3W2EA

Crystal structure of oxidation intermediate (20 min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
271
structure length
271
Chain Sequence
b'TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 74
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2eA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2eA02
3WYAA 1GR1A 3W2GA 1AIPA 4PGOA 1JA1A 2DEUA 1FRNA 4YHBA 4NCNA 5FA6A 3OW2B 1M90D 1KK2A 4U9UA 1WDTA 3QFTA 4PC1A 3JQQA 5GV8A 1IJEA 1OB2A 5EMNA 3VNUA 3CRZA 3CC7B 4LBVA 2PMDA 1A8PA 1KRHA 2EFGA 2QA4B 1TUIA 1XB2A 1ZM4A 1QH0A 3CD6B 1OGIA 1OB5A 2X3UA 4TMVA 2NPFA 1OGJA 4B47A 1M1KD 4HE6A 2BF4A 4PC3A 3CPWB 3MCAA 2CRVA 1Q7YD 3ZC3A 4RCZA 1QVGB 4RD2A 1QX4A 1KD1D 1QGYA 1KC8D 3CCLB 3WBJA 3G6EB 1VQLB 3AGPA 5GV7A 1QFYA 3CCJB 1QVFB 3I1FA 1F60A 3B78A 4K1XA 4LBYA 5JBQA 1SM4A 1N8RD 2RC6A 3WY9A 1ZM2A 5TY0A 4NBSA 1D8TA 4UAJA 1J9ZA 3CW2A 2B7CA 1I7PA 1E64A 2OTLB 1EP2B 4TN1A 3AVWA 4RD1A 3AVVA 2J7KA 2OK7A 5HXBA 2VYQA 2DCUA 2YWEA 1QFJA 1DARA 1BX1A 1FNBA 1EFTA 1W2BB 1FNCA 2BM1A 2EIXA 4RD3A 1G7RA 2R6HA 1YITB 3U6KA 4TMXA 3CCRB 1YJWB 3CC4B 4Y9UA 3U6BA 4MYTA 3E1YE 1QUFA 5THXA 2BV3A 1DDGA 1DG1G 4RD0A 3W2EA 1TLLA 4ZGNB 1ZUNB 1CNFA 1VQOB 1F20A 1E63A 1VQNB 1XE1A 4RCYA 2BN4A 4TMZA 4ZV4A 1K8AD 3LYUA 2DY1A 3OZVA 2VNJA 1BJKA 2HMAA 3ZZ0A 2ZITA 4M0LA 1YJ9B 4FWTA 3CCMB 1KJZA 3JQPA 4MYUA 1R5OA 3W5VA 3OZUA 4G1VA 3ES9A 1EFUA 3W5HA 4YALA 1QGZA 2BPOA 2BSAA 1G7TA 4LBWA 1NDHA 1QG0A 1FNMA 2XNCA 1Q86D 3P26A 1JJ2B 3LRXA 4EH1A 1AMOA 2BMWA 1G7SA 2HCJB 1GAWA 4RJLA 1JA0A 4DQKA 3B82A 1FNDA 3AGQA 3G4SB 4B48A 1W87A 3FJOA 3J81k 4P3YA 3SJZA 3WXMA 3A1FA 3CCEB 4M2LA 1GVHA 3WNBA 2VNIA 5H59A 2YWFA 3FPKA 3G71B 1VQ5B 1S72B 1W35A 1VQ9B 3LVBA 2BGJA 2DETA 1H85A 3CMAB 2B7BA 2AHOA 1EP1B 1EWYA 1B2RA 3QFRA 4RD6A 3VNVA 3AVXA 4YAWA 4WQMA 1R5BA 1QGAA 2FX3A 3CC2B 4B4DA 1U2RA 4Y9RA 1JB9A 1SKQA 4YAUA 3PENA 4DQLA 3AVTA 3OJXA 4B43A 3QSYA 3ZZTA 1GJRA 4N3GA 1N0VC 5KSWB 4G1BA 3W5UA 1YI2B 4H9GA 2GPJA 4N3NA 1VQ4B 3CMEB 4ZGQB 1E62A 1HA3A 2RC5A 1W34A 1KTVA 3W2IA 1VQ7B 4Q7JB 3JQRA 1BQEA 1IJFA 1VQ8B 3P27A 1B23P 1R5NA 2XNJA 3ZBTA 1ELOA 3ZZUA 3CCUB 1DDIA 2CNDA 2C77A 1VQKB 4RD4A 4BPRA 2QDXA 2PLFA 3WNDA 4Y7CA 4F7DA 1CQXA 3AVYA 3CCSB 3B8HA 3CCQB 3WBKA 1VQ6B 4P6VF 4G5GA 2QTLA 2QEXB 2E1RA 3W2HA 1YJNB 2BM0A 4IW3B 1EP3B 4M1KA 4ACAA 3OJWA 1IB0A 5DSZA 3I56B 2VNHA 4AF6A 4AC9A 3U2QA 1VQPB 4C0SA 1VQMB 1CNEA 4AF7A 3CCVB 1D1NA 2QN6A 1S0UA 1KK1A 4PC6A 4R71A 4HE5A 4PC2A 3ZBUA 3MMPA 3VMFA 1KK3A 1K9MD 4LC0A 1EFCA 2C78A 2YWGA 3MHPA 3QE2A 4TMWA 2HDNB 1ZM9A 2GQFA 2QMUA 4B44A 2DERA 2QTZA 1KK0A 3V76A 1NJID 3LO8A 4ZCMA 4QFMA 1Q82D 2PIAA 1Q81D 1TVCA 3CXCB 4PC7A 1JNYA 3CB4A 1D2EA 4M53A 3WNCA 4FN5A 2B5OA 5TV2A 4J0QA 1YHQB 3W2FA 1K73D 2D74A 2OTJB 4YAFA 1N0UA 4C43A 3QFCA 1G7CA 2VZLA 1GO2A 2BVNA 3QFSA 1TTTA 4ZCIA 2VNKA 4ZCLA 5AN9A 3VO1A 4M4SA 4FK8A 1FRQA 3OZWA 4QHYA 1GAQA 5H5JA 3I55B 1UMKA 4B3XA 1FDRA 4TMTA 4ACBA 2YWHA 5TR9A 1QUEA 2BGIA 3VO2A 2OK8A 1BX0A 1YIJB 4YAOA 1ZM3A 1EXMA 4LBZA 1QFZA 3AVUA 3E20A 2XEXA 1H42A 1KQSB
chains in the Genus database with same CATH superfamily
3KR9A 2XUJA 4EUFA 5CM8B 3FCSB 2ZUDA 5DBGA 1U1IA 3ZV5A 5J43A 1FU8A 5CCXA 1GXSA 5JXJA 2Y3IA 4D4MA 4DQVA 3REOA 1ZMBA 4AWAA 2GTIA 2JFUA 2YWDA 2HBZA 1P3Y1 5MDHA 2OXFA 2PVPA 2QL5A 3QK7A 1U5AA 1G42A 1O95C 1Q2XA 3E8SA 5IVHA 4PC1A 5JWRA 2EKLA 2ZJFA 2HJRA 4PGHA 5FBHA 3TJZA 4JI8B 3PFKA 2ZM5A 1A2OA 1OB2A 2NUPB 2XJ4A 1E5XA 1E98A 1Q0UA 2W7TA 3JSXA 3A58B 5G40A 3TRKA 3VOAA 1GL9B 2FEMA 3EPHA 1NUTA 2FKAA 3Q2IA 2YZKA 4GSKA 3ZIAA 2NZUG 2YWJA 4HDKA 3WIUA 5A5EA 1G38A 3ZJVA 1NWCA 4DDUA 1H8ED 2AD1A 2FG7C 1VOTA 1E9VA 3IDZA 4G5YA 2DECA 3VPDA 5JEDA 3M34A 3SG0A 1QB7A 4HX9A 5A8AA 4EF5A 4WK0B 2ZOSA 3KQQA 4US2R 5FJJA 4A15A 2P5UA 1KBQA 2VT3A 4RY9A 3A27A 1V25A 3EWNA 3UB4A 4DR1B 3GEMA 1M67A 3L4EA 2UAGA 2DUUA 1POXA 1PQPA 4JKIA 4BVGA 1E2KA 1C3OA 2ZL6A 1H6CA 4RXUA 3QPVA 3DHEA 4UUMA 4EX6A 3FRJA 1B15A 1HE4A 4FXOA 4IGAA 2FI1A 3NEJA 3WO0A 5JVDF 4EJSC 1E2FA 1C9NA 2JAQA 1SCUB 2R68A 2OO7A 4XEUA 5TE9A 3QH4A 4DLBA 2FZ5A 2E5FA 5E2AA 4MP3A 5KWSA 3DAOA 3RC7A 3ZK8A 3EMKA 5H68A 3BDIA 1EU1A 3QI2A 3B6IA 4GL4A 4O63O 3HCEA 1MIOA 3IUYA 1KC8D 1WXIA 3E8XA 3ND7A 1I51A 2WBLC 1KY5A 3OUUA 4IVQA 3G9QA 5ADWA 2QN9A 2XMQA 2NGRA 4FYPA 2D1QA 3N2IA 5CA0B 3I5MA 2UYGA 5GZ6A 3PHLA 3QTBA 3TM5A 1A9PA 1HRDA 3VTKA 2FR8C 2PXAA 3AHDA 1KO1A 5GV7A 1XBTA 1A72A 1GHTA 1ZOPA 2NO9A 3BERA 4N7RA 4Q1EA 5EIFA 3ZLBA 5JZMA 2Z6AA 2HTFA 3UK7A 1USGA 3MAAC 2WJPA 4YMIA 3I45A 4J9VA 3BHNA 4NOLA 3UK6A 5LNK6 3KAQA 1NVTA 1JDBC 2GCNA 5T4FA 3VYTB 1H5UA 4AZVA 1AV6A 2X0KA 3FUUA 3PYXA 2G5PA 5KPDA 4EPTA 4QBKA 3IPLA 5FWXA 1M0SA 1MABB 2W4MA 3FWYA 2V6MA 3LT0A 1QTQA 4U8HA 1K2VN 1JKJA 2QAGC 4P7BA 3CX8A 3KBBA 4XLEA 3LAWA 4QPZA 4KX3A 4BUZA 2LDBA 2Q5QA 3OCYA 3GVCA 3PNYA 1U8YA 1P0IA 4JITA 4JSRA 2JAUA 2FW8A 2QYTA 2YTZA 3DT6A 421PA 3G88A 4L5AA 1GNQA 2OYSA 3O8QB 1KZ9A 2WIFA 3OPQA 4LE2A 4MI3A 4V0LA 4D9MA 2WZNA 2NXCA 2CNKA 1P2VA 1AOXA 5EZYA 2XWJI 3D1VA 4YUZA 2EJCA 3ZYCA 2ZP1A 4ENSA 2CNWA 2CL7X 2Q0HA 3K4HA 5EG5A 5BN5B 3TDNA 3LFHA 2A7XA 3A1DA 2WABA 4TVKA 5LDDC 2D8MA 4EA9A 3NIFB 1RJ9A 4QASA 3TSWA 5JZ9A 3NGXA 5KVVA 1QBKC 1VXRA 2AYYA 1W5TA 5HR5A 1JR4A 4G1FA 2XBMA 1EFTA 5FNVA 3FMGA 3BCUA 3P5SA 3PYLA 4TUYB 3CX6A 4Y6QA 1J33A 3K0AA 3UHFA 1ZZEA 4U8GA 3ZPXA 2QRVA 3SKYA 4A8JA 1SUSA 2E87A 4H16A 4IZHA 1IC6A 4J0CA 2QRJA 3TGWA 3V80A 4LXIA 2PZGA 5KYVA 2XKKA 1GNRA 1Q95A 1O6ZA 1SVSA 3IELA 4JYMA 5BY2A 1Z4PX 3ICQB 1U7WA 2AG5A 2J3LA 2PH3A 3OMXA 4AYTA 2FPIA 4Z4FA 2JFPA 3ZDFA 1NBIA 2VBCA 5THXA 3OOCA 1EG7A 1SXJB 2P9GA 3O90A 4X1KB 3TQIA 5L7WA 3RC8A 3KSMA 1T6XA 2QUIA 1D4ZA 2ZPAA 4P6YA 1KEPA 4Z1MD 3F97A 3QFHA 5DJ5A 2OFXA 3U31A 5HPYB 3I3SR 1QO0A 4RNDB 2O14A 5LPNA 4XX1A 3SCZA 1GAXA 2OLJA 2PKQP 5KWIA 1ADBA 1Q0TA 4Q1DA 3KJEA 2E4YA 1GV1A 2WFMA 4N5DA 2GF9A 3QJYA 1SA0A 4I5FA 1HMPA 1QONA 1YX2A 1C3LA 4L78A 4RCYA 4FDAA 1Z8HA 5EJAA 2QXUA 4NJMB 5JG7A 3RRZA 1TQDA 4U02A 3SQXA 4P1ZA 3OEHA 3SX2A 3MTDA 4PG7A 3TD9A 2B4YA 3GIWA 3KYCA 3PRKE 1CEEA 1JECA 2HMAA 1GUAA 1I36A 2GBCA 1PT9A 1GRNA 3LBAA 1MP0A 3TLJA 3WLAA 6YASA 1IOWA 3P2OA 1P2FA 3RRMA 3JWJA 1M72A 4ZOLB 1E3WB 2K7ZA 3FHJA 3SBEA 4AJJA 1X6VA 3EA4A 3P2IA 4HD8A 2R6ZA 4N49A 4B7XA 3LP6A 4I9FA 2H4ZA 2JVIA 4UUBA 3EZYA 3OKCA 4LYDA 1TA4A 1Q1GA 1J22A 4HWTA 1R6BX 4LDRA 3H4TA 3L6CA 5AWFC 2FDXA 4QLOA 3RVDA 4CU5A 4EP1A 2A9PA 2J59A 3TINA 3WOVA 4HGRA 2OR3A 2FWPA 2X3FA 4UDNA 4F0JA 3LXUX 1FRFS 2I03A 1SQ5A 1I4OA 3MRTA 4XW2A 5JO0A 5BOVA 5BN1A 4HV4A 2QK4A 1M2OA 1V16A 2G5GX 1GPYA 1ZXLA 4WW0A 3X2FA 2IHUA 2H48A 3DYVA 4MHOA 4ROSA 3VR1A 1GIAA 2QSJA 4PCLA 1L5HB 2C5FA 4HDRA 2OGUA 4F96A 5ICMA 2VZ8A 4BTEA 3UPUA 3GLFA 5P21A 2C9MA 3ZBQA 3F5SA 2B36A 2GZAA 4EH1A 4XVRA 4RPDA 2WF5A 4I5DA 3EQ9A 3CRW1 2ZUVA 1NUAA 2Q07A 3DBIA 4R1MA 1IIBA 4LDZA 3R74A 3SEAA 5A0TA 5LBUA 3C4QA 3IOYA 5L3RA 5KYYB 2IY7A 1I0IA 1M73E 3BF8A 4EKDA 1PNOA 3MMNA 1GZVA 2SNIE 4UBKA 4FW9A 1PJZA 2O8EA 4UBNA 1U90A 2ECOA 5EE0A 3UUWA 3PVZA 4CM6A 5HUJA 1SB9A 4L3OA 5LKRA 3DOUA 4OHPA 3SIPA 2C00A 1X87A 2PHZA 5HCNA 1WNTA 3R2JA 4FE7A 4ND6A 4BVBA 1VQ5B 3QBDA 1EG2A 1F4PA 4WY2A 4X06A 5KYXA 4MHTA 2ZWPA 3A31A 4JL6A 1BXGA 1FMCA 3QXSA 1X7HA 3H9JA 1QRAA 2D3WA 3MQFA 3OZIA 3UGTA 1E9RA 2DR0A 4F4CA 4IZOA 2UYCA 2E3JA 3I9NA 3G6WA 1WOOA 4F56A 4JJ6A 4Y2QA 5IDVA 1A7AA 3I9V1 2RH5A 2O50A 4XIGS 2QD3A 3RRXA 5DTMA 4ARVA 4AX8A 3THXB 4CLRB 4YXWD 4I4CA 3G2QA 5A4JA 1Q83A 2CDNA 1FDWA 4HYYA 1E5LA 2ILTA 4XLFA 2F3TA 3UXYA 4O29A 3HB1A 4N54A 2RONA 2ZTVA 5DN9A 3KT3A 1AXRA 1CR4A 3TQHA 1T9GS 2J85A 3Q88A 1W36C 1QQ7A 3IMEA 1DWQA 1EFVA 1JHYA 3K5PA 3W34A 1C7JA 3NBZC 2BFCA 3D3QA 2CLOB 5L3SB 3AEQA 4LNUA 3LQ1A 4RHCA 1Q91A 1R5BA 1JXMA 3T9FA 4R41A 2BRUC 3AINA 3BN3A 2PNJA 3U1VA 5FUMA 5ALEA 1QCZA 4MIKA 4W9MC 2AKAB 3ZDAA 3NCTA 5FRDA 2Z3ZA 2VUUA 1TPZA 1ZS9A 1YB1A 3U80A 2ZEJA 2Z57A 1AT1A 3G5UA 3K4QA 3MXTA 4JUBA 3ZZTA 4EHBA 1KY3A 2I29A 3R7NA 1DQSA 1XJCA 3L1UA 2ONJA 2PGIA 4Y30A 4JZYA 2FB9A 4L6CA 5KOJA 2J6BA 1A5BB 1K4YA 5CPBA 4X6UA 1O5TA 4ER7A 4MP6A 5IZ4A 2Q3HA 4F60A 3BE8A 3LUDA 1PFYA 1U7UA 4YCBA 2FSSA 5A4FS 1D2CA 1Y5NA 3UUFA 3N8HA 4JEUA 1ZA1A 1ECFA 3PPVA 2RFLA 3AONB 3H2GA 4L0MA 4BTVA 4KDFA 4PYKA 4XX0A 2DQZA 4YRGA 2NADA 2Y1EA 1UDCA 4LEIA 1E2PA 4LKOA 5IC6A 2ES4A 3ZE1B 1XZ8A 2CLFB 4JP3A 5KTTA 3QKRA 3MHTA 4EHLA 2AK2A 1VL5A 1ZIDA 4IVNA 5ILOA 2R6R1 3ENZA 2IZ1A 2FUG6 4BB5A 3IVCA 2P9CA 4GMFA 2G1PA 1OPRA 1IBCA 1K6EA 5EEHA 2RGCA 2PYIA 3ZZUA 1K97A 1RQLA 1IN4A 2C96A 1LBHA 4GDMA 1RWQA 4BB9A 3EEYA 5JS1A 5ICSA 4XWOA 2Q9BA 2ODWA 4RWZA 3AX6A 3AO0B 4NG5A 5CLGA 5SV2A 4DCOA 1SC1A 3P0HA 2XNKA 1FSGA 5IAGA 2QRMA 5CT8A 3T12A 3QLUA 2EBWA 1Z6PA 3R0XA 3AI7A 4AUMA 4DREA 2JH3A 5A5FA 3WNDA 4Y7CA 4EVRA 4LK3A 1RM4A 3JTMA 3NWBA 1YONA 2VTVA 3HJRA 4IHQA 4RS4A 3PI7A 5JE8A 3T9EA 1X38A 5FV7A 5ICEA 1VB3A 4IJQA 2BBSA 2DJ5A 2J3DA 2PKEA 2V8OA 3TDKA 4BX3A 3B2QA 3OM9A 1E9CA 3HLTA 3JAWA 3D3KA 1RXUA 3IA2A 4O4HB 4PHTA 2FZLA 3QU7A 1IJBA 1CULC 4ACAA 3FGZA 3A9SA 3O26A 4XM0A 4UTRA 3EWIA 1TKAA 4IWNA 2OYRA 1B16A 2YS7A 3ZDQA 1KI3A 4BGIA 2ZYWX 5HW0A 1HTTA 3E82A 4MX8A 4X62B 3IILA 1W6UA 2WZQA 2O07A 2PG3A 4HLCA 3QTTA 4NE2A 3UWMA 4DTIA 1ZK0A 5HZMA 2B78A 1M10A 4RPCA 3TTYA 3QMMA 2JFXA 2WHRA 3LNCA 4ZHSA 1XTJA 2J67A 2QPOA 3HJFA 1WHSB 5A89A 4PYNA 4FGLA 3RARA 1T4BA 3IXQA 5BURA 5K2OA 4WEOA 1P4GA 2QLBA 3CPHA 3CVWA 1QHHA 4FFLA 4IVPA 3CVYA 2QBYB 1VLZA 4ZCRA 2QTGA 3VMFA 1WWKA 2JVKA 4LDJA 1C30A 5L51A 4UHDA 1GWNA 4LDAA 3L49A 2YWGA 1E4OA 1U6IA 3DZKA 3QE2A 3SKBA 2Y99A 3GLHA 2WAMA 4RC9A 4UMVA 4XWAA 1W0JD 4UARA 1SQGA 2DERA 2J9FB 2VDPB 5F12A 1P1JA 4ENWA 3FOZA 1NXTA 2BEKA 1ACMA 3STHA 5M5BA 2VG8A 3R0ZA 5BN3A 1KEEA 2D7CA 3BEOA 1N6NA 3H11B 3SLRA 2EERA 1TFRA 5LIRA 1PNRA 4P26A 1QC5B 1R7RA 3RAFC 1TZJA 1IMOA 2JEZA 1IBMB 4FLFA 3WWEA 1JR3D 4BE9A 3HI4A 3FFAA 2R1ZA 2AI3A 2RHOA 4GLLA 1TVCA 2E89A 2ZIZA 1A2QA 3EEFA 4GH5A 4Y9DA 3VSDA 2VQ6A 3OH8A 5AFSA 1QZ3A 4ZHQA 2IYXA 3BIOA 5T4HA 1FFXA 1NJ6A 5JNWA 4B9AA 3IE0A 5EWMB 4E5KA 2NU9B 1ISSA 5HFJA 3T15A 1GDHA 1O57A 1YHQB 1PFVA 3I4FA 3Q0IA 4Q00A 5DN6A 2PWYA 4M8KA 1XCMA 4KXXA 3GGDA 4MLZA 5I4BA 5K99A 3C3EA 3CHYA 3HDTA 3IC5A 4LGMA 1V11A 3V4ZA 3QLJA 4AJ9A 1QPZA 1VSVA 3N0TA 1YO6A 2PAAA 4AVZA 2A35A 5FORA 3VHXB 5BW8A 2Y4OA 3RS2A 2BGLA 3K9CA 3R3YA 4DLUA 1JTEA 3INYA 4MRMA 1FU4A 3VZCA 2OGSA 5AW2A 1QIKA 4AXXA 4JBLA 1IXKA 4WOJA 5D84A 1Q50A 3A3OA 4OJYA 2WWRA 3FAKA 5B7NA 2UVQA 3T99A 3YASA 1PL7A 2W48A 2HIHA 1P1KA 3B7GA 3T56B 1RFGE 2C2BA 3ELUA 3IEVA 2HV9A 1L4FA 3SR3A 4ZIRB 3SJAA 1HZZC 1H6BA 1TIPA 3ACCA 5AIBA 3H6KA 3DBRB 3I8XA 4FIDA 4MPDA 4WEQA 2WY2D 4GDFA 5K3CA 4DJFC 3KQHA 2R8RA 2YVLA 2PX3A 3SC2A 1XNJA 4E3WA 3MAGA 3DTNA 3LHKA 4S1TA 1AUQA 5C7OO 1DTWA 1Y7TA 1GPMA 5C37A 3L7IA 1SUAA 3QBVA 4HEHA 2O52A 2WNHA 4RANA 1Q0QA 2PZJA 4OFWA 2ZJ3A 1Y3DE 2PY6A 1K0FA 2OHVA 4FFVA 4AUEA 4A6EA 4F93B 1FQKA 3A9WA 3EE6A 4JQYA 4KXLA 4LE0A 4ZJUA 4MB6A 5EWJA 3GFFA 4L22A 3DJFA 2UXDB 2CVPA 3FF4A 2NNLD 4G4SP 5EGNA 1E5TA 3FHLA 6REQB 4TSFA 4NU6A 1GZDA 3AHEA 2PT7A 5DHRA 3OZRA 1EXMA 1T2DA 1RI1A 2IHJA 1OWOA 1JFSA 1ZC3A 3PNKA 3AVUA 3K9LA 1B43A 1LLUA 4O4HF 3ZJUA 3GCWA 1DTEA 1U31A 2ZUBA 4UOEA 2QUJA 3CEHA 4FSXA 5K51A 5T6MA 1UD5A 2CUZA 2CYBA 3MMZA 4Q21A 2XVXA 1T0PA 5KQGA 1FOEB 1JUDA 1NUSA 1FRNA 1XRSB 4RDLA 1E6MA 1ZUHA 2MYPA 4HK4A 4KKVA 4KQIA 4MGIR 3DGFC 2Z6UA 4XH9B 3G23A 4NCHA 2H7YA 2OSVA 2PUTA 3P9RA 1ATIA 1XHEA 2JPDA 4W7IA 2QP9X 4EFMA 1G20A 2BHLA 4KN5A 2H1IA 2O2SA 2ECPA 3RUDA 3L6EA 3RHZA 3IJPA 2W42A 2IQIA 5DIZA 1K88A 5H3HA 3WDMA 1SK9A 4JYBA 3WYCA 3A8JA 4PRKA 4EJSA 2NP7A 3UOAB 4AW9A 5A3VA 3H5OA 4U39A 3F6CA 3K70C 2W6IA 1M2GA 3EFHA 3HPQA 4KN6A 4XYLA 1E2DA 3A1TA 2WWXA 2ZCUA 5A9TA 1MAUA 3N0XA 4I55B 5E2BA 5IDWA 2Z5FA 5BSXA 1JHUA 1ODCA 3AFNA 4IY1A 1TJ3A 4J0DA 1KZ7B 4IZ6A 4CNQA 2C7GA 3DTVB 1DT5A 3Q7TA 4HLDA 1VPTA 4YN3A 5IXYA 3T7DA 5BSYA 3SSNA 3QXJA 1Q11A 4EGQA 2A88A 3SNHA 4GGPA 5B6JA 1GSHA 1NBMD 2YV2A 4KMRA 2WMDA 1Z0IA 1GL6A 4NCIA 3CF0A 2ASEA 1H4VB 5BR4A 4RTMA 3QU9A 4PQYA 2C0PA 3J80A 1ZVMA 2O8BA 4OHBA 5EMMA 3I04M 1KI9A 3TW4A 5K0JA 4TLMB 1FMTA 2VSNA 2WB4A 2X5XA 5FBKA 4KPUA 2INGX 2QAGA 3PHJA 3V8PA 3AU9A 2UYHA 3D4PA 3T1HB 1ULTA 1VMIA 4EB3A 3DKRA 3D43A 3JQ8B 1XDBA 1XG5A 3KUUA 5LXTA 5L46A 5BQFA 1Y8RA 1VB5A 2HA7A 5CFRA 3VKHA 4MICA 1CHDA 1VE6A 4XONA 2EJTA 4BVHA 4OBWA 4K2HA 3DM5A 2FUCA 4Q9KA 3LWZA 5AOBA 5E6SA 2C04A 2FMHA 3K9NA 1X9GA 2O06A 2YFQA 3JQ7B 2QTRA 3EVDA 4NLLA 5ER6A 5A4KA 3GCZA 4BNIA 2PS0A 4O1HA 4OYLA 3L41A 3M5WA 4EATA 4TLEA 3OICA 4KKXB 1C7ZA 2X7XA 3I6BA 3LYLA 4HEA6 4W5HA 2XRYA 1XF1A 2GVNA 2JG3A 3A6LA 1WE2A 1JL3A 1Y1RA 2FQQA 2WTEA 1KI7A 3FYHA 4K1XA 2VUSA 1N6OA 3TR5A 4BVLA 2P4UA 4EW2A 1PYDA 1NRJB 3DH0A 4Z9FA 4YRNA 2VJLA 3WB9A 3MB5A 4H4CA 3FWNA 4UBOA 3ZS9A 5J4HA 1KKLA 3GEDA 2EVWX 1U0TA 2JGLA 3WA7A 3WMRA 4NU0A 4PZZA 3OFVA 1IEWA 3KKPA 3TEFA 1LTKA 4F38A 2XRZA 3QNMA 1O94D 2CXOA 2OPBA 4F4DA 2OTLB 2XGGA 2WINI 1GPWB 2GK7A 2ZANA 3UW3A 2M1XA 4URFA 2P0EA 1G5QA 2V98A 4KKTA 2CNBA 1CRZA 1W5BA 4H0FA 4O2RA 3ZG6A 3LVQE 6NULA 1XC7A 4G4SO 1E92A 4WXEA 2DFKB 4F2GA 1ZGCA 1QU3A 4KWIA 4LY9A 5COBA 3CW8X 1MB4A 2A9JA 1WZUA 3H5VA 2OZEA 3LLSA 2XCQA 3QPAA 1FB5A 4WCFA 4YUXA 5BPFA 1V1RA 2I1LA 1BMTA 3M2TA 1XQXA 2ZLBA 4KSCA 4YX9A 1VLJA 5ELLA 1NY5A 4P80A 4RACA 2AC2A 2XMCA 4BFCA 3BHIA 1P5FA 4XQFA 1LU9A 4MGHA 3OZFA 2JH9A 2ZS7A 1FP6A 4GPIB 4JP2A 4Q3LA 4AKGA 1XMXA 3CR8A 1YB6A 2WSIA 2QNRA 5IM4F 5K6TA 4RD3A 2L18A 3AF1A 3BA1A 3CUVA 3MYRA 2WEKA 1NZFA 3AR2A 4OU4A 4WZAE 2FOIA 4B35A 1PYOA 1SHJA 5JPCA 4KR0A 4GICA 4ZODA 1ZK1A 4RLQA 1H66A 4QUZA 1S2IA 2AWOA 2XB8A 2QMHA 4D97A 3E7DA 2AFIE 3X2SA 2HUNA 4NNPA 5GP1A 5A7GA 1RIIA 3IO5A 4X0EA 3VKVA 3E1YE 4PN7A 3B13B 2BE9A 5LYJA 4DLPA 3JX9A 5BSVA 1R4NB 2YYSA 4QGAA 1THMA 2VDJA 1HDZA 3KEOA 3E9EA 5TQ2A 2NSJA 2JGJA 1PFQA 1CDEA 2P2LA 2WV9A 3E9DA 1F0YA 1NWHA 4NL4H 3WJ2A 5I8ZA 2JDID 1Z4QA 1UCFA 1UKZA 3W5IA 3ORYA 4ND2A 3ZZNA 1XLTA 3ZIUA 4E21A 1GZUA 2CV1A 1UKYA 4I55F 4KQ2A 1XQ6A 4G41A 5CW1A 3SQLA 4LJ6A 2EFEB 3GDHA 3KZXA 3LE8A 3UG6A 3F1KA 2MSKA 4A4DA 4ZXPA 5E8RA 2WRZA 3LSYA 2C7QA 3DFIA 4WADA 5I8PA 1BDBA 4L8JA 2AMFA 4QQRA 1X3SA 4JS0A 1W0KD 1OI4A 4NEQA 4TLBA 1C7RA 1Q3KA 4OCZA 2QN1A 2XITA 3B85A 4I5IA 2FUEA 1U6KA 4YCAA 5JLAA 4BLPA 3TZEA 4XOUA 2ZITA 1KYIA 2J6HA 1KFJB 2ST1A 1U8CB 3IVXA 5K4HA 5IKXA 1DRWA 1ZN7A 1H2FA 2I7DA 5KSYA 6ABPA 1NJ5A 2FP4A 3UEOA 1YLOA 3JQPA 2VPPA 3N8KA 2JJ1A 1NRWA 4I36A 4CF5A 2GBIA 3H2JA 3VSEA 4ROTA 2GFHA 3N8NA 1SOUA 5ALNA 3R6WA 4DJEC 5DI9A 4FX5A 3NNNA 3B5IA 1OLSA 4GX2A 2GVZC 3IUPA 3L0BA 3W9YA 1PS9A 4GX0A 4BNUA 4UHEA 2SBTA 4KPEC 3LS2A 3ZGLA 2J08A 2BPOA 1VJSA 1OWPA 5LQCA 4MUGA 3IAAA 4U7HA 1BW9A 5B5SA 2J4CA 4R2IA 4Z1OA 2QRUA 3MJFA 4I1UA 5SYMA 3IS3A 4EVIA 5IAAA 4GPZA 1NDHA 2Q7OE 4ZC1A 3ZVKA 1XU4A 2QJWA 4IXNA 1VSTA 4J4BA 1YMUA 1H9CA 4L7QA 4Z9XA 1MOSA 3LRXA 3DVRX 1RS0A 2Q2QA 2QVGA 3G0IA 2B99A 3OPXA 3T7IA 2DUWA 3B89A 1MJNA 2BMWA 1JAYA 1N2GA 1UWVA 1UC5B 3SQOA 3F5DA 1ZWLA 3VU9B 2OHOA 4F5YA 3WAGA 3O3NB 1N2IA 3PIDA 3VAAA 4ENRA 4WI1A 1S4MA 1KETA 3FNEA 2QT9A 3W4KA 3D81A 4H6VA 3A4TA 3FW1A 1DC7A 1NVVR 1HL3A 2BGRA 3LUJA 4MKZA 3JAMA 2LZ0A 4XQ0A 5CDSA 4QNRA 5HJ7A 1GLGA 4PSUA 4IIJA 5DYYA 3OKAA 3B5EA 1TTQB 4Y98A 1WPQA 3DP9A 2IGBA 2I33A 5G0VA 1QH8B 4YRRA 4BFTA 4YPFA 1Y98A 2ZI3A 1L8AA 4Q9LA 3OJOA 3BL5A 4D0RA 1EK6A 3PJDA 2BD0A 4RDXA 5JJBA 4J76A 2WK1A 3TGPA 2BH2A 4CMJA 5KX5F 4W9RA 3H9QA 4M87A 4OHKA 5LIPA 3ASZA 3VSAA 4UVHA 2QI9C 2A0FA 2VLBA 1B3RA 1EWKA 3ZE9A 2FWIA 4C30A 2PV0A 1XDUA 3Q6QA 3FPPA 3HKEA 1NFFA 1VIDA 5TPWB 4GUAA 2OFPA 4E32A 1T35A 3KZNA 2JASA 1KF0A 5TEWA 3PFIA 1OFHA 4RO0A 3FFXA 2JH8A 5T64A 3TNYA 2HSEA 2GH1A 3A7EA 2Q1XA 5E2IA 5A3JA 4UVIA 1V5EA 3A70A 4NECA 1CP3A 1RCUA 3AVXA 3A0UA 1AKNA 5C4GB 4B6JA 3IKLA 2X19A 4JJKA 2IF0A 3EDQA 4RKRA 4RYLA 4EI8A 4CVNA 4W5JA 2VCHA 1RLJA 1KSJA 2I6FA 3ITKA 3ERCA 2VF4X 5CLHA 4DRZA 2GN2A 3EXAA 3VVMA 2W2XA 4HXYA 2XUPA 2PCLA 4QL3A 5JPIA 3C8DA 3NVKI 3GD7A 4J2TA 1I24A 1T4DA 2WHPA 4L5CA 4GWLA 2WT8A 3WE7A 3ZTWA 4I2VA 3RD5A 4I2NA 4S05A 1WMBA 3RBVA 3WLOA 2ROQA 2ZE5A 1CS0B 3LCJA 4A91A 2FDRA 1SG9A 3EVCA 1YXMA 4PQFA 3C87A 5A6SB 4I5GA 2QNIA 4H9GA 4XYGA 1PO7A 5KTYA 3W8FA 1K1EA 1N2CA 3FDFA 2Z8YM 2IYFA 4JBGA 4Y2YA 2DWOA 2J3EA 3HA5A 3LT1A 1MR3F 4YASA 1M34A 3TCXB 4KXQA 4C6RA 4UFOA 3QF4A 4JOBA 1NY6A 2EP7A 1HK7A 3V6MA 1E1QD 2WU8A 2FOLA 3WJ7A 5HK9A 2JW5A 1R1DA 1VIYA 2Q4DA 4GP6A 3GVHA 4EGJA 1KTVA 3W2IA 4GX1A 5PGMA 1AQJA 5A05A 5H4HA 1TO2E 1TA9A 4OJTA 1PD1A 5EUQB 2HRQA 3KRTA 3SIXA 4D6XA 1XROA 2ZBPA 1JIJA 5A4DA 3VR3D 5IK2D 1ELOA 3U61B 4ZDWA 3WKEA 1I18A 4UTXA 3KJZA 3ZU2A 4GGMX 2X6QA 3P8ZA 3E3OA 4U7GA 2QTBA 3KLMX 1SH7A 2IHYA 4I99A 3C6YA 5REQA 3ZDXB 5EVCA 3GBSA 5GM1A 4MW7A 1N2JA 4RDIA 1SVOA 1J0CA 4YA6A 2CCGA 5D87A 1NN0A 4UKDA 4AO6A 4YFYA 3VJKA 1ADGA 4ZEMA 3Q7QA 1SIWA 1QRDA 3O8DA 1UFVA 2VJDA 4DLRA 2QL6A 4HDNA 4L07A 2QVYX 3DE4X 3VX4A 5ARBA 3FPAA 3NHWA 1SUEA 5EEGA 1DPFA 1YUMA 3MFQA 1BKDR 3GHHA 5DSZA 2RIPA 4R2MA 2WF8A 3T3DA 3I56B 1YQEA 4Q12A 3RF6A 1Q74A 3UJBA 4D8WA 3G89A 4ZVKA 5BNZA 3LVRE 1WF3A 3FYCA 1ORWA 2JFGA 5FA8A 1J9EA 2NUTB 4F1WA 1MHTA 3DUFB 1TVEA 3L4JA 3RTBA 2WMYA 2QLMA 3QVOA 4BZWA 3GW8A 1FU7A 1A9YA 1ZIXA 3GJZA 3OQ6A 2TMDA 3UWDA 3HJAA 3R7FA 2XI4A 4JP1A 4HEJA 3QWIA 1X94A 1UK7A 4H31A 4ZXFA 4XDHA 1O6BA 4MYHA 2M6KA 2WU1A 3JWPA 3VH2A 1LSJA 1LZKA 1H2ZA 1ABEA 3I2JA 4O4IB 1F3OA 5ALTA 3F3MA 4RESA 3QI7A 2PQ0A 4XAQA 3W04A 2O8FB 5JZSA 5I7OA 3U09A 4YPOA 2VDLB 5T8KA 3UAOA 3UK2A 4K28A 1NZJA 4F06A 2HMTA 3QUTA 4NX2A 2V97A 4HWGA 1OWLA 3T1VA 1Z5NA 3WIOA 3MA0A 1UJ2A 1XEXB 3NYQA 1TL7C 2XUHA 1A3CA 4NHEA 3OU7A 1PT5A 3CWQA 5ALMA 2HZBA 4OU5A 4V0NA 5IUJC 1EUQA 5BQXA 1U8TA 5DM1A 5KOIA 3PE3A 3EVFA 2VQEB 4JK3A 4KE7A 4CT4B 1Z63A 2VSXA 1IPHA 5KHAA 1TD1A 3MF4A 3H3JA 2X6WA 3S5JA 2JKYA 4M53A 1OLUB 2J5KA 2JGMA 4CW7A 1E18A 4RQAA 3NWEA 4FN5A 3CLRC 2IDMA 4C06A 2C95A 1WETA 3ZTTA 1J25A 3BCHA 3GLUA 3ITEA 4J7XA 2I7VA 4J0QA 4MWEA 3UJ7A 4DV3B 2CLSA 1Q6YA 1GZ5A 1T0JB 4ODIA 3BDVA 3QXGA 4DV0B 3JWHA 2C1XA 5FCDA 2ZUFA 1NW3A 4P5PA 4BLTA 1Z37A 3ZNPA 2PUGA 2HK8A 2OHGA 4YAFA 1H3EA 4C07A 4YAEA 1ZH6A 1DAKA 2GCGA 3OQPA 4KX5A 1SRQA 3OQIA 4YBRA 3A3BA 2EG9A 1E9BA 1PKEA 2Q6OA 1AB6A 3KELA 3OOYA 5CNKA 3TB6A 4NNJA 4ABTA 3NQ41 3EXHC 4UQPA 4XGQA 1B0AA 5G3ZA 3P32A 1T34A 1DAOA 2EFCB 3IAFA 3WGLA 3KHTA 3O4GA 5AKEA 5G0UA 2DPLA 1J49A 2NLOA 3EAQA 3VR4D 4XWKA 3U39A 2FFHA 2QTVA 3QLEA 3OA0A 5EKDA 3EJWA 3MM4A 5AT1A 3THOA 1E5QA 4F46A 2R1VB 5AJZA 1GKKA 2WYUA 1KEWA 3CCFA 1T9DA 3GVXA 3QMPA 4OBEA 4YLEA 5CD1A 3FNRA 1RHJA 1Z6AA 2PTGA 5EJ7A 3KL9A 3N76A 3KVYA 4RHYA 1Q21A 4TQUS 4TXNA 2C5LA 5ALYA 3M3HA 3TBKA 4C21A 5T3YA 1UAGA 1TW3A 4QU5A 3HJUA 5JS6A 1DXYA 3G0OA 2FK8A 3IQFA 4ZZ1A 4DADA 2G5TA 2GBLA 3K0KA 2Q3EA 4F4FA 1YB4A 3REQA 1D6JA 2EHDA 121PA 3I5UA 4FNOA 5C81A 4Z7JA 1KOGA 3LPDA 3JYLA 3VJMA 4BO4A 1IM2A 1YACA 4N0DA 1N7JA 1Q3TA 3IRVA 2EKPA 2O48X 3DD5A 1OX5A 2OZPA 1L7NA 1XQWA 1O9GA 3AJDA 3QPDA 5T41A 4YV7A 1X2EA 3A35A 1UADA 1SR8A 4INAA 2ZT5A 4MIEA 5DLPA 1CQJB 2ABWA 2DQ4A 2YOFA 2ZI9A 2ZJZA 3G2OA 3IXLA 3L8MA 3MOIA 3U7GA 2BFNA 2YZNA 1RQRA 2PM8A 4C7KA 1R37A 1EGAA 1KVRA 2A84A 3OZAA 4M0MA 2XCRB 5EQJB 4C3OB 1V8OA 2IZOA 2Q5IA 3F9RA 4F3NA 4RK1A 3FOCA 4MK4A 4UVEA 5F2EA 1LSOA 3HN7A 2V3WA 3WMWA 3NXKA 5FA6A 1CVLA 1Z0DA 3BIWA 1MA3A 5K0SA 2E5LB 2VCYA 4QREA 5IAOA 1LF0A 3OPNA 3WDLA 1G59A 2NU7B 1E6EA 2VHYA 2X5KO 3PUIA 4H6PA 3EYWA 2Y67A 1F2TB 3PUJA 3QVUA 2X7JA 4KQKA 4CCSA 1P9RA 4WZAB 1XX6A 3ETCA 4MKIA 5B58T 5GADl 3OF2A 1E6CA 4EENA 2X1LA 4N4AA 1ZH8A 3LC0A 1HSZA 1Q12A 2JGEA 3E9MA 3BKXA 3PA6A 1GPJA 3B1VA 3CC7B 4KH1A 4YJKA 5F1KA 4O4IF 4TTJA 3KYDA 3O82A 2HLHA 2MSLA 3OKFA 4QOGA 3ZQKA 3ZCSA 4GWKA 5IYWA 1P8AA 3HY4A 1J21A 3JD3A 1NXSA 2WQ7A 4JDUA 2ZYAA 4KPYA 1M6VB 3M1IA 5LZ8A 4BBAA 1CY4A 4CKBB 1H3NA 3ECCA 1W46A 2WF6A 1SQ0A 2JFVA 3C5EA 2AUMA 1J8FA 2G4LA 3L0DA 1J2YA 4Q9HA 4B47A 3N8DA 3I32A 4RVSA 2OC4A 1E0KA 3ZJYA 1KOLA 1QP7A 1V35A 3P0EA 4PLCA 4ND8A 2ZR0A 4R3UC 1Z12A 3JD4A 4E12A 1V96A 1JKXA 5AR1A 5FOQA 5DK4A 3KTDA 4FGUA 4PQEA 3NUQA 2PGOA 2QTHA 5EGSA 3SI7A 4HB4A 3WRXC 1J00A 5C35A 2OLKA 4MV6A 4CEIB 5A0VA 1NTRA 2IXDA 3L2OB 1VKNA 3NXSA 1BHJA 3RYCB 3LX5A 1VXOA 2Q45A 1UBRS 3QIAA 3JASA 3RYHA 3NAMA 3H0KA 1SKAA 4HRAA 3L6RA 1ZCBA 2JFFA 1U8UA 3LK6A 3P2EA 4DDWA 1YRQA 3JWGA 3GGCA 1CDDA 1OQAA 2AEMA 2IKQA 2NXWA 3A9UA 3IUMA 3TUIC 1E1LA 2EU8A 3ZHRA 4OPMA 2X6XA 1MOQA 1SVLA 1ZGGA 4OL9A 1LK5A 5IC4A 1UFKA 1XRJA 5FBZA 3TIIA 2C20A 3B78A 2WHEA 3JQAA 4G5QA 3I34X 4I1IA 4JD5A 4Y1RB 5GGYA 3TQTA 2TECE 2X76A 3L6OO 3TR6A 1S2DA 1XYYA 2H16A 2C8KA 4OQYA 3DB1A 4J3JA 1RXCA 2X85A 3KEFA 1EGHA 4MVJA 1LBTA 2ENUA 3K20A 3W3AA 2Q5LA 3E5NA 3NV9A 4B87A 5ADUS 4EO4A 4WASA 3EIWA 1S8FA 4DXDA 4BJHB 2VF7A 5IYNA 3OHMA 3PXEA 4NBKA 4Z7NB 3SICE 4LHEA 1W7AA 1EJ6A 2D3LA 1DZIA 1PZNA 5EZQA 2ZE6A 5EINA 1NKTA 1XDWA 2K5UA 1RC1A 4MQ6A 2QPTA 3CT4A 2HJGA 3GO4A 4NH0A 2OK7A 4A0GA 1AM4D 2ONYA 2ZUCA 2AD5A 3IIJA 4BGEA 4EGAA 1SC9A 2IF2A 4C6TB 4ZO8A 3EZGA 4NMWA 1FYFA 1T36B 4I66A 1IUKA 2X53S 1JWAB 2VHQA 3B7PA 2MMGA 1DARA 3DQZA 3QJ5A 1BX1A 3D2AA 3JD1A 4MIOA 4WZBE 5EE9A 3BXOA 1WHTB 2IX9A 1Y1LA 3DPUA 2DRIA 5JWHA 1NM5C 3QWBA 2OVBA 3DWFA 3C14C 1LNSA 1G3UA 4U6NA 4CL2A 5DNWA 1OH6A 2PUVA 3UJ8A 4AT1A 4MMYB 3F8SA 3L04A 3IMKA 4GQNA 1XLUA 4YRFA 1V5VA 1PL6A 4JT4A 3PLRA 4DXAA 5AUPB 2NTNA 3GMSA 1EFHA 1F0PA 1T8SA 3P4YA 4B75A 4FZ3A 3ZDDA 3ZZ1A 5K8LA 3U6BA 1LUAA 1SOVA 1XZIA 1Z0SA 1WJGA 3BPSA 1TZBA 1T8PA 3MCTA 3MXOA 4BCBA 1P60A 1KNQA 4PX3A 3IQWA 3IE1A 1MNAA 3HN6A 3WIDA 1BX3A 4G89A 1X1DA 2G25A 2K2QB 3QA9A 4AN1A 4EBBA 1PEAA 1Y0YA 2OUKA 4W99A 2V3CC 1GSIA 3G0BA 2Q0SA 1QO0D 3EY4A 1CUZA 3KFXA 3PFCA 5ICFA 4IHJB 1EE9A 2O7QA 4ZU3A 1OI2A 1S3SA 3IESA 5DLEA 3NFYA 1CIVA 3S2YA 3OLQA 3ZQJA 2IEZA 1I4EB 1ZAKA 2B92A 1XA0A 4MR7A 4R8RA 3WYNA 3HVIA 3J7TA 3JZMA 1AURA 1RABA 3OEHD 4WRRA 3RGWS 1KMCA 3PX2A 2DY1A 3T9DA 5I7EA 4PGFA 2EP8A 1N33B 1PKXA 3R6KA 1XA4A 5K3FB 4Q4CA 1QHXA 1MEOA 3OWOA 4DA8A 2OGZA 2E48A 3AFGA 3DL2A 3A3PA 1UFRA 2DBQA 5AW7A 4AVYA 1SURA 4KIWA 4UNSA 3FG9A 3U49A 3ZHXA 5KMGB 3FBTA 1KJZA 1T1RA 2XXAA 3B48A 1PP4A 1R5OA 1XKTA 3NIWA 6Q21A 3RUPA 2FMTA 2AN4A 3ZDZB 4E7OA 1YZLA 3VKWA 4RKEA 2O5CA 4Z4QA 3U1BA 2O0HA 1M2VB 2V7BA 2VQFB 4QGSA 1SG6A 3A1UA 4NICA 3SS8A 4BV8A 1UEJA 2QU7A 4WXYB 4KLRA 4G5RA 3BXFA 3N75A 3L92A 4XB1A 3U3ZA 4E03A 3OQJA 5G53C 4IDDA 4W4TA 4GI2A 4JKYA 3E23A 1ISFA 3QNUA 3OI7A 3UJDA 2ZYIA 3UFXA 4HR7A 4JASB 3P26A 2XE6A 3ET4A 4PQGA 2AXPA 2WNSA 5CFPA 1MENA 2IIBA 1CJTC 1TJ5A 1QDEA 2H4YA 2VJAA 3BMCB 3DYIA 1YRYE 4AZTA 3LDAA 2FSVC 2VBUA 3DBVO 2OM6A 3ANYB 2FW7A 3H0EA 3C16C 3KE8A 4IEEA 2XMRA 4L9WA 4PBRA 3UAWA 3WMXA 4LJRA 1GCOA 1M66A 4EMSA 5IUKC 2CK3A 2G07A 2JIPA 4D3FA 5CIYA 1EDEA 4QJIA 4R2XA 1YUBA 3DDOA 4HY3A 4LA4A 1Q0LA 3EF1A 5AVKA 5C5CA 3PJFA 3EVZA 1KU0A 2PU5A 1K7FB 2XEDA 4RUKA 3RVNA 2ZPUA 2WYRA 3D5EA 4G0ZA 4TLLB 4AQDA 4EO9A 4U3JA 4AKEA 1T4MA 4FQ7A 1JSZA 4YYZA 2C2GA 3AR6A 1J23A 3GARA 4G8JA 5TT0A 5I9LA 2R3SA 1BC5A 4LC9A 4WUTA 4YI3A 1WDKA 4QD3A 1RPTA 1PT6A 1HMYA 4LYHA 1JG2A 4S2EA 4B4OA 5ALSA 5CB4B 3IUBA 3LH5A 3NH9A 3L02A 3S7TA 1VQ9B 2PKCA 2JD2A 5AKYA 5IEBA 1WQ3A 2C9YA 2QUHA 4REQA 3USZA 3L7LA 1UBLS 2EEPA 4UUQA 1N3LA 4WZZA 3U7FB 1DOZA 3V4RA 3NC4A 3COWA 2O1XA 3HY3A 3F2IA 4P7GA 5HKLA 2EFHB 3V33A 1YHYA 1W48A 2QN8A 3EX7C 1OCEA 1P5HA 4OPVA 2QZPA 2NU8A 2BONA 5E0OA 2F62A 2X2OA 3OZ7A 2KSQA 4UCXA 5IRCD 2XTAA 3MJHA 4LSGA 1RWVA 1WPXA 3GPDG 1IN1A 3EG9B 4B32A 3AZPA 4YMVA 2DVMA 3ITDA 2BKLA 1QGUA 5K8TA 2JF0A 5LUAA 4FMDB 2YVUA 5FLYA 2AE2A 2OA0A 4D57A 2D2XA 1VDMA 2BKEA 3QZUA 3LDFA 1C1DB 2PX4A 3CUTA 3W1EA 1YL5A 1OXBB 4PRZA 4A0RA 2O3RA 4MR9B 1ZH4A 1NVVQ 1X15A 1VRWA 4MIYA 3ELYA 2G36A 3BGVA 4XR6A 4HX5A 2B61A 4HB2A 4R4JA 3S81A 1AKWA 2XMPA 3WGKA 2PMWB 4V3CA 4FHZA 1V45E 1OYOA 1PUIA 1CW2B 2XYHA 4G09A 2V31A 1PT8A 4IHJF 2SKCA 2WJGA 3ORQA 3OZBA 1CY0A 3R3ZA 2GYWA 2PRZA 3RHFA 4M1SA 2AFRA 3GLSA 3GROA 1NI4A 3EC7A 4J8PA 3A8KA 5AW1A 2R85A 1ZN2A 3GYBA 5F9MA 1SUDA 1TYBE 3IIMA 2W70A 3FN4A 3T1QA 3WDSA 2GDZA 5KKCA 5J2UB 2O0MA 1YD7A 3NH6A 4H7JA 2HNBA 1AG9A 1U0EA 1T9HA 1LX6A 4I9HA 4WLVA 1IH8A 2QM7A 3T0FA 2I0FA 1ZGAA 2YZ7A 2UZ4A 1SCQA 3M9WA 4YECA 1T1GA 3SF8A 4EA6A 5DT9A 3JCZA 5CLJA 2CHFA 3SVTA 1IJFA 4DCPA 3LGAA 2ZSKA 1G4AE 3UGJA 5IH3A 3MGCA 4BBPA 4F1KA 5C31A 1AA9A 3QPWA 3SX4A 5EYPA 2V0NA 2BI7A 1NKVA 1CK4A 4QHTA 1J1IA 4TWIA 3TRIA 2X9VA 1RM3A 4L2IB 4X94A 3W4IA 4PNEA 4TTTS 4DR2B 3ORSA 4ZALA 5IJ9B 5AVOA 2HSZA 2Z2YA 3ITNA 2R8BA 4CMEA 3A4MA 3DZGA 5I3ZA 5IYZB 2BISA 3OTWA 4N3CA 2PBLA 3LUHA 1RRMA 5CT5A 1SHTX 2GEJA 3U44A 4EM6A 2R84A 3CUEF 1HFJA 3EDRA 1JIVA 4R98A 4FBLA 5BNFA 2BYTA 2B94A 1SO8A 2Z4SA 1WUTA 2ZT7A 5FWYB 2GETA 2VDMB 1JV2B 4AKTA 3K8YA 3ESAA 4AMYA 4IKPA 2M6LA 1XEAA 2CE2X 3U7IA 5F1PA 3K2EA 3W3ZB 3DVQX 2R86A 4CODB 3WAJA 1IZ0A 1IM5A 4GLJA 2FETA 4W9NC 5CM2Z 3A6DA 4B3HA 2Z2XA 4F04A 4F3YA 4MH0R 4UC0A 2BP7B 3IJ5A 3WSTA 4I46A 4QFBA 2NX2A 1XHFA 3R23A 1ENZA 3GN1A 5TQJA 3RE1A 5LOVB 1MJFA 3OP1A 1QO7A 2XWSA 3MJ4A 3H9NA 1CRWG 1WSVA 3H75A 4RGYA 5BW4A 3HKCA 1XPJA 3PHIA 3AWDA 5FR2A 3CCVB 2G4CA 2OCBA 1L4HA 3ANLA 3MCZA 2JJ2A 4TTIA 4XSHA 3GB9A 1UBKS 4GRAA 1ZFNA 4PX5A 2RH8A 4UHCA 1G3QA 2YDYA 4AJ1A 1C3EA 5K0EA 4EEKA 2G40A 4BNDA 4PC6A 5JFOA 1TCBA 2JRCA 1FFSA 1Z15A 1XTUA 3HR7A 1VKOA 3MWEA 5CB4F 4G8CA 2PH1A 3GFQA 3OJLA 1K9MD 3DCNA 1NNI1 4E7PA 1QHYA 1VRVA 2RAUA 3QVGB 1XKXA 3VXKA 3A4IA 1EUZA 2IX3A 2B7LA 4INZA 2ZVQX 2FTKE 5DSXA 1H1LA 3DW1X 2C31A 4LJ5A 1PZXA 2R62A 5C4MA 1UM9A 4HLNA 1Z2EA 4HN4B 2QMUA 4MS3A 1ZESA 4IQFA 5ALHA 4M7RA 3U1TA 5I9IA 5L3QA 1KK0A 1NGSA 4MULA 1AKYA 2HOQA 4EGFA 5CHEA 4B82A 4BNLA 4YBZA 1XL0A 1GZ4A 4MZXA 3WL4A 4IIVA 1AX9A 2B1GA 1BXZA 4ZAFA 4HYTA 1NF2A 2BE7A 2FGKA 2QVZX 3A9RA 1PWYE 3KP1A 1G55A 3BK7A 4QUAA 5ILQA 3U3KA 4R9RA 1R0SA 8OHMA 7ADHA 2ADMA 3DVSX 1PR0A 4H3KB 4RETA 1JNYA 1PK7A 4QRHA 5AJTA 1SN7A 5A4MS 2F1OA 2QAJA 3GRCA 3B20A 4LJYA 3GDWA 1U0SY 4UPDA 2DFVA 4Z5XA 2IYAA 5HZHA 3U16A 3ILSA 4KE9A 1G3MA 3S99A 5TV2A 2CEKA 3FHCB 5FQOA 2C82A 4NENA 3FPHA 1DJMA 3BKWA 2R7NA 3IAUA 4Y2XA 3GLIA 3A4VA 3LPNA 4FEGA 2ZM6B 3T5GA 3WMEA 1E1DA 1GOTA 1UXJA 1LPOA 2JCSA 3HABA 4PO1A 1DAGA 4TYPA 1LDGA 5GOZA 1RHMA 3FIJA 2W2VA 4PLZA 4RKQA 4U2DA 3THWB 1GG2A 2O0JA 4NZOA 1O96A 4JUIA 2VUIB 2IV2X 3D7RA 1JR3E 2Y1DA 4DWVA 3LKZA 4KHPB 1JDUA 2F00A 2NZ8A 2XXJA 2ZJ6A 3CT6A 3PWKA 2O5RA 3BA6A 4KXNA 4YJDA 2HU2A 1Y8ZA 1GTSA 2BVNA 1ZRHA 4GBGA 5FI3A 1RP1A 2Y1XA 4X7FA 1B76A 1ONOA 1QNFA 3X43A 1NMQA 3CLHA 1SGWA 4WKGA 5LP6B 5FTLA 3GLGA 4ZYLA 4JIMA 3CH4B 4ZOEA 4MUBA 4N0PA 4G2NA 1MC4A 3WLPA 4NXNB 2PQMA 3P9XA 5AO9A 5FLKA 1I3KA 1WZNA 4JL5A 4ZCLA 4N3AA 1OAKA 5C0OE 1II8B 2XT9A 2HXYA 3KKNA 5DHAA 3HM9A 4YK7A 1WZIA 5JV5A 1MRNA 2ZJBA 2XUAA 4FK8A 1UOPA 3MGBA 3K0SA 4K0RA 4P36A 2EV9A 3KD3A 3A14A 1G2PA 2MSDB 3N6XA 3QVJA 2QY9A 4PV7A 3RASA 3ROXA 1JZTA 4EGCB 3I8SA 1NTOA 2O7SA 3H94A 1BZYA 3AETA 3G2LA 4J4HA 4K0KB 1NF8A 1NQOA 1UOEA 3ELWA 2OOKA 3WK6A 5BSFA 3IR5A 4UNIA 3V7AA 4NTZA 2D13A 4DRYA 3PDUA 3URKA 3GRVA 4BFZA 1FVFA 3OQ1A 2WFLA 1XQYA 2Z8XA 4K9PA 4KCGA 3T9CA 3PA2A 1MUUA 5HMMA 1NE2A 4LYJA 4R6WA 2AA3A 3D26A 5AJUA 3CRQA 1R0LA 5KQPA 4TSFD 1W49A 3ZKAA 3GAMA 3H6GA 3FPFA 3CF6R 3R6GA 1NXQA 1RYNA 1HDEA 1W581 1T5EA 1V37A 5D00A 1Z7GA 2AK3A 1QH0A 5HIIA 4IMPA 2FHPA 1MDFA 3ZLUA 4LFAB 1JWBB 2WLTA 3DOEA 2Q7XA 4PEVA 4Y2HA 2VRCA 5DLQC 4OHFA 2TMKA 2X5NA 3NPAA 1J0XO 1M33A 2O1EA 1NVUQ 2DM6A 1JDZA 3KXPA 2NYVA 1B7GO 2B5VA 3EWSA 4P58A 2PAFA 4Q4JB 3A2KA 4WCFC 1U0OC 5IKOA 2V58A 1QLWA 2M9MA 2JD0A 4DYDA 3C8HA 3EGOA 1T1IA 2WVJA 2YHSA 4K05A 5KDLA 4F3RA 1LPSA 2I8LA 4EGSA 1ST3A 5I7UA 1SBYA 2GRJA 5C80A 4H1VA 3RUFA 1W4ZA 2NQ2C 3WP0A 3E6AA 4RLSA 5F1OA 4ZGBA 3FGNA 1OIXA 4RSHA 5MF6A 4DV2B 1QIFA 2W6ID 2H1LA 2SKDA 3O8BA 4EHNA 2D1SA 1NLMA 2XMDA 4GKVA 1VCMA 5ABPA 4JLNA 4XLCA 1UMDA 2GN0A 3JR7A 1I30A 3SAJA 4PZ0A 1WW8A 3E7PA 2ACEA 2W8BA 3MTIA 5TARA 2AN1A 2O0KA 3TD2A 1H9BA 2YOHA 2Z56A 3PDJA 3RSGA 3UY4A 4DKJA 1H2EA 1T3GA 3CRNA 4JEIA 3S8MA 1TM4E 2KE5A 5COQA 2M2IA 5DGIA 4ECEA 1L3BA 4P7JA 5DWVA 5FTMA 2GARA 3R3HA 3ROGA 4CI0B 3Q7IA 1IE3A 4HE6A 1KXJA 4J94A 3HMQA 4NCKA 3JQ9C 4D25A 2AWNA 4FYWA 4E6EA 2AW3A 1I7QB 5IT0A 5FI5A 1K3TA 1TZKA 2C0QA 1GFIA 4HFNA 4ZEXA 1A8IA 1LLDA 2CYCA 5I45A 2JNWA 1S7CA 3MWYW 3QOWA 4BKRA 2WM2A 3OLXA 5I8WA 3PDIB 1V43A 2P5TB 2GYVA 4Z3OA 2GILA 3L4BC 3TL2A 1JHPA 4NOKA 4LGYA 3SXUB 1IHPA 2QLFA 3BL8A 4BNYA 3E22A 3NRBA 4G0WA 2HSGA 2WP8J 3U60B 4L8FA 3VMMA 2H00A 1G291 3I2HA 1TEHA 4M86A 1NBME 1YL7A 2OT3B 3MGAA 4N8EA 3OIUA 5AM5A 4BQRA 4EUKA 4QAJA 4BNTA 2J31A 1L7XA 2X9GA 3OCVA 4M3NA 3AIKA 2O7RA 1O5OA 3M9LA 1AZLA 5C1PA 3EGCA 1ESMA 4AO7A 1AXGA 1C1HA 3KS9A 5JAQA 3ZVLA 3TI7A 3FHTA 3KOOA 2HV8A 2H4XA 2RH9B 1D9XA 3KPVA 3RB8A 1AGYA 1JFVA 4DIBA 2OL4A 2B21A 4OKNA 3IQIX 2UUPA 1H4TA 13PKA 4JC0A 5B3AA 1YQQA 3IQGX 2A9FA 2WIAA 1EEXB 3WIVA 4BAZA 4R83A 3PL1A 4D6YA 5A7FA 5JJLA 1G9SA 1S2OA 2WFAA 4JUCA 4M46A 4MRRA 2E82A 3MJCA 4D46A 1XXHE 1Y5MA 4JI3B 4WN9B 2WPDA 4PAAA 3RPEA 3BF7A 2GBGA 3EXEB 1H6AA 1QYVA 3FNFA 5IPFA 2VQSA 2ZU0C 3PZBA 2Y76A 3I2KA 4Z8XA 4G0UA 2C97A 1Q2UA 1E8DA 4V0QA 1CEXA 1TK9A 1TC2A 3KLNA 2C54A 3IE2A 1R9JA 3W7AA 1N7HA 2CXTA 621PA 5D3ZA 2MSCB 3DLBA 3Q6MA 1E3DA 1ES9A 2Q50A 1PSDA 2P0AA 3OVMA 1A9XA 2X8KA 3SDSA 3ZEIA 2E4UA 4BX9A 1CRQA 3UJAA 4YRKA 5AJWA 1XMJA 3FI0A 4LK2A 2BR4A 3CW9A 4D4LA 3ISVA 1RPZA 1NJ8A 3THRA 1K8XB 3CONA 3VZSA 4ZP1A 2G09A 5C46F 2EYUA 2HLDA 3P7MA 1RCTE 3ESYA 4GZ6A 3QEAZ 3T54A 2VSOA 1XDGA 4K6MA 4EQZA 4IFBA 2GN9A 3U6KA 1QRUA 4I4IA 2PLAA 3B6MA 3DEAA 3GPCA 1GLVA 4G37A 3RVMA 1L5NA 3CC4B 1XL1A 1JDBB 4QYTA 1OREA 1WLYA 5JAUA 4AZ0A 2ZATA 1QUFA 3JYNA 2OCDA 2Q27A 2BJWA 2ZRCA 3BXHA 4GD3Q 4ZHQF 2R5FA 1ZEMA 4IIYA 2RK6A 3HZOA 2J3MA 1NPDA 2YNMA 5I4CA 1B8UA 4Q7KA 2VAPA 3Q5EA 3DXFA 1X0XA 1P0PA 3QYFA 1BSVA 5EIWA 1G5IA 3I28A 1ECJA 3OPVA 4TV9B 4ZYZA 3O4HA 1VQOB 2FOXA 4XR9A 5CR9A 5A3SA 4EG1A 5KKNB 2XGOA 3RAGA 3U3MA 1R0KA 1U2ZA 1VIAA 2PUDA 4RIGA 1EXDA 4JVNA 1R0ZA 3T0GA 3ZI0A 4ZVOA 5JY6A 4WVLA 3H5RA 3K8ZA 3L7JA 3PQFA 4UZSA 3WLLA 721PA 1AO0A 3MJVA 3V48A 4D4IA 4K6KA 3ADBA 2W6PA 1U3FA 1SQ6A 4Q47A 3RSHA 1JQEA 3EIOA 3TPZA 3EUAA 1KC1A 1T0HB 5EUBA 5CXUA 3E27A 2Q2VA 4D96A 4LFBB 7AT1A 1OW3B 4HNAB 3HO1A 2C92A 4JYZA 3ES9A 3KLBA 1I1HA 2B1RA 2WJAA 2VDNB 3KVOA 3O9MA 4UNNA 5G4KA 3ZWNA 4AI6A 4PFQA 2JB9A 3JZDA 4G4GA 5SZIA 4AY3A 3IALA 4TTPA 3JAKA 2I78A 4L4XA 3NBQA 3KZ1E 1YZGA 2BCEA 4L0DA 1YGPA 5T6BA 1QB8A 3AEUB 3CMCO 4FPXA 4RJKA 4DKXA 4RPKA 1YR7A 4H1HA 4BZPA 1OV4A 4PG5A 3G59A 4OMCA 2GPSA 1RYEA 3HHPA 3HUUA 1N08A 4LYFA 4PTYA 1Q86D 2CVZA 3JQCA 3DV9A 4ON9A 1U3TA 4UFPA 1JJ2B 4DMHA 3V46A 4ZQFA 5A7HA 1EEHA 1AV7A 3IBTA 3ZHQA 4LI3X 4RW0A 5H4GA 4PW0A 4U9IS 1ZGJA 3DB2A 1G7SA 1E2LA 2RKBA 3IMCA 5FWNA 4NFSA 1ZL2A 1JPJA 3EUWA 2ODQA 4N0MA 1XZLA 2EATA 4FYJA 3C7KA 3HJHA 2KX7A 4DBLC 5KVCA 4MRSA 4O5AA 3IO3A 4ZU6X 4AN4A 4K6GA 4FGSA 3BGIA 2PRSA 3SJZA 1DBRA 2Y2VA 2IH5A 4D42A 3CJRA 4E4RA 4RIFA 2X9QA 3ILXA 3ZX4A 3KJXA 2PUJA 2WTMA 2QB5A 3KJNA 4GI5A 4LISA 4LTMA 3S2UA 1XZAA 3E9YA 4N5IX 2CLHB 2YJGA 4OYRA 5DVZA 2WVGA 1JXAA 2Q3MA 1O8CA 1KERA 3R9XB 2VBTA 1D5WA 4OSOA 5IABA 5K3EA 2VH1A 3D2LA 3F4KA 4M54A 1QU2A 5JS2A 4GW3A 1DRVA 4RELA 3S68A 4WBNB 2C2HA 2FQXA 3OEYA 2BZGA 3Q3EA 3HGMA 4GVLA 3QE3A 4F91B 3M4NA 1FYWA 1Y33E 5BSWA 3C7TA 1UXKA 1Q0RA 5EOVA 5TNXA 3K72B 1UD8A 2WSSA 4BJ3A 2ZAGA 4BXOA 4LVCA 2JIOA 2WTAA 3JSAA 1Z88A 2LIVA 4UXHA 1B93A 4N82A 4DIKA 4EY3A 1JB1A 2AC7A 3TTSA 4TWRA 5JAMA 2YN4A 5ESRA 1O3YA 5BMVB 5BWBA 1XFAA 2CMFA 1P0FA 3I9KA 5JXHA 3CP2A 3DD1A 3BMQB 1LGYA 2NV2B 2OP0A 2Y05A 3H84A 1H5QA 3VOBA 3GOQA 3ZWXA 1HYGA 1Y6QA 4LS3A 4XIJA 1IUPA 2BFFB 1P7CA 4RK6A 3T06B 4TM8A 3ED5A 3CC2B 2E1PA 3LZDA 4HAZA 2XBLA 2CXXA 5H83A 3SSMA 3LLUA 1SJ9A 1N2OA 1RXVA 3FPGA 4WV3A 1K6IA 1Q1BA 2H29A 3AY3A 3HGTA 2R00C 5HBRA 3TBFA 3OJXA 3W77A 1J8QA 1TEXA 2O3QA 4OQEA 1XGKA 4DEVA 3TLGB 3ZLJA 3I61A 4XDYA 4A36A 3QQ5A 1ECPA 2V9ZA 2I7XA 4PY2A 5AVUA 1ZIPA 2HN9A 3EDOA 4BQFA 1J07A 2C4WA 3WV5A 5LXTF 4TV9F 2XQJA 4MSUA 1I10A 3F0TA 4NKRA 1JYEA 3AIOA 5TMBA 1AE1A 5CAEA 2PQ6A 1YU9A 4X7DA 3ST7A 3AJ9A 2IEAA 1EFPA 4UNRA 5HYVA 1AGRA 1S4QA 1JPNA 1L1QA 2AX3A 4GKBA 4LRTB 1J70A 1E62A 5JHHB 3PR2B 4CKEB 2YY5A 4TQGA 3ZNOA 1MJGA 1Y5RA 2RC5A 1V3QE 5H16A 4J1SA 1Z5OA 1C14A 1G5HA 2B1JA 4NU8X 2FH5B 2VO1A 1WUIS 1U2SA 2YZ2A 1CT9A 3C7CB 2IPNA 1AMUA 5DNYB 3MTAA 1W9HA 4GUDA 5DLYA 2OPHA 4I3FA 1GTG1 4JLDA 1QVAA 5DHPA 3PHGA 3P27A 3SS7X 2EP5A 5I5GA 4CI9A 4ZT4A 4MV4A 1W36B 4FR5A 1HC7A 2D5AA 2CB9A 2X15A 3GG9A 3H2HA 3TEJA 2OAP1 3LVFO 5CCEA 1LS6A 3G3EA 1CF4A 1FVXA 3UT0A 4I6JA 1F2VA 1W5EA 4V1CI 4PZEA 3P97A 5D5QA 2IYRA 2JBWA 5C8YA 1TZCA 1XMSA 2ZIWB 4J03A 3ZWKA 5BSUA 2B0CA 4KQWA 4MV1A 1BHO1 2G0AA 2VP5A 1PZGA 2HHLA 3LD9A 3F71A 4MKHA 4B4KA 4HFRA 4CQLB 4HVAA 1FUKA 5EERA 3WTCA 4BEVA 4I8DA 2FA9A 3HUDA 3B8HA 4WKNA 3TCNA 2AOTB 4QVIA 1SY7A 2P30A 4NBRA 2AF4C 5C5DA 2AN5A 3B1WA 4RTJA 5TPZD 1M8JA 1D0SA 3PXAA 2VWQA 2HBQA 4QIHA 3E0QA 5GZ1A 4I1VA 3K5WA 3ISXA 4M7PA 4AF6A 4F9TA 1JJ7A 1X77A 1G4UR 1KYYA 1UP4A 2CNLA 4G2TA 2FPKA 4OQPA 1SBQA 4OHVA 3ZWAA 4AB1A 1DRKA 3FCAA 4N5MA 4P2BA 4QDTA 1XTSA 1VKHA 3EHEA 2NXNA 3H5IA 5J1TB 4X7PA 3VU0A 4YMGA 1EGVB 1YSCA 1JLHA 4AF7A 4KWEA 3DMRA 4DDKA 1N9ZA 4KG7A 5K45A 3HU3A 4MQMA 3M6WA 4GPAA 4PSKA 5EE5B 3DOCA 3Q7EA 1PR4A 1OUMA 5JCXA 3VQTA 2FRDA 5ED0A 4A1FA 3ROTA 2ZYRA 4ZQIA 5C8VA 1NBHA 2RH4A 3DZFA 4UE2A 4EG5A 4WBNF 4D5GA 2HK9A 1WCV1 1TJPB 1DWPA 4BLUA 4LI0A 3LUGA 1KJIA 4Y8VA 2G9RA 4C7MA 1K7YA 1WUHS 3HJGA 1DAMA 2VHEA 2X6YA 4QC2A 5DX8A 4BFUA 1WU7A 4TMWA 3MJSA 1DGQA 3VTFA 2JLYA 4GE0A 3CUSA 7ABPA 2V1UA 3AK4A 2A1TS 3JYHA 3NIDB 4TVBA 2PSFA 3R7WB 3CLVA 4QYSA 1MFZA 1SULA 2JLRA 4ZC8A 4DNQA 5BMVF 2V7EA 4WA7A 5JS7A 3DDHA 2D1RA 3M6VA 2BHRA 1C0PA 2EGHA 1GCAA 2RJNA 3L0OA 4G1UC 5BV1A 1BWRA 3NAQA 2VDQB 1MAWA 2HO5A 2EDAA 2QD2A 4H3HB 1YR1A 2G9ZA 2ZB3A 3PJRA 1R6DA 5I51A 1RSZA 3GJYA 5BT9A 3OESA 1Y42X 2Z2KA 2YWRA 4Q9NA 4FINA 1CF9A 4Z4TA 4LWPA 4Q4AB 3RADC 1ZR4A 3NJ4A 1DO2A 3TWOA 1VPLA 2HJHA 4V38A 3N6VA 2DQKA 3OCCA 2B5OA 2CLMB 5HQJA 4F4UA 2EGGA 1ZQ9A 2NO4A 3DXZA 3P96A 5E1BA 2IXBA 2QG9A 3TL3A 3O8OB 5DSTA 1DFHA 1UPCA 3ZOKA 4OIFA 4C7BA 1R16A 2X0RA 1K73D 1XR3A 2C4TA 2R65A 2LCFA 4GYKA 1FUYB 1G2OA 4ZQBA 4EMUA 5CXSA 4V03A 1ZRSA 1EM8B 1ONPA 2HZ7A 3O4FA 3GRYA 3AY7A 4YJ3A 5ALOA 1P2DA 3EC1A 3AHHA 4LHXA 3A3YA 2I1VB 4DGSA 2VZLA 1JE1A 4J7UA 1Z3CA 1CUWA 2CZQA 2D54A 2XSZA 2A92A 3QFSA 1EMDA 1HFKA 1VE5A 2ALJA 4GQBA 4IRXA 3VPCA 4D4HA 4E88A 5KEIA 2P75A 1NN3A 3JZIA 3UMGA 1R6TA 4H2DA 5LLTA 4NEGA 3U4QA 1PL0A 1Y7PA 5C2JB 1WUJS 4TQ9A 1E1CB 1XAGA 2GZSA 3DR5A 3P2MA 4MLDA 5AXBA 4Z4UA 1HR0B 1PFGA 4DLVA 4K46A 1XPRA 1T5HX 4EQ6A 1VHQA 3JV7A 3ZU3A 4A92A 3GC6A 5BW6B 3C3JA 1L7OA 2F1IA 4AS1A 4MQEA 4MW6A 1SD2A 2JJQA 1J97A 2GASA 2CCJA 3DG9A 1V5FA 4KNVA 4RXTA 4RM0A 4FDVA 3PKZA 4BAUA 4F92B 4KITB 1Z4LA 4JT8A 1FYDA 5FUVA 4G85A 3ORHA 4KIJA 3PNQA 3USES 1NFRA 1J56A 1W30A 2WKQA 4JBXA 4UUPA 2YWHA 1CJMA 2ZIXA 3T1YB 1T25A 4BMOB 1TRKA 3C8UA 2YUIA 3HHEA 4GR9A 2WTXA 2WSMA 4M1MA 3S5UA 2IYSA 1ZITA 4Z7OB 1U4OA 3C6MA 3KKZA 4Z9AA 2OYCA 3EH2A 2Z2IA 1YIJB 1AKEA 1VP9A 1RKVA 1TADA 2CW5A 2H2WA 2CL6X 5HZBA 2ONKA 1K5HA 2R44A 2W6NA 1UMCA 1SEVA 2P3OA 2Z9DA 3OIGA 2XGJA 3PPWA 1V3VA 1SU8A 3AEKB 3MINA 4E07A 1M1NB 5AVVA 4B6GA 5JZVA 1NMEA 1KEVA 2MT9A 4U1RA 5AXCA 1ZOSA 2PMFA 4XFDA 5G1OA 2ZIEA 5SZJA 2CJYA 3BMXA 1RWKA 3MQ2A 2GHQA 4D80A 4TGLA 4K9NA 4Q6BA 3AP2A 4TXLA 5C8XA 2ZRLA 4IG9A 3Q8LA 5FB3A 4NCNA 1G6KA 4TL9A 1B2LA 3PLAE 4HLQB 4YIKA 2ZSAA 2AQIA 3IDAA 4Z8YA 1A04A 3H1GA 1E6UA 1G0OA 3VI4B 3VX3A 5CG2A 5JI2E 2Q6LA 1CKEA 1OTYA 2FJPA 2P67A 3LUPA 4BNXA 5BNTA 5BUZA 1VLYA 2CHEA 3GWZA 3PEFA 1Y6RA 4WLEA 4E5YA 4LDNA 2CXRA 1S01A 4DCJA 3OTGA 2JFZA 4G23A 2A0WA 5B2FA 4U7DA 1E2UA 4J16A 3JWEA 3M70A 2B69A 3OJFA 1GNLA 4WZEA 4LN1A 1GD1O 1JG4A 1IQPA 1X86B 2BF7A 4ZRDA 3VI3B 2W6JA 3SYLA 4WNAB 3UMMA 2RHBA 5J2TB 3WL6A 1R8YA 1PG0A 2JI4A 1ZM4A 5AKHA 4JH0A 2DYKA 3ZWMA 3BIJA 1I2BA 1T3LA 4LVNA 1THTA 1L4GA 3IEXA 4M9UA 4X9XA 3TNFA 5IN4A 5DW0A 3JALB 4O3MA 2QTNA 1PWZA 3UG7A 1IK6A 1L7PA 1YVDA 2FPXA 4EIWA 2A1UB 4IUYA 3CG0A 2G1AA 3QELB 4BNNA 2ECQA 1KAEA 4QJBA 3LUCA 4LG1A 3E81A 1U3CA 4Q9AA 3EGDA 2YW9A 1GTL1 4Y1FA 3W5JA 1QFXA 3MS2A 3C97A 2ODBA 5AESA 3WB1A 1JMYA 3CBGA 4FQ5A 1EXVA 4FUTA 4EKIA 1UKCA 3T5AA 2E85A 1VBKA 4DRXB 1VC2A 2NVOA 3GZJA 3RHTA 3AL0C 2A7QA 1LDMA 4NAVA 3ZHZA 4C7JA 1GRRA 4CG1A 1L7QA 1MBZA 2HX1A 2IXEA 5DO9A 2BM9A 2UV8A 4EF4A 2X77A 2ZZKA 3I01A 4P7KA 1NI3A 2ZBEA 3LKVA 4Y6RA 3K0BA 3IAS1 4ANFA 2Y27A 4DDTA 1U2PA 5DZSA 4CCYA 4FMCB 3T4PA 5K03A 3JQAD 4DIDA 3KQYA 3BDAA 1OSNA 5CNMA 1EK1A 2GNPA 1SM4A 1E58A 3GA7A 5FFFA 4FT4A 4KUHA 4EG6A 2XD4A 4YR7A 3GJ0A 4EKGA 1U2QA 3LC2O 4MVJD 5GWXA 2WHXA 3PGA1 2VQ3A 4MO9A 1XNQB 2AVNA 1JKFA 1DE0A 3ASVA 2FEXA 1OIVA 4R2HA 4LSZA 3FNBA 3EGIA 2XNSA 5ECGC 3RQIA 3ONVA 2W93A 3ZHCA 4BLVA 4KOAA 2WIJA 4MEAA 2I2XB 2XF8A 4YMLA 4FXUA 4MDFA 3KCNA 2B8NA 2R0QC 4QDOA 3B9BA 3R24A 4QT0A 3IAEA 1L7AA 3CNLA 5EKXA 3F6PA 1N6KA 3BAFA 3D3EA 4CPDA 5F9HA 5T57A 3OIWA 1PGNA 1TOAA 1XVVA 3QXHA 5CDTA 1HURA 4YS6A 3GJ7A 2ZPTX 3PGJA 1K4KA 2P1DA 4LQDA 1E9DA 4CIDA 1JQBA 5HM8A 3I58A 5EI5A 2CL0X 1QJCA 3DAYA 3ZCTA 4UULA 2P68A 5BSMA 2FPOA 1UT5A 3R41A 3TKYA 3KQWA 4YP7A 4PZPA 3DM9B 2WTUA 3EQ6A 3PDCA 2R6HA 3CSDA 4KE8A 3B2NA 3OA2A 4TT3A 4NV1A 3V32A 1SCKA 3ZY4A 4LJ7A 4GRIA 2FW9A 3LQQA 5HQ3A 4MGEA 1RWWA 2CXUA 3K6SB 4IG4A 1TAGA 3L0PA 3PX3A 4OMFG 1Y6GA 4E5NA 5EY5B 2P9FA 3O4VA 4TYWA 5JCOC 3PUMA 3D0QA 4FR0A 2QX6A 1Q92A 3K3PA 3NIBA 1PJLA 4DM3A 2FF7A 3LUAA 3AMVA 4L6AA 5TF4A 1X7YB 3LT5A 4W5RA 3OJ0A 4TKMA 5G1PA 1SCIA 4Y2UA 1KFEB 4LXHA 1DEOA 4L4RA 1LW6E 4EFLA 2NQTA 5JVDA 1TPYA 4YCSA 5J2TF 2WU3A 3OE5A 4MHSA 3J7AC 1NQAO 2ZXIA 1UK8A 1TLTA 2M32A 3ANMA 3FNIA 1KI6A 1AVTA 2HAEA 4FSHA 3PNPA 4WAUA 4YT5A 5DXFA 1L5OA 3ZHUA 5KTPA 1ZX1A 2FP3A 4FZ5A 3QLTA 4RWEA 4H7HA 1CETA 4EHDA 3WGIA 4P22A 1PVOA 2DWQA 3F6EX 3WHIA 1YJ9B 3K1AB 1WTAA 5K0CA 4CV1A 1Q7TA 1Q19A 2XBUA 1AQUA 3CISA 3IKVA 3L4SO 4XCXA 5DWDA 4MYUA 4ZOBA 3OLCX 2WJ3A 1L1EA 5DI3B 5K0GA 4GFDA 3COPA 4FOPA 3ABIA 2XODA 3PXUA 4HQLA 3QVMA 3V8EA 2E6UX 2X40A 3AUTA 4HL6A 1VLHA 1RLUA 4FLMA 4UATA 3UIEA 4ZYTA 2ZR8A 3W8EA 4K9RA 4BNKA 3RSSA 5BR8B 1BEZA 4RLHA 2HF9A 5KOHA 1Q5PA 5K0LA 3TQQA 1LVHA 2OV3A 2N47A 1BCSA 2IJGX 3IP3A 3OWXA 1BS2A 2QX9A 3RBAA 2CDCA 3VPAA 3KQPA 2RHRA 4GLBA 5AW4A 2RK4A 3F98A 3NHZA 1KSGA 3AU8A 5F76A 3MT9A 5E3HA 2JLQA 1F6DA 4PZCA 4DJTA 1RVV1 4K3UA 2OESA 1Y9AA 4WZKA 2HPHA 4XA8A 1YI8A 4MCHA 1YZTA 2JA1A 3V4OA 2O8DA 5FPSA 2HXSA 4R1SA 1GPKA 3EOZA 3TZLA 2VHVA 1KZGB 2JJYA 5D8DA 3DBOB 4CTJA 1RACA 3KJQA 5E6RB 2CK3D 4PYJA 4R8LA 2HDHA 4D44A 3EYAA 1A50B 1QV6A 3LV8A 5JRDS 1EJBA 2FEKA 1YE8A 2QYSA 3GFVA 3H5AA 4FFMA 4GOKA 1US8B 3UAVA 1BE1A 1YDWA 2EZ4A 4M88A 4B4UA 2IOFK 2YXPX 5CTJA 4RZ3A 1VHEA 5B6PA 1V5WA 1DG9A 4QQ8A 2WA2A 1REQB 1DQNA 3FDZA 3AHCA 3IP1A 2XPCA 3W6NA 5C7LO 3AR3A 2YWFA 1BS9A 4TX1A 3M5PA 4FNMA 1J2TA 3TJMA 2V4ZA 3EQ2A 5KW9A 1P62B 2RJ3A 1DXOA 3RVPA 2AC4A 3S55A 1GRVA 4DXHA 2DTEA 2ZI4A 4G1CA 1CPYA 2Q21A 3DL4A 3GLFE 4GQAA 4JB8A 1BVRA 3CKYA 5EHZA 3QEKA 1I14A 4PTZA 3LDUA 4LCBA 1EFKA 3GWGA 1ZN9A 2IW3A 2PZEA 3HSSA 4HXGA 3MUFA 1DP4A 3ETDA 2J41A 2ODPA 4PLTA 3GT4A 1Y4SA 3DULA 2D9RA 4M0FA 1YULA 2M1ZA 1IBLB 4JWTA 4DWWA 2IVFA 4TVOA 4RULA 2NUPA 3UHPA 2IODA 5CDGA 1HQDA 2J7PA 3DBLB 3GY0A 2R1TB 2H1FA 4C1NA 3OE1A 3RAEC 3FPEA 4G0OA 3WZMA 3IEUA 2BGKA 2ZIFA 3AQIA 3PFBA 1GTVA 2NM0A 2E37A 4RD6A 3HBMA 1NXWA 2FMKA 4IMIB 1I4WA 1TAQA 4NY1A 1BQ4A 4DM4A 3A28A 3KTFA 4HLUA 4ZT5A 3EWAA 3T1TA 5DGCA 3ONUA 1UBNA 2WUEA 2P1RA 2GEVA 5E6UB 2A4KA 4OHZA 1J7KA 5KPJA 1QF7A 1E79A 5DOZA 1JB9A 3CP8A 3WGJA 1TT7A 1XKLA 1H6DA 1L4YA 1QVRA 3WLKX 3KJIA 3RUHA 4X7EA 4UTOA 2GM4A 2J33A 3OOEA 4R2WA 5L4LA 2EX1A 1LK7A 2Q28A 2YHIB 2HHHB 1UDAA 1ODSA 3AHGA 3GJ4A 3NM4A 4INOA 4ITVA 3UXHA 4BNFA 5BWLA 3F3KA 2GA9A 2ZDHA 1E1NA 3I1IA 3MEQA 1AF7A 1SCUA 3HVHA 4B3FX 1N8SA 3D4IA 1P1CA 5IN5A 4N3NA 3HNPA 5IKMA 5LZ4A 4JI0B 1H3FA 2NO0A 2B4TO 4KMSA 1YDHA 1U1FA 1JJFA 1PGPA 2PNFA 3NALA 3QKSB 4YDRA 5AQEA 1SUFA 2FFJA 4N9QA 1T91A 3CPSA 2G9VA 3D31A 4PHCA 3WTBA 3DLHA 3VYUB 2HQOA 1U2DC 1X9IA 1RWOA 4HAYA 4X97A 5TQVA 1HX7A 2XCUA 1B00A 3Q3HA 1QIEA 1K8YB 4FW8A 4MVJM 3M3DA 1CQWA 1DAPA 4REOA 5JASA 2CLEB 2E49A 4KZPA 4IFEA 1ZLXA 3WBBA 3WR5A 1J2EA 1PVVA 1J09A 1XCOA 5BVGA 5F2NA 1LQUA 3EBPA 3RS5A 4HDCA 4BEBA 2D2FA 5THKA 1QYWA 2C5AA 2O05A 3N2KA 2Y77A 1Q0SA 3OX1A 2A14A 1MABA 1KJNA 2D5CA 2NV0A 2W6QA 4M9ZA 3CGGA 3AI3A 5JNRA 1AD2A 2VWGA 3GGSA 2QZSA 1DFIA 3W6UA 4RD4A 4XD7D 3ESQA 1X1TA 1QE3A 4DZRA 4F6CA 3C2QA 3R5TA 4XDZA 1TZMA 3EDMA 5FA5A 4UZEA 2PXCA 3O8QA 3NHYA 4EUHA 5JD6A 4G5GA 5G0SA 1WY7A 3V1MA 4G7WA 3AUKA 4AICA 1AH2A 3JVIA 4PGGA 3TW6A 4NQRA 5A9SB 2CJWB 1L5WA 1NNEA 1I7LA 2AVDA 4NPAA 5DOVA 3VKFA 1F17A 5BN4B 5BN5A 3SOZA 5I9MA 1JVSA 4QPPA 3IPRA 4RAQA 2VCEA 4UHFA 1GQYA 1TGYA 5A88A 2G88A 3G9XA 2C2WA 2HF2A 4O2AB 1Q20A 4PVCA 4BS9A 1YZFA 4ARSA 1VMAA 3B1YA 3ENWA 3E1GA 1Z3IX 3BVPA 2NACA 3UM9A 3BJRA 3TZBA 2OAQ1 1GV0A 4TUYA 2KM1A 5DFAA 3STTA 4A5OA 2HY7A 2JJ2D 3LECA 4PPNA 2YKGA 4N40A 4ZQHA 1S0UA 4OF4A 1HOTA