1VLYA

Crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
323
structure length
323
Chain Sequence
FTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLHIEPLPYSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Unknown protein from 2D-page (Spot PR51) (b2898) from Escherichia coli k12 at 1.30 A resolution
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Unknown protein from 2D-page
total genus 84
structure length 323
sequence length 323
ec nomenclature
pdb deposition date 2004-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.160 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1vlyA03
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1vlyA02
3.30.70.1630 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vlyA01
3GIRA 1WOSA 4P9SA 3GSIA 3A8JA 1PJ6A 1WSRA 1YX2A 3A8KA 4PABA 1WORA 5L46A 1WOOA 1WOPA 1PJ5A 1WSVA 1NRKA 1V5VA 1VLYA 1PJ7A 3A8IA 4PAAA 1VLOA
chains in the Genus database with same CATH superfamily
5D4NA 1ZZNA 2XCAA 4O3NA 2E1MC 3CMMA 3EGVA 5IT0A 4P75A 1KRPA 3K57A 2IBKA 4NEYA 2FTRA 2OYNA 4X7CA 4RW7A 1K1SA 2HHXA 2GS8A 4QR2A 1TELA 3E1YE 2AJ2A 1PG5B 3QAUA 3MMBA 4Y0FA 3T19A 1XR6A 4MK9A 1C1BB 2JEFA 2Y9HA 1U47A 1R0BG 3DLKB 4WP8A 3KJVB 2GHVC 4NYZA 3CF5Q 3TA0A 1EQMA 5L8RC 3G87A 2N4DA 4RPDA 1SKSA 2HRTA 4QYRA 2CRLA 2W2MP 4ICLB 1K0TA 4YFUA 4XOTA 2MTLA 4ILRA 3SCIE 2NLWA 2VNJA 1NJXA 2CQ1A 2K7JA 2ZL5A 1SJ3P 2B7BB 2YKNB 2MQLA 1GMUA 2HNZB 2C5BA 4Q0BB 3NGDA 2NYHA 2KL8A 1HNXJ 2HIYA 2MJUA 1PJ5A 4L74A 1Z1ZA 2DNOA 3T1HF 1QGYA 2GQQA 1HIYA 4JI3F 1J9ZA 3NAHA 1RAGB 4HHUA 4OI0A 1W25A 4Z4YA 4DQLA 5HJYA 1HNZJ 2NXUA 3IS9A 5AT1B 4Y65A 2JWNA 1X4AA 3SMZA 2B7CA 4M2LA 3O2IA 1OHHA 3A13A 1B0TA 2GQ2A 3HVAA 2FUG9 3NEKA 1DFDA 4CLLA 1VCTA 1FJ7A 2BGJA 3FZ2A 3GYNA 4PKDB 1ZBTA 4YAOA 2DTJA 1XNQF 2XM3A 3BR9A 4DUYF 3R8YA 1DTQA 2NPIA 3U02A 2LEPA 5KT4A 1XK8A 2RC6A 3CWJA 3MZIA 1T9UA 4NA3A 1JKHB 1PYOB 2G2OA 4UZCA 2BABA 1FXRA 4F4WA 4OV6A 1VIXA 3C6UA 5F8GA 1N54B 4TKTA 4IRDA 3OBIA 4OL8A 4OX6A 2F5GA 4C11B 3LOUA 3SJPA 3IXQA 4P72A 2CW5A 4ZDNA 4C2MA 1KC8T 1F3VA 4ECXA 1S48A 3PRBA 1TKDA 2WTFA 2X3UA 3BDEA 3CJ4A 1VJSA 3BN7A 1X9MA 3ONQA 1OMSA 3QGGA 4PR6A 2QA4B 5IXUA 1XQIA 1ZPVA 5IQQA 1FTCA 2Y1LB 3CE8A 5EUHA 1GQEA 3HPOA 4J9QA 2ZH7A 2VPWB 2OI2A 2Q79A 3FPPA 1S0VA 3EMTA 3DLLQ 1HARA 4JUZA 2YNFA 2C2EA 1NKEA 4WXOA 2ZL6A 3BY2A 3FK4A 4TKOB 5JXSA 2DYIA 2BX6A 3QZ8A 3DXBA 2H4WB 1JLQA 2GJ2A 4JV1A 4ZIVA 3MM8B 1VDHA 2GZOA 1WWHA 3DI6A 1SV5A 1LW2A 1UFKA 4FNHA 4X4NA 3WX8A 1G7CB 2EWHA 2W2NP 1LWXA 3OUYA 3KLVA 2D9RA 2KDOA 4PXEA 3MUVP 2ZH2A 1BQXA 3QFWA 1H2TZ 3M7VA 3M6WA 4CLUA 5GMDA 3EWGA 2MZSA 1VS3A 5J2MB 1VC0A 2VICA 3DLJA 2VBUA 4CLSA 3PR5B 1RT4A 3EPIA 2F4VF 1QVFB 3N6LA 2FX3A 1NBMA 4OYBA 4ZKAA 4Q45A 2N82B 3H5UA 3N0VA 3HFVA 1WKLA 3BO2A 3E01B 3OD2A 4OYAA 3TJ9A 1FE0A 2KT3A 3GILA 3LUYA 4LQ3A 3E01A 3AD9C 2IY5B 2NYIA 1U8WA 1V6HA 2M3DA 4EFAC 3PY8A 4CNZA 3GFXA 5KT6A 1S9EB 2DNLA 4WWSA 2R7RA 1X5OA 4DR4J 2DGWA 4CO2A 5BYSA 4RL1A 4IFVA 2ZH6A 1GAOA 1YI2S 3PW2A 4CYUA 4XAKA 5F8MA 2YQ0A 3R1HA 4B47A 4V1Ak 1ZH5A 1FNXH 3CCMS 4WFBQ 2K8GA 1Q53A 3CVKA 3MM7A 5B09A 4RU9A 1Y5LB 2OP5A 1Q79A 1RP5A 3T56B 4F50A 2XNRA 1T9TA 1CG2A 1BY9A 2JDJA 1U26A 4YR0A 1LXJA 2HDNB 4KTQA 1YI2B 3TX8A 3CJTA 1T0TV 1DQ9A 1S0MA 4J0QA 3D6HB 2QC3A 3MM8A 5DDQC 4KHPJ 5GAHI 1S4FA 2WB4A 2AZ1A 3HKZD 1T5EA 3QPIA 2RB7A 4ED5A 4F0HA 3L95X 4YELA 8RUCA 4ETXA 5HZBA 4QIVA 3HKWA 1KEKA 3JTNA 1NPKA 2HQGA 2ROPA 2MZ1A 2QN6B 1YJTA 2J7UA 4RO0A 2VNIA 3FZBA 3CCJB 2MHNA 2YBVA 4N5SA 1RTHA 3AVVA 4ZMMA 3RBXA 2XMWA 4B48A 3HDSA 1VQPS 4ED6A 2DD8S 2NSCA 4A8OA 4Y9UA 1WC1A 2XMTA 5C42B 1XB2A 4DQSA 3OT9A 1MU2A 1KS2A 3FUYA 4Y34A 2N7YA 4YR3A 4USJC 3E20A 1BWEA 2F65A 1S7IA 2O3DA 4F67A 4O3PA 1V5VA 4KSEB 2XLJA 2XY6A 3I32A 4A47A 2D74A 3N5BA 2VZ9A 1XBWA 2V7QA 2IRXA 2YNHB 1FX2A 4YHHJ 3I56S 5HMYA 4DUTA 2DCLA 1QUFA 4HE5A 1B0PA 4DQIA 2IJNA 4NOHA 2R2TA 4RDKA 4WBFA 2MQOA 4HH0A 2ZITA 4NNJA 1IKYA 2GIFA 1NB0A 4DQKA 2QIFA 4DSFA 4N41A 1PC4A 1BWVA 1CQMA 2BJ9A 3O8WA 4URQU 1AYEA 3FEZA 3BH6B 3M9NB 4GKKF 1IBLF 3V76A 2IYIA 2MZTA 4P73A 4QR0A 2HIQA 2V8HA 2F8MA 4PXBA 1XR7A 2RUSA 5M2RA 3OSNA 1KDNA 3EJMA 2HVHA 2FC9A 1M5PC 5KT3A 4YAFA 4ELVA 3UN5A 3HZGA 2RSQA 4RUAA 4DK0A 5CCMA 1GTHA 1VQNS 3PX0A 3J81Y 1I94F 2KU7A 2EC0A 3ZTSA 4F3OA 2HHTA 4I7FA 3M05A 4DG1A 2PGCA 1YJWS 4RWXA 2PA8D 2IBOA 4QWAA 2HCJB 3W2VA 4Q0BA 1YJVA 3DKDA 2FDNA 4MMOA 2G0JA 4O44B 1MMNA 1VQ4S 3LGNA 2DCUB 1RT6A 4QFMA 4MYUA 4I64A 1SKYB 4RPFA 1HZEA 2WOMA 3AAWB 3UFCX 2CFXA 4KIAA 2E1RA 1NH7A 3EDQB 2CQDA 4FYDA 2ILZA 3NRBA 2DPJA 3TARA 3G86A 3PFOA 1DRZA 3OJUA 1DDGA 3QJLA 4PABA 1RT2B 2EFPA 4RW7B 3H59A 4NLYA 4A8WA 3G4SS 3DLBA 5GAGI 3MD3A 3P4UB 2B5JA 2GCFA 3W2WA 1XR5A 2L48A 4ZGNB 1YRXA 3MFIA 2BJDA 2RHSB 5KFOA 3ZZOA 1TUGB 1M5KC 4LSNB 3QAEA 4WZKA 4PWDA 3PUNA 3VNUA 4DS4A 1VBZA 4GVLA 5CCLA 1T03B 4OYMA 2N3LA 5DG7A 3AJ1A 2XCPA 1RUSA 5I3UA 1RLDA 2XSJB 3VCDA 2HPUA 1LFWA 3ZTRA 4B3SF 2F9JA 5A8KB 4IRCA 1XERA 4LJMA 3G82B 1OB2A 2AGPA 3CDWA 3J7YI 1S1UA 1ZTTA 3I82A 3JQMA 4TY8B 4OZ3A 1VOMA 1UVMA 2I1RA 4M5DB 3SFGA 4F0KA 2R8IA 1NK4A 3TYTA 2RS2A 1X9WA 3GIJA 2GREA 4ZV4A 2EEYA 4PC6A 4RW6A 4ZVTB 2ZUAA 3IR6B 2AYBA 2D41A 2Z2LA 3HVRA 1DARA 2OTJS 1T6XA 2PEHA 2M2BA 2ZOFA 5DG9A 2C1EB 1MMDA 4RUCA 1B99A 1M1GA 1GXLA 3FEYB 3LP2B 2CNDA 4WE1A 3E8OA 2BBEA 2H65B 1G7RA 3MM6A 1C4CA 1JMTA 1S79A 2ILYA 3DRSA 1QFYA 2W2QP 1RWOB 4AD6A 1R8BA 1NM2A 5BR8J 4PC7A 4Q7JB 4N3GA 1X4FA 4UUXA 4NLQA 2AEFA 1UEUA 1ZOTA 1HNVB 2GK6A 3FPKA 5FLXY 4CH1A 1Z4UA 3MECB 4QR1A 2RE1A 2Z56B 2UZAA 3N6NA 4C9DA 1S0OA 1QSSA 4UY8T 4DV6F 4OI1A 1U6FA 4ANCA 1JXLA 5KFMA 2RU9A 2G1DA 4ECRA 3MEEB 3ZC4A 4KGVB 3AB4B 1RCXB 1H0HB 2RRBA 3NWRA 3RRHA 3RAMA 4OJ1A 2MSSA 2ZZGA 2MXYA 2HVEA 3VAHA 1N33J 1SKRA 4R5PA 5CYMB 2QL9B 2E9TA 3V4MA 4F2SA 1IKWA 5KG7A 5H9EJ 4EYIB 1CS4B 2CQBA 1Q86D 3I0RA 3PM9A 2KVOA 1ZAVA 3MEGB 3LP1A 4WU3A 4B17A 5SZTA 5K5MA 3D1QA 1TL3A 1X5PA 2RT3A 1R5OA 3FDSA 1FRHA 1R31A 3T41A 2V7VA 5HAOA 4K50A 1Q9SA 3SSRA 5M2UA 1VQKS 1VJQA 2V9WA 4HACA 4OOSA 4B08A 1UFWA 2LMIA 4DXLA 4NCGA 3IM8A 1PC5A 4KJIA 2VPZB 4CLTA 3H2VE 3HHEA 2AJ0A 3HT0A 4U96A 1BD6A 1FT8A 1SVDA 5IQ6A 1Q5VA 2LQ9A 3THTA 4ED7A 1W2IA 3CESA 1FDAA 2UXBF 4RM0A 2ZJQQ 3GCWP 2ZDOA 3QGPA 2UUAF 2CJ9A 2DXFA 3P26A 1GX6A 2VDIA 3QGIA 2MKYA 3ES9A 3CJ5A 3WIUA 1SKQA 4P3YA 3CCQB 2CPZA 1NMEB 1AFJA 3KHLA 3Q6RA 2W1BA 5AXLA 2FVRA 3HHKA 1QY7A 1FEEA 2EG1A 3GJRB 5J2NA 2HQCA 3K59A 3CCSS 4X62F 2NS1B 2E7WA 3CPWR 4RBTA 2FHKA 4TU9A 1NDLA 4NYPA 3PCOB 3PX6A 3MPVA 5ETPA 1YJ9B 4NXMJ 4PC3A 4DCOB 2JSXA 3CPWB 4ZVFA 4AVZA 3MAAA 4OYZA 2A10A 2YH0A 4ILLA 4FS1A 1IWGA 4X65J 1DLOA 4NLPA 3A8JA 3UCZP 4I67A 1V3ZA 1TK8A 4HHJA 7FD1A 2BANA 2HNDA 1NHVA 3GVLA 4KQZA 1E6YB 2O66A 1YK9A 4LF6J 5IT9U 4AC9A 1BMFA 3AVWA 2M8HA 1QFZA 3BNWA 2GHWA 3PKMA 3ZTPA 1Y7PA 5J2PB 2RJZA 1Y10A 1FA0A 2UUAJ 4DLEA 3MPUB 3X1LB 2R2SA 3ET6B 3HJFA 5EX0A 1HPZB 4P3IA 2B6AB 4YMEA 1YKWA 2LVWA 3DMJA 1D0EA 4CTAB 5GAEU 1H2UX 3BH4A 1IBMF 1R8CA 1GAQA 5GV8A 1KK1A 1X4BA 4I68A 1RTZA 1E62A 4J9UE 4TQRA 1C1CA 2CYYA 2GAHC 1RT7A 1CQNA 3MMCB 2IVFB 3A1PA 1SUQB 4L6V3 3H25A 4JI1J 1BQMA 2PSZA 2R4FA 2JFKA 1RTIA 4P74A 4X64J 1KC8D 2BRKA 5CA5A 4LF5J 3R6JA 5DO2A 3UCGA 2DRBA 2HS4A 4E8UA 4JI4F 4RW4A 2UVUA 1IXKA 5KG4A 1TFYA 4QPTA 4ECSA 2PN6A 1FJEB 2MKIA 2ZBPA 2YWGA 5FLXU 3DDIA 1BC6A 1JA0A 3BGRB 2OPRB 5HO4A 1OYDA 4AYBD 1N8RT 1RT3A 3KJFB 2UU9J 4HR2A 4O3QA 4KV8A 4X4SA 1Q16B 2GK7A 5DZ7A 4QU7A 4HI2A 3TANA 4X66F 1FFWB 2OD4A 2LCWA 1H98A 1VC5A 3QRPA 5HZAA 3DYAA 4X7EA 1XMBA 5E3AA 4ED2A 3GFZA 3PJ9A 1R43A 4DZ6A 1GH8A 5C24B 4ACBA 2OIHA 5T7LA 4YR2A 2GV1A 4RWWA 4KFBB 2G9OA 3RB0A 4PC2A 5GAHU 2AEMA 5L46A 1XMQF 1FRJA 3M2UB 3TZYA 4AE5A 1AROP 4KH1B 2ZBRA 1N32J 2LDYA 1SC6A 2WVDA 4X2BA 4CO3A 4ECTA 2G2ZA 4B3TJ 3GQBA 2FGOA 3DLGB 3U6KA 2PD1A 1SKUB 1TKTB 2U2FA 1RHKB 2HQFA 3P5BP 2H3EB 1G7SA 2XG8A 2N7CA 3DGPB 1PO6A 2ZD1B 1FEHA 1VIOA 3VAIA 1RWVB 3VWSA 2GAGC 2W4CA 1RAHB 1U1OA 1WI6A 2BQUA 4OV1A 2DOGA 2IAJA 2DXEA 5B6IA 4Q7AA 5LM7E 3RU0A 4DN9A 4A8XA 3ZTQA 2MKHA 3CO9A 3DCAA 3IRXA 2E1BA 2XO6A 5AE1A 3KJQB 1EAYC 3LO8A 1HQUB 4YXWA 1N5QA 2QEXS 4GRSA 1KQGB 3RAXA 2VJUA 3SYZA 5H1SV 4A8FA 5F8IA 4FF2A 3QQCD 4JI0J 3OZUA 1UVNA 3OFGA 1W2BB 2QLXA 1XEZA 3Q6QA 4DK1A 1VBKA 4DFJA 3RR7A 5RUBA 3MHYA 2HQ3A 2DPIA 4ACAA 1Y4ZB 2P9CA 2KO1A 1I51B 3DDYA 3DU6A 4LIWA 1K8AT 2VUGA 2E1PA 1LNQA 1I6JA 2IJFA 1E79A 4DUYJ 2EC2A 4P2SA 4UZBA 2H5EA 2Z4PA 5LMNJ 2DHSA 4NZ6A 3A4TA 3CIZA 5KFDA 3OHAA 5EDWA 5DM7Q 3RBZA 1KONA 1OGJA 4NLOA 4UOGA 2BVNA 2DGTA 3AD7C 1I1GA 2VG7B 4LF4J 4QIGA 5B0AA 2LQJA 1RCOB 4ZN1A 2BRLA 3DOMA 4F4ZA 1HNIA 1QVGB 2OHDA 3JYTA 1KK2A 2UXDJ 2V8PA 3OTDA 1C0TB 1P6TA 1TMMA 3OZWA 3BGOP 3CT9A 4GKJJ 1TL1B 3HSDA 3IWXA 4DR6J 5EX3A 3FFIB 4ZHRA 3MF5A 1TK0A 2CADA 5EHHA 4J9RA 3KLFB 3QRRA 2GW8A 3TVKA 1T94A 3NCQA 3H42A 4OYWA 2P9GA 3UPFA 2VD3A 3FVYA 4XO0A 2RS8A 4G1VA 4CT9A 1EARA 5HVGA 3M2RB 1PYTA 1RTJA 2HGMA 3IN5A 5DG8A 3IGNA 3H94A 4CT8A 1D9DA 3R1LA 1YDLA 4LSLA 3KLIA 2W7OA 3HI9A 3RBEA 3JQPA 5IV3A 5IYNA 2HZAA 1DTTB 4MFBB 3CC7B 2AJFE 4HI1A 1U1MA 3NS5A 3GIIA 5AXNA 1RB0A 1O6XA 4K59A 3BCFA 1WUUA 5DQGA 4DR1F 3CUNA 2MYFA 4FS2A 3FC9A 4F25A 2KVQE 1WPCA 2VBYA 3VV2B 3SKBA 1VRTA 3B6BA 4LF4F 2ATLA 2OPSA 3PZPA 2Y8WA 2BE2A 4V19X 2EFGA 2BMBA 1DBDA 4NI2B 4ZCLA 1EXMA 2IMWP 3C14B 1YSJA 2BR0A 2LU1A 2W4PA 4JI3J 1UETA 3Q89A 2XHCA 3KHHA 4X84A 2R7OA 1KD1T 3MOZA 3TEHB 1ROFA 3DXSX 5HJXA 5A89A 4O3OA 4ATNA 2GJPA 2QMWA 1HNWF 1VHIA 2WCXA 2FLNA 3EGNA 1F3FA 4B3MF 2CPXA 1S1WA 1N5TA 3JS9A 1VF7A 2E5LJ 1TKZA 3MMJA 1H6KX 4IR9A 4DV7F 4N56A 2YVSA 3EXYA 4P71A 1HQEA 1KNZA 4DR4F 4Z2XA 4U9RA 4DZDA 1B3TA 3GU0A 3TZWA 2HS3A 3CCJS 1JLGB 4U8YA 2LEBA 4I2PA 3IR7B 4EWTA 2V4JB 2Y1JA 1GAWA 3VAKA 1OWXA 3D54A 3D9BA 3GYGA 3RAQA 1FE4A 4K4WA 1MG7A 2B8QA 2GC8A 4UQTA 3ULHA 4X4UA 1LW0B 3G96A 2JC0A 3P8BB 3ZTOA 1VHFA 2C2ZB 3CCMB 2J0WA 3C16B 2YWHA 2E9ZA 4HIZA 1NDKA 5HP1B 1RXOB 2EPIA 1QX4A 3CJKA 3MM9A 2JLFA 1VLOA 4M0LA 1OJ4A 4JI0F 2ZTGA 4J9PA 4GC6A 3D26A 1NRKA 2MY7A 1EKRA 5K9FA 4F4KA 4FBUA 2APOA 2VBWA 5F8NA 4KKUA 5IOLA 3HHDA 1HNWJ 3MMAA 2XYGB 3HSGA 4LF6F 3G9CA 2B9WA 2QX0A 1U25A 4LREA 3D3CJ 1W2BR 2DO0A 3G6YA 3UD4P 1FKOA 3DRPA 2E5LF 2I1LA 1RK8A 1U6ZA 3T9ZA 5HLFA 3CD6B 3R5DA 4XL9A 4J37A 2R7QA 1UZHA 4MK7A 4PRFA 2ZNZA 3SFUA 1YIJS 2KT5A 1BX1A 1HWLA 4NCNA 3I0SB 3IC1A 3VGTA 2QMUA 3UD5A 1Q0NA 3ITHA 5A2QY 2EKYA 4ZVHA 1QE1B 1YBAA 4ZPBA 3A3NB 2L9DA 5E3QA 2ZC3A 1QH0A 4ED8A 5HQ8A 2CZVC 1VQ7B 2X51A 1VLYA 1YJNB 4K0KF 3R5AA 4ZPDA 4RNMA 2VOOA 2V8DA 3D2WA 2HRYA 4Y6IA 1H72C 3OL7A 4TT3A 5H9FJ 3GR1A 1N0VC 1CJUB 1XJWB 4BWMA 3UCUP 2FYXA 5CZVA 2KG1A 3I4HX 1F6TA 1NJWA 1JLFA 2ZXHA 5F4OA 1WG5A 2OKQA 3R6LB 3LAMA 2V2KA 2CZ9A 5B0EA 4ZLLA 1NK7A 3NCRA 3VAJA 4USTA 2C42A 3C66A 3PW7A 4E0DA 3FBCA 4H4MB 3QLHA 3UDEA 3R27A 5KT5A 5CH7B 1AXQA 2F4NA 3OP1A 4USUA 1TVRB 3I4PA 4YB1P 1JLAA 2Q6LA 4AF6A 1X60A 4ECZA 1CEZA 5C25B 3P49B 4XNFA 4EBCA 2WZ1A 2VHGA 3ILLA 3ICLA 5IM0A 4NLUA 2OK7A 4PG8A 2ASYA 3CGIA 3CCUB 1KFSA 4X4OA 1TVCA 1E3ZA 3N28A 3QWUA 4ZP9A 4URGA 2FZGB 5KG3A 3K7RA 2X1AA 1NJID 4OOVA 4O23A 1RKIA 2C4TA 2FLOA 1VQ9S 2RD5C 3D7SB 3IBWA 4O4GB 1S1VB 1DY3A 5E41A 3ISXA 2F8EX 1RACB 3ZZZA 3KMQA 4R8UB 4NLSA 4F7DA 2LEAA 2GPJA 3UW1A 4XDCA 3HLUA 2YXLA 1MROB 3R7NB 4XOPA 1RTDA 3UN2A 2X8KA 1EB0A 5I42A 3BSNA 1WTFA 4GC7A 1R6YA 3ELHA 2MZQA 1WACA 4DSEA 4WF9Q 4J9OA 1FVSA 2IC3B 3W2FA 1K9MT 1YRUA 5F3ZA 3NGSA 2DIEA 1RISA 3VGSA 2OTJB 5ETLA 2WJVA 4LFCF 1MN7A 3LWMA 4CM0A 1M90T 4IH7A 4OPSA 3J80U 2VF3A 4YS2A 2WB1D 5G0RA 3FMBA 2FC8A 2PT0A 3Q8RB 2OBRA 3T1YF 2C3YA 3ZBTA 2GHPA 4NEZA 1YJ7A 2BKPA 2DERA 4OP7A 3Q8YA 3ISZA 2J6UA 2I0XA 2ACMA 5LMNF 4PXDA 2CPFA 1GTEA 3GR0A 3GP9A 1WG4A 5F4JA 1VISA 3KLEA 2J8AA 3G71S 5E3CA 3OFNA 2HKEA 3K5OA 1NB7A 1N0UA 1Y9OA 2J8SA 5K8PA 5D0EA 4G1BA 3ILJA 4XLFA 1S10A 1WF2A 1LKZA 1HBNB 1M1KD 3G6EB 1AZSB 3OE7A 3DM2A 4LUBA 4L3KA 1UPMB 3A1YG 4PYDA 4RCYA 1RAAB 4I6WA 5KFRA 2HNYB 2DIVA 1PIEA 2OPPB 2VG5B 1C4AA 2VPXB 3MAQA 4U7UD 3BO3A 3CCWA 3KLGB 1T02A 3ENWA 2YPZA 1G1XA 2QO3A 2R2UA 3AT1B 4DL3A 3A3PB 1CJKB 4XK8C 4LFAF 1YQHA 3KXDA 3FCHA 4BLGA 1UMKA 2JJ2A 1GMVA 1Z2ZA 2W9CA 2HK3A 3KDOA 2YWFA 1UEKA 3CMEB 3C8YA 2Y1RI 2C3OA 2K3IA 3FGVA 4DR2J 3HULA 3W9HA 2CVIA 3HHLA 1WC6A 1N5YB 3OJSA 1CJVA 1JNRB 4KT0C 4DR1J 1NXIA 4USKA 3C6TA 2JX2A 2HVZA 4HYKA 4FXDA 3ZFVA 3NWGA 3QWPA 5HMZA 3TWZA 2RNEA 4W92B 3W63A 3J7AN 5ETSA 1EP1B 2QTLA 1RWNB 4EO6A 5A6WA 4MKBA 2GVZA 2BJ7A 3PENA 4CWBA 2BEFA 1SCJB 4ZK7M 2V69A 3CCQS 3THPA 1UKUA 1U6BA 3DOKB 4ZP8A 3BREA 2I8EA 1DQAA 1V9OA 3POTB 1SM4A 3AA9A 3DRXA 2PDAA 4X06A 2HMIB 3G8SA 1NCLA 3IR5B 2FHOB 1YJ9S 5FO1A 3LP0B 1IJFB 1L3UA 2WAQD 3KEWA 3TEGA 4OZ2A 3SV4A 1SL0A 3AVUA 2H5JB 1GX5A 4YDDB 2OAUA 2RIJA 1DURA 3H20A 1ZZFA 2V6AA 3PO4A 3RBDA 4DS5A 3GE9A 3I9V9 5ETNA 1JWWA 4YB7A 1ZAWA 4JI8J 3E3XA 1SH3A 5HSPA 4DR2F 4OI3A 3PYEA 2A1BA 3C19A 1WEYA 1JJCB 3V4IA 5A8AA 4B3RJ 4P7TA 2KT2A 4X62J 4A8YA 3I6PA 3GWCA 4YP3A 3DLEA 1GFWB 1V5IB 1PJ6A 3FJ2A 1EZZB 4NLDA 3IAS9 4ZJOA 3PEHA 2DISA 3NP5A 2QA2A 2E7XA 2E5GA 3OJWA 3AA8A 3FQLA 4DEZA 5LXRA 4Z37A 1QAYA 1UMJA 4KO0A 3K5PA 3KLHB 2DEUA 2JEIA 1I94J 4MH8A 5IS2A 4OIXA 4IDKA 2CG8A 3MPDA 3CMQA 1RT5A 3DN9A 3NAIA 2VNHA 2YNGA 4B9TA 3VO2A 2J9EA 3MMPA 1U2RA 1RAJA 4X4RA 5CHCB 1HWKA 3M8SA 1J5OB 3N4WA 2B8PA 2VJVA 1S6UA 3UI3A 1E1QA 5F0WA 1KP6A 1Q1KA 1BX0A 2X53S 4L75A 2KN4A 3CD7A 1U0HA 1QUEA 2G1HA 3WY9A 1Q7LB 2UUCF 3BPDA 2NR0A 3M1VA 3AJDA 1ZAXA 5KAKA 1GVHA 1FDNA 2YWKA 4QUZA 4HTJA 4DPYA 4PGOA 2LA4A 1P8GA 4FNIA 2HBQB 5C2GA 3OHBA 4K5RA 1EFTA 3G8TA 4MIAA 3W65A 5DDPC 1I5OB 2EBEA 2X1BA 1A0OB 3CEDA 4ER8A 2OK8A 4Z4RA 3WC2A 2CWXA 2Z57B 2PI5A 1F9HA 3BZQA 3PXGa 5LL6d 3Q23A 5KFUA 5GVQA 1EP3B 1YZ6A 4J9NA 4P52A 2AEJA 2QL7B 3OAAA 2V2QA 4FKYA 3QBCA 3A8IA 2D9PA 2W9AA 1HHQA 3TAQA 2Z0GA 4BWJA 2AU0A 3T3FA 3JU4A 3C15A 3EUNA 1D9AA 4G1QB 2MGZA 1P27B 2VJJA 4LF9J 1NJYA 4C3LA 1HBMB 5KFEA 1HD1A 1U45A 2R9LA 2EW9A 3TAMB 4RNFA 2QEXB 1S9GB 4ZCKA 4DV1F 3NLCA 1RYRA 1YGYA 2WBMA 4NZ7A 3LNNA 1MW7A 3DFEA 1VHOA 2VOPA 3MPYA 3W2GA 4QU6A 4DFMA 2OBTA 1TV6A 2HHHF 1KHWA 4X4QA 1RLCL 1A9NB 4XPCA 1B0VA 1X4HA 2W6IA 4WZLA 5GMKa 4YHBA 2RAQA 1MMLA 5D4LA 2ZH3A 1KVIA 1NSPA 2VBTA 1WSVA 1UEVA 1DQ8A 3M6XA 1G7TA 5CQGA 2HQIA 2W24A 4ZOSA 2B9XA 4TMXA 4RW8A 1PAUB 5D8HB 3O1LA 5CYQA 3GQCA 3I87A 1DDIA 3OR1B 5IT9Y 3A35A 2RKIA 4M8LA 3MR3A 4LF8F 2X6XA 5BR8F 2ZNYA 2NZCA 4C43A 5TRDA 2IIHA 2PIAA 1C0UB 2W7PA 1Q5YA 1RJJA 3TNVA 1X5TA 1Y0HA 2R9VA 4LRAA 1RA6A 4FK8A 3OSPA 4KRWA 3G6VA 4KKOA 3GJQB 2IFXA 3VMFA 1YJRA 1CJTB 2W4DA 2VB6A 2BSAA 2BJ8A 2XZPA 3UDCA 3TA2A 2PE3A 3M32B 4II3A 3KYLA 3R2CJ 4LQ9A 3W62A 4ZVUB 2ZBQA 4GO7X 3VF0B 3I5AA 2BE7D 3SQGA 2X7IA 2AF6A 4RD2A 1CSJA 2WBRA 4Z4UA 3ZPNA 2V0NA 3MXHP 2W6JA 1EETA 1NUEA 3CCLB 5M2PA 1YRTA 1SQFA 5KFQA 2X0KA 4QQBA 5FO0A 2XLKA 3V2UC 2DB1A 4PWWA 4EZ6A 3H2LA 4YY3J 3BQ2A 4LF1A 2IVMA 3EYZA 5J1PA 1S1XA 1X4GA 3HX9A 2XNCA 2J0QD 1PYSB 3UDVA 3OKXA 1NPRA 4H4OB 2JZ5A 3DDKA 2BM1A 3OVAA 4LF5F 1KLMB 3Q0AA 2WRMA 5KFNA 2ZM6J 1IJEA 2KFNA 2WHOA 2GGPB 1OPIA 5D4PA 2MJNA 4AFFA 3VGUA 5B0FA 1WTHD 3ZZUA 2DIUA 4WFZA 3TUIC 2OSRA 3CMAS 3DRRB 4DU7A 3SZ2A 2HLUA 3IGVA 4ANDA 4K4TA 4OI4A 1XFOA 3MEDA 1HNZF 2BKNA 3D4JA 1WKJA 3KNGA 4AL5A 4P10A 2RKIB 3OR1A 1Y3JA 4KGXB 2QLFB 4XKWA 1IBKJ 3PFEA 1HYSA 1W0JA 4JI7J 5HVFA 3HZEA 1Y5IB 4ZLPA 3UDLA 5JJBA 1L3KA 5KFFA 1IM4A 2L08A 3QO9A 3CDUA 4LMZA 1QUPA 5IZHA 4QBUA 1UFLA 1UW4A 5F9LA 4F4YA 4MAKA 4ED4A 1NLKL 4C4WA 1T9WA 2CZ4A 2VQFJ 3UE2A 1SXLA 1TV6B 3P3DA 2AKWB 5T14A 3OW2R 3TO8A 4RJVA 2CAJA 1TP7A 2PMHA 2O1PA 3SDEA 4G6IA 2J9DE 3FKBA 4P1VA 3IG1B 1UJ5A 4IH5A 2AD9A 3KK1A 1ULRA 1HBMA 1REVA 3RW7A 1X31C 1VK8A 5J3OA 2ZXIA 5KFPA 1H3DA 4C0BA 2R8HA 1JXEA 4M4SA 1JB0C 3D0GE 1UA0A 4GVBB 1HMVA 2XZWA 1EWYA 2FY8A 5LSOA 5AXMA 4J5OA 4QW9A 4PCQA 4ID5B 3BBFA 3HMJG 1RWMB 1IKXB 3M30B 1WDDA 1N06A 1FWKA 3EM1A 2E1CA 2QT7A 5HMXA 1E6VA 4M5IA 2GQFA 5E33A 2X1FA 4CQ1A 4EEYA 4NPOA 3GJTB 5E6TA 1NHUA 5A76A 1P9YA 3Q24A 1V3RA 2F9DA 3HP6A 2KB2A 4TXSA 5IWAF 1D8YA 3R6GB 3QT8A 1T8EA 3F0NA 3CCUS 2QYGA 3ENQA 2Q1LA 5DGBA 1FX0A 1WC4A 1YWXA 3OFEA 3M8YA 5HN0A 5J35A 1CC8A 2R7VA 3CDEA 2A0FB 5KFJA 2BE9B 4G5GA 2DNGA 3ISNC 1QAIA 3AQOA 4LBYA 2CPEA 2CNOB 2XC9A 1RT5B 4U9UA 4HDHA 1GK8A 2HHQA 2GO8A 4N47A 4NMLA 2ZE2B 1E1RA 2OFHX 3L4BC 2FJDB 2MY8A 5HMWA 4Y9RA 3KNAA 4KO0B 3HHLD 3N79A 1FK9B 4FYVB 3ISND 4DSIA 3CJQA 5AXKA 4NE9C 5GADI 1N6QB 3T6JA 1S6QB 2QSWA 3OW2B 2DNQA 4OLPA 2XNQA 1LWCA 3PTWA 4LF7J 4CO0A 3W5HA 1QG0A 1MWQA 5D15A 2OTLB 5L1IA 4RW9A 1X5SA 4M5GA 1NAQA 2YNIB 4KHPF 4ZITA 1WSRA 1QDUB 1NZ8A 3QSYA 1ZTWA 3V4IB 1KK0A 3S6EA 3P96A 5LJ5Y 4NBSA 3DHWC 1GJRA 1SIZA 3I96A 4FPRA 1EP4B 2E9RX 3V81B 5KFWA 1RWWB 4DV5J 3O3LA 3SIPB 2H1YA 2HVDA 1KMHA 4WZEA 2HRUA 1I8DA 2DJWA 3PHTA 1OGIA 4DI6A 4KAIA 1TU0B 4U7UK 4PUOA 4AL6A 4UF4A 1VRUA 1VBXA 3GIKA 2DXDA 4USIA 3EVMA 3L7PA 1CVJA 5DS7A 3OW7A 3TOQA 3K8WA 1RAOA 3N5FA 3ZO7A 3SXLA 4P2MA 4IW3B 1H42A 3BJYA 1Q81T 3VAGA 3WNBA 2HBYB 2B3TB 4KYZA 1UPPA 2LKZA 3AXKA 4FVCA 2LZJA 1KQKA 3D0IE 3LGMA 3BPSP 1UA1A 5B7WA 5FD1A 1B4SA 3AOAA 5MLCV 4FKXA 2DY9A 3NBPA 3A8EA 2FLPA 1IVZA 1ZUNB 2Y0SD 5DRKA 1KOOA 1AIPA 3J81j 2AW0A 1F9EB 5DSZA 2K1RB 5KFIA 1Q7YD 3MPWA 1U2FA 3CDAA 3KK2A 2YKAA 3U1LA 4ZVGA 1S99A 1N52B 2C5HA 1BQNA 1FJGF 4JI1F 3GLJA 4MTPA 3LQ6A 2JNJA 1K73T 1FD2A 3KKFA 4IG3B 4X65F 3CC2B 5HQMA 3H5XA 1CJKA 4JI4J 3EZOA 3ZZ0A 1BQNB 3M8PB 2WONB 2YKMA 3B4MA 2EIXA 5KFBA 3WBKA 3KLGA 3KL9A 4JYAJ 4PG6A 4DX6A 4CLKA 2OGUA 2LFVA 4WIQA 1U1LA 2OPPA 3A8KA 2WSSA 2HWIA 3Q86A 1S9FA 1WHYA 2FJEB 2VNKA 2V2VA 2CDQA 1VQMB 3NBPB 4DV4F 1QSLA 1WEZA 1A6LA 2R8GA 4QZVB 2M9KA 3CCVB 2QLWA 2VASA 3QNWB 2CWKA 1KSPA 1Q78A 1VI7A 2QJ3A 2HFSA 1YLOA 1OY9A 4NLRA 5CXTA 3GFHA 1JLCA 5JVGQ 3CULA 3GFYA 2ZH5A 1R7IA 2YWEA 2E5JA 3CC2S 1M5VC 2VODA 3WXMA 3CCVS 4TLRA 1U1PA 2CPYA 2OELA 4DL4A 1UCNA 1T9YA 4C8ZA 2HLTA 2B9YA 4PUOB 2OSQA 4DN0A 5CYJA 1ACMB 5F3TA 4G7XA 2X6YA 4UQGA 1UZDA 3V81A 2LDIA 5A8WA 1HBOB 2BA9A 5LMUJ 2UUBF 3ASPA 1Q82D 7FDRA 4X8IA 3ETOA 4FBTA 2ZH9A 3QJPA 4G1IA 1X4DA 3BQ0A 5KT2A 3N9UC 4FYYB 3W7BA 4X0CA 2YNIA 3NNHA 5ETMA 5I42B 3Q2SC 1RTDB 3D0HE 4ES2A 2H9ZA 2RVJA 1D8TA 4FPIA 2WVBA 3QATA 4L72B 1R89A 4R8UA 2DNHA 5ETOA 1ZYQA 5F8JA 3I5CA 1UD3A 1UVJA 1PCAA 1P1LA 4UOHA 2VFRA 1J2VA 1UVLA 3W3SA 1N36F 4I6YA 2ZE2A 5HBMB 1URRA 1IR0A 1FKPB 5FNZA 4X05A 4B43A 2HVIA 4OJGA 5DQIA 4DMZA 1SB6A 3ENAA 1H74A 2FVGA 3LA0A 4J9VA 1IKVA 1NPPA 3B82A 2W8LA 3KFWX 3PG9A 4DJBA 4QCLA 2CPDA 1NKBA 5IM0B 5KFYA 4RBUA 3AVYA 3NNAA 4I2QA 3PNIA 2A3JA 1LV5A 4UZEA 1JLAB 2L9NA 4MT1A 3RZAA 2V68A 1XC9A 3Q8PB 3QFTA 4H4MA 1ZM3A 3VHQA 1HKAA 2D3LA 1W9XA 3EGWB 3B78A 4DV0J 1R0AB 3V6DB 1HWIA 3CCES 2BYCA 4LFCJ 4Z7CA 5J2QB 4OYOA 2CJBA 4GMKA 1IB0A 5IFMA 2KJWA 5J2QA 4KGMA 1CJUA 3IRWP 2G0CA 2JOQA 1S6OA 3UR3C 4ID5A 1VQNB 4K1XA 3W5YA 1FXDA 4QWBA 1K8AD 2FVCA 4GVBA 4XN0A 4XMYA 2EBGA 3KG4A 2J9DA 3TUPA 1SJ4P 5DGAA 1VQ4B 4YQWA 4I2QB 4X7DA 3DU5A 4K4VA 2ADCA 5D6GA 4B3XA 3SEOA 3IG1A 5E2QA 4LRCA 3J7ZT 5KG2A 4NXNJ 3SDEB 1UAWA 1HW9A 1IKVB 2Q6BA 1L5UA 4RBVA 4L76A 1UJ4A 3EVOA 1RBAA 4IOCQ 4YAWA 4NLTA 2COLA 1FKPA 4EBEA 5HBMA 3OFFA 3R7BB 4DL0C 5HLFB 4ZLNA 2NXEA 2FB0A 1BUXA 4KB7A 2WK4A 3H2UB 2R6HA 3R7SB 5BSYA 4LBWA 3BF4A 1RU2A 4M53A 2Z30B 2V9KA 4B9VA 3LF0A 2ZL7A 3UWTA 3MM9B 4ZCIA 4JBCA 1S6PB 3W9IA 2DY1A 2JEJA 1JNZB 3TRGA 4F8RA 1FD8A 3C16A 3VVTA 1FI4A 2YX1A 5HQLA 2RDJA 3H40A 5EGYA 3MR2A 3QIPA 5A8WB 5DLFA 4LT6A 1LW0A 1HHSA 4DPXA 2W2OP 3DRRA 4ZP7A 3CCRB 3AGQA 4L8JA 3Q8SB 3U1NA 2OEKA 3JAMY 3PKYA 2VZLA 2D7SA 3U27A 1SC1B 2FPHX 3GSIA 1IJEB 2V4JA 3KUHA 1KR4A 3QIDA 4I2PB 4NASA 1XNRF 1HQEB 3S01A 1WNEA 1OB0A 1NEEA 2PLFA 4II2A 2FJBB 4WU2A 3R6KA 9RUBA 1SH0A 3PX4A 3BV8A 1TLLA 1JLCB 5TV2A 2OLWA 5DZ6A 5CD4H 3MCNA 4UT4A 1U02A 4F0MA 2C2MB 2HLDA 1OYEA 4QWCA 4A8SA 4NX9A 1BE4A 2PFFB 3GIRA 4Q8EA 3PHEA 1N32F 4CCHA 1DAXA 2AJ1A 1S5ZA 1EFCA 4DV2F 2VBZA 4BC7A 3EXCX 3SQGB 3K5NA 2XMJA 1F1BB 1UVKA 1O5JA 1R8AA 4LRDA 3MR5A 3M32A 3DHXA 4Z4ZA 2J0SD 2OPSB 5A0YB 4DOZA 1VRTB 2W2PP 4QW8A 2WONA 4ZVSB 3CCSB 3M8PA 2R2RA 4LFBF 2WW4A 3W60A 4PQUA 4IG3A 1E64A 4C8YA 2ZH1A 3NS6A 3DGVA 4KBIA 2C3UA 5DN6A 4ZVOB 2GMHA 4Z4VA 2BM0A 1VQ9B 3CTAA 3H5YA 2XZTB 5ETTA 1D09B 2HZVA 4P6VF 1IWAA 2XTJP 4WFAQ 5LT5A 2OO4A 4OX9F 3CMES 2K1RA 3IMQJ 2IRYA 3VR6A 2RHQB 2YQ3A 2XNDA 2ALZA 1VGYA 1H8HA 3K2YA 4P12A 1B7YB 2RQMA 2FGCA 2RH3A 2PMZD 3FFIA 4ZHRB 1D1UA 2QTZA 9ATCB 3PUMA 4DV4J 3HM9A 5KOXA 5FIUA 4P26A 1WDTA 1KLNA 3QT7A 4WP3A 4AXJA 1C0TA 5FA6A 2HHPA 2CDRB 4DDFA 4IOAQ 3ZNUA 3LPEA 3D6MB 5BXIA 2VPYB 2HK2A 2VG7A 3W5UA 2DNRA 1N88A 1B64A 3IBCB 1VBYA 2F43A 4WYLA 4DPOA 3EDRB 5F9NA 2XS5A 2DH9A 1VRUB 3CO0P 2ZJRQ 1H85A 3T1HJ 4GKJF 2M5YA 1XTZA 3TX0A 2OH2A 5A8RB 2LU2A 2PEBA 1VQMS 4Q2MA 4I0WA 8ATCB 3G05A 3W5ZA 5EWEA 2LECA 5KFCA 1LWEB 4XORA 4WYWA 5KFLA 3OTOJ 3Q22A 2GJRA 2EXUA 2XEXA 2GQCA 3OL9A 1VQLS 3R9LA 3ZUGA 2QDXA 3QYYA 1QTNB 4DV3F 5L1LA 2CRVA 1KD1D 4M5MA 4RW9B 3W61A 4JP8A 1XN9A 5KOWA 1NBEB 3K17A 1S12A 4W98A 2R7UA 4OHVA 5D0GA 1TK5A 4MJKA 4LIRA 1UP1A 4OHZA 2N3OA 5L1JA 1S6QA 1N6QA 2MPUA 2UVWA 1U1QA 4C97A 4F02A 2QYCA 2JDIA 4B9NA 5BJRA 2QA1A 2Z2YB 1H7WA 2IAJB 2LQBA 2VQEF 2HAFA 2Y8YA 4YEJA 1GO2A 3WDOA 1J5OA 3BN4A 2ZD1A 4LR9A 5L39A 2OMLA 2XZOA 5E0OA 3R5JB 1W7WA 3P6YC 3WBZA 2MQNA 2C2KB 1QTMA 3R97A 5U47A 1Y0RA 1SJ1A 3QJJA 2VFVA 4CIOA 3R3TA 4Y2MA 3CIMA 3ASQA 3K5MA 1R5NA 3BR8A 1O51A 2VBXA 1G2EA 1NDHA 3KLHA 3CXCB 2XMMA 4DR7F 1KN6A 4A8MP 3L09A 3J81k 4K5SA 2DNYA 4CLWA 4DX8H 5T7LB 1HHTP 3GZ7A 3JQKA 1IBCB 4WZQA 4LF8J 1Z2LA 5IYRA 3UQSA 2ZBCA 3I55S 1KBRA 2I6WA 3ZZPA 2QLBB 2IM0A 3V6HA 1KVKA 4BDPA 2ZZMA 1EJ7L 1E6VB 1G6BA 1U48A 4FF4A 4DR5F 3CC4B 3M30A 3H98A 1Q81D 2HHWA 1YJUA 2HBZB 1HR0F 3OTBA 4USHA 1LWEA 5IV4A 4ROXA 4JI5J 4O4RA 4NRTA 3OV7A 2ADBA 5K8OA 2W25A 3MCOA 3LALA 2XI2A 4RW4B 1RWXB 1UW9A 5A8RA 1WU8A 3VNVA 3KUGA 4Y2AA 2EFQA 1JJ2B 2H4YB 1FX4A 4P2FA 2P2CB 1Q8LA 1T7PA 1OQ6A 2FVQA 1REVB 1WOPA 2V7UA 3H9NA 3KK1B 3NL0A 1C1CB 1PJ7A 3MUMP 4F4AA 4R0EA 3LP0A 2E5HA 4GO5X 3A3GA 4NL5A 1X9SA 1SQGA 4R25A 1YIJB 2DR5A 2QSFA 5B0GA 4YY3F 4K2JA 4YN3B 1T6YA 2YWWA 2FIUA 4WK3A 2B6AA 3JTPA 2QGFB 4NWBA 5L9XA 4LRBA 3DOKA 1DHMA 1RWUA 4ES1A 1R0CB 1OIAA 1ICEB 3D66A 3QO9B 4U7CA 1WORA 1NZAA 2QZ8A 2ALYB 5J2PA 2R8JA 4RKUC 3WYAA 1VJWA 2VKZG 2HHSA 1PGZA 4ES3A 3FRZA 1HYSB 3C6TB 1CJVB 3P45B 1F5BA 1AT1B 3SI8A 1WEXA 2MSTA 1U8SA 2BOAA 4JV2A 4HH1A 4KGKA 3X3UA 4RU2A 4KKSA 1CLFA 1TAUA 3BGUA 4OZ1A 3PW0A 1C2PA 4RPBA 3HCXA 2V8VA 3MEDB 4DPUA 4PQUB 4QHYA 3T5KA 3H4DA 2VV5A 3V6KA 3BBBA 2IDLA 5A0YA 4PG7A 2HQDA 1RGVA 2C2RA 5JUMA 2NXNA 4LC0A 3T9NA 4P2NA 2WYRA 2AQ4A 4JV5J 5ETQA 5AJ3J 3QT5A 3LO3A 5F8HA 3GV5B 4NXNF 1H38A 1AZSA 4IQXA 2HFVA 2KHDA 1S72B 4YUDA 1NK6A 3P5TL 5HATA 3ETMA 4RX6A 4IR1A 2FQQB 1NJZA 2X3DA 5SUHA 2C2NA 2E29A 1FF2A 4IUFA 3J81U 3CTRA 2JFDA 1EQ0A 3GYXB 3OLAA 4U95A 1RAFB 4KHRA 3O5TB 1XWLA 4HACB 3DC2A 2IHR1 2OFGX 3RY8A 2QE5A 3WNCA 2VKRA 2HYIB 1PKVA 4UZUA 1M90D 3VAFA 1HI8A 1VQ8S 1FJCA 5FL7A 1APSA 1TL3B 2UXBJ 1XQBA 1CJTA 3MURP 3LP1B 4RNHA 3IWNC 1IN0A 4B3TF 1YHQB 3QIPB 3CNQP 1IR2A 4C8OA 2F3JA 4M5NA 2HZCA 1C0UA 1FNCA 2UV8A 5CYMA 3T5HA 2HWTA 2M52A 4R5PB 6AT1B 3PR4A 5LJ3Y 3J7Z5 1S6PA 1TL5A 4N76A 2AT1B 3BSAA 2ZBVA 1EX8A 2XYHB 3BH7B 5CAAA 3U7JA 1VQ6B 1D3WA 5T41A 3MEEA 5IK2A 3IM9A 1H8EA 2CIMA 2BXJA 4K4SA 1VQPB 4ILMA 4Q44A 1VMBA 4K0KJ 1FHTA 2W01A 3M4XA 2CQIA 5KNLA 1TL4A 2F1MA 3GSDA 3GVJA 1HLWA 3PDNA 2RU3A 3OPOA 4PC1A 2XQCA 3ZZRA 5ADZA 4C3KA 4CO5A 2XO7A 4P25A 4PXCA 1UD6A 3MM6B 2I2YA 4QVJA 1IHMA 4MKAA 3J7YU 1S9GA 1RQRA 2XHWA 4OHYA 2YTCA 3JQQA 4RDLA 4Y7CA 4DQQA 2VDHA 1R6VA 2ZBIA 4Y2KA 2PI4A 4NLXA 1O0PA 4J7CA 4LF7F 2MGZB 5C25A 2UXCJ 3L7UA 4DX5A 3C15B 5IYPA 4FXWA 2NSBA 2ZWPA 2MQ8A 1TZ0A 2NCKL 4KHMA 3OJXA 2KTQA 4EI2A 2DVIA 4AT1B 1DJ0A 1U7LA 2XMAA 3VGVA 1NB9A 1S1UB 4TN1A 4XTTA 4F7VA 3AXMA 2NPFA 1JLFB 4DR6F 3Q2TC 4JI2F 2CJYB 4BHQA 1F20A 3D5MA 2MQQA 4DX7A 2XSJA 1OY8A 3OEHA 3V6DA 1R0AA 4OOXA 4C3MA 1NKCA 3EX7B 1CQXA 2HAIA 1EKSA 2QGGA 1JA1A 1T03A 2JVRA 4QIWD 2D9OA 3GTYX 4C7QA 2DNPA 2PMWA 4S0MA 3AOCA 2OEJA 3M1VB 4CI0B 4PEOA 3TA1A 3ONUA 5F41A 2B56A 1QE1A 2IMOA 3W2WB 4M5KA 2O5DA 1KTQA 2QMUB 3PV8A 2KVIA 3I0SA 4I6AA 1XIQA 1UJ6A 4PG5A 1RT2A 4DF4A 4DR3J 3QFSA 5DS0A 2XI3A 2C22A 2B5OA 2XLIA 3U2QA 3ZXWA 1E43A 2YNGB 2ZC4A 2UXCF 5THXA 4RNOA 3M9MB 3QSIA 1UVIA 7AT1B 3GONA 4Z4SA 3FRYA 3TR5A 4FF3A 2ZBUA 1SH2A 1F5AA 2ZEJA 5LXYA 3TZZA 1BQEA 3OXGA 3P27A 4X4VA 4ITSA 1VQ7S 5KTQA 2POKA 3DLEB 2M88A 5B0BA 4OZJA 1M5HA 2DH7A 1I3OB 4NZ0A 2QL5B 2LQ5A 2EK6A 3T5JA 4DSLA 5F4MA 1L3SA 3ASTA 4CH7A 3FSIA 2XGJA 3KG1A 1J5EF 1HBOA 4XQFA 2BACA 3K5LA 4DFKA 1YVFA 4CLYA 4DV3J 3HSZA 2I9SA 5G4DA 3G71B 2Q6CA 2U1AA 4XR6A 2ZVIA 1NSAA 4OPVA 1JJ2R 4ZA1A 1HWUA 4XD7A 2GFFA 5HXBA 4XLHA 2ZZEA 2Y3YA 5HI7A 4X66J 1TKZB 2V94A 5FIIA 3BKTA 4L3NA 1QUVA 4QPXA 2HMIA 4NMXA 1FVQA 1BLIA 1KZLA 3NS7B 2A6OA 5I3QA 2D74B 3POTA 4IH6A 2YKPA 2ATCB 3B4DA 3V7AA 4G65A 5B0CA 1X8DA 2B51A 4WP9A 2GVZB 1KQSR 4UZFA 1FO1A 2NXCA 2X3GA 3C14A 3ASSA 4UUWA 2P6SA 3Q8QB 4P22A 1MWYA 1AFIA 2JJ1A 4F4XA 2ROGA 5A6PA 1SL2A 4WKYA 2IM3A 2BN4A 2UUBJ 4DF8A 1N5YA 2OJ3A 4F2RA 3MTKA 1Y11A 2C2DA 2YKMB 4KC5A 3C2PA 4V19J 3RB3A 3WQPA 2GJFA 2QN6A 3FBEA 4QJVA 3HVWA 1P4MA 2IA6A 1K28D 1RABB 3MCMA 5KSWB 3MFHA 1SC3B 3MCAA 3EZUA 1TAQA 1OS5A 2HW3A 2YX4A 1HI1A 2OMOA 1IUJA 5GMEA 1HFEL 3HXMA 4LSLB 3CJ8A 3KOAA 2AGQA 3WHIA 2NREA 2L41A 2R7TA 3D28A 2VFTA 3KK2B 3MCSA 5DDRC 3RRKA 2XGQA 2HFOA 5GV7A 3M2RA 3MDFA 2VG5A 4JI2J 1XNQJ 1KK3A 2HNYA 1QJHA 4RLEA 4JI7F 4P2XA 4QWEA 2DYAA 1VR6A 3PVDA 2UVVA 2LLZA 4WCEQ 4UOCA 5AJ3F 5EWFA 4YDXA 2D3UA 4LF2A 2XMUA 3VR1A 3MM7B 1BMQB 3GMGA 2GJKA 4K4YA 4G7WA 3JYTB 1HNIB 1WC5A 4M5HA 3PVXA 3IWLA 2XYPB 2L9WA 3OEEA 4IFVB 1UD8A 3KLEB 2CF4A 1AUDA 2JLEA 2AYGA 1A8PA 4M5JA 4PG4A 4NCAA 1HA1A 4Z1MA 2A2DA 2HHHJ 1KJZA 2ZZTA 5KT7A 4XLAA 2G4BA 2WVCA 3KHGA 2QE7A 1YX2A 4RUHA 4EBDA 2K3KA 1RWKB 4LVNP 2UVRA 4DHVA 4TY9A 2ZKTA 1EP4A 4UOFA 1V3SA 4HKQA 4FYWB 1BLUA 1FNMA 1G3OA 2CJQA 3SBMA 1JJ4A 2V63A 3I31A 2R8KA 1FDRA 4MYTA 3LGHA 3QSYB 2A6MA 1WC3A 2LP4A 4ZJQA 3NY0A 1RQ0A 4IYQA 6FDRA 4TMZA 4ECYA 3GJSB 3GV7B 1LWCB 2KHCA 3LAKA 3OXFA 4HTIA 1G7CA 4ZN3A 1LW2B 1HD0A 2X1GA 3HD1A 1CC7A 4O4GA 3ILIA 1FK9A 1JLQB 3FKSA 2BF4A 2BUNA 1WOOA 4FXUA 2RQ4A 2NQPA 3U1MA 2BJ1A 4LR7A 3SLNA 5KFSA 5A88A 3RB4A 2AGOA 4O3RA 4OYPA 2BJEA 3DLGA 2DGOA 3NGRA 1YJNS 3DRYA 3R5GA 3OL8A 3PRVA 4YB5A 5AE2A 2LA6A 2XS7A 1B23P 4F36A 3OL6A 2ASDA 4QVAA 4N77A 2KFYA 3FBBA 2K2PA 2FVSA 2AJ4A 5C24A 3MEKA 1N36J 3C46A 4O0IA 1TMJA 2VYQA 3A12A 3DYAB 2C4UA 1N5VA 4ZVEA 1FFSB 4C11A 4DPWA 1HQ2A 1WI8A 2HFNA 2PC6A 4Y28C 2XNJA 3VAMA 4K7QA 2QFIA 2Q66A 4ELTA 1V0FA 3R5CA 1YZ7A 1IKXA 2CJXB 3BO4A 3CCRS 5DJBA 3W8PA 3OVSA 4Y2IA 1RE1B 3MR7A 3FNNA 2DNNA 4B3FX 2V7TA 2DGSA 1BPLA 4O3SA 1RBLA 1FJGJ 1DTQB 1PILA 1HMVB 1QVFR 1RADB 4UTGA 2YQ1A 1NK5A 2YH1A 1NDCA 1VFJA 5DQHA 5KG0A 1FRQA 1RHRB 4LSZB 2IRUA 1SUQA 3CW2A 4AQYF 3BC9A 1M5SA 1TTTA 4JYAF 3FJOA 4LFAJ 3SCKE 4B9SA 3E2EA 3BDPA 1MSWD 4RZRA 4M63A 1QD1A 4ALZA 1PSDA 3DMJB 4HT5A 3K58A 2PMDA 2CXEA 4NRUA 1OQ3A 4DSJA 1NB2A 4ZCMA 3AH6A 3W2IA 4USMA 1X4CA 1FKOB 1NK0A 3CW2C 5LOQA 4FVMA 4WWVA 1T6ZA 4WFXA 3GB0A 4YHHF 3A3BA 1S4MA 1QLNA 2CA9A 2HBRB 1FNDA 1P9QC 3UN3A 2DBBA 2OBSA 4ICLA 3K8VA 1UD2A 1Q7YT 3GG1A 2H5IB 2DETA 3VQSA 3D6TB 2MKCA 3FSYA 1L3VA 2CPHA 2WW8A 2IM1A 3NGUA 2ZHAA 4ZPTR 2V4RA 3DLKA 2C77A 2HHVA 1MABA 3ZC3A 4WIIA 1IM6A 4BPRA 1K47A 4ZIWA 1C1BA 3SV3A 3MMBB 2UUWA 1WELA 4KKTA 3OZVA 4TQSA 3BM7A 1VC6A 4EMDA 3MAAB 3CJ2A 1Q4RA 4DL6A 2KXHA 4AQYJ 4ERDA 1U4BA 3MOJB 1F5CA 2GA7A 2H48B 2M4MA 2CPIA 1SQEA 2GGPA 2YX7A 4Y3CA 2ZVSA 2Q6OA 1JIHA 1KKHA 1JLGA 4DR5J 1KLMA 1TR0A 2HWHA 1TUIA 3TP2A 4H4OA 2Z58B 1SPBP 5IYWA 2OEMA 5TY0A 4DV1J 2QTWA 1S1XB 5ETKA 1S1WB 3CD5A 1FRXA 3PYFA 3CJ0A 4OI6A 1N33F 5CD4A 5HROA 4OYXA 1JK9B 4A8KA 2UP1A 4C8MA 5A2QU 4U6PA 3IAM9 2NV4A 1EETB 2VJIA 1YLXA 2W7AA 4U8VA 1X0PA 1UWAA 4ZVRB 1B2RA 3MAHA 4CLFA 3THVA 4NCGB 5HVHA 2D3O1 1LOUA 1FESA 3KG0A 2UXDF 1KHVA 3AQPA 4RD0A 2J5AA 4I1TA 5KG6A 1PBUA 1KQSB 2DRDA 2FJWA 3NMAA 1T9VA 4L73A 2BE2B 2P8IA 4B3GA 5K20B 4RCZA 1W26A 5KG1A 2V8GA 2VH7A 3GV8B 3CJRA 1DG1G 1S7HA 3UNGC 2J7KA 4KKOB 1NDPA 3PA1A 2MKKA 3PIOQ 3AVXA 4WJBA 2B4OA 2CG4A 1WHXA 5E3PA 4MFBA 1DTTA 2DGQA 3ADAC 2QFJA 4DNTB 2ABYA 4OI2A 4CLPA 2GVDB 1XMOJ 4N7TA 2M5SA 4FP9A 3T5LA 3KLIB 1GMWA 4GKKJ 5CYQB 2HEKA 1S49A 2ZH4A 4DPTA 2EVZA 1VHEA 2DK2A 4RW8B 3DLHA 2ZZNA 2E7VA 3OTCA 4ECVA 2R7WA 3B54A 1JJHA 2JLGA 2MLXA 1HNVA 4QIFA 1RU1A 3KLFA 3JSRA 3QFCA 3T1YJ 1WKKA 2MB0B 3Q39A 3HT3A 1FDBA 1MN9A 3JXOA 2IA0A 2HGLA 4UAJA 3SCLE 2VBVA 4C8LA 1JLEA 4LBHA 2DH8A 1AUSL 1L3TA 1RA7A 4OZ5A 4WE1B 1RHQB 1JLBB 3ENVA 3BGLA 5IWAJ 4A8QA 3L7OA 3TAMA 1ZS6A 3OR2B 3R2DJ 5HK4A 4OYIA 1LXNA 3ASRA 2JC1A 4DLGA 4CO4A 3SLDA 1FWPA 3H8YA 4ECWA 1VQ6S 2Z8QA 3TJAA 3E51A 2E44A 4G1QA 2GMJA 4WFYA 5KFXA 2CQ0A 3SSSA 4H4KC 5E5NA 4RUBA 4M5DA 3VTIA 2WSEC 2KZMA 4F3QA 2V4DA 2CJKA 1S77D 1EP2B 1QGZA 4LVOP 3D1OA 3CPXA 1UL3A 1YHQS 3G82A 1S1TB 3FBFA 1HI0P 5LMZA 5IYQA 1HBUB 2CJAA 3DOLA 4X4TA 3DDNA 3LTOA 5C7PA 2JJ4D 3MGJA 4Q2LA 3OOCA 5I3UB 1REGX 2EG2A 4DFPA 2Q6IA 5ITHA 1JNYA 3JSYA 2CNNB 1GXUA 4ZPCA 5KFGA 2GNKA 1KVJA 3Q8UA 5J1NA 2C2WA 4PWDB 1HVXA 3J7A1 4IO9Q 4LSNA 4I4BA 5CZXA 3D6FB 3QGHA 1U0HB 1JX4A 4J9MA 2ZKUA 3F73A 1QAXA 1NNDA 2B5JB 4HVZA 2BW2A 4OLOA 3W66A 2OD6A 2MHEA 3JAMU 1WF0A 2IYGA 2KRBA 2ZJPQ 4XN3A 1F60B 2F40A 3MR6A 2YY3A 1XNRJ 1Q95G 4N3NA 3AODA 2KXNB 2G2YA 4K4UA 4CZCA 4IDKB 2WOMB 3Q38A 1ZM2A 3KHRA 4EYHB 3M2UA 3CRZA 3G2XA 3CMAB 1SJFA 4JV0A 2NZ4A 3O44A 4ZPWR 3RGIA 5KG5A 5GAGU 1RT6B 3AY0A 4DUZJ 2DCUA 1RI7A 4X7FA 3MM5A 1ZM4A 1MLAA 3AVTA 4WTOB 2CUYA 1HW8A 2QA4G 4O44A 2XBPA 2V5HG 2XS2A 2LXFA 3TI0A 4I69A 3H90A 2V4QA 1RT1B 3MTJA 1T3OA 2V50A 4KV8B 4ZPAA 2MDAA 1WP6A 2Y0BB 2AP6A 4I7FB 3WIVA 3FQKA 4M5LA 4G3IA 2Z6BD 2DNKA 4WZMA 4HLBA 2OPRA 5BYQA 2ZTNA 3NE5B 3M9OB 2AWZA 2WSFC 5L38A 2CC2A 2ERRA 1Y5NB 2ZDPA 2VC1A 4ZS6A 1LFPA 1N07A 1SKWA 3WC0A 5GADU 1AA1B 4DCJB 2DNZA 2G0IA 3AOBA 1EFUA 1RTIB 4B3RF 5C5JA 2ZZQA 2V67A 5ETRA 4UW2A 3BS9A 2EFNA 4E0FA 1T05A 1ZA2B 3S1TA 4P6YA 4O0NA 3QMQA 2GO9A 1RT7B 2I5JB 2KYXA 1UWBB 3PJXA 1B70B 2CBXA 2E1AA 1V0EA 1RSCA 1IJFA 2QV6A 2DGVA 2MQPA 4J9SA 3M6UA 4ID8A 3US5A 3BYPA 2YNHA 3WQZA 1FRMA 1RQPA 3T1AA 1QSYA 5KW9A 1E63A 4CTAA 4DUZF 4Y2CA 1XE1A 3ZZTA 1HPZA 5HANA 2Q6KA 2XZLA 3D68A 1KQFB 5B0DA 3W64A 3TUJC 5H5JA 1I7PA 3M8QA 4RR5A 2PFDA 4B3MJ 5EN1A 4JOUA 3PA2A 2R42A 1ZPWX 2BMWA 2QA4S 1MU2B 3VZIA 4ANEA 5C42A 1VQ5B 1KOHA 4ED0A 3ZIAA 4TMWA 4NA1A 3W5VA 4DL5A 3B8HA 1FCAA 5JBQA 1NSQA 3HHNB 2MKJA 3VALA 4X4PA 1E6YA 2HG4A 1Q8IA 3KTQA 3NGKA 1ITPA 1WOSA 3HHLB 5DM6Q 3PO5A 4YB6A 3HO1A 2F8HA 4FWTA 2YPYA 2PIIA 5KFHA 5KFTA 2KJVA 3H5SA 3WX4A 4X64F 4OX7A 3L3CA 4KPCA 2RQCA 4WPAA 2C3PA 2HMAA 1U0SA 1M1KT 4ZPVR 2CPJA 2W9CB 4Z4TA 4LFBJ 4DCPB 3U6BA 4MIBA 1RKJA 1QM9A 4ZLJA 1RBOB 1CNEA 1FWLA 4I56A 2J9CA 4IFYB 1GXTA 1IBLJ 2D3ZA 3LANA 3LW5C 2WPDA 3LWLA 1S57A 3C3LA 2C78A 1FERA 4QYZK 2GIQA 2B9EA 3T51B 5JMNA 4ASUA 2CQ4A 3DM2B 1SC4B 2V31A 2CQCA 2EKNA 4A48A 3TAPA 1FRNA 1KRHA 2FZKB 4OQJA 3FMWA 2RRNA 3ILOA 1HBNA 2CNKB 3HSJA 1RHUB 5EWGA 1ELOA 1SJRA 2PE8A 3CC7S 2VL1A 2KM8C 1T11A 2ZH8A 3GIMA 1OSCA 2W9BB 2E5IA 2FJAB 1FRLA 5K8NA 4LR8A 2VFUA 4CYUB 1FXLA 5JVHQ 2FHMA 2DR8A 1ZM9A 4A4JA 2ZZFA 4K4ZA 1S9EA 1F2HA 1K44A 2C28A 4ZGQB 2M70A 2J76E 1S4EA 2RDIA 1TKXA 2RF2B 2EFVA 1TL7A 4Q5VA 3EZ5A 1YG0A 3N01A 5G0RB 1PBAA 3MEGA 2BQRA 2FHJD 1H7XA 5AE3A 2C3MA 2ZWOA 3HD2A 2JHEA 2BV3A 3AD8C 2CNLB 2LQ8A 3UD3P 2R7XA 1NHKL 4EU0A 3W8GA 4OHXA 1EIYB 2O01C 3BKUA 2IC3A 2RILA 3V5RA 5J2MA 2AJQA 1YTYA 3K89A 4JMQA 3PW4A 1AMOA 1IQTA 2CQHA 2MEWA 1YITB 5H9EK 2F7VA 5DLGA 3I1FA 1O8BA 2IPOB 1MROA 2JH3A 4N8NA 3OUYB 3AB2B 2NUUG 2UUTA 3MECA 1M5OC 1SV5B 4LBZA 2BW7A 1S1VA 4F3MA 4KE5A 4IOBA 4J90A 1CBKA 2FY1A 4FN5A 3G6ES 4C0SA 2YNFB 1U24A 3CJSA 2VQEJ 4QYZJ 2DHGA 2SXLA 2DT9A 2F63A 3DRSB 1U1RA 2WR8A 5LSRA 2DRAA 4AXIA 1TQLA 4DU8A 4PPDA 4ZJLA 2RC5A 4R71A 1OPZA 4C8KA 3OFHA 2D1CA 1U09A 2WVFA 1XMQJ 1JXVA 3PW5A 3G4SB 3F44A 1COWA 2F1FA 5HL7Q 4RW6B 2JN9A 4P9SA 1NK9A 2F1LA 4WK1A 4F26A 2MZRA 3CXCR 1TVRA 2VQFF 4Z4WA 5HKKA 1X7VA 2DGXA 3QLHB 1Q8KA 5L1KA 2A18A 3OTEA 2WZPP 4RDJA 4URSA 4TY8A 4NLGA 1N8RD 4MIWA 4RD1A 2GJIA 3IO1A 3WNDA 3AHPA 3GPAA 1LEOA 3C6UB 3CB4A 2DHHA 3CDBA 5A8KA 3PRDA 2KM8B 5KFZA 4C0OC 1JKHA 3EPGA 4B02A 3CP2A 1KFDA 2RQKA 4F04B 1UD5A 3BYRA 1OB5A 4PYAA 3WBJA 5BYRA 2FLLA 1U2CA 2ACYA 2JVOA 1HR0J 3HK2A 5D3GB 5D0HA 3T53B 1F2GA 2AHOA 2UV8G 2BVZA 4IQMA 2XB2D 4WZTA 3PYGA 3LPYA 3RR8A 1PAEX 4NLWA 3Q83A 2AYMA 1X4EA 3AGPA 1NO8A 2B7CB 4DSKA 4OJ3A 1IBKF 4TMTA 3LH2S 3ITHB 4OJHA 5GAEI 3W5XA 3H4BA 3BQ1A 2VFSA 2VBSA 3I9ZA 2BQ3A 2JL9A 1GR1A 4RJLA 3H0PA 1S59A 1S76D 3S8SA 1OSDA 2WSCC 4TMVA 2KZZA 3MHPA 2JRSA 4KY3A 4Y00A 3TW0A 2BPOA 3DRPB 3IP0A 2HSEB 3W2HA 2VONA 2QMXA 4XONA 1ZETA 2HNZA 2YKNA 4M95A 2B7BA 3MMAB 4HE6A 2Q43A 2HGNA 3M8ZA 1WF1A 4KR0B 4ED1A 3FEXB 1GNKA 4B44A 1P1TA 5IC6B 4C0HA 4ENOA 3W2VB 4EGLA 2MLYA 2KXFA 3CJKB 4XDDA 2B4UA 4DG1B 1H2VZ 1VK3A 3HFZB 4TN2A 5HP1A 2MKSA 4GQNA 1IBMJ 4HDGA 1F9FA 3GG0A 2EFOA 4WXWA 3HHLC 1FDDA 2DHXA 3TQ1A 2XWYA 2D3OR 2DR9A 4K4XA 2KI2A 3BY1A 4AL7A 4W4MA 3CJ3A 4JI6F 3I56B 4EK2A 2IDEA 3PJWA 4XIUA 2EK1A 3D1HA 2D3NA 5ETVA 3NNCA 1AW0A 2R7SA 1IKYB 4TU8A 4WFNQ 2M0GB 4OZNA 1NSKL 2H54B 2AHOB 1BHNA 4E98A 4WTYA 1WTBA 4J9LA 5D3GA 5I4MA 1TTHB 1GMWD 4R0JA 1KWMA 3F41A 3JTOA 4DV5F 5D78A 1D2EA 5CABA 5IT4A 1Q8BA 3QRQA 2XWXA 2L3MA 4B9LA 4B3OB 5L9NA 4CQJA 1S0NA 1X0FA 3ZNJ1 3HFKA 4EH1A 5D77A 2BOPA 3BQJA 4E2FB 1CULA 3HVTB 3MWBA 2LYVA 4WKRA 3IFEA 4NI2A 2VA3A 4H4KA 2XGPA 4B9UA 3ONYA 1U49A 1N34J 2IM2A 3KDNA 4PZVA 1YBUA 3I5BA 3PYDA 1RTHB 3QFRA 3VVUA 4DR7J 1NH8A 4IO1A 2JEGA 3BSOA 1SI9A 4OMFG 3NGTA 2YKOA 2G13A 4C98A 3D3BJ 3EVWA 1RHMB 4YOEA 3CCLS 4XPEA 1Y3KA 3GVKA 4PQAA 1WG1A 3OTOF 4XM3A 4TYAA 4NA2A 3TJ8A 2KYZA 2V2ZA 5E3RA 3RTVA 2AV5A 4IG0A 2D69A 1NK8A 2HURA 5EMNA 4TLQA 1RTJB 3KUEA 4YEAA 1QVGR 4ECUA 3V6JA 2CQGA 2I38A 2O67A 2CKWA 1FNBA 1D8ZA 1URNA 3S7RA 1D9FA 4TNOA 3K0JA 2B4PA 2X6WA 2RMLA 1W87A 1N5SA 2NUHA 3H7HB 3N6MA 2UU9F 3O6QA 4Q8FA 2HHUA 1S72S 1TL1A 4CH0S 1VQ8B 4D3GA 3BEGB 2ASJA 1WHVA 4LRFA 5KFVA 1RHJB 3LQEA 2DR7A 4WQMA 2MLZA 4JB8B 3DOMB 1OY6A 2FVPA 3TVZA 3MD1A 4C8NA 4AUKA 1R3NA 3JQRA 2V7XA 4B3SJ 3UR0A 3EICA 1CNFA 1TL7B 4DQRA 1IQZA 1TKXB 2RF2A 4AF7A 4K2XA 5K8MA 2UUCJ 4YALA 3SSQA 1UD4A 2RUGA 2VG6B 3G6XA 1LK5A 4EO8A 3RJMB 1CPZA 1GT8A 1RT4B 2BGIA 2W9BA 2K06A 5D0RA 1ZA1B 1HL6A 3M8WA 2DEJA 3W2EA 1VRQC 1OO0B 5AN9A 3BGFA 2B0GA 1VQYA 1K73D 3KJNB 4RD6A 3RUBL 1BXNA 4YAUA 1M0SA 3UO0A 4FYXB 1HQUA 2HS0A 4D3HA 1D1NA 2PO4A 3IRXB 4ZP6A 3OVBA 3G8QA 3DI6B 3QE2A 4P7VA 3EE3A 1WC0A 4C6AA 2GMLA 2HFUA 2XMKA 2OUGA 4P6QA 4TYBA 1XMOF 2ROEA 4ETZA 1WHWA 4IFYA 3OQ2A 4QIEA 2RRAA 3DGPA 1MNEA 3CSKA 3EGZA 3CD6S 5FJ4A 1PKUA 3CCTA 1TKTA 2XULA 1YBTA 3J80Y 4J91A 3SEJA 2CQ3A 2CVEA 4K8RA 2XMVA 5FDLA 3JSMA 1YJWB 4CNYA 1G4CA 4ED3A 3BSCA 4TSFA 4NLVA 1WD6A 3BBCA 5THWA 4KFBA 1LWFA 2QLJB 4CDIA 1AB8A 1N08A 3LVBA 1R8PA 1BJKA 3NXZA 2DGUA 5DETA 3KMSA 2MZJA 1Y0YA 1M1HA 2FJXA 4UY85 4H54A 2ZOGA 4QOTA 4M1KA 4NYOA 4DWIA 2X85A 3QT6A 2V7WA 4N8OA 5H9FK 1RWPB 3M8QB 1RT3B 3UNYA 3NKYA 2IVYA 3MUTP 2J0XA 3NMRA 1KTVA 1T95A 3BGRA 1VQSA 5J1EB 1I18A 5LSLA 4CRJA 3M6VA 1N34F 3CP8A 4HHHA 3I55B 5I3PA 3KK3B 4DL7A 4M94A 2ZFHA 5C2CA 1Q82T 1RAEB 2IJRA 4BBYA 2FZCB 3IBFB 1R27B 3NG8A 1UWBA 2W8KA 2I5JA 3W9JA 4EUVA 5CDFA 1U1NA 3TQEA 1BQMB 1RYSA 1T05B 1FKAF 5TR9A 2B43A 2XSFA 4XLEA 2M7SA 4DBQA 8AT1B 3MMCA 2P9EA 2CK3A 3BCDA 2A2CA 3BB5A 4FF1A 1RZMA 2FHJA 4ZVPB 3MI7X 3IS9B 1NJIT 4RD4A 2WVEA 3KK3A 2GIRA 5BSXA 1FRKA 4CLZA 4USVA 2AIRB 5J1EA 4BC9A 4MKVA 1N48A 3HF5A 1FRIA 1EHWA 3ET6A 1WJ9A 4PAAA 4FZVA 4OX8A 4A46A 3RYLA 1QFJA 2CQ2A 1A7GE 1MRZA 2ZOMA 4ELUA 1RT1A 1VQOS 3SCJE 2CQPA 4MK8A 3SQOP 2ASLA 4MKYA 1N56A 3NOCA 3MM5B 2BDPA 3IA0A 1K9MD 2R3VA 4FDFA 1T9XA 4LBVA 3F56A 2F4FA 1HWJA 1LWFB 2VC0A 1VQLB 3CCEB 1IR1A 2P3MA 3KJVA 3L9ZA 1SL1A 1R8HA 4KH0B 3QFHA 2BANB 2HNDB 3JSMB 2QG9B 5FDLB 2ZHBA 1FNOA 1EFRA 2P6TA 1FFGB 2K7KA 1DLOB 4DV6J 1QAJA 2P5VA 4PWUA 1JB9A 1F60A 2JIZA 1VYAA 4OZLA 2AX1A 1K0VA 1GEHA 4DV0F 3WZ0A 2MMYA 2WJYA 3JSBA 4QV2A 1S97A 3PEJA 1E3XA 2QRRA 3TUZC 2V34A 2RDDA 4KGZB 5J2NB 3R5BA 1TFWA 2DR6A 4JI6J 1VQKB 2Q3PA 3PIPQ 3TZXA 2AZ3A 4ZVQB 3M8RA 3W1YC 1T3NA 2C2OB 2KKHA 4RLZA 2DITA 1LK7A 3RW6A 4CP5A 3TVYA 1R5BA 3JB9k 4LBPA 3ZBUA 3DNCA 1VQ5S 3OLBA 1W34A 3Q8VA 2F4VJ 2MQMA 3Q3AA 3DOLB 4PPZA 2J6SA 4EZ9A 1HBUA 5K14B 1RDRA 5DDOC 4USWA 3RB6A 1SBRA 4KPYA 2BJ3A 1S1TA 2KRRA 3QZ7A 4FXVA 3M2VB 2VG6A 1JQGA 3AFGA 3LQVA 4IKAA 2Y1IA 5KFAA 3A3OB 5KFKA 4QWDA 4DL2A 1Y00A 5E7OB 4CO1A 5MAOA 1TUWA 3RRGA 4X07A 3FCVA 1U1KA 2J6TA 1K1QA 4J9KA 2GX8A 2XY5A 4W90B 4XLCA 3VQTA 3D67A 1N4LA 3I0RB 1CS4A 2ZUGA 3OR2A 3ZZYA 1IKWB 4Z7YA 1JLBA 1YITS 2AYEA 4CM2A 4DQPA 5F0UA 3OPKA 4BS2A 1JLEB 4DNRB 3UVJB 3VZHA 3CCZA 2B4VA 3VO1A 2FD2A 3T6BA 2LXUA 1S0UA 4NXMF 2OTLS 2AX0A 2OPQA 3PACA 4JI8F 2J7WA 3NCPA 2KG0A 2Z2MA 2PA3A 1SJQA 3GCXP 1B7FA 4C48A 3FSXA 3JQJA 2DKOB 5IC4B 3CD0A 4H9GA 3HAGA 2Z2ZA 2XY7A 4JV5F 2DNMA 5LMUF 2ZM6F 2YKQA 2KFZA 4XKVA 1MWZA 2VA2A 2DHAA 3KWMA 4OPOA 4IG0B 2OPQB 2BZ2A 1H73A 3FCWA 4Q43A 4G6VB 2FJVA 2ZHOA 2DEIA 4NCBA 4BCAA 2GVDA 3UVJA 1FTRA 3HJVA 4JI5F 4HEA9 2WZNA 4OHWA 4OX9J 4RD3A 1F0XA 3LP2A 1SIWB 3SJZA 4OZ0A 1HA3A 4LBIA 5D4OA 4LF9F 1W0KA 2NXJA 2N4CA 4IRKA 2AMCB 1N05A 3AJ2A 2LXIA 2BKOA 4HL9A 1CULB 3BKFA 2XOKA 3HVTA 4DV2J 4DV7J 6FD1A 1QGAA 2HFZA 2VIHA 4DR3F 1BGXT 5B08A 4B4DA 4ECQA 3M2VA 3OXLA 1J27A 4G1PA 2E66A 4U67Q 4B3OA 3RG6A 4HT7A 5HROB 5K14A 3NOGA 1RAIB 1Q86T 1W35A 1TUVA 2DO4A 2H51B 5F8LA 4TVAB 1UTAA 2M8DB 1HNXF 2KH9A 4TU7A 1VQOB 4OFZA 1LQ9A 5H59A 1J5EJ 2VU5A 1DZ5A 1NU4A 2XZDB 2EI5A 3CC4S 4B9MA 4RNNA
chains in the Genus database with same CATH topology
1FD8A 5D4NA 3OL7A 4TT3A 5H9FJ 1S49A 2ZH4A 2EVZA 2YX1A 1ZZNA 2XCAA 2RDJA 2DK2A 4RW8B 3H40A 3DLHA 4O3NA 5EGYA 3GR1A 3QIPA 5A8WB 3MR2A 2ZZNA 2E1MC 3CMMA 3OTCA 1LW0A 1HHSA 1N0VC 4LT6A 4BWMA 5IT0A 3K57A 5DLFA 3UCUP 1KRPA 2IBKA 5CZVA 2KG1A 2FTRA 3DRRA 3I4HX 4ZP7A 4ECVA 4L8JA 2R7WA 1NJWA 1JLFA 4RW7A 1JJHA 2ZXHA 1K1SA 3Q8SB 2JLGA 2HHXA 1HNVA 4QIFA 3U1NA 1WG5A 2OKQA 4QR2A 3JAMY 3PKYA 2D7SA 3LAMA 2V2KA 5B0EA 3KLFA 3JSRA 3U27A 2FPHX 3GSIA 1IJEB 2V4JA 1NK7A 3QAUA 2MB0B 3MMBA 4Y0FA 3NCRA 1KR4A 3QIDA 1XR6A 4I2PB 1C1BB 4MK9A 3T19A 2C42A 3C66A 3VAJA 3HT3A 1FDBA 3PW7A 2JEFA 4E0DA 4H4MB 2IA0A 1XNRF 3QLHA 3R27A 1HQEB 3S01A 5KT5A 1WNEA 5CH7B 1AXQA 1U47A 1TVRB 3DLKB 2HGLA 3I4PA 4YB1P 1OB0A 1JLAA 1NEEA 4II2A 3SCLE 3KJVB 4C8LA 1JLEA 2FJBB 2GHVC 4NYZA 2DH8A 4WU2A 3TA0A 3CF5Q 4ECZA 5L8RC 1CEZA 5C25B 1SH0A 3P49B 1L3TA 3PX4A 4XNFA 4EBCA 1RA7A 1JLCB 4OZ5A 4WE1B 1JLBB 2OLWA 2N4DA 3ENVA 3BGLA 1SKSA 4A8QA 3L7OA 4QYRA 2CRLA 4ICLB 3TAMA 5CD4H 3ICLA 3OR2B 1K0TA 4YFUA 4XOTA 5IM0A 4ILRA 3SCIE 2NLWA 4NLUA 4PG8A 1LXNA 2ASYA 1NJXA 2CQ1A 2HLDA 3CGIA 4QWCA 2JC1A 2K7JA 4DLGA 4A8SA 1KFSA 4CO4A 4X4OA 4NX9A 4ECWA 2B7BB 3H8YA 1SJ3P 2YKNB 1VQ6S 2Z8QA 2MQLA 3E51A 2E44A 1E3ZA 3N28A 3GIRA 2HNZB 4G1QA 2PFFB 2GMJA 3QWUA 4Q8EA 4WFYA 3PHEA 3NGDA 4Q0BB 1N32F 4CCHA 4ZP9A 4URGA 1DAXA 2AJ1A 4DV2F 5KFXA 2VBZA 2MJUA 1PJ5A 5KG3A 3K7RA 4BC7A 2X1AA 1Z1ZA 2CQ0A 2DNOA 3SSSA 3T1HF 4H4KC 5E5NA 3EXCX 3SQGB 2GQQA 4M5DA 4JI3F 3VTIA 3K5NA 2WSEC 4O23A 2XMJA 2KZMA 3NAHA 1UVKA 4F3QA 2V4DA 1O5JA 2CJKA 1R8AA 1S77D 3MR5A 1RKIA 2FLOA 3M32A 1VQ9S 4LVOP 4OI0A 2RD5C 3D1OA 3DHXA 1W25A 3IBWA 1UL3A 1YHQS 4O4GB 1S1VB 2J0SD 2OPSB 1S1TB 1HI0P 5E41A 5A0YB 2NXUA 2F8EX 3IS9A 4DOZA 3ZZZA 1VRTB 3KMQA 4Y65A 4QW8A 4R8UB 1HBUB 2CJAA 3DOLA 4NLSA 4X4TA 2WONA 2LEAA 3M8PA 2JWNA 3DDNA 3UW1A 2JJ4D 2R2RA 1X4AA 4LFBF 3MGJA 4XDCA 3SMZA 4PQUA 4Q2LA 3OOCA 3HLUA 2EG2A 5I3UB 4DFPA 4IG3A 1MROB 3O2IA 4XOPA 1RTDA 1OHHA 2X8KA 4C8YA 5ITHA 2ZH1A 3NS6A 5I42A 3BSNA 3JSYA 1GXUA 1B0TA 2GQ2A 4ZPCA 1WTFA 3HVAA 2FUG9 5KFGA 4GC7A 1DFDA 4KBIA 2C3UA 2GNKA 1FJ7A 1R6YA 5DN6A 3FZ2A 1KVJA 2MZQA 2GMHA 2BM0A 1WACA 5J1NA 3GYNA 4PKDB 3H5YA 4DSEA 1ZBTA 4WF9Q 4PWDB 1HVXA 4J9OA 1FVSA 2DTJA 1XNQF 3J7A1 3BR9A 2IC3B 1K9MT 1YRUA 5F3ZA 4IO9Q 4DUYF 2DIEA 1RISA 4LSNA 1DTQA 2NPIA 4I4BA 5CZXA 3U02A 3QGHA 2LEPA 5KT4A 1XK8A 2WJVA 4WFAQ 4J9MA 1JX4A 4LFCF 3CWJA 3LWMA 2ZKUA 3F73A 5LT5A 1QAXA 3MZIA 1M90T 1NNDA 2OO4A 4IH7A 2B5JB 4OX9F 4HVZA 3CMES 2BW2A 4NA3A 2K1RA 4OLOA 1JKHB 2IRYA 2OD6A 3VR6A 2MHEA 2WB1D 5G0RA 3FMBA 2YQ3A 2XNDA 2FC8A 2BABA 2ALZA 2PT0A 1WF0A 3Q8RB 1FXRA 1VGYA 4F4WA 2IYGA 2C3YA 3T1YF 1VIXA 3C6UA 2KRBA 2ZJPQ 2GHPA 5F8GA 1H8HA 1N54B 4TKTA 3K2YA 4XN3A 4IRDA 1F60B 2RQMA 3OBIA 4OL8A 2F40A 3MR6A 4OX6A 2YY3A 2FGCA 2RH3A 3ISZA 2J6UA 2I0XA 2PMZD 3FFIA 4C11B 4ZHRB 1D1UA 3LOUA 2KXNB 3IXQA 5LMNF 3HM9A 4ZDNA 4K4UA 4CZCA 5KOXA 4PXDA 4IDKB 4C2MA 1KC8T 2CPFA 2WOMB 1GTEA 3GR0A 4ECXA 1KLNA 1S48A 3PRBA 1TKDA 1ZM2A 1WG4A 3KHRA 4EYHB 3M2UA 3KLEA 2J8AA 2WTFA 5E3CA 3BDEA 3G71S 4AXJA 3OFNA 3K5OA 1C0TA 3CJ4A 1VJSA 3BN7A 1SJFA 4JV0A 1NB7A 1X9MA 3ONQA 1N0UA 3QGGA 1Y9OA 4PR6A 2NZ4A 3O44A 4ZPWR 2HHPA 5IXUA 1ZPVA 4DDFA 5KG5A 5GAGU 5K8PA 4IOAQ 1RT6B 3AY0A 5IQQA 1RI7A 2VPYB 3MM5A 1ZM4A 1FTCA 2VG7A 2DNRA 1N88A 1B64A 1VBYA 2F43A 4WYLA 1HW8A 3CE8A 5EUHA 4XLFA 4O44A 4DPOA 2QA4G 2XBPA 1S10A 1GQEA 1WF2A 3HPOA 1LKZA 1HBNB 2V5HG 2ZH7A 4J9QA 2LXFA 2XS2A 5F9NA 3TI0A 4I69A 2XS5A 2DH9A 2VPWB 1VRUB 2Q79A 2V4QA 2ZJRQ 1RT1B 3MTJA 1T3OA 4GKJF 2M5YA 1XTZA 4KV8B 3OE7A 3DM2A 3FPPA 4LUBA 4ZPAA 2MDAA 1WP6A 2AP6A 4I7FB 3FQKA 2OH2A 3A1YG 4G3IA 1S0VA 2Z6BD 5A8RB 3DLLQ 1HARA 2DNKA 2LU2A 4JUZA