2V31A

Structure of first catalytic cysteine half-domain of mouse ubiquitin- activating enzyme
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
112
structure length
112
Chain Sequence
EFGEEMVLTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPASLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords UBIQUITIN-ACTIVATING ENZYME E1 X
publication title Structure of First Catalytic Cysteine Half-Domain of Mouse Ubiquitin-Activating Enzyme
rcsb
total genus 8
structure length 112
sequence length 112
ec nomenclature ec 6.2.1.45: E1 ubiquitin-activating enzyme.
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.180 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2v31A01
3CMMA 4NNJA 2V31A 2LZJA 4P22A 5KNLA 4II2A 4II3A
chains in the Genus database with same CATH superfamily
2X6WA 3WY9A 1E3ZA 1W0KA 1NB9A 2ZZQA 2XZOA 1PJ6A 1VHOA 3ONYA 3G6EB 1N06A 4UZEA 3AGQA 2GJPA 4HIZA 3Q38A 3A8KA 4AC9A 1WP6A 4N3GA 3ASQA 1FX0A 3BC9A 2ZXIA 3SJPA 1SM4A 1W9XA 3BCDA 4ACAA 2RC5A 2YWFA 1BX0A 1V0FA 2XGJA 3FPKA 3PUNA 5HXBA 2FVGA 3QFTA 3CMMA 4ACBA 1OHHA 5F4MA 2QGGA 3ASPA 1E64A 2B7CA 4P3IA 4XKVA 4ASUA 4OP7A 3QE2A 3CCUB 1KK3A 1BQEA 2PE3A 1TUIA 4P6YA 4XD7A 3V7AA 3BY2A 4Y7CA 2X53S 1WOPA 4Z4WA 3LVBA 1T5EA 4F7DA 1N0UA 3LQEA 2QEXB 3WBKA 3CC7B 1NBMA 2DCUA 3Q39A 2JJ2A 3AVVA 1QGYA 1RQPA 3Q3AA 5TV2A 3I55B 1VQKB 1GO2A 2LZJA 4XLHA 2HMAA 4DK0A 4OPSA 2ZL6A 2VJIA 4KKSA 4PC3A 4ZCMA 5AN9A 1Q9SA 4XLFA 1ZM2A 3OZUA 2CW5A 4P3YA 3CCEB 2V7UA 2D3NA 4G1BA 2BM1A 4NCNA 4CQJA 4DNTB 3OZWA 4DNRB 4P9SA 3SEJA 3B8HA 5THXA 5BSYA 5HKKA 1TVCA 1BMFA 1B23P 2YWGA 5KW9A 1D2EA 1YITB 4RD0A 4OPOA 3OOCA 1WDTA 3GVKA 4X7EA 1VQOB 1Q81D 1UD2A 4M53A 1EP2B 1I7PA 4U9UA 2V7XA 4Z4VA 3P26A 5IYPA 4OOSA 3G71B 3OW2B 1KD1D 4P1VA 3VR6A 2B7BA 2WZNA 3W2FA 1WU8A 3BY1A 5A8AA 1W2BB 4WZKA 1JA0A 5FNZA 3SLDA 4LBWA 1XE1A 1WOOA 3H9NA 2OBRA 4P26A 1N0VC 1QVGB 4B3FX 4XQFA 2J7KA 2PLFA 4L8JA 2R6HA 3MMPA 1WPCA 3BNWA 4M1KA 3G4SB 3CCRB 2DEUA 1QFZA 1UMKA 2PMDA 3ZIAA 2GREA 1P4MA 2VYQA 2WR8A 4Z4TA 4TMXA 5B6IA 3CTAA 2V31A 3A8IA 3CP8A 4WZEA 4II2A 1VLYA 5F4JA 1T6ZA 3A3BA 1KQSB 5A89A 4WZLA 1V5VA 1K9MD 4XLCA 3OP1A 3J81k 2VJJA 4X8IA 4YHBA 1HZEA 3LO8A 1KZLA 5J35A 3OKXA 1JJ2B 1WOSA 3GQBA 3P27A 1UD5A 2KVOA 2YWEA 2OK7A 2CF4A 4ZCIA 1VQ7B 1N07A 2E1RA 1T6YA 3CB4A 4OOXA 5L46A 3PVDA 1YJNB 1KK2A 4Q7JB 1VHEA 4DQLA 1QUFA 2AHOA 1N8RD 4PGOA 3OW7A 4M4SA 3U6KA 1Y0RA 1PJ5A 4RLZA 1S72B 1NB0A 1J9ZA 1VQ9B 2E1BA 1G7SA 1I18A 1QGAA 3MHPA 3DDYA 1TLLA 4AF6A 4II3A 3ASSA 3CCQB 5EMNA 2I1LA 2V7QA 3OJWA 4J0QA 1GJRA 1AMOA 2BM0A 2C4TA 4C43A 3VNUA 2X85A 2XEXA 4RJLA 1N08A 3WNCA 3CCLB 1KRHA 1FNDA 3ZZ0A 4Z4UA 2D74A 4X06A 3QFRA 4RDKA 3FPPA 5FO0A 3OEHA 3A1PA 4Z4SA 2JJ1A 1K28D 5CDFA 1NRKA 1EFRA 1GAQA 2VBUA 4QUZA 1CQXA 1H8EA 3CMAB 2PIAA 1PKVA 2Q6IA 2ZBVA 2V4DA 2ZITA 3Q6QA 4PC7A 4RCZA 3ZZUA 2C2WA 4G1VA 1KJZA 2CK3A 1DDGA 2W6JA 2BGJA 3I1FA 1K73D 1G7CA 2QTLA 3FJOA 2DY1A 3A3GA 5BSXA 1H42A 3B82A 1FRQA 4LC0A 1D8TA 1HA3A 2V7WA 1W87A 4LBYA 2C77A 2VNKA 1WORA 4XONA 4P2NA 5JBQA 1QX4A 3JQRA 1E79A 2BVNA 1KTVA 1A8PA 3CW2A 1YX2A 3ZUGA 3W2EA 3SKBA 3W5UA 1R5OA 3PENA 1VLOA 4X0CA 4TT3A 2QMUA 4X7CA 1ZM4A 1FNCA 5TR9A 2OTLB 1BLIA 4Y9RA 4PC6A 4ZCLA 2GJKA 1QFJA 5GV7A 5A88A 4B48A 3HAGA 5FIUA 5IYQA 1W0JA 3OAAA 1UD6A 2EFGA 3KEWA 1XB2A 2BF4A 2ZZGA 2DIEA 2B5OA 2XNCA 3B78A 3E1YE 2ZZEA 2HCJB 3AGPA 3ONUA 4BPRA 1YI2B 4YELA 1YIJB 1UD4A 1GAWA 4P12A 4KKUA 3ZZTA 1IJEA 2WSSA 4RPDA 4ZV4A 4YAWA 3JQPA 3BCFA 1MRZA 2GPJA 4B3XA 1M1KD 2XNDA 4YEJA 1GR1A 1QH0A 3CXCB 2CBXA 2P3MA 3RY8A 2F4NA 2OYNA 4X7DA 4XKWA 2VBSA 1D1NA 1G7RA 2HLDA 4QV2A 4X05A 1NJID 1Q82D 1DDIA 3JQQA 2C5HA 2ZTNA 3GVJA 3FKSA 1UD8A 1EXMA 2ZL5A 3VO2A 3W2HA 4TMVA 2D3LA 3E20A 5KNLA 1KMHA 4WQMA 5GV8A 2XZLA 1JB9A 4XN3A 4OOVA 2YWHA 1VQMB 3ASTA 2V7TA 4LBVA 1VQNB 3ZBTA 2ZL7A 4AVZA 1YLOA 1GVHA 4TN1A 1BPLA 3ES9A 1VQPB 4ZGNB 2DOGA 4HE6A 1EP1B 2XZPA 2GJRA 2WZPP 4UAJA 1E3XA 4P22A 1EFCA 3CC4B 4G6IA 5DN6A 1OB2A 1HVXA 1IJFA 2BPOA 4RCYA 5HZBA 1VQ4B 4RD1A 4C0SA 1H85A 3JU4A 4UZUA 3A35A 3CC2B 3T56B 1QUEA 1OGJA 4G5GA 3CRZA 2NPFA 1FNMA 4QHYA 4XOTA 2C4UA 4KKTA 1QVFB 1QG0A 2F1LA 4B43A 4YAUA 2VBVA 3AVTA 1QGZA 4M2LA 4TMWA 4YAOA 3WXMA 4XNFA 3WBJA 5DSZA 2NV4A 1OGIA 4OPVA 4RD4A 1JA1A 4RPBA 2JDIA 1XFOA 2ZZFA 3WNDA 1E1QA 3T53B 1V0EA 1QFYA 2QTZA 2C5BA 5H59A 2V7VA 1E63A 4XR6A 3BQJA 3ISXA 3CP2A 4DK1A 2CNDA 2Z6BD 3GSIA 4P25A 4ZGQB 2Q6OA 4EH1A 3WQZA 1KC8D 5IYRA 2WYRA 3LQ6A 4YXWA 2X0KA 4R71A 3U6BA 1H8HA 4PABA 3CCVB 2DYIA 2Q6LA 3PA1A 1M90D 2HDNB 4X7FA 1R5NA 4M0LA 1OB0A 5H5JA 5HZAA 4N3NA 1VQ5B 3W5VA 1N05A 5DS0A 5KSWB 3R6KA 4XMYA 5J3OA 1Q86D 3GVLA 1YHQB 1TTTA 3LNNA 2CC2A 3VMFA 3AVWA 1WSVA 1EP3B 4QVAA 1JNYA 1F60A 2JN9A 3GIRA 5LMZA 2RC6A 1E62A 1IHMA 3H94A 4Z1MA 2BN4A 3CPXA 3QFCA 1CNFA 1VQ8B 3W2GA 1ELOA 2CRVA 5IYNA 4YALA 1EFTA 4UZFA 1E43A 1K8AD 1KK1A 4XLEA 1MABA 2BV3A 5IK2A 2M5SA 1YJ9B 1W34A 3OEEA 4WZTA 1FNBA 3CCJB 2F43A 4TMZA 4PC2A 1S4MA 4QVJA 4RD3A 5TY0A 4PC1A 3AVUA 3PA2A 1Y0YA 2D9RA 4FK8A 2GK7A 4MYUA 2WJYA 4WWVA 4GQNA 1B2RA 4Z4YA 1NDHA 1BX1A 2BGIA 5F4OA 3D26A 1EFUA 4NBSA 2X3UA 1VQ6B 2WPDA 3G05A 4P6VF 2OTJB 2VNJA 3CESA 3AVYA 1WTHD 2Q6KA 4FN5A 5FL7A 4RDLA 1Q7YD 2W6IA 1U2RA 2VZLA 4XL9A 1ZM9A 1VJSA 1WSRA 4RDJA 3I56B 3BH4A 1SKQA 3KL9A 1YJWB 3WNBA 2VBTA 3PUMA 1AIPA 4ROXA 3WYAA 4AF7A 1R5BA 2QN6A 3MCAA 2FX3A 4Y9UA 1RQRA 3CMEB 5FO1A 2OBSA 4XM3A 3Q6RA 2QE7A 2OK8A 2ZXHA 4E0FA 4B3GA 4HE5A 2GQFA 3NE5B 2QA4B 1IB0A 4RD2A 1T6XA 1F20A 2XNJA 4XN0A 1VQLB 2ZBUA 4H9GA 3ZBUA 1G7TA 3OPOA 4IW3B 4MYTA 2EIXA 2VNHA 2WJVA 4G7WA 1ZUNB 3A8JA 4B47A 3QSYA 3AVXA 3OFNA 4G7XA 5E6TA 1COWA 2F1MA 4Z4ZA 1BJKA 1XQBA 2X8KA 3R6JA 3U2QA 3VO1A 2BMWA 4XOPA 4XLAA 3VNVA 4FXUA 4QFMA 4TSFA 5IYWA 1SKYB 1FDRA 5TRDA 4RM0A 5FA6A 2X6YA 3V76A 1FRNA 3ZC3A 4JMQA 4K1XA 1VF7A 3OJXA 4B44A 2DETA 4TMTA 4B4DA 3OE7A 3W5HA 1E1RA 2GK6A 4DQKA 3T51B 4YAFA 1ZM3A 1EWYA 4FWTA 4X07A 1S0UA 2JIZA 2XOKA 4PAAA 4Z4RA 4RD6A 3W2IA 3CCSB 1PJ7A 4NNJA 3CCMB 1I8DA 1OB5A 3CD6B 3QFSA 3ZPNA 2VNIA 3OZVA 3SJZA 1CNEA 1W35A 1DARA 4LBZA 3CPWB 2QDXA 2X6XA 2BSAA 2DERA 3SLNA 2ZTGA 2C78A 4XORA 2OBTA 2R9VA 1UD3A 3ASRA 1DG1G 1KK0A 4TKOB
chains in the Genus database with same CATH topology
2X6WA 2XNDA 4YEJA 1E3ZA 1W0KA 2ZZQA 2GK7A 2XZOA 4XKWA 4XLCA 2WJYA 4GQNA 2HLDA 2VJJA 1HZEA 1KZLA 2ZTNA 2GJPA 4HIZA 2WPDA 3GVJA 3FKSA 1UD8A 3GQBA 3G05A 1UD5A 2D3LA 2KVOA 1WP6A 5KNLA 1KMHA 1FX0A 3BC9A 2ZXIA 3CESA 1WTHD 2XZLA 5FL7A 4XN3A 1W9XA 3BCDA 2W6IA 4XL9A 1VJSA 3BH4A 3OW7A 1V0FA 2XGJA 4AVZA 3CMMA 1OHHA 1BPLA 2E1BA 1I18A 3DDYA 2XZPA 4XKVA 2GJRA 2WZPP 4ASUA 4II3A 1E3XA 4XD7A 4P22A 2V7QA 4G6IA 5DN6A 4XM3A 1HVXA 2X53S 1T5EA 3JU4A 4UZUA 3A35A 2QE7A 2X85A 3T56B 2ZXHA 1NBMA 4E0FA 2JJ2A 4XOTA 4KKTA 3FPPA 3OEHA 4B3GA 2LZJA 2JJ1A 1K28D 3NE5B 4XLHA 5CDFA 1NRKA 4DK0A 1EFRA 4XNFA 2VJIA 1H8EA 4KKSA 1PKVA 4XN0A 2JDIA 4XLFA 2ZZFA 2V4DA 1E1QA 3OPOA 3T53B 1V0EA 2CK3A 2W6JA 2WJVA 4G7WA 2D3NA 3A3GA 3OFNA 4G7XA 1COWA 4XR6A 4DNTB 2F1MA 4DK1A 3CP2A 4DNRB 2X8KA 2Z6BD 3WQZA 4XOPA 4XLAA 4FXUA 4XONA 4TSFA 5HKKA 1SKYB 1BMFA 4YXWA 2X6YA 1H8HA 1E79A 4JMQA 3OOCA 3GVKA 1VF7A 1OB0A 1UD2A 4XMYA 3GVLA 4TT3A 3OE7A 1E1RA 2GK6A 3LNNA 3VR6A 3T51B 1BLIA 2JIZA 2XOKA 2GJKA 3HAGA 4NNJA 1I8DA 1W0JA 3OAAA 1UD6A 3H94A 3KEWA 4Z1MA 3ZPNA 4B3FX 4XQFA 2ZZGA 4L8JA 2DIEA 1WPCA 2ZZEA 3ZIAA 4YELA 1UD4A 1E43A 2X6XA 4KKUA 4XLEA 2WSSA 2V31A 1MABA 3CP8A 5IK2A 2M5SA 4II2A 1VLYA 3BCFA 3OEEA 4XORA 2R9VA 1UD3A 2F43A 3A3BA 2ZTGA 4TKOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMM A;  4NNJ A;  2V31 A;  2LZJ A;  4P22 A;  5KNL A;  4II2 A;  4II3 A; 
#chains in the Genus database with same CATH topology
 2X6W A;  3WY9 A;  1E3Z A;  1W0K A;  1NB9 A;  2ZZQ A;  2XZO A;  1PJ6 A;  1VHO A;  3ONY A;  3G6E B;  1N06 A;  4UZE A;  3AGQ A;  2GJP A;  4HIZ A;  3Q38 A;  3A8K A;  4AC9 A;  1WP6 A;  4N3G A;  3ASQ A;  1FX0 A;  3BC9 A;  2ZXI A;  3SJP A;  1SM4 A;  1W9X A;  3BCD A;  4ACA A;  2RC5 A;  2YWF A;  1BX0 A;  1V0F A;  2XGJ A;  3FPK A;  3PUN A;  5HXB A;  2FVG A;  3QFT A;  3CMM A;  4ACB A;  1OHH A;  5F4M A;  2QGG A;  3ASP A;  1E64 A;  2B7C A;  4P3I A;  4XKV A;  4ASU A;  4OP7 A;  3QE2 A;  3CCU B;  1KK3 A;  1BQE A;  2PE3 A;  1TUI A;  4P6Y A;  4XD7 A;  3V7A A;  3BY2 A;  4Y7C A;  2X53 S;  1WOP A;  4Z4W A;  3LVB A;  1T5E A;  4F7D A;  1N0U A;  3LQE A;  2QEX B;  3WBK A;  3CC7 B;  1NBM A;  2DCU A;  3Q39 A;  2JJ2 A;  3AVV A;  1QGY A;  1RQP A;  3Q3A A;  5TV2 A;  3I55 B;  1VQK B;  1GO2 A;  2LZJ A;  4XLH A;  2HMA A;  4DK0 A;  4OPS A;  2ZL6 A;  2VJI A;  4KKS A;  4PC3 A;  4ZCM A;  5AN9 A;  1Q9S A;  4XLF A;  1ZM2 A;  3OZU A;  2CW5 A;  4P3Y A;  3CCE B;  2V7U A;  2D3N A;  4G1B A;  2BM1 A;  4NCN A;  4CQJ A;  4DNT B;  3OZW A;  4DNR B;  4P9S A;  3SEJ A;  3B8H A;  5THX A;  5BSY A;  5HKK A;  1TVC A;  1BMF A;  1B23 P;  2YWG A;  5KW9 A;  1D2E A;  1YIT B;  4RD0 A;  4OPO A;  3OOC A;  1WDT A;  3GVK A;  4X7E A;  1VQO B;  1Q81 D;  1UD2 A;  4M53 A;  1EP2 B;  1I7P A;  4U9U A;  2V7X A;  4Z4V A;  3P26 A;  5IYP A;  4OOS A;  3G71 B;  3OW2 B;  1KD1 D;  4P1V A;  3VR6 A;  2B7B A;  2WZN A;  3W2F A;  1WU8 A;  3BY1 A;  5A8A A;  1W2B B;  4WZK A;  1JA0 A;  5FNZ A;  3SLD A;  4LBW A;  1XE1 A;  1WOO A;  3H9N A;  2OBR A;  4P26 A;  1N0V C;  1QVG B;  4B3F X;  4XQF A;  2J7K A;  2PLF A;  4L8J A;  2R6H A;  3MMP A;  1WPC A;  3BNW A;  4M1K A;  3G4S B;  3CCR B;  2DEU A;  1QFZ A;  1UMK A;  2PMD A;  3ZIA A;  2GRE A;  1P4M A;  2VYQ A;  2WR8 A;  4Z4T A;  4TMX A;  5B6I A;  3CTA A;  2V31 A;  3A8I A;  3CP8 A;  4WZE A;  4II2 A;  1VLY A;  5F4J A;  1T6Z A;  3A3B A;  1KQS B;  5A89 A;  4WZL A;  1V5V A;  1K9M D;  4XLC A;  3OP1 A;  3J81 k;  2VJJ A;  4X8I A;  4YHB A;  1HZE A;  3LO8 A;  1KZL A;  5J35 A;  3OKX A;  1JJ2 B;  1WOS A;  3GQB A;  3P27 A;  1UD5 A;  2KVO A;  2YWE A;  2OK7 A;  2CF4 A;  4ZCI A;  1VQ7 B;  1N07 A;  2E1R A;  1T6Y A;  3CB4 A;  4OOX A;  5L46 A;  3PVD A;  1YJN B;  1KK2 A;  4Q7J B;  1VHE A;  4DQL A;  1QUF A;  2AHO A;  1N8R D;  4PGO A;  3OW7 A;  4M4S A;  3U6K A;  1Y0R A;  1PJ5 A;  4RLZ A;  1S72 B;  1NB0 A;  1J9Z A;  1VQ9 B;  2E1B A;  1G7S A;  1I18 A;  1QGA A;  3MHP A;  3DDY A;  1TLL A;  4AF6 A;  4II3 A;  3ASS A;  3CCQ B;  5EMN A;  2I1L A;  2V7Q A;  3OJW A;  4J0Q A;  1GJR A;  1AMO A;  2BM0 A;  2C4T A;  4C43 A;  3VNU A;  2X85 A;  2XEX A;  4RJL A;  1N08 A;  3WNC A;  3CCL B;  1KRH A;  1FND A;  3ZZ0 A;  4Z4U A;  2D74 A;  4X06 A;  3QFR A;  4RDK A;  3FPP A;  5FO0 A;  3OEH A;  3A1P A;  4Z4S A;  2JJ1 A;  1K28 D;  5CDF A;  1NRK A;  1EFR A;  1GAQ A;  2VBU A;  4QUZ A;  1CQX A;  1H8E A;  3CMA B;  2PIA A;  1PKV A;  2Q6I A;  2ZBV A;  2V4D A;  2ZIT A;  3Q6Q A;  4PC7 A;  4RCZ A;  3ZZU A;  2C2W A;  4G1V A;  1KJZ A;  2CK3 A;  1DDG A;  2W6J A;  2BGJ A;  3I1F A;  1K73 D;  1G7C A;  2QTL A;  3FJO A;  2DY1 A;  3A3G A;  5BSX A;  1H42 A;  3B82 A;  1FRQ A;  4LC0 A;  1D8T A;  1HA3 A;  2V7W A;  1W87 A;  4LBY A;  2C77 A;  2VNK A;  1WOR A;  4XON A;  4P2N A;  5JBQ A;  1QX4 A;  3JQR A;  1E79 A;  2BVN A;  1KTV A;  1A8P A;  3CW2 A;  1YX2 A;  3ZUG A;  3W2E A;  3SKB A;  3W5U A;  1R5O A;  3PEN A;  1VLO A;  4X0C A;  4TT3 A;  2QMU A;  4X7C A;  1ZM4 A;  1FNC A;  5TR9 A;  2OTL B;  1BLI A;  4Y9R A;  4PC6 A;  4ZCL A;  2GJK A;  1QFJ A;  5GV7 A;  5A88 A;  4B48 A;  3HAG A;  5FIU A;  5IYQ A;  1W0J A;  3OAA A;  1UD6 A;  2EFG A;  3KEW A;  1XB2 A;  2BF4 A;  2ZZG A;  2DIE A;  2B5O A;  2XNC A;  3B78 A;  3E1Y E;  2ZZE A;  2HCJ B;  3AGP A;  3ONU A;  4BPR A;  1YI2 B;  4YEL A;  1YIJ B;  1UD4 A;  1GAW A;  4P12 A;  4KKU A;  3ZZT A;  1IJE A;  2WSS A;  4RPD A;  4ZV4 A;  4YAW A;  3JQP A;  3BCF A;  1MRZ A;  2GPJ A;  4B3X A;  1M1K D;  2XND A;  4YEJ A;  1GR1 A;  1QH0 A;  3CXC B;  2CBX A;  2P3M A;  3RY8 A;  2F4N A;  2OYN A;  4X7D A;  4XKW A;  2VBS A;  1D1N A;  1G7R A;  2HLD A;  4QV2 A;  4X05 A;  1NJI D;  1Q82 D;  1DDI A;  3JQQ A;  2C5H A;  2ZTN A;  3GVJ A;  3FKS A;  1UD8 A;  1EXM A;  2ZL5 A;  3VO2 A;  3W2H A;  4TMV A;  2D3L A;  3E20 A;  5KNL A;  1KMH A;  4WQM A;  5GV8 A;  2XZL A;  1JB9 A;  4XN3 A;  4OOV A;  2YWH A;  1VQM B;  3AST A;  2V7T A;  4LBV A;  1VQN B;  3ZBT A;  2ZL7 A;  4AVZ A;  1YLO A;  1GVH A;  4TN1 A;  1BPL A;  3ES9 A;  1VQP B;  4ZGN B;  2DOG A;  4HE6 A;  1EP1 B;  2XZP A;  2GJR A;  2WZP P;  4UAJ A;  1E3X A;  4P22 A;  1EFC A;  3CC4 B;  4G6I A;  5DN6 A;  1OB2 A;  1HVX A;  1IJF A;  2BPO A;  4RCY A;  5HZB A;  1VQ4 B;  4RD1 A;  4C0S A;  1H85 A;  3JU4 A;  4UZU A;  3A35 A;  3CC2 B;  3T56 B;  1QUE A;  1OGJ A;  4G5G A;  3CRZ A;  2NPF A;  1FNM A;  4QHY A;  4XOT A;  2C4U A;  4KKT A;  1QVF B;  1QG0 A;  2F1L A;  4B43 A;  4YAU A;  2VBV A;  3AVT A;  1QGZ A;  4M2L A;  4TMW A;  4YAO A;  3WXM A;  4XNF A;  3WBJ A;  5DSZ A;  2NV4 A;  1OGI A;  4OPV A;  4RD4 A;  1JA1 A;  4RPB A;  2JDI A;  1XFO A;  2ZZF A;  3WND A;  1E1Q A;  3T53 B;  1V0E A;  1QFY A;  2QTZ A;  2C5B A;  5H59 A;  2V7V A;  1E63 A;  4XR6 A;  3BQJ A;  3ISX A;  3CP2 A;  4DK1 A;  2CND A;  2Z6B D;  3GSI A;  4P25 A;  4ZGQ B;  2Q6O A;  4EH1 A;  3WQZ A;  1KC8 D;  5IYR A;  2WYR A;  3LQ6 A;  4YXW A;  2X0K A;  4R71 A;  3U6B A;  1H8H A;  4PAB A;  3CCV B;  2DYI A;  2Q6L A;  3PA1 A;  1M90 D;  2HDN B;  4X7F A;  1R5N A;  4M0L A;  1OB0 A;  5H5J A;  5HZA A;  4N3N A;  1VQ5 B;  3W5V A;  1N05 A;  5DS0 A;  5KSW B;  3R6K A;  4XMY A;  5J3O A;  1Q86 D;  3GVL A;  1YHQ B;  1TTT A;  3LNN A;  2CC2 A;  3VMF A;  3AVW A;  1WSV A;  1EP3 B;  4QVA A;  1JNY A;  1F60 A;  2JN9 A;  3GIR A;  5LMZ A;  2RC6 A;  1E62 A;  1IHM A;  3H94 A;  4Z1M A;  2BN4 A;  3CPX A;  3QFC A;  1CNF A;  1VQ8 B;  3W2G A;  1ELO A;  2CRV A;  5IYN A;  4YAL A;  1EFT A;  4UZF A;  1E43 A;  1K8A D;  1KK1 A;  4XLE A;  1MAB A;  2BV3 A;  5IK2 A;  2M5S A;  1YJ9 B;  1W34 A;  3OEE A;  4WZT A;  1FNB A;  3CCJ B;  2F43 A;  4TMZ A;  4PC2 A;  1S4M A;  4QVJ A;  4RD3 A;  5TY0 A;  4PC1 A;  3AVU A;  3PA2 A;  1Y0Y A;  2D9R A;  4FK8 A;  2GK7 A;  4MYU A;  2WJY A;  4WWV A;  4GQN A;  1B2R A;  4Z4Y A;  1NDH A;  1BX1 A;  2BGI A;  5F4O A;  3D26 A;  1EFU A;  4NBS A;  2X3U A;  1VQ6 B;  2WPD A;  3G05 A;  4P6V F;  2OTJ B;  2VNJ A;  3CES A;  3AVY A;  1WTH D;  2Q6K A;  4FN5 A;  5FL7 A;  4RDL A;  1Q7Y D;  2W6I A;  1U2R A;  2VZL A;  4XL9 A;  1ZM9 A;  1VJS A;  1WSR A;  4RDJ A;  3I56 B;  3BH4 A;  1SKQ A;  3KL9 A;  1YJW B;  3WNB A;  2VBT A;  3PUM A;  1AIP A;  4ROX A;  3WYA A;  4AF7 A;  1R5B A;  2QN6 A;  3MCA A;  2FX3 A;  4Y9U A;  1RQR A;  3CME B;  5FO1 A;  2OBS A;  4XM3 A;  3Q6R A;  2QE7 A;  2OK8 A;  2ZXH A;  4E0F A;  4B3G A;  4HE5 A;  2GQF A;  3NE5 B;  2QA4 B;  1IB0 A;  4RD2 A;  1T6X A;  1F20 A;  2XNJ A;  4XN0 A;  1VQL B;  2ZBU A;  4H9G A;  3ZBU A;  1G7T A;  3OPO A;  4IW3 B;  4MYT A;  2EIX A;  2VNH A;  2WJV A;  4G7W A;  1ZUN B;  3A8J A;  4B47 A;  3QSY A;  3AVX A;  3OFN A;  4G7X A;  5E6T A;  1COW A;  2F1M A;  4Z4Z A;  1BJK A;  1XQB A;  2X8K A;  3R6J A;  3U2Q A;  3VO1 A;  2BMW A;  4XOP A;  4XLA A;  3VNV A;  4FXU A;  4QFM A;  4TSF A;  5IYW A;  1SKY B;  1FDR A;  5TRD A;  4RM0 A;  5FA6 A;  2X6Y A;  3V76 A;  1FRN A;  3ZC3 A;  4JMQ A;  4K1X A;  1VF7 A;  3OJX A;  4B44 A;  2DET A;  4TMT A;  4B4D A;  3OE7 A;  3W5H A;  1E1R A;  2GK6 A;  4DQK A;  3T51 B;  4YAF A;  1ZM3 A;  1EWY A;  4FWT A;  4X07 A;  1S0U A;  2JIZ A;  2XOK A;  4PAA A;  4Z4R A;  4RD6 A;  3W2I A;  3CCS B;  1PJ7 A;  4NNJ A;  3CCM B;  1I8D A;  1OB5 A;  3CD6 B;  3QFS A;  3ZPN A;  2VNI A;  3OZV A;  3SJZ A;  1CNE A;  1W35 A;  1DAR A;  4LBZ A;  3CPW B;  2QDX A;  2X6X A;  2BSA A;  2DER A;  3SLN A;  2ZTG A;  2C78 A;  4XOR A;  2OBT A;  2R9V A;  1UD3 A;  3ASR A;  1DG1 G;  1KK0 A;  4TKO B; 
#chains in the Genus database with same CATH homology
 2X6W A;  2XND A;  4YEJ A;  1E3Z A;  1W0K A;  2ZZQ A;  2GK7 A;  2XZO A;  4XKW A;  4XLC A;  2WJY A;  4GQN A;  2HLD A;  2VJJ A;  1HZE A;  1KZL A;  2ZTN A;  2GJP A;  4HIZ A;  2WPD A;  3GVJ A;  3FKS A;  1UD8 A;  3GQB A;  3G05 A;  1UD5 A;  2D3L A;  2KVO A;  1WP6 A;  5KNL A;  1KMH A;  1FX0 A;  3BC9 A;  2ZXI A;  3CES A;  1WTH D;  2XZL A;  5FL7 A;  4XN3 A;  1W9X A;  3BCD A;  2W6I A;  4XL9 A;  1VJS A;  3BH4 A;  3OW7 A;  1V0F A;  2XGJ A;  4AVZ A;  3CMM A;  1OHH A;  1BPL A;  2E1B A;  1I18 A;  3DDY A;  2XZP A;  4XKV A;  2GJR A;  2WZP P;  4ASU A;  4II3 A;  1E3X A;  4XD7 A;  4P22 A;  2V7Q A;  4G6I A;  5DN6 A;  4XM3 A;  1HVX A;  2X53 S;  1T5E A;  3JU4 A;  4UZU A;  3A35 A;  2QE7 A;  2X85 A;  3T56 B;  2ZXH A;  1NBM A;  4E0F A;  2JJ2 A;  4XOT A;  4KKT A;  3FPP A;  3OEH A;  4B3G A;  2LZJ A;  2JJ1 A;  1K28 D;  3NE5 B;  4XLH A;  5CDF A;  1NRK A;  4DK0 A;  1EFR A;  4XNF A;  2VJI A;  1H8E A;  4KKS A;  1PKV A;  4XN0 A;  2JDI A;  4XLF A;  2ZZF A;  2V4D A;  1E1Q A;  3OPO A;  3T53 B;  1V0E A;  2CK3 A;  2W6J A;  2WJV A;  4G7W A;  2D3N A;  3A3G A;  3OFN A;  4G7X A;  1COW A;  4XR6 A;  4DNT B;  2F1M A;  4DK1 A;  3CP2 A;  4DNR B;  2X8K A;  2Z6B D;  3WQZ A;  4XOP A;  4XLA A;  4FXU A;  4XON A;  4TSF A;  5HKK A;  1SKY B;  1BMF A;  4YXW A;  2X6Y A;  1H8H A;  1E79 A;  4JMQ A;  3OOC A;  3GVK A;  1VF7 A;  1OB0 A;  1UD2 A;  4XMY A;  3GVL A;  4TT3 A;  3OE7 A;  1E1R A;  2GK6 A;  3LNN A;  3VR6 A;  3T51 B;  1BLI A;  2JIZ A;  2XOK A;  2GJK A;  3HAG A;  4NNJ A;  1I8D A;  1W0J A;  3OAA A;  1UD6 A;  3H94 A;  3KEW A;  4Z1M A;  3ZPN A;  4B3F X;  4XQF A;  2ZZG A;  4L8J A;  2DIE A;  1WPC A;  2ZZE A;  3ZIA A;  4YEL A;  1UD4 A;  1E43 A;  2X6X A;  4KKU A;  4XLE A;  2WSS A;  2V31 A;  1MAB A;  3CP8 A;  5IK2 A;  2M5S A;  4II2 A;  1VLY A;  3BCF A;  3OEE A;  4XOR A;  2R9V A;  1UD3 A;  2F43 A;  3A3B A;  2ZTG A;  4TKO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...