2QGGA

X-ray structure of the protein q6f7i0 from acinetobacter calcoaceticus amms 248. northeast structural genomics consortium target asr73.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
b'NVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPWYIETKAGWQTVDVKRWKPHGKGLVVSLKGVSDRTGAESLVASNIWIAKSQLPKADVDEYYWSDLKGLTVLGLDDEEQEVNLGQIHELFETGANDVMVVRATPDSIDSEERMIPWHKDVVQRVDLEAGRIYVNWGVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA-processing protein rimM
molecule tags Structural genomics, unknown function
source organism Acinetobacter calcoaceticus
publication title X-Ray structure of the protein Q6F7I0 from Acinetobacter calcoaceticus AmMS 248.
rcsb
total genus 41
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2007-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2qggA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2qggA01
2DOGA 2F1LA 3A1PA 3H9NA 2DYIA 2QGGA 3HTRA 1PM3A
chains in the Genus database with same CATH superfamily
4XNFA 4XTUA 1VQPT 2QEXA 1HZEA 1VQOT 1Y0YA 1D3BA 1K8AR 5KE2A 3EGXA 2HKNA 5FRMA 2CT4A 2CSQA 4B6MA 4C92B 5IXBA 1X6GA 1YJWB 4PJOA 5I2SA 2KQWA 1PD0A 2JJ2A 3SJZA 1T0JA 2QMUA 3NFCA 4RD2A 1M2OA 3RMSA 2MF2A 1YJWQ 5J39A 2W0ZA 2X0KA 1HXDA 4Z89A 1N0UA 5M9OA 4FSSA 2A36A 1WHJA 1RAGB 2GGRA 2QEXQ 2C2WA 1RADB 4HT8A 1I07A 3PA1A 1K73D 4RTVA 4ESRA 4AVZA 3CCSB 1GBQA 1VQ5B 2RA2A 5HCKA 1WQ7A 4X7CA 4PFOA 2QDLA 2ZPFB 3I56T 1Q81U 3CCLQ 5LJ5f 4FXUA 2AK5A 3WBKA 1KK3A 5I22A 3QYGB 3FJPA 1M1GA 3JV3A 2JNGA 1Q82C 4ZCLA 4ZGNB 2KROA 1E62A 1OU8A 4M78G 3CCJA 1LNXA 3G6ET 4OOXA 4YAWA 4L59A 3CCMB 1I81A 5CR2A 1YITT 1AWXA 2K2VA 4ZCIA 2VASA 2LZ6B 3SD4A 5L23A 4XL9A 4XONA 1K8AC 1H641 2QQBA 5A8AA 3M0TA 3ME9A 1AZEA 2L0AA 2G3RA 3OYLA 1VQMA 4LBVA 3EG9A 4LXCA 1BCOA 2HDNB 2P3MA 5CKHA 4KULA 1I0CA 3SEJA 3V8KA 1S72T 4YAUA 1Z9QA 3FIFA 5JBQA 1MGQA 7AT1B 1TU0B 4QUZA 2KR3A 4M7AD 1ZSZA 4C5HA 3L42A 2RH2A 3MEUA 2CH4W 1QP3A 5IAYA 5GANd 2ZL5A 1NB9A 2MPXC 1KQSB 2CH4A 1EP1B 1WXBA 2PVDB 4OOSA 1H8EA 3PA2A 3MP8A 5TRDA 3M0SA 3HP9A 5GAMj 4JZ3A 1NLOC 3DB3A 4N3GA 2CP3A 2QXFA 1X01A 3GNGA 2QYZA 2FZKB 1SSHA 4C8QG 1QLYA 4OB0B 2A7YA 4G1VA 1PSEA 3OA6A 1PWTA 2B7CA 4M7AE 1E6GA 4ELYC 4A4FA 1TXQA 1BI1A 1VUBA 3JCMV 3NMZC 4MDXA 2WR8A 5HKKA 3A8KA 2X3WD 1JB9A 3CP2A 3LH0A 3OQ5A 3GOXA 4C0ZA 2AKKA 3ISXA 1Z9ZA 1K4US 5TR9A 2E1HA 4F14A 5H59A 1GAQA 3J7AF 3CMEB 3V7SA 3G4SQ 3CMAT 3GNFB 1BLIA 3CXCP 4M1KA 2SRCA 3R6JA 3EGDB 1QG0A 1AZGB 1N5ZA 2O9VA 3M4GA 2HL5C 4JLGA 3X26B 2WSSA 2MWPA 4ZGJB 3PMTA 2OTLT 1Q82U 2CRVA 3V76A 1OPKA 4P6YA 2P0QA 1YJNA 3PIPA 2LNHB 2E1BA 3CCMT 4UZUA 2VNHA 2FPEA 3I55Q 4UZFA 1Y71A 2ENMA 3CCVA 5CK9A 5GAMh 5A0GA 2XGJA 2RK2A 2ZZDA 2H3EB 1YIJQ 1OX8A 5I11A 2XD0A 3GF5A 2DTOA 2VYTA 1W0KA 1ELOA 2VYQA 1NBMA 2I1LA 1HJDA 3HFNA 2GFAA 4PJOD 4OGEA 3CCEB 3X20B 2RQWA 3BDUA 2Q6LA 1ZLMA 2DIGA 3CC4T 3OYBA 1KZLA 2LVMA 2IVWA 1QVPA 5KYUA 4C43A 4XOTA 1KQSP 1KD1U 3HKSA 4A53A 4C8QC 1P4MA 1I4K1 2G6FX 1ABQA 5LJ3j 1D0ZA 1QQJA 3OW2A 3CCVQ 2R9VA 3CD6A 1GCPA 2YRCA 2VNJA 3J81E 3TVTA 4OMOA 4CQJA 2OTLB 3NGPA 1XJWB 2E64A 3OZVA 2DD5A 1VQMT 1BJKA 3WXMA 2DBMA 3UATA 4M7AC 4AFUC 1UD6A 1YI2Q 3AGQA 5GAOr 4PJJA 1SF9A 4G1BA 4CC3A 5FA6A 2V7WA 3V7AA 1GFDA 4MMKA 3OS5A 1X43A 3NE5B 1FRNA 2YRVA 3X24B 4B9XA 2KDSA 3OYNA 1IHVA 3W2HA 3H0HA 1YJ9Q 4E7LA 1Q86U 4WZTA 1GRIA 3CD6B 4HKEA 3CCQB 1TG0A 1KC8U 1C0MA 5IYWA 4WZKA 1UG1A 3MEVA 2HDAA 2PMDA 2J7KA 1VQ7A 1IGUA 3E2UA 1WP6A 1LCKA 1M5Q1 2XI9A 2OBSA 1VIEA 1G3TA 3LH5A 4MYUA 4M77A 1M90C 2XU8A 3OYMA 2J6FA 1KMHA 3Q39A 5GMKe 5LJ3d 1VQNT 2BPOA 2IPOB 1I8FA 2CZ7B 2Y90A 3R6OA 4D8KA 1T6XA 2X51A 3VYHB 1MABA 1SKQA 1R5NA 1LJOA 3AVXA 5GANh 2X4JA 3JU4A 3SLDA 3CC7B 4RD0A 3CC7Q 2YUQA 3I55T 4RTUA 2GTJA 5HXBA 4RDLA 4ZTFA 4G6IA 1EZZB 2X9HA 2WZPP 5LJ3e 2PU9B 3QE2A 1Q7YR 3AVVA 1K76A 2DYIA 2YXYA 3RKWA 1FX0A 4YALA 4ROXA 2F4NA 3GIBA 2YSQA 5CKEA 5IYQA 1VQLA 3RERA 3CBMA 4C0SA 1VQ5Q 2Q6KA 1WDXA 4M77E 3QFTA 1IB8A 4GBQA 5FNZA 2DMOA 1YITB 3A35A 5KW9A 3Q6QA 1U5SA 5CCAA 1XNIA 2CZ1B 4C92F 5GAMg 2JOYA 3U6BA 3CBOA 5FU6C 2EGAA 1Q7YU 2KI7A 4J7FA 1VLYA 2DL5A 2W6IA 4K1XA 3X25B 1QVGA 1KK0A 4E7HA 5KYYB 2JIZA 2J7IA 3T9NA 4LBYA 2VNIA 5GAN2 2J05A 3S3MA 2F69A 5A89A 1CKBA 4TMVA 1W4SA 4MZMA 1D8TA 4XMYA 2E12A 2V7TA 1NPRA 1EP3B 4CRIA 4QHYA 4EMKB 1WGSA 2ZXIA 2QDYB 4J8OA 3ZUGA 2MMPA 1NJIC 2PVOB 3CPWP 1K8AU 2XNJA 2DXCA 3CCSA 3I5SA 2JM9A 3PENA 3L2RA 4F17A 1BX1A 2QASA 3CMAA 3VS6A 1GBRA 4NNJA 1GR1A 1OZ2A 2DRKA 2ED1A 1EFRA 3OZUA 5F4MA 3EG9B 3JB9I 5FW9A 1VQ6A 1EFNA 2AKLA 1VLOA 1UD2A 5L46A 4IUPA 4C8QB 2V31A 2RHUA 4DA4A 4P22A 3GVKA 1E43A 2NV4A 3QKJA 2PQWA 2QA4B 2DVJA 2NUTA 1ZSZB 2NUZA 5HK0A 3A8MB 4X8IA 1MV0B 2QQSA 4HCCA 3SKBA 2RJFA 2K3YA 4JRIA 3RIRA 1VQ8T 1KRHA 4JRPA 1N8RC 3VNUA 1M27C 1NZ9A 1BMFA 4N4GA 4PJLA 3SWNC 4Y9UA 4IUTA 1PD1A 4P1VA 4ZN1A 2RK1A 1TLLA 2QI2A 1M3BA 2DL8A 4OPVA 5GJVB 1G7TA 2ZL6A 3F70A 4E7ZA 4KH0B 1KJWA 8AT1B 2K5FA 1V1CA 2EQKA 4ME7A 4PLLA 4Q7JB 3CC4Q 1M1KU 5HKCA 4BACA 3VUZA 2WYRA 4XQ3A 3OYHA 1Q86R 3CCJB 2C5HA 2R5AA 1UGPB 4F7UA 2PNIA 4LUEA 1ZM9A 3U23A 2EKOA 3ZBDA 4OPSA 1W0JA 4TN1A 1WIEA 3M53A 3MMPA 2NYSA 1QVFB 5IHKA 1VQKQ 2PVGB 5GAOq 5KSWB 1ZHIA 3JCMX 2BM0A 4C5EA 1B7TA 2CS7A 2CZ0B 2E70A 4XTYA 1I1JA 3M0RA 1YFNA 2RMOA 5KH6A 3QWYA 2EQJA 3OYIA 4B3FX 3EFOA 2ATCB 3CPWB 3ASSA 1Q81D 2DO3A 2KNBB 1X27A 4RD1A 3CMMA 3G4SB 1QFYA 1JJ2P 2Y4XA 3QG1A 2X8KA 3ASTA 1K9MD 2WSCE 1VQOQ 2RHZA 5J3OA 4N0AA 2ESWA 4F7UG 5GAN5 2L5QA 2JS2A 2R5MA 2RHYA 3OYCA 3G6EA 2VXFA 1VQPQ 1NRKA 3QDFA 1IJFA 2CF4A 4PLIA 1PJ6A 5IN1A 1FNMA 4HE6A 3QJ6A 2DXBA 1NDHA 3FPPA 3MPUB 2XEXA 3EG1A 1PRLC 4J6XA 4QW2A 4HVWA 3H41A 3LQ6A 1VQ9Q 1BCMA 1VQ6Q 1YCYA 1RL2A 1VQ9B 4PFZA 2C06A 5GAN7 4ZGDB 4RTWA 3A8IA 3E20A 4TMZA 4FYWB 2FEIA 2EYYA 3LGLA 3M0PA 4ANJA 2VBSA 2W10A 1ZA2B 2ZBVA 1AT1B 1WJQA 2KT1A 1KQSS 3TSWA 4NOYA 4RJLA 1UB4A 4NL2A 2LRQA 4FCYA 3UF4A 2CDTA 1VQNB 4XD7A 1YJ9B 3E1YE 1E3ZA 3NPFA 1HVXA 2CYZB 1UGSB 2MI6A 1VQLT 2LNVA 2K7AA 3DLMA 1C6VX 2EGCA 2CT3A 2LTOA 3GVJA 3O8VA 2COZA 2JJ1A 1WHLA 1AWOA 1K73U 8ATCB 5LL6S 4AFZC 2K6DA 3EFRA 2VZLA 2D8HA 3LWIA 1NM7A 1I5LA 3HRUA 4PAAA 2FX3A 3V7CA 4A54A 1Q86D 3KXTA 3CMAB 4JJBA 4XTVA 1FMWA 4PJOB 2CC2A 1ZA1B 1ZQ1A 1JBMA 1W1FA 1M90R 1VQLQ 2DOGA 4ZV4A 1YJ9A 4JZ4A 3PMIA 4Z4UA 1JJ2B 4M7DB 4J7IA 2LT1A 3QBYA 3FEOA 2NUPA 1N07A 2XG8D 3KBGA 4AMCA 1GL5A 4KBMB 2DVEA 1WORA 3REAB 4OP7A 4P3YA 1P92A 1MMNA 3JCMP 3P26A 3JB9H 4KKTA 5THXA 4HCZA 2K5IA 1XTDA 1YJNT 3CCMA 3VJPA 3ASRA 3CRZA 1VQOA 4D6WA 2RC5A 4IW3B 1QVGB 2ZPIB 4J9IA 2OTJA 2QTVA 4PKCC 5CDFA 2L2PA 1UTIA 1BBZA 2HSPA 1PRMC 2VGMA 1JJ2A 1VQ6T 1U1TA 2DIEA 4BY6C 3OS1A 2C0TA 2FHDA 1WXTA 4M75D 4JJNK 4J9BA 4DOVA 4MYTA 2GQVA 2P0KA 4JRQA 1KD1R 4QVAA 4GLKA 3QFCA 4D8DA 1M1KC 5GANf 2ZXHA 2D9TA 2RI5A 2HLDA 2DXTA 2DTHA 1DDGA 4M4SA 1N05A 2YRDA 4TT3A 1D0XA 3CCET 3HTRA 2HQEA 1GXIE 1KTVA 4PABA 2C0OA 1D09B 3I56B 5IYNA 4M77C 3L2ZA 1FMKA 1UUEA 1BI2A 2X4XA 2CK3A 2GJKA 3OW7A 2CKKA 3OYFA 2KAFA 2XNDA 4P6VF 5CKFA 4JDSA 1W2BP 3G71T 1IXDA 1JXOA 3CPWA 2V7QA 5FL7A 4MZTA 4RDJA 2BTTA 3A98A 3C4SA 1WZOA 4FK8A 1JNYA 2Z0WA 1LOJA 2CNDA 4A4EA 3CCJT 3JCMc 1OB2A 2AZVA 4AFQC 3CCQT 1VQ7T 4Z02A 2JMCA 4L6V5 1QX4A 1RAHB 1H8HA 1OX9A 4RMOA 4DOWA 4ZNXA 1B23P 1QKWA 4M78A 3NTHA 2B8AA 1NJID 1GCQA 4EMKC 5GAN6 2EQUA 3HRSA 4OMPA 3CCRQ 1RI9A 4X0CA 4EH1A 4XU1A 2DM1A 2O88A 4NL3A 4M7DD 2CUDA 2FYKA 1ABOA 4C92G 3H0IA 1WSRA 2C4TA 2V7VA 1Y07A 3QDRB 1YBYA 1BU1A 1WI7A 4ATOA 2RQRA 2A28A 1R5BA 2OX7A 5FU7B 1S4MA 3VUBA 1H85A 1G3WA 3TU4K 2GJRA 3I55A 5EC7A 4JJCA 3WVEB 5CQXA 4YTLA 1QGAA 4M7DG 2EJ9A 3BY7A 3R6KA 1AOJA 4OB1B 5KYWA 1WOSA 1RAAB 1WOPA 2JTEA 3EG3A 2F2WA 2OK7A 3HL8A 4PJOG 4RKUE 3JB9G 1M4ZA 3S3OA 5GAN3 2YWEA 3PIOA 4Z4SA 1S72B 1WHMA 2XHCA 1VQMQ 4E2FB 1KHCA 1ZM4A 3WVDB 1KQSA 1D2EA 3QSYA 1VQ8A 5LJ5j 4PGOA 1WYXA 2XZOA 5GV8A 1M3CA 1N8RD 4PK4A 1LVKA 3M59A 3EGDA 2ZZGA 4RG2A 1YHQQ 5LJ5g 1RAEB 2SEMA 2O01E 4JPBW 3L1AA 3VYGA 2P84A 2ZCFB 3OSVA 4TMWA 5AT1B 1JO8A 5GJWB 3M9QA 4G7XA 4C8QD 4M77G 4IUVA 3A5ZB 1TUGB 1TOVA 4IIMA 4ASUA 1ZBXA 3KFVA 2EAYA 3ZIAA 3QUIA 1VQLB 4OMFB 3MO8A 1E1RA 3JCMh 4HCKA 5IXFA 3OFNA 1BKBA 2EVRA 2KRNA 2L3SA 2WSFE 2K4YA 4UAJA 3CCMQ 1FX7A 5GMKj 3B82A 1ZBJA 5HK3A 3DB4A 1M8VA 4XK8E 2F1MA 2JS0A 2OTLQ 5KCHA 1XE1A 2RQVA 2BUDA 3G71Q 3SJPA 4NS5A 3CC2A 1R0BG 1QCOA 4GY5A 1SHGA 2DILA 3V8JA 1BK2A 2ECZA 1EFUA 5HY6A 2VBUA 1J3TA 1BI0A 2MK5A 2QA4T 2X53S 1S72A 5CAIA 3ES9A 3G4ST 1WU8A 1Y57A 2EQMA 1W6XA 2JT4A 3CCEQ 3CC7T 4XKVA 3E1SA 4PJOE 2LJ1A 2RQTA 5FU6B 2BM1A 3W2GA 3EH1A 5CQYA 1JA0A 1G5VA 2OBRA 1V0FA 1WHKA 4IIOA 2VNKA 1TUCA 2LP5A 3JB9J 3CCUQ 2F5KA 4IUUA 3Q38A 2LCSA 1VQNQ 1IJEA 3ZL7C 3T51B 4M53A 2E1RA 3CCRB 2HZYA 3CQTA 4RCZA 4TMTA 4PFPA 1O9SA 3H94A 3AHUA 3VU3C 1UD5A 2QAZA 3RUXA 4JS4A 4RG8A 5FO0A 4ZN3A 2BZXA 3BC9A 4N3NA 1YITA 2M5SA 2PTKA 4CC4B 2GBQA 2X6YA 1VQKA 3O5ZA 2J06A 2GQFA 2E5KA 5GAOm 2YUOA 4M78D 3A8HB 5B6IA 2DXUA 2E4HA 3AVTA 4RD4A 3OOCA 5KE3A 1V0EA 4RD3A 2LT4A 1N0VC 2DX1A 2RPNA 3J80E 3UPUA 1S72Q 3BY1A 1KQ1A 3CCRA 2A08A 2NUPB 3G7ZA 4XTWA 2V8KA 5H5JA 4C0DB 3PVQA 5FWBA 2VJIA 3OB9A 4QFMA 1W2BA 4RTYA 3LW5E 1TS9A 2DZCA 2OTLA 4DK0A 3OBWA 3META 4M7AF 3ZZ0A 4DBRA 1VQPA 1YITQ 1E79A 3GP8A 2PIAA 1E6HA 2XNCA 2E10A 3BCDA 4C0GA 3CPXA 4EMHA 2EBPA 4OF1A 4C92A 1MHNA 4Z4VA 4E7KA 4B3GA 3TSZA 4M75G 2I2LA 2LX9A 2O31A 3ZPNA 1E7OA 1ZX6A 1SHFA 4FSXA 1B34B 2CGHA 3CCRT 3CCLT 2OJ2A 3I56Q 4MMLA 5GANj 1IHMA 2E65A 4HVVA 1W2BB 5KNLA 2OK8A 4B9WA 2K3BA 4EDUA 5D6XA 2RHXA 2YT6A 2KVQG 2JVVA 2CP2A 2K5LA 3CEYA 3VKIA 3EG0A 1VQPB 3CCSQ 5DS0A 1D1NA 4N4IA 1Y96A 1KC8D 1JA1A 5IYPA 4P2NA 1VQOB 3CCJQ 3INZA 1T6ZA 1RQRA 4QQGA 1M2VB 3QFSA 2ZPHB 1PCXA 3L2UA 1IRXA 5A88A 1YJWT 4TVRA 1UHFA 2PLFA 3RKXA 3JB9D 1VQ9T 3HPWA 1TH7A 5GAMe 1DG1G 3QYHB 4AT1B 3URGA 2BE7D 4FT2A 2HCKA 4OGCA 1ARKA 1H42A 1OI1A 2DF6A 4C92E 1N06A 4EMGA 4R71A 3SB2A 4J9CA 2B86A 4FT4A 2OBTA 4RM0A 4KKUA 4M77F 3WBJA 1UGRB 4OB3B 2AHJB 3FRNA 3BNWA 3WQZA 4RD6A 1M1FA 3LQEA 1B3QA 3KEWA 4FN5A 2JW4A 5LJ3g 4P3IA 3CD6Q 5TY0A 2DFUA 3U2QA 3AVUA 3LGFA 3Q6RA 1VA7A 2L89A 2VUBA 4M0LA 3MP6A 4BDZA 4TMXA 2E5QA 2DKGA 1PM3A 4M75B 1WNLA 2BE9B 3CCLB 2E3HA 4M78F 2DZ9A 1R77A 2EWNA 1E3XA 2X3UA 3OYYA 2RHIA 1WQWA 2DBKA 4HVUA 1SSFA 4ACBA 1YNZA 2OI3A 3H9NA 1VQKT 1MMAA 4JS5A 5LMZA 1NLPC 4X06A 5FO1A 1EX4A 2KXDA 3FLGA 1Y0RA 2C78A 2B5OA 3A8LB 1X75C 1RI0A 3VO2A 1X2QA 5KYYA 3MHPA 1PJ7A 3PUNA 3GPLA 4XN3A 1B07A 3I56A 3LVBA 1F60A 4OMLA 2FL7A 3VRZA 2I0NA 2Y4YA 2HEQA 5KYWB 2WJVA 4O6JA 4P26A 4Y9RA 3CCUA 3NHNA 2GK7A 1TWBA 4M7DC 4YXWA 3SHWA 2LZJA 2NPFA 1QWEA 1XOVA 2M0OA 4OMNA 4OMQA 1A0NB 1KSWA 1QVFP 3M58A 2HKQB 4BI4A 2B7BA 2X4WA 1NB0A 1KC8C 5J35A 1MNEA 4X07A 4X34A 2QQAA 4XLAA 2K9GA 2EYZA 1Q86C 4KT0E 2PE3A 1BI3A 1VJSA 2K79A 3CMEA 2YLCA 3WXMB 2HAXA 2FPFA 1AVZC 2OAWA 2BGJA 1HK9A 3RESA 2DCUA 3CPFA 1Y7XA 1NEBA 2VB6A 3OYAA 5HZAA 2MYSA 4CI0C 2RC6A 1KD1C 4WWVA 3CC4A 1M90D 3OPOA 2M9UA 4C0FA 3ZEHA 4M7DA 2C5BA 4TKOB 2V26A 3OSSC 2BF4A 4FIBA 4U9UA 3VV0A 5DLQE 2QQRA 1EXMA 2JM8A 1YHQB 3EAEA 2F43A 1VF7A 3RMQA 3P8DA 1N9RA 2X35A 3LYIA 3H6ZA 2V1QA 3GVLA 1BPLA 1M1KR 2QTZA 1W9XA 2VXEA 2IIMA 2R57A 2BVNA 4XN0A 2PUOB 4BPRA 4QVCA 4WZLA 3M0QA 3OW2S 2QQ9A 3FJOA 4M7DF 2Q6OA 1E64A 2FRYA 2GCXA 5KYNA 1NE8A 1F20A 3BW1A 3MEWA 2VC8A 5GMKl 1FDRA 2EYWA 3B78A 3A3GA 1G3SA 1UGQB 4M75F 2RJEA 3BDLA 3W2FA 2K57A 1MV3A 1GCQC 1Q7YC 3P8BB 1FYNA 2FB7A 3OW2P 1K9MC 2DD4A 2F2XA 3SWNB 4LUDA 1DDIA 3BH4A 2EIXA 2EJFA 1IREB 2L3QA 2ZPEB 1ACMB 3TCJA 1K73C 2OTJT 2V7UA 4MDWA 1IZ6A 1JB0E 1PNJA 5GAN8 1KIKA 1V29B 1ZSZC 1SM4A 4QT7A 5A0DA 1WPYA 3PVLA 4AG2C 1A8PA 2DPPB 4R0KA 5L8RE 4FW2A 4RCBA 4E47A 1I8DA 4C8QA 1NJIU 3DDYA 2EYXA 1T3SA 4J6YA 1VQ4A 2LQWA 3E9FA 3SLNA 2EYQA 3HHTB 4XR6A 2ZBUA 3KL9A 2NWMA 2CUBA 3ONUA 1SEMA 2XZPA 3CCST 4VUBA 4AC9A 1PHTA 2YUPA 1MUZA 3H0FA 3C95A 3EHRA 1SG5A 1H3HA 5AYFA 4J9EA 2JDIA 3MJXA 4ZCMA 1NJIR 1RABB 1ZUUA 2DIQA 2HCJB 3W5HA 3QO3A 5GMKm 4H9GA 4M75C 2PZ1A 2VBTA 2CP6A 1N6AA 2RD1A 2WSEE 2KRSA 1YHQT 2XZLA 4XORA 1YP5A 2VVKA 3VS1A 4A4KA 2QEXB 1YJNB 4E7IA 2HQXA 2KXCA 2JTFA 3I1FA 4JLIA 3SFMA 4Q5WA 5GV7A 4PC7A 2DY1A 2AIRB 3AT1B 1QFZA 3ASQA 1SRLA 1K9MR 2DYBA 3EHQA 1K28D 2C77A 2ABLA 3M5AA 3RR6A 2W6JA 3GQBA 2ZTGA 2M0YA 2JJ9A 2K3XA 3HSBA 1OYXA 2ZAEA 3T56B 2RF0A 2EQIA 4AF7A 4UZEA 4II3A 4GQNA 1UFFA 5FLXE 1YN8A 5ECAA 1YCSB 1KJZA 4HT9A 1QFJA 2RQUA 1QVGS 2XDBA 1QGYA 2DRMA 1OGJA 4F7UF 4JMQA 4BE2A 1VQ8B 3TEEA 2EFIA 3MCAB 3UWNA 2KT8A 4YELA 1N9SA 1S0UA 4X7EA 3I5RA 2MWOA 4M78B 1K1ZA 2F1LA 3WNBA 4J6WA 3JCMW 2EFGA 3CTAA 4KUIA 2CSIA 4XM3A 4WQMA 3DKMA 2EIFA 3GLXA 2KE9A 1C1AA 1QUEA 1HYOA 2QTXA 1KFZA 4ZGEB 5BSYA 1W70A 2QGGA 1K73R 5FU7C 4A63B 2X6WA 2KGTA 4G5GA 2EKHA 3QXEB 3WYAA 1YIJA 1X6BA 2PUKB 3W2EA 2JZ2A 3M0UA 4HCBA 3PFSA 2RB6A 4KGXB 3N5BB 1D1CA 1OV3A 3P27A 2KMTA 4Z1MA 1QCFA 4QVDA 2DJQA 3VS7A 2YDLA 2V7XA 5J3BA 2LX7A 2BMWA 2AT1B 1D3BB 1PG5B 1VQ5T 4RUGA 2DEUA 2WPDA 1QKXA 3CXCA 3ZBUA 2P4RA 1VIFA 3PT9A 1OEBA 2CZ6B 4M78C 3GIRA 1V76A 1OGIA 2R6HA 1AHJB 5IYRA 1JRIA 4FYVB 5LJ5h 3E19A 1WFWA 2DJZA 4QVZA 1X6OA 1CQXA 3OYGA 2P4TA 3MCAA 3AVYA 2C4UA 3V7RA 3G6EB 1ZUKA 3C12A 1GO2A 3W5UA 4JJDA 3Q3AA 2BN4A 3TQ7P 1UJ0A 4MZPA 1I5OB 1QW1A 1NBEB 2GNCA 3UT1A 3JCMg 4JUVA 4HXJA 2GK6A 1Q81R 1FNCA 1K0XA 2CW5A 3EFOB 4PL6A 1YI2A 1K0SA 5EMNA 2X85A 2CP0A 1KK1A 3G4SA 2DEQA 3OW2B 1FNDA 4XOPA 1UGVA 3FJ5A 4BB7A 1YHQA 1YLOA 5F4OA 4X1VA 3CB4A 4AG1C 5D6WA 2V4DA 2H3JA 1HA3A 4RCYA 3R6NA 4JRKA 4ZGQB 1HSQA 1WHGA 1T0HA 4XU0A 3VS3A 4DQ2A 2GREA 1R5OA 3MEAA 2KYMA 3CCEA 5LJ5e 1I7PA 3THKA 1AWJA 3EGUA 2GJPA 1PC0A 2HD0A 1U8RA 1UJYA 3V8LA 3G71A 4PC6A 1NYFA 1AMOA 2CP5A 3G71B 4B43A 5KYUB 3MHXA 3ONYA 1H3ZA 2VKNA 1COWA 2COYA 3ZZTA 4LDVA 1YIJB 1YI2T 3B8HA 1G7RA 1IHWA 3JB9F 1M3AA 1G8XA 3BFMA 5A0LA 3EG2A 2D3NA 4M75E 2KSSA 3SDZA 2MOXA 2DA9A 3IQLA 4II2A 2DAQA 4HA8A 4LBZA 1KG1A 2EGEA 4P5NA 5DSZA 1D1AA 1XFOA 2E3IA 2OAUA 1T3LA 3RNJA 5GAMd 2RNAA 2XK0A 5DLOA 4RLZA 4R56A 1TTHB 3LX7A 1OOTA 3C94A 4YAFA 1QVGP 4LD6A 4M4ZA 1WOOA 1IO6A 1EFCA 6AT1B 1WTHD 4QV2A 5CKBA 3CXCS 4LDYA 1AWWA 2GTOA 3AVWA 1O75A 4LBWA 1KQ2A 5CIUA 3QSUA 3L2QA 3FKSA 3VR6A 2EPDA 4O5VA 2V8IA 2LC4A 4WCIA 2IG0A 2YWFA 1YIJT 2EW3A 4II1A 4N0AC 3JQPA 4OVAA 1VQ7Q 1IB0A 2YUNA 2QEXT 1VQ5A 1Q82R 1MMGA 4L5GA 3FC3A 1X69A 1G7CA 4GLMA 1E1QA 2GFUA 2QE7A 3ZC3A 4CC7A 1F1BB 2V1RA 5GAMf 1CKAA 5IHNA 3PTAA 2HBPA 1YWPA 3U6KA 3CW2A 1VQ6B 2XIDA 4F7DA 4OMMA 4XU3A 5LJ3h 4TSFA 2K2MA 1EIFA 1B34A 2DERA 1YX2A 2FVUA 5DN6A 2KK4A 3MP1A 4BUGA 4ACAA 2QK0A 3CD6T 2FO0A 4Z4WA 2M1HA 3L2VA 3EFSA 1E63A 2OTJQ 3FB9A 1U1SA 2ED0A 2CBXA 3JCMQ 3OY9A 3CMET 4CC2A 1VYUA 2FVGA 1K8AD 3M4YA 1UD3A 5IH2A 4UC4A 2ZZQA 4FYYB 5FROA 2WJYA 3OKXA 2OTJB 4PC1A 2HNIA 1YJWA 4C0DC 1ZUNB 2L3RA 1RLQC 1U06A 4PC3A 3CC2B 1VQMB 3CPWS 3DLLA 4A4HA 2DL3A 3ASKA 5LJ5d 3J81k 3JCMf 5E6TA 4BDYA 3GBQA 5GMKi 4Y91A 4LD9K 2XOKA 3FDRA 5GAOl 1NYGA 2R58A 3VS2A 1VQ4T 3ZBTA 1QVFS 1X2KA 3LWHA 3FPKA 1CSKA 4Z4ZA 4M78E 2GQIA 1SKUB 1YJNQ 1D0YA 1GAWA 3QZ9B 5AN9A 2E6ZA 2XKOC 4LC0A 3BQJA 3D26A 1YWOA 3OBYA 4BE0A 4PNOA 1W2BS 2HSEB 4XLCA 4BD3A 4M2LA 3M56A 2O9SA 1QWFA 3PVDA 4QQDA 4Z4YA 3P8HA 3A8OB 1J9ZA 2RN8A 4M77D 2LCCA 3BE3A 9ATCB 4QQ6A 2ZPBB 4E6RA 3BCFA 4C5GA 1QUFA 2WACA 1JJ2S 2D9RA 3CCLA 2E6NA 2RJDA 4XLFA 4P25A 5D7UA 4FWTA 3REBB 3OS2A 4J9DA 5EG2A 2RM4A 4C8QE 1PJ5A 5IHIA 3ZFJA 4FU6A 4J5YA 3QZ5B 3HFOA 3VO1A 2JXBA 5GMKh 1RAIB 4FYXB 3OEEA 1Q7YD 1KHIA 4XLHA 1ZM2A 4PJMA 5CKDA 1VQ8Q 3RY8A 3EH2A 2ROTA 3JAME 1PKSA 2D3LA 4DQLA 3W2IA 4WTOB 1PKTA 2A0FB 4KH1B 4LDXA 3G05A 4DBFA 2ZITA 5BSXA 3JCMe 1U3OA 2MCNA 5GANe 4P9SA 2O4XB 3QIIA 1BQEA 3VRYA 2LQ8A 3VS0A 4AFSC 4DQKA 4OPOA 2QGFB 1GVHA 2VBVA 1N27A 1VHEA 1VYTA 2DL7A 2BIVA 2QDXA 5D6YA 3NTIA 4M7AA 2BKDN 3UDCA 1NG2A 3CCVB 4B47A 1WLPB 1ZM3A 2F5TX 3CCQA 1W87A 4L8JA 3JQQA 4OP0A 2XDDA 3JQRA 1FRQA 2JN9A 1G3YA 1VQ4Q 4R55A 1Q9SA 1MNDA 4WF2A 4C92D 4FW1A 4OB2B 1BYMA 3M57A 1V5VA 2ZL7A 4X7DA 3OEHA 3T53B 2A3LA 4Z88A 4PC2A 4FL6A 1OQKA 2D0NA 2GF7A 3CP8A 2NUTB 1R0CB 2O2OA 2BGIA 3PE0A 4C92C 4PJOC 4X05A 2ZTNA 2D6FA 4F16A 5I21A 3OS0A 1M30A 3SWNA 3CMEQ 2YHTA 4J0QA 3JRZA 1DARA 4AF6A 2BV3A 3S6WA 4LDWA 2JMAA 2JUFA 2CREA 4ORZA 3VS4A 1OZ3A 3LLRA 4RTXA 2DTIA 5C0MA 1VQNA 1JEGA 1PSFA 2DL4A 2D0QB 2DE0X 4IKFA 2Q6IA 2BZYA 3L2WA 5HZBA 5KYXB 1M9SA 1NPPA 5KCOA 2KYBA 2ZZEA 1G83A 3A8JA 1UD8A 4IUQA 1FXXA 2ZGWA 4P12A 4EIKA 2Z6BD 1OB0A 1WXUA 2DK3A 4DK1A 2KEAA 2LJ3A 1QMCA 4XU2A 1RLPC 4J9FA 2M51A 3OAAA 2FZGB 1KK2A 3A1PA 4Y7CA 1WHHA 4KUDK 4OOVA 3QFRA 1D1BA 4PJNA 4PJOF 3KUFA 2X4YA 4F04B 4LNPA 4J9HA 4DBQA 1VQ9A 4B44A 2FG0A 2YWWA 1OB5A 1GJRA 5KYXA 3CC2Q 3ASPA 1UEBA 2RJCA 2QA4A 2DETA 2EJGA 1TTTA 3VNVA 1BB9A 5J26A 3CESA 1R8OB 2KY9A 3UA7A 1T5EA 3A8GB 3ULRB 3CC7A 4X7FA 5GANg 2X6XA 1SPKA 1OPLA 3OYDA 1Q81C 3X28B 2RI3A 2P0PA 4B3XA 1TUIA 4LN2A 3WNDA 4C5IA 1G2BA 1BX0A 2KRMA 2VJJA 3JCMb 4C8QF 2ZPGB 1VYVA 1XB2A 1Y0MA 1Q95G 4EMKA 1QP2A 3CBPA 3PUMA 1NEGA 5A2QE 3HAGA 4KGZB 2A37A 3JCMJ 3G1JA 4DEXA 1CNFA 1K9MU 2VGNA 1JQQA 1MMDA 3CCVT 5DY9A 1QVFA 1W34A 4XKWA 4YEJA 2GPJA 1VHOA 5CO7A 2QG9B 3M55A 2LQKA 2KBTA 2JN0A 3M54A 2AZSA 4Z8AA 2LJ0A 4RTZA 3CC4B 2LCLA 3ZZUA 3TREA 2E41A 1UDLA 1RUWA 1S1NA 4BI3A 3CCUT 1VQ4B 1VOMA 2RI2A 2BZ8A 1UMKA 2D8JA 2J6KA 1BIBA 1EWYA 2COWA 1WPCA 4F7UB 2J6OA 1AIPA 3PGGA 2L8DA 2LMJA 4KKSA 3UA6A 1G7SA 3OJWA 1WX6A 4WZEA 2D1XA 1VQKB 1Y96B 3CCQQ 3NTKA 3GSIA 4K11A 2DNUA 1OULA 5CVIA 4BI8B 2X3XD 1K9AA 1M2VA 1SRMA 3LNNA 2QA4Q 1FMVA 1TVCA 3H8ZA 3MKDA 3SEMA 5LJ3f 4RPBA 3QWXX 5F4JA 4M75A 2V8JA 1QGZA 2F2VA 2XDPA 3LO8A 3CMAQ 2C0IA 1ZSGA 1U2RA 5FWCA 4XQFA 4XTXA 1KC8R 2KVOA 1ZUYA 4RCCA 3ER0A 1EP2B 3BY2A 1EFTA 1QH0A 4N4HA 3OYKA 4E0FA 1WDTA 3OJXA 3OP1A 5DM7R 4Y92A 4Y28E 4HIZA 2LQNA 3I55B 1M1KD 2LDMA 2DLPA 1I18A 1PKVA 3VMFA 2H8HA 5FIUA 3A3BA 1OU9A 1TUDA 3VS5A 1GFCA 3RDVA 4Z4RA 4F7UE 4RDKA 5TV2A 2OYNA 4J9GA 4QKUA 1XQHA 4BE1A 3QPHA 4FM4B 2RO0A 4EPCA 2HQHA 3W5VA 2BSAA 1N8RR 2XICA 4G7WA 3OMGA 3D7SB 1YJ9T 4B48A 4V2SA 1WJRA 3QJYA 4QVJA 1KD1D 4Z4TA 2O4XA 3E9GA 1M90U 3OE7A 1FNBA 1JXMA 4XLEA 4IURA 2VWFA 4A4GA 3I35A 3CCUB 3JCMd 5GAOn 3WNCA 1SKYB 2CP7A 3QHSA 1H8KA 2HBWA 1WA7A 4DEYA 2NLUA 1N08A 1FWZA 1WJSA 4HE5A 4YHBA 4DNRB 1RAFB 1N8RU 1XQBA 4XAXB 2L3PA 1RACB 1B2RA 4X9DA 1UE9A 3C0CA 3G6EQ 2FZCB 1M8MA 2VV5A 1OHHA 2XMFA 1UD4A 1W35A 4X9CA 4KGVB 2HL3A 4M7DE 3CC2T 1H92A 2AHOA 3CXCB 2QTLA 1CNEA 1UECA 4J83A 3OYEA 4M77B 2M02A 5IT9E 2WZNA 4E7SA 1JU5C 3OZWA 2ZZFA 2JTMA 1AD5A 1AEYA 4DNTB 4B4DA 1YI2B 2QN6A 1HD3A 5GAN4 2YLBA 4E7JA 4LE9A 5I2MA 5FRNA 4XTZA 2YWHA 3RBBB 5IK2A 2FRWA 1T6YA 3I9QA 1WSVA 5C6SA 2MIOA 3JSCA 2M16A 4M7AG 4YAOA 1VQ7B 4NBSA 5GAOp 3EGXB 4KRTA 4RPDA 4RTTA 1RQPA 1Q82D 2FPDA 3Q1JA 4BY6B 1LPLA 1DJ7B 4ZTJA 3AGPA 3OMCA 4DBHA 1KK7A 1UHCA 1QCNA 2MAMA 2YWGA 4NCNA 3OYJA 1MRZA 3S3NA 3HRTA 1IGQA 1TSFA 4ELZC 2HMAA 3PNWC 4LDUA 4M7AB 2D74A 2ROLA 3WY9A 1BIAA 3RKYA
chains in the Genus database with same CATH topology
2DOGA 2F1LA 3A1PA 3H9NA 2DYIA 2QGGA 3HTRA 1PM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOG A;  2F1L A;  3A1P A;  3H9N A;  2DYI A;  2QGG A;  3HTR A;  1PM3 A; 
#chains in the Genus database with same CATH topology
 4XNF A;  4XTU A;  1VQP T;  2QEX A;  1HZE A;  1VQO T;  1Y0Y A;  1D3B A;  1K8A R;  5KE2 A;  3EGX A;  2HKN A;  5FRM A;  2CT4 A;  2CSQ A;  4B6M A;  4C92 B;  5IXB A;  1X6G A;  1YJW B;  4PJO A;  5I2S A;  2KQW A;  1PD0 A;  2JJ2 A;  3SJZ A;  1T0J A;  2QMU A;  3NFC A;  4RD2 A;  1M2O A;  3RMS A;  2MF2 A;  1YJW Q;  5J39 A;  2W0Z A;  2X0K A;  1HXD A;  4Z89 A;  1N0U A;  5M9O A;  4FSS A;  2A36 A;  1WHJ A;  1RAG B;  2GGR A;  2QEX Q;  2C2W A;  1RAD B;  4HT8 A;  1I07 A;  3PA1 A;  1K73 D;  4RTV A;  4ESR A;  4AVZ A;  3CCS B;  1GBQ A;  1VQ5 B;  2RA2 A;  5HCK A;  1WQ7 A;  4X7C A;  4PFO A;  2QDL A;  2ZPF B;  3I56 T;  1Q81 U;  3CCL Q;  5LJ5 f;  4FXU A;  2AK5 A;  3WBK A;  1KK3 A;  5I22 A;  3QYG B;  3FJP A;  1M1G A;  3JV3 A;  2JNG A;  1Q82 C;  4ZCL A;  4ZGN B;  2KRO A;  1E62 A;  1OU8 A;  4M78 G;  3CCJ A;  1LNX A;  3G6E T;  4OOX A;  4YAW A;  4L59 A;  3CCM B;  1I81 A;  5CR2 A;  1YIT T;  1AWX A;  2K2V A;  4ZCI A;  2VAS A;  2LZ6 B;  3SD4 A;  5L23 A;  4XL9 A;  4XON A;  1K8A C;  1H64 1;  2QQB A;  5A8A A;  3M0T A;  3ME9 A;  1AZE A;  2L0A A;  2G3R A;  3OYL A;  1VQM A;  4LBV A;  3EG9 A;  4LXC A;  1BCO A;  2HDN B;  2P3M A;  5CKH A;  4KUL A;  1I0C A;  3SEJ A;  3V8K A;  1S72 T;  4YAU A;  1Z9Q A;  3FIF A;  5JBQ A;  1MGQ A;  7AT1 B;  1TU0 B;  4QUZ A;  2KR3 A;  4M7A D;  1ZSZ A;  4C5H A;  3L42 A;  2RH2 A;  3MEU A;  2CH4 W;  1QP3 A;  5IAY A;  5GAN d;  2ZL5 A;  1NB9 A;  2MPX C;  1KQS B;  2CH4 A;  1EP1 B;  1WXB A;  2PVD B;  4OOS A;  1H8E A;  3PA2 A;  3MP8 A;  5TRD A;  3M0S A;  3HP9 A;  5GAM j;  4JZ3 A;  1NLO C;  3DB3 A;  4N3G A;  2CP3 A;  2QXF A;  1X01 A;  3GNG A;  2QYZ A;  2FZK B;  1SSH A;  4C8Q G;  1QLY A;  4OB0 B;  2A7Y A;  4G1V A;  1PSE A;  3OA6 A;  1PWT A;  2B7C A;  4M7A E;  1E6G A;  4ELY C;  4A4F A;  1TXQ A;  1BI1 A;  1VUB A;  3JCM V;  3NMZ C;  4MDX A;  2WR8 A;  5HKK A;  3A8K A;  2X3W D;  1JB9 A;  3CP2 A;  3LH0 A;  3OQ5 A;  3GOX A;  4C0Z A;  2AKK A;  3ISX A;  1Z9Z A;  1K4U S;  5TR9 A;  2E1H A;  4F14 A;  5H59 A;  1GAQ A;  3J7A F;  3CME B;  3V7S A;  3G4S Q;  3CMA T;  3GNF B;  1BLI A;  3CXC P;  4M1K A;  2SRC A;  3R6J A;  3EGD B;  1QG0 A;  1AZG B;  1N5Z A;  2O9V A;  3M4G A;  2HL5 C;  4JLG A;  3X26 B;  2WSS A;  2MWP A;  4ZGJ B;  3PMT A;  2OTL T;  1Q82 U;  2CRV A;  3V76 A;  1OPK A;  4P6Y A;  2P0Q A;  1YJN A;  3PIP A;  2LNH B;  2E1B A;  3CCM T;  4UZU A;  2VNH A;  2FPE A;  3I55 Q;  4UZF A;  1Y71 A;  2ENM A;  3CCV A;  5CK9 A;  5GAM h;  5A0G A;  2XGJ A;  2RK2 A;  2ZZD A;  2H3E B;  1YIJ Q;  1OX8 A;  5I11 A;  2XD0 A;  3GF5 A;  2DTO A;  2VYT A;  1W0K A;  1ELO A;  2VYQ A;  1NBM A;  2I1L A;  1HJD A;  3HFN A;  2GFA A;  4PJO D;  4OGE A;  3CCE B;  3X20 B;  2RQW A;  3BDU A;  2Q6L A;  1ZLM A;  2DIG A;  3CC4 T;  3OYB A;  1KZL A;  2LVM A;  2IVW A;  1QVP A;  5KYU A;  4C43 A;  4XOT A;  1KQS P;  1KD1 U;  3HKS A;  4A53 A;  4C8Q C;  1P4M A;  1I4K 1;  2G6F X;  1ABQ A;  5LJ3 j;  1D0Z A;  1QQJ A;  3OW2 A;  3CCV Q;  2R9V A;  3CD6 A;  1GCP A;  2YRC A;  2VNJ A;  3J81 E;  3TVT A;  4OMO A;  4CQJ A;  2OTL B;  3NGP A;  1XJW B;  2E64 A;  3OZV A;  2DD5 A;  1VQM T;  1BJK A;  3WXM A;  2DBM A;  3UAT A;  4M7A C;  4AFU C;  1UD6 A;  1YI2 Q;  3AGQ A;  5GAO r;  4PJJ A;  1SF9 A;  4G1B A;  4CC3 A;  5FA6 A;  2V7W A;  3V7A A;  1GFD A;  4MMK A;  3OS5 A;  1X43 A;  3NE5 B;  1FRN A;  2YRV A;  3X24 B;  4B9X A;  2KDS A;  3OYN A;  1IHV A;  3W2H A;  3H0H A;  1YJ9 Q;  4E7L A;  1Q86 U;  4WZT A;  1GRI A;  3CD6 B;  4HKE A;  3CCQ B;  1TG0 A;  1KC8 U;  1C0M A;  5IYW A;  4WZK A;  1UG1 A;  3MEV A;  2HDA A;  2PMD A;  2J7K A;  1VQ7 A;  1IGU A;  3E2U A;  1WP6 A;  1LCK A;  1M5Q 1;  2XI9 A;  2OBS A;  1VIE A;  1G3T A;  3LH5 A;  4MYU A;  4M77 A;  1M90 C;  2XU8 A;  3OYM A;  2J6F A;  1KMH A;  3Q39 A;  5GMK e;  5LJ3 d;  1VQN T;  2BPO A;  2IPO B;  1I8F A;  2CZ7 B;  2Y90 A;  3R6O A;  4D8K A;  1T6X A;  2X51 A;  3VYH B;  1MAB A;  1SKQ A;  1R5N A;  1LJO A;  3AVX A;  5GAN h;  2X4J A;  3JU4 A;  3SLD A;  3CC7 B;  4RD0 A;  3CC7 Q;  2YUQ A;  3I55 T;  4RTU A;  2GTJ A;  5HXB A;  4RDL A;  4ZTF A;  4G6I A;  1EZZ B;  2X9H A;  2WZP P;  5LJ3 e;  2PU9 B;  3QE2 A;  1Q7Y R;  3AVV A;  1K76 A;  2DYI A;  2YXY A;  3RKW A;  1FX0 A;  4YAL A;  4ROX A;  2F4N A;  3GIB A;  2YSQ A;  5CKE A;  5IYQ A;  1VQL A;  3RER A;  3CBM A;  4C0S A;  1VQ5 Q;  2Q6K A;  1WDX A;  4M77 E;  3QFT A;  1IB8 A;  4GBQ A;  5FNZ A;  2DMO A;  1YIT B;  3A35 A;  5KW9 A;  3Q6Q A;  1U5S A;  5CCA A;  1XNI A;  2CZ1 B;  4C92 F;  5GAM g;  2JOY A;  3U6B A;  3CBO A;  5FU6 C;  2EGA A;  1Q7Y U;  2KI7 A;  4J7F A;  1VLY A;  2DL5 A;  2W6I A;  4K1X A;  3X25 B;  1QVG A;  1KK0 A;  4E7H A;  5KYY B;  2JIZ A;  2J7I A;  3T9N A;  4LBY A;  2VNI A;  5GAN 2;  2J05 A;  3S3M A;  2F69 A;  5A89 A;  1CKB A;  4TMV A;  1W4S A;  4MZM A;  1D8T A;  4XMY A;  2E12 A;  2V7T A;  1NPR A;  1EP3 B;  4CRI A;  4QHY A;  4EMK B;  1WGS A;  2ZXI A;  2QDY B;  4J8O A;  3ZUG A;  2MMP A;  1NJI C;  2PVO B;  3CPW P;  1K8A U;  2XNJ A;  2DXC A;  3CCS A;  3I5S A;  2JM9 A;  3PEN A;  3L2R A;  4F17 A;  1BX1 A;  2QAS A;  3CMA A;  3VS6 A;  1GBR A;  4NNJ A;  1GR1 A;  1OZ2 A;  2DRK A;  2ED1 A;  1EFR A;  3OZU A;  5F4M A;  3EG9 B;  3JB9 I;  5FW9 A;  1VQ6 A;  1EFN A;  2AKL A;  1VLO A;  1UD2 A;  5L46 A;  4IUP A;  4C8Q B;  2V31 A;  2RHU A;  4DA4 A;  4P22 A;  3GVK A;  1E43 A;  2NV4 A;  3QKJ A;  2PQW A;  2QA4 B;  2DVJ A;  2NUT A;  1ZSZ B;  2NUZ A;  5HK0 A;  3A8M B;  4X8I A;  1MV0 B;  2QQS A;  4HCC A;  3SKB A;  2RJF A;  2K3Y A;  4JRI A;  3RIR A;  1VQ8 T;  1KRH A;  4JRP A;  1N8R C;  3VNU A;  1M27 C;  1NZ9 A;  1BMF A;  4N4G A;  4PJL A;  3SWN C;  4Y9U A;  4IUT A;  1PD1 A;  4P1V A;  4ZN1 A;  2RK1 A;  1TLL A;  2QI2 A;  1M3B A;  2DL8 A;  4OPV A;  5GJV B;  1G7T A;  2ZL6 A;  3F70 A;  4E7Z A;  4KH0 B;  1KJW A;  8AT1 B;  2K5F A;  1V1C A;  2EQK A;  4ME7 A;  4PLL A;  4Q7J B;  3CC4 Q;  1M1K U;  5HKC A;  4BAC A;  3VUZ A;  2WYR A;  4XQ3 A;  3OYH A;  1Q86 R;  3CCJ B;  2C5H A;  2R5A A;  1UGP B;  4F7U A;  2PNI A;  4LUE A;  1ZM9 A;  3U23 A;  2EKO A;  3ZBD A;  4OPS A;  1W0J A;  4TN1 A;  1WIE A;  3M53 A;  3MMP A;  2NYS A;  1QVF B;  5IHK A;  1VQK Q;  2PVG B;  5GAO q;  5KSW B;  1ZHI A;  3JCM X;  2BM0 A;  4C5E A;  1B7T A;  2CS7 A;  2CZ0 B;  2E70 A;  4XTY A;  1I1J A;  3M0R A;  1YFN A;  2RMO A;  5KH6 A;  3QWY A;  2EQJ A;  3OYI A;  4B3F X;  3EFO A;  2ATC B;  3CPW B;  3ASS A;  1Q81 D;  2DO3 A;  2KNB B;  1X27 A;  4RD1 A;  3CMM A;  3G4S B;  1QFY A;  1JJ2 P;  2Y4X A;  3QG1 A;  2X8K A;  3AST A;  1K9M D;  2WSC E;  1VQO Q;  2RHZ A;  5J3O A;  4N0A A;  2ESW A;  4F7U G;  5GAN 5;  2L5Q A;  2JS2 A;  2R5M A;  2RHY A;  3OYC A;  3G6E A;  2VXF A;  1VQP Q;  1NRK A;  3QDF A;  1IJF A;  2CF4 A;  4PLI A;  1PJ6 A;  5IN1 A;  1FNM A;  4HE6 A;  3QJ6 A;  2DXB A;  1NDH A;  3FPP A;  3MPU B;  2XEX A;  3EG1 A;  1PRL C;  4J6X A;  4QW2 A;  4HVW A;  3H41 A;  3LQ6 A;  1VQ9 Q;  1BCM A;  1VQ6 Q;  1YCY A;  1RL2 A;  1VQ9 B;  4PFZ A;  2C06 A;  5GAN 7;  4ZGD B;  4RTW A;  3A8I A;  3E20 A;  4TMZ A;  4FYW B;  2FEI A;  2EYY A;  3LGL A;  3M0P A;  4ANJ A;  2VBS A;  2W10 A;  1ZA2 B;  2ZBV A;  1AT1 B;  1WJQ A;  2KT1 A;  1KQS S;  3TSW A;  4NOY A;  4RJL A;  1UB4 A;  4NL2 A;  2LRQ A;  4FCY A;  3UF4 A;  2CDT A;  1VQN B;  4XD7 A;  1YJ9 B;  3E1Y E;  1E3Z A;  3NPF A;  1HVX A;  2CYZ B;  1UGS B;  2MI6 A;  1VQL T;  2LNV A;  2K7A A;  3DLM A;  1C6V X;  2EGC A;  2CT3 A;  2LTO A;  3GVJ A;  3O8V A;  2COZ A;  2JJ1 A;  1WHL A;  1AWO A;  1K73 U;  8ATC B;  5LL6 S;  4AFZ C;  2K6D A;  3EFR A;  2VZL A;  2D8H A;  3LWI A;  1NM7 A;  1I5L A;  3HRU A;  4PAA A;  2FX3 A;  3V7C A;  4A54 A;  1Q86 D;  3KXT A;  3CMA B;  4JJB A;  4XTV A;  1FMW A;  4PJO B;  2CC2 A;  1ZA1 B;  1ZQ1 A;  1JBM A;  1W1F A;  1M90 R;  1VQL Q;  2DOG A;  4ZV4 A;  1YJ9 A;  4JZ4 A;  3PMI A;  4Z4U A;  1JJ2 B;  4M7D B;  4J7I A;  2LT1 A;  3QBY A;  3FEO A;  2NUP A;  1N07 A;  2XG8 D;  3KBG A;  4AMC A;  1GL5 A;  4KBM B;  2DVE A;  1WOR A;  3REA B;  4OP7 A;  4P3Y A;  1P92 A;  1MMN A;  3JCM P;  3P26 A;  3JB9 H;  4KKT A;  5THX A;  4HCZ A;  2K5I A;  1XTD A;  1YJN T;  3CCM A;  3VJP A;  3ASR A;  3CRZ A;  1VQO A;  4D6W A;  2RC5 A;  4IW3 B;  1QVG B;  2ZPI B;  4J9I A;  2OTJ A;  2QTV A;  4PKC C;  5CDF A;  2L2P A;  1UTI A;  1BBZ A;  2HSP A;  1PRM C;  2VGM A;  1JJ2 A;  1VQ6 T;  1U1T A;  2DIE A;  4BY6 C;  3OS1 A;  2C0T A;  2FHD A;  1WXT A;  4M75 D;  4JJN K;  4J9B A;  4DOV A;  4MYT A;  2GQV A;  2P0K A;  4JRQ A;  1KD1 R;  4QVA A;  4GLK A;  3QFC A;  4D8D A;  1M1K C;  5GAN f;  2ZXH A;  2D9T A;  2RI5 A;  2HLD A;  2DXT A;  2DTH A;  1DDG A;  4M4S A;  1N05 A;  2YRD A;  4TT3 A;  1D0X A;  3CCE T;  3HTR A;  2HQE A;  1GXI E;  1KTV A;  4PAB A;  2C0O A;  1D09 B;  3I56 B;  5IYN A;  4M77 C;  3L2Z A;  1FMK A;  1UUE A;  1BI2 A;  2X4X A;  2CK3 A;  2GJK A;  3OW7 A;  2CKK A;  3OYF A;  2KAF A;  2XND A;  4P6V F;  5CKF A;  4JDS A;  1W2B P;  3G71 T;  1IXD A;  1JXO A;  3CPW A;  2V7Q A;  5FL7 A;  4MZT A;  4RDJ A;  2BTT A;  3A98 A;  3C4S A;  1WZO A;  4FK8 A;  1JNY A;  2Z0W A;  1LOJ A;  2CND A;  4A4E A;  3CCJ T;  3JCM c;  1OB2 A;  2AZV A;  4AFQ C;  3CCQ T;  1VQ7 T;  4Z02 A;  2JMC A;  4L6V 5;  1QX4 A;  1RAH B;  1H8H A;  1OX9 A;  4RMO A;  4DOW A;  4ZNX A;  1B23 P;  1QKW A;  4M78 A;  3NTH A;  2B8A A;  1NJI D;  1GCQ A;  4EMK C;  5GAN 6;  2EQU A;  3HRS A;  4OMP A;  3CCR Q;  1RI9 A;  4X0C A;  4EH1 A;  4XU1 A;  2DM1 A;  2O88 A;  4NL3 A;  4M7D D;  2CUD A;  2FYK A;  1ABO A;  4C92 G;  3H0I A;  1WSR A;  2C4T A;  2V7V A;  1Y07 A;  3QDR B;  1YBY A;  1BU1 A;  1WI7 A;  4ATO A;  2RQR A;  2A28 A;  1R5B A;  2OX7 A;  5FU7 B;  1S4M A;  3VUB A;  1H85 A;  1G3W A;  3TU4 K;  2GJR A;  3I55 A;  5EC7 A;  4JJC A;  3WVE B;  5CQX A;  4YTL A;  1QGA A;  4M7D G;  2EJ9 A;  3BY7 A;  3R6K A;  1AOJ A;  4OB1 B;  5KYW A;  1WOS A;  1RAA B;  1WOP A;  2JTE A;  3EG3 A;  2F2W A;  2OK7 A;  3HL8 A;  4PJO G;  4RKU E;  3JB9 G;  1M4Z A;  3S3O A;  5GAN 3;  2YWE A;  3PIO A;  4Z4S A;  1S72 B;  1WHM A;  2XHC A;  1VQM Q;  4E2F B;  1KHC A;  1ZM4 A;  3WVD B;  1KQS A;  1D2E A;  3QSY A;  1VQ8 A;  5LJ5 j;  4PGO A;  1WYX A;  2XZO A;  5GV8 A;  1M3C A;  1N8R D;  4PK4 A;  1LVK A;  3M59 A;  3EGD A;  2ZZG A;  4RG2 A;  1YHQ Q;  5LJ5 g;  1RAE B;  2SEM A;  2O01 E;  4JPB W;  3L1A A;  3VYG A;  2P84 A;  2ZCF B;  3OSV A;  4TMW A;  5AT1 B;  1JO8 A;  5GJW B;  3M9Q A;  4G7X A;  4C8Q D;  4M77 G;  4IUV A;  3A5Z B;  1TUG B;  1TOV A;  4IIM A;  4ASU A;  1ZBX A;  3KFV A;  2EAY A;  3ZIA A;  3QUI A;  1VQL B;  4OMF B;  3MO8 A;  1E1R A;  3JCM h;  4HCK A;  5IXF A;  3OFN A;  1BKB A;  2EVR A;  2KRN A;  2L3S A;  2WSF E;  2K4Y A;  4UAJ A;  3CCM Q;  1FX7 A;  5GMK j;  3B82 A;  1ZBJ A;  5HK3 A;  3DB4 A;  1M8V A;  4XK8 E;  2F1M A;  2JS0 A;  2OTL Q;  5KCH A;  1XE1 A;  2RQV A;  2BUD A;  3G71 Q;  3SJP A;  4NS5 A;  3CC2 A;  1R0B G;  1QCO A;  4GY5 A;  1SHG A;  2DIL A;  3V8J A;  1BK2 A;  2ECZ A;  1EFU A;  5HY6 A;  2VBU A;  1J3T A;  1BI0 A;  2MK5 A;  2QA4 T;  2X53 S;  1S72 A;  5CAI A;  3ES9 A;  3G4S T;  1WU8 A;  1Y57 A;  2EQM A;  1W6X A;  2JT4 A;  3CCE Q;  3CC7 T;  4XKV A;  3E1S A;  4PJO E;  2LJ1 A;  2RQT A;  5FU6 B;  2BM1 A;  3W2G A;  3EH1 A;  5CQY A;  1JA0 A;  1G5V A;  2OBR A;  1V0F A;  1WHK A;  4IIO A;  2VNK A;  1TUC A;  2LP5 A;  3JB9 J;  3CCU Q;  2F5K A;  4IUU A;  3Q38 A;  2LCS A;  1VQN Q;  1IJE A;  3ZL7 C;  3T51 B;  4M53 A;  2E1R A;  3CCR B;  2HZY A;  3CQT A;  4RCZ A;  4TMT A;  4PFP A;  1O9S A;  3H94 A;  3AHU A;  3VU3 C;  1UD5 A;  2QAZ A;  3RUX A;  4JS4 A;  4RG8 A;  5FO0 A;  4ZN3 A;  2BZX A;  3BC9 A;  4N3N A;  1YIT A;  2M5S A;  2PTK A;  4CC4 B;  2GBQ A;  2X6Y A;  1VQK A;  3O5Z A;  2J06 A;  2GQF A;  2E5K A;  5GAO m;  2YUO A;  4M78 D;  3A8H B;  5B6I A;  2DXU A;  2E4H A;  3AVT A;  4RD4 A;  3OOC A;  5KE3 A;  1V0E A;  4RD3 A;  2LT4 A;  1N0V C;  2DX1 A;  2RPN A;  3J80 E;  3UPU A;  1S72 Q;  3BY1 A;  1KQ1 A;  3CCR A;  2A08 A;  2NUP B;  3G7Z A;  4XTW A;  2V8K A;  5H5J A;  4C0D B;  3PVQ A;  5FWB A;  2VJI A;  3OB9 A;  4QFM A;  1W2B A;  4RTY A;  3LW5 E;  1TS9 A;  2DZC A;  2OTL A;  4DK0 A;  3OBW A;  3MET A;  4M7A F;  3ZZ0 A;  4DBR A;  1VQP A;  1YIT Q;  1E79 A;  3GP8 A;  2PIA A;  1E6H A;  2XNC A;  2E10 A;  3BCD A;  4C0G A;  3CPX A;  4EMH A;  2EBP A;  4OF1 A;  4C92 A;  1MHN A;  4Z4V A;  4E7K A;  4B3G A;  3TSZ A;  4M75 G;  2I2L A;  2LX9 A;  2O31 A;  3ZPN A;  1E7O A;  1ZX6 A;  1SHF A;  4FSX A;  1B34 B;  2CGH A;  3CCR T;  3CCL T;  2OJ2 A;  3I56 Q;  4MML A;  5GAN j;  1IHM A;  2E65 A;  4HVV A;  1W2B B;  5KNL A;  2OK8 A;  4B9W A;  2K3B A;  4EDU A;  5D6X A;  2RHX A;  2YT6 A;  2KVQ G;  2JVV A;  2CP2 A;  2K5L A;  3CEY A;  3VKI A;  3EG0 A;  1VQP B;  3CCS Q;  5DS0 A;  1D1N A;  4N4I A;  1Y96 A;  1KC8 D;  1JA1 A;  5IYP A;  4P2N A;  1VQO B;  3CCJ Q;  3INZ A;  1T6Z A;  1RQR A;  4QQG A;  1M2V B;  3QFS A;  2ZPH B;  1PCX A;  3L2U A;  1IRX A;  5A88 A;  1YJW T;  4TVR A;  1UHF A;  2PLF A;  3RKX A;  3JB9 D;  1VQ9 T;  3HPW A;  1TH7 A;  5GAM e;  1DG1 G;  3QYH B;  4AT1 B;  3URG A;  2BE7 D;  4FT2 A;  2HCK A;  4OGC A;  1ARK A;  1H42 A;  1OI1 A;  2DF6 A;  4C92 E;  1N06 A;  4EMG A;  4R71 A;  3SB2 A;  4J9C A;  2B86 A;  4FT4 A;  2OBT A;  4RM0 A;  4KKU A;  4M77 F;  3WBJ A;  1UGR B;  4OB3 B;  2AHJ B;  3FRN A;  3BNW A;  3WQZ A;  4RD6 A;  1M1F A;  3LQE A;  1B3Q A;  3KEW A;  4FN5 A;  2JW4 A;  5LJ3 g;  4P3I A;  3CD6 Q;  5TY0 A;  2DFU A;  3U2Q A;  3AVU A;  3LGF A;  3Q6R A;  1VA7 A;  2L89 A;  2VUB A;  4M0L A;  3MP6 A;  4BDZ A;  4TMX A;  2E5Q A;  2DKG A;  1PM3 A;  4M75 B;  1WNL A;  2BE9 B;  3CCL B;  2E3H A;  4M78 F;  2DZ9 A;  1R77 A;  2EWN A;  1E3X A;  2X3U A;  3OYY A;  2RHI A;  1WQW A;  2DBK A;  4HVU A;  1SSF A;  4ACB A;  1YNZ A;  2OI3 A;  3H9N A;  1VQK T;  1MMA A;  4JS5 A;  5LMZ A;  1NLP C;  4X06 A;  5FO1 A;  1EX4 A;  2KXD A;  3FLG A;  1Y0R A;  2C78 A;  2B5O A;  3A8L B;  1X75 C;  1RI0 A;  3VO2 A;  1X2Q A;  5KYY A;  3MHP A;  1PJ7 A;  3PUN A;  3GPL A;  4XN3 A;  1B07 A;  3I56 A;  3LVB A;  1F60 A;  4OML A;  2FL7 A;  3VRZ A;  2I0N A;  2Y4Y A;  2HEQ A;  5KYW B;  2WJV A;  4O6J A;  4P26 A;  4Y9R A;  3CCU A;  3NHN A;  2GK7 A;  1TWB A;  4M7D C;  4YXW A;  3SHW A;  2LZJ A;  2NPF A;  1QWE A;  1XOV A;  2M0O A;  4OMN A;  4OMQ A;  1A0N B;  1KSW A;  1QVF P;  3M58 A;  2HKQ B;  4BI4 A;  2B7B A;  2X4W A;  1NB0 A;  1KC8 C;  5J35 A;  1MNE A;  4X07 A;  4X34 A;  2QQA A;  4XLA A;  2K9G A;  2EYZ A;  1Q86 C;  4KT0 E;  2PE3 A;  1BI3 A;  1VJS A;  2K79 A;  3CME A;  2YLC A;  3WXM B;  2HAX A;  2FPF A;  1AVZ C;  2OAW A;  2BGJ A;  1HK9 A;  3RES A;  2DCU A;  3CPF A;  1Y7X A;  1NEB A;  2VB6 A;  3OYA A;  5HZA A;  2MYS A;  4CI0 C;  2RC6 A;  1KD1 C;  4WWV A;  3CC4 A;  1M90 D;  3OPO A;  2M9U A;  4C0F A;  3ZEH A;  4M7D A;  2C5B A;  4TKO B;  2V26 A;  3OSS C;  2BF4 A;  4FIB A;  4U9U A;  3VV0 A;  5DLQ E;  2QQR A;  1EXM A;  2JM8 A;  1YHQ B;  3EAE A;  2F43 A;  1VF7 A;  3RMQ A;  3P8D A;  1N9R A;  2X35 A;  3LYI A;  3H6Z A;  2V1Q A;  3GVL A;  1BPL A;  1M1K R;  2QTZ A;  1W9X A;  2VXE A;  2IIM A;  2R57 A;  2BVN A;  4XN0 A;  2PUO B;  4BPR A;  4QVC A;  4WZL A;  3M0Q A;  3OW2 S;  2QQ9 A;  3FJO A;  4M7D F;  2Q6O A;  1E64 A;  2FRY A;  2GCX A;  5KYN A;  1NE8 A;  1F20 A;  3BW1 A;  3MEW A;  2VC8 A;  5GMK l;  1FDR A;  2EYW A;  3B78 A;  3A3G A;  1G3S A;  1UGQ B;  4M75 F;  2RJE A;  3BDL A;  3W2F A;  2K57 A;  1MV3 A;  1GCQ C;  1Q7Y C;  3P8B B;  1FYN A;  2FB7 A;  3OW2 P;  1K9M C;  2DD4 A;  2F2X A;  3SWN B;  4LUD A;  1DDI A;  3BH4 A;  2EIX A;  2EJF A;  1IRE B;  2L3Q A;  2ZPE B;  1ACM B;  3TCJ A;  1K73 C;  2OTJ T;  2V7U A;  4MDW A;  1IZ6 A;  1JB0 E;  1PNJ A;  5GAN 8;  1KIK A;  1V29 B;  1ZSZ C;  1SM4 A;  4QT7 A;  5A0D A;  1WPY A;  3PVL A;  4AG2 C;  1A8P A;  2DPP B;  4R0K A;  5L8R E;  4FW2 A;  4RCB A;  4E47 A;  1I8D A;  4C8Q A;  1NJI U;  3DDY A;  2EYX A;  1T3S A;  4J6Y A;  1VQ4 A;  2LQW A;  3E9F A;  3SLN A;  2EYQ A;  3HHT B;  4XR6 A;  2ZBU A;  3KL9 A;  2NWM A;  2CUB A;  3ONU A;  1SEM A;  2XZP A;  3CCS T;  4VUB A;  4AC9 A;  1PHT A;  2YUP A;  1MUZ A;  3H0F A;  3C95 A;  3EHR A;  1SG5 A;  1H3H A;  5AYF A;  4J9E A;  2JDI A;  3MJX A;  4ZCM A;  1NJI R;  1RAB B;  1ZUU A;  2DIQ A;  2HCJ B;  3W5H A;  3QO3 A;  5GMK m;  4H9G A;  4M75 C;  2PZ1 A;  2VBT A;  2CP6 A;  1N6A A;  2RD1 A;  2WSE E;  2KRS A;  1YHQ T;  2XZL A;  4XOR A;  1YP5 A;  2VVK A;  3VS1 A;  4A4K A;  2QEX B;  1YJN B;  4E7I A;  2HQX A;  2KXC A;  2JTF A;  3I1F A;  4JLI A;  3SFM A;  4Q5W A;  5GV7 A;  4PC7 A;  2DY1 A;  2AIR B;  3AT1 B;  1QFZ A;  3ASQ A;  1SRL A;  1K9M R;  2DYB A;  3EHQ A;  1K28 D;  2C77 A;  2ABL A;  3M5A A;  3RR6 A;  2W6J A;  3GQB A;  2ZTG A;  2M0Y A;  2JJ9 A;  2K3X A;  3HSB A;  1OYX A;  2ZAE A;  3T56 B;  2RF0 A;  2EQI A;  4AF7 A;  4UZE A;  4II3 A;  4GQN A;  1UFF A;  5FLX E;  1YN8 A;  5ECA A;  1YCS B;  1KJZ A;  4HT9 A;  1QFJ A;  2RQU A;  1QVG S;  2XDB A;  1QGY A;  2DRM A;  1OGJ A;  4F7U F;  4JMQ A;  4BE2 A;  1VQ8 B;  3TEE A;  2EFI A;  3MCA B;  3UWN A;  2KT8 A;  4YEL A;  1N9S A;  1S0U A;  4X7E A;  3I5R A;  2MWO A;  4M78 B;  1K1Z A;  2F1L A;  3WNB A;  4J6W A;  3JCM W;  2EFG A;  3CTA A;  4KUI A;  2CSI A;  4XM3 A;  4WQM A;  3DKM A;  2EIF A;  3GLX A;  2KE9 A;  1C1A A;  1QUE A;  1HYO A;  2QTX A;  1KFZ A;  4ZGE B;  5BSY A;  1W70 A;  2QGG A;  1K73 R;  5FU7 C;  4A63 B;  2X6W A;  2KGT A;  4G5G A;  2EKH A;  3QXE B;  3WYA A;  1YIJ A;  1X6B A;  2PUK B;  3W2E A;  2JZ2 A;  3M0U A;  4HCB A;  3PFS A;  2RB6 A;  4KGX B;  3N5B B;  1D1C A;  1OV3 A;  3P27 A;  2KMT A;  4Z1M A;  1QCF A;  4QVD A;  2DJQ A;  3VS7 A;  2YDL A;  2V7X A;  5J3B A;  2LX7 A;  2BMW A;  2AT1 B;  1D3B B;  1PG5 B;  1VQ5 T;  4RUG A;  2DEU A;  2WPD A;  1QKX A;  3CXC A;  3ZBU A;  2P4R A;  1VIF A;  3PT9 A;  1OEB A;  2CZ6 B;  4M78 C;  3GIR A;  1V76 A;  1OGI A;  2R6H A;  1AHJ B;  5IYR A;  1JRI A;  4FYV B;  5LJ5 h;  3E19 A;  1WFW A;  2DJZ A;  4QVZ A;  1X6O A;  1CQX A;  3OYG A;  2P4T A;  3MCA A;  3AVY A;  2C4U A;  3V7R A;  3G6E B;  1ZUK A;  3C12 A;  1GO2 A;  3W5U A;  4JJD A;  3Q3A A;  2BN4 A;  3TQ7 P;  1UJ0 A;  4MZP A;  1I5O B;  1QW1 A;  1NBE B;  2GNC A;  3UT1 A;  3JCM g;  4JUV A;  4HXJ A;  2GK6 A;  1Q81 R;  1FNC A;  1K0X A;  2CW5 A;  3EFO B;  4PL6 A;  1YI2 A;  1K0S A;  5EMN A;  2X85 A;  2CP0 A;  1KK1 A;  3G4S A;  2DEQ A;  3OW2 B;  1FND A;  4XOP A;  1UGV A;  3FJ5 A;  4BB7 A;  1YHQ A;  1YLO A;  5F4O A;  4X1V A;  3CB4 A;  4AG1 C;  5D6W A;  2V4D A;  2H3J A;  1HA3 A;  4RCY A;  3R6N A;  4JRK A;  4ZGQ B;  1HSQ A;  1WHG A;  1T0H A;  4XU0 A;  3VS3 A;  4DQ2 A;  2GRE A;  1R5O A;  3MEA A;  2KYM A;  3CCE A;  5LJ5 e;  1I7P A;  3THK A;  1AWJ A;  3EGU A;  2GJP A;  1PC0 A;  2HD0 A;  1U8R A;  1UJY A;  3V8L A;  3G71 A;  4PC6 A;  1NYF A;  1AMO A;  2CP5 A;  3G71 B;  4B43 A;  5KYU B;  3MHX A;  3ONY A;  1H3Z A;  2VKN A;  1COW A;  2COY A;  3ZZT A;  4LDV A;  1YIJ B;  1YI2 T;  3B8H A;  1G7R A;  1IHW A;  3JB9 F;  1M3A A;  1G8X A;  3BFM A;  5A0L A;  3EG2 A;  2D3N A;  4M75 E;  2KSS A;  3SDZ A;  2MOX A;  2DA9 A;  3IQL A;  4II2 A;  2DAQ A;  4HA8 A;  4LBZ A;  1KG1 A;  2EGE A;  4P5N A;  5DSZ A;  1D1A A;  1XFO A;  2E3I A;  2OAU A;  1T3L A;  3RNJ A;  5GAM d;  2RNA A;  2XK0 A;  5DLO A;  4RLZ A;  4R56 A;  1TTH B;  3LX7 A;  1OOT A;  3C94 A;  4YAF A;  1QVG P;  4LD6 A;  4M4Z A;  1WOO A;  1IO6 A;  1EFC A;  6AT1 B;  1WTH D;  4QV2 A;  5CKB A;  3CXC S;  4LDY A;  1AWW A;  2GTO A;  3AVW A;  1O75 A;  4LBW A;  1KQ2 A;  5CIU A;  3QSU A;  3L2Q A;  3FKS A;  3VR6 A;  2EPD A;  4O5V A;  2V8I A;  2LC4 A;  4WCI A;  2IG0 A;  2YWF A;  1YIJ T;  2EW3 A;  4II1 A;  4N0A C;  3JQP A;  4OVA A;  1VQ7 Q;  1IB0 A;  2YUN A;  2QEX T;  1VQ5 A;  1Q82 R;  1MMG A;  4L5G A;  3FC3 A;  1X69 A;  1G7C A;  4GLM A;  1E1Q A;  2GFU A;  2QE7 A;  3ZC3 A;  4CC7 A;  1F1B B;  2V1R A;  5GAM f;  1CKA A;  5IHN A;  3PTA A;  2HBP A;  1YWP A;  3U6K A;  3CW2 A;  1VQ6 B;  2XID A;  4F7D A;  4OMM A;  4XU3 A;  5LJ3 h;  4TSF A;  2K2M A;  1EIF A;  1B34 A;  2DER A;  1YX2 A;  2FVU A;  5DN6 A;  2KK4 A;  3MP1 A;  4BUG A;  4ACA A;  2QK0 A;  3CD6 T;  2FO0 A;  4Z4W A;  2M1H A;  3L2V A;  3EFS A;  1E63 A;  2OTJ Q;  3FB9 A;  1U1S A;  2ED0 A;  2CBX A;  3JCM Q;  3OY9 A;  3CME T;  4CC2 A;  1VYU A;  2FVG A;  1K8A D;  3M4Y A;  1UD3 A;  5IH2 A;  4UC4 A;  2ZZQ A;  4FYY B;  5FRO A;  2WJY A;  3OKX A;  2OTJ B;  4PC1 A;  2HNI A;  1YJW A;  4C0D C;  1ZUN B;  2L3R A;  1RLQ C;  1U06 A;  4PC3 A;  3CC2 B;  1VQM B;  3CPW S;  3DLL A;  4A4H A;  2DL3 A;  3ASK A;  5LJ5 d;  3J81 k;  3JCM f;  5E6T A;  4BDY A;  3GBQ A;  5GMK i;  4Y91 A;  4LD9 K;  2XOK A;  3FDR A;  5GAO l;  1NYG A;  2R58 A;  3VS2 A;  1VQ4 T;  3ZBT A;  1QVF S;  1X2K A;  3LWH A;  3FPK A;  1CSK A;  4Z4Z A;  4M78 E;  2GQI A;  1SKU B;  1YJN Q;  1D0Y A;  1GAW A;  3QZ9 B;  5AN9 A;  2E6Z A;  2XKO C;  4LC0 A;  3BQJ A;  3D26 A;  1YWO A;  3OBY A;  4BE0 A;  4PNO A;  1W2B S;  2HSE B;  4XLC A;  4BD3 A;  4M2L A;  3M56 A;  2O9S A;  1QWF A;  3PVD A;  4QQD A;  4Z4Y A;  3P8H A;  3A8O B;  1J9Z A;  2RN8 A;  4M77 D;  2LCC A;  3BE3 A;  9ATC B;  4QQ6 A;  2ZPB B;  4E6R A;  3BCF A;  4C5G A;  1QUF A;  2WAC A;  1JJ2 S;  2D9R A;  3CCL A;  2E6N A;  2RJD A;  4XLF A;  4P25 A;  5D7U A;  4FWT A;  3REB B;  3OS2 A;  4J9D A;  5EG2 A;  2RM4 A;  4C8Q E;  1PJ5 A;  5IHI A;  3ZFJ A;  4FU6 A;  4J5Y A;  3QZ5 B;  3HFO A;  3VO1 A;  2JXB A;  5GMK h;  1RAI B;  4FYX B;  3OEE A;  1Q7Y D;  1KHI A;  4XLH A;  1ZM2 A;  4PJM A;  5CKD A;  1VQ8 Q;  3RY8 A;  3EH2 A;  2ROT A;  3JAM E;  1PKS A;  2D3L A;  4DQL A;  3W2I A;  4WTO B;  1PKT A;  2A0F B;  4KH1 B;  4LDX A;  3G05 A;  4DBF A;  2ZIT A;  5BSX A;  3JCM e;  1U3O A;  2MCN A;  5GAN e;  4P9S A;  2O4X B;  3QII A;  1BQE A;  3VRY A;  2LQ8 A;  3VS0 A;  4AFS C;  4DQK A;  4OPO A;  2QGF B;  1GVH A;  2VBV A;  1N27 A;  1VHE A;  1VYT A;  2DL7 A;  2BIV A;  2QDX A;  5D6Y A;  3NTI A;  4M7A A;  2BKD N;  3UDC A;  1NG2 A;  3CCV B;  4B47 A;  1WLP B;  1ZM3 A;  2F5T X;  3CCQ A;  1W87 A;  4L8J A;  3JQQ A;  4OP0 A;  2XDD A;  3JQR A;  1FRQ A;  2JN9 A;  1G3Y A;  1VQ4 Q;  4R55 A;  1Q9S A;  1MND A;  4WF2 A;  4C92 D;  4FW1 A;  4OB2 B;  1BYM A;  3M57 A;  1V5V A;  2ZL7 A;  4X7D A;  3OEH A;  3T53 B;  2A3L A;  4Z88 A;  4PC2 A;  4FL6 A;  1OQK A;  2D0N A;  2GF7 A;  3CP8 A;  2NUT B;  1R0C B;  2O2O A;  2BGI A;  3PE0 A;  4C92 C;  4PJO C;  4X05 A;  2ZTN A;  2D6F A;  4F16 A;  5I21 A;  3OS0 A;  1M30 A;  3SWN A;  3CME Q;  2YHT A;  4J0Q A;  3JRZ A;  1DAR A;  4AF6 A;  2BV3 A;  3S6W A;  4LDW A;  2JMA A;  2JUF A;  2CRE A;  4ORZ A;  3VS4 A;  1OZ3 A;  3LLR A;  4RTX A;  2DTI A;  5C0M A;  1VQN A;  1JEG A;  1PSF A;  2DL4 A;  2D0Q B;  2DE0 X;  4IKF A;  2Q6I A;  2BZY A;  3L2W A;  5HZB A;  5KYX B;  1M9S A;  1NPP A;  5KCO A;  2KYB A;  2ZZE A;  1G83 A;  3A8J A;  1UD8 A;  4IUQ A;  1FXX A;  2ZGW A;  4P12 A;  4EIK A;  2Z6B D;  1OB0 A;  1WXU A;  2DK3 A;  4DK1 A;  2KEA A;  2LJ3 A;  1QMC A;  4XU2 A;  1RLP C;  4J9F A;  2M51 A;  3OAA A;  2FZG B;  1KK2 A;  3A1P A;  4Y7C A;  1WHH A;  4KUD K;  4OOV A;  3QFR A;  1D1B A;  4PJN A;  4PJO F;  3KUF A;  2X4Y A;  4F04 B;  4LNP A;  4J9H A;  4DBQ A;  1VQ9 A;  4B44 A;  2FG0 A;  2YWW A;  1OB5 A;  1GJR A;  5KYX A;  3CC2 Q;  3ASP A;  1UEB A;  2RJC A;  2QA4 A;  2DET A;  2EJG A;  1TTT A;  3VNV A;  1BB9 A;  5J26 A;  3CES A;  1R8O B;  2KY9 A;  3UA7 A;  1T5E A;  3A8G B;  3ULR B;  3CC7 A;  4X7F A;  5GAN g;  2X6X A;  1SPK A;  1OPL A;  3OYD A;  1Q81 C;  3X28 B;  2RI3 A;  2P0P A;  4B3X A;  1TUI A;  4LN2 A;  3WND A;  4C5I A;  1G2B A;  1BX0 A;  2KRM A;  2VJJ A;  3JCM b;  4C8Q F;  2ZPG B;  1VYV A;  1XB2 A;  1Y0M A;  1Q95 G;  4EMK A;  1QP2 A;  3CBP A;  3PUM A;  1NEG A;  5A2Q E;  3HAG A;  4KGZ B;  2A37 A;  3JCM J;  3G1J A;  4DEX A;  1CNF A;  1K9M U;  2VGN A;  1JQQ A;  1MMD A;  3CCV T;  5DY9 A;  1QVF A;  1W34 A;  4XKW A;  4YEJ A;  2GPJ A;  1VHO A;  5CO7 A;  2QG9 B;  3M55 A;  2LQK A;  2KBT A;  2JN0 A;  3M54 A;  2AZS A;  4Z8A A;  2LJ0 A;  4RTZ A;  3CC4 B;  2LCL A;  3ZZU A;  3TRE A;  2E41 A;  1UDL A;  1RUW A;  1S1N A;  4BI3 A;  3CCU T;  1VQ4 B;  1VOM A;  2RI2 A;  2BZ8 A;  1UMK A;  2D8J A;  2J6K A;  1BIB A;  1EWY A;  2COW A;  1WPC A;  4F7U B;  2J6O A;  1AIP A;  3PGG A;  2L8D A;  2LMJ A;  4KKS A;  3UA6 A;  1G7S A;  3OJW A;  1WX6 A;  4WZE A;  2D1X A;  1VQK B;  1Y96 B;  3CCQ Q;  3NTK A;  3GSI A;  4K11 A;  2DNU A;  1OUL A;  5CVI A;  4BI8 B;  2X3X D;  1K9A A;  1M2V A;  1SRM A;  3LNN A;  2QA4 Q;  1FMV A;  1TVC A;  3H8Z A;  3MKD A;  3SEM A;  5LJ3 f;  4RPB A;  3QWX X;  5F4J A;  4M75 A;  2V8J A;  1QGZ A;  2F2V A;  2XDP A;  3LO8 A;  3CMA Q;  2C0I A;  1ZSG A;  1U2R A;  5FWC A;  4XQF A;  4XTX A;  1KC8 R;  2KVO A;  1ZUY A;  4RCC A;  3ER0 A;  1EP2 B;  3BY2 A;  1EFT A;  1QH0 A;  4N4H A;  3OYK A;  4E0F A;  1WDT A;  3OJX A;  3OP1 A;  5DM7 R;  4Y92 A;  4Y28 E;  4HIZ A;  2LQN A;  3I55 B;  1M1K D;  2LDM A;  2DLP A;  1I18 A;  1PKV A;  3VMF A;  2H8H A;  5FIU A;  3A3B A;  1OU9 A;  1TUD A;  3VS5 A;  1GFC A;  3RDV A;  4Z4R A;  4F7U E;  4RDK A;  5TV2 A;  2OYN A;  4J9G A;  4QKU A;  1XQH A;  4BE1 A;  3QPH A;  4FM4 B;  2RO0 A;  4EPC A;  2HQH A;  3W5V A;  2BSA A;  1N8R R;  2XIC A;  4G7W A;  3OMG A;  3D7S B;  1YJ9 T;  4B48 A;  4V2S A;  1WJR A;  3QJY A;  4QVJ A;  1KD1 D;  4Z4T A;  2O4X A;  3E9G A;  1M90 U;  3OE7 A;  1FNB A;  1JXM A;  4XLE A;  4IUR A;  2VWF A;  4A4G A;  3I35 A;  3CCU B;  3JCM d;  5GAO n;  3WNC A;  1SKY B;  2CP7 A;  3QHS A;  1H8K A;  2HBW A;  1WA7 A;  4DEY A;  2NLU A;  1N08 A;  1FWZ A;  1WJS A;  4HE5 A;  4YHB A;  4DNR B;  1RAF B;  1N8R U;  1XQB A;  4XAX B;  2L3P A;  1RAC B;  1B2R A;  4X9D A;  1UE9 A;  3C0C A;  3G6E Q;  2FZC B;  1M8M A;  2VV5 A;  1OHH A;  2XMF A;  1UD4 A;  1W35 A;  4X9C A;  4KGV B;  2HL3 A;  4M7D E;  3CC2 T;  1H92 A;  2AHO A;  3CXC B;  2QTL A;  1CNE A;  1UEC A;  4J83 A;  3OYE A;  4M77 B;  2M02 A;  5IT9 E;  2WZN A;  4E7S A;  1JU5 C;  3OZW A;  2ZZF A;  2JTM A;  1AD5 A;  1AEY A;  4DNT B;  4B4D A;  1YI2 B;  2QN6 A;  1HD3 A;  5GAN 4;  2YLB A;  4E7J A;  4LE9 A;  5I2M A;  5FRN A;  4XTZ A;  2YWH A;  3RBB B;  5IK2 A;  2FRW A;  1T6Y A;  3I9Q A;  1WSV A;  5C6S A;  2MIO A;  3JSC A;  2M16 A;  4M7A G;  4YAO A;  1VQ7 B;  4NBS A;  5GAO p;  3EGX B;  4KRT A;  4RPD A;  4RTT A;  1RQP A;  1Q82 D;  2FPD A;  3Q1J A;  4BY6 B;  1LPL A;  1DJ7 B;  4ZTJ A;  3AGP A;  3OMC A;  4DBH A;  1KK7 A;  1UHC A;  1QCN A;  2MAM A;  2YWG A;  4NCN A;  3OYJ A;  1MRZ A;  3S3N A;  3HRT A;  1IGQ A;  1TSF A;  4ELZ C;  2HMA A;  3PNW C;  4LDU A;  4M7A B;  2D74 A;  2ROL A;  3WY9 A;  1BIA A;  3RKY A; 
#chains in the Genus database with same CATH homology
 2DOG A;  2F1L A;  3A1P A;  3H9N A;  2DYI A;  2QGG A;  3HTR A;  1PM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...