2QGGA

X-ray structure of the protein q6f7i0 from acinetobacter calcoaceticus amms 248. northeast structural genomics consortium target asr73.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
NVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPWYIETKAGWQTVDVKRWKPHGKGLVVSLKGVSDRTGAESLVASNIWIAKSQLPKADVDEYYWSDLKGLTVLGLDDEEQEVNLGQIHELFETGANDVMVVRATPDSIDSEERMIPWHKDVVQRVDLEAGRIYVNWGVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA-processing protein rimM
publication title X-Ray structure of the protein Q6F7I0 from Acinetobacter calcoaceticus AmMS 248.
rcsb
source organism Acinetobacter calcoaceticus
molecule tags Structural genomics, unknown function
total genus 41
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2007-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2qggA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2qggA01
2QGGA 1PM3A 3HTRA 2DOGA 2F1LA 2DYIA 3A1PA 3H9NA
chains in the Genus database with same CATH superfamily
4Q7JB 1OHHA 3VRZA 4XOTA 3G4SB 3HFNA 4J5YA 2D0NA 2VBVA 1VQKA 2GK6A 1D3BB 3HRTA 1UJ0A 2X6YA 4KGVB 3OYAA 3CC2B 3HSBA 3SEMA 4FSXA 1G3YA 1VLOA 1PWTA 1K4US 2CREA 4N0AA 1OI1A 4XONA 2CT3A 4NCNA 1W2BB 2PE3A 4F7UA 1ZSZC 3RDVA 2CDTA 1KHCA 2KNBB 3QDFA 1VQLA 1YHQB 4Z1MA 4C92F 1VLYA 3QFTA 4FSSA 2BN4A 2VYQA 4P26A 1VQKQ 5GAMh 1KJWA 3CCMT 1UD8A 5FA6A 4C8QA 3CC4T 4C0GA 1Q82D 2RQUA 1GR1A 1VQ9B 5FWBA 4M7AF 3ZEHA 1TUIA 3P8HA 1M4ZA 4E7HA 2XI9A 3EHRA 1UEBA 1YCYA 3GVJA 4PC7A 4X7CA 4M4ZA 2CC2A 2K3BA 2P0QA 3M57A 3P8BB 4J9BA 3TU4K 2JVVA 3URGA 5E6TA 2E70A 3CBPA 3M9QA 5FU7C 2ZAEA 1W2BA 3CP2A 2L2PA 2RI5A 3P27A 4EMKA 2YWGA 4WZLA 3NMZC 2F2XA 2KT8A 4RCYA 3G4SQ 3S3MA 4KUDK 3AVWA 2RO0A 1YI2B 2JN9A 2DMOA 5DY9A 3H0HA 5CR2A 2BTTA 4QQ6A 3JRZA 4C0SA 5ECAA 4QV2A 2J06A 2LZ6B 1E63A 3JB9H 2DLPA 4JZ3A 2LNHB 2I1LA 1YITB 1M1KD 3VS7A 3EFSA 2OAWA 3G71A 1WHGA 4J6WA 3U23A 4Y7CA 2V7TA 1JXOA 5GJVB 5KH6A 3M4GA 4M75D 2NPFA 2EW3A 2MAMA 4CC7A 1W1FA 1FNBA 4TMXA 4OOXA 3CCLB 2FRYA 2BF4A 2DX1A 2O9SA 1YHQQ 1VQPB 2MK5A 1K9MC 3JCMf 4TKOB 5FNZA 1QG0A 3CCRB 4Y9RA 4RG2A 5HKCA 2FO0A 1Q86C 1Q81U 5GJWB 1D8TA 1VQKT 2V7VA 3JCMX 1VQ9Q 1X69A 3EGDB 2ECZA 2LDMA 2QTLA 2X4JA 2YLCA 2QQBA 2HAXA 5IXBA 1P4MA 1H8KA 3SJZA 3CCSA 1TUCA 2ZPEB 4AFUC 1TU0B 1MUZA 1I1JA 1JB0E 5CAIA 3GOXA 5KYYB 3KL9A 2JZ2A 4XLCA 4CC3A 1YIJB 1KC8D 3LH0A 2OTJA 4GQNA 3WNBA 4PL6A 2Q6OA 1E1QA 3BH4A 3MEAA 5AYFA 1LOJA 2RNAA 2YXYA 3EHQA 5I21A 4PJOG 1AWWA 3WNDA 4LD9K 1N6AA 4DNTB 4FT2A 1YI2Q 2VYTA 3G4ST 5IYWA 4HXJA 4KRTA 1RUWA 3EH2A 3LYIA 1KK1A 1YX2A 4C43A 4KKSA 2DCUA 2XICA 3CCSQ 2R9VA 4QW2A 3CCQA 2R6HA 3ZIAA 5GANd 1FNDA 1YITQ 4G1BA 1UFFA 1KZLA 4E7IA 4M7DA 4IUQA 1B34A 1X6GA 3OB9A 5LJ3g 3GQBA 2YWWA 5LJ5d 2OTJQ 2KXCA 2NUZA 4B44A 5BSXA 3M56A 1IB8A 4P12A 3VS5A 3CCLQ 3QG1A 4CC4B 2HDNB 4M77G 1VQPQ 4DK1A 4PJNA 1NB0A 1VHOA 1X2QA 1YHQT 1RABB 3OYKA 1XB2A 3RBBB 4Z4RA 1N8RD 3BY1A 2FVGA 4A54A 1JA0A 3NE5B 2V7QA 4X05A 4A53A 4CRIA 1VQ9T 1Y0YA 3OEEA 3I1FA 3OYDA 3RIRA 1ZUNB 1KIKA 1Q81R 4ZV4A 2XNJA 4XTXA 4M75E 4AG1C 4PJOC 2DTHA 1N0VC 1ZSZA 2LJ0A 3QFRA 3VRYA 4EIKA 4F7UF 3UPUA 1YIJQ 4HVUA 3JB9F 3M5AA 1QGZA 1XJWB 3OYGA 4XLAA 2EQIA 4P3IA 4E47A 1OX9A 1RAGB 2QDLA 4QKUA 4XLHA 3QFSA 1QVGB 4B48A 2LJ1A 4C0FA 4CQJA 1R0BG 3VS4A 4OPOA 3A8LB 2D9TA 4C8QF 3OYHA 1NBMA 4XU2A 2MMPA 4MZPA 4Z4TA 3I55A 3EFOB 2O01E 1YI2T 1S72B 3E9FA 3KXTA 3JQQA 4DOWA 1UGVA 4M77C 4AFSC 5DN6A 3CCST 2ZBUA 5EG2A 4GLKA 4J9DA 1ZUKA 3VV0A 1YITT 2M5SA 2XOKA 1AHJB 3CMEA 2GQFA 4BI3A 2F1MA 2O4XB 4FK8A 3R6OA 2OTJT 4F14A 2KAFA 2M0YA 2RK1A 2WZNA 1RI0A 2LQ8A 5LJ3j 3CCUA 2VGNA 1YNZA 1QVGA 2DPPB 1VQPT 1SG5A 2ZTNA 1LPLA 4O6JA 4X0CA 1VUBA 3JU4A 5FO0A 2HL3A 3OP1A 2C5BA 3V7SA 2MCNA 2DJQA 1OGIA 1OULA 2JXBA 1M1GA 2DL8A 4RTYA 2EYQA 3BNWA 1VQNA 3CMEQ 4EH1A 1OB0A 2F2WA 3H8ZA 4KGXB 3CMMA 2ABLA 3WQZA 4B9WA 4QQGA 2D3NA 1V76A 2JMCA 3JV3A 1YIJT 2BE9B 4KBMB 2W0ZA 3A8JA 5LMZA 3X24B 1KQ2A 3WXMB 4ACAA 4XU3A 2Z6BD 3VYHB 3CW2A 1WX6A 5A2QE 2PLFA 2LC4A 3ZBTA 4M78G 4P1VA 5A8AA 3OJXA 4XNFA 2ZBVA 3WNCA 2WPDA 2I0NA 2AHOA 1H3ZA 4JUVA 3Q39A 2XDPA 2V8IA 2VXFA 4QVJA 1E6GA 4PLIA 3VKIA 1K9MU 3QYHB 1VQNQ 4E2FB 3ES9A 1FXXA 1MV3A 3M4YA 2OTLA 1EFRA 2RQRA 3OSVA 3RKXA 3I56A 1Q86U 3OW2B 4FN5A 4MYUA 2M0OA 4RMOA 1V0EA 1U3OA 2DAQA 4M75B 5IYQA 1B07A 4OMLA 2RMOA 2VC8A 2OK8A 1QCNA 3A8HB 1OB2A 3WY9A 4QFMA 4Z02A 4X06A 1NPRA 2M02A 1TXQA 4PJMA 3VS6A 5J3BA 3ZL7C 2EGEA 2K9GA 3JCMW 2H3JA 1YJNA 3O8VA 4HVVA 5CKBA 1QKWA 2DVEA 3LGFA 4M7DF 1SPKA 3I56Q 2DETA 4PKCC 2C4UA 5GAN4 1TH7A 2DF6A 3CMET 3OS0A 2L5QA 1E79A 1BIAA 4M78C 1TG0A 3V8LA 4OP7A 4RCZA 1BIBA 4LDWA 3SD4A 1BI2A 3JCMV 5GAN8 2HEQA 1GJRA 2CP0A 1KG1A 3JB9D 3RMQA 2BPOA 3V8KA 3M58A 3CPWP 5D6YA 4ZCLA 4YAUA 1KK3A 1YJ9B 3S3NA 1MNEA 3RNJA 2XEXA 1JRIA 3NHNA 1VQ5A 4M53A 4OPSA 1X2KA 1VQNT 4E0FA 1TWBA 2QTVA 1QVFP 1B2RA 5LJ3f 3W2EA 1ZSGA 2HQXA 1NJIC 2V7WA 1H85A 4Z89A 1N05A 3VNVA 2F4NA 3CMAB 1MGQA 3LWHA 1GBRA 3EAEA 1Y96A 1EZZB 4XTVA 4ZGDB 2K7AA 1E7OA 3CCVA 1Q86R 4K1XA 1MMAA 2JJ1A 2ATCB 3X25B 2KROA 2CBXA 1Q7YC 4XN3A 2LX7A 3CPFA 3ZC3A 4QHYA 2CKKA 4M77A 3HHTB 1LVKA 3LGLA 4M2LA 1VQMB 3FIFA 2JT4A 4DBFA 4IUPA 4C92B 3VYGA 2CH4W 3WVEB 1BI1A 4BE0A 2G6FX 1V1CA 2ZTGA 3OPOA 3BY2A 5BSYA 1JJ2A 1QH0A 1JJ2P 2QA4A 1OOTA 1X43A 2V26A 3I56T 1Y0RA 4M7AB 4X7FA 5HZAA 1H641 4HVWA 1T0JA 1ZX6A 1R5OA 2QQAA 1KFZA 1YJWA 1VQ7A 4ZN3A 1I81A 4IW3B 5HZBA 3J81k 3OMGA 1DG1G 4N4GA 2LQWA 4E7SA 1MABA 2D3LA 3UDCA 3OYCA 4YEJA 2L0AA 2R58A 4X8IA 2GCXA 4X1VA 1YJ9Q 2RI2A 2V7XA 4RDKA 3F70A 3BFMA 2BM0A 1KK2A 5C0MA 4X34A 2YLBA 2O31A 4RD4A 3BY7A 1NZ9A 3W2HA 4KKTA 4P6VF 1N9SA 3QPHA 1M8MA 2EJFA 1OV3A 5GAMe 2KI7A 5HY6A 1UJYA 1G83A 4F7UE 1YJWQ 3CMAQ 1WNLA 4BD3A 4DK0A 2KYMA 1WDXA 4Z88A 3JCMd 2RJFA 4HT9A 3Q38A 4LN2A 1ZQ1A 4KH1B 4TN1A 2YUNA 4AFZC 4E7JA 1QUFA 5GAOl 3ZZ0A 2NUTA 2E3IA 2C5HA 2KQWA 2P0KA 4ZGNB 9ATCB 3VUBA 3HAGA 5A0GA 2CSQA 4J9CA 1VQMQ 2WSSA 1K28D 3CCMB 2KK4A 2HCJB 5GAN3 4G7XA 2CUDA 1YLOA 4P6YA 2E5QA 2DFUA 2GK7A 1M3BA 3G6EB 2ZITA 2VNJA 2A3LA 4OMQA 1I8DA 5KYUB 1S0UA 3UA7A 2EIXA 3OYBA 5HK0A 4NL3A 2E1HA 1H8HA 3M0PA 4JRKA 3FPKA 3C12A 2L3QA 1Q95G 2HKNA 2EJ9A 4EDUA 1Y57A 4XMYA 1QGAA 2YWFA 3QHSA 1YJ9T 1IO6A 1ZUUA 3AVUA 1N5ZA 5A88A 1SKQA 3META 2ZPFB 4G1VA 4XLEA 1RI9A 2EBPA 2VGMA 4D8KA 3LW5E 4FYYB 5FO1A 3AHUA 2XG8D 4C0DC 3ASRA 3EG9B 1IXDA 1YJWT 1VQ7T 2JMAA 5TRDA 3CMAT 2K2VA 3BDUA 1N27A 3BDLA 4R55A 1Z9QA 5FRMA 2BIVA 1PKSA 1BCOA 1QCOA 2J7IA 3MPUB 1HA3A 4F04B 2GQVA 4PJJA 4FT4A 1G7SA 5IHIA 5FRNA 4C0ZA 1VQMT 4ATOA 3L2VA 2BZ8A 4RTVA 5CKFA 3BCDA 2EQMA 2O9VA 4IUVA 6AT1B 3FJOA 1UDLA 3G6EQ 1ARKA 1N06A 2CS7A 1DDGA 4P25A 5KCHA 4Z8AA 2RJDA 1UD2A 2DIGA 2CNDA 2AKLA 3L2RA 3NTHA 3ONYA 3QDRB 1IGUA 2R5MA 2EYWA 2RJCA 4F7UB 3EG2A 4LUDA 1QMCA 4TVRA 1FNCA 2J7KA 4J7FA 3CXCA 2DVJA 4M77F 2DKGA 2ZXHA 4XN0A 4RPDA 2LTOA 1VQLB 1NJIU 4OMOA 4WTOB 2D9RA 4C8QB 2P0PA 2JS2A 2DYBA 4AC9A 2DY1A 1Q7YU 2C06A 4KGZB 3BC9A 1H42A 3B82A 1V5VA 2X85A 1ZUYA 5TV2A 3UATA 1OPLA 1GAQA 2DYIA 3VO1A 1K9MD 4DQ2A 1X27A 2FHDA 4ZCMA 1WHHA 3QKJA 5IAYA 2L3PA 3A3GA 3FKSA 1I18A 2RM4A 4EMKB 1JJ2S 4OOSA 3OOCA 3CCJA 4JLGA 1XTDA 1XOVA 5TR9A 3DDYA 2VJJA 3UF4A 2RB6A 1PRMC 1E3XA 2JS0A 2AZVA 5IYRA 1VIFA 1UUEA 3U2QA 1U1SA 3I9QA 3G6ET 4RTZA 2COZA 2CK3A 4LBZA 1QCFA 2BKDN 1WTHD 4JPBW 3X26B 1ZM3A 3M55A 2IVWA 4BUGA 3G71B 3OS5A 3QJYA 2K3YA 2DBKA 1EX4A 2JJ2A 1GL5A 1SRLA 1T3LA 2KR3A 1SHGA 5H5JA 4QVZA 1I8FA 2CP2A 3W2FA 1UGPB 1VQLQ 2LP5A 1X75C 3CCJQ 2KY9A 8AT1B 3VMFA 4P9SA 3OZUA 1RACB 3OYNA 2YUPA 1AWOA 1NJIR 4OB0B 1I4K1 5DSZA 3MHXA 3QUIA 5KE2A 4OOVA 2D8JA 2PVDB 2RPNA 2VXEA 4XAXB 3CCSB 4JZ4A 3HPWA 1K8AC 2VUBA 1NYGA 4PC2A 4XQ3A 4B3GA 1WLPB 1Q7YR 3KBGA 3MP1A 2FB7A 2OTJB 1WA7A 2E6NA 4B47A 3UA6A 4EPCA 4Z4YA 2AKKA 2QK0A 2ROLA 3QWYA 3OS2A 4PLLA 5CQXA 2RHXA 4JRIA 1FNMA 1TOVA 1N0UA 1VYVA 5H59A 1M90U 3JCMJ 2ZZEA 4B4DA 2FZCB 2OX7A 4A63B 3AVVA 3WBKA 2DXCA 1HJDA 2VASA 1VQ4A 1F60A 2HSEB 3FDRA 1EFTA 2JTMA 1SHFA 3ASKA 4FYVB 1NDHA 3CCQB 1RLPC 3J7AF 3MEVA 4N3GA 2XDBA 3R6NA 3KUFA 3PUMA 3G71Q 3A8MB 4M7DB 3RESA 2CZ6B 5HKKA 1B34B 5D7UA 2B5OA 1IHMA 2DILA 4ME7A 4PFZA 2NYSA 5GMKh 1D0XA 5HK3A 2E1BA 2NV4A 3OW7A 2XZLA 3PTAA 1UG1A 2WACA 3P8DA 3A35A 1R77A 2OYNA 2D1XA 2K79A 1G3SA 1MV0B 2AZSA 1GFDA 1IJFA 1VQLT 4IKFA 4TMWA 1MNDA 1EFCA 3ZFJA 3CCJT 1VYTA 4RTTA 3OYLA 1K1ZA 3LVBA 1Q82C 1VQ4Q 3AVXA 1NYFA 1FX7A 5LJ3d 2XGJA 2HKQB 1FYNA 3REAB 2A37A 1UD4A 3CCEA 1ZSZB 4II2A 3LWIA 2L89A 3V7CA 1XE1A 1U5SA 2X53S 2GFAA 2B7BA 5GAOn 4OMMA 4WZTA 4P22A 3JCMP 2ZZFA 1T5EA 4YTLA 3A98A 1D09B 3JAME 2JIZA 5GAOm 1VQOA 4E7ZA 4BY6C 3I55B 4BI8B 1PKVA 5KYXB 3PIPA 5FIUA 2PTKA 4HE5A 2BZXA 1KD1D 2DEUA 2K57A 1M90R 4C92D 3CCQQ 3LLRA 5KYNA 4JDSA 3PA1A 3U6BA 2VBSA 3MCAA 1WHKA 1WYXA 5FU7B 1SEMA 3CXCS 1K0SA 1JO8A 4D6WA 3G71T 3KEWA 4M7AD 3I35A 3CMEB 2FL7A 3RMSA 5GV7A 2CF4A 4UZUA 4DA4A 4TMVA 1ELOA 3CCUB 3C0CA 3LQEA 3A1PA 1EWYA 4DBRA 1FRQA 1WU8A 2COYA 2EKOA 5I2SA 1K9AA 2QEXA 5B6IA 1VQ4T 5KYXA 5CQYA 4FU6A 4ZNXA 2EQJA 4HE6A 4DEYA 1W70A 3OE7A 2COWA 3W5VA 2DL3A 1BYMA 2KRSA 4UZEA 1VQNB 1W0KA 5F4JA 1KC8C 1BX0A 1BQEA 4QT7A 2VKNA 4XTUA 3E19A 2AK5A 1WJRA 1W9XA 2AT1B 4KT0E 2V8JA 2O88A 2DNUA 2CH4A 1IREB 3SWNC 2J6KA 2HBWA 3I55Q 2CZ0B 1A8PA 5GAN2 1K73U 2JM8A 2PUKB 1GBQA 1G8XA 1M2VA 3GNGA 1VQ8A 2X3XD 1WOPA 1OX8A 3L42A 1WHLA 3CCQT 5AT1B 1D1NA 2OTLB 3CCET 1DDIA 4PFPA 3N5BB 3I56B 1KTVA 4LDVA 4X7EA 4J9IA 2GQIA 1OEBA 2RHIA 3P26A 3CCUQ 2MPXC 3L2QA 4HCZA 4YAOA 2YT6A 1K8AU 3G05A 2IIMA 4B9XA 1BJKA 1N8RC 5GAN5 2E12A 2RH2A 1QUEA 1Q9SA 2Z0WA 1OU9A 3CEYA 2RHUA 3M0TA 4KUIA 5KW9A 4C92E 4QVAA 1BKBA 1VQ8Q 1LCKA 2G3RA 4PFOA 1RAEB 1YJNB 4P3YA 2EYZA 4J9HA 2OBSA 5KE3A 2P3MA 1O9SA 2QQ9A 4M7AE 2V1QA 4RPBA 4J8OA 1NJID 2HMAA 1PSEA 5M9OA 4QUZA 1HVXA 2ZGWA 3MJXA 3H9NA 3EGXA 3H0IA 1SM4A 1UD5A 3FPPA 2GF7A 3W2IA 4OMPA 3CBOA 4FYWB 3GLXA 3QSYA 3V7AA 2A08A 2LNVA 1KQSA 3OBYA 1EP3B 2VNHA 1KQSP 1NEGA 1R8OB 3M0QA 1PCXA 3TSWA 3DLLA 4J6YA 3I55T 2QEXT 2C2WA 4MDXA 2ZPIB 2LVMA 1GCQC 3JSCA 4GY5A 3V7RA 4BI4A 3R6JA 4LBWA 3PE0A 4OB1B 4FWTA 2BGJA 4F17A 4LUEA 1RLQC 5DLQE 2A7YA 5AN9A 1VQ5B 1K73R 2OTLQ 4WF2A 3OYJA 2DA9A 2GTOA 3C95A 2I2LA 3X28B 1BPLA 3PVLA 1TUGB 3M53A 1Q82U 1M30A 2CRVA 2K2MA 1LNXA 2D0QB 1Y96B 3CCUT 2MOXA 5HXBA 4RUGA 5FLXE 3CCVB 5GAMg 2YRVA 4BACA 1YCSB 2V1RA 1D0ZA 2LCLA 4GBQA 3CPWA 1G5VA 1OQKA 3PMTA 4J0QA 2QQSA 4M77B 3M54A 1YJNQ 1K8AR 4YAFA 4AT1B 3T56B 1VQ8T 1SKUB 2VZLA 3OW2P 4DNRB 4PJOA 2LX9A 4C8QD 1C0MA 1PHTA 2M1HA 3W5UA 3HP9A 1JJ2B 2ZPBB 2QA4B 2NLUA 4FIBA 4N4IA 3JCMc 1NM7A 2QGFB 3ZUGA 5L8RE 1H92A 5CDFA 1RAIB 1QVFA 1QGYA 2PNIA 2GNCA 4WZEA 1X01A 1WOSA 2B8AA 1YJWB 1VQ7B 1X6OA 4C5GA 1R0CB 1Z9ZA 2HDAA 4QQDA 5FU6B 2CZ7B 1W34A 3MP8A 4XKWA 1AMOA 2K4YA 1BBZA 3LX7A 4ASUA 2DXTA 1DJ7B 3JB9G 4DOVA 1UD6A 1VQ5Q 3OYFA 3CP8A 2KXDA 3T9NA 2RC5A 2KYBA 2OTLT 4IIOA 4D8DA 1V29B 2HSPA 3L2ZA 3E1YE 1YWOA 3DB3A 2WSFE 2W6JA 4L8JA 1UE9A 2K5LA 1UGRB 4M1KA 1Q81D 3QXEB 2FEIA 1WGSA 1WXTA 1JU5C 3SWNA 1WHJA 3CCVQ 1TVCA 5J39A 1QWEA 1GFCA 1Q82R 2OJ2A 4A4FA 5CCAA 4KH0B 4II1A 1WQ7A 1KSWA 1G3WA 1BX1A 2EJGA 2NUTB 1GAWA 2YRDA 1KC8U 2YRCA 1QLYA 4DQKA 1HK9A 5GAMj 3VR6A 2ENMA 1PNJA 1YJNT 1M3CA 1YP5A 1VYUA 2PVGB 2QA4Q 2JN0A 4X9CA 4L59A 2PIAA 1T6YA 3QSUA 5DM7R 2KMTA 4Q5WA 4N0AC 1F1BB 2QYZA 1AVZC 1VQ7Q 4XTYA 3ISXA 5GANh 1F20A 3X20B 2XK0A 3ULRB 4YALA 2DBMA 3VNUA 5LJ5h 4R71A 1R5BA 4OMFB 4NBSA 2PUOB 4C8QE 3LNNA 1COWA 1S4MA 4VUBA 1JQQA 2E1RA 4CI0C 4M0LA 1VQ6A 4HT8A 1QFZA 1JEGA 1VQ5T 2CZ1B 2EQKA 1N8RU 2DE0X 1UHCA 5L23A 3VS1A 2DOGA 4XK8E 4M7DD 3B78A 1KK7A 4LE9A 1H8EA 4J7IA 1QVPA 5KYWA 1N9RA 1M90C 2XKOC 5F4MA 4XTWA 3LO8A 1XQHA 4YAWA 2OBTA 2QDYB 1UMKA 3SKBA 3CCVT 2EQUA 3OZVA 3QWXX 1GCQA 2FVUA 2P4TA 4J83A 4EMKC 3FB9A 1X6BA 4MZTA 1WP6A 1ZBJA 1WPCA 4E7LA 3A8IA 2JTEA 3LQ6A 2DZCA 2O2OA 3DKMA 5J3OA 5TY0A 4CC2A 4F16A 1KC8R 1ACMB 4DBQA 5IH2A 2A0FB 5CKEA 4B6MA 3M59A 4M78A 1GVHA 2QA4T 1WJSA 1ZLMA 2C77A 3GIRA 3NTIA 1KQSS 2BM1A 2X35A 2EIFA 5IYNA 5GAOq 1V0FA 1WQWA 2MWPA 3MHPA 5GMKj 3H94A 4NOYA 2EGCA 2F5KA 1ZHIA 1FMVA 1SRMA 2QN6A 1OPKA 1BLIA 2F43A 3CBMA 1NPPA 2RHYA 3OYYA 1ABQA 4MYTA 2E5KA 3SB2A 1NE8A 1AT1B 2VWFA 2GBQA 4TT3A 1PG5B 3CXCB 3CC4A 3CB4A 5GMKe 1PKTA 1ZA1B 1BK2A 1H3HA 4PJOF 3OEHA 4FYXB 3GPLA 3ONUA 5KSWB 4TMTA 3U6KA 1KMHA 3VJPA 5CO7A 1JB9A 2X4WA 2CGHA 1NRKA 4XM3A 4HKEA 4Y9UA 2JNGA 3QJ6A 2V31A 2C0IA 1BCMA 4OPVA 3QZ5B 3CPWS 2WSCE 2L3RA 1N8RR 4X07A 2IPOB 1CQXA 1SKYB 4FW2A 1I0CA 3ASPA 4NNJA 3GBQA 5FW9A 3JB9J 1BI3A 3BQJA 4ORZA 1B3QA 5GAMf 4ZCIA 3BW1A 5DS0A 4OF1A 2EKHA 2H8HA 2KBTA 3JQRA 1FRNA 1G7TA 2PU9B 3J80E 1QVFS 3CCJB 4JRPA 1D2EA 1EP1B 1U1TA 4PGOA 5J26A 4LBVA 1E6HA 3L2UA 2R5AA 3AT1B 4M7DE 5IK2A 2OBRA 2PVOB 3PVDA 2CP6A 2RK2A 4XU1A 5GV8A 4RG8A 1RAFB 3OAAA 2A36A 1PSFA 3FC3A 3O5ZA 2LT4A 3E9GA 3Q1JA 4F7DA 2PZ1A 2ZPHB 2QI2A 2DL7A 4LD6A 2HLDA 1MMGA 1Q86D 2LJ3A 1VOMA 3HL8A 4R0KA 2FPDA 1KHIA 2YWHA 2YWEA 1ZM4A 5LL6S 3H41A 4Y28E 1IRXA 1AOJA 4C5IA 1M8VA 2AHJB 2FPEA 1OB5A 3MEWA 1VIEA 3TVTA 1K76A 2D6FA 4RD2A 3SHWA 3PA2A 3PNWC 1E1RA 4ANJA 3EG1A 3GVKA 1FX0A 1K73C 1QFYA 2XZOA 1KRHA 5GMKl 2F2VA 4MZMA 2BUDA 3G4SA 3GSIA 1IHWA 3E2UA 1PJ5A 1CNFA 1D3BA 2ZZQA 2J6OA 1TSFA 3CC2A 1MRZA 2W6IA 4UC4A 2PMDA 2K3XA 2YUQA 1VQ4B 1IJEA 1M3AA 1WXUA 4C0DB 3QFCA 2KVQG 3FJPA 3VUZA 3HTRA 4ROXA 7AT1B 1W2BP 3W2GA 2L8DA 3HFOA 1XNIA 4IIMA 4OGCA 1M2OA 4YXWA 3C94A 3JQPA 1CKAA 1WJQA 1YHQA 2RQVA 3A3BA 2DD4A 1KQ1A 1HYOA 3PT9A 2Q6LA 4B3FX 4L5GA 1U8RA 2X4XA 5CIUA 2QGGA 2CUBA 4RDJA 1VQ9A 3CC2Q 1QW1A 3NGPA 2LT1A 2C0OA 1M5Q1 2ESWA 3VS0A 3QE2A 4M78F 1W35A 3QO3A 4OB3B 2E41A 4PJOD 3AVYA 2X6WA 2LMJA 1I5LA 4ACBA 3AVTA 4OB2B 2MF2A 1UECA 2RQTA 4C5HA 5GAOr 3WBJA 4FM4B 3CCEB 3VU3C 5A89A 1NLPC 4TMZA 5GAN6 4DEXA 2E10A 2QMUA 1TTTA 4A4KA 1PRLC 5KCOA 3GF5A 1T6ZA 2VJIA 4LNPA 4YHBA 2LQKA 4IUTA 5IN1A 2VBUA 4HIZA 4WWVA 3T53B 3TQ7P 1D1AA 1RAHB 2RD1A 3ZBDA 1G2BA 1CNEA 4J9GA 1YI2A 2ZCFB 1FMWA 2LCSA 5HCKA 2RN8A 4G5GA 1UGQB 1XQBA 1VQOB 3OMCA 1AD5A 1GXIE 4Z4UA 1WSVA 3EG3A 4J6XA 2P84A 4M75G 3FJ5A 4M77D 4RD0A 4UAJA 2DTIA 1YITA 1MMNA 2XIDA 2DD5A 1HD3A 1CKBA 1WFWA 1E62A 3MP6A 3UWNA 8ATCB 1PC0A 3MCAB 3J81E 1ZM2A 2K5IA 3GIBA 2KRMA 2JM9A 3CCLA 1U06A 1R5NA 2QDXA 1B7TA 2EVRA 1NBEB 3G7ZA 1VQPA 1EP2B 1Y71A 3CCRA 1A0NB 2JW4A 1FDRA 4B43A 1G3TA 4ZTFA 2KEAA 1HZEA 1RAAB 3Q6RA 4RM0A 1D1CA 1YFNA 3EGDA 2B86A 2RQWA 4KULA 3JCMh 1MMDA 3H6ZA 3CC2T 4A4GA 3CQTA 2RHZA 1VHEA 2QEXB 2YHTA 3DLMA 3QIIA 1LJOA 1P92A 2DRMA 4BDYA 1RQPA 4Z4SA 1QFJA 4MMLA 4FW1A 4RTXA 3OJWA 2FZGB 4LXCA 5KYYA 2E65A 1D1BA 5GANg 1YIJA 3CCEQ 1WIEA 2Y90A 1M1KC 2JUFA 2MYSA 4OMNA 1RQRA 5LJ5g 2FYKA 1OZ2A 1EFUA 3CCRQ 2DIQA 1EFNA 2DL4A 4M75C 2Q6IA 3CRZA 2E3HA 2HZYA 4QVDA 1M9SA 1O75A 3TCJA 3JCMQ 2ZPGB 1PD1A 1SSFA 4ELZC 1QX4A 5D6WA 4WCIA 3D26A 2EYXA 3L1AA 2QTXA 1VQOQ 4HCKA 1NLOC 3ASQA 3HRUA 1G7RA 3ZPNA 4PJOE 4XU0A 4RCCA 2DM1A 1M2VB 2Y4XA 1RL2A 1C1AA 1VQ8B 4OGEA 5CKDA 1UGSB 4EMHA 4XD7A 2DERA 1PJ7A 4JJNK 4MDWA 2V4DA 2DXUA 1C6VX 5F4OA 1ZA2B 2B7CA 3G1JA 4Y91A 5IT9E 2X8KA 4Z4VA 4H9GA 4C92G 2K6DA 5CK9A 2CSIA 3B8HA 4UZFA 4O5VA 2WR8A 1HSQA 1TLLA 4XTZA 4M77E 2QTZA 3L2WA 4M7AG 3OZWA 1Y0MA 2HQEA 3UT1A 1BMFA 2D8HA 2QEXQ 1W4SA 1UD3A 2YDLA 4AF6A 2DXBA 4XKVA 2GGRA 4KKUA 4U9UA 2GPJA 2LZJA 2HL5C 1WORA 3A8GB 2D74A 3ZZUA 2VV5A 5IHKA 2ZL6A 3OKXA 4M78D 1M1FA 1E64A 2E4HA 1TS9A 4X9DA 3CCLT 2JJ9A 2ZXIA 3EGXB 1QVGP 4EMGA 5GANj 3EH1A 3CCRT 2GJRA 4PK4A 3R6KA 4A4EA 1AZEA 5FU6C 3QYGB 5EC7A 2ED1A 3ASTA 5LJ5j 3EFOA 2X3UA 3PVQA 1ZBXA 1QWFA 5LJ3e 1S72A 1GO2A 4RLZA 1AWJA 2OI3A 1KQSB 4AFQC 2CYZB 5GANe 3ER0A 2FPFA 2AIRB 1W2BS 5FL7A 2F69A 1VQOT 1J9ZA 2GFUA 1KK0A 1FWZA 4L6V5 5IYPA 1KD1C 2VB6A 1SSHA 5LJ5e 2XNDA 3Q6QA 4C92C 4NS5A 1Y07A 1QP3A 2SEMA 3JCMb 1ABOA 2O4XA 4FL6A 4JS4A 2RJEA 1IHVA 1N08A 1W87A 4M7AC 2BVNA 3M0UA 4R56A 2ZZGA 2HD0A 3PENA 4JJBA 4P5NA 2E64A 4WQMA 2HBPA 2K5FA 3IQLA 4NL2A 1I07A 1VA7A 4E7KA 1YBYA 3ZZTA 2CP5A 1S72Q 2XNCA 2CP3A 1Q7YD 4PC3A 4GLMA 4BY6B 3VS2A 3TEEA 3OYIA 1QKXA 3CPWB 2DTOA 4X7DA 2DEQA 2V7UA 2FRWA 4HCBA 2QASA 1NB9A 2RI3A 4RTWA 3ME9A 1B23P 4IURA 2KE9A 2ED0A 2HQHA 3MO8A 5GMKi 4PJOB 4JJCA 4AMCA 3PUNA 3PGGA 3OS1A 3T51B 5FROA 2WJVA 2DRKA 1HXDA 3INZA 3NTKA 2C78A 1QVFB 1OU8A 1SF9A 2BV3A 4RJLA 3PIOA 1JNYA 1WOOA 2GJKA 3A8KA 5GAMd 3WXMA 2YSQA 1T0HA 3M0SA 3DB4A 3PFSA 5FWCA 4XOPA 5IXFA 4A4HA 3FEOA 2CW5A 2WSEE 5GMKm 1MHNA 3EFRA 1M27C 2CP7A 3BCFA 4M78E 2H3EB 2XHCA 4Z4ZA 3OW2A 2QE7A 3NPFA 3TSZA 4M75A 2ZL5A 1VF7A 2WZPP 4JS5A 2J05A 2KSSA 3HRSA 2X51A 3VO2A 2EYYA 2KT1A 2QQRA 2M51A 4C5EA 3EG0A 5DLOA 1OZ3A 3SWNB 2X6XA 1AZGB 3CPXA 2LQNA 2OAUA 1BU1A 2GTJA 3V76A 4ZN1A 4ZTJA 3AGPA 2F1LA 1S72T 1M1KU 1AWXA 2RC6A 2JTFA 3TREA 3Q3AA 2VNIA 4XORA 4RKUE 3LH5A 1WDTA 5JBQA 4TSFA 1N07A 2Y4YA 4DBHA 2Q6KA 1WI7A 3D7SB 1EIFA 1UHFA 4AVZA 4F7UG 2P4RA 1JA1A 1K9MR 4BPRA 2DZ9A 3HKSA 5GANf 3REBB 5CKHA 3M0RA 1M90D 1UB4A 1W6XA 2DJZA 1BB9A 3OY9A 5LJ5f 4ELYC 3FRNA 2EPDA 1I7PA 2C4TA 2FX3A 4C8QG 3RR6A 1CSKA 4RTUA 4LBYA 3CC7B 2MIOA 2NWMA 4BE2A 2JDIA 3SLDA 4G6IA 1E3ZA 4XQFA 2OK7A 5THXA 1YJ9A 2L3SA 4ESRA 1WSRA 3MEUA 2WJYA 3PMIA 4K11A 2BE7D 5C6SA 3OA6A 4ZGJB 3OYMA 4DQLA 5I22A 5KNLA 4N4HA 1VQ6B 2EFGA 4LDUA 1QP2A 2M9UA 4PC6A 1JBMA 4WZKA 2E6ZA 3GNFB 4RD6A 4PABA 3CMAA 2KGTA 1OYXA 2VVKA 4II3A 1IB0A 3CESA 2V8KA 3OYEA 5LJ3h 1DARA 1JXMA 2IG0A 4BE1A 3OFNA 3CD6B 5KYWB 3RKWA 4PC1A 3I5RA 2EWNA 2QXFA 3AGQA 3EGUA 2GJPA 3CC7A 3QZ9B 2XMFA 4RDLA 2LRQA 5I2MA 1VQMA 2PQWA 3ASSA 2M16A 1UTIA 4C92A 2XU8A 2DL5A 1E43A 4LDYA 2W10A 1WHMA 2DO3A 1Y7XA 3NFCA 2CT4A 1M1KR 2JOYA 2KRNA 1QVGS 4C8QC 3MMPA 4PNOA 1PD0A 4M7AA 4ZGEB 3A8OB 2SRCA 2EAYA 5A0LA 4M78B 2YUOA 2VBTA 1RADB 2WYRA 4IUUA 4M4SA 1KD1U 4XL9A 2FZKB 3BE3A 1GRIA 5CVIA 3RKYA 5GAN7 3CD6A 3CC7Q 4JRQA 5I11A 3JCMg 2F5TX 2DK3A 3SJPA 4B3XA 3FLGA 4PJLA 4J9EA 3OBWA 1BI0A 2LCCA 4J9FA 3CC4B 3V8JA 2C0TA 4JMQA 1QQJA 1I5OB 1U2RA 3C4SA 1VJSA 1VQ6Q 1WZOA 3RERA 5D6XA 5A0DA 4XLFA 3SDZA 2HCKA 3RY8A 5L46A 4RD1A 4V2SA 3E20A 2BGIA 1GCPA 4FXUA 1Q81C 5IHNA 3CD6Q 1XFOA 1K0XA 3MKDA 2MI6A 4JJDA 4Y92A 1NG2A 2XZPA 2VNKA 3ZBUA 3CCMA 2QAZA 4RD3A 1ZM9A 3KFVA 3OQ5A 4M7DG 4YELA 4OP0A 3G6EA 2XD0A 1D0YA 4E6RA 4M75F 1WPYA 4PAAA 2NUPB 3OSSC 1AIPA 3H0FA 1PM3A 2BZYA 2EGAA 5KYUA 1YWPA 3E1SA 1T3SA 2KDSA 4BB7A 5J35A 1FMKA 2X4YA 1K73D 4QVCA 4RCBA 2KVOA 2J6FA 1TTHB 1S1NA 1IZ6A 4G7WA 3CC7T 1T6XA 2R57A 3W5HA 1TUDA 2ZZDA 3A5ZB 3WVDB 3CCMQ 1KD1R 3OW2S 4XR6A 3CC4Q 1J3TA 5EMNA 4P2NA 3THKA 1AEYA 4Z4WA 2X3WD 2BMWA 4N3NA 1VQKB 2EFIA 3GVLA 5GAOp 2RA2A 3S3OA 2BSAA 2HNIA 2FG0A 4OVAA 4LDXA 1EXMA 3SLNA 3SEJA 3WYAA 4AF7A 4MMKA 3VS3A 4HCCA 4BDZA 1VQ6T 1IGQA 4FCYA 2NUPA 3I5SA 3QBYA 3S6WA 1K8AD 3JCMe 4LC0A 3EG9A 1NEBA 2ROTA 4AG2C 1KJZA 4HA8A 4ZGQB 2GREA 1W0JA 1YN8A 3RUXA 3JB9I 3GP8A 4M7DC 1PJ6A 2X0KA 3SFMA 2XDDA 3CD6T 4JLIA 3CXCP 2MWOA 2A28A 1G7CA 1WXBA 2X9HA 2ZL7A 2DIEA 2RF0A 3CTAA 1OGJA 2QG9B
chains in the Genus database with same CATH topology
2QGGA 1PM3A 3HTRA 2DOGA 2F1LA 2DYIA 3A1PA 3H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGG A;  1PM3 A;  3HTR A;  2DOG A;  2F1L A;  2DYI A;  3A1P A;  3H9N A; 
#chains in the Genus database with same CATH topology
 4Q7J B;  1OHH A;  3VRZ A;  4XOT A;  3G4S B;  3HFN A;  4J5Y A;  2D0N A;  2VBV A;  1VQK A;  2GK6 A;  1D3B B;  3HRT A;  1UJ0 A;  2X6Y A;  4KGV B;  3OYA A;  3CC2 B;  3HSB A;  3SEM A;  4FSX A;  1G3Y A;  1VLO A;  1PWT A;  1K4U S;  2CRE A;  4N0A A;  1OI1 A;  4XON A;  2CT3 A;  4NCN A;  1W2B B;  2PE3 A;  4F7U A;  1ZSZ C;  3RDV A;  2CDT A;  1KHC A;  2KNB B;  3QDF A;  1VQL A;  1YHQ B;  4Z1M A;  4C92 F;  1VLY A;  3QFT A;  4FSS A;  2BN4 A;  2VYQ A;  4P26 A;  1VQK Q;  5GAM h;  1KJW A;  3CCM T;  1UD8 A;  5FA6 A;  4C8Q A;  3CC4 T;  4C0G A;  1Q82 D;  2RQU A;  1GR1 A;  1VQ9 B;  5FWB A;  4M7A F;  3ZEH A;  1TUI A;  3P8H A;  1M4Z A;  4E7H A;  2XI9 A;  3EHR A;  1UEB A;  1YCY A;  3GVJ A;  4PC7 A;  4X7C A;  4M4Z A;  2CC2 A;  2K3B A;  2P0Q A;  3M57 A;  3P8B B;  4J9B A;  3TU4 K;  2JVV A;  3URG A;  5E6T A;  2E70 A;  3CBP A;  3M9Q A;  5FU7 C;  2ZAE A;  1W2B A;  3CP2 A;  2L2P A;  2RI5 A;  3P27 A;  4EMK A;  2YWG A;  4WZL A;  3NMZ C;  2F2X A;  2KT8 A;  4RCY A;  3G4S Q;  3S3M A;  4KUD K;  3AVW A;  2RO0 A;  1YI2 B;  2JN9 A;  2DMO A;  5DY9 A;  3H0H A;  5CR2 A;  2BTT A;  4QQ6 A;  3JRZ A;  4C0S A;  5ECA A;  4QV2 A;  2J06 A;  2LZ6 B;  1E63 A;  3JB9 H;  2DLP A;  4JZ3 A;  2LNH B;  2I1L A;  1YIT B;  1M1K D;  3VS7 A;  3EFS A;  2OAW A;  3G71 A;  1WHG A;  4J6W A;  3U23 A;  4Y7C A;  2V7T A;  1JXO A;  5GJV B;  5KH6 A;  3M4G A;  4M75 D;  2NPF A;  2EW3 A;  2MAM A;  4CC7 A;  1W1F A;  1FNB A;  4TMX A;  4OOX A;  3CCL B;  2FRY A;  2BF4 A;  2DX1 A;  2O9S A;  1YHQ Q;  1VQP B;  2MK5 A;  1K9M C;  3JCM f;  4TKO B;  5FNZ A;  1QG0 A;  3CCR B;  4Y9R A;  4RG2 A;  5HKC A;  2FO0 A;  1Q86 C;  1Q81 U;  5GJW B;  1D8T A;  1VQK T;  2V7V A;  3JCM X;  1VQ9 Q;  1X69 A;  3EGD B;  2ECZ A;  2LDM A;  2QTL A;  2X4J A;  2YLC A;  2QQB A;  2HAX A;  5IXB A;  1P4M A;  1H8K A;  3SJZ A;  3CCS A;  1TUC A;  2ZPE B;  4AFU C;  1TU0 B;  1MUZ A;  1I1J A;  1JB0 E;  5CAI A;  3GOX A;  5KYY B;  3KL9 A;  2JZ2 A;  4XLC A;  4CC3 A;  1YIJ B;  1KC8 D;  3LH0 A;  2OTJ A;  4GQN A;  3WNB A;  4PL6 A;  2Q6O A;  1E1Q A;  3BH4 A;  3MEA A;  5AYF A;  1LOJ A;  2RNA A;  2YXY A;  3EHQ A;  5I21 A;  4PJO G;  1AWW A;  3WND A;  4LD9 K;  1N6A A;  4DNT B;  4FT2 A;  1YI2 Q;  2VYT A;  3G4S T;  5IYW A;  4HXJ A;  4KRT A;  1RUW A;  3EH2 A;  3LYI A;  1KK1 A;  1YX2 A;  4C43 A;  4KKS A;  2DCU A;  2XIC A;  3CCS Q;  2R9V A;  4QW2 A;  3CCQ A;  2R6H A;  3ZIA A;  5GAN d;  1FND A;  1YIT Q;  4G1B A;  1UFF A;  1KZL A;  4E7I A;  4M7D A;  4IUQ A;  1B34 A;  1X6G A;  3OB9 A;  5LJ3 g;  3GQB A;  2YWW A;  5LJ5 d;  2OTJ Q;  2KXC A;  2NUZ A;  4B44 A;  5BSX A;  3M56 A;  1IB8 A;  4P12 A;  3VS5 A;  3CCL Q;  3QG1 A;  4CC4 B;  2HDN B;  4M77 G;  1VQP Q;  4DK1 A;  4PJN A;  1NB0 A;  1VHO A;  1X2Q A;  1YHQ T;  1RAB B;  3OYK A;  1XB2 A;  3RBB B;  4Z4R A;  1N8R D;  3BY1 A;  2FVG A;  4A54 A;  1JA0 A;  3NE5 B;  2V7Q A;  4X05 A;  4A53 A;  4CRI A;  1VQ9 T;  1Y0Y A;  3OEE A;  3I1F A;  3OYD A;  3RIR A;  1ZUN B;  1KIK A;  1Q81 R;  4ZV4 A;  2XNJ A;  4XTX A;  4M75 E;  4AG1 C;  4PJO C;  2DTH A;  1N0V C;  1ZSZ A;  2LJ0 A;  3QFR A;  3VRY A;  4EIK A;  4F7U F;  3UPU A;  1YIJ Q;  4HVU A;  3JB9 F;  3M5A A;  1QGZ A;  1XJW B;  3OYG A;  4XLA A;  2EQI A;  4P3I A;  4E47 A;  1OX9 A;  1RAG B;  2QDL A;  4QKU A;  4XLH A;  3QFS A;  1QVG B;  4B48 A;  2LJ1 A;  4C0F A;  4CQJ A;  1R0B G;  3VS4 A;  4OPO A;  3A8L B;  2D9T A;  4C8Q F;  3OYH A;  1NBM A;  4XU2 A;  2MMP A;  4MZP A;  4Z4T A;  3I55 A;  3EFO B;  2O01 E;  1YI2 T;  1S72 B;  3E9F A;  3KXT A;  3JQQ A;  4DOW A;  1UGV A;  4M77 C;  4AFS C;  5DN6 A;  3CCS T;  2ZBU A;  5EG2 A;  4GLK A;  4J9D A;  1ZUK A;  3VV0 A;  1YIT T;  2M5S A;  2XOK A;  1AHJ B;  3CME A;  2GQF A;  4BI3 A;  2F1M A;  2O4X B;  4FK8 A;  3R6O A;  2OTJ T;  4F14 A;  2KAF A;  2M0Y A;  2RK1 A;  2WZN A;  1RI0 A;  2LQ8 A;  5LJ3 j;  3CCU A;  2VGN A;  1YNZ A;  1QVG A;  2DPP B;  1VQP T;  1SG5 A;  2ZTN A;  1LPL A;  4O6J A;  4X0C A;  1VUB A;  3JU4 A;  5FO0 A;  2HL3 A;  3OP1 A;  2C5B A;  3V7S A;  2MCN A;  2DJQ A;  1OGI A;  1OUL A;  2JXB A;  1M1G A;  2DL8 A;  4RTY A;  2EYQ A;  3BNW A;  1VQN A;  3CME Q;  4EH1 A;  1OB0 A;  2F2W A;  3H8Z A;  4KGX B;  3CMM A;  2ABL A;  3WQZ A;  4B9W A;  4QQG A;  2D3N A;  1V76 A;  2JMC A;  3JV3 A;  1YIJ T;  2BE9 B;  4KBM B;  2W0Z A;  3A8J A;  5LMZ A;  3X24 B;  1KQ2 A;  3WXM B;  4ACA A;  4XU3 A;  2Z6B D;  3VYH B;  3CW2 A;  1WX6 A;  5A2Q E;  2PLF A;  2LC4 A;  3ZBT A;  4M78 G;  4P1V A;  5A8A A;  3OJX A;  4XNF A;  2ZBV A;  3WNC A;  2WPD A;  2I0N A;  2AHO A;  1H3Z A;  4JUV A;  3Q39 A;  2XDP A;  2V8I A;  2VXF A;  4QVJ A;  1E6G A;  4PLI A;  3VKI A;  1K9M U;  3QYH B;  1VQN Q;  4E2F B;  3ES9 A;  1FXX A;  1MV3 A;  3M4Y A;  2OTL A;  1EFR A;  2RQR A;  3OSV A;  3RKX A;  3I56 A;  1Q86 U;  3OW2 B;  4FN5 A;  4MYU A;  2M0O A;  4RMO A;  1V0E A;  1U3O A;  2DAQ A;  4M75 B;  5IYQ A;  1B07 A;  4OML A;  2RMO A;  2VC8 A;  2OK8 A;  1QCN A;  3A8H B;  1OB2 A;  3WY9 A;  4QFM A;  4Z02 A;  4X06 A;  1NPR A;  2M02 A;  1TXQ A;  4PJM A;  3VS6 A;  5J3B A;  3ZL7 C;  2EGE A;  2K9G A;  3JCM W;  2H3J A;  1YJN A;  3O8V A;  4HVV A;  5CKB A;  1QKW A;  2DVE A;  3LGF A;  4M7D F;  1SPK A;  3I56 Q;  2DET A;  4PKC C;  2C4U A;  5GAN 4;  1TH7 A;  2DF6 A;  3CME T;  3OS0 A;  2L5Q A;  1E79 A;  1BIA A;  4M78 C;  1TG0 A;  3V8L A;  4OP7 A;  4RCZ A;  1BIB A;  4LDW A;  3SD4 A;  1BI2 A;  3JCM V;  5GAN 8;  2HEQ A;  1GJR A;  2CP0 A;  1KG1 A;  3JB9 D;  3RMQ A;  2BPO A;  3V8K A;  3M58 A;  3CPW P;  5D6Y A;  4ZCL A;  4YAU A;  1KK3 A;  1YJ9 B;  3S3N A;  1MNE A;  3RNJ A;  2XEX A;  1JRI A;  3NHN A;  1VQ5 A;  4M53 A;  4OPS A;  1X2K A;  1VQN T;  4E0F A;  1TWB A;  2QTV A;  1QVF P;  1B2R A;  5LJ3 f;  3W2E A;  1ZSG A;  2HQX A;  1NJI C;  2V7W A;  1H85 A;  4Z89 A;  1N05 A;  3VNV A;  2F4N A;  3CMA B;  1MGQ A;  3LWH A;  1GBR A;  3EAE A;  1Y96 A;  1EZZ B;  4XTV A;  4ZGD B;  2K7A A;  1E7O A;  3CCV A;  1Q86 R;  4K1X A;  1MMA A;  2JJ1 A;  2ATC B;  3X25 B;  2KRO A;  2CBX A;  1Q7Y C;  4XN3 A;  2LX7 A;  3CPF A;  3ZC3 A;  4QHY A;  2CKK A;  4M77 A;  3HHT B;  1LVK A;  3LGL A;  4M2L A;  1VQM B;  3FIF A;  2JT4 A;  4DBF A;  4IUP A;  4C92 B;  3VYG A;  2CH4 W;  3WVE B;  1BI1 A;  4BE0 A;  2G6F X;  1V1C A;  2ZTG A;  3OPO A;  3BY2 A;  5BSY A;  1JJ2 A;  1QH0 A;  1JJ2 P;  2QA4 A;  1OOT A;  1X43 A;  2V26 A;  3I56 T;  1Y0R A;  4M7A B;  4X7F A;  5HZA A;  1H64 1;  4HVW A;  1T0J A;  1ZX6 A;  1R5O A;  2QQA A;  1KFZ A;  1YJW A;  1VQ7 A;  4ZN3 A;  1I81 A;  4IW3 B;  5HZB A;  3J81 k;  3OMG A;  1DG1 G;  4N4G A;  2LQW A;  4E7S A;  1MAB A;  2D3L A;  3UDC A;  3OYC A;  4YEJ A;  2L0A A;  2R58 A;  4X8I A;  2GCX A;  4X1V A;  1YJ9 Q;  2RI2 A;  2V7X A;  4RDK A;  3F70 A;  3BFM A;  2BM0 A;  1KK2 A;  5C0M A;  4X34 A;  2YLB A;  2O31 A;  4RD4 A;  3BY7 A;  1NZ9 A;  3W2H A;  4KKT A;  4P6V F;  1N9S A;  3QPH A;  1M8M A;  2EJF A;  1OV3 A;  5GAM e;  2KI7 A;  5HY6 A;  1UJY A;  1G83 A;  4F7U E;  1YJW Q;  3CMA Q;  1WNL A;  4BD3 A;  4DK0 A;  2KYM A;  1WDX A;  4Z88 A;  3JCM d;  2RJF A;  4HT9 A;  3Q38 A;  4LN2 A;  1ZQ1 A;  4KH1 B;  4TN1 A;  2YUN A;  4AFZ C;  4E7J A;  1QUF A;  5GAO l;  3ZZ0 A;  2NUT A;  2E3I A;  2C5H A;  2KQW A;  2P0K A;  4ZGN B;  9ATC B;  3VUB A;  3HAG A;  5A0G A;  2CSQ A;  4J9C A;  1VQM Q;  2WSS A;  1K28 D;  3CCM B;  2KK4 A;  2HCJ B;  5GAN 3;  4G7X A;  2CUD A;  1YLO A;  4P6Y A;  2E5Q A;  2DFU A;  2GK7 A;  1M3B A;  3G6E B;  2ZIT A;  2VNJ A;  2A3L A;  4OMQ A;  1I8D A;  5KYU B;  1S0U A;  3UA7 A;  2EIX A;  3OYB A;  5HK0 A;  4NL3 A;  2E1H A;  1H8H A;  3M0P A;  4JRK A;  3FPK A;  3C12 A;  2L3Q A;  1Q95 G;  2HKN A;  2EJ9 A;  4EDU A;  1Y57 A;  4XMY A;  1QGA A;  2YWF A;  3QHS A;  1YJ9 T;  1IO6 A;  1ZUU A;  3AVU A;  1N5Z A;  5A88 A;  1SKQ A;  3MET A;  2ZPF B;  4G1V A;  4XLE A;  1RI9 A;  2EBP A;  2VGM A;  4D8K A;  3LW5 E;  4FYY B;  5FO1 A;  3AHU A;  2XG8 D;  4C0D C;  3ASR A;  3EG9 B;  1IXD A;  1YJW T;  1VQ7 T;  2JMA A;  5TRD A;  3CMA T;  2K2V A;  3BDU A;  1N27 A;  3BDL A;  4R55 A;  1Z9Q A;  5FRM A;  2BIV A;  1PKS A;  1BCO A;  1QCO A;  2J7I A;  3MPU B;  1HA3 A;  4F04 B;  2GQV A;  4PJJ A;  4FT4 A;  1G7S A;  5IHI A;  5FRN A;  4C0Z A;  1VQM T;  4ATO A;  3L2V A;  2BZ8 A;  4RTV A;  5CKF A;  3BCD A;  2EQM A;  2O9V A;  4IUV A;  6AT1 B;  3FJO A;  1UDL A;  3G6E Q;  1ARK A;  1N06 A;  2CS7 A;  1DDG A;  4P25 A;  5KCH A;  4Z8A A;  2RJD A;  1UD2 A;  2DIG A;  2CND A;  2AKL A;  3L2R A;  3NTH A;  3ONY A;  3QDR B;  1IGU A;  2R5M A;  2EYW A;  2RJC A;  4F7U B;  3EG2 A;  4LUD A;  1QMC A;  4TVR A;  1FNC A;  2J7K A;  4J7F A;  3CXC A;  2DVJ A;  4M77 F;  2DKG A;  2ZXH A;  4XN0 A;  4RPD A;  2LTO A;  1VQL B;  1NJI U;  4OMO A;  4WTO B;  2D9R A;  4C8Q B;  2P0P A;  2JS2 A;  2DYB A;  4AC9 A;  2DY1 A;  1Q7Y U;  2C06 A;  4KGZ B;  3BC9 A;  1H42 A;  3B82 A;  1V5V A;  2X85 A;  1ZUY A;  5TV2 A;  3UAT A;  1OPL A;  1GAQ A;  2DYI A;  3VO1 A;  1K9M D;  4DQ2 A;  1X27 A;  2FHD A;  4ZCM A;  1WHH A;  3QKJ A;  5IAY A;  2L3P A;  3A3G A;  3FKS A;  1I18 A;  2RM4 A;  4EMK B;  1JJ2 S;  4OOS A;  3OOC A;  3CCJ A;  4JLG A;  1XTD A;  1XOV A;  5TR9 A;  3DDY A;  2VJJ A;  3UF4 A;  2RB6 A;  1PRM C;  1E3X A;  2JS0 A;  2AZV A;  5IYR A;  1VIF A;  1UUE A;  3U2Q A;  1U1S A;  3I9Q A;  3G6E T;  4RTZ A;  2COZ A;  2CK3 A;  4LBZ A;  1QCF A;  2BKD N;  1WTH D;  4JPB W;  3X26 B;  1ZM3 A;  3M55 A;  2IVW A;  4BUG A;  3G71 B;  3OS5 A;  3QJY A;  2K3Y A;  2DBK A;  1EX4 A;  2JJ2 A;  1GL5 A;  1SRL A;  1T3L A;  2KR3 A;  1SHG A;  5H5J A;  4QVZ A;  1I8F A;  2CP2 A;  3W2F A;  1UGP B;  1VQL Q;  2LP5 A;  1X75 C;  3CCJ Q;  2KY9 A;  8AT1 B;  3VMF A;  4P9S A;  3OZU A;  1RAC B;  3OYN A;  2YUP A;  1AWO A;  1NJI R;  4OB0 B;  1I4K 1;  5DSZ A;  3MHX A;  3QUI A;  5KE2 A;  4OOV A;  2D8J A;  2PVD B;  2RPN A;  2VXE A;  4XAX B;  3CCS B;  4JZ4 A;  3HPW A;  1K8A C;  2VUB A;  1NYG A;  4PC2 A;  4XQ3 A;  4B3G A;  1WLP B;  1Q7Y R;  3KBG A;  3MP1 A;  2FB7 A;  2OTJ B;  1WA7 A;  2E6N A;  4B47 A;  3UA6 A;  4EPC A;  4Z4Y A;  2AKK A;  2QK0 A;  2ROL A;  3QWY A;  3OS2 A;  4PLL A;  5CQX A;  2RHX A;  4JRI A;  1FNM A;  1TOV A;  1N0U A;  1VYV A;  5H59 A;  1M90 U;  3JCM J;  2ZZE A;  4B4D A;  2FZC B;  2OX7 A;  4A63 B;  3AVV A;  3WBK A;  2DXC A;  1HJD A;  2VAS A;  1VQ4 A;  1F60 A;  2HSE B;  3FDR A;  1EFT A;  2JTM A;  1SHF A;  3ASK A;  4FYV B;  1NDH A;  3CCQ B;  1RLP C;  3J7A F;  3MEV A;  4N3G A;  2XDB A;  3R6N A;  3KUF A;  3PUM A;  3G71 Q;  3A8M B;  4M7D B;  3RES A;  2CZ6 B;  5HKK A;  1B34 B;  5D7U A;  2B5O A;  1IHM A;  2DIL A;  4ME7 A;  4PFZ A;  2NYS A;  5GMK h;  1D0X A;  5HK3 A;  2E1B A;  2NV4 A;  3OW7 A;  2XZL A;  3PTA A;  1UG1 A;  2WAC A;  3P8D A;  3A35 A;  1R77 A;  2OYN A;  2D1X A;  2K79 A;  1G3S A;  1MV0 B;  2AZS A;  1GFD A;  1IJF A;  1VQL T;  4IKF A;  4TMW A;  1MND A;  1EFC A;  3ZFJ A;  3CCJ T;  1VYT A;  4RTT A;  3OYL A;  1K1Z A;  3LVB A;  1Q82 C;  1VQ4 Q;  3AVX A;  1NYF A;  1FX7 A;  5LJ3 d;  2XGJ A;  2HKQ B;  1FYN A;  3REA B;  2A37 A;  1UD4 A;  3CCE A;  1ZSZ B;  4II2 A;  3LWI A;  2L89 A;  3V7C A;  1XE1 A;  1U5S A;  2X53 S;  2GFA A;  2B7B A;  5GAO n;  4OMM A;  4WZT A;  4P22 A;  3JCM P;  2ZZF A;  1T5E A;  4YTL A;  3A98 A;  1D09 B;  3JAM E;  2JIZ A;  5GAO m;  1VQO A;  4E7Z A;  4BY6 C;  3I55 B;  4BI8 B;  1PKV A;  5KYX B;  3PIP A;  5FIU A;  2PTK A;  4HE5 A;  2BZX A;  1KD1 D;  2DEU A;  2K57 A;  1M90 R;  4C92 D;  3CCQ Q;  3LLR A;  5KYN A;  4JDS A;  3PA1 A;  3U6B A;  2VBS A;  3MCA A;  1WHK A;  1WYX A;  5FU7 B;  1SEM A;  3CXC S;  1K0S A;  1JO8 A;  4D6W A;  3G71 T;  3KEW A;  4M7A D;  3I35 A;  3CME B;  2FL7 A;  3RMS A;  5GV7 A;  2CF4 A;  4UZU A;  4DA4 A;  4TMV A;  1ELO A;  3CCU B;  3C0C A;  3LQE A;  3A1P A;  1EWY A;  4DBR A;  1FRQ A;  1WU8 A;  2COY A;  2EKO A;  5I2S A;  1K9A A;  2QEX A;  5B6I A;  1VQ4 T;  5KYX A;  5CQY A;  4FU6 A;  4ZNX A;  2EQJ A;  4HE6 A;  4DEY A;  1W70 A;  3OE7 A;  2COW A;  3W5V A;  2DL3 A;  1BYM A;  2KRS A;  4UZE A;  1VQN B;  1W0K A;  5F4J A;  1KC8 C;  1BX0 A;  1BQE A;  4QT7 A;  2VKN A;  4XTU A;  3E19 A;  2AK5 A;  1WJR A;  1W9X A;  2AT1 B;  4KT0 E;  2V8J A;  2O88 A;  2DNU A;  2CH4 A;  1IRE B;  3SWN C;  2J6K A;  2HBW A;  3I55 Q;  2CZ0 B;  1A8P A;  5GAN 2;  1K73 U;  2JM8 A;  2PUK B;  1GBQ A;  1G8X A;  1M2V A;  3GNG A;  1VQ8 A;  2X3X D;  1WOP A;  1OX8 A;  3L42 A;  1WHL A;  3CCQ T;  5AT1 B;  1D1N A;  2OTL B;  3CCE T;  1DDI A;  4PFP A;  3N5B B;  3I56 B;  1KTV A;  4LDV A;  4X7E A;  4J9I A;  2GQI A;  1OEB A;  2RHI A;  3P26 A;  3CCU Q;  2MPX C;  3L2Q A;  4HCZ A;  4YAO A;  2YT6 A;  1K8A U;  3G05 A;  2IIM A;  4B9X A;  1BJK A;  1N8R C;  5GAN 5;  2E12 A;  2RH2 A;  1QUE A;  1Q9S A;  2Z0W A;  1OU9 A;  3CEY A;  2RHU A;  3M0T A;  4KUI A;  5KW9 A;  4C92 E;  4QVA A;  1BKB A;  1VQ8 Q;  1LCK A;  2G3R A;  4PFO A;  1RAE B;  1YJN B;  4P3Y A;  2EYZ A;  4J9H A;  2OBS A;  5KE3 A;  2P3M A;  1O9S A;  2QQ9 A;  4M7A E;  2V1Q A;  4RPB A;  4J8O A;  1NJI D;  2HMA A;  1PSE A;  5M9O A;  4QUZ A;  1HVX A;  2ZGW A;  3MJX A;  3H9N A;  3EGX A;  3H0I A;  1SM4 A;  1UD5 A;  3FPP A;  2GF7 A;  3W2I A;  4OMP A;  3CBO A;  4FYW B;  3GLX A;  3QSY A;  3V7A A;  2A08 A;  2LNV A;  1KQS A;  3OBY A;  1EP3 B;  2VNH A;  1KQS P;  1NEG A;  1R8O B;  3M0Q A;  1PCX A;  3TSW A;  3DLL A;  4J6Y A;  3I55 T;  2QEX T;  2C2W A;  4MDX A;  2ZPI B;  2LVM A;  1GCQ C;  3JSC A;  4GY5 A;  3V7R A;  4BI4 A;  3R6J A;  4LBW A;  3PE0 A;  4OB1 B;  4FWT A;  2BGJ A;  4F17 A;  4LUE A;  1RLQ C;  5DLQ E;  2A7Y A;  5AN9 A;  1VQ5 B;  1K73 R;  2OTL Q;  4WF2 A;  3OYJ A;  2DA9 A;  2GTO A;  3C95 A;  2I2L A;  3X28 B;  1BPL A;  3PVL A;  1TUG B;  3M53 A;  1Q82 U;  1M30 A;  2CRV A;  2K2M A;  1LNX A;  2D0Q B;  1Y96 B;  3CCU T;  2MOX A;  5HXB A;  4RUG A;  5FLX E;  3CCV B;  5GAM g;  2YRV A;  4BAC A;  1YCS B;  2V1R A;  1D0Z A;  2LCL A;  4GBQ A;  3CPW A;  1G5V A;  1OQK A;  3PMT A;  4J0Q A;  2QQS A;  4M77 B;  3M54 A;  1YJN Q;  1K8A R;  4YAF A;  4AT1 B;  3T56 B;  1VQ8 T;  1SKU B;  2VZL A;  3OW2 P;  4DNR B;  4PJO A;  2LX9 A;  4C8Q D;  1C0M A;  1PHT A;  2M1H A;  3W5U A;  3HP9 A;  1JJ2 B;  2ZPB B;  2QA4 B;  2NLU A;  4FIB A;  4N4I A;  3JCM c;  1NM7 A;  2QGF B;  3ZUG A;  5L8R E;  1H92 A;  5CDF A;  1RAI B;  1QVF A;  1QGY A;  2PNI A;  2GNC A;  4WZE A;  1X01 A;  1WOS A;  2B8A A;  1YJW B;  1VQ7 B;  1X6O A;  4C5G A;  1R0C B;  1Z9Z A;  2HDA A;  4QQD A;  5FU6 B;  2CZ7 B;  1W34 A;  3MP8 A;  4XKW A;  1AMO A;  2K4Y A;  1BBZ A;  3LX7 A;  4ASU A;  2DXT A;  1DJ7 B;  3JB9 G;  4DOV A;  1UD6 A;  1VQ5 Q;  3OYF A;  3CP8 A;  2KXD A;  3T9N A;  2RC5 A;  2KYB A;  2OTL T;  4IIO A;  4D8D A;  1V29 B;  2HSP A;  3L2Z A;  3E1Y E;  1YWO A;  3DB3 A;  2WSF E;  2W6J A;  4L8J A;  1UE9 A;  2K5L A;  1UGR B;  4M1K A;  1Q81 D;  3QXE B;  2FEI A;  1WGS A;  1WXT A;  1JU5 C;  3SWN A;  1WHJ A;  3CCV Q;  1TVC A;  5J39 A;  1QWE A;  1GFC A;  1Q82 R;  2OJ2 A;  4A4F A;  5CCA A;  4KH0 B;  4II1 A;  1WQ7 A;  1KSW A;  1G3W A;  1BX1 A;  2EJG A;  2NUT B;  1GAW A;  2YRD A;  1KC8 U;  2YRC A;  1QLY A;  4DQK A;  1HK9 A;  5GAM j;  3VR6 A;  2ENM A;  1PNJ A;  1YJN T;  1M3C A;  1YP5 A;  1VYU A;  2PVG B;  2QA4 Q;  2JN0 A;  4X9C A;  4L59 A;  2PIA A;  1T6Y A;  3QSU A;  5DM7 R;  2KMT A;  4Q5W A;  4N0A C;  1F1B B;  2QYZ A;  1AVZ C;  1VQ7 Q;  4XTY A;  3ISX A;  5GAN h;  1F20 A;  3X20 B;  2XK0 A;  3ULR B;  4YAL A;  2DBM A;  3VNU A;  5LJ5 h;  4R71 A;  1R5B A;  4OMF B;  4NBS A;  2PUO B;  4C8Q E;  3LNN A;  1COW A;  1S4M A;  4VUB A;  1JQQ A;  2E1R A;  4CI0 C;  4M0L A;  1VQ6 A;  4HT8 A;  1QFZ A;  1JEG A;  1VQ5 T;  2CZ1 B;  2EQK A;  1N8R U;  2DE0 X;  1UHC A;  5L23 A;  3VS1 A;  2DOG A;  4XK8 E;  4M7D D;  3B78 A;  1KK7 A;  4LE9 A;  1H8E A;  4J7I A;  1QVP A;  5KYW A;  1N9R A;  1M90 C;  2XKO C;  5F4M A;  4XTW A;  3LO8 A;  1XQH A;  4YAW A;  2OBT A;  2QDY B;  1UMK A;  3SKB A;  3CCV T;  2EQU A;  3OZV A;  3QWX X;  1GCQ A;  2FVU A;  2P4T A;  4J83 A;  4EMK C;  3FB9 A;  1X6B A;  4MZT A;  1WP6 A;  1ZBJ A;  1WPC A;  4E7L A;  3A8I A;  2JTE A;  3LQ6 A;  2DZC A;  2O2O A;  3DKM A;  5J3O A;  5TY0 A;  4CC2 A;  4F16 A;  1KC8 R;  1ACM B;  4DBQ A;  5IH2 A;  2A0F B;  5CKE A;  4B6M A;  3M59 A;  4M78 A;  1GVH A;  2QA4 T;  1WJS A;  1ZLM A;  2C77 A;  3GIR A;  3NTI A;  1KQS S;  2BM1 A;  2X35 A;  2EIF A;  5IYN A;  5GAO q;  1V0F A;  1WQW A;  2MWP A;  3MHP A;  5GMK j;  3H94 A;  4NOY A;  2EGC A;  2F5K A;  1ZHI A;  1FMV A;  1SRM A;  2QN6 A;  1OPK A;  1BLI A;  2F43 A;  3CBM A;  1NPP A;  2RHY A;  3OYY A;  1ABQ A;  4MYT A;  2E5K A;  3SB2 A;  1NE8 A;  1AT1 B;  2VWF A;  2GBQ A;  4TT3 A;  1PG5 B;  3CXC B;  3CC4 A;  3CB4 A;  5GMK e;  1PKT A;  1ZA1 B;  1BK2 A;  1H3H A;  4PJO F;  3OEH A;  4FYX B;  3GPL A;  3ONU A;  5KSW B;  4TMT A;  3U6K A;  1KMH A;  3VJP A;  5CO7 A;  1JB9 A;  2X4W A;  2CGH A;  1NRK A;  4XM3 A;  4HKE A;  4Y9U A;  2JNG A;  3QJ6 A;  2V31 A;  2C0I A;  1BCM A;  4OPV A;  3QZ5 B;  3CPW S;  2WSC E;  2L3R A;  1N8R R;  4X07 A;  2IPO B;  1CQX A;  1SKY B;  4FW2 A;  1I0C A;  3ASP A;  4NNJ A;  3GBQ A;  5FW9 A;  3JB9 J;  1BI3 A;  3BQJ A;  4ORZ A;  1B3Q A;  5GAM f;  4ZCI A;  3BW1 A;  5DS0 A;  4OF1 A;  2EKH A;  2H8H A;  2KBT A;  3JQR A;  1FRN A;  1G7T A;  2PU9 B;  3J80 E;  1QVF S;  3CCJ B;  4JRP A;  1D2E A;  1EP1 B;  1U1T A;  4PGO A;  5J26 A;  4LBV A;  1E6H A;  3L2U A;  2R5A A;  3AT1 B;  4M7D E;  5IK2 A;  2OBR A;  2PVO B;  3PVD A;  2CP6 A;  2RK2 A;  4XU1 A;  5GV8 A;  4RG8 A;  1RAF B;  3OAA A;  2A36 A;  1PSF A;  3FC3 A;  3O5Z A;  2LT4 A;  3E9G A;  3Q1J A;  4F7D A;  2PZ1 A;  2ZPH B;  2QI2 A;  2DL7 A;  4LD6 A;  2HLD A;  1MMG A;  1Q86 D;  2LJ3 A;  1VOM A;  3HL8 A;  4R0K A;  2FPD A;  1KHI A;  2YWH A;  2YWE A;  1ZM4 A;  5LL6 S;  3H41 A;  4Y28 E;  1IRX A;  1AOJ A;  4C5I A;  1M8V A;  2AHJ B;  2FPE A;  1OB5 A;  3MEW A;  1VIE A;  3TVT A;  1K76 A;  2D6F A;  4RD2 A;  3SHW A;  3PA2 A;  3PNW C;  1E1R A;  4ANJ A;  3EG1 A;  3GVK A;  1FX0 A;  1K73 C;  1QFY A;  2XZO A;  1KRH A;  5GMK l;  2F2V A;  4MZM A;  2BUD A;  3G4S A;  3GSI A;  1IHW A;  3E2U A;  1PJ5 A;  1CNF A;  1D3B A;  2ZZQ A;  2J6O A;  1TSF A;  3CC2 A;  1MRZ A;  2W6I A;  4UC4 A;  2PMD A;  2K3X A;  2YUQ A;  1VQ4 B;  1IJE A;  1M3A A;  1WXU A;  4C0D B;  3QFC A;  2KVQ G;  3FJP A;  3VUZ A;  3HTR A;  4ROX A;  7AT1 B;  1W2B P;  3W2G A;  2L8D A;  3HFO A;  1XNI A;  4IIM A;  4OGC A;  1M2O A;  4YXW A;  3C94 A;  3JQP A;  1CKA A;  1WJQ A;  1YHQ A;  2RQV A;  3A3B A;  2DD4 A;  1KQ1 A;  1HYO A;  3PT9 A;  2Q6L A;  4B3F X;  4L5G A;  1U8R A;  2X4X A;  5CIU A;  2QGG A;  2CUB A;  4RDJ A;  1VQ9 A;  3CC2 Q;  1QW1 A;  3NGP A;  2LT1 A;  2C0O A;  1M5Q 1;  2ESW A;  3VS0 A;  3QE2 A;  4M78 F;  1W35 A;  3QO3 A;  4OB3 B;  2E41 A;  4PJO D;  3AVY A;  2X6W A;  2LMJ A;  1I5L A;  4ACB A;  3AVT A;  4OB2 B;  2MF2 A;  1UEC A;  2RQT A;  4C5H A;  5GAO r;  3WBJ A;  4FM4 B;  3CCE B;  3VU3 C;  5A89 A;  1NLP C;  4TMZ A;  5GAN 6;  4DEX A;  2E10 A;  2QMU A;  1TTT A;  4A4K A;  1PRL C;  5KCO A;  3GF5 A;  1T6Z A;  2VJI A;  4LNP A;  4YHB A;  2LQK A;  4IUT A;  5IN1 A;  2VBU A;  4HIZ A;  4WWV A;  3T53 B;  3TQ7 P;  1D1A A;  1RAH B;  2RD1 A;  3ZBD A;  1G2B A;  1CNE A;  4J9G A;  1YI2 A;  2ZCF B;  1FMW A;  2LCS A;  5HCK A;  2RN8 A;  4G5G A;  1UGQ B;  1XQB A;  1VQO B;  3OMC A;  1AD5 A;  1GXI E;  4Z4U A;  1WSV A;  3EG3 A;  4J6X A;  2P84 A;  4M75 G;  3FJ5 A;  4M77 D;  4RD0 A;  4UAJ A;  2DTI A;  1YIT A;  1MMN A;  2XID A;  2DD5 A;  1HD3 A;  1CKB A;  1WFW A;  1E62 A;  3MP6 A;  3UWN A;  8ATC B;  1PC0 A;  3MCA B;  3J81 E;  1ZM2 A;  2K5I A;  3GIB A;  2KRM A;  2JM9 A;  3CCL A;  1U06 A;  1R5N A;  2QDX A;  1B7T A;  2EVR A;  1NBE B;  3G7Z A;  1VQP A;  1EP2 B;  1Y71 A;  3CCR A;  1A0N B;  2JW4 A;  1FDR A;  4B43 A;  1G3T A;  4ZTF A;  2KEA A;  1HZE A;  1RAA B;  3Q6R A;  4RM0 A;  1D1C A;  1YFN A;  3EGD A;  2B86 A;  2RQW A;  4KUL A;  3JCM h;  1MMD A;  3H6Z A;  3CC2 T;  4A4G A;  3CQT A;  2RHZ A;  1VHE A;  2QEX B;  2YHT A;  3DLM A;  3QII A;  1LJO A;  1P92 A;  2DRM A;  4BDY A;  1RQP A;  4Z4S A;  1QFJ A;  4MML A;  4FW1 A;  4RTX A;  3OJW A;  2FZG B;  4LXC A;  5KYY A;  2E65 A;  1D1B A;  5GAN g;  1YIJ A;  3CCE Q;  1WIE A;  2Y90 A;  1M1K C;  2JUF A;  2MYS A;  4OMN A;  1RQR A;  5LJ5 g;  2FYK A;  1OZ2 A;  1EFU A;  3CCR Q;  2DIQ A;  1EFN A;  2DL4 A;  4M75 C;  2Q6I A;  3CRZ A;  2E3H A;  2HZY A;  4QVD A;  1M9S A;  1O75 A;  3TCJ A;  3JCM Q;  2ZPG B;  1PD1 A;  1SSF A;  4ELZ C;  1QX4 A;  5D6W A;  4WCI A;  3D26 A;  2EYX A;  3L1A A;  2QTX A;  1VQO Q;  4HCK A;  1NLO C;  3ASQ A;  3HRU A;  1G7R A;  3ZPN A;  4PJO E;  4XU0 A;  4RCC A;  2DM1 A;  1M2V B;  2Y4X A;  1RL2 A;  1C1A A;  1VQ8 B;  4OGE A;  5CKD A;  1UGS B;  4EMH A;  4XD7 A;  2DER A;  1PJ7 A;  4JJN K;  4MDW A;  2V4D A;  2DXU A;  1C6V X;  5F4O A;  1ZA2 B;  2B7C A;  3G1J A;  4Y91 A;  5IT9 E;  2X8K A;  4Z4V A;  4H9G A;  4C92 G;  2K6D A;  5CK9 A;  2CSI A;  3B8H A;  4UZF A;  4O5V A;  2WR8 A;  1HSQ A;  1TLL A;  4XTZ A;  4M77 E;  2QTZ A;  3L2W A;  4M7A G;  3OZW A;  1Y0M A;  2HQE A;  3UT1 A;  1BMF A;  2D8H A;  2QEX Q;  1W4S A;  1UD3 A;  2YDL A;  4AF6 A;  2DXB A;  4XKV A;  2GGR A;  4KKU A;  4U9U A;  2GPJ A;  2LZJ A;  2HL5 C;  1WOR A;  3A8G B;  2D74 A;  3ZZU A;  2VV5 A;  5IHK A;  2ZL6 A;  3OKX A;  4M78 D;  1M1F A;  1E64 A;  2E4H A;  1TS9 A;  4X9D A;  3CCL T;  2JJ9 A;  2ZXI A;  3EGX B;  1QVG P;  4EMG A;  5GAN j;  3EH1 A;  3CCR T;  2GJR A;  4PK4 A;  3R6K A;  4A4E A;  1AZE A;  5FU6 C;  3QYG B;  5EC7 A;  2ED1 A;  3AST A;  5LJ5 j;  3EFO A;  2X3U A;  3PVQ A;  1ZBX A;  1QWF A;  5LJ3 e;  1S72 A;  1GO2 A;  4RLZ A;  1AWJ A;  2OI3 A;  1KQS B;  4AFQ C;  2CYZ B;  5GAN e;  3ER0 A;  2FPF A;  2AIR B;  1W2B S;  5FL7 A;  2F69 A;  1VQO T;  1J9Z A;  2GFU A;  1KK0 A;  1FWZ A;  4L6V 5;  5IYP A;  1KD1 C;  2VB6 A;  1SSH A;  5LJ5 e;  2XND A;  3Q6Q A;  4C92 C;  4NS5 A;  1Y07 A;  1QP3 A;  2SEM A;  3JCM b;  1ABO A;  2O4X A;  4FL6 A;  4JS4 A;  2RJE A;  1IHV A;  1N08 A;  1W87 A;  4M7A C;  2BVN A;  3M0U A;  4R56 A;  2ZZG A;  2HD0 A;  3PEN A;  4JJB A;  4P5N A;  2E64 A;  4WQM A;  2HBP A;  2K5F A;  3IQL A;  4NL2 A;  1I07 A;  1VA7 A;  4E7K A;  1YBY A;  3ZZT A;  2CP5 A;  1S72 Q;  2XNC A;  2CP3 A;  1Q7Y D;  4PC3 A;  4GLM A;  4BY6 B;  3VS2 A;  3TEE A;  3OYI A;  1QKX A;  3CPW B;  2DTO A;  4X7D A;  2DEQ A;  2V7U A;  2FRW A;  4HCB A;  2QAS A;  1NB9 A;  2RI3 A;  4RTW A;  3ME9 A;  1B23 P;  4IUR A;  2KE9 A;  2ED0 A;  2HQH A;  3MO8 A;  5GMK i;  4PJO B;  4JJC A;  4AMC A;  3PUN A;  3PGG A;  3OS1 A;  3T51 B;  5FRO A;  2WJV A;  2DRK A;  1HXD A;  3INZ A;  3NTK A;  2C78 A;  1QVF B;  1OU8 A;  1SF9 A;  2BV3 A;  4RJL A;  3PIO A;  1JNY A;  1WOO A;  2GJK A;  3A8K A;  5GAM d;  3WXM A;  2YSQ A;  1T0H A;  3M0S A;  3DB4 A;  3PFS A;  5FWC A;  4XOP A;  5IXF A;  4A4H A;  3FEO A;  2CW5 A;  2WSE E;  5GMK m;  1MHN A;  3EFR A;  1M27 C;  2CP7 A;  3BCF A;  4M78 E;  2H3E B;  2XHC A;  4Z4Z A;  3OW2 A;  2QE7 A;  3NPF A;  3TSZ A;  4M75 A;  2ZL5 A;  1VF7 A;  2WZP P;  4JS5 A;  2J05 A;  2KSS A;  3HRS A;  2X51 A;  3VO2 A;  2EYY A;  2KT1 A;  2QQR A;  2M51 A;  4C5E A;  3EG0 A;  5DLO A;  1OZ3 A;  3SWN B;  2X6X A;  1AZG B;  3CPX A;  2LQN A;  2OAU A;  1BU1 A;  2GTJ A;  3V76 A;  4ZN1 A;  4ZTJ A;  3AGP A;  2F1L A;  1S72 T;  1M1K U;  1AWX A;  2RC6 A;  2JTF A;  3TRE A;  3Q3A A;  2VNI A;  4XOR A;  4RKU E;  3LH5 A;  1WDT A;  5JBQ A;  4TSF A;  1N07 A;  2Y4Y A;  4DBH A;  2Q6K A;  1WI7 A;  3D7S B;  1EIF A;  1UHF A;  4AVZ A;  4F7U G;  2P4R A;  1JA1 A;  1K9M R;  4BPR A;  2DZ9 A;  3HKS A;  5GAN f;  3REB B;  5CKH A;  3M0R A;  1M90 D;  1UB4 A;  1W6X A;  2DJZ A;  1BB9 A;  3OY9 A;  5LJ5 f;  4ELY C;  3FRN A;  2EPD A;  1I7P A;  2C4T A;  2FX3 A;  4C8Q G;  3RR6 A;  1CSK A;  4RTU A;  4LBY A;  3CC7 B;  2MIO A;  2NWM A;  4BE2 A;  2JDI A;  3SLD A;  4G6I A;  1E3Z A;  4XQF A;  2OK7 A;  5THX A;  1YJ9 A;  2L3S A;  4ESR A;  1WSR A;  3MEU A;  2WJY A;  3PMI A;  4K11 A;  2BE7 D;  5C6S A;  3OA6 A;  4ZGJ B;  3OYM A;  4DQL A;  5I22 A;  5KNL A;  4N4H A;  1VQ6 B;  2EFG A;  4LDU A;  1QP2 A;  2M9U A;  4PC6 A;  1JBM A;  4WZK A;  2E6Z A;  3GNF B;  4RD6 A;  4PAB A;  3CMA A;  2KGT A;  1OYX A;  2VVK A;  4II3 A;  1IB0 A;  3CES A;  2V8K A;  3OYE A;  5LJ3 h;  1DAR A;  1JXM A;  2IG0 A;  4BE1 A;  3OFN A;  3CD6 B;  5KYW B;  3RKW A;  4PC1 A;  3I5R A;  2EWN A;  2QXF A;  3AGQ A;  3EGU A;  2GJP A;  3CC7 A;  3QZ9 B;  2XMF A;  4RDL A;  2LRQ A;  5I2M A;  1VQM A;  2PQW A;  3ASS A;  2M16 A;  1UTI A;  4C92 A;  2XU8 A;  2DL5 A;  1E43 A;  4LDY A;  2W10 A;  1WHM A;  2DO3 A;  1Y7X A;  3NFC A;  2CT4 A;  1M1K R;  2JOY A;  2KRN A;  1QVG S;  4C8Q C;  3MMP A;  4PNO A;  1PD0 A;  4M7A A;  4ZGE B;  3A8O B;  2SRC A;  2EAY A;  5A0L A;  4M78 B;  2YUO A;  2VBT A;  1RAD B;  2WYR A;  4IUU A;  4M4S A;  1KD1 U;  4XL9 A;  2FZK B;  3BE3 A;  1GRI A;  5CVI A;  3RKY A;  5GAN 7;  3CD6 A;  3CC7 Q;  4JRQ A;  5I11 A;  3JCM g;  2F5T X;  2DK3 A;  3SJP A;  4B3X A;  3FLG A;  4PJL A;  4J9E A;  3OBW A;  1BI0 A;  2LCC A;  4J9F A;  3CC4 B;  3V8J A;  2C0T A;  4JMQ A;  1QQJ A;  1I5O B;  1U2R A;  3C4S A;  1VJS A;  1VQ6 Q;  1WZO A;  3RER A;  5D6X A;  5A0D A;  4XLF A;  3SDZ A;  2HCK A;  3RY8 A;  5L46 A;  4RD1 A;  4V2S A;  3E20 A;  2BGI A;  1GCP A;  4FXU A;  1Q81 C;  5IHN A;  3CD6 Q;  1XFO A;  1K0X A;  3MKD A;  2MI6 A;  4JJD A;  4Y92 A;  1NG2 A;  2XZP A;  2VNK A;  3ZBU A;  3CCM A;  2QAZ A;  4RD3 A;  1ZM9 A;  3KFV A;  3OQ5 A;  4M7D G;  4YEL A;  4OP0 A;  3G6E A;  2XD0 A;  1D0Y A;  4E6R A;  4M75 F;  1WPY A;  4PAA A;  2NUP B;  3OSS C;  1AIP A;  3H0F A;  1PM3 A;  2BZY A;  2EGA A;  5KYU A;  1YWP A;  3E1S A;  1T3S A;  2KDS A;  4BB7 A;  5J35 A;  1FMK A;  2X4Y A;  1K73 D;  4QVC A;  4RCB A;  2KVO A;  2J6F A;  1TTH B;  1S1N A;  1IZ6 A;  4G7W A;  3CC7 T;  1T6X A;  2R57 A;  3W5H A;  1TUD A;  2ZZD A;  3A5Z B;  3WVD B;  3CCM Q;  1KD1 R;  3OW2 S;  4XR6 A;  3CC4 Q;  1J3T A;  5EMN A;  4P2N A;  3THK A;  1AEY A;  4Z4W A;  2X3W D;  2BMW A;  4N3N A;  1VQK B;  2EFI A;  3GVL A;  5GAO p;  2RA2 A;  3S3O A;  2BSA A;  2HNI A;  2FG0 A;  4OVA A;  4LDX A;  1EXM A;  3SLN A;  3SEJ A;  3WYA A;  4AF7 A;  4MMK A;  3VS3 A;  4HCC A;  4BDZ A;  1VQ6 T;  1IGQ A;  4FCY A;  2NUP A;  3I5S A;  3QBY A;  3S6W A;  1K8A D;  3JCM e;  4LC0 A;  3EG9 A;  1NEB A;  2ROT A;  4AG2 C;  1KJZ A;  4HA8 A;  4ZGQ B;  2GRE A;  1W0J A;  1YN8 A;  3RUX A;  3JB9 I;  3GP8 A;  4M7D C;  1PJ6 A;  2X0K A;  3SFM A;  2XDD A;  3CD6 T;  4JLI A;  3CXC P;  2MWO A;  2A28 A;  1G7C A;  1WXB A;  2X9H A;  2ZL7 A;  2DIE A;  2RF0 A;  3CTA A;  1OGJ A;  2QG9 B; 
#chains in the Genus database with same CATH homology
 2QGG A;  1PM3 A;  3HTR A;  2DOG A;  2F1L A;  2DYI A;  3A1P A;  3H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...