2DEUA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
364
structure length
364
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords tRNA
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
total genus 85
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2deuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2deuA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2deuA01
2QTLA 1D2EA 2CV2A 1YIAA 3CLTD 3TS1A 2CUZA 1EP3B 2GOYA 1FRNA 3IMCA 1GAQA 3SYTA 1ZM3A 2CYBA 4EG6A 2X1LA 1KC8D 3H97A 3IOEA 3IUBA 1N1DA 4ZT2A 5TEWA 3AFHA 3UY4A 1QVGB 1QRTA 1GLNA 2PIAA 2YWFA 1SKQA 1EFTA 2QDXA 4YMIA 3CLUD 2A4MA 1N2JA 3DLAA 4M1KA 4UAJA 2O5RA 1O0BA 1JA1A 2GQFA 3PXUA 3IODA 4ZT6A 4YAUA 1KQOA 4DE5A 1BX1A 3CMEB 3N2YA 4KR6A 2OQ2A 1NUTA 4MW2A 4MUEA 1R6XA 3FHJA 4I6JA 4DDMA 4J76A 4B47A 2DLCX 1UFVA 1OWLA 3HZRA 1YJ9B 4L2IB 3ZXIA 3QFCA 4EFKA 5DASA 3ZUGA 2OK8A 1G7SA 2QUJA 1ZM2A 1IQ0A 1JEEA 1CNFA 3AVUA 3D6VA 3WNDA 3P26A 3CCVB 2A1UB 3N9IA 3UK2A 3SP1A 2QEXB 3W2HA 3LO8A 4B48A 3CCLB 2B7LA 4LBZA 3COYA 4M2LA 4MLPA 3RHSA 3TQOA 1YUMA 3DPIA 3WXMA 1GTSA 2E0IA 2B7BA 4PC6A 1VQ9B 3WBJA 1TFUA 3AIIA 3C8ZA 4PBTA 1OB5A 1EFVA 3AVXA 2VNKA 3CCEB 1Q82D 2IJGX 1M8PA 3A4IA 2XRZA 3ISJA 4J75A 1PFUA 1Q19A 3OJXA 3FDXA 2CNDA 3CCQB 2AKEA 2BM0A 3M5WA 1GTRA 3CVUA 2A86A 1O6BA 4UZFA 4EG7A 2BSAA 1SM4A 3LVBA 4NAHA 4JXXA 4PBRA 3L92A 2A1TS 4RCZA 1XE1A 1RQGA 2ZITA 2DUMA 1N2GA 3IMEA 4EG1A 1G8HA 2ZUEA 2YWHA 2J5BA 3UMVA 1WXEA 3SJZA 1D1NA 4MUKA 2BV3A 4R2MA 1O94D 4ZCQA 2H2AA 2A1TR 1EWYA 4XFDA 3FI0A 4WQMA 3D6UA 4N3NA 4JYZA 4YAOA 3LOQA 1GAXA 4AC9A 4TMXA 1I6KA 2J09A 1QX4A 3LCJA 4LBVA 2PZ8A 1WQ3A 5HG0A 4DLPA 4EG8A 3AKZA 3OJWA 1QRSA 1NDHA 2R5WA 4U8HA 3IVXA 2HMAA 1IRXA 2DERA 2BN4A 3ZBTA 1JZSA 1OWOA 1T6XA 1N2EA 5DK4A 1JB9A 5K0SA 2CFOA 1GAWA 4S1OA 1QUFA 3CCRB 2JAXA 1Q11A 1U7XA 2NZ2A 1O97D 3X1KA 4NCNA 3B82A 4U63A 2VTBB 1KJZA 1H3EA 2EJCA 4MUHA 3G5AA 4YALA 4OUDB 1BQEA 3QE2A 2A7XA 1JMVA 3H9BA 3JQRA 1NP7A 3AVWA 2CYAA 1I2DA 3ZZTA 4UZEA 3WBKA 1S4MA 3A2KA 1ZM9A 4ACAA 3CXCB 2YWEA 3FJOA 1VQMB 4G5GA 2D5BA 4C43A 4ZV4A 3CPWB 1BS2A 4MWEA 1XJQA 2G36A 1GO2A 3NV7A 1KRHA 4QHYA 1A8HA 1QUEA 1KAQA 3PNYA 1OGJA 3OTWA 3JXEA 1K4KA 2IELA 4MW1A 1T9GR 2QJOA 3VNUA 3COVA 3UOWA 1XNJA 3FNRA 1DDIA 4Y9UA 3MLAA 3BL5A 2BM1A 4KR9A 4ZGNB 2QTNA 4JFAA 4NATA 4YP5A 3W5HA 5TGTA 4ZCIA 1SURA 3H05A 4ZT3A 3VRHA 2QN6A 4G1VA 1OBHA 4AF7A 1H1TA 4MUGA 4AF6A 1EUYA 4EGAA 3ZZUA 2Z3VA 3KFLA 3G71B 1EP1B 1AMOA 2NPFA 1FNCA 1J1UA 2AG6A 3H99A 4MVCA 1U3CA 1ZUNA 2CV0A 2X0KA 3I05A 5TY0A 4ZT4A 1J20A 4KR7A 1IH8A 1PG2A 1O96A 1VBKA 1Y42X 1PFVA 1TYCA 1QH0A 3RFFA 1M90D 2D13A 3W5VA 5IHXA 1MBZA 1VQ6B 1W34A 2XNCA 1GN8A 1WQ4A 1WOYA 3G6KA 5DSZA 5K0TA 1E62A 4CT0A 2PG3A 3CLSD 4ZCRA 5HUJA 2AZXA 4OUDA 4ARCA 2AHOA 3DO8A 2OK7A 3DV2A 4ZCSA 3WNBA 1H3NA 3VNVA 3WY9A 2V0GA 1VBNA 1S0UA 1KAMA 2QTMA 3KT6A 4WSOA 1TYBE 4FN5A 3SZ3A 1F20A 3CVYA 3CD6B 5TS2A 4M4SA 2BYTA 1U2RA 1GR1A 1ZH6A 3CW2A 3OP1A 2GPJA 1IJEA 1J21A 4X0EA 3W5UA 4ZT7A 4PGOA 3SEQA 1V8FA 2NSYA 4DQKA 4MW9A 3I56B 3FOCA 2CV1A 4PC3A 3ZJUA 4DNXA 4DDKA 1LI7A 2PZAA 3TZEA 1KQNA 1VQNB 4HJRA 1R5BA 1OWMA 3I1FA 3CLSC 1ILEA 3AVTA 2CYCA 3ZJTA 4PY2A 4H9GA 1KTVA 1QGYA 4RD2A 4MW6A 3CVXA 4KPUB 5EKDA 1M1KD 1J09A 1KH1A 1MAWA 1IFXA 2EIXA 1O95D 3CA8A 4XFJA 4PC7A 2B7CA 1EJ2A 4U7JA 3OW2B 3F3MA 1Q7YD 2IP1A 3Q4GA 3TQIA 2WB2A 1WKBA 3P0HA 2RC6A 3VO2A 3I55B 1H3FA 3FPKA 1IB0A 4RD1A 1N3LA 1JILA 2I1LA 3CMAB 3VMFA 4RJLA 1WXGA 3AVYA 1J9ZA 1R5NA 4F7DA 2J07A 3COZA 4RUKA 3FETA 3JQPA 3QFTA 4YP6A 4YP7A 1XB2A 5HXBA 1NURA 1T6YA 3MMXA 1U3DA 4HK4A 3E27A 3FWKA 3PRHA 3MHPA 3P27A 1K8AD 4R71A 2CT8A 3AG5A 4MWDA 4HE5A 4QFMA 2VNJA 1KD1D 4C0SA 1KH2A 5TR9A 1PFYA 2X1MA 4MAFA 4QREA 1QG0A 1K97A 4BWVA 1QU2A 3QE4A 1O95C 1FNBA 4P2BA 4M0LA 1EP2B 1Q86D 4DJAA 1OBCA 4HPWA 1EUQA 3CR8A 3CC4B 4G6ZA 1K73D 1IVSA 1VBMA 4P6VF 1JHDA 1M8GA 1OWPA 5TV2A 1CT9A 1YJNB 1JIKA 2CRVA 1V47A 3ND7A 1NSYA 3ZIUA 2QA4B 5H5JA 4QRDA 3G6EB 1F4LA 4NBSA 5GV8A 3MUEA 4L2IA 5DB4A 3NBAA 2BTEA 3FH0A 2DETA 1QFYA 1M1ZA 1AIPA 3TZLA 3U6KA 4Q93A 5FA6A 4MUNA 2BVNA 2A1UA 4KPUA 2QJFA 3AGPA 4EG3A 2ZP1A 2ZUFA 5GV7A 1MRZA 2CSXA 2A88A 3FG9A 3NBKA 3G59A 1WXIA 2PXHA 3HMQA 1P7PA 3AL0C 3PENA 1T9GS 4K1XA 5J5AA 1JA0A 4ARIA 1H85A 1WY5A 2XRYA 3INNA 3SEZA 1IHOA 5LM3A 1QNFA 3ZGZA 1BJKA 1N2IA 4ZCMA 2D74A 2DCUA 3WNCA 1VQLB 1NI5A 1NYLA 3H9CA 2Z08A 2VNIA 3GMIA 4K0RA 3IOCA 3KT3A 1DG1G 1ULHA 2HDNB 5F23A 4GRIA 4G5YA 5FO1A 2YWBA 2PFSA 3RK1A 1QFJA 4TMZA 3CCSB 1FFYA 3KT0A 3CB4A 1QRUA 4M53A 3ZC3A 4GU5A 4EF6A 1O0CA 1GZUA 5JBNA 1UMKA 1G7RA 3IH5A 4MWCA 1K92A 1KQPA 1ELOA 4YHBA 4RD6A 4Y9RA 1HA3A 4MYTA 1NZJA 3GUZA 3ELBA 2WQ7A 1G7TA 4F4HA 1WXHA 1QU3A 1J70A 1NUPA 2A84A 2EFGA 4B3XA 3LE8A 5KHAA 5AN9A 1B6TA 3HV0A 4I6EA 3ZBUA 1NUSA 2QTZA 4RD3A 1K4MA 3PNVA 1TTTA 1JGTA 1M8FA 5KWVA 2OTLB 1I6LA 4YBRA 2VTBA 4RD0A 1Q77A 1QGZA 2HCJB 4ZGQB 1F9AA 1YIDA 1HYBA 3P0JA 1TYAE 4XSVA 5LFAA 4G5FA 2BF4A 1Q15A 1H42A 4MW7A 3SDBA 3OZWA 1KP2A 4TMTA 2E89A 2DXIA 3S3TA 4E1AA 2EL7A 1N0UA 2OV4A 5J58A 3RJZA 1B23P 3X1JA 2HGZA 4MUIA 1EFVB 3HGMA 3CCUB 3IMGA 1KH3A 1A8PA 1M83A 4YAFA 1B2RA 1WDTA 4B44A 1VQ5B 1QVFB 2QTRA 4MW5A 3CVWA 1K9MD 2C77A 1EE1A 2GM3A 1GJRA 2J08A 2YWCA 5AHWA 4ZCLA 1MC1A 1N75A 3X1MA 1F7UA 1KK1A 1MJHA 1E64A 4MULA 4R2LA 1I7PA 4MQ6A 3L93A 1G59A 3ES9A 1OGIA 4YAWA 1GVHA 1LI5A 1XNGA 1MAUA 1TYDE 3HL4A 1VL2A 4PC2A 3Q12A 3U1VA 3AGQA 1EFPB 1KORA 4FK8A 2J4DA 3W2EA 2DR2A 1MB9A 1FRQA 3QFSA 1YITB 3AVVA 2FX3A 1EFUA 2D54A 3W2FA 1R6UA 2PIDA 3QFRA 1NUQA 5HUHA 1D2RA 3E20A 2YY5A 2WQ6A 3CC2B 3A04A 1TEZA 1CQXA 1KQSB 1U0BB 1N2BA 1IQRA 1JECA 3P0IA 4AS1A 5IJXA 1W87A 1JZQA 2R6HA 3CC7B 1KR2A 3QTBA 1COZA 4HE6A 1M8JA 3B78A 1FYDA 1QQTA 1U7DA 5H59A 2JA2A 4OJMX 1XNHA 1W2BB 4H3SA 2B5OA 4R0NA 3CLTC 2DPLA 2VYQA 1OB2A 3CLRD 3HFJA 3RK0A 4EG5A 4DQLA 3QTTA 1KK0A 3UC5A 1YHQB 3OZUA 4Q7JB 3MMPA 3AG6A 2PLFA 1N0VC 4MYUA 1VQKB 1FNMA 1WXFA 2QUIA 5DEOA 5FNZA 3TNJA 2PMDA 3PNBA 4ND7A 3ND5A 1JEDA 1S72B 4JXZA 3K32A 3CLUC 5LLTA 1TUIA 3SZGA 1DARA 2GKSA 1QGAA 3GLVA 1LW7A 4LBWA 2X3FA 3P52A 3Q10A 5EMNA 1PG0A 3N8HA 5H7XA 1FNDA 1DDGA 1KK3A 1VLHA 1N2OA 1YI8A 2PZBA 1KKUA 4NX2A 1KK2A 1Q81D 1VQPB 5BNZA 3V76A 1G8GA 2RD2A 4F3RA 1EFCA 3B8HA 2TS1A 1E63A 1ZJWA 4ZCTA 4EG4A 1YULA 1BX0A 1YIJB 2RE8A 4ZCPA 2YXNA 4IW3B 1EFPA 4MVYA 5KSWB 1FDRA 2E18A 2H29A 3CLRC 1N78A 3IVGA 1R5OA 1N8RD 2DY1A 4B43A 4TMWA 1WZ2A 1W35A 3ND6A 4NDAA 1JNYA 3ZJVA 1G8FA 1ZUNB 3E1YE 1J1ZA 1IJFA 5J59A 4MVWA 3COWA 1QJCA 1X8XA 2DEUA 1O96B 4WNYA 4TS1A 2RC5A 2JANA 2XEXA 3FY4A 3K9WA 3QSYA 3N05A 1F7VA 2C5SA 1VQ4B 1M8KA 4EH1A 4A91A 1YUNA 1OD6A 1IQUA 4N3GA 4B4DA 2YWGA 1D8TA 4J0QA 1EXDA 4P3YA 4K03A 1MOPA 2HZ7A 1JJ2B 4ZT5A 3IDFA 2X3UA 5H16A 2BGJA 1JIIA 4Y7CA 1F60A 1ZM4A 1YI2B 4HJXA 4CQNA 1JIJA 5JBQA 3CVVA 4LC0A 1X6VA 4PC1A 4MVXA 1O94C 1G7CA 1TVCA 2C78A 1QTQA 3G4SB 3IOBA 4G1BA 3IUEA 1MB2A 1NJID 1O5TA 4MW4A 3U2QA 3U6BA 2OTJB 2O8VA 2Z09A 3FIUA 3MXTA 1WJGA 2WSIA 4PBSA 4RPIA 1VQ8B 4TMVA 4TN1A 1KP3A 1R6TA 1GPMA 1T6ZA 3ILVA 4I6GA 2E1RA 4LBYA 3A05A 1N77A 3J81k 1NUUA 3OZVA 3W2IA 3KT8A 2QMUA 3MLBA 1YJWB 1VQ7B 5FO0A 1O97C 3CRZA 2QUKA 2BMWA 4RD4A 3ZZ0A 1CNEA 5THXA 4ACBA 1VQOB 4U9UA 4RCYA 4BPRA 1ZH0A 2VXOA 4CDMA 4DDHA 2QUHA 4MWBA 3VU8A 2J7KA 3CCJB 4ND6A 1DNPA 3VO1A 2BPOA 1TQ8A 4JZYA 1QFZA 3VGJA 1EXMA 1PFWA 4FZJA 4NZPA 4KKVA 4CDNA 2VNHA 4NAUA 3CCMB 1N2HA 4MUJA 1OWNA 3IVCA 3MCAA 5KCMA 2V0CA 2VZLA 3W2GA 1TLLA 4FWTA 2E21A 2BGIA 4Q16A 5TEVA 3JQQA 3RBAA 3ZXSA 4AQ7A 3WYAA 2QJTA 2XNJA 4QBTA 4MUFA 4MW0A 1I6MA
chains in the Genus database with same CATH superfamily
2O0MA 4IXNA 3Q98A 2Q4RA 2FE1A 4ZYWA 2Y4XA 5KVVA 2VJKA 3BILA 2BBSA 4KNYA 3PPIA 1M1KU 4BAUA 3G23A 1ZBJA 5F5LA 1FSFA 4BEBA 4ESEA 1RHMA 1G6KA 1GUFA 3TB6A 1XMIA 2L0AA 4HNQA 3I73A 3LL4A 3UB3A 1BMFD 4QHSA 5LZ8A 5AYFA 3LQFA 2DZDA 1N2GA 4OF4A 4E7KA 1IATA 3GMDA 4JITA 2YXLA 3PX2A 3QBYA 1NC3A 4H7HA 4ZFNA 5E8JA 2BZYA 3WAJA 2WAAA 4FFBA 4DGSA 2PR7A 1H3EA 1P61B 1N5KA 4QVCA 1SOVA 3IAXA 1S1CA 4ZV4A 1QHXA 2DFPA 4DM3A 3ANNA 1OT3A 1EE9A 3ZXXA 4I99A 3KPYA 2XE7A 1E6WA 4EJSC 2B99A 4AUEA 1EDDA 2COEA 4PFZA 4B6SA 2X6TA 3ETLA 3ORHA 4IIOA 3RFFA 1BU8A 1WP6A 3A0RB 3A6PC 2B3DA 4ND1A 5ECGC 3FMFA 1E0DA 1MVLA 3IKLA 4A4EA 2QTMA 5DHFA 2XUFA 4V0NA 4P5PA 1V7ZA 1DX9A 1DLJA 1FPQA 3FOCA 4C2AA 4JLMA 1OQAA 2PUHA 1N5LA 2GFUA 3M6IA 2WIBA 1L7XA 3LSYA 3ZR4B 2SHKA 2FG6C 3O74A 2B7CA 2PRIA 3TRKA 3CCMA 2RCNA 3F67A 4AFQC 3KBGA 3LXUX 1T6YA 1O6CA 4BRWA 4YUWA 3QV2A 5BMVA 3A6ZA 2TSYB 3ONFA 3G85A 2OENG 1RHQA 1JJFA 1D2CA 4EZIA 1VBMA 5K8VA 5EJ2A 5IZCC 2YXPX 5CM8B 3PGLA 4CEIA 2RNAA 5C7IO 2CZ6B 5EPEA 4XPIA 5A0GA 1T1EA 3I01M 5J5AA 1P5JA 4ARIA 3HM9A 1P4MA 2H4FA 1M6VA 1NBWB 1R37A 3TSWA 2PFSA 2NXWA 4MTLA 3ZDEA 2WD7A 3FXAA 2FZGA 4DY4A 2HRDA 3BB1A 2MINA 2OV8A 2AZDA 3ELBA 2C2BA 2ATIA 2HFJA 1AZTA 4JDPA 4BY9E 1BK2A 4Z4QA 1DTWB 4RDXA 4AZ3A 4P34A 5AYVA 1Z4OA 4UCQA 1WVGA 3HRKA 4Q19A 5KPJA 4DB4A 3SQWA 5LDDC 4QYMA 4TVRA 1LDBA 2H00A 3N7AA 1KE1A 3STYA 1EH5A 4LF7B 5G40A 2Q9AA 2WOOA 3ZE1B 1PYOA 3M9WA 1ANKA 4QLBA 2FZKB 1XMVA 3GGGA 2OT3B 3JYOA 4P98A 4GP9A 2R6FA 3ZE2B 4DBLE 3ZXUB 2MHCA 6REQA 2WIJA 4CL0A 4IINA 1Q82U 3QYJA 2VQSA 2GLUA 5E0KB 4PEVA 4WKGA 1E32A 2Z8XA 4AMZA 3H65A 2IF0A 4FYWA 3GRCA 5DXJA 4EKIA 3NWJA 4F3RA 2Z1NA 3SWNB 1KP9A 3VKHA 3NQ41 4NPHA 5TVKA 2MSLA 4UFOA 2X51A 3TQSA 1GFDA 2K4MA 5CG1A 3UV6A 1PHRA 3O91A 1M8KA 3ZDZB 1OZAA 5KI6A 3BHNA 1Q14A 3WYEA 3MJTA 2V74B 3VZSA 2AEEA 3G0IA 2AGVA 1PT5A 2O8VA 3T6KA 4TMVA 3BREA 1Q1ZA 2GCXA 2QQGA 1NPPA 2A59A 2WQ6A 2EYXA 3GFRA 2XJ4A 1YX2A 1WD5A 3BXPA 3A9TA 2ILVA 2GXUA 3PA8A 4TV9B 5AVSA 4GUAA 4G36A 4HNHA 1W2BS 4IVPA 4UHEA 1LCKA 3ZE0B 5BR8B 1TM3E 2BZXA 4XLTA 5BSYA 3PCRB 8MHTA 2CF6A 1AQJA 3JQ9C 2XAUA 5H9VA 2F43A 1GNSA 5CA1F 2N0SA 3RJMA 4U7DA 4Y2UA 3WRYA 4RS3A 4E7OA 3EPJA 3GIRA 4QA9A 5TRDA 2AD1A 1X6BA 2QAZA 3AY6A 2R8EA 3LGFA 4EEXA 4BX8A 2DT8A 4ZD6A 4M78G 1P72A 2A1TR 1GDDA 1VMIA 1GZ5A 2DMRA 1BHSA 1TZCA 4WKBA 3CBQA 2XLBA 5E1BA 1MGOA 1F2DA 4OSEA 5K0SA 4BDTA 2V03A 3EXIA 3X1DA 3VR1A 3ZZ1A 4AMYA 3I58A 4OHFA 4L5BA 5IC6A 2K5LA 2PH3A 1KI9A 4FCCA 3K8QA 4BZZA 4M7AB 1VPVA 3U4CA 1ORVA 5INTA 4WADA 5JO0A 5JXJA 4KH1A 3QBJA 1ZUNA 4CMGA 4PQYA 1IH8A 1XT6A 3DE5X 3BE3A 3GGJA 1X80B 1G5IA 4EARA 2EKOA 1Y89A 4Z4VA 1R0BA 3FCOA 1PRLC 5E7MA 2VSFA 3NR2A 3PDIB 5LYJF 1K6JA 2FPDA 5LZ4A 3FAKA 1ORHA 2WWGA 2ZRGA 1JHPA 3L4EA 4PNOA 3I1FA 1MDBA 1WL8A 3TLZA 2QQ5A 3R6TA 4AO6A 1DJOA 2WB2A 3ZGNA 3WGTA 3W6ZA 3HTXA 4X1OA 3GX1A 1K8AD 4EI7A 2XJ9A 4BNKA 2AN4A 3MM4A 3W8RA 3Q7EA 4EOGA 1PO7A 3G71Q 2X5NA 4GOOD 3B9QA 3SHQA 2QZ9A 1JXMA 3DTVB 4HEJA 4FR2A 3DAPA 4HAZA 2PX5A 2JLXA 4BVHA 1EHIA 4YUZA 1Z16A 4ZQIA 3DV0B 1Y0YA 4PQEA 1RAEA 2Q1XA 4XOPA 3I32A 1YASA 4Z8AA 4EYGA 4KXLA 5DNUA 3IO5A 5EP3A 3KHKA 1WETA 1LY1A 2PZLA 2E5FA 2D7DA 2YV4A 4M9XA 3N74A 4MV7A 1V6CA 1QCNA 1K7CA 1GFZA 3S68A 4ZO4A 4RV9A 3B48A 3U31A 1NDUA 4JL5A 1NBIA 4KUEA 4FZRA 2JAPA 4WXMA 2IBSA 1Q77A 2CCJA 3C74A 1D1AA 3BE4A 3THKA 3PFHA 3RO7A 1Q20A 3T1HB 5GAOm 3EBPA 3ASZA 2OXCA 3KPJA 2KE5A 3SAJA 3C45A 4KDFA 5BOSB 2BFFA 3LW7A 4K9DA 5G53C 1LNQA 1KAGA 2QZZA 3UH1A 1M8JA 3VR4D 4H3SA 4IQ4A 5HIIA 5EEHA 5EQFA 1XJWB 1UFOA 5K0LA 1JG4A 1IIRA 4C0XA 4RGQA 5DXFA 1XTKA 1V5FA 1HL7A 3D6HA 2WW8A 1RXWA 2QQEA 2IPLA 3ABSB 1X8LA 4HGNA 2CMHA 3E2MA 2RF0A 2QP3A 1HG0A 2ZAYA 4ENWA 2R6GA 4CKBA 4MUYA 2AZVA 2PUEA 1I4EB 4WNYA 1DIBA 4CNQA 1OMOA 3UHAA 4IIHA 4PPQA 2YHSA 2CNOA 5BV8A 2LJ0A 4CYMA 2CNKA 1HSQA 4FGSA 2CP7A 4K40A 4G65A 1U63A 1CZNA 1Z2DA 1NQUA 3OJLA 4KWHA 2C42A 5G0UA 3ZZ0A 2BHLA 2YJ5A 4P6YA 5ICEA 2M6LA 4BN5A 5JOQA 4DMKA 5IJWA 1CKBA 1QZXA 3S3NA 3S44A 3WRWA 1JHOA 1SIUA 4KFTA 4C6TB 4I4IA 1SKQA 4H17A 2C9CA 1XTUA 2D3NA 2GM4A 2FFRA 3NYRA 1JWBB 3NP7A 1O77A 4V1CI 4FGJA 4OQXA 5JAUA 1UPUA 4BLVA 3OTGA 2E4HA 4MCIA 1LUAA 2AKEA 4JLOA 1VA4A 1AVZC 4HVUA 2FXVA 1XE1A 1NIJA 3QHQA 3SF8A 3II6X 4EMKA 1C3OA 1S4QA 3LCJA 1SHFA 4LCBA 1H2ZA 3SIXA 4PZYA 1C9KA 1ZD8A 4EFDA 5BW8A 1U0OC 1FMTA 4NI5A 4GGOA 2ZW9A 5KYKA 3FPBA 1BD3A 2CXTA 3STUA 3PUYA 1S72A 1N2CA 3OTWA 3GVHA 5E6UA 1A71A 4JEHA 2PL1A 2BI4A 4UC0A 5D51S 2DLPA 4D5GA 2H7CA 2HRBA 3JB9F 3HXMA 2IU4A 1NW8A 3MJEA 3JASB 4PS1A 1M2VA 1CZLA 4MVJP 2O7NA 2YNMD 5CIYA 4O4LA 5DIFA 3A8JA 1W48A 7YASA 1FFSA 2OY0A 3THWA 3DB1A 5D3MB 2ZFUA 5E8RA 4NAVA 1RLJA 1KNQA 4HADA 4PAOA 1J1IA 5CA0F 4Z5XA 1A9ZA 4DNXA 3QBTA 4H9GA 4UEKA 4GQIA 2Q3FA 1BXRA 4JI2B 1VZ2A 4XPZA 2O52A 2EWMA 2RGRA 1THGA 3AVYA 3B5IA 4WOCA 3UJ6A 1ZOOA 4Q4DA 3E5NA 1K0SA 5ISMA 2P0AA 2E5LB 4KP7A 4R01A 2FPWA 1Q91A 1QU2A 1U3WA 3PYLA 4ELYC 2W8BB 2R8RA 1PKVA 4CF3A 1OAKA 4MKRA 1QMCA 3QVUA 1EA7A 5BSMA 5E1OA 4BPBA 4BQNA 2YUNA 1KF0A 1QS0B 4BVGA 4LX0A 4FU6A 1SCKA 2ZP1A 2ZQZA 3AOEA 3KB8A 4NONA 3FG9A 5CB4A 4E14A 2JG3A 3IQDB 3PGVA 3DAGA 4K0RA 3O8CA 4Z4FA 4P5EA 2IXBA 1RZVA 4Y1EA 1GZUA 4K9RA 4KQ2A 3D8HA 1SCAA 4D1YA 1AB5A 2XE8A 4BB5A 1QV7A 1YBHA 3A6HA 1MJNA 4W63A 3LH5A 3ERCA 1M8FA 1OPRA 2OTLB 3CW8X 4DR5B 2EQJA 4DA4A 2CVQA 2RFLA 1FMFA 1QP7A 3QENA 5JFTA 3TEJA 1IEQA 1RAGA 4LOIA 4PICA 4B44A 4C5GA 2ONKA 1NQTA 3IOYA 1BFKA 1THMA 2X8KA 3HXPA 5D86A 3EG5A 4I3GA 3FPGA 3I4FA 5T3UA 3UW3A 1DOAA 2J31A 1DXYA 2YRFA 3AXSA 1QKXA 1PV2A 2DYBA 2HUNA 3K9HA 3T7IA 1T2EA 2J4CA 4A7PA 2I22A 1FYDA 4OHPA 3RTCA 3GGPA 1ONNA 1S9HA 2FPPA 2YRDA 4EG0A 3DEJA 4DRYA 3T51B 3P2IA 3AVOA 4J0HA 2NZJA 5EZYF 2WPDA 3W90A 3NAQA 1UADA 1NNSA 3KLOA 1L8XA 3BKWA 2GETA 4WNAB 5I3ZA 4D41A 2IE8A 4EH1A 1KEVA 4HP8A 3AZOA 4TQGA 4RMJA 1TT5B 1Q1NA 4P7FA 4XUEA 3CM0A 1IOZA 4J83A 4P33A 1OJLA 3VH4A 3IOBA 4CM3A 1FMKA 5ESDA 2R68A 3GXBA 4WBXC 3Q6IA 4EIWA 1ISFA 3JQAA 4C3ZA 2N1BA 2C9DA 2Y0DA 2ZYRA 1Z47A 4KR3A 3H9NA 2H0QA 2CLMB 1DAOA 1OU8A 2VZ9A 4JZYA 1VXRA 2JJ1D 4Z7JA 4RL4A 2IU3A 4P25A 3OFND 3LG2A 1VLZA 2OXTA 3IVCA 4WZTA 4QEDA 2P67A 3H0HA 4JLVA 4Z8XA 3VC7A 1NXTA 3P9ZA 3BQMB 4QXQA 1R0CA 5JS7A 4NBWA 4KVAA 2OO3A 2EFIA 5ERYA 1KQOA 3U7FB 5F73A 3OT5A 1R6XA 4TZ0A 1L7AA 3W8NA 2DHDA 4WL0A 1MX5A 3EA4A 1AO3A 2V59A 1JEEA 3DT8A 4ME6A 3CCLB 2PZJA 2AIRB 3WGJA 4BNYA 2V6MA 3WL6A 4FFLA 3FFAA 5DISB 5JDCC 3A1VA 1SHKA 1YACA 1ZXXA 4XR6A 3HCBA 4H31A 2HIMA 3PD1A 1N7GA 5IAAA 4N9QA 2V9PA 3W9UA 1WULS 1RP7A 4GRAA 3I6ZA 1LBHA 2RHXA 4M78A 3KQKA 2POCA 4MUHA 5EWMB 2R2GA 5E2IA 3TOXA 3OUTA 2HWYA 3T41A 2PH5A 3NV7A 4LJSA 5KB3A 3BMCA 1W76A 3DDYA 2GGRA 4XYLA 5E9JA 2C5HA 3SQNA 3EEQA 2C00A 3IV9A 3NO4A 3WMEA 5EAIA 2OBFA 1W5AA 4ARAA 1T36A 1F2UA 2CFTA 4QUBA 3G71T 1L4NA 1HI9A 4F5YA 1TK9A 1YONA 4HDSA 4OX9Y 1W0CA 4ALKA 5EJ5A 3PF9A 5ALDA 4B6MA 1GUZA 1GSHA 3ZWVA 4TL9A 4UASA 4JJ7A 3RODA 4UEJA 3DONA 1GZSA 1CUGA 4R8RA 1B8VA 4CJXA 3L1AA 3O21A 1SIWA 4X90A 4AM8A 2I2FA 1ZSNA 3VR6H 2CBZA 5LN1A 5CKHA 4FT4A 1XYGA 3JQ7A 1NTOA 1FTSA 3KKLA 1NSFA 5BNIA 2DWCA 2E82A 1IM8A 1U0HC 4A26A 2F8MA 2OYSA 4U9HS 2I2DA 3ONDA 3PQFA 1RZUA 2Z0MA 4O4IA 3W5CA 1U11A 1MAVA 3ZIUA 1EHCA 1GYQA 1JP7A 4ZYUA 1V9SA 1QGED 3CH7A 4J6WA 3FYSA 2PZKA 4HRVA 4DQDA 3ZBDA 5IM4F 1GQYA 3R5TA 3H17A 1NFFA 3C7TA 3R7AA 1ZCJA 3S8YA 1DVRA 3UA3A 3BF8A 1HJDA 4IIYA 3QEJA 2GEVA 4C20A 5EE5B 2F59A 3UJBA 3F47A 1ELOA 2HL6A 5LKAA 2C0PA 2C9OA 3RRYA 5TX7A 4YDQA 1SY7A 1QKJA 4XORA 5JISA 1F9AA 4DNFA 1T9BA 1Z56C 4LGMA 1SOAA 2FQYA 5YASA 3TO5A 1GSIA 4G9EA 4OGKA 3I5UA 4EM6A 1IZ7A 3CUTA 2O2GA 5ILGA 3F4LA 3DBHA 4KXVA 4H18A 4XKJA 2GK3A 2POQX 2IQ5A 2AMLA 2I4TA 2G5TA 2VNAA 4FBMA 1L3IA 4FINA 3E8SA 1A5AB 3TAUA 4Q12A 1WU8A 3A9UA 5B12A 3W05A 1BFUA 4QASA 1U0BB 2H5EA 4AURA 1M6EX 1COZA 4N48A 5CK9A 2XYRA 2R60A 4M6WB 3GEEA 3JQBA 3HSKA 3BVPA 3IOMA 5FWYA 4KLZA 2PLFA 3PIOA 4OB0B 1TMOA 1F9EA 3Q2IA 1MF7A 5IJ9A 1VG8A 4KMSA 3AEUB 4IF4A 1J0AA 3N2GA 4H1VA 4PL6A 1KOGA 1MX9A 4R3WA 2Q0XA 2O31A 1ZW1A 2RK4A 2VLBA 4UFNA 2PSSA 4BO4A 1G7CA 2AN3A 1DEHA 1YQDA 4G1BA 4X1IA 1ACMB 1FP4B 5CVUA 3NIWA 3RG8A 4KU4A 4D26A 3GLGE 1RWKA 2QMYA 5I9NA 3A3OA 4L27A 3MW8A 1K6EA 4QBFA 4E6PA 5IDWA 1MPXA 3KPVA 4YCLA 4JUFA 4WZLA 4LGCA 3EAEA 2X22A 1DP4A 1U5BA 2OXIA 2YS6A 5HS6A 1YR9A 4GPEA 4ZI5A 2D00A 3WSTA 5I7OA 1TOAA 2GCOA 1ZL0A 3MUOA 1Y3AA 2VJNA 1U31A 1V8ZA 2Z2ZA 1TM5E 4PZDA 3GRZA 2CVFA 5AKKA 3ZVMA 3CSSA 1HYQA 4B47A 4D57A 4W9NC 3WRXA 1Q92A 2L3RA 1SB8A 1KO8A 2B7BA 3STVA 1VQ9B 4CIDA 2LJ3A 1CR1A 2ZBDA 2QW0X 2R4TA 3HY4A 1M1YA 3M54A 3O03A 1CF9A 3O8OB 1H93A 4U5XA 1U0LA 5ED0A 3HB0A 1V0FA 2DECA 1C0IA 4JROA 1Q17A 4FGKA 5KCZA 3OWOA 3T5CA 1YFLA 1C7RA 1MO4A 3DH0A 3G5AA 4WBNF 2HAEA 3R7BA 1TTPB 4P93A 1Z06A 3VR5H 1XJ0A 4B3MB 1MV0B 3W06A 3AEXA 3CCEA 4CDRA 5IUJC 3QEOA 3TK1A 4ZCIA 2RHJA 4R16A 4NJMB 2QTHA 4QXAA 3HR7A 4CQMB 4PWZA 3NHAA 4M86A 3ESZA 3RNOA 4REQA 2JAHA 3O3NB 1O96A 4ZGWA 3ESDA 4BO9A 3EH2A 2FQWA 1KVSA 3VC2A 1C4WA 3HP7A 2J5KA 3OT1A 4CT0A 4EWLA 3O93A 2FSGA 3C94A 3BK2A 3CXCA 1J22A 3W04A 4KJXA 2LWIA 4NNJA 3K35A 1U2RA 4M3NA 3HN6A 3Q6NA 4DLXA 2HK7A 4AW9A 4HEQA 2FUKA 2JJ2A 4FJ0A 3JR7A 1HQDA 3HDGA 2HOQA 4V0OA 1DS6A 1QQ5A 1VIMA 4G89A 1O95D 3QXCA 1XRQA 2EX4A 3S5UA 1EJ2A 1JR6A 4KH0A 1A7KA 3FYUA 5JBIA 3P0HA 3U9LA 2EDAA 1W49A 5D3ZA 1NURA 3S99A 4D99A 3G7ZA 1EBBA 4QREA 3ZZMA 3PD0A 2HQOA 3Q9NA 4PFSA 2PUBA 5ENVA 4X7BA 4N7BA 3EPHA 4XN3A 2GM5A 2G25A 3T9FA 5GONB 4C8QF 3VR2D 2IYYA 2PVGB 1IN7A 1BE6A 2NP6A 3L6BA 2HLPA 4K3UA 2D5IA 3NRBA 2X58A 5FYDA 3TTVA 2WG1A 1DB3A 4O2AB 3DGFC 3A3GA 3EWIA 1NOJA 4ZCMA 3L46A 3P9XA 2FVYA 3G9ZA 4U2CA 2AOUB 2YUPA 1IIBA 2QSJA 4OMFG 4PSUA 5LD2B 2ID9A 2WWHA 3FDZA 3CESA 4FEAA 3SE0A 1LVHA 2P91A 3ZBUA 1WXBA 4U39A 4A1OA 1IZZA 4GE3A 3LBIA 2VUTA 5ELMA 2WYUA 3EVAA 4S1VA 4NE9A 3WAKA 3PZRA 1WCYA 4HVTA 4QYXA 1C50A 3HWX1 2FEIA 5DHUA 1WDTA 4RVUA 3VBCA 5JANA 4LGYA 2GJPA 2BI8A 3NE5B 1Q74A 3KO8A 5GPBA 3HR8A 4NOYA 4TLLB 4N49A 4TLDA 5KVAA 2JUFA 2HU5A 1IOVA 3EZGA 3DQQA 3JCMJ 4JLIA 3P9SA 1EE2A 3HCCA 3VMMA 2EERA 3I76A 3TTSA 1OZ0A 2Q3CA 3PLNA 2IU0A 3AK4A 2O4XA 4EA7A 3RVQA 1S2MA 4LRTB 1B7TA 2P2LA 5IYNA 4CEJA 5ESXA 5ER9A 4UHDA 4GMKA 4MDWA 3NB0A 5KSWB 4D3YA 4DR6B 4GPD1 1NT2A 4YRKA 1GBRA 1X9HA 4E09A 3OJEA 421PA 2W5UA 3MP1A 1S6YA 1V8DA 3W5SA 3PTZA 1EB8A 3C6MA 1FTNA 5H82A 2XMFA 1CRZA 1JEQA 4PZUA 3QPDA 1DMSA 2NXJA 4MGKR 3TLCA 4I6GA 2F2VA 3RU7A 1T4CB 1EFAA 1LC0A 3FCSB 4IMIB 4K6KA 4NYJR 2IH2A 5ILQA 1YRQA 4JYCA 1HOXA 3FHTA 1U3VA 2VDNB 1FP6A 1GA6A 2OHIA 3W78A 1GCUA 2ZBEA 1PS0A 4WWVA 3ZGOA 4Q16A 2CP5A 2REXB 2EF0A 2OPBA 2QTAA 2QTLA 4N3AA 5G3YA 2G4CA 5IBCA 1SZPA 2JIBA 5IYZA 4X91A 3N3AC 1N7HA 2GEJA 4HDNB 2WSSD 2QLNA 3PRKE 3AI1A 2BCJQ 1CY6A 1Z5OA 5JXHA 4DDWA 1M90C 4Y92A 3ZHRA 2Y4OA 4WVFA 3WNDA 3CCVB 1NZDA 1NRIA 3LBNA 1RMTA 4XJSA 3AF2A 5A2QA 2F48A 1JU4A 3ASSA 3CCQB 3OIYA 5K03A 1TA9A 4TT3D 4RCZA 1KAHA 2R5FA 2ASVA 4HYTA 3ZHSA 1R0LA 3PITA 1QVFP 1ABQA 4UXHA 2BGKA 1PNVA 4A0HA 3PYMA 2BT4A 3UXEA 1X7GA 4MX8A 1R64A 5JJIA 4JGGA 5LJLA 4F5EA 2JFHA 1P5FA 1LDGA 2Q8PA 4V39A 3W5HA 1WUHS 1WVIA 3PVZA 3IPRA 3OQNA 2DKOA 1EP1B 2X7JA 5AUNB 1PG2A 4JY7A 2FDXA 2XDQA 1NULA 3QXSA 4FWBA 2JJMA 3IQXA 3OSUA 3HYSA 3R76A 3C1AA 3I37X 2HJWA 3OX1A 3W2TA 4WN3A 4FN5A 4FJ2A 2WWVD 4Q3NA 4TV9F 4M4SA 3GLGB 5JPIA 1D9XA 4HNGA 1ZG3A 2GFQA 4C5EA 1YJCA 2W4QA 5E6SA 3RIRA 4M75G 1KTVA 4GX2A 3TL3A 2IV7A 4DCSA 2Q5OA 4QPDA 5LQSA 2C4MA 5ARCA 5FOXA 3T1VA 1N5OX 4RFLA 1ZX6A 5BVHB 4RH0A 2O2EA 4LQDA 2Z2KA 3HN2A 4E5VA 2W42A 5ALGA 3F49S 3NALA 2XVMA 2GF7A 5DNCA 4F5WA 1FFHA 1WHLA 1EUQA 1PDWA 1MNAA 3THXB 2QPLA 1BW9B 1F4LA 4I4LA 4HBZA 1ZSZC 1AG9A 1B76A 2FG0A 5BW5A 2XCQA 3U4MA 1QP4A 3WMRA 4R1UA 1GCAA 1E4VA 5BYKA 1U1FA 1DGQA 3RJ9A 5F23A 3PHBE 1HEIA 4QGBA 4YEDA 3E3MA 1U1CA 2ZU0C 4LDQA 4O1IA 5TIIA 3QXXA 2RHBA 2AOTA 5ICGA 2FZCA 3DF7A 5JYCA 4M7AF 4DANA 2OECA 3KKPA 1JWAB 3M3PA 2BF4A 4LC1A 4YB8A 3FM9A 1L5SA 2BKAA 2L89A 3WQZA 3MJCA 3ZWYA 4KB5A 4CTNA 4YLYA 3A28A 2EGAA 4L07A 4G0QA 1VL2A 3WIBA 3HABA 2BP7B 1P0PA 3EPPA 4OVKA 4EL5A 2CHFA 3S6WA 3AKYA 3RERA 1R15A 4ECAA 1Y3IA 4MPJA 5C8YF 3DDUA 3A26A 1Q0RA 2WP8J 1GWNA 1K88A 4HDKB 1G41A 1UUFA 4E7IA 3CBPA 2QPTA 3RS8A 4U6NA 4GX0A 1MHTA 5TGZA 4LXCA 5TQJA 1KI6B 4L59A 4PGMA 1KK2A 3TGPA 1M27C 3N2NA 4TWZA 3HC7A 3WGGA 2ZANA 2XHCA 3FX2A 1NA5A 1YBAA 1VQ4B 5B36A 1RZRA 4L5CA 1B8OA 5H16A 4YRQA 3KQHA 2C2XA 1AQLA 3DXXA 3NEJA 3PQ4A 4NP6A 5B57C 1H2YA 4TYYA 1E9VA 5T4HA 3IR5A 4GD3Q 3KOWA 3CWCA 1EM6A 4ZXFA 3FUTA 1X8KA 3DTVD 4HVAA 2RJEA 1Z18A 4P4TA 1MX3A 3WB2A 2IC5A 2EG9A 3D8NA 5AW7A 1PQYA 2VJDA 2BGIA 3KL4A 1YA8A 5CDTA 2N47A 3V8LA 4UM7A 5I9TA 5A03A 5BN5A 3IERA 3SR3A 2WU0A 3QW2A 1N1DA 2RGGA 2OO7A 4WZAB 1CPYA 2MR6A 5BQOA 5JH7F 3KR1A 3E53A 3AI7A 3M57A 4JGIA 3RYTC 1ZINA 3G8AA 4OATA 4HT8A 4YPFA 5G1OA 3DQZA 3UMVA 3D7SB 1PJ6A 5AMXA 2AW5A 3DZIA 4LHWA 4EBFA 4D4KA 1XD2B 4R1LA 3W6UA 2O8EA 1NE8A 4RO0A 4OI4A 3M4YA 1VLJA 5KNCA 3G0BA 3QZ5B 4B3FX 1Y5MA 3LUCA 5BRNA 1ULTA 3F6CA 2QEXA 2PQ6A 4EA6A 4ZREA 5F98A 1ZZGA 3OKPA 4LJYA 3HXLA 2B98A 2C88A 5BMOA 1ZN8A 3IPCA 5IHNA 4FQ5A 5GANf 3H5TA 3AF4A 2BM9A 4X63A 3IQZA 1BE8A 1Z34A 5KE2A 3L40A 1NM7A 2CGHA 2AHOA 3R0QA 1M7HA 1YI2A 4WXYB 1QG4A 4MS1A 3OLCX 2C8KA 4YJFB 3WLHA 1D1PA 1ORDA 4E3WA 5ITZB 1TO1E 4JVOA 2DH5A 3M33A 3Q3AA 8LDHA 1JJ2P 3BBPA 4TSFD 4M77F 1DG3A 4FW8A 3L1JA 3EEFA 4J7XA 4FTWA 3OQ5A 5DBOA 2GBPA 2NPOA 3ITNA 3ZX4A 3L8ZA 5FW9A 3FB9A 3V4PB 1KFBB 4X1KB 2C2KA 3M8KA 2FMXA 5FYQA 4XASA 3CKLA 3I61A 3F90A 3HG7A 3TW8A 2VUIB 5JXIA 4INOA 3VSDA 1D4FA 4R05A 2OGUA 3M9QA 4CNBA 2YVUA 1H85A 4FGUA 1ZBXA 4UUOA 2VP2A 4E7PA 3M5AA 5A9SB 4KKTA 3KT3A 5JJBA 3DDWA 3B1YA 1NAHA 1VSQA 1I0ZA 2JI9A 1D3BA 1KQPA 4WJKB 1P92A 3LM8A 1KMNA 1JR2A 4Q7LA 4UMFA 2ZXUA 3IQFA 3K05A 2VK4A 1T3HA 2K3YA 3NORA 2FKNA 5JNSA 2VJJA 1Y81A 3D3QA 3NDRA 4RPGA 6AT1B 3TNFA 3AR3A 2G7ZA 1AWWA 3PFBA 4FGLA 1B1CA 4EPWA 4P4SA 2OE2A 2P9JA 3CC4Q 3BXZA 4AIIA 5DM4A 4MULA 2F3RA 2A9JA 1E3MA 4TWIA 2ONZA 3U16A 5DHPA 3DXYA 5J2TA 2D54A 1E1RA 2YZMA 3E20A 4QUHA 4FFVA 1CKEA 1ZMBA 2JOYA 2C1EA 2H16A 3PEFA 3KAQA 3VU8A 2D8MA 4UMVA 3PBKA 3FRIA 4KFCA 5EMJA 1IO6A 2WAOA 2O3RA 3ZY5A 1PJ4A 3HJBA 3ZD8A 1RYBA 3QNUA 2GPAA 3R09A 1G3MA 3OIVA 1DDGA 1VLOA 3HDHA 3GQBA 1V3VA 1W0KD 2OAUA 3K70C 4FGWA 1D1CA 5T7BA 5EKXA 4NARA 5IT9E 1K89A 2E18A 3R7NA 3DE0X 3S3MA 2X2EA 1ZD1A 2Q3EA 3Q5DA 4ZVRA 3L4KA 2I62A 2UZ1A 3DVAA 3RS4A 3WWCA 5LU9A 5HKOA 3PI7A 1KO7A 2X3UA 5EIXA 2QV0A 3RUPA 2L42A 2C78A 2DQSA 2XICA 4J29A 4KQKA 5JUWA 3LWZA 3VXKA 3OW2P 4MA5A 3TJZA 1THZA 4TLMB 2JHAA 3WKEA 3URKA 4BV3A 3UUWA 2ZB4A 3GZTB 1JHUA 3MP6A 2GJ4A 2BY4A 4DV0B 2C04A 1LS1A 4IFIA 2JVVA 1GGNA 1A9QA 2IEGA 1UBFA 4NCXA 2O20A 2JGEA 2IYZA 3V1UA 2XGMA 3P9IA 3WYAA 3EUFA 4HDOB 1NHWA 5ADHA 1YTLA 4DHWA 2OC4A 2JFPA 1QVGB 3AFGA 1G6Q1 2JHPA 3PL5A 3GLIA 2O5RA 1JDNA 3OP4A 4C6SA 5AVRA 3MT8A 2FP4B 5MFZA 1QKIA 4O0MA 1NMEA 3QE0A 2IOHA 1QFXA 2JIZD 3K16A 4L5IA 1SC3A 1KC8C 3SXJA 3P96A 4UQOA 4I8XA 1GADO 3FMPB 2NUPB 2PMWB 1QHNA 1XVUA 3W79A 1MR3F 3LUAA 1UF9A 3HFOA 1X1EA 2Z5VA 4DNTB 2C2GA 1RQGA 5B5SA 4OBWA 2W4MA 1FVOA 3GSIA 1WXDA 1HT0A 5JCJA 5EGNA 5FUVA 1EAMA 1IBLB 2OBYA 3B82A 3TTXA 2PLWA 2WP0A 2IU6A 3U3MA 1LSOA 1P73A 1Z28A 4A10A 4PLZA 1H8ED 5I7SA 4JJ4A 3T56B 2DL4A 1B42A 5EKUA 1XEXA 1UTIA 4F93B 1LNXA 2IP2A 1NB0A 1NMYA 3BGIA 1DWPA 3QKRA 1Z3IX 3BL5A 1MT0A 1KYIA 2HDHA 4IGIA 5I6DA 3INYA 3KCNA 1BCRB 3KNZA 2BEWA 5TF0A 3QLTA 1B34B 3E19A 4ZMBA 1DFHA 5ALVA 3SE7A 4ZARA 1PFVA 2MSDB 4N0PA 3ZLVA 4J3JA 1SD1A 5HSGA 1Z0ZA 1W4ZA 1VQ6B 1T1GA 3A6DA 3QEAZ 3O5ZA 1A76A 3P9NA 2CD7A 4CL2A 3MWEB 3RVOA 3OP1A 1VQ8A 3W5UA 3HI6A 3HJTA 2AMFA 1H2WA 2WNIA 2AYYA 3G0OA 1XHLA 2Q1YA 4I36A 2V3VA 4X20A 3O1IC 4X7EA 1IHDA 1LCIA 5JMOA 4M75A 5DLEA 1QV9A 4WZZA 4UEQA 5J5VA 1N32B 1JT9A 1RRPA 1DIAA 2SEMA 4XWAA 5CLJA 4FYYA 1TC2A 2YDYA 4OQMA 1AUVA 2WSYB 2LNHB 2P9YA 1R16A 2EDCA 2JBHA 1CRLA 3NZEA 1E3WB 3GRKA 4Y2QA 3QH4A 1LBIA 3VZBA 3PX3A 3SHTA 4ZOQI 1KXJA 1N36B 1K8AR 4MDYA 2P4UA 2Y6VA 2OHXA 3OI7A 2UVQA 2FRDA 1U98A 1V8PA 4RX1A 3I55Q 3ZHTA 4GBGA 5G0TA 1ZK4A 3HBNA 1TTTA 1JGTA 4HUTA 2EARA 1T5DX 4YBRA 3DM9B 3T5BA 5JW6A 2E4UA 2F2TA 5BXYA 1HF3A 3ROMA 3QO3A 4EAAA 4YMSA 2EGUA 2J87A 4OEHA 2JGAA 3T95A 5EFOA 4LHSA 4IO0A 1F7UA 5BQXA 2IIVA 2RGAA 1XP8A 3UAYA 3HXTA 2VJIA 2ZYIA 3WHLA 1OV6A 1GKKA 1C9YA 3NWOA 4BOYA 3I9JA 3IJRA 1W87A 1JZQA 3GFVA 2MU1A 3B1XA 3G9UA 4ETNA 4J0KA 2X9NA 2ZIXB 1D2AA 4GKAA 3PNPA 2GBCA 1R0SA 5CAEB 1FFCA 1DXOA 4GVLA 1ECLA 2ZPFB 3CPFA 3K0KA 2V6FA 4IIFA 1UBEA 3KD2A 4P38A 3AL2A 2NU8A 1ODJA 3FCYA 3CCUQ 1P1FA 2E4ZA 2PGIA 5PGMA 4M37A 3K2EA 3G5LA 2ZZFA 2L0XA 2N75A 4LXYA 1YH3A 3G4SB 3R6WA 3VHLB 5FI1B 4LBYA 1XZFA 2XCRB 3VI4B 3CRZA 1X94A 1ZRHA 4XM3A 5CJ2A 5GANg 2L19A 5HUQA 1XUOA 2YMQA 1EQUA 4XVUA 4H6WA 4CDGA 4GRDA 2QQSA 4RC9A 3TEMA 4JEUA 2HB6A 3JQQA 4XTCS 1ZDMA 2HKQB 2ZRBA 4JI4B 3JV7A 5FOVA 4FB5A 4CM4A 5J35A 2J9FB 2K9GA 1DJ7B 1SUCA 1TCCA 4ZT6A 1Z26A 1BBZA 5C1DA 3LGSA 3L6CA 3DHYA 3BZWA 3PXEA 4IH1A 4E5YA 4AS2A 4M1QA 4YRFA 4DK0A 4PZEA 1UBOS 3EIFA 1UINA 1SC6A 3OQMA 1FL9A 4JMLA 3IMEA 4ZKEA 3DXZA 2AK5A 1OYXA 1HE8B 5D87A 1AQNA 3D7LA 3O4VA 4BKPA 4BXOA 4LCJA 5U1PA 3I9QA 2ZPHB 2GTPA 2XOKA 4V0LA 3KRTA 5EHGA 4JPBW 1IM5A 5H1YA 2PXXA 3F73A 1YHQA 4W5QA 2RBEA 4AG5A 4F6RB 3HCDA 5TMPA 2XSZA 2QRJA 3VC3A 2P75A 1Y98A 4PLVA 3MCUA 4EGAA 5D84A 3L04A 1TZKA 3LUBA 4FSXA 4XVHA 1KPHA 2G72A 5FRMA 3VKWA 3E9RA 3R7DA 3WK6A 3CV3A 5CH5A 4K8OA 5A0VA 4QX6A 2PG3A 2W22A 3CQTA 5K0NA 4NL4H 4P3PA 3ZVLA 1WOPA 4C5IA 1E2NA 1J00A 1JQEA 4DDTA 4JELA 2NZXA 3MSCA 3VNRA 1SVKA 2WIAA 4FNGA 3RWMB 2O01E 1WZIA 1JHRA 3TZEA 4E32A 1VQNB 1KZHA 3CVXA 1VQMQ 4XQCA 1T0HA 1NVMB 4IG9A 4OD0A 3L43A 1D0VA 1HYHA 2BMJA 1EGAA 3K5PA 1SA0A 1UWVA 1JHYA 3GV0A 1QC5A 3AUFA 3H4IA 2WF8A 2WM8A 4ZMRA 3LC7O 4AL4A 4M83A 2XTMA 1VL1A 3GJ7A 1QCFA 1KRWA 3EGUA 5LL6P 5AM1A 1YJNB 2B35A 4B5KA 2J33A 3M5PA 3CC4T 3JQGA 3WJ1A 4B09A 3OZTA 2R1TB 4MZPA 1U2GA 3LPLA 1P7PA 4BB7A 4ESOA 2FAXA 5FNVF 4Z0NA 4G4JA 4KPGA 3IUMA 1Y0RA 3SLKA 2QR3A 1NVVQ 1IPHA 4HQFA 4J0CA 1WXHA 1B6TA 3M56A 3C3WA 3PHGA 5C35A 5AJWA 5BVGA 1YI1A 4GZLA 4TMTA 4FEEA 3L4BA 3CVOA 4Q1VA 5CPBA 4MW5A 3JZMA 1YRLA 3JWJA 3AYXB 4DRZA 2WF6A 5JALA 2RKWA 1FRQA 5F77A 4KI7A 3HMKA 4UEWA 5HUHA 1D2RA 1VG0B 4RLHA 4G24A 3OYCA 4MJ7A 5T4FA 3TOVA 1CKAA 4KODA 4Z9FA 3BSYA 1NMXA 4EK9A 4LK2A 4CQMD 2C97A 1Q0QA 1K9VF 4R4JA 2JGNA 3GJRA 2HSDA 4C06A 4ID9A 2CS7A 4GGPA 1AKRA 1X7XA 3Q2KA 1YVPA 2I54A 2YV3A 4MQMA 9MHTA 3NCHA 4YONB 4ER0A 1EYZA 1BYUA 3H13A 4C87A 4CFSA 1T3LA 4F8YA 5J4LA 3DT6A 4OXKA 3H5OA 1RP1A 3ZY2A 3NXKA 3PGGA 2RMKA 3M6MD 5CEFA 5KQPA 3WKCA 4PQRA 5KQLA 5HP4A 3EEOA 3UAWA 1UB4A 4IDGA 2OOKA 2DPMA 4Y2GA 2Y92A 4IILA 1TJPB 1FJGB 4YJDA 3BGSA 1EGHA 2F7SA 4UQPA 3FOWA 4YC7A 1EFRA 4TSKA 4HQOA 3TLMA 2BMWA 1J0BA 1IPEA 4JT2A 1DNPA 2VJMB 2UUCB 4DQUA 4PPFA 3ZLBA 3NEAA 5CX4A 4S1WA 3SLRA 1RWWA 5BSHA 1NBEB 2L3QA 3ANLA 3EPKA 1GAQA 4UU7A 4DA0A 3HNPA 2WA1A 3OLYA 1TECE 4TXMA 2OGZA 3H6KA 3WICA 4V1CA 2PUVA 4QHTA 2ZWPA 2R9VA 4MRMB 3PKJA 3D6VA 5JS8A 3V3TA 4B9XA 1JQ3A 4HY3A 3WGVA 3QOYA 3R6KA 3L07A 1OB5A 1FDVA 1V7PC 1KI1A 4KIGA 5C5IA 3CNNA 3G2QA 4OP3A 1J9EA 1SHLA 4LQCA 2BV3A 3EXAA 1GFIA 4MGHA 3V8VA 4ZGEB 2FPGB 5C46F 3LUPA 3BK1A 1JKXA 1NDHA 1EX6A 3OQJA 5AICA 3U5ZB 4D9JA 2P4QA 1RXVA 3CNBA 3MGAA 2EJCA 3CB2A 5IFLA 2NXCA 4R8KA 1RKUA 2FZLA 3D4BA 3VH2A 1DG9A 4HAWA 4B7XA 3ORYA 2OILA 2WINI 5DNDA 5FTJA 1VJ1A 2EEPA 1RWMA 1TE2A 3WFIA 4WBSA 4KDRA 1I2CA 4WESA 5DSTA 5IN1A 4AG3A 1CYDA 3H99A 4RE6A 2CV0A 2AA3A 5AVTA 3W6PA 4Y2SA 1QQ7A 4RMNA 1KDPA 2FR8A 3T9NA 3VNVA 4DGQA 4B9WA 4MDFA 3Q3CA 1V1CA 3UMRA 3A9SA 2JTFA 1I5OB 2QGGA 4RM0A 4PGOA 1V8FA 2G9UA 4F9EA 2BIFA 4S0ZA 4QT4A 2NVBA 4ALIA 5EE1A 4NFLA 1B74A 1LVUA 5HF8A 3VPDA 2H6EA 4KAJA 4TQ9A 4M1EA 4FCWA 2AX4A 5HYVA 3DA8A 3I55T 1D2GA 1XB2A 3IEMA 5A5EA 2W6ID 4BZWA 1CQZA 1FMVA 5ADVA 1BQ3A 2E4AA 3D4NA 2LUOA 3WOVA 1CVLA 1JPUA 4G6ZA 4OMNA 3NAZA 9ATCA 3T4PA 1EESA 3IB3A 3I5RA 4G8CA 4DEYA 4XIIA 2Y0CA 3D3KA 3PUNA 2DY0A 1S3FA 3D31A 2E49A 4YQZA 5LXTA 1GCOA 1H6AA 5HQ3A 3V8PA 4Z3KA 1VQLB 4LQLA 2GQ0A 1JVBA 2QE6A 3A4NA 1YRWA 1OSNA 1XZGA 3NTIA 1UMKA 4EY8A 1WKCA 1QOPB 2ZCJA 2YFYA 1NAIA 2J59A 4M1MA 5BRAA 4TL6A 1OVMA 3BJIC 2E6ZA 2PGLA 1K6IA 2QA4A 1OLXB 4GO1A 1YIDA 3QX3A 4XDYA 4NBLA 3REQB 4DHEA 2JGKA 3LT4A 5JLJA 5JVDB 1T24A 1UDWA 1HRDA 3CCUT 1RXSA 4J7IA 2HA5A 1E59A 5IAYA 4D02A 1GY8A 5C0OE 1ZUYA 2GHQA 1IVYA 1WX1A 1OHHD 1HORA 1H05A 2WVHA 4IHJA 4MAMA 3GLKA 1P7YA 3LUHA 2W2VA 5EYPB 4CMBA 2GHRA 5DVZA 1C14A 4W1SA 2DVEA 1DJMA 1ES9A 1BVUA 2OZEA 2VYFA 3LP5A 1K73U 3IFSA 1SO8A 4WECA 1V1MA 5GP1A 1UDXA 2C58A 2NXNA 2C82A 3CLRC 4KBFA 4KEAA 2AH5A 3A3BA 3FNGA 4G4IA 5JI2E 2CXQA 3MBIA 2JVIA 4TS1A 5K0FA 1OU9A 2DFVA 3IR7A 1PZXA 4WKCA 4FYIA 1NC1A 3R0VA 3BFMA 3PHJA 4DJDC 1YQTA 2YUTA 2FRWA 3MMNA 3ME9A 3HCFA 2AUNA 4A4HA 5GAMe 2I7TA 1IM2A 2XI4A 5TGDA 1B0UA 2HIHA 3HN7A 3D54D 3QEKA 2ESRA 4AXXA 2XKJE 1ZOLA 3LXMA 1Q2UA 1XLTC 4K05A 4UUAA 3VGJA 1K8RA 4IEFB 3V8MA 3PTLA 3LLVA 1L7DA 5E6RA 4DL9A 3BH6A 2R25B 3ZWDA 4A5SA 2M16A 3ZI7A 2WIGA 3AUTA 3OH8A 3ZGXA 3VTKA 4XUCA 1T0BA 2J9XB 1EFTA 4RSHA 2Q5CA 2FV8A 2GQFA 3SJ7A 1I33A 2O9JA 3I3SR 4DPKA 1G5VA 5GAN6 5K51A 1REQA 1DBSA 4YFYA 1IZ6A 5HOEA 1MJFA 3KZXA 1J2JA 3N5CA 2CUKA 5JY6A 3LJKA 2ERXA 1BS1A 1NPDA 4RZUA 3S2EA 2A1IA 3C4VA 4UBKA 4QU0A 2DOKA 3CCJQ 2KDSA 1V5EA 3FI0A 4I9UA 3S2FA 1PQWA 4ZVOA 1CRWG 1T6XA 2WHEA 1KS2A 1KI7A 4FYKA 1YJ9A 2Q2OA 1S8FA 1K63A 4OMQA 1WMBA 4GPZA 4MMZB 3WBKA 2G08A 4C43A 5CFQA 2OOSA 1T9CA 1VQMT 3A8IA 2ZJOA 4GNRA 3QG5A 1FZQA 1RTKA 2DBVO 1W6XA 4RJIA 5BWOA 1UJ0A 1EPUA 1XMXA 3P1JA 4HQNA 3VYWA 2LTOA 1VC2A 3CPJB 4UEOA 3VPGA 2LRQA 2WICA 2Z3VA 5IEBA 4YMWA 1P1CA 2CC2A 2AHJB 2ZK7A 2QQAA 1FFGA 1YR3A 2ZBUA 5FI0B 1UBUS 3KBOA 3RUCA 1QH0A 2PD3A 2Y4NA 2VWQA 4WXRA 2IX9A 5EPOA 5A4AA 4IMJB 4YRLA 2AZXA 3LRXA 3SQOA 2VCHA 1L5FA 3AF0A 1RJFA 1F2VA 2JDID 4NWIA 4B82A 1T4BA 3I1IA 2ROLA 1CJTC 3KTOA 1XZBA 1XRPA 13PKA 1SIOA 2B9EA 3Q6RA 2XUAA 3HDYA 1ODIA 4UMDA 2BGUA 3KDAA 3QOXA 3AV0B 2V31A 1IC6A 4JJGA 2PTHA 3J80A 2B1JA 3V8QA 3LDFA 2ZRCA 3RW9A 3DD1A 4JZKA 3TFWA 1OZGA 4PYQA 3QE4A 1NVUQ 3IS3A 2AMVA 3L8GA 1I80A 3KQPA 1VGQA 2J9RA 3IAUA 1Y1KE 4QRDA 2G6TA 2AQ8A 1CUWA 1EQ2A 1DOHA 1U7HA 1HURA 4L8FA 1QLJA 3P0RA 4ENRA 5LJ5g 1T9GS 5GANj 3VVMA 4JKOA 3SD7A 3VAZA 5KNDA 1X42A 4J2HA 2OPHA 1P8AA 1Q16A 1OX4B 1ZESA 3BW1A 3TREA 3C7DB 4F9GA 4XAXB 1SCUB 4NENA 1P77A 1GG5A 2EYWA 4CM8B 2QTZA 1EWRA 3USES 3GARA 3HZZA 4PG5A 1E0JA 3JCMV 1HZEA 4JAVC 4PK4A 4NC9A 3U3RA 4HAUA 2OV4A 4G1MB 4JNCA 2YOHA 1ESNA 2Q2WA 5KSOA 3HK2A 1GPWB 2XF8A 1LZLA 3F4KA 5FR1A 3A5ZB 2QDLA 4PJNA 4OB2B 1MUZA 5FWNA 3A04A 1W44A 1WDLA 4TWBA 1JU3A 2L69A 8AT1A 4C92C 2A9PA 3L7DA 4IDHA 3RTEA 1XN1A 3M53A 4UBIA 3CD6A 3QVMA 1QGAA 5BNFA 4D4GA 3QPCA 2WDZA 4YJ3A 5KC8A 4XTUA 1E92A 3I56A 1B93A 1NXQA 5M29A 3DYVA 2QXFA 3DAHA 2GXSA 2H29A 1KHTA 3EN0A 1RAIB 2EHJA 1R9JA 1UEIA 3LZ6A 3EDRA 1PWZA 4BUCA 3NHRA 1UGSB 5GANd 3KEMA 3ORSA 4ZZ3A 3C95A 1W2HA 3N8IA 3B3FA 4RETA 4PBSA 5DHRA 2NSHA 2DFKB 2RKBA 1YP5A 1LJ8A 4BDYA 3AUSA 3G8BA 4N0EA 1P18A 2G28A 5KCMA 1OI3A 2RSLA 4DAOA 1RCUA 3OU6A 2LVBA 4XGKA 4AQ7A 2CL6X 1E9SA 2EGGA 2XWBF 2H07A 3T15A 1TI7A 4ZO9A 1GGKA 1ZM3A 2HA3A 2BUBA 1PBNA 2Q99A 2ZSIA 3H8WA 4J2TA 5K4AA 4HGQA 4Q47A 3R6JA 5LQUA 4D6XA 3ZUGA 2G5CA 1R50A 4O08A 3WJ2A 4GL4A 1CUSA 1Y8ZA 4G8DA 3IUQA 1KDZA 2R00A 2A0KA 1M33A 4R69A 3KTAB 1MAHA 3SKVA 4F45A 2XADA 2VP0A 1RAAB 2PUKB 5B2FA 1QVAA 3OQ6A 1YXMA 3I8SA 1HT1E 1AC5A 2FPKA 3G2KA 4WX2B 4W4TA 1OC4A 2ZUEA 1CUUA 3O31A 4JK3A 2HA6A 4MR9A 3BY2A 1R7RA 1GAXA 4AMVA 5BT9A 2EW1A 1VRWA 5CKDA 1Y3DE 1UBLS 4PAQA 5ALWA 4BC1A 2ZIUB 4MP3A 3OCZA 4O0LA 4NBUA 1S4MA 4OMOA 5JAOA 1NB9A 4LDXA 1NUHA 3PPYA 1NMZA 4PYNA 3GPDG 3GRAA 3SKYA 2XXAA 1DCTA 1QOQB 1IN6A 5DI3A 1I4LD 1VL0A 3GROA 2BM8A 2QLMA 4I1OA 4GG1A 4AKIA 4K9QA 1J1UA 4F72A 2C4WA 1AHHA 2H4ZA 5BN3A 3L82B 2ZZDA 2OL4A 3IBSA 1ISIA 1CE8A 4E4TA 2XZDA 5C2JB 3CBMA 2LBPA 2BYTA 1OW3B 1GQOA 3ZY3A 3ZI4A 3K5HA 4FP9A 4CEIB 1ACJA 1E1KA 2C4TA 5BSRA 4XPIB 4PCVA 1PJ7A 3A98A 3N87A 2C57A 1DIGA 3DMRA 2Z98A 4K9MA 4QUJA 1U4SA 4Z9XA 2JFXA 2QVZX 1Y63A 3WB0A 4AG2C 4QFMA 4WZBA 4RK4A 4PTLA 2FZGB 4D74A 3VOBA 2MINB 5CMLA 5TV2A 5K01A 3IAM6 4UM9B 3ND7A 1N2SA 4NCHA 3GBQA 4JI0B 1PLLA 5LP6C 4AZ3B 4PVCA 4Q93A 2EOAA 2Y71A 2ERYA 1UT8A 2ZUFA 4R1PA 3PTAA 2BJVA 2FW8A 4CKCB 4P86A 2CMDA 1Y7TA 4GDMA 1OAOA 4HYYA 1T1SA 3CEHA 5IJAA 3RB8A 4NV0A 1O0CA 1SKBA 2MWOA 2P2SA 3TUIC 1OH6A 3ZWKA 4E21A 4O4JA 4V38A 2WMNB 1Y8CA 1TM1E 1QHYA 3HV0A 1W8IA 2VP5A 4QSMA 5IXJA 1UKCA 5AJUA 4D9IA 3E0QA 1NQWA 1DKQA 2DXIA 4OMLA 4WZKA 2CHVA 5EY5B 1BTOA 5HIAA 4C0BA 5EKSA 4FYWB 4C07A 2IV3A 4EB6A 4YCBA 4LNHA 1FDOA 2DZ9A 1NXXA 3JWGA 1DCKA 1VKRA 2FE4A 1IBKB 2NO7A 5HIKA 4JXJA 4CLXA 1FSPA 1GNLA 3IXMA 3ULKA 3IE1A 2GXQA 4PZ0A 1C3XA 1PVVA 3CLTC 3K9FC 3HFGA 4QKQA 4EG5A 3SX4A 4B3HA 2I4NA 3V7WA 2OQRA 1NOKA 1B3QA 5C18A 4GVXA 3NI2A 3L4JA 5KOJB 4B9EA 4RELA 1XL1A 4EGCB 3IAS6 2Z6BD 2ZIGA 1XVAA 4EW6A 5HFJA 4MS3B 1FS4A 4B71A 1FW8A 5FORA 1ZI6A 4IEEA 1XZLA 4EPXA 4P12A 4BAZA 4D0RA 4TS3A 3QWFA 3OMCA 1HDZA 1ULBA 1X8XA 3RS5A 3LUJA 1W1UA 4M78D 2ZVJA 4IJUA 3AZQA 4R2XA 1GUYA 1PT8A 1B07A 5BV1A 1L1EA 4KWCA 4MMLA 5DM60 5K0BA 2V1RA 2K79A 1F6DA 1W19A 3WYCA 1FY2A 1R6TA 4TN1A 1KP3A 5FLYA 1RBZA 4IRMA 4RHFA 2ZQYA 2F43B 4DDHA 2QQFA 3E7XA 3CCJT 2UVPB 1OBOA 2GCPA 4DW8A 1ULAA 1KE2A 4P08A 4CLEA 4DSUA 3O94A 4MUFA 2FL7A 1CSEE 4AULA 4NL3A 3EGVA 4HUQA 1FYWA 4GM4A 3NTKA 1U8FO 4CMAA 5IF9A 4BO0A 1DSSG 1Z4PX 4LSGA 2NQTA 5EZQA 3ZBPA 1D6SA 3O26A 4MKGA 4UAVA 2FW1A 2I1QA 2BM0A 1I0CA 3OYIA 3MJ4A 4PBRA 1L5HA 1WLYA 3HKBA 3IT0A 3TLAA 5I11A 3UVEA 2R0QC 1G98A 4DT1A 4EG8A 4MAAA 2YSQA 2JCXA 4JV5B 3HVJA 1IRXA 5DK4A 2A3RA 4A6DA 4XWKA 4S1OA 1HG1A 3GAZA 2I2BA 1ZIOA 3IESA 3G05A 4J8PA 2CLLB 4EYSA 1M3CA 1KD1C 1RRCA 4UZEA 4RZ3A 2EFHB 4UNNA 4LJAA 4BX2A 2HW8A 3CRW1 1QH1A 2F9FA 4YIKA 1E7RA 2GK4A 1UJYA 1AGXA 2QJOA 4XU0A 4HGYA 3A06A 2QK4A 4UE2A 1OH7A 2P78A 2AFIA 2GF0A 4OPMA 1BC5A 3LCCA 3UWDA 3QHAA 5A62A 1M30A 5C4GB 1L4MA 5AI0A 3FMGA 1I1NA 3IEKA 4OUDA 4IJWA 2RIRA 4TKVA 1K3TA 4M54A 3TSOA 3HVRA 3LW8A 4HNAA 3QYHB 3U4DA 5TT0A 3CF6R 2RH9B 1H6CA 2LP4Y 4JQCA 3SMQA 4B0OA 3EUEA 2NSYA 2QIOA 1UPAA 3E3NA 3T9AA 4KC0A 3R1IA 3ETGA 3EODA 1Q83A 2VH5R 2FWRA 5CPFA 2Z04A 1HKHA 1VCHA 2VJBA 4FC7A 2V45A 3IQIX 3MEQA 2EFYA 1YNZA 1LI4A 4BVLA 1A7UA 4RJKA 1Z5WA 3DSRA 3DMDA 1G3QA 2QZ4A 3DXFA 5DCUA 2IEYA 1BB9A 1VKJA 2Q7OE 1NVFA 2AZSA 3AEYA 5IAKA 4X07A 2FXIA 2SKCA 1KC3A 5M5BA 1EFKA 2R79A 4QFBA 1R0YA 5CT4A 1AIPA 1N8TA 2WIDA 2NTNA 3PVQA 2DEQA 2ZI6A 1JG3A 2EG5A 2OCIA 1Q0HA 1AO0A 3WI7A 5G0WA 5ALJA 2KSSA 1BJKA 4JP5A 2OGTA 1NLFA 1DG1G 2PWYA 4HZIA 2YHBA 3EWAA 1ZITA 2BFFB 3KT0A 4B33A 1NW7A 3BEOA 1O1YA 3L77A 2EW2A 2BE7A 4UHHA 1QU3A 4M9RA 3ORQA 4RORA 5C37A 5LUAA 2BHSA 4HQKA 2VAXA 4M78E 2PWAA 4MW7A 1B8PA 1P6XA 3O6VA 3WQSB 2H7VA 3MGBA 2LCSA 3FR8A 1LRLA 1ADFA 5ITWA 2GPWA 3OPYB 4URZR 4D25A 3K72B 4YAJA 4GXNA 3W34A 4WGGA 1TLTA 2ZPAA 4BBJA 1GXSA 1XAIA 3AVVA 2JAOA 4JLSA 2WUDA 2C2HA 4CKBB 1C80A 1YO6A 1P9LA 4AJ9A 1OXVA 1V5WA 3AIOA 3ZD7A 1C29B 3B78A 5IXFA 3T3GA 3VDXA 2BFOA 1A7AA 4ZOEA 2QUIA 5ICMA 4L28A 2VDMB 1VQ5A 5IN4A 2XMZA 1SGWA 5UKDA 1M0WA 4TTPA 3H16A 2P2GA 3PDCA 3B89A 1UBRS 1KMCA 4AIRA 2EQMA 1J1ZA 1WFWA 2D6FA 2CDNA 2ODQA 3G7NA 3K8ZA 4X6LA 1ISPA 4QJ5A 3Q9SA 1OVGA 3OZSA 3CKMA 3AHUA 4MHTA 3IUEA 1A97A 3CC2Q 5IK2D 4QTTB 2FW6A 3QMPA 2QMUA 5FD8A 2EQKA 1G2IA 1UDAA 2QUHA 1MOSA 4YV7A 5A02A 1F06A 3R6GA 3MCAA 5C4IA 4X84A 4FWTA 1P45A 3VYTB 3H3FA 1SHJA 1H8HA 2XDBA 3SF8B 5EIAA 4EMKB 2CN1A 3U49A 2W4IA 2Z6AA 3CWQA 4JUIA 3QLUA 4BATA 3FRHA 3GFSA 1BX1A 2DJZA 3CFYA 5J4YA 4LNUA 2C5EA 3B6ZA 4AJOA 2JJ2D 2O6LA 2Q28A 4OFXA 5IVPA 3OLWA 4PABA 3R20A 4X5OA 3KHTA 5C3UA 3PQCA 2E0IA 2ZAIA 3EFRA 2W9XA 5SV2A 2E4VA 5DIZA 5BORA 4ZC8A 4MQLA 5GMKl 4GWKA 1Y6JA 4Z0HO 5LJ5j 2ATEA 3GY0A 2CBXA 2JW4A 1RFLA 2RI1A 3WR5A 1LC3A 5F33A 2J5BA 5CLGA 1G8AA 1P4SA 4XQ3A 1MNQA 2FVUA 1SVOA 3AB8A 3GRVA 3ZDAA 3WLKX 4IRUB 4LDVA 2VHTA 2AB0A 4M1TA 1XD9A 4O4LB 1ZJJA 1X2BA 3CC7A 4YRJA 3SM3A 2DUNA 4C7XA 1OU0A 4H1TA 5CXSA 1ZLYA 3THWB 1UCFA 1YDHA 2N3ZA 1E2IA 3C15C 2G6FX 4B3SB 1XNJA 1KFEB 1OROA 3HJNA 4B80A 1SB9A 5KS2A 5JD6A 4QYTA 1QYDA 2J3EA 5PNTA 3MWLA 2F3UA 4CHGA 5DKFA 3GJQA 2NW6A 1Y42X 4H0NA 1U3UA 2X9HA 3CCRA 1DC3A 3RIXA 2PZFA 4UDOA 5H3LA 5HUJA 3ZTTA 2IITA 4EUFA 1SD5A 4ZCSA 2CK3D 2VBSA 1WZNA 4AMUA 2IUUA 4BE4A 1V4VA 2BMDA 1NXWA 4FSSA 5JCPA 1X1SA 3MTBA 5IEJA 1ZJ4A 3IHLA 1V11A 4G8JA 3KZNA 2LKDA 3OHPA 4IMPA 2XE4A 4N8DA 1PR4A 2E64A 5E3JA 2EIXA 2QN8A 4J1QA 1AHJB 1FSGA 1OLUA 1M5Q1 2ISCA 5LJ5d 3CZ5A 3FSGA 4L9AA 1DRUA 4XTRA 5E4YA 4TRRA 1L7MA 4Y1GA 1JG1A 2GXAA 1B3RA 4LXHA 1V47A 3E7FA 2QBYB 3KOUA 1NSTA 2FRYA 1G8YA 4XDGA 4ZPXA 4W8OA 2BKDN 3DW3X 4K1LA 4EG3A 3C7AA 4K86A 3I0NA 4A0SA 1N2IA 1Y6GA 1O4VA 5JLAA 1QO9A 2PL5A 2HBYA 2K3XA 3ADPA 2R1VA 1WABA 5ALUA 4HB4A 4JBWA 4AI6A 2ZJ1A 4NY1A 3UXMA 3P0JA 2BFCA 5DE3A 3OJCA 1XAHA 3ZHBA 1UUEA 2FPPB 1I8FA 4WY2A 1B23P 3S8MA 2VHZA 1C7IA 1RL2A 4FLEA 1GUDA 1H1DA 2DTDA 3HPRA 3SGLA 5A6SA 3HFNA 4PONA 2GTHA 3R77A 3CZRA 4XM2A 4OL0A 4KLRA 4M55A 3GHYA 1RPZA 5ESWA 4L7QA 2LTAA 1G55A 4ZANA 4I46A 3GGDA 5DLPA 3U40A 4OU4A 3GF4A 3ZHQA 5FU6B 3F6PA 3PK0A 3RQIA 4DQLA 3C6QA 4TV8A 2ILTA 1NWCA 2AJBA 4XN0A 1FFWA 2P9EA 4Q4LA 1UJ5A 2OZVA 2ST1A 5F7XA 2JMAA 4YLEA 3HYTA 2FEKA 4QNRA 3DEFA 2QTBA 2RK2A 1OPXA 1G8GA 1R9MA 1YQXA 2XNDD 4BQQA 4GX1A 3CHYA 4JS4A 3EGXB 3ET4A 4HT9A 4GZMA 2NU6B 3K1AB 3IL2A 5HRUA 3RF7A 3DQPA 2JCBA 3V4LA 2UZAA 1XQYA 3WLQA 4HCJA 4RGBA 3DV9A 1PWEA 4HSEA 2ORED 3ANXA 3WWYA 2INGX 3OA0A 2XMGA 3FMOB 1MLDA 3A6FA 3IDAA 3W5JA 4PO8A 4HN2A 5THXA 3SIWA 3GYBA 1M2HA 4BO2A 4JJEA 3HJRA 1NPYA 1D2NA 1Z5PA 3CEMA 3OIUA 3W8FA 1WRBA 4JFRA 1EFDN 1G5PA 2P7IA 2F3SA 4MW0A 1WAMA 2QX7A 4URHA 4ZVSA 1MB4A 4BGDA 1ETHA 4NQZA 2DIGA 4YMIA 2JI7A 2W6JA 3MHTA 1H4VB 3WZMA 2EF1A 2Y67A 4IOMA 1YS6A 4J76A 2W2LD 4M78B 4KT0E 3SZMA 4JQYA 1HZZC 2LT1A 1BAPA 2ODEA 4L4XA 3DVLA 2WSFE 1K5DA 4M2LA 2WYHA 3QXHA 3BMCB 3ISJA 3OJXA 3SEMA 1T5IA 3NETA 3AWDA 2CP6A 3E48A 1T36B 1F2UB 2PQ2A 4LBVA 3ZPXA 2Q5QA 3HLTA 3IT2A 2HK6A 1L4EA 4QVJA 1JBEA 3RC2A 3AB7A 2Y1WA 2QRGA 3D6MA 3DWFA 1KAQA 2WSBA 3A1SA 4LF6B 2GD6A 4TSRA 2UXBB 2BM1A 1E8NA 2UYHA 4CC3A 1AKYA 1OBHA 1M76A 1OIVA 1J07A 3I42A 2D3TA 1CQWA 3IDQA 4KUIA 5FWXA 2GCGA 2GYUA 3OZCA 1E5XA 3M6AA 4LWQA 2KHZA 1G8KA 3KSMA 4OF1A 4C78A 4BYGA 4GC9A 3VJLA 2RK6A 1DAPA 1ZH6A 1IJEA 4QNMA 1UKBA 4ZZ2A 1MV3A 5A89A 1PD0A 5IN5A 5ESRA 4EB3A 3PXCX 1U8TA 3O2SB 2PFKA 3QVJA 2JN9A 4E5PA 1F17A 4NPAA 2JJQA 1RM0A 1EFHA 4Y2XA 2V7QA 5JYDA 2YL2A 5IFKA 1RWBA 2ACEA 1EHYA 3TXXA 3D1JA 4EGSA 4GKBA 4QVDA 5JSYA 3CPWS 3V4OA 1PZNA 3UV7A 5ES3A 2JJ8A 4UPEA 3RGGA 1V6AA 5A3VA 1UQTA 1J8FA 3O9VA 1K8XB 4FU0A 2V6IA 3UK6A 2DETA 1YGYA 5ETJA 5A5GA 3EVNA 3DBIA 1B43A 3QVWA 1YGPA 3SSMA 3PVSA 4LFCB 4B83A 9ABPA 2Q4OA 1NI3A 4LGVA 3DBHB 4LY6A 4QVGA 5A0FA 5A2QE 2VDUE 3KBBA 3BQNB 4HX2A 1SFRA 3A10A 5JAMA 3A8LB 3AF6A 2EZUA 2ZJ5A 3QKSA 2HI0A 3VUFA 5F78A 5DHQA 2AG8A 5C0MA 3PHLA 5MN6A 2IUSA 3FNBA 4CC4B 4P81A 3UF4A 1EVIA 4ZGQB 1RXUA 1JG6A 1WZEA 1Z4MA 5FWYB 3EOAI 4NCAA 4BV8A 4DLBA 2MK5A 4CTOA 3UK1A 2ZL7A 1SG6A 2PJDA 2NP7A 3OEHA 2P5SA 4GPBA 2PD4A 4DTCA 1Q2XA 4QJIA 2V7VA 3N2GB 1QIMA 3H75A 1Y5RA 2YQ4A 4XARA 1M1GA 1KQSB 3LTNC 2X41A 2PTGA 3SU8A 3CC2T 2JIRA 5GAN4 1J39A 5H59A 5IARA 3MTJA 2B1RA 2ZBVA 4E07A 2O2DA 1FFDA 4LAFA 5ECYA 4MGIR 3LC1O 5BWCA 4OOVA 1YUBA 4CI0C 4A8TA 4ZCPA 5CFRA 4MCHA 1WZ2A 4BE9A 3S3OA 1UIMA 1KZYC 4YI3A 1UWKA 1HDXA 5GAOl 4QW2A 5KNCD 2MCNA 4N4IA 1DEOA 3BCUA 5B1YA 3I35A 2K5FA 1YITQ 3I62A 4PJOC 4PFOA 1X2EA 1TYZA 4B31A 1DAMA 3OX4A 2K6GA 3AW8A 3FJ1A 5AW5A 3QU5A 1PR5A 1TD1A 4ARZB 1L5NA 4R81A 5KVCA 4U9IS 4DLWA 1HLDA 2ZULA 2LZ0A 2RK3A 5KC9A 2VBIA 4QTYA 2PKWA 5TEVA 1WDWB 5JI3E 1YIJQ 3P8DA 3U4HA 4KZPA 4OLBA 2QWXA 3SEJA 2QG9B 3ZWBA 3GUUA 1LNSA 3KVYA 1M74A 3SN6A 3VSAA 2PJUA 4G1UC 3T5PA 4UATA 3A8MB 5L95A 1QIFA 3CCEB 3R3UA 4XM0A 3GEMA 2NXEA 1XDWA 4R98A 4ZICA 4XR9A 5AVXA 2QLLA 3ETNA 4Y0VA 2XMRA 1TM4E 1JAHA 4XDZA 4AFSC 4HL6A 5GAMh 3IVXA 3RVDA 2REQB 1PF7E 4G41A 2QTVA 1ZHIA 4NCNA 2COZA 3QUAA 2I2WA 1W2BA 4B74A 5LLSA 3CXCB 5ALOA 2PNJA 1HNNA 3NIFB 3JQ8A 3PNYA 2DD4A 2PVSA 4Z7OB 1YJ8A 3AYZB 3D5TA 2I0FA 1EUDB 4LCEA 3ZX5A 3D7RA 2VA9A 5FPTA 3MWYW 4J9UE 4Q4CA 3DOFA 4OQLA 4BX9A 3OCCA 3FYUB 4MHSA 1YRHA 4YWHA 4TKUB 2KY9A 4LE9A 4Z9YA 4KFUA 1DJLA 3QKUA 2EBPA 4EI2A 4HR7A 4B6PA 4GLJA 1TJ4A 5ALEA 4F12A 3HWSA 4M7DC 2IUTA 2MYUA 5EFZA 1TF7A 3REAB 3HYCA 4MZTA 5DTRA 1KNXA 3K9GA 4ARBA 1Y80A 3D3EA 3ZDXB 2CLIB 3PC8C 4PS0A 2CLKB 1ZK0A 1ZLMA 3L8FA 3S1AA 1PSWA 1ISMA 1T1IA 1K97A 2ZM5A 1QWEA 3K6JA 3KETA 2ZUUA 3QPHA 1CY8A 4ZI3A 3FDZB 4LRSB 4OSPA 5L4SA 1CUAA 1XZQA 2O0KA 2NV4A 3D2AA 3TL2A 5DGXA 1SBYA 1Y4SA 3G2LA 4LZPA 2DBYA 1Z0UA 3G0GA 3KLNA 3HGQA 3HMQA 4M8NE 5GONF 2IWRA 5LJ5f 3R8XA 1W5FA 2HO4A 1Q81C 1ISGA 3GPLA 1YSCA 4S1NA 4BE1A 2J67A 1LPOA 2Q6OA 3RT1A 4JI8B 3W7VA 4O2AF 2HLNA 1Z3CA 2UXCB 2BD0A 5CM9C 1DADA 5C51B 1R0KA 4MYHA 5DY9A 3CMCO 3AETA 2C83A 1J7JA 5L3RA 2YYSA 2FMFA 4KXFB 4PX5A 2EYUA 2VT2A 1YCYA 1M90U 2R3SA 5CX1B 1N0UA 1A3CA 3QE9Y 4C0DC 2WZDA 1H69A 2EP8A 1MQSA 2DXBA 1ZMOA 4DSZA 1E77A 2GM3A 4LYHA 4C4TA 5AM5A 1IWOA 1XEFA 4DWOA 2UKDA 1DEKA 1N57A 3OQIB 3EZ9A 3WKDA 3UGKA 5A7HA 2Q8NA 2G04A 4Q39A 2EBUA 2G0AA 5AKXA 1VIFA 2VV5A 3UICA 3OW7A 1MC5A 4YECA 1SU4A 3RNLA 3SQLA 1VQKB 1LB1B 2PMKA 1JEQB 2AC7A 4XGQA 3ZTWA 2GFAA 2VRBA 4HFNA 1PS8A 3QVXA <