2QGGA

X-ray structure of the protein q6f7i0 from acinetobacter calcoaceticus amms 248. northeast structural genomics consortium target asr73.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
NVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPWYIETKAGWQTVDVKRWKPHGKGLVVSLKGVSDRTGAESLVASNIWIAKSQLPKADVDEYYWSDLKGLTVLGLDDEEQEVNLGQIHELFETGANDVMVVRATPDSIDSEERMIPWHKDVVQRVDLEAGRIYVNWGVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords 16S rRNA-processing protein rimM
publication title X-Ray structure of the protein Q6F7I0 from Acinetobacter calcoaceticus AmMS 248.
rcsb
source organism Acinetobacter calcoaceticus
total genus 41
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2007-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2qggA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2qggA01
1PM3A 3A1PA 2DYIA 2F1LA 2DOGA 3HTRA 2QGGA 3H9NA
chains in the Genus database with same CATH superfamily
4XTVA 3G6EA 2VGNA 1Y96B 1YCSB 2D0NA 2QA4T 1QKXA 1M1KC 2EYZA 4KBMB 2L0AA 4BI4A 2DJZA 4M77D 2IPOB 5I11A 2DFUA 4II3A 1K8AU 2VBTA 4BE1A 4E7HA 4ZCIA 1VQ9Q 5DS0A 3OJXA 3NPFA 1VQOQ 3CCRB 4QVAA 1VQ8B 3LVBA 1I8DA 1VQPA 1K9MR 1UTIA 1WHJA 5GAOq 2AKLA 4PLIA 1W2BP 1JJ2P 5M9OA 2M02A 2O9VA 4AC9A 1YJ9B 2LRQA 1LOJA 4Y7CA 1Z9ZA 2MCNA 4WCIA 3CCVB 1W70A 3JRZA 3OJWA 3CEYA 3M57A 1XOVA 2VUBA 1C6VX 1ZSZC 4M7AF 3ZBUA 2YT6A 4CI0C 4YAFA 2EQMA 1JXMA 4ELZC 1EFNA 2X3XD 1NE8A 3MMPA 3VS3A 3EG0A 1AT1B 1D3BB 1VQPQ 4RLZA 1WXUA 2CH4A 3OS1A 1W2BS 1JJ2S 2ZZQA 3VUZA 3JV3A 2OBSA 2FRYA 1WPCA 1KK7A 3L2VA 5DSZA 4X9DA 3CCQA 2CGHA 4ELYC 2FRWA 4QVDA 3HKSA 3OYDA 2LCLA 2QQSA 4M77G 4F14A 4R56A 4C92A 2EFGA 1UD8A 2CREA 3OS0A 2KVQG 2LZ6B 4DNRB 5HY6A 1Y71A 5CIUA 2GBQA 1G3WA 3TQ7P 5THXA 5IYRA 1LVKA 3VS5A 5A0GA 1DG1G 4IURA 4ATOA 5LJ5d 4C5GA 4G1BA 4F7UF 2CT4A 3OYYA 4K11A 1PWTA 1M2VB 2GJRA 1G2BA 5GAMf 2XD0A 3CCLB 2HDAA 1K9MC 4OB1B 1XNIA 1VQ4B 1Z9QA 4M7DA 3UA6A 2PVOB 4JJCA 2QDLA 2CNDA 1BCOA 3OYJA 1K8AD 5J26A 1YFNA 2BZ8A 2W10A 1R77A 2ATCB 4XN0A 5GV8A 2BF4A 3THKA 2RB6A 3L2RA 3ZZUA 1LPLA 2LT4A 2RQUA 3PT9A 1PSEA 1AIPA 1E7OA 1NG2A 2H3EB 4UZUA 2PQWA 4KGXB 1QMCA 5GAMg 4JLIA 1ZUKA 2EYQA 4XTYA 1DARA 2JUFA 1XQBA 2KY9A 3REAB 1OI1A 4RTTA 2OTJA 2C5BA 2H3JA 1GJRA 5IHNA 5AYFA 1FNMA 2CP2A 2VXEA 2XI9A 2XKOC 2DL4A 1Q7YR 3M0UA 4YEJA 4DOVA 2QQAA 2YHTA 2DAQA 2DNUA 2JXBA 4JDSA 2FPDA 4DQLA 3U23A 5CKFA 3ASQA 2GQIA 4GLMA 1KJWA 2NUTB 4RTXA 4CC2A 4C8QE 3CD6T 3JU4A 1BKBA 4MDXA 2VBSA 3M0QA 1Q81U 1M90U 4J9DA 3WQZA 1D2EA 1JEGA 1RAGB 2YUPA 2D74A 1I5OB 1N0UA 4XU3A 1TVCA 4ZGQB 4X0CA 2P0QA 1T6ZA 1K0XA 2JVVA 1TU0B 3LH0A 3E9GA 3CCMT 4AFZC 5GANd 2NUPA 3MP8A 2QA4B 4XQ3A 2FG0A 5KE3A 2DVJA 3WNDA 2IIMA 1NJIR 3CESA 2DIGA 1UD3A 4QQGA 4RG8A 2K5LA 2M1HA 2RHXA 2HSEB 2K5IA 2DLPA 1NRKA 3INZA 1Y0YA 3L2UA 3GQBA 2O2OA 3O8VA 3AGPA 4RJLA 2DEQA 4LNPA 4FYYB 2WSFE 4J7IA 1DDIA 3OPOA 2O01E 1JQQA 2DL8A 2ED0A 2VYTA 4L6V5 1S4MA 1OU9A 3S6WA 2K9GA 1N08A 4YAOA 2DVEA 1RLPC 2MWOA 1W2BA 2C4TA 1JJ2A 3FJOA 4KH0B 4C0DB 1QVFP 4M75B 5GV7A 2CDTA 2PTKA 1QGYA 2JT4A 4JJDA 1QVGB 3I55A 4RD3A 4WZTA 4BY6C 3W2EA 4PC3A 1SM4A 4JJBA 1Q7YC 2V7TA 1Q82R 3CPWP 5FIUA 2XIDA 4M53A 4P3IA 2C2WA 4G7WA 2EQUA 3CMET 1GBQA 1ZSZA 5CKDA 5J39A 2QE7A 2QK0A 4QT7A 4MZMA 2L3SA 3BFMA 2JTMA 1V0EA 3MPUB 3V8KA 1E3XA 4J6XA 1FDRA 1QGZA 4V2SA 4J8OA 2QMUA 2C78A 4BI3A 1OOTA 1QVFS 1CSKA 4XOTA 1YHQA 4P2NA 3UT1A 4L59A 3CXCA 4J9IA 5FW9A 3CPWS 2OI3A 4M75D 3E20A 3I55Q 3QYGB 1UUEA 3JSCA 3CCLQ 1F20A 1Q81D 3LW5E 2DILA 4J0QA 2C06A 1NJIC 1M90D 1SHGA 1WFWA 1VQ4Q 3HSBA 2RJCA 2GNCA 1H3HA 1VQMA 1SSFA 3JQQA 3SWNC 2BZXA 1GL5A 1D0XA 1NEBA 3HRUA 1WXTA 4M7AE 2YSQA 3OYLA 3A8JA 2I1LA 1AMOA 1T3LA 2V31A 3RY8A 2VNKA 1I1JA 5IHIA 4G6IA 4E7JA 2EYXA 4RDLA 4ZGEB 3BDUA 3OYNA 5KYYA 1ZUYA 5CQXA 2ZBVA 3HRSA 2DL3A 3EGDB 3QFTA 4XONA 3RMQA 2ZPGB 1YNZA 2HMAA 1RAFB 7AT1B 1GAWA 4P3YA 1VQMQ 2B7CA 1JA1A 1Q82C 1U3OA 4E2FB 4OMOA 3D7SB 4RD4A 5CVIA 5LJ5j 1B23P 1D8TA 1I0CA 3H0HA 5F4MA 3X24B 3CCSA 3I9QA 3T56B 3TSWA 2KT8A 2OBTA 2LJ0A 4GY5A 4M75G 4FT4A 1B7TA 3A8MB 1S72T 2QQRA 1BB9A 1ZQ1A 3CD6B 4CRIA 3RERA 1BI2A 3MP1A 1A0NB 2V7VA 4C8QC 4X7CA 3OW2B 4Z4TA 1R5BA 3SLNA 1B3QA 5GMKi 2QEXA 3RIRA 2QTXA 4XKWA 2E4HA 1QP3A 1N0VC 2RJDA 1XTDA 2OK7A 1FMKA 2JTFA 4Z4WA 4P9SA 2YLCA 3M56A 2QXFA 3UPUA 1BI0A 4HCZA 1MMDA 2M0YA 1QCNA 5FU6B 1HXDA 1BU1A 3SKBA 1PJ5A 1OEBA 3OYIA 1MRZA 4M0LA 5GMKe 3L2WA 3GNGA 2JNGA 1OB5A 3HL8A 2D8HA 4TN1A 4BPRA 4F7DA 2R9VA 2Z0WA 2ZZDA 4UC4A 1I7PA 4ZTFA 2QEXQ 1QGAA 2BE7D 1YP5A 2YUQA 1JU5C 3QDRB 2HAXA 4HE5A 1KC8U 3ONYA 3G6ET 4M77E 1WOSA 2QN6A 2X4YA 3VNUA 2L2PA 2FHDA 3SHWA 3OS5A 2HKQB 1AHJB 3JB9J 3MCAA 4XQFA 5GAN8 2IVWA 2RA2A 4OGEA 4Y28E 3VMFA 4X34A 1QVFA 2E12A 2XGJA 3Q6RA 3QFSA 2L8DA 3ZL7C 3CMEB 2KI7A 4KGZB 1K28D 4Y9UA 2X9HA 3LWIA 3HTRA 3SFMA 4OMLA 2VB6A 3CPWA 1QW1A 3CMAT 1K73U 1D1BA 5F4JA 4XL9A 3W2HA 2DD4A 1UGRB 1LCKA 2YUNA 1PNJA 5GAN6 3SD4A 3M4GA 1N5ZA 2CW5A 3MHPA 1QWFA 1HJDA 1GCQC 2KR3A 4FXUA 2R58A 1YCYA 5KYNA 2KVOA 4PC7A 1GO2A 2PLFA 2X4XA 3EG2A 5F4OA 2HDNB 4BACA 4X06A 1VQKT 4RTZA 1WHKA 2PVGB 5C0MA 3GSIA 4O6JA 3CCQT 4QUZA 3QJ6A 4M7AC 4ZV4A 1SRMA 4OVAA 1VQLT 2YRVA 4FSSA 3SWNA 4IUPA 2BPOA 3A98A 2L5QA 2PVDB 2F2WA 1UECA 2LC4A 4XNFA 4JJNK 4FYXB 2QDYB 3QO3A 5LJ5e 4HIZA 3NTKA 3GP8A 1VUBA 2ZAEA 2O31A 3A8KA 2KE9A 4II2A 3ZFJA 3ULRB 4O5VA 3X25B 1KQSP 1G7SA 2B7BA 1Q95G 4DBHA 2JW4A 1SKYB 5LJ3d 1SHFA 5DLQE 3WXMB 5KSWB 4XKVA 4OMNA 3BNWA 5KYXA 1KC8D 2E1BA 1NBMA 5FWCA 1YWPA 1E1RA 4ZN3A 1KK1A 2NV4A 4XTUA 3MEAA 1VHEA 3O5ZA 3LLRA 3I35A 5FLXE 3B78A 2KK4A 4OMQA 5IYNA 4P25A 4C8QG 1S72B 5KYUB 2PE3A 2EJGA 2X3UA 2EBPA 1KQSS 1WZOA 5KYWB 4BE0A 1OHHA 3BCDA 2VJJA 2MAMA 2KSSA 2XDDA 1PCXA 4OPVA 3N5BB 3GF5A 3GLXA 4RDKA 3CCJT 1A8PA 1UD6A 2FVUA 2OK8A 4EMKC 1K73D 4KULA 1H641 3A8HB 2OTJT 4C8QA 3LGFA 1BK2A 2E70A 3HAGA 3I5RA 2ZXHA 4JZ4A 4P5NA 1FNBA 4FM4B 2GCXA 3VRYA 4LBZA 3QZ5B 2RD1A 3CC2A 4PC2A 2JTEA 3VYGA 4II1A 3OYAA 5HZBA 2RHZA 1G3SA 4FT2A 3WNCA 4IUVA 4A4GA 2EKOA 2WPDA 3C94A 2RK2A 2MYSA 4EIKA 3TREA 3JCMh 3AVUA 2BZYA 5GANe 2CZ6B 2HQXA 1M1FA 1N9SA 3URGA 3G6EB 1TUGB 3UF4A 3CTAA 4RD6A 3WVEB 2IG0A 3HFOA 3M55A 2RHYA 1RAAB 4K1XA 2XMFA 3V8JA 4M77C 4PJJA 4PC6A 3HPWA 4F7UB 2G3RA 2BMWA 3H8ZA 1NB0A 5DN6A 1RADB 3H9NA 1YN8A 4HVWA 3GIRA 5L46A 5TR9A 1QCOA 4KRTA 4IKFA 5LJ5f 1KD1R 3BCFA 3JB9I 3U6BA 2PMDA 3WBKA 3OW7A 1IREB 2X85A 3OMGA 3EGXA 1VQ5B 2RNAA 3CMAB 1K8AR 4PC1A 4YALA 1PRLC 2BN4A 2HCKA 3E19A 3KL9A 4RPDA 2BVNA 4P22A 5GAN4 2QTZA 5D7UA 4C0GA 2O88A 1E79A 4BDYA 4DEYA 3TCJA 3PNWC 2YWGA 5D6WA 1LJOA 2X8KA 3LGLA 1GCPA 5LJ5g 1WORA 3CBMA 3G71A 3G7ZA 1VOMA 1NPRA 4QQDA 3JCMV 2O4XB 3EHQA 2EW3A 2JJ9A 1GCQA 3QWXX 4M7AG 1KHCA 2DXBA 5TY0A 3SDZA 1VQKB 4HVUA 3MHXA 2DA9A 1KG1A 4LN2A 3Q1JA 2VNJA 1AEYA 2RQTA 1ZM2A 2W6JA 2CSQA 3J81E 2HCJB 4L5GA 5KH6A 2DZCA 1VQLB 1D1CA 3A8OB 4OMPA 2D8JA 1WSVA 4M75E 1YHQT 1UGVA 4XLEA 1VQ9A 5FROA 4M7AA 1D1NA 4HE6A 2OTLB 4RTUA 4IW3B 3G71Q 4P6YA 3G05A 2XOKA 5HZAA 3BQJA 2DYBA 2WJVA 1CNEA 2GQVA 1OZ3A 1O9SA 2E6NA 2Q6KA 1RL2A 4UAJA 1KD1U 1T6YA 3NTIA 1KQSA 5GANf 2Y90A 3QWYA 2E41A 1N6AA 4OMMA 4E0FA 1YJWT 1K9AA 3PVLA 4F7UG 1K8AC 1NLOC 4JPBW 2QTLA 4ZNXA 4QVCA 4PJOF 4AG1C 3MKDA 1IHVA 4Z8AA 5GAOr 2RN8A 3PVQA 1NZ9A 1ZA1B 5FU7B 5GMKm 3CC7B 3RESA 3Q3AA 3H41A 4TMWA 4H9GA 3CCJB 5LL6S 1WX6A 5GANg 1QUEA 1YIJT 1WLPB 1IB0A 2DK3A 1GRIA 1VLYA 4OPSA 2R57A 1ZBXA 3ZUGA 3CCST 4YHBA 4ZGNB 1O75A 2DD5A 5LJ3j 4PJLA 3OZUA 4C0ZA 4EMKA 2ZPEB 1Q86U 4IUQA 4A4EA 4X1VA 1N8RU 1ARKA 3CRZA 1FMWA 4WTOB 1EWYA 2D9TA 3OYGA 3CCET 1KK0A 5FA6A 3CP8A 4B4DA 1FX0A 3PMIA 4FSXA 2F1MA 1B34B 2FB7A 2ZPBB 3CXCP 1W35A 5FL7A 4Z88A 1OX8A 2DO3A 2PU9B 4LBYA 3OYEA 1BLIA 2M0OA 3KBGA 3UA7A 3OEHA 4J5YA 2X3WD 1YITT 1QFJA 2E10A 1AZGB 4PLLA 1Q81R 1M90R 1UD5A 4IIMA 1U2RA 2KROA 4RD1A 4OMFB 1VQ5Q 1M9SA 3VS7A 2EPDA 2L3PA 2CH4W 4N4HA 3OP1A 2ABLA 4BD3A 2ROTA 4M77A 1Y07A 3BH4A 1VQ6T 2RI5A 2DTOA 3CXCS 1KK2A 1AOJA 3CC4A 2KRMA 2LTOA 1W87A 3I1FA 5H59A 1KD1D 5I22A 1H8HA 1T6XA 1YJNT 3GVLA 2HL5C 3EFRA 1YX2A 1W2BB 1MMNA 4NBSA 3A8GB 4C43A 2CC2A 1K1ZA 2L89A 4XU2A 1Y96A 1UDLA 1G3YA 1Y0RA 4R55A 4LC0A 5I2SA 3PENA 1M3BA 2FZGB 1RAEB 1TS9A 3U2QA 3DDYA 3EFOB 3CC4Q 4RG2A 5HKKA 3RNJA 3I56T 4X8IA 2F69A 4Y9RA 4LDWA 8ATCB 3CCRA 2OTLQ 1VQ8A 1T3SA 5GAOl 3A8LB 4ZTJA 2M5SA 3MJXA 1SEMA 2ECZA 3AVVA 1Q86D 3V76A 1ZA2B 4C0DC 1N8RD 1IZ6A 1YHQB 4M75C 4PL6A 4XOPA 4DQ2A 2KRSA 2VBVA 4C92F 3CCVA 3GVKA 5EC7A 1H8KA 1Q81C 1M90C 4A54A 3W5HA 2MIOA 3KUFA 2WR8A 2HZYA 1TTHB 1FX7A 4ACBA 2C0TA 2M16A 2GK7A 1VYTA 2DTHA 2V4DA 3CCRQ 4WWVA 1VQ8Q 2F2VA 1D3BA 3CC7Q 2X0KA 2WSCE 1WGSA 1YJWB 1P4MA 4XLFA 3OYHA 3JCMQ 2P3MA 4Z4SA 4PGOA 1ACMB 1YJ9Q 4M7DF 1H92A 3OYFA 1X6GA 3CCVQ 1OGIA 2DERA 5LJ3e 1NEGA 2JN0A 1TH7A 3NFCA 5CKHA 1UMKA 1LNXA 1QQJA 2P4RA 4AT1B 4E47A 2K3BA 3ASTA 5GMKj 1YI2T 2VJIA 3DLLA 1FRQA 3GPLA 3CCUT 2DL7A 1TLLA 1VQ7T 1YIJB 5GAMh 1SG5A 2QGGA 2R5MA 4B3FX 1AWXA 4ASUA 2MK5A 4AFUC 3G1JA 4Z02A 5J35A 2VYQA 1ZM9A 4CC7A 1M2VA 3W5VA 4J83A 3CCLA 2FX3A 1WJQA 1Y7XA 3AVWA 5LMZA 3ASPA 1VQ4A 2HSPA 1QFZA 3CCEB 2LQ8A 5JBQA 4RMOA 1HYOA 3G4ST 4XTWA 1ABOA 2KYMA 4EMGA 1GXIE 1M5Q1 3SLDA 1I5LA 1N05A 2G6FX 4FIBA 2XICA 1RI0A 2KRNA 1SF9A 3OKXA 4PJNA 4YXWA 1QKWA 3VR6A 2OYNA 5A88A 1M8VA 4ZCMA 1YITB 4AF6A 4J6YA 5FO0A 3GOXA 1E63A 3CC2T 1OZ2A 4WZLA 4LDYA 2GTOA 3S3OA 4F04B 4KUDK 1ZM3A 2HL3A 3QE2A 4RD2A 2XZOA 1FRNA 5KCHA 1BJKA 2K2VA 2YDLA 3QFRA 1VQ6B 4FW1A 1RQPA 1QLYA 3OW2P 1IJEA 4ROXA 5IN1A 2NUTA 1EXMA 1YJNB 1I4K1 1BQEA 2P84A 3P27A 4P12A 3X28B 4DK1A 2Q6IA 3M9QA 4BE2A 2CP0A 3TU4K 1D1AA 4AVZA 5HK0A 4HA8A 4AF7A 5FU6C 3VS4A 2RO0A 4M78B 1T0JA 2D6FA 1HVXA 3AVXA 3CMMA 2GF7A 1X6OA 2CUBA 3EHRA 4HXJA 2QA4A 1VQNT 1KC8R 5CCAA 3JAME 5KW9A 3OW2S 4LXCA 1DJ7B 4AFSC 4EH1A 5LJ3f 5TRDA 3DB4A 4BY6B 3JQPA 3FJ5A 5DM7R 4Z4YA 1OPLA 3I56B 1QUFA 1X43A 4OF1A 3QFCA 2LZJA 3EG9B 2KGTA 2J7IA 1M4ZA 3AHUA 4PFPA 2K3XA 3LYIA 3LQEA 4F7UE 1QVPA 5D6XA 3FC3A 5IXBA 1SKQA 4M78D 2QA4Q 1K73R 4PAAA 2D0QB 4PKCC 2DIEA 3WY9A 5BSYA 2I0NA 2EGAA 5LJ3g 2Y4XA 3WYAA 1U8RA 2VBUA 3ZEHA 4M75A 1X69A 3LWHA 4MYTA 1MUZA 1QVGA 2VWFA 1J3TA 3CCMB 4C0SA 4J9HA 1E3ZA 4N3NA 3BW1A 3BY2A 1UHFA 3M58A 1X2KA 2V7WA 4DOWA 3SEJA 2FL7A 1IXDA 1VQ9T 1QG0A 1EX4A 1IHWA 1NB9A 1VQOT 3M53A 4QW2A 2DTIA 4J9FA 2CT3A 2K6DA 4FL6A 3V7SA 1IHMA 5IK2A 1T5EA 2VVKA 3U6KA 1QFYA 1HK9A 1QP2A 4RKUE 4HT9A 1YI2B 1KC8C 2EYWA 4YTLA 3CCUB 1VQ7B 1TG0A 1PKSA 2GFUA 2JJ1A 2VZLA 4B3XA 1EP3B 1V0FA 3GNFB 1E64A 1XFOA 3VNVA 5GANj 1AZEA 4IIOA 3PUMA 5HCKA 4FU6A 2KEAA 4BDZA 2LNHB 2GJKA 1VQPT 1OGJA 4M4ZA 3GIBA 3G4SB 1OX9A 1JXOA 3MP6A 4JS5A 2AKKA 1K73C 5J3OA 1S0UA 3OZWA 3EGDA 1RABB 4PNOA 3OYCA 3F70A 1RLQC 1FYNA 5CO7A 5GAN5 4BB7A 3A3BA 3AT1B 4FK8A 1V76A 1IB8A 1UGSB 2BGJA 3QBYA 1G7TA 1KQ2A 5IYQA 4LD9K 5HKCA 2DXTA 4XD7A 1V29B 4XU0A 2YXYA 3EG1A 3H6ZA 5TV2A 2ZL6A 1IJFA 1HSQA 2F43A 4M4SA 1GBRA 1BX0A 3CD6A 4E7LA 1YWOA 4N4IA 1Q9SA 1D0ZA 5CK9A 3OW2A 5AT1B 2LDMA 4E6RA 2B5OA 2M51A 4ANJA 2ZTNA 4RM0A 4XR6A 5EMNA 3C95A 4RCBA 3VUBA 5KCOA 4RCCA 5I21A 4QVJA 3OYBA 4FWTA 1WJSA 2ZPFB 8AT1B 1UGPB 2DXUA 2V26A 1VQNB 3OMCA 2ESWA 4B48A 3KFVA 1JB0E 2QQ9A 4M78F 1JB9A 3W5UA 2LT1A 1XE1A 2KMTA 1RAHB 3M0PA 3CD6Q 4PJOB 4RD0A 2BTTA 4NL3A 3L2ZA 2XNCA 1KMHA 1OU8A 2CF4A 2JS2A 3PA1A 3R6KA 1BI3A 3VO1A 1ZM4A 4QFMA 1XQHA 2DXCA 2QG9B 4MMKA 2D9RA 3CW2A 1W0JA 3RKXA 2FEIA 1BI1A 3ASKA 3C4SA 3VS2A 2DKGA 3KXTA 3M0TA 3CCMQ 4E7IA 4N3GA 4YAWA 2HD0A 2J05A 3L2QA 3X20B 1N9RA 2ENMA 4FN5A 3QPHA 1KZLA 5A2QE 1UB4A 2ZXIA 4OOXA 2YWEA 2C4UA 4KUIA 1UFFA 1X2QA 3JCMX 4PJOD 2SRCA 1JA0A 4ZN1A 3CMEA 2J7KA 1PSFA 2FZCB 4B47A 2V1RA 4ZGDB 3QJYA 3S3NA 5IXFA 3V7AA 1PJ7A 3CP2A 3A35A 3OS2A 4NL2A 4GQNA 4JUVA 2XHCA 3SJZA 1VQ9B 2V7XA 1EFCA 4LUEA 3JCMc 1YI2Q 2F5TX 1VQOB 2DBKA 2A7YA 4DNTB 4XLHA 4JZ3A 4P26A 2HQHA 2QQBA 3OQ5A 2LNVA 2DOGA 3JB9H 4B6MA 5C6SA 3OA6A 3JQRA 1KIKA 2LP5A 1X01A 3ZIAA 1WDXA 3PA2A 2DETA 3R6JA 4ZCLA 3J81k 1EP1B 2RHUA 3C12A 3VYHB 2VNHA 1MMAA 1R0CB 3RR6A 3CMEQ 4R0KA 3ASSA 4EPCA 1WHMA 4X7EA 3L42A 1OB2A 3I5SA 2E5QA 1PM3A 3VS6A 3JCMJ 1TUDA 2MOXA 3HFNA 1VQPB 2Y4YA 5GMKh 4CC4B 1UJYA 1WOPA 1JBMA 4TMZA 9ATCB 3GBQA 4JLGA 4B9XA 2JS0A 4P6VF 4PJOG 2LJ1A 1VYUA 2RQWA 2P0PA 3OOCA 4FW2A 1ZUUA 1V1CA 2HKNA 1WSRA 2ZZGA 1CQXA 4KKUA 3I55T 1KJZA 3WXMA 1WDTA 2YWHA 3DLMA 3OBWA 2PNIA 2COZA 4LBVA 1VQ4T 2FYKA 5L8RE 5GAOn 3J80E 4RCYA 3OYKA 2V7QA 3Q6QA 1TTTA 1RQRA 2KBTA 3HP9A 4X9CA 2D3LA 4XK8E 1Q86R 4Z4UA 5IH2A 3CCQB 1S72A 2E1RA 5KYUA 1VYVA 1N8RR 1X75C 3JCMP 1SPKA 2MWPA 5KYWA 2OBRA 4KGVB 2OJ2A 1TUCA 1KHIA 4C92B 3JCMd 3VO2A 1WTHD 4C5HA 1UHCA 1VIFA 1X27A 2COYA 1SRLA 3OBYA 1MABA 3KEWA 4PJMA 2X6YA 2GTJA 1WP6A 4F16A 1E1QA 4YELA 3ISXA 1U1TA 4OP0A 4B44A 2DRKA 1VQMT 4VUBA 2K79A 2KQWA 2KDSA 1E6HA 2RMOA 1W34A 2X53S 1MHNA 2RC6A 1KD1C 1VLOA 1S72Q 3V7RA 1I8FA 4OOVA 4M7DB 2CBXA 2CZ1B 4D8DA 4RTWA 4B9WA 4B3GA 5IT9E 4C92D 2HEQA 2PIAA 4HVVA 4E7KA 4AFQC 4E7ZA 3H0IA 1EFRA 1WIEA 2EJ9A 4WQMA 5AN9A 1M1KU 1GR1A 2BGIA 2K7AA 4Q7JB 5LJ5h 1ZX6A 4F7UA 1COWA 5CKBA 1JRIA 2CZ0B 3IQLA 2V1QA 2OTJB 2DYIA 3LX7A 4M7DD 4G5GA 3FRNA 1Q86C 4TMVA 1N8RC 3ONUA 1E62A 1VQ5A 3BDLA 4M78E 5DY9A 3CMAA 2PZ1A 3G6EQ 3JB9F 3PIPA 2QEXT 4NOYA 4DQKA 1YBYA 2CSIA 2VGMA 3VRZA 2I2LA 4XTXA 2EYYA 3VV0A 1EFTA 2C5HA 5FO1A 2X4WA 3P8BB 1WXBA 1G3TA 3AGQA 1NDHA 4LBWA 2RK1A 2A36A 2NWMA 1FMVA 1E43A 1GFCA 2EAYA 3VKIA 4U9UA 2J6KA 2NUPB 3CBOA 3UWNA 1M3CA 4C92G 5CAIA 2O4XA 1AVZC 1KK3A 2CP7A 4JS4A 1VQKA 1W4SA 2A37A 1NYGA 4JRKA 3CMAQ 1AWJA 1H85A 2JN9A 3LH5A 1AWOA 3Q39A 1VQLA 3QDFA 3SJPA 1ZHIA 3QSYA 3ES9A 2P0KA 4C0FA 3QXEB 1N27A 2DM1A 6AT1B 2OTLA 4M7DG 4RPBA 2EWNA 2VXFA 1JJ2B 3BE3A 2AIRB 5IAYA 5GANh 2JIZA 1I81A 3ZZ0A 3NTHA 1KFZA 1U5SA 2V8KA 2WACA 1VQKQ 3QG1A 2MF2A 2CRVA 3I55B 5KE2A 4TMXA 5GAOp 3OFNA 1PRMC 2OAWA 1K9MU 3CCQQ 2DF6A 3FPKA 1TUIA 1M1KD 3D26A 3OEEA 3H0FA 1ZSZB 2DRMA 2F2XA 3MEVA 1VQLQ 4Z4VA 4R71A 2VC8A 2K4YA 3FPPA 2OAUA 1BIAA 5CDFA 1W1FA 1MV3A 3TSZA 1ZUNB 4UZEA 4J9GA 3A3GA 5GAN3 2AK5A 4C5IA 1WPYA 2DMOA 2ZGWA 4OB2B 3CC7A 2R6HA 1TWBA 1S1NA 2QAZA 2KT1A 2DX1A 2X35A 1PHTA 3MEUA 2MI6A 3SEMA 3CXCB 3CCJA 1VHOA 1UG1A 1YJ9A 1J9ZA 3NHNA 1QVGP 2EQJA 4ZGJB 5FWBA 3BY7A 4MZPA 2JDIA 3UATA 2RH2A 1VQMB 1GVHA 2XG8D 5A0DA 3RKYA 3FJPA 2VV5A 3LO8A 4N0AA 1MGQA 3OYMA 1XB2A 1CNFA 4M77F 2COWA 2DY1A 2DE0X 4CC3A 4RTYA 1HD3A 1HA3A 3EH1A 2W6IA 4ORZA 3T9NA 3M54A 1PC0A 1ELOA 3ZBTA 5KYYB 1WHLA 3JCMW 1B34A 2HNIA 3CCJQ 4XM3A 1D0YA 1QVGS 1FWZA 3M0SA 1T0HA 2JMCA 5FRMA 2FO0A 2LMJA 2OTJQ 2X51A 2QTVA 2LCSA 3A1PA 1PJ6A 4KH1B 2C77A 4HCKA 4EDUA 1TOVA 1C1AA 3RKWA 2X6XA 2SEMA 3L1AA 4XU1A 4RDJA 2RQVA 5GMKl 1C0MA 3P8HA 2NUZA 5CR2A 4FYWB 4X7FA 1UD4A 2ZCFB 1BIBA 3CCSB 4HKEA 4BUGA 5GAN2 2VKNA 1SSHA 2RF0A 4ACAA 2BIVA 3HRTA 3ZC3A 1ABQA 4XAXB 1W6XA 1GAQA 1R8OB 2XK0A 2V7UA 4J6WA 1K9MD 3B8HA 1WQWA 4J9CA 1YLOA 2HQEA 4M78C 4A53A 2ZZFA 2QEXB 3EGUA 3M4YA 1JNYA 1D09B 3GVJA 4ME7A 2C0IA 5IYPA 3ZBDA 4JRQA 3AVTA 2AZVA 2AT1B 1Y57A 1WYXA 2J6OA 4PJOE 3LQ6A 1Q7YU 3OZVA 4D6WA 2GFAA 2OX7A 1PKTA 2DCUA 3ME9A 1OB0A 4XMYA 3E1YE 2K57A 4KKSA 4XN3A 4TMTA 3EFOA 5A8AA 2L3QA 3WNBA 1U06A 2EKHA 4X7DA 4L8JA 3W2FA 4OB3B 2J6FA 1WNLA 3CBPA 5D6YA 5B6IA 4MMLA 4PK4A 4A4KA 1WU8A 3HHTB 2X4JA 1RAIB 3REBB 2XDBA 2ZPHB 1GFDA 2RJEA 2PUOB 3NE5B 4J7FA 2AHOA 3S3MA 2XU8A 2W0ZA 3TVTA 2D3NA 3EH2A 3OE7A 1NJIU 4PFZA 1G7RA 1QX4A 2AHJB 3R6NA 4P1VA 2EQIA 2Z6BD 2WYRA 1EFUA 3CB4A 3MCAB 1WQ7A 4Y91A 5GAMd 4FYVB 1E6GA 1K4US 1KSWA 2E3HA 3EFSA 2WSSA 1QVFB 3A5ZB 1VA7A 1KQ1A 4QV2A 1NLPC 4WZEA 2ZTGA 1MV0B 1WA7A 3CPWB 4J9BA 1YJWA 1YHQQ 2RQRA 4LDUA 4QQ6A 2RI2A 1EZZB 2P4TA 3P26A 5GAN7 4XLAA 3QSUA 3CPXA 2NYSA 2CZ7B 3FKSA 2JM9A 2LJ3A 3BY1A 1Q82U 3ZPNA 1XJWB 1YIJA 3G71T 2BKDN 3EAEA 2A08A 1RUWA 2Q6OA 2LQKA 3META 4G1VA 3X26B 4TKOB 1YJWQ 4LDVA 5FRNA 2KYBA 1WHGA 2ZITA 1X6BA 4NS5A 2NPFA 5KNLA 1Q7YD 1M27C 2V8IA 3JCMe 1M3AA 2CUDA 2E6ZA 2KNBB 1UE9A 2Q6LA 2CP3A 2ROLA 3CCEA 1CKBA 3SWNB 3AVYA 2ZL7A 2LCCA 4RCZA 2DL5A 2CP5A 3PMTA 3NMZC 3W2GA 2NLUA 1IGQA 1YIJQ 5HXBA 3E1SA 3WVDB 3VJPA 3PGGA 3TEEA 1W0KA 2A3LA 2XEXA 4KKTA 3CCSQ 3FLGA 3ZZTA 1VIEA 1NYFA 2DJQA 3FB9A 4DA4A 1YITA 2J06A 2JOYA 3V7CA 2YRCA 1BCMA 2FPFA 4PFOA 5KYXB 1G5VA 2JM8A 2WZPP 4Z4ZA 5EG2A 1ZBJA 1NJID 4C92E 3CCEQ 2XZLA 1OV3A 1PD0A 2X6WA 1UGQB 1VQ6A 4XORA 2EGEA 1R5NA 4CQJA 3OB9A 3RDVA 2A28A 5J3BA 1G8XA 1SKUB 2HBPA 1RI9A 2MMPA 1WHHA 4M78G 4A4FA 3WBJA 1K76A 4PABA 1DDGA 1YJNA 3FDRA 1BX1A 2DPPB 4XLCA 3QKJA 1YITQ 3OSVA 3V8LA 2DEUA 2F4NA 2CYZB 2F1LA 5IYWA 4DBRA 3PTAA 5GJVB 5FNZA 2D1XA 5LJ3h 4C8QB 4M78A 5I2MA 2H8HA 4M7DE 1VF7A 4DBQA 2BE9B 2RHIA 4PJOC 1HZEA 1JO8A 2CS7A 1VQ6Q 4M75F 3RBBB 5A0LA 2BM1A 4M1KA 1IO6A 4OGCA 1Q82D 3CC2B 2QYZA 1K0SA 1G83A 2RC5A 4BI8B 1VQ5T 3I56A 1YJNQ 1FNDA 1TXQA 3EG9A 3QHSA 2YRDA 3P8DA 1N06A 2BM0A 5IHKA 3VU3C 1KTVA 1PG5B 1I07A 5H5JA 2PUKB 2DZ9A 4HCBA 3PE0A 5CKEA 2E1HA 4C8QD 3ASRA 2O9SA 4JRPA 5L23A 3JCMf 2QASA 3DB3A 3H94A 4Q5WA 1MMGA 1M1GA 3CCMA 3I56Q 4Z1MA 4N4GA 2HBWA 2CP6A 2YWFA 2VASA 2ZZEA 2LVMA 4EMHA 4LE9A 1I18A 2A0FB 2B8AA 2F5KA 3CC4T 1B07A 4C5EA 2FVGA 3J7AF 3EGXB 4IUTA 2B86A 2M9UA 3C0CA 1QCFA 3PIOA 4OOSA 3PVDA 5A89A 4X05A 3JCMg 2OTLT 2K2MA 3PUNA 4AG2C 2VNIA 2LX7A 4Y92A 2YWWA 3MEWA 2E64A 2MPXC 4MZTA 3T53B 1YI2A 2KXDA 1QH0A 3CCUA 1F60A 1VQ7A 1H3ZA 1W9XA 4AMCA 2WJYA 4DEXA 3G71B 4NCNA 1PD1A 1R0BG 2GREA 5GAMj 4OPOA 4DBFA 4WF2A 1WJRA 2C0OA 2EVRA 1NPPA 3Q38A 2LQWA 2RM4A 3E9FA 1TSFA 3M59A 3CPFA 3CCRT 1VQ8T 1OYXA 2GQFA 1NBEB 2KXCA 2QGFB 1R5OA 3UDCA 2GK6A 4GLKA 5ECAA 3CC7T 4D8KA 1Y0MA 2HLDA 3G4SA 4MDWA 4NNJA 1B2RA 4XTZA 1M8MA 1BMFA 3M5AA 4IUUA 4M2LA 1V5VA 4M7AB 1YJ9T 2K5FA 1BBZA 3CCUQ 2GJPA 1UJ0A 4TVRA 3CCVT 5HK3A 1VQ7Q 2ED1A 4HCCA 1MNDA 2EGCA 4RUGA 4WZKA 3BC9A 2LX9A 2GPJA 3FIFA 3VS1A 3T51B 1EIFA 4JRIA 1KQSB 2FPEA 4OB0B 3ER0A 3LNNA 1P92A 4G7XA 4MYUA 3G4SQ 4DK0A 4C92C 2ZPIB 3JB9D 4UZFA 3PFSA 1UEBA 1WOOA 3QYHB 3MO8A 3E2UA 2EIXA 3R6OA 1IRXA 2RPNA 4M7AD 2XNJA 3QUIA 4LDXA 4ESRA 2XZPA 4HT8A 4GBQA 2LQNA 2CK3A 2RJFA 1N07A 4QVZA 1ZSGA 1VJSA 1FNCA 3CC2Q 3B82A 2BV3A 2DIQA 4TSFA 1UD2A 1BPLA 2YLBA 2JJ2A 1RACB 1ZLMA 1VQNA 2EQKA 2KAFA 4M7DC 1G7CA 1WI7A 3OSSC 1EP2B 2YUOA 5DLOA 1M1KR 2XDPA 1AD5A 4EMKB 3OY9A 2ZL5A 4C8QF 1H8EA 2BSAA 3CCLT 2GGRA 2K3YA 1OULA 1M30A 1QWEA 1CKAA 5CQYA 1MNEA 4PJOA 1KRHA 5BSXA 2QDXA 2L3RA 5FU7C 4J9EA 4TT3A 4OP7A 2JMAA 2R5AA 4B43A 1OPKA 2XNDA 3RUXA 2WZNA 3W2IA 4KT0E 3JCMb 3CQTA 3FEOA 3QZ9B 2JZ2A 5GJWB 4Z4RA 4F17A 1VQNQ 4LD6A 1OQKA 2V8JA 2WSEE 3JB9G 2EJFA 1FXXA 2EIFA 3EG3A 3RMSA 1IGUA 3A8IA 4QKUA 1PKVA 4YAUA 4A4HA 5GAOm 2FZKB 3NGPA 3OAAA 4N0AC 1BYMA 1H42A 2QI2A 2CKKA 5E6TA 4FCYA 2DBMA 4M77B 2EFIA 2E5KA 1M2OA 3SB2A 3M0RA 4A63B 4RTVA 3CC4B 2BUDA 4Z89A 4E7SA 3DKMA 2ZBUA 1AWWA 3VS0A 4LUDA 2RI3A 2AZSA 1VQOA 1NM7A 4X07A 2E3IA 5GAMe 3QIIA 1F1BB 4JMQA 4QHYA 2E65A 1U1SA
chains in the Genus database with same CATH topology
1PM3A 3A1PA 2DYIA 2F1LA 2DOGA 3HTRA 2QGGA 3H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PM3 A;  3A1P A;  2DYI A;  2F1L A;  2DOG A;  3HTR A;  2QGG A;  3H9N A; 
#chains in the Genus database with same CATH topology
 4XTV A;  3G6E A;  2VGN A;  1Y96 B;  1YCS B;  2D0N A;  2QA4 T;  1QKX A;  1M1K C;  2EYZ A;  4KBM B;  2L0A A;  4BI4 A;  2DJZ A;  4M77 D;  2IPO B;  5I11 A;  2DFU A;  4II3 A;  1K8A U;  2VBT A;  4BE1 A;  4E7H A;  4ZCI A;  1VQ9 Q;  5DS0 A;  3OJX A;  3NPF A;  1VQO Q;  3CCR B;  4QVA A;  1VQ8 B;  3LVB A;  1I8D A;  1VQP A;  1K9M R;  1UTI A;  1WHJ A;  5GAO q;  2AKL A;  4PLI A;  1W2B P;  1JJ2 P;  5M9O A;  2M02 A;  2O9V A;  4AC9 A;  1YJ9 B;  2LRQ A;  1LOJ A;  4Y7C A;  1Z9Z A;  2MCN A;  4WCI A;  3CCV B;  1W70 A;  3JRZ A;  3OJW A;  3CEY A;  3M57 A;  1XOV A;  2VUB A;  1C6V X;  1ZSZ C;  4M7A F;  3ZBU A;  2YT6 A;  4CI0 C;  4YAF A;  2EQM A;  1JXM A;  4ELZ C;  1EFN A;  2X3X D;  1NE8 A;  3MMP A;  3VS3 A;  3EG0 A;  1AT1 B;  1D3B B;  1VQP Q;  4RLZ A;  1WXU A;  2CH4 A;  3OS1 A;  1W2B S;  1JJ2 S;  2ZZQ A;  3VUZ A;  3JV3 A;  2OBS A;  2FRY A;  1WPC A;  1KK7 A;  3L2V A;  5DSZ A;  4X9D A;  3CCQ A;  2CGH A;  4ELY C;  2FRW A;  4QVD A;  3HKS A;  3OYD A;  2LCL A;  2QQS A;  4M77 G;  4F14 A;  4R56 A;  4C92 A;  2EFG A;  1UD8 A;  2CRE A;  3OS0 A;  2KVQ G;  2LZ6 B;  4DNR B;  5HY6 A;  1Y71 A;  5CIU A;  2GBQ A;  1G3W A;  3TQ7 P;  5THX A;  5IYR A;  1LVK A;  3VS5 A;  5A0G A;  1DG1 G;  4IUR A;  4ATO A;  5LJ5 d;  4C5G A;  4G1B A;  4F7U F;  2CT4 A;  3OYY A;  4K11 A;  1PWT A;  1M2V B;  2GJR A;  1G2B A;  5GAM f;  2XD0 A;  3CCL B;  2HDA A;  1K9M C;  4OB1 B;  1XNI A;  1VQ4 B;  1Z9Q A;  4M7D A;  3UA6 A;  2PVO B;  4JJC A;  2QDL A;  2CND A;  1BCO A;  3OYJ A;  1K8A D;  5J26 A;  1YFN A;  2BZ8 A;  2W10 A;  1R77 A;  2ATC B;  4XN0 A;  5GV8 A;  2BF4 A;  3THK A;  2RB6 A;  3L2R A;  3ZZU A;  1LPL A;  2LT4 A;  2RQU A;  3PT9 A;  1PSE A;  1AIP A;  1E7O A;  1NG2 A;  2H3E B;  4UZU A;  2PQW A;  4KGX B;  1QMC A;  5GAM g;  4JLI A;  1ZUK A;  2EYQ A;  4XTY A;  1DAR A;  2JUF A;  1XQB A;  2KY9 A;  3REA B;  1OI1 A;  4RTT A;  2OTJ A;  2C5B A;  2H3J A;  1GJR A;  5IHN A;  5AYF A;  1FNM A;  2CP2 A;  2VXE A;  2XI9 A;  2XKO C;  2DL4 A;  1Q7Y R;  3M0U A;  4YEJ A;  4DOV A;  2QQA A;  2YHT A;  2DAQ A;  2DNU A;  2JXB A;  4JDS A;  2FPD A;  4DQL A;  3U23 A;  5CKF A;  3ASQ A;  2GQI A;  4GLM A;  1KJW A;  2NUT B;  4RTX A;  4CC2 A;  4C8Q E;  3CD6 T;  3JU4 A;  1BKB A;  4MDX A;  2VBS A;  3M0Q A;  1Q81 U;  1M90 U;  4J9D A;  3WQZ A;  1D2E A;  1JEG A;  1RAG B;  2YUP A;  2D74 A;  1I5O B;  1N0U A;  4XU3 A;  1TVC A;  4ZGQ B;  4X0C A;  2P0Q A;  1T6Z A;  1K0X A;  2JVV A;  1TU0 B;  3LH0 A;  3E9G A;  3CCM T;  4AFZ C;  5GAN d;  2NUP A;  3MP8 A;  2QA4 B;  4XQ3 A;  2FG0 A;  5KE3 A;  2DVJ A;  3WND A;  2IIM A;  1NJI R;  3CES A;  2DIG A;  1UD3 A;  4QQG A;  4RG8 A;  2K5L A;  2M1H A;  2RHX A;  2HSE B;  2K5I A;  2DLP A;  1NRK A;  3INZ A;  1Y0Y A;  3L2U A;  3GQB A;  2O2O A;  3O8V A;  3AGP A;  4RJL A;  2DEQ A;  4LNP A;  4FYY B;  2WSF E;  4J7I A;  1DDI A;  3OPO A;  2O01 E;  1JQQ A;  2DL8 A;  2ED0 A;  2VYT A;  4L6V 5;  1S4M A;  1OU9 A;  3S6W A;  2K9G A;  1N08 A;  4YAO A;  2DVE A;  1RLP C;  2MWO A;  1W2B A;  2C4T A;  1JJ2 A;  3FJO A;  4KH0 B;  4C0D B;  1QVF P;  4M75 B;  5GV7 A;  2CDT A;  2PTK A;  1QGY A;  2JT4 A;  4JJD A;  1QVG B;  3I55 A;  4RD3 A;  4WZT A;  4BY6 C;  3W2E A;  4PC3 A;  1SM4 A;  4JJB A;  1Q7Y C;  2V7T A;  1Q82 R;  3CPW P;  5FIU A;  2XID A;  4M53 A;  4P3I A;  2C2W A;  4G7W A;  2EQU A;  3CME T;  1GBQ A;  1ZSZ A;  5CKD A;  5J39 A;  2QE7 A;  2QK0 A;  4QT7 A;  4MZM A;  2L3S A;  3BFM A;  2JTM A;  1V0E A;  3MPU B;  3V8K A;  1E3X A;  4J6X A;  1FDR A;  1QGZ A;  4V2S A;  4J8O A;  2QMU A;  2C78 A;  4BI3 A;  1OOT A;  1QVF S;  1CSK A;  4XOT A;  1YHQ A;  4P2N A;  3UT1 A;  4L59 A;  3CXC A;  4J9I A;  5FW9 A;  3CPW S;  2OI3 A;  4M75 D;  3E20 A;  3I55 Q;  3QYG B;  1UUE A;  3JSC A;  3CCL Q;  1F20 A;  1Q81 D;  3LW5 E;  2DIL A;  4J0Q A;  2C06 A;  1NJI C;  1M90 D;  1SHG A;  1WFW A;  1VQ4 Q;  3HSB A;  2RJC A;  2GNC A;  1H3H A;  1VQM A;  1SSF A;  3JQQ A;  3SWN C;  2BZX A;  1GL5 A;  1D0X A;  1NEB A;  3HRU A;  1WXT A;  4M7A E;  2YSQ A;  3OYL A;  3A8J A;  2I1L A;  1AMO A;  1T3L A;  2V31 A;  3RY8 A;  2VNK A;  1I1J A;  5IHI A;  4G6I A;  4E7J A;  2EYX A;  4RDL A;  4ZGE B;  3BDU A;  3OYN A;  5KYY A;  1ZUY A;  5CQX A;  2ZBV A;  3HRS A;  2DL3 A;  3EGD B;  3QFT A;  4XON A;  3RMQ A;  2ZPG B;  1YNZ A;  2HMA A;  1RAF B;  7AT1 B;  1GAW A;  4P3Y A;  1VQM Q;  2B7C A;  1JA1 A;  1Q82 C;  1U3O A;  4E2F B;  4OMO A;  3D7S B;  4RD4 A;  5CVI A;  5LJ5 j;  1B23 P;  1D8T A;  1I0C A;  3H0H A;  5F4M A;  3X24 B;  3CCS A;  3I9Q A;  3T56 B;  3TSW A;  2KT8 A;  2OBT A;  2LJ0 A;  4GY5 A;  4M75 G;  4FT4 A;  1B7T A;  3A8M B;  1S72 T;  2QQR A;  1BB9 A;  1ZQ1 A;  3CD6 B;  4CRI A;  3RER A;  1BI2 A;  3MP1 A;  1A0N B;  2V7V A;  4C8Q C;  4X7C A;  3OW2 B;  4Z4T A;  1R5B A;  3SLN A;  1B3Q A;  5GMK i;  2QEX A;  3RIR A;  2QTX A;  4XKW A;  2E4H A;  1QP3 A;  1N0V C;  2RJD A;  1XTD A;  2OK7 A;  1FMK A;  2JTF A;  4Z4W A;  4P9S A;  2YLC A;  3M56 A;  2QXF A;  3UPU A;  1BI0 A;  4HCZ A;  1MMD A;  2M0Y A;  1QCN A;  5FU6 B;  1HXD A;  1BU1 A;  3SKB A;  1PJ5 A;  1OEB A;  3OYI A;  1MRZ A;  4M0L A;  5GMK e;  3L2W A;  3GNG A;  2JNG A;  1OB5 A;  3HL8 A;  2D8H A;  4TN1 A;  4BPR A;  4F7D A;  2R9V A;  2Z0W A;  2ZZD A;  4UC4 A;  1I7P A;  4ZTF A;  2QEX Q;  1QGA A;  2BE7 D;  1YP5 A;  2YUQ A;  1JU5 C;  3QDR B;  2HAX A;  4HE5 A;  1KC8 U;  3ONY A;  3G6E T;  4M77 E;  1WOS A;  2QN6 A;  2X4Y A;  3VNU A;  2L2P A;  2FHD A;  3SHW A;  3OS5 A;  2HKQ B;  1AHJ B;  3JB9 J;  3MCA A;  4XQF A;  5GAN 8;  2IVW A;  2RA2 A;  4OGE A;  4Y28 E;  3VMF A;  4X34 A;  1QVF A;  2E12 A;  2XGJ A;  3Q6R A;  3QFS A;  2L8D A;  3ZL7 C;  3CME B;  2KI7 A;  4KGZ B;  1K28 D;  4Y9U A;  2X9H A;  3LWI A;  3HTR A;  3SFM A;  4OML A;  2VB6 A;  3CPW A;  1QW1 A;  3CMA T;  1K73 U;  1D1B A;  5F4J A;  4XL9 A;  3W2H A;  2DD4 A;  1UGR B;  1LCK A;  2YUN A;  1PNJ A;  5GAN 6;  3SD4 A;  3M4G A;  1N5Z A;  2CW5 A;  3MHP A;  1QWF A;  1HJD A;  1GCQ C;  2KR3 A;  4FXU A;  2R58 A;  1YCY A;  5KYN A;  2KVO A;  4PC7 A;  1GO2 A;  2PLF A;  2X4X A;  3EG2 A;  5F4O A;  2HDN B;  4BAC A;  4X06 A;  1VQK T;  4RTZ A;  1WHK A;  2PVG B;  5C0M A;  3GSI A;  4O6J A;  3CCQ T;  4QUZ A;  3QJ6 A;  4M7A C;  4ZV4 A;  1SRM A;  4OVA A;  1VQL T;  2YRV A;  4FSS A;  3SWN A;  4IUP A;  2BPO A;  3A98 A;  2L5Q A;  2PVD B;  2F2W A;  1UEC A;  2LC4 A;  4XNF A;  4JJN K;  4FYX B;  2QDY B;  3QO3 A;  5LJ5 e;  4HIZ A;  3NTK A;  3GP8 A;  1VUB A;  2ZAE A;  2O31 A;  3A8K A;  2KE9 A;  4II2 A;  3ZFJ A;  3ULR B;  4O5V A;  3X25 B;  1KQS P;  1G7S A;  2B7B A;  1Q95 G;  4DBH A;  2JW4 A;  1SKY B;  5LJ3 d;  1SHF A;  5DLQ E;  3WXM B;  5KSW B;  4XKV A;  4OMN A;  3BNW A;  5KYX A;  1KC8 D;  2E1B A;  1NBM A;  5FWC A;  1YWP A;  1E1R A;  4ZN3 A;  1KK1 A;  2NV4 A;  4XTU A;  3MEA A;  1VHE A;  3O5Z A;  3LLR A;  3I35 A;  5FLX E;  3B78 A;  2KK4 A;  4OMQ A;  5IYN A;  4P25 A;  4C8Q G;  1S72 B;  5KYU B;  2PE3 A;  2EJG A;  2X3U A;  2EBP A;  1KQS S;  1WZO A;  5KYW B;  4BE0 A;  1OHH A;  3BCD A;  2VJJ A;  2MAM A;  2KSS A;  2XDD A;  1PCX A;  4OPV A;  3N5B B;  3GF5 A;  3GLX A;  4RDK A;  3CCJ T;  1A8P A;  1UD6 A;  2FVU A;  2OK8 A;  4EMK C;  1K73 D;  4KUL A;  1H64 1;  3A8H B;  2OTJ T;  4C8Q A;  3LGF A;  1BK2 A;  2E70 A;  3HAG A;  3I5R A;  2ZXH A;  4JZ4 A;  4P5N A;  1FNB A;  4FM4 B;  2GCX A;  3VRY A;  4LBZ A;  3QZ5 B;  2RD1 A;  3CC2 A;  4PC2 A;  2JTE A;  3VYG A;  4II1 A;  3OYA A;  5HZB A;  2RHZ A;  1G3S A;  4FT2 A;  3WNC A;  4IUV A;  4A4G A;  2EKO A;  2WPD A;  3C94 A;  2RK2 A;  2MYS A;  4EIK A;  3TRE A;  3JCM h;  3AVU A;  2BZY A;  5GAN e;  2CZ6 B;  2HQX A;  1M1F A;  1N9S A;  3URG A;  3G6E B;  1TUG B;  3UF4 A;  3CTA A;  4RD6 A;  3WVE B;  2IG0 A;  3HFO A;  3M55 A;  2RHY A;  1RAA B;  4K1X A;  2XMF A;  3V8J A;  4M77 C;  4PJJ A;  4PC6 A;  3HPW A;  4F7U B;  2G3R A;  2BMW A;  3H8Z A;  1NB0 A;  5DN6 A;  1RAD B;  3H9N A;  1YN8 A;  4HVW A;  3GIR A;  5L46 A;  5TR9 A;  1QCO A;  4KRT A;  4IKF A;  5LJ5 f;  1KD1 R;  3BCF A;  3JB9 I;  3U6B A;  2PMD A;  3WBK A;  3OW7 A;  1IRE B;  2X85 A;  3OMG A;  3EGX A;  1VQ5 B;  2RNA A;  3CMA B;  1K8A R;  4PC1 A;  4YAL A;  1PRL C;  2BN4 A;  2HCK A;  3E19 A;  3KL9 A;  4RPD A;  2BVN A;  4P22 A;  5GAN 4;  2QTZ A;  5D7U A;  4C0G A;  2O88 A;  1E79 A;  4BDY A;  4DEY A;  3TCJ A;  3PNW C;  2YWG A;  5D6W A;  1LJO A;  2X8K A;  3LGL A;  1GCP A;  5LJ5 g;  1WOR A;  3CBM A;  3G71 A;  3G7Z A;  1VOM A;  1NPR A;  4QQD A;  3JCM V;  2O4X B;  3EHQ A;  2EW3 A;  2JJ9 A;  1GCQ A;  3QWX X;  4M7A G;  1KHC A;  2DXB A;  5TY0 A;  3SDZ A;  1VQK B;  4HVU A;  3MHX A;  2DA9 A;  1KG1 A;  4LN2 A;  3Q1J A;  2VNJ A;  1AEY A;  2RQT A;  1ZM2 A;  2W6J A;  2CSQ A;  3J81 E;  2HCJ B;  4L5G A;  5KH6 A;  2DZC A;  1VQL B;  1D1C A;  3A8O B;  4OMP A;  2D8J A;  1WSV A;  4M75 E;  1YHQ T;  1UGV A;  4XLE A;  1VQ9 A;  5FRO A;  4M7A A;  1D1N A;  4HE6 A;  2OTL B;  4RTU A;  4IW3 B;  3G71 Q;  4P6Y A;  3G05 A;  2XOK A;  5HZA A;  3BQJ A;  2DYB A;  2WJV A;  1CNE A;  2GQV A;  1OZ3 A;  1O9S A;  2E6N A;  2Q6K A;  1RL2 A;  4UAJ A;  1KD1 U;  1T6Y A;  3NTI A;  1KQS A;  5GAN f;  2Y90 A;  3QWY A;  2E41 A;  1N6A A;  4OMM A;  4E0F A;  1YJW T;  1K9A A;  3PVL A;  4F7U G;  1K8A C;  1NLO C;  4JPB W;  2QTL A;  4ZNX A;  4QVC A;  4PJO F;  4AG1 C;  3MKD A;  1IHV A;  4Z8A A;  5GAO r;  2RN8 A;  3PVQ A;  1NZ9 A;  1ZA1 B;  5FU7 B;  5GMK m;  3CC7 B;  3RES A;  3Q3A A;  3H41 A;  4TMW A;  4H9G A;  3CCJ B;  5LL6 S;  1WX6 A;  5GAN g;  1QUE A;  1YIJ T;  1WLP B;  1IB0 A;  2DK3 A;  1GRI A;  1VLY A;  4OPS A;  2R57 A;  1ZBX A;  3ZUG A;  3CCS T;  4YHB A;  4ZGN B;  1O75 A;  2DD5 A;  5LJ3 j;  4PJL A;  3OZU A;  4C0Z A;  4EMK A;  2ZPE B;  1Q86 U;  4IUQ A;  4A4E A;  4X1V A;  1N8R U;  1ARK A;  3CRZ A;  1FMW A;  4WTO B;  1EWY A;  2D9T A;  3OYG A;  3CCE T;  1KK0 A;  5FA6 A;  3CP8 A;  4B4D A;  1FX0 A;  3PMI A;  4FSX A;  2F1M A;  1B34 B;  2FB7 A;  2ZPB B;  3CXC P;  1W35 A;  5FL7 A;  4Z88 A;  1OX8 A;  2DO3 A;  2PU9 B;  4LBY A;  3OYE A;  1BLI A;  2M0O A;  3KBG A;  3UA7 A;  3OEH A;  4J5Y A;  2X3W D;  1YIT T;  1QFJ A;  2E10 A;  1AZG B;  4PLL A;  1Q81 R;  1M90 R;  1UD5 A;  4IIM A;  1U2R A;  2KRO A;  4RD1 A;  4OMF B;  1VQ5 Q;  1M9S A;  3VS7 A;  2EPD A;  2L3P A;  2CH4 W;  4N4H A;  3OP1 A;  2ABL A;  4BD3 A;  2ROT A;  4M77 A;  1Y07 A;  3BH4 A;  1VQ6 T;  2RI5 A;  2DTO A;  3CXC S;  1KK2 A;  1AOJ A;  3CC4 A;  2KRM A;  2LTO A;  1W87 A;  3I1F A;  5H59 A;  1KD1 D;  5I22 A;  1H8H A;  1T6X A;  1YJN T;  3GVL A;  2HL5 C;  3EFR A;  1YX2 A;  1W2B B;  1MMN A;  4NBS A;  3A8G B;  4C43 A;  2CC2 A;  1K1Z A;  2L89 A;  4XU2 A;  1Y96 A;  1UDL A;  1G3Y A;  1Y0R A;  4R55 A;  4LC0 A;  5I2S A;  3PEN A;  1M3B A;  2FZG B;  1RAE B;  1TS9 A;  3U2Q A;  3DDY A;  3EFO B;  3CC4 Q;  4RG2 A;  5HKK A;  3RNJ A;  3I56 T;  4X8I A;  2F69 A;  4Y9R A;  4LDW A;  8ATC B;  3CCR A;  2OTL Q;  1VQ8 A;  1T3S A;  5GAO l;  3A8L B;  4ZTJ A;  2M5S A;  3MJX A;  1SEM A;  2ECZ A;  3AVV A;  1Q86 D;  3V76 A;  1ZA2 B;  4C0D C;  1N8R D;  1IZ6 A;  1YHQ B;  4M75 C;  4PL6 A;  4XOP A;  4DQ2 A;  2KRS A;  2VBV A;  4C92 F;  3CCV A;  3GVK A;  5EC7 A;  1H8K A;  1Q81 C;  1M90 C;  4A54 A;  3W5H A;  2MIO A;  3KUF A;  2WR8 A;  2HZY A;  1TTH B;  1FX7 A;  4ACB A;  2C0T A;  2M16 A;  2GK7 A;  1VYT A;  2DTH A;  2V4D A;  3CCR Q;  4WWV A;  1VQ8 Q;  2F2V A;  1D3B A;  3CC7 Q;  2X0K A;  2WSC E;  1WGS A;  1YJW B;  1P4M A;  4XLF A;  3OYH A;  3JCM Q;  2P3M A;  4Z4S A;  4PGO A;  1ACM B;  1YJ9 Q;  4M7D F;  1H92 A;  3OYF A;  1X6G A;  3CCV Q;  1OGI A;  2DER A;  5LJ3 e;  1NEG A;  2JN0 A;  1TH7 A;  3NFC A;  5CKH A;  1UMK A;  1LNX A;  1QQJ A;  2P4R A;  4AT1 B;  4E47 A;  2K3B A;  3AST A;  5GMK j;  1YI2 T;  2VJI A;  3DLL A;  1FRQ A;  3GPL A;  3CCU T;  2DL7 A;  1TLL A;  1VQ7 T;  1YIJ B;  5GAM h;  1SG5 A;  2QGG A;  2R5M A;  4B3F X;  1AWX A;  4ASU A;  2MK5 A;  4AFU C;  3G1J A;  4Z02 A;  5J35 A;  2VYQ A;  1ZM9 A;  4CC7 A;  1M2V A;  3W5V A;  4J83 A;  3CCL A;  2FX3 A;  1WJQ A;  1Y7X A;  3AVW A;  5LMZ A;  3ASP A;  1VQ4 A;  2HSP A;  1QFZ A;  3CCE B;  2LQ8 A;  5JBQ A;  4RMO A;  1HYO A;  3G4S T;  4XTW A;  1ABO A;  2KYM A;  4EMG A;  1GXI E;  1M5Q 1;  3SLD A;  1I5L A;  1N05 A;  2G6F X;  4FIB A;  2XIC A;  1RI0 A;  2KRN A;  1SF9 A;  3OKX A;  4PJN A;  4YXW A;  1QKW A;  3VR6 A;  2OYN A;  5A88 A;  1M8V A;  4ZCM A;  1YIT B;  4AF6 A;  4J6Y A;  5FO0 A;  3GOX A;  1E63 A;  3CC2 T;  1OZ2 A;  4WZL A;  4LDY A;  2GTO A;  3S3O A;  4F04 B;  4KUD K;  1ZM3 A;  2HL3 A;  3QE2 A;  4RD2 A;  2XZO A;  1FRN A;  5KCH A;  1BJK A;  2K2V A;  2YDL A;  3QFR A;  1VQ6 B;  4FW1 A;  1RQP A;  1QLY A;  3OW2 P;  1IJE A;  4ROX A;  5IN1 A;  2NUT A;  1EXM A;  1YJN B;  1I4K 1;  1BQE A;  2P84 A;  3P27 A;  4P12 A;  3X28 B;  4DK1 A;  2Q6I A;  3M9Q A;  4BE2 A;  2CP0 A;  3TU4 K;  1D1A A;  4AVZ A;  5HK0 A;  4HA8 A;  4AF7 A;  5FU6 C;  3VS4 A;  2RO0 A;  4M78 B;  1T0J A;  2D6F A;  1HVX A;  3AVX A;  3CMM A;  2GF7 A;  1X6O A;  2CUB A;  3EHR A;  4HXJ A;  2QA4 A;  1VQN T;  1KC8 R;  5CCA A;  3JAM E;  5KW9 A;  3OW2 S;  4LXC A;  1DJ7 B;  4AFS C;  4EH1 A;  5LJ3 f;  5TRD A;  3DB4 A;  4BY6 B;  3JQP A;  3FJ5 A;  5DM7 R;  4Z4Y A;  1OPL A;  3I56 B;  1QUF A;  1X43 A;  4OF1 A;  3QFC A;  2LZJ A;  3EG9 B;  2KGT A;  2J7I A;  1M4Z A;  3AHU A;  4PFP A;  2K3X A;  3LYI A;  3LQE A;  4F7U E;  1QVP A;  5D6X A;  3FC3 A;  5IXB A;  1SKQ A;  4M78 D;  2QA4 Q;  1K73 R;  4PAA A;  2D0Q B;  4PKC C;  2DIE A;  3WY9 A;  5BSY A;  2I0N A;  2EGA A;  5LJ3 g;  2Y4X A;  3WYA A;  1U8R A;  2VBU A;  3ZEH A;  4M75 A;  1X69 A;  3LWH A;  4MYT A;  1MUZ A;  1QVG A;  2VWF A;  1J3T A;  3CCM B;  4C0S A;  4J9H A;  1E3Z A;  4N3N A;  3BW1 A;  3BY2 A;  1UHF A;  3M58 A;  1X2K A;  2V7W A;  4DOW A;  3SEJ A;  2FL7 A;  1IXD A;  1VQ9 T;  1QG0 A;  1EX4 A;  1IHW A;  1NB9 A;  1VQO T;  3M53 A;  4QW2 A;  2DTI A;  4J9F A;  2CT3 A;  2K6D A;  4FL6 A;  3V7S A;  1IHM A;  5IK2 A;  1T5E A;  2VVK A;  3U6K A;  1QFY A;  1HK9 A;  1QP2 A;  4RKU E;  4HT9 A;  1YI2 B;  1KC8 C;  2EYW A;  4YTL A;  3CCU B;  1VQ7 B;  1TG0 A;  1PKS A;  2GFU A;  2JJ1 A;  2VZL A;  4B3X A;  1EP3 B;  1V0F A;  3GNF B;  1E64 A;  1XFO A;  3VNV A;  5GAN j;  1AZE A;  4IIO A;  3PUM A;  5HCK A;  4FU6 A;  2KEA A;  4BDZ A;  2LNH B;  2GJK A;  1VQP T;  1OGJ A;  4M4Z A;  3GIB A;  3G4S B;  1OX9 A;  1JXO A;  3MP6 A;  4JS5 A;  2AKK A;  1K73 C;  5J3O A;  1S0U A;  3OZW A;  3EGD A;  1RAB B;  4PNO A;  3OYC A;  3F70 A;  1RLQ C;  1FYN A;  5CO7 A;  5GAN 5;  4BB7 A;  3A3B A;  3AT1 B;  4FK8 A;  1V76 A;  1IB8 A;  1UGS B;  2BGJ A;  3QBY A;  1G7T A;  1KQ2 A;  5IYQ A;  4LD9 K;  5HKC A;  2DXT A;  4XD7 A;  1V29 B;  4XU0 A;  2YXY A;  3EG1 A;  3H6Z A;  5TV2 A;  2ZL6 A;  1IJF A;  1HSQ A;  2F43 A;  4M4S A;  1GBR A;  1BX0 A;  3CD6 A;  4E7L A;  1YWO A;  4N4I A;  1Q9S A;  1D0Z A;  5CK9 A;  3OW2 A;  5AT1 B;  2LDM A;  4E6R A;  2B5O A;  2M51 A;  4ANJ A;  2ZTN A;  4RM0 A;  4XR6 A;  5EMN A;  3C95 A;  4RCB A;  3VUB A;  5KCO A;  4RCC A;  5I21 A;  4QVJ A;  3OYB A;  4FWT A;  1WJS A;  2ZPF B;  8AT1 B;  1UGP B;  2DXU A;  2V26 A;  1VQN B;  3OMC A;  2ESW A;  4B48 A;  3KFV A;  1JB0 E;  2QQ9 A;  4M78 F;  1JB9 A;  3W5U A;  2LT1 A;  1XE1 A;  2KMT A;  1RAH B;  3M0P A;  3CD6 Q;  4PJO B;  4RD0 A;  2BTT A;  4NL3 A;  3L2Z A;  2XNC A;  1KMH A;  1OU8 A;  2CF4 A;  2JS2 A;  3PA1 A;  3R6K A;  1BI3 A;  3VO1 A;  1ZM4 A;  4QFM A;  1XQH A;  2DXC A;  2QG9 B;  4MMK A;  2D9R A;  3CW2 A;  1W0J A;  3RKX A;  2FEI A;  1BI1 A;  3ASK A;  3C4S A;  3VS2 A;  2DKG A;  3KXT A;  3M0T A;  3CCM Q;  4E7I A;  4N3G A;  4YAW A;  2HD0 A;  2J05 A;  3L2Q A;  3X20 B;  1N9R A;  2ENM A;  4FN5 A;  3QPH A;  1KZL A;  5A2Q E;  1UB4 A;  2ZXI A;  4OOX A;  2YWE A;  2C4U A;  4KUI A;  1UFF A;  1X2Q A;  3JCM X;  4PJO D;  2SRC A;  1JA0 A;  4ZN1 A;  3CME A;  2J7K A;  1PSF A;  2FZC B;  4B47 A;  2V1R A;  4ZGD B;  3QJY A;  3S3N A;  5IXF A;  3V7A A;  1PJ7 A;  3CP2 A;  3A35 A;  3OS2 A;  4NL2 A;  4GQN A;  4JUV A;  2XHC A;  3SJZ A;  1VQ9 B;  2V7X A;  1EFC A;  4LUE A;  3JCM c;  1YI2 Q;  2F5T X;  1VQO B;  2DBK A;  2A7Y A;  4DNT B;  4XLH A;  4JZ3 A;  4P26 A;  2HQH A;  2QQB A;  3OQ5 A;  2LNV A;  2DOG A;  3JB9 H;  4B6M A;  5C6S A;  3OA6 A;  3JQR A;  1KIK A;  2LP5 A;  1X01 A;  3ZIA A;  1WDX A;  3PA2 A;  2DET A;  3R6J A;  4ZCL A;  3J81 k;  1EP1 B;  2RHU A;  3C12 A;  3VYH B;  2VNH A;  1MMA A;  1R0C B;  3RR6 A;  3CME Q;  4R0K A;  3ASS A;  4EPC A;  1WHM A;  4X7E A;  3L42 A;  1OB2 A;  3I5S A;  2E5Q A;  1PM3 A;  3VS6 A;  3JCM J;  1TUD A;  2MOX A;  3HFN A;  1VQP B;  2Y4Y A;  5GMK h;  4CC4 B;  1UJY A;  1WOP A;  1JBM A;  4TMZ A;  9ATC B;  3GBQ A;  4JLG A;  4B9X A;  2JS0 A;  4P6V F;  4PJO G;  2LJ1 A;  1VYU A;  2RQW A;  2P0P A;  3OOC A;  4FW2 A;  1ZUU A;  1V1C A;  2HKN A;  1WSR A;  2ZZG A;  1CQX A;  4KKU A;  3I55 T;  1KJZ A;  3WXM A;  1WDT A;  2YWH A;  3DLM A;  3OBW A;  2PNI A;  2COZ A;  4LBV A;  1VQ4 T;  2FYK A;  5L8R E;  5GAO n;  3J80 E;  4RCY A;  3OYK A;  2V7Q A;  3Q6Q A;  1TTT A;  1RQR A;  2KBT A;  3HP9 A;  4X9C A;  2D3L A;  4XK8 E;  1Q86 R;  4Z4U A;  5IH2 A;  3CCQ B;  1S72 A;  2E1R A;  5KYU A;  1VYV A;  1N8R R;  1X75 C;  3JCM P;  1SPK A;  2MWP A;  5KYW A;  2OBR A;  4KGV B;  2OJ2 A;  1TUC A;  1KHI A;  4C92 B;  3JCM d;  3VO2 A;  1WTH D;  4C5H A;  1UHC A;  1VIF A;  1X27 A;  2COY A;  1SRL A;  3OBY A;  1MAB A;  3KEW A;  4PJM A;  2X6Y A;  2GTJ A;  1WP6 A;  4F16 A;  1E1Q A;  4YEL A;  3ISX A;  1U1T A;  4OP0 A;  4B44 A;  2DRK A;  1VQM T;  4VUB A;  2K79 A;  2KQW A;  2KDS A;  1E6H A;  2RMO A;  1W34 A;  2X53 S;  1MHN A;  2RC6 A;  1KD1 C;  1VLO A;  1S72 Q;  3V7R A;  1I8F A;  4OOV A;  4M7D B;  2CBX A;  2CZ1 B;  4D8D A;  4RTW A;  4B9W A;  4B3G A;  5IT9 E;  4C92 D;  2HEQ A;  2PIA A;  4HVV A;  4E7K A;  4AFQ C;  4E7Z A;  3H0I A;  1EFR A;  1WIE A;  2EJ9 A;  4WQM A;  5AN9 A;  1M1K U;  1GR1 A;  2BGI A;  2K7A A;  4Q7J B;  5LJ5 h;  1ZX6 A;  4F7U A;  1COW A;  5CKB A;  1JRI A;  2CZ0 B;  3IQL A;  2V1Q A;  2OTJ B;  2DYI A;  3LX7 A;  4M7D D;  4G5G A;  3FRN A;  1Q86 C;  4TMV A;  1N8R C;  3ONU A;  1E62 A;  1VQ5 A;  3BDL A;  4M78 E;  5DY9 A;  3CMA A;  2PZ1 A;  3G6E Q;  3JB9 F;  3PIP A;  2QEX T;  4NOY A;  4DQK A;  1YBY A;  2CSI A;  2VGM A;  3VRZ A;  2I2L A;  4XTX A;  2EYY A;  3VV0 A;  1EFT A;  2C5H A;  5FO1 A;  2X4W A;  3P8B B;  1WXB A;  1G3T A;  3AGQ A;  1NDH A;  4LBW A;  2RK1 A;  2A36 A;  2NWM A;  1FMV A;  1E43 A;  1GFC A;  2EAY A;  3VKI A;  4U9U A;  2J6K A;  2NUP B;  3CBO A;  3UWN A;  1M3C A;  4C92 G;  5CAI A;  2O4X A;  1AVZ C;  1KK3 A;  2CP7 A;  4JS4 A;  1VQK A;  1W4S A;  2A37 A;  1NYG A;  4JRK A;  3CMA Q;  1AWJ A;  1H85 A;  2JN9 A;  3LH5 A;  1AWO A;  3Q39 A;  1VQL A;  3QDF A;  3SJP A;  1ZHI A;  3QSY A;  3ES9 A;  2P0K A;  4C0F A;  3QXE B;  1N27 A;  2DM1 A;  6AT1 B;  2OTL A;  4M7D G;  4RPB A;  2EWN A;  2VXF A;  1JJ2 B;  3BE3 A;  2AIR B;  5IAY A;  5GAN h;  2JIZ A;  1I81 A;  3ZZ0 A;  3NTH A;  1KFZ A;  1U5S A;  2V8K A;  2WAC A;  1VQK Q;  3QG1 A;  2MF2 A;  2CRV A;  3I55 B;  5KE2 A;  4TMX A;  5GAO p;  3OFN A;  1PRM C;  2OAW A;  1K9M U;  3CCQ Q;  2DF6 A;  3FPK A;  1TUI A;  1M1K D;  3D26 A;  3OEE A;  3H0F A;  1ZSZ B;  2DRM A;  2F2X A;  3MEV A;  1VQL Q;  4Z4V A;  4R71 A;  2VC8 A;  2K4Y A;  3FPP A;  2OAU A;  1BIA A;  5CDF A;  1W1F A;  1MV3 A;  3TSZ A;  1ZUN B;  4UZE A;  4J9G A;  3A3G A;  5GAN 3;  2AK5 A;  4C5I A;  1WPY A;  2DMO A;  2ZGW A;  4OB2 B;  3CC7 A;  2R6H A;  1TWB A;  1S1N A;  2QAZ A;  2KT1 A;  2DX1 A;  2X35 A;  1PHT A;  3MEU A;  2MI6 A;  3SEM A;  3CXC B;  3CCJ A;  1VHO A;  1UG1 A;  1YJ9 A;  1J9Z A;  3NHN A;  1QVG P;  2EQJ A;  4ZGJ B;  5FWB A;  3BY7 A;  4MZP A;  2JDI A;  3UAT A;  2RH2 A;  1VQM B;  1GVH A;  2XG8 D;  5A0D A;  3RKY A;  3FJP A;  2VV5 A;  3LO8 A;  4N0A A;  1MGQ A;  3OYM A;  1XB2 A;  1CNF A;  4M77 F;  2COW A;  2DY1 A;  2DE0 X;  4CC3 A;  4RTY A;  1HD3 A;  1HA3 A;  3EH1 A;  2W6I A;  4ORZ A;  3T9N A;  3M54 A;  1PC0 A;  1ELO A;  3ZBT A;  5KYY B;  1WHL A;  3JCM W;  1B34 A;  2HNI A;  3CCJ Q;  4XM3 A;  1D0Y A;  1QVG S;  1FWZ A;  3M0S A;  1T0H A;  2JMC A;  5FRM A;  2FO0 A;  2LMJ A;  2OTJ Q;  2X51 A;  2QTV A;  2LCS A;  3A1P A;  1PJ6 A;  4KH1 B;  2C77 A;  4HCK A;  4EDU A;  1TOV A;  1C1A A;  3RKW A;  2X6X A;  2SEM A;  3L1A A;  4XU1 A;  4RDJ A;  2RQV A;  5GMK l;  1C0M A;  3P8H A;  2NUZ A;  5CR2 A;  4FYW B;  4X7F A;  1UD4 A;  2ZCF B;  1BIB A;  3CCS B;  4HKE A;  4BUG A;  5GAN 2;  2VKN A;  1SSH A;  2RF0 A;  4ACA A;  2BIV A;  3HRT A;  3ZC3 A;  1ABQ A;  4XAX B;  1W6X A;  1GAQ A;  1R8O B;  2XK0 A;  2V7U A;  4J6W A;  1K9M D;  3B8H A;  1WQW A;  4J9C A;  1YLO A;  2HQE A;  4M78 C;  4A53 A;  2ZZF A;  2QEX B;  3EGU A;  3M4Y A;  1JNY A;  1D09 B;  3GVJ A;  4ME7 A;  2C0I A;  5IYP A;  3ZBD A;  4JRQ A;  3AVT A;  2AZV A;  2AT1 B;  1Y57 A;  1WYX A;  2J6O A;  4PJO E;  3LQ6 A;  1Q7Y U;  3OZV A;  4D6W A;  2GFA A;  2OX7 A;  1PKT A;  2DCU A;  3ME9 A;  1OB0 A;  4XMY A;  3E1Y E;  2K57 A;  4KKS A;  4XN3 A;  4TMT A;  3EFO A;  5A8A A;  2L3Q A;  3WNB A;  1U06 A;  2EKH A;  4X7D A;  4L8J A;  3W2F A;  4OB3 B;  2J6F A;  1WNL A;  3CBP A;  5D6Y A;  5B6I A;  4MML A;  4PK4 A;  4A4K A;  1WU8 A;  3HHT B;  2X4J A;  1RAI B;  3REB B;  2XDB A;  2ZPH B;  1GFD A;  2RJE A;  2PUO B;  3NE5 B;  4J7F A;  2AHO A;  3S3M A;  2XU8 A;  2W0Z A;  3TVT A;  2D3N A;  3EH2 A;  3OE7 A;  1NJI U;  4PFZ A;  1G7R A;  1QX4 A;  2AHJ B;  3R6N A;  4P1V A;  2EQI A;  2Z6B D;  2WYR A;  1EFU A;  3CB4 A;  3MCA B;  1WQ7 A;  4Y91 A;  5GAM d;  4FYV B;  1E6G A;  1K4U S;  1KSW A;  2E3H A;  3EFS A;  2WSS A;  1QVF B;  3A5Z B;  1VA7 A;  1KQ1 A;  4QV2 A;  1NLP C;  4WZE A;  2ZTG A;  1MV0 B;  1WA7 A;  3CPW B;  4J9B A;  1YJW A;  1YHQ Q;  2RQR A;  4LDU A;  4QQ6 A;  2RI2 A;  1EZZ B;  2P4T A;  3P26 A;  5GAN 7;  4XLA A;  3QSU A;  3CPX A;  2NYS A;  2CZ7 B;  3FKS A;  2JM9 A;  2LJ3 A;  3BY1 A;  1Q82 U;  3ZPN A;  1XJW B;  1YIJ A;  3G71 T;  2BKD N;  3EAE A;  2A08 A;  1RUW A;  2Q6O A;  2LQK A;  3MET A;  4G1V A;  3X26 B;  4TKO B;  1YJW Q;  4LDV A;  5FRN A;  2KYB A;  1WHG A;  2ZIT A;  1X6B A;  4NS5 A;  2NPF A;  5KNL A;  1Q7Y D;  1M27 C;  2V8I A;  3JCM e;  1M3A A;  2CUD A;  2E6Z A;  2KNB B;  1UE9 A;  2Q6L A;  2CP3 A;  2ROL A;  3CCE A;  1CKB A;  3SWN B;  3AVY A;  2ZL7 A;  2LCC A;  4RCZ A;  2DL5 A;  2CP5 A;  3PMT A;  3NMZ C;  3W2G A;  2NLU A;  1IGQ A;  1YIJ Q;  5HXB A;  3E1S A;  3WVD B;  3VJP A;  3PGG A;  3TEE A;  1W0K A;  2A3L A;  2XEX A;  4KKT A;  3CCS Q;  3FLG A;  3ZZT A;  1VIE A;  1NYF A;  2DJQ A;  3FB9 A;  4DA4 A;  1YIT A;  2J06 A;  2JOY A;  3V7C A;  2YRC A;  1BCM A;  2FPF A;  4PFO A;  5KYX B;  1G5V A;  2JM8 A;  2WZP P;  4Z4Z A;  5EG2 A;  1ZBJ A;  1NJI D;  4C92 E;  3CCE Q;  2XZL A;  1OV3 A;  1PD0 A;  2X6W A;  1UGQ B;  1VQ6 A;  4XOR A;  2EGE A;  1R5N A;  4CQJ A;  3OB9 A;  3RDV A;  2A28 A;  5J3B A;  1G8X A;  1SKU B;  2HBP A;  1RI9 A;  2MMP A;  1WHH A;  4M78 G;  4A4F A;  3WBJ A;  1K76 A;  4PAB A;  1DDG A;  1YJN A;  3FDR A;  1BX1 A;  2DPP B;  4XLC A;  3QKJ A;  1YIT Q;  3OSV A;  3V8L A;  2DEU A;  2F4N A;  2CYZ B;  2F1L A;  5IYW A;  4DBR A;  3PTA A;  5GJV B;  5FNZ A;  2D1X A;  5LJ3 h;  4C8Q B;  4M78 A;  5I2M A;  2H8H A;  4M7D E;  1VF7 A;  4DBQ A;  2BE9 B;  2RHI A;  4PJO C;  1HZE A;  1JO8 A;  2CS7 A;  1VQ6 Q;  4M75 F;  3RBB B;  5A0L A;  2BM1 A;  4M1K A;  1IO6 A;  4OGC A;  1Q82 D;  3CC2 B;  2QYZ A;  1K0S A;  1G83 A;  2RC5 A;  4BI8 B;  1VQ5 T;  3I56 A;  1YJN Q;  1FND A;  1TXQ A;  3EG9 A;  3QHS A;  2YRD A;  3P8D A;  1N06 A;  2BM0 A;  5IHK A;  3VU3 C;  1KTV A;  1PG5 B;  1I07 A;  5H5J A;  2PUK B;  2DZ9 A;  4HCB A;  3PE0 A;  5CKE A;  2E1H A;  4C8Q D;  3ASR A;  2O9S A;  4JRP A;  5L23 A;  3JCM f;  2QAS A;  3DB3 A;  3H94 A;  4Q5W A;  1MMG A;  1M1G A;  3CCM A;  3I56 Q;  4Z1M A;  4N4G A;  2HBW A;  2CP6 A;  2YWF A;  2VAS A;  2ZZE A;  2LVM A;  4EMH A;  4LE9 A;  1I18 A;  2A0F B;  2B8A A;  2F5K A;  3CC4 T;  1B07 A;  4C5E A;  2FVG A;  3J7A F;  3EGX B;  4IUT A;  2B86 A;  2M9U A;  3C0C A;  1QCF A;  3PIO A;  4OOS A;  3PVD A;  5A89 A;  4X05 A;  3JCM g;  2OTL T;  2K2M A;  3PUN A;  4AG2 C;  2VNI A;  2LX7 A;  4Y92 A;  2YWW A;  3MEW A;  2E64 A;  2MPX C;  4MZT A;  3T53 B;  1YI2 A;  2KXD A;  1QH0 A;  3CCU A;  1F60 A;  1VQ7 A;  1H3Z A;  1W9X A;  4AMC A;  2WJY A;  4DEX A;  3G71 B;  4NCN A;  1PD1 A;  1R0B G;  2GRE A;  5GAM j;  4OPO A;  4DBF A;  4WF2 A;  1WJR A;  2C0O A;  2EVR A;  1NPP A;  3Q38 A;  2LQW A;  2RM4 A;  3E9F A;  1TSF A;  3M59 A;  3CPF A;  3CCR T;  1VQ8 T;  1OYX A;  2GQF A;  1NBE B;  2KXC A;  2QGF B;  1R5O A;  3UDC A;  2GK6 A;  4GLK A;  5ECA A;  3CC7 T;  4D8K A;  1Y0M A;  2HLD A;  3G4S A;  4MDW A;  4NNJ A;  1B2R A;  4XTZ A;  1M8M A;  1BMF A;  3M5A A;  4IUU A;  4M2L A;  1V5V A;  4M7A B;  1YJ9 T;  2K5F A;  1BBZ A;  3CCU Q;  2GJP A;  1UJ0 A;  4TVR A;  3CCV T;  5HK3 A;  1VQ7 Q;  2ED1 A;  4HCC A;  1MND A;  2EGC A;  4RUG A;  4WZK A;  3BC9 A;  2LX9 A;  2GPJ A;  3FIF A;  3VS1 A;  3T51 B;  1EIF A;  4JRI A;  1KQS B;  2FPE A;  4OB0 B;  3ER0 A;  3LNN A;  1P92 A;  4G7X A;  4MYU A;  3G4S Q;  4DK0 A;  4C92 C;  2ZPI B;  3JB9 D;  4UZF A;  3PFS A;  1UEB A;  1WOO A;  3QYH B;  3MO8 A;  3E2U A;  2EIX A;  3R6O A;  1IRX A;  2RPN A;  4M7A D;  2XNJ A;  3QUI A;  4LDX A;  4ESR A;  2XZP A;  4HT8 A;  4GBQ A;  2LQN A;  2CK3 A;  2RJF A;  1N07 A;  4QVZ A;  1ZSG A;  1VJS A;  1FNC A;  3CC2 Q;  3B82 A;  2BV3 A;  2DIQ A;  4TSF A;  1UD2 A;  1BPL A;  2YLB A;  2JJ2 A;  1RAC B;  1ZLM A;  1VQN A;  2EQK A;  2KAF A;  4M7D C;  1G7C A;  1WI7 A;  3OSS C;  1EP2 B;  2YUO A;  5DLO A;  1M1K R;  2XDP A;  1AD5 A;  4EMK B;  3OY9 A;  2ZL5 A;  4C8Q F;  1H8E A;  2BSA A;  3CCL T;  2GGR A;  2K3Y A;  1OUL A;  1M30 A;  1QWE A;  1CKA A;  5CQY A;  1MNE A;  4PJO A;  1KRH A;  5BSX A;  2QDX A;  2L3R A;  5FU7 C;  4J9E A;  4TT3 A;  4OP7 A;  2JMA A;  2R5A A;  4B43 A;  1OPK A;  2XND A;  3RUX A;  2WZN A;  3W2I A;  4KT0 E;  3JCM b;  3CQT A;  3FEO A;  3QZ9 B;  2JZ2 A;  5GJW B;  4Z4R A;  4F17 A;  1VQN Q;  4LD6 A;  1OQK A;  2V8J A;  2WSE E;  3JB9 G;  2EJF A;  1FXX A;  2EIF A;  3EG3 A;  3RMS A;  1IGU A;  3A8I A;  4QKU A;  1PKV A;  4YAU A;  4A4H A;  5GAO m;  2FZK B;  3NGP A;  3OAA A;  4N0A C;  1BYM A;  1H42 A;  2QI2 A;  2CKK A;  5E6T A;  4FCY A;  2DBM A;  4M77 B;  2EFI A;  2E5K A;  1M2O A;  3SB2 A;  3M0R A;  4A63 B;  4RTV A;  3CC4 B;  2BUD A;  4Z89 A;  4E7S A;  3DKM A;  2ZBU A;  1AWW A;  3VS0 A;  4LUD A;  2RI3 A;  2AZS A;  1VQO A;  1NM7 A;  4X07 A;  2E3I A;  5GAM e;  3QII A;  1F1B B;  4JMQ A;  4QHY A;  2E65 A;  1U1S A; 
#chains in the Genus database with same CATH homology
 1PM3 A;  3A1P A;  2DYI A;  2F1L A;  2DOG A;  3HTR A;  2QGG A;  3H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...