2C5BA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 2'deoxy-5'deoxy-fluoroadenosine.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Substrate Specificity in Enzymatic Fluorination. The Fluorinase from Streptomyces Cattleya Accepts 2'-Deoxyadenosine Substrates.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 70
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2c5bA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2c5bA01
2C2WA 2Q6IA 2Q6LA 2V7VA 2WR8A 5FIUA 2C4UA 2F4NA 2C4TA 2C5HA 5LMZA 2C5BA 5B6IA 2CW5A 2ZBVA 2V7UA 2V7XA 1WU8A 2V7WA 2CC2A 1RQPA 4CQJA 2Q6KA 2V7TA 2Q6OA 2CBXA 1RQRA 2ZBUA
chains in the Genus database with same CATH superfamily
5DBEX 3I6IA 3QNMA 4IIYA 2BTOA 1REQB 3DA8A 4N18A 1NVKA 1O57A 5AXAA 4DQLA 3OOEA 4QARA 3WGLA 5JXJA 4OQ4A 4I36A 2CJWA 3WKBA 4LY9A 4ZI2A 2GKSA 3F3YA 3P0EA 3U44B 1RYFA 3AYXB 4M9RA 1WVMA 3AUUA 1Z2NX 3CNEA 3PPXA 1QVGB 4QL3A 2QHXA 2IELA 4M83A 1RTTA 3VNRA 4WJKB 4MVCA 5FT9A 5KKAA 4PC7A 4ZCQA 1UK9A 1YRYE 3FUCA 1UZAA 3UHFA 2P9YA 4Q7EA 2BSXA 2V7QA 2QORA 1JU4A 2YJZA 3MQ4A 3SC2B 1GPKA 1ST3A 1BS1A 1Y1QA 4HVCA 1YITB 5TIIA 3QHAA 1X80A 4PONA 3JASB 2N9UA 1QOQB 2B21A 1DGQA 3IQFA 1L1QA 2CFCA 2ERYA 3M4JA 4BYMA 1GFIA 4KYVA 1BOOA 1M8KA 4C0SA 1IL0A 1BJTA 3CMAB 2PXHA 3PFHA 2B4YA 4RM2A 3OIFA 3KV3O 1BXRA 3UXMA 4D1YA 3WHIA 3CEHA 2XDQB 1KFCB 3A1CA 3NEPX 1SXIA 4MRRA 4PLTA 2EW2A 3JQ8A 4JEUA 4K9KA 5FXMA 5C37A 5M5BA 4NOJA 3B2NA 4AS2A 1CY4A 1DQSA 3QK7A 1YA8A 3GZ4A 1W9MA 1AD2A 1MBZA 1XTVA 2JFGA 1S7GA 2Z4SA 1PJRA 2CMFA 3HNPA 3Q3JB 2Y1LA 2O8BB 1EBUA 2OHVA 4ZAYA 1CRWG 4DMFA 5DTRA 5IKMA 5K8LA 1EFLA 5AW4A 3THXA 4TV9F 3VU0A 1WD7A 1YR1A 4LHEA 4K88A 3T3MB 4ZVPA 1YHQB 4BZWA 1LVHA 1G5RA 2JD1A 3H3XA 4UBOA 1A97A 3HLKA 2JFNA 3ORSA 3QVMA 5IAGA 2CB0A 2NAFA 4CCSA 4UTNA 2J6HA 4UTXA 4C5BA 1W5TA 2C2BA 1AQLA 1FOEB 5LU9A 4HDRA 5KMGA 4TYQA 1XXHE 4MVWA 4AJ9A 1GVNB 2QN3A 1MDFA 1XDUA 5AJVB 5K3AA 2IZ7A 3W7AA 4RHYA 1N6LA 5DYNA 1J2TA 2XECA 4J0IA 2XAUA 4B3IA 1OQAA 2HF8A 4E51A 1SPBS 1PI3A 3DV2A 3BK2A 3JQAB 3I23A 1ZIOA 2OL4A 4G89A 3I5MA 4K87A 3U7RA 3I5YA 2O52A 1V9LA 1ZO8A 3H5NA 4P1ZA 3SLGA 2E4AA 4OXIA 2WUFA 3WOVA 1WMDA 4CR6A 1YR2A 5FPKA 2DZDA 4MUBA 1COWA 2OZEA 4KWIA 2V65A 4OXXA 4YJFA 1EH5A 5F77A 1E8MA 3G0HA 1S89A 3DPSA 3FFXA 2CW5A 3MWJA 5JO0A 2AG6A 3SYRA 1NF3A 1H2EA 1O94C 4MDHA 1Z3CA 2JZCA 3RD5A 1E7QA 4RE5A 3TVTA 4UQLA 2GCOA 5MFPA 3B36A 2P67A 4QOHA 5IAEA 1DG3A 4X8HA 3PZRA 1HZZC 3ZZUA 4LY6A 1DBIA 1VXRA 3LY7A 1K7XB 3GRPA 4IXNA 1Y8AA 3IL2A 1EK1A 5DLPA 3SHQA 1LQ2A 3MOSA 3W5CA 1IBLB 3VM6A 1NLMA 2QTCA 2JFYA 3MJSA 4ABYA 4AP9A 3L9XA 1TJYA 2MJLA 1K6IA 2IEYA 1JDJA 1Z12A 2HDNB 4MUEA 4ALKA 1RBYA 4XVRA 4FEGA 2O2EA 5JAZA 3OPXA 1R7RA 1SG9A 2COEA 2JIZA 3D3KA 3IXQA 4I55B 4Z7OB 3NMUF 4FXUA 1DOHA 2JD2A 2W2OA 2P8JA 4GH5A 4J7XA 3WK9A 5CDHA 2ZRKA 1XA4A 5C2JB 121PA 4EARA 3A25A 3RLIA 2H1IA 4EMSA 4IGAA 1PUIA 4NARA 4NDZA 4ZO6A 4ENQA 1E0DA 1WW8A 4CIYA 1WP4A 1P3DA 3R7BA 1BD3A 1D9ZA 1UC5B 2NO4A 4Z4TA 2YW9A 1X74A 2IRWA 2OV1A 3DDUA 3FNFA 3OQJA 4W1QA 4O3MA 4II3A 3C5WP 2D5LA 3ONFA 3F90A 1DHTA 4I4IA 4N49A 4ZZ0A 2VJCA 5AVUA 3IGFA 4BVBA 1UD2A 4UQPA 2QUIA 1CS0A 10MHA 1BYIA 1VCMA 4B87A 4EL5A 4DLLA 1FVOA 3TIFA 4ZOQI 3O90A 4TKLA 1XTUA 2XUFA 1XNHA 1Y6ZA 1F0NA 4UDOA 5JY1A 4BTEA 2BR3A 4EHDA 4U4AA 4LF6B 4J4TA 4LXIA 5EIFA 3JQEA 3WRYC 1DQYA 3HXLA 2GFHA 4FKMA 2E5WA 2WZCA 2X9GA 3O73A 3OPYA 4IWNA 3TRIA 3ZDXB 4DCVA 3RYHA 5IDWA 1MVLA 3A3YA 5P21A 3WXMA 1ABFA 5J3OA 1RRMA 4JVNA 2FEOA 2FLWA 3KV1A 4KO4S 1MV5A 3MWGA 4QGFA 1D04A 4XYMA 5HFJA 3EE6A 1OFVA 2J3IA 5MN4A 1I6LA 1K06A 4MVJI 5IM5A 1B15A 1ZOSA 1FYXA 1TUEA 1U2ZA 2PMBA 4UBMA 3I55B 5EMHA 5I9TA 1NX9A 2XV1A 2ZRCA 1OROA 4X7CA 3C8MA 3I04M 4DLUA 5KQPA 1E3EA 3QY0A 4OP7A 1T5LA 4Y1GA 4OPVA 1XRNA 1BWPA 1F48A 3GD5A 3OICA 3KHSA 1G4UR 1T3TA 4IPTA 4CQMB 3N5CA 3TR6A 5LQJA 4X3CA 5H9WA 4E2XA 3D1JA 1VLLA 2WA1A 4GBGA 2IT1A 1RJ9B 4PAOA 3U1TA 1P1HA 1KZ1A 2BN4A 1Y6QA 1WS6A 1MABB 5CR9A 3OUZA 4Y2QA 5BNZA 4WCFB 4U7PB 1DBVO 4D3SA 5J1SB 1T5DX 2CHEA 1XP8A 2XZOA 3BHMA 4ETMA 1ES9A 5AHWA 1KKMA 1BX3A 1OLXA 1UJCA 3VPSA 3T5TA 1DC4A 5ALQA 5A4FS 5F76A 2I66A 1J56A 2X76A 1BKSB 4AY3A 3L07A 1Y33E 5B7NA 3GFRA 4WIAA 1BNCA 1NJ8A 1UJMA 1TDJA 3LM8A 3U7IA 4LSZA 1VOTA 3FH0A 5EUCA 4ZZ2A 2ZWOA 2PUBA 4PSUA 5ICCA 1GARA 5KAMA 2NUPA 3BCHA 2R6CA 3N2NA 4O2BA 1JS1X 1F3LA 5DBFA 3UOGA 2FUKA 3ZBUA 4J0JA 4IIDA 4NLLA 1KEPA 2ORED 2ZULA 3OIDA 4A8TA 2P91A 3TRJA 3NCTA 1XZHA 4RO0A 1NRWA 4YUZA 2FUG1 2FZGA 2MINB 4RIEA 3L46A 5C32A 2Q62A 3GVIA 3OZ7A 3V32A 5BWNA 2RAFA 3T6KA 4DREA 2H1CA 3ETDA 3GCGA 2PNFA 2NZ2A 4JBGA 5LKRA 1I0ZA 4LMBA 3CN9A 3NEAA 4MX8A 1WPGA 2O2YA 3PKZA 4KXFB 4RQTA 3ZWWA 1T6NA 5A2QA 3H2KA 3PL5A 2QSUA 2B8EA 1YQTA 1ZRSA 2NZVG 3SZMA 4B31A 2PRIA 3DT6A 5HVNA 4TROA 4UXIA 2ASVA 4IQ0A 4F8EA 4JUFA 4TKUB 4EECA 3G8YA 1X1SA 4D5GA 1HE1C 4D42A 3E1KA 5CH3A 3BC9A 1W29A 2GAAA 2QYTA 2PCJA 1A9XB 1QX4A 5CLQA 4I6GA 1COZA 1HNNA 3ZLBA 4QEKA 4I4TA 5AJHA 3I2GA 1K4KA 2Z2JA 1M83A 4MGHA 1S8OA 4EVSA 2VRBA 2DHQA 3OP4A 4GKVA 3SMVA 4PZZA 3WLQA 1NSTA 1KARA 5FA6A 1CDZA 4TL6A 1OTYA 3Q0TA 3PHGA 5J2TA 5JI2E 3K4HA 1AQUA 1U7TA 2VHUA 2E1BA 3HUFA 3TW4A 4CFYA 3RRMA 1EGVB 3NHUA 1OC4A 2GCEA 2ECPA 5H3LA 5PGMA 1K3FA 1ORRA 3TZLA 6LDHA 3ON5A 1XL0A 3A1NA 4UMDA 4WSOA 5LZ8A 3CO5A 3OKXA 2C9ZA 2G77B 3AUXA 3FRIA 2VNJA 4AURA 3RUDA 3FAZA 3SXJA 1LSOA 3SQOA 3IMFA 3PHHA 1EVKA 4I6EA 5LFAA 1AUVA 4B3CA 4MQFB 1X3SA 3K9QO 3SC2A 4AO8A 3NJ4A 5EKDA 3P7MA 1QGYA 1ETUA 1MGOA 1NBWB 1JILA 2OY0A 4KACA 2OPBA 5CLFA 5U9CA 5EIHA 1K89A 3DLAA 3HYRA 5FORA 3ROMA 3TQFA 3VSEA 4EO4A 1PZMA 4PAGA 4TKZA 2V0GA 1NFFA 4ZCPA 5ICGA 1SVOA 4CF5A 2XJ4A 1ZGCA 3NHJA 4IHQA 4FR0A 3HWWA 4W8GA 4D2IA 2DOKA 1DJNA 3P4XA 2GHIA 3Q2OA 5A4JA 1CJUC 5AFSA 2OFWA 2Q3MA 3LOQA 3OEWA 3AESA 4G84A 4WADA 1HY3A 5A6VA 1VSBA 2VT7A 2IS6A 1H4TA 2Q4EA 1ZGZA 4IILA 4R83A 4XLLA 3DT9A 1OI4A 3ZZ0A 3DXFA 3HYCA 4ZEWA 4F4FA 2WJHA 3DGEC 3B2QA 4AU1A 3HCPA 3R77A 1QH0A 4RJTA 4QVIA 4DC1A 1KU0A 4RKFA 1ID8A 2ODNA 5LP6C 3FUVA 2HF9A 4BN0A 2PXAA 3K6SB 5AKGA 2O8FA 1CQJA 2O2GA 5KNDD 2DOGA 1OAOA 1RABA 1I2DA 1BE0A 4IMRA 4ADSG 5LZ9A 1R5JA 1IBMB 1QWSA 2BZSA 4BIIA 4E94A 3D02A 1U9IC 2FPRA 1WSBA 2R3SA 2X5XA 4JMLA 3V1LA 1KJWA 2JJMA 2C7PA 3EZGA 4B47A 3OKPA 2P9ZA 2O14A 3HVHA 3VDXA 3ZHSA 3UJ7A 1KBQA 1MJGM 3E4CA 4CMHA 3SF8A 4RVDA 2JCGA 2XSZA 3AI2A 3USCS 4GQIA 2O7RA 2EX0A 1YBHA 4HD8A 2VXCA 1TVCA 4TXJA 4CRWB 2O1EA 2WJJA 1RXIA 3A4VA 3B1VA 4BN4A 3Q39A 2RGAA 5LLTA 1T8SA 3P1JA 2HNBA 1GNQA 1JMVA 2UZAA 1TM2A 1FB5A 4KXMA 3TNYA 4MV3A 2HK8A 2L19A 1CWUA 4BRSA 1SR8A 2IP4A 5DE3A 4IDNA 2OFFA 1V48A 2BEWB 3INTA 3SBDA 3GPDG 5I47A 3GEDA 1XLTC 2OSBA 4H27A 2DTDA 2JFOA 5BQ5A 1P80A 3JD0A 4HNVA 3GJRA 4U9UA 3OC6A 4EGJA 1IG0A 1AXEA 3EVCA 1NUAA 4Z4IA 4PO1A 3S5UA 2NU9B 1KMCA 3M3HA 4EB6B 1YVPA 4WUTA 4PAAA 2BFCA 2CFTA 1RFGE 3JZAA 3SYKA 4BLRA 5ALIA 1EWVA 3EF0A 5B3AA 1GA4A 3C2QA 2HA4A 9ABPA 1JH8A 3ADBA 4ZI3A 4N54A 1CCWA 2NTNA 4Y1EA 2G9NA 1XDGA 1SZPA 3H9BA 4JQCA 4ND6A 1SD5A 3GRRA 3V1TC 2JAOA 3Q7RA 2L0XA 5SY9A 4GKKB 3HO6A 4YQYA 2YXBA 3WGIA 1AN9A 1P1IA 2KHZA 3PQ5A 5FOTA 3MOGA 3DBRB 3T9CA 1AUXA 2AYZA 4MMZB 4M8SA 1IQ0A 1KI1A 2TECE 3GEBA 1WCWA 2NPIA 3K2IA 1VPTA 2PSDA 3FG9A 4GLFA 3JAMA 3F5FA 3QXGA 4HWTA 2X2FA 1ADYA 3LWNA 2GTIA 1NG1A 3EVBA 2V1UA 2BFBA 1OIXA 2A3NA 4B0OA 1EP9A 1XVVA 3L92A 3A10A 3V1UA 4E5DA 1DCTA 2G5PA 1L3CA 5C52B 4LF5B 1QO0D 1AQYA 5EYPA 4YO7A 5EHQA 2HXGA 5J4KA 3KO8A 5E8RA 4DRYA 1SCQA 1H8HD 1IOZA 1JJBA 1O9BA 1U8ZA 1VL6A 1MF7A 3HB0A 3PDUA 3DNPA 4K6KA 5CA0F 4Z3KA 4UVDA 4L4XA 2HA5A 1E1KA 3LXMA 1WOOA 5H16A 1CUIA 3EZ6A 2AE2A 1ZHFA 5HQ3B 2R84A 3ROZA 2ZXUA 1TVKB 1G41A 1QFJA 1CERA 1MFPA 3O1LA 4MKZA 5AJYA 5HOEA 3AHJA 3BCSA 4LMRA 3OOCA 1HLGA 2XGGA 4AJJA 2DHRA 2IHUA 3USES 1N5RA 2FSIA 2ZYUX 1Y9AA 2DP4E 4HV4A 4ZFNA 4RDHA 2G06A 4OFBA 4YRBA 2H08A 1KTIA 1QF7A 4RKYA 2C5SA 3CTPA 1MXFA 2WB4A 4GVLA 4HH0A 5IVIA 1MX9A 4HWPA 3VGJA 2GKGA 1T2AA 2YWRA 4YT2A 4O4JF 4N5MA 3JQBA 1GPUA 2AFHE 4OX9B 4F5YA 1TF2A 4H1TA 2F1IA 2MOKA 2HSDA 5JANA 2C8KA 3D5QA 3CN7A 3EEBA 4MO2A 2JLWA 2IY7A 3FBTA 4EG4A 2EQBA 2JL1A 3W4KA 1TO6A 4AJEA 1NXQA 5EFOA 3G5TA 4DIUA 3OT4A 2AG8A 4PQYA 2FX2A 1SU6A 3IDQA 2RE8A 1UBTS 4JT9A 3E9QA 1J20A 1OXBB 2BFDB 3HN2A 1U7XA 3SDSA 4B79A 5C8ZA 3MTDA 4KCGA 1HE8B 4OOEA 2VXOA 1P2VA 1V16B 3GU3A 4DJTA 1O3YA 3TTXA 4BO3A 2UXCB 1DMSA 5E6TA 4BMOB 1RQ2A 4YCMA 1B7GO 4MPRA 1LV7A 1PJSA 4TM8A 3ZJUA 4ZCLA 4JGIA 4KAXA 4PG7A 1HNWB 3LQKA 3U6BA 2P11A 2Y2UA 3KR9A 1H2RS 5IKEA 4R7TA 3KFXA 1NBMD 3A9UA 4G5FA 1OB0A 1S9HA 4II7A 2QN1A 3QF7A 3WWEA 1TVMA 4BLVA 4QBGB 3HO8A 4RPGA 1KMHA 3D7RA 1CNMA 4EK9A 1E64A 4V1CB 2V3WA 1G9SA 3R4VA 4S3MA 1RYDA 4UHBA 3PA2A 2GEJA 2NYVA 4C06A 3HCEA 3SEAA 1DJPA 4I9GA 5C18A 1MB3A 4G67A 1ENYA 4JQSA 2B8JA 2PX4A 1ULUA 1NM5C 1SXJB 2RB5A 3RVKA 3SOZA 4L7QA 1BAPA 3ZK9A 3ZU3A 5HE8A 3EUWA 2QM0A 1OREA 3Q5DA 4N8DA 5DHTA 2QD5A 3SD7A 2Z43A 3UICA 3E9CA 3ND5A 2VG8A 4J76A 1W48A 2XWQA 2ZJ6A 1FYDA 1D8TA 1BPLA 4X7EA 2CXOA 4JGBA 3OCZA 1BQ4A 4R7GA 3U7QB 4UM8B 3ZBQA 3A3PA 3IPYA 3KL9A 3ZH2A 3VR6A 2NSDA 1L4EA 4K81B 4Y2HA 2C58A 2BMDA 2XVAA 2NX2A 3WX0A 3S44A 4KPGA 2CJXA 2WG0A 4AZVA 3IPCA 1LW7A 5E6UA 2YWXA 4YBZA 5H3CA 3A31A 1B6SA 2HRRA 2P0AA 1XFOA 2FX5A 3EIEA 4NONA 1DX6A 2YRWA 4G23A 3P2OA 2RDMA 3EFBA 3UJCA 5TPZA 5BV2P 5AKHA 1V3TA 1PQUA 4R68A 2PUEA 2B4KA 3C3XA 1N2JA 4C7VA 3PXUA 5K0GA 4NDAA 4I5EA 2XMPA 5LQKA 2P9FA 1J0XO 4LYEA 2J5RA 2PGXA 2WHXA 1Z35A 2GZAA 2QTFA 3G2QA 3MWKA 3OX4A 4I46A 4E09A 3K70D 4G8CA 2BGRA 3UM9A 5A7FA 2SBTA 3EXAA 2XMDA 1QC5A 2QE6A 1AMOA 3V6LA 3ZDDA 4HRYA 3AEKA 3L8HA 1U8XX 3IVAA 3RT9A 4EPYA 4KI0A 3UMRA 1GGJA 5KPJA 3GWGA 4JMPA 4BKUA 5LDHA 1Z8NA 3C0KA 3WTCA 3TGPA 1GLNA 2AWNA 3CCFA 3RVMA 2QNIA 3HQ4O 3OBBA 5HCIA 4C5AA 2ZANA 4E2YA 2EZTA 2HSJA 1JU3A 2B4TO 2YR0A 4TVSA 1YIJB 1BXGB 2OAGA 3GF4A 2GEVA 2MHCA 4NCJA 4FMDF 1UD4A 2IH5A 8MHTA 1QVVA 5J2UF 3FOWA 3GARA 5AUPB 3U7FB 1QYCA 1QYIA 4EY8A 4EHBA 1NR7A 2NVOA 3R9KA 3MSXA 3UMSA 5IT0A 1O0CA 2HV9A 3SX4A 5CBPB 5KREA 1NXWA 2PUVA 2HLPA 1THZA 3DZ8A 3GFTA 1FFCA 1DV2A 1T91A 3BDVA 4BMYA 2VHJA 1M1UA 1XJ0A 1YJ9B 1XWIA 4LNUA 2H1SA 4YV0A 3HJFA 2GJRA 4DR1B 2O3SA 3EY4A 4ONEA 3AERA 1VKNA 3BCFA 3DOHA 3T0GA 1YXMA 1MTZA 2FPWA 5BNFA 3A1WA 4HK4A 4XR4A 1VBFA 4MVXA 2FFAA 3INNA 3E4DA 3OOHA 4Q3LA 3ZIDA 4AJNA 1HOXA 2X1HA 4WZBE 1O9HA 4G8BA 2RONA 4M49A 2HUPA 2FR8C 2E4ZA 1CYEA 1JX6A 2VBFA 4O1MA 5CITA 2INGX 1QS0B 2QU7A 2D59A 4RZUA 3T3HA 1A9OA 3AKEA 1E9FA 4NPAA 4M8IA 4J8PA 4GYYA 3WR5A 3JATA 3HBFA 4O3FA 3GJYA 1GTRA 4WZLA 1YGPA 5ALSA 4AY4A 4Q9AA 1I18A 1NXVA 4W9RA 2RI6A 4QATA 3WNVA 5JARA 3OJFA 1BA3A 4ALMA 3W3AD 5K8CA 5K45A 3LVBA 2A35A 5B2ZA 4Q3EA 1V5VA 2LIPA 2VT6A 2XNDD 4IYRA 5LZ7A 2BHRA 2HJRA 3D6NB 4MI3A 2B8WA 4KFUA 4YMVA 1MNQA 5EIWA 1QYRA 3GZTB 3E20A 3DS8A 5C1PA 2D2EA 1VE3A 1NONA 2BJVA 1HORA 4GD3Q 1IEWA 2FRVA 5I01A 4ASUA 3SEFA 4YAGA 4RD2A 5B12A 1IMJA 3SF0A 4HAUA 4KE8A 4YJ2A 2X0JA 3QZUA 2V7PA 3OZXA 2YCBA 3F9CA 2HWWA 2VDNB 5FV4A 3DD5A 1E3WB 1GCIA 1L7QA 2WE7A 1M8JA 3MCVA 3FBGA 4H3HB 4Y6PA 3TQHA 1TE2A 3DMYA 5F2NA 2D1RA 5LCXA 5EINA 3QLEA 1RVDA 5E9AA 4AB1A 3PTLA 3E9ZA 4C0AC 5JNRA 1WCYA 3KAKA 3ABQB 3E2MA 2P1ZA 1N3YA 2JIMA 4B4DA 5IBRA 5ULLA 3U48A 1H0SA 4DAEA 2XNSA 4WA7A 4CIWA 3K9FC 1Y42X 4JJ7A 2XIQA 4XQCA 3DNMA 3BMQB 4AX4A 1TNDA 2AG5A 4MQEA 2IPXA 4DG9A 4ZEXA 5LU8A 2AOWA 3PGVA 1U2GA 3JWPA 4WN9B 5HILA 1O58A 1WD5A 3DMTC 4YECA 4HGYA 4AXXA 3JW8A 2QN9A 4DR6B 2AFIB 3UIEA 2A94A 3KQPA 2D0IA 2Y93A 2ZFUA 3L0IB 4UHDA 2QX8A 4F85A 3ZLUA 1HZEA 3FTPA 2JKZA 4HRXA 5IWCA 1FRNA 3IAEA 3PC4A 3KAQA 2YV1A 5C5CA 2OWDA 2YNMA 3LGSA 1O6FA 1JTVA 3ANYB 4HQFA 1MOSA 4NENB 5CVCA 5ALJA 2UXBB 4GIBA 4Q00A 1WZIA 5DEIA 1U2RA 3BRQA 4TLMB 4BQFA 1DELA 1UBKS 2Q5LA 4P25A 3LA6A 3BS4A 5M04A 2IA5A 4JDUA 3E3NA 3IR7A 1H4QA 1NLYA 4RU1A 5LNK1 4HJRA 4PBRA 3UJPA 3M8KA 5HZHA 3O95A 3DKKA 3QYFA 1YE8A 1Z4IA 5BW8A 3KS9A 3Q8LA 1VGRA 2V7VA 1GAQA 4BP9A 4FN5A 4DQKA 1BFUA 1MC1A 2CHFA 3LT0A 3T5CA 3FVTA 4XFKA 4X60A 3SM9A 4M0LA 3LUHA 1AO0A 4BFVA 3DBLB 2I2DA 2QLTA 2GLUA 4V0MA 5HJ2A 3QYJA 4DW8A 3ICCA 3VMMA 1UM9A 4EF5A 4ZYUA 2WWFA 1AKEA 1YH3A 1NURA 3B1JA 1WXIA 3E5NA 3OMXA 4G9BA 4Q3AA 3ZWBA 5AESA 1GU7A 2BWJA 1VM6A 1DQPA 2ZKLA 3HU5A 3I42A 4DLPA 5BMVB 2YWJA 1ZUNB 3COYA 4J0HA 4LE2A 4OAPA 2Z6QA 1QCDA 2RI0A 3LT5A 1M1NA 4CM4A 5PNTA 3VVLA 4L5BA 5T64A 5EXSA 5FWXB 3N1UA 5ITSA 5FUYA 3KZKA 4WGFA 1LEHA 1PP4A 3GXOA 2VZ9A 3S2GA 3HP4A 4C7BA 3W2TA 2ZZFA 1B8UA 1CR1A 2MWMA 2Z56A 4ZI7B 3I5UA 4GUDA 2NO1A 3MGKA 5TR9A 3QUAA 4I7EA 1BVUA 5EUMA 4K9DA 2AI2A 4Y2UA 2WNSA 1DIGA 2HY7A 3ZNQA 1IJFA 4IVPA 4MUIA 2EBHX 2QTVA 1AK2A 3NAMA 4PGHA 4E1AA 2FPOA 1ESNA 1TQDA 2XKAA 1N2CA 2VRWA 2ZSIA 3LCRA 4LW8A 2LV8A 2OMKA 5ELMA 4BNKA 3MHTA 1DKMA 4GM4A 4TUYF 3AB3A 3H9EO 2ECKA 2UYQA 5JCJA 1IXKA 4BO8A 4EPTA 2Y0PA 4FYWA 4L4ZA 2N1MA 1EGAA 4QFDA 3A4YA 4PFSA 4CR8A 5F64A 4ZVRA 3L8DA 5AVXA 2D2IA 1M2FA 5HM6A 4L6AA 2E37A 1RHJA 1TADA 2ZBQA 3KNZA 4J0DA 1LS1A 4RPDA 3CBGA 3QPCA 1EXDA 2R8ZA 3EHEA 3P9QA 4O4IB 4XYGA 4W5OA 4GO1A 1AKNA 3GJ7A 3I76A 3L49A 4S24A 3F6YA 1KMQA 2HWKA 2QD2A 2FNAA 2G36A 4ZAVA 1Y6GA 2CL5A 3LU1A 4Q15A 5AK4A 5ES3A 4G1VA 2JLCA 5JYDA 2DR2A 3F5MA 3K6JA 3LL4A 1Z17A 3JQ7A 3ONWA 2RKBA 2I1QA 4HNSA 4O59O 4QYSA 5DW0A 1DKLA 4A73A 1NJGA 3U61B 2FJ0A 2NACA 2OFPA 2A9VA 3BRSA 3HBNA 5EG5A 5IH7A 4HFJA 4Y2VA 5KOJA 4C3VA 2H00A 4GS5A 3PT9A 3SNKA 2C98A 2P3LA 1VKRA 2ZDGA 4QE3A 3V7WA 1XTBA 4G56A 4EYQA 5EJ9A 1RJGA 3BL5A 3FKQA 3JARA 3ZWMA 5A5VA 3CQ9A 4KWHA 3Q3VA 4ZTBA 2DFNA 3HCDA 4UVHA 4WBSA 3LX8A 2WZBA 3M5DA 4YJDA 3KP1A 3ETEA 4G97A 2ZL7A 2C5AA 1U28C 3BSFA 1MV8A 5C3MA 1T2CA 4OAQA 1GRRA 1JQ5A 1G7RA 2D2XA 1NYTA 4Y1FA 5HDBB 3IR5A 2YW2A 1JHVA 4BCDA 4QHSA 4GM1A 1V95A 5CXSA 4OMCA 3TRKA 2ZWIA 3I0ZA 4H2DA 4M1QA 3WZ2A 4AKTA 4G07A 4NFYA 1WVGA 2GZDA 4RVOA 2OB1A 5FOVA 1QGZA 3IUQA 5GJWC 1YB4A 3VHLB 1QGAA 1AF4A 1CK4A 3SBXA 4IUBS 1DAPA 3I01A 5HSGA 2HA2A 4X63A 2GA8A 4BMVA 4YX9A 3KZXA 5IJ9A 1XAIA 1PT5A 1CUHA 4OIFA 1ISJA 4KLZA 1ZH8A 4XCVA 1HTWA 1C7FA 1VJDA 1GITA 3RK1A 1SHTX 3GT4A 1P1CA 2HK6A 5FFMA 1FRFS 4Q34A 3B6JA 2EERA 3IP7A 3NANA 3ZKWA 2EWVA 3ZLVA 1WPXA 5AWFC 4JU9A 4XPZA 2YXNA 3HU2A 1G8KA 2HRZA 4HBZA 1DP4A 5ALOA 3FGOA 3G71B 2P2YA 1XF1A 4O4LF 4WDRA 1KRHA 3TLMA 2V74B 1UFRA 5C7LO 1NF8A 2CL6X 2M32A 2OV4A 1X7ZB 1Q7EA 1QIMA 2BRUC 2QUHA 1ULTA 3KZOA 3EDYA 5IPFA 2Z57A 3GRYA 2O1XA 2PFGA 4AZ3B 1K6EA 4ZT3A 4N6NA 4BXOA 4FOLA 3T3OA 4INJA 4ZDIA 1W59A 4JOQA 1LC0A 2KS6A 4G5XA 1JFSA 1HDXA 3A9WA 4OMFG 4Q05A 1PS0A 3VR2A 4QDUA 2BLLA 5L3SA 5KYXA 1OAKA 1Z2EA 3BXZA 4M1EA 1Z6GA 3T41A 3W6ZA 5EIAA 4TOIA 1V41E 2RI1A 3BMNB 1FP1D 1YI1A 4L4RA 1BG6A 5DISB 5AQEA 2XT6A 4Q0MA 5GIPE 2O5EA 2VPTA 3LVFO 3Q8MA 2QLJA 4FW8A 4UUQA 4XWWA 2IDMA 5ALVA 5YASA 2JJ2A 4L5AA 2R48A 1T1JA 3K73O 2C78A 4PEVA 1HTTA 4I08A 1F06A 3GFFA 5IXSA 2X9NA 4MSUA 1CQIA 2EG9A 2GILA 4KMOA 4YO8A 5EP1A 5AW9A 5HUHA 3G2LA 2O5CA 1HDIA 3D8NA 4LYYA 4C07A 1U2SA 3NVMB 3AM1A 1ZNYA 4FGSA 2QX4A 2AJ8A 1PV1A 3GVLA 3IPLA 3JAWB 2PX8A 3WJ1A 1F60A 1L5HA 2H8KA 5TVKA 5EEHA 4LX0A 2DH6A 1UPBA 1MPXA 3WB1A 3LTEA 3D4PA 2I91A 4ZVMA 1X19A 1AVTA 2VUHB 4S1NA 3E1YE 1LY1A 4P86A 3ESCA 1O97D 1F7VA 1NLUA 2QXTA 3DL2A 4JLMA 3AEQB 3CCUB 4LOJA 1PUXA 2W6MA 1FLDA 3Q7EA 4GOMD 4ZV7A 2R00C 1HLPA 3DOUA 1JPNA 3VH1A 3D4OA 1UP4A 1ESMA 4IHJB 4LQLA 4U2FA 5DF1A 4P4NA 3UG7A 4DLSA 1A1VA 3QVOA 2WKSA 3I28A 1CR2A 3OFSA 3NTXA 4BCBA 3I92A 2H1FA 3PHCA 3R6GA 4WXEA 2O3RA 4CV1A 3CXUA 1IULA 3HMQA 4ZQHA 3EDCA 1IHXA 2IYLD 3N9IA 4I1IA 2FPGA 3I1JA 2IIBA 3IUEA 2V7EA 4B43A 5DHQA 5GP1A 3UC5A 4PC1A 4QWWA 3AUFA 1FP6A 3GVHA 4A6PA 1JKMA 3ROTA 2GSWA 1EKXA 1KP3A 2Q9CA 4XUCA 3W0LB 1P2SA 3DWIA 5BOVA 1J8MF 5JS2A 1XEWY 2IDJA 4W63A 4MJ3A 2KVOA 3FB4A 1MPTA 1KO4A 5LBTA 2CNWD 2WZDA 1UKCA 3OAAD 3GJ5A 4UVGA 2QRVB 3DL0A 2D9RA 5HKKA 1SKYE 4TXNA 3NTUA 3VZRA 4I8XA 3VZQA 3ZCRA 3K70C 3I9LA 3ERCA 3RRYA 1BE8A 3WL7A 2Y1FA 2ZK7A 1EJ2A 2V58A 5BVGA 1IDOA 3HACA 4QZVA 1K97A 1SUPA 2CVHA 4KV7A 2WY2D 4EHIA 4PPNA 2Z9DA 1F0KA 5HF8A 1Q14A 5JJLA 1RJWA 4UVEA 3GLQA 1X1BA 4LF9B 3PDWA 4BFXA 1C3XA 1H5QA 1L4GA 3I8XA 4HF7A 2XDWA 2PGDA 3SGLA 3S8EA 3G8AA 1QRUA 3C6KA 3STUA 3UFXA 3EVDA 1JHXA 3EIWA 2CZGA 1CJSA 1G8GA 4J1SA 4KEAA 4TYPA 2VQEB 1KC8D 3E82A 3INRA 4KKXB 1ZZGA 4CBVA 1JQ3A 2FPIB 5MF6A 3D6MA 1ISGA 1KYXA 1UWKA 2Y0EA 4R2WA 4TL9A 4X00A 2NSLA 4CKWA 1FFEA 1Q0HA 2ONJA 3G1UA 3QKRA 4HNQA 3B52X 4QXRA 5CCEA 2I7VA 2WAXA 2JFFA 3AB8A 4CUJA 2GYWA 5LXTF 3IB3A 3OJCA 4YI3A 3IEUA 2ZXFA 3EMBA 4N5DA 2FN7A 3HDTA 2UZ0A 2DH5A 1KK1A 1J0CA 2BEVB 1N5JA 3OIWA 5HZAA 4NJMA 3DKPA 3L40A 5EE1A 5EWMB 3WYDA 5I45A 1YS2X 5IEJA 4ERNA 1P1FA 2H2HA 3H2ZA 4W1SA 1C2TA 4GWGA 3PUKA 4F56A 1Y9EA 2YFKA 2H5IA 4H0CA 4PPGA 4DIFA 5AI0A 2HYIC 2ZRGA 1GO2A 1LFAA 3TAUA 3L7OA 4XPIB 3TPCA 1XTRA 4RAOA 3EH2A 2DBQA 3PITA 1QZ3A 1BKDR 2O3UA 3RGWS 6CHYA 5AM3A 2XB4A 1EFTA 2CF4A 2QP3A 4W6ZA 5BN4B 1OWLA 5KJCA 2UUOA 3LWBA 2WKQA 3OM0A 2F1MA 5T4FA 2HEGA 2PQ0A 2WWGA 2CE2X 3F7OA 5JG7A 4YJGA 5DHFA 1WKCA 3R0ZA 2YOFA 2WIJA 4IEFB 1KEEA 1G1AA 4GBMA 5K99A 4AY2A 1PIWA 4F3NA 4JP1A 4BKMA 4OGKA 4BYGA 4DTCA 3P2KA 1OWNA 1SNYA 2OFOA 3BGOS 1WCV1 3VR0A 2VYQA 1HWYA 2I6GA 1D07A 1N3LA 1TX4B 2WHQA 4BNWA 2ZCUA 2EFJA 2FSPA 4I9UA 4HVTA 5G0TA 4ETWA 3VOSA 1R8XA 3FYUC 3ZDCA 3EFHA 5JSFA 3STYA 3GG9A 3LHFA 1XDDA 1U2PA 3BC1A 3WP1B 1KZHA 2QTBA 5HM8A 1NJID 4L51A 4O29A 5BORA 5KTOA 3EEYA 1OB2A 1WL8A 3GR6A 1CTQA 1JBEA 3IJRA 4FDVA 4K3UA 1TFRA 2REQA 2Q4OA 4NJEB 1FFYA 4HQ6A 4X66B 4PLHA 3GZNA 2VP3A 3LCMA 2COKA 1M5RA 3DT8A 2AQIA 3JQAD 1MB0A 1E3JA 4KPUB 4MW4A 4WKOA 1AE1A 3UYLA 4A5SA 2VWHA 4YQZA 5KI6A 1A9ZA 2Q5EA 3QHPA 4W5HA 4BJHB 2ZSAA 1WUHS 2HHHB 2F1KA 4NU0A 3WL4A 3WWOA 1OLSB 2BGUA 2JLAA 2VK8A 4A0HA 5IYZB 3IDZA 2GM4A 3NJ8A 2VYFA 3HJNA 2IZ6A 4D3FA 3LBAA 1X7WA 2FZVA 4B4UA 3P0JA 4DN6A 1JB9A 1KVQA 1Y81A 2YJNA 2ZRHA 3ZW9A 3DYIA 3EEQA 4OHKA 1E6WA 4FHCA 3IKLA 1ITZA 4ZKEA 2YJTD 4DR3B 4DYDA 2AW3A 2BTQA 3PNSA 4GRAA 3IKVA 3Q38A 3BE6A 4Y6QA 3WA6A 5KNDH 3GLIB 1QF9A 2ZYHA 4CLRB 3D8HA 1NXSA 2IGTA 3PR3A 4CPDA 2ATEA 5FB3A 1DWPA 1KJJA 3PNVA 4JWKA 1SXHA 2AYXA 2H48A 4FFSA 2C7BA 1WBBA 4KP7A 3K09A 2R6R1 3RKRA 3U13A 3L7BA 3MPUA 3OE1A 4D43A 5KJEA 1X9IA 1QGUA 3IUBA 4DNRB 1RQLA 3K0FA 2FMTA 1Y8ZA 1C7RA 1TM1E 3RT7A 2BF4A 2OBFA 4ALIA 4HLUC 1U94A 4C05A 5KEIA 4KREA 1Q84A 3GLHA 1TPZA 1GNTA 1YV9A 5CVDA 3RTBA 4CHGA 2IHTA 3VVCA 4I4LA 1MCZA 8ADHA 2ZRAA 1NBME 4B8ZA 4TV8B 3P0HA 2X9QA 3FYDA 1US8A 1JHZA 4YRDA 2X86A 2Y68A 5AP9A 4EP1A 1RZUA 1XT6A 2XOEA 1W2BB 1C9EA 4PABA 2XE6A 4LYJA 1NQAO 1FDVA 5MFZA 3Q11A 3MJRA 5AM4A 1R5NA 3G8CA 4KQ1A 5CYPA 2IEZA 3ZE6A 3V4SA 4LXQA 2E1RA 4URXR 5BRAA 1UADA 1X7ZA 4NU5A 5B3JA 2HGZA 2FCAA 4R51A 3QX9A 1TEXA 2XUKA 5BSTA 3F46A 2Q2NA 3CZ5A 3W8FA 3VU3A 5E1OA 1W35A 1B41A 2G0AA 2OB2A 3BH0A 3H1GA 1EFPB 3AM5A 1H1LB 3I62A 4WCVA 2QGGA 1EDDA 2UUBB 3GN2A 4FHDA 4WNAB 3U4DA 4L9WA 3RR2A 3D6HA 1R9JA 4FUTA 2BHNA 4KO8A 1QU3A 2ISCA 3EVNA 4UBLA 4RD6A 1Z2OX 2OHXA 1FFGA 2DLNA 2EZUA 5EJGA 3F7MA 2J4FA 4NTZA 1N6NA 2Q6KA 3ZUGA 2IZ5A 1J97A 2ZGVA 2H31A 4BNXA 3OZFA 2P7IA 2EJVA 4AKSA 3D3QA 4GL2A 3A8IA 1PG0A 4W4TA 3S28A 4OQZA 3KPYA 1T1RA 1P2FA 2ZU0C 1ZKMA 1GQYA 3FPAA 1EVZA 4G4GA 3W4JA 3DP9A 5HQ3A 3HXQA 2IEGA 3AEXA 4DV2B 4CQMD 2P79A 1XEXA 4C0JA 1TI7A 3VFDA 3DZGA 4CGYA 4QJ3A 4CIAA 5CDFE 4YCBA 2ID8A 1Y0BA 1JNXX 2AN3A 4Q39A 1RDFA 3UXYA 2OV3A 3JAWA 3EIUA 1E63A 1DUIA 1TT7A 1DG1G 3CE6A 2QUZA 3QFRA 3OO0A 2ZXIA 1U7UA 1CUCA 1FMTA 4FXPA 1KP9A 1TZMA 4KXQA 2ZIEA 3Q87B 3T1VA 2PKQP 3Q1KA 2K7ZA 4HDKA 4FYPA 2OV8A 4DMGA 1B1AA 4JUDX 1U65A 5F12A 2ZBGA 2RGEA 1SKAA 4IM7A 3LO8A 4PO8A 4U9HS 2RHBA 1NA5A 1RRPA 4G4SP 4YWJA 5BUCA 2ZTSA 4YEDA 5ICSA 3DP7A 1NWHA 1C0PA 1EUCA 3I39X 1RC0A 1UEJA 1TF7A 1U7ZA 3G2OA 2X5KO 3H42B 1M33A 2ZT5A 4IJMA 4XCQA 2B5WA 1DI0A 4LDRA 4C2AA 4PLZA 4QYWA 3TFOA 2HDOA 2JJYA 1ZM4A 1JIKA 3AR5A 2IV3A 3LQYA 1V1MB 1ORWA 2O3QA 1GKKA 3HXKA 1WF6A 4EB8A 4Q7JB 1GSIA 1K9SA 3HH8A 4TLAA 1GU1A 4YV2A 5JVDF 1CE8A 4YDQA 4EJSA 3C8HA 4JJFA 5E3JA 1IN6A 2LE0A 3VR1A 1ZJJA 3WWCA 2R7LA 1UMCB 4OEHA 3J7AC 4OJKA 2VATA 3U1BA 1N05A 2BGNA 4JUCA 1DDGA 4R2XA 3H3FA 5HR5A 4BVLA 3FTFA 3C4QA 1I2CA 2Z1DA 3WRVA 4G2TA 4B3RB 1Y3CE 1ZMRA 4MJ7A 2XQGA 5I8WA 4MCHA 1S2GA 1WW3A 1H6CA 2FSUA 2H1LA 4OREX 4P4LA 1E1YA 4C0BA 5E2AA 2XXAB 1GPH1 3L6OO 2CWDA 2G9RA 4HDMA 5JDIC 1ZVJA 4KPEC 4HAOA 1K5HA 3ENKA 1BU5A 4TGLA 2ZR0A 4BX9A 2NXCA 3A6GA 5BNTA 5K0ZA 5KQMA 4A16A 2W9XA 1OH5A 5MGBA 1HE2A 1W6UA 3CHYA 2ZREA 4ZEOA 4P7FA 4EABA 3BJRA 3TINA 2B1GA 5KSYA 2VTDA 4LXXA 5IUKC 3UMJA 2X14A 2WYWA 3QHQA 3HKCB 3QP9A 2BFWA 3WSWA 5AI8A 2FUG6 3RC8A 2OHOA 1EEHA 2FP3A 1E89A 3TCXB 4AVZA 1KERA 2WIGA 4Z5XA 2IYYA 3ADDA 2AD5A 3BRCA 4B32A 1NI4B 2RJNA 2CLIB 2KBEA 3I3SR 1D2NA 3QE3A 3PC8C 3BGVA 3PQDA 1CZNA 1XFAA 4X8IA 4B71A 2FZCA 2DPGA 1OKKA 1ZG3A 2HYDA 2E7ZA 1T9GS 2Y92A 4DC0A 5AYVA 2ABWA 4ZEMA 1JALA 5AQ1A 1EQUA 3QW4B 1EUDB 2AI3A 2IXGA 1SVKA 4GEGA 5DRTA 3QNUA 2JANA 4KDRA 3RYCA 3RFFA 3H4IA 4UNPA 1HX7A 4IZOA 1HF3A 3CR8A 3WGTA 2A5LA 1R18A 4PC2A 1AM4D 3MMZA 3V9PA 3EQ7A 3CF2A 4RM0A 1DS6A 1QHHB 2OOKA 2SKDA 2UAGA 4HWSA 3AGPA 4JR0A 4CMIA 1NN3A 5CEEA 3ZWPA 2J9GA 1QAQA 1L7DA 3ZWNA 4IF4A 1W85B 5I3CA 2VHTA 2Z95A 3WFJA 5AKJA 4P2BA 3TTYA 4RV4A 2FZLA 5JC1A 4TRRA 1G3IA 1DJQA 4PXYA 4YAUA 5I8PA 3KSUA 2ENUA 5KHLB 1EE2A 4FMCF 3Q6IA 3WAJA 3QWBA 4FHZA 1VYVA 1L5ZA 2MR5A 4JKOA 2P1RA 3DXYA 3EQZA 5D5HA 5K8VA 4RY2A 2CVQA 3ND7A 5F1KA 3FCCA 3NC4A 3SHOA 5TT0A 1Y8RB 1JG2A 4ZQCB 3CX7A 3WHLA 5KYWB 2OZKA 4BAUA 4DCNA 1USGA 1OYWA 4NBKA 4MP6A 1KP2A 5ALKA 4OVKA 4XTRA 1H0KA 2CNNA 3TD6A 3UT5B 1FK8A 2J0UB 4ER3A 3GRAA 4UCWA 3Q7TA 4EAQA 5E9JA 4QVJA 1JLHA 1R5BA 2VTVA 2B83A 4LVUA 3IAHA 1RXEA 2VYND 8ATCA 4EA6A 3M6MD 3TDNA 4TMWA 3ILYA 4RHCA 3EPLA 3R74A 3S7TA 3T34A 4YDRA 2J7PD 1L7XA 2FPSA 2EATA 3C6QA 4LQCA 4OKIA 1YFKA 2WV7A 4AG3A 1TO2E 1YMQA 4FCCA 4P32A 3FMPB 2B94A 4OYHA 5GM1A 1NW8A 3R5SA 3K5HA 4AX8A 4FOPA 4D0RA 2MSDB 2X4GA 2FTKE 2XNHA 3A3OA 4U5XA 3VHXA 3DAOA 4M6WB 2O8DA 4AM8A 2W2TA 5DCLA 1HH4A 3ASQA 3VAYA 1GSHA 1JA9A 5F98A 1FQOA 2NPFA 3LXUX 4OV6B 3WYNA 3RHFA 1NG9A 4MV8A 2V4DA 4C88A 1D5WA 1ZXBA 1YR3A 2DQ4A 4QTZA 2RG7A 4YP9A 3SP1A 4EUEA 4RTMA 3CONA 4PVCA 2IP2A 3DEJA 1TM3E 4DA9A 5I7VA 3K72B 1O8CA 1RBMA 5KW9A 1XZNA 5KPDA 1SIOA 3CH4B 2XGJA 3PNMA 2BI8A 2GXQA 4FCWA 3W2HA 2O8EB 3VJLA 4PNHA 1P6UA 1SUSA 2HIMA 1W87A 2P9EA 1OA1A 4RPLA 2H2GA 2PT6A 3DJYA 4B34A 4PW0A 3HO1A 1BFDA 5CNJA 1IUPA 3AHGA 2VK2A 1LQTA 4OJMX 4ARIA 5DLYA 2BBWA 5F9MA 1WOPA 4NHEA 5EVJA 5EFZA 4UMFA 1ZUD1 1W0CA 4Z4CA 2PIDA 1OHHD 4PXSA 2K2QB 1YNSA 4L0DA 3WBKA 3LUPA 4IKOA 1P60A 1U0SY 2Q3LA 4IDHA 2WM2A 4KIWA 3W3AH 5FWYA 4PAQA 3VJKA 5FOQA 4D25A 1J8DA 2JG3A 2JEZA 4UFNA 1ZWLA 3UWSA 1RQRA 1A72A 3NAZA 4QTXA 2QW8A 4FBLA 4U02A 4CKCB 4XB2A 1EJ0A 3AH8A 4OHPA 4BQEA 4IGKA 4EJ0A 3T52A 2ZR9A 3A4TA 3HXPA 4E08A 2OTCA 1YFZA 3OPYI 1N9GB 1HTBA 4EKYA 1IZ7A 2GBLC 2O23A 3BDIA 3P26A 3FPLA 3GX1A 1SOUA 2JJ8A 3IP5A 4FW9A 4YRKA 5JH7B 4WY8A 3ANLA 2P6RA 1NE2A 5FKJA 2G6BA 3P9CA 1WF3A 2GM9A 4MARA 3IP1A 2B37A 3E7DA 3GYGA 3CC7B 1RYNA 4OQYA 2BF7A 3TVYA 4PTLA 1W4ZA 4LX8A 4RVUA 3DO6A 1S0UA 1GN9A 1U6KA 3OURA 1CVIA 4PXAA 4N5HX 3HLTA 1Q7RA 5AI6A 4AMVA 3B9BA 3H2YA 4K6OA 1C1HA 2IBMA 2QK4A 4JC5A 3FZYA 1TXGA 1VL1A 2FSVC 3C74A 1WAMA 5DT2A 1PEDA 2E6UX 3OESA 4IX9A 3K1TA 5H1YA 1LK5A 3LUDA 2OK7A 3CNNA 5CXXA 5AIAA 1QB7A 2W00A 3Q40A 4FLFA 2BM0A 1M74A 1UZNA 2H63A 4WNAA 4KQEA 2QUAA 5EJ6A 1PT9A 2DJ5A 2QMHA 4C4YA 3JY6A 1QONA 2GTHA 2ZSUA 4NICA 1CPYA 4F8YA 2FP4A 2GN4A 4YRSA 4QLAA 5DP1A 3ASZA 4KVZA 2I67A 4W7HA 3TLEA 4UEQA 1PDWA 1A5TA 3KQQA 3OT1B 4JLJA 4DGSA 4XLFA 3MCZA 3NDRA 3S5JA 5IK2D 3SPXA 1ZC4A 1PT7A 1JR3D 5JY6A 1CFZA 2VBUA 1KI4A 2B4RO 4FFNA 1L7VC 4FMBB 5JAOA 3RVQA 4JA0A 1YRWA 1IQRA 2H5EA 4NV0A 1NHWA 2FZKA 2RK3A 2XB8A 1YL6A 1J90A 3H7IA 2HSWA 4WKGA 5H68A 2NT3A 2ODBA 3R1IA 3G85A 1A1SA 2F1HA 1Z6TA 2WU3A 2K7FA 3E05A 1G6OA 2QAIA 2WM8A 4FSXA 4G0QA 3PTAA 4DR4B 1QB8A 1QLWA 3DKVA 1SA0A 3M33A 3SQWA 3WBJA 4KIUA 2MSKA 1UAYA 4K1XA 4QQ8A 1ZJWA 2BUBA 2PTGA 4AJ4A 3BTOA 3GFVA 4H16A 1XPRA 1CUEA 3QEOA 1T3HA 4Z8YA 2H4JA 1QRSA 4D9KA 1Z25A 3IA7A 4ER0A 2FW7A 5DYGA 1I33A 5AOAA 2NMVA 2RMKA 2M6LA 3LUJA 1SXJD 5H70A 3SOPA 2BMFA 5B6JA 2F8TA 5LZ5A 4Q02A 3UKDA 1BRMA 5K0EA 1UDBA 5T67A 3CVJA 3E3MA 4Q3OA 1NW9B 1VHTA 5J5AA 1LKZA 4KQKA 4OTZA 2CSXA 5HCUA 3Q3EA 4KN8A 3LBHA 4HWOA 3UXEA 3QEMA 3UPUA 3E3LA 2VHVA 2VJPA 4TXLA 3S29A 4BUZA 3OCUA 4UNNA 2DYKA 2RAVA 1QH8B 3GHYA 4ZEVA 2WEKA 1UAAA 2QL9A 5JXIA 4AIIA 1KDPA 1Y7IA 2XZDA 2GBFA 1NR5A 2D3TA 4HDNB 3BMCA 3F6BX 5D5QA 4HIZA 5JECA 5A5FA 3R0XA 2DERA 1STOA 2Z04A 2JKYA 3O91A 4FFBA 5ERGB 1P8AA 2ZB4A 4BECA 2QT0A 1GPNA 1DKPA 1ESDA 3GC6A 2FGJA 3ZJTA 5F9HA 1XRRA 1RZRD 1GZ3A 3OTQA 1A77A 1F6DA 2AMLA 2H7XA 4LZZA 1BVYF 3NH6A 5ABPA 5IW8A 2ZCVA 3S7ZA 5I9SA 5HMLA 1XXLA 5GZ3A 3FPFA 2WTMA 2Z1MA 2WJPA 2VHYA 1V7PC 1SQ5A 3H6GA 1P6QA 3OCYA 2GF0A 3AR4A 5TARA 3SWWA 1QH9A 4MWEA 4F06A 3CCBA 5AHXA 1AB5A 1FW8A 2C2XA 4RPKA 2Q27A 1LDGA 4DHEA 1PKVA 1JSZA 4OHBA 4YYZA 2WRZA 2J87A 4CLHA 3CEAA 1NR1A 4KR7A 4HLQB 4WXHA 1E0SA 4IV5A 3NUGA 4M7OA 4S0XA 4DTIA 2WJIA 5D87A 4B44A 2GD2A 5DI3A 5F5XA 4D80A 3CVYA 4XWGA 1N7IA 4WGGA 4WLNA 3W04A 3FW1A 1CULC 5AW0A 4QJ5A 1XRSB 1Z0ZA 2C9DA 1W73A 4MWOA 2W2XA 1T6XA 4C43A 2GPWA 2JHCA 2VPIA 3ZQJA 3LOUA 3LUAA 5KNCA 1E4EA 1UBMS 1L7PA 1DRKA 2JCVA 4QRDA 4RGYA 5IF3A 1O03A 4MV9A 3BXEA 4OM7A 1UIMA 1H2YA 3LG2A 4JOCA 4KGVA 2I33A 1QVRA 3EWIA 2HMVA 1USIA 4HHEA 4YRMA 3DEFA 4P81A 4URYR 3VR4D 1AX9A 4DJ5X 2FXVA 2P2LA 3ZQ6A 2IKQA 4XKVA 2XKBA 4G9GA 1QRTA 2QN6A 1CLEA 5U1PA 4TRMA 4WMLA 3LZDA 1MG5A 5C8DA 3E35A 4WBNB 1RPNA 1I5EA 3G8BA 1N0WA 2C4UA 2IOYA 2JATA 3CUUA 4ZAGA 1OBOA 3OOYA 2UKDA 4HAXA 3VJMA 4DWJA 3AEUA 5FFNA 5JPDA 4RJ2A 4ZJZA 3BZBA 1IU9A 3ETGA 4E5YA 2FN4A 3EBPA 4DXDA 4NFHA 3T5AA 4YY3B 4W5RA 2JHPA 1E1RD 2RSLA 2W7TA 2GRUA 1W0KD 3AJDA 2OBSA 1QP8A 4WCFC 3R0QA 2LTAA 4YT8A 1QRAA 2MYTA 4LN1A 2WKWA 2Q50A 4Q03A 3GRVA 4DZZA 2ZUCA 5IN4A 3KVVA 3LF2A 3MWYW 2CKMA 4MVJF 4DLZA 1G21A 4W5JA 4YACA 5HOQA 4R31A 1EIZA 3SICE 1LI5A 1YZGA 2JDIA 1ZRHA 5DSTA 3DHNA 5JBNA 5GGYA 3FOFC 1U8CB 2HF7A 3GVKA 4MLZA 3W6PA 1E5LA 2FY8A 1NGSA 2C0PA 3ZG6A 3FKSA 4BDSA 2PZ8A 3SLNA 1YCDA 2D00A 2AN9A 1KDRA 1WHSA 3R3WA 4F1WA 1GKLA 3GLFA 2BJHA 1YASA 4I5IA 4YP5A 5AJUA 3DHEA 2QM7A 3QFHA 4KNVA 1WDKA 4MYDA 1AMUA 2FXIA 1WOSA 1VLHA 5AM2A 3DG9A 4AULA 3JYQA 5GIOE 3OLVA 3L6EA 3RT1A 1Z7WA 4FCTA 1E2DA 1C3LA 1RR6A 2O2HA 3BFVA 1QOPB 2I4OA 3R3YA 4OHXA 4A27A 1YR7A 2IPLA 3GEEA 3DZIA 3OM9A 3EB9A 1YZKA 2X8JB 3H9QA 1NQVA 4E5MA 4BP3A 3R3ZA 5EMJA 5JD5A 1BCSA 3X44A 5B53A 2OAP1 1NRXA 3NKVA 1KOLA 5CA1A 4QDXA 2HDHA 2HIAA 3AO0B 1UIRA 1P72A 1FYVA 2UVQA 4LPSA 3RRJA 4NE2A 3SJAA 5SZJA 4DMKA 4NBLA 4KU4A 3FPKA 2F1RA 1Z0SA 2FW6A 4KBYA 2KLBA 2PL5A 2IQIA 1XR3A 2C1EA 3A6EA 5AK0A 3O2SB 2E0IA 1FUYB 1L4HA 2WD7A 4KGDA 3X1MA 2DBYA 1JG7A 4F92B 2R6DA 5FI1B 4QXAA 5TS2A 2IL1A 3P96A 5EE9A 5KYNA 3NT2A 1BHJA 2R60A 3TK1A 1DBWA 3RFUA 4ES6A 1JEYA 1PTJC 1T9ZA 1YCHA 3ZCTA 1NP6A 1VYHA 5SV2A 3IC5A 4M99A 3N6VA 5JD4A 3II6X 1JDNA 4YROA 2QZSA 4BDTA 3GT0A 5IDVA 4PSVA 1XKXA 4MH0R 5KB3A 3VR5A 3B13B 2EDAA 5DNDA 5H7XA 1ZJZA 3EASA 5KYGA 5K3OA 3MBIA 4D45A 4OBEA 1G6KA 1ATIA 3KJNA 2NZUG 4JD5A 4Q6WA 4QECA 3LYHA 3RBZA 4ESOA 3D54D 4QUJA 4DCGA 5IULC 1E2KA 4A03A 3G0GA 4BBZA 1DKQA 4B48A 2V7UA 2GZHA 3BKXA 1NPDA 3EC7A 3C43A 3BDAA 4BO6A 1V26A 2BZGA 4ZOBA 2B2CA 1IQUA 2Y9MB 1C9MA 2VAWA 3T0FA 4F96A 1YL5A 3U4HA 2WJWA 3W4IA 1M6VB 2AC7A 1VQ6B 4XQ9A 1EEXB 1EXNA 3ZWOA 5CIYA 4IZHA 4QKQA 3CVWA 2GUWA 1PL0A 4JB2A 3G02A 3BFJA 3PUNA 1J2JA 2H3HA 3NYQA 4HNHA 1P2BA 2IYXA 4J16C 1T4BA 4MS1A 4KR9A 4BNDA 2DRIA 1NVBA 2ERXA 2XMRA 4GR5A 1BGXT 1DKUA 4DRXB 2LCQA 5I7EA 3IT1A 1PJ4A 3H0EA 4Q3NA 5J4LA 3MJDA 5B6IA 3WQZA 1XZDA 2C2KA 2VSFA 2D4AA 3WLAA 5HIMA 3AETA 5KNBA 5I9LA 1M2HA 2CK3D 1LPBB 3F2VA 3JD1A 2JRCA 1UBRS 2V97A 4ZI5A 2UDPA 3H86A 4NK4A 1YTLA 4UNRA 5KYYA 1C7ZA 4FR5A 1OT3A 1P91A 4C87A 5JBIA 5LNK6 3OPOA 2VHWA 3P94A 5FV7A 3P9XA 2PFKA 3KKEA 2BISA 2I2AA 1M54A 3KHUA 4UZSA 3W5UA 2IVFA 2NZWA 3ITNA 4Y6OA 2NZ8A 4BO9A 3URKA 1QU2A 4G65A 3ABRB 1M2NA 1Z4MA 1GG8A 2DG2A 3F97A 3ACCA 4X8MA 1DEXA 4DUYB 3KEWA 4ZWNA 3N2KB 4JLPA 4DLBA 1WPQA 4XARA 1N8RD 4I19A 4KKSA 1IY9A 4NZNA 5JE8A 4ZDJA 1HEYA 1USWA 5JSKA 3C6XA 5KQSA 2FEMA 1W9XA 1MX3A 3RODA 4CIDA 4PX3A 1V8FA 3NDJA 2WW8A 1DX9A 1JKXA 1E7YA 1JFVA 5A4KA 2XF2A 2V1XA 1T0UA 3GQBA 1GQOA 3EWAA 3F9RA 3QELB 5CHEA 1R6BX 2I5PO 3GO4A 4YJHB 4B4VA 2W2KA 2C8VA 2WHEA 5EY5B 4FBMA 5A62A 1D6NA 4TV9B 3WQBA 3H1PA 4HNGA 1MQAA 1JQDA 1PFYA 2PFSA 1E3IA 4ROSA 5JS1A 1BGWA 1QV7A 3DM5A 3O9MA 4M9XA 4EGQA 1VKHA 3DE4X 2GAOA 1ND5A 2WIAA 5B7QA 1EP2B 1PQ4A 5HP4A 2F1JA 5I8ZA 5IBPA 5D1NA 2XB6A 1L4LA 1R4NB 3OE7D 4CW7A 1HQYE 2JBAA 5FYDA 3TCNA 2E49A 2IPNA 4IBOA 4W8HA 4CV0A 4I1PA 1F2UA 4OL9A 1R4AA 3K9LA 5GONF 3HM2A 1KY3A 2VIIA 1D2EA 3JRNA 2XOKD 5I9NA 1G0OA 5KYUB 4PYLA 1ILEA 1X7YA 1YJCA 3IJEB 4KLRA 2WUVA 4KXUA 4PGGA 4FB5A 3GLGB 5HK9A 1ADBA 3N8IA 3OZWA 2WABA 3GDGA 4TS9A 1IPFA 2VJNA 1AZWA 5ALTA 2IQ5A 2ZPAA 3B6EA 4RHXA 1EWQA 3R3JA 4AWAA 1JKFA 2AOTB 1GPYA 3MWFA 3VNSA 3SEJA 2OD7A 4MEJA 1P44A 4YMLA 1FE8A 1KS2A 1E5XA 2C9MA 3NHFA 1DO2A 2BP7B 4Q1AA 2PKWA 1Z9BA 3PA1A 3ULKA 2ZZMA 1FSPA 2BTEA 4K7JA 1IHYA 1VQ4B 1Y5RA 1Z4KA 4FZJA 1O6CA 4TKVA 4PN7A 1Y7LA 1RSZA 1JHUA 3HY6A 3QTBA 1DFIA 4P92A 5EJ5A 4E15A 3E53A 4PX5A 3TL2A 4LZJA 4ARZB 4YMHA 3UAXA 2CL7X 2OG1A 3AUTA 1YB1A 4B75A 4QXMA 4RDLA 16PKA 3BRWD 4E3ZA 3TM5A 1UDXA 2R0QC 3G05A 1B16A 2A88A 1DC3A 2ZT7A 4BKPA 2ZUBA 4BNUA 4ZV4A 1G18A 1W75A 5BV1A 3C14C 5FLXA 5ITVA 4DUGA 2QZ9A 1T0HB 2C97A 1NP3A 4BB9A 4TSFD 5TY0A 3DEHA 4U63A 3QTLA 1GU0A 4WKBA 4FNMA 4IOKA 2DKNA 1RWVA 3LDFA 2JFZA 4MQ5A 4KITB 4YRZA 1T34A 4Y7DA 4CKEA 1FUIA 1E2EA 1P7CA 1K08A 2QTHA 1KBOA 1M6NA 1XOIA 3P0RA 3PJRA 3PFIA 4B3TB 1KZ4A 2IDZA 2H52A 4IFTA 1JHPA 5ECWA 2LDXA 3R0JA 3ZTWA 1U2TA 2BSQA 3JTEA 3D6FA 3DGFC 1KI2A 3KOYA 3R23A 2DQZA 1S96A 2DPXA 2QW0X 1XTJA 3EAGA 4UULA 1GR1A 2IHJA 2EF0A 2X4DA 5ALXA 2Q1YA 1OBHA 2BUAA 4JQZA 4NMXB 6REQA 1M2OA 3ECSA 4RA9A 3AVTA 4PO9A 3G9UA 4PIPA 4CDRA 3IIEA 2HU8A 2TMDA 3LJKA 4ZK6A 1DTSA 2DFVA 4FYMA 4O25A 5FCDA 1P0CA 2XAAA 3WL5A 3GPLA 3DOJA 4GDFA 2W2MA 3WIBA 5AW3A 4UTRA 1I3NA 2NSHA 3F3KA 4PHTA 1QRRA 4P53A 4TWZA 4QU9A 3R7AA 4H7JA 2WAOA 5A89A 1M6EX 4H35A 1E0KA 3SAJA 3TQCA 3ZI4A 1BVHA 1UT5A 3WLTA 2VOJA 1Q77A 2WPDA 1LH0A 2J59A 5IYPA 1T8PA 2GZ3A 1FXWA 2MSLA 1U2EA 4ZANA 4Q4LA 5KZMB 3OLXA 1H2WA 1V4BA 2DFTA 4D0NA 4J0GA 4S1PA 5ARBA 1SZCA 4JROA 1XCBA 2ZWMA 5AW8A 3KSBC 4L8GA 1XG5A 1PK9A 1AXGA 4D4HA 5F21A 4GKJB 2J4CA 4HS9A 4AKIA 2C8JA 4RCZA 1JQBA 1TU4A 3UWPA 3KDSE 1UBLS 3K8QA 3AINA 3UQZA 5KVCA 3A2MA 2F90A 4JB3A 3S40A 2HHLA 2Z5FA 1EI9A 1N2EA 4FK8A 2PZLA 2Q8NA 4R8MA 5A04A 5K8JB 3S99A 3NG1A 1D1NA 1CB7A 1HE4A 1C7EA 3IIJA 1Q3TA 3RANA 2V8BA 5TVGA 1ZU4A 3VVMA 5KUTA 1UDAA 4WLFA 3QEAZ 1DTWA 3EX7C 2FFQA 2C5EA 3DHWC 4H7HA 1L7NA 2G63A 4UMEA 4PWYA 5IANA 3CRNA 1SCDA 3D8UA 3ADPA 1XEFA 3O31A 3CX8A 4F1JA 1X1CA 4N5LA 4RELA 5EP2A 2W0MA 3SR4A 2E5LB 2Z83A 3JAKA 2QVYX 3DE5X 4YASA 2HQBA 3D2CA 3SXPA 4RTSA 4NCKA 1J00A 3N8NA 1QNFA 4ROTA 5FA5A 2YOHA 2YVAA 4INZA 1FU7A 1RM0A 1W76A 2HJVA 3OCWA 4Z0HO 4DLXA 3L1JA 1ID1A 4W6QA 3U31A 2W71A 2ZJ2A 2PVCA 4ROXA 1GA1A 2Q6VA 2W4MA 1R0LA 2YWCA 3OETA 3PC3A 4WL0A 5SICE 3RS5A 4B33A 3FMIA 5KCZA 3IEMA 4DMRA 4MR9B 1MKYA 5CX1A 4V0LA 1NC1A 1P9RA 4J4HA 3OQ6A 2WR8A 1ZA2A 2L17A 3D9QX 3GY0A 3H83A 3T7AA 2Q0QA 4IUCS 5LDDC 4G09A 2GPAA 4V02A 1I4OA 5BV7A 3VC2A 1EDZA 1EJBA 2QVLA 3HFGA 4FYJA 4E07A 4K6HA 5C9ZA 2ZM6B 4EUHA 1R6XA 2FPKA 1PJTA 3DV9A 3UUFA 3K35A 1W49A 5BV8A 4P22A 1NFRA 4Z9AA 3RYIA 1QIEA 1D3AA 3DEKA 2JAQA 3AUYA 3P9KA 4LJ9A 2BI4A 3RKUA 3UHOA 3JQGB 3AKZA 1XZMA 1DHRA 3A28A 1G8YA 1CW2B 1QK3A 5IT9A 2MMGA 5AHKA 2R6FA 5E6SB 4LY3A 1RWKA 2VJOA 2HBQA 4DMLA 4DV5B 1TAHA 4D4MA 1KJZA 4NCNA 1DAIA 2ZJ4A 1LSJA 1WDLA 4MYRA 1NMZA 2VPZA 2EVWX 2X77A 3H97A 4JP8A 5C34B 5IJ0A 1XHFA 5A9RA 1EUZA 1GTZA 3HWRA 1JF8A 3LT2A 1EM8A 4QGGA 2CYCA 3HWSA 4IIHA 3GROA 1U5AA 4G25A 4I5DA 3CF4A 3O8QA 4GWKA 5TC4A 1AHNA 2GLTA 3NM4A 4X45A 2RIRA 2FYTA 5JBQA 1NQOA 1K7EB 4DB4A 4GVPA 1F8YA 3KLNA 3T1HB 3HP7A 2DAPA 4LKOA 2XMBA 5JSUA 3FOCA 3T7RA 2F3SA 1NLFA 4G0NA 2WIBA 4NMWA 5DKFA 4ZT7A 1UOQA 4WLUA 1N34B 3ILXA 4IUDS 3IUYA 5G0SA 4BO4A 1SCNE 3DL4A 4ZGBA 2GFIA 1DPFA 2ECOA 1RHRA 1PFKA 3CD6B 1L5SA 1QE3A 2VP6A 5K51A 3ZU2A 1WUTA 5K20A 2FLVA 3D0RA 5AW2A 2IFTA 3PKIA 1GAEO 2VAMA 3DOIA 4V39A 3KJHA 3C8DA 3RC7A 4AIRA 3FDJA 4YRJA 3TLXA 1WEKA 2WF9A 1E69A 2A0YA 5KYVA 4C0XA 3L84A 3KWFA 2RAPA 4MDYA 2ZR7A 4MIEA 2ACKA 2JLUA 3VPFA 2KLHA 3R9XB 1G8PA 5E1MA 2A0WA 2Q4RA 2WYOA 2WOOA 4Q1DA 4IP0A 3CCLB 3O3NB 3KLPX 2YQ4A 3B9QA 2WTNA 3QOYA 4CT0A 4Y6GB 2IYNA 1VG1A 5TMDA 2OR3A 4MVJM 3HKDA 1IXSB 1Y37A 3DWEX 2C2WA 2IHBA 3N2GB 3QMWA 4PSAA 4Q1CA 1N6HA 4Z4WA 1ZH4A 3CNHA 1UBJS 2ES4A 2Q5CA 2XDAA 2OYSA 1VKJA 3BWEA 3R40A 1XFDA 4HAIA 3R7LA 4BLPA 2WVJA 4FBGA 4ILEA 3W6OA 5LA6A 3JWGA 3PGMA 4YI5A 5I9BA 1Z3IX 4OI1A 1XXHA 2GEFA 4KR0A 2AQ8A 1NVVQ 3IBFA 4P35A 2Z9BA 3I73A 3AK4A 3DBVO 1WXDA 3WLLA 3GEIA 4B6OA 5D86A 4HDQB 4HEA1 4LGVA 2H7CA 3IHWA 4HNAB 5B7GA 3UMMA 3O82A 1AKUA 1GTSA 1QAMA 1NW7A 3JU4A 1LPNA 2BZ1A 4G4JA 2DCUA 4X8OA 4L22A 3ZHXA 1X87A 1VQKB 4QJBA 1RWNA 4DRZA 4W7IA 4F71A 4AQ7A 1UXKA 5JLAA 3WLPA 1L3IA 4D3XA 1TUGA 3MD9A 1DJLA 3AHEA 3VTAA 3C4JA 2QJWA 1B8OA 3PQ8A 4NL4H 3SKYA 1UQUA 2ZRBA 3HBJA 3PSAA 1YDWA 3AHDA 3LI2A 1G3MA 5TPWA 3D8RA 3MSCA 4B6GA 3L7KA 4AP6A 1E79D 1BEZA 1JR3E 2GEDA 2VUUA 3MN1A 3PC2A 4LAFA 4B4OA 9LDBA 3CVVA 1GUBA 3G7NA 3ZPXA 2MSNA 1OZ0A 1LQUA 1V43A 2AH5A 4A3SA 4ISBA 2AW5A 4GPEA 1NATA 5E4TA 3GGPA 2YHSA 3NHZA 1Q1EA 4QU5A 3WS7A 2DTXA 1NZDA 3LUCA 1YQXA 3D3WB 5F9FA 1SVNA 1YS1X 3ENVA 1IHOA 3MJHA 2JS7A 1MR3F 1EMDA 2QMEA 2E4WA 3RYFB 4EDHA 2MSWA 4OYRA 3Q8WA 3KZMA 1TUBB 1XVUA 3QSYA 1IOLA 2A57A 4PICA 1Q0TA 1AT1A 1GCAA 4FWTA 1U8TA 1BXZA 2Q46A 2PK3A 3NORA 3D4IA 2FU5C 1C1YA 5E0OA 2BHLA 3DUFA 5JU6A 4BJ6A 1VC2A 4UD6A 5BR1A 4RTPA 2OMEA 4N3GA 1ISSA 3FVWA 2VNHA 3HEBA 2BMVA 3T7JA 3X1WA 1B74A 5DDIP 4BC0A 4MPPA 1SHZA 2NW6A 1FTQA 5ENVA 1Z39A 2JLQA 2IWRA 3PDIB 4R2HA 3HKEA 2QMQA 3BERA 3DW1X 4JITA 5ALMA 5IG2A 1AN0A 2Y6UA 2J9FB 5MGNA 3GFGA 3TXAA 3H3JA 2OHFA 1PK7A 1KI9A 4Y9SA 3MRVA 5CA0B 1CDOA 1H2BA 1K5GA 3TCKA 3JALA 2EARA 1EA5A 2A67A 2P2GA 4WT7A 2CBGA 3JVUA 3KQMA 2XYQA 1Z2DA 4F0JA 4NNOA 4Z4QA 4RVSA 3G4SB 1ZMOA 5EP4A 1F3OA 4P4SB 1ACMA 4QDKA 2ACVA 5CT4A 5FBVB 3PFCA 1DQNA 4MUJA 1W4LA 4G8JA 5GVRA 2FSHA 3KIPA 4TTJA 2VF4X 4KAAA 1BH2A 4FZ5A 2QMUA 5F78A 4B6SA 3ZQ4A 3DSRA 1M34A 5CBKA 1RYYA 4LJYA 2FEPA 1AS0A 1QCZA 2D06A 3ER8A 3WNQA 3LZ6A 1P19A 2I6UA 4O8ZA 4ND2A 1EWKA 4B74A 5FL3A 221PA 3AJ9A 1E3MA 4O4JB 1LX7A 3R8FA 1B3BA 2XGSA 3N0RA 2FSGA 2VHZA 2OUKA 4PZYA 4G86A 4EG0A 4CODB 2AFHB 2PQ2A 3PFFA 4M54A 1RYBA 4GSLA 1ZK0A 3E22B 3T1OA 3H2GA 1K3TA 2IXFA 1OR8A 2PPVA 2RHJA 4DV1B 2WZNA 4CYMA 5K6TA 3T38A 2AFRA 5CM9C 3BY1A 1WNTA 5D85A 2I03A 3SBOA 1O6BA 1IZZA 2EL7A 3QEJA 4W1PA 2JJ1A 2CUKA 3VDNB 1XU7A 4QDOA 1MB2A 2KB0A 1JAZA 1Z47A 3K32A 4KVAA 4MKXA 1LF0A 4MRMB 4X62B 2DQSA 1J5EB 2QT9A 4X24A 3UVEA 1SJ9A 3LPLA 5H80A 2WVHA 4EOGA 5JQWA 2XCQA 3DXZA 2Q7OE 2VAXA 2FDRA 3MHPA 2QD1A 5G4KA 3KVYA 1G59A 2C3YA 2EIXA 2D13A 2Z8XA 3K1AA 2RFLA 3NATA 3KT0A 4LV8B 3ZW7A 1JG1A 3ZDFA 4BQIA 2QP9X 3RHTA 4E14A 1MB9A 3DH0A 4NATA 5ILQA 3BGDA 2EYUA 2ZSBA 4OB8A 3KKOA 3UTDA 1P4JA 1ZAYA 3UFBA 1PZEA 4IYJA 5DCUA 1GL3A 1D6SA 2ZSKA 4I50A 4L74A 4CEIB 1WTAA 2PKRA 3EC2A 2J3KA 2ODWA 2IWHA 4M98A 1LCIA 2WHRA 4PZ0A 1WU7A 5TRTA 4G5GA 1KYVA 3QQPA 4JR1A 4F3YA 2PWAA 4O4HF 5JAHA 2GPYA 5JWOA 2XVZA 2V7WA 1K73D 1Z62A 5C5IA 1N1DA 1Q12A 1RXUA 3PLRA 4UZUA 1BCRA 1BTOA 4R05A 1X1DA 3VKVA 1IM2A 3I6YA 5GWXA 4HL6A 1Y3FE 3GG2A 5K3BA 2HA3A 2AD1A 2PA0A 1Y4SA 2FW9A 3L8FA 2AK3A 1TK3A 2X15A 5K6AC 4G8DA 2W8BA 4XYLA 4ALNA 3EYWA 3QVSA 4PS0A 4AI6A 2HXSA 3P9YA 2P27A 2ZJ1A 4X6YA 4ZXFA 4EW2A 4XN3A 1XD2B 5JYEA 4DARA 2EWWA 5B58T 4M7PA 3MRSA 4HPJB 5LOVB 4NXNB 1XO1A 3QF4A 2GXAA 1I1NA 3VNBA 2WMNB 2ZR8A 3UG6A 5DEOA 2K87A 2Q5OA 1FF9A 2VNKA 1H66A 2AFVA 1VECA 1MFZA 2ZIFA 3BMOB 3OU7A 4M88A 1Z0JA 4A0SA 4K5QA 2QL7A 3LX6A 2FVGA 1YWGO 3BAZA 1TW3A 2K4MA 1QK5A 4HZUA 3RC2A 1UKZA 4BBJA 5A4DA 2BHTA 5LJLA 3CPHA 5GV8A 2IW1A 2WSSA 3E6AA 3K0CC 4QC2A 4RHUA 4AN0A 1PKEA 4YXFA 3U4CA 4DIBA 2J5QA 3KM0A 1ECPA 4MV6A 4JIGA 3COPA 4A92A 3KCNA 4FMDB 3W8EA 4XONA 3E9EA 2ZUVA 1Q0SA 1Q1ZA 2JW5A 3GHHA 3RO7A 4D98A 4KB5A 1W36D 1BDJA 1VZ3A 4Q5IA 1THMA 4ZRMA 4XW2A 4JEHA 4X1YB 4R3WA 4ENRA 3AKDA 1FFXA 3MWLA 4HT3B 3PIIA 1S8FA 2IYFA 1A8IA 3WQRA 2P65A 4GOJA 2HRCA 2H7YA 4RGBA 3RSFA 2J9ZB 5CNIA 5A5EA 4DDTA 1EG7A 3O94A 4GE3A 1QVZA 1QFYA 4H77A 4AYWA 2WHPB 1RLMA 3HB9A 3UV6A 3R5JA 3RNLA 4CF7A 4WZKA 3PNLA 2OCKA 4YJ3F 5FF9A 2I1VB 5JCXA 6YASA 4J4BA 4B17A 4JYPA 4PFJA 4CQLB 3REOA 3BM5A 2WD9A 1JQAA 4JCOA 3RSSA 3MD0A 1IXYA 3ASSA 1HEIA 3OJOA 2ROQA 5IBCA 2I4IA 4X06A 5F7ZA 4B2IA 4KR2A 1JI0A 1CR4A 1QIIA 4WESB 3F2IA 3A6DA 3MRTA 5BWCA 3TG2A 1VMDA 4OOVA 3N0WA 4RF5A 3AHIA 3SFTA 1N2OA 1O94A 3H6HA 3VYVA 4DJAA 1DT5A 1Q20A 2PSHA 3SYTA 5LMCA 1QO9A 4RD4A 4PY2A 1C9KA 2B1JA 4P1VA 4AJPA 4FILA 3ZU5A 5DCYA 1AHPA 3V2UA 4JI0B 2DQKA 3O26A 3BREA 1SUCA 1ABEA 1X2BA 3T0IA 2FPLA 2G82A 2HK9A 3HA7A 4XD7D 5LR6A 3LT4A 2ZUWA 5C7YA 4XM3A 2N0SA 1H3EA 1YQQA 1XQ9A 2XUGA 1UPTA 3CX3A 4DG5A 4GI7A 3VR4H 3ZZ1A 3ICEA 2QXUA 1YQGA 2VJMB 2AMVA 1TK2A 3IUPA 3KJFA 3DBHB 4KIJA 1VXOA 2OORC 3GGGA 3A8JA 4R69A 4M9SA 5EJIA 3UH0A 3WKCA 4B45A 4DSAA 4E4RA 2Z8ZA 1SVLA 1JJIA 3P9RA 1AIPA 1ODLA 4AF7A 1I5OA 1QTNA 2IUFA 3WRXC 3C5EA 3WNBA 1FUEA 5FPHA 1GUYA 4MQBA 4DAOA 3KT6A 3LWDA 1MIOA 3DXXA 2GN6A 5FOUA 1YOVB 2QLFA 2O7VA 4GXTA 2X0RA 1KK2A 3QXHA 2RJOA 1YK1A 4GGOA 2NU8A 4GZ5A 3H65A 4FQ8A 3GLRA 2HLDA 4HC4A 1DRVA 3KOXA 1T5OA 4GKBA 4A15A 4B3XA 4ZAXA 1LZLA 3DE0X 4BV8A 1NQXA 3K1JA 5BVHA 3VA7A 4K1LA 3L02A 3S3TA 2G0NA 5JDCC 5H83A 2C03A 1HLDA 2HMTA 3CUEF 3ZIAA 3RK0A 4UUMA 2P5SA 1CIJA 1KY4A 3FDFA 4KZKA 4OQFA 5KC9A 5FNVF 4MR8A 3ZWVA 1M1YB 1Y63A 2JH8A 3FYCA 4O2RA 3WRYA 1C7QA 4NQZA 1A8HA 2DECA 3RFVA 3EGIA 1K5DA 2OBMA 4BBAA 5K0BA 2BKUA 2VDMB 4Z7NB 1WXQA 4IIUA 1J22A 2F9FA 2R7KA 5JR3A 5KQLA 3W5AA 4D0LB 4CDNA 4AICA 5IKPA 2ISQA 2H11A 3Q7QA 2ZATA 3PE3A 1E8NA 1YR8A 5EXTA 5LD2C 5K1ZA 2VDWB 3FPBA 5TF0A 3TYXA 1BLIA 1WORA 2CJPA 1L3BA 2SKEA 4REQB 1VHJA 3CZRA 4A6XA 4ZXPA 5ITZA 4RX1A 1X1RA 2B2XA 4GXQA 1G5PA 4MQMA 2IH2A 4ZGNB 1SRQA 3KR1A 3FWPA 1RQNA 1T9AA 2RBGA 4RVNA 4C78A 2P9CA 1NU6A 1JE1A 2QTAA 3FPJA 2IYOA 4G36A 5E7JA 4C9BA 4MUGA 2GK4A 4RJJA 4ZHQA 3T4XA 1TQ2A 5ANRB 3W7BA 3ZHYA 2VYVA 2CNBA 3L8EA 2B20A 4CR7A 3WDLA 1P9LA 4I5GA 1XMXA 4BGVA 3C1AA 4JGGA 4LSGA 1CY0A 3SIPA 1PR6A 3ZVKA 3PQ6A 2HEIA 3KYIB 3WC4A 1M2EA 5LM3A 2C7OA 5TNXA 3EZXA 3ESRA 1CNFA 5EUQB 3TL3A 4CM9A 3IR6A 5AK3A 3U7GA 1AQNA 1JA0A 4Q3DA 3T5BA 1RVV1 4JLKA 3BFXA 1N25A 2HJ9A 3ZCVA 5AVKA 2A86A 2XBLA 5D6OA 4X7BA 4TM7A 4FP9A 2C2HA 5A5DA 3TIIA 1F5SA 2CZQA 3K1YA 1SC1A 4WKNA 2PWPA 3KL4A 3V8NA 4G0YA 4HB3A 4F4IA 4ZYXA 3JYOA 2A6PA 3PWTA 4NCHA 2QAJA 2V45A 3CUVA 4FCVA 3MWEB 3K16A 4MV0A 1FP4B 3UBMA 3Q41A 2UXDB 1N1EA 3AOEA 2H5LA 4FKBA 2R1TB 2VDQB 2AZDA 3ORRA 3VR3A 1KIMA 3UA4A 1EFVB 2O0JA 5T7BA 2F8SA 4OP1A 4K2HA 2WTEA 5REQA 5BOSA 1SVMA 5JUWA 4F9EA 4C7OB 3GLSA 3REQB 2JGDB 1I7PA 1YJAA 1TT5A 3TOSA 4K46A 2A9JA 2R6JA 1TTHA 1W2HA 3V33A 3A6ZA 1PG5A 1DC6A 1ZUHA 1V8BA 1VI6A 2PKCA 3BF7A 1TA9A 3M9XA 4AO6A 4Z7QB 3WKEA 1KZYC 3ZWAA 2YDYA 1JT2A 4NCBA 1N75A 2Y9PB 1UKAA 1KQ3A 5JQGA 3M1YA 1I3MA 1Q11A 2OHGA 3C8ZA 5G0WA 4ZREA 3VC3A 4A2QA 3VXKA 3BH4A 1L8XA 4DQVA 2JGKA 1PFGA 2PBLA 3B1YA 4UVIA 2R8BA 4G01B 3JX9A 2YV2A 1DIBA 4GPD1 4HMOA 4RY0A 5TX7A 2HNAA 2YWFA 1QIJA 3U40A 7REQA 1Y6RA 5IASA 2FW0A 4LUCA 4ND1A 1DX4A 3IV9A 4JKYA 4TUYB 2QRZA 4HY3A 4AYTA 3LP5A 4PR3A 3CCCA 3DZJA 1NASA 2B7BA 4D82A 3MZ0A 1Z36A 2ZTUA 5KOYA 2AIRA 2ATXA 3TKLA 1JZTA 2GHRA 5D3MA 4ZARA 4ZT4A 3DKIA 2O1SA 3TLCA 3CB4A 3M5PA 1BMDA 3TSYA 1I7LA 2DCMA 3MINA 3UXHA 3DDNA 1G9XA 4RPHA 3OG9A 3RJZA 1N4DA 4PPQA 5C4IA 2GCIA 3A1EA 1MQSA 3VH3A 3EXEA 4UKDA 4CM6A 2C3PA 1JEEA 4EIWA 1GWNA 1KKUA 2DWUA 1Y89A 2WFLB 4YCDA 5ALZA 5D3ZA 1HDRA 4FDMA 1CRPA 1LJUA 3SSNA 1TYEB 3NPAA 5CHYA 4BZQA 3AVQA 2VN8A 3P52A 1NB0A 1QBKC 3X1ZA 4DY6A 3FIJA 1JQJC 3NHSA 2X41A 3SXUB 4BB6A 1W7AA 1JJVA 2QR2A 1YE5A 3KTFA 2RKWA 1C41A 4H9GA 5AKZA 1BWQA 1KMIY 2UVPA 1A9YA 3VTKA 2QVGA 5AVVA 1I7QB 1QFSA 5C4MA 3OZGA 4HKTA 1VGVA 1IOVA 4NQRA 5EIOA 1M72A 4FFDA 1A2OA 5DNYB 2ZB3A 4AG5A 5EKSA 3QPWA 1EM6A 1KPHA 1RI1A 4AJ2A 1T4GA 3IQHX 2OQVA 3L79A 1ZGJA 3KZCA 4DPLA 5JXHA 2F43B 2R62A 1KBZA 2RHRA 1XTQA 1H5NA 3JXEA 3NLLA 4H0FA 4DLNA 4WOKA 4LG1A 4EGAA 3IMEA 3Q7IA 2R8YA 3LW8A 5C46F 2V3CC 3RC1A 2FDCA 3TMYA 2QE7A 1W46A 3G23A 1X7GA 5GZ6A 3IBGA 5LP6A 1OXXK 2B9VA 2ZTLA 4PHGA 3ME5A 3PVCA 4DSNA 2Q8PA 5ESXA 2OD9A 3RVSA 3F8TA 3PQ2A 2RHLA 2WG1A 4YH1A 3QUQA 3LUBA 3ORFA 1JIVA 4U2DA 3QLVC 4HEQA 3BXHA 1NZJA 2J3EA 2X58A 2J30A 2ZYWX 1U9IA 1JIQA 1H6AA 3Q6RA 4GM0A 2QZJA 4P7KA 3PD7A 5IZCA 4BZPA 4PRYA 1A2QA 2AG1A 1EYZA 4I1OA 5C8YF 5AK6A 3W2EA 1DMRA 3PXXA 3WBFA 1RWPA 5FD8A 1UXJA 2AVNA 1OFUX 1RW4A 2ASEA 3PNOA 2DF8A 1UFOA 1YZHA 3FJOA 5L7YA 2D54A 4RA6A 1QIKA 3A3KA 4UDNA 1A96A 3H6KA 5CFRA 2ZIZA 5CURA 5FQOA </