2DEUA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
364
structure length
364
Chain Sequence
b'AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
total genus 85
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2deuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2deuA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2deuA01
1YIJB 3OP1A 3CVYA 1PFYA 2J09A 3HFJA 1FYDA 4C43A 1TYCA 2GQFA 2DCUA 4G5FA 1I2DA 3C8ZA 1QRTA 3LVBA 1M83A 1N75A 1W2BB 2OTLB 3CCVB 2QJFA 3PENA 1VQNB 1MOPA 3QTTA 3GMIA 3AVWA 2HMAA 1H1TA 2QTZA 3FWKA 4K0RA 4ZGNB 5FO0A 1G59A 3H9CA 2WSIA 4YAWA 4LBYA 1WXEA 3HZRA 2H2AA 3S3TA 3CC7B 2ZUFA 2YWEA 1IJFA 1QGYA 3CCQB 1ULHA 4ND7A 4NATA 4Q93A 1MB9A 4EG6A 4EGAA 2VNHA 1JHDA 1YJ9B 1QNFA 3U2QA 3FJOA 1U2RA 4RJLA 1OWPA 2QJTA 2OV4A 4H9GA 3COWA 5JBQA 4PY2A 3MHPA 1OD6A 4QFMA 3CW2A 3AFHA 2VZLA 2BF4A 4OJMX 1QUEA 4YAUA 1F4LA 1J9ZA 4F7DA 3CC4B 1EJ2A 1J20A 2XEXA 1DARA 2DERA 1QFYA 4MW1A 5FNZA 1PFWA 2YWHA 4B3XA 1GTRA 3CLTD 4MUEA 1IH8A 3MMPA 3G6EB 4NAUA 1T6YA 1I6KA 4JFAA 4FZJA 3CXCB 4P3YA 1PG0A 1YI8A 2QJOA 3CLRC 1O5TA 1VQKB 3FETA 3IDFA 3VU8A 1NURA 4P2BA 4MW7A 1S4MA 1YJWB 4Y9UA 1J1UA 3AG5A 2WQ7A 1TYBE 1OGIA 3G71B 4MWEA 1K73D 3W2GA 4DDMA 4B4DA 4KPUB 1KAMA 4PC6A 1NJID 1M8PA 1NSYA 1Q19A 2CYCA 1PG2A 4TS1A 1ZM3A 1M8FA 1X8XA 3MXTA 1OGJA 3CVUA 4EG8A 3INNA 3AIIA 1XE1A 4TMTA 5HXBA 3ZXSA 2B7BA 1VBKA 4ZT3A 3U6BA 4XFJA 1TQ8A 3P26A 1P7PA 1IJEA 1WXIA 1X6VA 4EG4A 1IRXA 1FNCA 3ZZ0A 1KR2A 1JA1A 4YP5A 3ZC3A 1IQRA 1R6XA 1YULA 3ND5A 4MLPA 4Y7CA 4Q7JB 1QVGB 2RC6A 2PMDA 3WNDA 1KP3A 1NP7A 1XNHA 3CCRB 1G8FA 1DDGA 4MYTA 3FOCA 3CC2B 2J07A 4YHBA 3CCLB 4AF6A 1O96B 1EE1A 1JB9A 2QN6A 4WQMA 2CYBA 3W2IA 3WY9A 2D54A 4PC7A 3QFCA 1EP2B 2O8VA 5J58A 3A4IA 1MBZA 5JBNA 2RD2A 3P27A 2VNKA 1M8JA 1U7DA 2J4DA 3P0JA 1D8TA 1SM4A 3WNCA 1Q11A 4NZPA 4ZCTA 4EH1A 4EG5A 4KR6A 3CVWA 3AVTA 1S0UA 1W34A 1EFVB 2A7XA 4NX2A 5TEWA 1KK0A 4ZCMA 4KKVA 3KT6A 3VGJA 4F4HA 4C0SA 3HMQA 4MW0A 2GPJA 5LM3A 1Q82D 1VL2A 1BX0A 2XRYA 1SKQA 3MLBA 3ELBA 1FDRA 4MW6A 3RHSA 4G6ZA 4OUDB 4PC1A 3UY4A 3OJXA 4YALA 3E20A 3FI0A 3H99A 1N1DA 1O95D 4B43A 4ZCSA 1Q86D 1GPMA 1XJQA 1OWMA 3IMEA 2TS1A 3CCMB 3Q4GA 1BJKA 2VYQA 3OZVA 4KPUA 5EKDA 3VRHA 4AQ7A 1QRSA 1N0UA 1I6LA 1GO2A 4GU5A 4E1AA 2DXIA 4NAHA 1R6UA 1NUTA 3W2EA 1Q81D 1YITB 2HCJB 2QTNA 1VQLB 4UZFA 1MB2A 3RJZA 1CQXA 3ZZUA 2BM1A 3U1VA 1EP1B 4G1BA 1JA0A 2YWGA 2EFGA 1WXFA 3IVGA 1F7VA 1GJRA 1N3LA 3Q12A 3TZLA 3JQRA 1YJNB 4HJXA 3IOEA 1TUIA 3FPKA 4YP7A 3E1YE 4LBVA 4JXZA 3TZEA 4TMVA 1OWNA 3FDXA 3VMFA 5AN9A 1MJHA 1QQTA 4N3NA 3G4SB 3MLAA 3AG6A 3AVYA 1EP3B 2BGJA 1RQGA 3AGPA 2Z09A 3IMCA 1VBMA 5DK4A 1O96A 2NZ2A 4DJAA 1EUQA 1TYDE 1DG1G 4KR9A 3HGMA 4PC2A 4ZT5A 1PFVA 1E64A 4H3SA 3I1FA 2X3FA 4RD1A 1B6TA 4HPWA 2BSAA 5GV8A 1M90D 3RK1A 4BWVA 2WQ6A 1EFVA 1V8FA 1ILEA 3G6KA 3ND6A 4XFDA 1WJGA 2GM3A 3FG9A 1ZUNB 4ZT2A 1KH2A 5DASA 2C77A 1KK3A 2RC5A 5KCMA 3W2FA 2D74A 4M53A 1IHOA 3IH5A 3KT3A 1M1KD 4MUJA 4X0EA 5KHAA 1GR1A 3CPWB 5TR9A 3G59A 3J81k 3COZA 4R0NA 3VNVA 4MUHA 1KAQA 2EJCA 2H29A 3LE8A 2E0IA 1JEEA 4MULA 4ZCLA 2EL7A 3RBAA 4B48A 1O94D 5DB4A 3JQQA 1U3CA 5H59A 3VO1A 2C78A 3HV0A 2OQ2A 2QUHA 1NUPA 1VQ4B 3E27A 3DV2A 3ZZTA 4R2LA 3CCJB 3CMAB 1MAWA 2CYAA 3MMXA 5K0SA 1JZSA 2E18A 3COYA 2VNIA 1Q77A 3AVUA 2J08A 2X1LA 1AMOA 3Q10A 1O0CA 4G5YA 4IW3B 1OBCA 4TMXA 4ZCPA 3PNBA 1F7UA 1K4MA 1JZQA 1H85A 1MRZA 1N77A 3ZJVA 1G8GA 2WB2A 1IQ0A 1OB5A 1U3DA 3I56B 3PNYA 1GAWA 4G5GA 3CLUD 3CVVA 4RD6A 3ZJUA 1N0VC 1YUMA 4LBZA 1GTSA 1KQNA 5TV2A 1QFZA 4RUKA 5J59A 1LW7A 1NZJA 4L2IB 3ZIUA 1QH0A 1K92A 3I05A 1NDHA 2CFOA 3W5UA 1ELOA 1KD1D 1COZA 1R5BA 1FNDA 2IJGX 1ZM2A 4MYUA 2VXOA 3ZBUA 4G1VA 3OZWA 3UC5A 1R5NA 1OWLA 3SYTA 3IOCA 4P6VF 3PRHA 2BYTA 1F20A 1YIAA 2E21A 2G36A 2AZXA 1GAXA 1ZUNA 1KP2A 2VTBB 4EFKA 4QRDA 1DNPA 2DEUA 2PIAA 4CDNA 2QEXB 3MUEA 1E62A 4ZCIA 4J75A 4MVCA 4XSVA 2HGZA 1O97C 2XRZA 4M2LA 2D5BA 3QTBA 1N2GA 1H3FA 4K1XA 2QUIA 4HK4A 2QDXA 4ZT4A 4RCYA 4RD0A 3N9IA 5KSWB 4PBSA 2Z08A 5F23A 1JEDA 1N78A 1EFPB 4DDKA 3OW2B 1D1NA 4ARCA 2JAXA 1YI2B 1QJCA 3KFLA 1KORA 1WDTA 2J7KA 1VQ9B 3L92A 3OTWA 5EMNA 1SURA 3IUEA 2IELA 1HA3A 3D6UA 2PZBA 1XNJA 1HYBA 3CLRD 4MVWA 1LI7A 1QGZA 1EUYA 4PGOA 3UOWA 1QGAA 2E89A 4JXXA 3ZJTA 3ES9A 2RE8A 3GUZA 4WSOA 4ACBA 3CR8A 1BX1A 1N2OA 3A05A 4UAJA 4HE5A 4U9UA 4MUGA 2BGIA 3KT0A 3TNJA 2BN4A 3P0IA 3H97A 1OBHA 2V0CA 5GV7A 3BL5A 4L2IA 4MW5A 4PBRA 2Z3VA 1YHQB 4MQ6A 3X1MA 1WKBA 1G7TA 2OK8A 2GOYA 4F3RA 3FHJA 4J76A 2DLCX 2X0KA 4PBTA 1QU3A 1LI5A 3P52A 5HUJA 5BNZA 3OJWA 5FA6A 3ZUGA 4YMIA 4MWDA 1TVCA 4U8HA 3CD6B 3N8HA 5LLTA 3FNRA 3I55B 4EG1A 2DUMA 1M8KA 4CQNA 1FRNA 3VO2A 3RK0A 2XNCA 3WNBA 4LBWA 1KTVA 4NCNA 1U7XA 1MAUA 1N2IA 1ZH0A 1M1ZA 1IFXA 3DLAA 3TS1A 3AL0C 3U6KA 4TMZA 3K32A 4ND6A 1JIJA 1KH1A 3OZUA 1KRHA 2VNJA 1D2RA 2YWBA 1N2EA 2PLFA 4YP6A 3H9BA 4MUIA 3IODA 5J5AA 1T6XA 1VBNA 2CV0A 1QX4A 1CT9A 1JIIA 1I7PA 1QG0A 3COVA 2A1UB 3DO8A 4KR7A 1JECA 4FWTA 3B82A 2CUZA 1A8HA 1F9AA 2HZ7A 1U0BB 5H7XA 2BTEA 1I6MA 4TMWA 1Q15A 3V76A 4AF7A 4DQKA 4R71A 3CLTC 4NDAA 3SEZA 5LFAA 1KC8D 1T6ZA 3ND7A 1J09A 4MAFA 4RD4A 1GAQA 2R6HA 4RD3A 1R6TA 2A1TR 3SP1A 3SZGA 2DETA 1W35A 1WZ2A 3QSYA 5K0TA 3FIUA 2PFSA 3F3MA 4FK8A 3H05A 1J70A 1NUSA 4OUDA 2O5RA 2CRVA 4B47A 1W87A 1F60A 2NPFA 1MC1A 1NUUA 1V47A 2IP1A 2PG3A 2BM0A 3TQIA 3WXMA 1T9GR 5DSZA 2BVNA 3TQOA 1UMKA 2YWCA 2QUJA 1N2HA 1K8AD 4DQLA 2GKSA 5DEOA 2CSXA 4N3GA 3ZXIA 3CRZA 4B44A 2ZP1A 4RCZA 1NI5A 1WXGA 3A04A 4ZCQA 4M0LA 3WBJA 3CCEB 1BQEA 1VQOB 1S72B 2CV2A 2XNJA 3W5HA 1H3EA 3L93A 4DDHA 4K03A 4UZEA 3AGQA 1JGTA 1O0BA 3CLSC 4M1KA 4NBSA 1NYLA 4ARIA 4YAOA 4JYZA 2A86A 1G7SA 1YUNA 2A4MA 4YBRA 3RFFA 4CT0A 1TLLA 2CNDA 4J0QA 2PZAA 4HE6A 1KJZA 1QUFA 2PXHA 1JNYA 4MVYA 2JA2A 3NBKA 2CV1A 1KQOA 3SJZA 1IVSA 4MW4A 4MWCA 3WYAA 1QU2A 3GLVA 2DPLA 5IJXA 3UMVA 5TGTA 2E1RA 3IVXA 1OWOA 3IVCA 2A1UA 1DDIA 3K9WA 2B7LA 2PIDA 3FY4A 4JZYA 4RD2A 1KQSB 1QFJA 1VQ8B 1TYAE 1UFVA 2X1MA 3JXEA 4DLPA 4LC0A 5FO1A 1GVHA 1VLHA 2J5BA 2BV3A 2AHOA 5H16A 1EXDA 3PNVA 2X3UA 2ZITA 1EFCA 1K97A 3AVVA 2C5SA 1JILA 2B7CA 1J1ZA 3CA8A 2V0GA 1JJ2B 3CMEB 1O95C 4I6JA 1G7RA 1N8RD 3SDBA 1FNBA 1TTTA 1EWYA 5TY0A 3QFSA 3IOBA 1D2EA 2B5OA 3VNUA 1JMVA 4MVXA 1FRQA 3ISJA 1A8PA 1G7CA 2DY1A 4WNYA 4FN5A 2AG6A 3LO8A 4QHYA 2QTLA 4R2MA 3LCJA 1H42A 2DR2A 1WY5A 3CLSD 2EIXA 3W2HA 1TFUA 1IB0A 1CNFA 1Q7YD 1KKUA 3NV7A 4U63A 2I1LA 2AKEA 2JANA 4Y9RA 1GLNA 1K4KA 4AC9A 4DE5A 1FFYA 2OTJB 1B23P 1KQPA 1IQUA 4PC3A 2HDNB 4MUNA 3CVXA 5THXA 4RPIA 4I6EA 1VQ6B 4I6GA 2QUKA 2BMWA 3JQPA 3QE4A 1J21A 1Y42X 4CDMA 1NUQA 4ACAA 1QRUA 4ZGQB 2A1TS 4MWBA 1N2BA 1KK2A 4M4SA 3D6VA 1FNMA 1VQ5B 4DNXA 4MW2A 1B2RA 1GZUA 1KH3A 1WQ3A 3NBAA 2FX3A 2QTRA 3PXUA 1WOYA 3B78A 1WQ4A 1YIDA 4EF6A 3N2YA 1T9GS 2D13A 4ZT6A 2QMUA 2PZ8A 3CCUB 3KT8A 3N05A 1EXMA 4MW9A 3P0HA 1QVFB 3QFTA 2OK7A 1O97D 2VTBA 4ZV4A 4EG3A 1KK1A 3CCSB 3ZGZA 5IHXA 5H5JA 3IUBA 3SEQA 5TEVA 1QTQA 1H3NA 1VQPB 1ZH6A 2QTMA 4HJRA 3MCAA 2A84A 1ZJWA 1R5OA 4MUFA 3A2KA 3DPIA 4S1OA 1EFUA 1BS2A 1N2JA 1O6BA 1GN8A 1AIPA 1ZM4A 3FH0A 1O94C 3G5AA 3HL4A 1EFPA 3ILVA 3LOQA 3X1JA 3X1KA 4ZCRA 4AS1A 5AHWA 1VQ7B 4YAFA 1VQMB 5HG0A 3CB4A 2A88A 2YXNA 3M5WA 4GRIA 3QE2A 4QBTA 1G8HA 4EG7A 1WXHA 2QA4B 4TN1A 2ZUEA 3UK2A 2YWFA 1EFTA 4BPRA 4ZT7A 2CT8A 1ZM9A 3ZBTA 1XNGA 1TEZA 3IMGA 1M8GA 4MUKA 3SZ3A 4U7JA 4Q16A 4QREA 3B8HA 1PFUA 5KWVA 1OB2A 4A91A 5HUHA 1E63A 3WBKA 5TS2A 3QFRA 3W5VA 1XB2A 1JIKA 2NSYA 3CLUC 3AKZA 1CNEA 2YY5A 1K9MD 2BPOA 3AVXA 2R5WA
chains in the Genus database with same CATH superfamily
4WNAB 1UJ5A 5L8RE 4YLYA 1E1LA 1I7SB 3VR6H 4ZHSA 4Z4IA 1ULHA 2Z0WA 3W8NA 4QZVA 3CJRA 2FSHA 4ZGGA 3L7KA 2L18A 2YXPX 4BECA 5AESA 1DDOA 3SWNB 1XELA 3L6OO 4ESOA 1BMFA 4P26A 5KYNA 1NURA 3M4YA 1OU0A 4IHKA 3D3EA 5ALHA 1OGJA 3RU3A 5CXSA 2ZCVA 2IXAA 5KHOC 4LOLA 5A5DA 3BEDA 4DV3B 4R5MA 1XK7A 4UTOA 1SEMA 3R77A 3F5QA 3E9RA 4M77G 1EE1A 2RQWA 4BHTA 3GNQA 3MAJA 2XSZD 2OQRA 1YR9A 3FTFA 3JQ8A 4B4WA 3MFYA 4IZOA 2XDYA 1GG8A 3RWMB 2WDPA 4GKVA 1CSKA 3H99A 2P1ZA 2IS1A 2FN9A 3R5TA 5KUTA 5JLAA 3PIIA 1ISPA 3NDPA 4YAGA 5AK6A 1KDVA 3EFRA 5ARCA 4J0JA 2HBZA 3ZKWB 1KSGA 1E2UA 4NZOA 2C58A 5KYUB 2CB0A 3OIVA 1TQ6A 3FDXA 5LCXA 2O9SA 3ACDA 3DB2A 3C39A 2BHRA 4NU8X 4G5RA 2H1FA 3S70A 5LZ8A 4GLOA 3JYOA 3X1WA 5DEIA 3Q8MA 4FC6A 2CUBA 2CZQA 4DXAA 3FJPA 4RKYA 1A7JA 2X6YA 4LV6A 3W8RA 2XGJA 2JN9A 5E8RA 3QELA 1E3DA 3UWMA 4YCAA 4B6RA 2Z9DA 2H1HA 2Y77A 3T3OA 2ODWA 4QDZA 5KYYA 2CLDX 1XZFA 1LPAB 2YQ5A 1K7CA 2I7XA 1AZTA 4YRBA 3TPFA 4AJ1A 1OIXA 5DW3A 2D6FA 1QFZA 4BVEA 2PEYA 5F7OA 3PJFA 1AGPA 2GZ3A 3IV6A 3PT5A 5JTTA 2ZATA 4QPZA 3ZBUA 3T1OA 1ZN9A 2QF7A 1E2MA 3HSYA 2ATCA 4QRDA 3EUAA 4PJMA 4ZCIA 3QLUA 1O6GA 2PL3A 2QEXQ 4O33A 4CLXA 4M54A 3VHLB 3CEJA 1XTTA 2FEKA 4X93A 2NW6A 4QECA 3A8GB 2GD6A 1XZEA 3ZGXA 5B6PA 3UT0A 5B37A 1Q3TA 1AA6A 4XTUA 3I2JA 2XUZA 3OVMA 6CHYA 1NQVA 1KY5A 2HLPA 2IC5A 5E7JA 5BXQC 1J39A 4Z4QA 2UZ3A 5FA6A 4IIOA 4GI3A 1S2DA 3B53X 1CUEA 4MITA 1PW5A 2H5JA 3VO2A 1G17A 5KCHA 2Q3MA 1ZH0A 2HKQB 4PO3X 4LHWA 1TVMA 3ILSA 3U0BA 4KR7A 2VQ3A 2OBSA 4BFTA 5H7XA 4JDPA 3DMFA 1QVAA 3V2UA 7REQB 3IPXA 4PFQA 5EIEA 1KQ1A 2J0SA 3EG5A 4P3IA 5CEFA 3TX6A 4N5LA 1SG5A 1E9FA 2GKSA 2UUBB 1FMLA 2EGAA 4XI9A 3CCEQ 5IXBA 2FEOA 1TA0A 1K4US 1PJ2A 2RG7A 1VDMA 1GTVA 3LSYA 4JBXA 5KNBH 1FQOA 5J3OA 2OHGA 1VQKQ 4BATA 3DZCA 3ZE0B 1YR6A 3BW1A 3BILA 3UXYA 3GFPA 3R8XA 3BXFA 3U7GA 3IUYA 1K9SA 3HCEA 5DTMA 3OJCA 4FHCA 4DY6A 3UAYA 4DV6B 1W5AA 4TMYA 4TT3D 2CJWA 2HQOA 1P8AA 2AKEA 3V8VA 4MDFA 1PLKA 3PEEA 2QUKA 3PICA 4ZGQB 1TTPB 3WGUA 3QA3E 4C8QF 2VQEB 4XQFA 2XGOA 3VU9B 1ZONA 1SZCA 1TPZA 2P8JA 1YZQA 4CCAA 2X5XA 3NWOA 4Y6OA 1KK1A 4Q4AB 3WYCA 2QW0X 2WSYB 4E7JA 2JJYA 1I24A 4ZK2A 1GU7A 1OYWA 4GRIA 3V9PA 3WSVA 1P2SA 3CISA 1GZHB 1I0IA 2OA0A 3ZS8A 4BGEA 2BWJA 4RJKA 2EARA 3FMGA 5ICFA 1GL3A 2PX6A 5EJ4A 2HRRA 3VDRA 2XYQA 4J6XA 3ELYA 4GOJA 3M6IA 3F6BX 4O5VA 3G88A 4XGIA 1QWFA 1KBZA 2DWCA 2H2AA 2FR8C 4PICA 3L0YA 1EAYA 4WL0A 4MQ5A 3AILA 4AURA 3NM6B 4XXHA 2QG9A 1NLPC 4GX5A 3B60A 4CBVA 5IJZA 1WHSB 3PPXA 1IUPA 1DAFA 3GCZA 4NH0A 4OLJA 1E18A 2AYXA 5E6UA 4B3MB 4P9NA 2PAAA 3EXG2 2IEIA 3A3YA 5F76A 2RGRA 4PC6A 4PLTA 1JHXA 3VO8A 1SNYA 4MZMA 2VXYA 4RK5A 1IQRA 3I8OA 5G3YA 3TLCA 3CC2B 1H4SA 3LJKA 3TOCA 3MGKA 3SLDA 4BB0A 1UKAA 3RJMA 4TWRA 1U8UA 2GEDA 1ZQ1A 3H8SA 4DSZA 3G6EA 4ZRNA 1MENA 1UT5A 4C03A 2V03A 5TC4A 1E6CA 2CYZB 2IF2A 4JWKA 3KETA 1Q86D 2IWRA 5FL3A 3AO0B 2WJ6A 2OG2A 4RPJA 4LD9K 4X06A 3KK0A 1JQEA 3TZEA 4F9TA 1LC0A 3LLVA 1GRQA 1ZIXA 3RMSA 1X74A 4TV9B 2QN9A 3NIWA 3WK8A 3O2NA 3KQQA 3V5NA 3KSUA 4W63A 2PJRA 3HCRA 2F9MA 2DVEA 1J25A 3F9CA 1JVBA 5BW5A 3OX1A 3CRW1 1ZX1A 4RF2A 1T1EA 5IJ9B 3TZBA 3I9QA 1Z38A 5HOEA 3EVDA 1I2ZA 4HAIA 4ZZ3A 1Q16A 3OG9A 4MWGA 1XJWB 5EMJA 4FEAA 1VLLA 4KXUA 3T4UA 4E2FA 4RWZA 2WJAA 1A0NB 4GMXA 1T3HA 1TO6A 1D2HA 1R6AA 3CPWA 5JYBA 2GUGA 3C4QA 4BXOA 3G23A 2AJBA 4RTTA 3B13B 5DXJA 1U9CA 4TPKA 3O8DA 3D3KA 2RI3A 1SK8A 3JASA 2QW1A 1HA3A 3AM3A 5G0UA 1CHDA 4DNPA 4BQSA 4ACBA 2W2OA 4KMOA 3Q6MA 2G80A 4UBIA 1X80B 3SQXA 2OK8A 1I7DA 1C1DB 2OV6A 1M0EA 1I2CA 5ALYA 5EJ7A 2F1RA 1UBGA 3QXCA 1WL8A 4RESA 2QPTA 4DLZA 4PO1A 4NJEB 4QOSA 2Y0DA 1JIIA 4JGGA 2Q7XA 4X8LA 3IDSA 4IS3A 5AR1A 5KBYA 1V3VA 4FK8A 2R7AA 3L0DA 1G9SA 2HKIA 2XT9A 4RTVA 3OQVA 4C4TA 4BNNA 3WIBA 3C3KA 3B85A 2FVYA 4ZTUB 2FN8A 3VTKA 3I55A 3RC9A 2WJGA 4A10A 2VDLB 3I72A 5KCOA 1U0LA 3BKWA 4FYXA 3UF0A 1OGYA 1JNYA 1Q0PA 4J1NA 3A8HB 4F06A 3GWZA 1ZH8A 2PL1A 4HFRA 3KSAC 2ZRAA 3OTQA 5BSRA 4II7A 3HJCA 1J22A 2JLAA 4GYYA 2QD4A 4DMCA 2GHTA 4PJOC 5AHXA 5BYJA 4E51A 5IUJC 4A8JA 4IIYA 2GFAA 4MOWA 1ZVMA 3KSBC 2YHTA 4ZALA 1A9XA 1R6VA 4L57A 3K5WA 2D3TA 2ANBA 4LDYA 1J0DA 1GEEA 5FA8A 3A7DA 3R24A 4D7AA 3QUQA 4PCUA 1E9DA 2IS2A 2OB2A 4BVGA 4OHUA 3LTNC 1OZ2A 2YBDA 3GUUA 4I36A 1FFBA 3KJQA 4HNHA 3U9TA 1C7QA 2XMGA 4L50A 4BZXA 1WXWA 2DH5A 2QYHA 1PR2A 4RNDB 1W0CA 1Y81A 1EVKA 1NXSA 2HMSA 5I11A 4KACA 5FQNA 1JPNA 1ZMTA 4M75F 3E81A 4JEMA 4XTCS 1YA8A 4EHNA 1ODTC 3JQ8B 4JASB 4E08A 1PR5A 1SCDA 1H0HA 3BCDA 3S40A 5FCDA 3HFSA 1Z35A 3A6FA 2G4VA 2XE6A 4AO6A 1ZA2A 5GJWC 4WWHA 4Q1AA 2W2KA 2LUOA 3RHTA 1P7PA 1IJEA 1L0BA 3GUVA 1QJ4A 4JJCA 4F04A 2QN2A 4ALJA 1XHLA 4DCGA 2QQRA 3DDWA 1EP2B 3PTZA 1SG0A 5SYNA 1R0KA 5AVTA 2V7WA 2HGSA 3JAMA 4YLEA 4MYDA 5COAA 4ZO4A 4LRUA 1I6LA 2VP3A 2YJNA 4JRIA 5BSKA 1H94A 1WCIA 1GSIA 2H3EA 4BCCA 5KYYB 5EHIA 3NOVA 3KPWA 1YRHA 3BFJA 2VJJA 3ILYA 3UENA 3CUYA 3OUUA 3I4LA 2GFHA 1X9HA 5EN4A 3T7KA 1ZOSA 2ATCB 1CD5A 4MPPA 2YWDA 2MOKA 5KHAA 4MP8A 1TVEA 1B15A 1S1CA 1EFRA 3KOXA 4MCHA 1XZJA 4B79A 3HFOA 2WK1A 1H2HA 3LIPA 3W9SA 2G70A 3R6NA 2C5HA 1BXZA 5TGZA 1Z2AA 4DLBA 2LQKA 2IBTA 4L08A 4F6LA 2RQVA 5IJAA 1BI3A 3E1SA 3OE7D 4IGIA 2AXQA 3PRHA 1CY2A 2WP0A 5K3SA 4P34A 3L6UA 1NW8A 1G8AA 1U9YA 1A8UA 3LT0A 4GLFA 4LXGA 4RCYA 3UJ3X 1N78A 2WHRA 3WGZA 4PK4A 1UJ0A 1BH2A 5EHNA 4N7MA 5CXQA 3A9VA 2VK8A 1N9GA 3IR5A 2VT2A 4UBMA 3NBMA 3RIRA 3MOIA 3L0SA 3UWKA 2FQXA 4RHUA 4RAQA 5JAMA 2VC8A 5DY9A 1Z13A 3MILA 4PN7A 1NL3A 1BNCA 1Y9AA 3KRTA 2PPLA 1K9MC 3QXHA 1OW3B 4ZGBA 3A1PA 2HREA 1E1NA 1KYXA 1WMAA 3PFIA 4LJ9A 3AUFA 2YC4C 4XAXB 3DLAA 2ZEJA 1EFHA 1KMIY 4UAUA 3B6KA 5B5SA 1EMDA 1JJAA 4BE1A 1VLZA 1P0QA 3O7MA 5CHEA 4RV9A 4DQKA 1X7GA 4EMUA 3UATA 1C0KA 4QUAA 1L5HA 1XQ9A 2PKWA 3THYA 3PGKA 1JRLA 2OZKA 2ZTGA 2FHSA 4KX5A 3ZXIA 1VJCA 3CRZA 3HVRA 3OEED 3GRUA 4G86A 4RUGA 1S72Q 3DE4X 3NHWA 1JBQA 4AL4A 4M78E 2OAGA 1JDUA 4MVYA 2WQZA 1QNLA 5L3RA 2J32A 3ODPA 1Z22A 3I76A 3IHWA 1L5OA 4EA8A 1W93A 2FUG6 2JCSA 3ASUA 3IULA 1MX5A 4BTEA 1ZCFA 3W34A 2IPNA 2WAYA 1F4VA 3HR7A 4GBJA 2XQKA 2VXBA 4B31A 1WHHA 5BN3B 1B42A 2ADFA 1BS9A 1MMNA 1VG9B 2BKEA 5C51B 1QK3A 1DV2A 1ZGAA 1AD2A 4GOMD 4X24A 2LDXA 5CCBA 1NDUA 2NXWA 2BKLA 5AUPB 2JTEA 3SYRA 2F1OA 1F48A 1EIZA 2V8JA 4WF2A 4DIMA 4RA9A 5SY9A 1SUPA 2VWFA 3FDIA 1P1CA 2C57A 4NL2A 2WJHA 2CXRA 3PT9A 3BWYA 3AFNA 2GAIA 1TM5E 5HTKA 5DP1A 1A9QA 3DLBA 1DC6A 5LMUB 2G63A 2D1FA 3PJEA 1QMCA 5EIOA 2A3RA 4RMHA 1QRTA 3RU7A 4FIDA 3KHKA 3BD6A 4BNUA 3SX2A 3E05A 2WMNB 4L8FA 3AK4A 3EE6A 1OV6A 1T5EA 4E7PA 5EIAA 2HYDA 1BB9A 3OX2A 3W2TA 3AW8A 2LKDA 4AZSA 2IEZA 2I71A 1EU1A 3E5HA 3G6EB 4J9GA 1VUBA 4L5YA 3KO8A 1CWUA 3C97A 1AQIA 3PITA 3V4ZA 3U5ZB 5DYWA 1RPZA 4MWEA 1NJID 3HRIA 2WAAA 4Y3UA 1VHQA 1JFFA 1V43A 3Q5GA 3I1IA 4OG2A 4XFJA 3S3OA 1IRXA 1W4RA 3GJ5A 4Y1GA 2OAEA 3KP1A 1ZWLA 2FRYA 5A0TA 2KROA 2B8TA 4XCQA 4TZTA 2W83A 1TLTA 1TNDA 3CBGA 4N4IA 3NHRA 4WN3A 2I80A 1T36A 4RPKA 4PG7A 4E5PA 1N6AA 4XU1A 1YI1A 1JEYB 4PHGA 4TGLA 4CI0B 2H3HA 1S1NA 3SM3A 3A0UA 4DMHA 1GAEO 4HI0E 2GZ1A 4TLLB 4NU0A 1JA0A 1L4FA 2G04A 3DWFA 4JQZA 2ZIFA 5AN9A 3RARA 3TRKA 2P0YA 3NC0C 1WPRA 3TW0A 2JI8A 4KR9A 4PYRA 3C6BA 2PXCA 1ADFA 3SOZA 3L7BA 3V8JA 5DBFA 3DPUA 4JRPA 2OO7A 2QQSA 3LWDA 5IP5A 1Z8DA 3GK3A 3CPWB 1JEEA 4IQ0A 3WAKA 3THXB 2WIJA 4DZTA 1JFLA 4NOMA 4TWIA 3JVVA 3AKDA 4BP8A 2P4RA 3OZ7A 3TD2A 4MGHA 4KYIB 4TSKA 4OYYA 4EZEA 2V7PA 3VYRB 4Y6QA 3BORA 1DJ7B 1YUBA 1V6SA 3V8QA 2ZG6A 2EBHX 1UJ6A 1CRQA 3Q2OA 3G1JA 3WLQA 3OZRA 2O7RA 4MQUA 4CMIB 2BEUA 3KJHA 2HXSA 2IT1A 1HNWB 2ATXA 2C54A 1NAHA 3FOFC 3EULA 4CDNA 2L17A 4WLNA 1WIWA 4X1IA 2O1EA 2ZRLA 1BYIA 1PEKE 1TCVA 5EHXA 3RVDA 2BR5A 2HJVA 4FHFA 5CW2A 2FUKA 4LDUA 1Z63A 2HU8A 3B6ZA 2RHDA 3BWCA 4AJ9A 1YS6A 1PBTA 1TUGA 4IXDA 4KBYA 1DKUA 4CJXA 4R56A 2C5FA 2GMWA 3BGIA 5L40A 1CZHA 4DQVA 3UT5A 2PU7A 3I55B 4D3XA 3VS7A 3NHKA 1T0PA 4KYVA 4LBWA 4FYXB 2HADA 2AUNA 2C2GA 3AEKA 1GCUA 1N08A 3G0IA 5BV1A 1SEPA 1DT5A 2CNKA 5JG7A 1K6IA 2CXOA 3WJ1A 5L23A 3LH5A 1P6UA 3L8YA 1ZSNA 3F3MA 1W59A 1K73C 2HF8A 2DFLA 1UJNA 4F8EA 4TQ9A 5J4YA 3V80A 1NPPA 3BFMA 4AJLA 4YAOA 2UZ1A 4E7ZA 3K96A 4PYLA 1WFWA 3ELWA 1MORA 3KWMA 2A5LA 3QEOA 4LF4B 1QK4A 3PGGA 1QFJA 2X85A 4PX2A 3V1LA 5EXXA 3KUDA 1WTAA 2DHDA 3UMRA 4AYWA 5HNKA 3SDBA 3F0TA 2GZMA 4AY5A 2P40A 3WGHA 3ISJA 2NUPA 3QNUA 1H2YA 1NF9A 4Z7JA 3H9GA 5JIBA 2A0UA 4DJEC 2PUTA 5TT0A 4CQJA 2V97A 2OR3A 2ZPBB 3JQPA 1LY1A 3UYLA 3ZCVA 3STUA 5J2TA 3AR2A 1ZUD1 2OCYC 3M2PA 3ZWPA 1X38A 1U8EA 1FYNA 1ILWA 4XCVA 5AK5A 1SUWA 2ZRCA 4AWAA 5EHZA 2OG1A 4N6NA 4MRNA 4FCYA 1Y9EA 3NALA 4ZQFA 2Q8PA 2RDMA 1WMFA 1V29B 3KL4A 4OI4A 3JARA 3QPDA 5I21A 1TKRA 2LQWA 1WD7A 3VS2A 2FUG1 1F9EA 3WRYC 4UKDA 3PXCX 3JD0A 4DEYA 4KAJA 5E1OA 2DWUA 4CN9A 4P22A 3M3DA 1ZN2A 1M6HA 3FI9A 1R27A 3KTDA 1IG0A 5HQJA 4RJLA 1FXSA 4QO8A 4PO8A 3SEAA 4E21A 2GBQA 3T5TA 3LXMA 1LQ2A 2BCEA 3WG9A 1W36B 3O83A 5JWOA 2W2LA 3DL7A 3WGOA 4OP0A 3TN7A 4M77C 1JHRA 1WCIB 1PEYA 2H3EB 3F8SA 1XVAA 1XCGB 2I6TA 1NV9A 4F11A 4UJ5A 1X9GA 3JCMg 4MI1A 1KJJA 1W5SA 3L4BC 4XYLA 2CYBA 3A26A 5JZBA 4JA2A 5J58A 5HK0A 3MHXA 3C1UA 2FDCA 3N3AC 5LM3A 4D57A 4M6WA 5DKFA 3IA7A 1VTKA 4IV8A 5JXWA 4M38A 3BMCA 4X5OA 2NV2B 4U3JA 4C01A 2V6JA 4BDYA 3SOPA 3WB2A 5HBGA 4PRLA 4B76A 2AZSA 4W5QA 3E1YE 3FPAA 3KVVA 5T8KC 4DPMA 2P0PA 4ZO9A 3TG8A 3N3BC 3GMDA 4PSVA 4IRUB 4PAMA 4FHEA 3VR6A 1QCZA 4YAKA 3Q1JA 3AEYA 1KI2A 3ND6A 3I5RA 1EE2A 1FP1D 2HA4A 3E3OA 4RLQA 3E18A 4QTTB 1MNAA 4FX2A 3CH7A 1FFHA 1U3CA 2AN9A 2QT1A 4RANA 3BRSA 1TKBA 3WR5A 2OO3A 1BEEA 4HUQA 1XRLA 5IDVA 3SSMA 2HV8A 2N47A 1SIOA 4M1TA 4Q5IA 1OA1A 1Y4SA 2WTNA 3FFTA 4QTYA 2CFOA 4FPXA 2HF2A 4IWNA 2G36A 2HIHA 2ZRBA 1ZUNA 2OBLA 3QKSA 1IZ7A 3A3GA 2XGMA 2IU0A 3DULA 5BQXA 5KYTA 5KVVA 4C4OA 1D1NA 2EKQA 3L2UA 2I4LA 3OKAA 4G97A 5AI8A 2F3RA 3ZD8A 2PUBA 3VVLA 1Y6RA 4EB6A 2FZCA 2DBQA 1L5HB 1WW2A 3THYB 5C7YA 3L7IA 1OX9A 2VJMA 3MMSA 3UTCA 1E2DA 3OZGA 3C3XA 1ULAA 2H1SA 3L7NA 3ZD7A 4B32A 2BKAA 4RQAA 3U4QA 3ZE7A 4ZQBA 3FNRA 5HIJA 5JE8A 1R8SA 1FRNA 2AFVA 3LXRA 3AU8A 4DMKA 1U80A 3WLLA 4R3UC 4L5JA 4EB3A 1PE0A 2SKCA 1USVA 3RB8A 1WNFA 1JKJA 1ZLMA 2M0OA 5DOVA 4I55A 4QDXA 4MV6A 1X6BA 2HSJA 4MVJP 5FU6C 2X7JA 4CG0A 1E59A 1T0HA 1RLPC 2A9OA 2RHWA 2QX9A 3P9KA 4M21A 4WMLA 4ROSA 5CVCA 2XECA 3U26A 4LX0A 3MJTA 1UKZA 2GEFA 4N5IX 1TK2A 2GF9A 1OC4A 3OZDA 4YRAA 1G21E 4RA9B 3R0ZA 1PBNA 5CR9A 4HUJA 2ATVA 3MD9A 5CK4A 1LBSA 3T5DA 2XI9A 3SMQA 3CA8A 1WABA 3SCZA 1N8RD 4Q3EA 4UVGA 2HXYA 1V6CA 4ASUD 1K5HA 1EG7A 3T9AA 3A4YA 2VJYA 1KNXA 1BRMA 1Y7TA 5FRNA 2R2GA 4FQ7A 3ER9A 4N3AA 3CESA 3MGBA 4DCSA 1QORA 1JSRA 5F5NA 2ATEA 3UUEA 1LS1A 5D85A 2HHLA 5HKKD 1YASA 2HY7A 4ZQHA 2O6LA 4MW9A 1G8PA 1V0EA 3NDBB 4F8JA 4KVAA 4HGOA 3KYJB 4L59A 1VQPQ 2RJEA 2VT3A 1QHYA 2JKZA 3RM3A 3P9IA 1RAIA 1VQ7Q 3UEOA 2D4HA 2QA4B 2FQQA 4L7QA 4L78A 2IV7A 2EYYA 3CGWA 2IIQA 3ENQA 5TF0A 4DDWA 2V1RA 1E77A 1V1MB 2AF4C 3AF3A 2X9QA 4MPRA 2O4UX 4X91A 2IDKA 3W9BA 4CGYA 1ZEJA 2X4LA 1S8OA 2FNAA 4QUJA 3EGDB 1X77A 5JNTA 3TI9A 1ZRSA 4CYMA 3OE5A 3P20A 5KNBA 1M1UA 3URMA 2E5WA 3ZVNA 2VZLA 1VLJA 3WFIA 2YVKA 1KMHA 1XCJA 4HQOA 3PP8A 1U2ZA 2JHFA 5CB4F 2XQJA 2PNJA 3BK1A 4Y0NA 1DX4A 2YHUA 1KFBB 2FRXA 1ORTA 4ER6A 3KOYA 2Q8QA 2VUHB 4WN9B 2FK7A 3I42A 4ZAXA 3C8HA 3M0SA 1DEXA 2YNMC 3A8JA 2AA3A 4D8WA 2QKYA 3QJGA 1CJTC 4FGLA 1Y6FA 3VOBA 3AESA 1GUYA 2PSSA 3HLYA 2I5PO 4IPTA 4NHEA 3E1KA 5TEWA 2DM1A 3PMIA 1SOUA 4F4HA 5E3HA 1P9WA 1BPLA 1I32A 4ND8A 2FOLA 4D79A 3VR2A 3QMWA 1NJFA 4AQ7A 1I2AA 3P5SA 4GU5A 1F4PA 4E6EA 1N06A 5AVJA 4HCCA 2A7QA 3M9LA 3BIJA 2VAXA 3CCRA 3VMFA 3IMCA 1TZKA 4PC2A 2TMDA 2PUEA 2X3FA 4RD1A 4FMDF 2BEUB 2H1IA 3BWXA 4YAJA 2FPPA 3FD8A 2QLLA 1LF0A 4WADA 4RE6A 2WYHA 4KQHA 1I80A 1X7YB 3LYLA 2LRHA 1YR1A 2XXJA 5I7WA 1W75A 3T53B 5CCEA 4RCVA 1I94B 3HN2A 4YRLA 1ZZEA 1U0JA 4UHEA 4X1YA 4M7DG 4JUAA 2PR7A 3R7WA 1GP2A 4LBZA 3ZXYA 2VLIA 1M67A 1ZBDA 4X66B 1FP6A 3E0XA 2XVMA 3ZK7A 1HLPA 5D01A 3QPBA 4NNJA 1EQUA 2ZGWA 1LU9A 3MUEA 3AEKB 1RWPA 1B93A 1FJGB 1ID8A 1JP7A 5J4VA 1YHZA 1MVOA 3G0CA 3I9OA 1SCUB 3IEPA 4NZMA 1N33B 2XAAA 1AZWA 2KT8A 5AW4A 3C7DB 4DOWA 3HYTA 1N6RA 3ET4A 1ZR4A 1GYQA 4FHDA 1ZOLA 3WLSA 4BNVA 3UPDA 4AN0A 2BBTA 2O4XA 2NYSA 3WBFA 2VRWA 5JASA 2ZJZA 4RHXA 5C1BA 2X51A 4ZDWA 3QVLA 2UZ1B 2ZAEA 3BD8A 4PLIA 1U7XA 4CLRA 2C0PA 4ZEVA 4TMZA 3V6LA 2Q5FA 2PBFA 1HORA 2DKGA 2PV0A 3K73O 3L2WA 3NTXA 4JGIA 5IT9A 1FYFA 4OYLA 1P4MA 1NZFA 4N8EA 3QW2A 4J1TA 4JP1A 3HXQA 5AJYA 1V47A 1UF9A 4PCVA 4JUFA 2O31A 4AFUC 5GP1A 2NUPB 4G5XA 4G67A 3A36A 1AQYA 3KHUA 4LQCA 1UFQA 2XZDA 4XQ0A 3UC9A 3TI7A 4IH9A 2SKEA 3SLKA 4DUGA 1ECJA 4LA4A 2XVXA 4BLWA 5J2TB 5L7YA 3U3OA 5F2OA 3KPYA 4M9ZA 3OA2A 2C5SA 1W19A 5HE9A 1AK9A 4CV3A 8OHMA 1YS1X 4UHCA 5KTMA 5HZHA 2FFBA 1G38A 3HM2A 4QG7A 1XZLA 1Q81C 4W9NA 1VQ9T 4IWYA 3KD2A 2ZJ0A 1UH5A 3PF8A 4PNHA 2NV6A 2AD1A 5CNMA 2VQFB 4TSFA 1OZGA 5C6SA 4DADA 3PI7A 1X0XA 3OQJA 1N36B 2Z2KA 1YVRA 2XCQA 4MRAA 5FBRB 2HFJA 5LKAA 3DYIA 4H0CA 5JSYA 4QHSA 3DAPA 2QASA 5K4HA 3QYJA 3OHPA 4F8YA 1EX7A 2VNAA 3U81A 1R4AA 4C5AA 1SOVA 3LHFA 5HG0A 2CLCX 3M5WA 4NMMA 2OWEA 3LRTA 2GPSA 2GM4A 5E1DA 4HR7A 1KL7A 3LPDA 2EJGA 4CLOA 4PX3A 1S7CA 3TW6A 4OD0A 5LZ4A 1KTIA 3PF9A 2GFUA 5FAXA 3K5PA 2OGWA 1WMSA 3SF0A 2OV4A 4OJMX 1W1UA 3UKJA 1FSGA 4YTEA 2ECQA 1YDWA 4M6WB 4G24A 1G5QA 2YSQA 1WCXA 3SC2A 1XCOA 1NRKA 2BHLA 4TTJA 3AOGA 1WIEA 4L85A 1G6HA 2PVDB 1CUIA 3G5TA 5AT1B 4ZN3A 2VKNA 2C31A 5JSKA 3BPSA 2RN8A 4GW3A 2QGFA 4FGJA 5EQJB 1XJCA 1XZIA 1CB7A 5CX1A 3MT7A 5EPEA 4BNWA 2XRYA 2CXTA 5D2CA 1QLJA 4EY7A 1EWKA 4YDQA 2D0IA 1QVFP 3R7LA 4MVJG 2DPMA 2Y4YA 1T6BY 4GI7A 4UHHA 3K0KA 4PZ9A 5FWBA 1KFKB 3T1TA 5HVNA 4DABA 4JXZA 2J48A 3Q6RA 1QQTA 1G3RA 4I8XA 3F49S 4BI3A 3HY6A 3FKSA 1EE9A 1TYDE 2X19A 1K0SA 1MA3A 2WEKA 1C2TA 3MP1A 2VN8A 3E9ZA 1BKBA 1ML3A 3FJ5A 1ZUNB 3TDKA 2VJNA 5KCMA 1L4EA 4D8KA 2FEWB 3MCZA 2UZAA 2GM5A 3BE6A 4MULA 1E8MA 3LVFO 1D1QA 2OAP1 5K9ZA 4DCJA 5I7RA 2A9VA 3ZK9A 5DNDA 5LUAA 4ZCPA 2VJMB 2WB2A 3B8EA 1YJWT 3O3NB 5DNWA 5KZMB 1Z5OA 1CF2O 1ABQA 2KBTA 3L0PA 4C5HA 3K72B 4HN9A 4L9WA 1GAJA 1JQLB 1O97C 4JEIA 1G20A 4FR0A 2RQUA 5KNCD 1IIBA 4KODA 1M8MA 5JXGA 1H8KA 4A7PA 4HGQA 1I4EB 3PFBA 4I55B 4JVMA 4DA7A 5BR4A 1JKFA 1P5RA 3ST7A 4G85A 4WSOA 1VG1A 3FTPA 2I66A 1T0HB 1YHNA 4EFLA 1FQKA 3JCMf 1MB4A 4HAOA 1JJVA 3SBXA 1N27A 3EJ6A 1L7QA 4CV1A 5EAIA 2QRMA 4CF3A 1Y5RA 1U9IC 5ITZA 3L9XA 1RC1A 3VNQA 4RE5A 3ZTYA 3IODA 4WW0A 2FP3A 2HWYA 2MAMA 4OI1A 2MSKA 1BHQ1 1H0SA 1XWIA 2NNLD 2BZGA 1J8DA 1EBFA 4JDSA 2R6HA 4DHWA 1W35A 3EVAA 3TREA 3CSUA 3IPLA 3IKLA 3SJUA 4C04A 4HEHA 2QYSA 4XB1A 5J63A 2UZIR 4KL8S 2EU8A 4QT4A 4M0LA 2N3ZA 3H4TA 5ERGB 4DWJA 4NFYA 1B3RA 1TJYA 2POQX 2ZU0C 4AMZA 4TYPA 2X0DA 2FKAA 3T5AA 1BGWA 1S2IA 4YTLA 4MW4A 4AO8A 1WPGA 1FTYA 1L3IA 1GFDA 4YMWA 2I4RA 2XBUA 4GLJA 3U7QA 1L5VA 1NJ5A 1OZ0A 4MI6A 5A7HA 4LMBA 1QK5A 1K3UB 3GJYA 2XMDA 4XONA 4DLYA 1RBZA 2VI5A 2IF0A 4GZMA 1EM6A 2VBTA 1JKXA 3VTAA 1BDHA 4AG5A 1UJ4A 3DDNA 4KW7A 1P6QA 5AJVB 1Z6ZA 1LPNA 3AEUB 1C30B 3CP8A 2Q1SA 1WQ3A 3NBAA 4WZLA 1M2WA 4FFPA 4XH9B 1KDRA 3O1LA 2CLFB 1ZVKA 3ASKA 4JJ4A 3D6TB 2QRUA 4I19A 2L42A 2AN1A 2X3XD 2IK8A 1KMHB 4QRHA 5A1JA 5HF5A 1S4QA 2BFEB 3FBGA 3GJXC 1MPTA 3SYKA 3GFVA 1ZSZA 4WK4B 4B9EA 5IEJA 3UV7A 4JJFA 3KELA 4M75A 3FWPA 1G5FA 2FSVA 3KCQA 4PLPA 3USZA 1VQ5A 2OZEA 2P91A 3C8ZA 4QASA 2CGEA 2WE7A 2J0UA 4UM7A 5LR6A 5K8CA 3JQ9C 2QTZA 2YOFA 2PK3A 2XCUA 4PPFA 2F2TA 2CW5A 4LNUB 1RXYA 3BZBA 3AESB 3MIIA 2H2WA 3F96A 3SZLA 1GTRA 2F17A 4A03A 4R68A 2VZ9A 1X1TA 3N0WA 2FYKA 4QJIA 1EDOA 2ZTHA 1JSLA 1PR4A 3EHRA 3S2ZA 2PGOA 1YFZA 3N28A 4XLLA 5IM4F 3RY8A 2AEJA 3GP3A 3F4BA 2I1VB 1R3DA 1LDMA 3CCRB 4NR0A 4DR4B 4AKGA 3ZJ4A 4CG1A 3FOBA 4XKWA 3W2IA 4XM3A 1JAYA 4KSCA 3I45A 2FRVA 4FM9A 2P9FA 1QR6A 2VHVA 1LB1B 3WO0A 1KD1R 3NEAA 5CBPB 1BO6A 1Z07A 5AQ1A 2QVCA 3G71A 1OWMA 2G08A 2HHCA 1RTTA 1S1MA 1EGQA 3ZBDA 4LJAA 3DBHA 3PX7A 4KR3A 1N4DA 5A04A 2Z2YA 2V7QA 1BVUA 1OXXK 1UXHA 4BNYA 3NH9A 4FEEA 3FUCA 1BYUA 4HH3C 1RQRA 1NNSA 2M32A 4EM6A 1LPOA 5F1YA 1V8FA 3B52X 4OMOA 5HILA 3I9LA 3IQDB 3JV3A 4WK0B 4JT4A 2BRUC 2HPAA 4Q1CA 1GL7A 4JBIA 1ONBA 3M4JA 1Y96B 2TRSB 3LECA 4ZZ1A 4ZYWA 4REOA 2C5GA 4ERNA 2QRLA 5DHFA 3FVQA 1JQ3A 4GM1A 3G4SA 2J1LA 5CVIA 1UBSB 1P1KA 2JIPA 3UFXA 3NKFA 3QFFA 1AQNA 2Q3HA 1DLJA 4LJ4A 2EJFA 1JHPA 1YIAA 4RSRA 1PZGA 4JC8A 4CQLA 4DUYB 1VHTA 5LLTA 3GJQA 1RLIA 2J6HA 3PIPA 5IYZF 3BXZA 3M8KA 1I8DA 3BQMB 3BBPA 1PS9A 2HT6A 3PQ8A 1DFGA 1FDOA 3NGXA 5H02A 2DKOA 2QRQA 3HA2A 2E87A 4AMYA 2V0CA 1ZK4A 1YTUA 4N47A 3EGUA 2AVDA 4LJKA 4DV5B 2D0OB 5AW6A 1BEUB 3DDZX 1LK5A 1IUOA 1ZD4A 2VHJA 3ENNA 1U28A 1YQWA 4NS4A 5LLDA 4PVDA 1CV2A 1QXSA 3S1LA 1BE1A 4JQCA 1YDMA 2HWXA 1NLFA 2NLUA 4F7WA 2FZWA 1T6ZA 3DT9A 1FVXA 3H5AA 3PR2B 1RCFA 2JFXA 5B3LA 1C4XA 1H4VB 4C5GA 2KW5A 1WSDA 1U4NA 1Z4IA 3CTPA 3HDJA 4M88A 2J6KA 4C8QB 2IOHA 1R0XA 4G5OA 3FPCA 1SUSA 2FHPA 5K3DA 3EXFA 3OYJA 4KOEC 1JQ5A 3U9SA 2EBPA 2PUAA 3GH3A 4XYBA 3NKVA 4FYWA 5H80A 3L6BA 1Y1LA 2VTEA 3A28A 4OVAA 1J8VA 1N5JA 3CE6A 3UJ6A 3RYHA 3K1YA 4KO8A 4UEQA 2W2PA 4OXKA 1CLUA 5A62A 2GWHA 1S2LA 1G7CA 4OK5A 3IS3A 1A04A 2ZBRA 4NYJQ 5A0GA 4UE3S 2Z5LA 3GR6A 2JFFA 4QUHA 2QMQA 4M7WA 1TQ4A 2DKNA 3SZRA 4E7IA 1CG6A 2QTWB 3A9UA 3K9CA 3CQ9A 2UZ0A 2ZR9A 2NVUB 4MV4A 1QQBA 3GCDA 1VLQA 2QTMA 1BN6A 1Z5WA 1U3FA 3UAZA 5DBOA 3KR0A 4JYBA 1VMDA 1PVDA 4KN9S 4R84A 3D1VA 3HKDB 3SC2B 3PXEA 4OI2A 2RB6A 1Z4PX 2MK5A 1ORRA 2IIVA 5C1OA 1UHFA 4BNMA 1AN9A 1OV3A 4N0AC 4YAWA 3I2KA 2GK3A 1CY0A 1MJ5A 2PH1A 2H2DA 2DLDA 3E9CA 4P4GA 2HNAA 5DVZA 5JV5A 2O9JA 3RD5A 4BUCA 1HD3A 3EXG1 1EGMB 2ZYUX 4D0SA 1V16A 4RMNA 3AG5A 2P2ZA 3CXCP 4E7KA 3L2RA 4O2AF 2ZLBA 3OPNA 1XE1A 1K6MA 1G66A 3FZYA 2P67A 4WLOA 3D54D 5F4JA 3NNSA 1JJFA 1VLVA 2L3QA 1L6IA 4X7DA 1IGQA 5LB4A 4P3KA 4AX4A 3TW4A 1DBVO 2RD2A 1NFQA 2OXRA 1ODJA 4K3VA 3LF2A 3OCVA 2G4LA 3T4PA 2VAVA 3H7AA 3KYDA 4A82A 2IGBA 3ED5A 2W6MA 3AR8A 2L69A 4JP3A 4PC1A 2PJZA 5HKOA 3IAXA 2GD1O 5LQKA 1GPMA 5EIHA 1PJ5A 4WZZA 4BACA 2PMEA 5EE9A 4JRKA 3GY0A 5EMLA 4C92F 1P39A 1ZJ4A 3TM5A 3BFXA 1UFRA 5CEJA 3WFZA 1OWNA 2F43B 2PWPA 1RQGA 4RXMA 4C6HA 2GVDC 4WVFA 4FGZA 4FCCA 2G8NA 3MTGA 3AT1A 3VQTA 1MEEA 3OZXA 4ZT2A 4GR5A 2YZ2A 1M5TA 3IO3A 1RHUA 4L76A 2VYVD 4OAOA 4GSKA 2GJPA 3A1WA 4P1VA 4P3OA 4Z4RA 3PU6A 4C0KA 1XN1A 1PO7A 3B7GA 2E18A 5AVKA 4HT3B 3PVCA 2H1OA 4WA8A 1PTKA 2VVTA 5I7UA 4Z02A 4HZUA 1Q86U 1MHTA 3BMQA 3NP7A 4MYRA 1KP2A 3D4IA 4EFKA 2XOKD 5KOIA 7YASA 3TRDA 3TH5A 2X2EA 4HVAA 1U4OA 2Z04A 2NUAA 1ORDA 1Q44A 4BQPA 1D1BA 3DR5A 4YUVA 1Q0ZA 1NM7A 3PWKA 4M7OA 4LN1A 1YJWA 4K88A 1DQSA 1N9KA 2DTXA 3BZWA 3AUAA 3LUDA 2FCRA 4ZYZA 1PJLA 3GSIA 5K6RA 2FUCA 4JKYA 4NYJR 3TOXA 4I66A 2GREA 2OUKA 4XYMA 3DR3A 4NCNA 1N2IA 2VAMA 1YB1A 4AJPA 4MUIA 1NI3A 3DUWA 2VSXA 3CZPA 2CH4W 3U7QB 4MV8A 1MO6A 2OJ2A 4KYTA 3GLTA 2Z1DA 3DEFA 4ELZC 3G13A 3R9WA 1Q0SA 3RC3A 4L5GA 3R3YA 5JS8A 2PZAA 4E5KA 1RQPA 4BFUA 3GOQA 4HFMA 1MH9A 4YGYA 4HNTA 5B4TA 2DEQA 4IURA 5CK5A 1UP7A 4II1A 4AAYA 3K70C 4R81A 4JUBA 2E65A 1H9AA 2BCJQ 5FL7A 2GN2A 2JFBA 2JRCA 4I6JA 2ROLA 3AQ4A 4UPVA 1FNBA 1IY8A 1CUVA 1IIRA 2OXEA 3UT1A 1HT1E 2WUWE 5F4OA 2D1RA 4RTKA 2FB7A 1FFYA 5EUQB 4D96A 1ZD8A 4M75B 5F2KA 1FMWA 3BY7A 3SEJA 3MO8A 1VQ5B 4D5GA 1RXUA 3DEZA 2VDUE 3FSGD 3SZUA 4EHHA 3QFTA 2JASA 4YRTA 5HRCA 5LUBA 1KVUA 3QELB 2JW4A 1ZY2A 4V24A 2K3XA 4JQYA 3GAMA 3R7BA 4GRAA 1II8A 1C0EA 1XF9A 2X8BA 3LL4A 3H2KA 1LLQA 4EVQA 4NXMB 1HG1A 2VAWA 2CSUA 2WSMA 5AKEA 1Z83A 1GV0A 4PG8A 5HJ7A 2YUIA 4RXTA 4MQ4A 3VDNB 3SF8A 5K3BA 3ROGA 4FZRA 5BRJA 3LV8A 4G56A 2Q9BA 3GGSA 1JLHA 3LX4A 2FLWA 1KIMA 1S4MA 3G71B 5BORA 1E2KA 3UG7A 4NENA 3VYUB 3C3YA 5K7SA 1P9LA 2XVAA 2PUFA 3DBHB 3CF4A 7AT1A 1NVAA 3KX2A 1UDCA 3KAKA 1HYHA 2QNIA 3RVKA 3QU9A 1H4QA 2ZZFA 3EDOA 4QDUA 3FLGA 3PZRA 3DCIA 4KSBA 5AJHA 2BGUA 4YMHA 2PSJA 4E7HA 2ZVPX 3LCVB 3WVNA 1U06A 4S05A 3HWX1 2QM0A 3RRYA 1RHMA 2ZJ5A 4NAHA 4RDIA 4FYYA 1NQXA 3PC8A 2FEMA 1T0JA 2YWGA 1GTMA 4RJ2A 4E7LA 3G4SB 1U5AA 5JXJA 1AKVA 4OHRA 1SO8A 2WT8A 2DF6A 3UFXB 4RDCA 5DT9A 2OE2A 2KEAA 3WL8A 3W05A 1EA7A 1Q1EA 4LMAA 3VJLA 4JLOA 3ZXUB 4YFVA 4CIAA 4M7DC 4QXMA 4NXNB 2BKXA 1AHNA 2CJWB 1C3XA 2DXBA 3GX1A 3VNRA 4CTNA 4I99A 4IS2A 2RMKA 3ASRA 4F7UA 3UAOA 1N5RA 4KG7A 3KUFA 1XEXA 3UC5A 3ZWYA 4DNRB 2R79A 1M5UA 1TOVA 3BE5A 2QG4A 5ICSA 1MC5A 1LPMA 3ANYB 4CM7A 4NNOA 2NX2A 3FMVA 2WWWA 3T56B 1YZTA 4CLEA 4MX8A 3NCTA 3JQCA 1VLYA 5C35A 4MARA 2COWA 4RA6A 2J9YB 2DFPA 3G2OA 2CLEB 1IPEA 5C34B 4DC1A 1E1RA 2QG9B 3U4DA 4YONB 3DW1X 2H2FA 1MVNA 5E6UB 1PV4A 4D74A 3A1CA 1UKVY 2Q07A 1GU0A 3TTXA 4GM4A 5A2GA 4X85A 3FB1A 3L8HA 2VJKA 2BJHA 4E2WA 2XZLA 2CK3A 1VQNQ 4FTWA 1NG2A 3LPCA 4LC9A 2DT8A 1SQ0A 2ON6A 2P9JA 1U0GA 3QKJA 3RFFA 3DAFA 2G0AA 2M6LA 1KQSS 3DMNA 2P9HA 4R9SA 4EMTA 1KMCA 1SCBA 2W11A 2C7VA 3R3ZA 4AVYA 2HKNA 3CURA 3NPFA 4DLTA 4ZMRA 3WMRA 2Q6KA 5T4FA 4G8DA 2V0GA 3BTVA 2H9IA 1XD9A 1NBIA 4WJZA 3D4NA 3HTXA 3E5RA 1AKWA 1DX6A 4Z7NB 5JDIC 3VHQA 3IEXA 3M4ZA 4GZ3A 4W6ZA 3DLHA 1HQYE 1IQUA 3CCLQ 3HJGA 3SR4A 1C6VX 1R64A 5HXAA 1Q1NA 3MBKA 4XLAA 4Y0AA 2DFKB 2YMLA 4C76A 4LCJA 1RQNA 1JPUA 1XKTA 1FUKA 1AUOA 3VH4A 4ZNXA 2R00A 3E9MA 3M34A 4NVRA 4RZHA 3D1JA 3JAME 1FMVA 2PKXA 4WXEA 1TEZA 8AT1A 1SCAA 2C95A 2WIFA 3F8TA 3DD1A 7ABPA 3BE8A 3CLUC 3OJFA 3QLVC 3CN7A 3DWGA 1UM8A 1FYDA 1U0OC 4WK6A 1XXLA 1T10A 4E2FB 2OTLQ 3T7SA 1G59A 1TW3A 4BXOB 1QNFA 5JWRA 5CB4A 2Q2OA 3TRJA 3JASB 1KSJA 3KSRA 3QWYA 1NEGA 5C1DA 2I67A 4KXNA 2XCRB 3JZAA 2QTCA 2VTVA 3PQ3A 3TZCA 2GAFA 3C70A 4J0GA 2Y4NA 5M29A 1R6XA 2LJ3A 4W7SA 3WNDA 3KV1A 3P71T 3BGDA 4BVBA 3W4IA 1JB9A 1NXPA 3QZ5B 2NMVA 1ARZA 4M55A 4BBPA 3RI3A 2HPZA 4RKWA 2XT6A 1EWTA 4ZCMA 3PLRA 4N54A 4G8CA 4FDVA 5GONF 2KI7A 3OJXA 1KZLA 3AH8A 4A26A 5CD1A 3DXFA 2RHRA 3U1VA 2I34A 1QGOA 2GJ8A 4PPYA 4BE2A 1NIJA 1IHWA 4CMKA 1NU6A 3ZV6A 5ILOA 1EP3B 4HQKA 3ED1A 5KX5F 1NJIU 4WV3A 2FEPA 3BMQB 3H83A 3I73A 2GZDA 1OYYA 4L0MA 3UKOA 2VYNA 2VHXA 3GO4A 1B8VA 3TLMA 4A8JB 2H8HA 1VHJA 4X0EA 4D4LA 1D1PA 2QD1A 1GR1A 2BZXA 2P35A 3RKSA 2LGJA 2EL7A 2NUAB 4TZKA 3RUIA 4QTZA 1A9XB 3ONDA 1MAWA 4ESEA 3GUHA 2JCXA 2V65A 4G5YA 1Q7CA 4TMXA 2UXCB 2REXB 1WV1A 1P9NA 4J16A 4WXRA 3ANNA 5DX1A 4EJMA 2OCXA 4ZGJB 4LDXA 4L4XA 2G09A 2WWYA 2DBYA 4B3BA 4RYLA 3JZMA 1I4LD 3RSHA 1OXMA 2Q0HA 4HN4B 2G0NA 2OM2A 3PR3A 4JI5B 3OOYA 4KAXA 3ASSA 3OYMA 3N8KA 3V8EA 3HM9A 3WYBA 2G72A 3JSXA 3TTTA 1GLVA 2ZYTX 1XAHA 5JEEA 2XOXA 1Q50A 3BBLA 2JAHA 3QP9A 4J7UA 3S29A 1CHNA 4FYPA 1LJUA 3VBCA 3IEMA 5B1SA 1U7ZA 5A02A 1BS1A 5DWVA 13PKA 3ELDA 3KZNA 3QXJA 1RWQA 2NN3C 4Z7QB 1SK9A 3U3JA 3QF4A 2DUNA 3S2FA 5JC8A 4I9FA 5T3YA 3T3NA 1ZA2B 5TLSA 2VA8A 3IEVA 2YWRA 2NPIA 3A4LA 2JT4A 2JJ8A 2W2KB 3TIXB 3NG1A 1ZWKA 3I37X 2HQEA 2VTKA 1DCKA 4F04B 1KARA 3VZSA 1AC5A 1YUNA 2YZMA 4F14A 4C7XA 3ISXA 4M7AG 4RIFA 1Q0LA 4RTXA 5ER9A 4MWCA 3UCFA 1XDUA 3ZLJA 3AHJA 2FRDC 4CM8A 2AD5A 1JR3A 4GG1A 1P2UA 1J1ZA 4YJKA 1NKVA 4K9PA 4YJFA 4J5YA 3MM4A 4XX1A 1VP3A 4KUDK 4BNDA 1MRNA 4Z4TA 1M72A 1ZH4A 4A9AA 3S7TA 4RC9A 4RHYA 2Y67A 3H2BA 2O59A 3KB1A 4UC4A 2VHCA 1F17A 3EAQA 4EHJA 2KHZA 4BAGA 5C0OE 1WEHA 3CCUQ 1C3OA 1UEJA 3VZRA 4N8SA 1DI0A 5KHLB 3SF8B 1TRKA 2X14A 1ZM4A 3TLYA 3WDMA 4AS1A 3C1AA 5JT1A 2BE7D 3OYKA 2V5AA 1EVEA 1R6DA 5BYAA 3VJRA 4KX3A 3JALA 4KN8A 3H04A 3KKKA 3O2QB 1NSFA 3EW7A 1Q82R 3WQZA 5H4GA 3QFRA 2B8WA 2GCPA 1VMIA 4G5FA 1U2DA 1BXKA 2WZPP 4A2PA 3AVWA 3PDHA 3GBPA 4QXOA 3RRXA 4KDFA 3ETLA 3T54A 5HJ5A 4Q66C 4FCTA 1X2EA 2WZDA 3H0EA 1N9GB 2BFBA 3B1VA 2Z6QA 2RMOA 4IAOA 3ABIA 2FH5B 1VPTA 3SSOA 3OPXA 1MG5A 2RGWA 2C4KA 3MF4A 3O4FA 2Q3BA 5IANA 2I2AA 4EO4A 3Q1KA 2C59A 5LDDC 2I87A 4H3VA 5B7QA 2CE2X 1E94E 4F7UF 4MMYB 2XUFA 5FPPA 1WVIA 4BFVA 1QG4A 1TJNA 3FYSA 2XNSA 1M8JA 2WD7A 3DBRA 3H16A 3PD1A 2ZRFA 3AVTA 3W3AD 4LRTB 1ZK0A 2JEYA 4UM9D 4RGBA 4PS0A 3KKLA 3QW4B 4INJA 3T1YB 3HSSA 3KAJA 1N7JA 2PZEA 1GT6A 3FYHA 4KQWA 1ZK1A 3OH8A 1RWWA 3UZUA 2B4TO 5FUWA 4IQGA 4TX1A 4EW2A 5LYJF 1OY1A 3CY6A 1VRVA 4RKRA 1ATZA 3F9IA 3DL4A 2D3LA 4E2ZA 2AF3C 5EQTA 4OMCA 4X34A 3V9AA 3FZGA 5DB4A 2GB4A 4WKGA 1FNNA 1UGVA 2GFIA 2BFPA 4AUNA 4JMPA 1PSDA 2HO4A 2PKRA 3VAZA 4F71A 1JR6A 1QOPB 2O07A 1YUMA 5T6MA 4RS3A 1CIJA 1PYDA 4R6WA 3CX3A 1Z73A 5ICMA 1XZBA 4BNHA 1GAXA 3C3CA 1ADBA 5M3BA 1XF1A 1GHTA 1E62A 1HE5A 4WXYB 3WWOA 5GZ3A 4EOGA 1SQGA 4H4EA 1OX4A 2OZVA 5SYAA 1DAHA 3THKA 4YAIA 3OQBA 4M8IA 1L9KA 3ZDZB 1JJIA 5KEIA 5A0LA 3PGA1 1HWYA 3CCMT 2YASA 2HZYA 4J4TA 3KCNA 4L2IA 4MQ6A 1H8EA 3O3CA 1KPGA 4J76A 3WRXA 1VQLT 1FLNA 1ZC3A 1TGYA 3H2IA 3QDFA 1NBHA 4PWZA 1P61B 1RWOA 1FWZA 1B7GO 3U44A 2Q3EA 5GVSA 4I5EA 5BSXA 3U56A 1YB6A 1ZGBA 4R7ZA 4G8JA 4Y2XA 2KAFA 2YOHA 4L75A 1XYGA 5JFOA 2P41A 4FEYA 2NG1A 3VUFA 5BMOA 4BNLA 3IQEA 5EUBA 4K9SA 1JFFB 2E2WA 2PJUA 4G4SP 1N2HA 5TIIA 3WGYA 3L46A 3TLZA 2C9CA 4Q3NA 3UJAA 3CB2A 3UAWA 4NP6A 4PYQA 3OTOB 1T26A 3MLEA 1T36B 4Y2YA 3C2QA 3ZWOA 4W5RA 4JXKA 1I7LA 4HVUA 2PMBA 4PONA 2ZZMA 1XROA 1LC3A 1XHFA 1AZLA 3H6KA 2PO7A 4AZ0A 3PFCA 2VOJA 2JMAA 2BFAA 1ZX6A 1HTWA 4ITVA 2QI9C 1EVJA 1FW8A 3R20A 8AT1B 1BU5A 4HQNA 3NHLA 1TL7C 3T9EA 1Z6PA 3BDUA 4QKUA 1Y42X 2WPDD 4MGEA 1ZGCA 4RCBA 5F9HA 1DHRA 1O4VA 3B6IA 1MVLA 4AECA 5ADWA 3I39X 4X1KA 1L4BA 3EPJA 3AB3A 3BB3A 1H2RS 4G7WA 5CB4B 3JVUA 1KVRA 1FFXA 4G1EB 3CPJB 5D86A 4Z2AA 1T2FA 1H3HA 1ZI8A 5JYEA 5WRFA 3RF7A 1TS9A 4GP9A 1LXCA 2JI7A 3K2BA 2O2SA 4Z2YA 3KKNA 1N8RU 1K86A 3I2YX 5AVOA 3UW3A 2H4JA 3LVBA 1FYVA 1PWHA 3EIUA 4EGSA 2AC2A 3SX4A 2C0IA 2FWNA 4X1IB 1DTSA 4OA5A 1NRJB 2FPGA 1OPXA 5K45A 3AFHA 4G0OA 5FI1B 3GA0A 3MJRA 4MW1A 3NU1A 1GNTA 5IM4A 4DLSA 2WUGA 1LNZA 4FS8A 1TUGB 3CFYA 5EUCA 4QQ8A 4UASA 2C03A 1QVRA 3W04A 1I8FA 2FPFA 5HXBA 2Z8YM 1PJQA 3F6EX 3IE1A 1TQ8A 4FMDB 2JIMA 2IYTA 3UT5B 1K06A 4IQ8A 1NP7A 1T43A 2JI4A 4JX9A 4Y98A 3JAWA 1N32B 3JV7A 2COZA 3QY9A 1W48A 3PX3A 2AQHA 3NP9A 3LVQE 4FNAA 1KQSA 2DZDA 4K9RA 1IAVA 1NQUA 4H7EA 3C85A 4WOJA 2DZ9A 4G1FA 1ZA1A 1H2AS 4KDEA 3FKJA 1VKOA 1BG6A 3PQ6A 3D8NA 3AR3A 4NBUA 3DF9A 4HVVA 1AZSC 2CEAA 4BL5A 1SKMA 3LBYA 5FPTA 5G1PA 1NN1A 1LWNA 3DHEA 5SZIA 3VV2A 3P9RA 2G9RA 2OC9A 5EQDA 2I7TA 1CR2A 1XWFA 1U2GC 2C20A 3H87A 1GFWA 3JCMV 2WFZA 1E7YA 3JQFC 5CVEA 3V8KA 3IT0A 3OKCA 5CRIA 2HQBA 2RAUA 2LTOA 5FWAA 3BHNA 4H7FA 5GAOq 5DYTA 3F5MA 4J3NA 3TB6A 1KD1D 5ARBA 1AKUA 5FBVB 4QE3A 5GZ1A 2CHUA 4BO7A 2M1HA 5IYZA 2PLWA 1D4OA 2VIIA 3ZIAD 5DGXA 4QV2A 3NEYA 3G1WA 2ZR7A 5KSWB 5I9BA 5BWCA 2CWDA 5SZJA 4CMJA 3M3PA 2P6RA 4C7VA 4FI3F 4EX6A 3AWDA 4UULA 3JARB 1ESCA 3EG2A 4OQNA 2BKDN 2QRHA 3FYDA 3E03A 3EEOA 3Q3JB 2EEZA 4JODA 3RRNA 3O5ZA 2XYHA 3CNNA 3T35A 3NHSA 5F4ZA 3W90A 4R40A 3VX4A 4OUKX 1JG4A 1AT1A 2CCGA 4J90A 2A67A 1VE6A 1U1DA 3LMKA 2VXEA 4JVNA 5K01A 4J2HA 4UAVA 3HCDA 5LKRA 3GGCA 2OCAA 3PBKA 3GGDA 1AKMA 4RD3A 4LY0A 1PIWA 1C0PA 3LOUA 3G2KA 2PL9A 3HBNA 1NUUA 1PGQA 5F2NA 5HX7A 3W8FA 3CO0S 4RHTA 1M8VA 4D82A 4XM0A 3ZNPA 4KV9A 3U7JA 5CFLA 3IQGX 3TZHA 4RPGA 4BNDB 1U3GA 2O2OA 1FBTA 2WVHA 1OLXA 3V2HA 3BXEA 1TLLA 2JFZA 4QYIA 4NMLA 2HQSA 1KO8A 3OURA 3V55A 1OYVA 3JPWA 3LY9A 4HAXA 5B2EA 1OWOA 1ODIA 3UIEA 2DTDA 3W5BA 1L1QA 1RT9A 1WUIS 5DLQC 2HW8A 3G8CA 4OB1B 3BMCB 4OL9A 4U3JB 1EP9A 4LDRA 3I1YA 5HM6A 2BR3A 4A2QA 2HNKA 3GEIA 3A9RA 2I2DA 4PZAA 4EAQA 4P98A 4PC3A 2LZJA 1UAYA 4K8OA 1EHIA 1YU6A 2VZ8A 1FC0A 2HMUA 2QM3A 2GRJA 4ZVUA 5DM0A 4XUEA 4PLFA 1PC0A 2ODTX 3ITKA 2FMUA 1Q84A 1SHTX 1T9GS 4Q19A 2D13A 1EVYA 2O2CA 1QWEA 1U02A 1L4GA 1EVIA 1YGYA 4JHLA 3MCAA 1BU8A 2EPDA 3LPAA 2JLCA 5CFPA 4WGGA 4YMTA 4P3PA 2JK0A 3PGVA 3FPJA 3KQYA 4KMRA 3UV6A 2JIRA 4HUQB 5AVRA 1ISIA 3IMGA 3NDIA 3EODA 4KV7A 5I8ZA 2NO6A 4MCAA 1ZD9A 4JJ6A 1XA0A 4UEWA 3QKSB 1J90A 3I9JA 2DBMA 2YWEA 2Y71A 5I6DA 3OYLA 2GKGA 3PKIA 4IZHA 3LP8A 2WD7B 2JJ2D 4C4PA 1SVNA 1QP0A 4O2AA 4YAUA 3FROA 4E09A 2ZRGA 1EJ2A 4EB6B 2FZCB 3T7IA 2WB4A 2W6ID 2VH1A 4A4HA 1NNLA 4MW7A 4BOYA 2LCLA 1SU7A 4E5YA 4HAUA 3PVZA 5NLLA 4MZDA 2FN7A 2AOXA 2LIPA 3U4QB 5FRDA 3W5CA 3KYBA 4UUOA 1WDMA 2PBZA 4GVLA 8ATCA 2X4YA 1X9IA 5BT8A 4NONA 5B1IA 1V1RA 5JDCA 5FEUA 5COQA 1JBMA 1JKJB 2PWZA 3ZWDA 4R2HA 4RPHA 4P0PB 5L3QA 4KR0A 1CUJA 1N9SA 4C92A 3MN1A 2ZSFA 3DOFA 3N8DA 4ZJUA 3MK31 1Z45A 2HBYA 3V4OA 4ARAA 1A4XA 4WFQA 3ERCA 2WG1A 4QYSA 3DOHA 4RFSA 4G0UA 2IH4A 3R3JA 4BYGA 2EC5A 1VXRA 4M1YA 3MLAA 4IV5A 1G4HA 5KJFA 4F5YA 1IEQA 2FWIA 1IHVA 5U4QA 1QIGA 2EGHA 3O82A 4I2NA 4D3YA 3HPRA 5ED4A 2XNHA 2Y6VA 1W6XA 3S4YA 3X25B 4QFBA 3T9BA 1JXAA 3R7NA 5KE3A 2PXXA 5F1PA 4EHAA 1PJTA 3CW8X 3QWIA 5IEBA 1QV6A 3AERA 3VI4B 1OB5A 2RB5A 5BUQA 2V4ZA 2RH5A 4L2IB 4G26A 4AICA 1UB4A 2GCIA 1DRUA 1P2GA 1F20A 1QP8A 2DEUA 3U44B 2J3LA 2WLTA 3EPPA 1L7RA 1GRRA 1LVUA 3PFFA 2ZVDA 4BMSA 1RAIB 1MIOA 1VRCA 2ZL7A 1NQWA 1O94A 5AW0A 1NZ9A 3ZHBA 4XD7A 2Y1WA 4QUIA 2NZXA 2CDNA 4B40A 3T5MA 2C00A 4C8QE 2I8LA 1YE8A 4UW9A 4RY2A 1P81A 3O03A 3C7KA 4JJGA 3G0BA 2XYRA 2BDTA 1JHAA 3OY2A 3G05A 3GLXA 2LCQA 3FGPA 2A94A 2E6KA 4IUUA 4M89A 3NTKA 1GPWB 4TMKA 1N2EA 2Y4OA 3M82A 1FSSA 4CKXA 5GAN7 1LEHA 2QS9A 2B6NA 3CR7A 1V1CA 4MAFA 1QOQB 4FHZA 1P0PA 5FHRA 4C3VA 2XITA 3AIOA 3HFGA 1XTZA 2OP1A 4DPLA 3RIHA 4POAA 2G5PA 4IJ6A 2ZBQA 4Y8VA 3OEYA 2ZTSA 4DDHA 1KVTA 1BQ4A 1ZN8A 5ALRA 4KMSA 4PZLA 3RBVA 2A3NA 3BD9A 3KXDA 5CYGA 3QEBZ 5IG2A 3T3MB 1PWZA 2BMJA 4YRIA 3CKLA 1LPLA 5JUWA 1SC4A 3L4EA 2A1UA 4H16A 4ND8B 4X1KB 1VLHA 4RVGA 1NVDA 3O8QA 1YB2A 3CNHA 4ENPA 1DS6A 3PFNA 4OBEA 2ZRJA 4DZRA 5EOVA 2VEDA 4R2MA 3LCJA 3L07A 5AOBA 3WIOA 3RAPR 2VDMB 5EWLA 4AJEA 3UMBA 2V6GA 2CJYA 2YHSA 4E14A 5KYWA 4Q00A 3T41A 4ZK6A 3QYHB 3RNJA 1YVPA 4BRUA 3PHCA 1RYZA 2FPPB 5J5VA 3W79A 2VPWA 1SXGA 2I8AA 4US1R 1DEKA 5E0KB 3ZH9B 2FPGB 4FIBA 2FSIA 2O3RA 3TGPA 2C61A 1N57A 2PSEA 3U7RA 5G0SA 3G2PA 2EQIA 4IOMA 2TMGA 4X1YB 1SMKA 3D4LA 1DAGA 1A2BA 3R7WB 4ZYTA 2ST1A 3ZE6A 4CDGA 4ZO7A 2F8TA 2HQXA 2FPRA 3FJ1A 2DTIA 5JAZA 3E8XA 3OQMA 2XKOC 3HO8A 4QOEA 5KDLA 3I6BA 4LI3X 1TPYA 1WJQA 1RCUA 4DG9A 2O8DA 3JAWB 3VKUA 3VYWA 2IOFA 1Z5PA 4EECA 2HDWA 1MDBA 1EPUA 1L5RA 2BGWA 4BNKA 1HL3A 4B3TB 1OGIA 4GOND 3W2GA 1BXGA 2NPOA 2O4XB 1ZA1B 3BC1A 4N5NA 3JCMe 2BC9A 3IBCA 3LX7A 4JLNA 2OBNA 4YP5A 1PV1A 1QH8A 1QHNA 4MDYA 1IZ9A 4QQKA 1VYVA 3LBNA 4CLRB 3BNWA 3M0RA 2JFHA 4NBKA 2XDDA 5CB6A 4UBLA 4OV6B 3GL9A 2GJSA 2Q1XA 3KVRA 3LZ6A 3VGJA 3HVIA 4L1KA 4MJ7A 3PR1A 4Q0MA 1TKAA 1KFJB 4B3JA 3BEOA 4D9FA 2YRDA 1GLGA 2YHBA 2DTEA 3OCCA 1WQWA 1VJ0A 3EDCA 1TIKA 1YOVA 3QVUA 1WXFA 3RUAA 3Q12A 1QE3A 4G1MB 1EFNA 4O8ZA 4NCXA 4V0MA 3LQ2A 1UBNA 3D8UA 3GRPA 3CW9A 3N86A 4CUKA 2BJVA 3T51B 2C77A 2E1PA 4GF5A 5KQGA 3KDAA 3HSBA 1TD1A 2H29A 2XCOA 4JZ3A 4AG3A 3RRBA 1XBTA 2FETA 4P08A 4NU5A 1W9XA 1JQDA 5F4BA 2BUBA 3O5AA 1OBCA 4DLAA 2JGIA 3KFXA 4JL5A 1M90R 3W1WA 4ALLA 2YHAA 1K89A 1HFKA 1AEYA 3DMRA 1NVWQ 4A0GA 5GAN5 3ZNQA 3KWLA 4F46A 3KHTA 2QL5A 1IPFA 4LHYA 5KU1A 3GDFA 1VPVA 1LJOA 3NWEA 2HGZA 2P3LA 1JDZA 2VO1A 3AUKA 2ZI4A 1S02A 3QY0A 3HGTA 5LL6S 3V6MA 4PXAA 1M34A 2OLJA 3X3HA 1VYUA 3IR6A 2NVBA 3DDCA 4IP0A 1U7TA 5CKHA 1X75C 3W1EA 4DYHA 3OPOA 2I3AA 1J5XA 4HLUA 4U5QA 4CNBA 4HXGA 1IN1A 3ORRA 4CLOB 3DMPA 5IYPA 3NKLA 1RMTA 1AX9A 1JKMA 2VJDA 4Q37A 4WCFA 2ZJ1A 1MJGA 1OLXB 1XMJA 2ZREA 3AM4A 3MRSA 1T2NA 4KJZA 1GNSA 1USKA 3EIHA 4QYIB 2D8AA 3MW8A 3NYIA 4XSHA 1T5LA 3AY3A 2BEJA 3UM9A 3C8MA 1YBAA 3WE7A 1VQ9A 2BTEA 4BV9A 3PKZA 1M7HA 2PMCA 4ZD6A 1A4IA 3E82A 4QYTA 1TO1E 4XYEA 1DX9A 2Y1OA 2FFQA 2UUAB 5IMBA 4M7AC 1D03A 2WSLA 3ICVA 3L0BA 3VR4H 2VRCA 4OMLA 2P77A 4FD2A 3VU3C 4M75E 4J3JA 5D7NA 2PLAA 4IQFA 2QGFB 3CEMA 4KK3A 5A3VA 5CX1B 1H1LA 3QJ5A 2P75A 3DBVO 4CMCA 2AHOA 1E8NA 4HRYA 8ABPA 2ZIXA 4OFZA 3MCAB 2HXGA 3WV4A 2JKYA 3AHCA 2B5OA 4ZAYA 1GILA 3L18A 3MSCA 2GVNA 2UYHA 3CYFA 3WGVA 5AHOA 3L1JA 3S7ZA 3VJKA 4U7DA 2ZPHB 2NAPA 2HDNB 4Z4WA 2W2XA 1J21A 3INYA 1P2BA 3EFSA 4ETMA 1WJRA 3CUKA 2R97A 4MVJI 1G5PA 1ETHA 2H48A 3RTEA 1EDEA 2KM1A 3N2YA 4HSGA 6YASA 1ZXBA 1BD3A 1ZNWA 2P0QA 1NKTA 4PFSA 2B2CA 5INTA 4EYGA 1NQTA 3KBBA 4ZT7A 1XNGA 9ATCA 2X6WA 2IZ5A 5IH2A 3UAXA 3PEUA 4JUDX 2HUPA 1COWD 3PA8A 5L8VA 1KI9A 4BY6C 2QG6A 2GCNA 3P2MA 5BV0A 1W2BS 1NBMD 2CXNA 1JH9A 1H1DA 3PRKE 9ABPA 1SEVA 2GNPA 2V1QA 5JQGF 2GJKA 2ZUSA 1T8SA 6GPBA 2ASVA 3Q9UA 1G20B 4ND7A 1V5GA 5EMMA 3PUMA 4H9GA 4EPYA 1MO2A 2PU9B 1KZ7B 4Q21A 2BBWA 2XZOA 1RLOA 5L3QB 2NGRA 1T6YA 2O3TA 1RRGA 1U9ZA 1E79D 3R40A 2NUZA 4RFSB 4XZ3A 2RHMA 4CIDA 5FJJA 4ZMBA 3F3YA 2BZ1A 3ZZ0A 1NNI1 4JK3A 3ZC3A 4MLPA 3SYMA 2AUTA 5ITZB 4Q9KA 4DUPA 5GONA 4L9RA 2DYKA 3Q3CA 4BGVA 1KJNA 2AYZA 5LA6F 1RZ3A 4RFLA 4RELA 1SBYA 4M9QA 1M2VA 1XALA 2D5AA 4D92A 2XNDA 1HE2A 5GM2A 2FPWA 5CLLA 4GBMA 5C53B 4J03A 5KX5A 1LGYA 3B3QA 4UZFA 2FMXA 3TZLA 1UUFA 1D3AA 2JCVA 1YNOA 4B7ZA 1VGQA 1TYZA 4RZ3A 2CLSA 3GB9A 3RS2A 3WLRA 3BRQA 3U4IA 1GZ5A 3LCRA 3PJGA 4JELA 3K0HA 2D74A 2AX3A 4U7PB 3JVDA 5DU2A 2BMVA 2EWMA 5H4HA 2V3CC 3HLKA 4W5OA 3CXUA 1I0CA 1YDHA 2M1XA 1OI2A 4TMFA 2VDPB 2C0TA 3QXGA 1WMBA 4R9RA 3OA0A 4K05A 1Z5UA 2ZIGA 3M70A 2O8NA 3ZEHA 1RKBA 3ESYA 3MEWA 2Q9UA 3SFTA 1Q3HA 1E58A 3KQWA 3ZXXA 2YIVX 1DNPA 3KEQA 3GD5A 4FEGA 4RD0A 4KAFA 1UK7A 4MPJA 5EWMA 3I0MA 1JDBB 3AYZB 1OFIA 3ZHZA 1WZIA 3WFJA 3CLRD 3L8FA 4C7BA 4ANJA 1ZSZB 5CCAA 3QA9A 4Q4HA 3TQ7P 2I2FA 1VIFA 4ALNA 3QMMA 3H97A 3CV3A 4R1TA 2O2XA 3D4PA 2J0UB 4D99A 1CRPA 3IX7A 2FPOA 1FQWA 2GM9A 3FBTA 4BFZA 5DIZA 4NABA 2WKRA 2RHHA 2QWXA 4HEJA 2R66A 4FL6A 4IV0A 2YW9A 3GIRA 4HDKA 3I62A 2V7VA 1Z9QA 1QG0A 2A1UB 3VKVA 4L5AA 1YKGA 4F1JA 5FUXA 3GJ3A 4GPTA 3L0IB 2G83A 3O8QB 2PE3A 4G4SO 1JLKA 1ZIDA 2WU1A 3CONA 3TW8A 2K7ZA 5IABA 1VL5A 2XR1A 2PFSA 3BRCA 2JD2A 2C2WA 1IL0A 2X0NA 4CR7A 1FBNA 3UA7A 2X0FA 2ZWOA 4G07A 2HBPA 1DO2A 1ZNQO 2C9BA 2YUOA 4G0ZA 3MRXA 1S9DA