2A 4M4SA 5KSWB 4IW3B 1D8TA 1XNGA 1EUQA 3JQPA 4J0QA 2QA4B 1I6LA 4ZCSA 2CYBA 1D2RA 2E18A 1N3LA 4TN1A 4WNYA 1E63A 1T9GS 5LFAA 2NPFA 1R6TA 4X0EA 3Q4GA 1R5BA 3PENA 3IOEA 4MLPA 4ZGQB 3WNCA 4EFKA 4RD6A 4G5GA 1PFVA 2YWHA 1Q86D 2PFSA 2BM1A 1AMOA 3COYA 1O0CA 1O94D 3AGQA 1WZ2A 3IUEA 1BS2A 1M8GA 4DQKA 1KKUA 1KP3A 3ZJUA 4HJRA 4MYTA 5DK4A 2VNHA 4ARCA 1UFVA 4ARIA 1EWYA 3G6KA 1ZUNA 3F3MA 1ZH6A 2B7LA 4OUDA 4ZCLA 4RUKA 2DY1A 1NI5A 1YITB 4C0SA 1LI5A 3CC7B 1J20A 4CT0A 5HUJA 1JZQA 4MW2A 1YHQB 2QTRA 4FN5A 1G7TA 2D54A 1F7UA 4ZV4A 3UK2A 2QJTA 1MRZA 1K97A 1DDIA 3W2FA 3W2HA 3IMGA 4MWDA 2J7KA 2GM3A 1COZA 3N9IA 3W2GA 2DCUA 3NBAA 3CLSC 3DPIA 4M1KA 3DO8A 1BQEA 2OTJB 2J5BA 3ZZUA 4ZCPA 3VMFA 2PMDA 1K4MA 4KR7A 1TQ8A 1OGIA 1OWNA 3TZLA 4MUGA 1QVFB 1M8KA 2VTBA 1IQ0A 1E64A 2A1TR 3FDXA 4MUIA 4EGAA 4JXXA 3AVXA 3UY4A 1EFUA 1EFTA 4H9GA 2QDXA 1VQ6B 4DDMA 1VBMA 4QBTA 1KK0A 3OJWA 3FIUA 1H3NA 1YUNA 4PC7A 1IQUA 1U7DA 1O95D 4ACBA 3H9CA 4ZT5A 2B7BA 3HZRA 3W5UA 1XB2A 1ZM4A 4PC3A 1M1ZA 2BMWA 1YI2B 4B4DA 3H99A 2BGJA 3CXCB 3CPWB 2BPOA 1NUTA 1DDGA 3G6EB 1VQLB 4XFJA 3KT0A 4QRDA 3COZA 1VQPB 2A7XA 3ELBA 3K32A 1YUMA 1O6BA 2A88A 1N1DA 3CLSD 3HFJA 1VQMB 3VO1A 4ZT7A 1EXMA 1G7RA 2ZITA 1GN8A 4MWBA 3MLAA 3QFCA 3CB4A 3FWKA 4ZT6A 2X1MA 1IQRA 3B8HA 5TGTA 4LBVA 3J81k 2IP1A 3QTBA 2QUIA 2CYAA 2EFGA 4CDNA 5DASA 2YWCA 4MYUA 3RK0A 1TFUA 3RFFA 3AVUA 1VL2A 3AVYA 2RE8A 1EUYA 4B44A 4ZT4A 3CCEB 2DERA 3CCSB 4ZCTA 4KPUA 4P6VF 2QUHA 1H3EA 1K9MD 3TZEA 1I6KA 4Y9RA 1J1UA 1G8HA 2H2AA 3OTWA 5H7XA 1FFYA 5JBQA 1X8XA 3HL4A 1T9GR 3AVTA 5DB4A 1WY5A 4NX2A 4EG1A 2A1UA 1I6MA 3DLAA 3CC4B 2OK7A 4XSVA 3X1KA 1MBZA 2RC6A 1KR2A 1ILEA 3NV7A 4MUJA 1F9AA 3U1VA 2CV2A 1BX1A 1ZM3A 1N2HA 4MW9A 2PLFA 2DXIA 5F23A 1MB2A 5GV7A 3D6VA 1RQGA 2A84A 3FOCA 3ZUGA 3G71B 3FY4A 3IOCA 2CV0A 3H97A 2DEUA 3CLUD 1MOPA 1R6XA 3KT3A 1G59A 1EXDA 1KORA 3GLVA 3ND5A 1TLLA 1S0UA 5IHXA 2PZ8A 4MUNA 2O8VA 1QGAA 4LBYA 2DUMA 5FO1A 1PG0A 3CVUA 2DR2A 4DQLA 1YIDA 4RD1A 3SEZA 1JZSA 1GAQA 1O97D 1EFPB 3AG5A 4JXZA 1ZM9A 1JNYA 4QHYA 4LBZA 1B23P 1N78A 2HDNB 2G36A 1PFWA 3ZZTA 3MCAA 1Q11A 1U3DA 4UZFA 1TYAE 2J08A 1CQXA 3CMAB 3RBAA 4N3GA 1YIAA 4MQ6A 1ZJWA 4F3RA 2QEXB 4L2IA 4F4HA 3MUEA 1IB0A 3SZ3A 2YWGA 3P26A 5K0SA 3AGPA 1T6YA 4G5YA 5TEVA 1M1KD 3B82A 1B2RA 4YALA 4TS1A 1QUFA 2V0CA 1EJ2A 4ACAA 1J9ZA 3IVCA 2BTEA 1VQ8B 1EP3B 4RD2A 1TYBE 1V8FA 2GPJA 1WOYA 4PBRA 4PGOA 4EG5A 1Q19A 1FRNA 1EFPA 3A05A 2IELA 3I05A 1K73D 1OD6A 3HGMA 3QTTA 1QQTA 1KK3A 2X0KA 4JFAA 3P27A 1OB5A 1R6UA 2Z3VA 4YP7A 3FHJA 1NUQA 4HE5A 2BN4A 1M8JA 1IJFA 1OBHA 1I7PA 2WSIA 3CCLB 4A91A 3M5WA 4YAWA 3CVXA 2YY5A 3W5HA 1VBKA 4TMVA 1KH1A 1NURA 4AF6A 1R5OA 2C5SA 3Q10A 5DEOA 3S3TA 3SDBA 1GTRA 3E1YE 2VNKA 4AC9A 1HA3A 2PG3A 4R0NA 1O94C 2OTLB 4KR9A 3K9WA 3TNJA 4JZYA 1QFZA 5TV2A 1Q77A 3IMEA 4XFDA 2XRZA 2EIXA 4MUKA 4K0RA 4RD3A 4HE6A 1IVSA 2FX3A 1LW7A 1QG0A 1S72B 4MVCA 3RHSA 4G1BA 3V76A 1KAQA 1KH2A 5K0TA 2VNJA 2Z08A 2TS1A 3CLTD 3W5VA 3CC2B 1JJ2B 4YP6A 1NUPA 3HMQA 1O96A 3B78A 2J09A 1NYLA 1QNFA 3ZXSA 1QU3A 4KPUB 5HXBA 4OUDB 4G6ZA 3OZWA 1M83A 2VYQA 1KQSB 4BPRA 4ZT3A 1WXFA 1OGJA 2AG6A 3JQRA 1WKBA 1VBNA 3BL5A 4PC1A 1F60A 3FPKA 3MLBA 3ILVA 1N8RD 3CW2A 5EMNA 1ZH0A 4YBRA 2PZBA 1UMKA 3CLTC 3FI0A 4ND6A 1TEZA 4EG4A 2GQFA 4DLPA 1OBCA 1EFCA 1XE1A 5FA6A 4FZJA 2WQ6A 2YXNA 1CNFA 1W87A 5H5JA 3P0IA 5FO0A 2CUZA 3CRZA 1JECA 1H1TA 4GRIA 4J76A 4I6GA 1N2BA 3ZJVA 1YJWB 1KH3A 3CCVB 1QVGB 1KK1A 4UAJA 3PNBA 4MVYA 2C77A 1QU2A 1JILA 1QTQA 3X1MA 3D6UA 5J59A 2CV1A 3WNBA 1KQPA 1Q82D 1N2OA 3G59A 1WQ4A 1O95C 4RD4A 1KAMA 1SM4A 1XJQA 3Q12A 4YAUA 2QUKA 4YP5A 1QRUA 4YAOA 1DNPA 1JEDA 1YIJB 3GMIA 3AVWA 1VQ4B 3AVVA 1H42A 4RJLA 4C43A 3KFLA 3FETA 2D74A 1KJZA 3ZZ0A 3COVA 4RPIA 2VTBB 1NZJA 1WXGA 2BM0A 1MJHA 2JANA 4ZGNB 3N8HA 1QRSA 1LI7A 1SURA 1GR1A 1O5TA 4K03A 1TTTA 4PBSA 3SJZA 5IJXA 3UC5A 1QGYA 3CMEB 3ES9A 4F7DA 3QSYA 1N2EA 2VZLA 4DE5A 3CCRB 4RD0A 1IH8A 4Y9UA 2E0IA 3H05A 2WQ7A 2V0GA 2BGIA 3G5AA 3LO8A 1G8FA 2IJGX 1KQNA 2B7CA 4NZPA 5FNZA 2J07A 1DG1G 2NSYA 3A2KA 3A04A 3CVVA 4YAFA 1JB9A 2VNIA 4ZCIA 1EE1A 3AFHA 1O0BA 1E62A 4MW6A 1S4MA 1ZUNB 4E1AA 3WY9A 4MAFA 3QFRA 4AF7A 1GLNA 3COWA 1O96B 3U6KA 2C78A 1WXIA 4HK4A 1WXEA 1XNHA 3TS1A 1G7CA 1WJGA 4J75A 3LE8A 2QTZA 1X6VA 1DARA 2CNDA 4FK8A 1GVHA 5DSZA 2HMAA 2QJFA 4MW0A 4NDAA 1O97C 4M53A 1VQKB 1M8FA 1EP2B 2AKEA 2RC5A 1XNJA 2ZP1A 2CRVA 1G8GA 1EP1B 2DETA 1F7VA 2GOYA 2X3UA 3FG9A 4PY2A 1N2JA 3ZXIA 1F4LA 1JA1A 2EL7A 1NDHA 1VQ9B 1QRTA 1QX4A 2BF4A 3LCJA 1GTSA 1GAXA 5LM3A 1VQ7B 1V47A 1JMVA 1N75A 4OJMX 2A86A 1ULHA 5H16A 1IRXA 1NP7A 3FH0A 1PFYA 3IH5A 3CD6B 1D2EA 1GJRA 1MAUA 1WQ3A 1TUIA 3QE2A 4HPWA 3NBKA 1W34A 4R2LA 2D13A 1FNCA 1MAWA 5TR9A 1KQOA 3P0HA 3UMVA 1OWMA 3I55B 4MW5A 1BJKA 2HGZA 1ELOA 5KCMA 2YWEA 1KP2A 3X1JA 4MUEA 2HZ7A 3IODA 4EG7A 1N77A 3VNVA 2XEXA 3LVBA 2B5OA 5HUHA 3MHPA 3TQOA 1Y42X 1H85A 1QJCA 5J58A 2CSXA 4EF6A 4S1OA 4BWVA 2BSAA 4EG3A 3E27A 4K1XA 3CLRD 1KTVA 4TMXA 1PFUA 3I1FA 1BX0A 1VQOB 2PZAA 2D5BA 4R71A 1K4KA 1JIJA 4R2MA 1NJID 4ZCRA 1VQNB 1W2BB 2JAXA 5HG0A 3ZJTA 5LLTA 2YWBA 4YHBA 4ND7A 1J09A 1PG2A 4MWEA 2PIAA 4MW7A 2OK8A 1K8AD 4U9UA 4B47A 4MVXA 4NATA 4P2BA 2O5RA 2QTMA 1F20A 4ZCQA 5J5AA 4TMTA 3VNUA 4KKVA 4NBSA 3CVWA 4I6JA 1VQ5B 2ZUEA 1T6ZA 1IHOA 1K92A 2CFOA 4HJXA 4EH1A 3IMCA 3U6BA 3ISJA 4QREA 1U3CA 4PC2A 3E20A 2R5WA 3MMXA 3AIIA 1M90D 3L93A 1J1ZA 3CLRC 3ND7A 4MWCA 4L2IB 1JHDA 3C8ZA 5AHWA 2XNCA 2I1LA 2HCJB 4N3NA 5TS2A 3JQQA 3QFTA 3ZBUA 1JGTA 3PRHA 2R6HA 2H29A 1U7XA 3CCUB 3IVXA 1I2DA 1QFYA 4NCNA 1T6XA 3QE4A 3PNVA 3AKZA 3HV0A 2BYTA 4DDKA 4DJAA 1P7PA 2XNJA 1YJ9B 4ZCMA 1YJNB 2CT8A 3PNYA 3CA8A 2QJOA 4TMZA 4CQNA 4AS1A 1A8PA 1GZUA 3OZUA 4MULA 4RCYA 3W2IA 4MW1A 4WSOA 4DDHA 4EG6A 1HYBA 3IOBA 3QFSA 4Q7JB 4MUHA 1Q81D 3IUBA 2A4MA 2Z09A 2BVNA 1TVCA 4AQ7A 4U63A 1MB9A 4MUFA 3KT6A 3I56B 3P52A 1KK2A 4WQMA 2X1LA 1GPMA 1B6TA 1NUUA 3P0JA 4MW4A 1FNDA 2A1TS 4NAUA 5BNZA 2QTNA 3SP1A 4U8HA 3JXEA 5H59A 2EJCA 2J4DA 3TQIA 3U2QA 2YWFA 4MVWA 1KRHA 3ND6A 4H3SA 1OWLA 5KWVA 1QFJA 1A8HA 3L92A 3UOWA 3OW2B
chains in the Genus database with same CATH superfamily
4LG1A 2PJUA 4HZIA 5J3OA 5CHEA 3IVGA 2PGNA 5FYQA 1J2YA 1XDWA 3BFXA 3LYAA 4X1KB 2GX6A 3DBLA 1YS6A 5LJ5h 1GXSB 1QYWA 2HNKA 2FEMA 2QY9A 1OVMA 3E3NA 4OHBA 1P44A 3O82A 4YWHA 4P0PB 4CEHB 2WILA 2CLFB 2C5BA 4IICA 3VI3B 3GDFA 3CQ9A 3ZIUA 1VL0A 5AN9A 3KHUA 3PTZA 4FFVA 2G1AA 1CUIA 1F3LA 1T8UA 3GLHB 3LNCA 4RF3A 4FSDA 4RFLA 5ANRB 5TMBA 3W9BA 4BO7A 1M2VB 2WJ4A 1KPGA 1T2VA 2ZSKA 3DBIA 3FGNA 2GN6A 4QG7A 3G3EA 3VZRA 5EJ6A 1KOLA 4OL9A 2QK0A 3HDYA 4M7AC 1NQAO 1Z38A 3QXHA 4HH1A 5B7NA 4H3HB 3P9KA 1Q84A 2A9VA 4MEBA 3JQCA 1PO7A 4B9WA 2R1TA 3EDRA 4IKEA 5LQSA 3PK0A 2FZVA 1ETUA 1WSBA 3PNPA 4O0MA 1DXOA 2F3QA 2YHTA 1KYYA 1FLVA 4YHHB 1WVGA 1ZP6A 4F3NA 4WZBA 4A8TA 4CLOB 1PGJA 1OEBA 2PKYX 1GKIA 3MK31 1G7SA 1HBJA 3ND9A 3QUTA 4ZVUA 3LHDA 5UKDA 2IYZA 4PYJA 4F93B 3ZE6A 3U7EB 1WDTA 4CDRA 3K0HA 1YI1A 4WXMA 4B7XA 3UDCA 5LWHA 2PGLA 4WJKB 2VBSA 1SVNA 3A3YA 2H2GA 1KXJA 2GNPA 2YIJA 4EKGA 4F4JA 5BP7A 1OI7A 4LCJA 2G9RA 2R6GA 4WECA 1ZIDA 2EF1A 1DUIA 4FB5A 4ZP1A 3IEKA 1T5HX 1EWVA 3I8OA 4XEUA 1UD2A 3SPXA 3VRZA 2W6ID 1NV8A 4RA6A 4AW9A 1ZM2A 2FEXA 3M9XA 3SZGA 2ED1A 2FEIA 4YA6A 3UV6A 1DV2A 1KC8D 1MR3F 4XN3A 1UAAA 2IFTA 3OFSA 3A8IA 3K70C 2VH1A 3L5KA 2A1UB 5BV7A 1Z29A 2OXRA 3Q9LA 3RYCA 3ELUA 4W5WA 2GKSA 5FUMA 4P3YA 3GQBA 3L7MA 3WADA 3CXUA 3KUCA 2UVQA 3STHA 1NVTA 1YITA 3WLAA 3DKPA 4AECA 4M7AD 1U28C 2X0IA 2RGCA 5FWBA 4LNHA 4RACA 5BUCA 4M4SA 3D2CA 3JQEA 4IW3B 1QP2A 3BJZA 3ZW7A 1E5TA 3JQPA 2QA4B 4P1ZA 2W2LD 3AW8A 4J43A 1LX6A 1R74A 5JFGA 3HLKA 2ECQA 4ZCSA 1FTWA 2Z1MA 2H4ZA 2K6GA 1XTIA 4N0PA 4IIDA 4L4YA 3HUUA 3BAFA 5EWJB 3ONEA 4M89A 3LYHA 1IL0A 4XE5A 1NVFA 2ZB4A 3IOEA 3KAQA 3MELA 4DBLC 4EARA 3VPDA 1GU0A 4JT4A 2J3DA 1UK8A 4EI2A 3RFUA 1MEEA 4MV9A 1ODLA 2GLXA 1XNQB 3TREA 2KVOA 1JAIA 1O94D 2VBTA 3LBAA 4YJFA 4RTKA 3NFCA 1BYIA 5KQLA 4AG5A 1VPTA 2DBRA 3A32A 1IYZA 4XARA 1N08A 2MU1A 4D46A 3EHEA 5F4ZA 3BIJA 3EB9A 1Z4LA 1Z83A 2JTFA 4RPBA 1IZ0A 2MIIA 5EEGA 1S9HA 1WEHA 2Y92A 2ZPTX 3K6JA 3T4XA 3GUHA 1VPVA 3LW7A 5F52A 4MMKA 4TN5A 5AIBA 3FNFA 2B7LA 3W06A 3EPRA 4D44A 2G4VA 4P4UA 3OLWA 1BCMA 1CJKC 3ANSA 3NI2A 3U7FB 3N8KA 4AZTA 4ZANA 2GYYA 5ISMA 4EK9A 2AFIE 2J5XA 3R6KA 2PZMA 4LGYA 2QTRA 2WFAA 2CLMB 4M7DD 2VQ6A 1JEOA 1G2OA 4AK9A 1X87A 4HNSA 2J7KA 1WMDA 2XYVA 4JJEA 1OZHA 2YASA 4TUYB 4NOYA 1WU7A 4TVKA 2W22A 4UDNA 2M02A 1AHPA 2LV8A 1UPUA 4P7JA 4IUYA 3BMNA 4CKBA 3L2ZA 5LA6B 3V4FA 5EMMA 3TZLA 3KTFA 1P73A 4K81B 4WA8A 4E32A 1RNLA 1R0YA 1GG5A 1WCV1 2DBQA 4GG1A 1B1AA 4LTNA 2P62A 2IUFA 4G84A 1S3IA 4X7PA 3OT5A 4E5MA 4H9GA 4F8JA 4PGFA 3W6OA 4QBTA 2XIJA 1D6NA 1Y0BA 2FQ1A 3B5JA 3NHZA 4OFXA 1FVHA 4LZOA 3QBVA 2JLSA 1U94A 2MK5A 4YUWA 4IWNA 5K6RA 2ZXUA 4DLLA 1FSZA 1VG1A 4PFPA 1W76A 3N7TA 3LPDA 3I9OA 4WGGA 4WUTA 4BJ6A 2EF0A 4YRGA 5JS7A 1TEHA 1DQNA 2XI4A 1LSUA 2R86A 3KT0A 1J97A 2WIAA 1BI3A 2PX8A 3CLSD 3C7DB 3LGLA 2LBPA 3U7RA 1U2GA 3F5DA 5CA0F 2OD9A 1T6BY 5EIEA 1FXSA 2FGJA 1BOOA 3SQOA 1RXCA 1TM3E 5IFLA 3EASA 4FXPA 4XX0A 4S1VA 1OXBB 2WAYA 1E9SA 5HFAA 1K6JA 1HDOA 3M1YA 4FE4A 4PJOF 1BE8A 4NCBA 2DECA 1XP5A 2GMWA 1YRQA 2PSFA 4W4TA 4ZZ2A 2DERA 4OHPA 3HM2A 4W8HA 2YV1A 4WNIA 4XOIA 1K9MD 1DBRA 1M4ZA 2R00A 2OBTA 3DFFA 2DWPA 5BRNA 3OX2A 4W9MC 1YR6A 4DREA 1V8BA 2HK8A 4LZWA 4RJTA 5JZOA 4B3HA 3F70A 1PRMC 4FHCA 2Q8QA 2RI6A 3SBEA 3FOZA 1PZNA 4IOKA 1SZDA 5K3EA 2R68A 3RC3A 4CF6A 4DZZA 1A9YA 2G72A 2X3XD 3EH1A 3MWGA 4EMTA 3Q6MA 5ENVA 4A6XA 2UYQA 2NLUA 5GAJA 4WOPA 4QQKA 4XGNA 3FSGD 1A27A 1J0CA 4F2DA 2JIDA 4HNAB 3TPZA 2V8JA 4OAQA 1ZRSA 7ABPA 2B4AA 5E7IA 1OTYA 1SXJA 1ZMOA 4JA2A 1JKMA 2NYRA 1JQQA 3HBJA 3NRJA 2IIMA 5IBRA 4K0KB 2IL1A 1GG2A 1ZCZA 3R3HA 2XOXA 3SLDA 2JFXA 4H6VA 3OOWA 1WOOA 1DAIA 3LMKA 1BXGB 4FMCB 3WDLA 1SKUA 3VKIA 3SR4A 1W5BA 1UMBB 2H59A 3MINA 5G0UA 4FWIB 3UJHA 2XA1A 3GLUA 1C1DB 4CM4B 4CT4B 3GEMA 2OHVA 1NXQA 1REQB 4CLEA 1BKSB 1Q0TA 1SXIA 5SYMA 2AJBA 4BATA 4IMRA 2GPNA 4ZEXA 1NEBA 1Z13A 1TDJA 2VJIA 4MVJP 3T0GA 3ZI7A 1OR8A 1WB6A 3PQDA 2X5KO 1N7HA 5LQAA 1PR4A 4O4HB 1P3JA 1U3DA 5KPDA 5FA8A 4DV2B 1TS9A 3OUUA 1NXXA 5C18A 4TKMA 3RTDA 1XDDA 5K0CA 1GCQA 4OF1A 1TOVA 1WB9A 3IHLA 4Z4VA 3QITA 3K0FB 1Z26A 3HVKA 4PO3X 1EVLA 4K6CA 1TO6A 4YFVA 5DCWA 3BYZA 1MMFB 2WG1A 4KBMB 2EHJA 2R5FA 2CLDX 2YSQA 3CCVQ 4N49A 4QXAA 1GCPA 1JV2B 1LBTA 2OQIA 3PPWA 4HGOA 1BXRB 2CLKB 4YJHA 4DPMA 5KTPA 2I5PO 2FN9A 5EHZA 3T3EA 4EUFA 9LDTA 5DWVA 5CYPA 3LTNC 2YWWA 1UDWA 1CHDA 2PWPA 3CH4B 3ICPA 3JVDA 4NR0A 5AHOA 1B34A 2R8RA 3OMLA 2QMHA 3DD5A 3X1YA 1ZD8A 1Z2CA 5JASA 4YREA 1ESEA 2IELA 3ISTA 4FNMA 1KZ6A 4Z7JA 3ADCA 2JLQA 1D2GA 1UMDA 3GJ3A 3QTTA 1G4AE 4EYQA 1ZK4A 1IMOA 1EX9A 1OB5A 2DNUA 2P27A 3T0FA 4P25A 1C4KA 3KQOA 2EFJA 3BXZA 4BX2A 1ONOA 3FSRA 3W6PA 2IHNA 3KDAA 1RDFA 2WSIA 2GDJA 3CCLB 3EVCA 4JNKA 5T64A 4M77C 5DM70 1AKWA 3LXMA 2VUSA 1YKGA 3EFOA 4GI3A 2FRDC 4AF8A 2VHWA 4QATA 2YRWA 4EL5A 4AF6A 3NCHA 1GTRA 3UPUA 1MUUA 4C05A 5M9OA 2KAFA 4AC9A 3DZBA 3TAHA 3O2NA 3K0SA 4QGBA 2GEUA 5JY1A 1OE0A 3HCAA 1QFZA 5LQJA 1QLYA 2I6FA 2ZYIA 2ZR7A 3E15A 4WK4B 2QRJA 3SAJA 4AY6A 1GLGA 2QVCA 1WE2A 1KEVA 3AF3A 1E20A 2O4UX 1JJVA 4NICA 1WXQA 5COQA 4BX3A 4RQTA 1YB4A 5I5GA 4G1BA 4KUHA 3WWDA 2KBTA 4B3IA 1N6KA 1YR1A 3AF1A 3D0OA 2H9AA 4UBJA 3PE6A 3EX7C 2W8BB 3ZXSA 1K73U 1RQ2A 3R7LA 2C82A 1Z9QA 5FTWA 4JRQA 2E5QA 2Q5CA 4KPUB 4EDUA 5ETJA 3DOHA 1X6OA 4ECAA 4HX5A 4G86A 2EKBA 5LJIA 4BLWA 3H1BA 3FNGA 2ZBGA 1F0PA 2V9PA 1QCNA 1VSVA 2SRCA 1QVZA 3MZ0A 5EXPA 1QRRA 3CLTC 4ND6A 4DA9A 5EJ5A 4QYSA 4B3TB 2FFRA 2Q6LA 2KM1A 4U1RA 5JNTA 3CPXA 4DXHA 2XDYA 5AVXA 3PDHA 1MQSA 2OILA 2V5VA 2YJNA 5C1OA 1UD5A 1QKKA 3HB1A 3I55A 3ZVKA 4FQ5A 2Y2UA 3QA9A 4P4GA 1GGNA 4N18A 4LFBB 4YT8A 2OBYA 1VQ9T 1I3MA 1KH3A 1M0TA 5A9RA 1JIVA 2WY2D 5K4HA 1WXUA 1KIKA 1DRJA 1N5KA 1SQSA 2I6TA 3IBFA 3PFBA 4ZYWA 9GPBA 5J59A 1E61A 3RSOA 2OPBA 1XJQA 2DPPB 4II3A 2ZCVA 3A1VA 1T5EA 1QQ5A 2G6TA 2I4TA 1RMYA 2X3WD 2I78A 3G85A 4QPZA 1R4MB 2FPMA 4C8QG 3PQ8A 4JI1B 3MVEA 3RUDA 4ZJPA 2OV1A 2D74A 5FWXB 3COVA 1UJBA 3ONYA 4KUEA 1WI7A 1KHIA 1LRKA 4EMHA 4JWKA 4XWTA 4EHNA 1Y33E 2JANA 2P9QA 3N8HA 3QF4B 4YXWD 1QRSA 2C4WA 5E2IA 3M6XA 4E2YA 3UC5A 3R0ZA 4A1OA 3SD4A 1BMFA 5BSYA 2ZYWX 1MC5A 3OTHA 4I8IA 4CGYA 4EZIA 4BBZA 1RWNA 3IA7A 3IVRA 4Q3OA 2AXNA 2YJGA 4UMFA 1EFHA 1LS6A 2ZIUB 3W5JA 5F7XA 3CD6A 5D6WA 3LO8A 1T0JB 3EBPA 2YZGA 4BFZA 1WQ7A 1RLUA 1Y0RA 2JS7A 2ZJOA 4LOLA 2PL5A 1BQ3A 1E2DA 2GF0A 4AXBA 4ZCIA 3UA6A 1E62A 3E9RA 1VQ6Q 4ZVOA 3DEAA 2IZ5A 5C8ZA 2XWBF 1KMQA 2ANBA 3R44A 2XZTA 4ZAXA 2P3MA 2AC2A 2JGJA 3L82B 2K2MA 2QRVA 2FY8A 2FPIB 1V71A 2R7MA 1SCUA 1GYPA 4J2TA 4QYIA 1R6AA 1DZ3A 5NLLA 5JS1A 1NRWA 4PCVA 2VSFA 3LH5A 2YQ5A 2ZP1A 2FK8A 3EUEA 3EGVA 4FDMA 1DBQA 4GEKA 5KH6A 1IMJA 4EA6A 1APBA 2O8BB 4Q9DA 1BCOA 1DXYA 3PUIA 4CI0B 4EYGA 5DU2A 3FPEA 1JA1A 2PLNA 3M2PA 2CH4W 4EFNA 2ZJ4A 2BRUC 5DNVA 2DAQA 3D0RA 1ACLA 1JSRA 4E33A 2L18A 3UGJA 3W1VA 1FDVA 4N12A 5JI3E 2A86A 1Q1EA 3FH0A 3CPSA 1Y0MA 2V4UA 3OZDA 2OX7A 3JYNA 2B82A 3A58B 2OV6A 1RCTE 3HCBA 4AWBA 2OTLQ 1UWVA 3LT2A 4DB2A 4J2OA 3NWEA 1PHPA 2ATCA 2ST1A 4MROA 4HH3C 2HRQA 1YQTA 1MQ8B 3QVMA 3B2EA 4CF5A 4EYOA 1SVMA 5IAKA 1GDHA 1ZMTA 3C3AA 5KOYA 4X1YB 2CSXA 4MR8A 2GN2A 3HJCA 1W5FA 1XCLA 2E6UX 3PB3A 1WSWA 3LQ1A 2BW0A 1M2VA 3ZTTA 2PVPA 3G8BA 3QO3A 2AOUB 3T9BA 3MMSA 3GLIB 3CMAQ 1T9DA 4NK5A 4LW8A 3O8DA 3VR3A 3TSZA 4OV6B 2DJIA 3IAFA 3THKA 3L2UA 3IT1A 1TZBA 2O0HA 4JP3A 5EWLA 3U4QB 2EQIA 2GEVA 3QKSA 4BLUA 2FOLA 4AZ3B 3F1LA 4JQSA 3W6NA 3DBLB 2J7PD 1JXAA 4WNAA 5E1MA 3D6TB 3UQZA 5JG7A 1EXDA 3VU3A 2O5RA 1KWGA 2RDMA 5LJ5g 1X94A 3KEMA 4BO3A 4V0SA 2J67A 3CVWA 3BWDD 5LMNB 1KEEA 2HJ9A 1UZLA 1XE3A 4O6JA 1IHOA 2PVCA 1F1BA 1NF8A 2H65A 2VC8A 1RM3A 2WUEA 1H8ED 2YVKA 3EHDA 3OKFA 4NV1A 2QD3A 3N0RA 5FOQA 3RAFC 5E4JA 5LQUA 3LVQE 1Y5LA 4TRJA 2PAAA 1JHDA 1ULZA 3EIFA 1Z22A 1Z4QA 1GP2A 2GD6A 3O91A 3JRZA 1E2PA 3MWEA 3V1YA 1E6MA 2NXNA 3DFZA 2C0TA 3ZUPA 1NGSA 4KN9S 3ZX5A 3DVAA 2VP6A 8AT1B 3V7AA 4UPDA 2ENMA 1SBIA 5CEEA 2P2GA 4IFTA 4NQZA 1D1PA 3L8ZA 2Z6BD 4CHGA 1NPYA 1VG9B 2BGUA 4FFSA 4TRMA 4BE0A 1ZJJA 5K51A 3H4TA 4DJAA 1N8RR 2QGNA 4YLGA 4X61A 3HY3A 5K8UA 1TSFA 2XWJI 3AR9A 4KL8S 4BTLA 4CQNA 3OS1A 4DR6B 4KH1B 2VP4A 5EWMB 4B8ZA 1YDGA 2GBCA 3A9VA 4Y6OA 2X9HA 3HDGA 5TVGA 3VJLA 5LP6F 4HEHA 4ZEMA 1LRLA 4DIEA 2C7PA 1NKTA 2A4MA 4P81A 3T3OA 2W7TA 2FRDA 4M88A 5JQGF 4RPDA 5F4OA 5EXSA 4LFAB 3ICEA 1JQDA 4FFOA 1J2UA 3LZ6A 1YIJA 4U7PB 5TQVA 1UK9A 3WE7A 2V0NA 4M37A 5ALXA 1Z8FA 2IV3A 3K8ZA 4CM8A 1II9A 2JFVA 2IDMA 1K5PA 2JAHA 4YO8A 4UARA 4EZBA 1ZITA 4U8HA 3O95A 3JXEA 3P9IA 5H59A 1BDMA 2CWWA 3R41A 1VDMA 2NUPA 3CCVA 2FZ5A 4JWTA 4BB9A 1WJRA 5A4DA 2ZL6A 4MVWA 1DKMA 4L4SA 4C4OA 2Z95A 4KIFA 3G1UA 3A8JA 3A1DA 3BD8A 4BV8A 4HVTA 3CIOA 4TLMB 5G02A 4NZMA 3QJGA 3ICCA 4U7JA 2VUBA 4BZPA 1LC3A 2ALJA 3ANYB 1D6MA 4OYRA 5EYPB 4Z2AA 1PR9A 3K0AA 5B57C 1W6UA 2HK7A 3SS7X 1CR4A 1FNMA 5IYPA 5FOSA 1JA0A 1X7WA 2QAIA 2X2OA 2JT4A 1V7QA 3X20B 1W85B 3TU4K 1GGFA 2DVMA 4OQXA 3G9ZA 3IOYA 5GVSA 5AOAA 2X9GA 4LJ6A 1NONA 2E89A 1U0LA 2EQAA 2HQ1A 1WHSB 2WAOA 1L1RA 2QQAA 5EIWA 2QTXA 3G7ZA 4EITA 4M76B 5BMVB 4WKPA 4BMNA 2RN8A 2WFLB 1HWYA 2RGDA 2BMFA 1D1SA 1BO6A 1IK6A 3DP9A 4P9NA 1W2HA 1A5SB 3GDWA 3KQPA 3QYJA 4JT8A 5CVUA 4C5CA 1WMSA 3EY9A 3OA0A 4EYKA 3ZE9A 3ESQA 4KRXA 1P4HA 3FCXA 3H3FA 2WWVD 3U3JA 3U37A 5KNLA 5BRAA 5LKAA 3MCZA 3E84A 3PC2A 4ZQEA 2KBFA 3HXMA 2RK3A 1XK6A 3FWZA 1OPXA 3LUPA 3L0DA 4UTVA 3RUIA 2XHZA 4B48A 4R1LA 4EJ6A 1C1HA 1U1FA 4IX1A 4YP1A 1QAMA 2JBHA 3DMGA 2RAFA 4P3PA 5JI2E 4H0NA 4U6SA 4YCJA 4WL0A 5IRCD 1BKBA 1H05A 1QHEA 2Q0XA 1H3FA 2FW6A 2PA0A 3K9CA 4L5YA 5IT9E 1A2OA 1C9DB 1VQMQ 2WQZA 4FONA 4K9DA 5IW8A 3SHTA 1XEXB 2QAZA 3I55T 2P35A 2WHPB 1FVOA 4B6JA 3S3OA 4MO2A 1YR2A 1X86B 4MMXB 1E66A 1ODJA 2AKKA 3NO4A 3K4QA 1E3EA 2OENG 1HG0A 2X8JA 3CEMA 4HCKA 3R5FA 4GBJA 4NZNA 5ESRA 5BSUA 1DVRA 1CNEA 4RF4A 2FMTA 2HBYA 4MS3B 1G0OA 4ND4A 4D8XA 3A98A 4W5RA 3OZIA 2PAFA 1U0SY 2QX6A 3NANA 5LXTB 4RY9A 5TMEA 1UE9A 1H92A 3G2PA 3FYCA 4INOA 3TGWA 1XYVA 2XQGA 1G42A 1PV1A 4C8QE 4XU3A 5CKEA 4CVNA 5KNCH 4ATOA 3OZRA 5AW2A 2D1XA 1G3YA 4PLPA 2VUUA 1X7ZA 1LS1A 1MO4A 1W4RA 3GL9A 3HY6A 3LDAA 3MINB 2GCEA 4JBIA 1YIOA 3MERA 4XSGA 4C22A 1KGDA 5I7EA 2PWZA 4AP6A 2FQQA 1P0FA 5CNJA 1MRNA 1RRFA 1UBSB 1I6LA 3USZA 4B3JA 2BTOA 5I8ZA 1Q1AA 3M56A 3AM4A 3CTAA 1WSVA 5EGNA 1Z4MA 4PJOE 4R98A 1LV7A 1UGRB 2G9UA 5EJAA 4BU1A 1XQXA 4DLNA 3EUWA 2OO5C 3VJRA 4PX9A 1L1FA 3Q11A 1Y9ZA 4GLOA 3G9UA 4I3HA 1IG3A 4DVJA 4CU5A 2FEWB 4MLPA 2VKQA 4OLFA 1XELA 3T3NA 4BLOA 1CUDA 4G5GA 1FL9A 1P4SA 3L07A 3T5CA 1JDUA 2XW6A 2GA9A 1AMOA 3DXZA 1GZSA 2PT9A 4JSRA 4I4IA 3PE0A 2IEBA 2QPAA 2BGGA 1C3VA 1WHKA 4Z4FA 1W88A 3TMAA 1QYDA 1QQJA 1K98A 1SBNE 3TRJA 2B4QA 4HDKB 1XN4A 5FAXA 3ZLJA 4QGFA 3WGKA 4CLDA 2V3VA 4NXNB 3TOXA 4TV8A 4TYYA 3G6KA 1E2JA 1Z45A 2HIAA 1PJ7A 1E3QA 2D8AA 2P8SA 1UBTS 2H5LA 3NTOA 3RVQA 5M3BA 2Z6QA 1F5SA 3HM9A 3KQVA 1VQ1A 3SVZA 4G1UC 1UGQB 2FPGB 3FDJA 4HMQA 1B0AA 3HCPA 3TL6A 4PZ0A 3HJNA 3QENA 4D3SA 5JR3A 1NMQA 4IVQA 4MH0R 5A4IS 1EX7A 1OYYA 1VQKA 3AHIA 1BPLA 2RGAA 5BYAA 4OBWA 3CBOA 3M6FA 3ZVNA 2FJ0A 2DCUA 4XMYA 2R4TA 3DPIA 3FM9A 3T95A 1K8AU 3CCET 3THYB 1DX6A 2CNWA 2R3SA 1Y3DE 3BRWD 3CFYA 4IJVA 4TZ6A 3SQDA 3BERA 1EFDN 3OKAA 1M67A 5CU7A 4LYJA 1FDUA 1LPMA 1M1YE 2D0OB 3H6GA 4QQ8A 1NQTA 2A67A 2CFCA 1XEXA 1L7RA 2Q9UA 3GT3A 3AUFA 3QWHA 5ULLA 5AVSA 3MTBA 2QDXA 1W9HA 3PT9A 2NUAA 3GFBA 4QSMA 3SSOA 2C7RA 1SZJG 1W93A 1ZW1A 2PU9B 2I65A 3F5QA 1S9DA 4UZSA 1Z8HA 5F4BA 4TXNA 1AJEA 4BY6B 3GFOA 1UGPB 2XNDD 1EB9A 2QPOA 3H9CA 4CTNA 2DCMA 1XB2A 2VPQA 1TUDA 4N3BA 4X7FA 2E65A 2M1HA 4A4GA 3I9FA 2XVZA 2GD2A 1YI2B 4Q7MB 1UJ6A 1HH4A 2BFEA 2C1ZA 4K6HA 5FQOA 3G6EB 3Q41A 4ARZA 5LYYA 3CE6A 2X8BA 3SDSA 5F9MA 3WHIA 2IDKA 3ELBA 5GMKl 1J1IA 3K1ZA 3NPMA 2DAPA 3PDJA 4Q48A 2FFAA 2I54A 2X4XA 3ZU5A 1P5FA 4OGCA 3W8RA 3T5AA 2FE4A 3WLLA 3B6IA 3J81k 1GIAA 5DXJA 1D09A 1NF2A 3PNKA 4GRAA 4OHVA 3KXLA 4ARBA 5FU7B 2FSVA 3KDSE 2DRMA 3EDYA 4BLSA 5KSPA 4FNOA 4IDOA 4E2FA 4Y2QA 1II8A 3GPIA 2QUHA 2ROTA 1CDZA 1PR0A 2AKAB 2VZEA 4IH1A 4O29A 3SEMA 3E35A 2IY7A 2ZR8A 5H7XA 4C8QA 1ZGAA 4EB6B 4GBQA 1SG5A 2ORED 4Z3OA 4LX8A 2JS2A 4PX2A 4X1OA 4ZYUA 5KTMA 3CZAA 4WZKA 4EG1A 3OQBA 2X2FA 2GR9A 3QYGB 4CMCA 3BMQB 5F21A 1UC9A 1D1CA 9ATCA 1C1AA 3GZNB 1LVKA 3F0TA 2VJDA 3K1AB 4OMDA 1XPOA 2CMHA 2ZSFA 4NS4A 4LF4B 1WD7A 4TMFA 2PBRA 3F1KA 4OFWA 1QH1B 4F46A 2N3ZA 1COWA 4M7DB 3OPVA 3QLJA 3BWYA 3D6VA 4Y7DA 1YVRA 2BUBA 3LP5A 3QLUC 4YRZA 4N03A 4HHEA 3A11A 1QS0B 1L7AA 1SC4A 1SC1A 3A1TA 1UDXA 3I37X 3RW9A 1R6XA 4E0FA 1YK1A 1I4EB 2W2PA 5A5GA 4C9BA 3NU1A 5LYJB 1DSSG 4IV0A 3E4CA 4BNMA 2QOEA 3R3XA 3F97A 3SM9A 3DWEX 3BB1A 3OCXA 1M34A 2D3LA 3BMCA 1TU0B 2EW1A 3GQBB 4UNQA 1XR3A 3RAJA 4BU0A 5JJLA 4DBHA 2IYVA 4MRSA 1SCIA 2MSDB 1OYVA 3BMOA 5B1YA 4B6PA 2IZ1A 1AH2A 3MCAA 1FP1D 2QUZA 2PSSA 2PX3A 3K96A 4G0VA 2J08A 1DDOA 4OQDA 1I4OA 4JV5B 5B4VA 1Z36A 4JK3A 3FRJA 5ILOA 4LN2A 1OHHD 5EN4A 3DVLA 1PJLA 5LQKA 2XOEA 4NMLA 4K7JA 2BE9A 4XIJA 3PE4A 4EWLA 1GNLA 3H3XA 3SHOA 5IZ4A 5AR1A 2DL3A 5IANA 5EZ6B 1JU3A 4G5SA 4E6RA 4L2IA 1SBZA 5KNDA 3MXOA 3P0FA 1K0SA 1EG2A 3LQQA 3MUEA 3RV4A 4M21A 2WHQA 3PRYA 3F2VA 3C3XA 2W2MA 3IB3A 1XKQA 2ZTVA 3KTAB 4PQRA 3SE0A 4OFBA 2EBPA 1RLQC 4KXQA 2Z2XA 2Z58A 2PYZA 1BEUB 2HL6A 1BH6A 4LXHA 1E2EA 2WLSA 4JUAA 1DFIA 4XB6B 3OYYA 3JQAA 3HN7A 2ZBUA 1M27C 3TL3A 5SICE 1HDXA 1ORWA 1WEKA 3NAMA 2H1WA 3I05A 5EUMA 4QVZA 2RJFA 3FMPB 1F8UA 3R2JA 2PVSA 4UM5A 3VTAA 3K8QA 3PQ2A 3UBMA 4NF2A 3UKOA 1XMJA 4HRYA 3NHMA 2R1TB 4YP7A 4C4SA 4L16A 4HQFA 3TLAA 1JEQB 5EWMA 3X25B 4GI5A 1WZIA 1I7PA 2QLFA 3EZYA 3R0XA 9MHTA 3ZE2B 5C8VA 5BO5A 2YY5A 3NETA 4HZGA 5DLYA 2D0NA 3RVSA 2A0WA 3LT1A 2GFAA 4Q5WA 2GSDA 2O2CA 4HRXA 1R5OA 2C5SA 2JIPA 2PS0A 3MT7A 5SY6A 4ER5A 2O52A 4FZ5A 4RFSB 2FLVA 4RYDA 2O3SA 3N2ZB 4Q3DA 2F2VA 2QYZA 4UQLA 5H82A 2P77A 3OF2A 4PR3A 4QDXA 4Q9IA 4X1KA 1V0JA 5HIMA 4DLWA 2DZCA 1NM7A 2H4WA 4E7IA 4F6RA 1B16A 4QTZA 1GAJA 1Q50A 3S5JA 1KH2A 4EVSA 2GO1A 2NVUB 5CVIA 5KI6A 1ZSZC 3W5VA 1JJ2B 2WFZA 3UJ8A 5FPHA 2WZCA 4A5SA 4MWTA 4N5LA 5LCXA 3Q9NA 2L3PA 2XA2A 4FE3A 3HXPA 4DOMA 1ZHIA 3DKMA 4ILEA 4WESA 3PIDA 3KSZO 3V6MA 4YJ2A 1KQSB 5AXCA 2C0OA 1BKDR 1ZRMA 3JQRA 2AN9A 1T13A 3UIEA 5ERYA 3ILVA 3QZUA 5TRTA 1G59A 2IU0A 3HXTA 2GTPA 4J9EA 3M1IA 3OZAA 2OORC 3G7UA 1DADA 1VRVA 2RGNC 2XITA 4BKRA 3LU1A 1KO1A 1CNFA 3ETGA 2AIRB 3QE3A 4UM7A 4BYGA 5B55A 5LJ3f 1M74A 2TMYA 1HSOA 5GAOl 4EO9A 4KSCA 3SLRA 1RRMA 4I6GA 4XGIA 1R9GA 3IUQA 4JS5A 1KK1A 1ZIXA 2OCLA 4C0DC 3GH3A 5IYWA 4QELA 5IAEA 3TN7A 3ULKA 3ZK8A 1C50A 2ILTA 4GKBA 4DLYA 4OMFB 1HT1E 1SB9A 4ER7A 3R75A 3GG9A 1N2OA 4RTNA 3ORSA 2LZJA 2R65A 4AWAA 3NMUF 2XCUA 2F1RA 2OBLA 3P9QA 4JDSA 1V3VA 2ZRLA 3MCWA 1JHXA 3RFXA 3TQRA 1H1LB 2DM1A 3GMIA 1GZ4A 3G2NA 3P9SA 2PLWA 3ENNA 4JYBA 1T1IA 4X8HA 4AROA 1IZ6A 4P2GA 4CMAA 2CP2A 2P90A 2I9KA 4B7UA 2KY9A 3C3CA 3QPUA 2WBLC 4P38A 4R5HA 1KJQA 3JQ7A 4K03A 1KTIA 3H5AA 5HKLA 3U3MA 3CMEB 2WSCE 4KQ6A 4QVAA 3AFNA 1ICEA 3R23A 4NS1A 1UQRA 1N8SA 4E47A 2OZKA 3JU3A 1VC2A 2RHHA 4GEGA 4DJDC 4QHTA 3IPRA 4U2CA 2BE7D 1QCZA 2M9MA 2RHLA 3DV0A 4RG2A 3GVHA 4IRUB 4QBIA 3T5MA 3KXTA 3FZGA 1ZVVA 4XPIA 1OIWA 3HS3A 1RZVA 3D8BA 2ZYRA 4MS4B 4PFJA 1IONA 3G2QA 3QGMA 1D5WA 2BISA 1B41A 2YXEA 3LTEA 5FADA 1UBJS 2FEPA 3HXLA 3NOQA 2M9UA 4Y9DA 4Y8VA 2LDXA 4YMTA 3KQNA 2P4EA 2HHAA 1M3BA 5LZ4A 2MMGA 4E4TA 3QYFA 2W2QA 2OGUA 1KIAA 1KVSA 3WHLA 2ZRGA 1Z28A 3HVRA 1A8SA 5I5EA 1QIIA 1WM1A 1U0FA 3CXCS 3Q0TA 4O2BF 5DSZA 4B5KA 2QJFA 1RAAA 5AVWA 4QL3A 2QA4Q 4MDEA 5KKNB 4V0ME 2DF6A 3LOPA 1DRKA 5E6TA 2EQ5A 3I8SA 3NBQA 4MTLA 4ZHQF 1LI4A 1YJNA 3TBFA 3REFA 2EG5A 1F7VA 3VVBA 4O5AA 4UATA 2ZJ1A 1VMAA 2V4ZA 3JCMg 4HGRA 3QA3E 3KL9A 2KLBA 3UV3A 3QXCA 2W6ZA 1QG2A 4R40A 4KQ9A 1CQIB 1PL8A 1J0EA 1O7JA 1L5MA 2ODPA 2PWYA 2ZJYA 1YDFA 4P34A 3REQA 1K7EB 3K8OE 1JMVA 1N75A 1G9XA 1P4AA 1E32A 1QV6A 1IRXA 3OIDA 5CKBA 2P9TA 3DMRA 5BSRA 3PD0A 4E30A 2ACWA 2D1TA 4B46A 4XGRA 1A97A 1QANA 3Q7QA 3EIWA 2UAGA 4QNNA 3NEAA 1LCIA 3QE2A 5C0OE 1LBEA 4UHEA 2VCEA 3RQIA 3V1UA 4B4OA 2D2IA 3D7SB 3HYCA 2WT9A 4RKFA 1KQOA 5EE9A 1WKCA 3PC4A 3T38A 1B8PA 3ZHRA 4EHKA 2F1LA 4H4DA 2ZRIA 5BSGA 1Q21A 1K76A 3OIUA 1V76A 2G06A 4PZAA 5LB2A 4BNUA 1J99A 1UJ0A 3FOFC 2V8KA 1XZ8A 2YVLA 1T4MA 1FW8A 2W6JD 1PE0A 1E2NA 2Q9CA 2ZAYA 4NU8X 4QARA 2EKOA 1OAOC 5ESXA 5ADUS 1OULA 5AM0A 1YB6A 3E22A 4M75C 3FSJX 1FYVA 1N0IA 3NHKA 3WMXA 4JY7A 3W2TA 2AB0A 2ZTUA 1GGJA 3GGGA 3LUHA 4KFSA 4LHYA 3SX0A 2WWRA 3ITNA 5KNCD 2CWDA 1YRLA 2YH2A 2I2DA 1WCXA 1E99A 2GF2A 4HLQB 2WE8A 4XNFA 1KZ7B 1Z62A 2O0MA 4Y0VA 4A73A 1U7PA 2P1ZA 3CXRA 3DUWA 5DN9A 1KU0A 3CLVA 3QG1A 2HIGA 1I7DA 4MJXA 3CC2A 2JH3A 3D8TA 2E6NA 1SWWA 4LMPA 1BI1A 1F0KA 1K7XB 2CEKA 4UHHA 3R9XB 4ZO4A 5AJHA 1NJSA 1S4QA 4Q03A 2HNIA 3OHMA 4EKYA 4A82A 2HM7A 3GXBA 3NEYA 4MPJA 1U0NA 4R2XA 2EYWA 5J5AA 5D7UA 1FNNA 4I4TF 3ZWMA 3NH9A 2WSYB 4DA6A 1GY8A 4J8PA 3OE7A 1FMVA 4HJXA 2ZGVA 4IKFA 4RHCA 5CCXA 1LRJA 1PHTA 2ET6A 3D7KA 4TSKA 3JTEA 5CKFA 3QUIA 3C24A 4C7XA 5L8RE 3L0PA 1IVYA 4FZVA 5CDSA 4EHBA 5TS2A 1G66A 3JQQA 1X9GA 3OQPA 4QQ6A 4UEOA 4EAQA 3HJFA 1Z2EA 3PRHA 3HO1A 3B3QA 1QVFS 1IN4A 1X1EA 2PNIA 1C3JA 2LCQA 2BEVB 4D81A 4KQKA 5EJIA 5LA6A 4DCCA 2BYTA 3AHGA 3CC4Q 1W30A 3BWBA 1CJBA 3CG0A 3MTGA 2EBWA 3P97A 3U23A 1YJNB 1CERA 1HXHA 1L4KA 4IJ5A 5EIOA 2CT8A 9ABPA 1ZHHA 4OX9B 1GZUA 1C9JA 3VR6A 1R15A 2QSZA 2RG7A 4N5HX 4X95A 5L7TA 3QNUA 5CAIA 2W6PA 4Q7JB 2WWXA 3O03A 4M77A 4MUHA 1RHQA 3OZXA 3AHCA 3TINA 4HVLA 2HSEB 2Z09A 4JJZA 5KNBH 1ZA1A 2PZ1A 4WACA 4E5PA 5CB0A 4LNPA 2PEZA 2ROQA 3OVMA 1GPMA 3H5IA 3LX5A 4W5QA 4LE9A 2XX3A 3OUZA 521PA 4R9UC 1L5QA 1G5RA 2ZPIB 2D7CA 3LW8A 1Y8QA 1ZH8A 4AM8A 4S1PA 4DT1B 4RZ2A 2EJCA 5L8VA 2KRSA 1VKJA 2BWJA 3U2QA 4UVDA 2K5IA 1N2XA 2LQWA 2ZS7A 5EIXA 1VLVA 1OB0A 1W75A 3CSDA 1QFJA 3O8QA 3OJOA 4HLNA 4RPHA 1WD5A 3TOZA 4EY6A 3RSZA 4HVCA 4HY3A 5BWMA 2QTLA 4NHEA 2O07A 2Y2VA 2PTKA 4J7CA 2FOXA 4Q1DA 1JJ2P 1OFGA 1I0IA 1YS7A 2WDPA 3PVZA 1TZCA 5EVJA 4E1VA 4X6YA 5TQ0A 1M2FA 1YFJA 1AF4A 1CRZA 2MSWA 1UPBA 2PXCA 3ABZA 3EDCA 1GNQA 2WUFA 3KU1A 3FLMA 4TM8A 3WLJA 4HDSA 3H84A 1JEEA 3ORQA 4F9TA 1XXLA 3KTOA 3O4VA 4I4TB 4JLVA 1NW6A 5JH7B 3QBEA 1Y5NA 1O58A 2YW2A 3B2QA 2KHZA 3HFSA 1MQ9A 3NAZA 1Z5NA 2VI5A 1AZEA 3PFKA 3L2RA 2OOKA 1TZJA 1U9ZA 3N75A 5AKJA 3WQHA 2HYDA 4TTPA 4BX9A 8ABPA 4FEYA 3Q0EA 1Z8DA 4R05A 4QBHA 1Y8RB 2QPLA 3STUA 1HPLA 2HZBA 4ESEA 2F4VB 1PFQA 1R66A 2QZ9A 1CUXA 1KWKA 5EQJB 2JVVA 1L5ZA 5T8KC 4FT2A 1F8XA 5G40A 3QXEB 1XZGA 4KX5A 1AE1A 2GB4A 4G67A 2VK8A 4FYVA 2RK1A 1BYUA 1WVMA 1YOVB 2XBUA 3T54A 3JSCA 3OOCA 2VWPA 2G82A 1BFUA 2X0FA 1SBHA 1T3GA 4QVGA 4AMVA 1GTJ1 1I13A 1NMSA 2CXNA 3CT6A 3GJTA 2AZXA 4A27A 1E1LA 4I1OA 1EFRA 1C29B 2AEEA 3IBYA 4B87A 1WMBA 2CXOA 4DIOA 1WMAA 3QX8A 4PABA 1EJBA 3TW4A 4L8WB 3WI7A 3EDQA 2HCTA 3KYDB 5K8VA 3D8NA 2YUQA 1IXKA 1L9XA 2GZ2A 3WNDA 1AKVA 2QA5A 2PR2A 1QHSA 3C15C 1KHHA 3GLQA 5L3RA 4AY3A 2DPYA 3TRDA 3JWIA 4DF3A 4Y18A 4DG5A 1W6RA 1QE3A 5ED0A 4LXXA 1CS0A 3GRVA 4MPTA 4PJLA 4GPIB 3KZ1E 2JRCA 4KMSA 3RE1A 3DNFA 1XZFA 4FZRA 5FUXA 5AVQA 2WPNA 2C2GA 2ZI6A 3VOSA 1XTUA 4R1TA 3NB0A 4UCQA 4UFNA 1JZTA 1MP0A 2ONYA 3RBXA 2JLXA 2VWHA 5K7SA 4ZHQB 1M76A 2LGJA 1CKEA 3CKMA 3E3OA 4OAPA 3K09C 2Z6VA 1HE8B 7YASA 1NW7A 1Y0YA 3R3SA 2EJ9A 3KUDA 2VV5A 2E18A 1G64A 2QD2A 4LRUA 4E7SA 2Q3JA 4O2BB 5DNAA 5JLAA 1LBQA 3V9PA 3ZY3A 4CG1A 1GV1A 4ZVTA 1YWGO 3P2YA 3P9CA 4CTKA 1TKBA 1F2VA 3SVLA 3ADKA 4ALKA 1NVDA 3QVWA 3F4LA 5THKA 4BP8A 3EVGA 1RWPA 3E9NA 1YN8A 3AUUA 1JJIA 4FCTA 2PUOB 3JB9G 1IY8A 1ULUA 3VYUB 4CQLB 4F86A 5GIOE 1HL3A 4ABYA 3M6LA 1E6LA 5CCEA 4PWYA 5C53B 2LCLA 5EFZA 4D4LA 5A2QA 3DPSA 1NV9A 1QKJA 3GT4A 4EENA 1ISRA 1W9XA 1JHUA 3B9BA 1FFCA 3DE4X 3KJGA 1YL6A 5EIHA 2LX7A 2VYTA 3BCHA 2R96A 2WINI 4PW0A 4BEVA 3L2QA 2IP4A 3KWJA 3FPHA 3LM8A 3MN1A 3FYDA 4ND2A 4O1IA 5E6RB 1TEVA 4RUKA 1YVDA 3TIFA 5J5VA 1X7YA 4M0CA 1YITB 1QCOA 1HYGA 1TM4E 3G1WA 4U7GA 4E7ZA 3SI7A 1NG9A 2XODA 2Z2ZA 4U7HA 3QKUA 2CUKA 1NUAA 4R2KA 3EXHB 3OPYB 3PV0A 2CMGA 1HK9A 1QMCA 3U1BA 3D1VA 3W2GA 4R7TA 3UWNA 2BCGY 3KQMA 2J5BA 1K6XA 1H9CA 3NJ8A 1O9BA 1PT5A 4KR7A 3JALB 5HQ3A 2P0YA 3SQLA 2O3RA 1ZVKA 2PH7A 2WIBA 2WU1A 4QTUB 5FYDA 1AK2A 1IQ0A 1LGYA 1HQKA 5D1NA 2NU7B 2UVPA 1A2BA 2NO9A 1I4K1 4WBNA 1NU6A 3DQQA 2H31A 2FN3A 4LF7B 2E70A 2LRQA 3QIAA 4P84A 4URZR 3A9TA 3BG5A 3UJDA 3WVEB 1GU1A 4ALMA 2XKAA 4ZI7F 4OHYA 4OJKA 2DMRA 3OSSC 1P2VA 3H99A 3T1OA 3CXCB 3VOAA 3CPWB 2ARKA 1W5EA 1DDGA 1VI5A 1VJTA 3K1AA 4XFJA 4QRDA 3WIOA 1U9IA 4WZBB 2GFQA 2HKNA 1EZZA 3KV1A 2A88A 3QHQA 1G5PA 1RXUA 4IFIA 1E3LA 4JJGA 4DLXA 4X8IA 2D5CA 2WJ6A 3C1AA 3JR7A 5EHQA 3WGNA 4GMKA 4CLRB 3FWKA 4TKVA 1FRVA 4PHFA 5FHRA 1P1HA 4PCUA 1YB2A 4JB3A 2P6OA 3AM5A 4TZKA 5CVEA 4X62B 1Z6QA 2L8DA 3NKVA 6ADHA 3ZGYA 4O3MA 4RPKA 4BX0A 3AVUA 2JJ2D 1SH7A 4D57A 3M3PA 4V0QA 2EZTA 1Z39A 5B3LA 5TPWB 4KGZB 3CCSB 3AR7A 1HYOA 3EBLA 5JSKA 4QFDA 1SHUX 1GZ5A 3H75A 3PT5A 5KDOA 2AHJB 1FVXA 1SUCA 5HUHA 2F8LA 3RUHA 2OM6A 3B1YA 1QPZA 2CCGA 1OLXB 2A08A 2TRSB 2QJWA 4DRYA 3CC2Q 2VJOA 3LLSA 3MCTA 4JCOA 4XB1A 2F9LA 1OUMA 3LF1A 3CUEF 1A0NB 5DHUA 1KI2A 1XLVA 1RI9A 4FYKA 2OHHA 5FA5A 5JDCC 2DLNA 4EBFA 2GZHA 1M7HA 3D8RA 2OYRA 4DNTB 1P2SA 3BTSA 1XI2A 4WD3A 4ED9A 2C5HA 1O0SA 2KB0A 2YVQA 3F6EX 1PDWA 1TTQB 2HEGA 3MYRA 4QUHA 3SE7A 1YDEA 2DFDA 5F23A 3ZDBA 3PIOA 2F1JA 4DJFC 2AEFA 2YHSA 1PKSA 3DZJA 4FR0A 4M60A 1A7KA 2PNFA 1OH8A 2RARA 3DBVO 3MCVA 3O3NB 1VHOA 1R6VA 1F6WA 1E3IA 3NBMA 3ND5A 4KAAA 4RF5A 4TQ9A 4TX1A 7MDHA 4MUNA 1IN6A 2ABWA 3EXAA 1XMIA 1P5ZB 2WV7A 4DQLA 4F16A 3CV3A 1A8QA 2BP7B 4XU1A 2L69A 4JELA 4OHOA 3KXPA 3DJYA 2H5JA 4UE3S 1ZM9A 1TM7E 4R8SA 2OPHA 2R6DA 2HDNB 1PJ8A 1PFWA 1IE3A 3LA6A 1JT2A 4M75G 1CZUA 1U8XX 2Q3FA 5E2BA 5GY7A 3BILA 3HADA 4JI0B 2DQ4A 4ZV7A 3HK2A 3V8EA 5F4MA 4AG1C 3MAAC 1L2TA 2FUNB 4FILA 2ZVQX 1YBYA 2WP8J 2ZI9A 1EUZA 1KFEB 2A5YB 2JHPA 4X93A 4ENVA 3VO9A 1LW6E 4UDYX 4LXUA 1ZSZA 3EG9A 3P26A 3D64A 4FI3C 4IRMA 3RSLA 5H9WA 3WKAA 1QH1A 2GO7A 3I4LA 5EZ5A 2D62A 4ZD6A 3D6JA 4N82A 5ALQA 1Y63A 3JVIA 4DADA 5IWAB 2V0CA 3I2YX 4N0AA 2IHTA 3CRW1 2W2KB 5TGDA 7REQA 3TRFA 2C4UA 3TD6A 2ZYUX 4LOIA 5FHQA 1ESMA 4QFBA 2QN2A 4BTVA 2TMKA 2IOHA 2JVJA 2HQBA 3FCSB 1C6VX 1J07A 3GFPA 2G07A 2YRFA 3SLKA 4RV9A 4MRRA 1EFPA 1M6NA 2HJVA 2IZ0A 4K9KA 2I55A 3R7NA 2YR0A 3L79A 3GRCA 3ZZMA 2P6NA 4AMZA 1TCVA 3U0BA 3CW9A 5I7VA 3UPDA 3P27A 5TIIA 4D4MA 3PGXA 3FHJA 3U40A 4GM1A 3KZMA 3CCUQ 1RD4A 1YRAA 3MEAA 1YZKA 4NV3A 1OFIA 1T3HA 2IA5A 3WIUA 4CPDA 1KFJB 3PYMA 3BHIA 3QI7A 2L89A 3WO1A 1FTGA 5LJ3d 4R4JA 7GPBA 3MJ4A 4MZDA 5A7GA 3ZBPA 2Q4EA 1SBQA 3H0FA 3PTLA 1IK4A 3CCRA 1O94C 3AUKA 3BTVA 3RAEC 2PWBA 3DE0X 2E9SA 5AOCA 2WACA 3QPDA 4HT9A 4D02A 4LRWA 4OHXA 2AWOA 2VPYA 3BC9A 1HOXA 2QLMA 1Z4PX 4FBGA 1M2GA 1KMHB 1JTFA 2FX3A 4BHTA 3QX3A 4CMKA 1YI2A 5KVVA 4PJOD 4OP3A 3W5CA 1WTCA 2V1XA 1RQRA 4PPYA 3VTKA 5IVPA 1K0XA 4GR5A 4JI5B 4F5ZA 2W83A 2J31A 4B35A 2QI9C 2ABLA 4NNJA 4N8EA 3ZI0A 1MLDA 4B85A 3UHAA 5IG2A 1S6YA 2BBTA 4HQ6A 4HWTA 1MFZA 3RVNA 5KQSA 1JDVA 3T3MB 2QXUA 3AEUB 1ATIA 2TYSB 3PD7A 4WN9B 5MF6A 5BN5B 3IUSA 2DLPA 1QOZA 2O1SA 1WXFA 3ZL7C 3ME5A 2XKKA 4QQGA 1XMQB 4DB4A 4J9BA 2CB0A 2PCLA 3K0KA 4I1UA 4ZKEA 5KMGB 2O1EA 2V8BA 3TR6A 1HD3A 2DGDA 4DDUA 4ARAA 1PWXA 1QOPB 1V0EA 4MEAA 4NBTA 4IIUA 2WQ6A 1E1DA 4INJA 3F6PA 2JIZD 2WYOA 5I2SA 4WASA 1LOJA 1LLDA 4J76A 1IN8A 1YJWB 1UDBA 1PKXA 4BZXA 1SIBE 3D54D 4O0LA 3BQNB 3T3IA 2D0PB 3Q7EA 5BVGA 4LDPA 1FP2A 2FP4A 4RYLA 4M75A 2I6QA 3WNBA 1KQPA 3QPBA 4BFXA 3AOEA 3KFXA 3O84A 5CYFA 5E6SA 4JYAB 1Z0AA 3LGXA 4OA5A 5A0FA 1VQ8T 1AQJA 1VQ4B 1ST3A 3AR2A 3K30A 4RKQA 4NFLA 4BNLA 1WTHD 4KPFC 3BAZA 5LUAA 1E60A 1C7JA 1HF3A 4FHGA 1NE2A 5FFNA 1QLWA 3DL4A 1CRWG 3M4XA 3MF4A 4NAVA 3ZIAD 2FB7A 2AOXA 2CEAA 4DYHA 1ZJYA 2FLWA 4UUPA 2JM9A 1T36A 1YJ8A 4DUYB 3UHJA 3GLTA 5DRTA 3QSYA 5KZMB 4TSFA 1T5DX 2II6A 1HE2A 1XZMA 2PBFA 1SD2A 3D7SA 4FDLA 3ZNOA 4JGIA 3ITKA 4BRWA 5CDTA 5D3MB 5IXJA 3DF9A 1EVJA 4EHHA 1RI5A 1BD3A 2J5KA 4JLJA 4B4VA 1DIOB 2EDCA 3ABIA 3CRQA 3RGWS 3SWNA 2O3QA 1UL1X 2VK1A 3HFRA 4I4LA 4AZVA 1JG6A 1I01A 2OBRA 1XHLA 2EJGA 3LWIA 2OHIA 3FXAA 3GA7A 1MMDA 1J39A 3GNSA 4N0AC 3H13A 4X7BA 1I8DA 5KAMA 2J59A 4AF7A 5D51S 1Q1ZA 5TQ2A 3USCS 1OYWA 1TM1E 4KU4A 2CL0X 5EE0A 2DX7A 3DQPA 4K26A 3WL4A 1IXDA 1K3FA 1ZBQA 2CNOA 2IK8A 2I6UA 2CNDA 3GWGA 4UOQA 3VBEA 1BGWA 3NRCA 2I80A 3ZE0B 1BDIA 3MP8A 2ID4A 1F1JA 2ECKA 1U4SA 2MT9A 4C3UA 1QGED 3VU3C 2PUDA 2CRVA 2JKYA 4QOGA 1L4FA 3IUYA 4Z9BA 2YUIA 2DWCA 2X3UA 2JEOA 2V65A 2I29A 2P0KA 1CE8A 3CJTA 4ZRNA 5HUQA 1WXWA 3N2LA 3INRA 4JJ7A 1VSUA 4R51A 1M2EA 5LXTF 3TM4A 2LD4A 1PT9A 3IA2A 5ALLA 4RVUA 5E9AA 4MGZR 4BMPB 1NYQA 2Z2KA 3RUXA 3NUZA 1N2CB 4IRXA 4BUGA 1R1DA 2QTWB 1FEZA 3EEBA 3W90A 3VR4A 4LE0A 4D26A 5J23A 3P96A 4NP6A 2BHSA 4DR7B 2B21A 3RR2A 1D2CA 5F73A 3FTFA 2EGCA 2ZS9A 3DDWA 1L7XA 2EGAA 2VDKB 1C3LA 2ZUUA 3THRA 1X2KA 2GCIA 3EW9A 1M73E 1ARKA 4DLUA 4J49A 2VSXA 4RTRA 3AV0B 1RACA 1YC5A 1SBCA 1J23A 3DDOA 3OZSA 4NZYA 3S4YA 2RGGA 1S3GA 1VE3A 3HAGA 3MHPA 5CLIA 4AJ2A 1CY4A 4QT7A 2KMLA 5FI5A 1GQ2A 5D84A 5BV2P 2P40A 2H8KA 3BH0A 4K9RA 5BMVA 3H9JA 4NTZA 3GFTA 4F9EA 3AXSA 3C2QA 5HS6A 4Y91A 3KXIA 2IPAB 4X7RA 3AL2A 5KAPA 4B71A 1JR2A 3PFGA 5TPWA 4LDYA 1RAGA 2ZKLA 4A2QA 1GA4A 3E9YA 3FAZA 5LVAA 4S1TA 4P82A 1HMPA 3UB3A 1VQPT 1OH5A 4RTPA 2AZVA 2H6EA 1QGDA 4BIMA 4RK6A 5FUVA 2CL5A 3NIWA 4NBWA 4JUVA 3KOMA 5CAEA 2VHQA 1WIWA 3FUCA 3R6TA 3KPJA 3D0KA 3TZ6A 4IO1A 2OM2A 2B20A 2BFWA 3GLSA 2KNBB 3FN4A 3O47A 3HSBA 1VQNA 1ZESA 4UMEA 3WNVA 5KU7A 2ZRKA 2FCRA 3BE5A 3VSDA 4UEJA 3NBXX 4NEQA 2A57A 5HCUA 2APJA 4LJRA 1DP4A 2ZUVA 2ZPHB 1DINA 3C8ZA 3HYTA 1I1NA 5BPHA 4WBNB 2XUHA 1G5VA 5A6SB 4DV6B 3EG0A 1CW2B 2PKQP 2ZK7A 3DZFA 3GJ5A 3H2ZA 4PTZA 4YBZA 5HIKA 1VFNA 3BGSA 5B7QA 4KDCA 5F9FA 4M77E 2ZSIA 4FCCA 3HV0A 4D4KA 3IEXA 3PPVA 3TB6A 4ZCMA 3LKVA 4R56A 6GPBA 2B98A 5JAOA 1UD8A 2YN0A 2A35A 3TJZA 4DGSA 3MPUB 1E6UA 5CAEB 1GRRA 4L76A 3IOBA 2XCIA 5CYOA 1NJIC 2VF7A 4BB5A 3QWAA 5FEMA 3N28A 3NOXA 1RPZA 3AYXB 4ZXFA 1NVGA 2VYVD 1YT5A 5GAOn 2Z0MA 4ZI3A 1Z08A 3PC8C 1BE0A 5DZSA 4Z7OB 4CF7A 5HM6A 2GUGA 3CCVT 4AI6A 5LR6A 2NZXA 4XH9B 5K3AA 3A14A 1B6TA 2P3SA 3IEIA 3ZWBA 4G5OA 1AS3A 1DRWA 1U2ZA 2PANA 3B12A 2AJ8A 4AD8A 4RCBA 1JBMA 2YLBA 1QVGA 4BDZA 2QX8A 3EK2A 1BZYA 3FZEA 3W1WA 5KWVA 2UYHA 3LNTA 1RPAA 1TJYA 2J6OA 2FPLA 3CWQA 1SIWA 3PWSA 3HCNA 1TM2A 1NWHA 4V02A 3A5ZB 4A4FA 3ZCTA 2ZJAA 4MRPA 2DIEA 1WXHA 5IASA 1LNSA 3Q3VA 1HXDA 4LZPA 5KOJA 4IZ6A 3TVDA 4C30A 2VKTA 4LISA 1GAWA 3IQEA 5FBLB 5IJ9B 5AVYA 2NZUG 1CJVC 4TTJA 1KRXA 1J7KA 2VJKA 3G1TA 3R6GA 4QUZA 1YX2A 2PN1A 3K0BA 4IIGA 1XQ6A 1OOTA 4BE2A 3KHKA 2Q3BA 3MSCA 1ZD3A 1LNQA 3DV2A 2V7UA 2HNAA 3I72A 1TH7A 2C97A 1QWFA 1NXOA 1R4MA 3RSCA 2JDID 1PFKA 3KJIA 3W34A 2A0KA 5BWCA 3ZD7A 2YDYA 4NEHB 4G0UA 2A9OA 1L0BA 1G5FA 3E9DA 1GFZA 2JRLA 3DZIA 4BMZA 2GM9A 4GI1A 4RKYA 5KHLB 4E7OA 4JASB 1S72A 4LVOA 4FW1A 2C0IA 1YA8A 2ESRA 4BI3A 1Y7XA 1BDJA 1S3SA 2W2OA 4HX2A 2EBUA 4MITA 4UDXX 2HD0A 3CCRQ 2F4NA 2GN9A 2ATCB 1Q7YU 1E2QA 2IOFA 2NO6A 2WKPA 3P2EA 4M7PA 4PYNA 2OAWA 1J70A 4OQMA 1TU0A 2GK6A 4UTOA 3WL7A 1VBFA 2OC4A 2QLJA 2AH5A 3HHPA 5EG5A 2EYQA 3MO8A 1WP6A 3TW8B 4DTCA 4MGYR 4OK5A 3ZCXA 3IJEB 5T3UA 3E5NA 4MDWA 1QMPA 1ZW6A 3R7AA 1AUOA 1T9ZA 5AW1A 2O54A 1Z25A 2X23A 3OBWA 5GANd 3CVYA 3S29A 1XJWB 3EA0A 1UHCA 4TWBA 4CGZA 1M66A 3BK2A 3NHYA 4KJZA 4AMYA 1OX9A 3WXMA 5AJTA 5FBZA 1SHZA 2W98A 1AS0A 1NMXA 4FYHA 4HUTA 1ZKMA 1W1UA 4XTZA 2RI1A 4JLPA 5IJ0A 2VDWA 1BJTA 2W6QA 4ND5A 4CKEA 3QDRB 2P6UA 2QXTA 3AC0A 4IIFA 3H86A 4JLBA 3JD4A 4HH4A 4ODIA 4OQYA 5IDYA 3N8IA 2QS9A 2BH2A 4BNVA 3N5CA 5HK8A 3W8DA 3TTYA 1A96A 2IXAA 2O3UA 3P9XA 4LHVA 3EXFB 4OGEA 5JROA 3GLFA 4BRSA 3HDJA 2A0FA 2JMCA 2WA1A 4JS4A 4TRNA 4WPGA 5ECGC 4ZT2A 2NSDA 3RVBA 2ZU0C 2N46A 3VU8A 1EINA 1VLMA 1XZAA 3KD2A 3AQIA 1JR6A 1E7MA 3KKQA 2SKDA 2OJ2A 5LJ5e 3JSAA 4W7IA 1D8TA 4GHWA 2X7HA 2JK0A 3OM0A 4GQNA 1Z17A 4OK3A 1WX1A 1BIFA 3KZKA 4H4CA 3CCLA 3GSIA 3PI6A 4PRKA 3ET5A 3GIWA 1PRYA 1N3LA 2B36A 4C0ZA 1J06A 1UIMA 3JQGB 1TCUA 3U4GA 2O2SA 4R68A 2L82A 1R5BA 4RZXA 5DHRA 4O2LA 3L1VA 4D56A 3WJAA 3PDIA 3F2IA 3TSWA 3LUFA 2TMDA 1O0CA 2BM1A 4M38A 3G0GA 3GJ8A 5ALRA 1FXUA 1ZNXA 2J0UB 2V45A 4PAMA 3HPQA 3U09A 4H6PA 3JQAD 4UXJA 2YYSA 3S28A 2CKMA 5FRNA 1F8YA 5ALWA 5DK4A 2EDAA 1IEXA 1FBTA 4TVBA 1UFVA 4DRXB 3GH1A 3V55A 4LDZA 2H52A 4P0QB 5DM0A 4LQLA 4ZPJA 1UJMA 3YASA 4PM4A 1ITZA 5DLDA 1QQ7A 2RONA 1FXWF 1OZ0A 1CR1A 3ZIAA 1WLSA 1NR5A 2VSQA 1P19A 3C39A 4HDCA 4DILA 3FYSA 1SXJC 1OXUA 2B99A 4FZ3A 4V2UA 5ALJA 5LYJF 6NULA 5ER6A 1R37A 1WHTA 1BW9B 2JD2A 1ISIA 4YS6A 1P7WA 5AJUA 2NV4A 4M83A 1KMHA 3N9IA 4EF5A 4DJTA 3W04A 1P91A 3NBAA 5L3SB 2PNJA 2NTVA 1ABOA 3FB9A 3MS7A 2JC3A 4V39A 3RRYA 4EFDA 2P4RA 1H0SA 5KDDA 5FU6B 3BCFA 1NVWQ 1Q2UA 1T8TA 4GGOA 4Z4QA 1ORRA 3DEHA 4ZDWA 2H17A 4EHJA 2GCPA 2D2EA 4EGAA 2QRUA 2GJRA 3UY4A 2VHJA 1ORIA 1J0DA 1TZKA 4HNQA 4P5PA 1KK0A 3F7NA 2B1QA 3OJWA 1QWOA 2MSNA 1PSWA 1VLYA 1M1YA 4MGKR 2B7BA 3GRYA 1Y4ZA 2BSXA 5JRDS 1U8AA 4KXXA 4PTLA 4IJQA 2JI4A 2ATXA 2VUTA 2QQBA 5ECWA 4H27A 4YRLA 4N40A 1SC6A 2ZZKA 5EE1A 2MJLA 3RFTA 1LJUA 4CM8B 1R0LA 1JH8A 1PIWA 4LYYA 1E58A 1H2HA 4PZYA 4IVRA 2ECZA 3Q2IA 5KWEA 2N1BA 5LP1A 2P9BA 2XXBA 3UJNA 3THXA 2BZYA 2WU0A 1VE1A 3META 1QO9A 3LHKA 5KBYA 1WHGA 1SHTX 3K1TA 4DR2B 3BSSA 4OP0A 3DLMA 4O8CA 5TMDA 1EUYA 2RE8A 1VE6A 3N2GA 4D0RA 5LZ2A 3OMCA 2HFJA 2I1VB 4G9EA 4H1UA 3V3KA 4EY7A 3VS6A 1LDGA 4L0DA 4Z02A 5SZJA 4M1TA 5DDIP 1SCQA 3DCIA 4JJFA 4K46A 5GM2A 1GCQC 3ZHZA 3T94A 2QZ4A 1X8XA 2BC9A 2YZ2A 3K2BA 3N6XA 4IR7A 1L7BA 1M7GA 3JASB 4RL4A 1U3GA 4ZVRA 2VJPA 3UTDA 2VJQA 4EJ0A 5B3KA 3ST7A 4HB3A 1UKEA 3G23A 3CC4B 4QU5A 3JQ6A 1CYDA 2YUTA 4CN9A 2Y1DA 3D43A 3RM3A 3IPLA 2JS0A 3U1VA 1HNZB 3ZDAA 2LIVA 1BX1A 3EULA 4HDRB 3FTEA 2Y27A 2WNSA 3G8AA 1NYTA 1ZLYA 3TLZA 5GV7A 1Q1BA 2GPTA 3DF7A 4I5DA 4JEUA 4MAMA 2F3PA 2C5FA 1KO7A 1N32B 1J8VA 4E13A 5CFQA 5PGMA 2P0PA 1I9CA 3D3JA 3GEHA 4FLMA 4EIWA 3FFBA 4X1VA 2VUIB 1NQOA 3O38A 3P94A 3Q7SA 1TLLA 3BULA 3AILA 5CK4A 2YUOA 3WYDA 3OM9A 1MB4A 5AICA 4K1LA 3UFXB 4RD1A 2NN3C 3HRTA 1XTPA 1DV1A 4C87A 3TEEA 3G8CA 1BNCA 1EAMA 3F71A 3GV0A 4H7PA 4WH0A 5F7ZA 5FLEX 5FTJA 4E94A 5C5IA 4C2TA 3C4SA 5C3MA 3ADOA 3W9YA 2F43A 1G2QA 1TT5B 1TAHA 4M0UA 3PNQA 1I1JA 5LJ5f 2GAFA 1FTNA 1NE8A 1UR5A 3CMAB 1F0YA 1K8QA 3QIVA 1H23A 4XQ9A 2I2CA 2R8BA 1BG6A 3O8BA 3T15A 4O4HF 3I9QA 1MD9A 4N6NA 2QQRA 3MB8A 4P4TA 4JBWA 3VS2A 3P20A 1GL5A 2QL7A 3T7AA 3T5GA 3U81A 3A8MB 4DQXA 1SCNE 4CR7A 5ARBA 2K7ZA 2UZ4A 3NWPA 3IEVA 3FJ5A 5KNDD 1TCCA 2OLKA 4LI0A 4QOIA 4EF4A 3HKEA 4TT3D 4E3ZA 2ZXIA 4XTVA 3CPWP 5CJPA 5EUCA 1PWHA 2YCLA 4ADSG 4OXRA 4ZYTA 3GZTB 1V1MA 2KK4A 1E8DA 3CXCA 1ABEA 4C92A 1QQTA 1Q7YR 4MCAA 3AETB 1KVTA 4XR9A 3NS7A 1PDOA 1NUQA 3EG9B 4A54A 4IIEA 2CNNA 5G3ZA 3SHQA 3RKRA 4LOAA 3GNTA 3ZQ4A 2D8MA 1CP3A 4M7AF 2L42A 4MUYA 1E92A 1Q83A 2RKWA 5BY2A 1JVBA 4XX0B 5BSHA 1YS2X 2QJRA 2R0QC 3TD2A 1TXGA 3I12A 4F5WA 5K0FA 1P5HA 4KMRA 5JMPA 1GRVA 5KTOA 1LB1B 2QLNA 4HNTA 2P8JA 2R66A 1VJ0A 1P7YA 1T1RA 2Q7DA 5JQWA 1W73A 4HE6A 1T0HB 4G3XA 2QGZA 1PR1A 3ZG6A 3AI2A 2CZ7B 4Z4WA 1O89A 3BREA 4Q39A 4RPLA 2HA5A 2HV9A 3E70C 1PUIA 4XQFA 5K0TA 3VV3A 2JCYA 2QRQA 1DLIA 1GQQA 2TS1A 4CR6A 2CP7A 4YP6A 3OD1A 2XNDA 3I55Q 3C1UA 5HXBA 3FUWA 4H3VA 1TOAA 5LL6P 2I4NA 2JIMA 4Y0AA 2HSPA 4QVCA 3EG2A 3MS4A 5IZCC 4W1SA 1NJ8A 4KGVB 1E1QA 1YRYE 2O8NA 4F4FA 3BF8A 4BGVA 4ZVKA 2CVPA 1T2NA 3C14C 1KEEB 3KOXA 1YSCA 1TEZA 5ERGB 4BQIA 4F6RB 1Z5WA 2PE5A 4QV2A 2V58A 3PQFA 4OLJA 3KYCA 4HH0A 4QPDA 2HTFA 3GRPA 4BS9A 3VISA 5FAKA 4GUDA 4QODA 3P0IA 2ZTSA 4CLOA 1LPLA 4K05A 1QFSA 4UNRA 1XZBA 3WLRA 4OGLA 4CC3A 3BFJA 1M34E 1OLXA 4U0KA 2DR3A 3PGKA 4H77A 1ZXLA 3VOTA 4M54A 3E2MA 1Y1SA 4BVLA 1MAAA 2GCGA 4WKNA 1VQOA 2ODAA 1PM3A 1G8YA 3H8WA 3LVRE 2I99A 3RS9A 3M5CA 2Q9BA 1RI2A 1KAMA 1SNYA 4N48A 5EJEA 1YQ9A 4L6CA 1BDHA 2O8CB 2P2CA 2ZBVA 3LRTA 3FYUA 3PJGA 1PUXA 1WXGA 1GQRA 3B9PA 4EIKA 2CJPA 4UUAA 3EZLA 3WLHA 1EZZB 3R8CA 3UA3A 4CFZA 4L5GA 1Z6YA 3MWFA 2EQJA 5IJXA 5FLYA 4XVUA 2AG1A 4R3UC 2GTOA 3V4RA 2Q6KA 4LY0A 3RRMA 1G3SA 2E0IA 5CDHA 5JPIA 2RKBA 1G8FA 1UUFA 3NLLA 1YE5A 4K6GA 5JZBA 3F6CA 1MORA 4JJ6A 5B2ZA 4PO9A 3HDQA 4YAFA 1NT2A 1V1JA 1NX9A 4FGSA 3B51X 1X6BA 2ESWA 1VQ5Q 2JZNA 4H2DA 1NUHA 2EJVA 1P9WA 1T8YA 2DBZA 2GBLA 1DELA 1JYEA 2H08A 1UBMS 2HK6A 4KV7A 5E4YA 1MPTA 2P91A 4WIAA 1AM4D 2PXXA 4OOSA 4Y2RA 1KI3A 5CIYA 3T8YA 3TOVA 2C06A 3T9CA 4J4TA 1SHFA 1Y3CE 3U1TA 5B4UA 5L40A 2O8DA 5HY6A 4NPAA 3NOVA 3MJHA 1E94E 2QMEA 1MO5A 3IOMA 4A8JA 1O97C 2NAFA 1CUBA 3AMVA 2HQOA 4ROXA 3EXHA 4FKMA 1FWZA 4RJKA 4V0NA 1O03A 2CFRA 4IVNA 5HIAA 2AKEA 2CP3A 1DL5A 1H6AA 5AI4A 3WDKA 3VXKA 4IMJB 5JCZA 5LJ3j 2OTLA 1TRHA 3INYA 1XXHE 3OW7A 1HZZA 4XD7D 2QDKA 4ZARA 4E15A 4GP9A 2ZWMA 3ZXYA 2QP9X 1ULBA 3Q1JA 3KWLA 1E1MA 2GA8A 4KTTE 4UOZA 5BWNA 1GAXA 5BR4A 2A1IA 3RMSA 4G1MB 4MP8A 4JBGA 5ERXA 1GSHA 4B82A 3L4EA 5KE3A 1I3CA 4HPWA 4DGQA 3HPWA 3N2KA 4R2LA 4YCDA 1T25A 3I53A 4MUBA 4EG8A 2BGNA 5JRJA 5KYKA 4JL6A 3T4EA 3JTMA 2QP3A 3JQ8A 3NP7A 1H9AA 1OWMA 1PI3A 4D3ZA 2YQZA 4HG2A 2Q8NA 3BK7A 3AT1A 3IIKA 1JTVA 5HEKA 4D1YA 1AGNA 3VNVA 2B5OA 2X7XA 1U5SA 1QJCA 3TSOA 1TKAA 2J3IA 2Q3HA 4EUHA 1KSWA 3BF7A 4DRZA 5FXMA 1YONA 2ZJZA 4TTSA 4IH4A 4K9MA 4YIHA 1EDZA 3QIIA 4TZTA 3WX0A 2HPZA 3L8GA 1COWD 5DYYA 1VQOB 4R0VA 4J0GA 4R71A 3EVEA 3JYQA 1NJID 1SFRA 4KKUA 1NNSA 2BGTA 4WKOA 1XRRA 1VQ8Q 3L8YA 1JE0A 1V39A 1MNQA 2JIRA 2YHBA 3BL6A 2AVNA 3GY0A 3ZLTA 2ZBPA 4A26A 2AV6A 4IAOA 2I3DA 2K7AA 2QVGA 3NOOA 3OZTA 2KLHA 4A6PA 3D6HA