4RM0A

Crystal structure of norovirus oif p domain in complex with lewis a trisaccharide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
307
structure length
307
Chain Sequence
KTKPFTLPILTIGELTNSRFPAPIDQLYTSPNADVVVQPQNGRCSLDGELQGTTQLLTTAICSYRGMTSNPTRDYWDGHLLHLVHPNGATYDPTEDVPAPFGTQDFRGILYGVLTQNPRASGDEAANSQGVYISSTSEKFTPKLGTIGLHQVQGNIASNQQSKFTPVGIAVNGNTPFRQWELPNYSGALTLNTNLAPAVGPNFPGEQILFFRSNVPSVQGGQPIEIDCLIPQEWVSHFYQESAPSQSDVALVRYVNPDTGRTIFEAKLHRQGFITIAATGSNPVVVPPNGYFRFDSWVNQFYALAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein
publication title A Unique Human Norovirus Lineage with a Distinct HBGA Binding Interface.
pubmed doi rcsb
source organism Norovirus
total genus 71
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rm0A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rm0A01
3BY1A 4Z4RA 5IYQA 3ONYA 4RPBA 3SLDA 4OOSA 4ROXA 2OBTA 4X06A 2ZL5A 3R6KA 4OOXA 3ONUA 4Z4ZA 3SKBA 4OP7A 3ASRA 3BY2A 4RDKA 5F4MA 3LQ6A 4X0CA 3Q6RA 4WZTA 3SLNA 3PUMA 4OPSA 4WZLA 5HZAA 3PA1A 4WZKA 4Z4UA 3Q6QA 4OPOA 4QVAA 3LQEA 5J3OA 4Z4WA 4P2NA 3PA2A 4P25A 5F4OA 4Z4SA 4P1VA 3Q3AA 4RDJA 3Q39A 4RPDA 4P12A 2ZL7A 3PUNA 3Q38A 4X7DA 2OBSA 3V7AA 4OPVA 5IYPA 3R6JA 4P3IA 3RY8A 5IYNA 3D26A 5F4JA 5HZBA 3ASSA 5BSYA 3SEJA 5BSXA 4RM0A 5KW9A 3PVDA 5IYRA 2ZL6A 4Z4VA 3ASQA 4P26A 4X7FA 3SJPA 4X7CA 4Z4YA 2OBRA 4RLZA 3ASTA 1IHMA 5J35A 4OOVA 4Z4TA 4QV2A 5IYWA 4QVJA 4RDLA 3ASPA 5E6TA 4X05A 3BQJA 4X07A 4QUZA 4WZEA 4X7EA
chains in the Genus database with same CATH superfamily
2NPFA 1KQSB 1EFTA 2GK7A 2QGGA 4Z4RA 4TMVA 2JJ1A 4IW3B 1BLIA 2QTLA 3ONYA 4P6YA 2BM1A 1OB0A 3SLDA 4OOSA 3E20A 4RD2A 4ROXA 4XD7A 3WYAA 3CMAB 1YI2B 1FRNA 3MCAA 4B3GA 3LVBA 1N0UA 3ONUA 4Z4ZA 2FX3A 4N3GA 2GQFA 4N3NA 2V7UA 1VQPB 2X0KA 1NDHA 2ZZFA 1N06A 1KMHA 4RDKA 2C77A 4F7DA 3OEHA 4XLAA 1FNDA 2WSSA 4J0QA 2V31A 3WBJA 1M90D 2F43A 1VQ5B 3ZZ0A 2HMAA 3OAAA 3J81k 4TMZA 4OPSA 1QGAA 3FPKA 2ZZGA 3GQBA 2DEUA 3NE5B 1PJ7A 2F1MA 3W2FA 2C2WA 4WZKA 4Z4UA 2RC6A 4XR6A 2ZXIA 1R5BA 1K9MD 4JMQA 2OYNA 2XZOA 1VQ9B 4ZCLA 2Q6OA 4P2NA 4P25A 1BX1A 4B47A 4RDJA 3WY9A 1D2EA 2HLDA 1W0JA 2ZTNA 4LBZA 1WORA 2CBXA 1A8PA 4NBSA 3PUNA 4G5GA 2BSAA 1QX4A 2WR8A 2X6WA 5JBQA 1QVGB 1N05A 2CF4A 2V7QA 2QE7A 1CNEA 5IYPA 1HZEA 3U6KA 1CNFA 1W87A 1S0UA 4XLCA 1ZM2A 4M0LA 5HZBA 1E62A 1Q9SA 1G7CA 1J9ZA 3QSYA 1WTHD 3VO1A 3I55B 5BSXA 4MYUA 1KK1A 1NBMA 3LO8A 2XNJA 3JU4A 1VLYA 3PVDA 1YJWB 5THXA 3CMEB 1K8AD 2Z6BD 1MRZA 4RD1A 4Z4VA 3ASQA 4PC1A 1Q86D 4YAOA 1B23P 1D8TA 4Z4YA 2C5HA 5GV8A 2CNDA 4DK1A 1M1KD 1K73D 1EFCA 1ZUNB 1ELOA 1SKQA 3OJWA 3WXMA 1OGJA 3VR6A 2JJ2A 1XFOA 1UD4A 4KKUA 3CP2A 5IK2A 3OOCA 3V76A 3HAGA 1FNCA 1GJRA 1NB9A 1UMKA 4PC7A 5GV7A 4QVJA 1Q7YD 4FN5A 1H8EA 3ASPA 4P9SA 2CRVA 2X85A 1IB0A 3U2QA 2BGIA 3GIRA 4NCNA 4X7EA 1KZLA 1I7PA 2XNDA 2V7TA 1VHEA 2R6HA 2YWEA 2OTJB 4CQJA 5IYQA 1KC8D 1G7RA 4LBYA 5KSWB 1IJFA 4M53A 1H8HA 2OBTA 2VBTA 5L46A 1IJEA 4DQLA 4RCZA 3CP8A 5DN6A 1H85A 2X8KA 5FL7A 4MYTA 2BV3A 4EH1A 2C5BA 4OP7A 4XL9A 3CRZA 3CTAA 1QFYA 4YAFA 4TMWA 1WOOA 1JJ2B 2CW5A 2W6IA 4XLHA 5TY0A 3LQ6A 4ACAA 1OGIA 4P22A 3CESA 2R9VA 4QHYA 4WZTA 3CB4A 3KEWA 4ZGQB 2VBUA 1AIPA 5CDFA 3VMFA 3OKXA 1W2BB 4Y7CA 1SKYB 5HXBA 5A88A 4Q7JB 2ZZEA 3AVXA 3B82A 4XN0A 4DK0A 1D1NA 3DDYA 3Q6QA 1EP3B 4UAJA 1YLOA 2WJVA 4XLEA 2ZZQA 5J3OA 3W2HA 1DDGA 2WYRA 3OJXA 3W2EA 4DNRB 5F4OA 3CC4B 1E3XA 1QGZA 4Z4SA 3H9NA 3OEEA 4P1VA 3AGPA 2QDXA 4RPDA 1GAWA 1DARA 2GREA 3Q38A 5DS0A 4ACBA 2OBSA 5FNZA 4OPVA 4P3YA 3RY8A 4B3XA 3QFTA 1E79A 4G7XA 5IYNA 1TUIA 1TVCA 3OZWA 4K1XA 4Y9RA 2E1BA 1F60A 1N08A 4YXWA 3SEJA 1XB2A 1XE1A 1YIJB 1H42A 1Y0RA 3BCDA 3CW2A 2VNIA 1KK2A 2VBSA 3JQQA 4TKOB 2OK8A 4PGOA 4P26A 3QE2A 4X7FA 1VJSA 3OZUA 1V5VA 3CCSB 1QFZA 3OE7A 1CQXA 2B5OA 4P6VF 1GR1A 3CC2B 4RLZA 3WBKA 2PIAA 3ASTA 4PC6A 2LZJA 3BCFA 4XOPA 1WOSA 1IHMA 2BGJA 4RD6A 4ZV4A 5J35A 1VQ6B 2FVGA 2EFGA 3BH4A 3CMMA 1ZM9A 2VNJA 1PJ5A 1FDRA 4Z4TA 3VO2A 2V7XA 4AF7A 2NV4A 1S72B 2CK3A 4ASUA 2C78A 4B44A 3LNNA 3CCJB 2DERA 4TSFA 5A89A 4QUZA 4B3FX 4G1BA 4QV2A 2E1RA 1VQMB 1EFRA 1JB9A 5FIUA 3I56B 4YALA 2X6YA 4NNJA 1I18A 3WNCA 1KJZA 2BMWA 1MABA 4XN3A 5AN9A 3QFCA 5LMZA 4AF6A 4RJLA 1FNBA 2ZL5A 4PABA 3R6KA 4OOXA 1WP6A 1WPCA 1FX0A 2VZLA 2B7CA 1BJKA 2XEXA 1W35A 3OW7A 1E1QA 1V0EA 1E64A 3JQRA 3W5UA 5F4MA 1VQKB 2C4TA 1QUFA 1Y0YA 3FJOA 4HE6A 4XORA 1QUEA 3Q6RA 2WZPP 1YJNB 4WZLA 2DETA 1YHQB 2ZITA 5HZAA 3CCUB 2JIZA 1U2RA 1B2RA 1F20A 5H5JA 2GJRA 3H94A 1TLLA 3I1FA 1BPLA 1E43A 1ZM4A 3AVTA 4HE5A 4OPOA 2YWHA 5A8AA 2BM0A 3AVUA 3BNWA 1WDTA 3ZZUA 2Q6IA 3SJZA 1RQPA 3OPOA 3B78A 3Q3AA 3Q39A 2ZBVA 4DNTB 1EP1B 4H9GA 4II2A 3G6EB 2VJIA 4RD0A 2V7VA 2ZL7A 3G05A 3ISXA 2QN6A 1E3ZA 1EP2B 2HDNB 5TR9A 1JA1A 1EXMA 3R6JA 4P3IA 3B8HA 3D26A 5F4JA 4LC0A 1BMFA 5FO1A 4AC9A 3FKSA 1TTTA 4WQMA 5BSYA 5DSZA 4XKWA 1OHHA 4L8JA 4G7WA 4II3A 1WOPA 3GSIA 5KW9A 2WPDA 3A3BA 2PE3A 3E1YE 4YEJA 5H59A 3CPWB 2I1LA 2QA4B 3AVWA 3GVKA 4B43A 4G6IA 3P27A 1COWA 3W2GA 1T6ZA 1YJ9B 1PJ6A 4C43A 1EWYA 1G7SA 1WSVA 4HIZA 1I8DA 4RCYA 1UD6A 4YAUA 4PAAA 2VBVA 3ZUGA 4ZCIA 5HKKA 3ZBUA 2D3NA 5TRDA 2XGJA 2BPOA 3G4SB 3GVJA 4XNFA 1OB5A 1NJID 1G7TA 4G1VA 4XKVA 4YELA 1VLOA 1VHOA 3MMPA 4Y9UA 4OOVA 4PC2A 1Q81D 4QFMA 1R5NA 1DG1G 1HA3A 4FXUA 2DYIA 3G71B 1VQLB 4RD3A 1VQ8B 1FRQA 1NB0A 5IYWA 2GPJA 3QFRA 2PLFA 2BN4A 4WWVA 3OP1A 2OTLB 4RDLA 3W5VA 1WU8A 3CCLB 4E0FA 1AMOA 2W6JA 1UD5A 5E6TA 4X05A 3W2IA 1QH0A 3BQJA 4XLFA 1KTVA 1Q82D 1KD1D 3CXCB 4AVZA 2GJKA 3BY1A 4KKTA 3CCQB 2VNKA 1QGYA 2WJYA 1BX0A 4TN1A 3VNUA 4XOTA 2Q6KA 1OB2A 2XOKA 1SM4A 4RPBA 5KNLA 3A3GA 4X06A 3WNDA 2VNHA 2DOGA 1P4MA 4GQNA 1N0VC 4BPRA 2BF4A 3SKBA 3QFSA 2D9RA 3ZBTA 3BC9A 4Z1MA 1RQRA 1KK0A 2WZNA 3W5HA 2J7KA 3ASRA 3CCRB 3BY2A 3CPXA 2XZPA 2GK6A 3OZVA 4TMTA 2CC2A 1UD3A 2HCJB 2AHOA 2EIXA 4TT3A 4X0CA 1VQOB 2F4NA 1K28D 3SLNA 5B6IA 3PUMA 1VQ7B 3A8KA 4C0SA 1V0FA 4ZCMA 4X8IA 1GAQA 2X53S 2YWFA 4YHBA 2XZLA 2F1LA 2P3MA 3PA1A 1WSRA 2YWGA 3ZPNA 3ZZTA 4M1KA 2OK7A 1KRHA 1FNMA 1QFJA 4QVAA 3A35A 3LQEA 2DY1A 2QTZA 2Q6LA 4Z4WA 4FWTA 3PA2A 1R5OA 1VF7A 3AVVA 1T6XA 3ZIAA 3OFNA 1T5EA 4LBWA 1N8RD 3U6BA 4B48A 3VNVA 3CCMB 2JDIA 4P12A 4XQFA 3T56B 4B4DA 1DDIA 2RC5A 4UZEA 2VYQA 3CCVB 2XNCA 1S4MA 1JA0A 1EFUA 4X7DA 5TV2A 1VQNB 3V7AA 4U9UA 4TMXA 1N07A 3FPPA 4RD4A 3CC7B 2D74A 3KL9A 2QEXB 3MHPA 3ASSA 4KKSA 4LBVA 1GO2A 3AGQA 1QG0A 1ZM3A 3A1PA 4UZUA 4M2LA 3A8IA 1KK3A 3JQPA 3AVYA 4RM0A 1QVFB 2X6XA 2KVOA 1W9XA 5IYRA 1PKVA 2X3UA 1VQ4B 1YITB 2ZL6A 4PC3A 3WNBA 1E63A 2ZBUA 3GVLA 1NRKA 3SJPA 1YX2A 4X7CA 3OW2B 1JNYA 2QMUA 2PMDA 2D3LA 1E1RA 1UD2A 1GVHA 3A8JA 2OBRA 2ZTGA 2C4UA 3ES9A 1W34A 5FO0A 1HVXA 4XMYA 4XM3A 5EMNA 2B7BA 2BVNA 2DIEA 3T51B 2GJPA 1XQBA 1UD8A 2M5SA 2ZXHA 4UZFA 3T53B 4FK8A 2VJJA 3CCEB 1T6YA 3PENA 4M4SA 2DCUA 4ZGNB 4DQKA 4R71A 3ZC3A 2JN9A 5FA6A 3P26A 4XONA 1BQEA 3WQZA 3CD6B 1W0KA 2V4DA 2V7WA 4X07A 4YAWA 4WZEA
chains in the Genus database with same CATH topology
3BY1A 4Z4RA 5IYQA 3ONYA 4RPBA 3SLDA 4OOSA 4ROXA 2OBTA 4X06A 2ZL5A 3R6KA 4OOXA 3ONUA 4Z4ZA 3SKBA 4OP7A 3ASRA 3BY2A 4RDKA 5F4MA 3LQ6A 4X0CA 3Q6RA 4WZTA 3SLNA 3PUMA 4OPSA 4WZLA 5HZAA 3PA1A 4WZKA 4Z4UA 3Q6QA 4OPOA 4QVAA 3LQEA 5J3OA 4Z4WA 4P2NA 3PA2A 4P25A 5F4OA 4Z4SA 4P1VA 3Q3AA 4RDJA 3Q39A 4RPDA 4P12A 2ZL7A 3PUNA 3Q38A 4X7DA 2OBSA 3V7AA 4OPVA 5IYPA 3R6JA 4P3IA 3RY8A 5IYNA 3D26A 5F4JA 5HZBA 3ASSA 5BSYA 3SEJA 5BSXA 4RM0A 5KW9A 3PVDA 5IYRA 2ZL6A 4Z4VA 3ASQA 4P26A 4X7FA 3SJPA 4X7CA 4Z4YA 2OBRA 4RLZA 3ASTA 1IHMA 5J35A 4OOVA 4Z4TA 4QV2A 5IYWA 4QVJA 4RDLA 3ASPA 5E6TA 4X05A 3BQJA 4X07A 4QUZA 4WZEA 4X7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY1 A;  4Z4R A;  5IYQ A;  3ONY A;  4RPB A;  3SLD A;  4OOS A;  4ROX A;  2OBT A;  4X06 A;  2ZL5 A;  3R6K A;  4OOX A;  3ONU A;  4Z4Z A;  3SKB A;  4OP7 A;  3ASR A;  3BY2 A;  4RDK A;  5F4M A;  3LQ6 A;  4X0C A;  3Q6R A;  4WZT A;  3SLN A;  3PUM A;  4OPS A;  4WZL A;  5HZA A;  3PA1 A;  4WZK A;  4Z4U A;  3Q6Q A;  4OPO A;  4QVA A;  3LQE A;  5J3O A;  4Z4W A;  4P2N A;  3PA2 A;  4P25 A;  5F4O A;  4Z4S A;  4P1V A;  3Q3A A;  4RDJ A;  3Q39 A;  4RPD A;  4P12 A;  2ZL7 A;  3PUN A;  3Q38 A;  4X7D A;  2OBS A;  3V7A A;  4OPV A;  5IYP A;  3R6J A;  4P3I A;  3RY8 A;  5IYN A;  3D26 A;  5F4J A;  5HZB A;  3ASS A;  5BSY A;  3SEJ A;  5BSX A;  4RM0 A;  5KW9 A;  3PVD A;  5IYR A;  2ZL6 A;  4Z4V A;  3ASQ A;  4P26 A;  4X7F A;  3SJP A;  4X7C A;  4Z4Y A;  2OBR A;  4RLZ A;  3AST A;  1IHM A;  5J35 A;  4OOV A;  4Z4T A;  4QV2 A;  5IYW A;  4QVJ A;  4RDL A;  3ASP A;  5E6T A;  4X05 A;  3BQJ A;  4X07 A;  4QUZ A;  4WZE A;  4X7E A; 
#chains in the Genus database with same CATH topology
 2NPF A;  1KQS B;  1EFT A;  2GK7 A;  2QGG A;  4Z4R A;  4TMV A;  2JJ1 A;  4IW3 B;  1BLI A;  2QTL A;  3ONY A;  4P6Y A;  2BM1 A;  1OB0 A;  3SLD A;  4OOS A;  3E20 A;  4RD2 A;  4ROX A;  4XD7 A;  3WYA A;  3CMA B;  1YI2 B;  1FRN A;  3MCA A;  4B3G A;  3LVB A;  1N0U A;  3ONU A;  4Z4Z A;  2FX3 A;  4N3G A;  2GQF A;  4N3N A;  2V7U A;  1VQP B;  2X0K A;  1NDH A;  2ZZF A;  1N06 A;  1KMH A;  4RDK A;  2C77 A;  4F7D A;  3OEH A;  4XLA A;  1FND A;  2WSS A;  4J0Q A;  2V31 A;  3WBJ A;  1M90 D;  2F43 A;  1VQ5 B;  3ZZ0 A;  2HMA A;  3OAA A;  3J81 k;  4TMZ A;  4OPS A;  1QGA A;  3FPK A;  2ZZG A;  3GQB A;  2DEU A;  3NE5 B;  1PJ7 A;  2F1M A;  3W2F A;  2C2W A;  4WZK A;  4Z4U A;  2RC6 A;  4XR6 A;  2ZXI A;  1R5B A;  1K9M D;  4JMQ A;  2OYN A;  2XZO A;  1VQ9 B;  4ZCL A;  2Q6O A;  4P2N A;  4P25 A;  1BX1 A;  4B47 A;  4RDJ A;  3WY9 A;  1D2E A;  2HLD A;  1W0J A;  2ZTN A;  4LBZ A;  1WOR A;  2CBX A;  1A8P A;  4NBS A;  3PUN A;  4G5G A;  2BSA A;  1QX4 A;  2WR8 A;  2X6W A;  5JBQ A;  1QVG B;  1N05 A;  2CF4 A;  2V7Q A;  2QE7 A;  1CNE A;  5IYP A;  1HZE A;  3U6K A;  1CNF A;  1W87 A;  1S0U A;  4XLC A;  1ZM2 A;  4M0L A;  5HZB A;  1E62 A;  1Q9S A;  1G7C A;  1J9Z A;  3QSY A;  1WTH D;  3VO1 A;  3I55 B;  5BSX A;  4MYU A;  1KK1 A;  1NBM A;  3LO8 A;  2XNJ A;  3JU4 A;  1VLY A;  3PVD A;  1YJW B;  5THX A;  3CME B;  1K8A D;  2Z6B D;  1MRZ A;  4RD1 A;  4Z4V A;  3ASQ A;  4PC1 A;  1Q86 D;  4YAO A;  1B23 P;  1D8T A;  4Z4Y A;  2C5H A;  5GV8 A;  2CND A;  4DK1 A;  1M1K D;  1K73 D;  1EFC A;  1ZUN B;  1ELO A;  1SKQ A;  3OJW A;  3WXM A;  1OGJ A;  3VR6 A;  2JJ2 A;  1XFO A;  1UD4 A;  4KKU A;  3CP2 A;  5IK2 A;  3OOC A;  3V76 A;  3HAG A;  1FNC A;  1GJR A;  1NB9 A;  1UMK A;  4PC7 A;  5GV7 A;  4QVJ A;  1Q7Y D;  4FN5 A;  1H8E A;  3ASP A;  4P9S A;  2CRV A;  2X85 A;  1IB0 A;  3U2Q A;  2BGI A;  3GIR A;  4NCN A;  4X7E A;  1KZL A;  1I7P A;  2XND A;  2V7T A;  1VHE A;  2R6H A;  2YWE A;  2OTJ B;  4CQJ A;  5IYQ A;  1KC8 D;  1G7R A;  4LBY A;  5KSW B;  1IJF A;  4M53 A;  1H8H A;  2OBT A;  2VBT A;  5L46 A;  1IJE A;  4DQL A;  4RCZ A;  3CP8 A;  5DN6 A;  1H85 A;  2X8K A;  5FL7 A;  4MYT A;  2BV3 A;  4EH1 A;  2C5B A;  4OP7 A;  4XL9 A;  3CRZ A;  3CTA A;  1QFY A;  4YAF A;  4TMW A;  1WOO A;  1JJ2 B;  2CW5 A;  2W6I A;  4XLH A;  5TY0 A;  3LQ6 A;  4ACA A;  1OGI A;  4P22 A;  3CES A;  2R9V A;  4QHY A;  4WZT A;  3CB4 A;  3KEW A;  4ZGQ B;  2VBU A;  1AIP A;  5CDF A;  3VMF A;  3OKX A;  1W2B B;  4Y7C A;  1SKY B;  5HXB A;  5A88 A;  4Q7J B;  2ZZE A;  3AVX A;  3B82 A;  4XN0 A;  4DK0 A;  1D1N A;  3DDY A;  3Q6Q A;  1EP3 B;  4UAJ A;  1YLO A;  2WJV A;  4XLE A;  2ZZQ A;  5J3O A;  3W2H A;  1DDG A;  2WYR A;  3OJX A;  3W2E A;  4DNR B;  5F4O A;  3CC4 B;  1E3X A;  1QGZ A;  4Z4S A;  3H9N A;  3OEE A;  4P1V A;  3AGP A;  2QDX A;  4RPD A;  1GAW A;  1DAR A;  2GRE A;  3Q38 A;  5DS0 A;  4ACB A;  2OBS A;  5FNZ A;  4OPV A;  4P3Y A;  3RY8 A;  4B3X A;  3QFT A;  1E79 A;  4G7X A;  5IYN A;  1TUI A;  1TVC A;  3OZW A;  4K1X A;  4Y9R A;  2E1B A;  1F60 A;  1N08 A;  4YXW A;  3SEJ A;  1XB2 A;  1XE1 A;  1YIJ B;  1H42 A;  1Y0R A;  3BCD A;  3CW2 A;  2VNI A;  1KK2 A;  2VBS A;  3JQQ A;  4TKO B;  2OK8 A;  4PGO A;  4P26 A;  3QE2 A;  4X7F A;  1VJS A;  3OZU A;  1V5V A;  3CCS B;  1QFZ A;  3OE7 A;  1CQX A;  2B5O A;  4P6V F;  1GR1 A;  3CC2 B;  4RLZ A;  3WBK A;  2PIA A;  3AST A;  4PC6 A;  2LZJ A;  3BCF A;  4XOP A;  1WOS A;  1IHM A;  2BGJ A;  4RD6 A;  4ZV4 A;  5J35 A;  1VQ6 B;  2FVG A;  2EFG A;  3BH4 A;  3CMM A;  1ZM9 A;  2VNJ A;  1PJ5 A;  1FDR A;  4Z4T A;  3VO2 A;  2V7X A;  4AF7 A;  2NV4 A;  1S72 B;  2CK3 A;  4ASU A;  2C78 A;  4B44 A;  3LNN A;  3CCJ B;  2DER A;  4TSF A;  5A89 A;  4QUZ A;  4B3F X;  4G1B A;  4QV2 A;  2E1R A;  1VQM B;  1EFR A;  1JB9 A;  5FIU A;  3I56 B;  4YAL A;  2X6Y A;  4NNJ A;  1I18 A;  3WNC A;  1KJZ A;  2BMW A;  1MAB A;  4XN3 A;  5AN9 A;  3QFC A;  5LMZ A;  4AF6 A;  4RJL A;  1FNB A;  2ZL5 A;  4PAB A;  3R6K A;  4OOX A;  1WP6 A;  1WPC A;  1FX0 A;  2VZL A;  2B7C A;  1BJK A;  2XEX A;  1W35 A;  3OW7 A;  1E1Q A;  1V0E A;  1E64 A;  3JQR A;  3W5U A;  5F4M A;  1VQK B;  2C4T A;  1QUF A;  1Y0Y A;  3FJO A;  4HE6 A;  4XOR A;  1QUE A;  3Q6R A;  2WZP P;  1YJN B;  4WZL A;  2DET A;  1YHQ B;  2ZIT A;  5HZA A;  3CCU B;  2JIZ A;  1U2R A;  1B2R A;  1F20 A;  5H5J A;  2GJR A;  3H94 A;  1TLL A;  3I1F A;  1BPL A;  1E43 A;  1ZM4 A;  3AVT A;  4HE5 A;  4OPO A;  2YWH A;  5A8A A;  2BM0 A;  3AVU A;  3BNW A;  1WDT A;  3ZZU A;  2Q6I A;  3SJZ A;  1RQP A;  3OPO A;  3B78 A;  3Q3A A;  3Q39 A;  2ZBV A;  4DNT B;  1EP1 B;  4H9G A;  4II2 A;  3G6E B;  2VJI A;  4RD0 A;  2V7V A;  2ZL7 A;  3G05 A;  3ISX A;  2QN6 A;  1E3Z A;  1EP2 B;  2HDN B;  5TR9 A;  1JA1 A;  1EXM A;  3R6J A;  4P3I A;  3B8H A;  3D26 A;  5F4J A;  4LC0 A;  1BMF A;  5FO1 A;  4AC9 A;  3FKS A;  1TTT A;  4WQM A;  5BSY A;  5DSZ A;  4XKW A;  1OHH A;  4L8J A;  4G7W A;  4II3 A;  1WOP A;  3GSI A;  5KW9 A;  2WPD A;  3A3B A;  2PE3 A;  3E1Y E;  4YEJ A;  5H59 A;  3CPW B;  2I1L A;  2QA4 B;  3AVW A;  3GVK A;  4B43 A;  4G6I A;  3P27 A;  1COW A;  3W2G A;  1T6Z A;  1YJ9 B;  1PJ6 A;  4C43 A;  1EWY A;  1G7S A;  1WSV A;  4HIZ A;  1I8D A;  4RCY A;  1UD6 A;  4YAU A;  4PAA A;  2VBV A;  3ZUG A;  4ZCI A;  5HKK A;  3ZBU A;  2D3N A;  5TRD A;  2XGJ A;  2BPO A;  3G4S B;  3GVJ A;  4XNF A;  1OB5 A;  1NJI D;  1G7T A;  4G1V A;  4XKV A;  4YEL A;  1VLO A;  1VHO A;  3MMP A;  4Y9U A;  4OOV A;  4PC2 A;  1Q81 D;  4QFM A;  1R5N A;  1DG1 G;  1HA3 A;  4FXU A;  2DYI A;  3G71 B;  1VQL B;  4RD3 A;  1VQ8 B;  1FRQ A;  1NB0 A;  5IYW A;  2GPJ A;  3QFR A;  2PLF A;  2BN4 A;  4WWV A;  3OP1 A;  2OTL B;  4RDL A;  3W5V A;  1WU8 A;  3CCL B;  4E0F A;  1AMO A;  2W6J A;  1UD5 A;  5E6T A;  4X05 A;  3W2I A;  1QH0 A;  3BQJ A;  4XLF A;  1KTV A;  1Q82 D;  1KD1 D;  3CXC B;  4AVZ A;  2GJK A;  3BY1 A;  4KKT A;  3CCQ B;  2VNK A;  1QGY A;  2WJY A;  1BX0 A;  4TN1 A;  3VNU A;  4XOT A;  2Q6K A;  1OB2 A;  2XOK A;  1SM4 A;  4RPB A;  5KNL A;  3A3G A;  4X06 A;  3WND A;  2VNH A;  2DOG A;  1P4M A;  4GQN A;  1N0V C;  4BPR A;  2BF4 A;  3SKB A;  3QFS A;  2D9R A;  3ZBT A;  3BC9 A;  4Z1M A;  1RQR A;  1KK0 A;  2WZN A;  3W5H A;  2J7K A;  3ASR A;  3CCR B;  3BY2 A;  3CPX A;  2XZP A;  2GK6 A;  3OZV A;  4TMT A;  2CC2 A;  1UD3 A;  2HCJ B;  2AHO A;  2EIX A;  4TT3 A;  4X0C A;  1VQO B;  2F4N A;  1K28 D;  3SLN A;  5B6I A;  3PUM A;  1VQ7 B;  3A8K A;  4C0S A;  1V0F A;  4ZCM A;  4X8I A;  1GAQ A;  2X53 S;  2YWF A;  4YHB A;  2XZL A;  2F1L A;  2P3M A;  3PA1 A;  1WSR A;  2YWG A;  3ZPN A;  3ZZT A;  4M1K A;  2OK7 A;  1KRH A;  1FNM A;  1QFJ A;  4QVA A;  3A35 A;  3LQE A;  2DY1 A;  2QTZ A;  2Q6L A;  4Z4W A;  4FWT A;  3PA2 A;  1R5O A;  1VF7 A;  3AVV A;  1T6X A;  3ZIA A;  3OFN A;  1T5E A;  4LBW A;  1N8R D;  3U6B A;  4B48 A;  3VNV A;  3CCM B;  2JDI A;  4P12 A;  4XQF A;  3T56 B;  4B4D A;  1DDI A;  2RC5 A;  4UZE A;  2VYQ A;  3CCV B;  2XNC A;  1S4M A;  1JA0 A;  1EFU A;  4X7D A;  5TV2 A;  1VQN B;  3V7A A;  4U9U A;  4TMX A;  1N07 A;  3FPP A;  4RD4 A;  3CC7 B;  2D74 A;  3KL9 A;  2QEX B;  3MHP A;  3ASS A;  4KKS A;  4LBV A;  1GO2 A;  3AGQ A;  1QG0 A;  1ZM3 A;  3A1P A;  4UZU A;  4M2L A;  3A8I A;  1KK3 A;  3JQP A;  3AVY A;  4RM0 A;  1QVF B;  2X6X A;  2KVO A;  1W9X A;  5IYR A;  1PKV A;  2X3U A;  1VQ4 B;  1YIT B;  2ZL6 A;  4PC3 A;  3WNB A;  1E63 A;  2ZBU A;  3GVL A;  1NRK A;  3SJP A;  1YX2 A;  4X7C A;  3OW2 B;  1JNY A;  2QMU A;  2PMD A;  2D3L A;  1E1R A;  1UD2 A;  1GVH A;  3A8J A;  2OBR A;  2ZTG A;  2C4U A;  3ES9 A;  1W34 A;  5FO0 A;  1HVX A;  4XMY A;  4XM3 A;  5EMN A;  2B7B A;  2BVN A;  2DIE A;  3T51 B;  2GJP A;  1XQB A;  1UD8 A;  2M5S A;  2ZXH A;  4UZF A;  3T53 B;  4FK8 A;  2VJJ A;  3CCE B;  1T6Y A;  3PEN A;  4M4S A;  2DCU A;  4ZGN B;  4DQK A;  4R71 A;  3ZC3 A;  2JN9 A;  5FA6 A;  3P26 A;  4XON A;  1BQE A;  3WQZ A;  3CD6 B;  1W0K A;  2V4D A;  2V7W A;  4X07 A;  4YAW A;  4WZE A; 
#chains in the Genus database with same CATH homology
 3BY1 A;  4Z4R A;  5IYQ A;  3ONY A;  4RPB A;  3SLD A;  4OOS A;  4ROX A;  2OBT A;  4X06 A;  2ZL5 A;  3R6K A;  4OOX A;  3ONU A;  4Z4Z A;  3SKB A;  4OP7 A;  3ASR A;  3BY2 A;  4RDK A;  5F4M A;  3LQ6 A;  4X0C A;  3Q6R A;  4WZT A;  3SLN A;  3PUM A;  4OPS A;  4WZL A;  5HZA A;  3PA1 A;  4WZK A;  4Z4U A;  3Q6Q A;  4OPO A;  4QVA A;  3LQE A;  5J3O A;  4Z4W A;  4P2N A;  3PA2 A;  4P25 A;  5F4O A;  4Z4S A;  4P1V A;  3Q3A A;  4RDJ A;  3Q39 A;  4RPD A;  4P12 A;  2ZL7 A;  3PUN A;  3Q38 A;  4X7D A;  2OBS A;  3V7A A;  4OPV A;  5IYP A;  3R6J A;  4P3I A;  3RY8 A;  5IYN A;  3D26 A;  5F4J A;  5HZB A;  3ASS A;  5BSY A;  3SEJ A;  5BSX A;  4RM0 A;  5KW9 A;  3PVD A;  5IYR A;  2ZL6 A;  4Z4V A;  3ASQ A;  4P26 A;  4X7F A;  3SJP A;  4X7C A;  4Z4Y A;  2OBR A;  4RLZ A;  3AST A;  1IHM A;  5J35 A;  4OOV A;  4Z4T A;  4QV2 A;  5IYW A;  4QVJ A;  4RDL A;  3ASP A;  5E6T A;  4X05 A;  3BQJ A;  4X07 A;  4QUZ A;  4WZE A;  4X7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...