2C5BA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 2'deoxy-5'deoxy-fluoroadenosine.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Substrate Specificity in Enzymatic Fluorination. The Fluorinase from Streptomyces Cattleya Accepts 2'-Deoxyadenosine Substrates.
pubmed doi rcsb
source organism Streptomyces cattleya
total genus 70
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2c5bA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2c5bA01
2C2WA 2CW5A 2C4UA 5LMZA 2Q6LA 2V7TA 2WR8A 2CC2A 2C5BA 5FIUA 2C4TA 2V7VA 2Q6IA 2Q6OA 2C5HA 2V7XA 4CQJA 5B6IA 2V7UA 1WU8A 2Q6KA 2ZBVA 1RQPA 2ZBUA 1RQRA 2V7WA 2CBXA 2F4NA
chains in the Genus database with same CATH superfamily
1W19A 4TKVA 2HDWA 3IEXA 1FE8A 5LB4A 3VHQA 1V4VA 2QI9F 3FPPA 4YMUA 1F38A 3F97A 4TT8A 4TWBA 4D41A 1J07A 1J42A 5KAMA 3VU1A 4P1VA 5J5VA 2IEDA 5ALSA 4E5NA 3L04A 4YT2A 3LBFA 3MHTA 3TLKA 5CX4A 5BSVA 1JKFA 2FUG1 3QU4A 4XTRA 1ZI8A 3BK2A 4AJKA 3GMDA 3GGGA 3KZKA 3F1KA 3AJAA 1XWWA 3DCIA 4WE3A 2B83A 4QICA 1WBDA 5HUQA 1K7EB 1QZXA 2LTAA 3HBAA 3HFRA 4B3JA 4IVPA 4YO8A 5F4OA 3CVWA 2B4TO 4KWEA 5EHGA 5IUNC 4IIEA 4DBVO 2Z2XA 4J16C 3U09A 1T5TA 3MJFA 4NYMQ 4L2IA 3IEIA 3COJA 3R7LA 2CL7X 4CM3A 2ZTLA 2QBYA 3L4SO 1IIBA 1M76A 2PKYX 3H6HA 4J0CA 4ALJA 1BXGB 1YZVA 3SKVA 2XSZD 4QJ3A 4FGSA 1UKYA 3C6XA 4FXUA 1E3DA 2H3HA 3GWGA 3NCHA 4KREA 1U8UA 4RL6A 5BWLA 4Z4TA 5C5DA 4MQ4A 1RYYA 2JH3A 4ZOBA 3KPUA 2PGLA 1U0SY 4R81A 4TVKA 2AK2A 4NOLA 5AVVA 4LYHA 5G4LA 4RE5A 1KDRA 4LJ5A 4OGKA 4ZT3A 3EY9A 4EJ2A 1QQTA 3AXTA 4L5BA 1HL3A 2XMDA 4WEOA 1HZEA 3MWJA 4DCUA 1ZISA 2OHHA 1W581 4LNAA 2Q5CA 4ZQGA 3G0CA 5A5FA 3OOCA 5EJ9A 4PG8A 4C0XA 1A95A 4K2AA 3HPQA 1GTL1 3H1GA 3SC4A 3O9ZA 1SC9A 2HJHA 3ZZ1A 5ALLA 4OXXA 3HKBA 4QOSA 4WZBB 1DKPA 3IB3A 4FOTA 4PO3X 4PG4A 3TLZA 1TU4A 2IWHA 1I7PA 3LMKA 2XKKA 3OUUA 4DAEA 2GR9A 4DT1B 2I2XB 1JNYA 3PIIA 4BLUA 2N75A 1K8QA 2QIPA 3FUWA 4QUGA 5L3ZA 1F7UA 4UCQA 1UODA 1MLDA 3NX4A 3FBGA 2OBRA 1IHOA 2YUTA 4XQ0A 2A1TR 3MWEA 1GCGA 3CUTA 4CM8A 1YHNA 3ZBQA 4Y9TA 4U7JA 4ZPJA 4LYDA 3VR4D 4R40A 1DEOA 2OTCA 1C3JA 4MVWA 4OP1A 4UTXA 1VSTA 2OCAA 2X14A 4BRWA 4E7OA 4REQB 1DXOA 1B3BA 4OUDA 1EQAA 1Y4DE 4BLRA 4KIUA 4RNCA 1KRXA 1M2EA 1V3UA 5ELXA 5H0IA 2FMUA 2JAQA 1PT5A 3DKPA 1KI3A 2HGZA 4P4UA 4RJ2A 1EGHA 2BWJA 1TUBB 1PL0A 3DTYA 4QATA 1QKJA 5D5HA 2LDBA 4GZ3A 4AJLA 4BLQA 2XRYA 4URHA 5ILQA 3RBVA 3EPKA 3FVTA 5JASA 4ZAWA 1K5HA 3WMWA 1ZVMA 3EIEA 2B1RA 3JCZA 3GL9A 4MUFA 3ZGVA 1RNLA 1JHXA 2Z56A 2QW8A 2V7VA 2V6FA 2RARA 3P0EA 4WZLA 1D2HA 2R1UA 2WM3A 3LQ6A 3WQZA 3FTFA 5K2MA 3G9XA 4GUDA 4F4UA 4PCUA 3MSCA 4O5OA 3DLBA 5EHXA 2BFDA 2O3JA 2WA1A 3WZLA 4YCSA 5B1DA 4CETA 3T5PA 2AIRA 2H06A 2IU3A 1PBTA 2GHRA 2C9YA 2O48X 2FOIA 1MRNA 1W44A 2P1ZA 4OHOA 5EZYF 1NSYA 4Q5IA 1HQDA 1MQ8B 1TX4B 3D2BA 1QG6A 3H8JA 4R0NA 1VE7A 3BD7A 4G4IA 3IOCA 4GQNA 1TC2A 2VBCA 4IVRA 4TQ9A 1LCIA 4BEWA 4D5GA 1RIIA 4LY6A 3WVNA 4BNIA 4J2TA 5DM0A 3UXMA 5DNCA 2CWWA 3PQ8A 4DG9A 3TLCA 5SZHB 5K09A 2PUBA 1L4NA 5A4IS 5D6OA 3RY8A 3LVFO 3MVEA 5A5GA 4D26A 4D1YA 2JLRA 5BN4A 1MGOA 3E9MA 3GUUA 1I36A 1IG0A 2G28A 2IDKA 2OFXA 1O6GA 2C2MA 3PNOA 3WA7A 3WQRA 4QAJA 4BO9A 2ZLBA 3BL6A 1IN5A 1OLXA 4BRUA 4YALA 1G8HA 3HUUA 4QIHA 4G0XA 4Y8VA 5B58T 1RWXA 5FI5A 5K7SA 3KAKA 1TGYA 1VPWA 3DXFA 4A5SA 3AI2A 1HDOA 1YDHA 4Y6SA 3L92A 1D1TA 1MDBA 4MB2A 4ZU6X 5CDHA 3ND5A 4EB6A 1GILA 1T13A 3L7BA 3R3JA 3G0GA 4ZKDA 3S8YA 3IIIA 3BSWA 1M8GA 1MRZA 2WD8A 2ZWMA 3TSCA 1BOOA 5BW8A 4IOLA 5KC9A 5MGNA 4NC9A 3DFZA 5DVZA 1LBQA 1YUNA 1KO7A 5ALGA 1FVXA 2G8NA 5DXFA 2IV2X 3PC2A 2DP4E 4GWGA 3SDSA 3RC2A 3URKA 1B15A 1WV1A 4MR9A 1K8RA 1Z7GA 2G9ZA 4PHCA 4EG4A 5KPDA 1WTHD 2VI5A 4I1RA 5FOXA 1I4LD 2ETVA 3T41A 3VSCA 4EHKA 1BYIA 2YQZA 1OB2A 4CIVA 4MVJF 3REGA 1T2EA 2WSBA 1SHKA 1H2XA 2YYYA 1IY1A 3DONA 1H69A 3PXAA 4FHFA 1E6CA 2H9IA 1P1JA 1Y34E 3A37A 2IZ1A 1N4DA 3DL4A 4MV5A 4JMQA 4GP7A 4YREA 4P3IA 3U7RA 2CHEA 4B33A 4C6RA 3BCSA 1Y37A 5IF9A 3UMCA 4GD3Q 2VCEA 3NRCA 2AFHA 1JPVA 2R6JA 4HQ6A 4KAXA 1HA3A 3MJSA 1Z5ZA 4MQUA 4XD7A 3GPDG 1YJNB 1X80A 3KALA 1ISMA 2BLNA 1OWNA 1HOTA 3WHKA 5IT4A 3ETGA 3VVBA 2ZXUA 1S2GA 1P7PA 1ECBA 3M4XA 1IRIA 2R66A 2N47A 4WERA 5AO9A 1KMCA 2KM1A 2ROQA 4MA5A 4X06A 1S72B 1KBOA 2DPGA 2ZAOA 4XCVA 5JARA 3S2YA 5KBYA 3EXHA 1P77A 3H75A 1SQ5A 3D6FA 1O2DA 4G67A 1T91A 3GNSA 4NYJQ 5KYTA 4O4JF 4FJ0A 1UINA 3V55A 1SHZA 4XLEA 2OVBA 3GROA 3P1JA 4Y67A 2WTMA 3DOEA 2ZR7A 5KKNB 4A2WA 3STWA 2OYRA 4U2EA 3DUFA 2FSPA 3ZJYA 4DUPA 1OXKB 4JP2A 3AL3A 1X74A 3LPNA 1CHDA 4GM0A 4OMCA 5BNFA 1DG1G 3PQ5A 1GGEA 3P2OA 2BGNA 5ESDA 4DLKA 1E7MA 2QM0A 3PYXA 2BHNA 1FTWA 3AM5A 3LQEA 4HB2A 5I7OA 4F2HA 3S5UA 3O8QA 4DQUA 4R8LA 1NY6A 1Y8RA 3IPCA 3GCXA 1SHLA 4TV8A 2FWBA 3BPSA 4XQ9A 4JI1B 5LP6A 1WZ2A 4IQ4A 3ESRA 2ECOA 1CJSA 4MA4A 1YQQA 3AR4A 3ZTWA 3MT8A 4BJ3A 1SUPA 2AOUB 4N47A 3SJ7A 4LDPA 1EFCA 1DQZA 2AW5A 1COWA 1SIWA 2OQRA 3HKCB 1D0SA 4HMOA 4H16A 5FQOA 1M2VB 4Q15A 2MSCB 1F2DA 3QTLA 4G5RA 3RRFA 2AN1A 3AHJA 4Z3DA 4XONA 1IM5A 2NPOA 3MJRA 2IVFA 4PX5A 5TQ2A 1JZTA 4FUTA 3UTDA 2ZJ7A 3FOZA 2OWEA 1YZTA 4K2HA 1TM7E 4QSHA 3O5AA 5DX0A 5B1YA 1JDTA 5BWCA 4GVXA 2G0TA 2R48A 1W4LA 4KQWA 2EDAA 4YY3B 2ZIUB 2OY0A 3I52A 4GZLA 5ALWA 1SD5A 2PTHA 1DKOA 5EPOA 4KXVA 4NI5A 4X8OA 2JC3A 2G0AA 4BN0A 4C2AA 5DWVA 5LZ8A 4JS0A 3SY8A 1AZTA 1QQ6A 1WCIA 3TFWA 5L4NA 2D54A 2W93A 3GLUA 3T7KA 3DYIA 3PUXA 4R41A 5HEKA 2XJ9A 2DQ4A 3H04A 2XW6A 5C8VA 5J4YA 2O3SA 3DBLA 2VATA 3F0TA 4NJMB 2IBSA 1BS1A 3DUWA 4C76A 5F73A 5I9BA 2J59A 1QK3A 2O2HA 4EUKA 2W42A 2J9YB 3G88A 1JLSA 4J1SA 1XMJA 4NICA 4EGFA 3H5VA 2FF5A 5BR4A 1FVFA 2G0NA 2DQZA 3PGA1 1QS0B 3R3UA 2PL1A 4ROSA 3SDZA 3TIGA 3VUEA 5HX7A 2YC2C 5AIAA 5B2FA 1EK6A 1SBZA 1EBBA 3QG5A 2CHFA 3RBZA 4DIBA 2QRJA 3PEVA 4Z49A 2HSDA 4UCWA 5EVCA 3H9BA 1IXZA 3B6EA 2XUPA 3MT9A 5D86A 2Y27A 4C14A 4EJ0A 3ZBUA 1U2PA 5ESXA 3ZW9A 2BIFA 2EKPA 2ONCA 3TTXA 4PX9A 3H3XA 4MS4B 3VQTA 4F5YA 1NG9A 1GQSA 2QVLA 3VVCA 2YJ4A 4M8IA 3NTRA 1YQWA 3ENNA 2PSEA 3NANA 1Q1AA 2BFBA 4GPIB 2Y67A 1K2WA 2C4KA 1MBZA 1FFGA 2GAJA 4PGGA 2ZSBA 1EXNA 1ZL2A 4JXKA 4JP5A 1A9ZA 1QC5B 1BU8A 4ZI7A 1OXTA 2V7PA 4Q18A 3VAAA 5LMCA 1CEEA 3D7RA 3U13A 1LSJA 3PF8A 2OV8A 4CMEA 2FMIA 4D82A 3A4NA 4U2DA 2OK7A 1K8AD 1YKGA 3OA0A 4FPXA 5BV7A 3DWGA 2GEBA 1FFXA 5ERYA 2PSDA 3E5NA 1CQIA 2OSBA 2V7UA 2CNOA 5FX2A 2VAXA 2GKOA 1L7PA 5H70A 4GMXA 4KLZA 4AO6A 5M2QA 1ORVA 3VZPA 3QXXA 3LSYA 4Z4QA 4C6HA 5L7WA 3TM5A 5FTNA 4G2NA 4EW2A 3CM0A 2D9RA 2JASA 5HFAA 2BDEA 3NRJA 1X39A 3F74A 1L7EA 3KUXA 1PNQA 3DTVA 1YK1A 4OP3A 1P1FA 5FBRB 1CUGA 1JIUA 1DE0A 5TJ9A 5GADl 4OXKA 1MB2A 4KQ2A 1KTVA 1A2BA 1Z0UA 2Z6UA 5F1OA 1PUJA 5KKCA 3RC7A 3HZHA 1F0PA 3MTBA 1TCUA 3ZWCA 2R9VA 3HACA 2BR3A 5TF4A 2W70A 3U3ZA 3KV3O 4F2WA 2QPLA 5HZGA 3B78A 3PGXA 4HQNA 4OAQA 2BR4A 4Z51A 1JP7A 5K0TA 4FINA 1KIMA 2I22A 4YRJA 1JDBB 2ZRCA 5I4KA 1T5LA 2WINI 3ASZA 1TA0A 1QIJA 4K6FA 3E84A 3G2LA 1H4SA 4J3JA 2EX1A 1ZMRA 3O9MA 2NO5A 3PNMA 3COPA 2ZL6A 4XR4A 4BLVA 3SJAA 1RS0A 3UJDA 5JS7A 4D9JA 3RVOA 1CR6A 3BRWA 3RYTC 4I99A 1A4IA 3UAYA 1WR8A 1C7QA 1Y48E 2RHHA 2ZT6A 2XNSA 3EIWA 1PTJA 4G0QA 2C3PA 2NOAA 1LQUA 3FFWA 4E30A 4D56A 3V1UA 6LDHA 5IJ9B 2R3SA 4X7FA 3K9HA 2H9AA 4C89A 4MJXA 3V32A 5SZJA 2OG2A 4I5IA 2JBAB 4DZRA 3W9YA 2PUGA 3W8RA 1E7YA 2XEXA 1UDRA 2XMSA 3JRNA 1I2AA 2LXNA 3MAGA 3QKIA 3ZLUA 3EZ6A 4O33A 1TL7C 3JQBC 3U7GA 2NV2B 4KDCA 1J9EA 4PG5A 1GSAA 4UTOA 2DJ5A 3ELWA 4G37A 1ZWKA 1LBEA 2A0KA 2H4YA 3CZMA 5B3KA 4E1BA 3LXUX 1JQEA 2WB2A 2H3EA 2I6QA 4L3VA 1Y6QA 4IDHA 5DI3A 4OOVA 2ZIFA 4QLBA 1G7CA 2PQ6A 3UJCA 1NV8A 4Z9BA 4DLXA 2ZDQA 1AMUA 2AYYA 4HRYA 4PQGA 1KFEB 3BB3A 3E58A 4FILA 5A5DA 4LHXA 5BT8A 5CXQA 4ZAFA 3OWOA 1QRAA 2PS0A 1N1MA 3L46A 2RHGB 4M60A 4Q3CA 3FKSA 1QORA 4MWDA 3IO5A 3RBAA 1KWGA 1AN0A 3UK6A 3IAHA 1Q15A 4RFLA 1O94A 2MTBA 3RFTA 4BV2A 4FOPA 2GJKA 3TRFA 3BXEA 1NL3A 4C5CA 1V7CA 2OZKA 4JT4A 1P2UA 3DDYA 4NZOA 4ZMBA 5TGTA 4X60A 5A9RA 3IESA 3CPSA 3WAJA 1E2HA 1IHPA 2IE0A 2AZXA 4LQ4A 4BNMA 3EY4A 1P3JA 3F49S 4IHKA 4RAQA 4ZVMA 3WHPA 5LJLA 1JFFB 4MPRA 2HU7A 2ZS9A 3VZDA 1YITB 4B8WA 4D9CA 4MVJP 2KYRA 3KHTA 2B8TA 2N0SA 5F12A 2HLHA 4G5HA 4R16A 5IYQA 2BJVA 2XNKA 2X1MA 1ZJWA 5DPMA 4KYTA 3PNSA 1OU0A 3A1PA 3BFVA 3N6XA 1DXQA 4H1TA 2IV3A 2FUKA 1MO2A 1Z5UA 2HIHA 3RUFA 3HB0A 4CKEB 1DL5A 4JYPA 4ZVQA 4PGOA 2VF8A 1GL9B 5B4UA 5IYZF 1CC1S 3Q3HA 2X6YA 4OBXA 4B79A 5CCBA 2FPGB 4FNMA 1SIOA 3NXKA 5KTRA 2I33A 2BMFA 5BW6B 5C4IA 5FO0A 3HKDA 2HOQA 4IDAA 4HQRA 4RABA 2NZYA 3EFOA 1X8LA 1YI1A 3OIFA 4D0LB 1L4GA 1QO0A 4NVRA 1GPYA 2IWRA 1UP7A 4FCCA 4LOAA 4BE4A 1EHCA 4CF7A 4P93A 5DXJA 1DHRA 4GSLA 5LC1A 2ZM5A 4X1YB 3NBQA 1U28A 5JSHA 3IPXA 1D1QA 2B35A 2O8NA 3AX6A 4NH0A 1H8HD 1J7JA 3VR3A 1QZTA 3A32A 5EXSA 2ZWPA 3IR7A 5KSZA 3EMVA 5DEIA 1ZGCA 16PKA 3OTQA 2WKRA 1HE4A 3BKXA 4U7FA 1WZUA 2PUVA 4UMEA 4KBYA 1ZINA 5LM3A 1J2UA 2ZZQA 4YI3A 3KD2A 1GWNA 2JBHA 1YVRA 4ZO6A 2DE0X 5H1YA 4HWPA 1AG9A 2FW7A 1T4GA 5EC8A 1LNQA 3E1YE 2JNWA 3BMCA 4HGRA 5EUMA 5TSDA 4FN5A 3MCUA 3RWMB 3ZHZA 5JCOC 1GPH1 2WF8A 3A6DA 1SCDA 2IYPA 5LA6B 3CPEA 5F2EA 5JC8A 3T34A 2IW1A 3BXHA 1VQ5B 4G0VA 1UZNA 4HDSA 5J3JA 2HFJA 3AIKA 2F7SA 1Z74A 2YFQA 5BSXA 4Z4UA 1L5OA 4PC2A 1V5EA 4RZIA 3R1IA 1WTCA 1NWCA 3EEQA 1QCYA 3ZN2A 1B2RA 2CLMB 1V96A 2ZIXB 3GAMA 4MS3B 4WX2B 1XMPA 1NJ8A 1P5ZB 5C2JB 4AUMA 2CZCA 4R2HA 3WL3A 5KJCA 4FZJA 721PA 3O3OB 1FFBA 1FU7A 2ADOA 1OHHA 5IW8A 1C1DB 3AKCA 3O9VA 2GXUA 1BHO1 2ZS8A 1NF3A 3I8SA 5AK6A 4D9HA 3VGJA 1B8UA 4ZEOA 3RG8A 1Q7RA 3RSQA 5E2IA 3AT1A 3EGXB 5HBGA 2CFOA 3TQCA 1ZR2A 2XZDA 3CINA 3ICOA 2P6PA 2C7GA 3FUCA 1WY5A 1ZZGA 2A1UB 2QTVB 1U2GA 1YZGA 1REQA 3OJCA 3VI3B 2DFDA 3DE5X 4JY7A 1M1YA 4BNFA 5FOWA 4TWJA 2XCSB 1CIJA 1A4UA 1HGXA 1Y3CE 1W76A 1KK1A 2HPVA 2IHBA 1V5FA 3IBTA 4L6CA 4XA8A 4C7JA 1QZZA 5LMUB 1Z4OA 4X54A 1NB9A 1WWKA 1WW3A 1RWNA 2HM7A 4DIFA 2ZKIA 4L15A 2YVLA 4FHZA 4CODB 1DC3A 3SQDA 2R1VB 4AVYA 2VJJA 3RVLA 4ZYUA 3F5QA 3GQBA 1FYFA 1MG0A 2Q2NA 1RWPA 1ZRNA 3QVTA 3E9ZA 4XUDA 4IICA 1B00A 1BW9A 3GT0A 4U9IS 5FQNA 4MZDA 4O1MA 1M1NB 3E7WA 2L69A 5LD2B 2NUTA 1E2DA 1NIPA 1NUSA 2P7HA 3G0BA 1GLGA 3I32A 4JA0A 4YRNA 4YJGB 1GUBA 3B2EA 3AF5A 4ATNA 2VG8A 4V0KA 1YBMA 1YUBA 5JV5A 3VMMA 5CAEA 3CLTC 5B2EA 2AFRA 1AGXA 1YFZA 4OM8A 3T7DA 1RWWA 4EI8A 2QPOA 1IL0A 4K9OA 3QLVC 5KTPA 2VBUA 4I55B 3V1KA 2OK8A 2APJA 2CUTA 2NNLD 3AI1A 1FMLA 2J9RA 2DLCX 1TECE 2OCBA 3AG6A 3GLHE 1PEAA 2X9GA 3RBXA 1GRNA 1GUYA 2GXQA 4PFSA 2HCFA 2QRPA 1P4RA 3K15A 5CCDA 2CXSA 1V1RA 4MQEA 1AUQA 5FKJA 3IDZA 3W06A 1H85A 2ZSAA 1RQRA 2CNWD 3M6MD 2BDUA 3T5CA 3TDMA 2EBFX 3ZQKA 5BSYA 3V6MA 1N0IA 3NUQA 3IS3A 3QE3A 4OMFG 4B82A 2R2AA 1LLCA 4M9SA 1U1EA 4AF8A 1MHTA 1PTKA 3D6JA 4K9QA 2HJSA 2PZLA 3WLKX 4IY1A 3R3WA 2ZW9A 3F46A 1KPHA 2KI5A 5G0SA 4LF9B 2TS1A 3AVXA 4ZCQA 1SN7A 2CYAA 2XXBA 2FPPB 4OBBA 2R00C 4KYVA 4FC6A 1PJ5A 4OXYA 4R9RA 4G1MB 4RC9A 3HHEA 4QRDA 3C5VA 1FBTA 3FYTA 3R41A 4UBNA 4K6CA 2HN9A 2NVBA 4KOEC 5H80A 2GJSA 3FN4A 3M1LA 4IXMA 5FORA 4D3FA 1T6BY 2B3TA 3MTGA 2YZ7A 4I5DA 3RSLA 1JF8A 3OJXA 4JWTA 4MINA 1CUZA 1Q7CA 4KKSA 1UD5A 1JJ7A 2IYFA 3SOZA 3C3YA 3U6BA 2HF7A 3DE1X 3QHQA 4KN8A 3PDCA 1KSJA 2HWYA 2RB5A 3L49A 2B99A 1G20A 3K30A 5CJPA 3RUCA 1GEGA 3HNRA 4GU5A 3K5HA 1RAHA 1RAIA 4CPDA 1CE8A 2BMVA 2C5FA 4HAZA 4RY9A 4JLJA 3TLYA 2B4RO 1EDBA 2J6HA 3ZWNA 5L6LB 5D84A 4A10A 4XWOA 1A7JA 4LK3A 5T41A 3PDJA 1CZNA 1IK6A 4GRIA 2QMYA 2ZYRA 2YWEA 1IWBB 2F48A 3PR3A 1UJNA 2C9MA 3OZCA 5JBIA 3R74A 4P3YA 1OX4A 1IXYA 5CT6A 4Q9LA 3AR3A 3STXA 1SVKA 2JGJA 1V6CA 1AKYA 3NZEA 5AOCA 1N34B 2PH1A 1C4KA 4H7EA 1GQOA 1QYRA 3I0MA 1WQ1R 3UCEA 3NGXA 1QZUA 2P41A 3EH2A 3F78A 2UZIR 4AS1A 2G9NA 3WWOA 4CR6A 3KVYA 1LDYA 4OJQA 5KYGA 2ZTHA 1UXHA 1FUYB 2UZ0A 5AXAA 3OQJA 4E7PA 5DO9A 3I5UA 2RE8A 4I7EA 3U7IA 3H5LA 2QE7A 1PX0A 4DFDA 4EZIA 1TMYA 3O92A 2WWWA 1CEYA 3KTOA 1ZMBA 4JB0A 1EUQA 2ZL7A 1T9ZA 1CERA 1N0HA 4XB1A 1KEEB 1N2IA 1E9DA 2XNDD 4GMDA 2YYSA 4RZSA 3WV4A 5BV2P 1KP3A 2WU4A 1I2ZA 1MAVA 2PGOA 3BD6A 4JDUA 4OKNA 3D5QA 1CYEA 3DE7X 4G0OA 4RXTA 4B0OA 4NV3A 1W9HA 3K4PA 4LI3X 3WBKA 1OIXA 1BCRB 2GESA 2IZ0A 5LXTA 1R37A 5CX1A 3COYA 4O1IA 5EIFA 3EXFA 1Q44A 2C2YA 3KKQA 2WWRA 2ZQYA 3ZOZA 4C0JA 2IXFA 3BORA 1N2SA 1ZZEA 3AHIA 3FSJX 4NBUA 1VQPB 1XO1A 1ETHA 2FR0A 2FK7A 4ZTBA 2LZJA 1QIDA 3RS2A 3Q7IA 4DGQA 1XZAA 1GTRA 4WK6A 2XXJA 5GONF 3L9XA 2Q2QA 2NMVA 3PQ3A 4LWZA 2ODPA 1X42A 5A1TA 1M7BA 3NPMA 1KAQA 2C83A 4ZDKA 2DCMA 3IBSA 4B2LA 3RYCB 1GO2A 2DEUA 4DJDC 3SYLA 3CRQA 3MINB 1N9GB 1ICEA 3GFGA 4LJ8A 4BZXA 1LDEA 2UUAB 3OMLA 5E9AA 3GLKA 3G2QA 3KJEA 4Q3DA 4YMHA 4IIDA 2XZOA 2A78A 3RG2A 3CEJA 1VPTA 3O90A 3PUYA 1DKLA 2CEAA 3JATB 4GXRA 4C03A 5CFLA 2EZ8A 2FZ4A 3LYLA 3ZD9A 4IJVA 2FG7C 3W1WA 4AIIA 3G2MA 3RF7A 3UKDA 1W5TA 1J2YA 1ZKDA 5EWLB 4GOOD 3U4HA 1KVQA 1L2TA 1R9NA 1ZXBA 5CVTA 1CZKA 3ASSA 1V9SA 2X7JA 1PG5A 4GKAA 1C0KA 5JO9A 2AI2A 4KLAA 3PUHA 3VH1A 2PMBA 1PYGA 5KOIA 1LLFA 1WU8A 2QLLA 3L4BA 4P82A 2R6GA 1EX1A 3I5AA 5JAOA 4K0KB 5KNCA 1DMSA 3TVDA 4LC0A 4IEIA 1PKVA 3NUGA 4KSCA 3UMMA 3DHVA 4BWYA 4W7IA 2WFMA 4OVKA 1OH6A 3OFKA 4JP8A 1TT7A 4U6SA 4X8IA 4N3GA 1Q7GA 3SKXA 4F5WA 1GL3A 4F7WA 4X1IA 4LHZA 3PX2A 4B3TB 4TTIA 1FTQA 2AI1A 2AS0A 2JF0A 1GYPA 4QFDA 3RO7A 3F73A 1KXJA 2QRMA 2NVUB 4MEJA 3RADC 5CPFA 3Q7RA 2BFPA 1YZYA 1U9CA 2NXEA 1ADBA 1K08A 3BG5A 3LLSA 4CGYA 3LCVB 1QKIA 2E5FA 4AY6A 1QRTA 4ILKA 2PNFA 5DGCA 2R6DA 2OILA 3NHRA 5FR2A 3LCCA 1O7JA 5TQ0A 4AYWA 2I5PO 4E2FA 4X5OA 5BN5B 2EKLA 1FYWA 4QDZA 4Z9AA 3NQ41 1T3TA 3DLIA 3SYMA 1T34A 2H1HA 2OT3B 4N7BA 2QM8A 2Z1DA 3FMIA 4IKEA 3T35A 2BFOA 2C20A 2IYOA 1MG5A 3Q87B 1DFGA 1HDGO 3KVRA 4P2GA 2W22A 4PAQA 1NW8A 4LE2A 4GBGA 1YZFA 3VKVA 2Y0DA 4YHHB 1E5LA 1BE6A 1ZVKA 2C9DA 4JYMA 4NENB 3QG1A 4JBHA 3PGKA 4G6IA 5JROA 1XDSA 5EIXA 4GE3A 5A3JA 4DSUA 4O8ZA 5G0UA 1J1UA 5FWXB 2ZPAA 3PNYA 1P81A 2V0GA 5CW2A 2AUNA 4KPUB 1V16B 1HLDA 2BHLA 4F7DA 1OX6A 4KE6A 4WFJA 3T7JA 4BB9A 1SC4A 3EDOA 4HUTA 4XI9A 2XODA 4DWOA 3LI2A 1JR4A 4F60A 1U8XX 2ODTX 1B7GO 2HEIA 2P4SA 3ZIDA 4CQMD 2ECPA 1C81A 3H8VA 2WVJA 3KWMA 4GZ6A 3PHGA 2GPBA 2VSFA 3IL2A 1SOMA 1Y3HA 2CDCA 1OYOA 2FZEA 3NBKA 4HAOA 4HH3C 4O6VA 4YAJA 2GK4A 3WRXA 4AP6A 5T7BA 1OH7A 5B7PA 3L5OA 3OLWA 3UT5A 3OOYA 1XU7A 1ZG3A 2A33A 4HNAA 3X1DA 4QVJA 1V7ZA 3WE7A 3EE6A 3PCTA 2QP4A 1KIAA 4RSHA 1EJ6A 3OURA 5E6SA 4YJ2B 5B3JC 2G82A 5KTYA 1ZJJA 4B81A 2I1WA 4ZALA 1KK2A 2I4OA 2RGUA 4Z5XA 1SXGA 3BWDD 2QRNA 5EIWA 2ZSJA 3N2EA 2FZVA 2NZ8A 4J75A 4CM4A 2GZSA 2PWBA 4LGMA 1SG6A 3STUA 2JATA 3W7AA 4M21A 3WDMA 3VXKA 4ENRA 4YAUA 1HZZC 3DEIA 4FMCF 3U60B 4AG6A 4FMCB 4KXLA 1BROA 3HNOA 4PY2A 5HJ7A 2OYSA 3FCYA 1CT9A 4PTYA 4GX5A 1NP6A 4RZQA 4H18A 5LWQA 2X23A 1KYXA 5C3MA 2J6IA 3N2NA 1U3DA 3IO3A 1R6VA 3PVCA 4GWKA 4QQ8A 4F97A 4RQBA 4G4SO 2E4UA 4HH0A 2ODWA 1F7VA 2PHZA 4NMHA 2G80A 4Q1EA 1CK4A 4AMVA 1WE2A 1XP8A 2GPAA 3Q2OA 1BAPA 3R7SA 5K05A 3I9NA 4N18A 3ADCA 3P9IA 2R0QC 1VSQA 3DVRX 5JEDA 4EF6A 3OFJA 4KWHA 4M7RA 2JCBA 3AUFA 3SM9A 1JG3A 2K5UA 3R6KA 3VTFA 1XT6A 4ARCA 1HE5A 1L3IA 2G36A 1IYZA 1U99A 2YV2A 1MOZA 5B3LA 2DBVO 1XZPA 1XZMA 5JE8A 4G81A 4KG7A 4QVAA 2D3LA 1KQSB 2PUJA 1QAOA 3GEEA 2AVDA 1L4EA 5EWMA 5DLPA 2GUGA 3AM1A 2VJBA 3ESBA 5K3EA 3A2KA 2QJWA 3TLJA 3R4CA 4BMXA 2IUYA 1V0EA 2BSQA 4KWCA 1L8OA 5JS6A 1AOXA 1VI2A 4CLDA 3V33A 3RANA 2VHXA 4P3KA 5E1MA 4KV9A 3EPHA 1FCJA 2HA0A 3JQEA 2FZLA 2GTIA 3K8OE 4IFBA 4LCBA 4OI4A 4B3IA 1ZM2A 2WKWA 3AMVA 1EM8A 2JLQA 3Q2IA 4YK7A 4CF6A 1NRXA 3ILHA 4MWCA 5C1BA 5HJ5A 1DC6A 1Q1ZA 4Y1RB 2GN4A 1KRWA 1CUDA 3BH6A 4IAOA 2PRZA 2XR1A 4XEHA 1YX2A 2RB4A 3QI2A 1EDOA 3EVNA 1HE3A 4ND2A 1E1YA 2I87A 5KNDH 2FVGA 1TKAA 5HKLA 3GPLA 2BV3A 3EJWA 1H2EA 2QRUA 3GB9A 2J0EA 4ZYVA 1NOKA 2AD1A 2XF2A 3S40A 4P38A 5KWVA 3PVDA 1UBNA 2BRUA 2DOGA 4I1OA 1NGSA 2AN4A 3GLQA 4UKDA 2W11A 2KWIA 2GAIA 2RC5A 2YXDA 5GMOA 4PYIA 4DAOA 1WOPA 3V7AA 3OC6A 5L3QA 1Z2OX 4ZEWA 2H6EA 2NU6B 3EDYA 4F5DA 3UMGA 3FWKA 3AF1A 1YQ9A 1BWPA 4WZBA 1YDWA 1KSGA 3GJ5A 1HEIA 2FNAA 1VBFA 2WJ3A 2IY8A 4DG5A 4V2IA 1ZD3A 3INNA 3K0CC 2NM0A 4J6FA 3SBDA 2GOYA 4DT1A 3GP8A 1HX7A 2X22A 1JG7A 5LQAA 3LHIA 1O4WA 1W94A 1Z5GA 4I4TA 4IOJA 4IEEA 1IK4A 1V11B 5CURA 3WYBA 3EH1A 2D0IA 1NN5A 1UFKA 3C1OA 4RY0A 2ZZMA 5CA1B 1XZBA 2XY4A 1YV9A 4N39A 5LOVB 5K6TA 4MDHA 4EJSC 1C3LA 1DIBA 4L51A 1E7QA 2C3MA 2IXTA 2WK1A 2YUIA 3JYQA 1NE2A 2FFAA 1U9YA 3KR2A 3IOYA 1GTSA 2K7FA 1I01A 1TUBA 4HFMA 4CKXA 4MYTA 3K73O 1DUIA 1QJCA 1YZQA 2PJZA 4X7CA 1N6IA 1BFUA 1JNXX 3D7MA 1CDOA 1HDYA 1O1YA 1ZL0A 3C8UA 3NHUA 3PHLA 5EE9A 1NUHA 3N28A 2JGRA 5TGDA 3RI3A 1VQ6B 4J29A 2WBLC 4TTRA 5L4SA 2Q9UA 5G4KB 1DP4A 4XN3A 4Y0VA 1C7FA 5I9MA 1YE8A 2ATEA 2JARA 1RYEA 3H2SA 4ZAGA 3EXEB 5FI0B 2GILA 5AI8A 5KEIA 4BN5A 5FA8A 5B5SA 3O8OA 2B69A 2IL1A 3SE7A 4E14A 1U0RA 1J0CA 4UE3S 3TEJA 4C2TA 4X07A 1PG2A 2QA5A 2VSQA 4G0WA 4YX9A 2CNLA 1X92A 2YTZA 1FJXA 1RWMA 3DQZA 5BQPA 2P6UA 3RFFA 1B26A 3PFBA 2DY1A 4EH1A 1ENPA 4KOAA 5E7QA 4Z7QB 3BBLA 8ADHA 1S1CA 3AHFA 1J22A 2WZNA 3RABA 3L1KA 1TM5E 2XGMA 3NBUA 3T9FA 4ZYWA 5JWOA 2QAGB 4D4KA 3LA8A 5LQMA 2AYZA 3FOBA 4R2IA 4ARZB 2QYTA 4AYXA 4D80A 2QNIA 3QYFA 3WKCA 1OXVA 3FPGA 3H42B 3BIWA 2VDQB 3HKEB 1M72A 1B16A 1YZLA 1OWMA 1YHQB 2IFTA 4NESA 1HTBA 3FCSB 3IBCA 1WY7A 2VP3A 1LDBA 4DZTA 1Z17A 3PX3A 4AAYA 5D5QA 4UUOA 1HSZA 3KNZA 3SIPA 3ZX5A 3A1TA 4GH5A 3DFMA 2PKEA 5CA0F 3TPFA 3RJTA 1LY1A 1VQOB 1VQ9B 1OFIA 2JKYA 2YIVX 3AIOA 3KEOA 4W5JA 2ZTMA 3AKEA 4KACA 3WQBA 2AR0A 3IDOA 3QPUA 4B3MB 2NTVA 5T6MA 3TSOA 1R50A 3LQ4A 5K3OA 4BBPA 5GM1A 3IXLA 4B32A 2YZKA 3ZHTA 4LC1A 5H02A 2Q50A 1ODTC 2GARA 4OFZA 4RESA 4BKPA 1ILEA 4YPVA 3PD1A 4NLLA 4J0HA 4KQ9A 3SYKA 1X13A 1JKXA 3S7ZA 4EMTA 3FZYA 3DW1X 1S2IA 1E9VA 3EVTA 2IBMA 2F64A 2PTGA 2W8BB 3FGNA 4LYGA 2OGZA 5A02A 3HB7A 3FY4A 3EDRA 3GLHB 1QSGA 4TV9F 1GQRA 1Z6XA 3D0QA 1S4QA 3LLVA 2PT6A 2PMFA 2J5QA 3LO5A 4CMGA 5K4AA 2NGRA 3D9QX 3QYAA 2FZGA 1QG4A 1Z2CA 2XMZA 3HCFA 3BGDA 3JVVA 4NBKA 3TMYA 4U7WA 1LW7A 2RK6A 2FCRA 5DHSA 3OM8A 1JECA 2Q4BA 3BD8A 3MJDA 4KP7A 3RRNA 4CIXA 2H57A 1WP9A 3T3IA 2RDMA 3A1EA 3VPAA 1ISHA 3P2MA 4EFNA 3KYCA 3AONB 4O1HA 1DO0A 3GEIA 2FPLA 1UJMA 4TTAA 1T1EA 1CLUA 3W6ZA 2HY7A 3FMOB 1Y7HA 2FMKA 1JJIA 2HJRA 1BHJA 3UWMA 1P3DA 3LP8A 3ZIAD 5E6RB 4G1VA 1G21E 3I5YA 1WZEA 5ECDA 4L85A 2WSIA 3CSUA 4R0VA 1Y3AA 2QT9A 1SY7A 2B7CA 1XDDA 2RJOA 3C7AA 3AP2A 3DWEX 4GBJA 1KZGB 4I1IA 4FDTA 3ZZTA 5EINA 2CXQA 4I08A 3EA5A 2LNDA 3QRWA 4LHYA 2R7LA 3QW2A 2DETA 1P2VA 1PYDA 1ZY2A 2BGRA 3LD9A 5LMNB 3UCFA 2QORA 4C6TB 1QH8B 3WY9A 1FLVA 1VGVA 2O2GA 1J2TA 5LQKA 5EKTA 3H2GA 5FT9A 4EHAA 2DBRA 2Q5FA 3TGWA 1P4JA 2Z1NA 4IR7A 4DV1B 2VFAA 1D03A 4O2BA 5HK8A 1C1HA 1JMYA 3M89A 1VRCA 5B1EA 4NU5A 3LGXA 1ESMA 1GNPA 3F6BX 3LK7A 4CCAA 4D81A 3OTOB 2MYTA 4EKYA 1LWOA 3PQDA 4YEJA 4IO1A 2AOUA 1G5PA 1RI4A 2ACEA 2W4QA 3B6JA 3K31A 4BWVA 4EG8A 2G08A 2CV0A 1DRKA 2W9XA 5C8YF 3NM6B 4P7JA 2M6LA 4WUVA 4S2UA 4H08A 4CUJA 1UBOS 2DR0A 2Q9AA 3E3AA 1NBWB 2ZSHA 1OVGA 1IUPA 1IRXA 2ZGVA 5D6NA 1Y42X 3M5WA 2X4DA 3KL9A 1XROA 3QWHA 3SI7A 1MEOA 2C42A 2JW5A 2ZIGA 2O1EA 3DBOB 4MDFA 1UZLA 3EAGA 2EGGA 4D46A 2W2LA 4C4TA 3UICA 4DGSA 2G6TA 4KU4A 3FWYA 4IV0A 3WB1A 3QXCA 4YWJA 3WSWA 3EXAA 3RYHB 3WQQA 4F45A 2JLSA 1U8ZA 4HDRB 5D1HA 3UH1A 3CT6A 2JGNA 4JJ4A 2WTXA 5A3RA 4L95C 4LF5B 1H2YA 1R5NA 2I34A 4ZIRB 2F1MA 1W6UA 3JS5A 4I2VA 3C3DA 4KXUA 4F86A 2PWAA 5G41A 4NJMA 4F5ZA 1RBYA 3J7TA 3HJRA 2O2ZA 4GM4A 4EAQA 5JO0A 2QMZA 2IZ5A 2YZMA 1T4MA 4ZQHA 3RH0A 3OT1B 1DQPA 1X7WA 3ZDEA 1QS0A 1XX6A 1TYEB 1W93A 3LV8A 3OX2A 3FXAA 3GAFA 4LZWA 1KWKA 2WUDA 4EMUA 5CP8A 2HF2A 4R3WA 5L6MB 1EX9A 4IIBA 3PJFA 1PGJA 1E2QA 3DMHA 4K3VA 2XYVA 3R75A 4H6WA 4ZVSA 3HXOA 2PU5A 4HHEA 2YKGA 2R97A 1OAOA 3FPLA 4HN4B 5KTMA 4E09A 3BTVA 4P4SB 1LRKA 1TCVA 2W90A 4BKMA 1CY2A 5L7TA 4BNXA 2PT7A 4M0LA 4XWKA 2B4KA 4I1YA 2JPDA 4CLXA 5TEVA 3FPFA 2C92A 2GLUA 2CMHA 5IDVA 3ZTTA 1I1QB 4KHPB 1I2MA 3GIWA 2PQ2A 1KZ4A 1WD5A 4YBZA 1P2TA 1XAGA 3FYUA 3N5CA 1QC5A 5C3UA 4ZYYA 1FS4A 4JQYA 2ACWA 3TTSA 1QDLB 1U7DA 5IWAB 2JIOA 1BCSB 1HT0A 4X90A 3AEKB 2QX9A 2W00A 3UYLA 1SHJA 4FFVA 1JQ3A 3ZHYA 5AXBA 3K1AB 3WJ7A 5KQRA 4E6EA 3CGGA 3HVRA 4WGGA 1UJ2A 3ZLJA 2CFRA 3HXLA 5AI6A 4Z8YA 3SD7A 3MS4A 4PBRA 4RPJA 1PLLA 3O47A 4GGPA 2JFOA 1E1KA 3FHJA 4BGIA 4CG3A 4DMFA 1II9A 3NYRA 3UTCA 1Z33A 2YH2A 3O3CA 3PQEA 1C14A 1PR3A 1TTHA 2CFSA 4YPOA 5A7HA 3PJDA 5KC8A 2ZTGA 4UBJA 1E1QD 3IR6A 2G5PA 7YASA 3SWWA 5EXPA 1U3TA 2LWIA 3U4CA 1R0LA 1SBTA 4QXMA 4KI0A 1IM2A 2UXBB 1YF3A 4YCMA 3D0OA 3L82B 3O7MA 1X9IA 4F4IA 4YRGA 1RC8A 4ZKEA 3M1AA 4NZNA 5KQLA 2PRIA 1R7RA 2JH9A 4M1OA 5AJUA 4JJ7A 5IAGA 5TPZD 1FP1D 2AZ4A 2PXXA 3D6TB 1R4MB 1RZVA 1DARA 3R5FA 4WZ6A 5F33A 4EZBA 4KFCA 2BKXA 1YQDA 3ST7A 1P5HA 4NG5A 2NXNA 1MT0A 1AA9A 4UZSA 5F9MA 2HIGA 2ID4A 1O3YA 4HDCA 5FPYA 3RUPA 5AKGA 3WDSA 4DUYB 1N57A 4J1NA 1Q95A 3KB2A 1SBNE 4DR2B 3IDFA 4XOIA 2ASVA 3S2GA 1Q74A 1MOQA 1SUSA 1H4VB 4JGIA 1GCAA 3KWLA 3TTUA 4YFVA 2OXIA 3TNJA 2JBAA 4Y2VA 3ZLTA 3Q6QA 1U3GA 3PCXA 1OMOA 5LFAA 2DWQA 4PLHA 2VA8A 3WL7A 5J47A 3RUDA 3T1YB 3EVCA 5HWSA 4QYIB 5IP5A 2BCGY 1YC2A 3G1UA 3AIMA 1E18A 2YW2A 3H99A 1OC2A 2H2WA 4XKVA 3FPAA 1XZJA 4Q24A 4OA8A 5HGJA 2VUSA 1T8TA 4KR2A 3FCOA 4D8XA 2OAP1 2AYXA 1ABEA 2H08A 4CM9D 3CCVB 3Q3AA 3LX4A 3V1LA 1GPKA 1XXLA 3GGOA 5G1OA 5D3QA 4HTFA 2G9UA 1O95C 1WABA 3U9TA 2BKUA 2XB4A 4Q02A 1K66A 4QFCA 2EBUA 1Q77A 1IU9A 5M04A 4HJXA 5FV7A 3OHPA 4K3UA 4OO3A 2QZSA 3LW8A 4PICA 4LF4B 3WTCA 3A7DA 1RVDA 3CEMA 2V9CA 1KI1A 2GPNA 1WMFA 5FLYA 4TKLA 3TSYA 3EZ7A 1P7CA 1ONBA 1RRFA 3O8CA 4I4IA 3TZKA 3G0OA 4ZOLB 5CRIA 1VQNB 4FFMA 2RGBA 5IBQA 2VHTA 3NNDA 1ONSA 3NAGA 5LP6C 3KZMA 3PNPA 1K97A 4GP9A 1F1JA 2XGOA 5A88A 1NUTA 2X76A 3JQDA 3NT5A 3VOAA 2ZREA 4FLFA 4LX8A 3OPVA 4RZ3A 4LBWA 5ICMA 2VQ6A 1KZYC 1US8B 3CCRB 3UJ8A 4CKEA 4JROA 3M5PA 4H3VA 4C9BA 4DQDA 3P9XA 2CK3A 3CHYA 2YMLA 4MSUA 5JNLA 1U0HC 3E8XA 4FW8A 3V00A 2QRQA 3WIUA 5CXUA 3VC2A 3ZWBA 5FOQA 3QVWA 2AZDA 4WY5A 4HNQA 1ZUIA 3HCBA 3AGPA 3PL5A 2J9GA 3OT5A 4FZRA 1KJJA 4Y3UA 1SZDA 4L02A 1BJRE 1DT3A 3A28A 1UDCA 4NE7A 2D7DA 1GPAA 5LYYA 5MN6A 4RPKA 3G7SA 4X1YA 3T7RA 4CFSA 5MHTA 3F6EX 4GLOA 4Z1MA 4F11A 4J2OA 2GEJA 4RVGA 1E3WB 2ZE5A 4F4DA 1ULTA 1VYTA 1ZSNA 2EFHB 2JGDB 4JBYA 4N12A 2GO1A 1VQ7B 3K4HA 2A88A 5CW1A 4E03A 4EHLA 1NW3A 4Q3BA 1QH0A 3PITA 4KAFA 2WZBA 1X0XA 1HQKA 3I01A 4KDEA 5BQOA 1Q50A 3SKYA 5TVKA 1SOWA 3V7YA 3OE7A 2XDQA 2O06A 1D2MA 4L0QA 2VDKB 2FVXA 4JHLA 2IDMA 5TT0A 3QP9A 1Z29A 5C34B 3WHLA 5TEWA 6PFKA 2XBLA 4MVXA 2H1VA 3A10A 2OGWA 1YE3A 1QMGA 3IQFA 3MLBA 2B25A 1LWNA 3GK3A 3BHIA 5C0OE 1MR3F 3KFVA 3OAAD 5LA6A 1NJ1A 2JJ8A 1R0WA 1ODLA 2SHKA 1R6XA 1QU3A 1YB5A 4IZIA 1U4SA 3VKWA 1AA6A 4A5OA 2BSAA 2PCJA 3T9EA 2AWOA 5ARCA 4N0EA 4PAOA 2NSDA 4K26A 3ROEA 1QONA 2ZIXA 3QYPA 1VIVA 3T5TA 4HVLA 2RAFA 5E1DA 1CY4A 2XITA 1EWRA 4DIEA 1NVVQ 4G0YA 2EARA 1MO4A 1EXMA 5BRAA 5JNUA 1DDGA 4I1PA 1T3HA 4HT3B 4DLTA 2WFLB 1DAPA 4XUGB 5KW9A 1UM9B 1R0RE 1GRVA 4OHCA 1IDN1 4CMEC 4YUAA 1JSRA 4QGSA 1JKIA 4PHFA 3W2IA 4LGYA 5DGDA 4JCCA 3WKAA 1DU4A 1Q7YD 1GJRA 3GFBA 4LC9A 2CYCA 3H4VA 1BQ4A 2QTVA 3D1LA 3RKUA 1VDZA 4JCOA 4TX1A 4E88A 1PJAA 3P9QA 3V4ZA 4HH1A 3GP5A 2HA6A 2CMGA 3HWX1 4FW9A 3FLAA 4J0EA 3V7WA 1BGWA 2E85A 3DLTA 3BWCA 4JLSA 1ULAA 1T26A 3CS3A 3IPYA 3O4RA 3W6OA 2NV4A 1EQUA 4MPPA 3N0RA 1XEAA 2XTJA 2XTAA 3T4PA 4R6WA 1X2EA 2R1VA 5AI0A 5FUBA 1VIAA 4AMUA 3V80A 5C1OA 2RH8A 4BQEA 1LXCA 3WNZA 3Q9NA 1U8EA 3I9OA 5IDWA 1RI3A 1UFOA 3COWA 3EWIA 1BDJA 1KETA 2QXUA 3M83A 4FSHA 1M1NA 1WMDA 2R11A 4FYMA 2EBWA 2EV9A 1MX3A 4EK9A 2DYIA 4DV4B 4A6PA 1U6JA 1KH2A 3IV6A 1X9HA 4YJGA 5TT1A 1XDZA 2RC6A 1ZK1A 2JFUA 1LDGA 2QRHA 3BOSA 3P19A 4FI3C 4WZZA 1E99A 3SQNA 5CDFA 5JS2A 3GUCA 4W5TA 2DULA 2I4TA 4Q4LA 2YVAA 1KYTA 4MHOA 4I55A 4XQFA 3FDXA 1CP2A 3H4IA 1PTJC 3LWDA 2F6RA 4WCFA 5HIMA 1OFVA 3EGWA 3PG5A 5ALEA 3ZCSA 2OCYC 4CIDA 4FQ5A 3EEOA 3L7MA 4P7KA 4RK0A 2Y6VA 3IKVA 1VHDA 5IYNA 1DTSA 1ST3A 2PR7A 3WK6A 3B1ZA 2O2IA 1BJKA 1XL0A 1OI7A 3N3AC 1K5PA 1YJAA 4K9KA 1TFRA 1U0NA 5J1TB 5AJXA 1BHSA 3ESDA 4JASB 4MVYA 1JE0A 5DMXA 1UPAA 3NATA 3WLEA 2A4MA 2IHTA 2AD5A 2ZRNA 4XARA 3M9LA 4GR4A 2VYQA 1U90A 5C32A 3FGPA 3WWYA 1FYVA 2HHJA 3IUNA 4AS2A 1JAHA 3U4DA 4JXXA 2FPPA 2XVXA 3PK0A 2OO3A 4YNBA 5HKAA 4OL0A 2FSUA 2V55B 1KQOA 1VMKA 2FSFA 3IT2A 4PIPA 1I4DD 2QTRA 2PM8A 3IDSA 3JD4A 3WYNA 4BVAA 4Q7LA 4UHKA 5HJEA 4D8UA 1MAAA 5DF1A 1KNXA 1H66A 1O94C 3C8MA 3DMYA 5FCDA 3BK7A 1YSCA 3UMRA 3NHSA 4J0QA 1TJ3A 1Y5IA 1TK3A 4HG2A 5ITZB 1GPMA 3ZWWA 6YASA 3T1HB 1FPQA 4GOKA 3MUFA 3N0XA 4HGPA 2D7CA 4KIJA 1YIOA 4L4RA 3ASUA 4DRXB 1P0PA 1UBCA 1UK7A 4D6XA 1U0FA 1RYFA 3IPRA 4RVHA 4OX9Y 4D0NA 2R62A 1YFLA 4QUIA 1YR1A 3ELYA 2FW8A 2AJDA 3COVA 2WE8A 1T9CA 3EQ6A 3NBXX 1T0UA 5AVQA 3EF1A 2Y93A 3EEYA 1JDUA 4AO7A 2P75A 2FMHA 4O4LB 1KP2A 2PX4A 4V24A 1P4AA 2NZUG 4K86A 3LXXA 4WADA 4ZARA 4CJXA 4QYTA 1MX9A 1V1MB 1EFRA 3BE4A 5BPHA 4G5XA 2G9QA 3VDNB 4Z0TA 1QRUA 1DCKA 3BGVA 3DBHB 4FK8A 1IULA 1DJPA 1JA1A 1Y81A 3G2NA 3CLUD 1BOFA 5L46A 4MLDA 4AUKA 1W59A 4TKZA 4OIFA 1UPCA 1IAQA 1UP6A 2IEIA 3Q15C 1AQYA 1W0JA 3R0XA 2V4UA 2ZU6A 4RZXA 4HDAA 1U28C 2BTOA 4Z4GA 3KS9A 4F9EA 3NEJA 1KEEA 1FTSA 4Z6KA 3H1EA 1H5QA 4YAWA 1JEQA 2HW8A 1VLJA 1L7DA 3K3PA 1FNCA 3V8EA 5ADHA 1VMDA 4TT3A 4ERXA 2LRHA 2HK7A 1FUKA 4RCZA 1QR6A 2ZIEA 1JKJB 1E2KA 4NCXA 3MPUA 3FVRA 1YRWA 1EUDA 3CU5A 4A6XA 5K8UA 3U44B 3QTTA 1MX1A 2KBEA 3LFTA 2A5YB 1G21B 1DC5A 2WU8A 4KBFA 1KI6B 3FKQA 4R9NA 1TO2E 1QG2A 1UBUS 5FI3A 4BX2A 4WIAA 4FGUA 3IBYA 4TSFD 5AW7A 5JNTA 1OA0A 5B30A 1YXMA 3VO1A 3A9SA 5AHWA 3G49A 3PRKE 2W6MA 5JADA 4JKOA 1WSDA 1HVXA 6ABPA 3DT8A 2ZPTX 5TQVA 5KVAA 5K20A 1RLOA 4Y1GA 2B30A 3CF2A 2WJJA 2GZHA 4NV1A 4TTTS 4LBZA 3EEIA 1LPSA 4TN1A 4U9HS 2IODA 4UTZA 4DLLA 1JLRA 4N5DA 4IZ6A 3X43A 4ZN6A 5HXAA 3MINA 1N9GA 4R8MA 3NAQA 1FXSA 4KRFA 3VR6A 1H2BA 1ANKA 3HJGA 2ZUVA 5B7QA 1G3IA 2GN9A 3ICVA 1OKKD 5K2OA 3HFJA 1AGYA 4EHIA 3QKWA 4E2WA 1A2OA 1K4YA 1N1GA 4CT4B 2ZJ2A 2W43A 4YN3A 5CB4B 1Z2EA 1RYNA 3R24A 3S55A 4QSMA 2J5KA 3O21A 2I7CA 3JATA 4LVOA 1BA2A 4NJEB 1LS1A 2BUCA 1WB9A 1HTWA 1T35A 1QP8A 1R6BX 4HYQA 4O2RA 3IMEA 3Q4GA 3GPCA 4XVCA 1XRNA 2GZ3A 4Q7JB 3EQ8A 5B3AA 4ZDJA 1XR3A 3LQRA 2G76A 4OPMA 3TRIA 1PZXA 1R27A 2O1XA 3CSDA 3JVDA 5HNKA 2P3SA 2XADA 1XZKA 1LPAB 3Q9UA 1H2FA 3HLKA 3LPAA 1WLYA 3JQ7B 5K0BA 4KRGA 4M0KA 3NFRA 3ZS8A 4B6RA 2QVGA 2Y6UA 3HTXA 4MQFB 1J97A 1Q7TA 1P2FA 5LDGA 4NHOA 1RXEA 1JSZA 3EOBI 1EG2A 4REMA 3OCYA 5LLSA 1GN9A 3JQAA 1A9TA 3KEQA 3Q0EA 1L4KA 1S6YA 1VB3A 2NVUA 1H0SA 2DBZA 3JXEA 3EVEA 3QGMA 4PSKA 4QDTA 1LB1B 1ZMOA 2DLNA 3N8NA 4QTZA 3NM4A 4XWGA 4UNSA 1DAOA 2PZAA 4HEA6 1FRFS 1D2GA 3G8BA 4XVHA 2OZLB 5T8KA 5C5IA 1VG9B 3Q9SA 4P3NA 3QWBA 4WCVA 1R88A 4BMOB 1NBMD 3I4LA 2P1DA 3KB8A 5IPFA 3WB9A 4K40A 3X1MA 1HI9A 4BUCA 3ONEA 1JFVA 3ZJVA 3K72B 2J0VA 3O03A 2DPHA 4HDQB 4M9ZA 4YP1A 1PNOA 3R7BA 3UAVA 4CI9A 4EX6A 1MDFA 4J94A 5IJZA 4MYUA 2VVTA 4P31A 2WG0A 3JQ6A 3CFYA 3KO8A 2ZUCA 3STHA 3ZK8A 4MI3A 5FUWA 1DG3A 3TMAA 3UPUA 3E0XA 2KSQA 3UQYS 4NENA 1NOJA 4PANA 1Z56C 4J7CA 4XSGA 5DCYA 1GR0A 5DOVA 4CXMA 2YWGA 1FSSA 4PPYA 4Q82A 4ANFA 3IVMA 4V0ME 4HFRA 3GDGA 1ND5A 1WUYA 4RA9B 2EJUA 3MUOA 4JUBA 1RRGA 4J76A 2AFIE 1V16A 4KPUA 4G0NA 1IY9A 3LQYA 4TM7A 4RK5A 2PLNA 3RUHA 2JZCA 4AY3A 2QVXX 2YRXA 4Y1EA 4RHYA 2V7XA 3S2SA 3NKVA 4M37A 3WJAA 2E49A 4L5CA 3HCNA 1Q0QA 2Y1GA 5K99A 2Q99A 3LWBA 2OTLB 3MWKA 3D4PA 3PQ6A 2YOFA 2D8MA 4LWOA 2WSMA 1IY0A 2OV4A 4JUIA 5AOAA 2RHWA 2OBSA 2KLBA 2B20A 3S8MA 1TYAE 1YS1X 1KVSA 3SBOA 2ICAA 3T54A 3IDAA 3PJRA 1WOOA 5HUHA 3KTFA 2QK4A 2PBRA 1GL6A 5GJWC 4DARA 1NJ2A 2CL5A 1BMDA 2XWPA 3DHEA 4IDCA 1Z25A 2YOHA 3FPKA 1SVNA 1RACA 2YWRA 3BZBA 3PDIB 2YIJA 3L6BA 3PNQA 4IFTA 4WOPA 4NMXB 2K7ZA 1YWGO 1V95A 3ULKA 4L8FA 4QGFA 1QVVA 4RGQA 2D3WA 2F9FA 2YS7A 3QFFA 4NY1A 4KVGA 3BXFA 1Z38A 3LKVA 3MXTA 4UHBA 3UW3A 4D4LA 2J85A 4S1NA 4RLZA 1Q1EA 3QXGA 3PUJA 3WGLA 4GI5A 2JKZA 1XRLA 4EG6A 5DM70 1QGZA 1ZUD1 3CC2B 3G2HA 4DLVA 4E12A 1DLJA 3A58B 5KIAA 1CQPA 2GT1A 2VPIA 2ATVA 3F71A 4R7TA 1XCBA 1U4NA 4L75A 2BP7B 5GP1A 1TTPB 4M9RA 3CTMA 4FDUA 3QKTA 4P3OA 3F7OA 4DM3A 2AEMA 4AQ7A 3L6EA 2VBSA 1IONA 3GIDA 3B5EA 4B4VA 2PD6A 3KOZA 1LVGA 1NLUA 5ICSA 4QDJA 1GCOA 2Q5IA 3NOQA 4H4DA 1X1RA 4L7QA 1AVTA 3UHFA 4HWRA 3BAZA 4TMVA 1KQFA 2X2EA 2GCNA 5EGNA 3RUIA 1Z6GA 5IU6A 3RVDA 1TVKA 4EA9A 1GG8A 1U7XA 3WAGA 1ESCA 3U19A 3VVMA 3EW9A 3KSBC 1RFLA 2Z1MA 2W5UA 3FDZA 1U1DA 1WCYA 4EA6A 1RQNA 1DEAA 2FYTA 4R54A 5EUCA 3VV3A 4L5IA 4Y1FA 1P6XA 3BFKA 4ZAYA 1J2JA 4FKBA 1NVEA 3HB9A 1UJ5A 3CBGA 2SKDA 2OM2A 1MABB 2V96A 1PWHA 2B8JA 4I5EA 3OIGA 4EA7A 1ADGA 4O4IF 3ACBA 4O4IB 3ZDQA 2UYHA 4D25A 1PD1A 5DCLA 2G4CA 4RDJA 2JB9A 1XNRB 4Z7NB 2Q6LA 2XQFA 4RXUA 3UUEA 4S3MA 2MU1A 4HXFB 1I7QB 3AXSA 4YFYA 2BM8A 5HIAA 3T3NA 2BGIA 2QTCA 3MEQA 3E03A 5P8WA 1XD2A 2P2LA 3DF7A 4BRZA 1YI2B 4HAVA 5EZQA 5IYRA 3UKOA 2WWIA 1PSDA 3DD1A 3AQIA 1N6PA 4O0LA 3GVHA 3IX7A 1OA1A 2ZZGA 1JAIA 1X38A 2QPTA 3KHSA 3C43A 4QBHA 3QUAA 1AS0A 2EW8A 3EG9B 3L2OB 4UUPA 2M9MA 2XMBA 3OX4A 2ILTA 5ER6A 1NW6A 1ZIYA 5E4FA 3K7EA 3O2NA 1XTUA 3C70A 1VE6A 3H1AA 4J0FA 4RW0A 1Z26A 2C9OA 4JB3A 3LGAA 4Y9UA 4MS1B 4TQUS 4AMZA 2PJDA 2GVNA 5DK4A 3DEHA 4HXEB 4YUYA 3GA5A 1EP9A 4I66A 3KLBA 4TLMB 1TF5A 1NIJA 4BQPA 5AUOB 4IJMA 4YYEA 4YWHA 4KMSA 1HNXB 2VK4A 3RUEA 3T3PB 3PQCA 1T1IA 1YRQA 1XA3A 1XZCA 2ORED 2VYVA 3IDQA 4AO8A 1S3FA 5I9IA 1Z8HA 4B9EA 1IOZA 2PUAA 2CNNA 3VNSA 3AP1A 1QP4A 2PVSA 4ER0A 9LDTA 4RTSA 1PKEA 4DBLC 3D2CA 1DCTA 2Q5QA 2HU2A 2RGXA 3HPRA 1VE3A 2XWQA 2YASA 3OJWA 1NNSA 3LQQA 4W9RA 3HBLA 4ZDIA 3QPCA 2I2DA 4Q4AB 5C46F 2YMPA 2VT7A 3ZQUA 2CBXA 3LK6A 1UKAA 3L4BC 2P30A 3IILA 4OYYA 2EOAA 2FFBA 1BN7A 4LYYA 4FE4A 2PKRA 3DDOA 2GM3A 1KI4A 2RHJA 3JZMA 3KAJA 4NQRA 4DCMA 3SX4A 4R9VA 1QNLA 1N25A 1XYYA 5H3CA 1RLJA 4ISBA 4N49A 1V11A 2JIPA 4HEQA 4OG2A 5CTAA 4X7BA 5H4HA 5CA1A 1V4NA 4H0CA 3ZQ6A 5LOVA 3OCUA 1JG1A 3TKLA 4DYHA 2HNKA 3BILA 3FIUA 2QGGA 5ALZA 1CF4A 1ID1A 1OW3B 1HDIA 2FPIB 1JQBA 3WYAA 2HBZA 2DWUA 2PZEA 2RJNA 3L1UA 3R4VA 1S96A 2NUAB 5A0TA 1E0JA 2G77B 4LV5B 1V8PA 3VPXA 1ZONA 3OUZA 4CLOA 4OLAA 3R7DA 2JAHA 1PJ3A 3R3VA 4EB3A 5G4KA 1X1SA 3SF0A 1J56A 1VJCA 4Z99A 3EIUA 2OFOA 5DW3A 3DM5A 1M5RA 1G0NA 4MKIA 5CCEA 4IILA 4XM3A 1TKRA 1WUJS 1FC0A 1YJQA 1C2YA 1XF1A 1YQTA 4PG6A 2QLTA 1CR4A 2I4IA 2X41A 4N5IX 1KAGA 2I6UA 3AVVA 1JH9A 1U1GA 2JN9A 1A5TA 2WJ6A 3CZAA 3I09A 3I9KA 3KDAA 1L4UA 5D85A 5KOJA 3WNQA 5JR3A 2O57A 5I9TA 5AR1A 1C2TA 2P6NA 3TG8A 2HHHB 1J90A 3W8EA 4OOSA 2OYCA 2JJ1D 2OPHA 5HTOA 1CJUC 2VWQA 2ZRAA 2QAGA 3A2LA 3I83A 1KO1A 2ZE7A 4JHXA 4BP1A 5KX5F 3TVTA 1Z73A 3LPMA 5SY4A 1A9XB 5BXYA 5DN6D 4CT5A 3N7UA 5GJVC 1PZFA 1SFRA 1VM6A 3LE8A 1YMUA 4GG1A 4X94A 1WUTA 2CFCA 2XVMA 2QL6A 4Y2JA 1D8TA 3CMAB 1M74A 3M3PA 3DFKA 3HKEA 5FEMA 3RVBA 3DAPA 3BGSA 1L7AA 3P27A 2G7ZA 3H5WA 3TPCA 3WRXC 1SRRA 3RK0A 4DS3A 3B9RA 3ZK9A 1XXHE 3ENQA 1RZRA 1P0FA 1A5ZA 4GBED 1M0WA 4PINA 4RTOA 1G9TA 2PZJA 4JVSB 2Q5OA 3O7WA 5BVGA 3A4VA 3GCWA 3ZH9B 3CY6A 1L7OA 2QRKA 1L9XA 1I1OA 3G1WA 2NSHA 2YZ2A 4E70A 3RRXA 3COSA 3LL4A 4DUZB 2IQ5A 2XRZA 5J35A 3KJXA 3OCZA 1JBQA 1XTBA 2QXYA 5ALJA 1RWVA 4ECAA 2PVPA 4ZO7A 1QYCA 4OMUA 3CUWA 3FSRA 3FPCA 1BXRB 2JCVA 2WKSA 3VC1A 3NBFA 1IBLB 3TMKA 2O5RA 2RHBA 4GVLA 4IXTA 4XDGA 5JSUA 1AQNA 3K1JA 1PR6A 1FQOA 2PIAA 2G5CA 4E5UA 4RVOA 5GOZA 2ATXA 2FU5C 2KQUA 3PP8A 2R1TA 4Y7CA 1JDNA 2W8BA 2HYIC 5BN3A 4NJOA 4BY9E 1YRAA 3WXBA 4RTJA 3RASA 3T9BA 1ID8A 2XVAA 3GT4A 5FOSA 1PQ4A 3OJOA 5EIHA 4P7FA 4RMIA 1GN8A 3FCXA 1Y5RA 3GHHA 1BO6A 1FMCA 1NXXA 2CBZA 1Z5VA 3PUZA 4MP8A 1FFAA 4QQFA 1A8UA 4KKXB 3WBJA 4WL0A 3FRIA 2QAJA 5IF3A 1SKYE 3BTSA 2C54A 5TDHA 3S2UA 3DZFA 1TYBE 1TZKA 3JVUA 3AETB 3VKFA 4C04A 1JZQA 5A4MS 3TJMA 4WDRA 5K0EA 1QQBA 1TQ2A 4AZ3B 3NBZC 1ZK3A 1O4VA 2NXWA 1YACA 1P8JA 2FDXA 2ORWA 3G5UA 1C4WA 4NXNB 1YDFA 3KQVA 3ICCA 2CGEA 2HCRA 2O9JA 3BB4A 4MW0A 3ZH2A 3S44A 4AS3A 2XUZA 2H4JA 2Q1UA 4I46A 1E2NA 4OSEA 4Q1FA 4CKBA 2I8AA 1NAHA 3DXZA 4D9FA 3VNQA 1WDMA 1I3MA 1XALA 5A3SA 5BRNA 2VRWA 2W6PA 3MUNA 1CZHA 5E6RA 4O4HF 4EFKA 4EO7A 5HK9A 2FRDA 3CLVA 5F78A 4PC3A 1UBRS 4DG8A 2ZJAA 4RKFA 3OU2A 1IMJA 3GV0A 3H3FA 4N41A 1VKZA 4UUNA 2I80A 4UW9A 1M2KA 1YL6A 1NUUA 3IUEA 2P9BA 1KZLA 4IOMA 4YAGA 4H7KA 4XE5A 5IXJA 2C1ZA 1ZHOA 1L4BA 3B89A 3C6KA 3DMPA 4C6TA 4RSRA 3BC1A 3GRPA 3WRYC 5JUWA 2VNIA 3KTAA 1KVRA 1QH9A 2PY6A 2QUKA 4QOFA 1X7ZB 4H4CA 1BDIA 3ZDCA 4ZV7A 2JA1A 2C3UA 1YVDA 2WV7A 5COAA 5F3DA 4X6LA 1V6SA 4WKGA 2H5JA 3K2IA 3AEQB 3TGPA 4E51A 2GK7A 121PA 1X7XB 3KQHA 2FWRA 1M2NA 4G4SP 1OLOA 2BRUC 4HWTA 2XCIA 4DCGA 1NYLA 4ZZIA 5GINE 1JSCA 4TL8A 1LF5A 1UMBB 1NPYA 1Z4JA 4N8SA 3A4IA 1I5OA 4RWEA 1TD1A 3CH4B 3H8SA 4KXXA 5F5XA 3H11A 3RT9A 4F3CA 3ZY4A 4PNEA 3JZDA 4HDKB 1A7KA 2FR8A 2B1IA 5CPBA 3HNPA 2V97A 4MUHA 4NEQA 4TTPA 3WNVA 1LI4A 4E21A 1XWIA 5LU9A 1PNRA 1U7OA 2Q2VA 3PLRA 5ED0A 2QWXA 3RYHA 5A4KA 2JH8A 4JK3A 2D4HA 4M1MA 4HDRA 2QRLA 1ZCAA 3SQMA 4D6PA 3RODA 1TAQA 1X1BA 1PJ7A 1WM1A 5MN5A 4ZIRA 1XTQA 1DO2A 1YVUA 2HRCA 5I47A 2RAUA 3GFPA 4L0MA 2I55A 2NT3A 1WOYA 3GDHA 2ODQA 1JQDA 5GGYA 4BEVA 3M1IA 5L4LA 2JAOA 4NZMA 1M8FA 2WWYA 1U3VA 2QZ4A 2VCHA 3C74A 3E1SA 4BC1A 3EOAI 4DQ0A 1CIPA 1VGRA 1QVGB 1F06A 3SSMA 3LU1A 3PA8A 3P45A 3AVYA 4E5DA 4IJKA 3VO9A 5JZBA 2Q3CA 4K9SA 3NEYA 1P45A 4LG1A 1ESEA 2PUTA 3BDIA 2GSDA 3TQQA 1L5VA 4DBZA 4ZEMA 1T1RA 2V5UA 3JARB 1Z6YA 1LSOA 3S5JA 3M8KA 5FNVF 2CLFB 4MVJH 5ENVA 3TRDA 5KREA 1YCFA 5BUZA 4GZMA 1ISJA 1UK8A 1Z0KA 1SIBE 4P4SA 4EWLA 1KSHA 2AQ8A 1DTWA 1FNSA 4ND5A 4W1QA 2QGZA 1E5VA 3ZCQA 2FZ5A 1SAYA 1SUWA 4HWGA 2X8KA 1F8FA 4KQ6A 4CZ2A 1GVNB 2OMEA 4LJ7A 3UAZA 1Y3FE 2XXAA 3RS7A 1X3LA 5FBKA 1CY6A 4EL5A 2JFGA 4YJ3B 4BVLA 3VDQA 4YUWA 1SXPA 1BCSA 1G5HA 3G9ZA 2QU8A 2VCYA 4XVQA 5EXDA 3TSWA 3TZHA 1Z5WA 4BP9A 1SU7A 1FW6A 4Q3LA 5FA6A 2BGUA 2VKTA 3F67A 4XIGS 1UUFA 1E3LA 3JW8A 4LZAA 1WORA 4PE5B 2CVZA 5COQA 3ERCA 2FG6C 5AKEA 4NK5A 2ZBEA 2UVQA 2C7VA 4ZI3A 3ML1A 4DR1B 4NKRA 1SUCA 2NAFA 4P53A 3WL5A 2FB9A 4KLNA 1ZGZA 4XL9A 1EIZA 3DSRA 4HGQA 4B75A 2QUIA 4UJ5A 5KMGB 4BO3A 4TTJA 9MHTA 1P4HA 2A5DA 2KX7A 1X86B 2VWPA 3QQPA 4IDEA 4Q34A 4TTSA 5LPNA 3KR1A 4ZYXA 5I7VA 4ZJUA 3DULA 1KKUA 4RF3A 1FTYA 4RV9A 5KYUB 4IDBA 3SC2B 3BD9A 3PUKA 4BMYA 4X92A 3HB4X 1TZ2A 3L8GA 2CWDA 3IQZA 1R4MA 4JOSA 3SXJA 2CL0X 4AN1A 1RI1A 3LCUA 1W35A 1R4ZA 2BFEB 1U04A 1GAJA 4QOIA 5EPEA 2OTJB 1XIVA 2LPMA 2NTJA 3PWSA 5ALNA 5DYGA 2JHFA 4Q7KA 4TTVA 5AJWA 3HR7A 2BMAA 1YR9A 3GBVA 3BMOB 1LD3A 1LPPA 1PR4A 2GEUA 1P7ZA 1BD4A 2BAGA 1P3Y1 2RGEA 1H94A 2ZYAA 4HWOA 4JLPA 4PCAA 1SD2A 3SMVA 4MVJG 2F1RA 4ETMA 1TEVA 3NHZA 1C3OA 1ESNA 1YNOA 3FCAA 3ZGLA 3GBPA 4IX9A 4INJA 4P9SA 2COKA 1SVIA 1PR5A 3GZ4A 2VYNA 4DA0A 1Y5MA 4FBLA 3WK4A 5DLEA 3W3AA 1Y6GA 4Q1BA 4FDMA 3RVKA 2AFIB 5L95A 4GPZA 3KFXA 3AB3A 1CUAA 4QYIA 1XTZA 4RPDA 4HEHA 4X3PA 4RIFA 4AXXA 1YCHA 3AUYA 3W7VA 5CNMA 4L73A 3OEED 5L9AA 4KUEA 3KXIA 4BQRA 4CIWA 1JYEA 4PXSA 3U7EB 3GJ7A 4FEYA 1CLEA 5CJ2A 2ZSIA 1ZCBA 3DL0A 4EG0A 2PU7A 1MA3A 1XHFA 4XYMA 5FPPA 5LR6A 4ZGNB 4LDQA 5K5EA 4LTDA 1T43A 1HO3A 1N5KA 3P4UA 2ZUBA 4MI6A 3P52A 3T1NA 3TUJC 3A8IA 3UWKA 5CEJA 3EC7A 1WD7A 3A4MA 4JBNA 1KE2A 4PGMA 3H9UA 3L7LA 1MB9A 2BEWB 4JLVA 4X6UA 5EJ2A 2BUBA 2HSEA 3WGOA 2WF7A 4HPXB 4EO9A 4BKQA 2ZAMA 4YRAA 4UHJA 3L77A 2Z5LA 1NXVA 2J6BA 4ZOLA 2GM9A 5KAPA 1EWQA 1OIVA 3SLNA 1QV7A 2LBPA 3GFOA 3U4QA 5K0JA 1JB1A 1QIKA 1O57A 5CGQB 4NAHA 1VE5A 4XB6B 4LYEA 5E8JA 4LRSB 2WYWA 1EGQA 4ALIA 4BKOA 2WYOA 1H1LB 4JVMA 2I1QA 4CHGA 1KZ1A 3V48A 2ZWOA 1JLKA 1R9JA 4B46A 3O8RA 4YXWA 1AHNA 1PR9A 1N78A 2QJOA 2WT9A 3HCWA 2JFWA 5JJ5A 2FRXA 3I64A 1CG6A 2DRIA 3QX9A 2ZXIA 1BVYF 3V9PA 3L4EA 3WQHA 1U5AA 3ABOB 4CT0A 4JBLA 4M89A 5PGMA 2Q0SA 4UPVA 4LJAA 2Q3HA 4K1LA 2A7XA 3K0HA 2JIDA 1HE8B 1B6SA 3IFSA 1DBRA 3IJEB 2A5LA 3D8TA 3QENA 3ZEAA 4NCHA 4PLTA 4QOEA 1TQDA 3QBEA 5DIZA 3SK0A 3X1ZA 3X1WA 1V9LA 2CLEB 4GKVA 2YCBA 3ZDRA 1B8PA 2V7BA 1UK6A 2G9VA 1CRQA 3QJ5A 1UBKS 4XW2A 3KQPA 4B3CA 5FNZA 2L0XA 4EY7A 1QQ5A 2NZXA 2Y1WA 1KMMA 5HZKA 1THGA 1E3WA 1PP4A 1EXWA 2ZUUA 4K6HA 1K5GA 1VXOA 1LC3A 2DUUA 1DMRA 1A8IA 4AZ0B 2CMFA 2AJCA 2GRUA 2DPMA 4R01A 5A04A 2L82A 3OLYA 3HI4A 4P25A 1U0LA 4LWPA 1SCUA 1CQJB 3B5IA 2DCUA 2NX2A 3JWEA 4LSGA 4Y0NA 2N1MA 2ZRIA 1OJ7A 3JQGB 4GXTA 4LHWA 4GAEA 2PUFA 1E3MA 5T4FA 1VP9A 5D00A 2IJGX 2X1LA 4PLGA 4RZ2A 3W05A 3NI2A 1AF4A 2IUFA 4EFDA 5COBA 1WLSA 2XGJA 2A0WA 3P0FA 1IN7A 3TOSA 3OF5A 2OCLA 3VPDA 5JQGA 5MN4A 3WYFA 3LHSA 1Z8DA 4KQXA 1K6EA 3HC7A 1TU3A 4NATA 4XYEA 1G5TA 3ROTA 5IZCC 1BX1A 4MW5A 3JR3A 1UP4A 3ZGZA 2WZQA 1LJUA 1OAOC 3BRQA 3FI9A 3FMFA 5DNEA 4D2IA 2QRVB 2H31A 4IRUB 3N3BC 5IKOA 1MQAA 3EGCA 4I19A 4K9MA 1UXJA 3K20A 1YULA 3T6KA 3K5PA 3R5XA 1B6TA 2HXGA 1N0VC 1PLKA 1QPBA 2ADFA 2C5BA 1EUCB 2G1UA 4V39A 3ANTA 3TBFA 3H1TA 3BY2A 1T3SA 2PX0A 3SGLA 1EE2A 3FYUC 2F1LA 3OQ6A 3IV9A 5JZSA 1B0AA 1U94A 1UDWA 4JLWA 4UPDA 1ZOSA 2VBGA 4LFAB 2QV0A 1QM5A 1ZGJA 3P0RA 3E9EA 4G6ZA 3W9UA 4RF5A 3IMKA 1JLLB 1Q6YA 4KE9A 4YUXA 4HEJA 3HRIA 1WIWA 3AUAA 5JS8A 2XBUA 1TOAA 5A62A 1O9GA 1GFWA 1RKBA 2BM9A 2JCGA 4YCJA 5H7XA 3STVA 3L8HA 3D8HA 2A30A 1A8PA 1JDPA 2DM6A 1U0GA 2B1QA 2EU8A 1AURA 3GEPA 1C50A 3HS3A 4LRYA 3ZWMA 3A7EA 4KRXA 2H1RA 1JR3E 3CWQA 2AC4A 3CEHA 2BE9A 3H9CA 4G86A 1YQUA 3Q3JB 1A5SB 4X3OA 1XDGA 3CISA 4E94A 4FU0A 1R9MA 1Y8QA 2O05A 4RK7A 5IVIA 3RJ9A 1DJNA 4TYWA 1N4AA 3TNDA 4RYLA 1MVOA 3AY0A 1T29A 2IYZA 2PUHA 3N8IA 3Q9LA 3FRJA 1B8VA 1D7AA 1CUCA 2IPXA 2J30A 3AKDA 1W9MA 1GGVA 4ZP1A 3QU9A 5C8DA 1FIUA 4OGGA 4PIMA 1R15A 3WV5A 3Q12A 2P6RA 2C8VA 4IDOA 4OB7A 4F8JA 1MW8X 1NR1A 4MK4A 3DH0A 2K87A 2WHRA 4CTKA 4LXQA 5A2QA 4S1TA 1M10A 2POQX 4PLVA 4S1PA 4OU4A 3PUMA 7MDHA 4X91A 3ZVLA 4PAAA 3QFTA 1Y9EA 4KQFA 4DLRA 1J09A 1CF9A 1LJLA 2JAXA 4Q4CA 5CLJA 3Q3CA 1KO4A 1QHYA 4MGHA 3IQDB 2CY0A 2GKSA 4EGCB 1OY1A 1SPBS 5JTTA 4NXMB 3N53A 3PSAA 4IKPA 1K27A 2K2WA 1SXJC 2DTDA 3G9QA 2PQ0A 4WKBA 3JWPA 4TGLA 2LVBA 3Q0TA 3KSDO 2N3ZA 2BKEA 4GI7A 4XKJA 2X0IA 5BNIA 5INTA 5JOQA 4J9VA 3RV3A 2MHCA 2BDTA 5EIOA 2HBYA 3Q3IA 5E1BA 3HCOA 4RHXA 4BTLA 4GQAA 4M76B 2WUEA 4WESB 4UTRA 3DOOA 2IPNA 3RTDA 2HV9A 3KKMA 3TECE 5K0ZA 5FWDA 2IXBA 2PLWA 3JSXA 5K3BA 5LZ7A 2JIZD 3ESCA 4G4JA 4HAXA 2YXEA 4PZ0A 5FBHA 1XXHB 4Y6OA 3B1JA 3RC1A 2Z57A 4EDHA 2HNAA 1WXGA 1CJKC 1IBCA 1SKAA 2A9VA 2JIQA 4ZOQI 5I01A 2MYNA 3HZRA 1WMAA 3PT9A 4W6ZA 4ZXPA 4LDRA 2V31A 1SPXA 3AOGA 4EKEA 2X53S 3A35A 2BGMA 3SG0A 4AVZA 4AY5A 5ITZA 1TLLA 5IJWA 4QT0A 2QD4A 2QYOA 1TJYA 1IN8A 5I5EA 3NDBB 4JN6B 1ST2A 4DRXA 5AVXA 3C7TA 3VAYA 3LLCA 1UEXC 4C20A 3JSAA 3W04A 4NYIR 4GOLD 4B43A 3AVOA 1D1SA 4GMHA 3I12A 2W6IA 1E0DA 2ERXA 1SXHA 3ESAA 4ZZ2A 2EERA 3PC4A 1VLOA 2E1PA 4INOA 5CT9A 4EVRA 5AKIA 2FY8A 1W36D 4LFBB 4O4LA 2O8CB 1XRRA 1ULBA 2JFHA 1ZEJA 3VR4A 3N2ZB 4GECA 2O2EA 1CF2O 3B1VA 3ADDA 4OQYA 3KQQA 3BF7A 2R86A 4B6FA 3N74A 2DMRA 1XRPA 1V1MA 1CETA 2ECQA 3DBHA 2JJQA 5ECGC 3UW1A 5MF6A 4P5PA 4UOEA 5KVVA 1SKYB 3HA5A 2VLBA 3PWKA 2H1WA 3RARA 2O19A 4RHCA 3JYLA 3ODPA 4BTVA 5SYMA 2ET6A 4RXMA 1J5EB 1LV7A 2Q1TA 3D6HA 3E27A 1FXWF 2Z4SA 4TXLA 3L02A 2GCEA 5JXHA 3IE1A 4F3RA 4R2WA 1ZM4A 1UK9A 2PUWA 1W96A 2W8ZA 4UU7A 4COOA 4EIWA 5B57C 4XGQA 3VO8A 1DAGA 4QTYA 4KJZA 1PFYA 5SV2A 1PEYA 3JWIA 3KOXA 5EY5B 1L1FA 3KWJA 4UVDA 2UYGA 4AJ9A 5G02A 3WYGA 2XWBF 2Z95A 2P9QA 3CR8A 5TMDA 3RK4A 1Z22A 2WNIA 3C3MA 1WTAA 3E7PA 3RS8A 3U44A 3AW8A 1D1PA 1QNFA 1T2FA 2VPYA 4LY9A 4NMMA 4PBSA 1SELA 5DDIP 3QE4A 3MA0A 3EMBA 1ZH4A 1D5WA 4BMVA 2ZI6A 4DLYA 2A5JA 3J81k 1X8JA 2C96A 2JI8A 3OPOA 3PCRB 5I7SA 1RKUA 5JZMA 1VZ2A 3LLUA 2F1IA 3MIZA 2GHTA 2YNMD 1N2OA 2X0EA 4MYDA 1PG0A 1KU0A 3CLKA 5JSFA 2QYSA 4CKCA 2M5SA 1UJCA 3NWEA 1N2CE 2AHRA 4ENQA 3A1NA 2RBGA 4FKMA 3CNQS 4MW4A 3QLTA 1O0CA 4U6QA 4BQIA 1UT5A 4H7PA 1JPNA 5H82A 4NBVA 4KHZA 3A9VA 4GYWA 4V38A 3TZ6A 1I33A 2Q6VA 1MFPA 3UB3A 4CIAA 4QUAA 2VSYA 1J99A 5F2NA 4EEKA 1WETA 2XECA 2C29D 3MCZA 3MOSA 2J5RA 4FFNA 5CLLA 5CB4A 1VSUA 3PI7A 2HK9A 4TZTA 1GRQA 1PZNA 1W49A 2VJCA 1AGPA 1DAIA 1VF7A 1EE1A 1KI7A 3EGEA 4PZDA 4DY4A 5AFSA 4TKVB 3DLCA 3DC7A 1CU1A 1GGJA 4L6IA 3OLQA 3AINA 3A3BA 2GGSA 4EARA 1MF7A 4RADA 1QUEA 4Y9RA 3QPDA 4JX8A 3LWZA 2VHCA 3VSDA 4A0GA 5CM8B 1HL7A 2Y05A 3ISVA 1DCMA 3D6UA 4LEIA 1W1IA 3V3KA 1VGQA 4BASA 4K03A 1RHMA 5CEEA 1QGYA 1E60A 2ZAYA 4Z4IA 2GN0A 2GYWA 2OORC 2W2OA 3INYA 3ON5A 3JQ7A 4RGVA 2GN2A 3USCS 5LKAA 1IC6A 1E2BA 3BCUA 5K8JB 5TPWB 1X7HA 2H52A 2HPHA 3AQ4A 5DYWA 4MQFA 2VEDA 1AHHA 1XMXA 3LY8A 4JIGA 4L2IB 3E9RA 1LUAA 2QBYB 3TSZA 2PEZA 4MUIA 3V1TC 5KDOA 1QHHA 2X15A 4Q9HA 4MUJA 4OK3A 2F9LA 5IASA 2C2KA 1SBQA 4R2JA 4PV7A 2R60A 2HWXA 3G9TA 3KZNA 4KCGA 1VYUA 4KNVA 1KAEA 2JEYA 2ZJ4A 1GU7A 3KTDA 3EHEA 2F1KA 1VFNA 3BSSA 2O8FA 1ELOA 3Q38A 1QTIA 3KOYA 1QE5A 1CJVC 1WW2A 4XJXA 1V25A 2A2ZA 2O1WA 4M8NE 4RQAA 1QBGA 1FNDA 4Q4JA 5HCNA 4BQFA 5EXTA 4D74A 1JEYB 3JWGA 1B76A 1XNGA 4YJHA 1G8MA 4D0SA 3VX3A 1CD5A 1CKEA 1X15A 3I6ZA 4WCFC 3UUWA 4Z7OB 4JYAB 2V0NA 2VHWA 3W90A 5K8IA 2V45A 4W99A 4FHGA 4C0QC 1E3IA 4O5AA 1LDMA 5JD3A 1LJ8A 3H05A 3WP1B 2XRMA 3RRBA 2FA9A 1TLFA 4O2AB 5J2TA 2GPYA 3HKBB 3HABA 3CC8A 2AE2A 1Q16A 3H3JA 2GJ4A 2Y3IA 3R2JA 1K7SN 1NOIA 3EB9A 4WNIA 5SY6A 4C43A 1GZHB 1SUFA 2GN1A 3W6UA 3BAFA 3WRVA 1K4MA 1J0BA 1ETUA 1T5BA 2OYNA 2YFHA 1D4ZA 5DN9A 1FMTA 2AMYA 2J4FA 3PFHA 4LVUA 4QU0A 2ZB4A 5CVDA 2X19A 1V7QA 2ANCA 3MWGA 3MWEB 1VL5A 1NRIA 3M4YA 4G1EB 4P81A