2DEUA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
364
structure length
364
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA
total genus 85
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2deuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2deuA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2deuA01
3CLTC 2BV3A 2QJOA 4H3SA 3L92A 1A8PA 2JA2A 2C5SA 2WSIA 1GR1A 4MW9A 3ZJVA 1JHDA 4M0LA 1K8AD 3JXEA 1KQSB 3I56B 2A1UA 3CA8A 1IH8A 3LOQA 4MUJA 4HE5A 1Q86D 2XNCA 1JZSA 1VQ5B 1Q81D 1EUQA 2GPJA 1F20A 2OTJB 3UC5A 2YWCA 3FNRA 1DNPA 3CVXA 2YWHA 2QTZA 1O5TA 4ZCSA 4HE6A 4YMIA 4ZCLA 5THXA 2HZ7A 2E18A 3L93A 4G1VA 2B7CA 3UK2A 4JXXA 4CQNA 1H3NA 3CW2A 1QUFA 3CRZA 3U6KA 1E64A 1QG0A 2NSYA 1WKBA 4BPRA 2PIDA 4NZPA 4CDMA 4MUEA 2D54A 1TYCA 3MLAA 1O94C 2O8VA 2J5BA 3AL0C 1O97D 1MAUA 1N2GA 1H42A 5K0TA 1PG0A 2DY1A 3OZWA 1F7UA 2VNHA 3IVXA 4RCYA 3W5HA 2X0KA 5DK4A 3SEQA 1V8FA 3CC4B 1I6MA 3H99A 1I2DA 5DB4A 1XE1A 5KHAA 2B7LA 5TEVA 1QFZA 4R71A 2CV2A 4U63A 3S3TA 3FDXA 4NCNA 1N8RD 1QQTA 2OK8A 1IQUA 3G6KA 3ZXSA 3G6EB 1VQ9B 1ZH0A 5DEOA 1QFYA 4AS1A 3P0HA 1WQ4A 4FN5A 1D2RA 1EXMA 3IDFA 3SYTA 4AQ7A 1S4MA 1ULHA 2QMUA 1G7CA 1MBZA 5TR9A 1KQPA 3KFLA 3KT0A 4DLPA 3CXCB 4YHBA 3OW2B 1KTVA 2QUJA 3CR8A 3QTBA 4OJMX 1SM4A 2D5BA 3ISJA 3OTWA 4F3RA 1EFVB 1R5BA 3WBJA 1WJGA 3Q4GA 1N2IA 4PC2A 4HK4A 3AVWA 1BX0A 1GJRA 1U3CA 1NZJA 3FIUA 4MUKA 1D1NA 1Q77A 2CYAA 5H5JA 3QFSA 4F7DA 4Y9RA 1KAQA 1M83A 1NUTA 1X6VA 1LW7A 3IVGA 3RK0A 1EE1A 3K9WA 1Q19A 1WZ2A 3CCUB 1FYDA 2PG3A 4GRIA 3E1YE 1KJZA 3FWKA 3IH5A 4ARIA 4P6VF 3LE8A 1W35A 1JA0A 5AHWA 1EFPB 3ZJUA 3JQQA 1YJ9B 1J21A 1YI2B 3COVA 1EXDA 1EWYA 5TEWA 1N2JA 2E89A 5JBQA 1JGTA 2XRYA 2HMAA 1TUIA 1OWPA 1HYBA 1TEZA 5H59A 3CCLB 1VQ7B 4MVXA 4AC9A 1WOYA 4JFAA 4YP5A 3CD6B 5EKDA 1O0CA 2HCJB 3HGMA 1MRZA 1PFVA 4K03A 2DR2A 4FWTA 4B3XA 1QH0A 1W34A 1B6TA 2A1TR 5KSWB 5HXBA 4ACBA 4YAUA 1WXEA 2R5WA 4ZGNB 2BTEA 3MMPA 4NBSA 3J81k 4MUIA 4DNXA 3IMEA 4U7JA 1N2OA 1JMVA 4LBWA 4C0SA 4HPWA 1WXFA 3QE2A 3G71B 3M5WA 1ZUNB 1GAWA 1TFUA 3H05A 3D6VA 3QE4A 1V47A 3MHPA 3TNJA 1M8GA 3P52A 3OZUA 1ZJWA 1JZQA 3SDBA 1EFPA 4UAJA 2RC5A 4ZGQB 1U2RA 3H9CA 4ZT6A 4PC6A 1WXIA 3ILVA 4MW2A 2GM3A 3DV2A 4DDKA 2EIXA 1JEDA 5TY0A 1I6KA 3NV7A 3VGJA 1PG2A 4TMWA 1J20A 2VTBA 3SJZA 3RFFA 2PZ8A 4NAUA 4R2MA 1KQOA 1FNDA 2B5OA 3W5VA 4ACAA 1YHQB 1N2BA 1G7RA 2I1LA 4QBTA 3GLVA 5AN9A 4C43A 1QTQA 2BGJA 3PNBA 5FO0A 3LO8A 1K4MA 1N2EA 2YWBA 2BM0A 3ND5A 4KPUB 4ZT7A 4ZCPA 1N75A 3WNCA 1KK0A 4B48A 3DLAA 1KRHA 1Q11A 3VRHA 4EG1A 1I7PA 1WQ3A 3FJOA 2VNKA 1VL2A 4R0NA 3VNUA 2BSAA 3B8HA 4PC3A 2QTMA 4DDMA 1E62A 2A1UB 3ND6A 1Q15A 1S0UA 4P2BA 1O95C 1VBNA 2JANA 3VU8A 3CVWA 4YP6A 3ZBUA 1G8GA 4B4DA 1QNFA 4MYUA 3CLSD 4RPIA 1F4LA 4ARCA 2X3FA 2QA4B 1YITB 1ILEA 1EFCA 2DETA 2YXNA 1N77A 3AGPA 4P3YA 3W2EA 1NURA 1K73D 1ZH6A 1QGAA 1H85A 3HMQA 4B47A 1F60A 3ZUGA 1R5NA 2PLFA 1N0UA 4Y7CA 4RD2A 4Q7JB 1B23P 4A91A 1M1ZA 4EG6A 4CT0A 1OWLA 1TQ8A 2E21A 4HJRA 1T9GR 1T6YA 1N1DA 2PMDA 1N3LA 3NBKA 3Q12A 5TGTA 2BPOA 2CNDA 4EG8A 4QHYA 3HL4A 3N2YA 4E1AA 2J4DA 4M4SA 1KAMA 1TYDE 1NUUA 1FNCA 3C8ZA 3CLSC 4NDAA 1QFJA 1WDTA 3PRHA 1VQOB 4WQMA 3QFTA 2X3UA 1TTTA 1VQKB 2D13A 1ZM4A 4KR9A 3RK1A 4MUGA 3ZXIA 1EJ2A 3QFRA 1AMOA 3CCSB 4Y9UA 4KR7A 1J9ZA 2VXOA 4YALA 2DUMA 3ZZUA 1GN8A 2YY5A 3RBAA 1IHOA 3IOEA 4DDHA 1H1TA 4MUNA 3RHSA 1W87A 4MW0A 1NSYA 1WXGA 2ZP1A 1CNFA 3IOCA 1OWMA 3TQOA 2FX3A 5KCMA 2BM1A 1HA3A 1MC1A 1DARA 2CV1A 1QGYA 1VBKA 3CLUD 1BQEA 2Z08A 2AZXA 4ND7A 3VNVA 3CCEB 1WY5A 4RD4A 1OGJA 1FNBA 4B44A 4PY2A 3KT8A 3ZGZA 4K1XA 1ZUNA 3MMXA 3CLUC 1JILA 2JAXA 4WNYA 3GUZA 1JIIA 1IB0A 1N0VC 1TVCA 4ZCRA 2NZ2A 3WXMA 1KC8D 1O95D 1Q7YD 3H97A 1N78A 2DPLA 4LC0A 2NPFA 1KORA 5J59A 3AG5A 4G6ZA 4I6EA 1UFVA 4PC7A 2PZAA 4CDNA 1M8KA 1EP1B 3WYAA 1YIDA 5IJXA 4B43A 5J58A 3ZZTA 1SURA 4G5YA 2A88A 1S72B 4NATA 3AKZA 3WNDA 1K9MD 1G8FA 4JYZA 1XNHA 1FRNA 2YWEA 1OD6A 4MW5A 1G8HA 2OTLB 4EF6A 3DO8A 2V0GA 3U6BA 1M8FA 1M8PA 2XRZA 3QSYA 3KT6A 4NX2A 1FNMA 4DJAA 4ND6A 3GMIA 4ZCIA 4ZCTA 4J0QA 1PFWA 3AIIA 3X1MA 4MWDA 1MB2A 1DG1G 1TLLA 4ZCMA 1QJCA 5TS2A 4TMTA 3Q10A 3OJWA 2Z3VA 1D2EA 2X1MA 1YUMA 4OUDB 3A04A 3TZEA 1CNEA 2WQ7A 1GTRA 4RD0A 2YWFA 1VQ6B 4YP7A 1IVSA 2QTLA 1IFXA 2RD2A 2EFGA 1X8XA 3CCVB 1KK3A 5LFAA 1ELOA 3K32A 2E0IA 4XFJA 4EFKA 5HUJA 2CSXA 2DEUA 5TV2A 1F9AA 2BF4A 1EP3B 1CT9A 1YJNB 2C78A 3HV0A 4L2IA 1B2RA 2Z09A 5F23A 3OJXA 3COWA 2J07A 3N9IA 4MULA 2IP1A 4TS1A 3UY4A 1R6UA 4MVYA 4XSVA 4J76A 1DDGA 3A4IA 1QU2A 3SEZA 1WXHA 1U7DA 4YBRA 2CUZA 3P27A 3NBAA 2CV0A 3WY9A 3FHJA 4MAFA 2J08A 2VYQA 2C77A 3QFCA 1RQGA 1JB9A 1MJHA 2PIAA 1OB2A 3IUEA 4MQ6A 4TMXA 1VLHA 3VMFA 1J70A 1IQRA 1JEEA 4RD3A 1YIAA 4L2IB 3CCQB 4KR6A 3E20A 5DSZA 3CC2B 1AIPA 3CCMB 4OUDA 3TZLA 1A8HA 1NYLA 3UOWA 3CVUA 1U3DA 3SZ3A 3CMAB 1K4KA 1U7XA 4WSOA 1T9GS 2BN4A 4JZYA 3SZGA 1KK1A 2RC6A 3LCJA 3PENA 2R6HA 2VNJA 1BS2A 1YI8A 3H9BA 3I05A 4R2LA 1QGZA 2D74A 3JQRA 2PFSA 4BWVA 1KH1A 1XNJA 5GV8A 2BVNA 3W2IA 4UZEA 1YJWB 3D6UA 5LM3A 1EUYA 4S1OA 4YAWA 4LBVA 2EJCA 1KH2A 3COZA 2ZITA 5J5AA 3VO2A 3P0IA 1LI7A 4U8HA 4ZT4A 1GVHA 3OP1A 1ZM2A 4FZJA 5GV7A 3VO1A 1G7TA 1FRQA 3W5UA 1KKUA 4K0RA 3CCRB 1O97C 4MW4A 3N8HA 3CVYA 1KP2A 2G36A 1BX1A 1BJKA 3CCJB 2QUHA 3CLRD 3IMCA 4X0EA 1EFUA 1ZM9A 4N3GA 4G5GA 1G59A 4ZT2A 2QDXA 1QVGB 3INNA 1U0BB 4LBZA 1DDIA 5HG0A 1QRTA 2AKEA 2B7BA 2OK7A 1IQ0A 3PNYA 3MXTA 1MB9A 4M2LA 1FFYA 1TYAE 2V0CA 4FK8A 3G59A 2VNIA 5IHXA 1OGIA 2E1RA 2IELA 2J09A 1GTSA 2QUIA 1KD1D 1GLNA 3COYA 3WBKA 3AVUA 4N3NA 2XEXA 1P7PA 1ZM3A 3IOBA 1VQ4B 1VBMA 3DPIA 2A86A 3ELBA 1GZUA 3BL5A 4KPUA 4AF6A 4DE5A 3AVYA 5BNZA 4MVWA 1KP3A 1YUNA 1XNGA 1J1UA 3G5AA 1I6LA 2J7KA 4MLPA 4EG4A 3FOCA 2YWGA 1NDHA 4H9GA 4RD6A 1CQXA 4M1KA 1VQMB 2QN6A 1OB5A 1JIKA 3FI0A 3AVTA 1N2HA 4XFDA 3V76A 5DASA 3B82A 2OV4A 4MUHA 1NUQA 1JJ2B 1FDRA 2CYBA 4ZV4A 1QRSA 1OBCA 1XJQA 2WQ6A 1O96B 1MOPA 3KT3A 4MWEA 5H7XA 1GPMA 2QJTA 1O94D 1G7SA 1EP2B 3MCAA 4UZFA 1LI5A 1H3FA 1GAQA 4EG5A 4RD1A 1H3EA 3LVBA 4MVCA 4MWBA 4EGAA 4LBYA 3IUBA 2RE8A 4JXZA 2O5RA 3E27A 3IODA 4MUFA 3ZJTA 3FG9A 5FA6A 5H16A 1JNYA 1TYBE 1NJID 2QTNA 2PZBA 2QEXB 3ND7A 1IRXA 1EFTA 1OWOA 4I6JA 3TQIA 2BMWA 4RUKA 3CMEB 3IMGA 1KQNA 4MWCA 1VQNB 3A05A 4TN1A 1O96A 1M1KD 2HGZA 1IJFA 4ZT3A 3AVVA 4EG7A 2CFOA 4QRDA 2AHOA 1R6TA 3X1JA 2H2AA 4QREA 2CT8A 4J75A 4Q16A 2DCUA 1NUSA 1D8TA 2GOYA 4TMZA 3HZRA 4EG3A 3ZBTA 2HDNB 3AG6A 1GO2A 1EFVA 2X1LA 1PFYA 1T6XA 5FNZA 3I1FA 3JQPA 1VQPB 2H29A 4ZT5A 2TS1A 1O0BA 4QFMA 3MUEA 3ZC3A 2DXIA 1UMKA 2A84A 2A4MA 2GQFA 1F7VA 2XNJA 1GAXA 4TMVA 2IJGX 1KK2A 1K92A 3P0JA 3FETA 3U1VA 1NI5A 1NUPA 4MW6A 3FY4A 1J09A 1R5OA 3UMVA 2AG6A 2DLCX 2OQ2A 1QRUA 4RJLA 4PBSA 3X1KA 4YAOA 1MAWA 4YAFA 3W2GA 4EH1A 3FPKA 2ZUEA 3AFHA 5FO1A 1Q82D 1VQ8B 3PXUA 3FH0A 5HUHA 3IVCA 4PGOA 1IJEA 1YIJB 3TS1A 3P26A 4MYTA 4PBRA 4ZCQA 3AGQA 1KR2A 1QUEA 2VZLA 2PXHA 1PFUA 1JA1A 1J1ZA 4DQKA 1M90D 1OBHA 2CRVA 3U2QA 2QUKA 1O6BA 4PBTA 5KWVA 2BYTA 2DERA 2CYCA 3B78A 3F3MA 3CLTD 3MLBA 1OWNA 3ZIUA 1QVFB 4U9UA 5JBNA 1Y42X 3WNBA 4I6GA 4MW7A 2A1TS 4DQLA 4Q93A 5LLTA 1VQLB 3AVXA 3N05A 1K97A 4NAHA 3ZZ0A 4IW3B 1JECA 3HFJA 4PC1A 2EL7A 2QJFA 4GU5A 3ES9A 4G5FA 5EMNA 1XB2A 3CPWB 3CC7B 3QTTA 4M53A 2QTRA 4MW1A 1QX4A 1QU3A 4RCZA 2ZUFA 3W2HA 1T6ZA 4G1BA 1E63A 4KKVA 2GKSA 2VTBB 1SKQA 2BGIA 3I55B 1COZA 2WB2A 3A2KA 3CB4A 2A7XA 1W2BB 3OZVA 3CVVA 3W2FA 1JIJA 3SP1A 4HJXA 4AF7A 3G4SB 1M8JA 1NP7A 1YULA 4F4HA 5K0SA 3RJZA 1KH3A 3PNVA 1R6XA 3CLRC
chains in the Genus database with same CATH superfamily
2YMQA 3E9RA 4L7QA 2V6GA 4BMDA 1F8YA 3B8EA 4TZKA 2AB0A 1H5QA 1KVSA 4OF4A 3UK6A 5JDIA 2NWQA 1GYQA 3M49A 3FJPA 4KX3A 3RYIA 3T7TA 2DILA 2G9RA 4LVNA 1OU8A 1RADB 4LFAB 3JR3A 3LRXA 3KQTA 1RCFA 2G08A 2IGTA 3X1WA 4DREA 4A36A 3A35A 1QORA 4WKOA 3JYPA 3NKVA 2W0ZA 2D8HA 1V5IA 4EUFA 5FA8A 4H35A 3GNGA 3ZHRA 3SWWA 1FS6A 2XMGA 4JI1B 5EPUA 1QZZA 1R4MB 3FNRA 4X97A 1WTAA 5F52A 1PNRA 1GNPA 2DQ4A 5TRTA 2UYOA 4ZP1A 5J4HA 2QXFA 3UK2A 3UG6A 2ZB3A 3SFMA 2BD0A 2GYWA 1VCOA 3GN1A 1IDN1 3Q3AA 1JO8A 1QHGA 4YRKA 3GJ7A 1VKRA 4ZZIA 3SR3A 5ENDA 1XI2A 2YASA 5G1NA 3TCXB 4JUFA 3U9TA 2AR9A 3VYTB 4E6PA 5TPZA 1GQYA 4DJJA 1CJSA 2O5VA 3S1AA 5JVDF 1O97D 5DKFA 4FC7A 3BWMA 2C7OA 1PFQA 4WF2A 4P12A 2CWDA 3KQYA 5CVJA 5GM1A 3GHYA 1Y1KE 5HDBB 2YNMC 1KZLA 1A04A 3SHWA 4O4JB 4AJKA 1R66A 1IUPA 2VJKA 4HR7A 4RF2A 3HJTA 4R9VA 4ZOCA 4LY9A 5KCZA 1AQNA 3V4RA 4GZ5A 2XVZA 1VQOQ 1HI9A 1PZGA 4J9VA 3RS5A 3USCS 5JY6A 3L42A 2JZNA 2LX9A 4DBQA 2JIPA 1Y4SA 3CKKA 2GBQA 3VPGA 2IUTA 5DLYA 3R7WA 3TOXA 1JJ7A 3IHWA 2YMPA 2JI9A 5DEOA 3BXPA 1R27A 2F48A 4L50A 3GZTB 1UF9A 1PJLA 3EW9A 4GLMA 4QPPA 1ULHA 5A7GA 3WGQA 2W6ID 2EJWA 5DXAA 1CF9A 2DR0A 2XGOA 4DVGA 4C8QC 2OI3A 2R7LA 2ZSDA 1SBTA 1VHTA 3IO5A 3L6CA 1F17A 1MVNA 1VMDA 1XFOA 3P9CA 3QTBA 4NR0A 1KBOA 3FRJA 4F3RA 1EA5A 4LG1A 4JSTA 2FG0A 3NNDA 3NYQA 4EWLA 3V1UA 1Q84A 5J1SB 3GJRA 4Y6SA 1U3CA 2G28A 2GJ4A 2YFHA 4K6MA 5IAJA 3AJEA 2QPAA 3BFKA 3GT4A 4PJNA 4PZUA 3BF7A 2WWYA 1CG6A 1LWNA 3DKRA 1NT4A 3BQ9A 3LT2A 4KFUA 4KQ2A 2K2MA 3CCUB 1LKZA 2I03A 1MPXA 3FPPA 1NXQA 1OPLA 3DVAB 3IUMA 3IR7A 4QGAA 4CQMA 1RAEA 1QPZA 1CF4A 4ZRMA 2RN8A 1W35A 3QLJA 2Z43A 1K86A 2DLNA 3ZHYA 1MCZA 2GDZA 3FFXA 4INAA 2WNHA 2ECOA 3BXXA 3LSYA 3C3PA 5CIUA 1O57A 2OCDA 1EXWA 3JALB 3QYGB 1XDUA 3N8DA 1TUIA 3FAZA 3FN4A 5DI3A 3RS2A 3VKUA 5K05A 3NP7A 1Y6RA 2CT8A 1XCPA 3A1PA 3IEIA 3TAHA 3MRVA 2O5EA 5EKDA 3PR2B 1J7JA 4FDAA 1MRZA 2CMHA 2I6GA 4ANFA 2BCJQ 4OQDA 6PFKA 1PHTA 1KMMA 3FB9A 3UDCA 3JYQA 2LCFA 4GSYA 5DP2A 1H66A 2P0PA 4D8UA 4DNXA 3K6SA 1UINA 1CZHA 2A94A 2NN3C 1IPEA 1JMVA 5AKXA 3UV3A 1V95A 4ZIRA 3A6KA 3LHSA 1DRJA 2A0YA 4YJ3F 5EMJA 3TLEA 3JCMP 4ZOBA 1SG5A 2GGSA 3QNMA 1EBBA 1ZJWA 3SDBA 1IK4A 2W6IA 1JEQB 4XAXB 2OGSA 4ZT6A 3ZWMA 1KC8U 5DRTA 3Q7PA 1QAMA 2Q3LA 1UEBA 1RBMA 3S3MA 1Z6PA 5C51B 3VNSA 2HK8A 3C15C 2FJPA 4Q5WA 3NHZA 2B69A 4Q7QA 1ECGA 4AMVA 5JD4A 5CVEA 1NKSA 4NAUA 2A57A 1YFJA 1PLJA 1JQLB 4LTMA 4K9QA 4G1UC 5CMLA 1U9YA 3E05A 2HHLA 5L3QB 1QTQA 2CP2A 2WWTA 3FZGA 4PFQA 4Z8XA 1WW8A 1LRJA 1RRMA 1GZ6A 4RKYA 5DLQE 1BW9A 1KIMA 1TQHA 1Z6YA 5GMKl 4UCQA 4B6RA 2FB7A 4ZO6A 1AM4D 3NOVA 2CJFA 4NQZA 3C97A 2J9ZB 2QNBA 2ORWA 1Z5ZA 4R0NA 3R40A 3BEDA 4LJSA 1KFZA 4M77A 3QPCA 5JSHA 3LK7A 4NESA 4JLSA 1IHYA 3T5MA 5K4AA 4A63B 1KVQA 2Q2QA 2Q3JA 2YXNA 3WWEA 1UGPB 1B34A 4RDLA 4BY9E 3CMET 1QGAA 3CZ9A 3CZ4A 2RBKA 1R5NA 1Q2XA 4GD3Q 3SIPA 6YASA 3LUKA 2UUBB 3EPLA 3OKXA 3TZKA 1UADA 1XXHA 3CYFA 4H15A 4NPAA 2A33A 4Z4YA 4O1IA 4XWYA 2RGYA 4AD8A 2NTEA 3EFRA 4IUBS 3VZPA 1S9HA 2PBFA 3HDGA 1XD8A 4J1TC 4CT0A 3L6RA 5B3JC 5BWMA 1PP4A 1OWLA 1UK6A 5G0SA 4YX9A 2QVYX 3EUEA 3VJRA 2ZPTX 5GWXA 2CE7A 3S5JA 4EVRA 4TTRA 5DM4A 1P33A 3Q6IA 1DQNA 2FG5A 2FXVA 3ZJ5A 2X76A 1P9OA 2P78A 4M0EA 1WDTA 2AI1A 1Y0RA 2J41A 3LCVB 1RJ9A 2Q28A 3T0GA 4C14A 1QHSA 4MEAA 3PWSA 3CPJB 2R7NA 1U5CA 4C8QA 4QEKA 3UPDA 3M5PA 1H1LB 4FYXA 5LCXA 4DBVO 4YALA 4OI4A 2LVMA 1M6WA 1Y0BA 2IEGA 5T8KA 16PKA 4QDUA 3UK0A 1EFKA 1Y7IA 1DUVG 1U9IC 3N8KA 4PYNA 1H1TA 1JIUA 3PTLA 1XZAA 3ZLTA 1TYEB 4HWKA 4Q01A 2D00A 1G8XA 1TK3A 3MGGA 2O3JA 3ANYB 2R6FA 2AT1A 4J29A 3PVLA 1G55A 4O2AA 4Q1VA 4KT0E 3HFRA 1Q7EA 1SHUX 3L8FA 2KGTA 1AV6A 4Y9DA 1NHGA 2DBYA 1GNQA 2MSNA 2P2GA 3TEJA 2W2TA 3HXQA 3EOZA 1ITZA 1WTHD 4BMOB 1PAUA 2I2CA 3BJZA 3NUZA 3AIOA 4L8FA 4TT8A 4CQLB 2INGX 4PHFA 4CM4B 1YIJT 4ZCRA 5PNTA 1KC8D 1YHNA 1PG5A 1K6JA 3DEIA 3QXJA 4OQMA 3WL6A 3NVKI 4HNAB 1XMJA 4LW8A 3RG2A 3REAB 2PEZA 3M6XA 4O4LA 1KBQA 1PFKA 4HH0A 1MMNA 4B0OA 4UHFA 3ZWNA 2GHIA 3MXOA 1UOOA 2PZAA 2MYSA 1UUFA 3OQMA 1K6MA 5CEEA 2XG8D 3IAXA 5DZSA 1T2FA 2N9UA 1D2GA 3REOA 1DJ7B 3NWBA 4HXYA 1F5SA 2P40A 1Y8ZA 4CMJA 4CODB 2CKDA 4CI0C 2O3SA 1HC7A 1ZXBA 3AF4A 1GCQC 4FGWA 5FA5A 1ZC3A 1NYQA 3T4UA 2GPAA 3E7DA 1V0EA 1RLMA 1X92A 4OOFA 2V0GA 1P2DA 2J5KA 3KT6A 5HKAA 3KQUA 4R2WA 3RC3A 2ZB4A 1XAHA 2XA2A 1TU0B 4YEJA 4LD9K 4I4TF 4Y2HA 3U31A 3VKFA 5KDOA 4B3MB 5IEBA 3MNFA 2SNIE 3L1KA 4NJEB 1MB2A 2FWAA 2VJPA 1JW9B 2X9VA 4BFSA 2C4NA 2VT2A 2C7VA 4P5PA 3Q11A 3TZEA 1FW8A 3CCMA 1G21B 1OEBA 1N4DA 4L5AA 5CLGA 1QQAA 1UP6A 2DHRA 2QTLA 5BSEA 1KK3A 2OCBA 3IA7A 4CLHA 4MCIA 4OP2A 2XW6A 2X4WA 4XN0A 1TAHA 3BG5A 3KHUA 5IDVA 1N34B 1BC5A 2V1RA 1YJNB 1ONSA 1JHYA 3OJLA 1IGUA 2V65A 3JATA 1VXOA 4GBQA 4Y6LA 3HH8A 2FHPA 4BQFA 1GA4A 1GKIA 3ZGVA 2IHNA 4HWSA 2O8CA 3DYVA 2GO1A 2Q3HA 1X3LA 1TGVA 2XRFA 4RTOA 1VI2A 4TXHA 5U9CA 3L8YA 2J46A 3MIZA 5I7UA 4ZA2A 2VT3A 5AVRA 2IK8A 3A4IA 3IEXA 3NJ4A 1CYEA 3WBBA 3VUFA 4EA6A 1U7DA 4JLWA 1NBEB 1DX9A 3BGWA 3OJ0A 4UM8B 2X51A 3LH5A 1G0OA 1OIVA 1LBSA 3OH8A 4NYIR 2WJIA 2E6NA 4R68A 4TWIA 3HSYA 3C0KA 2O7NA 5EAIA 2G5PA 4UOZA 1JWAB 2HADA 4FUTA 3WBFA 1SBNE 3N59A 3PITA 3A3YA 1LTKA 4O0LA 5J1TB 2IPNA 5FUVA 3WLQA 2GASA 3X28B 3ROGA 1TC2A 1J70A 1JEEA 2WIKA 4RD3A 1P1IA 2DTOA 4L2IB 2JLXA 1GBQA 2MOXA 3FLAA 4AMCA 1CJMA 1YR2A 2QGFB 5AQEA 1P2SA 1T0HB 3TLMA 1AWJA 4DWWA 1BVRA 3N2LA 2DH6A 3H5LA 1T5IA 1VHQA 3TG2A 2I9KA 3WIDA 3E1SA 3DEZA 1B0AA 1CS0A 1EUDA 1JKJA 1P6XA 1XRQA 2H16A 4WADA 4N0AA 4G7WA 2ZCJA 2PBLA 1VQ7T 2NT3A 4B6JA 3GLIE 2IW1A 3AKCA 2YDXA 3U60B 3VU3C 1PVDA 2AUNA 2CFRA 2XVYA 3G7UA 3P5SA 2D3NA 1DMRA 3E53A 4Y1GA 1OFTA 3CEYA 2DTHA 4C3ZA 1T0JB 4FFBB 1LSSA 1UXOA 2XJ4A 4OJNA 3OYAA 3KOUA 2K6DA 2YFKA 4RELA 3G1JA 2ONJA 4FDUA 1E3MA 3A1EA 3A8TA 2QYOA 4EFNA 1F6BA 3H2JA 3KZ1E 1D09B 1WSAA 2IYRA 4PLWA 4ESRA 2V45A 3WA7A 2AJLI 1SVUA 3TNDA 3JRNA 2XXAB 2GKGA 3HGTA 1Z36A 3PA8A 5FQOA 1EBUA 4A27A 3I04A 4GM1A 2KT1A 4I55B 2OZLA 1FFEA 2XUOA 1NJSA 2GK7A 1BHSA 1E2EA 2WW8A 1ZESA 4AY2A 1KYWA 4BO4A 1KETA 4F38A 4BNDA 5KS2A 4ZDJA 1JKFA 2I7VA 4TMFA 2AKEA 4QA9A 5HG0A 2PUTA 4ZHSA 4CKZA 3A1SA 2JGRA 2BFFA 2OM6A 1LBEA 3M7IA 4DQ2A 3TW6A 2M6RA 4FK8A 2J5XA 2KROA 4A53A 5AFSA 1QF6A 1XYVA 5C32A 5J47A 3P0EA 2CW5A 4KN6A 3SHQA 3COYA 1VPDA 1JSXA 1XDWA 4M46A 4PO8A 2M98A 3IOBA 5A5DA 1ZVMA 3D43A 2PE5A 4C4AA 1QP7A 1Y4AE 2Z5GA 1GPLA 2GF0A 1MG5A 3AHFA 3CTMA 5E4YA 2W42A 2IXAA 2KB0A 4MKZA 5REQA 1M90U 1ZUD1 1JBEA 3Q6MA 2VJIA 4NRDA 1JSRA 1TH7A 2HBRA 3VHLB 1BQ3A 5E95A 2OD7A 5EWMA 5SYMA 2EAYA 2BRUA 1NNEA 3KKEA 2AYYA 2EYWA 4M1KA 2P3OA 2NUTA 2OFXA 5CM9C 5DXFA 3DBRA 4UHEA 3BXHA 4U4AA 1QIDA 3FGZA 3SQLA 1GRCA 5IRCD 1ZM7A 2PLAA 3FYHA 2GEKA 1G8MA 3WOVA 5LWQA 3E8SA 2GEVA 3AXTA 5EQTA 1B34B 4JL5A 3QMWA 3QPAA 4AJEA 3KT3A 1L7DA 3Q1LA 3DBLA 1PKXA 1S9DA 2E82A 4Q05A 5HKLA 2ODAA 2G3RA 5B30A 1BMDA 3OHPA 2IUYA 4P7KA 4FC6A 2JXBA 3PQ2A 3AT1B 2O0KA 4KDEA 5HM6A 2DA9A 4IV0A 4EJ6A 4YV0A 2DR3A 2EFEB 1AY0A 2NO6A 3IODA 1T6BY 2C8KA 2EYXA 4DHEA 1BXGB 2FTKE 2XMCA 3SF8B 2PLWA 5CCAA 3WMWA 5ALGA 4LGVA 3D7MA 3TLCA 4IR7A 4YAGA 1GGNA 1XZHA 1P45A 1XZJA 2OBBA 3DEAA 4A8PA 1JEYB 3CCUQ 3IDZA 5BR7A 4MQEB 2JRCA 2OV8A 3JVVA 4FXOA 4NYJQ 1KQNA 2EW1A 4PZEA 4Y67A 4M8KA 1M1KD 3L82B 4BXOB 2ZPIB 4OBBA 4TQ9A 1IJFA 3FDRA 4FKBA 4JY7A 4KQ1A 4UHJA 3SQOA 2FRDA 2UZ4A 3QVSA 4J0FA 2C7BA 3N2KA 3RR6A 1EK6A 2C2KA 2WRZA 4I3GA 2HW8A 1Z2OX 4XVRA 3KR9A 5C1PA 3BQJA 4C0XA 1E99A 3R44A 3ZK8A 4XYGA 3U23A 1X1CA 2RHDA 4RNCA 1GO2A 1V39A 2GCPA 1EFVA 2GDJA 4KIFA 4NU6A 3DBVO 3NTRA 4ZXPA 5HBGA 2IXEA 3CPWA 2J9FB 2L82A 1AKNA 1RI2A 1VLZA 1ACLA 1XMXA 2QVLA 3BH0A 1HSZA 3OFND 4H6PA 2HL5C 4KE9A 5JHGB 1C7RA 3OESA 3ZDDA 2A4MA 1H6CA 4YCCA 2BAGA 1DJNA 1NL3A 1VRVA 1B1AA 3VZBA 4FW8A 1WOOA 1AN9A 2I5PO 3H84A 3LRTA 4MV9A 1ZUWA 3VNBA 4PXSA 3PLAE 1GILA 2N75A 1N33B 3L1AA 1EXNA 2K79A 2HJHA 3F98A 1T9HA 3AQ4A 5IBPA 2OQ2A 2ZBVA 1U0NA 4JUCA 2GVZC 3NM4A 4ND4A 5IHKA 1M3BA 2GT1A 2P6PA 1Q1ZA 2W4IA 2ZRDA 4MJLA 4N0PA 4NFHA 2EVWX 3FLEA 2XQIA 1LV8A 4X7RA 5CH5A 3BGIA 4DBRA 3PKJA 1SBYA 2XECA 4N6GA 3UXMA 5LJ3f 2HA7A 3HVKA 5ILQA 3VX3A 1QR2A 1ZNWA 3ZD7A 4DCJA 4J0DA 2JJYA 2VZLA 2Y0CA 2QRNA 3EA5A 4RH3A 2ECPA 1EWKA 2OCPA 4JBXA 3ORRA 3GVJA 4PAGA 5AKKA 1RPZA 3PXAA 2V26A 4U2FA 1IN5A 1Y6JA 4FHCA 4CTOA 4BB6A 2BYTA 4KFSA 1L7OA 2WINI 3C48A 1E9DA 1OH5A 3C4QA 3LL7A 3ED5A 2Q6KA 1YJCA 2C0TA 4DIBA 3O0DA 4IUPA 3SY8A 5JAMA 1Q17A 3ZQUA 3LY9A 1VB5A 3QPHA 2O3UA 1O6GA 3ZJTA 3ZZ0A 3LQRA 3PJFA 3H11A 4J6EA 2YBDA 2GM9A 3AJ9A 4E21A 3BTVA 2RGXA 3V55A 2VPTA 4JELA 3H7AA 3P9KA 4GL2A 1F2TB 3N74A 3GGPA 3MJEA 4OLFA 2ODEA 4NCIA 3AU8A 4GPD1 5LOVB 1ZGGA 1TUDA 3ADDA 1CEQA 1VP3A 1HDZA 2CGEA 3QWIA 4QDJA 5FULA 3CCLT 4OX9Y 3KVYA 3OZVA 3IKTA 1JFFA 2LW7A 1VQ5A 4KKSA 3OS1A 4NBLA 1E1LA 2HHJA 1XTSA 3RANA 1PNQA 1KJNA 3RCBA 3H11B 1WVMA 2H00A 4K6FA 4LWOA 1KH3A 4YRAA 1RYHA 2CCGA 3CLTC 3AP2A 1ZA2A 3R5HA 2WJYA 3I0ZA 3GAMA 5JSYA 1XZQA 1A5ZA 2IS2A 4HWTA 4FYVA 1U4SA 3ZJVA 4X3OA 1UHCA 3RMSA 2LQNA 3H04A 4P93A 4U7PB 3X2EA 3T6KA 1YBVA 2I6UA 1VQ5B 1Q81D 3H9UA 4TV8A 4A0GA 4E4RA 1FMCA 1AQ6A 3ADBA 1E9SA 4BKUA 4BB9A 3ABSB 1FMTA 4YMSA 2B5VA 4B9EA 2EYZA 4LNHA 1I4EB 3WYGA 1VJSA 1W5FA 4G1VA 1J8VA 2B83A 2N47A 3E2PA 2WK1A 1TJPB 3FUWA 2QQ0A 1OU9A 5TC4A 1CZRA 1FJGB 3W5CA 2Z0MA 1I94B 5SZIA 1BI0A 1WUTA 1XZLA 1ECBA 1XQHA 3GIBA 4BPRA 4QODA 2JHCA 4NZPA 1VOMA 1XRJA 1Z0KA 1GUDA 2QQAA 4IHKA 3T7IA 2GK4A 1ZRNA 3J80E 2JH8A 3JPWA 3ZWXA 1Y96B 3FROA 2J5BA 3FRNA 4HNUA 1JR2A 1E7QA 2A5GA 2PUCA 3WADA 4ICIA 1H9CA 4HADA 1WG8A 3WMEA 4BX9A 2ZPFB 5D5HA 4G0NA 3UVEA 3DVQX 4FYWA 4HY3A 4XB6B 3W5HA 2J3MA 4M0MA 1DKUA 3WVEB 4BY6C 3DCYA 5DK4A 5HFNA 1SOVA 4NCKA 5HKKD 5L3QA 4BBAA 3H99A 4GX2A 3AKZA 3GO4A 4U63A 1DCTA 3OZFA 2XAAA 1RAIB 4CUJA 1XL0A 2A5JA 2Q6IA 4NS4A 1GNVA 1NVEA 3H18A 4DILA 4LF6B 2HA5A 3OMCA 4RAQA 2CBXA 5IT9E 4YCMA 4HLUA 1BMQA 1ECCA 1I2CA 3TTWA 1VL5A 3QX8A 3IEMA 4NG5A 1N2ZA 2FPLA 4KH1A 4A92A 4YPOA 1BS9A 1MBZA 3PQEA 1I8FA 1B16A 3A4VA 4F2WA 3H1EA 3B13B 3ZVKA 1BDJA 1ZHFA 4L9AA 3HU5A 5TF4A 3AESB 3JQEA 1SM4A 5GOTA 1OXKB 2PT9A 3OTWA 1XCBA 3V7YA 4TKVB 1MB0A 5BNWA 2QA4Q 4I55F 4IRMA 3NXSA 4JQSA 1OF1A 2CSUA 1N2IA 2PZMA 1NM5C 4LY3A 5K4GA 1IIRA 4HNGA 3A58B 3NBUA 2QP9X 4F7UG 3BN3A 3FIUA 2H8HA 3EGEA 2MDTA 4D9JA 3QFSA 3DYIA 4ENUA 3RK0A 4KHZA 5IFKA 3BMNB 3PQ3A 1IHUA 4KAXA 3HFNA 2EWVA 4A6XA 1C1AA 2BC9A 4NYMR 1E3QA 3R2JA 4M36A 4C7OB 1Q22A 5GAN4 3CMMA 2QG6A 3MM4A 1V29B 2EX1A 4PS0A 4ARIA 1MAVA 2UVPA 1C4WA 2GEBA 1LTQA 1PW5A 4TL7A 3M1AA 5AVOA 1EWTA 1R88A 2VH1A 5DYYA 4ABTA 4L5GA 5K3SA 3V9PA 2IOQA 3WB0A 4C3VA 1NFFA 2OT3B 5A6VA 4MTLA 3RUEA 5H83A 1RNLA 1KYVA 2PHZA 1KY2A 1H0RA 2AFIA 3CRVA 2ZIWB 2GN6A 2ONZA 3DO6A 2V7WA 3GFQA 1B6TA 4TMKA 5ALUA 4KLAA 3RU7A 2M0YA 3S1LA 1YKSA 4ZVUA 1XWFA 3AT1A 1SD5A 2C0CA 2H57A 3FPLA 1G5PA 1GTVA 5E9AA 5CH3A 4OSEA 3PEYA 1Y8RA 4XQCA 4WKBA 2P30A 3OZUA 4OVAA 3ZBPA 3ETCA 3OCWA 1EFPA 4OFBA 3E2MA 3WK9A 5BOSA 4YT2A 3L6OO 2O54A 1PDWA 2O2IA 3VKIA 1YR7A 2XGMA 3G49A 3VVBA 4MYSA 1UJ6A 4KQHA 2WWWA 2QN1A 2Z4TA 4JR0A 1OIWA 4WN9A 3S5UA 1KBZA 4EUHA 1H93A 1CXZA 3HP9A 4P25A 5D7NA 4R2MA 4DEVA 3KWLA 4GM0A 1IUOA 3HWRA 4QBTA 5F4BA 2PKQO 2I4OA 3P4YA 4P54A 3A1DA 4DIOA 4L6IA 4XX0B 4LJAA 5ECYA 2EKHA 4MPDA 4FZRA 1PR0A 3MCWA 3TL6A 2QG9B 1EIFA 1I3LA 2AC7A 4K9NA 5A7FA 1G3QA 4KUHA 3EODA 4IWXA 3FNEA 3LX4A 4CIDA 3EY9A 5AVYA 5GAOm 3KZVA 2VT7A 4W1SA 4KQCA 2OGUA 5DJ5A 3PG5A 5FFNA 3PQ4A 2XD0A 3I01M 3Q9UA 5I6DA 4QO7A 3UT6A 3L84A 3DV0A 2I1QA 1Z9BA 4FDTA 3M0EA 3D6JA 4RPHA 4MRVA 5HIKA 1H4TA 3M58A 1CW2B 1Z83A 2X22A 3HR8A 3L5OA 4FMBB 4IXTA 3SJ7A 1F60A 4RXUA 3HRUA 1SWVA 1DOAA 1CVLA 1ZMOA 2PL9A 2XOEA 3IP6A 1UWCA 4FMCB 4KNWA 1RCTE 4KYIB 1GT91 1KJWA 4H08A 3A6LA 4JWTA 3L7NA 5GP1A 5JRDS 3AZPA 1VQPQ 1HDOA 1BI2A 1G64A 4H1HA 4K9PA 5GTDA 4IQ8A 1HX7A 1LRLA 3HYCA 4HFRA 1XWIA 2E21A 1PT6A 4EA9A 4ER0A 1LI4A 4FYIA 1N77A 3BFXA 5K0CA 5FNVF 4KACA 1XQ9A 4BOYA 3RKRA 4A2PA 1PM3A 1XZ8A 3ZDRA 2CNOA 2X2OA 3M1IA 5BRNA 1RAHB 1ES9A 1ZI6A 2WHYA 4C5IA 1B93A 4DA9A 9ABPA 3ICEA 2BGNA 4BVJA 2GJRA 5CJPA 5LUAA 5KOHB 4O2BA 1LQ2A 3EHEA 5JR3A 2J4CA 1FP6A 5H82A 4OHVA 2A28A 3NGPA 3UH1A 5B5SA 1U7WA 2Q1XA 1P31A 2VP6A 4KK3A 4X06A 3U17A 4CUKA 1SD2A 5EY5B 2WJ3A 4DDHA 3DAGA 4EO4A 2W48A 2JFVA 5A7HA 2PA0A 1F2UA 2FX3A 2DYKA 4MAMA 2O2GA 4MS4B 2GK6A 2F64A 3REQA 1A4XA 1XHFA 3MOIA 1BWQA 3GLIB 5K0EA 2AZXA 1WY5A 5KKCA 1Q3TA 3KAQA 4PY2A 3OFVA 1UD2A 2CXQA 3K15A 1O89A 2ZBGA 2B86A 1TO2E 5JZ9A 2ZJ8A 3KJNA 2GJPA 4B84A 4UD6A 1Y5NA 1NC3A 5K6AA 3RRJA 1Z4NA 1XTVA 2V8BA 4PANA 5CITA 5JJCA 2NXWA 3KX2A 3T0FA 4INJA 3T9AA 5AUOB 1WYXA 1AZSC 4ZDWA 3ENWA 1Z45A 2PX0A 3RE1A 3O47A 3R3XA 2VF7A 3GLIA 1XMOB 1I5LA 1MNEA 4OOXA 1PYGA 2WD7A 2AC4A 3RJTA 4IX1A 5IBCA 2JIOA 2ON6A 1SR8A 2WSCE 3QNWA 2VIIA 3HBFA 4G4SO 4WWHA 4AJ2A 4BCDA 3Q98A 5HHTA 1RYZA 4AMUA 4PCVA 1NQ5A 2J30A 1KYXA 4F56A 4PG8A 2P9GA 5LJ3e 4P5DA 3IQDB 4DN6A 3EG3A 1PRLC 1H2WA 2XF2A 5EXEA 1GQRA 4MW5A 1HYOA 4YJGA 2J0QA 4L16A 4CTJA 1YUBA 4ALMA 4DJAA 3BS4A 3IS3A 4E12A 2WTAA 4XUGB 2PXXA 2PKYX 3IFSA 3QG1A 2W5UA 3PNPA 4PIMA 4X9CA 1RI3A 1C9MA 2PZFA 3PCTA 1DG9A 5EMMA 4HNTA 2YV2A 5JQGB 1KFJB 2ISQA 4ZCMA 1WMFA 3D9QX 4B4OA 2IDMA 1Z5VA 1GPYA 1XZPA 1GXSA 3FWPA 1Z25A 3AHDA 1E1QD 3K8QA 3S6WA 5ALIA 1TRKA 5CCBA 1IZYA 2FMHA 1DHTA 4GKAA 1DE0A 3QXCA 3IKJA 4H3VA 4PLCA 4GG1A 1U1TA 4EHBA 3A2NA 1OR8A 3PTZA 3U7IA 3V1KA 3L0DA 4CKWB 2G06A 4RA9B 4HN9A 4QT4A 1DKNA 2HA6A 5K6AC 4Z4SA 4QUIA 2BLLA 1ISSA 3GLHE 4GOKA 1BGVA 1CT9A 1XDDA 1F1BB 3QOYA 4HWGA 3R9WA 3VTZA 5GAOp 2PKEA 1DT3A 1AV7A 1PT7A 3HWSA 4UPDA 4XPZA 5DGDA 4ZJUA 3ZBDA 1Y81A 4PFKA 4D4LA 4D9IA 4YACA 1ST2A 1XAIA 5DYGA 3DFUA 3EGDB 4OM7A 4YDSA 2NUTB 2ZJOA 4R1MA 2IP1A 2F4VB 1RXCA 1JDNA 1EG7A 2VC2B 3VUBA 2I7DA 3JQCA 1I07A 2BKXA 2RK6A 4JJ8A 2XDBA 4XSVA 3UY4A 1YXMA 5A0GA 2IV3A 3ZJYA 3L5KA 1XNQB 1CQPA 1CZLA 4ND1A 3B89A 4FR5A 4NMWA 4HFMA 4M0FA 3IPXA 2ZAMA 4KAJA 4KQWA 4OB6A 3CCJQ 2H92A 4OQFA 3BD6A 4TVOA 2DQSA 3HJCA 4BN0A 5LNK1 3T06B 3KR2A 5I8PA 3K9CA 4OTZA 5MGNA 3CPSA 4UMDA 4OB0B 3UM9A 3DFZA 3C6YA 3T99A 3U4IA 3OBWA 1XIVA 1FQOA 2FPMA 3ANXA 2ZUWA 3AUAA 2WF8A 4XCVA 4BNKA 4KR6A 4P5EA 1W76A 1E96A 3U3RA 4GI1A 4YCJA 3WIBA 4JB0A 3QU9A 1N5DA 1P7WA 2ZS7A 3ZU4A 1ORWA 4P36A 2C1EA 2M6LA 5C46F 1LCIA 1KFCB 1T9GS 1YZHA 2G67A 4OHXA 5LQKA 3SZGA 1CUDA 5CFRA 3S81A 5HRUA 3TD2A 5DNYB 1JJ2P 3AR5A 3OYLA 2MTBA 2X5NA 3C3JA 3LKBA 3W4JA 621PA 1KH1A 5JEEA 1SEVA 2OCIA 3IEPA 1Z07A 4CKCA 2DU8A 1H9BA 5T41A 1E77A 2NQTA 2VDLB 3KB6A 1DBSA 4JR1A 3COZA 4ETWA 3UPUA 3F4BA 2ZS8A 3K8YA 1GARA 2JJMA 3EAGA 3BH6A 3OP1A 3L3BA 2WQZA 3C2QA 3EGIA 4IO1A 5KNBA 4GXQA 1FLAA 3E3LA 1VQ9A 3TXAA 1M8MA 3GT0A 1FFDA 4BZWA 4JODA 4BP1A 3U3MA 1UEXC 2O9VA 2C00A 2HRDA 2VR1A 2BZ1A 1JHQA 1K98A 2I6FA 2UUOA 3OPVA 1WPGA 1NRKA 1OPXA 2CK3D 2EQ5A 3AERA 2G80A 1N8TA 1PYOA 1AZGB 3H4MA 1G60A 1Q92A 3PEFA 1QVPA 4PRLA 3GJYA 5DGCA 3KVOA 4CM8B 4RTJA 2JJ2D 4DOMA 4WN9B 4H4CA 5KJFA 2Q41A 5GAN8 1UOEA 2C94A 2NV0A 1JJ2A 3O8OB 1T3HA 2O20A 4U8GA 3G59A 5L51A 1QS0A 5A9RA 4FE3A 3RUCA 4UEOA 1GLNA 1HGXA 3WQHA 5J4YA 1M34A 1RAAA 2PYDA 2ORVA 2OXFA 2P27A 4OV6B 1A0NB 5LD2C 2FEMA 1P1BA 2QRVA 4I50B 4X95A 5I9IA 2EWNA 2O2EA 1MTOA 1I6LA 1OREA 2R7MA 1USGA 2RARA 2D8AA 3L8CA 3ROQA 2NP6A 4RABA 3EGCA 3LZCA 4Q4JB 2JANA 3CZPA 2Q62A 4FQ7A 4W1PA 3A5ZB 2XT9A 1UKAA 1IZ7A 1Z4PX 1UPFA 2C83A 4MUHA 1D5WA 3GLQA 4LF5B 1UZLA 1VQ7A 1I8DA 1QRSA 2QN7A 4TV8F 2Q46A 4C07A 2EP8A 1CUBA 3MTAA 4BI3A 1O96B 1MOPA 1USWA 4I14A 2E37A 1GPMA 2PSSA 1F4PA 5DH9A 1GNLA 1F2TA 5JEDA 4GLBA 3UAYA 1ZN7A 4WZAA 1L8OA 4V1CB 4HDRA 2O8EB 4DGQA 1UPAA 4HH1A 4DQVA 5GJVB 4PF1A 1PHRA 3FSJX 1RWMA 4GOMD 4MUFA 1G6HA 1R8SA 1TYBE 2HKIA 3OI7A 1EK2A 3X1XA 4KPFC 3DFIA 4OPOA 1EFTA 1R4ZA 4AMGA 3EZNA 1WHSA 2ZRBA 4ZYUA 2FDXA 3KE8A 2W2OA 4KI0A 4WZAB 3CMEB 3FCUB 1JAIA 4DNTB 3WKAA 1AUPA 1SUFA 1AO0A 4W63A 3LZDA 3T38A 3VSCA 4YRBA 3NH9A 3FCCA 4MQFB 3P9NA 3WLSA 4HATA 5AYVA 3D3EA 3X1JA 4XTXA 1A77A 1RLJA 4J75A 5J2TA 1KD1R 2DCUA 3DE3X 3LO5A 2GXAA 5BV8A 2GNCA 1Z2AA 4LDPA 1YK1A 3M4XA 4PG7A 5IKMA 2DMRA 4EELA 1EFLA 3R75A 2VDQB 4TLEA 2W8BB 2C82A 2XDYA 2BFCA 3EEQA 4JT8A 4AZ3A 1NMQA 2O06A 1WQWA 3KB2A 3W04A 1IXRC 4MI3A 1KO1A 2XNJA 2YUIA 2MMPA 5BURA 2NPOA 1Y7PA 4REMA 3NHWA 4ZI3A 5IH2A 1VSQA 5LQJA 3FETA 3U1VA 2O8DA 3EQ6A 1MW9X 1EUZA 3OYGA 1YE5A 2VHQA 3F7TA 1SVMA 3KEFA 5GMOA 4AG3A 1M7HA 1SAYA 2BZ0A 1BJRE 4RFVA 5K20A 3U5ZB 1SU6A 2NVUA 2JLWA 1XV5A 1VIDA 2VXEA 3O38A 5FO1A 1Q82D 2BY4A 3CLVA 1DDOA 3NRCA 4KZKA 1TT7A 5IBRA 5AVUA 5HUHA 4D46A 3M3PA 1NQWA 4MWOA 3AGQA 1EFNA 1ZBQA 3IMFA 3LMKA 4PAMA 2XD9A 4NP6A 5CO7A 1KGDA 1SOMA 4RX1A 1ZINA 4IAOA 1TZ2A 5ARDA 3SYRA 1APBA 1XZBA 3RRBA 5AKGA 4ZOAA 5KC9A 2WQ7A 4YASA 1YVPA 3LW7A 2H4JA 2QZSA 3DWFA 3L4EA 4IFIA 3U80A 4X24A 4QVAA 4QFCA 4Q93A 1H4SA 4PXYA 4DMUB 4OKNA 1DJOA 1HLPA 3DEJA 1K97A 4DIKA 2ETXA 3ES9A 4M37A 1E6EA 2V7QD 4Q7MB 4QUEA 3GWGA 5TPWB 2GPSA 3OYMA 1WKCA 2FSIA 2QGNA 2OHIA 2R00A 3F1KA 3OOJA 3W6PA 3OF5A 1MVLA 3LUGA 4PRYA 2ED0A 3BT7A 3NBXX 1OX6A 4IS2A 3QLEA 4L5YA 3F71A 4ZAXA 4DA4A 4BVAA 1R0SA 4Z6KA 2BDUA 3UW1A 2CNBA 4Q3DA 1E8MA 1ZHHA 5C35A 5K4HA 3FVVA 5FF9A 3TE6A 3ADCA 4BATA 5LJ3h 4IUQA 1ZSNA 1D2MA 2VXYA 3DP9A 4UAUA 4UU1A 2ZM6B 2QN2A 2WZQA 3O9MA 3DLCA 3HRIA 2TMDA 1VJGA 4OY3A 1V45E 3E22A 4RM3A 3L40A 2PQ2A 3TQ7P 4EZBA 5C8YF 5KYTA 2C5SA 4BB5A 1DQYA 2ZBUA 3OYKA 1DBQA 2BWJA 3KKOA 4JLOA 2PRZA 4DG5A 3ZXYA 1Q0LA 2EKLA 1KQSB 2HMWA 4EW2A 1FSFA 3OBBA 2F9MA 4HDNB 1DKMA 2HBPA 2R57A 1MP0A 2AFIE 3GG2A 1CUWA 1R6AA 5I9BA 1H4QA 2VYFA 4JRIA 3I4LA 4J0GA 1EVEA 3K96A 3CTAA 1RC0A 2ECZA 1OILA 4AU1A 5AW3A 1UCFA 3K9BA 4R98A 4A5SA 1D2NA 2VCYA 2OVFA 3ZVRA 5KX5F 3IT1A 1ZY2A 4E14A 2WKSA 2YXPX 3I6YA 3ZWPA 4Q7LA 2PIDA 3TIFA 1TYCA 2DCMA 4X63A 3SZOA 4G8BA 2ZWPA 3I5XA 2FUKA 2HF8A 2ICAA 5JZVA 1JLHA 1IN6A 2QAJA 3D7RA 6GPBA 3ZR4B 2GD1O 1V6CA 1WF3A 3ILSA 4O2RA 3EMKA 1Y0YA 3WZLA 3WXMB 1JJFA 4KDFA 3WL7A 3TLGB 1XNIA 1NA5A 3FX2A 1N2CA 3SIRA 3BE4A 4Q3CA 1SXJC 4U3JB 1ABBA 2FRYA 1GCAA 2B7LA 3D6MA 2GJKA 3G85A 2IHYA 3CR7A 4U2EA 4EG0A 2DAPA 4GKJB 3G8DA 5L53A 4DADA 1JWLA 1QWFA 1A2QA 4GZ3A 2SCUB 1A9XA 1Q0PA 1PGNA 1QQTA 1Z2NX 2QD4A 2JLSA 4FILA 2ZSIA 4E0BA 2GD2A 4QAJA 1Z6QA 2H5LA 3EXFB 1QQJA 2OV6A 2YQZA 2CKMA 2H7VA 1K27A 5JT1A 1RZRA 1ZHOA 3HK2A 3QUSA 4JP5A 5IDQA 3FSGA 2OHFA 3A6PC 4QE3A 3BEOA 1M1YA 4UE2A 1M73E 1VCHA 3I37X 3AERB 1YS9A 1BXRB 3CBPA 2Z57A 4GECA 4JU9A 3DMGA 1QG6A 3KFLA 4QIHA 1Q1BA 2ZUVA 5D8DA 5D7BA 2QBYB 4GMDA 2QUJA 3CR8A 4D57A 3HCNA 2XBMA 3I1JA 4KRXA 1PJTA 1I0IA 1SKUA 3II6X 2KE5A 1RQRA 1M2HA 4EAQA 2ECFA 1PT9A 2CXHA 1NFRA 3C70A 4G5RA 2CUKA 3SNHA 4MUKA 5E7QA 4ZN6A 6REQB 1NUTA 1Z3CA 4LZWA 4DDVA 4HFJA 2AG8A 4HQNA 1B0PA 3OSSC 4IUTA 4QWMA 3FOEC 1MIOA 1VB3A 1KA9H 3QIAA 4BEBA 4QQKA 3IV9A 1K9MC 1IY1A 1UMDB 3EYAA 3KELA 3IH5A 1FTWA 1CULC 2FZKB 1EQ2A 4TN5A 1EXDA 3FBTA 4FQ5A 3KOWA 4BGUA 7ADHA 1W0KA 2EJ9A 3UXYA 3FUXA 4XOIA 4H31A 1OBOA 1Z6GA 1N1GA 2VQDA 2XHEA 4ZVKA 5AVJA 1PZXA 1ZOOA 1RHKA 2KPOA 3CCLB 7MDHA 3QVMA 3O95A 3H86A 4QYWA 3PR3A 3KSUA 5HZAA 1I5EA 4H0FA 5CJJA 4BO7A 3KDSE 5EJ5A 3GD5A 1KPIA 2WD8A 3MF4A 4HAUA 3WLOA 2FGKA 4IDFA 1K0SA 3MMPA 1K6XA 3MFQA 1GRQA 1MV8A 4JJCA 2ZWIA 1A72A 3OCXA 1QDEA 4MMXB 4E2FA 2ZM5A 3K09C 1V48A 1VUBA 1V47A 4N39A 1G4AE 5JADA 1TUCA 1VQ8T 2GSDA 2PGLA 3BXFA 1RACA 1K2WA 1NMXA 4C5CA 5ADWA 1T8WA 2UUCB 4DDKA 4YMHA 1D03A 3WX0A 3L07A 4W5OA 1RRKA 4CMAA 2D0DA 3H9NA 4IIGA 1MGQA 1C0LA 2O2JA 5JAPA 1T4CA 4L3VA 3RVLA 4DJEC 2C2OA 3GLSA 3FTFA 5BSRA 5KNCD 5IK2A 4FYYB 4OHFA 5AVKA 1W85A 2D7JA 1T3SA 3QMPA 2J3IA 2C29D 2B1RA 3DQZA 1TF7A 3FJ1A 1ODLA 2GCEA 5LDHA 4NCBA 2R97A 3CUEF 1KZGB 3VRHA 4B6OA 1CPYA 4BKPA 4IIJF 5JO9A 3HUDA 4PZDA 1DXHA 1XXHB 4XL9A 2JIBA 4YCNA 2F1HA 1PQWA 2HWWA 3H9QA 4E7SA 3KXPA 3QUIA 4M7DE 1VYVA 1H8HD 3RBBB 2DXBA 2XZPA 4JMQA 1VCMA 3AFNA 4R3WA 4BFWA 5JUWA 5BUQA 2JJ9A 3CCRQ 2O3TA 5FD8A 1F4LA 4PJJA 2PWBA 1WPCA 1PNTA 3N8GA 1K73U 4WZKA 4P3YA 1H2ZA 1NURA 1TL7C 1K73D 1E1RD 1ZH6A 3Q6QA 4C92B 2EX4A 2G0AA 2QENA 3I0MA 2AMLA 3NALA 2F00A 4LUEA 1QRRA 3FYCA 3AJRA 4G4IA 1PL6A 2IYOA 1MH9A 3SC2B 3T4XA 3VR3A 2IA5A 2G82A 2GN8A 1QOQB 2LVBA 3AOGA 2NU9B 2NVUB 2P9QA 3VU8A 1EESA 3IT2A 3S2GA 4D9EA 2EARA 1H641 3GZNB 3GLFA 2ZI6A 4Q7KA 4ZMSA 4WRRA 1IVNA 1C1XB 4CC3A 1NJFA 3C8UA 4FR0A 4BVGA 3THKA 4RTKA 1QQBA 4BIMA 4FONA 1TYDE 1BWSA 2D4HA 4ARZB 4XYLA 2AZDA 4AKIA 3R6NA 1CJUC 2P4TA 1TF2A 2XUKA 1VMIA 3D4LA 4JK3A 2VH5R 2EW3A 3PRHA 2AQIA 1WCWA 2AOXA 3QFTA 2EZ4A 2JNWA 1F06A 3DLMA 3GPLA 1SXGA 2DWCA 4MH0R 4NABA 1NKTA 2EFJA 2FR8C 3FUUA 1Y1LA 2C4MA 3KDAA 3NHBA 2QQ9A 4WJZA 2LNVA 4D81A 5A03A 1F6DA 1W30A 1Y34E 2C92A 2P6UA 2UVQA 1MMAA 3VS3A 3GBVA 3LQ4A 4WLFA 3KYJB 3VS2A 4X61A 3SC6A 1Z9QA 1MAAA 2Z2ZA 4JB3A 3WHLA 5E6UA 5BQXA 4P7JA 1OJLA 3BF8A 3BY7A 4HAZA 4MYRA 2QASA 4M75B 1NW3A 2I2XB 3FTCA 2VDNB 1MJGA 1MZPA 1VE7A 1MC1A 2W90A 1LU9A 3CLUD 2E6ZA 4EPCA 3ZDXB 2D1TA 2PGAA 2HJGA 1BSVA 3GAZA 3OTQA 5AOVA 4N82A 1QGED 2F8MA 3K1JA 5ANRB 5GAN5 2IPLA 3C45A 4XIYA 2C54A 3SXUA 2LMJA 5BYKA 4EKGA 5AVQA 2O3QA 1Z34A 2VZ9A 3U56A 3H13A 3PEWA 2F62A 1YBHA 2Q7XA 5IBQA 5C5CA 1X6GA 3PF9A 1DAFA 4L5IA 3JQFA 3JD1A 1OQKA 5CEJA 3AG5A 2FVGA 4G6ZA 4L0MA 3GBSA 2Q1WA 2JAUA 2CNLA 3U3DA 3FKQA 4HDKB 1VIAA 4DRXB 3NTHA 1OXXK 2B1IA 3EB9A 5K8LA 3IDQA 4WINA 3I72A 2DX1A 1UBEA 4CN9A 3G2QA 3TPCA 1S72B 1WHMA 5I47A 2WG2A 3VTAA 1JF8A 2JJ1D 3T3NA 2CSIA 3P9RA 1S8FA 3QU7A 4GOJA 4RS3A 2WIAA 4M9SA 3DZDA 2HPVA 2VDUE 1R0LA 4P83A 5DF1A 4ESEA 5HK3A 3JCMQ 3INYA 1YS4A 3EZ9A 2PUBA 1A2KC 2C9MA 3FKSD 4M3NA 1W1FA 3L7DA 3WGKA 1TPZA 2Y6VA 2XCOA 2CVQA 4QASA 5D2CA 1UPBA 4EZIA 4OFWA 1GYPA 4ZCIA 1XZKA 3EZYA 5AM1A 5FLKA 1PFWA 2RA2A 1IBLB 5IHNA 1L4EA 4HT9A 2KY9A 1EK0A 1TTHA 2ENWA 3ETJA 3NWOA 4O25A 4OGFA 4QHSA 2YOFA 3JCMh 2JBHA 4J91A 4DC0A 1QJCA 4FD2A 2TYSB 2MIIA 2WF5A 4M99A 4FFNA 4UDXX 1EGMB 1P7CA 4ZO9A 1R12A 5HGJA 4V3CA 3RWMB 3PIDA 4BN5A 4BZPA 3N5CA 5BWBA 3JASA 2OTCA 5LOVA 1AD2A 1LEHA 4QU5A 2HMYB 2FG6C 3U9SA 1BPLA 2BKLA 4D3XA 2LDMA 3PS9A 3HA7A 2E0IA 2O6HA 3TDNA 5GIOE 1M1NA 4LRXA 5AK0A 3MS4A 1H2XA 1QZXA 3E3MA 4QVJA 2FO0A 1UJCA 4HOYA 4EFMA 1Y3DE 4OI0A 4N4HA 4ROTA 4B82A 4MDEA 4IGEA 4YJ3A 3COWA 3T0IA 2BHSA 2JVIA 3THSA 3WGTA 4JYCA 3U7FB 1D1SA 4ZOLF 3ZZMA 2P2YA 2YVQA 3IBSA 3K2QA 4MULA 4CU5A 4S1TA 3UXHA 2CDBA 3DFFA 1PK7A 3H5WA 3NHMA 1IG0A 3LOUA 4UBNA 3PIRA 1DX4A 3SEZA 1QVVA 2DL3A 1KSHA 2CUZA 1H1LA 1R0BA 2AZVA 2K2VA 3I6ZA 4UEKA 2E49A 3VTFA 3K3PA 4EYKA 5C8YB 2NNLD 2C77A 2JOYA 3K1YA 2AR0A 7REQB 2OBTA 1RP1A 3OA2A 4RGYA 3RERA 3PDCA 2TMGA 5L3ZA 2KW5A 1P18A 1NBIA 3G2KA 2NZUG 2A0WA 1GY8A 3ZDAA 4IDDA 5CEFA 3C6ZA 1U3VA 1DWOA 2EKBA 4ZFNA 3ZCTA 5BSKA 2VPYA 1K6IA 3SDZA 1RBYA 2ZXIA 2ZIVB 3WWZA 2XK0A 4GSKA 1SIWA 3DOIA 1T5SA 3NI2A 5ITSA 2VKQA 1G4UR 4XQ0A 4CL2A 5ITWA 1KK1A 4GRAA 5FR2A 3QOXA 2BLNA 1HLGA 4AWXA 4EUEA 4M87A 1E9EA 1NVXQ 1K8AU 3HKDB 3MOGA 1Z4LA 1RLTA 3WWPA 4YRIA 1QONA 1JG2A 3OUTA 3KL9A 2YXEA 2L19A 1LFAA 4IY1A 5DHSA 1LH0A 4L51A 1AUXA 3C7TA 2QQSA 2EJCA 1VHLA 4H4DA 1CIPA 4M7AG 2FMIA 1Z29A 3NO4A 2YQ4A 4JROA 4WLVA 4Z9FA 3SHVA 1X1RA 1ZGBA 2BMDA 4XQFA 5AXAA 3QZ5B 1D8AA 2VYVA 3HB5X 4D6PA 2I1VB 5LUBA 3DHWC 3RYHA 2ZJ2A 2HRQA 1KI9A 3EF1A 3VO1A 4HFNA 4EFLA 1FRQA 3GBQA 2EBHX 3AF5A 3DBLB 3L4SO 3M5DA 2FPPB 1BFUA 4OAPA 2IWRA 2DFPA 1TKCA 3UJPA 2POCA 4ZN3A 3FB1A 1U5BB 3GUCA 3ZVNA 3DF7A 4N3GA 1CUSA 4CM1A 4I1RA 1DI0A 5EZQA 2YZ2A 5CVIA 4ZT2A 5KDDA 2HEIA 1WBDA 1Q21A 1E7MA 3LLSA 1JS1X 1ZGJA 3O9ZA 4GR9A 5DYNA 4CN8A 3NDBB 3M9WA 1MB9A 2WMYA 2X4LA 4ARUA 1BCOA 4JZ4A 1KD1D 1JSZA 3HVJA 2RGEA 3IVMA 3OO1A 3CCJA 3KJFA 2QXUA 4X90A 3RBXA 2DKOA 2C7PA 2HYDA 5BNZA 1AQUA 1NVMB 4S0XA 1N5MA 5BMVF 1ZNZA 2DFKB 2DJIA 5FJIA 3K31A 3O8QB 3GVLA 1RKBA 2HWKA 3GJ3A 4C5GA 3C6KA 2DLDA 4C21A 1ISFA 1SGWA 2AOTB 3F1LA 1TA9A 1G2PA 4GLKA 1PJAA 3BFMA 1YZYA 2CMGA 2ZROA 1Y1QA 4F1JA 3BCSA 5DBEX 3T3PB 4D5EA 2BGWA 5DI9A 1OROA 1HE3A 1U3UA 3V1MA 2AI3A 4LS3A 4Z53A 1PQYA 4UVGA 2IH5A 4HXJA 5FPHA 1NXSA 5FUWA 1K2VN 2FW0A 5M34A 1KHIA 3A10A 4GOXA 4L22A 2BGGA 2XITA 1G63A 4OJYA 3T5AA 4MP6A 2RE8A 3IQWA 2IOFK 2O5RA 2A0FA 5JS7A 1YDWA 3CO5A 4ID3A 3GWZA 5CX1A 3P9IA 3CXCP 4XLCA 2IHVA 2C97A 1OA0A 3WFIA 1XAGA 3L05A 4CG1A 2QLBA 1KSGA 4K9MA 3UATA 4ZGEB 1GKLA 3MINB 1AZTA 4AFUC 1HL7A 2X9NA 3QWHA 4QVZA 2JBWA 3CWCA 4KN5A 2RSLA 1MG0A 1NY6A 1H94A 2YJ3A 4RUKA 2NU8A 1KAEA 3DS8A 1GAEO 1JA9A 4XPIA 1ONPA 1JKJB 3BK2A 1V3UA 1T2AA 3MJ4A 4XVHA 3A05A 4R2JA 4BRWA 1SHZA 1JG6A 1T2CA 2HJWA 3AUFA 3OMXA 2XWPA 3IOMA 1AQLA 2BKDN 4UE6A 1RWVA 4NY1A 3KUFA 5BVHB 4M78B 2P41A 2LQWA 5C7IO 2D7DA 3PNOA 4JC0A 2Z2JA 2RI2A 4YRCA 4ZRDA 1IL0A 4W9NA 5ILOA 1XTIA 1M1FA 3K0FB 2GEUA 3CB2A 3D0OA 1KERA 3MS2A 1RWPA 4LTDA 4PIPA 5CVDA 4ZQGA 3N3BC 4N8SA 2JTEA 4DIDA 1KRXA 5FWXB 3P96A 2H29A 1VQPB 3VH2A 3DMNA 3WE7A 4CV3A 3C8MA 5FU7B 1LQTA 1SU4A 2O7RA 3EK2A 4HIZA 3QTLA 4EHAA 2R2AA 3VPDA 4TMVA 5FI3A 4R1SA 5EERA 3DVRX 3NC0C 4ZYXA 3NBFA 4JJZA 5EN4A 5GANf 1KXJA 5J2UF 3GJZA 3ULKA 4F9TA 5JSUA 2JN0A 4Q03A 2C04A 4R56A 1A2BA 3BQNB 8LDHA 3CCQA 3QXGA 3JWGA 5BYBA 3GEGA 1NN3A 4YDHB 5DDIP 2GCNA 2E5WA 2ERCA 1NYRA 1EBFA 2P91A 3KJEA 3PXUA 1B6RA 5EP4A 3QV1A 3OKFA 2ZZKA 2B8TA 3VM6A 1WQ1R 2EG5A 3M4JA 1GPWB 4WFKA 5KINB 2VDJA 4PBTA 4BJ6A 4PLTA 1S02A 3OQBA 2C84A 5AW5A 2WJHA 5JASA 2C5BA 4F3KA 4LNPA 2CL0X 4WBNF 2C7RA 4A15A 1ADJA 4J16A 1XRLA 3IX7A 4RIGA 3ZXXA 4BC1A 2NO4A 3LPCA 4DLSA 1E9CA 1AKEA 5IARA 4YXWA 4R2IA 1X9IA 2NSHA 4RGQA 3T3EA 4RF5A 2X35A 1JQEA 3OIDA 3GT3A 5EYPB 3OPMA 2EL7A 4GAEA 4JBLA 2D5IA 2DBZA 4X7MA 5E7IA 5KIAA 5EMNA 3C3BA 1W2HA 3OEYA 5L3RA 3RS7A 1Y7LA 3O6VA 3OJCA 4MO9A 4MW1A 4D0RA 4RCZA 1V7QA 2LUOA 1X7ZB 3L7LA 4C04A 4NS1A 2VHWA 4QZVA 3AB7A 3OTGA 4EHKA 3SHOA 1R4MA 3HPWA 1PGPA 4IXMA 4LQLA 4BE1A 4C0LA 4D4IA 5BN4A 3KXTA 3W2FA 4IUUA 5DYTA 1W19A 1M2GA 4D92A 4U1RA 3UT1A 1U0GA 1UD8A 2WLTA 3R20A 4ZYTA 1ZIDA 4P4TA 2YYZA 3PNVA 1QKXA 2IDJA 1WP6A 2BV3A 1DEHA 2ADFA 1DVRA 1OU4A 4KFRA 5IVHA 2XNDD 1D0XA 1NFQA 521PA 2WJ4A 1UC4B 4MW9A 1NE8A 4ZJYA 3WZ2A 1PKVA 3I2HA 2H3EB 2E65A 1RI4A 4FYJA 1OMOA 2XGGA 2JASA 1E5QA 1JJIA 4EFDA 2C8LA 1EUQA 3ZWCA 4BCCA 1FEZA 5FOQA 4C0KA 3K70B 5TQ0A 1I7QB 3ZGXA 4N4GA 2Y1DA 4B3HA 3M5AA 2B1GA 1AEYA 4L5CA 1RJDA 1SQFA 5I48A 1M76A 2OGWA 1GA1A 1FA9A 6NULA 4GH5A 1BAPA 3KNZA 4Q39A 3G5LA 4QGGA 4E88A 1V4BA 3R7WB 1XO1A 4TL9A 1BA2A 1JDSA 1GPH1 3MTDA 5I8ZA 3SLKA 1UQTA 1VCIA 4O59O 4CDMA 4FR2A 3GUUA 4EGSA 3VNAA 1E2JA 3HYSA 5IN4A 4BX3A 5CX4A 5LZ8A 1N2GA 3D3WA 4X5OA 2H9AA 3M2TA 5C81A 3OO0A 3U4CA 3S2SA 3SPXA 1PG0A 2VAPA 4YT5A 4FN4A 5ECAA 3GJ6A 3OE5A 4CM4A 3BJRA 4UUNA 4DMHA 821PA 1TZJA 5I4CA 3J81A 4BO2A 5MDHA 2MI6A 2QTHA 2VDMB 1R9MA 1SZCA 2YMMA 4RSRA 5IN1A 2PD3A 4PPGA 3ZCSA 4RZ2A 1A1VA 1DAHA 1I3OA 2UZAA 3BIFA 5CDSA 4R71A 3LVRE 4G8CA 3DBHA 3ZE6A 3KLBA 5E9WA 1AGRA 1RRPA 2P5YA 4NCNA 3HEBA 3V00A 4CT5A 4E4YA 5U4XA 3UA4A 4PG4A 2LV8A 4RPDA 4C5BA 4E0FA 1ZIYA 3KKNA 2DOKA 4RY2A 4UU7A 4FFSA 5CYFA 3S7ZA 1NTRA 1GCUA 4BFYA 1S4MA 2ZRIA 1K7CA 3FPGA 2J0UA 1E6MA 4MLDA 2JEZA 3BRWD 2WUEA 4LRUA 4NEHB 1L7XA 2V98A 4P33A 4X1OA 3SKYA 3TX6A 1XJCA 4UM9D 3NC4A 5TQ2B 1AKTA 3JD0A 3OT1B 4BLQA 2FYTA 1R5BA 1UWKA 4C8QG 2QZPA 3FVTA 3I53A 1YCGA 4OA8A 2LBPA 3FE2A 3KG2A 1P1RA 5H02A 4NZNA 4BP9A 1V26A 1GFSA 2P2LA 5AW0A 5HW0A 1XU7A 2ZRMA 1XDGA 1LW7A 2YY6A 2JI4A 2QN8A 3DTVB 4XDZA 4YDQA 2QRHA 3ZDFA 1Q19A 3JD4A 3TI7A 2K6GA 1FYDA 1Z8HA 2CLKB 1R64A 4C4TA 2OCYC 2RHXA 1WLSA 4I9NA 1C9KA 2HU7A 4F2DA 5HDQA 4WD3A 3K5IA 1B8NA 2BR3A 4YCDA 4HAIA 1KGSA 4PCLA 1Y71A 1HTBA 4REOA 5KUTA 2A9KA 1CR2A 3E22B 2YJTD 5HE8A 2FMXA 1N8SA 3PFNA 3KUUA 2W6NA 4JGGA 4U5QA 1TEZA 5H59A 2DUUA 1WOYA 3H9JA 3RFXA 2VUIB 4TRMA 4PRKA 5KTMA 1FZTA 5FOSA 4BN4A 2OBMA 3JSAA 1W34A 3ZPXA 4D9NA 4ACBA 5J4KA 2C3PA 3C3MA 3B6ZA 4U0JA 3A3NA 4IP0A 1VMEA 3GBPA 1BZYA 1KY3A 1IK6A 1N2OA 1RYFA 2BBOA 1I9CA 1KSJA 3M5WA 1TFUA 2FGJA 1CTQA 3CV3A 1T5TA 2F8SA 5CAIA 3COPA 3G2JA 5FU6C 3RTEA 3GGGA 2QUAA 3ENNA 2P4EA 4UHDA 3ONDA 2WQ6A 3OZRA 4KUDK 2ZJAA 2X6YA 3FTPA 2JVJA 1CX9B 3F6CA 2VDVE 2D2XA 2ID4A 5IVDA 1JALA 4AXBA 2QX7A 3BCRA 3F4LA 1IN8A 4V2UA 2BEJA 5K1ZA 3BGOS 5KTSA 5K5EA 4YJ3B 3LHFA 1EU1A 3TKLA 1G5HA 2FSFA 2D8MA 1Z8DA 3L7KA 4HGPA 5CXSA 1DBIA 5FORA 5IWAB 3FGNA 3HLKA 1ETUA 3Q8WA 4H7PA 1GLGA 1J56A 3LO8A 1K4MA 1VL0A 1XVVA 3AF2A 3JPYA 3FLMA 1NF9A 4HBZA 4KPUB 3GNSA 4ZT7A 3CESA 3LFHA 5JFOA 1V1JA 5TMPA 3AO0B 3BMOA 1R0WA 4F4UA 4AKHA 2QWXA 1Q5PA 1VRWA 3L18A 4EY3A 3W3AD 2ZJ0A 5LQNA 1RKVA 3B8HA 1B7GO 2XWSA 4DDMA 4S2UA 4EBFA 1E62A 2YZ7A 4FQ8A 3CD6A 4HGOA 1ZD2P 3ZUPA 4ZKDA 3QE9Y 1B0ZA 4R9SA 4ZU1X 2IXDA 3EG9B 3LIPA 3M0SA 1QH1B 2JFQA 4J7XA 4YI3A 1EQUA 5EVJA 4H18A 1GPDG 2NUBA 3N2IA 3SDSA 3Q0EA 1LUAA 1W36C 1JT2A 2V6MA 5CK4A 3VNRA 1T2EA 1P0PA 8ATCA 4AB1A 3SYNA 3IJEB 1LV7A 3ZOZA 5J3BA 4BYGA 2DBMA 3GXOA 1DAEA 1I7DA 4A23A 3ILYA 4NV0A 3MGCA 3NNNA 1M30A 1AF4A 1L7VC 1WM1A 2CL6X 2FWRA 3GUHA 3HJUA 4IHJB 4TS3A 1NUAA 3GYGA 2PD6A 1N1DA 3MC1A 4XXHA 4B8ZA 4LV6A 4QUGA 3HDTA 3C8ZA 2RQWA 4GPIB 1T2DA 3WV5A 2EJTA 3OLCX 1DTEA 2NV2B 2QA5A 3HP4A 3RK1A 2B8JA 3QYFA 1M72A 4IILA 3CVJA 4K46A 4OHPA 3G9QA 3G2MA 2QD2A 4Z4FA 2DPGA 2FV8A 1XU9A 2PSFA 1E4EB 1VKZA 3ZZUA 3IDOA 5CKDA 4PHTA 2P0AA 3QI2A 4DLTA 3I8XA 2YV4A 1GRVA 2XBUA 4KL8S 4ENSA 2HO4A 2IC5A 2ZT6A 5J2TB 4M75F 3FMPB 3DZBA 5EOVA 4X1KB 5DLEA 4FOPA 2ISSD 1BU5A 1VE1A 4A2WA 1VBKA 4UMEA 4KHPB 4AP9A 1U98A 1R18A 3CCEB 2H4XA 3PGMA 4OGEA 3UFXB 4B44A 1U3FA 4KRFA 1R16A 1NM7A 3HA5A 5EG5A 5A89A 3IQFA 4F5DA 5KE3A 4K1XA 1AK2A 1E4EA 1LDYA 3DTTA 2XDPA 1K66A 2R79A 2FQ1A 2EFCB 2FW6A 2NZ2A 3D54D 1MABB 3P2KA 1U1SA 1LBHA 1S2GA 4FSSA 3B1XA 1V4NA 4N4IA 2WU8A 4MVJA 4RVNA 4RVOA 4E7JA 4MR9A 3PNQA 2LCQA 3RGWS 1K7XB 3RWBA 4G36A 3VC1A 3VC7A 2IHJA 3HYNA 4BO6A 2IUEA 3AEUA 3ROMA 3G0OA 3PT9A 1M33A 3BB4A 3L7YA 2JHFA 3MWEA 4MJ3A 4PSKA 2XYQA 5J59A 3W78A 4V0ME 1MC8A 1CUVA 2CXUA 1QTIA 1X70A 3LBIA 4FCTA 5JXIA 4U6QA 4XSHA 4B43A 4F5YA 3AHUA 3K72B 3EVCA 1ECJA 3QBVA 2H0RA 2HUPA 5T3YA 1OZAA 2XQVA 4BGIA 4QECA 1G8FA 1KK7A 1B42A 4IJUA 4HC4A 2SEMA 5F21A 2NTVA 3H8SA 2Z9BA 1TM4E 2BFBB 3DBOB 4FNAA 4R4JA 1M1GA 1EYZA 1TSFA 1FTNA 1RRFA 2ZR9A 3W5IA 2F2WA 1QP4A 2ZAGA 1YNZA 3UHPA 1SRLA 4G84A 4HDSA 3ZQ6A 4FOOA 3AUJB 3P0FA 4C8QE 4Y2QA 1F1BA 3X1MA 3BQMB 4K5QA 2WPDA 4URWR 3SZUA 4LDZA 2ZSJA 3RC7A 3B7GA 3Q8MA 4JQOA 1QMCA 1RWOA 4IUCS 2FW9A 1TMGE 3Q10A 2C31A 5EJIA 3R9IA 1YONA 1I33A 1YBFA 2BT4A 3T53B 5C0OE 5E3HA 3DZKA 4YP7A 2VYVD 5B36A 1AX9A 4OPSA 4DT1A 1KMHA 2OG1A 1Q44A 1V1MA 3B1VA 5KTOA 5KZMB 3D2BA 5JH7A 2CSXA 5ERXA 1KYIA 1PZNA 4RM0A 1A8SA 2QM0A 1KQGA 4KBMB 1O08A 2R6CA 4MCHA 2MIOA 1IWOA 1JHXA 1B2RA 3N1UA 4UNPA 5DP1A 3SX0A 4EB3A 4XGQA 1PQ4A 3ZY5A 4PX3A 5DWQA 4WDRA 4BKMA 2YMLA 5JOQA 2XGJA 4MUAA 3DHVA 1NG2A 3QKSB 4G0OA 1F5NA 2DL4A 4M0KA 1DDGA 4BDTA 4O2BB 1Z26A 3ELYA 3MYYA 4HGZA 1DV2A 5ADUS 2Q6VA 3OX4A 2VHCA 3KEWA 4JFRA 2C7QA 4K3UA 4Q7EA 1Y9DA 2Z9CA 1A4UA 2JH3A 2JFGA 4L4UA 3QFCA 2H63A 1RQGA 3R6LA 1KS2A 5I3ZA 3M5CA 2LIVA 3K4QA 4FFBA 3RT7A 3WJ2A 4JLJA 1PJ5A 4MKGA 2GZAA 1DWUA 2K2QB 2ZL6A 3KJGA 4Y1RA 5HQTA 4ISBA 1IM5A 1O5IA 1KMQA 4FEAA 2P1DA 4JJ7A 4UTVA 2KS6A 4RDIA 1PX0A 1TVKA 4JLMA 4EK9A 3EJ6A 3U4MA 1NYLA 2IZZA 3ETGA 1UDXA 3O3CA 4MHOA 3SXUB 1YE8A 3TKAA 4R7ZA 4WSOA 1NR7A 1TIKA 3GR6A 1VM6A 3LT1A 4D4JA 4NV3A 2HXYA 1YI8A 2K7FA 1BS2A 3KTAA 4ITUA 3VS0A 2FX2A 3W8RA 4YRNA 1M5TA 2HSDA 4EABA 2R85A 4HVLA 2CREA 4YAWA 4RG8A 2PY6A 3SQNA 1O75A 5AVVA 5J5AA 3LQEA 3P0IA 3S99A 6REQA 3V2UA 1PJ2A 2LC4A 3K0FA 4FGKA 1I01A 1P1KA 4BCBA 2E4UA 2V7GA 4JJDA 3R6OA 3ICVA 3JCZA 3E9EA 5KYXA 3W4KA 1G7TA 4CIYA 3K94A 4WZTA 3BTOA 4JP2A 5SZHB 4K11A 1HYQA 4PZYA 4TTAA 3TB4A 1FNSA 3GEDA 2O8EA 2D9TA 9MHTA 1ZM9A 5DW0A 3UUGA 5EZ6B 2W22A 4NCJA 1WL8A 2BGUA 2OEPA 3WMRA 1FBNA 1Q9SA 1TKRA 2QPTA 2Q2VA 3DGEC 4I5DA 2X58A 3PHIA 4WCFC 2XI4A 1GNTA 2RH5A 3RAGA 4HAOA 5JVDA 1IZ9A 1QRTA 2XCLA 1XPOA 1QRAA 5LL6P 4CR7A 2VJQA 1QCYA 2FR0A 1SCDA 1X15A 2PCJA 1T1IA 1VE5A 3EUWA 2X9GA 1FU4A 2LQKA 1RSZA 1UKVY 2ACWA 2MYPA 2QUIA 2QX4A 3LT5A 4OXIA 1TCUA 2PX2A 5BN5A 5ADHA 5LOVF 1JJVA 4I8DA 3P2MA 4BGVA 3DG9A 1PW7A 5LD2B 3FNFA 4G2TA 4WNIA 1DOZA 3JCMJ 3KKPA 4OMFG 2IHUA 4K3VA 2QYZA 3CP8A 4M9CA 5CTJA 3V1NA 5KOIA 1NW9B 3WGZA 1NSFA 4L6V5 4MQBA 2AWOA 3KYDB 2C9DA 1R0CB 4LV8B 5ARBA 4MLPA 3VS7A 4X0CA 1C0PA 2P5TB 2WFZA 3FOCA 3RVBA 3GIDA 1HORA 3WLLA 3EGDA 1PD1A 4N7JA 1TM1E 3IQLA 3U49A 1DAOA 4QICA 5KYUB 4MWEA 1YASA 3CX4A 2RJFA 1X7ZA 5HJEA 4MIYA 4C4PA 1LI5A 2Y1GA 3ETLA 1UEIA 3PUIA 4RTYA 3OEWA 5FYQA 4RJ2A 4AN0A 2F59A 4KIUA 2NXCA 4LBYA 3L9WA 3GJTA 4N5HX 5AM4A 1MV0B 4MXDA 1L7BA 4Y6RA 1ODCA 4RZUA 3UAXA 3I6QA 2ZL7A 2IT1A 2L18A 3KU4A 4ZICA 2QEQA 2V7EA 4JH0A 4OXRA 5BMVA 4IH1A 2P5SA 2KMLA 2VTKA 5KNDD 3DL4A 2OCLA 4I3FA 1NPYA 3DZFA 1J99A 2OAQ1 4BE2A 3UAZA 1M3CA 3VH3A 3VZDA 3U3OA 1AXEA 4Z7NB 1A98A 4XIIA 4ZU3A 5EG2A 3IRUA 3KEQA 2VHJA 2EKQA 2VWHA 3VZQA 4C87A 3FCAA 1HETA 1J7KA 5LP1A 4XM3A 5FT9A 3I83A 5JCPA 1WXTA 2V8OA 3H0FA 4H1WA 2HU5A 2JTFA 4IH9A 2W6MA 4HN2A 3FMOB 4AROA 4JI5B 4L85A 4HVAA 3AI1A 3V7NA 4XWOA 4ZK2A 2FZLA 9LDTA 4QQGA 1U2SA 3CRQA 3SGLA 5AJTA 4G8JA 2TS1A 1O0BA 4UDOA 4PABA 1U99A 1E3TA 3RIYA 3Q1JA 2D1YA 3ITKA 4OGKA 2RMKA 3D7LA 3QV2A 2UXCB 1C1DA 1K92A 1F3LA 1ZBDA 1DELA 3G5TA 3M6MD 4DLWA 3QI7A 1J09A 4IM7A 1Q7YR 3JYLA 4O08A 1CKAA 4HWPA 3H1BA 3ROEA 1IMOA 2BBTA 4RJLA 1B3QA 2RD1A 1RMYA 4PBSA 5FADA 3BB3A 3QEJA 4LNAA 1E6UA 2PU7A 3DDHA 1FU8A 1YVEI 2B9VA 4LA4A 4M1QA 1GQQA 3IVCA 3TGWA 3WV4A 1GRNA 7REQA 4ZCQA 1T1JA 1BNCA 1WWKA 2SKEA 1C7FA 2YXLA 4UJ5A 4UHCA 4XW2A 2AKKA 3UMJA 4KDRA 2QX9A 3MOSA 1A7AA 2E4YA 4II3A 4BACA 1DLIA 1YNSA 5CVVA 4PX5A 5KREA