2QGGA

X-ray structure of the protein q6f7i0 from acinetobacter calcoaceticus amms 248. northeast structural genomics consortium target asr73.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
NVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPWYIETKAGWQTVDVKRWKPHGKGLVVSLKGVSDRTGAESLVASNIWIAKSQLPKADVDEYYWSDLKGLTVLGLDDEEQEVNLGQIHELFETGANDVMVVRATPDSIDSEERMIPWHKDVVQRVDLEAGRIYVNWGVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the protein Q6F7I0 from Acinetobacter calcoaceticus AmMS 248.
rcsb
source organism Acinetobacter calcoaceticus
molecule tags Structural genomics, unknown function
molecule keywords 16S rRNA-processing protein rimM
total genus 41
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2007-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2qggA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2qggA01
1PM3A 3H9NA 2F1LA 2DOGA 3A1PA 3HTRA 2DYIA 2QGGA
chains in the Genus database with same CATH superfamily
4LDWA 2HCJB 3CC2T 1OEBA 4QVZA 4WQMA 1ZX6A 2HD0A 3NGPA 3NTHA 1ABQA 3GP8A 1GCQC 4BUGA 3CCMQ 2QEXA 3FKSA 3O5ZA 1KHCA 2AIRB 2GFAA 2IVWA 2QQAA 3JCMP 3GLXA 3N5BB 5KNLA 2EQJA 3P8BB 2ZPFB 4B9WA 4L6V5 3CPFA 3J80E 3BE3A 1KC8C 2XIDA 1B23P 3E9GA 4IUQA 4OGCA 3ZBDA 2V7TA 4C8QE 2K3YA 3CP8A 3CPWS 1I81A 3G71Q 2KQWA 2QMUA 2CZ7B 2GTOA 4DQLA 5KE2A 1YIJQ 4KGVB 1X75C 1PD0A 2ED0A 4BDYA 2GREA 3EGDA 2A3LA 3ISXA 3VS6A 5HZAA 4R55A 2R5AA 2GF7A 1VQ5A 4WZEA 4P26A 1U8RA 5FIUA 1Q81R 1YITT 1GBQA 4J5YA 3CCQT 1H8HA 2V7WA 1KQSB 1U2RA 2F5TX 2J7IA 2K7AA 3CCJQ 1QVGB 4LDYA 4M78C 4DA4A 4GQNA 4JRQA 2NUTA 3CCLA 3SWNC 3LGLA 1VQ8Q 2NUPB 4C0GA 2KT1A 1IXDA 1NPPA 5F4JA 3DDYA 1MV3A 2DOGA 2V4DA 1Y96A 3A8LB 2C0OA 4JDSA 4TVRA 5J39A 4RTWA 3GOXA 1E3ZA 3RNJA 5CDFA 2O9SA 1Y0RA 5L8RE 4M0LA 1BCOA 1NLOC 2EQKA 4C5IA 4M75D 1KK7A 1QVFS 1IGUA 2R6HA 1VQKA 4PJNA 1OB0A 1ZLMA 5KYNA 1OI1A 2EJFA 1UD5A 3MP6A 1WHMA 5KYUA 4DBHA 4OMPA 3CC4T 2ZBUA 2LNHB 3OS1A 4AFQC 1ZA1B 1AOJA 1GJRA 1RLPC 1JJ2S 1WHLA 5DM7R 2BTTA 4RTUA 1Y0MA 3H8ZA 1M1GA 1XOVA 1IZ6A 4P6YA 3SWNA 3T56B 4P22A 2QN6A 5M9OA 1G3WA 3URGA 3CMEA 1KC8D 4XLHA 1ZHIA 1I07A 5I2SA 1ZUNB 5J26A 1PJ7A 5HK0A 3OW2B 2ATCB 4M78D 3MO8A 1YHQB 5DSZA 1I0CA 1Q82R 3ZBUA 1WDTA 1N5ZA 1YJWQ 2LT4A 4BE0A 5IK2A 1V0FA 3ES9A 5FU7B 3QE2A 2E41A 3META 4FCYA 3CC2B 1VQLB 2HKNA 1KFZA 2GCXA 2XHCA 4CI0C 2OTLB 1E6HA 1FMWA 4HCKA 2VKNA 2VVKA 3AVVA 1OQKA 3D26A 1I1JA 4RD2A 3QSYA 4CC4B 4BACA 2OTLA 2DVEA 2A7YA 3RKWA 4HE6A 3FB9A 2M1HA 1KD1C 1D0ZA 1UHFA 2PVGB 2C4TA 4F7UG 2EQMA 3T9NA 3FEOA 2VYTA 3OYNA 4XOPA 1RAIB 1K0XA 5LJ3d 3G6EQ 2P84A 1RUWA 5GAOq 1YJWB 3GNGA 1NYFA 2ZPEB 5GAN6 3QFCA 2RJFA 5CQXA 2YRCA 4EMKA 1N9SA 1RL2A 2K3XA 2JJ9A 3QO3A 2BGIA 3RY8A 2YRDA 3CCLT 2NWMA 3QHSA 3M53A 3QFTA 5L23A 3AVTA 4D6WA 4KGZB 2XU8A 3I55Q 1ZSZC 4ANJA 1YJWT 1YHQA 1I7PA 1T3SA 1OHHA 3M0UA 4MDXA 1YX2A 1AD5A 1AWWA 3GIRA 5FU6C 4II3A 2JN9A 2MF2A 1MUZA 3CW2A 2NPFA 1CKBA 1TH7A 1EWYA 4B48A 5A8AA 2X9HA 3HAGA 2E1RA 1AWOA 1U06A 3I1FA 1IHWA 2CSIA 2B86A 1WSRA 3OYIA 4Z4SA 5A0DA 4J0QA 4RDJA 3H94A 2ZL5A 2AHJB 2OTLT 1OV3A 1JEGA 4M75A 4UZEA 1KD1R 3OOCA 1RADB 3R6JA 2LVMA 2MCNA 2O4XB 2EYZA 2RHUA 4FYYB 1K76A 1PRLC 1KZLA 3TSZA 2AK5A 4B9XA 4P12A 1D3BA 2GTJA 3PUNA 3QFRA 3T51B 1OULA 4M7DG 3HFNA 5DS0A 5DLOA 3CCSB 3RESA 3IQLA 1WHKA 3LH5A 2O2OA 4DEXA 4KGXB 1BJKA 2X6YA 1JRIA 2C77A 3DB4A 2X0KA 2PUKB 4N0AA 3CMEQ 2E6ZA 1WU8A 3CMMA 2L0AA 2COWA 2H3JA 2DEQA 2O31A 4RCBA 4ZTJA 4KRTA 2JTFA 1Q7YD 4IKFA 1S0UA 2EJGA 2D8HA 1JXOA 3OYAA 5IHKA 1VQNQ 2CP5A 1WYXA 1M4ZA 4Y9UA 1YCSB 3MEUA 2MIOA 3L2VA 3SD4A 2C2WA 2J6OA 2VWFA 2SEMA 2ZBVA 4ZTFA 1MNEA 5IH2A 2KT8A 1N9RA 2VNIA 1D2EA 4P5NA 4Z8AA 1W35A 1QP3A 2GK6A 3WNBA 2DL7A 1YJ9Q 4RPDA 3RIRA 4NL2A 3JSCA 2V7QA 2FZKB 2BZYA 4PLIA 3OYFA 2OTJT 5TRDA 1K8AC 1TG0A 4AT1B 4M4SA 1QW1A 2FX3A 3V8JA 2RI5A 4HKEA 5FA6A 1TS9A 3W5UA 3V7AA 5GAOr 1YBYA 1FNBA 2XZPA 3BCFA 5KYWB 2RC6A 4C8QA 1GXIE 5L46A 4DBFA 1KQSS 1Q82U 2WYRA 2EKHA 2HL3A 4XU0A 4ZV4A 3ASKA 5FWCA 2DPPB 4BI8B 2B8AA 2K6DA 2YXYA 3EFRA 1YN8A 4C43A 1Q82D 2ZPGB 1QFZA 3Q6QA 4TMXA 3CD6T 1LJOA 2LTOA 3REBB 1E79A 4WZLA 1G2BA 2EFIA 3VYHB 1QWFA 3JCMh 1VHOA 1Y71A 2BM1A 4JZ3A 3E19A 3V8KA 1M3CA 1UGPB 5KYXB 3J81E 2CZ0B 1UUEA 2J05A 3PMIA 4HVVA 1TUDA 5FU7C 3OYJA 4XKVA 2DZ9A 4E7LA 3CCRB 2GFUA 1FDRA 2RHZA 5KYUB 4P25A 1F60A 4PL6A 1ABOA 1AWJA 3MCAB 1GRIA 3JB9F 3KEWA 2PTKA 1EFUA 3JQPA 4M7DF 4PC2A 2XMFA 1WSVA 2CUBA 2KNBB 3A98A 2FRYA 1YJ9B 2C5BA 4MZTA 5IXFA 2DYIA 1Q81C 3ASRA 2EWNA 2BM0A 5GANh 1QCFA 2DBKA 1NM7A 1GR1A 1JJ2A 1M1KR 4AG1C 1B7TA 2QEXT 1K73R 3CCET 5CKHA 4FU6A 4M53A 3G6EB 5GMKl 2FPFA 3OYKA 2ZTGA 3BFMA 2DM1A 4L8JA 4UAJA 1C0MA 1BBZA 4X7EA 3WBJA 2ENMA 4Y92A 1Q86R 1Q86C 1G7TA 3CCUA 5TY0A 2RM4A 4M4ZA 4OB2B 3R6OA 4PFZA 3VRZA 1G7RA 5CQYA 1Q81D 1UGVA 3UWNA 3SLDA 1I4K1 2HQHA 1MMGA 3CCRA 3CCMA 2ZL6A 2DD5A 1TOVA 2PNIA 4M78B 4PJJA 1UEBA 5FWBA 3PFSA 1P4MA 3VO1A 2BKDN 1X6OA 3AHUA 3CCMB 2C5HA 2W10A 4IUPA 1B2RA 4XU2A 1EFTA 1MHNA 4EMHA 2RHXA 2RMOA 4M77E 4YXWA 3HRSA 2X53S 2DJZA 1BI3A 4JMQA 1E1RA 2YDLA 1QUEA 4HCZA 2DCUA 2DZCA 2LJ3A 3PA2A 2ZTNA 2K79A 1HSQA 2QDXA 1VQ6B 4C92D 4E7ZA 1VQ8B 2LCLA 2KROA 1E6GA 1YI2B 3HHTB 2WSFE 4Y28E 2ROLA 1VQ8A 2HDNB 3NHNA 3V8LA 5GAMf 5CKFA 1VQ5Q 4PKCC 1D1AA 3ASQA 1NB9A 1H641 2JZ2A 3G6ET 1YIJA 4RD0A 2OAWA 2EGAA 3SEMA 3QXEB 2CH4A 1VQKQ 3VUBA 2VBTA 2BZXA 3Q39A 2VNHA 4M7DA 2HAXA 2Y4XA 1LOJA 1TU0B 2NYSA 4Z02A 5GMKj 3PMTA 1MMDA 5GAOl 1QGAA 4Y7CA 4Z1MA 4M77D 6AT1B 4F7UA 3OYBA 4PNOA 3CCLQ 1PNJA 2M0OA 3CXCA 1UD6A 1OZ3A 2D1XA 2F2VA 2LQKA 1WP6A 4RG2A 1UHCA 1Y07A 3BDUA 3OYLA 3QWYA 1M8VA 1M2VB 5GAN7 1QVPA 4OMQA 4OMOA 1I18A 1QVFP 3MKDA 4IUUA 1VYTA 3OA6A 2CKKA 5LJ3j 3EG2A 2QA4A 1SHGA 2KXDA 1Y0YA 2XZLA 1UGQB 4TKOB 2X4XA 4EMGA 4XU1A 1BMFA 5GANj 4M78F 3U6KA 3EGDB 5FO1A 4X07A 1TWBA 2RF0A 1UJ0A 1NLPC 3CC4Q 2V7VA 3HP9A 4HXJA 3V76A 2KMTA 5A0GA 1VQKT 1VQ7B 3CD6Q 1D1BA 4N3GA 5HKKA 5IAYA 1QVGA 3A8JA 1UE9A 2WJVA 2F2XA 3EG1A 4DOWA 5C6SA 3VS0A 1UD2A 4FN5A 2EYXA 1VQ4Q 2L5QA 4FW2A 3MJXA 3INZA 3RDVA 4WZKA 3CMAB 1K73U 2XNCA 3C12A 4PGOA 2RQVA 2WZPP 1SM4A 2YWWA 2HEQA 3ZPNA 3T53B 1WHGA 1YWOA 2QQSA 1WOOA 3ZZUA 1XTDA 5LJ5d 1WDXA 2EIFA 2RHIA 1OYXA 5A2QE 3M54A 2CRVA 3BW1A 3QPHA 1SPKA 5GMKm 2A08A 3X20B 4QHYA 2C0IA 3OJWA 2GQVA 1ELOA 2HZYA 3AVXA 2MAMA 4RCCA 1XB2A 5FRNA 2LCCA 2PZ1A 4HT9A 3W2IA 1QUFA 3VO2A 4ZGJB 1EP2B 3EG3A 2CP3A 2FEIA 2EQUA 2COZA 2KRNA 5FO0A 4X7CA 1LPLA 3SHWA 1YIJT 2PLFA 2HKQB 3HRUA 3ASPA 3ONYA 2AT1B 4J9GA 5J3OA 4C5HA 4XQFA 2OBRA 4FSSA 1AWXA 1EFNA 3M4GA 3TQ7P 2CDTA 4RUGA 2VJJA 2P0QA 2GNCA 1KQ2A 3W2GA 3Q38A 1SSFA 2HSEB 3E2UA 3ZZTA 2DTIA 2HL5C 1M90D 1FX7A 5H5JA 2MWPA 1KJWA 3CCST 4Q7JB 4FW1A 1K9MD 3OBYA 1VQ4T 1H85A 5J3BA 3M9QA 1WQ7A 1M90U 4OPSA 2EYYA 4KH1B 3WVEB 1VQMQ 8ATCB 1D1CA 5IYWA 1NJID 1BCMA 2A37A 1YHQQ 4XTUA 5LJ3f 2FVUA 1IRXA 4CC7A 4RMOA 1FXXA 1T5EA 1VOMA 1R5NA 2X3WD 4R71A 3CB4A 1K8AD 3CCJA 4QV2A 4BI4A 2QTZA 2D3NA 1GFDA 4LBYA 1PCXA 1D0YA 1C6VX 2I0NA 4JS5A 1BB9A 1N6AA 1HJDA 2BN4A 5GAN4 1N8RR 4EPCA 2BPOA 4RD4A 2P4TA 3LNNA 2RQUA 1CQXA 2E3HA 1AEYA 1YITB 1VIFA 3AVWA 2CREA 1TLLA 3CTAA 2KYBA 4E2FB 1RAFB 4QVDA 2JOYA 4XM3A 4M7DC 1M27C 2V7UA 4II2A 2XGJA 2VGNA 3VV0A 2Z0WA 2CT3A 2X4WA 2KI7A 4FIBA 2DIGA 2ESWA 2LMJA 4Z4YA 2RJCA 4OP0A 2F69A 3A3GA 2YUPA 2MK5A 2VBUA 4P3YA 4J9BA 2FZCB 4M7AD 1PJ5A 4JJCA 2CUDA 5GV7A 1VLOA 4EH1A 4JJNK 3X28B 1AHJB 2AZSA 2LNVA 3OMCA 9ATCB 1VQ9Q 1W9XA 1IB0A 2E12A 3ZUGA 4PJOA 4ZNXA 2QA4B 4ZGEB 4ROXA 4HVWA 2G6FX 3I35A 1VQLQ 1OU8A 3EG9B 1ZA2B 1WQWA 2EAYA 2Y4YA 4WF2A 3AVUA 1KK1A 4RM0A 4PJOD 3TCJA 3H41A 4XN3A 2YT6A 5GAN5 2BF4A 3L2UA 5I22A 1WGSA 2LP5A 2GJPA 2KVQG 4F7UB 2VXFA 3M0PA 2DEUA 1Z9QA 4B3GA 2DA9A 4AMCA 1X01A 1LCKA 1X69A 5HCKA 1VQOB 4PFOA 3CXCS 4LDUA 1SKQA 4G6IA 3QYGB 3RKXA 5LJ5f 1K28D 1D3BB 3LX7A 3QUIA 4AFSC 3L2WA 1PSEA 5KCHA 1V76A 1Y96B 5KCOA 4JRPA 2DFUA 4XOTA 3FJ5A 3CXCB 2ZAEA 4P9SA 3QZ9B 1NEBA 2P0KA 5GJWB 5LJ5g 2E1HA 2XEXA 3X25B 4X34A 2WSCE 2FHDA 1RLQC 5A0LA 3BH4A 4ACBA 3EGXA 4M78E 1JA0A 2O9VA 3ASSA 2DILA 3B8HA 1VQMB 1SG5A 2JM9A 2CW5A 1MMNA 2DO3A 2JJ1A 2X51A 5CR2A 4J7FA 5CAIA 3LGFA 3CD6A 2RB6A 3CPWA 4M7AC 5J35A 2BIVA 1KC8R 5KYWA 1N06A 5KH6A 3ZIAA 4BE2A 3AVYA 1V1CA 3PENA 2YWEA 2K2VA 4F16A 2ZPIB 3G1JA 3PTAA 4J9IA 5IHNA 4YTLA 1VQOA 4B44A 3EHQA 2QTXA 4LBVA 1NZ9A 4GLKA 5BSXA 1E43A 1TUCA 1V29B 1K0SA 2QG9B 1UECA 2KK4A 4M77F 5LJ3g 3OYEA 2AKKA 4N3NA 1BLIA 2WSSA 2V8IA 2CT4A 5EG2A 1NBMA 1H3ZA 2GBQA 3DB3A 4XKWA 3TEEA 3VNVA 2H3EB 1ZSZA 1IB8A 2EKOA 1UD4A 2RI2A 3DKMA 5GAMd 1W6XA 3X26B 4OMNA 2B5OA 1MNDA 4HCBA 5IN1A 3G4SQ 3JCMb 1S72T 1KIKA 3L1AA 3H0IA 4JZ4A 1OB2A 4X1VA 2OK7A 3HSBA 2HSPA 4D8KA 1VQ8T 3CBPA 4LUEA 1HXDA 2F1MA 4PJMA 1VQ7A 2PMDA 4ZGDB 1WFWA 3CCRQ 4PC6A 3M58A 1E1QA 3WNCA 1YJ9A 1JQQA 4ESRA 2CP0A 4B3FX 5A88A 1KQSA 4C92E 3JCMQ 2KYMA 4QVJA 3WY9A 4JLIA 4NS5A 2CBXA 1W2BP 1VQ6T 3CESA 4C8QB 2QK0A 3NE5B 5FLXE 1YLOA 1SKYB 3HFOA 1SRMA 3E1SA 1KC8U 1G3YA 2DJQA 4H9GA 4KKTA 4JRKA 2W0ZA 4C8QF 3I55B 2HQEA 1V0EA 4E6RA 1EZZB 4PLLA 2KXCA 2VASA 2EQIA 2KDSA 3I56A 1VLYA 1VQLA 1Q81U 1RAEB 3S3NA 4ATOA 4E7HA 2C4UA 2QE7A 1WA7A 2AHOA 3OAAA 2AZVA 2F5KA 4P3IA 3JQQA 4XK8E 5KYXA 3P8HA 2DK3A 3JB9I 3M59A 4LXCA 1VQNB 1YP5A 3Q1JA 1NYGA 2ZZFA 3PIOA 5GMKe 1BK2A 4IW3B 4J9DA 5KW9A 3GSIA 1IJFA 3FRNA 2QTVA 4M75C 1FRQA 2HDAA 4OF1A 1R0CB 1XE1A 4ELZC 4JLGA 1JU5C 4Y91A 3CCSA 3A8IA 4X9DA 1OPLA 3TU4K 1VQOT 2LX7A 4QFMA 4F14A 4X06A 3JCMd 5HZBA 1Q9SA 2KY9A 3VJPA 2PQWA 4RKUE 2LZ6B 2D0QB 4PJOC 2R5MA 1QMCA 1VQPB 2EYQA 4LD6A 4E7IA 1G8XA 2M5SA 1UTIA 4RG8A 2XI9A 2X8KA 4TMTA 4PC3A 3CMET 1M9SA 2DTHA 3CC2A 3HRTA 2XDBA 4XNFA 1TUIA 3CC7B 2R57A 5HY6A 3OYHA 4YAWA 1FX0A 5GAMj 5FNZA 3MPUB 2HQXA 1S72A 3AGQA 2QA4T 4TSFA 3CD6B 2YUOA 2YSQA 3D7SB 1M1FA 2CNDA 5D6WA 1FMVA 2WSEE 1BI0A 1UMKA 2QI2A 3SFMA 4C0DB 2I1LA 1SKUB 5IYQA 3GVLA 1HYOA 2X35A 5IT9E 1N05A 2DRKA 3JCMe 1CNEA 3A8HB 2GQIA 3MHXA 3BCDA 2CYZB 2CP6A 2EW3A 1Y57A 3PVQA 3CP2A 3Q6RA 3VS5A 4RTTA 3JCMc 3NTKA 1PKVA 1ZM2A 1IHVA 2OBTA 2ZXHA 1WOSA 4E0FA 2Q6OA 5A89A 1Q95G 4OMLA 3OYDA 3VS4A 4BY6B 4Z4VA 4XLFA 4QT7A 1ZUYA 2VB6A 4PFPA 3CCQA 2DXCA 1M1KU 1EFRA 2DRMA 1IGQA 1VQ5T 1VQMA 2YRVA 4NOYA 3THKA 4YAUA 4K11A 2D0NA 3QDFA 4IURA 4DNTB 1T0JA 1M3AA 3TREA 4D8DA 1R0BG 2V26A 3I55T 4LBWA 1WJRA 5GAMg 3CCEA 4C0FA 4PJOE 1VUBA 1S72B 1UD8A 4B4DA 1WNLA 2CSQA 3BY1A 4DK1A 2DERA 2VNJA 4RDKA 2VZLA 2M02A 3PE0A 4RD3A 4MMLA 5TV2A 4NL3A 3GQBA 1W2BB 3CCVA 3CCVQ 2CP7A 1U3OA 3JV3A 4MMKA 1E3XA 4X7FA 3W5HA 4DBQA 3RBBB 3QYHB 4M7DE 1VYVA 3VYGA 3OW2S 2QGFB 2XNDA 1H8EA 5F4OA 3OS2A 3OBWA 4HE5A 2PU9B 4N4IA 1NDHA 1QFYA 2FL7A 2DNUA 2XG8D 1NJIR 1TXQA 1VQ9A 3A8MB 5B6IA 3I5RA 4M7AA 1VQ9B 3PIPA 5LJ5e 3VS2A 4FYVB 4X9CA 4QQDA 5DY9A 3R6KA 1ZSZB 4M2LA 1M90R 2D9RA 2KE9A 3EH1A 5IXBA 1DJ7B 3L2QA 2ZPBB 4MZMA 4QVCA 3ZL7C 1Q7YC 4YELA 1X6GA 2CF4A 2VNKA 4KUIA 4C0DC 3QSUA 2DAQA 3NFCA 4J9HA 2YWGA 3LWIA 1ZM4A 4CC3A 2Q6IA 2JVVA 1MGQA 2CZ1B 1V5VA 2OTJQ 1WORA 5E6TA 1BI2A 1YJNB 1EP3B 3A8OB 5GV8A 2WZNA 3SWNB 2RNAA 4OOVA 4KT0E 4M77A 3C95A 1D8TA 4LC0A 3H0FA 2OTJA 2RH2A 1VQ6A 3UA6A 1T3LA 2OTLQ 2EYWA 1D1NA 2VGMA 1C1AA 1G5VA 2RA2A 3G4ST 1S72Q 3CC2Q 3WBKA 1XJWB 3I55A 2EVRA 1QCNA 2K5FA 3VS7A 4C92G 4FK8A 2ZCFB 3VS1A 3EG0A 1OX9A 1YIJB 3MMPA 1X2QA 3I9QA 3REAB 1EX4A 1NJIC 4A63B 1VF7A 3I56T 1JB9A 5GAN2 1VQLT 4A4HA 1CSKA 1H8KA 5THXA 2DE0X 1TVCA 5EMNA 2OYNA 3P27A 3MEWA 4B6MA 1RABB 5GAN3 1YJNT 1ZBXA 1WXTA 3OZUA 4L59A 4FYWB 3JRZA 4GLMA 5HK3A 4PAAA 5LL6S 4F17A 1VQPT 3CCSQ 1PC0A 5IYPA 2LRQA 1AVZC 1SEMA 2RQTA 3G71T 2D8JA 3A1PA 2LJ0A 3OZVA 3QJYA 4YALA 3OSVA 4XTYA 4J6WA 1MMAA 1X43A 1XNIA 5C0MA 4RTVA 4M7DD 5CKDA 3FLGA 4PJOB 1WOPA 2QTLA 2L8DA 2FZGB 2VV5A 2JMCA 5FROA 1RAGB 1QX4A 1GCQA 1ZM3A 5GAOn 3M57A 3NPFA 1KJZA 4RLZA 3CMAQ 4KKSA 2WR8A 2V8JA 3EGXB 1E63A 2HNIA 1O9SA 1OGIA 2RQRA 1PG5B 4XR6A 3O8VA 2EFGA 2FPEA 3QKJA 5LJ5j 1XFOA 3HKSA 4FT2A 4MDWA 1D0XA 2CH4W 2RC5A 1BYMA 4RCZA 2LX9A 2QQRA 4F7UE 1HD3A 2J06A 3EHRA 3CC7Q 1GVHA 1RI0A 1W1FA 2LJ1A 4G5GA 4OGEA 1HK9A 5KYYA 1F1BB 2E64A 1WHHA 1M1KC 3QBYA 4WTOB 5JBQA 2QYZA 4XONA 4P1VA 1H92A 1X27A 1QKWA 2EPDA 3KFVA 1AZGB 3QWXX 3OFNA 4CQJA 5GMKi 1SSHA 2EBPA 1VQOQ 2X6WA 1ZSGA 2QAZA 3OJXA 2FVGA 2JS2A 2DTOA 1J3TA 3G71A 2XDPA 2ZZQA 2QQBA 3JAME 1FMKA 1YNZA 3CCQB 2PVDB 1ARKA 4YEJA 2DL5A 3EFSA 4FT4A 4ZN3A 1QQJA 1T6XA 1A0NB 5LMZA 2BVNA 2A28A 2BE7D 3UPUA 1I8DA 2CP2A 2ECZA 4Z4UA 4J9CA 5I11A 3OB9A 3CPWP 4N0AC 2ZPHB 1P92A 2JMAA 3QZ5B 4LNPA 1QWEA 1B34A 1W70A 3WXMB 5ECAA 2JN0A 3AT1B 4RD6A 3H9NA 3CC7A 2SRCA 3MEAA 2BGJA 4OB0B 2MPXC 3W2EA 5GAMh 4DK0A 5GANg 2HMAA 3JCMf 4ZCLA 1J9ZA 2CGHA 2F2WA 3A5ZB 3EH2A 3ME9A 2JIZA 3L2RA 5DN6A 3J81k 4RTXA 3MCAA 4HIZA 3JU4A 4F04B 1KRHA 2GPJA 3JB9D 1PHTA 5KYYB 3ER0A 1OX8A 2GJRA 3GVKA 3EAEA 5D6XA 2E1BA 4KULA 1Q86D 2ZZEA 3B78A 3MP1A 2RK1A 4II1A 2VXEA 3R6NA 2ED1A 1OZ2A 1AT1B 3PUMA 1Q86U 1W2BA 3OEHA 5D6YA 1UFFA 4AFUC 1GCPA 1YFNA 1K73D 1NEGA 1KQSP 3J7AF 1FNCA 2MYSA 3OYYA 4YAOA 3OW2P 3JCMJ 4XN0A 1KMHA 2YUNA 1QFJA 4MZPA 2FB7A 1FNMA 3VKIA 4IIMA 1SRLA 2YHTA 4OB1B 4QQGA 1M2VA 2RI3A 1WI7A 1JA1A 1VQPQ 1YI2Q 5FL7A 2P3MA 1VQNT 1QVGS 3JCMV 2K57A 2KEAA 4RTZA 1YITA 4XAXB 4M7AB 3OKXA 4M1KA 3I5SA 1EXMA 3QDRB 4XMYA 3U6BA 4UC4A 2X4JA 2J6KA 1ZUUA 4OB3B 1GBRA 1BU1A 1BQEA 2XNJA 2ZXIA 3NMZC 3CCJT 3C0CA 4TN1A 2K5IA 3OSSC 3FPKA 1WHJA 1VJSA 1YITQ 1K9MU 3OE7A 3CMAT 3H6ZA 2J6FA 4C8QC 4TMZA 4X05A 2EGCA 3SEJA 1BX1A 1IHMA 5GANf 1WJQA 2AKLA 2VBSA 4X0CA 3U23A 1WJSA 5CIUA 1NBEB 1SF9A 2JM8A 4BDZA 5BSYA 4BY6C 2WACA 2HCKA 3CMEB 8AT1B 2VYQA 2XZOA 2WJYA 2VC8A 3X24B 1XQHA 3ZFJA 2D3LA 3VR6A 2M16A 4G7XA 2FRWA 3FDRA 4LE9A 2QASA 4LUDA 4M77C 3MHPA 3CEYA 3SLNA 1CNFA 3OMGA 1YJNQ 1G7SA 2CK3A 2BMWA 4TT3A 4XD7A 4LBZA 4UZFA 1DDGA 3BC9A 4B47A 1MRZA 4OVAA 2E6NA 2P0PA 3VRYA 1BIBA 1DG1G 4XU3A 3G4SA 3OS0A 3CC7T 1LVKA 5GAOp 4BE1A 1QCOA 1A8PA 3BY7A 2R9VA 4FXUA 4LDXA 2V8KA 4M7DB 1GAWA 3A8KA 1T6YA 1F20A 2YUQA 4ZCIA 2NUZA 1VA7A 4PC1A 3SJZA 2B7CA 4J9EA 1EFCA 3SB2A 2DMOA 7AT1B 1EP1B 2BE9B 5IHIA 1W34A 2I2LA 3LW5E 2LDMA 2Q6KA 3L42A 1TTTA 1OB5A 2C0TA 1NB0A 4XTXA 2M0YA 3KL9A 1KK0A 5FW9A 2YLBA 1PD1A 3CCMT 1KTVA 2HLDA 2MWOA 4F7UF 2BZ8A 4JRIA 2V31A 1UJYA 4IIOA 4PABA 1KK3A 3RERA 2FPDA 3UATA 3M0RA 1W0JA 2RK2A 1R77A 3M0QA 1K9MC 1OU9A 3OS5A 1N0VC 3OQ5A 4G1VA 1QVFA 1GO2A 4JJDA 1BIAA 4M7AF 4AC9A 3TVTA 2RPNA 1W0KA 2QEXQ 1AIPA 3I56Q 4AVZA 2M9UA 1VQMT 2LCSA 1O75A 2KRMA 5H59A 1KD1D 2KAFA 1N07A 1EIFA 4ZGNB 4J8OA 5EC7A 3CXCP 4J6XA 4E7JA 1FYNA 4DNRB 2FG0A 1IREB 1PM3A 2OAUA 3UT1A 5FU6B 1Q82C 3CCLB 1RQPA 1KD1U 4M78A 3LQEA 3GPLA 4M75F 1N08A 2JJ2A 2F4NA 4RD1A 1GFCA 3OP1A 4AF7A 2X3XD 5IYRA 2XDDA 1K1ZA 1JNYA 3CCVT 1S4MA 1VQ4B 1YJ9T 1N8RD 1XQBA 1YCYA 3B82A 3KBGA 4M75G 1T0HA 4F7DA 1K8AR 1KSWA 3F70A 4E7SA 1VQ4A 1UGSB 1E64A 1N8RU 3M56A 1QVGP 2MI6A 3JCMW 1NRKA 4Y9RA 1Y7XA 4DOVA 1K9AA 4AFZC 2DETA 4J7IA 4C92B 1COWA 3C4SA 4DEYA 2GK7A 2YWHA 3CCEB 2QXFA 4AG2C 4OP7A 4KBMB 3FJOA 3VUZA 1M2OA 4QQ6A 1QVFB 2VJIA 2ZL7A 4TMVA 3CBOA 4JPBW 2E4HA 4C5EA 2NLUA 1VIEA 1RAHB 4QW2A 4WZTA 5TR9A 1H42A 2O01E 4C0ZA 1M30A 2JS0A 4VUBA 4WWVA 2HBWA 2ZZDA 4Z4TA 1K9MR 1FRNA 2JDIA 3QJ6A 4KH0B 1DDIA 1K4US 2JTMA 1YHQT 2YWFA 1NG2A 2W6JA 3LLRA 2DX1A 3P26A 3QG1A 1CKAA 3A8GB 1ZUKA 2Q6LA 2KR3A 4A53A 1WIEA 1B3QA 4M75E 4K1XA 1PJ6A 3ZZ0A 4QUZA 4A4KA 5LJ3h 4M77G 1WPCA 1VQ6Q 1OPKA 4XLCA 3DLMA 4G1BA 3WNDA 3PT9A 2A36A 4FWTA 2K2MA 3RMQA 3A3BA 1G7CA 3G6EA 1BPLA 2BSAA 3I56B 1D09B 4NCNA 4YHBA 4A4GA 3S3MA 1JB0E 1TUGB 1X2KA 3JCMg 3LQ6A 3PA1A 1OGJA 3E9FA 3SKBA 2OBSA 4G7WA 1WLPB 1PRMC 3EGUA 2JTEA 4EIKA 1JJ2P 4OPVA 2L2PA 4FYXB 3Q3AA 2JUFA 2X3UA 3NTIA 3W2HA 2RO0A 4FM4B 2L3PA 3VNUA 3RUXA 2C06A 4Q5WA 2K4YA 1I5OB 2JXBA 2LC4A 2OJ2A 2E65A 1W2BS 4Z4RA 2DXTA 1JXMA 1WX6A 3JB9J 3MEVA 2QQ9A 3OYMA 2ZZGA 3LH0A 5HKCA 2LQNA 2EIXA 1G3TA 2OTJB 2NUTB 1TTHB 1JBMA 2NUPA 5CK9A 4HCCA 4TMWA 2V1RA 1YJNA 2O88A 2W6IA 3SJPA 2RD1A 1G83A 1KK2A 2MMPA 4HT8A 5LJ3e 2L3RA 4JUVA 1R5OA 3MP8A 3FPPA 4P6VF 2XKOC 1TSFA 2X4YA 2NV4A 2FO0A 1ZBJA 2IG0A 2F43A 1ZM9A 3CCUQ 3S6WA 2LQ8A 3BY2A 1RI9A 4DQ2A 3JB9G 4XTZA 1W87A 2WPDA 2EGEA 4J9FA 1MABA 3U2QA 2DXUA 1QLYA 1VQ7Q 3A35A 1VQNA 2E10A 3CC4B 3HTRA 1RAAB 4V2SA 2PVOB 3PVLA 4O6JA 1KG1A 2DL4A 4RTYA 4XTWA 1RQRA 2ZGWA 2PE3A 4QKUA 4KKUA 2OI3A 5LJ5h 5GAOm 4Z88A 4MYUA 3GF5A 4ACAA 2ROTA 4UZUA 1AMOA 1WXUA 2OK8A 4WCIA 5I21A 2V1QA 3H0HA 4ZCMA 3ONUA 2BUDA 4OMMA 2L3QA 2XD0A 1U1SA 5CKBA 4E47A 1BX0A 3OW2A 3M55A 4R0KA 4M7AE 4EMKB 4R56A 1N0UA 2LT1A 4BPRA 4FL6A 4NNJA 4DBRA 1QGYA 4XQ3A 3ZBTA 2KSSA 5DLQE 3JCMX 2D9TA 1JJ2B 1UG1A 2A0FB 5CVIA 1UDLA 4M78G 2DBMA 4C92A 2D74A 3W5VA 3RKYA 2DXBA 3EFOB 4PJOG 4PK4A 2VUBA 1M90C 2XK0A 2B7BA 4E7KA 3OW7A 4BI3A 3CPXA 4LD9K 3M4YA 4C0SA 3G4SB 4LN2A 3EFOA 4C8QG 1VQ5B 4P2NA 3KXTA 1PSFA 1U5SA 4J83A 4OPOA 3BQJA 5CKEA 2BV3A 1N8RC 4OMFB 2F1LA 3UDCA 2K9GA 3UF4A 1WTHD 1DARA 3P8DA 2GGRA 2IPOB 2QEXB 4N4GA 4XORA 3WQZA 4JJBA 5FRMA 2X85A 2Z6BD 4PJLA 1PWTA 2IIMA 4ZGQB 3SDZA 5F4MA 4HVUA 3CBMA 5HXBA 3PNWC 2XOKA 2CC2A 3GBQA 4C5GA 1PKSA 4BB7A 4Z4ZA 4OOXA 4AF6A 3QIIA 4NBSA 3V7RA 4QVAA 3G71B 1M8MA 1FNDA 4KUDK 3VMFA 1KHIA 4RCYA 1QG0A 3GVJA 2KGTA 4J6YA 4HA8A 3ZC3A 3VS3A 4B3XA 1Q7YU 3CCRT 1I5LA 1M1KD 4XTVA 1X6BA 2R58A 2RJEA 3G05A 1UGRB 3BDLA 1W4SA 1HVXA 3LWHA 3CRZA 5GANe 2D6FA 3OZWA 1UB4A 1R8OB 3CCVB 5D7UA 3FIFA 2DL8A 2O4XA 3BNWA 4JS4A 2COYA 4CC2A 4O5VA 1WXBA 2E5QA 3AGPA 3V7SA 1ACMB 3PGGA 3OY9A 2VBVA 1AZEA 3CMAA 2MOXA 3QFSA 1N27A 3JB9H 2GQFA 1S1NA 4GBQA 4XLAA 3CCQQ 4X7DA 1VQ7T 1VQKB 2JT4A 2G3RA 4FSXA 2FYKA 4BD3A 3WVDB 1WZOA 3OEEA 2QDLA 5GMKh 4U9UA 2J7KA 3UA7A 3FJPA 4Z89A 4LDVA 3ZEHA 2QGGA 4DQKA 2DKGA 4GY5A 1K73C 1E62A 2LZJA 2JNGA 1H3HA 4N4HA 5I2MA 1GAQA 2CS7A 1I8FA 4PC7A 4B43A 1M5Q1 3M0SA 2YLCA 3OYCA 1GL5A 1JO8A 2E5KA 1VYUA 1VQ9T 3CPWB 3RR6A 3LYIA 4C92F 1LNXA 1NPRA 4OOSA 1QH0A 3C94A 1WPYA 2V7XA 2C78A 1SHFA 3ASTA 2RN8A 1T6ZA 1NJIU 4ZN1A 2L89A 2M51A 1NE8A 4XL9A 2E3IA 4CRIA 1YI2T 3LVBA 2KBTA 2PUOB 1RACB 1HZEA 2LQWA 3GNFB 5AT1B 1K8AU 2E70A 4MYTA 4IUTA 1UD3A 5CO7A 3KUFA 1OOTA 3FC3A 4YAFA 1BI1A 1M3BA 4PJOF 2Y90A 2QA4Q 2CZ6B 3EG9A 1Q7YR 4C8QD 2P4RA 3CQTA 1B07A 1E7OA 1BKBA 1QP2A 4RJLA 5IYNA 2K3BA 3S3OA 4M75B 1QKXA 3M5AA 4M7AG 2DYBA 3CCUB 5GJVB 5GAMe 2PIAA 2RQWA 5KSWB 5AYFA 3JQRA 2DF6A 2DD4A 4XLEA 1G3SA 2XICA 1KQ1A 2DL3A 2EJ9A 4ORZA 2DIQA 1HA3A 2ZITA 4Z4WA 2ABLA 1IO6A 1YJWA 5GANd 1ZQ1A 1QGZA 3OYGA 3V7CA 3L2ZA 1FWZA 4EMKC 3ULRB 4M77B 2DLPA 2DIEA 1MV0B 2HBPA 1YI2A 5AN9A 4IUVA 4ASUA 2GJKA 2L3SA 3RMSA 2QDYB 3DLLA 4ELYC 4EDUA 5KE3A 4ME7A 1Z9ZA 2OX7A 1U1TA 4RPBA 1B34B 3HL8A 4A54A 3HPWA 1VQPA 3WXMA 3CCUT 3E1YE 4C92C 3VU3C 2RHYA 5GAN8 4A4FA 2K5LA 4RDLA 2RJDA 3CCJB 3G7ZA 1R5BA 3GIBA 5CCAA 3OPOA 2KRSA 3LO8A 3CC4A 2X6XA 3WYAA 3M0TA 2DY1A 4A4EA 2DVJA 2H8HA 4X8IA 1YWPA 2JW4A 3TSWA 1IJEA 2KVOA 1VHEA 4L5GA 3W2FA 3CCEQ 3E20A 3PVDA 1PKTA
chains in the Genus database with same CATH topology
1PM3A 3H9NA 2F1LA 2DOGA 3A1PA 3HTRA 2DYIA 2QGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PM3 A;  3H9N A;  2F1L A;  2DOG A;  3A1P A;  3HTR A;  2DYI A;  2QGG A; 
#chains in the Genus database with same CATH topology
 4LDW A;  2HCJ B;  3CC2 T;  1OEB A;  4QVZ A;  4WQM A;  1ZX6 A;  2HD0 A;  3NGP A;  3NTH A;  1ABQ A;  3GP8 A;  1GCQ C;  4BUG A;  3CCM Q;  2QEX A;  3FKS A;  3O5Z A;  1KHC A;  2AIR B;  2GFA A;  2IVW A;  2QQA A;  3JCM P;  3GLX A;  3N5B B;  5KNL A;  2EQJ A;  3P8B B;  2ZPF B;  4B9W A;  4L6V 5;  3CPF A;  3J80 E;  3BE3 A;  1KC8 C;  2XID A;  1B23 P;  3E9G A;  4IUQ A;  4OGC A;  3ZBD A;  2V7T A;  4C8Q E;  2K3Y A;  3CP8 A;  3CPW S;  1I81 A;  3G71 Q;  2KQW A;  2QMU A;  2CZ7 B;  2GTO A;  4DQL A;  5KE2 A;  1YIJ Q;  4KGV B;  1X75 C;  1PD0 A;  2ED0 A;  4BDY A;  2GRE A;  3EGD A;  2A3L A;  3ISX A;  3VS6 A;  5HZA A;  4R55 A;  2R5A A;  2GF7 A;  1VQ5 A;  4WZE A;  4P26 A;  1U8R A;  5FIU A;  1Q81 R;  1YIT T;  1GBQ A;  4J5Y A;  3CCQ T;  1H8H A;  2V7W A;  1KQS B;  1U2R A;  2F5T X;  2J7I A;  2K7A A;  3CCJ Q;  1QVG B;  4LDY A;  4M78 C;  4DA4 A;  4GQN A;  4JRQ A;  2NUT A;  3CCL A;  3SWN C;  3LGL A;  1VQ8 Q;  2NUP B;  4C0G A;  2KT1 A;  1IXD A;  1NPP A;  5F4J A;  3DDY A;  1MV3 A;  2DOG A;  2V4D A;  1Y96 A;  3A8L B;  2C0O A;  4JDS A;  4TVR A;  5J39 A;  4RTW A;  3GOX A;  1E3Z A;  3RNJ A;  5CDF A;  2O9S A;  1Y0R A;  5L8R E;  4M0L A;  1BCO A;  1NLO C;  2EQK A;  4C5I A;  4M75 D;  1KK7 A;  1QVF S;  1IGU A;  2R6H A;  1VQK A;  4PJN A;  1OB0 A;  1ZLM A;  5KYN A;  1OI1 A;  2EJF A;  1UD5 A;  3MP6 A;  1WHM A;  5KYU A;  4DBH A;  4OMP A;  3CC4 T;  2ZBU A;  2LNH B;  3OS1 A;  4AFQ C;  1ZA1 B;  1AOJ A;  1GJR A;  1RLP C;  1JJ2 S;  1WHL A;  5DM7 R;  2BTT A;  4RTU A;  1Y0M A;  3H8Z A;  1M1G A;  1XOV A;  1IZ6 A;  4P6Y A;  3SWN A;  3T56 B;  4P22 A;  2QN6 A;  5M9O A;  1G3W A;  3URG A;  3CME A;  1KC8 D;  4XLH A;  1ZHI A;  1I07 A;  5I2S A;  1ZUN B;  5J26 A;  1PJ7 A;  5HK0 A;  3OW2 B;  2ATC B;  4M78 D;  3MO8 A;  1YHQ B;  5DSZ A;  1I0C A;  1Q82 R;  3ZBU A;  1WDT A;  1N5Z A;  1YJW Q;  2LT4 A;  4BE0 A;  5IK2 A;  1V0F A;  3ES9 A;  5FU7 B;  3QE2 A;  2E41 A;  3MET A;  4FCY A;  3CC2 B;  1VQL B;  2HKN A;  1KFZ A;  2GCX A;  2XHC A;  4CI0 C;  2OTL B;  1E6H A;  1FMW A;  4HCK A;  2VKN A;  2VVK A;  3AVV A;  1OQK A;  3D26 A;  1I1J A;  4RD2 A;  3QSY A;  4CC4 B;  4BAC A;  2OTL A;  2DVE A;  2A7Y A;  3RKW A;  4HE6 A;  3FB9 A;  2M1H A;  1KD1 C;  1D0Z A;  1UHF A;  2PVG B;  2C4T A;  4F7U G;  2EQM A;  3T9N A;  3FEO A;  2VYT A;  3OYN A;  4XOP A;  1RAI B;  1K0X A;  5LJ3 d;  3G6E Q;  2P84 A;  1RUW A;  5GAO q;  1YJW B;  3GNG A;  1NYF A;  2ZPE B;  5GAN 6;  3QFC A;  2RJF A;  5CQX A;  2YRC A;  4EMK A;  1N9S A;  1RL2 A;  2K3X A;  2JJ9 A;  3QO3 A;  2BGI A;  3RY8 A;  2YRD A;  3CCL T;  2NWM A;  3QHS A;  3M53 A;  3QFT A;  5L23 A;  3AVT A;  4D6W A;  4KGZ B;  2XU8 A;  3I55 Q;  1ZSZ C;  4ANJ A;  1YJW T;  1YHQ A;  1I7P A;  1T3S A;  1OHH A;  3M0U A;  4MDX A;  1YX2 A;  1AD5 A;  1AWW A;  3GIR A;  5FU6 C;  4II3 A;  2JN9 A;  2MF2 A;  1MUZ A;  3CW2 A;  2NPF A;  1CKB A;  1TH7 A;  1EWY A;  4B48 A;  5A8A A;  2X9H A;  3HAG A;  2E1R A;  1AWO A;  1U06 A;  3I1F A;  1IHW A;  2CSI A;  2B86 A;  1WSR A;  3OYI A;  4Z4S A;  5A0D A;  4J0Q A;  4RDJ A;  3H94 A;  2ZL5 A;  2AHJ B;  2OTL T;  1OV3 A;  1JEG A;  4M75 A;  4UZE A;  1KD1 R;  3OOC A;  1RAD B;  3R6J A;  2LVM A;  2MCN A;  2O4X B;  2EYZ A;  2RHU A;  4FYY B;  1K76 A;  1PRL C;  1KZL A;  3TSZ A;  2AK5 A;  4B9X A;  4P12 A;  1D3B A;  2GTJ A;  3PUN A;  3QFR A;  3T51 B;  1OUL A;  4M7D G;  3HFN A;  5DS0 A;  5DLO A;  3CCS B;  3RES A;  3IQL A;  1WHK A;  3LH5 A;  2O2O A;  4DEX A;  4KGX B;  1BJK A;  2X6Y A;  1JRI A;  2C77 A;  3DB4 A;  2X0K A;  2PUK B;  4N0A A;  3CME Q;  2E6Z A;  1WU8 A;  3CMM A;  2L0A A;  2COW A;  2H3J A;  2DEQ A;  2O31 A;  4RCB A;  4ZTJ A;  4KRT A;  2JTF A;  1Q7Y D;  4IKF A;  1S0U A;  2EJG A;  2D8H A;  1JXO A;  3OYA A;  5IHK A;  1VQN Q;  2CP5 A;  1WYX A;  1M4Z A;  4Y9U A;  1YCS B;  3MEU A;  2MIO A;  3L2V A;  3SD4 A;  2C2W A;  2J6O A;  2VWF A;  2SEM A;  2ZBV A;  4ZTF A;  1MNE A;  5IH2 A;  2KT8 A;  1N9R A;  2VNI A;  1D2E A;  4P5N A;  4Z8A A;  1W35 A;  1QP3 A;  2GK6 A;  3WNB A;  2DL7 A;  1YJ9 Q;  4RPD A;  3RIR A;  4NL2 A;  3JSC A;  2V7Q A;  2FZK B;  2BZY A;  4PLI A;  3OYF A;  2OTJ T;  5TRD A;  1K8A C;  1TG0 A;  4AT1 B;  4M4S A;  1QW1 A;  2FX3 A;  3V8J A;  2RI5 A;  4HKE A;  5FA6 A;  1TS9 A;  3W5U A;  3V7A A;  5GAO r;  1YBY A;  1FNB A;  2XZP A;  3BCF A;  5KYW B;  2RC6 A;  4C8Q A;  1GXI E;  5L46 A;  4DBF A;  1KQS S;  1Q82 U;  2WYR A;  2EKH A;  2HL3 A;  4XU0 A;  4ZV4 A;  3ASK A;  5FWC A;  2DPP B;  4BI8 B;  2B8A A;  2K6D A;  2YXY A;  3EFR A;  1YN8 A;  4C43 A;  1Q82 D;  2ZPG B;  1QFZ A;  3Q6Q A;  4TMX A;  3CD6 T;  1LJO A;  2LTO A;  3REB B;  1E79 A;  4WZL A;  1G2B A;  2EFI A;  3VYH B;  1QWF A;  3JCM h;  1VHO A;  1Y71 A;  2BM1 A;  4JZ3 A;  3E19 A;  3V8K A;  1M3C A;  1UGP B;  5KYX B;  3J81 E;  2CZ0 B;  1UUE A;  2J05 A;  3PMI A;  4HVV A;  1TUD A;  5FU7 C;  3OYJ A;  4XKV A;  2DZ9 A;  4E7L A;  3CCR B;  2GFU A;  1FDR A;  2RHZ A;  5KYU B;  4P25 A;  1F60 A;  4PL6 A;  1ABO A;  1AWJ A;  3MCA B;  1GRI A;  3JB9 F;  3KEW A;  2PTK A;  1EFU A;  3JQP A;  4M7D F;  4PC2 A;  2XMF A;  1WSV A;  2CUB A;  2KNB B;  3A98 A;  2FRY A;  1YJ9 B;  2C5B A;  4MZT A;  5IXF A;  2DYI A;  1Q81 C;  3ASR A;  2EWN A;  2BM0 A;  5GAN h;  1QCF A;  2DBK A;  1NM7 A;  1GR1 A;  1JJ2 A;  1M1K R;  4AG1 C;  1B7T A;  2QEX T;  1K73 R;  3CCE T;  5CKH A;  4FU6 A;  4M53 A;  3G6E B;  5GMK l;  2FPF A;  3OYK A;  2ZTG A;  3BFM A;  2DM1 A;  4L8J A;  4UAJ A;  1C0M A;  1BBZ A;  4X7E A;  3WBJ A;  2ENM A;  4Y92 A;  1Q86 R;  1Q86 C;  1G7T A;  3CCU A;  5TY0 A;  2RM4 A;  4M4Z A;  4OB2 B;  3R6O A;  4PFZ A;  3VRZ A;  1G7R A;  5CQY A;  1Q81 D;  1UGV A;  3UWN A;  3SLD A;  1I4K 1;  2HQH A;  1MMG A;  3CCR A;  3CCM A;  2ZL6 A;  2DD5 A;  1TOV A;  2PNI A;  4M78 B;  4PJJ A;  1UEB A;  5FWB A;  3PFS A;  1P4M A;  3VO1 A;  2BKD N;  1X6O A;  3AHU A;  3CCM B;  2C5H A;  2W10 A;  4IUP A;  1B2R A;  4XU2 A;  1EFT A;  1MHN A;  4EMH A;  2RHX A;  2RMO A;  4M77 E;  4YXW A;  3HRS A;  2X53 S;  2DJZ A;  1BI3 A;  4JMQ A;  1E1R A;  2YDL A;  1QUE A;  4HCZ A;  2DCU A;  2DZC A;  2LJ3 A;  3PA2 A;  2ZTN A;  2K79 A;  1HSQ A;  2QDX A;  1VQ6 B;  4C92 D;  4E7Z A;  1VQ8 B;  2LCL A;  2KRO A;  1E6G A;  1YI2 B;  3HHT B;  2WSF E;  4Y28 E;  2ROL A;  1VQ8 A;  2HDN B;  3NHN A;  3V8L A;  5GAM f;  5CKF A;  1VQ5 Q;  4PKC C;  1D1A A;  3ASQ A;  1NB9 A;  1H64 1;  2JZ2 A;  3G6E T;  1YIJ A;  4RD0 A;  2OAW A;  2EGA A;  3SEM A;  3QXE B;  2CH4 A;  1VQK Q;  3VUB A;  2VBT A;  2BZX A;  3Q39 A;  2VNH A;  4M7D A;  2HAX A;  2Y4X A;  1LOJ A;  1TU0 B;  2NYS A;  4Z02 A;  5GMK j;  3PMT A;  1MMD A;  5GAO l;  1QGA A;  4Y7C A;  4Z1M A;  4M77 D;  6AT1 B;  4F7U A;  3OYB A;  4PNO A;  3CCL Q;  1PNJ A;  2M0O A;  3CXC A;  1UD6 A;  1OZ3 A;  2D1X A;  2F2V A;  2LQK A;  1WP6 A;  4RG2 A;  1UHC A;  1Y07 A;  3BDU A;  3OYL A;  3QWY A;  1M8V A;  1M2V B;  5GAN 7;  1QVP A;  4OMQ A;  4OMO A;  1I18 A;  1QVF P;  3MKD A;  4IUU A;  1VYT A;  3OA6 A;  2CKK A;  5LJ3 j;  3EG2 A;  2QA4 A;  1SHG A;  2KXD A;  1Y0Y A;  2XZL A;  1UGQ B;  4TKO B;  2X4X A;  4EMG A;  4XU1 A;  1BMF A;  5GAN j;  4M78 F;  3U6K A;  3EGD B;  5FO1 A;  4X07 A;  1TWB A;  2RF0 A;  1UJ0 A;  1NLP C;  3CC4 Q;  2V7V A;  3HP9 A;  4HXJ A;  3V76 A;  2KMT A;  5A0G A;  1VQK T;  1VQ7 B;  3CD6 Q;  1D1B A;  4N3G A;  5HKK A;  5IAY A;  1QVG A;  3A8J A;  1UE9 A;  2WJV A;  2F2X A;  3EG1 A;  4DOW A;  5C6S A;  3VS0 A;  1UD2 A;  4FN5 A;  2EYX A;  1VQ4 Q;  2L5Q A;  4FW2 A;  3MJX A;  3INZ A;  3RDV A;  4WZK A;  3CMA B;  1K73 U;  2XNC A;  3C12 A;  4PGO A;  2RQV A;  2WZP P;  1SM4 A;  2YWW A;  2HEQ A;  3ZPN A;  3T53 B;  1WHG A;  1YWO A;  2QQS A;  1WOO A;  3ZZU A;  1XTD A;  5LJ5 d;  1WDX A;  2EIF A;  2RHI A;  1OYX A;  5A2Q E;  3M54 A;  2CRV A;  3BW1 A;  3QPH A;  1SPK A;  5GMK m;  2A08 A;  3X20 B;  4QHY A;  2C0I A;  3OJW A;  2GQV A;  1ELO A;  2HZY A;  3AVX A;  2MAM A;  4RCC A;  1XB2 A;  5FRN A;  2LCC A;  2PZ1 A;  4HT9 A;  3W2I A;  1QUF A;  3VO2 A;  4ZGJ B;  1EP2 B;  3EG3 A;  2CP3 A;  2FEI A;  2EQU A;  2COZ A;  2KRN A;  5FO0 A;  4X7C A;  1LPL A;  3SHW A;  1YIJ T;  2PLF A;  2HKQ B;  3HRU A;  3ASP A;  3ONY A;  2AT1 B;  4J9G A;  5J3O A;  4C5H A;  4XQF A;  2OBR A;  4FSS A;  1AWX A;  1EFN A;  3M4G A;  3TQ7 P;  2CDT A;  4RUG A;  2VJJ A;  2P0Q A;  2GNC A;  1KQ2 A;  3W2G A;  3Q38 A;  1SSF A;  2HSE B;  3E2U A;  3ZZT A;  2DTI A;  2HL5 C;  1M90 D;  1FX7 A;  5H5J A;  2MWP A;  1KJW A;  3CCS T;  4Q7J B;  4FW1 A;  1K9M D;  3OBY A;  1VQ4 T;  1H85 A;  5J3B A;  3M9Q A;  1WQ7 A;  1M90 U;  4OPS A;  2EYY A;  4KH1 B;  3WVE B;  1VQM Q;  8ATC B;  1D1C A;  5IYW A;  1NJI D;  1BCM A;  2A37 A;  1YHQ Q;  4XTU A;  5LJ3 f;  2FVU A;  1IRX A;  4CC7 A;  4RMO A;  1FXX A;  1T5E A;  1VOM A;  1R5N A;  2X3W D;  4R71 A;  3CB4 A;  1K8A D;  3CCJ A;  4QV2 A;  4BI4 A;  2QTZ A;  2D3N A;  1GFD A;  4LBY A;  1PCX A;  1D0Y A;  1C6V X;  2I0N A;  4JS5 A;  1BB9 A;  1N6A A;  1HJD A;  2BN4 A;  5GAN 4;  1N8R R;  4EPC A;  2BPO A;  4RD4 A;  2P4T A;  3LNN A;  2RQU A;  1CQX A;  2E3H A;  1AEY A;  1YIT B;  1VIF A;  3AVW A;  2CRE A;  1TLL A;  3CTA A;  2KYB A;  4E2F B;  1RAF B;  4QVD A;  2JOY A;  4XM3 A;  4M7D C;  1M27 C;  2V7U A;  4II2 A;  2XGJ A;  2VGN A;  3VV0 A;  2Z0W A;  2CT3 A;  2X4W A;  2KI7 A;  4FIB A;  2DIG A;  2ESW A;  2LMJ A;  4Z4Y A;  2RJC A;  4OP0 A;  2F69 A;  3A3G A;  2YUP A;  2MK5 A;  2VBU A;  4P3Y A;  4J9B A;  2FZC B;  4M7A D;  1PJ5 A;  4JJC A;  2CUD A;  5GV7 A;  1VLO A;  4EH1 A;  4JJN K;  3X28 B;  1AHJ B;  2AZS A;  2LNV A;  3OMC A;  9ATC B;  1VQ9 Q;  1W9X A;  1IB0 A;  2E12 A;  3ZUG A;  4PJO A;  4ZNX A;  2QA4 B;  4ZGE B;  4ROX A;  4HVW A;  2G6F X;  3I35 A;  1VQL Q;  1OU8 A;  3EG9 B;  1ZA2 B;  1WQW A;  2EAY A;  2Y4Y A;  4WF2 A;  3AVU A;  1KK1 A;  4RM0 A;  4PJO D;  3TCJ A;  3H41 A;  4XN3 A;  2YT6 A;  5GAN 5;  2BF4 A;  3L2U A;  5I22 A;  1WGS A;  2LP5 A;  2GJP A;  2KVQ G;  4F7U B;  2VXF A;  3M0P A;  2DEU A;  1Z9Q A;  4B3G A;  2DA9 A;  4AMC A;  1X01 A;  1LCK A;  1X69 A;  5HCK A;  1VQO B;  4PFO A;  3CXC S;  4LDU A;  1SKQ A;  4G6I A;  3QYG B;  3RKX A;  5LJ5 f;  1K28 D;  1D3B B;  3LX7 A;  3QUI A;  4AFS C;  3L2W A;  1PSE A;  5KCH A;  1V76 A;  1Y96 B;  5KCO A;  4JRP A;  2DFU A;  4XOT A;  3FJ5 A;  3CXC B;  2ZAE A;  4P9S A;  3QZ9 B;  1NEB A;  2P0K A;  5GJW B;  5LJ5 g;  2E1H A;  2XEX A;  3X25 B;  4X34 A;  2WSC E;  2FHD A;  1RLQ C;  5A0L A;  3BH4 A;  4ACB A;  3EGX A;  4M78 E;  1JA0 A;  2O9V A;  3ASS A;  2DIL A;  3B8H A;  1VQM B;  1SG5 A;  2JM9 A;  2CW5 A;  1MMN A;  2DO3 A;  2JJ1 A;  2X51 A;  5CR2 A;  4J7F A;  5CAI A;  3LGF A;  3CD6 A;  2RB6 A;  3CPW A;  4M7A C;  5J35 A;  2BIV A;  1KC8 R;  5KYW A;  1N06 A;  5KH6 A;  3ZIA A;  4BE2 A;  3AVY A;  1V1C A;  3PEN A;  2YWE A;  2K2V A;  4F16 A;  2ZPI B;  3G1J A;  3PTA A;  4J9I A;  5IHN A;  4YTL A;  1VQO A;  4B44 A;  3EHQ A;  2QTX A;  4LBV A;  1NZ9 A;  4GLK A;  5BSX A;  1E43 A;  1TUC A;  1V29 B;  1K0S A;  2QG9 B;  1UEC A;  2KK4 A;  4M77 F;  5LJ3 g;  3OYE A;  2AKK A;  4N3N A;  1BLI A;  2WSS A;  2V8I A;  2CT4 A;  5EG2 A;  1NBM A;  1H3Z A;  2GBQ A;  3DB3 A;  4XKW A;  3TEE A;  3VNV A;  2H3E B;  1ZSZ A;  1IB8 A;  2EKO A;  1UD4 A;  2RI2 A;  3DKM A;  5GAM d;  1W6X A;  3X26 B;  4OMN A;  2B5O A;  1MND A;  4HCB A;  5IN1 A;  3G4S Q;  3JCM b;  1S72 T;  1KIK A;  3L1A A;  3H0I A;  4JZ4 A;  1OB2 A;  4X1V A;  2OK7 A;  3HSB A;  2HSP A;  4D8K A;  1VQ8 T;  3CBP A;  4LUE A;  1HXD A;  2F1M A;  4PJM A;  1VQ7 A;  2PMD A;  4ZGD B;  1WFW A;  3CCR Q;  4PC6 A;  3M58 A;  1E1Q A;  3WNC A;  1YJ9 A;  1JQQ A;  4ESR A;  2CP0 A;  4B3F X;  5A88 A;  1KQS A;  4C92 E;  3JCM Q;  2KYM A;  4QVJ A;  3WY9 A;  4JLI A;  4NS5 A;  2CBX A;  1W2B P;  1VQ6 T;  3CES A;  4C8Q B;  2QK0 A;  3NE5 B;  5FLX E;  1YLO A;  1SKY B;  3HFO A;  1SRM A;  3E1S A;  1KC8 U;  1G3Y A;  2DJQ A;  4H9G A;  4KKT A;  4JRK A;  2W0Z A;  4C8Q F;  3I55 B;  2HQE A;  1V0E A;  4E6R A;  1EZZ B;  4PLL A;  2KXC A;  2VAS A;  2EQI A;  2KDS A;  3I56 A;  1VLY A;  1VQL A;  1Q81 U;  1RAE B;  3S3N A;  4ATO A;  4E7H A;  2C4U A;  2QE7 A;  1WA7 A;  2AHO A;  3OAA A;  2AZV A;  2F5K A;  4P3I A;  3JQQ A;  4XK8 E;  5KYX A;  3P8H A;  2DK3 A;  3JB9 I;  3M59 A;  4LXC A;  1VQN B;  1YP5 A;  3Q1J A;  1NYG A;  2ZZF A;  3PIO A;  5GMK e;  1BK2 A;  4IW3 B;  4J9D A;  5KW9 A;  3GSI A;  1IJF A;  3FRN A;  2QTV A;  4M75 C;  1FRQ A;  2HDA A;  4OF1 A;  1R0C B;  1XE1 A;  4ELZ C;  4JLG A;  1JU5 C;  4Y91 A;  3CCS A;  3A8I A;  4X9D A;  1OPL A;  3TU4 K;  1VQO T;  2LX7 A;  4QFM A;  4F14 A;  4X06 A;  3JCM d;  5HZB A;  1Q9S A;  2KY9 A;  3VJP A;  2PQW A;  4RKU E;  2LZ6 B;  2D0Q B;  4PJO C;  2R5M A;  1QMC A;  1VQP B;  2EYQ A;  4LD6 A;  4E7I A;  1G8X A;  2M5S A;  1UTI A;  4RG8 A;  2XI9 A;  2X8K A;  4TMT A;  4PC3 A;  3CME T;  1M9S A;  2DTH A;  3CC2 A;  3HRT A;  2XDB A;  4XNF A;  1TUI A;  3CC7 B;  2R57 A;  5HY6 A;  3OYH A;  4YAW A;  1FX0 A;  5GAM j;  5FNZ A;  3MPU B;  2HQX A;  1S72 A;  3AGQ A;  2QA4 T;  4TSF A;  3CD6 B;  2YUO A;  2YSQ A;  3D7S B;  1M1F A;  2CND A;  5D6W A;  1FMV A;  2WSE E;  1BI0 A;  1UMK A;  2QI2 A;  3SFM A;  4C0D B;  2I1L A;  1SKU B;  5IYQ A;  3GVL A;  1HYO A;  2X35 A;  5IT9 E;  1N05 A;  2DRK A;  3JCM e;  1CNE A;  3A8H B;  2GQI A;  3MHX A;  3BCD A;  2CYZ B;  2CP6 A;  2EW3 A;  1Y57 A;  3PVQ A;  3CP2 A;  3Q6R A;  3VS5 A;  4RTT A;  3JCM c;  3NTK A;  1PKV A;  1ZM2 A;  1IHV A;  2OBT A;  2ZXH A;  1WOS A;  4E0F A;  2Q6O A;  5A89 A;  1Q95 G;  4OML A;  3OYD A;  3VS4 A;  4BY6 B;  4Z4V A;  4XLF A;  4QT7 A;  1ZUY A;  2VB6 A;  4PFP A;  3CCQ A;  2DXC A;  1M1K U;  1EFR A;  2DRM A;  1IGQ A;  1VQ5 T;  1VQM A;  2YRV A;  4NOY A;  3THK A;  4YAU A;  4K11 A;  2D0N A;  3QDF A;  4IUR A;  4DNT B;  1T0J A;  1M3A A;  3TRE A;  4D8D A;  1R0B G;  2V26 A;  3I55 T;  4LBW A;  1WJR A;  5GAM g;  3CCE A;  4C0F A;  4PJO E;  1VUB A;  1S72 B;  1UD8 A;  4B4D A;  1WNL A;  2CSQ A;  3BY1 A;  4DK1 A;  2DER A;  2VNJ A;  4RDK A;  2VZL A;  2M02 A;  3PE0 A;  4RD3 A;  4MML A;  5TV2 A;  4NL3 A;  3GQB A;  1W2B B;  3CCV A;  3CCV Q;  2CP7 A;  1U3O A;  3JV3 A;  4MMK A;  1E3X A;  4X7F A;  3W5H A;  4DBQ A;  3RBB B;  3QYH B;  4M7D E;  1VYV A;  3VYG A;  3OW2 S;  2QGF B;  2XND A;  1H8E A;  5F4O A;  3OS2 A;  3OBW A;  4HE5 A;  2PU9 B;  4N4I A;  1NDH A;  1QFY A;  2FL7 A;  2DNU A;  2XG8 D;  1NJI R;  1TXQ A;  1VQ9 A;  3A8M B;  5B6I A;  3I5R A;  4M7A A;  1VQ9 B;  3PIP A;  5LJ5 e;  3VS2 A;  4FYV B;  4X9C A;  4QQD A;  5DY9 A;  3R6K A;  1ZSZ B;  4M2L A;  1M90 R;  2D9R A;  2KE9 A;  3EH1 A;  5IXB A;  1DJ7 B;  3L2Q A;  2ZPB B;  4MZM A;  4QVC A;  3ZL7 C;  1Q7Y C;  4YEL A;  1X6G A;  2CF4 A;  2VNK A;  4KUI A;  4C0D C;  3QSU A;  2DAQ A;  3NFC A;  4J9H A;  2YWG A;  3LWI A;  1ZM4 A;  4CC3 A;  2Q6I A;  2JVV A;  1MGQ A;  2CZ1 B;  1V5V A;  2OTJ Q;  1WOR A;  5E6T A;  1BI2 A;  1YJN B;  1EP3 B;  3A8O B;  5GV8 A;  2WZN A;  3SWN B;  2RNA A;  4OOV A;  4KT0 E;  4M77 A;  3C95 A;  1D8T A;  4LC0 A;  3H0F A;  2OTJ A;  2RH2 A;  1VQ6 A;  3UA6 A;  1T3L A;  2OTL Q;  2EYW A;  1D1N A;  2VGM A;  1C1A A;  1G5V A;  2RA2 A;  3G4S T;  1S72 Q;  3CC2 Q;  3WBK A;  1XJW B;  3I55 A;  2EVR A;  1QCN A;  2K5F A;  3VS7 A;  4C92 G;  4FK8 A;  2ZCF B;  3VS1 A;  3EG0 A;  1OX9 A;  1YIJ B;  3MMP A;  1X2Q A;  3I9Q A;  3REA B;  1EX4 A;  1NJI C;  4A63 B;  1VF7 A;  3I56 T;  1JB9 A;  5GAN 2;  1VQL T;  4A4H A;  1CSK A;  1H8K A;  5THX A;  2DE0 X;  1TVC A;  5EMN A;  2OYN A;  3P27 A;  3MEW A;  4B6M A;  1RAB B;  5GAN 3;  1YJN T;  1ZBX A;  1WXT A;  3OZU A;  4L59 A;  4FYW B;  3JRZ A;  4GLM A;  5HK3 A;  4PAA A;  5LL6 S;  4F17 A;  1VQP T;  3CCS Q;  1PC0 A;  5IYP A;  2LRQ A;  1AVZ C;  1SEM A;  2RQT A;  3G71 T;  2D8J A;  3A1P A;  2LJ0 A;  3OZV A;  3QJY A;  4YAL A;  3OSV A;  4XTY A;  4J6W A;  1MMA A;  1X43 A;  1XNI A;  5C0M A;  4RTV A;  4M7D D;  5CKD A;  3FLG A;  4PJO B;  1WOP A;  2QTL A;  2L8D A;  2FZG B;  2VV5 A;  2JMC A;  5FRO A;  1RAG B;  1QX4 A;  1GCQ A;  1ZM3 A;  5GAO n;  3M57 A;  3NPF A;  1KJZ A;  4RLZ A;  3CMA Q;  4KKS A;  2WR8 A;  2V8J A;  3EGX B;  1E63 A;  2HNI A;  1O9S A;  1OGI A;  2RQR A;  1PG5 B;  4XR6 A;  3O8V A;  2EFG A;  2FPE A;  3QKJ A;  5LJ5 j;  1XFO A;  3HKS A;  4FT2 A;  4MDW A;  1D0X A;  2CH4 W;  2RC5 A;  1BYM A;  4RCZ A;  2LX9 A;  2QQR A;  4F7U E;  1HD3 A;  2J06 A;  3EHR A;  3CC7 Q;  1GVH A;  1RI0 A;  1W1F A;  2LJ1 A;  4G5G A;  4OGE A;  1HK9 A;  5KYY A;  1F1B B;  2E64 A;  1WHH A;  1M1K C;  3QBY A;  4WTO B;  5JBQ A;  2QYZ A;  4XON A;  4P1V A;  1H92 A;  1X27 A;  1QKW A;  2EPD A;  3KFV A;  1AZG B;  3QWX X;  3OFN A;  4CQJ A;  5GMK i;  1SSH A;  2EBP A;  1VQO Q;  2X6W A;  1ZSG A;  2QAZ A;  3OJX A;  2FVG A;  2JS2 A;  2DTO A;  1J3T A;  3G71 A;  2XDP A;  2ZZQ A;  2QQB A;  3JAM E;  1FMK A;  1YNZ A;  3CCQ B;  2PVD B;  1ARK A;  4YEJ A;  2DL5 A;  3EFS A;  4FT4 A;  4ZN3 A;  1QQJ A;  1T6X A;  1A0N B;  5LMZ A;  2BVN A;  2A28 A;  2BE7 D;  3UPU A;  1I8D A;  2CP2 A;  2ECZ A;  4Z4U A;  4J9C A;  5I11 A;  3OB9 A;  3CPW P;  4N0A C;  2ZPH B;  1P92 A;  2JMA A;  3QZ5 B;  4LNP A;  1QWE A;  1B34 A;  1W70 A;  3WXM B;  5ECA A;  2JN0 A;  3AT1 B;  4RD6 A;  3H9N A;  3CC7 A;  2SRC A;  3MEA A;  2BGJ A;  4OB0 B;  2MPX C;  3W2E A;  5GAM h;  4DK0 A;  5GAN g;  2HMA A;  3JCM f;  4ZCL A;  1J9Z A;  2CGH A;  2F2W A;  3A5Z B;  3EH2 A;  3ME9 A;  2JIZ A;  3L2R A;  5DN6 A;  3J81 k;  4RTX A;  3MCA A;  4HIZ A;  3JU4 A;  4F04 B;  1KRH A;  2GPJ A;  3JB9 D;  1PHT A;  5KYY B;  3ER0 A;  1OX8 A;  2GJR A;  3GVK A;  3EAE A;  5D6X A;  2E1B A;  4KUL A;  1Q86 D;  2ZZE A;  3B78 A;  3MP1 A;  2RK1 A;  4II1 A;  2VXE A;  3R6N A;  2ED1 A;  1OZ2 A;  1AT1 B;  3PUM A;  1Q86 U;  1W2B A;  3OEH A;  5D6Y A;  1UFF A;  4AFU C;  1GCP A;  1YFN A;  1K73 D;  1NEG A;  1KQS P;  3J7A F;  1FNC A;  2MYS A;  3OYY A;  4YAO A;  3OW2 P;  3JCM J;  4XN0 A;  1KMH A;  2YUN A;  1QFJ A;  4MZP A;  2FB7 A;  1FNM A;  3VKI A;  4IIM A;  1SRL A;  2YHT A;  4OB1 B;  4QQG A;  1M2V A;  2RI3 A;  1WI7 A;  1JA1 A;  1VQP Q;  1YI2 Q;  5FL7 A;  2P3M A;  1VQN T;  1QVG S;  3JCM V;  2K57 A;  2KEA A;  4RTZ A;  1YIT A;  4XAX B;  4M7A B;  3OKX A;  4M1K A;  3I5S A;  1EXM A;  3QDR B;  4XMY A;  3U6B A;  4UC4 A;  2X4J A;  2J6K A;  1ZUU A;  4OB3 B;  1GBR A;  1BU1 A;  1BQE A;  2XNJ A;  2ZXI A;  3NMZ C;  3CCJ T;  3C0C A;  4TN1 A;  2K5I A;  3OSS C;  3FPK A;  1WHJ A;  1VJS A;  1YIT Q;  1K9M U;  3OE7 A;  3CMA T;  3H6Z A;  2J6F A;  4C8Q C;  4TMZ A;  4X05 A;  2EGC A;  3SEJ A;  1BX1 A;  1IHM A;  5GAN f;  1WJQ A;  2AKL A;  2VBS A;  4X0C A;  3U23 A;  1WJS A;  5CIU A;  1NBE B;  1SF9 A;  2JM8 A;  4BDZ A;  5BSY A;  4BY6 C;  2WAC A;  2HCK A;  3CME B;  8AT1 B;  2VYQ A;  2XZO A;  2WJY A;  2VC8 A;  3X24 B;  1XQH A;  3ZFJ A;  2D3L A;  3VR6 A;  2M16 A;  4G7X A;  2FRW A;  3FDR A;  4LE9 A;  2QAS A;  4LUD A;  4M77 C;  3MHP A;  3CEY A;  3SLN A;  1CNF A;  3OMG A;  1YJN Q;  1G7S A;  2CK3 A;  2BMW A;  4TT3 A;  4XD7 A;  4LBZ A;  4UZF A;  1DDG A;  3BC9 A;  4B47 A;  1MRZ A;  4OVA A;  2E6N A;  2P0P A;  3VRY A;  1BIB A;  1DG1 G;  4XU3 A;  3G4S A;  3OS0 A;  3CC7 T;  1LVK A;  5GAO p;  4BE1 A;  1QCO A;  1A8P A;  3BY7 A;  2R9V A;  4FXU A;  4LDX A;  2V8K A;  4M7D B;  1GAW A;  3A8K A;  1T6Y A;  1F20 A;  2YUQ A;  4ZCI A;  2NUZ A;  1VA7 A;  4PC1 A;  3SJZ A;  2B7C A;  4J9E A;  1EFC A;  3SB2 A;  2DMO A;  7AT1 B;  1EP1 B;  2BE9 B;  5IHI A;  1W34 A;  2I2L A;  3LW5 E;  2LDM A;  2Q6K A;  3L42 A;  1TTT A;  1OB5 A;  2C0T A;  1NB0 A;  4XTX A;  2M0Y A;  3KL9 A;  1KK0 A;  5FW9 A;  2YLB A;  1PD1 A;  3CCM T;  1KTV A;  2HLD A;  2MWO A;  4F7U F;  2BZ8 A;  4JRI A;  2V31 A;  1UJY A;  4IIO A;  4PAB A;  1KK3 A;  3RER A;  2FPD A;  3UAT A;  3M0R A;  1W0J A;  2RK2 A;  1R77 A;  3M0Q A;  1K9M C;  1OU9 A;  3OS5 A;  1N0V C;  3OQ5 A;  4G1V A;  1QVF A;  1GO2 A;  4JJD A;  1BIA A;  4M7A F;  4AC9 A;  3TVT A;  2RPN A;  1W0K A;  2QEX Q;  1AIP A;  3I56 Q;  4AVZ A;  2M9U A;  1VQM T;  2LCS A;  1O75 A;  2KRM A;  5H59 A;  1KD1 D;  2KAF A;  1N07 A;  1EIF A;  4ZGN B;  4J8O A;  5EC7 A;  3CXC P;  4J6X A;  4E7J A;  1FYN A;  4DNR B;  2FG0 A;  1IRE B;  1PM3 A;  2OAU A;  3UT1 A;  5FU6 B;  1Q82 C;  3CCL B;  1RQP A;  1KD1 U;  4M78 A;  3LQE A;  3GPL A;  4M75 F;  1N08 A;  2JJ2 A;  2F4N A;  4RD1 A;  1GFC A;  3OP1 A;  4AF7 A;  2X3X D;  5IYR A;  2XDD A;  1K1Z A;  1JNY A;  3CCV T;  1S4M A;  1VQ4 B;  1YJ9 T;  1N8R D;  1XQB A;  1YCY A;  3B82 A;  3KBG A;  4M75 G;  1T0H A;  4F7D A;  1K8A R;  1KSW A;  3F70 A;  4E7S A;  1VQ4 A;  1UGS B;  1E64 A;  1N8R U;  3M56 A;  1QVG P;  2MI6 A;  3JCM W;  1NRK A;  4Y9R A;  1Y7X A;  4DOV A;  1K9A A;  4AFZ C;  2DET A;  4J7I A;  4C92 B;  1COW A;  3C4S A;  4DEY A;  2GK7 A;  2YWH A;  3CCE B;  2QXF A;  4AG2 C;  4OP7 A;  4KBM B;  3FJO A;  3VUZ A;  1M2O A;  4QQ6 A;  1QVF B;  2VJI A;  2ZL7 A;  4TMV A;  3CBO A;  4JPB W;  2E4H A;  4C5E A;  2NLU A;  1VIE A;  1RAH B;  4QW2 A;  4WZT A;  5TR9 A;  1H42 A;  2O01 E;  4C0Z A;  1M30 A;  2JS0 A;  4VUB A;  4WWV A;  2HBW A;  2ZZD A;  4Z4T A;  1K9M R;  1FRN A;  2JDI A;  3QJ6 A;  4KH0 B;  1DDI A;  1K4U S;  2JTM A;  1YHQ T;  2YWF A;  1NG2 A;  2W6J A;  3LLR A;  2DX1 A;  3P26 A;  3QG1 A;  1CKA A;  3A8G B;  1ZUK A;  2Q6L A;  2KR3 A;  4A53 A;  1WIE A;  1B3Q A;  4M75 E;  4K1X A;  1PJ6 A;  3ZZ0 A;  4QUZ A;  4A4K A;  5LJ3 h;  4M77 G;  1WPC A;  1VQ6 Q;  1OPK A;  4XLC A;  3DLM A;  4G1B A;  3WND A;  3PT9 A;  2A36 A;  4FWT A;  2K2M A;  3RMQ A;  3A3B A;  1G7C A;  3G6E A;  1BPL A;  2BSA A;  3I56 B;  1D09 B;  4NCN A;  4YHB A;  4A4G A;  3S3M A;  1JB0 E;  1TUG B;  1X2K A;  3JCM g;  3LQ6 A;  3PA1 A;  1OGJ A;  3E9F A;  3SKB A;  2OBS A;  4G7W A;  1WLP B;  1PRM C;  3EGU A;  2JTE A;  4EIK A;  1JJ2 P;  4OPV A;  2L2P A;  4FYX B;  3Q3A A;  2JUF A;  2X3U A;  3NTI A;  3W2H A;  2RO0 A;  4FM4 B;  2L3P A;  3VNU A;  3RUX A;  2C06 A;  4Q5W A;  2K4Y A;  1I5O B;  2JXB A;  2LC4 A;  2OJ2 A;  2E65 A;  1W2B S;  4Z4R A;  2DXT A;  1JXM A;  1WX6 A;  3JB9 J;  3MEV A;  2QQ9 A;  3OYM A;  2ZZG A;  3LH0 A;  5HKC A;  2LQN A;  2EIX A;  1G3T A;  2OTJ B;  2NUT B;  1TTH B;  1JBM A;  2NUP A;  5CK9 A;  4HCC A;  4TMW A;  2V1R A;  1YJN A;  2O88 A;  2W6I A;  3SJP A;  2RD1 A;  1G83 A;  1KK2 A;  2MMP A;  4HT8 A;  5LJ3 e;  2L3R A;  4JUV A;  1R5O A;  3MP8 A;  3FPP A;  4P6V F;  2XKO C;  1TSF A;  2X4Y A;  2NV4 A;  2FO0 A;  1ZBJ A;  2IG0 A;  2F43 A;  1ZM9 A;  3CCU Q;  3S6W A;  2LQ8 A;  3BY2 A;  1RI9 A;  4DQ2 A;  3JB9 G;  4XTZ A;  1W87 A;  2WPD A;  2EGE A;  4J9F A;  1MAB A;  3U2Q A;  2DXU A;  1QLY A;  1VQ7 Q;  3A35 A;  1VQN A;  2E10 A;  3CC4 B;  3HTR A;  1RAA B;  4V2S A;  2PVO B;  3PVL A;  4O6J A;  1KG1 A;  2DL4 A;  4RTY A;  4XTW A;  1RQR A;  2ZGW A;  2PE3 A;  4QKU A;  4KKU A;  2OI3 A;  5LJ5 h;  5GAO m;  4Z88 A;  4MYU A;  3GF5 A;  4ACA A;  2ROT A;  4UZU A;  1AMO A;  1WXU A;  2OK8 A;  4WCI A;  5I21 A;  2V1Q A;  3H0H A;  4ZCM A;  3ONU A;  2BUD A;  4OMM A;  2L3Q A;  2XD0 A;  1U1S A;  5CKB A;  4E47 A;  1BX0 A;  3OW2 A;  3M55 A;  4R0K A;  4M7A E;  4EMK B;  4R56 A;  1N0U A;  2LT1 A;  4BPR A;  4FL6 A;  4NNJ A;  4DBR A;  1QGY A;  4XQ3 A;  3ZBT A;  2KSS A;  5DLQ E;  3JCM X;  2D9T A;  1JJ2 B;  1UG1 A;  2A0F B;  5CVI A;  1UDL A;  4M78 G;  2DBM A;  4C92 A;  2D74 A;  3W5V A;  3RKY A;  2DXB A;  3EFO B;  4PJO G;  4PK4 A;  2VUB A;  1M90 C;  2XK0 A;  2B7B A;  4E7K A;  3OW7 A;  4BI3 A;  3CPX A;  4LD9 K;  3M4Y A;  4C0S A;  3G4S B;  4LN2 A;  3EFO A;  4C8Q G;  1VQ5 B;  4P2N A;  3KXT A;  1PSF A;  1U5S A;  4J83 A;  4OPO A;  3BQJ A;  5CKE A;  2BV3 A;  1N8R C;  4OMF B;  2F1L A;  3UDC A;  2K9G A;  3UF4 A;  1WTH D;  1DAR A;  3P8D A;  2GGR A;  2IPO B;  2QEX B;  4N4G A;  4XOR A;  3WQZ A;  4JJB A;  5FRM A;  2X85 A;  2Z6B D;  4PJL A;  1PWT A;  2IIM A;  4ZGQ B;  3SDZ A;  5F4M A;  4HVU A;  3CBM A;  5HXB A;  3PNW C;  2XOK A;  2CC2 A;  3GBQ A;  4C5G A;  1PKS A;  4BB7 A;  4Z4Z A;  4OOX A;  4AF6 A;  3QII A;  4NBS A;  3V7R A;  4QVA A;  3G71 B;  1M8M A;  1FND A;  4KUD K;  3VMF A;  1KHI A;  4RCY A;  1QG0 A;  3GVJ A;  2KGT A;  4J6Y A;  4HA8 A;  3ZC3 A;  3VS3 A;  4B3X A;  1Q7Y U;  3CCR T;  1I5L A;  1M1K D;  4XTV A;  1X6B A;  2R58 A;  2RJE A;  3G05 A;  1UGR B;  3BDL A;  1W4S A;  1HVX A;  3LWH A;  3CRZ A;  5GAN e;  2D6F A;  3OZW A;  1UB4 A;  1R8O B;  3CCV B;  5D7U A;  3FIF A;  2DL8 A;  2O4X A;  3BNW A;  4JS4 A;  2COY A;  4CC2 A;  4O5V A;  1WXB A;  2E5Q A;  3AGP A;  3V7S A;  1ACM B;  3PGG A;  3OY9 A;  2VBV A;  1AZE A;  3CMA A;  2MOX A;  3QFS A;  1N27 A;  3JB9 H;  2GQF A;  1S1N A;  4GBQ A;  4XLA A;  3CCQ Q;  4X7D A;  1VQ7 T;  1VQK B;  2JT4 A;  2G3R A;  4FSX A;  2FYK A;  4BD3 A;  3WVD B;  1WZO A;  3OEE A;  2QDL A;  5GMK h;  4U9U A;  2J7K A;  3UA7 A;  3FJP A;  4Z89 A;  4LDV A;  3ZEH A;  2QGG A;  4DQK A;  2DKG A;  4GY5 A;  1K73 C;  1E62 A;  2LZJ A;  2JNG A;  1H3H A;  4N4H A;  5I2M A;  1GAQ A;  2CS7 A;  1I8F A;  4PC7 A;  4B43 A;  1M5Q 1;  3M0S A;  2YLC A;  3OYC A;  1GL5 A;  1JO8 A;  2E5K A;  1VYU A;  1VQ9 T;  3CPW B;  3RR6 A;  3LYI A;  4C92 F;  1LNX A;  1NPR A;  4OOS A;  1QH0 A;  3C94 A;  1WPY A;  2V7X A;  2C78 A;  1SHF A;  3AST A;  2RN8 A;  1T6Z A;  1NJI U;  4ZN1 A;  2L89 A;  2M51 A;  1NE8 A;  4XL9 A;  2E3I A;  4CRI A;  1YI2 T;  3LVB A;  2KBT A;  2PUO B;  1RAC B;  1HZE A;  2LQW A;  3GNF B;  5AT1 B;  1K8A U;  2E70 A;  4MYT A;  4IUT A;  1UD3 A;  5CO7 A;  3KUF A;  1OOT A;  3FC3 A;  4YAF A;  1BI1 A;  1M3B A;  4PJO F;  2Y90 A;  2QA4 Q;  2CZ6 B;  3EG9 A;  1Q7Y R;  4C8Q D;  2P4R A;  3CQT A;  1B07 A;  1E7O A;  1BKB A;  1QP2 A;  4RJL A;  5IYN A;  2K3B A;  3S3O A;  4M75 B;  1QKX A;  3M5A A;  4M7A G;  2DYB A;  3CCU B;  5GJV B;  5GAM e;  2PIA A;  2RQW A;  5KSW B;  5AYF A;  3JQR A;  2DF6 A;  2DD4 A;  4XLE A;  1G3S A;  2XIC A;  1KQ1 A;  2DL3 A;  2EJ9 A;  4ORZ A;  2DIQ A;  1HA3 A;  2ZIT A;  4Z4W A;  2ABL A;  1IO6 A;  1YJW A;  5GAN d;  1ZQ1 A;  1QGZ A;  3OYG A;  3V7C A;  3L2Z A;  1FWZ A;  4EMK C;  3ULR B;  4M77 B;  2DLP A;  2DIE A;  1MV0 B;  2HBP A;  1YI2 A;  5AN9 A;  4IUV A;  4ASU A;  2GJK A;  2L3S A;  3RMS A;  2QDY B;  3DLL A;  4ELY C;  4EDU A;  5KE3 A;  4ME7 A;  1Z9Z A;  2OX7 A;  1U1T A;  4RPB A;  1B34 B;  3HL8 A;  4A54 A;  3HPW A;  1VQP A;  3WXM A;  3CCU T;  3E1Y E;  4C92 C;  3VU3 C;  2RHY A;  5GAN 8;  4A4F A;  2K5L A;  4RDL A;  2RJD A;  3CCJ B;  3G7Z A;  1R5B A;  3GIB A;  5CCA A;  3OPO A;  2KRS A;  3LO8 A;  3CC4 A;  2X6X A;  3WYA A;  3M0T A;  2DY1 A;  4A4E A;  2DVJ A;  2H8H A;  4X8I A;  1YWP A;  2JW4 A;  3TSW A;  1IJE A;  2KVO A;  1VHE A;  4L5G A;  3W2F A;  3CCE Q;  3E20 A;  3PVD A;  1PKT A; 
#chains in the Genus database with same CATH homology
 1PM3 A;  3H9N A;  2F1L A;  2DOG A;  3A1P A;  3HTR A;  2DYI A;  2QGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...