2V31A

Structure of first catalytic cysteine half-domain of mouse ubiquitin- activating enzyme
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
112
structure length
112
Chain Sequence
EFGEEMVLTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPASLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-ACTIVATING ENZYME E1 X
publication title Structure of First Catalytic Cysteine Half-Domain of Mouse Ubiquitin-Activating Enzyme
rcsb
molecule tags Ligase
total genus 8
structure length 112
sequence length 112
ec nomenclature ec 6.2.1.45: E1 ubiquitin-activating enzyme.
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.180 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2v31A01
4P22A 2V31A 3CMMA 5KNLA 4II2A 2LZJA 4NNJA 4II3A
chains in the Genus database with same CATH superfamily
1UD6A 1WDTA 3OZVA 1WP6A 2VZLA 4M0LA 4X7CA 1PJ5A 2NPFA 4PC2A 4DNRB 4Z4ZA 4HIZA 4FXUA 4Z4YA 3VR6A 3CB4A 1T5EA 4XNFA 2F43A 2BM0A 3BC9A 3Q39A 2WPDA 1GAWA 5FNZA 3CD6B 4ZCLA 1EWYA 3QFRA 1KD1D 3ASSA 4WWVA 2OK8A 3ASRA 1K9MD 4PGOA 2JIZA 3FPPA 3R6KA 2QMUA 2V7VA 4XORA 1GAQA 2W6IA 3QE2A 5TY0A 2WZPP 1S0UA 4B3XA 3HAGA 1KK2A 4GQNA 3Q6QA 2QEXB 3ZZTA 2VBTA 3WNCA 1NB9A 3ES9A 3A3BA 5F4OA 4B44A 2X8KA 4P1VA 4J0QA 4RD0A 4RCZA 3CMMA 3A8JA 2HCJB 1N08A 3BH4A 4B3GA 1W35A 4UZEA 1KK1A 3OKXA 3CRZA 3Q6RA 4OOXA 2XZLA 3LQ6A 1FNMA 1VQMB 1HA3A 3ZC3A 4B43A 3ONUA 3BCDA 1NBMA 1VQ8B 4RDJA 1V0FA 3T51B 4B3FX 5THXA 2Q6LA 1BJKA 1YI2B 1AMOA 1KRHA 3CCSB 3VO2A 3ONYA 2QA4B 1D2EA 1NB0A 1KTVA 1VLYA 2ZZEA 1QG0A 1VQ4B 2BVNA 3A35A 1V5VA 3GVJA 2VBUA 2Z6BD 4Z4RA 3D26A 1KQSB 1PKVA 2M5SA 4RPBA 4Z4SA 4X7DA 4X7EA 4Z4TA 2XGJA 1I8DA 3OEEA 3OJWA 3AVYA 3W2IA 1FNBA 1EP1B 4N3NA 4RD1A 3CCEB 1KZLA 1BLIA 2VJJA 2BPOA 4G1VA 4YAWA 1K73D 3OZWA 4II3A 3U6BA 3LQEA 4JMQA 2X53S 2PLFA 4Z4VA 3GSIA 1WTHD 2BSAA 1VHEA 5FIUA 2BN4A 1H85A 3ZIAA 2WSSA 4G7WA 3J81k 3CPXA 1Q81D 2QGGA 1E3ZA 3CCLB 4QUZA 4E0FA 4P3YA 2VBVA 5IYRA 3CESA 3AVXA 1W34A 4P9SA 3AVVA 3R6JA 5FA6A 5JBQA 2E1BA 1VQ6B 4XKVA 1UD2A 3KL9A 1I7PA 4LBZA 3OP1A 2BGJA 3CP2A 4RD4A 1UD8A 4P26A 3FJOA 4DQKA 2WYRA 2FVGA 1EP2B 4ACAA 3QSYA 4TKOB 2ZL7A 3WY9A 2XNJA 1QFZA 1XFOA 4X8IA 1QGYA 2ZBVA 2HMAA 1TLLA 3T53B 5IYPA 1UMKA 3NE5B 4WQMA 4XOPA 4RJLA 2EIXA 3ASPA 4TMVA 1PJ6A 1CNFA 1E64A 2DIEA 3FKSA 2GQFA 5IK2A 3JQPA 1BQEA 3ZBTA 4ZCMA 1TUIA 4XOTA 3CCJB 5DN6A 2QN6A 1YJNB 2ZZFA 4BPRA 1UD5A 1VLOA 4XD7A 3DDYA 2C2WA 3ASQA 1VF7A 3CCRB 1FRQA 3OPOA 4RD3A 1DDGA 1OGIA 2DOGA 1YJWB 3JU4A 2AHOA 2DCUA 2CBXA 2D3LA 4FK8A 4X0CA 3VO1A 4II2A 4LBWA 3ZPNA 2RC5A 2ZL6A 1WOSA 4NCNA 3ZZUA 2DERA 3AGPA 2F1LA 2GJPA 3CW2A 4AC9A 3GIRA 1E3XA 3MCAA 5DSZA 2DY1A 4RM0A 4KKUA 2VYQA 1ZM2A 4OPSA 1QGAA 1Y0RA 4TSFA 3AVUA 3CXCB 4Z1MA 4TMTA 3SEJA 1N0VC 3JQRA 4QHYA 1IJEA 1YX2A 4RD6A 1G7CA 3Q3AA 4YHBA 3PUNA 1VQLB 1F20A 3JQQA 2ZBUA 4M2LA 3SLDA 4OOVA 1GVHA 4P6YA 4XM3A 3FPKA 5BSXA 3OW7A 2X3UA 5TR9A 4ZV4A 2WJVA 3CMEB 3PENA 1GR1A 1E62A 4UZUA 3CCQB 3OZUA 4L8JA 1QUEA 3B82A 4LBYA 5IYWA 2W6JA 2OTLB 2QE7A 4AF7A 4X7FA 4M4SA 4P3IA 1VJSA 5HXBA 1SM4A 1T6XA 3CC7B 2WR8A 4OOSA 1H8EA 1BX1A 1XB2A 1NRKA 4YAUA 1B2RA 4XLFA 1YJ9B 1NDHA 1OGJA 3BY2A 4K1XA 4Z4UA 4Y9UA 2F4NA 3MHPA 1DG1G 2B5OA 4G1BA 2NV4A 1ELOA 2JN9A 4PAAA 4Y7CA 3G6EB 2C4TA 2YWFA 2DETA 1WU8A 4UAJA 1FDRA 3GVLA 1QVFB 4G7XA 4XLHA 1F60A 2ZXHA 3PA2A 4YXWA 2XOKA 1IJFA 2C5HA 2EFGA 3MMPA 1N8RD 1Q7YD 2V7QA 4C0SA 5A88A 4ACBA 1P4MA 3SLNA 5A8AA 3PUMA 1EXMA 2B7CA 2VNJA 1QH0A 4TMWA 2BMWA 1E63A 2ZXIA 4NBSA 2V4DA 1YHQB 3W5UA 4XQFA 2KVOA 4QVJA 4XLAA 1E1QA 1EFCA 3ZUGA 2V31A 1H8HA 2BV3A 1E43A 1N05A 4MYTA 3LVBA 3OJXA 4F7DA 1WPCA 4M1KA 5E6TA 3ISXA 1M1KD 3ZZ0A 1D8TA 3BQJA 1W2BB 4CQJA 1EFRA 1UD3A 3VNUA 3WBKA 4XN3A 3G05A 1N07A 5L46A 1UD4A 1PJ7A 4RD2A 4YALA 4N3GA 2DEUA 1WORA 2J7KA 2JDIA 3VNVA 5F4JA 2XEXA 4QV2A 1RQPA 2Q6OA 3W2FA 4TMXA 3B78A 5A89A 5GV8A 1WOPA 3T56B 3OFNA 4TT3A 2C5BA 1G7SA 1V0EA 4Y9RA 4P22A 4WZTA 5FO0A 2YWEA 5LMZA 2LZJA 4NNJA 1Q82D 4IW3B 3QFCA 1K8AD 4FN5A 1G7RA 1W0KA 4XN0A 3WBJA 1GJRA 2ZITA 1QUFA 2CNDA 1I18A 1WSRA 2CK3A 2VJIA 5J35A 3SKBA 1ZM4A 1IHMA 1ZUNB 3I1FA 1FNCA 3WNBA 2XNCA 3PA1A 2Q6IA 4XONA 1N0UA 1MRZA 2OYNA 4RDKA 3WQZA 1TVCA 2C78A 2JJ2A 3CMAB 3CCMB 1XE1A 4ROXA 1VQPB 1W87A 1R5NA 2GJKA 3CC4B 1QVGB 3PVDA 3QFTA 1BMFA 2B7BA 2CF4A 1JJ2B 4DNTB 2X6XA 1DDIA 1JNYA 3LO8A 3GQBA 4YELA 3U6KA 3G71B 2YWGA 1B23P 4AVZA 1OB0A 2GK7A 3BY1A 4UZFA 4G5GA 5GV7A 4XR6A 1E79A 2OBRA 4X06A 3AGQA 4XL9A 2PE3A 1E1RA 2ZL5A 2WZNA 1JB9A 4WZEA 1VQOB 2WJYA 2F1MA 3V7AA 1G7TA 2VBSA 5IYNA 1AIPA 1VQ7B 4XLCA 4LBVA 2CW5A 4XLEA 3WXMA 3I55B 1VQ5B 1MABA 5TRDA 3B8HA 4DK1A 2C77A 1M90D 1JA1A 3RY8A 3BNWA 1CNEA 2XZOA 1RQRA 5IYQA 3WNDA 4C43A 4ASUA 1ZM3A 3H94A 5HKKA 3GVKA 4DK0A 1YITB 1YIJB 3W2HA 1SKYB 3ASTA 4OP7A 2R9VA 1XQBA 2XZPA 3W5VA 3LNNA 1Q9SA 4P25A 1KC8D 3W2GA 1EP3B 2X6YA 4PC6A 1BPLA 4HE5A 1IB0A 1WOOA 4PC3A 2HLDA 4OPOA 2YWHA 3W2EA 4RCYA 4EH1A 1NJID 2X0KA 1OB5A 1FNDA 1KMHA 1W9XA 2I1LA 1QGZA 1T6ZA 3BCFA 5AN9A 1VHOA 1R5OA 1S72B 3V76A 2X85A 2CC2A 5KNLA 1COWA 1JA0A 4XMYA 2D74A 3CCUB 1FRNA 2V7WA 1N06A 5KW9A 3AVWA 3KEWA 3H9NA 4P6VF 1WSVA 5F4MA 3OW2B 5TV2A 4H9GA 5H5JA 2XNDA 3E1YE 1VQKB 4TN1A 5J3OA 4X07A 2DYIA 5B6IA 1ZM9A 2VNIA 1KK0A 4G6IA 3CCVB 1BX0A 2QTLA 2X6WA 1Q86D 4X05A 3OEHA 3AVTA 3CP8A 2RC6A 4QFMA 4PABA 3OOCA 1H42A 1QFYA 2OK7A 3A8IA 2OBTA 2VNKA 2BGIA 5FO1A 1TTTA 5BSYA 2ZTGA 4AF6A 4ZGQB 4KKTA 2PMDA 4PC7A 2GPJA 4OPVA 2GJRA 4XKWA 3P26A 3CC2B 2ZZQA 1OB2A 1R5BA 1VQNB 2Q6KA 2QDXA 2BF4A 2R6HA 4HE6A 4U9UA 3SJPA 3W5HA 3QFSA 4ZGNB 3WYAA 1KK3A 1W0JA 3U2QA 2BM1A 1EFTA 2D3NA 1D1NA 4MYUA 2GREA 2CRVA 2ZZGA 4RLZA 4YAOA 5KSWB 4B4DA 3SJZA 5FL7A 3I56B 2GK6A 4WZLA 4B47A 4P2NA 3A3GA 1T6YA 2QTZA 5H59A 1A8PA 1QFJA 2OTJB 5CDFA 2FX3A 4YEJA 1U2RA 2E1RA 2HDNB 3VMFA 3OE7A 1QX4A 1S4MA 1HVXA 3Q38A 4RPDA 3OAAA 1K28D 4Q7JB 2V7TA 3A8KA 5DS0A 5HZBA 4M53A 2VNHA 4PC1A 3A1PA 1Y0YA 2OBSA 2P3MA 3E20A 1SKQA 1OHHA 1FX0A 1HZEA 1KJZA 2V7XA 3ZBUA 3P27A 3CPWB 1VQ9B 4TMZA 5EMNA 4P12A 4ZCIA 2D9RA 4WZKA 4DQLA 4YAFA 4B48A 3G4SB 1CQXA 1YLOA 4RDLA 2PIAA 3CTAA 1EFUA 4R71A 4KKSA 2ZTNA 1GO2A 2C4UA 4QVAA 5HZAA 1J9ZA 4LC0A 1DARA 2V7UA 4Z4WA 4FWTA 2JJ1A
chains in the Genus database with same CATH topology
2ZXIA 1UD6A 1WP6A 2X6YA 2V4DA 1BPLA 2HLDA 4XQFA 3T53B 2KVOA 4XLAA 4DNRB 1KMHA 1W9XA 3BCFA 1E1QA 3NE5B 4HIZA 4FXUA 2V31A 3VR6A 1T5EA 1H8HA 1E43A 2X85A 4XNFA 2F43A 4XOPA 1WPCA 3BC9A 2WPDA 2DIEA 3FKSA 1EFRA 1UD3A 5IK2A 5KNLA 1COWA 3G05A 4XN3A 4XOTA 2JIZA 1UD4A 5DN6A 3FPPA 4XMYA 4XORA 2ZZFA 2W6IA 1UD5A 3KEWA 4XD7A 2WZPP 3DDYA 3HAGA 4GQNA 2JDIA 1VF7A 2XNDA 3OPOA 3A3BA 1I18A 2X8KA 3JU4A 2D3LA 3BH4A 3CMMA 4B3GA 4II2A 4G6IA 3T56B 3OFNA 4TT3A 3ZPNA 1V0EA 2X6WA 2XZLA 4P22A 2GJPA 3OEHA 1E3XA 2LZJA 3CP8A 4NNJA 3BCDA 1NBMA 4KKUA 3OOCA 1V0FA 3T51B 4B3FX 1W0KA 4XN0A 4TSFA 4Z1MA 2ZTGA 4KKTA 2CK3A 2VJIA 2ZZEA 1VLYA 4XKWA 2GJRA 2ZZQA 3A35A 4XM3A 3GVJA 4XONA 2Z6BD 3WQZA 1PKVA 2JJ2A 3OW7A 1W0JA 2M5SA 2GJKA 2D3NA 2ZZGA 2XGJA 1BMFA 2WJVA 1I8DA 3OEEA 5FL7A 4UZUA 4DNTB 2X6XA 2GK6A 4L8JA 3GQBA 4YELA 3A3GA 4AVZA 5CDFA 1OB0A 2GK7A 1KZLA 1BLIA 2QE7A 2VJJA 2W6JA 4YEJA 4XR6A 1VJSA 1E79A 4II3A 3OE7A 1HVXA 1H8EA 4JMQA 4XL9A 1NRKA 3OAAA 1K28D 1E1RA 2X53S 4XLFA 1WTHD 2WJYA 2F1MA 3ZIAA 2WSSA 4G7WA 4XLCA 1OHHA 1E3ZA 1FX0A 1HZEA 4E0FA 4XLEA 3CESA 1MABA 4DK1A 3GVLA 4G7XA 4XLHA 2E1BA 2XZOA 2ZXHA 4YXWA 4XKVA 1UD2A 4ASUA 2XOKA 3H94A 5HKKA 3GVKA 4DK0A 3CP2A 4KKSA 1UD8A 1SKYB 2R9VA 2ZTNA 2V7QA 2XZPA 3LNNA 4TKOB 2JJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P22 A;  2V31 A;  3CMM A;  5KNL A;  4II2 A;  2LZJ A;  4NNJ A;  4II3 A; 
#chains in the Genus database with same CATH topology
 1UD6 A;  1WDT A;  3OZV A;  1WP6 A;  2VZL A;  4M0L A;  4X7C A;  1PJ5 A;  2NPF A;  4PC2 A;  4DNR B;  4Z4Z A;  4HIZ A;  4FXU A;  4Z4Y A;  3VR6 A;  3CB4 A;  1T5E A;  4XNF A;  2F43 A;  2BM0 A;  3BC9 A;  3Q39 A;  2WPD A;  1GAW A;  5FNZ A;  3CD6 B;  4ZCL A;  1EWY A;  3QFR A;  1KD1 D;  3ASS A;  4WWV A;  2OK8 A;  3ASR A;  1K9M D;  4PGO A;  2JIZ A;  3FPP A;  3R6K A;  2QMU A;  2V7V A;  4XOR A;  1GAQ A;  2W6I A;  3QE2 A;  5TY0 A;  2WZP P;  1S0U A;  4B3X A;  3HAG A;  1KK2 A;  4GQN A;  3Q6Q A;  2QEX B;  3ZZT A;  2VBT A;  3WNC A;  1NB9 A;  3ES9 A;  3A3B A;  5F4O A;  4B44 A;  2X8K A;  4P1V A;  4J0Q A;  4RD0 A;  4RCZ A;  3CMM A;  3A8J A;  2HCJ B;  1N08 A;  3BH4 A;  4B3G A;  1W35 A;  4UZE A;  1KK1 A;  3OKX A;  3CRZ A;  3Q6R A;  4OOX A;  2XZL A;  3LQ6 A;  1FNM A;  1VQM B;  1HA3 A;  3ZC3 A;  4B43 A;  3ONU A;  3BCD A;  1NBM A;  1VQ8 B;  4RDJ A;  1V0F A;  3T51 B;  4B3F X;  5THX A;  2Q6L A;  1BJK A;  1YI2 B;  1AMO A;  1KRH A;  3CCS B;  3VO2 A;  3ONY A;  2QA4 B;  1D2E A;  1NB0 A;  1KTV A;  1VLY A;  2ZZE A;  1QG0 A;  1VQ4 B;  2BVN A;  3A35 A;  1V5V A;  3GVJ A;  2VBU A;  2Z6B D;  4Z4R A;  3D26 A;  1KQS B;  1PKV A;  2M5S A;  4RPB A;  4Z4S A;  4X7D A;  4X7E A;  4Z4T A;  2XGJ A;  1I8D A;  3OEE A;  3OJW A;  3AVY A;  3W2I A;  1FNB A;  1EP1 B;  4N3N A;  4RD1 A;  3CCE B;  1KZL A;  1BLI A;  2VJJ A;  2BPO A;  4G1V A;  4YAW A;  1K73 D;  3OZW A;  4II3 A;  3U6B A;  3LQE A;  4JMQ A;  2X53 S;  2PLF A;  4Z4V A;  3GSI A;  1WTH D;  2BSA A;  1VHE A;  5FIU A;  2BN4 A;  1H85 A;  3ZIA A;  2WSS A;  4G7W A;  3J81 k;  3CPX A;  1Q81 D;  2QGG A;  1E3Z A;  3CCL B;  4QUZ A;  4E0F A;  4P3Y A;  2VBV A;  5IYR A;  3CES A;  3AVX A;  1W34 A;  4P9S A;  3AVV A;  3R6J A;  5FA6 A;  5JBQ A;  2E1B A;  1VQ6 B;  4XKV A;  1UD2 A;  3KL9 A;  1I7P A;  4LBZ A;  3OP1 A;  2BGJ A;  3CP2 A;  4RD4 A;  1UD8 A;  4P26 A;  3FJO A;  4DQK A;  2WYR A;  2FVG A;  1EP2 B;  4ACA A;  3QSY A;  4TKO B;  2ZL7 A;  3WY9 A;  2XNJ A;  1QFZ A;  1XFO A;  4X8I A;  1QGY A;  2ZBV A;  2HMA A;  1TLL A;  3T53 B;  5IYP A;  1UMK A;  3NE5 B;  4WQM A;  4XOP A;  4RJL A;  2EIX A;  3ASP A;  4TMV A;  1PJ6 A;  1CNF A;  1E64 A;  2DIE A;  3FKS A;  2GQF A;  5IK2 A;  3JQP A;  1BQE A;  3ZBT A;  4ZCM A;  1TUI A;  4XOT A;  3CCJ B;  5DN6 A;  2QN6 A;  1YJN B;  2ZZF A;  4BPR A;  1UD5 A;  1VLO A;  4XD7 A;  3DDY A;  2C2W A;  3ASQ A;  1VF7 A;  3CCR B;  1FRQ A;  3OPO A;  4RD3 A;  1DDG A;  1OGI A;  2DOG A;  1YJW B;  3JU4 A;  2AHO A;  2DCU A;  2CBX A;  2D3L A;  4FK8 A;  4X0C A;  3VO1 A;  4II2 A;  4LBW A;  3ZPN A;  2RC5 A;  2ZL6 A;  1WOS A;  4NCN A;  3ZZU A;  2DER A;  3AGP A;  2F1L A;  2GJP A;  3CW2 A;  4AC9 A;  3GIR A;  1E3X A;  3MCA A;  5DSZ A;  2DY1 A;  4RM0 A;  4KKU A;  2VYQ A;  1ZM2 A;  4OPS A;  1QGA A;  1Y0R A;  4TSF A;  3AVU A;  3CXC B;  4Z1M A;  4TMT A;  3SEJ A;  1N0V C;  3JQR A;  4QHY A;  1IJE A;  1YX2 A;  4RD6 A;  1G7C A;  3Q3A A;  4YHB A;  3PUN A;  1VQL B;  1F20 A;  3JQQ A;  2ZBU A;  4M2L A;  3SLD A;  4OOV A;  1GVH A;  4P6Y A;  4XM3 A;  3FPK A;  5BSX A;  3OW7 A;  2X3U A;  5TR9 A;  4ZV4 A;  2WJV A;  3CME B;  3PEN A;  1GR1 A;  1E62 A;  4UZU A;  3CCQ B;  3OZU A;  4L8J A;  1QUE A;  3B82 A;  4LBY A;  5IYW A;  2W6J A;  2OTL B;  2QE7 A;  4AF7 A;  4X7F A;  4M4S A;  4P3I A;  1VJS A;  5HXB A;  1SM4 A;  1T6X A;  3CC7 B;  2WR8 A;  4OOS A;  1H8E A;  1BX1 A;  1XB2 A;  1NRK A;  4YAU A;  1B2R A;  4XLF A;  1YJ9 B;  1NDH A;  1OGJ A;  3BY2 A;  4K1X A;  4Z4U A;  4Y9U A;  2F4N A;  3MHP A;  1DG1 G;  2B5O A;  4G1B A;  2NV4 A;  1ELO A;  2JN9 A;  4PAA A;  4Y7C A;  3G6E B;  2C4T A;  2YWF A;  2DET A;  1WU8 A;  4UAJ A;  1FDR A;  3GVL A;  1QVF B;  4G7X A;  4XLH A;  1F60 A;  2ZXH A;  3PA2 A;  4YXW A;  2XOK A;  1IJF A;  2C5H A;  2EFG A;  3MMP A;  1N8R D;  1Q7Y D;  2V7Q A;  4C0S A;  5A88 A;  4ACB A;  1P4M A;  3SLN A;  5A8A A;  3PUM A;  1EXM A;  2B7C A;  2VNJ A;  1QH0 A;  4TMW A;  2BMW A;  1E63 A;  2ZXI A;  4NBS A;  2V4D A;  1YHQ B;  3W5U A;  4XQF A;  2KVO A;  4QVJ A;  4XLA A;  1E1Q A;  1EFC A;  3ZUG A;  2V31 A;  1H8H A;  2BV3 A;  1E43 A;  1N05 A;  4MYT A;  3LVB A;  3OJX A;  4F7D A;  1WPC A;  4M1K A;  5E6T A;  3ISX A;  1M1K D;  3ZZ0 A;  1D8T A;  3BQJ A;  1W2B B;  4CQJ A;  1EFR A;  1UD3 A;  3VNU A;  3WBK A;  4XN3 A;  3G05 A;  1N07 A;  5L46 A;  1UD4 A;  1PJ7 A;  4RD2 A;  4YAL A;  4N3G A;  2DEU A;  1WOR A;  2J7K A;  2JDI A;  3VNV A;  5F4J A;  2XEX A;  4QV2 A;  1RQP A;  2Q6O A;  3W2F A;  4TMX A;  3B78 A;  5A89 A;  5GV8 A;  1WOP A;  3T56 B;  3OFN A;  4TT3 A;  2C5B A;  1G7S A;  1V0E A;  4Y9R A;  4P22 A;  4WZT A;  5FO0 A;  2YWE A;  5LMZ A;  2LZJ A;  4NNJ A;  1Q82 D;  4IW3 B;  3QFC A;  1K8A D;  4FN5 A;  1G7R A;  1W0K A;  4XN0 A;  3WBJ A;  1GJR A;  2ZIT A;  1QUF A;  2CND A;  1I18 A;  1WSR A;  2CK3 A;  2VJI A;  5J35 A;  3SKB A;  1ZM4 A;  1IHM A;  1ZUN B;  3I1F A;  1FNC A;  3WNB A;  2XNC A;  3PA1 A;  2Q6I A;  4XON A;  1N0U A;  1MRZ A;  2OYN A;  4RDK A;  3WQZ A;  1TVC A;  2C78 A;  2JJ2 A;  3CMA B;  3CCM B;  1XE1 A;  4ROX A;  1VQP B;  1W87 A;  1R5N A;  2GJK A;  3CC4 B;  1QVG B;  3PVD A;  3QFT A;  1BMF A;  2B7B A;  2CF4 A;  1JJ2 B;  4DNT B;  2X6X A;  1DDI A;  1JNY A;  3LO8 A;  3GQB A;  4YEL A;  3U6K A;  3G71 B;  2YWG A;  1B23 P;  4AVZ A;  1OB0 A;  2GK7 A;  3BY1 A;  4UZF A;  4G5G A;  5GV7 A;  4XR6 A;  1E79 A;  2OBR A;  4X06 A;  3AGQ A;  4XL9 A;  2PE3 A;  1E1R A;  2ZL5 A;  2WZN A;  1JB9 A;  4WZE A;  1VQO B;  2WJY A;  2F1M A;  3V7A A;  1G7T A;  2VBS A;  5IYN A;  1AIP A;  1VQ7 B;  4XLC A;  4LBV A;  2CW5 A;  4XLE A;  3WXM A;  3I55 B;  1VQ5 B;  1MAB A;  5TRD A;  3B8H A;  4DK1 A;  2C77 A;  1M90 D;  1JA1 A;  3RY8 A;  3BNW A;  1CNE A;  2XZO A;  1RQR A;  5IYQ A;  3WND A;  4C43 A;  4ASU A;  1ZM3 A;  3H94 A;  5HKK A;  3GVK A;  4DK0 A;  1YIT B;  1YIJ B;  3W2H A;  1SKY B;  3AST A;  4OP7 A;  2R9V A;  1XQB A;  2XZP A;  3W5V A;  3LNN A;  1Q9S A;  4P25 A;  1KC8 D;  3W2G A;  1EP3 B;  2X6Y A;  4PC6 A;  1BPL A;  4HE5 A;  1IB0 A;  1WOO A;  4PC3 A;  2HLD A;  4OPO A;  2YWH A;  3W2E A;  4RCY A;  4EH1 A;  1NJI D;  2X0K A;  1OB5 A;  1FND A;  1KMH A;  1W9X A;  2I1L A;  1QGZ A;  1T6Z A;  3BCF A;  5AN9 A;  1VHO A;  1R5O A;  1S72 B;  3V76 A;  2X85 A;  2CC2 A;  5KNL A;  1COW A;  1JA0 A;  4XMY A;  2D74 A;  3CCU B;  1FRN A;  2V7W A;  1N06 A;  5KW9 A;  3AVW A;  3KEW A;  3H9N A;  4P6V F;  1WSV A;  5F4M A;  3OW2 B;  5TV2 A;  4H9G A;  5H5J A;  2XND A;  3E1Y E;  1VQK B;  4TN1 A;  5J3O A;  4X07 A;  2DYI A;  5B6I A;  1ZM9 A;  2VNI A;  1KK0 A;  4G6I A;  3CCV B;  1BX0 A;  2QTL A;  2X6W A;  1Q86 D;  4X05 A;  3OEH A;  3AVT A;  3CP8 A;  2RC6 A;  4QFM A;  4PAB A;  3OOC A;  1H42 A;  1QFY A;  2OK7 A;  3A8I A;  2OBT A;  2VNK A;  2BGI A;  5FO1 A;  1TTT A;  5BSY A;  2ZTG A;  4AF6 A;  4ZGQ B;  4KKT A;  2PMD A;  4PC7 A;  2GPJ A;  4OPV A;  2GJR A;  4XKW A;  3P26 A;  3CC2 B;  2ZZQ A;  1OB2 A;  1R5B A;  1VQN B;  2Q6K A;  2QDX A;  2BF4 A;  2R6H A;  4HE6 A;  4U9U A;  3SJP A;  3W5H A;  3QFS A;  4ZGN B;  3WYA A;  1KK3 A;  1W0J A;  3U2Q A;  2BM1 A;  1EFT A;  2D3N A;  1D1N A;  4MYU A;  2GRE A;  2CRV A;  2ZZG A;  4RLZ A;  4YAO A;  5KSW B;  4B4D A;  3SJZ A;  5FL7 A;  3I56 B;  2GK6 A;  4WZL A;  4B47 A;  4P2N A;  3A3G A;  1T6Y A;  2QTZ A;  5H59 A;  1A8P A;  1QFJ A;  2OTJ B;  5CDF A;  2FX3 A;  4YEJ A;  1U2R A;  2E1R A;  2HDN B;  3VMF A;  3OE7 A;  1QX4 A;  1S4M A;  1HVX A;  3Q38 A;  4RPD A;  3OAA A;  1K28 D;  4Q7J B;  2V7T A;  3A8K A;  5DS0 A;  5HZB A;  4M53 A;  2VNH A;  4PC1 A;  3A1P A;  1Y0Y A;  2OBS A;  2P3M A;  3E20 A;  1SKQ A;  1OHH A;  1FX0 A;  1HZE A;  1KJZ A;  2V7X A;  3ZBU A;  3P27 A;  3CPW B;  1VQ9 B;  4TMZ A;  5EMN A;  4P12 A;  4ZCI A;  2D9R A;  4WZK A;  4DQL A;  4YAF A;  4B48 A;  3G4S B;  1CQX A;  1YLO A;  4RDL A;  2PIA A;  3CTA A;  1EFU A;  4R71 A;  4KKS A;  2ZTN A;  1GO2 A;  2C4U A;  4QVA A;  5HZA A;  1J9Z A;  4LC0 A;  1DAR A;  2V7U A;  4Z4W A;  4FWT A;  2JJ1 A; 
#chains in the Genus database with same CATH homology
 2ZXI A;  1UD6 A;  1WP6 A;  2X6Y A;  2V4D A;  1BPL A;  2HLD A;  4XQF A;  3T53 B;  2KVO A;  4XLA A;  4DNR B;  1KMH A;  1W9X A;  3BCF A;  1E1Q A;  3NE5 B;  4HIZ A;  4FXU A;  2V31 A;  3VR6 A;  1T5E A;  1H8H A;  1E43 A;  2X85 A;  4XNF A;  2F43 A;  4XOP A;  1WPC A;  3BC9 A;  2WPD A;  2DIE A;  3FKS A;  1EFR A;  1UD3 A;  5IK2 A;  5KNL A;  1COW A;  3G05 A;  4XN3 A;  4XOT A;  2JIZ A;  1UD4 A;  5DN6 A;  3FPP A;  4XMY A;  4XOR A;  2ZZF A;  2W6I A;  1UD5 A;  3KEW A;  4XD7 A;  2WZP P;  3DDY A;  3HAG A;  4GQN A;  2JDI A;  1VF7 A;  2XND A;  3OPO A;  3A3B A;  1I18 A;  2X8K A;  3JU4 A;  2D3L A;  3BH4 A;  3CMM A;  4B3G A;  4II2 A;  4G6I A;  3T56 B;  3OFN A;  4TT3 A;  3ZPN A;  1V0E A;  2X6W A;  2XZL A;  4P22 A;  2GJP A;  3OEH A;  1E3X A;  2LZJ A;  3CP8 A;  4NNJ A;  3BCD A;  1NBM A;  4KKU A;  3OOC A;  1V0F A;  3T51 B;  4B3F X;  1W0K A;  4XN0 A;  4TSF A;  4Z1M A;  2ZTG A;  4KKT A;  2CK3 A;  2VJI A;  2ZZE A;  1VLY A;  4XKW A;  2GJR A;  2ZZQ A;  3A35 A;  4XM3 A;  3GVJ A;  4XON A;  2Z6B D;  3WQZ A;  1PKV A;  2JJ2 A;  3OW7 A;  1W0J A;  2M5S A;  2GJK A;  2D3N A;  2ZZG A;  2XGJ A;  1BMF A;  2WJV A;  1I8D A;  3OEE A;  5FL7 A;  4UZU A;  4DNT B;  2X6X A;  2GK6 A;  4L8J A;  3GQB A;  4YEL A;  3A3G A;  4AVZ A;  5CDF A;  1OB0 A;  2GK7 A;  1KZL A;  1BLI A;  2QE7 A;  2VJJ A;  2W6J A;  4YEJ A;  4XR6 A;  1VJS A;  1E79 A;  4II3 A;  3OE7 A;  1HVX A;  1H8E A;  4JMQ A;  4XL9 A;  1NRK A;  3OAA A;  1K28 D;  1E1R A;  2X53 S;  4XLF A;  1WTH D;  2WJY A;  2F1M A;  3ZIA A;  2WSS A;  4G7W A;  4XLC A;  1OHH A;  1E3Z A;  1FX0 A;  1HZE A;  4E0F A;  4XLE A;  3CES A;  1MAB A;  4DK1 A;  3GVL A;  4G7X A;  4XLH A;  2E1B A;  2XZO A;  2ZXH A;  4YXW A;  4XKV A;  1UD2 A;  4ASU A;  2XOK A;  3H94 A;  5HKK A;  3GVK A;  4DK0 A;  3CP2 A;  4KKS A;  1UD8 A;  1SKY B;  2R9V A;  2ZTN A;  2V7Q A;  2XZP A;  3LNN A;  4TKO B;  2JJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...