2C5BA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 2'deoxy-5'deoxy-fluoroadenosine.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Specificity in Enzymatic Fluorination. The Fluorinase from Streptomyces Cattleya Accepts 2'-Deoxyadenosine Substrates.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
total genus 70
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2c5bA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2c5bA01
2CW5A 1RQRA 2F4NA 2C4UA 2V7UA 2V7TA 2V7WA 2Q6IA 2WR8A 2ZBVA 2C5BA 5LMZA 4CQJA 2Q6KA 2C2WA 1RQPA 2ZBUA 5FIUA 2CC2A 1WU8A 2CBXA 2C5HA 2Q6OA 2C4TA 2Q6LA 2V7VA 5B6IA 2V7XA
chains in the Genus database with same CATH superfamily
4C30A 2JKZA 1U8XX 4MQLA 3SZLA 4Q9NA 3SXPA 5L95A 2I2AA 2WYUA 4GU5A 2RHOA 5KCZA 2XIQA 1KYXA 3VNUA 3O8DA 1QOPB 3CZRA 3GFQA 4LYAA 2BLLA 2X19A 4JSYA 5ALTA 5LLDA 1GSOA 4R1UA 1KEEA 4XJVA 5DI3A 3QJYA 3R0IA 3A9SA 3V8QA 4E4RA 3TDMA 1G5RA 3H2HA 2C7OA 2XJ9A 1PO7A 3X1ZA 5CNJA 3CCUB 1T2EA 3I92A 3OEEA 4E1VA 2VKQA 1MEOA 3WQHA 3TQQA 2VF8A 3RSSA 2HA6A 5JCXA 4D7AA 1DO0A 5A5VA 1E9VA 3KSBC 1WS6A 2B8JA 1LSJA 4L5AA 4I55B 2EIXA 4M88A 3KJFA 3BX1A 1R6UA 3A3KA 2AXPA 5JADA 2ZE8A 3DZDA 1XU7A 5IM4F 2BY4A 1X94A 3F1KA 4B4DA 4K6MA 4EW6A 3QEAZ 4QECA 4LJRA 4HH1A 1NWHA 2GZMA 2NZYA 3IKMB 5ALZA 2VF4X 3ZQ6A 4LC0A 4BQNA 1THGA 2PEYA 1HFJA 1GQFA 1UFQA 2YOHA 4Q01A 4OUDB 4QELA 3RT9A 3TGLA 3GUCA 4LG1A 1XLUA 3UN1A 1G20E 3HJHA 4X6LA 3OH8A 1X1AA 1A4XA 2IXGA 2PVSA 2Q7OE 3UV6A 5BPFA 2VCHA 1M6VA 5L3QA 3V8RA 3BXZA 4KQCA 1R8SA 5JS2A 3SK0A 4TT8A 2IXBA 5CCEA 2Y68A 1GG5A 5G4LA 1UC4B 1KEZA 2GCNA 4GOMD 1WU7A 2Y27A 1R0BA 3FVTA 2YCLA 2VDNB 4JP1A 3WSWA 4PTYA 4ZJYA 5LR6A 1YL6A 2MTBA 3KZVA 2Z6BD 2CNNA 3WFZA 2Q21A 4LQCA 1G8YA 1QV7A 1X8JA 2R1TB 1J9ZA 3IP3A 4GO1A 1T5OA 3A36A 4JNKA 2H51A 4IQ8A 2WKQA 2YASA 2GEBA 4F8EA 4RACA 4WBNB 1EWRA 2HV9A 5B6JA 4J9UE 4LQDA 2V03A 4KN9S 5THQA 5KYGA 4GMXA 2X9LA 2XHZA 4LOKA 1U8YA 3OQIB 3W5UA 3UF0A 1XMVA 4MIYA 4JI8B 4OHYA 1G38A 1M8KA 4LRXA 2GCGA 2X2PA 4CKZA 2O07A 1NAIA 4ZPXA 1XPRA 4W9NA 1YE8A 4QODA 4N7JA 1QYDA 3DTVD 5F78A 2FN4A 3KR9A 1PSDA 3GEMA 3OWXA 3ZC3A 1R6TA 2RB4A 3CVJA 1DRKA 5ALWA 1NJ2A 2GERA 1J0BA 2B7CA 3W5JA 3ID6C 4KFRA 1J0AA 2NSJA 3R76A 4OJYA 4TN1A 1L4UA 4Y1EA 4AMGA 1CDDA 1AIPA 4MLZA 5AT1A 1S2OA 3A26A 3DBOB 4KI7A 1I0LA 1O8BA 2J67A 4KQKA 1KQOA 2A9QA 2QRJA 5DGTA 5FBHA 4ETWA 3F6SA 1CY8A 4A6EA 1PWYE 1Z3CA 2ZJ8A 2NYRA 1KC1A 3WGLA 1E8NA 1OGYA 4KO3S 2KW5A 1P44A 2OK7A 1JI3A 3FN4A 2ZRIA 2GBIA 4FE4A 4FZ3A 4LDAA 3S7TA 1B42A 4DSZA 4LYFA 4EO9A 5ICMA 4HOYA 1YH3A 2XT6A 2I2BA 3TOSA 1R18A 1JEAA 1G7RA 1O96A 1W2GA 1VLVA 3PXUA 1HQKA 4OIMA 2VYND 3RDPA 2IHVA 3C5WP 2EKZA 5I7EA 2P0YA 3RYFB 4U6SA 4P9NA 3D4OA 4I66A 3ROGA 3M7IA 1AH2A 4UE3S 3I04A 3QG5A 5DMHA 1FMFA 3C70A 1DZIA 3E0XA 3VU0A 1WD5A 2ASVA 3D4IA 1JLHA 1Y9ZA 1E2NA 1QG6A 1P5ZB 1QRRA 3QF4A 5F2NA 1QAQA 2VJNA 4TSKA 2XB4A 2ZWIA 4U02A 5L4SA 1E3SA 1F2UA 1M34B 1KFBB 1ZLXA 1ZNZA 2XYGA 3LLUA 4CL8A 2NZUG 5CFMA 1JHVA 1LB1B 1XZGA 5EMKA 4Z4CA 5CDFE 1NOIA 4GM4A 4NENB 5K5EA 2YINC 2H4ZA 2QX4A 3NNNA 3RBZA 4O3FA 5IKXA 5DTMA 5JAQA 2DBYA 2BTQA 1A8QA 1K6IA 1U6JA 3IKVA 4MCJA 4R9RA 2FQWA 5DLPA 5BV8A 4LJYA 3IJPA 5L7WA 3SYRA 4BIIA 2X77A 2C2OA 3IUJA 4B7XA 4ES6A 3MGAA 1MJNA 5BT8A 1TYEB 3U1BA 4Q12A 2JVJA 1C7EA 1UMDA 3CRZA 3HKEA 4N8EA 5EMJA 2CHGA 3OAAD 4URWR 4BMDA 7YASA 4EGFA 5KKCA 3HO6A 3IUQA 3QYJA 3IQZA 1NJFA 3PNLA 3RK0A 4RD2A 1RT9A 3FCEA 3MJSA 3ZV5A 4P81A 3OZFA 1LI7A 2QD3A 3HI4A 1TK9A 2GJAA 4X7DA 1R00A 1R15A 2PAAA 1I1HA 2WKSA 4W4TA 1U3GA 2C84A 4JZKA 5FOVA 2ZRPA 3RY8A 2QM8A 4MWCA 3RJMA 3EUFA 1E1KA 1LTHR 3TB6A 1J33A 1EHIA 4WK4B 2GCPA 3AL2A 3RJTA 3NVKI 3X2EA 1G8FA 2RGAA 4JB0A 4GLFA 1REQA 3GJTA 2Z9CA 3MIZA 3DW3X 4HWKA 1F6BA 2J0UB 3TI7A 1DBVO 5C46F 9ABPA 4BO6A 3K9LA 2RC5A 5CPBA 2O7QA 2WA2A 2WC1A 1NQTA 3KWFA 5LYJF 4QHSA 5AFSA 1K9VF 2EWVA 4V1CA 3VO9A 4EL0A 5L4LA 3W2GA 1G1AA 2OG2A 3C5CA 3G8DA 4LY6A 3FMFA 4JQSA 4F7DA 4GXNA 4KZKA 4WSOA 5C5IA 1GM5A 1K86A 1YVRA 2E89A 4QASA 3KTDA 1XDDA 3SJUA 4IFTA 1VM6A 5EIHA 3TQRA 3SZRA 3F0TA 1R0WA 3EFEA 1DAEA 2DTDA 2HUPA 2JJMA 2VP6A 3NTQA 4RDJA 4KYTA 3T94A 5BXYA 1G16A 1G2IA 2IVFA 2YVAA 3CPHA 3EYWA 1ZJ4A 1UDXA 3CUYA 1MVOA 1UKZA 4MKHA 2YH2A 1QLHA 4DANA 2W6MA 3LUAA 4TLCA 3AUYA 2QL5A 5HXBA 3CCRB 4NIMA 4EMUA 1VPTA 5PGMA 3BMQB 1QE5A 1BQEA 2MOKA 1OWLA 1FJ2A 3EVBA 3CIOA 3GZNB 3K09A 3OECA 2PL9A 1DKNA 2PZAA 1FXWA 3BB1A 3CFYA 1BFDA 2NVWA 4XOUA 3PF8A 3WQZA 3V34A 3DFZA 4NDZA 5EJFA 3JVVA 5I9MA 4MV8A 4C0QC 5CMLA 1JAYA 2RHLA 2KS6A 4N8DA 1HETA 4LJAA 1LJUA 4XD2A 2G5GX 1M2KA 5ESWA 3PFCA 2OFXA 4L2IB 1SA0A 2MSLA 1CY2A 4OEHA 4Q3KA 4TT3D 3TLAA 4EBBA 4L9AA 4BGIA 4XWAA 2XJ4A 4G24A 3GLRA 1JVNA 2NUPB 4I6JA 4MLCA 1ZESA 2NADA 4N01A 1MA3A 1ZJZA 2HREA 2TS1A 1USGA 1YU9A 3FYTA 3K0FA 3OU6A 4A8HA 2FMHA 2X0FA 1TPYA 1G6Q1 3GJ4A 2GK3A 3GI1A 2RK3A 5BY2A 3IP1A 1XTKA 1EK5A 1IQPA 4H1UA 4L0QA 2B0JA 3CRMA 1PJ7A 4QYSA 2AZXA 2FPKA 4CM1A 4UTXA 4YGXB 3TPZA 1C9JA 4K6GA 4M99A 1I7QB 4JB3A 3TECE 2OQRA 1XF1A 4MRPA 5M7EA 1U3CA 2XITA 4QDZA 4YJ3F 3K0AB 2ONCA 1K97A 1ZCAA 4YO8A 5F1OA 3UG6A 5JNTA 1XPOA 3T35A 3UWPA 1EUCA 4XDGA 4HBGA 3BT7A 2GTHA 1M75A 1E89A 3MUNA 1N78A 3WL4A 3UFBA 4CLOA 1TADA 1JIUA 4IFEA 2WD8A 1NNLA 1X15A 2VDKB 3L4SO 2D4HA 2ZXIA 2A67A 5J58A 5CCBA 1VLJA 1W6UA 3ZVLA 3TJMA 1JQJC 1PJAA 2JLUA 4KYIB 3U7QA 2GKOA 2O7SA 3CVVA 1SOWA 2BD0A 2NU7A 2PSJA 1U8EA 3IBYA 3OOYA 4MYRA 2GS9A 2VEDA 2W8BB 3HUTA 4PNZA 5EAIA 3VR4H 2H4YA 4ANFA 5D8DA 3OTQA 5DXAA 4H3HB 4IHQA 1KO8A 2IV2X 1DHTA 1DLJA 4Y9DA 3URMA 4TM7A 1I0IA 1Q91A 2BEKA 9MHTA 5CRIA 3QV2A 3THYA 4QWWA 5AW9A 2ECKA 3WHLA 1P4GA 2H9AA 2RHBA 3DLAA 3FAZA 1TGVA 3WKDA 4IWXA 3GFOA 2WUGA 5BSHA 3UW1A 3LCCA 2P2ZA 1LPNA 2VPZA 3BFVA 3NUGA 3CLVA 2O2ZA 4EMSA 4ML3A 3UPTA 5TB5A 4HN4B 3QSGA 5K0GA 1YC5A 1AMUA 2Q07A 3WO0A 1E1QD 1NJ6A 2D3WA 2E1PA 3GRVA 1TAGA 4JHLA 4G4IA 4LKRA 4WNIA 5FL7A 5ALYA 2FQXA 1NBEA 4G1CA 3R7AA 3LRXA 1CD5A 1O08A 2HPZA 3BEDA 3JVUA 1YRYE 3ETEA 3M81A 3OJOA 4NCXA 4NV0A 2HMTA 3V2GA 4B6FA 1X92A 3KXPA 1PNOA 3AEKB 4G8JA 2WSBA 1J70A 1CUWA 5LZ4A 3T9BA 3WLOA 2AN9A 3CZ4A 4AS1A 2DT5A 1SCAA 3KXLA 2XMSA 3JQFC 1J2YA 1E2DA 3H87A 4MIKA 4QLBA 1X1TA 1Q11A 3N6RA 2BMAA 2OZPA 5IWAB 2D5AA 1CY7A 2VYFA 3M82A 3W2EA 3GRCA 3DKIA 4YT4A 3LDGA 1WSAA 1VB3A 3AR3A 4EGJA 2AVNA 2VRCA 3L6CA 4I5FA 1PJQA 3FDZA 1V5GA 4A8JC 4IF4A 5HOEA 1QYIA 1AKYA 1ONPA 1R8XA 5ALHA 5TX7A 4I0WB 5EUMA 2ZIVB 3KAJA 1J0CA 4ADSG 5EMLA 5ITVA 4CKYA 4CL0A 2X23A 2C3YA 5ADUS 3L5OA 3TLMA 2DF8A 2CZGA 3KM0A 1D8TA 3BD7A 2CW5A 2AFVA 1PQPA 2PKWA 5F4OA 4CR7A 1SIOA 4XB6B 5FCDA 2DR2A 1GQOA 1QGUB 2DPXA 4P08A 5IAJA 2YY6A 3DT8A 4QXOA 2B7LA 3LF1A 5L7YA 2KSQA 1H93A 1E3WB 1XCLA 4MPRA 1XEXA 2G63A 2PZEA 1SG6A 5M34A 5JANA 1E1DA 4UDYX 4EW1A 2EDCA 4L57A 3PA6A 3CX7A 4A0QA 1U80A 5JAZA 5CA1B 1BD4A 1MA0A 2ZETA 3AHFA 2CBXA 2Y0BA 4RJIA 4HDNB 1ZCFA 5C37A 3DVQX 1ANKA 2WT8A 5LDDC 5COAA 2RHGB 5J5AA 2HU8A 2QM3A 5F76A 4E6EA 4M83A 4FWTA 1V6AA 1GZ4A 1CUEA 1JSRA 2G1UA 4N9WA 4MUGA 5EZ5A 4ARZB 4F2PA 5JVDA 1L7RA 1UOPA 3LGAA 1YNOA 1YJWB 2FETA 3A04A 1XAIA 3BGIA 3MRXA 1HT2E 1WE2A 2Q46A 4GH5A 4JLUA 3U56A 4FI3C 1N9GB 2FQ1A 2GETA 2GZDA 4QJ5A 5CXXA 4I5IA 1SZPA 3U80A 4AG6A 4X92A 5A3JA 2YWDA 1XCOA 3DNPA 4IEIA 4BNVA 1S3FA 2BEUB 2AC7A 3IP7A 5AICA 2GAIA 4Z4FA 2CFRA 1SGWA 3N8KA 3OJCA 1UANA 4RTJA 3HJGA 2JCBA 3DLCA 1J24A 4KLCA 2YWGA 3M4JA 3Q39A 2XA2A 1V45E 2OY0A 1M8GA 4XB2A 1ORHA 3CZPA 1XZAA 1C9DB 3BH6A 2AW5A 3H8VA 4QJBA 3HYSA 3UPDA 3SEFA 2PNFA 1YUMA 1NVUQ 2OVFA 3DLIA 4OD0A 5TRTA 4LX8A 1GYRA 4UE2A 5C80A 1BXZA 1FNSA 2AE1A 5U1PA 2E49A 1CZOA 3CD6B 2Z43A 1Q84A 3CX3A 4O25A 4QDOA 1O94C 4ESOA 3R6TA 3INGA 4X24A 1RQ7A 1RCUA 3T5AA 2WUDA 4J4HA 4BS9A 5MGNA 5A1TA 4AY2A 2QU7A 4I4CA 2PWBA 4YGYA 3RYHB 2Q2WA 1G5HA 4MQFA 4QATA 3RU9A 2E1RA 4RENA 3JQQA 1WSBA 3QE2A 4CCWA 4BEWA 5A4KA 1P8AA 2B82A 4AJ4A 3W6UA 1P7YA 4FHEA 5DTIA 4BTEA 3MQ4A 1QHIA 3D54D 3OE1A 5MFZA 3F1LA 2WJGA 3KL4A 3KHSA 5IVDA 2AG0A 1JJ2B 5F1YA 4DLWA 2BF4A 1GPKA 1W2WB 2ZTHA 3LCVB 2HA2A 5G2OA 3KL9A 1ZOIA 5TRDA 1E3QA 4XM2A 4I50B 3JPWA 3RUPA 4MZDA 4PGOA 1C0EA 4K40A 3DEFA 1JV2B 3JQ6A 3KFLA 1U4NA 2CCJA 3SDBA 1QXSA 1LX7A 4DCMA 4Q1CA 4AJIA 3WK7A 3ZWMA 4ETIA 5BWLA 2L42A 3N8GA 1JIJA 3K4PA 3VTKA 2P5SA 1KK2A 3B52X 5BSGA 4AO7A 1Y4DE 3IAEA 4MQEB 5ALJA 4MVXA 1D6SA 2Q99A 5EJ2A 2NU6A 1A8HA 3GARA 4BFYA 3KYJB 3UAYA 2ZRQA 2BMJA 2NQTA 5H5JA 3ET4A 4YWHA 5AQEA 3RRZA 3A6ZA 3WJ2A 4PRKA 1JAZA 5ESRA 1QP0A 3ZBTA 4WCFA 3DR3A 3MYRA 3WIEA 2YC2C 4RV5A 2BHRA 2G0TA 4QE3A 2H7YA 2VBFA 4D8YA 1LC0A 1OR8A 2PKEA 3M9WA 1EXWA 3C6MA 5LYYA 3NEYA 3T5DA 5KEIA 4PVDA 2IT1A 2KLHA 3N8NA 1P9OA 1X0VA 4DA4A 3QG1A 2QIOA 2IE8A 3T3IA 3MGBA 4PXAA 3U1TA 3SX2A 4ZEOA 5ENZA 2D1FA 3AP1A 3HVHA 1YUNA 2IPLA 2DFPA 4YEJA 3C4VA 3KLNA 4ZVOA 4YXWD 2OBBA 2ZUDA 3RVQA 3IVMA 3A1NA 1RAHA 3UJHA 2BFPA 3IIIA 5FUWA 1ISMA 1Z25A 2GJ4A 2ZL5A 2BL4A 2O3TA 3H6KA 3O8QA 5HBGA 3E3OA 1TRHA 2KM1A 4DCGA 4W7HA 1UD5A 3OLXA 2Z2ZA 4A0RA 2YY7A 2TECE 2ZJ7A 4QA9A 1IRIA 1H8HA 4KBYA 2W2QA 5AW6A 1EE1A 4RBNA 3GJSA 4OFBA 3TZ6A 4MVJE 1GNVA 3H0EA 1XNHA 2FWPA 4D4MA 4OPSA 4B3RB 1VQ8B 1ZK1A 1QGOA 5FBZA 4LAFA 2FPSA 1P9RA 5JSYA 5CA1A 2O14A 1F1JA 3T5MA 4RLSA 3UWMA 3WGUA 1EWQA 4K9RA 2GWHA 4Y6LA 5JS7A 1BW9A 2V6FA 3X2FA 5ITWA 5J59A 2E4XA 1X1DA 1FNMA 4J0IA 5JCZA 3OFJA 3C5VA 1P7CA 3AEUA 4KWIA 4Q37A 5AK3A 5M3BA 3V33A 2SNIE 1R6DA 3LG2A 3ICQB 3CCSB 2QMQA 3R7LA 2UYYA 3DAYA 3O84A 4KN6A 5YASA 3SGLA 4Q5IA 2X41A 4LOIA 1KKLA 2B8NA 1AK2A 2CMDA 3T7TA 2XVMA 1T36A 4E46A 2ZJ2A 3BWDD 4NOKA 3OTIA 1GCUA 4NCKA 4NTZA 4NBWA 2JH9A 4MI6A 4YRFA 2O2GA 4D99A 2RHCA 2DE0X 3MAGA 2ZFUA 1WMDA 1PEDA 1UBSB 2D5IA 3V2UA 5BOVA 1ZNQO 2RGBA 1EFTA 1D0VA 2CDCA 4R84A 4TTSA 4XX0B 4ZRMA 1NC3A 4F46A 5FKJA 2L18A 5FA6A 4RM0A 3HGQA 5BWOA 4HLDA 5CBPB 2MYUA 4YMUA 3SKBA 5C18A 4EHJA 4GW3A 2EHDA 1QR6A 4I9FA 3OHSX 1TK3A 2VSQA 5A05A 4ZEVA 4WCVA 5AXCA 3RRFA 3BGSA 1SXJC 2XT0A 4N0DA 2F62A 4TWAA 3EPJA 1U6KA 2C9ZA 2QZ9A 3OQPA 4WLVA 1WW8A 1WXDA 4ASUA 3HCNA 3UK0A 2VBVA 4KGXA 3V7WA 4QPNA 3FMOB 4NXNB 2Q2VA 4IUCS 4JJ4A 4JP2A 3WP0A 1CJMA 1QQ7A 1ZGAA 1DBWA 1H69A 5EVJA 4D8WA 3HPRA 4FZRA 1XPUA 2DFDA 2CN1A 2BJHA 3PRHA 3W05A 1W9MA 1JH9A 3T4EA 3AK4A 4QVGA 3PNPA 2AUTA 3GXOA 4P3NA 2YICA 2A3NA 4P22A 1CR0A 2CZQA 1VLMA 3B2NA 3JQAA 4JL6A 2XSZA 3REFA 2WSLA 4URHA 1VA5A 5AYVA 2YR0A 4Z2AA 1J1UA 3PTAA 1CK4A 1MO3A 1W5AA 3H99A 2CGEA 1E5LA 1MRNA 1GNPA 4Q48A 1TFRA 4GBGA 1XRNA 3LSTA 1U90A 2VSFA 4FUTA 3DVLA 4RDKA 2FWRA 4OU5A 5EQDA 2OBTA 2G9VA 5FUVA 3HR8A 3PTZA 3FJ1A 3HU3A 4B3MB 1P2SA 1HLDA 3D4LA 3THYB 1TMOA 4RIHA 1KJNA 1U0GA 4LZPA 1NP6A 4EYGA 3LC1O 5BYAA 1YR2A 3VYUB 3QU9A 4MV3A 5I51A 3HO8A 3TFOA 2WD7A 4HZUB 5K2OA 3U44B 1LC3A 1IN5A 2W8BA 1Q7CA 1MZVA 4EG5A 1C3EA 3I34X 2WJIA 2WKPA 5CFQA 2F9MA 2R47A 3UFXA 1PEKE 4ZAGA 1K7XB 1V25A 3ZZNA 4DM3A 3FZNA 1DVRA 3T15A 3PQ7A 2OSVA 5C32A 4C03A 2D2FA 3GCDA 1ZUNB 3IVRA 1LBQA 2CYCA 2EFCB 1YC2A 3BMXA 4EVIA 3GYBA 3IPXA 1EUCB 3RS5A 4PZ0A 4GKJB 3KEMA 4RORA 3TIIA 4MQBA 1SC4A 5MF6A 1PYDA 2I4IA 3ONWA 3EXG1 1CS4C 1N8SA 4FOSA 2Y4NA 3K4QA 4FR5A 1RDFA 2AWOA 2YIJA 3WTCA 3ZX4A 5JNUA 5DK6A 4TSFD 5C8ZA 4AJLA 4TTQA 3ZKAA 2HJHA 2RI1A 2X9VA 2ZYTX 4WY5A 5KX5B 1Q7BA 2UXCB 2WWIA 2Z09A 2GCOA 1YA8A 2BV3A 2GF9A 4P86A 1V11B 3N2KA 4UNSA 2R8RA 2B2NA 3NV7A 3MWDB 3FPLA 3EDQA 5FPHA 4GXRA 4DT1A 1PZEA 1F4VA 3I5UA 3QTLA 4IDHA 4BXOA 4MVJI 2ZYDA 3WAJA 2O3SA 3K2IA 1NX9A 4Q93A 1FP6A 2XX3A 4B8WA 1M5UA 4UOZA 1E1LA 1TF2A 1TXGA 4M9ZA 3UUEA 4BRUA 2F3UA 2ZSFA 3GVJA 3GUYA 5AO9A 4EPWA 1KO1A 1G8AA 2PFSA 2YUIA 2FN8A 5AVKA 2R751 3SSOA 5B1SA 3TKYA 4YQEA 1MIOA 3ABQB 3F9IA 3I32A 4MHTA 2QMHA 1GIAA 5DM0A 1NE7A 4H3SA 1II8B 3CVXA 3T1YB 3DPSA 3BGVA 4ZCPA 3NAGA 3V9PA 2FEKA 2BM1A 4ZCQA 4JJKA 4AP5A 3OPYA 4MTCA 3I2IA 1IEVA 2CRVA 1A04A 4RFSB 4IXMA 2HWYA 4G6ZA 2XUAA 3M89A 3RS3A 1FU4A 2YXEA 4DS3A 2V8BA 2FMIA 4AY5A 3DOOA 4DARA 3VR4D 4D42A 1H3FA 4ZWNA 3V1NA 3H86A 4PO3X 3JALA 5J1SB 3HLYA 3HFJA 1XWWA 4BNYA 4E7OA 3E9MA 4UD6A 5CM9C 1KEWA 5EP4A 3EG5A 1JJ7A 3PV0A 1FDWA 2W2NA 1PYOA 2VH2A 1DOAA 2RARA 3H5WA 3Q6NA 4QC2A 1G59A 4IZ6A 2PRSA 4RHYA 5EJ5A 4UEJA 4JKOA 4LZNA 5TC4A 1MH9A 1YR9A 1ZCZA 1KA9H 1OGJA 4NK4A 3U6KA 1HYBA 1T4CB 1RXCA 5HG0A 4AMYA 1DV2A 1M72A 5JTUA 3U26A 3BB4A 3N07A 1W46A 821PA 2LNDA 3A58B 4IJQA 3C2QA 1IEQA 1K1EA 4MKZA 3FFBA 3VOSA 3INRA 2ZPAA 4W5HA 1K4MA 1KMMA 2L2QA 4TZTA 5ECYA 3OE7D 1BOFA 2QNIA 4HWPA 2WAMA 4NZYA 4DCTA 2C03A 4EA8A 3G2HA 4GLLA 1SHUX 5EIFA 2ZSEA 1FW8A 1X9IA 4LQLA 5LB4A 1R16A 1X1QA 2ZSUA 1AHHA 3IIKA 3F73A 1HFWA 3T7JA 4QLAA 5T4BA 1Q1NA 2HGZA 5G0VA 1VMDA 2G9ZA 3K20A 1CPYA 4LKOA 4MMZB 1C29B 3B82A 1JLMA 1HC7A 4FNGA 1TF7A 2VSOA 1ZGZA 3ETLA 3I2GA 2FX3A 2J87A 1RD4A 3IEKA 4AJ9A 4Z4QA 1ESMA 1R6BX 4LGYA 1GD1O 5IUJC 3O4GA 3S44A 3DOJA 1WORA 3AUFA 2BEVA 2Z83A 4HJXA 4BWVA 2HRQA 4DWOA 3QJGA 1WSWA 3SNHA 4AFNA 1NXTA 5K3OA 3GVCA 2X5OA 3GQBB 2XCLA 5GY7A 4FGJA 4ARUA 1NVVQ 2PTGA 2H52A 1F06A 2QMZA 3HRKA 3KK0A 5DBHX 1EJBA 3JXEA 1TIBA 2UVDA 2WJPA 2B8TA 2D00A 2CNDA 1DWPA 3PGKA 3U16A 3H1FA 2WWFA 3SYLA 1IFXA 2O3JA 1M0WA 2JGAA 2O57A 4U3JB 4ZAZA 2A1TS 3JZDA 2OYSA 4KRYA 4REOA 3DL4A 3PP8A 3VC3A 1FDUA 1NMEA 4CCYB 3IE1A 1XEFA 3CY6A 3E18A 2QS9A 2X9QA 1AKNA 3QTTA 4B5KA 2G5TA 4F96A 1UJCA 3WRVA 3C6XA 4OYRA 3DO8A 4RHUA 3TMAA 3COJA 1OKKA 2OXFA 1ZIXA 5DGXA 4X8IA 4KFUA 5DBFA 1E6KA 3SMQA 3FNQA 4DQLA 4GQNA 4A15A 3A1CA 3DO5A 3G8AA 2HDOA 1II9A 4G26A 4HH0A 1YLOA 3DOCA 4YH1A 2FZGA 1L5OA 3SBEA 2V1XA 2XE4A 3IIEA 5DTRA 1DQYA 3VZBA 3OKXA 2P2NA 1VKHA 8ADHA 4KKXB 4GRAA 5D3ZA 3I5AA 3D0OA 2GMWA 3D6HA 5K51A 1YR6A 1FLDA 3ILXA 2EIHA 1RMTA 1NXWA 1RZUA 1Q1EA 2C96A 3L77A 3HZZA 4X7PA 3KLPX 1OAOA 4GVPA 3VJMA 1NNEA 5IXJA 3RWBA 4S2EA 3ZDRA 1GNQA 4FCCA 1RS0A 1GEEA 1GKYA 2J9FA 3HVKA 4Y0VA 1JJVA 4BFZA 1TTPB 1OU0A 2ZRFA 1PTJC 2VT2A 3A8TA 3Q3JB 3RVDA 3V48A 3VYTB 1Q0TA 2PUFA 3AVXA 4RD1A 2F7SA 3OTWA 4CIXA 3QFTA 2DKOA 1GUFA 4GZMA 5KAMA 3OQIA 4KDRA 1Q20A 1F0YA 4XORA 1MAVA 1AVTA 3WC4A 5SZJA 3G17A 3SZ3A 4MS1B 1P1HA 2RDMA 3R7SA 4KPEC 4NZPA 1MCZA 5GM2A 2GLTA 1F2TA 5KYYA 3UMFA 2ZYWX 3N5CA 2BFWA 1HK7A 1NN1A 4ESEA 1EA7A 5AJYA 2BGMA 5F52A 1JZTA 2VHJA 4RANA 1E9RA 1IUPA 4LHVA 4YJDA 4GOXA 3ZV6A 5AKIA 3P9CA 4WASA 3FWZA 5KNBD 4ZAXA 5KWIA 2Y71A 1D2CA 3FCUB 2Q6KA 4P4UA 3KUXA 3SJPA 1SHKA 1TD9A 4WA7A 4A6DA 4A9AA 4CM4B 4BPBA 1U63A 1KETA 1U28C 3A2LA 5KYUB 1T3SA 3NONA 5DLDA 1B3RA 1VG0B 4YAUA 1Z17A 3HA7A 3KJZA 3PQEA 3W5DA 4NBUA 5CX1B 2VDUE 1Z16A 3Q98A 1G21E 4L6AA 1B14A 3P0FA 3PI6A 4NMLA 3ZBQA 5HK9A 1YBFA 4X45A 1SMKA 1TM2A 1ZOLA 3R3ZA 4LHXA 3SS8A 4RJTA 1H4VB 5AHWA 1PGQA 4CDNA 3P8ZA 2A14A 2VP5A 4BLQA 2X4GA 2ZIXA 2P2SA 4DK0A 3VR3D 2BVNA 5TT1A 3KRTA 3RM3A 2G9RA 1F5NA 3HB4X 3LMKA 4I55A 4TXHA 1KRHA 1J7JA 4LJ5A 5E9JA 3N53A 4KE7A 3GH1A 1G20B 3O4JA 2PQ2A 2XMCA 4CIWA 3COZA 2UUAB 1LQUA 1X7DA 1AF7A 4QOGA 1XGKA 3WIBA 2GB4A 1IHPA 1Y81A 2R1UA 3HE3A 4B4UA 4BLVA 1QRSA 1YCHA 1VYTA 2B94A 4BDTA 1C81A 2VWGA 4D3FA 3T1QA 3PQ5A 3OIGA 1JHYA 1U1IA 1X7YA 2BMDA 4PNPA 4DCPA 1WKVA 2R5WA 1A82A 1TW2A 3FVWA 1CFJA 1Q12A 1X1RA 1XZBA 3VPXA 1J07A 3NHLA 4RTRA 2L0XA 1AKMA 3ABRB 1HI9A 1VL1A 3ZHZA 3SC2A 4ZO4A 1WOYA 5K9ZA 3ASTA 2B5VA 2J3JA 1JXQA 3I9LA 3SBDA 4FX5A 3WJ7A 1JJAA 3JQEA 4QT4A 1CJSA 1Q6YA 1G3RA 3KG2A 3TLGB 3WQSB 3BWBA 5AN9A 1IQRA 1JFFA 3ZXXA 1N3YA 1M2WA 4RIGA 1Y37A 4W7SA 5ALIA 4FFBB 4JBGA 3BFXA 4UEKA 2PXXA 2CXNA 4JELA 1Q0PA 1CDZA 1HYQA 5LUBA 3LAWA 5JJCA 3IE2A 1HTTA 3LC2O 1UL1X 4W8OA 4TKUB 3H9UA 4BECA 3I6ZA 2HMWA 3TSYA 2QY6A 4YAEA 1VPLA 4EFLA 3OOHA 5LZ8A 1FQWA 3W6OA 1T0UA 4DV7B 1KIMA 3BF8A 4AUMA 4FDVA 2M6KA 4FNMA 1NKVA 1ZDMA 1UXGA 5HPYB 4RA6A 1DIBA 4U1RA 4OKIA 3S2UA 1GUYA 3GROA 1EE2A 3D7SA 3ZG6A 1AKRA 1SUIA 2W2KA 1GO2A 2J9XB 4IFBA 2HCRA 2FZWA 2AHRA 3A4NA 4PONA 4BBAA 4EYKA 4LBVA 1JDZA 3IUPA 4JCOA 1NVTA 2OD9A 1YX2A 4NZ9A 1XZCA 4RVOA 3M6WA 2DWUA 2UKDA 2CK3A 1Y6JA 4YJGB 5ARBA 1QKKA 3D5QA 1ZSNA 4F3TA 3F3KA 3TIXB 1EFRA 4TRJA 2BAGA 2CZCA 3H65A 4E5DA 2QGGA 1IOLA 1UF9A 2FR0A 3R3VA 2I8CA 3S2SA 3RH0A 3W0LB 2JFXA 4DPKA 1AY0A 7REQB 5DYYA 1R74A 3NKLA 2RIRA 1MU0A 1OGIA 1DPGA 3JQGA 1C9EA 2HLDD 3N9IA 4RKFA 1S5PA 4Z99A 5UKDA 1KE1A 2JIBA 1ISPA 3TBKA 3ZZMA 1NQ5A 3ORQA 4UDNA 3ZI4A 1RRGA 1UKYA 1Z2AA 2X0JA 4HFMA 3KR2A 3R3SA 1GSHA 3RVNA 3RKRA 4AB1A 4E5NA 2GWRA 2I3ZA 1VIDA 2FSVA 3ZW8A 4GSLA 1FDVA 2XMRA 2YWXA 1E7RA 2H48A 4JR0A 3GT0A 4YP9A 1UFOA 3G9UA 3OTGA 3STHA 1VOTA 2HY7A 2GRUA 4NMWA 5JEEA 2XXJA 2NVOA 3STVA 3U7IA 2JIOA 3TTSA 1IJEA 5LM3A 3BL6A 4F9TA 3PIDA 2VIIA 3H11B 5C1DA 3OOWA 3EX7C 4DSNA 3SMVA 4PV7A 5GVRA 3GUUA 3CKLA 3JQ8B 2FV8A 3AR5A 5E9AA 4PBRA 3A0RB 3D3KA 4YAFA 1AGRA 3C3DA 4R1LA 4P34A 4OQQA 1YR7A 3COSA 4BNHA 1I3KA 5CDYA 3DZGA 3ZU4A 1VL5A 4DV1B 4EGCB 3EH2A 1QQAA 2C97A 1XA3A 2H3EA 1XXHE 2JGDB 3G2QA 1JEQB 3ZVNA 1FLAA 4R2MA 4DJTA 4GKVA 4ROXA 2I6TA 3G8YA 1JEQA 4D82A 4FILA 4MROA 1KR2A 3RUIA 3QQ5A 1SVNA 3BL8A 4B79A 2F8TA 5AM5A 3DTVA 1KI8A 4B6SA 2PRKA 1II0A 4KX5A 3T54A 2FMUA 2EBHX 1KARA 3MZ0A 1GTL1 1CR6A 2XUOA 1DJPA 2JL1A 3CKKA 4OFZA 4I36A 2WHYA 2A5DA 4HUTA 4Y2RA 5B7PA 1G18A 3CNLA 3NHJA 2JJ1A 1OXVA 3F7MA 4FYYA 4OA8A 4D5GA 3RYIB 3W3AH 2FRVA 1GU1A 5LQAA 2G0NA 1FFBA 3THOA 5JRZA 1VB5A 4IQ4A 4ATNA 2IZ1A 1T13A 4X6XA 2HPVA 2H0RA 5KNDA 3K96A 1LDYA 3SJZA 1GP2A 1IC6A 2QNBA 2ZSHA 5BYBA 3D7NA 4RTKA 3LIPA 1NNSA 3L7AA 3VTZA 2HMYB 4JDUA 1Z5WA 2NT4A 4GKAA 3QPCA 2MSDB 3S68A 1WX1A 3LRTA 1WCIA 2ZI7A 5JD5A 3O9ZA 5ECGC 2WZNA 1E0KA 3AF1A 2VT7A 2GKGA 4HGQA 5DLYA 1GRVA 1V0JA 2NSYA 4NZOA 4W1PA 3EBPA 4XYMA 1SWWA 1D1TA 1ORIA 1RAAA 1MVNA 2CE7A 2H1RA 3LX5A 1A1SA 3C8MA 5EZ6B 3UGKA 3H3JA 4A3SA 3HJBA 1JG2A 1YZTA 2IU0A 1E3EA 1Y6QA 2ROQA 4PC2A 3NVDA 2EX1A 5F33A 3RIMA 1RZ3A 1EVKA 4HXFB 5BSEA 3NH6A 1NJ1A 3N8IA 2C88A 3CZCA 2OTCA 4ZGNB 2AF3C 4IS2A 1FMCA 3C85A 4QRHA 4M1OA 5EI5A 5L6LB 5AIAA 4L76A 1SOVA 2QL9A 4LRYA 5KVVA 1WMEA 4YUVA 3L46A 4L9WA 5U9CA 5EQJB 1ZNYA 3ELBA 4WTOA 2DLDA 3O8OA 3EB9A 1I6LA 4IJVA 1E9SA 4QOIA 4UTPA 3S5JA 1MIHA 1U3VA 3K0HA 3SVLA 1B43A 2E5WA 2K7FA 1G66A 5HUJA 3AP2A 2AJ8A 1EUZA 1Y7HA 3CBQA 5EKXA 1N0IA 4GR5A 5HQ3A 2PE5A 3FPEA 1LK7A 1FNDA 4WKGA 1S2MA 1BH2A 1YTLA 5SYAA 1W52X 3C5HA 3ROFA 4AJ2A 4Z3DA 4MS3A 2X40A 4OJQA 4X1KB 3UOGA 4LPKA 1SXJE 1Y3BE 1ZI6A 2FMXA 3OJLA 4ZJPA 2OXRA 3TVDA 1KZ7B 2EEZA 2YTZA 4C3VA 5K99A 5G1NA 2ADMA 1BXRB 4HB0A 4MSUA 4Y2GA 4DIFA 5IS2A 1JQ5A 4DA0A 2Q49A 5EFZA 4EELA 2BFAA 4WGFA 3PR1A 1W47A 2DBVO 5CAEB 3TQHA 3RVRA 2ZI5A 3OFNA 1RWMA 4CETA 2NYUA 4Y2PA 3FUVA 3M83A 4Q3AA 5H9VA 2YS6A 3UANA 4GXQA 4HLUC 1QIDA 3CP2A 2VP2A 1HPLA 1KXZA 3HBMA 5LPNA 4N6GA 2UUOA 5D3MB 3JQ9C 3MA0A 4WD3A 1Z0UA 4IIDA 2QQ5A 2YHAA 4U2FA 3BDIA 2HSJA 4DQXA 1I4EB 1QQTA 1UQRA 4OBXA 5AHXA 2R8ZA 3V8NA 5LVAA 2FZEA 2NX2A 4L73A 3GV0A 1A3CA 4F6RA 1N36B 5L46A 2C20A 2W11A 4BNFA 2C5HA 3HDHA 3IMFA 1W1IA 2M1XA 3IHKA 1F14A 3HEBA 4D92A 2A5JA 3ENZA 3GAMA 5IVIA 1B26A 4FJ0A 3RRYA 3DFFA 1BKSB 5ULLA 3T1TA 2QTNA 1XD9A 5FNVA 2WNHA 4FMCF 5DO9A 3V1MA 3VQTA 3MMNA 5BSWA 1MVLA 2P69A 1NASA 2R1VA 1EP2B 3ZNNA 5IABA 3SAJA 4W5QA 4MDEA 1KDVA 5F5LA 3NC1C 3F6YA 1Z6ZA 4G36A 5TGZA 3F2VA 2Y05A 4KH0A 5BOSA 4PHCA 2IYVA 3P9SA 1DKUA 4HDCA 3WIDA 5KS2A 3K6SA 5I5GA 1N3LA 3CU5A 3M6LA 4ZEWA 2X6XA 3FPPA 4IDEA 4ALLA 5KYUA 4TVKA 1HWYA 5KTRA 4CM4A 2HWWA 3C1TA 2BFOA 3GBPA 3Q9SA 3ZYCA 4ER6A 1T2CA 1YZNA 5A4FS 4S2UA 1G6OA 1P7VA 1XHFA 1XB2A 2IYQA 2AW3A 2ZB4A 1H2WA 3BRWA 4OQMA 5CT4A 1G98A 3BB3A 4UNIA 3ER9A 1KNXA 2D9RA 5DGCA 2QYHA 3IOYA 3P9NA 3AERA 1WKBA 2FK8A 1X14A 1SCUA 4FVTA 1SKYB 4J75A 3TTTA 4RPJA 5ERYA 4KTVE 1Y5NA 3B6KA 4CMJA 1JI0A 3ECSA 1W5FA 4MS1A 4E03A 2HI0A 4IIYA 1QVGB 3SF8B 2DFNA 2BI4A 2NYAA 1FTQA 2XXAB 1UBMS 3D0KA 4H4DA 3BULA 3ASRA 3QUTA 4W63A 4F7WA 4M2LA 3BFJA 3NCHA 2DHEA 3K9GA 2PVPA 1QC5B 4HQ0A 4X6YA 4BNLA 2WABA 1YR3A 4CEJA 5SY9A 3IKTA 4JOQA 3ONYA 2Y0DA 1L4MA 2QVZX 5KHLB 3ND8A 1MHPA 3PXBA 4BUCA 1UT8A 1DMSA 2N1BA 1XZNA 2WG1A 3FUTA 4E2FA 2Q0HA 5AWFC 3I9MA 3Q5GA 3U3JA 3EIFA 3Q0IA 1OQAA 5F9HA 2P2LA 3EUAA 4FDUA 4KLNA 4HIZA 3JU3A 1A72A 2BKLA 2O05A 2ZUBA 5CNKA 1D7AA 4XIGS 2A0WA 4BQFA 2XOKD 1C7FA 1TA4A 3AEQA 3HVIA 5J2TA 3X1MA 5CT8A 1KJ8A 3L8CA 4CKXA 1NIPA 2HK6A 3QBVA 4UHFA 4PPFA 1CDEA 3JRWA 5CIQA 3ZGLA 3WNQA 2H1OA 3H1GA 2DIEA 2Y1GA 1EFAA 1E6UA 2NO1A 4AW9A 3H4TA 1U2RA 1Z18A 3NXSA 4UJ5A 1L7NA 3VZPA 4A5OA 2PUBA 1P2UA 3N2ZB 3SQWA 2FEXA 2QMOA 3N5KA 3H17A 4RVSA 2A57A 3W4IA 4EP1A 1ZG3A 4CCYA 2OR3A 2VF7A 2LCFA 2VN8A 4CG0A 4MPDA 1XWIA 2XBMA 5ITZA 2OBSA 1KI9A 3OPXA 4YCSA 5B7QA 3T5PA 1VGVA 1BIFA 2EFDB 3G7UA 5C8YA 1JHXA 4OQPA 4HZIA 5H83A 2EARA 3ZHBA 1A4IA 2RJNA 3AVVA 1EI9A 3H5NA 4FU0A 4RH0A 1UOOA 4F5ZA 4FB5A 1RHQA 1KZLA 4P26A 4KU4A 4I8XA 4JJFA 4WECA 4ZVKA 1YBAA 3IAS1 5FF9A 3D5EA 3VU9B 2IX3A 4YCNA 2HL6A 1L1RA 2Q28A 3M5WA 5DCYA 2ZB3A 5CB4B 2YXLA 2AFIE 4MVYA 2BEVB 3QUQA 4CQMD 4YA6A 1CUCA 1EVQA 4R1QA 4P6YA 2AV6A 1GCIA 3USZA 4EO7A 5KTPA 4DQDA 3K2BA 3OM8A 2Z98A 3DNFA 4OPVA 5FPTA 1ECLA 1A0OA 4Q1AA 5B3AA 3DD5A 3DPUA 4ZKDA 1WCWA 1C9YA 4C2AA 2CVZA 4Q3LA 3VPAA 4NYMR 1E9CA 2JLVA 2VNKA 1VSQA 4JXKA 2PQ0A 1P0MA 1P9WA 3AY3A 3VPHA 2QTTA 4BNWA 1JAXA 4BUJA 4EF6A 5CCXA 4LK2A 1EVIA 2VJQA 3CINA 1E1RD 3RASA 4CV0A 3C4JA 1V4VA 4B6GA 3AY0A 4GMKA 1JFVA 4L9SA 3JYQA 1W35A 3OQBA 4N3AA 3ZS8A 5J4VA 1LPAB 3W6PA 3NHYA 3DEKA 2CVFA 1MAWA 3QHPA 4HRYA 4NEQA 4LMBA 4C6HA 3CVUA 1IM5A 1KE2A 7ABPA 1K7YA 2YXBA 2WOOA 1WKCA 2GN8A 4ABTA 5GONB 5HF6A 5K0ZA 2I76A 3N86A 3T9AA 3U7HB 2FXVA 3T3PB 3EEFA 2FFHA 4ZHSA 3A3BA 2BEJA 3ZWPA 5C3UA 4R81A 2PJRA 2WTUA 4GRDA 5B1DA 4CLHA 3I0MA 3EQZA 5IBPA 2JHCA 3WS7A 3VPSA 1L6IA 4C7VA 5HYVA 5SY4A 4HPXB 3O8RA 2E7ZA 1XXLA 1KH3A 3G13A 3H5VA 5THXA 4ZZ2A 3U4AA 3N3BC 1SQFA 5CB4F 4URVR 4EHFA 1X8XA 3PL1A 2JFVA 1KHTA 4ILKA 3O2NA 1QCYA 4BWFB 4DLPA 5HIJA 2ZB2A 2Q41A 2FPMA 2V97A 3QUSA 4E31A 4QUZA 2C92A 3VZSA 5HZHA 2JI7A 1V39A 1JPVA 5EIOA 3LVRE 2ZPTX 3GUVA 1AG9A 3SQNA 2ISSD 3W2IA 2G04A 2GUGA 2JB9A 2JJ8A 2WJHA 3M34A 2EJTA 4ZN6A 4Y8VA 1VQ7B 4Y3UA 4F21A 1W4CA 1ZM9A 5D84A 1GGHA 2BIFA 5HCNA 1PBTA 3F98A 1WQ4A 2ZWVA 1EDBA 1P18A 2IY7A 4LE2A 3BPSA 1PP4A 1B0AA 4HRAA 1CZNA 5KU1A 1CV2A 4F9GA 2GQFA 1P2BA 2RGDA 1M1NA 2EJUA 3G0GA 1ESEA 5CYFA 5E6RB 2C2GA 5IDQA 3IAAA 2EW1A 1P72A 1U9JA 1K0UA 2KB0A 3CLSC 4ZXFA 3G71B 3EGOA 5MN5A 3VVLA 3WHPA 5BSFA 3VM6A 1L4EA 4J7CA 4GYKA 1X7XB 1XT6A 1MXFA 1KJIA 1LWNA 3HI6A 1T2NA 5C1PA 1RSZA 3WL5A 1FRQA 8GPBA 3C24A 3MWDA 2B78A 1M1KD 4G5XA 2HJVA 1VPWA 4I19A 1V11A 3DS8A 1M2HA 2GCOB 3EFBA 3FSJX 1MX3A 1V47A 3JASB 1NZFA 4ND1A 1YS2X 3ES9A 4KAJA 5B2ZA 4WFKA 4MJXA 4E88A 2CLMB 5E6TA 1YCFA 5LOVA 1G41A 1U2GC 3C7TA 3MWJA 1KYQA 2JFWA 1WABA 1QG4A 4I3HA 4BO1A 4C0LA 1VE3A 3DYBA 4K7JA 3CN9A 1GA4A 2QJFA 1IJBA 2R5NA 1FTYA 2B2CA 2XTAA 3HKBB 4UEOA 4KUHA 3ROQA 5LXTB 2GR9A 5FNVF 1WRBA 2GYUA 3C4QA 3F5QA 3HU1A 2H1SA 2GREA 1IRXA 1DRVA 2ZATA 1ZWKA 3PX2A 3W1VA 1V7CA 4M22A 1ZUNA 2JCYA 3D26A 5IJ0B 4AQ7A 3ZWWA 1VDMA 4P7GA 4Y9TA 5A03A 1BFUA 1SUAA 4O6VA 4WN9A 5HFNA 1ECFA 5KWSA 1U8ZA 4OIFA 1W48A 2XCSB 221PA 2OCAA 3QVOA 1E69A 4EEXA 5JUWA 3L7YA 3LQ4A 3P52A 2JJ2D 2PKCA 1AHNA 3CEJA 2WD7B 3FNBA 3R6DA 3NBUA 4HZUA 4WJKB 4E32A 4EUFA 4EVSA 4YRMA 2CLCX 3DV9A 3ZV3A 4MDYA 1GZHB 3IXMA 3HEMA 2BI8A 1NATA 1JLRA 2WIFA 1BDMA 1YKGA 2GD1O 4WNAB 2E1BA 1U4SA 3ADOA 1PAUA 1P2FA 1FSGA 1B74A 2X8AA 3DAOA 3K31A 4AUNA 4EF5A 1IZZA 4UJ3A 1SKAA 4XLFA 4Q9IA 4X90A 2OO5A 4I1UA 4UBIA 2YMMA 3UK1A 1M5RA 3QVSA 3ADDA 1QKJA 1T1GA 1L1QA 1M6EX 2F3SA 2GX6A 1M1XB 1TCAA 4YJHB 5AH0A 3NYQA 4O59O 4PLPA 1PZHA 3BIFA 2I4NA 5CD1A 3KQNA 1G2OA 1HA3A 2OAEA 3P9XA 5GV7A 4DF3A 4JLSA 1NUUA 2YN0A 1JXOA 1VE9A 1CS0A 1G63A 2QHXA 2JFHA 3EEYA 3AHIA 5HILA 5JLJA 1AQUA 1IUOA 4Q4HA 1JLSA 3AHGA 4M1YA 5JH7A 2CHFA 3NGMA 2YIVX 4BB0A 4PYRA 5D3QA 1T9HA 3A05A 4RDCA 4HAWA 4DXHA 4UBKA 1IBLB 4B33A 2WWVD 1XZMA 3KQVA 4H6WA 4HI0E 4YRNA 1E3DA 4BJ3A 2AF4C 2D7JA 4IL5A 3ILYA 1IVNA 1NSTA 1GAEO 4YCMA 4JT9A 4F1WA 5K0EA 1GZUA 5LFAA 1U2PA 4IYRA 3ONFA 1KI1A 1ICIA 1U8FO 2GF2A 1ZFNA 2JF0A 1IHMA 1MRSA 4L4RA 3VMMA 4UQLA 1MP0A 3KWMA 5CK5A 2W71A 3OMWA 4ZCMA 3ANYB 1D2RA 4N82A 4EGQA 3FYHA 1D6NA 3IAUA 1SCIA 3TRJA 4O2BA 4ZRNA 3ZN2A 1EEXB 4X7RA 3VAAA 4DABA 4Q34A 5IYWA 1IE3A 1OTYA 3F5FA 1HRKA 2P0AA 3CCBA 3FW1A 5K6AA 4BNZA 1E4OA 3GVPA 5HK8A 4ZI7F 3RLFA 2A78A 4J6EA 3D9QX 4BQIA 1NRKA 1CJCA 5A6SA 3DMNA 5AESA 1J2RA 5JXIA 2XT9A 3SYKA 3ZDDA 2GT1A 3NOQA 1QVAA 1RVV1 3OICA 4OHKA 3MQFA 1GPWB 3BILA 4MUAA 3AB8A 3Q0EA 1U7OA 1BJRE 4F9EA 5JMWA 3O26A 5D1HA 5AMXA 5AW3A 1XQYA 5LDGA 4AS2A 3OX2A 1C0PA 2B34A 2QT1A 2AHOA 3KS9A 4HDAA 1F17A 2AZMA 3D3WA 4FX2A 3LT4A 1X1BA 3JRXA 2V59A 4OQEA 4CKWA 5P21A 2I6GA 4AF8A 4BVFA 2V4MA 4HLUA 5BWNA 2X2FA 4NL4H 3HN2A 2AWNA 1NR5A 1WPXA 1A4UA 3OMXA 1OHHA 1EFVA 4DVJA 2VBTA 3SLNA 2YJGA 4M54A 4ON9A 1FFHA 3B2QA 5DH9A 1HE3A 1R4AA 2IYZA 2Q3BA 2R8OA 2VAPA 2ZTMA 1P0FA 2UZAA 3C43A 2IH2A 3O75A 4N7MA 5HVNA 4UTZA 4ZREA 4MVJH 1DAGA 4I9GA 4R5HA 5FLKA 4QTTB 1XRLA 5LZ9A 2QRHA 3EDMA 5JMPA 5TF4A 1MQSA 3MYYA 3SKXA 1DRJA 4XIYA 1IK6A 4X06A 5T7BA 3CMAB 4BJHB 1XF9A 3QYAA 5DX1A 1XTUA 5CXQA 1G8HA 2MYTA 4ZVPA 3BDAA 4C7XA 5FWNA 2F67A 4C4AA 4LF8B 2VHEA 1Y4ZA 4UCFA 4BMSA 2J5QA 1H8EA 4V2UA 4PLFA 3WMWA 2RAVA 1M8FA 2WPDA 3R3XA 1W0JD 4ISCA 3ZLUA 4AECA 5TQ0A 5A3QA 2EG5A 4QOEA 4EHBA 4P4NA 1T9BA 4DSOA 1BO6A 4L15A 1F6WA 4BE9A 4CLRA 3CNEA 4UNRA 2VQFB 4DC0A 4V0RA 3KSUA 4YT8A 4AO6A 5LP1A 4X93A 5ANRB 4O2BF 5TT0A 2QN9A 4Q7EA 5CVDA 2UUBB 1CT9A 3NOVA 1XQ6A 3MWKA 1SXGA 2QN7A 4UMFA 3KR0A 4BKPA 5J2UF 3HVJA 3RAJA 3QVGB 4KQIA 3SI7A 1HE8B 3HWWA 4W5WA 1C8VB 4BMPB 1J5PA 1U02A 1NGSA 2CNKA 4CR8A 5IG2A 1RABA 1SUPA 1ODLA 3B13B 5T64A 4EYQA 2IITA 1JECA 4K05A 2P40A 4OTZA 3VISA 4CKBA 2IOFK 5CA1F 4U0KA 2ALJA 5J23A 1P75A 1OYVA 1RRPA 1YFJA 2O0HA 4PCUA 4WZBA 3AC0A 1NLZA 4ZOQI 2JZOA 4ARVA 4RJJA 1S7CA 5CFNA 4TSFA 3GRPA 3WHIA 1LWOA 5FBQB 5BN3B 1AUPA 3KV1A 3PITA 4DMMA 3AFIA 2CDRA 4UVEA 1MJGM 2X2OA 4ZQIA 1V1MA 3E22A 3BA6A 2CHEA 5KOJB 4E51A 2XECA 4HV4A 3D8RA 1EAMA 4D02A 2NPIA 2OTJB 2FVXA 4MQFB 3U6BA 2XZPA 3FPSA 3VYWA 3EIWA 4CV1A 4M9CA 1BDBA 2J6CA 3BVPA 3LBIA 3ZCXA 4Q7KA 5CH8A 3FOEC 4PGFA 2MIIA 2QD1A 5CJJA 5H82A 3TRHA 3EVTA 1TVEA 1SJ9A 1C1HA 4IQ0A 1E3IA 2FMKA 1QVZA 3S29A 3W04A 4YRGA 1WP6A 4HCJA 3WSVA 3UMJA 1Y3DE 3MTAA 1Y6RA 1TZBA 2OD2A 1XZLA 4Z6KA 1SBZA 2I2FA 5T67A 1FP4B 1VCNA 2HMVA 4WY2A 1FYDA 1V71A 3CCMB 1XMIA 2IOFA 3K8QA 4RD0A 2HYIC 5FTNA 3FB4A 1YS7A 1L8OA 1U2EA 3RFTA 2F2TA 2VQ3A 1SXIA 4EHIA 5EIAA 2ZJ0A 1DEHA 4CV2A 2AIRA 3UJ7A 5L45A 4CM6A 2QJRA 3F46A 5KOYA 4HJRA 5KQGA 3A9UA 1UZNA 3E9DA 5GV8A 1K8AD 4ENSA 2BEUA 1PNQA 2QXUA 3EOBI 4EKEA 5BP7A 4HX2A 3IBTA 1SCKA 4AQYB 2EBWA 2Z4TA 4ZT6A 1QIIA 4M0FA 3HTXA 1N9GA 3ZZ0A 3A2KA 1B8OA 1BE8A 1GN8A 3BQNB 3I6QA 2H8KA 2RJOA 3KVRA 4MW6A 3VDXA 2YRXA 3FBTA 5ALSA 3WL8A 2B1IA 1WUYA 5GAJA 2MU1A 5JVDB 2BFFB 5BN5A 4IIGA 4FZVA 5F4JA 2R79A 4FYPA 4L85A 5CDTA 2PUCA 1Z73A 4DCUA 2WEKA 2XTMA 3F8SA 1VJCA 2CBZA 6ADHA 3FI9A 1CR1A 2OENG 4O5OA 3PPWA 1SUSA 5C53B 3EXEA 5DT9A 5EEGA 5DWQA 5IKOA 3BJRA 1AX9A 3HNOA 4RZQA 2IU3A 3GT7A 2YJ3A 1WB4A 4L5JA 3E03A 3P4UA 2D1TA 4IJMA 4KK4A 1RWOA 2O8CA 1FB5A 1Y7LA 3EW9A 4M98A 3Q7SA 1KVQA 3E20A 4OOVA 4KTTE 2QTMA 5AUPB 1WCV1 1XEXB 2I62A 5SZHB 4UOEA 5LDHA 4EPXA 1OYWA 3GVIA 1N06A 1YB2A 2H4WA 4G0PA 3DULA 4BV8A 4Q9KA 3P9QA 1OFUX 4X3CA 1JYFA 1HZZC 1KY2A 1KY3A 1U2GA 2VAMA 3VPBA 3AESB 3HACA 3TLBA 2FUG6 2GHRA 4QU5A 3ESQA 1DAMA 4MUJA 5ALVA 3VJRA 3LGXA 4M89A 5AKKA 5DE3A 1ZIYA 5IYPA 1T5LA 6YASA 3L4BA 2E2WA 2XKJE 3HDVA 4LHEA 1TU3A 4W5JA 3FBWA 2UYGA 2QTHA 4F91B 3GUZA 4IX9A 2P65A 1TKRA 3O92A 5SYMA 2VWHA 5DW0A 4BRSA 4D8TA 3O1JC 3FCYA 1FIUA 4ZGQB 1OXBB 3BCUA 3ORHA 4BN4A 5HQTA 1LDBA 2O3UA 1Y80A 3PDIB 1GYQA 2IZZA 5JEDA 5CLQA 1E9EA 1Y8QB 4GBMA 4PSKA 1WW2A 4WFJA 1IN4A 1IBRA 5CNMA 2GPWA 4D25A 5K3BA 2KBFA 1GN9A 1Y48E 4KRGA 3V6MA 3R5TA 2QENA 1X80B 1SWVA 2JGLA 1I2BA 4LXGA 3ZK7A 5U4XA 3AVYA 1ZZGA 3ZOZA 4AZVA 4ALIA 2ETXA 2DFVA 2HPHA 1OZHA 2AN4A 4MUHA 1EGMB 3S27A 4X7FA 1NW7A 1XVAA 2P1RA 4YUZA 5GTDA 1U5BB 3MF4A 1WY5A 5FR2A 1P4SA 4WK2B 4DUGA 1WD7A 4EY7A 3AJEA 2AN5A 4BKRA 1QH8B 1V6CA 1XOIA 2RAPA 4QVAA 1RC1A 1MX1A 3C7KA 3BMCA 2W2TA 4AKIA 2CEAA 2XIJA 4M9RA 3VAYA 3IGFA 4PNEA 4ZTUB 5CIWA 2IXDA 3LPAA 4P32A 5JW6A 3ONNA 5DV9A 2VNJA 1H6BA 1TMKA 3WLHA 2QTAA 2V5VA 1T8RA 4ZAVA 5GINE 2Q3HA 2ZJYA 2WJZB 5FPQA 3NTUA 3OJEA 3NB0A 4FT4A 3PHBE 4JJEA 4MRSA 5T6BA 1KEVA 1QBKC 3EZ6A 4W9NC 4CF6A 1W5EA 3JVDA 1GG9A 3MJ4A 3G2NA 1JHRA 3VU8A 1HE1C 2F59A 4Z49A 2GQ0A 3AF6A 2QRMA 1YQUA 1RBYA 4P84A 4BWGA 4YDRA 2P4SA 4PLYA 3DT9A 3NLLA 3GVKA 4QOSA 1JIIA 4P25A 5FFNA 3I9JA 5L6MB 4LMRA 4WZ6A 2F1JA 2X7XA 3AOEA 3PGJA 3H2JA 3RNLA 4BNXA 2VUHB 4CLOB 4HQKA 3HCCA 1ZNXA 2V31A 3HR7A 2VH1A 4KR2A 1Y9EA 2CWDA 1TKAA 4K03A 3G9XA 3RU3A 4AYWA 4F3KA 1P31A 5E3JA 3MCZA 3CH7A 1MQ8B 1AGXA 1H2EA 1MEJA 2RH9B 3UHOA 5FI5A 4CTNA 4V0QA 3EIOA 4HWSA 4JEUA 1PR2A 3IPYA 4Y9SA 5M29A 4EEZA 4UU1A 4HRVA 4JENA 5FBKA 1MHTA 4ZO7A 3AYXB 5DHAA 4DSUA 4AL4A 1V0FA 3E15A 3EZXA 4XGNA 5HA5A 1UKCA 2C83A 3FHOA 4KXFB 2FOIA 1KVSA 3K0FB 1U1CA 1Z0IA 1SHJA 1VBMA 2Q1WA 2FMTA 4NYIQ 2PFGA 2P9YA 3CCCA 3EXFA 3OKPA 4WBNF 4ARCA 4L2IA 1L4KA 5BNZA 1PGOA 2Q2QA 4ID3A 4LZJA 2NWQA 1DSSG 2HADA 1ZIOA 2WDZA 1ZM4A 3LLCA 1QJ4A 4V0OA 4Q4CA 1VSTA 3B7WA 4Y6SA 4M0UA 2ON6A 1HR0B 4IDCA 5C5DA 2ODTX 2YC4C 3BIWA 3MXTA 4LJLA 4AS3A 4BKUA 3TNJA 4FW8A 1KRXA 2YYZA 4ID9A 3KD2A 2QKYA 2PLNA 3JYOA 4INJA 2ZDGA 4PR3A 5AOAA 2YYYA 2Q5IA 2A35A 1FMTA 1P0QA 4NCAA 2FMFA 3IJEB 4LXTA 4YCLA 1TA9A 2D0IA 2ZJFA 1JPUA 2NTYC 4RMHA 3SLRA 5BVHA 4U2BA 3LYLA 4U9IS 1L7PA 5FBWB 4YHHB 1RLJA 4TM8A 5GGXA 3L1IA 1QIJA 3E9ZA 1C0KA 3FF4A 5CUQA 2F9FA 1HL7A 3QWFA 4NS4A 3DBIA 3ESYA 3VGJA 5LU8A 2B69A 1FTNA 1TEXA 3SLKA 4AROA 3ZGNA 2PU7A 1JLLA 4TQGA 1XYVA 3QFFA 5IBRA 1RYZA 2BFBB 4AY3A 4BEBA 1Q0ZA 3HR4A 4WZAE 3IBCA 5AI5A 2FX5A 4DB2A 4G0QA 4ARBA 2WSMA 1TW3A 13PKA 3V9AA 1YDFA 4LDQA 3UATA 3PNMA 4H4EA 2LDBA 1BQ3A 1YL5A 3K9WA 4MH0R 4YV7A 2W90A 3BQ9A 5L53A 5GZ3A 2JLYA 4UBJA 1BDJA 3A14A 4S35A 7ADHA 5KW9A 1N6RA 1P77A 2WSIA 2PRJA 3VPGA 2COEA 2Q3MA 3C14C 2HBYA 3H13A 5DEIA 2XF2A 3I28A 3N59A 3USES 2BUCA 3KTAB 3GMSA 1JQDA 2DPHA 5DHSA 5TS3A 3TINA 4MO9A 2O1XA 2LR0A 5CDSA 3UTCA 1YS4A 1N1EA 5CK4A 2VPQA 3I0NA 4GIBA 16PKA 4M7WA 4CN8A 3PHIA 4JI2B 5ENDA 4JMQA 4ZAWA 1IIRA 4ZYYA 1UMDB 2D3TA 1XIVA 1BYUA 4ENRA 4X71A 3PENA 5K1ZA 4HYYA 2QLJA 1MAHA 2Q3EA 3TM4A 1Q57A 4NQZA 4B6JA 1B8NA 4MAMA 2G4LA 3HYCA 2AI2A 1S2GA 2C8JA 1NBWB 1LKZA 1KL7A 4HGYA 4GHWA 3D8TA 4NATA 4P3OA 2BTQB 3C41J 3DUWA 3LQ1A 4OBBA 2SECE 3S1SA 2IEYA 3E8MA 3H9GA 1TTHA 1CUUA 2Z9DA 4WNYA 2Z57A 5F77A 2BBTA 1IG0A 3K1JA 1M2JA 1IXZA 4OXQA 3WLTA 2GN2A 2VPYA 2WU1A 3CUEF 1F2UB 3OG9A 3FWPA 2ZKLA 4MCHA 5JJIA 2K5UA 3IAXA 2LCQA 1FC0A 3ZKWA 1ST2A 2QRUA 2G9UA 3NRBA 1BQ4A 2IIPA 3FLAA 3SC3A 4ND6A 1X77A 4OPOA 3L8MA 3BCDA 2QQFA 3QYFA 1NY5A 3OW7A 1Q3KA 3H5IA 3NRCA 1TC1A 2A1UB 2CLKB 4XLCA 5HF8A 3VV2A 1H23A 3GIRA 5FI1B 1WV1A 4P7FA 5CHYA 2HSEA 1NG1A 3RYFA 3CN7A 1AKWA 2M5SA 3QUBA 4F60A 4RZHA 5C7LO 4IG9A 2XH8A 4EZBA 4WUVA 2Q8PA 3H1AA 4URZR 3CR8A 1V2GA 4U7DA 4V38A 4N48A 1BROA 2W6IA 1MR3F 3CRNA 5FAKA 5KOHB 1YJAA 2Q4TA 3E27A 3ET5A 4N5NA 2P62A 3O4VA 4QQRA 5HF9A 2C1XA 5JRJA 4GPAA 4J2HA 4XR4A 4NYJR 5K6AC 2FRXA 4HRXA 2Q6VA 3UUWA 1FTSA 4F4JA 2XSZD 1A8UA 2PS9A 4PABA 1TVCA 1O5OA 1KVTA 2EWWA 5EIBD 3T9CA 1O94A 2PDAA 5KTKA 4V24A 5FEMA 3MSCA 3FIUA 1EESA 3H8WA 3QVWA 1D2GA 2NU9A 2YQ4A 2LBPA 4OF4A 1P9LA 3B9PA 1JBKA 3L18A 3GNQA 2OCDA 5JNRA 1Y8ZA 1CX9B 4MYHA 1DP4A 1D1PA 1MJGA 1DIAA 2FEOA 3P97A 3U31A 1VXRA 5AI9A 3AU8A 1W87A 1TM7E 3GF4A 3LP8A 1ZRMA 1PJ3A 4YMLA 5IF3A 5CA0A 3EH1A 1YIJB 3FYDA 3L4JA 5K4AA 1V3VA 3ITDA 2HA5A 5AHKA 4GFDA 5DB4A 1RQGA 3RUFA 2BYTA 1UKVY 2VQSA 4XRGA 2B6HA 3L7KA 3PGMA 1GILA 3B5IA 3EHDA 3QNUA 1VJDA 2ZPUA 3OBIA 1DELA 3EWIA 1VP3A 3UWKA 4DQUA 4ZCRA 4H60A 2Y1EA 3I53A 2FPUA 4K9OA 4HUJA 3QEKA 1Z3IX 1PVOA 4TV8F 1HDRA 2DZDA 3FI0A 1DC8A 2OFFA 5C35A 4YFVA 1QG0A 4OLAA 2R1TA 2XUDA 1Q2XA 4EJ2A 3P7MA 2FW1A 2VTVA 1CUIA 1SBYA 3HUFA 5BSRA 1ACLA 4ZCIA 3L7LA 2VTDA 2O5CA 1QWOA 5E7IA 1OMOA 2O2IA 3RS0A 3HNPA 4N49A 1BVHA 1GTJ1 2BT4A 2ZVDA 3QVMA 2H1LA 1SBTA 3IMKA 4AP9A 2YZMA 3IP8A 3L01A 3O1HB 1Z13A 2QN2A 4M8NE 4X5OA 4ENUA 3H75A 2C4MA 2P79A 1I6MA 1WUJS 3TXAA 4QVIA 1XZFA 3G0CA 4JI5B 3H6HA 3RC1A 3B6IA 1CRZA 1TU4A 3C97A 3ND5A 1GZDA 4KAAA 4ME6A 4OUDA 1YAJA 2CYBA 1XVTA 3BRQA 5BYJA 1Y3FE 5JDCC 1SNYA 3WGIA 4DNFA 3MS4A 5HRCA 5KWEA 1URPA 1VRVA 3VV3A 5C8VA 4XFJA 1X9GA 2ZT6A 1JR4A 4Z9AA 3SIPA 2LV8A 4E11A 4XN3A 3HWX1 4FBMA 2XPCA 3FRIA 1WVMA 2XMGA 4KWEA 2VP4A 2ZB7A 3DVSX 4OM7A 4XQGA 1NBOA 3NCTA 3QVKA 5IPFA 2ZRBA 4WOCA 3WYDA 4R1PA 2D54A 4WESA 3ZE7A 1S7GA 2OSBA 1GARA 3B6EA 4XYGA 3L0PA 4WZTA 4OHXA 2R65A 2PUAA 3FFWA 3WGNA 3HMKA 4GOLD 5H3HA 1KAOA 3L8ZA 4MRRA 1C7IA 3G1WA 1GT91 4PY2A 5EJEA 4H7KA 2G80A 4CI0B 3G88A 4JFAA 1EFPA 5DI3B 3G9ZA 2HF8A 3BAZA 1UKAA 4M9SA 4QXQA 4OHBA 2F1KA 3KLMX 2Q5QA 3T8YA 3WQRA 2Q3JA 1QS0A 1Z83A 4YCDA 1QO0D 4YB8A 2O2YA 2XKKA 1KYIA 5AVOA 3RSQA 4PZUA 1S6YA 3EF3A 3T4PA 2HKIA 1J8VA 3GJ8A 3W8FA 2IS1A 1RYHA 1Z33A 2X6TA 3ICWA 4XCVA 4ALKA 5TMEA 1RYBA 4B76A 1OLXB 1RLOA 4YRSA 2R6R1 3LP6A 1IH8A 1U2DA 2QD2A 4K81B 4EMTA 4ER0A 5WRFA 5LP6B 2FEMA 2ZUEA 1YE5A 4TV8A 5AK4A 1LFDB 1ZD2P 4I9NA 4R2XA 5EY5B 4CU2A 2FAXA 5EPOA 4E3ZA 2DH5A 2XTNA 4HVCA 3W8NA 3PFHA 1F9EA 3FOWA 4GI3A 1WQ1R 4Q7MB 4MI9A 1XAHA 3KPJA 1PRYA 4PBSA 1GADO 2ATIA 3CTPA 4J0EA 3DXYA 4XGRA 2FFJA 5IM5A 1AZSC 1RWKA 1XTZA 2P8SA 4CF4A 1G4HA 3DPIA 1Z6QA 1QB7A 4G89A 5AJHA 3UVEA 3UWSA 3P4YA 1OY1A 1JGTA 3LXMA 4P53A 3RT1A 2CFSA 4CHTA 3CEPB 2POCA 1BN7A 3HP7A 4PQYA 4GX0A 4RS3A 4ZYXA 1QKIA 4FQ7A 1P17A 4MDHA 4ZKEA 4DRXB 1IHXA 1NVFA 4GS5A 4IFIA 2O48X 3M3HA 1IN7A 4DJJA 3ZCPA 3HM9A 4ESVA 5HFJA 4S3MA 1XJWA 4HK4A 3FWKA 3DE2X 4AZTA 4B3XA 1KORA 2OHXA 3BXEA 3DQPA 1T91A 3ORYA 4K9LA 4BTLA 4YDHB 3QLVA 4EA6A 4FYHA 3T1OA 4FFOA 1JFSA 4DILA 1JVBA 4QHYA 3IX7A 3RBVA 1ZQ9A 2ZVPX 1UQTA 5F9MA 1YHZA 1EP3B 1W581 5B30A 1IB0A 2OILA 4P35A 4W8GA 3ZLTA 1YU6A 2ZXHA 3LDUA 3T3NA 3H94A 1IPEA 1NYRA 1W44A 4OOSA 3DF9A 1YHNA 1NM5A 1T0JB 2PT5A 1TO1E 1ZD9A 5EL0A 1B6SA 4NJEB 1VQMB 1VKRA 2C5LA 1FX0B 4K0RA 3FTCA 1G5FA 3TIGA 5EXSA 1CUHA 2FJ0A 2IYPA 5F35A 3OO1A 3G49A 3RIXA 2PLWA 2I1QA 1YL7A 4HTAA 2IEAA 5DHQA 4N3NA 2G88A 2NLOA 2V55B 5IRCD 4TYWA 3HWRA 1TGYA 2B1GA 4LRTB 2N75A 3MPOA 2ZIWB 3OEHD 4OSPA 4P5DA 4BNKA 4JYCA 4HVTA 1YZ3A 4BHTA 1B8UA 4AULA 4KYVA 2X3YA 1BTOA 1Z08A 1F1BA 2Y2UA 3AM5A 4QT0A 4XA8A 5E1DA 3TW0A 4JT8A 4C89A 3KPVA 4HYEA 5CLFA 1WA5A 4RE5A 4E30A 3GEGA 1PW7A 4CFZA 1USWA 4ENPA 2J41A 2XKBA 3OA0A 4IM7A 3WBKA 2BFDB 4V0KA 3WISA 1ZGJA 2QX7A 1GNSA 1C30B 2Q50A 1QIHA 1OFUA 3J81k 1E6LA 2VF5X 1GKIA 1Z26A 3OF5A 5IBQA 2ZBUA 1HKUA 4MAFA 4OP3A 1ABBA 3SXUA 1E5DA 2O8NA 1DDGA 3UXMA 4N0QA 1KF0A 1PT9A 5IN4A 3LCRA 5AVSA 3MIIA 4BP8A 4XWYA 2IW1A 4B7ZA 2CSXA 2WHQA 3GWGA 4LY0A 3UMMA 4IG4A 4ND8B 3HBNA 1FA9A 1PWHA 1ZBQA 2G25A 3M1LA 3GLGA 5HDQA 2EFJA 3E1GA 2PX4A 2EP8A 2PR2A 4CWAA 4MV1A 2VDMB 3TLJA 2XRYA 5H3LA 3AFHA 3TTXA 4AC9A 3TPCA 3DLBA 4Z4EA 5KWVA 3L7NA 1E1YA 1KJYA 1RWVA 4L5IA 1H2AS 4PGAA 2OPBA 3SM3A 1QVRA 1QHHA 4KDEA 4O29A 3FWHA 3ACCA 3N0XA 5F64A 4L75A 5AM2A 4BAUA 4MYUA 4MX8A 5MN6A 3SOZA 3MJRA 3R41A 3D1JA 1FEZA 2YZ7A 1ZA2A 3ASVA 3DMDA 3INYA 5HP4A 4H17A 2XUFA 3OIWA 3HKCB 4Y0AA 2GPBA 1OBHA 2C59A 1IEWA 4RA9B 2Y93A 2YFHA 5LL6P 1U98A 1KH2A 4RC9A 2GXUA 2CNOA 1WTCA 3ZCVA 1ISFA 3I6IA 1KOLA 1LPBB 1FF9A 4YDQA 1HDYA 5BV1A 5GZ6A 3OM0A 4AZWA 1BSVA 4RQBA 1G7SA 3WP1B 5TEWA 1G8SA 1XC7A 5AJXA 1SU7A 1NBIA 5GM1A 4LSGA 3EBLA 1FDRA 3M6VA 4OGGA 1GL9B 1DKOA 4RJKA 4RNCA 4JUDX 3ZQJA 2GJ8A 1MB3A 3QENA 1QMGA 4DB4A 1M1YB 4J91A 3GAZA 2W37A 3F90A 3TW4A 4DLBA 4QGFA 1YA6A 1W36B 3I3SR 1F2DA 1AZWA 2WB4A 3ZIUA 1M67A 2OBRA 2Z4SA 4W99A 5FBLB 2VJDA 3AQIA 3LKVA 4B34A 2BE9A 2ZDQA 3E9EA 3PD1A 4QBIA 5F23A 3GZJA 4FD2A 5ILGA 1C9NA 1N8NA 2AJBA 2PX6A 2Y1KA 1G9SA 2Q2NA 2P2YA 4B32A 2BEWB 3QEMB 4LHZA 3WJAA 3GXBA 3ABSB 3A6LA 4PYKA 1NYLA 1PVVA 4ALMA 2PUTA 3DE1X 2PQ6A 2GEDA 4IJUA 5JO0A 3TCXB 1PFUA 4LXHA 4JY7A 1MB2A 5EE1A 4AJ1A 2QRKA 1AUQA 5LP6F 1OV4A 3PGLA 3SDZA 3BREA 2PGXA 2IXAA 4BE7B 3ZXIA 2OGSA 3BGDA 2BKEA 3BRSA 3F4BA 4D2IA 1B0UA 3I1JA 4L8JA 5IZ4A 1R0CA 2Q4BA 3ZD9A 4O4LF 4UTNA 3ODGA 3MCVA 3QKRA 4KVGA 1M1YA 2WWTA 3OCUA 5ISMA 2QRVA 4INOA 2EYUA 1GYPA 1OXSC 1KJJA 1RI2A 2HAEA 2IP2A 3FX2A 4HDRB 3MBOA 3TL2A 5IT0A 4G1VA 4JA0A 4KIUA 1LRLA 1COZA 2FSGA 3QXGA 4Q4JA 5CHEA 3KNZA 3ANMA 4WXRA 1BWSA 4N54A 5DW3A 3MOGA 3ZD8A 4E6PA 2VP9A 2F8MA 4QBKA 2W98A 3ORSA 4F2HA 3IEVA 2OP1A 3N2YA 3FAKA 3OY2A 4QPDA 4MVJP 1QG2A 2H92A 2OLEA 4D4IA 1Z6TA 3GCWA 5IJ9B 2GK7A 3MB8A 3D7MA 2DUNA 4D96A 5FLXA 4NAHA 4OGWA 4TOIA 3CLHA 3HKCA 3UV3A 5KYNA 1DJNA 4ZJUA 2R4UA 1I8TA 4PR0A 3V4LA 4XQCA 5AKHA 4HT3B 1A97A 1Q7RA 3OTHA 1JUDA 5B37A 3TW8B 3ZX5A 3B3GA 5CA0F 5KJCA 1JEDA 3ANLA 3SM9A 4EA9A 4HADA 1Q1QA 2HEIA 3E81A 4M87A 4XUDA 4M0MA 4ZIRB 1PSWA 2AOXA 3IP9A 4OQFA 1DOHA 3QFRA 1ZMXA 4LXQA 4YAWA 3EIXA 4QAQA 4X7EA 5EHZA 1W93A 3H6GA 3TSWA 3E4CA 3S5UA 2W83A 4AUKA 2PS0A 1RJ9B 2NYVA 3S2ZA 5LZ7A 3COVA 3TYXA 121PA 4F06A 1L7XA 3CWZA 4NDNE 4I14A 3LUJA 2X8BA 5EJGA 5A9SB 2AVDA 4OJNA 2XYRA 1GLVA 3WI7A 2J5RA 2JLAA 4O2RA 3DCYA 3TUZC 2W6OA 1HFKA 2ZRMA 3MILA 1J22A 1K2WA 1NDUA 4Z9XA 4BPRA 1OKKD 3D2BA 4J0JA 5HKKA 4B46A 2C7GA 4RCYA 1HZZA 3PFNA 4DLYA 1R4NA 2JAOA 2XV1A 1FVOA 1UBRS 2JRLA 3G2KA 4JQYA 4IIXA 3TQFA 1W0KD 4YY3B 4P0PB 2VPTA 1E0AA 1NQXA 4BLSA 1MENA 2JLRA 2V7VA 2NGRA 2BSXA 2X0NA 3F71A 2QEXB 4W5OA 3OD1A 2BR4A 2DM6A 1W73A 1SU8A 1T1RA 4K8RB 1XFOA 2BMFA 2JFZA 3CKYA 4HWRA 1S3SA 2YHUA 1ZOOA 2DQYA 2ZRCA 1M7HA 2PS3A 5FPYA 4GYYA 3SR4A 4IEEA 4GP7A 2WTAA 4DV3B 1CNMA 2ODPA 2A3RA 2WYOA 1FP2A 3DMHA 1GXSA 3A11A 2AXNA 3UGJA 2EKLA 4IRXA 3U3ZA 3L82B 3UK6A 2E55A 4G41A 1POWA 2VC2B 2C1ZA 3JQ7A 2ZCJA 3E6AA 4AAYA 1HZJA 2AOVA 1P81A 2OV1A 2NXEA 2HCTA 1JG1A 3NBMA 3LKZA 1U11A 2X53S 2REQB 4BZQA 4RGYA 3A9CA 4NYMQ 3AJ9A 4J03A 5K0TA 2FZKA 5AKYA 3ABOB 3C3MA 1RP7A 1F38A 3EVDA 4OH1A 4Z8YA 2IHJA 1UQUA 3ZW7A 3CUKA 2O7VA 2E37A 3DHNA 5BR8B 4PE5B 2GAAA 1CUFA 4B87A 3V1KA 3FUXA 2JZCA 1UBJS 3I1FA 1QFXA 2BN4A 3DH0A 4I1VA 2WFZA 3DCNA 2XYPA 2X6RA 5KHOC 4MYCA 1EUQA 2X14A 1VCMA 4TROA 3NNSA 4UXIA 2I4MA 2C98A 4K9SA 2IYXA 1R0LA 1H3NA 2NUAB 3NMUF 3V46A 1WHSA 1YSCA 4HBZA 3FPAA 4G5YA 2PX8A 2R2AA 4L22A 3DBVO 4C7KA 4G5GA 1CLUA 4NJOA 3LYUA 3CMMA 4RDLA 4OB6A 1NF3A 1GV1A 2VWQA 2CF6A 2QSZA 1PL7A 5E8JA 4JOSA 3EC1A 4UZUA 1EG7A 2WVJA 2ZRJA 4D46A 1X7GA 4MULA 3QLVC 5LP6C 4KGDA 4P2BA 3PLNA 2XVYA 4II3A 3HS3A 2BBWA 1GL6A 1FFAA 1DBPA 1K8ZB 2PCJA 3EG9B 3NT2A 4RLZA 3G0OA 3PYXA 4GPIB 2REOA 1FTGA 1SELA 1U1EA 3JR3A 3EE6A 4IZIA 4L5CA 2ODQA 2VDOB 2OZLB 4QWMA 4UCXA 3DD1A 3W8DA 2G8NA 3PVZA 1E5TA 2GZSA 1Y7TA 1R10A 2CC2A 3IDQA 4R7GA 3V7NA 1VCIA 4YJFA 1T0HB 3ISJA 3F6CA 4L6CA 3W9SA 3GSIA 1P2GA 1QM5A 2Z58A 5D1NA 2ZZNA 1JX6A 2QG9A 1TNDA 3ZNOA 4E5MA 2D06A 1MN6A 4YWJA 3WHKA 3G5LA 1UJNA 4HDSB 3KQPA 3ZUPA 2P6OA 2IXFA 3LA8A 5FWYB 4M8KA 2IPXA 2CVPA 4CQMB 2PIAA 2PYZA 4M76B 4CVNA 1XMOB 1YI2B 1PV2A 4EY8A 4WOJA 2A94A 2ZG6A 4QYTA 1QS0B 4X8HA 3A25A 5AD1A 2WIJA 1I3CA 1KDTA 3MGKA 1IONA 3GFRA 3M4YA 2JVKA 1ISJA 5H0IA 5KCMA 5THKA 4BMOB 5AKGA 3TCNA 1TUBB 3MWEB 3VI3B 5L40A 4EO4A 4Q1EA 4R3UC 4RSGA 1C4KA 4N6OA 5E9WA 2JLXA 3MHTA 1OT3A 4YYEA 2P7IA 4EBFA 4TLLB 4XPIB 4OHMA 1KSJA 2R0QC 3PDJA 3EGXB 4OYHA 5HCIA 3GA0A 2GLUA 1OZFA 3FZYA 1K06A 2WVGA 3H19A 1HLPA 4IHAA 4LRWA 4KR9A 4WESB 1M0SA 3BCHA 1OLOA 3E9QA 4X20A 2CLIB 5F73A 3M1AA 4LWPA 5EHNA 3GLFB 1X13A 2I1WA 2MJLA 4OK6A 1E58A 5FXMA 1CQZA 1ZCJA 2OHFA 2OZVA 1JDTA 3GFVA 3PUIA 4TQ9A 5IJWA 4AIIA 3Q9LA 3RFXA 4DBLC 1DU4A 1F8YA 1NE2A 4DLKA 2PEZA 4G7WA 1GITA 1GSIA 3IPAA 4WRRA 1L0BA 3ETHA 4XR6A 3G2OA 3L4KA 1FE8A 3GJ5A 5TF0A 4ZQFA 3ZH2A 1CF4A 5B4TA 5AVJA 2RGNC 1V43A 1X7HA 2G1JA 3N0VA 1HDCA 1QTRA 2QQ0A 3EAQA 4KIFA 2QX6A 1R3DA 1T3TA 1XU4A 2AFHB 2IY8A 2ZYIA 3IIMA 3MEQA 2I5PO 4KVZA 5E38A 1IVSA 2QG6A 2HYDA 1PLLA 1RP1A 1R9MA 4CEHB 3ESCA 4YMIA 4QU0A 5LKRA 3BKWA 4OFXA 1TAQA 1JMVA 3WV4A 3S99A 4XJSA 3K09C 1ZP6A 2Z1NA 3HN7A 4XD7D 4GMGA 4BZZA 5CBKA 3S8EA 4E0FA 1M66A 3ESRA 5J35A 3EC2A 2XAAA 4E08A 1R8YA 4CDRA 1G7TA 4AT1A 1VHQA 4L0MA 1BC5A 1BRTA 2XMDA 4Y30A 4B6QA 2G17A 2EVWX 3FTDA 2J08A 2Z04A 4YREA 4LBZA 4TYNA 4F6CA 4H7EA 2X0EA 2RKOA 4YQYA 1ESZA 1KY4A 3BJEA 3TOVA 4D6XA 1Y6GA 1M1ZA 1T2VA 3WFIA 4V1CI 1VE6A 3DM9B 1VA4A 1UT5A 3KEGA 5AW0A 4W5RA 1U4OA 1PWXA 3A9TA 1LCIA 3V7AA 5KSPA 2G77B 3PXAA 1OX6A 4CEIB 4QQNA 1L5NA 2IV7A 3EUEA 3P71T 3HWSA 4JVNA 5IFLA 3EJWA 1V16A 2BRUA 1E59A 1ISSA 4Y2UA 4TL6A 4GT1A 2XUZA 3SBOA 3OPVA 2E4YA 4UPEA 2PWZA 2ZI6A 3T9EA 1IPHA 4EKYA 3FBGA 2NU9B 3VVMA 1C1XB 4JLOA 4HQNA 4PZAA 3EDOA 3LDAA 3LPDA 3K15A 1VHDA 2JGKA 5TY0A 4G1UC 4LDNA 4JUCA 3D4PA 1F0NA 4AJNA 4RFLA 4HEA1 1USKA 3QXHA 1QCDA 4OA5A 5IM4A 2VDVE 4EDFA 1JQAA 4LDJA 1LV8A 2EQ5A 4HGZA 5AHOA 3EDRA 4QYIB 5E7JA 4I46A 5EG5A 4OBWA 1H2RS 1M3SA 3EZ9A 1HOXA 5C8DA 1ZVJA 4R2HA 2B8WA 2I1LA 3I62A 1ZK0A 2BH2A 1UH5A 4ZI7A 4A2PA 4LCJA 2NV4A 3GRFA 2JJ1D 4MW7A 5CVEA 3SLDA 3A1PA 2O5VA 5J3OA 3P2KA 2M9MA 3I58A 4QOHA 3PE3A 1ILEA 1Q3TA 3OU7A 5LZ2A 1WOOA 1DKMA 3KOMA 4XGKA 4YP6A 1AHPA 5IDYA 3WRXC 2PHZA 4MCIA 4C87A 2XNDD 3UT0A 3ZD7A 3WZLA 1BWRA 3DEJA 1PKVA 1WQ3A 4R2IA 4TWJA 1J1IA 5AI0A 4BVEA 1HY3A 3GJYA 5BURA