3ZC3A

Ferredoxin-nadp reductase (mutation s80a) complexed with nadp by cocrystallization
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYAIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNEKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title A Hydrogen Bond Network in the Active Site of Anabaena Ferredoxin-Nadp(+) Reductase Modulates its Catalytic Efficiency.
pubmed doi rcsb
source organism Nostoc sp. pcc7119
total genus 88
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3zc3A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3zc3A02
4YAUA 3QFSA 4HE6A 1QX4A 3WNCA 1H85A 3LO8A 1JB9A 3AVYA 2BSAA 1QFYA 2YWHA 3CCEB 1QGAA 4AF6A 2DEUA 4ZCLA 4AF7A 2PIAA 1TLLA 2QTLA 1VQPB 1EFTA 4ZGQB 2BN4A 1F20A 4HE5A 1VQ4B 4ACAA 1VQMB 1KK1A 1W2BB 1GAQA 5TV2A 1QFJA 3P26A 1R5BA 1ZUNB 2VNJA 3CCQB 1K8AD 4YALA 3OJWA 5DSZA 4ZCIA 1R5OA 1GJRA 1B23P 1BQEA 3B78A 3FPKA 2BM0A 4Y9RA 3U6BA 3W2FA 3QE2A 4PC3A 1KK3A 4FK8A 1I7PA 1TUIA 1E62A 3JQRA 4Q7JB 3ZZ0A 1DDGA 2BM1A 4TMWA 1M1KD 4TMVA 4B44A 3QSYA 4YAWA 2QDXA 4BPRA 1E64A 2B7CA 1GO2A 3WXMA 4ZCMA 2RC6A 1EP1B 2PMDA 4TN1A 1GR1A 1Q82D 3CW2A 5EMNA 2E1RA 1OB2A 1CQXA 4RD6A 3W5HA 2VNHA 1K9MD 3B82A 1NJID 2GQFA 4PC1A 3I1FA 2BMWA 4K1XA 3AVUA 2C77A 3P27A 2QMUA 3OZWA 4M2LA 1F60A 5GV7A 1VQ9B 2VYQA 2EIXA 1AIPA 1XB2A 4ACBA 4EH1A 4FWTA 3E1YE 2QEXB 2BPOA 3CC4B 4B4DA 3WNDA 3VMFA 1VQOB 1FDRA 4LBYA 3VO2A 1BJKA 1QFZA 3OZUA 4U9UA 1IJFA 4NBSA 1U2RA 3W2IA 1IJEA 2R6HA 3AVXA 1JJ2B 3CB4A 2QN6A 4DQLA 3AVTA 5GV8A 1ZM9A 1CNEA 3J81k 4G5GA 4NCNA 3I56B 1D1NA 4P3YA 1S72B 1OGJA 4MYUA 5TR9A 2QA4B 2BV3A 2OK8A 3WNBA 1Q81D 4RJLA 1YJWB 1QH0A 4AC9A 1D2EA 2DCUA 1DDIA 1R5NA 2HMAA 2NPFA 1OB5A 1KRHA 4YHBA 3CCUB 2BF4A 1J9ZA 3QFTA 2QTZA 2YWEA 2VNIA 3B8HA 4TMXA 3CC2B 3MCAA 1QGZA 1M90D 1OGIA 3MHPA 4B48A 3A1FA 1N0VC 1KQSB 4ZGNB 4TMTA 1YITB 4PGOA 1E63A 3AGPA 1QUEA 3CRZA 1SM4A 5H5JA 3VNVA 4Y9UA 3FJOA 3CPWB 1KD1D 1AMOA 4QFMA 4Y7CA 1SKQA 4F7DA 3QFCA 1VQ6B 1G7RA 3CXCB 1W87A 4RD1A 1CNFA 1QG0A 1Q7YD 4WQMA 1VQNB 2VZLA 2PLFA 3G71B 1VQ5B 2B5OA 3WY9A 2HDNB 5HXBA 3ZBTA 3CCRB 3CMEB 4C0SA 4MYTA 4M1KA 1YIJB 3U6KA 2XEXA 1W35A 4TMZA 2C78A 3G4SB 1Q86D 1W34A 1G7CA 1FNBA 1GAWA 1IB0A 2DERA 5KSWB 4PC6A 3V76A 1EP3B 1N8RD 4RCYA 4LBZA 2CRVA 2OTJB 4LC0A 2X3UA 3CCSB 5AN9A 3AVWA 3JQPA 4IW3B 4C43A 3LRXA 3CCLB 4PC7A 1JA0A 2VNKA 3CMAB 1BX0A 3QFRA 4M0LA 3OW2B 3E20A 4YAFA 4N3GA 3ZZTA 2OTLB 4RD3A 1ZM3A 1KK2A 2XNJA 1N0UA 1VQ7B 4YAOA 1QUFA 3VO1A 1FRNA 4LBWA 1TVCA 4J0QA 4LBVA 4RCZA 2BGJA 3W5UA 3VNUA 1HA3A 3MMPA 3JQQA 2B7BA 1YJNB 1EFUA 1KJZA 4M4SA 3W2EA 3CCVB 3ZBUA 3LYUA 1KK0A 3AVVA 4RD0A 2BVNA 3OJXA 1QGYA 1G7TA 4R71A 2RC5A 4M53A 1VQKB 3U2QA 3WBJA 1DARA 1JA1A 4ZV4A 4P6VF 1YJ9B 1H42A 4QHYA 3W2GA 3I55B 4G1VA 3PENA 5H59A 1UMKA 1FNDA 4G1BA 4RD4A 2DY1A 4H9GA 1XE1A 3LVBA 1VQ8B 3W2HA 2DETA 3ZC3A 4PC2A 4UAJA 4FN5A 3WYAA 2OK7A 2YWGA 5TY0A 2CNDA 1EFCA 3CC7B 3CCMB 2XNCA 1QVGB 1G7SA 1ZM4A 2GPJA 3CCJB 2ZITA 1VQLB 1DG1G 3G6EB 1D8TA 1BX1A 1S0UA 5JBQA 3AGQA 4N3NA 2J7KA 1EP2B 1FNCA 1YI2B 5FA6A 2BGIA 4B3XA 2EFGA 4DQKA 1NDHA 3WBKA 4B43A 1KTVA 1YHQB 1KC8D 4B47A 3ZZUA 2YWFA 3ES9A 1K73D 1WDTA 1ZM2A 1B2RA 1QVFB 1FNMA 5THXA 3OZVA 1FRQA 2HCJB 1A8PA 1EXMA 1ELOA 3CD6B 3SJZA 4RD2A 1EWYA 2AHOA 3W5VA 1TTTA 1JNYA 2FX3A 1GVHA 2D74A
chains in the Genus database with same CATH superfamily
1FK8A 3L0SA 3QFSA 3KUDA 1KGDA 4DM4A 2CLCX 3M33A 4Q1FA 3RSOA 4AX4A 1RCFA 2F9MA 3HCNA 4JLKA 1I4EB 2QLJA 4Y6PA 3MPOA 3ROFA 3SJAA 3THWA 4MH0R 1Y82A 2ZJ4A 3KTAB 4IICA 1CTQA 4Q1VA 2JD1A 3RUEA 3TTVA 4C20A 1ZJWA 2B61A 3B20A 3M6LA 1BC5A 4XSHA 5ESXA 5FI3A 5ALIA 4DMFA 5HKAA 3STVA 3BMNB 2X6TA 4HQNA 3MGBA 4YUWA 2YWHA 2TMGA 3BE8A 2I1VB 3PNKA 4OG2A 4WTOA 4W4TA 4WE3A 4HB4A 1LNZA 2DEUA 4MHOA 1ZH8A 5L3RA 2W6ZA 4V0KA 3EGCA 4FHEA 1DT5A 1E2IA 4BIIA 4DMHA 2YVKA 1TLLA 2QTLA 1YVUA 3KOUA 1C7FA 4WZEA 1OHHD 5C2JB 3ZUGA 4OUDA 2DP4E 1AKYA 1GR0A 4ACAA 4LC9A 1DOAA 3FIUA 1Z73A 1XZEA 3ONNA 2BGKA 1YRQA 3TUZC 3L7YA 3RRZA 4BNLA 1Y89A 2GVDC 2MSLA 2PA0A 3KZCA 4D82A 1AHIA 4C78A 1GG2A 3OPYB 3OJWA 1BA3A 4F8EA 4CETA 4EKYA 5A3QA 5GTDA 2IUFA 2QVGA 4CMAA 5B5SA 1MX1A 4LHZA 4L4UA 4Q6WA 3TOCA 3R7AA 4CCSA 2H1SA 4X6UA 1NVWQ 4DDUA 3IAS1 4LJRA 1RLMA 1YQGA 2WFLA 5H83A 2EF0A 4PF1A 3O4VA 1JJFA 1JAYA 3H16A 4PHGA 1B4DA 1KI2A 2GCOB 5LB2A 4ZOAA 2G1PA 1Q5PA 2DQYA 3IP5A 4UBOA 1R15A 1ZGHA 2H4ZA 4MMXB 1ZUNA 1LDMA 5A3JA 5KKNB 3TLGB 1DDGA 1KFEB 3B52X 3KQTA 2OB1A 3W6OA 3BYZA 3NHFA 3Q41A 1JQDA 2PLRA 3C5VA 3S4YA 1A3CA 2YIVX 3VC1A 1U4NA 3U5ZB 2IWHA 3L7CA 4UUQA 4OHPA 4KKXB 1M0EA 2QQEA 4G4JA 3PC6A 3L8MA 1K9SA 3GLFB 5HCUA 1USWA 1M7HA 2WSLA 1LLQA 7REQB 3WQRA 4X05A 5H8WA 4N7MA 1EP1B 3BA6A 5CBPB 3OE4A 5CYOA 4G0VA 3KPVA 4P3NA 1LVGA 2BOVA 3PKIA 1NOIA 3T4EA 1G64A 4EYEA 1GGJA 4MGYR 3IHTA 1X8LA 3DCNA 4FGUA 5JRZA 3L82B 4K9DA 3DULA 4QBFA 1HNNA 3MW8A 2RGEA 2K7FA 1O94C 4XFJA 3OE7D 4RWEA 5HUQA 4AQYB 3UUGA 3W77A 1CQXA 4TXHA 5KEIA 3IE2A 3G9TA 4DLUA 1OC2A 1UD8A 1P0CA 2QRUA 3MWEB 1VL0A 4G5XA 4FVTA 4N8SA 3B82A 3I6QA 1J56A 3LECA 3B89A 2UDPA 3F7NA 4KQGA 2JIOA 1ULHA 2EVWX 3K9CA 3ANLA 3C3AA 2LE0A 3HVKA 2VAWA 2GILA 4B9AA 1AZSC 4E2ZA 1QO0A 5FFMA 1E8NA 4IZ6A 4ASUA 2AR7A 3P4XA 1JU4A 4H1HA 3EG9A 1SBZA 4G25A 3GLRA 4FCCA 5ITWA 4GPEA 1KR2A 3Q1LA 4BBJA 1PGJA 2H29A 3P27A 3G2KA 2O0MA 3GA5A 3KLPX 4PYRA 4BVGA 5LKRA 1KS2A 3W3AH 1E3QA 2WTAA 3F2IA 3TR0A 1MVNA 1FLVA 2W93A 4P3OA 2EIXA 4PBTA 5T67A 3ZH9B 5JATA 3WK8A 3OCUA 3NV9A 3NALA 4TV8F 4RULA 1LC3A 3E22A 4C01A 2CXQA 3CX8A 3RV4A 2FW6A 2VBGA 3QVWA 3T8YA 5IABA 1TU3A 2H3EA 8LDHA 3IO5A 3HK2A 3GLHB 1WO8A 2VP2A 4ZDWA 4REQB 4DRXA 1A2OA 2GK6A 1OW3B 1CRQA 2CYAA 3VU9A 3TQSA 2PS9A 2ZTMA 4RWZA 2TECE 5DIZA 2YICA 4AQ7A 3C7TA 2QRQA 1P80A 2A7XA 4BAZA 1Q21A 4F96A 3M83A 4MGKR 1G8AA 3H19A 4MP8A 3VR6H 1BAPA 1I14A 4C7VA 2BSQA 3CIFA 2I1LA 2VAPA 3QEAZ 3SSNA 2IUYA 1ORTA 2VHUA 4EUEA 3AT1A 5EJ6A 4CLEA 2V7UA 3RAGA 3BXZA 3DE6X 3EGVA 3BCHA 3QVUA 1PUJA 4PQEA 5AM1A 3TQCA 2JGRA 2I2DA 3MLAA 5HUHA 3QKIA 2VZ0A 1S2MA 3THOA 2DWUA 4KE6A 1IIRA 1Q57A 1O97D 1GU1A 3K1YA 5CH5A 3F4LA 2GK4A 4MPJA 3PBKA 3QOXA 1I7QB 1U6JA 2QM7A 2JFGA 2L0XA 2IQ5A 4XLLA 1I3MA 2VQFB 3ILYA 4WY5A 2VLBA 4ZVPA 2XTAA 3KUKA 4BWVA 1QXSA 1TMYA 3ZVLA 1WL8A 3U61B 2GBLA 2R97A 4MOWA 3TTTA 3C3DA 1UJ5A 4PGFA 2RGGA 2MYTA 4TT3A 3QKRA 3VZDA 2GHTA 4Z7OB 4I4TB 4UBKA 3ADCA 1NKTA 4X63A 4MPRA 2OK8A 3D02A 1B1CA 4J03A 5E9QA 1GTJ1 3LV8A 4WOPA 3BZBA 3OZFA 5C53B 4PNPA 3FMGA 3UY4A 5AKGA 3ZEIA 3H4VA 2BRUC 1UWLA 3H86A 1HE2A 1UK8A 1A96A 4NQRA 4CG2A 2HMAA 2COUA 4QQ8A 5FCDA 4B3RB 3U3ZA 1JQAA 2XB9A 2QUKA 4WZKA 3BDIA 4HHEA 4OHBA 4YACA 1SBCA 5FD8A 5C4GB 3X2SA 4EDHA 5HNKA 3CTAA 1NPDA 3PVSA 5HIIA 9MHTA 3WJ2A 3G88A 4DM7A 1IZYA 2POQX 3R6KA 1M5TA 4IH4A 3B8HA 5G02A 2WD8A 2XITA 3F6BX 4DMMA 3QEKA 1SBTA 4AJKA 1EXWA 5CYFA 5B12A 2H2WA 3GJXC 4ZTUB 2V8BA 3ESXA 5DSXA 5KYXA 1RQXA 1ZIDA 3HVRA 1RW4A 2VJOA 3H6KA 2AZMA 4QQKA 5IHPA 1B6RA 2VK8A 3N2IA 2VZEA 3VJLA 1NNI1 1YC2A 2NQ8A 3KALA 4RL4A 1L5KA 1B42A 1PV1A 3AERB 3HGQA 5EXDA 3P0EA 3ND8A 1YR7A 2WWTA 4XN0A 1NYQA 2BHTA 2H8KA 2EC5A 2HHAA 3AY6A 3QU7A 4MIEA 4XVRA 4PGOA 1ULZA 4Y9DA 3ZXYA 4RPHA 2D5CA 4AUEA 1LQTA 3LYLA 2OUIA 2OZEA 3DOUA 4MVJG 3DLBA 1CZNA 7ABPA 4FMCB 1SM4A 4QPPA 5E4JA 2AWNA 3S8EA 1R4ZA 1IDN1 1FRFS 4KDCA 2K6GA 4ZARA 4ESOA 3AZPA 4B7UA 5TC4A 1QLHA 1U2QA 3ABOB 4WKNA 2ZZMA 2JKYA 1N1EA 3OKXA 1S6YA 1J07A 4II7A 2Q28A 2WIJA 5J23A 1J7KA 1KARA 2ZQ5A 4WESA 1KOJA 2P9EA 4TQ9A 4YAEA 1RWNA 3HXTA 4ASUD 1F5NA 1Q19A 1WZCA 3AUJB 2SNIE 1VLYA 2VBSA 1S8FA 1G7RA 2D62A 3A3YA 3CPSA 4LECA 4MQFA 3R9KA 1ZY2A 3I5MA 1DDOA 1GZDA 4YR7A 4YNBA 1G2OA 1TVKA 3KHSA 4BBPA 4PG5A 3MD0A 1CB7A 2Q4BA 1XELA 3HVUA 4FHZA 2GPAA 4GQBA 4A16A 1W88A 5JFOA 2WIKA 4MI6A 4KPUB 4C07A 1VQ5B 4IR7A 1Y37A 2ZSBA 4OMFG 1WOOA 5DYYA 5B7PA 3A4LA 1GM5A 3OBBA 1JEYB 5LP6B 1UEIA 4FFWA 2A0WA 2N3ZA 1DBIA 3O7MA 4GMHA 3G0IA 1NUPA 1P4GA 1G8PA 1P1RA 1S2OA 3JAKB 3QU2A 2O7VA 4UM9B 2OZPA 2LR0A 2PVCA 3LIIA 4MW0A 3E1GA 2O2IA 2ZWOA 4LKOA 4BGIA 1RMQA 4ITVA 4MVJH 1SQ5A 3C74A 1KDVA 2E5FA 4W5TA 1J8YF 1IAQA 1RT9A 2C31A 2PT6A 1F0NA 1QIMA 1BA2A 2EW2A 1ZG3A 2QAIA 4IIDA 4PYMA 4XWOA 5DNCA 4L2IB 1KVSA 4RJTA 5KTRA 2RHGB 1NBMA 3W8RA 4X1IA 2WNSA 3MJVA 4PZEA 1PI3A 5FL7A 4JQCA 5CBKA 1OXXK 4YONB 1PKEA 2IYSA 2IGBA 5CX4A 3TD2A 4N47A 4D8YA 1HZZA 3N2NA 3OTIA 1W34A 1KC1A 3CR7A 4HEA1 1FNBA 4PG7A 4S24A 4QU5A 3IOCA 2IHTA 5GAJA 3IESA 4KIJA 1ZN8A 3U3OA 4XEUA 3ZWKA 3R9XB 1V6AA 4W7HA 3UYLA 2PKRA 1DXOA 3PQ2A 3QV2A 3W3ZB 4D8UA 1XTVA 4BVLA 2Q7XA 4QD3A 3SHTA 1OTYA 3AFGA 2FUG6 2MIIA 1VMEA 2F62A 3H5WA 3LDFA 1ATIA 3GGOA 4GGMX 3CZCA 5NULA 3SY8A 1PQUA 5ICMA 4C7OB 2P79A 1L8QA 2X3UA 3OPQA 5IF9A 3P96A 16PKA 5F7ZA 3ZDDA 3EEIA 2K2QB 3JQPA 2IZOA 5CA0B 1LLDA 4KR6A 3LUJA 4TT3D 3E58A 3J7TA 2HWWA 4NDZA 2FZCA 2WG2A 1SOVA 2C3OA 3IOEA 1H5UA 4Q3AA 5ALYA 1P1CA 2P8SA 1R5JA 5DWVA 1R4MA 3RYIB 1JDBB 1BWSA 4Y2RA 1XRMA 1Q7BA 1TVMA 3JD1A 3NOVA 2EZTA 3LBYA 4RD3A 3AXSA 5JMOA 1D6MA 1E2JA 1FMCA 2C88A 4EG4A 2JIPA 1FLDA 3HWX1 3BFKA 3LHKA 1N0UA 4IL5A 4IVPA 4OH1A 4R9SA 2YZKA 5DEOA 1C0KA 5L40A 1UQUA 5DHQA 5A3VA 2QSJA 1XL0A 4ND8B 4MCHA 3CPJB 4RXMA 4WBNB 4YPVA 4GM4A 5JC8A 4X1OA 4LBVA 3DF7A 4ZVVA 2O2XA 3RG2A 2J6IA 1RWWA 3L9XA 2E18A 3B3JA 1EEHA 3H04A 1VHJA 1KFCB 1YR1A 2GKOA 5FA5A 4P82A 1SQSA 2ZXFA 5DBGA 1BDIA 2FPRA 5C1BA 1LBIA 1MP0A 2L17A 4J76A 1HV8A 1T36B 3ETGA 2EARA 4AZVA 3CVVA 2GF0A 5KMGA 4UBLA 1VB3A 1N5RA 1GYPA 2CFCA 1K0FA 3NRCA 1N0WA 2EHDA 3UAOA 1DFHA 2ZM5A 5J58A 3HL0A 3GSIA 1T5SA 5DHRA 2HA0A 2IOFK 4ND1A 3H1FA 1T2NA 3M6FA 2ATEA 2R84A 1VSUA 1Z6TA 3WYNA 2YDXA 4ZEMA 2BFEB 5H9VA 2E6KA 2XBUA 3NX4A 3B7PA 3C87A 4HXFB 4ZQBA 5FUXA 2RI0A 2J3EA 4NZMA 1W52X 2NZ2A 5IK2A 2L2QA 1BD3A 2XODA 4AWXA 3KBOA 4GL4A 4TZ0A 1MB4A 2OILA 2OCYC 2PY6A 2ZWIA 3R20A 5A3SA 1HLPA 2WUWE 4WI1A 2AOUB 4Z99A 5IJZA 1KMHA 5GM2A 4DNOA 4U0JA 4JP5A 2A35A 2FXVA 1QK4A 2OYRA 5ED4A 1Y9ZA 5BV8A 1IQ0A 1M2JA 3RK1A 1U8EA 4AG3A 3SQWA 4HDKA 1YB1A 2IC5A 4J6EA 3DM5A 3I0NA 3I28A 1XD8A 2CSUA 2WHEA 3IB6A 3HDVA 5WRFA 1CK4A 2GYUA 3ADPA 3C6YA 3AI3A 4PSKA 2CLEB 3Q3VA 4KQ2A 1KPIA 4WOKA 1KI9A 4ZT6A 4KH0A 1E3EA 2BELA 3G79A 4KO2S 2BHNA 2AFIA 2OV8A 3U49A 1TA0A 2YWGA 3ZDBA 1KY5A 3EVTA 5A05A 5DO9A 1XFAA 4PQRA 5COAA 2X5XA 4CU5A 1N2OA 3GJYA 4LOKA 3DB2A 4EZBA 2PUFA 3AW9A 1VCHA 4RZXA 4K81B 3Q3EA 1CPYA 3ET4A 2EEPA 1OI7A 3SI7A 4LGYA 1UDAA 2Q0SA 3WTCA 1NP7A 2IYNA 4JB3A 4MW1A 4AUKA 4RLZA 2NVBA 1EKXA 1H8HD 1O9BA 3CH7A 5EL0A 5LXTF 4AMBA 5A6SA 4V1CA 3DDCA 1RQNA 2YXPX 3PSHA 4HRYA 3R7FA 2BJVA 2BLNA 1SN7A 2GD2A 2QM3A 3LIPA 3M6IA 4H6PA 3EVNA 4U5QA 4FD2A 2IE8A 5FL7D 1BEUB 4GMFA 1JHVA 4G0NA 4QUZA 5FTWA 2PNFA 3HS3A 4RYLA 1ECLA 2MR5A 3IQFA 5HMLA 1PTKA 1V5FA 3HC7A 4B43A 1YC5A 2N75A 4H0NA 3L7NA 4NMMA 3RIMA 1WP4A 3E9RA 2XRYA 4IRMA 4YDHB 2BGTA 3LQFA 2YWFA 5BN3B 4UNQA 2VWGA 4BFSA 4H59A 3WGIA 1GOTA 2FWAA 2M9MA 3FF1A 3MCWA 1L6IA 4PX9A 4P4SA 2DJIA 3AUAA 3C6QA 2MYUA 3WRYA 5B1SA 4LRUA 4AO6A 4V3CA 4G0QA 4HV4A 3G5AA 4YK7A 3VU0A 2AOVA 3CNLA 4M8KA 4EMTA 1HQYE 4H7KA 5U4XA 3VAYA 3U7EB 2XA2A 1EXMA 3K5IA 1E58A 2B5VA 3EMDA 1CUBA 2ZJ5A 3KZOA 3MJ4A 4KIUA 3O21A 2J3KA 1KO4A 2DQSA 3CBGA 3NPAA 3R6DA 5CYPA 5SZHB 3CUKA 4IILA 3SHVA 1NNUA 1UP7A 1YQEA 2IU4A 3WDKA 3ORRA 2PBFA 2I76A 1VL5A 1DZIA 3CXUA 1Z68A 2M2IA 4KC0A 3C85A 3DWIA 3MSXA 4PFQA 1E7QA 3PUXA 2O52A 3EFBA 1TEZA 2Z4TA 3VR5D 2C9BA 5LZ8A 3M81A 2XMQA 2D2EA 3A6ZA 3NUQA 3ZHYA 1ZMTA 4B45A 5ADWA 2G77B 4I4TF 2P1ZA 2R7NA 4ZCQA 3DZFA 4AJHA 1E18A 3LCMA 1YS7A 2FLWA 2HV8A 4HZUA 3VO8A 5FOQA 5CFLA 1KH1A 1Q1EA 3WNCA 5BQFA 2LBPA 1H85A 1JEQA 1NWCA 1VKOA 3FB1A 4OHCA 3NYWA 3LNTA 3LKBA 1KY4A 2E87A 3DNPA 3IL2A 4FFNA 2AOXA 2FXIA 5AVQA 1C1DA 1MNQA 2OORA 5TMEA 3C3KA 3WHIA 3H9BA 4KWIA 4W8HA 3RTCA 3Q15C 5EUQB 2YCBA 2Z8YA 3KLNA 3RJTA 5CEJA 1KEKA 3D1LA 4QEKA 4RM3A 2GZMA 3DO6A 4NONA 5G40A 2PEZA 4BEVA 4P31A 4L16A 3AM1A 1VQPB 1MW8X 1JR4A 2QRVB 1SUSA 3OE1A 3J81A 1GYQA 2YNMA 3HNRA 5HQTA 1G6KA 1KK1A 5FBWB 2ZETA 4JYMA 5C35A 2QU8A 1M1NB 4KB5A 5FOVA 5KDLA 4FHGA 1ZAKA 4X9XA 3C43A 3IC5A 1XKLA 4DCGA 2N0SA 3W2TA 4PCUA 2C7VA 4Q93A 4PO1A 2OOSA 2HEIA 3FDZB 4TLLB 3S28A 3G5TA 5ICCA 1XD2A 2QV0A 3GDOA 3QVSA 4DA9A 1K4KA 1W1IA 4UE2A 4FMCF 3WZLA 1RVV1 2AMYA 3G8DA 4XE5A 2PM8A 4BVBA 2PEYA 1SG6A 1J2EA 4DCTA 1DCFA 3L6DA 2FGKA 2GPYA 2R62A 3I9OA 4LPSA 1AZTA 3CR3C 3DDWA 3ONWA 5LA6A 2HI0A 4CM4A 1W76A 1KA9H 4CHTA 1JE0A 1FP4B 2V6GA 3CINA 1HDGO 3QFFA 4UBIA 5FXMA 3HSYA 3G8YA 2ZI5A 3UH1A 5KOJA 3EJ6A 3PWZA 2XXAA 2XUAA 2V59A 3RK0A 3VDXA 2CE2X 3SKXA 5B2EA 2OGTA 1OIXA 2VH2A 3V7NA 1CS4C 4OVKA 2X5OA 2XUFA 221PA 4YP9A 2YHBA 1QH8B 1KQGA 4WINA 5BV0A 4MWZA 1RI2A 4BCCA 1OH5A 2O5CA 2V7QA 1AJEA 2XGSA 3DOCA 5KOHB 2C92A 3KT3A 1B0AA 1NY5A 3JS5A 1CF4A 4Q6BA 2GXUA 4OJMX 1NB9A 1D6NA 5JYDA 2PMDA 2ZRLA 4FGZA 5KC8A 1GT91 1NNEA 3I2YX 3LMKA 5AOCA 3DCYA 1CR1A 4MV1A 4C2TA 1HURA 1IHPA 2PX5A 4JBXA 4OP2A 1GLNA 5FX2A 4GICA 1XRJA 3L7BA 4JUDX 1N5IA 3E9EA 4CM6A 2ODTX 2NG1A 2DPXA 2NU7A 3HYCA 3HB9A 2G5CA 3U39A 5CA1B 3LLCA 1ESCA 1IVNA 2YBDA 1CUCA 2B69A 3E18A 2JJ1A 3HVJA 1F48A 1NPYA 2VUUA 3HZOA 3I6MA 4ZJZA 3HTXA 1I10A 2H1IA 1IC6A 3MELA 2GQFA 2EFDB 3ASPA 1JRLA 4NMWA 2YXBA 3ZWXA 2BF7A 4ZYTA 1PJRA 1BPLA 1BYUA 2Y4NA 4HUQA 1X80A 2QAGC 1NULA 2BMJA 1LH0A 3P94A 1RADA 4Q01A 3X1XA 1JDZA 4LJLA 3ZW9A 3D7RA 2E4XA 5CFQA 2AZXA 1E2KA 5TDHA 5JDIC 2EOAA 1OIVA 2H0AA 3TSZA 2OXFA 821PA 1X38A 3LXMA 4IHAA 3AOGA 3BH0A 1OMOA 2FCAA 2PWAA 3SG0A 4WT7A 1VQ9B 1C7EA 2Y0DA 3JVUA 5AOAA 4ZVQA 4BFTA 2XKBA 1S01A 1EUQA 3TLBA 1AIPA 2CXHA 2VBCA 3Q38A 4J75A 1WU7A 4QGBA 5C1IA 2DT8A 3NPMA 3PHLA 3TZCA 3VMMA 3HDYA 2A6PA 5BNTA 1ZEJA 3PCRB 1YDMA 3L7DA 2BPOA 1WXDA 2HEGA 4HR7A 2XWQA 1J4AA 2FSUA 4P84A 4PHFA 3C5EA 3L05A 3GJQA 3UXYA 4MR7A 1U3VA 2O4UX 2Y92A 3DVLA 3OH8A 5DLPA 3WOHA 2ABWA 3FZGA 4UU0A 5AI5A 1ZVMA 1UIRA 3K1AA 3UG6A 4CR7A 2Q8PA 3D0QA 4TTRA 3WC4A 2P3QA 1JTEA 4IOLA 3ZWNA 5DM4A 5HQ3B 1NN1A 2WVAA 3EVDA 4IDNA 5CPFA 1XQVA 1ZVQA 1Q2XA 5IG2A 1WPGA 5DHPA 4HDNB 1A9PA 4WKPA 1UXGA 2AYXA 3UB3A 4HDMB 2K7ZA 1JR3A 3CJTA 1U2PA 3QEOA 5TMBA 2DBRA 3T7EA 4WBNF 3WXBA 5MFZA 1Y8ZA 2CVZA 3C0KA 3LFHA 3SMVA 4D57A 1P61B 1X7HA 2JAXA 3DDZX 4GI2A 4RBNA 4BBAA 5K0GA 3MS4A 3AVTA 3ULKA 2YNMD 1OTXA 5JT1A 4QVGA 1O96A 2RDMA 2XVYA 1JFRA 4TKVA 1QGOA 3OFND 3IKTA 4BB6A 5G53C 1E6KA 4M9QA 4MWEA 1K97A 1H23A 2QVLA 4XWTA 1IPHA 3NHKA 3CRQA 3FPHA 4JVMA 1USUA 2YRXA 3C7KA 5I7HA 1LK7A 1LUAA 2DPLA 2ILTA 2R47A 2R6R1 2V5UA 3K0KA 3BL5A 4JENA 1FYEA 4Z4RA 1U1IA 3N74A 5SY4A 3ZHCA 2JASA 2EF1A 3VTFA 3OP1A 3WB0A 3GU3A 4M55A 2FFHA 1YJWB 1N9ZA 5CIQA 3SD7A 1WW2A 2OAEA 3JQFC 3EXHA 3ILXA 1QORA 2CLSA 1FFDA 1HI9A 1MO3A 2RAUA 4R3UC 1V5WA 4R41A 1ZN9A 1IN4A 4KQXA 4BLUA 1LLUA 2H51A 2R5NA 1QYWA 5I7UA 4PANA 4FM9A 5AJTA 1ML4A 3MRSA 2XUPA 3RSSA 4KZPA 3KR1A 4KQMA 4BRUA 1TE2A 2ON6A 3QFTA 1V1MB 3K70C 1ZBQA 1B0UA 1F2TB 1ZXBA 4E21A 2C2HA 5KTNA 4M76B 5DTIA 5LSAA 3A9CA 1TKCA 4BE7B 1E3XA 1ZC3A 2J3MA 1J2TA 2VBUA 1ZGGA 3AZOA 4WZTA 4N01A 1J21A 3LF2A 1LDEA 4ZI3A 4EI7A 2IX9A 3T56B 3CFYA 5HF8A 1OGIA 2BGUA 3CS3A 1T2UA 2HIAA 2GJPA 3B1KA 1G0NA 2OR3A 3FNHA 2MMGA 2WILA 4N49A 1PFVA 3KV3O 4BNDA 3EC2A 1Y0RA 3D0OA 4Q1DA 3KEGA 3OTHA 4HPXB 3EMBA 3HZRA 3AGPA 3EYWA 4TMKA 2X6WA 3MF4A 4MVJF 1WOYA 5KHOC 4TYNA 4OU4A 5IANA 2C7QA 1UWVA 3RHZA 2NMVA 4JLAA 3VTKA 1W0JA 3EH2A 4H6WA 5HE9A 5F64A 3O1LA 4YJ2A 3D2BA 3NTXA 3QQ5A 1WSWA 3WKAA 4A0HA 3IR7A 2BFOA 3BTUA 4I2NA 3TJRA 2AJBA 1RYBA 2OENG 3MVEA 1IEQA 4PLGA 1NBOA 3DPUA 3HUUA 3ZHSA 1E9BA 3NRBA 2HF9A 3ESCA 6YASA 4ETMA 3OM1A 1DV1A 1XBTA 1Z0SA 1ZJ5A 2BAGA 3QWAA 1TF7A 3LUHA 4QUKA 2EWWA 1UXJA 2HV9A 2YN0A 4YMVA 1U8CB 4Z86A 3ZTYA 4QTXA 3TCNA 3C15C 1KQOA 2Y4OA 3SIPA 3L04A 4MKGA 3W9UA 3WGQA 2WF8A 2IHNA 4AYXA 3K9GA 4WECA 4F2HA 3KAPA 4AO7A 5KYWB 2ZI9A 1OREA 3NBKA 3WAGA 3B8EA 3QUTA 4OOVA 2PKXA 2HA3A 1KP9A 2D06A 2E21A 2PG3A 3KKZA 2OB2A 3PHBE 4HQ6A 5EKXA 4UUPA 3WLAA 3TGWA 5A04A 3AF1A 2FWPA 4E09A 2D5LA 3LUBA 4FW8A 1OBFO 4GMGA 5IH3A 4NK4A 3DWEX 3CLRC 1YL7A 3SZLA 3G0HA 4C0SA 2BFMA 2JATA 3CE9A 3TIIA 3U26A 2R9VA 4YFYA 5CM8B 1H0SA 3N8NA 4B17A 4BY9E 4OKNA 4HOYA 4B6PA 2PSEA 5CVCA 3V4LA 3R2JA 4G5SA 4MQEB 3U60B 4HFRA 2X1LA 3BD8A 3ENQA 4WZBA 5SICE 4BO7A 4DCUA 1CF9A 1LJUA 3RIEA 2VUIB 4DDMA 1ZKMA 4MRVA 5IN4A 3UJPA 5L7TA 4ENPA 3UFXB 1TYEB 1UXOA 1JFTA 1YB7A 2CF6A 1N5JA 2I03A 1A2KC 3MTGA 4CLHA 4IGAA 4EO7A 1IQRA 3ENVA 1DBVO 1U0GA 2NAPA 4BFYA 1UWKA 1WHSB 3HDJA 3FWNA 2WYVA 4OUKX 4EIWA 1JPJA 1MRSA 3RAFC 1E0AA 1JG7A 2QDKA 2R6AA 4IJKA 4O2AB 3ZDQA 3N2ZB 1NRJB 1WBJB 4N0QA 4I1RA 2H48A 4E13A 5HK9A 7MHTA 2X5KO 2PXAA 3EF1A 3OC0A 4TXLA 3CCSB 1S02A 3KSRA 1VLVA 4LNHA 1WZ2A 4G8BA 4CI9A 3T99A 3UGQA 2P65A 4IGIA 3M0EA 4M0LA 1F6BA 1WNFA 2QRLA 1RYYA 3OW2B 2WOOA 4IG4A 4OBWA 1NQAO 5AUNB 2YZGA 1UUFA 3DYIA 5LZ2A 4WUVA 4LSGA 4M0EA 2QVBA 3WL6A 2B3DA 4HNAB 2RH8A 4XMYA 1JKFA 3H97A 1N4AA 3EUEA 1U9YA 4P7KA 2WDZA 2IDZA 2I6QA 2J9ZB 2IW3A 3KVYA 3R3ZA 3UAGA 2B34A 1M34A 2WWYA 1NSTA 5DHTA 4YV0A 4AMGA 1DBWA 3F47A 1E3LA 2C29D 1LRLA 4NJMA 1OPRA 4P86A 3VO1A 3AR8A 5J4VA 2C61A 1PWHA 3DXFA 1RHRA 3H9GA 3KL2A 4RDHA 4LFCB 3W5BA 1XEAA 3HJBA 1TVCA 3DXZA 3WBBA 1GUZA 5CMLA 2AK3A 2BIFA 4R0MA 1VBFA 3ADDA 3W5UA 3VNUA 4XYGA 4BQQA 4ZZ1A 3FH0A 3W8FA 2K2WA 1Z88A 5KTOA 4LMRA 5EPUA 5FBKA 3SHFA 3T7IA 4J7CA 3DEAA 2EDCA 2AMJA 2GDZA 2R44A 5JECA 1KSJA 1U0OC 3HN2A 2XHEA 4EHJA 1DJQA 3A06A 3D7MA 1DSSG 1Z5ZA 1NFFA 3ZIDA 1UM8A 1RI1A 2FSVC 3IV6A 1K89A 3TI7A 3QE0A 1OBCA 1FY2A 3LW7A 1ZH2A 1REQA 2UZ1A 1UD3A 3HKEA 5CJPA 2JLYA 5FWYA 1DIAA 2YVUA 1OU0A 3N6VA 3IR5A 3I6BA 4GX1A 4URZR 4Y9SA 5BMVA 2R8RA 2EG5A 1KZLA 1YUNA 3A9TA 3IODA 4YAGA 1W0JD 1WKCA 4JVLA 3VV2A 4A0QA 1S2DA 1Y6JA 4O33A 1ISGA 2IYTA 2G80A 2RKOA 4EQZA 5C4MA 1EVIA 1BKSB 4HH0A 4OLHA 4KXMA 2WSSA 2JF0A 1R4NB 1WY5A 3DHWC 3GLGB 4LC1A 1T8TA 2P68A 2QMOA 2BC9A 3L1IA 5FI0B 4ZO6A 4R7TA 1C9DB 4ZC8A 4A2QA 1XA3A 1YKFA 1CG6A 4KACA 3MPUA 2DYIA 3NKFA 4YAJA 4CFSA 4C05A 2WHRA 2LKCA 2H9AA 2ZK7A 2BEUA 3TFOA 1V0FA 1ZDMA 3GB9A 3QENA 1RXUA 5CGZA 3BMOA 4KHPB 5FPHA 5KZMB 1JL3A 1G18A 1OU4A 1GKKA 3SZOA 3WGTA 3WYAA 4QBGB 3U44A 3QQPA 1YONA 2ECQA 1L3IA 3QPAA 2OK7A 3M8KA 3KOMA 1E32A 3FTPA 3IILA 3L7JA 4AK9A 3CC7B 5FTLA 1L4GA 3IEVA 1Z08A 1LF5A 2XNCA 3F6SA 2VZ9A 1I3LA 4EHKA 2I87A 2W6ID 4O2RA 1N1DA 1C4WA 4S12A 3A2LA 2E5LB 1FRZA 1ZM4A 2EP5A 3QNUA 4ZANA 4BFZA 4EHNA 1BH2A 5AVTA 1VQLB 2WAOA 1E3SA 3K71B 3DVAB 1H0HA 2DT5A 1BX1A 3BDVA 2ZJ1A 3ZE9A 3KQWA 3SIRA 5CVVA 3RU9A 2NW6A 3AGQA 3N05A 2IZ7A 4GR5A 3D4LA 2VDJA 5ECGC 5KI6A 4TWBA 4UDOA 5AM3A 5AW2A 4D92A 1ZNXA 3V4SA 1DRVA 3PDWA 1D2GA 1RACA 2X19A 3ODPA 3Q0TA 1C3VA 1ADJA 4ML3A 4B3FX 5LC1A 5KNBH 1U2TA 3FMOB 3PPVA 1A9RA 1EGVB 1X8KA 5AJUA 5G4LA 3T9DA 1YS2X 1SCIA 2ZYSA 1GEEA 3FYDA 3BXHA 4M88A 3U3MA 1QB7A 3WFZA 4ZHQB 1MO6A 3C1AA 5DIFA 1XE3A 2ZRKA 4MPPA 3TQOA 1E6CA 3IT0A 3ZZUA 5E9AA 3F71A 3NJ4A 1RI3A 2H5JA 3EXIB 1U1FA 2ETXA 2IEGA 3HXLA 3NC1C 4QRHA 1Z9BA 2VNAA 5A0FA 1FNMA 5THXA 1N2JA 3O03A 3WL4A 2C5AA 2AR9A 4GI7A 4P36A 5ICFA 4WJLA 3WJ7A 3A6JA 1WVIA 2G5TA 3QJYA 1EU1A 3NBUA 4TVKA 4EG5A 3R8FA 4RW0A 3HKBA 2OKGA 1H66A 4R9RA 2E9SA 1HUQA 2NGRA 1J7JA 4ERNA 1ZYUA 2I91A 3QLVA 2IS6A 4XYBA 3G89A 3KU4A 3MERA 5JNLA 1B16A 2JGEA 4IUCS 4L4YA 1RPTA 2ZDHA 1CJUC 4QDTA 4BVKA 2VDRB 4HMPA 5AI9A 3GWZA 1A71A 2ZREA 4JUCA 3O3CA 1E2EA 4DJTA 3AR5A 4UUNA 4HE6A 3I9V6 4B3DA 1LPBB 1PFKA 2DKOA 2VP4A 5DRYA 1NW3A 2JCXA 2QN2A 2QLTA 4K26A 5F52A 1Z74A 3SKBA 3DA8A 2D0DA 5JAMA 1UJMA 5A9TA 3TE6A 3L0ZA 2Q9AA 5EC8A 5LUBA 3UA3A 3FSGA 1SCBA 4N6NA 4Q47A 3EXEB 1BVYF 1GG9A 3FUXA 3BQMB 4ZYVA 2BP7B 2AI2A 1JG2A 1CXZA 3DSRA 3HR7A 1GZ5A 4WZLA 5CNMA 3V6MA 4BXOB 5KOYA 3O8BA 3QXJA 1RQRA 2FA9A 1B14A 4OHVA 1UC9A 1NRKA 3LUKA 2PGXA 1A76A 4D4KA 2JLZA 2VJIA 4X7FA 5E1DA 4IZHA 4CIDA 1Z0IA 2J33A 2Y0PA 4KN9S 3TEMA 2VKTA 1HG0A 2G6BA 3LBFA 5JSFA 5ITZB 2QTTA 1TM2A 1ZMXA 4DB2A 3SR3A 1VQ4B 1DQSA 2ECKA 2EW1A 2WHXA 3IBYA 2PL3A 3DMTC 1J2UA 3NVDA 4OQPA 1NVKA 4P2BA 2C3MA 1DC5A 1V7QA 2GNOA 3LUAA 2H7VA 4YQYA 3M2PA 5D5PA 3ZKWB 1EK1A 3EX7C 1V9CA 3MOGA 2J41A 2YVLA 4XPIB 5MF6A 2DLCX 1LVHA 4FXPA 1JHPA 1STOA 1C8KA 2O7RA 1RR6A 4LCEA 2VEDA 3ZJ5A 5I7WA 1N2SA 2DY0A 3PPXA 2DSTA 4RIFA 2OXEA 1GCGA 3K6RA 4I50B 4BX9A 5GPBA 3SHWA 1X77A 3TRIA 5ADHA 3GVKA 5DMXA 1WQ1R 5AW0A 2AFHA 2CB9A 3ZTWA 2AOTA 3JXEA 2WV9A 3B78A 3GEPA 4WAUA 3PNBA 1P31A 3BM5A 4HK4A 5AKIA 1CEQA 2G88A 3CNQS 5ESWA 5C7OO 2JG3A 3WV4A 1QRDA 3C3PA 1WLSA 3QWIA 4MEAA 4PC3A 3SLRA 2WLSA 3G8CA 3I37X 2FG6C 2YV1A 3A0UA 4GECA 4CF4A 3W8EA 2CWDA 3I2FA 3CZRA 3UJ3X 1NASA 3FHTA 2OSVA 5CDHA 3VR4A 3PCXA 1W29A 4QC2A 1BDBA 3BJRA 3WRXA 2WUGA 2A0KA 2O2EA 4HWPA 3UAZA 2GJAA 2WIAA 4NESA 2W4QA 4D98A 1RAEA 1XQ9A 3JU3A 4AZTA 1JR6A 4E3ZA 2QI9C 1RXCA 1KMMA 5I01A 3EFOA 4TS9A 5KWVA 4ZU6X 1EZ4A 3BIFA 4V0NA 5B3JC 1G2QA 5CNIA 2ZR0A 1T8YA 3BERA 4LX8A 4TN1A 4E11A 3CLUC 4DAEA 5KU1A 3GGDA 1YMVA 3MS7A 2X5NA 1G8MA 4LQDA 5H3CA 3WLQA 4EKEA 2WPNA 1EFLA 2D9RA 1RKUA 5BSFA 2P6MA 1B8PA 3F4KA 4PAOA 4FFSA 1W9XA 2BH9A 3HA7A 3HLKA 5H7XA 4EW6A 4LJ8A 3V1UA 2Q7OE 2PGDA 3DKPA 3QMWA 1K9MD 3D2CA 3TGPA 2PR2A 3ER8A 4GGPA 2NX2A 1E1RA 1GRQA 3PD1A 4A03A 3A3KA 3K9HA 1WV1A 4X1KA 4LF7B 3B3FA 3H2IA 2D3LA 3VZBA 4J1TA 4MVCA 4XCXA 3KQLA 3ICVA 2ZUEA 3OF5A 5CU7A 3C14C 4W5JA 2HLHA 1NF8A 5DNWA 2UYHA 3CT4A 3E2PA 3OECA 3N86A 4U2BA 3QX3A 2PL5A 3VPDA 2BJWA 4KQKA 4UVEA 2GF2A 4C2AA 3DFUA 2A3RA 3R6WA 4BEBA 3BCFA 3OZWA 1AKVA 3IAFA 2X0FA 3GVJA 1X15A 4G6IA 4KQIA 2M1ZA 4ZO4A 1AKMA 3M5WA 4LIPD 2OZLB 2BONA 4M9UA 3OKPA 4DNXA 2IE0A 1VLQA 5AVXA 4O2AF 2VYQA 2IODA 4RENA 1MJ5A 2O0HA 4TZTA 3HFGA 4U2KA 5HG0A 3NBMA 1X1SA 2YJTD 4GX0A 1M1UA 1M0TA 5EHZA 1R8JA 4A4DA 1Q1ZA 1XB2A 1UDXA 2VKQA 4HJRA 5UKDA 3BAZA 1ZGBA 3CEAA 2C0CA 3VJRA 1XZLA 3E1YE 3A9SA 3EE6A 4JI5B 2V45A 3WHPA 1IUNA 1E94E 1L4NA 1WXIA 3UJAA 4OP3A 1VOTA 1M2KA 1BWQA 3AG6A 1CR6A 3B9PA 3WNDA 5DCYA 1D7AA 1V3TA 4EJSC 4Q3DA 3D31A 3FSGD 2GO7A 3QEMB 3LI2A 2DR0A 1X7XA 2JVKA 4I19A 4KOAA 5KREA 3KZXA 2ZE6A 4GBED 2UZ4A 1BHQ1 2M5SA 3I72A 3CWZA 4XYLA 5BW6B 5KNDH 1OH6A 3WLKX 4NBSA 1WEKA 4NNJA 3FTFA 4DLTA 4LJ4A 3EW7A 1AUQA 3FWZA 3OCYA 3CO5A 1JJ2B 3A6DA 3SSAA 4A2PA 3LXUX 1U7DA 2QZ9A 3KYDB 3PT9A 1N2BA 2R66A 2IVFA 3A6FA 1FXWF 3QVXA 2IUEA 4L7VA 2I62A 2V5VA 1KJ9A 2I6UA 3X1YA 1U2SA 3QITA 4CM9D 1WDLA 3H2KA 1F5SA 4QQRA 3GQBB 4JROA 4B6JA 2X76A 4FFMA 1CIPA 4IHJB 4Y6LA 4MDEA 1CFZA 2CT8A 4NCNA 3QVMA 4OYRA 5JV5A 1LLCA 4FN4A 2WJVA 3R6GA 5EJFA 1Z4KA 4WK4B 3TH5A 1W44A 2X2FA 2E37A 3BGOS 1NJGA 3UCFA 4K6CA 4QJ3A 1OFUA 4Q7EA 4DSZA 1J70A 3PA2A 1XZDA 5LDHA 4Q9IA 4Z3OA 3ZW7A 2NOAA 2GAAA 3OHMA 3QELA 3F90A 4IVRA 4WLVA 1K7SN 2YMMA 3H5IA 4GH5A 2C5HA 1C30A 4PRLA 4X90A 1MOSA 5IUNC 1MVOA 3C3YA 4W99A 4ARZA 2V55B 1DDIA 3UBTA 2UXDB 3K35A 3W1EA 4ID3A 5IFLA 2FPMA 1GPYA 2Y6UA 2C8JA 1UOEA 1T6BY 4LHEA 1NSFA 1PWEA 1JLSA 4RLFA 1UKVY 2RBGA 3MTJA 4RHYA 5COBA 2QTZA 4RANA 2W0SA 5I7AA 3STHA 1E2NA 2HMUA 1QGUA 4JBWA 4QPDA 4B2IA 2E1BA 3RVDA 3S2ZA 5GJVC 3MCAA 3EWSA 3H1GA 1MU0A 3F5FA 2JAUA 4PN7A 1O0SA 4FKBA 4PE5B 1DBRA 1P1KA 2RI1A 2YHSA 1G6Q1 3F97A 5HF5A 4XA8A 1RYFA 4W5HA 5FA8A 3W7AA 3A70A 3WKDA 3M4XA 2ZL6A 3PUYA 4K7JA 4YJGA 5T4FA 2HJVA 3V00A 5A1JA 1V0EA 2BCJQ 4R05A 2ZTNA 1A04A 3UC5A 1FTYA 3A8TA 3G2NA 6AT1A 1BN6A 1SBQA 2VT2A 2IP4A 2XDYA 1Q1GA 3B5JA 1JLLB 4UTRA 6LDHA 2JD0A 5DTJA 3QLUC 1DTEA 4C08A 3WK5A 5JNUA 3E7WA 2GYYA 4IXTA 4XVHA 4LN1A 1AQLA 3KQQA 3PJFA 2KMLA 3MUOA 1WRBA 1TZBA 2PMFA 3EVBA 3WDLA 2VFAA 5BT8A 1BRMA 1GKLA 1WXHA 2G1JA 2R7LA 4LVOA 1MRZA 5C1DA 1EGMB 2D5BA 2XB4A 5K3EA 2P2DA 5KINB 2QJTA 3OOJA 1NOKA 1VPEA 1MJGM 2B8JA 3L6EA 5ICSA 1IL0A 1MD9A 3VUEA 2C1XA 1VHOA 3ASRA 4JA2A 4MW4A 2OYNA 5L51A 4NC9A 1AO3A 2H63A 1FFBA 2C2GA 2CMGA 2CUKA 3NEPX 3GRAA 4MJ3A 1QG0A 1NXOA 5J2UB 1M9NA 4YRMA 3OZCA 4ZHQF 2ZBEA 5HILA 5BSMA 3IT1A 4JWKA 3JU4A 5B6IA 1UPTA 1E69A 2R1TB 2VJMA 3F7TA 4R1OA 3VR0A 1YGPA 4C3VA 5BQOA 1RZRA 3V9AA 3GAFA 1PNQA 1KHHA 3TW8B 2C42A 4I4IA 3RG8A 4KSBA 3QUBA 4NBKA 2IU6A 2QHXA 1GL7A 1CQZA 4E1BA 4C5CA 1IBMB 2WU1A 4BWFB 2FMHA 1T5IA 2CMHA 4D0RA 1IQPA 3DL2A 3L6UA 1SULA 1R6VA 4AKTA 5CTAA 1DXHA 5A6SB 5SYAA 1P1IA 4DLNA 4EPXA 4IKEA 4CF6A 4JEHA 4WXPA 1QMGA 1VLJA 1IN8A 1C5KA 3WIEA 2ZB2A 3OZAA 1ODLA 1JIIA 3T5GA 1U6KA 3NASA 4XLZA 5ECDA 3OLQA 1ZD1A 4BWYA 1EWRA 2ZYDA 5JCXA 5CDYA 3FCEA 1JJ7A 3IIJA 4CI0B 5LNK1 3LY7A 3W4JA 4M54A 4NE9A 5DWDA 2NU9B 1OH8A 2ANBA 2OOKA 2KM1A 3OZGA 3KYCB 3ONYA 4C0LA 4R7ZA 4ANFA 2XZDA 1XKQA 3C97A 1P33A 3ODGA 1Z5PA 3D7NA 3UA4A 3D8SA 3EUAA 3ZLTA 1GZVA 1V11B 2A9OA 2QAGB 4HQKA 5JU6A 2HRRA 2VS1A 3NDIA 4O2BB 4LQ4A 4R0NA 2YFKA 5T6BA 3SZ3A 1LU9A 5CB6A 2P40A 3LWZA 1U02A 2VA9A 4LC0A 2I2FA 4GWGA 1SBIA 2FOLA 2AX4A 2CBXA 2G36A 3L02A 2VTBA 2VTKA 1U9ZA 4HLCA 1O8BA 1YIAA 4QNRA 2ZBRA 3CMAB 4N65A 2NYUA 1XT6A 4HWRA 2I6SA 4WJZA 1Y33E 4AY6A 2B82A 5TQ2B 1M8KA 1RLJA 4URXR 4QSMA 3GGCA 3MYRA 4N76A 3JWEA 4MEJA 3GPCA 1RWKA 2WU4A 3EF0A 1YJ5A 3LP6A 3WZMA 4CIXA 1BMFA 4DADA 1P2BA 3E5HA 3ZZTA 1DX9A 2OTLB 3EIQA 4KXUA 1PWXA 3N0RA 2BI8A 1I1HA 3TF5A 4LZJA 4V0OA 2VIIA 4EPRA 1XZCA 4RKYA 4XYEA 4D0NA 3U4MA 1UIMA 4XR9A 4H1TA 1KI6B 1ZQ1A 4OB7A 2BTQA 1ANKA 3COZA 2X8AA 4RPJA 2XGJA 2G04A 3TL3A 1IEXA 1SFRA 1LK5A 3L0BA 2AJLI 4C6TA 2GJ9A 1H2WA 2II6A 4LJAA 1IK6A 1HA3A 4IQ0A 3SC2B 5C81A 4XM0A 1KBOA 4LYDA 4ZDIA 1QYCA 5F2EA 1ZCFA 2E7ZA 3D54D 3GBPA 3GMSA 3W2EA 2BT4A 1YUBA 3P2IA 3OPMA 1XROA 4TVBA 4FZ3A 1SCJA 4GMDA 5FWAA 4X64B 3F2VA 5FBQB 4KPEC 3TQRA 4LYGA 2ZRAA 3OLYA 1ETUA 6NULA 2GTPA 3E7PA 1NU6A 4F85A 1B2LA 1K6XA 3M1YA 4J0CA 4TWJA 5HS6A 4QE3A 5E6RB 1JA9A 3RC9A 3T9EA 1LY1A 3HBFA 1MA0A 2HADA 2GAIA 2GZ3A 4M53A 1PGQA 1USGA 4AROA 4F1KA 1ACMA 4JR0A 3VSEA 3VVMA 4WERA 4CEHB 3D6AA 3KSUA 3HB7A 5AO9A 4I1OA 3EK2A 4Q9HA 4BCDA 3CVXA 2ODWA 4G3XA 3W5IA 3I5YA 2V31A 1CRWG 4H3VA 2TSYB 3AZQA 4GDFA 3IEXA 3R24A 1DTSA 4WZZA 3W2GA 3AW8A 4DDKA 1O9GA 1EDOA 1PFWA 1KEEB 2EU8A 3NHLA 2J6BA 3BG5A 4IJVA 3BTSA 4HDRA 4Q00A 4Q4JA 1XLVA 3UYKA 5DASA 3UGJA 3O1HB 3ID6C 4HJXA 1VBNA 5TARA 3OCCA 5CHEA 2PTHA 2PSSA 1PJ5A 2A5JA 6REQB 1I01A 1ISJA 1RZRD 4TTSA 5D8DA 1UINA 2W2KB 3NM5A 1H2YA 4XM2A 4XIFA 3OLCX 3PPIA 4FYVA 4HEQA 3FTDA 4K9OA 4N03A 3F73A 4EY8A 2BTOA 4OYLA 2AI3A 1EBBA 1YQTA 3FW1A 5KAMA 1A97A 3PR1A 2ES4A 3T3GA 2YFYA 4JL8A 3L8HA 1P2DA 3WNZA 1UOPA 4WADA 2ZSDA 2JLXA 3HY4A 2FU5C 1BE1A 1D2MA 3KQNA 4KVGA 4INZA 5AW6A 4D41A 1SCDA 5CT6A 5ALFA 4BASA 1CUSA 4KWCA 1OXMA 3LQEA 3TBKA 3AHGA 4DOMA 2XNDA 1FFYA 3OURA 4HCJA 2VK1A 5ALSA 1ZRHA 3HCFA 1TYDE 1T8RA 1ZKDA 1DAOA 1X7WA 2B94A 2GKSA 2KPOA 2Q2QA 3DQQA 1Q3HA 2NAFA 1OXBB 1C1XB 2R0QC 3SQDA 1GSHA 4Z9FA 4GP6A 1OXSC 4X7MA 3O4HA 2C00A 2EFGA 1MQSA 3G5LA 4GPIB 4JLPA 4NS4A 3UKDA 6Q21A 4FYIA 4WZAA 3A3PA 1MORA 4URUR 5KHAA 3FWPA 3V1NA 5BYAA 4EJMA 7MDHA 3IVXA 3PEWA 1JPVA 3T61A 1HPLA 4K40A 5E3IA 3UT5B 4Z4ZA 3ZK7A 4RE5A 4C0XA 5K3FB 4JV5B 1SK9A 1XWIA 1ZM2A 4RF4A 4WFIA 2IDKA 1CQIB 4H1VA 4E2WA 1CR4A 1WABA 3P2MA 2AKYA 4ZT2A 1M2WA 3EXFA 4LNUA 2H57A 1HK7A 1NMXA 2RAPA 1EDZA 5I9MA 3OJ0A 1EJBA 2P0YA 2R8XA 1W75A 3CD6B 3I4LA 3KJZA 4Z0NA 1GILA 3UMMA 2FG5A 4BMOB 1FDVA 3BCRA 4IYRA 3D6UA 4JDPA 1R74A 3FCUB 4I6EA 1P75A 1EESA 3N7UA 5B1EA 1ZCZA 3KZKA 1N3BA 1BMFD 1EEXB 1H1DA 5CRIA 2DR3A 4DRYA 2FX3A 3I42A 3UAYA 1GQFA 1Y48E 4N5HX 1N1MA 1BXGA 1V9SA 2JI8A 1HE4A 3K7EA 3WIUA 4FZ5A 2ZJZA 1RE1A 2VJDA 2O8NA 2G76A 1NQVA 1QDEA 3QBJA 1NVBA 1EJ0A 1B93A 4X6YA 4RTRA 2UAGA 3AKZA 2Z2ZA 4P2NA 1JHZA 1GZHB 2Z4SA 2WIDA 4MUAA 4AKEA 2H0QA 1SUCA 4IEEA 4RNCA 3VPFA 4FHCA 1E9SA 2WYWA 4IP0A 4RSMA 3AVYA 3GIWA 3HGMA 5H81A 2OP0A 4YEDA 3FE2A 4PLVA 4QOHA 4AAYA 4TL7A 5C7YA 1R6XA 1XPUA 3LPAA 3LRPA 2VZ8A 5FOUA 2IV2X 4A0SA 3OIYA 2VP5A 3ILVA 2Z30A 4AF7A 2NN3C 5GP1A 2WF6A 5CXSA 1CIJA 1KE2A 2G71A 4KCGA 4HB0A 4WACA 1OWNA 2ZDQA 4GC9A 1TTPB 1KQFA 1N07A 1PX0A 2I7CA 2XEDA 4OQDA 4RZ3A 3MINB 4LRYA 3EPPA 2YCLA 3BH6A 4ZQGA 1LCIA 4XVCA 5K6AA 1A77A 2PD3A 3NETA 4IGEA 1GGNA 1TI7A 2F9FA 1FJHA 4O4IB 1KU6A 3WO1A 1EQAA 4MJXA 3IRVA 1W2BB 1GAQA 3V7WA 2ZP1A 5LWHA 4G0ZA 5KVAA 3V4ZA 3BMNA 1T0HB 2R4QA 3HU1A 8ADHA 3W9BA 2IYOA 3CCQB 1P9WA 4WGGA 4RE6A 1R6DA 3H0CA 1PUIA 1NI4B 5KYVA 4G5YA 5TB5A 2XWSA 5JZSA 2VQ3A 3WGVA 4PV7A 1NC3A 4H7DA 2P9YA 4GOXA 2YV3A 4FFRA 1RE0A 3D5EA 2L69A 3KT8A 2ISCA 2OG2A 4I99A 1I1QB 2VH5R 3SBXA 4PRYA 4B4WA 3RTGA 2DQZA 2BM0A 2JRLA 4ZCSA 1NVAA 4OOXA 1SRQA 3O93A 3PGVA 2WJ4A 3CCCA 4HTAA 4KEAA 4LHXA 5JEEA 1TEHA 1Z25A 1RRFA 2EQBA 2IELA 2WAXA 2Z6VA 3CZMA 3LHIA 3REQB 4DF3A 2CVPA 3F4BA 4M1MA 5AICA 1TQHA 4Y2PA 2VYCA 5FUWA 4EYQA 5EFZA 1OKKA 3PUNA 2I2WA 1V3VA 1DEOA 3L5OA 3PFFA 3OPYA 1N6HA 4FYMA 5BPHA 2XBMA 1IXZA 1AGYA 3RIHA 1DI0A 3PXEA 5ICGA 1WCYA 1Z0ZA 3SK0A 3LT5A 4A8PA 1GRNA 2FEAA 2CXPA 1TW2A 2JFUA 5J2UF 4PPGA 4FUQA 4J91A 3OMWA 4U2GA 1SPBS 1DMSA 3K0FA 2RGNC 1GT6A 4JQOA 5IVPA 5DW3A 3T34A 1L1RA 4S0XA 2ZJOA 3MT9A 4NMLA 4R98A 2GCOA 4GLOA 1HVXA 1U7TA 1MQAA 4PTLA 3WGZA 1XI2A 3P9PA 4H3KB 4KL8S 2ZBPA 2XUJA 4YI5A 3R7DA 4NPAA 2ZS7A 3TLGA 1KI1A 3ZHUA 2XNDD 4LOJA 3WLHA 2IEIA 3WLSA 1EWVA 2PK3A 2V65A 2FSSA 1Q1BA 2QN1A 2XADA 4CM3A 2QMYA 1GPJA 1LDYA 1R6TA 2QG9A 3QMMA 1NQ5A 4HSGA 3HM9A 4BV8A 2WM9B 3PU6A 3RTAA 5KJFA 3GLFA 2A8YA 3CP2A 4LQCA 2HA7A 4M1ZA 5AQ1A 2NVWA 2WYIA 5GQSA 2BFAA 3E70C 5DLEA 1LNQA 7REQA 4RF3A 2FY8A 2OV2A 5CBPA 2FUNB 1OXVA 1X2BA 4A91A 1EDDA 2JAWA 3PGXA 2Z5VA 4MAAA 3DE4X 3LX4A 2PJRA 2W6NA 4EENA 3GLTA 5I8WA 1RKBA 3QPBA 3TG8A 2RHMA 2QT1A 4BCBA 4ZGGA 1I3KA 1MF7A 4ADSG 1JDSA 1FYWA 3BH7A 1PS8A 3W8NA 1WW3A 2VPXA 1NVVQ 1PQYA 4OOEA 2MR6A 4LYFA 2ZVJA 3MWEA 5KVVA 4O2BF 1JVBA 1F60A 2QTNA 5IC5A 4OCZA 3SF0A 4JHLA 4CCYB 1XU7A 3KR9A 3TEFA 1Z5WA 4P4LA 5K0TA 3T3OA 3C8MA 2CKDA 3QTBA 4QIHA 3WHLA 4JJ4A 4V2UA 5SY6A 4ZVTA 1C8BA 1SRRA 2CMKA 2RKBA 4FU0A 1X6VA 1OBVA 2ZIFA 3K0CC 4YRFA 5DBEX 5DNYB 2GPNA 3T1VA 5DE3A 1WB6A 5T8KA 2ZIGA 5CLLA 1W94A 1EXNA 2A1TR 1GTG1 3O26A 3VJKA 4YBRA 1FRVA 1RS0A 1NBME 3X1ZA 4DRZA 2YFQA 4WCFC 1NRIA 2LXNA 1IN6A 3ND9A 2V0CA 1OZAA 3ZHQA 5KB3A 3BX1A 5D1NA 1TAGA 1SXJA 2QGFA 2R6CA 1O1YA 3LCRA 1KQNA 3KM0A 3QF4A 4S2EA 3VOBA 3TZBA 3OZUA 1KOFA 4ZYYA 1N75A 4G0YA 2SCUB 4A8HA 1I8DA 2M1XA 3SIXA 2DECA 3GJ7A 3BXPA 2NPOA 3OFJA 5JHHB 2QZPA 4ZQEA 4OFZA 4IVQA 3T3EA 1QO7A 1Q22A 1JLKA 2ZTVA 2EAUA 3NDRA 3QOYA 4REQA 2CLDX 2ICAA 4RVOA 1T4BA 1BHO1 1U90A 4PEVA 3X44A 1TM7E 1QAQA 1HFJA 3JPYA 4DC1A 2IEZA 1JQBA 1S4QA 5IEBA 5GIOE 3M7IA 3K9QO 4RAOA 1VE6A 1IAVA 1HQDA 3PE4A 4DARA 4EG7A 2IT1A 3DFIA 1FUYB 5IARA 3U4IA 2A5LA 1D1NA 4K05A 2GSDA 1L7NA 2QW1A 3E9CA 5T4EA 4OD0A 4IIJB 3C6KA 1ZIOA 4XAQA 5EMMA 3ONUA 1X1QA 1XO1A 3N53A 2P11A 4LCJA 1V8BA 2XSZA 2OMKA 1YFZA 1I6WA 1JAIA 4B85A 4HAYA 4KR0A 2VNSA 3KJGA 3I2IA 2Q6IA 2GLTA 2XLCA 4D3ZA 1WMFA 5E7JA 2D1TA 1I4TD 2VQSA 4AKSA 4UULA 1ESZA 1A50B 3N6XA 1TZ2A 2ZBGA 3QPWA 4GMXA 5NLLA 3JAMA 4HDQB 1OKKD 5E4YA 3HP4A 5JDCC 4DLBA 3CV3A 1M75A 4RVCA 3TZLA 4BV3A 1OI4A 2QR5A 3GJ5A 2WRZA 1PR9A 3QUQA 1NRXA 3ROZA 2VNIA 4I4TA 5BYJA 3V32A 3E8MA 2PZMA 4GKKB 1VKHA 4JBYA 1V8DA 1A4IA 4QAJA 5H1YA 3DE7X 4Q7LA 1FLAA 2I2XB 1Z6YA 1R7RA 1UPAA 1H8ED 1NURA 2JGFA 5JSHA 3UMJA 3MHPA 3HI4A 4B48A 1WOSA 3CURA 2QG6A 1L5QA 5HDBB 4ZGNB 1ZK4A 3AUFA 1R88A 2ZJAA 1LX7A 1HGXA 4US0R 1EPUA 2PPLA 4NABA 2QUHA 4LDRA 4NV1A 5KQGA 3DZ8A 1UT6A 3JTMA 2WY2D 1OLOA 4BV2A 4FR0A 4ENVA 2HBQA 3B6EA 5EYPB 4MR9A 1HETA 4DV2B 4QT4A 3I45A 1KD1D 5DGDA 3AEZA 2F90A 2YHUA 1G3MA 4HC4A 4Q21A 3L7OA 3EEFA 4W9NC 3VC7A 4BDSA 4BDTA 7GPBA 4LXQA 2DTEA 3MMXA 4L51A 4EA9A 2Q3MA 5FUQA 1N57A 1Y3BE 1KZ7B 1RHMA 2XUOA 3AERA 3F9CA 3T0IA 2P8JA 5ANRB 4F7DA 2IBMA 3I58A 3BB4A 1S5PA 4QPCA 2OV4A 4QDXA 1VB5A 1Z0FA 3RRBA 1UFVA 4GEGA 4RJJA 3K5WA 2AQ8A 2FETA 4JFRA 2BGNA 2EJTA 1NE7A 4FNAA 3BHIA 2H17A 1ZSVA 1E5QA 2EL9A 3OTGA 4YMWA 2B2NA 1TLTA 3VYRB 2WV7A 2YZ7A 4B81A 4IEFB 1UKCA 2WMDA 1CEYA 3GRVA 1T1RA 2BCEA 2H92A 5HFJA 4RVGA 4G1EB 3H6HA 2B5OA 5J47A 2FQQA 2EZ8A 5ALZA 3KOZA 4KR7A 4EJ6A 4F5WA 1JSZA 1WKVA 1BQ3A 1C9MA 2YX1A 4HRAA 2VN8A 3LL4A 1IQUA 1OAKA 3QJ5A 4JMQA 1F0KA 1VGQA 1FEZA 2BKLA 2ZB7A 2FVGA 3O73A 5C34B 4P81A 2VHZA 2HY7A 3KIPA 3BTOA 1NJ2A 2CBZA 1IPEA 3ITKA 3PC8C 2ATXA 1DAKA 2FSGA 3W3AA 5IUJC 5LQRA 3TRDA 1UADA 4FD3A 1QFSA 3CNHA 4I6GA 2PGIA 2ZIZA 1P5RA 5FWDA 1KEZA 1RC1A 1SHLA 3AB3A 1Y0YA 2F00A 2YVAA 1Q0PA 3AJAA 4NU8X 4B0PA 3ASQA 3IUBA 1AS0A 4KPUA 1ODFA 2OFPA 5J9FA 3UJDA 2HJRA 4NY1A 4W8GA 1UPFA 4YFVA 5AM5A 2R68A 4TQUS 4JI6B 3TOXA 3R6JA 2LKDA 3U56A 5LP6A 2H1RA 2VDNB 5IYPA 3H5LA 3VDNB 5IDXA 4NBTA 3ZCSA 1K88A 1CUVA 2J31A 3PUKA 3JAKA 4JI4B 1QHYA 2BEVB 1E9AA 2C9DA 1XNHA 3MWDB 3HABA 2SECE 4PC6A 5K3BA 3UAWA 4ZT7A 4IDOA 3ECSA 3VR6A 1GGMA 3RFFA 3SNHA 1YRBA 1PDOA 3FKJA 1RFLA 4L27A 4WGFA 2JGIA 4RX1A 4JYAB 2UVPB 1L4YA 1XA0A 4L2IA 1D5WA 1HMYA 1P4RA 2JVJA 2YS6A 1O95A 4U6SA 2BBWA 3AVWA 2I6XA 3WR5A 4QTYA 1DRKA 5CDSA 5HW0A 1Y9JA 3B7WA 4CV3A 4CG0A 4ENSA 2YH2A 3M82A 3RC7A 4O4IF 1GZUA 1O58A 1OFVA 2XSZD 4NAVA 4DLAA 1TF2A 3R9XA 2VA8A 3SEJA 4AY2A 1J99A 3GOQA 4C7OA 4F3TA 3F96A 4QXRA 1L9KA 5IAAA 1ZZEA 3FA2A 2Y0CA 1KPHA 3OUZA 2VO1A 1U94A 4L75A 4YBZA 1QR6A 3SJPA 3B7GA 1P0PA 1K86A 3JSAA 3HYRA 2BZ1A 2OYCA 5FH9A 1KK2A 3L77A 4EJSB 3BXXA 4RHXA 1QC5A 5JSUA 5CA0A 4DWOA 4YCLA 1E2PA 4LBWA 2P2ZA 3IAM1 4BP3A 2ZZGA 3A3NA 1JQEA 5FTJA 2IOQA 2Y1LA 3Q8WA 5AKHA 3TOSA 3EZ7A 1U0JA 4IDCA 3RYIA 1A0OA 4PONA 3AV3A 1NQUA 1ZW6A 4GRDA 2LNDA 3VDMA 4BNIA 2B7BA 4R8LA 2JFQA 5EESA 2YINC 1XMIA 3MCUA 1KJZA 2CFTA 3E53A 3OFVA 4K5QA 4YRBA 4B09A 4DR3B 3IOMA 4ZMRA 1TC1A 1LPSA 1M83A 2YBEA 3BSYA 3DOFA 1WUKS 2O3TA 3WLLA 1OFTA 2V7PA 1OR8A 3LKDA 4WBNA 1CZKA 2XD9A 5EIAA 1P18A 1IRXA 1G7TA 1UZMA 1EE9A 1PK8A 1ZIPA 2I7DA 5C18A 2C1ZA 4L9SA 4NPCA 4UNPA 3WBJA 3HY3A 1T6ZA 1JU3A 2HCRA 1E5LA 3PFKA 4ZV4A 3KOXA 4UE3S 5H3HA 1T36A 2PQ0A 3OTOB 4G36A 2X4LA 5HJ2A 2Q0QA 1VZ3A 1CDZA 3JR7A 5EIWA 1IK4A 3BD7A 4YRCA 3UANA 3UWPA 1NFQA 1YZLA 2YOFA 3C4VA 1YJQA 5CNJA 4ENRA 4Y9TA 5AVZA 2X7HA 2AE2A 2CJWB 4P5DA 1C14A 1HZEA 2OMEA 5JXJA 5EKSA 2BFEA 1KJNA 1XP5A 3DDSA 2QPLA 3FHOA 3N1UA 2DETA 2D7DA 2VDUE 5IBQA 3CCBA 4B74A 3M4YA 3GFOA 1L5OA 3ZI4A 2J5QA 3O9MA 4TYMA 3A1NA 4UTXA 2CV1A 1NYRA 3N28A 4X95A 2J3QA 2AOUA 1W2HA 3T3MB 1KXZA 3KXDA 3NHRA 5AJYA 1YHNA 1I3CA 3AR3A 3EZ6A 4HZGA 1J8DA 3D8TA 3IPLA 4FEYA 3TBFA 3UATA 1DO2A 1F8GA 2D0IA 2G8LA 1DBPA 1NUQA 4FC7A 3W3AD 2BCGY 4D9CA 4H3HB 4MRMB 5EJ7A 2MOKA 4MQLA 1BDHA 2AN1A 3MTBA 3VHXB 4BVFA 1M8FA 4MCIA 1Z7EA 3RS8A 3VI3B 2VF8A 4ARVA 1LJLA 1QHHB 4HAZA 3TRFA 2Q5OA 4YDRA 1Z0AA 4PU0A 4UPVA 3N2KB 1GPAA 3U80A 2I3BA 5J3JA 4MNTA 3HBLA 5HMMA 3DB1A 3UAXA 3H4IA 1JH9A 2F3RA 1WDMA 2NO1A 1O5IA 1A7JA 4WLEA 2BGIA 1CJTC 3LQYA 2E4VA 5B6JA 4UM9D 2RCYA 2W2XA 2WJAA 4RADA 4GLJA 4WXEA 2PMWB 5CLHA 4OIMA 4MVJA 3R75A 3RVMA 4IDAA 5CDFA 2HXGA 3O82A 4X84A 3SXPA 4J94A 3TQIA 3VR6D 5B4VA 3RAEC 1MB0A 3ES9A 3MWLA 1RAIA 1G9SA 1GGKA 5H3LA 3ZCUA 1L7EA 2Q6LA 1IBRA 4ITRC 4R16A 4YRLA 3FJ1A 3IUSA 4F12A 3OTQA 4AY5A 3O47A 2ZSKA 1MAHA 1QV7A 4N0MA 3EVFA 2P9JA 3AR9A 1SCUB 1HFWA 1FRQA 1U8XX 2ECFA 3G2PA 3LZDA 4U6NA 3ZJYA 5F2NA 4I4NA 5CB4F 1UDBA 1T4MA 3T5BA 3O0DA 4ZZ2A 3CZ4A 3RROA 2H2DA 3RI3A 5E8RA 3RYHB 4R1SA 4U2DA 3SR4A 4Z4GA 4X8HA 3GBVA 4PSAA 5DH9A 4QL3A 1CUWA 2WTNA 2Z2IA 3DMFA 3DBHA 4C14A 1H9AA 1GV1A 1RIIA 3RSCA 1WDWB 2W98A 1NUTA 3EPLA 4MYHA 1NWHA 3JWPA 1CUAA 1Z0JA 2WINI 4EJFA 5H70A 3ER9A 2FAXA 1PAUA 1XPOA 4HBGA 2CN1A 1EJ2A 2R7AA 4FYPA 4R5HA 5D5QA 1FVOA 3OT4A 3MNFA 1B26A 1SUPA 1JR3E 2QTFA 3LT1A 3LO8A 1XJWA 2BBOA 2CD7A 2QVZX 3EDMA 3IVCA 3USCS 2BMAA 2GFQA 3F8WA 3C4JA 1YKGA 1ZJJA 4GHWA 3UKOA 1M6YA 1GU0A 1QCCA 3CX4A 1DCMA 3TFQA 4B6QA 4DW8A 1FS6A 4F86A 1EE2A 3I1JA 4ESHA 2YJ5A 1CKEA 3DONA 2CLKB 4HAUA 4LSWA 4YGXB 5EEHA 2ACKA 4HUTA 2DLDA 3NOOA 2V6JA 4HEJA 1BE0A 1FFWA 2FP4B 4LDQA 5P8WA 3T7AA 3ZJ4A 1P81A 2I33A 3VR5H 5DB4A 4C4AA 1I24A 2Q1SA 1RM0A 3Q6MA 4PZUA 1GPWB 1T3GA 3L9WA 1R0RE 1X14A 4YI3A 4QG3A 2FUEA 2R3SA 1Z29A 3CUSA 4LK3A 5EHXA 4FFLA 4XIGS 4CM1A 3ASTA 4WCDA 1G5TA 2HA4A 3NS7A 5T4HA 4OPVA 4GOMD 1IZ9A 3C5WP 4NG4A 5G3YA 2PJUA 3A1SA 5TQ0B 1S7CA 4Q15A 4DMKA 3NUGA 2ZPTX 5LZ5A 1T10A 3P45A 2A9FA 1BEZA 3WYDA 2QRVA 4LOAA 5KSOA 2W4MA 4Y9RA 2VUHB 3O8CA 1YK0A 4GZ3A 2EGHA 3IIMA 1ZR4A 2GYVA 3OLVA 3FPAA 4JOBA 1M1NA 1L7PA 1QLWA 2BW0A 3KX2A 1KYVA 3JQRA 4JYPA 3TYXA 5L6MB 2W2PA 4L85A 4KN6A 4EB0A 2BM1A 1WG8A 1UBMS 3NT4A 5DM0A 2O3RA 2Q1TA 2A92A 3FDZA 1YUMA 3HDGA 4K9PA 4MV7A 4OI2A 1MFPA 5P21A 3ZPXA 1WX1A 3EY9A 4GSKA 2XCTB 1BRTA 3E5NA 4OV6B 4XVQA 5DGTA 2C2OA 4ERXA 2D3WA 3B9BA 2QXUA 4QOEA 2D7JA 3SX2A 3F9RA 4DV1B 5A03A 1VKRA 2H52A 4CKBB 4V24A 5B1IA 5KWEA 2R00A 4IIHA 4UFNA 1RBZA 4GBGA 4K9QA 4HD8A 4QFBA 3UCEA 2UYOA 1US8B 1OF1A 1HDEA 1TDJA 1FP4A 2PLWA 3PUVA 3ZE8A 2QI9F 5JQGF 1JDVA 4IDPA 1T1JA 1X7YA 3I1YA 2GR9A 1Q82D 4MITA 1JR2A 2YHIB 2PKWA 1JBEA 3FRHA 3NR2A 2OPHA 2JKVA 4EPTA 3I5UA 1EFDN 1OBHA 5AJXA 1R10A 3TL2A 1CZHA 3SBDA 3W5HA 4NBVA 1YAHA 4J0EA 6GPBA 1QH8A 1R6AA 2OQRA 2IYVA 2ODNA 2YQZA 4MVJD 1Y7PA 1NMZA 4N4AA 5KOHA 1JFLA 5TVKA 4X3CA 4IS2A 3GEEA 4IDGA 4YAKA 1G4HA 3AWDA 4I9HA 3QYFA 4OQZA 4EFMA 3FF4A 1ILEA 4P38A 1PZNA 2YWCA 3DDNA 3ZIAD 2HNKA 4IS3A 2Y3IA 1H6CA 1B43A 2EKPA 2JK1A 1YAJA 2Q3HA 3C1TA 4RHUA 1GKIA 5AIBA 4HVLA 3PNVA 4PG4A 3N9IA 2DH5A 3WX0A 5B55A 1E79A 4QRDA 1SXGA 2X9VA 1GUYA 2CZQA 2I4TA 2WT8A 2DFPA 3ELWA 5GV7A 1E7MA 5A71A 3GLKA 1R3UA 3FRIA 3OM9A 3I01M 4DCPA 1S8OA 2GN0A 1L5ZA 2RGAA 1LQUA 4OI1A 3LYAA 5JAOA 1J90A 3ITDA 4KFRA 4MYDA 4UPDA 4ACBA 2FPPB 1BVRA 1C0LA 1JQKA 2BKEA 2H59A 4QBHA 2GEKA 4TKLA 5JQWA 1I4OA 4GSLA 4BKMA 1FIUA 1EI9A 4TTIA 3ZD6A 4KMRA 3DP9A 4RZUA 5I7VA 3R7WB 1F1JA 5AVKA 3U62A 4RZ2A 5IYZB 1P1HA 2PKCA 4C6RA 3KB1A 3K53A 4K9NA 2LGJA 3H2SA 2CGEA 3TRJA 2JJ8A 3UV7A 3F78A 1NUUA 3CRRA 3JALA 2ODBA 2GD0A 3MA0A 3PHJA 3OTWA 5LD2C 3D8BA 1ISIA 4QREA 2YZ2A 3L1HA 1PLKA 3HHPA 3S2EA 4CV0A 1N8TA 1DWQA 5HP4A 3VOSA 2J4CA 3NHUA 3V3KA 3MWFA 4Q19A 4JNCA 4ID9A 4IKOA 3WYBA 4G85A 3VNRA 1ABEA 1MB9A 4BFXA 1ND5A 4Z7NB 3JWJA 1CS0A 3D3QA 1KKLA 4NL4H 4WA8A 5HQ3A 3P52A 3BHNA 1A5AB 3PTLA 1D2RA 2EX1A 2Z56A 4XFKA 3WK6A 3RWOA 3MJEA 4RJKA 5L53A 4MS4B 4HDMA 1W4LA 5D5HA 4F60A 1OLSA 3DAFA 5J5CA 3KB6A 1M34E 7ADHA 4WN9B 1RWVA 5DCLA 4I1SA 3RVOA 4D9HA 5J2TB 2QYHA 4GPD1 3A3BA 4LMAA 2O19A 2OZKA 4JJAA 3AG5A 4KE8A 4MQBA 2J5BA 3GRCA 3QKSB 2OY0A 2DCUA 1HTBA 1XVTA 3NNDA 4GMKA 4LYHA 4WNYA 4A8JB 1L4HA 4FS3A 4HX2A 1L7QA 4BNGA 1OE0A 3FNGA 3IMKA 1WDKA 4NEHB 4ON9A 1AKUA 4DUZB 3FMIA 3U4GA 1QONA 1YNOA 5FV7A 1EAYA 2B30A 4ND5A 4F5DA 3D4NA 2C58A 3EQZA 1PNOA 3CC2B 3TG2A 3D6JA 1IONA 1GQSA 1QPZA 1SK8A 3KJFA 2QRHA 1H2ZA 4BO9A 2ZQYA 4EVQA 3M1IA 3B6MA 2IITA 1FUIA 3EFEA 4OGFA 5FI5A 2FSHA 3RHSA 4GUAA 4OXYA 3H3XA 2QTRA 3HCBA 1J22A 1PT9A 2IXTA 2Z6BD 3CY6A 4EPWA 2ZVDA 4PPYA 3A3GA 1SOAA 2VOEA 4FBLA 4NBWA 2GZHA 1S3GA 5EERA 4IQ8A 3HE3A 1PU2A 4YWHA 4XSGA 3BXOA 3SYRA 4GUDA 3CMCO 3RRFA 4JJIA 4M36A 5BQ3A 1F2TA 2DHEA 4P0TA 4W5OA 2H08A 2W43A 5H5JA 3FNRA 1KJYA 1TYZA 2ZUUA 4LTNA 1LPPA 1W0KA 1YI8A 2ZJ7A 2KI5A 3PUZA 3QNWA 4CQMB 1UK6A 5LU8A 1LI4A 4NE7A 3L7MA 4KU4A 4E5KA 5HZKA 1A95A 4JT9A 2WQ7A 1YE5A 4NOLA 4TS1A 4U02A 1ISSA 4DT1A 4DWJA 5I6DA 2F1RA 4Y2QA 5IWCA 2PH7A 3FPPA 1ZH0A 1SKQA 1OASA 5BSVA 1UKZA 4DLYA 2R5WA 3RVKA 5LOVB 3HNPA 4OHXA 1T9CA 1J1IA 2QZJA 4OEHA 2XE7A 4S35A 2Q2OA 5CH8A 4OFXA 2W2NA 2YJNA 2RHJA 3MBKA 1IUPA 3KWMA 4X91A 4EVSA 4KLCA 1NR1A 1WMBA 1AB6A 1E79D 3PT5A 1B41A 3B1XA 1GDTA 1DLJA 2JCGA 2FRDC 1D7OA 4IFIA 3HN6A 4GO1A 1EUZA 4RSHA 1AGNA 3FPLA 3BEDA 3HEBA 3QMPA 1OAOC 2F48A 2QMZA 4QQNA 4Z0TA 5IAKA 4QXQA 1D0SA 3MJRA 5A8AA 1ORRA 1P4AA 3M6MD 1T9BA 2WG0A 3SOZA 4DIDA 3TS1A 4ZVSA 2A86A 2J9RA 4C0QC 4C0KA 2J5KA 4V1CI 4X65B 1WV0A 1MC4A 3N8HA 4WVLA 2D6FA 5E7IA 1WJGA 5BSRA 3TLYA 4TVOA 2FB9A 1JG1A 3HDHA 4OP7A 2ENUA 4R1QA 2BDTA 2WHQA 1SGWA 4NH4A 1IUKA 4P9NA 5IEJA 3PLAE 3ZGOA 4Q1EA 2BDEA 2ODEA 1U0HC 1ST3A 2WUDA 4L72A 4QNNA 1I2MA 4JZKA 1W35A 1FTGA 4J2TA 4I3HA 4DMLA 3DT9A 2NZWA 2XHZA 3HDQA 3TLKA 3I34X 4JJGA 2X0EA 4BUCA 3G7SA 3NATA 2HF2A 1XLUA 3MTIA 4HO1X 4O0MA 3ZVMA 4TMFA 3IEUA 5JD3A 3T9AA 1D6SA 1A82A 3OEED 2VCYA 3DVRX 1Y1RA 3OESA 4IJUA 2AT1A 5FHRA 1FFHA 3KK0A 1WCXA 4MGIR 4YRTA 3SJCA 4S2UA 4LWQA 2EKBA 3A11A 1K66A 1BJRE 3CE6A 3V76A 1VZ2A 3Q0IA 2PQ6A 1UM9B 3NHAA 1B00A 5FLKA 3H6GA 3L8EA 1OZFA 1U2EA 1W4ZA 4WLNA 2VYND 2RGCA 4HLDA 4YUZA 2Q4EA 1K27A 5CPBA 2UVDA 3VPGA 1L5RA 4MQEA 4D97A 1DO0A 3N8IA 1Q1AA 2XD4A 1IRIA 3X2EA 5FOXA 2VJPA 3DDUA 4MX8A 3QI2A 3UFXA 3N5KA 1TADA 2ZEJA 4BL5A 1XV5A 4ECAA 2IK8A 3GVIA 2DXIA 2VAVA 1C4KA 3UQYS 1E1YA 1T0UA 2V7TA 4JJFA 4RHTA 3O94A 1WHSA 3W4KA 3KKEA 2JW5A 2J07A 3L43A 4JBHA 2JARA 3T51B 3PLRA 4KLZA 5LLSA 1DC7A 4O2AA 1HM5A 1UC8A 4ZRDA 2ZXHA 2IBSA 4RA6B 5C46F 1THGA 2W2VA 2FR8C 1XALA 1X74A 4WCFB 3RC3A 4K9RA 1IXKA 3WSTA 1Y7LA 2HSDA 4OXXA 4DCVA 5K05A 2GNAA 4M7WA 4GBJA 4GP9A 4R54A 1ZSYA 4UJ3A 1G9TA 1HMPA 3DNMA 2W83A 4M8LA 4PX5A 2GLUA 3FIJA 3MIIA 3CSUA 2XWJI 3B5EA 2BE7A 3O2QB 4DK1A 4N48A 2BGJA 3IP7A 1H5QA 4RK0A 1AKQA 4H7FA 5JMTA 2GQ0A 5F76A 2LD4A 4EHDA 5IJ9B 4HNAA 2LZ0A 1I13A 3KQUA 4KPGA 1MA3A 4LF4B 2WAMA 4M46A 3SX4A 1H0RA 4DMRA 3EWNA 4U7PB 1L0BA 2ZZFA 4GVLA 3FI9A 2PJZA 3EQ2A 5F5LA 4JLOA 3OA2A 3WLIA 5A9SB 1M66A 1J2JA 3GF4A 1JIJA 2X14A 3M3PA 5GM1A 5EQFA 4Q18A 2CK3D 2BVNA 2AJCA 2FP3A 1TJ5A 3TIGA 4YCMA 4DQ0A 1M54A 1Q3TA 3LZ6A 3IVMA 4ZI7B 3ICQB 2DHRA 2ZWMA 2OHIA 3VC3A 3K96A 1VP3A 4ZAYA 2IUUA 4D96A 1PEKE 3OZDA 3UO8B 3F1LA 4RS3A 5FDFA 3NLLA 1NI3A 3EGXB 2I7VA 3H18A 3AKCA 3EPKA 2I7XA 1CUJA 3SEQA 3U2QA 3CZAA 4H35A 3UW3A 2ZJ3A 1Y80A 1UD5A 1R9JA