3DDYA

Structure of lumazine protein, an optical transponder of luminescent bacteria
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
184
structure length
175
Chain Sequence
b'MFRGIVQGRGVIRSISKSEDSQRHGIAFPEGMFQLVDVDTVMLVNGCSNTVVRILGDMVYFDIDQALGTTTFDGLKEGDQVNLEIHPGLTGNIKGTALVAAIEENDAGFSVLIDIPKGLAENLTVKDDIGIDGISLPITDMSDSIITLNYSRDLLASTNIASLAKDVKVNVEILN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lumazine protein
molecule tags Luminescent protein
source organism Photobacterium leiognathi
publication title Structure of lumazine protein, an optical transponder of luminescent bacteria.
pubmed doi rcsb
total genus 33
structure length 175
sequence length 184
ec nomenclature
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00677 Lum_binding Lumazine binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.20 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ddyA01
2.40.30.20 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ddyA02
3OE7A 2JIZA 2WPDA 3OAAA 3OEHA 5FL7A 1V0EA 5HKKA 3GQBA 5CDFA 1OHHA 1W0JA 3ZIAA 2JDIA 1COWA 1E79A 4FXUA 2F43A 2HLDA 4ASUA 2XOKA 2JJ1A 3JU4A 1FX0A 3VR6A 1I18A 4YXWA 2XNDA 1W0KA 1MABA 4GQNA 2CK3A 1HZEA 4E0FA 1SKYB 3DDYA 1NBMA 1PKVA 1E1QA 4TSFA 2W6IA 1KMHA 3A3BA 3GVLA 2JJ2A 3A3GA 1E1RA 1BMFA 1V0FA 4HIZA 1KZLA 5IK2A 2QE7A 2W6JA 3FKSA 3OFNA 3A35A 1I8DA 3GVJA 3OEEA 1EFRA 4TT3A 2WSSA 2R9VA 2V7QA 3GVKA 1H8HA 4G6IA 4XD7A 5DN6A 4Z1MA 1H8EA
chains in the Genus database with same CATH superfamily
4UZEA 3Q6QA 1V0EA 3WNBA 3G71B 2BM0A 3LVBA 3WBJA 4B47A 2BGJA 1QFJA 1XE1A 2F43A 2GQFA 1BX1A 4ZCLA 1OB0A 2OBTA 5KSWB 2F4NA 3WQZA 3FPPA 1W0KA 2XEXA 1Q82D 2RC5A 1FRNA 1KTVA 2E1RA 3VNUA 1SKYB 1PKVA 3ZZ0A 3GVLA 2OYNA 3OJWA 4XLFA 1YJNB 1K73D 1V5VA 4M2LA 2YWEA 4B43A 3CMAB 3CP8A 3CCEB 3GVJA 1P4MA 3OEEA 1VQMB 4L8JA 4G6IA 4RD3A 2M5SA 1XB2A 4NBSA 3JQPA 3CCVB 4ZGNB 4XN0A 5B6IA 1E79A 1BQEA 2HLDA 4ASUA 3GSIA 2VBVA 3W2GA 3ES9A 2VNHA 1FRQA 3NE5B 4YAWA 5IYNA 4XM3A 4TN1A 1MRZA 4GQNA 1N8RD 2GK6A 3R6JA 1IJFA 2D3LA 4WZKA 3OW2B 4ROXA 3W5UA 1JJ2B 2ZTGA 3PVDA 5FA6A 2HDNB 4FWTA 1W35A 2VBSA 3A35A 4XMYA 3WXMA 4LBZA 2QN6A 5IYPA 2DERA 2PLFA 3A1PA 3CW2A 1G7SA 3ISXA 4HE6A 4YALA 4AC9A 4F7DA 5TV2A 4Q7JB 1KRHA 4DQKA 1QH0A 1VQPB 1QUEA 2WZNA 3CRZA 3I56B 3T51B 1FNDA 3ONUA 2X53S 2WR8A 2ZZQA 3ASRA 3KEWA 3CC7B 1QGAA 3SJZA 1CQXA 3B8HA 1AIPA 1YITB 1E1QA 1VHOA 2W6IA 2Q6KA 1E63A 4KKUA 1M90D 1DARA 3A3GA 4N3GA 4XL9A 4Z4RA 3AVVA 1B23P 3ZPNA 4P25A 4C43A 1E62A 3CB4A 2W6JA 1VLYA 2OBRA 3CPXA 1G7CA 4Z4SA 2E1BA 1TUIA 4QVAA 4XKWA 1S4MA 3OE7A 3FJOA 3VNVA 3OW7A 3G4SB 3CCQB 1OGJA 4ZGQB 2V7XA 4XR6A 1EP3B 4X8IA 4TKOB 3H9NA 1YI2B 2AHOA 3H94A 2C4UA 3CC2B 4E0FA 1QFYA 3P26A 1EP1B 4AF7A 1EWYA 3ASSA 4RDJA 5DS0A 2GK7A 1KMHA 3BY1A 4B3XA 2D74A 1VQ4B 4HIZA 1N06A 3W2FA 2V7VA 3CCSB 4LBYA 4P3YA 4RLZA 1QVFB 1EFTA 5DN6A 2VJIA 3BQJA 3W2EA 1E64A 2WPDA 4DNTB 2XZOA 5CDFA 4NNJA 2GJKA 2ZBUA 2ZL7A 1W9XA 3R6KA 5F4OA 4ZV4A 1SKQA 4UZUA 1CNEA 1GAQA 3WBKA 2JJ1A 2VJJA 2ZL6A 3U6KA 4XORA 5F4MA 4P12A 5A89A 1WSRA 2WJVA 4AF6A 2JN9A 3HAGA 1EFCA 4Z4ZA 2C4TA 3B82A 3CCJB 4EH1A 1ZM4A 1SM4A 4PGOA 3CXCB 1ZM2A 5E6TA 1WU8A 5FL7A 1PJ7A 4DK1A 3CC4B 4FN5A 4DQLA 3V76A 3GQBA 1BJKA 3FPKA 2YWHA 2OK8A 1H85A 4XLHA 2JDIA 4YAOA 4WZTA 1UMKA 2XOKA 4G1BA 3OPOA 4PABA 4C0SA 4II3A 4BPRA 1AMOA 5TRDA 1S72B 4PAAA 2FVGA 1M1KD 3OZWA 3MHPA 3VMFA 1VQ9B 2HMAA 2VNIA 3AVWA 5IYWA 1QFZA 5HZBA 2QEXB 2OBSA 2QGGA 1Q86D 2QE7A 1ZUNB 1VHEA 4B48A 1F60A 1JNYA 2ZXHA 1EFRA 1NJID 4XD7A 3W5HA 3OKXA 2XNCA 1YJ9B 4P1VA 1VQ7B 2CRVA 3E20A 5KW9A 1K8AD 1E3ZA 4X06A 1IHMA 5EMNA 3U6BA 4AVZA 3A8JA 3CP2A 4XOTA 1MABA 4YHBA 2GJPA 3CPWB 3B78A 4JMQA 2XZLA 4XLAA 1T5EA 2GREA 4X05A 2ZZEA 1JA1A 1KK0A 2ZZGA 1T6ZA 1QUFA 4PC2A 3CCRB 1YHQB 3FKSA 3Q3AA 2NV4A 4RD6A 5DSZA 1UD8A 1NDHA 1N0VC 2GJRA 2WSSA 4K1XA 4YELA 4YAUA 2EFGA 2DY1A 2QTZA 1QX4A 2CC2A 1FNCA 2BVNA 2BPOA 3LNNA 3Q39A 1VQ5B 1D1NA 4RJLA 1COWA 3I1FA 4FXUA 4MYUA 3OZVA 4PC6A 5AN9A 4B4DA 1KD1D 5A8AA 2C5HA 2BMWA 1E43A 2C77A 3CMEB 2X8KA 3QFRA 4TSFA 1Y0RA 2Q6IA 2R6HA 3CD6B 3MMPA 2ZL5A 4QHYA 4PC1A 4KKTA 1KZLA 4RDKA 3Q38A 5J35A 3RY8A 1W2BB 2DYIA 4HE5A 3CCUB 3JQQA 4Z1MA 2V7QA 3QFTA 1GR1A 2XNJA 2RC6A 1HA3A 3GIRA 2VNJA 2EIXA 3I55B 3PENA 3J81k 4LBWA 4KKSA 3ZUGA 2BGIA 1FNBA 4X0CA 1WOPA 4CQJA 2CW5A 4YXWA 1WOSA 2XNDA 3E1YE 5FO1A 5IYRA 5H5JA 2DIEA 3OZUA 2VBTA 1NBMA 3Q6RA 4TMTA 1GO2A 4X7DA 1QG0A 2JJ2A 3A8IA 4XONA 2BF4A 1V0FA 2LZJA 2X3UA 3VO1A 1K28D 3OFNA 4Y7CA 4U9UA 3GVKA 3P27A 2FX3A 4B3GA 2DOGA 2WZPP 5KNLA 1VQNB 4XLCA 5HKKA 1T6XA 2X6WA 3MCAA 3ASPA 5BSXA 1VQ6B 4IW3B 1DDGA 1N07A 3ZBUA 1QVGB 2ZITA 4P2NA 2V7TA 2YWFA 4WZEA 4X7CA 4J0QA 4B3FX 5FNZA 2VYQA 1UD2A 2QMUA 2B7BA 1K9MD 4Z4WA 5JBQA 1G7TA 3DDYA 1Q9SA 1W34A 2C2WA 4LC0A 1RQRA 2PIAA 4X7FA 2VNKA 5TR9A 3G6EB 2OK7A 3D26A 2WJYA 3WYAA 4OPSA 1DG1G 4II2A 1VF7A 3BH4A 1H8EA 1BMFA 3LQEA 1I7PA 1RQPA 3SEJA 1IB0A 4WQMA 2OTLB 1DDIA 4XNFA 2ZXIA 4PC3A 4Z4VA 2X85A 1GAWA 3WY9A 1KQSB 4G7WA 4P22A 1R5OA 3QSYA 1N05A 1FNMA 1YJWB 3LQ6A 1TTTA 1GVHA 1VQOB 1NB9A 2C5BA 2CBXA 4WZLA 2F1MA 4NCNA 4M53A 1WORA 3SJPA 5A88A 1F20A 3OEHA 4LBVA 3SKBA 4OPVA 4RDLA 5IYQA 3CMMA 1WPCA 2V4DA 2V7WA 1ELOA 3ZC3A 3AGPA 1A8PA 4RM0A 2BV3A 4XLEA 3QFSA 3W5VA 1R5BA 1YLOA 1TVCA 3QE2A 4M1KA 5J3OA 3CCLB 2B5OA 4P9SA 1HVXA 1N08A 3BNWA 1I8DA 2DEUA 4YEJA 2R9VA 1OB5A 2BM1A 3G05A 4P6YA 2PE3A 5FO0A 5GV7A 3T56B 4R71A 1XFOA 2JIZA 3SLDA 4TMXA 4DK0A 1OB2A 2VZLA 1BX0A 2BSAA 1KC8D 1OGIA 2Z6BD 4TMVA 3JU4A 1KJZA 1I18A 4P6VF 2DCUA 3CTAA 1FDRA 3T53B 1CNFA 1JA0A 1KK1A 3A8KA 2QA4B 4XN3A 2HCJB 3PUNA 1GJRA 3AVXA 1WOOA 2NPFA 5GV8A 4RCZA 2X6YA 1YIJB 3U2QA 1JB9A 1EP2B 3ZBTA 4X07A 1PJ6A 2X6XA 3OP1A 1PJ5A 4P3IA 4TMZA 4YAFA 4UAJA 5HXBA 3WNDA 1UD5A 4M0LA 2BN4A 1OHHA 4RD1A 1W0JA 4Z4UA 1B2RA 1YX2A 2QTLA 4G7XA 3LO8A 2F1LA 3AVYA 3QFCA 3OJXA 4XKVA 1S0UA 1FX0A 1R5NA 1VJSA 2DETA 1QGZA 2CK3A 3PA1A 1HZEA 1BLIA 4X7EA 1ZM9A 4XQFA 2V7UA 1Y0YA 3A3BA 5H59A 5LMZA 1NRKA 1E1RA 3BCFA 2WYRA 4RD2A 4PC7A 2C78A 5IK2A 3AVTA 2CNDA 4MYTA 1N0UA 1ZM3A 1QGYA 5THXA 4B44A 4P26A 3W2IA 4UZFA 3AVUA 4Z4TA 3CESA 4M4SA 1WDTA 1U2RA 4OOSA 2ZZFA 3PA2A 3W2HA 2GPJA 5L46A 3VO2A 4H9GA 2QDXA 4WWVA 1UD4A 4ACAA 4G1VA 1Q81D 2XGJA 4OPOA 2D9RA 1VQKB 3BCDA 1VLOA 3WNCA 2PMDA 4G5GA 2B7CA 4TMWA 3ZZTA 4OP7A 4QVJA 2J7KA 4QV2A 5FIUA 2KVOA 1BPLA 1W87A 4N3NA 3SLNA 1NB0A 1UD3A 4RPDA 3BC9A 5BSYA 3BY2A 4QFMA 1J9ZA 4TT3A 2D3NA 1KK2A 2Q6LA 2ZBVA 3OOCA 2YWGA 4RD4A 2XZPA 3OAAA 3ASTA 4FK8A 4XOPA 1H42A 1VQLB 3ZIAA 1E3XA 1EXMA 3ASQA 4Y9RA 4Z4YA 3JQRA 5TY0A 4DNRB 1WP6A 3VR6A 1WSVA 1Q7YD 1VQ8B 2I1LA 4QUZA 4RD0A 2X0KA 2OTJB 2P3MA 3PUMA 1G7RA 2Q6OA 1IJEA 3AGQA 1TLLA 4ZCMA 3ONYA 3CCMB 4ZCIA 1D8TA 5F4JA 2CF4A 3V7AA 4RPBA 1T6YA 1UD6A 3KL9A 4RCYA 2VBUA 1D2EA 1XQBA 2V31A 2ZTNA 4Y9UA 4OOXA 3ZZUA 5HZAA 1KK3A 1H8HA 1EFUA 4ACBA 1WTHD 4OOVA
chains in the Genus database with same CATH topology
2JIZA 2WPDA 4DNTB 2XZOA 1V0EA 5CDFA 4NNJA 4DK0A 2GJKA 4KKSA 1W9XA 2F43A 4UZUA 2Z6BD 1OB0A 2JJ1A 2VJJA 3JU4A 1I18A 4YXWA 3WQZA 4XORA 2XNDA 1W0KA 3FPPA 3T53B 2DIEA 1SKYB 2WJVA 1NBMA 1PKVA 4XN3A 3GVLA 2JJ2A 3HAGA 4XONA 2X6YA 4XLFA 1V0FA 2LZJA 2X6XA 1K28D 3OFNA 3CP8A 3GVJA 3OEEA 4L8JA 4G6IA 3GVKA 5FL7A 2M5SA 4DK1A 4B3GA 2WZPP 5KNLA 1UD5A 3G05A 3GQBA 4XLCA 1OHHA 2X6WA 1W0JA 5HKKA 4XLHA 4G7XA 2JDIA 4XN0A 1E79A 2HLDA 4ASUA 2XOKA 4XKVA 4B3FX 3OPOA 1FX0A 3NE5B 1VJSA 4II3A 1UD2A 4XM3A 4GQNA 2CK3A 2GK6A 1HZEA 1BLIA 2D3LA 3DDYA 4XQFA 3A3BA 2ZTGA 1NRKA 1E1RA 3BCFA 5IK2A 2QE7A 2WJYA 3A35A 4XMYA 2ZXHA 1EFRA 4XD7A 4II2A 1VF7A 3BH4A 1BMFA 1H8EA 3CESA 2ZZFA 1E3ZA 4XNFA 1UD4A 2ZXIA 3T51B 2XGJA 2X53S 3BCDA 2ZZQA 4AVZA 3KEWA 3CP2A 4XOTA 1MABA 1WTHD 2GJPA 4JMQA 2X85A 1E1QA 2XZLA 2W6IA 2KVOA 4XLAA 1T5EA 1BPLA 4KKUA 4G7WA 3A3GA 4P22A 2ZZEA 4XL9A 2ZZGA 3ZPNA 1UD3A 2W6JA 1VLYA 3BC9A 3FKSA 1UD8A 4TT3A 2F1MA 2D3NA 2E1BA 2WSSA 2GJRA 3OOCA 4YELA 4XKWA 3OE7A 3OEHA 2XZPA 3OAAA 3CMMA 1WPCA 2V4DA 3LNNA 3OW7A 4XOPA 3ZIAA 1E3XA 1COWA 4FXUA 4XR6A 4XLEA 4DNRB 1WP6A 4TKOB 3VR6A 3H94A 4E0FA 1E43A 2X8KA 4TSFA 2GK7A 1KMHA 1HVXA 4HIZA 4KKTA 1KZLA 3T56B 1UD6A 2ZTNA 2V31A 1I8DA 4YEJA 2R9VA 2V7QA 4Z1MA 1H8HA 5DN6A 2VJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OE7 A;  2JIZ A;  2WPD A;  3OAA A;  3OEH A;  5FL7 A;  1V0E A;  5HKK A;  3GQB A;  5CDF A;  1OHH A;  1W0J A;  3ZIA A;  2JDI A;  1COW A;  1E79 A;  4FXU A;  2F43 A;  2HLD A;  4ASU A;  2XOK A;  2JJ1 A;  3JU4 A;  1FX0 A;  3VR6 A;  1I18 A;  4YXW A;  2XND A;  1W0K A;  1MAB A;  4GQN A;  2CK3 A;  1HZE A;  4E0F A;  1SKY B;  3DDY A;  1NBM A;  1PKV A;  1E1Q A;  4TSF A;  2W6I A;  1KMH A;  3A3B A;  3GVL A;  2JJ2 A;  3A3G A;  1E1R A;  1BMF A;  1V0F A;  4HIZ A;  1KZL A;  5IK2 A;  2QE7 A;  2W6J A;  3FKS A;  3OFN A;  3A35 A;  1I8D A;  3GVJ A;  3OEE A;  1EFR A;  4TT3 A;  2WSS A;  2R9V A;  2V7Q A;  3GVK A;  1H8H A;  4G6I A;  4XD7 A;  5DN6 A;  4Z1M A;  1H8E A; 
#chains in the Genus database with same CATH topology
 4UZE A;  3Q6Q A;  1V0E A;  3WNB A;  3G71 B;  2BM0 A;  3LVB A;  3WBJ A;  4B47 A;  2BGJ A;  1QFJ A;  1XE1 A;  2F43 A;  2GQF A;  1BX1 A;  4ZCL A;  1OB0 A;  2OBT A;  5KSW B;  2F4N A;  3WQZ A;  3FPP A;  1W0K A;  2XEX A;  1Q82 D;  2RC5 A;  1FRN A;  1KTV A;  2E1R A;  3VNU A;  1SKY B;  1PKV A;  3ZZ0 A;  3GVL A;  2OYN A;  3OJW A;  4XLF A;  1YJN B;  1K73 D;  1V5V A;  4M2L A;  2YWE A;  4B43 A;  3CMA B;  3CP8 A;  3CCE B;  3GVJ A;  1P4M A;  3OEE A;  1VQM B;  4L8J A;  4G6I A;  4RD3 A;  2M5S A;  1XB2 A;  4NBS A;  3JQP A;  3CCV B;  4ZGN B;  4XN0 A;  5B6I A;  1E79 A;  1BQE A;  2HLD A;  4ASU A;  3GSI A;  2VBV A;  3W2G A;  3ES9 A;  2VNH A;  1FRQ A;  3NE5 B;  4YAW A;  5IYN A;  4XM3 A;  4TN1 A;  1MRZ A;  4GQN A;  1N8R D;  2GK6 A;  3R6J A;  1IJF A;  2D3L A;  4WZK A;  3OW2 B;  4ROX A;  3W5U A;  1JJ2 B;  2ZTG A;  3PVD A;  5FA6 A;  2HDN B;  4FWT A;  1W35 A;  2VBS A;  3A35 A;  4XMY A;  3WXM A;  4LBZ A;  2QN6 A;  5IYP A;  2DER A;  2PLF A;  3A1P A;  3CW2 A;  1G7S A;  3ISX A;  4HE6 A;  4YAL A;  4AC9 A;  4F7D A;  5TV2 A;  4Q7J B;  1KRH A;  4DQK A;  1QH0 A;  1VQP B;  1QUE A;  2WZN A;  3CRZ A;  3I56 B;  3T51 B;  1FND A;  3ONU A;  2X53 S;  2WR8 A;  2ZZQ A;  3ASR A;  3KEW A;  3CC7 B;  1QGA A;  3SJZ A;  1CQX A;  3B8H A;  1AIP A;  1YIT B;  1E1Q A;  1VHO A;  2W6I A;  2Q6K A;  1E63 A;  4KKU A;  1M90 D;  1DAR A;  3A3G A;  4N3G A;  4XL9 A;  4Z4R A;  3AVV A;  1B23 P;  3ZPN A;  4P25 A;  4C43 A;  1E62 A;  3CB4 A;  2W6J A;  1VLY A;  2OBR A;  3CPX A;  1G7C A;  4Z4S A;  2E1B A;  1TUI A;  4QVA A;  4XKW A;  1S4M A;  3OE7 A;  3FJO A;  3VNV A;  3OW7 A;  3G4S B;  3CCQ B;  1OGJ A;  4ZGQ B;  2V7X A;  4XR6 A;  1EP3 B;  4X8I A;  4TKO B;  3H9N A;  1YI2 B;  2AHO A;  3H94 A;  2C4U A;  3CC2 B;  4E0F A;  1QFY A;  3P26 A;  1EP1 B;  4AF7 A;  1EWY A;  3ASS A;  4RDJ A;  5DS0 A;  2GK7 A;  1KMH A;  3BY1 A;  4B3X A;  2D74 A;  1VQ4 B;  4HIZ A;  1N06 A;  3W2F A;  2V7V A;  3CCS B;  4LBY A;  4P3Y A;  4RLZ A;  1QVF B;  1EFT A;  5DN6 A;  2VJI A;  3BQJ A;  3W2E A;  1E64 A;  2WPD A;  4DNT B;  2XZO A;  5CDF A;  4NNJ A;  2GJK A;  2ZBU A;  2ZL7 A;  1W9X A;  3R6K A;  5F4O A;  4ZV4 A;  1SKQ A;  4UZU A;  1CNE A;  1GAQ A;  3WBK A;  2JJ1 A;  2VJJ A;  2ZL6 A;  3U6K A;  4XOR A;  5F4M A;  4P12 A;  5A89 A;  1WSR A;  2WJV A;  4AF6 A;  2JN9 A;  3HAG A;  1EFC A;  4Z4Z A;  2C4T A;  3B82 A;  3CCJ B;  4EH1 A;  1ZM4 A;  1SM4 A;  4PGO A;  3CXC B;  1ZM2 A;  5E6T A;  1WU8 A;  5FL7 A;  1PJ7 A;  4DK1 A;  3CC4 B;  4FN5 A;  4DQL A;  3V76 A;  3GQB A;  1BJK A;  3FPK A;  2YWH A;  2OK8 A;  1H85 A;  4XLH A;  2JDI A;  4YAO A;  4WZT A;  1UMK A;  2XOK A;  4G1B A;  3OPO A;  4PAB A;  4C0S A;  4II3 A;  4BPR A;  1AMO A;  5TRD A;  1S72 B;  4PAA A;  2FVG A;  1M1K D;  3OZW A;  3MHP A;  3VMF A;  1VQ9 B;  2HMA A;  2VNI A;  3AVW A;  5IYW A;  1QFZ A;  5HZB A;  2QEX B;  2OBS A;  2QGG A;  1Q86 D;  2QE7 A;  1ZUN B;  1VHE A;  4B48 A;  1F60 A;  1JNY A;  2ZXH A;  1EFR A;  1NJI D;  4XD7 A;  3W5H A;  3OKX A;  2XNC A;  1YJ9 B;  4P1V A;  1VQ7 B;  2CRV A;  3E20 A;  5KW9 A;  1K8A D;  1E3Z A;  4X06 A;  1IHM A;  5EMN A;  3U6B A;  4AVZ A;  3A8J A;  3CP2 A;  4XOT A;  1MAB A;  4YHB A;  2GJP A;  3CPW B;  3B78 A;  4JMQ A;  2XZL A;  4XLA A;  1T5E A;  2GRE A;  4X05 A;  2ZZE A;  1JA1 A;  1KK0 A;  2ZZG A;  1T6Z A;  1QUF A;  4PC2 A;  3CCR B;  1YHQ B;  3FKS A;  3Q3A A;  2NV4 A;  4RD6 A;  5DSZ A;  1UD8 A;  1NDH A;  1N0V C;  2GJR A;  2WSS A;  4K1X A;  4YEL A;  4YAU A;  2EFG A;  2DY1 A;  2QTZ A;  1QX4 A;  2CC2 A;  1FNC A;  2BVN A;  2BPO A;  3LNN A;  3Q39 A;  1VQ5 B;  1D1N A;  4RJL A;  1COW A;  3I1F A;  4FXU A;  4MYU A;  3OZV A;  4PC6 A;  5AN9 A;  4B4D A;  1KD1 D;  5A8A A;  2C5H A;  2BMW A;  1E43 A;  2C77 A;  3CME B;  2X8K A;  3QFR A;  4TSF A;  1Y0R A;  2Q6I A;  2R6H A;  3CD6 B;  3MMP A;  2ZL5 A;  4QHY A;  4PC1 A;  4KKT A;  1KZL A;  4RDK A;  3Q38 A;  5J35 A;  3RY8 A;  1W2B B;  2DYI A;  4HE5 A;  3CCU B;  3JQQ A;  4Z1M A;  2V7Q A;  3QFT A;  1GR1 A;  2XNJ A;  2RC6 A;  1HA3 A;  3GIR A;  2VNJ A;  2EIX A;  3I55 B;  3PEN A;  3J81 k;  4LBW A;  4KKS A;  3ZUG A;  2BGI A;  1FNB A;  4X0C A;  1WOP A;  4CQJ A;  2CW5 A;  4YXW A;  1WOS A;  2XND A;  3E1Y E;  5FO1 A;  5IYR A;  5H5J A;  2DIE A;  3OZU A;  2VBT A;  1NBM A;  3Q6R A;  4TMT A;  1GO2 A;  4X7D A;  1QG0 A;  2JJ2 A;  3A8I A;  4XON A;  2BF4 A;  1V0F A;  2LZJ A;  2X3U A;  3VO1 A;  1K28 D;  3OFN A;  4Y7C A;  4U9U A;  3GVK A;  3P27 A;  2FX3 A;  4B3G A;  2DOG A;  2WZP P;  5KNL A;  1VQN B;  4XLC A;  5HKK A;  1T6X A;  2X6W A;  3MCA A;  3ASP A;  5BSX A;  1VQ6 B;  4IW3 B;  1DDG A;  1N07 A;  3ZBU A;  1QVG B;  2ZIT A;  4P2N A;  2V7T A;  2YWF A;  4WZE A;  4X7C A;  4J0Q A;  4B3F X;  5FNZ A;  2VYQ A;  1UD2 A;  2QMU A;  2B7B A;  1K9M D;  4Z4W A;  5JBQ A;  1G7T A;  3DDY A;  1Q9S A;  1W34 A;  2C2W A;  4LC0 A;  1RQR A;  2PIA A;  4X7F A;  2VNK A;  5TR9 A;  3G6E B;  2OK7 A;  3D26 A;  2WJY A;  3WYA A;  4OPS A;  1DG1 G;  4II2 A;  1VF7 A;  3BH4 A;  1H8E A;  1BMF A;  3LQE A;  1I7P A;  1RQP A;  3SEJ A;  1IB0 A;  4WQM A;  2OTL B;  1DDI A;  4XNF A;  2ZXI A;  4PC3 A;  4Z4V A;  2X85 A;  1GAW A;  3WY9 A;  1KQS B;  4G7W A;  4P22 A;  1R5O A;  3QSY A;  1N05 A;  1FNM A;  1YJW B;  3LQ6 A;  1TTT A;  1GVH A;  1VQO B;  1NB9 A;  2C5B A;  2CBX A;  4WZL A;  2F1M A;  4NCN A;  4M53 A;  1WOR A;  3SJP A;  5A88 A;  1F20 A;  3OEH A;  4LBV A;  3SKB A;  4OPV A;  4RDL A;  5IYQ A;  3CMM A;  1WPC A;  2V4D A;  2V7W A;  1ELO A;  3ZC3 A;  3AGP A;  1A8P A;  4RM0 A;  2BV3 A;  4XLE A;  3QFS A;  3W5V A;  1R5B A;  1YLO A;  1TVC A;  3QE2 A;  4M1K A;  5J3O A;  3CCL B;  2B5O A;  4P9S A;  1HVX A;  1N08 A;  3BNW A;  1I8D A;  2DEU A;  4YEJ A;  2R9V A;  1OB5 A;  2BM1 A;  3G05 A;  4P6Y A;  2PE3 A;  5FO0 A;  5GV7 A;  3T56 B;  4R71 A;  1XFO A;  2JIZ A;  3SLD A;  4TMX A;  4DK0 A;  1OB2 A;  2VZL A;  1BX0 A;  2BSA A;  1KC8 D;  1OGI A;  2Z6B D;  4TMV A;  3JU4 A;  1KJZ A;  1I18 A;  4P6V F;  2DCU A;  3CTA A;  1FDR A;  3T53 B;  1CNF A;  1JA0 A;  1KK1 A;  3A8K A;  2QA4 B;  4XN3 A;  2HCJ B;  3PUN A;  1GJR A;  3AVX A;  1WOO A;  2NPF A;  5GV8 A;  4RCZ A;  2X6Y A;  1YIJ B;  3U2Q A;  1JB9 A;  1EP2 B;  3ZBT A;  4X07 A;  1PJ6 A;  2X6X A;  3OP1 A;  1PJ5 A;  4P3I A;  4TMZ A;  4YAF A;  4UAJ A;  5HXB A;  3WND A;  1UD5 A;  4M0L A;  2BN4 A;  1OHH A;  4RD1 A;  1W0J A;  4Z4U A;  1B2R A;  1YX2 A;  2QTL A;  4G7X A;  3LO8 A;  2F1L A;  3AVY A;  3QFC A;  3OJX A;  4XKV A;  1S0U A;  1FX0 A;  1R5N A;  1VJS A;  2DET A;  1QGZ A;  2CK3 A;  3PA1 A;  1HZE A;  1BLI A;  4X7E A;  1ZM9 A;  4XQF A;  2V7U A;  1Y0Y A;  3A3B A;  5H59 A;  5LMZ A;  1NRK A;  1E1R A;  3BCF A;  2WYR A;  4RD2 A;  4PC7 A;  2C78 A;  5IK2 A;  3AVT A;  2CND A;  4MYT A;  1N0U A;  1ZM3 A;  1QGY A;  5THX A;  4B44 A;  4P26 A;  3W2I A;  4UZF A;  3AVU A;  4Z4T A;  3CES A;  4M4S A;  1WDT A;  1U2R A;  4OOS A;  2ZZF A;  3PA2 A;  3W2H A;  2GPJ A;  5L46 A;  3VO2 A;  4H9G A;  2QDX A;  4WWV A;  1UD4 A;  4ACA A;  4G1V A;  1Q81 D;  2XGJ A;  4OPO A;  2D9R A;  1VQK B;  3BCD A;  1VLO A;  3WNC A;  2PMD A;  4G5G A;  2B7C A;  4TMW A;  3ZZT A;  4OP7 A;  4QVJ A;  2J7K A;  4QV2 A;  5FIU A;  2KVO A;  1BPL A;  1W87 A;  4N3N A;  3SLN A;  1NB0 A;  1UD3 A;  4RPD A;  3BC9 A;  5BSY A;  3BY2 A;  4QFM A;  1J9Z A;  4TT3 A;  2D3N A;  1KK2 A;  2Q6L A;  2ZBV A;  3OOC A;  2YWG A;  4RD4 A;  2XZP A;  3OAA A;  3AST A;  4FK8 A;  4XOP A;  1H42 A;  1VQL B;  3ZIA A;  1E3X A;  1EXM A;  3ASQ A;  4Y9R A;  4Z4Y A;  3JQR A;  5TY0 A;  4DNR B;  1WP6 A;  3VR6 A;  1WSV A;  1Q7Y D;  1VQ8 B;  2I1L A;  4QUZ A;  4RD0 A;  2X0K A;  2OTJ B;  2P3M A;  3PUM A;  1G7R A;  2Q6O A;  1IJE A;  3AGQ A;  1TLL A;  4ZCM A;  3ONY A;  3CCM B;  4ZCI A;  1D8T A;  5F4J A;  2CF4 A;  3V7A A;  4RPB A;  1T6Y A;  1UD6 A;  3KL9 A;  4RCY A;  2VBU A;  1D2E A;  1XQB A;  2V31 A;  2ZTN A;  4Y9U A;  4OOX A;  3ZZU A;  5HZA A;  1KK3 A;  1H8H A;  1EFU A;  4ACB A;  1WTH D;  4OOV A; 
#chains in the Genus database with same CATH homology
 2JIZ A;  2WPD A;  4DNT B;  2XZO A;  1V0E A;  5CDF A;  4NNJ A;  4DK0 A;  2GJK A;  4KKS A;  1W9X A;  2F43 A;  4UZU A;  2Z6B D;  1OB0 A;  2JJ1 A;  2VJJ A;  3JU4 A;  1I18 A;  4YXW A;  3WQZ A;  4XOR A;  2XND A;  1W0K A;  3FPP A;  3T53 B;  2DIE A;  1SKY B;  2WJV A;  1NBM A;  1PKV A;  4XN3 A;  3GVL A;  2JJ2 A;  3HAG A;  4XON A;  2X6Y A;  4XLF A;  1V0F A;  2LZJ A;  2X6X A;  1K28 D;  3OFN A;  3CP8 A;  3GVJ A;  3OEE A;  4L8J A;  4G6I A;  3GVK A;  5FL7 A;  2M5S A;  4DK1 A;  4B3G A;  2WZP P;  5KNL A;  1UD5 A;  3G05 A;  3GQB A;  4XLC A;  1OHH A;  2X6W A;  1W0J A;  5HKK A;  4XLH A;  4G7X A;  2JDI A;  4XN0 A;  1E79 A;  2HLD A;  4ASU A;  2XOK A;  4XKV A;  4B3F X;  3OPO A;  1FX0 A;  3NE5 B;  1VJS A;  4II3 A;  1UD2 A;  4XM3 A;  4GQN A;  2CK3 A;  2GK6 A;  1HZE A;  1BLI A;  2D3L A;  3DDY A;  4XQF A;  3A3B A;  2ZTG A;  1NRK A;  1E1R A;  3BCF A;  5IK2 A;  2QE7 A;  2WJY A;  3A35 A;  4XMY A;  2ZXH A;  1EFR A;  4XD7 A;  4II2 A;  1VF7 A;  3BH4 A;  1BMF A;  1H8E A;  3CES A;  2ZZF A;  1E3Z A;  4XNF A;  1UD4 A;  2ZXI A;  3T51 B;  2XGJ A;  2X53 S;  3BCD A;  2ZZQ A;  4AVZ A;  3KEW A;  3CP2 A;  4XOT A;  1MAB A;  1WTH D;  2GJP A;  4JMQ A;  2X85 A;  1E1Q A;  2XZL A;  2W6I A;  2KVO A;  4XLA A;  1T5E A;  1BPL A;  4KKU A;  4G7W A;  3A3G A;  4P22 A;  2ZZE A;  4XL9 A;  2ZZG A;  3ZPN A;  1UD3 A;  2W6J A;  1VLY A;  3BC9 A;  3FKS A;  1UD8 A;  4TT3 A;  2F1M A;  2D3N A;  2E1B A;  2WSS A;  2GJR A;  3OOC A;  4YEL A;  4XKW A;  3OE7 A;  3OEH A;  2XZP A;  3OAA A;  3CMM A;  1WPC A;  2V4D A;  3LNN A;  3OW7 A;  4XOP A;  3ZIA A;  1E3X A;  1COW A;  4FXU A;  4XR6 A;  4XLE A;  4DNR B;  1WP6 A;  4TKO B;  3VR6 A;  3H94 A;  4E0F A;  1E43 A;  2X8K A;  4TSF A;  2GK7 A;  1KMH A;  1HVX A;  4HIZ A;  4KKT A;  1KZL A;  3T56 B;  1UD6 A;  2ZTN A;  2V31 A;  1I8D A;  4YEJ A;  2R9V A;  2V7Q A;  4Z1M A;  1H8H A;  5DN6 A;  2VJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...