3ZC3A

Ferredoxin-nadp reductase (mutation s80a) complexed with nadp by cocrystallization
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYAIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNEKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title A Hydrogen Bond Network in the Active Site of Anabaena Ferredoxin-Nadp(+) Reductase Modulates its Catalytic Efficiency.
pubmed doi rcsb
source organism Nostoc sp. pcc7119
molecule tags Oxidoreductase
total genus 88
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3zc3A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3zc3A02
1N8RD 3JQQA 3AVYA 3CC2B 3VO1A 1QH0A 5TY0A 4TMTA 1CQXA 4NBSA 4RD6A 2QMUA 1K9MD 4B4DA 1TLLA 5EMNA 2RC5A 3AVTA 1B2RA 4RD2A 3VNVA 1JJ2B 1D8TA 4U9UA 3B8HA 1ZM9A 1VQ5B 4ZCMA 1J9ZA 1B23P 5THXA 2EFGA 3WNBA 4M1KA 1YHQB 2OTJB 4MYUA 3JQRA 1ZM3A 1KK3A 4RD1A 1OB2A 1DDGA 3B78A 4M2LA 1IJEA 3OJWA 3P26A 2FX3A 1VQMB 3U6BA 4B43A 3I1FA 3VO2A 2XEXA 4G1VA 2VNJA 1CNFA 3AVXA 1F20A 4PGOA 1E64A 4AF6A 1A8PA 1GAQA 4B44A 4RD4A 3CMAB 4R71A 2VZLA 3VNUA 1QGAA 2B7CA 2ZITA 4BPRA 3WY9A 3MHPA 1TVCA 1U2RA 2QTLA 2BV3A 1E62A 4LBZA 5KSWB 3AGPA 1YI2B 4PC1A 3CCQB 1KTVA 1BQEA 1VQ6B 3LYUA 1GAWA 3CCUB 1N0UA 4B3XA 2C77A 1EWYA 4YHBA 3WYAA 3ZZTA 5FA6A 3CPWB 2OTLB 4Y9UA 4ZGNB 1VQ7B 4YAUA 3OJXA 2BMWA 4B48A 1NDHA 1FRQA 1VQPB 2XNJA 3CMEB 1FNBA 2E1RA 3QFSA 5JBQA 3CC7B 3CCSB 2GQFA 1XB2A 4DQLA 2DY1A 1YIJB 1Q86D 1M90D 4LBYA 1W35A 1ZM4A 3ZBUA 2CNDA 1S0UA 4QHYA 3ZBTA 1EFUA 4P3YA 2BF4A 2QA4B 1TTTA 4TMWA 4DQKA 4EH1A 3WBJA 1D1NA 2QN6A 4YAWA 1QVFB 3MMPA 1G7CA 2YWFA 3AVWA 4C0SA 1VQ4B 1DG1G 2VYQA 3B82A 3AVUA 1N0VC 3CCVB 3CD6B 1EFTA 3OZUA 1JA1A 4AF7A 4M53A 3CCJB 1Q81D 1VQLB 4LBVA 2DCUA 1ZM2A 3CCLB 3PENA 2B7BA 3G4SB 4TMVA 4B47A 1GR1A 4IW3B 4PC6A 5HXBA 2YWHA 4PC7A 4RJLA 4C43A 1YJWB 3U6KA 1AMOA 4UAJA 1NJID 1KRHA 4F7DA 1KD1D 3W2GA 1GO2A 3W2FA 1K73D 4YAFA 2VNKA 1H85A 2BM1A 3CRZA 1QGYA 1DARA 3ZC3A 1DDIA 1G7RA 3OZVA 3P27A 3JQPA 2D74A 3LRXA 2EIXA 2HMAA 2VNHA 2OK8A 4AC9A 1M1KD 1GJRA 2QTZA 3FJOA 4G5GA 2NPFA 4RCYA 1AIPA 2XNCA 5TR9A 3WBKA 3WNDA 3LO8A 4N3NA 3LVBA 4M0LA 2PIAA 4FK8A 2X3UA 1QFZA 2DETA 3WNCA 2BPOA 3CCMB 3G71B 2DEUA 1KK2A 5H5JA 3W5HA 3WXMA 1R5BA 1QUEA 1VQ8B 1FDRA 2BM0A 4RD3A 1K8AD 3OZWA 1EP3B 4TMXA 1JA0A 1S72B 2R6HA 3U2QA 1D2EA 3G6EB 5AN9A 1KC8D 2BVNA 1VQKB 1W2BB 3J81k 4RCZA 4ACBA 1FNMA 4FWTA 4Q7JB 4YAOA 3A1FA 1FNDA 3QFTA 3QFCA 4TN1A 2CRVA 5H59A 3W5VA 2AHOA 1R5OA 3SJZA 4LC0A 4ZCIA 1IJFA 2C78A 1FNCA 1FRNA 2VNIA 4ZGQB 4FN5A 2PLFA 4K1XA 4HE5A 1KK1A 2DERA 3MCAA 4YALA 4H9GA 2B5OA 1HA3A 1BX1A 1EP2B 1OGJA 3FPKA 3CC4B 1ELOA 2QDXA 1QFYA 1G7SA 1I7PA 4MYTA 3CXCB 1TUIA 3W2IA 4M4SA 1CNEA 1R5NA 1QG0A 4TMZA 4Y9RA 3W2EA 1EP1B 3VMFA 3W2HA 4ACAA 4NCNA 3OW2B 2QEXB 1IB0A 4PC2A 1SM4A 4N3GA 4J0QA 1F60A 4Y7CA 5TV2A 1BX0A 4QFMA 3CCEB 3ZZUA 4P6VF 1YITB 3CB4A 4RD0A 3QSYA 1XE1A 1KJZA 1KK0A 1OGIA 1UMKA 2J7KA 4PC3A 5DSZA 4LBWA 1KQSB 2YWGA 1YJNB 1QGZA 1QUFA 3AVVA 1BJKA 1E63A 3QFRA 1H42A 2YWEA 3CCRB 2BN4A 1G7TA 1W87A 3AGQA 2GPJA 1VQ9B 1W34A 4HE6A 1VQNB 1OB5A 2PMDA 4ZV4A 1JB9A 2BGJA 3I55B 1QX4A 2OK7A 1VQOB 2HDNB 2BSAA 1ZUNB 1Q82D 3ZZ0A 1EXMA 3CW2A 3QE2A 1QVGB 3E20A 2RC6A 3I56B 4G1BA 2BGIA 1WDTA 1SKQA 1EFCA 1YJ9B 1Q7YD 1GVHA 4ZCLA 1JNYA 3W5UA 1QFJA 3E1YE 5GV8A 2HCJB 3V76A 4WQMA 3ES9A 5GV7A
chains in the Genus database with same CATH superfamily
2A6PA 2Y2UA 1M2VA 3SVTA 1UXKA 1CQWA 4J9VA 4O4IB 3T53B 1MW8X 2YVUA 3U13A 5IHXA 3M7IA 3A8IA 1BA2A 1S3FA 4RLZA 4RZ2A 3F5FA 3GCDA 5DMHA 5IUKC 3L1UA 1V3TA 3HVUA 4FGWA 1M34A 1N9ZA 1XTKA 3GDHA 1OGYA 5HYVA 4M21A 4MWSA 3SQWA 4HADA 1IJKA 3GAFA 2EFEB 2NADA 4G1CA 1EE1A 3TIXB 2WHPB 1H4VB 5ESXA 4MYCA 5JCZA 3I9KA 1DAOA 3NGXA 5HDBB 1WBBA 2WHEA 3I9V6 1YB7A 1JWBB 1PTKA 3BZBA 4BJ1A 3NJ4A 3OEHD 4NL4H 1E3ZA 1K5PA 1SOVA 3ESQA 4DLRA 1DEHA 1YS2X 1DJMA 1K0UA 4Y2YA 4U9UA 1DTWA 2EF1A 1VSVA 4FOTA 3R44A 3BCFA 3TB6A 4ALIA 5JV5A 4RKFA 1KQFA 1AA9A 2HYDA 2O07A 4C22A 2ODNA 4QYIA 1TQ2A 3TI9A 4M76B 1X92A 2VQEB 1AOXA 2P41A 1LV7A 3H04A 3THSA 1FS5A 4HDCA 3LSTA 1YVPA 3FD8A 1UM9B 1TRKA 2YR0A 5AI9A 5FUXA 1QK5A 2V6IA 3CC8A 1XEWY 4HDOB 1RBQA 3K72B 3I1IA 4M99A 4OQLA 3C5WP 2IWHA 3WRXC 2IF0A 1QZUA 2JIRA 4J0IA 4FJ1A 2FZVA 5IJXA 2DYIA 3EASA 4WXYB 1ZVQA 2BCJQ 4GM0A 4WFQA 4NHOA 2VNSA 4WWVA 2EBHX 4Y98A 1F7VA 1PJ5A 1SPBS 1EM8B 2CNNA 2Z2IA 4I19A 1Y8ZA 1THGA 1Z36A 3GNQA 4K03A 2D59A 121PA 1J21A 3PP8A 2P4UA 3VO2A 2XWBF 4MQLA 1OILA 2Q0XA 4W7SA 1LPNA 1GUAA 1E1RA 3GFPA 4RZXA 2AH5A 3Q3HA 4TQ9A 1Y89A 2XW6A 3ILYA 3HRKA 3JVUA 4FEEA 4IGFA 2IOYA 1KMQA 4IWNA 3FMPB 3QG5A 4EB0A 2H2FA 3KZKA 2R1VA 2SNIE 3AHIA 3H13A 2F4NA 4IIDA 3FTNA 3WWEA 4YMHA 2X7XA 3W3AH 4ARVA 3C7TA 4GFDA 1D2MA 3FRJA 3GMSA 3A3KA 3KB6A 2F3QA 2X5JO 4NRDA 2NO9A 2B4QA 2HO4A 2AT1A 1D4ZA 3HUEA 1PS9A 1J5EB 5AI6A 1IVYA 1E2DA 2E4AA 3C3MA 3PGXA 2QTVB 2QDKA 2PS0A 1XL0A 3JYNA 4GUDA 4A6EA 4Q4HA 5DNDA 4KRFA 1UR5A 4YJHB 3BB3A 4BRSA 2UZIR 1W9MA 4BFSA 3FKQA 1E62A 1B74A 5KSWB 3JQBC 3OIDA 4MV4A 4N6GA 5KYXB 1L5HB 1JH9A 5CEFA 2FXVA 2D0DA 3SFVA 2XE4A 5HE8A 1SO8A 4LGMA 1M2FA 2Y77A 2I1WA 1IQRA 3AV0B 3D6UA 3E4CA 3I05A 3ML1A 2AKYA 1D2GA 3N5KA 5LQNA 1JECA 1S1CA 3ME5A 2YX1A 4MUJA 4GBMA 2J3DA 3RV3A 3U49A 4TZ0A 3QBEA 2JLRA 3UJDA 4BU0A 5FBZA 5JAQA 4BV8A 5CDHA 4TTTS 3KQKA 4AZTA 3KDSE 4NATA 5E9JA 1A8UA 1EB8A 2ZSEA 4NARA 5CFQA 4DR4B 5I47A 1KMCA 1AQNA 3SM3A 3E03A 2RKWA 4AD8A 1DSSG 4G37A 4RL4A 3I39X 3ETNA 4ZI5A 3ZV7A 1YFLA 3GGPA 3IUQA 3X44A 1FNBA 3FGPA 5BN5B 4EI7A 1BH2A 2QU8A 2OCKA 4WXMA 3EA4A 1NONA 3EZLA 1QU2A 5P8WA 2QSZA 2ZRIA 3OG9A 4RZIA 1TCBA 2DJIA 3A6ZA 3I2IA 1RU3A 1DEXA 1JRLA 2D4AA 1T2AA 2J1LA 2Z3VA 3NORA 1ZM4A 5LBIA 1LLUA 1U80A 4DBLC 5JFOA 1RFGE 4ZTZB 4LZPA 1M6WA 3WC4A 4AG6A 1O5TA 3SXUA 4BZZA 3A6DA 3SQMA 5K8JB 1WD5A 2R87A 2J3JA 3ZBQA 2O8EA 5BSMA 4OH7A 5C3MA 1QFSA 2NUPA 4ZQHA 1R0YA 2BEKA 3FWZA 5D3KA 1JR4A 4HRVA 3VZSA 3IE0A 1TJYA 5BN4B 1K28D 5BPFA 1RCTE 5MGBA 4A6DA 2FW1A 2GD6A 3OZIA 4MWCA 4DQKA 1OB0A 4FHDA 4ZT5A 2P6MA 5TGTA 3SFTA 1LQ2A 1XVLA 5JZ9A 4MPJA 3VH2A 3AVWA 2IHTA 4K2HA 4XIGS 1M5TA 2ZZGA 2YOGA 3FTPA 3PKZA 1R0KA 1E1NA 1W59A 3QVTA 5A9RA 3E0XA 3O93A 1N0WA 1OBFO 4C6TB 4HDKA 1D2NA 2W5UA 3OZUA 1M6VB 2X42A 5LZ4A 4YI3A 4N01A 2DPXA 2H2IA 4KN9S 1IQUA 2WOJA 3FOBA 4YYZA 4BE9A 5B3JC 3QEMA 5KSOA 4IVNA 4MJ3A 2H5EA 3IUJA 2H8KA 3CFYA 4D4LA 1Y3AA 2PPVA 2FU5C 1DCMA 3A1NA 3IVMA 3HKCB 4RETA 5HFNA 1GAEO 2RD2A 2VZ8A 2I66A 1N2IA 1NXVA 1N5MA 2JK0A 4KQ1A 4L3OA 2JI7A 4WI1A 2HU7A 1RYZA 4UUQA 1JFFB 2QS9A 2VO1A 3PR2B 4KPUA 2DQ4A 4MHTA 2NMVA 2Z8YM 5IDWA 1OKKA 1PYOA 1XQ9A 1R6VA 1XJQA 2D8AA 3HY4A 1U3WA 4DUGA 3ONNA 1EWKA 2LCQA 5C5CA 5JU6A 2FQWA 3A4LA 1HT0A 3PWSA 4JI6B 2WAYA 1CETA 1M1NA 1V39A 4NVRA 5DW0A 4N7MA 4LWOA 1C30A 1LVUA 3I09A 4OMFG 2IS1A 5AW7A 1J07A 2BY4A 2WRZA 3NUGA 4TQUS 2HT1A 2FOLA 4ZI2A 2XHZA 2Y6VA 5HEKA 4MK4A 3A2NA 3ZJ4A 4ZRMA 1F8GA 2ZE6A 4YK7A 2YNMC 4MVJD 4NMWA 4EG0A 3QYFA 5JS2A 2ZR7A 2FPWA 2ZWIA 3AR7A 2FETA 1QIKA 1JXQA 3GI1A 1F2DA 1GG8A 1W4RA 2ZXFA 3AXTA 5HF6A 1P2TA 2RHHA 2VTEA 1IHOA 3TK1A 1KTIA 3MQFA 1E3EA 3B3GA 3L0CA 1DC3A 1EVJA 1U3FA 2NVUB 1COZA 2BM8A 3M6LA 5C1OA 3MTEA 3INGA 4DLNA 4IIFA 4G5YA 1BCRB 1O5IA 1XTZA 1FVOA 3LY5A 3WLHA 1ECFA 1MB9A 1N25A 2HK6A 5I7RA 1YO6A 2PZFA 1EGAA 2ENUA 2O2CA 1OLUA 1P9LA 4JS0A 1D5CA 3GPDG 3ZCPA 2GHIA 1RHMA 4E70A 2AN5A 5LQCA 4JHXA 2WFLA 1OLOA 1SG6A 2POCA 4K0RA 5KNCD 1C5KA 3PYLA 2CHQA 3PFCA 2EKLA 3LCRA 3ENKA 1YWGO 2BHLA 2WMNB 4FP9A 2XITA 4BKQA 4YLYA 5LOVB 2N47A 4D82A 1W88B 2XUOA 2GCEA 3QX7A 3I5MA 3MC1A 3PXUA 3I2JA 2HA7A 4I66A 1DBWA 3JQ6A 1FUUA 1ORHA 5FJIA 5ALYA 2C5SA 3UMJA 1SU6A 5EHZA 4DMFA 2JCYA 1NYQA 1E2QA 1Z34A 5AVYA 1M2OA 3L8YA 4W4TA 3JAKB 1HZJA 2E82A 1N5LA 4JASB 4JU9A 4XX0B 4COKA 5IF3A 1MLDA 1X9GA 2HL6A 2X8BA 4DN6A 5T64A 4UDYX 2GYVA 3DV0B 4XWOA 4FHGA 1CHDA 4CKBA 3R8FA 2VCYA 3OIVA 4PRLA 5K3SA 3QHAA 4AY3A 2C7GA 4KXLA 1ADJA 3UHFA 2FDCA 1O8CA 1G9TA 2NZWA 3K7EA 2AFIB 1LJLA 4U7TB 5CT4A 3W8EA 3R5KA 4KTTE 3GRUA 3THWB 1D2HA 3LDFA 3CEAA 4JYPA 3QENA 3C3AA 3KJEA 3QY9A 3UG7A 4Z4QA 1QHHB 2DSTA 5BP7A 1D1SA 1MO5A 3EH1A 1P2DA 4DMRA 1G2PA 4MEJA 4A0GA 1TA9A 4MTLA 5JSKA 2DUUA 1KAGA 4L9RA 4YMGA 1VPWA 2VC2B 4KB5A 4OK3A 3GAAA 4RTMA 4XQFA 2GBCA 4FTWA 4KAXA 1SXGA 1Q0LA 3DKPA 3HYTA 4JT4A 4YEDA 5FJJA 1W7AA 1M33A 2YJGA 3GRYA 2QMEA 3ZWDA 2H3HA 3RQIA 3HP1A 4O2LA 1OWLA 1Q1GA 3CX4A 1N2ZA 2Q7OE 4RZSA 1CJMA 1ZXBA 4PQEA 3ZDDA 3GG9A 5CW1A 4OTZA 2OE2A 2C97A 1GPNA 3QFHA 3ANTA 3SX0A 1YIAA 3T3GA 2A9JA 2RHGB 1E5XA 2PSSA 2X9GA 4KE8A 4O4HA 4FLFA 3U1BA 1KU0A 1NW6A 2J08A 2IIVA 1SXJC 2PUJA 4NHEA 3EE6A 4QUHA 1E89A 2HU2A 4K9SA 2NZVG 1YH3A 4R8VA 2NO1A 1LFDB 2C9BA 4QDXA 1ECBA 1GVNB 1FRZA 2BFCB 3IPRA 4WVLA 3LL4A 1U02A 1DG9A 3I32A 2IYXA 5SY4A 2X0EA 4HV4A 5EP3A 3T3IA 1WCYA 2C59A 4NOKA 1QAOA 3EWAA 1I10A 4QV2A 5A8AA 2QMOA 1LLDA 3EBPA 4F91B 2IH2A 5CDGA 3PRKE 2B5OA 1AKRA 1XTTA 1N77A 5F3WB 2B4RO 3N05A 4EGJA 3N07A 2ZUFA 2G08A 3FYUB 1CP3A 1GN9A 4BNVA 2CBXA 5IYZA 1Z6ZA 1QPBA 4WK0B 2YHSA 1QYDA 1M2NA 1YI1A 1Z13A 5K8LA 2AWOA 1VHTA 2ZB7A 3FA2A 1EVIA 4IX1A 4O4JA 2JFZA 3EGCA 4HDSA 3JWIA 4TKVB 1Q0ZA 3W2IA 3COWA 3VH4A 1OYVA 3EDCA 4JLWA 4ER7A 2Q1YA 1J5XA 3BJMA 4QUJA 4ZZIA 2ZSHA 2ZJAA 1NJ2A 2NUTB 3KYBA 3SFZA 2QX6A 1JHYA 1UXOA 2OL4A 4WLOA 3FMOB 5DFAA 1AQLA 3SKBA 2GBLA 2QP3A 3OP1A 4FMPA 5TNXA 3EFEA 3FB4A 1WMAA 2BI7A 2RK6A 4C5BA 4JBWA 1NUPA 4IKEA 1JTEA 1M1YA 1P1RA 4QXQA 2E2WA 5C37A 5EJGA 3AU9A 1PV2A 2G63A 2VBGA 4N0DA 3EYAA 3AF3A 3N75A 4E30A 4LFAB 1M73E 1UD8A 3Q4GA 3EGEA 1YK0A 4J0QA 1F60A 2YJ5A 5K3DA 3LC0A 4QJ4A 4RDHA 2YV2A 2E4ZA 3A9RA 4JUDX 2UVQA 5HBGA 1BDHA 1NYRA 3VR0A 2YV3A 2IYOA 2LTAA 2L2QA 1PF7E 2Z5FA 4ZCQA 4OQEA 1XRJA 1TTHA 3HUTA 2WD7B 3GGGA 1PZEA 3O8LA 4O4LB 3VNSA 3A1SA 4IGAA 4YT8A 3W06A 1YGYA 1PDWA 2QLBA 2R00A 2QZSA 4GR4A 1A8IA 1CB0A 4NMMA 1DELA 2SICE 3ANSA 2P9HA 2YIDA 5CHEA 5LA6A 4DA6A 1GTL1 4PC3A 4OP3A 4GEGA 2PLAA 1J23A 1X7YB 2GFHA 2R6FA 1I7LA 2RHWA 3V55A 1P44A 2JD1A 2OCIA 2YZ2A 4TXMA 4MARA 4BXOB 1QWSA 1WR8A 2QRVA 4F2PA 2Q2OA 3CCRB 4E07A 3VO8A 2DY0A 3DL2A 4LJRA 5GIPE 5IJZA 3CO5A 2JAHA 3T9DA 4FB5A 2G0AA 3LKDA 4AO7A 4JGBA 4LUCA 5SZJA 4OXQA 2QEQA 5TQ2A 4V24A 1DC5A 3AGQA 3MJ4A 4U6SA 4DRZA 1PJ3A 3UXHA 2ZIVB 1KJNA 5LBTA 5JAIA 2PJRA 2O2SA 2QE6A 1ETHA 1ZUD1 4TV8F 4EA9A 1W34A 2DPYA 4YRIA 3EPJA 1FB5A 4NBWA 4J16A 2GD1O 4M9QA 1D5WA 1IBRA 5FI3A 4C4TA 4HAZA 1JQKA 2RCYA 1YA8A 1IUPA 3CP2A 1RPAA 1W19A 2BCGY 4PYJA 1UJ2A 2CVZA 3GRZA 4N3AA 4XARA 4I9HA 3K71B 4HT3B 2DWCA 2IU6A 4NCKA 2BSAA 1ZJ6A 3L4EA 3NBFA 1RAAA 3ZZ0A 1C0PA 1K7YA 5FLKA 5EESA 2HA3A 2Z56A 3U0BA 4DV0B 1Y0YA 4CMBA 2RGXA 2I8AA 2MSEB 2E4UA 2C5FA 3DMGA 1QVGB 1DBIA 1LX7A 2C95A 4FW8A 1PJCA 2P9EA 4E0FA 4QJ5A 4EY7A 2FLWA 1CQPA 3GVKA 5K3FB 3WVNA 4BCDA 3ICPA 2ISQA 2WPDA 3Q9LA 5BT9A 2UZAA 3AKDA 4PS0A 3RKUA 4XN3A 3MTQA 3IAHA 1SQ0A 2I4OA 2QGZA 4TS3A 5K8TA 3NEJA 1VE7A 3FAKA 4PZZA 1Y33E 1JTFA 2WMYA 4J7XA 1GGJA 8AT1A 2VF2A 1HDIA 2VDWB 3AUFA 2OFFA 2HCJB 1B7GO 3L4JA 1H23A 2FEAA 4R0NA 5B2EA 2HPHA 1OA1A 1A2OA 3L8EA 3ROGA 1H4QA 4JEUA 4WH0A 4JSTA 3BMOB 1JB1A 2DUWA 2G9QA 3FE2A 5K4HA 3ZVMA 1NXTA 4YDHB 1FYVA 4U4AA 4QPNA 2UYQA 2ZL5A 3JWGA 3JU4A 2IP4A 4LDPA 3VPHA 5EP1A 1G41A 4BIMA 5IP5A 2JFNA 4KRYA 4EHNA 3VR6A 1A76A 4LF4B 4LQCA 3IPLA 3CC2B 2CT8A 1OI2A 3NRCA 1WM1A 1PJ8A 4H16A 3LSYA 3V2HA 3MELA 3EQ6A 5AD1A 3ZE7A 1RJGA 2VCEA 1E2GA 2BGWA 5KMGB 1QYVA 3EZYA 3O4IA 3A0RB 3WL5A 2OYSA 5CIQA 4D6PA 1OROA 3CN7A 4BQSA 4K6GA 4ID9A 2QAJA 5G1NA 1BCSB 2RC5A 4JQYA 3QU7A 4CMIB 1VC2A 4DM3A 1GFSA 1L3IA 3PPYA 3CB2A 4YFVA 1KJQA 3N28A 1I7QB 5JECA 3CZ5A 2V3WA 3K9GA 4LK3A 1WVIA 2PX3A 4TXNA 1MAUA 1WHTB 4TYYA 1JLMA 1P0PA 3LX5A 4HWPA 1DIHA 1MJ5A 3ZLVA 4GR5A 4OLHA 4WKNA 2QN7A 5JS6A 3OIUA 4KACA 3PE3A 4Z4EA 1J9ZA 2BKEA 1H8EA 1LS6A 1Z4NA 3WK7A 5DI3A 4GOOD 3GLUA 3F6RA 2OC9A 1YHQB 1SJ9A 4F2WA 4MI6A 3KUUA 4ADSG 2OB1A 4MIKA 2L19A 3MN1A 1WETA 2EKBA 4RK7A 1Z63A 2W2NA 4I99A 3GEHA 4WEOA 2ZRKA 3P2IA 3QW2A 2NUAA 2WJ4A 3Q72A 1KRWA 1G4AE 3N6VA 3WHIA 1PWEA 5J4YA 3L41A 1CX9B 2YC4C 3DD5A 3HS3A 3NYIA 4H1TA 4RS4A 3L0BA 1C1HA 5CB4F 5CT9A 3P9SA 4YGYA 4PZYA 4O02B 3BSSA 1U3TA 3EGIA 5L3ZA 2MHCA 1UPAA 1U4OA 2A57A 3TSYA 2O5VA 4GKVA 1CD5A 5SY9A 4XYGA 5FNVF 3A8JA 4GOXA 3QWAA 3HFJA 1IH8A 2UAGA 3T3MB 5IAGA 2XKAA 3DBOB 1E64A 3BQMB 3TRHA 2FZWA 4ZP1A 3VXKA 4CV3A 2SCUA 2WYWA 3UC5A 2AUTA 3QSGA 2P40A 1HE2A 4G5OA 4Q1AA 5F21A 4C21A 3K8ZA 3MQ4A 1QDLB 5K0JA 3RG2A 3MD0A 4LRWA 3FTFA 2Z4TA 1E3SA 1IN7A 2QN9A 5L51A 3ZZMA 1BFUA 1U8UA 1XHFA 2O3QA 3U9LA 1XBTA 3QG1A 4CMEA 1YZTA 5KSYA 1CT9A 4P92A 4N76A 3QXJA 3KR1A 3WJ1A 4GRIA 1Y9JA 1FFCA 2GA9A 4HAUA 4MWGA 4Y1RB 1YB4A 4D44A 5C8VA 5IVPA 5KBYA 4LBZA 1KEKA 2QPOA 5DM4A 2ZI7A 1GSIA 1NN5A 1T1RA 1XAHA 2H48A 4ZT7A 3ZE9A 4DABA 4CMEC 2ZM6B 2IV7A 1DRKA 2Y0DA 4YMVA 3E9RA 3G6KA 4GDFA 3OPYI 4GXRA 2EEZA 3F5MA 3P0JA 4FDAA 3WSWA 1WDLA 3QJ5A 5L6MB 1XJWA 4D3SA 2O8CB 4J43A 1YOVB 2IX3A 1L4GA 1V26A 1Z2EA 3OPYB 1ZP6A 2XGSA 2WSMA 3PXBA 3T7CA 4PTLA 4Y9UA 4DDHA 4M9RA 3WA7A 2ZVDA 4FZRA 1IY0A 5HSGA 1MIOA 1DQNA 4EYOA 1NDHA 2V5VA 3ADOA 4B0PA 1PAUA 2JFUA 2QENA 3CBQA 5JWOA 1STOA 1MC1A 3BB4A 4OQMA 5JBQA 3ZE6A 2OT3B 5AT1A 2EFCB 1K9SA 3D4IA 4YRJA 1LJ8A 3PC7A 3HY6A 3VAAA 1UDXA 2Y0CA 4P36A 3VR6H 3H05A 4X9XA 2X22A 1GQOA 3K9FC 1OD6A 5KTMA 4JYZA 5FOVA 4CGYA 5AJUA 1ZU5A 3F7MA 1NNUA 3LF1A 1QV9A 1FEZA 4I55A 9ABPA 1KOLA 4PLVA 2C7RA 1QK3A 1P33A 4C0JA 2II6A 4K9KA 4RFVA 5B37A 4RJJA 4W5HA 5BORA 2Q3FA 1SOUA 3P20A 3LA8A 2XF8A 1XVIA 3DE3X 3LOPA 4QUDA 5FP0A 4WE3A 3RRNA 2F8LA 4GQNA 2V03A 3VTZA 1HNWB 2O8BB 2X8WA 4HC4A 1M10A 1Q19A 1NJ5A 4LDZA 5WRFA 3TNDA 3DOJA 3GQBB 3HRHA 3X1ZA 4BP8A 4E5VA 3UUWA 3FBTA 3N8IA 4LWQA 3Q98A 4PFSA 4HMOA 2WWVD 4EMTA 3LQQA 3TUZC 4KX5A 1UC8A 4RH0A 3TCNA 3A14A 1EFTA 3TXXA 3LDUA 3CNOA 5CFPA 5B1EA 1U2SA 1GRVA 4DIUA 1T9ZA 3OKXA 1W1WA 4OCZA 4TLLB 4WASA 4DLVA 1D0SA 4N4AA 3UA3A 2VDOB 1RAHA 5CVVA 3EIHA 3STTA 5KW9A 5B7GA 3AUKA 3JYOA 3OEEA 5KU1A 2DCUA 3M4JA 3KB8A 4NAUA 1SZPA 3OE7D 5FRDA 4F9GA 4JI3B 1U28A 3H2HA 2CL5A 1SWVA 1I5OA 4JLNA 4KMSA 1I18A 4PYRA 1SG9A 2EQ5A 4BZWA 3J7AC 3CLVA 5F7OA 2Z83A 1WP4A 3SZOA 4B75A 1K4YA 3Q9SA 3BWMA 2MYTA 3OLWA 3A4TA 3D9QX 1SC6A 3V4RA 1VHLA 1XKXA 1V8OA 4KL8S 1XMPA 2B4TO 2X9LA 4UUBA 5DLPA 5GONA 5AW9A 4Z4ZA 1Q84A 1GDHA 1XKLA 3LVQE 4INJA 4WUVA 4R69A 2FW8A 2GBPA 1OTHA 3S2ZA 4EUSA 1AMOA 2ODWA 4RANA 3TN7A 3CLUD 3CUEF 2A9VA 4MO2A 2W70A 2QRNA 3PQ8A 3BZUA 3AHHA 1F0KA 3BX1A 3MCWA 4KU4A 3W6PA 1J25A 1ADBA 2Q6TA 5G0WA 3A3NA 1E4VA 4UREA 3VR1A 3KZ1E 1M7GA 1A27A 1ODFA 4KKSA 1OLXB 2HUPA 2OILA 2WNIA 3GJ4A 3I73A 2FPGB 3KCNA 4QJIA 3RM3A 4EFDA 5JG7A 4AJIA 1OFIA 4F86A 2BFBB 1Q1ZA 1VHEA 4MUMA 5EKXA 3CRQA 3L40A 2PUBA 2VP0A 2AFHB 3IQFA 1TT5B 4NLLA 2XNDA 2OBFA 3H6GA 3ZJ5A 4X90A 1EK2A 1NU8A 1BZYA 1VSQA 3IQHX 3LS2A 1V25A 1J2JA 3TLXA 1G7RA 4CMKA 2QM3A 2CL7X 3AT1A 3DBRA 4RM3A 5E6RA 1JJVA 4JCCA 1ITZA 3SKXA 4EO9A 4XUEA 3SY8A 2R2AA 3H11A 3T3DA 2WAXA 4WOJA 5ARCA 5A4AA 1DC6A 2NZYA 3I6BA 2IC5A 3IBCA 4BNWA 5BNWA 1IM2A 5BWBA 5IUNC 5DLQC 5ALRA 5GJBA 4CIDA 4F11A 2QAGC 5TJHA 3T12A 4L51A 2H08A 1XYGA 5ELXA 3WIBA 1JV2B 2FGKA 2EWMA 1V45E 3OY2A 5KVQA 2OBMA 5BR7A 5ICCA 2YIVX 4PAGA 2QLFA 1BHJA 4DJ5X 3SKVA 1U8ZA 4YQZA 4Z7QB 5ANRB 2H6EA 3M4XA 4G5XA 4NBUA 3PQ2A 1Y3HA 3NBXX 3NTXA 4QYXA 3CLSD 4Z0PA 1RC0A 1CY7A 2PX2A 3B70A 1V5VA 1SA0A 3BFVA 4FK8A 3DEAA 4MWOA 3UJAA 4DT1A 5I51A 4AKIA 2FUCA 1N2BA 4L28A 5M3BA 5IYPA 4M87A 5LFAA 3GJ3A 4MR7A 3ECCA 2K4MA 4U2BA 2PWAA 1Z68A 3ORQA 4ZU1X 5I7VA 1OSNA 1RWXA 1U9IC 1RZVA 3M5CA 2PJUA 2BGKA 3AY3A 1M34E 1T15A 5CU7A 1M8PA 1NVFA 4BFWA 1A4RA 1GD1O 3D7RA 4BNIA 2GPAA 4BO0A 1COWA 3SF8B 4EHAA 5FORA 3E81A 2CJXA 2CE2X 2H2AA 1AC5A 1H0SA 1Z0KA 1JE1A 4IH4A 2WB2A 5EUQB 1XZHA 2X40A 4LV5B 5DNWA 2ACWA 4ZI3A 1O94A 3F90A 4BASA 4MAFA 3ENWA 2W4MA 3ETHA 4KGXA 2IS6A 1BFDA 1W2BB 4P83A 2PZ8A 4LE0A 4IXDA 5TXGA 4XLEA 2WW8A 3BGOS 4LPKA 2QMQA 3CTPA 5A6SA 1NQVA 2J33A 3B52X 4G81A 1DKOA 2XY4A 1Y3BE 2GEFA 2VHZA 2AMYA 2I33A 1RIFA 4ENRA 5M5BA 1TIPA 1A9XB 2Y1FA 4N8SA 1CBUA 5MFZA 2H1OA 4LJ7A 1Y7TA 1MT0A 2JFQA 4PQRA 1QR6A 2ZIXB 3QFCA 4UATA 3AHEA 3DBHA 3QA3E 4LDNA 1V9LA 4NYJR 2ZJ4A 1ATZA 5A3QA 1ST2A 3UWKA 1XV5A 1NLUA 1AN0A 1BFKA 3E58A 3LDAA 4V39A 5LYJF 2UXCB 3OWOA 2QD1A 5K6AA 5BVHB 5AW0A 2X6WA 2CUNA 3OTWA 1GZDA 4L75A 1JR2A 1C9JA 3QOXA 4JQZA 3JV7A 4CXMA 2DQYA 3AR4A 4AJKA 4JXJA 3EXAA 1HQDA 4WN9B 4EY4A 4OPSA 5T8KC 1E3IA 3KSUA 5SY6A 3SZLA 3VKVA 4OJTA 4HE5A 2FDXA 3L0ZA 1WB6A 3VI4B 3CW8X 4CL2A 4FWIB 5TPZD 4NAHA 1LWNA 1JHZA 5L4LA 3OCUA 1T3ZA 4DRYA 4J0JA 5KNBA 1MOZA 2WVJA 3S3TA 5DLYA 3W1VA 4KV9A 4MLCA 2J0QA 1FMJA 1VYTA 1FDWA 3VHLB 1CC1S 2HXYA 3WYEA 3E9CA 3B48A 5K3BA 2V7PA 1R15A 2IEIA 2J9FB 4IDEA 2ZSDA 3E27A 5IARA 4A8TA 3NRBA 2X0JA 4ESHA 2GVDC 2O7VA 2OBYA 1ANKA 1E6KA 3EGXB 4QG3A 2ZBDA 2XE6A 4YR9A 3FUTA 3WAKA 1Q6ZA 4KITB 3ZGLA 3D8BA 3DTNA 3S68A 3OMLA 1VIMA 3SS8A 3DLBA 4N7BA 1QH8B 2CV0A 5C5IA 4ROXA 1CY1A 3M0EA 3O31A 1ONSA 1HQYE 1CJSA 2Q6OA 2C88A 2PZKA 2I8CA 5LLTA 4RHFA 1EP1B 5EMMA 1BTOA 3N0VA 4NAVA 1A1SA 3HXKA 1GGEA 1CDZA 5H83A 2NV2B 1JEJA 1II8A 3SQDA 4N5LA 3KFLA 3TDNA 2OFXA 3SLNA 3ZY2A 2FMUA 2RSLA 1V11A 4CN8A 4LF8B 1FDUA 4LCBA 1NY6A 4MLDA 2ZKLA 4E1AA 1Q1QA 1VIDA 3O9VA 4NV0A 4F3YA 4UTPA 4BNFA 2IT1A 2HGZA 2VQ6A 4P6VF 4Q1CA 2AMLA 2ABWA 1W5TA 3G5MA 4HGPA 4MYSA 2XYRA 2FKNA 2AF4C 2REQB 1GUBA 1OF1A 3TS1A 4O08A 3CSDA 3OUZA 1XE1A 1L7DA 2JHAA 2Y67A 4G07A 3D3QA 5AR1A 1M5UA 4BQFA 3TLKA 2R86A 3O9ZA 3KEQA 3G7SA 4I5DA 3QOWA 2BUBA 3SYRA 2PT9A 4B83A 3IEUA 3NO4A 4AG3A 4MAMA 2J67A 5HJ7A 2ZUCA 4XVUA 1HG0A 4ROSA 3M1YA 5I7UA 2YWGA 2B8WA 3OCXA 3UN1A 5LQKA 1Z5NA 1EHIA 3S29A 4FGJA 2ZROA 3Q6IA 2HT6A 3AEQB 4FFPA 3CKLA 5C1IA 3T38A 5FBVB 1D2AA 2C1XA 3RLIA 3MCTA 3RYHA 2D5CA 5KOYA 1AZLA 4CT0A 4AMBA 4MDEA 1QTNA 4XSHA 4A8JA 1F4VA 4PO3X 4QUGA 3OZSA 4QBHA 1GPBA 4MCIA 6REQA 3IUEA 4BB5A 3COZA 1RI3A 5ITZA 2OBSA 1G1MA 1SPXA 1KHHA 1D8AA 2A33A 3A05A 4V1CA 2G4VA 5AVSA 3AM4A 3PFNA 1TJ3A 3IQWA 3EDMA 2O8DA 2AJDA 2WWHA 2HEGA 1KOGA 1O97C 2QT1A 3L0YA 1VL1A 3V8EA 4H3SA 2PV0A 2QUJA 3AKEA 1XT6A 4IXNA 2XUQA 3M1IA 4LJ8A 3VYUB 1JEAA 3GMIA 1V7PC 2JRLA 2QLMA 4C04A 5I7SA 5KHLB 3GLGB 1PEAA 2UYOA 5JAZA 2F4VB 1YNOA 3H1GA 3IHWA 3CLKA 3MWEB 4RSMA 3MXTA 1RXCA 1FVFA 2HU5A 1ZOOA 4QHTA 4J2OA 4UNQA 4ZPJA 4EPTA 1FXWF 4NBLA 2B1RA 1SBZA 3SX4A 4ZOLF 2PUEA 2ONYA 2YWXA 1C1DB 3MNFA 1LPOA 4D79A 4KZPA 3MPOA 1Z2OX 3K0FB 1MO2A 5ERGB 1M8GA 2GBFA 1DJOA 4MV5A 2XRZA 3LKVA 1I0ZA 5F1OA 2JJYA 5B5SA 4MCHA 4LXQA 5CJPA 1BVRA 2FSUA 3OI7A 1WU7A 3G2NA 2ZYIA 4BBAA 3CF2A 2ZKIA 4GGPA 3I62A 2A86A 3VH1A 2FMHA 1ZCJA 2OC4A 3JWJA 4R54A 2ZYDA 2IHBA 1BXKA 1CUHA 2HPVA 3GZTB 4CF6A 4N41A 4L5YA 1YJ9B 4C0WA 2WYUA 3DOHA 4MZXA 4ZAFA 2Q3MA 3K9BA 5DNVA 4CR8A 1YUBA 1SHJA 2LUOA 4MRMA 3RV4A 1RPTA 3JAWB 1T2FA 5KNBH 3FWYA 1O9HA 1WZNA 3JARA 2G0NA 1T2VA 1T1SA 2DKNA 3FPEA 3ITEA 1VL6A 2ON6A 4NZYA 3RHTA 4F9TA 3ORFA 1SQGA 2FUG1 3FPSA 3OE4A 3VSCA 1KWKA 2X53S 3V42A 1OYOA 3PZBA 4WBNA 1I0LA 2HBQA 3Q2IA 4A0FA 4LNUA 4WCFA 3AEZA 4C7JA 5FWDA 4EO4A 1G5QA 1QFMA 3CF0A 4HWRA 1RPZA 4YFYA 1GSAA 1GTMA 1OX5A 4FE3A 4AMYA 1V7QA 3FTQA 2CNWD 3E8SA 1VE5A 1T9DA 2B4YA 2FCRA 1M7BA 1H2XA 2G5GX 2VEDA 3KR9A 4G4SO 4MR9A 4IV8A 4IF4A 2YL2A 2NU7A 3G2MA 2A9OA 2XVMA 4DEYA 3F9RA 2AYXA 2EVWX 1AXRA 1K9MD 2Q21A 3H97A 2P8JA 4U39A 3ACDA 1LLCA 3K20A 3VPXA 1UADA 1TAGA 4Q4AA 1AGXA 4LMRA 4RPLA 3FFXA 4FJ0A 3QV1A 4GXQA 4Z2YA 3NAMA 3TNYA 3VU0A 4YYEA 4ETMA 4QU9A 3OFSA 1AKYA 2WWWA 4YUWA 1GZUA 1X0XA 1N3YA 4YCLA 4HXEB 1AK9A 2GJ4A 1CY6A 1ICIA 5KYUA 3HZOA 4HX2A 1SFRA 4TKUA 1USIA 4BEJA 2BFDB 3H42B 4EDFA 4PR3A 4FM9A 2OCLA 4ITUA 5K0GA 1E1MA 3PC4A 5A5GA 3KVRA 2HMYB 1EU1A 2VOEA 3P9ZA 1T10A 2X2PA 1VQ5B 3QVXA 1P4GA 4YLGA 3R6GA 5HFJA 1XZBA 4D0RA 3RADC 5IJWA 1GZ6A 3CTAA 5E8RA 4GH5A 1C8KA 3EGVA 1QGDA 4M1KA 3R3YA 4O2AA 1MVOA 1D0VA 2IXAA 3KQSA 4CKEB 1QB7A 3I12A 3A1CA 4MQ5A 3WJ2A 1A95A 1ODKA 1RCFA 1S8AA 2AEJA 3OHMA 5ES4B 2CE7A 3JQAA 3T9BA 4KPGA 1F8UA 5AJXA 1NVUQ 1ODLA 3STUA 2XI4A 4Q82A 4CM8A 5C46F 1Q57A 4L5CA 3CN9A 3L7DA 4A0RA 4CR6A 1OIXA 2IV3A 2XTNA 4OYYA 2YBDA 3ZHQA 2HFJA 2OM2A 1KOJA 1NBOA 3FH0A 3PEYA 5GMOA 4B3TB 1OBCA 2B92A 3H1EA 2WJ6A 1MIHA 2PKQO 3KQPA 4LDRA 5K3AA 1ZNQO 2ZTHA 5B64A 2PKWA 1Z26A 4YGXB 2QX8A 1BAPA 4MPPA 3INRA 2HD4A 4HN2A 2QJFA 3OC6A 5AK3A 1Y9EA 1NW8A 4DQ0A 1QVRA 1ZJJA 4UM5A 1IEVA 1ORTA 1Y7IA 1Z74A 2VK4A 3AM3A 2C2BA 3IXQA 4HWOA 3ECSA 4E2WA 3ONEA 5J4HA 1NF8A 1XG5A 5KU7A 4G0QA 5INTA 4ZAWA 2KLHA 2OG2A 1EFVA 4FB4A 1KNXA 2JASA 3VOTA 1CR0A 1YSCA 1TJ4A 2JFPA 2Z5GA 4NONA 4O5OA 3NI2A 5DGDA 3D6VA 2A3RA 3H84A 5DLDA 3EXFA 1Y5RA 1KY4A 2RK3A 2ONCA 1JJBA 1LW6E 1JTVA 1YZNA 4R2XA 5E2AA 3IPXA 2I2XB 3BH0A 3AM1A 4Z6KA 1O6FA 2QTCA 1Y5MA 2ETVA 4CG1A 1H8HA 1QKJA 3C87A 2XADA 4Q48A 3HKEB 1QVAA 3MTGA 1OE0A 1C3OB 3MERA 1RXYA 3KS9A 2B20A 2ZB8A 2DTXA 4OA8A 4S2UA 4BVJA 3HADA 4M3NA 5EPEA 4ESOA 3KKPA 1E7SA 4JQOA 1AY0A 3TW0A 3CESA 3SF0A 4HWGA 4P80A 4FNGA 2DBRA 3MCZA 3K0AB 3W7AA 4KYVA 3MJDA 1NXPA 2DBQA 2A2ZA 3O8OA 1N0UA 1U0OC 2C84A 3D54D 4QULA 1DWQA 1EVYA 3HA5A 4UCFA 3ASTA 1AA6A 1X9IA 4N6OA 4ZT6A 4QSMA 5H9VA 1H94A 1UBHS 1GG5A 3K31A 3ND8A 3WP0A 2BR3A 3ASRA 3LKZA 4G0PA 1N6IA 3CF4G 5KYYA 4WNAB 3ZDFA 2V4DA 4UXIA 5CA1F 1BDIA 1USWA 2WE8A 3P4UA 4R01A 5IVKA 2A5DA 4D9GA 1IIBA 5E6SA 1IU9A 2RDMA 3B6MA 1CS4C 5FI1B 2ZTUA 1TX4B 3ADPA 5DCWA 1YDWA 2B0JA 5IBQA 1QLWA 4X93A 5HA5A 1EVQA 4LVOA 4MUAA 3SBDA 4BQPA 3I52A 3JQ7B 5GGYA 2CZGA 3ZGVA 4KREA 1FP7A 3FPCA 3MOSA 2FN3A 4UJ5A 5I8PA 4UAGA 2GKGA 1VJCA 4ZOQI 5B4UA 4QAJA 2CB9A 1GITA 1XTQA 3I9OA 3BXXA 3JASA 2O2YA 3L7IA 3NP7A 4WMLA 2C4UA 1EIZA 2I0FA 5DSTA 5ENDA 4P3PA 3RVDA 2LIVA 1ADYA 1SQ6A 3BJIC 4PQYA 2HQSA 1T4GA 3ZUGA 1AB6A 1M1YE 4QQKA 3N58A 4YXWD 3BXHA 4ICIA 4K9DA 2OV4A 4FR0A 1TTTA 1FDTA 2FW9A 2HR1A 1P75A 5D7NA 2OKGA 3CX3A 2E18A 4WV3A 4P5PA 3S40A 5A1TA 3GPBA 1QVFB 1CUGA 1PCXA 3E7WA 1II0A 1NNEA 1TFRA 2R5WA 4RULA 1NRKA 3LTEA 3GOQA 1P1FA 4KO3S 5ALLA 4BNKA 3DLHA 1V1MA 2GAJA 2O1XA 3SSOA 1CUZA 3ZS9A 1Z4OA 4QXAA 1JAZA 1LZKA 4POOA 3KDPA 1N36B 4ZHSA 1FU7A 1RRMA 3Q12A 2NW6A 1R6DA 1UOQA 4PFQA 4C3VA 1BJTA 1CUAA 2GMWA 1Q81D 4IDQA 2WTBA 1VQLB 5D51S 1QANA 1DE0A 1PX2A 2H31A 2ZWPA 2PKXA 5LSAA 4HUQB 4ZQFA 4HLNA 4R3UC 5B2ZA 3CCLB 2RI6A 2PVPA 2JIPA 3PGKA 3F4LA 1CJVC 3L92A 4Z7NB 2HHLA 3VPCA 3ETDA 4M0FA 2IH4A 2JHFA 4PGFA 3C3EA 4Q6BA 3OWXA 1FFBA 4PLHA 1T36B 2WJYA 4IW3B 3JSAA 4IZ6A 5A3RA 3B6JA 3K92A 3ZD9A 3EVNA 2P2SA 5EZYA 5DM2A 2XVXA 4H60A 1EUYA 5ICSA 1U2DC 2IOFK 5A0VA 4C43A 5DP2A 1W94A 3TW8B 4ND1A 2K2WA 5HS6A 3CSSA 5KYKA 1NJID 4O8ZA 1UQRA 1RWVA 3UBMA 4CQNA 1UZNA 3JD3A 4M6WA 3SC2A 2QVCA 4DCCA 2FZGA 2BYTA 1KQPA 1BQ4A 1NVWQ 4RA6B 2HWYA 4B87A 5EHQA 4ER3A 1NXSA 5I9MA 5HQ3A 1TKRA 4KVAA 3VU1A 1XWWA 5JLAA 3OTGA 1W36B 1MH1A 3G0DA 4YUXA 3DNPA 4F4UA 3QOYA 5LUAA 1DWOA 2L0XA 2WILA 3OT4A 2R2GA 4X97A 2J5KA 2C0QA 2C9CA 2YWDA 3K8YA 3KELA 5E7MA 4CUJA 4PM4A 3PL5A 4OP7A 3AIKA 1Y5NA 1P8AA 1DKLA 2Q3EA 3X2SA 4BMPB 1YS7A 2HA2A 4IUCS 4JJGA 5AM1A 4CKCA 1XELA 2DF8A 1TO2E 3JQ9C 2VDKB 5HF8A 4JY7A 2VNHA 1E7WA 5D3QA 4NCBA 3I76A 1P81A 1VFPA 4LVNA 3Q15C 4AU1A 2OK8A 2ENWA 3P9IA 4MH0R 5DYIA 5EJMA 3FHCB 4C6RA 1Z4JA 3PR1A 4PLWA 3AI1A 1CF2O 4QRIA 2GK6A 1PFWA 3QEOA 5IBRA 1FRVA 3AILA 1BIFA 3NASA 4Y2GA 4EAQA 2V1UA 3PNOA 1K2VN 1T2CA 1BMTA 3B51X 3C43A 1DJLA 1ONNA 1RHUA 3AZPA 3U16A 3GJXC 2VWQA 2FE1A 1NW4A 2G28A 2OV3A 5CM2Z 2NZ2A 4JUFA 1ZL2A 4R1MA 3S44A 3IHKA 1W52X 2D7JA 3K96A 2QJRA 4TMKA 2HLDD 5ADHA 2ZYTX 1VPTA 4OQYA 4UU7A 2GAIA 5C1BA 3GD5A 4ILEA 3WLPA 1GXSB 2FMFA 2P0AA 2GTPA 2PGOA 2VYND 4HDMA 4FE7A 4L95C 1U6KA 1ZD3A 3PITA 4D98A 1VYHA 4IDPA 3RC3A 2H9IA 5EINA 4KPYA 1FTWA 3ULKA 1MPTA 1RPNA 3FNRA 2VNAA 2AFVA 4FILA 4OHOA 5LB4A 4GSKA 1ODTC 1ZK0A 3B36A 5AJVB 4FCWA 5BNFA 3U4GA 4TV9B 1RXWA 2AUNA 2I55A 2QOEA 4WBXC 2KS6A 1SD2A 3IP5A 4BX9A 2A94A 1HLDA 5GAJA 2XYPA 3LBHA 1BKSB 3L6BA 1DFHA 1QYWA 2JGMA 2PWPA 3AJ8A 5AOAA 2PUDA 1YZUA 3BD7A 3F3MA 3WGVA 1EUZA 4X7EA 1X86B 1BMFD 2ZW9A 1C2YA 1M2HA 1ZBDA 1K1EA 3B9QA 3CLSC 3GZ4A 3JR3A 4ZVSA 3WDMA 4QOFA 4RCZA 3AM5A 2WYHA 3L46A 3ZXIA 4F3NA 1TCUA 1K75A 2EW2A 4PLFA 3NONA 4CKZA 4G23A 1EX7A 5IBCA 3AVOA 3HJFA 3IODA 4Q4LA 3RG8A 3ISXA 1NVGA 2LE0A 4F4HA 1N05A 4FMBB 1HNNA 2R97A 3D02A 3QKTA 4IINA 4MUXA 4GYWA 4D02A 1PV4A 1G59A 2GXAA 1QO0A 2BEWA 2CJFA 5K0SA 2P5SA 4B35A 4C0AC 2CRVA 2B8TA 2IP2A 2J0EA 4NPAA 4RNDB 4UZEA 4NYMQ 3DDZX 3FNIA 3OQPA 3O9MA 3QTTA 5ER6A 1D1PA 1P4AA 1UUFA 2EWVA 4Q00A 4ZCIA 3D0KA 4GMKA 4ZO8A 4EA6A 5F9FA 2EG5A 3Q6RA 3HHEA 4UMFA 3F49S 2OCXA 1WV1A 2KBEA 4UDNA 1YRAA 3FG9A 3Q1KA 5GJWC 4OOSA 2J31A 1P7VA 5FOXA 4FN5A 1Z07A 2Q5EA 2WTMA 3N3AC 2HF8A 3P2KA 3Q8WA 4TYWA 3EBLA 1TTQB 3GJZA 2YXDA 1W2WB 2EBUA 4IUBS 1BXRA 1J7JA 3H0KA 3ZXXA 5T4FA 1O7JA 4EZBA 2ZE8A 4Z2AA 4JOSA 1X8LA 3U4HA 3P2JA 4LXUA 3Q5DA 4GX5A 2ZJZA 4UC0A 3OZFA 4KJZA 1W1UA 1G2QA 3KKOA 3LYHA 4JUAA 5EKUA 4DK0A 2OKCA 1ECLA 3PG5A 1O2DA 2DTEA 4I9GA 3VU8A 2I6SA 3V8RA 2AWNA 1ABBA 1USVA 1R9GA 3DVLA 3IT3A 3NBYC 5AKGA 4MTCA 2ASEA 1N6HA 2ZB3A 3KPWA 4HFNA 1JDNA 3FZQA 4X7BA 3MM4A 1SKBA 1TLFA 3LUCA 2O19A 1FQWA 3QWFA 5REQA 4E11A 1F51E 2HM7A 4KIGA 5BSKA 3KSBC 1DAPA 3ZCRA 3W6ZA 4ZC1A 1XQ1A 2WIKA 2JW5A 2H7CA 2ZQYA 3QPBA 4WNCA 3RWOA 3BMCB 2XNHA 1J06A 4UVDA 2RIPA 1SN7A 1ZVMA 2O5RA 1KWGA 1UWVA 5JO9A 2CJWB 4GRDA 4OAQA 1PJTA 1C1XA 2AQHA 3T15A 4M0MA 3PQEA 3D2AA 4PC2A 4GEKA 5EWJB 2VG8A 1L4BA 4PGMA 4KXFB 2QD5A 1Y8QB 4F5DA 5EMJA 1UQUA 3OE1A 2I4RA 4ZO7A 4Q16A 3LT5A 8ATCA 1CVRA 4JQCA 1JVNA 3A3BA 4FFLA 4OK6A 2H1SA 3IP6A 5IC4A 1ZLYA 1J0XO 4QATA 2FKAA 3F8TA 5EYPB 1H4SA 3WGQA 2RAFA 3VBEA 3HXTA 1GLGA 1TL7C 4P4SA 5K01A 1OI7A 4ZANA 1JFVA 3O8RA 1EESA 4W1PA 3ZHRA 2D00A 4BWGA 3L7LA 2G6TA 2EX1A 3HNOA 1I2BA 1O03A 1O96B 4ED9A 3KFVA 3T5PA 4UOEA 3AUAA 3MJRA 1OJLA 3TZHA 3A7DA 1T0UA 2AEMA 5CVDA 3S0JA 4R51A 4EELA 3QPAA 2XZTA 1MX1A 1P61B 3D7KA 3H1PA 3NGLA 4L73A 3RUEA 3SPXA 1DS6A 3TCXB 1P2UA 5IULC 1JDJA 3EZ6A 5FWYB 4P08A 3PUWA 2FSFA 1BXGB 5ALSA 3SQNA 3RTAA 5EIBD 1TYCA 1B3BA 2X1MA 4FBLA 4XWGA 5AI8A 4R2IA 3HABA 3R7AA 1C4XA 1N3IA 1FJXA 1PL0A 5I7AA 2F1JA 1BHQ1 1TK3A 4IGEA 3TIGA 3AR3A 3WGJA 5IYQA 4DCGA 4CDMA 3FHTA 3C70A 4WZ6A 2O7SA 5H4GA 1O95C 4C2BA 2PMDA 4OPOA 2Q5CA 4MXDA 5BRJA 3IMKA 4LC1A 5TQ0B 2XQFA 1F0NA 5KJ1A 3GU3A 2CF4A 4XM0A 4WZTA 1R1DA 2XODA 3OPMA 1G5PA 4RXMA 2N1BA 1USGA 3NC4A 4KNYA 3KQMA 3NKVA 2ZUWA 1WXWA 1DKUA 2EX4A 1RE0A 3HY3A 3W4IA 4EG4A 3O8CA 3R75A 1UH5A 2MINB 4L07A 3PV0A 4JJEA 4Z4IA 5L3RA 5TMDA 2NAFA 1OX4A 4FMCF 1FA9A 1W2HA 3LDGA 3NTQA 4CM9D 5J5AA 3EVZA 1XQBA 4XVRA 4CHGA 4HQ6A 5BXQC 1BOFA 1XXHA 3LT2A 5IYNA 3SYNA 3UMSA 3B1WA 1PFVA 2H9AA 3EJWA 2ZSFA 8ADHA 5J2UA 1YA4A 1Q7YD 1CWUA 5JAPA 1E1QD 1H6BA 1EXNA 4ZCLA 1JNYA 4NE2A 2WTUA 2OOKA 1EJ0A 3NNNA 2R7NA 5BQFA 4ITVA 4LZLA 4LZJA 3BKXA 3QVJA 4G41A 1E8DA 4ND8B 3EF3A 1GPWB 2G83A 1VPVA 3MCVA 5IXJA 3G2IA 1E8NA 3GJ0A 4HWKA 3OCYA 1WUTA 4G3XA 1PFYA 4EJSA 3F97A 4YRMA 5IDVA 1ZI9A 1DMRA 4F5ZA 4BMYA 2P3MA 2RH9B 4E32A 1MU0A 5EOVA 1W0CA 4EO7A 4HBGA 1E2JA 1JPUA 2AI3A 3HG7A 4N0QA 4PEVA 1JIJA 5JSQA 2XXAA 3DFIA 2XPCA 1V8FA 3EMBA 5BWOA 3MHTA 1KZ6A 4TX1A 4P22A 2Q1WA 2WIFA 1E9DA 2VTVA 2VUHB 3H99A 4FS3A 3UM9A 2BL4A 2J3HA 3ISVA 1CQXA 4ECEA 3MINB 3QBDA 2PUAA 3AX6A 4FC6A 4RD6A 3JD2A 1ID1A 3K6SB 3ZD6A 5CURA 2VDRB 1P3Y1 4BDTA 4DIBA 3NZEA 7AT1A 2XTAA 2ARKA 1JU4A 1LRJA 5ALIA 4A2QA 3GJ5A 1C3EA 2ADOA 2AVDA 1L7NA 3SSNA 3ZN2A 1SVUA 2XBMA 4Z4UA 1HLGA 2YZMA 1UAYA 3WL8A 4WJLA 1TF5A 3KK0A 4H4CA 4JB0A 5K0EA 3E1SA 3M1LA 2OP1A 2KLBA 2A9QA 3U44B 1R12A 3NKLA 4BKPA 2ADFA 2DFPA 5FWAA 4Q37A 1MP0A 5E1BA 1H3EA 1WPCA 1GUFA 2C54A 2PAFA 5ELMA 3FDXA 4ERNA 2GPSA 5FT9A 4FXUA 4F3KA 5JJBA 2VT7A 3SC4A 5LZ9A 3PNPA 2C2KA 3R9WA 2FMXA 2B8NA 1ULHA 1LRKA 1ZD2P 1WMEA 5HQJA 2JCSA 2IXTA 2YOHA 3DXYA 3QI7A 1NP7A 4UCWA 1VLOA 5KVVA 3N70A 3JZMA 1U2GA 1IN8A 4GBJA 4J7AA 2O7RA 5I45A 4GMFA 3CZQA 4M2LA 3E5MA 3OJWA 4HGOA 2YTZA 5DBFA 1L5YA 5G3ZA 3U6BA 2W0MA 3DZBA 4WW0A 3TSZA 3FOCA 3I6QA 4CIBA 4R8MA 3HU3A 4DC0A 1KYTA 3V8BA 5L46A 1VZ3A 3NAZA 4IQ0A 5DM60 2G9ZA 5FULA 2QLNA 4G1VA 2DWQA 2ZE7A 2H1HA 4W9NA 3SS7X 4ZYLA 4IXWA 1U0HC 1NHWA 3CJQA 1L5GB 4ZVKA 1AUPA 2JC3A 3H18A 4BUJA 4RGBA 1KDZA 3W4KA 1OZGA 1RYHA 4C6HA 4E1BA 4RLQA 4QWMA 1R0LA 1KVRA 2Q5LA 2W6IA 3NBAA 1SB8A 3O1IC 4NULA 1RQPA 2YN0A 3HVIA 4B5KA 3O8NA 3CONA 2VKQA 3NKFA 3D2LA 4M89A 3PU6A 2VP9A 2HN9A 3ZCVA 1CIVA 5BQOA 1TZ2A 4Z0NA 2IHJA 1RBZA 4J8PA 3MD9A 3DWIA 4HN4B 4J4BA 4BMCA 1SRRA 2ODQA 2ZBVA 1GTJ1 1XRRA 5FBKA 1RQLA 2QUBA 4GPEA 1XI2A 5GIOE 4RWZA 4Z9XA 1IN5A 2YV5A 4OHVA 3S81A 1YR2A 1JG2A 3AUYA 4FEYA 4O59O 1WEHA 4YCDA 1GPLA 3M3HA 2OZVA 2Q6VA 3PDHA 4XOPA 2VWPA 3CSUA 4TLDA 1NXWA 3GY0A 4IHAA 4OLAA 2YICA 4P33A 1L5LA 3BEOA 4Y6QA 2DPMA 4DCUA 1I94B 4WCDA 1V3QE 2I8LA 4DANA 1A8QA 5F51A 4LI0A 1O3YA 3BTUA 1E3LA 1ZK4A 1UBLS 2QTGA 3NNDA 2W48A 2UZ1B 4JC5A 3WYAA 4JP8A 3B38A 4PLCA 3LQ6A 2PYDA 3CPWB 4FXOA 3EUWA 5JQGA 1U5BA 1KJ9A 2C1EA 5TRTA 4H4DA 1KVTA 4MMZB 5CLIA 2IHZA 4H6PA 2XOEA 2XJ9A 5C5DA 1PG2A 5T4BA 3JATA 3T5CA 4CLRA 5L7WA 3GF4A 4BECA 3R5HA 4W1RA 1E0JA 3ZCQA 3L1HA 2XNJA 4ALLA 3PPXA 4WKGA 2A7QA 1VG8A 1XKQA 4CIXA 4B6PA 3PA1A 3CLRC 1ES9A 2UVPB 4AJEA 5ALEA 4OJQA 4TM7A 1ZNWA 4BBPA 3PNYA 2CNDA 3V4FA 1W0KD 1X80A 2PVCA 5K05A 3G8DA 5AVOA 3BGWA 4UUNA 3R20A 3DZGA 4S0ZA 3ZYZA 1R88A 2A88A 2CK3D 2AK3A 4F6RA 4NMXB 5TX7A 3VNAA 5I01A 3AV3A 1WABA 2X9NA 3M6WA 2W00A 3MILA 4FN4A 3SNHA 3TM5A 3P2MA 4W9MC 5FPTA 4KE7A 5F5XA 1EHYA 3KVNA 4CGZA 1NBAA 1GV0A 4QDZA 1JG7A 4TUYA 1FLDA 4LSGA 3LNTA 4RGQA 5G1PA 5IDXA 3MTIA 5K20A 3A6EA 5ADWA 5IK2D 1TPYA 1GCGA 3ZPXA 2WTAA 3TL2A 3BCDA 1VLVA 3DZJA 3KQWA 4UCQA 3ZDYB 1DADA 3OM9A 7MDHA 3TR0A 4XPIB 5ERYA 2VJCA 4S05A 1Z38A 3GOHA 3HJCA 3P4YA 4L2IA 4RX1A 3DP9A 3FNQA 1Q95A 3S7ZA 3CD6B 1WG8A 5BQPA 2PS9A 3ZCUA 1R27A 3VZDA 2WNSA 3L01A 1NQOA 1X7XB 4ZEVA 4ZQCB 2GO1A 3F7NA 3QPCA 3UK2A 1L5VA 1JGTA 2GN2A 3UK1A 5JNWA 1T4CB 5COAA 2HXSA 5JCOA 2PL5A 1G4UR 1PDOA 4FYJA 2ODEA 4HEHA 1UBRS 4Q47A 4ANFA 3KVYA 4OMCA 1LSUA 2WV7A 3WZ2A 2HW8A 1A9PA 3H5RA 2IYWA 2X2EA 1H6DA 3KD3A 4HNAA 3DTVB 1XHLA 1IHXA 3K73O 4F5EA 1JDUA 3K09C 4FGZA 2J59A 4JYCA 3D8SA 1PFQA 3UTDA 4B47A 1Q12A 3E3NA 3EOBI 2TSYB 3MWJA 4YVFA 4IQGA 5JVDB 1DKNA 4R2KA 1RRPA 4G0OA 4G25A 2YWHA 1IHMA 1G9SA 2AB0A 4RJLA 4A0SA 4A6XA 1REQB 1FU4A 1FYWA 3DMTA 2BFEA 1WHSA 5LN1A 4REQA 4ZEXA 2BCEA 4QVKA 2MSNA 4DQXA 3A2MA 1GA6A 3GRPA 2IE0A 2N75A 2P75A 2AG8A 3FUWA 1CV2A 3LK6A 2G09A 4NV1A 5CM8B 3TF5A 4PXYA 1UJNA 1BWSA 3SWWA 1QF7A 2MTBA 3V33A 4K81B 2W9XA 2ZRDA 1K6XA 2V54A 3NBZC 4H7KA 4LXHA 4PYOA 4KHZA 3BE5A 3TD6A 1AKQA 1LH0A 3TLZA 5LVAA 5B57C 1XLTC 1H69A 4IBOA 5DISB 1DOAA 1CY0A 1U1DA 1LSSA 1X7DA 4MRNA 3TZBA 1Z6AA 3ZH9B 5KYWB 1SIBE 3N2KA 1Z39A 1A7AA 2QZJA 4RPGA 1UQTA 5GOTA 5ICFA 1F5NA 2AXNA 3BGVA 3C4JA 4X84A 1Q17A 2NU6B 3LRXA 2HMAA 1RXEA 1GP2A 1PQYA 3A06A 3A1DA 3HA2A 3RJZA 1XVTA 1K27A 5F77A 1WO8A 1Y1RA 3HWWA 5GADl 2PGNA 4UPDA 5JXGA 2VZ9A 4FT2A 3BNWA 1RMYA 2LVBA 3IEKA 4G5GA 2O52A 3VM6A 2PV7A 4NBNA 4PGAA 1TMOA 2UUOA 5GWXA 3IEXA 2C04A 2JGNA 3DVSX 2GCPA 4GI7A 5H3CA 3USCS 3NCTA 3HKDB 3QVKA 2G9NA 3QLEA 4GKAA 4HH0A 2O6LA 5IC6A 1KP9A 3WP1B 4DDKA 3TVDA 5A6VA 4Y3UA 4IHJF 1QTQA 3IHLA 3O4HA 3QVVA 4N5IX 3W9YA 2XNSA 4CEIA 5C8DA 3EAQA 1O9GA 2B5VA 4MVXA 1XCOA 4MQMA 2QV7A 1RI1A 4LXIA 1Z16A 2PJZA 2VJAA 3L6UA 4EKEA 3ZJVA 1RKQA 2Y9PB 3LX8A 4NK4A 4RZHA 3CRVA 5A4JA 4N48A 1NJ6A 5G40A 4F3RA 5F9HA 4FFSA 1Y1LA 1OXBB 2Q3JA 3IAS1 4W8HA 4BMNA 5LMCA 1TNDA 1C9NA 4MJXA 4LGYA 4RKWA 2ZVPX 5BW6B 1R5BA 4FYPA 4EG5A 3GUHA 3L07A 1VQ8B 4J07A 2RB4A 2D1SA 3I04M 4E1VA 3NTOA 2YH2A 3MYYA 1P9RA 4XJXA 1XIVA 1YR6A 1VXRA 2QRZA 2W8BA 1ZQ9A 4X1IA 3CM0A 2OYNA 2EHJA 3NS7A 4LRYA 3SU8A 3D0QA 5T41A 4IIYA 3MAGA 4BFUA 4F97A 4EFMA 1DKPA 3DDHA 3PQ6A 1O6ZA 4DLAA 3BN3A 2F43A 4BO4A 4RPKA 4LV8B 1UD5A 3LOQA 5ALVA 2DTDA 3EK2A 4TTVA 4DLKA 3ND5A 1Z0FA 2GUWA 3PQ7A 5KZMB 3LP6A 2WZNA 4AY2A 3HHPA 1N57A 4E4RA 3ZGXA 3A1EA 3CNQS 2CC2A 2GNAA 3BHNA 1WUYA 3PQ4A 5SYNA 3MB5A 4DB2A 4Z4YA 2P3QA 4I1RA 4ZZ2A 3ZHZA 2AHOA 4PR0A 5AM3A 4REMA 1FTQA 5TVKA 1G16A 1KZLA 3O6VA 3DYIA 3TXYA 4CCWA 5JYCA 5F1PA 4DSAA 1EX1A 3DWGA 1E6EA 3LO5A 2FN8A 3M6MD 3SC3A 3VHQA 3E1GA 1QU3A 3A4NA 3TDKA 2YVQA 5FWNA 5C52B 3HYLA 2EAUA 4CL8A 4K1XA 3WGHA 3THRA 1SCKA 4HXFB 4M7OA 2XCLA 2O8NA 5HKBA 2G25A 5JDCA 1LBTA 1PYGA 2VQSA 2BSQA 3ORHA 1G8KA 2HTFA 2EJUA 3H86A 4KO2S 2W2QA 4XKWA 3UMVA 1WAMA 2GKSA 4V0MA 2CLMB 4XR6A 3D4OA 1C4KA 2C9DA 3L18A 1OGJA 1DXHA 2VJPA 5E3JA 2ZZEA 4BQOA 4ZYTA 1YL5A 4F5WA 2A84A 4CIVA 1N5RA 3Q3GE 4QG7A 2BH9A 2ALJA 2ZRNA 4OGFA 1WTCA 2I6XA 3Q1LA 4EY3A 2IYVA 2AQ8A 3BCUA 1I7PA 1E9EA 1F8XA 4MYTA 4W1SA 3KZCA 3TSAA 2KM1A 4YJKA 4H15A 2X3YA 4Q3LA 1IBLB 4J4TA 4JL8A 2HTEA 1GCAA 2YHIA 5BR8B 3B9RA 1R0ZA 3RTCA 5LBUA 1R5NA 3WGNA 2H16A 4C6SA 1OH7A 5K0LA 3GLIA 1E7QA 4IV0A 4PFKA 4GGOA 1XAJA 3CWQA 1V95A 3RFCA 1NE7A 1YR9A 3O2NA 4IRMA 2VYVA 1WOSA 1LDNA 5KDLA 4DG5A 1EZ1A 1OR8A 3EXHB 5GJCA 3TBHA 1NW3A 1M0WA 4X20B 4ALKA 2H0AA 2ZYVX 3LOUA 4Q7LA 2G8LA 4P53A 1UEJA 1SCUB 2PZJA 1QRTA 5E4JA 3GT3A 4IRXA 4L74A 2O5EA 3MWDB 4PG6A 5D84A 1EH5A 3ZU6A 3GO4A 5EWLA 3OZEA 1VCNA 4AKEA 2UZ0A 1E2KA 3W2TA 1GCIA 2R6JA 3CB4A 4NDZA 2JVKA 2Z4SA 1UMDA 1NVAA 4QREA 4MKHA 1IPHA 5U9CA 4PONA 3GJ8A 4ABYA 1Y8RA 3AK4A 4K6HA 2XOXA 3N2GA 3SZGA 5AVVA 3KL4A 2J7PD 2EJTA 2O1EA 3PYXA 1YMUA 1JQLB 4UOQA 4RDKA 3KT0A 5K3CA 4HNGA 4MVJF 2IU0A 1QCYA 2YV1A 4EM6A 3W3AD 3OVMA 1RLMA 1BOOA 1ORIA 2UYGA 4C07A 4HTFB 3TLYA 1VCMA 4XYBA 1O4WA 3W6OA 2FSVC 3AHFA 2AX4A 1E63A 1BLIA 5DTEA 1KERA 1TC1A 1YDHA 1B15A 5A7HA 5HZGA 1NXXA 3ZLBA 2EW8A 4NV3A 2OD2A 1PFGA 2KX7A 3BILA 4B6SA 1P7WA 1E7YA 4RIGA 4RK5A 4V2UA 5KHAA 1L7RA 3O26A 3DV2A 5A0TA 5D00A 1SXJE 4AS1A 1Z7BA 2VK2A 2C7PA 2VBTA 1VQ9B 3LYLA 3MWFA 4NF2A 4HDNA 4EIWA 1JXAA 4O2BB 5KAPA 1N4DA 1KFBB 3EFOB 2RJNA 1NF2A 2V31A 2OMEA 1KDOA 5ALMA 2AE2A 1NKTA 2GSDA 2R6AA 3AERA 5BV0A 4BEWA 2C00A 3I53A 5C5EA 1D2CA 4NTZA 2BWJA 1V37A 2CBGA 4MGZR 1O6GA 4DCSA 5EWMB 1L5QA 2YVKA 2AYYA 3VGJA 5DMXA 3UXEA 2GCOB 3F9CA 4Q4DA 3L4BC 1BQ3A 4UTZA 1B2LA 1URPA 2HDNB 2Q49A 4IDBA 4Q9KA 3VR2D 2VUTA 4Z54A 1EXMA 3ESBA 1LTQA 2GJAA 3KAKA 4BBZA 1V6CA 3N8KA 1MDBA 2B94A 3EULA 3KJIA 2XUKA 1BPLA 3PFBA 3R4CA 1WP9A 4LHZA 5EIBC 1A72A 1E4EA 3O3MB 2IYPA 4BLOA 4M8LA 1DBVO 1VL8A 1WEKA 2CMKA 1M76A 1NNSA 1EWRA 1QMGA 3AVQA 3EG9A 2CDRA 4BVHA 4MPDA 4JI2B 3PDWA 1UBOS 1ZI8A 2PBRA 1B14A 2Q2QA 1VMKA 1Z45A 2ODAA 3M4NA 3FCOA 1IHPA 2WM3A 4Q3NA 5K4AA 3UK6A 3WLOA 3WK4A 4KQGA 3DE2X 4QGHA 4MV9A 3BJEA 4ZU6X 1TCVA 3K2EA 3GJRA 1G0NA 1GU0A 2C4KA 2O2ZA 5DHPA 3LQ4A 2SBTA 2BBSA 1JZQA 1PL8A 2ZXEA 3MS4A 2PWBA 3D2BA 2P1RA 3HU5A 4EP1A 4PZLA 2ZJ5A 4F92B 1WXDA 3SXJA 3LW8A 3PNVA 1AKMA 2C2HA 4E5UA 2PHZA 1G19A 3KQVA 3PC3A 4RUKA 4UAUA 5C81A 1C3LA 1J8YF 4N0MA 2GXSA 1V47A 1QYXA 2E85A 3Q38A 2FFBA 3OEYA 2BMFA 4HSEA 4ZO4A 4A8HA 2FSIA 5BSFA 1W49A 2Q1UA 2GARA 5DTQA 3SLRA 4W7HA 2J4DA 4C4XA 3TEMA 5DCUA 1FDOA 3LIPA 4DVJA 4G5RA 4D9JA 2E4YA 4NBSA 4JLMA 1KYQA 5BN3A 4E5YA 1XZ8A 3P0IA 4NE7A 4HAVA 4EG1A 3LNCA 4INPA 1C7IA 2EZ4A 2IX9A 3H65A 4UHEA 3DOEA 5BQXA 1N5DA 3WE7A 4B4VA 1XZLA 1Z0DA 4F60A 3NQ41 3QMPA 3R0JA 4E09A 2GLXA 1WF3A 4DM7A 4E6PA 1K8YB 1OWPA 3UV3A 2WMOB 3AETA 4K05A 3BL8A 4OHPA 1NU6A 2XDAA 3M6VA 4HGYA 4J29A 4ZI7A 5KVAA 1UPBA 3BC1A 3NBQA 1E3WB 4RE5A 3QMMA 4DRXB 1JR6A 3PJEA 3BKWA 3HK2A 4DNPA 1W6UA 3QQ5A 2P9YA 2QUIA 4TWBA 2QAIA 4R31A 1OVGA 1FUYB 2QT0A 3L7OA 2RGNA 2RI0A 5J63A 4C3OB 2VK1A 2ZBRA 2GZ1A 4CMAA 1E1RD 1XL1A 4O25A 1VBMA 3UWOA 2VPZA 2ZDQA 5LQRA 5DBOA 3VJLA 1WV0A 1BMQA 2XB8A 2PN1A 4BX3A 1CF9A 4XGKA 3P1JA 1IJEA 1XDDA 1SC3A 3GUZA 3WS7A 1XYVA 4AVZA 2V7GA 5JH7B 4X41A 3TPZA 1NMXA 3FYTA 3UWMA 5E4FA 4C30A 3N1UA 1YU6A 2B1IA 3RSZA 2QX4A 4BGIA 3UAGA 3C6KA 2I4TA 4PZ0A 3RIEA 3T1OA 3LHSA 3T7IA 4EARA 1O0BA 2QSJA 2WIGA 3HJHA 4G5SA 5HMMA 5A3JA 3HJNA 3ZV3A 4BFYA 2YV4A 1WXFA 1N7JA 1ZSNA 3LCMA 2H1IA 2LPMA 1ZUWA 5CJJA 2H5IA 2IEGA 2B9EA 1S9HA 5EJ6A 1IEXA 2Z6VA 2ZVQX 3DKRA 2C5HA 4DNFA 3JZIA 1UJ5A 1JNXX 4LY0A 1DAKA 4KLZA 1JYEA 2ZDGA 3K1ZA 3HDYA 3T4XA 4BPRA 3AIMA 3MW8A 3JQFC 3WY9A 1S8NA 4IFEA 3GRKA 3MSXA 3CE6A 2WF6A 3QLUA 2VBVA 1NBMD 4RF3A 4CUZA 4XQ9A 4CTMA 2O3JA 3WRYA 4QBKA 4LYAA 4GMGA 2NXWA 3PWZA 2WHQA 4IZIA 1L5OA 1YI2B 1BX3A 1UJMA 1YHZA 3CCQB 1Y98A 1YNSA 2ZQZA 2ZYHA 1P4HA 3L5OA 3HI6A 4BB6A 1JKMA 3EXEB 1I4EB 3J81A 1YU9A 1ZH8A 1ZN9A 4U9HS 3PGMA 3H2KA 2LZ0A 1H4TA 4AICA 1RT9A 6LDHA 2ZBEA 3H1BA 1FUIA 1P45A 2M9MA 3NUQA 5ALHA 4C03A 4YT5A 3NH6A 4TLBA 1KZ9A 5ALOA 3SKYA 4CMHA 3B7GA 1RWWA 4AULA 1J2RA 3ZD8A 4CW7A 1WBJB 2GBIA 3RYCA 1Z8NA 1EWYA 3JQ8B 5BWNA 3GZNA 4OHUA 4LVUA 5FA6A 2OTLB 4B34A 1JIQA 5CM9C 2GB4A 2YJTD 3N0XA 1LEHA 3PQ5A 5LKRA 3Q7PA 3UJCA 4DIOA 3GG2A 1U04A 1IIRA 1LI4A 1Z29A 1NOJA 1R0SA 1NASA 1SVSA 3F6BX 4GWLA 4HWTA 3VV3A 4DC9A 6NULA 1X1BA 4PCAA 1N2CA 1NW5A 2Z5VA 3QPVA 4XDYA 3V32A 1G38A 1RAIA 4MS4B 4EI9A 1JX6A 1NUUA 2PMBA 5DN6A 4R40A 1G4HA 5DK4A 1CE8B 4NDAA 4ZAXA 3STWA 1KZ7B 4G85A 1W35A 3K70B 2I6UA 4CV0A 2CDNA 5DNUA 3DCIA 4DPKA 2X76A 1UZLA 3S8MA 2ZRHA 3PNBA 2E6UX 2QTFA 4A6PA 3EXHC 4B6OA 1KQGA 5CVTA 5T7BA 1U4NA 1T0JB 4MUHA 3N0WA 1CLUA 3TQQA 2ZZKA 1YJQA 3MF4A 4XPZA 5BYJA 4M1MA 4D81A 2YIJA 4MQBA 5BUZA 1D9XA 2GJSA 2XQJA 5FYQA 5CNIA 3ZW7A 3HM9A 4Z9AA 1FLAA 5GGXA 1E2EA 4IV5A 4BN4A 5JRJA 3HH8A 3MVEA 1NRJB 3WWDA 3RRJA 4NX2A 2C57A 4TGLA 4K9MA 1PX0A 3A6GA 1T5DX 4HDRB 5MN5A 1DIRA 3VDQA 1PBNA 1RYMA 3KEWA 1AQIA 4X8HA 2DECA 3AB7A 3H16A 2HSWA 2JH3A 2VHUA 4K2AA 1H1LB 4YUVA 3GQVA 3EDRA 3WIUA 3DC7A 1RWPA 1ECGA 2HA0A 1E9CA 3U37A 1HDGO 2ODPA 4HBZA 4DUGD 2NTNA 2X77A 2GJ8A 2YFYA 3HYCA 1KETA 4B3JA 4GBGA 4AG5A 4RE6A 4U9IS 2G36A 1XA3A 3I34X 3VHXA 4TM8A 2OAQ1 1I3LA 5KSZA 3I5YA 3CVJA 2AE1A 4NC9A 4CM5A 1JT9A 1FVXA 1N8TA 2P6RA 2PUCA 3FRHA 4BB0A 4PSUA 5TJ9A 5KI6A 4EVRA 1F2VA 1QKKA 1XD2A 1NSFA 2WINI 2JLCA 3D6HA 3FPLA 3LK7A 4HNSA 3VKWA 2W58A 1QH1B 1RHJA 3CJTA 4UBLA 4WA8A 2B3TA 1WJGA 2GRAA 2VPIA 1RVDA 3HAGA 5BV1A 2HWKA 3MAAC 1P73A 4BMDA 5ED4A 1I6LA 4C0XA 1VI5A 3P71T 5I7EA 3GEIA 3T5TA 4CQLA 1Y9ZA 4TWZA 1MN6A 4Z7JA 3BHJA 2E49A 2FWAA 1ISFA 5TPZA 5CITA 4C7VA 5I7FA 5BQ3A 1EFPB 2L69A 3RSGA 3OQNA 5HDQA 3Q3IA 4DUPA 2A0YA 1CB7A 4MI9A 1JQ5A 2XB4A 3RRFA 1K7SN 3T99A 1Q3KA 5CFNA 2A9KA 2CMHA 4KO4S 4HUTA 13PKA 1I7NA 2XMSA 1OASA 1OT5A 1N8NA 1NZDA 1XTSA 2E4XA 3A0UA 3C85A 2VNKA 3EVBA 2RH8A 2PNJA 5HPYB 2D7DA 6Q21A 1F0PA 1H85A 1JLRA 3D4PA 1HTWA 4IOMA 4S3MA 1JFSA 2ICAA 3RRBA 2WK1A 1M6YA 4NZZA 5C8XA 2ZFUA 2UV8A 2WBLC 1PJQA 1PT5A 3BD8A 1GWNA 1WDMA 4E5NA 3ZC3A 4BMVA 3WMGA 5H70A 3AFHA 4L0QA 3JQPA 3G9TA 4TKOB 1BXZA 2VATA 5EIHA 5LKAA 2YYYA 4E33A 1NF3A 1M2VB 2GSWA 3RBVA 1MA0A 3K5PA 4RPHA 1UOPA 3K8QA 2FPXA 1G3RA 5FI5A 2H1WA 3OBBA 3L82B 3X1MA 3QJGA 3PQCA 2IYRA 2GGSA 4ON9A 1RPJA 1XXHE 3UMBA 4ESEA 2IHVA 4F4IA 4MJLA 3LT1A 3G17A 3REQA 1L8AA 2C29D 2NSLA 1Z0AA 2GXUA 4IIGA 2RHOA 4OB8A 4D8TA 1Q91A 4HPJB 1PGQA 4RHCA 3S55A 5FF9A 5ES3A 1HYHA 4PTYA 4OQNA 3JD4A 3TLMA 3ZTWA 2I2CA 1YRBA 3D31A 4II2A 1NMZA 3KJXA 4GZ6A 1I24A 3IXLA 5LCXA 5H02A 1RMTA 5JANA 1VOTA 2GM5A 2X2OA 3IQIX 4G63A 4HQLA 3RS3A 3TKAA 2HCTA 3NHMA 5HGXA 3TPFA 4I50F 2OEPA 4CEJB 4UFNA 4ZZ0A 3PI6A 5JNLA 3GGCA 2GX6A 2NACA 3W5SA 4ITRC 5A5EA 3IDFA 1QFZA 3IAM6 1XOIA 1XK7A 3WTBA 4MS3B 2VRWA 2DETA 4KN5A 4K88A 3T56B 1U1GA 2NLOA 3WK8A 3ZE8A 4FBGA 3KV1A 4J03A 1BDJA 4Y2TA 3U7FB 3IIIA 1QHXA 4WK2B 3ESDA 5IT0A 2JFXA 3IAUA 3G89A 3IX7A 4IIEA 4US2R 4IO0A 5J58A 3AEUB 4OOFA 1AN9A 1FUKA 1JPJA 3U5ZB 4TS9A 2F8TA 2ZYRA 3S2YA 4CE6A 1GNVA 3KTOA 1GV1A 1V16B 3PBKA 2QN3A 3JPYA 3ENZA 3I2FA 3IQGX 4J94A 5DRTA 1WOYA 3QVUA 1IBCA 1RYYA 2C7BA 3FWPA 4IIJF 5LJLA 4RTOA 5SV2A 3CF4A 5E7IA 2R6HA 2WJ3A 4IF6A 2CYBA 4DYHA 2HQRA 2ZUVA 4CTJA 2QU7A 1VQKB 1GQFA 4LRSB 1I8TA 2Y27A 1MB4A 3ASZA 5JXJA 5F2EA 2P4HX 3A28A 4JEHA 4EITA 1PR2A 3ZNQA 2H92A 2OGWA 2CJPA 1IPFA 1YS4A 4B6GA 4XWYA 4B8WA 3IULA 4BZPA 2DHEA 1J2TA 2BW0A 5F1KA 1NC1A 4U8GA 1Y3DE 2DR3A 1AZWA 1JYSA 2GRJA 2PX8A 3FDZB 2GETA 1ZIOA 3U3XA 2VWHA 4GVPA 1T5SA 1XDSA 1ZQ1A 1A2BA 4Q4JA 3TG8A 2YUIA 5LMUB 3IMGA 5DJ5A 4EPYA 1O0SA 1MF7A 1E58A 5HP4A 3ON5A 1R5OA 4GO1A 4YI5A 2H4YA 1WXGA 1CZOA 3MRXA 2NU9B 4DKXA 1VECA 1JDTA 2MWMA 2VAVA 3ANNA 4JLUA 4DIKA 1JJIA 1J9EA 2VNIA 4X6UA 4XYEA 2XIJA 2O2XA 3U48A 3CS3A 1J0AA 1IK6A 2FWJA 5CX1B 4Q4HB 4JROA 2ECOA 3L6OO 4NENB 2ONKA 5FIUA 3OPNA 4RQAA 1CR4A 4YC7A 1K3UB 4EDHA 2Y68A 1Q50A 1A98A 1EFRD 1Z15A 3OLVA 2HHAA 4HPXB 5FO0A 3OICA 3P0RA 2AKEA 3C3XA 4ZQBA 4JJ4A 4EATA 2JGKA 2XTJA 1XZAA 2NV0A 3BFKA 2VTKA 1E6WA 1XQYA 2DWOA 2EP5A 2H06A 4TV8B 3MFQA 1Z5ZA 5ETJA 1E61A 4P35A 3ZI4A 5BN1A 3LU1A 4N5HX 2VSXA 4QE3A 1EDDA 5C2JB 3ITNA 1YCGA 3TE6A 4ISBA 2BRUC 4UMVA 2OO5C 4A1OA 4Y2XA 3M9XA 2EZ9A 3K1JA 4QGAA 3EPHA 4WUTA 1YCHA 3TIFA 5J5CA 1L0BA 4M4SA 3P97A 4GDMA 3NHWA 1G3MA 1U7ZA 1ZD1A 4UU1A 2CNWA 4H1HA 2JJ1A 2VF8A 3ABQB 3EW7A 1AHNA 1SHUX 3IGFA 5KAMA 1NWHA 1CEXA 2K2QB 2CLOB 4Y9RA 2Y0PA 4RORA 3IKTA 4M49A 4Q9LA 4LW8A 2DR0A 3WYGA 5BSWA 5D1NA 3DGEC 3GJSA 5IU6A 2RCNA 1XEAA 2AOUA 2JGDA 3IELA 2R9VA 2HRCA 2P91A 5GZ6A 3UG6A 1MMFB 4JBXA 2NSHA 1HPLA 1EZ4A 1ULSA 3U9SA 1XZKA 3LLVA 2ZIUB 1NUHA 1ZIPA 2BZSA 3FDJA 3M33A 1CR1A 4IZHA 4P38A 5EJ2A 3DLPX 4JP5A 5BWMA 1WE2A 2F1LA 4QFMA 1WSAA 4WZEA 5FBHA 4D0LB 2AOTA 3TINA 1Q83A 4I1UA 5LP6C 5BV8A 1OFTA 3VPSA 2FRDA 1APBA 4K87A 4DV5B 2G9VA 5EPUA 3GA7A 1EDBA 1I9GA 3T5MA 3G2JA 2VAPA 2WFZA 5A71A 1NR1A 5CUQA 1OGIA 1JQ3A 2H59A 4W7IA 3ZJUA 1JUDA 2E1BA 5F33A 3KLBA