4RM0A

Crystal structure of norovirus oif p domain in complex with lewis a trisaccharide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
307
structure length
307
Chain Sequence
KTKPFTLPILTIGELTNSRFPAPIDQLYTSPNADVVVQPQNGRCSLDGELQGTTQLLTTAICSYRGMTSNPTRDYWDGHLLHLVHPNGATYDPTEDVPAPFGTQDFRGILYGVLTQNPRASGDEAANSQGVYISSTSEKFTPKLGTIGLHQVQGNIASNQQSKFTPVGIAVNGNTPFRQWELPNYSGALTLNTNLAPAVGPNFPGEQILFFRSNVPSVQGGQPIEIDCLIPQEWVSHFYQESAPSQSDVALVRYVNPDTGRTIFEAKLHRQGFITIAATGSNPVVVPPNGYFRFDSWVNQFYALAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title A Unique Human Norovirus Lineage with a Distinct HBGA Binding Interface.
pubmed doi rcsb
source organism Norovirus
molecule tags Viral protein
total genus 71
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rm0A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rm0A01
4RDKA 3Q38A 4RDJA 4RM0A 4Z4RA 4P25A 4QUZA 4OPOA 3ASRA 4WZKA 3BQJA 3R6KA 3SLNA 5IYWA 3V7AA 4OOXA 4X7DA 3PA2A 4P2NA 1IHMA 3SKBA 4RLZA 4WZEA 5F4OA 3PUMA 3PUNA 3LQEA 3PA1A 4P3IA 4RDLA 5IYNA 4Z4VA 3Q39A 4P1VA 4Z4TA 3SLDA 3SJPA 2OBSA 2OBTA 3ASQA 4X7CA 3LQ6A 4Z4UA 5HZBA 5F4JA 4QVAA 4Z4YA 4Z4ZA 3RY8A 3BY1A 5J35A 3SEJA 2OBRA 5IYRA 3Q6RA 4P12A 3ASPA 3Q6QA 4OPSA 5J3OA 4X7EA 4QVJA 4RPDA 4X06A 2ZL5A 4OPVA 4WZLA 2ZL6A 4ROXA 5IYQA 3ONYA 3PVDA 4RPBA 5BSXA 4OP7A 4P26A 4QV2A 3D26A 5E6TA 5IYPA 4OOVA 3ASSA 3R6JA 5BSYA 3ONUA 4X7FA 4Z4SA 4X0CA 4X05A 4Z4WA 2ZL7A 4OOSA 5HZAA 4WZTA 5F4MA 3BY2A 4X07A 3ASTA 5KW9A 3Q3AA
chains in the Genus database with same CATH superfamily
1FRNA 4RDJA 4YAUA 3QE2A 3CCQB 4K1XA 1S0UA 4RM0A 4YXWA 1QFZA 3ZZUA 3OEEA 2D3LA 2F4NA 4J0QA 1VQKB 1EFTA 4FXUA 4QUZA 3CCJB 2CBXA 3WXMA 1KK1A 3B78A 1MABA 5TRDA 1WTHD 5TY0A 5IK2A 3R6KA 1ZM3A 1EFUA 1H8EA 1H85A 1R5BA 3FPPA 1EP1B 3FJOA 2X85A 4B48A 1GAWA 2WZPP 5FNZA 2R9VA 4P2NA 2C77A 4ZV4A 3SKBA 4XOTA 3W5UA 3VO2A 4RD2A 1PJ5A 3T51B 4TMTA 1E62A 3CCMB 3T53B 4WZEA 1RQPA 3PUNA 3LQEA 1YI2B 3U6KA 2HDNB 3GQBA 1W0KA 2XOKA 1KMHA 2XZPA 3WNCA 1AIPA 1KJZA 4UZEA 3Q39A 3W2FA 2Q6KA 3QFTA 1PJ7A 2EFGA 3A35A 4Z4TA 4ZCMA 1Y0YA 4MYUA 2OBSA 1G7CA 2QE7A 3OW7A 2VJJA 2VNJA 2GJPA 4AVZA 2P3MA 5THXA 1KK0A 1E64A 1B23P 2XGJA 4BPRA 2WZNA 1DDIA 4Z4ZA 1YJ9B 3ZZTA 1H8HA 4PC1A 1T6XA 3W5VA 1ZM9A 2C2WA 4PGOA 1I7PA 1QUFA 4DQKA 1WORA 2C5HA 3FKSA 2QEXB 1KK3A 1KRHA 3CC2B 3GSIA 1QG0A 4X7EA 1H42A 4GQNA 4QVJA 2X53S 2X0KA 4X06A 2ZL5A 2YWFA 4ZGNB 1I18A 2JJ2A 4P6VF 3FPKA 2I1LA 3OAAA 3ONYA 1IB0A 4XORA 3QSYA 3CW2A 3QFCA 1SKQA 3JU4A 4UZUA 2ZZFA 4LBVA 3U2QA 3OP1A 2ZITA 2GJKA 4QFMA 1UD5A 1T5EA 3QFSA 3WNBA 5FO1A 3W2GA 2OK7A 5FL7A 4ASUA 3OZVA 2BM1A 3OOCA 2BPOA 5FA6A 1NB0A 4FK8A 4WWVA 2DEUA 4Z4SA 2X6WA 2CW5A 3CESA 4H9GA 3CXCB 4XONA 5A8AA 4Z4WA 3MCAA 4XLFA 2ZL7A 2DYIA 4OOSA 2OK8A 2NPFA 2ZTNA 3BH4A 4RJLA 3I56B 3WY9A 2B5OA 2WSSA 1U2RA 3KEWA 1K28D 4JMQA 5HKKA 1N06A 2RC6A 5KW9A 3CMMA 2X6XA 3CC4B 4RDKA 1W9XA 1D2EA 1KQSB 1IJEA 1HVXA 1D8TA 4Z4RA 2VZLA 3AVXA 1VQ8B 2DCUA 2QA4B 1TLLA 1V0EA 1KK2A 4WZKA 1NDHA 1QX4A 3AGPA 1NBMA 4UAJA 3V7AA 1VQLB 4DNTB 4TMVA 3W2EA 4YELA 1W35A 4CQJA 3J81k 4X7DA 4NBSA 3W2IA 3DDYA 4XLHA 2M5SA 4Q7JB 3W5HA 1EXMA 1OB2A 3BNWA 4RLZA 4TN1A 4E0FA 2X6YA 4LBZA 2BMWA 5F4OA 2D9RA 3MMPA 1XFOA 2FVGA 2JDIA 2Z6BD 1MRZA 3CB4A 3AVVA 4G6IA 4XL9A 1OGIA 1E3ZA 2J7KA 1PKVA 4LBWA 1D1NA 3SLDA 3V76A 1E1RA 4B3FX 2LZJA 4Y7CA 5A88A 2OBTA 4L8JA 5DSZA 1UD6A 3ASQA 4RD1A 3LQ6A 1JNYA 2VJIA 1WOSA 4Z4UA 5HZBA 2BN4A 3JQRA 2GREA 1QGYA 2YWGA 2QDXA 3RY8A 1P4MA 3SEJA 2OBRA 5IYRA 2PIAA 4XKWA 2JIZA 4P12A 1EFCA 3Q6QA 2HLDA 4II3A 3ZBTA 2ZZEA 3P26A 2V7XA 1JB9A 2E1RA 3CPXA 4OPSA 4YAFA 1GVHA 4RCYA 3CC7B 1S4MA 4XLEA 1WPCA 4RPDA 1QUEA 2C4UA 3GIRA 3OZUA 4OPVA 4U9UA 4WZLA 3ZPNA 4B4DA 2YWEA 4ROXA 4TSFA 2R6HA 3PVDA 4PABA 3E20A 1YJWB 4C0SA 5BSXA 2V4DA 1Q81D 3E1YE 4LBYA 1E1QA 3A8JA 4P3YA 4XD7A 1K8AD 4PC2A 4HE5A 1VQ7B 1EWYA 4M0LA 5E6TA 5TR9A 3CCLB 1VQ5B 5A89A 3GVKA 5GV7A 1N07A 2V7VA 2PE3A 2FX3A 3WBJA 4B47A 4XLCA 2BGIA 1GAQA 1OGJA 4XR6A 5BSYA 2NV4A 3ONUA 4X7FA 4P22A 1OB0A 2DETA 1SM4A 3PENA 3CD6B 3I1FA 5H59A 3WYAA 1QGZA 4YAWA 4ACBA 5F4MA 2GJRA 3A8KA 4RD0A 3BY2A 4X07A 2V7TA 2X8KA 4G7WA 1EFRA 1TUIA 2B7BA 3OZWA 4Y9UA 3CCVB 4IW3B 4X8IA 4XN0A 4QHYA 3AVWA 3MHPA 4XKVA 2ZXIA 1N0VC 4ZCLA 3Q3AA 4NCNA 3Q38A 4PC3A 3CCUB 4XLAA 2WPDA 1BMFA 1NB9A 1E63A 1V0FA 3JQPA 4DK1A 2XNCA 1TVCA 5B6IA 2PLFA 2C5BA 1JJ2B 4OPOA 1ZM4A 2D3NA 1FNDA 5TV2A 1E79A 3BQJA 3BC9A 3WQZA 5IYWA 2BVNA 3U6BA 2HCJB 2VBSA 1TTTA 1W2BB 2VNHA 4G5GA 4HE6A 3ZC3A 3PA2A 1VQMB 5HXBA 3VO1A 3LO8A 1WSVA 2JJ1A 3ISXA 3WBKA 1A8PA 2XEXA 1GO2A 2BM0A 2EIXA 5AN9A 3NE5B 4N3GA 2QTZA 2VBUA 2WJVA 3PA1A 5DN6A 3CCEB 3KL9A 2V7WA 1CNEA 1WSRA 4P3IA 5IYNA 1FRQA 4NNJA 2CK3A 1YHQB 3W2HA 3LVBA 2WJYA 4RD6A 3OEHA 1CNFA 2GQFA 4DNRB 4RD4A 4XQFA 2OTJB 5EMNA 2YWHA 4X7CA 1M90D 5KNLA 1BX0A 1DG1G 2OYNA 2C4TA 3CP8A 3P27A 4M4SA 2XZLA 1QVFB 5F4JA 4Z4YA 4TMXA 2Q6OA 1ZUNB 4M2LA 1NJID 4PC6A 3A1PA 1VQOB 1COWA 3BY1A 3CP2A 1BLIA 3Q6RA 4P6YA 3VR6A 1UD4A 3H9NA 3G05A 3G4SB 1YITB 1N8RD 3AVTA 4LC0A 1Y0RA 2X3UA 4P9SA 1KD1D 3AVUA 2ZBUA 1KC8D 4DK0A 2W6IA 3SJZA 4WQMA 4AC9A 5LMZA 2GPJA 1HA3A 2ZL6A 1VQ4B 3CRZA 4M1KA 3B8HA 1VHEA 2V7UA 4FWTA 2Q6LA 5H5JA 2ZBVA 4OP7A 4QV2A 3OFNA 1ELOA 1VHOA 2F1LA 1R5OA 5CDFA 2XZOA 1QFYA 3D26A 4OOVA 3A3GA 1WP6A 3ASSA 4AF6A 3CTAA 2AHOA 1QH0A 2WR8A 3R6JA 4TKOB 4B43A 2PMDA 2BV3A 4HIZA 4KKSA 1JA0A 1G7RA 2BF4A 2CF4A 4KKUA 4X05A 3AGQA 4YAOA 3GVLA 3WNDA 1VLOA 2VNIA 1QGAA 2V31A 5KSWB 1N05A 4Y9RA 4YHBA 1W87A 1FNCA 1YLOA 1AMOA 1Q86D 2GK6A 4B3XA 4UZFA 1UD8A 2QMUA 2ZXHA 1BPLA 1RQRA 1BX1A 1M1KD 4G7XA 2F1MA 3B82A 1KTVA 4EH1A 1N08A 1EP3B 1UMKA 3LNNA 1BJKA 4P25A 1S72B 1FX0A 2F43A 1FNBA 2VBVA 1N0UA 3G6EB 3ASRA 3OW2B 2QGGA 3SLNA 4RD3A 2DOGA 1Q7YD 4OOXA 3H94A 3GVJA 1I8DA 4G1VA 2VYQA 4PC7A 5FO0A 3CPWB 2Q6IA 4RCZA 4R71A 4II2A 3ZBUA 1QVGB 1IHMA 4B44A 2ZZGA 2HMAA 4M53A 1K73D 4AF7A 3CCSB 1XQBA 1DDGA 2XNDA 3BCFA 4FN5A 3G71B 1PJ6A 3PUMA 1VQPB 2VNKA 1QFJA 3ZIAA 4ZCIA 5JBQA 4RDLA 4XOPA 4Z4VA 1FDRA 4TT3A 1VJSA 1K9MD 4P1VA 1YX2A 2RC5A 1W0JA 1T6ZA 3SJPA 1J9ZA 1F60A 1E43A 1WU8A 4G1BA 1WDTA 3CMEB 1IJFA 1WOPA 1UD2A 1VF7A 4ZGQB 4QVAA 1VLYA 2W6JA 1VQ9B 4YALA 1GJRA 1NRKA 3ES9A 1EP2B 2DY1A 1Q9SA 2ZTGA 5J35A 5L46A 1UD3A 2OTLB 3ASPA 2C78A 3T56B 1YJNB 4XM3A 2DERA 3OJWA 1DARA 1JA1A 5J3OA 4XMYA 4N3NA 2GK7A 2BSAA 2JN9A 2QN6A 1XB2A 3VNUA 3BCDA 4XNFA 1VQNB 4Z1MA 4KKTA 2E1BA 2QTLA 3ZUGA 2CRVA 4C43A 4F7DA 4MYTA 1OB5A 2CC2A 1B2RA 5GV8A 1FNMA 5IYQA 1ZM2A 2ZZQA 4RPBA 3CMAB 3AVYA 2CNDA 1OHHA 1W34A 4TMWA 4P26A 3I55B 4DQLA 2V7QA 4PAAA 1SKYB 2DIEA 1R5NA 5DS0A 2XNJA 3OE7A 5IYPA 5FIUA 2KVOA 4TMZA 3OKXA 1VQ6B 1G7TA 1KZLA 1V5VA 1G7SA 1T6YA 1GR1A 3OPOA 4B3GA 3A3BA 1BQEA 2BGJA 2VBTA 4X0CA 1HZEA 1YIJB 3QFRA 4XN3A 5HZAA 4WZTA 3OJXA 2D74A 2WYRA 1WOOA 1Q82D 3ASTA 3VMFA 1F20A 1E3XA 3ZZ0A 3CCRB 4YEJA 3JQQA 1CQXA 3HAGA 4ACAA 2B7CA 3VNVA 3A8IA 1XE1A
chains in the Genus database with same CATH topology
4RDKA 3Q38A 4RDJA 4RM0A 4Z4RA 4P25A 4QUZA 4OPOA 3ASRA 4WZKA 3BQJA 3R6KA 3SLNA 5IYWA 3V7AA 4OOXA 4X7DA 3PA2A 4P2NA 1IHMA 3SKBA 4RLZA 4WZEA 5F4OA 3PUMA 3PUNA 3LQEA 3PA1A 4P3IA 4RDLA 5IYNA 4Z4VA 3Q39A 4P1VA 4Z4TA 3SLDA 3SJPA 2OBSA 2OBTA 3ASQA 4X7CA 3LQ6A 4Z4UA 5HZBA 5F4JA 4QVAA 4Z4YA 4Z4ZA 3RY8A 3BY1A 5J35A 3SEJA 2OBRA 5IYRA 3Q6RA 4P12A 3ASPA 3Q6QA 4OPSA 5J3OA 4X7EA 4QVJA 4RPDA 4X06A 2ZL5A 4OPVA 4WZLA 2ZL6A 4ROXA 5IYQA 3ONYA 3PVDA 4RPBA 5BSXA 4OP7A 4P26A 4QV2A 3D26A 5E6TA 5IYPA 4OOVA 3ASSA 3R6JA 5BSYA 3ONUA 4X7FA 4Z4SA 4X0CA 4X05A 4Z4WA 2ZL7A 4OOSA 5HZAA 4WZTA 5F4MA 3BY2A 4X07A 3ASTA 5KW9A 3Q3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RDK A;  3Q38 A;  4RDJ A;  4RM0 A;  4Z4R A;  4P25 A;  4QUZ A;  4OPO A;  3ASR A;  4WZK A;  3BQJ A;  3R6K A;  3SLN A;  5IYW A;  3V7A A;  4OOX A;  4X7D A;  3PA2 A;  4P2N A;  1IHM A;  3SKB A;  4RLZ A;  4WZE A;  5F4O A;  3PUM A;  3PUN A;  3LQE A;  3PA1 A;  4P3I A;  4RDL A;  5IYN A;  4Z4V A;  3Q39 A;  4P1V A;  4Z4T A;  3SLD A;  3SJP A;  2OBS A;  2OBT A;  3ASQ A;  4X7C A;  3LQ6 A;  4Z4U A;  5HZB A;  5F4J A;  4QVA A;  4Z4Y A;  4Z4Z A;  3RY8 A;  3BY1 A;  5J35 A;  3SEJ A;  2OBR A;  5IYR A;  3Q6R A;  4P12 A;  3ASP A;  3Q6Q A;  4OPS A;  5J3O A;  4X7E A;  4QVJ A;  4RPD A;  4X06 A;  2ZL5 A;  4OPV A;  4WZL A;  2ZL6 A;  4ROX A;  5IYQ A;  3ONY A;  3PVD A;  4RPB A;  5BSX A;  4OP7 A;  4P26 A;  4QV2 A;  3D26 A;  5E6T A;  5IYP A;  4OOV A;  3ASS A;  3R6J A;  5BSY A;  3ONU A;  4X7F A;  4Z4S A;  4X0C A;  4X05 A;  4Z4W A;  2ZL7 A;  4OOS A;  5HZA A;  4WZT A;  5F4M A;  3BY2 A;  4X07 A;  3AST A;  5KW9 A;  3Q3A A; 
#chains in the Genus database with same CATH topology
 1FRN A;  4RDJ A;  4YAU A;  3QE2 A;  3CCQ B;  4K1X A;  1S0U A;  4RM0 A;  4YXW A;  1QFZ A;  3ZZU A;  3OEE A;  2D3L A;  2F4N A;  4J0Q A;  1VQK B;  1EFT A;  4FXU A;  4QUZ A;  3CCJ B;  2CBX A;  3WXM A;  1KK1 A;  3B78 A;  1MAB A;  5TRD A;  1WTH D;  5TY0 A;  5IK2 A;  3R6K A;  1ZM3 A;  1EFU A;  1H8E A;  1H85 A;  1R5B A;  3FPP A;  1EP1 B;  3FJO A;  2X85 A;  4B48 A;  1GAW A;  2WZP P;  5FNZ A;  2R9V A;  4P2N A;  2C77 A;  4ZV4 A;  3SKB A;  4XOT A;  3W5U A;  3VO2 A;  4RD2 A;  1PJ5 A;  3T51 B;  4TMT A;  1E62 A;  3CCM B;  3T53 B;  4WZE A;  1RQP A;  3PUN A;  3LQE A;  1YI2 B;  3U6K A;  2HDN B;  3GQB A;  1W0K A;  2XOK A;  1KMH A;  2XZP A;  3WNC A;  1AIP A;  1KJZ A;  4UZE A;  3Q39 A;  3W2F A;  2Q6K A;  3QFT A;  1PJ7 A;  2EFG A;  3A35 A;  4Z4T A;  4ZCM A;  1Y0Y A;  4MYU A;  2OBS A;  1G7C A;  2QE7 A;  3OW7 A;  2VJJ A;  2VNJ A;  2GJP A;  4AVZ A;  2P3M A;  5THX A;  1KK0 A;  1E64 A;  1B23 P;  2XGJ A;  4BPR A;  2WZN A;  1DDI A;  4Z4Z A;  1YJ9 B;  3ZZT A;  1H8H A;  4PC1 A;  1T6X A;  3W5V A;  1ZM9 A;  2C2W A;  4PGO A;  1I7P A;  1QUF A;  4DQK A;  1WOR A;  2C5H A;  3FKS A;  2QEX B;  1KK3 A;  1KRH A;  3CC2 B;  3GSI A;  1QG0 A;  4X7E A;  1H42 A;  4GQN A;  4QVJ A;  2X53 S;  2X0K A;  4X06 A;  2ZL5 A;  2YWF A;  4ZGN B;  1I18 A;  2JJ2 A;  4P6V F;  3FPK A;  2I1L A;  3OAA A;  3ONY A;  1IB0 A;  4XOR A;  3QSY A;  3CW2 A;  3QFC A;  1SKQ A;  3JU4 A;  4UZU A;  2ZZF A;  4LBV A;  3U2Q A;  3OP1 A;  2ZIT A;  2GJK A;  4QFM A;  1UD5 A;  1T5E A;  3QFS A;  3WNB A;  5FO1 A;  3W2G A;  2OK7 A;  5FL7 A;  4ASU A;  3OZV A;  2BM1 A;  3OOC A;  2BPO A;  5FA6 A;  1NB0 A;  4FK8 A;  4WWV A;  2DEU A;  4Z4S A;  2X6W A;  2CW5 A;  3CES A;  4H9G A;  3CXC B;  4XON A;  5A8A A;  4Z4W A;  3MCA A;  4XLF A;  2ZL7 A;  2DYI A;  4OOS A;  2OK8 A;  2NPF A;  2ZTN A;  3BH4 A;  4RJL A;  3I56 B;  3WY9 A;  2B5O A;  2WSS A;  1U2R A;  3KEW A;  1K28 D;  4JMQ A;  5HKK A;  1N06 A;  2RC6 A;  5KW9 A;  3CMM A;  2X6X A;  3CC4 B;  4RDK A;  1W9X A;  1D2E A;  1KQS B;  1IJE A;  1HVX A;  1D8T A;  4Z4R A;  2VZL A;  3AVX A;  1VQ8 B;  2DCU A;  2QA4 B;  1TLL A;  1V0E A;  1KK2 A;  4WZK A;  1NDH A;  1QX4 A;  3AGP A;  1NBM A;  4UAJ A;  3V7A A;  1VQL B;  4DNT B;  4TMV A;  3W2E A;  4YEL A;  1W35 A;  4CQJ A;  3J81 k;  4X7D A;  4NBS A;  3W2I A;  3DDY A;  4XLH A;  2M5S A;  4Q7J B;  3W5H A;  1EXM A;  1OB2 A;  3BNW A;  4RLZ A;  4TN1 A;  4E0F A;  2X6Y A;  4LBZ A;  2BMW A;  5F4O A;  2D9R A;  3MMP A;  1XFO A;  2FVG A;  2JDI A;  2Z6B D;  1MRZ A;  3CB4 A;  3AVV A;  4G6I A;  4XL9 A;  1OGI A;  1E3Z A;  2J7K A;  1PKV A;  4LBW A;  1D1N A;  3SLD A;  3V76 A;  1E1R A;  4B3F X;  2LZJ A;  4Y7C A;  5A88 A;  2OBT A;  4L8J A;  5DSZ A;  1UD6 A;  3ASQ A;  4RD1 A;  3LQ6 A;  1JNY A;  2VJI A;  1WOS A;  4Z4U A;  5HZB A;  2BN4 A;  3JQR A;  2GRE A;  1QGY A;  2YWG A;  2QDX A;  3RY8 A;  1P4M A;  3SEJ A;  2OBR A;  5IYR A;  2PIA A;  4XKW A;  2JIZ A;  4P12 A;  1EFC A;  3Q6Q A;  2HLD A;  4II3 A;  3ZBT A;  2ZZE A;  3P26 A;  2V7X A;  1JB9 A;  2E1R A;  3CPX A;  4OPS A;  4YAF A;  1GVH A;  4RCY A;  3CC7 B;  1S4M A;  4XLE A;  1WPC A;  4RPD A;  1QUE A;  2C4U A;  3GIR A;  3OZU A;  4OPV A;  4U9U A;  4WZL A;  3ZPN A;  4B4D A;  2YWE A;  4ROX A;  4TSF A;  2R6H A;  3PVD A;  4PAB A;  3E20 A;  1YJW B;  4C0S A;  5BSX A;  2V4D A;  1Q81 D;  3E1Y E;  4LBY A;  1E1Q A;  3A8J A;  4P3Y A;  4XD7 A;  1K8A D;  4PC2 A;  4HE5 A;  1VQ7 B;  1EWY A;  4M0L A;  5E6T A;  5TR9 A;  3CCL B;  1VQ5 B;  5A89 A;  3GVK A;  5GV7 A;  1N07 A;  2V7V A;  2PE3 A;  2FX3 A;  3WBJ A;  4B47 A;  4XLC A;  2BGI A;  1GAQ A;  1OGJ A;  4XR6 A;  5BSY A;  2NV4 A;  3ONU A;  4X7F A;  4P22 A;  1OB0 A;  2DET A;  1SM4 A;  3PEN A;  3CD6 B;  3I1F A;  5H59 A;  3WYA A;  1QGZ A;  4YAW A;  4ACB A;  5F4M A;  2GJR A;  3A8K A;  4RD0 A;  3BY2 A;  4X07 A;  2V7T A;  2X8K A;  4G7W A;  1EFR A;  1TUI A;  2B7B A;  3OZW A;  4Y9U A;  3CCV B;  4IW3 B;  4X8I A;  4XN0 A;  4QHY A;  3AVW A;  3MHP A;  4XKV A;  2ZXI A;  1N0V C;  4ZCL A;  3Q3A A;  4NCN A;  3Q38 A;  4PC3 A;  3CCU B;  4XLA A;  2WPD A;  1BMF A;  1NB9 A;  1E63 A;  1V0F A;  3JQP A;  4DK1 A;  2XNC A;  1TVC A;  5B6I A;  2PLF A;  2C5B A;  1JJ2 B;  4OPO A;  1ZM4 A;  2D3N A;  1FND A;  5TV2 A;  1E79 A;  3BQJ A;  3BC9 A;  3WQZ A;  5IYW A;  2BVN A;  3U6B A;  2HCJ B;  2VBS A;  1TTT A;  1W2B B;  2VNH A;  4G5G A;  4HE6 A;  3ZC3 A;  3PA2 A;  1VQM B;  5HXB A;  3VO1 A;  3LO8 A;  1WSV A;  2JJ1 A;  3ISX A;  3WBK A;  1A8P A;  2XEX A;  1GO2 A;  2BM0 A;  2EIX A;  5AN9 A;  3NE5 B;  4N3G A;  2QTZ A;  2VBU A;  2WJV A;  3PA1 A;  5DN6 A;  3CCE B;  3KL9 A;  2V7W A;  1CNE A;  1WSR A;  4P3I A;  5IYN A;  1FRQ A;  4NNJ A;  2CK3 A;  1YHQ B;  3W2H A;  3LVB A;  2WJY A;  4RD6 A;  3OEH A;  1CNF A;  2GQF A;  4DNR B;  4RD4 A;  4XQF A;  2OTJ B;  5EMN A;  2YWH A;  4X7C A;  1M90 D;  5KNL A;  1BX0 A;  1DG1 G;  2OYN A;  2C4T A;  3CP8 A;  3P27 A;  4M4S A;  2XZL A;  1QVF B;  5F4J A;  4Z4Y A;  4TMX A;  2Q6O A;  1ZUN B;  4M2L A;  1NJI D;  4PC6 A;  3A1P A;  1VQO B;  1COW A;  3BY1 A;  3CP2 A;  1BLI A;  3Q6R A;  4P6Y A;  3VR6 A;  1UD4 A;  3H9N A;  3G05 A;  3G4S B;  1YIT B;  1N8R D;  3AVT A;  4LC0 A;  1Y0R A;  2X3U A;  4P9S A;  1KD1 D;  3AVU A;  2ZBU A;  1KC8 D;  4DK0 A;  2W6I A;  3SJZ A;  4WQM A;  4AC9 A;  5LMZ A;  2GPJ A;  1HA3 A;  2ZL6 A;  1VQ4 B;  3CRZ A;  4M1K A;  3B8H A;  1VHE A;  2V7U A;  4FWT A;  2Q6L A;  5H5J A;  2ZBV A;  4OP7 A;  4QV2 A;  3OFN A;  1ELO A;  1VHO A;  2F1L A;  1R5O A;  5CDF A;  2XZO A;  1QFY A;  3D26 A;  4OOV A;  3A3G A;  1WP6 A;  3ASS A;  4AF6 A;  3CTA A;  2AHO A;  1QH0 A;  2WR8 A;  3R6J A;  4TKO B;  4B43 A;  2PMD A;  2BV3 A;  4HIZ A;  4KKS A;  1JA0 A;  1G7R A;  2BF4 A;  2CF4 A;  4KKU A;  4X05 A;  3AGQ A;  4YAO A;  3GVL A;  3WND A;  1VLO A;  2VNI A;  1QGA A;  2V31 A;  5KSW B;  1N05 A;  4Y9R A;  4YHB A;  1W87 A;  1FNC A;  1YLO A;  1AMO A;  1Q86 D;  2GK6 A;  4B3X A;  4UZF A;  1UD8 A;  2QMU A;  2ZXH A;  1BPL A;  1RQR A;  1BX1 A;  1M1K D;  4G7X A;  2F1M A;  3B82 A;  1KTV A;  4EH1 A;  1N08 A;  1EP3 B;  1UMK A;  3LNN A;  1BJK A;  4P25 A;  1S72 B;  1FX0 A;  2F43 A;  1FNB A;  2VBV A;  1N0U A;  3G6E B;  3ASR A;  3OW2 B;  2QGG A;  3SLN A;  4RD3 A;  2DOG A;  1Q7Y D;  4OOX A;  3H94 A;  3GVJ A;  1I8D A;  4G1V A;  2VYQ A;  4PC7 A;  5FO0 A;  3CPW B;  2Q6I A;  4RCZ A;  4R71 A;  4II2 A;  3ZBU A;  1QVG B;  1IHM A;  4B44 A;  2ZZG A;  2HMA A;  4M53 A;  1K73 D;  4AF7 A;  3CCS B;  1XQB A;  1DDG A;  2XND A;  3BCF A;  4FN5 A;  3G71 B;  1PJ6 A;  3PUM A;  1VQP B;  2VNK A;  1QFJ A;  3ZIA A;  4ZCI A;  5JBQ A;  4RDL A;  4XOP A;  4Z4V A;  1FDR A;  4TT3 A;  1VJS A;  1K9M D;  4P1V A;  1YX2 A;  2RC5 A;  1W0J A;  1T6Z A;  3SJP A;  1J9Z A;  1F60 A;  1E43 A;  1WU8 A;  4G1B A;  1WDT A;  3CME B;  1IJF A;  1WOP A;  1UD2 A;  1VF7 A;  4ZGQ B;  4QVA A;  1VLY A;  2W6J A;  1VQ9 B;  4YAL A;  1GJR A;  1NRK A;  3ES9 A;  1EP2 B;  2DY1 A;  1Q9S A;  2ZTG A;  5J35 A;  5L46 A;  1UD3 A;  2OTL B;  3ASP A;  2C78 A;  3T56 B;  1YJN B;  4XM3 A;  2DER A;  3OJW A;  1DAR A;  1JA1 A;  5J3O A;  4XMY A;  4N3N A;  2GK7 A;  2BSA A;  2JN9 A;  2QN6 A;  1XB2 A;  3VNU A;  3BCD A;  4XNF A;  1VQN B;  4Z1M A;  4KKT A;  2E1B A;  2QTL A;  3ZUG A;  2CRV A;  4C43 A;  4F7D A;  4MYT A;  1OB5 A;  2CC2 A;  1B2R A;  5GV8 A;  1FNM A;  5IYQ A;  1ZM2 A;  2ZZQ A;  4RPB A;  3CMA B;  3AVY A;  2CND A;  1OHH A;  1W34 A;  4TMW A;  4P26 A;  3I55 B;  4DQL A;  2V7Q A;  4PAA A;  1SKY B;  2DIE A;  1R5N A;  5DS0 A;  2XNJ A;  3OE7 A;  5IYP A;  5FIU A;  2KVO A;  4TMZ A;  3OKX A;  1VQ6 B;  1G7T A;  1KZL A;  1V5V A;  1G7S A;  1T6Y A;  1GR1 A;  3OPO A;  4B3G A;  3A3B A;  1BQE A;  2BGJ A;  2VBT A;  4X0C A;  1HZE A;  1YIJ B;  3QFR A;  4XN3 A;  5HZA A;  4WZT A;  3OJX A;  2D74 A;  2WYR A;  1WOO A;  1Q82 D;  3AST A;  3VMF A;  1F20 A;  1E3X A;  3ZZ0 A;  3CCR B;  4YEJ A;  3JQQ A;  1CQX A;  3HAG A;  4ACA A;  2B7C A;  3VNV A;  3A8I A;  1XE1 A; 
#chains in the Genus database with same CATH homology
 4RDK A;  3Q38 A;  4RDJ A;  4RM0 A;  4Z4R A;  4P25 A;  4QUZ A;  4OPO A;  3ASR A;  4WZK A;  3BQJ A;  3R6K A;  3SLN A;  5IYW A;  3V7A A;  4OOX A;  4X7D A;  3PA2 A;  4P2N A;  1IHM A;  3SKB A;  4RLZ A;  4WZE A;  5F4O A;  3PUM A;  3PUN A;  3LQE A;  3PA1 A;  4P3I A;  4RDL A;  5IYN A;  4Z4V A;  3Q39 A;  4P1V A;  4Z4T A;  3SLD A;  3SJP A;  2OBS A;  2OBT A;  3ASQ A;  4X7C A;  3LQ6 A;  4Z4U A;  5HZB A;  5F4J A;  4QVA A;  4Z4Y A;  4Z4Z A;  3RY8 A;  3BY1 A;  5J35 A;  3SEJ A;  2OBR A;  5IYR A;  3Q6R A;  4P12 A;  3ASP A;  3Q6Q A;  4OPS A;  5J3O A;  4X7E A;  4QVJ A;  4RPD A;  4X06 A;  2ZL5 A;  4OPV A;  4WZL A;  2ZL6 A;  4ROX A;  5IYQ A;  3ONY A;  3PVD A;  4RPB A;  5BSX A;  4OP7 A;  4P26 A;  4QV2 A;  3D26 A;  5E6T A;  5IYP A;  4OOV A;  3ASS A;  3R6J A;  5BSY A;  3ONU A;  4X7F A;  4Z4S A;  4X0C A;  4X05 A;  4Z4W A;  2ZL7 A;  4OOS A;  5HZA A;  4WZT A;  5F4M A;  3BY2 A;  4X07 A;  3AST A;  5KW9 A;  3Q3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...