3ZC3A

Ferredoxin-nadp reductase (mutation s80a) complexed with nadp by cocrystallization
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYAIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNEKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Hydrogen Bond Network in the Active Site of Anabaena Ferredoxin-Nadp(+) Reductase Modulates its Catalytic Efficiency.
pubmed doi rcsb
source organism Nostoc sp. pcc7119
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
total genus 88
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3zc3A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3zc3A02
3P27A 4RD1A 4B4DA 1KK2A 1XB2A 3ES9A 2OTJB 1IJFA 3W5VA 4LC0A 3U2QA 5JBQA 2PLFA 4NBSA 1TTTA 3JQPA 3E1YE 3SJZA 3LVBA 1EP3B 3CCUB 1D8TA 1KC8D 1VQ7B 2XEXA 4B44A 3MMPA 4LBWA 2GPJA 3QFSA 4MYTA 3P26A 2DY1A 3G6EB 4M1KA 5H59A 1E63A 4FWTA 2QN6A 4QHYA 3CC4B 4UAJA 2BM0A 3ZZUA 3AGPA 4R71A 2EIXA 1DDGA 2QEXB 1F60A 2ZITA 1KQSB 2BF4A 2B5OA 4TMTA 1A8PA 3FPKA 1ZM4A 3OJXA 1GO2A 3G71B 1EFUA 4BPRA 3W2GA 3U6BA 3JQQA 3FJOA 5TR9A 1R5NA 5GV8A 5THXA 1D2EA 2VZLA 2QA4B 4G1VA 1FDRA 4Y9RA 1VQPB 1QX4A 1G7SA 3W5UA 1VQ6B 1VQMB 4YAFA 4RD6A 4AF6A 3CCRB 3MCAA 1FNBA 2BV3A 3QE2A 3CW2A 3WNCA 4H9GA 4M53A 1QUEA 1W2BB 4TMZA 1U2RA 1YHQB 4B48A 1EWYA 1B23P 1G7CA 1K73D 5AN9A 4PC6A 4AC9A 1FRNA 2BVNA 2BSAA 5TY0A 1IJEA 4K1XA 2HMAA 4YAUA 4M4SA 3CCJB 1OGIA 4B43A 1ZUNB 2PIAA 3QSYA 1AIPA 1FNDA 4C0SA 4TMVA 2BMWA 1TVCA 2YWFA 1OB5A 4DQKA 3I55B 3VNUA 1DDIA 1KK1A 3LO8A 3ZBUA 4YAWA 4ZCIA 4PC2A 2BGJA 3WBKA 1ZM3A 4RJLA 1F20A 4ACBA 1DARA 1KK3A 1H85A 4Y7CA 1EP1B 3QFRA 1BX1A 1W34A 1UMKA 1R5OA 4M2LA 4WQMA 1QUFA 2NPFA 4RCYA 2OTLB 2EFGA 1B2RA 4ZGNB 3I56B 4G5GA 2OK8A 2DERA 1KRHA 1KJZA 1QGYA 2AHOA 2BM1A 4RD3A 1ZM9A 1NJID 2HDNB 1S0UA 1TLLA 1JJ2B 4ACAA 1D1NA 3CCSB 3OW2B 3JQRA 1QVFB 2DCUA 2VYQA 4QFMA 1KK0A 3WNDA 2R6HA 5DSZA 3VO2A 5KSWB 1AMOA 2QTLA 1QFYA 1EFTA 4RD4A 2DEUA 4TN1A 1G7RA 3W2FA 1VQNB 4B3XA 1QGAA 4ZCLA 4P6VF 1EXMA 1BX0A 1WDTA 3CCEB 1IB0A 1R5BA 2YWEA 5FA6A 4EH1A 3W2IA 1E64A 1I7PA 3W2HA 3AVWA 3QFCA 2X3UA 2B7CA 2QMUA 4ZV4A 4YHBA 3CB4A 3AGQA 1OB2A 3CXCB 1K8AD 3CRZA 2CRVA 4RCZA 1CNFA 1CQXA 2BN4A 2VNJA 4U9UA 4G1BA 3CCQB 3CMEB 2YWGA 3AVUA 1FNMA 2C78A 1W35A 3WXMA 4LBYA 4Y9UA 4PC3A 4HE6A 1HA3A 2DETA 1OGJA 3J81k 1YJNB 1SKQA 2BPOA 3B78A 1YIJB 4AF7A 4TMWA 1YJWB 4RD0A 2FX3A 4RD2A 4PGOA 3OZWA 1EFCA 5H5JA 2OK7A 1BJKA 3WYAA 1Q82D 3B82A 5TV2A 1YJ9B 1GVHA 1JA1A 1FNCA 1BQEA 4FK8A 3CC7B 1QG0A 2RC6A 3G4SB 4P3YA 4N3NA 3ZBTA 3U6KA 1N8RD 3B8HA 2B7BA 4TMXA 4NCNA 2D74A 3CC2B 3ZZTA 3CPWB 1VQKB 5HXBA 1QH0A 1M90D 3QFTA 5GV7A 3OJWA 2GQFA 4M0LA 2VNIA 2CNDA 4HE5A 1YITB 3VNVA 2XNCA 2YWHA 4Q7JB 3AVTA 1SM4A 1VQOB 3ZZ0A 3LRXA 3WY9A 1CNEA 1JB9A 2XNJA 1VQ8B 1JA0A 1N0VC 3AVVA 1H42A 1GJRA 4LBVA 3CCVB 1KD1D 3CCMB 2VNHA 1G7TA 4ZCMA 1GAQA 3E20A 4FN5A 1M1KD 1QGZA 2QDXA 4ZGQB 1Q86D 3CD6B 1XE1A 3W5HA 1J9ZA 1VQ9B 1K9MD 1TUIA 1S72B 3VMFA 3ZC3A 1N0UA 4J0QA 2BGIA 1VQLB 4N3GA 3I1FA 3WBJA 1ELOA 1YI2B 3V76A 1QFJA 3LYUA 4B47A 2RC5A 4PC1A 1GR1A 1W87A 1DG1G 2C77A 3CCLB 1QVGB 4F7DA 3PENA 4YALA 3AVXA 1VQ4B 4IW3B 1Q81D 1GAWA 1ZM2A 3AVYA 1NDHA 3OZUA 2VNKA 1E62A 3MHPA 2PMDA 4YAOA 3OZVA 1FRQA 4C43A 2J7KA 3W2EA 1Q7YD 3A1FA 1QFZA 1EP2B 4PC7A 4DQLA 2E1RA 3VO1A 4LBZA 2HCJB 3WNBA 2QTZA 1VQ5B 3CMAB 1JNYA 5EMNA 1KTVA 4MYUA
chains in the Genus database with same CATH superfamily
1VIMA 3GJ5A 2QGFA 3MUEA 3K9LA 5K3FB 4HVCA 4IYRA 3HYRA 5HRUA 4ZVVA 4GC9A 3NIBA 5DJ5A 1CG6A 2A9JA 1H94A 3D81A 3NYWA 3PC3A 1IJFA 4M0EA 1F9EA 1A71A 1VC2A 1GTZA 2Z8YA 3CLSC 1Y6RA 2IIVA 3FKJA 4HAWA 1UKAA 5IYZB 5IP5A 1CZUA 2FVGA 4C6TA 1GZDA 1JXAA 2HK6A 3MF4A 3U61B 1WXWA 5CDGA 3K4QA 4OMDA 3LY5A 4KL8S 2A33A 1CUIA 2PTHA 5DHUA 2WILA 4A91A 2ODBA 3R7LA 1BXRA 2FR8C 1H1LB 4J49A 1N8NA 5E6TA 1R8SA 3FPAA 1Z18A 1Z5WA 2HOQA 1CEYA 1V1MB 3H1PA 5JJ5A 3BB4A 3BMNA 5LZ2A 4HO1X 4AMZA 1SD2A 4QECA 4QD3A 5H7XA 2X5JO 4OI4A 1EBBA 1XCBA 4FFBA 1NF2A 1RI5A 3IQZA 2HRBA 2ZTMA 4J1TA 4MO2A 3LT0A 3SDBA 2OBFA 3IEPA 2KI5A 2R97A 2P6UA 4IZHA 1ANKA 2FRDA 4XD7D 2XE4A 1VPWA 1USUA 4TLAA 1UXJA 1QG6A 5DOVA 1VDZA 4IWNA 3PUKA 5BW8A 5KWEA 2YRWA 1SC1A 3MLEA 4NCXA 2NV6A 2Y9PB 1F1BA 1CDDA 1JRLA 1ZDMA 2D0PB 5BSYA 3CC4B 4OOFA 2BM0A 4K9RA 4PSDA 2JBHA 3F7NA 3FZNA 5K2MA 2YXNA 4L76A 1E3WB 2IHVA 1CQIB 1G3QA 4OI1A 4CV0A 3HADA 5KYVA 4E13A 4ENQA 1PDWA 5E1DA 4ZRNA 5B30A 3LECA 1OYOA 2ECOA 1TX4B 1OWLA 4P12A 5I7AA 5B5SA 3HKDA 2IS1A 2XNKA 3ME5A 2EHDA 4G1UC 4CCYA 4IG4A 1JJFA 3ZU4A 1ZW6A 2OXCA 3PKJA 3VOBA 1Z8FA 5KYKA 1ODSA 2YUTA 3BDVA 4GO1A 4PZPA 2HF2A 1Y48E 4I6JA 2PGDA 4BV2A 1UBRS 1R74A 2YW9A 1JIQA 3K0AB 3AI7A 3AF2A 4FJ2A 4REMA 5ICCA 4HH3C 2AVDA 2PNJA 4BGVA 4N82A 3PFCA 4ZO9A 3WIDA 2IPXA 1WUYA 1I4TD 4BNKA 3VPXA 2AEFA 1FFHA 1IHDA 3EH2A 4WAUA 5MN5A 1VTKA 4DJ5X 1G6Q1 2EKDA 3VFDA 2OOSA 3KELA 1GA1A 5GV8A 3A1VA 5DNDA 2BI7A 3PHIA 4E14A 3FPFA 4RKQA 4DQUA 1RFGE 1V6SA 3LVFO 3F5DA 1PK7A 1ZOLA 3V4VB 4ZOCA 1HG1A 2FMFA 4ZZ2A 1HKHA 3E6AA 3OM1A 4KPEC 4Y0NA 4G1FA 4MRMA 4I46A 5CB8A 1G3MA 1IQRA 2GAOA 2YS6A 3E81A 3JZDA 5ALYA 2XQKA 4I9UA 2BGKA 3KSZO 2VTEA 3PCRB 4MUAA 5LIRA 3LCRA 4CE6A 2DTXA 1XZGA 2GCNA 1A7JA 1RKXA 4ENSA 4AQ7A 3WNCA 1A2KC 3NHMA 3E2MA 1E5TA 2F3RA 2QU7A 5DEIA 3H9GA 4S2EA 5JIBA 4I4NA 3VKVA 2YQ4A 1I33A 5C9ZA 1I7SB 2NO5A 2QZJA 5FJJA 4JR0A 2RGDA 1N9GB 3F67A 1YBMA 4KI7A 5DULA 3SSAA 3WJ2A 3PF9A 4AVZA 1EWVA 2ESRA 3LWBA 3CJRA 1ORVA 3L01A 3P9PA 2PD3A 5HUQA 2OG2A 4PSKA 4NAHA 1K2VN 2NTYC 3ABOB 2MYUA 3ISJA 3OQIB 2VNSA 3IKVA 1VMIA 4IV8A 5DN9A 3KOWA 1D6SA 2YDYA 2ZKIA 3HO1A 1KKUA 1IZ7A 1UWCA 4JDPA 1PG0A 1S3GA 1GZ4A 2JCGA 4HQ6A 2G76A 3AG5A 4JUAA 5KS2A 4JI5B 3W5IA 2JAQA 2P5YA 3RR2A 5CDFE 3T7KA 4BEWA 3Q2KA 1G98A 1TM5E 2JD0A 4A8JC 5LMZA 3T53B 1FJ2A 3EIOA 3KL4A 3ZDFA 1N5OX 3KYCA 4X97A 2ZB8A 1OGIA 2P3LA 4HDNB 4Q7QA 4RVUA 2AW3A 1WDKA 2W93A 3CVXA 3MYRA 1SUEA 2R751 2PXCA 3KALA 3W8RA 2YYYA 2RGCA 2PIAA 1SAYA 1PJZA 2DPLA 1C8BA 1T5DX 4P3PA 5IG2A 3BUSA 1E0AA 1J8DA 5DM2A 5IDXA 1RP1A 5K5EA 3I55B 4YP5A 1B3BA 3TXXA 3MEQA 4G24A 1G6OA 4YPFA 1KK1A 2CCKA 4R2JA 2QT9A 2CYCA 3OU7A 2DQ4A 2OCXA 4BQNA 2H2IA 2QRGA 4MWBA 2GK6A 1LLCA 3I2FA 3QXHA 1O4VA 4P25A 3G8BA 3KSDO 4CNBA 3WSVA 3BMXA 4CQLA 2OZLA 3ICCA 4Y6SA 2PZFA 3TLYA 3DLIA 2EWVA 4UNQA 2Q99A 2VHZA 3DPIA 1C8LA 5LOVB 4CKBB 2NUAB 2NW6A 1MT0A 3IDOA 5T6MA 3R6LA 4R5MA 3TPFA 4AMGA 2P0EA 2DFDA 2QAIA 5HF6A 1UBOS 3OUUA 4FFOA 4JCCA 1K4YA 1UMKA 3SXUB 4HDMB 3UAGA 4DYDA 2DWCA 5JYBA 3JW8A 5JS2A 4OLBA 5COBA 2CDCA 1PZNA 4AW9A 4CFYA 2EKQA 3CLKA 4PYOA 1Y0RA 5TQVA 3U3OA 4QEZA 3OCUA 1E5LA 1RABA 1JHVA 2ZBUA 1WKCA 1F2TA 2DERA 1N2XA 3D8BA 2JH3A 3DTVB 5KYWB 5KWIA 3PHJA 4TQGA 1S8FA 5DHSA 2AHOA 1DC7A 1HDYA 1X8XA 4UHJA 4EVSA 3SX0A 2QE6A 4I5GA 2VPYA 1RHRA 2DE0X 5IK2D 2WUEA 5FX2A 2O0LA 3LVRE 4F45A 1TLLA 5LN1A 1G21A 4NRDA 2PR2A 3GDWA 2CLOB 2HRQA 3KPUA 3SLKA 5AW9A 1KJNA 4L5JA 4YWHA 2ZE5A 2PKCA 1YZNA 1DT3A 2ARKA 1ILWA 1FLAA 3KZNA 2Q1UA 3EDCA 3GFQA 2IZZA 1UXHA 3PKIA 1SCKA 2H85A 3SGLA 2W70A 3O1LA 5HTOA 2ATXA 1DEXA 4CLXA 5A4JA 4OPSA 2LE0A 1NXTA 1Y9DA 2H2GA 1RIIA 2PGIA 4GMHA 4TM8A 2QG6A 1N6KA 4RD4A 4TXMA 1IE3A 4NU5A 4CT0A 2PVSA 1IJKA 3ENZA 1US8B 2VUSA 3IP3A 4KUGA 4Z9XA 5LP6B 4FYMA 4NMWA 5TMDA 4QUDA 5ALDA 1L5WA 2J46A 5FPTA 3HVIA 4QXQA 4DXHA 1NYRA 3I28A 5D51S 3WK7A 4BN4A 4IVNA 5CB0A 3RS2A 1EJ0A 3ZI4A 3SS8A 2Z09A 2Y0EA 3GUVA 4JJ8A 3B53X 2IYWA 5KEIA 3HM2A 5FBLB 3RH0A 4W5QA 5BN5A 5A05A 3L79A 2CWWA 2JLRA 2W2QA 2X3UA 1LI5A 1HT2E 5L3SA 1A8UA 2CN1A 2FR8A 1H1LA 3KUUA 1QO0A 1CR0A 1DKMA 1BMFD 1BYIA 2GH1A 1FRVA 2QMUA 2MSDB 1JJAA 4KSBA 3R7DA 3MT7A 4C05A 2W4MA 1HXHA 1KY3A 2B4TO 3AHHA 4QYIB 1QE3A 4CHTA 2CYBA 4DJEC 4MV0A 2B20A 2VRCD 1Z4OA 2JLAA 5IBPA 3LC0A 4MJ3A 1KAEA 2C2XA 2BLNA 3H87A 5J4YA 3G5MA 4J7XA 1WEKA 1YS7A 4WZEA 4JL8A 1Y9EA 4I9NA 4K9SA 1WDMA 3GVJA 1L4LA 3HYLA 3OTOB 2PKYX 2G80A 3ID6C 3DW1X 4D0LB 2AWNA 4U9UA 3IVMA 2Q9AA 2H2WA 4XR6A 1O95A 2XTNA 4TTQA 1ZLYA 2SECE 2O8NA 3OIFA 3IV6A 1NVWQ 4P4LA 4XX0A 3UO8B 2C3YA 1UQUA 1VG8A 2GCEA 3MFYA 4O5AA 2JGRA 3L0ZA 2H1OA 3NH6A 2AOTB 2FWMX 2HBQA 4UZFA 1FBTA 1JLLB 2ETVA 3AFGA 3PVSA 1TEZA 1E43A 4U3JB 2IYTA 1Z0AA 5MDHA 3J81k 2Q3BA 2ANCA 2XGMA 4IFIA 3VNBA 1B6TA 4F72A 3H5VA 5K0FA 2A78A 3VR6D 1PR5A 4IHJA 1PL7A 1OWNA 5F7ZA 2GXQA 3HU1A 5J3JA 3B1WA 5J47A 4CFSA 4CQMA 2ZRQA 5FNVF 2J45A 5EJFA 4AJKA 1G5TA 3ZXYA 3ZE6A 2UYCA 1NX9A 3UJPA 1OGYA 4XQ9A 2AQHA 1JKXA 1U9YA 1NSFA 1XNJA 2P68A 2XCUA 3DDOA 2BMAA 2TS1A 3FLBA 5LUBA 3IP5A 1QVRA 2WABA 2D4HA 1YJ9B 2XODA 3DC2A 1Q1NA 4BVEA 4NAVA 3SZRA 1YDHA 3LPAA 3UH0A 2W6NA 1A97A 3MIZA 3U56A 3G4SB 3WMFA 3I62A 4TT3A 4JJ4A 4OHWA 4UHEA 5IEBA 2G5TA 2G71A 3B8HA 4TMXA 1R9GA 2RHRA 2QN3A 2YMMA 5E4FA 1CHNA 1YRLA 3FSRA 1TTPB 4QJ4A 3OZ7A 3DAOA 1J0EA 3TSAA 1QAOA 5EE9A 4NZ9A 5KVCA 4XASA 3Q8KA 3KR9A 6NULA 4Z5XA 4DWWA 1A0OA 1PNOA 2Z5FA 1DG3A 1UC4B 2E4ZA 3I9V6 3JRWA 5GZ6A 3S1AB 2IV3A 1X15A 3HZZA 1NVVR 3GHHA 3M1LA 3SIRA 3V9AA 5JMOA 2VNIA 1EX9A 2PFSA 2Q0QA 1ZK0A 3E48A 3L0YA 4X65B 3S40A 5JYCA 3I0MA 1KZGB 5K6TA 2GDZA 1VBKA 2DH6A 1E9SA 3RVSA 2BCGY 2VZEA 2G40A 3Q0EA 2C5FA 3DBOB 1JEQB 5HEKA 4KNYA 2YWHA 2VHCA 3OX1A 2IBMA 1KOJA 121PA 2WKPA 4X8OA 1LRLA 5H3CA 2VBTA 1VQOB 1CFJA 1YO6A 2ZT6A 5C5IA 2ENWA 1MIOB 4RV4A 3EQZA 4FUTA 3TGLA 3DV0B 1L5RA 3PEEA 3W78A 1G291 1JFFB 3MJDA 3TTSA 1J2UA 1Z4PX 4UE2A 2VCYA 4DTIA 1IN1A 1LPPA 2EQAA 4YIHA 4KC0A 2PUWA 4XVRA 3O95A 4CKCB 4GG1A 4AMYA 1CUZA 1TM4E 2P35A 1U2EA 4QARA 1EG7A 3H7AA 2ZRLA 4II2A 2C20A 4G1CA 5FEMA 1M8FA 4HDNA 3B1KA 4LBVA 2CE2X 1Z16A 4L0DA 3U9SA 4CLEA 2WIAA 1ZLXA 3STXA 1P4MA 4O08A 1ZOOA 2C42A 1QFSA 3DHEA 1KAMA 4GC5A 4BQSA 4EW2A 2YFKA 2QD4A 3KSMA 2WU8A 3H4IA 3UJCA 3UMSA 1AN9A 3DVLA 3V97A 1UDRA 4GKVA 2QT1A 1G6KA 2R8OA 4EARA 3LPLA 4LYDA 2IPLA 2JAHA 2F3QA 5KCMA 1EP9A 2I91A 2SHKA 2R2GA 2XW6A 2COKA 1USGA 1TD1A 1JI3A 1F8YA 1TCCA 4IICA 3SVLA 3CE6A 5KNDH 1CB7A 3UTCA 3IXMA 4YP6A 1HSZA 5LLTA 5IJAA 5K2OA 2DWQA 4C3UA 2BKVA 3NVDA 5C18A 2VHVA 4B73A 4L4SA 4PNEA 3C3DA 2ZR0A 2RHTA 2OORA 3HDVA 4MOWA 3BEOA 4DR6B 3A1EA 4CCSA 2Q0SA 2HSWA 2BGIA 3HMKA 4KAAA 5CUQA 5IVHA 1P5FA 1XPUA 1PU2A 5CDYA 5TLSA 4GH5A 1IZ9A 2HBZA 4M9QA 2Q7OE 1PGPA 1PQPA 4C4ZA 2OD7A 4CZ2A 5JRZA 1YI2B 4UM8B 2YZNA 2QSZA 4LXYA 4PS1A 4EPWA 3H0KA 3BDAA 4G63A 4C0KA 3HVJA 4IYJA 1IUNA 2VDPB 1GR1A 2GXUA 1WG8A 5A2QA 1BH2A 2BJWA 3HB1A 4EQ6B 1HNNA 4D3DA 4MB0A 1N5JA 4J4HA 1OD6A 2NUTA 4XOTA 4FC6A 3QVKA 4BQQA 1PZHA 1WUHS 4QASA 2EG9A 5EG5A 5KWVA 4LFCB 3L49A 3QM1A 4UFNA 3EVDA 1L6RA 4JD5A 3B89A 3AMVA 4G0XA 1A8QA 2VLBA 3C8DA 4MXDA 1IG0A 4HEA1 2ZIWB 5HWSA 1Z2OX 1Z8DA 3L0CA 4UE3S 4I9FA 3EJWA 2I3DA 4LI3X 2X3YA 3F78A 4CNQA 2ZJ8A 3OFVA 4PLVA 3SC6A 4RA6A 3Q3VA 3WADA 1FVOA 4BUCA 3QVTA 4PCAA 3RIXA 2Q1TA 1V9CA 4C4AA 2DR3A 1RRKA 2VKQA 1WORA 1Q77A 4FNOA 4RGVA 3KK0A 2GCIA 5ERYA 2P9HA 1O6FA 4X60A 2J09A 2XSZA 3GPBA 3NU1A 5LNK1 3M6XA 1Q7YD 1R3DA 2HLNA 2HX1A 4LXTA 1J2RA 3E9MA 4MYSA 5ER6A 2P9QA 1MX1A 1ES9A 2EGGA 4LSWA 2M6LA 5LP6A 3WL3A 1H2FA 1KJ9A 2YY6A 3O8BA 2W8BB 1N9ZA 3A3YA 3NP9A 3VV3A 3WWZA 3RO7A 3VR1A 4DABA 1UMDB 4AL4A 5TJHA 4PXAA 1YHZA 3MLAA 2OMKA 3B48A 3D3WA 4BFXA 1GDHA 2G07A 2PCJA 3T12A 1P60A 2NV4A 1GG9A 3DLAA 1JYFA 3HQ4O 4C3ZA 2Z5GA 1OUMA 1Q50A 4PO9A 2H00A 5FFMA 1EFAA 4O25A 1YH3A 4P93A 5JWRA 2C03A 3AG6A 3LY8A 3R74A 3T3IA 2O59A 3ES9A 2OTJB 2Q1YA 1XZFA 3HN7A 4GHWA 1Z0KA 3PUYA 4U9HS 4LC0A 2MYNA 4HGPA 4L50A 4Y1RA 3RRYA 3LBFA 5K8CA 4B3SB 1MF7A 3HU2A 3OZIA 3MA0A 3VSCA 5CFNA 4G65A 3HC7A 3LTEA 4NCBA 1ODKA 3KQPA 3BMOB 3GLGA 1K7SN 1R0RE 3R6DA 4QOFA 1G8MA 5DWVA 3VJKA 2NP6A 1VQ7B 3FW1A 3OE7D 4U6NA 4ZOLF 1Z29A 2BFFB 3QKWA 221PA 3CXUA 2C1EA 1XDGA 2ENUA 2RI1A 2ZI9A 5KQMA 4DW8A 4HUJA 2ZYHA 1FC0A 1UCFA 3F6YA 4NENA 1QYDA 1K0FA 3TYXA 1MKYA 4J1QA 1PR6A 4EDFA 4MMXB 3EDYA 6GPBA 4MYTA 2OCLA 5F2NA 1Z6XA 3WLFA 4GPEA 4BVJA 2XYHA 4O5OA 2GVNA 4GI5A 2KVOA 5BMVF 1XLUA 4V38A 4YCAA 2GOYA 1O96A 5BR4A 3ZLTA 2GK7A 1WXDA 5E4YA 5J9FA 2OVFA 2ZI5A 3K09A 2ZZEA 1XTTA 2DWPA 5HK8A 1TZ2A 2FWIA 1A4UA 1OREA 1TLFA 4LHEA 2BTQB 4OIFA 3L5KA 4A7PA 3Q6NA 1WU7A 3WP1B 4NH0A 3SJ7A 1Q3TA 2LBPA 3V8PA 1USKA 3ZD9A 1QE0A 2XZPA 2OHVA 2ZT8A 2ZB2A 1ZUHA 3AVQA 3N87A 3WDMA 3HR7A 3KHUA 5LXTB 4MQEB 1O03A 4ONEA 4OYLA 4AZSA 2CEAA 2ACEA 2Z2YA 1IN7A 3GZJA 4KH0A 3B60A 1QHGA 4KV7A 3ETGA 2I2CA 2O52A 2E6UX 4BWVA 4MHTA 2B9EA 5AI6A 3Q1LA 2WWHA 2UUCB 3VU9A 1NNEA 1FLDA 5FLEX 4UCFA 5ICGA 2OZKA 4BO0A 1XVIA 1U28A 3GJRA 1CUXA 5REQA 3P2JA 5T57A 1FS5A 2FP3A 3C6XA 3H0CA 3WV5A 4S05A 1E1NA 4WFKA 3JYHA 1XZ8A 3OJXA 4FSDA 3ISXA 1C9EA 3OIGA 3EPKA 3HABA 1Q14A 4AWBA 2QLJA 1Y1KE 2Y1WA 2C98A 1IVYA 4R9VA 1P5ZB 4TQ9A 3Q6QA 5DE3A 5TARA 4J6EA 1T2EA 3UGQA 4C4TA 1T5BA 1MP0A 4A82A 5KTPA 5J3OA 1IY9A 2XWSA 4YONB 2EKLA 3KR0A 1D2EA 1PFGA 3CONA 3EYAA 3L8ZA 3PNBA 4HFMA 1CVLA 4X84A 4MQLA 2PAAA 5FI0B 2XMCA 5KU1A 2X0NA 2XUDA 5DM70 4QQNA 5ALNA 1UODA 4MV9A 1ICIA 3PHLA 3K8ZA 3SZLA 3QOXA 4H1TA 3H4MA 4B2PA 5JZMA 1N2HA 4J75A 2ZZNA 3NVKI 2EGHA 4KKTA 3O6VA 1R9NA 4LUCA 1G3UA 2PZGA 2FFHA 3M0EA 4E4TA 3PNSA 3SDSA 2YIMA 2ZE7A 3PPYA 4PNPA 3W6ZA 5IJ9A 4M53A 3FOCA 1QUEA 1YJCA 1N2JA 4CXMA 2VYNA 3VAYA 4YCMA 4HWRA 1WZEA 1GEGA 4X8HA 1A4RA 2DFNA 1LRKA 3WWPA 1RXWA 1PYGA 4WI1A 4JLPA 2Y1OA 3FWHA 3IQEA 3H2JA 1J8MF 4YLGA 2MT9A 5T6BA 3A37A 3VZPA 2PH3A 2TMKA 5A5EA 1GPH1 3SS7X 3SK0A 2WOOA 4GEKA 2R60A 4R8SA 4WLOA 3VKHA 4N5MA 1S4QA 3UFXB 5BSWA 4WHMA 5LL6P 1TJPB 3W5DA 2WB2A 2EJUA 3HWRA 4QZVA 2IHYA 1U04A 4EY4A 3TW6A 3A7DA 5JNWA 2VAMA 2BSAA 2PY6A 1K8QA 3RBVA 5KWJA 5TY0A 3RI3A 1CVIA 1OASA 3T7JA 2J4DA 4JWTA 4PQYA 5I9NA 2HO4A 4FOOA 4ME6A 2FEPA 1F8GA 4L07A 4OU4A 5J1SB 5CPBA 4JODA 3IODA 4GAEA 3JD1A 2ZJZA 3UG6A 5FO0A 3BJIC 3GFBA 2LDXA 4D41A 4RANA 2IU6A 3U7HB 1AOXA 5B4VA 2QLTA 2GEUA 3NEJA 1L7VC 3KL2A 3AESB 3AR6A 1U98A 2JLCA 4V0RA 1JT9A 3ZDXB 3KDPA 1JR3E 3HN2A 4PZDA 1NURA 5AW7A 3GVKA 5L3VA 1YGYA 3NDIA 2C0PA 1UP6A 2UVQA 1WNFA 2VH5R 2YZ2A 2Z5LA 2GUGA 3PRHA 4YJ3A 2DBZA 4J1SA 1A9XB 1Z13A 4R9RA 1G55A 1H0KA 2OCYC 3PXCX 5GTDA 1WVGA 2PQ6A 3NHKA 1YOVB 1GV0A 1X7HA 3VHXB 4DV6B 4AZVA 1F20A 3M5CA 4MAFA 1QYWA 4D45A 1TMOA 2GN4A 4M89A 4GBJA 3MGAA 4G0QA 5TJ9A 1YGPA 3ROEA 1JQBA 3JSAA 3OFJA 3UOGA 3VPSA 3K3PA 3N8IA 2HNAA 4MEAA 3C3AA 1ISHA 4NTZA 1VLYA 4QGHA 2D54A 4MVXA 3TMKA 3SF8B 3Q12A 1MO6A 1ULUA 1YOBA 2WLTA 4NESA 1M34B 5C4GB 1M2VA 2C1ZA 4WNAA 1D03A 1IM5A 1LI4A 1NYLA 3AR3A 3MTAA 4KAJA 1HQCA 1MOSA 1JG3A 3GEHA 2QI9F 4OMUA 3RAEC 4CQNA 3PDCA 1VL6A 3OPYA 3IXLA 4UDYX 5BSHA 3WYBA 5C37A 4L0QA 4TROA 5DNWA 1Y1PA 4WKCA 1SKYE 1XDWA 3RU9A 4YR9A 1YDFA 3WAJA 4CMBA 2EW1A 4QJIA 2FV8A 2CF4A 2BFEB 4ND1A 3FBTA 3KDSE 4JB0A 2I7VA 2LCFA 3GRFA 3HFGA 3AEUA 4NI5A 3GVPA 3DVQX 2RCNA 1ACLA 1O5OA 3KE9A 4OREX 4WFQA 1AQNA 1A8IA 3GLFB 1MRZA 5DW3A 5IVKA 2WFLB 3ZJ4A 5ARDA 2E4WA 1SUDA 2M1ZA 2H63A 4CV2A 3DE5X 3FH0A 2FHPA 2ORWA 1WSDA 1ZVVA 2OXFA 1UOEA 3N74A 3QYAA 4HDKB 1MHPA 5CVUA 4CF7A 3WGYA 1ZXLA 3WNQA 3M6UA 3L6CA 4BNUA 4EIWA 4GPIB 1SXHA 2P3SA 3F8SA 5DISB 5DLPA 2PRJA 3AV0B 1NW7A 1PUJA 4P1VA 4XGQA 2W22A 5F2OA 1QMGA 4E6EA 4BVAA 4DV4B 1YJ5A 3U40A 5C4MA 1K7CA 2X5XA 4O4JB 3PQ2A 5KTOA 5IYNA 2EJWA 3L1HA 1GUZA 3AP3A 1IAVA 2W90A 2LV8A 1WSWA 3V1YA 3REOA 2ZQ5A 4OMFG 2A88A 3V2UA 4C08A 4X3OA 1HNXB 3G7NA 1SOMA 4G5RA 4G4GA 5EINA 5IRCD 1XD8A 4D4LA 1CB0A 4WLUA 2WWYA 3U7QA 2FSUA 2WJGA 1Y4ZA 3MSCA 1E69A 4G5YA 1L7QA 3EW7A 3GCZA 4DDMA 1XTVA 4M1YA 3AVWA 5JCPA 1CDEA 1E5QA 3LP8A 3DBVO 3BWEA 3COVA 1OTYA 3EH1A 2WUFA 1OX5A 4EA8A 4RPGA 2QUZA 4N49A 4W5WA 5L3RA 4QVIA 4MV7A 5EFOA 1R0WA 2C3PA 3M33A 3VYSB 5HZBA 3CMMA 1T0BA 2XNHA 3LLSA 1H5UA 1P4SA 1JR3A 1Z07A 2M6RA 5LQSA 5SY9A 3ZHZA 5IT9A 3BE6A 1L8QA 3F4LA 1HYEA 1UMBB 2GVZC 2HL6A 2QSYA 4JROA 4M6WA 4WBXC 4WGFA 5LCXA 2PMEA 5K09A 3Q7TA 3EZLA 5FV4A 1VE1A 2GJ4A 4HN4B 5A7GA 2FN3A 4EJ0A 5I9SA 1N0HA 1XZQA 5DBFA 3UMGA 4YUWA 3RS5A 1XMQB 4R8LA 1DQRA 3GIWA 1DAMA 3E5HA 2PZJA 4D5EA 4E88A 3GZNB 1VI5A 3NV7A 1JSCA 3ERCA 2BUCA 1WZ2A 4IDQA 2ZWVA 5F1OA 2QN9A 1NVBA 1D2CA 2W6JD 4KSCA 2EFDB 3N9IA 4DNRB 3CMEB 1RHMA 3PHBE 1Q57A 2BFNA 3MT9A 4YTEA 1THZA 3F8WA 3K0FA 5HP4A 1C30A 4EA9A 4C78A 1FU4A 1NXWA 1ZNXA 3AJEA 4YMWA 5LQRA 1DLIA 2QN7A 2HHLA 4N3AA 5GWXA 3OE5A 1DO2A 4RTRA 1D6JA 4BCCA 4PO1A 3IPYA 3T7SA 2EL9A 4BMZA 2V8OA 5AW0A 1ZY2A 2F7SA 4LMRA 1X7DA 1OIXA 2GZDA 4HFNA 4EB6A 1AKMA 2QG9A 1W94A 3F97A 1VL1A 1M1NA 2MR6A 1ZMOA 3P0EA 1G8GA 4E09A 3IVCA 4P53A 2F1HA 3GGGA 3O75A 3WLTA 4CEHA 3O4RA 4YGYA 3LSYA 1ZAYA 1K63A 1YIDA 2X14A 5LP6C 3UXYA 3W5AA 3O2QB 2X5NA 4PPFA 1UQRA 4WA8A 4OQPA 5C1IA 2PCLA 1WW3A 5IAEA 1KVSA 1Y7PA 7MDHA 2ZK7A 1L5HA 1IQPA 2QN8A 2C5LA 5T41A 1MFZA 5LMNB 5JVDB 5AKZA 5KZMB 1TB4A 1UFKA 3PUXA 1DX6A 3M3DA 4ZJYA 4JJFA 1T5EA 1KEZA 2EX1A 2PT6A 3UAYA 3UZUA 3A1PA 1CTQA 3P96A 1V1MA 4JL6A 3VZQA 2GD0A 1W4ZA 2X9GA 1M2OB 3BRSA 5KWSA 4GP7A 3GEEA 3OQNA 3WGMA 4H6PA 2X53S 4QTZA 5HXBA 1KQFA 2JB9A 2DPGA 3EIXA 3IAS6 4RSMA 1CY1A 1K6EA 1KFEB 3NRCA 3P9SA 2IXEA 4I1SA 4IM7A 3CLTC 4B6SA 3CIFA 1AHNA 2IXFA 2AR0A 2CZCA 3D0KA 4P1ZA 4QODA 4UUQA 1R0SA 3DWFA 4UUOA 3FOAA 5E3IA 1W4CA 3KXDA 4Z4TA 1ZZGA 1JDVA 2R8RA 4MRVA 1AQ6A 1C7QA 1XZPA 3TL6A 1JQJC 3AVTA 5JDIC 5L45A 4YCDA 4B4KA 3KT6A 4EEZA 2GCPA 1S01A 4XLTA 1GPWB 3LRXA 1PR4A 2K7ZA 3IC5A 4I36A 4MUMA 2O1EA 3ICVA 1J39A 5AVTA 4RE6A 4ZVLA 4Z1MA 1X7XB 1X7WB 2M5SA 3Q6RA 1BRMA 1ZKMA 1ZZEA 2ODNA 2GZ2A 4CUKA 2D3TA 2VWGA 3K9GA 2R6FA 2ZU6A 3CF4G 4POAA 4UTXA 1C1YA 3AONB 1JG2A 4FNMA 3LFTA 1ECLA 3AVVA 2VBFA 1SCNE 2G17A 1H6BA 2BCEA 4ZKEA 1CRZA 1U6JA 2O6HA 4FE3A 3C1TA 3RSZA 5AI5A 3JQFC 1RQ7A 2O2IA 4WY2A 2JGNA 4ITUA 3HXKA 4GLBA 3STVA 4JITA 5EI5A 5B55A 3LWNA 1GAQA 5TIIA 4D97A 5IT5A 1N07A 2VT6A 2A9QA 5E7IA 2ZRMA 3J7AC 1DZ3A 3X1MA 4UVEA 1Q0ZA 2BC9A 3S8YA 3UMBA 3ZX5A 2BMVA 4IUYA 3T3GA 4DC1A 2PWBA 2ZJYA 3ZY6A 1QTIA 3L0PA 4TGLA 4EY5A 3AT1A 4NFSA 4PG6A 3OWHA 4DMGA 2V7QA 3IT0A 1AGPA 5DTQA 1ADCA 1PDOA 1XD9A 1MU0A 1QANA 4AJ4A 5LBUA 1WWKA 4HXFB 4MVCA 4V39A 3RVLA 5GJBA 5GJVC 1E2KA 4KPGA 2E4UA 3LP5A 3V7YA 2Y68A 1QH9A 4DHEA 1XU7A 2X8WA 2CVQA 5C7YA 4X6XA 3CP2A 3VSAA 3I1FA 4L4XA 1W5TA 5CCBA 4KG7A 1C1XB 5K4AA 4ILKA 2O7RA 3GRPA 3LYUA 4UHKA 2BKLA 3I73A 4GZ3A 1JUDA 4H7FA 4U2EA 4M60A 1YASA 3OFKA 3KLMX 4ZO4A 1BVHA 1EESA 2C3UA 3DXXA 3C85A 1ZD2P 1LF5A 1QYIA 4MQ5A 3ZWVA 1PSWA 4W99A 1WBBA 1R6TA 2EYQA 2BEKA 4O4LA 2MIIA 4UXJA 2I8AA 1KDRA 4PONA 1MQSA 3K6KA 3ZWYA 2Z2JA 5I7UA 1V11A 5IJXA 1LA2A 3HKEA 1WB4A 1X38A 3C5WP 4ZVRA 1K98A 3U31A 4B6QA 4K88A 3HN6A 5THKA 1P9LA 4YALA 1RRMA 5AOBA 3UHOA 3V4PB 4OI2A 1OF1A 3E23A 4NNPA 1TYEB 1T8PA 2IOFK 2R1ZA 2EWWA 4KMMA 1MBZA 4HX9A 3THSA 2G67A 5CDSA 2AT1A 1KMMA 1PR1A 4JEMA 3W9YA 1VCHA 1IUKA 3C7CB 2I6GA 4JQYA 3GMSA 1QE5A 5A4DA 4XRGA 1WJGA 1KQGA 3ZJ5A 3TG2A 4MGIR 3R76A 1JFRA 2ZWOA 1PR2A 3B12A 4IXTA 4X1IA 3CHYA 3QYJA 2KE5A 1XTJA 4NARA 3AR5A 3C3CA 4R98A 2OQIA 3NBAA 1ZUD1 2FLVA 4O4JA 4TXHA 1G5FA 1QLJA 1AKWA 3KM0A 2CHVA 2FH5B 1GPUA 4KB5A 2JJ2D 3WRXA 3DB1A 1YS2X 1R2QA 4IV5A 3RAFC 2CCGA 1KXZA 5KBYA 2HB6A 1JHXA 4URFA 3O03A 4LCBA 1VPLA 2C2YA 1E3MA 2ZSKA 4MDHA 5BVGA 5CB4F 4CKEA 2G1UA 3CQ9A 4BP3A 4CR8A 2IL1A 3E1GA 4Z2AA 4CKBA 4JASB 4M36A 2RD2A 2D0IA 3KPWA 5CM2Z 1G5HA 2IYUA 1NQTA 5A89A 1QPGA 4D3SA 4BCBA 4ZDIA 1QORA 3ACCA 4HDMA 2P1ZA 1XGKA 4RIHA 4W1QA 4J3NA 4EYGA 1VYVA 3H65A 3H6HA 4ERXA 4DR4B 1J8QA 4UMFA 4JU9A 1VHJA 1UFQA 5ALQA 4I5EA 1ZQ1A 3UT0A 3WRWA 3T5CA 4EFNA 1NVVQ 1IAQA 3L0OA 4QUAA 5I48A 2AX4A 2QD1A 4B2IA 4YPOA 5FBQB 5IAGA 3PYMA 2VYCA 5B1HA 1S8NA 4XFDA 3EZ9A 5ECYA 1ZWLA 1E2LA 1M34E 4E5YA 1CC1S 2WNHA 1P4GA 1SWVA 5F4JA 2EFEB 3GJ0A 1QVZA 3IJRA 3CEAA 5IABA 3ABSB 1S8OA 4GLJA 4P2GA 1YZ3A 4FKBA 4XIIA 4XSGA 4B6PA 2VJJA 4PPGA 5HDQA 3UW3A 2BEWA 4WK4B 2ZUUA 4BU1A 4BFYA 3WIOA 3FDZB 3P4YA 5DGHA 3S70A 4C0LA 3J81A 1JFSA 2I33A 3GLFE 5HM8A 3LPCA 2YCLA 2IY7A 5IAOA 3M7IA 1XNRB 1K66A 1EB8A 1GQQA 4H4DA 2Y1XA 5AM2A 1S1MA 1Z88A 4BJHB 3U4CA 1MDBA 2K6GA 4M0KA 1T29A 3F5MA 1AUOA 3OSZA 2YWJA 1V39A 1J42A 2XQIA 2X6RA 1KQSB 1ZFNA 4YK7A 2CB0A 3WLMA 3K0EA 3OURA 1HYGA 2O0KA 2HD4A 1G21E 4ZOLA 2RBKA 3RD5A 5T4EA 3S5JA 1RYEA 3NWEA 2ZJOA 2YVLA 4LDJA 1EVLA 2JLVA 3GI1A 3CB2A 3F3YA 2B8TA 2F55A 3BCDA 4FKMA 4QUJA 1YBHA 5ABPA 3D3EA 2E87A 2OLJA 2DQKA 3SLGA 2AN9A 4ID9A 3PE6A 1JSZA 1JJBA 3C74A 1WSAA 3JQQA 2EZ9A 5JASA 1TJ4A 4WLNA 4EO7A 2B2CA 4JP5A 5BMVA 3HCCA 4PFJA 3CC8A 4LYHA 5GZ1A 2FQQA 2R4TA 3DD5A 4DHWA 3WZLA 1KMNA 4EB3A 2WT9A 1KOLA 1XFDA 1E66A 1XXLA 4NG5A 3BGSA 5G02A 4ND5A 2N75A 3TRKA 3WKAA 3P9XA 2NOAA 4L2IB 3BJZA 1D4OA 3NTVA 2RHLA 5HKLA 3D31A 4Y2UA 4ZTBA 2WYIA 4NBTA 3Q7PA 4R2XA 1TK2A 1TIBA 3CEJA 4HQLA 5EZYB 3VSDA 3JWIA 1BHO1 2X2EA 5CA0A 2PPVA 1FNBA 2X3FA 3NATA 2P77A 4YP7A 4GI1A 5CVTA 4LN1A 3RIMA 1TAQA 1XPJA 4I5DA 5HKAA 4O4HF 2GWHA 3PLNA 4KFRA 4NE7A 2EU8A 3ROZA 2RGEA 4Y6GB 2CE7A 2XV1A 2AOTA 1FTNA 4F21A 2JHCA 3KCQA 4POOA 4W5OA 3N0VA 2C99A 3RGGA 5JR3A 4B48A 5CBPB 4RTKA 4FFPA 1NULA 4F96A 2AUNA 3E84A 4XQCA 1BKDR 1DJOA 3D4IA 3NBMA 2Q2OA 1QWSA 4YRTA 5T4FA 1GNVA 1RAHA 3V1MA 2BE9A 3Q7EA 4AZ0A 2WSYB 1OXVA 2GARA 3THXA 1FRNA 1X9IA 1T15A 1SU7A 3D6MA 4D6XA 1WHSB 1ZM7A 3T7IA 3GHYA 1IQUA 1MX5A 2QB5A 2BMFA 1A69A 1PGNA 1T34A 2NO7A 4C03A 3VBEA 1XYVA 1QDLB 4IX9A 4DZRA 2HMAA 4C7BA 4EG7A 5LMUB 4M4SA 1ZI6A 3W4JA 3LUPA 2VJMB 3TDMA 3QGMA 4MP3A 2VPQA 2D06A 2DHCA 3G1TA 2FW0A 4HLNA 5EIBC 5BWLA 5HM6A 4Q48A 3NJ4A 3ZDRA 3KFVA 5C7LO 1AIPA 2R48A 1BHJA 5JAHA 1AB6A 2V54A 3PXEA 2R6R1 1HSOA 3TPZA 2Q6KA 3HV2A 3VR4D 2ZCJA 3S8EA 1E1CA 4LK2A 3C48A 2XYQA 2BI8A 4JJGA 2PL1A 2CYAA 1P72A 2JFBA 3G0BA 4KFUA 2JD1A 4GR5A 2YXDA 5ADWA 4KBGA 2BD0A 4YAWA 4QSHA 1L7MA 5KNBH 2BP7A 4LZLA 5DX0A 3SQLA 1M0TA 4W7HA 1WOSA 5D7NA 4YRAA 2VJAA 4KQCA 2GJRA 2W0MA 5ILOA 4IIHA 4JVNA 3SC3A 2A8YA 1KDPA 1PVDA 4EUSA 4ZHSA 1NOKA 1TCUA 2HPHA 1ZJ6A 4IVRA 1UBKS 2V5UA 3A3GA 2WAXA 4HSGA 4D5GA 2AFHA 5ALWA 1JJVA 4OXKA 4X62B 1YQGA 3UICA 4NJEA 3O3CA 4DLXA 4DXDA 1IZZA 4EMBA 1XTRA 1KZ1A 4ZT3A 4ZJUA 4MV3A 3WK6A 4FBGA 1A72A 2NPFA 3AF1A 3R3ZA 4OGFA 2WP8J 4OL0A 1JDNA 1YRWA 2DTDA 2HPZA 2JIZD 5CH5A 4ZT2A 4X64B 4BRSA 1SWWA 1PWHA 1ENYA 3L7MA 4FMBB 4JSTA 4V0KA 5E6RB 4YUVA 3SQXA 3N0TA 2XHEA 3SQOA 2IYQA 1Q1QA 4W5NA 3O82A 1NNI1 2V0NA 3DF7A 3V8BA 4MPJA 4N0EA 3TOSA 1XZEA 2X5OA 3LY7A 2P8JA 4XUGB 2H7XA 3V4OA 1RRGA 2WNSA 3IALA 4OSEA 1JW9B 5C7OO 1Q6YA 2ZVDA 3R09A 1ZD9A 4OHMA 1KAHA 2XH8A 1NL3A 4D8XA 4AVYA 4B3MB 3H97A 3UJ8A 3FPBA 3UB4A 3O4FA 2QL9A 4FXPA 2JF0A 3S1LA 1ISRA 1A98A 2B25A 3OTWA 1W5BA 2I99A 2ZSFA 3AFHA 3C1AA 2YINC 4FVTA 4YS6A 4DJAA 5NLLA 4TV9B 2WV9A 1Z63A 1R6BX 1C8VB 4ND8B 5GIPE 1Y8ZA 3A36A 3QWAA 4Q37A 4Q9LA 1IUOA 5ALUA 1TAGA 5LZ5A 4YDQA 3RFUA 1FU7A 3U3ZA 3PVDA 1TLTA 1ZSYA 2JKYA 4PG7A 1VPVA 3K2EA 4HLDA 4PHGA 4C6HA 3PLRA 4I14A 3EF0A 1FK8A 1AHIA 3MRVA 5JU6A 2PH7A 1KP9A 2AOWA 3UCXA 4B74A 1KO8A 1OZHA 1YZHA 4NFYA 3T95A 1XQ1A 2V0GA 4ML3A 1MV5A 2C0QA 5BUQA 2QX9A 3MJ4A 5D3MB 1QXSA 2R4QA 3T5AA 2I1LA 4NV3A 2JLWA 4BB9A 2JIRA 2J48A 3PZBA 5JT1A 1Z56C 4QRIA 4EQ6A 4EW6A 3CINA 4ZZIA 4P0PB 1KMCA 2VVTA 3JQDA 5JO9A 4NBNA 3F8TA 4D0SA 3PQ5A 4MWTA 3BSSA 4Y2QA 5DNUA 4ZV4A 3QKRB 3RQSA 1OZFA 5BR8B 1HOTA 3IDQA 5K8IA 1E9EA 4R1PA 4U7FA 3SR4A 4DJFC 4ZJPA 4JHLA 5IM4F 2DECA 3NASA 5J1TB 1PG5A 3DA8A 4Q01A 2CUNA 4YO8A 2CCJA 3A4NA 4KQKA 4AUNA 1CNFA 4HX2A 4P3NA 2JI7A 3QVOA 2Z4RA 2O3TA 5EKDA 3NWOA 2GD2A 3Q38A 1RAGA 2NXWA 3C6KA 3JALA 4LSMA 3T3EA 1Z5GA 3IS3A 2GXAA 1ZA2A 3CVOA 4FXOA 3PFBA 3CT6A 3IL2A 3VDXA 3F74A 1D4FA 2GCGA 2IUFA 2P9FA 3E3OA 4N5NA 4WWHA 2PD6A 3ZCVA 2WPDD 4BIMA 1YCDA 2YWGA 2QQ5A 3IEXA 2I3BA 2OENG 3PA6A 4Q3DA 2VP3A 1Q44A 3BE5A 2Q5IA 2C5EA 2GDJA 2AG0A 1NNLA 3B6EA 3GD7A 3IQDB 1OW3B 4IEFB 1UJNA 3KVVA 4CMEA 2F1MA 4XYGA 1QZZA 3II6X 5K0SA 2C7GA 3IAM1 5FIUA 4EGFA 4ISCA 4K8OA 4WESB 1FZTA 5B12A 1UMDA 2WF5A 2F1OA 3LQQA 3FUCA 4GVXA 4INPA 1JLRA 3MXOA 1SG6A 2OK7A 2BZGA 2B8JA 3MJSA 4MI6A 4DM3A 3DFUA 3AY3A 2ZTHA 2WJ4A 1Y5MA 5BQFA 1KPHA 1QONA 1CZNA 4RAQA 4EF4A 1TVKB 1MJGM 2VHXA 2B6NA 2G9NA 5DO9A 5ADVA 5EYPA 3K05A 2FUEA 2YQZA 1L3CA 1XEAA 4LF5B 5GJCA 1EFPA 1XZDA 2O8DA 1L7BA 4FFDA 1IPEA 1L8XA 3OE7A 3DGEC 2ZYSA 1RLOA 1W1UA 1XTKA 3H8WA 1U5BB 3UJDA 3NGMA 4I7EA 1ESCA 2OB1A 1BQEA 4CLHA 5KTKA 1OXUA 1KU0A 1RXIA 1TUBB 4LOKA 5G0VA 2V4UA 4F8JA 2FMTA 3KTFA 3ZBTA 4OJKA 5JNUA 3I42A 3ZKAA 5A3VA 4C7MA 3ASSA 1ISJA 1LV8A 4FYJA 4NENB 5TXGA 1YVPA 5F4BA 1C0EA 3A4LA 5FPKA 2C04A 2NSHA 4MS4A 3FB4A 3KD3A 5FPPA 1N9KA 3TCXB 3TZCA 1EX1A 3B9PA 3ZWXA 5CLFA 2ZE6A 3KP1A 2YBEA 5FL7D 1R50A 1VM6A 2VC2B 1T36B 4CPDA 3ASTA 3G2LA 5I4BA 3BFXA 5BW4A 3F6RA 3F9IA 3OJWA 1NBME 1F5NA 3R5HA 4HCJA 4NQZA 5B2ZA 4XIFA 3FVVA 1GPMA 1AZLA 4JYCA 5HKOA 4RAOA 1M33A 2PUEA 3IO5A 1FFAA 1OV6A 5CBPA 3FZGA 3VNVA 4E5VA 1DBQA 1R1DA 2OYSA 2LR0A 2WEKA 3SY8A 2IS2A 1PL6A 4YJGA 4UAUA 5ED4A 1IHOA 1OYVA 1SB8A 2GRJA 4LHXA 5A1TA 1DWOA 4JYMA 2EF0A 4GFDA 2OUKA 1SOAA 1P0QA 1YTLA 2VHJA 4QUHA 2I5PO 4L73A 2NO6A 1RW4A 1M1YE 2GM5A 4II7A 1ZK4A 4OQDA 3TIGA 4JLBA 2JZCA 2FNAA 3VU9B 4NPHA 2QD3A 2Q50A 3QV2A 5HFNA 1H42A 1O6ZA 2GN8A 1E98A 1U0EA 1M0SA 4FDUA 2QA5A 4LYAA 1RLUA 2VNHA 1TGYA 1M3SA 4U6SA 3HVHA 3FOBA 4RK4A 1U81A 1WPCA 1DEHA 4AN1A 1EQ2A 4BO3A 6REQB 1T0JB 4ABYA 1S4MA 2R7MA 5HZAA 1T9CA 4EKNB 3BB3A 3OZFA 2P27A 2I6QA 2V45A 3KEQA 1C50A 3QIVA 4GMKA 4GXNA 4ZGQB 5BQ5A 1Z5ZA 3TW8A 3IR6A 2DB3A 4XLFA 4ETIA 4BMSA 1W0CA 4QBKA 3E3NA 1P7ZA 4MWSA 4QWWA 3VHRA 2FA9A 1NAHA 2CK3D 3E9ZA 5TPZD 1CXZA 1U94A 4D6YA 1GDDA 3QPCA 4GMGA 2OCPA 4PVDA 1JR4A 2J9YB 2QP3A 4BE9A 2QRHA 1ZN2A 3MT0A 4KP7A 2CC2A 1Z0FA 4FINA 1BE6A 4XOIA 4E4RA 3N70A 3DS8A 3JQ8A 4NJEB 1LZLA 1WP4A 3GAFA 4WNIA 3FGPA 1Z73A 4M9ZA 5F73A 4HV4A 3B9RA 1QFJA 3CX6A 3O2NA 2GF9A 1I9CA 3CW9A 5CT9A 1EX6A 2XUAA 3ENQA 3UY4A 1KZHA 4Q4JB 2Y9MB 1CNMA 2RC5A 1EUQA 3MS7A 2I4RA 2AMFA 3HFJA 3TSYA 3RC8A 1ZHHA 2ZDQA 2DTEA 1RDFA 2PXAA 3TS1A 1FW8A 3BCSA 3P8ZA 4GP9A 1J9GA 1FMLA 1OKKA 3KJGA 3WA6A 3RW9A 4BZPA 4RF3A 4DDUA 1J0XO 2Z3WA 3ZS8A 3WXBA 2XB6A 3RJTA 3KQKA 5JZBA 1T4CA 2JH9A 3ITNA 1OLOA 3ZHXA 2AXNA 3E9NA 2DU8A 2J0QA 4PZUA 1CJUC 2FZGA 3ENNA 2UUOA 3HK2A 4LZAA 1P7CA 1HT1E 2RKOA 3UWDA 1A2QA 3UJAA 2WAYA 3EXHC 4DXAA 1AURA 2YIJA 3CF6R 3MW8A 7REQA 2WUDA 3AVYA 3PC7A 2AWOA 3LPDA 1ID8A 1JV2B 3SIWA 1I10A 4KLAA 1XZCA 1GXSB 2C96A 3SR0A 3EPRA 1A7AA 4Q02A 4RVCA 4DMFA 4JNCA 2EJCA 2ZRAA 2IYRA 3O90A 3R0IA 3QVLA 1VE6A 4ITRC 1DEAA 1WY7A 4IQGA 3ZW8A 4EKEA 2JLXA 3RKRA 2DFPA 4B3BA 4YJDA 3N7TA 1FRQA 1F9AA 1T6XA 2D3LA 1PF7E 3H18A 4E1AA 1MQAA 1JFVA 1SULA 2DJIA 3V8QA 3EZ6A 4JKYA 5I5EA 2CNKA 3V6MA 4PC7A 3WLOA 4A73A 2PSFA 2H4XA 1UKCA 3PPWA 1OJLA 3JWHA 4FOPA 5DF1A 4AI6A 1OWPA 1UDBA 1B3RA 1XTUA 3C2QA 3M70A 3A3BA 1DFIA 3IHKA 4JLUA 2FU5C 3VH3A 3LA6A 4F6LA 1ZPDA 3DEFA 3DWEX 3TSCA 4OD0A 2Y93A 4WBSA 1XWWA 2GF0A 4Z4VA 5KUTA 1SXGA 3T3PB 5FWDA 5EP3A 2JHAA 1UD5A 1P4RA 4FGUA 2F3PA 3JR7A 4KOAA 4X8LA 5EIBD 4KR2A 2VF5X 1Z0JA 4KQWA 3MTIA 4OL9A 4QGGA 4WFIA 2ZL7A 4U00A 4J90A 4QOIA 3BRQA 3QKRA 3L4BC 1NMSA 4YUZA 1GITA 1U02A 2QYHA 3N28A 3Q5DA 4FT2A 4J0JA 3VHQA 1TAUA 4G25A 1X3LA 1QRAA 1GL6A 1Z06A 5KPDA 4QVAA 4I08A 2GNPA 3QVMA 4G0NA 4U39A 1U0GA 1SVMA 4OK6A 5AP9A 2ZS7A 2QMYA 2C4WA 2DT8A 3D7KA 4GLLA 1G8PA 3I5MA 5HPYB 5I7WA 5GADl 5D1NA 2PL5A 5J2UB 4PY2A 1BC5A 3IPLA 2Q3JA 3DB2A 1P80A 4JSRA 1IY2A 2PVCA 3QU2A 1RHQA 3FR8A 2KLBA 4H16A 4INAA 5F3RA 4Z4UA 5K3BA 5IWAB 1EK2A 4XPIA 1QF6A 3DEJA 3GLFA 2PMKA 1EFDN 1ZWKA 4M7PA 3AHCA 3QTTA 3KKKA 1RZUA 4MVJF 4UNRA 4LRTB 5JPIA 4REQB 3Q5EA 3QEMA 2ZTSA 2BIFA 3OOJA 5C1OA 2YS7A 1ILEA 2GEDA 3RC7A 3K4PA 2XBUA 3T1HB 3T3MB 4RMGA 1XWIA 3ZZUA 4HB3A 1EIWA 1CIPA 2XF8A 2X2OA 2AYXA 2FPGA 3IMGA 4DMLA 1CBUA 2IXBA 4CDRA 2NQ8A 3PGJA 3ANTA 4LW8A 4WZAB 5FPSA 3G7SA 1YRHA 1PT9A 4E2XA 1IB6A 4IY1A 1TVKA 3ZCUA 3EEYA 1YVEI 5D3QA 4RULA 3IB3A 3KPVA 1VI2A 4MHOA 5EE1A 5EYPB 2XB9A 4GL4A 4QLAA 2B1IA 3H94A 4P4SA 2QRMA 1EFPB 3JYNA 3N2YA 3RVKA 2WF6A 3GEDA 3PXUA 1J7JA 5LNK6 1HURA 3BCHA 4B4OA 1ZM4A 5IF3A 3ROTA 3EZGA 1E0SA 5KNDA 2BH2A 4R0MA 2MMCA 5IAJA 3U0BA 4E5MA 4GLOA 1BFUA 4BJ3A 2PKRA 4RTLA 2CHFA 1XQBA 1KKLA 1A04A 1Z2AA 4AS1A 1RWWA 4GWLA 3TL2A 2IH5A 1NBMD 5E8RA 4A3SA 4CU2A 1EGVB 3ETEA 2GPWA 5THXA 3AHGA 4G9EA 6CHYA 2QPTA 2AK2A 2VIIA 2WD7A 3G1WA 5CLHA 1ML4A 5LD2B 1D2HA 1K8RA 4H31A 3B9BA 4DBZA 3IELA 1K89A 4LVCA 4P08A 4Q47A 5BNIA 3KJIA 4WZLA 3V42A 3V4FA 1VQ6B 1GAEO 1L5FA 3CZRA 4OOEA 3ONEA 2IEGA 4G67A 4MCJA 4OXYA 3T5TA 4DRXA 4NQRA 2JGKA 3R8FA 4HR7A 3RVBA 1CIVA 4C6SA 3QE2A 2X4LA 3FE2A 2BHSA 3GA7A 3HCWA 3LY9A 5T7BA 5JJKA 1XFOA 4H9GA 5DS0A 2HQ1A 3ZJTA 4HKTA 2OPBA 3HSSA 2EFJA 1C30B 2F9FA 5DLQC 1RS0A 4JMQA 3MCUA 4JR2A 2G83A 4J0FA 1LPMA 5IU6A 2EBFX 1ZH6A 2XITA 4TMZA 1U2RA 3IDSA 4HWGA 3SSOA 3GT7A 1J0BA 1NA5A 1NW5A 1B23P 4Q9JA 3ZU2A 3EGXB 3RVMA 4Q21A 4BHTA 2HA7A 1SUIA 4M9SA 1T5LA 3RK1A 5AJZA 2P90A 1YRBA 2LNDA 1XXHA 2B78A 1O6GA 3ESRA 4ZCQA 5EIWA 2Q8PA 4V1CI 3VR5H 1IY0A 5F12A 1CW2B 4ZIRA 3RRFA 4NPAA 2Y1GA 1QC5A 3LUGA 3RWBA 1V5GA 3TVTA 3OCYA 1GEEA 5C4IA 1VB5A 1LC0A 5JCXA 3OLWA 1V7PC 4DIFA 3HUUA 1RP7A 1JWBB 4B81A 5ITZA 1E0JA 1YB5A 2VDUE 4QUEA 2XKBA 3NS7A 1N2BA 2ZJFA 3COYA 4TWAA 1ONSA 4BGIA 1GQYA 5B3LA 4MUXA 3OM8A 1PT8A 3VNAA 1HQDA 2CV0A 1M2EA 1ACJA 4R1LA 1P7WA 1VSUA 1O5TA 3NGXA 4WIAA 2Z8YM 3F6BX 2NP7A 1U0NA 2IYNA 1QK4A 1A4XA 4M7WA 1Z6QA 1VL2A 1N0IA 3HCOA 4JBWA 4ZHQA 2W6IA 1JAIA 2ORIA 3WFIA 3N05A 2JJ2A 1ABFA 1DKNA 5BSMA 3V1UA 5IDQA 1QHIA 4KDEA 5DLDA 2WI8A 1X80A 3P9NA 4W1PA 3V2HA 1PJSA 5JC1A 1KQ3A 2A1IA 3EQ2A 4UPDA 4V02A 1XAGA 1BEEA 2J0VA 2Y1FA 1EJ6A 2NIPA 1REQA 4LX8A 1GD1O 2NTNA 1TJ5A 1Z6GA 1C1HA 3DL4A 3I32A 2HMWA 1LDEA 1SXJA 3KEGA 1IFXA 4LAFA 4MGZR 4AJJA 5BURA 1CX9B 2PUTA 4R7GA 3EUWA 4GZ5A 5F52A 3PQ4A 4A8PA 4MR7B 4F5ZA 4DVGA 1CRPA 2ZPAA 4CIVA 4PN7A 4CM6A 5DV9A 1JG4A 1GFSA 4FILA 2OTLB 1UK7A 1D0SA 4LE1A 3BMCB 1Z5PA 3HP7A 3MWLA 3N2KA 4P3OA 2HMUA 1E20A 3KVYA 3CZ5A 3A2NA 3MBIA 3IEIA 2BFDB 3ELDA 1SK9A 1Y7IA 1JDSA 2J3IA 2P8SA 4Z7OB 1HFJA 3EDMA 1ZM9A 3MERA 1NJID 1GXSA 4HNUA 2PJRA 4DQ0A 1HT0A 2RAFA 3MGBA 1PFWA 1QH8B 3K6RA 1WXHA 3AI2A 4TYNA 2BFOA 3BNWA 4TUYB 2GLXA 1N2ZA 3ZNOA 2G4VA 4GOND 5EHGA 4NCAA 2VQ6A 3SSNA 1XTZA 4Y7DA 1ZXXA 2YRFA 4XGKA 1UIRA 2R8PA 1B1AA 3LBIA 1KIFA 4ES6A 2CSXA 2O8EB 5BSRA 2VK4A 1YL5A 2CVOA 4M1ZA 3FZYA 2NMVA 4NZMA 3D6VA 4GUAA 4M1SA 4BX8A 1E60A 1K5DA 1V1RB 3I72A 2OE2A 1U28C 1EFTA 1WUJS 2W0SA 3PYXA 1KEVA 4QIHA 4QWMA 3K1JA 4QXAA 1LPOA 2A6PA 2WHPB 5DHFA 2WDZA 4YXWD 1HYBA 4DSZA 1FYEA 1X1QA 1KJ8A 3TLAA 1ADGA 2GERA 4JBHA 5K3FA 1XA4A 3BULA 2PRZA 3CR7A 4QOGA 3AXSA 3EF1A 3BGOS 2FF5A 1ZK3A 3PIRA 4NMXB 5IPFA 3BILA 3PXXA 3CZ4A 1E7WA 3LG2A 3W4IA 1YZLA 3FCUB 4G5SA 2R47A 4JBNA 5JJIA 3ESYA 3UUFA 5K99A 1DHTA 2XE8A 1F51E 2CLDX 3IOMA 1U1EA 4LVOA 3RUAA 3EZNA 4UFOA 3QPDA 3IQFA 3MQFA 2WIJA 5HJ5A 1BD4A 5EZ5A 1MHTA 3VDNB 3UNXA 1RXUA 2CB9A 1SQ6A 3F6CA 1VZ3A 4X24A 2P1DA 2W6ZA 3W4KA 1Y6FA 3GPDG 4AECA 2IFTA 8OHMA 4WK6A 4WN3A 1QCYA 2H1VA 1MW9X 4JP1A 2CRVA 4FFBB 1OFTA 1THGA 4DG5A 1N5RA 1CR2A 1QM5A 4FDMA 3JQ9C 1U4SA 2QVLA 4REQA 3PTAA 1AZSC 3P5SA 1ODIA 2XAUA 3OLQA 1JU3A 5FNVB 2FN9A 4XNFA 1IBLB 1N33B 2XY4A 4GPTA 1SKYB 1R37A 4PFSA 4QT4A 3CCQB 3AI1A 3U81A 4MARA 1R6DA 4MP6A 4FJ0A 1KYQA 1GNSA 4BNNA 3WXMA 1FQWA 1S2GA 1V3TA 2FPGB 3C3YA 3QWHA 4QRHA 1N8SA 2C4UA 1WQ1R 4PC3A 1D1QA 1RZVA 2G0TA 3PRJA 4XUEA 5FOSA 4PGAA 4RJIA 2QD2A 5HZHA 2DM6A 2UYQA 1C8KA 3BQJA 2A7XA 3C4VA 3MWKA 4LYGA 4DMUB 1BGXT 1CZKA 4U8GA 4AK9A 3A3OA 5JALA 1VBNA 2FFQA 4X54A 5FHQA 3ZZMA 1M9NA 3R23A 1V8ZA 4HB2A 3HBJA 3TR5A 3BXOA 4F2HA 2XADA 1PV4A 3HCFA 3T7EA 5E9QA 1KBOA 1XAIA 3QELA 3D4NA 3GSIA 4UEOA 4F8EA 2OORC 5H3LA 4BMDA 3R3UA 2V9ZA 3LPMA 3NHLA 5CFMA 3UWSA 3H4VA 3O8LA 5ETJA 1WPQA 3UJHA 1PJQA 4BVLA 3EC7A 4P3KA 1AKRA 3STUA 4JOSA 5FTNA 4Y2TA 5IKEA 3KWMA 5EJ6A 2FDXA 5JQWA 5MF6A 3N5CA 3RRNA 3U44A 2NADA 4GMXA 4WOJA 1JA1A 3AIKA 5UKDA 3RYHB 3MTQA 1W73A 2CV2A 3QMMA 1L1RA 3C6QA 2CFOA 4PSCA 2J3LA 4Y6LA 3MGCA 5CVCA 4ZC8A 1SUSA 5JH7F 3R9XA 1S2LA 2A4MA 2ETXA 4OXQA 1UAGA 3ESCA 2ZIVB 4UUPA 4BQIA 3ZWAA 3SC2A 3QU4A 3JAWB 5CAEB 3VR4A 4L08A 2QUIA 4M0MA 1SBNE 4KOEC 1I24A 1L4UA 2HGZA 3IVRA 5KVQA 2QJTA 1NI3A 3JAKA 3H4TA 4BX2A 4PGMA 3RBZA 3CLUD 1JYSA 4IFTA 4DA7A 1E9VA 1V16B 1NRJB 3TQCA 3PQ3A 3UJNA 4RSGA 2O2GA 2G09A 1M1YA 3FSGA 4DS3A 1MTZA 3TUZC 2FEXA 5A9TA 3NG1A 3W7VA 4J9VA 3OHSX 4HE5A 4Z1OA 1EFHA 1AKEA 3HLYA 4JX8A 3GOQA 4HTAA 3W04A 3QWIA 4ZPJA 4M83A 4B6OA 3B13B 3TLXA 2OM6A 1QR6A 2ZB7A 4Q7JB 3C39A 3I5XA 3CVVA 3K0CC 3TQFA 4XUDA 3JQ7A 4BNHA 1L4MA 2XXAA 3HDJA 4KKVA 3CBGA 3L1IA 4P2NA 4QQRA 4PN3A 3WY9A 1Y8RB 3CUYA 2BFBB 3OCWA 4H35A 3I4FA 4U0KA 4XARA 1UL1X 3H5TA 5LUAA 3EGWA 1HE5A 1P2SA 1ZK1A 4HADA 1Y8QA 3FTFA 5AIAA 4QOHA 1HLDA 4CL2A 4L8GA 4CVNA 4FE7A 3MRTA 1C41A 2ZUBA 4MROA 2HJVA 1MABA 1KHHA 3ZWNA 3EC2A 2ZIAA 3AW8A 1Q16A 4JGBA 4LSGA 4RBNA 1KI6B 4KWHA 3CCMB 1SC4A 3BBPA 2ZZGA 1O7JA 4LK3A 1UT8A 3KBBA 5CVVA 6LDHA 4JELA 2QZ4A 2XWJI 2YWDA 5KJ6A 2BFCA 2ZG6A 4YJ2F 1MTOA 1QGZA 3L06A 1KDOA 3ZGZA 3RANA 2ONCA 2XYGA 5AVXA 3WDSA 2AIRA 2O3QA 2P9ZA 5KO2A 3CD6B 4RMJA 3TKYA 3IP9A 4Y2XA 5EJ5A 3LZDA 4X07A 2ZBGA 4P5PA 5LKRA 1V3QE 4EG6A 3HY6A 1P6QA 2VXYA 3L7CA 4JUCA 3BTSA 5EE0A 3EVNA 3NDRA 4JVOA 1NKTA 4OQXA 2HT1A 1C4OA 2WVJA 3FZQA 1NW9B 5EPUA 5FPQA 2Q9BA 2ZI6A 1OY1A 1ECJA 1AS2A 4BFTA 3OOYA 1QCDA 2JK0A 4BTVA 1GTL1 5I4CA 3FTPA 4DQDA 3F71A 1VJ0A 2XVAA 1ELOA 3IBFA 3CEHA 5LP6F 1J07A 3I2IA 4V2IA 3IBGA 4BNDB 3LL4A 4QDKA 3TMYA 5IEJA 1KNQA 3I4CA 4ETNA 1U6IA 4I55F 1W87A 3HYSA 4NBUA 5IBCA 4AAYA 1MENA 4LFBB 2YJ4A 3PLAE 5KNBD 4ND2A 1EXVA 3D4BA 1DCMA 3TX2A 5TVKA 3Q6IA 1KS9A 1KA9H 3KR1A 4CI0B 1R66A 2A1UB 4JV5B 1CE8A 1PTKA 2OHHA 3D64A 2FFAA 2P78A 3PX3A 1DUVG 3GJSA 5ILGA 4XONA 3DCIA 1ZCJA 3FYUB 4WKOA 4JYPA 1JXQA 5JQGF 3HBMA 5AKYA 5DHAA 4V3BA 1G21B 4KITB 4PHHA 5DIFA 1DAOA 3HSYA 3X2FA 1NYQA 1R10A 5TPWB 3KEMA 3U0VA 4RTSA 4R41A 1E2GA 4HDOB 2EFCB 2FOXA 1T1JA 3OZVA 1KFBB 2A35A 1DC6A 3K1YA 5T8KA 4CQJA 1OV4A 3A6ZA 3D1JA 1R4NA 3LYLA 2J9ZB 3M5DA 1VE5A 4AJNA 3AHEA 2V9PA 3GVLA 1E2NA 1P8AA 3G02A 3BWCA 4LC9A 5FR2A 2CDAA 3WB0A 1CJCA 1XLVA 2IKSA 4KQMA 3DNFA 1Y8CA 2CDNA 4X94A 2H1WA 1N4AA 3Q41A 4TMYA 3DZBA 4MI1A 1QFZA 1XZLA 4B8ZA 4JLNA 1BNCA 4CEJA 3ZY5A 3CZMA 4IILA 2BP7B 4A0QA 2P9CA 1U8YA 1RRCA 2EZ8A 1F1JA 2F64A 3EVFA 2GYUA 1VQ5B 2VR1A 2ZZMA 3R3YA 3ZWKA 3LX6A 1WUKS 3GXOA 3V5NA 4TOIA 4EY7A 1G2IA 1H4TA 1GRQA 4RD1A 3JYLA 2QRJA 4ZN6A 1KK2A 3TB6A 1NGSA 5GZ3A 1WB5A 2AFHB 5EJAA 4AZ3A 2EFHB 5JNVA 3U2QA 1OIVA 1E1QD 4LRXA 4BNXA 4PBRA 2OGZA 2DBVO 2QM3A 3AERB 4P0TA 4EZIA 1CQZA 3FDXA 1L0BA 3KOZA 1SU4A 4LGMA 1ENOA 2GJ8A 3GRVA 2JEYA 3E1YE 1TKCA 2FWJA 4Q1EA 1FXWA 4OP2A 1A5TA 1WDLA 1TZKA 4HGRA 2Q7DA 1IY1A 1YQEA 1N2EA 3AB8A 4L9RA 5AXAA 4Y6QA 4MP8A 2BTOA 3KEFA 3ZDBA 1Q0QA 2XJ9A 4IIDA 1C80A 1OPRA 1MJFA 1ZCAA 2PEZA 4LJYA 4U7DA 1JPNA 3BXHA 3H8SA 5J2TB 5L7WA 2XOKA 3ASUA 2IT1A 2R1VA 3ORFA 4X91A 4FNGA 4B45A 4LNHA 1G4AE 3A6DA 4MEJA 2P3QA 4WZBA 4KKUA 3HKBB 3I8XA 3AB7A 2JPDA 3EXHB 4XX0B 3LUHA 2AI3A 5DHRA 4B79A 2N47A 2O05A 4CGYA 3JQEA 4DM4A 3M4ZA 3FM9A 1NY6A 2VEDA 4LEIA 4LSZA 4GZLA 2EW2A 4UCQA 3S2YA 3X1ZA 1Y1QA 3T3NA 3BWDD 5FKJA 5EGNA 4ZI3A 2D8AA 4JT9A 4AQYB 5CURA 3ELUA 4HJRA 1J24A 4U1RA 3S2FA 5CH3A 4P38A 3U4HA 2UZAA 2FYTA 3AWIA 3ZHYA 2HC9A 3L4JA 4YCJA 3I34X 5D86A 3BHMA 4D6PA 4BGDA 2KM1A 2AI2A 1O94A 2AFIA 3QELB 5CT6A 2JCYA 3T94A 1XVVA 3IBTA 4FYVA 4G5OA 5DI9A 4DNFA 4G56A 2O57A 1VXOA 2QTCA 1DIAA 1TQDA 3A4YA 3O38A 3ZWCA 2R9VA 3RYTC 5DNEA 2C4NA 4F85A 4A23A 3MWFA 1NW4A 2A9PA 3L4KA 3NC4A 1VZ2A 1JR6A 5EUQB 3GLIE 4I9GA 1EZZA 4LI0A 1EEXB 3ITKA 3FYHA 5K0GA 2XIJA 2FF7A 1P9NA 3WQRA 3LQ6A 5F4MA 3VGPA 1EFUA 1KWGA 4BPRA 1IUPA 1NF8A 2C0CA 2LKDA 2W2MA 3GFFA 3PD0A 3ZW9A 5ITZB 2IWRA 2ZBFA 3LAWA 1R5NA 5EC8A 2XXJA 1Q19A 2ZM5A 1U3UA 3I04A 1FVXA 1GTVA 1BCSB 2APJA 2VZLA 1GPYA 2QA4B 2X0KA 3L40A 3UV7A 3H16A 4EJ2A 3AH8A 1U3DA 3FMOB 1KY5A 1X3SA 2VK2A 3QE4A 5I7OA 4HZUB 1IRIA 4IS3A 3I9JA 3QWBA 2FWBA 2COEA 2YHSA 3HWSA 3NIFB 5DIZA 3HBNA 3HJRA 3JALB 3RWMB 4CKWB 4FS8A 2RCYA 1S2DA 1VQMB 3B3QA 4RVFA 3VC1A 4N5IX 3EJ6A 4NWIA 2PZ8A 3RSLA 4BVBA 4W1SA 1GSHA 4TRRA 4XPZA 3KDAA 3RTGA 4EHIA 4ZZ1A 4EABA 3F73A 1BRTA 4MW6A 3CVUA 1HYQA 5K0LA 2LDBA 4NZOA 4S1VA 1V37A 4XL9A 3B51X 3D1LA 1QIHA 4UHCA 4AKEA 4JXZA 3K0CA 3TD6A 2RH4A 3UFBA 4DARA 5FLXA 2XRZA 1FLVA 3N8KA 5FTLA 3LIPA 5KJCA 3EG5A 1U63A 1DXQA 5CG1A 2YHAA 1BOFA 2PBFA 5HILA 2ZJ1A 4W9NC 5D3ZA 2WHQA 3GCWA 1TIKA 3V3KA 3KPJA 5HS6A 4PCLA 2FZKA 1U0RA 3DXYA 3EVBA 3I4LA 3QV1A 3OJFA 1VL8A 3GCDA 4INZA 4GOJA 4KYIB 5AICA 3WDKA 2UXCB 2PE3A 2W6ID 3AK4A 4G4SO 1IK6A 2O7SA 4HGOA 4Y9DA 3DOHA 2H52A 1MA3A 2GN6A 4M87A 1PJ6A 1P2BA 1X1RA 2IZ6A 4QNMA 4WLFA 2ACVA 2IZ1A 3VH1A 4UJ3A 3UJ9A 4XR4A 1FS6A 2QAJA 3ZI0A 5J4LA 4RF4A 2WMNB 2G9ZA 1JTVA 1Z37A 4O2AA 1ORRA 1TCBA 2X58A 1QZUA 1U9IA 2G1AA 2O5EA 1ISSA 1KYWA 3DBRB 3K2BA 3KX2A 3GLKA 2NQ2C 4HMQA 4MMYB 2FKAA 2UZ1A 4J29A 4PWYA 4Q19A 4CIDA 4LXHA 2YWFA 3SQWA 2ICAA 2H4HA 2WSSA 2NNWB 3SJBA 2DXIA 4DQKA 4ECAA 2EDAA 3HEBA 3TM4A 1SR8A 2A5FA 5A7FA 1E99A 4BLSA 2C2BA 3WGUA 4KPUA 1T3SA 1UEJA 2C9YA 2X8KA 3MQ4A 4M88A 4TTRA 1S2MA 2ANBA 2XMGA 3NHFA 2I62A 1YXMA 4PU0A 3QWFA 4GGMX 3CLSD 4K6FA 1Z25A 5LD2C 4NECA 4I1OA 3TZEA 3A4MA 3UGKA 3JVVA 3U16A 1NVUQ 1PK9A 2GASA 2WF7A 5ITVA 5EQTA 2GREA 2ZYAA 2BGTA 1UXKA 4DY4A 4P7JA 3SQMA 1VJTA 2PT9A 3EASA 4ZZ3A 2E48A 1E18A 1BX1A 4R2IA 5G3YA 2E82A 1NKSA 2QTAA 2IYZA 2PEYA 4M2LA 1EB9A 4HN2A 2RJNA 1P6UA 2ZAGA 4YJGB 3KL9A 2GPYA 3HA2A 3KUDA 3NHZA 3S8MA 3TQRA 1RAEA 4HGZA 4Y0AA 4ETWA 1RWQA 1FUYB 3B2QA 3BD7A 4S12A 3DL7A 1YCHA 4OHKA 2YX1A 1SUBA 2XKJE 5F2EA 3KB8A 1JPJA 4L8YA 4ZMBA 1LFDB 3RTDA 3QVXA 4JJKA 1Y37A 2IYYA 1KRHA 2EEZA 5F76A 5HUHA 3V7AA 1TEXA 2V7BA 2FZ5A 4UKDA 3KXPA 4OLFA 4MDYA 5TPWA 2F9LA 3AKEA 3V55A 4MAMA 1W6RA 3ROQA 3VA7A 3GEGA 4EFLA 4ZDJA 1F8UA 1XQWA 4EPYA 1R4NB 1V43A 2P40A 2WYUA 4FZ5A 1C7IA 1TD9A 1SHLA 1ZJJA 3NTLA 3LW8A 4N6GA 3GP5A 5ALKA 2C2WA 4ZVOA 2FY8A 1ISIA 1J6UA 3CUSA 1GY8A 1RAIA 1HMYA 5M7EA 3CYFA 2H1CA 3VC7A 5KPJA 4PZLA 1JFLA 1KE2A 2O6LA 1UWLA 2AYYA 5HOEA 3D3NA 1X7YA 3FRIA 3GJZA 5KSWB 3GMDA 4K2HA 4F0JA 1MD9A 1QCCA 3RADC 5AHWA 3ICEA 5P21A 2Q45A 3V7WA 4BE4A 3ZHUA 3GH1A 3ZHVA 1EM8B 1P0FA 3SXUA 3D54D 1CQJA 4H6WA 1UAYA 3MS4A 2QJFA 3K72B 3PI7A 3BGWA 2DYIA 1OAAA 4RDLA 4EENA 3DMPA 4U6QA 1QHHA 3DAHA 2QAGA 1NC3A 5A88A 2QKYA 3RVOA 3AF6A 2AZXA 3RIGA 5DNCA 3OPOA 1IB0A 1I2BA 1R5BA 2C88A 2FJUA 1K5HA 2CKMA 1PNQA 1MOPA 2JGDA 2NUPA 2QMOA 2ZRDA 3NYQA 4M9XA 1I7PA 4Y0VA 5EKTA 2JBAB 4C7OA 5F2KA 2MDTA 3OY2A 4DAOA 3HU3A 3T54A 1W48A 4Z4GA 3H7IA 2NV0A 1ZHOA 5IARA 2H1RA 2HCBA 1YMVA 3F0TA 4AURA 4YV2A 1H1TA 2FPOA 2OD2A 2H7YA 3EG9B 1T24A 1T9ZA 2V31A 1K6XA 1FP4B 1YZYA 2HADA 3BQNB 1ATIA 1HYHA 3FJ1A 1B8OA 2ZYDA 4MVJG 3UKJA 4DGSA 5IM4A 1N25A 2WTNA 2JFXA 3SNKA 1T5SA 2P41A 7ADHA 4XE5A 3T7RA 3BS4A 3IIMA 4BOYA 2JFNA 3RTAA 4W4TA 2B83A 2XLBA 2ODAA 4E5PA 5DTJA 1GQSA 1P74A 2G7ZA 2GI4A 3VXKA 1ESDA 5A5DA 1P33A 1NW3A 2Y8EA 1J5EB 2XGJA 1UOPA 2TRSB 3P0JA 3T6KA 3L6DA 1HDGO 2OLKA 4IXWA 5CLGA 3L9XA 5KYXB 1KYZA 1DMSA 1LVUA 3WGOA 4C2UA 3EQ6A 4GX0A 1ETHA 1KZ7B 4UZUA 4WNCA 2C1XA 3HGMA 3JVUA 2IHBA 4RADA 4JMPA 3DG9A 4Q4AA 1O94C 1YJNB 3LLVA 4HNRA 1MVLA 4YQEA 4YRDA 4DF3A 2PSHA 2TMGA 4HPJB 1PKVA 4IJVA 4R5HA 2NVUA 1YIJB 3EULA 1G19A 4RGBA 1XRMA 1RYZA 3OZWA 2JCSA 1W8DA 2ZBDA 3LMKA 4LZPA 4W1RA 5BN5B 4AWXA 3JRXA 2PX5A 5AOAA 5EGSA 3B6KA 3L7OA 3WYAA 3RSOA 4ZVNA 3C8ZA 4JNKA 4MWEA 2ADFA 1DPGA 4WZZA 3T9BA 5KMGA 3LL7A 5FQOA 2O19A 2POCA 2AXEA 5C81A 2ONYA 1Z6YA 1NG9A 2VAXA 5KTRA 2YFHA 3ESBA 5IYZA 4FLFA 3I6IA 4RJKA 1E8DA 2GAAA 2RB4A 5TV2A 4ZQGA 2XZOA 1T1SA 2CD7A 3LOQA 4QGBA 3SXJA 3SIXA 3VAAA 1FB5A 2IYFA 3U3RA 4MYDA 4DIKA 4ZEVA 3QPAA 3WWOA 4DA6A 1TFRA 1IN5A 3O92A 2Y71A 4IRUB 2ORVA 4P54A 3U6KA 4HZUA 2QNBA 3E8XA 2B92A 4IO1A 4UM9B 2G1PA 1WXEA 1IWOA 4NZNA 2IGBA 1P9RA 2DULA 2PG3A 4NYMQ 4MTCA 1G4UR 1PX2A 1SUPA 4KAFA 5FB3A 2A5YB 2QN1A 1MNQA 1EAYA 1I4LD 2JKZA 1UR5A 4QYMA 4WVLA 5KKAA 2PLWA 3SYKA 2ZUTA 3TQTA 1EUZA 2Z9BA 4RFSA 4KO4S 5DK4A 4FYYA 2EDCA 4UATA 3AVPA 1K28D 4GPD1 3GLHE 2Y0CA 5SYAA 3VKWA 2G63A 2BFPA 4NKRA 4XLZA 3WWEA 3KE8A 3KC2A 2XX3A 1SHTX 3R8XA 2Q6IA 3IRVA 1S2IA 3FBGA 3KXKA 1ZSVA 2J3HA 3LLCA 4NBWA 3BYZA 4N1AA 4TV8F 3VSEA 3HJUA 3ZLUA 1JHQA 3DTVD 3STTA 3AIMA 1H65A 4M1TA 4RKEA 3THRA 3AM1A 3VHLB 2EF1A 2G5GX 5FLYA 1BO6A 1D3AA 2VHTA 1Q91A 3DCNA 4GVLA 4FHCA 4HWTA 5DYTA 4AN0A 2F4VB 5K4GA 3LO5A 1Z5OA 4I4TA 4TWIA 4XVHA 2GA8A 3R7BA 5LKAA 1RZ3A 1N3LA 1EA7A 5HFJA 2QZ9A 3OKFA 1QQTA 1A9PA 1RPTA 2IC5A 2AZMA 5AVOA 4L3VA 5I8ZA 4BTLA 5IHPA 1JDUA 4G0UA 1N7GA 3CG0A 2ZSAA 4RENA 2AJCA 3RTEA 1HEYA 2J5KA 2BEUA 3KFXA 3M9LA 4BP8A 4KR7A 3JPWA 3K0AA 3EZXA 3G2IA 1UC8A 3L7JA 5BN4B 1JTFA 1A50B 4O2AB 2I7TA 7GPBA 3FUWA 3K8OE 2DWUA 1ZEMA 3P2IA 4YVFA 1SQGA 2DSNA 4NJMB 3ZY2A 4XDGA 2IYLD 4K3VA 4BEJA 2OD9A 4HAZA 4FN5A 1TK3A 1SB9A 2G06A 3G23A 4OM8A 2OYNA 4PAWA 3EFOA 3WMRA 1MN6A 4XCVA 5H9VA 4MS3B 4HTFA 4KCGA 5F35A 1XMIA 1N2SA 1N05A 2H5JA 3AJ9A 1QR2A 3BB1A 2QP4A 3I23A 1K7FB 1W1WA 3HJAA 3B5EA 3IUMA 2JDIA 3VKFA 1A82A 5EY5B 3MWJA 5L51A 4Z8YA 1SG9A 3U48A 2AQIA 5F3WB 1M6NA 4X71A 1H0SA 4IH4A 4RGYA 3A0RB 2QMHA 2PZMA 2HF9A 2QYOA 2JAWA 4WXHA 4C89A 2HH9A 4F6RB 4UBIA 2F6RA 3GRZA 3UUWA 1SZDA 3UK1A 2PUCA 5EMLA 1CY6A 1CRQA 5CB6A 1KEUA 1QB8A 2QLFA 1YX2A 2X9NA 2YMPA 3DDNA 3LK7A 1PT7A 3HUDA 1TQ2A 4IF4A 4MLZA 3B3FA 5LQCA 3GMTA 5AFSA 5BR1A 2W6OA 2XT6A 1G5QA 3TSOA 3AKDA 3WBJA 3TLKA 3ZGNA 1U1FA 4A0FA 1FYDA 4G07A 2PSEA 1VP3A 4S1NA 1SXIA 3KB2A 4PC1A 2B98A 1H2ZA 5AHOA 1OT5A 2D0OB 1N9GA 4GE3A 3HL0A 4NC9A 4YAJA 1I7QB 4BE7B</