3DDYA

Structure of lumazine protein, an optical transponder of luminescent bacteria
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
184
structure length
175
Chain Sequence
MFRGIVQGRGVIRSISKSEDSQRHGIAFPEGMFQLVDVDTVMLVNGCSNTVVRILGDMVYFDIDQALGTTTFDGLKEGDQVNLEIHPGLTGNIKGTALVAAIEENDAGFSVLIDIPKGLAENLTVKDDIGIDGISLPITDMSDSIITLNYSRDLLASTNIASLAKDVKVNVEILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of lumazine protein, an optical transponder of luminescent bacteria.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Luminescent protein
molecule keywords Lumazine protein
total genus 33
structure length 175
sequence length 184
ec nomenclature
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00677 Lum_binding Lumazine binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.20 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ddyA01
2.40.30.20 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ddyA02
3GVJA 1FX0A 4E0FA 1E1QA 3A35A 1V0EA 1W0JA 4TSFA 2WSSA 1KMHA 3GVLA 2CK3A 5CDFA 1W0KA 2JJ1A 1EFRA 4G6IA 2XOKA 1COWA 1H8HA 1SKYB 3OFNA 5DN6A 4YXWA 1PKVA 3A3GA 1NBMA 2QE7A 1OHHA 2W6IA 2W6JA 4XD7A 2R9VA 1H8EA 3OE7A 3A3BA 3DDYA 3GVKA 3OEEA 4TT3A 2F43A 2XNDA 1KZLA 4FXUA 1E1RA 2JIZA 5FL7A 5HKKA 3OAAA 5IK2A 3ZIAA 1I18A 2WPDA 4HIZA 1I8DA 1E79A 3JU4A 1V0FA 4ASUA 2JDIA 1HZEA 1MABA 3GQBA 3OEHA 4GQNA 3FKSA 3VR6A 2V7QA 2HLDA 2JJ2A 4Z1MA 1BMFA
chains in the Genus database with same CATH superfamily
4PC7A 1VQKB 3AVWA 2X85A 5A88A 1XFOA 1KMHA 1IJEA 4YAOA 4RDJA 4KKSA 3A8IA 2V4DA 4Z4VA 2BPOA 1QFZA 2R9VA 3KL9A 4YAWA 3QE2A 1ZM9A 1W87A 2XNCA 4N3NA 1YJ9B 2OBTA 3MCAA 3CC7B 2F4NA 1E62A 5J35A 1DDIA 1E79A 2YWFA 1Q82D 1VQ8B 1U2RA 4RPDA 4Z4YA 3OZUA 4BPRA 2B5OA 3FJOA 2WYRA 3CRZA 5KSWB 5A8AA 4R71A 1PJ6A 1FNBA 4YELA 4YXWA 4OPSA 1V5VA 2VBTA 1FRNA 2R6HA 1NB9A 3LVBA 1N8RD 4LC0A 3AVYA 3ASPA 1H8EA 5AN9A 2F1MA 3Q3AA 5IYNA 1VQPB 1DG1G 2PLFA 4B47A 2ZTNA 4M1KA 3PENA 2CC2A 2Q6LA 1VQ4B 1N0VC 4HIZA 1I8DA 3BC9A 1EP2B 4DQLA 3OJXA 3G05A 4GQNA 3VR6A 2X6XA 3A3GA 1S0UA 1WTHD 3W5UA 3SJZA 3A35A 3QFRA 1T6XA 1W0JA 4Y9RA 1JB9A 4TMXA 1QG0A 4XOTA 4C43A 2DYIA 3R6KA 4RDKA 5IYWA 3CC2B 1P4MA 4G6IA 2ZXIA 1EP3B 2X0KA 1EXMA 2KVOA 1G7TA 1NDHA 1D8TA 5FIUA 1QUFA 3JQRA 2ZZEA 3QFSA 2QA4B 4X07A 1J9ZA 2BN4A 3KEWA 4LBVA 2X53S 4OP7A 1VQNB 2Q6KA 2OK8A 2DY1A 3W2EA 1EWYA 3J81k 4TMWA 1SM4A 4P25A 5F4OA 3CP8A 3JQPA 4PC2A 2J7KA 4ACBA 4X8IA 3W5HA 2BM1A 3E1YE 1UD5A 3FPPA 4RPBA 4XL9A 5THXA 2WZPP 3OW7A 4X05A 2X6YA 1VHEA 1OB0A 1EFRA 4ZGNB 1WOSA 3CCQB 1GVHA 4AC9A 1F20A 2ZZQA 3CCUB 1FRQA 3OOCA 2XZPA 2GK6A 3WBKA 4RD2A 3BY1A 2CBXA 2VZLA 3OPOA 4G1VA 4ZGQB 1R5BA 3CPWB 1BJKA 3AVXA 2PE3A 2FVGA 2PIAA 3SKBA 1OB2A 2HMAA 1JJ2B 2QN6A 5A89A 4OPOA 2ZL7A 3PVDA 4UAJA 2X3UA 1YITB 2QMUA 4RJLA 4QUZA 3D26A 2VJIA 1IJFA 1VQMB 5TY0A 1D2EA 1VQLB 1OGIA 1VQOB 3SEJA 4G7WA 5B6IA 4P6YA 3BQJA 1K28D 1BLIA 2W6JA 1H85A 1WORA 1WP6A 3G6EB 2Q6OA 1QGZA 2VBSA 4PGOA 3CCRB 2GPJA 4P12A 1UD2A 1YX2A 2OK7A 2X6WA 3I1FA 1KQSB 1UD3A 3AVUA 4OOSA 4RM0A 4DNTB 2V31A 2V7TA 3GIRA 3OJWA 1KJZA 5F4MA 1KK0A 2ZBUA 4B43A 2JJ2A 4Z1MA 1GAWA 3ZZ0A 3BY2A 1E1QA 4XR6A 1NJID 3WY9A 5TV2A 2BSAA 3GSIA 1KK3A 3SLDA 4X7CA 3BNWA 2QTLA 4RLZA 4ZCMA 3ASTA 1WSVA 5GV8A 3BCDA 1QFYA 1NRKA 4M2LA 4WZTA 4TMTA 1G7RA 2RC5A 3ZBTA 4ACAA 1W2BB 3G71B 5FL7A 4YEJA 2VBUA 2B7CA 1KTVA 4XLAA 4XNFA 2JN9A 3B82A 1DDGA 1QH0A 1QVFB 1E64A 3BCFA 1TLLA 4TMZA 1TTTA 2BGIA 3MHPA 2YWEA 4QVJA 4P6VF 3CCJB 3I56B 2ZITA 2VYQA 1FDRA 1PKVA 2BF4A 2V7UA 1MRZA 4XLEA 4YAFA 3SLNA 4KKTA 3CCEB 3ISXA 2CRVA 4XKVA 1JA1A 4RD4A 2XNDA 3CESA 3VNUA 3Q38A 1R5OA 2JIZA 3CTAA 1G7CA 2YWGA 4Z4WA 3I55B 4F7DA 2BVNA 2C5BA 1EFTA 3CP2A 5BSYA 1N07A 4XORA 2XGJA 1E63A 4AF6A 3A8JA 1W9XA 1IB0A 4TKOB 4Y9UA 4YALA 4TSFA 1OB5A 4FWTA 1FNMA 4X7DA 4G7XA 2XEXA 2X8KA 3PA1A 3OW2B 1QVGB 3AGPA 4MYTA 3FPKA 2D3NA 1OHHA 2Z6BD 1XB2A 2QGGA 3CMMA 4U9UA 3W2FA 3CCLB 4EH1A 1KC8D 4XD7A 4HE6A 3QFCA 3CPXA 1YI2B 2VNKA 4NNJA 4DQKA 1KK1A 5KW9A 2DOGA 1UD4A 4UZUA 5GV7A 1M1KD 3AVTA 1YJWB 2OYNA 4N3GA 5H59A 1Q86D 1PJ7A 1MABA 1T6YA 2PMDA 1Y0RA 2QDXA 1WDTA 1E3ZA 4XLHA 2VNIA 1WOPA 1NB0A 1ZUNB 4YAUA 1AMOA 3CD6B 2V7XA 2GQFA 3OZWA 2DETA 2WSSA 4PC1A 4P22A 4PC3A 2CK3A 4Y7CA 1VHOA 2WJVA 3WQZA 2OTLB 3WYAA 4AF7A 4LBYA 5DS0A 3OE7A 4TT3A 4RD6A 2F43A 3CB4A 4K1XA 4HE5A 4PAAA 3LO8A 3WNBA 5L46A 4XLFA 5FA6A 3ZUGA 1XQBA 4DNRB 4RDLA 4CQJA 1BPLA 3G4SB 4B48A 3ASRA 3CCVB 3ZZTA 1QUEA 4FN5A 4II2A 4WZLA 3ONUA 2GJPA 2CF4A 2ZL6A 3AGQA 4X06A 1VQ9B 1EP1B 1KRHA 2VBVA 3ASSA 1WPCA 2JJ1A 1K73D 3ASQA 2Q6IA 3OFNA 4KKUA 3T53B 2BMWA 1HA3A 2P3MA 2WZNA 2V7WA 1HVXA 3U6BA 2RC6A 5FO1A 3ZBUA 3LNNA 4QFMA 5IYQA 2CW5A 4X0CA 4XOPA 1N0UA 2BV3A 1B2RA 1H42A 2BM0A 4RCYA 3CMEB 5HKKA 1Q7YD 1CQXA 3OKXA 5IK2A 4AVZA 2WPDA 3JU4A 4YHBA 1V0FA 4J0QA 4IW3B 2FX3A 4Q7JB 3DDYA 4RD0A 4Z4ZA 4NBSA 2GREA 1D1NA 1FNDA 1QFJA 4RD3A 3W2GA 4X7FA 1GJRA 1ZM2A 3W5VA 4PC6A 1NBMA 1VJSA 4XN3A 3RY8A 3U2QA 4XQFA 3OZVA 1I7PA 3Q6QA 2DERA 1E43A 2B7BA 5LMZA 5BSXA 1BQEA 1JA0A 3GVKA 2E1BA 1KZLA 2NV4A 3VO1A 1GR1A 4NCNA 2E1RA 3HAGA 4L8JA 4ASUA 4LBZA 4B44A 2YWHA 1SKQA 4RCZA 3FKSA 3VMFA 5HZAA 1ELOA 4E0FA 4X7EA 1V0EA 3W2IA 5HZBA 2DEUA 1OGJA 5CDFA 5JBQA 1DARA 2D74A 3AVVA 1B23P 2AHOA 1COWA 1Q81D 2OBSA 5FNZA 1F60A 3JQQA 3CC4B 1UD6A 4M4SA 4WZEA 1UD8A 1YLOA 2I1LA 3MMPA 3A3BA 2F1LA 4QHYA 4XLCA 2EFGA 2XZOA 1AIPA 2C2WA 1S72B 4FXUA 3LQEA 4B4DA 4B3GA 4Z4RA 4P26A 5H5JA 3CMAB 4B3FX 5IYPA 5TR9A 3CW2A 4OOVA 1EFUA 5E6TA 4UZEA 5DSZA 1S4MA 5FO0A 1RQRA 3ES9A 3E20A 2BGJA 1N06A 4Z4SA 1KK2A 3T51B 3PA2A 4MYUA 1XE1A 1YJNB 2WJYA 2WR8A 2ZZFA 4XM3A 4C0SA 4FK8A 4Z4UA 1KD1D 2C77A 2EIXA 2GK7A 3WXMA 1H8HA 5IYRA 1SKYB 5DN6A 3QSYA 1K8AD 1QGAA 3ZPNA 1VLYA 4M0LA 1BX1A 5F4JA 1WSRA 4DK0A 1ZM3A 4ROXA 1G7SA 3NE5B 4ZV4A 4H9GA 1N05A 2ZZGA 1K9MD 3OAAA 4ZCLA 1PJ5A 2OTJB 3PUNA 2JDIA 1HZEA 4XN0A 5TRDA 2XZLA 2HLDA 1UMKA 3QFTA 3B8HA 2QEXB 3GVJA 4QV2A 4P3IA 3VNVA 1YIJB 4M53A 3A1PA 3GVLA 2GJRA 1E3XA 2XOKA 2D3LA 1T5EA 2OBRA 2ZBVA 1VQ6B 4DK1A 2VJJA 3V7AA 5J3OA 2W6IA 1A8PA 4OOXA 2QTZA 4TMVA 1WOOA 3P26A 2DIEA 2NPFA 4Z4TA 1T6ZA 4UZFA 3H9NA 1R5NA 4XONA 5KNLA 5HXBA 4WWVA 1BMFA 3GQBA 1FX0A 1QGYA 2VNJA 4WQMA 3W2HA 2HCJB 3ONYA 4XMYA 3R6JA 4PABA 1N08A 1RQPA 1GAQA 2HDNB 4JMQA 1IHMA 1JNYA 3P27A 1TVCA 4B3XA 1M90D 3CCSB 3LQ6A 1ZM4A 3Q6RA 2C4UA 2C5HA 3Q39A 3V76A 3WBJA 1VLOA 2M5SA 1E1RA 4P1VA 1CNEA 2VNHA 3CXCB 1VF7A 3PUMA 4WZKA 1I18A 1W34A 2XNJA 3CCMB 1VQ5B 1CNFA 4XKWA 3OP1A 3OEHA 2V7QA 1QX4A 3ZZUA 4G5GA 3ZC3A 1Q9SA 2GJKA 1VQ7B 3BH4A 2C78A 1TUIA 4P2NA 4P3YA 5EMNA 1W0KA 2ZTGA 1EFCA 1W35A 3WNDA 1YHQB 4RD1A 2QE7A 1Y0YA 2V7VA 2CNDA 2ZXHA 4G1BA 3OEEA 2LZJA 3H94A 1BX0A 4QVAA 4OPVA 3WNCA 4LBWA 1WU8A 3B78A 4P9SA 3ZIAA 2C4TA 2D9RA 3A8KA 3SJPA 2DCUA 3VO2A 2ZL5A 4II3A 1FNCA 4TN1A 1GO2A 3U6KA 3T56B 4ZCIA
chains in the Genus database with same CATH topology
3T51B 2VJIA 2X85A 2WSSA 1KMHA 2WJYA 4P22A 2CK3A 2ZZFA 4XM3A 2GK7A 1H8HA 4KKSA 1SKYB 4G7WA 5DN6A 2WJVA 3WQZA 2V4DA 3ZPNA 1VLYA 1K28D 1BLIA 2W6JA 4DK0A 2R9VA 1WP6A 3OE7A 4TT3A 2F43A 1UD2A 3NE5B 2X6WA 1UD3A 4XLFA 4DNTB 2ZZGA 3OAAA 2V31A 4DNRB 1E79A 2JDIA 1BPLA 1HZEA 4XN0A 2XZLA 2HLDA 2JJ2A 4Z1MA 3GVJA 4II2A 1E1QA 2GJPA 4XR6A 3GVLA 2GJRA 1WPCA 2JJ1A 2XOKA 1E3XA 2D3LA 3OFNA 1T5EA 4KKUA 4YELA 4YXWA 3T53B 4DK1A 2VJJA 2W6IA 1HVXA 1H8EA 3BCDA 3LNNA 1NRKA 2F1MA 4XOPA 5FL7A 2DIEA 2ZTNA 4YEJA 5HKKA 5IK2A 4AVZA 2WPDA 4HIZA 1I8DA 3JU4A 4XLAA 1V0FA 3BC9A 4XNFA 3G05A 4GQNA 4XONA 3VR6A 2X6XA 3A3GA 3DDYA 5KNLA 1WTHD 1BMFA 3GQBA 1FX0A 3A35A 1W0JA 3BCFA 4XOTA 4XMYA 4G6IA 2ZXIA 2KVOA 1PKVA 4XLEA 4JMQA 1NBMA 1VJSA 4XN3A 4XQFA 1E43A 2ZZEA 4KKTA 3GVKA 4XKVA 2E1BA 3KEWA 2X53S 1KZLA 2XNDA 3CESA 2M5SA 1E1RA 2JIZA 1VF7A 1I18A 3HAGA 4L8JA 4ASUA 3CP8A 4XKWA 3CP2A 3OEHA 4XORA 2XGJA 3FKSA 2V7QA 1UD5A 1W9XA 3FPPA 4TKOB 2GJKA 4XL9A 4E0FA 1V0EA 3BH4A 4TSFA 2WZPP 3OW7A 5CDFA 2X6YA 1W0KA 1OB0A 1EFRA 2ZTGA 2X8KA 4G7XA 1COWA 2ZZQA 3OOCA 2XZPA 2D3NA 2GK6A 2QE7A 1OHHA 1UD6A 2Z6BD 3CMMA 3OPOA 1UD8A 4XD7A 2ZXHA 3A3BA 3OEEA 2LZJA 3H94A 4XLCA 2XZOA 4FXUA 4NNJA 4B3GA 1UD4A 4UZUA 4B3FX 3ZIAA 4II3A 1MABA 4XLHA 1E3ZA 3T56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GVJ A;  1FX0 A;  4E0F A;  1E1Q A;  3A35 A;  1V0E A;  1W0J A;  4TSF A;  2WSS A;  1KMH A;  3GVL A;  2CK3 A;  5CDF A;  1W0K A;  2JJ1 A;  1EFR A;  4G6I A;  2XOK A;  1COW A;  1H8H A;  1SKY B;  3OFN A;  5DN6 A;  4YXW A;  1PKV A;  3A3G A;  1NBM A;  2QE7 A;  1OHH A;  2W6I A;  2W6J A;  4XD7 A;  2R9V A;  1H8E A;  3OE7 A;  3A3B A;  3DDY A;  3GVK A;  3OEE A;  4TT3 A;  2F43 A;  2XND A;  1KZL A;  4FXU A;  1E1R A;  2JIZ A;  5FL7 A;  5HKK A;  3OAA A;  5IK2 A;  3ZIA A;  1I18 A;  2WPD A;  4HIZ A;  1I8D A;  1E79 A;  3JU4 A;  1V0F A;  4ASU A;  2JDI A;  1HZE A;  1MAB A;  3GQB A;  3OEH A;  4GQN A;  3FKS A;  3VR6 A;  2V7Q A;  2HLD A;  2JJ2 A;  4Z1M A;  1BMF A; 
#chains in the Genus database with same CATH topology
 4PC7 A;  1VQK B;  3AVW A;  2X85 A;  5A88 A;  1XFO A;  1KMH A;  1IJE A;  4YAO A;  4RDJ A;  4KKS A;  3A8I A;  2V4D A;  4Z4V A;  2BPO A;  1QFZ A;  2R9V A;  3KL9 A;  4YAW A;  3QE2 A;  1ZM9 A;  1W87 A;  2XNC A;  4N3N A;  1YJ9 B;  2OBT A;  3MCA A;  3CC7 B;  2F4N A;  1E62 A;  5J35 A;  1DDI A;  1E79 A;  2YWF A;  1Q82 D;  1VQ8 B;  1U2R A;  4RPD A;  4Z4Y A;  3OZU A;  4BPR A;  2B5O A;  3FJO A;  2WYR A;  3CRZ A;  5KSW B;  5A8A A;  4R71 A;  1PJ6 A;  1FNB A;  4YEL A;  4YXW A;  4OPS A;  1V5V A;  2VBT A;  1FRN A;  2R6H A;  1NB9 A;  3LVB A;  1N8R D;  4LC0 A;  3AVY A;  3ASP A;  1H8E A;  5AN9 A;  2F1M A;  3Q3A A;  5IYN A;  1VQP B;  1DG1 G;  2PLF A;  4B47 A;  2ZTN A;  4M1K A;  3PEN A;  2CC2 A;  2Q6L A;  1VQ4 B;  1N0V C;  4HIZ A;  1I8D A;  3BC9 A;  1EP2 B;  4DQL A;  3OJX A;  3G05 A;  4GQN A;  3VR6 A;  2X6X A;  3A3G A;  1S0U A;  1WTH D;  3W5U A;  3SJZ A;  3A35 A;  3QFR A;  1T6X A;  1W0J A;  4Y9R A;  1JB9 A;  4TMX A;  1QG0 A;  4XOT A;  4C43 A;  2DYI A;  3R6K A;  4RDK A;  5IYW A;  3CC2 B;  1P4M A;  4G6I A;  2ZXI A;  1EP3 B;  2X0K A;  1EXM A;  2KVO A;  1G7T A;  1NDH A;  1D8T A;  5FIU A;  1QUF A;  3JQR A;  2ZZE A;  3QFS A;  2QA4 B;  4X07 A;  1J9Z A;  2BN4 A;  3KEW A;  4LBV A;  2X53 S;  4OP7 A;  1VQN B;  2Q6K A;  2OK8 A;  2DY1 A;  3W2E A;  1EWY A;  3J81 k;  4TMW A;  1SM4 A;  4P25 A;  5F4O A;  3CP8 A;  3JQP A;  4PC2 A;  2J7K A;  4ACB A;  4X8I A;  3W5H A;  2BM1 A;  3E1Y E;  1UD5 A;  3FPP A;  4RPB A;  4XL9 A;  5THX A;  2WZP P;  3OW7 A;  4X05 A;  2X6Y A;  1VHE A;  1OB0 A;  1EFR A;  4ZGN B;  1WOS A;  3CCQ B;  1GVH A;  4AC9 A;  1F20 A;  2ZZQ A;  3CCU B;  1FRQ A;  3OOC A;  2XZP A;  2GK6 A;  3WBK A;  4RD2 A;  3BY1 A;  2CBX A;  2VZL A;  3OPO A;  4G1V A;  4ZGQ B;  1R5B A;  3CPW B;  1BJK A;  3AVX A;  2PE3 A;  2FVG A;  2PIA A;  3SKB A;  1OB2 A;  2HMA A;  1JJ2 B;  2QN6 A;  5A89 A;  4OPO A;  2ZL7 A;  3PVD A;  4UAJ A;  2X3U A;  1YIT B;  2QMU A;  4RJL A;  4QUZ A;  3D26 A;  2VJI A;  1IJF A;  1VQM B;  5TY0 A;  1D2E A;  1VQL B;  1OGI A;  1VQO B;  3SEJ A;  4G7W A;  5B6I A;  4P6Y A;  3BQJ A;  1K28 D;  1BLI A;  2W6J A;  1H85 A;  1WOR A;  1WP6 A;  3G6E B;  2Q6O A;  1QGZ A;  2VBS A;  4PGO A;  3CCR B;  2GPJ A;  4P12 A;  1UD2 A;  1YX2 A;  2OK7 A;  2X6W A;  3I1F A;  1KQS B;  1UD3 A;  3AVU A;  4OOS A;  4RM0 A;  4DNT B;  2V31 A;  2V7T A;  3GIR A;  3OJW A;  1KJZ A;  5F4M A;  1KK0 A;  2ZBU A;  4B43 A;  2JJ2 A;  4Z1M A;  1GAW A;  3ZZ0 A;  3BY2 A;  1E1Q A;  4XR6 A;  1NJI D;  3WY9 A;  5TV2 A;  2BSA A;  3GSI A;  1KK3 A;  3SLD A;  4X7C A;  3BNW A;  2QTL A;  4RLZ A;  4ZCM A;  3AST A;  1WSV A;  5GV8 A;  3BCD A;  1QFY A;  1NRK A;  4M2L A;  4WZT A;  4TMT A;  1G7R A;  2RC5 A;  3ZBT A;  4ACA A;  1W2B B;  3G71 B;  5FL7 A;  4YEJ A;  2VBU A;  2B7C A;  1KTV A;  4XLA A;  4XNF A;  2JN9 A;  3B82 A;  1DDG A;  1QH0 A;  1QVF B;  1E64 A;  3BCF A;  1TLL A;  4TMZ A;  1TTT A;  2BGI A;  3MHP A;  2YWE A;  4QVJ A;  4P6V F;  3CCJ B;  3I56 B;  2ZIT A;  2VYQ A;  1FDR A;  1PKV A;  2BF4 A;  2V7U A;  1MRZ A;  4XLE A;  4YAF A;  3SLN A;  4KKT A;  3CCE B;  3ISX A;  2CRV A;  4XKV A;  1JA1 A;  4RD4 A;  2XND A;  3CES A;  3VNU A;  3Q38 A;  1R5O A;  2JIZ A;  3CTA A;  1G7C A;  2YWG A;  4Z4W A;  3I55 B;  4F7D A;  2BVN A;  2C5B A;  1EFT A;  3CP2 A;  5BSY A;  1N07 A;  4XOR A;  2XGJ A;  1E63 A;  4AF6 A;  3A8J A;  1W9X A;  1IB0 A;  4TKO B;  4Y9U A;  4YAL A;  4TSF A;  1OB5 A;  4FWT A;  1FNM A;  4X7D A;  4G7X A;  2XEX A;  2X8K A;  3PA1 A;  3OW2 B;  1QVG B;  3AGP A;  4MYT A;  3FPK A;  2D3N A;  1OHH A;  2Z6B D;  1XB2 A;  2QGG A;  3CMM A;  4U9U A;  3W2F A;  3CCL B;  4EH1 A;  1KC8 D;  4XD7 A;  4HE6 A;  3QFC A;  3CPX A;  1YI2 B;  2VNK A;  4NNJ A;  4DQK A;  1KK1 A;  5KW9 A;  2DOG A;  1UD4 A;  4UZU A;  5GV7 A;  1M1K D;  3AVT A;  1YJW B;  2OYN A;  4N3G A;  5H59 A;  1Q86 D;  1PJ7 A;  1MAB A;  1T6Y A;  2PMD A;  1Y0R A;  2QDX A;  1WDT A;  1E3Z A;  4XLH A;  2VNI A;  1WOP A;  1NB0 A;  1ZUN B;  4YAU A;  1AMO A;  3CD6 B;  2V7X A;  2GQF A;  3OZW A;  2DET A;  2WSS A;  4PC1 A;  4P22 A;  4PC3 A;  2CK3 A;  4Y7C A;  1VHO A;  2WJV A;  3WQZ A;  2OTL B;  3WYA A;  4AF7 A;  4LBY A;  5DS0 A;  3OE7 A;  4TT3 A;  4RD6 A;  2F43 A;  3CB4 A;  4K1X A;  4HE5 A;  4PAA A;  3LO8 A;  3WNB A;  5L46 A;  4XLF A;  5FA6 A;  3ZUG A;  1XQB A;  4DNR B;  4RDL A;  4CQJ A;  1BPL A;  3G4S B;  4B48 A;  3ASR A;  3CCV B;  3ZZT A;  1QUE A;  4FN5 A;  4II2 A;  4WZL A;  3ONU A;  2GJP A;  2CF4 A;  2ZL6 A;  3AGQ A;  4X06 A;  1VQ9 B;  1EP1 B;  1KRH A;  2VBV A;  3ASS A;  1WPC A;  2JJ1 A;  1K73 D;  3ASQ A;  2Q6I A;  3OFN A;  4KKU A;  3T53 B;  2BMW A;  1HA3 A;  2P3M A;  2WZN A;  2V7W A;  1HVX A;  3U6B A;  2RC6 A;  5FO1 A;  3ZBU A;  3LNN A;  4QFM A;  5IYQ A;  2CW5 A;  4X0C A;  4XOP A;  1N0U A;  2BV3 A;  1B2R A;  1H42 A;  2BM0 A;  4RCY A;  3CME B;  5HKK A;  1Q7Y D;  1CQX A;  3OKX A;  5IK2 A;  4AVZ A;  2WPD A;  3JU4 A;  4YHB A;  1V0F A;  4J0Q A;  4IW3 B;  2FX3 A;  4Q7J B;  3DDY A;  4RD0 A;  4Z4Z A;  4NBS A;  2GRE A;  1D1N A;  1FND A;  1QFJ A;  4RD3 A;  3W2G A;  4X7F A;  1GJR A;  1ZM2 A;  3W5V A;  4PC6 A;  1NBM A;  1VJS A;  4XN3 A;  3RY8 A;  3U2Q A;  4XQF A;  3OZV A;  1I7P A;  3Q6Q A;  2DER A;  1E43 A;  2B7B A;  5LMZ A;  5BSX A;  1BQE A;  1JA0 A;  3GVK A;  2E1B A;  1KZL A;  2NV4 A;  3VO1 A;  1GR1 A;  4NCN A;  2E1R A;  3HAG A;  4L8J A;  4ASU A;  4LBZ A;  4B44 A;  2YWH A;  1SKQ A;  4RCZ A;  3FKS A;  3VMF A;  5HZA A;  1ELO A;  4E0F A;  4X7E A;  1V0E A;  3W2I A;  5HZB A;  2DEU A;  1OGJ A;  5CDF A;  5JBQ A;  1DAR A;  2D74 A;  3AVV A;  1B23 P;  2AHO A;  1COW A;  1Q81 D;  2OBS A;  5FNZ A;  1F60 A;  3JQQ A;  3CC4 B;  1UD6 A;  4M4S A;  4WZE A;  1UD8 A;  1YLO A;  2I1L A;  3MMP A;  3A3B A;  2F1L A;  4QHY A;  4XLC A;  2EFG A;  2XZO A;  1AIP A;  2C2W A;  1S72 B;  4FXU A;  3LQE A;  4B4D A;  4B3G A;  4Z4R A;  4P26 A;  5H5J A;  3CMA B;  4B3F X;  5IYP A;  5TR9 A;  3CW2 A;  4OOV A;  1EFU A;  5E6T A;  4UZE A;  5DSZ A;  1S4M A;  5FO0 A;  1RQR A;  3ES9 A;  3E20 A;  2BGJ A;  1N06 A;  4Z4S A;  1KK2 A;  3T51 B;  3PA2 A;  4MYU A;  1XE1 A;  1YJN B;  2WJY A;  2WR8 A;  2ZZF A;  4XM3 A;  4C0S A;  4FK8 A;  4Z4U A;  1KD1 D;  2C77 A;  2EIX A;  2GK7 A;  3WXM A;  1H8H A;  5IYR A;  1SKY B;  5DN6 A;  3QSY A;  1K8A D;  1QGA A;  3ZPN A;  1VLY A;  4M0L A;  1BX1 A;  5F4J A;  1WSR A;  4DK0 A;  1ZM3 A;  4ROX A;  1G7S A;  3NE5 B;  4ZV4 A;  4H9G A;  1N05 A;  2ZZG A;  1K9M D;  3OAA A;  4ZCL A;  1PJ5 A;  2OTJ B;  3PUN A;  2JDI A;  1HZE A;  4XN0 A;  5TRD A;  2XZL A;  2HLD A;  1UMK A;  3QFT A;  3B8H A;  2QEX B;  3GVJ A;  4QV2 A;  4P3I A;  3VNV A;  1YIJ B;  4M53 A;  3A1P A;  3GVL A;  2GJR A;  1E3X A;  2XOK A;  2D3L A;  1T5E A;  2OBR A;  2ZBV A;  1VQ6 B;  4DK1 A;  2VJJ A;  3V7A A;  5J3O A;  2W6I A;  1A8P A;  4OOX A;  2QTZ A;  4TMV A;  1WOO A;  3P26 A;  2DIE A;  2NPF A;  4Z4T A;  1T6Z A;  4UZF A;  3H9N A;  1R5N A;  4XON A;  5KNL A;  5HXB A;  4WWV A;  1BMF A;  3GQB A;  1FX0 A;  1QGY A;  2VNJ A;  4WQM A;  3W2H A;  2HCJ B;  3ONY A;  4XMY A;  3R6J A;  4PAB A;  1N08 A;  1RQP A;  1GAQ A;  2HDN B;  4JMQ A;  1IHM A;  1JNY A;  3P27 A;  1TVC A;  4B3X A;  1M90 D;  3CCS B;  3LQ6 A;  1ZM4 A;  3Q6R A;  2C4U A;  2C5H A;  3Q39 A;  3V76 A;  3WBJ A;  1VLO A;  2M5S A;  1E1R A;  4P1V A;  1CNE A;  2VNH A;  3CXC B;  1VF7 A;  3PUM A;  4WZK A;  1I18 A;  1W34 A;  2XNJ A;  3CCM B;  1VQ5 B;  1CNF A;  4XKW A;  3OP1 A;  3OEH A;  2V7Q A;  1QX4 A;  3ZZU A;  4G5G A;  3ZC3 A;  1Q9S A;  2GJK A;  1VQ7 B;  3BH4 A;  2C78 A;  1TUI A;  4P2N A;  4P3Y A;  5EMN A;  1W0K A;  2ZTG A;  1EFC A;  1W35 A;  3WND A;  1YHQ B;  4RD1 A;  2QE7 A;  1Y0Y A;  2V7V A;  2CND A;  2ZXH A;  4G1B A;  3OEE A;  2LZJ A;  3H94 A;  1BX0 A;  4QVA A;  4OPV A;  3WNC A;  4LBW A;  1WU8 A;  3B78 A;  4P9S A;  3ZIA A;  2C4T A;  2D9R A;  3A8K A;  3SJP A;  2DCU A;  3VO2 A;  2ZL5 A;  4II3 A;  1FNC A;  4TN1 A;  1GO2 A;  3U6K A;  3T56 B;  4ZCI A; 
#chains in the Genus database with same CATH homology
 3T51 B;  2VJI A;  2X85 A;  2WSS A;  1KMH A;  2WJY A;  4P22 A;  2CK3 A;  2ZZF A;  4XM3 A;  2GK7 A;  1H8H A;  4KKS A;  1SKY B;  4G7W A;  5DN6 A;  2WJV A;  3WQZ A;  2V4D A;  3ZPN A;  1VLY A;  1K28 D;  1BLI A;  2W6J A;  4DK0 A;  2R9V A;  1WP6 A;  3OE7 A;  4TT3 A;  2F43 A;  1UD2 A;  3NE5 B;  2X6W A;  1UD3 A;  4XLF A;  4DNT B;  2ZZG A;  3OAA A;  2V31 A;  4DNR B;  1E79 A;  2JDI A;  1BPL A;  1HZE A;  4XN0 A;  2XZL A;  2HLD A;  2JJ2 A;  4Z1M A;  3GVJ A;  4II2 A;  1E1Q A;  2GJP A;  4XR6 A;  3GVL A;  2GJR A;  1WPC A;  2JJ1 A;  2XOK A;  1E3X A;  2D3L A;  3OFN A;  1T5E A;  4KKU A;  4YEL A;  4YXW A;  3T53 B;  4DK1 A;  2VJJ A;  2W6I A;  1HVX A;  1H8E A;  3BCD A;  3LNN A;  1NRK A;  2F1M A;  4XOP A;  5FL7 A;  2DIE A;  2ZTN A;  4YEJ A;  5HKK A;  5IK2 A;  4AVZ A;  2WPD A;  4HIZ A;  1I8D A;  3JU4 A;  4XLA A;  1V0F A;  3BC9 A;  4XNF A;  3G05 A;  4GQN A;  4XON A;  3VR6 A;  2X6X A;  3A3G A;  3DDY A;  5KNL A;  1WTH D;  1BMF A;  3GQB A;  1FX0 A;  3A35 A;  1W0J A;  3BCF A;  4XOT A;  4XMY A;  4G6I A;  2ZXI A;  2KVO A;  1PKV A;  4XLE A;  4JMQ A;  1NBM A;  1VJS A;  4XN3 A;  4XQF A;  1E43 A;  2ZZE A;  4KKT A;  3GVK A;  4XKV A;  2E1B A;  3KEW A;  2X53 S;  1KZL A;  2XND A;  3CES A;  2M5S A;  1E1R A;  2JIZ A;  1VF7 A;  1I18 A;  3HAG A;  4L8J A;  4ASU A;  3CP8 A;  4XKW A;  3CP2 A;  3OEH A;  4XOR A;  2XGJ A;  3FKS A;  2V7Q A;  1UD5 A;  1W9X A;  3FPP A;  4TKO B;  2GJK A;  4XL9 A;  4E0F A;  1V0E A;  3BH4 A;  4TSF A;  2WZP P;  3OW7 A;  5CDF A;  2X6Y A;  1W0K A;  1OB0 A;  1EFR A;  2ZTG A;  2X8K A;  4G7X A;  1COW A;  2ZZQ A;  3OOC A;  2XZP A;  2D3N A;  2GK6 A;  2QE7 A;  1OHH A;  1UD6 A;  2Z6B D;  3CMM A;  3OPO A;  1UD8 A;  4XD7 A;  2ZXH A;  3A3B A;  3OEE A;  2LZJ A;  3H94 A;  4XLC A;  2XZO A;  4FXU A;  4NNJ A;  4B3G A;  1UD4 A;  4UZU A;  4B3F X;  3ZIA A;  4II3 A;  1MAB A;  4XLH A;  1E3Z A;  3T56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...