4RM0A

Crystal structure of norovirus oif p domain in complex with lewis a trisaccharide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
307
structure length
307
Chain Sequence
KTKPFTLPILTIGELTNSRFPAPIDQLYTSPNADVVVQPQNGRCSLDGELQGTTQLLTTAICSYRGMTSNPTRDYWDGHLLHLVHPNGATYDPTEDVPAPFGTQDFRGILYGVLTQNPRASGDEAANSQGVYISSTSEKFTPKLGTIGLHQVQGNIASNQQSKFTPVGIAVNGNTPFRQWELPNYSGALTLNTNLAPAVGPNFPGEQILFFRSNVPSVQGGQPIEIDCLIPQEWVSHFYQESAPSQSDVALVRYVNPDTGRTIFEAKLHRQGFITIAATGSNPVVVPPNGYFRFDSWVNQFYALAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title A Unique Human Norovirus Lineage with a Distinct HBGA Binding Interface.
pubmed doi rcsb
source organism Norovirus
molecule tags Viral protein
total genus 71
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rm0A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rm0A01
4OOVA 4QV2A 3PA1A 4Z4VA 3PA2A 4OPVA 5HZBA 3Q6RA 4X7CA 4X05A 4RPBA 3RY8A 3LQEA 4P1VA 5IYWA 2OBTA 2OBSA 3ASPA 3SLDA 5IYQA 3ASRA 4Z4YA 3PVDA 5IYRA 5IYPA 4WZEA 5BSXA 4OPSA 4Z4WA 4Z4UA 5J3OA 3Q6QA 3ONUA 4WZTA 4Z4RA 4RDLA 4X7EA 1IHMA 3SKBA 4X7DA 3D26A 4P26A 4X7FA 2ZL6A 4ROXA 3BQJA 4OOXA 5F4MA 3Q39A 5BSYA 5HZAA 4RPDA 3LQ6A 4QVJA 5E6TA 4Z4SA 3PUMA 4RLZA 3R6JA 3R6KA 4Z4ZA 4RDJA 4RM0A 4OPOA 5F4OA 2OBRA 3ASQA 3BY2A 4Z4TA 3ONYA 3SEJA 4P2NA 3ASSA 2ZL5A 4WZKA 3SLNA 4X06A 4WZLA 4X07A 2ZL7A 5F4JA 4QUZA 3V7AA 3BY1A 4OP7A 5KW9A 3SJPA 3ASTA 3PUNA 4RDKA 4QVAA 4P3IA 4P12A 5J35A 4P25A 4X0CA 3Q3AA 4OOSA 3Q38A 5IYNA
chains in the Genus database with same CATH superfamily
2RC5A 4II2A 1TLLA 3DDYA 2BV3A 4G7XA 5DS0A 4MYTA 4QV2A 3W2EA 1QG0A 4EH1A 1VQMB 4PGOA 4QFMA 2WZPP 1DDIA 2EIXA 1WSVA 1D8TA 1YI2B 2JIZA 1NDHA 3GVKA 1WDTA 1NB9A 1TTTA 3W5HA 1KK2A 1RQRA 4P22A 4ASUA 4X05A 1GAWA 2ZZFA 1W9XA 3LQEA 4P1VA 4YEJA 2PLFA 2ZITA 1WTHD 1IJFA 2BSAA 2XNDA 3WNBA 5THXA 1YIJB 3ASPA 4DK0A 2VYQA 3ASRA 2KVOA 5IYRA 1BMFA 2M5SA 2WYRA 3H94A 1VF7A 3NE5B 2NV4A 4Z4WA 1G7CA 3CC4B 2JJ2A 1VQ4B 4G1BA 1S72B 1WORA 3FKSA 3CW2A 3E20A 4UAJA 2D3LA 1E79A 2W6IA 3GVJA 3P27A 2VNJA 2DEUA 2CK3A 3A8JA 3VNVA 2B7CA 1KD1D 4MYUA 3CCVB 1V0EA 2GREA 4X7FA 1QUEA 5FIUA 3CC7B 3BQJA 5FO1A 5F4MA 3Q39A 2OTLB 5HXBA 1PJ6A 2OK7A 1E3XA 3WBKA 4ZCMA 5BSYA 1KQSB 3GIRA 1I8DA 3LQ6A 4XLEA 4II3A 1WP6A 2F4NA 4H9GA 3JQPA 1JB9A 2F1MA 4Z4SA 5FNZA 4RLZA 4C0SA 1S0UA 2E1BA 4M2LA 1VQNB 1XE1A 1R5BA 3R6JA 4XOTA 2VNIA 3OZWA 4XORA 4RDJA 1PJ5A 4RD1A 4RM0A 2DY1A 4KKSA 1A8PA 1WSRA 2C2WA 2OBRA 3ASQA 4IW3B 3GQBA 1B2RA 1KJZA 3G05A 5GV7A 3BY2A 4XN3A 3VR6A 2GK7A 4AF6A 3SEJA 4P2NA 3QFSA 3ZBTA 1VQ5B 1KK3A 4M0LA 4PC1A 1Q86D 4FK8A 4ACBA 3ZZ0A 3E1YE 2OYNA 3ZPNA 2Q6KA 1EFRA 3LO8A 4X07A 2VNHA 2VZLA 1KC8D 1YJ9B 5F4JA 1J9ZA 1N08A 3V7AA 3W2IA 4J0QA 3VO2A 2VBUA 2X6XA 1COWA 2QTLA 4XL9A 4C43A 2BVNA 1KZLA 3MHPA 2QE7A 1EFUA 2Z6BD 1W2BB 2X3UA 1WOSA 1QH0A 2DYIA 4RDKA 1YJWB 1VQKB 1WOOA 3B82A 1H8HA 4PC3A 4LBYA 1VLOA 1E1QA 2Q6OA 3OE7A 4G6IA 3Q3AA 1BQEA 2BM1A 2C5HA 1G7TA 2WZNA 3OJXA 4G5GA 4G7WA 4OOSA 3W5UA 3CCEB 3AVVA 1WU8A 3ISXA 1DARA 1RQPA 4ZCIA 3A3BA 3CC2B 1XQBA 4B4DA 3JQRA 4Z4VA 4K1XA 3AVUA 3CTAA 3BCDA 4RPBA 4XONA 2OBTA 2OBSA 4DNRB 3U2QA 2HMAA 1CNEA 1GJRA 3ZIAA 2ZZEA 4PC2A 3LNNA 3A1PA 4WZEA 3T51B 2CRVA 1NJID 4OPSA 1IB0A 3U6BA 1D1NA 1I18A 1QUFA 1G7SA 3Q6QA 4B43A 3ONUA 4XQFA 1VQ7B 3HAGA 4PAAA 4B3FX 1G7RA 1W0JA 4KKUA 1M90D 1IHMA 2P3MA 1Q81D 4XMYA 1T5EA 1VQPB 4M53A 3CCRB 3CCMB 2CC2A 1UD2A 2ZL6A 4ROXA 2PIAA 1FNDA 1QFYA 3T53B 4XR6A 4HIZA 3CB4A 1VQLB 3ZBUA 3OEEA 3CCQB 4N3GA 1ZUNB 2V31A 4BPRA 1UD6A 1HA3A 3B78A 1NRKA 4ZCLA 3I56B 4B3GA 1E63A 3OW2B 1DG1G 2ZZQA 5HKKA 2CNDA 2QEXB 4RJLA 1K73D 1N06A 4RD3A 3VMFA 3CD6B 2C4TA 3A8IA 1F60A 1YLOA 5DSZA 1Q82D 4XLFA 4ZGQB 2XNJA 4Z4TA 3WBJA 2VBTA 2V7VA 3ONYA 2DERA 1KMHA 4XLHA 5FL7A 1HZEA 3AGQA 4JMQA 4U9UA 3BC9A 1GR1A 3SLNA 2V4DA 2V7WA 3KEWA 1BX0A 2DETA 2X8KA 4M1KA 3J81k 3OJWA 1XB2A 2GPJA 2DCUA 1T6XA 1T6YA 2ZL7A 2F1LA 2HLDA 2JJ1A 1FNMA 5L46A 2J7KA 4TMWA 1Y0YA 2BN4A 5KNLA 1SKQA 4N3NA 3CCJB 2B5OA 3ASTA 1EP1B 1UMKA 4G1VA 2I1LA 2JN9A 4XNFA 2Q6LA 3JU4A 4YAOA 3CRZA 3VO1A 1E1RA 4YALA 3LVBA 5FO0A 5J35A 1OGJA 2W6JA 2WPDA 1JNYA 1VQOB 4X0CA 4XKWA 3PENA 4R71A 2OTJB 1OB2A 1MABA 2R9VA 4FN5A 3FPPA 3ES9A 1K9MD 1TUIA 3CMAB 3CMEB 4TN1A 4OOVA 2WR8A 1OB0A 3OZVA 3PA1A 3PA2A 1W35A 4RCYA 4PC7A 4OPVA 5HZBA 3CPWB 2V7TA 1AIPA 3Q6RA 2XEXA 4X7CA 1OB5A 4LBVA 4PC6A 2NPFA 1FRNA 1BPLA 5IYWA 3JQQA 5DN6A 3OKXA 1QVGB 2YWFA 4TMTA 3CESA 4L8JA 5IYQA 1W0KA 2VJIA 1Q7YD 3V76A 2X85A 3PVDA 5IYPA 2QDXA 1N0VC 2XOKA 5BSXA 3WYAA 3G4SB 2BGIA 4AC9A 4Z4UA 1VHOA 5J3OA 2PMDA 1FNBA 3OOCA 1E62A 1NB0A 4WZTA 5B6IA 1F20A 4KKTA 4RDLA 4X7EA 4XLCA 1QGAA 1E43A 1VHEA 3SKBA 2ZBUA 4X7DA 3ZUGA 3VNUA 4P3YA 4HE6A 4WWVA 5GV8A 4P26A 1E64A 3FJOA 3ZZTA 1R5OA 3A3GA 4XOPA 3CCLB 3GSIA 4NNJA 3P26A 1BJKA 3A8KA 3ZZUA 5HZAA 4RPDA 2D74A 1AMOA 4Q7JB 2HCJB 4Y9RA 4QVJA 3SJZA 4PABA 2VNKA 2BGJA 4B48A 3PUMA 1VQ6B 3B8HA 3I55B 2XGJA 1ZM4A 4HE5A 1N07A 1B23P 5AN9A 1V0FA 1SKYB 2V7UA 4TMZA 4Z4ZA 3W2FA 1XFOA 4OPOA 4Y7CA 4YHBA 2QTZA 1H85A 1JA0A 2VBSA 2HDNB 2QN6A 3OW7A 3OPOA 4XKVA 3W5VA 4ZV4A 1EP3B 3OFNA 1JJ2B 2ZZGA 3ASSA 1YX2A 2JDIA 1I7PA 2CF4A 2QGGA 4WZKA 2LZJA 3BCFA 4ZGNB 4TMXA 1N05A 3QFRA 1H8EA 4B44A 4X06A 1DDGA 1P4MA 1QVFB 4DK1A 1KK1A 1K8AD 3AVXA 2C4UA 5TR9A 2RC6A 4P6VF 4QUZA 1K28D 2GJKA 2XZPA 4TKOB 2QA4B 1QGYA 2AHOA 2PE3A 1OHHA 3BH4A 2YWGA 3QFTA 4TSFA 3OZUA 1TVCA 1D2EA 1W34A 4OP7A 3H9NA 4FWTA 4X8IA 2B7BA 3CCUB 1BLIA 1E3ZA 2QMUA 4LBWA 4UZEA 3AVYA 2GQFA 2XNCA 5EMNA 4QVAA 3T56B 1H42A 2XZLA 1KTVA 3CCSB 3Q38A 4LBZA 5A8AA 3G71B 1VJSA 4XN0A 5IK2A 1M1KD 4YAUA 2CBXA 3CMMA 1VLYA 5A88A 5JBQA 3CP2A 2GJPA 2FVGA 1NBMA 1EWYA 4P6YA 3QSYA 4QHYA 4NBSA 3RY8A 2Q6IA 4Z1MA 1V5VA 1PJ7A 4CQJA 3SLDA 1EXMA 4FXUA 2BF4A 4F7DA 3G6EB 3MCAA 3KL9A 4Z4YA 1Y0RA 5H59A 1CNFA 1GO2A 1QGZA 5A89A 4YAWA 4RD6A 3MMPA 3BNWA 4LC0A 2DIEA 3OAAA 1BX1A 1JA1A 4Y9UA 2BPOA 1Q9SA 5TV2A 4WQMA 4XM3A 1U2RA 5TY0A 3WNCA 2FX3A 4Z4RA 3A35A 1YITB 3WXMA 2XZOA 1T6ZA 4P9SA 1FX0A 2V7QA 1UD4A 3D26A 4ACAA 3U6KA 4OOXA 1IJEA 2YWEA 4TMVA 3WNDA 2VBVA 4YAFA 2OK8A 3I1FA 2C78A 2E1RA 1UD8A 3OP1A 3FPKA 4UZUA 1FNCA 1KRHA 5E6TA 4AVZA 1MRZA 1WPCA 4XD7A 2DOGA 4YXWA 1GAQA 1GVHA 1OGIA 4YELA 4AF7A 2ZTGA 3ZC3A 2ZXIA 1N0UA 3R6KA 3AVTA 4RCZA 2X0KA 1YHQB 5LMZA 2VJJA 1ZM3A 1UD5A 5F4OA 2F43A 5TRDA 2X53S 2X6YA 1EP2B 3CXCB 3W2GA 4B3XA 4GQNA 1EFCA 1PKVA 5FA6A 3WY9A 2D9RA 2GK6A 3AGPA 4DNTB 1N8RD 5CDFA 2ZL5A 2WJVA 2WSSA 1SM4A 2ZTNA 5H5JA 3WQZA 4WZLA 1WOPA 2X6WA 1S4MA 2C5BA 4NCNA 1HVXA 3QFCA 1CQXA 2WJYA 1QFZA 3GVLA 1W87A 3OEHA 4DQLA 2ZBVA 1VQ8B 4DQKA 5KSWB 3BY1A 2D3NA 2R6HA 4XLAA 1YJNB 2CW5A 2V7XA 3QE2A 1FDRA 2YWHA 1QX4A 1UD3A 3W2HA 4RD4A 4UZFA 2GJRA 4E0FA 2EFGA 2C77A 1ELOA 1ZM9A 3SJPA 4B47A 4RD2A 5KW9A 1VQ9B 3PUNA 3AVWA 1ZM2A 4TT3A 1QFJA 4P3IA 3CPXA 2ZXHA 4RD0A 1KK0A 1R5NA 4P12A 2BMWA 1FRQA 4M4SA 4P25A 1EFTA 2BM0A 3CP8A 5IYNA
chains in the Genus database with same CATH topology
4OOVA 4QV2A 3PA1A 4Z4VA 3PA2A 4OPVA 5HZBA 3Q6RA 4X7CA 4X05A 4RPBA 3RY8A 3LQEA 4P1VA 5IYWA 2OBTA 2OBSA 3ASPA 3SLDA 5IYQA 3ASRA 4Z4YA 3PVDA 5IYRA 5IYPA 4WZEA 5BSXA 4OPSA 4Z4WA 4Z4UA 5J3OA 3Q6QA 3ONUA 4WZTA 4Z4RA 4RDLA 4X7EA 1IHMA 3SKBA 4X7DA 3D26A 4P26A 4X7FA 2ZL6A 4ROXA 3BQJA 4OOXA 5F4MA 3Q39A 5BSYA 5HZAA 4RPDA 3LQ6A 4QVJA 5E6TA 4Z4SA 3PUMA 4RLZA 3R6JA 3R6KA 4Z4ZA 4RDJA 4RM0A 4OPOA 5F4OA 2OBRA 3ASQA 3BY2A 4Z4TA 3ONYA 3SEJA 4P2NA 3ASSA 2ZL5A 4WZKA 3SLNA 4X06A 4WZLA 4X07A 2ZL7A 5F4JA 4QUZA 3V7AA 3BY1A 4OP7A 5KW9A 3SJPA 3ASTA 3PUNA 4RDKA 4QVAA 4P3IA 4P12A 5J35A 4P25A 4X0CA 3Q3AA 4OOSA 3Q38A 5IYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OOV A;  4QV2 A;  3PA1 A;  4Z4V A;  3PA2 A;  4OPV A;  5HZB A;  3Q6R A;  4X7C A;  4X05 A;  4RPB A;  3RY8 A;  3LQE A;  4P1V A;  5IYW A;  2OBT A;  2OBS A;  3ASP A;  3SLD A;  5IYQ A;  3ASR A;  4Z4Y A;  3PVD A;  5IYR A;  5IYP A;  4WZE A;  5BSX A;  4OPS A;  4Z4W A;  4Z4U A;  5J3O A;  3Q6Q A;  3ONU A;  4WZT A;  4Z4R A;  4RDL A;  4X7E A;  1IHM A;  3SKB A;  4X7D A;  3D26 A;  4P26 A;  4X7F A;  2ZL6 A;  4ROX A;  3BQJ A;  4OOX A;  5F4M A;  3Q39 A;  5BSY A;  5HZA A;  4RPD A;  3LQ6 A;  4QVJ A;  5E6T A;  4Z4S A;  3PUM A;  4RLZ A;  3R6J A;  3R6K A;  4Z4Z A;  4RDJ A;  4RM0 A;  4OPO A;  5F4O A;  2OBR A;  3ASQ A;  3BY2 A;  4Z4T A;  3ONY A;  3SEJ A;  4P2N A;  3ASS A;  2ZL5 A;  4WZK A;  3SLN A;  4X06 A;  4WZL A;  4X07 A;  2ZL7 A;  5F4J A;  4QUZ A;  3V7A A;  3BY1 A;  4OP7 A;  5KW9 A;  3SJP A;  3AST A;  3PUN A;  4RDK A;  4QVA A;  4P3I A;  4P12 A;  5J35 A;  4P25 A;  4X0C A;  3Q3A A;  4OOS A;  3Q38 A;  5IYN A; 
#chains in the Genus database with same CATH topology
 2RC5 A;  4II2 A;  1TLL A;  3DDY A;  2BV3 A;  4G7X A;  5DS0 A;  4MYT A;  4QV2 A;  3W2E A;  1QG0 A;  4EH1 A;  1VQM B;  4PGO A;  4QFM A;  2WZP P;  1DDI A;  2EIX A;  1WSV A;  1D8T A;  1YI2 B;  2JIZ A;  1NDH A;  3GVK A;  1WDT A;  1NB9 A;  1TTT A;  3W5H A;  1KK2 A;  1RQR A;  4P22 A;  4ASU A;  4X05 A;  1GAW A;  2ZZF A;  1W9X A;  3LQE A;  4P1V A;  4YEJ A;  2PLF A;  2ZIT A;  1WTH D;  1IJF A;  2BSA A;  2XND A;  3WNB A;  5THX A;  1YIJ B;  3ASP A;  4DK0 A;  2VYQ A;  3ASR A;  2KVO A;  5IYR A;  1BMF A;  2M5S A;  2WYR A;  3H94 A;  1VF7 A;  3NE5 B;  2NV4 A;  4Z4W A;  1G7C A;  3CC4 B;  2JJ2 A;  1VQ4 B;  4G1B A;  1S72 B;  1WOR A;  3FKS A;  3CW2 A;  3E20 A;  4UAJ A;  2D3L A;  1E79 A;  2W6I A;  3GVJ A;  3P27 A;  2VNJ A;  2DEU A;  2CK3 A;  3A8J A;  3VNV A;  2B7C A;  1KD1 D;  4MYU A;  3CCV B;  1V0E A;  2GRE A;  4X7F A;  1QUE A;  5FIU A;  3CC7 B;  3BQJ A;  5FO1 A;  5F4M A;  3Q39 A;  2OTL B;  5HXB A;  1PJ6 A;  2OK7 A;  1E3X A;  3WBK A;  4ZCM A;  5BSY A;  1KQS B;  3GIR A;  1I8D A;  3LQ6 A;  4XLE A;  4II3 A;  1WP6 A;  2F4N A;  4H9G A;  3JQP A;  1JB9 A;  2F1M A;  4Z4S A;  5FNZ A;  4RLZ A;  4C0S A;  1S0U A;  2E1B A;  4M2L A;  1VQN B;  1XE1 A;  1R5B A;  3R6J A;  4XOT A;  2VNI A;  3OZW A;  4XOR A;  4RDJ A;  1PJ5 A;  4RD1 A;  4RM0 A;  2DY1 A;  4KKS A;  1A8P A;  1WSR A;  2C2W A;  2OBR A;  3ASQ A;  4IW3 B;  3GQB A;  1B2R A;  1KJZ A;  3G05 A;  5GV7 A;  3BY2 A;  4XN3 A;  3VR6 A;  2GK7 A;  4AF6 A;  3SEJ A;  4P2N A;  3QFS A;  3ZBT A;  1VQ5 B;  1KK3 A;  4M0L A;  4PC1 A;  1Q86 D;  4FK8 A;  4ACB A;  3ZZ0 A;  3E1Y E;  2OYN A;  3ZPN A;  2Q6K A;  1EFR A;  3LO8 A;  4X07 A;  2VNH A;  2VZL A;  1KC8 D;  1YJ9 B;  5F4J A;  1J9Z A;  1N08 A;  3V7A A;  3W2I A;  4J0Q A;  3VO2 A;  2VBU A;  2X6X A;  1COW A;  2QTL A;  4XL9 A;  4C43 A;  2BVN A;  1KZL A;  3MHP A;  2QE7 A;  1EFU A;  2Z6B D;  1W2B B;  2X3U A;  1WOS A;  1QH0 A;  2DYI A;  4RDK A;  1YJW B;  1VQK B;  1WOO A;  3B82 A;  1H8H A;  4PC3 A;  4LBY A;  1VLO A;  1E1Q A;  2Q6O A;  3OE7 A;  4G6I A;  3Q3A A;  1BQE A;  2BM1 A;  2C5H A;  1G7T A;  2WZN A;  3OJX A;  4G5G A;  4G7W A;  4OOS A;  3W5U A;  3CCE B;  3AVV A;  1WU8 A;  3ISX A;  1DAR A;  1RQP A;  4ZCI A;  3A3B A;  3CC2 B;  1XQB A;  4B4D A;  3JQR A;  4Z4V A;  4K1X A;  3AVU A;  3CTA A;  3BCD A;  4RPB A;  4XON A;  2OBT A;  2OBS A;  4DNR B;  3U2Q A;  2HMA A;  1CNE A;  1GJR A;  3ZIA A;  2ZZE A;  4PC2 A;  3LNN A;  3A1P A;  4WZE A;  3T51 B;  2CRV A;  1NJI D;  4OPS A;  1IB0 A;  3U6B A;  1D1N A;  1I18 A;  1QUF A;  1G7S A;  3Q6Q A;  4B43 A;  3ONU A;  4XQF A;  1VQ7 B;  3HAG A;  4PAA A;  4B3F X;  1G7R A;  1W0J A;  4KKU A;  1M90 D;  1IHM A;  2P3M A;  1Q81 D;  4XMY A;  1T5E A;  1VQP B;  4M53 A;  3CCR B;  3CCM B;  2CC2 A;  1UD2 A;  2ZL6 A;  4ROX A;  2PIA A;  1FND A;  1QFY A;  3T53 B;  4XR6 A;  4HIZ A;  3CB4 A;  1VQL B;  3ZBU A;  3OEE A;  3CCQ B;  4N3G A;  1ZUN B;  2V31 A;  4BPR A;  1UD6 A;  1HA3 A;  3B78 A;  1NRK A;  4ZCL A;  3I56 B;  4B3G A;  1E63 A;  3OW2 B;  1DG1 G;  2ZZQ A;  5HKK A;  2CND A;  2QEX B;  4RJL A;  1K73 D;  1N06 A;  4RD3 A;  3VMF A;  3CD6 B;  2C4T A;  3A8I A;  1F60 A;  1YLO A;  5DSZ A;  1Q82 D;  4XLF A;  4ZGQ B;  2XNJ A;  4Z4T A;  3WBJ A;  2VBT A;  2V7V A;  3ONY A;  2DER A;  1KMH A;  4XLH A;  5FL7 A;  1HZE A;  3AGQ A;  4JMQ A;  4U9U A;  3BC9 A;  1GR1 A;  3SLN A;  2V4D A;  2V7W A;  3KEW A;  1BX0 A;  2DET A;  2X8K A;  4M1K A;  3J81 k;  3OJW A;  1XB2 A;  2GPJ A;  2DCU A;  1T6X A;  1T6Y A;  2ZL7 A;  2F1L A;  2HLD A;  2JJ1 A;  1FNM A;  5L46 A;  2J7K A;  4TMW A;  1Y0Y A;  2BN4 A;  5KNL A;  1SKQ A;  4N3N A;  3CCJ B;  2B5O A;  3AST A;  1EP1 B;  1UMK A;  4G1V A;  2I1L A;  2JN9 A;  4XNF A;  2Q6L A;  3JU4 A;  4YAO A;  3CRZ A;  3VO1 A;  1E1R A;  4YAL A;  3LVB A;  5FO0 A;  5J35 A;  1OGJ A;  2W6J A;  2WPD A;  1JNY A;  1VQO B;  4X0C A;  4XKW A;  3PEN A;  4R71 A;  2OTJ B;  1OB2 A;  1MAB A;  2R9V A;  4FN5 A;  3FPP A;  3ES9 A;  1K9M D;  1TUI A;  3CMA B;  3CME B;  4TN1 A;  4OOV A;  2WR8 A;  1OB0 A;  3OZV A;  3PA1 A;  3PA2 A;  1W35 A;  4RCY A;  4PC7 A;  4OPV A;  5HZB A;  3CPW B;  2V7T A;  1AIP A;  3Q6R A;  2XEX A;  4X7C A;  1OB5 A;  4LBV A;  4PC6 A;  2NPF A;  1FRN A;  1BPL A;  5IYW A;  3JQQ A;  5DN6 A;  3OKX A;  1QVG B;  2YWF A;  4TMT A;  3CES A;  4L8J A;  5IYQ A;  1W0K A;  2VJI A;  1Q7Y D;  3V76 A;  2X85 A;  3PVD A;  5IYP A;  2QDX A;  1N0V C;  2XOK A;  5BSX A;  3WYA A;  3G4S B;  2BGI A;  4AC9 A;  4Z4U A;  1VHO A;  5J3O A;  2PMD A;  1FNB A;  3OOC A;  1E62 A;  1NB0 A;  4WZT A;  5B6I A;  1F20 A;  4KKT A;  4RDL A;  4X7E A;  4XLC A;  1QGA A;  1E43 A;  1VHE A;  3SKB A;  2ZBU A;  4X7D A;  3ZUG A;  3VNU A;  4P3Y A;  4HE6 A;  4WWV A;  5GV8 A;  4P26 A;  1E64 A;  3FJO A;  3ZZT A;  1R5O A;  3A3G A;  4XOP A;  3CCL B;  3GSI A;  4NNJ A;  3P26 A;  1BJK A;  3A8K A;  3ZZU A;  5HZA A;  4RPD A;  2D74 A;  1AMO A;  4Q7J B;  2HCJ B;  4Y9R A;  4QVJ A;  3SJZ A;  4PAB A;  2VNK A;  2BGJ A;  4B48 A;  3PUM A;  1VQ6 B;  3B8H A;  3I55 B;  2XGJ A;  1ZM4 A;  4HE5 A;  1N07 A;  1B23 P;  5AN9 A;  1V0F A;  1SKY B;  2V7U A;  4TMZ A;  4Z4Z A;  3W2F A;  1XFO A;  4OPO A;  4Y7C A;  4YHB A;  2QTZ A;  1H85 A;  1JA0 A;  2VBS A;  2HDN B;  2QN6 A;  3OW7 A;  3OPO A;  4XKV A;  3W5V A;  4ZV4 A;  1EP3 B;  3OFN A;  1JJ2 B;  2ZZG A;  3ASS A;  1YX2 A;  2JDI A;  1I7P A;  2CF4 A;  2QGG A;  4WZK A;  2LZJ A;  3BCF A;  4ZGN B;  4TMX A;  1N05 A;  3QFR A;  1H8E A;  4B44 A;  4X06 A;  1DDG A;  1P4M A;  1QVF B;  4DK1 A;  1KK1 A;  1K8A D;  3AVX A;  2C4U A;  5TR9 A;  2RC6 A;  4P6V F;  4QUZ A;  1K28 D;  2GJK A;  2XZP A;  4TKO B;  2QA4 B;  1QGY A;  2AHO A;  2PE3 A;  1OHH A;  3BH4 A;  2YWG A;  3QFT A;  4TSF A;  3OZU A;  1TVC A;  1D2E A;  1W34 A;  4OP7 A;  3H9N A;  4FWT A;  4X8I A;  2B7B A;  3CCU B;  1BLI A;  1E3Z A;  2QMU A;  4LBW A;  4UZE A;  3AVY A;  2GQF A;  2XNC A;  5EMN A;  4QVA A;  3T56 B;  1H42 A;  2XZL A;  1KTV A;  3CCS B;  3Q38 A;  4LBZ A;  5A8A A;  3G71 B;  1VJS A;  4XN0 A;  5IK2 A;  1M1K D;  4YAU A;  2CBX A;  3CMM A;  1VLY A;  5A88 A;  5JBQ A;  3CP2 A;  2GJP A;  2FVG A;  1NBM A;  1EWY A;  4P6Y A;  3QSY A;  4QHY A;  4NBS A;  3RY8 A;  2Q6I A;  4Z1M A;  1V5V A;  1PJ7 A;  4CQJ A;  3SLD A;  1EXM A;  4FXU A;  2BF4 A;  4F7D A;  3G6E B;  3MCA A;  3KL9 A;  4Z4Y A;  1Y0R A;  5H59 A;  1CNF A;  1GO2 A;  1QGZ A;  5A89 A;  4YAW A;  4RD6 A;  3MMP A;  3BNW A;  4LC0 A;  2DIE A;  3OAA A;  1BX1 A;  1JA1 A;  4Y9U A;  2BPO A;  1Q9S A;  5TV2 A;  4WQM A;  4XM3 A;  1U2R A;  5TY0 A;  3WNC A;  2FX3 A;  4Z4R A;  3A35 A;  1YIT B;  3WXM A;  2XZO A;  1T6Z A;  4P9S A;  1FX0 A;  2V7Q A;  1UD4 A;  3D26 A;  4ACA A;  3U6K A;  4OOX A;  1IJE A;  2YWE A;  4TMV A;  3WND A;  2VBV A;  4YAF A;  2OK8 A;  3I1F A;  2C78 A;  2E1R A;  1UD8 A;  3OP1 A;  3FPK A;  4UZU A;  1FNC A;  1KRH A;  5E6T A;  4AVZ A;  1MRZ A;  1WPC A;  4XD7 A;  2DOG A;  4YXW A;  1GAQ A;  1GVH A;  1OGI A;  4YEL A;  4AF7 A;  2ZTG A;  3ZC3 A;  2ZXI A;  1N0U A;  3R6K A;  3AVT A;  4RCZ A;  2X0K A;  1YHQ B;  5LMZ A;  2VJJ A;  1ZM3 A;  1UD5 A;  5F4O A;  2F43 A;  5TRD A;  2X53 S;  2X6Y A;  1EP2 B;  3CXC B;  3W2G A;  4B3X A;  4GQN A;  1EFC A;  1PKV A;  5FA6 A;  3WY9 A;  2D9R A;  2GK6 A;  3AGP A;  4DNT B;  1N8R D;  5CDF A;  2ZL5 A;  2WJV A;  2WSS A;  1SM4 A;  2ZTN A;  5H5J A;  3WQZ A;  4WZL A;  1WOP A;  2X6W A;  1S4M A;  2C5B A;  4NCN A;  1HVX A;  3QFC A;  1CQX A;  2WJY A;  1QFZ A;  3GVL A;  1W87 A;  3OEH A;  4DQL A;  2ZBV A;  1VQ8 B;  4DQK A;  5KSW B;  3BY1 A;  2D3N A;  2R6H A;  4XLA A;  1YJN B;  2CW5 A;  2V7X A;  3QE2 A;  1FDR A;  2YWH A;  1QX4 A;  1UD3 A;  3W2H A;  4RD4 A;  4UZF A;  2GJR A;  4E0F A;  2EFG A;  2C77 A;  1ELO A;  1ZM9 A;  3SJP A;  4B47 A;  4RD2 A;  5KW9 A;  1VQ9 B;  3PUN A;  3AVW A;  1ZM2 A;  4TT3 A;  1QFJ A;  4P3I A;  3CPX A;  2ZXH A;  4RD0 A;  1KK0 A;  1R5N A;  4P12 A;  2BMW A;  1FRQ A;  4M4S A;  4P25 A;  1EFT A;  2BM0 A;  3CP8 A;  5IYN A; 
#chains in the Genus database with same CATH homology
 4OOV A;  4QV2 A;  3PA1 A;  4Z4V A;  3PA2 A;  4OPV A;  5HZB A;  3Q6R A;  4X7C A;  4X05 A;  4RPB A;  3RY8 A;  3LQE A;  4P1V A;  5IYW A;  2OBT A;  2OBS A;  3ASP A;  3SLD A;  5IYQ A;  3ASR A;  4Z4Y A;  3PVD A;  5IYR A;  5IYP A;  4WZE A;  5BSX A;  4OPS A;  4Z4W A;  4Z4U A;  5J3O A;  3Q6Q A;  3ONU A;  4WZT A;  4Z4R A;  4RDL A;  4X7E A;  1IHM A;  3SKB A;  4X7D A;  3D26 A;  4P26 A;  4X7F A;  2ZL6 A;  4ROX A;  3BQJ A;  4OOX A;  5F4M A;  3Q39 A;  5BSY A;  5HZA A;  4RPD A;  3LQ6 A;  4QVJ A;  5E6T A;  4Z4S A;  3PUM A;  4RLZ A;  3R6J A;  3R6K A;  4Z4Z A;  4RDJ A;  4RM0 A;  4OPO A;  5F4O A;  2OBR A;  3ASQ A;  3BY2 A;  4Z4T A;  3ONY A;  3SEJ A;  4P2N A;  3ASS A;  2ZL5 A;  4WZK A;  3SLN A;  4X06 A;  4WZL A;  4X07 A;  2ZL7 A;  5F4J A;  4QUZ A;  3V7A A;  3BY1 A;  4OP7 A;  5KW9 A;  3SJP A;  3AST A;  3PUN A;  4RDK A;  4QVA A;  4P3I A;  4P12 A;  5J35 A;  4P25 A;  4X0C A;  3Q3A A;  4OOS A;  3Q38 A;  5IYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...