2B5OA

Ferredoxin-nadp reductase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
292
structure length
292
Chain Sequence
SVPVNIYRPKTPFLGKCIENYELVDEGGSGTVRHVTFDISEGDLRYLEGQSIGIIPPGEDKNGKPHKLRLYSIASTRHGDMEDNKTVSLCVRQLEYQDPESGETVYGVCSTYLCNLPVGTDDVKITGPVGKEMLLPDDEDATVVMLATGTGIAPFRAFLWRMFKEQHEDYKFKGKAWLIFGVPYTANILYKDDFEKMAAENPDNFRLTYAISREQKTADGGKVYVQSRVSEYADELFEMIQKPNTHVYMCGLKGMQPPIDETFTAEAEKRGLNWEEMRRSMKKEHRWHVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP reductase
publication title Crystal Structure of Ferredoxin-NADP reductase from Synechococcus sp. (PCC 7002)
rcsb
total genus 89
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF01383 CpcD CpcD/allophycocyanin linker domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2b5oA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2b5oA02
1ZUNB 1GAWA 4N3NA 3WYAA 1VQPB 2PMDA 4BPRA 1Q7YD 4M1KA 3VNUA 4PC3A 1H42A 2B7CA 1BX0A 1VQ9B 2X3UA 3MMPA 4RD6A 3CCJB 5DSZA 3ZZUA 1FNBA 3I1FA 4B47A 5GV7A 5TR9A 1JNYA 4RCZA 1QGYA 2C78A 1KQSB 2VNHA 1NJID 1GR1A 3AVVA 1FNCA 1EP1B 3ZZ0A 4FWTA 4HE6A 1YJ9B 2GQFA 1VQMB 2R6HA 4YAOA 2BGJA 1VQ5B 1G7RA 3OZUA 3WXMA 2XNJA 3WBJA 2OTLB 4RD3A 3CXCB 4LC0A 3CMAB 1KC8D 4B43A 2AHOA 3B8HA 1GO2A 1D1NA 3ZZTA 4Q7JB 4TMVA 2DETA 3ES9A 2GPJA 1NDHA 3CW2A 1N0VC 4DQKA 1VQ7B 3WNBA 3OZWA 3V76A 3W5HA 4TMWA 3G4SB 3JQPA 3W5UA 3JQQA 3I55B 1YJNB 1R5BA 3CC7B 4PC2A 1FDRA 1YJWB 1FNDA 1JA1A 1Q81D 1A8PA 4PC6A 2RC5A 3OZVA 1QVGB 3LYUA 3G71B 1KK1A 1E62A 1R5OA 1VQ8B 4WQMA 2VYQA 1YIJB 1QFZA 5GV8A 5TY0A 3FJOA 4C43A 3J81k 2BPOA 4HE5A 4B44A 1M90D 4EH1A 1QG0A 3U6KA 2BM1A 1F20A 2B7BA 1FRQA 4Y7CA 2OTJB 4RCYA 2J7KA 2DEUA 1HA3A 4H9GA 1KD1D 1OB5A 5HXBA 1VQLB 3QFRA 1DG1G 3LRXA 1VQKB 4QFMA 4LBVA 2BGIA 1JA0A 1BQEA 5FA6A 2NPFA 3VO1A 1F60A 1TLLA 4UAJA 3W2HA 2EFGA 4ACBA 2E1RA 4M2LA 2QTZA 3FPKA 1BX1A 1EWYA 4YALA 1K73D 4PC1A 1EFUA 4N3GA 3AVYA 1AIPA 1H85A 4Y9RA 2XEXA 3CCEB 1DDGA 3CCLB 3CCSB 3P27A 4RD4A 4M4SA 4ZCLA 1VQNB 2HDNB 1GAQA 5EMNA 2QDXA 2OK8A 2BMWA 1OGJA 1GJRA 3W2FA 2ZITA 1CNEA 2QTLA 1QUFA 4K1XA 3G6EB 1AMOA 3QFTA 1TVCA 4FN5A 1QX4A 3CMEB 1QH0A 1EXMA 3CCVB 2XNCA 3W5VA 5H59A 5KSWB 2B5OA 4TMTA 4NCNA 3A1FA 2QN6A 4ACAA 3ZBTA 4IW3B 3LVBA 3E1YE 2PIAA 4P3YA 1I7PA 1N8RD 1VQOB 1CQXA 4DQLA 1CNFA 1KK0A 1EP3B 4J0QA 1VQ6B 1ELOA 2CRVA 3W2IA 1IJFA 4ZGNB 1B23P 3B82A 4PC7A 4B3XA 4M0LA 2VNJA 3WBKA 4AC9A 1ZM4A 4FK8A 2QMUA 1B2RA 4ZV4A 1OGIA 1ZM9A 3VNVA 1U2RA 4M53A 1W87A 1FRNA 3CRZA 3CC4B 2QEXB 4YAWA 1G7CA 3QE2A 1VQ4B 1KJZA 2HCJB 2YWFA 1EFCA 4YAUA 3OJXA 3WNDA 1QGZA 1FNMA 4MYUA 1TUIA 1QUEA 4NBSA 3SJZA 1JB9A 2FX3A 3AGQA 2BF4A 4PGOA 5THXA 4YHBA 2VNIA 4B48A 4ZCMA 1S72B 1KK2A 3U2QA 3CCUB 2BV3A 1SM4A 1Q86D 2YWEA 3ZBUA 2OK7A 3E20A 1M1KD 2VZLA 1YHQB 4RD2A 1YI2B 2YWGA 4TMZA 3OW2B 3B78A 1DDIA 3AGPA 1QGAA 2HMAA 4AF7A 1BJKA 5H5JA 3I56B 1QVFB 4R71A 3ZC3A 3CC2B 1K9MD 4G1BA 2YWHA 3QFSA 1XB2A 1W2BB 4QHYA 5TV2A 3AVXA 1IB0A 1WDTA 3CD6B 4TMXA 1N0UA 1QFJA 2BVNA 2DY1A 1Q82D 3P26A 1W35A 1EFTA 3CCMB 1D2EA 3QSYA 1KK3A 3MHPA 3VMFA 1DARA 1QFYA 4RJLA 1J9ZA 1R5NA 5JBQA 4Y9UA 1D8TA 3JQRA 1K8AD 1OB2A 1XE1A 3AVUA 4RD1A 2BSAA 3W2EA 1G7SA 1GVHA 2VNKA 3CB4A 4MYTA 4G1VA 4F7DA 1G7TA 3MCAA 4G5GA 3LO8A 1UMKA 3W2GA 4YAFA 2CNDA 4LBZA 2C77A 1SKQA 4ZCIA 1KRHA 4LBYA 4LBWA 3U6BA 4C0SA 2BN4A 3CPWB 4RD0A 3QFCA 1ZM3A 4AF6A 2D74A 1W34A 3CCQB 1ZM2A 3OJWA 4ZGQB 4B4DA 2DCUA 1JJ2B 1KTVA 4P6VF 3WY9A 1E63A 1S0UA 4TN1A 1TTTA 4U9UA 3AVTA 2QA4B 1E64A 3VO2A 2BM0A 3PENA 1IJEA 3WNCA 3CCRB 1EP2B 1YITB 2EIXA 5AN9A 2PLFA 3AVWA 2RC6A 2DERA
chains in the Genus database with same CATH superfamily
2QPOA 4NS1A 4YPFA 4O2BB 1J06A 3HLYA 2ZJYA 1T6ZA 1P1RA 3G2LA 4PXAA 1SK9A 3IO5A 1VMEA 2OCIA 4YLEA 3PBKA 3TLZA 4A8JC 1M1UA 2OPHA 1PD1A 2WJZB 3CR3C 4H4EA 5C0OE 4P32A 3IE2A 4D4GA 3P97A 2F3UA 4X90A 1K3FA 2C3PA 4WXMA 3A3PA 2B7CA 1ULTA 1I7DA 2O8CA 5JSZA 3H1GA 2O7SA 3A9WA 4TZ6A 2O8BA 3KEQA 1N2XA 2W2PA 2X3UA 4KNWA 1NT2A 2WWIA 3ECAA 4FCWA 4JP2A 5KVAA 4HSEA 4AMZA 5JXJA 3G9QA 1W0JD 3O8LA 4H3SA 3NBQA 5TMEA 3HBAA 2JFPA 3FKQA 1LC3A 4OJKA 2A58A 4WZKA 4DMFA 4EKGA 4G0WA 2ZR7A 4H3HB 1JAZA 4ROSA 4TWJA 1WQ1R 2PSEA 4RX1A 2VJYA 1CP2A 3KR2A 1NB9A 4JZYA 4N0PA 3IBTA 4XORA 1KYXA 2ZUTA 1ZHOA 1JNYA 3ZKWB 3GDOA 3BRQA 2CXHA 2QZZA 2WJ3A 3NJ4A 4YB8A 3ZZ0A 4BNXA 4C4XA 3F49S 3KAQA 5AVQA 3LUBA 1XMOB 4R7ZA 2CSXA 4AJNA 2XWBF 4N7BA 1Q15A 3CEAA 2B2XA 3FUWA 2IZ6A 3KU1A 3NUZA 4I55A 4LOAA 1SUWA 4ZAZA 4DG5A 7ABPA 5IAJA 1SAYA 1HM5A 3UH0A 1MAWA 2J1LA 4DAEA 4E88A 4FFMA 1R66A 5B5SA 3QVMA 2BFWA 4QWMA 4FQ7A 3COZA 3QNWA 1BMQA 3EYAA 4UFPA 3NJ8A 2XOKD 3G7SA 2OTLB 4PSUA 3UHOA 2Y1KA 3SLDA 1JVNA 4XVQA 2W2XA 2RGBA 2B3DA 3C98A 2P4UA 4IUYA 1SUDA 4RIIA 4G09A 4BJ6A 1TAGA 1UEXC 1A9TA 1SIUA 3KSMA 4PCAA 3NMUF 3HFRA 2ZB7A 3MTAA 3NT5A 3KBOA 4XTRA 3OT1A 2GLUA 1WSWA 4B43A 1OQAA 4JUFA 3Q5EA 5HIMA 2CL0X 3DM5A 3IJEB 2Y0CA 3EZYA 3P52A 5DP2A 4DRZA 4TMVA 2RGDA 3IUEA 4XGRA 3KQTA 2P35A 4I50F 4NCKA 2ZPTX 3GNSA 1FP2A 2F9FA 2XKAA 3L0PA 4GUDA 4RK7A 3O91A 1RBMA 2JA1A 3M8KA 4WZBB 1MW8X 2ZTHA 4MPDA 3L93A 1LQTA 1DQRA 1P3Y1 3B1XA 1E6WA 1N32B 3H1TA 3G4SB 1GN8A 3GXBA 1KOJA 4NV1A 1MT3A 2FRDC 2NX2A 1F6DA 4RPDA 1QOZA 1QM5A 1U28C 1X7ZA 1UOPA 2BJHA 4I9NA 4I4CA 4QPDA 3VU9A 5JCZA 4I5FA 3AEKB 4U4AA 1N8TA 1AMNA 2MU1A 2AX4A 2ZXEA 1U1CA 4OJYA 4BJ3A 1JA1A 4I4NA 4OQMA 2PXAA 3F2IA 1M7GA 2I3ZA 2PWAA 4GPEA 4PU0A 3ZU3A 1I5OA 2OYSA 4FR5A 1QVGB 1X7YA 3EF3A 3AH8A 4TGLA 421PA 1ZIOA 3LOPA 3G17A 1Q83A 1PGQA 3O3OB 3PDCA 1NVAA 4HATA 1N5KA 2B8TA 4JK3A 4KQWA 4QTUB 4R2KA 3SEQA 3KBBA 3U9LA 4CL3A 2UYHA 3AYXB 4WQMA 4QV2A 4YRSA 2O5VA 2ZAGA 1KZ6A 1PL6A 1XTBA 3G13A 2GETA 1ZH6A 2LE0A 2PA0A 3OQJA 4HGRA 2JZOA 2BTQB 4AWBA 5EI5A 1CRZA 1NBMA 1SBIA 3HUEA 4N0QA 2LCQA 5KDLA 1DC3A 2D06A 4NS4A 1PUXA 2AUMA 4EB3A 1ZI8A 1W9MA 4FFRA 1SVNA 1VGRA 2I34A 4MQ5A 2C1XA 3H5IA 4B44A 1C0IA 4TWZA 3SSMA 2XUOA 5ECGC 3FYUC 1N36B 1L7XA 4F91B 3AV0B 2IHUA 1B2LA 1GCOA 4J1SA 4LDNA 1SC1A 4YQYA 1QWOA 5KPJA 1GCAA 2VBCA 2OTJB 1XMJA 2PX2A 4RFSA 2AN5A 2JCBA 4WOBA 4Y2RA 3OZAA 4DK1A 4KQHA 4Y6SA 4Z8YA 5E8JA 5FNVB 1OLXB 4EBBA 1KD1D 3HXKA 1BKSB 3UAWA 4UZFA 3AJRA 3AKEA 2VATA 1K88A 1P1JA 3KVRA 3ZN2A 1RBYA 5CIWA 5IWAB 3A1VA 3HJRA 4FSXA 2VP0A 2PRKA 5KS2A 4MQEA 5EJGA 3ZVRA 2Z2XA 5IG2A 3KR0A 3FOZA 1WVMA 4YT4A 4G0QA 3DHWC 1YR8A 3GQBA 3HWX1 3E05A 4DCMA 5ICSA 3EVDA 5JWRA 2PY6A 3PICA 4ER7A 1IPFA 2OMKA 4JFRA 3A9UA 4DL9A 1TJNA 1BS9A 5HDBB 1X42A 4YPVA 2E1RA 1AF4A 2GK4A 3DTYA 2J5RA 1JHYA 4G3XA 2QTNA 4IMJB 4QATA 1LGYA 4X62B 2ZCJA 3T3PB 2XTAA 3WWDA 4NXMB 2RMKA 1E1LA 1O5IA 3WNVA 2I5PO 4BIIA 3QYPA 4JLVA 4EYSA 4B79A 5IYZB 3RF7A 5CA0F 2IGBA 1DXQA 2DLNA 1N6PA 1DWUA 1NLMA 3OZBA 3R5HA 3NT2A 1VI5A 4HUJA 1GILA 4QPJC 3VOSA 4DQUA 1LFAA 2ZETA 3HEAA 1DKMA 2IHNA 2FWMX 1UBKS 3ASVA 5KOIA 5EAIA 3ZX4A 1MGOA 3W5JA 4BO8A 4YPOA 3K2EA 1KAMA 1U11A 3W7BA 2AC4A 1X92A 2VUIB 3BWEA 4YX9A 3AFGA 5AVZA 3HY4A 3N2GA 3K09A 4XX1A 2XUKA 1TIBA 1ZEJA 4ZRMA 3NAGA 1Q7BA 3QHQA 1T1JA 1CJBA 1Y6ZA 4XQCA 5FWAA 4ZCLA 4DR4B 3F6PA 4CMEA 2QTTA 2RK4A 3AM4A 3GDWA 2IP4A 1BKYA 3KLMX 5AKIA 3RYIB 5K0BA 4XWWA 4Q4AA 1NUQA 2VAMA 5A6SB 4OQZA 5BV0A 1Q22A 4ICIA 4DV4B 5BN3B 4GDFA 5JEEA 3QF4B 5HKLA 4ENRA 3RS9A 2V5AA 1C1XA 5IRCD 1JLMA 1D0VA 1H2FA 3AR2A 3QELA 3EZFA 4HH1A 1PVOA 2PAAA 4GOND 2R68A 1I3NA 4UTVA 4LXQA 1H22A 2CHQA 4A36A 3LKBA 3AEXA 3HACA 3H11B 5ARCA 4LV5B 1N3IA 1SVIA 4TV9B 1YRLA 2IYYA 1H6CA 4KP7A 2AKEA 5TQVA 2OQRA 2R1VA 4OI4A 3WGLA 3MMXA 4LJRA 4TUYA 2IYUA 3VAZA 3K9GA 3M6FA 4Q0MA 2P1ZA 3O2NA 1T9ZA 3W5AA 1R12A 2C2GA 3UK1A 2BKXA 5IM5A 5LR6A 4JITA 2PKYX 4E5SA 1L1FA 4BLSA 3N5KA 2FPXA 3GGJA 3LY7A 5AOCA 4QM7A 3R9WA 1I3LA 1EA7A 3CCVB 1Z4KA 3PUVA 2M5SA 4XM1A 1WSRA 1FQJA 3JZDA 2D0OB 4XZ3A 5HF6A 3OAAA 1UADA 5B4UA 1H1DA 3BAFA 4HX5A 2X5KO 5HOEA 1ZGBA 4LA4A 2Q2OA 4B7XA 4DM4A 1YFJA 4WCVA 5DVZA 3VC7A 3IALA 4IV5A 2JGAA 1JDBB 3UT0A 3VR4H 4BKRA 2O54A 3OA0A 1SXGA 1FQKA 5D1HA 5U1PA 3QHAA 4DR3B 1A2BA 1WP4A 2D4AA 3D3WA 1D4AA 1RZ3A 4ZDIA 2EKLA 2FAXA 3JRWA 5GM1A 4MIKA 3UAZA 2JASA 2OCDA 3ZU6A 1X38A 1ZCBA 3Q9LA 1XZEA 2Z5GA 2AI3A 2EL7A 2GFHA 2ZTMA 4ZK6A 1KWGA 4OMCA 3GLFE 7ADHA 5I7UA 2ZTUA 4XQ0A 2AC2A 4G9BA 5ABPA 1ZSNA 3KQOA 3INRA 2HI0A 2DT5A 3KOYA 4BFXA 1IJFA 3LCUA 2X0NA 1Y4UA 4XQGA 5HCUA 1M6EX 4X1IA 4XSHA 3VH3A 1NG1A 3SS7X 1G66A 4PC7A 3LK7A 2C92A 2FUG6 4NK5A 3IBYA 1JIKA 3ITEA 3OY2A 4QGAA 1INLA 2KJQA 4W1QA 3S29A 1E3XA 4B7UA 4BMVA 4BX2A 3L8FA 2FPSA 4HHEA 3ND8A 1CEQA 3LBAA 3OT4A 4UULA 3ZCQA 3LKZA 5JQWA 2JIOA 3MJFA 5NLLA 1GGFA 4F5DA 5ICCA 4UNQA 3D6FA 2CXOA 1SCAA 1GKIA 3QIAA 3E61A 3UMFA 3VR4A 1CDOA 3B9QA 4ZEMA 5IU6A 3IVAA 2ZJ3A 4G5SA 4A15A 4TYWA 3EQ2A 1UAGA 4RTLA 5JYCA 4NBWA 3B6MA 3IJRA 1GPDG 3M5PA 1XJWA 2V5UA 2YVQA 3E3NA 4L3WA 3M1YA 3WZMA 4ODIA 1JHZA 4HGYA 2ZM6B 4I1RA 4IDFA 5CB0A 3GJSA 2EW8A 4L8VA 4UASA 4UCFA 1MENA 4X8HA 3OJXA 3PLRA 2IX3A 1FNMA 3BY1A 1E6KA 2CFRA 3TLJA 1G20E 2LXNA 3EFEA 3VZPA 3TAHA 2FX3A 1YKFA 3KT3A 4DJJA 2OM6A 4WLFA 3U0BA 3CTAA 1WX1A 3W77A 4X65B 4PTLA 3F7TA 3UPUA 1OLSA 1E1CB 1W1UA 3EQ8A 1YQWA 5DHAA 721PA 5IFLA 3H75A 2ZAOA 2VQ3A 2N1MA 4A73A 2I8LA 2ZT8A 1S72B 1MOQA 1PKVA 3L02A 3FYHA 4RZ2A 3NLLA 5F12A 4D80A 1WG8A 3G6KA 3NHWA 2GZ2A 3WGOA 4ZOLF 3E9ZA 1L8AA 5AVUA 3EY9A 5I9SA 2ANCA 5B3AA 3M5WA 4B6JA 4B9EA 3WJ7A 2IHBA 4N5IX 4S1OA 3WGKA 1WXXA 3WL4A 2IEIA 3WKDA 3PGLA 1TLTA 2XVZA 1L5WA 1QGUB 3AESB 3NI2A 4NOMA 3F5SA 3ETGA 4PXYA 5FOWA 5AW4A 1K3UB 1DOHA 2J3EA 2MYPA 3DEYX 1L0BA 3BYZA 4X7CA 4R8SA 3OUUA 2AMLA 1QGAA 2C0PA 2D59A 2C3MA 4BGVA 5I8PA 3D7NA 1Y4SA 1FFWA 3QZUA 1Z3CA 3AR6A 3SKYA 1CBUA 3IHLA 4GLJA 1WHSB 1EA5A 3OPXA 4K9LA 3O93A 3WLAA 4GOJA 5ITSA 2DHDA 4E5YA 4Q3CA 2ZYVX 3DXFA 3DQQA 3JYPA 2DHRA 2SNIE 3LGXA 3N0RA 3BTOA 4IOMA 4RENA 1DAIA 2G88A 3R7WB 3TOVA 1C1YA 1LRKA 5A3SA 2OC9A 1PTKA 2QR5A 2JFGA 1D4FA 3KPVA 4H7PA 1YDGA 2VXYA 4NEQA 4U1RA 4LY9A 1PLKA 4DAOA 3NYIA 5CBPB 1EUQA 1B00A 1OWPA 3N8HA 2CKDA 1TTPB 3B3FA 3ZJ4A 2JHAA 2PVSA 2BM8A 1ESEA 2J0EA 1YOVB 4M38A 1NNSA 3NGMA 3HVHA 2Q9UA 1UBCA 2C58A 2BHNA 2YYZA 5LMZA 2J3MA 3U7HB 4Y3UA 1P4HA 1K7FB 3BMNB 4D74A 4LRYA 5AOVA 1OTYA 5I7OA 4YELA 2RB5A 3JY6A 2ZREA 1IUNA 2HA3A 3MCVA 3WISA 4RDJA 4EJSA 2FSVC 1AUPA 2HM7A 2B4QA 4LYDA 1Z5UA 3OKPA 4BNFA 3TSCA 4O29A 3QSYA 4PF1A 5DHSA 3SJUA 3ET5A 1VIYA 3JVIA 3P0HA 2Q1SA 1RWXA 1ECBA 4ETMA 1MB3A 2JIBA 1XZDA 3C48A 4MLCA 3L6EA 1AHPA 3D6UA 1NUUA 4R31A 3DKIA 3FLEA 3JQBA 4QGBA 2ZB4A 4EKEA 1NDUA 2FZVA 2H9AA 1HH4A 3RU7A 2QD3A 3ZZNA 4ESEA 4JJ7A 4FYJA 3Q6MA 4IDAA 4I9UA 4QVKA 4ZPXA 3BFJA 2X5NA 3F3MA 1V16A 3NIDB 3NWJA 2PWPA 3CYFA 4LRSB 5K3FA 3THRA 4M8IA 1NIJA 2TMGA 4PW0A 4BE9A 5AMXA 3TOCA 1JR3E 3OIFA 4XX0B 5SV2A 4BWGA 4AWAA 5E3HA 3B51X 4FFPA 1RKBA 3GLHE 4JOQA 1P2GA 5K8TA 1CR1A 1LSSA 2PGJA 2X7XA 3FLAA 1X1RA 3G9ZA 3PT9A 4YCSA 3FNGA 2QUZA 1E7YA 3L1JA 4JBXA 4J94A 1EJ6A 2OGSA 2PR7A 1P6XA 3DFUA 1NPYA 3TW0A 2XV1A 2O8EB 4OA8A 3DZJA 3MWEA 4UFOA 4K9NA 1GKUB 3IOMA 4G37A 2E5LB 4F6RA 2W6ZA 5IYRA 1YRYE 3OM0A 4KQJA 1THGA 1O0BA 4ZHQA 4GZ6A 4MPPA 1MGPA 4K81B 2X8AA 1SVUA 1L4HA 1Z26A 4ZCIA 3D1VA 3GELA 1E3WB 1UWVA 1VPDA 5AOAA 2AFIE 3G89A 4WMLA 1T5DX 1K9SA 5E9AA 4BVHA 5CIQA 3K1AA 5HUQA 3GEIA 1M67A 3BCDA 5BRNA 3SGLA 3ZWYA 1SQ0A 2A3RA 1ZM3A 4D3YA 2GAIA 2JGFA 1HUQA 1UD2A 1VECA 4WCFA 2C9YA 3K96A 3NM5A 3FCCA 3T3IA 4W63A 2RJNA 3ONEA 1B42A 1KERA 1S96A 1FFSA 2PT6A 2OFOA 4UUAA 4DLAA 5FD8A 1DL5A 2B25A 1PFKA 2XB6A 1P1CA 4QVGA 1DX9A 2Z1DA 1II9A 3TXXA 4X0CA 1J8VA 4ZARA 1UKCA 4EG5A 4HNVA 3PNYA 5EMLA 1OLOA 1DV2A 4F84A 2JGDA 1QP8A 5ALPA 4U2BA 5T41A 2OXFA 3FY4A 4QLBA 1XFOA 2VQ6A 3JQCA 1HQDA 1M2JA 3KUKA 3KQLA 3GJ3A 2CVPA 4WTOA 1ZH4A 3E9EA 4PQGA 4ND1A 4GECA 3SYNA 4CF3A 2FQQA 1XEXA 2XCRB 1XRMA 5DW0A 2Q41A 1T8PA 1BU8A 1SU8A 3CF6R 3RC8A 1R8YA 2ARKA 4BLWA 2OESA 1VIMA 3I9JA 1F9AA 1HDOA 1VL1A 3P9CA 3T52A 3WBBA 1OC2A 4RLQA 3GRVA 1E0KA 2ZM5A 1QDEA 2QOEA 4ZCPA 3KD2A 1GDHA 1EX7A 3AI1A 3DZBA 1CUVA 3TX6A 2RJ3A 4EVSA 5BNIA 4PPYA 4KR3A 3JD4A 3OH8A 3LRPA 2YHIA 5IH3A 3RODA 4YMIA 4FZ3A 2R1TA 3NVAA 1THTA 5FADA 4MS1B 1K7YA 2MT9A 1GAWA 2W2LA 3C8ZA 2ECQA 1Y3IA 3KX2A 2I7DA 4TL6A 1PJ6A 1HWYA 2J45A 2QQ5A 2NU9B 1QHHB 3O0TA 3SCZA 3QKRB 4CLHA 2W42A 4ER6A 4UBKA 3ER9A 1ILWA 4RZIA 2FEXA 4RMHA 3O1HB 3U5ZB 4H08A 3OI7A 3SZRA 3MBIA 2CNLA 3DBIA 5CVVA 3S5UA 4FGZA 4NECA 3VTZA 4ESOA 1CQPA 3OOSA 4HNUA 1O94A 2XDQB 2E4UA 4JWTA 1Q91A 3IKLA 1RKXA 5BT8A 1IBKB 3D6AA 3QX9A 3JXEA 3PE6A 2OENG 1TFUA 3ZZUA 3OPVA 1J0BA 1P91A 4PZDA 2NVUB 2ZSDA 4JR1A 3DTVA 3IHKA 2GZAA 1MIHA 1CB7A 1N5IA 2XGMA 5A9TA 4M0CA 2AZTA 4QBIA 3AW8A 1WHTA 2IOYA 2ZRCA 3BD7A 1WO8A 1OX4A 3CWCA 3RK1A 2OL4A 1HTTA 3U37A 1EJBA 4M60A 3THWA 4G0VA 4Z4GA 4KXYA 2VNHA 2C5EA 3QXJA 2WUDA 4O4JA 1ISRA 2R87A 1V43A 2G9NA 3KQNA 4ZOQI 3IUSA 3SQOA 1ZHHA 3Q8MA 4FXUA 3D0RA 4ZT4A 3GR6A 2H5LA 3WXMA 2NMVA 2DPHA 2HU7A 5JMOA 3HCBA 3ROQA 4Y6OA 1KE1A 5CXUA 5BWCA 1NWHA 2BUCA 2QQEA 1B3BA 3FTEA 3CXCB 1GLGA 1T2UA 3KAPA 3IMCA 4OB6A 1VJ0A 2VHEA 1LBIA 1Z56C 5ELLA 1C0LA 4FHZA 2X41A 1ENYA 5C5CA 2YWBA 1AD2A 1CD5A 4RSRA 4WKOA 3EIFA 3Q9NA 5K0CA 4EATA 1NJ6A 4Q4CA 4B3GA 2FW7A 2Z2ZA 3F5QA 3IEKA 3MVEA 5F1OA 5REQB 4XLFA 2BHTA 3ES9A 5LQDA 2I2XB 5LQSA 2Z8YM 4BNTA 5BYAA 4W5HA 3SHVA 4PAWA 2ONJA 4EHNA 1Q1GA 2DQ4A 2GCEA 3LLSA 4K6MA 3UMBA 2ID9A 3I58A 3OOWA 1U2DC 4KXFB 5I9TA 3QVSA 3FCOA 1SCKA 3QVUA 2XVXA 4P86A 3VKHA 2YHUA 4XJVA 4FNMA 2OB2A 5EE5B 1KVTA 1R5BA 1W4ZA 4GW3A 2V45A 4YAGA 5HZBA 3GFGA 3O7MA 5ENVA 1ZINA 3TLMA 5AVJA 4OXNA 4E11A 4NYJQ 1PDWA 1RXIA 5FTNA 5ICMA 3BE4A 3LI2A 2JBWA 5ALEA 3N2NA 2PGXA 3FVTA 2VQFB 3FGPA 3I01A 3KV1A 1SZDA 4WGGA 3RAJA 1CF9A 3SF8A 5A9RA 4NU0A 5H83A 1NMZA 1PL8A 4BCBA 5IYQA 1QE3A 4K8OA 1TM5E 4KC0A 4IIJF 3PD1A 4M1YA 2AN3A 3E9QA 2I1LA 3IB6A 1ZRMA 2NYUA 2O7NA 3KFXA 3U49A 3ZXXA 2ECFA 4X71A 4C0XA 3FHTA 3ROXA 1UP4A 1SJ9A 1JWBB 4R51A 4UBJA 3HKCA 4UJ3A 2V03A 3OM8A 3UFXB 4OQXA 1N0WA 2Y1DA 3C1TA 4Q00A 5DGHA 5EHXA 1G21A 4F46A 1ZCZA 3F73A 4YJ3A 3ZVLA 3KS9A 4K6GA 5DT2A 3G0DA 1BMDA 1ESCA 1V3TA 2HEIA 3V5NA 4MUBA 4NKRA 1Z0FA 3QX8A 3P0JA 1H1LB 2VJLA 4QRIA 3TIIA 1XJCA 5KNCA 2E18A 5LZ7A 2IH2A 1VP9A 1I2ZA 1QXSA 1F2UB 3W1EA 3QE9Y 4U39A 4YAIA 4H15A 5B3JC 1AGXA 2CCJA 1MFZA 2ERYA 3H19A 3QEMB 1BTOA 4PPFA 4NCAA 2HXYA 3CUVA 1JVBA 4PINA 1YHNA 5BNFA 4JEIA 3T4UA 3ONNA 2CHUA 1FFDA 4G7WA 1ZI6A 1J5EB 5IVHA 3AP1A 5J9FA 2OPBA 3F4LA 3VO1A 3RYHA 1AO3A 1SCNE 3GNQA 1NP7A 3SFVA 2R8RA 3H5OA 2VBSA 2RHLA 5HK8A 5ICEA 1P7CA 1TKAA 5B58T 2ZBQA 3OZIA 1IB6A 3LC0A 2UYQA 4OA5A 2R7NA 5E4JA 4R01A 4TV9F 4CQNA 2BH2A 4P3KA 2D5LA 1R6AA 4HQNA 2DULA 2CMGA 4BO4A 5KU7A 4LSGA 2E85A 1ORDA 3A3OA 5LKRA 3AUTA 2YBDA 1EFUA 5WRFA 3KEOA 2RG1A 2PTGA 2GREA 4X91A 2O5EA 4CFYA 2XBMA 3UATA 4EYKA 1AIPA 2ZE5A 3KK0A 4RIGA 3ZGNA 4AZ0A 1SUFA 1XP8A 3PQCA 1F48A 3O8DA 3KYCA 2H2FA 5FLXA 1LSUA 3RVQA 4RL4A 2GZ3A 1V7QA 2BR5A 3QPDA 5CCXA 5ALKA 3UJBA 3FG9A 3NM6B 3R3SA 3P27A 4LHVA 4E6PA 1JEAA 1ZZGA 1BA3A 3W4KA 2ENUA 2PX4A 4C7BA 4YH1A 5EMNA 2NVWA 1E5DA 1GNPA 1DAMA 1FS4A 2JB9A 5G4LA 3TLGB 1F7VA 1VJRA 4KQKA 4U2DA 3Q5GA 2QXTA 1FX0A 2ID7A 2W6MA 2EFJA 3CRQA 3VVLA 1XQYA 4ZJUA 2J85A 3R24A 5G0UA 4F2WA 5IW8A 5ITWA 4JI6B 1T5TA 3I9OA 2DFLA 4KPYA 3TFOA 5K3SA 1ZOPA 1LCIA 3I9V6 3TQHA 4D56A 5JFOA 1Z2EA 2Q4BA 3DZHA 5DN6A 3KWLA 4OI1A 1QANA 1YA6A 2HRDA 5AK4A 2PUCA 4GX0A 3KKZA 2IUSA 1OR8A 3QHPA 3A2KA 3RIGA 1ZVQA 3PIIA 4DLNA 1JEQA 1R4ZA 1RVV1 3D8RA 2HOQA 4B75A 1T0IA 1H4TA 5KDOA 4DCUA 2IC5A 4FN5A 3NTOA 3SLRA 4QZVA 5ITZB 2V4MA 2AQIA 2IXAA 1GU7A 1L5OA 2VDQB 2WSSD 1J2RA 3H5NA 3UKJA 3HKEB 1YACA 2Q6TA 2ZCVA 2RIPA 3RYTC 4IHJA 2Z1MA 3B9PA 2P67A 1BXZA 1BRMA 4YUXA 5KSWB 1EFVB 1K4MA 3TOSA 3Q8XB 4NCXA 4C2AA 3H1PA 1Z22A 2OSBA 4GGPA 3U7QB 4LF6B 4F4HA 4FYWA 4HKTA 5IVIA 4EG1A 4EPWA 4P4LA 4Q4HA 1KAGA 3ZE7A 3EXHC 1S9DA 5AJYA 5LPNA 2XT9A 2YWXA 4X84A 1ZGAA 3FOWA 3E1YE 4W1SA 3PB3A 5DLDA 5LSAA 2FSIA 5HTKA 5BMVA 1USWA 1VMAA 2BGUA 2FPRA 4J16C 5BSRA 3TQCA 5K0SA 1U0LA 4A0FA 1MUUA 4GLLA 4RSGA 4NBKA 2O8FA 2ORED 4DB4A 2NXJA 2GFIA 4MV3A 2IV3A 3TDNA 2QGFA 4TXMA 4WNAA 1XNQB 1P4SA 2H92A 3ZZ1A 1FYFA 2B82A 1UBRS 2FPIB 4JI3B 3NDJA 2EJUA 4OQLA 2WSYB 2REXB 2XRYA 1I1NA 1O95D 4HVCA 3B82A 2D5BA 3WGYA 1R0ZA 1Z4LA 4JDUA 4U7PB 1DZIA 4V2UA 3O8QA 1ZEMA 1FTWA 2WTAA 2G9QA 4X20B 5B1IA 3V1TC 5K4GA 5L6LB 3ETDA 4H7IA 2CZGA 3F3SA 4OOEA 1PLJA 3KUXA 4Z0TA 1KR2A 1E9RA 2HMYB 1VGQA 3SYKA 3OEHA 3HPRA 4N5LA 2P3SA 3F6YA 5BN5B 2R60A 5BVGA 4M53A 2I4NA 1WIWA 4HXFB 5CFRA 5JNVA 1YDWA 2WPDA 2F8MA 3D54D 3M1IA 1U7DA 4II7A 5DHFA 3PXUA 5SY4A 3QNUA 4O59O 1AB5A 4FX5A 1STOA 5TGZA 2Q50A 5UKDA 2O8CB 3OECA 5LYJA 5JSZB 4CTOA 3P2JA 2ZKIA 3EC7A 1A7KA 1GEGA 1GIAA 1QE0A 2B35A 3KR9A 2ZT6A 2AQ8A 3NOVA 4FR0A 1U7OA 1O03A 3K0CA 1GZ7A 1RXYA 4V1CI 2B30A 3L7BA 4LRWA 4TXLA 1DJNA 3E81A 1C1DA 1K4YA 3QFFA 2FFHA 4H6VA 1C41A 4HDSB 2BHRA 4RVUA 1QIFA 3QY0A 1FFEA 4MVJA 1DO8A 3ESRA 5F4OA 1JH8A 5LQNA 1Q95A 1BGWA 3GUVA 3O95A 4GICA 4J43A 5KHLB 4BMOB 3JZIA 4UVIA 4L2IA 3FWZA 5C81A 5L3SA 1EU1A 3J7TA 2FSGA 1HOTA 4D4MA 3UGQA 5KAMA 1RKVA 2BIFA 3BQNB 5M2QA 1BH6A 5AP9A 3KJXA 4ARIA 1A27A 5IF9A 5EWJA 4OKIA 5E6RA 2WYVA 4I55B 1HLFA 1IK6A 2O1XA 3RKRA 5GOZA 4C7KA 1COWD 1WABA 3B8EA 2BEVA 3ZQ6A 5A71A 5F35A 4RD2A 4G23A 4I36A 3WQSB 5KQPA 3KZKA 1ML4A 2WP0A 3D3KA 3L9WA 2QN9A 4KAFA 3LQ4A 4L8LA 4DVGA 3B78A 1DTEA 5C32A 2HMAA 2F1MA 1YNSA 4C0WA 2BDEA 4KEAA 4R71A 3HSYA 1N6OA 1SVWA 3KHSA 4TQ9A 1FUKA 2VPQA 5LA6A 3K31A 3O1JC 3OT1B 2C95A 2JZCA 1PJ8A 3TTYA 3UJCA 2GESA 5DIFA 4DG9A 2PUHA 1N06A 1P2DA 5JCOA 2KHZA 3PC2A 4Q9NA 3TSAA 3P2KA 1BE8A 3HKDB 1XB2A 1W2BB 1LZKA 2RH5A 2VI5A 3DTNA 3B7PA 5K6AA 3IERA 4UREA 4YV2A 3L8ZA 5JH7A 2A88A 1DGQA 4URUR 3NBFA 1CZKA 4NAHA 5EZYA 4F1KA 1E2QA 3UMVA 4PNEA 1UD3A 1VPVA 2CHEA 2QZJA 4OHPA 1MO5A 3LDHA 1VGVA 1PJTA 1QBKC 5CK5A 3FPGA 1BOOA 3ZWCA 1PVDA 5KBYA 1X7ZB 2ZJZA 1B6SA 4L78A 4PGFA 4MLZA 5COBA 5IC5A 2PO5A 5DX1A 5KKCA 4LC9A 4E2ZA 2DY1A 4XL9A 4BZXA 4D3FA 2AEJA 1UK8A 3ST7A 5E9WA 1UOOA 1W35A 2O3QA 2PX8A 3CSUA 4Y98A 2ODWA 1UBLS 1GQRA 1EFTA 1O4VA 1Z0JA 2CFCA 2G9RA 3HO8A 3U4IA 1B8PA 2FGKA 3KJNA 4JSRA 4GVXA 4JUBA 3NTLA 4KXXA 2OQIA 5C8YB 2BEUA 3HP7A 5AKJA 4MKRA 3ZXIA 4EWLA 2FK7A 2QUBA 5IM4F 1XVAA 1E7MA 4KO1S 2YJTD 1I3KA 3OJCA 1X74A 4KGDA 4IHQA 3D4NA 1TCCA 1M73E 4Q02A 4Q3DA 2IFTA 3FX2A 1CEXA 3EE6A 4TV8B 1L4UA 4XD7D 5D00A 3TL6A 1S8NA 4MRMA 5KWJA 1CRWG 2YQZA 3EGXB 2HDHA 2Z1NA 3JQRA 5T3UA 1SC6A 5ALLA 2R6DA 4FW9A 3CUWA 1PWHA 2W0MA 4Z0HO 3AP2A 4UHBA 4DLPA 4KGXA 5I8ZA 4RIHA 5KKAA 3TWOA 4P80A 2QRHA 4EA7A 3SE7A 2IYSA 2Y99A 1KSHA 1R4NA 1ZMXA 1GLVA 4RFSB 4YNBA 1OMOA 4CIVA 4RJ2A 1ONSA 4TLAA 3FZGA 1GVHA 1OXBB 4IUCS 4MWCA 2FETA 3I5AA 4HJXA 2J7PA 2MYNA 3V42A 3L7JA 1QRAA 3NE5B 3DHYA 4OLJA 2CXNA 3UICA 4P81A 2O57A 1S6YA 4F60A 2YHAA 4WXYB 1UOEA 5EJIA 3R7BA 4FU0A 3VPBA 3AUKA 3BB3A 3FD8A 3VU1A 3DEAA 4G8BA 4D57A 2C2ZA 4MQEB 1R1DA 3DMTA 2LPMA 2Q0SA 3QENA 1YXMA 4GPBA 4BQIA 2FVXA 1JKJA 1MLDA 1Q1EA 1Q19A 3F6CA 1UJ5A 4JLBA 4NBTA 4OJTA 3C3CA 2XGOA 3GLVA 2GMWA 4IV0A 5JATA 3ZDBA 1Y89A 2WT4A 3ROTA 4DLXA 3GGOA 4WK4B 3GLGB 3DMNA 1CS4C 1VPTA 4D4KA 5KYNA 3FM9A 3T3OA 1I33A 2ONZA 3ML1A 4ZCQA 3WYGA 1Q84A 3G5LA 3UY4A 2ZZQA 4TKLA 3IBGA 4RE6A 4D26A 1XD9A 2AG1A 2FP4A 1E5QA 1WLSA 4HDRA 3PUHA 3L92A 3ZJYA 5AW6A 3RVRA 2YZ7A 3H9UA 4J0KA 4FEEA 3L8YA 1WAMA 4UJ5A 2FRVA 2JDID 4DDUA 4BBAA 4BMYA 1BXGA 3R9KA 2FWIA 2ZATA 2CB9A 3VDQA 3ZS8A 2ETXA 4HVAA 5KYXB 5JJBA 1WD7A 3GVCA 3HA3A 3DC2A 4MHSA 4V0NA 4Y2JA 1UFVA 5JBIA 4BP9A 1RYEA 2C9OA 4MUHA 3N2GB 3FVQA 3H2JA 2GJSA 1CJKC 2ZB2A 3L0ZA 4MUEA 4AMBA 4DIDA 5M04A 3LX6A 3JD0A 4MRPA 1QFSA 4QUIA 3R7SA 1EPUA 1N9GA 4Y6PA 1L2TA 3TRDA 1NBWB 3MIIA 4Q4AB 4RHCA 4XIIA 4D4JA 1HR0B 5DMHA 3TIFA 4FJ2A 5CDTA 3A1TA 1ZD3A 3A6JA 4WEOA 2O6HA 1C1XB 1Y81A 2J9FA 3C87A 1EXDA 1DHTA 2WHYA 4MNTA 3QELB 3TPCA 4KWEA 5EIFA 4PN7A 3OBBA 5J3OA 3QU9A 3TTWA 3QI7A 4NDAA 4PGGA 4YJHB 3U7IA 4HLUC 2PEZA 4CKEA 3K5WA 5E3IA 3S8YA 4PYRA 1QPBA 4DQ0A 2E89A 1U2GA 1J7KA 2R1VB 3UQZA 1IM2A 4XPZA 2NAFA 4B3CA 4TUYB 2V5VA 1O58A 4A6EA 3WMRA 4OHCA 3ETJA 5JWHA 1GOTA 3D8SA 4RF3A 5FLEX 3IT3A 3OAAD 3UGTA 1VE7A 1VPWA 2ADMA 1KZGB 1G2IA 2E4XA 2NXWA 3GLSA 1E32A 1G16A 1XCMA 2GCNA 1OZGA 1T2CA 3CZRA 5AKYA 5EXDA 4KR9A 1ZJZA 2CLIB 3HHPA 1KEZA 1R4MA 1JFTA 5HZAA 4NPAA 2DM6A 3IVCA 3N8DA 1NRKA 2WYHA 3ITKA 4OG2A 5ALIA 3T7RA 1FNBA 4B7CA 2QB5A 3C3DA 1TRHA 1PW5A 1O87A 5LZ5A 3C6MA 4PAAA 3OHMA 1ORTA 2N47A 2RB4A 4L6AA 4G63A 1LVUA 4O2AF 3OE7D 4KIUA 4Y1RA 2NUTA 4ENPA 5BWLA 5DTQA 3KL9A 4NJEA 3KQSA 5CW2A 2V31A 4ZQFA 2QENA 3D3WB 4OBWA 2ZWOA 1E1QA 3DPIA 2OD2A 3L49A 4KJXA 1VQMB 3W9SA 2JVIA 2JA2A 4WAUA 4G41A 3C3XA 3C8HA 5EIAA 3VV3A 2G5PA 3H2BA 3OZGA 4X5OA 1J2JA 2OSVA 3NC4A 1K66A 1N1EA 2JL1A 2QQGA 3BSYA 3GEBA 4GEKA 4MAFA 4MVYA 1EUDA 4B3TB 1KFEB 3FFAA 2XZPA 2BGKA 3GJYA 4HZGA 2BUBA 1C3EA 3LHKA 4UDYX 2D62A 1BC5A 1TF2A 4NHOA 1O5OA 4Z7QB 1LBHA 4X1IB 3D3NA 5KYUB 1T3HA 2VBIA 3IGFA 1DBWA 4IEFB 1RXWA 3QUCA 3OEYA 1RRGA 3RQSA 2QM7A 4UPEA 3IIMA 2YTZA 3G05A 5BT9A 3TXAA 3TZEA 2ZYUX 5FTLA 5FIUA 1I51A 1XROA 4P3PA 1RHMA 2XXBA 1E9CA 2H2HA 4BUJA 4WBSA 2YX1A 3D8TA 3PA1A 2J3IA 4UBIA 1G9TA 4YP6A 1P5HA 1XZIA 3CE6A 1S4MA 1XEWX 3OZWA 3EVAA 1I7QB 4FMCF 1NXWA 3PUIA 1B43A 2PT9A 4UNIA 1A5BB 1N8KA 4P3NA 4GT1A 3PF8A 4YDSA 1XN4A 2DHQA 4ASUA 2WUWE 2XCIA 3L8DA 2XXAA 3IXMA 4D5GA 3IULA 4P08A 1AQUA 2J30A 2XKJE 4QPNA 4P3OA 1NSYA 4KMSA 4OATA 1U8UA 1XYVA 1K0FA 3PFBA 4RKFA 1AXGA 1H69A 3OLCX 3M83A 1ISHA 1O9GA 4XLLA 3HMQA 3M70A 1JFLA 1JN0A 1O54A 1SG9A 3FDZA 4BMDA 4XLHA 4E5UA 1OROA 1THMA 4Y2TA 5JC1A 4BQEA 1AGPA 1OLSB 3IUNA 4GOXA 5IXSA 1GRCA 5HKOA 4C0LA 3QBTA 4IXWA 3H4VA 4QDXA 9LDTA 1E94E 1VSTA 4AJOA 4GC9A 2CNWA 3MNFA 3QVOA 3AY7A 2C4UA 2Z2IA 4LGMA 4IOKA 4RPHA 3R20A 3T06B 1M66A 1IBRA 2QNRA 5D3MA 3VOTA 1NMYA 1XC7A 4RHUA 2ZSHA 4YQZA 3VNBA 2Q9AA 3IA7A 1MO6A 4HRAA 3GI1A 2Y71A 4QSHA 3NBAA 2ZIUB 1I4LD 4JNCA 1GTSA 3W5CA 1UBHS 4IO0A 2WYOA 1GPUA 1XNJA 3NATA 3GSIA 4WDRA 5BP7A 1PGNA 1Z6QA 3A1NA 3G2JA 3G8AA 4XQ9A 4EJMA 4I2NA 1OFUA 2WD8A 4JCOA 4YT5A 4MX8A 5JZMA 2EX1A 2RAVA 2OV4A 4RTNA 4B87A 1JXMA 1QO0A 4MQLA 3A58B 3V7NA 1ZOOA 4X1OA 3NANA 1U0RA 1RMQA 1JNXX 1ULZA 2JATA 3ABOB 4HN9A 3DAGA 1ZMTA 3N2IA 4PFKA 1IUKA 5G4KB 5MFZA 1NFQA 4AIIA 3THXA 1W36D 1TD1A 4P3XA 1YC5A 1BQEA 2DX7A 2GZRA 3BMOA 3TM4A 1AHIA 1MFPA 4QE3A 2WK1A 4EVQA 4MWSA 1E89A 1HFJA 2YYAA 2ZYSA 2AK3A 1W36B 3I5MA 3D0QA 1RXVA 4WY8A 2Z6AA 1P62B 4EFDA 2IHKA 2A4KA 2WAXA 3HQ4O 4KFRA 1I3OA 5F73A 2P9GA 1CUBA 1T2DA 1V8ZA 2B4KA 2GM5A 4B3FX 2GS9A 3X44A 2TSYB 3IAHA 2JFOA 2X2FA 1NR7A 1OU0A 1U1DA 1JWAB 5D3QA 2ORIA 1K8RA 2JJ1D 1MDBA 4EJSB 5CD1A 4YALA 3UWMA 3VOAA 1T5IA 3E48A 4F5ZA 1PS8A 1SK8A 1XZLA 4NPCA 4HB3A 1ZRNA 2XZTA 1D5CA 2O2EA 3DD1A 3RVJA 1DPGA 2ZJ4A 5KCMA 4X24A 3T4PA 1E3MA 4D45A 4HQKA 4X97A 3VM6A 1OAOA 3SKXA 5KEIA 2ZL5A 1J00A 5A7HA 1DXYA 3EDOA 1G8GA 1IUOA 2QAIA 1MA0A 3LY8A 2OOKA 2VJPA 1VE1A 3B2EA 4GM4A 5LOVB 4M89A 3GGCA 3TR6A 1KGDA 2UUCB 2WMNB 1HQCA 5CH3A 3V2GA 2TS1A 4HAVA 5K0JA 3U56A 2FR8C 1RYBA 4LXHA 3LL7A 1E9SA 5IAGA 2C9BA 3EXEB 1KEEA 2NZJA 2FZ5A 2WSLA 2JIRA 2HT1A 5D2CA 4WFIA 4QA9A 3TE6A 1ZL2A 4ALNA 3EAFA 1KAOA 3MZ0A 4BBJA 3RKUA 2QNIA 4YGYA 5ERYA 1YI1A 2IZZA 1Y5LA 4YWHA 1ZLXA 2G83A 5FPQA 2V7WA 3HJHA 3W2FA 1YA4A 2ADOA 4CU5A 4DIMA 1X80A 2OA0A 2N1BA 3OTQA 5HVNA 3L0DA 3S2EA 4GH5A 1OZFA 3MWEB 1ADBA 1FA9A 4LJLA 3ICEA 4ARUA 1IY9A 2GVDC 1P8AA 1MAAA 3CISA 2RDMA 4D9HA 4O4HF 1SO8A 4ZHQB 5ERGB 1AE1A 2L19A 2VUTA 3K16A 2GCIA 3OZTA 4DC0A 1XPOA 3KEFA 3ED5A 4UNNA 4BGDA 3AEUA 1E2PA 3HBLA 3P0EA 5D6OA 1ML3A 4O2RA 3ON5A 3T7SA 4JT9A 3ZIAA 2BYTA 4FGUA 3K1AB 1R0XA 3IEVA 3RRJA 2HH9A 2CHFA 3AV3A 1BAPA 1GZSA 4CUKA 2ERCA 2V9PA 5DTMA 4GKJB 2K6GA 3N8KA 4LE2A 5TT0A 4ER5A 2BMVA 1Q2XA 2PH1A 2QG9A 5IAKA 5FR2A 4FYXA 4QDKA 1H2WA 3N58A 4FDTA 4XIGS 1Y34E 3I3SR 4WASA 3MGAA 3UKOA 3ZBTA 1VI6A 4IDOA 4ZC1A 3SU8A 3V8EA 4NZZA 3SBOA 2NNLD 4G5RA 1YCDA 5FOXA 3B6EA 2EOAA 3FWKA 2XMQA 4JQSA 1FXSA 1MAVA 1FUEA 1Z7GA 5JYDA 3V8PA 1T1EA 2JGDB 4MPTA 1TJ5A 2VPPA 4R6XA 1WTHD 3U0VA 1PNOA 1TEXA 1ZK3A 2GD1O 1UWLA 2Q46A 4YRZA 5IANA 1BO6A 1FPQA 2PJDA 3M3DA 4DDKA 1XEXB 3BBLA 1E4YA 3PEVA 4G1FA 4EVIA 1QG2A 1ZIXA 6REQB 4F5YA 4YV0A 1W581 2K2QB 4AO7A 4N0DA 1ZQ9A 2HQOA 4KE6A 5AQ1A 1W5TA 4UM8B 3K4HA 5F1YA 4BNUA 1Z18A 4FFBA 1ENOA 2ON6A 3ZWWA 3RFUA 4YQFA 3KL4A 4JWKA 1NDQA 1TQ4A 2W2LD 2G7MC 1DBPA 1E92A 3NNNA 4WKPA 2NO7A 1GNTA 1H8HA 1XPJA 3ZGVA 3SX4A 1D6MA 2Q4RA 1KZ4A 3NBXX 4KLRA 4YA6A 5HJ7A 4IJ6A 2VAPA 2E55A 2WHQA 3MG9A 2Z2JA 2BHLA 4GKBA 4ZODA 1IIRA 1KBQA 3DWIA 3T9DA 5K6RA 2DQSA 2WU0A 1YL5A 3NIBA 4W99A 4LMAA 3F97A 4DUGD 2HXSA 3L6UA 4PZAA 1PBTA 5KVSA 3DEFA 1Q17A 4TRNA 3Q39A 1BH2A 3ESQA 2J08A 4KYVA 3GA5A 1UM9B 3UCFA 2QD5A 5CW1A 2M6LA 1QTRA 3EC1A 4AUKA 5JHHB 2QAGC 1H2YA 4RA9A 1OYWA 2OXTA 1DUSA 3WNDA 1M1ZA 3AF3A 4FJ1A 4HL6A 1ZOIA 2YZMA 4KUHA 1ZJYA 3LXXA 3SJZA 1AQIA 4MP8A 5BO5A 1NPDA 1W4RA 4OMUA 1QRSA 4J4BA 4OSOA 2NYAA 5JU6A 1MNAA 1WCWA 2L82A 1YJAA 3JD2A 3IEMA 2QM8A 1G8AA 4FSDA 4MJ7A 2EWVA 1WHTB 2JI8A 4YHBA 1N3LA 3DE7X 3LCMA 1G19A 4PS0A 5AJHA 1NT4A 5EJEA 3AX6A 3WYCA 3RGGA 4PRLA 1XHEA 2LDXA 1AN9A 1POWA 2GPBA 1EFHA 4EAAA 4O4JB 2XB4A 1KYYA 5HZMA 4AMYA 4E2FA 4Q3NA 4JYMA 3HY3A 1GPNA 5F3DA 3I1YA 4AJ2A 1KHHA 5AFSA 2JAOA 1CVRA 2OZVA 5KI6A 3EIOA 4DYDA 3HVKA 1V6AA 3OHPA 1TC1A 3E7XA 3Q7SA 5C8YF 1NOKA 1Z07A 3FNEA 1HFWA 1FFXA 1EEHA 4JJAA 3JR3A 4YFYA 4EZEA 1UD4A 3TNYA 2C2WA 1XKXA 4GO1A 4J2HA 1XNRB 1YRQA 1P7VA 4I3GA 1TM3E 2OBYA 2BGRA 3RUEA 3Q0IA 2AXEA 5H5JA 2C4HA 1JHUA 1BMTA 3CV3A 1NM5A 2REQA 2JANA 4BAGA 4EG8A 3D1LA 4A0SA 4EY8A 2AR7A 3R6WA 1YB7A 4COOA 2CNOA 4B81A 4BRZA 2KM1A 5KYVA 3EG9A 3KKOA 3HN7A 2IELA 1NUSA 3V55A 4B2YA 4U63A 4JC5A 3TGLA 4AP5A 2VPTA 3COWA 2YBEA 3LQ6A 1CY1A 1RBQA 1UT6A 2ZT7A 4II2A 2QSYA 3LVFO 3LQ2A 3KE9A 4HFMA 5AYVA 4CMKA 2JAQA 1ZFNA 2I33A 2XYGA 3PHBE 1QQAA 4QKQA 1M0EA 3AVXA 1D6SA 2BC9A 3ABZA 1N6IA 4W9RA 5EWLA 5K3BA 3TSOA 4ER3A 5B2ZA 2CDRA 2Q9BA 3A6DA 3R8XA 4CZ2A 5LFAA 1MC4A 2YJ4A 3QXXA 3DDWA 1HYQA 5T64A 3SBEA 2XB8A 1IHMA 1FSFA 2IZ5A 1XYYA 2UV8A 4IXDA 5CPFA 1BFKA 1M6WA 2QA5A 1IUPA 1SXJA 4TPKA 1XZNA 3QPWA 4FC6A 5AI5A 2O23A 4HI0E 1IPEA 1KQFA 3T15A 3SF8B 1OVMA 1W44A 1WUJS 2XWPA 4V02A 5TNXA 4YO8A 5CHEA 1TKRA 4O5OA 2AUNA 1XMVA 4MYDA 1Q1BA 3CHYA 3TMYA 1J39A 2FSFA 4WN9A 3TPZA 1K06A 4D96A 4YLYA 1JSLA 2P3LA 4C6SA 1XJ5A 3RV4A 1CR0A 3AM3A 1U1IA 4N54A 3ROEA 3SYTA 2JC3A 4G0YA 4BVJA 5MN6A 3M33A 5ETJA 2IYRA 4NDZA 3HKCB 1TYDE 5LZ8A 3W9BA 1PBNA 4G25A 3U5TA 3NDIA 2OD9A 5AK6A 2PZJA 5IAOA 1G21B 3D4LA 1IH8A 4YJ3B 1YO6A 2QWXA 1NJGA 3DUFA 1I0LA 1B93A 2R7KA 1WF3A 4IXMA 4NCHA 2UUAB 3MWFA 5LB4A 2F1HA 2O3UA 1ZNXA 4ZI7A 2A4MA 2EJTA 2II6A 3SSOA 5ALNA 3GY0A 5JXWA 1KYIA 3TZLA 3LA6A 4DDTA 3ZDZB 1IZ7A 3F9CA 5CTJA 4I8XA 4FYMA 1T13A 3JAKA 1QYWA 3K20A 4A3SA 4ZVQA 4E4YA 3PI6A 4B35A 1VP3A 5TEWA 1O6GA 3TJRA 4F7DA 5HEKA 3OQPA 3ZZMA 3MCAA 2CHVA 3B38A 1PTJC 3U3JA 1JDSA 2UXBB 1CZNA 4R05A 1HORA 2I1QA 1Z2CA 1Z2OX 4ND5A 3RYHB 1CXZA 3LK6A 1Y9DA 2UZ1A 3CNHA 4MDHA 4RKQA 4LBYA 3BWCA 3COVA 2EARA 4LBWA 2O48X 4GUAA 4JSYA 4ZO4A 4XYEA 5A0FA 4Q19A 3KQVA 4IWNA 1W2WB 3HDHA 1SZPA 4QGFA 2C2XA 2ECPA 1TMKA 1EK5A 4MV8A 5AWFC 4GOLD 3RSZA 4XQFA 1K6JA 3EZLA 4MOWA 2G72A 1W34A 1QK4A 2CDNA 4D1YA 1OB0A 4EL5A 5HWSA 1ZM2A 3B2QA 1RJ9A 3U48A 5D5HA 3RJTA 1P9NA 1U8ZA 4X7BA 4X3OA 4FKZA 2VL7A 5EVJA 4LDJA 1DWQA 3EHEA 3JQGA 1PS9A 2DCUA 1DC7A 1I0IA 2F2TA 1R10A 2YWRA 1JR6A 5DK4A 2POQX 3OA2A 5JLAA 2FLWA 4D0RA 1L5GB 4Z5XA 2NZ2A 4F5EA 1KI8A 3KYCB 3K70C 2P6UA 1RZRA 2BGMA 3NDRA 4D6XA 4KXUA 2QE7A 4KSCA 1IJKA 4CEHA 2ZBFA 5KNLA 3NU1A 5FYQA 2P79A 4D9NA 1D9XA 2VP3A 4TRRA 4D9FA 4EM6A 5ALGA 1KWKA 3PWKA 3LPCA 2XJ9A 4RA6B 3LMKA 1UJ6A 2V8OA 3AR7A 3H83A 5CK4A 1ZC4A 3U13A 2NTVA 1LDYA 1I4OA 3ZVKA 5DK6A 2XMRA 2P9JA 1A04A 2PMWB 1X7GA 3T6KA 3I76A 2GRJA 4OYRA 2C31A 4YIKA 2WQZA 4DILA 2DYKA 4KDCA 5DISB 3CIFA 3U7GA 2DWQA 2PUBA 4Q9IA 1TU4A 3KQMA 3K7EA 3PJGA 1FX0B 3WWZA 1VMKA 4RO0A 1COZA 1U8XX 3WIDA 2UVDA 2JGRA 3PXXA 3Q7RA 4DKXA 5AI6A 1XRLA 4RK5A 1YDEA 5E7JA 2UYGA 2GK6A 4XE5A 4PAGA 4GSLA 4AS3A 1VHOA 2PMDA 2XMCA 1Q7YD 4DJDC 4NZ9A 3ZCVA 2C7OA 1E61A 2ZSBA 4URWR 1FVFA 4M3NA 1AZLA 1ZY2A 4Z4UA 4TSFA 3GFFA 4B6GA 2ZROA 3LKVA 5AM0A 1BVHA 1QHSA 3I0MA 1SWVA 1YI8A 1V0JA 2BL4A 2ZVPX 4WKNA 5JJLA 1YR2A 2R1ZA 4L7QA 4EP1A 5KNDH 1XTTA 2HDOA 4JQZA 3K9NA 4DV7B 3EUEA 3CLTD 1Z5ZA 4M1QA 1ZG3A 5HIJA 1LUAA 4PZCA 4WINA 4UCWA 1NBHA 3TGWA 3OFNA 4Q4HB 4V2IA 4MRRA 5A0TA 3LECA 4BNHA 1V0EA 1VA4A 1QVVA 3CUSA 3OESA 4HDKA 4TKVA 4J0EA 1KI4A 2QVGA 2KX7A 5BMVB 1VHTA 2JPDA 2ZRIA 1I4DD 5FOTA 2O8FB 1TKCA 1DRVA 2PT5A 2PRJA 3WHPA 4WOKA 4YIHA 4JX8A 4X8LA 4WNAB 3EXIA 5AHRA 3WBJA 1WKCA 1ZPDA 2XWQA 4DVJA 2H4FA 2ZRAA 1JDPA 3OEED 1LRJA 3FLBA 4B76A 3CMAB 3OEHD 5FA8A 1C9YA 3O8QB 1YB4A 3KWJA 1N5LA 2VDPB 2H0AA 4IOLA 4J0HA 1J97A 4OGWA 1L7BA 1QYVA 3QMWA 4RELA 5SZJA 3TBHA 3ZOKA 4OX9B 1I2DA 2X15A 5A3RA 5HQTA 4K7JA 2AMVA 4CR6A 2VSQA 2C99A 4ZQEA 5TT1A 5BVGB 3A1SA 3KZ1E 4EIWA 1SUCA 821PA 2ZTSA 3WNBA 3TLCA 2OHIA 2XBUA 2JFFA 4XUDA 4TMWA 2Z8ZA 1US8A 3TCXB 3ASRA 2YWCA 3IPRA 5AKKA 1RKUA 5AKEA 4JMPA 5K0FA 4PC2A 1PFWA 1PLLA 1A9SA 4YDHB 2B1GA 1E4VA 5F76A 4DZZA 4NLLA 4M0EA 2GBLA 4B7AA 1R6TA 1N2CE 4FFOA 2IU6A 3R3JA 4TVKA 4PC6A 1Z25A 3CTPA 3IAFA 1QIKA 3IUBA 1ZGGA 3R6LA 3Q72A 5A0VA 3S27A 2HZBA 1BHO1 1VSQA 4NH4A 2O19A 4HUQB 2Q1XA 1MJGA 1LLUA 3H42B 1JU3A 1CUGA 3FHLA 4B8ZA 5A4AA 5L3SB 4L2IB 2WUVA 1ORHA 4PRKA 4C4PA 5HR5A 1CEEA 4D4HA 1HDCA 2VSYA 2XMBA 3GNLA 2OO5A 3ID6C 3KJGA 1K9VF 2QT1A 4LDQA 3N74A 2XD4A 3KSDO 4NFLA 4BKOA 1PRYA 1XCLA 3R75A 3GLRA 3S1AB 3O03A 5DN9A 4HE5A 3TOZA 4TT3A 2DFDA 2QKYA 3NFRA 2VHVA 4KVZA 5ARDA 3H99A 3NP7A 2V0GA 2OXRA 5CM9C 4A6PA 3PFWO 3SHFA 4CNQA 4Q3BA 3WDLA 1OGYA 4R81A 5DWVA 1P75A 3WL5A 4W8GA 3U6KA 5BXYA 2OLKA 4DSAA 3AU8A 4P58A 3W78A 4CRWB 5ELMA 2G1KA 4UVGA 2FMTA 2J7KA 2V6GA 1N2SA 2OCGA 3R3UA 4WZZA 4RVFA 3UJ8A 5EKXA 1P1KA 4RJTA 5LOVF 1K86A 1MB4A 5JTUA 3PXAA 1T26A 4PY2A 3EFBA 1NR1A 4JT2A 1HLPA 1J99A 2GHRA 3E70C 3P94A 1VBNA 3I3OA 3PT5A 1SVSA 4PIPA 2WYWA 2NV4A 1QNLA 4E7PA 5JALA 5KYWA 1KRXA 2J9XB 4UUBA 4PR0A 5EN4A 4BFUA 1UBEA 3CEHA 3REQA 2WBLC 3KVNA 1OWNA 1ODFA 4N03A 4R68A 3SYMA 3SC3A 4B85A 4CU2A 2JFNA 4ZGWA 3SZOA 5JH7B 1KI7A 4XLAA 4ENUA 1AKYA 2P62A 1MJNA 3L4BC 1IN7A 2AKAB 4GI3A 3CVVA 1Y5RA 4FS8A 4K87A 4RKWA 3WLFA 3O1LA 3HB4X 4GE0A 5CP8A 1PR4A 4YCMA 4UHFA 4FE3A 4M2LA 3N76A 4ME6A 2QTZA 1P80A 5IX8A 4YMSA 5FTWA 5TQ2A 1OASA 2QVBA 2HCFA 3BK1A 4E2YA 3B2NA 2B4TO 1BX1A 4M21A 5CAEA 4IHAA 2XCQA 5DHRA 3DKRA 1E6LA 3JQ9A 5EE3A 1B3RA 4ONEA 1K7SN 1RSZA 2BEUB 3P2YA 2FSSA 1RHUA 3C3PA 3EIEA 3IKVA 3IELA 4FXPA 1T9DA 4W6ZA 4Z4WA 2X0EA 2B1RA 4JH0A 4KMMA 4ZMBA 3O73A 2VHQA 3D3EA 4G0OA 1I36A 1ZCAA 4LXIA 2Q1TA 1EVQA 1G1MA 3E27A 1GP2A 3E3OA 1Y5MA 4CKCA 4B6EA 2OLJA 1I8TA 2FJUA 2HHHB 1F6BA 4XM0A 5IP5A 1HEYA 3FIUA 2BMJA 2FN8A 4Q4JA 3GPIA 1L1EA 1CR6A 2PSDA 2Q5QA 3QVXA 1PJLA 1WVIA 1U3FA 3Q3AA 1GQYA 3OF2A 5E1BA 4F45A 5BQ3A 3QX3A 2OK8A 1TE2A 1X9HA 3C5WP 3QPAA 5FF9A 2R7AA 4WXPA 2GKGA 1FJHA 2KWIA 5JZBA 1GGHA 2R5WA 2W90A 1GZVA 3HWRA 2YDYA 5E1OA 3PNKA 3IP6A 3O4GA 1L4NA 2Y1OA 4BFYA 1W25A 5HOQA 5IDXA 1DAKA 1YS1X 2A30A 4Q7MB 5AJUA 1OH5A 4CMBA 5LUAA 4LFCB 1P0MA 4RVSA 3KU4A 2REBA 3ACCA 1LPPA 3LCVB 4PLHA 4RACA 3EQ7A 4I6EA 1DXHA 1XHLA 3ODGA 2YFHA 4US1R 4HZUB 4IDDA 4E4RA 2ATXA 3V33A 9ABPA 4BXOA 2Y1CA 3T9EA 4TTIA 3E9NA 3GLUA 4KGZA 2PV7A 5TX7A 2W2MA 4DLKA 5DTEA 1TCVA 3FOEC 1FJXA 2WKWA 4BX8A 5K3AA 1ODIA 5EJ9A 3E9DA 2C5AA 4M49A 4US0R 1JFRA 3PC4A 3BCRA 3P96A 3F6BX 4PAMA 4C14A 4EUHA 4BNDA 2RI6A 3P19A 4NBLA 4LYAA 2H52A 1QHIA 1V39A 1ZSVA 5KTMA 4R9RA 3WLPA 3QTTA 1Y7TA 3PFKA 1YMUA 3F46A 3EIUA 3HVIA 1WULS 2Q5CA 3GEGA 3H2IA 4PSVA 3F4KA 1SBNE 1VCNA 3D8HA 3IAS6 4HDRB 1E1KA 1K97A 2O6LA 4GLFA 1NVGA 4QAQA 2WWVD 5J59A 2PZKA 1GUZA 1AY0A 1D2NA 1WPXA 4Y2YA 2C96A 1VXOA 4KAXA 5L4NA 3M6LA 2VXOA 3EH2A 2YXPX 4CCSA 2XYQA 2ZIEA 2FG5A 1BXGB 4C07A 1M83A 2P40A 1UMBA 1FW6A 1PR6A 2UZIR 4JI5B 2PIAA 4LE1A 4H2DA 2FUG1 1RM4A 1KMHA 1LWNA 4CQMA 1K5GA 5HE9A 3EA5A 5A5FA 4YLGA 1A4IA 1R64A 4HB4A 4IKOA 2IYEA 2HHJA 1N9GB 2KPOA 1GL9B 4O1IA 2HK7A 3UWSA 2BGWA 1ACMA 4RKYA 3SNKA 2AJLI 4M0UA 1ZH8A 4OFBA 5CFQA 2IHVA 4RDXA 1RPZA 1KEUA 2HQBA 2D5CA 5LU8A 3WBKA 4J0DA 3DVAA 4R9VA 3IPLA 2IIPA 4K6FA 5FLYA 1SZJG 4GI7A 2ZJ2A 2ZRLA 4DCVA 2FI1A 1N2GA 2ID8A 2GF2A 3Q3IA 4HYYA 3RYFB 2JIPA 1I13A 3PSHA 2DBRA 4BWVA 4OH1A 5G02A 3NHRA 2AYYA 3ICCA 1TT5A 1EWVA 1OBOA 2JLXA 2FSPA 2JLAA 4PAQA 4TYQA 2SKEA 2W4IA 1QQ6A 4D9BA 1WU8A 4BGEA 2HDWA 2I2BA 2Z6BD 1T3TA 2JHPA 1BJTA 2WU4A 3EGDA 3K0FA 3ZE1B 3EPHA 1IQUA 1WOOA 3EUFA 3LH5A 5HKKD 4BVFA 1WW2A 3P0FA 5JXGA 1XJQA 2E4AA 1FFYA 3FOCA 1IHOA 1NW4A 2DKOA 2Z56A 2HA5A 3K8YA 4MZDA 3HYRA 3JQ8A 5EP4A 3R6JA 3VPDA 3ILYA 1NVVR 3A1EA 4OQNA 4C1NA 3TSZA 4CGZA 1JLRA 1FJGB 4S1PA 3QVWA 1NW8A 2BFOA 4WESB 1X9GA 2GUGA 3IT0A 4PX9A 5E7IA 2CV2A 5ALUA 2JN9A 1R4MB 3WK9A 3O9ZA 16PKA 1LPAB 1HSOA 3UOAB 5JPCA 2ZJ6A 1RRCA 4GI5A 2BF4A 2HWWA 2ZYWX 3W7VA 1I2BA 2GZHA 3DBHA 3EBOA 3PL5A 4GWLA 2HWKA 3CVJA 4AT1A 1WQ3A 5IAAA 5THQA 4Y1RB 2NUTB 1FRZA 1HXHA 1PV1A 1N2ZA 4DWVA 3M1AA 4HXGA 1H5UA 1R6BX 1TL7C 2CLOB 4P82A 4XYBA 1W30A 1LX7A 4K46A 3F67A 3HNOA 3VDNB 4DBVO 1YQ9A 1VHQA 2V1UA 4YCLA 3E20A 3MLBA 2VO1A 2ZLBA 3LJKA 1SWWA 1T2VA 2WI8A 4FIDA 4KDEA 3BL8A 4C76A 4GIBA 2YV2A 3CLRC 2Y0BA 4I1VA 4MRNA 5BSWA 3A6KA 3AL3A 4KQXA 2V6IA 1ITZA 4GI1A 2HV8A 4GMHA 3I56B 1QVFB 5JVDF 4BPBA 1FK8A 1YKSA 5KWVA 4BP8A 1L1QA 2A9RA 5F98A 5BSGA 1SRRA 3R0VA 3DB2A 3FYDA 5ICFA 3VJLA 2PX6A 2CXQA 4X8IA 3ISVA 4B40A 2CCKA 2P91A 3TGPA 2GK7A 3OM9A 4A8JA 3AYZB 5B36A 4CKWA 3OOYA 3WFZA 5HRAA 2WYIA 4MW0A 1V5EA 1JEOA 2QT0A 3TQOA 1PFQA 1UQUA 4F9TA 3EXAA 3DCNA 3AUUA 1GUDA 1V3UA 2VJMB 4BECA 3O4RA 3GLTA 5CNJA 3WWCA 1KJYA 2XXAB 3I6ZA 1CTQA 1K6IA 3KCNA 4UAUA 4ZREA 4E31A 1VKHA 3JRNA 1Q82D 3L82B 4ESVA 3TTXA 4XIYA 2NUBA 3GV0A 1QB8A 3ZCSA 1E0SA 1B16A 3A25A 1CJMA 1GGEA 4IICA 3SM3A 4E5VA 1EGMB 1TUEA 2GNOA 2ST1A 5ILQA 1ATZA 5K6TA 2NACA 3IV9A 1AKQA 5ALDA 5DIZA 2CNWD 1ZU5A 2PH5A 3UOWA 4CYMA 5TQJA 2DCMA 1YTUA 2EHJA 2ZWVA 2C3UA 2YNMD 4NYMQ 4RQBA 3UA3A 5KYGA 2I8CA 2C1ZA 3PGJA 1T5LA 3P9QA 4GXQA 1RLMA 4KAAA 3ZGLA 1Y8CA 1KORA 3ADCA 1SBTA 4LECA 1RRFA 2ZYDA 1BEUB 2R7LA 2VDWB 3U44B 4CMIA 5FI0B 2GM9A 4HQOA 2O4CA 2PZEA 3I34X 3NWPA 5KTNA 3MIZA 5D3MB 4YJGA 5EQDA 1KEPA 5HJ5A 4OQEA 4A7PA 3CBGA 4RMIA 4NAVA 2VRWA 1AUQA 1WNFA 2BE9A 4PEVA 4R9SA 4FIZA 1J42A 3ZKAA 4EB6A 2ZBRA 5H9WA 1D4ZA 1XVTA 2IYFA 3U60B 1OIWA 1FBTA 1L4KA 1NVKA 1VJDA 4TTQA 4EKDA 4PX3A 3S2ZA 1L6RA 3KUUA 4FVTA 4L95C 4ZU6X 3BREA 2C94A 2EF0A 1ND6A 3DDUA 1JJVA 3ELUA 2POCA 4IIHA 4PANA 5DSTA 3WQBA 1MA3A 1XZBA 4IRUB 3DLCA 3D3JA 1MX3A 1NV9A 3G9TA 1B8NA 1GM5A 1QLHA 4NOJA 1PQWA 1GY8A 4D8UA 4L0CA 4DMHA 3G88A 3IDQA 1PNQA 2BP7A 3HK2A 4ZI2A 4KKVA 1S9HA 4G5GA 3GLIB 3MYRA 5FV7A 1UPUA 4V0OA 2J6CA 4TXNA 3VSDA 3H9JA 4LBZA 4XONA 3BMOB 2NO6A 4WDQA 1UBFA 1NLYA 3MJDA 1U28A 4LMRA 2GVNA 4BRWA 2JLSA 1NJFA 2P0AA 3OLZA 1OC4A 1PG5A 3H05A 4J2TA 2WYRA 4NV3A 5BXQC 4RD0A 1XIVA 2IODA 3LC7O 1Y1SA 3D5TA 3V1MA 4JMQA 3SG0A 5KCZA 4DWOA 4J0JA 4HIZA 1UDXA 4JP5A 3SSNA 5EXTA 2P90A 2GI4A 4URZR 4K0KB 3A37A 4P33A 1XDBA 1DC6A 3C4QA 5EHZA 3EA0A 5B4TA 4JEHA 1W85A 2ILVA 3EN0A 3SF0A 2A33A 3H3XA 4XW2A 5ALVA 1O9BA 2FW1A 4FJ0A 1E3DA 1X14A 2PKQO 3CZ5A 3HI4A 2XWJI 3OWOA 4FDAA 5IBCA 1U5BA 3RWBA 3BUSA 3TTVA 3R6DA 2ET6A 4ALIA 4DOMA 1V8PA 4DDVA 3U81A 2JFWA 4QHSA 2FRXA 2QI9F 3DLAA 4PWYA 3FCXA 1ADJA 5BSMA 3UTDA 4LRXA 4QU5A 1IDN1 3S3TA 3ZR4B 1BYUA 2W6OA 3FYUA 3PENA 3V7WA 3WYBA 4EQ6A 3B1WA 2J8ZA 2XSZD 4OJMX 1KEEB 1KP2A 3OCUA 3VDMA 4EEZA 1WCIB 3BJIC 3N59A 4JR2A 4FMDB 1R9MA 2X77A 3MBOA 3PRYA 3T3HA 5GVRA 2PMBA 4JBHA 4EYQA 4WLVA 3CP2A 1F17A 4RV5A 1YMQA 4ZC8A 3S7TA 2C42A 2WD9A 2RE8A 1ZUNB 2WICA 3CO5A 4Y6LA 1XZAA 4H1TA 5IFKA 2D7CA 3HSKA 4QREA 3KDPA 3EWNA 3ZIAD 2ERXA 1PHPA 1DLJA 1YZFA 2FOLA 2QLBA 2X1LA 2IIVA 3CE9A 3IBCA 3MTDA 4UMDA 5FBHA 3TFWA 3UG7A 2I7VA 3VAAA 5JDCC 3AEUB 4QDTA 4CM1A 3DYBA 4REQB 3GJ5A 4YRCA 8AT1A 4C4YA 2AZXA 2QN8A 4HMQA 1W5FA 1UH5A 3C0KA 3CLUD 4UEJA 4DGSA 1U94A 3HLKA 3GEMA 1CE8A 1SPXA 1NI3A 4GXNA 1U0GA 3GN2A 1UKYA 4RPGA 2QV0A 3WMWA 1U0HC 2ETVA 1TZBA 2XRMA 3DLTA 4LHXA 1PCXA 4N3BA 3ROPA 2WJIA 4OP7A 3LXRA 4JI1B 5CURA 4B3SB 1SVMA 4B6OA 4ETNA 5CDSA 3KEWA 2IGTA 3FIJA 1Z0DA 1QGYA 3VPXA 1GR1A 2AYZA 4AG6A 4PHGA 4A6XA 1PSWA 1B0PA 2D5AA 2OV3A 4IMPA 2XA9A 5GJWC 3OUZA 4ER0A 3UJDA 2VBFA 1U3TA 2BGJA 1R5JA 1VQ5B 3GBPA 4ISBA 4UKDA 2QTBA 5CR9A 1JDVA 4QEDA 4X7MA 3TAUA 5DM2A 1DIBA 2HT6A 3GBVA 1NXPA 1RHKA 1T9KA 4Z3OA 1TEVA 3UUFA 3SQLA 4PHHA 1W29A 2QW1A 3AIMA 2PJRA 3H2YA 1JBEA 1H8HD 5HXAA 4KMOA 2ZE8A 4CV2A 4B9AA 4FFBB 4KXMA 3CT6A 5JFTA 1PZXA 2WWFA 1SKMA 1QO9A 1JEYA 2HBQA 3SVLA 3ZLJA 4DCTA 2YVUA 3LQEA 2DPLA 1IN5A 4Q7JB 4I14A 4OAPA 2Q3HA 3AY0A 5CFZA 1YZLA 4KE8A 1N0VC 1Y8ZA 3TX2A 4Y0NA 3DNMA 3QPCA 4BDTA 1KMIY 1NXQA 2E87A 2PGLA 3HZOA 3RG8A 4QGSA 4UTRA 5LZ2A 4QGHA 5SZKB 4YECA 4JY7A 2C9CA 2Y2VA 5YASA 1LLFA 3SMVA 4F12A 2GHIA 3C4VA 1FTNA 2B21A 2F3SA 2HGZA 3DBOB 3ND6A 3VNRA 4D82A 5B12A 4IFBA 1Z6PA 1VBMA 3FBGA 1P81A 4LOIA 1YJXA 1X8LA 2M1XA 3SXPA 1PGPA 2IBTA 3AINA 4HWKA 1KEKA 1TYCA 1P1HA 1GRRA 1K8ZB 2AOXA 1O0CA 1MMFB 3AI3A 1D6NA 4FT4A 2I8AA 3K8QA 3ZTWA 5JCPA 1E5VA 4FYVA 2WIKA 4RTJA 4HNGA 1X1QA 5JI2E 1VPEA 4KWCA 4KXWA 5T57A 1Q12A 4JYCA 2G8LA 5FJIA 1EP9A 3BZUA 3G2KA 1GNQA 2E21A 4FHFA 4PCVA 4Y1GA 3TB4A 4BEJA 1JJ7A 5C8ZA 1GTRA 1LF0A 3D2CA 4MWEA 3LBIA 2C4WA 3NV7A 5TPZD 1SU7A 4H6XA 6LDHA 3HVRA 4FUQA 1D5WA 1MBZA 2DBZA 2B0JA 1FU4A 1OWLA 3G0IA 3IT1A 1U31A 4KQ2A 4PHFA 4PO8A 4IRMA 4Q1VA 4RPCA 1GSOA 1FFXB 1M90D 2KBFA 2VYVD 2PBFA 3WE7A 4B4UA 9LDBA 1C5KA 1BHQ1 2QXUA 3GZTB 3SEZA 4B5KA 1CF4A 4KN5A 5BVHA 2GNPA 2KYRA 4KXVA 4OK6A 3L7LA 5IMBA 1TEHA 2HF8A 1ZS9A 1OBFO 2O2SA 1V37A 2REQB 3IPXA 3QVJA 1OB5A 4LE0A 1C30B 4LYGA 4JI0B 3FOFC 1VQLB 1ZR2A 4INZA 1MEOA 4P2NA 1QVZA 4LS3A 1EINA 2I6QA 4DARA 4BTEA 2NIPA 3EG9B 4EI7A 5BQFA 5JEDA 4Z4ZA 3Q5DA 4O33A 1ESNA 2XGJA 4K9PA 3RS8A 3B5EA 1WOMA 4UE3S 2ZR8A 4LNAA 1UC4B 3EOZA 5HMLA 3ZE9A 3F5DA 1JA0A 1YGPA 1DKLA 1T0UA 5EE9A 4Z54A 2R8XA 1KVUA 1MN6A 1PSDA 2MYTA 2QR2A 4QODA 5ESWA 4L27A 2X4GA 2YQ4A 3I6QA 1TLLA 1BGXT 1RC8A 1GKYA 3IEXA 5DT9A 2O50A 5DX0A 3RTDA 3VJMA 3T1HB 3SJPA 3N6RA 5AK5A 1M2EA 2YS7A 4Q39A 3U3XA 3N53A 1EK2A 2GUWA 3E82A 1CYDA 1SXJB 2JIMA 4HFNA 5E9QA 1YMVA 4BMZA 5BV8A 2JGNA 4RESA 3ZDDA 2LVBA 2RARA 1GRVA 3NCHA 4I5EA 4B45A 3TF5A 4TKUA 1XRNA 2BBTA 4OEHA 1UKAA 2JI6A 2HKIA 2I6XA 4TVOA 2UXDB 4CIBA 2EP5A 2QLTA 4M86A 3O8NA 4FN4A 4I50A 4WN9B 3ZHOA 2VRNA 4F2HA 3A28A 1Z47A 2IF2A 1IWPB 3WFIA 3CCEB 4QYWA 5EUMA 5JUWA 1WCYA 1Y9AA 3P4YA 4I9FA 2DXIA 2O7RA 1BA2A 4AMUA 4DT1B 1V8DA 1M2GA 1DDGA 5DX8A 1Y0YA 4AD8A 1FMFA 1LPOA 3JD3A 4QBKA 1I6WA 1XN1A 3PD0A 4IUBS 4XVHA 1PKEA 3IIKA 3VYTB 1FMJA 3GP8A 1IJBA 3O2SB 3RUIA 2F55A 1U2EA 1KO1A 1OH7A 5IK2A 3CSDA 4QUGA 2OO7A 2BMWA 1H2HA 2NLOA 1UMDB 1GGJA 4TLEA 2XHZA 4ZI7B 1HX7A 3IEIA 2HWYA 3FVRA 4HH3C 3Q11A 3ZY2A 1O4WA 1WD5A 1Z29A 3FTPA 4RNDB 5DLPA 4TXHA 1AKUA 3QLUC 5EZSA 5JMWA 1J0AA 4I1SA 5CLQA 3KO8A 4M8NE 1Z74A 3E6AA 3HFGA 1KI6B 1N9ZA 5A03A 4NI5A 5ALOA 1L3BA 4C29A 1WXEA 5I7HA 1C7EA 1YFZA 2NNWB 1ABFA 1I14A 3GVKA 3FPJA 2LWIA 1WKVA 3H4MA 4Z53A 2EF1A 2PS1A 4Q3AA 3P71T 4W7HA 3T7CA 3TSYA 3AHDA 1I5RA 5LDHA 2UZ1B 4X8MA 4CKEB 2WHPA 2QI9C 1CUDA 2GTIA 2ZRJA 1JMYA 3BSWA 1K75A 4FMPA 3CMEB 1RIFA 5EHIA 1JKFA 4K6HA 3V9PA 1T9AA 2VJIA 1E2JA 3BCFA 3EGWA 2WTXA 2D13A 3TTSA 2VPZA 2Q6KA 4W82A 3RRBA 2B5OA 3DBRA 3HJUA 1CB0A 3G0OA 3D2BA 1WM1A 2FDRA 2DVMA 4J0GA 3TD2A 3OOCA 3ESDA 3AEQA 3V1LA 1ISGA 5IKPA 4BNJA 1H3EA 3OCCA 4KU4A 2WYUA 2VHWA 3OLWA 5EA2A 1SOMA 1BQ4A 1PNRA 1G3QA 2GB4A 3C43A 3O8RA 1DELA 1EEXB 3PEFA 1TECE 4DA0A 3L7IA 2IDZA 1JMKC 5TF0A 1IDOA 1GGVA 1K89A 2G7ZA 5DBGA 1QONA 1XQ1A 4M1ZA 4FBMA 3VJKA 2X1HA 3C3WA 3ZEAA 5CB4F 1QTIA 1TFRA 2YDXA 4Q82A 3WP0A 1VL8A 5F5LA 4ZEVA 5BW8A 4LPSA 1JHAA 1Y1LA 5GQSA 2CJWB 4BO5A 1RJDA 3HCFA 1ICEA 3OPYA 3QIVA 4WCDA 2FUKA 2OHXA 4PG5A 3NG1A 4HX2A 3DFFA 2PUTA 1DCKA 1VJTA 2AZMA 3PUMA 2MSLA 2Y1WA 1XZQA 5IYNA 3A4NA 4HMOA 1R00A 5TC4A 1O77A 1PV2A 2QP4A 2R8YA 4UOQA 4YCAA 4W5NA 5DXFA 2AWNA 2C4NA 2VDNB 3BPSA 4HEA6 2GEUA 5CA0A 4M0MA 1JIJA 3PRKE 4NPHA 2MINA 3EASA 1GQ2A 4ZV4A 2N3ZA 1OGIA 1MR3F 3BGOS 3N2KA 4QOSA 1ZRSA 3UHJA 1ISFA 3LW8A 5EQTA 1FRNA 3ZH9B 4TTAA 4G2TA 5G0WA 4ADSG 3DKVA 1VOTA 2E4ZA 3KSRA 4F4CA 5K3CA 3VR1A 3AUAA 1DMRA 2O2CA 4MA5A 3L2OB 3G7UA 2PWBA 1QYCA 2RGGA 1CLEA 1TU3A 2VSXA 3UGKA 5E4TA 4NP6A 2CYAA 3VO8A 3I2HA 3ZU4A 1RI2A 1FQOA 3NORA 5ED0A 4E15A 5L7WA 1NLZA 1Y4DE 5LJLA 3HVUA 1ONNA 3MJTA 4P34A 2Q2WA 3WI7A 4BGIA 5I7FA 2XAUA 5T7BA 1JQJC 4BC0A 1CUCA 4B17A 3ND5A 1ZIYA 4AJLA 1XZHA 3BRWA 3SXUA 5I9LA 2QLNA 2VOJA 3T34A 3PEEA 3ZCXA 4MMXB 1ODCA 4XR4A 4B2LA 4K9RA 2QMYA 1X77A 3KJIA 2BGLA 1BMFA 3A1PA 5F2KA 3NCTA 4A9AA 3EULA 4TKVB 1F2TB 1ZNQO 3IP3A 1DQNA 2BSQA 1XR3A 1HZZA 3UHFA 4AMVA 3QA3E 4X7PA 1IOLA 1E4EA 2PAFA 3KZVA 5FCDA 2TRSB 4Z2YA 4KREA 4L28A 4S3MA 3EXIB 3D43A 2YS6A 1QQ7A 4I5GA 2VH2A 1H9AA 4BRUA 3I4LA 1DDIA 2XOXA 2JD0A 4HNHA 5FUMA 3ASQA 2WE8A 3NYRA 2REOA 3ULKA 3GFVA 3SP1A 2KE5A 2UVPB 1YS9A 1T29A 1OD6A 2P0EA 1UUFA 4MINA 2WWYA 3NFYA 1YB6A 1HDYA 4OHWA 1ZA1A 2EFCB 5J5CA 5IPFA 2A0YA 5CFMA 2LNDA 2GH1A 2NV0A 1TEZA 1OHHA 3FCYA 3NS7A 4MQUA 1KAQA 1I18A 5A6VA 4IZOA 4HB0A 1OX6A 3OQNA 4DK0A 3ORYA 4D97A 2ZRNA 2FV8A 3I62A 3MOIA 3B1YA 3PHCA 3MT9A 5E9JA 4ZVTA 2BKUA 4J49A 3FHCB 2HNAA 1US8B 4EABA 1N05A 1R37A 3GVLA 2C20A 2AUTA 2HV9A 1DKQA 3K6JA 3FGNA 4JZKA 3H9NA 3P9NA 4KO8A 4ZRNA 5DYGA 4F3TA 2OO3A 5K6AC 5MHTA 4WWHA 3HXTA 1PJ5A 3F78A 4WADA 2Z6VA 3G8DA 1C9JA 3GJRA 3H5RA 3KJFA 4RVDA 2RSLA 4WKCA 2I3BA 5EKTA 1L6IA 3Q0TA 4CV3A