2V31A

Structure of first catalytic cysteine half-domain of mouse ubiquitin- activating enzyme
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
112
structure length
112
Chain Sequence
EFGEEMVLTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPASLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of First Catalytic Cysteine Half-Domain of Mouse Ubiquitin-Activating Enzyme
rcsb
molecule tags Ligase
molecule keywords UBIQUITIN-ACTIVATING ENZYME E1 X
total genus 8
structure length 112
sequence length 112
ec nomenclature ec 6.2.1.45: E1 ubiquitin-activating enzyme.
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.180 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2v31A01
4II3A 4P22A 2LZJA 4NNJA 3CMMA 2V31A 5KNLA 4II2A
chains in the Genus database with same CATH superfamily
2ZXHA 3A8IA 3GQBA 1WP6A 4QV2A 1KRHA 4HIZA 5CDFA 1GAQA 3T56B 1IB0A 1E62A 2NPFA 3ZBTA 2AHOA 1G7TA 4QVAA 4RDKA 3CCUB 3ONYA 2M5SA 3KL9A 3OEHA 3CCJB 1BX1A 1DARA 3W2FA 3G6EB 4TMVA 2PIAA 4B3XA 2BN4A 4N3NA 4RD1A 1UD6A 3AVYA 3V7AA 4LBVA 2OTJB 1WTHD 1QFZA 1S4MA 4AF7A 4H9GA 5H59A 3CCEB 1E43A 2XNCA 2QEXB 4RCZA 3NE5B 4AVZA 1Q81D 3FJOA 3CC2B 1XFOA 3OAAA 5IYQA 2Q6KA 4Z4RA 1W0KA 4RD3A 2JJ2A 3V76A 2OK8A 4Y9UA 3CRZA 1KQSB 4XLHA 1HA3A 4Z4SA 2DCUA 1TVCA 2C78A 4HE6A 5LMZA 3W5HA 5TY0A 3W2HA 1CNFA 1E79A 5KSWB 4OP7A 1N08A 2EFGA 3QFCA 4RCYA 2D3LA 1EXMA 3WNDA 2OBRA 4RD4A 2WYRA 4M1KA 4QVJA 2DYIA 5BSYA 5DSZA 3AVTA 2CRVA 4XLFA 2ZL7A 3VO2A 2X6YA 1VQOB 4G6IA 4B4DA 1VHOA 2HDNB 1IHMA 4XKVA 3WNBA 3Q6RA 2RC5A 1K9MD 3WY9A 4X8IA 1QG0A 4Z4ZA 4QUZA 1N06A 5EMNA 5IYRA 4FWTA 3JQPA 3SEJA 2OK7A 1SKYB 4QFMA 4AF6A 3PVDA 1Q7YD 1BMFA 1Y0YA 2XGJA 4G1VA 3CCQB 4X06A 4NNJA 4Z4VA 2DOGA 5J3OA 2XZOA 4XONA 3GVLA 1P4MA 2XNDA 1QGYA 2GJPA 1OB0A 2ZL6A 2E1RA 2C4TA 3H9NA 3OKXA 3SLNA 2HCJB 4YAUA 5DS0A 3R6KA 2CW5A 4DK0A 3GVKA 3CD6B 3VNUA 4OPSA 3ZBUA 4P22A 1F60A 3CP2A 1Q86D 4UAJA 2ZTNA 5AN9A 1RQPA 4CQJA 4KKTA 1E64A 3ZIAA 3VR6A 1T6YA 2CF4A 3WYAA 1BLIA 5TV2A 1NJID 1BPLA 1WU8A 1I7PA 4UZFA 3I56B 3E20A 3PA1A 4KKUA 4ZV4A 5KNLA 1QVGB 3ZZTA 1BJKA 1VQ7B 2JIZA 4WZLA 5TR9A 2BPOA 4XLCA 1H42A 1KD1D 2R9VA 3CCLB 3QFTA 4OOXA 4B47A 1J9ZA 1G7SA 4OPOA 5THXA 3CMEB 1YI2B 4G1BA 3BCFA 4M0LA 5JBQA 4M4SA 4ROXA 4TN1A 3QFSA 3A8JA 5J35A 1DDGA 4HE5A 4RDLA 3G4SB 1R5BA 1M90D 2FVGA 3JQRA 2YWEA 3QE2A 4UZUA 3PA2A 4YXWA 1T6XA 2ZZFA 1KMHA 4PC7A 4E0FA 4RPDA 3CCRB 1Q82D 3A3BA 2XOKA 2JDIA 1S72B 2PLFA 3ZZ0A 5IYPA 2VNJA 3AVUA 2X85A 1V0EA 4PAAA 1N05A 2W6IA 1KK0A 2Z6BD 2VNKA 2ZBVA 2B7BA 3LQ6A 3LQEA 5GV8A 1VQ9B 4XN0A 4II2A 1ZM9A 3W2EA 3WQZA 2QN6A 4RD2A 2BV3A 2CBXA 1NDHA 3PENA 3AVVA 2WZNA 3Q39A 3OEEA 4PABA 1W2BB 4P2NA 1JB9A 5FO1A 4RPBA 1PJ7A 5A89A 2VBSA 4X7DA 2OYNA 3I1FA 1H8HA 1GR1A 1PKVA 2VNIA 3MMPA 4Z1MA 3T53B 3CXCB 4FXUA 5FL7A 1H8EA 1JA0A 5F4JA 3OPOA 4MYTA 2V7QA 4X7EA 1VQ8B 2QGGA 3FKSA 5A88A 4YAOA 3A3GA 2ZBUA 2QDXA 2C4UA 1EP2B 2GK7A 1UD3A 4XD7A 1FNCA 2YWGA 4XL9A 3AGPA 5HZAA 1VQLB 2GREA 2DETA 3AVWA 4ZCLA 2D9RA 1JNYA 4G7XA 2Q6OA 5E6TA 2X3UA 3WNCA 3OW7A 4XNFA 3BQJA 1XQBA 1FNMA 3ASPA 4EH1A 1VQ6B 1NBMA 3U2QA 1T6ZA 1IJEA 4P6YA 4PC3A 1QGAA 4XR6A 4OOVA 3ASTA 1VQMB 1AIPA 1UD8A 4OPVA 4WZEA 3OZWA 4Y7CA 4Z4UA 1RQRA 4YEJA 1W34A 1YLOA 2F1LA 4PC6A 2EIXA 1HVXA 4ACAA 4M2LA 1DG1G 3CMMA 4ZCMA 2BVNA 2GPJA 4YELA 4C43A 1VLYA 4YAWA 4ZGNB 3A8KA 3LNNA 3ASSA 1K8AD 2NV4A 1Q9SA 3P26A 3B82A 5A8AA 3DDYA 2YWHA 4P3IA 4LC0A 3W2GA 2VBTA 1FNDA 1FX0A 3ONUA 1IJFA 4RDJA 2DEUA 4P26A 4P25A 4TMXA 3CCVB 3BNWA 5BSXA 1YIJB 3W5UA 3SJPA 4AC9A 2VJIA 2X6XA 1FRQA 1VQNB 3OZVA 3CP8A 1KK1A 4RD0A 4Y9RA 1OB2A 1ELOA 1DDIA 1GVHA 2F4NA 1KK3A 3T51B 3CPWB 2V7TA 4NBSA 3WBKA 1V5VA 1ZM3A 2LZJA 3BY1A 1H85A 1QFYA 3KEWA 1QUEA 4PC1A 1B2RA 2WZPP 4X05A 2JN9A 1A8PA 3A1PA 2V4DA 2D74A 4YHBA 5F4MA 4Z4WA 1UD2A 3W2IA 2DY1A 5IYWA 1N8RD 1NB9A 5F4OA 3LVBA 3ZZUA 2D3NA 2KVOA 4B44A 3P27A 5HXBA 2I1LA 4GQNA 3PUNA 1K73D 4WZTA 5KW9A 1ZM2A 4DQKA 5GV7A 1E63A 2CK3A 4WZKA 5FNZA 2RC6A 2OBSA 1PJ5A 1WSVA 2GJKA 4FN5A 1GO2A 2CC2A 2X6WA 1WSRA 4II3A 3CPXA 1COWA 1WPCA 2QA4B 3GVJA 4XOPA 2ZXIA 1N0UA 4G7WA 4U9UA 4DK1A 2ZZEA 4G5GA 2V7UA 4FK8A 2VNHA 3SJZA 4TMTA 3GIRA 1YJWB 4RD6A 3BCDA 1OB5A 1EFRA 1E3ZA 2GJRA 3ZPNA 2HLDA 3CCMB 3BY2A 2C5BA 4JMQA 4YAFA 1QGZA 3OP1A 3OE7A 1YHQB 2C77A 3G05A 2V7WA 3CMAB 1W9XA 1JJ2B 2E1BA 1U2RA 4P3YA 1QX4A 3AVXA 3U6KA 1R5OA 3OJXA 2XEXA 2BM0A 2VJJA 3W5VA 3H94A 5B6IA 1WOPA 3J81k 3E1YE 1G7CA 5HKKA 5TRDA 2XZPA 1SM4A 2R6HA 3QSYA 2ZITA 1AMOA 2DERA 4K1XA 4B43A 2XZLA 3WXMA 3B8HA 4P9SA 3OW2B 1EWYA 3Q38A 1SKQA 5FIUA 1XB2A 3CW2A 2Q6IA 1FRNA 3LO8A 2GK6A 3GSIA 3B78A 4P12A 2WPDA 1QFJA 4RLZA 1GJRA 3Q3AA 2OTLB 2CNDA 4TKOB 1M1KD 1YX2A 1NB0A 4RJLA 2WJVA 4XKWA 3OOCA 1GAWA 1E1QA 1VLOA 1WOOA 4B3GA 4LBYA 4Z4TA 1FDRA 4XMYA 1QUFA 2X53S 4ACBA 4PC2A 4XM3A 2WJYA 3ASRA 1G7RA 4XN3A 3D26A 1VQ4B 2JJ1A 2Q6LA 2QMUA 1I18A 1E3XA 3VO1A 2BMWA 1UMKA 2DIEA 1EP1B 4KKSA 4R71A 3I55B 3FPKA 2ZZQA 4IW3B 2V7XA 3Q6QA 1VQKB 1VHEA 1OHHA 2P3MA 3CC4B 2BGJA 3QFRA 1EFTA 3WBJA 3CB4A 1VQPB 1FNBA 3ZC3A 4F7DA 1Y0RA 4LBWA 4UZEA 3OZUA 5FA6A 4DNRB 4B3FX 4TT3A 2B5OA 1KZLA 3ZUGA 3SKBA 4Z4YA 3CC7B 4X0CA 1JA1A 4ZGQB 1UD5A 3CCSB 1WDTA 2BM1A 2ZL5A 2X0KA 1W0JA 3CESA 4WQMA 4DQLA 4C0SA 4ZCIA 2B7CA 1T5EA 1QVFB 1CQXA 3CTAA 1QH0A 5HZBA 1KJZA 3A35A 5H5JA 5IYNA 3PUMA 1EP3B 4L8JA 1WOSA 2V31A 2YWFA 3JQQA 3OJWA 2QE7A 1E1RA 4P1VA 4BPRA 5IK2A 3FPPA 3R6JA 1V0FA 2ZTGA 3AGQA 2V7VA 2BF4A 4M53A 1CNEA 3BC9A 4XORA 4DNTB 3HAGA 4XLAA 3VNVA 4J0QA 4OOSA 2QTLA 1KTVA 1N0VC 3ES9A 1R5NA 2F1MA 2PMDA 3OFNA 3MCAA 4TSFA 4XOTA 3U6BA 2ZZGA 4X07A 1W87A 3SLDA 2PE3A 2VBUA 2X8KA 3G71B 1VF7A 4YALA 1UD4A 2VBVA 1WORA 2OBTA 1YITB 1MABA 2VYQA 1YJ9B 1OGIA 2BSAA 4MYUA 2F43A 1ZM4A 4P6VF 1D8TA 4QHYA 2BGIA 1EFCA 1NRKA 4WWVA 1KC8D 4TMZA 3BH4A 1BQEA 4Q7JB 1N07A 5FO0A 1F20A 1D1NA 3MHPA 4NCNA 1TLLA 3VMFA 1BX0A 1W35A 2VZLA 1KK2A 2WR8A 2J7KA 1ZUNB 2XNJA 1XE1A 1I8DA 1B23P 2C2WA 5DN6A 3RY8A 3JU4A 5L46A 1PJ6A 4RM0A 2C5HA 2FX3A 4PGOA 1HZEA 1OGJA 1VJSA 2GQFA 4X7FA 1YJNB 2WSSA 4ASUA 2QTZA 3ASQA 1D2EA 2W6JA 1S0UA 4TMWA 3ISXA 4XQFA 1MRZA 2HMAA 4X7CA 1TTTA 1K28D 1TUIA 4XLEA 1EFUA 4B48A 4N3GA 1VQ5B 4LBZA
chains in the Genus database with same CATH topology
2JIZA 2WJVA 2ZXHA 1WP6A 3GQBA 3OOCA 3DDYA 1E1QA 4XKWA 4XLCA 4B3GA 4HIZA 3T56B 2R9VA 4XMYA 2X53S 1FX0A 4XM3A 2WJYA 2M5SA 3OEHA 4XN3A 3BCFA 2JJ1A 1I18A 1E3XA 2DIEA 2VJIA 4KKSA 1UD6A 2X6XA 2ZZQA 3CP8A 1OHHA 4UZUA 1WTHD 4YXWA 3T51B 2ZZFA 1KMHA 1E43A 4AVZA 3NE5B 4E0FA 2LZJA 3A3BA 4DNRB 2XOKA 4B3FX 4TT3A 2JDIA 3KEWA 1KZLA 2WZPP 3OAAA 2X85A 2V4DA 1UD5A 1V0EA 1W0KA 2JJ2A 3CESA 2W6IA 2Z6BD 1W0JA 1UD2A 4XLHA 1T5EA 4XN0A 4II2A 3WQZA 2D3NA 3A35A 2KVOA 1E79A 4GQNA 4L8JA 2V31A 3OEEA 2QE7A 1E1RA 5IK2A 3FPPA 2CK3A 1V0FA 2ZTGA 2D3LA 2GJKA 3BC9A 4XORA 4DNTB 3HAGA 1PKVA 1H8HA 4Z1MA 3T53B 2X6WA 4XLAA 4II3A 4FXUA 5FL7A 1COWA 1H8EA 1WPCA 3GVJA 3OPOA 2V7QA 2ZXIA 3OFNA 2F1MA 4TSFA 4XLFA 2X6YA 4G7WA 4XOTA 4DK1A 2ZZEA 2ZZGA 4G6IA 3BCDA 3FKSA 1EFRA 1E3ZA 3A3GA 2GJRA 2X8KA 3ZPNA 1VF7A 2HLDA 2GK7A 1UD3A 1UD4A 4JMQA 4XD7A 4XL9A 1MABA 4XKVA 3OE7A 3G05A 1W9XA 2F43A 4G7XA 2E1BA 1NRKA 3OW7A 3BH4A 1SKYB 4XNFA 1BMFA 2XGJA 1NBMA 2VJJA 3H94A 4NNJA 4XR6A 2XZOA 4XONA 3GVLA 5HKKA 2XZPA 1I8DA 2GJPA 2XNDA 1OB0A 5CDFA 1UD8A 5DN6A 2XZLA 3JU4A 4XOPA 4DK0A 3GVKA 4YEJA 1HZEA 1VJSA 4P22A 1HVXA 3CP2A 2WSSA 2ZTNA 4ASUA 3CMMA 4KKTA 2GK6A 2W6JA 3ZIAA 4XQFA 4YELA 3VR6A 1BLIA 1VLYA 2WPDA 1K28D 1BPLA 3LNNA 4TKOB 4XLEA 4KKUA 5KNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II3 A;  4P22 A;  2LZJ A;  4NNJ A;  3CMM A;  2V31 A;  5KNL A;  4II2 A; 
#chains in the Genus database with same CATH topology
 2ZXH A;  3A8I A;  3GQB A;  1WP6 A;  4QV2 A;  1KRH A;  4HIZ A;  5CDF A;  1GAQ A;  3T56 B;  1IB0 A;  1E62 A;  2NPF A;  3ZBT A;  2AHO A;  1G7T A;  4QVA A;  4RDK A;  3CCU B;  3ONY A;  2M5S A;  3KL9 A;  3OEH A;  3CCJ B;  1BX1 A;  1DAR A;  3W2F A;  3G6E B;  4TMV A;  2PIA A;  4B3X A;  2BN4 A;  4N3N A;  4RD1 A;  1UD6 A;  3AVY A;  3V7A A;  4LBV A;  2OTJ B;  1WTH D;  1QFZ A;  1S4M A;  4AF7 A;  4H9G A;  5H59 A;  3CCE B;  1E43 A;  2XNC A;  2QEX B;  4RCZ A;  3NE5 B;  4AVZ A;  1Q81 D;  3FJO A;  3CC2 B;  1XFO A;  3OAA A;  5IYQ A;  2Q6K A;  4Z4R A;  1W0K A;  4RD3 A;  2JJ2 A;  3V76 A;  2OK8 A;  4Y9U A;  3CRZ A;  1KQS B;  4XLH A;  1HA3 A;  4Z4S A;  2DCU A;  1TVC A;  2C78 A;  4HE6 A;  5LMZ A;  3W5H A;  5TY0 A;  3W2H A;  1CNF A;  1E79 A;  5KSW B;  4OP7 A;  1N08 A;  2EFG A;  3QFC A;  4RCY A;  2D3L A;  1EXM A;  3WND A;  2OBR A;  4RD4 A;  2WYR A;  4M1K A;  4QVJ A;  2DYI A;  5BSY A;  5DSZ A;  3AVT A;  2CRV A;  4XLF A;  2ZL7 A;  3VO2 A;  2X6Y A;  1VQO B;  4G6I A;  4B4D A;  1VHO A;  2HDN B;  1IHM A;  4XKV A;  3WNB A;  3Q6R A;  2RC5 A;  1K9M D;  3WY9 A;  4X8I A;  1QG0 A;  4Z4Z A;  4QUZ A;  1N06 A;  5EMN A;  5IYR A;  4FWT A;  3JQP A;  3SEJ A;  2OK7 A;  1SKY B;  4QFM A;  4AF6 A;  3PVD A;  1Q7Y D;  1BMF A;  1Y0Y A;  2XGJ A;  4G1V A;  3CCQ B;  4X06 A;  4NNJ A;  4Z4V A;  2DOG A;  5J3O A;  2XZO A;  4XON A;  3GVL A;  1P4M A;  2XND A;  1QGY A;  2GJP A;  1OB0 A;  2ZL6 A;  2E1R A;  2C4T A;  3H9N A;  3OKX A;  3SLN A;  2HCJ B;  4YAU A;  5DS0 A;  3R6K A;  2CW5 A;  4DK0 A;  3GVK A;  3CD6 B;  3VNU A;  4OPS A;  3ZBU A;  4P22 A;  1F60 A;  3CP2 A;  1Q86 D;  4UAJ A;  2ZTN A;  5AN9 A;  1RQP A;  4CQJ A;  4KKT A;  1E64 A;  3ZIA A;  3VR6 A;  1T6Y A;  2CF4 A;  3WYA A;  1BLI A;  5TV2 A;  1NJI D;  1BPL A;  1WU8 A;  1I7P A;  4UZF A;  3I56 B;  3E20 A;  3PA1 A;  4KKU A;  4ZV4 A;  5KNL A;  1QVG B;  3ZZT A;  1BJK A;  1VQ7 B;  2JIZ A;  4WZL A;  5TR9 A;  2BPO A;  4XLC A;  1H42 A;  1KD1 D;  2R9V A;  3CCL B;  3QFT A;  4OOX A;  4B47 A;  1J9Z A;  1G7S A;  4OPO A;  5THX A;  3CME B;  1YI2 B;  4G1B A;  3BCF A;  4M0L A;  5JBQ A;  4M4S A;  4ROX A;  4TN1 A;  3QFS A;  3A8J A;  5J35 A;  1DDG A;  4HE5 A;  4RDL A;  3G4S B;  1R5B A;  1M90 D;  2FVG A;  3JQR A;  2YWE A;  3QE2 A;  4UZU A;  3PA2 A;  4YXW A;  1T6X A;  2ZZF A;  1KMH A;  4PC7 A;  4E0F A;  4RPD A;  3CCR B;  1Q82 D;  3A3B A;  2XOK A;  2JDI A;  1S72 B;  2PLF A;  3ZZ0 A;  5IYP A;  2VNJ A;  3AVU A;  2X85 A;  1V0E A;  4PAA A;  1N05 A;  2W6I A;  1KK0 A;  2Z6B D;  2VNK A;  2ZBV A;  2B7B A;  3LQ6 A;  3LQE A;  5GV8 A;  1VQ9 B;  4XN0 A;  4II2 A;  1ZM9 A;  3W2E A;  3WQZ A;  2QN6 A;  4RD2 A;  2BV3 A;  2CBX A;  1NDH A;  3PEN A;  3AVV A;  2WZN A;  3Q39 A;  3OEE A;  4PAB A;  1W2B B;  4P2N A;  1JB9 A;  5FO1 A;  4RPB A;  1PJ7 A;  5A89 A;  2VBS A;  4X7D A;  2OYN A;  3I1F A;  1H8H A;  1GR1 A;  1PKV A;  2VNI A;  3MMP A;  4Z1M A;  3T53 B;  3CXC B;  4FXU A;  5FL7 A;  1H8E A;  1JA0 A;  5F4J A;  3OPO A;  4MYT A;  2V7Q A;  4X7E A;  1VQ8 B;  2QGG A;  3FKS A;  5A88 A;  4YAO A;  3A3G A;  2ZBU A;  2QDX A;  2C4U A;  1EP2 B;  2GK7 A;  1UD3 A;  4XD7 A;  1FNC A;  2YWG A;  4XL9 A;  3AGP A;  5HZA A;  1VQL B;  2GRE A;  2DET A;  3AVW A;  4ZCL A;  2D9R A;  1JNY A;  4G7X A;  2Q6O A;  5E6T A;  2X3U A;  3WNC A;  3OW7 A;  4XNF A;  3BQJ A;  1XQB A;  1FNM A;  3ASP A;  4EH1 A;  1VQ6 B;  1NBM A;  3U2Q A;  1T6Z A;  1IJE A;  4P6Y A;  4PC3 A;  1QGA A;  4XR6 A;  4OOV A;  3AST A;  1VQM B;  1AIP A;  1UD8 A;  4OPV A;  4WZE A;  3OZW A;  4Y7C A;  4Z4U A;  1RQR A;  4YEJ A;  1W34 A;  1YLO A;  2F1L A;  4PC6 A;  2EIX A;  1HVX A;  4ACA A;  4M2L A;  1DG1 G;  3CMM A;  4ZCM A;  2BVN A;  2GPJ A;  4YEL A;  4C43 A;  1VLY A;  4YAW A;  4ZGN B;  3A8K A;  3LNN A;  3ASS A;  1K8A D;  2NV4 A;  1Q9S A;  3P26 A;  3B82 A;  5A8A A;  3DDY A;  2YWH A;  4P3I A;  4LC0 A;  3W2G A;  2VBT A;  1FND A;  1FX0 A;  3ONU A;  1IJF A;  4RDJ A;  2DEU A;  4P26 A;  4P25 A;  4TMX A;  3CCV B;  3BNW A;  5BSX A;  1YIJ B;  3W5U A;  3SJP A;  4AC9 A;  2VJI A;  2X6X A;  1FRQ A;  1VQN B;  3OZV A;  3CP8 A;  1KK1 A;  4RD0 A;  4Y9R A;  1OB2 A;  1ELO A;  1DDI A;  1GVH A;  2F4N A;  1KK3 A;  3T51 B;  3CPW B;  2V7T A;  4NBS A;  3WBK A;  1V5V A;  1ZM3 A;  2LZJ A;  3BY1 A;  1H85 A;  1QFY A;  3KEW A;  1QUE A;  4PC1 A;  1B2R A;  2WZP P;  4X05 A;  2JN9 A;  1A8P A;  3A1P A;  2V4D A;  2D74 A;  4YHB A;  5F4M A;  4Z4W A;  1UD2 A;  3W2I A;  2DY1 A;  5IYW A;  1N8R D;  1NB9 A;  5F4O A;  3LVB A;  3ZZU A;  2D3N A;  2KVO A;  4B44 A;  3P27 A;  5HXB A;  2I1L A;  4GQN A;  3PUN A;  1K73 D;  4WZT A;  5KW9 A;  1ZM2 A;  4DQK A;  5GV7 A;  1E63 A;  2CK3 A;  4WZK A;  5FNZ A;  2RC6 A;  2OBS A;  1PJ5 A;  1WSV A;  2GJK A;  4FN5 A;  1GO2 A;  2CC2 A;  2X6W A;  1WSR A;  4II3 A;  3CPX A;  1COW A;  1WPC A;  2QA4 B;  3GVJ A;  4XOP A;  2ZXI A;  1N0U A;  4G7W A;  4U9U A;  4DK1 A;  2ZZE A;  4G5G A;  2V7U A;  4FK8 A;  2VNH A;  3SJZ A;  4TMT A;  3GIR A;  1YJW B;  4RD6 A;  3BCD A;  1OB5 A;  1EFR A;  1E3Z A;  2GJR A;  3ZPN A;  2HLD A;  3CCM B;  3BY2 A;  2C5B A;  4JMQ A;  4YAF A;  1QGZ A;  3OP1 A;  3OE7 A;  1YHQ B;  2C77 A;  3G05 A;  2V7W A;  3CMA B;  1W9X A;  1JJ2 B;  2E1B A;  1U2R A;  4P3Y A;  1QX4 A;  3AVX A;  3U6K A;  1R5O A;  3OJX A;  2XEX A;  2BM0 A;  2VJJ A;  3W5V A;  3H94 A;  5B6I A;  1WOP A;  3J81 k;  3E1Y E;  1G7C A;  5HKK A;  5TRD A;  2XZP A;  1SM4 A;  2R6H A;  3QSY A;  2ZIT A;  1AMO A;  2DER A;  4K1X A;  4B43 A;  2XZL A;  3WXM A;  3B8H A;  4P9S A;  3OW2 B;  1EWY A;  3Q38 A;  1SKQ A;  5FIU A;  1XB2 A;  3CW2 A;  2Q6I A;  1FRN A;  3LO8 A;  2GK6 A;  3GSI A;  3B78 A;  4P12 A;  2WPD A;  1QFJ A;  4RLZ A;  1GJR A;  3Q3A A;  2OTL B;  2CND A;  4TKO B;  1M1K D;  1YX2 A;  1NB0 A;  4RJL A;  2WJV A;  4XKW A;  3OOC A;  1GAW A;  1E1Q A;  1VLO A;  1WOO A;  4B3G A;  4LBY A;  4Z4T A;  1FDR A;  4XMY A;  1QUF A;  2X53 S;  4ACB A;  4PC2 A;  4XM3 A;  2WJY A;  3ASR A;  1G7R A;  4XN3 A;  3D26 A;  1VQ4 B;  2JJ1 A;  2Q6L A;  2QMU A;  1I18 A;  1E3X A;  3VO1 A;  2BMW A;  1UMK A;  2DIE A;  1EP1 B;  4KKS A;  4R71 A;  3I55 B;  3FPK A;  2ZZQ A;  4IW3 B;  2V7X A;  3Q6Q A;  1VQK B;  1VHE A;  1OHH A;  2P3M A;  3CC4 B;  2BGJ A;  3QFR A;  1EFT A;  3WBJ A;  3CB4 A;  1VQP B;  1FNB A;  3ZC3 A;  4F7D A;  1Y0R A;  4LBW A;  4UZE A;  3OZU A;  5FA6 A;  4DNR B;  4B3F X;  4TT3 A;  2B5O A;  1KZL A;  3ZUG A;  3SKB A;  4Z4Y A;  3CC7 B;  4X0C A;  1JA1 A;  4ZGQ B;  1UD5 A;  3CCS B;  1WDT A;  2BM1 A;  2ZL5 A;  2X0K A;  1W0J A;  3CES A;  4WQM A;  4DQL A;  4C0S A;  4ZCI A;  2B7C A;  1T5E A;  1QVF B;  1CQX A;  3CTA A;  1QH0 A;  5HZB A;  1KJZ A;  3A35 A;  5H5J A;  5IYN A;  3PUM A;  1EP3 B;  4L8J A;  1WOS A;  2V31 A;  2YWF A;  3JQQ A;  3OJW A;  2QE7 A;  1E1R A;  4P1V A;  4BPR A;  5IK2 A;  3FPP A;  3R6J A;  1V0F A;  2ZTG A;  3AGQ A;  2V7V A;  2BF4 A;  4M53 A;  1CNE A;  3BC9 A;  4XOR A;  4DNT B;  3HAG A;  4XLA A;  3VNV A;  4J0Q A;  4OOS A;  2QTL A;  1KTV A;  1N0V C;  3ES9 A;  1R5N A;  2F1M A;  2PMD A;  3OFN A;  3MCA A;  4TSF A;  4XOT A;  3U6B A;  2ZZG A;  4X07 A;  1W87 A;  3SLD A;  2PE3 A;  2VBU A;  2X8K A;  3G71 B;  1VF7 A;  4YAL A;  1UD4 A;  2VBV A;  1WOR A;  2OBT A;  1YIT B;  1MAB A;  2VYQ A;  1YJ9 B;  1OGI A;  2BSA A;  4MYU A;  2F43 A;  1ZM4 A;  4P6V F;  1D8T A;  4QHY A;  2BGI A;  1EFC A;  1NRK A;  4WWV A;  1KC8 D;  4TMZ A;  3BH4 A;  1BQE A;  4Q7J B;  1N07 A;  5FO0 A;  1F20 A;  1D1N A;  3MHP A;  4NCN A;  1TLL A;  3VMF A;  1BX0 A;  1W35 A;  2VZL A;  1KK2 A;  2WR8 A;  2J7K A;  1ZUN B;  2XNJ A;  1XE1 A;  1I8D A;  1B23 P;  2C2W A;  5DN6 A;  3RY8 A;  3JU4 A;  5L46 A;  1PJ6 A;  4RM0 A;  2C5H A;  2FX3 A;  4PGO A;  1HZE A;  1OGJ A;  1VJS A;  2GQF A;  4X7F A;  1YJN B;  2WSS A;  4ASU A;  2QTZ A;  3ASQ A;  1D2E A;  2W6J A;  1S0U A;  4TMW A;  3ISX A;  4XQF A;  1MRZ A;  2HMA A;  4X7C A;  1TTT A;  1K28 D;  1TUI A;  4XLE A;  1EFU A;  4B48 A;  4N3G A;  1VQ5 B;  4LBZ A; 
#chains in the Genus database with same CATH homology
 2JIZ A;  2WJV A;  2ZXH A;  1WP6 A;  3GQB A;  3OOC A;  3DDY A;  1E1Q A;  4XKW A;  4XLC A;  4B3G A;  4HIZ A;  3T56 B;  2R9V A;  4XMY A;  2X53 S;  1FX0 A;  4XM3 A;  2WJY A;  2M5S A;  3OEH A;  4XN3 A;  3BCF A;  2JJ1 A;  1I18 A;  1E3X A;  2DIE A;  2VJI A;  4KKS A;  1UD6 A;  2X6X A;  2ZZQ A;  3CP8 A;  1OHH A;  4UZU A;  1WTH D;  4YXW A;  3T51 B;  2ZZF A;  1KMH A;  1E43 A;  4AVZ A;  3NE5 B;  4E0F A;  2LZJ A;  3A3B A;  4DNR B;  2XOK A;  4B3F X;  4TT3 A;  2JDI A;  3KEW A;  1KZL A;  2WZP P;  3OAA A;  2X85 A;  2V4D A;  1UD5 A;  1V0E A;  1W0K A;  2JJ2 A;  3CES A;  2W6I A;  2Z6B D;  1W0J A;  1UD2 A;  4XLH A;  1T5E A;  4XN0 A;  4II2 A;  3WQZ A;  2D3N A;  3A35 A;  2KVO A;  1E79 A;  4GQN A;  4L8J A;  2V31 A;  3OEE A;  2QE7 A;  1E1R A;  5IK2 A;  3FPP A;  2CK3 A;  1V0F A;  2ZTG A;  2D3L A;  2GJK A;  3BC9 A;  4XOR A;  4DNT B;  3HAG A;  1PKV A;  1H8H A;  4Z1M A;  3T53 B;  2X6W A;  4XLA A;  4II3 A;  4FXU A;  5FL7 A;  1COW A;  1H8E A;  1WPC A;  3GVJ A;  3OPO A;  2V7Q A;  2ZXI A;  3OFN A;  2F1M A;  4TSF A;  4XLF A;  2X6Y A;  4G7W A;  4XOT A;  4DK1 A;  2ZZE A;  2ZZG A;  4G6I A;  3BCD A;  3FKS A;  1EFR A;  1E3Z A;  3A3G A;  2GJR A;  2X8K A;  3ZPN A;  1VF7 A;  2HLD A;  2GK7 A;  1UD3 A;  1UD4 A;  4JMQ A;  4XD7 A;  4XL9 A;  1MAB A;  4XKV A;  3OE7 A;  3G05 A;  1W9X A;  2F43 A;  4G7X A;  2E1B A;  1NRK A;  3OW7 A;  3BH4 A;  1SKY B;  4XNF A;  1BMF A;  2XGJ A;  1NBM A;  2VJJ A;  3H94 A;  4NNJ A;  4XR6 A;  2XZO A;  4XON A;  3GVL A;  5HKK A;  2XZP A;  1I8D A;  2GJP A;  2XND A;  1OB0 A;  5CDF A;  1UD8 A;  5DN6 A;  2XZL A;  3JU4 A;  4XOP A;  4DK0 A;  3GVK A;  4YEJ A;  1HZE A;  1VJS A;  4P22 A;  1HVX A;  3CP2 A;  2WSS A;  2ZTN A;  4ASU A;  3CMM A;  4KKT A;  2GK6 A;  2W6J A;  3ZIA A;  4XQF A;  4YEL A;  3VR6 A;  1BLI A;  1VLY A;  2WPD A;  1K28 D;  1BPL A;  3LNN A;  4TKO B;  4XLE A;  4KKU A;  5KNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...