4U9UA

Crystal structure of nqrf fad-binding domain from vibrio cholerae
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
279
Chain Sequence
VKKWECTVISNDNKATFIKELKLAIPDGESVPFRAGGYIQIEAPAHHVKYADFDVPEKYRGDWDKFNLFRYESKVDEPIIRAYSMANYPEEFGIIMLNVRIATPPPNNPNVPPGQMSSYIWSLKAGDKCTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRLKSKRKMSYWYGARSKREMFYVEDFDGLAAENDNFVWHCALSDPQPEDNWTGYTGFIHNVLYENYLKDHEAPEDCEYYMCGPPMMNAAVINMLKNLGVEEENILLDDFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Na(+)-translocating NADH-quinone reductase subunit F
publication title Structure of the V. cholerae Na+-pumping NADH:quinone oxidoreductase.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 87
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 7.2.1.1: NADH:ubiquinone reductase (Na(+)-transporting).
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4u9uA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4u9uA02
1D8TA 1FNMA 4B44A 3OJXA 3U6KA 1I7PA 5EMNA 3OJWA 4M2LA 2XEXA 3WYAA 1QGAA 2XNCA 1K9MD 1QG0A 2BGIA 1FNBA 1E63A 4HE5A 2BM1A 2VNHA 3AVWA 4NBSA 3QE2A 1DDIA 3ES9A 2BM0A 3CRZA 4YAOA 1SKQA 4PC7A 4B43A 3JQRA 1S0UA 2B7BA 2OTJB 1JB9A 1DDGA 4K1XA 3FJOA 4C43A 3QSYA 2GQFA 2QTLA 3CMEB 1BJKA 4TMVA 3VO1A 3W2HA 1ZM2A 3CC2B 2OTLB 4RCZA 4R71A 4RCYA 2D74A 1EFTA 1IJEA 4LBWA 3LO8A 1NJID 5H59A 1EWYA 1GAWA 2CNDA 4EH1A 1OB5A 4M4SA 3OZWA 4ACBA 2EIXA 2BF4A 3E1YE 5TR9A 4P6VF 1EXMA 1QFZA 4QHYA 3JQPA 1N8RD 1KK3A 5HXBA 4TMWA 1K73D 4RD1A 3CCLB 3QFSA 3CCJB 3CPWB 2EFGA 3LVBA 4N3GA 2HDNB 3W2EA 2BVNA 1FRNA 3WNDA 3WBJA 1XE1A 2BMWA 4YALA 1B2RA 4H9GA 3U6BA 4ZGNB 3AVYA 4ZGQB 1QUEA 4M53A 3LYUA 2DCUA 1QH0A 1TLLA 1QGZA 3W2IA 3P26A 1TVCA 3OZUA 2QDXA 1BX0A 5THXA 1VQMB 2OK8A 3CXCB 1OGIA 3QFTA 2DETA 4G1BA 4FK8A 3ZBTA 2BV3A 4NCNA 4B3XA 4RD6A 4LC0A 2YWEA 2PLFA 2GPJA 2VZLA 4TN1A 3G6EB 3I55B 4TMXA 5H5JA 3W5HA 1YIJB 3QFCA 1AMOA 1J9ZA 1R5NA 4F7DA 1ZUNB 1GR1A 4RD0A 4LBZA 1FDRA 2DERA 3U2QA 3CCRB 1BX1A 1QUFA 1BQEA 4BPRA 2RC5A 3CCVB 3B82A 1OB2A 3MMPA 3AVUA 1Q7YD 3CC7B 1VQ9B 1B23P 1YITB 3P27A 3SJZA 3AVVA 1EFCA 4B4DA 5DSZA 5FA6A 4PC2A 1H42A 4P3YA 2BN4A 2QMUA 1N0UA 2AHOA 2B7CA 1VQ7B 4TMZA 1SM4A 3VO2A 3CCEB 1FNDA 1VQ6B 1IB0A 4UAJA 1A8PA 2BSAA 3WNCA 1QVGB 1F60A 2VYQA 2QTZA 1H85A 2RC6A 4WQMA 1IJFA 3CC4B 1DARA 2HMAA 4YHBA 2BPOA 2VNKA 2FX3A 3W5VA 4Y7CA 3OW2B 3ZZ0A 4C0SA 4Y9UA 1S72B 3CCUB 1E64A 1GAQA 1GJRA 1YJWB 2QN6A 4YAFA 2CRVA 3G4SB 3FPKA 5AN9A 4MYUA 4U9UA 1ELOA 2DY1A 3WXMA 4ZCMA 1KJZA 3G71B 3B78A 1EP3B 1EFUA 1HA3A 2VNJA 1CNEA 3CW2A 4AF7A 4PGOA 3MHPA 1AIPA 4J0QA 2X3UA 1JA0A 4DQKA 4RD2A 1FRQA 4M1KA 2R6HA 2C77A 4LBVA 1KD1D 4YAWA 1CQXA 4B48A 4LBYA 1KQSB 1GO2A 5TY0A 5TV2A 1VQLB 1R5OA 2YWGA 1YI2B 1TUIA 2J7KA 1G7SA 1E62A 1U2RA 5KSWB 3JQQA 1VQ4B 2C78A 4QFMA 3VNVA 1OGJA 1WDTA 4YAUA 3PENA 4RJLA 5GV7A 2DEUA 3A1FA 4RD3A 3I56B 4HE6A 1R5BA 2ZITA 3ZZTA 4Y9RA 1VQOB 2XNJA 3VNUA 1YJNB 2B5OA 1GVHA 4ZV4A 3AVTA 3E20A 3ZZUA 3CCSB 1VQPB 5JBQA 1DG1G 2BGJA 4IW3B 1NDHA 4ZCIA 3W2GA 1G7RA 4G5GA 1ZM4A 1YJ9B 1W35A 4N3NA 1KK2A 1QFYA 1Q82D 3LRXA 1JNYA 3AVXA 3W2FA 3CCMB 1EP2B 4G1VA 1VQNB 4TMTA 4AC9A 4DQLA 3OZVA 4PC1A 2E1RA 1KRHA 5GV8A 1VQ5B 1JA1A 4Q7JB 2HCJB 1JJ2B 4MYTA 1VQKB 1G7TA 1EP1B 1FNCA 3CD6B 1ZM9A 1CNFA 3WBKA 1KC8D 2VNIA 1XB2A 3ZC3A 4RD4A 1N0VC 1QVFB 3VMFA 4FWTA 1M1KD 4ACAA 1QX4A 1Q81D 4FN5A 1KK0A 3V76A 3QFRA 4ZCLA 4M0LA 1M90D 2QA4B 1W87A 2PIAA 3J81k 3MCAA 4PC6A 1G7CA 2PMDA 1YHQB 3CMAB 1Q86D 3AGQA 1KTVA 3WY9A 4B47A 3B8HA 2NPFA 4AF6A 2OK7A 1W34A 4PC3A 3I1FA 1ZM3A 1D1NA 3CCQB 1QGYA 1VQ8B 3ZBUA 1F20A 3CB4A 3W5UA 1W2BB 1TTTA 2QEXB 3AGPA 2YWHA 1K8AD 1QFJA 1KK1A 2YWFA 1D2EA 1UMKA 3WNBA
chains in the Genus database with same CATH superfamily
2WFAA 1JQLB 1OASA 4MW0A 3TW8B 2WIFA 3ZW7A 1V9CA 2Y9MB 4OH1A 4PAGA 2RJNA 2BGWA 3GCWA 4KK3A 5LBUA 1VOTA 2HLDD 1SUBA 1V4VA 3OPMA 4JYBA 5F5NA 1G6HA 1L3CA 2ZVPX 4X1KB 2H65A 1K0UA 2EWWA 2QL9A 3AWDA 2BGNA 4M2LA 2HF8A 3A28A 3I2HA 2GJ9A 4ZKDA 1DGQA 1E9DA 2CJYA 2VDLB 3JY6A 1Y0RA 3GU3A 5JADA 1QGAA 5CYPA 3UMGA 4G0UA 2FMUA 4L4YA 1FJXA 3PITA 5BNZA 3IJRA 4P35A 2F43B 3WB1A 3MWFA 4E7OA 1JKJA 2XEDA 3B9BA 2F6RA 2PYZA 4P12A 2Y67A 2D7JA 3O31A 3GYGA 4JBHA 4JLUA 1V7ZA 4B4OA 4GLBA 2DBQA 4Z4TA 4BQEA 3IAAA 1J2RA 3M6UA 1QKJA 1T5SA 5KYYB 3CZAA 3QOXA 4PPYA 2GF0A 3QI7A 1B8PA 4YGXB 3UCFA 3NOOA 3KVNA 1ML4A 4P86A 4QAQA 5D5PA 4FMCB 5HBRA 2ZEJA 1HSOA 3C39A 3CZ5A 3A4LA 4RJKA 4YAOA 4PRLA 2Z0MA 2F3SA 4P4SA 1M1NB 2C5LA 2X77A 2YMPA 1N77A 4X61A 1OAOC 5L7YA 4OQ4A 1Q1QA 1ZWKA 4ENTA 2OTJB 1W48A 5JCPA 3A1PA 1DIHA 2EP8A 2MOKA 1EFPA 3FRIA 3UB3A 5K01A 3JVEA 3AR2A 3C70A 3TTTA 3ZXSA 2C9MA 1E2DA 1Z15A 3OTIA 1Y3DE 4N7RA 3LHIA 4A8JA 3WGUA 4HZUA 4M7PA 3H18A 1J7JA 4BO9A 4UUMA 3TEFA 3OCXA 3COZA 5AKKA 5CLQA 3W2HA 5SZIA 1OYYA 3TR0A 4BVHA 2CZCA 2FI1A 1RU3A 1CZRA 1VRCA 1WO8A 2C31A 2K2WA 1U98A 1N8NA 2H7VA 4KE7A 4S0XA 3UT5B 5H59A 5EAIA 2JNWA 3O4HA 4MARA 3N0XA 4GOKA 4MUAA 5IKOA 2XVZA 4BNHA 2WABA 3NOQA 4TMFA 3QFFA 3UK1A 2BZSA 2LKDA 3A6KA 2WOJA 3B2QA 3HKEB 1ZWLA 2VZ8A 4LXQA 4U6SA 4YONB 5CCDA 3S2EA 3ZYCA 1YWGO 5BNTA 3GLFA 3TM4A 4PWYA 2X6RA 3C85A 4XWAA 4EIWA 3ZHBA 2ZAOA 2VR1A 4Q1FA 1DKRA 4F38A 3CRQA 1JJIA 4KYTA 1C7IA 1TQ4A 4O1HA 4ZAGA 2Z6QA 3F8SA 3C3AA 1WHTB 1RYHA 1ZLYA 2LDBA 3IJPA 3PC7A 5KIAA 1Z6ZA 2WTAA 2XH8A 3A1DA 3LC1O 5SZKB 1EVIA 4EEKA 3IQDB 2HSZA 1C0IA 3RSLA 4CEIA 3X1WA 4P58A 1YQWA 1C2YA 1QRTA 2XRZA 1ZMXA 1I6KA 3PCRB 2ZUEA 4K9LA 1L4HA 1KVUA 1D5WA 1JG6A 3OOHA 2OECA 1ANKA 3P9ZA 4R68A 5F7OA 1YTUA 1WU8A 2ZIUB 4ZQHA 1IJBA 1UWCA 3OM1A 4MCHA 1NNLA 2IYLD 3GW8A 2X7HA 5J1SB 3FCXA 1BD3A 2X58A 5ALRA 2CKMA 3IDFA 3IELA 4Q1BA 2XADA 1NM5A 3PWZA 4CCYA 3HXMA 4Z6KA 1OBCA 4WZAB 3TINA 2AFHE 4YJFB 2WMNB 3NM5A 4EB6A 1OIWA 3DQQA 3AVYA 2EQBA 3MT9A 3QZUA 5K45A 5CAEA 2XWSA 2B8WA 4TSKA 1P7CA 3VH2A 3IAS6 2V97A 4B9EA 2EBFX 3IEMA 1JIJA 2OHJA 2PANA 4EW6A 2EAUA 1WU7A 2FPPA 3OD1A 4LW8A 2OBSA 4QYWA 1ZK4A 5JD6A 5HBGA 4P1VA 3GFRA 1XFDA 1AUOA 1RI5A 2AN1A 3OZUA 1PG0A 3ENWA 1LDMA 1IZZA 4K3VA 5AKJA 2Q5HA 4ZGGA 2COUA 1RWBA 5ADVA 4HTFB 3NNDA 4HDAA 2ZRGA 1CB0A 3K30A 1XLTA 2P8SA 2RHBA 3DKKA 4OTZA 2EARA 4UEKA 2JBAA 3HV2A 5JI2E 1GD1O 2RG7A 2ZSHA 4WCFC 1VE7A 1FMCA 2JHCA 1DIAA 3E23A 1P7PA 4E09A 2ZXFA 1FP1D 3IAXA 4X90A 1E6WA 1PTJA 3ANSA 4YASA 1C9MA 2V7XA 2XQKA 3GCXA 4WZBE 5HDQA 3G5MA 1XT6A 1TJYA 1PT8A 2GT1A 3OZCA 3MIZA 1MJFA 3NVAA 3TOZA 3QWIA 2Q3EA 3WYNA 3ESYA 1TYDE 4EJSA 1R8QA 3W5HA 4HH3C 5AM3A 1T1GA 2JK1A 1EYZA 3IKMB 3LTNC 2HMUA 3MS2A 3K70C 3T4XA 4HUJA 2DQKA 1GQQA 3GHHA 4LOHA 3AIIA 1DC6A 2UUAB 3WAKA 5K6RA 5LXTA 2C9ZA 2FSGA 1V71A 2OAEA 1JQJC 3CNHA 1E3ZA 1GSIA 2PH7A 1D1TA 2XCQA 4CIWA 3RC2A 1JHVA 1MBZA 5EQTA 3R9IA 4ITUA 3LQEA 2MR5A 2FJUA 2GTHA 1JE1A 4OHXA 5FHQA 4CNQA 4Q9JA 1I4TD 3FM9A 4QBHA 1Z0ZA 3DXYA 4XLHA 1E6CA 1FVHA 1YKFA 2NU7A 2Q28A 3KKEA 5E4YA 3PNMA 3B82A 3KHSA 2CLOB 5J3JA 1K4YA 1KHHA 3G79A 5CFQA 1IQRA 2LXNA 2JL1A 4XSGA 1H8EA 2QSYA 2VI5A 4KDFA 2Q9UA 4AT1A 2XQVA 3BMCA 4QUDA 5FUMA 5HM6A 5JAHA 4Z4EA 1C9JA 4UTXA 1GTSA 1T0HB 2A9QA 5EQFA 1YL6A 1GCAA 2IBMA 1E0AA 4ENPA 1ZNYA 1SBCA 2VHWA 1U2TA 1K2VN 3PUXA 3M9LA 3LCJA 4RZIA 4P3YA 2HA4A 3WYCA 4BUZA 2RGRA 2OZLA 3OEEA 1DV2A 1NRKA 2A59A 2P4UA 3OOYA 1EI9A 4ME6A 4QEKA 2BFAA 3M4JA 5DK4A 5HMLA 3W6NA 1L5FA 1Q50A 1XPJA 5G40A 4NKRA 5EJ6A 1H9CA 3WOVA 1NBWB 3CUSA 2KLHA 4PS1A 4OBWA 3ROZA 4XVCA 1L7MA 3NBKA 1NASA 4XUCA 1HQDA 6PFKA 3A25A 4P84A 5ARCA 2KI5A 2FN4A 3P9IA 4EGFA 621PA 1IVYA 4QQFA 2H85A 1UXJA 2PKXA 4LCBA 5AM4A 2PFSA 2YDXA 4RKWA 1OLSB 2E3JA 2UVQA 2OB2A 1X7ZA 3ND7A 2IZOA 5FOUA 1UKCA 4Y7DA 5H1YA 3ZU2A 3IEVA 1JHMA 3ZCPA 7REQA 2WD9A 2YINC 5JDIC 3QJ5A 4Y2HA 2CFOA 1SCUB 1RIFA 2CUZA 2XXJA 2FFRA 3AR7A 1Z4PX 4I81A 2RI6A 3NHZA 2QW8A 3C98A 1WY7A 2NT4A 5LYJF 2OBNA 5ALVA 3QHQA 3K0AA 2R1TA 3N3BC 1SY7A 1RRVA 3L05A 4K81B 6AT1A 3JU3A 4L1KA 3WL4A 5DLYA 2PMEA 4PABA 2JIBA 3KL4A 5DHRA 3K8QA 1COZA 1W19A 4D9IA 3IVXA 5JHGB 2GEUA 3JQ8A 5IN5A 1QE3A 2X1LA 5ALYA 5CPFA 5D01A 1BTOA 3G5TA 5AI9A 5TMBA 5JH7F 3VSBA 1FVOA 4DMKA 4JUIA 4FZVA 4ZO6A 1CRPA 2HCFA 4JJ8A 1EHIA 4ZCMA 1XKTA 3ASZA 1GTL1 3IEIA 3WDKA 4KPEC 5KU7A 5ILQA 1KJZA 2AFHB 5IUKC 4GWLA 5HZBA 3DDSA 4H7IA 4Z2YA 3JWJA 3T99A 4QVAA 2IGTA 3CZQA 5M34A 1DMSA 1XELA 2B4TO 2HJSA 3NDPA 4GR9A 4NS4A 4KXFB 4BGVA 1XCJA 3BHJA 1O97C 1Z8DA 2FV8A 2GBLA 4O2LA 1K4MA 1XZNA 3PNSA 3TLZA 1UC4B 4L76A 2REBA 3KQYA 5EE5B 3SKXA 2FVGA 4AYXA 4C76A 1PQYA 2IE8A 4H4EA 4IYRA 4OJMX 3QNWA 2GLXA 3ZK9A 5GIPE 4C7BA 4HWKA 3CH5A 4JUAA 3X2EA 1FDIA 2Q0QA 2PL5A 3EG5A 4AN0A 3QY0A 3ECCA 4HLUC 1MO6A 1HZJA 3JR3A 4G5HA 5KOHB 1AGPA 3V1YA 4R3NA 4EWLA 3LO5A 4XDGA 2ZBQA 2HJGA 2IUTA 3QF4B 5I7UA 1RRKA 2ZE5A 3DZJA 4WECA 3REOA 1EGVB 5DLQC 2CL0X 5JOQA 3GLGE 3U61B 2MTBA 1AKUA 4WZBB 1OLOA 3CTMA 3DFUA 1EM8A 1IQUA 1JHXA 4FNGA 5K0EA 2YN4A 4MW9A 4OFZA 3I01A 1YI2B 1ITZA 3V2HA 5LQMA 1EXVA 1KJIA 4DMHA 2YV2A 3R3JA 4IBOA 4IILA 4K28A 1W5EA 6REQB 4EK9A 1M6HA 4ND1A 4QGFA 2A33A 3F3YA 1WE2A 4TVBA 3DS8A 2XUOA 4IKOA 1AA9A 2HRCA 1GAEO 1O5IA 1G6Q1 1OAAA 1VPTA 2REQB 5FWXB 5JFOA 1CQPA 1ESDA 5IDYA 1UDAA 2EKLA 3KZCA 2BJVA 1E3IA 1V0JA 2ZYAA 4PLYA 3PFHA 1YZLA 4GEGA 3RK1A 3IHTA 4YUYA 1SXPA 4MS4A 5HGJA 3T15A 1I2CA 4ARSA 2NQ8A 3W6OA 9LDBA 3AERB 4JN6B 3MSXA 2CYCA 5IKMA 2IXTA 4GZ3A 3SVTA 3IEUA 2PMCA 3BS4A 1WVGA 2LR0A 4H0CA 2OA0A 4GQBA 1IEQA 2IHYA 5EWJB 4RA6A 4CV3A 3TW4A 1HDOA 3FHOA 3IDQA 4QL3A 2JHFA 3KSAC 3KKPA 4YT8A 4PY2A 1WP4A 2FEWB 4PX5A 3T06B 3MGGA 4JGIA 3CUUA 4NJMA 5E4TA 1TQDA 2FLVA 1KZHA 4DPMA 1GUDA 3T3EA 4X95A 2XOEA 3U0VA 4BKUA 4NMLA 1P9WA 1TPYA 4XDYA 5ECGC 4DRYA 4NLLA 3I09A 3DR5A 4YQZA 1CY7A 2PUBA 1J1UA 2P3OA 2EQ5A 2FMXA 2KJQA 3C5WP 4KFRA 3AY7A 1G6OA 2Q4EA 3AETB 3E20A 1Z35A 1F6WA 1LC3A 3GVIA 2DWUA 3ABSB 4G0XA 4BLOA 2C7VA 2G28A 2A8YA 3ZDZB 2DUMA 1GTVA 4CMIA 1RLJA 2ZETA 1F17A 4RSGA 2R7AA 2BHNA 4ZCIA 4KQMA 2O2EA 1QHEA 1Y4UA 3Q12A 4C20A 3R3XA 5JY1A 1HYGA 2ZIXA 4AUNA 3SAJA 3ZLVA 3GQBA 2XNKA 2QZZA 3ZNPA 1CY4A 1X77A 1QF7A 4HAXA 4OREX 4EY8A 3B3FA 4NY1A 4UREA 2QN8A 3WK9A 2X8LA 4RK6A 2VUTA 3FCOA 1RWNA 2AI2A 1T1IA 3HYLA 4XVRA 4EBBA 2G82A 3BHMA 2QJOA 1DXQA 2VP9A 4V24A 4AC9A 4R8MA 3ICVA 3V9PA 4UZFA 5CFOA 5CK5A 1BH6A 3FUXA 5AI6A 4N8SA 1C0EA 3E7WA 2VK8A 2CXQA 2WSSD 4AQDA 3AEQA 4X8HA 1FX1A 3ISJA 4QKQA 4EGCB 2NUAB 4MYTA 2IVFA 4XOPA 3QSGA 2PUGA 1J06A 1JHDA 1LSOA 2O9JA 5DBOA 2GEVA 3NBYC 4FM9A 1R9NA 3ESZA 4LVCA 1J2YA 3LF2A 1FDSA 3G88A 1KQ3A 4LI0A 4KO2S 3EJ6A 2BP7B 3CX4A 3VNAA 5KNCA 2V7GA 3OQVA 1MH1A 4DHWA 4OKNA 1K7EB 1HQKA 4X20B 1I10A 3ANMA 3PGXA 3IBYA 1Z63A 4CM7A 2QRQA 3EF0A 4ACAA 1ODTC 1NBOA 1JU9A 1VYUA 3Q3HA 2P9EA 3AF3A 4TVOA 4FFBB 1PS0A 4FN5A 2GPNA 1KK0A 1N5RA 1W93A 1EK5A 1RLTA 1DIRA 3KKLA 1VA4A 3TJZA 2PLNA 1L7EA 2EKZA 4LWZA 3HRHA 2VWQA 1O94C 3E9ZA 3VPFA 4IMJB 1B1CA 4ZRDA 3DNMA 4B7XA 4DV3B 3C7KA 1LC0A 3VNSA 3U3RA 1QGUA 2P40A 4M3NA 3U4IA 2FUNB 1N3IA 4OG2A 1WB4A 3QEJA 4ZAWA 5CCXA 8MHTA 4GLLA 2R1UA 3GLGB 2DWPA 3A35A 2CD7A 2FHSA 2G06A 4MV8A 4B34A 4CF4A 3VYWA 4N3CA 1VIYA 2D3WA 1ESCA 4IIUA 2PUWA 3PXDA 4MV4A 5FWDA 5L53A 2QD1A 1XWIA 4OOSA 1C7JA 4HMPA 4YUVA 4F5ZA 2OK7A 1K6XA 4V3CA 3SSMA 3OPYB 3I1FA 1GZ7A 1U7XA 4IQ8A 1JECA 4HQNA 1BCSB 4L9SA 4CMGA 1KL7A 3CX8A 4GWGA 1HFWA 2FE1A 3U7RA 3SMVA 1FPMA 4Z51A 4K9RA 4N03A 3U4GA 3HL4A 3CFYA 1L8QA 2ZW9A 5M2QA 4JYCA 1NP3A 3ZDBA 4B6PA 1A04A 3DXZA 2X0NA 4C4TA 3FMIA 1A1VA 1CUBA 4G09A 1IM8A 1QXSA 3LY9A 5JZOA 4DM7A 1G20E 4QFDA 1XU7A 3CLTD 2OL4A 4R40A 3AL0C 1W4BA 2XWPA 4J4TA 3JASA 2HL6A 5AH0A 1VL8A 3AC0A 4PVCA 4CDRA 3IOBA 4YX9A 1P2VA 4L2IA 4DJ5X 4RF5A 4QBKA 3TXAA 2ZRHA 3GRAA 4JBIA 5LXTF 1QYRA 2X1VA 3D7RA 4ZHQB 3DAYA 1MNQA 3AHGA 2NWQA 3W9BA 1Y3AA 3R8CA 1DADA 3NHYA 1M1XB 4J0KA 2ZJ1A 1DJLA 3MTBA 1R4NA 1UKZA 2WJ6A 4E5PA 2UUPA 2VSQA 4YN3A 3ABIA 2J7PA 3LIPA 2QLMA 2DTXA 1MG0A 4JSYA 4C0HA 1M2JA 4I9FA 1RJEA 2I1QA 2V7EA 4C7KA 5A4FS 1EFKA 1N2CA 3MXTA 3OF5A 1HUQA 1GRVA 3EGDB 3T12A 2MINA 1U8TA 2BGIA 2XVAA 1FW8A 2PPVA 2PT6A 3CLRC 4JNKA 4AG3A 5EMKA 1WQ4A 3FFAA 3NBMA 4HE5A 2JD2A 3PGA1 2RH8A 4EHJA 4P4GA 2WJ4A 1YQDA 5ER9A 2RGXA 5EXPA 1FTQA 2OMKA 5CB8A 4V1CA 1V3UA 3HCDA 4MRMB 2VFAA 1VLLA 2O0JA 2OV3A 4I3FA 1Y48E 3K72B 3KTAA 3OZAA 3ZWAA 2CUNA 3ZWYA 4Q1EA 3DL0A 3Q0IA 2O5EA 2C0CA 4REOA 1N2BA 2SECE 4PXSA 4LF7B 1XQVA 1EG2A 2ID7A 3KOMA 3QVMA 2IF0A 2QRHA 4QBFA 2JASA 1EEHA 2WB4A 2Z08A 3G2IA 4U6QA 3ROKA 1CUFA 4MVJD 1IHYA 4TXLA 5HF6A 5CDFE 2ZU6A 2ESRA 1PQWA 4WEOA 2WD7A 4L0DA 3QIVA 1T8UA 3B70A 5LQDA 4QAJA 2XZDA 3KJIA 3DOOA 5A0TA 5LLSA 3C87A 1T35A 4LG1A 5HQTA 2VJMA 3X0DA 5IM5A 2CCGA 4J2TA 3F3SA 4PHHA 3GRYA 4NK4A 3ISTA 3GPDG 1WXHA 1DRVA 4DSTA 3R6JA 1ST3A 4OHCA 2QQFA 3BSWA 4NATA 1HH4A 4BC1A 3DCJA 1FU8A 3NYRA 3H4IA 4BB6A 3K9NA 1ZAKA 1RWQA 3HAGA 1FBTA 2XVXA 3GZJA 3FOEC 2DBVO 1YU9A 1J00A 1JZQA 3FI9A 4NAUA 4BO2A 1HXHA 3GPBA 3LKDA 3GD7A 1HVXA 1N5JA 3EF1A 2EFHB 5IC6A 1QYCA 4HBGA 4N0DA 4QPJC 3TXXA 3W9YA 1ZG3A 4XWOA 4EGAA 1BW9A 2E5LB 4IIJA 1WDWB 1WIWA 3L6BA 5HIJA 3G8AA 3E1YE 1XTIA 3ESBA 4HWPA 4MPPA 5B3AA 2WA2A 4KJZA 4ZYXA 4UPVA 3MWGA 2PPLA 4L07A 5DXAA 2VDMB 1BRMA 1RQXA 1P1KA 3AO0B 3IA7A 3PL5A 5EJAA 3T7TA 4DTCA 5AI4A 2POCA 1Y37A 3K5HA 3M3PA 3RM3A 3JQPA 1O03A 4YRIA 3GLIA 3IDSA 1BS9A 1B4DA 1HKUA 2FWMX 2ZWMA 1E2MA 3GAMA 4GC5A 2DF8A 4PYNA 1NBMA 3JALB 4H6PA 3TPFA 3CCBA 3MN1A 3RJZA 1HOXA 1XZIA 5GZ6A 1K88A 2GBPA 2Q27A 3H4MA 3NOXA 5MN4A 4DARA 1XDGA 2EEZA 3ZEIA 2FN7A 4X1IB 3MHTA 4DC9A 3EGXA 5HKOA 4BNYA 3M0EA 4C2BA 3BKXA 3GEPA 3UWMA 2IWRA 1NA5A 1GP2A 1ODJA 3G7NA 3FYTA 2CB0A 2ETVA 1YAHA 1GQRA 2QP4A 1YIAA 4X6XA 3HK2A 1DKUA 4IIGA 1SVMA 3UOGA 1XVUA 3T7SA 3ZHSA 2YY7A 2B6HA 2PBFA 2CEKA 1WUKS 1TMYA 5FULA 2HQRA 2Q5OA 3EWNA 4Q4JA 5GPBA 1XZBA 2VP5A 4G0MA 2ZVDA 5SYAA 1P91A 1PT7A 3KUXA 5F1KA 3SS7X 3MJRA 3QKSB 2VBVA 5JDCA 2V3CC 2O8DA 1PLJA 1TA9A 2H1CA 3I37X 3LWNA 3PEUA 2XCRB 4XKVA 2GILA 3UTCA 5A4MS 3PQ2A 1U3WA 1ESNA 1OGIA 3LOUA 4ZI5A 3ENZA 1G20B 5GZ3A 1NVBA 2QPTA 1EVZA 5EIAA 1T9GR 1E3EA 3QUCA 4YIKA 2MHCA 3ZE8A 2H29A 4FXUA 1GTG1 1UDBA 3A4TA 3EASA 4RLFA 1RXWA 3W1WA 4EPXA 1U8FO 4IKEA 4IINA 1AUPA 1NVVR 1UP4A 4AKTA 3F78A 2ZTLA 1RPAA 4YJ2B 1C9YA 2OCGA 1VM6A 3GBVA 3ROGA 2PMKA 2RK4A 2AYZA 3LV8A 4EY6A 1A9RA 1VG0B 3OAAD 4FKMA 4EVRA 4YT4A 5KSYA 3G02A 1OX4B 3JQEA 4AS1A 1WZCA 2W2KA 2YCLA 3GZTB 3N2NA 4JJFA 2IW3A 2DVMA 2J5QA 4KRGA 2A88A 4XI9A 5JEDA 1QJ4A 4AURA 1YONA 2O2ZA 1XZLA 4FKZA 2ZUTA 4IUDS 2P3LA 3AV3A 5EUBA 5DN6D 4MJXA 1TB4A 2EJTA 2FUEA 3A3NA 1ISFA 4N7BA 1ECLA 4MGYR 2XT0A 5TVKA 5AJVB 3ADKA 3VNBA 3U7HB 5K3DA 1E4EA 2FSVA 5ALKA 3VJMA 1KWGA 1R16A 2XY4A 3OSZA 3H84A 3RRYA 3ZK7A 4DMRA 5DOVA 2RB5A 2XOXA 4LXHA 4TSRA 1BX1A 3RWMB 2B4KA 3BRWA 1YA6A 4JCCA 2RC5A 1WCIA 4QGAA 3RFTA 4C4XA 3ZNOA 1KZ1A 4N0EA 3N2GA 3QEAZ 2QVCA 2PFKA 3O2QB 1HOTA 4G0ZA 5GAJA 3WFIA 3ZS9A 2I6QA 2B94A 2P77A 2WE8A 2CZGA 4BNMA 2HZ7A 4GPTA 3NCTA 5FFNA 4FC6A 3KYCB 3PK0A 3JATA 3GY0A 4PZ0A 4GVXA 3HCOA 3UKJA 2BR3A 4XM0A 2MCFA 1AHPA 1E61A 3PUYA 3O8OB 3LPDA 2QUKA 2XUGA 4LHXA 1YB5A 4NYIQ 4OFWA 4X62B 2GPSA 4IDNA 1Q57A 2QR5A 4FMDB 1VI5A 5AK6A 1R9GA 5AW8A 4ZT7A 3V33A 4ERNA 2BMAA 4ZYUA 5C1OA 5LDDC 4EDHA 1O6CA 1XDSA 4W99A 2XDAA 5BUQA 4WY8A 1VQ6B 1J2JA 2QF7A 3JQAD 1U1EA 1IB0A 3O74A 1USKA 1ADCA 2BRUC 4AS3A 4D92A 2YFKA 1X1SA 1CV2A 2QRLA 2VYCA 2KVOA 3AHFA 4NSNA 1ZBQA 5JLAA 1A9TA 1IY0A 4IGKA 5A4JA 1HC7A 4KV7A 1IE3A 3EPLA 1DCFA 3BWBA 1IJFA 3HFGA 4I50A 5COBA 3VZQA 4XWTA 2E4XA 2PH1A 1ZYUA 2EJWA 3I2GA 2R0QC 1X70A 3PYLA 4G0OA 1NRXA 4IJ6A 3RJ5A 4J49A 2VJDA 3GXBA 5L40A 4G0QA 4TV9A 1DFGA 3P97A 3I04M 1PFWA 3ZZ0A 4FLFA 3RYTC 1CRQA 5IPFA 1MR3F 3EGOA 3WICA 4Z8YA 4YROA 1I0LA 4L02A 2V6BA 4ZDWA 5D1NA 4MYCA 4Z86A 2Z2YA 6NULA 3E58A 4H6WA 1ECGA 1JJ7A 4PN3A 3MJVA 1E2GA 2QZ4A 4QRIA 4GP6A 5G3YA 4WNCA 3OUZA 4PSVA 2XXAB 1Y4ZA 2PTHA 4HADA 1H05A 2GUWA 3ZNQA 1NW4A 2CNKA 3BMNB 1QG2A 2WJJA 1RW4A 2YJNA 3WMXA 1TA0A 3G7UA 4Q3DA 2D4HA 3ZHZA 3IUJA 4FILA 1PNTA 2FSSA 4CODB 5C8DA 2JZNA 4DAOA 2Y4OA 4F12A 2AVNA 2ZJ4A 3FETA 1N9KA 3KT6A 4FBMA 4NDAA 4RLSA 1QHIA 4XEHA 4XTCS 5I9TA 1KJYA 3TQRA 1PFGA 4M36A 1PRYA 4HNSA 4BJ1A 2BOVA 4MV6A 4EJFA 2WM9B 1RQLA 5KYWA 4YRTA 4FOTA 3MGCA 4TLLB 2GCIA 1GZVA 1VKZA 3PJDA 3FB1A 4L22A 4R05A 2CHFA 4Z7NB 2QZ9A 3OT1B 3P4YA 4EDFA 4M38A 5AVVA 3G05A 4MPTA 1TZ2A 3LGAA 4NULA 5EJMA 1B74A 3GEEA 4GPBA 3TW0A 1KAMA 4IFTA 3DE0X 3NJ8A 3K09C 5CB4A 3GFSA 1U0EA 4FOLA 1MPXA 1VPEA 3SDSA 4D6PA 1Q2XA 3TW6A 2OYSA 1ZVQA 4A6DA 2V7BA 1HX7A 1CETA 4C0QC 1FX0B 1CEYA 1F5NA 1QM5A 2ZSJA 1SKUA 5HMMA 5CFPA 1GQSA 2JVIA 3SSOA 3U62A 1OYWA 3JX9A 2P9ZA 1MNAA 2HD4A 3OIWA 3BF7A 5TV2A 3O9MA 4B40A 4WLNA 1O08A 4RS3A 2VT3A 521PA 2I03A 3E9MA 3SHVA 2OQ2A 2R5FA 4D8YA 2WIDA 1UQRA 2V7QA 1W59A 2J3DA 2QX7A 3MMNA 5C1PA 1U8YA 3AU9A 1Q7TA 1XMPA 2NZYA 2GYWA 1NU6A 1M1YE 2V74B 3I0ZA 4C7OA 2GSWA 4G4JA 3CC8A 3GEDA 3PQFA 4G0PA 4WLUA 1A8SA 4JJIA 1ZCFA 4Z0PA 4GBMA 3I1IA 4HDMA 3ZW8A 4FOPA 5J4HA 3F49S 3K53A 4PBSA 3H05A 3UFXB 4HEA1 1DFIA 2HPAA 2XUDA 2O05A 4F4DA 2VJKA 1SRQA 3HWWA 2AN4A 3PENA 1BS2A 4RJLA 4GQAA 4HYQA 4BPBA 3M83A 3PEYA 4LVNA 5ANRB 4Q6WA 2BAGA 1KJ8A 3R5XA 4CKZA 2BMEA 4QSHA 2ORED 5ERGB 3DT6A 3SNHA 1QHHB 4B3BA 3HJRA 4XJVA 3UZUA 4CIDA 3DV9A 2RHRA 5FFMA 4CKBA 3FUWA 3PRJA 1N2JA 3ED5A 2JATA 3WADA 3OE7D 1VLYA 4KPUB 4LPSA 4YYEA 4A2PA 5EIXA 5EERA 4CL8A 4EATA 4CM4A 2HWYA 4EPTA 2DLDA 1VHEA 1EUDB 5BQOA 2NZJA 4OQDA 3M1YA 5FPSA 2PLAA 1QGDA 3UYKA 4IOLA 4P54A 4WLOA 3JD4A 1V5VA 4ZPJA 3ZLJA 1I4OA 2NO0A 3K92A 5LA6A 4LNAA 3KQNA 1Z47A 2E4YA 2RGCA 2W2NA 3CX3A 2CCKA 5AI5A 1R8YA 2O52A 3UJCA 1IN4A 3HJCA 3WLNA 5FUQA 1BRTA 1VLHA 3QBEA 3UH0A 3HWX1 4J6FA 4KW7A 5FP0A 2JH9A 3VH1A 4AWXA 3PUNA 4DANA 2CLKB 3LNTA 4PO9A 4MI3A 4TMKA 5CBPA 3HP1A 4PINA 3PUIA 3EHDA 3MW8A 4Z4FA 3AXTA 2LE0A 1G7RA 2F1RA 1WXIA 4WUVA 1Q19A 1ST2A 1V3QE 3H5RA 4H59A 4W1QA 1E8MA 1WXFA 2J07A 1HM5A 1UIMA 4DWJA 3O7WA 2ZWIA 3K0CA 4PLZA 4R2IA 4JU9A 2XKJE 2F8MA 3T3GA 1P2DA 3LX6A 3SIPA 4MQEB 5CA0A 1R4MB 1P9OA 3VZBA 3ZCRA 1GZUA 1T3ZA 1AJEA 2DLNA 1H65A 1ENOA 4G5XA 4ZO9A 5LD2B 4NYJR 5ALUA 4IIJF 3MJCA 4BEJA 2PVCA 1UXGA 2EDAA 4UCQA 3W3AD 1WAMA 2HSEA 1REQB 2P2GA 1DOAA 4NWIA 1JQ5A 1G21E 3FZEA 4TYNA 1LRKA 3ZWNA 1GNTA 4MGEA 3CUVA 4AY5A 3KQVA 3WKCA 1TM1E 1U9IA 5DI3B 2Q1WA 3PNLA 4L78A 3O75A 3PHBE 4IP0A 3G1WA 2GCNA 5C52B 1V8OA 5AVXA 1F4VA 5CITA 1E79D 1A5SB 3GJ4A 4OP1A 1L1EA 1DC8A 1QIIA 2O8VA 4L8FA 4LY9A 5AW1A 2JGRA 3EVEA 2M98A 4DL9A 1SQ5A 1Q14A 1SOUA 3ZC3A 3ORRA 3MWEA 2Q8PA 1U63A 1X39A 2CBGA 3DT8A 3GNSA 2A7QA 3NIFB 1CY0A 4YRCA 2WF6A 1A9XA 2H0AA 4S1OA 3MWYW 1EHCA 4RIHA 3F6RA 3KTFA 3VPAA 2NZXA 1IQPA 2JJMA 1SHKA 3LWBA 1AURA 1V41E 2VBUA 2YCBA 5JWOA 1E4VA 3W4JA 5FNVB 3S6JA 5A3RA 4F6LA 1OTYA 4WXPA 1V7CA 3B20A 3DMGA 1ZFNA 3N70A 4PTYA 3KAQA 5DM1A 1AKTA 4LY3A 1TMOA 2ECFA 5A71A 5CB6A 3EZ6A 2C5HA 4RVSA 2EFEB 2Y6VA 2W93A 4LZJA 4RDKA 2N9UA 4PX2A 2IOHA 3AGQA 4V0QA 3P9NA 3NRBA 5I3CA 4A0FA 3B36A 3V7WA 3SZRA 3GGCA 5IDXA 1O97D 5FR2A 4O3MA 2OBFA 1AUXA 1HSZA 1ZUWA 2X0DA 1Z34A 2W7TA 2DPGA 3K1AB 1LY1A 2G17A 3PUJA 1M1YB 2GZ1A 2YXBA 3KXIA 5FBRB 4CHTA 4DCCA 4XQCA 3RU3A 1UOPA 3H5LA 3A2KA 1JQAA 3H2SA 5K03A 4MKZA 1XZGA 4JI7B 3KUUA 1T5TA 3MTIA 5IF9A 4Q24A 3AUSA 3NW9A 1OT5A 1DEKA 1NQUA 1YJCA 2OFXA 4G4GA 4KUGA 5FOSA 5U4QA 3UJAA 2IRWA 3G0CA 3KCNA 4IDCA 4R1MA 2Q5QA 2YZ7A 1DO0A 4BO0A 1S9HA 5B6IA 1H1LB 3ROEA 4CT0A 1E2HA 4J4HA 4Q7QA 3CURA 3S1AB 2HXYA 2Q8QA 3NM6B 4MA4A 3LT2A 2O20A 5CYOA 2C99A 4XR4A 5A06A 3TVDA 2PXHA 1U0LA 2I9KA 4B44A 3LPCA 3EPKA 3L5KA 5K20A 2XNHA 3D26A 1YZHA 2NPIA 4F8EA 1M2VB 2WJHA 1YRWA 1PGPA 4PW0A 2HADA 2PD4A 1JKXA 1OXSC 1CVRA 1ORIA 3DD5A 1WM1A 3UHJA 3LQYA 3RS7A 3ZDFA 2QRZA 3D4BA 1HR0B 5LP6B 4HQKA 2P9QA 2FFQA 2XB9A 3LFTA 1IOZA 4UBKA 1Z5OA 2P4QA 2XNCA 1HT2E 3DOFA 2QXUA 2R4TA 3O0TA 4KYUA 4YCBA 4C4RA 1YMUA 1KMHB 1WXWA 2EJVA 2IHKA 2QL5A 2X5NA 3H7AA 3RDPA 6LDHA 4W8GA 3EGVA 5A0VA 3EGWA 1COWD 3AI1A 4JX8A 3HADA 3IGFA 1BCRB 5SY6A 3H8SA 2FDCA 3LQ2A 1JFTA 1KKUA 2G7MC 4PPQA 5AVWA 3DONA 2O59A 5JZSA 4YRPA 3JCZA 4QYIA 3BB3A 5IBRA 2DT8A 3HUFA 3ZS8A 1JJBA 5T6BA 1S4QA 4RHEA 1B3BA 3L6OO 4UU1A 1AZLA 2X19A 1J1ZA 2W6ZA 1EFVA 4OQMA 1A8IA 3IP5A 3WRWA 3UT0A 3DT9A 3ZHCA 5I47A 2AZ4A 1S2GA 5E6SA 4KRXA 1NBAA 2ABWA 1RI1A 3PSHA 2R47A 3LX5A 2H5IA 2ZWOA 3UYLA 2WY2D 2AWOA 1S0UA 3INNA 4FMPA 1V1RB 2GMWA 2ZR7A 3O9VA 2I4TA 4RQBA 1NONA 2XQGA 5DX8A 3RHTA 1ID8A 4L27A 3TK1A 2OCAA 3WLAA 3G9QA 1GL9B 1FA9A 4UM7A 4CMBA 4MV1A 3L0IB 5FBWB 5JAMA 1QHFA 2VUIB 1KFKB 2CXHA 2G1JA 3LQQA 1NQTA 3NNNA 4PIVA 1G21B 1PGOA 4U2KA 5DM4A 3ISXA 3NAMA 4REQA 2OR3A 2D5AA 2PS1A 4MWCA 1DBRA 1K3TA 3D6JA 4FBLA 4WKPA 1E99A 3V55A 1I6WA 3TX6A 1NJID 1B26A 2C7RA 4II2A 4J76A 1XZJA 4TV9F 4YYZA 4DYVA 2B82A 4HLNA 4TVSA 3ZE9A 4X1YA 4CT5A 1O96B 4KU4A 1ZK2A 3SS8A 2VPZA 2ZOSA 1B0AA 5TQ2B 4BBAA 2HBYA 3AKCA 3BXEA 1WBBA 4XWGA 1KEEB 3CYFA 1F4PA 1MTZA 4KX3A 4EKGA 5FUYA 1L8AA 3G5LA 2RAUA 3KVRA 4EG6A 2GD6A 1S3FA 3EDRA 3OUUA 5EPOA 3RT7A 1XMOB 1QAQA 3PI6A 4PANA 2GDZA 4Q47A 2VCEA 2NU8B 4IDOA 1CG6A 4QHYA 3WQBA 2AOXA 4MTCA 3JQ7A 2HV8A 1N8RD 1J8MF 1XUOA 3C7DB 1PVVA 3E2MA 1XCMA 3BX1A 3EXG2 3IQZA 3OZRA 4QOHA 2IP2A 4GM1A 5JNWA 1B2LA 4TMWA 3ZOKA 5CEJA 4RD1A 1CUWA 1DC3A 4MNTA 4BGIA 3LCUA 4ENUA 2DUJA 2XHZA 2IDZA 3AHDA 3RK0A 3GDWA 2D1SA 1A77A 3AL2A 1WUHS 4H7EA 4HQ6A 4QATA 2D5LA 4EB3A 3BH4A 4NESA 4RJJA 3W2EA 1HURA 4JXZA 4M76B 2XMPA 5JBIA 3VR5D 1NBIA 1X15A 5ESXA 3TOXA 3WRVA 3TG2A 4DMLA 3IVMA 3G0IA 4II7A 1Z73A 4D3FA 2FFBA 4QVKA 4ZIRB 5C7OO 2X8KA 1MC8A 3ZPNA 1UKAA 2D2VA 1LPSA 1Q95A 2FPOA 3HJHA 1B2RA 3K9WA 1DT5A 2R44A 1NP6A 2VUHB 4W8OA 3YASA 4HKTA 3PQ6A 4KN5A 1XTSA 1RRFA 2O7VA 3G2NA 4K03A 2GFHA 4F6CA 3AR9A 4KVZA 4ZALA 3WV4A 3G9TA 1DKOA 1SVOA 3PLNA 5IEBA 2M9MA 2CYAA 1WP6A 5F9HA 1A9SA 2Z2ZA 4EG7A 3WKDA 1ZU4A 2WF9A 1A96A 2DQ4A 1ZA2A 3PL1A 4H35A 3ILHA 3CXCB 4B84A 3IUNA 2OQVA 4HNAA 1T0PA 4LYDA 4CG0A 3REQB 3V4LA 3X44A 4WGGA 3K9HA 4IIHA 3TTXA 1CTQA 1G9TA 2BDTA 4MIEA 2RGNC 3HJFA 4TQ9A 3JU4A 3HB1A 3R7WB 3EA5A 4HVAA 2FVXA 3N39C 4L5IA 4GE0A 3QUBA 3F3MA 5H3LA 3N8NA 4EUFA 1TT5A 4PSDA 1TO2E 1UMDB 2GPJA 2DTEA 3X43A 1HE2A 4PG5A 2ID8A 2YX1A 1HYQA 1PJSA 4TMXA 3CF2A 1HDRA 2EQAA 2ZVJA 5ES3A 4IGEA 2G9ZA 3PT5A 2YVLA 3RKSA 4ZK2A 5ICSA 4UFPA 2DSTA 2EZTA 2RHGB 3B85A 3L2OB 2L82A 3EXG1 4MOWA 3F8WA 3HPQA 4P36A 2A1IA 5BWOA 1J9ZA 4E21A 3L93A 1HK7A 2X0RA 1MAVA 1PJ6A 1CYEA 2QL7A 2XRMA 3BN3A 3LOPA 3PC2A 5LU8A 2WWWA 3OZGA 2X4IA 1Y6QA 2GETA 3HVJA 1XJWA 1B41A 2GFIA 2O2HA 1I51A 2R5NA 1YVEI 4DCNA 3H65A 3L1IA 5LA6F 4MS3B 1M2OB 2FR1A 1XAIA 2Z1MA 1RZVA 1X7WA 3BMXA 1PL7A 3P0JA 3UUGA 2OUKA 3T0FA 5TS2A 2X5XA 2K5UA 5G1NA 3EH2A 5ALDA 5IK2A 2IYRA 3C4QA 5PGMA 5ALZA 2QTWB 3P27A 3RTEA 5JXGA 3OIUA 4YCMA 5CB4F 4HV4A 5ALWA 2H8GA 5FI3A 2YQ4A 2QTTA 4DFDA 4ID3A 4AX8A 4K0KB 1Z8HA 1ZEJA 3Q87B 1X9GA 4FGZA 5F9MA 1DRUA 1MCZA 1UMBB 2QMYA 1IIRA 4Y3UA 5EXSA 4KV9A 3OQJA 1YUBA 2QEQA 3BQNB 3FLMA 3WO1A 4M1SA 4Z9XA 1FJGB 1IHOA 1F4LA 1Q5PA 4XYGA 1QDUA 1XQ9A 5LP1A 3A9CA 1BXGB 4JR2A 5CA0F 4TYYA 5IVIA 4KQ9A 4DSZA 3BICA 2ORVA 3QF7A 2H4FA 4Y9SA 4KAAA 5BWCA 3TUZC 2VUUA 3GGSA 5JAZA 4LRWA 3EEOA 1P7WA 3QX7A 3EWIA 4YRQA 4KYVA 4CDMA 4LGVA 4DMCA 3KZMA 1T2AA 3K5WA 1DVRA 3LD9A 1WDLA 3LK7A 1NKVA 4G2TA 3DZFA 1GYQA 3ZVNA 4J0JA 5DW0A 2H0QA 3M6IA 3QUTA 3IUPA 4I8DA 3WK5A 1P0CA 3C1UA 3CC4B 4DIUA 4EY4A 4DLNA 2HMYB 2VHJA 3K1TA 3U17A 1A95A 3GRRA 5EINA 3RSZA 3WMRA 1KYQA 2PCLA 1R88A 2V8BA 4BGUA 1KERA 2CLFB 4HXYA 1Z5ZA 3NBZC 3H2JA 4Y7CA 1Q12A 2NN3C 3KLMX 3QVJA 3EZGA 1ORHA 2QVGA 4Q3OA 2ZSAA 4FIZA 1MGOA 3GUCA 3IURA 4Y1FA 3KOOA 3SP1A 5P8WA 3CCUB 4EZEA 1ZINA 4B6GA 5KNLA 3IUQA 2B5VA 1NNUA 1ZJYA 4MR8A 5LYYA 5GVSA 4YECA 1X7XB 2AXNA 5AVOA 3NE5B 2CHVA 2O57A 1B42A 4IVRA 2VYNA 4H0NA 1G8AA 1X94A 3RUPA 2C7PA 2Y0PA 3A6PC 4PAOA 5IRCD 1MAWA 3OOSA 3AX6A 3W5CA 1D6NA 1BMTA 1MX5A 1K7SN 1E7SA 1BC5A 3F5FA 3HLYA 4YQYA 3G71B 2YIVX 3V34A 2DH6A 4PRKA 1E60A 1E18A 2XGMA 4QICA 4BUJA 2BFEB 5BP7A 4J0EA 2A9PA 5TQ0A 3KL9A 1O9HA 3DZGA 4BBJA 2G1AA 2VP0A 3ANXA 2ZAIA 4QOGA 3UY4A 2VRCA 4WNAA 4ZO8A 5CLFA 1HF3A 3T9AA 1T6NA 4M9XA 3SDBA 3R0XA 4GP9A 4F9TA 4Q9IA 5I9LA 5K8VA 1JEYB 4XD7A 4BMOB 3R3ZA 1NU8A 5F3WB 4IO0A 1ZRNA 4A3SA 4NZ9A 2EW8A 1MH9A 4LMAA 1JB1A 4KBYA 4I66A 5FCDA 3BCRA 2OLKA 3RSGA 2C2YA 5JMTA 4RZ3A 3FMGA 2ZE8A 3BE8A 1FDUA 3RJ9A 1WUJS 1UD4A 2C77A 4KXVA 4A91A 1YR7A 4R3UC 2QTAA 1TQ6A 1SXJE 1T5DX 1CUXA 1YR1A 2ZQZA 1VCHA 3P4XA 3REGA 5JZMA 1JWBB 2OFFA 3ER9A 4HWOA 1LB1B 4MS1A 3STHA 5KOYA 4C6TB 3LLCA 1XNJA 2VQFB 2WAYA 3LWDA 4ZU3A 4C3UA 1KGDA 3FCSB 4OUDB 3QYJA 1Q91A 2Q5JA 3FGOA 4RQAA 3PXXA 3FJYA 4G26A 4C14A 4YEDA 2Z04A 3BTSA 2H4ZA 1SXGA 3DFZA 3QHAA 1XGKA 1VQ4B 2GAJA 4WBNB 2JGEA 2NXCA 3CKMA 3L7DA 3S0JA 2NUPA 4QVJA 1DG3A 3T4UA 3FXAA 1SVSA 1W75A 1E58A 3C6BA 3SZOA 4MLDA 3U31A 4U2EA 1IXYA 3L0SA 3R6WA 2VT7A 3G6KA 3ZCSA 4R41A 4CQMA 3L4JA 4C2TA 2ZUDA 4ZYZA 3H04A 2H2DA 1Y42X 5J2UF 3R6DA 1TAUA 2IPXA 4YTEA 2C29D 1SPBS 4KMMA 5AJXA 3LUGA 4BBPA 1OU4A 3GP5A 2X40A 1XALA 5IT5A 3A1FA 1JDBB 3I4CA 2XUAA 1D2AA 5J35A 4N01A 1G17A 5DLDA 5F1YA 3J80A 4G7WA 2R96A 2JI4A 1J9GA 4Z53A 3T51B 1MORA 2EJBA 1FYDA 2AMYA 1U3CA 1GQYA 4OY3A 3HSKA 1Z29A 5TE9A 5FDFA 4GX0A 5FHRA 2AWNA 2Z3WA 3HEMA 4Y9RA 1VQOB 3DDHA 2LPMA 4LRQA 4ZU1X 3AF1A 3ODPA 3PHJA 4P7KA 1H1TA 1IK6A 3UJBA 1J8YF 2AZDA 5BSMA 5ITZB 4BMXA 1Z75A 1MJ5A 4H27A 3TLGA 4ZDJA 4NHOA 3B13B 1IPHA 1XXHA 1NMXA 3KDPA 2NTJA 1U7DA 4HPJB 1PR1A 2EDCA 3DGFC 1QP8A 5IAOA 4FZRA 4IHKA 2V9PA 4ZOAA 5DMXA 4FZJA 4YJDA 1Z56C 4W63A 3VKVA 2ERXA 2Y66A 1P1IA 1J5PA 4DN6A 5SY9A 4D56A 4IW3B 3BQ9A 5FA8A 2FWNA 2OWDA 5K4GA 4KOEC 4F60A 4RM0A 5ETJA 1NPTO 4CE6A 5EJEA 2JGMA 1L5YA 4WJZA 4DRXA 1FTSA 1IAQA 4PM4A 2YS6A 5D87A 3RU2A 3T9DA 3ZDRA 1QONA 4F3YA 2IKQA 4D8VA 2F1LA 3PYMA 3DVAA 2B1QA 2UYYA 2W2LA 3AZOA 3BWDD 3P45A 2FQXA 4KWIA 4OB6A 2D59A 3QPUA 3FOFC 5A5GA 3QPBA 1ONOA 4DPKA 3ILSA 2R60A 5KYVA 3PCXA 5L3QA 1NMSA 1VFPA 2GPBA 2WD8A 5KJ6A 1Z5VA 2CLEB 3GVHA 2G4CA 1G1MA 3WC4A 3E61A 1W29A 1V9LA 3OEWA 2GLTA 2Y1DA 3GWGA 1C9KA 2BW0A 4JEIA 4P3XA 4QPZA 3VPDA 3PHHA 4X00A 2VWGA 3K3PA 3ZZMA 4RVOA 2RMKA 3SWWA 1HNXB 1QC5B 3TZ6A 2ODBA 4FUQA 5IVHA 3GJ3A 4MR9B 4KPYA 1A8QA 5TGDA 1O6ZA 1JHQA 4W5OA 2AG5A 3CB2A 4J0FA 1Q11A 4RGYA 3LDGA 2IKSA 4FDVA 2ZPAA 2F1JA 4HXEB 4MUBA 4QUBA 3WBKA 3OX1A 4TN5A 2C5EA 4RL4A 2Z8ZA 4M0FA 3GK3A 3GZ4A 2FTKE 4L4UA 4QGGA 4S1NA 3KJXA 1KZ4A 2C2XA 4CCWA 4DA6A 4Y6LA 3CG0A 1FSPA 3C3BA 4TV8A 4JB0A 4LDAA 3DGEC 4LV6A 4DLAA 1IUPA 2C4VA 3IP3A 4H6XA 4MI9A 4DLSA 1YBFA 2FPLA 2CMKA 1WABA 1P7YA 1K92A 3LBYA 3O8BA 2WF7A 2JLVA 4XQFA 1WXQA 1C1XA 4GRDA 1E1MA 2HMWA 3SR0A 1KNXA 2RH4A 1G9XA 2V0CA 4GSYA 4NBWA 1E92A 3QFRA 4MHSA 2CWDA 4R5HA 5C8YB 2GJSA 3RRNA 1TXGA 2Q0HA 3TD6A 1J0DA 3DV2A 3RTDA 1W87A 2B4RO 1ZKDA 1I5OA 2BEVB 2N1MA 3P2KA 4GUAA 4DILA 1IN8A 5DBEX 2G5PA 2F00A 1LW6E 3FY4A 2CGEA 4BMYA 3DLAA 3UPUA 5CT9A 2HK6A 1G66A 2M6SA 2XUFA 3HP7A 1V95A 3C16C 4JU8A 1ZESA 4XAQA 3PXGA 1PD0A 1SXJB 4BNNA 2UZ1B 2Y1LA 3HU2A 4M9ZA 1JZTA 4FR0A 2DAPA 2VJNA 1DE0A 2ATCA 1XMQB 5HUHA 3BTUA 2GBFA 1ESEA 2J33A 1RCUA 3DCIA 2VWPA 3GUUA 1KVTA 4QYTA 4ARAA 2D7CA 5LMCA 1DJOA 1RWXA 4DSNA 3AINA 2HHJA 4RVNA 2J08A 2UVDA 1Y3BE 3F4KA 2HU5A 2AMVA 3A6JA 5CNIA 1MEEA 4ZXPA 3WVNA 1T3LA 2VBTA 3DMPA 3KQTA 1PFQA 4M87A 3MGBA 3C7AA 4RXUA 4WK0B 3TCXB 2H9IA 1K7XB 1QFJA 1Q83A 4BNVA 1P2TA 1CR6A 5CXUA 1QHYA 1SHZA 2O7NA 4HUQB 3IMFA 3U9TA 2I3ZA 1ACJA 2PBRA 4TZTA 2M1ZA 3MFYA 3RG2A 4HB4A 3B1YA 4HNRA 4JJEA 4JJKA 3WNBA 4LK3A 4MQLA 4J0CA 1A98A 1XL1A 4ZI2A 1R0WA 2G6TA 4QWMA 3ICEA 3PPXA 2PD6A 2QLNA 2VSFA 3DHYA 5IX8A 1B6SA 5CIQA 3OQHA 3SQWA 1LPBB 2W6ID 5BR4A 2NTYC 4EPYA 4YREA 4KVGA 1MABA 1PV1A 3DHWC 4XASA 3ZCXA 4GPAA 3C45A 1NLUA 1MUUA 1WEKA 2XLCA 4DC0A 3WYAA 3COPA 4HAOA 1F7VA 1THGA 2OAGA 2CFRA 4MYRA 3UHPA 3W5IA 4G86A 1JG7A 4D57A 1XKLA 1RYMA 3WWDA 4EUEA 2A0UA 4UHJA 1YB1A 1Q7EA 3D1LA 5HKKA 3GN1A 1VKJA 3GOHA 4D4HA 4CHGA 1GL6A 2BM1A 5FO0A 1VJ0A 2Y77A 5CGQB 1TK2A 5ALHA 1UADA 4Q9AA 1G291 2W6OA 2VPQA 3Q88A 3ET5A 4UATA 5A2QA 1AGXA 1ZK1A 2QKYA 2J5RA 3I23A 1E9RA 1T8WA 3D6FA 2WUGA 5KYTA 4OKSA 1IATA 1QBKC 2ZSBA 2RCYA 4YJGA 2IH2A 3LQKA 2QRUA 1FFEA 1YKGA 3EFOB 3ZQ6A 4O8CA 3D64A 2Q3FA 4DV6B 4KLRA 4BU1A 3OFND 4GXQA 3IR7A 3O4VA 3BNWA 1FS4A 2BEUA 1X6VA 2Q4DA 1NOJA 4WESB 2NNWB 5ILOA 1M66A 1Z7YA 3MELA 1Y0BA 2V9ZA 3G1TA 5CW2A 5B5SA 3QXCA 2J0UA 3U1TA 2HWWA 3QKRA 4D8XA 1BFUA 1JG2A 2MYUA 4Y1RA 5BSYA 3NBXX 1A2OA 2SKCA 4X9XA 2FZKA 1NN1A 1RI3A 3KR9A 1W6UA 2OO7A 3EUFA 6Q21A 1HZZA 1QV7A 3FHTA 1RJWA 4WKGA 5HIKA 4KOAA 3C0KA 3N2EA 1EQAA 3NKFA 4AJEA 1DZIA 1FYEA 4KKXB 4HFNA 1D0IA 3O8LA 4JODA 1Z6GA 4UM5A 4J3NA 5F12A 1PG5A 2HHLA 2XDQB 4P82A 4E14A 4JP3A 3ICPA 5FUBA 3TSZA 4PCUA 1ZD1A 2DHQA 4XCVA 4DQXA 1NF3A 1GVNB 3P94A 3R5KA 1FMLA 2GI4A 3GXOA 1IPEA 3DO6A 3RR2A 1KZGB 2KPOA 3AFIA 3I5UA 4JJZA 3SF8A 3VSAA 2II6A 2AZMA 4IGFA 2WV7A 3HHEA 5CT4A 3ZX4A 1H8HA 4D3SA 4LHWA 3ONVA 1RP1A 2RHMA 3UHFA 3HSSA 4M98A 2A0XA 4CKXA 1XROA 2SICE 4X44A 2JEYA 4GVPA 3R0JA 1BGXT 4DRZA 2FUG6 4KGDA 4XOUA 5EJ4A 1PR6A 3D5TA 4LEIA 1QYDA 1WTAA 4IR7A 3O5AA 1WDMA 1IHXA 2ACVA 3GZNB 3KCQA 3KYDA 4IH9A 1NKTA 4J90A 3TLMA 5SYMA 1Z5NA 3RAJA 3IUSA 3N2KA 3WRXA 3GJ5A 1QYIA 3S40A 2IW1A 3PVSA 4ZV7A 1M33A 1NJGA 1M8FA 1U0HC 4ZVLA 3WDMA 1P0QA 3I64A 1NPYA 1FU4A 3DOHA 1KFEB 1SB8A 1J8VA 4C6SA 3LC7O 4DG9A 3O03A 5HR5A 2HA3A 3SC2A 5EG5A 3NXSA 4Z3DA 5I7AA 2P1DA 2CLCX 2IDJA 3FFTA 3VX4A 6GPBA 1Z0UA 2R87A 4H9GA 3EC1A 5DCLA 5ALLA 1MXHA 4CKYA 2DX7A 3NEAA 3RYFB 2ZBEA 4EG3A 4ZGQB 2AG8A 5EHNA 4D8TA 1JHUA 2ZTSA 3D4IA 4FFRA 4TS4A 3W04A 1I14A 2X4GA 2QU8A 2YH2A 4LXXA 2ZIFA 1FDOA 2JIQA 2P4HX 3PDIB 4CL0A 2O1XA 3JYOA 3BGVA 5E8RA 4HSGA 1QH0A 3EQ8A 4ONEA 4X66B 4X8MA 1T8YA 1V43A 1OUMA 1CQIA 3KPYA 4O5AA 4PZYA 2A92A 5CXXA 2OK8A 3OE1A 3OCWA 1JJVA 1QLWA 3QFHA 3MZ0A 1KAHA 4QECA 4A0QA 4D46A 1EFRD 1GGFA 2OZEA 4MCJA 5TGTA 3UGTA 2XMZA 2JLYA 3W34A 4Z8XA 4KE8A 3WGTA 3C6XA 1FCJA 1QZUA 1II8A 2Q7XA 3D7NA 2HMTA 1WD5A 1MQAA 1VRVA 2RHTA 2A1UB 1USUA 2WM8A 4BYGA 3HBFA 2YBDA 3NRJA 3D4NA 4U7PB 5EMLA 5CT8A 3WLJA 3AKYA 3DMFA 3OOWA 4I5EA 1ZH0A 4TSFA 3UIEA 5BN3A 2BTEA 3OWXA 2DBZA 4AY2A 2WB2A 1EZ4A 2I1WA 2QMQA 4B6RA 4DA7A 1JSCA 2X86A 2NUTB 2HGSA 2Q6OA 1BHQ1 1NDUA 2A6PA 3B1ZA 2X0IA 3DBLA 5AUPB 5BMOA 2OV6A 4ILEA 4K88A 4F5WA 1ZUNB 1KMIY 1V0EA 2GKGA 1SG0A 2H5LA 4HSEA 4OHKA 4Y67A 3UPTA 3T6KA 1OC4A 2BCEA 3C97A 1KYTA 2WSIA 2OHOA 2Y1OA 2ZUUA 1WCV1 2B98A 1W0JD 4ZA2A 5TB5A 4I4TA 3FZYA 1QU3A 1MO3A 4IQFA 5DTJA 3VDQA 3UC9A 1S9DA 2Q2NA 5GM1A 2YOGA 3ZHUA 4MP3A 1MIOB 1YVRA 2YMQA 2AJLI 2EX0A 4A0GA 4YPOA 3CCRB 1PIWA 2FG6C 4CR6A 3ZV6A 3AESB 1QUFA 1E77A 3IBGA 2VTEA 1XDUA 4MLCA 3WNZA 3D0QA 3DAFA 1SBHA 5KYXB 3OVMA 3DYVA 3Q8XB 4FYKA 5CVEA 3KXPA 3LZDA 2LP4Y 4IMIB 3IQWA 3Q0TA 4J3FA 1QDEA 2B2XA 1SR8A 4MEAA 1VQ9B 4EKYA 4WHMA 1CJBA 2OORC 3AUAA 1KSJA 2VJLA 1X7YA 5LIRA 1BNCA 3VO8A 1EVYA 2P9HA 3JWIA 2PZGA 4U7FA 4IFBA 3VV3A 3V3TA 5IT0A 3VZSA 2PV7A 3TN7A 3TX2A 3UN1A 4PZ9A 4DDWA 3E3NA 1QSGA 3N07A 5KOJB 5FH9A 3K2EA 3I61A 1OWLA 3OBIA 1FUYB 1CR4A 1F9AA 3FN4A 2FRXA 3EXEA 4FQ8A 4E0FA 1KY5A 2ZT7A 2WIGA 2V3VA 1D1SA 2PJRA 1ULAA 5EC8A 4OQZA 3UG6A 4YMHA 2YV5A 3TFOA 4HLDA 5KDLA 3I2KA 5KCZA 2BSAA 1M83A 3LP5A 1NV9A 2H4WA 4NPHA 4WWVA 2VYQA 4EQZA 1A4RA 2RI1A 2FP4A 3QLVA 1JR2A 3P71T 2PX4A 1PAUA 4Q37A 4TWRA 1USIA 2JLXA 4DT1A 4DWWA 1U0TA 3PUWA 2VNKA 3JAKB 3JVIA 4IWYA 2OGZA 2Y3IA 1RYEA 1T0IA 5JNRA 5C5IA 1P2FA 2QRPA 4AIRA 2CY0A 4BQPA 8ABPA 2Z58A 1N6KA 4KJXA 5BR7A 1EJ0A 1ZOOA 1LTQA 1XZHA 2JCXA 3Q1LA 3QPDA 4G5QA 3WOHA 1QQAA 1YASA 3FNEA 2OOKA 2YS7A 1EFAA 4TV8F 4YPFA 1GOTA 3MUEA 2NPOA 3CR7A 5DI9A 4HAZA 3WAJA 2ISCA 4QTTB 1GJRA 1FP2A 5CH8A 1D4ZA 3JQBA 4M22A 1OWNA 1Q3TA 4UXHA 3CINA 2P0AA 2QE7A 2JN9A 4ZVSA 2RAPA 3E0XA 1VP3A 4KTVE 4A2QA 5CTJA 1OHHA 1R8SA 2YY6A 4KBGA 1J25A 1CR0A 3CW9A 4RDJA 3NHRA 4LX8A 2H52A 2ODPA 4KUHA 4BYMA 1FJHA 5BYJA 3L46A 5GJCA 1YR9A 1YNSA 1GA4A 3FSRA 3SNKA 3R4VA 4D9MA 5CVUA 1CE8A 4MROA 8GPBA 3RUIA 1E2EA 4P2NA 4HN4B 3T5TA 2FPWA 1YS2X 4EYGA 1YI1A 3K0FA 1UKVY 1WZIA 4URWR 1Y5RA 3FMFA 4Q4LA 4RETA 1VBMA 4M9SA 3U7QA 1ODLA 3B1WA 3LVRE 5KWJA 1ORDA 3IX7A 3QRWA 2G5TA 5HIAA 3AY6A 4NONA 1BE8A 5IJAA 4BXOB 4YVFA 5CHEA 2A1TS 1DINA 2WVGA 5DXFA 2WQ7A 4B6JA 4FZ3A 2XYGA 4R01A 3NHPA 1MC5A 2IA5A 1PLLA 3ZH2A 5CNMA 2B9EA 1SB9A 2RHCA 2AEFA 2W8BA 3SX0A 1EAMA 5JSYA 1HL7A 2ZSDA 1MEJA 1KBOA 2YYYA 3LCMA 1DSSG 1ZSYA 3F46A 3PC6A 3Q1KA 3M34A 1VQLB 4S1WA 5G53C 5E2BA 1E9SA 4RW0A 3GLKA 1AB6A 2YWGA 4QARA 4D02A 5B1SA 3ZN2A 1TFRA 3GH3A 3Q2KA 4DR6B 4X41A 3LSTA 2WPDD 4DCOA 4M7OA 2O8NA 1EDEA 5TEWA 1VCMA 1YZKA 3G13A 4Z4RA 1ULHA 5FOQA 1A2QA 3HKBB 1V37A 3G5AA 1X2EA 3GJQA 4M99A 4JHLA 5E1DA 3VDRA 2GZAA 4G4SP 3HY6A 4GM0A 3UQZA 4MA0A 4IMRA 1VSUA 1D6SA 2PE5A 5JAQA 4BFXA 3OM0A 1WDTA 4YAUA 1E6MA 4O02B 3SR4A 1N7JA 1W88A 1M74A 3LXMA 3CLUD 4EF6A 1Y1QA 2QIPA 3BWXA 4EI2A 2A5LA 2CXUA 4X7CA 3P2MA 1ZAYA 4Y98A 3TZEA 5I9BA 5AVQA 3OU6A 4URXR 5HKLA 4ALNA 4C2AA 5CVTA 1EE9A 4F93B 3GJTA 2OHFA 3A7EA 5H4GA 1CJMA 2ZITA 2VHTA 3K0SA 1ESZA 1TCAA 3EPPA 1X7ZB 2HREA 3B12A 3DF7A 4PX3A 5B4VA 4B80A 1SA0A 2HKIA 3NT2A 4JLWA 1NR5A 1ML3A 2BSQA 4LSZA 5EFOA 1S2NA 1MVNA 1X1DA 3C4VA 3BAZA 3SOPA 1N2XA 2PGXA 4XARA 5C37A 3S44A 4FWBA 3T94A 4WD3A 4PTLA 3V2IA 5DNWA 1THMA 1MA0A 3AI3A 3NANA 3MCWA 2CLSA 3EVFA 4OBXA 1QPBA 1CHNA 1VQPB 1KXZA 3K0KA 1TJ3A 2M6KA 4F3NA 2HCRA 4IOJA 1EIWA 2FWBA 2N0SA 4LXUA 4KGXA 4TS1A 5EIBD 2WUDA 1W76A 4IZHA 3ZE1B 4MR7B 4Q3NA 2J31A 3I6IA 3ODGA 3F6SA 3CT4A 3KKMA 1YJ9B 2ZRNA 1S8NA 2ZPUA 2Q2QA 3JWPA 3VMMA 2QRVA 1N5IA 5EQDA 4BZQA 5JY6A 1SJ9A 1E3LA 1O3YA 3DE5X 4ROSA 1O0BA 3I4LA 3EXHB 3KZOA 2IYWA 2FNAA 4EMBA 3OO1A 1RXUA 2V0NA 2XWQA 4IDHA 5JV5A 3R7BA 3RADC 2TECE 1AQNA 1ADBA 1SAYA 1JSLA 3KWLA 3W2FA 3VR3A 3GGOA 1QF6A 5DU2A 2GS9A 4IVQA 5EY5B 1GGJA 1KYXA 4E5VA 2C9YA 3RLIA 5BN3B 1Z06A 4J03A 4YO7A 1ECPA 3AFNA 2JI9A 3QNMA 1JLHA 3VC3A 4JSRA 4AZ3B 1BYIA 1UMCB 1VPDA 2JFBA 4B5LA 1O9BA 2IT1A 5GJWC 4DKXA 8LDHA 5HPYB 2HA7A 3HFSA 4U7GA 2AK2A 5AKEA 4P9SA 1Q2UA 3HTXA 4O63O 3ZW9A 2DPHA 4HZIA 2X6YA 3QEMB 2WTNA 3DBRA 4X3OA 3P2OA 3ZJVA 1I0IA 1QAMA 3CCCA 2GHQA 3FAKA 4X84A 1WEHA 3RGWS 3ILYA 1OJLA 1QIEA 2J30A 4LMRA 4QDTA 5CPBA 4XDZA 2WR8A 2CE7A 2JJQA 2QN7A 2WI8A 3DJFA 4CIBA 4FE7A 3GARA 3O4IA 3PR1A 5IUJC 5CNKA 1P6QA 5MDHA 4MV9A 3ICCA 1L4BA 4FFDA 4UHHA 3R3VA 3T7KA 3Q8LA 3OSUA 5B36A 3I8SA 3OZEA 4M0PA 3V6MA 2FW6A 2JGLA 2CNBA 4XW2A 4PHTA 3A9WA 4EP1A 3ZY5A 3MWDB 4G9GA 3VZPA 4WKNA 3BMQB 2QA4B 1NJ2A 4QFBA 2FF5A 5IVDA 4LDNA 2XZOA 4TM7A 3ACCA 2JAPA 1QGOA 1EKXA 1W2GA 1XZAA 1FSGA 4MVJE 4PC6A 1HYEA 3AQIA 3A8TA 5CVCA 5D7NA 3RUAA 3TGWA 4CKEB 4QV2A 3OLCX 2QVBA 1AO0A 4ZK6A 1J1IA 3DBVO 3O2NA 2FN9A 4JR1A 2M6LA 3AOGA 3GG2A 2OHXA 4MKRA 3QXJA 2OAQ1 4HWTA 4OK3A 4ZWNA 7MHTA 2GVZC 2X3YA 3LX4A 2RGEA 1FOEB 4PCLA 2QRMA 1V25A 2QPAA 2JIZA 3IIJA 2RAFA 3BKWA 4I8IA 5GMOA 4BIMA 3WMFA 2HIHA 3MWKA 1UD5A 1MW9X 1W581 1Z4NA 2OCLA 4IG9A 2NT3A 2YC2C 3L8YA 4UHCA 3B6EA 1QORA 2DUNA 1P62B 2P2DA 5K3FB 3T3PB 2IEBA 1GPKA 4OQYA 4W5NA 5EGNA 1E9CA 5BSFA 2R6GA 3S68A 4G4SO 3U5ZB 4OVKA 1JIIA 2JARA 2YWFA 5LC1A 1Q0PA 1D2EA 3KT0A 3KAKA 1K7YA 1WVIA 3R3SA 1FUKA 4K9MA 4R31A 2XMDA 3SJ7A 1SCAA 4YCLA 1NVGA 2WT4A 1ZCBA 1NWCA 2VHZA 3LPMA 5KQGA 3C14C 5LD2C 1SC9A 2A7XA 1G4UR 1QQ7A 3KS9A 3GD5A 4ND4A 3GBSA 4RLQA 5CFLA 1U2GC 2ATEA 3SICE 5DM2A 2BC9A 4TT3D 4UUOA 1NFQA 4ZN6A 4I4TF 5EWLB 3RBVA 3RG8A 1YVDA 4W1SA 4XOIA 4ZVOA 3FFBA 4KG7A 4QQRA 5DX0A 2ZJ0A 5K4AA 3EISA 2F8LA 3TDMA 3LP8A 1SKYE 5ENDA 4NH4A 2J41A 2Z4RA 4J43A 1Z45A 3BRSA 1Y63A 3OKFA 3ZCQA 1KRWA 4O4IA 1RQ2A 1UD6A 1ZGCA 3FVRA 1E63A 4HDSB 2NZVG 4YUAA 5CDSA 2W98A 4JBXA 4GKBA 2PJZA 3CLSD 1WXDA 4OUKX 4X65B 1J99A 1CP2A 2FFAA 4HGQA 4JUCA 3OW7A 1A88A 3MAGA 2P6NA 1DDIA 3L0ZA 3ZYZA 4BLQA 1JN0A 5EKXA 3FTEA 4NG5A 3RRMA 1L6RA 1YF3A 3ZE0B 1NRWA 5CX1A 1BJTA 1FFGA 4XGKA 3UG7A 4G81A 3PFIA 2BF7A 3M6LA 4CRWB 3K6KA 3RKRA 3V2GA 1ZCAA 2JHPA 3WIBA 4NCBA 3WWPA 2QYTA 4PYKA 1CNMA 4UVGA 3PJFA 1NAIA 1W4AA 1U4SA 1WPXA 3HYRA 3L6EA 5DBIA 4MXDA 1OFGA 2X8WA 4DV4B 3D6AA 3ZIDA 4AYTA 4AXXA 1NYQA 2CHQA 5LQAA 4ID9A 5DNVA 3HA5A 5HE8A 5JJLA 3F4LA 1MXFA 4ND2A 8OHMA 1ZHOA 3ZV3A 1VB3A 3PFGA 2G0AA 2AW5A 2YRFA 4H1WA 3TE6A 1CZNA 3E81A 4RC9A 1MVOA 1F48A 4JL8A 3V4PB 1GZ5A 4D3YA 2CNDA 2J5BA 4AY4A 4EH1A 4TKOB 4GH5A 5JATA 2VTBB 3VPGA 3S8EA 3NDJA 1AN0A 1QFXA 5CM9C 3BK2A 4MWZA 2NSHA 4PGGA 2BFDA 1KYIA 4RPCA 3HUTA 1BWQA 1QIDA 5KTTA 1VPWA 3ZHTA 4DDKA 4RBNA 4DZRA 1XPOA 4F4JA 1ZH4A 3GMIA 2PUTA 1I33A 2J9YB 4K9DA 5ECYA 2IYXA 5EXDA 3MTJA 5IS2A 2WJIA 1R15A 3H6GA 3AEUB 2O6HA 3UAOA 4QQ8A 4HNTA 4P2BA 4PRYA 2EATA 1GFZA 2AV6A 5C35A 1Y9AA 3KVVA 4WCFA 3NX4A 4UOZA 3GLTA 4HF7A 3SYKA 3M8KA 4F1KA 3GA7A 3EXIB 4F8JA 4H16A 4E03A 5BYKA 2AOUA 2G5CA 2IY7A 1RABA 2AKYA 5LP6C 1OBFO 3OEHD 3G17A 4QODA 3ZV7A 5AKXA 2QTVA 1VIDA 4E33A 3ASQA 2M5SA 4I55B 5KX5A 1B93A 3LLVA 2H1SA 2JCVA 3ON5A 5CW1A 1LA2A 2R751 4U2DA 3E2PA 4LGCA 4N0PA 4QFCA 1A3CA 4U7HA 3VR1A 5B7QA 4GWKA 2HQOA 1E1CB 4B09A 5A04A 2O3RA 3EK2A 4FXOA 3A26A 2FQQA 2Z1DA 3K35A 2KYRA 4FBGA 2GN1A 2QTMA 3DFMA 2G9QA 2C88A 4AW9A 1IXZA 3DOJA 4YP7A 3Q7TA 3HXLA 1KOFA 3KQQA 4U5QA 3PHCA 5CTAA 4BJHB 2YJ3A 4X8OA 5IAJA 2Q5CA 2VJQA 2PMBA 4FI3C 2F3TA 3BHIA 4CTOA 1ZHHA 1QPGA 3KYBA 2JFGA 1R6VA 1RWMA 3I9FA 3AEYA 4C9BA 1JDVA 4JJ4A 4BE9A 1LDGA 1SOWA 4BRSA 3C3YA 2XKKA 4XUDA 4LJ4A 1ZH2A 3KTAB 4O2AA 5DASA 5I01A 4YCNA 3DUWA 2ISSD 4ARCA 4INPA 1U4OA 2OBBA 3AJ9A 4X71A 5CLIA 1E5QA 2V65A 2AEMA 1M34B 1K1EA 2IYYA 2XUPA 3NU1A 4O2BB 1HG0A 5FB3A 4YV1A 1XA3A 4RD6A 4OJYA 1TVKA 4GMXA 1U8AA 1KE2A 1GQOA 2CFCA 4XRGA 1C3VA 2NU6A 4B81A 1E2KA 4NNOA 5J2TB 1MEOA 4PAAA 1LCIA 2OAP1 3FWNA 3L0BA 4MVWA 4B76A 3PD0A 1SKYB 1IIBA 1Y8QA 4U63A 1CJCA 4CT4B 1USVA 4OBEA 2Z8YA 3DV0A 4CV1A 3OC6A 2IHNA 5FUWA 2H1RA 3INYA 3HDHA 2RD2A 2QG4A 4WOKA 4BO4A 1T8TA 3IP1A 4P3OA 4S2EA 1FNSA 4C0WA 5CDGA 2CDAA 1GA6A 1WSAA 4FKBA 1AE1A 4GKAA 4JP8A 2GJKA 1JTVA 1C9NA 2D06A 2L18A 4NENB 1JFFA 3FZNA 1FRZA 4DIKA 1KF0A 1Z4JA 5EYPB 2JIDA 1MOSA 1SK8A 1TUBA 3A0RB 1QIFA 3ONFA 3CXUA 4DCSA 3IPRA 1LSJA 1W2WB 3UCEA 1NRIA 2VDWA 2FXVA 2RAVA 3WB0A 4D5EA 4MKIA 4HEHA 4L4XA 4LC1A 1SUCA 4WKOA 1QWSA 5JDIA 3ZDDA 3J81A 3ACDA 2HRZA 1E3WB 4ZXFA 1YL5A 1ZUHA 4BMSA 3ONWA 3VGPA 2QM8A 1Q7YD 1B8NA 3BF8A 4PZPA 4WK6A 4D3ZA 1C8VB 5AM5A 2JDID 1HO3A 2R8YA 2YZMA 3NTUA 3VGJA 4EHDA 4DOMA 1H2FA 3FBWA 1SWWA 4XB1A 5FA6A 4R1TA 4BQOA 1V4NA 2JGJA 2OGUA 3BE4A 3BJEA 1IONA 5I5EA 4KMRA 4XYBA 3CE9A 1GGKA 1LLDA 1OKKD 2DHEA 2J6HA 3OJFA 4LPKA 4QA9A 5FTJA 4EUKA 2Z3ZA 2WICA 5HM8A 4A23A 3R5HA 1VQ7B 2AZXA 3B5IA 3BD6A 2VA8A 2YFYA 4TKVA 3P0RA 1WCWA 3LH5A 4RIEA 2HQBA 2NYUA 4I0WB 4KO3S 1VCNA 4KN6A 1LTHR 3DULA 2FEMA 3TWOA 3RNLA 4BMNA 2PQMA 1PL8A 3RVPA 4Q03A 5B12A 2NQTA 2QNBA 3B3GA 4B73A 3CVUA 3OZIA 4IOKA 1J2UA 3CH7A 3OOEA 3F71A 4ERXA 4IJ5A 3SVZA 1X9IA 2RHJA 3OHSX 5HEKA 2PRYA 2VHVA 3IQIX 4GL4A 4IH1A 2I2XB 4Y6RA 4Y6PA 3FSGD 1ACLA 3VI4B 2P7HA 3M1LA 3EEBA 2OPBA 4RPKA 4BKOA 421PA 3AIMA 4PIPA 2CXSA 1KPHA 2MSEB 2QTGA 3UGQA 1YGPA 3PI7A 4OB7A 1KS9A 1E9EA 4GPEA 3UUFA 4IHJB 5F2NA 1QQBA 1NY5A 3BIOA 3D1VA 1Z0KA 3LT4A 3OFVA 1K3FA 4XX0A 3OQNA 2HLPA 1PJ7A 4MWBA 4PGHA 1EM6A 1M75A 4V03A 4ZD6A 1WPRA 3O83A 2HLNA 2LW7A 2Q7OE 2FRDC 3VTZA 2PKCA 3FYHA 4D41A 3O73A 3URKA 2XGJA 4TTIA 1UXHA 5ALFA 1K6JA 1YZTA 5BSHA 5JMOA 1T4DA 3ROTA 3G4SB 4LV8B 4M1MA 1PZXA 2B5WA 3CMCO 1E0KA 3WGMA 1V6CA 4PNPA 3NIGB 4OHUA 4JLAA 1G3RA 1UP7A 3LPLA 4J1TC 4R2WA 3VI3B 4N0QA 1VLVA 1YQGA 4U2FA 1XWFA 4MDHA 3RVQA 2P5UA 3LCRA 1FLVA 1QQ6A 1TVMA 3FUCA 3HFRA 3NNSA 3DL2A 1P1BA 5JVDA 3SY8A 1CP3A 1O95C 2PK3A 3OIGA 3D4LA 4MWTA 1UBSB 2RBKA 3CW2A 1QBGA 1Z2OX 3CTAA 1RM0A 3EZFA 3K8YA 2IP1A 3ZWQA 2O7RA 4N5DA 1E1DA 4NCIA 5I7EA 4YCJA 3WGOA 2ZYGA 4TQGA 4UNQA 1YRLA 5TT1A 3VM6A 4NPAA 3OPYI 3EQ9A 1US8B 3P9SA 1K9VF 2X3UA 1P60A 3JQAB 3JZAA 2FMFA 5A89A 4FCTA 4G65A 1I2BA 4R7TA 5F77A 3RO7A 2A0KA 3B48A 2X8JA 3K96A 4M0CA 1Q9SA 5K0LA 2W6QA 1MA3A 4OHRA 4U7WA 5THKA 1G98A 1TIPA 1E5TA 3OPNA 4QTUB 2BJWA 2CVPA 3HEBA 2GCGA 1R8XA 4LOKA 2X4DA 3Q9LA 4B48A 4HQOA 4EF4A 1GO2A 2DH5A 3D54D 3OOCA 4JC8A 5AP9A 2MYPA 3NC0C 1M5RA 5I4IA 5TY0A 4BFUA 2ERCA 3DZCA 3DPIA 5CGZA 1WB9A 3FNHA 2WJYA 4QUKA 1HFEL 3L9XA 4CQMD 4KFCA 1U80A 1QK5A 4Q1AA 5A5FA 3GRUA 2WU0A 1KMQA 4K3UA 3PB3A 5EMJA 4HVTA 5KNCH 4R8RA 1SKAA 3HHPA 3LHDA 5FD8A 4ARVA 4QGSA 1ZXLA 1RJFA 1N1GA 2GEJA 2QB5A 4B2PA 2A9VA 2XQFA 4ZDKA 2IIQA 3UJ3X 3IE1A 1GPH1 1P9NA 1W8DA 4N7MA 4MPJA 3U26A 1FFYA 4G63A 1EGMB 4EVIA 3F96A 1SBIA 4DLKA 2P67A 1PHRA 1R6AA 3MAJA 6CHYA 4GMFA 2AF4C 3AK4A 3DEIA 3U1VA 3L7AA 2ZBFA 4R98A 2C9OA 5LJIA 1AV7A 2GZ3A 3ITKA 3TRFA 3PV0A 1VRWA 5AXBA 3KJNA 3FKSD 1TCVA 3IQEA 4KLAA 4O4IF 4TRNA 3FWZA 4ZU6X 4DUPA 1KO7A 2AVDA 1YK0A 2Q4BA 4OCZA 4MAAA 1J8DA 4E7PA 1D8AA 2HK7A 1SKBA 2I2WA 3LBFA 3LKBA 1IM2A 3OMWA 2HC9A 1T2CA 2VXOA 4GG1A 3EBPA 5U4XA 2ISQA 1R5BA 1L5WA 1JI0A 2A5GA 2IYVA 1M0TA 2I54A 5FTMA 3TYXA 2JJ2A 1GU0A 2ONZA 3LY5A 3HYNA 4M9UA 3MJ4A 4HC4A 2BHSA 5EKSA 4EMTA 2FEXA 3G59A 1L7NA 1TYZA 2P8JA 3BMOB 4FC7A 1FLNA 3U13A 4YEJA 2YWCA 2B5OA 1NQOA 3FDZB 2W4IA 5CG2A 3EY4A 1GAXA 3IMGA 1NW7A 3EEQA 3RYHA 4ZV4A 1FVFA 4FHFA 3VR4H 5J2UA 1L4KA 2AKEA 3ZZUA 2DFLA 2IDMA 2R8ZA 3DP7A 4IX9A 2VLIA 1KOGA 1EXNA 1YSCA 3EQZA 4MO2A 4DGSA 4K6FA 4M9QA 4HD8A 5C31A 4C3OB 4GKJB 1DG1G 4L9AA 2ZRJA 4LJLA 2BGJA 1YOVB 1CCWA 3RRZA 3BZUA 2EBWA 4UM8B 4QDOA 1JEQB 1U8ZA 1UC8A 3USES 1PZGA 3HY4A 2ETXA 2H5EA 1RMQA 5A9SA 4YR9A 5H80A 1QVAA 3DOCA 3EZXA 4BMDA 4YUZA 4RFVA 4R2JA 1H3NA 1RQGA 1T5HX 2NXWA 2HY7A 5AM2A 4XLLA 4HLCA 2BZGA 5IYRA 5IJ9B 2FGJA 1GUYA 1O94A 1VL5A 4G24A 4MEBA 3V42A 1NQ5A 2CVZA 4G8BA 5CT5A 3RVJA 1H2EA 2MSLA 1VPVA 4DB4A 3ZCVA 1NE7A 1TTHA 1B0PA 4HH4A 4G1VA 4YP0A 4X6YA 3NHUA 5HSGA 2HPVA 5IBPA 2GBGA 3A4IA 3KWJA 4DC1A 3EUEA 4LXIA 1KO1A 4PU0A 5EZYB 3Q5DA 5KNDH 5IVKA 3L07A 5CA1B 1TFUA 3NTOA