2DEUA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
364
structure length
364
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
total genus 85
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2deuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2deuA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2deuA01
1TLLA 1JNYA 4MYUA 4RD0A 3ISJA 3FNRA 1MAWA 2HCJB 4ND7A 4U7JA 5DEOA 3PENA 1OBCA 3CVVA 2DY1A 1G7CA 1GVHA 1JZQA 1J1ZA 1OBHA 4M4SA 1V8FA 3INNA 1GJRA 3WXMA 1IH8A 4G1BA 1YULA 1R6TA 1WOYA 1FNDA 1VQ4B 3U1VA 1VBNA 3AVVA 4ARIA 1QRTA 1XNJA 1LI5A 3VO2A 1N2BA 3CRZA 1PFUA 4YP7A 3CVYA 1YIAA 3LO8A 5FA6A 4Y9UA 3N05A 1KQNA 1O97C 1HA3A 4JXXA 1E62A 2PFSA 3AGPA 2J07A 3OW2B 1EFVB 1N2GA 1ZUNB 3ZZUA 3ND6A 4GRIA 3ZXSA 4U8HA 2Z3VA 1AIPA 1KORA 1T6YA 3I1FA 2DERA 2VTBA 4EG5A 1FNBA 1VQNB 1JB9A 1WQ4A 1Q19A 3FDXA 3X1JA 3CPWB 4CDMA 4NBSA 1N8RD 3VNVA 1MB2A 1XNGA 1N3LA 1YJWB 4KR9A 3IH5A 2PZBA 2A86A 1M8GA 3HGMA 2VZLA 4HJXA 1JJ2B 3C8ZA 4YP6A 1PG0A 3NV7A 1E64A 4EG6A 1KQPA 4J0QA 3CC4B 1JIIA 2QTRA 4ZT7A 5FO0A 3CCVB 3SZGA 4NDAA 5LFAA 1IQRA 1S0UA 4KKVA 2OK8A 4X0EA 4J76A 3GLVA 4I6JA 4NAHA 4DDKA 4EF6A 1H3EA 5TR9A 3VMFA 4KR6A 5HUJA 1I2DA 3N9IA 4LBVA 2A7XA 2J09A 1V47A 2YWCA 3CCSB 1KC8D 3H9BA 2V0CA 4HK4A 4MUGA 1W35A 1W87A 1NUSA 4I6GA 3QFTA 5THXA 3MCAA 1D1NA 1M8KA 1NUTA 1WXHA 3D6UA 3NBAA 3SDBA 4JYZA 4AQ7A 1GAXA 4FZJA 4MW7A 3L92A 2E18A 2BM1A 3CMEB 3BL5A 4PBTA 5KCMA 3CCJB 1O0CA 4MW2A 3UC5A 2XNCA 5K0TA 1VQ6B 2EFGA 3AVTA 3L93A 3CLSC 2BYTA 3AL0C 2B5OA 1GAQA 2J5BA 2VYQA 1I7PA 2PZ8A 3HFJA 4PC1A 5EKDA 3P52A 5KWVA 1H85A 4NAUA 5KSWB 2VNJA 4F7DA 3SJZA 3FIUA 4J75A 3CC2B 1YJ9B 3IODA 2QUKA 3SYTA 5EMNA 2H29A 4YAFA 1G7TA 1ZM3A 3G71B 1TYBE 1R6UA 2D13A 2DPLA 4M53A 4RPIA 1GTRA 3CC7B 2BM0A 3F3MA 1U2RA 4MUFA 2DXIA 1IHOA 4PBRA 2QJTA 1VBKA 3QFCA 1U7DA 3COYA 4EG7A 1KK2A 3OTWA 2E21A 2PG3A 4NX2A 4G5GA 4TMXA 1K4MA 4P2BA 1ZJWA 1J1UA 1VQOB 4MAFA 1M90D 4DQKA 5LM3A 2FX3A 3P0HA 5H59A 4ACAA 1Q81D 3PNYA 1O0BA 4HE6A 1TFUA 2I1LA 3UOWA 1R5BA 2QTMA 3TZEA 2CYAA 3HV0A 4ZCSA 4F3RA 2NZ2A 3A2KA 5IJXA 2J4DA 2J7KA 1OD6A 4YMIA 1GR1A 3QFSA 1R5OA 3QTTA 2WB2A 3S3TA 4M1KA 5TEVA 4ND6A 1NJID 1XJQA 3FJOA 4MULA 4EGAA 1XB2A 1DNPA 4Q7JB 2Z09A 1N2HA 4DE5A 3J81k 2Z08A 4EG3A 1QFYA 5HXBA 2PMDA 3B82A 5IHXA 1N1DA 1QVGB 5GV8A 3CVXA 1W34A 2PLFA 1U3CA 3FOCA 1OWLA 1VQKB 1TYAE 2DR2A 4LBWA 3SZ3A 2BGIA 1R6XA 3SP1A 3ELBA 4UZEA 2A1UA 3ZUGA 1LI7A 4PC2A 1WXEA 1X6VA 3GMIA 5BNZA 1FRQA 3OZVA 1G8HA 1EWYA 1EP2B 1VQPB 2DUMA 3OP1A 4WQMA 4BPRA 1B6TA 2ZITA 4C0SA 4ZCQA 3H99A 2AHOA 2YWGA 1PFVA 1EFPB 1J09A 1JEEA 1WXIA 1QTQA 3JQQA 3ZXIA 4QFMA 3ZIUA 1I6MA 4K1XA 4MVCA 3MMXA 4YP5A 5J5AA 1IJEA 3CLRC 2IJGX 3NBKA 1CNFA 4Q93A 3JXEA 1KAMA 1FDRA 1I6LA 3Q4GA 3FG9A 1TVCA 3E1YE 3ZBUA 1NYLA 1DARA 1QQTA 1IFXA 4MWBA 4OUDA 2CV0A 1QU2A 4RCZA 4N3GA 3ZBTA 1FNCA 1KK3A 2OTJB 3CCQB 2HMAA 2QN6A 4YHBA 4ZCIA 1GZUA 1OWMA 4PC3A 4Y7CA 3CXCB 1OWNA 1Y42X 3COVA 3QE4A 4MWDA 2EJCA 3VNUA 3CLTC 4KR7A 2VNIA 1T6ZA 4NCNA 2E89A 3W2HA 2CUZA 3FETA 1U0BB 3M5WA 1EXDA 3AVUA 1N2OA 4RD1A 1JIJA 1ELOA 1MOPA 3DO8A 4ZV4A 4H9GA 3IMEA 1SKQA 2CRVA 1VQLB 1GAWA 3IMGA 3IUEA 1JGTA 4ZT2A 2D54A 1N78A 1MJHA 3CLSD 4A91A 1J70A 2XRYA 3FHJA 4MUNA 3CVWA 1JZSA 4DQLA 3PXUA 4E1AA 4HJRA 1B2RA 3ZZ0A 2C77A 2D5BA 4DNXA 1TYCA 1NP7A 3ES9A 1KQOA 2EL7A 2GQFA 1U3DA 1N0VC 1YJNB 1F4LA 4EG8A 4UAJA 3AKZA 3COWA 1QNFA 1IQUA 2WQ6A 4PC6A 4QREA 1OWPA 3W5VA 1MB9A 3CCUB 2PXHA 1LW7A 1Q86D 2YXNA 3AFHA 2AZXA 4MQ6A 3CCLB 1QU3A 1J21A 1IB0A 4XFJA 1KH2A 4HE5A 3U2QA 1M8PA 2ZP1A 1ZM9A 2V0GA 3MXTA 3WNCA 1NUQA 1H3NA 2BGJA 3IMCA 5AN9A 3COZA 3CCEB 1EE1A 2DETA 3A05A 1U7XA 1COZA 4MW4A 1WZ2A 5H16A 3B78A 2DEUA 2R5WA 4NZPA 2VTBB 4MW5A 4BWVA 2BF4A 3H05A 4B43A 1MC1A 1XNHA 3U6KA 1YIJB 1IRXA 4AC9A 2AKEA 5TV2A 1TQ8A 4TMZA 4KPUA 1YHQB 3MUEA 1K73D 1A8PA 5DSZA 4LBYA 2WSIA 4MUHA 4QRDA 4K0RA 3UY4A 4Y9RA 1RQGA 3AG5A 1N75A 1M1KD 5FO1A 1BJKA 1O96A 1P7PA 1E63A 2J08A 1PFWA 2JA2A 3TQOA 1KKUA 2OTLB 3A04A 4DDHA 4U9UA 5K0SA 3VO1A 2BV3A 4MWCA 3WY9A 4NATA 3N8HA 3P26A 1MAUA 2A1TS 4WSOA 2OK7A 4ZT4A 1FFYA 4PGOA 2YWBA 3FY4A 4MVXA 4DJAA 3CLUD 5J58A 5GV7A 5TGTA 3W5UA 1BX1A 1Q77A 3G5AA 4MYTA 1H1TA 4YAOA 1T9GS 4L2IA 4AF7A 3ZJUA 1VBMA 4QBTA 1VL2A 3RHSA 3MHPA 2HZ7A 1TYDE 4ARCA 1ZH6A 3H9CA 1EFCA 4RUKA 3SEQA 3ZJVA 3OJWA 3OZWA 3LOQA 3CVUA 3P0JA 3V76A 3W2IA 1QVFB 1EUYA 3ND7A 4ZCPA 4OJMX 1NDHA 1PFYA 1S4MA 3HMQA 2YWEA 1TTTA 1HYBA 1CQXA 3CR8A 1BX0A 3ZZTA 1ZH0A 4P3YA 1GLNA 4FK8A 3MLBA 4ZCRA 4EG1A 4ZCTA 2BTEA 2CYBA 1O97D 2QTLA 2YY5A 3AVYA 4PY2A 4IW3B 1TEZA 4ZGNB 3IOEA 1JEDA 3HZRA 1DDGA 1J9ZA 3IOCA 3CCMB 3QFRA 2QTZA 1JMVA 2A84A 3RK1A 2RD2A 4M2LA 1ULHA 3QE2A 1O5TA 3LCJA 2C5SA 4GU5A 3SEZA 2PZAA 5DK4A 1XE1A 4K03A 4JZYA 2B7CA 3IVXA 3WBJA 1YUNA 1O6BA 1YI8A 3W2EA 4MUIA 1IVSA 2X0KA 2HGZA 3IVGA 1KP2A 4ACBA 3G59A 3K9WA 2ZUEA 4FWTA 4ZCLA 4R71A 4MVYA 1F20A 2QDXA 2PIDA 1QGAA 4WNYA 4ZGQB 3D6VA 4MLPA 3UK2A 3I56B 1B23P 1G59A 1N2JA 2B7LA 3AIIA 2CYCA 3W2GA 4RD6A 1J20A 3WNDA 2TS1A 4EFKA 2E1RA 3QSYA 1D2EA 1NURA 4MW0A 4RCYA 4S1OA 5DASA 1N77A 1D8TA 1EP3B 2DCUA 3OJXA 3DLAA 3PNBA 4JFAA 3VGJA 3VRHA 3ZJTA 2A1UB 4XSVA 1EFVA 3RK0A 1ZUNA 4DLPA 5LLTA 1UFVA 1Q15A 3GUZA 1VLHA 3P27A 3KT0A 1K8AD 4R2LA 5DB4A 2BN4A 4CQNA 1IQ0A 2BPOA 4YAUA 1I6KA 4B47A 1O94C 3QTBA 1VQ9B 1KH1A 2CV2A 4MWEA 4M0LA 1ZM2A 2QEXB 2X3UA 3DV2A 4G6ZA 1N2EA 1FRNA 2BSAA 4FN5A 1Q7YD 1M8JA 1N0UA 3FPKA 4P6VF 1YI2B 2GM3A 1O95C 1EFTA 1DDIA 1KK0A 4EG4A 4CT0A 2A1TR 3U6BA 4LC0A 1SURA 2GKSA 1QX4A 5HG0A 1NUUA 5TS2A 4H3SA 4ZT6A 1KAQA 1GN8A 3JQRA 3E20A 2G36A 1EUQA 2NSYA 1OWOA 1T9GR 3K32A 1KRHA 2ZUFA 4JXZA 4OUDB 1SM4A 4RD4A 3WNBA 1ZM4A 1DG1G 1G8FA 1NZJA 1KK1A 1JHDA 2VNHA 1K92A 1JA1A 2D74A 2CT8A 2H2AA 1GTSA 2B7BA 1EXMA 4RJLA 3WBKA 1QG0A 2YWHA 3IOBA 2A88A 1YIDA 3KT8A 3Q12A 1W2BB 3OZUA 2QUIA 3TNJA 5H5JA 2X1MA 2WQ7A 2QUJA 2VNKA 1AMOA 2DLCX 1K9MD 1QH0A 2RE8A 3B8HA 1PG2A 4F4HA 4UZFA 2XNJA 1K4KA 4N3NA 1X8XA 3G6KA 4XFDA 1FNMA 2GOYA 4R2MA 2CSXA 1EP1B 1S72B 4C43A 4QHYA 4MW1A 1OB2A 1WXFA 3LE8A 3RBAA 5HUHA 3IVCA 3ILVA 1M1ZA 1KP3A 1QUFA 4YAWA 5TY0A 3X1MA 2O8VA 4TN1A 3P0IA 3AGQA 3IUBA 2A4MA 5F23A 1R5NA 2JANA 2QTNA 3N2YA 3ZGZA 5KHAA 1G8GA 4TMVA 2QMUA 3AVWA 1F9AA 4MW9A 1KD1D 1Q82D 4U63A 4AS1A 3FH0A 2AG6A 2EIXA 4ZT3A 3E27A 1H42A 1T6XA 4B48A 2QJFA 3PRHA 1JECA 3RFFA 1WJGA 3X1KA 1JILA 1WQ3A 4G5YA 1FYDA 3PNVA 1QRSA 4TS1A 1JA0A 4MUEA 2XRZA 3LVBA 1VQ5B 1KQSB 4EH1A 2C78A 2XEXA 5FNZA 1QFJA 3CMAB 4Q16A 5J59A 1M83A 1EJ2A 1BQEA 2RC6A 1M8FA 5H7XA 3KFLA 4B44A 2IP1A 1GO2A 2BVNA 3DPIA 3W5HA 1QFZA 3CLRD 1WDTA 3ND5A 1G7RA 4YALA 4CDNA 1VQ8B 4RD2A 2CFOA 1QRUA 4KPUB 3CA8A 3I05A 1IJFA 4PC7A 1F7VA 1OGIA 2X1LA 3MLAA 1O96B 4MVWA 1NUPA 1GPMA 1QGZA 1N2IA 3CLTD 4MW6A 4HPWA 3WYAA 1F60A 1NSYA 1O94D 4R0NA 3KT6A 2PIAA 1D2RA 3ZC3A 1TUIA 1OGJA 2HDNB 4MUKA 1EFPA 1KJZA 2OV4A 1YITB 2QA4B 2O5RA 2RC5A 3AG6A 1UMKA 1O95D 2X3FA 4L2IB 1K97A 5JBNA 2YWFA 1VQMB 1G7SA 3CCRB 3TQIA 4LBZA 3CD6B 5TEWA 3KT3A 2CNDA 3IDFA 3UMVA 5JBQA 4DDMA 1WKBA 3TZLA 1VQ7B 1EFUA 1NI5A 1QGYA 3A4IA 2NPFA 1KR2A 1KH3A 2E0IA 4MUJA 3RJZA 4ZCMA 3JQPA 3G4SB 3FI0A 3W2FA 1H3FA 3CB4A 3FWKA 2CV1A 5AHWA 1CNEA 3H97A 4TMWA 3Q10A 1QJCA 1WY5A 3TS1A 4RD3A 1BS2A 4YBRA 1YUMA 1A8HA 1OB5A 4G1VA 2OQ2A 2QJOA 3G6EB 1CT9A 2GPJA 1ILEA 1F7UA 1JIKA 2JAXA 4ZT5A 1WXGA 3CLUC 4I6EA 4B4DA 3AVXA 3CW2A 4AF6A 2BMWA 3I55B 1MRZA 3MMPA 2VXOA 4G5FA 4PBSA 2R6HA 1MBZA 1QUEA 3VU8A 4B3XA 1KTVA 2QUHA 4TMTA 1Q11A 3HL4A 2IELA
chains in the Genus database with same CATH superfamily
4JRKA 3PUNA 3KKQA 3D8BA 1KZ9A 5IUJC 4ZOLF 2NO6A 4YJFB 2ZS9A 3O1IC 1NJIC 4ZVRA 2R6GA 2GTPA 1ZFNA 2X85A 1XTSA 3IAM1 3X25B 3I92A 1E9FA 1DZIA 2VGNA 1HGXA 4GC9A 1RC8A 3SBXA 4NBSA 1VB3A 1YMVA 1XVAA 3U3XA 3WGOA 2DM6A 2OC4A 5AKXA 1GSAA 2KRSA 4O02B 2X7XA 2QVBA 4HDNB 2J9XB 5INTA 1HL7A 4AUEA 5JARA 2CP5A 1UXOA 3R5SA 3VTZA 1T0HA 5DXAA 4Y6PA 4OY3A 3G2IA 5D7NA 3U80A 4LFCB 1ZUD1 1BX3A 1MO4A 1QLHA 3I12A 4PQFA 2GZSA 4UTRA 4F7DA 3ABSB 4MMKA 1GFDA 3UMSA 5SZKB 3AHCA 1KDVA 4BQFA 4BASA 3S70A 3UO8B 4FHEA 1NAIA 4AMZA 5ECAA 4AZ0B 5MF6A 2I6QA 4N0AA 1TQHA 4FJ1A 3KXLA 3RIXA 4FXOA 1U3UA 2DHQA 1GNLA 4C4AA 4AXBA 1ISRA 1USIA 4P3OA 2R751 1UE9A 2R6CA 4YI3A 2FRXA 4D41A 1NP3A 3P9YA 1WFWA 2OP0A 3MOIA 2F3SA 1IOZA 1F6DA 1S3SA 5EIBD 1TVCA 2I87A 3QY0A 4FN4A 2ISSD 3LLUA 1DWUA 1A9ZA 3V97A 1ZD5A 3EGXB 2C4KA 4R2HA 2PWZA 4RTJA 2RK1A 5EUCA 4A4HA 1ZOOA 4P4UA 4NPAA 4V2IA 5HZMA 3Q6IA 4TLBA 2WP0A 5K8JB 3H1BA 1XDUA 4JFRA 1KJ8A 2XTMA 5EMKA 1MMGA 4YAEA 3VV3A 4NBLA 2F69A 4WPGA 4B31A 4BO4A 3RSCA 4AJPA 3DD5A 2QQSA 3Q8LA 3E18A 1F0PA 4F5YA 4IYJA 3AV3A 4INOA 4XIFA 5M7EA 4HFMA 3FOBA 1D1SA 4K9OA 2R8YA 3MHPA 3GUHA 5CYPA 1MC4A 5E3HA 4CMCA 3P0JA 3A8HB 4C5CA 2NWMA 4XYLA 2WJZB 3IIIA 4CM5A 1H4VB 3AU9A 4QSMA 1BVYF 2P3MA 1YZQA 2AWOA 2QMEA 3L0SA 4R71A 2FI1A 2UV8A 2VDNB 4K9QA 4IIGA 3N8NA 1NBOA 4Y2TA 4OF4A 2IYLD 4M78B 3PNBA 3R3JA 4HDMB 4IMIB 2RGXA 1XEFA 3RVLA 2QEXB 1C2YA 1KO5A 3BIXA 3K3PA 2GKSA 3ITEA 4H3SA 3SXPA 1GTL1 3ZQUA 1T2FA 3O75A 2P4UA 3M0PA 5JC1A 3GJ3A 2KE9A 4RVNA 1JA1A 4WEOA 2F1RA 2GAFA 4GX0A 3I1JA 1LCIA 2WFLB 1ANKA 4L78A 3W06A 3I3SR 3VTAA 1SXGA 4R8MA 3B8HA 3H86A 3ADKA 2NP6A 6GPBA 1DP4A 3AGQA 4X6UA 3ABIA 4JSTA 3LHIA 5WRFA 1W2BP 3MUNA 2GK7A 1MHNA 4YRFA 4M0MA 3B1VA 2KQUA 1ZN7A 1JFVA 3KJQA 3H1PA 1JQJC 5EWLB 1YDEA 2D6FA 2OR3A 1N7IA 5C5CA 1W4ZA 4OU4A 3WICA 1Q86C 4BYMA 3LWDA 2D9RA 4YRRA 1FS4A 2V96A 3U13A 1Q81U 2Z5GA 3NHYA 3GEHA 4XLEA 2YWFA 5LMCA 1Y3FE 5EIEA 2GFHA 1I8DA 3KV1A 4REQA 4NRDA 2PO5A 3DOCA 1XRJA 2ZZEA 2RHWA 2AHJB 1KERA 3K7EA 2VBCA 1KSWA 4JBNA 4MYUA 4PG8A 3ZX5A 1E7SA 4M7AA 4KIUA 1Y0MA 5IYQA 1HEIA 1QV7A 2XXBA 1E2GA 1OLUA 3K1YA 1KBQA 2EV9A 3JQ9C 4TLDA 3D6FA 1E94E 1ULSA 3F7TA 4QT7A 1IDN1 5DYGA 3BGVA 1BMFD 4OTZA 5BV0A 1KI4A 3S2UA 4IUBS 4G6IA 2G8NA 3SC2A 1KPIA 3GDFA 1SOAA 4NPHA 3CCSB 3CBQA 4RA6A 5ALHA 1GUAA 2C0CA 2HPAA 2QRVA 3RS0A 3CCJB 1V45E 4EX7A 4Q82A 2B3TA 3B6EA 4GMDA 2QUKA 4TT3A 1YXMA 3KU4A 4LVUA 3IUMA 2A9PA 4BE7B 4BV2A 3Q8KA 1U7DA 3NC4A 1AO3A 2PUJA 3WWZA 2HT1A 2CY0A 1VI6A 1TUGA 2FEAA 2VHQA 3TOZA 5KVCA 3ESQA 4F2WA 1D6SA 1JB1A 2DUNA 5K2MA 3WIVA 3E81A 4JD5A 2DTHA 4II2A 3ZUGA 4M36A 2KS6A 2AJBA 3RM3A 2Q6KA 3F8TA 4EHIA 4BB9A 1U8ZA 4LYJA 1N1EA 2WDZA 5ECWA 3P8BB 4HH4A 4UJ5A 5A3VA 4C4ZA 3OX4A 4CTNA 1CUVA 3DQZA 3R6WA 4EVRA 4RKFA 4ZCIA 1K8QA 3FETA 3C6ZA 1XE3A 5CJJA 1N2OA 7MHTA 4JYPA 3GZTB 1JAHA 5DXFA 1AC5A 1JDPA 1BDHA 2XI4A 1V6CA 4N4GA 1WD5A 2Q28A 1I5RA 1T8YA 2FOLA 1B34B 3QVGA 4KE9A 4Q1DA 1JBEA 2RH2A 1F6BA 3W5BA 3QXJA 1ORRA 4LDPA 5TV2A 1Y1KE 2FP4A 3GJ8A 2IU0A 3CBOA 3GZJA 2W2OA 4CEHB 1RQGA 2GARA 2C2GA 1E1NA 3ECSA 3ZBQA 4N47A 1MAUA 2LE0A 2AJ8A 2VHWA 1SVNA 4M86A 3M4NA 3QX7A 2PGJA 4OOFA 3EWAA 1ES9A 1JWLA 1C4XA 1NDHA 5B55A 3SDZA 4B0OA 1L5FA 2IH4A 1QE3A 2KQWA 3OTQA 1SXJD 3F6PA 1G6KA 4V1CB 5EN4A 4M98A 4DB4A 1A7AA 2CDNA 1YI8A 1NJ1A 4K7JA 1NM5A 3UJ8A 1PJTA 2XA1A 4KRGA 1H2RS 3A10A 2P6MA 2QR5A 2AYZA 1O94C 3QXEB 2YBDA 1M9NA 1IM5A 5K99A 1KDOA 1Z35A 5E6TA 4H15A 3NATA 2QY6A 1J90A 4ND1A 4XK8E 1JMKC 2YHIB 2NSYA 1UD6A 5CT5A 4UHJA 1LUAA 2ZIAA 4PFJA 2F1JA 3SWNB 5BW5A 1WP4A 3C3BA 3NWEA 4CVNA 4L8JA 3HGQA 4AJHA 4K6GA 3S2GA 1R0XA 3MKDA 1S72B 1U3TA 1V6AA 2Q7DA 3QE9Y 1NPDA 3S3NA 4BNNA 3DVLA 3IIEA 4M54A 3LOUA 3TPCA 4UEQA 5FWAA 4ILKA 1WUIS 3DMNA 5FW9A 5J9FA 5JALA 3R0IA 3VR4A 1KIMA 1H6BA 1S4QA 3EG2A 1ZGJA 5IC4A 1FXXA 1W48A 4C4OA 2TMYA 1II8A 2WFZA 2PRYA 1U1TA 1D1TA 1UHFA 2ZL7A 1BXKA 5AI8A 4RK4A 4BUCA 2R8BA 3AHJA 3ZKAA 3OQMA 4O2AA 3K35A 4HFJA 5EVJA 1C8BA 3VFDA 4ZI7F 5LOVF 5JBQA 1L6RA 1OEBA 3FYTA 5KINB 1NJGA 1CNEA 1JKXA 3I6QA 5LA6A 1A9QA 4PWYA 1RMTA 2YQ4A 2CHGA 3KE9A 1P1JA 3T0GA 2HQXA 4D8VA 3LCCA 4RSGA 5J63A 1GA1A 2WU3A 1Z0JA 1VFPA 4PIVA 3PU6A 4Z4GA 1FUKA 2F59A 1YS1X 3EYAA 3IQEA 1C7ZA 3U9LA 3HGTA 4UHHA 4N8EA 5GM1A 6LDHA 3OFND 4ETNA 4S1TA 1FMVA 1GVNB 4KRTA 2VTBA 3S2IA 1SG5A 2NZVG 5ALQA 4KR9A 1U28C 4FINA 2GCIA 2YY6A 4WDRA 1FFXA 4IRXA 3CF4G 5DMXA 3PE6A 1NBWB 1V47A 2HJHA 2GX6A 4K2AA 4XUDA 2FAXA 4QUGA 1Z73A 2OB2A 1N25A 1WHTA 3ZZNA 3R3XA 4MZPA 1H85A 4BEWA 3B60A 4MQFA 1UEXC 5FDFA 3D8UA 4LWPA 4PBRA 4M7RA 1DAOA 3T3NA 3OIWA 4ACAA 4EDUA 1JLMA 2SNIE 1MABA 5FWNA 1RHKA 3GXBA 4ESRA 4MULA 3OPOA 3LX5A 4IM7A 1GHTA 3HXMA 1YCSB 2WHPA 2OX7A 4AL4A 1N9GA 2MINB 4ER0A 3NRBA 4BQNA 1YU9A 2IPOA 1K5DA 3N0RA 5ALNA 3Q9SA 1ZR4A 4J1QA 3NVKI 2OAWA 2E2WA 3QBTA 2O50A 4FC7A 3RVJA 3JAMA 4Y2RA 4E09A 4FKZA 2Q0SA 1Q21A 3QOWA 5LQCA 2IPAB 2MOKA 3FSGA 1DRVA 1GT91 5DO9A 2DT5A 1E7RA 3HCOA 5LQKA 3CPHA 1QNFA 1XLWA 2ZIGA 4QLBA 4OAOA 1GYQA 3RVQA 2MIOA 2MHCA 1PM3A 3B5EA 1VG1A 1EE1A 1RBQA 4KMRA 5GQSA 3Q7IA 4UXHA 3STXA 3T5TA 4S1PA 4YAIA 5F1OA 4MUHA 1M2VA 4PCLA 2IP2A 4F3TA 2GCEA 4HSGA 3ZR4B 4J0GA 3WY9A 4L4YA 2KX7A 4M0KA 2DBRA 4R1LA 3U4IA 1WTHD 3OAAD 2HU2A 2GXAA 3V4FA 4RVCA 4QG7A 2GZ3A 4OJMX 3HNOA 1PLJA 2QTWB 2X3WD 4LMRA 4D9EA 4OB8A 1SKUA 3JQAA 1OV3A 4CLOA 3LY7A 1M6YA 4BQRA 1EFHA 3QYJA 2HCRA 4XEUA 2PKRA 3IP7A 2CXOA 5CK4A 2FZCB 3GHYA 4MRRA 2DD5A 8ADHA 2OORC 3CKLA 2XYQA 4N18A 1QOQB 4P0TA 3ROFA 2FH5B 3WKEA 1XVVA 1D2CA 2A1UB 1E0JA 1GXSB 3QENA 2ANBA 3UJCA 2Q6VA 3NTOA 4FN5A 3FTPA 2GM3A 1Z5VA 1B0PA 3M70A 3M6XA 3CFYA 5ICSA 4CM4A 3IJEB 4FOTA 1HYEA 3H2BA 1QS0B 4LJ8A 5BV2P 1R4MB 4G01B 4ANJA 2C5BA 1GTSA 1ESZA 5IT9A 4H3KB 3CMEA 4P3PA 3U26A 1PG2A 7YASA 3D3WA 1RACA 5AXAA 2CL6X 2ORYA 4ANFA 2YTZA 1OB2A 1IDOA 2D59A 1Q6ZA 3Q2IA 4I1OA 2ZVPX 2Z43A 1H8HD 3UCFA 3HP4A 3HKSA 6YASA 3FPHA 1H42A 3JARA 1OZGA 4F84A 2VJYA 1ULAA 3LT2A 4BAGA 1A5TA 2AKLA 5HS4A 3WO1A 1VE7A 4P93A 3EVNA 3DB3A 1YS9A 2Y67A 5AM5A 2P3QA 3ND5A 1Q2XA 2WD7A 1JFRA 5FUYA 3HM9A 4L7QA 3NDBB 1NFRA 3CN7A 1P1FA 4IQFA 4QA9A 1CQWA 1YZHA 1R0BG 1EGMB 3VAYA 7REQB 3L7LA 2YIVX 2CZ0B 2XYRA 3E9CA 1S5PA 1MCZA 3HJRA 4QG3A 5JCZA 3NTVA 3HKCA 1NBAA 3T8YA 3DAOA 1PD1A 4F5DA 4Z0TA 2QLJA 1UJ6A 5LWHA 5A0FA 2QGZA 2XYGA 2PM8A 4EVQA 3DE1X 2V54A 1SHFA 3ASTA 1AJEA 1T3LA 1W4LA 1NRIA 3GLUA 4KL8S 6REQB 3AJEA 4A8JC 4RU1A 1MMNA 3K0CA 2JI7A 2CXUA 4H1UA 2PU5A 5AUOB 4NZ9A 1EK0A 2W6OA 4PNPA 1DX9A 3CPEA 2PFKA 2HKIA 2ZWIA 4XYGA 4D45A 4EW6A 3FOZA 1PEDA 3VSEA 1L8QA 4JLSA 1NJ6A 3I6BA 1C1HA 2C8LA 1LRLA 1TAQA 4EJSA 3X44A 2ZB3A 3TQSA 1WBBA 3MP1A 5D2CA 3TR6A 4XDYA 4XDZA 2AIRB 4E0FA 4QGHA 4J3FA 4MUGA 4C92G 3MTQA 2X6QA 2P11A 4HRAA 2XNCA 3BHJA 2QQAA 1GAQA 2X2EA 1U0RA 3LGAA 3F5MA 3GVKA 3OS2A 5K8CA 5LL6S 5KJEA 4HAUA 3KUXA 4HNSA 3U81A 2EW1A 3GHHA 4G5GA 2C4VA 3TFOA 1JU5C 3U23A 1Q81D 1HK7A 2H06A 1E2EA 3SS7X 3UOWA 4AJ1A 2O14A 3HADA 4DBZA 5EJMA 4C92C 2K2MA 1U65A 2CF4A 4LGVA 3A8KA 2JDIA 3BVPA 5JQGB 3SFTA 2OXCA 4LPKA 2X8JA 3NPFA 1NLFA 3OICA 2ETVA 2FFQA 2IDKA 4EY7A 1WXIA 3HB1A 1RWPA 4YP5A 1V7PC 3NBKA 4CC3A 1B1CA 5DTMA 2A5JA 1YBYA 4C3VA 4TL6A 3EUEA 2P5YA 3RBBB 3TXYA 1FWZA 1BFKA 1UBUS 1QRAA 3WK7A 2NSDA 1WE2A 1PTJA 2RSLA 2C61A 4YV1A 4NS4A 2J5XA 1D2HA 2PH7A 3CX6A 2OVFA 4R3WA 1IQUA 1FB5A 1FJHA 1ZEMA 5J43A 4N39A 1ZM9A 3EG9A 2P8JA 5EJ4A 3RRYA 2FRDA 1G6Q1 4F1WA 2XDBA 3V4VB 3AB3A 5DT2A 4PX3A 1BYIA 1A8PA 2HPVA 4ZVQA 4UDOA 2H3HA 4HT8A 2BUBA 3ELWA 4EHJA 4XM1A 3A2MA 2XUKA 5JHHB 2Y1EA 4B3IA 3ZWKA 5EE9A 3MCAB 2GD2A 1YITQ 2QA4Q 2ES4A 2ZU0C 5B5SA 1U9CA 4BO9A 3PXGA 3P2EA 4RUKA 5TPWB 5ILQA 1Y4UA 2V6BA 4BI3A 1PR5A 2GKOA 5CLIA 2ZSBA 3VOAA 3I58A 1FVXA 1IXYA 3AUJB 3H1TA 5JNRA 3O26A 1MO5A 1EX1A 3IILA 1TJ5A 1XE1A 2ZWPA 2FSIA 2MYUA 4ATNA 5GY7A 4HAIA 3LWZA 2QAZA 1RZUA 1PV4A 1R0KA 3QUCA 5D1NA 4PNZA 4ROTA 1OBOA 5HNKA 3R8FA 5JXHA 2POQX 2WTAA 4JPBW 2COWA 5B3KA 4JJ6A 1HDYA 1GUFA 3GQBB 4RIIA 1PWXA 2C4TA 4S1VA 4QBKA 1OH6A 2NZXA 3FWPA 3L07A 2D0PB 3R7BA 1GCOA 4BNFA 1KK1A 4IR7A 5JAPA 2QY9A 1D3BB 2A88A 1YIDA 1U31A 4CKBB 3LNTA 3EGDA 2AEJA 3HFRA 2F64A 1DEKA 1TMOA 2G5GX 2C3PA 1CF2O 3IUYA 3O1JC 4AO7A 4R56A 1Q82D 3BDAA 3G7UA 1TS9A 4RJJA 5KOJA 2VJDA 4G8JA 4LK3A 3KS9A 3SEMA 2P2DA 2DKOA 2KRNA 3CJRA 1UZAA 8OHMA 4K0KB 2G3YA 1TZKA 3MWJA 2ATCA 2P84A 1NMYA 1ZOIA 4RTLA 3THWB 3SE0A 3HSBA 3K8YA 1O95A 1KVTA 1ITZA 3REQB 4HEA1 4A8JB 3GJXC 3PQDA 2MAMA 3L5KA 4KMOA 5ALJA 1XGKA 4GDMA 2J6FA 2X8AA 1DBIA 4IL5A 1P2UA 1PRMC 2XT9A 3SCZA 1U8CB 4HH0A 1JKJB 3TS1A 3B70A 5C4GB 2X0EA 5EQDA 3H2GA 4LISA 2XMGA 1C8LA 1LEHA 2ZUTA 3TZHA 4CUKA 2W6PA 2VXEA 4L5YA 3GVHA 1JDJA 1V7QA 1N7GA 2RJFA 5CNIA 4CI9A 3OLZA 1K8RA 2GRUA 3VO2A 4GPBA 3IO5A 5D6NA 4W4TA 4RZIA 1O7JA 4PZZA 1L7AA 1N36B 1FQOA 3RVBA 2EQKA 4EKNB 1MB2A 1E9VA 3MEUA 1NBME 2A5DA 4MVJD 4JY7A 5L3QB 3TLKA 1K2VN 1M1YE 3HHTB 4QV2A 3KAKA 3WIBA 4C92B 3WOHA 3L1HA 1W1FA 1M5RA 2ZXHA 1CFJA 4KH1B 4M38A 4PG6A 2H4WA 5LJ5f 3FFAA 2ZCUA 3TQQA 3OMWA 2UUBB 1QF9A 3AV0B 3OTWA 3EVZA 2CLIB 3IOYA 4J7IA 3ZHCA 1MU0A 2QWXA 1YJCA 4GRAA 1RQXA 1JAXA 3C6BA 3DDOA 2R68A 4M9UA 1L1FA 1WSDA 5KNCD 3RPEA 1ADGA 4EL0A 2H85A 1RXYA 4K6OA 4UBIA 3Q2OA 3TN7A 3H4TA 4F7UA 3CS3A 1B6TA 1FMTA 1JLKA 4RL4A 4V0QA 3Q7TA 1TA0A 1K6IA 1WUKS 2WWXA 1XO1A 1QVVA 4ZZIA 2B94A 5AVRA 1G5HA 4PSKA 2V9ZA 1YQGA 1D1QA 1FEZA 1T5BA 2JAOA 2GYVA 3EXHA 2CK3D 2Y1OA 5BYJA 3MB8A 1K98A 4BBZA 1B2RA 1F0YA 1T1RA 3W7BA 4CTKA 4HX2A 1W29A 3MILA 4JYAB 4IF4A 2UYGA 3QW2A 3DAPA 1IB0A 2DLNA 4PRLA 4FDUA 2YXYA 3HFNA 5SZJA 1E77A 1XNHA 5IDWA 3BSSA 2VTEA 4ERXA 3DBHA 2HNKA 1PJ4A 4LC9A 2FETA 4J1NA 1MTZA 1PGPA 1V3TA 1ICIA 1O9HA 1FFDA 3IUNA 3QWFA 3VU1A 1ZCZA 5E3IA 4P92A 4KUEA 4EMSA 3SIRA 2CXXA 1P60A 4JJ8A 3LOQA 1Y4DE 3GFQA 4JDUA 5JRZA 1OV4A 1VQ5T 1GQOA 4OX9B 3GFSA 3O91A 5HFNA 1BHQ1 5HKLA 3CKMA 3GLIB 1QIFA 3WMFA 4UU7A 2P40A 4RPJA 3X2SA 1OB0A 3PIRA 4G41A 2PZGA 3JVUA 1RMYA 3WP0A 1GQ2A 4X62B 3SNHA 4P9SA 1VLHA 5D85A 4YAUA 2F17A 2G9RA 4LXCA 4XYEA 1V8BA 5MGBA 5I9BA 2R1ZA 4ZT6A 2YUNA 3CLHA 2Z9DA 4X66B 2PBZA 2EJGA 1NZFA 3PJDA 2ZE8A 2BISA 1G8PA 1L5NA 4KT0E 3K72B 4GNKA 1E9CA 1OSNA 3D6NB 4EO7A 2GWRA 1XZKA 4D44A 3TWOA 4XCVA 3L4EA 1DCKA 1BA2A 2G6BA 1LQTA 1FRVA 2VJNA 1L9XA 2BEVA 2DWQA 4Q7EA 5KNDH 1N1MA 4X0CA 2OBXA 4TVSA 4GEKA 3PTAA 2Y92A 3TPFA 1ML3A 4DA6A 4HG2A 2BRUA 4JLJA 3MHXA 4WBXC 4HAWA 4AW9A 3L9XA 2UUAB 2E9SA 3U48A 4WWVA 2QQ5A 5DM0A 3S6JA 3AERA 5B57C 2FPUA 2P62A 1HQYE 3KUFA 3TL3A 3I9QA 2E4YA 2DYBA 2HNIA 4NBKA 4JWTA 5EWMA 5LSAA 3D54D 3THXA 5ESWA 1G6HA 1VYUA 4TYPA 1CKAA 4HUQA 1Z29A 1NW9B 2C97A 3ENWA 4XU1A 1NI5A 4JDSA 2MWMA 3RJZA 2O0LA 5DE3A 4C21A 1CR6A 2AL7A 3KNZA 3TJRA 1T3TA 4OX9Y 3DM5A 2IBSA 5F7JA 3BJEA 4KZPA 1LJOA 2DP4E 4LHVA 3QUBA 4UPEA 1WSAA 3C8DA 3ACDA 4YUXA 3H6ZA 2OKGA 4KW7A 4H18A 4NQZA 3EXG1 3AI7A 1JKIA 1AEYA 4YRDA 3HUEA 3PDJA 2EW2A 4E7LA 2B92A 1XNGA 2HD4A 5EIAA 2PZBA 1N8RR 1HZEA 4YBZA 3WLLA 4OHZA 5JH7A 1PRLC 5GAOm 3MEQA 2CHFA 1QB7A 4IJ5A 3GOHA 2YWXA 3UMBA 1P1KA 4OSOA 2EF0A 2WILA 3ER8A 1JBMA 4RTSA 4P0PB 4OQFA 1NI4B 3ZI0A 3WYFA 4E2WA 4QQDA 4LHYA 3I1YA 4WXRA 3H3JA 4J9BA 5AQEA 4YLEA 2ZI6A 4P7JA 3AHDA 5LP6C 1AKWA 2OQVA 1J1UA 3DUFB 3FTDA 5TJ9A 1GFSA 2I1LA 2E5LB 2XMPA 4M0DA 3TZ6A 3KHUA 4EY8A 3P0EA 3DMTA 1QVGB 1RWBA 1TAGA 1R6XA 2XEDA 3KQSA 1CRWG 5CPBA 3FGOA 3DZ8A 3EG1A 4JODA 1QFMA 1W93A 1L3IA 3ZD8A 1NULA 2P5SA 3ZW8A 2NLUA 2RONA 1COWA 3RGGA 1N2CA 1RYEA 1CC1S 3JXEA 4E2FA 3FYSA 3RSFA 1CUIA 2P2NA 1P4RA 2VOJA 5LYJF 5JROA 4MKXA 1TVKA 4NCNA 2OO7A 4PJJA 4U6SA 5IFLA 3LKBA 2EG5A 2E4UA 3L4BC 1TMGE 4IGFA 4E1AA 4OBWA 1LJUA 3ZJYA 5BN5B 1F4LA 1TT5A 5TSDA 5FD8A 4BPBA 3W6OA 5A6VA 4M75E 4Q3DA 1CJBA 2D4AA 2RI1A 5A88A 4EBBA 4OQMA 5CURA 1RWMA 4GEGA 3RYFA 2V5VA 1GZ5A 4BCBA 4C6SA 3BXXA 1U7PA 2Q2VA 1FYVA 1XFOA 5AM4A 5A71A 1BG6A 2VLBA 5J3OA 2HZ7A 4CFSA 3IQZA 1DJNA 4YT8A 1UFFA 5LBUA 2QM3A 1GCIA 2RJCA 1V2HE 3NNDA 4GQNA 4BX0A 4LN2A 1YJAA 4LTDA 2C5LA 2OSVA 4HQ0A 3K0FA 3AXSA 2A84A 3M33A 4GBMA 5JCPA 1G8AA 4A36A 5SYNA 4X1YA 5KVQA 1VIAA 4HNQA 1I7LA 1M1NB 3J81A 2HDOA 2W6QA 1WHMA 6CHYA 5LJ3e 1G59A 2AFIB 2VHCA 3OSZA 3V7YA 1CIPA 2F43B 3I52A 1YGYA 1SCNE 4NOYA 3Q7QA 4DGSA 1RWXA 2KYRA 3RIEA 3GUZA 4IUPA 4AO8A 4XLTA 1ZM2A 1TLTA 1JX6A 4R2JA 4FCCA 4EHHA 2FPPA 5BUSA 2AKKA 1UBNA 2QRPA 1T2CA 3N1UA 1NTRA 2IITA 3LUDA 1F8XA 2I2FA 4ZAXA 2O8CB 4C0BA 1Q74A 2ID9A 4OM8A 2OGWA 3I1IA 1EP1B 3DCNA 4JN6B 1WXFA 4HLUA 3P0IA 1NU6A 4XD7D 3ZK7A 4KBGA 2GRJA 3EIQA 2ZJZA 3E27A 4RMGA 1PEAA 4YJ3A 2O8BA 4E70A 1VKRA 5KYYA 1NQUA 4RENA 1SOWA 3LX8A 4O4HF 3QVXA 3K5HA 5B53A 4IIOA 4DWVA 3HBLA 3A6EA 2XUAA 4XTZA 2X15A 2E4ZA 3ZW9A 3RB8A 3DR5A 5HF5A 1OZ2A 1N9RA 5B3JA 2X3FA 4KQKA 4XU3A 3OZRA 2JFNA 3HA3A 1S3GA 3NTUA 4Q5WA 2HMSA 4HGRA 3DVSX 4QVGA 1CVRA 3PQ6A 1T10A 1SBHA 1S1NA 2VJBA 3D5TA 3HSSA 4CNQA 5BW6B 4BVHA 4ZI3A 1JS1X 4I1PA 3E3MA 4L3VA 2P2LA 2VC2B 5HCKA 1CYDA 3U44A 1OBCA 4EHFA 4EYGA 5I7VA 1UZUA 2KEAA 3V9AA 3RS5A 3KEMA 4E88A 2CNBA 3LY8A 1A9OA 3AUKA 3GCZA 4D3YA 4Y9UA 1YOVB 5IN1A 3NX4A 3FFBA 4X34A 4Z54A 3R9XA 2EYQA 2JXBA 5E4YA 3T1HB 3JQ7B 4P12A 2FW8A 3EC2A 4N9QA 1O8CA 3BRWA 3SX2A 5DPMA 1HWYA 2NPOA 5LP6B 2QRJA 1ATIA 2VQSA 4TSRA 5C46F 1GCQA 4HK4A 5AOCA 5IU6A 3PJRA 1CUBA 1UKVY 3OC0A 1IB6A 4DDVA 1RT9A 2CXRA 4OQNA 1LTHR 2DC1A 3E8XA 1WEKA 5E4JA 2I65A 1YS4A 1HZJA 3BXHA 4MIEA 4QPJC 4RLSA 3FJ5A 1TKCA 2QTAA 4RABA 4X60A 3DWIA 5THQA 3FIJA 3E7DA 3B7GA 5EKUA 3HJGA 2GCXA 3K1ZA 4JQOA 4YWHA 3QOXA 3EVAA 4F6RA 3CD6Q 1SKYB 3PA6A 3A2KA 1DVRA 4N12A 4ORZA 3VR5H 4DV7B 4ND6A 3I56Q 1R3DA 1CPYA 4C8QD 1XC7A 2F67A 3LSTA 1H65A 1HLPA 1X3SA 1MO2A 2B5WA 1D1PA 1X70A 3ZCXA 5LDGA 4M78G 1U4NA 3TLEA 5JAOA 1SHJA 4E7PA 4F5ZA 3VKIA 3I5UA 5DF1A 2QN6A 1AD2A 4KR7A 4XARA 2Q1WA 4Y2XA 2V5AA 3QJ6A 5AJWA 3TKYA 4LDZA 3ZHOA 1YP5A 4OM7A 1XMPA 1I01A 4DIKA 2I78A 3MP8A 5IBPA 3RG2A 5A06A 2C1XA 3V2UA 3ZHUA 2JZNA 3V1NA 3ILXA 5ER9A 4UU1A 4WZ6A 2OZLB 1PR3A 2IEIA 4IDGA 4HVUA 1DBQA 2HLHA 2YZ7A 4GX2A 1Q7YC 1MPTA 1F4VA 1T1EA 3I5RA 1A2KC 4X8OA 4L15A 1W36C 4RTUA 3R3VA 3HU1A 3WK9A 5E1BA 4M7DE 4V0NA 3IKTA 4RV5A 1MAHA 1QHEA 4XH9B 4RZQA 3GVIA 2QU8A 1Z8HA 3F5FA 2D3WA 2B1IA 5H4HA 3IT2A 2C96A 3TNYA 1TRHA 2I80A 5KWEA 3GAZA 1G8SA 2ZCVA 3IR7A 1R0SA 1L2TA 2DFKB 4L07A 1ISIA 3TB4A 1WPQA 1QO0D 4BBAA 1VL1A 4BNWA 1U0NA 4BMNA 3H11A 3OKCA 1YSCA 2PKQO 3A8TA 3KOOA 2GVDC 1DDGA 1DJOA 1PQUA 3I55Q 4U2KA 3G79A 1RAEA 3I9V1 5I5EA 2AI1A 5A3RA 1PT5A 3QEMA 2BH9A 4G1UC 2C1EA 2CZ1B 3N87A 4MMXB 5HY6A 4DLKA 3UHPA 2DVEA 3H2JA 4JROA 4M78F 2YYSA 3TMAA 4KIFA 4QPNA 1EVJA 3U7FB 3LPDA 1NEGA 1UWLA 2QQ9A 4ISCA 2IEBA 2QG6A 4FIBA 1T9KA 4BX8A 1GILA 4I4TB 2X1VA 4NCKA 2P6NA 2VPPA 3QWXX 2TSYB 1BXZA 1DIGA 3B7WA 1V43A 1IZZA 3F7OA 3E48A 1VQ5B 1I4DD 2Y0DA 3KHKA 1DXQA 3CCBA 3TLCA 2RK2A 1RWWA 2JFPA 2MCFA 4HRYA 5A5DA 4MW6A 4WECA 3Q7EA 3WYAA 2PNJA 3UAXA 3CC2T 4HQKA 1YL5A 3UPUA 3VS1A 2JBAB 5D51S 2P4HX 4ITVA 1M2WA 2CS7A 4ZV7A 4W7HA 4XQFA 5LZ5A 1J0CA 1YAHA 1W6UA 3TFWA 2AA3A 2PBLA 2OQ2A 1ILEA 1ID8A 1P4JA 1W581 2R0QC 3HBMA 5DBGA 5HVNA 4QOSA 5AJYA 2ET6A 1QYWA 3LPMA 3PDWA 3WGUA 2JVJA 4J6FA 4CIBA 2Q4OA 2W22A 3R5FA 5I7FA 3Q40A 4EMKC 1JV2B 1DZ3A 1HXHA 4BN0A 3GA7A 3EEBA 1KKLA 1JEQA 1WPRA 5LLDA 1JQQA 3R1IA 2YYAA 1JIIA 5IYNA 1E2UA 3SZGA 1BVRA 4UXJA 4BUGA 4D9JA 3F98A 2GGSA 3ZWWA 3UJ6A 2GQVA 2CWDA 3A4VA 1UJ2A 2BZ8A 4EEZA 2QDYB 1PZFA 3ROQA 3BL6A 2RFLA 3OX3A 3A5ZB 1N9ZA 1LQ2A 1KHCA 4OP0A 2BM0A 1Z5OA 5JI3E 2RGGA 3DAYA 3U7GA 4NOKA 3QO3A 1T0BA 4FGJA 1NF3A 3HA7A 3MQ2A 4JDPA 4RTRA 2E82A 3KYJB 2PWBA 1UZMA 5HXBA 4RK1A 5HK0A 3M6IA 2BGIA 4EW3A 1RE1A 3A1FA 5BSGA 4I9NA 2DUMA 2BDTA 5ITZA 3AHUA 2FKNA 1I0LA 4BX2A 2PQ6A 3CLRC 3S28A 3PR3A 4U7FA 1Z6QA 2WWHA 4R4JA 3ZU2A 4BY9E 4G1EB 1OYYA 5IK2D 2RB6A 3RYCA 4MKRA 1X86B 2YMMA 1SD1A 4HQNA 3PNQA 4YCSA 4YRTA 3IRUA 1URPA 2K5IA 2J0UA 1MNEA 4QLAA 3D1VA 1W36B 1QP0A 5F21A 1GRRA 3ZZMA 5KE3A 5A9SB 5I45A 1JHOA 3TX2A 4HYYA 1V16B 4EQZA 5AN9A 1I0ZA 3IB6A 1A5SB 1XKTA 4W5JA 4RC9A 3URMA 1NASA 3ANNA 4FM9A 2OAUA 4HNAB 1EVEA 1J2RA 4X84A 3CRQA 1TUDA 3QVKA 4P32A 3A28A 3GA5A 2YUPA 5GAOn 4LBYA 4QU9A 4V0KA 2WD8A 1VG0B 3D7MA 1N05A 1PNVA 1UBSB 2RH4A 3OQOA 1DJPA 5A5EA 3HE3A 2P9BA 5EINA 1VQMA 3V7NA 4TXMA 4JR1A 1RQNA 2R8XA 3QPHA 3CR8A 2X9VA 3ONFA 2VT6A 4RM3A 1C0KA 4WFKA 4YRZA 5HWSA 3TSAA 3VDMA 1L7NA 1H9BA 2XMDA 1ZA2B 3EMDA 2FWIA 3AUSA 5FBKA 2FQWA 2Y77A 2M6LA 4BMVA 2ORWA 1U8EA 3CD6T 3P27A 1C0PA 2VBIA 1VCOA 4B47A 2C92A 5FP0A 4NYIR 1KK0A 1WF3A 2YWRA 3FHLA 4N1AA 4CCYA 2JGNA 4S1NA 1F14A 1GDTA 3BBLA 1T2AA 2VF5X 1JHDA 2NUTB 3CCEQ 4B4UA 3O4FA 1NMSA 3OCVA 3OLYA 5ICCA 4EJMA 2RMOA 3OPVA 2ZQ5A 5G0WA 2VXFA 3VC1A 1T8UA 3BSWA 1ZIXA 1X39A 1IIBA 1GZ7A 2EKLA 1IUKA 4LYEA 2ZGWA 4IURA 5DSTA 4XZ3A 2MSWA 3O8DA 2R5FA 1KWKA 3MGBA 3M9XA 4YXFA 1CY4A 1E7OA 3HJHA 1XCJA 4KPGA 1UPBA 1X15A 3KT6A 4LNAA 1PUIA 3BX1A 1OGJA 4TXNA 4GOMD 1XJWA 4QYWA 3K0HA 2XNKA 1UXJA 4EMKB 1AHIA 4HKTA 4IHJB 3CMCO 4ZHQA 2BHSA 1RJEA 4MR7B 3FDRA 4HDRB 1UC4B 1SA0A 4MEJA 4B40A 3EISA 3W8FA 2X6WA 2R1VB 3T5PA 4MRSA 1C29B 2NOAA 1M1UA 1IH8A 2HW8A 4FNGA 3SVLA 2O0KA 2WJJA 4AMYA 2FR0A 3TD2A 3CEAA 4GMKA 5JCOC 3RS2A 1S8AA 4URYR 3GBVA 4IFTA 4EY4A 5AHXA 1T3HA 2GZHA 5FNVA 2X6XA 3KOUA 4X63A 3K73O 2YFYA 1LLCA 2ZVJA 3QMWA 2VLIA 3T3IA 4D92A 3OP4A 5I7OA 4L8VA 1DC6A 2IYWA 3RU2A 3RVNA 2BM1A 2QX9A 1L5MA 3OCXA 3LW8A 5L4LA 1Q82U 2BP7A 2M0OA 2XH8A 4TL7A 4TVRA 3D5EA 4BYGA 2HQOA 1JJ7A 2QJTA 1VBKA 4GRDA 1F06A 5GZ6A 2P0QA 5HQJA 2MSNA 1DIHA 2FLKA 3LP8A 4ZDWA 1I94B 3WLNA 3C7DB 3HRKA 4YQFA 4X7MA 5IM4A 2NZ2A 3IQHX 3CLKA 2ZT5A 1KWGA 2FJ0A 1QFYA 2RHTA 4HPJB 3V80A 5BSXA 4FQ8A 2XLCA 3R6TA 4UM9B 2K57A 1G38A 1VQ9A 1EFPB 3AOGA 4BVGA 3L84A 3WSWA 1OX9A 1NLOC 4PLTA 2GASA 4W8GA 4Q3EA 5JS7A 4W8HA 2VT3A 5A0VA 1VCNA 1L5LA 4UU8A 1FP2A 3VNUA 1W2BA 2HB6A 1ZBJA 2XAAA 4G0OA 5SICE 2BE9A 2HIMA 4DQLA 3R23A 3L6BA 4EMUA 5KOIA 4DANA 2EL7A 5ER6A 3B6IA 4RUGA 4YB8A 5AVYA 3T1YB 3K9GA 4KQCA 1NVBA 1UJMA 4MQMA 1CEXA 3E82A 3ISVA 3NIWA 4XIIA 4DW8A 3WNCA 2FQ1A 1IN5A 2JAWA 2X8KA 5C7IO 1DWPA 1I1JA 5J47A 1J8QA 2JBHA 3QUIA 2VF2A 3PQ7A 4P4NA 1GU1A 1HNNA 1N75A 4QHTA 2DQSA 2J6KA 2BIFA 4UXIA 3RKYA 1T8WA 4ETIA 3G7NA 3RBZA 5GAOq 2ZYTX 3H2HA 2CJWB 3GEPA 5AM3A 3C3CA 4QKUA 4EHAA 3W3ZB 3OYMA 1XD9A 3K31A 1IK6A 3ND7A 3KYIB 4XJVA 4ZMRA 4F6CA 1SCJA 3L8MA 4JYCA 2MJLA 4E7KA 4TYQA 4TTJA 3G6EA 3COPA 3CV3A 3L0BA 3JCMh 2P9CA 5HZAA 2PSFA 1E3IA 4H60A 3K9CA 4IAOA 4NENA 4X8IA 4G4SO 4ZOCA 1IB8A 4NZYA 4DLSA 1TU0A 1B23P 4YCLA 1ZK4A 4YRPA 4A10A 1Y07A 1G6OA 3ASSA 2NSLA 1WQ7A 4MV8A 3GFRA 3S0JA 1UGVA 1H4QA 1AGPA 1HT3A 4TYWA 3DFFA 1I5OB 4R9RA 4JEHA 2PMWB 2CE7A 1PZEA 1ULUA 1NZJA 4QUBA 2DKGA 3DS8A 2HQEA 3H2ZA 5FWYA 1OIVA 4G37A 5LD2C 2RB5A 2X1MA 3CWCA 2Q4EA 4PJOG 5EGSA 2LC4A 4ZNXA 1IHWA 1GKYA 1PTKA 2ZQYA 1VG9B 3CVOA 4OREX 4DL9A 3P8ZA 2QD5A 3U7JA 1E18A 5ALIA 1LBQA 4CEJB 1VDMA 2YW9A 2R8ZA 3OE1A 4G5YA 3HKEB 4TS1A 3L1KA 1F2UB 5HYVA 4O8CA 5CH8A 2A9VA 4O6JA 1SZJG 2OAP1 1UZLA 1VFNA 1WDTA 1P4MA 5CVCA 3QXHA 3EX7C 4PX9A 2ZBPA 1ZGBA 4PJOC 2NU8B 1CR0A 4HWKA 4AMVA 1GTVA 4YLGA 4O6VA 3AFIA 4IBOA 2VA8A 4BXOA 1DBRA 3R5JA 3N2KB 1QYDA 5JPCA 3OEED 3CH4B 1GKIA 1GDDA 3U7EB 2ZS8A 1AKNA 5ALRA 4BX3A 4UUBA 1XTUA 3F47A 2RAPA 1HEYA 5KS2A 1I5EA 4XWOA 1ISPA 3P2OA 1D0VA 2YHTA 1MXFA 4RD3A 3OOWA 1KOJA 1NKTA 4ZT5A 3O82A 2WFMA 1FP4B 3T1QA 5HEKA 3DKVA 2CFRA 2DKNA 2Y05A 1T34A 1C0EA 3E9GA 1XA0A 5IM5A 3WXBA 3O74A 1PKXA 3AH8A 5J4HA 3ND6A 3DB4A 2OZEA 2BR5A 3M1IA 4NV1A 1N33B 5B3LA 1LNSA 5FBQB 1XAHA 7ADHA 3IQFA 4IF6A 4S12A 3PFWO 3F6YA 1NE8A 2XUOA 4AKSA 2PUHA 4QX6A 4PCAA 4NOJA 1OH5A 5CCDA 5ALYA 3KU1A 1KAHA 3G2PA 2JI6A 2EGCA 4QXPA 1JEOA 3V1YA 2BHTA 1R66A 5EHNA 5L8RE 3WGVA 3CCET 3CC2B 2JCVA 2H29A 1FVFA 4UKDA 2NTEA 3IDQA 3D7LA 4CQMD 2NUZA 3E19A 5ENDA 5JSUA 1RC1A 2ACWA 1YB6A 4I8DA 5KNBA 1U8XX 2MMCA 3H5VA 4AZWA 3C3JA 1Q81R 1V3VA 3CRW1 2IIQA 3TL2A 4PLPA 1XXHA 2HUPA 4P1ZA 4FDMA 1Q14A 4CPDA 4AURA 5K0GA 3OVMA 2JD0A 2OO5C 3ANLA 5ABPA 3HS3A 2ZBDA 4YIHA 4Q4AA 1CEYA 1AOJA 3KBOA 4IKPA 1IVYA 5JQGF 3K9FC 4PABA 3IQWA 4CQJA 2QASA 2WU8A 4KGVA 3FBWA 4EBFA 1SQ0A 2RBEA 2J05A 1FS6A 1C30A 1TPZA 2V9CA 1ZUYA 1DI0A 1I4OA 2NZJA 3CE6A 2IYRA 1G8MA 4EPRA 2VRCD 3E3LA 4PO3X 1NXTA 3GLGB 2VSOA 3GSIA 3B9PA 1EGAA 3FHJA 3ZXYA 3LKZA 4LRSB 3QKRB 5REQB 3QWIA 5BUCA 3EGWA 3NUZA 2E3IA 1P7CA 3SB2A 1IRIA 3L06A 3TG2A 1XQXA 3TBHA 4JC8A 5I7WA 3D6MA 3AZPA 1JR2A 4G97A 5G4KA 3A32A 3D8NA 1A88A 4KVFA 2HPZA 1AQ6A 1VXRA 5BVGB 1NFFA 5DVZA 1KZGB 3ZGXA 1UMBB 3OA2A 3GJQA 1X0XA 3TSCA 1FVOA 2FPKA 2A1TS 2E65A 4RIHA 1VRVA 2HSDA 4EUKA 2HWWA 3QMMA 3TBFA 4DNQA 2LWIA 4B3SB 5JJCA 5D86A 3H41A 4PFSA 2HL6A 2DL7A 2ZB2A 1Q92A 4X24A 1VECA 2FOXA 5TC4A 3DE7X 5AVVA 3KWJA 2ZDQA 4FSHA 2ZAOA 3STWA 4CC7A 2RGWA 3ZGOA 4JLUA 4WACA 2VXYA 2I6SA 1MV5A 4RLQA 1UK6A 5FBVB 4CEIB 3VKHA 3DSRA 1J8MF 1SVSA 3EAGA 1LSJA 4EQ6B 4FVTA 4RCYA 5LD2B 3MS7A 1G21A 4MUMA 4NY1A 2ZTLA 4YMSA 2WMOB 3P45A 3DV2A 3FB1A 4G5OA 1UZNA 2QS9A 3DDZX 1QFSA 2D1TA 3D43A 4ZIRB 2I91A 1CY7A 2O1WA 3KZMA 3H9QA 5ARDA 5DBIA 3OMLA 4RD4A 2OD2A 4GNRA 1TG0A 5K8VA 4HZUB 1IYZA 4DT1B 1BXGA 1WB6A 1KEPA 1LTQA 4D0SA 1AGNA 2KBEA 5ED4A 1FYXA 4PJOB 1EM8B 4OK5A 2ZUUA 3VHQA 4WNAA 4YQYA 4CFYA 2ZK7A 1G19A 1CVLA 3NT2A 4NCIA 4OGEA 3NXSA 2HSGA 2OO3A 1F38A 4B0PA 2NGRA 3KEQA 1BI3A 3A8OB 3OE4A 3VQTA 3GUCA 2JARA 1IHDA 4I9UA 2H2IA 3NTXA 4ZAGA 5IJ0B 1HDRA 4JT8A 1M2GA 1Z5NA 1ST2A 3FZNA 1JNXX 2HRBA 1KQ1A 4A2QA 4PYIA 4C78A 1DWOA 4U2GA 3CD6B 3TINA 5DCUA 4NBNA 3O2NA 5CB4F 4WINA 2RH9B 4C89A 2VP6A 2IH5A 3CCQA 5B30A 1E3ZA 1F7UA 4F9TA 4I4LA 5DIZA 3NDRA 4WZBB 3WB0A 2N9UA 3E7FA 3KKZA 1U81A 3I04M 2QYHA 1YD7A 2ZSDA 3L7YA 3PWTA 3ZN2A 3V7WA 4DV5B 4BLSA 1JLLB 2BEWA 5L51A 2IOFA 4XLAA 1R15A 1M75A 4IMPA 1QCFA 4LSGA 3EZLA 4LGCA 3GNFB 3SKBA 2ZUDA 1ORTA 4QM7A 1BSVA 2Q2QA 2OUIA 1E3LA 4A63B 3ZU3A 4YRJA 1HYOA 1YR3A 2J5KA 3RHZA 5K0TA 4D9CA 5EIOA 3PC2A 4EFNA 4NAUA 3W3AH 1KDZA 1YHNA 1WB4A 1W0JD 1JVNA 3OEHA 4C92F 3F3MA 5FH9A 1QCNA 3QU7A 3D7RA 4WH0A 2J3IA 4HNHA 2IEDA 3EQ2A 4CZ2A 3SWWA 1R9NA 4RTKA 2X7JA 5IULC 1XZEA 3GI1A 4Q7JB 2ZAMA 5BV8A 2Z08A 3S2YA 4NL2A 3DMPA 3IX7A 4RG8A 2XD4A 1JJVA 3WKAA 3L2OB 3OJFA 3SYNA 2CSQA 4YP1A 2VC8A 4Y2GA 1RXIA 2ZT6A 1F0KA 2BDEA 5KTRA 3PEYA 1X14A 1CUZA 4X00A 2ZWMA 2VHVA 2XX3A 3JQFC 1M34B 4AYTA 4YAGA 1ZESA 1UAGA 5TNXA 4U6QA 4LSZA 2RK6A 3BEOA 1OU0A 4NJMA 1HNWB 3BXPA 2XCTB 3DHYA 4DWOA 4JGBA 3PQ3A 3LLMA 3O9MA 3LF1A 1JGTA 5CFMA 5KX5B 1J70A 4MPRA 3U62A 1A98A 2Q3HA 1Q57A 3PUZA 2PMEA 4YAKA 4FGLA 2VBFA 4JOQA 1A2OA 2DHEA 2J9ZB 4AG2C 1TK2A 5JJLA 3MFQA 4JH0A 1MB9A 3O83A 3GT0A 3A70A 1RI0A 2F1HA 1SQ6A 3QJGA 3K6RA 5FQNA 4G0XA 2ZXEA 1RKQA 2NQTA 3LRXA 4QGGA 2ZJYA 3VHXB 1O4VA 1Y63A 4FHFA 1AKTA 2X0RA 2FJUA 3OLVA 4NG5A 4Q1VA 4LFAB 4D25A 1YL6A 4RKWA 1PG5A 4M77D 3X24B 2DHCA 2M6SA 1ORDA 3L0IB 2RQVA 1RXSA 4GMFA 1QG4A 4BNMA 1L7VC 3ETLA 3A9VA 4DMUB 4QYMA 3KG2A 1PFYA 2QZ9A 1RYHA 1O4WA 3GA0A 4D6XA 3M34A 3NZEA 5I2MA 2FWPA 1QHNA 3N5BB 1IXZA 1C9JA 2NPIA 2DZ9A 1QW1A 2ZYSA 5TQ2B 1TQ2A 2PO7A 1SG6A 1RP1A 2GTJA 5CLLA 4WLVA 2VRBA 2P5TB 1JTFA 2AH5A 2JLAA 3R9WA 4XSVA 2AK5A 5B7QA 2OCPA 4CQNA 2P0KA 2GRAA 3NEAA 5G41A 2J4FA 1DDIA 2Y68A 4GI5A 3A26A 4MDYA 4FI3C 3NM4A 2P2GA 4G0WA 3QWYA 1T6BY 3CP8A 5IJWA 4AY3A 2H2AA 3THYB 1DAKA 5FQOA 3VJMA 2ZRAA 1QG2A 1SFRA 3OLQA 3BTUA 2VPTA 2DZCA 3NGLA 1LPNA 5L7TA 3E05A 1IHMA 4P81A 4KQIA 2DLPA 1RXVA 4M8LA 2Y66A 2YV2A 4H35A 3LVQE 3OZDA 3C70A 1NOJA 2J87A 2Q3LA 5AHKA 2H5EA 3K70C 1EJ2A 2AX3A 2GJKA 3H8SA 1JHMA 4IIYA 1CY0A 4TS4A 1C1DA 5KAPA 3ZBDA 3FBGA 1CUXA 1GRNA 1JQEA 3UJPA 3WBFA 2QYZA 1K97A 1KKMA 3BL8A 2GPYA 3NTRA 4GP7A 4ZDJA 2XMRA 2NPFA 1I8FA 5BUZA 3EPHA 5IT4A 1OXMA 4G3XA 3UVEA 5CBPA 5KC9A 3ROPA 4NU8X 4GI1A 2WJPA 3ZTWA 1WDKA 2BEUA 2BMEA 4ND8B 5IDYA 3DFKA 1RRFA 4L4ZA 4YN3A 1ESCA 1LCKA 1LI5A 3EY4A 1EUCA 5IWCA 1GFIA 3DHNA 1ZSGA 4JL6A 2VJOA 4BWYA 1YIJA 1VIEA 1ZICA 1ZVMA 1AHPA 3BFJA 3FAKA 1JHUA 1KMCA 5DGDA 4X0EA 2X0JA 2VAPA 2W7TA 2M32A 1Y37A 2AEFA 4FS3A 3H5NA 1FYNA 2YNMA 1GAXA 1BVUA 3WQSB 1FUYB 3KR1A 2CVOA 5E2IA 4HXGA 4JB3A 4XYBA 4AG1C 3EMBA 3V6MA 4UHEA 3W1VA 3RTDA 1VXOA 1YRHA 4Z1MD 3WLPA 5HMMA 3V7CA 2XB9A 1GGVA 4P3IA 5LQMA 1QWEA 1OAKA 1XU7A 1Z5WA 1J0XO 2ZPBB 4KSCA 1LOJA 3EHEA 1CBUA 1XJQA 5CFLA 2QEQA 4E0BA 2VDWA 3ELBA 1MP0A 4TSFA 1UGSB 1XP8A 1FP7A 5IHKA 4X7FA 3B3GA 4OHYA 1KDYA 4NH4A 1LPAB 4MDWA 5DWQA 3ZBUA 4BNTA 4LXYA 3QU2A 1U5BB 1O87A 4ZTFA 1YB7A 3CUYA 1OWNA 3ILYA 2AEMA 2GILA 1HF3A 5JWRA 3HM2A 4WBNB 4Q4HA 4QJ4A 4LNHA 1CUYA 2X0IA 5F4BA 3DZFA 1YZ3A 2OJ2A 4TTIA 3CXCP 1Q7GA 1K28D 3Q1LA 3JAKA 4TN5A 1LDMA 2XUZA 1BI1A 3CCEB 4X1IB 4MSUA 4Z0NA 1JZTA 3PSAA 4RPLA 1VL8A 3F0TA 2LBPA 5EYPA 4RTMA 4UBMA 1Q12A 2PE3A 2Q0QA 3C45A 2F2WA 1R18A 2JGRA 2P7HA 3UY4A 3NGPA 1DS6A 4Q47A 1GQFA 1Y96A 3T6KA 1WLSA 4AJIA 5E0KB 2B8AA 1S2OA 3VDRA 2UAGA 5MFZA 3UF4A 3PEFA 3DVAA 1PDWA 1MFPA 1RJWA 3VZPA 2EP5A 2C82A 5E6UA 1P0QA 1P73A 1PKEA 1SCIA 2B36A 4FHCA 1OAOA 2Y1FA 5JS8A 3MWFA 1YITT 4D57A 4M1TA 2X0NA 2QA4T 4Z7OB 4RD6A 3DLAA 5I11A 1XPJA 2A4KA 2OAQ1 4I9GA 1E0SA 3BK2A 5DLOA 1L9KA 1G5VA 3V1LA 4CDRA 5HG0A 4IMJB 1B6SA 3K70B 2FRWA 1VUBA 4KO3S 1AXGA 4RSMA 2X9HA 3KKNA 2O8VA 1H1LA 2HF9A 2A8YA 1OZ3A 1A2QA 1QCOA 2A3RA 4MIYA 2Q3MA 3VNQA 4BNZA 4B45A 3DNPA 4F11A 1UPTA 3QLVC 2HD0A 2YDLA 2P65A 2P9FA 3P71T 5BUQA 2IYZA 2V7PA 4R0NA 4A0GA 1X1CA 1P3Y1 3B1XA 2HCFA 5J3BA 2X4JA 1FW8A 4LOKA 3UYLA 3EIHA 1E5XA 3HLTA 5A5GA 2HIGA 4CT5A 4MEBA 3UHOA 2GBGA 5JAMA 3WGKA 4G1VA 1HKUA 2FPDA 1CT9A 3JVDA 4BC0A 1TKBA 4Y98A 3OZFA 2V0NA 3NG1A 4DV3B 3RO7A 5J2TB 4F9EA 2GJPA 2PMKA 3ND8A 4UCXA 2D1QA 4C4TA 2D1SA 3M2TA 4OLHA 5KOHA 3EXG2 1EFVB 1USGA 2PGLA 3ZXSA 4J8OA 4CLXA 1Y7XA 1TU3A 3PEUA 3HWSA 5H68A 1NBHA 4Z4EA 3NHMA 2GN2A 1P62B 4Q4DA 4L85A 3IAUA 1GZ6A 3EZ2A 5LP6F 3AVOA 2C20A 1RFLA 1JU3A 1VPDA 2P2ZA 1K73U 1OXUA 4RZ3A 4J5YA 2Z1DA 4L3WA 2JHPA 1R6VA 4PEVA 1PBTA 3LY9A 5J4VA 2O5VA 2OESA 5LM3A 8ABPA 4KQWA 5CXUA 2QSYA 3RI3A 3H75A 4LDJA 4D8UA 5IJXA 2D7CA 3QTTA 2AC2A 2CZ6B 3U7IA 2EZ4A 3QRWA 1PQYA 2JGFA 4LCBA 5EZYA 3P4XA 4Z8YA 3K30A 4NBVA 4EY5A 5CA1A 1OW3B 3M5AA 1E6HA 4V03A 2YWGA 1VF7A 2AXEA 1XZIA 1D4AA 2XVZA 4LE1A 4K1XA 2PH5A 2CLSA 2OC9A 2HF8A 2V1UA 1V0EA 1LDBA 1KAMA 3BY7A 2CC2A 2RHLA 5AP9A 3Q2KA 3GARA 3O9VA 1E9RA 1SCKA 3OIVA 3Q72A 1V71A 5AKIA 2NZWA 4TQ9A 4OYLA 2GMWA 2CUZA 5TMDA 3ODGA 4QJ5A 1RXCA 1MGOA 3IV6A 4O3MA 1NQWA 2R7MA 3MJXA 1FFWA 2C9BA 5JOQA 1V1CA 4FX5A 5KW9A 3IEUA 3GPLA 4I1YA 2ASVA 3F6BX 4WKNA 2P79A 2XF2A 4D79A 4H59A 2VN8A 2CD9A 3QQPA 4Y9RA 2H4YA 1XNRB 1NWCA 1IU9A 3FYCA 5ARCA 1HE2A 2I6FA 5K0SA 3V3TA 2Y90A 5HZHA 3WHPA 2Q9UA 2WTMA 3E15A 4Y6QA 3B1JA 2KPOA 1T9GS 1ZSVA 4CHGA 1VBMA 3MCZA 3TGPA 1BOFA 3ZVNA 1GZSA 4J9HA 2FN3A 2ZSEA 1CZLA 2GKGA 1J7JA 1S2DA 3HMQA 2VH5R 4P4SB 4O0MA 5ILGA 4KK3A 5JEEA 1X75C 1X7XB 2JZOA 5EQJB 3ZWDA 5BR7A 1LBTA 3WE7A 4EUFA 2ZRBA 3UMCA 1YI0A 4OMMA 1P77A 2DSTA 2PEZA 3V46A 3K0AB 3UPTA 1HO3A 2VDVE 1O5IA 3DKPA 9ATCA 4UREA 4E4RA 2XGOA 5DASA 1D09A 1AA6A 4AKEA 1CEQA 4CMJA 4M55A 4DR4B 4Q3AA 3VVCA 3AUXA 3LHSA 5IH2A 4HB3A 3GMSA 3EA4A 4EG4A 3RS4A 3AWIA 3VDQA 1ZCJA 1Q9SA 3REAB 3BFVA 1J23A 4WUVA 5M29A 3IT0A 1KRHA 3A6PC 1U2DA 3BDUA 3TLMA 1LK0A 2B9EA 2FZGB 3E3AA 2DLCX 2FGJA 4DCUA 3MT9A 5BO5A 5AMXA 1KARA 3Q87B 5JC8A 3HL8A 4DMLA 5BRNA 4E3WA 4U63A 4I4TF 2ZTMA 1OTYA 1QRSA 2C4HA 3VOSA 1QP7A 1I10A 3CSUA 3W5HA 5MHTA 3BRCA 3I05A 5HJ7A 4RPHA 4EPWA 2GCNA 1E59A 1ZI6A 3C7CB 1OPXA 3HP7A 1QZZA 3KTAB 3IE1A 1KC8C 3AL2A 2I2BA 2Y93A 1UUFA 4ZGJB 2P30A 4DOVA 4FKMA 1RM3A 4WESA 1X13A 4LE0A 5DNEA 4OHOA 3RYIA 2G5CA 3C3WA 2V7UA 1JF8A 1HBJA 3GIRA 1Q1AA 4Q19A 2XJ9A 3ID6C 3AVXA 1ACMB 1JHYA 4ZPXA 2O8DB 4Y8VA 4CV1A 1DLIA 1KTVA 3KDAA 1X2QA 4Y1GA 1DKOA 2QXTA 2HXGA 1JZQA 4M9SA 5YASA 2WA2A 2GK6A 1EDDA 1SIOA 821PA 3ITNA 2QQFA 4KHPB 4ML3A 5KNLA 2DERA 2JAUA 1RKBA 3TLZA 2ERCA 3O95A 2FSUA 5IKPA 2B25A 1YE8A 4FC6A 3NANA 4RHEA 2V7QD 4Z88A 1SK8A 3IBTA 2BFOA 2GEBA 5ERYA 2EFCB 3NOQA 2GWHA 2AR7A 4R2KA 1BE0A 2WZPP 3IEIA 1SXJE 3ICCA 4JS4A 3QLUC 5HBRA 1TF2A 5IKOA 1YS6A 4ZANA 1C80A 3WMEA 1IM2A 1PTJC 4DZZA 3NH6A 3QLEA 4L22A 3MBKA 2E21A 5KI6A 3S5UA 1LY1A 3VHLB 4FHZA 2A9QA 3I2HA 4A8PA 1K9MC 4EO9A 3LZ6A 2XXAA 1UDCA 4NF2A 1UK8A 3ZDFA 2YX1A 5LU9A 4KWEA 4Y1RB 3QF7A 3N3BC 1XLTA 1TYAE 1SKMA 3IA7A 1CZUA 4RMOA 1V4VA 3P2YA 1IJEA 4S05A 3ELDA 3E22A 3FG9A 5I3ZA 1VMAA 2H8KA 4D9KA 1NM7A 4OL0A 1OX6A 2WMDA 1JXOA 1N78A 4WZTA 3CWZA 2J0QA 3PB3A 3FDIA 3SZRA 3NPAA 1E69A 4D5EA 3TG8A 3REGA 3HRUA 2G0NA 3QWHA 1RKXA 3GFPA 4CM4B 4UE2A 1G3YA 2ODAA 4GX5A 3THKA 4TXJA 3RWOA 1EFDN 1Y1QA 4OUKX 1YBMA 1SSFA 1KMHA 2NQ8A 5F4ZA 4QTXA 3MTGA 4AKIA 1YJ9Q 3WHLA 4FYPA 1DHTA 4MB6A 2LIVA 2FSHA 2XR1A 2XMBA 4KSBA 3C98A 3ROZA 2HBRA 4JS5A 4QICA 4W9NC 5AK4A 2BY4A 4MS1A 1YQQA 5CA0B 4TWJA 2JLBA 2QPTA 2I6TA 5CLQA 1G9XA 4U00A 1N3YA 2BJWA 3LA6A 3SNKA 4GQBA 1HYBA 2FVUA 4NYMR 4ZCRA 3DZHA 5HZBA 3E8SA 3IS3A 3GGCA 3VC3A 4KDCA 3ESDA 1I3NA 1ZRHA 5LDDC 4L95C 4O5VA 3G59A 4OSEA 2WTBA 4GICA 1OLOA 2DPMA 3GJZA 3CTPA 4WBSA 3I8XA 4G4GA 3W5AA 5KNDD 2ZTHA 2HQHA 5DTEA 3W5JA 5TARA 5ICFA 2XB8A 1O95C 3VS5A 4WVLA 2WIDA 3WJ1A 4GKBA 2J5RA 2XI9A 1NT2A 4AKGA 5LP1A 3NMUF 2YRVA 1C1AA 5IJZA 3EAEA 2J9RA 3DW1X 4R51A 2KYMA 4E5YA 3B1ZA 4KXNA 1AMOA 3EEFA 3F97A 2YVUA 2FB7A 4FB4A 5H9WA 4M21A 3CUKA 3GH1A 4QVZA 2VR1A 1ZJ5A 1WVGA 5MFPA 2ZWAA 2RNAA 2AXNA 3E23A 4AROA 1DEAA 5A02A 3VRZA 4G1CA 2Y9PB 3NC1C 5F9HA 1YWGO 2MPXC 1OZFA 1Y3HA 3T9NA 1ECLA 1MH1A 1V3QE 1KQSP 1SK9A 2JS7A 3VR1A 3JVEA 4RV9A 3CPJB 5JFGA 2B4KA 4A5SA 1YAJA 3AMVA 1YITB 2QA4B 2QN8A 4UTVA 1E4EB 4FEYA 3RIGA 3KT3A 1PI3A 4YT2A 4PHCA 3JQPA 1TVEA 4V3CA 2ZB7A 1IG3A 1GPKA 2B4YA 3W5SA 3EPKA 8ATCB 3M6VA 4ELYC 2X8JB 3G49A 2GN9A 3AUFA 2R57A 2QP4A 4OMCA 2OG1A 4IHJF 1WOPA 5K03A 1TLLA 1ENYA 3EGOA 2ZZQA 4J9EA 4X92A 4G8CA 4HB2A 1V0JA 3RIRA 1D1BA 3WR5A 3S40A 1VBNA 2N46A 2X4GA 1QGDA 2Y0CA 4TKOB 3VZCA 3AJRA 2HHJA 4U8HA 1H2HA 3T5MA 1Z39A 4D8KA 1Z9QA 2ENUA 3HGMA 4DQUA 1PG0A 2IIPA 1JL3A 4J2HA 4DA0A 4COKA 4HSEA 4I6JA 3AT1B 3DLIA 2Q3DA 4GBQA 3EA0A 4DV1B 2DQYA 1GIAA 3BYZA 2PAFA 3GF5A 1AK1A 4Y6GB 2P69A 3FPEA 2RK4A 1TJ4A 4Q9DA 4AFNA 3AVTA 3C5EA 1QH1A 3LIIA 1GTG1 4RZ2A 2O06A 3EZ6A 2KLHA 2LDMA 3ME5A 4FXPA 3AOEC 3JYOA 5AW1A 5LQAA 3LDUA 1PYDA 5LJ5g 5FBHA 4EKDA 1SBTA 3T9CA 4UHCA 3MAGA 1E2KA 1AT1B 2UDPA 3DTVA 1E5QA 1YKFA 1KZ1A 3ZDCA 4YASA 1W49A 2V7GA 3F6CA 1IPFA 4YRNA 2ZKLA 3ZE9A 4RMNA 5JDCC 2IEGA 2YWJA 3SP1A 3LD9A 1JFFB 1AXEA 1NVEA 4ELZC 1L5WA 3TD9A 1FX0B 4PSDA 2D1FA 5C5DA 3CF2A 1Z0AA 1Q91A 4M9RA 1JEYB 3D0OA 3CG4A 4Q01A 2R8PA 2VSFA 3PC4A 1Q83A 3RD5A 4HEQA 4U9HS 1EXDA 5J2UA 3I56T 4IGAA 4YMHA 4QAJA 4E1VA 3CLSD 3C1AA 1PFQA 3KV3O 3ZZ0A 5EKXA 3V4ZA 1NP7A 3AKZA 1O75A 4KUGA 3HVRA 5D3KA 4PAMA 1VGQA 5GGXA 2EBPA 1HG0A 1BMTA 2PX4A 2G28A 3ESZA 1M5UA 1NW5A 3T38A 4H7EA 4RH1A 2RBKA 2E12A 5HE8A 4M22A 3ILHA 3QBYA 1K73D 3CZQA 5DSZA 3C3PA 4LA4A 3SLGA 3V8KA 1PJ6A 1XCPA 1FMCA 3DF9A 3PEWA 4BDYA 1NR5A 4MYHA 3FY4A 4QGBA 3WDMA 5BMVA 2K7ZA 2OOKA 1M2OA 1FUUA 2X5JO 1RYNA 1W9XA 2XJ4A 4OO3A 1VQMQ 1SC3A 5E1OA 5TMEA 4ER5A 1XCGB 4CUZA 4UJ3A 5ETJA 1H6AA 1KBOA 2BFBB 1GGKA 5DM1A 4FZRA 1XCOA 3N58A 2QTLA 2IIMA 4F3CA 4F5WA 2BGUA 5TQ0B 2Z6QA 1JDSA 4J7CA 3C14C 3N2NA 5IARA 2H7XA 1XG5A 1ZJ6A 5DBEX 3TQCA 4GF5A 3L40A 4NAVA 2BN4A 1IQ0A 3FCAA 4P33A 2E4HA 1UF9A 1YWOA 4KXWA 13PKA 3A3NA 1GRQA 4ZDIA 3AF2A 5JCJD 3I55T 5L3SB 6ABPA 3GVXA 5FLXE 3PDIA 4V3BA 1UDBA 2OPBA 2OUKA 1G83A 1A9XA 3GLFE 4M1EA 4WHMA 5AOBA 4E07A 4FEEA 2SEMA 3HEBA 3RW9A 5BXYA 1UBFA 5F23A 3N2YA 5KMGB 4DQDA 4MW9A 3E1GA 1PT7A 5FFFA 3DM9B 1WQ3A 2XNDD 3AJAA 2IY7A 3V7SA 4W82A 1C5KA 3TZCA 4G65A 4YDHB 2CFOA 4UHFA 5E7MA 1P9NA 5G1OA 1F7VA 4KXYA 4ENTA 3KP1A 4B83A 1YJ9T 4MUKA 3OYNA 2PVCA 3FGZA 3RU7A 2FHDA 2VHZA 1XEWX 4P9NA 2VK1A 3FX2A 3FOFC 1EG2A 4D99A 4BEBA 1OVMA 2W00A 2ZOSA 4E08A 3OJCA 3DKKA 3KJEA 4Q4JA 3R7LA 3UCEA 3TIFA 4QVIA 3ERCA 3WGLA 4KOAA 5CAEA 1EFNA 5CT8A 1SEPA 4Y1FA 1SQFA 4C0AC 2O7RA 1KJNA 5JXJA 3CCLA 5GMKm 4FNAA 4YDSA 1JDTA 4HO1X 2DJIA 4LDVA 5K0BA 4C30A 3V4SA 2VHYA 2RIRA 3LLRA 1JQAA 3M0UA 2DULA 4HJXA 3CYFA 1V5VA 2R6AA 3RADC 4W1SA 4L74A 3DTYA 2Q4BA 4NARA 4J1TC 3GQVA 2AD5A 3K16A 1E6MA 4I50A 3QLJA 3TYXA 3CEYA 4B5LA 2J5BA 3H4VA 3TLGB 3KRTA 4P83A 5D6WA 4BMDA 1UD5A 2RHRA 1T9AA 4ZGEB 3GJ6A 4JUCA 2XWBF 4HY3A 4R55A 1NVWQ 2IPNA 3WHKA 3DZKA 2Q1SA 3I53A 2Q5LA 5D8DA 1NJ8A 4UFPA 1E1MA 2O59A 4OBXA 5ES4B 4OOVA 2LIPA 4OMQA 1T6NA 1FTNA 1ZAKA 3JYHA 1FDWA 4RAOA 4C0SA 2NIPA 3DOIA 2V1RA 3PTZA 4OH7A 4WVFA 3G89A 3ANTA 1FYEA 4QUZA 4DPKA 1SUPA 2JHGA 4J0DA 2PK3A 3ORQA 3EEQA 3GELA 4MGEA 1GUZA 5I7SA 3T5AA 1U2TA 2KBFA 1ZVKA 3FCUB 4QWMA 2EFIA 3PYMA 5EXDA 4YRMA 3S8MA 1HETA 4JJAA 3WWOA 2B99A 1N5MA 5EHGA 4C4SA 2E5FA 4FFSA 1YFKA 3O4HA 3QVJA 4NHOA 3E2PA 3HDQA 2Y1LA 1OX5A 2PGOA 3ETGA 2XDDA 1NVKA 1J25A 3GJ4A 1WXXA 1J21A 3LPAA 4X06A 1GGNA 2ZP1A 3RFTA 4GLBA 2GYYA 4XWTA 4TLCA 4GW3A 2RB4A 4A1OA 2H7CA 4AC9A 1HKHA 1BN6A 3DFUA 4C7OA 3FHCB 4QULA 3OWOA 2Q2NA 4FDVA 2PQMA 1P7PA 3A04A 1ML4A 2R86A 2A36A 4YJGA 1GGFA 2QZJA 1YJBA 5K8IA 4F9FA 3IBFA 2BF7A 3B12A 3CCRA 2HDHA 1V1MA 1SELA 3UH1A 4BWGA 5KOYA 3F90A 1ZD9A 1VPTA 1JEGA 3PK0A 2YWEA 1POXA 3ZZTA 1GLVA 4XU2A 1TM5E 1KYQA 3KJGA 1PJCA 1PV1A 2QK0A 1O97D 3ND9A 4N3CA 1IHVA 1T8SA 3QFRA 1ZNYA 3NHUA 4M2LA 2JAHA 5EJ8A 4FQ7A 1W5SA 1JP7A 5JSQA 2EW8A 1VIVA 3K9WA 3EVFA 3AU8A 2OHHA 4N0MA 3DC7A 1QIDA 4RVHA 4Q03A 2J0SA 2WEKA 1FSZA 4MVJE 4J0IA 2G0TA 1IULA 4HDCA 2B2NA 4PAOA 2JGDA 1AHHA 3QEAZ 2Q3FA 3T5CA 4UD2A 4J16C 5SZHB 1BD4A 3CONA 1JR4A 3OQBA 3V2GA 2H0AA 2BMJA 2PS1A 1OVGA 5BRJA 4RJLA 3S8EA 4MKGA 3H5RA 3MJSA 4P2NA 1FTQA 1L8AA