3DDYA

Structure of lumazine protein, an optical transponder of luminescent bacteria
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
184
structure length
175
Chain Sequence
MFRGIVQGRGVIRSISKSEDSQRHGIAFPEGMFQLVDVDTVMLVNGCSNTVVRILGDMVYFDIDQALGTTTFDGLKEGDQVNLEIHPGLTGNIKGTALVAAIEENDAGFSVLIDIPKGLAENLTVKDDIGIDGISLPITDMSDSIITLNYSRDLLASTNIASLAKDVKVNVEILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Lumazine protein
publication title Structure of lumazine protein, an optical transponder of luminescent bacteria.
pubmed doi rcsb
source organism Photobacterium leiognathi
total genus 33
structure length 175
sequence length 184
ec nomenclature
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00677 Lum_binding Lumazine binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.20 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ddyA01
2.40.30.20 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ddyA02
1E1RA 1KZLA 4Z1MA 5CDFA 3OAAA 4TSFA 5HKKA 2F43A 1KMHA 3A3BA 3OEHA 5IK2A 3A35A 3OE7A 1NBMA 2QE7A 3GVKA 1V0EA 4E0FA 1I8DA 2JIZA 3DDYA 2W6JA 2CK3A 3OFNA 3GQBA 4GQNA 1EFRA 1E79A 3FKSA 4ASUA 1V0FA 3VR6A 2JJ2A 1H8HA 3GVJA 2XOKA 2W6IA 4XD7A 4FXUA 1FX0A 4TT3A 1BMFA 1SKYB 1I18A 1OHHA 1W0KA 1W0JA 3OEEA 2WSSA 1E1QA 2R9VA 2WPDA 3A3GA 4YXWA 3ZIAA 1MABA 1H8EA 1COWA 4HIZA 5FL7A 1PKVA 2JDIA 2HLDA 2JJ1A 1HZEA 2V7QA 4G6IA 5DN6A 2XNDA 3GVLA 3JU4A
chains in the Genus database with same CATH superfamily
2I1LA 1B23P 5CDFA 1KK0A 3Q38A 3QFRA 1WU8A 4XR6A 3QFTA 3WBJA 2ZBVA 3CRZA 4F7DA 4Y7CA 1UD4A 3LQEA 3PENA 3W2HA 2FVGA 3DDYA 3CCLB 3WNBA 2XEXA 1EP1B 3QFSA 1UD8A 3OOCA 2V7WA 2V7TA 1E43A 3W5VA 3GVJA 2W6IA 2WR8A 1E3XA 2M5SA 4TN1A 2XNJA 4P2NA 4YAWA 4RD0A 4XONA 1D1NA 2ZZQA 1R5BA 1KQSB 1H42A 1H8EA 4OPOA 2Z6BD 5FL7A 4RD6A 2C5BA 2V31A 2V7QA 4RDJA 2VBUA 3JU4A 4B3FX 5HXBA 3HAGA 1VQ4B 2F43A 1KMHA 4P3IA 5IK2A 3D26A 4FWTA 3WXMA 1K28D 3G4SB 1T6YA 3AVXA 1WSRA 1EWYA 1VQ6B 2DCUA 3ZZTA 1QUFA 1VHEA 1F20A 4Z4ZA 1N07A 1QGZA 3H9NA 4TMTA 1QG0A 2Q6OA 2EIXA 3CP2A 1MABA 5IYPA 2C4UA 3BCDA 4NBSA 1COWA 4R71A 5J3OA 4NNJA 2B5OA 4WZLA 4OOVA 2JJ1A 4RD4A 2ZZGA 4E0FA 1Q7YD 2DEUA 3B8HA 1E1RA 1GAQA 4Z1MA 3V7AA 2OK8A 1ZUNB 4AC9A 5A88A 1I7PA 5DS0A 3A3BA 5TRDA 1DDGA 2XGJA 3OZUA 1IJEA 4B4DA 1KK1A 4Q7JB 5F4OA 3U6KA 1FX0A 2F1LA 2XNCA 4C43A 4P3YA 4WQMA 3PA2A 3OEEA 1YHQB 1E1QA 2CBXA 4H9GA 3P27A 1NJID 4Y9RA 5F4MA 1TUIA 3MMPA 3PVDA 2CRVA 1YIJB 4XN3A 4P6YA 3BCFA 5HZBA 1D2EA 4XORA 2BM0A 4YELA 4X7FA 4XQFA 4ZGQB 1EP3B 1K8AD 1FNBA 1QVFB 3CCUB 3MHPA 2CC2A 3B78A 5JBQA 3G71B 2B7BA 2D3LA 4YAUA 2X6WA 3QFCA 3T51B 4WZTA 4U9UA 4BPRA 1D8TA 3WNDA 4Z4SA 1OB0A 2YWFA 4G7XA 4QV2A 3I56B 1M90D 1UD3A 2X8KA 3WBKA 3B82A 1EFUA 1YJNB 4UZFA 2BGIA 1WDTA 3JQRA 1T6XA 4RM0A 3OP1A 4N3NA 3Q39A 4ZCMA 4DNRB 3GSIA 4DK0A 3OAAA 2GK6A 4TSFA 1VQ7B 2CW5A 3BY2A 2WZPP 4P25A 2NPFA 1FNDA 2ZL5A 3OEHA 5F4JA 3FJOA 2QMUA 1V0EA 3T53B 1W2BB 4JMQA 2PE3A 3CC4B 3FKSA 4XM3A 1EP2B 4RCZA 2VJJA 2ZTGA 4X7CA 1S72B 3CPXA 2B7CA 1QFZA 4OPVA 3CD6B 4XLHA 1YITB 4X7DA 3AVTA 3ZPNA 2GPJA 3W5UA 4P9SA 5GV8A 3CMEB 2HCJB 2R9VA 3SJZA 2X6YA 1GO2A 1VQPB 3ASPA 3J81k 1QGYA 3WQZA 2ZL6A 4Z4UA 1AIPA 3ZC3A 1UD5A 4ACBA 4X8IA 4QUZA 1RQPA 3ZZUA 2WZNA 5FIUA 3ISXA 1PJ6A 2X3UA 2WYRA 4B44A 1OB2A 2PIAA 5GV7A 2QE7A 1JA0A 3OFNA 2VBSA 4LC0A 3CCVB 1R5OA 3ZBTA 1E79A 1WOPA 3A8JA 2KVOA 4AVZA 3VR6A 1Y0YA 4KKTA 1A8PA 3G6EB 1ZM9A 2BV3A 1QVGB 1G7SA 1BMFA 1W0KA 2QDXA 5B6IA 1ZM4A 1BX0A 2YWHA 1VQNB 3CW2A 2RC6A 2ZXHA 4YEJA 4PC3A 1BPLA 1NB0A 1N0UA 1Q86D 1FNCA 3NE5B 4RCYA 4X06A 3CMMA 4G5GA 4TMWA 1BJKA 3LNNA 1S0UA 1XQBA 3CC2B 3PA1A 3R6KA 2ZTNA 4QVAA 4WZEA 4Z4YA 5DSZA 3FPKA 2BGJA 2CK3A 2VZLA 3ONUA 1XE1A 3CCEB 3GIRA 4XKVA 3VNVA 1W34A 3ZBUA 1VQKB 4XOTA 3CCQB 2JN9A 4NCNA 2X85A 4PC2A 5J35A 4M4SA 4TT3A 1SKYB 4P6VF 3CPWB 1N05A 1TVCA 2VYQA 2YWEA 3SLDA 1G7TA 5L46A 1VQ5B 3WY9A 2BN4A 1FRQA 2GJPA 5H59A 4XNFA 1IB0A 3ASQA 4B47A 1PJ5A 2PMDA 1WPCA 4TMVA 3OPOA 1VQ8B 1EFCA 1QFYA 2DETA 4TMXA 2VJIA 1E63A 1VJSA 3OW7A 1R5NA 1ZM3A 1VHOA 4ASUA 4YAFA 5EMNA 1CQXA 1KK3A 2V4DA 1KD1D 1W9XA 4YHBA 5A89A 3CP8A 1VLYA 4OP7A 5AN9A 4TMZA 2DERA 2LZJA 1CNEA 2GJRA 2P3MA 4C0SA 5IYWA 1M1KD 1PKVA 2BVNA 2HDNB 5TY0A 3PUMA 2XZOA 3OKXA 3GVLA 2OTJB 2HMAA 2CF4A 3QE2A 1AMOA 3BH4A 2ZZEA 3CCRB 1E62A 3R6JA 2D3NA 2DY1A 1KJZA 2ZXIA 4DQKA 5E6TA 1E3ZA 1DDIA 4XL9A 3V76A 2OYNA 1IHMA 1KRHA 2V7UA 4XD7A 3BY1A 1EFTA 4DQLA 1OHHA 4QFMA 1OGIA 2Q6LA 4RLZA 2ZL7A 2ZITA 4P12A 1T6ZA 2HLDA 1HZEA 1VQ9B 1VQLB 3W2EA 3VO1A 3ASRA 1KZLA 4FK8A 4ZCIA 1YX2A 1Q81D 3VNUA 3AGQA 4RJLA 3SEJA 3BQJA 1NBMA 1I8DA 2VBVA 4XLCA 4GQNA 2QA4B 1NB9A 4ZV4A 1K9MD 2OBTA 1WOSA 1WTHD 2JJ2A 5BSXA 1MRZA 3A8KA 4B3XA 2XOKA 4P22A 2D74A 4X07A 2QTLA 1QX4A 1Y0RA 2WPDA 4ROXA 4QHYA 4ZGNB 4XLEA 1N8RD 4M1KA 1N08A 1UMKA 1EXMA 2OK7A 2YWGA 3VMFA 2J7KA 1VQMB 3CCMB 4P26A 3E20A 3VO2A 1DARA 2V7XA 2E1BA 5FO0A 3ZZ0A 3Q6RA 2C78A 1T5EA 4WZKA 2ZZFA 1Q82D 3P26A 1Q9SA 4HE5A 1GJRA 1U2RA 1CNFA 1V0FA 4HE6A 2XZPA 4Z4VA 2F1MA 5H5JA 4WWVA 1I18A 4RDLA 1KTVA 2X6XA 4UZUA 4Y9UA 4X05A 3SJPA 1G7RA 3AGPA 1OGJA 1UD6A 1W0JA 3LVBA 4X7EA 1GR1A 5TR9A 2EFGA 3AVWA 5KW9A 1GAWA 3OE7A 4XLFA 2D9RA 4IW3B 2XNDA 4PC1A 1WSVA 3T56B 1S4MA 3FPPA 1TLLA 3BNWA 4X0CA 1WP6A 1OB5A 1QGAA 2JIZA 4PC7A 2CNDA 3GQBA 2RC5A 3G05A 3JQQA 3ZUGA 4LBVA 4Z4RA 1PJ7A 2ZBUA 1JA1A 1H8HA 5IYNA 1ELOA 3WNCA 2QGGA 2FX3A 2WSSA 2OBSA 2AHOA 2QEXB 2OTLB 3ZIAA 3A1PA 4YXWA 4II3A 3SKBA 3W2FA 4P1VA 3ONYA 3Q6QA 3WYAA 4OOXA 1WOOA 2DIEA 2WJVA 2DYIA 1SKQA 5HKKA 3A35A 5IYRA 3MCAA 1TTTA 4UZEA 4B48A 3OJWA 1VQOB 1P4MA 4RPDA 4PABA 1FDRA 3U6BA 4EH1A 2E1RA 2C77A 2VNIA 3KEWA 2OBRA 2PLFA 1QUEA 3OZWA 3CXCB 1YJWB 4MYTA 1YJ9B 3OZVA 4II2A 5KNLA 4AF7A 2X53S 4M53A 1W87A 2BF4A 2XZLA 2QTZA 4G1VA 2VNJA 4RDKA 4PC6A 4OPSA 1V5VA 4J0QA 3KL9A 1WORA 2C5HA 4XMYA 3PUNA 2F4NA 2DOGA 1W35A 1E64A 1H85A 3GVKA 5TV2A 1HVXA 4ZCLA 2GK7A 1XB2A 3ASTA 3ES9A 1UD2A 1DG1G 5FA6A 3CCJB 1RQRA 2V7VA 1FNMA 1B2RA 1VF7A 3AVVA 1G7CA 3OW2B 3RY8A 4M2LA 1N06A 2GJKA 4B3GA 4PGOA 4RD1A 1BLIA 1SM4A 5FNZA 4XN0A 5IYQA 5LMZA 4ACAA 1HA3A 4YAOA 2X0KA 3CB4A 1YLOA 2VBTA 5DN6A 4G6IA 1NRKA 4L8JA 2Q6IA 3U2QA 3SLNA 3A8IA 2C2WA 4MYUA 4XLAA 2QN6A 3W2IA 4B43A 3AVYA 4XKWA 3QSYA 1XFOA 4G7WA 1VLOA 1J9ZA 4PAAA 1BX1A 4KKUA 4TKOB 3I55B 4CQJA 3CTAA 4LBWA 3Q3AA 4FXUA 5A8AA 3JQPA 3W5HA 4Z4WA 4OOSA 5FO1A 4N3GA 4XOPA 3A3GA 1NDHA 5BSYA 4HIZA 4AF6A 1IJFA 3ASSA 4Z4TA 1KK2A 4RPBA 2R6HA 3E1YE 3H94A 2GQFA 2GREA 4DK1A 3CMAB 1QFJA 4LBZA 4QVJA 1FRNA 4KKSA 3CESA 1F60A 4M0LA 2W6JA 2BPOA 3W2GA 5HZAA 3CC7B 1EFRA 5THXA 1QH0A 4FN5A 4YALA 4K1XA 3CCSB 3BC9A 4RD3A 2Q6KA 5KSWB 3I1FA 1KC8D 1JJ2B 4G1BA 4DNTB 2VNKA 2NV4A 1JNYA 1GVHA 1K73D 2BM1A 4LBYA 1ZM2A 1N0VC 2BSAA 2VNHA 3LO8A 2WJYA 1YI2B 1BQEA 3AVUA 3OJXA 3LQ6A 4UAJA 2JDIA 2BMWA 1JB9A 4RD2A 2C4TA
chains in the Genus database with same CATH topology
5CDFA 5HKKA 4XR6A 3BH4A 2WZPP 2ZZEA 3OEHA 2D3NA 3A35A 2ZXIA 1UD4A 1V0EA 3DDYA 1E3ZA 3T53B 4JMQA 3FKSA 4XM3A 1UD8A 3OOCA 2VJJA 2ZTGA 1E43A 4XL9A 3KEWA 3GVJA 2W6IA 4XD7A 1E3XA 2M5SA 4XLHA 4XONA 3ZPNA 1OHHA 2ZZQA 4II2A 2R9VA 2X6YA 5KNLA 1H8EA 2Z6BD 5FL7A 2X53S 3WQZA 2V31A 2HLDA 1UD5A 1HZEA 2V7QA 2XZLA 3JU4A 1KZLA 4B3FX 4TSFA 3HAGA 2F43A 1KMHA 4XMYA 5IK2A 1NBMA 2QE7A 3GVKA 1K28D 1I8DA 3OFNA 1HVXA 4XLCA 4GQNA 1E79A 2GK7A 2KVOA 1WTHD 3VR6A 4AVZA 2JJ2A 1UD2A 4KKTA 2XOKA 4P22A 1BMFA 1VF7A 1W0KA 2GJKA 4B3GA 3CP2A 1BLIA 2WPDA 2ZXHA 1MABA 4XLEA 4XN0A 4YEJA 3BCDA 1COWA 1BPLA 4NNJA 3NE5B 3CMMA 5DN6A 2JJ1A 4G6IA 2ZZGA 4E0FA 3LNNA 1NRKA 4L8JA 1E1RA 4Z1MA 4XLAA 3A3BA 2E1BA 2ZTNA 4XKWA 4G7WA 2CK3A 2XGJA 1T5EA 2ZZFA 4XKVA 4KKUA 1V0FA 4TKOB 4XOTA 2X85A 2XZPA 2F1MA 4FXUA 1FX0A 4TT3A 1SKYB 1I18A 2X6XA 4UZUA 1UD6A 1W0JA 3OEEA 4XOPA 1E1QA 3A3GA 2GJPA 4HIZA 4XNFA 3OE7A 4XLFA 2XNDA 1WPCA 4XN3A 3H94A 3OPOA 3T56B 3BCFA 3OAAA 3FPPA 4XORA 4DK1A 1WP6A 2VJIA 4YELA 4XQFA 1VJSA 3OW7A 2JIZA 3CESA 4KKSA 2W6JA 3GQBA 1EFRA 3G05A 4ASUA 1H8HA 2D3LA 2V4DA 2X6WA 3T51B 3BC9A 1W9XA 1OB0A 4G7XA 4DNTB 3CP8A 1VLYA 1UD3A 2WSSA 2X8KA 3ZIAA 2LZJA 4YXWA 4II3A 2WJYA 2GJRA 1PKVA 2JDIA 2DIEA 2XZOA 2WJVA 4DNRB 4DK0A 3GVLA 2GK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1R A;  1KZL A;  4Z1M A;  5CDF A;  3OAA A;  4TSF A;  5HKK A;  2F43 A;  1KMH A;  3A3B A;  3OEH A;  5IK2 A;  3A35 A;  3OE7 A;  1NBM A;  2QE7 A;  3GVK A;  1V0E A;  4E0F A;  1I8D A;  2JIZ A;  3DDY A;  2W6J A;  2CK3 A;  3OFN A;  3GQB A;  4GQN A;  1EFR A;  1E79 A;  3FKS A;  4ASU A;  1V0F A;  3VR6 A;  2JJ2 A;  1H8H A;  3GVJ A;  2XOK A;  2W6I A;  4XD7 A;  4FXU A;  1FX0 A;  4TT3 A;  1BMF A;  1SKY B;  1I18 A;  1OHH A;  1W0K A;  1W0J A;  3OEE A;  2WSS A;  1E1Q A;  2R9V A;  2WPD A;  3A3G A;  4YXW A;  3ZIA A;  1MAB A;  1H8E A;  1COW A;  4HIZ A;  5FL7 A;  1PKV A;  2JDI A;  2HLD A;  2JJ1 A;  1HZE A;  2V7Q A;  4G6I A;  5DN6 A;  2XND A;  3GVL A;  3JU4 A; 
#chains in the Genus database with same CATH topology
 2I1L A;  1B23 P;  5CDF A;  1KK0 A;  3Q38 A;  3QFR A;  1WU8 A;  4XR6 A;  3QFT A;  3WBJ A;  2ZBV A;  3CRZ A;  4F7D A;  4Y7C A;  1UD4 A;  3LQE A;  3PEN A;  3W2H A;  2FVG A;  3DDY A;  3CCL B;  3WNB A;  2XEX A;  1EP1 B;  3QFS A;  1UD8 A;  3OOC A;  2V7W A;  2V7T A;  1E43 A;  3W5V A;  3GVJ A;  2W6I A;  2WR8 A;  1E3X A;  2M5S A;  4TN1 A;  2XNJ A;  4P2N A;  4YAW A;  4RD0 A;  4XON A;  1D1N A;  2ZZQ A;  1R5B A;  1KQS B;  1H42 A;  1H8E A;  4OPO A;  2Z6B D;  5FL7 A;  4RD6 A;  2C5B A;  2V31 A;  2V7Q A;  4RDJ A;  2VBU A;  3JU4 A;  4B3F X;  5HXB A;  3HAG A;  1VQ4 B;  2F43 A;  1KMH A;  4P3I A;  5IK2 A;  3D26 A;  4FWT A;  3WXM A;  1K28 D;  3G4S B;  1T6Y A;  3AVX A;  1WSR A;  1EWY A;  1VQ6 B;  2DCU A;  3ZZT A;  1QUF A;  1VHE A;  1F20 A;  4Z4Z A;  1N07 A;  1QGZ A;  3H9N A;  4TMT A;  1QG0 A;  2Q6O A;  2EIX A;  3CP2 A;  1MAB A;  5IYP A;  2C4U A;  3BCD A;  4NBS A;  1COW A;  4R71 A;  5J3O A;  4NNJ A;  2B5O A;  4WZL A;  4OOV A;  2JJ1 A;  4RD4 A;  2ZZG A;  4E0F A;  1Q7Y D;  2DEU A;  3B8H A;  1E1R A;  1GAQ A;  4Z1M A;  3V7A A;  2OK8 A;  1ZUN B;  4AC9 A;  5A88 A;  1I7P A;  5DS0 A;  3A3B A;  5TRD A;  1DDG A;  2XGJ A;  3OZU A;  1IJE A;  4B4D A;  1KK1 A;  4Q7J B;  5F4O A;  3U6K A;  1FX0 A;  2F1L A;  2XNC A;  4C43 A;  4P3Y A;  4WQM A;  3PA2 A;  3OEE A;  1YHQ B;  1E1Q A;  2CBX A;  4H9G A;  3P27 A;  1NJI D;  4Y9R A;  5F4M A;  1TUI A;  3MMP A;  3PVD A;  2CRV A;  1YIJ B;  4XN3 A;  4P6Y A;  3BCF A;  5HZB A;  1D2E A;  4XOR A;  2BM0 A;  4YEL A;  4X7F A;  4XQF A;  4ZGQ B;  1EP3 B;  1K8A D;  1FNB A;  1QVF B;  3CCU B;  3MHP A;  2CC2 A;  3B78 A;  5JBQ A;  3G71 B;  2B7B A;  2D3L A;  4YAU A;  2X6W A;  3QFC A;  3T51 B;  4WZT A;  4U9U A;  4BPR A;  1D8T A;  3WND A;  4Z4S A;  1OB0 A;  2YWF A;  4G7X A;  4QV2 A;  3I56 B;  1M90 D;  1UD3 A;  2X8K A;  3WBK A;  3B82 A;  1EFU A;  1YJN B;  4UZF A;  2BGI A;  1WDT A;  3JQR A;  1T6X A;  4RM0 A;  3OP1 A;  4N3N A;  3Q39 A;  4ZCM A;  4DNR B;  3GSI A;  4DK0 A;  3OAA A;  2GK6 A;  4TSF A;  1VQ7 B;  2CW5 A;  3BY2 A;  2WZP P;  4P25 A;  2NPF A;  1FND A;  2ZL5 A;  3OEH A;  5F4J A;  3FJO A;  2QMU A;  1V0E A;  3T53 B;  1W2B B;  4JMQ A;  2PE3 A;  3CC4 B;  3FKS A;  4XM3 A;  1EP2 B;  4RCZ A;  2VJJ A;  2ZTG A;  4X7C A;  1S72 B;  3CPX A;  2B7C A;  1QFZ A;  4OPV A;  3CD6 B;  4XLH A;  1YIT B;  4X7D A;  3AVT A;  3ZPN A;  2GPJ A;  3W5U A;  4P9S A;  5GV8 A;  3CME B;  2HCJ B;  2R9V A;  3SJZ A;  2X6Y A;  1GO2 A;  1VQP B;  3ASP A;  3J81 k;  1QGY A;  3WQZ A;  2ZL6 A;  4Z4U A;  1AIP A;  3ZC3 A;  1UD5 A;  4ACB A;  4X8I A;  4QUZ A;  1RQP A;  3ZZU A;  2WZN A;  5FIU A;  3ISX A;  1PJ6 A;  2X3U A;  2WYR A;  4B44 A;  1OB2 A;  2PIA A;  5GV7 A;  2QE7 A;  1JA0 A;  3OFN A;  2VBS A;  4LC0 A;  3CCV B;  1R5O A;  3ZBT A;  1E79 A;  1WOP A;  3A8J A;  2KVO A;  4AVZ A;  3VR6 A;  1Y0Y A;  4KKT A;  1A8P A;  3G6E B;  1ZM9 A;  2BV3 A;  1QVG B;  1G7S A;  1BMF A;  1W0K A;  2QDX A;  5B6I A;  1ZM4 A;  1BX0 A;  2YWH A;  1VQN B;  3CW2 A;  2RC6 A;  2ZXH A;  4YEJ A;  4PC3 A;  1BPL A;  1NB0 A;  1N0U A;  1Q86 D;  1FNC A;  3NE5 B;  4RCY A;  4X06 A;  3CMM A;  4G5G A;  4TMW A;  1BJK A;  3LNN A;  1S0U A;  1XQB A;  3CC2 B;  3PA1 A;  3R6K A;  2ZTN A;  4QVA A;  4WZE A;  4Z4Y A;  5DSZ A;  3FPK A;  2BGJ A;  2CK3 A;  2VZL A;  3ONU A;  1XE1 A;  3CCE B;  3GIR A;  4XKV A;  3VNV A;  1W34 A;  3ZBU A;  1VQK B;  4XOT A;  3CCQ B;  2JN9 A;  4NCN A;  2X85 A;  4PC2 A;  5J35 A;  4M4S A;  4TT3 A;  1SKY B;  4P6V F;  3CPW B;  1N05 A;  1TVC A;  2VYQ A;  2YWE A;  3SLD A;  1G7T A;  5L46 A;  1VQ5 B;  3WY9 A;  2BN4 A;  1FRQ A;  2GJP A;  5H59 A;  4XNF A;  1IB0 A;  3ASQ A;  4B47 A;  1PJ5 A;  2PMD A;  1WPC A;  4TMV A;  3OPO A;  1VQ8 B;  1EFC A;  1QFY A;  2DET A;  4TMX A;  2VJI A;  1E63 A;  1VJS A;  3OW7 A;  1R5N A;  1ZM3 A;  1VHO A;  4ASU A;  4YAF A;  5EMN A;  1CQX A;  1KK3 A;  2V4D A;  1KD1 D;  1W9X A;  4YHB A;  5A89 A;  3CP8 A;  1VLY A;  4OP7 A;  5AN9 A;  4TMZ A;  2DER A;  2LZJ A;  1CNE A;  2GJR A;  2P3M A;  4C0S A;  5IYW A;  1M1K D;  1PKV A;  2BVN A;  2HDN B;  5TY0 A;  3PUM A;  2XZO A;  3OKX A;  3GVL A;  2OTJ B;  2HMA A;  2CF4 A;  3QE2 A;  1AMO A;  3BH4 A;  2ZZE A;  3CCR B;  1E62 A;  3R6J A;  2D3N A;  2DY1 A;  1KJZ A;  2ZXI A;  4DQK A;  5E6T A;  1E3Z A;  1DDI A;  4XL9 A;  3V76 A;  2OYN A;  1IHM A;  1KRH A;  2V7U A;  4XD7 A;  3BY1 A;  1EFT A;  4DQL A;  1OHH A;  4QFM A;  1OGI A;  2Q6L A;  4RLZ A;  2ZL7 A;  2ZIT A;  4P12 A;  1T6Z A;  2HLD A;  1HZE A;  1VQ9 B;  1VQL B;  3W2E A;  3VO1 A;  3ASR A;  1KZL A;  4FK8 A;  4ZCI A;  1YX2 A;  1Q81 D;  3VNU A;  3AGQ A;  4RJL A;  3SEJ A;  3BQJ A;  1NBM A;  1I8D A;  2VBV A;  4XLC A;  4GQN A;  2QA4 B;  1NB9 A;  4ZV4 A;  1K9M D;  2OBT A;  1WOS A;  1WTH D;  2JJ2 A;  5BSX A;  1MRZ A;  3A8K A;  4B3X A;  2XOK A;  4P22 A;  2D74 A;  4X07 A;  2QTL A;  1QX4 A;  1Y0R A;  2WPD A;  4ROX A;  4QHY A;  4ZGN B;  4XLE A;  1N8R D;  4M1K A;  1N08 A;  1UMK A;  1EXM A;  2OK7 A;  2YWG A;  3VMF A;  2J7K A;  1VQM B;  3CCM B;  4P26 A;  3E20 A;  3VO2 A;  1DAR A;  2V7X A;  2E1B A;  5FO0 A;  3ZZ0 A;  3Q6R A;  2C78 A;  1T5E A;  4WZK A;  2ZZF A;  1Q82 D;  3P26 A;  1Q9S A;  4HE5 A;  1GJR A;  1U2R A;  1CNF A;  1V0F A;  4HE6 A;  2XZP A;  4Z4V A;  2F1M A;  5H5J A;  4WWV A;  1I18 A;  4RDL A;  1KTV A;  2X6X A;  4UZU A;  4Y9U A;  4X05 A;  3SJP A;  1G7R A;  3AGP A;  1OGJ A;  1UD6 A;  1W0J A;  3LVB A;  4X7E A;  1GR1 A;  5TR9 A;  2EFG A;  3AVW A;  5KW9 A;  1GAW A;  3OE7 A;  4XLF A;  2D9R A;  4IW3 B;  2XND A;  4PC1 A;  1WSV A;  3T56 B;  1S4M A;  3FPP A;  1TLL A;  3BNW A;  4X0C A;  1WP6 A;  1OB5 A;  1QGA A;  2JIZ A;  4PC7 A;  2CND A;  3GQB A;  2RC5 A;  3G05 A;  3JQQ A;  3ZUG A;  4LBV A;  4Z4R A;  1PJ7 A;  2ZBU A;  1JA1 A;  1H8H A;  5IYN A;  1ELO A;  3WNC A;  2QGG A;  2FX3 A;  2WSS A;  2OBS A;  2AHO A;  2QEX B;  2OTL B;  3ZIA A;  3A1P A;  4YXW A;  4II3 A;  3SKB A;  3W2F A;  4P1V A;  3ONY A;  3Q6Q A;  3WYA A;  4OOX A;  1WOO A;  2DIE A;  2WJV A;  2DYI A;  1SKQ A;  5HKK A;  3A35 A;  5IYR A;  3MCA A;  1TTT A;  4UZE A;  4B48 A;  3OJW A;  1VQO B;  1P4M A;  4RPD A;  4PAB A;  1FDR A;  3U6B A;  4EH1 A;  2E1R A;  2C77 A;  2VNI A;  3KEW A;  2OBR A;  2PLF A;  1QUE A;  3OZW A;  3CXC B;  1YJW B;  4MYT A;  1YJ9 B;  3OZV A;  4II2 A;  5KNL A;  4AF7 A;  2X53 S;  4M53 A;  1W87 A;  2BF4 A;  2XZL A;  2QTZ A;  4G1V A;  2VNJ A;  4RDK A;  4PC6 A;  4OPS A;  1V5V A;  4J0Q A;  3KL9 A;  1WOR A;  2C5H A;  4XMY A;  3PUN A;  2F4N A;  2DOG A;  1W35 A;  1E64 A;  1H85 A;  3GVK A;  5TV2 A;  1HVX A;  4ZCL A;  2GK7 A;  1XB2 A;  3AST A;  3ES9 A;  1UD2 A;  1DG1 G;  5FA6 A;  3CCJ B;  1RQR A;  2V7V A;  1FNM A;  1B2R A;  1VF7 A;  3AVV A;  1G7C A;  3OW2 B;  3RY8 A;  4M2L A;  1N06 A;  2GJK A;  4B3G A;  4PGO A;  4RD1 A;  1BLI A;  1SM4 A;  5FNZ A;  4XN0 A;  5IYQ A;  5LMZ A;  4ACA A;  1HA3 A;  4YAO A;  2X0K A;  3CB4 A;  1YLO A;  2VBT A;  5DN6 A;  4G6I A;  1NRK A;  4L8J A;  2Q6I A;  3U2Q A;  3SLN A;  3A8I A;  2C2W A;  4MYU A;  4XLA A;  2QN6 A;  3W2I A;  4B43 A;  3AVY A;  4XKW A;  3QSY A;  1XFO A;  4G7W A;  1VLO A;  1J9Z A;  4PAA A;  1BX1 A;  4KKU A;  4TKO B;  3I55 B;  4CQJ A;  3CTA A;  4LBW A;  3Q3A A;  4FXU A;  5A8A A;  3JQP A;  3W5H A;  4Z4W A;  4OOS A;  5FO1 A;  4N3G A;  4XOP A;  3A3G A;  1NDH A;  5BSY A;  4HIZ A;  4AF6 A;  1IJF A;  3ASS A;  4Z4T A;  1KK2 A;  4RPB A;  2R6H A;  3E1Y E;  3H94 A;  2GQF A;  2GRE A;  4DK1 A;  3CMA B;  1QFJ A;  4LBZ A;  4QVJ A;  1FRN A;  4KKS A;  3CES A;  1F60 A;  4M0L A;  2W6J A;  2BPO A;  3W2G A;  5HZA A;  3CC7 B;  1EFR A;  5THX A;  1QH0 A;  4FN5 A;  4YAL A;  4K1X A;  3CCS B;  3BC9 A;  4RD3 A;  2Q6K A;  5KSW B;  3I1F A;  1KC8 D;  1JJ2 B;  4G1B A;  4DNT B;  2VNK A;  2NV4 A;  1JNY A;  1GVH A;  1K73 D;  2BM1 A;  4LBY A;  1ZM2 A;  1N0V C;  2BSA A;  2VNH A;  3LO8 A;  2WJY A;  1YI2 B;  1BQE A;  3AVU A;  3OJX A;  3LQ6 A;  4UAJ A;  2JDI A;  2BMW A;  1JB9 A;  4RD2 A;  2C4T A; 
#chains in the Genus database with same CATH homology
 5CDF A;  5HKK A;  4XR6 A;  3BH4 A;  2WZP P;  2ZZE A;  3OEH A;  2D3N A;  3A35 A;  2ZXI A;  1UD4 A;  1V0E A;  3DDY A;  1E3Z A;  3T53 B;  4JMQ A;  3FKS A;  4XM3 A;  1UD8 A;  3OOC A;  2VJJ A;  2ZTG A;  1E43 A;  4XL9 A;  3KEW A;  3GVJ A;  2W6I A;  4XD7 A;  1E3X A;  2M5S A;  4XLH A;  4XON A;  3ZPN A;  1OHH A;  2ZZQ A;  4II2 A;  2R9V A;  2X6Y A;  5KNL A;  1H8E A;  2Z6B D;  5FL7 A;  2X53 S;  3WQZ A;  2V31 A;  2HLD A;  1UD5 A;  1HZE A;  2V7Q A;  2XZL A;  3JU4 A;  1KZL A;  4B3F X;  4TSF A;  3HAG A;  2F43 A;  1KMH A;  4XMY A;  5IK2 A;  1NBM A;  2QE7 A;  3GVK A;  1K28 D;  1I8D A;  3OFN A;  1HVX A;  4XLC A;  4GQN A;  1E79 A;  2GK7 A;  2KVO A;  1WTH D;  3VR6 A;  4AVZ A;  2JJ2 A;  1UD2 A;  4KKT A;  2XOK A;  4P22 A;  1BMF A;  1VF7 A;  1W0K A;  2GJK A;  4B3G A;  3CP2 A;  1BLI A;  2WPD A;  2ZXH A;  1MAB A;  4XLE A;  4XN0 A;  4YEJ A;  3BCD A;  1COW A;  1BPL A;  4NNJ A;  3NE5 B;  3CMM A;  5DN6 A;  2JJ1 A;  4G6I A;  2ZZG A;  4E0F A;  3LNN A;  1NRK A;  4L8J A;  1E1R A;  4Z1M A;  4XLA A;  3A3B A;  2E1B A;  2ZTN A;  4XKW A;  4G7W A;  2CK3 A;  2XGJ A;  1T5E A;  2ZZF A;  4XKV A;  4KKU A;  1V0F A;  4TKO B;  4XOT A;  2X85 A;  2XZP A;  2F1M A;  4FXU A;  1FX0 A;  4TT3 A;  1SKY B;  1I18 A;  2X6X A;  4UZU A;  1UD6 A;  1W0J A;  3OEE A;  4XOP A;  1E1Q A;  3A3G A;  2GJP A;  4HIZ A;  4XNF A;  3OE7 A;  4XLF A;  2XND A;  1WPC A;  4XN3 A;  3H94 A;  3OPO A;  3T56 B;  3BCF A;  3OAA A;  3FPP A;  4XOR A;  4DK1 A;  1WP6 A;  2VJI A;  4YEL A;  4XQF A;  1VJS A;  3OW7 A;  2JIZ A;  3CES A;  4KKS A;  2W6J A;  3GQB A;  1EFR A;  3G05 A;  4ASU A;  1H8H A;  2D3L A;  2V4D A;  2X6W A;  3T51 B;  3BC9 A;  1W9X A;  1OB0 A;  4G7X A;  4DNT B;  3CP8 A;  1VLY A;  1UD3 A;  2WSS A;  2X8K A;  3ZIA A;  2LZJ A;  4YXW A;  4II3 A;  2WJY A;  2GJR A;  1PKV A;  2JDI A;  2DIE A;  2XZO A;  2WJV A;  4DNR B;  4DK0 A;  3GVL A;  2GK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...