3W2EA

Crystal structure of oxidation intermediate (20 min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
271
structure length
271
Chain Sequence
TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 74
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2eA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2eA02
4Y7CA 1ZM4A 1GJRA 4U9UA 3MMPA 2VNKA 3WYAA 3CCLB 3A1FA 4PC2A 1DG1G 4AF7A 3ZZ0A 3G4SB 2OK7A 4FK8A 2YWGA 2BGJA 4J0QA 1CQXA 3P26A 1YIJB 4B3XA 4Q7JB 2BF4A 4B43A 2HMAA 1VQKB 4ZGQB 1EFCA 3CCSB 4UAJA 3W5UA 1KK0A 3JQRA 3B78A 2FX3A 4G5GA 3AVWA 3LVBA 2YWFA 5H59A 4QHYA 1KK1A 1AIPA 2OTJB 1EP2B 3QFTA 3CCUB 2X3UA 1FDRA 1U2RA 3AVTA 1B23P 4FN5A 4IW3B 2YWEA 1KQSB 1VQ8B 1OGJA 1SM4A 1F20A 1KK3A 4LBVA 2QA4B 1VQPB 4B48A 3VMFA 1NDHA 1KC8D 4TMXA 4FWTA 4P3YA 1GAQA 1FNBA 3CD6B 1VQ9B 2D74A 1G7SA 4DQKA 1W35A 1JJ2B 3CB4A 1YJWB 1R5OA 1G7CA 1K9MD 2CNDA 1TLLA 5H5JA 5THXA 2XEXA 2BPOA 2QEXB 1QGYA 1KJZA 2BM0A 3WBKA 4M1KA 4AF6A 4Y9RA 1G7RA 1F60A 4RD1A 4YAUA 1S72B 3MHPA 3OZVA 4YAOA 3PENA 2BGIA 1JA0A 2BN4A 3CCEB 2RC6A 1VQ7B 3QFRA 3CCJB 1XB2A 3AVUA 1VQMB 3V76A 2QTZA 1A8PA 1EFUA 1DARA 2GPJA 2HDNB 4NBSA 3CC7B 1QFYA 4NCNA 1W34A 2C77A 4M2LA 2XNJA 2EFGA 1Q7YD 1YI2B 1JA1A 3QFSA 1K73D 1QGZA 2PIAA 4YAWA 3CCMB 1YJ9B 3P27A 1FNDA 1KRHA 3CPWB 1QFZA 1QG0A 3AGPA 4H9GA 1VQOB 4Y9UA 4RCZA 1GO2A 2OTLB 2BMWA 1W87A 4TMTA 2B7BA 3E20A 1CNEA 3I1FA 1QVFB 1BX0A 3WXMA 3CMEB 4WQMA 1VQNB 1D8TA 4YHBA 1JNYA 3VO1A 3MCAA 1VQ6B 2EIXA 4TMVA 4MYUA 4K1XA 4M0LA 4RD2A 2C78A 1FRNA 3OW2B 1IB0A 4HE5A 1UMKA 3ZBTA 2R6HA 1EP3B 2DERA 5FA6A 1GR1A 3I55B 4B4DA 4M4SA 4LBYA 1ZM3A 2RC5A 1QFJA 2E1RA 2BSAA 3W2FA 4ZCMA 3JQPA 3OZUA 4TMWA 2VNHA 4M53A 3ZZTA 1B2RA 3AVXA 1Q82D 2B7CA 2YWHA 1S0UA 1KTVA 4QFMA 2BM1A 1EWYA 3E1YE 3JQQA 4C0SA 1NJID 1H85A 1I7PA 4BPRA 3WBJA 2VYQA 1YITB 3ZBUA 3I56B 1QUFA 4B44A 2B5OA 3SJZA 4RD3A 5EMNA 1SKQA 3WY9A 1W2BB 2QMUA 2CRVA 1GVHA 1E64A 1OB2A 3ZZUA 1JB9A 2VZLA 2VNJA 4ZCLA 3G6EB 1KD1D 1KK2A 3VNVA 3WNBA 1ZM9A 3G71B 3QE2A 1BX1A 5TR9A 1QUEA 4YAFA 5AN9A 2BV3A 4LBWA 3LYUA 3U6BA 3QFCA 1FNMA 3W2HA 1BQEA 3W5HA 1QH0A 4N3NA 4EH1A 1QGAA 1M1KD 5KSWB 1FNCA 4C43A 4DQLA 3W2IA 3U6KA 1GAWA 3J81k 2QDXA 4ACBA 5GV7A 3OJWA 4TN1A 4B47A 3CC2B 3CRZA 3FJOA 3FPKA 1TVCA 2NPFA 1Q81D 1IJFA 2J7KA 1D1NA 4MYTA 1VQ5B 1FRQA 4RD0A 1R5BA 1ZM2A 1XE1A 4TMZA 1DDGA 4HE6A 4RD6A 4LC0A 1DDIA 1EP1B 4G1BA 3VNUA 4F7DA 4ZV4A 2PMDA 5TV2A 1G7TA 4P6VF 4PC1A 1E63A 1M90D 3AVYA 4G1VA 1ELOA 3B8HA 2XNCA 5DSZA 4AC9A 1HA3A 4ZCIA 1YHQB 1EXMA 1D2EA 1Q86D 3CW2A 3VO2A 5HXBA 2QTLA 2AHOA 4ACAA 3U2QA 3W5VA 3LRXA 1R5NA 3B82A 5TY0A 3CCVB 4RCYA 3QSYA 4PC6A 3WNDA 2VNIA 3W2GA 1QVGB 1K8AD 4PC7A 1OB5A 3CC4B 3CXCB 4RJLA 3LO8A 2HCJB 1TTTA 2QN6A 3ES9A 4ZGNB 1J9ZA 3AVVA 3OJXA 3OZWA 2DCUA 3W2EA 1N0VC 1VQLB 4YALA 1EFTA 1E62A 1N0UA 1WDTA 1BJKA 1OGIA 2OK8A 2ZITA 4LBZA 4PC3A 4N3GA 3WNCA 1ZUNB 3CCRB 3ZC3A 1QX4A 2DY1A 1H42A 5GV8A 4R71A 2BVNA 1TUIA 5JBQA 4RD4A 1IJEA 1N8RD 4PGOA 2GQFA 1AMOA 1YJNB 1CNFA 2PLFA 2DEUA 3CMAB 3AGQA 2DETA 3CCQB 1VQ4B
chains in the Genus database with same CATH superfamily
1W73A 4OYLA 2DP4E 3DBOB 2W43A 1V2HE 2YR0A 4ETNA 1ZAYA 4INOA 5CTAA 3M4ZA 3HSKA 5T6BA 3MGBA 1YCGA 5EVJA 3DDCA 2ADMA 3F7TA 4AF7A 4JOCA 2IYOA 2Y3IA 1G0OA 4J3FA 5A04A 3B6JA 2I55A 2Z1MA 3ILVA 1KH1A 4FC7A 4QVGA 3CESA 2I03A 3H8WA 5AVXA 1JLLB 1P0IA 4ESOA 5LLDA 3TNFA 1AA6A 5G1NA 2GM4A 1L7OA 3OIDA 5I7SA 5A2GA 5KREA 5H9VA 1GG2A 1WSBA 1W5FA 3ZU2A 2O0JA 1NJFA 1YX2A 2VYCA 4X97A 4XL9A 2IIBA 1M2JA 2ZR0A 4R0VA 4BC1A 5C35A 5AW8A 4RTRA 4CI9A 1VMEA 3K6KA 1T5OA 5K0ZA 5K2OA 1JDBC 4KWIA 3WZMA 4RVSA 1NZDA 1C29B 2VTDA 2GB4A 3HV0A 3I12A 4BYMA 2WWRA 3KKOA 3QXSA 1J23A 3JQRA 1XVIA 1IATA 1Y5NA 3B3AA 3ELUA 3H6HA 3PUXA 2QN1A 4FMPA 4JLBA 5J5AA 3UK1A 1WSDA 4ILKA 5CFOA 5FX2A 1TLFA 4GXTA 5KX5B 5L4SA 5TT0A 2ORWA 1QIFA 2NLOA 2VJNA 2DX7A 3PQ2A 4OQMA 4PR0A 4YPFA 4QHYA 5LXTF 4CETA 5JDIC 1JDTA 2YZKA 3HP7A 5DSTA 2C3YA 4I5IA 3JV7A 3CCUB 3ZDRA 4EMSA 2X2OA 1HE3A 2ZSBA 2B78A 4IH1A 4URVR 1FFAA 1VRCA 1TF2A 1PG0A 2XAAA 3OOHA 5AW3A 3MC1A 3CRRA 4XLHA 4FMDB 1U7UA 3FPAA 2JCSA 1BH2A 4KR6A 3U4HA 1CRLA 1QHHA 1QO0A 4G25A 4MRSA 3UV6A 1W47A 2XXBA 2JFPA 2VF8A 2HOQA 1QV6A 1YSCA 3FFXA 1KK3A 5ALXA 5K0LA 2EP7A 3ZQ6A 3U4DA 3ANNA 2HRBA 1BD3A 1Q21A 1KDOA 1L7VC 3IPYA 2EJUA 4P4TA 3AKZA 2Q6KA 4P3YA 1A2OA 1FFWA 1Q92A 2H16A 3QLJA 3X2EA 3KTFA 5EZQA 3LT0A 3V6LA 3IMEA 1E9FA 3OQPA 4GP9A 4CHGA 4DQKA 2PR2A 1HEYA 1TVKB 4XOIA 5CCXA 5FV4A 3ROZA 3U7HB 4FILA 2JLUA 1A8UA 3OF2A 5K0JA 1YE5A 4KNYA 4XYGA 1TU3A 2VWQA 1J8VA 4MK4A 3OCWA 3TLYA 2AMVA 4D5GA 3UB3A 3OPNA 5FQNA 2WU1A 3G5UA 4MIOA 1ZUHA 1M2FA 2RBKA 2REXB 2ZUCA 3I05A 2WB4A 3L8HA 3X1DA 5A3JA 4J75A 1TE2A 2WWFA 1V1MA 3BAZA 4DXHA 4I0WB 1QHNA 3A1SA 2OXFA 1WY7A 3A1TA 1PR5A 2V3WA 3CVOA 3I4FA 1TYZA 3KKMA 1XZ8A 3PUHA 4LTNA 3I2FA 1EFPB 2QP3A 3O0TA 3FZYA 2JKYA 5CAEB 1L7XA 1N2CA 1UDRA 1B0AA 1DQRA 1TMGE 1UMCB 2PGOA 1TDJA 2R4QA 3G5MA 5ULLA 3UUWA 5C5IA 5CPBA 2I2FA 1YQEA 4BAZA 3L4BC 3O9VA 4PO3X 3NIBA 4N76A 2ZATA 3BGWA 2VRCA 1CZHA 1NUUA 4IQFA 3TLCA 3A6LA 2PS3A 2Q46A 1TIPA 1XCBA 3BBPA 1H22A 4G56A 3ZHUA 3H3XA 4R7ZA 4GMDA 4GR5A 3N2GA 5B1DA 1M0EA 4ESEA 5EHGA 2EX4A 1B6SA 5K3OA 3CLSC 3W05A 2ZTVA 4DS3A 3PWTA 3KD3A 1E1MA 1XNJA 1NM5C 3LQ4A 4L5BA 1EWRA 5EMMA 1ULUA 2BEKA 5E4YA 1P9NA 1YJBA 2QMQA 3G68A 1QVAA 4PYQA 4UOQA 5GOZA 3QKRA 4CM9A 3V76A 3Q40A 1MAHA 3F7MA 1XMQB 4X6UA 1JDPA 4CKCB 3A28A 1OJLA 1QPBA 4M46A 1Y8QB 4P22A 2DKNA 3VU8A 2EEPA 5DNUA 4P93A 2WA2A 1QFSA 5HIJA 3T99A 4BUZA 4D9JA 5KVSA 3VZSA 3MGAA 3DZCA 1OXXK 2FWPA 5DASA 1U98A 5DNAA 5FBHA 4B34A 4BC0A 5E4JA 1BEUB 4KN9S 4M60A 1YOVA 1R6BX 2X7XA 1G2QA 1KSHA 1NVUQ 3KL4A 1Q0SA 1M34B 4BAGA 721PA 1EXVA 1Z0FA 1FDSA 1SXHA 4UFOA 4BQPA 4E08A 4ZOAA 3E2IA 1A2KC 2FUKA 1M2OA 3CSUA 5HIIA 1LWNA 3NHAA 3NYQA 4WACA 3SZMA 3L0BA 1C9JA 1CJCA 1FP6A 3TJMA 2C2KA 3U7RA 3DMNA 4CKEA 2ABWA 1MO6A 1JBQA 5DN6A 5IJ9B 4DV6B 3DD1A 5JJBA 2JEYA 4JLKA 3TSCA 1EQAA 2IY7A 4ND3A 2FQXA 2AJLI 1JTVA 1Y0RA 4X63A 4CKXA 4HVCA 1QMPA 2O7QA 4YP0A 4H9GA 1W0KD 1J1IA 2BFCA 1MVLA 1VKOA 5EIBD 3NE5B 2K7FA 4ZOCA 1WXHA 1GO2A 3RJTA 3ILYA 4HYEA 5DULA 3F4LA 1W87A 3B3GA 3OOYA 4P58A 3U39A 4RQUA 2PUFA 1HT0A 2FW9A 1HWYA 1J9EA 4OTZA 3CX7A 3SQXA 4JEMA 3P52A 2EDCA 5LFAA 1GU1A 1JAHA 2NO4A 3ANXA 3OECA 1VFNA 2P6MA 2PJDA 3FBWA 2RAPA 1UQUA 3EGXB 2C42A 3ICWA 1DT3A 4F7WA 4I5DA 2FFRA 5ICSA 2Y4OA 2VF5X 2JA1A 3TZEA 1QRTA 3CF0A 3GL9A 4BCDA 5BV7A 2QTNA 4AKSA 2AC2A 1B6GA 4IDPA 3RIXA 4GPIB 4AMGA 1FU4A 3GR6A 1FRNA 3DHNA 2DT5A 2AN9A 1GAJA 3E35A 3ZVLA 4WNYA 3AW8A 1EJ2A 2RHRA 4N0EA 2WVAA 2WTXA 2OQRA 3C8HA 1U8TA 1Y3CE 1BDBA 3BSSA 3KR2A 4QGGA 1A9QA 2Q9CA 1D7OA 1PFQA 4K8RB 2MINB 1OV6A 3HFJA 5DXAA 5LN1A 2J0SA 1YHZA 3DS8A 3HCAA 2AGVA 3EXEA 3TW4A 3LHDA 4K40A 1WZCA 4OHZA 3P94A 4WUVA 4XWGA 4IUYA 1YB2A 4EKNB 5BMVA 5MGBA 1JPNA 3JQPA 3N8DA 2G76A 2RMKA 2X6YA 3F6YA 1IWPB 1JJ7A 1FBNA 3JQEA 1WKCA 1K7YA 3R3JA 5HGJA 2HMVA 1CSEE 3K4QA 4F5YA 2RJOA 4GI2A 4IJKA 1Q83A 2GLUA 2ZKLA 4LK2A 5DVZA 3RHFA 2Z6AA 4P5DA 4B3GA 3WRYC 1UD2A 1DO2A 2CBZA 1RXUA 3CJQA 2GAAA 1NT2A 3HU1A 3GFVA 4QFMA 3PC7A 3S4YA 2F8TA 4M3NA 5JNSA 2PZEA 4B2LA 1YNSA 3JW8A 1XZIA 2GZRA 1DKQA 3DO6A 2AR7A 3M5PA 2Q1SA 1OA1A 3HB0A 2O8BB 3MJDA 2LZ0A 2SICE 5E7IA 3R76A 1SVSA 1Z6PA 1PAUA 4J9UE 3KK0A 3ZI4A 3BB3A 3MTQA 3HTXA 1X70A 4RD3A 1GL6A 3AL2A 1WMBA 2Q41A 3TNLA 3A2LA 2YX1A 4BTEA 2WV9A 1BMQA 2XUJA 3E27A 3GLQA 3L0OA 4GYYA 3M6AA 2H51A 3KSRA 2EFHB 2JRLA 4XLEA 2F9MA 3WLJA 1JHYA 1NUPA 1RI4A 4L6CA 3P9CA 4UDXX 4CG1A 3Q72A 4QYXA 4XWKA 5EFOA 1NXVA 3JD1A 2VHYA 2C94A 3ONYA 1SPXA 1VOTA 1Z18A 1PF7E 3BXXA 2J5QA 1OYYA 3NEYA 5ALWA 3SC2A 4C6SA 5ITZB 1BKDR 4Z9FA 2R47A 1BVRA 4YELA 4UAVA 4DR3B 3I1IA 4PBTA 1TRKA 4I4LA 5TMPA 3OZRA 4TV9F 1L4BA 3PF8A 1Q5PA 1N8KA 1XJQA 4HDAA 4XB1A 5DBGA 4ALJA 3PGJA 1JNXX 5JS1A 1MA3A 3A35A 1Q0LA 2AFHE 2Q5IA 3O92A 3WFJA 2RI6A 5HKBA 3KFVA 5DLEA 1MOQA 2WWGA 4WADA 2G3YA 2JVJA 4ZV9A 2VT7A 2VC2B 2YV5A 3ENQA 3MERA 4DDHA 1I8TA 3HJCA 1ZRSA 1AQYA 3BBLA 4RF2A 4DLSA 1SU4A 1XZAA 1G3MA 2SKEA 5TRDA 4LRSB 1G5PA 3UJDA 3HP4A 5HBRA 5C52B 3RFTA 4WKBA 1NVBA 3PK0A 2FR1A 4MV3A 1K68A 1QGAA 3H75A 3Q6IA 4WXHA 5P8WA 4BZXA 1UINA 2QVXX 1XGKA 4IUDS 1JR3E 1URPA 3WMFA 3E5RA 4CVNA 1MABA 2JFBA 5AK0A 3DL0A 4BECA 1VLZA 3OJEA 2AOTA 4HFMA 4OF4A 4WHMA 3UJAA 3TOXA 3WVNA 5A1TA 4D96A 3GCXA 1JEQA 2INGX 2O52A 4L5JA 4XZ3A 4FE4A 5ALLA 4PNZA 2CEAA 2I5PO 5A7HA 3ZDCA 3W1WA 1UBMS 4BVFA 3OJWA 1CX9B 4ENQA 3HWSA 4GLLA 5JVDA 5M04A 1A5ZA 1Z3CA 3LUFA 4H60A 4Q4HA 4E46A 1Z4KA 3WHPA 2HK7A 5E3JA 4Z9XA 1TVCA 5A06A 1M0WA 2YIVX 5I4CA 4LYDA 1Y8ZA 5T5QA 3O26A 1U0RA 4RAOA 4X91A 5SZJA 1ZNZA 4TWBA 2Q2VA 2A9KA 3GCZA 3RPEA 4XVCA 2GT1A 2C7RA 1B76A 4KGVA 4OKSA 2MYNA 1NMSA 4WLFA 2I67A 2CXUA 2Z8YM 4KUHA 4CBVA 4B3TB 3AHFA 5DTRA 3QHPA 2OZPA 5KDOA 4EO7A 1XE1A 4Z4FA 2EQ5A 4JB0A 2P0EA 4LC0A 2JD1A 3PJEA 3QY0A 4BFYA 4D81A 4BO6A 2YRXA 4TL7A 5TS3A 4ZAYA 5MN5A 1IG0A 1E1NA 4HJRA 3E7DA 4MKHA 5FEMA 3BS4A 4E21A 3UXEA 1OXVA 1XN4A 5B58C 5JRJA 1IXYA 1MPXA 5BSKA 4ZV4A 1T2NA 2HREA 1B8PA 2NTVA 5I5EA 1C1DA 2ZE8A 3V3KA 1Y3IA 3SZLA 7ADHA 1WOYA 1J5PA 5AUOB 1G8YA 2GCOA 4WK2B 1NRKA 1FSFA 2DUNA 4U8GA 5CT6A 2A9OA 2HZ7A 3FMOB 5E7MA 3L1VA 3RSGA 3ZWYA 4PEVA 1MEEA 3ZZ1A 4P53A 1E5LA 1CRWG 4H3VA 1T6ZA 5D51S 4MCHA 2P4HX 2WHRA 4W7SA 2AKEA 1HE4A 4QGHA 2FG7C 4R5MA 4TLLB 1DAHA 2LKCA 4M54A 1F1BA 2H00A 3DFKA 5JNRA 2VSFA 4DNRB 2VJYA 2O2CA 2B4KA 1VBMA 3R7LA 1M1ZA 2JATA 4JC0A 4JP1A 4X3CA 2PTGA 5TPZA 2DJIA 5CX4A 2XB4A 4X07A 2ZXEA 1I30A 2CNBA 1XAJA 4FFPA 1L9XA 1A8QA 2GF2A 3A6ZA 2ZZEA 1N1EA 1HYHA 1FRFS 3EG9B 1UT5A 1YB1A 5TQ2B 4ZI7F 3U2QA 3W5VA 1XUOA 3DAGA 3H8JA 3MD0A 4RMJA 1K4KA 1E8MA 3G9UA 3N0TA 4OAOA 2PVCA 2WWVD 3VPXA 3VHRA 1JHOA 2JEZA 4BFVA 3BFKA 2Q4BA 3EVEA 3G79A 3NKFA 3CZ4A 3EF1A 2HM7A 3P0HA 1Z2NX 4A4DA 4EVRA 2C4VA 1TM4E 1WG8A 3W4KA 1GZ3A 2FMIA 1E1DA 4HFJA 5DNWA 1K5GA 3S27A 4YRLA 4EG3A 5KNCD 4P5PA 2RKWA 5EHNA 3O8OA 1VHWA 2D2FA 3MCTA 3QLVA 4LJ9A 2B1GA 2JCBA 1A5BB 1NBWB 1M2EA 2WIAA 2VH5R 1YAJA 3LWBA 4G26A 1PK7A 2CUNA 2ZVJA 2ILTA 2PXHA 4N0MA 5H1YA 2Z57A 4Z7OB 2O2GA 1NC1A 3RSQA 1G19A 3MK31 1QBGA 3PHJA 4XE5A 5F7JA 3HJUA 4FUTA 3PVSA 5IJZA 3ES9A 4QGAA 1Z12A 3DE5X 1CY1A 1GUYA 2CE2X 3FCSB 1I2AA 1RWVA 2CVZA 4WLUA 3N2KA 1NPYA 2NACA 1Q1BA 4PZYA 3W8NA 1IMJA 4CDGA 1AGYA 1EAMA 2ZIZA 3AIOA 4ND6A 4HDMB 5LWQA 1XAGA 3M6FA 5IKPA 3GN2A 2G07A 2B82A 1OLSA 3QXHA 4EENA 1EM8B 4N18A 5JPIA 3IV7A 2W22A 4JI1B 3ZV7A 4F38A 5A2QA 3RC3A 3IKTA 3O47A 3D3JA 4EKYA 1OKKA 3G9QA 2COUA 2W6IA 1CIJA 1HT3A 4J0DA 3I0MA 4PO9A 1E2BA 4OMFG 4G84A 2O4CA 1EFRA 5ILGA 3CLSD 1JJVA 1KH3A 1XDSA 1QX4A 3L6BA 1UKYA 4U2KA 5FKJA 4Y9DA 2I6SA 4YA6A 2CLEB 2IHZA 3SHOA 4BZZA 4KNWA 3CPXA 1FTYA 1HURA 4XLAA 1RJWA 1G66A 2BGTA 3OZTA 1JR3A 3M0EA 3WLRA 5KHOC 1J39A 1IJEA 3B2QA 4RS3A 4Q15A 3IMKA 3MXTA 4PLYA 4Q3KA 5ALQA 5AXCA 5LDGA 2LUOA 2XKBA 1T3GA 4AJEA 4PFKA 2R62A 2MR5A 4IIUA 2AFIE 4FGZA 3QF4A 4N6GA 3AY6A 1I4DD 1ULZA 4MS3A 5JMOA 3N2NA 2R8XA 3LY8A 4LDJA 1ZBDA 4DGQA 3UN1A 1SKMA 2CJWB 4QOHA 4ZXFA 3KV3O 3I9OA 3ZWCA 1VQ4B 4FDVA 1VJSA 1D1PA 2B9VA 3E9NA 5JLAA 1M2GA 4ZDWA 1ZM4A 5LQSA 1RQGA 4LJ7A 1AQLA 1VZ3A 5DHQA 3B20A 4LNHA 1DG1G 2PBRA 4W4TA 5J9FA 5T3YA 3ROTA 3EW7A 5H3CA 4AKEA 2V54A 1SA0A 5A1JA 5KQLA 4BO0A 3FVWA 2VYVD 4FK8A 4EI7A 3IP8A 3HDJA 1V4VA 1H1TA 1EP9A 1ZD5A 4UBNA 5JHHB 1IPHA 1LQTA 1KVRA 4GM0A 4JFRA 3TQQA 1JLHA 3N0VA 2WFAA 3I5XA 2IEGA 5B36A 1CUUA 5B57C 2J6CA 4KK3A 1PWXA 2V59A 3O0DA 3RFVA 3ZW7A 2V6BA 3IKVA 4X61A 4D3FA 1BC5A 3DBRB 4ZMRA 4ZDKA 4ZAZA 2FH5B 4NMLA 1KY5A 1VG8A 2J9FB 3DTVD 4IQ4A 5J43A 2VDPB 3FOCA 1Q6ZA 2ATXA 3MCZA 3HZOA 4H31A 3KQYA 2WYRA 1YJXA 3ZY3A 1PT5A 1TAQA 3NUGA 1D4AA 1QK3A 5DKFA 4CT0A 2PQ0A 4ALKA 3GLFB 2GBLA 3D4NA 2YWFA 5ALHA 2ZZKA 3DCYA 3M89A 3RRJA 1Z7BA 2XB8A 3F9RA 3K1TA 1TJNA 1DEOA 3E4DA 1EP2B 4MO2A 3VSDA 4B76A 5BNZA 4JI5B 1T0HB 2ONYA 2C9CA 2JKZA 3PUKA 4HPXB 1M76A 4MS4A 3VKGA 2DBQA 5K4HA 5LUAA 1TO6A 4RO0A 5C51B 2D3WA 2NVOA 4R3UC 1HPLA 4XIFA 3A4TA 2YJ4A 4IX1A 2E21A 1V5IA 1EUCA 5JD5A 4LFAB 3BK7A 3KT8A 4MJLA 1LI7A 1JPUA 3H0KA 4D9IA 5C1PA 1QMGA 1IZ9A 3N07A 1RKXA 1T8TA 1GXSA 3JQDA 1OHHD 4EBBA 1NMYA 3KWJA 2OZLB 5CFMA 2DTXA 4LRQA 2J09A 3FMPB 4KAAA 4KO1S 1FNBA 1EHYA 3KYJB 5K6RA 4E0FA 2NNLD 2QXYA 3VTZA 3GLIE 2QNIA 4R81A 1SKBA 1CF9A 2ZBQA 4RPIA 2DMRA 3MLAA 4TMFA 3DT9A 4U2CA 4RPGA 4XVRA 5IAJA 4Q7KA 5EGSA 4ILEA 1D6JA 5BR1A 5J35A 1NKSA 1T8YA 3TTWA 5BW8A 1DP4A 2JGDA 4IDEA 4BLRA 4GH5A 1NWHA 1M73E 1RZUA 3INNA 1ENZA 3M1IA 2WUFA 3RSFA 1P5RA 4CKWB 5JY1A 4C7OA 3J80A 3ASTA 1Z75A 2N3ZA 3REGA 2ZTGA 4GOOD 4I4TF 5E3IA 1Z5VA 2DXIA 1TFUA 5HZBA 5C8YF 1TLLA 1S1MA 1T8RA 3R6DA 4MP8A 2IH5A 3Q15C 3Q3AA 4US0R 3A1UA 4J0GA 3VR6A 2QJOA 2XUKA 4IJVA 4YJ3B 3MXOA 4TPKA 4DW8A 1XTTA 3TPFA 1JR4A 2ODNA 4AF6A 1MA0A 9ABPA 1RXCA 1PD1A 1DKPA 2JGAA 5DMHA 3KQMA 2QMYA 3R4CA 3U81A 5CVTA 1U5AA 2WG0A 1F60A 1E7RA 3NKLA 1JEDA 2R1VA 4Q3AA 4DMFA 4L78A 5KX5A 1VJ5A 2XNDA 1MFZA 1WMDA 3PHIA 5T7BA 1S72B 1E61A 1B0ZA 2BRUC 3BHJA 3OZVA 5BYKA 5B7GA 2CXTA 1WBBA 3T9CA 2WZNA 4G6IA 1THTA 3OFSA 3VYSB 1NHWA 1U8YA 5KKAA 4YCAA 3KHUA 5CR9A 3SHQA 4EKGA 5FWAA 1ZIXA 3HDYA 2CUKA 4ZVRA 1ZM7A 5GOTA 4MUNA 4A2WA 3QKSA 2XUAA 1LFAA 2QZSA 1E2DA 2RHCA 4GR4A 4M76B 3QKWA 3UT5B 1KPIA 2FZGA 2OP1A 3ZCPA 3DKRA 5MN6A 4KMOA 4MPTA 1JWBB 2VK4A 4K2AA 2Q5FA 3A8IA 2GPJA 4CHTA 3AL3A 4DV2B 4NCNA 4D9BA 4KX3A 1I4WA 5HZKA 3RANA 4OH7A 1DCKA 2WPDD 1HG0A 2AZ4A 3GXOA 3I9JA 2NV0A 1FUYB 2C95A 4JJGA 1TVKA 2J6IA 4F6RA 1I24A 2FJUA 1IZZA 3TWOA 5CB4F 4BNLA 5EWLB 5ED0A 3JTEA 4U2FA 3AG5A 1TKRA 1U31A 4J1TA 4WJZA 1N6LA 3A06A 4DIOA 2BKXA 4DJEC 4PPFA 3QJ5A 1NLZA 2CE7A 4ZT7A 3CN9A 5IJXA 3CPJB 3SS8A 1L5KA 2X0KA 4X7FA 1NRJB 1G64A 1QIJA 3FTNA 5BW6B 4FZJA 5IANA 1WEKA 4PBRA 3K9QO 4A23A 1Z6AA 1YMVA 1WNTA 1K5HA 2XTAA 3EVFA 3CWQA 4FU0A 4HAOA 4J6EA 4MKFA 1PLLA 1IQPA 2VCHA 3CH5A 4IICA 5JAIA 3LUKA 1E3WB 1NF3A 1NKTA 3C3JA 4ZV7A 5IDXA 4I81A 4AYTA 1K4YA 4UD2A 1Y5RA 1FQKA 4ITVA 5ILQA 3KKLA 1RM0A 5B3JA 3UJCA 4BAUA 2PL9A 1VBNA 5LCXA 1NG9A 1QO0D 3FHTA 4QREA 4I50F 1MU0A 4KH1A 4PGAA 3UWKA 3CUYA 1F4VA 2G5TA 3PIDA 3B52X 3O1JC 4IS2A 4RDKA 2PKRA 5BN5B 3M33A 3P71T 3IR6A 5DSXA 2C82A 3LRTA 1H2XA 3GRVA 1SHUX 3RS7A 1X42A 5HK8A 2ZJBA 5JQGB 3G5AA 4KIUA 4QUIA 5ISMA 2POCA 1IN4A 4IZ6A 1MJGM 3TYXA 1O6CA 2J0VA 4BLOA 3KSZO 5IW8A 2BR4A 3P0IA 5T57A 3DGEC 2OMKA 1G5IA 5BSXA 1XEWX 2PIDA 2IPLA 1TTPB 3ZDEA 4DV0B 3R9XB 3QLVC 4RDIA 2QVBA 2RB4A 3M6UA 4Y2QA 1JKXA 5A7GA 3N3BC 4QPDA 4TS4A 1TF5A 5ALEA 4AP9A 1IMOA 4X8HA 3S5UA 3HBLA 4FTWA 4D8VA 4CKCA 1EVEA 5BO5A 5IEJA 4QD3A 2Y2UA 4DWJA 1G8AA 2WKPA 2YWBA 3L8CA 1YS9A 2JGJA 4XQCA 1QM5A 1VCNA 2QX9A 3K5HA 3RVNA 2BTQB 3CZPA 3T1TA 3GOHA 4AY4A 1YZTA 4QPCA 2CVHA 1QAOA 3GLIA 1N07A 1WUYA 1JFSA 1RWWA 1YRHA 5CUQA 2P2GA 2ETVA 2A3NA 1WOOA 3OQ6A 4KKVA 4CEHA 4PZUA 2WICA 2NUPB 4RTKA 5IYNA 1DRKA 2BSAA 1YI8A 2BJVA 3PCXA 4HDSA 1J8DA 2GEFA 5JE8A 3TTYA 4B6SA 5EIFA 4F71A 4FT4A 3IIEA 4CQMD 1ABBA 4EG1A 3DE0X 1CWUA 1LTKA 1E1RA 2QU7A 2VRCD 3LYAA 4X6YA 3ZZTA 1V5VA 2NTEA 2YXEA 3CH4B 3LXXA 2C5BA 1G6OA 4NZPA 3LCVB 4DDUA 3RTEA 1W0CA 1QV7A 2B7CA 3VKUA 5H8WA 2YWHA 4R9VA 1XL1A 1OH8A 3PRHA 2CMFA 2XAUA 2PUVA 3FSEA 5DI3B 3NAMA 3CNHA 4Z4VA 1O89A 3U80A 1LLUA 3HSSA 5LBUA 2GQ0A 3L41A 4WZBB 3MYYA 2GEDA 1E0JA 3ZVKA 3E6AA 3GLKA 2O5EA 3Q38A 1ETUA 2ZRLA 4BPRA 3JRWA 2Q9BA 4H3KB 4OM7A 3UOAB 2YJ5A 4KQXA 1K7FB 3T3EA 1AQIA 3AY3A 1KERA 5KQGA 2ZCJA 4MVJP 5KNLA 3CUWA 3FRHA 2PZGA 5EE5B 3A6PC 2CVFA 4LQLA 2W70A 3LPCA 1RAGA 4CM9D 4UTZA 1QF6A 2FXIA 3BJIC 4NCHA 4QU5A 2Z1NA 1QUFA 1GNLA 3QPWA 4WZZA 4E3ZA 1TM3E 1PR3A 3IUEA 5B58T 1K8XB 1V45E 2ZQZA 3V4RA 1SCUB 3RLFA 1R12A 3G49A 3NUZA 2P5YA 1GNTA 3EZXA 2JH3A 3JYPA 4R01A 3TL6A 5EHZA 3IBGA 2HRDA 3IRVA 4XSGA 3T38A 2HA5A 1SG6A 3OC6A 3ND9A 4XVUA 4QVIA 2ESRA 2PZFA 3GFSA 1LNQA 1OI7A 1DJQA 1VHDA 2HIHA 3T7AA 4WASA 3NQ41 1G6KA 2YWCA 3RASA 2BISA 5JXHA 2VF7A 1V11A 1Z4IA 4J49A 3O2QB 3SSNA 3AEXA 2YVUA 4RX1A 1L5YA 3WGOA 5KTRA 2I3DA 4H7HA 2MINA 4TKVB 1RBMA 1UPXA 4FC6A 4C5BA 2XUOA 2BV3A 1YB6A 4RULA 1SEPA 2EJBA 3VPDA 3ABSB 1NR7A 1VSQA 2WK1A 3F71A 5HS4A 5AKZA 3RJ9A 3TIXB 5ALZA 4H7FA 1U5BA 3DLIA 3A27A 4N01A 2EFEB 3SS9X 1TCCA 3QEJA 4M9CA 3R5TA 3HXTA 3O8CA 1H2BA 2WD7A 4L3OA 1NMXA 3V1KA 3OP1A 1E0SA 1N3BA 4ND1A 5TQVA 1YR1A 2VJMB 4IQ8A 5I9LA 3SHTA 4DUPA 7AT1A 2VPPA 4GO1A 3THOA 4R16A 1R6XA 3RNOA 1QK5A 2GBLC 4RADA 1A2QA 2SCUB 1W93A 2UUOA 4ZT6A 2G1KA 2QD4A 5AHWA 3UPTA 3I62A 3OHPA 2TMGA 4HQKA 4AB1A 5JROA 2ZETA 5A4JA 5FP0A 3O82A 3GC6A 3L6OO 4IGKA 2PFSA 2R8RA 5G0VA 4HL6A 1GADO 1KSJA 2GPTA 1A71A 1LTHR 2OO7A 4JGGA 3AHCA 1LD3A 2IODA 3URMA 4PZLA 3G0IA 3T54A 1F48A 4CMAA 3DW3X 2RE8A 3VOTA 2G0NA 1KZGB 3OLVA 4ZMSA 1Z33A 2QX8A 1NSYA 3S1AA 5TIIA 1OLUA 3UWOA 4OY3A 3T5MA 4EKDA 3TFOA 3KETA 3K3PA 4U7WA 4CQMB 3M4XA 1ZGHA 1W8DA 3ZV6A 2VK1A 3WK8A 5K3EA 1ZVMA 4LXQA 3H2ZA 3HAGA 4LJ4A 4V3BA 3L4JA 1EHCA 5IN5A 4A1FA 3ERCA 4WOJA 3TDMA 4UVEA 3JATB 4Q9NA 3PUJA 3V4ZA 1YCHA 3GJ7A 3K9NA 1LNSA 1X14A 4XYLA 5KNDA 4CGZA 2VUSA 3BMNA 2YVQA 3Q11A 3R24A 1B1CA 2P27A 4IPTA 1XZKA 4QO8A 2YHIB 1UDCA 5I7FA 5F2KA 4OJYA 1V16A 2O2EA 2BD0A 1ISGA 2Q8NA 5A5VA 4JOQA 3BF7A 3DM9B 3ZOZA 1USVA 4BLPA 5GONF 3U4MA 4N47A 3OWOA 1ZHOA 2W2XA 2Q5CA 3KZ1E 4N3CA 5TARA 3WNQA 3HGTA 2WHEA 2X53S 3DZDA 1DBRA 4N4AA 1L1RA 4P1VA 1P7ZA 3MEQA 4EYGA 4IZHA 1ODSA 5HPYB 1E2EA 4G4GA 3RS4A 2JFUA 4FZVA 2PSEA 1EFDN 5BN4A 2ZI9A 1RACA 2AYZA 1PJ3A 1D03A 2MDTA 1GU7A 4U9IS 1XFDA 3CO0S 3CW2A 1FB5A 1C4KA 2GF0A 3A1CA 3T94A 5LDHA 2C07A 2J7PA 3L04A 2JLYA 3LZDA 3ZCRA 4DT1B 4HUQB 1XQWA 2I87A 1GQRA 2HB6A 1T9GR 1NVAA 3KVRA 3LRXA 4AKGA 1QHEA 1J00A 5FADA 3ZX5A 1BQ4A 1PW7A 3K0CC 3OQ1A 4AECA 4PX5A 1G9XA 3ISVA 1E9SA 2Z8XA 3NTQA 4OHPA 4MWTA 2GAOA 5JNWA 1V1RB 3GRPA 4NBNA 2C0PA 1Q19A 1VE5A 1HR0B 4KAFA 4HMPA 2O3TA 3DZ8A 2G6BA 1K3TA 2WUDA 1SZCA 3D3EA 2WD9A 3LRPA 4IXNA 4RVGA 3AC0A 2FPOA 3D59A 3TS1A 3WGLA 4NJEB 1VBKA 3JQ7A 3NHJA 5HOEA 3H5AA 4QDTA 1MN6A 1QX3A 4CMHA 2H2WA 3IB6A 1S1CA 4YCBA 2C7OA 1A95A 1W29A 4EYOA 1CUVA 1JG2A 3W6ZA 4ZVKA 3D26A 1IBSA 2HCJB 4DJTA 3AF0A 3QVMA 3UGQA 3W6UA 4PWZA 5IM4F 3KVOA 3C3BA 2OUKA 3QLEA 4IX9A 4O2BB 3KPWA 13PKA 4NABA 4BWYA 4FB5A 1UFVA 4X85A 1CKEA 2Y66A 4LG1A 4I46A 4JC8A 4FI3F 3OSZA 4MI6A 2EYQA 3USZA 3C3EA 3W2EA 4ADSG 1AF7A 2FEKA 3LPDA 2XYPA 4OOVA 4J1TC 3IE2A 2NV4A 2IZ7A 5ES4B 4EA7A 2JAUA 3JVEA 2ORVA 1GKUB 4QRIA 4RHUA 1JIQA 1K92A 1K9VF 1NI4A 1B0UA 3DG9A 3NASA 2JHFA 2EGHA 3PGKA 1EG7A 1T34A 2AE2A 4M9UA 4NONA 3UHPA 1NW5A 1TUBB 1ORRA 4B6QA 4EHHA 1EWQA 3ANTA 3EC7A 1QVVA 4UQLA 1Z6GA 1GGKA 1HOTA 1ZSNA 2I4NA 2FETA 1KJQA 5JMTA 1N6OA 2YFQA 4PC3A 2W2PA 4C21A 2NXNA 3RBVA 4RFLA 2GCIA 2ATIA 5EJ9A 5J4VA 1EVJA 5JYBA 1ECFA 4F2WA 1UKAA 4B83A 3GPDG 2NV6A 1IUKA 2WLSA 2ZWOA 3ZC3A 5TMDA 2RH4A 4JP3A 4N3AA 1VRWA 4EL0A 1KZ1A 4ENRA 4HEJA 4KPUA 5K4AA 5JC8A 1KEKA 1E3LA 1HRDA 3HWWA 4ZT2A 4E5VA 1KIAA 4CQLB 4RLSA 1N4DA 3PNLA 1B26A 1UBTS 4REQA 2J07A 5IVIA 4YB8A 3I61A 1RLJA 1SAYA 4WBNA 4ZT5A 1YJNB 1XHEA 1CUAA 1H93A 2WJVA 4DV5B 4C6HA 5A88A 1W4LA 1UXOA 3GG2A 3AGQA 4LZOA 5KYGA 1U1EA 2BONA 2R8PA 4OL9A 3VX4A 1AZLA 1Z2EA 5TXGA 3LSTA 1MGOA 3TSZA 3BJEA 3EPHA 4OFZA 4JN6B 3ICEA 1PHPA 4NFSA 4JNCA 2FMHA 2J59A 3OZFA 2MHCA 3A1EA 4OJKA 1T15A 3E8XA 5CYFA 3F6CA 4IHQA 4MR8B 2B5WA 3WJ2A 2H1RA 3HS3A 4CT4B 4JP8A 2YWGA 5F5LA 3WL3A 2IYFA 3UAOA 3PFKA 5D85A 3ZIDA 1WOMA 1WZ2A 1CU1A 3QV1A 3FTQA 4MJXA 4PANA 1LV7A 1TT5A 2ZB4A 2OFFA 1LRJA 2IYYA 3TIVA 4PRYA 4AP6A 4C0WA 2AA3A 2PX4A 4O4JA 4RGBA 5B4UA 3I9KA 2IHJA 2FPKA 1HH4A 2UDPA 1WW2A 2VTKA 1C7QA 5CM8B 4F9GA 3MUFA 1ZDMA 1DC4A 1ZOIA 3PTZA 3QYAA 4JBWA 1X39A 1R00A 1T9CA 4OQQA 3ZWOA 4WOCA 2GBIA 1R4MB 2H5IA 2WHPA 1GARA 3GT7A 1S8OA 3FHCB 4NCIA 5G0UA 4B3DA 1GZUA 4NQRA 3LCJA 4RY2A 4AMZA 2XOKA 2WA1A 2ECFA 3BIWA 4HNGA 4O3FA 2PPLA 5KYVA 3UAWA 1KORA 1I2ZA 3V32A 3O5AA 1QIKA 2C4KA 2QL6A 4CLOB 1ENPA 2DFLA 3CLKA 1MNAA 4N54A 4ABTA 3QFTA 3UUFA 3U1BA 2W6NA 5J3OA 1VHLA 5J1SB 1RRMA 1OWNA 1WBJB 3KOOA 1X1AA 3ODGA 1B23P 2JCYA 3N8IA 4NYJR 5CCDA 4B3FX 3RS0A 4DA0A 3DVLA 5BSVA 1JSLA 5HILA 1ADBA 5E95A 2PXXA 1A5AB 3ASQA 2AX4A 4WEOA 3VNRA 5KSYA 2IEYA 4D26A 2O2IA 3DFMA 2BDUA 2R3SA 4MW5A 2O7VA 1ABEA 1AUVA 1RQNA 2JGKA 1TA9A 4NS1A 4DLPA 1NN1A 1R8XA 4RZUA 1D2MA 1SURA 3S7ZA 2WWHA 4KQ9A 1WLSA 5CDUA 2IF2A 2EYUA 2UZ1A 4XX0A 4FDUA 5G4KB 3RFCA 3A4MA 1MAWA 1GN9A 2F90A 5D6NA 4BRUA 2PLNA 3IV6A 2H4JA 4ZAVA 3AUSA 3WWEA 1L5OA 3FWYA 3TQIA 4YCCA 2EZ4A 2WSMA 3EGEA 2ZWPA 3I04M 3CCFA 1LGYA 2G28A 3JRNA 3N0WA 1RYFA 4NE2A 1Y3BE 1JJ2B 4QC2A 2NXCA 1Y7PA 2YV4A 1OKKD 2MSKA 3UJ6A 1XD8A 1EX1A 2I7DA 1BXZA 2W6ID 3AM4A 4TLMB 3TG8A 1WW3A 1KO8A 4G1CA 5LL6P 1D5WA 5EN4A 4B33A 4C2UA 2XF2A 3BMQB 4DIFA 1J1ZA 1MHPA 2I1LA 2XEXA 2C5EA 2JAOA 4IJQA 4LNUA 1QH8B 1JQKA 1M83A 1VSUA 1J2JA 1JR3D 1JHRA 1U0NA 2POQX 2XTJA 1HUQA 1XROA 3R5FA 4N5NA 1XE3A 3U3MA 2CMDA 2HHJA 1AC5A 1ZP6A 2VDMB 1B93A 4HWSA 4EYQA 2J0QA 2BSXA 4FFMA 3KJQA 4HBGA 1GZHB 2CJXA 3C41J 1SZDA 2ZSDA 2ZBFA 2R4UA 3CRMA 4GPAA 2HWYA 5HOQA 5KQPA 2Y6VA 2QY9A 4WKCA 3GARA 5F5NA 1JYSA 3GLFA 4YVFA 3AEQB 1E9EA 3AH8A 1U7WA 3IB3A 4LCEA 4OQEA 5T4BA 2Z4RA 2NP7A 3MJVA 1E6MA 2WVJA 1EFVA 1F5SA 4OQ4A 4BMCA 1P39A 3KHTA 4ZXPA 2OWEA 1G6Q1 1RYYA 3ECCA 4NY1A 3SK0A 1FFXA 1CJTC 3WJAA 3L4KA 3ZHBA 3IJRA 1DNPA 2PVSA 2YJ3A 1UPBA 3NHSA 3PUNA 1K3UB 3CX8A 1EIZA 4FCCA 1QB8A 2O1EA 1T2CA 3FSJX 3MS2A 1IVNA 1K1EA 4DOMA 3KX2A 2C58A 3OFVA 4P3IA 1I1NA 4V03A 6GPBA 3NJ4A 4QOSA 1TZKA 4PN7A 1IBLB 2OKGA 3AYXB 4L02A 1Y0BA 1C9KA 3DLPX 2B3TA 3MTGA 5C5DA 2GXSA 2RGCA 2BCGY 3GNTA 3WXBA 2IYPA 5A9TA 4FZ5A 3ZZMA 2B6NA 4NV1A 3VR3A 3GUUA 3TE7A 3CVVA 2PRIA 4YY3B 2EFGA 1UMDB 1VKRA 4QA9A 2WQZA 3GD5A 3K5WA 3X1WA 5JLJA 4X45A 3DQQA 4CFZA 4BCCA 3B60A 3KEOA 5CX1A 4CI0B 1YQGA 3UNXA 4WMLA 4BVJA 1ZICA 3N2IA 2HXSA 1EWTA 3IAM6 3TOZA 2AN1A 4EG5A 1G21E 2W71A 3MN1A 3OM9A 1D4FA 1YVUA 4PINA 5IUNC 2CBXA 2APJA 2J48A 2QP9X 1EGAA 1VI5A 1YVDA 2PLWA 3KJIA 1EGHA 1YZYA 2FA9A 4L4RA 5FLEX 3ISTA 3CXRA 1YHNA 5G53C 3CPWB 4YJ3A 3I5UA 4M89A 4HQRA 1Z8NA 5EAIA 4NEQA 1CJSA 1L5RA 5HM8A 4NG4A 4YJ2A 2X5JO 5H83A 3ZU4A 1NJSA 2HSEA 2QXTA 3H9EO 1VPEA 5LOVB 2ZJ4A 3USES 1NB0A 4ZREA 3UYLA 1H0HA 2WZQA 2I1VB 5EE0A 2HF9A 3HA3A 5C4MA 2YMPA 4MVJE 4RDLA 4K6CA 4B45A 5CDGA 3RC8A 1WCIA 3JS5A 4LV6A 2BMVA 4XR9A 1T8UA 3VU3A 1IL0A 3VQTA 2F3UA 3LOUA 2W6QA 3NANA 1P62B 2IEZA 2PNFA 2OXRA 4TMYA 4KQIA 4DMGA 1DEAA 2NZJA 2O07A 4JNKA 4AJ4A 4I9HA 4TMVA 2W4IA 4MYUA 3AO0B 4JT8A 4PCUA 5DLYA 3MYRA 2JCVA 2JK1A 4MW6A 3UT5A 1G8KA 1LFDB 2PUHA 4X8OA 2NUTA 5I7UA 1NXQA 2XB9A 1SXQA 2VNAA 1WD7A 3E15A 3QVGB 3A10A 4L8FA 2JFNA 4NLLA 3RFXA 1EP3B 2VZ8A 1BA2A 1X1QA 3AQ4A 1P6UA 1LSUA 1SD1A 1NE2A 2H8GA 2Q28A 3RF6A 2EDAA 4L4UA 3EIQA 5UKDA 1SCBA 2PX5A 3D8UA 2XCUA 3L7JA 3E1KA 3VR6D 2OP0A 2IDMA 3SVTA 2HV9A 2FEXA 2ZIEA 1XEFA 2YWJA 2V4ZA 3D7SA 3F46A 1DTWA 2MSLA 4PRLA 1E94E 1NWCA 2VF4X 2Y1FA 4IKEA 1NQVA 3FIJA 3OJOA 2XPCA 4LXHA 5G02A 4C7KA 1AM4D 2XNDD 4G0XA 1DFGA 2NAPA 5BWBA 2AK2A 3IOBA 2EBHX 2OGUA 1JX6A 2AYXA 2I1WA 2JBAB 4IDFA 3QVTA 4J0CA 4BFZA 4DNTB 1RLUA 4FFNA 4OHRA 3S2IA 3DD5A 1FLAA 3NRCA 3DNFA 1RM3A 1KPHA 3DDYA 3E1YE 3KUXA 1I94B 3PI6A 2HN9A 3PFWO 3VSAA 3RGGA 1KRWA 2F1RA 4YAKA 1NXTA 1CW2B 4W5JA 2J9XB 1GILA 2GLTA 3OQJA 1CP2A 1XNHA 3Q0TA 4KFRA 4XASA 2NU8B 4LHYA 5KQMA 1PWEA 9LDTA 1CPYA 1WULS 2CD7A 3O9MA 4HWRA 3WV4A 4DDWA 1EUYA 1AKWA 2FOIA 4P7GA 3VZBA 3JQAB 4C1BA 5IBCA 2CZCA 4B8WA 1QOPB 4A1OA 1Y9JA 4NXNB 2GHTA 4JC5A 1WABA 4M0DA 1TL7C 4IXMA 3VR2A 3PLAE 1FFHA 1LBHA 3N0XA 5K99A 4O0LA 4Y6LA 4RLQA 1G18A 2EWVA 2D06A 5E38A 3MM4A 1XC7A 4QUEA 1M8PA 1D2RA 1VG1A 2J4DA 1NU8A 1Y7HA 3I45A 2YOHA 1UWLA 2EP8A 3MIIA 4RBNA 3TRFA 3SSOA 3H94A 4EELA 3I83A 3PTLA 4BMZA 3M34A 4KW7A 3WLFA 2JJ1A 4MH0R 1IYZA 16PKA 3NFYA 4HXEB 3BUSA 2FSVA 2QN3A 4ZCLA 2ZB3A 4AY6A 1YKGA 3G6EB 3KOZA 3AUJB 1H0SA 5A05A 3VPAA 2WF9A 4U0KA 4ARIA 4RELA 3QITA 1N06A 1ISIA 1YZ3A 1BX1A 4TV8B 5DGIA 1FL9A 1CJBA 3QMMA 2ZBRA 5E0OA 1SUCA 1Y6GA 5AN9A 1H6CA 1PR1A 2O3JA 2ZB8A 1N5LA 4RGVA 1D3AA 4DCUA 3HCPA 3FUXA 1N2OA 3BAFA 5H02A 2M6RA 3FFWA 1ADJA 3LT2A 1NJ1A 3WRVA 3CINA 1KKUA 1VPDA 3E7PA 5SV2A 4AU1A 1FCJA 5AK5A 4DAOA 2AMJA 2WIBA 4PVCA 4JL6A 4PXAA 1GQOA 1G21A 1WX1A 3SJPA 4XUDA 4DB2A 4K9OA 2Q5QA 2C04A 1EE9A 3ET4A 3HCCA 1QZXA 3QEKA 1SNYA 4FMDF 1XTBA 5EJGA 3GT0A 2QLJA 4PF1A 2D1QA 4HEHA 2X2EA 6Q21A 1M54A 3NPMA 4MIKA 2IGTA 5ALRA 3HVHA 2BFBB 3T3OA 2WMOB 3QE0A 3BE4A 3QRWA 4WDQA 4RIHA 5G0TA 3MTJA 3HCBA 5FUQA 1QYXA 3IBSA 4Z4WA 1Y42X 4S05A 4B47A 4J1QA 2RI0A 2WR8A 1SZPA 3FWKA 3GMIA 3CRZA 1XTKA 2NSYA 2YV3A 3H3JA 4FHEA 5SY9A 2IYNA 3EN0A 4LJ8A 3F6SA 3LUJA 1T6NA 4EA6A 3T12A 5JH7B 4BKQA 1Q1GA 2GOYA 4MVJA 4BV9A 2GZ2A 1P7CA 3WB1A 3S55A 2JLAA 4JROA 1ZK4A 2GM9A 4G0NA 2R2AA 3HCFA 5KMGB 2HPVA 3Q41A 3T1NA 4U3JA 1BWQA 2JGMA 1OFUX 5BSYA 2H52A 1NUAA 3FUWA 2UUBB 3HU5A 3DDNA 3KQSA 1KOLA 3VTKA 1JHQA 5LP6B 2LVBA 1HFEL 1D5CA 1VLMA 3DT8A 1Y0YA 1DQNA 1VGVA 2HYDA 3NYRA 1E1RD 4LGVA 4LMBA 4QFBA 3WMRA 4RV9A 3W7VA 5A62A 2D0DA 3GVKA 1G17A 4YLEA 1ZRNA 4L2IB 1IWOA 3WIBA 3GJ5A 4IHJA 1FLDA 1NQTA 1E2MA 1EUDB 3IUSA 2O2ZA 1M2VA 3IUMA 3LK7A 4FKZA 1QNLA 4M8SA 4OKNA 3EK2A 1L5HA 5C81A 4YXWA 2AFIB 2AK3A 3NHKA 3ND7A 3VGPA 4NTZA 5MGNA 5HCNA 3HDVA 4XFKA 5L3QB 1II8A 2XBMA 3SYLA 4ZYZA 2O8FB 3D2LA 2GBCA 2PWBA 2ON6A 3K0AB 1Z0KA 2ZAYA 3O84A 2FP3A 3KUCA 3ZHOA 2XLCA 4C87A 1WQ1R 1VCIA 2WLTA 4P4UA 2P0AA 3OW7A 2CSUA 3NFRA 1H5NA 4G4IA 2PBLA 4KO3S 2C3UA 1I8DA 1P7WA 2X0DA 5FLKA 4TZ6A 1WXXA 1WSAA 2I8CA 1FP4A 2J1LA 4QEDA 1YF3A 1UPFA 1E1CB 2NUAA 3G0OA 4FFWA 2AHOA 4HX2A 3KAPA 3HXOA 4R2IA 2VBUA 4HGZA 3LNNA 4GSLA 1KC1A 3PDIA 1X8LA 2M32A 3KB2A 3QOWA 5EE9A 2DRIA 4A0RA 3WGVA 4W1QA 3EDRA 3BHIA 4PHTA 2EERA 4LA4A 3U62A 4C4YA 1F14A 2VF2A 2G9ZA 1OIWA 4G4JA 4P92A 3ASSA 4Z4GA 3WNDA 2Q45A 3T52A 4JVNA 2QQEA 5HCUA 1R6VA 4GSKA 3ET5A 1GQ2A 3SR0A 1PKXA 2DYIA 1UXGA 3E0QA 1KMMA 1PBNA 3MUEA 4UDYX 4N5HX 3GP8A 4FT2A 4PAQA 5JJCA 4BX3A 2WKQA 2GRUA 3EWIA 1ZMTA 3IEUA 4QT0A 1HMPA 1XA3A 3GGSA 3ZCQA 1CRQA 1W59A 3D31A 1H94A 1VHTA 4PSVA 3KB1A 3HP1A 5BSTA 5EWJB 4DNQA 3CJRA 1QU3A 3FGZA 1UMBB 1RAAA 3CUUA 2DCUA 3QNWA 4IIGA 4NKRA 4ZVQA 1TKCA 2UUPA 1QIGA 3QXJA 4Q1AA 4CR6A 1JDVA 2H9AA 4BNJA 4HAYA 1T4DA 1DC3A 1N0UA 2AJTA 3C5VA 2OCGA 2PU5A 3M81A 5U4QA 3B1JA 2Z2ZA 3DHVA 3OTHA 2HA4A 4LOLA 1G6HA 1G41A 5FWXA 3WQHA 5K6AA 2O50A 1Z8FA 4D2IA 4FFOA 4K7JA 3EPRA 3PQCA 1OXKB 2PZJA 3H4IA 3P2OA 3FCCA 4LHSA 1L1EA 5LKAA 1KZ4A 3W6OA 3U7GA 2XRZA 2H9IA 2X8LA 5LJIA 2D4AA 4OK5A 2CDBA 2V7GA 4B3HA 2O2YA 4HQFA 1X1DA 2QM7A 3L1UA 2D4HA 1K3FA 3L79A 4KQEA 2DHDA 2VAWA 1IK4A 4KE7A 1WOPA 4OXKA 3IKMB 3SYNA 1ZD4A 2JIZA 1GAXA 4GXRA 4DT1A 1FZQA 4UVDA 2CYBA 1S2IA 3EQ2A 5IXJA 3DOFA 3DTTA 2VSQA 1WSWA 3EGDB 1ID1A 4JJ7A 4Y6OA 2WOOA 1C3LA 2YASA 4GRAA 3ILSA 2YJGA 4UCFA 1EZ1A 2N47A 4RM2A 5KNDD 4IEEA 5ECDA 5K8LA 1EGQA 1KU0A 2P30A 1AX9A 2V0CA 3BD7A 3HYCA 3CCQB 4O29A 4HYQA 4LE0A 2ZVQX 4LVUA 2M9MA 3B12A 4UMEA 1LBQA 5AUQA 4EPYA 4F4HA 4OEHA 4UU8A 1GLVA 1SQ6A 4N1AA 3PUWA 4N65A 3B53X 5HQJA 1GJRA 1L5QA 2GESA 3FCYA 2QJWA 2FUNB 2Y0PA 2C7QA 4JD5A 4RAQA 3DLHA 1TJPB 1KJ9A 1VHJA 2C5LA 4FE3A 1JIIA 1JU3A 3DQZA 1M9NA 1ODKA 2P41A 2XZLA 5FOSA 2NTYC 5GJCA 4CNBA 3HUFA 4J0QA 1CQXA 3P26A 1VLHA 3EGVA 4K0KB 4ZYUA 4MVWA 2P9JA 4UHBA 3M8KA 4J7XA 1GWNA 4L74A 4WINA 3RIYA 1ZN7A 3NRBA 5L3ZA 5TSDA 3A3PA 3TAUA 5AM3A 5CLFA 4KAXA 1CUIA 2P5SA 1KIMA 2J7PD 3QKUA 1S9HA 2IZOA 4TQ9A 5HS6A 2X5KO 3HN6A 1S9DA 5BUQA 5HM6A 1YGPA 5CA0B 3ORHA 1IEXA 3RUAA 3FDXA 1TTQB 1VJ1A 4DA8A 5IYZA 1G0NA 4LWQA 4HDOB 1YUNA 4HTFB 2ZIUB 3RS3A 3BEDA 4RACA 2PJUA 3ZJTA 3FYUA 2AG1A 3ITDA 4BO1A 1CUZA 3DDZX 5AVJA 3W9UA 1UEIA 4F46A 2V4DA 1SXJE 4FYHA 2C83A 3VOSA 3G2HA 4DC0A 1Z38A 3GOQA 2CDCA 4M6WA 4E5PA 2H4YA 4MJ3A 4R2LA 5TVGA 1P1FA 1XTUA 4EHLA 3S8YA 1MHTA 3DO8A 4OQPA 3RYFB 1SKUA 4Q3OA 3TG2A 2EW1A 2TS1A 1GCAA 3ESDA 1PL0A 1D0SA 1I1QB 3Q2IA 4DPLA 2VXYA 4NDNE 1KEWA 1VQ8B 1XLTA 1OE0A 4L27A 4RVDA 3WHKA 4UM5A 4IV5A 1F12A 4G0YA 1WU8A 1SM4A 1A77A 1E2UA 4OYYA 4W1RA 1UFRA 1XKTA 2PY6A 3IILA 5CG2A 2BLLA 5FWYA 1ISMA 4B48A 4YRDA 4ALMA 2HHCA 3N8GA 1NDHA 1AGRA 1DAPA 3IX7A 2QUKA 1SQ0A 4Z4TA 5DLDA 2KX7A 3B1WA 4Q01A 121PA 1TLTA 5KWSA 3RSCA 4D9EA 1GNVA 4HB3A 1KEEA 3T3DA 1X74A 3R3VA 2FSVC 4M1MA 3HKBB 2R7LA 3PD0A 1W35A 1C4XA 4BMVA 4L4YA 4LKOA 3MZ0A 3MGCA 3MQ4A 4MQLA 1L4YA 2OT3B 1T1JA 2MSEB 1GKLA 3EXFA 3G2MA 3LL7A 3O4JA 4IWYA 4V0SA 5K8VA 5L95A 3KSDO 2HPAA 1NBME 2Z1DA 2AMYA 3PNQA 2B8WA 3K16A 4YBZA 5HDQA 1RNLA 3IP7A 4UNNA 3WK5A 1EJ6A 2CNDA 4BWFB 8ABPA 5IN4A 3EX7C 2ZS9A 3KYBA 2QEXB 2NSLA 3KBBA 3LC0A 4L07A 2ACEA 5TF0A 3CEPB 4M1TA 4RF5A 1CDEA 2V55B 4BKUA 3HUDA 5AW1A 2ZYAA 1MT0A 1MAAA 2GN9A 1PYGA 2JC3A 1HL3A 1UP7A 2PZMA 3CBGA 5F5XA 3SP1A 3WFZA 2YY6A 2DUMA 4IRXA 3NXKA 3D3KA 4YAUA 2NV2B 3PJGA 3LZ6A 1AO3A 1I33A 2WJHA 2X40A 1GNPA 1AZWA 1JRLA 2VLBA 4ZA2A 4KRFA 1GGEA 3UMFA 2PSDA 4UEKA 4YO8A 3FUVA 4ZJUA 2FWAA 1E60A 1U81A 1ZIYA 2LE0A 3PRYA 3Q85A 1NQOA 4DIDA 2WP0A 3L7MA 4P81A 1L7MA 1CRZA 5EI5A 3GVLA 3RG8A 3SJBA 3I32A 3F67A 1QE3A 1JA0A 2W4QA 1T6BY 2ZP1A 3FNIA 1V35A 1G98A 2AZDA 4LVNA 2ZRAA 4R8RA 4M1SA 3LC2O 1YBFA 2WTEA 4BE9A 4L9SA 1U1IA 3SBXA 1T1IA 1VLJA 4L0DA 4JZKA 4XRGA 4WXEA 3JARB 4D79A 4QZVA 5D8DA 4V1CI 5LSAA 5TS2A 1VLQA 6CHYA 4G86A 1M5RA 4EHIA 3I9MA 3SAJA 5I7HA 4OLFA 5HKOA 3ORRA 4MRVA 4DSOA 1CLEA 1NNUA 3EGCA 3GEGA 1UD5A 3UT0A 2DKOA 4JYPA 4C14A 4JBXA 1ND6A 1UK9A 4S3MA 1Y34E 1TKAA 4MAFA 3KVYA 4RSHA 2AXEA 4WW0A 4PVDA 5DIFA 1O9BA 1XCJA 4B5KA 1VJTA 1K73D 3THXB 4DV1B 1BE6A 5IRCD 1XLVA 3BDAA 4QRDA 3TZBA 3VR5H 1POXA 2X4DA 5KI6A 4OX9Y 5KNBA 4Z9AA 2XOKD 4WOBA 1JH9A 4UOEA 4OXXA 4UJ5A 5I9IA 3IEKA 4INPA 3WAGA 4ZALA 4MUYA 2WD8A 3DFFA 3OHMA 4Q3NA 3L6RA 3D5QA 3KC2A 3LCCA 3RC2A 1NF8A 4KIWA 4P4SA 1E2IA 5IXYA 1PJRA 4MGHA 1DBIA 1FDWA 2F3QA 4MV4A 3DWGA 2Z56A 4UDNA 4F85A 2YMLA 1DQYA 1CZRA 4QFDA 1P19A 4BNUA 1QH9A 2B7BA 2CYCA 3D3WB 3HNOA 3ZGZA 1KVUA 3O1HB 3O8QA 1N05A 3E81A 3WZLA 4RJIA 3WQSB 2BEVA 3CMEB 3NRJA 4MMZB 4X1IB 5JCJA 4LYYA 2PBFA 4UTVA 3HCWA 1D8TA 3K6SB 1LK5A 1A50B 1JG3A 4DK1A 2Y1OA 4DIUA 3LWNA 2ERYA 3RJ5A 5I8PA 4LQCA 2D1FA 2ASEA 2VHTA 1B0PA 2AEEA 1LI5A 3D6UA 4BN4A 5FUWA 4E2WA 1PRYA 5BQFA 4FFDA 4PYNA 1TAGA 2XIQA 2ZRDA 2DCMA 4Y18A 3VHXA 1BS1A 3I01A 3NWOA 4CM5A 3EY9A 5L45A 5JAQA 4KC0A 4Y2TA 3OEWA 4NU0A 2HCBA 1DRUA 3AMVA 3MGGA 4G8CA 4ALNA 1GRNA 4Y1GA 4YCMA 1TYAE 1Q22A 1XVAA 3U7JA 4KI7A 3PGA1 2OO3A 4DTIA 1HDCA 1PNVA 4GMXA 2L17A 4I8DA 1XDDA 3UK2A 3E05A 1I6KA 1ULHA 2B4QA 3BQNB 4AX8A 4ZJZA 3V8EA 3CKYA 5A5FA 5BURA 5JAZA 1J5EB 3K0FB 4X54A 5SZKB 2H29A 2G7MC 1VLVA 1L4GA 2C03A 3G0CA 2V9ZA 3VYUB 2EF0A 3NO4A 2GWRA 9ATCA 1VYUA 2PD3A 3I8XA 1TK3A 3H9CA 3TBFA 1GOTA 1ZI9A 4EMUA 5PNTA 5I7WA 4O2AB 2R84A 3A14A 2XRMA 3NOOA 3EQ7A 4CIXA 1UBLS 3GX1A 2BDEA 1J25A 1DIRA 1Y1RA 3PPXA 4MQ5A 1K8ZB 4WIAA 2VAVA 3A6FA 2W11A 3STYA 5CK5A 1BAPA 2QOEA 2JBWA 1LC3A 3UAVA 2G5CA 5JO9A 1KDYA 1L5SA 1LPNA 3ZBUA 4L9WA 3HGMA 4EPRA 4N0DA 4DRZA 4C6TB 3Q1LA 3FPPA 4AURA 5LIPA 2G8LA 3MWJA 1DV1A 5IEBA 4AL4A 1H3EA 2W0MA 5CHYA 5BYBA 1KXZA 2I62A 3DL4A 3GJ6A 1YFKA 4KKTA 1H2YA 3B85A 4DDMA 4X62B 1WTAA 1Z2CA 4MLCA 4ZO7A 4AXXA 2OAGA 5AD1A 2JHGA 1ZU5A 3GBVA 4LRUA 3VR3D 1E3JA 4E2XA 4UNQA 4A0HA 4TRMA 3K71B 2LD4A 2PZ8A 5FL7D 4FSXA 1GKYA 4I66A 5A3QA 1FFDA 1T5EA 1NBOA 1UM8A 1XHFA 3AEUB 2COKA 3PE6A 4I1VA 3HBMA 4NZMA 3B6IA 1X7GA 5DPMA 3JYHA 1B73A 2FLVA 1E2LA 3AXTA 4EHKA 1KD1D 3R9IA 3BERA 3T7RA 2OCIA 3QVGA 1XU9A 1ZSVA 3O90A 1KPGA 3SLDA 2VUHB 1UKVY 1VC2A 1XYYA 3FPHA 4LZAA 2RGGA 4Z99A 1QRUA 3NEJA 1L5NA 4FGWA 2ZI4A 1QUEA 4M8NE 4OA8A 3V1LA 1O94A 3GDFA 1MPTA 4RIIA 4YGXB 3ZGXA 3JPWA 1PT9A 5IJAA 2GN8A 3STUA 3PLNA 4DEYA 3PVDA 1E9BA 1HK7A 1IUNA 2XCOA 3HNRA 3MLEA 4N82A 4UMVA 3T4UA 2DQ4A 2J3QA 3TGPA 2NZVG 3UA3A 2Z98A 3H2SA 5D3ZA 1UWCA 1OBVA 4PPNA 3VSEA 2FHPA 5KW9A 2XMCA 1BIFA 5KOHA 1US8A 3JQ9A 5CK4A 1XXHE 1ZGGA 4QFCA 1QP7A 1AMUA 1OH7A 1MJHA 3SQWA 1LTQA 4GLFA 4G5FA 1FNCA 4DQLA 1JQ3A 4GMGA 4Q4LA 3VSCA 5ETJA 1PV2A 2UAGA 3HCNA 4NYIR 2F59A 3HXMA 1B8OA 2HBZA 2CVOA 1GNSA 4JBNA 4ZOLB 5AJWA 5MN4A 3KHSA 1OH6A 8AT1A 1ESCA 4JK3A 1TGYA 2CXHA 2YVLA 4F9TA 5JR3A 1J2UA 3WZ2A 2GZMA 2H1WA 3AEYA 3LNCA 1C1XA 1KFEB 1RHRA 5E6RB 2XA2A 4Q0MA 5C53B 3BXPA 1XLTC 2NT3A 3E03A 1GCGA 1OH5A 1DIHA 4FYWA 3TIIA 1HG1A 1WO8A 4Y2JA 5U4XA 1Y8RA 3H5OA 2E4YA 3LY7A 3PEFA 4YP1A 3KOYA 4MYTA 1RJFA 4CG3A 4E4TA 1F2TB 1FDTA 1A7KA 1DBQA 2GX6A 3MLBA 4YP9A 4IHAA 4CEJB 1OCEA 2QA5A 3OG9A 4AN4A 1RZVA 2H1CA 2KWIA 4MV0A 1AZTA 3T9FA 2BAGA 2A5JA 4OAQA 1WD5A 4TMZA 1PQUA 1DDGA 1YZQA 2Y6UA 2QLMA 3CSSA 4WZKA 4GKVA 2IYZA 1DAOA 3L8ZA 4Q1CA 3WYFA 1BHO1 2CNLA 3IIMA 4KR2A 3GLGB 3KQLA 3I2YX 3ZDBA 3WYCA 4MQMA 3DYBA 1U2QA 3ZEIA 3JVIA 3OCXA 1FS5A 3K30A 5EP1A 1C9EA 2GJAA 4D9FA 1ESZA 3E1SA 1JU4A 3FCXA 3G2KA 4DKXA 1YR6A 1DIOB 4WV3A 1SQGA 3LWZA 4Q7EA 3TIGA 2R6JA 1TQ2A 1AKEA 1BSVA 3PGLA 2H65A 3ZWXA 4CNQA 4NMXB 1BZYA 1JR2A 3UENA 4DV3B 3I76A 2X8WA 3ZU5A 1C4OA 2CJFA 4B2YA 1PZEA 4KLNA 3EZGA 2FPIA 4V0KA 3S1LA 2QQ5A 3HL4A 3FAZA 3H2YA 4TUYB 2YL2A 1RKUA 3E23A 1PJ6A 2HK9A 1LPPA 3E3OA 2GZDA 2VK8A 2FWNA 4N6OA 3UK7A 2QJTA 1NW6A 4JBGA 1GPKA 2IXAA 1E5VA 5HXBA 2DOGA 2PO7A 4ZEWA 3TW8A 4FYKA 3BCDA 2IZZA 3K9LA 1NIJA 5J2TB 5K05A 2FP4A 1UAAA 4MW0A 4YR7A 4P3PA 3PPVA 4JGIA 1O5OA 3KQQA 5B1EA 5LJLA 3DBLA 4DA9A 1MC5A 4KO4S 5ALNA 3UJHA 4DWOA 3EOAI 5L3VA 3KIPA 3MHTA 1FJGB 1U0GA 2TMKA 5JDCC 4QUAA 3CR3C 4NI5A 3AONB 1WXFA 3PIIA 3EXG2 4N8DA 1KS9A 3OCCA 4UUQA 5ICCA 3KYCA 3TEJA 1QGOA 3A37A 2X86A 4UREA 3ZS8A 1R64A 1X1BA 4J2TA 2H7VA 1SUIA 4N41A 1ZH2A 3TQSA 1T24A 2BHTA 3WL5A 4ZHQB 3DVQX 3CC4B 1T2FA 2ZJYA 3FNEA 3TPZA 3D8TA 1DCTA 3LO8A 4RHXA 2ZU6A 4XFJA 3GIDA 1XG5A 3GGOA 1DC8A 4KXLA 3WC4A 1P0FA 1Y6ZA 2QN6A 1UJ4A 4N8SA 1WSRA 3CYFA 3DA8A 2Q9UA 2XIJA 3K1ZA 1U02A 4O5AA 4BGUA 1J9ZA 4TS9A 4EHAA 2ZANA 1T13A 3H83A 4Q16A 5IJ0B 1Y7LA 3B6MA 5EHIA 3LCRA 3QVXA 3PC2A 2JH8A 3BFJA 4EHDA 3CVXA 1XCOA 2CNKA 4S04A 1HFJA 1P5ZB 3QH4A 3INTA 4LJSA 3KG2A 4KXMA 2IX3A 3KL9A 4YRJA 2R6AA 1SIOA 3IP6A 2F62A 3CG4A 4BIMA 5LU8A 5DLPA 1HGXA 4OBEA 5FT9A 1QU2A 1X3LA 5EA2A 3Q9UA 3TMYA 2I99A 4AZ0B 5LC1A 3P2JA 4UNRA 1FJHA 1NAIA 4X7EA 1VYTA 3U60B 2O8FA 2G5PA 5A0VA 3DFIA 3EFBA 5BWLA 5LNK1 3QPDA 4EJSB 2GZ1A 1V3TA 2GEBA 2D1RA 3EFOA 3CCRB 2PGNA 1UOOA 3DV0A 1R27A 4KCGA 4ZK6A 1GP2A 3KE9A 1USUA 2W4MA 3G3EA 4KL8S 4UW9A 5JQGF 4OHCA 4MVJD 1B3RA 4UM9D 4RIFA 5FD8A 5GY7A 2QRLA 4KQGA 5E6UB 3LI2A 1ZD3A 4HYYA 3UMCA 3Q8WA 4YAIA 5BQXA 4PX2A 5CEEA 1KYIA 2BGGA 2WAOA 1JLRA 2XODA 4RD4A 4FKMA 4QPNA 1JMKC 3Q10A 1YJ5A 3CZ9A 1OFUA 3HQ4O 2HHAA 4L16A 1Y7IA 2P9EA 1SXJC 4FVTA 2ZBEA 1X7WA 4II7A 4ZZ2A 3MJSA 3I8OA 3OT4A 3TO5A 4CU5A 1R2QA 4UOZA 3RJMA 2OE2A 3ZE2B 2DEUA 3RRFA 4YMGA 2EG5A 3C3PA 4EHFA 4PHFA 4W6QA 1H2RS 1DG3A 2OM6A 2O05A 4CLRB 3TGLA 3I0ZA 2Z08A 4X44A 5AQ1A 2ZRCA 2HLNA 2HO4A 2HQ1A 3GVHA 3HHEA 1XZPA 4MW7A 3AY7A 4AO6A 1A8HA 4K9PA 4DG9A 2PS1A 5FBWB 3F1KA 2E5LB 5K9ZA 2A1TS 1CEXA 1U2GA 5L6LB 2FEWB 4YXWD 1CUBA 1K6XA 3JALB 3PNPA 2G9QA 5F2NA 3F73A 2DBYA 2CDAA 3T8YA 3IHWA 3KZOA 3SDBA 4FYIA 3NI2A 2FN4A 2X1HA 5EWJA 4C7JA 4NU5A 3RQSA 2ZYIA 3RK4A 4KHPB 2ZBDA 3AUTA 2YTZA 1UMBA 3PWZA 2ICAA 4YUVA 4K9KA 2QAGB 5EIEA 1M2HA 4AUKA 2XCLA 4O1HA 4B73A 5GJVC 4XB6B 3PDHA 2OZVA 2PWPA 1B7GO 2F7SA 1YR9A 4M98A 1P6XA 4X7CA 3B13B 1BKYA 3H7AA 4U2EA 2M1ZA 4Q7JB 4ESHA 1PG5A 4BFTA 3KLPX 1LSJA 5AI8A 3SIWA 4R1PA 2HMAA 3ADDA 3NHBA 1AT1A 2LCIA 2I2AA 2RHMA 1P9LA 3CG0A 3Q0IA 4MV6A 4D98A 1QO9A 1Q3KA 3CLVA 4YNBA 4BEVA 1K86A 4Q7QA 4G1EB 4DC1A 3T7KA 1L7BA 3DB2A 4OO3A 1TM2A 3GP3A 2GJ4A 4LWOA 3GEMA 3UY4A 3UOGA 1AS2A 1EFKA 3OLCX 2PX2A 5FUMA 3CIOA 4MQEA 3CGGA 3DZHA 5I3ZA 2DR2A 2KHZA 4EB6B 5FL3A 2QQGA 3TDKA 2BE7A 3UMBA 2BFDA 3ZDAA 1F8FA 3L0DA 4QATA 1H2EA 1TECE 4BFWA 3ZE0B 4GZ3A 5ALUA 1MMFB 4XLZA 4GXQA 1H4TA 4OLJA 4GR9A 3AT1A 4IW3B 2E85A 4BO4A 4NNJA 3EGDA 2AQHA 5DYTA 3FMIA 2XVZA 4GKAA 2YBDA 4A8JC 1UBHS 5JZOA 4OHKA 2FNAA 4NP6A 4ARUA 4FGUA 4OFXA 1JALA 2RFLA 4TMXA 3QXCA 2IXEA 3W5IA 4ZN6A 1YZNA 4E7PA 1FYWA 3KLMX 5LYJB 1QOQB 3AIIA 2YS7A 1MP0A 4OLHA 3BY1A 1WXIA 4RSGA 3AXSA 1X80B 3GGPA 3SKXA 5IUKC 1FOEB 5DW3A 2O8CB 2HU8A 3O03A 1IIBA 2H48A 4IGAA 4TWIA 4ER0A 4X71A 4YTEA 1JHZA 4DV4B 5THQA 3FR8A 3KELA 1O03A 3OKPA 1I6MA 3IA7A 2VN8A 3Q8KA 5EZ5A 1O8BA 2V4MA 1O94C 1UAGA 1G1AA 4AZSA 4ML3A 5F7OA 4JB2A 6AT1A 4ZODA 2C2YA 3S8EA 5BR8B 1KO4A 4LDRA 4HRXA 1KY3A 3NHWA 1KDTA 1FFYA 2HCTA 2PGXA 1GZVA 1GVNB 5FEUA 4PLFA 2J87A 3H1EA 3GH1A 3GEIA 1Z4LA 2AOXA 2R8YA 4KEAA 3O74A 5CNJA 4Z0NA 2FVXA 2FSIA 2X1MA 3SXPA 4MS1B 4F4JA 2B1RA 3FYHA 2JIZD 3SC6A 1E3DA 1UC5B 1W30A 3AJ8A 1M7HA 3PXBA 4HHEA 4Y9SA 4BJ1A 2DH5A 4BMOB 3P9XA 3BGIA 3K4PA 4KLCA 2R11A 3E3MA 4AWAA 1J0EA 5B6PA 1TCUA 2NSHA 3Q9SA 4EYEA 1MTOA 2R25B 3CFYA 1PEKE 1YZVA 5CFLA 4ERNA 4BNNA 3MS7A 5EJ8A 1T2EA 2G9NA 3ROMA 5C37A 4HNAA 4B6FA 1KU6A 1M0TA 2P90A 2UZAA 1A88A 3EMVA 4IFEA 3EXIA 4M7RA 1OF1A 3OM8A 2OPBA 4XWYA 3DUFA 2XTMA 2QTTA 2YJ6A 2WAAA 3NM4A 4KR3A 1O6ZA 1VMDA 4ON9A 7REQB 3NHMA 3MWGA 3O8RA 3U31A 4ID3A 3SLGA 1G8HA 3L8FA 4V2IA 2UZ3A 4X1KB 1AHNA 1LLDA 1X9IA 1PDOA 3EASA 3ORQA 2I2WA 1FTGA 1SBNE 1YRQA 3AIKA 4Q03A 5KKCA 4XLCA 2BFWA 2NYUA 1M6VA 2O2XA 5EPOA 1RWBA 1RCFA 5GGXA 4YMUA 2PE5A 1KNQA 1MH9A 1Q16A 2VYFA 3AZQA 3BC1A 3FJ1A 1XL0A 1KXJA 1XCLA 1F8XA 1W52X 3KU1A 4LHZA 4MUIA 2AG8A 1QZZA 2J3KA 4I7EA 1R9NA 2P2DA 4ZYXA 2GHQA 1C0LA 5GPBA 3UANA 2J0UB 2IP4A 5CFZA 1FUKA 2VDJA 4WXRA 1LVUA 1BRMA 1W9XA 1Q0PA 2ZSHA 1WB9A 3HDHA 4WVFA 5GP1A 1O9GA 3S81A 2E49A 1PFWA 1J0CA 5JYEA 1LZLA 3BWDD 2R5FA 3NVKI 2ZIWB 4MWDA 1W5TA 4K05A 4Z51A 1XPOA 2EVWX 2YKGA 1YU6A 4X5OA 3ZPXA 1U0BB 1YJ9B 1OBFO 4XOPA 2ZSUA 5EIOA 1Z56C 2RHHA 3KD2A 3KSAC 1V4BA 1JF8A 5GZ6A 2MSDB 1UKZA 2ACWA 3NNNA 2OHVA 4EHNA 3GRUA 1OPRA 4HADA 3R9WA 1GSAA 3LMKA 2HHHB 2VCYA 3T9DA 1DMRA 1RXYA 5DO9A 1LDNA 5EJAA 1W5AA 2W2MA 1W0JA 2PJZA 4JUFA 4ZGGA 3ADBA 4GL4A 3DMTA 5HJ2A 3TLAA 5L4LA 4HDKB 1NLFA 3GMDA 5TE9A 1MQAA 3HI4A 3N8KA 4RHEA 5AXAA 2B8JA 3OZXA 2WDZA 5KWVA 1N2JA 1X7YA 4QAJA 1PYOA 4H15A 3C8UA 1I7SB 2WTBA 4F4FA 2FDRA 3CTAA 1E79A 3RROA 1BKSB 2AE1A 5B6JA 5LZ8A 5AUPB 3THYB 4NQZA 3S6JA 1M8JA 1JNYA 2XXJA 2D3LA 4O2BF 4D3ZA 4BWVA 1SWWA 4LGMA 5FUXA 1XBTA 1XEAA 1JZQA 1NJ8A 2H5LA 3BCUA 2Z04A 4LF6B 5A8AA 4M0PA 4D9GA 4E5MA 2FZEA 4M0LA 4OG2A 4UCWA 5TQJA 3ZLBA 5BVGA 3ZH2A 1N78A 3AU9A 3ZLVA 4EGJA 4Y30A 1U9IA 3EIXA 1IB0A 3RRXA 1TC1A 3ICVA 3EEYA 1CYEA 2A9QA 3GRFA 3VBCA 4H7JA 1M1NA 4HVAA 4LRYA 2O8DA 5H3LA 4BGDA 2X19A 4KZKA 3QBJA 3GEEA 5I7AA 4ZIRB 1FXWA 2A58A 2R8ZA 3GJXC 3ZHZA 3ZGLA 2FUEA 3ZVMA 1TXGA 2J3MA 1ZGJA 2EX0A 2FMFA 3I09A 1PX2A 2I2CA 3QSGA 2G71A 2R6FA 3BH4A 1SCQA 2OOSA 3GO4A 4EK9A 1JXOA 1QAMA 1XZGA 2RIRA 2UYQA 2ZIXA 4LBYA 3I72A 5F21A 5LZ7A 3TSOA 4EWLA 4FD3A 1E0AA 2ZS7A 2JFQA 4JLNA 3VDMA 5C4GB 3WWPA 2N42A 5C1IA 2BBSA 1U8ZA 3HN7A 4P83A 2AWNA 1C8VB 2ZZQA 4YMVA 4P9SA 1JYFA 2JBHA 1LDEA 1L7AA 1C80A 4I1SA 1K7EB 3B51X 4PS1A 2QI9C 1LNZA 4AZ3B 3HKEB 3QVUA 5KKNB 2IOYA 2JHPA 3GFGA 4AG5A 4R54A 3WLAA 5A4MS 3ODPA 4ZVVA 3OJ0A 1H85A 3SZUA 3WQBA 1BW9A 2X4LA 3VH2A 5CP8A 3ADCA 3ZWDA 4DMLA 1KC3A 5KYKA 3A9CA 3L5KA 3VJRA 1GSOA 4N7RA 3R8FA 2ONKA 4IGEA 421PA 4UPEA 1DC5A 4D8TA 1P4RA 4ER6A 3D1LA 1C3XA 4D3DA 4DLRA 2UYHA 5A3RA 2NO9A 4UZSA 4PTZA 1ULAA 1Y48E 4TWAA 3GQBA 3GJTA 3SJZA 1E9RA 1M7GA 4V0NA 5D3MB 1BU8A 4EX6A 3ZXSA 1HT2E 3ZWQA 4Q6BA 2BDTA 2D0PB 4X1IA 5EZYA 1V0FA 3V4PB 2XWBF 2DIEA 2QD3A 1TYBE 5ALJA 2HD4A 1PLJA 1O6BA 3H11A 3WDLA 2Q2WA 3R23A 3FNFA 2RGNA 3O8BA 3H1GA 5AJUA 3AUXA 2PT6A 1KOFA 3MGKA 1P4HA 2O5VA 2UVPB 5L46A 1ISJA 1ULSA 2MYUA 2XZPA 3DBHB 4QLAA 3F8WA 4A6XA 1XK6A 4UXJA 2IQIA 5F3RA 3ROGA 1A72A 3PITA 3ST7A 3GFTA 3A3YA 3OOEA 4QBFA 1QIDA 3VNVA 1NMZA 3HY6A 4ZRMA 2H85A 3AEZA 5F9MA 1KQNA 1RAFA 1NYTA 2UYYA 5JJKA 4KFUA 4YQZA 2FPLA 2WZCA 2QIPA 1IDOA 1V8BA 4M0MA 4QG7A 1THZA 4TMKA 2K5UA 5DHPA 1M10A 3LYUA 1XFAA 4BQIA 1HKHA 2I76A 1OBCA 4L8JA 3L7NA 2WJWA 3QQPA 3B70A 3EZ7A 2YYYA 1A96A 2W2NA 2D3NA 4GVLA 3W8FA 4BNFA 4RTOA 1UADA 1IHPA 5AXDA 1T25A 4EY8A 1AS3A 3IDSA 1RJEA 4NV3A 3UMRA 2YZNA 2B2XA 1H3NA 1ZXBA 4EGQA 1SXJD 1BCRA 3EYAA 3MW8A 5JCJD 5K01A 3T7JA 1JA9A 2H6EA 2FEAA 5LA6B 3U1TA 3BSWA 3WYNA 2ATCA 3W2IA 1XRQA 2HCFA 3BRWA 3I53A 1R74A 3RQIA 1JG6A 1ZD9A 2VPIA 2VBVA 1WXGA 4XJTA 1LPOA 1X7ZB 1S6YA 2GAFA 1KYXA 1DE0A 2H92A 3Q1KA 4RABA 3URKA 2HA3A 2YZ2A 4Z4IA 1LRLA 3M5DA 4MV7A 3FRIA 4P98A 2Q1XA 4YUYA 1GPDG 1ST2A 4C6TA 4TKLA 3ED5A 3F74A 1QCYA 5A89A 2CZQA 3T35A 4QXPA 4MQFB 1XZFA 1UPUA 3ZGOA 4BX8A 4QM7A 5LMNB 5IC6A 2QWXA 1QK4A 1MV8A 5F4BA 1G4AE 1P7VA 1DJPA 1QVZA 1D1NA 1B8VA 2ACKA 2GSDA 1N2GA 3LQFA 3OWHA 4ISBA 2YQ4A 4QDOA 2IU3A 1RKQA 1FUIA 4A5OA 4DIKA 4AX4A 4QPPA 2WSSA 4OH1A 4BMNA 2HMUA 1X7XA 2YC4C 4FR5A 4C7VA 3ZW8A 3L7IA 4TXLA 1SUBA 2WWIA 4CEIA 1ZHHA 2NU6B 3K9WA 3RVPA 3IOCA 1ZQ9A 3O4IA 1EP1B 4FGLA 1G2PA 4BASA 4D44A 4RTJA 4EGCB 3G05A 1SUWA 5DTQA 3O9ZA 2EIHA 3HDGA 1MJNA 4L4SA 4Q9JA 1TD9A 1RM4A 5CVJA 4F6LA 2PMDA 1NBMD 1NVVR 2WHXA 1H8HD 2PS9A 3GV0A 1H9AA 4DYVA 1U3WA 5FI3A 4P12A 1XT6A 4YPOA 1NVWQ 1REQA 3FM9A 1IEWA 1D7AA 3LQ2A 1QLWA 2FDXA 3UWPA 4ZYVA 2O0HA 2ZT6A 4FZ3A 3SIXA 2X8AA 3UGKA 1Q1EA 2DYKA 3B8HA 4IIJF