3W2EA

Crystal structure of oxidation intermediate (20 min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
271
structure length
271
Chain Sequence
TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
molecule keywords NADH-cytochrome b5 reductase 3
total genus 74
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2eA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2eA02
2XNCA 2BM1A 2BSAA 3FJOA 2QTLA 2YWEA 3VNVA 2BPOA 1AMOA 4TN1A 3I56B 1G7TA 3MCAA 3A1FA 3B8HA 1R5NA 4QFMA 1Q82D 1M90D 1QUFA 3LVBA 3QFTA 4ACAA 3WNCA 1D1NA 4TMTA 4DQKA 1YJWB 3I1FA 2QMUA 1YJNB 1QFZA 2NPFA 3W5HA 1YHQB 3P26A 4TMVA 1TVCA 1QH0A 1VQOB 2GPJA 1FDRA 1VQ9B 1D2EA 4Y9UA 4TMXA 4QHYA 3JQRA 1SKQA 3CCSB 4M4SA 3W2FA 1K8AD 4RD1A 1IB0A 3WBJA 4TMZA 4Q7JB 4MYTA 4LBWA 1GO2A 4EH1A 2B7BA 1EFTA 5HXBA 4YALA 3CRZA 1UMKA 5KSWB 1N8RD 2DEUA 1QFJA 3AVWA 3SJZA 3JQPA 1EFUA 1QGZA 3E1YE 4FK8A 1S0UA 5AN9A 5GV8A 4YHBA 3CC2B 2BGIA 4ZCIA 3AVUA 1G7CA 3U6BA 2R6HA 1W34A 2GQFA 3WY9A 3AGPA 4RD4A 1GVHA 1G7SA 1KRHA 4LBYA 1QG0A 1OB2A 4DQLA 2VZLA 1GAWA 2DERA 1OB5A 3PENA 4M53A 4B44A 4ZV4A 2PMDA 4G1BA 1HA3A 1FNBA 4RCZA 3AVTA 1K73D 3ZBTA 3LRXA 3G71B 1QX4A 3CCLB 2B7CA 1G7RA 3ZZUA 3J81k 4H9GA 1E64A 5THXA 1FRQA 3OZWA 2QEXB 1VQPB 4G5GA 3MHPA 4J0QA 1KK3A 2BVNA 3CPWB 4HE5A 1NJID 1DARA 5DSZA 1ZM2A 2BF4A 2PIAA 2C77A 1W2BB 4AF6A 1EFCA 3W2GA 4LC0A 4ZCLA 1TUIA 3CB4A 1QVFB 1ZUNB 2EFGA 2J7KA 4PC3A 1GJRA 1R5OA 4N3GA 1JNYA 3OJWA 1KTVA 1KJZA 4M2LA 3AVYA 1JA0A 1KK1A 3W5VA 3E20A 1KQSB 4YAOA 1Q86D 3OJXA 4B48A 1BX0A 4M0LA 1YJ9B 3VMFA 2YWFA 4BPRA 1KC8D 2DCUA 2OTLB 1YIJB 4UAJA 1OGIA 2YWGA 4YAWA 1ZM3A 3CW2A 3LO8A 5JBQA 1VQNB 2EIXA 1H85A 1OGJA 1DDGA 1FNCA 3CCRB 3U2QA 1B2RA 1BX1A 1EP2B 2HMAA 1VQLB 4YAFA 4Y9RA 4AF7A 2QN6A 3CXCB 2X3UA 3CC7B 2BV3A 4RCYA 1E63A 3WNBA 3AVVA 5EMNA 3CCUB 1JA1A 1XE1A 4P6VF 2RC5A 1VQMB 1VQ4B 1I7PA 1VQ6B 1ELOA 4ZCMA 3LYUA 1A8PA 3V76A 1TLLA 1FRNA 3G4SB 1Q81D 4F7DA 3CCEB 1JB9A 2VNHA 3JQQA 1EXMA 3U6KA 2CNDA 1EP1B 2DY1A 2E1RA 3VNUA 1E62A 1J9ZA 2XEXA 1GAQA 1WDTA 3W2EA 3ZZ0A 1W35A 4LBZA 4FN5A 2YWHA 3WYAA 4K1XA 1IJFA 2QTZA 3OW2B 1CQXA 2D74A 4WQMA 3G6EB 1CNFA 4Y7CA 3VO2A 1U2RA 1B23P 1IJEA 1KD1D 3CMAB 4IW3B 3B82A 1D8TA 4P3YA 5H59A 1F20A 3WXMA 1VQ5B 1EWYA 1CNEA 5TY0A 4PC6A 3ZZTA 1QUEA 1YITB 1K9MD 3CC4B 4AC9A 1ZM4A 3OZUA 1FNMA 3ES9A 2XNJA 2CRVA 3AGQA 1EP3B 2BN4A 3CMEB 2OTJB 4PC1A 3CD6B 2C78A 3W2HA 4FWTA 4LBVA 3MMPA 1R5BA 4ZGNB 1QVGB 4B43A 2RC6A 4RJLA 5TR9A 1ZM9A 2QDXA 2QA4B 2OK7A 3B78A 3W5UA 1H42A 4C0SA 3ZC3A 4ACBA 3OZVA 4G1VA 4MYUA 1AIPA 4N3NA 4ZGQB 4RD6A 4U9UA 4RD2A 3WNDA 3CCJB 4B3XA 1TTTA 4M1KA 5TV2A 2VNJA 3AVXA 4RD0A 3QE2A 3FPKA 2OK8A 2HCJB 4R71A 4B47A 4PC7A 1QGYA 3QFCA 1JJ2B 4NCNA 1VQ7B 3P27A 1VQ8B 1GR1A 1KK0A 2ZITA 1N0UA 1XB2A 3QFRA 3CCQB 2B5OA 2BM0A 3W2IA 4PGOA 1DDIA 2VNKA 4NBSA 3QSYA 1S72B 1VQKB 1N0VC 4RD3A 3I55B 1YI2B 3QFSA 1DG1G 4B4DA 4PC2A 2BMWA 2FX3A 3CCMB 1KK2A 1BQEA 4TMWA 5H5JA 4C43A 2AHOA 2HDNB 1NDHA 3WBKA 4YAUA 1F60A 5GV7A 2PLFA 1Q7YD 1FNDA 3CCVB 1BJKA 3ZBUA 1QFYA 1W87A 1QGAA 2DETA 4HE6A 1SM4A 5FA6A 2VYQA 2VNIA 3VO1A 2BGJA 1M1KD
chains in the Genus database with same CATH superfamily
1D2HA 1P0IA 2ZI4A 2UVPB 3GVXA 4MV6A 2P9CA 4OU4A 3RVSA 1H2AS 2B94A 3K0AA 5GIPE 2QTAA 4CUKA 2WMDA 1I6WA 1OXXK 4I2VA 4J2OA 4PTYA 5DNUA 5FKJA 4QQKA 3RS3A 4P26A 1EVJA 1NW9B 1PR2A 3EGOA 4GI7A 5KREA 1Z4OA 2FX2A 4IGKA 4CF4A 1OYVA 4BO7A 3TLYA 3WP1B 4PZUA 4B7ZA 3MM4A 3HYNA 4H0FA 1WORA 2WJGA 3VHRA 2X4GA 3COZA 3IV7A 3MJVA 4B2IA 3L05A 2C4VA 2PRYA 4PPGA 2RI0A 4ZU6X 2IVZA 3ZXYA 4B6OA 1M8KA 3N2KA 1YMUA 4KR6A 1QBKC 1WBJB 3MXOA 4H6VA 4C7MA 3W8EA 4R1LA 3ELBA 3B3JA 4MPRA 4ZI7F 3ZGVA 3ZGXA 4FX5A 4HH1A 4RADA 4BB9A 4CIVA 1QS0B 1SG9A 3PITA 1QK5A 2QSYA 4HG2A 1Q20A 3BD8A 1ISIA 1LSJA 2PL3A 4C6RA 1EWKA 3USCS 2FWRA 4OG2A 4Y2PA 2D5IA 5KJ1A 3RIYA 2WWVD 1YJWB 1ZOPA 2N0SA 2ORED 1VHDA 2B1QA 3TLJA 1OFHA 4JLDA 2J9RA 3LXUX 4LZWA 4YDHB 5K0ZA 3LYHA 3ZQKA 1JAZA 1JEOA 2BP7A 3H5LA 3Q8KA 1S2DA 2DWCA 2PQ6A 5JNVA 4ECEA 2DPLA 4F6LA 4G0XA 2DY0A 3KDPA 4ARUA 5LVAA 4Q4JA 1M6EX 3INGA 2L17A 3QVSA 4PX5A 2I1WA 1L5ZA 3AHIA 2H8KA 3PC6A 4YQFA 1PZGA 3E18A 1P5HA 1QH0A 3UUFA 2QTVA 2PUEA 1U3FA 4TMYA 1IRIA 3QBDA 4GBMA 4ILKA 4OJTA 3TL2A 3KSDO 3FE2A 1WEKA 1XU4A 1NT2A 2ZJ0A 1HRDA 2OM6A 3I12A 5AMXA 1YRYE 1Z7WA 3RAFC 3OD1A 3C6YA 1UWVA 2I22A 1AKNA 1TOAA 2EBHX 2J6IA 2JJ1A 3DMRA 1DJLA 5AQEA 1PZHA 2IDKA 1ARZA 5ILQA 3LJKA 4FMDF 3IIKA 3L4BA 3OSZA 2CVPA 3DZKA 3OY7A 2ZRCA 2IZ6A 4JHLA 4LXYA 4N0MA 2JIPA 4TUYF 4LE0A 3ZNNA 3Q12A 1ZD1A 4B2YA 2FSGA 4ZYLA 2JCGA 5DOVA 3ZTTA 3BSFA 3FW1A 4RD1A 1WUYA 3EF3A 2ZDQA 4GVLA 4M21A 4U3JA 3TLMA 5LD2B 1UWLA 2WG2A 5ED4A 3GG9A 2PTGA 1OX4A 1C2TA 1KGDA 3IGFA 4P6YA 1I18A 1IK4A 3IB3A 4H7IA 4EGAA 4AZWA 3SJZA 1ONSA 4KGDA 1NUAA 3CLSC 3GA0A 5EHQA 4BMOB 1WW2A 1RE0A 1AGNA 3KSRA 4LIPD 1OLSA 2ZTMA 3UHAA 4RF2A 2BY4A 2BCJQ 2LCIA 1L2TA 1T15A 2OV1A 5FR1A 5A6SB 3H4VA 1PS9A 2GTIA 3BCRA 4Q16A 4E22A 1H1TA 3WWDA 1IHUA 2W6IA 1L5NA 4YHBA 5TGDA 3FFAA 1QHXA 2EQAA 2GF0A 3RC9A 2I2WA 4GPBA 1ZH0A 4GAEA 4RTMA 2YIMA 5JS8A 4BNHA 4QOFA 4RC9A 4L8JA 2ZULA 1WUHS 2V7BA 5LKRA 2ZRDA 1Z2NX 3DL0A 3D81A 3M2PA 1SEPA 2YFHA 1CPYA 2O2GA 4B1FA 4CLOA 2RKBA 1W30A 3JTMA 3Q4GA 4BGEA 4D2IA 4FFPA 1MZPA 1J8YF 2WAOA 1JHPA 1QLJA 1GVHA 1J20A 1TC2A 2ONCA 2NU7A 4BZZA 1QG0A 1NY6A 2NXJA 1SXJC 3K16A 1IK6A 1Q9SA 3JWEA 3PD1A 4Q4HB 3TLKA 2DERA 1DU4A 3MC1A 4I9UA 1B8PA 4M76B 4TSRA 5DT9A 5A4KA 3KL4A 4IKPA 3L8MA 4HVAA 4IF6A 1RTKA 3BOSA 3EGIA 2Y4NA 1HL7A 4MUAA 1WLSA 1UBCA 4FE7A 3AOEA 4TLEA 3CLHA 2XUQA 1L1FA 2NZ2A 3UC5A 4HNQA 1QJ4A 2EW1A 1ZVQA 2GN2A 4EG0A 1N2CB 3QEOA 3QELA 1JL3A 4HRXA 5DVZA 1RACA 3G71B 5G0TA 3TZ6A 3ZBQA 2VSOA 3ZI4A 2Q41A 5TGZA 3TQRA 2R8PA 1J2TA 3ZZUA 1GRQA 1U99A 3OLQA 2HIMA 2AV6A 1DWPA 3K6RA 4MS1A 3OKCA 4OYRA 4BQNA 1Z4PX 1RRGA 1TW3A 4H7FA 2QQ0A 4FBMA 3ZE8A 1Z47A 4E70A 5BW8A 3MJ4A 3H5WA 5K01A 3HSSA 2FU5C 3NRJA 5HF5A 1LD3A 1ZBDA 1ACJA 2DQZA 4P84A 4XYBA 2IEAA 2RI1A 3DZFA 3ONWA 3ZDAA 3QVGB 2GN0A 3NHSA 3PDCA 4LKRA 1USVA 3WDSA 3PZRA 1VLMA 1WABA 4FR0A 5IT5A 4AJEA 1XWWA 3IESA 4U63A 3IEUA 3FCXA 3PUHA 3CPWB 2WEKA 2XW6A 4X7EA 2ODWA 3NUZA 3FCOA 1MO3A 4UDNA 2PAAA 1GD1O 1OILA 1YACA 3C5VA 4YWJA 5LQAA 3X0DA 4WCFC 2FEPA 5TPWB 1H9AA 3EIFA 1YUNA 3B6ZA 1Y3CE 3QQ5A 2C77A 5HMMA 1YDWA 4FI3F 1XMQB 1JG2A 1PJ3A 2VT6A 4TV9A 3UWKA 1CZNA 1ANKA 2GYYA 3KVOA 4OQYA 5F98A 3ZPNA 5A9SB 1Y8RB 5A3QA 2WG0A 1JR2A 2QDKA 3NBUA 2YHBA 2CE2X 4FOSA 1Q77A 2IF2A 3KPUA 4GYJA 3QU2A 5JC1A 1RLIA 1ECGA 2QA5A 2WA2A 5HOQA 3E9MA 5CVEA 4PC3A 3A9TA 4WACA 3AR7A 5CEEA 2COEA 2XRYA 3HHPA 1A9OA 2DJ5A 3QEKA 4N7JA 5JG7A 4YQYA 1KK1A 3UWDA 3E20A 1F2UA 1W9MA 4UEQA 1KJQA 1WULS 5HCUA 3VAYA 3RJTA 4B48A 4M0LA 4A8PA 1X14A 4GVPA 3LA6A 3REOA 1T9DA 2Y1CA 1E3WB 2ZUUA 4K05A 1UEJA 4LV5B 3AHHA 1QCCA 1RM3A 1MORA 4PLCA 5EXEA 4DE5A 3E5MA 3QUAA 4PS0A 3RWBA 3V4LA 4TTQA 3RVKA 2KVOA 1C0PA 3EG9B 3P8ZA 4YAWA 1VJTA 1ZD2P 1ZM3A 2EERA 4OXQA 4PBTA 4CEIA 1B0UA 3AM5A 3LO8A 4HYEA 2GLUA 5A7GA 4EPTA 2H1SA 4KU4A 2NMVA 2PZKA 5SZIA 5BQXA 1U5BA 3JQFA 1GKIA 4X7CA 2Q29A 2OZPA 4R40A 5J2UF 4JB8A 3C3YA 1OXVA 4YO7A 2YXDA 3FRJA 1FDVA 2RHLA 2WNIA 2A0FA 4IRXA 4R8KA 1HDXA 1X6VA 1TVKB 1TO2E 4KR9A 5BRJA 4CMGA 3A27A 2Z4SA 3UV6A 3CZRA 3SC6A 3X1ZA 1L5QA 1LLQA 4BLTA 1GL6A 1L3BA 2MTBA 3NBXX 3MJFA 4KK3A 4B6PA 4YYEA 1G8MA 1RYEA 1VQMB 3PT5A 2F4NA 3U7HB 4J7AA 2AXQA 1FU4A 2JFPA 1I7PA 3LDAA 1VQ6B 1EJ0A 3FOCA 3NTQA 5KKCA 5IYPA 3ZKAA 1VB3A 3IKVA 1HBJA 1P18A 2EWMA 4D4HA 3ZQ4A 3LT1A 1JQBA 1QMGA 4HQFA 1UJCA 5JATA 4JVNA 3M81A 3V76A 2ADOA 4DV4B 2O23A 3Q15C 1FRNA 2EP8A 2FF5A 1YJ8A 3GYBA 3K2QA 4HWKA 4MI6A 1WHSA 4URWR 3CTPA 4UOQA 5EP1A 2QP9X 3EGVA 1O0CA 4OBXA 3JQAA 4D99A 2CXUA 1SIBE 1R3UA 4BB6A 4CMBA 4YPOA 2UYCA 2ZWOA 2BMDA 3I2FA 5CYFA 4S1VA 4JC0A 2C2GA 1XG5A 4UE3S 3VC7A 3PJFA 4JP2A 4MQMA 5KTYA 2NSDA 4PFJA 2P2DA 4DUPA 3PWKA 1F6WA 5GQSA 5J4VA 3PE6A 1GSOA 1BWPA 3FLBA 1ORRA 1PS0A 1KZ6A 4D8VA 1ESMA 4TT3A 2GB4A 2VUUA 4E0FA 3SG0A 3B1YA 1WSDA 1YQ9A 3HBJA 4P4GA 4J03A 4MYHA 3BTUA 1GAQA 1KJYA 3AX6A 1R2QA 2LDBA 2VRCD 3HDJA 3H5AA 3W6PA 3ZW7A 1QPGA 2OD7A 3HS3A 5CVDA 3USZA 3FYTA 3SSMA 5JAOA 3GLHB 4YUVA 3QYAA 4OV6B 4D3YA 3WB9A 3M9XA 2GESA 4KPUB 4KMOA 1VIDA 4FHCA 4LQCA 2CSXA 4KFCA 5AHKA 3I2IA 1FJ2A 4E5PA 1OPRA 4LQDA 1A9XA 2G67A 2WZPP 4G0ZA 4UARA 3JQEA 3W1WA 5FDFA 3RBAA 2WZCA 2G09A 3UOAB 5B58C 1DADA 1EFRD 1XZIA 4CM8B 3PXEA 4G5SA 2HT1A 4WERA 1JRLA 5LC1A 3RD5A 4B34A 4XM2A 4KKTA 2YYZA 2GAIA 1P8AA 1D8TA 2QPLA 2V7PA 2M98A 4KQJA 1JF8A 1H6AA 2O1WA 2R00C 3TTWA 1PFGA 1DC6A 2BTQB 4XW2A 4DJDC 2FRDA 4EL0A 3FB1A 5EKUA 3N0WA 2F1MA 1B8OA 3H1EA 4I1SA 1U6KA 1YONA 3ABQB 3RNOA 2HQOA 5B4UA 3PIIA 4MHOA 4MRVA 4A8JA 2OV8A 2K7FA 2H9AA 2FHSA 1ST3A 2XUKA 5CH5A 1N2XA 1ZMTA 1XPRA 3UNXA 3SR0A 3ZH9B 3SLNA 2VJDA 5FYDA 1PZXA 3R6GA 2C20A 4RPGA 4PCUA 4I1IA 5MN4A 2JGFA 3HXOA 3F0TA 5IJ0A 3FUUA 5AOBA 3ESBA 5A5GA 4OCZA 2FMXA 1NNLA 2I4RA 2ZUTA 2XAUA 3DEAA 3I6BA 3DOEA 5K3FB 4D6XA 3WC4A 2Z3WA 3AGQA 2VPZA 3PCXA 4B32A 2BN4A 4C78A 3K71B 1POXA 4HIZA 4UC0A 3DNMA 3OCJA 1TUGA 1GGHA 1XF9A 2GAFA 2VK2A 2VQ6A 2BEWA 3OT1A 4KR0A 3RFTA 1R4ZA 3BKWA 4JYPA 4U9IS 3ZYZA 6REQA 3B3FA 2EKZA 5J1TB 1JSZA 3MWDA 1VKJA 2I2AA 4EF4A 3V2HA 5BOSA 2H65A 2X14A 1YRHA 5TR9A 2OC4A 1TUEA 2O07A 3AZQA 3F7TA 2ZAYA 3OX3A 5TQ2B 3EG5A 2VT7A 4LCEA 1CS0A 1VI2A 3HJUA 1J2UA 3JQ8A 1Q0LA 2QTFA 3W5UA 3KKOA 1PWEA 3VTAA 5BV1A 2NU6A 3ZR4B 4C0SA 3ZU6A 1WDMA 3ZC3A 1CV2A 2CXXA 3KNZA 3RU7A 3MGGA 4W1QA 1L7VC 4GPD1 2X4LA 3BA6A 1J8MF 2H1RA 2FDXA 1GZ6A 2FQQA 3F6CA 3LXMA 3O8OA 4XB2A 3H83A 3QKRA 2DRIA 4GKAA 1P3Y1 4BIIA 5CA0F 1UUFA 5HQ3A 3D59A 1I7NA 1DAPA 1HOTA 2XCLA 4MLPA 3PC3A 4MVJG 2JFYA 2IE8A 5ELXA 4UVEA 2ZWMA 2ZBUA 3EPRA 4UNNA 4MS4A 2AQIA 3DUFA 4JMLA 3T7CA 1WM1A 3TOCA 3UOGA 1KAGA 3HSKA 3K72B 4MP8A 4QVAA 1E2NA 1WWKA 3NTRA 2IUFA 1NASA 621PA 1L8OA 1NBHA 4HC4A 5AR1A 3L7OA 4BP8A 3R76A 1Q0HA 2YWDA 1B41A 1RI1A 5ECWA 2PWZA 5HBRA 3OKPA 3NU1A 1RAGA 3LFUA 1RJEA 2QXTA 4UVGA 3IP8A 4KDRA 4Z3DA 5A4FS 3CCQB 1EAYA 1XF1A 3O2QB 4IQFA 4BP9A 4QUZA 1USWA 3BDAA 2ZE5A 2A30A 4IDNA 3SJBA 3IOMA 5FUVA 1Y7IA 3EAGA 3WGNA 4KJZA 4AJOA 3GG2A 3VSDA 1CX9B 2QGFA 3GVIA 4KE8A 3EWSA 2RH5A 4LX0A 3KCNA 4NK4A 3U62A 1DEAA 3LE8A 5TDHA 4D41A 1UK8A 5K8IA 2Y0BA 3GEHA 1PJ7A 5J47A 2DBQA 2W2MA 3T9AA 3PYXA 1J7KA 3HY4A 1NLYA 4Y8VA 5ALWA 2DFDA 1R8SA 2XMQA 3ND8A 4OHUA 5I9IA 2A33A 2G70A 3D4BA 2PGNA 5ICCA 3KOYA 2GBPA 1KEPA 1AM4D 4YNBA 5GPBA 5HM6A 4KIFA 1ULSA 3B12A 4JP5A 4A16A 4AZVA 1Z73A 2WP8J 4D9CA 4Y2HA 2I29A 3ZTWA 4PABA 1Z4JA 3PKZA 2J7PD 3KQUA 1K3UB 5CT4A 3DCYA 4EG6A 1C1XA 2X8WA 4EJFA 1KO5A 3CLKA 1FRZA 1V1RA 1E1DA 1O6CA 4V1CA 1G21B 4QYSA 4TKMA 2Q9CA 1OV6A 4DLUA 3UG6A 4LXIA 4F2WA 4TZ6A 3PICA 2H57A 3URKA 1AKVA 3AFIA 3RVRA 1SIOA 2JZCA 2XWQA 4LNUB 3RKUA 1YJCA 3H7IA 1W6RA 3ILYA 5KW9A 1T26A 3DDCA 3T7IA 5LIRA 3BD7A 4BNDA 3SLRA 3KTFA 3DDHA 2F8SA 4B7UA 4PQYA 3LXRA 1JDVA 1VGQA 1VQ1A 2A9KA 4OMFG 3SQMA 2BONA 4KGZA 3D3NA 9GPBA 2XYHA 2C2OA 2JAOA 3WNZA 1VPLA 1X92A 2I6GA 1P6UA 3MUFA 4KTVE 2PVSA 1ZUIA 1JU3A 3JVVA 4U9HS 1DO2A 1UM9A 1VE6A 2ZKLA 3AEQB 1E4EB 3V1LA 4HJRA 4ARSA 3DT8A 7MDHA 4UUPA 3IV6A 1OZGA 1TF7A 3PR3A 1UMBA 3GEDA 5KVQA 1Z9BA 2IYQA 3Q0TA 2FPXA 2YV3A 2G9VA 3V7AA 3H99A 3FOZA 3T3IA 2WJVA 2OVFA 3ECSA 2A67A 2W2VA 4YLEA 1TCBA 3CEJA 1G2QA 1V0FA 2WHYA 1ZU4A 4TMTA 4O2AF 5EMJA 5IBQA 3L8DA 4JBGA 4J9VA 4FEAA 3T3OA 5DSTA 4NJMA 4F3CA 3AVPA 3BULA 1PV2A 1Z36A 4KXQA 1DO0A 3TLGB 3NATA 1FBTA 3UZUA 4D9EA 1YDEA 5B3JC 3BRSA 2Z2IA 5DCLA 4EY3A 4E4YA 5CFPA 5ILOA 2NPFA 1LQ2A 1ZUWA 5FXMA 2JC3A 4YAJA 1RXYA 1OQAA 2I1QA 1QORA 3K70B 3OZTA 4G26A 4P3XA 1X2EA 3OHMA 4GNRA 5I9LA 3HKEB 2FEWB 1OXSC 1P0MA 2A2ZA 1DQRA 3F7NA 3MQFA 4DSNA 2ZYHA 1NA5A 5KYTA 4AY4A 1OROA 1ZN9A 4Q9KA 5KI6A 2PKXA 4AG5A 4YBRA 3RC1A 3CBQA 1HTBA 2WWXA 2JJ8A 3OMWA 1YULA 2PL5A 2GPNA 1YJXA 3ZCSA 2FP4A 2JANA 3EDYA 3FUTA 3L7MA 4GFDA 3M5PA 4M38A 5FBZA 1LPNA 5CW1A 4JYAB 1ZN8A 4JI4B 5FUYA 4EI2A 2O5RA 1NBMD 1ETUA 1OFTA 1VGRA 2AX4A 3OOSA 4I1RA 4MRSA 4C7BA 3RS5A 3BXGA 1BWRA 1L4BA 3OPMA 4CDGA 5KC8A 1JBKA 1E60A 2QRZA 3NI2A 3LS2A 4M9CA 4BV2A 2DLDA 3FDIA 2C59A 2IEZA 2YV2A 4TQUS 4F3KA 1TCUA 3C3WA 4WY2A 4DUGA 2XT9A 4BMSA 3OX1A 2MSWA 4JI1B 4QNRA 1C14A 2E5LB 4D8YA 3OC6A 1N8RD 1EM8B 2MT9A 2I6QA 2Z04A 1QHHA 3V33A 3ZXSA 3QRWA 4G67A 3OFNA 1V7CA 1XZFA 2B36A 4O4IA 3P9PA 3WGJA 1IU9A 3LV8A 1EFUA 2O3TA 1RAFA 5COBA 2Q1UA 4KXMA 1XRSB 1N2IA 4FK8A 2PKCA 3UCEA 1O0SA 1QOPB 3O84A 4LZPA 3RK4A 3NDIA 4IIEA 4BEJA 3LWNA 4WZEA 2XCIA 4AIIA 4ZJZA 1X7DA 1NNUA 2WF8A 1SD5A 5I47A 1DKUA 4D9KA 3I0NA 4OQFA 1PP4A 4OLHA 3IDFA 3TE6A 5EUCA 4EG1A 5IK2D 3PX7A 5BRNA 2QRNA 1Q2XA 4L4YA 3ZD8A 1ZK4A 3B6KA 4I99A 3IAM6 1AKWA 1R0KA 2IY9A 4LE1A 1CRPA 1GQSA 1AF4A 1NFFA 4C3OB 3GDGA 1YZLA 1VIYA 4GLJA 1QPBA 3OCYA 4PQRA 4UPEA 5K2MA 1XXHE 1R37A 4KQEA 3VX4A 1OH6A 4R81A 3K73O 2Z6VA 4KE6A 1O95D 1QRSA 4MX8A 2MJLA 4KZPA 1U0NA 3H9BA 3QUSA 3QU9A 2Y0EA 4OHYA 2IEDA 3CGWA 3CLSD 3CWZA 3F8TA 5LLTA 1FPQA 2ENUA 5EE0A 1TPYA 1YHNA 5EQFA 5K7SA 1RC8A 1KP3A 2BBOA 3QW2A 5THQA 3SMQA 4FP9A 3VTKA 3SZMA 2SICE 1T2EA 5EZYF 3FWNA 1TDJA 4CQMD 2NTJA 1RXVA 3NHBA 2Q6IA 4M98A 1KAQA 5HM8A 4FXOA 3QEJA 1JXQA 2GO7A 2J6HA 2WOJA 5HCIA 4YRJA 1WTCA 1ZRMA 1YO6A 1ZI9A 3O1IC 4Y6GB 2OL4A 5KU7A 1RP1A 1KJNA 2PKQO 4K9RA 4NLLA 5HIMA 3FGNA 4A27A 2XZLA 5AM3A 3JY6A 8LDHA 3OU6A 4KGXA 4P3OA 3ASRA 2X7JA 1UINA 2YIVX 3KDSE 3NONA 4DRXA 2BUAA 4C4XA 1H6CA 4QJBA 4WNYA 4L22A 1AA9A 2H07A 2PSHA 3GLIA 3QTBA 2BFFB 2HIGA 3S1AA 1H65A 5K8TA 1NVUQ 3Q3GE 5IZ4A 1V8BA 1CUWA 4O4JB 1U3DA 1JSCA 2ZR9A 5AKHA 3I61A 4LF4B 1T13A 5TQJA 3I53A 3JU4A 2WYIA 3PSAA 1RWWA 3MWYW 3NHJA 4BFUA 4G8DA 1Z2OX 1YK0A 2ZYUX 4FDUA 4DEXA 4JH0A 2AFVA 1YAHA 1YIOA 3EBOA 3KPYA 3KEFA 3WGOA 1KH3A 2WU0A 2PVCA 1T9GR 2C7VA 1UBLS 2NO5A 2OZLA 5LZ2A 2FA9A 5KEIA 3AEQA 2AJBA 4YB8A 3GFSA 4YS6A 5JZMA 3JAMA 4QT4A 2ZT7A 1V96A 3A28A 3HZOA 4JOQA 3LBFA 4ER0A 2HO5A 1MZVA 2AG1A 1X70A 2R4TA 4L15A 1ADBA 5HG0A 4R7ZA 2V0NA 4TLDA 5EPOA 1OH5A 2HMTA 2JKVA 2VDRB 3LDHA 3MSCA 4MGEA 4N49A 4DC9A 1EP9A 221PA 2WIBA 2TMDA 1GXSB 4FHFA 4GRAA 5A4DA 4JL6A 4TSKA 5JW6A 2OV4A 4EEZA 4MUJA 4U39A 4JAVC 3SIWA 3OLVA 5ERXA 4BCDA 3KUDA 3GJ7A 1N2OA 3OCZA 4XDGA 3UG7A 4EMTA 1BX0A 3QEAZ 1G0NA 1G20B 1UMBB 2XE6A 5AO9A 3WNVA 4TMKA 2D0OB 5IMSA 2AG5A 4BPRA 1D6SA 3QE3A 4DREA 2P9HA 4N6GA 3CEMA 2DCUA 2OTLB 1YIJB 2F3TA 3DE7X 3SF0A 2XBLA 1GPDG 4YC7A 3QFFA 1E0AA 3ZHVA 2H3EA 3T9FA 1CR0A 5CBPB 1RRCA 4QHSA 3FMGA 4LVNA 4Q93A 4Z7OB 2I9PA 4WFKA 4HAUA 4UZSA 4HT3B 4ZVTA 4W82A 5K99A 2JH8A 1W4ZA 4HQ0A 2DX7A 1ODLA 3A4IA 3IUNA 1VQNB 1FU8A 1TU0A 2FE1A 2VOEA 3BAFA 4U7WA 4DLPA 3JQFC 4KO2S 5HK9A 1OGJA 4M7RA 1FNSA 1YZNA 2AG6A 4YCSA 3K6JA 2C7GA 2FLWA 5IWCA 4HB2A 5LFAA 4D80A 3DC7A 1Y98A 4EIWA 1EE9A 3X1JA 4TWAA 5B3JA 1MFZA 3OE4A 3QEMB 4OHWA 3EVEA 2GK6A 2QUZA 3HCCA 4KQWA 3T7EA 3CC7B 3R3HA 4NEQA 5IF3A 4PAAA 3P2MA 3W8NA 1JAXA 2V31A 3LPAA 4JU8A 3PDJA 5LU8A 4PSKA 2LIPA 4AS3A 3VKGA 2XGJA 1RXSA 2OP0A 4RPCA 5AHOA 1UPCA 2RC5A 4GXQA 4F2HA 4ETNA 5GGXA 5KX5F 4J6EA 3ZWPA 4BE7B 3HACA 3NVMB 1ZVVA 3RC7A 5H82A 3DMHA 1TQ6A 1DRJA 3W90A 2E6UX 2J5XA 1EDBA 1UIRA 4MRMB 5H16A 2PMEA 1FBNA 1BEUB 3P2EA 3ZJUA 1CUUA 1P7VA 1T1RA 1ZD8A 4XIFA 3BMNA 4LRWA 1FMLA 2VK8A 5IVIA 2A7QA 3TSAA 5JNRA 5EYPA 2GCOB 2V6BA 1J99A 2XZPA 4LY3A 3WO1A 4D74A 4FZVA 1THZA 1PJ8A 3EXIA 5I7UA 2G3YA 3KV1A 4YI5A 3UXMA 1JB9A 1G8HA 3JQQA 1SB8A 3PR1A 4R2MA 5AW4A 2ZR0A 4X8IA 1CUAA 2JLRA 5BSGA 1V35A 2Q5FA 1P8JA 4ZAYA 2IU4A 2VAXA 5LJLA 3VNUA 1SXGA 2Q6TA 2X19A 4XDYA 5D1NA 3ZJVA 5FWXB 3IMGA 2YZGA 5HQTA 4Z4UA 4V2IA 3B7PA 4XM1A 4A15A 4AQDA 4MMZB 2WSSD 2V6FA 2QU8A 1ZGAA 3VR0A 4UD6A 3USES 3RFFA 1Z6AA 3VBEA 5KYWB 3R2JA 2PUGA 1PCXA 1L1QA 4B3JA 2CLOB 2GF2A 5E9AA 2PX5A 5BSVA 1ZQ9A 3E23A 4DXHA 3V9AA 3CR3C 5CDUA 1RCFA 1ZGGA 2OSBA 3H2JA 2X8KA 2QTZA 1O58A 1PI3A 2WD7B 3L0BA 2HNBA 4IPTA 1E18A 1LU9A 2FN3A 3O83A 4XX0B 4BBJA 2ZXUA 3JQGA 1U2RA 2D06A 4XVQA 4YFYA 3VH2A 1ZQ1A 4K9PA 5REQA 4AULA 2FW7A 1KD1D 1JIVA 1KVTA 1MO4A 1N1MA 4IW3B 2P2LA 3WLLA 2XQIA 1G5QA 1EZ1A 3UXYA 1N3BA 3AEUA 4P86A 2O3SA 4RDKA 1PJ5A 1RYDA 1F6BA 2FP3A 1ZCAA 3OC0A 4LNAA 1UZMA 4UEKA 3U7IA 2XWSA 4BRWA 1A2QA 1G16A 4EGFA 2ZBQA 3T1OA 2J3KA 4QJ3A 4RK0A 3LBNA 5ALEA 5LB2A 5E1MA 4RY8A 5JZBA 1U65A 2NSJA 3LPNA 4UPDA 4CCYB 4QRDA 1KJ8A 4M1QA 3C24A 3JWGA 7YASA 1HFKA 4HQNA 1J8QA 3FNIA 3O73A 4KBFA 4U7FA 2PXCA 2QEQA 4Z4IA 1W4CA 3N05A 4DDUA 5LQSA 3NKFA 2D00A 2JHPA 1AUXA 1LK7A 1SHTX 1AHPA 3VR1A 3UMYA 1U4SA 2VZ0A 4YDSA 2J9FB 1UFQA 1I4DD 2ZRQA 3OCVA 3V1KA 3VVMA 3KEMA 1HR0B 1PJAA 1Z7GA 3R0IA 5CXXA 3B5EA 3D0RA 4V1CB 3PUVA 5LP6B 1HEYA 4LOAA 3STVA 3O4RA 4GQIA 4I4TA 4JUCA 3DKPA 5HUHA 4RTNA 7AT1A 4MWEA 3P9QA 3SDSA 3TR6A 2Y9PB 2W4IA 3COPA 3HB4X 3JQ7B 1ETHA 3M6VA 4IUYA 4I3FA 3UV7A 4FB4A 2ADMA 4QUIA 3BTVA 2PQ2A 4WE3A 5C1OA 1J24A 4MQFB 5CFLA 1Y3FE 1PNOA 2XTZA 3ILHA 4JL8A 3EFOB 1GQ2A 4QU8A 1S1MA 2CJYA 2F8LA 3E8XA 3PPYA 5FBHA 4PG7A 1D2RA 1C30A 4ACBA 1H2BA 3DTVD 4IDGA 2PXAA 1N1DA 1OCEA 1RJWA 3A6HA 1W29A 4WWVA 4OMCA 4FLMA 4ZVKA 1Z0AA 4DDMA 3HYSA 2B30A 2L18A 4DK0A 4ZGQB 1UKZA 2BOVA 3DMFA 3NM5A 2PKQP 4JS0A 1FFCA 1TLFA 3ZX4A 3ZS8A 1J7JA 4ZZ2A 3EVAA 3TQSA 4ES6A 2EGHA 4BX8A 2YCLA 3KS9A 1N6NA 5I7AA 4I4TB 4HAWA 4QUJA 4OH1A 2PUVA 2RG7A 3L1IA 4M1KA 2WJWA 4YJGB 3GEBA 3K1JA 3W6NA 2O20A 1YRWA 3BFKA 1VKOA 4N54A 4OBWA 2HHHB 4R71A 2PEYA 4RA6B 2AUNA 1Y3DE 5D6NA 2WKWA 3TEFA 3NP7A 1RR6A 1T0JB 2NV0A 1JJ2B 3GJSA 3M1AA 1R4MA 1RYZA 4M83A 3WKAA 5KWIA 2O2EA 4URHA 1MEOA 2I2CA 5ALKA 4YRAA 5JNUA 1FOEB 1SWWA 2PH7A 2XGSA 3GMDA 4ZQFA 5H0IA 3SKVA 5KWEA 3UJ3X 2Z8YM 1TFRA 3RIHA 1IHMA 1SZPA 3SFTA 2HJWA 1PK8A 4QIHA 4XGNA 5DGTA 5JZOA 3ORFA 3CXRA 4DEYA 3K0BA 1YR7A 2A1TR 4MVJI 1RYNA 3RTBA 2QTGA 2DHRA 2ZUDA 1EDEA 3Q7PA 1KKUA 1RW4A 3I55B 2X7HA 3LKBA 4JP1A 3TQIA 3VR5A 2C61A 3OIUA 1K2WA 3WOHA 3T3MB 4W8HA 2H1IA 3DSRA 3DGFC 3SFZA 1Z5ZA 4ERNA 1SCIA 1D1TA 2IEIA 3BA1A 4Y6RA 4LWQA 3BIJA 2QI9F 3E15A 4ONEA 3GJ8A 1GNLA 1U2SA 3DWIA 1INLA 1XZKA 3HHEA 5K8LA 4OGKA 1ULUA 3RS9A 2FR0A 1M7BA 2HN9A 4P81A 1Q7TA 5EE3A 4W4TA 3TNFA 3LT0A 1OWLA 5F2EA 5AKIA 4X1KB 3HCBA 1SK8A 4YVFA 5H3CA 2X0DA 1JHQA 1XXLA 1N9GB 3QUTA 3UC9A 4QD3A 1YOVA 4TTTS 1NBEA 4OHBA 2ZYSA 2GAAA 1QFSA 2II6A 1SURA 1T5HX 1U2EA 2WHEA 2YL2A 1A97A 3P96A 1L4NA 4PQEA 5CVCA 2JD0A 4A10A 1N7JA 3UV3A 2UU9B 4IQ0A 3RW9A 1OR8A 2VZ8A 5HGJA 3AM1A 4LYJA 2YRXA 1EX6A 2XECA 4NBLA 5GJBA 1GPAA 3COVA 3F6EX 3EIEA 2J07A 4EFNA 3IDQA 2D1YA 2BGJA 3RB8A 2NUPB 1GN9A 3D5QA 1ZWLA 3R3YA 3OU7A 3R5HA 5L95A 1IUPA 4NE9A 2RHMA 4E2ZA 4UTVA 3IX7A 4TN1A 3LAWA 5EPEA 3WL3A 1ULZA 3CUYA 2M32A 3EEYA 4JJFA 1CUZA 2PGLA 2PO5A 3DLPX 4XIIA 1ZUNA 1UK7A 2JIOA 3H4TA 2ZJ6A 5B53A 3HA5A 4GX2A 2HU2A 3RRXA 2ODBA 2OKGA 2Q3DA 4LZJA 3WE7A 1ZD4A 2MINA 5KDOA 3K8YA 1K66A 3T38A 2W2TA 5AUQA 4JXKA 4XIGS 3CZ9A 2OO3A 5J40A 5JD4A 2OXRA 5J4KA 1UFRA 1TM7E 1CSEE 4Q9DA 1JDSA 4PYQA 4I4TF 3UCXA 1EXWA 1EZZA 3PA8A 5LMZA 4B0PA 2OTCA 3COWA 4UMFA 2YBDA 3WNCA 2GXQA 3G8DA 1X39A 4J91A 3UJ8A 4F4IA 2BH9A 2A3NA 2HBQA 3HBFA 1AA6A 2RGGA 2O7NA 1Z6ZA 2YUTA 1ENYA 4OUDB 3W5DA 3G17A 3PF9A 3CF2A 4F96A 2XMPA 3HCNA 2IP1A 1ZKMA 2PKRA 1SVWA 5AHWA 3VU0A 4BFVA 1FYXA 5A4IS 1TCVA 2IRWA 4OAOA 3K5WA 1BD3A 2XF2A 1ZP6A 4NSNA 4XQGA 3T4PA 4C01A 4CL3A 2QTNA 1QFZA 1TZBA 4TLBA 4PS1A 4XH9B 5KNDH 2P9YA 1Z7EA 1SXPA 3DVRX 1V8DA 2R751 4DYDA 5CFNA 4IWNA 3L8GA 3UMRA 2QX8A 4AP6A 1D03A 2EWWA 2PD6A 1WB5A 2Q3JA 3FSEA 5EJIA 4EG8A 3KPWA 4IEIA 2AOVA 2IYNA 5AKJA 5HMLA 3G85A 3WADA 3X1WA 1E3LA 4EX6A 4KKUA 4K86A 5ICFA 5T7BA 3OM8A 1QTQA 1U0EA 2X0KA 3LQ6A 3QXXA 4EVIA 2XBMA 5KWJA 1ZEMA 3U13A 2WPDD 4QVIA 4LJLA 2ZJ3A 1K92A 3ZJTA 3A6PC 1WO8A 3M5WA 4TYYA 3STTA 3M6IA 1WW8A 1XQWA 4GRDA 2ZBFA 1WZUA 5BNIA 3WX0A 1V71A 2Q7XA 2BMJA 2CXRA 4BB0A 2ACWA 1QQ7A 3W2FA 1C3XA 2WYRA 4MNTA 2JN9A 1CF9A 4RWEA 4RHYA 3VPHA 4BAUA 1SKUA 4JC5A 1FPMA 4MB2A 4RMIA 2PGAA 3QEBZ 4REMA 3V8VA 3DEFA 3P32A 1J1IA 2D2VA 3MA0A 1WSAA 4GMKA 4ARBA 5KSWB 5IYWA 1IZ8A 1UD4A 1G5FA 2WPNA 1XU7A 3S1LA 1O8CA 4DV1B 2RGNC 2YQZA 4B76A 4FM9A 2I3BA 5JT1A 3UHPA 4BL5A 3LUHA 3D4NA 3I2KA 1RFLA 3Q5GA 4NCBA 3A11A 5DWQA 1OTYA 3HI6A 4X45A 4D81A 3NMUF 4H31A 3MCWA 4YMUA 2AK3A 4IF4A 4PGFA 1UAGA 3CF4A 4L9RA 2BIFA 1P7YA 1S0UA 1ZH2A 5J2UA 2HSDA 3HXTA 2P9GA 2I76A 3AUYA 3OLCX 4RMHA 5DBHX 1H2EA 1WCIA 3KHSA 2VKQA 4IIBA 3OEYA 1PZEA 1Z07A 4NAVA 2EYUA 2AXNA 2XADA 3K5HA 3MN1A 4L6AA 1FE8A 2BL4A 2JEZA 4O8ZA 2FWIA 3P0JA 4EAQA 4EFLA 2CNKA 3A3KA 3KKQA 4MWBA 5JROA 4ZAGA 3NPAA 2JAXA 1DBWA 3EXFA 1RVV1 3GW8A 1JYSA 4JLJA 4P4TA 2XCTB 4OLFA 3I04A 2ZTLA 5H1YA 4DMGA 3WY9A 2BBSA 3OZ7A 3TLEA 1WDLA 1TADA 3UTDA 1LNSA 1G66A 4I81A 3WB0A 3DV0A 3RS7A 3O9MA 2NTYC 4A9AA 1XNQB 1UT5A 2IF0A 4DQLA 5CT5A 1XZJA 1SCBA 1SQ6A 1GNVA 1RC0A 2RHDA 1PFKA 4EM6A 1J8DA 4OB7A 5E38A 1YZTA 1QK3A 5J35A 2X13A 3A6GA 4B44A 2XKAA 4LJRA 3IAHA 2X0FA 4CKEA 2IIQA 5LZ5A 1LPOA 3DCNA 2RD2A 1SH7A 3A31A 1K7FB 2E4ZA 3C3KA 5AW1A 4TYNA 1Y89A 1GARA 2RHWA 3BGIA 1NJ2A 2NO7A 1PD1A 1J0AA 3E9CA 4J4HA 4AL4A 5JSHA 1DIBA 3W4JA 4WK0B 5A62A 1EGQA 2P79A 3CRQA 1C7ZA 3M9WA 2IZ5A 4ZEXA 3ZXXA 4LUCA 1GG9A 3KZNA 4IG9A 3RARA 2GVDC 3N76A 1RRFA 2WNSA 4DJEC 3H9CA 4HTFA 5CFOA 3M89A 3OU2A 2FGJA 4FEGA 1V3UA 3KKLA 3NT2A 4WKBA 4CV3A 3I34X 1FP2A 5FPYA 1BOOA 4EKEA 5THXA 5K4GA 3BGVA 1KGSA 3EPJA 1A88A 3GDWA 2ISCA 4GMHA 4B3GA 3NW9A 2HA7A 4M54A 1HM5A 3QXSA 1E9RA 4BLWA 1R6XA 2C57A 1MPXA 2I0FA 2IC5A 3L7AA 3N2LA 1YB4A 3QOYA 1O6FA 4WN9B 5AM0A 2X5KO 4MWZA 2ZUFA 5A0VA 4OXIA 3IDAA 3WS7A 1C7JA 1H94A 1TKCA 4OOVA 3CTAA 5I9MA 1GUAA 3HXKA 4YK7A 2KBEA 4PLZA 4CBVA 2GN1A 2C83A 1DNPA 2QMOA 2UVQA 2X6TA 3I9MA 3Q2IA 2XUDA 3NEJA 4NZPA 5F33A 5KSPA 1A9ZA 5C5IA 1H5QA 4RBNA 4HNTA 1CUDA 4E2XA 5CLLA 1PO7A 3R7LA 2PZGA 5FL3A 5D1HA 2VEOA 3R23A 4ND6A 5GMOA 2W2NA 2ADFA 3HJNA 1R88A 2Y6UA 1AXEA 1C3OA 3GCDA 5LNK6 5FOTA 2DQ4A 2G5PA 2QX6A 5DGHA 4C3VA 1PK7A 3GEMA 4AMBA 9ATCA 3A6LA 1M0EA 1ZNWA 2C2HA 5C1BA 1Z13A 1IUKA 4QA9A 4X1YA 4Q7MB 5AUPB 4F86A 3LO5A 4FVTA 4X1KA 4BN4A 1PWZA 5D84A 3W78A 3OAAD 3ZQJA 4S1TA 1I4TD 2Z57A 4FCTA 3ZHTA 4NCKA 3VTZA 1YZUA 3HRHA 3IOBA 2V0GA 3FZEA 1ODJA 2QNRA 3T0IA 5KVCA 4ZVLA 1QB8A 1I5EA 4RY2A 1IOWA 4XFJA 4LE2A 1OW3B 1RIIA 4ZGWA 2FWAA 2QLNA 1KRXA 1XQYA 1SVUA 4UCXA 4NXMB 3LWBA 1NI4A 5TJ9A 3IUQA 4OI4A 1PDVA 3R7WA 1MAVA 4YACA 3IJEB 3CNEA 2JCXA 3G9ZA 4F38A 3PYMA 2PZ8A 1MRSA 1Q1EA 2NSLA 5ETJA 2ZBVA 4MA0A 1JWBB 4NFHA 1X1QA 2X6RA 4XWOA 5F7OA 3SJCA 3Q6IA 2O5EA 1KNXA 5EUBA 3IEXA 1MNAA 2VJMA 4ALMA 3A1TA 2B20A 3D1JA 3I6IA 1J07A 2O05A 5HP4A 4K3UA 1WZ2A 3T4EA 5TQ2A 1LI7A 3OTQA 4PCLA 1E5LA 1OFGA 3TZCA 3W8RA 1OBCA 4EKYA 2YWGA 4QVGA 3L7IA 2BR3A 4A36A 4JFRA 1GNPA 3FCEA 1QG4A 1QIHA 4KBYA 1FVFA 1R27A 2I4NA 4G23A 4LY6A 4ZO6A 5E1DA 3F98A 3RFCA 5LIPA 1NMSA 3AR5A 3AK4A 4PG4A 5CB0A 3M2TA 5JXIA 1GIAA 4XLLA 3SM3A 4Q0MA 1UD8A 3LGXA 3IT3A 1LA2A 4EMBA 1B2RA 3CBGA 2GTPA 2XWPA 3ZK7A 3IHLA 3R7SA 4RPIA 2I03A 7REQA 4C14A 1YL5A 3EJWA 2O3JA 4XI9A 4AO7A 1HETA 1DEHA 2FGKA 2FN4A 3T7KA 3V00A 2PSDA 4ZYUA 2Z98A 4Y9RA 1J1UA 1P73A 4DBZA 4X65B 2QN6A 4RTKA 4JQYA 3LH5A 1LPPA 1P3JA 3LYLA 1FW6A 3NASA 1E63A 1X15A 1OT5A 1T9AA 2ANCA 2AD5A 1RBZA 1X1RA 1VRWA 2CY0A 1CIVA 2CNWA 2I7TA 3C6BA 3NGMA 3NYQA 3PB3A 1JEQB 5CT6A 1EI9A 2NWQA 1PGQA 4IFTA 4A4DA 5ISMA 4MWCA 4JI7B 4G85A 3ABOB 1AOXA 4A2QA 3PWZA 3G82C 1RPJA 5AW7A 2BFOA 3U9SA 2DYKA 2FETA 3C3MA 4H1WA 2ECOA 2LTAA 2IBTA 5GY7A 4YJGA 4A2PA 4NHOA 1KQFA 2V3VA 4EGQA 3PNQA 4GG1A 3G4SB 3G6WA 2M6KA 3EIUA 1OBFO 1DZIA 3H16A 1SD1A 3SCZA 3U4QB 3ESYA 2O59A 2ORWA 1E7MA 2I34A 3SHFA 1HLDA 3FWKA 4QYIA 2H9YA 1LC3A 4M9SA 2IYFA 4CHGA 5JTTA 1O95C 3OPYA 1LF0A 2JFGA 4CF5A 5CITA 3V4OA 4CDMA 2E1RA 1J00A 1XZLA 3L04A 3EFOA 4DB4A 2B0CA 2VCYA 2XT0A 4BB5A 2ZRLA 2E3JA 4PGGA 3NT4A 1W0JA 2VJKA 1H0HA 4LPKA 2W00A 2J5RA 3CKYA 3GT0A 4TL7A 2FN8A 5C7IO 9MHTA 5CYGA 2JJQA 3T1VA 2JLYA 4K6OA 4HRAA 2I4MA 4GF5A 4HB4A 3KR1A 2FV8A 2PS9A 3UJPA 4LOKA 4DWOA 3JAWB 1TZCA 1V4VA 2BAGA 1GTJ1 2W6PA 3R8FA 5IYZB 1GU7A 1RI3A 4FCVA 4MMXB 1UR5A 1CUXA 3OW2B 1CQXA 1IM8A 2FW0A 3CRVA 3ASPA 1SR8A 2J6CA 3JZFA 2UDPA 1VE1A 1MIHA 2PJZA 4R4JA 5GOTA 4B3HA 1G98A 4TT8A 3I1JA 2C9DA 2YRWA 1WMBA 3MXTA 2A88A 1YA4A 2AMJA 1IY8A 3TTXA 3L8EA 1B76A 1T2VA 2QVLA 1KPGA 5K3SA 4A6PA 1ISHA 2CWDA 5TE9A 1YC5A 1BDMA 3ZZ1A 1O6BA 1N9GA 2JLSA 3B82A 5FFMA 2CMGA 1KDZA 4P3YA 4UZFA 5F4JA 2OCDA 5H59A 5LSAA 3JZIA 3EWAA 4CNBA 3BL5A 1I80A 1NUTA 3HGMA 2W6JA 1VSQA 3Q7TA 4LJYA 3F67A 1DRWA 4HVLA 4C0XA 4HV4A 2WF6A 4Z54A 2AQ8A 4L28A 2QMQA 4OP1A 1GPLA 3DMTC 4OIFA 2R2GA 3P2YA 4BUCA 1MW9X 1YITB 4FHEA 3ZV3A 4LF5B 4MDEA 2VEDA 1T5EA 3GUHA 5L7WA 3ASVA 5KVVA 3PHJA 2ZTVA 4GOLD 2CXNA 3IQEA 4WZAE 3WWCA 3GFOA 1CT9A 1DRVA 4BO6A 1QO0A 4AUEA 1CQIB 1BAPA 4KAJA 4IWXA 1G1MA 1QH8A 2W7TA 3BGDA 3G2MA 2OO5A 2GCEA 2QV0A 4OBEA 3EY4A 5IF9A 5JIBA 5HDBB 4KXWA 3HZZA 3BMNB 2FX5A 2DAPA 5C4IA 1JTEA 1I2BA 3EXHC 5JBNA 4DUZB 4RJLA 4LVCA 3A06A 1OV4A 3U4DA 3D4PA 3CS3A 3HDTA 2QDXA 3UJ7A 3KFLA 4NBVA 1E3DA 4YIKA 1NUUA 1ZNYA 1GU1A 3C7AA 3GARA 4G1UC 1YMQA 1B0AA 2HA3A 2PV0A 3NHRA 1Q74A 3CLTD 3DLCA 5TT1A 3QPWA 4UUQA 2DECA 5A1JA 3TOVA 3T06B 4R68A 4TRMA 1AURA 1QLWA 3G59A 4OSOA 1DLJA 3MCZA 3OPNA 1ITZA 2HJHA 2HRZA 2BDUA 4MCIA 3S40A 3RTGA 4EYGA 1F8GA 2JI9A 3NHAA 4XYGA 3TK1A 3WNDA 2VS1A 2YW9A 3HYRA 4TWZA 3OX4A 1P77A 1WVGA 2NPOA 3ZI0A 3DT6A 2XJ4A 1QDLB 3H42B 3AVXA 3V4VB 3VGJA 1XZNA 3MAAC 4FGKA 3DP7A 8ABPA 5K8VA 4HGYA 4DSTA 5KQPA 2JFZA 1HVXA 3IMCA 3KHTA 3TZQA 2IQ5A 1MC5A 4HQRA 1UQTA 1YE8A 2FPPA 2ZSIA 3AEKB 3U3OA 5CURA 1T9KA 1IATA 2ZJ7A 3LCCA 5DTEA 4ED9A 2X0IA 2Y1EA 1RJ9A 4IL5A 1XN4A 3ROMA 3GPLA 2NVOA 5JO9A 4AVYA 1MT3A 1RWVA 2XYQA 1CTQA 4Y30A 3IEVA 3TQFA 1D2GA 3ENKA 5FPTA 2HMWA 3OZXA 1WXWA 2AC4A 5H9VA 1KMHA 1DDIA 4F9GA 3FTQA 3M3DA 5EJ5A 1BWQA 3ENZA 4PYOA 3U9LA 2ZM5A 3AYXB 4NCIA 4DQVA 2MYNA 4JXZA 2JA1A 3G0GA 1UD3A 1YBMA 3EMBA 4UHFA 5CH3A 1SUSA 3IAM1 4G0QA 1NKSA 3LUDA 4YPVA 1SA0A 5AW0A 4G6ZA 1TMYA 1CY2A 3F71A 3IQZA 1VLQA 4Z99A 5AKGA 3A3GA 1BKYA 2ONJA 3RRNA 3ZY4A 4C43A 3ISJA 3VU8A 1LRJA 5F7ZA 3UK1A 3MSXA 2I71A 3NWBA 3P9KA 3PFHA 4Q47A 3FD8A 4C4OA 3W6ZA 3BMQB 3R3XA 3AIIA 4QYWA 1UEIA 1F2TA 5BSRA 1G5TA 2DH5A 4S0ZA 1DKQA 2H5IA 1J90A 1GUDA 3MYRA 4QG7A 2AS0A 1XUOA 2GASA 1HDRA 4NH0A 5LQRA 4NOLA 4TKUA 4MV3A 3KQKA 3OE7A 4RIGA 2O8EA 4JLPA 4D0NA 4MUGA 4V1CI 1MG5A 2WD9A 5C3UA 2FK7A 4E33A 5IEJA 3VO1A 4Q1BA 3FCCA 3O93A 1Q2UA 3PP8A 4XQ9A 1ZRSA 1T9HA 4Y2VA 3DQPA 3U48A 3UUGA 2NVUA 2XB2A 5A7FA 1M1KD 3HO6A 4PX3A 1P33A 4RDXA 3Q9LA 4OHXA 3FJOA 4FNGA 4HNUA 2QTLA 2ERYA 4L3WA 3W6OA 3N87A 4LHZA 4A3SA 1NX6A 3DWFA 3PFBA 3PXGA 3N7AA 1G8GA 3JASA 2GEKA 4OK3A 1YJBA 3GO4A 2LXNA 2FHPA 4QL3A 3OOCA 4LC1A 1CB7A 1SC9A 4LTMA 1LPBB 3W5CA 2OXIA 2XQKA 3O3NB 5FB3A 1L5FA 3A1FA 1XBTA 3B9PA 3JVIA 1R5NA 3KT3A 2O9JA 4IDQA 4QFMA 5K6RA 2NP7A 2JZNA 2O8CB 3UK2A 3RDPA 1I10A 4XWKA 1DAMA 1XZDA 1V7QA 1F4LA 1FP6A 3JAWA 5IHPA 1N3IA 3TW8A 1NXXA 1SXQA 4FQ5A 5BSHA 1NRWA 1K5HA 4URFA 1AKQA 4AB1A 5BSWA 2IPLA 3CZPA 2GSWA 2PK3A 1DTWA 2QZJA 3PLNA 4PAQA 1GWNA 2JBHA 3SYLA 1T8PA 2QBYB 1OWOA 4BNDB 2JATA 5HDQA 2ENWA 3RE1A 1GQOA 3TI9A 3W06A 4EY8A 1G8AA 2W6CX 4Z4VA 3QOXA 5EIBD 4B8ZA 2Z08A 3QPVA 1A0OA 4XUGB 2R6CA 2R84A 5AXDA 2LGJA 3UT6A 5F4MA 1M8GA 1XNHA 4U5QA 3RVBA 5BUSA 1BXRB 2L19A 2RK3A 3HPQA 3A0RB 5TEVA 3RT7A 5CB4F 3HJFA 4KLRA 2ZWVA 4PHTA 1Z74A 1DJOA 1MCZA 4XPZA 5F2OA 1UC9A 1SXJB 3P9SA 1GXSA 2YN2A 4K3VA 4P08A 3WZ2A 2F90A 5HGXA 1PQ4A 2XR1A 4LDJA 1NM5C 2Q5OA 4NPHA 1QVWA 1XTIA 4ZA2A 4J1NA 2O1SA 1R3DA 3QKSB 4KAAA 3F6RA 3IAUA 5EQDA 4RELA 3HV2A 3QXJA 1FDTA 1XTSA 4P3NA 3BYZA 1HMYA 5FFNA 3B1KA 2PZJA 5ECYA 3DVLA 1MAWA 3OT1B 5FO1A 4O1HA 5I51A 2G1AA 5AI5A 1JIQA 4YA6A 2P4HX 1XAJA 2WYOA 4OQXA 5BUQA 4Q4AA 4BX2A 1YS7A 5K4AA 1TVEA 4AYTA 2V8BA 4CVNA 4IUBS 3WMFA 4EO7A 4GUDA 4R3NA 1UOQA 2BKLA 1L6IA 4G41A 3ZVNA 5ICMA 5D3ZA 1IBMB 5G1OA 1YCFA 2IFTA 3CJRA 5EWLA 1YRAA 2FJUA 3WBJA 2DWOA 1DP4A 2HU7A 2QV7A 5AVSA 2R7AA 1IE3A 1AQUA 2P62A 2B7BA 2RGUA 4L4RA 3AFOA 2QNBA 4I6JA 1U6IA 3H2SA 3FZGA 2Z2XA 5E9QA 4I1YA 2F43B 4M8KA 5LNK1 3O82A 2VHVA 1L3CA 4TYPA 1VSBA 4RW0A 1F38A 4RZ3A 4LGMA 5DM1A 3QI7A 1NBME 1DLIA 5FOWA 5C7LO 4KPYA 4K6CA 1V8FA 4XEUA 3DCIA 2F64A 4C5BA 5EHZA 4G09A 3QKIA 4PCVA 1KDOA 1UFOA 2XH8A 5AW5A 5JO0A 1JN0A 1W93A 4V0ME 3ODPA 1AS3A 4DBLC 3ET4A 3K0SA 2O06A 3HEBA 3NOOA 2Q7OE 3PXCX 5K0BA 1O94A 1VDZA 2WUVA 3D2BA 3JWIA 4LSMA 5AJTA 3LDGA 2NYVA 3K9LA 1EPUA 1KIMA 2WTNA 1SVIA 2XI4A 2R7LA 6ABPA 2JLWA 2OHFA 4CRWB 4JB0A 4RGVA 2AOTB 1U3CA 5LCXA 5L3QA 2R1VA 3GLTA 4UW9A 3ONNA 5TQ0A 1U7TA 3L0DA 2W2LA 4GSYA 4C6TA 1F17A 2EVWX 1Y5LA 4K6KA 4JI8B 1G4AE 1AB6A 2Q5LA 3Q6QA 3I1YA 3W0LB 3H3XA 2I66A 5TQVA 4AXXA 4RX1A 2C1ZA 2ACVA 2GZDA 3IALA 4M55A 5EZ6B 1IOLA 4B73A 5J1SB 3H6KA 4KXNA 3NV7A 3AY6A 3RVLA 3DPSA 4HB0A 2BFFA 1PLJA 2IU3A 3WYEA 4CL0A 2VQDA 2B83A 2CL6X 3E4CA 4HTAA 2IX9A 4DBVO 2F17A 1FY2A 5KNBH 1E7QA 4OD0A 3WZMA 2PUTA 2XKKA 3W1VA 4YEJA 3DPUA 3T95A 1JFVA 1J22A 5LJIA 4E3WA 5KJCA 1GDDA 1G8KA 4KGVA 4MAMA 1KF0A 3BC9A 5FI3A 3JALB 3N8KA 1SC6A 1XNJA 2GK3A 3MD9A 4C0KA 4HH3C 4FS3A 1RKXA 2GPWA 5K3BA 3UJBA 1RZRD 4HLDA 2GILA 3NJ4A 2ZPTX 3B2QA 3WGYA 1FFSA 3ROZA 1VQPB 2CLLB 3TRKA 1WXHA 1HI9A 1IHOA 3HY3A 5KCMA 1ABBA 2W43A 2NUAA 1NI4B 4PSVA 3O0TA 1XD8A 2UUAB 2BVNA 1QAQA 5DM2A 1UM9B 4JGGA 5K3AA 5JWHA 2P91A 3DO8A 3UAGA 3WTCA 3AIOA 3BE5A 1QYCA 1TYAE 4NZMA 2ID7A 3C98A 3RCBA 5SZKB 3DTTA 4O59O 5LZ7A 4HXEB 3V55A 5A9TA 1JLLB 2D8MA 2WVHA 2O4UX 4IHKA 3H94A 1DCFA 1PRYA 1T4BA 4UREA 2RHJA 3IP7A 4BNZA 5FD8A 4WRRA 2EF1A 1FMJA 4RA9A 4ZO4A 3TR0A 3GGSA 3EFBA 1TA0A 4ALJA 8ATCA 4PR0A 1DX4A 1ZR4A 5HZAA 1U2GC 2JAQA 1QIJA 2FUNB 4P38A 3JXEA 1XEXA 1RPAA 2J46A 4WNCA 5TC4A 2OUKA 3L8HA 2V7XA 3HU2A 5I8ZA 1NN3A 4Z1MA 1EX1A 2ZI6A 3CM0A 3MNFA 4JJ6A 1NRKA 1BMQA 1M83A 1R6AA 2V97A 2B5WA 3HKEA 3NLLA 2ZZQA 3OJWA 2OG1A 4C0QC 3BUSA 3D8UA 1L4YA 4A0FA 5LLDA 4QZVA 2IE0A 4Z4YA 4TYMA 1T91A 2OGSA 3L1VA 1HT0A 3R6DA 1J06A 5B2ZA 4L0QA 3S2ZA 3WSWA 3W3AA 4CIYA 1Z6QA 3SXUA 3MHTA 2AD1A 2HBYA 2XVMA 2CMHA 4CV0A 1CR6A 1T2CA 2FLVA 3PV0A 5BQ5A 3A8IA 2QRUA 2FFJA 3QMMA 4IS3A 3T3EA 1N5MA 4EA8A 3GF4A 4MLCA 5EY5B 1MP0A 1W0CA 4HLUC 1TF2A 3AESA 4O6VA 2HLPA 3Q3EA 4HYQA 4B81A 5KPJA 1F7VA 4HNVA 2ECKA 2CJFA 4D96A 2R6FA 1L3IA 1SIUA 1XRNA 1M2WA 4XLCA 4YQZA 1HO3A 2O8DB 1Q1ZA 2IOFK 4L7VA 4PIMA 4HDSB 3CRW1 2ETVA 2WSYB 3WGLA 4AG6A 4OGFA 1U8FO 4QO8A 4DL9A 1TYEB 1HORA 1UOPA 4MROA 2GDJA 4KACA 3EULA 3I9V6 2OYSA 2C7PA 1PT6A 2V7GA 4ESEA 4JLKA 3B13B 2CXTA 3NNNA 4MUYA 3FKJA 3K9FC 4LV8B 3SYTA 2HR1A 1W88A 1GLGA 3ZDXB 3KSAC 2B82A 2YXNA 3K9BA 1N33B 2ATEA 4M9UA 1BFDA 2VK4A 3LLUA 3S8MA 1Y4SA 1YOVB 3NIWA 2WYHA 1E6KA 4GI5A 3L18A 4WVFA 5C4GB 2DFNA 5SYAA 1Y6RA 4UDYX 5KPDA 1UL1X 1FMTA 1W88B 3T61A 1UQUA 5A3SA 1A69A 4ZRDA 4B4WA 4TTSA 5GONA 2HPVA 4GP6A 1U3TA 2IYLD 2HZ7A 2C7BA 2AN5A 2AEMA 3LSYA 4HSGA 4L85A 3VSAA 2N1MA 4QRIA 3SI7A 4II2A 4KQ1A 3VZCA 1HDOA 3VR3D 1BD4A 1UPFA 1DIHA 3MWDB 3MZ0A 1G6OA 3WWYA 2G07A 4A73A 1JILA 2ZU0C 2XUPA 1VKNA 2H0QA 3N5KA 3ZGZA 2UV8A 3D1LA 2CDAA 2WJ6A 4MRRA 4C0HA 3ER9A 2P77A 3HWSA 4UBOA 1EWQA 5J3OA 4E14A 1JDUA 3GVPA 2D1QA 2QQEA 2WUGA 3GY0A 2FXVA 1RPZA 1E2LA 1JIJA 4QVJA 2JHAA 2MSDB 2GJSA 2ZYRA 2HLNA 1JKJB 4NU6A 4NEGA 4Z7JA 2WU3A 1RYYA 2ASEA 4G5XA 3SBEA 4ZJYA 4KZKA 5H81A 1UDCA 4Q03A 1LNQA 2HDOA 5FJJA 4CI9A 4MS3B 2ZZGA 4DV6B 3EEOA 1UKYA 3KRTA 4KVFA 4LMPA 4EPVA 4Y2XA 4XQFA 1ULTA 3SS9X 3UWSA 4ZT7A 4DFDA 5F35A 3MTQA 1H0SA 1UIMA 1MT0A 1BCSA 2O0HA 4UM7A 2CDBA 5TGTA 1L5VA 4G5YA 5K0EA 5K9ZA 2OG2A 5CH8A 4KWEA 4IQGA 4ZV7A 3ER8A 4K1XA 3I9KA 3QLTA 1QE3A 2MINB 4K03A 2FPIA 3C7CB 4G8JA 2EOAA 1PJ4A 3G5LA 2ORVA 2P1RA 4FIDA 2W2KB 1U0JA 2XVYA 3GUZA 3NAMA 4L5IA 5B1YA 1PKEA 1PJQA 5ICSA 3LTEA 4U7PB 2XCRB 5DLQC 5CAEA 3CPXA 3KQQA 4ZRMA 2VSYA 3BRQA 3HH8A 4L3VA 1D1PA 4MEAA 2J08A 2PANA 1HNZB 3LVRE 1Q7BA 3B52X 1LUAA 1Z45A 2NACA 4HKTA 4OA8A 3A6JA 1H9BA 4JX9A 1JNXX 4AIRA 4D3DA 3WXMA 2R6R1 4BQOA 2P0EA 4QOGA 3L7KA 5D87A 3BHMA 1HQYE 1H1DA 2CF4A 1T5OA 4WXHA 1UBFA 3EQ7A 4PO3X 4BNLA 3UMSA 4KJXA 1GL9B 2W6QA 3ZZTA 1ZDMA 5F4OA 2LP4Y 2O48X 1KR5A 2PMBA 1CYEA 1UEXC 1CC1S 1MKYA 3V7UA 4EJ2A 1JKJA 1NP3A 3FWZA 5LP1A 2W2KA 1QYWA 5A8AA 1OIXA 1SOVA 2ZSFA 5ALMA 3WLIA 1NI5A 1C7IA 3DUWA 1NAIA 2FFRA 2PGOA 4GGOA 4N8EA 2VK1A 1UAYA 4MPTA 2Q50A 4H2DA 2Z3VA 2ST1A 3BILA 3CUSA 4CLHA 1G2IA 1JR3A 2ERCA 3NBQA 1EQ2A 1Z3IX 4EYKA 2XCQA 3A70A 4FWTA 2ZI7A 1NTOA 3QPCA 5DPMA 5I4IA 4GR5A 5JPCA 4CCSA 1ZD5A 2E6KA 3BFJA 1VHQA 2QW0X 3KZVA 2I54A 4DANA 3AERA 3WB2A 3PA6A 5JSZB 3N8IA 1QZTA 1XDGA 3Q9NA 2G06A 2RGEA 3GLFE 1H3NA 5JZ9A 4OA5A 3B78A 3A2NA 3CCCA 1N2EA 2VWHA 3P9ZA 2J30A 4MWTA 4TWRA 3FY4A 1G60A 4UM9D 5FA5A 4JKYA 4MJ7A 2DUWA 1XAGA 1ACMA 4EDHA 3H75A 3TLXA 2DQYA 1XP5A 3D7KA 3E27A 5IJ0B 4Q4LA 3L92A 2NU8B 1AIPA 1E3IA 1BS1A 2BGMA 5AK3A 2X77A 4KBGA 3VHQA 2IT1A 4E7OA 1E2JA 1QGUB 2IWRA 3CRMA 5H9WA 1RLTA 3HN2A 5BSUA 3WIVA 1B6RA 1V5GA 5KBYA 4DC1A 3LP8A 1I1HA 3NIFB 4XPIB 2GLXA 5DRYA 5DYNA 5H4HA 4B7AA 5TV2A 4DS3A 1SQSA 5ADVA 1NZJA 1ZH6A 5JY1A 2GXUA 4LFBB 2BDTA 3H0KA 2BMEA 2DBZA 3SHVA 3VO9A 1IEQA 1KI8A 3AINA 4BJHB 2O8DA 1YBAA 4IS2A 4F9FA 2XCSB 2J87A 2J5BA 4EFDA 3VJRA 4CM9D 1UDRA 2M2IA 3QVUA 1RMQA 4E5NA 4AX8A 3BX1A 2JKZA 3QXGA 1B6GA 2G77B 2GX6A 3BY2A 2H29A 3PGVA 1VQ8B 3Q3CA 4JJ8A 5ALHA 4AZ0A 3MF4A 4YECA 4M99A 1I3KA 1W1IA 4ZALA 2Q2QA 4AXBA 3RSSA 1X1TA 3K0AB 4ZYXA 4OPVA 1DHTA 3GV0A 2QT0A 3F8WA 4CQMA 4EHAA 4ENTA 5HXAA 1ZKDA 4ND7A 1JEYB 2BM0A 2BWJA 3MELA 3NBFA 4WCDA 2FRVA 4S1WA 1S72B 2X2EA 2FWBA 4D3XA 2D4AA 2VCHA 5IM4F 2NO6A 3ETDA 4Y18A 5FOVA 4UMDA 3WDLA 4LFAB 4I1VA 1YTLA 4HAYA 5IYRA 3QVWA 5CNKA 3ZIDA 1KMCA 5CB8A 2FCRA 2QZ9A 1DSSG 2IZZA 4RKQA 3GFRA 2VDLB 5JCPA 5JWRA 1NQVA 1XAIA 3FOBA 1YQQA 1RIFA 4PBRA 3D0OA 3B60A 1QQ6A 2WHPB 1U4NA 3EPHA 1ZFNA 1VPTA 2NZXA 2Z5GA 4P93A 2H1VA 2IK8A 2NVBA 2WWIA 3KQWA 3NEYA 4GRIA 4H1HA 4P3KA 1ZW6A 3CUUA 5A71A 3WRYC 3EX7C 4I1UA 1I2ZA 3SPXA 3AVOA 1NXPA 1GA6A 1LDNA 2CF6A 2HRCA 2ONYA 5DYIA 5ECGC 1IHXA 1MVOA 3DT9A 3HO8A 4QYMA 3EXHA 3HYCA 2P9QA 1K63A 4ECAA 1E3ZA 4RQBA 3W2TA 3GEIA 3TIXB 2DFPA 1QGAA 4TLCA 4KXXA 4HDAA 5KYYA 4JIGA 1G19A 3A3YA 2QJRA 2X86A 1TECE 5DNEA 5LB4A 5EMKA 4WZTA 4AJHA 4OPOA 2ZI3A 4DABA 2WJ4A 4BZWA 1BU8A 2VUIB 1D8AA 5CXQA 1NQAO 1EK5A 3FRIA 4FZRA 3L0OA 1T3ZA 4NQRA 1Z12A 5KKNB 3KR2A 1A72A 1ZCJA 4IO0A 4XZ3A 3U37A 1FLVA 4K9OA 4FFOA 3WNQA 1L5WA 5A9SA 4U00A 3KQHA 4HQOA 3BGOS 1FX0B 1LX7A 1O9HA 3KT8A 3BRWD 1Q1AA 1UKCA 3JD0A 4ZCPA 4CQJA 3OEEA 2DWPA 4G4SP 2W58A 2V5UA 3EVFA 3QBVA 4YRPA 3SLGA 3SQLA 2GEFA 3NZEA 4JYZA 1L7OA 5CUQA 5LYJF 1NULA 1JPUA 2P4SA 3KOZA 3PGA1 2J3MA 3NFRA 4HXFB 5BYAA 1YDHA 1AO3A 3WLJA 3S70A 4YCMA 1BDHA 5IJZA 3A37A 1UJBA 1AN0A 1G8FA 4Y2GA 3C3XA 4G0WA 1KARA 1XMSA 4P2GA 1W4BA 3E5HA 1SOMA 3H9GA 2GCGA 3ZGOA 1CD5A 4BRUA 3OLWA 4XJSA 1Y8ZA 4LHYA 4Q7EA 2VUTA 1Y8CA 2ECQA 1A7KA 3L1HA 4NWIA 4TUYA 5IDVA 2O19A 1KI2A 1R9JA 2V65A 1ZR2A 3CGGA 2G17A 5CG1A 1H22A 2HBRA 4INOA 2CHQA 2MYPA 5KQLA 1QF9A 2HWKA 2H9IA 1ODSA 1ZONA 3JVUA 4GYKA 5C35A 3BHJA 2BFCB 4MJXA 2Z8YA 3ESAA 5CGZA 1TQ8A 3IVGA 1FYFA 2G1KA 4GKJB 2YJ6A 4F11A 2O1XA 1Y5MA 3AR6A 3SQXA 4UEWA 4KQ2A 1GU0A 3V1YA 1H2RS 3LUJA 1CRLA 1SBQA 2IS6A 1YHQB 1KQPA 1Y9JA 5EYPB 2OCYC 4L5JA 2ZAIA 5BW5A 1S8OA 1WOYA 2GJ4A 3AF4A 3OPYI 3ROTA 4F06A 5HJEA 3WRVA 3ASZA 2P6NA 4P4SB 1B0PA 3IMEA 3BGSA 4TVOA 4YLYA 3TRFA 1V6CA 3KSUA 4N01A 2G72A 2WHXA 4DDTA 4XYLA 3DZBA 3IYLW 3HKBA 4R0NA 3GSIA 4PVCA 3DVQX 3TAHA 4Y9UA 2ZAOA 3DFUA 5KYKA 4JKIA 4D8WA 5HK8A 5BXYA 1FQJA 1F9AA 5LA6B 3T1YB 3JQ7A 3QFHA 1TD9A 4PE5B 1FQWA 3I3SR 1U31A 4CMIB 2P30A 2QIOA 3F4KA 3K7EA 4LSZA 4M37A 3TNDA 3WGHA 2RKWA 3DVSX 1WXDA 2WINI 1E79A 5KTMA 3IL2A 4CL2A 1E66A 3GIRA 1AUOA 1JVSA 1GRVA 2PZEA 3CN9A 3EG9A 4NU0A 1GO2A 1YDMA 5FNZA 1LLCA 1U2DC 1EFTA 3B51X 3KAQA 3KYDB 3SE7A 4MWOA 4EG7A 4DLRA 1FP4A 1KH1A 5EJ4A 5J43A 1T36A 4XYMA 1ZPDA 2GEVA 5B1HA 2ZRNA 2A57A 4WZAA 1PFUA 3SSOA 1RADA 4I55F 2G08A 1KC1A 3CB2A 4N8DA 2VHZA 3VDRA 4C06A 1N4AA 1ZN7A 3PHCA 3IAXA 3R9XB 1QB7A 3RBZA 5IVHA 1N78A 3TJRA 1RHJA 3L7YA 5GZ1A 2C5SA 4EB6B 2ZCUA 1SU4A 1NU6A 1DQSA 3IPXA 4XN0A 3BIOA 4FW9A 4JHXA 1L4HA 2GXSA 4UNSA 4WXMA 4TS9A 2WR8A 2Q28A 1VJCA 4KE9A 1D07A 1RXUA 1ZJ6A 2HFJA 4WZBE 1QHYA 1RI5A 4JLOA 2QZPA 4LXUA 3AVUA 1PDWA 2AUTA 3FYUA 4FW8A 3MCVA 2WVJA 4RYLA 4XASA 5FBLB 4OL0A 3VVCA 3EDRA 4OQEA 1X13A 1S2MA 1ADYA 1JECA 1J09A 4A0HA 5B7QA 1UD5A 2NQ2C 3B3QA 2WP0A 1E2FA 4FIZA 4JGBA 4R2KA 3NALA 1S96A 5DGIA 1ND5A 1SBIA 1KI7A 5F5NA 2VHYA 4PFSA 5AJZA 3HRKA 1XK6A 1XQ6A 4NMWA 2OFFA 2ETXA 4G5FA 4BDTA 3K8OE 5HILA 4DWWA 2GZ1A 2X22A 3MT8A 3KM0A 3L93A 3O4FA 4NNPA 3AR4A 3LTNC 2VPTA 2NU7B 1F5SA 5BV2P 1DAEA 1RD4A 2F3PA 3KTAB 4O4IF 4UFPA 1A9PA 3V4SA 1PEDA 2Y93A 4COOA 4MOWA 1ONNA 5EWMA 3C70A 1K73D 1TAQA 4HZUA 1KYIA 1MAAA 1K6IA 3GJRA 1G7RA 3I4FA 1QHHB 4HWOA 3TG2A 4DJFC 3EVBA 2OPHA 4IAOA 3W7VA 5BXQC 4O3MA 3OKXA 3WGKA 3UB4A 4X7PA 1W581 3PUIA 1QP8A 3PEVA 3QSGA 2HK7A 1VIMA 3T15A 5LUBA 5IYQA 1JE0A 3HUDA 1JLSA 3OJ0A 4WKNA 10MHA 1Q14A 2J0SA 1G20A 4FOLA 2C2WA 4G4IA 3CH6A 4HVCA 3WLAA 3ZY6A 2C0PA 3DHVA 3A4TA 4QJ5A 2LUOA 4D6YA 3MHPA 2E2WA 3L0CA 5GOZA 2IS2A 1N36B 4OGLA 5ITZA 4FN4A 5JJLA 3A6ZA 4F4DA 2KJQA 4B74A 5DSZA 2JGAA 4YDRA 5A6VA 1YQTA 2C4KA 2GWHA 3DDYA 1U0LA 3B2EA 4MUEA 4PU0A 3SQOA 4EJSB 2FB9A 3CLUC 5EXTA 2VP4A 3IH5A 2EEZA 3GNSA 4YUXA 5K0SA 4YP5A 1SUEA 3EGXA 1JH8A 3ASTA 5CM8B 4B31A 3AMVA 3LSTA 4UTRA 4WZKA 1EFKA 1Z2DA 4DCUA 5D8DA 3AB8A 1T6BY 1V5VA 2F1OA 3AETA 4MPDA 1BRMA 5CLQA 4OHZA 3NIDB 4ZI5A 3ZE7A 1EIWA 1SBHA 3O94A 3T1HB 2BD0A 1T4MA 1TT5B 3AUXA 1T1EA 1ZJZA 4LA4A 4C87A 1VBFA 2RGAA 3NKLA 4CLXA 5KNCA 1EK1A 1CKEA 5BR8B 1Y8RA 2IXDA 1GJRA 3ICPA 3C7DB 2MSNA 1MAHA 1C9YA 5BPFA 2WIKA 4I9HA 1X94A 4US2R 1RABA 2CL0X 3COSA 4ZCTA 3W5VA 5DW0A 3RHZA 4EHKA 4PX9A 5JYCA 1NRJB 2WM3A 1Q86D 2GNAA 5E1BA 5HZKA 3H8SA 1HNNA 4D92A 4U2DA 1YB5A 2A6PA 2AJLI 4JJ7A 3OKAA 3FR7A 1U0OC 4MCHA 1WXGA 1WDKA 5HA5A 3P0RA 3ZGNA 1YS6A 4BFCA 1KY3A 2H1WA 3IOYA 2QKYA 2GTHA 2AOUB 2QT1A 2WYUA 2XUOA 3EXEB 3GZJA 4K5QA 1FRVA 4U3JB 5B1SA 3ZCXA 4DYVA 5CLJA 2HT6A 4MW4A 1MPTA 4XVHA 4WEQA 3TM5A 1H4VB 2V54A 3KOOA 2HSZA 3U80A 3VYWA 3NKVA 2BMVA 1L5MA 2P3OA 3OIDA 4GP7A 4CLOB 1YI8A 3ZWXA 2XWJI 1H85A 4KQXA 2C4WA 2A5LA 4QM7A 3SZ3A 2ID4A 4PSUA 5DH9A 4EGCB 3V2GA 5ABPA 2EFHB 3W9YA 5K6TA 5JCZA 4CGYA 1K9SA 2H4WA 1NX9A 5F1YA 3Q3AA 4NARA 2B9EA 3QQPA 3F3MA 1KDVA 5HS4A 3A26A 3TKAA 1CWUA 3CXCB 4IR7A 1RMTA 2C2MA 3TAXA 1EYZA 2ZUEA 3H84A 4KWIA 3ICQB 1ULHA 2J3EA 5L46A 3AVVA 4O4LF 1SO8A 2OBTA 1QXSA 4OM7A 4OUKX 4IX1A 4IDEA 3VKVA 3CZMA 1HDGO 1Y9EA 1L7RA 5LBTA 1YB6A 4ARAA 3D64A 3EQ8A 3ZK9A 2ZYVX 4C4RA 4HZIA 1ELOA 4KQCA 4N7MA 4ZCMA 3UMGA 2QUKA 3DXYA 3ZVLA 1VCNA 2WJAA 1N8NA 2A94A 3D8RA 2VDMB 4YXWA 2C5GA 3HKCB 3MAGA 4GMFA 4H27A 5CDYA 2XZTA 3D43A 1CR2A 3M3PA 1IBLB 1LVHA 4D4KA 5JRZA 1B4DA 5KJEA 4YGXB 5IK2A 2OO5C 2V5AA 2VHUA 4CMEC 1JT9A 1U9JA 4R5HA 1OSNA 4HUTA 3HR4A 3OZDA 1NN0A 3FCYA 3RNLA 3R9XA 4RTPA 5K3DA 3QJYA 2RGDA 1NC3A 1SPXA 2QVGA 2FG7C 2B37A 4YJ3A 4M9XA 2AOWA 3ENVA 3N1UA 1OI3A 1E69A 2KBFA 4ND8A 3HM9A 1F8XA 3CZCA 3QY0A 4NEHB 4ZZ0A 4LK3A 5IM4A 4KITB 2WTBA 1V5WA 5ITZB 2VJLA 3GGOA 1J9ZA 4DCJA 2CWWA 5DXAA 3OO1A 4WINA 2P75A 4JODA 4KRYA 4OYLA 3QBTA 2PL1A 5BO5A 1VYHA 4W9RA 3W2EA 1UH5A 1Z75A 3NCTA 3VH3A 2R7MA 2CVFA 5IFKA 2JBWA 2CLMB 3FPFA 4AT1A 1ZI8A 1LBHA 3GRPA 2QSJA 3IIJA 4GZ6A 2VJAA 1AXRA 2TMYA 2CK3A 2Z43A 3KHUA 3CA8A 2EARA 2XXAA 4GX5A 1EFLA 4LRTB 5BOVA 1E61A 2Q2VA 3FSGA 5D5QA 5EFOA 3GJ5A 2NZYA 5CD9A 3PE4A 3ZHCA 4EUHA 1RWNA 2CK3D 5AJYA 1YJ5A 2OE2A 1UJ2A 3ER6A 4M0DA 5I9SA 2CC2A 4P34A 3VVBA 1YQUA 1VBNA 2J4CA 5AT1A 1GPUA 2UZ3A 4LTNA 4W6ZA 2NU8A 3I09A 3ZIUA 2GJ8A 2WUDA 3GBSA 3EMKA 4UVIA 2O2HA 1V2HE 1F20A 2FG5A 3BK1A 3TGPA 4HYTA 3FPPA 3O1LA 3ED1A 2D1FA 1VQ5B 2FFQA 3BICA 1UT8A 2JAPA 2M6LA 1F1JA 1KOJA 3GA7A 2D7DA 2FPKA 3P2KA 4HGOA 3OA0A 1VL1A 1NVVR 3C85A 4G9EA 4LJ5A 1PUXA 4RL6A 1L5LA 3NO4A 1PYGA 2X5JO 2H7CA 3EC7A 2BLNA 4WKCA 4MRPA 3CCFA 4M8LA 4ZO7A 1K9MD 4GVXA 3PHLA 4CN8A 4EPWA 1DAFA 2Y2VA 1VPVA 5C8YB 1IHPA 4R41A 2FFAA 2XNJA 1A4IA 3BF7A 1Z4MA 2DQSA 4H3SA 821PA 4OLAA 3LA8A 3SBXA 5DK4A 3V5NA 1X8LA 5C5EA 1GCGA 3Q41A 5CMLA 3PUZA 4UUMA 6AT1A 2HB6A 3CPHA 2WHPA 2Z5VA 3ELWA 4LXXA 1XZ8A 2G28A 3R7BA 1E7WA 1Y0RA 1KHTA 3MJEA 2YICA 3IFSA 4M36A 4NFYA 4M0MA 2YASA 4ZGNB 2EHJA 5JARA 1T29A 2H2IA 1BFUA 3DG9A 3FIJA 1ND6A 1CHDA 2J6BA 3P94A 1K5PA 5ITVA 1YVPA 3ROXA 1AGRA 4DNRB 1NSTA 1P74A 1NYLA 3ZY3A 2QA4B 4QUHA 2XYRA 5F9HA 2I7DA 1TRHA 3HMQA 4LGVA 3VPAA 3TW0A 4GEKA 3CW8X 3GEEA 4TXJA 5EC8A 4BBZA 3FOFC 2VTDA 2FNAA 2PNJA 3WKDA 5F23A 1E99A 2GDZA 3HSYA 3KEGA 4G1VA 2GD1O 1ZXLA 4NCXA 3WLNA 3JQ6A 5KX5B 2LVBA 3F6YA 1N5KA 5DTRA 4DB2A 2QPTA 4N3NA 4AN1A 3W1EA 2C7RA 4Q1VA 1C9NA 2AE2A 4ZJPA 4MWDA 1OXKB 4WBXC 5FL7D 5AXCA 1RTTA 3EZGA 4B80A 2BKVA 5DISB 1I7LA 3V3KA 4RLFA 1NSYA 3H2IA 2EKQA 3E9RA 1RKVA 1COWD 2ZI9A 2X6QA 3HC7A 3ND9A 3TRDA 4NMMA 3B1XA 1AGXA 1NKVA 1X77A 4IICA 4RUKA 5H83A 4CUJA 3ROQA 1HT3A 4EB8A 2X6XA 4IDDA 2BGTA 2XHEA 3IJRA 4KAXA 3SIPA 2Q3EA 3HXMA 1SQFA 3QLVC 2EKPA 1DJPA 2IL1A 4WGGA 1XVIA 2HXYA 1G21E 3T34A 3ZW8A 4GICA 3BT7A 3LHKA 1EXNA 1VGVA 1XFDA 4PZAA 4ANFA 4HEQA 1G17A 1JKXA 1FDSA 4IDHA 3HKCA 2L69A