2V31A

Structure of first catalytic cysteine half-domain of mouse ubiquitin- activating enzyme
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
112
structure length
112
Chain Sequence
EFGEEMVLTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPASLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-ACTIVATING ENZYME E1 X
publication title Structure of First Catalytic Cysteine Half-Domain of Mouse Ubiquitin-Activating Enzyme
rcsb
molecule tags Ligase
total genus 8
structure length 112
sequence length 112
ec nomenclature ec 6.2.1.45: E1 ubiquitin-activating enzyme.
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.180 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2v31A01
4II2A 4NNJA 4P22A 5KNLA 2V31A 3CMMA 4II3A 2LZJA
chains in the Genus database with same CATH superfamily
2C77A 3A8JA 1E43A 3CD6B 2XNDA 5F4JA 1W34A 1QGYA 2WPDA 3ZC3A 5J3OA 3CCSB 1VQ5B 2NPFA 1FDRA 1V0EA 2W6IA 4XOPA 3ASQA 2V4DA 2BGIA 1CQXA 2OK7A 1PJ7A 4YHBA 5H59A 1FRNA 1H85A 5FIUA 2VJJA 3B82A 1VQ8B 1AMOA 3A3BA 2C78A 1JJ2B 2B7BA 1VQ4B 1VQ7B 1XE1A 4E0FA 1ZM9A 1D2EA 3W5UA 2DERA 1JB9A 1R5OA 1EFUA 4X7FA 4EH1A 5A8AA 1H42A 1EFRA 3ONYA 5THXA 2BV3A 4P2NA 1QFYA 2C2WA 3OE7A 1F60A 2VBTA 3LQEA 3Q6RA 4QHYA 2DOGA 3FKSA 1DARA 4PC1A 4WQMA 4M2LA 3VMFA 2BF4A 3HAGA 3OOCA 4G7WA 3R6KA 1GR1A 1VLYA 3OJWA 1IJEA 4TN1A 1HZEA 1PJ6A 2BSAA 1RQPA 4ACBA 3OEEA 1VQPB 3T53B 4LC0A 3WNBA 2R9VA 4PAAA 4RPDA 1OB0A 1EFCA 3RY8A 2ZBVA 3PVDA 1W0KA 2V7UA 3GVKA 4OPSA 1UD2A 3JQQA 1NDHA 1UD8A 3BY2A 1HVXA 4FXUA 4J0QA 4XONA 1Q86D 4X7EA 2WJYA 4JMQA 1ZM4A 2GJPA 4XL9A 2X6YA 1V0FA 2VNJA 2ZBUA 1EXMA 4LBYA 3OPOA 4XKVA 5TRDA 1ZM3A 3ISXA 4NNJA 1G7CA 4XLCA 3OZVA 1K9MD 4AC9A 2YWGA 3QFTA 4Z4TA 1FX0A 3ZIAA 4HE6A 3ZZUA 4UZFA 3B78A 1GO2A 4FN5A 1PKVA 1YJWB 2VBVA 3ASTA 5IYRA 1OHHA 1DG1G 2JN9A 3Q39A 4B47A 2PMDA 2XZOA 2X85A 2ZXIA 3Q3AA 1KD1D 3CCLB 2XNJA 3SEJA 1KQSB 4XLEA 4XOTA 2VNIA 2XGJA 3OW2B 5HZBA 3CTAA 4TSFA 3LQ6A 2E1RA 1VQ6B 1TLLA 2BPOA 4TMWA 2C5BA 5B6IA 3CMAB 4FWTA 1I8DA 2AHOA 4DQKA 4OPOA 2QDXA 3QFSA 4HIZA 5LMZA 2EFGA 1WSRA 3CMEB 5GV7A 4YXWA 2WJVA 1Q9SA 3CP8A 4YAOA 2EIXA 3AVXA 1Q7YD 1Y0YA 1KMHA 3MMPA 1WOPA 4DNTB 4QFMA 4LBZA 4XLAA 1IB0A 1BX1A 2QGGA 2Q6IA 5IYWA 3CCJB 4RD2A 4XN3A 1BX0A 3WNCA 3WBKA 2OBTA 2ZXHA 5H5JA 2X3UA 4AF6A 2ZITA 2C4UA 2WZNA 4Z4RA 4LBVA 1SKYB 2D3NA 2Z6BD 4G7XA 3A8IA 2F1LA 5KSWB 3CB4A 4RD4A 3W2GA 4B43A 4YAUA 1EFTA 1FNBA 1H8EA 5TV2A 2ZZQA 1HA3A 1QGZA 4X07A 1E3ZA 3QFRA 4M53A 4YAFA 2X6WA 4YEJA 3I56B 1N06A 3WNDA 4B3GA 4PC2A 4Z4WA 4BPRA 2QA4B 4PGOA 1Q81D 3V7AA 1F20A 4P3IA 2D3LA 1UD5A 2WYRA 3CESA 3SLNA 2P3MA 3JQPA 4H9GA 2X0KA 3OJXA 1DDIA 4G6IA 1JA0A 3W2HA 4WZTA 1QFJA 1H8HA 4QVJA 1QX4A 2DCUA 5IK2A 2V7VA 3GQBA 4OOXA 1NRKA 1VHOA 1W9XA 4UAJA 2R6HA 2V7TA 2KVOA 2ZL6A 4P26A 3VR6A 3ZUGA 1CNFA 4B3XA 1G7RA 1T6ZA 2PE3A 3P26A 3CCUB 1WU8A 3VNVA 1JNYA 2X8KA 3W2IA 4C0SA 4ZGQB 1GJRA 4XQFA 1BPLA 3CPWB 1VQNB 3VO1A 4II3A 3T51B 3CCQB 4RDLA 3ZPNA 4NBSA 1N0UA 2BN4A 3PUMA 4WZKA 4X0CA 2D9RA 2HMAA 1QVGB 1OGIA 5HZAA 3G71B 4PABA 4B48A 2DEUA 3WXMA 1XB2A 2OYNA 4ZCLA 1T5EA 4IW3B 4RPBA 3W2FA 3W5VA 2DIEA 3E20A 4FK8A 1K73D 1FNDA 2VBUA 2QN6A 2YWHA 2GREA 3A8KA 3U6BA 5DS0A 1Q82D 1RQRA 3D26A 1JA1A 3MHPA 3OAAA 3WYAA 4ZV4A 3A3GA 3CW2A 3SKBA 4R71A 3T56B 2I1LA 4ROXA 4F7DA 4XMYA 4Z1MA 1A8PA 4TMTA 1OB5A 4OOVA 3GIRA 1T6YA 3CC7B 4B44A 2JJ1A 3G05A 2X53S 3OEHA 3ONUA 3PA2A 2ZZGA 3A1PA 3FPPA 1UD3A 5DN6A 2QEXB 1I18A 1OB2A 4XD7A 1TUIA 4Y9UA 5F4OA 3CRZA 4M4SA 3VO2A 3E1YE 4P25A 1QGAA 1S4MA 2X6XA 3LVBA 5FNZA 5AN9A 4AVZA 4RD1A 3BCDA 1B23P 1XQBA 2JIZA 5FO0A 4N3NA 1W87A 3ASSA 3U2QA 4C43A 4KKSA 2PLFA 4P6VF 4X8IA 4TT3A 3SLDA 4Z4YA 2VNKA 2Q6OA 2GK7A 4P1VA 1N08A 4RD3A 1MABA 1FNCA 5HKKA 1Y0RA 2YWFA 4G1VA 4P22A 4OP7A 1COWA 1VLOA 5IYPA 3AGQA 1S0UA 3CCVB 1V5VA 3I1FA 4XN0A 1B2RA 3LO8A 3NE5B 1UD4A 3GVJA 3CXCB 1N07A 1K28D 3R6JA 1KK1A 3CMMA 1VHEA 3ASPA 4B3FX 4HE5A 5KW9A 2VZLA 4MYUA 4X7DA 4B4DA 3JQRA 3CCRB 2HDNB 1VQKB 3OKXA 4QVAA 2GQFA 1VQMB 4RM0A 3FPKA 1EWYA 3Q38A 3WY9A 2ZL7A 4QUZA 1W35A 4XLHA 5E6TA 4WWVA 1YHQB 1E62A 4LBWA 3PA1A 1QUEA 3OZUA 4MYTA 1VF7A 3CCMB 4TMZA 2GJRA 1M1KD 3AVVA 4XLFA 3H94A 1G7TA 1EP2B 1KZLA 3I55B 2C5HA 4KKUA 2V7QA 4ZGNB 4YALA 2XEXA 1VJSA 4ZCIA 1VQ9B 2ZTNA 4K1XA 3ZZTA 4DNRB 3AVYA 1QVFB 1R5NA 1J9ZA 2GJKA 2J7KA 4P9SA 3AVUA 2CF4A 3CC2B 5HXBA 3H9NA 3CP2A 4M1KA 2DETA 2BVNA 4ACAA 1TTTA 2YWEA 1BMFA 3B8HA 1FRQA 1YIJB 4RCYA 4RDKA 5L46A 2CBXA 1ZM2A 4YELA 1TVCA 1T6XA 3PENA 1WTHD 3BY1A 3QFCA 4N3GA 1P4MA 4DK1A 3P27A 2GK6A 2PIAA 5FO1A 2VNHA 2WSSA 1YI2B 2D74A 4II2A 2Q6LA 4AF7A 2ZL5A 4TMXA 3GSIA 1QFZA 5FA6A 2RC6A 2F4NA 2LZJA 1E79A 3VNUA 4XR6A 4Q7JB 1GAWA 3CC4B 1PJ5A 2QE7A 2V31A 5JBQA 2DY1A 2JJ2A 1M90D 1SM4A 2F43A 3SJPA 3G6EB 1WOOA 3JU4A 4TKOB 3J81k 1YJNB 2B5OA 3U6KA 1I7PA 2OBRA 2CRVA 1MRZA 2V7XA 3ZBUA 1KC8D 1NB0A 4UZEA 2ZZFA 1UMKA 1QH0A 1OGJA 1E64A 1GVHA 1WDTA 3BCFA 1E63A 3AVWA 4U9UA 5FL7A 1DDGA 1WORA 1BLIA 1WSVA 2CK3A 1WPCA 5IYNA 1YX2A 3FJOA 4M0LA 3CCEB 3AVTA 4NCNA 4OOSA 2CC2A 3QSYA 4YAWA 2WR8A 4TMVA 1G7SA 2NV4A 1NBMA 3SJZA 2BM1A 2FVGA 3OFNA 3A35A 2HCJB 3W2EA 5A88A 1D8TA 3Q6QA 5GV8A 1N05A 3KL9A 3ES9A 3G4SB 4PC7A 2FX3A 4ASUA 1N8RD 2BM0A 3BQJA 1W0JA 4UZUA 4OPVA 2OBSA 4CQJA 5DSZA 3BH4A 3ZZ0A 1WP6A 2XNCA 2JDIA 4QV2A 1EP3B 3CPXA 1U2RA 5TR9A 5BSYA 4GQNA 4P6YA 3ZBTA 3W5HA 2OTLB 2XZPA 2W6JA 4Y7CA 5F4MA 4Y9RA 3ASRA 1VQOB 1R5BA 1YLOA 3BNWA 2E1BA 2XOKA 2ZZEA 1UD6A 2C4TA 3OW7A 4XM3A 5KNLA 1S72B 3OP1A 3LNNA 2OTJB 1WOSA 4DQLA 3KEWA 4RDJA 4XKWA 1YITB 4X05A 2GPJA 3V76A 4G1BA 4PC3A 1YJ9B 2ZTGA 2HLDA 1IJFA 2VYQA 1E3XA 2B7CA 3GVLA 4Z4SA 1ELOA 5IYQA 5J35A 4WZEA 4Z4UA 2XZLA 2CNDA 1GAQA 4X7CA 4RD0A 1NJID 5CDFA 1KK0A 2OK8A 1KTVA 1N0VC 3WBJA 5EMNA 1CNEA 2DYIA 4RJLA 4Z4ZA 2M5SA 2RC5A 1W2BB 1E1QA 1D1NA 5TY0A 1KRHA 3WQZA 1EP1B 4WZLA 4XORA 4X06A 4ZCMA 2VBSA 4RD6A 1KK2A 2QTZA 1VQLB 4DK0A 2F1MA 2Q6KA 1XFOA 4PC6A 3BC9A 3MCAA 4KKTA 2V7WA 4Z4VA 3OZWA 2VJIA 2QMUA 4P12A 4RLZA 2CW5A 3AGPA 2BMWA 2WZPP 1AIPA 4RCZA 1BJKA 1QUFA 1ZUNB 2BGJA 1K8AD 1KJZA 1FNMA 1SKQA 1IHMA 1QG0A 2QTLA 1BQEA 4P3YA 1KK3A 4XNFA 3DDYA 4G5GA 3PUNA 1NB9A 3QE2A 5A89A 5BSXA 1E1RA 4L8JA
chains in the Genus database with same CATH topology
3BCDA 1E43A 2JIZA 4XLAA 2XNDA 2WPDA 2ZZFA 4KKSA 1V0EA 4XN3A 2W6IA 4TT3A 4XOPA 3BCFA 2V4DA 5FL7A 2ZXHA 1BLIA 2GK7A 2CK3A 1WPCA 1MABA 5HKKA 1SKYB 2D3NA 2Z6BD 4P22A 2VJJA 4G7XA 1COWA 3A3BA 1NBMA 4E0FA 3OFNA 3A35A 1H8EA 4XN0A 1EFRA 2ZZQA 3NE5B 1UD4A 3GVJA 1E3ZA 3OE7A 2X6WA 4YEJA 4ASUA 3FKSA 4B3GA 1K28D 3CMMA 4B3FX 1W0JA 4UZUA 2D3LA 3HAGA 1UD5A 3OOCA 4G7WA 3CESA 1VLYA 1HZEA 3BH4A 4G6IA 1WP6A 2JDIA 1H8HA 3OEEA 4XLHA 3T53B 2R9VA 4GQNA 1OB0A 2XZPA 2W6JA 1VF7A 5IK2A 4XM3A 3OW7A 2E1BA 2XOKA 1W0KA 1UD6A 2ZZEA 3GVKA 5KNLA 1UD2A 3GQBA 2GJRA 3LNNA 1UD8A 1W9XA 1HVXA 1NRKA 3H94A 3KEWA 4FXUA 2KVOA 4XKWA 4XLFA 3VR6A 1KZLA 4XONA 4KKUA 2WJYA 2V7QA 2ZTGA 2X8KA 4JMQA 2HLDA 2GJPA 4XL9A 2X6YA 1V0FA 1VJSA 1E3XA 4XQFA 2ZTNA 3GVLA 4DNRB 3OPOA 1BPLA 4XKVA 2XZLA 4NNJA 2GJKA 4XLCA 5CDFA 4II3A 3T51B 3ZPNA 3CP2A 1FX0A 3ZIAA 2M5SA 1BMFA 1E1QA 1PKVA 3WQZA 4XORA 1T5EA 2DIEA 1OHHA 2XZOA 4YELA 1KMHA 2X85A 2ZXIA 4DK0A 1WTHD 2F1MA 3OAAA 4XLEA 4XOTA 3A3GA 3BC9A 4DK1A 2GK6A 2XGJA 3T56B 4XMYA 2WSSA 4KKTA 4Z1MA 2VJIA 4II2A 4TSFA 2JJ1A 3G05A 2X53S 3OEHA 2WZPP 2ZZGA 2LZJA 1I8DA 3FPPA 1E79A 1UD3A 5DN6A 4XR6A 1I18A 4XD7A 4HIZA 2QE7A 4XNFA 2V31A 2JJ2A 4YXWA 3DDYA 2WJVA 3CP8A 2F43A 2X6XA 3JU4A 4TKOB 4AVZA 1E1RA 4L8JA 4DNTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II2 A;  4NNJ A;  4P22 A;  5KNL A;  2V31 A;  3CMM A;  4II3 A;  2LZJ A; 
#chains in the Genus database with same CATH topology
 2C77 A;  3A8J A;  1E43 A;  3CD6 B;  2XND A;  5F4J A;  1W34 A;  1QGY A;  2WPD A;  3ZC3 A;  5J3O A;  3CCS B;  1VQ5 B;  2NPF A;  1FDR A;  1V0E A;  2W6I A;  4XOP A;  3ASQ A;  2V4D A;  2BGI A;  1CQX A;  2OK7 A;  1PJ7 A;  4YHB A;  5H59 A;  1FRN A;  1H85 A;  5FIU A;  2VJJ A;  3B82 A;  1VQ8 B;  1AMO A;  3A3B A;  2C78 A;  1JJ2 B;  2B7B A;  1VQ4 B;  1VQ7 B;  1XE1 A;  4E0F A;  1ZM9 A;  1D2E A;  3W5U A;  2DER A;  1JB9 A;  1R5O A;  1EFU A;  4X7F A;  4EH1 A;  5A8A A;  1H42 A;  1EFR A;  3ONY A;  5THX A;  2BV3 A;  4P2N A;  1QFY A;  2C2W A;  3OE7 A;  1F60 A;  2VBT A;  3LQE A;  3Q6R A;  4QHY A;  2DOG A;  3FKS A;  1DAR A;  4PC1 A;  4WQM A;  4M2L A;  3VMF A;  2BF4 A;  3HAG A;  3OOC A;  4G7W A;  3R6K A;  1GR1 A;  1VLY A;  3OJW A;  1IJE A;  4TN1 A;  1HZE A;  1PJ6 A;  2BSA A;  1RQP A;  4ACB A;  3OEE A;  1VQP B;  3T53 B;  4LC0 A;  3WNB A;  2R9V A;  4PAA A;  4RPD A;  1OB0 A;  1EFC A;  3RY8 A;  2ZBV A;  3PVD A;  1W0K A;  2V7U A;  3GVK A;  4OPS A;  1UD2 A;  3JQQ A;  1NDH A;  1UD8 A;  3BY2 A;  1HVX A;  4FXU A;  4J0Q A;  4XON A;  1Q86 D;  4X7E A;  2WJY A;  4JMQ A;  1ZM4 A;  2GJP A;  4XL9 A;  2X6Y A;  1V0F A;  2VNJ A;  2ZBU A;  1EXM A;  4LBY A;  3OPO A;  4XKV A;  5TRD A;  1ZM3 A;  3ISX A;  4NNJ A;  1G7C A;  4XLC A;  3OZV A;  1K9M D;  4AC9 A;  2YWG A;  3QFT A;  4Z4T A;  1FX0 A;  3ZIA A;  4HE6 A;  3ZZU A;  4UZF A;  3B78 A;  1GO2 A;  4FN5 A;  1PKV A;  1YJW B;  2VBV A;  3AST A;  5IYR A;  1OHH A;  1DG1 G;  2JN9 A;  3Q39 A;  4B47 A;  2PMD A;  2XZO A;  2X85 A;  2ZXI A;  3Q3A A;  1KD1 D;  3CCL B;  2XNJ A;  3SEJ A;  1KQS B;  4XLE A;  4XOT A;  2VNI A;  2XGJ A;  3OW2 B;  5HZB A;  3CTA A;  4TSF A;  3LQ6 A;  2E1R A;  1VQ6 B;  1TLL A;  2BPO A;  4TMW A;  2C5B A;  5B6I A;  3CMA B;  4FWT A;  1I8D A;  2AHO A;  4DQK A;  4OPO A;  2QDX A;  3QFS A;  4HIZ A;  5LMZ A;  2EFG A;  1WSR A;  3CME B;  5GV7 A;  4YXW A;  2WJV A;  1Q9S A;  3CP8 A;  4YAO A;  2EIX A;  3AVX A;  1Q7Y D;  1Y0Y A;  1KMH A;  3MMP A;  1WOP A;  4DNT B;  4QFM A;  4LBZ A;  4XLA A;  1IB0 A;  1BX1 A;  2QGG A;  2Q6I A;  5IYW A;  3CCJ B;  4RD2 A;  4XN3 A;  1BX0 A;  3WNC A;  3WBK A;  2OBT A;  2ZXH A;  5H5J A;  2X3U A;  4AF6 A;  2ZIT A;  2C4U A;  2WZN A;  4Z4R A;  4LBV A;  1SKY B;  2D3N A;  2Z6B D;  4G7X A;  3A8I A;  2F1L A;  5KSW B;  3CB4 A;  4RD4 A;  3W2G A;  4B43 A;  4YAU A;  1EFT A;  1FNB A;  1H8E A;  5TV2 A;  2ZZQ A;  1HA3 A;  1QGZ A;  4X07 A;  1E3Z A;  3QFR A;  4M53 A;  4YAF A;  2X6W A;  4YEJ A;  3I56 B;  1N06 A;  3WND A;  4B3G A;  4PC2 A;  4Z4W A;  4BPR A;  2QA4 B;  4PGO A;  1Q81 D;  3V7A A;  1F20 A;  4P3I A;  2D3L A;  1UD5 A;  2WYR A;  3CES A;  3SLN A;  2P3M A;  3JQP A;  4H9G A;  2X0K A;  3OJX A;  1DDI A;  4G6I A;  1JA0 A;  3W2H A;  4WZT A;  1QFJ A;  1H8H A;  4QVJ A;  1QX4 A;  2DCU A;  5IK2 A;  2V7V A;  3GQB A;  4OOX A;  1NRK A;  1VHO A;  1W9X A;  4UAJ A;  2R6H A;  2V7T A;  2KVO A;  2ZL6 A;  4P26 A;  3VR6 A;  3ZUG A;  1CNF A;  4B3X A;  1G7R A;  1T6Z A;  2PE3 A;  3P26 A;  3CCU B;  1WU8 A;  3VNV A;  1JNY A;  2X8K A;  3W2I A;  4C0S A;  4ZGQ B;  1GJR A;  4XQF A;  1BPL A;  3CPW B;  1VQN B;  3VO1 A;  4II3 A;  3T51 B;  3CCQ B;  4RDL A;  3ZPN A;  4NBS A;  1N0U A;  2BN4 A;  3PUM A;  4WZK A;  4X0C A;  2D9R A;  2HMA A;  1QVG B;  1OGI A;  5HZA A;  3G71 B;  4PAB A;  4B48 A;  2DEU A;  3WXM A;  1XB2 A;  2OYN A;  4ZCL A;  1T5E A;  4IW3 B;  4RPB A;  3W2F A;  3W5V A;  2DIE A;  3E20 A;  4FK8 A;  1K73 D;  1FND A;  2VBU A;  2QN6 A;  2YWH A;  2GRE A;  3A8K A;  3U6B A;  5DS0 A;  1Q82 D;  1RQR A;  3D26 A;  1JA1 A;  3MHP A;  3OAA A;  3WYA A;  4ZV4 A;  3A3G A;  3CW2 A;  3SKB A;  4R71 A;  3T56 B;  2I1L A;  4ROX A;  4F7D A;  4XMY A;  4Z1M A;  1A8P A;  4TMT A;  1OB5 A;  4OOV A;  3GIR A;  1T6Y A;  3CC7 B;  4B44 A;  2JJ1 A;  3G05 A;  2X53 S;  3OEH A;  3ONU A;  3PA2 A;  2ZZG A;  3A1P A;  3FPP A;  1UD3 A;  5DN6 A;  2QEX B;  1I18 A;  1OB2 A;  4XD7 A;  1TUI A;  4Y9U A;  5F4O A;  3CRZ A;  4M4S A;  3VO2 A;  3E1Y E;  4P25 A;  1QGA A;  1S4M A;  2X6X A;  3LVB A;  5FNZ A;  5AN9 A;  4AVZ A;  4RD1 A;  3BCD A;  1B23 P;  1XQB A;  2JIZ A;  5FO0 A;  4N3N A;  1W87 A;  3ASS A;  3U2Q A;  4C43 A;  4KKS A;  2PLF A;  4P6V F;  4X8I A;  4TT3 A;  3SLD A;  4Z4Y A;  2VNK A;  2Q6O A;  2GK7 A;  4P1V A;  1N08 A;  4RD3 A;  1MAB A;  1FNC A;  5HKK A;  1Y0R A;  2YWF A;  4G1V A;  4P22 A;  4OP7 A;  1COW A;  1VLO A;  5IYP A;  3AGQ A;  1S0U A;  3CCV B;  1V5V A;  3I1F A;  4XN0 A;  1B2R A;  3LO8 A;  3NE5 B;  1UD4 A;  3GVJ A;  3CXC B;  1N07 A;  1K28 D;  3R6J A;  1KK1 A;  3CMM A;  1VHE A;  3ASP A;  4B3F X;  4HE5 A;  5KW9 A;  2VZL A;  4MYU A;  4X7D A;  4B4D A;  3JQR A;  3CCR B;  2HDN B;  1VQK B;  3OKX A;  4QVA A;  2GQF A;  1VQM B;  4RM0 A;  3FPK A;  1EWY A;  3Q38 A;  3WY9 A;  2ZL7 A;  4QUZ A;  1W35 A;  4XLH A;  5E6T A;  4WWV A;  1YHQ B;  1E62 A;  4LBW A;  3PA1 A;  1QUE A;  3OZU A;  4MYT A;  1VF7 A;  3CCM B;  4TMZ A;  2GJR A;  1M1K D;  3AVV A;  4XLF A;  3H94 A;  1G7T A;  1EP2 B;  1KZL A;  3I55 B;  2C5H A;  4KKU A;  2V7Q A;  4ZGN B;  4YAL A;  2XEX A;  1VJS A;  4ZCI A;  1VQ9 B;  2ZTN A;  4K1X A;  3ZZT A;  4DNR B;  3AVY A;  1QVF B;  1R5N A;  1J9Z A;  2GJK A;  2J7K A;  4P9S A;  3AVU A;  2CF4 A;  3CC2 B;  5HXB A;  3H9N A;  3CP2 A;  4M1K A;  2DET A;  2BVN A;  4ACA A;  1TTT A;  2YWE A;  1BMF A;  3B8H A;  1FRQ A;  1YIJ B;  4RCY A;  4RDK A;  5L46 A;  2CBX A;  1ZM2 A;  4YEL A;  1TVC A;  1T6X A;  3PEN A;  1WTH D;  3BY1 A;  3QFC A;  4N3G A;  1P4M A;  4DK1 A;  3P27 A;  2GK6 A;  2PIA A;  5FO1 A;  2VNH A;  2WSS A;  1YI2 B;  2D74 A;  4II2 A;  2Q6L A;  4AF7 A;  2ZL5 A;  4TMX A;  3GSI A;  1QFZ A;  5FA6 A;  2RC6 A;  2F4N A;  2LZJ A;  1E79 A;  3VNU A;  4XR6 A;  4Q7J B;  1GAW A;  3CC4 B;  1PJ5 A;  2QE7 A;  2V31 A;  5JBQ A;  2DY1 A;  2JJ2 A;  1M90 D;  1SM4 A;  2F43 A;  3SJP A;  3G6E B;  1WOO A;  3JU4 A;  4TKO B;  3J81 k;  1YJN B;  2B5O A;  3U6K A;  1I7P A;  2OBR A;  2CRV A;  1MRZ A;  2V7X A;  3ZBU A;  1KC8 D;  1NB0 A;  4UZE A;  2ZZF A;  1UMK A;  1QH0 A;  1OGJ A;  1E64 A;  1GVH A;  1WDT A;  3BCF A;  1E63 A;  3AVW A;  4U9U A;  5FL7 A;  1DDG A;  1WOR A;  1BLI A;  1WSV A;  2CK3 A;  1WPC A;  5IYN A;  1YX2 A;  3FJO A;  4M0L A;  3CCE B;  3AVT A;  4NCN A;  4OOS A;  2CC2 A;  3QSY A;  4YAW A;  2WR8 A;  4TMV A;  1G7S A;  2NV4 A;  1NBM A;  3SJZ A;  2BM1 A;  2FVG A;  3OFN A;  3A35 A;  2HCJ B;  3W2E A;  5A88 A;  1D8T A;  3Q6Q A;  5GV8 A;  1N05 A;  3KL9 A;  3ES9 A;  3G4S B;  4PC7 A;  2FX3 A;  4ASU A;  1N8R D;  2BM0 A;  3BQJ A;  1W0J A;  4UZU A;  4OPV A;  2OBS A;  4CQJ A;  5DSZ A;  3BH4 A;  3ZZ0 A;  1WP6 A;  2XNC A;  2JDI A;  4QV2 A;  1EP3 B;  3CPX A;  1U2R A;  5TR9 A;  5BSY A;  4GQN A;  4P6Y A;  3ZBT A;  3W5H A;  2OTL B;  2XZP A;  2W6J A;  4Y7C A;  5F4M A;  4Y9R A;  3ASR A;  1VQO B;  1R5B A;  1YLO A;  3BNW A;  2E1B A;  2XOK A;  2ZZE A;  1UD6 A;  2C4T A;  3OW7 A;  4XM3 A;  5KNL A;  1S72 B;  3OP1 A;  3LNN A;  2OTJ B;  1WOS A;  4DQL A;  3KEW A;  4RDJ A;  4XKW A;  1YIT B;  4X05 A;  2GPJ A;  3V76 A;  4G1B A;  4PC3 A;  1YJ9 B;  2ZTG A;  2HLD A;  1IJF A;  2VYQ A;  1E3X A;  2B7C A;  3GVL A;  4Z4S A;  1ELO A;  5IYQ A;  5J35 A;  4WZE A;  4Z4U A;  2XZL A;  2CND A;  1GAQ A;  4X7C A;  4RD0 A;  1NJI D;  5CDF A;  1KK0 A;  2OK8 A;  1KTV A;  1N0V C;  3WBJ A;  5EMN A;  1CNE A;  2DYI A;  4RJL A;  4Z4Z A;  2M5S A;  2RC5 A;  1W2B B;  1E1Q A;  1D1N A;  5TY0 A;  1KRH A;  3WQZ A;  1EP1 B;  4WZL A;  4XOR A;  4X06 A;  4ZCM A;  2VBS A;  4RD6 A;  1KK2 A;  2QTZ A;  1VQL B;  4DK0 A;  2F1M A;  2Q6K A;  1XFO A;  4PC6 A;  3BC9 A;  3MCA A;  4KKT A;  2V7W A;  4Z4V A;  3OZW A;  2VJI A;  2QMU A;  4P12 A;  4RLZ A;  2CW5 A;  3AGP A;  2BMW A;  2WZP P;  1AIP A;  4RCZ A;  1BJK A;  1QUF A;  1ZUN B;  2BGJ A;  1K8A D;  1KJZ A;  1FNM A;  1SKQ A;  1IHM A;  1QG0 A;  2QTL A;  1BQE A;  4P3Y A;  1KK3 A;  4XNF A;  3DDY A;  4G5G A;  3PUN A;  1NB9 A;  3QE2 A;  5A89 A;  5BSX A;  1E1R A;  4L8J A; 
#chains in the Genus database with same CATH homology
 3BCD A;  1E43 A;  2JIZ A;  4XLA A;  2XND A;  2WPD A;  2ZZF A;  4KKS A;  1V0E A;  4XN3 A;  2W6I A;  4TT3 A;  4XOP A;  3BCF A;  2V4D A;  5FL7 A;  2ZXH A;  1BLI A;  2GK7 A;  2CK3 A;  1WPC A;  1MAB A;  5HKK A;  1SKY B;  2D3N A;  2Z6B D;  4P22 A;  2VJJ A;  4G7X A;  1COW A;  3A3B A;  1NBM A;  4E0F A;  3OFN A;  3A35 A;  1H8E A;  4XN0 A;  1EFR A;  2ZZQ A;  3NE5 B;  1UD4 A;  3GVJ A;  1E3Z A;  3OE7 A;  2X6W A;  4YEJ A;  4ASU A;  3FKS A;  4B3G A;  1K28 D;  3CMM A;  4B3F X;  1W0J A;  4UZU A;  2D3L A;  3HAG A;  1UD5 A;  3OOC A;  4G7W A;  3CES A;  1VLY A;  1HZE A;  3BH4 A;  4G6I A;  1WP6 A;  2JDI A;  1H8H A;  3OEE A;  4XLH A;  3T53 B;  2R9V A;  4GQN A;  1OB0 A;  2XZP A;  2W6J A;  1VF7 A;  5IK2 A;  4XM3 A;  3OW7 A;  2E1B A;  2XOK A;  1W0K A;  1UD6 A;  2ZZE A;  3GVK A;  5KNL A;  1UD2 A;  3GQB A;  2GJR A;  3LNN A;  1UD8 A;  1W9X A;  1HVX A;  1NRK A;  3H94 A;  3KEW A;  4FXU A;  2KVO A;  4XKW A;  4XLF A;  3VR6 A;  1KZL A;  4XON A;  4KKU A;  2WJY A;  2V7Q A;  2ZTG A;  2X8K A;  4JMQ A;  2HLD A;  2GJP A;  4XL9 A;  2X6Y A;  1V0F A;  1VJS A;  1E3X A;  4XQF A;  2ZTN A;  3GVL A;  4DNR B;  3OPO A;  1BPL A;  4XKV A;  2XZL A;  4NNJ A;  2GJK A;  4XLC A;  5CDF A;  4II3 A;  3T51 B;  3ZPN A;  3CP2 A;  1FX0 A;  3ZIA A;  2M5S A;  1BMF A;  1E1Q A;  1PKV A;  3WQZ A;  4XOR A;  1T5E A;  2DIE A;  1OHH A;  2XZO A;  4YEL A;  1KMH A;  2X85 A;  2ZXI A;  4DK0 A;  1WTH D;  2F1M A;  3OAA A;  4XLE A;  4XOT A;  3A3G A;  3BC9 A;  4DK1 A;  2GK6 A;  2XGJ A;  3T56 B;  4XMY A;  2WSS A;  4KKT A;  4Z1M A;  2VJI A;  4II2 A;  4TSF A;  2JJ1 A;  3G05 A;  2X53 S;  3OEH A;  2WZP P;  2ZZG A;  2LZJ A;  1I8D A;  3FPP A;  1E79 A;  1UD3 A;  5DN6 A;  4XR6 A;  1I18 A;  4XD7 A;  4HIZ A;  2QE7 A;  4XNF A;  2V31 A;  2JJ2 A;  4YXW A;  3DDY A;  2WJV A;  3CP8 A;  2F43 A;  2X6X A;  3JU4 A;  4TKO B;  4AVZ A;  1E1R A;  4L8J A;  4DNT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...