2V31A

Structure of first catalytic cysteine half-domain of mouse ubiquitin- activating enzyme
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
112
structure length
112
Chain Sequence
b'EFGEEMVLTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPASLVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-ACTIVATING ENZYME E1 X
molecule tags Ligase
publication title Structure of First Catalytic Cysteine Half-Domain of Mouse Ubiquitin-Activating Enzyme
rcsb
total genus 8
structure length 112
sequence length 112
ec nomenclature ec 6.2.1.45: E1 ubiquitin-activating enzyme.
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.180 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2v31A01
5KNLA 4II3A 2LZJA 2V31A 4NNJA 3CMMA 4II2A 4P22A
chains in the Genus database with same CATH superfamily
1BMFA 3A35A 3MHPA 3OKXA 3HAGA 4ASUA 3ES9A 1BPLA 3BH4A 4B48A 1W2BB 4E0FA 2BPOA 5TRDA 2D74A 3LQ6A 1QX4A 3JQRA 2HCJB 1WORA 2EIXA 1OGIA 3JU4A 4HE5A 4P6VF 1VJSA 3JQQA 1VF7A 1WOOA 4MYTA 3ZC3A 2ZL7A 5GV8A 1QUFA 4F7DA 3ASQA 1E1QA 4YAUA 1VQ4B 3W5HA 2BF4A 2Z6BD 4XM3A 2ZTNA 4KKSA 5JBQA 1XE1A 1KK3A 4ZCLA 3WXMA 1WSVA 1E79A 1QGYA 4RD1A 2RC6A 2ZZEA 2D9RA 1VHEA 3ZIAA 1VQ6B 3FKSA 4ACAA 3PA1A 4RJLA 3CC2B 2CBXA 3CCJB 3V7AA 2YWFA 3LQEA 2XNDA 4HIZA 1H8EA 1FX0A 3AVYA 1WPCA 2WJVA 4OPVA 4PABA 2V7XA 4RCYA 1KMHA 4QFMA 3PVDA 1UD3A 3CP2A 1PJ6A 4XKVA 4XLHA 3QE2A 4PC3A 1GAWA 1HZEA 2ZL5A 2VBUA 3ASTA 3CW2A 4Z4ZA 4QVJA 4RD2A 4G6IA 4TMZA 4NNJA 3ZZ0A 3CXCB 1TTTA 2X53S 1CNEA 3GSIA 4U9UA 3W2HA 1V0EA 4XQFA 2QTZA 2B5OA 3WBKA 1VQOB 2YWHA 3LVBA 1EFCA 2XOKA 2RC5A 4IW3B 3CESA 4XMYA 1PKVA 5EMNA 3ZBTA 4XD7A 3H94A 1UMKA 3GIRA 1TVCA 1YIJB 4KKUA 2C77A 3OZVA 1WP6A 3A3BA 2V7VA 3CC4B 2E1RA 3VMFA 1QH0A 1JA1A 2D3LA 4K1XA 2Q6OA 3G4SB 1WOPA 1W0JA 2X85A 1NBMA 3OFNA 3G6EB 3CD6B 2YWGA 2JIZA 4ZCIA 2GK7A 1T6XA 1ZUNB 3ASPA 1W87A 2BM0A 1EFTA 1G7SA 5F4OA 3QFSA 2GJRA 5F4MA 1KD1D 3W2IA 3CC7B 2XZLA 1H42A 1ZM2A 1B2RA 4DQKA 4YELA 1T5EA 3G05A 1QGZA 1G7RA 2V7TA 3BC9A 3Q38A 3OOCA 4FXUA 4WZTA 1OB2A 3AGQA 3KL9A 2V31A 1BJKA 1ZM9A 1N0VC 4C43A 3ZPNA 2BMWA 1YJNB 4X05A 3P26A 1HA3A 3GVLA 3QFCA 4YALA 1R5NA 3OP1A 1QVGB 3WYAA 3CCMB 1WOSA 4XLAA 4RDLA 2HLDA 2OTLB 2NPFA 2GREA 2C2WA 3OAAA 1R5BA 1KK2A 5LMZA 2D3NA 5GV7A 2F1MA 2DETA 2ZXHA 1YJ9B 1KZLA 3BCDA 1SKQA 2E1BA 3H9NA 1TLLA 4WZKA 4CQJA 1QG0A 3A3GA 4YXWA 3B82A 2XGJA 3GVJA 1QVFB 3SLDA 5FIUA 1VLOA 3P27A 2OBTA 4WWVA 4YAOA 4ZV4A 1Q86D 1OGJA 2OBSA 3MMPA 2F4NA 4X0CA 4Y9UA 4PGOA 4TSFA 3CCEB 4Y9RA 1NB0A 1QFJA 1K28D 1AMOA 2PLFA 1I8DA 1D1NA 3A8IA 2QEXB 5AN9A 5E6TA 4P1VA 4LC0A 4PC1A 5TY0A 3WNBA 1ELOA 1P4MA 5J3OA 4Z4YA 4XL9A 4XR6A 4OP7A 3VNVA 2JN9A 3SEJA 3Q3AA 3I56B 1FNMA 4FN5A 3VR6A 4XLEA 1JNYA 2VYQA 4H9GA 4P2NA 2OYNA 1CNFA 4P9SA 2JJ1A 2VNJA 5H59A 1UD6A 2OK7A 3W2EA 3OEEA 5CDFA 1V0FA 4XORA 1E62A 1JA0A 4DQLA 1SM4A 1WDTA 5TR9A 1E43A 1VQ5B 1AIPA 4ROXA 1W35A 1BLIA 1N0UA 1MABA 1T6ZA 2F1LA 2QMUA 5HZAA 4ZCMA 3CB4A 4XN0A 1N05A 1BX0A 3R6KA 2C4TA 1UD2A 1QUEA 2C78A 4P22A 1GR1A 3WQZA 2V7WA 4C0SA 2BN4A 3CMEB 2VBVA 5FNZA 3QFTA 2GJKA 3BY2A 4TMXA 5DS0A 1VQNB 3U2QA 5BSXA 2VBTA 3T56B 1EFUA 5H5JA 2C5HA 2HMAA 3CTAA 1YHQB 3W2FA 3I55B 4RD6A 1QFZA 4AVZA 3B8HA 4UAJA 4Z4WA 4P3IA 4TT3A 3WBJA 2NV4A 2WZNA 2V7QA 4KKTA 4HE6A 2F43A 2X3UA 4WQMA 1PJ5A 2GJPA 4EH1A 2CNDA 2PIAA 2XNJA 4FWTA 3PENA 1NB9A 4RLZA 1GAQA 4OPOA 1EP2B 4XNFA 2QGGA 1D8TA 2C5BA 3FPKA 2VZLA 1DARA 4PAAA 1G7TA 5IYQA 3Q39A 2CRVA 1RQPA 4UZUA 1YITB 3WY9A 4Z4VA 4DNRB 3CCLB 4JMQA 4MYUA 3I1FA 4Z4RA 3ONUA 4M1KA 2Q6LA 3AGPA 1M1KD 1FRQA 3CMAB 3BNWA 2ZL6A 1K9MD 1KK1A 1NDHA 1V5VA 2R6HA 3QFRA 4TKOB 5FO1A 4N3NA 3T51B 4QHYA 3U6BA 2ZTGA 1IJEA 5F4JA 2X6XA 4II3A 1Y0YA 3CPXA 1D2EA 1KTVA 1QGAA 1UD4A 1E3ZA 1N8RD 1W9XA 2DCUA 4RM0A 3CP8A 1N06A 1QFYA 4NBSA 4XOPA 1GJRA 2QN6A 1E64A 3AVTA 3KEWA 3PUNA 2FX3A 4RPBA 4TMTA 4YHBA 1VQ9B 5DN6A 2VJIA 2DIEA 2Q6KA 2BVNA 2ZBVA 1KQSB 4ACBA 1KJZA 5L46A 1NRKA 2WJYA 1Q82D 4J0QA 2JJ2A 1OB5A 5THXA 1VQPB 1H8HA 2AHOA 4ZGQB 4G7WA 1FNBA 1XQBA 4RD0A 1YI2B 1BQEA 3R6JA 1XB2A 1MRZA 2OK8A 3PUMA 4G1VA 1VHOA 1FNDA 2BSAA 2V7UA 2ZBUA 4M53A 3V76A 2VBSA 1K73D 4YAWA 3RY8A 2BGIA 2ZZQA 3ZZTA 2B7CA 5IK2A 4PC2A 3SJPA 3U6KA 4LBYA 4P12A 4AC9A 3A1PA 1R5OA 2VNKA 2X6WA 1TUIA 4DNTB 2Q6IA 4P26A 2YWEA 4P3YA 3AVXA 1G7CA 1PJ7A 2PE3A 4Q7JB 3W2GA 1WSRA 5BSYA 3G71B 1OB0A 1DDGA 1N07A 3OJXA 3OZWA 3W5VA 1WTHD 2DOGA 4X7FA 4II2A 1K8AD 2WZPP 1Q7YD 4XONA 5FA6A 5IYRA 2OBRA 3AVUA 4GQNA 1S0UA 1VQ8B 2VNHA 4B3GA 2B7BA 4P25A 4UZEA 2X6YA 2CC2A 2QA4B 1I7PA 4B3XA 2WYRA 1VQKB 1FNCA 1UD8A 2I1LA 3PA2A 4AF6A 4Y7CA 1JB9A 3JQPA 4G7XA 5TV2A 3CCQB 5FL7A 1IHMA 2J7KA 3CRZA 3B78A 2FVGA 4B3FX 3ZBUA 4YAFA 3WNCA 4QV2A 3CMMA 1E3XA 4R71A 3OJWA 3BCFA 4YEJA 1EXMA 1COWA 2ZZFA 2W6IA 3WNDA 3OZUA 4TN1A 4DK1A 3ZZUA 3FJOA 1Y0RA 3ZUGA 1HVXA 2QTLA 1F60A 1FRNA 3ASSA 1GVHA 1Q9SA 3ASRA 4RDKA 3E1YE 2GPJA 5HXBA 5J35A 4WZLA 4LBZA 3W5UA 3BQJA 4G1BA 3OW2B 2V4DA 1M90D 2M5SA 3GVKA 4B47A 5A89A 2X8KA 4M2LA 3CCVB 2WPDA 2KVOA 3AVWA 4FK8A 4Z4TA 2GQFA 4ZGNB 1DG1G 3VO2A 5KSWB 4PC7A 3OEHA 4XLFA 3E20A 5IYNA 4X8IA 3D26A 2WR8A 3BY1A 3CCRB 3Q6RA 5A8AA 1E63A 4BPRA 1VQLB 2ZXIA 3OE7A 4P6YA 4QUZA 3CCSB 4X7CA 1E1RA 1EWYA 2DY1A 1CQXA 2QE7A 1KK0A 4NCNA 2XZOA 1DDIA 3A8JA 4WZEA 2JDIA 1H85A 2HDNB 3SKBA 1JJ2B 5KNLA 4G5GA 4RPDA 2LZJA 5HZBA 3J81k 3SLNA 1F20A 2DYIA 5DSZA 3GQBA 1I18A 2CK3A 3AVVA 3Q6QA 4Z4SA 3OPOA 1RQRA 1SKYB 4RDJA 4XOTA 2DEUA 4OOXA 4OOSA 2BV3A 2GK6A 4N3GA 3T53B 1EP1B 2C4UA 2QDXA 4OOVA 4XKWA 3SJZA 2R9VA 1YLOA 2WSSA 4M4SA 1W0KA 3FPPA 1KC8D 4AF7A 4OPSA 1UD5A 5IYWA 1S4MA 2P3MA 2ZZGA 2CW5A 5FO0A 2EFGA 1Q81D 3LNNA 2PMDA 1B23P 2X0KA 5IYPA 4B4DA 4X7EA 4M0LA 3ONYA 3CCUB 3LO8A 2VNIA 1ZM4A 1T6YA 3ISXA 1YX2A 5B6IA 4TMVA 2XEXA 4XN3A 2XNCA 4B43A 1J9ZA 1A8PA 1YJWB 1N08A 1U2RA 4UZFA 4X7DA 1IB0A 1EFRA 4X06A 4B44A 4LBWA 3CPWB 2VJJA 3MCAA 1VLYA 2BM1A 1XFOA 2ZITA 3NE5B 4XLCA 1EP3B 1GO2A 1FDRA 3A8KA 5A88A 4DK0A 4QVAA 2CF4A 2BGJA 4RD4A 1VQMB 1WU8A 1W34A 3DDYA 3OW7A 4LBVA 4RD3A 5KW9A 4L8JA 1OHHA 3QSYA 1S72B 2W6JA 2DERA 4PC6A 5HKKA 1IJFA 1KRHA 2OTJB 4X07A 4Z4UA 3VNUA 4Z1MA 1BX1A 4RCZA 3VO1A 4TMWA 1ZM3A 2XZPA 1NJID 1VQ7B
chains in the Genus database with same CATH topology
1BMFA 3A35A 3HAGA 4ASUA 1BPLA 3BH4A 2D3NA 4E0FA 2F1MA 3OEHA 4TKOB 4XLFA 2ZXHA 1KZLA 3BCDA 3T51B 2E1BA 2ZTGA 2X6XA 3A3GA 4II3A 4YXWA 2XGJA 3JU4A 3GVJA 1VJSA 1VF7A 1UD4A 1E3ZA 2ZXIA 1W9XA 1E1QA 3OE7A 2Z6BD 3CP8A 4XM3A 2ZTNA 4KKSA 4XOPA 1E1RA 2QE7A 2XZOA 3KEWA 1E79A 2ZZEA 4TSFA 3ZIAA 3FKSA 2JDIA 5DN6A 2VJIA 2DIEA 1K28D 1I8DA 5KNLA 2XNDA 4HIZA 1H8EA 1NRKA 1FX0A 2LZJA 1WPCA 2WJVA 2WJYA 1KMHA 2JJ2A 1UD3A 1H8HA 3CP2A 3GQBA 1I18A 2CK3A 4XKVA 4G7WA 4XL9A 4XR6A 4XLHA 1HZEA 3VR6A 3OPOA 1SKYB 4G6IA 4XLEA 4NNJA 4XOTA 2ZZQA 2JJ1A 2GK6A 2X53S 5IK2A 3T53B 1UD6A 1V0EA 4XKWA 4XQFA 3OEEA 5CDFA 2R9VA 2WSSA 1V0FA 1W0KA 3FPPA 4XORA 1UD5A 2XOKA 2X6WA 3CESA 4XMYA 1E43A 2ZZGA 4DNTB 1PKVA 1BLIA 1MABA 4XD7A 3H94A 4KKUA 4XN0A 3LNNA 1OB0A 1WP6A 1UD2A 1WTHD 3A3BA 4II2A 2WZPP 4XONA 4P22A 3WQZA 2D3LA 4GQNA 1W0JA 2X85A 1NBMA 3OFNA 2GJKA 4B3GA 2X6YA 2JIZA 2GK7A 4XN3A 3T56B 1UD8A 4G7XA 2GJRA 1EFRA 5FL7A 2VJJA 2XZLA 1VLYA 4B3FX 4AVZA 3NE5B 4XLCA 4TT3A 3CMMA 4YELA 1E3XA 1T5EA 3G05A 4YEJA 3BCFA 3BC9A 1COWA 2V7QA 2ZZFA 4KKTA 2W6IA 3OOCA 4FXUA 2F43A 4DK0A 4DK1A 2V31A 2GJPA 3DDYA 3OW7A 3ZPNA 1HVXA 4L8JA 1OHHA 2W6JA 4XNFA 5HKKA 3GVLA 4Z1MA 4UZUA 2XZPA 2V4DA 4XLAA 2M5SA 3GVKA 4JMQA 4DNRB 2HLDA 2X8KA 2WPDA 3OAAA 2KVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KNL A;  4II3 A;  2LZJ A;  2V31 A;  4NNJ A;  3CMM A;  4II2 A;  4P22 A; 
#chains in the Genus database with same CATH topology
 1BMF A;  3A35 A;  3MHP A;  3OKX A;  3HAG A;  4ASU A;  3ES9 A;  1BPL A;  3BH4 A;  4B48 A;  1W2B B;  4E0F A;  2BPO A;  5TRD A;  2D74 A;  3LQ6 A;  1QX4 A;  3JQR A;  2HCJ B;  1WOR A;  2EIX A;  1OGI A;  3JU4 A;  4HE5 A;  4P6V F;  1VJS A;  3JQQ A;  1VF7 A;  1WOO A;  4MYT A;  3ZC3 A;  2ZL7 A;  5GV8 A;  1QUF A;  4F7D A;  3ASQ A;  1E1Q A;  4YAU A;  1VQ4 B;  3W5H A;  2BF4 A;  2Z6B D;  4XM3 A;  2ZTN A;  4KKS A;  5JBQ A;  1XE1 A;  1KK3 A;  4ZCL A;  3WXM A;  1WSV A;  1E79 A;  1QGY A;  4RD1 A;  2RC6 A;  2ZZE A;  2D9R A;  1VHE A;  3ZIA A;  1VQ6 B;  3FKS A;  4ACA A;  3PA1 A;  4RJL A;  3CC2 B;  2CBX A;  3CCJ B;  3V7A A;  2YWF A;  3LQE A;  2XND A;  4HIZ A;  1H8E A;  1FX0 A;  3AVY A;  1WPC A;  2WJV A;  4OPV A;  4PAB A;  2V7X A;  4RCY A;  1KMH A;  4QFM A;  3PVD A;  1UD3 A;  3CP2 A;  1PJ6 A;  4XKV A;  4XLH A;  3QE2 A;  4PC3 A;  1GAW A;  1HZE A;  2ZL5 A;  2VBU A;  3AST A;  3CW2 A;  4Z4Z A;  4QVJ A;  4RD2 A;  4G6I A;  4TMZ A;  4NNJ A;  3ZZ0 A;  3CXC B;  1TTT A;  2X53 S;  1CNE A;  3GSI A;  4U9U A;  3W2H A;  1V0E A;  4XQF A;  2QTZ A;  2B5O A;  3WBK A;  1VQO B;  2YWH A;  3LVB A;  1EFC A;  2XOK A;  2RC5 A;  4IW3 B;  3CES A;  4XMY A;  1PKV A;  5EMN A;  3ZBT A;  4XD7 A;  3H94 A;  1UMK A;  3GIR A;  1TVC A;  1YIJ B;  4KKU A;  2C77 A;  3OZV A;  1WP6 A;  3A3B A;  2V7V A;  3CC4 B;  2E1R A;  3VMF A;  1QH0 A;  1JA1 A;  2D3L A;  4K1X A;  2Q6O A;  3G4S B;  1WOP A;  1W0J A;  2X85 A;  1NBM A;  3OFN A;  3G6E B;  3CD6 B;  2YWG A;  2JIZ A;  4ZCI A;  2GK7 A;  1T6X A;  1ZUN B;  3ASP A;  1W87 A;  2BM0 A;  1EFT A;  1G7S A;  5F4O A;  3QFS A;  2GJR A;  5F4M A;  1KD1 D;  3W2I A;  3CC7 B;  2XZL A;  1H42 A;  1ZM2 A;  1B2R A;  4DQK A;  4YEL A;  1T5E A;  3G05 A;  1QGZ A;  1G7R A;  2V7T A;  3BC9 A;  3Q38 A;  3OOC A;  4FXU A;  4WZT A;  1OB2 A;  3AGQ A;  3KL9 A;  2V31 A;  1BJK A;  1ZM9 A;  1N0V C;  4C43 A;  3ZPN A;  2BMW A;  1YJN B;  4X05 A;  3P26 A;  1HA3 A;  3GVL A;  3QFC A;  4YAL A;  1R5N A;  3OP1 A;  1QVG B;  3WYA A;  3CCM B;  1WOS A;  4XLA A;  4RDL A;  2HLD A;  2OTL B;  2NPF A;  2GRE A;  2C2W A;  3OAA A;  1R5B A;  1KK2 A;  5LMZ A;  2D3N A;  5GV7 A;  2F1M A;  2DET A;  2ZXH A;  1YJ9 B;  1KZL A;  3BCD A;  1SKQ A;  2E1B A;  3H9N A;  1TLL A;  4WZK A;  4CQJ A;  1QG0 A;  3A3G A;  4YXW A;  3B82 A;  2XGJ A;  3GVJ A;  1QVF B;  3SLD A;  5FIU A;  1VLO A;  3P27 A;  2OBT A;  4WWV A;  4YAO A;  4ZV4 A;  1Q86 D;  1OGJ A;  2OBS A;  3MMP A;  2F4N A;  4X0C A;  4Y9U A;  4PGO A;  4TSF A;  3CCE B;  4Y9R A;  1NB0 A;  1QFJ A;  1K28 D;  1AMO A;  2PLF A;  1I8D A;  1D1N A;  3A8I A;  2QEX B;  5AN9 A;  5E6T A;  4P1V A;  4LC0 A;  4PC1 A;  5TY0 A;  3WNB A;  1ELO A;  1P4M A;  5J3O A;  4Z4Y A;  4XL9 A;  4XR6 A;  4OP7 A;  3VNV A;  2JN9 A;  3SEJ A;  3Q3A A;  3I56 B;  1FNM A;  4FN5 A;  3VR6 A;  4XLE A;  1JNY A;  2VYQ A;  4H9G A;  4P2N A;  2OYN A;  1CNF A;  4P9S A;  2JJ1 A;  2VNJ A;  5H59 A;  1UD6 A;  2OK7 A;  3W2E A;  3OEE A;  5CDF A;  1V0F A;  4XOR A;  1E62 A;  1JA0 A;  4DQL A;  1SM4 A;  1WDT A;  5TR9 A;  1E43 A;  1VQ5 B;  1AIP A;  4ROX A;  1W35 A;  1BLI A;  1N0U A;  1MAB A;  1T6Z A;  2F1L A;  2QMU A;  5HZA A;  4ZCM A;  3CB4 A;  4XN0 A;  1N05 A;  1BX0 A;  3R6K A;  2C4T A;  1UD2 A;  1QUE A;  2C78 A;  4P22 A;  1GR1 A;  3WQZ A;  2V7W A;  4C0S A;  2BN4 A;  3CME B;  2VBV A;  5FNZ A;  3QFT A;  2GJK A;  3BY2 A;  4TMX A;  5DS0 A;  1VQN B;  3U2Q A;  5BSX A;  2VBT A;  3T56 B;  1EFU A;  5H5J A;  2C5H A;  2HMA A;  3CTA A;  1YHQ B;  3W2F A;  3I55 B;  4RD6 A;  1QFZ A;  4AVZ A;  3B8H A;  4UAJ A;  4Z4W A;  4P3I A;  4TT3 A;  3WBJ A;  2NV4 A;  2WZN A;  2V7Q A;  4KKT A;  4HE6 A;  2F43 A;  2X3U A;  4WQM A;  1PJ5 A;  2GJP A;  4EH1 A;  2CND A;  2PIA A;  2XNJ A;  4FWT A;  3PEN A;  1NB9 A;  4RLZ A;  1GAQ A;  4OPO A;  1EP2 B;  4XNF A;  2QGG A;  1D8T A;  2C5B A;  3FPK A;  2VZL A;  1DAR A;  4PAA A;  1G7T A;  5IYQ A;  3Q39 A;  2CRV A;  1RQP A;  4UZU A;  1YIT B;  3WY9 A;  4Z4V A;  4DNR B;  3CCL B;  4JMQ A;  4MYU A;  3I1F A;  4Z4R A;  3ONU A;  4M1K A;  2Q6L A;  3AGP A;  1M1K D;  1FRQ A;  3CMA B;  3BNW A;  2ZL6 A;  1K9M D;  1KK1 A;  1NDH A;  1V5V A;  2R6H A;  3QFR A;  4TKO B;  5FO1 A;  4N3N A;  3T51 B;  4QHY A;  3U6B A;  2ZTG A;  1IJE A;  5F4J A;  2X6X A;  4II3 A;  1Y0Y A;  3CPX A;  1D2E A;  1KTV A;  1QGA A;  1UD4 A;  1E3Z A;  1N8R D;  1W9X A;  2DCU A;  4RM0 A;  3CP8 A;  1N06 A;  1QFY A;  4NBS A;  4XOP A;  1GJR A;  2QN6 A;  1E64 A;  3AVT A;  3KEW A;  3PUN A;  2FX3 A;  4RPB A;  4TMT A;  4YHB A;  1VQ9 B;  5DN6 A;  2VJI A;  2DIE A;  2Q6K A;  2BVN A;  2ZBV A;  1KQS B;  4ACB A;  1KJZ A;  5L46 A;  1NRK A;  2WJY A;  1Q82 D;  4J0Q A;  2JJ2 A;  1OB5 A;  5THX A;  1VQP B;  1H8H A;  2AHO A;  4ZGQ B;  4G7W A;  1FNB A;  1XQB A;  4RD0 A;  1YI2 B;  1BQE A;  3R6J A;  1XB2 A;  1MRZ A;  2OK8 A;  3PUM A;  4G1V A;  1VHO A;  1FND A;  2BSA A;  2V7U A;  2ZBU A;  4M53 A;  3V76 A;  2VBS A;  1K73 D;  4YAW A;  3RY8 A;  2BGI A;  2ZZQ A;  3ZZT A;  2B7C A;  5IK2 A;  4PC2 A;  3SJP A;  3U6K A;  4LBY A;  4P12 A;  4AC9 A;  3A1P A;  1R5O A;  2VNK A;  2X6W A;  1TUI A;  4DNT B;  2Q6I A;  4P26 A;  2YWE A;  4P3Y A;  3AVX A;  1G7C A;  1PJ7 A;  2PE3 A;  4Q7J B;  3W2G A;  1WSR A;  5BSY A;  3G71 B;  1OB0 A;  1DDG A;  1N07 A;  3OJX A;  3OZW A;  3W5V A;  1WTH D;  2DOG A;  4X7F A;  4II2 A;  1K8A D;  2WZP P;  1Q7Y D;  4XON A;  5FA6 A;  5IYR A;  2OBR A;  3AVU A;  4GQN A;  1S0U A;  1VQ8 B;  2VNH A;  4B3G A;  2B7B A;  4P25 A;  4UZE A;  2X6Y A;  2CC2 A;  2QA4 B;  1I7P A;  4B3X A;  2WYR A;  1VQK B;  1FNC A;  1UD8 A;  2I1L A;  3PA2 A;  4AF6 A;  4Y7C A;  1JB9 A;  3JQP A;  4G7X A;  5TV2 A;  3CCQ B;  5FL7 A;  1IHM A;  2J7K A;  3CRZ A;  3B78 A;  2FVG A;  4B3F X;  3ZBU A;  4YAF A;  3WNC A;  4QV2 A;  3CMM A;  1E3X A;  4R71 A;  3OJW A;  3BCF A;  4YEJ A;  1EXM A;  1COW A;  2ZZF A;  2W6I A;  3WND A;  3OZU A;  4TN1 A;  4DK1 A;  3ZZU A;  3FJO A;  1Y0R A;  3ZUG A;  1HVX A;  2QTL A;  1F60 A;  1FRN A;  3ASS A;  1GVH A;  1Q9S A;  3ASR A;  4RDK A;  3E1Y E;  2GPJ A;  5HXB A;  5J35 A;  4WZL A;  4LBZ A;  3W5U A;  3BQJ A;  4G1B A;  3OW2 B;  2V4D A;  1M90 D;  2M5S A;  3GVK A;  4B47 A;  5A89 A;  2X8K A;  4M2L A;  3CCV B;  2WPD A;  2KVO A;  3AVW A;  4FK8 A;  4Z4T A;  2GQF A;  4ZGN B;  1DG1 G;  3VO2 A;  5KSW B;  4PC7 A;  3OEH A;  4XLF A;  3E20 A;  5IYN A;  4X8I A;  3D26 A;  2WR8 A;  3BY1 A;  3CCR B;  3Q6R A;  5A8A A;  1E63 A;  4BPR A;  1VQL B;  2ZXI A;  3OE7 A;  4P6Y A;  4QUZ A;  3CCS B;  4X7C A;  1E1R A;  1EWY A;  2DY1 A;  1CQX A;  2QE7 A;  1KK0 A;  4NCN A;  2XZO A;  1DDI A;  3A8J A;  4WZE A;  2JDI A;  1H85 A;  2HDN B;  3SKB A;  1JJ2 B;  5KNL A;  4G5G A;  4RPD A;  2LZJ A;  5HZB A;  3J81 k;  3SLN A;  1F20 A;  2DYI A;  5DSZ A;  3GQB A;  1I18 A;  2CK3 A;  3AVV A;  3Q6Q A;  4Z4S A;  3OPO A;  1RQR A;  1SKY B;  4RDJ A;  4XOT A;  2DEU A;  4OOX A;  4OOS A;  2BV3 A;  2GK6 A;  4N3G A;  3T53 B;  1EP1 B;  2C4U A;  2QDX A;  4OOV A;  4XKW A;  3SJZ A;  2R9V A;  1YLO A;  2WSS A;  4M4S A;  1W0K A;  3FPP A;  1KC8 D;  4AF7 A;  4OPS A;  1UD5 A;  5IYW A;  1S4M A;  2P3M A;  2ZZG A;  2CW5 A;  5FO0 A;  2EFG A;  1Q81 D;  3LNN A;  2PMD A;  1B23 P;  2X0K A;  5IYP A;  4B4D A;  4X7E A;  4M0L A;  3ONY A;  3CCU B;  3LO8 A;  2VNI A;  1ZM4 A;  1T6Y A;  3ISX A;  1YX2 A;  5B6I A;  4TMV A;  2XEX A;  4XN3 A;  2XNC A;  4B43 A;  1J9Z A;  1A8P A;  1YJW B;  1N08 A;  1U2R A;  4UZF A;  4X7D A;  1IB0 A;  1EFR A;  4X06 A;  4B44 A;  4LBW A;  3CPW B;  2VJJ A;  3MCA A;  1VLY A;  2BM1 A;  1XFO A;  2ZIT A;  3NE5 B;  4XLC A;  1EP3 B;  1GO2 A;  1FDR A;  3A8K A;  5A88 A;  4DK0 A;  4QVA A;  2CF4 A;  2BGJ A;  4RD4 A;  1VQM B;  1WU8 A;  1W34 A;  3DDY A;  3OW7 A;  4LBV A;  4RD3 A;  5KW9 A;  4L8J A;  1OHH A;  3QSY A;  1S72 B;  2W6J A;  2DER A;  4PC6 A;  5HKK A;  1IJF A;  1KRH A;  2OTJ B;  4X07 A;  4Z4U A;  3VNU A;  4Z1M A;  1BX1 A;  4RCZ A;  3VO1 A;  4TMW A;  1ZM3 A;  2XZP A;  1NJI D;  1VQ7 B; 
#chains in the Genus database with same CATH homology
 1BMF A;  3A35 A;  3HAG A;  4ASU A;  1BPL A;  3BH4 A;  2D3N A;  4E0F A;  2F1M A;  3OEH A;  4TKO B;  4XLF A;  2ZXH A;  1KZL A;  3BCD A;  3T51 B;  2E1B A;  2ZTG A;  2X6X A;  3A3G A;  4II3 A;  4YXW A;  2XGJ A;  3JU4 A;  3GVJ A;  1VJS A;  1VF7 A;  1UD4 A;  1E3Z A;  2ZXI A;  1W9X A;  1E1Q A;  3OE7 A;  2Z6B D;  3CP8 A;  4XM3 A;  2ZTN A;  4KKS A;  4XOP A;  1E1R A;  2QE7 A;  2XZO A;  3KEW A;  1E79 A;  2ZZE A;  4TSF A;  3ZIA A;  3FKS A;  2JDI A;  5DN6 A;  2VJI A;  2DIE A;  1K28 D;  1I8D A;  5KNL A;  2XND A;  4HIZ A;  1H8E A;  1NRK A;  1FX0 A;  2LZJ A;  1WPC A;  2WJV A;  2WJY A;  1KMH A;  2JJ2 A;  1UD3 A;  1H8H A;  3CP2 A;  3GQB A;  1I18 A;  2CK3 A;  4XKV A;  4G7W A;  4XL9 A;  4XR6 A;  4XLH A;  1HZE A;  3VR6 A;  3OPO A;  1SKY B;  4G6I A;  4XLE A;  4NNJ A;  4XOT A;  2ZZQ A;  2JJ1 A;  2GK6 A;  2X53 S;  5IK2 A;  3T53 B;  1UD6 A;  1V0E A;  4XKW A;  4XQF A;  3OEE A;  5CDF A;  2R9V A;  2WSS A;  1V0F A;  1W0K A;  3FPP A;  4XOR A;  1UD5 A;  2XOK A;  2X6W A;  3CES A;  4XMY A;  1E43 A;  2ZZG A;  4DNT B;  1PKV A;  1BLI A;  1MAB A;  4XD7 A;  3H94 A;  4KKU A;  4XN0 A;  3LNN A;  1OB0 A;  1WP6 A;  1UD2 A;  1WTH D;  3A3B A;  4II2 A;  2WZP P;  4XON A;  4P22 A;  3WQZ A;  2D3L A;  4GQN A;  1W0J A;  2X85 A;  1NBM A;  3OFN A;  2GJK A;  4B3G A;  2X6Y A;  2JIZ A;  2GK7 A;  4XN3 A;  3T56 B;  1UD8 A;  4G7X A;  2GJR A;  1EFR A;  5FL7 A;  2VJJ A;  2XZL A;  1VLY A;  4B3F X;  4AVZ A;  3NE5 B;  4XLC A;  4TT3 A;  3CMM A;  4YEL A;  1E3X A;  1T5E A;  3G05 A;  4YEJ A;  3BCF A;  3BC9 A;  1COW A;  2V7Q A;  2ZZF A;  4KKT A;  2W6I A;  3OOC A;  4FXU A;  2F43 A;  4DK0 A;  4DK1 A;  2V31 A;  2GJP A;  3DDY A;  3OW7 A;  3ZPN A;  1HVX A;  4L8J A;  1OHH A;  2W6J A;  4XNF A;  5HKK A;  3GVL A;  4Z1M A;  4UZU A;  2XZP A;  2V4D A;  4XLA A;  2M5S A;  3GVK A;  4JMQ A;  4DNR B;  2HLD A;  2X8K A;  2WPD A;  3OAA A;  2KVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...