1VLYA

Crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
323
structure length
323
Chain Sequence
FTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLHIEPLPYSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Unknown protein from 2D-page
publication title Crystal structure of Unknown protein from 2D-page (Spot PR51) (b2898) from Escherichia coli k12 at 1.30 A resolution
rcsb
source organism Escherichia coli
total genus 84
structure length 323
sequence length 323
ec nomenclature
pdb deposition date 2004-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.160 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1vlyA03
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1vlyA02
3.30.70.1630 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vlyA01
3A8JA 1PJ6A 4PABA 1WSRA 4PAAA 4P9SA 1NRKA 3A8IA 1WOOA 1PJ7A 1WSVA 3GIRA 1WOPA 1VLOA 3A8KA 1PJ5A 1WOSA 1YX2A 5L46A 1V5VA 3GSIA 1VLYA 1WORA
chains in the Genus database with same CATH superfamily
3QT8A 1V9OA 2XGQA 2KH9A 3CC7S 4DZ6A 1CC8A 1CJVA 1VS3A 5B7WA 3HLUA 2HRYA 2QC3A 4DV6F 3CCMB 1LWEB 1NNDA 1C0TA 2BE9B 3T5HA 4YB1P 3LP2B 4O3RA 2YKNA 2LFVA 3PVXA 1WKLA 3EXCX 1XMQF 2B7BB 4QVJA 4JOUA 2PD1A 1SB6A 1WU8A 3PCOB 1HNXF 3DRPB 3NRBA 1NKBA 3DLGB 2G13A 3PHTA 1XJWB 3K8WA 3O1LA 5HZBA 3HT0A 4QFMA 1S1UB 1YITB 1W25A 5GAGI 1YI2S 1AYEA 3BY1A 3R9LA 2HHQA 5KG5A 4OYIA 2P9EA 3GMGA 4IFYA 3PENA 1Y5IB 1T0TV 4J37A 1VQPS 2ZH9A 3CCUB 3DYAB 3GFXA 3NGSA 4ZPTR 2W1BA 4K59A 2AYMA 4Q8EA 2D74B 3DRSA 4LF1A 1IBMJ 2VQFF 1VOMA 4ER8A 4ICLA 4RU9A 1TUGB 2B9YA 3CDEA 1EP1B 4TLQA 2XCAA 3IMQJ 3MCMA 2BJEA 1YBAA 4DJBA 2Q6LA 2Z30B 2W8KA 3THPA 2ZUGA 4YY3J 2G2OA 3D68A 4Z2XA 1RP5A 5CYQB 2CA9A 3BCFA 3Q8UA 1GAQA 1T3NA 1UZDA 3H4DA 1S0UA 4J9SA 3KUHA 1Q86T 2KU7A 1CS4B 3IGVA 3TR5A 3AA9A 1SJFA 3OAAA 3D6MB 4W92B 1AT1B 1N8RD 4ID8A 2DPIA 5MAOA 2FZKB 3SV4A 3OSPA 1N88A 2HIYA 5GMDA 1FI4A 1Y0HA 1NUEA 3GVKA 3T1YF 2Z2LA 4DL3A 4F7VA 1VQKB 2VNJA 3IAS9 3KK3A 1YSJA 4FYDA 3Q2TC 2VG6A 3MMBA 4EO8A 3JSYA 1S12A 1QGZA 5A8KA 3TARA 1WD6A 4XKVA 4LIRA 1NK6A 3JSRA 5AE2A 4KKUA 1SJ4P 3NGDA 1M5VC 3HHNB 1ZA2B 1N32J 4GRSA 2H48B 1UPMB 3GU0A 1SUQB 3WDOA 1WC5A 3L9ZA 3HXMA 4YEAA 5RUBA 2VUGA 3NS5A 1M0SA 2L48A 2MZSA 1UW9A 1N0UA 2C2RA 3VZIA 5IS2A 3OUYA 5A8RB 4PRFA 3EGVA 2XNJA 1S1WA 5D0EA 4ILMA 4I7FA 4DWIA 5F4MA 5IM0B 3RBEA 1RTDA 1LK7A 1S9EA 2EKNA 1IKYA 2LQ5A 3KUEA 4X4UA 5HJXA 3BBCA 4IH5A 1XNQF 1YTYA 5KG4A 3PX6A 4DR3F 3UDEA 2CZ4A 1RAIB 4L76A 3AVWA 4F25A 2FC8A 4DV3J 2Z56B 4F4YA 4B43A 1C0UA 3SSRA 3M8WA 2GQFA 3IWNC 4J9OA 1GTEA 4XL9A 4P2XA 1KLMA 4JYAF 5IZHA 3PZPA 1LKZA 3CCSS 5BJRA 5IYQA 4M5IA 5D0GA 2CZ9A 4JI4J 4KYZA 1M5HA 2BKNA 7AT1B 4HH1A 5LL6d 4M5DB 2C2KB 3DLHA 5F3TA 3ILLA 5K8MA 5ETQA 4ED0A 1T95A 1N54B 2M8DB 2JN9A 2AX1A 4YDXA 4QOTA 4KV8A 4JV0A 2YNHA 1D1NA 2GVDA 1FDBA 2KI2A 2MZJA 1NSPA 3CMAS 5DG8A 4PC3A 3SQOP 4ERDA 1FXDA 4YB6A 2E1MC 2XWXA 4QWAA 4X06A 3DM2B 2QA2A 2W9CB 4CCHA 4N8NA 5F3ZA 1UP1A 3KHGA 1VQOS 3CD6B 5KNLA 2EFVA 4B4DA 2WSSA 4ANCA 2QRRA 4OZNA 3NBPA 1CVJA 2B7CA 2W2QP 4M5GA 2W8LA 1YJTA 2GIQA 4OHXA 3MAAA 1R8BA 4YDDB 3D1HA 3U2QA 4XMYA 1PYTA 2FHJA 2P5VA 2OTLS 1ZTWA 4M53A 3ENAA 3OFEA 4B02A 5AE1A 2DR5A 3I82A 4FNIA 2HRUA 3TNVA 1PJ7A 4MKVA 3RGIA 2V7VA 5LSLA 4DQQA 1S0OA 3VGUA 1VHOA 1N34F 1L3KA 2RD5C 3CNQP 4QQBA 4KHPF 2QO3A 2KT5A 4DV0J 2RC6A 1PKVA 3HCXA 2W7PA 4FPRA 2AF6A 1RYSA 4DR5F 3OT9A 4XONA 2KTQA 4TMTA 2MQMA 3SFUA 3W2WA 2RSQA 2QA4G 3BF4A 1GMVA 4LFCF 4MIWA 4KHMA 3V6HA 3FVYA 2WJYA 2ZL7A 1W26A 2JJ4D 3W3SA 1JNYA 4ETZA 3KL9A 4ZVEA 2J6UA 1VRTB 3CP2A 4I6WA 4NLDA 3GPAA 2C78A 4JP8A 3QJLA 2D9RA 3KLIA 3EVWA 2UXBF 3N79A 5F8GA 1AFIA 2IRYA 2W9BA 1Q1KA 3P49B 3SSSA 1N08A 4LR9A 1HKAA 3LP0B 4KT0C 4QVAA 2M8HA 1PAUB 2WHOA 1UD3A 2HGNA 2HPUA 1X5PA 3LWMA 1S76D 2JOQA 5E0OA 2ATCB 1CJTB 1ZPWX 4OYZA 4U6PA 3DXBA 1NPKA 5B08A 5M2PA 3D26A 3HO1A 4X7DA 4ZK7M 2ASDA 2LVWA 1F0XA 1HNVA 5CHCB 3GE9A 1EQMA 4TNOA 2HNDB 2H5IB 4FDFA 3VR1A 3EPGA 2WSEC 4XPEA 2DNQA 1VQ4B 2R7VA 3J81j 3GQBA 3PVDA 3Q89A 2DCLA 1SIZA 2K7JA 3V6JA 4HIZA 3QGPA 4RUBA 3MHYA 3H59A 1OMSA 4GVLA 1DAXA 4HACB 3BKFA 3GZ7A 2BMWA 4DK0A 2XWYA 2E1AA 4XLAA 1UEUA 1OGJA 4QUZA 2GAHC 1QSLA 3KG4A 1JB0C 5B0GA 2RC5A 3BC9A 3W1YC 4AE5A 4CQJA 8RUCA 1ROFA 3X3UA 1S7HA 3NWGA 2UVVA 4F36A 4FBTA 1ZM3A 2FJWA 1N5YB 3D3CJ 3UCUP 1RWOB 4X62J 4K1XA 1VQ8S 1N06A 4C3LA 3DLKA 2NXEA 2EBEA 1XFOA 4G3IA 4OIXA 4ZMMA 3W5YA 2AGQA 3OVAA 2CXEA 1X9WA 2VB6A 3Q8VA 2FLPA 4TKTA 4ZVPB 4ZIVA 5KFQA 2KO1A 2E5GA 3B4DA 4DZDA 1JA1A 4CLYA 5DDQC 1Q8BA 3H25A 2BF4A 3OTBA 1KFDA 3VGSA 3PX4A 2JIZA 3OVBA 1FRHA 5H9EJ 2W9AA 5IC6B 1VR6A 4DL0C 2KYZA 1PSDA 2YWEA 5FIIA 2KT2A 4GC6A 2O67A 1LXJA 1FRKA 1FRJA 4EBCA 1VIOA 2GMJA 2KYXA 4CH1A 4USIA 1X4FA 2GO8A 1GXLA 4OPSA 1HHQA 3LTOA 1N8RT 4DNTB 2ZKUA 1X5SA 4X4SA 1JJ4A 2V4RA 1T02A 4LF6J 1BX1A 5K8PA 4B9TA 1GT8A 3C14B 2FVQA 4PWDA 1VMBA 3WZ0A 4XLCA 4ID5B 1FX2A 2QJ3A 3Q8PB 3UR3C 1RQRA 3AD9C 4LSLB 2WAQD 4ECZA 4CLWA 3BNWA 2NLWA 3NXZA 1KD1D 2VOOA 1FKOA 2LQJA 4ZPAA 4LBWA 1VBKA 3RB3A 2V6AA 3SQGB 2C3YA 2IM0A 3B6BA 3PM9A 2OK8A 3GJTB 4OL8A 1MN9A 1RT4B 2XMKA 3SDEA 3IP0A 4QW8A 4B3OB 5ETRA 4RCZA 4LMZA 1FFSB 2Q6OA 2WOMA 1AROP 2RRBA 2KHCA 3NGKA 3JQPA 4EBEA 1PBUA 2LA6A 3TP2A 3GG0A 2NS1B 2QEXS 2FY8A 3CW2A 4R0JA 4ECQA 1WWHA 2CQHA 2EK1A 3EZUA 5HAOA 2CQCA 3FBCA 4M5HA 4U95A 1JKHA 3CCRB 4TT3A 3QBCA 3M9MB 1UFKA 3TZXA 2J7UA 1L3TA 1HMVB 3C19A 4QU6A 2ADCA 4XO0A 4K4VA 2CQGA 2YKMB 4PG7A 3ZO7A 4EO6A 3DLBA 2HS3A 4G1PA 1H42A 3PY8A 2OUGA 1OS5A 5FD1A 5E7OB 4Q2LA 4ZVGA 1S1TB 1TKXB 3Q24A 1S4EA 3DGPB 2C2MB 1B70B 2R7WA 3IRXA 5LMUF 4B47A 3K5NA 4RW4A 1H8HA 2RKIB 2H1YA 4Y0FA 4L73A 1NDHA 3C15B 3E20A 2BRLA 1CJUA 4OZ5A 1V3ZA 4CLKA 2LU1A 3GCXP 4NLYA 2YNIA 5F8MA 1KMHA 1X9SA 2VV5A 2QGGA 4YHBA 3TVYA 3WYAA 1A0OB 3UD5A 2KFNA 3H4BA 2D41A 1FF2A 1YJUA 2D3ZA 2YPYA 3AVXA 3PFOA 4PG8A 3GVLA 2IC3A 4W98A 3BB5A 2WB1D 2OYNA 4B3RJ 4KPCA 4XORA 4X64F 4KAIA 3TA2A 1CJKA 2HNZB 4USKA 2HHWA 3UDLA 4L3KA 1H85A 4F02A 1FNMA 2OPRB 1HBNA 4YB7A 4ACAA 5CCLA 4TQSA 2DBBA 1NAQA 4LSNB 3EGNA 1JB9A 2OP5A 3HHEA 4AYBD 3PUNA 1JLAA 2HG4A 3WQPA 4ACBA 3QSIA 2YBVA 3FPKA 3BO4A 1NJYA 4CLUA 1JLGA 4DS5A 1I1GA 2HWIA 4CDIA 4C8NA 3KJQB 2I5JB 1TFYA 1M5PC 1VRUA 1Q79A 2OTJS 1SKQA 3DGVA 5KTQA 2GK7A 1NJWA 3GG1A 3RBXA 1TKTA 1FCAA 4LF7J 3N6MA 4ZDNA 1WEZA 4RW6B 1VK3A 4GO7X 4GVBA 4RX6A 1JIHA 3G8TA 4X4OA 1KP6A 1IBLJ 2IA6A 4F4WA 4ASUA 4DV6J 1XTZA 5HKKA 3KLHA 3OFGA 2XYPB 4ED3A 4NLTA 2VASA 4V19X 1YQHA 4O0NA 3G71S 3F56A 1X60A 2J0SD 4WFNQ 3KXDA 3LH2S 1GFWB 3HHLB 2HWTA 1U8WA 1PO6A 4AT1B 1OYEA 5L1JA 3TA0A 2F9DA 4K4XA 3A8IA 2MHNA 1YLOA 3BGLA 4EUVA 1BC6A 1OB2A 3QFTA 5FL7A 2V2VA 3OR1B 3NKYA 4F4ZA 1M5OC 1K9MD 4OOSA 4RJVA 3ENQA 3P8BB 2HFNA 1LWFA 2ZITA 1NDPA 4A8XA 1U6FA 2GVZA 3QGIA 5A8WA 1U1QA 1RAJA 1TAQA 2GJIA 2C2NA 2GJRA 3GONA 3CESA 4TMXA 1S1VA 2V8GA 4CLSA 3ZZZA 4QYRA 4ELUA 5KFAA 3G9CA 1P1LA 1S6UA 3BKUA 4NCAA 1TUVA 1SJQA 1RT6B 3TVKA 1VC6A 1NDLA 4LJMA 3QJJA 4O23A 2KXFA 2PI5A 2F43A 2ZEJA 1QAJA 4YHHF 4DV7F 4P25A 3QGGA 5HL7Q 2GMHA 1B2RA 4RD6A 1CSJA 4P2MA 2BVZA 1URNA 1RT7A 3BQ1A 1EAYC 3ZZYA 3T1YJ 2DJWA 5J2MA 2C4UA 4X4QA 3E8OA 1YJNB 2NPFA 1RT1B 1F5CA 2RHSB 2MQPA 2F63A 1RA6A 4LVOP 4NOHA 3R5DA 2CPYA 3MMAB 2CQPA 2IMOA 3OHBA 4DV4J 2RU3A 5LMZA 2OSRA 3U02A 2G1HA 5DO2A 1VK8A 1KQSB 4PAAA 1KK2A 1YJ9S 2A0FB 1P4MA 5D0RA 2W4CA 1RTIA 1Q5VA 1IBCB 3GV7B 3VV2B 4ZP9A 3HSJA 1RWUA 4RWXA 5I4MA 2D3O1 1H2TZ 3GSIA 2YH1A 1VIXA 1OSCA 1RWPB 1PJ6A 2A6OA 1WTFA 4I4BA 4UAJA 2YQ3A 1IQZA 3KJVB 1FXRA 3O8WA 4OX8A 4EI2A 4P73A 3UWTA 1ZS6A 4Y3CA 5A8AA 4ROXA 4NXNJ 1EARA 4HT7A 1NRKA 3EGZA 2B5JB 4M5NA 4DR3J 3P27A 3D7SB 2W7OA 5D6GA 1T7PA 4PQAA 1VLYA 2B8PA 3MPUB 1HZEA 1SJ1A 1NJID 2VJUA 1FX0A 2JDIA 1VBYA 2E5HA 4C0BA 4FYYB 2XS2A 4Q0BB 2O3DA 3OW2R 1FNCA 1DG1G 3DKDA 5F0WA 4O3NA 2NV4A 2WZNA 1DTTB 3DDIA 3MPVA 2CVEA 2V7WA 1KK0A 3MWBA 2DR6A 5ETKA 3SIPB 2EC0A 4YFUA 5J2PA 4OHZA 3AVYA 2BA9A 1RHRB 2UU9J 2ZC4A 1DTQA 1M90D 2CNKB 2J0XA 4P7VA 2XM3A 3PW7A 3D6TB 3D54A 3TX8A 5IQQA 1FFGB 2PEBA 4N76A 2R8IA 2VODA 2HW3A 4P2SA 4XLHA 1KLNA 3W9JA 1RACB 3SFGA 4LF2A 1HA1A 1S59A 4NYPA 2CC2A 1X5TA 1Q8IA 3CC4S 2C2ZB 2LZJA 4FBUA 3UPFA 1Y7PA 4XIUA 3ENWA 3QRRA 4KBIA 4XD7A 5HVGA 4P3YA 5DQIA 2ZXHA 4LF8J 1ZTTA 3MEKA 3JB9k 2LXFA 3DDKA 3N9UC 5A0YB 1T5EA 4Q5VA 3QRPA 2F1LA 4FKXA 1NKCA 4IO1A 2QN6A 1NHKL 2UZAA 5D8HB 3WBJA 1SL1A 2HKEA 1R8HA 4JI0F 1NM2A 3DRRA 3W64A 4CH7A 1VGYA 3ILOA 5F9NA 1GXTA 4Z4VA 5IWAJ 1I3OB 4PUOA 1E3XA 4WZLA 2IFXA 4HE6A 3M6VA 3EX7B 2HVDA 4UZBA 4AQYJ 4RDJA 3LNNA 5SUHA 4OX7A 1KC8D 2DIVA 2JEIA 4UW2A 1TV6B 3I0RA 3ZZRA 1EX8A 5KFSA 5IT0A 4WQMA 3DCAA 4DSJA 3LVBA 4FYWB 4AFFA 1TVRA 1FWKA 1W2BB 4X4VA 1CQNA 5CZVA 2UXBJ 2UXDJ 3QLHA 1RXOB 4CRJA 2W4PA 2Y1LB 3DMJA 3PKMA 2CVIA 3KJNB 2AZ1A 1F1BB 2L9DA 4WK3A 5CQGA 4OI1A 2XC9A 4YAOA 1RT3B 3J81k 4NRUA 5KFTA 4OLOA 1YHQS 5C25B 2H9ZA 3W2GA 1GQEA 3NS7B 4WIIA 1FHTA 4I68A 4JV1A 3A4TA 3CCES 1Q95G 4HI2A 4DCJB 2HGLA 1Q78A 2G0IA 4HLBA 1TL1B 5T7LB 1VBZA 4X4RA 1E79A 2CBXA 2RUSA 4ZVHA 1RAAB 1DLOA 4WPAA 1QGYA 4CNYA 3H5YA 1FK9A 3N01A 4GKJF 4XM3A 3R7SB 1W2IA 1KK1A 2XSJB 3D4JA 4ELVA 2XHWA 4DCPB 2W2MP 2P9CA 2XMVA 2BQUA 1HNWJ 5EUHA 2MZRA 5E2QA 3BREA 2X51A 5D4OA 3CIZA 1TU0B 3OJSA 2E66A 3FRYA 2BPOA 2DETA 2X3DA 1C0TB 1JXEA 4Z37A 5G4DA 2YKNB 3VVTA 4BPRA 4CIOA 1BMFA 4G1IA 2G1DA 3DHWC 5KFRA 4JI5J 2DGTA 4Q7AA 1D9FA 4JI8F 5DZ6A 4ANDA 2UUBF 3HZGA 2R9VA 3PACA 5DM6Q 1MG7A 2F3JA 2N4DA 3L7OA 4JV5F 3ASPA 2R7SA 3KLFA 4IFYB 3ES9A 1M1KD 2J7WA 4FF2A 1XK8A 3H5SA 4UOCA 1TL7A 2ZNYA 3MR2A 1G4CA 1RISA 3GIMA 1P9YA 1FO1A 2DRDA 5LMNF 3QFWA 3IBFB 1N4LA 4ICLB 4QIEA 2X1FA 1KDNA 3CCVB 1JJHA 1N36J 2XHCA 1T05A 2SXLA 2Y3YA 3JSMA 5F4OA 4PWWA 3E3XA 1X7VA 4QPXA 3ETOA 1EP2B 2E1RA 2PMDA 3BQJA 1ZAWA 2PC6A 3ONQA 4P6VF 3CVKA 3CCTA 4CM0A 1TMJA 2R42A 1AZSA 4HVZA 2EIXA 3WNBA 3PXGa 2VBVA 4HHHA 5B0CA 1NJZA 1NEEA 2HHSA 1K8AD 1WHVA 1E1QA 2MXYA 1F60A 2YXLA 4IYQA 3KK3B 4YXWA 3QMQA 2JSXA 2DNPA 2VG6B 3MMBB 2ZZGA 4DV2F 5A8KB 2XY5A 3BY2A 1GVHA 1SC1B 4O3SA 3GFZA 2C42A 3A13A 5CZXA 4MK8A 4OHYA 3E01A 3BPDA 4NLQA 2KG0A 4F8RA 2ZH8A 4RW7A 3OP1A 1VQMB 1RHKB 3ZZOA 2NZCA 5GAEU 2C2WA 3PJ9A 4U8VA 3AAWB 2HYIB 3MM8A 4X66J 3FRZA 4P74A 1UMKA 1QAYA 2HDNB 4KGXB 4YUDA 5F8IA 4QV2A 2WBRA 3MUTP 1P6TA 2R7TA 2R2TA 1AMOA 3EYZA 1S1WB 3UN2A 2W4DA 2DIEA 4I7FB 1RTDB 1S9EB 3MR6A 1IKYB 3I0SA 4OI0A 2MQLA 3PIOQ 4JUZA 2P9GA 1Q82T 3R7NB 1NJIT 1J5EJ 3JTNA 3ASTA 3BQ2A 3A3OB 1U25A 4O44A 1WORA 1S72B 3ZTSA 2OELA 1C0UB 2JVOA 2R7XA 1R0AA 2CRVA 3K5PA 1R8CA 5IYPA 1BQMB 4N3GA 3Q0AA 5E33A 1KLMB 4G1QA 2GREA 1SV5B 1X4CA 4HT5A 1TKZA 2OIHA 4OYMA 4DSEA 5M2RA 1UPPA 3O2IA 1BWEA 3TJAA 5LMUJ 1U7LA 3NCRA 1WSRA 1EFTA 2CPIA 2OMLA 1RKIA 2AWZA 2XBPA 4OI4A 1WOPA 1T03B 2ZL6A 1U1LA 2YWFA 3PR4A 2GHVC 1R43A 4OV6A 4KO0A 4FP9A 5KFOA 4B08A 3PA1A 3GQCA 2RQMA 1S57A 2PE8A 5DQGA 2GVDB 4ZLLA 2XI2A 1ZH5A 1NLKL 2BDPA 1RHJB 4OOVA 3LPYA 2DR7A 2L9NA 4M0LA 1P1TA 3C6UA 4DSIA 3VWSA 4N41A 2G4BA 3RY8A 5KFNA 4ES2A 4X64J 4K4UA 3NBPB 2B7CB 3UCZP 4NASA 4O3OA 3WXMA 1HQUA 4M63A 4NLGA 4WE1A 3H2VE 3MAAB 3M2RA 5EDWA 1OO0B 1MMNA 3G6ES 5DDRC 2OMOA 1VRQC 3PW5A 1Q0NA 2HSEB 4Z4ZA 1EKRA 4ANEA 1U09A 3F73A 1IJEA 4B3GA 1VQNB 2EG2A 2X1GA 3W5UA 5ETSA 1Z1ZA 3KKFA 1N33F 4FXWA 4BLGA 2VNKA 3UNGC 1S0NA 2ASYA 4NLPA 4OZ1A 4ILLA 2JFDA 2VYQA 4B17A 4LF9J 4J5OA 3CB4A 2OSQA 3MEGB 4CO2A 2NXJA 3CXCB 2QIFA 2NREA 2GQ2A 3ASSA 3IXQA 1PYOB 1G3OA 3SI8A 3VAFA 3SXLA 3R6KA 1U6BA 1W9XA 5H59A 1Y5NB 4UZFA 3W2WB 3FJOA 5LXRA 4MK9A 3R6LB 2UP1A 4B3TJ 4IG0A 1FRXA 4YQWA 3MDFA 2ZH3A 1IBMF 1EKSA 3I55B 2FVGA 2BW2A 3JQQA 2RB7A 1FWPA 5IYNA 2MGZA 4P1VA 2I8EA 3FCVA 1NH7A 4K5RA 4LF5J 3D0GE 2KRBA 4QIWD 2Y1IA 4PC7A 5T41A 1PILA 1NSQA 2ZBIA 3CCJS 2AGOA 5TR9A 3T41A 1EWYA 3IN5A 3KLIB 5KFLA 4YY3F 2Z2MA 3VAMA 2E5IA 1X31C 1HBMA 4HTJA 2W9BB 1BPLA 3CWJA 4II2A 1UVNA 1FD8A 1FE4A 2DNGA 3M8SA 5GAHU 3UN3A 4I67A 3MAHA 3CCUS 1G7RA 2Q1LA 1FNOA 2YX1A 2Z8QA 1MROA 1WEXA 2MKKA 4NA1A 4ZHRA 3FNNA 4DQPA 2KHDA 4WKRA 2RILA 3ULHA 4ZVSB 2EWHA 3CO9A 1CULA 4P71A 3GTYX 1FVQA 1BD6A 2GK6A 2DY1A 1HNVB 2GHWA 3CD7A 3BPSP 2HLUA 1HWIA 3D1OA 2EXUA 2CQ4A 2ZVSA 4F4KA 3V4IA 3ILIA 1PKUA 1HVXA 2F1FA 1NKEA 3ET6A 4D3HA 1BE4A 4DV7J 5KFJA 1PG5B 1XEZA 4P26A 4RD4A 4U9UA 4DF8A 3CTRA 3CJKB 5AE3A 3US5A 2J76E 4LFAF 1GK8A 2OPPA 1VQKS 2XOKA 4K2JA 1BQXA 4A8KA 4ED1A 2PDAA 4DFJA 1P27B 4H4KC 2W2NP 1RZMA 2JC1A 3HHLD 5HROA 3ZFVA 4KH1B 5K8NA 5BYRA 2ZE2A 3DLKB 2I1LA 2OBRA 1CLFA 1C1CB 4Z4WA 1VHEA 2VJVA 2CAJA 4CI0B 1E6YA 2FYXA 3A1YG 2DH8A 2ROPA 3ISNC 4C3KA 3ZNUA 2AEJA 2ZXIA 2W2PP 1J9ZA 3SV3A 3V7AA 3KLVA 3M4XA 5DJBA 3AGQA 4R8UA 1I94J 3RR7A 4JI4F 3BBFA 3GYGA 3OE7A 4RJLA 1FTRA 4GKKJ 1DHMA 4GC7A 1AA1B 3LAKA 5ETNA 4WWSA 1BLIA 4L72B 3HF5A 2AJFE 1SH3A 2KRRA 3TJ8A 1G7SA 1K1QA 3O6QA 3UNYA 1RQ0A 4ZP8A 5AXMA 4M8LA 1VQYA 1EQ0A 2W25A 4K4WA 2VFVA 4MKAA 2IRUA 1GEHA 4IQMA 3R2CJ 2EPIA 3MM6B 3FC9A 1WP6A 3T9NA 1K8AT 1K73D 5H1SV 5BR8F 3D66A 4I2QA 1V5VA 4BCAA 4ZJQA 2IY5B 1WI6A 4OX6A 3IAM9 4WTOB 4USJC 4PWDB 3PHEA 3AOBA 3RB6A 3CTAA 2L9WA 2DGUA 5CAAA 4WFBQ 3MMCA 4V19J 3NP5A 3EZOA 4PZVA 3AFGA 2VJJA 1U8SA 2V2ZA 2CQ2A 1GX5A 3WX4A 2XGPA 2HNYA 3R3TA 5A88A 4LUBA 1FA0A 3M2UB 1EJ7L 3SDEB 2V50A 4DDFA 4OX9J 5J2NA 1CNFA 3MXHP 1PCAA 3V81A 3W60A 3DLJA 2OJ3A 3IGNA 1RLDA 4DV0F 2VPWB 1T11A 2O5DA 2BOAA 4PQUB 3CCSB 1L5UA 3SCLE 2KVOA 3D5MA 4RBVA 3I31A 1HIYA 3GP9A 3VMFA 3OJUA 3MOJB 4IDKA 1JKHB 3RR8A 1TLLA 3P26A 2RIJA 2YWWA 2DB1A 3AA8A 4WIQA 1LFWA 3VALA 4KR0B 4YELA 2HQCA 4ED7A 1YZ6A 5D3GB 2B9WA 1L3VA 4OJGA 2M9KA 3MAQA 3M32A 4KPYA 1VC5A 2DPJA 1RGVA 5A6PA 1R5NA 3KDNA 3C46A 5KG2A 2XS7A 5FO0A 2P8IA 3KK1A 1QFJA 3IFEA 4NNJA 4C11B 3SJPA 3BBBA 4IO9Q 4A8WA 3HKZD 3V76A 3IRXB 3UE2A 3MM9A 1DARA 4RW4B 5K14A 5KFUA 1VF7A 5KFBA 1HBUA 4NXMJ 1CJUB 2XLKA 1MABA 4FS1A 4LRDA 3M8ZA 2A18A 2KN4A 2PIAA 3FK4A 2F5GA 3BYRA 2YNIB 4P72A 2NSCA 2M0GB 5CABA 1SJ3P 3A8JA 1UFWA 5JXSA 4A4JA 1A8PA 1D3WA 3GJSB 1WC1A 2X53S 3T56B 2OEJA 2IBKA 3J7YI 3MM7A 4WZEA 3UO0A 4PXCA 1U1RA 3FEZA 2IC3B 3M6XA 4PCQA 1S10A 1JLBA 5E5NA 1FEHA 4DR6J 8AT1B 1NK8A 2M3DA 2HRTA 2JNJA 2J6TA 4FZVA 4UOFA 1IWAA 1W87A 3V6KA 4QJVA 1HBNB 1JQGA 1JLEA 4G5GA 4X7FA 4QWDA 2YWHA 2VFTA 2CJQA 2LU2A 2QZ8A 1O0PA 1JLAB 4Y2MA 1FJCA 1AB8A 1IR1A 4QR0A 1JLGB 2H51B 4RD0A 3MCOA 2X6YA 4DQLA 1H74A 2DEUA 1VRUB 4P75A 4GKJJ 3AGPA 1GR1A 4RUHA 3S8SA 2RH3A 1FDAA 1BGXT 1FRMA 3B82A 1HNIA 3DLGA 5KOXA 1TKTB 1SVDA 3IM9A 4ZPBA 4I64A 4QZVB 5KFEA 1KTVA 3M7VA 2BMBA 4DL6A 4CLPA 1B64A 4DR2J 2DNRA 2FUG9 2BABA 4M1KA 2GW8A 2A3JA 2R8HA 1TUIA 1LNQA 3CJ5A 4FVMA 3DFEA 2WW4A 3PR5B 2QGFB 4ZN1A 5G0RB 3CCQB 3KLHB 4MH8A 1GH8A 2FHOB 5LM7E 1A7GE 5J3OA 2R7RA 2W01A 3SCKE 5HN0A 1RAEB 2BJ9A 3KNGA 4HH0A 4FS2A 4C8YA 2V7UA 4JI8J 3OBIA 5CYJA 2Q66A 2UUBJ 2CFXA 1V0EA 1KZLA 3M1VA 3DC2A 3F44A 2DO0A 4JV5J 1NK9A 4ZJOA 4NA3A 5CD4H 5FJ4A 2CRLA 3SKBA 4LF6F 3TUZC 3FMBA 2ZJQQ 1FNDA 5D4PA 3WQZA 1PC5A 4DR1J 1LWFB 2BE7D 2GVZB 2QLWA 5LMNJ 3GYXB 3BQ0A 2YQ0A 4ECSA 1RU1A 2LQBA 3CJ8A 2HQ3A 4J9UE 3KMSA 3AB2B 4M5KA 3A1PA 2YKQA 1S1VB 1ICEB 5F9LA 4OZLA 1MU2A 2HFUA 3ZZUA 1GX6A 2R4FA 1XMOJ 1GMWA 3GCWP 3OL6A 3SBMA 3MUVP 2E7VA 1WNEA 2QTZA 5LJ3Y 4CNZA 1Y3KA 3PO5A 4Y28C 2MSTA 3Q39A 1VJWA 1KRPA 4RR5A 4Y2CA 4CO5A 3S1TA 2MB0B 1RT7B 2CQ0A 4L3NA 2GGPB 4GQNA 3N6NA 3W5VA 3FBFA 2V34A 5J2MB 3ZC4A 4M94A 4K2XA 1KQSR 3I56B 2C5BA 2VKZG 3Q8YA 4HEA9 5H9FJ 1HYSB 5T14A 3ZBTA 5DGAA 4QR1A 5K9FA 4P2NA 3T1AA 3AQPA 1UEVA 1IKXA 5KT3A 3ISND 1NK4A 4OI2A 1RTIB 1FVSA 4OMFG 2G0CA 4OPVA 3LO3A 3C6TB 4B9NA 4X4TA 2ZWOA 4UTGA 2A2DA 1N6QA 2YX7A 3V5RA 1UD5A 2R7UA 2KKHA 3N5BA 3CMEB 2B9XA 3DU6A 3FBBA 4USUA 1OSDA 5EWEA 3TQ1A 2C3OA 2WK4A 2PFDA 4M5DA 3CCRS 4DUYJ 3NE5B 3MD1A 2LXIA 2MZQA 1J27A 3LP1A 5CYMB 4ZITA 4PXBA 4NI2A 1K73T 1TVCA 5E6TA 2EEYA 2RRAA 1WDTA 2C28A 3CF5Q 3EZ5A 2MKSA 2AIRB 2X0KA 1FERA 2BBEA 1GJRA 4KE5A 3K7RA 1RQPA 4B3RF 3RRGA 3EM1A 1IM4A 2JJ1A 3Q8SB 3JXOA 2ILYA 3U1LA 3N4WA 3UI3A 3PDNA 1NK5A 4CO0A 3RZAA 2CNOB 2KFYA 3CJ2A 3JQJA 4H4MA 5KAKA 4R71A 4IG3A 1JWWA 5KW9A 3NOCA 4OOXA 1FRIA 5ETOA 5IQ6A 5J2PB 2DT9A 1DTQB 1MLAA 4FKYA 1XNRJ 2V4JA 1YRTA 4AUKA 4BC9A 4WFAQ 3KTQA 2OPQA 1UJ6A 2WVDA 4J90A 1MMDA 2QE7A 4P9SA 3G86A 1B7FA 1U0HA 3RW6A 1UVLA 2DGVA 2J8SA 1LOUA 4NBSA 4PR6A 2AJ4A 3IRWP 4DL7A 3RB4A 1F3VA 3KK2A 5K5MA 4ED6A 4LF7F 1WOSA 1B0TA 2VIHA 4IQXA 3PW2A 4F0KA 4XQFA 3OOCA 3EPIA 3MI7X 1IHMA 5CDFA 4Q44A 4B44A 3IWXA 2KXNB 5JMNA 3BN4A 4H4KA 1WHYA 3CW2C 1IBLF 1OHHA 2BEFA 3MM5A 4XNFA 4WXOA 4ECWA 2OEKA 2IA0A 1FKPB 2VKRA 3FSXA 4ZVRB 4CYUA 4C6AA 1RBAA 1RCOB 2RT3A 1JLCB 1KSPA 1C4AA 3TX0A 1DBDA 4Z7YA 2KZMA 1S4MA 4MMOA 2IBOA 1N33J 5L39A 2M7SA 4WYWA 1H0HB 3A35A 1Y0YA 1Q8KA 1VRTA 4H54A 2GJPA 1VQLB 2ZJPQ 1T9WA 2PMWA 3OTCA 1WKKA 1NZ8A 2VFUA 1FDDA 2NPIA 3RUBL 4CLTA 2DCUB 3DRRB 3GJRB 2UXCJ 3VAKA 1H8EA 1KR4A 2R2UA 3A3PB 1R0CB 4U7UD 3VAJA 5BXIA 2NXNA 2LDYA 4F3QA 1R7IA 2ALZA 2YNFB 4TYAA 3QRQA 1QY7A 1KQFB 3MGJA 4OI6A 2XZDB 4UOHA 2F1MA 3BDPA 1GO2A 2WPDA 4CO4A 4WU2A 4FYXB 1O5JA 3BGRB 5KG3A 1W2BR 3OXGA 1SC3B 3U6KA 3I0RB 3KHHA 3I4HX 4UQTA 1EZZB 5H9FK 3LWLA 2BACA 1TMMA 3QZ7A 1LQ9A 3DOMA 2WVEA 4RWWA 2F4NA 1TVRB 5E3RA 4OV1A 2J9DE 4J9VA 3EDRB 3QLHB 4RW8B 5B6IA 2Z4PA 3DXSX 2BE2A 3DMJB 3AHPA 2XI3A 3RU0A 2DNLA 3QAUA 5C7PA 4ED5A 1KHVA 3R8YA 5DDOC 3CJ3A 4C97A 4YR3A 1KHWA 2V2KA 2F40A 2FLNA 2CG4A 1JXVA 3FBEA 4DUTA 4X84A 4EH1A 3MEDA 1S79A 1WG1A 4PXEA 5HATA 4HACA 3H2UB 3NLCA 5D4LA 2FHJD 4NLWA 2HK3A 2HFSA 4A47A 3EJMA 3AOAA 2RJZA 4EYHB 1I6JA 1K44A 2AYEA 2FJXA 3G96A 4FVCA 1NO8A 2ZWPA 4DV4F 3P45B 4EMDA 3L3CA 1ZBTA 4BC7A 4XR6A 1KBRA 1N56A 2ADBA 2GS8A 3P3DA 5KFHA 1HQ2A 1DLOB 1FK9B 4TKOB 3I32A 4YEJA 1YG0A 2LEPA 3KEWA 4PC2A 2VFSA 3W2FA 2FB0A 1YRXA 1GTHA 3ZTOA 1U2FA 4J9LA 1VQ6S 4Z1MA 3HVTA 2QLJB 1FX4A 3TYTA 3UD4P 2XMUA 4LFAJ 3PW0A 1ZZNA 3LA0A 2DXFA 1NJXA 3W66A 2W2OP 1IJFB 4AL6A 1YJNS 2DRBA 1U02A 1WHXA 3CPWR 4DUZF 5I3QA 4QW9A 5ETPA 3WC2A 3KFWX 3MTKA 4NXNF 1UD2A 2YY3A 2VZ9A 3GJQB 3FDSA 4UZCA 4F50A 4YMEA 3JU4A 3I1FA 1GXUA 5HQLA 3CMMA 4M5LA 4IOCQ 4AF6A 4OYAA 3JTPA 1X4HA 1QE1B 2JHEA 2MQOA 2MJUA 2H5JB 4NMLA 5LSOA 3KLFB 3BCDA 1QVGB 3DI6A 3GIJA 1H7WA 4K4ZA 4F3OA 3I5BA 2ACYA 5AJ3F 3N28A 4C0HA 1TL7B 3L7UA 3WBKA 1VLOA 2O66A 4OJ3A 1FJGJ 1M1GA 4WU3A 4F26A 2VH7A 3RW7A 2OD4A 5IK2A 3TVZA 1RE1B 2CUYA 4P12A 4IH6A 2DNKA 2IYIA 2C3PA 4QWBA 4HDGA 2OBTA 4DX6A 3JSMB 1YZ7A 2UU9F 2N3OA 3SQGA 1FE0A 5K8OA 1RLCL 2EBGA 4X05A 1RDRA 5B0DA 2CJYB 5BR8J 1YJ9B 3VQSA 4AF7A 1RI7A 3DOKB 4LSZB 1DDGA 4B48A 2CPJA 5GADI 1AZSB 4CZCA 1J5OA 4DPYA 1HL6A 4WBFA 5B0FA 3BYPA 3HFZB 5KT5A 2HHVA 1RHQB 4DQIA 4PG5A 2M5SA 2JX2A 2PEHA 4WCEQ 3NGUA 3TUPA 1K28D 3GIRA 3HULA 4N47A 4WTYA 4CT9A 3A12A 2PO4A 1TELA 4OFZA 1REVA 3H94A 3GB0A 2LCWA 3ZTQA 4LF8F 3IBCB 1HPZA 2ZM6J 4ZOSA 1UTAA 2OGUA 3AJ1A 3O3LA 3E01B 2IVYA 4TU9A 3K5MA 3GR1A 4OZJA 2CNDA 2IPOB 4TQRA 2CJAA 3CJ0A 9RUBA 2NCKL 2IM2A 3BM7A 2L41A 3LPEA 2XLIA 3SSQA 4EU0A 1BX0A 3MECA 3AOCA 2ZUAA 2MKHA 4RZRA 4JI7J 3MM8B 3ONUA 1SH2A 5F8NA 5IWAF 2C2DA 2E9ZA 2CADA 1K0VA 1S1TA 3K57A 3P96A 2RQ4A 3QT7A 2B4UA 5ETMA 4AQYF 4RNHA 3OTEA 3I0SB 4DV1F 1U0SA 1DRZA 4DPWA 1KN6A 1X8DA 4NCNA 2BKOA 4KIAA 1N48A 4ELTA 4ZGQB 2GCFA 2VBSA 3LALA 4E2FB 3R6GB 3TI0A 4Q7JB 1I51B 1U1NA 2HQGA 3NGTA 4O44B 1LW0A 3QSYB 2PLFA 1R0AB 2UXDF 1RB0A 2PGCA 5I3UB 4NPOA 1NB0A 3HAGA 2E7WA 4A8MP 3M9NB 4G1QB 2HQDA 3K2YA 4LC0A 4WK1A 1S49A 2F65A 2ZJRQ 4ECVA 2XZTB 2BN4A 1IN0A 1R3NA 2RDDA 1G7CA 4P22A 1R8PA 1HI0P 3CC4B 1YWXA 2HZVA 4A8QA 2VOPA 1PGZA 4UZEA 3NL0A 5ETVA 3VR6A 3IM8A 3LQEA 4UOGA 3K5LA 1KOHA 3T6JA 1XQBA 4RPDA 1SJRA 2WSFC 2HHHJ 2ZBUA 4O4RA 2I5JA 3C6UB 2I6WA 1D2EA 2V9WA 3ENVA 5HP1A 2D9OA 3PIPQ 1Q81D 4C0OC 4C2MA 2V2QA 2CPEA 1HNWF 1HQUB 2Q6CA 4P6QA 1JA0A 1Q9SA 5C2GA 5J35A 4NCBA 2ZNZA 3AVVA 1HNZJ 2CJBA 2I38A 4YN3B 4RW9B 1IJEB 4A48A 4QWCA 2BQ3A 2HBZB 1HWKA 4DX7A 4JI5F 1HBOA 4C3MA 1EB0A 4O0IA 4ECRA 3R5GA 2XNQA 4RBTA 2ROEA 3W5ZA 2JH3A 4UY85 4WXWA 2VQEF 4TU8A 5KG0A 3MFIA 2RNEA 2XMTA 2IJFA 1YVFA 4RPFA 2B43A 2C2OB 5DLFA 5EGYA 1B0VA 4WP9A 3H20A 4LRCA 2OO4A 2UUCF 3Q23A 3B54A 2FGOA 4UUXA 1EP4A 4KY3A 3OLAA 5GMKa 3IA0A 1N36F 2MGZB 4DPTA 3IS9A 4PC6A 2BX6A 3M9OB 2DEJA 2ZZQA 3BS9A 1S1XB 4S0MA 5C42A 4F4AA 2ZBPA 4LBYA 3QIDA 1HBMB 4RDKA 2PA3A 3HSGA 3MCAA 4XLEA 4Y2IA 2WONA 1RT6A 2XLJA 2AJ2A 3VF0B 1HW8A 1OY8A 5IC4B 3ITHA 2ZH1A 4U7CA 3SLDA 3CCZA 2UVUA 2QL9B 2IYGA 3HVWA 4K5SA 3HHDA 1TTTA 4ZHRB 1Q86D 1OPIA 3H0PA 1U1OA 4RD3A 2VNIA 3BKTA 1OJ4A 1RT1A 4LR8A 4ZVFA 3R1LA 4G1VA 4B9LA 3MMAA 5GV8A 2ZOGA 4ZIWA 1VJSA 2CDRB 5GAGU 3UVJA 3ZPNA 1UVKA 1KVIA 3M30B 1RTHA 4MKYA 1Y4ZB 2Q6BA 4B3XA 3RG6A 3MD3A 4XKWA 3QYYA 3ET6B 2C1EB 1YDLA 2QL7B 4JBCA 1QAIA 1QD1A 4NLUA 1V3SA 1N07A 4X66F 4N8OA 2C5HA 4M2LA 3D28A 2K06A 4ZPDA 4JI2F 4B3FX 4KSEB 5A6WA 2OPPB 2HHXA 1G2EA 1S6PB 3KJVA 4L75A 1WACA 3H2LA 4XLFA 4USMA 2E9TA 4E8UA 1JJ2B 1TAUA 4ZA1A 2FD2A 3LQVA 1KFSA 4EZ6A 2QFIA 5H5JA 2G0JA 1J5EF 1BJKA 5HLFA 2ZE2B 4JI3J 4KKOA 4WKYA 2E1BA 4J7CA 4K4TA 4HHJA 4ALZA 1E6YB 1VQMS 3OFFA 3GR0A 2VBZA 3T6BA 1CBKA 2A10A 1QAXA 2HMIA 3DDNA 1BHNA 4ZCKA 3T9ZA 2JEJA 4G1BA 2BW7A 4RD2A 4Q0BA 4PG6A 4R8UB 3HM9A 1EHWA 2DHSA 2ZKTA 1H6KX 4I2PB 5C5JA 5FLXU 5J2QA 5FLXY 2XCPA 2AEFA 4LF4J 3GYNA 3LQ6A 2OK7A 2HZCA 2HEKA 3PRBA 3KG1A 5DSZA 1MNEA 5B0BA 3JQMA 3KDOA 3CDUA 2BOPA 3A8EA 4OYXA 3V6DB 2FVSA 1SKWA 4FWTA 1MN7A 4AD6A 1VDHA 3EGWB 1S72S 1ZM2A 2FHKA 2AX0A 2H3EB 2VA3A 1RAOA 2ZOMA 4I2QB 1TR0A 4TXSA 2JDJA 4ITSA 1U47A 1R6VA 4ZLPA 4DX8H 2VBWA 1N5VA 1X4BA 4PKDB 1YBUA 2ZZMA 1QSSA 3MMCB 3B4MA 2CQ3A 5AN9A 1SC4B 4XAKA 2XY7A 2NXCA 2LLZA 3ADAC 3L09A 1W7WA 2W7AA 3AVTA 2CNLB 4U67Q 1ZAXA 2ASLA 1NZAA 3MEEA 3A3BA 4YAFA 2DD8S 2HNYB 4KKSA 5KSWB 2NSBA 3RBZA 3E2EA 3QGHA 4OP7A 4URGA 1SH0A 2XO6A 2HHTA 2CWKA 1A6LA 2CWXA 4QYZK 1WC6A 2DO4A 4LF9F 5J2NB 1OB5A 2I2YA 1Y10A 3MPYA 1JMTA 2DR9A 1HHTP 4B3MJ 3BZQA 2M2BA 1NB2A 1U6ZA 2F9JA 4YR2A 2DHGA 4Q43A 3HFKA 1LV5A 1BMQB 4F67A 3NMRA 4O4GA 4B3TF 4JI6F 1SCJB 4IDKB 2X3GA 3DNCA 1E1RA 3K17A 2F4VJ 1M1HA 2KJVA 4U7UK 5KT4A 5TRDA 1E64A 1WEYA 1VQNS 3SLNA 4LF5F 4ZP7A 4QPTA 1QUVA 1IVZA 4DX5A 1TTHB 2CQBA 3CGIA 2J6SA 3W2VA 1VQSA 3H90A 3TAPA 4RD1A 2IVFB 3M32B 3R7BB 1UWBA 3RB0A 2Z0GA 3MCNA 2JL9A 3KK1B 4RLEA 4CO3A 3K0JA 3KJFB 5JUMA 2HZAA 1COWA 1TQLA 4BWJA 4WZQA 2V69A 3ICLA 5E3AA 3QAEA 1FD2A 1WSVA 3MM9B 4ENOA 5K14B 2GV1A 1HBUB 4IH7A 1H72C 3I55S 3DU5A 1UD6A 2AHOA 4QIFA 4KJIA 5C25A 4E0DA 3NAHA 1DQ9A 1ZM4A 3ZC3A 1RT5A 1I7PA 4X4PA 1N52B 1VC0A 4TMVA 4DSFA 4TVAB 2ZHAA 3HSZA 3VAHA 3TAMA 2MLZA 3TEGA 1K0TA 3MMJA 5DM7Q 4OJ1A 1RWMB 4L6V3 3MM7B 2ROGA 1RBLA 1SBRA 2DGQA 3H40A 1WG4A 1JLBB 2JC0A 1S9GB 4EYIB 4WZKA 1SQFA 4WWVA 3A8KA 5CD4A 2E5JA 1XB2A 2E29A 3D6FB 3OXLA 1RYRA 2XYGB 4QWEA 1LFPA 1GMUA 3CJRA 2FDNA 2J9EA 3I87A 1QG0A 1DQ8A 4NLXA 1JNRB 3PX0A 1TK8A 4LBVA 3LUYA 1SKRA 2GO9A 5I3PA 3S01A 5BSYA 2DH9A 1CNEA 2UV8G 2AQ4A 1AFJA 3FPPA 5C2CA 1BLUA 4R25A 4DSKA 5LOQA 1WDDA 1TK0A 1CQXA 1EXMA 3JS9A 2OKQA 5FDLA 2QE5A 4USVA 4TY8A 3CCJB 2ZDPA 4P7TA 1HNIB 1FFWB 2GPJA 2HBQB 5DN6A 2NXUA 4BBYA 2D9PA 4MFBB 3ZUGA 5CCMA 2VICA 1I94F 2GJKA 3THTA 4ZCIA 1WC0A 3J7Z5 2KL8A 3HPOA 2UUTA 3RYLA 2WVFA 4GKKF 4CLLA 2LQ9A 3CUNA 2UV8A 1U26A 4DUZJ 2EFQA 1QVFB 3BN7A 2BR0A 2WB4A 2LEBA 3AJDA 2MJNA 2R2SA 4F2SA 1YIJS 3D67A 5I42A 3Q86A 1FJ7A 2C2EA 2IMWP 1SIWB 1T9YA 3BGUA 4DR7J 4CT8A 4YS2A 1VJQA 3JAMU 3JAMY 3JYTA 2E7XA 1VQ9B 4KTQA 3M1VB 3G8SA 4J9QA 3BR8A 2LMIA 1OY6A 4M5JA 1RCXB 4X8IA 1RAFB 1D8YA 1FT8A 9ATCB 1DZ5A 3E51A 2QYGA 1HW9A 1KD1T 1UWAA 5AJ3J 1ZETA 4ECYA 2FLOA 3J81U 1W35A 3J81Y 5EX0A 3DDYA 3T1HJ 1H2UX 2BANB 3S6EA 1E6VA 1PYSB 3QWPA 1WJ9A 2VHGA 2MLXA 2GJ2A 2QG9B 3LW5C 1UETA 3PYGA 3PW4A 2F4FA 1O8BA 1RAGB 2MKCA 4CLZA 3J7A1 3OD2A 2R3VA 1BQNA 2I9SA 1DY3A 1MU2B 2JJ2A 1OYDA 2WZ1A 3PYEA 2MDAA 3KNAA 4JB8B 1S0MA 2V9KA 3FFIB 4C8OA 3FUYA 4OX9F 2MLYA 3KLGA 3J7AN 1C1BB 3EE3A 2J9CA 3M8QB 4K50A 1UVMA 3Q2SC 4ZVUB 5IV3A 4NLVA 1U24A 1UKUA 5IXUA 2HS4A 1ZM9A 4NEYA 3ZIAA 2DOGA 5D4NA 1FDNA 2PN6A 4ILRA 4FK8A 3HVAA 2WRMA 1IQTA 4P2FA 4URQU 1NBMA 1IKXB 3PYFA 2B4PA 2B4OA 2ZHOA 3OVSA 3TOQA 3DOLB 3ZNJ1 4ECXA 4YALA 5F8HA 4K4YA 2BYCA 4QIVA 2DGWA 2BM1A 3NG8A 3C2PA 1VQ5S 1N6QB 2RF2A 2VPZB 2WZPP 2YNGA 1BQMA 5KFMA 1UVIA 1HWJA 4NX9A 2MZ1A 1SV5A 4ZJLA 3CJTA 1R31A 4USHA 4IW3B 2R8GA 5D78A 1HQEA 4IFVB 3H5XA 2I0XA 4DV1J 2HVHA 4NXMF 1N5QA 4WP3A 3C16A 3F41A 3UDCA 2DK2A 5F41A 1T03A 1HHSA 3LP1B 2BM0A 3HD2A 4DG1A 4NI2B 3H7HB 5L1LA 4I6AA 4AL7A 2DGXA 4I56A 2BKPA 5E3CA 2DHXA 4TN2A 4A8FA 2B0GA 4C98A 3WNDA 1S6OA 1JNZB 3PUMA 3CC2B 5D0HA 1WKJA 3QO9A 4DR6F 2H5EA 2XMWA 2WTFA 5MLCV 2CW5A 3G4SS 2BV3A 1KVKA 3D3BJ 3Q8RB 1VQ7B 4B3SJ 3VNUA 1WELA 3HMJG 3CDBA 3BH4A 3IWLA 4NCGA 4RU2A 1IWGA 3OR2B 4ZV4A 1LK5A 2QLBB 1JX4A 5J1EA 3ZXWA 4ES3A 4UF4A 2BZ2A 4H4MB 4IG3B 4HL9A 3CSKA 2XB2D 1PJ5A 4UZUA 2GMLA 2R7QA 4OJHA 2JEFA 3FSIA 1UJ4A 2YVSA 4E98A 1T9VA 4PC1A 1REGX 3G87A 4Y6IA 3QWUA 3GV8B 1IR2A 3I5CA 4A8SA 2V4JB 2QT7A 2VL1A 4Q2MA 2OPQB 2ABYA 1EIYB 3WBZA 1UZHA 2JFKA 2MTLA 3LO8A 4X4NA 1U0HB 5KT2A 1JLQB 3MUMP 4ED8A 4F3MA 3KK2B 3T3FA 3MEGA 4ETXA 1JLFB 2U1AA 2MZTA 3R5JB 4DL5A 2Z58B 3OKXA 2RRNA 3TEHB 1CQMA 4DR2F 4W90B 2EVZA 2MKJA 4PEOA 3WNCA 1R89A 3U7JA 1CJVB 4G7WA 2WVCA 4XOPA 2Q79A 3MF5A 4J9MA 1XWLA 5EHHA 3MM5B 2L08A 4CYUB 1HLWA 1X4AA 4F4XA 4XPCA 2BRKA 4IOAQ 4OYOA 2RS2A 3PRDA 3UFCX 2QTWA 1QUFA 4LFBF 2J9DA 3FGVA 3K5OA 3PJXA 3IR7B 2IIHA 2GQCA 2R2RA 1N5TA 2CNNB 5D77A 1K9MT 2VQEJ 3Q22A 3LGHA 3KLEA 2IJRA 1R0BG 3W62A 2OH2A 1T6XA 3CT9A 4DMZA 1K1SA 5KG7A 4C9DA 2BJ7A 1IXKA 1ZYQA 3KYLA 2FZCB 4DR1F 3RJMB 5BYSA 4TY9A 5IT4A 3HI9A 2UUCJ 2VG5A 3DRSB 1HFEL 3DRYA 3CCQS 1HARA 1R6YA 1IR0A 4WFZA 4H4OA 2K2PA 4KGZB 1FTCA 1X0PA 3TA1A 2O01C 2W24A 3G8QA 3DOMB 2AP6A 2K7KA 4ED2A 3CCLB 2MYFA 2AJQA 1ZA1B 2WSCC 1XMOF 2X7IA 1MWYA 5J1PA 4TU7A 1S48A 4ZS6A 2VNHA 3M6UA 1QSYA 2DNNA 2BE2B 5A76A 3AB4B 4RNMA 2XZOA 1KS2A 3BSOA 2DNOA 2C3UA 2Q3PA 3HD1A 4L74A 4RDLA 2RE1A 4LQ9A 4C8KA 3MEDB 3ZZ0A 2BGJA 3CJKA 2IJNA 1X4EA 2GIFA 2RUGA 1LW2A 3LAMA 2Y8WA 1D0EA 2AMCB 3BGOP 4J9KA 3R5BA 3TUIC 1SXLA 1TL3A 1XR6A 2KVIA 1FXLA 1C1CA 5HQMA 4B9UA 5KG6A 2BJ3A 3HVTB 2Y1RI 2B6AA 3OUYB 2VONA 3VVUA 4JI2J 4AXIA 4QU7A 2RDJA 2AJ1A 4I6YA 2ATLA 4NWBA 3Q6QA 3I56S 3MZIA 4KGKA 2RQCA 3U1MA 3BJYA 1XBWA 1DJ0A 2F7VA 3PJWA 5AXLA 3ZBUA 4K8RA 4DUYF 2E1CA 2CQ1A 2QA1A 1AUSL 4J91A 1U49A 3D2WA 3T5LA 1JXLA 2N7YA 4EBDA 1QVGR 4N5SA 3TZWA 1FRQA 5DDPC 1ZAVA 2VG7A 5HMXA 3MM6A 4U9RA 1RADB 4KGMA 1URRA 4ZCLA 3DI6B 3WIUA 2B51A 4M95A 1BWVA 3AD7C 3MPWA 3CMES 4F2RA 1YGYA 2XG8A 5JVHQ 3OZWA 4DNRB 1F5BA 3GFHA 5L8RC 3WC0A 4HYKA 2PFFB 3R1HA 4UT4A 2E5LJ 3BSAA 2IDEA 3QATA 5L1KA 4YAWA 4NLOA 1Y11A 1M90T 2A1BA 4OYWA 7FD1A 5KFXA 3PG9A 2D3LA 1E3ZA 4KV8B 2YNHB 2ZZEA 1Z2LA 1XNRF 1GAWA 2IVMA 3VCDA 2OPSA 3M2UA 4LRFA 1S7IA 1QDUB 1X0FA 3D6HB 2UUAJ 1J5OB 2F8MA 4RUAA 1OPZA 3HT3A 2Z57B 2RQKA 3IG1A 2CPFA 2B9EA 3L7PA 3TAQA 3AODA 1QFYA 3NEKA 1LXNA 4PQUA 3Q6RA 1HR0J 1NHUA 2X6WA 2OBSA 1TFWA 5IYWA 1UD4A 2DNHA 3Q38A 1B3TA 3FKSA 1X9MA 3SEOA 4KRWA 3OZVA 2M88A 1REVB 1IBKF 3R6JA 1A9NB 2F8HA 1HPZB 1YJWB 3R27A 4GMKA 2GNKA 5HVFA 4RM0A 5DZ7A 3MCSA 1IKWA 1D8TA 1SPBP 2Y0BB 2V7XA 3R5AA 3M8PA 1F2HA 1PBAA 2J0QD 4FF1A 3ZTRA 4H9GA 3OHAA 5D3GA 4KC5A 4ZVQB 3FQKA 3MECB 2UXCF 1VISA 2XO7A 1OB0A 2QSFA 4XOTA 1QGAA 1KC8T 4C11A 1XN9A 1IKVA 2DXDA 2GC8A 1O6XA 5HK4A 4JI6J 3H9NA 4EEYA 2FJDB 2D69A 3CCMS 1UCNA 2XNRA 2P6SA 2ZD1A 4TMWA 1U45A 2BGIA 4I0WA 4FF4A 2QV6A 4PXDA 1FKAF 2MPUA 3CULA 5HZAA 1TP7A 3T5JA 2VBTA 2AU0A 3HX9A 3MR7A 2FIUA 4B9SA 2P2CB 3D0HE 1LW0B 3M2VA 3MR3A 1VQLS 1MWQA 3POTA 4IRKA 4LQ3A 5C24A 4RNNA 2DEIA 1YITS 2QA4B 5AXNA 4C43A 2OAUA 3BV8A 3HDSA 3JSBA 3T5KA 2FVRA 1MSWD 4PPDA 1VHIA 3U1NA 2LXUA 3W9IA 4ATNA 2HGMA 4FN5A 3VGVA 3F0NA 3ISXA 4NL5A 4U96A 2V7QA 5M2UA 1SKSA 1G7CB 3CC7B 1FWLA 2ZDOA 3OFHA 2JWNA 4LREA 2CDQA 2LYVA 1EFCA 3OV7A 5FA6A 1FESA 1HWUA 3CP8A 5HI7A 2HVIA 2ILZA 5H9EK 3PFEA 3UN5A 5KFZA 2KXHA 4DQSA 3QE2A 1WTHD 2D7SA 4TN1A 4I69A 3MOZA 3FQLA 3BH7B 2HAIA 1FRLA 2K1RA 1RBOB 2ZL5A 4OZ0A 4JI1J 3ONYA 5HP1B 3AY0A 1F9EB 3QZ8A 1YI2B 3T51B 3G82A 4OLPA 1KK3A 3FKBA 2V8PA 3BR9A 1VQPB 1H7XA 1RSCA 2PT0A 1NHVA 2C4TA 2X1AA 1EETA 5BYQA 5G0RA 4O3PA 3OPOA 4R0EA 1MRZA 4NYZA 1TL4A 3W8PA 3MFHA 4LR7A 5CXTA 1TZ0A 1XMQJ 3RAMA 1HBOB 3OJWA 1UJ5A 1HNXJ 2Z6BD 4A46A 4EK2A 2MMYA 1M1KT 1LEOA 2IAJA 1V6HA 4M5MA 4LT6A 1EFUA 3E1YE 5GMEA 4X65F 3TJ9A 4DFKA 4DF4A 1GNKA 4ECTA 4UY8T 4DXLA 3CJQA 1FJGF 2R8JA 3NCQA 2V31A 5FNZA 2BQRA 2CG8A 5GAEI 4YAUA 3W5XA 3BSCA 1EP4B 2VQFJ 1YJVA 2AYGA 2YWGA 3HJFA 2EFNA 5FIUA 2XULA 4CTAA 3W2HA 1F9HA 3IS9B 3OL7A 2A2CA 2HCJB 1UW4A 2CK3A 3TWZA 2VJIA 1NB9A 2G9OA 5DG7A 3FCWA 2J5AA 3P4UB 5C42B 1WI8A 4FPIA 2RVJA 4RKUC 3SYZA 1HD0A 5HBMA 3EICA 4Z4UA 2JLGA 3GILA 1Q4RA 2WONB 4MKBA 4R5PA 4OHVA 3ITHB 1Y9OA 3UDVA 2ZOFA 4HI1A 2FVPA 2WW8A 1B23P 1O51A 3K89A 1VQ6B 3L4BC 1LWCA 2GGPA 4XTTA 1QM9A 8ATCB 6AT1B 4ZN3A 1FKOB 2GHPA 2KZZA 1KONA 4ED4A 5HMWA 1F9FA 1RT2A 1HYSA 3ZZPA 1OGIA 3UVJB 4OYPA 3S7RA 2ZM6F 1RTHB 3I96A 2DR8A 3TW0A 5D15A 3B78A 2KT3A 2WOMB 2ZH6A 3R97A 2HMAA 4F0MA 3C6TA 3N6LA 3CD6S 2NUUG 5KFFA 2KM8B 4RUCA 1U48A 4MAKA 5JVGQ 2XNCA 4JI7F 4OHWA 1T6YA 4HHUA 3FJ2A 3OJXA 1JJ2R 4YP3A 1KQGB 1CC7A 2FQQB 4F04B 5ITHA 4PYDA 2Y9HA 2FVCA 3PEJA 4QR2A 2EFPA 1YJ7A 2EG1A 5U47A 3BEGB 1CPZA 5KT7A 2HBRB 3ASRA 1QX4A 1XNQJ 4BS2A 2X6XA 4RBUA 1I18A 5CYMA 2J7KA 5HLFB 1NK7A 5BSXA 2Q43A 1NBEB 1RKJA 1ULRA 3IR5B 2E44A 4KKOB 3NNHA 4AVZA 5JJBA 5B0AA 1Q82D 2LP4A 4DEZA 1D8ZA 3CMAB 2X1BA 2Y8YA 2HMIB 3W65A 3WHIA 1RWWB 2GA7A 4JYAJ 2QMUA 1HI1A 4K7QA 3HVRA 1VQOB 3W63A 5LJ5Y 3DLEA 1W34A 1XR5A 4LBIA 4KQZA 2HLTA 5J2QB 2N4CA 3QIPA 4DS4A 4FYVB 3QT6A 2NZ4A 5TY0A 2AJ0A 3OXFA 3U27A 1Q53A 2CPXA 2VD3A 2OTLB 5F0UA 1GMWD 2U2FA 1F5AA 3OTOF 4DU7A 2DNYA 2XMAA 3GIKA 2JLEA 3VHQA 4IKAA 4J9PA 3DN9A 2ZH4A 2X85A 4KFBA 2HHHF 2KJWA 2DGOA 5F8JA 2R9LA 3K58A 3A3NB 3UCGA 1CJKB 3QFCA 1RTJA 3ZTPA 2GX8A 2NUHA 4YR0A 1YK9A 1S6QA 3DLLQ 4Z4RA 2B4VA 1F2GA 2FJVA 2AZ3A 4ZP6A 3ISZA 4DFMA 2CF4A 4DI6A 4ZVOB 2XS5A 5E3QA 2KDOA 5GAHI 3AXKA 1HNZF 2BUNA 3MEEB 3PYDA 1LWEA 1KNZA 3KWMA 1FKPA 1IUJA 4NEZA 1U1MA 4DR4F 2MY8A 3LP2A 1EFRA 3CMQA 4XDCA 4P52A 4Y2KA 1JLCA 4OQJA 3DRXA 2B7BA 4CP5A 1VQ4S 1XIQA 1B0PA 1Z2ZA 3DRPA 4LBZA 2VDHA 3GIIA 3A3GA 1BQEA 1N34J 3ILJA 4KHPJ 1S1UA 3CCWA 3T53B 3R2DJ 4K0KF 2AEMA 4DR5J 2DCUA 3LF0A 2VZLA 1FNXH 4GVBB 1KOOA 3LGNA 4JMQA 5AT1B 4O4GB 3BSNA 3DYAA 2BSAA 2YNFA 4NRTA 4LFCJ 4X0CA 2D74A 3VAGA 4V1Ak 2UVRA 1XQIA 2AT1B 3BGRA 2M70A 1D9DA 1AUDA 4WFYA 4LFBJ 7FDRA 1WG5A 3OEEA 4USWA 5KFDA 1U1PA 1QUPA 2JEGA 2CJ9A 3W2VB 2AYBA 2V8DA 4RPBA 4KHRA 1SI9A 5HQ8A 2V67A 1S9FA 3EVOA 2WCXA 3EDQB 5CYQA 4RW8A 4C4WA 1UWBB 1NDCA 3HZEA 2DITA 3T19A 1CS4A 1MMLA 1FRNA 1TUWA 3W2EA 3GSDA 5A8WB 1DURA 4Y7CA 2FHMA 1ZUNB 1GAOA 3UR0A 1G1XA 3OEHA 1WHWA 5F4JA 2HWHA 2AHOB 3AQOA 4CLFA 5DGBA 1UA0A 2QFJA 1RT5B 2KVQE 5KFCA 2COLA 3VAIA 3EUNA 4G6VB 1J2VA 2V8HA 3OZUA 2ZC3A 1I8DA 3TAMB 3RAXA 2H54B 4IOBA 1T9XA 3FEXB 2FPHX 2J8AA 4NZ7A 1ITPA 2M5YA 1VQ8B 3TANA 5EMNA 2YPZA 3OSNA 3OL8A 1SUQA 2N7CA 1X4GA 5EN1A 5E3PA 1B7YB 4TLRA 2ZVIA 3DHXA 4IUFA 2AD9A 5A8RA 3HKWA 1K47A 3IC1A 1IB0A 3SCIE 5L38A 1IJFA 3CD0A 3VNVA 1AIPA 5IM0A 1XERA 1WF1A 2NQPA 3PEHA 1S0VA 2RDIA 4RNOA 3OFNA 1V0FA 4NZ0A 1T94A 2FZGB 4IRCA 2PI4A 3CPWB 4JI3F 1F3FA 2CYYA 5L9XA 3GVJA 5HO4A 2HFZA 2WBMA 3KHLA 5FDLB 4TY8B 4KGVB 2BJ8A 3HHKA 2DTJA 1YLXA 2KB2A 1QE1A 3HHLC 3TZYA 2OLWA 1QVFR 3CDWA 2QYCA 3ELHA 2CJXB 4MTPA 4ZGNB 2V8VA 4MK7A 1VFJA 1R5OA 1L3SA 3JQKA 3P6YC 3NNCA 2FC9A 2POKA 5SZTA 2DYAA 3WX8A 2DKOB 3NAIA 4LF4F 4WP8A 3H98A 4URSA 5DS7A 2LKZA 5I42B 4DPOA 3J7ZT 1PC4A 4DV5F 4JV2A 1RA7A 4F0HA 1FDRA 3JYTB 2QLFB 2NR0A 3AD8C 4DQKA 2MEWA 4DN0A 4DPUA 1VHFA 3DM2A 3SCJE 3DOKA 1S4FA 2W9CA 2APOA 1WC3A 2YKOA 1NCLA 1F20A 1D9AA 2HIQA 2HQIA 2QEXB 1Y00A 1QTMA 2ZTNA 5DRKA 2V7TA 3QT5A 4K4SA 1E6VB 1C4CA 2XNDA 1KRHA 4OYBA 1V3RA 4LBPA 3Q8QB 1BQNB 4A8OA 4ZVTB 4DK1A 1YRUA 5KFKA 5EX3A 4EZ9A 2EKYA 3KLGB 3N0VA 5EWFA 1X4DA 4P6YA 4CM2A 2G2ZA 3QPIA 4B3MF 2VC1A 1H38A 2IDLA 4P10A 2HQFA 2PE3A 4DN9A 2KM8C 1BUXA 2XQCA 5THWA 5IV4A 2XSFA 4M4SA 5CH7B 1XE1A 3LGMA 2MQ8A 2F4VF 1IBKJ 3EXYA 1V5IB 2RU9A 4G65A 1E63A 3W7BA 3D1QA 4IRDA 4X7CA 2HHPA 3LANA 1D1UA 3TO8A 2QN6B 3L95X 3QSYA 4Y65A 1BXNA 2LA4A 2RS8A 5HVHA 2RF2B 4B9MA 2YNGB 5I3UA 1RUSA 2DGSA 3D0IE 3K59A 1Q16B 3BH6B 4PUOB 3IO1A 4MIAA 3PKYA 2CPDA 3CPXA 3LP0A 5DG9A 4LBHA 1B99A 3GV5B 3KHRA 4ZPVR 5IOLA 5GVQA 1QH0A 1HQEB 1WTBA 2EK6A 4IR9A 3NY0A 6FDRA 1CJTA 3RTVA 2IRXA 3CO0P 2VBYA 3C16B 2FGCA 5E41A 4DCOB 3HJVA 3OW7A 4DU8A 4DG1B 3MMPA 3QFSA 2X3UA 2OFHX 3U6BA 1M5KC 4PABA 2J0WA 2AW0A 1UMJA 3HSDA 2HNDA 1NH8A 4N7TA 1KVJA 3ASQA 2OTJB 4ES1A 1W0KA 3QO9B 4NE9C 4DQRA 1UAWA 2HLDA 3G2XA 5ETTA 2FY1A 5KFGA 4RO0A 2M52A 2MQNA 1H98A 4DSLA 2PA8D 2ZTGA 4J9NA 1RWKB 2C22A 4NCGB 2V63A 3H8YA 4B9VA 1PIEA 2HURA 1C2PA 2MY7A 2DNMA 1UA1A 2XGJA 5J1EB 4Y9RA 4XN0A 4XK8C 3VGTA 4KH0B 3G6YA 3MHPA 4X7EA 3W5HA 1SKUB 2RHQB 2OD6A 4RW9A 1DFDA 1N5YA 3N5FA 3G71B 3EMTA 2ZHBA 3M6WA 1MW7A 3NOGA 2DHHA 3QFRA 2GQQA 3GLJA 3RRHA 1M5SA 2JRSA 4Q8FA 2ZH2A 2CQIA 3B8HA 2K3KA 3M05A 3SMZA 3C66A 2V68A 4Z4TA 4MT1A 3FSYA 5DQHA 2DY9A 2ZBRA 1RJJA 4MYUA 2LEAA 2FJEB 4DBQA 2FTRA 1CG2A 2GJFA 1Q8LA 3I9ZA 4Z7CA 2HAFA 2CKWA 2QTLA 4J9RA 5TV2A 3R5CA 1TK5A 1TL5A 4EGLA 3J7YU 1JJCB 1RWXB 5DETA 4FXUA 2ZZTA 1T9TA 2ZBCA 2QL5B 3UQSA 2MHEA 2V94A 2I1RA 2VDIA 2DNZA 4DR7F 3P5TL 1N5SA 1S1XA 4N3NA 3PRVA 1QFZA 1NMEB 4U8YA 1U2CA 3KLEB 4C48A 2BJ1A 2WVBA 4YB5A 4DLEA 4X65J 3W61A 1EP3B 1S5ZA 3C14A 4D3GA 5LT5A 3I5AA 4ID5A 4KB7A 1IM6A 2VG5B 3KUGA 2MSSA 4PG4A 3KOAA 3T1HF 4LSLA 1L3UA 3NNAA 2XMJA 2FJBB 3CIMA 5L1IA 4HDHA 4FXVA 1DDIA 1UL3A 3ZZTA 4H4OB 4BHQA 1T05B 2DVIA 5IYRA 1NDKA 3NMAA 5B09A 4RCYA 1E62A 1RU2A 2FX3A 2YKPA 1VQ9S 3M30A 1RT4A 4ZCMA 3H42A 3FMWA 1N32F 2ALYB 4B3OA 4C8LA 3I6PA 3C8YA 3GWCA 2ZZFA 1QLNA 2ERRA 3FZBA 3BGFA 1S97A 1Y0RA 1RWVB 4YHHJ 2EC2A 1F60B 2GZOA 5HJYA 1SL0A 1G6BA 2HS0A 1AXQA 2P6TA 3WIVA 1LW2B 3PV8A 1S6PA 2HBYB 3JTOA 1P8GA 1U4BA 4ZPCA 3W9HA 2E1PA 3ETMA 4X07A 3QJPA 3EVMA 2C3MA 1T8EA 6FD1A 1Q5YA 5LSRA 2PMZD 1YIJB 1R8AA 1RWNB 2NYHA 2XY6A 2QMXA 1CEZA 1HMVA 4RW7B 1R5BA 1TL3B 5JBQA 2D1CA 1FNBA 1ELOA 4DV3F 3MPDA 3AXMA 2YKMA 4CQ1A 5KFIA 2ZH7A 2MKIA 2B6AB 1ZZFA 1Y3JA 4DOZA 2XYHB 3TRGA 1TKXA 2XMMA 5IFMA 2EFGA 4LRAA 3JQRA 4Z4YA 3PNIA 3DGPA 1QUEA 1JK9B 4I2PA 2RKIA 3C15A 4O3QA 3Q83A 2Q6IA 3G6XA 3NCPA 1YX2A 3I4PA 4LRBA 3HP6A 3K8VA 1UEKA 2PIIA 1G7TA 5KOWA 4UUWA 3TZZA 3V6DA 1ZPVA 2VG7B 2ZZNA 4NLSA 2GFFA 2RMLA 4N77A 4RL1A 1TKZB 4LVNP 3M8RA 1OY9A 1SQEA 2H4YB 2HFOA 3MURP 1FJEB 5HXBA 2AV5A 1VBXA 4USTA 4B3SF 2HNZA 5DS0A 3PO4A 2OPRA 3MTJA 5HANA 3W8GA 1WPCA 2B3TB 2QX0A 4LSNA 4QIGA 3OL9A 1S99A 4OZ3A 4KO0B 3G6VA 4G6IA 5KT6A 3FZ2A 4BWMA 3OTOJ 1TKDA 1SC6A 1RTZA 5LXYA 4HKQA 2UUWA 1KEKA 2DRAA 2L3MA 2EFOA 4N56A 4NLRA 2V5HG 2YKAA 4Y34A 3BO2A 3OTDA 2OHDA 2OPSB 4GO5X 3P5BP 2XTJP 1F6TA 2YTCA 2R6HA 5KFYA 1NSKL 3CJ4A 4AC9A 3CC2S 5ETLA 4WZMA 5F8LA 2WR8A 2A6MA 1E43A 1Q7YD 1RK8A 4CWBA 1HWLA 2HK2A 3NS6A 1VQ5B 3C3LA 4AXJA 3IG1B 1VQ7S 4NYOA 1NXIA 1HI8A 4RW6A 4WE1B 5A2QU 3MR5A 5A2QY 2DIUA 2JVRA 3M2RB 1FEEA 1P9QC 2XZPA 3UW1A 2LDIA 1HD1A 5KFPA 2D3UA 2VBUA 1KTQA 4DR4J 4WYLA 2YWKA 3CXCR 5K20B 1W0JA 3QQCD 1OQ3A 1IKWB 2B8QA 4G7XA 2E9RX 3M8PB 3HHLA 3UD3P 4OPOA 4I1TA 1Y5LB 2BXJA 4XDDA 4K0KJ 2EI5A 2QLXA 2V0NA 4JI0J 3OR1A 4NZ6A 1UFLA 3SZ2A 3G4SB 1XC9A 1IKVB 4IG0B 3EWGA 2N82B 3KMQA 4WZTA 4X2BA 2ZD1B 1YHQB 2W6IA 3IBWA 2XEXA 1Q7LB 2PSZA 1NB7A 3OPKA 2Q6KA 1AW0A 4HR2A 3CCEB 1DQAA 2XZWA 4QYZJ 4F7DA 3V2UC 2VFRA 2M4MA 2HHUA 4E0FA 3M2VB 2N3LA 3POTB 5C24B 2ZBVA 3CEDA 4MJKA 4EWTA 2B56A 2KG1A 1R27B 1X5OA 4ZLJA 1NPRA 2D3NA 4DL2A 1RHUB 3CD5A 1S9GA 2BVNA 3CRZA 2QMWA 5EWGA 2R7OA 4PGOA 2Z2YB 1MROB 1HA3A 5FO1A 4DPXA 1APSA 4Y00A 4FXDA 1KQKA 1RAHB 3CCVS 1WF2A 2PMHA 1CULB 2CQDA 4HE5A 1T3OA 1KWMA 2VF3A 3NGRA 1YJRA 4PWUA 3FCHA 4ECUA 3VZHA 1ACMB 3CCLS 4DFPA 4A8YA 2F8EX 3V4IB 3WY9A 4OZ2A 4FF3A 5AXKA 4X62F 2MQQA 3HFVA 1VYAA 1MWZA 2K1RB 2G2YA 2LQ8A 3RBDA 2VPXB 3CJSA 3Q3AA 3D9BA 1ZOTA 2OEMA 2JZ5A 3G05A 2CIMA 3RRKA 1KKHA 2H4WB 1N0VC 2YH0A 3G82B 3O5TB 1T6ZA 4WJBA 2Y0SD 1OQ6A 4MFBA 4EFAC 2VA2A 3VQTA 4OI3A 4CO1A 2DHAA 1WC4A 2ZH5A 2IHR1 2Z2ZA 4HTIA 2IM3A 5J1NA 2H65B 1EETB 1QJHA 4DHVA 4WFXA 4NMXA 5HROB 2V4DA 1I5OB 3CE8A 3AVUA 2X8KA 1WF0A 2B5JA 4QHYA 5B0EA 2WYRA 4Y2AA 2ZBQA 2VPYB 4TSFA 4W4MA 4C8ZA 2GIRA 2IAJB 3SJZA 2VBXA 2V4QA 2VC0A 2HVEA 3OLBA 1NU4A 1WOOA 1WUUA 5GV7A 5ADZA 3J80U 4WF9Q 3J80Y 2FLLA 1DTTA 2E5LF 2DERA 1YBTA 5KFWA 4Y9UA 1SM4A 3FEYB 3RAQA 1XR7A 1H2VZ 2BANA 3OW2B 4CTAB 1VCTA 4DV5J 4UQGA 2XZLA 2OI2A 3LOUA 2CJKA 3VO1A 2R8KA 4C8MA 1VI7A 5L46A 4DL4A 1RHMB 4CH0S 5HBMB 5HSPA 4AL5A 1LWXA 3BDEA 2EW9A 2DISA 2RAQA 2B5OA 3FFIA 5A89A 4MIBA 1H73A 4R5PB 2CPZA 2UUAF 1SKYB 1C1BA 5IT9U 2DH7A 5IT9Y 3M8QA 1T9UA 2Y1JA 1SQGA 1SL2A 3VO2A 2UVWA 1D09B 2NYIA 4PPZA 3SEJA 1LWCB 5THXA 1NK0A 1HR0F 4RNFA 1OWXA 4RLZA 2OFGX 3AT1B 2JLFA 2GAGC 4DV2J 3HK2A 1RT2B 4YOEA 2LECA 3QNWB 2IM1A 3BO3A 1S77D 2W6JA 3X1LB 5A0YA 4DLGA 3DOLA 3V81B 3AJ2A 3OQ2A 4MYTA 4XN3A 2DXEA 4ZLNA 4QBUA 3NWRA 3O44A 5HMZA 4Z4SA 1OIAA 2ACMA 3TUJC 3I9V9 2YX4A 2DYIA 2K3IA 2WJVA 2QSWA 1U2RA 3W2IA 4Q45A 4IFVA 1U1KA 4IR1A 3H5UA 1XMBA 2C77A 3GFYA 2AGPA 2P3MA 1BY9A 1UD8A 4J0QA 1TV6A 4QCLA 4C7QA 1YJWS 5CA5A 2CPHA 5GADU 2CZVC 2QDXA 3PA2A 3TQEA 2ASJA 4ZPWR 3CDAA 4NA2A 2BJDA 3AH6A 4FNHA 5KG1A 4TYBA 1H3DA 2HVZA 4TMZA 4ZKAA 2HFVA 2ZFHA 2AKWB 2QMUB 4BDPA 1B4SA 3DLEB 1RT3A 4PYAA 2FJAB 4L8JA 4II3A 3QIPB 2KFZA 5DLGA 1PAEX 1RABB 4P3IA 3OR2A 4LIWA 1UVJA 1N05A 3PTWA 2MKYA 3KG0A 3IR6B 4KKTA 3G6EB 2O1PA 1YKWA 1QTNB 5HMYA 1TL1A 5T7LA 1Q81T 3THVA 1Z4UA 2YQ1A 1Q7YT 5L9NA 2QA4S 4C0SA 4KFBB 1NSAA 2K8GA 4JI1F 2VU5A 3VTIA 2D3OR 1KJZA 1JLQA 5KFVA 2XSJA 1RTJB 3M8YA 1JLFA 1NPPA 3QFHA 1S6QB 1JLEB 3V4MA
chains in the Genus database with same CATH topology
5CZXA 4MK8A 2DR8A 4OHYA 1HQUB 3E01A 1V9OA 3TW0A 2Q6CA 2XGQA 2KH9A 4NLQA 3CC7S 4P6QA 2KG0A 3B78A 1CC8A 2KT3A 2WOMB 4F8RA 1VS3A 5B7WA 2ZH6A 2ZH8A 4RW7A 3HLUA 4NCBA 2HRYA 2ZNZA 3C6TA 3N6LA 3CD6S 3ZZOA 2NUUG 4DV6F 5GAEU 2CJBA 1LWEB 2I38A 5KFFA 4RW9B 2KM8B 1NNDA 4RUCA 1U48A 4MAKA 5JVGQ 1C0TA 3T5HA 4JI7F 4YB1P 3LP2B 4O3RA 3AAWB 4OHWA 2YKNA 2HYIB 3MM8A 1IJEB 3FRZA 3PVXA 1QAYA 3EXCX 3FJ2A 4A48A 4QWCA 4YUDA 5F8IA 2WBRA 2B7BB 3MUTP 2BQ3A 1XMQF 1HWKA 1JJ2R 4YP3A 1KQGB 4JOUA 4JI5F 1CC7A 1P6TA 1HBOA 1SB6A 2PD1A 4C3MA 3EYZA 2R2TA 3DRPB 1HNXF 2R7TA 5ITHA 3NRBA 1S1WB 4O0IA 4ECRA 2W4DA 3DLGB 1NKBA 2G13A 2DIEA 2ROEA 2XNQA 4I7FB 2JH3A 4RBTA 3K8WA 1RTDB 4WXWA 4UY85 2FVCA 3O1LA 2VQEF 1S9EB 3MR6A 3PEJA 1S1UB 4QR2A 1IKYB 2EFPA 1W25A 3I0SA 5GAGI 1YI2S 2EG1A 5U47A 4TU8A 3BEGB 4OI0A 1CPZA 5KT7A 2MQLA 3PIOQ 4JUZA 2P9GA 1Q82T 5KG0A 2HHQA 5KG5A 3MFIA 2RNEA 2P9EA 3GMGA 4IFYA 1NJIT 4BS2A 2X6XA 2XMTA 4RBUA 2IJFA 1I18A 1YVFA 2J7KA 5CYMA 5HLFB 1NK7A 2Q43A 2B43A 1Y5IB 1RKJA 1VQPS 4J37A 3JTNA 2ZH9A 3BQ2A 5DLFA 3DYAB 3GFXA 1ULRA 5EGYA 3IR5B 2E44A 4KKOB 3NNHA 1B0VA 1U25A 3H20A 4O44A 4ZPTR 4AVZA 4K59A 2AYMA 2OO4A 5JJBA 2UUCF 1WORA 5B0AA 1C0UB 2JVOA 4Q8EA 4DEZA 2R7XA 3Q23A 1R0AA 2D74B 2FGOA 3DRSA 1D8ZA 3K5PA 1VOMA 2VQFF 1R8CA 1BQMB 1EP4A 4UUXA 2X1BA 4ICLA 3Q0AA 2HMIB 4RU9A 3OLAA 2GA7A 2B9YA 3CDEA 1KLMB 3IA0A 4G1QA 5E33A 5GMKa 1N36F 2MGZB 1SV5B 1X4CA 4HT5A 1HI1A 3IS9A 1VC5A 4TLQA 2XCAA 1TKZA 3HVRA 2OIHA 2DPJA 3M9OB 2BJEA 5LJ5Y 2ZZQA 4DSEA 1YBAA 5M2RA 3DLEA 4DJBA 3BS9A 1XR5A 3O2IA 1BWEA 1S1XB 2W8KA 1U7LA 3NCRA 5C42A 4KQZA 2HLTA 5J2QB 1WSRA 2CPIA 2N4CA 3THPA 3QIPA 2ZUGA 4DS4A 2OMLA 1RKIA 3QIDA 4Z2XA 1HBMB 2PA3A 1RP5A 2AWZA 5CYQB 2XBPA 4OI4A 3BCFA 4XLEA 1WOPA 1T3NA 2NZ4A 1T03B 1U1LA 3H4DA 4Y2IA 4J9SA 2WONA 2YWFA 3PR4A 2AJ0A 1RT6A 3OXFA 1Q86T 2GHVC 3U27A 1R43A 2KU7A 3VF0B 1HW8A 2XLJA 1Q53A 3ITHA 2CPXA 3IGVA 4KO0A 2ZH1A 4U7CA 4FP9A 2VD3A 5KFOA 3TR5A 5F0UA 3AA9A 4B08A 1SJFA 3OAAA 4W92B 2U2FA 3GQCA 1F5AA 2RQMA 3CCZA 2UVUA 4ID8A 3OTOF 2DPIA 2PE8A 2DNYA 5DQGA 3GIKA 2JLEA 5MAOA 2IYGA 2XI2A 3HVWA 4K5SA 4IKAA 1ZH5A 3HHDA 4J9PA 3SV4A 3OSPA 3DN9A 4ZHRB 2ZH4A 1N88A 2BDPA 2X85A 1Y0HA 3LPYA 3GVKA 1OPIA 3T1YF 2Z2LA 4KFBA 4DL3A 2DR7A 2HHHF 2L9NA 3IAS9 1U1OA 3KK3A 1YSJA 1P1TA 4FYDA 3C6UA 2KJWA 2DGOA 1RT1A 4DSIA 3VWSA 4ZVFA 3R1LA 4N41A 5F8JA 3Q2TC 2G4BA 2VG6A 2R9LA 3MMBA 4B9LA 4EO8A 3MMAA 2ZOGA 3JSYA 5KFNA 4ES2A 3K58A 3UCGA 5A8KA 1VJSA 3TARA 1RTJA 1WD6A 5GAGU 4XKVA 4LIRA 3ZPNA 1NK6A 2GX8A 1UVKA 2NUHA 4YR0A 4K4UA 3NBPB 3M30B 2B7CB 3JSRA 1RTHA 1KVIA 1S6QA 3UCZP 3DLLQ 4MKYA 2B4VA 1Y4ZB 1F2GA 2Q6BA 5AE2A 4KKUA 4O3OA 1SJ4P 3NGDA 1M5VC 2FJVA 1HQUA 3HHNB 4M63A 4NLGA 4ZP6A 4WE1A 3ISZA 3H2VE 4DFMA 3MD3A 3M2RA 2XS5A 5EDWA 1OO0B 1SUQB 3WDOA 4XKWA 3QYYA 5E3QA 3HXMA 2KDOA 1MMNA 4YEAA 5GAHI 3G6ES 2VUGA 5DDRC 1HNZF 3NS5A 4JBCA 2BUNA 3MEEB 1QAIA 2OMOA 1LWEA 4NLUA 1KNZA 3KWMA 1FKPA 1M0SA 1IUJA 1V3SA 2L48A 2MZSA 3PW5A 1U1MA 4DR4F 2MY8A 3LP2A 1EFRA 1U09A 3F73A 4XDCA 1N0UA 4X66F 4N8OA 4Y2KA 4B3GA 2EG2A 2X1GA 2C2RA 1JLCA 4OQJA 3VZIA 5IS2A 3OUYA 3DRXA 5A8RB 1Z1ZA 3D28A 4ZPDA 4PRFA 4JI2F 3KKFA 4B3FX 1N33F 1VQ4S 4FXWA 4KSEB 3UNGC 1S0NA 5A6WA 2ASYA 1B0PA 2OPPB 1Z2ZA 3DRPA 4NLPA 2HHXA 4OZ1A 1G2EA 4ILLA 1S1WA 2JFDA 4B17A 1S6PB 4J5OA 4ILMA 2OSQA 3CB4A 4I7FA 3A3GA 5IM0B 3KJVA 3GIIA 3MEGB 3RBEA 1RTDA 4DWIA 1LK7A 1S9EA 4CO2A 1WACA 3H2LA 1S1UA 4XLFA 1IKYA 2E9TA 3CCWA 3T53B 2LQ5A 2QIFA 2NREA 2GQ2A 4K0KF 4E8UA 3IXQA 2Q66A 4X4UA 1G3OA 4IH5A 3SI8A 4ZA1A 1XNQF 2FD2A 3LQVA 3VAFA 1KFSA 1TAUA 3LF0A 4EZ6A 3SXLA 1YTYA 5KG4A 1FNXH 1U6BA 1J5EF 1KOOA 3LGNA 4JMQA 3PX6A 5HLFA 4DR3F 1W9XA 4O4GB 1Y5NB 2ZE2B 3BSNA