2QGGA

X-ray structure of the protein q6f7i0 from acinetobacter calcoaceticus amms 248. northeast structural genomics consortium target asr73.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
NVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPWYIETKAGWQTVDVKRWKPHGKGLVVSLKGVSDRTGAESLVASNIWIAKSQLPKADVDEYYWSDLKGLTVLGLDDEEQEVNLGQIHELFETGANDVMVVRATPDSIDSEERMIPWHKDVVQRVDLEAGRIYVNWGVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the protein Q6F7I0 from Acinetobacter calcoaceticus AmMS 248.
rcsb
source organism Acinetobacter calcoaceticus
molecule tags Structural genomics, unknown function
molecule keywords 16S rRNA-processing protein rimM
total genus 41
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2007-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 2qggA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2qggA01
2DYIA 2F1LA 1PM3A 2QGGA 3HTRA 3A1PA 3H9NA 2DOGA
chains in the Genus database with same CATH superfamily
2W0ZA 4MDWA 5EG2A 3VS3A 5GAN8 1JB9A 2F4NA 2P4RA 2E5QA 4UZUA 1IHVA 3AVTA 1QMCA 4MZPA 5KYUB 4JRQA 1S72Q 1ZQ1A 3LGLA 3CB4A 3OZUA 1JU5C 3CCMT 4J9EA 3LVBA 2L3RA 1KC8D 2R58A 4M78F 4C8QB 4PJOA 2P3MA 3MCAA 4M7DA 2VC8A 2B5OA 3PA1A 3CC7A 3VMFA 1NEBA 4XU3A 2DRMA 4JMQA 3L2ZA 1K1ZA 4RTTA 5GAOm 4IUUA 1XE1A 1E6HA 2I1LA 1OX9A 4M7AF 1AHJB 4XU2A 3DLMA 1TWBA 2ZGWA 4AF7A 3H9NA 5FO0A 4OB1B 4EMKA 1BKBA 2OBSA 3RESA 2EGAA 3GVKA 1Q7YD 4M77G 2LCSA 1NJIR 2LQNA 1WHJA 2WYRA 4LBVA 3LGFA 3OYJA 1YJWT 1H3HA 3TCJA 1MMGA 4HCZA 3ZL7C 2JJ2A 1PJ6A 3META 3L42A 2ZPBB 2FZGB 1F20A 3ZBUA 3WVDB 3GSIA 4PFOA 4H9GA 1UG1A 1E1RA 3G6EB 1X69A 1K73D 1Q7YR 3CW2A 1AEYA 4QVZA 3A8OB 4GBQA 3G71T 3EG9A 2Q6OA 1EFCA 2F2XA 3SWNC 1P4MA 4D6WA 2P4TA 4OPVA 1WGSA 3RKXA 2A0FB 2VYTA 1AOJA 1G7RA 2PMDA 4ZCMA 3G71A 3QUIA 4C8QG 2XI9A 3RMSA 4WQMA 4RTXA 4JLIA 3CC2B 4TT3A 2QI2A 3NMZC 3VO1A 4QHYA 3A8IA 1QP3A 2COZA 1KJZA 3I55B 4DBQA 2YWWA 2O4XB 3Q3AA 4ACAA 1QUEA 2XU8A 4P1VA 1GCQA 1VQ9T 4M77E 1KC8R 1EZZB 1WQ7A 4XR6A 1U5SA 1OB0A 3THKA 2X4JA 2RHUA 1QVGS 2YWHA 2EKOA 4N0AA 2QQAA 3H0FA 1KK7A 2RQRA 2BGJA 2GJKA 1JJ2P 3EHQA 3GIBA 3GF5A 1TOVA 1V76A 5I2MA 1KTVA 2C4UA 1V29B 4ZCIA 1OGJA 1HJDA 1CSKA 1BU1A 1R8OB 4P9SA 2EQJA 4PFZA 5EC7A 2JTMA 3PENA 4KULA 3JCMg 2MOXA 3REBB 3CMEA 4K11A 2EYXA 2J6KA 2VV5A 2WSCE 3CCVQ 1GVHA 4FYXB 2XZPA 4B47A 3CCQT 4NBSA 2DIEA 2L8DA 2WSEE 1PRMC 1MABA 3ISXA 1MMAA 2AKKA 3HL8A 4KGVB 3EGXB 5A2QE 3M56A 4ELZC 4E7JA 4QVCA 4M75B 3ES9A 1RAAB 4QKUA 3RMQA 2CK3A 5D6WA 3RY8A 1VQOT 4E7IA 1VQLT 1Q81R 2MPXC 5GAOl 3CXCS 2DXBA 4E47A 1EWYA 5A0LA 2LP5A 4ZN3A 1G3SA 1WA7A 2AKLA 2X0KA 1ZLMA 3E20A 1QVFS 4QT7A 4XLEA 1T6XA 1W2BB 2H3EB 1KG1A 2VBUA 1OEBA 1BIBA 3CMAT 1BI3A 2GK6A 1FRNA 4BE1A 3M0UA 4AT1B 1W6XA 2V4DA 1KD1U 1QH0A 3I5SA 1EP1B 4QV2A 1WTHD 3WNBA 3BC9A 3CCVA 4RCCA 1BX0A 1JA0A 1N8RD 2AHJB 3M0SA 1X6OA 3G4SQ 5A89A 1LVKA 4UZEA 1NLPC 1E6GA 4HCKA 3CCMB 2NYSA 2E70A 3JB9J 1M1FA 4FM4B 4NL2A 4LUDA 2BM0A 1T0JA 2LQKA 2SRCA 2GBQA 4C92C 1M3AA 2E6NA 4PJJA 5J35A 3CCET 5FU6C 2YWEA 1Y7XA 3MEVA 3CMET 5CKHA 4EMHA 4RCBA 1WFWA 1G83A 4X1VA 2QASA 4RDLA 9ATCB 1ZM9A 1IRXA 2V1RA 3VYGA 4XQFA 1BYMA 5KYNA 1SRMA 2V7WA 4LDYA 4VUBA 3A3BA 2ZZQA 1FYNA 4LXCA 1VQ6Q 3LWHA 2PUKB 5FO1A 2WACA 4M4SA 1OYXA 4F7UA 1IB0A 3V7SA 4KH1B 1T6YA 4LDWA 2DERA 1ZA2B 2G6FX 1X6GA 2MIOA 5DLQE 5BSXA 1GBQA 5GAN5 2LTOA 2D1XA 3H41A 1NZ9A 3HPWA 2VBVA 3CCSA 1KIKA 2RC5A 3M4GA 3HAGA 4Z4VA 4P5NA 4DQ2A 2HDAA 2EIXA 1ZSZB 4EMKC 4M77F 3GOXA 1CKBA 1NYGA 3HP9A 4IIOA 1N0UA 2WSSA 3CCST 3VS4A 4BB7A 1VQ8A 2KY9A 3J81E 1VJSA 1VQPB 3OW2B 1UJYA 1YX2A 1QFYA 3CMAB 1D1NA 3WXMB 2OYNA 1KSWA 2M0YA 4JRPA 3KUFA 1QVPA 2MYSA 4B9XA 1QVFB 4RTUA 1H42A 2E41A 4U9UA 2X6YA 1P92A 5HZAA 2CYZB 4J6XA 5GAOq 5GAOr 2Q6IA 3BH4A 3EG2A 2VJIA 2EYWA 2W10A 3OYDA 4XKVA 1BMFA 4KGXB 4ZCLA 5DLOA 2DF6A 2PLFA 4Z89A 2EW3A 4X05A 1Q7YU 2VASA 4M4ZA 4FYWB 2DJQA 1GBRA 1VQNA 2LZJA 1D2EA 5TV2A 1CNFA 1V5VA 3TSWA 3TU4K 1PHTA 5HK0A 1JA1A 4RMOA 1UD3A 5L8RE 2YWFA 2EQUA 5FLXE 3NPFA 1JXMA 4XLAA 1GRIA 1WJQA 2FRWA 2VJJA 2RH2A 2JOYA 2HSPA 2EQKA 2HCJB 4TMTA 3OSSC 3W5HA 1I0CA 3P8HA 3C4SA 3ZBTA 1VYTA 3V7AA 3MP6A 5CQYA 4OMNA 1M90R 2K79A 4J7IA 1JRIA 2Y4YA 4HKEA 1MMDA 3LH0A 2JTEA 5C0MA 3SDZA 3QWYA 3M0RA 2XDBA 2JN0A 2JDIA 5IH2A 1PNJA 4RUGA 1VQ4B 2E3HA 4XTWA 1NJIU 2EYZA 1EP2B 3VO2A 5A88A 4BE0A 1F1BB 1S72A 1IO6A 4FN5A 2YSQA 3CC7T 3ZC3A 5GAN3 2KVOA 1YIJQ 2K9GA 1VQPA 3I5RA 4PJOC 4ELYC 3FEOA 4J9BA 4MYTA 8AT1B 1W0KA 4TMWA 2KROA 4DOWA 3VS6A 1VUBA 3CC2Q 3CCQQ 1WJSA 2NUZA 5LJ3e 2P0PA 3EFRA 1XTDA 1RAHB 2YLCA 3G7ZA 1X01A 1ZUNB 3VNVA 2HL5C 3PE0A 2K3BA 3JB9I 3JCMe 1GCPA 1GAWA 4L5GA 3OY9A 2EIFA 2FZCB 1FWZA 1QVGB 2XHCA 4ZGEB 3BE3A 2YUQA 1HK9A 4LDVA 4LBZA 1AMOA 2HLDA 3UA7A 3E2UA 2OAUA 3UT1A 4Z4UA 4P2NA 3DDYA 1YHQB 3KBGA 1G3WA 1HSQA 2YXYA 2RHZA 1HZEA 1VQ9Q 4M75G 5D7UA 3CCLA 2HEQA 1BCOA 2X6XA 5GMKe 2RB6A 4A63B 1OGIA 2CT4A 4TMZA 4ROXA 1BK2A 2HD0A 4RTYA 4ME7A 4LNPA 2C5HA 2LNVA 2HDNB 1M2VB 1O9SA 1WHKA 1IXDA 4Z4RA 4XOPA 3AVVA 2AIRB 1VHEA 3AVWA 1OHHA 3CCMA 3OE7A 4J9IA 4GLKA 3JB9D 3T51B 1Y96A 3W2GA 1I18A 1NB0A 4NCNA 4ESRA 2WSFE 1V0FA 5KCHA 2P0KA 5AYFA 5FROA 4O5VA 2ZXIA 2V7QA 5J39A 2RC6A 2Y90A 4FIBA 3I1FA 2EGEA 3CC7B 3KL9A 1WXTA 2X51A 1YIJT 4X0CA 1M90C 4QVDA 1QUFA 4A4FA 3X20B 1UD2A 1M90U 3FKSA 4L6V5 2DBKA 1KK3A 3SFMA 2CGHA 1M30A 2ZITA 1D0XA 2D3NA 5KYUA 2PTKA 3WY9A 1NB9A 4M78D 2LZ6B 4N3GA 2QDXA 4LBWA 2A28A 2CUBA 2KK4A 2ZBUA 1IREB 2EBPA 2RQWA 3ASSA 2ZPEB 1SF9A 1YWOA 3P8DA 3MP1A 4MYUA 2LJ0A 2QEXQ 1BIAA 3CCJB 4AFSC 2FZKB 2O01E 2LCCA 1RAIB 1A0NB 1UD4A 1TTHB 3CXCA 4R0KA 3CRZA 5CIUA 3JCMX 1W1FA 3VU3C 3QDFA 1M1KD 4B3XA 2OJ2A 4LC0A 2DTIA 4IUVA 2B7BA 1T3LA 3ASKA 1K73C 1WXUA 3S3OA 3BDUA 3URGA 1WDTA 3L2QA 4Z4YA 2JT4A 1IB8A 3VUZA 3DKMA 1Y96B 5THXA 1YHQQ 3OYNA 2WZPP 2DXTA 5CAIA 2C0TA 1QX4A 1UECA 1E3XA 3CPWB 3EGDA 4CC4B 2ZZFA 3QE2A 2QGGA 1ZUYA 2DEQA 2VGNA 3W2FA 4FU6A 3M9QA 3PMTA 1C6VX 3OYMA 4WTOB 1Q82U 2AHOA 2DIQA 4OMLA 2C0OA 4E7ZA 4XTXA 4KUDK 1R5NA 4HVWA 3BNWA 4C5GA 5KE2A 1Z9QA 1TH7A 2DO3A 2QG9B 4RD1A 2DZCA 2GFUA 4N4IA 5KYXB 3Q6QA 1COWA 1YLOA 4F7UF 2WJYA 2ROTA 3AHUA 1HVXA 3OS2A 1A8PA 5HZBA 2DILA 2GK7A 3Q1JA 1KMHA 3CCQB 5BSYA 1VQOB 1B2RA 2VNJA 3A5ZB 3CCRB 1NRKA 3VUBA 1WJRA 4PKCC 3EGUA 4XU0A 3GVLA 4D8DA 3JQPA 2JMAA 2RK1A 1ZSZC 4EMKB 3L2RA 1KD1C 1E43A 1YFNA 5GV8A 5GAN7 3INZA 2DCUA 2RHYA 4B9WA 3RKWA 2ZTGA 4TSFA 5KNLA 3ZFJA 1JB0E 4BD3A 1VQ7Q 2M0OA 4ORZA 2IIMA 2PZ1A 1FNCA 2JM9A 1IJFA 2EYQA 3UWNA 3FPPA 2J6OA 1N0VC 1XOVA 2DVJA 2CS7A 2RM4A 4J7FA 4PJLA 4M75F 3EHRA 2CDTA 1DG1G 5D6YA 3WYAA 1U06A 3B8HA 1QGAA 1G7TA 1XJWB 3X26B 3SEJA 5I2SA 4NNJA 3QDRB 4HA8A 4IIMA 5HCKA 3VS5A 2V31A 2GPJA 3M55A 4KUIA 1PKSA 5GAMj 2RO0A 3CCUB 4B6MA 1W2BP 3U2QA 1KD1D 1YJNT 4AC9A 5C6SA 3I35A 4OMMA 2DM1A 3JCMh 4X9CA 1D0ZA 4IKFA 3LO8A 3QIIA 2QK0A 1KFZA 4LE9A 5HXBA 5FRNA 3HRUA 3ZEHA 1SSHA 4RD4A 2X3UA 1YITA 3W2IA 5DM7R 1WPCA 3JAME 1UDLA 5FU7B 1PSFA 2QEXA 2KMTA 1WDXA 1RLQC 4X8IA 4PJOD 1PRLC 2YWGA 2HQEA 2QGFB 1H641 3V76A 2OTLA 2KGTA 1TUCA 1WSRA 1QVGP 2DE0X 1R0CB 3JCMJ 3BY7A 1H8HA 2D0QB 2XEXA 4KKSA 3ONYA 2SEMA 4QVJA 2QTZA 5CKBA 2OTLT 2E6ZA 3M59A 4PJOF 2RQVA 5IN1A 3FLGA 2NUPA 4HE5A 3BFMA 1GAQA 4ZTJA 2O9SA 1HYOA 1VQPT 1XQHA 5L23A 2LQWA 1ZM2A 3LWIA 1RAEB 2QA4A 4OF1A 1VQ7T 4P12A 3CCSB 1S72B 3NTIA 1B3QA 1VYVA 1M4ZA 4OB3B 2BTTA 2OTJT 2CF4A 6AT1B 3QZ5B 1VQ5A 3OOCA 5AN9A 4CC7A 4RD3A 2R5MA 1YN8A 2D6FA 3LW5E 3CCLT 2GFAA 1GFDA 1TUIA 1KHCA 2CP7A 2MF2A 2OTJA 1E7OA 3OS5A 1HD3A 3P27A 4Z02A 3FIFA 1K9MU 3A8JA 4CQJA 3A35A 2CSQA 3BDLA 4BY6C 1AWOA 1KZLA 1PJ7A 4WZTA 3LX7A 1ZM4A 4XLFA 3VS7A 1WLPB 3A8HB 2PIAA 1GL5A 4RG8A 3RUXA 2FPFA 2BGIA 2MI6A 3EGDB 1I81A 1F60A 1YJNB 4M75E 1VF7A 1SKQA 4C0GA 3EG3A 2ZTNA 2J6FA 2RQTA 4M78B 4C8QF 3VKIA 4IUPA 4KH0B 3CCUQ 2C4TA 2DL5A 2K5IA 2DL8A 3JCMP 3ULRB 1SRLA 1M3CA 1EFRA 4RTWA 3OYCA 2QEXB 3WNCA 4M1KA 2FHDA 8ATCB 3CBPA 1RACB 4DOVA 4R55A 3SD4A 1UMKA 1ZUKA 3OAAA 1FMVA 5IHKA 3UPUA 2E65A 1E79A 4QQDA 4YALA 1Q81D 4M0LA 1BPLA 3MP8A 1VQ8B 1QFJA 4LD6A 3CTAA 4P3IA 2KT8A 2GQVA 3B82A 3J81k 3G05A 2JIZA 4R71A 5KYWA 3J80E 1YIJA 2EVRA 1QCNA 5JBQA 2KEAA 1S1NA 1JQQA 3E1YE 5LJ5d 1VQOA 4FK8A 1KK2A 5IYRA 1VQ7B 2RHXA 3VRYA 4ATOA 1K9AA 2OTJB 2JNGA 2VBSA 1KQ2A 1WP6A 3VYHB 1UUEA 5CO7A 5HY6A 3OYYA 4X34A 1QW1A 2KI7A 3PUMA 5HKKA 1YHQT 1NPPA 2CKKA 2RQUA 3QYHB 1TUGB 1WXBA 2YUOA 2P84A 5GANh 2E5KA 3JB9F 4PC3A 1HXDA 4TMVA 4RM0A 1ABOA 2JUFA 4YTLA 1R5OA 2D8HA 3DB4A 4RDKA 4OOSA 1WZOA 1TTTA 3L2UA 1YJ9T 2E12A 2ZZDA 4C92G 3I55A 2CC2A 5GMKm 1QQJA 2CP2A 3D7SB 4AMCA 1UB4A 1K9MR 4RPBA 1TVCA 1YCYA 4BI8B 1U2RA 4M77D 1H92A 3T56B 2FRYA 3NHNA 1W34A 1D09B 2QQ9A 2R6HA 3H6ZA 2LT1A 2ZL5A 4G5GA 2QYZA 1KQ1A 1VQLB 3R6JA 3JRZA 2A7YA 2RF0A 4OGCA 4G1VA 2HL3A 4XKWA 4ANJA 2EJGA 1SM4A 1JNYA 1M5Q1 2D9TA 4XLHA 1EX4A 4CC3A 2YT6A 2WJVA 2RA2A 3G4SB 2M5SA 1OU9A 1QKXA 2A3LA 5GAMh 1WORA 2O31A 2BM1A 4TKOB 5IYWA 1XB2A 4DK1A 2GNCA 4B4DA 4DNTB 3FJ5A 2F5TX 2QMUA 1VQ6A 3OYIA 3TEEA 1H3ZA 2XNJA 2K3YA 4OGEA 3SJPA 1FXXA 4V2SA 3HRTA 4M77B 2QE7A 3TREA 3JCMW 1Q7YC 2VBTA 4AF6A 5TRDA 3AVYA 1N8RR 3T9NA 2GTJA 2K57A 2DL4A 4ZNXA 1KQSB 2DPPB 3CC4B 3CMMA 2XDDA 2VXFA 2AZVA 4G7WA 2BVNA 1PM3A 2DY1A 3IQLA 1FNBA 3QFRA 1G3YA 2BN4A 2L3SA 4Q5WA 3OB9A 1KRHA 1Y0MA 3CD6Q 2KNBB 1SEMA 4PJOB 1ACMB 4HCCA 2QAZA 4PC6A 5GAMf 1N08A 3OJXA 4N3NA 5LL6S 4EPCA 4M78E 3S3MA 3GPLA 4P6YA 5DS0A 1FNDA 4OB0B 1MHNA 3CCRA 1N05A 4XU1A 3QJYA 3QO3A 3G4SA 5IYPA 1EXMA 2EGCA 1EFTA 1OX8A 4E7HA 1FRQA 4YAOA 3OKXA 4XAXB 4DQLA 1EFNA 4A54A 1BX1A 2BZXA 1Y07A 2XMFA 4UZFA 3AVUA 4JJDA 2JVVA 1PCXA 1W9XA 3CPWS 1X43A 3CMAQ 1VQLA 2CH4A 2BE9B 2PNIA 4EIKA 3ONUA 1UGPB 4Y91A 3RBBB 4L8JA 2GTOA 1QVGA 3OYGA 2EFIA 2OTLQ 1GXIE 2M9UA 4KKTA 5LJ5g 1TS9A 4C5HA 2K2VA 2R5AA 2LCLA 2E4HA 4DA4A 2CZ0B 4C0SA 1E1QA 4XK8E 2OBRA 3CPWA 2D9RA 4XOTA 2DX1A 1BBZA 1Q86C 4PLIA 2CZ7B 3H94A 3X28B 1OU8A 2QDYB 3P8BB 3F70A 3CMEQ 4CI0C 4BI3A 1WQWA 3C0CA 4JZ3A 4II2A 5LJ5h 4M75D 1W4SA 1WI7A 1N06A 2X53S 3Q39A 1Q82R 1DARA 4JS5A 2CP0A 1VQKA 2DFUA 5LJ3f 2Z0WA 3JQQA 4FT4A 2GJRA 1YWPA 4LD9K 1N9RA 3U6BA 1CKAA 4TVRA 4FW2A 4A53A 1VQ4Q 1KQSS 1QGZA 3RNJA 2YHTA 3VR6A 2DD4A 2FVUA 1U1TA 2JM8A 2PUOB 4J9GA 7AT1B 1IGQA 2V1QA 3QYGB 3L2WA 3CD6B 2E10A 2Y4XA 3G71Q 3M4YA 1QKWA 1FMKA 4M7AA 1YP5A 4J8OA 5FIUA 1I4K1 2VB6A 1OZ3A 2X85A 5KSWB 5CK9A 4E6RA 5KCOA 3DLLA 1QCFA 4BPRA 3L1AA 5KYYA 1M1KC 4XTVA 1D3BA 4X7EA 2WZNA 4WF2A 4ZN1A 4KBMB 4BDYA 1VIEA 1YITT 3GBQA 1CQXA 4JUVA 5GMKh 3JV3A 5J3BA 1K28D 1MNEA 1SSFA 2FL7A 4Z4SA 5IYNA 4K1XA 2RK2A 2NV4A 4KKUA 2RNAA 3OS0A 1BI0A 5KYYB 3PA2A 1G7SA 3WBJA 3A98A 3MHXA 2DTHA 1UEBA 3FC3A 1BB9A 3M53A 4RCYA 4TMXA 1B34B 2D74A 1WHLA 1Y0YA 1VQKT 5FRMA 4PC2A 2ZPGB 5LJ5j 1N8RU 1X6BA 2NPFA 3D26A 1YI2T 3CCJT 4C92E 3EFOB 1NEGA 5IYQA 3E9GA 5GAN4 4XLCA 2EQMA 5TY0A 2B8AA 1TLLA 1E3ZA 2BMWA 5KE3A 5CKFA 2X35A 1YHQA 1BJKA 3OEHA 3CCEB 1Y71A 4A4KA 3BY1A 2RJEA 3OZWA 2JTFA 2LMJA 4E2FB 4Z88A 1NM7A 5EMNA 5F4MA 4PJNA 4HCBA 4O6JA 1VQ5B 1RI9A 1XNIA 3GIRA 2IG0A 3AT1B 3OW2A 3ZPNA 1YJ9B 4PJMA 1PD1A 1JO8A 2HKQB 3KFVA 2GJPA 4LUEA 2WR8A 4RD0A 2RHIA 1TU0B 1AVZC 3G6EQ 2V8KA 4DNRB 4RKUE 4XNFA 1WHHA 2J06A 1R0BG 2EQIA 3E19A 3EAEA 1K4US 3W2HA 1TUDA 1YJ9A 2COWA 2O4XA 4HT9A 1OULA 2VXEA 3SLDA 2ZPFB 4BY6B 1G5VA 4KRTA 1YJWQ 4G6IA 1NYFA 5FNZA 5DSZA 1QLYA 3C94A 2HNIA 1UHCA 3CCEA 2LJ3A 1X27A 4B3GA 1D3BB 1G2BA 3MEAA 2MAMA 4CRIA 2DYBA 1UD6A 2ZL7A 4RLZA 2BV3A 1WSVA 4JRIA 5CKDA 1V1CA 3DB3A 1KJWA 4M7DE 5LMZA 1I1JA 1D1AA 4E7LA 4FYYB 3G1JA 1GO2A 1VQMA 4NL3A 1MMNA 3V8KA 3CPFA 1I5LA 4OOVA 2KXCA 1UGQB 4X06A 4NOYA 3OW2S 1RI0A 2B7CA 2BE7D 4QQ6A 2Z6BD 4G7XA 4X07A 3CCMQ 3JCMf 4B3FX 2E64A 3SWNB 1LPLA 2J05A 3OP1A 3WBKA 3FPKA 1VQNB 1H85A 1C0MA 4P6VF 1IJEA 2XOKA 4FW1A 4FSXA 2ZZGA 2DETA 4OPOA 2JW4A 2LJ1A 1QP2A 4IUTA 3H0HA 4N4HA 1VQMQ 1NJIC 1K8AD 4X9DA 4HVVA 2OK8A 5GAN6 2W6IA 3HTRA 3PVLA 3EG1A 4PC7A 5KW9A 5FU7C 1VQ9A 1FNMA 1PSEA 2HBPA 5GJVB 1SPKA 4E7SA 5F4JA 4P3YA 3A1PA 2EJ9A 2KQWA 4DBRA 3OPOA 2ESWA 3CCEQ 5IXFA 1VHOA 3RKYA 2VNIA 3CXCB 1VQ6B 1QCOA 2I2LA 5LJ3g 3CCVT 3UATA 1PG5B 4AFUC 2KYBA 1RQPA 1RQRA 2J7KA 4MDXA 2PE3A 2A08A 4MMLA 1PWTA 1W2BS 4YHBA 5J3OA 1YJ9Q 1KC8C 2RI2A 4JZ4A 5FU6B 5GMKj 3CCQA 5HKCA 3CC2A 2DYIA 1I8DA 1WOPA 1XQBA 1PD0A 3ZBDA 4M78G 1YNZA 2VGMA 4Z8AA 3CCRT 1MV0B 1VLOA 4FCYA 2AK5A 4J5YA 2KSSA 2OBTA 1VQPQ 4RTVA 4JDSA 3OYAA 1VQKB 1Y0RA 3R6OA 4EMGA 1J3TA 3O5ZA 3FB9A 3S3NA 3OYKA 2JJ9A 4BACA 1RAGB 1JBMA 1B23P 1U8RA 1PKTA 5LJ3d 2KBTA 2F2WA 4J83A 3TVTA 4OMQA 3QXEB 2L89A 2AT1B 3GP8A 2X6WA 1AZEA 1BLIA 4RTZA 3T53B 1R5BA 4BE2A 3SLNA 4G1BA 4M2LA 4A4GA 1LOJA 4DEXA 4WCIA 3FRNA 2OK7A 4P22A 1VQ9B 3CCLB 4RG2A 2NWMA 2DOGA 2K4YA 1VQNQ 2IVWA 4F16A 4OB2B 2CREA 5A8AA 3A8GB 2DAQA 2X4XA 4BUGA 3VS2A 1H8EA 3KXTA 1W87A 2GQFA 2K5LA 5DY9A 3QBYA 4J9FA 2H8HA 3QZ9B 2KXDA 2ATCB 1WX6A 3RDVA 4PGOA 3U6KA 1WHMA 4QQGA 2YRVA 1QGYA 2CP5A 4ASUA 2C77A 2DXCA 2OAWA 1UD8A 2DK3A 3V7RA 1VQ8Q 4M75A 4C0DC 3S6WA 4HT8A 3WNDA 5L46A 2JZ2A 2A37A 2IPOB 4LBYA 4YELA 1QWEA 5H5JA 4J9DA 1ZBJA 4C8QD 5GANd 2RJFA 1NE8A 1EP3B 1T5EA 4F7DA 1Y57A 2O9VA 3Q6RA 3CCSQ 3BW1A 3NFCA 3HFOA 3I9QA 1WHGA 1Q95G 1AZGB 3LQEA 3MCAB 2DKGA 3CPXA 1VQ4A 2YDLA 2KYMA 4C8QA 2DA9A 2QN6A 4PNOA 5FL7A 1RABB 4KGZB 4P26A 5A0GA 2FEIA 2V26A 1YI2Q 3JCMV 5H59A 1M2VA 1AWWA 1NBEB 3M0QA 4B43A 3QPHA 1VQKQ 4OP7A 5I22A 3NGPA 5IXBA 3PFSA 2FVGA 4A4HA 4Z4ZA 2RJCA 2ECZA 1WPYA 3PIOA 1O75A 3CCJQ 2E3IA 5HK3A 2ED1A 2A36A 4XQ3A 4RD6A 2KVQG 3OMCA 2X3WD 2F69A 2K3XA 2KT1A 3H0IA 2OX7A 2V7UA 4FWTA 3NE5B 3ASPA 2LC4A 4LDUA 3CD6T 1VQNT 4N4GA 5GV7A 4DQKA 2YUNA 3REAB 3UDCA 2DLPA 1E62A 1AT1B 5CDFA 4M7AD 1YCSB 3HFNA 3LLRA 2O88A 4A4EA 1YJWB 1WOSA 4C92D 3I56A 2L0AA 4MZTA 5ECAA 4JRKA 2HQHA 3CPWP 4XTZA 1I5OB 2KDSA 2C0IA 2FB7A 4XMYA 3CMAA 1VQLQ 4M7DG 4WWVA 1X75C 2KRNA 1MGQA 4PJOG 5KYWB 2VKNA 4Y9UA 1M1KU 2DZ9A 1KC8U 1B7TA 4UAJA 1JXOA 4C8QC 1T6ZA 3RIRA 1PC0A 4OVAA 5A0DA 1K0XA 1DDIA 1WYXA 2PVDB 2V8IA 3WVEB 5B6IA 1SKYB 4Y7CA 3FJPA 5CCAA 2FYKA 3I55T 3W5VA 2EYYA 3M5AA 4DEYA 2CRVA 3BCFA 4FXUA 1IZ6A 5CKEA 5GANe 3OZVA 4R56A 1QFZA 4F7UB 4M7DB 3ASTA 1C1AA 2XK0A 3R6NA 2X3XD 4M53A 1YITB 3E9FA 2CSIA 3QFCA 2Q6LA 4GLMA 1UFFA 3OS1A 4ZV4A 3ZIAA 5GAN2 2O2OA 1NLOC 3C12A 2XDPA 3CCRQ 1OI1A 3W5UA 4ZTFA 1VQ5T 3CXCP 2RPNA 3CD6A 1E64A 1ELOA 1J9ZA 1YI2B 1VOMA 2H3JA 3CC4Q 1I07A 4C5EA 2ZPIB 1WNLA 4P25A 2GGRA 2DVEA 2LQ8A 3SJZA 1ZA1B 1VQMT 2C5BA 2CH4W 4AFQC 2HKNA 3ASQA 5CQXA 1W35A 3NTHA 1D0YA 1M9SA 4PK4A 2HQXA 4J9CA 1BI2A 2V7TA 1K76A 1FDRA 4C0FA 4PC1A 3WXMA 1OB2A 1MNDA 3SHWA 1K9MD 2C06A 2PVGB 2BZ8A 1UGSB 1MUZA 4J6WA 2DNUA 4XM3A 3L2VA 4C0DB 3QFSA 5FWCA 5GAOp 1RUWA 1FMWA 2RI5A 4EDUA 1OZ2A 1G3TA 4Y9RA 4XN0A 3U23A 3I55Q 1JJ2S 2KRMA 2OI3A 2BSAA 4XTUA 3I56B 3G4ST 3H8ZA 1M3BA 2EAYA 2F2VA 2QDLA 1U3OA 2NUTA 3PGGA 1T3SA 1SHGA 4QVAA 4RD2A 3GNFB 2XKOC 3QJ6A 3X24B 3SKBA 1UJ0A 1UGRB 3C95A 1K9MC 2YUPA 2L2PA 1W0JA 2QA4B 2K5FA 4UC4A 1BQEA 2BKDN 3TSZA 1NDHA 3CC7Q 2CUDA 4YXWA 3VJPA 2E1HA 2M1HA 3EG0A 4IW3B 2EPDA 3CEYA 1WOOA 1EIFA 2DD5A 3PMIA 3AGPA 2FG0A 4X7FA 3CC4T 1B07A 4EH1A 3GVJA 1M2OA 1QVFP 1UE9A 3MKDA 4OMFB 3E1SA 1DJ7B 4Z4WA 4M77C 5LJ5e 1V0EA 2QXFA 2ZL6A 1GR1A 1N07A 3GNGA 4F17A 3JCMd 2XNDA 3ZZTA 2W6JA 5GMKl 2VNHA 2YRCA 3EH1A 2ZBVA 3QSYA 2K7AA 1XFOA 1Q82D 4II3A 3JB9H 5TR9A 3VV0A 1SHFA 4RCZA 4OPSA 1I8FA 1ZHIA 1PKVA 4RJLA 1VQOQ 1ZX6A 1M27C 1D1BA 1MRZA 1S4MA 3MHPA 1W2BA 5E6TA 3LQ6A 3X25B 4WZEA 3W2EA 3ZZ0A 4ACBA 2BPOA 3QKJA 2EFGA 5IK2A 4HVUA 3EFSA 2XICA 2C2WA 3BCDA 3A8KA 4JJBA 2JN9A 2F5KA 2JJ1A 1ARKA 3CCUA 4Y28E 1N27A 3CC2T 3VRZA 5AT1B 5I11A 2CP6A 2K2MA 2DBMA 4FSSA 1TG0A 4IUQA 2B86A 2HAXA 3PVQA 4QW2A 3I56T 1ZM3A 2KR3A 2QTXA 5FW9A 1DDGA 4ZGNB 4AVZA 4J0QA 3RR6A 3CMEB 2CW5A 4RPDA 1X2QA 5KYXA 3M58A 5CR2A 3OEEA 3QWXX 2F1MA 2KRSA 1IHMA 2RN8A 3CQTA 1M8MA 3QSUA 1KQSA 3CC4A 3AGQA 3LH5A 2X4YA 4JLGA 4F7UE 1ZSGA 1KK1A 4M77A 4C92B 1I7PA 1LNXA 3JB9G 2X9HA 1M90D 3VNUA 3PNWC 5LJ5f 1FX0A 1S72T 2QA4Q 1W70A 4PJOE 3P26A 2OTJQ 2RD1A 5KH6A 2ZPHB 4C92A 3PIPA 2DJZA 3UA6A 3VS0A 4D8KA 4M7DD 2X8KA 3FJOA 3G71B 1BCMA 1VQ5Q 3R6KA 3MMPA 1NBMA 2GCXA 3G6ET 4GQNA 1YJNQ 2QTVA 1UD5A 2LX9A 4WZKA 1CNEA 5LJ3h 2D8JA 5IHIA 5LJ3j 1OQKA 1H8KA 2KAFA 3HKSA 3JSCA 3A3GA 3M57A 2XGJA 2CBXA 1IGUA 3V8JA 1OPLA 2X4WA 2V8JA 2XG8D 3BY2A 3M0TA 2I0NA 2D0NA 4KT0E 3V7CA 1YITQ 2VNKA 5GANj 3FDRA 3RERA 5IHNA 1LCKA 3LYIA 4X7CA 2DL3A 4M7AE 2CZ1B 4M75C 3I56Q 2CP3A 3SEMA 2MWOA 2QEXT 4HIZA 4CC2A 4M78C 1K73U 2CT3A 3OBYA 2MK5A 3OQ5A 4YAFA 3MO8A 2J7IA 4MMKA 1Q86U 3A8MB 5I21A 2XZOA 2QQRA 3QFTA 1KHIA 1ZUUA 1G8XA 1QWFA 1OPKA 1VLYA 2PVOB 2PU9B 2L5QA 3Q38A 2JMCA 2QQSA 3HRSA 1VQ4T 1G7CA 4XN3A 4C5IA 1AWJA 3OSVA 2FX3A 3B78A 5M9OA 2DL7A 3CCJA 1M1GA 3WQZA 2ZZEA 4XORA 1E63A 4PABA 4M78A 1D1CA 2QA4T 1VQ7A 1X2KA 4HE6A 1KD1R 2G3RA 1EFUA 2JS2A 1YI2A 4N0AC 5GAMe 2M02A 2ROLA 2ZCFB 1VQMB 2JS0A 3SWNA 4Z4TA 1Q81U 1YIJB 2XD0A 3CESA 1KK0A 4JPBW 1WIEA 2LNHB 2ED0A 4PL6A 2D3LA 1UGVA 4FYVB 4BI4A 5IAYA 1GCQC 1VA7A 2NLUA 2DEUA 4OOXA 4Y92A 3JCMQ 2WPDA 2CZ6B 3LNNA 3MEUA 4XL9A 4XD7A 1Q86D 2QQBA 4YAWA 5FA6A 4LN2A 1JJ2B 4DBHA 1RAFB 1AWXA 4F14A 2LVMA 3TQ7P 1YBYA 2CNDA 2Q6KA 2YLBA 1WU8A 1PJ5A 1AD5A 3QHSA 2LRQA 3EH2A 3OYBA 2R9VA 1OV3A 2XZLA 3V8LA 1ZBXA 3AVXA 2FPDA 3PUNA 3CBMA 4F04B 1ZSZA 4BDZA 1TXQA 2QTLA 4OP0A 4QFMA 1ABQA 3BQJA 4RDJA 2HBWA 4XONA 1RADB 2RI3A 3JU4A 4Z1MA 2R57A 2OTLB 3GQBA 1OOTA 4B48A 1U1SA 3QG1A 2C78A 2L3QA 3MJXA 1RLPC 3VS1A 2MMPA 1SKUB 3O8VA 4PAAA 4C8QE 1M1KR 2NUTB 1Q86R 3ER0A 4MZMA 3HSBA 5GAOn 3ZUGA 4AG2C 1NPRA 2K6DA 1R77A 2HMAA 5FWBA 4B44A 2COYA 4HXJA 3MPUB 4L59A 4X7DA 3EFOA 3ASRA 2RJDA 1GJRA 1UTIA 3ZZUA 4C92F 1N5ZA 2FO0A 1Q82C 2V7VA 5IT9E 2E1RA 2XNCA 2DIGA 2RMOA 4C0ZA 2BF4A 1N6AA 4Q7JB 3CCVB 2BUDA 1VQ8T 5J26A 1VQ6T 2P0QA 3JCMc 3PVDA 1AIPA 4GY5A 3OFNA 1FX7A 2XIDA 5F4OA 2MCNA 1QVFA 1N9SA 2F1LA 3OYFA 2E1BA 3GLXA 4FT2A 5GJWB 2LT4A 1K8AR 1Q9SA 2AZSA 2V7XA 4JJCA 1S0UA 4OMOA 4J9HA 2HCKA 1SG5A 1MV3A 1LJOA 3KEWA 2DMOA 2ZAEA 2M16A 4M7AB 4J6YA 2YRDA 4E0FA 1K73R 2HZYA 2GQIA 2ZXHA 1GFCA 4YAUA 1N8RC 3MEWA 1YJNA 4DBFA 1K0SA 5GANf 3UF4A 3OMGA 3M0PA 1D8TA 2BZYA 3NTKA 1NG2A 3PTAA 3PT9A 4OMPA 1NJID 1OB5A 4QUZA 4FL6A 1TSFA 3EGXA 4LDXA 4M7AC 5CVIA 5GMKi 3CCUT 1M8VA 2VZLA 1JEGA 4YEJA 3CP8A 2HSEB 2VUBA 3M54A 1VYUA 3A8LB 1QG0A 4PFPA 3CCLQ 3OYHA 1IHWA 2PQWA 3OYEA 2VWFA 2EWNA 4WZLA 3OW7A 2GREA 4ZGDB 4NS5A 4ZGQB 4JS4A 3SB2A 2BIVA 1BI1A 2F43A 2NUPB 3HHTB 1Q81C 1B34A 2L3PA 5GAMd 3OW2P 3N5BB 2KE9A 3JCMb 1VIFA 1KQSP 4M7AG 3CP2A 4F7UG 4ZGJB 2EJFA 3JQRA 3CBOA 4M7DF 2JXBA 2ENMA 5DN6A 4AFZC 2LX7A 2DTOA 3ME9A 5GAMg 1T0HA 4C43A 2ABLA 4XTYA 2EKHA 1YJWA 2MWPA 3OBWA 3OA6A 1HA3A 4AG1C 4JJNK 3OYLA 4PLLA 4IURA 1JJ2A 3EG9B 1Z9ZA 4TN1A 5D6XA 3J7AF 4DK0A 2VVKA 2LDMA 3G6EA 2FPEA 4E7KA 5GANg 2DXUA 4II1A 1K8AC 2M51A 3OJWA 1RL2A 2DRKA 2VYQA 1K8AU 2GF7A 4M7DC 1UHFA
chains in the Genus database with same CATH topology
2DYIA 2F1LA 1PM3A 2QGGA 3HTRA 3A1PA 3H9NA 2DOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYI A;  2F1L A;  1PM3 A;  2QGG A;  3HTR A;  3A1P A;  3H9N A;  2DOG A; 
#chains in the Genus database with same CATH topology
 2W0Z A;  4MDW A;  5EG2 A;  3VS3 A;  5GAN 8;  1JB9 A;  2F4N A;  2P4R A;  2E5Q A;  4UZU A;  1IHV A;  3AVT A;  1QMC A;  4MZP A;  5KYU B;  4JRQ A;  1S72 Q;  1ZQ1 A;  3LGL A;  3CB4 A;  3OZU A;  1JU5 C;  3CCM T;  4J9E A;  3LVB A;  2L3R A;  1KC8 D;  2R58 A;  4M78 F;  4C8Q B;  4PJO A;  2P3M A;  3MCA A;  4M7D A;  2VC8 A;  2B5O A;  3PA1 A;  3CC7 A;  3VMF A;  1NEB A;  4XU3 A;  2DRM A;  4JMQ A;  3L2Z A;  1K1Z A;  4RTT A;  5GAO m;  4IUU A;  1XE1 A;  1E6H A;  2I1L A;  1OX9 A;  4M7A F;  1AHJ B;  4XU2 A;  3DLM A;  1TWB A;  2ZGW A;  4AF7 A;  3H9N A;  5FO0 A;  4OB1 B;  4EMK A;  1BKB A;  2OBS A;  3RES A;  2EGA A;  3GVK A;  1Q7Y D;  4M77 G;  2LCS A;  1NJI R;  2LQN A;  1WHJ A;  2WYR A;  4LBV A;  3LGF A;  3OYJ A;  1YJW T;  1H3H A;  3TCJ A;  1MMG A;  4HCZ A;  3ZL7 C;  2JJ2 A;  1PJ6 A;  3MET A;  3L42 A;  2ZPB B;  2FZG B;  1F20 A;  3ZBU A;  3WVD B;  3GSI A;  4PFO A;  4H9G A;  1UG1 A;  1E1R A;  3G6E B;  1X69 A;  1K73 D;  1Q7Y R;  3CW2 A;  1AEY A;  4QVZ A;  3A8O B;  4GBQ A;  3G71 T;  3EG9 A;  2Q6O A;  1EFC A;  2F2X A;  3SWN C;  1P4M A;  4D6W A;  2P4T A;  4OPV A;  1WGS A;  3RKX A;  2A0F B;  2VYT A;  1AOJ A;  1G7R A;  2PMD A;  4ZCM A;  3G71 A;  3QUI A;  4C8Q G;  2XI9 A;  3RMS A;  4WQM A;  4RTX A;  4JLI A;  3CC2 B;  4TT3 A;  2QI2 A;  3NMZ C;  3VO1 A;  4QHY A;  3A8I A;  1QP3 A;  2COZ A;  1KJZ A;  3I55 B;  4DBQ A;  2YWW A;  2O4X B;  3Q3A A;  4ACA A;  1QUE A;  2XU8 A;  4P1V A;  1GCQ A;  1VQ9 T;  4M77 E;  1KC8 R;  1EZZ B;  1WQ7 A;  4XR6 A;  1U5S A;  1OB0 A;  3THK A;  2X4J A;  2RHU A;  1QVG S;  2YWH A;  2EKO A;  4N0A A;  2QQA A;  3H0F A;  1KK7 A;  2RQR A;  2BGJ A;  2GJK A;  1JJ2 P;  3EHQ A;  3GIB A;  3GF5 A;  1TOV A;  1V76 A;  5I2M A;  1KTV A;  2C4U A;  1V29 B;  4ZCI A;  1OGJ A;  1HJD A;  1CSK A;  1BU1 A;  1R8O B;  4P9S A;  2EQJ A;  4PFZ A;  5EC7 A;  2JTM A;  3PEN A;  4KUL A;  3JCM g;  2MOX A;  3REB B;  3CME A;  4K11 A;  2EYX A;  2J6K A;  2VV5 A;  2WSC E;  3CCV Q;  1GVH A;  4FYX B;  2XZP A;  4B47 A;  3CCQ T;  4NBS A;  2DIE A;  2L8D A;  2WSE E;  1PRM C;  1MAB A;  3ISX A;  1MMA A;  2AKK A;  3HL8 A;  4KGV B;  3EGX B;  5A2Q E;  3M56 A;  4ELZ C;  4E7J A;  4QVC A;  4M75 B;  3ES9 A;  1RAA B;  4QKU A;  3RMQ A;  2CK3 A;  5D6W A;  3RY8 A;  1VQO T;  4E7I A;  1VQL T;  1Q81 R;  2MPX C;  5GAO l;  3CXC S;  2DXB A;  4E47 A;  1EWY A;  5A0L A;  2LP5 A;  4ZN3 A;  1G3S A;  1WA7 A;  2AKL A;  2X0K A;  1ZLM A;  3E20 A;  1QVF S;  4QT7 A;  4XLE A;  1T6X A;  1W2B B;  2H3E B;  1KG1 A;  2VBU A;  1OEB A;  1BIB A;  3CMA T;  1BI3 A;  2GK6 A;  1FRN A;  4BE1 A;  3M0U A;  4AT1 B;  1W6X A;  2V4D A;  1KD1 U;  1QH0 A;  3I5S A;  1EP1 B;  4QV2 A;  1WTH D;  3WNB A;  3BC9 A;  3CCV A;  4RCC A;  1BX0 A;  1JA0 A;  1N8R D;  2AHJ B;  3M0S A;  1X6O A;  3G4S Q;  5A89 A;  1LVK A;  4UZE A;  1NLP C;  1E6G A;  4HCK A;  3CCM B;  2NYS A;  2E70 A;  3JB9 J;  1M1F A;  4FM4 B;  4NL2 A;  4LUD A;  2BM0 A;  1T0J A;  2LQK A;  2SRC A;  2GBQ A;  4C92 C;  1M3A A;  2E6N A;  4PJJ A;  5J35 A;  3CCE T;  5FU6 C;  2YWE A;  1Y7X A;  3MEV A;  3CME T;  5CKH A;  4EMH A;  4RCB A;  1WFW A;  1G83 A;  4X1V A;  2QAS A;  4RDL A;  9ATC B;  1ZM9 A;  1IRX A;  2V1R A;  3VYG A;  4XQF A;  1BYM A;  5KYN A;  1SRM A;  2V7W A;  4LDY A;  4VUB A;  3A3B A;  2ZZQ A;  1FYN A;  4LXC A;  1VQ6 Q;  3LWH A;  2PUK B;  5FO1 A;  2WAC A;  4M4S A;  1OYX A;  4F7U A;  1IB0 A;  3V7S A;  4KH1 B;  1T6Y A;  4LDW A;  2DER A;  1ZA2 B;  2G6F X;  1X6G A;  2MIO A;  5DLQ E;  5BSX A;  1GBQ A;  5GAN 5;  2LTO A;  2D1X A;  3H41 A;  1NZ9 A;  3HPW A;  2VBV A;  3CCS A;  1KIK A;  2RC5 A;  3M4G A;  3HAG A;  4Z4V A;  4P5N A;  4DQ2 A;  2HDA A;  2EIX A;  1ZSZ B;  4EMK C;  4M77 F;  3GOX A;  1CKB A;  1NYG A;  3HP9 A;  4IIO A;  1N0U A;  2WSS A;  3CCS T;  3VS4 A;  4BB7 A;  1VQ8 A;  2KY9 A;  3J81 E;  1VJS A;  1VQP B;  3OW2 B;  1UJY A;  1YX2 A;  1QFY A;  3CMA B;  1D1N A;  3WXM B;  2OYN A;  1KSW A;  2M0Y A;  4JRP A;  3KUF A;  1QVP A;  2MYS A;  4B9X A;  1QVF B;  4RTU A;  1H42 A;  2E41 A;  4U9U A;  2X6Y A;  1P92 A;  5HZA A;  2CYZ B;  4J6X A;  5GAO q;  5GAO r;  2Q6I A;  3BH4 A;  3EG2 A;  2VJI A;  2EYW A;  2W10 A;  3OYD A;  4XKV A;  1BMF A;  4KGX B;  4ZCL A;  5DLO A;  2DF6 A;  2PLF A;  4Z89 A;  2EW3 A;  4X05 A;  1Q7Y U;  2VAS A;  4M4Z A;  4FYW B;  2DJQ A;  1GBR A;  1VQN A;  2LZJ A;  1D2E A;  5TV2 A;  1CNF A;  1V5V A;  3TSW A;  3TU4 K;  1PHT A;  5HK0 A;  1JA1 A;  4RMO A;  1UD3 A;  5L8R E;  2YWF A;  2EQU A;  5FLX E;  3NPF A;  1JXM A;  4XLA A;  1GRI A;  1WJQ A;  2FRW A;  2VJJ A;  2RH2 A;  2JOY A;  2HSP A;  2EQK A;  2HCJ B;  4TMT A;  3OSS C;  3W5H A;  1I0C A;  3P8H A;  3C4S A;  3ZBT A;  1VYT A;  3V7A A;  3MP6 A;  5CQY A;  4OMN A;  1M90 R;  2K79 A;  4J7I A;  1JRI A;  2Y4Y A;  4HKE A;  1MMD A;  3LH0 A;  2JTE A;  5C0M A;  3SDZ A;  3QWY A;  3M0R A;  2XDB A;  2JN0 A;  2JDI A;  5IH2 A;  1PNJ A;  4RUG A;  1VQ4 B;  2E3H A;  4XTW A;  1NJI U;  2EYZ A;  1EP2 B;  3VO2 A;  5A88 A;  4BE0 A;  1F1B B;  1S72 A;  1IO6 A;  4FN5 A;  2YSQ A;  3CC7 T;  3ZC3 A;  5GAN 3;  2KVO A;  1YIJ Q;  2K9G A;  1VQP A;  3I5R A;  4PJO C;  4ELY C;  3FEO A;  4J9B A;  4MYT A;  8AT1 B;  1W0K A;  4TMW A;  2KRO A;  4DOW A;  3VS6 A;  1VUB A;  3CC2 Q;  3CCQ Q;  1WJS A;  2NUZ A;  5LJ3 e;  2P0P A;  3EFR A;  1XTD A;  1RAH B;  2YLC A;  3G7Z A;  1X01 A;  1ZUN B;  3VNV A;  2HL5 C;  3PE0 A;  2K3B A;  3JB9 I;  3JCM e;  1GCP A;  1GAW A;  4L5G A;  3OY9 A;  2EIF A;  2FZC B;  1FWZ A;  1QVG B;  2XHC A;  4ZGE B;  3BE3 A;  2YUQ A;  1HK9 A;  4LDV A;  4LBZ A;  1AMO A;  2HLD A;  3UA7 A;  3E2U A;  2OAU A;  3UT1 A;  4Z4U A;  4P2N A;  3DDY A;  1YHQ B;  3KBG A;  1G3W A;  1HSQ A;  2YXY A;  2RHZ A;  1HZE A;  1VQ9 Q;  4M75 G;  5D7U A;  3CCL A;  2HEQ A;  1BCO A;  2X6X A;  5GMK e;  2RB6 A;  4A63 B;  1OGI A;  2CT4 A;  4TMZ A;  4ROX A;  1BK2 A;  2HD0 A;  4RTY A;  4ME7 A;  4LNP A;  2C5H A;  2LNV A;  2HDN B;  1M2V B;  1O9S A;  1WHK A;  1IXD A;  4Z4R A;  4XOP A;  3AVV A;  2AIR B;  1VHE A;  3AVW A;  1OHH A;  3CCM A;  3OE7 A;  4J9I A;  4GLK A;  3JB9 D;  3T51 B;  1Y96 A;  3W2G A;  1I18 A;  1NB0 A;  4NCN A;  4ESR A;  2WSF E;  1V0F A;  5KCH A;  2P0K A;  5AYF A;  5FRO A;  4O5V A;  2ZXI A;  2V7Q A;  5J39 A;  2RC6 A;  2Y90 A;  4FIB A;  3I1F A;  2EGE A;  3CC7 B;  3KL9 A;  1WXT A;  2X51 A;  1YIJ T;  4X0C A;  1M90 C;  4QVD A;  1QUF A;  4A4F A;  3X20 B;  1UD2 A;  1M90 U;  3FKS A;  4L6V 5;  2DBK A;  1KK3 A;  3SFM A;  2CGH A;  1M30 A;  2ZIT A;  1D0X A;  2D3N A;  5KYU A;  2PTK A;  3WY9 A;  1NB9 A;  4M78 D;  2LZ6 B;  4N3G A;  2QDX A;  4LBW A;  2A28 A;  2CUB A;  2KK4 A;  2ZBU A;  1IRE B;  2EBP A;  2RQW A;  3ASS A;  2ZPE B;  1SF9 A;  1YWO A;  3P8D A;  3MP1 A;  4MYU A;  2LJ0 A;  2QEX Q;  1BIA A;  3CCJ B;  4AFS C;  2FZK B;  2O01 E;  2LCC A;  1RAI B;  1A0N B;  1UD4 A;  1TTH B;  3CXC A;  4R0K A;  3CRZ A;  5CIU A;  3JCM X;  1W1F A;  3VU3 C;  3QDF A;  1M1K D;  4B3X A;  2OJ2 A;  4LC0 A;  2DTI A;  4IUV A;  2B7B A;  1T3L A;  3ASK A;  1K73 C;  1WXU A;  3S3O A;  3BDU A;  3URG A;  1WDT A;  3L2Q A;  4Z4Y A;  2JT4 A;  1IB8 A;  3VUZ A;  3DKM A;  1Y96 B;  5THX A;  1YHQ Q;  3OYN A;  2WZP P;  2DXT A;  5CAI A;  2C0T A;  1QX4 A;  1UEC A;  1E3X A;  3CPW B;  3EGD A;  4CC4 B;  2ZZF A;  3QE2 A;  2QGG A;  1ZUY A;  2DEQ A;  2VGN A;  3W2F A;  4FU6 A;  3M9Q A;  3PMT A;  1C6V X;  3OYM A;  4WTO B;  1Q82 U;  2AHO A;  2DIQ A;  4OML A;  2C0O A;  4E7Z A;  4XTX A;  4KUD K;  1R5N A;  4HVW A;  3BNW A;  4C5G A;  5KE2 A;  1Z9Q A;  1TH7 A;  2DO3 A;  2QG9 B;  4RD1 A;  2DZC A;  2GFU A;  4N4I A;  5KYX B;  3Q6Q A;  1COW A;  1YLO A;  4F7U F;  2WJY A;  2ROT A;  3AHU A;  1HVX A;  3OS2 A;  1A8P A;  5HZB A;  2DIL A;  2GK7 A;  3Q1J A;  1KMH A;  3CCQ B;  5BSY A;  1VQO B;  1B2R A;  2VNJ A;  3A5Z B;  3CCR B;  1NRK A;  3VUB A;  1WJR A;  4PKC C;  3EGU A;  4XU0 A;  3GVL A;  4D8D A;  3JQP A;  2JMA A;  2RK1 A;  1ZSZ C;  4EMK B;  3L2R A;  1KD1 C;  1E43 A;  1YFN A;  5GV8 A;  5GAN 7;  3INZ A;  2DCU A;  2RHY A;  4B9W A;  3RKW A;  2ZTG A;  4TSF A;  5KNL A;  3ZFJ A;  1JB0 E;  4BD3 A;  1VQ7 Q;  2M0O A;  4ORZ A;  2IIM A;  2PZ1 A;  1FNC A;  2JM9 A;  1IJF A;  2EYQ A;  3UWN A;  3FPP A;  2J6O A;  1N0V C;  1XOV A;  2DVJ A;  2CS7 A;  2RM4 A;  4J7F A;  4PJL A;  4M75 F;  3EHR A;  2CDT A;  1DG1 G;  5D6Y A;  3WYA A;  1U06 A;  3B8H A;  1QGA A;  1G7T A;  1XJW B;  3X26 B;  3SEJ A;  5I2S A;  4NNJ A;  3QDR B;  4HA8 A;  4IIM A;  5HCK A;  3VS5 A;  2V31 A;  2GPJ A;  3M55 A;  4KUI A;  1PKS A;  5GAM j;  2RO0 A;  3CCU B;  4B6M A;  1W2B P;  3U2Q A;  1KD1 D;  1YJN T;  4AC9 A;  5C6S A;  3I35 A;  4OMM A;  2DM1 A;  3JCM h;  4X9C A;  1D0Z A;  4IKF A;  3LO8 A;  3QII A;  2QK0 A;  1KFZ A;  4LE9 A;  5HXB A;  5FRN A;  3HRU A;  3ZEH A;  1SSH A;  4RD4 A;  2X3U A;  1YIT A;  3W2I A;  5DM7 R;  1WPC A;  3JAM E;  1UDL A;  5FU7 B;  1PSF A;  2QEX A;  2KMT A;  1WDX A;  1RLQ C;  4X8I A;  4PJO D;  1PRL C;  2YWG A;  2HQE A;  2QGF B;  1H64 1;  3V76 A;  2OTL A;  2KGT A;  1TUC A;  1WSR A;  1QVG P;  2DE0 X;  1R0C B;  3JCM J;  3BY7 A;  1H8H A;  2D0Q B;  2XEX A;  4KKS A;  3ONY A;  2SEM A;  4QVJ A;  2QTZ A;  5CKB A;  2OTL T;  2E6Z A;  3M59 A;  4PJO F;  2RQV A;  5IN1 A;  3FLG A;  2NUP A;  4HE5 A;  3BFM A;  1GAQ A;  4ZTJ A;  2O9S A;  1HYO A;  1VQP T;  1XQH A;  5L23 A;  2LQW A;  1ZM2 A;  3LWI A;  1RAE B;  2QA4 A;  4OF1 A;  1VQ7 T;  4P12 A;  3CCS B;  1S72 B;  3NTI A;  1B3Q A;  1VYV A;  1M4Z A;  4OB3 B;  2BTT A;  2OTJ T;  2CF4 A;  6AT1 B;  3QZ5 B;  1VQ5 A;  3OOC A;  5AN9 A;  4CC7 A;  4RD3 A;  2R5M A;  1YN8 A;  2D6F A;  3LW5 E;  3CCL T;  2GFA A;  1GFD A;  1TUI A;  1KHC A;  2CP7 A;  2MF2 A;  2OTJ A;  1E7O A;  3OS5 A;  1HD3 A;  3P27 A;  4Z02 A;  3FIF A;  1K9M U;  3A8J A;  4CQJ A;  3A35 A;  2CSQ A;  3BDL A;  4BY6 C;  1AWO A;  1KZL A;  1PJ7 A;  4WZT A;  3LX7 A;  1ZM4 A;  4XLF A;  3VS7 A;  1WLP B;  3A8H B;  2PIA A;  1GL5 A;  4RG8 A;  3RUX A;  2FPF A;  2BGI A;  2MI6 A;  3EGD B;  1I81 A;  1F60 A;  1YJN B;  4M75 E;  1VF7 A;  1SKQ A;  4C0G A;  3EG3 A;  2ZTN A;  2J6F A;  2RQT A;  4M78 B;  4C8Q F;  3VKI A;  4IUP A;  4KH0 B;  3CCU Q;  2C4T A;  2DL5 A;  2K5I A;  2DL8 A;  3JCM P;  3ULR B;  1SRL A;  1M3C A;  1EFR A;  4RTW A;  3OYC A;  2QEX B;  3WNC A;  4M1K A;  2FHD A;  8ATC B;  3CBP A;  1RAC B;  4DOV A;  4R55 A;  3SD4 A;  1UMK A;  1ZUK A;  3OAA A;  1FMV A;  5IHK A;  3UPU A;  2E65 A;  1E79 A;  4QQD A;  4YAL A;  1Q81 D;  4M0L A;  1BPL A;  3MP8 A;  1VQ8 B;  1QFJ A;  4LD6 A;  3CTA A;  4P3I A;  2KT8 A;  2GQV A;  3B82 A;  3J81 k;  3G05 A;  2JIZ A;  4R71 A;  5KYW A;  3J80 E;  1YIJ A;  2EVR A;  1QCN A;  5JBQ A;  2KEA A;  1S1N A;  1JQQ A;  3E1Y E;  5LJ5 d;  1VQO A;  4FK8 A;  1KK2 A;  5IYR A;  1VQ7 B;  2RHX A;  3VRY A;  4ATO A;  1K9A A;  2OTJ B;  2JNG A;  2VBS A;  1KQ2 A;  1WP6 A;  3VYH B;  1UUE A;  5CO7 A;  5HY6 A;  3OYY A;  4X34 A;  1QW1 A;  2KI7 A;  3PUM A;  5HKK A;  1YHQ T;  1NPP A;  2CKK A;  2RQU A;  3QYH B;  1TUG B;  1WXB A;  2YUO A;  2P84 A;  5GAN h;  2E5K A;  3JB9 F;  4PC3 A;  1HXD A;  4TMV A;  4RM0 A;  1ABO A;  2JUF A;  4YTL A;  1R5O A;  2D8H A;  3DB4 A;  4RDK A;  4OOS A;  1WZO A;  1TTT A;  3L2U A;  1YJ9 T;  2E12 A;  2ZZD A;  4C92 G;  3I55 A;  2CC2 A;  5GMK m;  1QQJ A;  2CP2 A;  3D7S B;  4AMC A;  1UB4 A;  1K9M R;  4RPB A;  1TVC A;  1YCY A;  4BI8 B;  1U2R A;  4M77 D;  1H92 A;  3T56 B;  2FRY A;  3NHN A;  1W34 A;  1D09 B;  2QQ9 A;  2R6H A;  3H6Z A;  2LT1 A;  2ZL5 A;  4G5G A;  2QYZ A;  1KQ1 A;  1VQL B;  3R6J A;  3JRZ A;  2A7Y A;  2RF0 A;  4OGC A;  4G1V A;  2HL3 A;  4XKW A;  4ANJ A;  2EJG A;  1SM4 A;  1JNY A;  1M5Q 1;  2D9T A;  4XLH A;  1EX4 A;  4CC3 A;  2YT6 A;  2WJV A;  2RA2 A;  3G4S B;  2M5S A;  1OU9 A;  1QKX A;  2A3L A;  5GAM h;  1WOR A;  2O31 A;  2BM1 A;  4TKO B;  5IYW A;  1XB2 A;  4DK1 A;  2GNC A;  4B4D A;  4DNT B;  3FJ5 A;  2F5T X;  2QMU A;  1VQ6 A;  3OYI A;  3TEE A;  1H3Z A;  2XNJ A;  2K3Y A;  4OGE A;  3SJP A;  1FXX A;  4V2S A;  3HRT A;  4M77 B;  2QE7 A;  3TRE A;  3JCM W;  1Q7Y C;  2VBT A;  4AF6 A;  5TRD A;  3AVY A;  1N8R R;  3T9N A;  2GTJ A;  2K57 A;  2DL4 A;  4ZNX A;  1KQS B;  2DPP B;  3CC4 B;  3CMM A;  2XDD A;  2VXF A;  2AZV A;  4G7W A;  2BVN A;  1PM3 A;  2DY1 A;  3IQL A;  1FNB A;  3QFR A;  1G3Y A;  2BN4 A;  2L3S A;  4Q5W A;  3OB9 A;  1KRH A;  1Y0M A;  3CD6 Q;  2KNB B;  1SEM A;  4PJO B;  1ACM B;  4HCC A;  2QAZ A;  4PC6 A;  5GAM f;  1N08 A;  3OJX A;  4N3N A;  5LL6 S;  4EPC A;  4M78 E;  3S3M A;  3GPL A;  4P6Y A;  5DS0 A;  1FND A;  4OB0 B;  1MHN A;  3CCR A;  1N05 A;  4XU1 A;  3QJY A;  3QO3 A;  3G4S A;  5IYP A;  1EXM A;  2EGC A;  1EFT A;  1OX8 A;  4E7H A;  1FRQ A;  4YAO A;  3OKX A;  4XAX B;  4DQL A;  1EFN A;  4A54 A;  1BX1 A;  2BZX A;  1Y07 A;  2XMF A;  4UZF A;  3AVU A;  4JJD A;  2JVV A;  1PCX A;  1W9X A;  3CPW S;  1X43 A;  3CMA Q;  1VQL A;  2CH4 A;  2BE9 B;  2PNI A;  4EIK A;  3ONU A;  1UGP B;  4Y91 A;  3RBB B;  4L8J A;  2GTO A;  1QVG A;  3OYG A;  2EFI A;  2OTL Q;  1GXI E;  2M9U A;  4KKT A;  5LJ5 g;  1TS9 A;  4C5H A;  2K2V A;  2R5A A;  2LCL A;  2E4H A;  4DA4 A;  2CZ0 B;  4C0S A;  1E1Q A;  4XK8 E;  2OBR A;  3CPW A;  2D9R A;  4XOT A;  2DX1 A;  1BBZ A;  1Q86 C;  4PLI A;  2CZ7 B;  3H94 A;  3X28 B;  1OU8 A;  2QDY B;  3P8B B;  3F70 A;  3CME Q;  4CI0 C;  4BI3 A;  1WQW A;  3C0C A;  4JZ3 A;  4II2 A;  5LJ5 h;  4M75 D;  1W4S A;  1WI7 A;  1N06 A;  2X53 S;  3Q39 A;  1Q82 R;  1DAR A;  4JS5 A;  2CP0 A;  1VQK A;  2DFU A;  5LJ3 f;  2Z0W A;  3JQQ A;  4FT4 A;  2GJR A;  1YWP A;  4LD9 K;  1N9R A;  3U6B A;  1CKA A;  4TVR A;  4FW2 A;  4A53 A;  1VQ4 Q;  1KQS S;  1QGZ A;  3RNJ A;  2YHT A;  3VR6 A;  2DD4 A;  2FVU A;  1U1T A;  2JM8 A;  2PUO B;  4J9G A;  7AT1 B;  1IGQ A;  2V1Q A;  3QYG B;  3L2W A;  3CD6 B;  2E10 A;  2Y4X A;  3G71 Q;  3M4Y A;  1QKW A;  1FMK A;  4M7A A;  1YP5 A;  4J8O A;  5FIU A;  1I4K 1;  2VB6 A;  1OZ3 A;  2X85 A;  5KSW B;  5CK9 A;  4E6R A;  5KCO A;  3DLL A;  1QCF A;  4BPR A;  3L1A A;  5KYY A;  1M1K C;  4XTV A;  1D3B A;  4X7E A;  2WZN A;  4WF2 A;  4ZN1 A;  4KBM B;  4BDY A;  1VIE A;  1YIT T;  3GBQ A;  1CQX A;  4JUV A;  5GMK h;  3JV3 A;  5J3B A;  1K28 D;  1MNE A;  1SSF A;  2FL7 A;  4Z4S A;  5IYN A;  4K1X A;  2RK2 A;  2NV4 A;  4KKU A;  2RNA A;  3OS0 A;  1BI0 A;  5KYY B;  3PA2 A;  1G7S A;  3WBJ A;  3A98 A;  3MHX A;  2DTH A;  1UEB A;  3FC3 A;  1BB9 A;  3M53 A;  4RCY A;  4TMX A;  1B34 B;  2D74 A;  1WHL A;  1Y0Y A;  1VQK T;  5FRM A;  4PC2 A;  2ZPG B;  5LJ5 j;  1N8R U;  1X6B A;  2NPF A;  3D26 A;  1YI2 T;  3CCJ T;  4C92 E;  3EFO B;  1NEG A;  5IYQ A;  3E9G A;  5GAN 4;  4XLC A;  2EQM A;  5TY0 A;  2B8A A;  1TLL A;  1E3Z A;  2BMW A;  5KE3 A;  5CKF A;  2X35 A;  1YHQ A;  1BJK A;  3OEH A;  3CCE B;  1Y71 A;  4A4K A;  3BY1 A;  2RJE A;  3OZW A;  2JTF A;  2LMJ A;  4E2F B;  4Z88 A;  1NM7 A;  5EMN A;  5F4M A;  4PJN A;  4HCB A;  4O6J A;  1VQ5 B;  1RI9 A;  1XNI A;  3GIR A;  2IG0 A;  3AT1 B;  3OW2 A;  3ZPN A;  1YJ9 B;  4PJM A;  1PD1 A;  1JO8 A;  2HKQ B;  3KFV A;  2GJP A;  4LUE A;  2WR8 A;  4RD0 A;  2RHI A;  1TU0 B;  1AVZ C;  3G6E Q;  2V8K A;  4DNR B;  4RKU E;  4XNF A;  1WHH A;  2J06 A;  1R0B G;  2EQI A;  3E19 A;  3EAE A;  1K4U S;  3W2H A;  1TUD A;  1YJ9 A;  2COW A;  2O4X A;  4HT9 A;  1OUL A;  2VXE A;  3SLD A;  2ZPF B;  4BY6 B;  1G5V A;  4KRT A;  1YJW Q;  4G6I A;  1NYF A;  5FNZ A;  5DSZ A;  1QLY A;  3C94 A;  2HNI A;  1UHC A;  3CCE A;  2LJ3 A;  1X27 A;  4B3G A;  1D3B B;  1G2B A;  3MEA A;  2MAM A;  4CRI A;  2DYB A;  1UD6 A;  2ZL7 A;  4RLZ A;  2BV3 A;  1WSV A;  4JRI A;  5CKD A;  1V1C A;  3DB3 A;  1KJW A;  4M7D E;  5LMZ A;  1I1J A;  1D1A A;  4E7L A;  4FYY B;  3G1J A;  1GO2 A;  1VQM A;  4NL3 A;  1MMN A;  3V8K A;  3CPF A;  1I5L A;  4OOV A;  2KXC A;  1UGQ B;  4X06 A;  4NOY A;  3OW2 S;  1RI0 A;  2B7C A;  2BE7 D;  4QQ6 A;  2Z6B D;  4G7X A;  4X07 A;  3CCM Q;  3JCM f;  4B3F X;  2E64 A;  3SWN B;  1LPL A;  2J05 A;  3OP1 A;  3WBK A;  3FPK A;  1VQN B;  1H85 A;  1C0M A;  4P6V F;  1IJE A;  2XOK A;  4FW1 A;  4FSX A;  2ZZG A;  2DET A;  4OPO A;  2JW4 A;  2LJ1 A;  1QP2 A;  4IUT A;  3H0H A;  4N4H A;  1VQM Q;  1NJI C;  1K8A D;  4X9D A;  4HVV A;  2OK8 A;  5GAN 6;  2W6I A;  3HTR A;  3PVL A;  3EG1 A;  4PC7 A;  5KW9 A;  5FU7 C;  1VQ9 A;  1FNM A;  1PSE A;  2HBP A;  5GJV B;  1SPK A;  4E7S A;  5F4J A;  4P3Y A;  3A1P A;  2EJ9 A;  2KQW A;  4DBR A;  3OPO A;  2ESW A;  3CCE Q;  5IXF A;  1VHO A;  3RKY A;  2VNI A;  3CXC B;  1VQ6 B;  1QCO A;  2I2L A;  5LJ3 g;  3CCV T;  3UAT A;  1PG5 B;  4AFU C;  2KYB A;  1RQP A;  1RQR A;  2J7K A;  4MDX A;  2PE3 A;  2A08 A;  4MML A;  1PWT A;  1W2B S;  4YHB A;  5J3O A;  1YJ9 Q;  1KC8 C;  2RI2 A;  4JZ4 A;  5FU6 B;  5GMK j;  3CCQ A;  5HKC A;  3CC2 A;  2DYI A;  1I8D A;  1WOP A;  1XQB A;  1PD0 A;  3ZBD A;  4M78 G;  1YNZ A;  2VGM A;  4Z8A A;  3CCR T;  1MV0 B;  1VLO A;  4FCY A;  2AK5 A;  4J5Y A;  2KSS A;  2OBT A;  1VQP Q;  4RTV A;  4JDS A;  3OYA A;  1VQK B;  1Y0R A;  3R6O A;  4EMG A;  1J3T A;  3O5Z A;  3FB9 A;  3S3N A;  3OYK A;  2JJ9 A;  4BAC A;  1RAG B;  1JBM A;  1B23 P;  1U8R A;  1PKT A;  5LJ3 d;  2KBT A;  2F2W A;  4J83 A;  3TVT A;  4OMQ A;  3QXE B;  2L89 A;  2AT1 B;  3GP8 A;  2X6W A;  1AZE A;  1BLI A;  4RTZ A;  3T53 B;  1R5B A;  4BE2 A;  3SLN A;  4G1B A;  4M2L A;  4A4G A;  1LOJ A;  4DEX A;  4WCI A;  3FRN A;  2OK7 A;  4P22 A;  1VQ9 B;  3CCL B;  4RG2 A;  2NWM A;  2DOG A;  2K4Y A;  1VQN Q;  2IVW A;  4F16 A;  4OB2 B;  2CRE A;  5A8A A;  3A8G B;  2DAQ A;  2X4X A;  4BUG A;  3VS2 A;  1H8E A;  3KXT A;  1W87 A;  2GQF A;  2K5L A;  5DY9 A;  3QBY A;  4J9F A;  2H8H A;  3QZ9 B;  2KXD A;  2ATC B;  1WX6 A;  3RDV A;  4PGO A;  3U6K A;  1WHM A;  4QQG A;  2YRV A;  1QGY A;  2CP5 A;  4ASU A;  2C77 A;  2DXC A;  2OAW A;  1UD8 A;  2DK3 A;  3V7R A;  1VQ8 Q;  4M75 A;  4C0D C;  3S6W A;  4HT8 A;  3WND A;  5L46 A;  2JZ2 A;  2A37 A;  2IPO B;  4LBY A;  4YEL A;  1QWE A;  5H5J A;  4J9D A;  1ZBJ A;  4C8Q D;  5GAN d;  2RJF A;  1NE8 A;  1EP3 B;  1T5E A;  4F7D A;  1Y57 A;  2O9V A;  3Q6R A;  3CCS Q;  3BW1 A;  3NFC A;  3HFO A;  3I9Q A;  1WHG A;  1Q95 G;  1AZG B;  3LQE A;  3MCA B;  2DKG A;  3CPX A;  1VQ4 A;  2YDL A;  2KYM A;  4C8Q A;  2DA9 A;  2QN6 A;  4PNO A;  5FL7 A;  1RAB B;  4KGZ B;  4P26 A;  5A0G A;  2FEI A;  2V26 A;  1YI2 Q;  3JCM V;  5H59 A;  1M2V A;  1AWW A;  1NBE B;  3M0Q A;  4B43 A;  3QPH A;  1VQK Q;  4OP7 A;  5I22 A;  3NGP A;  5IXB A;  3PFS A;  2FVG A;  4A4H A;  4Z4Z A;  2RJC A;  2ECZ A;  1WPY A;  3PIO A;  1O75 A;  3CCJ Q;  2E3I A;  5HK3 A;  2ED1 A;  2A36 A;  4XQ3 A;  4RD6 A;  2KVQ G;  3OMC A;  2X3W D;  2F69 A;  2K3X A;  2KT1 A;  3H0I A;  2OX7 A;  2V7U A;  4FWT A;  3NE5 B;  3ASP A;  2LC4 A;  4LDU A;  3CD6 T;  1VQN T;  4N4G A;  5GV7 A;  4DQK A;  2YUN A;  3REA B;  3UDC A;  2DLP A;  1E62 A;  1AT1 B;  5CDF A;  4M7A D;  1YCS B;  3HFN A;  3LLR A;  2O88 A;  4A4E A;  1YJW B;  1WOS A;  4C92 D;  3I56 A;  2L0A A;  4MZT A;  5ECA A;  4JRK A;  2HQH A;  3CPW P;  4XTZ A;  1I5O B;  2KDS A;  2C0I A;  2FB7 A;  4XMY A;  3CMA A;  1VQL Q;  4M7D G;  4WWV A;  1X75 C;  2KRN A;  1MGQ A;  4PJO G;  5KYW B;  2VKN A;  4Y9U A;  1M1K U;  2DZ9 A;  1KC8 U;  1B7T A;  4UAJ A;  1JXO A;  4C8Q C;  1T6Z A;  3RIR A;  1PC0 A;  4OVA A;  5A0D A;  1K0X A;  1DDI A;  1WYX A;  2PVD B;  2V8I A;  3WVE B;  5B6I A;  1SKY B;  4Y7C A;  3FJP A;  5CCA A;  2FYK A;  3I55 T;  3W5V A;  2EYY A;  3M5A A;  4DEY A;  2CRV A;  3BCF A;  4FXU A;  1IZ6 A;  5CKE A;  5GAN e;  3OZV A;  4R56 A;  1QFZ A;  4F7U B;  4M7D B;  3AST A;  1C1A A;  2XK0 A;  3R6N A;  2X3X D;  4M53 A;  1YIT B;  3E9F A;  2CSI A;  3QFC A;  2Q6L A;  4GLM A;  1UFF A;  3OS1 A;  4ZV4 A;  3ZIA A;  5GAN 2;  2O2O A;  1NLO C;  3C12 A;  2XDP A;  3CCR Q;  1OI1 A;  3W5U A;  4ZTF A;  1VQ5 T;  3CXC P;  2RPN A;  3CD6 A;  1E64 A;  1ELO A;  1J9Z A;  1YI2 B;  1VOM A;  2H3J A;  3CC4 Q;  1I07 A;  4C5E A;  2ZPI B;  1WNL A;  4P25 A;  2GGR A;  2DVE A;  2LQ8 A;  3SJZ A;  1ZA1 B;  1VQM T;  2C5B A;  2CH4 W;  4AFQ C;  2HKN A;  3ASQ A;  5CQX A;  1W35 A;  3NTH A;  1D0Y A;  1M9S A;  4PK4 A;  2HQX A;  4J9C A;  1BI2 A;  2V7T A;  1K76 A;  1FDR A;  4C0F A;  4PC1 A;  3WXM A;  1OB2 A;  1MND A;  3SHW A;  1K9M D;  2C06 A;  2PVG B;  2BZ8 A;  1UGS B;  1MUZ A;  4J6W A;  2DNU A;  4XM3 A;  3L2V A;  4C0D B;  3QFS A;  5FWC A;  5GAO p;  1RUW A;  1FMW A;  2RI5 A;  4EDU A;  1OZ2 A;  1G3T A;  4Y9R A;  4XN0 A;  3U23 A;  3I55 Q;  1JJ2 S;  2KRM A;  2OI3 A;  2BSA A;  4XTU A;  3I56 B;  3G4S T;  3H8Z A;  1M3B A;  2EAY A;  2F2V A;  2QDL A;  1U3O A;  2NUT A;  3PGG A;  1T3S A;  1SHG A;  4QVA A;  4RD2 A;  3GNF B;  2XKO C;  3QJ6 A;  3X24 B;  3SKB A;  1UJ0 A;  1UGR B;  3C95 A;  1K9M C;  2YUP A;  2L2P A;  1W0J A;  2QA4 B;  2K5F A;  4UC4 A;  1BQE A;  2BKD N;  3TSZ A;  1NDH A;  3CC7 Q;  2CUD A;  4YXW A;  3VJP A;  2E1H A;  2M1H A;  3EG0 A;  4IW3 B;  2EPD A;  3CEY A;  1WOO A;  1EIF A;  2DD5 A;  3PMI A;  3AGP A;  2FG0 A;  4X7F A;  3CC4 T;  1B07 A;  4EH1 A;  3GVJ A;  1M2O A;  1QVF P;  1UE9 A;  3MKD A;  4OMF B;  3E1S A;  1DJ7 B;  4Z4W A;  4M77 C;  5LJ5 e;  1V0E A;  2QXF A;  2ZL6 A;  1GR1 A;  1N07 A;  3GNG A;  4F17 A;  3JCM d;  2XND A;  3ZZT A;  2W6J A;  5GMK l;  2VNH A;  2YRC A;  3EH1 A;  2ZBV A;  3QSY A;  2K7A A;  1XFO A;  1Q82 D;  4II3 A;  3JB9 H;  5TR9 A;  3VV0 A;  1SHF A;  4RCZ A;  4OPS A;  1I8F A;  1ZHI A;  1PKV A;  4RJL A;  1VQO Q;  1ZX6 A;  1M27 C;  1D1B A;  1MRZ A;  1S4M A;  3MHP A;  1W2B A;  5E6T A;  3LQ6 A;  3X25 B;  4WZE A;  3W2E A;  3ZZ0 A;  4ACB A;  2BPO A;  3QKJ A;  2EFG A;  5IK2 A;  4HVU A;  3EFS A;  2XIC A;  2C2W A;  3BCD A;  3A8K A;  4JJB A;  2JN9 A;  2F5K A;  2JJ1 A;  1ARK A;  3CCU A;  4Y28 E;  1N27 A;  3CC2 T;  3VRZ A;  5AT1 B;  5I11 A;  2CP6 A;  2K2M A;  2DBM A;  4FSS A;  1TG0 A;  4IUQ A;  2B86 A;  2HAX A;  3PVQ A;  4QW2 A;  3I56 T;  1ZM3 A;  2KR3 A;  2QTX A;  5FW9 A;  1DDG A;  4ZGN B;  4AVZ A;  4J0Q A;  3RR6 A;  3CME B;  2CW5 A;  4RPD A;  1X2Q A;  5KYX A;  3M58 A;  5CR2 A;  3OEE A;  3QWX X;  2F1M A;  2KRS A;  1IHM A;  2RN8 A;  3CQT A;  1M8M A;  3QSU A;  1KQS A;  3CC4 A;  3AGQ A;  3LH5 A;  2X4Y A;  4JLG A;  4F7U E;  1ZSG A;  1KK1 A;  4M77 A;  4C92 B;  1I7P A;  1LNX A;  3JB9 G;  2X9H A;  1M90 D;  3VNU A;  3PNW C;  5LJ5 f;  1FX0 A;  1S72 T;  2QA4 Q;  1W70 A;  4PJO E;  3P26 A;  2OTJ Q;  2RD1 A;  5KH6 A;  2ZPH B;  4C92 A;  3PIP A;  2DJZ A;  3UA6 A;  3VS0 A;  4D8K A;  4M7D D;  2X8K A;  3FJO A;  3G71 B;  1BCM A;  1VQ5 Q;  3R6K A;  3MMP A;  1NBM A;  2GCX A;  3G6E T;  4GQN A;  1YJN Q;  2QTV A;  1UD5 A;  2LX9 A;  4WZK A;  1CNE A;  5LJ3 h;  2D8J A;  5IHI A;  5LJ3 j;  1OQK A;  1H8K A;  2KAF A;  3HKS A;  3JSC A;  3A3G A;  3M57 A;  2XGJ A;  2CBX A;  1IGU A;  3V8J A;  1OPL A;  2X4W A;  2V8J A;  2XG8 D;  3BY2 A;  3M0T A;  2I0N A;  2D0N A;  4KT0 E;  3V7C A;  1YIT Q;  2VNK A;  5GAN j;  3FDR A;  3RER A;  5IHN A;  1LCK A;  3LYI A;  4X7C A;  2DL3 A;  4M7A E;  2CZ1 B;  4M75 C;  3I56 Q;  2CP3 A;  3SEM A;  2MWO A;  2QEX T;  4HIZ A;  4CC2 A;  4M78 C;  1K73 U;  2CT3 A;  3OBY A;  2MK5 A;  3OQ5 A;  4YAF A;  3MO8 A;  2J7I A;  4MMK A;  1Q86 U;  3A8M B;  5I21 A;  2XZO A;  2QQR A;  3QFT A;  1KHI A;  1ZUU A;  1G8X A;  1QWF A;  1OPK A;  1VLY A;  2PVO B;  2PU9 B;  2L5Q A;  3Q38 A;  2JMC A;  2QQS A;  3HRS A;  1VQ4 T;  1G7C A;  4XN3 A;  4C5I A;  1AWJ A;  3OSV A;  2FX3 A;  3B78 A;  5M9O A;  2DL7 A;  3CCJ A;  1M1G A;  3WQZ A;  2ZZE A;  4XOR A;  1E63 A;  4PAB A;  4M78 A;  1D1C A;  2QA4 T;  1VQ7 A;  1X2K A;  4HE6 A;  1KD1 R;  2G3R A;  1EFU A;  2JS2 A;  1YI2 A;  4N0A C;  5GAM e;  2M02 A;  2ROL A;  2ZCF B;  1VQM B;  2JS0 A;  3SWN A;  4Z4T A;  1Q81 U;  1YIJ B;  2XD0 A;  3CES A;  1KK0 A;  4JPB W;  1WIE A;  2LNH B;  2ED0 A;  4PL6 A;  2D3L A;  1UGV A;  4FYV B;  4BI4 A;  5IAY A;  1GCQ C;  1VA7 A;  2NLU A;  2DEU A;  4OOX A;  4Y92 A;  3JCM Q;  2WPD A;  2CZ6 B;  3LNN A;  3MEU A;  4XL9 A;  4XD7 A;  1Q86 D;  2QQB A;  4YAW A;  5FA6 A;  4LN2 A;  1JJ2 B;  4DBH A;  1RAF B;  1AWX A;  4F14 A;  2LVM A;  3TQ7 P;  1YBY A;  2CND A;  2Q6K A;  2YLB A;  1WU8 A;  1PJ5 A;  1AD5 A;  3QHS A;  2LRQ A;  3EH2 A;  3OYB A;  2R9V A;  1OV3 A;  2XZL A;  3V8L A;  1ZBX A;  3AVX A;  2FPD A;  3PUN A;  3CBM A;  4F04 B;  1ZSZ A;  4BDZ A;  1TXQ A;  2QTL A;  4OP0 A;  4QFM A;  1ABQ A;  3BQJ A;  4RDJ A;  2HBW A;  4XON A;  1RAD B;  2RI3 A;  3JU4 A;  4Z1M A;  2R57 A;  2OTL B;  3GQB A;  1OOT A;  4B48 A;  1U1S A;  3QG1 A;  2C78 A;  2L3Q A;  3MJX A;  1RLP C;  3VS1 A;  2MMP A;  1SKU B;  3O8V A;  4PAA A;  4C8Q E;  1M1K R;  2NUT B;  1Q86 R;  3ER0 A;  4MZM A;  3HSB A;  5GAO n;  3ZUG A;  4AG2 C;  1NPR A;  2K6D A;  1R77 A;  2HMA A;  5FWB A;  4B44 A;  2COY A;  4HXJ A;  3MPU B;  4L59 A;  4X7D A;  3EFO A;  3ASR A;  2RJD A;  1GJR A;  1UTI A;  3ZZU A;  4C92 F;  1N5Z A;  2FO0 A;  1Q82 C;  2V7V A;  5IT9 E;  2E1R A;  2XNC A;  2DIG A;  2RMO A;  4C0Z A;  2BF4 A;  1N6A A;  4Q7J B;  3CCV B;  2BUD A;  1VQ8 T;  5J26 A;  1VQ6 T;  2P0Q A;  3JCM c;  3PVD A;  1AIP A;  4GY5 A;  3OFN A;  1FX7 A;  2XID A;  5F4O A;  2MCN A;  1QVF A;  1N9S A;  2F1L A;  3OYF A;  2E1B A;  3GLX A;  4FT2 A;  5GJW B;  2LT4 A;  1K8A R;  1Q9S A;  2AZS A;  2V7X A;  4JJC A;  1S0U A;  4OMO A;  4J9H A;  2HCK A;  1SG5 A;  1MV3 A;  1LJO A;  3KEW A;  2DMO A;  2ZAE A;  2M16 A;  4M7A B;  4J6Y A;  2YRD A;  4E0F A;  1K73 R;  2HZY A;  2GQI A;  2ZXH A;  1GFC A;  4YAU A;  1N8R C;  3MEW A;  1YJN A;  4DBF A;  1K0S A;  5GAN f;  3UF4 A;  3OMG A;  3M0P A;  1D8T A;  2BZY A;  3NTK A;  1NG2 A;  3PTA A;  3PT9 A;  4OMP A;  1NJI D;  1OB5 A;  4QUZ A;  4FL6 A;  1TSF A;  3EGX A;  4LDX A;  4M7A C;  5CVI A;  5GMK i;  3CCU T;  1M8V A;  2VZL A;  1JEG A;  4YEJ A;  3CP8 A;  2HSE B;  2VUB A;  3M54 A;  1VYU A;  3A8L B;  1QG0 A;  4PFP A;  3CCL Q;  3OYH A;  1IHW A;  2PQW A;  3OYE A;  2VWF A;  2EWN A;  4WZL A;  3OW7 A;  2GRE A;  4ZGD B;  4NS5 A;  4ZGQ B;  4JS4 A;  3SB2 A;  2BIV A;  1BI1 A;  2F43 A;  2NUP B;  3HHT B;  1Q81 C;  1B34 A;  2L3P A;  5GAM d;  3OW2 P;  3N5B B;  2KE9 A;  3JCM b;  1VIF A;  1KQS P;  4M7A G;  3CP2 A;  4F7U G;  4ZGJ B;  2EJF A;  3JQR A;  3CBO A;  4M7D F;  2JXB A;  2ENM A;  5DN6 A;  4AFZ C;  2LX7 A;  2DTO A;  3ME9 A;  5GAM g;  1T0H A;  4C43 A;  2ABL A;  4XTY A;  2EKH A;  1YJW A;  2MWP A;  3OBW A;  3OA6 A;  1HA3 A;  4AG1 C;  4JJN K;  3OYL A;  4PLL A;  4IUR A;  1JJ2 A;  3EG9 B;  1Z9Z A;  4TN1 A;  5D6X A;  3J7A F;  4DK0 A;  2VVK A;  2LDM A;  3G6E A;  2FPE A;  4E7K A;  5GAN g;  2DXU A;  4II1 A;  1K8A C;  2M51 A;  3OJW A;  1RL2 A;  2DRK A;  2VYQ A;  1K8A U;  2GF7 A;  4M7D C;  1UHF A; 
#chains in the Genus database with same CATH homology
 2DYI A;  2F1L A;  1PM3 A;  2QGG A;  3HTR A;  3A1P A;  3H9N A;  2DOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...