3DDYA

Structure of lumazine protein, an optical transponder of luminescent bacteria
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
184
structure length
175
Chain Sequence
MFRGIVQGRGVIRSISKSEDSQRHGIAFPEGMFQLVDVDTVMLVNGCSNTVVRILGDMVYFDIDQALGTTTFDGLKEGDQVNLEIHPGLTGNIKGTALVAAIEENDAGFSVLIDIPKGLAENLTVKDDIGIDGISLPITDMSDSIITLNYSRDLLASTNIASLAKDVKVNVEILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of lumazine protein, an optical transponder of luminescent bacteria.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Luminescent protein
molecule keywords Lumazine protein
total genus 33
structure length 175
sequence length 184
ec nomenclature
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00677 Lum_binding Lumazine binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.20 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ddyA01
2.40.30.20 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ddyA02
3OE7A 2JIZA 2CK3A 2W6JA 3GVLA 1V0FA 1E1QA 3DDYA 3A3BA 2XNDA 3OFNA 3FKSA 5DN6A 1COWA 1MABA 1BMFA 1KZLA 3OEHA 4GQNA 4XD7A 4ASUA 1H8EA 1HZEA 1PKVA 4YXWA 1NBMA 4HIZA 1W0KA 2WPDA 3JU4A 2JJ1A 5IK2A 3ZIAA 1FX0A 1W0JA 5HKKA 2XOKA 3OAAA 4Z1MA 2JDIA 1OHHA 1E1RA 1V0EA 3GVKA 2V7QA 2JJ2A 3A3GA 2WSSA 2QE7A 1I8DA 1EFRA 2R9VA 1E79A 3GQBA 3OEEA 4G6IA 3VR6A 5FL7A 4FXUA 2F43A 2HLDA 4TSFA 5CDFA 2W6IA 1I18A 1SKYB 4E0FA 1H8HA 4TT3A 3A35A 3GVJA 1KMHA
chains in the Genus database with same CATH superfamily
1S72B 2B5OA 4BPRA 1VQMB 2F1LA 3GIRA 1E64A 1YLOA 2BF4A 1KK2A 2OK7A 4Y9UA 1OB2A 3CPWB 1N0VC 3LVBA 1COWA 3Q6RA 1OB0A 2Q6IA 1KD1D 4WQMA 3ZZTA 3LQ6A 5FA6A 3U2QA 4XLAA 1W0JA 2FVGA 4DK0A 2XOKA 2BVNA 4XM3A 4YAUA 3CB4A 1N07A 5IYWA 2CF4A 3CW2A 4XKVA 3R6JA 4AF6A 1UD3A 4LBZA 4X8IA 4XOPA 2GPJA 4NCNA 1JJ2B 1FNMA 4G7WA 1QGAA 2QN6A 4OPVA 2D3NA 1G7RA 1H85A 2ZITA 4XLFA 3ZZUA 4Z4VA 3CP8A 3BY2A 2F4NA 4QVAA 2CW5A 3A35A 5E6TA 3G4SB 1KQSB 2E1BA 2V7WA 2VNKA 4XOTA 1A8PA 2XNDA 2D3LA 4AVZA 1XB2A 3WYAA 2AHOA 1VHOA 1MABA 4M0LA 2DIEA 2NPFA 4XD7A 1HA3A 4PC6A 5TR9A 3BNWA 3FJOA 1IJEA 2WPDA 2QEXB 3A8JA 3ASTA 3CCQB 2C77A 4M2LA 4RPBA 1HVXA 2DETA 2DY1A 4UZEA 3JQRA 1D1NA 1E1RA 3OOCA 4XNFA 1BJKA 1UD4A 5KW9A 2R9VA 1N0UA 4G7XA 5F4MA 1W9XA 2VNIA 2ZTNA 1NB0A 3SKBA 1KK0A 3W2GA 2GREA 3WQZA 1N06A 5TRDA 3CMEB 3W2FA 1QH0A 1YI2B 3OZUA 4TN1A 3SJZA 2V7VA 3OW2B 4GQNA 4OP7A 2WR8A 3WXMA 2X0KA 5H59A 2Q6LA 1M90D 4RJLA 1B2RA 4IW3B 4RM0A 1KK1A 2FX3A 4WZEA 3MMPA 5HXBA 3T56B 1YITB 4PABA 2VBSA 1Y0RA 1JA0A 1OGJA 3GVJA 3GVLA 1PJ5A 4OOXA 3A3BA 4OPOA 2HMAA 2VBVA 3WBJA 4XR6A 2ZTGA 4RD3A 4ASUA 1QFYA 2DYIA 4L8JA 4P3YA 4X7FA 4B48A 3U6BA 2WJYA 1W2BB 3SLNA 1WORA 1DDIA 4UZUA 1FNBA 3H9NA 2B7CA 4FN5A 2ZZFA 3PUMA 1I7PA 1NJID 2JJ2A 4QVJA 2VYQA 3CMMA 2DEUA 3Q38A 4MYTA 4TSFA 1QVGB 2BMWA 4E0FA 3CD6B 2CNDA 3W5HA 4B3GA 4G1BA 2CK3A 1QUEA 1YIJB 1VQ6B 1KTVA 1KK3A 3BCDA 3G6EB 3W2EA 4PGOA 1XFOA 4HIZA 4DQLA 1GAWA 5FIUA 1EFTA 4XN3A 3BQJA 2X6WA 1Q9SA 2V7QA 1D8TA 3OEEA 3ONYA 3PA1A 5AN9A 4FK8A 2GJPA 3VNUA 4U9UA 1NRKA 1CQXA 1QG0A 3DDYA 3OFNA 5IYRA 1K28D 4WZLA 1WOPA 5L46A 1WOSA 1VJSA 3OPOA 4N3NA 3LQEA 4C0SA 4P22A 3I56B 3ES9A 2GQFA 1W35A 1MRZA 2BPOA 2BM1A 3OJXA 2M5SA 2V7UA 3GSIA 4Z1MA 3JQQA 3ASSA 2LZJA 1S0UA 4P9SA 1G7TA 4II3A 5TY0A 3PENA 2WSSA 4P1VA 2ZBVA 3CPXA 2C4UA 3CTAA 4FWTA 4PC3A 1TUIA 3CP2A 4B3XA 1YX2A 2OYNA 2X8KA 3HAGA 5F4JA 1V0FA 2F1MA 1GO2A 2OBRA 4B4DA 2RC5A 3G71B 1T6XA 4M4SA 1E3ZA 4RDLA 2VJIA 2YWEA 2GK6A 4TMVA 2QA4B 1VQ9B 1UD8A 1EP3B 4XQFA 1VQ5B 4XONA 3WNCA 4YAOA 4J0QA 4G5GA 1YJNB 4Z4RA 3WNDA 4OOSA 2CC2A 3CC4B 3BC9A 5A8AA 3PUNA 4G6IA 3VR6A 4RD2A 3RY8A 4X0CA 1BPLA 4X06A 2JIZA 2W6JA 1E1QA 1WPCA 4Z4SA 1F60A 4UZFA 4CQJA 3AVYA 4RD6A 4HE6A 3OZVA 4RCZA 1H42A 2ZXHA 4UAJA 2Q6KA 1P4MA 1G7CA 1ZM4A 2PE3A 4F7DA 2QTZA 3G05A 4YHBA 2VZLA 2VNHA 1NBMA 3NE5B 4Q7JB 5B6IA 5A89A 3A1PA 4YAFA 3Q6QA 3LO8A 3VO1A 1VQ8B 1UMKA 3GVKA 1YHQB 4Y7CA 5CDFA 1DG1G 2CRVA 1M1KD 1FRQA 2D74A 3I1FA 4P6YA 4B47A 1VF7A 4YELA 1G7SA 3QFCA 2BGIA 3W5VA 1E3XA 2OTJB 4WZTA 1EWYA 1BX0A 5H5JA 2YWFA 1WTHD 3AVXA 4XL9A 4LBYA 1T6ZA 1BMFA 1EP1B 2EFGA 4P12A 4YXWA 2V7XA 3V7AA 3CESA 3CMAB 1VQNB 1R5NA 1RQPA 3P27A 5FO1A 4MYUA 4QV2A 3SEJA 2YWHA 5A88A 3OKXA 4NNJA 1OGIA 3CC7B 2HCJB 2QDXA 1GAQA 1IB0A 2VBTA 3B82A 4QUZA 4ZCIA 5BSYA 1BQEA 1BLIA 1KJZA 4FXUA 2HLDA 2GJKA 2WJVA 4ZV4A 1VQLB 3AVWA 4Z4UA 4ACAA 1IHMA 1EFRA 1S4MA 1Q81D 4OPSA 2QGGA 1DARA 4II2A 3KEWA 4R71A 2ZZQA 4WZKA 2E1RA 2XZLA 2ZXIA 4X7DA 3CCUB 2XEXA 2OTLB 4P25A 4RDKA 1B23P 5IK2A 1W0KA 5EMNA 2ZZEA 2JJ1A 4LBVA 3W5UA 3BH4A 4PC7A 2YWGA 4YALA 2X6YA 3CXCB 1UD6A 1E63A 1V5VA 4P3IA 1EP2B 1I8DA 5TV2A 4RLZA 1PJ7A 1XE1A 1I18A 1KMHA 2R6HA 3OE7A 3ONUA 5DS0A 3FKSA 3AVVA 2X6XA 3ASPA 4Z4WA 4XLEA 3MHPA 1KRHA 1NDHA 1ZUNB 2BM0A 3OEHA 2QMUA 4ZCMA 1YJ9B 1VLYA 1GR1A 1T5EA 2XNCA 1WU8A 2PIAA 1QVFB 2JDIA 1OHHA 3AVTA 5BSXA 3CC2B 1T6YA 1V0EA 3KL9A 3A3GA 3CCRB 5FL7A 1Y0YA 2F43A 1K8AD 3BCFA 2V7TA 3ZBTA 1SKYB 1WP6A 2C78A 2OBTA 1H8HA 1UD2A 4Y9RA 4DQKA 2V4DA 2WZNA 2WZPP 4XLCA 5HZBA 2EIXA 2X3UA 3PVDA 4M53A 5F4OA 1EFUA 2DOGA 3JQPA 3VNVA 5J35A 1QFJA 1H8EA 1E62A 3V76A 4DK1A 1RQRA 1ZM2A 2WYRA 3CCMB 4PAAA 1W87A 4TMTA 3J81k 1Q7YD 2C4TA 3SJPA 2JN9A 4YAWA 1FNDA 1DDGA 1CNEA 3ZC3A 4Z4TA 3VO2A 5THXA 2Q6OA 3AVUA 2CBXA 1WDTA 2PMDA 1K9MD 1VQ4B 5JBQA 4XN0A 2HDNB 1WSRA 5LMZA 4X05A 1ELOA 4RD1A 1JB9A 3E1YE 1OB5A 2RC6A 4N3GA 1N05A 1E43A 1QGYA 1HZEA 1XQBA 3QSYA 1R5OA 1Q86D 3ZIAA 3JU4A 5KSWB 4RDJA 3P26A 4PC2A 1N08A 1QUFA 1VQOB 1WOOA 3CCSB 4TMZA 3ZZ0A 5IYQA 5FO0A 4XLHA 1VLOA 2ZBUA 4HE5A 4JMQA 3LNNA 4X7CA 4DNRB 1FDRA 3Q39A 3T51B 1VHEA 2X53S 3ZUGA 4AF7A 1PJ6A 2OBSA 1K73D 4ZGQB 4C43A 3AGPA 4QHYA 3U6KA 2X85A 4LBWA 1F20A 4RD4A 4XORA 4EH1A 2I1LA 3QFSA 2ZL6A 3PA2A 2C5HA 1J9ZA 3SLDA 4B44A 1ZM9A 2DCUA 3H94A 1SKQA 4RCYA 4ZCLA 3ASRA 2BGJA 4DNTB 5HKKA 4Z4ZA 1FX0A 3CCLB 1TTTA 1EXMA 3D26A 2B7BA 2GK7A 3OW7A 4KKTA 1VQKB 3Q3AA 5IYPA 3CCVB 4TKOB 3BY1A 1BX1A 1JA1A 1E79A 3FPPA 1WSVA 2BV3A 2VJJA 1AIPA 3W2IA 4ZGNB 4WWVA 4H9GA 3W2HA 1VQPB 1YJWB 3OJWA 3CCJB 3QFRA 3ISXA 1QGZA 5J3OA 2XGJA 3CCEB 2KVOA 5KNLA 2D9RA 3A8KA 3B78A 4YEJA 2VNJA 1VQ7B 4X07A 1SM4A 2OK8A 2C5BA 3WBKA 3E20A 4LC0A 1FNCA 3MCAA 1CNFA 4TMWA 5HZAA 1D2EA 3A8IA 4OOVA 1PKVA 2ZL7A 3ASQA 2ZZGA 1ZM3A 5GV8A 3ZBUA 3I55B 3QFTA 1UD5A 3AGQA 4QFMA 1IJFA 4P26A 4B3FX 4TMXA 5GV7A 1EFCA 3FPKA 2PLFA 4XKWA 5IYNA 4ROXA 2QE7A 4X7EA 3B8HA 3VMFA 2W6IA 1TVCA 1QFZA 2ZL5A 4KKUA 4NBSA 1TLLA 1W34A 3WY9A 4RPDA 4XMYA 2QTLA 1R5BA 2BN4A 2NV4A 1GJRA 4G1VA 2J7KA 3QE2A 1N8RD 5DN6A 2BSAA 1KC8D 1QX4A 4M1KA 1JNYA 1NB9A 2C2WA 4ACBA 5DSZA 2XZOA 3CRZA 4AC9A 1KZLA 4B43A 2DERA 3ZPNA 2XZPA 4Z4YA 3R6KA 2GJRA 2P3MA 1FRNA 1Q82D 4PC1A 3OP1A 3OAAA 4P6VF 1AMOA 1GVHA 3T53B 2XNJA 3GQBA 2V31A 4KKSA 2VBUA 5FNZA 3OZWA 2Z6BD 3WNBA 1U2RA 4P2NA 4K1XA 4TT3A 4RD0A
chains in the Genus database with same CATH topology
4YELA 4XN0A 2CK3A 1E3XA 1WTHD 4XL9A 1COWA 1E43A 1BMFA 1OB0A 3BCDA 1HZEA 4YXWA 4HIZA 3ZIAA 3CESA 3JU4A 4XLAA 1W0JA 4DK0A 2XOKA 4XM3A 4XKVA 4NNJA 1UD3A 4XLHA 4XN3A 2X6WA 4XOPA 2V7QA 4JMQA 3LNNA 4DNRB 3OEEA 3T51B 2X53S 1BLIA 4G7WA 4XLFA 2D3NA 2HLDA 2GJKA 4FXUA 2WJVA 3CP8A 2GJPA 2X85A 3A35A 1EFRA 2E1BA 1NRKA 3DDYA 3OFNA 4XOTA 1K28D 2XNDA 3KEWA 4II2A 4XORA 2ZZQA 2XZLA 2D3LA 2ZXIA 1VJSA 3OPOA 4AVZA 1MABA 2DIEA 4P22A 4XD7A 3H94A 5IK2A 4DNTB 1W0KA 2WPDA 2ZZEA 2JJ1A 5HKKA 1FX0A 3BH4A 2GK7A 2M5SA 4Z1MA 1HVXA 3OW7A 2LZJA 4KKTA 1E1RA 2X6YA 4II3A 4TKOB 3OOCA 4XNFA 1UD6A 1UD4A 2WSSA 1I8DA 2R9VA 3FPPA 1E79A 2VJJA 4G7XA 3CP2A 1W9XA 2ZTNA 1I18A 1KMHA 3WQZA 3OE7A 2X8KA 3HAGA 2XGJA 1V0FA 2KVOA 2F1MA 5KNLA 3FKSA 4YEJA 2X6XA 4XLEA 1E3ZA 2VJIA 2GK6A 3OEHA 4GQNA 1UD8A 1VLYA 1PKVA 4XQFA 2ZZGA 4XONA 1T5EA 1UD5A 2JDIA 4B3FX 1OHHA 1V0EA 4XKWA 3BC9A 3A3GA 2QE7A 4G6IA 3T56B 3VR6A 5FL7A 2F43A 2W6IA 3BCFA 1SKYB 1WP6A 4KKUA 1UD2A 1H8HA 2V4DA 3GVJA 1BPLA 4XLCA 4XMYA 2JIZA 2W6JA 3GVLA 2WZPP 1E1QA 1WPCA 3A3BA 4XR6A 2ZTGA 5DN6A 2ZXHA 2XZOA 1KZLA 4ASUA 1H8EA 4L8JA 3ZPNA 3G05A 2WJYA 2XZPA 3NE5B 1NBMA 4DK1A 2GJRA 3OAAA 4UZUA 2ZZFA 3GVKA 2JJ2A 3CMMA 3T53B 3GQBA 4KKSA 2V31A 2Z6BD 4TSFA 5CDFA 4E0FA 4B3GA 4TT3A 1VF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OE7 A;  2JIZ A;  2CK3 A;  2W6J A;  3GVL A;  1V0F A;  1E1Q A;  3DDY A;  3A3B A;  2XND A;  3OFN A;  3FKS A;  5DN6 A;  1COW A;  1MAB A;  1BMF A;  1KZL A;  3OEH A;  4GQN A;  4XD7 A;  4ASU A;  1H8E A;  1HZE A;  1PKV A;  4YXW A;  1NBM A;  4HIZ A;  1W0K A;  2WPD A;  3JU4 A;  2JJ1 A;  5IK2 A;  3ZIA A;  1FX0 A;  1W0J A;  5HKK A;  2XOK A;  3OAA A;  4Z1M A;  2JDI A;  1OHH A;  1E1R A;  1V0E A;  3GVK A;  2V7Q A;  2JJ2 A;  3A3G A;  2WSS A;  2QE7 A;  1I8D A;  1EFR A;  2R9V A;  1E79 A;  3GQB A;  3OEE A;  4G6I A;  3VR6 A;  5FL7 A;  4FXU A;  2F43 A;  2HLD A;  4TSF A;  5CDF A;  2W6I A;  1I18 A;  1SKY B;  4E0F A;  1H8H A;  4TT3 A;  3A35 A;  3GVJ A;  1KMH A; 
#chains in the Genus database with same CATH topology
 1S72 B;  2B5O A;  4BPR A;  1VQM B;  2F1L A;  3GIR A;  1E64 A;  1YLO A;  2BF4 A;  1KK2 A;  2OK7 A;  4Y9U A;  1OB2 A;  3CPW B;  1N0V C;  3LVB A;  1COW A;  3Q6R A;  1OB0 A;  2Q6I A;  1KD1 D;  4WQM A;  3ZZT A;  3LQ6 A;  5FA6 A;  3U2Q A;  4XLA A;  1W0J A;  2FVG A;  4DK0 A;  2XOK A;  2BVN A;  4XM3 A;  4YAU A;  3CB4 A;  1N07 A;  5IYW A;  2CF4 A;  3CW2 A;  4XKV A;  3R6J A;  4AF6 A;  1UD3 A;  4LBZ A;  4X8I A;  4XOP A;  2GPJ A;  4NCN A;  1JJ2 B;  1FNM A;  4G7W A;  1QGA A;  2QN6 A;  4OPV A;  2D3N A;  1G7R A;  1H85 A;  2ZIT A;  4XLF A;  3ZZU A;  4Z4V A;  3CP8 A;  3BY2 A;  2F4N A;  4QVA A;  2CW5 A;  3A35 A;  5E6T A;  3G4S B;  1KQS B;  2E1B A;  2V7W A;  2VNK A;  4XOT A;  1A8P A;  2XND A;  2D3L A;  4AVZ A;  1XB2 A;  3WYA A;  2AHO A;  1VHO A;  1MAB A;  4M0L A;  2DIE A;  2NPF A;  4XD7 A;  1HA3 A;  4PC6 A;  5TR9 A;  3BNW A;  3FJO A;  1IJE A;  2WPD A;  2QEX B;  3A8J A;  3AST A;  3CCQ B;  2C77 A;  4M2L A;  4RPB A;  1HVX A;  2DET A;  2DY1 A;  4UZE A;  3JQR A;  1D1N A;  1E1R A;  3OOC A;  4XNF A;  1BJK A;  1UD4 A;  5KW9 A;  2R9V A;  1N0U A;  4G7X A;  5F4M A;  1W9X A;  2VNI A;  2ZTN A;  1NB0 A;  3SKB A;  1KK0 A;  3W2G A;  2GRE A;  3WQZ A;  1N06 A;  5TRD A;  3CME B;  3W2F A;  1QH0 A;  1YI2 B;  3OZU A;  4TN1 A;  3SJZ A;  2V7V A;  3OW2 B;  4GQN A;  4OP7 A;  2WR8 A;  3WXM A;  2X0K A;  5H59 A;  2Q6L A;  1M90 D;  4RJL A;  1B2R A;  4IW3 B;  4RM0 A;  1KK1 A;  2FX3 A;  4WZE A;  3MMP A;  5HXB A;  3T56 B;  1YIT B;  4PAB A;  2VBS A;  1Y0R A;  1JA0 A;  1OGJ A;  3GVJ A;  3GVL A;  1PJ5 A;  4OOX A;  3A3B A;  4OPO A;  2HMA A;  2VBV A;  3WBJ A;  4XR6 A;  2ZTG A;  4RD3 A;  4ASU A;  1QFY A;  2DYI A;  4L8J A;  4P3Y A;  4X7F A;  4B48 A;  3U6B A;  2WJY A;  1W2B B;  3SLN A;  1WOR A;  1DDI A;  4UZU A;  1FNB A;  3H9N A;  2B7C A;  4FN5 A;  2ZZF A;  3PUM A;  1I7P A;  1NJI D;  2JJ2 A;  4QVJ A;  2VYQ A;  3CMM A;  2DEU A;  3Q38 A;  4MYT A;  4TSF A;  1QVG B;  2BMW A;  4E0F A;  3CD6 B;  2CND A;  3W5H A;  4B3G A;  4G1B A;  2CK3 A;  1QUE A;  1YIJ B;  1VQ6 B;  1KTV A;  1KK3 A;  3BCD A;  3G6E B;  3W2E A;  4PGO A;  1XFO A;  4HIZ A;  4DQL A;  1GAW A;  5FIU A;  1EFT A;  4XN3 A;  3BQJ A;  2X6W A;  1Q9S A;  2V7Q A;  1D8T A;  3OEE A;  3ONY A;  3PA1 A;  5AN9 A;  4FK8 A;  2GJP A;  3VNU A;  4U9U A;  1NRK A;  1CQX A;  1QG0 A;  3DDY A;  3OFN A;  5IYR A;  1K28 D;  4WZL A;  1WOP A;  5L46 A;  1WOS A;  1VJS A;  3OPO A;  4N3N A;  3LQE A;  4C0S A;  4P22 A;  3I56 B;  3ES9 A;  2GQF A;  1W35 A;  1MRZ A;  2BPO A;  2BM1 A;  3OJX A;  2M5S A;  2V7U A;  3GSI A;  4Z1M A;  3JQQ A;  3ASS A;  2LZJ A;  1S0U A;  4P9S A;  1G7T A;  4II3 A;  5TY0 A;  3PEN A;  2WSS A;  4P1V A;  2ZBV A;  3CPX A;  2C4U A;  3CTA A;  4FWT A;  4PC3 A;  1TUI A;  3CP2 A;  4B3X A;  1YX2 A;  2OYN A;  2X8K A;  3HAG A;  5F4J A;  1V0F A;  2F1M A;  1GO2 A;  2OBR A;  4B4D A;  2RC5 A;  3G71 B;  1T6X A;  4M4S A;  1E3Z A;  4RDL A;  2VJI A;  2YWE A;  2GK6 A;  4TMV A;  2QA4 B;  1VQ9 B;  1UD8 A;  1EP3 B;  4XQF A;  1VQ5 B;  4XON A;  3WNC A;  4YAO A;  4J0Q A;  4G5G A;  1YJN B;  4Z4R A;  3WND A;  4OOS A;  2CC2 A;  3CC4 B;  3BC9 A;  5A8A A;  3PUN A;  4G6I A;  3VR6 A;  4RD2 A;  3RY8 A;  4X0C A;  1BPL A;  4X06 A;  2JIZ A;  2W6J A;  1E1Q A;  1WPC A;  4Z4S A;  1F60 A;  4UZF A;  4CQJ A;  3AVY A;  4RD6 A;  4HE6 A;  3OZV A;  4RCZ A;  1H42 A;  2ZXH A;  4UAJ A;  2Q6K A;  1P4M A;  1G7C A;  1ZM4 A;  2PE3 A;  4F7D A;  2QTZ A;  3G05 A;  4YHB A;  2VZL A;  2VNH A;  1NBM A;  3NE5 B;  4Q7J B;  5B6I A;  5A89 A;  3A1P A;  4YAF A;  3Q6Q A;  3LO8 A;  3VO1 A;  1VQ8 B;  1UMK A;  3GVK A;  1YHQ B;  4Y7C A;  5CDF A;  1DG1 G;  2CRV A;  1M1K D;  1FRQ A;  2D74 A;  3I1F A;  4P6Y A;  4B47 A;  1VF7 A;  4YEL A;  1G7S A;  3QFC A;  2BGI A;  3W5V A;  1E3X A;  2OTJ B;  4WZT A;  1EWY A;  1BX0 A;  5H5J A;  2YWF A;  1WTH D;  3AVX A;  4XL9 A;  4LBY A;  1T6Z A;  1BMF A;  1EP1 B;  2EFG A;  4P12 A;  4YXW A;  2V7X A;  3V7A A;  3CES A;  3CMA B;  1VQN B;  1R5N A;  1RQP A;  3P27 A;  5FO1 A;  4MYU A;  4QV2 A;  3SEJ A;  2YWH A;  5A88 A;  3OKX A;  4NNJ A;  1OGI A;  3CC7 B;  2HCJ B;  2QDX A;  1GAQ A;  1IB0 A;  2VBT A;  3B82 A;  4QUZ A;  4ZCI A;  5BSY A;  1BQE A;  1BLI A;  1KJZ A;  4FXU A;  2HLD A;  2GJK A;  2WJV A;  4ZV4 A;  1VQL B;  3AVW A;  4Z4U A;  4ACA A;  1IHM A;  1EFR A;  1S4M A;  1Q81 D;  4OPS A;  2QGG A;  1DAR A;  4II2 A;  3KEW A;  4R71 A;  2ZZQ A;  4WZK A;  2E1R A;  2XZL A;  2ZXI A;  4X7D A;  3CCU B;  2XEX A;  2OTL B;  4P25 A;  4RDK A;  1B23 P;  5IK2 A;  1W0K A;  5EMN A;  2ZZE A;  2JJ1 A;  4LBV A;  3W5U A;  3BH4 A;  4PC7 A;  2YWG A;  4YAL A;  2X6Y A;  3CXC B;  1UD6 A;  1E63 A;  1V5V A;  4P3I A;  1EP2 B;  1I8D A;  5TV2 A;  4RLZ A;  1PJ7 A;  1XE1 A;  1I18 A;  1KMH A;  2R6H A;  3OE7 A;  3ONU A;  5DS0 A;  3FKS A;  3AVV A;  2X6X A;  3ASP A;  4Z4W A;  4XLE A;  3MHP A;  1KRH A;  1NDH A;  1ZUN B;  2BM0 A;  3OEH A;  2QMU A;  4ZCM A;  1YJ9 B;  1VLY A;  1GR1 A;  1T5E A;  2XNC A;  1WU8 A;  2PIA A;  1QVF B;  2JDI A;  1OHH A;  3AVT A;  5BSX A;  3CC2 B;  1T6Y A;  1V0E A;  3KL9 A;  3A3G A;  3CCR B;  5FL7 A;  1Y0Y A;  2F43 A;  1K8A D;  3BCF A;  2V7T A;  3ZBT A;  1SKY B;  1WP6 A;  2C78 A;  2OBT A;  1H8H A;  1UD2 A;  4Y9R A;  4DQK A;  2V4D A;  2WZN A;  2WZP P;  4XLC A;  5HZB A;  2EIX A;  2X3U A;  3PVD A;  4M53 A;  5F4O A;  1EFU A;  2DOG A;  3JQP A;  3VNV A;  5J35 A;  1QFJ A;  1H8E A;  1E62 A;  3V76 A;  4DK1 A;  1RQR A;  1ZM2 A;  2WYR A;  3CCM B;  4PAA A;  1W87 A;  4TMT A;  3J81 k;  1Q7Y D;  2C4T A;  3SJP A;  2JN9 A;  4YAW A;  1FND A;  1DDG A;  1CNE A;  3ZC3 A;  4Z4T A;  3VO2 A;  5THX A;  2Q6O A;  3AVU A;  2CBX A;  1WDT A;  2PMD A;  1K9M D;  1VQ4 B;  5JBQ A;  4XN0 A;  2HDN B;  1WSR A;  5LMZ A;  4X05 A;  1ELO A;  4RD1 A;  1JB9 A;  3E1Y E;  1OB5 A;  2RC6 A;  4N3G A;  1N05 A;  1E43 A;  1QGY A;  1HZE A;  1XQB A;  3QSY A;  1R5O A;  1Q86 D;  3ZIA A;  3JU4 A;  5KSW B;  4RDJ A;  3P26 A;  4PC2 A;  1N08 A;  1QUF A;  1VQO B;  1WOO A;  3CCS B;  4TMZ A;  3ZZ0 A;  5IYQ A;  5FO0 A;  4XLH A;  1VLO A;  2ZBU A;  4HE5 A;  4JMQ A;  3LNN A;  4X7C A;  4DNR B;  1FDR A;  3Q39 A;  3T51 B;  1VHE A;  2X53 S;  3ZUG A;  4AF7 A;  1PJ6 A;  2OBS A;  1K73 D;  4ZGQ B;  4C43 A;  3AGP A;  4QHY A;  3U6K A;  2X85 A;  4LBW A;  1F20 A;  4RD4 A;  4XOR A;  4EH1 A;  2I1L A;  3QFS A;  2ZL6 A;  3PA2 A;  2C5H A;  1J9Z A;  3SLD A;  4B44 A;  1ZM9 A;  2DCU A;  3H94 A;  1SKQ A;  4RCY A;  4ZCL A;  3ASR A;  2BGJ A;  4DNT B;  5HKK A;  4Z4Z A;  1FX0 A;  3CCL B;  1TTT A;  1EXM A;  3D26 A;  2B7B A;  2GK7 A;  3OW7 A;  4KKT A;  1VQK B;  3Q3A A;  5IYP A;  3CCV B;  4TKO B;  3BY1 A;  1BX1 A;  1JA1 A;  1E79 A;  3FPP A;  1WSV A;  2BV3 A;  2VJJ A;  1AIP A;  3W2I A;  4ZGN B;  4WWV A;  4H9G A;  3W2H A;  1VQP B;  1YJW B;  3OJW A;  3CCJ B;  3QFR A;  3ISX A;  1QGZ A;  5J3O A;  2XGJ A;  3CCE B;  2KVO A;  5KNL A;  2D9R A;  3A8K A;  3B78 A;  4YEJ A;  2VNJ A;  1VQ7 B;  4X07 A;  1SM4 A;  2OK8 A;  2C5B A;  3WBK A;  3E20 A;  4LC0 A;  1FNC A;  3MCA A;  1CNF A;  4TMW A;  5HZA A;  1D2E A;  3A8I A;  4OOV A;  1PKV A;  2ZL7 A;  3ASQ A;  2ZZG A;  1ZM3 A;  5GV8 A;  3ZBU A;  3I55 B;  3QFT A;  1UD5 A;  3AGQ A;  4QFM A;  1IJF A;  4P26 A;  4B3F X;  4TMX A;  5GV7 A;  1EFC A;  3FPK A;  2PLF A;  4XKW A;  5IYN A;  4ROX A;  2QE7 A;  4X7E A;  3B8H A;  3VMF A;  2W6I A;  1TVC A;  1QFZ A;  2ZL5 A;  4KKU A;  4NBS A;  1TLL A;  1W34 A;  3WY9 A;  4RPD A;  4XMY A;  2QTL A;  1R5B A;  2BN4 A;  2NV4 A;  1GJR A;  4G1V A;  2J7K A;  3QE2 A;  1N8R D;  5DN6 A;  2BSA A;  1KC8 D;  1QX4 A;  4M1K A;  1JNY A;  1NB9 A;  2C2W A;  4ACB A;  5DSZ A;  2XZO A;  3CRZ A;  4AC9 A;  1KZL A;  4B43 A;  2DER A;  3ZPN A;  2XZP A;  4Z4Y A;  3R6K A;  2GJR A;  2P3M A;  1FRN A;  1Q82 D;  4PC1 A;  3OP1 A;  3OAA A;  4P6V F;  1AMO A;  1GVH A;  3T53 B;  2XNJ A;  3GQB A;  2V31 A;  4KKS A;  2VBU A;  5FNZ A;  3OZW A;  2Z6B D;  3WNB A;  1U2R A;  4P2N A;  4K1X A;  4TT3 A;  4RD0 A; 
#chains in the Genus database with same CATH homology
 4YEL A;  4XN0 A;  2CK3 A;  1E3X A;  1WTH D;  4XL9 A;  1COW A;  1E43 A;  1BMF A;  1OB0 A;  3BCD A;  1HZE A;  4YXW A;  4HIZ A;  3ZIA A;  3CES A;  3JU4 A;  4XLA A;  1W0J A;  4DK0 A;  2XOK A;  4XM3 A;  4XKV A;  4NNJ A;  1UD3 A;  4XLH A;  4XN3 A;  2X6W A;  4XOP A;  2V7Q A;  4JMQ A;  3LNN A;  4DNR B;  3OEE A;  3T51 B;  2X53 S;  1BLI A;  4G7W A;  4XLF A;  2D3N A;  2HLD A;  2GJK A;  4FXU A;  2WJV A;  3CP8 A;  2GJP A;  2X85 A;  3A35 A;  1EFR A;  2E1B A;  1NRK A;  3DDY A;  3OFN A;  4XOT A;  1K28 D;  2XND A;  3KEW A;  4II2 A;  4XOR A;  2ZZQ A;  2XZL A;  2D3L A;  2ZXI A;  1VJS A;  3OPO A;  4AVZ A;  1MAB A;  2DIE A;  4P22 A;  4XD7 A;  3H94 A;  5IK2 A;  4DNT B;  1W0K A;  2WPD A;  2ZZE A;  2JJ1 A;  5HKK A;  1FX0 A;  3BH4 A;  2GK7 A;  2M5S A;  4Z1M A;  1HVX A;  3OW7 A;  2LZJ A;  4KKT A;  1E1R A;  2X6Y A;  4II3 A;  4TKO B;  3OOC A;  4XNF A;  1UD6 A;  1UD4 A;  2WSS A;  1I8D A;  2R9V A;  3FPP A;  1E79 A;  2VJJ A;  4G7X A;  3CP2 A;  1W9X A;  2ZTN A;  1I18 A;  1KMH A;  3WQZ A;  3OE7 A;  2X8K A;  3HAG A;  2XGJ A;  1V0F A;  2KVO A;  2F1M A;  5KNL A;  3FKS A;  4YEJ A;  2X6X A;  4XLE A;  1E3Z A;  2VJI A;  2GK6 A;  3OEH A;  4GQN A;  1UD8 A;  1VLY A;  1PKV A;  4XQF A;  2ZZG A;  4XON A;  1T5E A;  1UD5 A;  2JDI A;  4B3F X;  1OHH A;  1V0E A;  4XKW A;  3BC9 A;  3A3G A;  2QE7 A;  4G6I A;  3T56 B;  3VR6 A;  5FL7 A;  2F43 A;  2W6I A;  3BCF A;  1SKY B;  1WP6 A;  4KKU A;  1UD2 A;  1H8H A;  2V4D A;  3GVJ A;  1BPL A;  4XLC A;  4XMY A;  2JIZ A;  2W6J A;  3GVL A;  2WZP P;  1E1Q A;  1WPC A;  3A3B A;  4XR6 A;  2ZTG A;  5DN6 A;  2ZXH A;  2XZO A;  1KZL A;  4ASU A;  1H8E A;  4L8J A;  3ZPN A;  3G05 A;  2WJY A;  2XZP A;  3NE5 B;  1NBM A;  4DK1 A;  2GJR A;  3OAA A;  4UZU A;  2ZZF A;  3GVK A;  2JJ2 A;  3CMM A;  3T53 B;  3GQB A;  4KKS A;  2V31 A;  2Z6B D;  4TSF A;  5CDF A;  4E0F A;  4B3G A;  4TT3 A;  1VF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...