2QGGA

X-ray structure of the protein q6f7i0 from acinetobacter calcoaceticus amms 248. northeast structural genomics consortium target asr73.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
NVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPWYIETKAGWQTVDVKRWKPHGKGLVVSLKGVSDRTGAESLVASNIWIAKSQLPKADVDEYYWSDLKGLTVLGLDDEEQEVNLGQIHELFETGANDVMVVRATPDSIDSEERMIPWHKDVVQRVDLEAGRIYVNWGVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the protein Q6F7I0 from Acinetobacter calcoaceticus AmMS 248.
rcsb
source organism Acinetobacter calcoaceticus
molecule tags Structural genomics, unknown function
molecule keywords 16S rRNA-processing protein rimM
total genus 41
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2007-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2qggA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2qggA01
3HTRA 1PM3A 2QGGA 2F1LA 2DOGA 2DYIA 3A1PA 3H9NA
chains in the Genus database with same CATH superfamily
3HRUA 1VQ9T 1PKSA 2CYZB 2P4RA 1Q81D 1UUEA 4M78B 4E7LA 5GAOl 1E3ZA 4JZ3A 3MHPA 4BB7A 3H9NA 1BB9A 1VJSA 5J26A 3JCMX 1G3YA 4PJOC 1VQLB 2QN6A 1F20A 4P22A 2SRCA 2QMUA 1HZEA 4J7FA 1K8AU 2C5HA 1K1ZA 3HPWA 3REBB 2CKKA 2OTJB 3EGDA 3TSZA 3OW7A 2HSPA 2FRYA 2SEMA 1UD5A 4M1KA 2C77A 4LBVA 3CXCP 3Q38A 4A4EA 2W0ZA 2NUTB 2YHTA 3EG2A 2DVJA 4OPVA 4XU2A 5I2SA 4M77D 2CRVA 2ZBUA 4OOVA 2RJFA 4II2A 1PRLC 3JB9H 1E1RA 2DAQA 5DLOA 5KSWB 2ZTNA 1UG1A 3LWHA 4YHBA 2QEXA 1EP1B 4M7DA 2KROA 1TXQA 2QA4A 3BCDA 1QVFP 3P8BB 4KKTA 2EJFA 2YT6A 4WZLA 4YXWA 2QYZA 2QDXA 4QVAA 4C92E 4HCKA 3PUNA 3QG1A 3CCET 4NS5A 5GANg 4XKWA 3J81E 4R55A 1V0EA 2F5TX 3G6ET 1QH0A 2DXBA 5LJ5e 2KXCA 2VNJA 1MMNA 1EP2B 3FB9A 3VV0A 4P3YA 1X01A 2XMFA 4C5EA 1XFOA 1RLQC 4CC2A 4F16A 3CC2Q 4M2LA 3JB9D 5GJVB 2KBTA 3EHQA 4Z4SA 1VQ6T 1KQ1A 1OI1A 2DL4A 3MP6A 2YWWA 1NEBA 2BN4A 4ACAA 2DTIA 2K5IA 4QKUA 4YTLA 4X7DA 4FSSA 3OYKA 2ZPGB 5CVIA 1Y07A 1NE8A 2XDBA 1T0JA 1GO2A 2L3QA 2V8KA 1SHFA 2XHCA 2OYNA 3LW5E 4ATOA 5FA6A 4PC1A 3O5ZA 1R77A 4LD6A 5A88A 5FL7A 2CP7A 2JTFA 4N0AC 4NOYA 5DSZA 4EMHA 4YAUA 2EBPA 3HFOA 1S0UA 1W2BB 2DL8A 2KAFA 2OX7A 2GTJA 3QO3A 2IPOB 4KULA 1TG0A 3PNWC 5GAN2 3C95A 4FM4B 4M7DE 3OYBA 1G3WA 4Y91A 3WNCA 1HXDA 1VUBA 3I56T 3CCQT 2DEUA 2OTJQ 5IK2A 4UZFA 3JRZA 3SDZA 2QQBA 2KYBA 2M1HA 1SG5A 4C0GA 2HCJB 4WZKA 1UHFA 3CCQB 1JB9A 4LD9K 4MDXA 1X6OA 1YJWA 1OX9A 3HHTB 5GAOn 2OI3A 4XMYA 2XIDA 2KR3A 2LC4A 3G1JA 2FB7A 2X6WA 1QP2A 4ZTJA 2VBUA 2KVQG 1VQOB 4WF2A 1T6XA 4LBYA 1QCFA 1KRHA 2PIAA 3M54A 1U1SA 1FRNA 3L2QA 3CCSA 2YXYA 2OJ2A 4DQKA 2ZL5A 3HL8A 1TOVA 4X9CA 1GVHA 2EQKA 3BY7A 2RPNA 2O4XB 1YJNA 2X4WA 2DILA 2GF7A 2H8HA 6AT1B 1VQNT 1P4MA 1YN8A 1SKYB 1BBZA 2M9UA 2QQRA 1RACB 4X7CA 1YJNQ 3EHRA 1RUWA 2DO3A 2FVUA 3WYAA 1QVFA 2RA2A 3X20B 3I55Q 1K73D 3JQPA 4E6RA 1MABA 2BGJA 2D9TA 2PUOB 2ZPIB 1DG1G 3G4SA 1YITA 2CC2A 2EFIA 3CMMA 3AVUA 4FW2A 3H0IA 2DD5A 2E64A 3RKYA 1YJ9A 2AT1B 3GVKA 1Q9SA 1NRKA 3ZZUA 2H3JA 1AVZC 1WJRA 1E7OA 2VNIA 2CP5A 5KYUB 4PC6A 2DOGA 4LE9A 3V8KA 4KUDK 4N3GA 4GLMA 2NV4A 2WACA 2WJYA 1I8DA 3VR6A 4XD7A 1VQ5B 1EFCA 5KYWB 1VYVA 3ZC3A 4DBHA 2HL3A 4OB0B 2DF6A 4HVUA 1I5LA 3META 4XN0A 2D0NA 2DBMA 3CC7B 3P8HA 1VQ5T 1WHLA 1T0HA 1KC8R 3CC7A 5D7UA 4OB1B 3G6EQ 1NYFA 1W70A 4DOVA 2XI9A 1Z9QA 1KJWA 4XQFA 2J6KA 4G1VA 3PA2A 4EIKA 2JS2A 2MK5A 1BI2A 1HVXA 2CF4A 1QVGA 3RKXA 4PJOB 2L0AA 2BMWA 1QCOA 2X6YA 2DK3A 2FRWA 3OYHA 3CPWS 1SRMA 4M7AE 1BPLA 2CP0A 3B82A 3T53B 4WWVA 1RABB 5F4JA 3GSIA 4M75A 1FNMA 4JLGA 3SKBA 1YJ9B 1ZQ1A 3LO8A 3QSUA 3GQBA 3A8HB 4JS5A 1KC8D 1OGIA 1YITB 4JRPA 1Y0RA 2ZAEA 3JCMQ 3FDRA 4E7IA 1U8RA 3LQ6A 4FXUA 3KFVA 1VQ7B 2R9VA 3E9FA 1R5BA 2Q6KA 1CKAA 1VQ6A 1FRQA 4BDZA 2KRNA 4Z8AA 4F7UB 5GAOr 1TUGB 3SJZA 3CCMT 2HDNB 1K9AA 5IYRA 3UDCA 3CPXA 4RDJA 1RAHB 5GAOm 1OZ3A 3QJYA 1B2RA 1TWBA 4JRKA 5IXBA 4DQLA 1NPRA 3WXMB 2I1LA 4P6YA 2ZPFB 5IHIA 3B8HA 1KQSB 3CCUA 3A5ZB 3CCQQ 3QWXX 3PMIA 1R8OB 3W2FA 4OB2B 3JQQA 4N4IA 2ZCFB 1IHWA 3LQEA 4AC9A 2CH4W 1YI2T 1JXOA 4J5YA 3E2UA 2HKNA 2RQUA 1K0XA 1QFZA 2EQMA 2ZZQA 1ZA2B 3JSCA 3CC4T 3OW2P 3WY9A 2V7XA 1I07A 4LUDA 3QFSA 3VS6A 4C0FA 4C0ZA 5GANh 1GAQA 1WPYA 1YI2B 4KRTA 1MRZA 4PJOD 2CK3A 3Q3AA 3OB9A 3OPOA 3MP1A 3CCRA 1W0KA 2GJRA 2XKOC 3KL9A 4OOXA 5J3OA 3RNJA 5KCOA 4ZGEB 4GLKA 4PJLA 2ZTGA 1BIAA 1SKQA 2VJIA 2W6IA 4OMPA 2LVMA 1OV3A 4C8QG 2KDSA 3OYDA 1YJWT 3ZUGA 1IHVA 3ASPA 3BH4A 4MZTA 2YWHA 1NM7A 3CMAB 1Y0MA 1YCSB 4DOWA 1SRLA 5J39A 4OMQA 1VQPB 2DTHA 3URGA 3UWNA 3AGQA 2HKQB 3OYJA 2QEXB 3OS0A 1VQ5A 3G71B 4KGVB 1I18A 1TU0B 4E7HA 2DIEA 2XNCA 5GAN6 1S72T 3T56B 4TMVA 2DMOA 5KH6A 1M90U 4DBQA 1V5VA 2D6FA 3BC9A 3CCEQ 3CMET 5L23A 3G71T 2CS7A 4PC3A 2YUOA 1UD6A 1PRMC 2EKHA 2BSAA 2DY1A 3GNFB 1E43A 2DYIA 2KVOA 1J9ZA 1JA0A 3WVEB 3WXMA 5BSYA 4CC4B 2E65A 2BZXA 2L2PA 2QXFA 3EFOB 2OTJA 4RCCA 1HJDA 2Y4YA 1VQ7Q 1YJNT 4FYVB 4Z88A 2JJ1A 3I55A 1K9MU 2F2XA 2JT4A 4BE0A 1LJOA 3AVYA 1M9SA 4HXJA 1YI2Q 2X4YA 1WSRA 2X53S 4G1BA 4FYYB 2DM1A 3PVDA 3THKA 2NLUA 2C0OA 5IXFA 3CC2A 3W5VA 1E63A 3PIOA 1QGZA 2KI7A 2XZLA 4J8OA 1D0ZA 4CQJA 1X27A 2PNIA 3ZBDA 1Y57A 3CCVT 3X24B 1YLOA 1NBMA 1N06A 2D3NA 4DNTB 1MNEA 1GL5A 5C6SA 1GAWA 1Q81U 3CD6A 3P8DA 4C8QB 2R5MA 4XNFA 3CCMQ 1YJ9Q 5FRNA 4B9XA 1VQKT 1W2BP 3DLMA 1WORA 1VQLT 1T3LA 3EG9A 1H85A 3C4SA 1JXMA 3RMSA 1PG5B 1X2QA 1XQBA 1UD2A 2QA4T 4G6IA 4B3GA 1DDIA 4X0CA 4NL2A 1QMCA 4HCZA 4Z4ZA 1V1CA 1OOTA 3L2UA 2OBTA 1FMVA 1SF9A 5M9OA 1ABQA 2J7IA 1QVGS 2RK1A 1IZ6A 1NPPA 1D1NA 4ORZA 2RJDA 3G4SB 2JZ2A 2KK4A 3A98A 3U6BA 1VQLA 1T5EA 2MMPA 1PJ7A 1YIJT 5GANf 4BE1A 1NLOC 3H8ZA 3LH5A 4RD1A 2AIRB 1YWOA 2AHJB 2MPXC 3X28B 1OB0A 5LJ5d 2QASA 2CH4A 2WSFE 1KJZA 1V29B 9ATCB 2YUNA 1WIEA 4FYXB 1C0MA 4J9HA 1VQKA 1D0XA 2QTXA 3PFSA 1BI0A 4C8QF 3A8OB 3VRZA 3QFRA 1PSFA 4OB3B 2JN9A 1WDXA 4L6V5 3CRZA 3G6EB 3W2IA 1QCNA 1DJ7B 2BZYA 1Y7XA 1UGQB 1WNLA 3M0UA 2RMOA 1U5SA 4QFMA 1A8PA 4QQGA 3EG9B 1UDLA 3GIBA 2KEAA 5I11A 1TVCA 2MWPA 4JZ4A 1B07A 1RLPC 5AT1B 1HYOA 2CP6A 1YNZA 3S6WA 3OYNA 3ONUA 4MDWA 3A35A 2J06A 2A0FB 4P1VA 4JUVA 4P5NA 3H0FA 1G3TA 3VO2A 2COWA 1PKTA 2JVVA 4RTZA 5IYQA 2EFGA 3SLNA 2C4UA 2XICA 1OULA 1H8HA 2OTLB 1EFUA 4A53A 3CCLT 1W2BS 5LJ5h 4RTXA 1M8MA 4XU3A 2IG0A 3VS7A 1G2BA 1GCQC 3PGGA 4N4GA 3SEMA 4C5GA 4RDLA 3WNBA 3EGXB 3INZA 1WGSA 2HMAA 3I55T 2V1RA 4KKSA 1AHJB 1ZLMA 2PQWA 3GVLA 3ME9A 1UD3A 1T6YA 1OGJA 4V2SA 3EFOA 2JNGA 2ZBVA 1F60A 4ZN1A 3I55B 1WQWA 2RQWA 3AVTA 5FU6C 2GPJA 5KE3A 2K4YA 3VS4A 4II1A 1BQEA 5CIUA 1N8RR 1SEMA 1AD5A 5KCHA 4JJCA 1U2RA 3WBJA 2EJ9A 3CCLQ 1EP3B 4XK8E 3CMEQ 1N0UA 1U3OA 2YWGA 3FJ5A 3HKSA 5IYNA 1M1GA 1Y96A 4RKUE 2C0IA 1Z9ZA 3CBOA 2LT1A 1N5ZA 5CR2A 1YP5A 2WSEE 5J3BA 2JS0A 1WDTA 4BI4A 1Q7YR 1UFFA 5FW9A 3VUZA 3A1PA 4TN1A 1MV3A 4JJDA 4B47A 4EMKA 1Y71A 4OP7A 1AMOA 2PLFA 2FPEA 1X6BA 2A7YA 4HT8A 1J3TA 3NE5B 2EAYA 1ELOA 2ZL7A 4Z4YA 5CO7A 1BX0A 4AFSC 3CQTA 3LVBA 3OZWA 2EGEA 4ZGNB 4PABA 4ZCMA 3QHSA 4FIBA 1KK7A 4KH0B 1RQRA 4OP0A 4DK0A 4B3XA 1ACMB 5GAMd 3WNDA 3OP1A 4AG2C 1IHMA 4G5GA 4TKOB 3VMFA 4QVDA 5IHKA 4UZUA 3R6JA 1K73U 3C94A 2EYYA 3M4YA 1VQNQ 2LNHB 1WHJA 3DLLA 3CD6T 1BMFA 3CC2B 2L3PA 4QQDA 1WHHA 4EMKB 3MCAB 2BPOA 2WYRA 2Y90A 1WHMA 4Z02A 4XTXA 1B23P 5HZAA 4DA4A 3CC7T 3VJPA 3JB9J 4G7XA 3QXEB 4HKEA 1K8AC 5D6YA 1H3ZA 4MMLA 4YALA 1TUCA 2VC8A 4XTUA 1BI1A 4F7UA 2F2VA 2PVDB 4M75F 5DLQE 1G3SA 2LNVA 4J7IA 1EWYA 1FX7A 2BVNA 2DCUA 1OU8A 2L3SA 2RB6A 1WPCA 2VVKA 1VQ4Q 5CKEA 3OMGA 7AT1B 2HBPA 2PU9B 4BY6C 1VQ7A 4TMZA 1VLOA 2HQHA 2CSQA 4RCZA 3JCMJ 2LJ1A 5HKCA 4OGEA 3V7AA 4X7EA 2PVGB 5IYWA 4IUVA 3ZBTA 1SPKA 2BV3A 3DB4A 1Q81R 3VYGA 1TTTA 1RI9A 4PL6A 3W2GA 2DLPA 3L42A 4N0AA 3JB9F 5IHNA 2K3YA 1XNIA 1RAGB 3EH2A 1OB2A 2GFAA 1VQ7T 1X69A 5EC7A 2XGJA 1CSKA 1N27A 2RNAA 3MCAA 3FRNA 2DKGA 5CQXA 2VBSA 3S3OA 3M55A 3ZBUA 5KYNA 1YHQQ 1M1KC 2K2MA 2KQWA 3EG0A 1Y0YA 1WHGA 3Q39A 4AFUC 1AT1B 3GBQA 2RN8A 2CZ0B 1V76A 1UGRB 3MEVA 1ZM9A 4FSXA 3EFSA 2DIGA 4M7AB 3OKXA 1OZ2A 4RD2A 1AEYA 2MF2A 4J83A 1PC0A 4JLIA 3FKSA 4PC7A 1KC8U 1NB0A 1D1BA 2BM0A 1KZLA 2QGFB 4E2FB 2M5SA 3GVJA 3M0SA 4E47A 2LTOA 5GMKi 3U2QA 4B3FX 3OJXA 3J7AF 3CC4B 2P0QA 1AWWA 2ABLA 3VKIA 5THXA 3ZPNA 5H5JA 4HCBA 4P3IA 5LJ5f 4TSFA 1B34B 3LGLA 3I9QA 4AG1C 1BCMA 3CW2A 1VF7A 1GCQA 2VWFA 2EGAA 1SSHA 1R5OA 3M58A 3OEEA 3M53A 4RCYA 4RLZA 1RI0A 4N3NA 1TUIA 4PC2A 3M59A 2EJGA 2X3XD 3MEWA 5KYYB 1YIJQ 2VNKA 2YSQA 1NJIU 4M77E 1Q86R 3GF5A 4PFPA 1VYUA 3ULRB 2JJ9A 2R5AA 4AT1B 1YHQB 4C8QE 2JUFA 3SEJA 1KMHA 5A0DA 1WOOA 1KK2A 2DJQA 2ZITA 4YAWA 3QDFA 2F4NA 2Q6IA 2I2LA 1TUDA 3QFTA 1X2KA 3W2EA 1XB2A 3ASTA 3SFMA 2A28A 2QA4Q 1S72B 5KYXB 2BE9B 2DX1A 2DIQA 4LDXA 4QV2A 4PLLA 2DZ9A 4XONA 3VRYA 1WXBA 3U6KA 1YJ9T 4J9FA 3M4GA 4BACA 1QVFB 2VXEA 3AVXA 4M77G 1B3QA 3OFNA 1QKWA 1I1JA 1OU9A 1TTHB 4C0DB 3G6EA 2ROTA 1UGVA 2DYBA 1TLLA 2VB6A 1KC8C 2QEXT 4K1XA 1CNFA 4DBFA 8AT1B 2E1RA 1UGPB 4EMKC 2HQXA 2DXTA 5TV2A 1YWPA 2WPDA 2O9SA 1BIBA 4C8QD 4M0LA 3QZ9B 3CBMA 1N6AA 1BLIA 4PFZA 3I56Q 3B78A 3EFRA 1UB4A 2RM4A 5CKHA 5GANd 4ZGQB 2V8JA 4XU1A 4LC0A 1BYMA 2NPFA 2EKOA 3JCMh 3CPFA 5FNZA 2M16A 2RD1A 2RHZA 3OYMA 3X25B 1UJ0A 4ESRA 1QWFA 1Q7YU 3H41A 2LJ0A 2C0TA 1M8VA 4M75C 2QAZA 3BDUA 5IT9E 1WI7A 3CESA 2D0QB 1WU8A 1VQKB 4ROXA 4BI3A 1EZZB 3ZIAA 2O88A 3E1YE 5A89A 4FWTA 3CCJA 5HY6A 3CCVB 2E12A 4EPCA 2ECZA 3LWIA 2X0KA 1K76A 5GJWB 2RHUA 3ZZTA 4M7AA 3ZL7C 2DVEA 2XDPA 4KBMB 5GMKm 1FMKA 3CCQA 2KY9A 1VQPA 2WJVA 4H9GA 2O4XA 2VUBA 4C5HA 2DERA 2QQ9A 3QYHB 1TSFA 2EYXA 2YDLA 2DA9A 1K73R 1VQPQ 4WZEA 4FN5A 2JJ2A 4C92D 2C4TA 4WQMA 2EGCA 3I5RA 2GREA 2BE7D 1PSEA 1QVFS 1D1AA 2EYWA 2HLDA 3C12A 2QG9B 2KRMA 3M0TA 3UT1A 4OPOA 4C92A 3OYYA 4OPSA 1I8FA 3R6OA 2C5BA 5HK3A 4TMWA 3V7CA 4OGCA 4M7DB 2X4XA 1W1FA 3CB4A 4NNJA 3CCSQ 3CCRQ 2HCKA 2M0OA 1M30A 4LBZA 4LDVA 2ED0A 2GQVA 3E1SA 4X06A 3NTKA 2LZ6B 2YUPA 2QDYB 3CMEB 3OYGA 2XNJA 3NFCA 4HE5A 3CCJT 4RPDA 2NWMA 2MI6A 4CC3A 2F1LA 4AVZA 2NUTA 3TEEA 3MJXA 1PCXA 1YFNA 2FYKA 4BDYA 4Z4TA 1FDRA 4QT7A 3CCUQ 2XG8D 2KYMA 2ZXIA 2RK2A 2MYSA 2A08A 2D8JA 1ZSGA 1OB5A 4KKUA 1VQLQ 3M57A 1VQMT 5F4MA 1QGAA 1GFDA 1V0FA 2F69A 4XTZA 3SWNC 1QKXA 2DXCA 4OMLA 1HSQA 1AWXA 4AFZC 1IJFA 1VHEA 1D09B 2XD0A 4NCNA 2X85A 4RG8A 2A36A 5BSXA 1JA1A 5CKBA 4YAFA 2ATCB 1OHHA 3LX7A 1M4ZA 1FX0A 1Q82D 5GAOp 3E19A 5FWBA 2O31A 1VIEA 2AKLA 4KUIA 2XZOA 1ZUKA 3RIRA 1VYTA 2J6FA 1PNJA 4JS4A 1I81A 3I56B 1KIKA 1Q95G 2V26A 2OTJT 2PUKB 3G71A 4J9EA 3NHNA 4U9UA 3CCLB 3L2VA 1YIJB 5CKDA 1M2OA 3ASKA 1G7SA 4X07A 4RD4A 1QGYA 1HD3A 3RR6A 1ZUUA 1VQ8A 4M77C 5LJ3e 1W9XA 4XLAA 4M75D 4XTVA 5LJ3j 1NB9A 2DZCA 2G3RA 3SJPA 4Y9UA 3Q6QA 4ZGJB 3QBYA 1M3AA 4XL9A 2WSSA 3OAAA 2OK7A 4Z89A 2ZPEB 5I2MA 2E10A 4ZCIA 1R5NA 1VQ4T 5FU7B 4HIZA 1N9RA 2KGTA 4M7AF 1LVKA 3VS2A 5GAOq 2CT3A 2EQUA 2V31A 4RPBA 2JW4A 3TQ7P 3CPWP 4QVJA 4E7SA 3G4SQ 1Q86D 1U06A 5AN9A 3QWYA 3H0HA 5KYYA 2WZPP 2LX9A 5GAN8 3CCVA 3CCJB 4EDUA 2CREA 2P0KA 3J80E 3UPUA 4E7KA 3E20A 5EMNA 2G6FX 3T51B 1VQ8B 2IIMA 4D8KA 1JJ2A 2NYSA 3BW1A 1CNEA 2YLCA 3BNWA 1GFCA 2GQFA 4PNOA 1LOJA 3CCLA 1UHCA 2LZJA 1G5VA 1WJQA 4M4ZA 3OYEA 2QQSA 4C92G 4CC7A 2FX3A 2PMDA 3S3NA 3OS5A 3KXTA 4KH1B 1AZGB 4K11A 4HE6A 1NLPC 4XN3A 1PKVA 2BZ8A 3CC4Q 4B43A 4J9IA 2XNDA 3OBWA 3OJWA 4J6YA 2FO0A 2OTLT 4GQNA 1RL2A 2Q6LA 2YWEA 4M7AG 2JXBA 4ME7A 5TRDA 1M5Q1 3TREA 1NJIC 3FPKA 4FT4A 3MEUA 3FJOA 4B4DA 3JCMc 3CXCA 1KHCA 2GTOA 4RUGA 3FPPA 3IQLA 2CUDA 1T6ZA 5FO0A 2GQIA 2QTZA 1BK2A 3RERA 1WTHD 1MGQA 4E0FA 2LT4A 2O9VA 2RQTA 4ZN3A 1XJWB 5A2QE 2GGRA 2RH2A 3JCMf 1YI2A 2D3LA 2E1HA 4OMNA 4P2NA 3VO1A 1LNXA 3NGPA 3JB9G 1PJ5A 2VYTA 2H3EB 2HL5C 2M0YA 3CCEB 2R57A 2B7CA 1E6GA 2FL7A 1EIFA 2VZLA 2JTEA 3OZVA 3WBKA 2FHDA 4ZGDB 3J81k 3NPFA 2MAMA 3UF4A 2ED1A 5L8RE 3V76A 3HP9A 1YBYA 5TR9A 3GOXA 4C92C 3CD6Q 1G7TA 1JRIA 1JBMA 3TVTA 5GAN4 4X34A 3BQJA 2X3WD 4G7WA 3A8JA 2OK8A 1M2VB 4A54A 1W2BA 3JU4A 5LMZA 1TS9A 2B86A 4Y7CA 4BI8B 3RKWA 3JV3A 5CDFA 3WVDB 4QHYA 2DD4A 4GBQA 5GANe 2YLBA 1VQ9A 1GCPA 1W35A 1M90R 1WOSA 5FWCA 1QVGP 1VA7A 4MZPA 1KK0A 3AGPA 2CP3A 2DL5A 4M7DF 2KE9A 2HEQA 1PHTA 5LJ3g 4XKVA 3QPHA 1N8RC 4WCIA 4BE2A 1BU1A 3EH1A 1MMAA 1OPKA 2DFUA 2P3MA 2K7AA 4F17A 1NG2A 3CMEA 3I1FA 2E1BA 3CCUB 4FK8A 2VJJA 4UAJA 5F4OA 3QIIA 4M77B 5FU6B 4Y28E 3OA6A 2DPPB 1JEGA 2BF4A 3W2HA 3CC2T 3CD6B 1ZBJA 3M56A 3X26B 2VKNA 5L46A 3I35A 2JTMA 5IH2A 1GBRA 2VXFA 1OX8A 3GNGA 4M78C 1K9MC 2BGIA 2O01E 3L2ZA 3OMCA 1NJID 3ER0A 2EIXA 3CTAA 3R6KA 5D6XA 3UA6A 2HSEB 4EMGA 1H8EA 2L8DA 4XTYA 3OZUA 2ENMA 3VU3C 3OYFA 2PVOB 2GK7A 1YHQT 1X75C 1JJ2S 2QI2A 2VASA 3EGUA 1IB8A 4P26A 1R0CB 5I21A 5LL6S 4UZEA 4XLCA 1D3BA 4M77A 2DL3A 2J6OA 2V7WA 4JMQA 4M7DC 4YELA 1XTDA 2FZCB 1D2EA 1EXMA 3TU4K 4PJOG 3V7RA 4F04B 1KK3A 3PENA 4RD3A 1DDGA 2FG0A 5A0GA 5HCKA 5CAIA 4MYUA 4XU0A 1N05A 4C92F 4FW1A 2DETA 4A63B 3M0RA 2DEQA 2IVWA 2OAUA 2XU8A 5GV8A 2RI3A 1D8TA 1E6HA 1U1TA 2GJKA 1E1QA 3D26A 1H3HA 1UE9A 4MMKA 3MMPA 2AKKA 2J05A 3CCMA 1ZHIA 2ZZGA 5A0LA 1SKUB 4FT2A 4XAXB 1LCKA 1VQKQ 3EGDB 1VQ4A 5LJ5g 2ZZEA 5GAMj 2ZL6A 1OQKA 1QVGB 4PK4A 4O6JA 3MKDA 4TT3A 2WSCE 2CP2A 3EGXA 1VQ9Q 4LDYA 1O9SA 3SWNB 1ZM2A 2E4HA 1Q82U 4RD0A 2FZKB 1AIPA 1B7TA 1ARKA 3ASRA 2LQ8A 1PD0A 5DM7R 3CCUT 2LCLA 1WXUA 1G7CA 1MMDA 2D9RA 2E6NA 4O5VA 4EH1A 3CC4A 4D6WA 1JNYA 1X43A 2QDLA 1I0CA 3AVWA 2DE0X 2X3UA 4IW3B 3CCRT 4FU6A 1XE1A 2JIZA 2KMTA 3AVVA 4ZTFA 3HTRA 4M78E 4PFOA 4P25A 4X9DA 3CCST 1ZA1B 5HK0A 1LPLA 3ASQA 1D1CA 4C8QA 1Q7YD 3G7ZA 3GIRA 4XLEA 4XOPA 1M1KR 2B5OA 2OTLA 1RADB 5LJ5j 2YWFA 3L2RA 1H641 4HVVA 2C2WA 2LQNA 3OOCA 2CSIA 3JCMg 4XQ3A 3Q6RA 1MUZA 3FIFA 4JRQA 1HA3A 3AT1B 3L2WA 4M77F 3QFCA 5GMKl 1OEBA 4XOTA 2AZVA 3W5HA 1N07A 3A8KA 1FNDA 1KQ2A 1W34A 1Y96B 3G4ST 2GNCA 4AMCA 2Y4XA 4X8IA 3O8VA 4DEXA 1FNBA 5TY0A 1E64A 1X6GA 1N8RU 3CMAT 2RQVA 2K3BA 1MHNA 1JQQA 1YITT 1I7PA 4IKFA 3AHUA 3V8JA 4D8DA 4RTUA 1KG1A 1RQPA 2C06A 4BUGA 2CNDA 4L59A 3CEYA 4Y9RA 4RTWA 4M7AD 5KNLA 4KGXB 2X9HA 2V7TA 3OYCA 3JCMP 3PUMA 3OE7A 4AFQC 4F7UE 4J9BA 3P27A 2QQAA 4F7UG 1Q86C 2EIFA 5LJ3f 1VQ9B 1W4SA 2C78A 3VUBA 1VQMB 3HRSA 3GP8A 1K8AR 1VHOA 3N5BB 4PJJA 4OMFB 2XZPA 4WZTA 3JCMd 2FPFA 4J0QA 1YJNB 1M2VA 1BX1A 1GJRA 3PT9A 1KD1U 1XQHA 1RAEB 4IUUA 2X8KA 3OQ5A 1R0BG 3CPWA 2VNHA 3RBBB 4PGOA 4M75G 1WP6A 4OOSA 3OW2A 3OW2S 2RHYA 5GAMg 2VGNA 1EFRA 5KYWA 2FPDA 4HCCA 1PJ6A 1VQOA 3EAEA 3CCRB 3A8IA 5FLXE 1ZSZB 2YRVA 1QVPA 1JB0E 2F2WA 1AOJA 1VQOQ 2D8HA 4AF7A 1M90C 4B6MA 2DRKA 2ZGWA 1WOPA 5GAN5 3OS1A 4ACBA 1WA7A 4Q5WA 2ZXHA 2K5LA 4OF1A 2EQIA 3HRTA 4NBSA 2HD0A 3JAME 1QWEA 2JN0A 1N9SA 3JCMW 1MV0B 3TCJA 1N0VC 2DXUA 1F1BB 2QE7A 4E7JA 5GAMe 1UJYA 2KXDA 2JOYA 2JM9A 5LJ3h 4HT9A 4ELYC 1IO6A 2LX7A 3M0QA 2MCNA 1VQ4B 2EQJA 3FLGA 1M27C 3HAGA 4KGZB 3GPLA 5GAMh 1O75A 1E62A 3UA7A 4PJNA 3M9QA 2DL7A 4JDSA 1Q86U 5CCAA 3OYLA 2ZPBB 1S4MA 4J9GA 3VS5A 1W6XA 5FU7C 4LXCA 2QTLA 2BUDA 1KQSP 4F7DA 1QFJA 1KD1C 4IIOA 2W6JA 2KT8A 4LBWA 4BD3A 2ROLA 1PWTA 2K79A 1FNCA 4P6VF 2Z0WA 2L3RA 4M75B 1QFYA 2RJEA 4LNPA 3SD4A 3L1AA 3MPUB 3CMAA 3RDVA 1UMKA 2GJPA 3PTAA 3PMTA 4M7AC 1K8AD 1IRXA 4XR6A 4PAAA 3BCFA 4X05A 3W5UA 4J9CA 1D0YA 1ZSZA 4ASUA 3OW2B 2EYQA 5DY9A 3VS0A 2COYA 4IURA 2JDIA 3FEOA 5D6WA 3DDYA 2V1QA 4M7DD 2NUPB 4GY5A 3JCMV 3A8GB 4B44A 2R58A 4TMXA 3LLRA 2JMAA 2MWOA 4C43A 2K6DA 2QK0A 2LRQA 4R56A 1KTVA 4LUEA 4JRIA 1KQSS 2LCSA 3JCMe 2I0NA 4RTYA 5IN1A 2PTKA 1K73C 3CP2A 1IB0A 1G7RA 2RJCA 4PJOE 4YAOA 3CP8A 3C0CA 3QSYA 4AF6A 3A8LB 4C5IA 1NEGA 3MP8A 4DQ2A 2B7BA 3QZ5B 2ZPHB 1I5OB 1NZ9A 1GXIE 3LGFA 4FYWB 4PLIA 2HDAA 3REAB 1ZUYA 4QVCA 2L5QA 3I56A 4JJNK 2EWNA 2HAXA 3H6ZA 2K2VA 3VS3A 3A8MB 1YITQ 1VQ5Q 3A3GA 3PVQA 3SWNA 1VQMA 1JJ2P 3ASSA 1ZM3A 4PJOA 2RHIA 1VQ6B 2M02A 3JCMb 1VQMQ 2E3IA 3JB9I 2CW5A 1DARA 1M1KD 2JMCA 2LJ3A 2K57A 3F70A 4DEYA 1WX6A 3SLDA 4M78A 1WQ7A 3CC7Q 4RDKA 4CRIA 3CBPA 5IYPA 4RTTA 3H94A 3OYIA 4M4SA 1BCOA 4M78D 1K9MD 1NYGA 1RAIB 4R0KA 3CCJQ 4XTWA 4XLFA 4Z4WA 2NUPA 4M78G 4J9DA 3OYAA 3OS2A 1VQ8T 2OTLQ 1QUFA 1N08A 3ZFJA 1ABOA 2LDMA 2YRDA 5GANj 3D7SB 2RF0A 3QYGB 1WYXA 2A3LA 3TSWA 2PE3A 2E70A 4XORA 4R71A 1UTIA 2RHXA 1VQ8Q 5EG2A 3EG1A 1ZM4A 3UATA 4LDUA 1S1NA 2E41A 4XM3A 2AZSA 2CZ6B 4ZNXA 4JPBW 1G8XA 1CQXA 5I22A 1ZUNB 1KFZA 4YEJA 4FCYA 1H42A 2K5FA 4FL6A 4E7ZA 1QLYA 1A0NB 5C0MA 3SHWA 1VQ6Q 4IUQA 4M7DG 4RMOA 3JQRA 2RI2A 1WLPB 2B8AA 2XOKA 5FROA 1AWJA 1YCYA 5HZBA 2LQKA 2COZA 4P12A 2Z6BD 4IUTA 1VQOT 2VYQA 3WQZA 4PJOF 2R6HA 4KT0E 1GRIA 4XLHA 4QVZA 1YIJA 3HSBA 1VIFA 2OBSA 3PIPA 5GV7A 4DK1A 2L89A 4BPRA 4RM0A 1IREB 5FIUA 2P84A 2VV5A 2P0PA 1JJ2B 2BM1A 1IXDA 2BTTA 4TVRA 2QTVA 4HVWA 1C1AA 2VBTA 2EW3A 1W0JA 5E6TA 2KRSA 1AZEA 4J6WA 2EPDA 2E3HA 4DBRA 4L8JA 5GMKe 3I5SA 3ISXA 3U23A 3RY8A 2MIOA 3NTHA 5GAN7 5GAN3 2GBQA 2VBVA 4M75E 2ZZFA 2WR8A 2CT4A 3QKJA 3RUXA 1P92A 2DNUA 3EG3A 3DB3A 2GK6A 4P9SA 1OYXA 3RMQA 1VQNB 3CCMB 2F43A 3BE3A 1Q82R 1H92A 2RQRA 3PA1A 1K9MR 2KNBB 4PKCC 1WZOA 2MOXA 3G71Q 1Q82C 3T9NA 5CK9A 2QEXQ 1IJEA 3QUIA 2V7VA 4C0DC 5FO1A 4LDWA 3CMAQ 5H59A 3DKMA 2F5KA 2LP5A 3ZEHA 2PZ1A 1YX2A 1UD8A 1KD1R 3VYHB 3M5AA 2BIVA 2RC5A 1FMWA 1FYNA 4Y92A 5KE2A 1UEBA 2OBRA 1ZSZC 3VNVA 4ANJA 2OAWA 2CZ7B 2M51A 1M3BA 2AHOA 3P26A 5B6IA 3PVLA 2AK5A 5FRMA 1G83A 4MZMA 1WJSA 1YJWQ 1K4US 3FJPA 1S72A 3G05A 2V7UA 2A37A 4L5GA 2X4JA 2DTOA 1QQJA 3BY2A 1KQSA 4OMOA 3ZZ0A 1T3SA 2FZGB 1K0SA 2YUQA 4A4GA 2EYZA 2LCCA 1WHKA 1W87A 4ZV4A 1VLYA 5GMKh 3MO8A 1SSFA 2F1MA 3VS1A 1PM3A 2CZ1B 2QGGA 4A4KA 1KHIA 4Z4UA 1VOMA 4N4HA 1E3XA 2ZZDA 2JM8A 3CCSB 4F14A 4PJMA 3BFMA 4RD6A 4RCBA 1K28D 2NUZA 1I4K1 2EVRA 3V8LA 1M1FA 2P4TA 2D1XA 1JU5C 1B34A 4MYTA 2FEIA 2V8IA 1IGUA 4QUZA 2RI5A 2CDTA 5IAYA 1YJWB 5HKKA 1ZX6A 3HFNA 1FXXA 4HA8A 1D3BB 5CQYA 2RC6A 1GR1A 2HBWA 3PE0A 4IUPA 4ZCLA 1UD4A 3QE2A 1GBQA 1AWOA 1NBEB 4ELZC 2E6ZA 2DBKA 1WSVA 4X7FA 4IIMA 4UC4A 5KW9A 2XK0A 4NL3A 3A3BA 3E9GA 1N8RD 4F7UF 4RTVA 2CGHA 5GMKj 3Q1JA 2X6XA 2XEXA 2ESWA 1UECA 3OSVA 3CCVQ 4Z4RA 1BI3A 4Z4VA 1QG0A 2HNIA 1Q81C 3CPWB 3QDRB 3BY1A 3MHXA 1OPLA 3MEAA 3FC3A 2D74A 5J35A 2LQWA 1HK9A 1KD1D 2RO0A 3CXCS 2V7QA 3KBGA 2FVGA 3LNNA 4C0SA 1SM4A 1YHQA 2X35A 2KSSA 1TH7A 5AYFA 3KUFA 4X1VA 2GFUA 5LJ3d 5KYUA 3NMZC 1M3CA 1CKBA 3ONYA 5KYXA 1QUEA 1WFWA 2O2OA 4DNRB 2VGMA 1EFNA 2HQEA 3M0PA 4A4FA 1S72Q 5DS0A 3CXCB 3CCEA 2Q6OA 4B48A 5HXBA 4OMMA 1QW1A 1RAAB 1VQPT 3OEHA 3BDLA 2KT1A 1FWZA 1COWA 4Z1MA 1IGQA 8ATCB 4TMTA 2GCXA 4RG2A 3SB2A 2WZNA 1KSWA 1M1KU 2E5KA 2K3XA 1M90D 1PD1A 1EX4A 2CBXA 3NTIA 5GAMf 3VNUA 1XOVA 4II3A 4OVAA 3LH0A 1H8KA 1VQNA 1MNDA 1KK1A 1WXTA 1JO8A 3LYIA 5A8AA 4J6XA 3R6NA 1BKBA 2QA4B 3KEWA 5ECAA 3RESA 4Q7JB 5DN6A 3V7SA 4BY6B 3OY9A 1NDHA 2J7KA 3ES9A 4CI0C 4WTOB 4JJBA 3OBYA 2W10A 2DRMA 1RAFB 5CKFA 1QX4A 2DJZA 4A4HA 3S3MA 3OSSC 3GLXA 2XDDA 1BJKA 4C8QC 2CUBA 2V4DA 3QJ6A 2K9GA 1EFTA 4RJLA 1QP3A 2X51A 1SHGA 2LMJA 4QW2A 1Q7YC 4C92B 1UGSB 4B9WA 1C6VX 2HZYA 4QQ6A 5JBQA 1ZBXA 1E79A 2YRCA 1NJIR 4LN2A 2BKDN 2E5QA 4M53A 4M78F 4VUBA 1MMGA
chains in the Genus database with same CATH topology
3HTRA 1PM3A 2QGGA 2F1LA 2DOGA 2DYIA 3A1PA 3H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTR A;  1PM3 A;  2QGG A;  2F1L A;  2DOG A;  2DYI A;  3A1P A;  3H9N A; 
#chains in the Genus database with same CATH topology
 3HRU A;  1VQ9 T;  1PKS A;  2CYZ B;  2P4R A;  1Q81 D;  1UUE A;  4M78 B;  4E7L A;  5GAO l;  1E3Z A;  4JZ3 A;  3MHP A;  4BB7 A;  3H9N A;  1BB9 A;  1VJS A;  5J26 A;  3JCM X;  1G3Y A;  4PJO C;  1VQL B;  2QN6 A;  1F20 A;  4P22 A;  2SRC A;  2QMU A;  1HZE A;  4J7F A;  1K8A U;  2C5H A;  1K1Z A;  3HPW A;  3REB B;  2CKK A;  2OTJ B;  3EGD A;  3TSZ A;  3OW7 A;  2HSP A;  2FRY A;  2SEM A;  1UD5 A;  4M1K A;  2C77 A;  4LBV A;  3CXC P;  3Q38 A;  4A4E A;  2W0Z A;  2NUT B;  2YHT A;  3EG2 A;  2DVJ A;  4OPV A;  4XU2 A;  5I2S A;  4M77 D;  2CRV A;  2ZBU A;  4OOV A;  2RJF A;  4II2 A;  1PRL C;  3JB9 H;  1E1R A;  2DAQ A;  5DLO A;  5KSW B;  2ZTN A;  1UG1 A;  3LWH A;  4YHB A;  2QEX A;  1EP1 B;  4M7D A;  2KRO A;  1TXQ A;  2QA4 A;  3BCD A;  1QVF P;  3P8B B;  4KKT A;  2EJF A;  2YT6 A;  4WZL A;  4YXW A;  2QYZ A;  2QDX A;  4QVA A;  4C92 E;  4HCK A;  3PUN A;  3QG1 A;  3CCE T;  4NS5 A;  5GAN g;  4XKW A;  3J81 E;  4R55 A;  1V0E A;  2F5T X;  3G6E T;  1QH0 A;  2DXB A;  5LJ5 e;  2KXC A;  2VNJ A;  1MMN A;  1EP2 B;  3FB9 A;  3VV0 A;  4P3Y A;  1X01 A;  2XMF A;  4C5E A;  1XFO A;  1RLQ C;  4CC2 A;  4F16 A;  3CC2 Q;  4M2L A;  3JB9 D;  5GJV B;  2KBT A;  3EHQ A;  4Z4S A;  1VQ6 T;  1KQ1 A;  1OI1 A;  2DL4 A;  3MP6 A;  2YWW A;  1NEB A;  2BN4 A;  4ACA A;  2DTI A;  2K5I A;  4QKU A;  4YTL A;  4X7D A;  4FSS A;  3OYK A;  2ZPG B;  5CVI A;  1Y07 A;  1NE8 A;  2XDB A;  1T0J A;  1GO2 A;  2L3Q A;  2V8K A;  1SHF A;  2XHC A;  2OYN A;  3LW5 E;  4ATO A;  5FA6 A;  4PC1 A;  3O5Z A;  1R77 A;  4LD6 A;  5A88 A;  5FL7 A;  2CP7 A;  2JTF A;  4N0A C;  4NOY A;  5DSZ A;  4EMH A;  4YAU A;  2EBP A;  3HFO A;  1S0U A;  1W2B B;  2DL8 A;  2KAF A;  2OX7 A;  2GTJ A;  3QO3 A;  2IPO B;  4KUL A;  1TG0 A;  3PNW C;  5GAN 2;  3C95 A;  4FM4 B;  4M7D E;  3OYB A;  1G3W A;  4Y91 A;  3WNC A;  1HXD A;  1VUB A;  3I56 T;  3CCQ T;  2DEU A;  2OTJ Q;  5IK2 A;  4UZF A;  3JRZ A;  3SDZ A;  2QQB A;  2KYB A;  2M1H A;  1SG5 A;  4C0G A;  2HCJ B;  4WZK A;  1UHF A;  3CCQ B;  1JB9 A;  4LD9 K;  4MDX A;  1X6O A;  1YJW A;  1OX9 A;  3HHT B;  5GAO n;  2OI3 A;  4XMY A;  2XID A;  2KR3 A;  2LC4 A;  3G1J A;  2FB7 A;  2X6W A;  1QP2 A;  4ZTJ A;  2VBU A;  2KVQ G;  1VQO B;  4WF2 A;  1T6X A;  4LBY A;  1QCF A;  1KRH A;  2PIA A;  3M54 A;  1U1S A;  1FRN A;  3L2Q A;  3CCS A;  2YXY A;  2OJ2 A;  4DQK A;  2ZL5 A;  3HL8 A;  1TOV A;  4X9C A;  1GVH A;  2EQK A;  3BY7 A;  2RPN A;  2O4X B;  1YJN A;  2X4W A;  2DIL A;  2GF7 A;  2H8H A;  6AT1 B;  1VQN T;  1P4M A;  1YN8 A;  1SKY B;  1BBZ A;  2M9U A;  2QQR A;  1RAC B;  4X7C A;  1YJN Q;  3EHR A;  1RUW A;  2DO3 A;  2FVU A;  3WYA A;  1QVF A;  2RA2 A;  3X20 B;  3I55 Q;  1K73 D;  3JQP A;  4E6R A;  1MAB A;  2BGJ A;  2D9T A;  2PUO B;  2ZPI B;  1DG1 G;  3G4S A;  1YIT A;  2CC2 A;  2EFI A;  3CMM A;  3AVU A;  4FW2 A;  3H0I A;  2DD5 A;  2E64 A;  3RKY A;  1YJ9 A;  2AT1 B;  3GVK A;  1Q9S A;  1NRK A;  3ZZU A;  2H3J A;  1AVZ C;  1WJR A;  1E7O A;  2VNI A;  2CP5 A;  5KYU B;  4PC6 A;  2DOG A;  4LE9 A;  3V8K A;  4KUD K;  4N3G A;  4GLM A;  2NV4 A;  2WAC A;  2WJY A;  1I8D A;  3VR6 A;  4XD7 A;  1VQ5 B;  1EFC A;  5KYW B;  1VYV A;  3ZC3 A;  4DBH A;  2HL3 A;  4OB0 B;  2DF6 A;  4HVU A;  1I5L A;  3MET A;  4XN0 A;  2D0N A;  2DBM A;  3CC7 B;  3P8H A;  1VQ5 T;  1WHL A;  1T0H A;  1KC8 R;  3CC7 A;  5D7U A;  4OB1 B;  3G6E Q;  1NYF A;  1W70 A;  4DOV A;  2XI9 A;  1Z9Q A;  1KJW A;  4XQF A;  2J6K A;  4G1V A;  3PA2 A;  4EIK A;  2JS2 A;  2MK5 A;  1BI2 A;  1HVX A;  2CF4 A;  1QVG A;  3RKX A;  4PJO B;  2L0A A;  2BMW A;  1QCO A;  2X6Y A;  2DK3 A;  2FRW A;  3OYH A;  3CPW S;  1SRM A;  4M7A E;  1BPL A;  2CP0 A;  3B82 A;  3T53 B;  4WWV A;  1RAB B;  5F4J A;  3GSI A;  4M75 A;  1FNM A;  4JLG A;  3SKB A;  1YJ9 B;  1ZQ1 A;  3LO8 A;  3QSU A;  3GQB A;  3A8H B;  4JS5 A;  1KC8 D;  1OGI A;  1YIT B;  4JRP A;  1Y0R A;  2ZAE A;  3JCM Q;  3FDR A;  4E7I A;  1U8R A;  3LQ6 A;  4FXU A;  3KFV A;  1VQ7 B;  2R9V A;  3E9F A;  1R5B A;  2Q6K A;  1CKA A;  1VQ6 A;  1FRQ A;  4BDZ A;  2KRN A;  4Z8A A;  4F7U B;  5GAO r;  1TUG B;  3SJZ A;  3CCM T;  2HDN B;  1K9A A;  5IYR A;  3UDC A;  3CPX A;  4RDJ A;  1RAH B;  5GAO m;  1OZ3 A;  3QJY A;  1B2R A;  1TWB A;  4JRK A;  5IXB A;  4DQL A;  1NPR A;  3WXM B;  2I1L A;  4P6Y A;  2ZPF B;  5IHI A;  3B8H A;  1KQS B;  3CCU A;  3A5Z B;  3CCQ Q;  3QWX X;  3PMI A;  1R8O B;  3W2F A;  4OB2 B;  3JQQ A;  4N4I A;  2ZCF B;  1IHW A;  3LQE A;  4AC9 A;  2CH4 W;  1YI2 T;  1JXO A;  4J5Y A;  3E2U A;  2HKN A;  2RQU A;  1K0X A;  1QFZ A;  2EQM A;  2ZZQ A;  1ZA2 B;  3JSC A;  3CC4 T;  3OW2 P;  3WY9 A;  2V7X A;  1I07 A;  4LUD A;  3QFS A;  3VS6 A;  4C0F A;  4C0Z A;  5GAN h;  1GAQ A;  1WPY A;  1YI2 B;  4KRT A;  1MRZ A;  4PJO D;  2CK3 A;  3Q3A A;  3OB9 A;  3OPO A;  3MP1 A;  3CCR A;  1W0K A;  2GJR A;  2XKO C;  3KL9 A;  4OOX A;  5J3O A;  3RNJ A;  5KCO A;  4ZGE B;  4GLK A;  4PJL A;  2ZTG A;  1BIA A;  1SKQ A;  2VJI A;  2W6I A;  4OMP A;  2LVM A;  1OV3 A;  4C8Q G;  2KDS A;  3OYD A;  1YJW T;  3ZUG A;  1IHV A;  3ASP A;  3BH4 A;  4MZT A;  2YWH A;  1NM7 A;  3CMA B;  1Y0M A;  1YCS B;  4DOW A;  1SRL A;  5J39 A;  4OMQ A;  1VQP B;  2DTH A;  3URG A;  3UWN A;  3AGQ A;  2HKQ B;  3OYJ A;  2QEX B;  3OS0 A;  1VQ5 A;  3G71 B;  4KGV B;  1I18 A;  1TU0 B;  4E7H A;  2DIE A;  2XNC A;  5GAN 6;  1S72 T;  3T56 B;  4TMV A;  2DMO A;  5KH6 A;  1M90 U;  4DBQ A;  1V5V A;  2D6F A;  3BC9 A;  3CCE Q;  3CME T;  5L23 A;  3G71 T;  2CS7 A;  4PC3 A;  2YUO A;  1UD6 A;  1PRM C;  2EKH A;  2BSA A;  2DY1 A;  3GNF B;  1E43 A;  2DYI A;  2KVO A;  1J9Z A;  1JA0 A;  3WVE B;  3WXM A;  5BSY A;  4CC4 B;  2E65 A;  2BZX A;  2L2P A;  2QXF A;  3EFO B;  2OTJ A;  4RCC A;  1HJD A;  2Y4Y A;  1VQ7 Q;  1YJN T;  4FYV B;  4Z88 A;  2JJ1 A;  3I55 A;  1K9M U;  2F2X A;  2JT4 A;  4BE0 A;  1LJO A;  3AVY A;  1M9S A;  4HXJ A;  1YI2 Q;  2X4Y A;  1WSR A;  2X53 S;  4G1B A;  4FYY B;  2DM1 A;  3PVD A;  3THK A;  2NLU A;  2C0O A;  5IXF A;  3CC2 A;  3W5V A;  1E63 A;  3PIO A;  1QGZ A;  2KI7 A;  2XZL A;  4J8O A;  1D0Z A;  4CQJ A;  1X27 A;  2PNI A;  3ZBD A;  1Y57 A;  3CCV T;  3X24 B;  1YLO A;  1NBM A;  1N06 A;  2D3N A;  4DNT B;  1MNE A;  1GL5 A;  5C6S A;  1GAW A;  1Q81 U;  3CD6 A;  3P8D A;  4C8Q B;  2R5M A;  4XNF A;  3CCM Q;  1YJ9 Q;  5FRN A;  4B9X A;  1VQK T;  1W2B P;  3DLM A;  1WOR A;  1VQL T;  1T3L A;  3EG9 A;  1H85 A;  3C4S A;  1JXM A;  3RMS A;  1PG5 B;  1X2Q A;  1XQB A;  1UD2 A;  2QA4 T;  4G6I A;  4B3G A;  1DDI A;  4X0C A;  4NL2 A;  1QMC A;  4HCZ A;  4Z4Z A;  1V1C A;  1OOT A;  3L2U A;  2OBT A;  1FMV A;  1SF9 A;  5M9O A;  1ABQ A;  2J7I A;  1QVG S;  2RK1 A;  1IZ6 A;  1NPP A;  1D1N A;  4ORZ A;  2RJD A;  3G4S B;  2JZ2 A;  2KK4 A;  3A98 A;  3U6B A;  1VQL A;  1T5E A;  2MMP A;  1PJ7 A;  1YIJ T;  5GAN f;  4BE1 A;  1NLO C;  3H8Z A;  3LH5 A;  4RD1 A;  2AIR B;  1YWO A;  2AHJ B;  2MPX C;  3X28 B;  1OB0 A;  5LJ5 d;  2QAS A;  2CH4 A;  2WSF E;  1KJZ A;  1V29 B;  9ATC B;  2YUN A;  1WIE A;  4FYX B;  1C0M A;  4J9H A;  1VQK A;  1D0X A;  2QTX A;  3PFS A;  1BI0 A;  4C8Q F;  3A8O B;  3VRZ A;  3QFR A;  1PSF A;  4OB3 B;  2JN9 A;  1WDX A;  4L6V 5;  3CRZ A;  3G6E B;  3W2I A;  1QCN A;  1DJ7 B;  2BZY A;  1Y7X A;  1UGQ B;  1WNL A;  3M0U A;  2RMO A;  1U5S A;  4QFM A;  1A8P A;  4QQG A;  3EG9 B;  1UDL A;  3GIB A;  2KEA A;  5I11 A;  1TVC A;  2MWP A;  4JZ4 A;  1B07 A;  1RLP C;  5AT1 B;  1HYO A;  2CP6 A;  1YNZ A;  3S6W A;  3OYN A;  3ONU A;  4MDW A;  3A35 A;  2J06 A;  2A0F B;  4P1V A;  4JUV A;  4P5N A;  3H0F A;  1G3T A;  3VO2 A;  2COW A;  1PKT A;  2JVV A;  4RTZ A;  5IYQ A;  2EFG A;  3SLN A;  2C4U A;  2XIC A;  1OUL A;  1H8H A;  2OTL B;  1EFU A;  4A53 A;  3CCL T;  1W2B S;  5LJ5 h;  4RTX A;  1M8M A;  4XU3 A;  2IG0 A;  3VS7 A;  1G2B A;  1GCQ C;  3PGG A;  4N4G A;  3SEM A;  4C5G A;  4RDL A;  3WNB A;  3EGX B;  3INZ A;  1WGS A;  2HMA A;  3I55 T;  2V1R A;  4KKS A;  1AHJ B;  1ZLM A;  2PQW A;  3GVL A;  3ME9 A;  1UD3 A;  1T6Y A;  1OGJ A;  4V2S A;  3EFO A;  2JNG A;  2ZBV A;  1F60 A;  4ZN1 A;  3I55 B;  1WQW A;  2RQW A;  3AVT A;  5FU6 C;  2GPJ A;  5KE3 A;  2K4Y A;  3VS4 A;  4II1 A;  1BQE A;  5CIU A;  1N8R R;  1SEM A;  1AD5 A;  5KCH A;  4JJC A;  1U2R A;  3WBJ A;  2EJ9 A;  3CCL Q;  1EP3 B;  4XK8 E;  3CME Q;  1N0U A;  1U3O A;  2YWG A;  3FJ5 A;  3HKS A;  5IYN A;  1M1G A;  1Y96 A;  4RKU E;  2C0I A;  1Z9Z A;  3CBO A;  2LT1 A;  1N5Z A;  5CR2 A;  1YP5 A;  2WSE E;  5J3B A;  2JS0 A;  1WDT A;  4BI4 A;  1Q7Y R;  1UFF A;  5FW9 A;  3VUZ A;  3A1P A;  4TN1 A;  1MV3 A;  4JJD A;  4B47 A;  4EMK A;  1Y71 A;  4OP7 A;  1AMO A;  2PLF A;  2FPE A;  1X6B A;  2A7Y A;  4HT8 A;  1J3T A;  3NE5 B;  2EAY A;  1ELO A;  2ZL7 A;  4Z4Y A;  5CO7 A;  1BX0 A;  4AFS C;  3CQT A;  3LVB A;  3OZW A;  2EGE A;  4ZGN B;  4PAB A;  4ZCM A;  3QHS A;  4FIB A;  1KK7 A;  4KH0 B;  1RQR A;  4OP0 A;  4DK0 A;  4B3X A;  1ACM B;  5GAM d;  3WND A;  3OP1 A;  4AG2 C;  1IHM A;  4G5G A;  4TKO B;  3VMF A;  4QVD A;  5IHK A;  4UZU A;  3R6J A;  1K73 U;  3C94 A;  2EYY A;  3M4Y A;  1VQN Q;  2LNH B;  1WHJ A;  3DLL A;  3CD6 T;  1BMF A;  3CC2 B;  2L3P A;  4QQD A;  1WHH A;  4EMK B;  3MCA B;  2BPO A;  2WYR A;  2Y90 A;  1WHM A;  4Z02 A;  4XTX A;  1B23 P;  5HZA A;  4DA4 A;  3CC7 T;  3VJP A;  3JB9 J;  4G7X A;  3QXE B;  4HKE A;  1K8A C;  5D6Y A;  1H3Z A;  4MML A;  4YAL A;  1TUC A;  2VC8 A;  4XTU A;  1BI1 A;  4F7U A;  2F2V A;  2PVD B;  4M75 F;  5DLQ E;  1G3S A;  2LNV A;  4J7I A;  1EWY A;  1FX7 A;  2BVN A;  2DCU A;  1OU8 A;  2L3S A;  2RB6 A;  1WPC A;  2VVK A;  1VQ4 Q;  5CKE A;  3OMG A;  7AT1 B;  2HBP A;  2PU9 B;  4BY6 C;  1VQ7 A;  4TMZ A;  1VLO A;  2HQH A;  2CSQ A;  4RCZ A;  3JCM J;  2LJ1 A;  5HKC A;  4OGE A;  3V7A A;  4X7E A;  2PVG B;  5IYW A;  4IUV A;  3ZBT A;  1SPK A;  2BV3 A;  3DB4 A;  1Q81 R;  3VYG A;  1TTT A;  1RI9 A;  4PL6 A;  3W2G A;  2DLP A;  3L42 A;  4N0A A;  3JB9 F;  5IHN A;  2K3Y A;  1XNI A;  1RAG B;  3EH2 A;  1OB2 A;  2GFA A;  1VQ7 T;  1X69 A;  5EC7 A;  2XGJ A;  1CSK A;  1N27 A;  2RNA A;  3MCA A;  3FRN A;  2DKG A;  5CQX A;  2VBS A;  3S3O A;  3M55 A;  3ZBU A;  5KYN A;  1YHQ Q;  1M1K C;  2K2M A;  2KQW A;  3EG0 A;  1Y0Y A;  1WHG A;  3Q39 A;  4AFU C;  1AT1 B;  3GBQ A;  2RN8 A;  2CZ0 B;  1V76 A;  1UGR B;  3MEV A;  1ZM9 A;  4FSX A;  3EFS A;  2DIG A;  4M7A B;  3OKX A;  1OZ2 A;  4RD2 A;  1AEY A;  2MF2 A;  4J83 A;  1PC0 A;  4JLI A;  3FKS A;  4PC7 A;  1KC8 U;  1NB0 A;  1D1B A;  2BM0 A;  1KZL A;  2QGF B;  4E2F B;  2M5S A;  3GVJ A;  3M0S A;  4E47 A;  2LTO A;  5GMK i;  3U2Q A;  4B3F X;  3OJX A;  3J7A F;  3CC4 B;  2P0Q A;  1AWW A;  2ABL A;  3VKI A;  5THX A;  3ZPN A;  5H5J A;  4HCB A;  4P3I A;  5LJ5 f;  4TSF A;  1B34 B;  3LGL A;  3I9Q A;  4AG1 C;  1BCM A;  3CW2 A;  1VF7 A;  1GCQ A;  2VWF A;  2EGA A;  1SSH A;  1R5O A;  3M58 A;  3OEE A;  3M53 A;  4RCY A;  4RLZ A;  1RI0 A;  4N3N A;  1TUI A;  4PC2 A;  3M59 A;  2EJG A;  2X3X D;  3MEW A;  5KYY B;  1YIJ Q;  2VNK A;  2YSQ A;  1NJI U;  4M77 E;  1Q86 R;  3GF5 A;  4PFP A;  1VYU A;  3ULR B;  2JJ9 A;  2R5A A;  4AT1 B;  1YHQ B;  4C8Q E;  2JUF A;  3SEJ A;  1KMH A;  5A0D A;  1WOO A;  1KK2 A;  2DJQ A;  2ZIT A;  4YAW A;  3QDF A;  2F4N A;  2Q6I A;  2I2L A;  1TUD A;  3QFT A;  1X2K A;  3W2E A;  1XB2 A;  3AST A;  3SFM A;  2A28 A;  2QA4 Q;  1S72 B;  5KYX B;  2BE9 B;  2DX1 A;  2DIQ A;  4LDX A;  4QV2 A;  4PLL A;  2DZ9 A;  4XON A;  3VRY A;  1WXB A;  3U6K A;  1YJ9 T;  4J9F A;  3M4G A;  4BAC A;  1QVF B;  2VXE A;  3AVX A;  4M77 G;  1B3Q A;  3OFN A;  1QKW A;  1I1J A;  1OU9 A;  1TTH B;  4C0D B;  3G6E A;  2ROT A;  1UGV A;  2DYB A;  1TLL A;  2VB6 A;  1KC8 C;  2QEX T;  4K1X A;  1CNF A;  4DBF A;  8AT1 B;  2E1R A;  1UGP B;  4EMK C;  2HQX A;  2DXT A;  5TV2 A;  1YWP A;  2WPD A;  2O9S A;  1BIB A;  4C8Q D;  4M0L A;  3QZ9 B;  3CBM A;  1N6A A;  1BLI A;  4PFZ A;  3I56 Q;  3B78 A;  3EFR A;  1UB4 A;  2RM4 A;  5CKH A;  5GAN d;  4ZGQ B;  2V8J A;  4XU1 A;  4LC0 A;  1BYM A;  2NPF A;  2EKO A;  3JCM h;  3CPF A;  5FNZ A;  2M16 A;  2RD1 A;  2RHZ A;  3OYM A;  3X25 B;  1UJ0 A;  4ESR A;  1QWF A;  1Q7Y U;  3H41 A;  2LJ0 A;  2C0T A;  1M8V A;  4M75 C;  2QAZ A;  3BDU A;  5IT9 E;  1WI7 A;  3CES A;  2D0Q B;  1WU8 A;  1VQK B;  4ROX A;  4BI3 A;  1EZZ B;  3ZIA A;  2O88 A;  3E1Y E;  5A89 A;  4FWT A;  3CCJ A;  5HY6 A;  3CCV B;  2E12 A;  4EPC A;  2ECZ A;  3LWI A;  2X0K A;  1K76 A;  5GJW B;  2RHU A;  3ZZT A;  4M7A A;  3ZL7 C;  2DVE A;  2XDP A;  4KBM B;  5GMK m;  1FMK A;  3CCQ A;  2KY9 A;  1VQP A;  2WJV A;  4H9G A;  2O4X A;  2VUB A;  4C5H A;  2DER A;  2QQ9 A;  3QYH B;  1TSF A;  2EYX A;  2YDL A;  2DA9 A;  1K73 R;  1VQP Q;  4WZE A;  4FN5 A;  2JJ2 A;  4C92 D;  2C4T A;  4WQM A;  2EGC A;  3I5R A;  2GRE A;  2BE7 D;  1PSE A;  1QVF S;  1D1A A;  2EYW A;  2HLD A;  3C12 A;  2QG9 B;  2KRM A;  3M0T A;  3UT1 A;  4OPO A;  4C92 A;  3OYY A;  4OPS A;  1I8F A;  3R6O A;  2C5B A;  5HK3 A;  4TMW A;  3V7C A;  4OGC A;  4M7D B;  2X4X A;  1W1F A;  3CB4 A;  4NNJ A;  3CCS Q;  3CCR Q;  2HCK A;  2M0O A;  1M30 A;  4LBZ A;  4LDV A;  2ED0 A;  2GQV A;  3E1S A;  4X06 A;  3NTK A;  2LZ6 B;  2YUP A;  2QDY B;  3CME B;  3OYG A;  2XNJ A;  3NFC A;  4HE5 A;  3CCJ T;  4RPD A;  2NWM A;  2MI6 A;  4CC3 A;  2F1L A;  4AVZ A;  2NUT A;  3TEE A;  3MJX A;  1PCX A;  1YFN A;  2FYK A;  4BDY A;  4Z4T A;  1FDR A;  4QT7 A;  3CCU Q;  2XG8 D;  2KYM A;  2ZXI A;  2RK2 A;  2MYS A;  2A08 A;  2D8J A;  1ZSG A;  1OB5 A;  4KKU A;  1VQL Q;  3M57 A;  1VQM T;  5F4M A;  1QGA A;  1GFD A;  1V0F A;  2F69 A;  4XTZ A;  3SWN C;  1QKX A;  2DXC A;  4OML A;  1HSQ A;  1AWX A;  4AFZ C;  1IJF A;  1VHE A;  1D09 B;  2XD0 A;  4NCN A;  2X85 A;  4RG8 A;  2A36 A;  5BSX A;  1JA1 A;  5CKB A;  4YAF A;  2ATC B;  1OHH A;  3LX7 A;  1M4Z A;  1FX0 A;  1Q82 D;  5GAO p;  3E19 A;  5FWB A;  2O31 A;  1VIE A;  2AKL A;  4KUI A;  2XZO A;  1ZUK A;  3RIR A;  1VYT A;  2J6F A;  1PNJ A;  4JS4 A;  1I81 A;  3I56 B;  1KIK A;  1Q95 G;  2V26 A;  2OTJ T;  2PUK B;  3G71 A;  4J9E A;  3NHN A;  4U9U A;  3CCL B;  3L2V A;  1YIJ B;  5CKD A;  1M2O A;  3ASK A;  1G7S A;  4X07 A;  4RD4 A;  1QGY A;  1HD3 A;  3RR6 A;  1ZUU A;  1VQ8 A;  4M77 C;  5LJ3 e;  1W9X A;  4XLA A;  4M75 D;  4XTV A;  5LJ3 j;  1NB9 A;  2DZC A;  2G3R A;  3SJP A;  4Y9U A;  3Q6Q A;  4ZGJ B;  3QBY A;  1M3A A;  4XL9 A;  2WSS A;  3OAA A;  2OK7 A;  4Z89 A;  2ZPE B;  5I2M A;  2E10 A;  4ZCI A;  1R5N A;  1VQ4 T;  5FU7 B;  4HIZ A;  1N9R A;  2KGT A;  4M7A F;  1LVK A;  3VS2 A;  5GAO q;  2CT3 A;  2EQU A;  2V31 A;  4RPB A;  2JW4 A;  3TQ7 P;  3CPW P;  4QVJ A;  4E7S A;  3G4S Q;  1Q86 D;  1U06 A;  5AN9 A;  3QWY A;  3H0H A;  5KYY A;  2WZP P;  2LX9 A;  5GAN 8;  3CCV A;  3CCJ B;  4EDU A;  2CRE A;  2P0K A;  3J80 E;  3UPU A;  4E7K A;  3E20 A;  5EMN A;  2G6F X;  3T51 B;  1VQ8 B;  2IIM A;  4D8K A;  1JJ2 A;  2NYS A;  3BW1 A;  1CNE A;  2YLC A;  3BNW A;  1GFC A;  2GQF A;  4PNO A;  1LOJ A;  3CCL A;  1UHC A;  2LZJ A;  1G5V A;  1WJQ A;  4M4Z A;  3OYE A;  2QQS A;  4C92 G;  4CC7 A;  2FX3 A;  2PMD A;  3S3N A;  3OS5 A;  3KXT A;  4KH1 B;  1AZG B;  4K11 A;  4HE6 A;  1NLP C;  4XN3 A;  1PKV A;  2BZ8 A;  3CC4 Q;  4B43 A;  4J9I A;  2XND A;  3OBW A;  3OJW A;  4J6Y A;  2FO0 A;  2OTL T;  4GQN A;  1RL2 A;  2Q6L A;  2YWE A;  4M7A G;  2JXB A;  4ME7 A;  5TRD A;  1M5Q 1;  3TRE A;  1NJI C;  3FPK A;  4FT4 A;  3MEU A;  3FJO A;  4B4D A;  3JCM c;  3CXC A;  1KHC A;  2GTO A;  4RUG A;  3FPP A;  3IQL A;  2CUD A;  1T6Z A;  5FO0 A;  2GQI A;  2QTZ A;  1BK2 A;  3RER A;  1WTH D;  1MGQ A;  4E0F A;  2LT4 A;  2O9V A;  2RQT A;  4ZN3 A;  1XJW B;  5A2Q E;  2GGR A;  2RH2 A;  3JCM f;  1YI2 A;  2D3L A;  2E1H A;  4OMN A;  4P2N A;  3VO1 A;  1LNX A;  3NGP A;  3JB9 G;  1PJ5 A;  2VYT A;  2H3E B;  2HL5 C;  2M0Y A;  3CCE B;  2R57 A;  2B7C A;  1E6G A;  2FL7 A;  1EIF A;  2VZL A;  2JTE A;  3OZV A;  3WBK A;  2FHD A;  4ZGD B;  3J81 k;  3NPF A;  2MAM A;  3UF4 A;  2ED1 A;  5L8R E;  3V76 A;  3HP9 A;  1YBY A;  5TR9 A;  3GOX A;  4C92 C;  3CD6 Q;  1G7T A;  1JRI A;  1JBM A;  3TVT A;  5GAN 4;  4X34 A;  3BQJ A;  2X3W D;  4G7W A;  3A8J A;  2OK8 A;  1M2V B;  4A54 A;  1W2B A;  3JU4 A;  5LMZ A;  1TS9 A;  2B86 A;  4Y7C A;  4BI8 B;  3RKW A;  3JV3 A;  5CDF A;  3WVD B;  4QHY A;  2DD4 A;  4GBQ A;  5GAN e;  2YLB A;  1VQ9 A;  1GCP A;  1W35 A;  1M90 R;  1WOS A;  5FWC A;  1QVG P;  1VA7 A;  4MZP A;  1KK0 A;  3AGP A;  2CP3 A;  2DL5 A;  4M7D F;  2KE9 A;  2HEQ A;  1PHT A;  5LJ3 g;  4XKV A;  3QPH A;  1N8R C;  4WCI A;  4BE2 A;  1BU1 A;  3EH1 A;  1MMA A;  1OPK A;  2DFU A;  2P3M A;  2K7A A;  4F17 A;  1NG2 A;  3CME A;  3I1F A;  2E1B A;  3CCU B;  4FK8 A;  2VJJ A;  4UAJ A;  5F4O A;  3QII A;  4M77 B;  5FU6 B;  4Y28 E;  3OA6 A;  2DPP B;  1JEG A;  2BF4 A;  3W2H A;  3CC2 T;  3CD6 B;  1ZBJ A;  3M56 A;  3X26 B;  2VKN A;  5L46 A;  3I35 A;  2JTM A;  5IH2 A;  1GBR A;  2VXF A;  1OX8 A;  3GNG A;  4M78 C;  1K9M C;  2BGI A;  2O01 E;  3L2Z A;  3OMC A;  1NJI D;  3ER0 A;  2EIX A;  3CTA A;  3R6K A;  5D6X A;  3UA6 A;  2HSE B;  4EMG A;  1H8E A;  2L8D A;  4XTY A;  3OZU A;  2ENM A;  3VU3 C;  3OYF A;  2PVO B;  2GK7 A;  1YHQ T;  1X75 C;  1JJ2 S;  2QI2 A;  2VAS A;  3EGU A;  1IB8 A;  4P26 A;  1R0C B;  5I21 A;  5LL6 S;  4UZE A;  4XLC A;  1D3B A;  4M77 A;  2DL3 A;  2J6O A;  2V7W A;  4JMQ A;  4M7D C;  4YEL A;  1XTD A;  2FZC B;  1D2E A;  1EXM A;  3TU4 K;  4PJO G;  3V7R A;  4F04 B;  1KK3 A;  3PEN A;  4RD3 A;  1DDG A;  2FG0 A;  5A0G A;  5HCK A;  5CAI A;  4MYU A;  4XU0 A;  1N05 A;  4C92 F;  4FW1 A;  2DET A;  4A63 B;  3M0R A;  2DEQ A;  2IVW A;  2OAU A;  2XU8 A;  5GV8 A;  2RI3 A;  1D8T A;  1E6H A;  1U1T A;  2GJK A;  1E1Q A;  3D26 A;  1H3H A;  1UE9 A;  4MMK A;  3MMP A;  2AKK A;  2J05 A;  3CCM A;  1ZHI A;  2ZZG A;  5A0L A;  1SKU B;  4FT2 A;  4XAX B;  1LCK A;  1VQK Q;  3EGD B;  1VQ4 A;  5LJ5 g;  2ZZE A;  5GAM j;  2ZL6 A;  1OQK A;  1QVG B;  4PK4 A;  4O6J A;  3MKD A;  4TT3 A;  2WSC E;  2CP2 A;  3EGX A;  1VQ9 Q;  4LDY A;  1O9S A;  3SWN B;  1ZM2 A;  2E4H A;  1Q82 U;  4RD0 A;  2FZK B;  1AIP A;  1B7T A;  1ARK A;  3ASR A;  2LQ8 A;  1PD0 A;  5DM7 R;  3CCU T;  2LCL A;  1WXU A;  1G7C A;  1MMD A;  2D9R A;  2E6N A;  4O5V A;  4EH1 A;  3CC4 A;  4D6W A;  1JNY A;  1X43 A;  2QDL A;  1I0C A;  3AVW A;  2DE0 X;  2X3U A;  4IW3 B;  3CCR T;  4FU6 A;  1XE1 A;  2JIZ A;  2KMT A;  3AVV A;  4ZTF A;  3HTR A;  4M78 E;  4PFO A;  4P25 A;  4X9D A;  3CCS T;  1ZA1 B;  5HK0 A;  1LPL A;  3ASQ A;  1D1C A;  4C8Q A;  1Q7Y D;  3G7Z A;  3GIR A;  4XLE A;  4XOP A;  1M1K R;  2B5O A;  2OTL A;  1RAD B;  5LJ5 j;  2YWF A;  3L2R A;  1H64 1;  4HVV A;  2C2W A;  2LQN A;  3OOC A;  2CSI A;  3JCM g;  4XQ3 A;  3Q6R A;  1MUZ A;  3FIF A;  4JRQ A;  1HA3 A;  3AT1 B;  3L2W A;  4M77 F;  3QFC A;  5GMK l;  1OEB A;  4XOT A;  2AZV A;  3W5H A;  1N07 A;  3A8K A;  1FND A;  1KQ2 A;  1W34 A;  1Y96 B;  3G4S T;  2GNC A;  4AMC A;  2Y4X A;  4X8I A;  3O8V A;  4DEX A;  1FNB A;  5TY0 A;  1E64 A;  1X6G A;  1N8R U;  3CMA T;  2RQV A;  2K3B A;  1MHN A;  1JQQ A;  1YIT T;  1I7P A;  4IKF A;  3AHU A;  3V8J A;  4D8D A;  4RTU A;  1KG1 A;  1RQP A;  2C06 A;  4BUG A;  2CND A;  4L59 A;  3CEY A;  4Y9R A;  4RTW A;  4M7A D;  5KNL A;  4KGX B;  2X9H A;  2V7T A;  3OYC A;  3JCM P;  3PUM A;  3OE7 A;  4AFQ C;  4F7U E;  4J9B A;  3P27 A;  2QQA A;  4F7U G;  1Q86 C;  2EIF A;  5LJ3 f;  1VQ9 B;  1W4S A;  2C78 A;  3VUB A;  1VQM B;  3HRS A;  3GP8 A;  1K8A R;  1VHO A;  3N5B B;  4PJJ A;  4OMF B;  2XZP A;  4WZT A;  3JCM d;  2FPF A;  4J0Q A;  1YJN B;  1M2V A;  1BX1 A;  1GJR A;  3PT9 A;  1KD1 U;  1XQH A;  1RAE B;  4IUU A;  2X8K A;  3OQ5 A;  1R0B G;  3CPW A;  2VNH A;  3RBB B;  4PGO A;  4M75 G;  1WP6 A;  4OOS A;  3OW2 A;  3OW2 S;  2RHY A;  5GAM g;  2VGN A;  1EFR A;  5KYW A;  2FPD A;  4HCC A;  1PJ6 A;  1VQO A;  3EAE A;  3CCR B;  3A8I A;  5FLX E;  1ZSZ B;  2YRV A;  1QVP A;  1JB0 E;  2F2W A;  1AOJ A;  1VQO Q;  2D8H A;  4AF7 A;  1M90 C;  4B6M A;  2DRK A;  2ZGW A;  1WOP A;  5GAN 5;  3OS1 A;  4ACB A;  1WA7 A;  4Q5W A;  2ZXH A;  2K5L A;  4OF1 A;  2EQI A;  3HRT A;  4NBS A;  2HD0 A;  3JAM E;  1QWE A;  2JN0 A;  1N9S A;  3JCM W;  1MV0 B;  3TCJ A;  1N0V C;  2DXU A;  1F1B B;  2QE7 A;  4E7J A;  5GAM e;  1UJY A;  2KXD A;  2JOY A;  2JM9 A;  5LJ3 h;  4HT9 A;  4ELY C;  1IO6 A;  2LX7 A;  3M0Q A;  2MCN A;  1VQ4 B;  2EQJ A;  3FLG A;  1M27 C;  3HAG A;  4KGZ B;  3GPL A;  5GAM h;  1O75 A;  1E62 A;  3UA7 A;  4PJN A;  3M9Q A;  2DL7 A;  4JDS A;  1Q86 U;  5CCA A;  3OYL A;  2ZPB B;  1S4M A;  4J9G A;  3VS5 A;  1W6X A;  5FU7 C;  4LXC A;  2QTL A;  2BUD A;  1KQS P;  4F7D A;  1QFJ A;  1KD1 C;  4IIO A;  2W6J A;  2KT8 A;  4LBW A;  4BD3 A;  2ROL A;  1PWT A;  2K79 A;  1FNC A;  4P6V F;  2Z0W A;  2L3R A;  4M75 B;  1QFY A;  2RJE A;  4LNP A;  3SD4 A;  3L1A A;  3MPU B;  3CMA A;  3RDV A;  1UMK A;  2GJP A;  3PTA A;  3PMT A;  4M7A C;  1K8A D;  1IRX A;  4XR6 A;  4PAA A;  3BCF A;  4X05 A;  3W5U A;  4J9C A;  1D0Y A;  1ZSZ A;  4ASU A;  3OW2 B;  2EYQ A;  5DY9 A;  3VS0 A;  2COY A;  4IUR A;  2JDI A;  3FEO A;  5D6W A;  3DDY A;  2V1Q A;  4M7D D;  2NUP B;  4GY5 A;  3JCM V;  3A8G B;  4B44 A;  2R58 A;  4TMX A;  3LLR A;  2JMA A;  2MWO A;  4C43 A;  2K6D A;  2QK0 A;  2LRQ A;  4R56 A;  1KTV A;  4LUE A;  4JRI A;  1KQS S;  2LCS A;  3JCM e;  2I0N A;  4RTY A;  5IN1 A;  2PTK A;  1K73 C;  3CP2 A;  1IB0 A;  1G7R A;  2RJC A;  4PJO E;  4YAO A;  3CP8 A;  3C0C A;  3QSY A;  4AF6 A;  3A8L B;  4C5I A;  1NEG A;  3MP8 A;  4DQ2 A;  2B7B A;  3QZ5 B;  2ZPH B;  1I5O B;  1NZ9 A;  1GXI E;  3LGF A;  4FYW B;  4PLI A;  2HDA A;  3REA B;  1ZUY A;  4QVC A;  2L5Q A;  3I56 A;  4JJN K;  2EWN A;  2HAX A;  3H6Z A;  2K2V A;  3VS3 A;  3A8M B;  1YIT Q;  1VQ5 Q;  3A3G A;  3PVQ A;  3SWN A;  1VQM A;  1JJ2 P;  3ASS A;  1ZM3 A;  4PJO A;  2RHI A;  1VQ6 B;  2M02 A;  3JCM b;  1VQM Q;  2E3I A;  3JB9 I;  2CW5 A;  1DAR A;  1M1K D;  2JMC A;  2LJ3 A;  2K57 A;  3F70 A;  4DEY A;  1WX6 A;  3SLD A;  4M78 A;  1WQ7 A;  3CC7 Q;  4RDK A;  4CRI A;  3CBP A;  5IYP A;  4RTT A;  3H94 A;  3OYI A;  4M4S A;  1BCO A;  4M78 D;  1K9M D;  1NYG A;  1RAI B;  4R0K A;  3CCJ Q;  4XTW A;  4XLF A;  4Z4W A;  2NUP A;  4M78 G;  4J9D A;  3OYA A;  3OS2 A;  1VQ8 T;  2OTL Q;  1QUF A;  1N08 A;  3ZFJ A;  1ABO A;  2LDM A;  2YRD A;  5GAN j;  3D7S B;  2RF0 A;  3QYG B;  1WYX A;  2A3L A;  3TSW A;  2PE3 A;  2E70 A;  4XOR A;  4R71 A;  1UTI A;  2RHX A;  1VQ8 Q;  5EG2 A;  3EG1 A;  1ZM4 A;  3UAT A;  4LDU A;  1S1N A;  2E41 A;  4XM3 A;  2AZS A;  2CZ6 B;  4ZNX A;  4JPB W;  1G8X A;  1CQX A;  5I22 A;  1ZUN B;  1KFZ A;  4YEJ A;  4FCY A;  1H42 A;  2K5F A;  4FL6 A;  4E7Z A;  1QLY A;  1A0N B;  5C0M A;  3SHW A;  1VQ6 Q;  4IUQ A;  4M7D G;  4RMO A;  3JQR A;  2RI2 A;  1WLP B;  2B8A A;  2XOK A;  5FRO A;  1AWJ A;  1YCY A;  5HZB A;  2LQK A;  2COZ A;  4P12 A;  2Z6B D;  4IUT A;  1VQO T;  2VYQ A;  3WQZ A;  4PJO F;  2R6H A;  4KT0 E;  1GRI A;  4XLH A;  4QVZ A;  1YIJ A;  3HSB A;  1VIF A;  2OBS A;  3PIP A;  5GV7 A;  4DK1 A;  2L89 A;  4BPR A;  4RM0 A;  1IRE B;  5FIU A;  2P84 A;  2VV5 A;  2P0P A;  1JJ2 B;  2BM1 A;  1IXD A;  2BTT A;  4TVR A;  2QTV A;  4HVW A;  1C1A A;  2VBT A;  2EW3 A;  1W0J A;  5E6T A;  2KRS A;  1AZE A;  4J6W A;  2EPD A;  2E3H A;  4DBR A;  4L8J A;  5GMK e;  3I5S A;  3ISX A;  3U23 A;  3RY8 A;  2MIO A;  3NTH A;  5GAN 7;  5GAN 3;  2GBQ A;  2VBV A;  4M75 E;  2ZZF A;  2WR8 A;  2CT4 A;  3QKJ A;  3RUX A;  1P92 A;  2DNU A;  3EG3 A;  3DB3 A;  2GK6 A;  4P9S A;  1OYX A;  3RMQ A;  1VQN B;  3CCM B;  2F43 A;  3BE3 A;  1Q82 R;  1H92 A;  2RQR A;  3PA1 A;  1K9M R;  2KNB B;  4PKC C;  1WZO A;  2MOX A;  3G71 Q;  1Q82 C;  3T9N A;  5CK9 A;  2QEX Q;  1IJE A;  3QUI A;  2V7V A;  4C0D C;  5FO1 A;  4LDW A;  3CMA Q;  5H59 A;  3DKM A;  2F5K A;  2LP5 A;  3ZEH A;  2PZ1 A;  1YX2 A;  1UD8 A;  1KD1 R;  3VYH B;  3M5A A;  2BIV A;  2RC5 A;  1FMW A;  1FYN A;  4Y92 A;  5KE2 A;  1UEB A;  2OBR A;  1ZSZ C;  3VNV A;  4ANJ A;  2OAW A;  2CZ7 B;  2M51 A;  1M3B A;  2AHO A;  3P26 A;  5B6I A;  3PVL A;  2AK5 A;  5FRM A;  1G83 A;  4MZM A;  1WJS A;  1YJW Q;  1K4U S;  3FJP A;  1S72 A;  3G05 A;  2V7U A;  2A37 A;  4L5G A;  2X4J A;  2DTO A;  1QQJ A;  3BY2 A;  1KQS A;  4OMO A;  3ZZ0 A;  1T3S A;  2FZG B;  1K0S A;  2YUQ A;  4A4G A;  2EYZ A;  2LCC A;  1WHK A;  1W87 A;  4ZV4 A;  1VLY A;  5GMK h;  3MO8 A;  1SSF A;  2F1M A;  3VS1 A;  1PM3 A;  2CZ1 B;  2QGG A;  4A4K A;  1KHI A;  4Z4U A;  1VOM A;  4N4H A;  1E3X A;  2ZZD A;  2JM8 A;  3CCS B;  4F14 A;  4PJM A;  3BFM A;  4RD6 A;  4RCB A;  1K28 D;  2NUZ A;  1I4K 1;  2EVR A;  3V8L A;  1M1F A;  2P4T A;  2D1X A;  1JU5 C;  1B34 A;  4MYT A;  2FEI A;  2V8I A;  1IGU A;  4QUZ A;  2RI5 A;  2CDT A;  5IAY A;  1YJW B;  5HKK A;  1ZX6 A;  3HFN A;  1FXX A;  4HA8 A;  1D3B B;  5CQY A;  2RC6 A;  1GR1 A;  2HBW A;  3PE0 A;  4IUP A;  4ZCL A;  1UD4 A;  3QE2 A;  1GBQ A;  1AWO A;  1NBE B;  4ELZ C;  2E6Z A;  2DBK A;  1WSV A;  4X7F A;  4IIM A;  4UC4 A;  5KW9 A;  2XK0 A;  4NL3 A;  3A3B A;  3E9G A;  1N8R D;  4F7U F;  4RTV A;  2CGH A;  5GMK j;  3Q1J A;  2X6X A;  2XEX A;  2ESW A;  1UEC A;  3OSV A;  3CCV Q;  4Z4R A;  1BI3 A;  4Z4V A;  1QG0 A;  2HNI A;  1Q81 C;  3CPW B;  3QDR B;  3BY1 A;  3MHX A;  1OPL A;  3MEA A;  3FC3 A;  2D74 A;  5J35 A;  2LQW A;  1HK9 A;  1KD1 D;  2RO0 A;  3CXC S;  2V7Q A;  3KBG A;  2FVG A;  3LNN A;  4C0S A;  1SM4 A;  1YHQ A;  2X35 A;  2KSS A;  1TH7 A;  5AYF A;  3KUF A;  4X1V A;  2GFU A;  5LJ3 d;  5KYU A;  3NMZ C;  1M3C A;  1CKB A;  3ONY A;  5KYX A;  1QUE A;  1WFW A;  2O2O A;  4DNR B;  2VGM A;  1EFN A;  2HQE A;  3M0P A;  4A4F A;  1S72 Q;  5DS0 A;  3CXC B;  3CCE A;  2Q6O A;  4B48 A;  5HXB A;  4OMM A;  1QW1 A;  1RAA B;  1VQP T;  3OEH A;  3BDL A;  2KT1 A;  1FWZ A;  1COW A;  4Z1M A;  1IGQ A;  8ATC B;  4TMT A;  2GCX A;  4RG2 A;  3SB2 A;  2WZN A;  1KSW A;  1M1K U;  2E5K A;  2K3X A;  1M90 D;  1PD1 A;  1EX4 A;  2CBX A;  3NTI A;  5GAM f;  3VNU A;  1XOV A;  4II3 A;  4OVA A;  3LH0 A;  1H8K A;  1VQN A;  1MND A;  1KK1 A;  1WXT A;  1JO8 A;  3LYI A;  5A8A A;  4J6X A;  3R6N A;  1BKB A;  2QA4 B;  3KEW A;  5ECA A;  3RES A;  4Q7J B;  5DN6 A;  3V7S A;  4BY6 B;  3OY9 A;  1NDH A;  2J7K A;  3ES9 A;  4CI0 C;  4WTO B;  4JJB A;  3OBY A;  2W10 A;  2DRM A;  1RAF B;  5CKF A;  1QX4 A;  2DJZ A;  4A4H A;  3S3M A;  3OSS C;  3GLX A;  2XDD A;  1BJK A;  4C8Q C;  2CUB A;  2V4D A;  3QJ6 A;  2K9G A;  1EFT A;  4RJL A;  1QP3 A;  2X51 A;  1SHG A;  2LMJ A;  4QW2 A;  1Q7Y C;  4C92 B;  1UGS B;  4B9W A;  1C6V X;  2HZY A;  4QQ6 A;  5JBQ A;  1ZBX A;  1E79 A;  2YRC A;  1NJI R;  4LN2 A;  2BKD N;  2E5Q A;  4M53 A;  4M78 F;  4VUB A;  1MMG A; 
#chains in the Genus database with same CATH homology
 3HTR A;  1PM3 A;  2QGG A;  2F1L A;  2DOG A;  2DYI A;  3A1P A;  3H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...