3DDYA

Structure of lumazine protein, an optical transponder of luminescent bacteria
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
184
structure length
175
Chain Sequence
MFRGIVQGRGVIRSISKSEDSQRHGIAFPEGMFQLVDVDTVMLVNGCSNTVVRILGDMVYFDIDQALGTTTFDGLKEGDQVNLEIHPGLTGNIKGTALVAAIEENDAGFSVLIDIPKGLAENLTVKDDIGIDGISLPITDMSDSIITLNYSRDLLASTNIASLAKDVKVNVEILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lumazine protein
publication title Structure of lumazine protein, an optical transponder of luminescent bacteria.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Luminescent protein
total genus 33
structure length 175
sequence length 184
ec nomenclature
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00677 Lum_binding Lumazine binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.20 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ddyA01
2.40.30.20 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ddyA02
3FKSA 3VR6A 4FXUA 1MABA 3GQBA 2HLDA 3OFNA 3OEEA 4HIZA 2F43A 1H8HA 5DN6A 2CK3A 1SKYB 3DDYA 5CDFA 1E1QA 1NBMA 2QE7A 1KZLA 2JJ2A 3OE7A 4G6IA 4Z1MA 4E0FA 1W0KA 1PKVA 4GQNA 2JDIA 4TSFA 5IK2A 4ASUA 3A3BA 1OHHA 1HZEA 3GVLA 3OEHA 1E1RA 2XNDA 3JU4A 2JIZA 5FL7A 5HKKA 3GVKA 1EFRA 3OAAA 1V0EA 2WSSA 2W6JA 1COWA 1H8EA 3A3GA 3ZIAA 1I18A 1I8DA 2R9VA 3A35A 1E79A 2V7QA 2W6IA 4XD7A 4YXWA 2XOKA 1W0JA 4TT3A 3GVJA 1KMHA 1V0FA 2JJ1A 1BMFA 2WPDA 1FX0A
chains in the Genus database with same CATH superfamily
3CC2B 1KTVA 1M1KD 3ONUA 2PIAA 1WTHD 2BSAA 1XFOA 4TMXA 2QTLA 2AHOA 4YAWA 3OW2B 4HIZA 5DN6A 3VR6A 2ZZEA 2X6WA 1A8PA 4X06A 5FNZA 4YAUA 4XOPA 2HCJB 1VHEA 3WNDA 1F20A 4XLHA 1G7TA 1E64A 2C4TA 3ES9A 3JQPA 4TSFA 4ACAA 2B7BA 3WY9A 4G1VA 1VQKB 1OB0A 3SEJA 3CP8A 4XORA 3G05A 1H8EA 1OGIA 1IHMA 1JA0A 2X3UA 1N06A 3CPWB 2F4NA 4WWVA 4PABA 3ZUGA 1DARA 2XZPA 1BMFA 3CW2A 4P3IA 1E62A 3BC9A 4JMQA 1Q82D 5LMZA 3A8JA 4X0CA 1VQLB 2F43A 2CK3A 3DDYA 3PENA 1YI2B 1EP1B 4GQNA 1HA3A 2PMDA 3A8KA 3CESA 4P2NA 1QVGB 2V7UA 4G7XA 4XLCA 2B5OA 5KSWB 3JU4A 4B3GA 3CC4B 2WJVA 2XZOA 3MHPA 1KK2A 2WSSA 3QFTA 3ZIAA 1T6ZA 1QH0A 4QVJA 1MRZA 2Q6OA 4ZV4A 5FA6A 4P6VF 5A88A 1F60A 1QGZA 3A8IA 1UD6A 4UAJA 3OEEA 2Q6KA 3HAGA 1IJFA 4FN5A 4G6IA 1N08A 3AVYA 3SKBA 4ASUA 3W2FA 1S0UA 4B44A 1EP3B 2XNJA 3BY2A 4ACBA 2V4DA 3E1YE 4Z4SA 1JNYA 1ZUNB 3ZBUA 1EXMA 4XD7A 3ZPNA 2NV4A 1W0JA 4HE5A 5TY0A 4FK8A 1VQ5B 2ZITA 3MMPA 2X53S 1OGJA 3CCQB 3AVVA 3FPKA 4B4DA 1AMOA 1OB5A 1IB0A 1WSVA 1H8HA 2GK6A 3OZUA 3B8HA 1FDRA 1PJ6A 4WZKA 3PVDA 1GAQA 4R71A 4X7CA 4WZLA 1YJWB 1XQBA 2BGJA 1OHHA 3V7AA 3R6KA 4RD1A 2JIZA 1YITB 2ZTNA 2FVGA 1NRKA 4RDKA 4KKTA 4B3XA 3CCMB 1NJID 3WYAA 3VNVA 3A3GA 2R9VA 2ZXIA 3ASPA 4RCZA 4EH1A 3P27A 1R5BA 1VQOB 2P3MA 5TV2A 1E63A 2OK7A 1VQ6B 1P4MA 1U2RA 3WXMA 5DSZA 4N3GA 1WPCA 2V7TA 4X07A 4XN0A 5EMNA 4HE6A 4NNJA 3W2EA 1CNEA 2C78A 1PJ5A 4Z4WA 4MYTA 1EFTA 4Y7CA 1WORA 1W87A 2J7KA 4OPOA 2ZL5A 1QGYA 3ZZUA 3CCVB 2ZZFA 3CB4A 3LVBA 1EFRA 4OOXA 3CCJB 4PC3A 1NB0A 2ZTGA 1N0UA 3BNWA 1KJZA 1T6YA 2X0KA 1WSRA 4XR6A 1I7PA 3BQJA 1ZM4A 4M1KA 1QG0A 2QEXB 1JB9A 4K1XA 1UD8A 3OJXA 3OW7A 5TRDA 2D3LA 2B7CA 4AVZA 1E3XA 3OPOA 4ZCIA 2DETA 3AVUA 5F4JA 3CXCB 3OJWA 4FWTA 2ZBUA 1N07A 3SLNA 3FJOA 2VNKA 4RDLA 1Q81D 1FNMA 3JQQA 1YHQB 4UZUA 2GQFA 1KC8D 1TTTA 1KRHA 2DIEA 1BX0A 3PA2A 3ASQA 1BQEA 3CMMA 4QV2A 4AF6A 1DDGA 3QE2A 2DCUA 2W6IA 3U2QA 3I55B 1VQ9B 4YXWA 2BM1A 2VJJA 2EFGA 2JN9A 3VO2A 4AC9A 2C4UA 2XZLA 2E1RA 4P1VA 4RD6A 4OP7A 2GK7A 1UD4A 2Q6IA 4TKOB 3CC7B 2YWGA 3Q39A 4M2LA 4X7EA 4YEJA 1NBMA 4Z4RA 2JJ2A 1GVHA 2WZPP 1XB2A 4II2A 1CNFA 2CF4A 1J9ZA 3SJPA 4AF7A 2DERA 4X7DA 3Q3AA 3A1PA 2GJPA 1EP2B 3AGPA 3OEHA 1VQ4B 2HMAA 1E1RA 4YAFA 1WU8A 2X6XA 5THXA 4ZGQB 1N0VC 1COWA 1KK1A 4P25A 3WNCA 1UD5A 3R6JA 4X8IA 2CNDA 3OZVA 1HVXA 2VBTA 1FX0A 3QFCA 1QGAA 1KD1D 1ZM2A 2BM0A 3H94A 1SKYB 2R6HA 2BN4A 2D9RA 3OE7A 3CD6B 4QFMA 2DY1A 2F1LA 2OK8A 3PA1A 3RY8A 4XONA 4B48A 2CRVA 2ZXHA 1EWYA 1Q9SA 4F7DA 4B47A 1QX4A 4TMZA 4XLAA 3CMAB 2VBVA 3BCDA 2WYRA 4DQKA 4Z4ZA 4U9UA 1JA1A 2V7VA 1DDIA 3ASTA 3W2GA 4LC0A 4X05A 4LBVA 2XEXA 3CTAA 2VBSA 4XKWA 3J81k 4TMWA 1QFYA 1KK0A 5KNLA 1OB2A 3AGQA 5FIUA 2DEUA 3P26A 1YJNB 5CDFA 1E1QA 1NDHA 4WZTA 3MCAA 2DYIA 3D26A 3V76A 2D3NA 3GSIA 2I1LA 2VJIA 3QSYA 3OKXA 3U6BA 1WP6A 5FO1A 1Y0RA 1QFJA 1V0EA 2WJYA 3LQ6A 1UD2A 4X7FA 2YWFA 5J35A 1I8DA 1QUFA 4RD4A 5L46A 3VNUA 3ZZTA 1AIPA 1UD3A 1W35A 4XNFA 1KMHA 5IK2A 5HZBA 3G4SB 1QUEA 1S72B 2E1BA 2QA4B 3LNNA 4B43A 1WOPA 4PAAA 3E20A 2ZZGA 4LBZA 4PC2A 2BMWA 2QE7A 2VNHA 1B23P 4NBSA 4Z1MA 3AVWA 4DNRB 2OTJB 1PKVA 3NE5B 1N05A 2X6YA 3I1FA 4P26A 4CQJA 2JDIA 5DS0A 3CMEB 1K73D 1WOOA 4C43A 4XQFA 1HZEA 4DQLA 5BSXA 1TLLA 4DK1A 4PC7A 3VO1A 1VQMB 3AVTA 1ZM9A 1WDTA 2D74A 2Q6LA 1EFCA 1BLIA 4OPVA 3A35A 1WOSA 1D1NA 1E79A 1GAWA 2C5BA 4LBWA 3ZBTA 1NB9A 4TT3A 1JJ2B 1W34A 3ASRA 3SJZA 2HDNB 4WZEA 3JQRA 3WBKA 5B6IA 1YLOA 2DOGA 1E43A 3Q6QA 3W2IA 3AVXA 1RQRA 1TVCA 4ROXA 5IYRA 1XE1A 2VBUA 1ELOA 1BX1A 2V7XA 4Q7JB 2OTLB 2VNJA 4Z4TA 5J3OA 3LO8A 1BPLA 4M0LA 4YALA 5HKKA 1SM4A 3W2HA 4ZGNB 1QVFB 2QN6A 4M53A 3QFRA 2GREA 1VQ7B 3B82A 3ASSA 2ZBVA 2GJRA 2V7QA 4OPSA 4B3FX 2QTZA 4XLFA 1YX2A 4XLEA 4P3YA 2YWHA 4FXUA 4QVAA 4XN3A 1GO2A 4RJLA 3FPPA 4TMTA 4Y9RA 3VMFA 1G7SA 2HLDA 5GV8A 4P9SA 3W5UA 4YHBA 3BY1A 4E0FA 2CBXA 2V7WA 4PC1A 4DNTB 2RC5A 4RD2A 1FNCA 3OOCA 4KKUA 4PGOA 4G1BA 3Q6RA 4UZFA 4Z4UA 4MYUA 1RQPA 5FL7A 5BSYA 2CW5A 1G7RA 2KVOA 4XM3A 3T56B 1K9MD 1FNDA 2VZLA 4RD0A 5TR9A 1W2BB 1TUIA 3H9NA 3G6EB 1M90D 4P12A 3PUMA 2GJKA 1Q86D 4J0QA 1FRNA 1SKQA 1EFUA 2ZL7A 2WPDA 2WR8A 4KKSA 2X8KA 5F4MA 4RDJA 3W5VA 4IW3B 2EIXA 3CP2A 2XNCA 3CPXA 3GQBA 3B78A 4TN1A 3QFSA 1VQNB 1IJEA 3OZWA 4XOTA 3GIRA 1KZLA 5H59A 2BPOA 2ZZQA 1K8AD 5AN9A 3CCLB 5JBQA 3GVLA 4P22A 1VLOA 4YAOA 2V31A 5FO0A 3PUNA 3W5HA 2FX3A 1W9XA 1I18A 4YELA 1GR1A 3OP1A 1Y0YA 2GPJA 3ZZ0A 1BJKA 2X85A 2CC2A 1YJ9B 3ONYA 3FKSA 5IYWA 4BPRA 3WNBA 2VYQA 1D8TA 4M4SA 1MABA 1VLYA 3BCFA 4Z4VA 5IYQA 1PJ7A 5IYNA 2M5SA 4N3NA 3WQZA 5HXBA 3I56B 4C0SA 2C77A 1N8RD 3A3BA 5HZAA 5IYPA 2Z6BD 2WZNA 4ZCLA 3LQEA 1VHOA 2RC6A 3OAAA 4G7WA 2LZJA 3Q38A 1DG1G 4G5GA 2BVNA 3ISXA 4H9GA 4PC6A 4DK0A 4LBYA 1QFZA 2ZL6A 1CQXA 1T5EA 4RD3A 2JJ1A 3BH4A 2BF4A 4NCNA 1UMKA 4XL9A 4RM0A 4UZEA 1S4MA 2C5HA 2BGIA 4RPDA 1GJRA 1H42A 3CCEB 3CCUB 4RLZA 3CCRB 1Q7YD 2PLFA 2QMUA 1VQ8B 2OBTA 4TMVA 2VNIA 5F4OA 2OBSA 3T53B 4ZCMA 3SLDA 5GV7A 1YIJB 1R5OA 1H85A 2YWEA 4RCYA 3CRZA 4XKVA 3WBJA 1KK3A 5H5JA 2XOKA 1B2RA 4QHYA 4OOSA 1V0FA 5A89A 2F1MA 1R5NA 2PE3A 3CCSB 1KQSB 2QDXA 2C2WA 3KL9A 3OFNA 1FNBA 1V5VA 2OYNA 4P6YA 2OBRA 1W0KA 1VF7A 4XMYA 3KEWA 1VQPB 2XGJA 1E3ZA 1VJSA 4Z4YA 3T51B 5A8AA 1D2EA 2NPFA 1G7CA 2XNDA 3G71B 2BV3A 4RPBA 4WQMA 5KW9A 3GVKA 4II3A 3ZC3A 1FRQA 2W6JA 4Y9UA 3U6KA 4OOVA 5E6TA 4QUZA 4L8JA 1T6XA 1ZM3A 2QGGA 1K28D 3GVJA
chains in the Genus database with same CATH topology
4KKSA 2X8KA 4XKWA 1WTHD 5KNLA 3CP2A 3GQBA 4HIZA 1WPCA 5DN6A 3VR6A 4XN0A 2ZZEA 2X6WA 4NNJA 1E1QA 4XOTA 5CDFA 1KZLA 4XOPA 2ZZQA 2D3NA 4TSFA 4XLHA 2VJIA 3GVLA 4P22A 1OB0A 2ZZFA 2V31A 1WP6A 3CP8A 1EFRA 1V0EA 2WJYA 2ZTGA 1UD2A 4XORA 3G05A 1H8EA 1W9XA 1I18A 4YELA 1I8DA 4XR6A 1UD3A 2XZPA 1KMHA 4XNFA 5IK2A 1BMFA 2X85A 2E1BA 3BC9A 3FKSA 1UD8A 4JMQA 3LNNA 3OW7A 2D3LA 4AVZA 1MABA 1E3XA 1VLYA 2ZZGA 3OPOA 3BCFA 2F43A 2CK3A 3DDYA 2M5SA 2QE7A 4Z1MA 4DNRB 3WQZA 1PKVA 3NE5B 2X6YA 4GQNA 3CESA 2JDIA 3A3BA 4UZUA 4XQFA 1HZEA 4G7XA 2Z6BD 4XLCA 4DK1A 3JU4A 2DIEA 4B3GA 2WJVA 3OAAA 4G7WA 2XZOA 2LZJA 2WSSA 3CMMA 3ZIAA 1BLIA 3A35A 4DK0A 1E79A 2W6IA 4YXWA 2VJJA 4TT3A 1T5EA 2JJ1A 2XZLA 3BH4A 1UD6A 2GK7A 1UD4A 4TKOB 1E43A 4XL9A 3OEEA 3HAGA 4YEJA 1NBMA 2JJ2A 4G6IA 2WZPP 4II2A 4ASUA 2GJPA 1BPLA 3OEHA 3T53B 1E1RA 2X6XA 5HKKA 1COWA 2V4DA 4XKVA 1UD5A 2GJRA 2V7QA 4XD7A 3ZPNA 2XOKA 4B3FX 1W0JA 1HVXA 1V0FA 4XLFA 4XLEA 2F1MA 1FX0A 2X53S 4FXUA 4XN3A 3FPPA 2HLDA 3OFNA 1H8HA 2GK6A 3H94A 1SKYB 3OE7A 4E0FA 1W0KA 1VF7A 4XMYA 3KEWA 4DNTB 2XGJA 3OOCA 1E3ZA 1VJSA 4KKUA 1OHHA 3T51B 4XONA 2XNDA 2JIZA 2ZXHA 5FL7A 2ZTNA 1NRKA 2KVOA 3GVKA 4KKTA 4II3A 4XM3A 4XLAA 2W6JA 3T56B 3A3GA 3BCDA 2R9VA 2ZXIA 4L8JA 2GJKA 3GVJA 1K28D 2WPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKS A;  3VR6 A;  4FXU A;  1MAB A;  3GQB A;  2HLD A;  3OFN A;  3OEE A;  4HIZ A;  2F43 A;  1H8H A;  5DN6 A;  2CK3 A;  1SKY B;  3DDY A;  5CDF A;  1E1Q A;  1NBM A;  2QE7 A;  1KZL A;  2JJ2 A;  3OE7 A;  4G6I A;  4Z1M A;  4E0F A;  1W0K A;  1PKV A;  4GQN A;  2JDI A;  4TSF A;  5IK2 A;  4ASU A;  3A3B A;  1OHH A;  1HZE A;  3GVL A;  3OEH A;  1E1R A;  2XND A;  3JU4 A;  2JIZ A;  5FL7 A;  5HKK A;  3GVK A;  1EFR A;  3OAA A;  1V0E A;  2WSS A;  2W6J A;  1COW A;  1H8E A;  3A3G A;  3ZIA A;  1I18 A;  1I8D A;  2R9V A;  3A35 A;  1E79 A;  2V7Q A;  2W6I A;  4XD7 A;  4YXW A;  2XOK A;  1W0J A;  4TT3 A;  3GVJ A;  1KMH A;  1V0F A;  2JJ1 A;  1BMF A;  2WPD A;  1FX0 A; 
#chains in the Genus database with same CATH topology
 3CC2 B;  1KTV A;  1M1K D;  3ONU A;  2PIA A;  1WTH D;  2BSA A;  1XFO A;  4TMX A;  2QTL A;  2AHO A;  4YAW A;  3OW2 B;  4HIZ A;  5DN6 A;  3VR6 A;  2ZZE A;  2X6W A;  1A8P A;  4X06 A;  5FNZ A;  4YAU A;  4XOP A;  2HCJ B;  1VHE A;  3WND A;  1F20 A;  4XLH A;  1G7T A;  1E64 A;  2C4T A;  3ES9 A;  3JQP A;  4TSF A;  4ACA A;  2B7B A;  3WY9 A;  4G1V A;  1VQK B;  1OB0 A;  3SEJ A;  3CP8 A;  4XOR A;  3G05 A;  1H8E A;  1OGI A;  1IHM A;  1JA0 A;  2X3U A;  1N06 A;  3CPW B;  2F4N A;  4WWV A;  4PAB A;  3ZUG A;  1DAR A;  2XZP A;  1BMF A;  3CW2 A;  4P3I A;  1E62 A;  3BC9 A;  4JMQ A;  1Q82 D;  5LMZ A;  3A8J A;  4X0C A;  1VQL B;  2F43 A;  2CK3 A;  3DDY A;  3PEN A;  1YI2 B;  1EP1 B;  4GQN A;  1HA3 A;  2PMD A;  3A8K A;  3CES A;  4P2N A;  1QVG B;  2V7U A;  4G7X A;  4XLC A;  2B5O A;  5KSW B;  3JU4 A;  4B3G A;  3CC4 B;  2WJV A;  2XZO A;  3MHP A;  1KK2 A;  2WSS A;  3QFT A;  3ZIA A;  1T6Z A;  1QH0 A;  4QVJ A;  1MRZ A;  2Q6O A;  4ZV4 A;  5FA6 A;  4P6V F;  5A88 A;  1F60 A;  1QGZ A;  3A8I A;  1UD6 A;  4UAJ A;  3OEE A;  2Q6K A;  3HAG A;  1IJF A;  4FN5 A;  4G6I A;  1N08 A;  3AVY A;  3SKB A;  4ASU A;  3W2F A;  1S0U A;  4B44 A;  1EP3 B;  2XNJ A;  3BY2 A;  4ACB A;  2V4D A;  3E1Y E;  4Z4S A;  1JNY A;  1ZUN B;  3ZBU A;  1EXM A;  4XD7 A;  3ZPN A;  2NV4 A;  1W0J A;  4HE5 A;  5TY0 A;  4FK8 A;  1VQ5 B;  2ZIT A;  3MMP A;  2X53 S;  1OGJ A;  3CCQ B;  3AVV A;  3FPK A;  4B4D A;  1AMO A;  1OB5 A;  1IB0 A;  1WSV A;  1H8H A;  2GK6 A;  3OZU A;  3B8H A;  1FDR A;  1PJ6 A;  4WZK A;  3PVD A;  1GAQ A;  4R71 A;  4X7C A;  4WZL A;  1YJW B;  1XQB A;  2BGJ A;  1OHH A;  3V7A A;  3R6K A;  4RD1 A;  2JIZ A;  1YIT B;  2ZTN A;  2FVG A;  1NRK A;  4RDK A;  4KKT A;  4B3X A;  3CCM B;  1NJI D;  3WYA A;  3VNV A;  3A3G A;  2R9V A;  2ZXI A;  3ASP A;  4RCZ A;  4EH1 A;  3P27 A;  1R5B A;  1VQO B;  2P3M A;  5TV2 A;  1E63 A;  2OK7 A;  1VQ6 B;  1P4M A;  1U2R A;  3WXM A;  5DSZ A;  4N3G A;  1WPC A;  2V7T A;  4X07 A;  4XN0 A;  5EMN A;  4HE6 A;  4NNJ A;  3W2E A;  1CNE A;  2C78 A;  1PJ5 A;  4Z4W A;  4MYT A;  1EFT A;  4Y7C A;  1WOR A;  1W87 A;  2J7K A;  4OPO A;  2ZL5 A;  1QGY A;  3ZZU A;  3CCV B;  2ZZF A;  3CB4 A;  3LVB A;  1EFR A;  4OOX A;  3CCJ B;  4PC3 A;  1NB0 A;  2ZTG A;  1N0U A;  3BNW A;  1KJZ A;  1T6Y A;  2X0K A;  1WSR A;  4XR6 A;  1I7P A;  3BQJ A;  1ZM4 A;  4M1K A;  1QG0 A;  2QEX B;  1JB9 A;  4K1X A;  1UD8 A;  3OJX A;  3OW7 A;  5TRD A;  2D3L A;  2B7C A;  4AVZ A;  1E3X A;  3OPO A;  4ZCI A;  2DET A;  3AVU A;  5F4J A;  3CXC B;  3OJW A;  4FWT A;  2ZBU A;  1N07 A;  3SLN A;  3FJO A;  2VNK A;  4RDL A;  1Q81 D;  1FNM A;  3JQQ A;  1YHQ B;  4UZU A;  2GQF A;  1KC8 D;  1TTT A;  1KRH A;  2DIE A;  1BX0 A;  3PA2 A;  3ASQ A;  1BQE A;  3CMM A;  4QV2 A;  4AF6 A;  1DDG A;  3QE2 A;  2DCU A;  2W6I A;  3U2Q A;  3I55 B;  1VQ9 B;  4YXW A;  2BM1 A;  2VJJ A;  2EFG A;  2JN9 A;  3VO2 A;  4AC9 A;  2C4U A;  2XZL A;  2E1R A;  4P1V A;  4RD6 A;  4OP7 A;  2GK7 A;  1UD4 A;  2Q6I A;  4TKO B;  3CC7 B;  2YWG A;  3Q39 A;  4M2L A;  4X7E A;  4YEJ A;  1NBM A;  4Z4R A;  2JJ2 A;  1GVH A;  2WZP P;  1XB2 A;  4II2 A;  1CNF A;  2CF4 A;  1J9Z A;  3SJP A;  4AF7 A;  2DER A;  4X7D A;  3Q3A A;  3A1P A;  2GJP A;  1EP2 B;  3AGP A;  3OEH A;  1VQ4 B;  2HMA A;  1E1R A;  4YAF A;  1WU8 A;  2X6X A;  5THX A;  4ZGQ B;  1N0V C;  1COW A;  1KK1 A;  4P25 A;  3WNC A;  1UD5 A;  3R6J A;  4X8I A;  2CND A;  3OZV A;  1HVX A;  2VBT A;  1FX0 A;  3QFC A;  1QGA A;  1KD1 D;  1ZM2 A;  2BM0 A;  3H94 A;  1SKY B;  2R6H A;  2BN4 A;  2D9R A;  3OE7 A;  3CD6 B;  4QFM A;  2DY1 A;  2F1L A;  2OK8 A;  3PA1 A;  3RY8 A;  4XON A;  4B48 A;  2CRV A;  2ZXH A;  1EWY A;  1Q9S A;  4F7D A;  4B47 A;  1QX4 A;  4TMZ A;  4XLA A;  3CMA B;  2VBV A;  3BCD A;  2WYR A;  4DQK A;  4Z4Z A;  4U9U A;  1JA1 A;  2V7V A;  1DDI A;  3AST A;  3W2G A;  4LC0 A;  4X05 A;  4LBV A;  2XEX A;  3CTA A;  2VBS A;  4XKW A;  3J81 k;  4TMW A;  1QFY A;  1KK0 A;  5KNL A;  1OB2 A;  3AGQ A;  5FIU A;  2DEU A;  3P26 A;  1YJN B;  5CDF A;  1E1Q A;  1NDH A;  4WZT A;  3MCA A;  2DYI A;  3D26 A;  3V76 A;  2D3N A;  3GSI A;  2I1L A;  2VJI A;  3QSY A;  3OKX A;  3U6B A;  1WP6 A;  5FO1 A;  1Y0R A;  1QFJ A;  1V0E A;  2WJY A;  3LQ6 A;  1UD2 A;  4X7F A;  2YWF A;  5J35 A;  1I8D A;  1QUF A;  4RD4 A;  5L46 A;  3VNU A;  3ZZT A;  1AIP A;  1UD3 A;  1W35 A;  4XNF A;  1KMH A;  5IK2 A;  5HZB A;  3G4S B;  1QUE A;  1S72 B;  2E1B A;  2QA4 B;  3LNN A;  4B43 A;  1WOP A;  4PAA A;  3E20 A;  2ZZG A;  4LBZ A;  4PC2 A;  2BMW A;  2QE7 A;  2VNH A;  1B23 P;  4NBS A;  4Z1M A;  3AVW A;  4DNR B;  2OTJ B;  1PKV A;  3NE5 B;  1N05 A;  2X6Y A;  3I1F A;  4P26 A;  4CQJ A;  2JDI A;  5DS0 A;  3CME B;  1K73 D;  1WOO A;  4C43 A;  4XQF A;  1HZE A;  4DQL A;  5BSX A;  1TLL A;  4DK1 A;  4PC7 A;  3VO1 A;  1VQM B;  3AVT A;  1ZM9 A;  1WDT A;  2D74 A;  2Q6L A;  1EFC A;  1BLI A;  4OPV A;  3A35 A;  1WOS A;  1D1N A;  1E79 A;  1GAW A;  2C5B A;  4LBW A;  3ZBT A;  1NB9 A;  4TT3 A;  1JJ2 B;  1W34 A;  3ASR A;  3SJZ A;  2HDN B;  4WZE A;  3JQR A;  3WBK A;  5B6I A;  1YLO A;  2DOG A;  1E43 A;  3Q6Q A;  3W2I A;  3AVX A;  1RQR A;  1TVC A;  4ROX A;  5IYR A;  1XE1 A;  2VBU A;  1ELO A;  1BX1 A;  2V7X A;  4Q7J B;  2OTL B;  2VNJ A;  4Z4T A;  5J3O A;  3LO8 A;  1BPL A;  4M0L A;  4YAL A;  5HKK A;  1SM4 A;  3W2H A;  4ZGN B;  1QVF B;  2QN6 A;  4M53 A;  3QFR A;  2GRE A;  1VQ7 B;  3B82 A;  3ASS A;  2ZBV A;  2GJR A;  2V7Q A;  4OPS A;  4B3F X;  2QTZ A;  4XLF A;  1YX2 A;  4XLE A;  4P3Y A;  2YWH A;  4FXU A;  4QVA A;  4XN3 A;  1GO2 A;  4RJL A;  3FPP A;  4TMT A;  4Y9R A;  3VMF A;  1G7S A;  2HLD A;  5GV8 A;  4P9S A;  3W5U A;  4YHB A;  3BY1 A;  4E0F A;  2CBX A;  2V7W A;  4PC1 A;  4DNT B;  2RC5 A;  4RD2 A;  1FNC A;  3OOC A;  4KKU A;  4PGO A;  4G1B A;  3Q6R A;  4UZF A;  4Z4U A;  4MYU A;  1RQP A;  5FL7 A;  5BSY A;  2CW5 A;  1G7R A;  2KVO A;  4XM3 A;  3T56 B;  1K9M D;  1FND A;  2VZL A;  4RD0 A;  5TR9 A;  1W2B B;  1TUI A;  3H9N A;  3G6E B;  1M90 D;  4P12 A;  3PUM A;  2GJK A;  1Q86 D;  4J0Q A;  1FRN A;  1SKQ A;  1EFU A;  2ZL7 A;  2WPD A;  2WR8 A;  4KKS A;  2X8K A;  5F4M A;  4RDJ A;  3W5V A;  4IW3 B;  2EIX A;  3CP2 A;  2XNC A;  3CPX A;  3GQB A;  3B78 A;  4TN1 A;  3QFS A;  1VQN B;  1IJE A;  3OZW A;  4XOT A;  3GIR A;  1KZL A;  5H59 A;  2BPO A;  2ZZQ A;  1K8A D;  5AN9 A;  3CCL B;  5JBQ A;  3GVL A;  4P22 A;  1VLO A;  4YAO A;  2V31 A;  5FO0 A;  3PUN A;  3W5H A;  2FX3 A;  1W9X A;  1I18 A;  4YEL A;  1GR1 A;  3OP1 A;  1Y0Y A;  2GPJ A;  3ZZ0 A;  1BJK A;  2X85 A;  2CC2 A;  1YJ9 B;  3ONY A;  3FKS A;  5IYW A;  4BPR A;  3WNB A;  2VYQ A;  1D8T A;  4M4S A;  1MAB A;  1VLY A;  3BCF A;  4Z4V A;  5IYQ A;  1PJ7 A;  5IYN A;  2M5S A;  4N3N A;  3WQZ A;  5HXB A;  3I56 B;  4C0S A;  2C77 A;  1N8R D;  3A3B A;  5HZA A;  5IYP A;  2Z6B D;  2WZN A;  4ZCL A;  3LQE A;  1VHO A;  2RC6 A;  3OAA A;  4G7W A;  2LZJ A;  3Q38 A;  1DG1 G;  4G5G A;  2BVN A;  3ISX A;  4H9G A;  4PC6 A;  4DK0 A;  4LBY A;  1QFZ A;  2ZL6 A;  1CQX A;  1T5E A;  4RD3 A;  2JJ1 A;  3BH4 A;  2BF4 A;  4NCN A;  1UMK A;  4XL9 A;  4RM0 A;  4UZE A;  1S4M A;  2C5H A;  2BGI A;  4RPD A;  1GJR A;  1H42 A;  3CCE B;  3CCU B;  4RLZ A;  3CCR B;  1Q7Y D;  2PLF A;  2QMU A;  1VQ8 B;  2OBT A;  4TMV A;  2VNI A;  5F4O A;  2OBS A;  3T53 B;  4ZCM A;  3SLD A;  5GV7 A;  1YIJ B;  1R5O A;  1H85 A;  2YWE A;  4RCY A;  3CRZ A;  4XKV A;  3WBJ A;  1KK3 A;  5H5J A;  2XOK A;  1B2R A;  4QHY A;  4OOS A;  1V0F A;  5A89 A;  2F1M A;  1R5N A;  2PE3 A;  3CCS B;  1KQS B;  2QDX A;  2C2W A;  3KL9 A;  3OFN A;  1FNB A;  1V5V A;  2OYN A;  4P6Y A;  2OBR A;  1W0K A;  1VF7 A;  4XMY A;  3KEW A;  1VQP B;  2XGJ A;  1E3Z A;  1VJS A;  4Z4Y A;  3T51 B;  5A8A A;  1D2E A;  2NPF A;  1G7C A;  2XND A;  3G71 B;  2BV3 A;  4RPB A;  4WQM A;  5KW9 A;  3GVK A;  4II3 A;  3ZC3 A;  1FRQ A;  2W6J A;  4Y9U A;  3U6K A;  4OOV A;  5E6T A;  4QUZ A;  4L8J A;  1T6X A;  1ZM3 A;  2QGG A;  1K28 D;  3GVJ A; 
#chains in the Genus database with same CATH homology
 4KKS A;  2X8K A;  4XKW A;  1WTH D;  5KNL A;  3CP2 A;  3GQB A;  4HIZ A;  1WPC A;  5DN6 A;  3VR6 A;  4XN0 A;  2ZZE A;  2X6W A;  4NNJ A;  1E1Q A;  4XOT A;  5CDF A;  1KZL A;  4XOP A;  2ZZQ A;  2D3N A;  4TSF A;  4XLH A;  2VJI A;  3GVL A;  4P22 A;  1OB0 A;  2ZZF A;  2V31 A;  1WP6 A;  3CP8 A;  1EFR A;  1V0E A;  2WJY A;  2ZTG A;  1UD2 A;  4XOR A;  3G05 A;  1H8E A;  1W9X A;  1I18 A;  4YEL A;  1I8D A;  4XR6 A;  1UD3 A;  2XZP A;  1KMH A;  4XNF A;  5IK2 A;  1BMF A;  2X85 A;  2E1B A;  3BC9 A;  3FKS A;  1UD8 A;  4JMQ A;  3LNN A;  3OW7 A;  2D3L A;  4AVZ A;  1MAB A;  1E3X A;  1VLY A;  2ZZG A;  3OPO A;  3BCF A;  2F43 A;  2CK3 A;  3DDY A;  2M5S A;  2QE7 A;  4Z1M A;  4DNR B;  3WQZ A;  1PKV A;  3NE5 B;  2X6Y A;  4GQN A;  3CES A;  2JDI A;  3A3B A;  4UZU A;  4XQF A;  1HZE A;  4G7X A;  2Z6B D;  4XLC A;  4DK1 A;  3JU4 A;  2DIE A;  4B3G A;  2WJV A;  3OAA A;  4G7W A;  2XZO A;  2LZJ A;  2WSS A;  3CMM A;  3ZIA A;  1BLI A;  3A35 A;  4DK0 A;  1E79 A;  2W6I A;  4YXW A;  2VJJ A;  4TT3 A;  1T5E A;  2JJ1 A;  2XZL A;  3BH4 A;  1UD6 A;  2GK7 A;  1UD4 A;  4TKO B;  1E43 A;  4XL9 A;  3OEE A;  3HAG A;  4YEJ A;  1NBM A;  2JJ2 A;  4G6I A;  2WZP P;  4II2 A;  4ASU A;  2GJP A;  1BPL A;  3OEH A;  3T53 B;  1E1R A;  2X6X A;  5HKK A;  1COW A;  2V4D A;  4XKV A;  1UD5 A;  2GJR A;  2V7Q A;  4XD7 A;  3ZPN A;  2XOK A;  4B3F X;  1W0J A;  1HVX A;  1V0F A;  4XLF A;  4XLE A;  2F1M A;  1FX0 A;  2X53 S;  4FXU A;  4XN3 A;  3FPP A;  2HLD A;  3OFN A;  1H8H A;  2GK6 A;  3H94 A;  1SKY B;  3OE7 A;  4E0F A;  1W0K A;  1VF7 A;  4XMY A;  3KEW A;  4DNT B;  2XGJ A;  3OOC A;  1E3Z A;  1VJS A;  4KKU A;  1OHH A;  3T51 B;  4XON A;  2XND A;  2JIZ A;  2ZXH A;  5FL7 A;  2ZTN A;  1NRK A;  2KVO A;  3GVK A;  4KKT A;  4II3 A;  4XM3 A;  4XLA A;  2W6J A;  3T56 B;  3A3G A;  3BCD A;  2R9V A;  2ZXI A;  4L8J A;  2GJK A;  3GVJ A;  1K28 D;  2WPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...