4U9UA

Crystal structure of nqrf fad-binding domain from vibrio cholerae
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
279
Chain Sequence
VKKWECTVISNDNKATFIKELKLAIPDGESVPFRAGGYIQIEAPAHHVKYADFDVPEKYRGDWDKFNLFRYESKVDEPIIRAYSMANYPEEFGIIMLNVRIATPPPNNPNVPPGQMSSYIWSLKAGDKCTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRLKSKRKMSYWYGARSKREMFYVEDFDGLAAENDNFVWHCALSDPQPEDNWTGYTGFIHNVLYENYLKDHEAPEDCEYYMCGPPMMNAAVINMLKNLGVEEENILLDDFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the V. cholerae Na+-pumping NADH:quinone oxidoreductase.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
molecule keywords Na(+)-translocating NADH-quinone reductase subunit F
total genus 87
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 7.2.1.1: NADH:ubiquinone reductase (Na(+)-transporting).
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4u9uA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4u9uA02
4PGOA 1GVHA 3P26A 2NPFA 2DCUA 1EP1B 1VQ9B 3W5HA 3I55B 3OJWA 2BVNA 4H9GA 1XB2A 4B3XA 3ZZTA 3CCMB 1EFTA 2X3UA 4RD3A 2QDXA 3B82A 4HE5A 4PC7A 1DG1G 4AF7A 1S0UA 1VQ7B 1H42A 3G4SB 1QH0A 1KD1D 1ZM9A 1KK3A 1EFCA 3WNCA 1H85A 3V76A 2DETA 2B5OA 2YWEA 5HXBA 4WQMA 1GR1A 1IJEA 5FA6A 1FNDA 1R5OA 4UAJA 1GAQA 1Q7YD 4DQLA 4F7DA 1HA3A 3WNBA 3MCAA 2BM0A 4RJLA 4G5GA 2CRVA 1SKQA 3AVWA 2QN6A 1TTTA 1QGAA 4TN1A 1E63A 3A1FA 1KJZA 1ELOA 1DDGA 1W35A 1KK1A 3U6BA 3JQQA 3LO8A 4ZCMA 2XNCA 1VQMB 1QGZA 1CQXA 2PLFA 3AVTA 1E64A 5TR9A 4M0LA 3VO2A 2YWGA 3P27A 1W87A 1EFUA 4M1KA 2R6HA 3WYAA 3CB4A 2B7BA 1FNCA 3ZBUA 1QGYA 1ZM4A 3LYUA 5JBQA 1IJFA 2D74A 2OTJB 1D2EA 4ZCLA 4ACAA 2VYQA 2C78A 2GQFA 3E20A 4B44A 1JA1A 3MHPA 4MYTA 4FK8A 4HE6A 3W2EA 3ZBTA 4Q7JB 2C77A 1D8TA 1BJKA 1AMOA 4ACBA 3CRZA 4P3YA 3CMEB 1VQ6B 3U6KA 3OZUA 2XEXA 3W5VA 2VNJA 2YWHA 3J81k 1TVCA 1M90D 1VQKB 4C0SA 1G7TA 1N0UA 1NDHA 4TMWA 4G1BA 1Q86D 1ZM2A 2J7KA 3W2FA 1YJWB 1OB5A 2RC5A 3CC2B 3LVBA 5EMNA 3CCRB 2YWFA 5H59A 2EFGA 4NCNA 4YHBA 3ZZUA 3B78A 3AVXA 2VNHA 3CW2A 2QA4B 1A8PA 1GO2A 4M4SA 1CNFA 2DEUA 3G71B 3QFTA 3PENA 1F20A 2OK8A 5THXA 2GPJA 1YIJB 1QFJA 3QSYA 3CXCB 1ZUNB 1B23P 1Q81D 1W2BB 3B8HA 2QTLA 5H5JA 1Q82D 3AVUA 3AGQA 2FX3A 3WY9A 2DY1A 3CCEB 5DSZA 2BPOA 5TY0A 4FN5A 4TMZA 1FRNA 1R5BA 1M1KD 1QVFB 3QE2A 4ZGNB 2PMDA 1ZM3A 1YI2B 1KTVA 3I56B 4RD6A 4B4DA 1K8AD 3VNVA 4LC0A 3G6EB 4RD2A 1KRHA 1KC8D 3ZC3A 4PC2A 4RD4A 3FJOA 1D1NA 2HCJB 2BV3A 4K1XA 2BMWA 3LRXA 1GJRA 4YALA 4TMVA 3CMAB 4RCYA 4TMTA 2B7CA 4LBZA 3CD6B 3CCUB 4P6VF 4RD1A 3QFSA 2AHOA 5GV8A 3W2GA 3ES9A 3MMPA 1YHQB 3VMFA 2QTZA 4AF6A 4ZCIA 4TMXA 1CNEA 1EP2B 4B47A 1R5NA 1KQSB 1E62A 2OTLB 1EXMA 1OB2A 1SM4A 1I7PA 1IB0A 1QFZA 4PC6A 1QVGB 2XNJA 5AN9A 3FPKA 1YJNB 2BF4A 2BN4A 1TLLA 1YJ9B 3WXMA 3CC7B 1EWYA 1DARA 3W2HA 4MYUA 2CNDA 3QFRA 2PIAA 4AC9A 1OGJA 3I1FA 2BGIA 4LBVA 1GAWA 1FDRA 3W5UA 4LBWA 2HMAA 2QEXB 3CCLB 1FRQA 4Y9UA 1VQOB 4YAUA 1G7RA 4N3GA 1FNBA 3SJZA 1VQPB 4YAFA 1JB9A 3WNDA 4IW3B 1QUEA 3JQRA 1VQ5B 1VQ8B 2VNKA 4Y9RA 4ZV4A 1DDIA 4N3NA 1BX0A 2DERA 3VNUA 2QMUA 1QFYA 1U2RA 3OZVA 3ZZ0A 2EIXA 4LBYA 4J0QA 3VO1A 3AVVA 1QG0A 1QUFA 4B48A 1NJID 3JQPA 1G7CA 1QX4A 4NBSA 4YAWA 1VQLB 2BGJA 4R71A 4G1VA 4M2LA 2HDNB 2VZLA 4DQKA 1AIPA 3AVYA 1FNMA 1VQNB 1JA0A 4Y7CA 3CCVB 1KK0A 1N8RD 1EP3B 4ZGQB 1F60A 1JJ2B 4QFMA 2RC6A 5TV2A 4C43A 3CCJB 1TUIA 1B2RA 4U9UA 2OK7A 1BQEA 3CCQB 1KK2A 3OW2B 1WDTA 1UMKA 1K73D 1K9MD 3CC4B 3CCSB 3OZWA 4PC3A 1W34A 1J9ZA 1XE1A 1G7SA 1S72B 2ZITA 4PC1A 3U2QA 3E1YE 3OJXA 1N0VC 1OGIA 1YITB 4YAOA 3WBJA 4BPRA 3W2IA 4RCZA 2VNIA 2E1RA 3QFCA 4QHYA 4EH1A 1BX1A 1JNYA 3WBKA 5GV7A 4M53A 2BSAA 2BM1A 1VQ4B 4RD0A 4FWTA 3AGPA 5KSWB 3CPWB 4B43A
chains in the Genus database with same CATH superfamily
3SICE 1ST2A 4NVRA 3DNFA 4M0CA 1Y6GA 1ADJA 2FJUA 2VDWA 2XYGA 3G2KA 3LNCA 1W4AA 3SQMA 2NM0A 3ZJTA 1I51A 3DCYA 4KN9S 2FDXA 4EG7A 1QF7A 3M6VA 4GLBA 4P36A 3UF0A 4BAGA 4X97A 3M7IA 1QQ6A 3MXTA 1K2WA 3NAMA 1EDEA 4CG2A 4CEIB 2HBZA 3W5HA 3I55B 1SZDA 2WVHA 2ZR7A 3NIDB 4RQUA 5ICCA 2QZSA 1L4EA 4U8GA 4AT1A 4CM8B 2ETXA 5DS0A 4MQUA 3RT7A 4AICA 3EIHA 1QE5A 1FVXA 4R0VA 2QDXA 4GPTA 3B82A 1MNAA 2W70A 3VDRA 2CNWA 3RIXA 2C5FA 3D6NB 1N7GA 2BMAA 2DHRA 4JT2A 2CVHA 4U7HA 4X3CA 3BXOA 4KXLA 4P8RA 3JQ7A 4P7FA 1U99A 4XR4A 1DQNA 4HZIA 5B55A 3BIOA 3WKCA 4IS3A 3FY4A 1B4DA 4GHWA 4QTTB 2OHFA 1MENA 3CPEA 1SVKA 4POAA 4TUYF 1NU8A 4GO1A 4PS1A 4M1EA 3KSBC 1N1EA 3WSTA 3WNCA 4XIGS 4BP1A 5TQJA 4HDRB 1P5JA 3EHDA 1CQZA 5A4KA 3KD3A 3R23A 2QNBA 1I01A 1W93A 2IYFA 3KEGA 2Q3LA 4RZQA 4WUVA 1O95D 4R0MA 1KRXA 2OO3A 2OCAA 1O96B 3LDUA 4G1EB 4MR9A 3FZEA 4PG5A 2VRNA 2QKYA 1ZLYA 3ENVA 4R3NA 4AZVA 1SHUX 1GCUA 2WLTA 3T35A 4ZOLB 5EQJB 3TRDA 1G2OA 1V25A 4S35A 5UKDA 4FD2A 3THRA 1XEXA 4DEVA 4IMJB 2RJNA 1QH1B 3T15A 3CKLA 1YZTA 2J9GA 1V0EA 3U40A 1Z5ZA 5KOHB 1PK9A 2A9FA 1XNHA 2IY7A 3BTVA 4DN6A 3QKTA 2JLRA 4QOFA 4FM9A 2IEYA 2HO4A 4UNIA 4XMYA 5J9FA 1JIQA 2QP3A 1QB8A 3QUQA 4P5PA 4DA4A 1VIYA 4U2EA 1VE3A 1N5KA 1PR1A 3WAKA 4N65A 3IA2A 1YV9A 3DQZA 3N75A 1UMCA 4BJ3A 3RUIA 1ANKA 1ZW6A 4DLKA 4MAFA 3D8BA 4F8YA 5LL6P 3U1BA 2O1WA 4GYWA 4OJYA 3FOFC 1E7MA 2A67A 3HL4A 2D3NA 1UFRA 4UMDA 2EW2A 2HF7A 2NU6B 1NVBA 4G8JA 3UWPA 4IZHA 4JBNA 4LE2A 3QWFA 2IHKA 4AY4A 4DL9A 4IH4A 3VOTA 1PR4A 4IF6A 4XIYA 1XZGA 3ZX4A 2GEVA 4UUQA 5EKSA 3NWPA 4M0DA 1QHYA 3WKDA 1G9SA 3LT4A 3DE5X 4JI3B 2VRCD 4BQIA 3JVDA 4I55B 1BFDA 1R6BX 1ZVMA 3ILYA 4EBFA 2E87A 3AR7A 1W2WB 5E2IA 3O1HB 4OOVA 3GEHA 5FP0A 4FFDA 5KNBH 1GAJA 2YWGA 2YBDA 4PNEA 5I7WA 1MV5A 3SMVA 2R6HA 1U8AA 2CN1A 1FX0A 3KR1A 4ZHQF 2R86A 3TD2A 1GGEA 1NVVQ 1SR8A 1Z9BA 4FGJA 3CQ9A 1T9GS 3KC2A 3K70D 2R8XA 3OIWA 2IGTA 1V37A 2XDAA 3IIMA 3LYUA 3THSA 4N7BA 2P69A 2C5GA 5K0CA 1X8LA 2NAPA 2IYNA 3F3MA 4DLUA 4EI2A 2H3EA 2OWDA 5DGXA 4X85A 3T7DA 3W7BA 3TIXB 1J9GA 1PKEA 3H1PA 4M0UA 4X1OA 3L7AA 1JA1A 5K9ZA 4MZDA 4K6MA 3HZRA 3PUVA 1H2BA 4L8YA 5A9SA 4WLEA 3JD2A 1JLRA 4IWNA 4FJ1A 1E3QA 1P80A 3PA1A 2BH9A 3N0RA 4DBLE 3E18A 4BYGA 4F3KA 4FC7A 3KYDA 2WTEA 4TXMA 3QX3A 1GQFA 2NO9A 1N7HA 3UKOA 1PT8A 4E2XA 3W2EA 1SKYE 4EG8A 1IUOA 4EVRA 1D8TA 1OTYA 3EZYA 3MZ0A 3P5SA 4RHXA 2YNMD 5A4FS 2QJTA 3ZV3A 3O21A 4O4IF 5KDLA 2UZ0A 5BUQA 1IJBA 3GJ6A 4AKGA 4OLAA 1FEZA 3C41J 4CQLB 1N2HA 1DFHA 3H11A 1W88A 3NBKA 1PU2A 4RGBA 1TJPB 4PAMA 2PUGA 5AW1A 3PKJA 1KHHA 5MN6A 5DLEA 4K9RA 5M29A 4R1SA 1U80A 3E15A 3JPWA 5HE9A 2TMYA 3E3AA 3DMNA 2OM6A 4EGCB 3STUA 4M6WA 1E2GA 1U3WA 5JIBA 5KMGA 4MLCA 3Q9NA 5A7GA 4BTEA 4UE2A 1LPPA 3IERA 1NNEA 1RJ9B 4F04A 4PGGA 4DMCA 3NHYA 3IUJA 4U02A 1N07A 4Q0MA 1GL9B 4R8KA 1KJWA 1YJWB 1JJBA 1OB5A 1XMIA 2VWGA 3OPVA 5D86A 4ALMA 6Q21A 4X66B 2H4YA 4X8IA 2FZEA 3M0EA 3E1GA 4X1YB 4YUWA 4L8FA 4C4ZA 1QZXA 3RAPR 5FTKA 4ETNA 4YUZA 3Q6RA 3AH8A 3N2LA 4QOJA 4NF2A 3UV6A 4OB8A 4IIBA 4QDTA 3ZWPA 5SYMA 2BGGA 4WGGA 5HA5A 4UTZA 5TQVA 3GDGA 2QMHA 3EQ2A 3LO5A 1NX6A 4ZAXA 3CPHA 4RV4A 1CUEA 1ORWA 2TMDA 5TF0A 1DIBA 1TJNA 4L7VA 1RBQA 4M7RA 5TT1A 3W77A 3Q38A 1BDJA 4MEJA 4D46A 2OK8A 2X1VA 3ONDA 4M46A 4OHVA 5E38A 3O47A 4EFNA 4MW0A 1RWXA 4LOHA 3A4YA 3VPGA 1W4LA 4DMRA 4H7DA 5EJFA 3OZBA 1PEKE 1SXIA 2C88A 4KQIA 1MO4A 1ZOPA 3IR7A 5BSKA 3CE9A 3P2KA 1XZQA 4FGWA 4L7QA 3CXCB 4MVJE 3W9SA 4DZZA 3FLAA 2XOXA 3A11A 1XMQB 2C07A 4V0MA 3BMXA 1M2WA 1VCMA 1YS6A 3U0BA 2QTLA 2RI0A 4WOCA 3CVVA 3EDMA 2G8NA 3L1IA 2EKLA 1KNQA 4JEIA 5KTNA 1LQTA 4DRXB 3RNLA 4M86A 2FUEA 4YMSA 3IJRA 4M38A 3TMKA 1E60A 1ZD1A 4Y2HA 2JPDA 2ZYAA 2EF1A 4N0MA 3CCEB 4JJAA 5JQGB 1LDNA 3MD0A 3TB4A 4BFSA 4YV0A 3FWHA 3ACBA 3NNNA 1AVTA 5JDCC 4E88A 3W3AD 3DE4X 4FEAA 3CMMA 3OCWA 1PWHA 2ECPA 3RBAA 2Z1MA 1FRNA 4OL9A 1PJQA 1D0IA 5EE9A 1BKYA 1QVAA 1I8DA 1FDWA 1XP8A 4I1VA 5EFOA 3T8YA 1CZUA 4Y6LA 1ZM3A 4IOKA 1ORRA 1WY7A 1OV4A 1YK1A 2D5LA 3KHTA 2BHSA 1K8AD 1JR3D 1U81A 3I6QA 4MUJA 2DYIA 1GPMA 2O0MA 2UUAB 3G2IA 4QBHA 5G4KB 5IKXA 2DQKA 2DKNA 2WAOA 3HVJA 5EE0A 10MHA 2R97A 5ES4B 3SI7A 2O7QA 1QYXA 3QPDA 4MWGA 1O03A 3UTDA 1H4VB 1P7YA 3CX7A 4I7EA 4CGYA 2PUFA 1TPZA 1IK6A 1NI4A 4HQKA 4R1UA 1PAUA 4DKXA 3NLLA 1XVAA 4IVNA 1J7KA 4F5DA 2DY0A 5J4VA 5A62A 1YZKA 5HKKA 2X0NA 2WU8A 2RK3A 2YYZA 3GMSA 1KZ6A 5JNUA 2ZL5A 2D1QA 4QXRA 1NF8A 4UHCA 2PX2A 1B73A 4YN3A 1QOQB 2CUKA 5CEJA 5IM4F 3AESB 3ZDQA 3CD6B 2BGWA 2PUVA 3DVAA 4WZAA 5DCWA 4DUYB 5CITA 3UXHA 1UBEA 1KJYA 2IYTA 4CDNA 3JASA 2UZ1B 4IQGA 4X45A 3SSMA 4J1TC 3MMPA 4KK3A 5JS2A 1NYRA 3WHPA 4A8JC 1UJNA 3IMEA 4AY3A 1RWWA 4CIAA 4X7BA 1MPTA 1KZHA 1QOPB 5J4YA 4BWGA 4HWKA 3HKCB 4EAAA 7REQB 1NXVA 3BXXA 8MHTA 1R5NA 4TYQA 5KHLB 1CLEA 4I66A 3ZNOA 4OQ4A 1XWIA 1W19A 1QS0A 2PSSA 4AO6A 1X8JA 3ENKA 4YMHA 4MVJM 2JJ8A 5I4BA 4DCOA 1ZH0A 1L4KA 3EZLA 1CS0A 4NCHA 4ALNA 5JH7B 2ADMA 4JLOA 2YXEA 2ZRGA 3AI1A 3HJNA 3BDIA 1E99A 1EK1A 3GT4A 3K2IA 4FFNA 4AS1A 2C9CA 5CPBA 4Y8VA 2XWJI 1Z8HA 2GRAA 1TM7E 1ZGCA 5LOVA 2V7UA 1P0CA 3X1ZA 4X64B 5DTQA 1G21E 1TU3A 3NHSA 2H4FA 1QHIA 2PA0A 1DARA 1M0TA 4JIGA 3W4KA 5IRCD 1N6OA 1VQ1A 2BGNA 2CNDA 4RU1A 5TMEA 3N5CA 4ZHQA 4JR2A 4PEVA 1JFLA 2BZ0A 2E9SA 5HRCA 3DFMA 4L50A 1NXPA 1QCDA 2D4HA 2EJVA 3T6KA 2PIAA 4LXUA 3CUWA 1NE2A 3KDPA 3T3MB 4ED9A 2AFIB 1S2OA 2OG2A 3INYA 2UUBB 2Y1DA 3VR2D 4CQMB 4R4JA 3R0IA 1KR2A 3G2HA 4BJ1A 4Z4VA 3UK1A 5IU6A 1Y5LA 2VLIA 3H05A 3PGA1 2WT4A 3HEMA 2X85A 4L72A 3EXEA 4D80A 3EG5A 4WY5A 4UJ3A 3UB2A 4C4OA 3BWMA 3H7IA 4MDFA 3HP1A 2DSTA 3DVLA 4KNWA 3VC3A 1TVKB 4I6GA 2JDIA 3HCNA 1SVSA 3L82B 4HXEB 2IXTA 4OLFA 1LC0A 2GMWA 3QKSA 3AIIA 4O2BB 1FFEA 1C4XA 1VA4A 2JKYA 4EB0A 2A5YB 2AZTA 3LZDA 4MICA 3TBFA 3OFNA 5LVAA 2YXBA 3DV2A 1T5SA 4XVQA 1F8YA 5F3WB 4QPDA 2J3DA 5JDIC 1M1YE 1MQ8B 4Q7QA 2VHEA 3H4TA 4J75A 4E22A 5EXPA 3T95A 3VHRA 4CUJA 1J0CA 5EUMA 4KPFC 2HU2A 2UAGA 3QF7A 1BN6A 4OUDA 3TLZA 3GDHA 4FE3A 4A91A 1NSTA 1LI4A 1FMFA 4ZK6A 5L3QB 2F3RA 1X2BA 2W8BA 5REQB 4M76B 2AUTA 2O9JA 5B1SA 1L5QA 4MQBA 3AFGA 4OMDA 4Y0NA 1Q3KA 1PKVA 5ECDA 2BWJA 1PSDA 5JO0A 4N12A 3QKRA 2YWJA 4KR2A 2QF7A 3QXCA 5IDVA 1MHPA 2EG5A 2ZRNA 4XAQA 2AHRA 1WSAA 3CWQA 2NTNA 2WM2A 3RFVA 3OF5A 2WHPA 1KARA 5JZBA 1TGYA 2HSZA 2QVXX 4PO1A 3B52X 1GPAA 1Y98A 4LGCA 1NT2A 5GZ1A 3PC6A 2W37A 2PL1A 2GM4A 1P1IA 4N9QA 3DE7X 3TKLA 4KOEC 4TXLA 1KQFA 4S3MA 1XEFA 1F51E 3EX7C 3ZHSA 2O2GA 2EYUA 1TGVA 1II9A 1TIPA 3GMIA 1ZKDA 3AJAA 2DE0X 2QU7A 1NXWA 4H35A 5L3ZA 1ZOOA 1OBVA 3PC4A 4DNFA 5DZSA 1AUPA 1Z39A 4RUKA 4AN0A 4RL6A 1KEKA 1CUSA 1ORHA 3GIRA 3ACCA 2DWOA 3RROA 3TFQA 1EQAA 3WMFA 1ISRA 2YZMA 1DFGA 3DE6X 1U8FO 4A6XA 5K0JA 3P19A 4PLGA 1CR6A 1JG1A 4U7PB 2XUIA 5LLSA 2V7QD 4U9IS 4XYMA 2SECE 1ADCA 3M83A 3PUXA 4Y0VA 4C7KA 5JTTA 4YRSA 3O8DA 2FX5A 2NU7B 2OLJA 2PS3A 5BUCA 3EGIA 3MJSA 4HVTA 3OW2B 1O6BA 4FONA 3CG4A 3R7DA 3DXZA 5FI1B 3SKBA 3SYMA 3K35A 4ENQA 5CTJA 5K4GA 5I4CA 1MG0A 1E18A 1L7OA 1V45E 3K7EA 4QO8A 4XWTA 2F6RA 2HPAA 1PQ4A 1RRMA 4BC0A 4UHEA 4ZIRA 3LDFA 5IYZB 2EBUA 3GPIA 1E69A 2C5AA 3T54A 4D3DA 5B1EA 1J5PA 2ZITA 2BW0A 4EO4A 4B3MB 3UC9A 2ODQA 2BEWA 2QPTA 3PDWA 5D51S 3R9XA 3DT6A 1EZ4A 2RGAA 1VG8A 4JMPA 2ID7A 3R41A 2I8AA 4W6QA 3ONEA 4ZICA 3O8QB 4O1MA 1WB5A 2Y9PB 4KPUB 1KMNA 4BLOA 1XRMA 3H65A 4IOMA 4LGMA 5JEEA 1J49A 2C3OA 4HF7A 1EINA 2E1RA 5J3OA 4NZMA 3DFZA 3K15A 5F76A 3RIYA 4CMGA 4PN3A 1QH1A 3EF0A 3DQQA 1JNYA 1IN5A 1MXFA 1IPEA 2VPXA 4GI2A 3ZHQA 4ZJPA 3U56A 5CX4A 3U5ZB 1GUAA 2GKGA 4FMDB 4P34A 3A4TA 2GYUA 3DBRA 1YUBA 2F8MA 4JT4A 2VDKB 5HQTA 2I9KA 3AY0A 2C7GA 1TX4B 1OMOA 3NRCA 3BY1A 3HKDB 4HJXA 3SJUA 1IMOA 4OMCA 3VC7A 1I2ZA 3KL4A 3LWZA 1JLMA 1RHJA 2F3TA 3FLMA 3O8OA 1M2GA 4IVRA 2RH8A 4NICA 3JAKA 3WB2A 1XXHE 2W2XA 2DECA 4G6ZA 2FSHA 1ZEMA 3ZCXA 2H2GA 1VLJA 3H1EA 3VR2A 3HQ4O 1Z15A 4C0JA 4O2RA 4M9QA 4NL4H 5FNVF 2Z04A 4P4GA 5FUMA 3ETGA 2D5IA 2GPSA 3A05A 3AFMA 4D9NA 5FYDA 3S1LA 3W8FA 3N0VA 4EA9A 4H9GA 4QSHA 3UANA 4G8CA 5M04A 4JUCA 1ECGA 2WJZB 4C5CA 5EY5B 1JIKA 3H2GA 3QW2A 1PJTA 2X6QA 3VHXA 1PR3A 2PKQP 4JI4B 2WY2D 3V2GA 2XJ4A 3E3OA 4AZ3A 3DW1X 1DOAA 1ZJYA 4KPEC 2IWRA 3OWOA 4FZ3A 1G5HA 2VK1A 1RPJA 2JA2A 4MVWA 3W5AA 1NN0A 1F06A 3HJRA 3KUXA 1HDZA 3IR5A 2JK1A 5EKXA 1V71A 3L8HA 3GZJA 4I50B 5EUCA 4B31A 1QRAA 4BKPA 2I1VB 3IMCA 1MAHA 1BRMA 1JGTA 1NVWQ 1MFPA 4ENWA 3JAWA 5F7JA 1Z22A 2YHIA 2WW8A 4M0KA 2JB9A 1A2KC 2JCYA 3D3QA 4C7BA 1FXWA 4HDKA 1KVUA 3B36A 2PGOA 3LGSA 1E9VA 2CFCA 3I3SR 4J7UA 1X7DA 1TO1E 1UKBA 4UCFA 5HFJA 4MWSA 5JUWA 2DR2A 4F3RA 3ZJVA 1RPAA 2ETVA 4XGQA 5E1BA 4ZQBA 3MAJA 1R9GA 3EEBA 3HYNA 1KERA 2C4KA 4EYOA 1QANA 4BO7A 2I1WA 5EHQA 2J59A 4PR0A 1Q50A 3SZLA 1FTYA 5HIAA 1VIAA 2ERYA 2W93A 2ZGVA 2O5EA 1GGNA 2W2OA 5LOVF 2OHIA 3NATA 4FINA 4M54A 4R01A 2UYCA 1Y89A 4ZO9A 4U0JA 2BEJA 2W6ID 1OX5A 5EINA 2R3SA 3SF8B 1J5EB 1AGXA 3H5RA 1KO8A 3GGGA 4GUAA 4WLFA 1Y7PA 5KYNA 1RXWA 1N7JA 3IT1A 4L9WA 1DL5A 5JXWA 3L06A 5TPWA 5ALZA 1AV7A 4TV8F 3D6HA 3WNVA 4ZI3A 1OXSC 1IYZA 3TH5A 1HE5A 3ZGXA 3FKSD 1U94A 2VWPA 4CQLA 3AM5A 1DDGA 3TW0A 9ATCA 2Q45A 3OO1A 5KVCA 4OX9B 1ORIA 1SU8A 4LS3A 5T4FA 3PHIA 3ZS8A 1FRVA 4LDZA 1UDWA 3U6BA 1GA1A 3NUZA 3Q6IA 2B7LA 3LUKA 3H1TA 3O4GA 4V39A 2AFRA 3C43A 3H4MA 1Z4JA 1L8QA 2XDQA 3AL3A 1HMYA 2CFSA 4NY1A 4BNVA 1AJEA 4DLLA 5KYGA 3L0IB 3ND9A 3MCVA 1XKTA 3WQQA 3KWLA 5HF8A 4B8ZA 2PO5A 5FR2A 1SVUA 5I5EA 1YR8A 3SY8A 1YU6A 1GLNA 1PEAA 3T3IA 1MVOA 5L95A 1WMFA 3WLEA 4R8MA 1K27A 4Q1CA 2IYRA 2GJ9A 3BD6A 5KO2A 3VO2A 1LCIA 5BOVA 5MGNA 4UBJA 4H17A 3AM4A 3MEQA 4EJSA 1Z29A 1OD6A 2FWMX 4MQEB 4KV7A 2OXCA 4UHHA 4OQQA 1Y7HA 2NPOA 3AVQA 4IIGA 2ZYSA 5DI9A 2BFEB 3UWSA 5CEFA 1ZRSA 4IGEA 5FPTA 3G2NA 5B12A 3OOCA 2PX5A 2CF6A 5FXMA 5H8WA 1HNZB 2GARA 2A86A 3V2UA 1LXCA 3I12A 2CD9A 4PZLA 2OD9A 3USCS 3INGA 3OPOA 2A0XA 3IBTA 3JQBC 4LTMA 1VFNA 2NSJA 3EF1A 3GFSA 1YWGO 3IBYA 3QXJA 1DTSA 3WA6A 1JYSA 3NBXX 2PL5A 4WW0A 2VYQA 4QUBA 3VR5A 4BB6A 1K2VN 1M6YA 4N9WA 3UJCA 3ZD8A 2VXCA 3SR3A 1WO8A 1T9CA 1XE3A 4RESA 4Z2YA 3QWHA 4N03A 3TQTA 4CI9A 4EKEA 1Y8AA 3E9EA 3ZPXA 3PR1A 3EK2A 4MYTA 2YRFA 1Z83A 2DYKA 4PIMA 4WN9A 1TYDE 3ZKAA 5H3LA 4AAYA 5BSWA 4HNGA 4Q34A 1K68A 2B2XA 1F0KA 3U7GA 4MPDA 1YI0A 1QCZA 4RSMA 1UQRA 3DL2A 3UOAB 1H2ZA 4NSNA 4X0EA 2VBTA 1BWSA 3FTQA 4KN5A 4A0FA 1RKUA 4TQUS 2C95A 2RHGB 3A6EA 4KAXA 5A0TA 4QJIA 3UT0A 2ZZGA 3YASA 4OH1A 1U0JA 4MAAA 4ZREA 2WF6A 3F6SA 4OU4A 4JXXA 4DNTB 3VDQA 2CL6X 2HWUA 2XSZA 2JGDB 1VDZA 3NHPA 3SR4A 1E98A 4PLCA 1XF1A 3MJFA 3TN7A 4Z6KA 2X5KO 4F4FA 1EVJA 1XFDA 1Y8QA 4YECA 5JQGA 1RM5A 4MV0A 5SZKB 3HDHA 2ZROA 1RLTA 4YRNA 2O48X 1U63A 1ENPA 1VSQA 2WA2A 3VAZA 2ONJA 4B0PA 3WLHA 4KL8S 4U5QA 2MYPA 2H2IA 3COZA 2RHWA 2VN8A 3VI3B 4BVFA 3U5TA 3F46A 1TYBE 1HE8B 4J16A 1L5FA 1Y42X 1Y6QA 3QVGB 4QPPA 1DKPA 1JIVA 4L5CA 3VM6A 1XMXA 1V8FA 2VG8A 1YVRA 4KR0A 2PAFA 3K31A 5HZKA 3O3CA 4TN5A 4LGYA 1EK0A 3UB4A 1FUKA 1RJDA 3WWOA 3VOAA 3Q2KA 1L5WA 2WK1A 4EOGA 2FEOA 4QO7A 1MOSA 1V5VA 1IK4A 3E6AA 4I9FA 5HBRA 3UMBA 4B75A 1PR6A 1SIWA 1E3WA 1OAOC 5EGSA 5DBIA 4OBXA 3GL9A 1T5BA 2HU5A 7AT1A 1R66A 3SXPA 2RAUA 3CTPA 2CXQA 1Q6ZA 4MW2A 1H3FA 1X77A 3KWFA 1C2TA 2QA4B 4H31A 3UYKA 4ARSA 3E03A 3I64A 1WRBA 1YJXA 3OKPA 4MO9A 3P0JA 4F3CA 4DV6B 3UBTA 1A8PA 1Z6TA 3PVCA 3PXCX 4LZPA 4BU1A 4Q9JA 2F17A 5F7OA 2DQ4A 1HI9A 2Z0MA 3E9YA 4NXNB 2G71A 2I87A 4HEA6 4JJ6A 3FM9A 3REGA 4HVCA 4DSOA 4NMHA 2IV2X 4OQDA 3H5OA 1BHO1 5KS2A 2IFTA 4GUDA 2CZQA 2D1SA 2FLVA 3OZXA 4C2UA 6ABPA 3I62A 3NTRA 1KU6A 1FYFA 1YOVA 3K6KA 4JKOA 4ZZ2A 4CNQA 4UCWA 5TJ9A 3LCJA 4AM8A 1PRYA 1T9BA 1U6KA 2JW5A 1DAHA 2Y93A 1P19A 2Z09A 3P5BA 1XTIA 3CZQA 5BYBA 4D8UA 2JLCA 4FIZA 3C7KA 9MHTA 1RHUA 3AVUA 1YA6A 4X7FA 2JK0A 1JI3A 3GFVA 4G86A 1M67A 4ZANA 1Y3FE 5IVIA 5TQ2A 5A2GA 4D26A 1GNQA 4KREA 1T0HB 2HPVA 1F2TA 2XEDA 3CVJA 3DULA 4HQLA 1BMFA 1K88A 2QV0A 3U4HA 5FNVA 3Q10A 2BPOA 3ZLTA 4JI6B 2WUEA 2OCLA 2XIQA 3VHLB 3W5SA 3AETB 1EX1A 4TKMA 2AKAB 4E5PA 1UK6A 3AOGA 4EPXA 4V1CA 3JQCA 4MLDA 4OBBA 5FRDA 4BY9E 3U60B 3KJHA 1M1KD 5HCIA 3PQ6A 1YXMA 2VEDA 1MB9A 2W2VA 1WMDA 3FR7A 1NNSA 4LHVA 1MC4A 1A4IA 3CY6A 3D6AA 4EABA 1FP4A 2SNIE 1R0RE 1JV2B 2MYNA 4QASA 2I33A 2PUTA 3EVCA 2VP5A 4EMTA 2YIJA 4PLFA 5AHWA 1I3CA 3JYHA 4LC0A 3G6EB 1DQPA 4ECAA 1UD2A 1THTA 3FR8A 1M75A 3L7JA 1QRSA 3AY7A 5EHZA 5AOAA 1FXWF 3THYA 2JHAA 3DONA 4RWZA 4QYTA 5IVKA 2JZNA 3GWZA 3LRXA 1W0JA 2P7HA 4QVKA 3E58A 3I8OA 2BISA 2Q50A 3GU3A 4G0ZA 4CDGA 1P0QA 3R6WA 1EUZA 5I4KA 4UQOA 1DTWA 3VGJA 1O5OA 1ONPA 4LTDA 3IAM1 2ES4A 4IHJA 4QUJA 1T9KA 5JAZA 1K28D 2HU7A 1MU0A 1WETA 4G7XA 1G17A 3ZW7A 2AOTB 4YR7A 3ONWA 5AKHA 3DDZX 2YFKA 3KPUA 2MR6A 1BXGA 1YE5A 3BSSA 3OIYA 3TQQA 4CL3A 4DVJA 2H3HA 4DSAA 5JZSA 2IX3A 1P9NA 4ZCIA 1UT8A 4FYMA 3RF6A 1PFVA 2R68A 5F2NA 3LKVA 3CRVA 4C0XA 3VTKA 1M6VB 3U37A 4YCDA 1QIFA 3ASVA 4IZIA 5AIBA 3H94A 2UZIR 2GKSA 1E62A 2CEAA 2OXFA 2Z95A 4YT5A 2JFOA 2ZWIA 5HF6A 3HTXA 1EAYA 3C5EA 1M2OB 3UN1A 5DYTA 3B5IA 4GYYA 1T2FA 5HIIA 3QG1A 5F7ZA 4GYJA 3PX7A 3ZCSA 3C3EA 1CZRA 1DIOB 1DZ3A 2XF2A 3R24A 1N5LA 2QR2A 3FMIA 5F33A 3RT9A 5C32A 5LPNA 2Y8EA 2IIBA 3EQ6A 3FI9A 4FMDF 4BMDA 3BE6A 4K6FA 5BVGB 2X8JA 1PTJA 3N0WA 3AW8A 1NONA 2HSDA 2JNWA 5HF9A 3CC7B 2Y66A 4B3BA 5HX7A 3R9WA 3T1TA 1PJSA 3ZVMA 2DBRA 4MH0R 1DC6A 2J5QA 1ZJ5A 3H2HA 1ZESA 1MPXA 1QWOA 2L82A 5GGYA 1LF5A 2VYFA 3LX6A 1M2EA 1I0ZA 3IVMA 4NENB 1XVIA 4R8VA 4S2UA 1HDIA 4FHCA 2O6HA 5DNYB 4EGSA 3RC7A 4GRAA 5JZVA 1WV1A 2E6KA 4B6SA 2ZJ5A 1NZDA 2QM3A 3I1FA 4P32A 4TT3D 1RR6A 1H4SA 4MA4A 1AHHA 1DEHA 2RHDA 4FEGA 2G72A 2VXYA 4QPNA 1PJ3A 1NMSA 5K51A 2ZBUA 3SZUA 4ZGGA 4X6LA 1NB9A 1KBZA 2HXSA 4AURA 2VJMA 5L3RA 4LRXA 5AT1A 4ZOQI 4UU8A 1WV0A 4LC1A 4X1IB 1R6TA 1FLVA 1LJUA 2XUGA 3SE0A 5I7VA 1RC8A 4B3RB 3M5CA 2AEFA 1H3EA 4IUBS 2FXVA 2G4CA 2DIEA 3ELUA 3NANA 5JWHA 1QO7A 3OOYA 1JB9A 1OHHA 4X91A 3HLYA 1NNUA 3R9KA 1X15A 2R1UA 4X41A 4E0BA 1TVEA 1Y1PA 2DBYA 4RDKA 2AN1A 2HADA 3FCYA 1FJGB 1K7YA 1GTVA 1WKVA 3KQQA 2Q9BA 2JHGA 3RKSA 1M2VA 4M0FA 3R9XB 2G0NA 3O31A 2C4NA 4D74A 4I14A 3JVIA 4CT5A 2DERA 1Z07A 1LSOA 4F1KA 4TVKA 1VM6A 1OZFA 3KU4A 4QA9A 2Z4TA 1U2RA 1P39A 4X00A 5IT4A 3W6NA 3ZZ0A 2D0IA 2QWXA 1XQWA 4PLWA 5CFOA 3EZ7A 1T1EA 5FTJA 1RC1A 2QAGA 4MGZR 4Y2QA 3ROQA 3CTAA 3TNDA 3U61B 3G5UA 2YIMA 4OOFA 4RANA 4WBNA 1PNOA 3G5TA 2Z1DA 1RD4A 2FN4A 5LYJA 3WICA 4A8JA 1QUFA 3DBRB 1NJID 3BHJA 3PHLA 4MRAA 3ZE9A 2R4TA 4HLNA 4KOAA 4DLAA 3A2LA 1V2GA 4OYHA 4NBRA 2QTCA 3DTVA 2XNSA 1II0A 3B1YA 4HLCA 4P3XA 3THWA 4CM9D 3RUCA 2OQIA 4RFSA 2O07A 5J2UB 4DS3A 1FMJA 1C29B 1PJ8A 1W25A 2QT0A 4URWR 721PA 3WK5A 1DRWA 2I7CA 3DO6A 3DP7A 2QGZA 3GJSA 4B17A 3IRUA 4ESOA 2F64A 1NATA 2Q7XA 1SUSA 4X92A 4KQXA 3ZLBA 3GUHA 4R69A 3VMMA 1DAIA 1SB8A 4G37A 4GX5A 5DV9A 3PLAE 1L5HB 3VPXA 5B7QA 6YASA 1M6EX 1XJCA 3JD3A 2OENG 3LQYA 2A9RA 1I7SB 1MGPA 4QYXA 4KLCA 4ZYYA 5CM9C 2VAWA 1SXJA 3PNMA 4CQJA 2JCGA 2JFWA 1XDZA 2ZTVA 4XB1A 1N34B 2QX7A 1BXKA 2ZQZA 1FU8A 1M1NB 3L3BA 5H3CA 3VHXB 2E4ZA 2ZJAA 1JHAA 4RY2A 1YX2A 1V9SA 4AZ3B 2E5WA 2GAOA 1CF4A 2GZ2A 5SYAA 2IOQA 5J1TB 3ANYB 3PFIA 5M3BA 3EVZA 3IYLW 4UZEA 4EG1A 2XUOA 2NUPA 3O2QB 3D8TA 2Z8XA 3Q39A 1Z0JA 1V7QA 4I9GA 5EHXA 1GTZA 1GVNB 2HKIA 3OMWA 2PY6A 1N0HA 5EZYF 3TJRA 3ZHTA 1IE3A 4W4TA 5B3KA 4CKZA 4V0OA 4IRXA 1CY6A 1A9XB 3K0BA 3TK1A 2RK4A 5GWXA 4GKBA 4E13A 5AW0A 1NYQA 4OHBA 1VBMA 2Z6BD 1Z36A 1UXGA 1S72B 1Y82A 2XB6A 5FPHA 3WYCA 1UPTA 3P0FA 3OOSA 1Q0UA 3EH1A 4ZV7A 4O0MA 1MAVA 4YUXA 2JFXA 2EYQA 4PU0A 3CUTA 4G0NA 1T3LA 4Y6PA 5EZSA 4W8OA 2H08A 4II7A 5AVRA 5BSUA 2Z6UA 4EG3A 4AVZA 4GI1A 3P2IA 4DUGA 2R6DA 1F5SA 1KDRA 3MCWA 4OFWA 1GQQA 4I1PA 1NQWA 2BGMA 3M8KA 4Z53A 2V45A 2IE0A 2QRHA 1ZOSA 5U9CA 3KQVA 4PAGA 1JMKC 2PNFA 1E2MA 3COVA 4L5BA 5GINE 3B6ZA 3V7YA 1YDFA 3AKZA 3B70A 4JHXA 1N6RA 1XZEA 1EHYA 2IITA 1IPHA 3PQ8A 4R9VA 4ZT6A 3OICA 3RSZA 3SS9X 3ZLJA 2W6IA 2G08A 1M0SA 3TF5A 1ZU5A 4U2KA 1YR3A 3VVCA 4A1FA 5JD3A 1QKIA 2W98A 3BJZA 1YCFA 1TQ4A 2A0UA 2WMNB 2YMPA 1HLFA 3JRNA 5JO9A 3OZRA 4PZDA 4UW9A 2QQEA 5I7EA 1VHJA 1O2DA 5JZOA 2VSFA 4O1IA 3DMHA 2A33A 5K0TA 3WGMA 1Y5NA 3OY2A 3TAHA 4F9EA 2CSUA 1J0AA 3WV5A 2ODBA 1ZONA 3RO7A 2V6BA 2CEKA 2OGSA 4X9XA 4CM4A 2Y6VA 1IVSA 1FBTA 3WKAA 1D03A 1JZSA 4B3XA 3GRCA 3NIBA 2P2LA 2H4JA 4AXBA 1EM8A 2COUA 3EGDA 2DPHA 4NMWA 5IM5A 3PR3A 5BN1A 5EWLB 5JNRA 5CBPB 5IUKC 2GVZC 1HZEA 1TOAA 4JCOA 1EJBA 1KFCB 2X1HA 4KV9A 4K9PA 2B98A 2ZRAA 4QTXA 4B8WA 4A16A 4OOXA 1Y5RA 4YQFA 4HNVA 5JJKA 2TMGA 1Y1QA 1JDVA 3GLUA 3F6RA 5DRTA 4D6XA 2GD6A 2ODTX 1V3VA 2PBRA 4LDAA 4IQ8A 1P6XA 4J3NA 3ICEA 1I6MA 3E7PA 1YQXA 2KW5A 3PD7A 4PPNA 4X6UA 4CUKA 3FX2A 1NSYA 4DV2B 1ZQ1A 1H85A 4KMSA 3DWFA 2DETA 1NBOA 4E15A 4MX8A 1JHQA 2IHUA 2WSMA 3UICA 3I6YA 3B1VA 4NXMB 1GY8A 1P81A 3Q8XB 4HAUA 4PM4A 1YBVA 2M6KA 5EP4A 3RVSA 4TYYA 4F56A 4RDXA 1ISFA 1E4EA 2C0CA 3IQWA 4A03A 4IIJF 1TCAA 2HA7A 5HILA 4BNDB 5IKMA 5C34B 4FDLA 2PKRA 3EA5A 1N7IA 1UZUA 4TMYA 5IXYA 1A5ZA 4BP3A 2ID8A 4UM5A 3EXFB 4X6XA 1KFEB 3K9NA 4LVCA 2P91A 2XMQA 3CISA 2GRJA 3VR0A 4C78A 4CKEA 1NL3A 1ESCA 3BCRA 3RS7A 1DDOA 5LP6F 3BD7A 1JE0A 4U2BA 2XRZA 3T12A 4PSCA 4NOLA 1EXNA 2FPPA 3FPPA 4WXYB 4JNCA 5K6AA 4GQNA 1L5KA 5KQLA 4AZSA 5AJYA 3HZZA 1NN1A 4HDNA 2VYVD 3PXBA 1H8EA 3CEMA 1U2GA 3CN9A 4LNAA 4MR8B 5LCXA 5KYUA 3ZJ4A 4YT4A 2OFPA 2WE7A 4PX2A 1OH5A 4HKTA 2ZB2A 1QDUA 4MV1A 4HAWA 4MZXA 1FPQA 1VMAA 4EHKA 4J03A 4ZWNA 1KTIA 2Y1XA 5EIFA 1E2KA 4B8YA 4DIEA 1OWLA 5DMXA 4XR6A 2P2YA 2O3JA 3LUBA 4MV6A 3LA8A 4PYNA 5FBKA 3A6PC 5EMJA 4NULA 2WJ4A 4R3UC 1FYWA 2NAFA 4EMSA 2DPMA 1DCFA 4BU0A 3AVTA 3RVRA 4GLJA 3ZE6A 4F8JA 2F8LA 2WVAA 4LRQA 4Z0HO 3FTEA 3BFKA 3NU1A 4GZ5A 3DVRX 1XMVA 3RJ9A 2J0VA 3CUKA 1DBPA 1E6LA 1XGKA 5T57A 1X6VA 3PJEA 1LC3A 1ZD8A 2B4KA 2ILTA 3PQ3A 5LU9A 1ZD9A 4UREA 3HU1A 1N5OX 2BFPA 5CT5A 4A6PA 5F35A 3KB8A 2NT3A 3C87A 3O8CA 1CVRA 5IVHA 1U7WA 2IXFA 4QGHA 3LI2A 1CETA 4KKVA 4ZT3A 4DXAA 4YRFA 4Z86A 1SC9A 2J9XB 3L6BA 1W85A 4FYXA 3U13A 5KC9A 5CD9A 1DC4A 1JS1X 1A9QA 2WUVA 2WIGA 3CU5A 4KXWA 3ONNA 1JHMA 3QELA 2VJDA 4HWTA 1UXJA 3LWDA 4IKEA 3TLGB 3OLQA 1ZVKA 3ED5A 4G0OA 4XUEA 5ERXA 2FSIA 2QT1A 1LW7A 1B6SA 3HZHA 3KUUA 4HN9A 3NALA 4MYCA 1YJ8A 1VKNA 2FH5B 3AEUB 4D4IA 3KIPA 4QATA 2I34A 2WG1A 4WK6A 3VAAA 4Z2AA 1P2VA 1RE1A 1V8BA 2GEFA 2PX6A 3HBAA 4Z3DA 4CU2A 1P91A 4YRKA 3V4RA 1ZCZA 5KOIA 2PKWA 3FNQA 2PRIA 2D2EA 1BG6A 1T2NA 4FR0A 1MAAA 4RLQA 4C29A 5C8YF 5TQ2B 5JAPA 2XMRA 3O1IC 3EZ6A 1XPUA 1RXUA 3GRFA 1RU3A 1NAIA 4KQ9A 5LMNB 2CSXA 2DULA 1Y6ZA 1KQOA 3WP0A 3AU8A 3BRCA 4LHWA 1QIHA 2IXBA 1PJRA 4GI5A 1OB0A 3LPMA 1PQPA 5AI9A 1I3MA 2FFJA 1I1OA 2JFBA 4TZKA 3E5HA 3B5EA 1OILA 3K9HA 3K9CA 5IMBA 3IVRA 2I2FA 1WBJB 2PRYA 4ARVA 4QJBA 3ONYA 1EM6A 4U39A 4D3XA 1J33A 4EHDA 4WZAE 1IL0A 2OCKA 1YOBA 5DN9A 1E8MA 2VQSA 4WLVA 4D41A 2X6TA 3OQIA 4DA9A 5FBQB 3JSXA 4EL5A 5HJ5A 1KYVA 2I3GA 4KWHA 4LJ9A 4D4GA 2JCXA 4K3VA 1HYQA 2JASA 1G98A 4FFSA 3UJ6A 5B2FA 1TO6A 3LBHA 1QCCA 4ID9A 4QGFA 3LPAA 4XH9B 2OBSA 4FNAA 3RCBA 4EW3A 2WWHA 4GOOD 4ER5A 3Q1KA 4IIDA 1TLFA 1SKUA 2EX0A 3F97A 1G5IA 3QLEA 3KS9A 2FLWA 2AYXA 1DTWB 2LKCA 1Y8RB 1MO2A 3MELA 5ER6A 4IHJB 2XPCA 2MSNA 1V11A 4J4TA 1RYDA 1A95A 4HH4A 4RY9A 5G3ZA 4G26A 1WXFA 1CVLA 1I6WA 1ODLA 1QZUA 1F20A 3OOEA 5CFQA 2PH5A 1QVWA 1YTLA 4DMLA 1BX3A 1CCWA 4U4AA 4GXQA 1HT3A 2W2MA 3OLWA 3PXAA 5KNDA 4EI7A 2QG6A 4YCJA 3GAFA 1ODSA 1U0OC 1VIDA 2IDZA 5FF9A 5A7HA 3ZD9A 4GAEA 2WAMA 2JLBA 3ZDAA 4RHUA 3RBXA 3B8HA 1U4NA 5IUNC 2OAQ1 2X9VA 2NZUG 1NR1A 4Q9KA 4C88A 4E46A 4ZVMA 2H7XA 1IQUA 4ER6A 1RRGA 1H23A 2C3MA 2P4SA 4RM2A 4ECEA 4F9GA 4J6EA 1M34E 4D9FA 4LOAA 1LQ2A 5E2AA 1NVEA 1UD8A 1HDOA 2AEMA 5FDFA 5ICSA 3HCEA 4Y9DA 1X1CA 1P44A 4OJQA 5LLDA 1WCV1 2XT9A 3NM5A 3T7AA 4TMZA 2FP4A 4OAPA 1GQRA 5KX5A 3R6KA 3S5UA 1NT4A 4AUEA 3NX4A 4LMBA 1RRPA 3HA3A 4LOKA 4PICA 3COWA 5DN6A 4U2FA 2ZB4A 3E0QA 3KXDA 3NT2A 3QOFA 4AJPA 5BOSA 4GGPA 4DIBA 4EUHA 1KEVA 4ZFNA 3GUCA 5BQXA 1K9SA 2OV1A 1I18A 2I3AA 2I54A 1I9GA 3DXFA 4JP1A 4Y9SA 4DV7B 1X8XA 1CRWG 3S3TA 3S6JA 3INRA 1D1NA 1I2AA 4JMLA 3IJEB 3QVJA 1W59A 1GYPA 1OT5A 3K09C 3QYFA 3I2HA 1UD6A 1JALA 2J0QA 3UWMA 2AG6A 3FKSA 2BFDB 1YS4A 1GGJA 2QW1A 1U2PA 3CRNA 3NG1A 1OIVA 3MS2A 4IL5A 4QAQA 4NYMQ 1C0PA 2BTQA 3RWOA 5AJTA 3T4EA 1AMNA 5FR1A 4TTPA 3HN6A 3KPYA 2GM9A 1ZL0A 2WINI 4Z99A 3IL2A 3CKKA 5GVRA 2I4TA 2DP4E 3G9ZA 2AHOA 4NG4A 2ZVQX 3KJFA 4HNHA 2ZIFA 2HSGA 4K6KA 4I3HA 2JLVA 2FG6C 1G2IA 4D8WA 1OH7A 4K7JA 1LPAB 4NAVA 3VKHA 1ZD2P 4QJ4A 2H52A 3CNLA 4D4JA 2FQXA 2R5NA 3P96A 5TIIA 2IS2A 1JG7A 2CYCA 2G6BA 2FW7A 2HCFA 3ZLVA 3D5QA 1OZAA 2AF4C 3FPEA 4ZI7B 2H4XA 4YLGA 3QE4A 4FIDA 3TM5A 3WRVA 3V8NA 4HAVA 3BICA 3UPTA 4JKIA 1KQSB 4JK3A 2JCVA 5JAMA 3F49S 4L5JA 5HFAA 2CVFA 2DTEA 4PN7A 4YEJA 4NFLA 1WOMA 2IEIA 3DHWC 4KHZA 1O0BA 3HDGA 1IBMB 3GGDA 3KT3A 2JIPA 4ILEA 5K0GA 1L1EA 3AJ9A 1SM4A 3CH5A 2C82A 3L6UA 3EPPA 2B94A 4RPCA 2F1LA 2IPXA 4P2NA 1GAEO 4PC6A 2H7CA 3AJEA 3MRTA 4K86A 1NMEA 3G0GA 4WT7A 2RHBA 4MPPA 1OR8A 3DMYA 4RZSA 1JXMA 3TFOA 1XDSA 2DJIA 5J3JA 3Q8KA 5FV4A 5A6VA 4JLJA 4ZCPA 4XJXA 2XHEA 4RDLA 1Z45A 4IO0A 3QMWA 4JEHA 3JQAD 1KI6B 3L0BA 4PO9A 5F78A 2BFFB 4R7TA 4RFSB 1DIHA 2ZI3A 1SHZA 3LU1A 3PDHA 5DYNA 2WD7B 1CNMA 3RS2A 1OV6A 1V1MB 3OPYB 4FCWA 5BY2A 4URXR 2FV8A 5AVZA 3W6OA 2D13A 2VRBA 3NTUA 1SZPA 3PQCA 1OGJA 1KSHA 3ESRA 5I6DA 3NASA 2WZBA 1UBNA 2AOUA 4R6XA 5JNWA 1SXPA 1Q11A 2Y77A 2AV6A 3KKQA 2IHYA 3WK4A 3VU0A 3LSYA 2P4UA 2VXOA 4TTIA 4QJ3A 2WU0A 4RVCA 4BOYA 4DREA 4C20A 3CR8A 3U9TA 1JG4A 3MWGA 2O8VA 3HVIA 2Q7OE 3NCHA 2VH5R 2BAGA 2FA9A 4WI1A 2ZTMA 4AJ1A 5KTYA 3B2NA 3PHCA 4L4XA 4OI1A 1IDN1 2R44A 1IM5A 4G23A 4H0FA 4C06A 3SCZA 2RBEA 1FP7A 3EPRA 5ELLA 1N3BA 3FTNA 4GQIA 2KI5A 3ZEAA 3ZY3A 1HK7A 1KY2A 2B1QA 4S1VA 2Q5HA 2SCUA 2L19A 3BORA 5IKEA 4MUKA 3MCUA 1L4LA 1R0KA 1UWCA 2M6RA 2PLNA 3JRWA 4DDKA 5DMHA 5H81A 3R20A 1KEZA 5JWOA 1VLYA 4Y9RA 3B3JA 3OWHA 4N3NA 4IOJA 1K0UA 3QFFA 2XB9A 3OA2A 3QVSA 4D4HA 4A36A 5ALDA 3OP4A 1XG5A 4HWSA 2AUNA 3TW4A 2OV6A 4RGYA 1U31A 2OECA 3AP1A 3E9MA 2MCFA 5KWVA 2OMEA 3ZQ6A 4Z9BA 4IDGA 4ZI5A 4Q12A 2ZZQA 1K66A 4B2YA 4ML3A 1YLOA 1SVOA 1DWQA 3BHIA 4QRDA 4TV9A 3NO4A 1SBHA 3L0OA 2HMTA 1D1QA 3UK7A 3TS1A 4D2IA 3M5PA 1LLFA 1TMKA 1WSBA 2J5XA 1KP9A 4O1HA 5EE5B 3UMRA 5BNTA 2H1OA 2OAGA 2X7JA 3TOSA 1TU0A 2IX9A 1CB0A 3ZR4B 3ZIAA 1NR5A 4IEIA 1DO0A 4PLPA 3CNBA 2PMBA 3AFOA 3R44A 1WORA 1XAJA 1U3GA 4JH0A 4GX1A 2H63A 2EVWX 4YO7A 5A3SA 5D5QA 1H05A 2W6MA 3BRWD 3VYWA 2ZUDA 2J85A 1C4WA 3S2GA 3NEAA 4N40A 3A1TA 2ZJOA 4IXDA 1A2QA 1QLJA 1E4VA 2RHTA 3MTJA 4HCJA 2DFDA 4M1TA 4LMPA 4Q19A 4QUAA 4AMBA 1X86B 3W8DA 3OCJA 3JALA 4PXYA 5KCMA 2C2KA 5H82A 1JJ2B 4NEQA 1PDOA 4OJNA 2ZJ1A 4NDAA 3SZOA 2DG2A 1ARZA 3A27A 1YE8A 3IUQA 2PT9A 2VTKA 3KTDA 3MOGA 2MHCA 3CZMA 3HRIA 5EE1A 2ZK7A 1Y5IA 4PYIA 3DDSA 3UXEA 1UXKA 4CKCB 4WK2B 4HXFB 3EIFA 3G6KA 2IYVA 1U11A 5EJ9A 1RJGA 2P6MA 4JLKA 1OIXA 1R2QA 1SPXA 2K6GA 4B2LA 2G07A 3RRBA 5E7MA 2XGJA 5AVQA 1BXZA 4Q3DA 4EKDA 3GFGA 2VP9A 4MARA 3BTSA 2VQDA 4MRVA 1R4ZA 4O33A 2ODWA 4EI8A 1A8IA 3GXBA 1I7LA 3G9XA 1WUJS 1SC6A 3LBYA 2AN9A 4UQPA 2C2BA 2B8WA 4RORA 4YAOA 2FF5A 2O3QA 4N5NA 3C1TA 1P1CA 4KJXA 3S1AB 4ZQFA 1E6WA 4RGQA 5CT4A 3NGXA 2VNIA 2FEAA 5CLHA 3SSOA 4YRDA 5KSPA 4HB4A 4FOOA 5DFAA 5BUSA 1JSCA 1WY5A 2V4MA 3WBKA 3UW3A 2VPWA 3JU3A 1BMTA 3MTAA 4FT2A 2PUDA 2RDMA 2BLLA 3CNNA 3HHEA 4XPIA 3OW7A 1VFPA 2CLKB 1NLYA 1VB5A 4U1RA 1QWSA 4YRIA 3F5QA 5LQCA 4WJLA 4B3DA 4FWTA 3KYJB 3D5EA 1PW7A 2ZPAA 3AR3A 1IUPA 2VBGA 4UUAA 4YLYA 4IG4A 3TIIA 3V5NA 1H0RA 3NYRA 4L2IB 4FYIA 1H2HA 2P9CA 1SGWA 5D1NA 1KY3A 1XQ1A 1F38A 1DBWA 3BG5A 2R9VA 3HPQA 2WYRA 1X8KA 5EESA 3GFTA 5AK0A 2GESA 3PRJA 4LW8A 3S7ZA 1EP1B 3NIWA 1XCOA 1MO5A 2KYRA 5BSHA 4RVOA 2ESRA 1PKXA 1W75A 4Q02A 2BE7A 3FMFA 4J1SA 1JEJA 4MKZA 4RENA 1HL7A 1B0ZA 4H27A 1ISGA 3OJWA 2GLUA 4BGDA 5IANA 3TW6A 2XKBA 1WR8A 4Z3OA 4NV1A 4X07A 1EDBA 1KPIA 2P2SA 4H1HA 4C7OB 3GXOA 2CHUA 2FFHA 1O9GA 1PL6A 3GP3A 2JIOA 4G1FA 4M88A 4DBZA 2XADA 2OXTA 1YB6A 3JS5A 1W9HA 2RMKA 5HIMA 2DXIA 1YKSA 1SUAA 1SG0A 1A97A 2L17A 3PGVA 2IYXA 1T5DX 4JUDX 4H7FA 1QPBA 3PDIB 3DFIA 5FOVA 3AKYA 4LRTB 4CN8A 2NO6A 1GKIA 1ZM9A 1JKMA 1Q3TA 1RLJA 2VK2A 4XNFA 3AF5A 3GEEA 3IGFA 3LE8A 2F1IA 2IYYA 1EFCA 4OREX 4UM9D 4BJ6A 2XVXA 4U7GA 8GPBA 3AZOA 1O1YA 3E1SA 4IXTA 3VPFA 1SCJA 2B92A 2VXBA 5EIWA 4PCAA 3G8BA 3FTDA 4IIXA 4LJ6A 4DLSA 1T1RA 4OI0A 4QIHA 2PWZA 1C7EA 2EW1A 3GJ8A 3L7LA 1AKWA 1XRJA 3IE1A 1D1PA 4OA8A 5MGBA 3CWZA 1T4GA 1FP2A 2Z30A 5H0IA 2ACEA 1E1RD 3WNBA 4OOSA 1NV8A 3W3AH 3I5AA 1V8PA 2YW2A 2RCNA 1CZHA 1UBKS 3AXSA 1NI5A 4RJLA 1YCGA 4G5GA 2Q2WA 5LNK1 3LUFA 3C6BA 3HAGA 1YB2A 4EF6A 5EERA 1TZ2A 3MPOA 2FPGB 3GJ5A 2OHVA 4FB5A 4MP3A 1OU0A 1P29A 4P53A 5D2CA 4ZTZB 2CNKA 4XIFA 4W5QA 3V8PA 2FSGA 3W6UA 1PLJA 3RE1A 1OWPA 1MAUA 1LLCA 1RQ2A 3FDFA 2JCSA 2JHFA 3OEWA 4WSOA 4S04A 2GPWA 4ZVOA 4C1BA 4ER3A 5BR4A 4OJMX 5AYVA 4TLEA 3SBDA 3L40A 1ZJ4A 4A2WA 3CX6A 5U1PA 3HWRA 2LP4Y 2DPGA 4QNRA 3REOA 4CG1A 4EMBA 1R9JA 4OKNA 1BH2A 4F5WA 2XNCA 5D3MA 4WEQA 3V7UA 2XWPA 3ILXA 4FP9A 4C21A 4CYMA 5CT8A 3B3QA 4R8RA 4MWZA 1CS4C 1Q7TA 1WULS 5AM4A 3RGWS 4BFCA 5KKNB 4IFBA 3BL8A 1Z4QA 3BCUA 2H7YA 3HY4A 1N25A 1JJAA 5KWEA 1PT9A 3R5XA 4O02B 1I7QB 3QNMA 4ZV9A 4HXGA 2XR1A 1Q14A 2GPNA 1NRKA 1ZWKA 3H2JA 4LJLA 4XYEA 4MRSA 5E9JA 2RAFA 1UOEA 1ISMA 4K6OA 1E43A 1MEEA 4RAOA 4U7WA 1YA8A 3WHLA 1M2HA 1QH8B 1Y8RA 4PTZA 3DAYA 3R5TA 4ZZ0A 4K9SA 4IDBA 1VXRA 4DPKA 4G0MA 2AZ4A 3DEYX 2ZS8A 1D2EA 3L6EA 2K4MA 4ZPJA 4JI1B 5L4SA 2R96A 4Y6SA 2BLNA 3KLMX 3OD1A 2F1JA 3ZV4A 1ADGA 3GRKA 5HJ2A 1NJFA 4KGVA 4WZLA 2CB0A 3N6RA 3EQ7A 4HY3A 2WQ6A 1H5UA 3GJ4A 5LYJF 2ZBDA 1QJCA 3GLGB 4CIVA 4KITB 5FB3A 3VGPA 1WLSA 2HGSA 1N6KA 2WILA 2YINC 3T1VA 3ELWA 3FSEA 5EIXA 2BTEA 4BMYA 5HVNA 5KYWA 1CLUA 4OATA 3U49A 1U0TA 4UUOA 3W90A 4C01A 4R2MA 3WB9A 3K2EA 1REQB 1UMBA 3D1JA 2ZZMA 2YFQA 4PZPA 3JVEA 3ZV7A 3RYCB 4IY1A 4MRMA 4JY7A 2X1LA 2HWKA 5IFKA 2O54A 2JJ2A 3NOVA 5LB2A 3CMEB 4LC9A 4KN6A 5BP7A 2HRQA 3DWGA 3EQZA 4GOJA 1P0MA 5ERYA 4I4CA 4HX5A 5JMWA 2FPUA 2ZKLA 2YIDA 4S1PA 1DRUA 5IF3A 3ID6C 3VRHA 1F0YA 4QUIA 1QP4A 1M90D 1V0JA 1IWOA 1E2IA 1P9LA 2V7QA 2RONA 2VCYA 2BKLA 4H16A 5G02A 4G9EA 3RNOA 1GQSA 5BV0A 5L7YA 1C1YA 1B2LA 3AR2A 3FCXA 2H5LA 3EC7A 3BFXA 3Q7TA 4OHMA 1TEVA 1B3RA 1FE8A 4K46A 4I50F 2FR8C 1EWKA 5BOSB 1NX9A 1Z38A 1ZC3A 3RIMA 2YN0A 5D3KA 1HG1A 2XE7A 4O5AA 4EZEA 1ZM2A 1A1SA 2PSHA 2W6JD 3DLIA 5C9ZA 2ZXHA 1GILA 2JBWA 4K1LA 1R4NB 3AEZA 1AQYA 2FN3A 2AFHE 2Z5GA 1Q83A 1IOVA 3GLFA 3OBIA 3TMYA 2QRKA 1UPAA 2VP3A 4LSZA 2WWFA 5BRAA 1A7KA 5EUBA 2EFGA 5JZMA 3JZMA 2D1FA 3TI9A 4DLYA 1WMAA 3MUEA 1WXWA 3CIFA 1G3QA 1HOTA 2Q8QA 3JQBA 4KQ1A 4QFBA 3GLIA 1FMCA 4DJTA 5HP4A 1ZA2A 3HCWA 4TROA 4KHPB 1GGMA 5FO0A 5CU7A 1AC5A 4JBLA 5DLPA 3NHMA 2CT8A 1H66A 4W5WA 1EDDA 5LM3A 3PJGA 3QEAZ 3L2OB 4FYWA 4TVSA 3ADDA 1G5TA 1GZ4A 1T6YA 2ZUEA 1IN6A 2WUFA 1J9EA 1BXRA 2M9MA 4RK6A 2CFRA 3RTEA 3P0IA 4ZI7A 5KYYB 1CYDA 2ZTLA 4RKQA 5EP1A 3EVTA 2ZYGA 3WG9A 2W83A 2IIPA 5CM2Z 1PWZA 4XM2A 5JNLA 1RTTA 1X7XA 1MABA 2XXBA 3C7CB 4KKUA 3UHOA 4CG0A 5AW2A 3HK2A 2X9QA 1UAGA 2QYTA 4CCYB 4DIMA 5K8CA 4UNQA 4WZZA 2HUNA 1R10A 3MGCA 5BV7A 4GP9A 3P71T 3R7WA 2HPZA 3OFSA 5CDHA 3MRXA 3KETA 1WW2A 1RRKA 3STWA 1E77A 3PYXA 4JBHA 4A15A 2WIFA 3AUTA 2X77A 2IDKA 3R6LA 2XBLA 2B69A 1OYOA 4L4YA 1EG2A 5FA5A 1X14A 5MHTA 1BZYA 3GFOA 4WESA 3G0DA 4S1NA 5J5AA 5TY0A 1SUDA 2EFJA 2IUEA 3EFHA 3GZNB 3PUZA 4R0NA 5ICMA 4Z4GA 3R77A 4BNIA 4LGVA 1KC1A 8LDHA 4POOA 4AY2A 2WJIA 3TE7A 1KI6A 2P40A 2P68A 2X9GA 3IBFA 2CXPA 1PIWA 5D85A 3QE2A 2Q6VA 2PMDA 2WD7A 1KTVA 1W44A 3GRZA 2P90A 1J8MF 1V1MA 3RYHA 1AK1A 3DOJA 3OCZA 4QOEA 4DLXA 5ITVA 1NFFA 3QMPA 1ZHHA 2IF2A 2BJVA 3G0BA 4WLOA 1G4HA 2AOUB 5E4YA 5KDOA 3JQDA 3K1YA 2JGMA 3BVPA 1EZ1A 4ZYUA 3GPCA 4JLMA 4CLXA 4Z4TA 2EZUA 2R7AA 2HXGA 1RHQA 4P35A 2DUUA 3E4DA 1KZLA 3PPIA 3LTEA 3IAXA 4CETA 1Z4OA 3B6MA 2FPWA 1F6WA 4YELA 3SQWA 1J6UA 3BMOB 4ASUD 5TS2A 4N54A 1UKZA 4GIBA 5C3UA 1NW9B 1P1RA 2RE8A 1Z4LA 4R31A 1R0SA 1R18A 2C99A 1TC1A 3VDMA 2FK8A 1E66A 1B42A 2HC9A 4YP7A 2GFHA 3KTOA 3LD9A 3V42A 3VJLA 3MWYW 5BN3B 1BEZA 3U7JA 4E4RA 2EFEB 3QE3A 4CMIA 2C4VA 1AKRA 3BMCB 1LU9A 3IE2A 2IQ5A 3M6UA 4CKWB 1TK2A 3IIEA 5IT0A 4FHDA 4QLAA 2SKCA 4HDCA 4JL6A 4GWLA 1YZVA 3OFKA 2FJ0A 2IYOA 5IDXA 4JU8A 3FZNA 3HCAA 3DNMA 4KDEA 2YYYA 4LISA 5G1NA 1AMUA 3LX8A 2NZXA 1E3SA 1W5AA 5BVHA 1M1XB 3NI2A 1R0LA 4E08A 1A04A 1QOZA 4WIAA 3FVTA 1Z8FA 1B0PA 1TUEA 4LWZA 2GH1A 4P33A 5LZ8A 4TWJA 3TZ6A 5FNZA 3OQ1A 1I7PA 1FQWA 1L7BA 3DUFA 1N2ZA 1U90A 3TPFA 3L9WA 1G8SA 4V0LA 4BNWA 4EB6A 1VPDA 4JDUA 2D1RA 2BR4A 3MMNA 5EZYB 2QI9C 1Z75A 4INPA 4PPQA 5JVDA 1DRJA 1JTVA 3FWNA 4PHCA 1RAAA 4PCUA 4RQAA 2QPOA 1A9SA 3FOBA 4CCAA 4Q1EA 1EBFA 4Q3NA 2I62A 3PUYA 1WF3A 1SC1A 2BCEA 1DB3A 4C4XA 4XVUA 3TD6A 1P5RA 2QTRA 4BRWA 3C15C 4W82A 3QNWA 2EFHB 4LOJA 1PJ6A 1HDGO 4E21A 5BN5B 4EELA 1DWUA 3UKJA 4HZGA 1E7SA 1G3IA 1OX4A 3EDOA 1JX6A 4R2JA 2P8SA 2I6XA 3D7SA 5C37A 5JASA 3DLHA 1QNLA 4PCLA 5JZ9A 2JJQA 3LC2O 5HBGA 3HI6A 5H4GA 2Q5JA 1ZCBA 3QBTA 4PQRA 3PEUA 1VLVA 4W7IA 3TR0A 1DAGA 4AK9A 5JROA 2HRCA 5ALRA 3SZRA 5IJ0A 3HJFA 1C9KA 4EB3A 3N53A 2B20A 2GNPA 2NV6A 4PVDA 4ENVA 3OCVA 4MUYA 4TSFD 4YS6A 5KNDH 1EFPB 1LJ8A 4LF4B 3RD5A 2WPDD 3T0GA 1NJ5A 5J1SB 5FUQA 4MQ6A 3QF4A 2EKQA 1C14A 2Y1GA 4QBFA 4PO8A 2JGLA 2WE8A 4HWGA 4GZLA 1E6UA 3D4OA 2PA3A 1W9MA 2BC9A 2ZJ7A 1DKNA 2PKEA 1VJCA 3RV3A 4CODB 3T06B 1GCAA 3C8DA 2ATXA 4WZBE 1RYMA 4LY0A 3QJYA 1TI7A 3I2IA 3JRXA 4DEXA 3JQRA 5L3SB 5KZMB 4DNRB 3L0YA 1L9KA 4Q3BA 3DZFA 4ZVLA 2CF4A 4NU0A 3OLXA 4ZV4A 4XLZA 1ULUA 3SLNA 2IZ7A 1E3TA 4BKOA 1KKMA 1UJMA 3KFVA 4BO5A 3IAAA 5KNDD 5JWRA 2BF7A 2GD0A 1JEOA 4DHWA 2PM8A 1AZSC 1L5YA 3ROZA 1WHTB 2V3WA 4ICIA 1GQYA 2GCGA 2VA8A 2GTPA 3FYDA 4O2LA 1PNTA 3SHFA 2J87A 1I5EA 3UMSA 2CV2A 1PZNA 3F8SA 3D26A 5EXSA 3LT2A 4P92A 3QTLA 3UUFA 4JNKA 1YR9A 1EEXB 3IMFA 4ZDWA 2D7DA 3AR8A 3HBNA 3JQPA 4XORA 5BSYA 4M1OA 4RKRA 3X1WA 3VR3A 3V8QA 3PNKA 4J8PA 3ZOZA 2CL7X 5E95A 1VQLB 2G63A 5I48A 1IBKB 3KSUA 2VZLA 2XGSA 1XJ0A 4EQZA 3FPHA 1RPZA 4G85A 1QHNA 2W22A 1U0RA 3OX1A 5HRUA 5EN4A 2XECA 5J4KA 3CSUA 3GG9A 3UIEA 2R1TB 3OZIA 4S2EA 1IQRA 4Y7CA 1NA5A 2Q5LA 4YACA 1J99A 2Y76A 3IPYA 3RFCA 4A1OA 1CD5A 2FGKA 5A5DA 2CK3D 3I8XA 3KR2A 3BQMB 4JT8A 4Z9XA 4C7OA 3H1GA 1G9TA 1NVUQ 3K2QA 3O4FA 2AKEA 1XBTA 1MZVA 1BTOA 4CTKA 3FOCA 1KK2A 5DGIA 4EK9A 4GRDA 2MSLA 4HD8A 5JSZB 1P0IA 3BMNB 5H02A 5ILGA 1TA0A 1N6IA 1CUJA 3E22A 3RSSA 3TD9A 1GN9A 3R6JA 2G0AA 3KALA 3KWJA 1XLUA 2BDTA 4UOZA 3FOEC 1XZAA 3T1YB 2FW1A 1M2NA 1NVKA 3V3KA 4B4OA 4HT3B 5K3FA 4UCQA 1GZ3A 1S1MA 2DJ5A 2D0DA 3LQKA 1JFFA 2HMYB 1O7JA 3FYTA 3RS0A 5GTDA 3JR3A 3D9QX 3EEQA 3FNEA 1NVVR 2RARA 2JFHA 3OJXA 1ITZA 3BIWA 3GMDA 2YDYA 4CR8A 4Q4CA 2Q3JA 3O2NA 5AVXA 3LGAA 4AKIA 1CV2A 4HDOB 3FLEA 4RA9B 1RPTA 2AJBA 1I5OA 2DC1A 3T5DA 1V3UA 1B8UA 5F64A 2LZJA 3ZIDA 2NNLD 1PL7A 4KVFA 4YGYA 1XX6A 4R7GA 5GONF 3T51B 3USZA 4MB2A 4DBVO 1IXYA 4O0LA 3D3EA 3DTTA 1V48A 4I5DA 4KVGA 5DHFA 2EP7A 4GR9A 3R75A 3WSWA 2CXRA 4ZYLA 5L51A 3UJ3X 1X39A 2HMSA 1CZNA 4TM7A 2ZBPA 4RHFA 2GZAA 4AROA 2B35A 2X0JA 3J7AC 1JR2A 4RD0A 3O83A 2AKYA 4PGAA 2CLDX 1GA4A 2BFBB 4KFRA 1EK5A 1VJRA 4RBNA 3BK1A 4AL4A 4BX8A 3A58B 1D6JA 221PA 4MPTA 3NFRA 4CG3A 1UBJS 2Q3HA 2PT5A 2QD5A 3LUAA 5KAPA 4CIYA 1G5PA 4A8PA 3DDWA 2GBGA 3LQFA 4G89A 4I1YA 4J49A 4MA5A 5JXGA 2ZI5A 2FAXA 3KFXA 4C0LA 1OFTA 4FLFA 1S96A 1U1GA 1ZMRA 2PH7A 2C2HA 4LNUA 2KJQA 2Q0XA 4TT3A 1BEEA 2PQ2A 3H6HA 3N8HA 3Q2OA 1X1SA 1U65A 4UEJA 1RKXA 5KVVA 1KDPA 1D0SA 2XOKD 5EXEA 4BO8A 2AZDA 3RARA 1XB2A 1T2DA 1WG8A 1PG5A 2XQGA 1JVBA 1M0WA 1MJHA 1WDMA 4UFOA 4RZUA 3SYKA 4DLZA 5IULC 2VYND 2AUMA 2XRYA 4K3UA 4RL4A 2G1PA 4PC7A 5FX2A 4EHFA 1CXZA 3JAMA 3DFFA 3GFFA 1NJ8A 4BO1A 1NXOA 3ASRA 1RCTE 2H4HA 3R40A 4P54A 4RVNA 5IAOA 1EBBA 3ROKA 5HZGA 4MP8A 3T7KA 3P2JA 1O77A 1KD1D 1P4SA 3PC2A 1A50B 1NN5A 4MWEA 4FKMA 4GOXA 4HBZA 4G4SP 1DOHA 1W1WA 3A6KA 4RK7A 4AJNA 4PGFA 1RQRA 3FSGD 4DRYA 5L45A 2KBEA 3HXQA 2C29D 4C0WA 5JRZA 1LWNA 3P94A 4GOLD 1G6Q1 1SXGA 1S2GA 2VPIA 2X13A 4OJTA 3PRKE 4PXSA 5DBFA 2G40A 1A5SB 5LZ2A 1TEHA 2V9ZA 2DQYA 3EZGA 5CB4B 1MAWA 2APJA 2WYUA 4LDPA 3ZG6A 5AK6A 2WJPA 3ZXIA 5EIBC 4AJLA 1WMSA 2D8AA 3REFA 4EKYA 3THXB 3QU7A 3Q8MA 4OOEA 2JIZA 4MGHA 4P3NA 1EGHA 1TADA 2XLBA 5KOJA 2XZLA 1HA3A 4BC1A 2P3SA 3GUZA 1Q1BA 2Q4OA 1XTSA 4WRRA 1C9EA 4KQKA 1F1BA 1RZ3A 1E3ZA 1HZZC 1LBHA 1GKKA 4ROTA 3ROFA 1KMMA 1HTWA 4BMPB 2VVTA 3PQ2A 1J7JA 3TXAA 4E5SA 2GJRA 2ZRQA 3IQEA 4KVZA 3L1HA 3AVWA 3OM1A 4D0SA 2FFRA 1VIVA 4TN1A 1UPFA 2GUGA 2O0HA 1YMQA 2XD4A 3G17A 2NXWA 3MT7A 4IJ5A 4AMGA 4E32A 1NB0A 1KJZA 1ELOA 1CDDA 2VOEA 3B51X 4KWCA 3WOHA 3WGLA 1B3BA 1U9ZA 1WXXA 3JYPA 4BTVA 3EIQA 3HO1A 3CESA 1KXJA 2W2LD 3CGGA 2PN1A 3VTFA 1J21A 4EGQA 1XJQA 1U7DA 4B32A 4AMZA 5CXUA 2M5SA 5DDIP 2LZ0A 4HQRA 1FS5A 1VA5A 1O9HA 3F98A 3ED1A 4WACA 3ORRA 2Q41A 1NY6A 4IIYA 4DA0A 3L6DA 4Z7NB 3QEJA 1IVYA 3RIHA 3KBOA 1CFJA 2A5DA 3ROPA 3C1OA 4WJKB 5C8ZA 1A4UA 1JQEA 3E27A 4JQYA 4WDQA 3UV7A 3OQPA 5DYIA 3TZQA 5CYPA 3E2PA 5KWSA 3DEKA 1UM9B 4PAAA 2A58A 2QRPA 3H5VA 3KKZA 4KP7A 3OCYA 4H4CA 2OESA 3RUPA 3TUZC 3K4HA 1R4AA 3P97A 4CEJA 2UVQA 3H4VA 1V2HE 1L4BA 1ND5A 3G8CA 5CA0A 1KOGA 4Z4RA 4MRRA 1AHIA 1R0XA 2G1KA 2YVAA 3Q0EA 2OFOA 3L8EA 4WCVA 4QFDA 4F92B 2MJLA 1XZPA 1GPJA 3D54D 3MWDB 4URFA 1QGYA 1OXKB 2QM8A 4RQBA 1CEXA 3M33A 2W6JA 1IUNA 1S8NA 2ZI9A 3I9JA 1CF2O 3PB3A 1ONSA 5COAA 5AVOA 1KDVA 1A72A 2A5JA 2FSPA 4PYKA 3IOEA 1DXYA 4M22A 1LKZA 2XWBF 3MINB 3O92A 4JLPA 5ITSA 1Z0FA 1C0IA 3K5WA 5H1YA 5I4IA 1XXHA 3JX9A 1Z7BA 4RM3A 1ZOIA 2YJZA 3I58A 1IHMA 3DZCA 5F7XA 1A7UA 5KYYA 2D54A 1NWCA 1NOKA 3HVHA 4X05A 2C9ZA 2BEUA 5J5CA 1ZUIA 4KLRA 4FN4A 2WSBA 1EWRA 4GXNA 5HRAA 3RHTA 3QW4B 2EZ9A 3IALA 1VYUA 1YC5A 3BYZA 4RGVA 2OSBA 2DR3A 2ZAOA 2O8NA 1ZY2A 4WFKA 4YK7A 2IPLA 3CRZA 1YR1A 1U7HA 2XZDA 3MTGA 3QPWA 3FCCA 1BD3A 1G60A 2BJWA 3VPBA 3GJXC 3U6KA 3EY4A 4UC0A 2O8CA 2D62A 2VSQA 4X94A 1ILEA 2DLCX 3V9AA 5SZIA 3OVMA 4LDNA 3RV4A 1DS6A 1QRDA 1YA4A 3R5JA 2XTZA 4BMNA 2RGUA 2I6TA 4LYDA 2W43A 1Y7IA 2GK4A 2WB4A 3VZDA 1CHDA 1RJEA 2Y1OA 2VNSA 2BHRA 4ZAFA 5J40A 3RK4A 5FH9A 4EZBA 4C0SA 5EHNA 3K72B 5JS6A 3GMTA 1ULHA 3ANMA 3K1TA 4F38A 3LG2A 1G7TA 4JUFA 5AVUA 4GW3A 3CX3A 4O2BF 2C5EA 5DEOA 4X95A 2Y2UA 3IAEA 4DY4A 1LD3A 4A0SA 1TRKA 4BCDA 3AVPA 4MKXA 1PJBA 4BNJA 2GD2A 4AXXA 2QUZA 2E37A 1AN0A 4FTWA 4TOIA 3WGZA 1BCSB 1QTQA 5HZAA 2HF9A 1KHTA 1KVRA 2IHTA 2ZRHA 4TKUA 1W88B 3E35A 3WMWA 4NLLA 1XVUA 3HJHA 1N33B 3KBBA 2ZPTX 3PFCA 1W30A 3BAZA 1X0VA 4UVDA 2OV4A 3C97A 3INNA 4OVKA 4YUAA 2FSSA 2GXQA 4KRFA 2YL2A 3PA6A 1MRZA 2QIPA 2ZBGA 2FDRA 3PQDA 2ZBEA 2QD3A 4UU7A 4BO4A 1ONNA 5I3CA 1PE0A 1T5HX 4YIKA 2W2QA 1V3QE 3C3PA 4HUQA 1HEIA 4M98A 2VBUA 4P1VA 3C6YA 5AJVB 3UY4A 3E8SA 1CULC 2EQBA 1O95A 1X7YB 1X13A 4M1SA 3BIJA 1ESMA 1KZ4A 4RH3A 1T43A 4AMUA 3WTBA 1ZUNB 2IBSA 1Y1RA 3D0QA 3D43A 2ZAGA 4INZA 4N6GA 4Z9AA 4DDTA 1PBTA 1NMYA 1PFUA 5A89A 1UZAA 1F7UA 3ESDA 1UINA 3LX5A 4EDHA 4Z4CA 4G07A 4L5YA 2PV7A 1Z5VA 1YKGA 4C6RA 3H18A 1YQGA 2I66A 3R7AA 2BCJQ 1OFVA 3TBKA 2ORED 3FPLA 3IO5A 4HFMA 1VB3A 4PZYA 5J4HA 2NMVA 2PLRA 4HAYA 1ZN8A 3TQSA 2ZXIA 1RAGA 1K1EA 4H60A 4CMAA 1ZXBA 1DUVG 3I72A 1W1IA 3C6MA 3AIKA 2G5CA 4HGNA 4P4SB 4W9MC 4FN5A 3OECA 1C80A 3MN1A 3HWWA 4RZIA 2CWDA 3CZAA 1J0XO 2O3RA 5AVKA 1VRCA 3ILSA 4FYVA 3I56B 1XWFA 3L4KA 3WMGA 5JCZA 2YV2A 1EVIA 4ZVRA 4Z54A 1XQ6A 3C3BA 2Y27A 3C2QA 1IHOA 2VPTA 3G9TA 3T61A 1BA2A 3ZY5A 4BNFA 1MJGM 3QVWA 3L1UA 4YCMA 1M1UA 3IUMA 4LV6A 3F67A 4EHNA 2HA3A 1HURA 1WZEA 4FFOA 4UEOA 4V02A 4DAOA 3U3JA 2HCJB 3PFGA 2XKKA 3T5BA 1E2JA 5BW8A 3BTOA 3LP6A 1U0NA 5IJ0B 1NVGA 3HJBA 1NGSA 1HUQA 3VV2A 1WXIA 2DCMA 2NSHA 4ZD6A 1L7VC 2G36A 3KZVA 3HXOA 1IIRA 2QJRA 4IG9A 4MRPA 5FQNA 4D6PA 1JPJA 2GM3A 1C5KA 2PH1A 3JARA 3NGLA 3SM9A 3AUAA 3PGMA 1W0CA 2V4DA 3VU9B 3PHJA 2HCBA 1J24A 2II6A 3KQLA 2CVPA 2ZJ4A 3KD2A 4B46A 3LGXA 1MX9A 2IDMA 3UH1A 4WNYA 5CTAA 3RANA 1JZTA 2Z43A 3PUWA 3MERA 2DKOA 1FZQA 2HNKA 2Y3IA 4O3FA 1OH8A 3W4JA 3G2JA 3TEFA 1NI4B 5ADHA 3DZBA 3AUYA 2OTLB 1U7XA 4I6EA 4R1PA 2K7FA 1LUAA 1R64A 5EJMA 3L1JA 3MBKA 2QZJA 5HEKA 2ZE7A 3L93A 3NS7A 2X6WA 3B12A 4ZHSA 1XCLA 4DDHA 5BNZA 3F73A 1XCJA 5C8YB 1ZIXA 2D5BA 3NBUA 4MLPA 1W49A 1DKUA 4R1QA 4C2TA 4L8GA 4MTCA 1WHTA 3S8MA 2ECKA 1IB0A 4FS3A 4LWQA 5KTPA 2IOFA 1BS2A 4PYLA 1RWBA 5K0BA 4JI8B 3UJDA 3ZDBA 1W5BA 4CNBA 5LUAA 1S7GA 3JVVA 3WFZA 3H9CA 4B3JA 3MYYA 4XLAA 1VGQA 3KG2A 1TM4E 2J9FA 5F51A 4MCIA 4AUNA 2CNLA 4B83A 3VR4H 4DLBA 5JAUA 4IDPA 3F8WA 4KO8A 3B1ZA 3DDNA 3VC2A 3VNBA 7REQA 1QFXA 3RTDA 4JJIA 1W94A 2CDNA 4QQKA 2EXXA 3R5HA 1SQ6A 1UBOS 3U4DA 3KPJA 2GJPA 2J3KA 1WU8A 2VF8A 3JWEA 1D0VA 4KGZA 4KDFA 3VNSA 3LECA 1J2RA 1QAMA 1Z7EA 1ADFA 3IXQA 2DPXA 1NQUA 2WJHA 2FPXA 3KKPA 4K0RA 5B37A 3NM6B 1BE1A 1D4AA 1KSJA 2RHHA 5U4XA 5CB4F 1XEAA 3P2MA 3RVQA 3S70A 1JEQA 2H54A 3A9RA 1E79D 1UMDA 2ZE8A 3C0KA 3D1LA 4ZEXA 3EOZA 5JQGF 1X42A 4E6PA 4RTRA 3EPKA 4PABA 3HGQA 4HDMB 1PFYA 5BRNA 2NUTA 1J56A 2MINA 3M1AA 4HADA 1YUNA 2H57A 2QXYA 1NBME 3UGKA 3IODA 4RTQA 4BEWA 5JVDF 4OJKA 2DAPA 3ZE8A 3IPCA 2ZAMA 3PGKA 2PS1A 3BE8A 1HQDA 3WNDA 1UWVA 2GF2A 2RHJA 3PF9A 1YH3A 1YDWA 2PE3A 4N0QA 1H93A 2QV7A 3SKXA 2VR1A 3AR4A 3UHAA 3IEPA 3AFNA 4Y6QA 4TTQA 4UHKA 3VOBA 4MVJI 2X86A 3ECCA 1M8JA 2C9DA 1R6AA 1UXIA 4Y3UA 4J29A 4OYRA 4U7TB 5JNTA 2AS0A 4O4HA 2VNKA 1XOIA 3L5OA 4UD6A 3QYPA 1IZYA 3GGCA 1E89A 2CHEA 1A5BB 3B89A 3K0KA 1QQ7A 1IFXA 3B48A 3HG7A 1L1FA 1SHJA 1QFYA 3C6ZA 4KQ2A 4F3TA 1HQKA 1T3HA 1A88A 1FRZA 3JU4A 1JR3A 1X9GA 3S27A 5DN6D 5M7EA 4HRYA 3WLTA 3AVVA 3MK31 4GKAA 4URZR 2F1MA 2W4IA 2BHLA 5TRDA 1X7ZA 4KFSA 2BCGY 4HTAA 4B48A 5LYYA 2BR3A 2JVIA 2O2DA 2GVDC 5A4IS 1W8IA 3NNSA 2P75A 4OUKX 3AKCA 1EJ2A 3DQPA 4ZMBA 3K96A 2H6EA 1NF2A 5KYXB 4HS9A 1I30A 1E58A 4E1AA 2QZPA 3ETEA 1Z33A 4DQXA 4K88A 4TYMA 4Z4IA 3IP3A 1SIOA 3T4PA 3SMQA 3TG8A 2EU8A 4AI6A 2DFVA 3PXDA 1OIWA 1W0KA 2GX6A 5AKKA 3S2FA 3UAOA 4YR9A 3NC0C 5L3QA 2W8BB 1WHSA 3G5LA 1RQPA 2P6PA 4MS3B 2FEKA 4ATNA 4LNUB 3CCVB 2DTDA 5EG5A