2QGGA

X-ray structure of the protein q6f7i0 from acinetobacter calcoaceticus amms 248. northeast structural genomics consortium target asr73.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
b'NVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPWYIETKAGWQTVDVKRWKPHGKGLVVSLKGVSDRTGAESLVASNIWIAKSQLPKADVDEYYWSDLKGLTVLGLDDEEQEVNLGQIHELFETGANDVMVVRATPDSIDSEERMIPWHKDVVQRVDLEAGRIYVNWGVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA-processing protein rimM
publication title X-Ray structure of the protein Q6F7I0 from Acinetobacter calcoaceticus AmMS 248.
rcsb
source organism Acinetobacter calcoaceticus
molecule tags Structural genomics, unknown function
total genus 41
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2007-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2qggA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2qggA01
3HTRA 3H9NA 1PM3A 2DOGA 2QGGA 3A1PA 2F1LA 2DYIA
chains in the Genus database with same CATH superfamily
2KRMA 1N9RA 2JZ2A 2SRCA 1VA7A 2DKGA 2RI5A 2K5FA 1VQMT 3W2EA 5GAOp 3P8BB 2PTKA 1UMKA 4X7DA 3AVTA 2JM8A 2W6IA 3MMPA 4BI4A 2CREA 4JDSA 5I2MA 1YI2T 1Y96B 5LMZA 1VQ9Q 3VUBA 1WHKA 3G05A 1XTDA 2KAFA 1WXUA 1NDHA 2B5OA 2CP5A 1OX9A 3WBJA 1ZLMA 1Q82U 2XU8A 4LDUA 1S1NA 4YALA 5GAN2 2EGCA 2JNGA 4BPRA 1QVFS 4Q5WA 3H0IA 3ISXA 1EIFA 1BX0A 2GFUA 2GK6A 2RI3A 2RHIA 3CMAT 1WTHD 3OY9A 5A2QE 3HRTA 1M1KR 5FLXE 4R55A 1VLOA 4ASUA 1ZA1B 2EPDA 2V1QA 1EFTA 1TTHB 5TR9A 4M0LA 2DMOA 2VNKA 3AVVA 2P84A 4OMOA 2JTFA 4ZTJA 4ZNXA 2VNIA 5A0GA 2DY1A 5CKHA 4BY6C 1VOMA 2C2WA 5IYPA 4PNOA 4WTOB 2Q6IA 1R5NA 1N6AA 1VQMB 2O9SA 1EP1B 1HXDA 1LOJA 5A0LA 2EYZA 1BIAA 1PSEA 2ZXHA 1SRLA 3JCMe 3CMEA 1AIPA 5LJ5j 5FIUA 2HKNA 1I0CA 3GNFB 1QVFA 4E7LA 4LBZA 2XG8D 3CCSB 3FC3A 1K9AA 1X6OA 4AFUC 3EHRA 1WA7A 1FRQA 5HK3A 1VQOA 1BI1A 4KBMB 4XONA 1QVPA 2YDLA 2VVKA 2B7CA 2QEXT 1PCXA 2LQNA 1QFJA 1PWTA 2HD0A 1TS9A 4A53A 2L8DA 3W2HA 3OS5A 3CCRA 3OAAA 4C8QE 3ZC3A 2V7XA 3CMAB 1YIJB 1QGYA 4PGOA 2JS2A 4M75F 3TU4K 4J9GA 3Q6QA 3MEAA 4IUTA 1SF9A 2Q6OA 2FL7A 1OB0A 2EAYA 1PM3A 4LNPA 4HKEA 2BIVA 3ULRB 2MWOA 1W4SA 3V7CA 4BI3A 2X3UA 1S72Q 5EC7A 1KHCA 3CQTA 3ZBDA 4C8QD 2XZLA 1JJ2S 3VUZA 2E10A 2O31A 3V7AA 2J06A 3H0FA 1M2VA 2XDBA 4BB7A 1VF7A 1UGSB 3A8IA 3OBYA 2GBQA 3CCLQ 4HE5A 1UJ0A 4QVZA 3W5HA 1Y7XA 4ZGQB 1KFZA 4Y28E 3E9GA 1UD2A 3TCJA 3VO1A 3P8DA 4FSXA 1MMDA 4EMKA 3MCAA 3QWXX 4TVRA 2OTJB 3MPUB 4M77G 2GTJA 4XAXB 1C0MA 1YJ9A 1I18A 4XU2A 2CRVA 4JRPA 4FYWB 4ZCMA 1YITB 1OHHA 1K1ZA 2R5MA 4F7UE 2K6DA 2LJ3A 1N8RU 2DEUA 3OYAA 3CPWS 4P6YA 1KC8C 2QTXA 1VQKQ 3QFCA 2MAMA 2RJCA 1FXXA 1QH0A 3E1YE 1AEYA 4PJOA 1JJ2A 3VV0A 3M0QA 5IYNA 4Z89A 2OAWA 3C12A 3VRYA 4Z4TA 2F5TX 2BMWA 2X6WA 1IXDA 4P1VA 3T56B 2ZZQA 5GMKe 2QG9B 2RB6A 3I55T 4XORA 3CCMQ 1QGAA 2EKOA 2F5KA 4EMKC 3META 1M4ZA 2BGIA 4QQ6A 3RMSA 1T3LA 5GV8A 5LJ3j 1VQ8Q 1CQXA 1WYXA 2QN6A 2DL7A 4KGVB 3PIPA 1Q95G 3JCMh 4KUDK 1D0ZA 1W2BB 3UPUA 2OK8A 4M4ZA 1E6HA 4P25A 1I8DA 4JJCA 1YJWT 1NEBA 4LDVA 4RUGA 5J39A 4BE2A 2OAUA 5FNZA 2PUOB 3CPWA 2H8HA 4J6WA 4M7DG 1RAHB 1VQLT 2AK5A 4QHYA 2EQIA 4LDWA 3QE2A 1NPPA 1W87A 3OYKA 4QUZA 2GFAA 3JB9H 1BI2A 5KSWB 3VS2A 5GANg 3J7AF 1GCPA 2JIZA 1QWEA 2JMCA 3E19A 2WR8A 4J9FA 2M9UA 2YWGA 1B07A 4A4HA 5D6WA 4Z4VA 1FNDA 4LBWA 2CYZB 4M78D 3FB9A 1WGSA 1D8TA 3OW2S 2RC5A 3OZUA 3OYMA 1PD1A 3FJ5A 4BY6B 4YXWA 2K3YA 1SHFA 1K9MR 2G3RA 1VQ6Q 2XDPA 4FIBA 3HFOA 2EFGA 3QSYA 1GXIE 3DDYA 4DEXA 2E41A 4L59A 1Q82C 1K8AD 3CCRT 1VQNA 3ZZ0A 5GANd 3CC7T 1HYOA 1ZX6A 3NTHA 2W6JA 2ZBUA 3ASQA 5GAOn 1E7OA 2QQSA 5GAN7 2LCLA 3U2QA 1WHJA 2SEMA 2DRMA 3OEEA 4Z1MA 1OZ2A 1W9XA 3G71A 1E64A 2FZGB 1MMAA 1VQ5T 3W2IA 2E5KA 1K73R 3ONYA 3CC2A 3N5BB 2R9VA 1R0BG 3OW2A 1UD3A 3CXCB 2KE9A 2OBSA 5GJWB 4X07A 1DDIA 4HCBA 4TSFA 1VQ7Q 1ZM9A 3W2GA 1ZSGA 5L46A 3I56Q 3CMEB 2L3PA 2KDSA 1ZM2A 3ZEHA 3ZZUA 4CI0C 1QVFB 4XMYA 1RAIB 4CC7A 1JB0E 4LC0A 3WBKA 3I5SA 5GMKm 4ME7A 4WZLA 1QQJA 4XL9A 2XHCA 4RMOA 5GMKh 4XN0A 4RCCA 4OB0B 3MP6A 1XNIA 4F04B 4WZKA 2DJZA 3GSIA 4XN3A 3KUFA 3S3NA 2GJKA 3ZBUA 4C43A 5IT9E 4CRIA 5LJ5g 1KQSP 3L2RA 4E7HA 3P8HA 4RG2A 1AWJA 1AMOA 3CCRB 3HHTB 3RKYA 4AFQC 4LE9A 5I11A 2LQ8A 2H3EB 3TREA 2DETA 4BE1A 5DSZA 4MYUA 3ONUA 4HT8A 2YWWA 2RJFA 5KYUA 3R6KA 1Q86R 3UATA 5TV2A 4M7AG 4OPVA 2OX7A 2RPNA 3RY8A 4M77D 1M27C 3R6OA 1S4MA 1V0FA 4O5VA 2HSEB 3CCET 1UHFA 3PENA 4DQLA 2JN0A 1SHGA 1PRLC 4RTUA 2EJ9A 5GMKi 2PZ1A 5GV7A 2CSQA 4E7IA 3SJPA 1YBYA 4M78A 3ZBTA 3QSUA 1M2VB 3REBB 3JCMb 5KE2A 3E2UA 2YWHA 5LJ5d 1Y0RA 1YWOA 2KT8A 1JA1A 2QTZA 2DL8A 1O9SA 4B43A 1KD1D 2ZPFB 4HVWA 3JCMQ 1WLPB 1EXMA 4XTUA 4XLAA 1GR1A 2QXFA 1M8MA 1OOTA 2RN8A 5ECAA 4EMKB 2WZPP 2M16A 3MCAB 2JJ2A 4OMQA 1NE8A 3TSZA 1YJ9B 2E65A 2X35A 3NTKA 3DB4A 3QIIA 5CIUA 2QA4Q 4ANJA 4QV2A 3BCFA 2OTLA 2BUDA 1RI0A 4FYYB 1WXTA 4ZGDB 3T53B 4IUVA 4F17A 4YHBA 2R5AA 5CVIA 4OMPA 3CP8A 1N8RC 4M78C 2EJGA 3X20B 4X8IA 1EP3B 4PJOB 4RD2A 4RCZA 3HL8A 2J6KA 5J3BA 2R58A 2K9GA 5IHNA 2QQBA 3LW5E 5KCHA 5IYRA 2DAQA 3D7SB 5I21A 1N5ZA 5C0MA 1TU0B 4M7DD 5AN9A 5IXBA 1YHQQ 1KK7A 1W1FA 4J9EA 4Z02A 1AT1B 3BDLA 4HVVA 1UECA 2XNDA 3QDRB 3V8KA 2M0OA 1YWPA 2IVWA 2HNIA 1Q7YD 1NJID 1GO2A 1OGJA 4PC6A 5LJ3f 2VGNA 1VQ9A 3RKXA 3MJXA 5HKCA 3AVWA 2KK4A 2YWFA 2DIGA 1ZHIA 2FPEA 4AF6A 2E1HA 2XDDA 4PJOF 2ZXIA 2LCCA 4JMQA 1HJDA 3I9QA 1IREB 1OV3A 2CDTA 3CPWB 4OOVA 4ZN1A 2E64A 5LJ3g 1VQ4Q 1TUIA 3FLGA 4UC4A 5F4MA 3V7SA 1RABB 1TTTA 5THXA 5GAMf 2B86A 1JA0A 4ACAA 3F70A 1UGPB 4XU1A 2AT1B 5FU6C 4GY5A 2X6XA 4N3GA 4M77A 4RTZA 3G7ZA 1T0JA 2EYQA 3M5AA 4B47A 5FA6A 1BK2A 2WYRA 5CKDA 3M0TA 2VXFA 3UF4A 4KGZB 4PJLA 1P92A 1OX8A 4RDLA 3LH0A 2ZPGB 5IHKA 2E5QA 1NBEB 3ER0A 2LT1A 4DNRB 1S0UA 2X4JA 4HA8A 5GAN6 3OFNA 1OGIA 2HL3A 2D3LA 1Q81D 3GIRA 4Z4YA 1YJNQ 1WJQA 8AT1B 2DRKA 1DJ7B 1T6YA 2EYXA 3CTAA 1VQNB 2BZ8A 4PAAA 2EVRA 4B44A 1ZBJA 2D0QB 1B34A 2IPOB 4JS5A 2QTLA 7AT1B 4TMTA 2YRCA 2NUTB 4M77C 3R6NA 3GP8A 3CCQQ 4DOVA 4P26A 4LBYA 3G71B 1EFNA 3IQLA 2FX3A 4HCKA 3ASTA 1X43A 2V8IA 2YUPA 4LUEA 1JB9A 2J6FA 5BSYA 1MMGA 1V1CA 4ZTFA 4TN1A 4ZCIA 4XK8E 1OQKA 3CCVT 3OW2B 2DD5A 4DBHA 3EG1A 1SG5A 2RMOA 3AGPA 5HXBA 5A89A 1IHVA 2PLFA 1N07A 4VUBA 4M7DA 1IJEA 1C6VX 1I5LA 2FRWA 2M1HA 4YAFA 2AHOA 3D26A 4M7AD 2AKKA 1OYXA 2HBWA 1S72A 4RKUE 4JJBA 1Y07A 3EFOB 3ASPA 2JXBA 1HSQA 2KR3A 2CP0A 3V8JA 2ROLA 1K76A 2LZ6B 5H5JA 2NLUA 2ATCB 3G6EQ 4RDJA 3CCLA 4Y92A 4IUQA 5HK0A 2K57A 2BF4A 1UHCA 4FK8A 4AG1C 2ZZFA 3KFVA 2P3MA 5B6IA 2DM1A 5FL7A 1RLQC 4J6XA 1IB8A 2X3XD 3M9QA 4C8QG 3CD6Q 4II1A 4TT3A 3CRZA 1KC8R 1M9SA 5KYUB 2BE9B 3HSBA 3CW2A 3JB9G 4M7DC 1RACB 5DLQE 3KBGA 2B8AA 1VQKA 2ZZGA 4FWTA 2L5QA 1N05A 3CCUQ 3CCVB 1RQRA 2PVOB 1VQ9T 1UFFA 3VJPA 4M53A 3H8ZA 3CESA 4FM4B 2YLBA 3GF5A 1BU1A 3WNDA 1NLOC 3CC4Q 3L42A 2DVEA 4KH1B 2M0YA 5GAOl 2GJPA 1QLYA 1M90D 2YLCA 2DTOA 5D6YA 3L2QA 2JTMA 3CCMA 2BKDN 3O5ZA 4AMCA 1X6GA 2YRVA 2RHYA 1BCOA 1WDTA 2FPDA 1YCSB 2KYMA 4QVJA 2DIEA 3VS3A 1I7PA 1VQ8A 4II2A 3A8HB 1PHTA 2YSQA 1E62A 4R56A 5JBQA 1Y0YA 2OTLB 1MUZA 1BI3A 1V76A 2ROTA 4F7UG 2HQEA 3OOCA 1UUEA 3QFTA 4JLGA 3OZVA 1EFRA 3JB9I 5FROA 1ELOA 4B3XA 4C0SA 1I1JA 1XOVA 4GLMA 4XLCA 3G4SQ 1R5OA 4RPDA 2MCNA 2JJ1A 2QASA 4X05A 1SKUB 2CUBA 2PNIA 3LLRA 4Z4SA 2F2WA 3BY7A 2JDIA 2V7VA 3CCST 4G1VA 1R8OB 2RHXA 2P4RA 4RDKA 2J7KA 4AVZA 3CEYA 4M7AA 4ACBA 2VASA 1AHJB 2DE0X 3HAGA 3UA7A 5C6SA 1VQ9B 4B6MA 2CZ7B 4C0DB 1Q82R 2RF0A 1AVZC 3WXMA 1VQ6A 2QGGA 4BE0A 2LDMA 1BB9A 3AVUA 3FIFA 4J0QA 2M02A 3OYBA 3SKBA 3VYGA 2ZTGA 4M2LA 5HZAA 4PLIA 1YIJT 4M78G 3GPLA 2GQVA 3A5ZB 3TSWA 2QE7A 1X6BA 3M59A 1JXMA 2X4XA 3L2WA 1UGRB 2QK0A 2FZKB 1VQPT 4RD3A 4JUVA 2MI6A 3C94A 4C5EA 4PJOE 4M7AC 3MEVA 3RDVA 2LMJA 4KRTA 8ATCB 2R6HA 1D09B 1D3BA 2XNJA 1ZA2B 2E6NA 3OMGA 2F2VA 2VNHA 4PL6A 5FRMA 1JU5C 2RI2A 3P27A 2ZZDA 1KQ1A 3M56A 4M75B 1COWA 4Y9UA 2WACA 1VQ7A 2K4YA 3M53A 4MZMA 2OTJT 3I56A 1VQMQ 3LVBA 2ZPIB 1G7RA 4B3GA 1YITT 1YN8A 4P3IA 4M77F 2COZA 1YI2Q 1B34B 4OOXA 2QTVA 4JJDA 3E9FA 2GGRA 1FYNA 3LQ6A 2DL5A 4FYXB 4J9HA 3OS2A 4F16A 2RK1A 4JRKA 3OS0A 4XOTA 4LD9K 1H8HA 1E79A 3L2VA 2V1RA 1WZOA 3CCJA 1U06A 1N0VC 4H9GA 4P5NA 3SB2A 4FSSA 4NCNA 1VQPB 2RJEA 1OEBA 1S72B 3PIOA 2CZ6B 3JB9D 3MHPA 1KJZA 2D3NA 2YUQA 3LGFA 5DN6A 1WI7A 3DKMA 2GK7A 3Q6RA 1M1KD 2JVVA 4FW2A 4PJNA 1PKSA 2EKHA 4F14A 3OYCA 3KXTA 5M9OA 3UDCA 2C5BA 2D6FA 3LYIA 2VUBA 3M0PA 1IJFA 4LDYA 4TMVA 2JOYA 4HE6A 2KBTA 5GAOq 1GVHA 4DEYA 1QUFA 4XU3A 4M7DF 3REAB 1I07A 4CC3A 1E63A 1R0CB 1QFYA 2CGHA 2X4WA 1WSRA 1G83A 1N8RR 1RI9A 1ZUKA 2QA4A 3OQ5A 2CUDA 1D1CA 4J83A 3OKXA 1GBRA 3OYFA 2XZPA 3GVJA 3FEOA 1UGVA 2K2VA 1VQKB 2QEXQ 2FB7A 4A63B 1K8AU 1QP3A 1H92A 4IUUA 4G7WA 2DERA 1H8KA 4XTXA 5LJ3e 1ZM4A 4XTYA 4IW3B 2CP2A 4P22A 3PVLA 1YHQA 2KXCA 2HCJB 5CDFA 2GQFA 3OYHA 3FJOA 3WQZA 3CBMA 5F4JA 2BVNA 1W6XA 1TOVA 1BPLA 1VQ8B 4DOWA 2LQKA 5AYFA 2Y4YA 3W5UA 4C5HA 2DOGA 5GANf 2DO3A 5GAMe 4C92E 1BBZA 1XQHA 5CKFA 3VKIA 1ZUYA 1PKTA 3A8OB 3EG9A 4RD0A 5HKKA 1HK9A 5GMKj 3VU3C 2VBVA 5D7UA 1KK0A 3OZWA 1M3CA 4X7CA 1VQ4A 1EX4A 2ZL5A 2K3BA 1TUDA 4GLKA 2HCKA 3VS1A 3W5VA 1M30A 3OB9A 4RCYA 4Z4UA 3I5RA 2V31A 5HCKA 4C92D 3CMET 1RAFB 3SWNC 1QCFA 4C8QA 3NTIA 5L8RE 3NHNA 4ZGNB 5KYYA 3LNNA 1VQOT 1UD5A 2M51A 1E6GA 2KRSA 4X06A 1H8EA 3OSVA 3A1PA 1I4K1 4OOSA 2ZPHB 4NNJA 4OVAA 3ZFJA 4B4DA 1RAGB 3EHQA 2E6ZA 3C0CA 2ZL6A 1YJNA 2P0PA 2V7QA 3I55Q 1E1QA 4EMHA 3RR6A 4XU0A 1IHWA 2AKLA 3GVKA 3EGXA 3EGUA 4EMGA 1TXQA 3CCJT 4M7AF 3PMIA 2E70A 2DXUA 3PTAA 1EFUA 1AZGB 4C8QC 5KCOA 1QCOA 3VS6A 1KD1U 1A8PA 3GQBA 3CCQA 2YUNA 4E2FB 2QGFB 4GQNA 4XQFA 1YJWQ 2HLDA 4F7UA 1YX2A 1VHEA 1V29B 1JNYA 1VQLQ 3DB3A 4BDYA 4RTYA 1WU8A 4E0FA 5LJ5f 2V7TA 1BLIA 3SLDA 2P4TA 3I56B 4IUPA 1FRNA 3HP9A 1YJ9T 4DQ2A 3ZL7C 1HD3A 1VQOB 3BFMA 4UZEA 3PGGA 2BTTA 2EQJA 4RTVA 2NWMA 1DARA 4E7ZA 5GAOm 4ZGJB 2YHTA 2WPDA 5IXFA 3OYGA 1TLLA 4BI8B 1KSWA 3LX7A 2A28A 2OJ2A 1WP6A 1W2BP 3GIBA 2L0AA 1BQEA 1NM7A 2DL4A 2J7IA 3HKSA 5KW9A 2ED1A 2L3RA 4J8OA 5GAMh 3M0UA 3EH2A 3CD6A 1Q7YU 1NJIU 3JV3A 3OMCA 4QT7A 3CCJB 3RUXA 2VGMA 4A4KA 3CC7Q 1RLPC 2DBKA 4TMZA 3JCMc 3TEEA 3A3BA 1KJWA 2LX9A 1MNDA 4JPBW 1KRHA 1N08A 1WDXA 4Z88A 2ZPBB 3S6WA 1K0SA 3QXEB 1AOJA 1UJYA 3RERA 1QVGP 4XNFA 1NB9A 3OYYA 2HSPA 1GAQA 3VYHB 3CBOA 5KYWA 3CCUA 1VQ5Q 1GL5A 2V8KA 4M75E 2LZJA 4OB2B 1M2OA 3SFMA 3ZZTA 1PKVA 4XTZA 2A37A 2K79A 2D8HA 3GVLA 3CC4A 2BSAA 1SEMA 1FDRA 1UTIA 3ES9A 4NBSA 3AHUA 2P0QA 2X3WD 3FDRA 4ATOA 2VC8A 2BPOA 2RM4A 2FYKA 3QZ5B 5D6XA 4MMKA 2QDYB 5FO1A 1UDLA 3JCMd 1X2KA 2ECZA 3PA1A 2EYWA 1W35A 2NUPA 2PIAA 5GJVB 3RESA 1SM4A 4UZFA 2COWA 2D74A 2X51A 1QG0A 2HZYA 1U2RA 1JJ2B 2CKKA 1Q81U 4BACA 4CQJA 3OE7A 2BE7D 4J6YA 1N0UA 3A35A 3U6KA 4N0AC 3G4SA 2PVDB 1KK3A 4EH1A 2XMFA 4LXCA 4AFZC 3QDFA 1OULA 4NL2A 2JW4A 1K8AC 2FO0A 2C4TA 3QO3A 2X9HA 4KH0B 1B7TA 2L3SA 1YHQB 5CK9A 4OMMA 3JCMV 4EPCA 2ZBVA 1VQNT 4QKUA 1K0XA 3VNVA 3CXCP 3BW1A 1JEGA 4DBRA 3CCEQ 2K2MA 5IHIA 5IAYA 4KUIA 1IZ6A 2RQTA 4QFMA 4OF1A 3LQEA 2X53S 3B82A 4RD1A 4X7FA 1Q86D 1PNJA 2L2PA 1QVFP 1Q9SA 5I2SA 4QVAA 3TVTA 4KGXB 1VUBA 3G71T 3EG9B 4O6JA 4XKWA 4CC4B 4X34A 4AC9A 3PUNA 5CKEA 3CC2T 1AWWA 1G5VA 3HFNA 4HXJA 1KZLA 1WX6A 3RNJA 2RO0A 3NFCA 3E1SA 4XLFA 3X25B 5A88A 5J3OA 2NV4A 2KSSA 3LH5A 1UGQB 4KULA 4X0CA 3NE5B 4C8QB 2DVJA 2Y4XA 2XICA 1KTVA 1SSHA 3B78A 1LNXA 5KYYB 4LBVA 4L5GA 4RCBA 4MDWA 1H3ZA 4J5YA 5A8AA 1H3HA 2JJ9A 4JRQA 4PC7A 1GCQA 2RC6A 2D1XA 2FZCB 1R5BA 4OGEA 1D1NA 3SEMA 5KE3A 2ZGWA 2DILA 1GFCA 2HQXA 4FCYA 2DYIA 4C5IA 5CO7A 4OMNA 5GAN5 1QX4A 5HY6A 5FO0A 1ZM3A 2C78A 2CF4A 1ZQ1A 1NZ9A 2X0KA 1JRIA 3M58A 1KHIA 1Y71A 3EGXB 4C8QF 3ASRA 3OYDA 2OBRA 1RAAB 3MEUA 2RQVA 3FRNA 5AT1B 4A4EA 4YELA 4AG2C 4QQDA 1YI2A 1MRZA 4PJMA 1W34A 4FL6A 3JB9F 2C77A 3OYEA 2MK5A 1IGUA 3CCQB 3CC2B 2FG0A 4ELYC 1QUEA 2LTOA 2X4YA 2JM9A 3H94A 4Q7JB 4HCZA 4F7UB 2QYZA 2VYQA 3OPOA 2XKOC 1KD1C 1M90U 4FW1A 1GCQC 1MGQA 3QG1A 1LPLA 3HRSA 2VJIA 2PMDA 5IYQA 2VB6A 4TMXA 1NLPC 2RNAA 1CKAA 1IHMA 3QBYA 1E3ZA 2BZXA 4J7FA 4LD6A 1PJ5A 1ACMB 3MKDA 2MF2A 2BM0A 4Y9RA 2DX1A 2K5IA 3U23A 2OTLT 1UEBA 2DL3A 2J6OA 2KY9A 4WF2A 2BN4A 4BD3A 5CQYA 4RD4A 2X85A 2H3JA 3M4GA 3AGQA 4ZGEB 1BI0A 2RQRA 2F1LA 3FJPA 4P12A 4F7UF 2A0FB 2FRYA 1SKYB 4FXUA 1WNLA 3GBQA 4PFPA 1OU8A 1GJRA 1G7TA 1PSFA 1OI1A 5A0DA 1XFOA 3SLNA 4AF7A 1LCKA 4FN5A 2DXTA 3M54A 3NMZC 1KQSS 1DG1G 3CD6B 4M4SA 3NPFA 3CPWP 2A3LA 1U1TA 4R71A 2O4XA 4M78B 1I5OB 2CH4W 1Q7YC 1NJIC 3OEHA 4NS5A 1W2BS 1M1FA 3E20A 2VV5A 4XTWA 4MZPA 2KVOA 2QEXA 2I0NA 1FMVA 4Z8AA 3CCUB 2B7BA 2KRNA 3PE0A 5FU7C 3JAME 3CCVQ 1EP2B 1H85A 3CC4B 4XR6A 5GANe 4C0FA 4XD7A 4PC2A 2DTIA 1QVGS 3SD4A 1XB2A 2EQKA 3VS0A 1V5VA 3OJWA 4M78F 3I1FA 1QW1A 4PFZA 2CT3A 1KQSA 4B3FX 2NUPB 3CBPA 1BIBA 4ORZA 3AVXA 1N27A 4J9BA 1VHOA 3HRUA 2CSIA 2YWEA 2KYBA 1W2BA 1N06A 2E1BA 4UZUA 1MNEA 3G4SB 5FU6B 2XK0A 3HTRA 3A3GA 3BY2A 2CS7A 1Q81C 1MV0B 4B9WA 2FHDA 3VS4A 2Q6LA 2XI9A 4G1BA 5IN1A 4RTTA 3OW2P 1CKBA 2C0TA 4C5GA 1VIFA 1WXBA 2JN9A 2HDAA 2FVGA 4PK4A 2DK3A 1D1BA 4MDXA 5GAN3 2MOXA 4WWVA 1Z9QA 3QUIA 1QVGA 1KC8D 1NBMA 2A36A 3EG0A 2F69A 2C4UA 2D9TA 2WSCE 4XQ3A 4G5GA 4HIZA 4ZV4A 1BX1A 5KH6A 3Q1JA 2K3XA 3A8GB 3CPXA 1FMKA 2ABLA 3CXCS 2EFIA 4C92G 3J81k 3LGLA 3JSCA 2LJ1A 2WSSA 3QYGB 1UD8A 3BNWA 3EFRA 1U1SA 2DPPB 3MP1A 4KT0E 3HPWA 1X01A 3I55A 2V4DA 4FT4A 4M77B 2XGJA 2F2XA 5BSXA 2JUFA 1T6XA 1KQ2A 1M1KU 5L23A 2LCSA 2XEXA 2OK7A 1S72T 1EZZB 4LN2A 2ED0A 4GBQA 5LJ5e 2PUKB 2DCUA 1X75C 1U8RA 3B8HA 3M55A 4NL3A 3EH1A 3M0RA 1YJWA 3QFSA 4LDXA 2VXEA 3CCLT 1OB2A 2LX7A 4PJOD 3R6JA 2V8JA 1J3TA 1VQLA 4OB3B 2JS0A 4YAUA 2W0ZA 1R77A 1X69A 1J9ZA 3CXCA 2PQWA 4DBFA 4MYTA 2EBPA 1D0XA 4G7XA 3CCSQ 2C5HA 4C0ZA 1VLYA 4ROXA 5GANh 2KQWA 2C0IA 2HDNB 1YI2B 1N9SA 3G1JA 4KKUA 1JQQA 4RTXA 4AFSC 4YEJA 2MYSA 1VQKT 3ZIAA 3RKWA 3PA2A 1EWYA 2VBTA 3O8VA 1G8XA 2WSFE 3W2FA 4N3NA 1SPKA 3RIRA 3WVDB 1UD6A 2PE3A 4Z4RA 3PMTA 3OSSC 2GCXA 2PVGB 2RH2A 2KT1A 2DEQA 1Q82D 3CMAQ 3WYAA 1YIJQ 4M7DB 4XTVA 4JZ4A 3LWIA 3QHSA 2HBPA 5HZBA 2HKQB 3Q39A 1M90C 3FKSA 3CC7A 2E3IA 1RAEB 3X26B 3CCMT 2D8JA 2EYYA 4PC1A 1WPYA 2A08A 4TKOB 4DBQA 2RD1A 2CW5A 3H9NA 3OW7A 1VQ8T 2CP6A 1ZUNB 4P3YA 1WHMA 1PD0A 1VQPQ 2O01E 1W0KA 1UB4A 2EW3A 2QQAA 3CCLB 1G3SA 2YT6A 1WJRA 5FU7B 3QYHB 2LP5A 2D0NA 1VQ5A 4IURA 3AVYA 3ZPNA 5CR2A 4N4IA 2QI2A 5TRDA 1BKBA 3L2ZA 3H6ZA 2MPXC 1HZEA 2DTHA 2EIFA 1JXOA 2JMAA 4QVDA 1NRKA 2QMUA 1SRMA 4X9DA 1RADB 5LL6S 4OPOA 4N4GA 5J26A 3VS7A 3AT1B 3ZUGA 2OTJQ 4BDZA 1F20A 2EWNA 4JRIA 2DLPA 4OMLA 5EMNA 1XQBA 3BE3A 1YITQ 3A98A 1T6ZA 4JJNK 2O4XB 3ME9A 1YP5A 1Y57A 1ZSZA 3KL9A 1VIEA 5I22A 3CP2A 2DNUA 1UE9A 1SKQA 2WSEE 4PC3A 2LC4A 1K8AR 2CK3A 3INZA 1YLOA 2QEXB 5EG2A 1WPCA 2JTEA 1VQ6T 3QJ6A 4OMFB 3QWYA 2MMPA 3SWNA 2VWFA 2ZZEA 4OPSA 1JO8A 5CKBA 4OP7A 1M3BA 4M75G 5LJ5h 3V76A 1G3TA 2E12A 3BDUA 3OP1A 3CCMB 3ASSA 3OS1A 1W70A 2CZ0B 4WCIA 4ZN3A 1BYMA 3L2UA 1MMNA 4QW2A 1QMCA 2NYSA 1QKXA 2E4HA 3CCEA 1KG1A 1KQSB 1WFWA 1M5Q1 2AZSA 2OBTA 2CC2A 3M0SA 1ZSZC 2VKNA 4UAJA 3BH4A 3CMMA 3X24B 3UWNA 2ZITA 2NPFA 4J7IA 3BY1A 1ZUUA 4F7DA 1H42A 3M4YA 3VS5A 1XJWB 4CC2A 2C06A 1G7SA 5KYXA 1WHHA 1NYFA 1VQ7T 4M78E 3OYLA 2VZLA 3JQPA 4PJOC 2IG0A 3A8MB 3I56T 4M7AB 3J81E 1OPLA 3WNCA 5GAMj 2KNBB 1Z9ZA 2YXYA 3QFRA 4B48A 3WXMB 4YAWA 1VQ6B 1WHLA 1QVGB 1NEGA 3S3OA 2XNCA 1LJOA 3MHXA 3OYIA 2LRQA 4RLZA 1N8RD 2CH4A 5DY9A 1K9MU 3T9NA 5GAN4 1M8VA 1PJ7A 3H41A 3FPKA 4XM3A 1G7CA 2K7AA 2VNJA 1AD5A 2D9RA 4E6RA 1T3SA 1T0HA 2AZVA 3Q38A 1G3YA 3I55B 1K4US 3MEWA 1C1AA 5FWCA 1PJ6A 5DM7R 2BZYA 2KI7A 2QDLA 1CNFA 1NG2A 2O2OA 3A8KA 3UA6A 1QGZA 1TUGB 3THKA 4OB1B 3PNWC 5CCAA 1KD1R 2DYBA 4RD6A 1D3BB 2RQWA 2DD4A 1YNZA 2WJYA 1B2RA 2DBMA 4EDUA 1M1KC 4X7EA 3L1AA 2KMTA 2RHZA 2XOKA 1YJWB 2NUTA 2CP3A 3EFSA 2L89A 3QJYA 1ABQA 9ATCB 3X28B 2KEAA 1K73U 1DDGA 1VQ7B 2MIOA 4OP0A 1VQLB 1JBMA 4D8DA 3JQRA 2V7UA 2EJFA 4WQMA 5E6TA 2HEQA 5LJ3h 1TG0A 4OGCA 3CMEQ 2PU9B 1BJKA 4ELZC 4QQGA 4NOYA 2RK2A 1IGQA 2YRDA 3EGDA 3TQ7P 4V2SA 3DLLA 1O75A 2QA4T 1FX7A 1NYGA 1X2QA 3SDZA 3G6EA 1AWXA 2DA9A 3H0HA 5DLOA 1VQOQ 1WSVA 3A8JA 4DNTB 3V7RA 2QAZA 1KIKA 1T5EA 2Q6KA 2QQRA 2LNHB 3JCMf 4P9SA 4XOPA 1UD4A 3EFOA 1V0EA 1RUWA 5F4OA 1WIEA 3JQQA 1K9MD 3GLXA 3C95A 1U5SA 3CCRQ 2DXCA 1WOSA 4M77E 5GAN8 3M57A 3MO8A 3UT1A 4RM0A 1Q7YR 1NJIR 4C92A 4QVCA 3ASKA 2JT4A 3C4SA 2LT4A 2W10A 3JCMg 1YHQT 4KKSA 4K1XA 2DFUA 3CC7B 3A8LB 1Q86U 1G2BA 2I2LA 1RQPA 1PG5B 2KROA 3CCJQ 2Z6BD 1MABA 2EQMA 4FT2A 1U3OA 2HMAA 4N0AA 2XIDA 2VBSA 4J9IA 2DZ9A 1F1BB 1I8FA 1FWZA 3Q3AA 1VQ5B 2M5SA 1RL2A 3CPFA 2DXBA 3VMFA 2F4NA 4IIMA 2BM1A 4DK0A 2OI3A 2G6FX 4JS4A 1K73D 3CCVA 1E43A 1VQ4T 4HCCA 4BUGA 5TY0A 4M75D 1FX0A 2DIQA 2QA4B 2QQ9A 2GJRA 1KMHA 4C92C 1YJ9Q 3I35A 1MV3A 2L3QA 5KNLA 5FWBA 3DLMA 4L6V5 4RG8A 1M1GA 4A4FA 1WOPA 1ZSZB 2F43A 1FNMA 3OYNA 1GAWA 3BC9A 2EGEA 3VRZA 4IIOA 1M3AA 1Q81R 4RJLA 1VYVA 4M7DE 2KVQG 1GBQA 6AT1B 1K28D 3LWHA 3SWNB 4WZEA 2LVMA 3QKJA 1FNCA 4R0KA 3U6BA 1VYUA 1YJNT 4J9DA 1TVCA 2GNCA 2X6YA 1HA3A 1GFDA 2HAXA 3CCEB 1NPRA 4RPBA 2Y90A 1Y96A 3WY9A 3VNUA 1A0NB 3JCMJ 1X27A 3OYJA 3CCQT 4IKFA 3T51B 2RA2A 1WORA 2IIMA 2ESWA 1ARKA 3FPPA 2EIXA 5H59A 1VQ4B 1WHGA 2RQUA 2DJQA 4G6IA 1B3QA 2GREA 1IO6A 1NB0A 5KYXB 2Z0WA 2XD0A 1P4MA 1W0JA 1QFZA 4MMLA 3S3MA 2GPJA 2O9VA 4XLHA 3NGPA 2C0OA 2BGJA 3OJXA 2R57A 2VBUA 1VJSA 1H641 3CB4A 1D1AA 4E47A 3EAEA 4A54A 1YFNA 1QWFA 4FYVB 3P26A 3WNBA 4EIKA 3GOXA 4U9UA 3SEJA 1QCNA 1ABOA 4PFOA 3EG2A 3JCMW 4PABA 4Y91A 2P0KA 4YTLA 4A4GA 4MZTA 3G6ET 2F1MA 5GAMg 1E1RA 2ZTNA 2BV3A 1YJNB 2V26A 3PVQA 1PRMC 2NUZA 1SSFA 4C0GA 4C0DC 3SHWA 1IRXA 1VQMA 4TMWA 4Y7CA 3GNGA 1OU9A 1G3WA 3URGA 2LNVA 4AT1B 1K9MC 3WVEB 5LJ3d 3CD6T 1VQNQ 3JCMP 4M75A 3OBWA 2ZL7A 1FMWA 4LUDA 2COYA 3RBBB 3CCSA 1E3XA 1WOOA 4Z4ZA 4M1KA 5IYWA 1TSFA 1OZ3A 1AZEA 4PJOG 4P6VF 3G71Q 2O88A 2KXDA 3PFSA 2EQUA 1MHNA 2GQIA 3CCUT 1M90R 2E3HA 5GAMd 1OB5A 4HT9A 4J9CA 3CC2Q 3OA6A 1VYTA 2XZOA 1JJ2P 2GTOA 3CMAA 1YIJA 3CC4T 4M7AE 1TWBA 4DQKA 5CQXA 2A7YA 2RJDA 1F60A 4FU6A 3JRZA 4E7SA 2MWPA 2AHJB 1K73C 2RHUA 1QP2A 2KGTA 2AIRB 1LVKA 4II3A 3JB9J 1B23P 4P2NA 3EGDB 4M75C 3VR6A 2J05A 2K5LA 2ZAEA 3LO8A 1VQPA 3G6EB 4K11A 1WJSA 5KYNA 1QKWA 1UG1A 5FRNA 4DK1A 2FEIA 1IB0A 4D6WA 2CT4A 5J35A 2EGAA 5IK2A 1CNEA 1TUCA 3RMQA 1XE1A 3G4ST 1D2EA 3QPHA 2I1LA 1GRIA 2ENMA 2LJ0A 4PLLA 4HVUA 1HVXA 1KK2A 2OYNA 2CNDA 4C92B 1BCMA 2WJVA 1YCYA 2OTJA 1Y0MA 4YAOA 3QZ9B 2LQWA 2VYTA 1YITA 1KC8U 4ZCLA 4E7JA 1TH7A 5FW9A 3PT9A 3V8LA 2QDXA 3PVDA 4L8JA 4JZ3A 1PC0A 4E7KA 5DS0A 5CAIA 2YUOA 2DF6A 5KYWB 1Q86C 2HQHA 4B9XA 1BMFA 2WZNA 2X8KA 4RTWA 3PUMA 4D8KA 4N4HA 2HL5C 4KKTA 3SJZA 2ZCFB 2FVUA 4ESRA 2CBXA 3EG3A 1I81A 5GMKl 1AWOA 4XLEA 2V7WA 1WQWA 4C92F 4JLIA 1WQ7A 1EFCA 3MP8A 5IH2A 4Z4WA 2ZPEB 4WZTA 1CSKA 3BCDA 4X9CA 2DZCA 2OTLQ 3JU4A 4DA4A 2GF7A 1FNBA 4X1VA 5GANj 3JCMX 1KK1A 2CP7A 5GAOr 1D0YA 1OPKA 4PKCC 1ZBXA 2E1RA 3KEWA 3VO2A 3J80E 2VJJA 4PJJA 2CZ1B 2FPFA 4XKVA 3BQJA
chains in the Genus database with same CATH topology
3HTRA 3H9NA 1PM3A 2DOGA 2QGGA 3A1PA 2F1LA 2DYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTR A;  3H9N A;  1PM3 A;  2DOG A;  2QGG A;  3A1P A;  2F1L A;  2DYI A; 
#chains in the Genus database with same CATH topology
 2KRM A;  1N9R A;  2JZ2 A;  2SRC A;  1VA7 A;  2DKG A;  2RI5 A;  2K5F A;  1VQM T;  3W2E A;  5GAO p;  3P8B B;  2PTK A;  1UMK A;  4X7D A;  3AVT A;  2JM8 A;  2W6I A;  3MMP A;  4BI4 A;  2CRE A;  4JDS A;  5I2M A;  1YI2 T;  1Y96 B;  5LMZ A;  1VQ9 Q;  3VUB A;  1WHK A;  3G05 A;  1XTD A;  2KAF A;  1WXU A;  1NDH A;  2B5O A;  2CP5 A;  1OX9 A;  3WBJ A;  1ZLM A;  1Q82 U;  2XU8 A;  4LDU A;  1S1N A;  4YAL A;  5GAN 2;  2EGC A;  2JNG A;  4BPR A;  1QVF S;  4Q5W A;  3H0I A;  3ISX A;  1EIF A;  1BX0 A;  2GFU A;  2GK6 A;  2RI3 A;  2RHI A;  3CMA T;  1WTH D;  3OY9 A;  5A2Q E;  3HRT A;  1M1K R;  5FLX E;  4R55 A;  1VLO A;  4ASU A;  1ZA1 B;  2EPD A;  2V1Q A;  1EFT A;  1TTH B;  5TR9 A;  4M0L A;  2DMO A;  2VNK A;  3AVV A;  2P84 A;  4OMO A;  2JTF A;  4ZTJ A;  4ZNX A;  2VNI A;  5A0G A;  2DY1 A;  5CKH A;  4BY6 C;  1VOM A;  2C2W A;  5IYP A;  4PNO A;  4WTO B;  2Q6I A;  1R5N A;  1N6A A;  1VQM B;  2O9S A;  1EP1 B;  1HXD A;  1LOJ A;  5A0L A;  2EYZ A;  1BIA A;  1PSE A;  2ZXH A;  1SRL A;  3JCM e;  3CME A;  1AIP A;  5LJ5 j;  5FIU A;  2HKN A;  1I0C A;  3GNF B;  1QVF A;  4E7L A;  4LBZ A;  2XG8 D;  3CCS B;  3FC3 A;  1K9A A;  1X6O A;  4AFU C;  3EHR A;  1WA7 A;  1FRQ A;  5HK3 A;  1VQO A;  1BI1 A;  4KBM B;  4XON A;  1QVP A;  2YDL A;  2VVK A;  2B7C A;  2QEX T;  1PCX A;  2LQN A;  1QFJ A;  1PWT A;  2HD0 A;  1TS9 A;  4A53 A;  2L8D A;  3W2H A;  3OS5 A;  3CCR A;  3OAA A;  4C8Q E;  3ZC3 A;  2V7X A;  3CMA B;  1YIJ B;  1QGY A;  4PGO A;  2JS2 A;  4M75 F;  3TU4 K;  4J9G A;  3Q6Q A;  3MEA A;  4IUT A;  1SF9 A;  2Q6O A;  2FL7 A;  1OB0 A;  2EAY A;  1PM3 A;  4LNP A;  4HKE A;  2BIV A;  3ULR B;  2MWO A;  1W4S A;  3V7C A;  4BI3 A;  2X3U A;  1S72 Q;  5EC7 A;  1KHC A;  3CQT A;  3ZBD A;  4C8Q D;  2XZL A;  1JJ2 S;  3VUZ A;  2E10 A;  2O31 A;  3V7A A;  2J06 A;  3H0F A;  1M2V A;  2XDB A;  4BB7 A;  1VF7 A;  1UGS B;  3A8I A;  3OBY A;  2GBQ A;  3CCL Q;  4HE5 A;  1UJ0 A;  4QVZ A;  3W5H A;  1Y7X A;  4ZGQ B;  1KFZ A;  4Y28 E;  3E9G A;  1UD2 A;  3TCJ A;  3VO1 A;  3P8D A;  4FSX A;  1MMD A;  4EMK A;  3MCA A;  3QWX X;  4TVR A;  2OTJ B;  3MPU B;  4M77 G;  2GTJ A;  4XAX B;  1C0M A;  1YJ9 A;  1I18 A;  4XU2 A;  2CRV A;  4JRP A;  4FYW B;  4ZCM A;  1YIT B;  1OHH A;  1K1Z A;  2R5M A;  4F7U E;  2K6D A;  2LJ3 A;  1N8R U;  2DEU A;  3OYA A;  3CPW S;  4P6Y A;  1KC8 C;  2QTX A;  1VQK Q;  3QFC A;  2MAM A;  2RJC A;  1FXX A;  1QH0 A;  3E1Y E;  1AEY A;  4PJO A;  1JJ2 A;  3VV0 A;  3M0Q A;  5IYN A;  4Z89 A;  2OAW A;  3C12 A;  3VRY A;  4Z4T A;  2F5T X;  2BMW A;  2X6W A;  1IXD A;  4P1V A;  3T56 B;  2ZZQ A;  5GMK e;  2QG9 B;  2RB6 A;  3I55 T;  4XOR A;  3CCM Q;  1QGA A;  2EKO A;  2F5K A;  4EMK C;  3MET A;  1M4Z A;  2BGI A;  4QQ6 A;  3RMS A;  1T3L A;  5GV8 A;  5LJ3 j;  1VQ8 Q;  1CQX A;  1WYX A;  2QN6 A;  2DL7 A;  4KGV B;  3PIP A;  1Q95 G;  3JCM h;  4KUD K;  1D0Z A;  1W2B B;  3UPU A;  2OK8 A;  4M4Z A;  1E6H A;  4P25 A;  1I8D A;  4JJC A;  1YJW T;  1NEB A;  4LDV A;  4RUG A;  5J39 A;  4BE2 A;  2OAU A;  5FNZ A;  2PUO B;  3CPW A;  2H8H A;  4J6W A;  4M7D G;  1RAH B;  1VQL T;  2AK5 A;  4QHY A;  2EQI A;  4LDW A;  3QE2 A;  1NPP A;  1W87 A;  3OYK A;  4QUZ A;  2GFA A;  3JB9 H;  1BI2 A;  5KSW B;  3VS2 A;  5GAN g;  3J7A F;  1GCP A;  2JIZ A;  1QWE A;  2JMC A;  3E19 A;  2WR8 A;  4J9F A;  2M9U A;  2YWG A;  1B07 A;  4A4H A;  5D6W A;  4Z4V A;  1FND A;  4LBW A;  2CYZ B;  4M78 D;  3FB9 A;  1WGS A;  1D8T A;  3OW2 S;  2RC5 A;  3OZU A;  3OYM A;  1PD1 A;  3FJ5 A;  4BY6 B;  4YXW A;  2K3Y A;  1SHF A;  1K9M R;  2G3R A;  1VQ6 Q;  2XDP A;  4FIB A;  3HFO A;  2EFG A;  3QSY A;  1GXI E;  3DDY A;  4DEX A;  2E41 A;  4L59 A;  1Q82 C;  1K8A D;  3CCR T;  1VQN A;  3ZZ0 A;  5GAN d;  3CC7 T;  1HYO A;  1ZX6 A;  3NTH A;  2W6J A;  2ZBU A;  3ASQ A;  5GAO n;  1E7O A;  2QQS A;  5GAN 7;  2LCL A;  3U2Q A;  1WHJ A;  2SEM A;  2DRM A;  3OEE A;  4Z1M A;  1OZ2 A;  1W9X A;  3G71 A;  1E64 A;  2FZG B;  1MMA A;  1VQ5 T;  3W2I A;  2E5K A;  1K73 R;  3ONY A;  3CC2 A;  3N5B B;  2R9V A;  1R0B G;  3OW2 A;  1UD3 A;  3CXC B;  2KE9 A;  2OBS A;  5GJW B;  4X07 A;  1DDI A;  4HCB A;  4TSF A;  1VQ7 Q;  1ZM9 A;  3W2G A;  1ZSG A;  5L46 A;  3I56 Q;  3CME B;  2L3P A;  2KDS A;  1ZM2 A;  3ZEH A;  3ZZU A;  4CI0 C;  1QVF B;  4XMY A;  1RAI B;  4CC7 A;  1JB0 E;  4LC0 A;  3WBK A;  3I5S A;  5GMK m;  4ME7 A;  4WZL A;  1QQJ A;  4XL9 A;  2XHC A;  4RMO A;  5GMK h;  4XN0 A;  4RCC A;  4OB0 B;  3MP6 A;  1XNI A;  4F04 B;  4WZK A;  2DJZ A;  3GSI A;  4XN3 A;  3KUF A;  3S3N A;  2GJK A;  3ZBU A;  4C43 A;  5IT9 E;  4CRI A;  5LJ5 g;  1KQS P;  3L2R A;  4E7H A;  3P8H A;  4RG2 A;  1AWJ A;  1AMO A;  3CCR B;  3HHT B;  3RKY A;  4AFQ C;  4LE9 A;  5I11 A;  2LQ8 A;  2H3E B;  3TRE A;  2DET A;  4BE1 A;  5DSZ A;  4MYU A;  3ONU A;  4HT8 A;  2YWW A;  2RJF A;  5KYU A;  3R6K A;  1Q86 R;  3UAT A;  5TV2 A;  4M7A G;  4OPV A;  2OX7 A;  2RPN A;  3RY8 A;  4M77 D;  1M27 C;  3R6O A;  1S4M A;  1V0F A;  4O5V A;  2HSE B;  3CCE T;  1UHF A;  3PEN A;  4DQL A;  2JN0 A;  1SHG A;  1PRL C;  4RTU A;  2EJ9 A;  5GMK i;  2PZ1 A;  5GV7 A;  2CSQ A;  4E7I A;  3SJP A;  1YBY A;  4M78 A;  3ZBT A;  3QSU A;  1M2V B;  3REB B;  3JCM b;  5KE2 A;  3E2U A;  2YWH A;  5LJ5 d;  1Y0R A;  1YWO A;  2KT8 A;  1JA1 A;  2QTZ A;  2DL8 A;  1O9S A;  4B43 A;  1KD1 D;  2ZPF B;  4HVW A;  3JCM Q;  1WLP B;  1EXM A;  4XTU A;  4XLA A;  1GR1 A;  2QXF A;  1M8M A;  1OOT A;  2RN8 A;  5ECA A;  4EMK B;  2WZP P;  2M16 A;  3MCA B;  2JJ2 A;  4OMQ A;  1NE8 A;  3TSZ A;  1YJ9 B;  2E65 A;  2X35 A;  3NTK A;  3DB4 A;  3QII A;  5CIU A;  2QA4 Q;  4ANJ A;  4QV2 A;  3BCF A;  2OTL A;  2BUD A;  1RI0 A;  4FYY B;  1WXT A;  4ZGD B;  3T53 B;  4IUV A;  4F17 A;  4YHB A;  2R5A A;  5CVI A;  4OMP A;  3CP8 A;  1N8R C;  4M78 C;  2EJG A;  3X20 B;  4X8I A;  1EP3 B;  4PJO B;  4RD2 A;  4RCZ A;  3HL8 A;  2J6K A;  5J3B A;  2R58 A;  2K9G A;  5IHN A;  2QQB A;  3LW5 E;  5KCH A;  5IYR A;  2DAQ A;  3D7S B;  5I21 A;  1N5Z A;  5C0M A;  1TU0 B;  4M7D D;  5AN9 A;  5IXB A;  1YHQ Q;  1KK7 A;  1W1F A;  4J9E A;  4Z02 A;  1AT1 B;  3BDL A;  4HVV A;  1UEC A;  2XND A;  3QDR B;  3V8K A;  2M0O A;  1YWP A;  2IVW A;  2HNI A;  1Q7Y D;  1NJI D;  1GO2 A;  1OGJ A;  4PC6 A;  5LJ3 f;  2VGN A;  1VQ9 A;  3RKX A;  3MJX A;  5HKC A;  3AVW A;  2KK4 A;  2YWF A;  2DIG A;  1ZHI A;  2FPE A;  4AF6 A;  2E1H A;  2XDD A;  4PJO F;  2ZXI A;  2LCC A;  4JMQ A;  1HJD A;  3I9Q A;  1IRE B;  1OV3 A;  2CDT A;  3CPW B;  4OOV A;  4ZN1 A;  2E64 A;  5LJ3 g;  1VQ4 Q;  1TUI A;  3FLG A;  4UC4 A;  5F4M A;  3V7S A;  1RAB B;  1TTT A;  5THX A;  5GAM f;  2B86 A;  1JA0 A;  4ACA A;  3F70 A;  1UGP B;  4XU1 A;  2AT1 B;  5FU6 C;  4GY5 A;  2X6X A;  4N3G A;  4M77 A;  4RTZ A;  3G7Z A;  1T0J A;  2EYQ A;  3M5A A;  4B47 A;  5FA6 A;  1BK2 A;  2WYR A;  5CKD A;  3M0T A;  2VXF A;  3UF4 A;  4KGZ B;  4PJL A;  1P92 A;  1OX8 A;  4RDL A;  3LH0 A;  2ZPG B;  5IHK A;  2E5Q A;  1NBE B;  3ER0 A;  2LT1 A;  4DNR B;  1S0U A;  2X4J A;  4HA8 A;  5GAN 6;  3OFN A;  1OGI A;  2HL3 A;  2D3L A;  1Q81 D;  3GIR A;  4Z4Y A;  1YJN Q;  1WJQ A;  8AT1 B;  2DRK A;  1DJ7 B;  1T6Y A;  2EYX A;  3CTA A;  1VQN B;  2BZ8 A;  4PAA A;  2EVR A;  4B44 A;  1ZBJ A;  2D0Q B;  1B34 A;  2IPO B;  4JS5 A;  2QTL A;  7AT1 B;  4TMT A;  2YRC A;  2NUT B;  4M77 C;  3R6N A;  3GP8 A;  3CCQ Q;  4DOV A;  4P26 A;  4LBY A;  3G71 B;  1EFN A;  3IQL A;  2FX3 A;  4HCK A;  3AST A;  1X43 A;  2V8I A;  2YUP A;  4LUE A;  1JB9 A;  2J6F A;  5BSY A;  1MMG A;  1V1C A;  4ZTF A;  4TN1 A;  4ZCI A;  4XK8 E;  1OQK A;  3CCV T;  3OW2 B;  2DD5 A;  4DBH A;  3EG1 A;  1SG5 A;  2RMO A;  3AGP A;  5HXB A;  5A89 A;  1IHV A;  2PLF A;  1N07 A;  4VUB A;  4M7D A;  1IJE A;  1C6V X;  1I5L A;  2FRW A;  2M1H A;  4YAF A;  2AHO A;  3D26 A;  4M7A D;  2AKK A;  1OYX A;  2HBW A;  1S72 A;  4RKU E;  4JJB A;  1Y07 A;  3EFO B;  3ASP A;  2JXB A;  1HSQ A;  2KR3 A;  2CP0 A;  3V8J A;  2ROL A;  1K76 A;  2LZ6 B;  5H5J A;  2NLU A;  2ATC B;  3G6E Q;  4RDJ A;  3CCL A;  4Y92 A;  4IUQ A;  5HK0 A;  2K57 A;  2BF4 A;  1UHC A;  4FK8 A;  4AG1 C;  2ZZF A;  3KFV A;  2P3M A;  5B6I A;  2DM1 A;  5FL7 A;  1RLQ C;  4J6X A;  1IB8 A;  2X3X D;  3M9Q A;  4C8Q G;  3CD6 Q;  4II1 A;  4TT3 A;  3CRZ A;  1KC8 R;  1M9S A;  5KYU B;  2BE9 B;  3HSB A;  3CW2 A;  3JB9 G;  4M7D C;  1RAC B;  5DLQ E;  3KBG A;  2B8A A;  1VQK A;  2ZZG A;  4FWT A;  2L5Q A;  1N05 A;  3CCU Q;  3CCV B;  1RQR A;  2PVO B;  1VQ9 T;  1UFF A;  3VJP A;  4M53 A;  3H8Z A;  3CES A;  4FM4 B;  2YLB A;  3GF5 A;  1BU1 A;  3WND A;  1NLO C;  3CC4 Q;  3L42 A;  2DVE A;  4KH1 B;  2M0Y A;  5GAO l;  2GJP A;  1QLY A;  1M90 D;  2YLC A;  2DTO A;  5D6Y A;  3L2Q A;  2JTM A;  3CCM A;  2BKD N;  3O5Z A;  4AMC A;  1X6G A;  2YRV A;  2RHY A;  1BCO A;  1WDT A;  2FPD A;  1YCS B;  2KYM A;  4QVJ A;  2DIE A;  3VS3 A;  1I7P A;  1VQ8 A;  4II2 A;  3A8H B;  1PHT A;  2YSQ A;  1E62 A;  4R56 A;  5JBQ A;  1Y0Y A;  2OTL B;  1MUZ A;  1BI3 A;  1V76 A;  2ROT A;  4F7U G;  2HQE A;  3OOC A;  1UUE A;  3QFT A;  4JLG A;  3OZV A;  1EFR A;  3JB9 I;  5FRO A;  1ELO A;  4B3X A;  4C0S A;  1I1J A;  1XOV A;  4GLM A;  4XLC A;  3G4S Q;  1R5O A;  4RPD A;  2MCN A;  2JJ1 A;  2QAS A;  4X05 A;  1SKU B;  2CUB A;  2PNI A;  3LLR A;  4Z4S A;  2F2W A;  3BY7 A;  2JDI A;  2V7V A;  3CCS T;  4G1V A;  1R8O B;  2RHX A;  2P4R A;  4RDK A;  2J7K A;  4AVZ A;  3CEY A;  4M7A A;  4ACB A;  2VAS A;  1AHJ B;  2DE0 X;  3HAG A;  3UA7 A;  5C6S A;  1VQ9 B;  4B6M A;  2CZ7 B;  4C0D B;  1Q82 R;  2RF0 A;  1AVZ C;  3WXM A;  1VQ6 A;  2QGG A;  4BE0 A;  2LDM A;  1BB9 A;  3AVU A;  3FIF A;  4J0Q A;  2M02 A;  3OYB A;  3SKB A;  3VYG A;  2ZTG A;  4M2L A;  5HZA A;  4PLI A;  1YIJ T;  4M78 G;  3GPL A;  2GQV A;  3A5Z B;  3TSW A;  2QE7 A;  1X6B A;  3M59 A;  1JXM A;  2X4X A;  3L2W A;  1UGR B;  2QK0 A;  2FZK B;  1VQP T;  4RD3 A;  4JUV A;  2MI6 A;  3C94 A;  4C5E A;  4PJO E;  4M7A C;  3MEV A;  3RDV A;  2LMJ A;  4KRT A;  8ATC B;  2R6H A;  1D09 B;  1D3B A;  2XNJ A;  1ZA2 B;  2E6N A;  3OMG A;  2F2V A;  2VNH A;  4PL6 A;  5FRM A;  1JU5 C;  2RI2 A;  3P27 A;  2ZZD A;  1KQ1 A;  3M56 A;  4M75 B;  1COW A;  4Y9U A;  2WAC A;  1VQ7 A;  2K4Y A;  3M53 A;  4MZM A;  2OTJ T;  3I56 A;  1VQM Q;  3LVB A;  2ZPI B;  1G7R A;  4B3G A;  1YIT T;  1YN8 A;  4P3I A;  4M77 F;  2COZ A;  1YI2 Q;  1B34 B;  4OOX A;  2QTV A;  4JJD A;  3E9F A;  2GGR A;  1FYN A;  3LQ6 A;  2DL5 A;  4FYX B;  4J9H A;  3OS2 A;  4F16 A;  2RK1 A;  4JRK A;  3OS0 A;  4XOT A;  4LD9 K;  1H8H A;  1E79 A;  3L2V A;  2V1R A;  1WZO A;  3CCJ A;  1U06 A;  1N0V C;  4H9G A;  4P5N A;  3SB2 A;  4FSS A;  4NCN A;  1VQP B;  2RJE A;  1OEB A;  1S72 B;  3PIO A;  2CZ6 B;  3JB9 D;  3MHP A;  1KJZ A;  2D3N A;  2YUQ A;  3LGF A;  5DN6 A;  1WI7 A;  3DKM A;  2GK7 A;  3Q6R A;  1M1K D;  2JVV A;  4FW2 A;  4PJN A;  1PKS A;  2EKH A;  4F14 A;  3OYC A;  3KXT A;  5M9O A;  3UDC A;  2C5B A;  2D6F A;  3LYI A;  2VUB A;  3M0P A;  1IJF A;  4LDY A;  4TMV A;  2JOY A;  4HE6 A;  2KBT A;  5GAO q;  1GVH A;  4DEY A;  1QUF A;  4XU3 A;  4M7D F;  3REA B;  1I07 A;  4CC3 A;  1E63 A;  1R0C B;  1QFY A;  2CGH A;  2X4W A;  1WSR A;  1G83 A;  1N8R R;  1RI9 A;  1ZUK A;  2QA4 A;  3OQ5 A;  2CUD A;  1D1C A;  4J83 A;  3OKX A;  1GBR A;  3OYF A;  2XZP A;  3GVJ A;  3FEO A;  1UGV A;  2K2V A;  1VQK B;  2QEX Q;  2FB7 A;  4A63 B;  1K8A U;  1QP3 A;  1H92 A;  4IUU A;  4G7W A;  2DER A;  1H8K A;  4XTX A;  5LJ3 e;  1ZM4 A;  4XTY A;  4IW3 B;  2CP2 A;  4P22 A;  3PVL A;  1YHQ A;  2KXC A;  2HCJ B;  5CDF A;  2GQF A;  3OYH A;  3FJO A;  3WQZ A;  3CBM A;  5F4J A;  2BVN A;  1W6X A;  1TOV A;  1BPL A;  1VQ8 B;  4DOW A;  2LQK A;  5AYF A;  2Y4Y A;  3W5U A;  4C5H A;  2DOG A;  5GAN f;  2DO3 A;  5GAM e;  4C92 E;  1BBZ A;  1XQH A;  5CKF A;  3VKI A;  1ZUY A;  1PKT A;  3A8O B;  3EG9 A;  4RD0 A;  5HKK A;  1HK9 A;  5GMK j;  3VU3 C;  2VBV A;  5D7U A;  1KK0 A;  3OZW A;  1M3C A;  4X7C A;  1VQ4 A;  1EX4 A;  2ZL5 A;  2K3B A;  1TUD A;  4GLK A;  2HCK A;  3VS1 A;  3W5V A;  1M30 A;  3OB9 A;  4RCY A;  4Z4U A;  3I5R A;  2V31 A;  5HCK A;  4C92 D;  3CME T;  1RAF B;  3SWN C;  1QCF A;  4C8Q A;  3NTI A;  5L8R E;  3NHN A;  4ZGN B;  5KYY A;  3LNN A;  1VQO T;  1UD5 A;  2M51 A;  1E6G A;  2KRS A;  4X06 A;  1H8E A;  3OSV A;  3A1P A;  1I4K 1;  4OOS A;  2ZPH B;  4NNJ A;  4OVA A;  3ZFJ A;  4B4D A;  1RAG B;  3EHQ A;  2E6Z A;  3C0C A;  2ZL6 A;  1YJN A;  2P0P A;  2V7Q A;  3I55 Q;  1E1Q A;  4EMH A;  3RR6 A;  4XU0 A;  1IHW A;  2AKL A;  3GVK A;  3EGX A;  3EGU A;  4EMG A;  1TXQ A;  3CCJ T;  4M7A F;  3PMI A;  2E70 A;  2DXU A;  3PTA A;  1EFU A;  1AZG B;  4C8Q C;  5KCO A;  1QCO A;  3VS6 A;  1KD1 U;  1A8P A;  3GQB A;  3CCQ A;  2YUN A;  4E2F B;  2QGF B;  4GQN A;  4XQF A;  1YJW Q;  2HLD A;  4F7U A;  1YX2 A;  1VHE A;  1V29 B;  1JNY A;  1VQL Q;  3DB3 A;  4BDY A;  4RTY A;  1WU8 A;  4E0F A;  5LJ5 f;  2V7T A;  1BLI A;  3SLD A;  2P4T A;  3I56 B;  4IUP A;  1FRN A;  3HP9 A;  1YJ9 T;  4DQ2 A;  3ZL7 C;  1HD3 A;  1VQO B;  3BFM A;  4UZE A;  3PGG A;  2BTT A;  2EQJ A;  4RTV A;  2NWM A;  1DAR A;  4E7Z A;  5GAO m;  4ZGJ B;  2YHT A;  2WPD A;  5IXF A;  3OYG A;  1TLL A;  4BI8 B;  1KSW A;  3LX7 A;  2A28 A;  2OJ2 A;  1WP6 A;  1W2B P;  3GIB A;  2L0A A;  1BQE A;  1NM7 A;  2DL4 A;  2J7I A;  3HKS A;  5KW9 A;  2ED1 A;  2L3R A;  4J8O A;  5GAM h;  3M0U A;  3EH2 A;  3CD6 A;  1Q7Y U;  1NJI U;  3JV3 A;  3OMC A;  4QT7 A;  3CCJ B;  3RUX A;  2VGM A;  4A4K A;  3CC7 Q;  1RLP C;  2DBK A;  4TMZ A;  3JCM c;  3TEE A;  3A3B A;  1KJW A;  2LX9 A;  1MND A;  4JPB W;  1KRH A;  1N08 A;  1WDX A;  4Z88 A;  2ZPB B;  3S6W A;  1K0S A;  3QXE B;  1AOJ A;  1UJY A;  3RER A;  1QVG P;  4XNF A;  1NB9 A;  3OYY A;  2HSP A;  1GAQ A;  3VYH B;  3CBO A;  5KYW A;  3CCU A;  1VQ5 Q;  1GL5 A;  2V8K A;  4M75 E;  2LZJ A;  4OB2 B;  1M2O A;  3SFM A;  3ZZT A;  1PKV A;  4XTZ A;  2A37 A;  2K79 A;  2D8H A;  3GVL A;  3CC4 A;  2BSA A;  1SEM A;  1FDR A;  1UTI A;  3ES9 A;  4NBS A;  3AHU A;  2P0Q A;  2X3W D;  3FDR A;  4ATO A;  2VC8 A;  2BPO A;  2RM4 A;  2FYK A;  3QZ5 B;  5D6X A;  4MMK A;  2QDY B;  5FO1 A;  1UDL A;  3JCM d;  1X2K A;  2ECZ A;  3PA1 A;  2EYW A;  1W35 A;  2NUP A;  2PIA A;  5GJV B;  3RES A;  1SM4 A;  4UZF A;  2COW A;  2D74 A;  2X51 A;  1QG0 A;  2HZY A;  1U2R A;  1JJ2 B;  2CKK A;  1Q81 U;  4BAC A;  4CQJ A;  3OE7 A;  2BE7 D;  4J6Y A;  1N0U A;  3A35 A;  3U6K A;  4N0A C;  3G4S A;  2PVD B;  1KK3 A;  4EH1 A;  2XMF A;  4LXC A;  4AFZ C;  3QDF A;  1OUL A;  4NL2 A;  2JW4 A;  1K8A C;  2FO0 A;  2C4T A;  3QO3 A;  2X9H A;  4KH0 B;  1B7T A;  2L3S A;  1YHQ B;  5CK9 A;  4OMM A;  3JCM V;  4EPC A;  2ZBV A;  1VQN T;  4QKU A;  1K0X A;  3VNV A;  3CXC P;  3BW1 A;  1JEG A;  4DBR A;  3CCE Q;  2K2M A;  5IHI A;  5IAY A;  4KUI A;  1IZ6 A;  2RQT A;  4QFM A;  4OF1 A;  3LQE A;  2X53 S;  3B82 A;  4RD1 A;  4X7F A;  1Q86 D;  1PNJ A;  2L2P A;  1QVF P;  1Q9S A;  5I2S A;  4QVA A;  3TVT A;  4KGX B;  1VUB A;  3G71 T;  3EG9 B;  4O6J A;  4XKW A;  4CC4 B;  4X34 A;  4AC9 A;  3PUN A;  5CKE A;  3CC2 T;  1AWW A;  1G5V A;  3HFN A;  4HXJ A;  1KZL A;  1WX6 A;  3RNJ A;  2RO0 A;  3NFC A;  3E1S A;  4XLF A;  3X25 B;  5A88 A;  5J3O A;  2NV4 A;  2KSS A;  3LH5 A;  1UGQ B;  4KUL A;  4X0C A;  3NE5 B;  4C8Q B;  2DVJ A;  2Y4X A;  2XIC A;  1KTV A;  1SSH A;  3B78 A;  1LNX A;  5KYY B;  4LBV A;  4L5G A;  4RCB A;  4MDW A;  1H3Z A;  4J5Y A;  5A8A A;  1H3H A;  2JJ9 A;  4JRQ A;  4PC7 A;  1GCQ A;  2RC6 A;  2D1X A;  2FZC B;  1R5B A;  4OGE A;  1D1N A;  3SEM A;  5KE3 A;  2ZGW A;  2DIL A;  1GFC A;  2HQX A;  4FCY A;  2DYI A;  4C5I A;  5CO7 A;  4OMN A;  5GAN 5;  1QX4 A;  5HY6 A;  5FO0 A;  1ZM3 A;  2C78 A;  2CF4 A;  1ZQ1 A;  1NZ9 A;  2X0K A;  1JRI A;  3M58 A;  1KHI A;  1Y71 A;  3EGX B;  4C8Q F;  3ASR A;  3OYD A;  2OBR A;  1RAA B;  3MEU A;  2RQV A;  3FRN A;  5AT1 B;  4A4E A;  4YEL A;  4AG2 C;  4QQD A;  1YI2 A;  1MRZ A;  4PJM A;  1W34 A;  4FL6 A;  3JB9 F;  2C77 A;  3OYE A;  2MK5 A;  1IGU A;  3CCQ B;  3CC2 B;  2FG0 A;  4ELY C;  1QUE A;  2LTO A;  2X4Y A;  2JM9 A;  3H94 A;  4Q7J B;  4HCZ A;  4F7U B;  2QYZ A;  2VYQ A;  3OPO A;  2XKO C;  1KD1 C;  1M90 U;  4FW1 A;  1GCQ C;  1MGQ A;  3QG1 A;  1LPL A;  3HRS A;  2VJI A;  2PMD A;  5IYQ A;  2VB6 A;  4TMX A;  1NLP C;  2RNA A;  1CKA A;  1IHM A;  3QBY A;  1E3Z A;  2BZX A;  4J7F A;  4LD6 A;  1PJ5 A;  1ACM B;  3MKD A;  2MF2 A;  2BM0 A;  4Y9R A;  2DX1 A;  2K5I A;  3U23 A;  2OTL T;  1UEB A;  2DL3 A;  2J6O A;  2KY9 A;  4WF2 A;  2BN4 A;  4BD3 A;  5CQY A;  4RD4 A;  2X85 A;  2H3J A;  3M4G A;  3AGQ A;  4ZGE B;  1BI0 A;  2RQR A;  2F1L A;  3FJP A;  4P12 A;  4F7U F;  2A0F B;  2FRY A;  1SKY B;  4FXU A;  1WNL A;  3GBQ A;  4PFP A;  1OU8 A;  1GJR A;  1G7T A;  1PSF A;  1OI1 A;  5A0D A;  1XFO A;  3SLN A;  4AF7 A;  1LCK A;  4FN5 A;  2DXT A;  3M54 A;  3NMZ C;  1KQS S;  1DG1 G;  3CD6 B;  4M4S A;  3NPF A;  3CPW P;  2A3L A;  1U1T A;  4R71 A;  2O4X A;  4M78 B;  1I5O B;  2CH4 W;  1Q7Y C;  1NJI C;  3OEH A;  4NS5 A;  1W2B S;  1M1F A;  3E20 A;  2VV5 A;  4XTW A;  4MZP A;  2KVO A;  2QEX A;  2I0N A;  1FMV A;  4Z8A A;  3CCU B;  2B7B A;  2KRN A;  3PE0 A;  5FU7 C;  3JAM E;  3CCV Q;  1EP2 B;  1H85 A;  3CC4 B;  4XR6 A;  5GAN e;  4C0F A;  4XD7 A;  4PC2 A;  2DTI A;  1QVG S;  3SD4 A;  1XB2 A;  2EQK A;  3VS0 A;  1V5V A;  3OJW A;  4M78 F;  3I1F A;  1QW1 A;  4PFZ A;  2CT3 A;  1KQS A;  4B3F X;  2NUP B;  3CBP A;  1BIB A;  4ORZ A;  3AVX A;  1N27 A;  4J9B A;  1VHO A;  3HRU A;  2CSI A;  2YWE A;  2KYB A;  1W2B A;  1N06 A;  2E1B A;  4UZU A;  1MNE A;  3G4S B;  5FU6 B;  2XK0 A;  3HTR A;  3A3G A;  3BY2 A;  2CS7 A;  1Q81 C;  1MV0 B;  4B9W A;  2FHD A;  3VS4 A;  2Q6L A;  2XI9 A;  4G1B A;  5IN1 A;  4RTT A;  3OW2 P;  1CKB A;  2C0T A;  4C5G A;  1VIF A;  1WXB A;  2JN9 A;  2HDA A;  2FVG A;  4PK4 A;  2DK3 A;  1D1B A;  4MDX A;  5GAN 3;  2MOX A;  4WWV A;  1Z9Q A;  3QUI A;  1QVG A;  1KC8 D;  1NBM A;  2A36 A;  3EG0 A;  2F69 A;  2C4U A;  2D9T A;  2WSC E;  4XQ3 A;  4G5G A;  4HIZ A;  4ZV4 A;  1BX1 A;  5KH6 A;  3Q1J A;  2K3X A;  3A8G B;  3CPX A;  1FMK A;  2ABL A;  3CXC S;  2EFI A;  4C92 G;  3J81 k;  3LGL A;  3JSC A;  2LJ1 A;  2WSS A;  3QYG B;  1UD8 A;  3BNW A;  3EFR A;  1U1S A;  2DPP B;  3MP1 A;  4KT0 E;  3HPW A;  1X01 A;  3I55 A;  2V4D A;  4FT4 A;  4M77 B;  2XGJ A;  2F2X A;  5BSX A;  2JUF A;  1T6X A;  1KQ2 A;  1M1K U;  5L23 A;  2LCS A;  2XEX A;  2OK7 A;  1S72 T;  1EZZ B;  4LN2 A;  2ED0 A;  4GBQ A;  5LJ5 e;  2PUK B;  2DCU A;  1X75 C;  1U8R A;  3B8H A;  3M55 A;  4NL3 A;  3EH1 A;  3M0R A;  1YJW A;  3QFS A;  4LDX A;  2VXE A;  3CCL T;  1OB2 A;  2LX7 A;  4PJO D;  3R6J A;  2V8J A;  1J3T A;  1VQL A;  4OB3 B;  2JS0 A;  4YAU A;  2W0Z A;  1R77 A;  1X69 A;  1J9Z A;  3CXC A;  2PQW A;  4DBF A;  4MYT A;  2EBP A;  1D0X A;  4G7X A;  3CCS Q;  2C5H A;  4C0Z A;  1VLY A;  4ROX A;  5GAN h;  2KQW A;  2C0I A;  2HDN B;  1YI2 B;  1N9S A;  3G1J A;  4KKU A;  1JQQ A;  4RTX A;  4AFS C;  4YEJ A;  2MYS A;  1VQK T;  3ZIA A;  3RKW A;  3PA2 A;  1EWY A;  2VBT A;  3O8V A;  1G8X A;  2WSF E;  3W2F A;  4N3N A;  1SPK A;  3RIR A;  3WVD B;  1UD6 A;  2PE3 A;  4Z4R A;  3PMT A;  3OSS C;  2GCX A;  2PVG B;  2RH2 A;  2KT1 A;  2DEQ A;  1Q82 D;  3CMA Q;  3WYA A;  1YIJ Q;  4M7D B;  4XTV A;  4JZ4 A;  3LWI A;  3QHS A;  2HBP A;  5HZB A;  2HKQ B;  3Q39 A;  1M90 C;  3FKS A;  3CC7 A;  2E3I A;  1RAE B;  3X26 B;  3CCM T;  2D8J A;  2EYY A;  4PC1 A;  1WPY A;  2A08 A;  4TKO B;  4DBQ A;  2RD1 A;  2CW5 A;  3H9N A;  3OW7 A;  1VQ8 T;  2CP6 A;  1ZUN B;  4P3Y A;  1WHM A;  1PD0 A;  1VQP Q;  2O01 E;  1W0K A;  1UB4 A;  2EW3 A;  2QQA A;  3CCL B;  1G3S A;  2YT6 A;  1WJR A;  5FU7 B;  3QYH B;  2LP5 A;  2D0N A;  1VQ5 A;  4IUR A;  3AVY A;  3ZPN A;  5CR2 A;  4N4I A;  2QI2 A;  5TRD A;  1BKB A;  3L2Z A;  3H6Z A;  2MPX C;  1HZE A;  2DTH A;  2EIF A;  1JXO A;  2JMA A;  4QVD A;  1NRK A;  2QMU A;  1SRM A;  4X9D A;  1RAD B;  5LL6 S;  4OPO A;  4N4G A;  5J26 A;  3VS7 A;  3AT1 B;  3ZUG A;  2OTJ Q;  4BDZ A;  1F20 A;  2EWN A;  4JRI A;  2DLP A;  4OML A;  5EMN A;  1XQB A;  3BE3 A;  1YIT Q;  3A98 A;  1T6Z A;  4JJN K;  2O4X B;  3ME9 A;  1YP5 A;  1Y57 A;  1ZSZ A;  3KL9 A;  1VIE A;  5I22 A;  3CP2 A;  2DNU A;  1UE9 A;  1SKQ A;  2WSE E;  4PC3 A;  2LC4 A;  1K8A R;  2CK3 A;  3INZ A;  1YLO A;  2QEX B;  5EG2 A;  1WPC A;  2JTE A;  1VQ6 T;  3QJ6 A;  4OMF B;  3QWY A;  2MMP A;  3SWN A;  2VWF A;  2ZZE A;  4OPS A;  1JO8 A;  5CKB A;  4OP7 A;  1M3B A;  4M75 G;  5LJ5 h;  3V76 A;  1G3T A;  2E12 A;  3BDU A;  3OP1 A;  3CCM B;  3ASS A;  3OS1 A;  1W70 A;  2CZ0 B;  4WCI A;  4ZN3 A;  1BYM A;  3L2U A;  1MMN A;  4QW2 A;  1QMC A;  2NYS A;  1QKX A;  2E4H A;  3CCE A;  1KG1 A;  1KQS B;  1WFW A;  1M5Q 1;  2AZS A;  2OBT A;  2CC2 A;  3M0S A;  1ZSZ C;  2VKN A;  4UAJ A;  3BH4 A;  3CMM A;  3X24 B;  3UWN A;  2ZIT A;  2NPF A;  4J7I A;  3BY1 A;  1ZUU A;  4F7D A;  1H42 A;  3M4Y A;  3VS5 A;  1XJW B;  4CC2 A;  2C06 A;  1G7S A;  5KYX A;  1WHH A;  1NYF A;  1VQ7 T;  4M78 E;  3OYL A;  2VZL A;  3JQP A;  4PJO C;  2IG0 A;  3A8M B;  3I56 T;  4M7A B;  3J81 E;  1OPL A;  3WNC A;  5GAM j;  2KNB B;  1Z9Z A;  2YXY A;  3QFR A;  4B48 A;  3WXM B;  4YAW A;  1VQ6 B;  1WHL A;  1QVG B;  1NEG A;  3S3O A;  2XNC A;  1LJO A;  3MHX A;  3OYI A;  2LRQ A;  4RLZ A;  1N8R D;  2CH4 A;  5DY9 A;  1K9M U;  3T9N A;  5GAN 4;  1M8V A;  1PJ7 A;  3H41 A;  3FPK A;  4XM3 A;  1G7C A;  2K7A A;  2VNJ A;  1AD5 A;  2D9R A;  4E6R A;  1T3S A;  1T0H A;  2AZV A;  3Q38 A;  1G3Y A;  3I55 B;  1K4U S;  3MEW A;  1C1A A;  5FWC A;  1PJ6 A;  5DM7 R;  2BZY A;  2KI7 A;  2QDL A;  1CNF A;  1NG2 A;  2O2O A;  3A8K A;  3UA6 A;  1QGZ A;  1TUG B;  3THK A;  4OB1 B;  3PNW C;  5CCA A;  1KD1 R;  2DYB A;  4RD6 A;  1D3B B;  2RQW A;  2DD4 A;  1YNZ A;  2WJY A;  1B2R A;  2DBM A;  4EDU A;  1M1K C;  4X7E A;  3L1A A;  2KMT A;  2RHZ A;  2XOK A;  1YJW B;  2NUT A;  2CP3 A;  3EFS A;  2L89 A;  3QJY A;  1ABQ A;  9ATC B;  3X28 B;  2KEA A;  1K73 U;  1DDG A;  1VQ7 B;  2MIO A;  4OP0 A;  1VQL B;  1JBM A;  4D8D A;  3JQR A;  2V7U A;  2EJF A;  4WQM A;  5E6T A;  2HEQ A;  5LJ3 h;  1TG0 A;  4OGC A;  3CME Q;  2PU9 B;  1BJK A;  4ELZ C;  4QQG A;  4NOY A;  2RK2 A;  1IGQ A;  2YRD A;  3EGD A;  3TQ7 P;  4V2S A;  3DLL A;  1O75 A;  2QA4 T;  1FX7 A;  1NYG A;  1X2Q A;  3SDZ A;  3G6E A;  1AWX A;  2DA9 A;  3H0H A;  5DLO A;  1VQO Q;  1WSV A;  3A8J A;  4DNT B;  3V7R A;  2QAZ A;  1KIK A;  1T5E A;  2Q6K A;  2QQR A;  2LNH B;  3JCM f;  4P9S A;  4XOP A;  1UD4 A;  3EFO A;  1V0E A;  1RUW A;  5F4O A;  1WIE A;  3JQQ A;  1K9M D;  3GLX A;  3C95 A;  1U5S A;  3CCR Q;  2DXC A;  1WOS A;  4M77 E;  5GAN 8;  3M57 A;  3MO8 A;  3UT1 A;  4RM0 A;  1Q7Y R;  1NJI R;  4C92 A;  4QVC A;  3ASK A;  2JT4 A;  3C4S A;  2LT4 A;  2W10 A;  3JCM g;  1YHQ T;  4KKS A;  4K1X A;  2DFU A;  3CC7 B;  3A8L B;  1Q86 U;  1G2B A;  2I2L A;  1RQP A;  1PG5 B;  2KRO A;  3CCJ Q;  2Z6B D;  1MAB A;  2EQM A;  4FT2 A;  1U3O A;  2HMA A;  4N0A A;  2XID A;  2VBS A;  4J9I A;  2DZ9 A;  1F1B B;  1I8F A;  1FWZ A;  3Q3A A;  1VQ5 B;  2M5S A;  1RL2 A;  3CPF A;  2DXB A;  3VMF A;  2F4N A;  4IIM A;  2BM1 A;  4DK0 A;  2OI3 A;  2G6F X;  4JS4 A;  1K73 D;  3CCV A;  1E43 A;  1VQ4 T;  4HCC A;  4BUG A;  5TY0 A;  4M75 D;  1FX0 A;  2DIQ A;  2QA4 B;  2QQ9 A;  2GJR A;  1KMH A;  4C92 C;  1YJ9 Q;  3I35 A;  1MV3 A;  2L3Q A;  5KNL A;  5FWB A;  3DLM A;  4L6V 5;  4RG8 A;  1M1G A;  4A4F A;  1WOP A;  1ZSZ B;  2F43 A;  1FNM A;  3OYN A;  1GAW A;  3BC9 A;  2EGE A;  3VRZ A;  4IIO A;  1M3A A;  1Q81 R;  4RJL A;  1VYV A;  4M7D E;  2KVQ G;  1GBQ A;  6AT1 B;  1K28 D;  3LWH A;  3SWN B;  4WZE A;  2LVM A;  3QKJ A;  1FNC A;  4R0K A;  3U6B A;  1VYU A;  1YJN T;  4J9D A;  1TVC A;  2GNC A;  2X6Y A;  1HA3 A;  1GFD A;  2HAX A;  3CCE B;  1NPR A;  4RPB A;  2Y90 A;  1Y96 A;  3WY9 A;  3VNU A;  1A0N B;  3JCM J;  1X27 A;  3OYJ A;  3CCQ T;  4IKF A;  3T51 B;  2RA2 A;  1WOR A;  2IIM A;  2ESW A;  1ARK A;  3FPP A;  2EIX A;  5H59 A;  1VQ4 B;  1WHG A;  2RQU A;  2DJQ A;  4G6I A;  1B3Q A;  2GRE A;  1IO6 A;  1NB0 A;  5KYX B;  2Z0W A;  2XD0 A;  1P4M A;  1W0J A;  1QFZ A;  4MML A;  3S3M A;  2GPJ A;  2O9V A;  4XLH A;  3NGP A;  2C0O A;  2BGJ A;  3OJX A;  2R57 A;  2VBU A;  1VJS A;  1H64 1;  3CB4 A;  1D1A A;  4E47 A;  3EAE A;  4A54 A;  1YFN A;  1QWF A;  4FYV B;  3P26 A;  3WNB A;  4EIK A;  3GOX A;  4U9U A;  3SEJ A;  1QCN A;  1ABO A;  4PFO A;  3EG2 A;  3JCM W;  4PAB A;  4Y91 A;  2P0K A;  4YTL A;  4A4G A;  4MZT A;  3G6E T;  2F1M A;  5GAM g;  1E1R A;  2ZTN A;  2BV3 A;  1YJN B;  2V26 A;  3PVQ A;  1PRM C;  2NUZ A;  1SSF A;  4C0G A;  4C0D C;  3SHW A;  1IRX A;  1VQM A;  4TMW A;  4Y7C A;  3GNG A;  1OU9 A;  1G3W A;  3URG A;  2LNV A;  4AT1 B;  1K9M C;  3WVE B;  5LJ3 d;  3CD6 T;  1VQN Q;  3JCM P;  4M75 A;  3OBW A;  2ZL7 A;  1FMW A;  4LUD A;  2COY A;  3RBB B;  3CCS A;  1E3X A;  1WOO A;  4Z4Z A;  4M1K A;  5IYW A;  1TSF A;  1OZ3 A;  1AZE A;  4PJO G;  4P6V F;  3G71 Q;  2O88 A;  2KXD A;  3PFS A;  2EQU A;  1MHN A;  2GQI A;  3CCU T;  1M90 R;  2E3H A;  5GAM d;  1OB5 A;  4HT9 A;  4J9C A;  3CC2 Q;  3OA6 A;  1VYT A;  2XZO A;  1JJ2 P;  2GTO A;  3CMA A;  1YIJ A;  3CC4 T;  4M7A E;  1TWB A;  4DQK A;  5CQX A;  2A7Y A;  2RJD A;  1F60 A;  4FU6 A;  3JRZ A;  4E7S A;  2MWP A;  2AHJ B;  1K73 C;  2RHU A;  1QP2 A;  2KGT A;  2AIR B;  1LVK A;  4II3 A;  3JB9 J;  1B23 P;  4P2N A;  3EGD B;  4M75 C;  3VR6 A;  2J05 A;  2K5L A;  2ZAE A;  3LO8 A;  1VQP A;  3G6E B;  4K11 A;  1WJS A;  5KYN A;  1QKW A;  1UG1 A;  5FRN A;  4DK1 A;  2FEI A;  1IB0 A;  4D6W A;  2CT4 A;  5J35 A;  2EGA A;  5IK2 A;  1CNE A;  1TUC A;  3RMQ A;  1XE1 A;  3G4S T;  1D2E A;  3QPH A;  2I1L A;  1GRI A;  2ENM A;  2LJ0 A;  4PLL A;  4HVU A;  1HVX A;  1KK2 A;  2OYN A;  2CND A;  4C92 B;  1BCM A;  2WJV A;  1YCY A;  2OTJ A;  1Y0M A;  4YAO A;  3QZ9 B;  2LQW A;  2VYT A;  1YIT A;  1KC8 U;  4ZCL A;  4E7J A;  1TH7 A;  5FW9 A;  3PT9 A;  3V8L A;  2QDX A;  3PVD A;  4L8J A;  4JZ3 A;  1PC0 A;  4E7K A;  5DS0 A;  5CAI A;  2YUO A;  2DF6 A;  5KYW B;  1Q86 C;  2HQH A;  4B9X A;  1BMF A;  2WZN A;  2X8K A;  4RTW A;  3PUM A;  4D8K A;  4N4H A;  2HL5 C;  4KKT A;  3SJZ A;  2ZCF B;  2FVU A;  4ESR A;  2CBX A;  3EG3 A;  1I81 A;  5GMK l;  1AWO A;  4XLE A;  2V7W A;  1WQW A;  4C92 F;  4JLI A;  1WQ7 A;  1EFC A;  3MP8 A;  5IH2 A;  4Z4W A;  2ZPE B;  4WZT A;  1CSK A;  3BCD A;  4X9C A;  2DZC A;  2OTL Q;  3JU4 A;  4DA4 A;  2GF7 A;  1FNB A;  4X1V A;  5GAN j;  3JCM X;  1KK1 A;  2CP7 A;  5GAO r;  1D0Y A;  1OPK A;  4PKC C;  1ZBX A;  2E1R A;  3KEW A;  3VO2 A;  3J80 E;  2VJJ A;  4PJJ A;  2CZ1 B;  2FPF A;  4XKV A;  3BQJ A; 
#chains in the Genus database with same CATH homology
 3HTR A;  3H9N A;  1PM3 A;  2DOG A;  2QGG A;  3A1P A;  2F1L A;  2DYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...