1VLYA

Crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
323
structure length
323
Chain Sequence
FTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLHIEPLPYSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Unknown protein from 2D-page (Spot PR51) (b2898) from Escherichia coli k12 at 1.30 A resolution
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Unknown protein from 2D-page
total genus 84
structure length 323
sequence length 323
ec nomenclature
pdb deposition date 2004-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.160 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1vlyA03
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1vlyA02
3.30.70.1630 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vlyA01
4PAAA 1WOSA 3A8IA 1VLOA 1WORA 4P9SA 1PJ6A 1VLYA 5L46A 1PJ5A 1PJ7A 1V5VA 1WOOA 3A8KA 1WSVA 1YX2A 1NRKA 1WSRA 3GIRA 4PABA 3GSIA 1WOPA 3A8JA
chains in the Genus database with same CATH superfamily
1TFYA 1E63A 2ABYA 2HK2A 2FLNA 4ZVPB 1OGIA 6FD1A 1TR0A 3IS9B 3PIPQ 2CVEA 5J2MA 3MEGB 4LFBJ 1Q95G 1Y5NB 4NLVA 4ER8A 4AYBD 3MCSA 5AXKA 3OFNA 2CQPA 2HNZA 1DARA 2HIYA 3H9NA 1PJ7A 3R27A 2F40A 5L38A 2RRBA 4RW8A 3PFOA 2NYIA 5HZBA 1JLAA 4YHBA 3OFHA 2C2WA 3D5MA 2X85A 2F8EX 1Q0NA 1U1OA 1BWEA 1QH0A 5F8IA 3LO8A 3MM7B 1Z2LA 2KO1A 4OJ1A 1FVSA 1O51A 2BJ3A 3UDLA 5J1EA 2MXYA 2RSQA 3TZYA 2PIIA 4GO5X 4USVA 4EK2A 3Q23A 3RR7A 3ZZZA 1NH7A 1WEYA 2OAUA 2XY6A 3B4MA 1HW8A 2FVCA 1IR1A 4MKYA 2DRAA 4K8RA 5ETSA 4IO1A 2BX6A 2VOOA 2MQMA 3JQQA 4PGOA 3BC9A 2IMWP 5A76A 2AJQA 2PC6A 3FEXB 1HHTP 1TL3A 2OD4A 4NYOA 2DR8A 1QGAA 2CVIA 4Y0FA 1UEVA 1PC4A 1LQ9A 2V0NA 3J81k 3EZ5A 3D6HB 1RTHA 3F0NA 5HI7A 2DNGA 5ADZA 1RAAB 3WQZA 2E9TA 2YVSA 2BJ9A 4KGVB 2ZZTA 4FF3A 3M2VB 3ZC4A 1RTJA 4DDFA 2OEKA 1YJRA 4LF6F 2D1CA 2BANA 3D1QA 4DI6A 4QWCA 1NHUA 3M2UB 4RPFA 2E66A 1UJ5A 3PEJA 3B82A 2RQ4A 4RW7B 1JLAB 2DNHA 3PHTA 2BANB 2WTFA 2Z57B 3IR6B 4PG6A 2BRLA 5FLXY 1H38A 2V4JB 2FIUA 4JV0A 1KC8D 3LQEA 3QRRA 1K0TA 1TV6A 5B0BA 5M2PA 3ZPNA 4WFAQ 3DI6B 5TY0A 4WFBQ 2UVRA 4F4ZA 1N56A 1RT2B 4PG7A 5HP1A 1AXQA 1CJKB 3KK1A 2DETA 4LSLA 1J2VA 2MQPA 3MD3A 3A3PB 3DOKA 2M7SA 2VPZB 3ZZOA 3MR5A 4B9LA 2ZBPA 2F4VF 2AJ0A 3D6TB 5I42A 3OXLA 3EWGA 1Q4RA 2HAFA 2HVDA 2KN4A 1XR6A 3KXDA 1VBKA 1QUFA 4H4OA 4OYIA 4EEYA 4G7WA 3MCOA 4YB6A 5DS7A 2PMDA 2OSRA 2ZVIA 1QG0A 2EBEA 2AZ1A 4BWMA 5IWAF 4DPYA 1UCNA 2VG7B 2L9WA 4DV3J 4DL7A 2ROGA 1IQZA 1VIXA 3JQJA 4JI4J 4XTTA 3D7SB 1X4AA 4RLZA 1FRMA 4DR6F 4AQYJ 2LQ9A 1B2RA 5IYPA 1R8AA 3UPFA 2JLEA 2QE5A 4IRKA 4LF4F 2CJBA 1TTTA 1ZM9A 1JLGB 2X53S 4F2RA 4F3QA 1FRKA 4ES1A 2J7UA 3ENAA 3K5OA 1HL6A 2YNGB 3R2DJ 4YQWA 2YXLA 1X9WA 1LWFB 2H51B 2RNEA 4YDXA 2NXJA 3NS7B 1PJ6A 1YI2B 4N56A 3WBJA 5J2QA 4FN5A 4O3NA 3BH4A 3PO4A 1LWEA 3PW0A 1E6YA 1DBDA 4ECQA 2ALYB 5KG0A 1XTZA 3EGVA 3MOZA 4ECYA 2Y1LB 1RHRB 4NCGB 4DR2J 4UZFA 1MSWD 3OEEA 1P9YA 5CZVA 1UD3A 1YLXA 4ZPCA 3I4HX 5IQQA 2MHEA 3JSYA 3CTAA 5SUHA 4DK0A 3BKFA 3IAM9 4B3MJ 3WX8A 4DV5F 3Q8SB 1UWAA 4J7CA 4B3TJ 1PYOB 3KUHA 3MEKA 3PR4A 4ACAA 1CC7A 2VB6A 5HL7Q 3KHRA 1UETA 1GAQA 3CCRS 2BJEA 3C3LA 1KRPA 2RS8A 2NR0A 4M5KA 3PZPA 4BBYA 1FFSB 3T5KA 3S8SA 1G1XA 3NOCA 2KFZA 2QMWA 2ZM6J 3Q38A 4FF2A 1VC0A 4FDFA 4JI0J 3MD1A 4QIGA 1TAQA 4WZKA 2NSCA 2RKIB 2ATCB 5E6TA 3GZ7A 3O5TB 3QT5A 1RCOB 1P9QC 1A9NB 4I2PB 2EPIA 2YNFB 2D9RA 2JDIA 1N8RD 1FE0A 3U6KA 2G0CA 4R8UA 2AYMA 2BE2A 1YI2S 5J1NA 2U1AA 2DNOA 2PGCA 2QMUA 3HDSA 1GFWB 1RABB 4EYIB 1J9ZA 1Q79A 1CSJA 4XLAA 2WR8A 4USIA 4EBDA 1WTBA 2ZH8A 5HJYA 4P72A 4FS2A 1W9XA 2Z2MA 4ECTA 4B3SF 2R8JA 3M2RA 4O4GB 4DFKA 2IM2A 4II3A 2NS1B 3AHPA 4C8YA 1VYAA 3HHNB 2CADA 3FEYB 3QIPA 1BC6A 1EZZB 1U24A 3H40A 2FHKA 1WSRA 4IFYB 2KDOA 4RBTA 1NPPA 2AEJA 4K4SA 1BE4A 1XMQF 3NS5A 2J6UA 2KB2A 5MAOA 3G6XA 2EFVA 4EGLA 4IDKB 4GQNA 3L95X 3DRXA 4WE1B 3OZVA 2WONB 4CLKA 2VA3A 1RWOB 2FGCA 2G1DA 1NZAA 4DL3A 1S1TA 3CPXA 3TNVA 2AD9A 3NGDA 1EETB 1KTVA 3DM2A 2XGPA 4ED1A 2LKZA 4QPXA 4DV2J 4U7CA 4ELTA 3CIZA 1NSAA 1EFCA 5KAKA 4K2JA 2RRNA 4BDPA 2O66A 4LVNP 4QR0A 2HRTA 2BUNA 3OZWA 4ED5A 4M4SA 1E1RA 3HP6A 2ADCA 3MAAA 5C2GA 3NGKA 1IKXA 1Y5IB 1H8EA 1RXOB 1B0TA 5KG4A 3SCJE 4USHA 2B5JB 4HL9A 1R3NA 4U67Q 2RF2A 1Q8IA 5F9LA 3OLAA 1G7CA 1KQKA 1KP6A 3OTDA 4OYAA 1YIJS 3TQ1A 3U1NA 3SXLA 1RP5A 4H9GA 4CO1A 5ETVA 5HQMA 2HGNA 3IG1A 2XOKA 1VQ9S 2ZUGA 2DRBA 4LFCF 3D0IE 2ZH1A 3H59A 2FGOA 3MPWA 2KYXA 4HI2A 1X9SA 3KL9A 4QPTA 5KFEA 4Y7CA 1XQIA 5ETQA 2CZ4A 3BV8A 3GV5B 3LGMA 4ECVA 1U1QA 3ZTSA 2ZZQA 5AJ3J 1JA0A 3GIMA 1MLAA 1I8DA 1U4BA 1EETA 2HVZA 1YHQB 2BACA 3DCAA 3KFWX 3K7RA 2KYZA 4NLGA 1GTHA 3AY0A 4Y2MA 3QLHB 1KONA 3V6KA 4X7DA 2M3DA 3KHHA 3BSAA 5DG9A 3Q22A 1UWBA 3T1HF 5A8RA 3QT6A 1AT1B 2OFGX 2W4CA 5C5JA 3F41A 3HD2A 2ASYA 5AE1A 1F3FA 2OK8A 4TU8A 5A6PA 1HA3A 1CULB 3MMBB 3NGTA 3K0JA 3SLDA 5F8JA 4DR5J 4DJBA 4QR1A 1QGZA 4L8JA 3KHLA 3BH7B 2X6XA 4Y28C 2YX4A 1QAXA 1HA1A 2G13A 2ZE2A 3CO0P 1KC8T 5DDOC 2WVFA 2W9CA 2P8IA 5D4PA 1O0PA 5KFJA 2V4DA 5KOWA 2WYRA 4WIIA 3H2UB 4FVMA 1SJRA 4AL7A 1T9VA 2D9PA 1VK8A 3DKDA 3W3SA 2WPDA 4J9MA 3IRWP 4K4TA 3PW5A 3ILIA 2XZOA 4JI7F 2W01A 1R0AB 3S01A 3QWUA 2MQQA 3G4SB 3VAMA 3MOJB 3TAMB 1UWBB 2VFUA 3Q24A 1BUXA 3EDRB 3L7OA 3MM5A 5C7PA 2VICA 5CYQA 2EWHA 1QE1B 2LZJA 2QTZA 1R0CB 2EK1A 2GQ2A 2GAGC 3UR0A 1Q1KA 1LFWA 3EX7B 2XZPA 5A2QU 1BMFA 4QOTA 2QL9B 2WSFC 4DPOA 5A8WA 4X66J 2XG8A 1N5TA 1JLQB 5CA5A 1TK8A 1PJ5A 4YP3A 3AOCA 4J9UE 4OYMA 4J9SA 2JH3A 1IJFB 3RY8A 3W2VB 5BYQA 2XCAA 4K5SA 4XQFA 2ZNZA 4HT7A 3U1MA 2CPJA 3G71S 1APSA 3KK2A 2OPRB 2OYNA 1U8WA 8RUCA 1SIZA 4O0IA 5FA6A 1WHXA 3HJVA 4QIWD 4UAJA 2HS3A 1X5OA 3IWXA 1PILA 3L3CA 2DT9A 5B08A 1X31C 3QO9B 5A6WA 4LBZA 4XOTA 1YJUA 1YRUA 3A3OB 1TUGB 2JL9A 2G0JA 4XPEA 1S1XB 4ZP9A 2ILYA 4L72B 1T03A 1XNQF 1X8DA 2EFQA 2Y3YA 4X07A 4Z4TA 3I9V9 2YNHB 2RUGA 3NBPB 1N34J 5HROB 4KBIA 4AD6A 3ASPA 3I0SB 1D9FA 2H48B 5DQHA 2PO4A 4ECZA 4P1VA 3I5AA 1EQMA 5KFNA 2WW4A 3X1LB 1T9TA 2HGMA 1RDRA 3P5TL 4NLWA 3H5XA 5I3PA 1HBUB 2OPQB 4NLXA 3GFXA 3G82B 3W2GA 1H2TZ 3AJ2A 1T03B 4ZVSB 3NAIA 2XNDA 3MTJA 4X84A 3VZIA 4MJKA 3CE8A 2OPQA 4KC5A 3TZXA 1NRKA 3P6YC 1OWXA 4RW4A 3ASTA 2JX2A 4PXDA 3RAXA 3I55S 4P75A 2E1BA 2L41A 2E7XA 3TA2A 3Q8QB 4UUXA 4G1VA 1DRZA 3DN9A 1U25A 4XM3A 3THPA 3ILOA 4OJHA 4Q8EA 4J9OA 4M2LA 4I68A 2AF6A 4LQ3A 2HK3A 4C4WA 4UZCA 3CW2A 2WB4A 4H4OB 1FESA 3TANA 1U09A 2W24A 5F4OA 3PVXA 3GVLA 1VHEA 1XNRJ 5KG5A 3KK3A 4ZPDA 4DX8H 1D8ZA 2VKRA 2DJWA 2VFRA 5IM0A 3QFRA 1N33J 4WTYA 3D1OA 4H4MA 2HHHJ 2O1PA 4ZLLA 1S48A 4CDIA 1EAYC 1YGYA 3JSMA 3GSDA 3K59A 1R43A 1K8AD 3ENWA 2V9WA 1XERA 4XLEA 2FVRA 5HMYA 2GVDA 4J37A 3ZNJ1 3K89A 4QUZA 1YBUA 4M5DB 4IUFA 5B09A 4M5DA 3TI0A 3WNCA 1F60B 3H5UA 2CC2A 1X4DA 3CNQP 1TELA 1G4CA 2DGSA 1SH3A 2MZ1A 2JVOA 4K0KF 3ZC3A 2VG6A 3C15B 1XMOJ 1FCAA 4DV3F 3EE3A 1SJQA 2B43A 3M8WA 1LK5A 2V8DA 3AXMA 4WQMA 4ZVFA 2Q79A 4C0BA 2OK7A 3R1LA 3DFEA 4ZA1A 1UVLA 3P49B 3ZBTA 1TK5A 2R7UA 1HYSA 2H65B 5D3GA 1HLWA 3OXGA 2B9XA 5IM0B 1NH8A 1E6VA 2PT0A 1R5BA 1FKAF 4DQQA 2DNZA 5THWA 3E8OA 1WACA 1VQKB 2W7OA 2VJIA 1RHQB 3S7RA 3RBDA 3KLGA 5CCLA 4YR0A 2MQLA 4OI0A 1RAIB 2CPIA 3NY0A 4ALZA 5L1JA 2KTQA 3A1YG 3EICA 3EPIA 1H3DA 2WBMA 3W2WA 2HNDB 1Q7LB 5E7OB 2K8GA 1W2BB 3OE7A 2FHJA 2VZLA 2I1RA 1S6PA 2HBQB 2DNKA 3K8VA 5IYRA 1H2VZ 5GAGU 1RWUA 4C11B 2KL8A 1N5SA 4ACBA 2YH0A 2HHQA 3WC2A 2A6OA 4DG1A 1RLDA 1K8AT 2E5IA 3WXMA 3G82A 3FSIA 3GG1A 1HQEB 1HQUB 2BEFA 1N6QB 1UJ6A 3DRPB 3VMFA 3N9UC 1X7VA 5H9FK 2HZCA 4RW9A 4WXOA 2VBXA 3IFEA 3C14A 3EXYA 4CM2A 2JEGA 3VO2A 1U47A 4LVOP 4LMZA 2F1FA 4FS1A 1YDLA 1P1TA 4HTJA 4I67A 1NXIA 2ALZA 4OI3A 2FJXA 2RDJA 4C0OC 4NCAA 3B54A 1X0FA 5LSRA 2BJ8A 3MI7X 5KFGA 1ZTWA 2EKYA 2XO6A 4YALA 2M52A 3HM9A 4R5PA 1S6QA 3W8PA 2V7XA 4X06A 3BNWA 1FJCA 4DSFA 3JYTB 2F43A 2J8AA 1J5OB 2W8KA 4C48A 3RRHA 1FRXA 1KS2A 1S99A 4N8NA 3E20A 2CG4A 4M5GA 4O3PA 1HKAA 3C46A 2XCPA 4FF1A 1GXTA 2OTLS 2KHDA 1TL4A 2P6TA 3KG0A 2QN6A 2QA1A 1HNXJ 4A8OA 5KFZA 4J9QA 3M6UA 1K1SA 4F02A 1RU2A 3AJ1A 1PGZA 4YAUA 2FC9A 4L74A 5KG7A 3QSYB 1KFDA 9ATCB 1JB9A 2QN6B 3L09A 3DLKB 3WDOA 3CCZA 4FYWB 5HQ8A 1NB9A 2GMLA 5A88A 4HKQA 3GFYA 4NNJA 4JI5J 3NG8A 3ILJA 4XKVA 4V19X 2GGPB 5KOXA 4KE5A 2HQGA 2W4PA 2CWXA 2E7WA 1F9EB 3BSOA 5HJXA 5KFVA 3KLGB 4DV1J 3DRSA 2DEJA 2GC8A 4QIFA 1RYRA 5D4NA 1F3VA 5HMZA 2R7WA 4JV5F 4DQRA 2UXCF 4DZDA 1CNFA 1YRTA 1KVJA 3SDEA 3W5XA 2I1LA 3BR9A 3CCSS 3QJLA 3V7AA 3LP2A 2JFDA 5KFLA 1F1BB 1Y9OA 3MURP 5D4LA 2X51A 1F5BA 2KI2A 4RNMA 3CD6B 2ZHOA 3C15A 2VHGA 5D78A 2DGQA 4FWTA 2VODA 1SL0A 3FFIB 4JUZA 4C7QA 4TU9A 2RT3A 1DLOA 4P6QA 5DN6A 4QU7A 3A13A 2L08A 2YNGA 2CAJA 4TMVA 2XMAA 1EP4B 4X4NA 4AF6A 3I0RB 3FSYA 1Y3KA 2ZUAA 1KD1T 4XAKA 5F4MA 3FQKA 5DG8A 2A18A 3UN3A 4RW6A 4YB1P 1ZTTA 4PXBA 4Z37A 4UY85 4XN3A 4F4AA 3PHEA 3TW0A 4RW8B 4OYOA 3MUMP 1E3XA 1DQ8A 4RCYA 2VQFF 3T3FA 4ROXA 3UCUP 3U6BA 5CYMA 4WYWA 2BYCA 5A89A 1FRJA 1BJKA 2XGQA 1FFGB 5CXTA 1R6VA 2H5JB 2F9DA 4Q7AA 2DO4A 1EXMA 3RBEA 3V6DB 4YB5A 4ED6A 4RNFA 2F8HA 2MDAA 1FEHA 3CCVS 2RQKA 1O5JA 4J9LA 2MKCA 4CLSA 1U2RA 1WPCA 5G0RB 4RDJA 1N4LA 2I9SA 3MM9B 3I5CA 4OV1A 1RISA 2PMZD 2ZFHA 3D6MB 4IRDA 5GVQA 4HACA 5DZ6A 2W2QP 3BKUA 4AXJA 2ZZEA 4AT1B 3K5NA 4NI2A 2GFFA 4K4ZA 2XZLA 2HQFA 1EP2B 4OP7A 3OQ2A 1RSCA 2NQPA 2XQCA 3JSRA 2YKNA 3R3TA 2VKZG 2MZTA 3JSBA 3SMZA 3EXCX 3SV3A 3J80Y 1VR6A 1SVDA 4L3KA 3H4BA 3TX0A 1FWPA 2MHNA 3BQJA 1DURA 3CDEA 4OI1A 4CO0A 2BPOA 4RBVA 2ROPA 1EWYA 2CPEA 3C6TA 3LALA 4UUWA 4UOHA 1RTJB 4B3RF 2ACMA 5E3CA 3VR1A 4DQSA 3TAMA 3A4TA 4P2SA 3J81U 3TARA 3OFEA 2BJ7A 2H3EB 2VL1A 2OSQA 3CMAS 3WNDA 3MM7A 3OL7A 1SM4A 3H98A 4GVBB 1P4MA 3DGPB 2EFNA 4ETXA 3HSZA 1BX1A 3H5SA 1FD8A 2CJAA 4ZLNA 3Q86A 3TOQA 1FHTA 3UD3P 3JYTA 1U2FA 5IWAJ 3SV4A 2MZJA 1HBNA 4CH0S 1HNXF 4ZGQB 2ATLA 3AOAA 4ELVA 5D4OA 3QWPA 2EBGA 1FJEB 2V5HG 4V19J 4PWDA 2B6AA 1VQPB 1TZ0A 3LQVA 5KFDA 2PA8D 1TFWA 1S9EB 1NK7A 3OT9A 2D74B 4KO0B 2AEMA 1H6KX 2IRXA 4BCAA 2B4UA 4KR0B 2V4QA 2K1RB 1V5VA 3TUPA 2B8PA 1S4FA 2QMXA 4UTGA 4V1Ak 3W2IA 3MM9A 2ZZGA 2ZBCA 2DGTA 1XK8A 4ICLA 5DDPC 4LIWA 2CK3A 1KQGB 5T7LB 2MJNA 3VGSA 3KLIA 2DVIA 3H2LA 2F8MA 3LP2B 2ZZFA 5F3TA 2X1BA 3IBFB 3G6EB 2Y8WA 2PEBA 4ZPWR 2ADBA 3FPPA 1XIQA 3QE2A 1RJJA 3K5PA 4KSEB 3LH2S 1RAGB 1WG5A 4B3OB 2AQ4A 1KFSA 4NCBA 2EG2A 4ZP7A 5L8RC 1K73D 1JWWA 1R0AA 1AB8A 3HVWA 2LFVA 1K9MD 4JI0F 2BVNA 2Z6BD 3AH6A 1K73T 3SCKE 2I8EA 5GAEU 3IRXB 4DSLA 4M5LA 2K7KA 3E01B 3MPUB 2EXUA 3UWTA 3GV7B 1REVA 1HQ2A 1WTHD 4B43A 4YXWA 2CPFA 4B3MF 4NASA 5KSWB 4PQUA 1KZLA 3Q2SC 5H9EK 2D74A 1FWKA 3Q8VA 4X2BA 3O6QA 4CH7A 3FGVA 1TMJA 1HARA 2P9EA 2XBPA 1SC3B 1SH0A 4JI1F 1JLEA 5L9XA 4DS5A 4YUDA 1MNEA 3GQCA 5HQLA 2V7TA 2JEJA 4NPOA 4ZVQB 2MGZA 4P25A 4K5RA 1FDRA 1W2BR 3MTKA 1FK9B 1T7PA 4P2XA 2VFTA 3CIMA 3T51B 1WHWA 4UZUA 1HFEL 1I1GA 4F8RA 2QLXA 3DLBA 3V4IB 1QVFB 3AVWA 4MKAA 3GJTB 3EZUA 3TQEA 1UFWA 4NLUA 3ISND 2VC0A 2BA9A 1X0PA 4MH8A 2P9GA 2VJVA 4KKUA 2DYAA 4I64A 2VJJA 5D15A 3MECA 3PJXA 3FJ2A 3K2YA 2GHVC 2I2YA 3H4DA 4USUA 4I2QA 4DQLA 4NBSA 1AFIA 3BQ0A 3UDEA 4OX6A 1M5KC 4Z4ZA 1SV5A 1LWCA 1VI7A 1X5SA 3UD5A 2ZOFA 1L3TA 2MKKA 2UV8G 1HR0J 5LJ5Y 4Q44A 3V81B 1RAHB 3WBKA 5ETNA 3CCMB 4TY8B 1QY7A 2HHHF 1RWWB 5TRDA 2BMWA 4IFVB 1IVZA 2RF2B 3GVKA 3M9MB 2HFVA 3IGNA 5U47A 4PKDB 3DXSX 2IRYA 5F8MA 2IVFB 1S0MA 3JXOA 4NLRA 4FPRA 1NZ8A 1YJNB 4C97A 2DIVA 1OGJA 3Q39A 2UUWA 4LSZB 2Y1JA 2BKOA 1HHSA 3SEOA 2CQ3A 1CJUA 1BMQB 3GCXP 4K0KJ 4OZLA 2GS8A 1S59A 1NSKL 1SC4B 3NL0A 3CMEB 5E3PA 3T53B 3LWMA 4IFVA 3UDCA 1SL2A 1UD6A 5DDRC 4GKKF 2VUGA 4Z4SA 3GLJA 3CW2C 3OTOJ 4U9UA 3D4JA 2FYXA 4NLDA 1COWA 3GWCA 1Y10A 2N3OA 4CI0B 3NCPA 4M8LA 1RE1B 4CYUA 4DCOB 3D1HA 3HHKA 2DNMA 1J5EF 2VBYA 1PC5A 4X4RA 3HPOA 1N48A 3CT9A 3MCMA 1H73A 2W25A 3CJ5A 1V0FA 3GIIA 1UEUA 4RX6A 2DK2A 4OFZA 1RQRA 1S0OA 4OHVA 3DYAA 4CTAA 1HBOB 3PRVA 2JN9A 4KPYA 3I0SA 2DGWA 2Z0GA 4NZ6A 1KTQA 4O4RA 1DQAA 1QUPA 4AF7A 2XS2A 1JLFA 2RHQB 3LGHA 2OBSA 2O67A 3ZXWA 4LF7F 2V34A 4ASUA 2HYIB 1PAEX 1X5TA 1RAJA 4P3IA 2UUCJ 2Q66A 2Z30B 3FKSA 4FNIA 4KY3A 2VC1A 3CESA 4RDLA 2EVZA 1FE4A 1GEHA 3IGVA 3Q8YA 4K4UA 2GREA 2HWHA 4R8UB 1FA0A 3G6YA 1QUVA 4DPUA 5KFHA 1WG1A 2UXCJ 3UI3A 2EFGA 3QGPA 1U6ZA 1MU2B 4NRUA 4RR5A 1URRA 1KOHA 5LOQA 1D8YA 1TKZA 4EU0A 2A0FB 2SXLA 2C2RA 2GHWA 2LA4A 1JJHA 5GV8A 3K17A 2NLWA 3GIRA 1TQLA 3ZO7A 4IW3B 3NEKA 2KVOA 3PXGa 2RDIA 3NNAA 3NCQA 4A8KA 1RBOB 3J7A1 1RT1B 2HQIA 3I1FA 2UUTA 4CLFA 4NOHA 4QJVA 4TMZA 5GAEI 3W5YA 2KRRA 5E3AA 4PC6A 2DEUA 4DQIA 4X4UA 4HE5A 2DYIA 4ZVOB 2J6SA 2VH7A 1J5EJ 2GMJA 3PX4A 2DH8A 2HNZB 4TVAB 1L3KA 3GV8B 4K59A 3GU0A 4HDHA 3OJSA 3U02A 4PABA 2CNKB 2W6IA 2DGUA 3BBBA 5D0GA 1FNBA 2HZAA 3W7BA 1N88A 3MCAA 4NLYA 5D77A 2BABA 3VAGA 3IN5A 3E3XA 1EARA 5GAHI 1BHNA 4F50A 1SJFA 3OR1B 5E5NA 4DSJA 2GZOA 2JJ4D 2ZE2B 1X9MA 3AXKA 4YS2A 4RZRA 1IKXB 5LL6d 4LF8J 4ZCMA 3C14B 5FD1A 4CLPA 4W92B 2XZTB 5B0AA 1NNDA 3DMJA 4ZLJA 2UUBJ 4RW9B 2VNJA 1JX4A 3ONUA 3R7SB 3VNVA 5IS2A 2CJKA 1PYTA 2WJVA 5HANA 1TKXA 4XORA 4RD6A 5KW9A 2HBYB 2ZC4A 2J9CA 3NWRA 4ILLA 4OZJA 3N79A 1KR4A 1EFTA 2UXDJ 2AU0A 4NCNA 2HCJB 2N4DA 3I4PA 2DCLA 1T3NA 1NDPA 4X05A 3BO4A 5HXBA 2FY8A 4EMDA 4USKA 2YTCA 3AQPA 4MTPA 4KGXB 1CC8A 2NPIA 3CCLB 1WU8A 2LA6A 3EM1A 4ZITA 5JVGQ 3CD5A 2KRBA 7AT1B 4J9NA 3TJ9A 4XR6A 3I0RA 1VRUB 2JDJA 3HSGA 1RHUB 1W35A 4XLFA 1PKVA 1ZAWA 5F8GA 1LOUA 1Y00A 2KG0A 1U1PA 1YJ9S 2W8LA 1WI8A 3VQTA 2K3KA 3Q89A 5H9FJ 2BZ2A 4FXWA 3BGFA 3C16A 3ASQA 4B48A 2E9RX 1Y0YA 2X1AA 3BQ1A 3W60A 1ELOA 3U1LA 2IPOB 3Q83A 5HKKA 1IXKA 2WVDA 2L9DA 3OFFA 1HPZB 2FLPA 1YQHA 3IA0A 1UZHA 1FKOB 3A8JA 3BJYA 2K2PA 4DNRB 2OP5A 2MQOA 1MROB 2PSZA 3CMQA 1QGYA 4MIAA 1ZOTA 1FVQA 2L48A 4X4QA 4YELA 2CWKA 4Y2AA 1QLNA 2FZGB 4ZPBA 3CO9A 1G6BA 4UOGA 4DSKA 2BOPA 4XDCA 5G0RA 2Z2LA 1U6FA 1SC6A 1YBTA 4UZBA 2Y9HA 2R9LA 1VQ5S 4OYXA 1M1KD 1DQ9A 1OSCA 2AV5A 5B0GA 3R7BB 3V5RA 2C4TA 1WEXA 3KJNB 1FF2A 1FRNA 4PC1A 1AYEA 3M30B 4OZNA 4JI3F 1VQ7B 5EUHA 3HFZB 1Z4UA 2R8HA 3KWMA 2XI3A 3EVMA 2FHOB 1U1MA 4GMKA 3Q8RB 2JOQA 2GQFA 3RZAA 4FBTA 2OLWA 2CRLA 1KKHA 5IYWA 3FUYA 2QA4S 4HHJA 1LW2A 2BJ1A 1M1GA 2GJRA 1RT4A 4M5JA 2YKOA 1HD1A 5IYNA 1R89A 2DNLA 3DLHA 3SYZA 1NJID 2PEHA 1RA6A 1G3OA 4IH7A 3C8YA 2XSJB 2IRUA 2V7VA 3ONQA 1Q53A 1ROFA 4USTA 1JMTA 2NUHA 4GKJF 2XMUA 3AB2B 3KMSA 4B3RJ 4OQJA 3EDQB 4C0SA 4U9RA 2X3GA 4KH1B 2QGGA 1A6LA 1FTRA 2B6AB 4O4GA 3QFWA 2BQ3A 3F44A 2MKJA 2QL7B 5FDLB 2AMCB 4AE5A 1SKWA 3PEHA 4OI6A 1TK0A 1J27A 1M1HA 4KHPJ 3WC0A 3JQRA 4KT0C 5LXYA 2UP1A 1WD6A 1JKHA 4DV6F 3IR7B 3J7YI 1VQPS 1NCLA 3CRZA 5HP1B 2IFXA 2M5YA 1E64A 1HQUA 2C2EA 1QVFR 2HLDA 2CPXA 1VIOA 3M8QB 5H1SV 2EFPA 3QMQA 3H94A 1QAYA 3MPYA 2OJ3A 1XN9A 2V31A 1HBUA 3N28A 2M8DB 5FNZA 1RWPB 4I4BA 1RTIA 5HK4A 2BXJA 3FJOA 3HX9A 4LF2A 2PE8A 1T5EA 4LF9J 2C2ZB 3NBPA 3DLEA 2GK6A 4JP8A 4RKUC 3HT0A 3TA1A 2E1MC 4I1TA 3DRYA 3E51A 3HZGA 2V8HA 4ECXA 2ZD1A 3M4XA 3MM6A 5A2QY 4NYPA 3U7JA 1TVCA 3GYXB 3RRGA 2I5JB 3RB0A 4NI2B 2R7SA 2G2OA 2DR7A 1D2EA 1K9MT 3TEHB 3IG1B 4R0EA 1U2CA 2DNQA 5KFUA 4YOEA 2RQCA 2ILZA 1Q5VA 3CDBA 3FCHA 2W2OP 4MKVA 3VF0B 2EC0A 2W7PA 1CJKA 2WVBA 3ZZPA 1PYSB 2GJIA 2CIMA 3T6JA 1TL5A 4ZLPA 4K4WA 1DG1G 2NYHA 5DZ7A 2DRDA 4TN1A 1TV6B 5K14B 1UJ4A 1FFWB 4ES3A 4PC3A 1TMMA 3CCES 4DCPB 4KHPF 5EN1A 5KT2A 3I32A 3T6BA 1YJNS 4EH1A 5B0EA 3W64A 4U8YA 3JAMY 1PKUA 1KK2A 3MR2A 3UR3C 1Q16B 3DRRA 1F5CA 1Q86T 2V50A 1S10A 4CO5A 4P2FA 3DI6A 3V2UC 3TWZA 2QRRA 3D28A 4ZVUB 4WWSA 2XLIA 2HVHA 2O5DA 3CCUS 3HVTA 4WU3A 1VGYA 4CLTA 3TA0A 3LPEA 4PWWA 2CQDA 4C11A 3OVAA 4USMA 2DHXA 3OTOF 2ERRA 2ASJA 3W5VA 3CSKA 3T5JA 4RU9A 1V3RA 3CC4S 4MK7A 4P71A 4RM0A 1ZZNA 3DU6A 4OI4A 2G9OA 3WQPA 2PFDA 2F1MA 4P2MA 3PM9A 3CULA 4ILMA 1GQEA 2XULA 1C0TA 4Q2LA 3QGHA 5EMNA 2CQBA 5I3QA 3MEEB 5HMXA 2HFSA 3PR5B 3KKFA 1U7LA 3MMAB 1MMLA 1KLMA 5L46A 1D3WA 4TYAA 2VASA 2JNJA 2DB1A 1PO6A 2CNNB 2YKPA 2JSXA 3CPWR 4OHZA 4ZPVR 2VNIA 5K9FA 4MIWA 3W1YC 4A8MP 4WK3A 2KZZA 2XMMA 4A8YA 1A7GE 1Q8LA 4X8IA 4WZTA 5EHHA 1JIHA 2XS5A 3JTOA 1DZ5A 5DSZA 4P52A 2R6HA 4Z4WA 3TYTA 4DPWA 4B3XA 3R7NB 2MLZA 2HHTA 1VBYA 4JI2J 2CNOB 3POTB 4OYWA 5AXMA 2JWNA 1S57A 4MFBB 1BQNB 2VNKA 1TVRA 2KHCA 2OBTA 3NS6A 2C5BA 1YITS 3UNGC 1VQLB 3GR0A 2FVGA 5AT1B 5J3OA 4F0MA 4O3SA 4X64J 1JXEA 1NJIT 1I94J 3NCRA 2COLA 3M8PB 4C8LA 2FJAB 3A8EA 2HS4A 5T14A 2IBKA 1MROA 1SQFA 3ELHA 4OJGA 3LP1B 3ENQA 2W6JA 3OUYB 3R5GA 2JHEA 4I69A 2ZJQQ 1KD1D 3BGLA 3OUYA 1CQMA 3U2QA 2B5JA 3CDAA 3OHBA 4K4YA 2Q6CA 2R7RA 1Q8KA 2YNHA 2HWIA 2GVZB 2HFZA 1B23P 3UVJB 1WOSA 3CC2B 4OZ1A 4XK8C 1N5QA 4C8NA 2J6TA 3VTIA 4WZLA 1TU0B 1ICEB 3T5HA 2K7JA 4LRFA 5KT5A 2JLFA 2GVDB 3POTA 1FDNA 2E1CA 2DNYA 4CO4A 3GJRB 2QFIA 3CMMA 3CCUB 1VQ8S 3ET6B 1RB0A 4FXVA 5CHCB 1KN6A 1REVB 4ED3A 2R7QA 1U0HB 1FEEA 1WC5A 1TL7B 3LQ6A 2XGJA 4LR9A 3RAMA 1N33F 3P8BB 1PBAA 3WZ0A 3R97A 5A8AA 3KEWA 2RU3A 4FP9A 3W2FA 1Q82D 2R2RA 2Z8QA 4MYUA 4QYZJ 4B08A 3GG0A 1GR1A 4MAKA 4AUKA 3CC4B 2Q6OA 3J7AN 4RW6B 4OPVA 3PDNA 1GMWA 2G0IA 2LCWA 3M32A 1UMKA 3ILLA 1Q5YA 2VONA 1TKTB 3VHQA 4URGA 3QIPB 1Q81D 1VQ4S 5LMZA 3X3UA 3CD6S 2X7IA 3MMAA 2DKOB 2IJRA 1HW9A 4LUBA 3PTWA 1WDDA 3W2WB 2FVPA 3TVYA 2ZJPQ 5ETTA 3EVWA 1VJQA 5CCMA 3TZWA 2CZ9A 1QSLA 2X6YA 1X4BA 1SH2A 4DR5F 3KJVA 3D2WA 2QX0A 4DPTA 1T9XA 2VU5A 2R3VA 2BF4A 4RUCA 4DUZJ 1C0UA 2Q43A 3QO9A 2NCKL 1S49A 1WF2A 1B99A 2CQHA 2CNLB 4JYAJ 4FF4A 1ZM3A 3F56A 1HNVB 5I4MA 1WNEA 2HDNB 2Y8YA 4G6VB 1BXNA 2E1AA 1UVIA 1VISA 4JI6F 3FBCA 4Y3CA 1F60A 1WHYA 3Q6RA 2WHOA 4D3GA 5IXUA 2QYGA 3UCGA 4ANEA 3NE5B 3R9LA 3S6EA 3GJSB 3BYPA 3FBFA 2W9BB 2R8IA 3O8WA 4C3MA 1RWXB 3AFGA 1IKVA 2OI2A 1GX6A 4ECSA 4Y00A 3SBMA 4LF8F 3EYZA 4M5IA 1H42A 1IHMA 2B4VA 1VRTB 1KVIA 1WF0A 1ZS6A 3CCVB 3CWJA 3US5A 2XY7A 3VO1A 4URSA 4UF4A 3BCDA 2JIZA 4A8FA 2DIUA 4QW9A 2WSCC 3MAHA 3SSQA 4O44B 5IQ6A 2EC2A 2RHSB 1NSQA 3SZ2A 4UOFA 2IM0A 2M4MA 4F4XA 3CMAB 3NP5A 2MZQA 1MRZA 1DTTB 3ZTQA 3VGUA 4RJLA 2BJDA 4HI1A 4H4KA 3TX8A 4NRTA 3OL9A 2DNRA 5E3RA 1LFPA 4OX8A 2RAQA 5THXA 2R7XA 4WKRA 3VQSA 5KNLA 2LXUA 1T05A 1NKCA 3TJAA 1U1KA 2FD2A 3AVXA 1UKUA 1JB0C 4X4TA 1I94F 1D0EA 4N3GA 1VLOA 3MAAB 3BGUA 1QE1A 5DQGA 4AQYF 4XKWA 2RIJA 2BN4A 2EI5A 1IJEA 2POKA 3JTPA 3MGJA 1UD5A 1DDIA 3BO3A 2G1HA 3MMPA 2HBRB 3A12A 2DXDA 1NMEB 3CC7B 2UV8A 3QZ7A 3LW5C 1MN7A 2I5JA 4MK8A 4CZCA 4LBYA 2J0WA 5A8RB 1QD1A 1H7XA 3AQOA 2ACYA 1VLYA 3R6GB 6FDRA 4ES2A 3CGIA 4DUYJ 1IBLF 2EK6A 3V6JA 3MEEA 1S6QB 1B3TA 4G1PA 2HHXA 2GNKA 4WXWA 2BW2A 2QV6A 1OJ4A 3HKWA 4Z4YA 2F1LA 1FDAA 2QO3A 1M5SA 1ZA1B 1RBLA 3AD7C 3J81j 1SBRA 4GO7X 1F9FA 1HZEA 1NPKA 2L3MA 4PWUA 3BY2A 1QSYA 3HF5A 4X66F 3G96A 2EKNA 5FO0A 2A3JA 3WIUA 1HYSB 2XMKA 3KNGA 4TLRA 2RU9A 4ELUA 2DCUB 3RB4A 1RTZA 1HNIA 3KLHB 4DHVA 4AC9A 3PRDA 1SC1B 2C42A 4OLPA 3OV7A 1RCXB 5FJ4A 3PKYA 3CJ3A 4E2FB 3LGNA 1OMSA 3DOLA 4DU8A 5DETA 4CH1A 1GJRA 4LF5J 3W2VA 4P9SA 2W9AA 4BC7A 5HLFB 2QLJB 3EGWB 1RLCL 2W7AA 4OI2A 1ACMB 1U02A 1KLNA 4F67A 5GADI 3I82A 2P3MA 3OPKA 4AFFA 4ICLB 2L9NA 1NBMA 2LEAA 4FYDA 2J5AA 1G7RA 3DOLB 2ZDOA 3W61A 4ZHRB 1JXLA 1RTIB 2J0XA 4GRSA 3VAHA 4WIQA 1S5ZA 1U0SA 3V76A 3KG4A 1MN9A 3M1VA 2BV3A 3H8YA 4H4KC 4B02A 4KGMA 1LXJA 2JJ1A 3K5MA 2QFJA 4Q7JB 2RKIA 3GQBA 2E7VA 5KG3A 1UL3A 4FKXA 2YWGA 2ZXHA 3HXMA 2LP4A 2HQCA 1MWQA 2IIHA 2KJVA 3MHPA 1VQ4B 2GQCA 2VF3A 2XLJA 2HNYA 1RADB 4RO0A 1WKJA 2OMLA 4TNOA 3VV2B 4Y9RA 2U2FA 3KJFB 2LLZA 4NCGA 1HNWF 3M6WA 3CJ4A 1JLCB 2IM1A 1DTQA 2J0SD 4HYKA 2HHPA 2XNQA 3RJMB 1RT5B 3QT7A 5JBQA 3D26A 5JJBA 2ZITA 2Z2YB 3OHAA 4TY8A 4DUTA 2ZTNA 3THVA 1IKYB 2BE9B 1HNZJ 3OKXA 2MZRA 4B3FX 3N6NA 4RD2A 4RPBA 2RE1A 4Q2MA 3H42A 4NLPA 2HQDA 1VQOB 4N41A 3CJKB 1HWKA 3FZ2A 3DRRB 3SSRA 3DDIA 3QRPA 5SZTA 2DGOA 3U27A 4C98A 1S6PB 1EJ7L 1BQMB 1UVJA 4IYQA 1JQGA 1N0VC 1A8PA 2X6WA 2RUSA 4I7FA 5K5MA 2OEMA 1UMJA 4Q8FA 4HHHA 2VDHA 1VQ5B 3L7PA 4X7FA 2LU2A 5IT9U 1JJ2R 1H85A 4ZOSA 4BWJA 2V2ZA 4EO6A 2E5LJ 1AZSB 2N82B 7FDRA 4I6YA 1IKVB 3NGUA 2N7CA 1S9EA 2UZAA 2NUUG 2ZH5A 2B56A 3CCTA 3M8ZA 1TKXB 1VHOA 4DPXA 1QTMA 3CEDA 2GQQA 2CJXB 3IWLA 2M70A 4B17A 2FZKB 2GCFA 3OL8A 4YFUA 3GSIA 2KH9A 5BYSA 2HGLA 2MB0B 3CC7S 1NJZA 4DN0A 4F2SA 3V81A 5D8HB 4X4SA 2HWTA 1LW0B 4B9SA 3DLGB 1S72B 1CPZA 3LO3A 1M90D 4DFMA 1BPLA 3OTBA 3BEGB 3JQPA 3M8YA 1BQNA 2VD3A 4FXDA 1YVFA 2K06A 3RU0A 3T41A 5DJBA 2KVQE 1E43A 3FSXA 3CCRB 1VRUA 3W2EA 1JNRB 1RU1A 5FLXU 4OYPA 4OYZA 4QQBA 2ZBUA 1Q7YD 4RU2A 3CCMS 2AHOA 3DHWC 4LFCJ 1RT2A 1EFUA 3TO8A 3M2VA 1YTYA 1HR0F 5AXLA 1NPRA 3OP1A 1W7WA 3RB6A 3WNBA 3W9JA 3H7HB 3QNWB 1FJGF 4P12A 3D3BJ 2IYGA 4WKYA 5EX3A 3IR5B 4WZEA 5IFMA 1TP7A 2RVJA 1OYDA 3B78A 2AGPA 1NDHA 1F20A 3BGOP 5BYRA 5E2QA 1C4CA 1BQXA 1AW0A 3WHIA 2DITA 1V9OA 4HTIA 1OB0A 1XJWB 1V0EA 1E3ZA 1HBOA 2HVEA 3IO1A 1FDDA 3VGVA 1NDKA 2HNYB 4KTQA 1B7YB 3OW2R 2C2DA 1NK4A 4XNFA 1GT8A 1NK6A 4X64F 2GX8A 1S6UA 1RWMB 5IT9Y 2GVZA 2B7CA 3KLFB 3QAUA 5K8PA 5LMUF 2FJBB 3MEDA 2OD6A 2DHHA 3ZZRA 3CUNA 1WDTA 1TTHB 2ZEJA 5KFWA 4CT9A 1VQYA 3H5YA 1H74A 1WC4A 1OQ6A 5AXNA 1EX8A 1OY6A 3MPDA 1Y4ZB 1N5YA 1T11A 5BSYA 2M2BA 4DL6A 1DAXA 1T6XA 5I3UB 5L1KA 1U0HA 2R2UA 1VRTA 1YZ6A 2AGQA 2E5GA 2V2QA 2DPJA 4DLEA 2GIRA 2V9KA 3W5UA 5C24A 4FYVB 1R8CA 1IR2A 4Y2CA 2E5HA 4DV0F 4UOCA 4W98A 4Z4UA 3ZUGA 3AB4B 5CH7B 5F8HA 2LDYA 1XFOA 3PA1A 3P45B 5F4JA 4N47A 4G1QB 3Q8UA 3OTEA 3CCQB 2LU1A 3W9HA 1M5PC 3LAKA 1GMUA 4ID5A 2Q6IA 3AA9A 3LP0A 3TJ8A 2UUAJ 1MMDA 4RNNA 2Q6LA 5K14A 2VPXB 2YH1A 4OPSA 5K8MA 4X65J 4KO0A 1FX2A 2ASLA 4WWVA 4LSLB 1FRLA 2AJ1A 4C6AA 2YBVA 1KK3A 2OPRA 3ETMA 4HIZA 4DBQA 4DV4F 5M2RA 5E41A 5DG7A 2C3OA 3I96A 1HQEA 3OJWA 4P7TA 1VRQC 4RD4A 2BR0A 2KM8B 4C8KA 1TL3B 2B7CB 4NZ7A 3WX4A 3MAQA 3G71B 1W87A 4RNHA 2D3O1 2HURA 2B9YA 2JJ2A 4KRWA 2KXNB 3QLHA 1XR7A 2GJKA 1VQLS 1C0TB 3IP0A 6AT1B 4PWDB 3PYGA 4LREA 3M6VA 3E2EA 2AKWB 2WRMA 1IM6A 3CF5Q 4EBCA 4OZ3A 1A0OB 3NWGA 4WP3A 2CPDA 2IJFA 4J5OA 4K1XA 2C1EB 3PRBA 4KV8B 5J35A 2D9OA 1N05A 4U7UD 1UD2A 4QWBA 2EW9A 2OPPB 2YKNB 2BGIA 1LWXA 2G2YA 1T0TV 5L39A 2DIEA 3WYAA 3N4WA 3SQOP 4HE6A 1RZMA 1NDLA 2R9VA 5B7WA 4OV6A 2FQQB 4TY9A 3LANA 4ZV4A 4Z7YA 5HO4A 1QVGB 2V8PA 2CFXA 3M2RB 2PD1A 2Z4PA 1ZH5A 2QYCA 1RUSA 2RB7A 2H54B 1LNQA 3MMCA 8ATCB 3NLCA 3M9OB 1LW0A 4PYAA 1NUEA 1G7TA 1F9HA 1RYSA 4WZQA 1H8HA 4U7UK 4DWIA 2VPWB 4GC6A 2XLKA 4DOZA 2ZXIA 2QMUB 3HLUA 2BKNA 4LBVA 3R5BA 1EP1B 2DXFA 1YJWS 4F4WA 4LF6J 4O23A 4DN9A 4I7FB 2VBTA 4AL5A 4KYZA 5L1IA 4ETZA 3PUMA 1W34A 5CABA 4Y34A 4ZIVA 4CO3A 1JLEB 4CIOA 4FBUA 3LP1A 5EWGA 5ETPA 2FZCB 2P9CA 2IMOA 1N07A 1X4GA 3H90A 2JVRA 3ISZA 1HNVA 2LECA 1RAOA 2MQ8A 1D1NA 1QFZA 1IB0A 1WOOA 4D3HA 3KLEA 3OJXA 2IM3A 1D9DA 2HNDA 4NMXA 3DXBA 2J0QD 4CP5A 1XEZA 4CQ1A 3FRYA 2YQ1A 5B0DA 1KHVA 5F0WA 1BWVA 1MG7A 4C0HA 2QJ3A 1GK8A 4O3QA 4OHWA 2J8SA 1EQ0A 3LA0A 1XWLA 1RTHB 4XLHA 1DJ0A 4EYHB 3QATA 1BQEA 1UPMB 4WCEQ 1SKQA 3MMJA 4DFPA 3CDWA 4ED7A 2BQRA 5CD4A 3G9CA 1GTEA 1RK8A 3RGIA 2HS0A 2VFVA 2CQGA 3VCDA 4ZVGA 5ETLA 1G7CB 2W4DA 3CP8A 3ZZUA 4LBPA 2FJDB 2IY5B 1DTTA 3ZNUA 1FNMA 1OSDA 1VOMA 2RMLA 2MEWA 4JOUA 5AE2A 3OZUA 2DR9A 4PEOA 5J1EB 3BQ2A 4OOVA 5J2QB 4DR1F 1T6YA 1R8BA 1B70B 3PIOQ 1C1CA 3P27A 1P6TA 4L76A 3B8HA 3EUNA 4DR3J 4EO8A 3GPAA 2FJEB 1TKTA 2R7VA 1C4AA 3R5AA 3VAJA 1QDUB 1HD0A 5HVGA 3UD4P 1RWNB 1YKWA 4BHQA 2DEIA 4FPIA 4KAIA 4M1KA 4FYYB 5L1LA 2YWEA 2F4VJ 3SSSA 4EZ6A 4ZP6A 4CYUB 3D6FB 1H98A 1FX0A 2NPFA 3IBCB 3W2HA 1IBKJ 4XDDA 3GCWP 3A3BA 2M5SA 3LUYA 2MGZB 3I56S 4LBIA 4QWDA 1DHMA 1WC6A 4WFZA 2CBXA 3K57A 2AYBA 3A8KA 2MMYA 1UD8A 2DOGA 5IT4A 3SQGB 3I9ZA 2MY8A 1KVKA 3GR1A 1DDGA 1IUJA 2DGXA 2C2MB 2V8GA 3MCNA 2ZZNA 1I6JA 3UVJA 4ILRA 2XNCA 2C2NA 4MKBA 2ZL5A 3MM6B 3I55B 1N8RT 3BSNA 4KKOB 2RDDA 5IC4B 3T1AA 1OS5A 5M2UA 4ANCA 3M05A 2XEXA 3E01A 4LC0A 1NHVA 1CJTB 1L3UA 3RYLA 3CPWB 5DO2A 4ZN3A 4B9MA 4JI1J 2HHVA 2KT5A 2QLBB 4PRFA 2G2ZA 3C66A 1BY9A 5J1PA 2VG6B 3WBZA 4O44A 1JK9B 4IQXA 1I5OB 3I5BA 3PUNA 2XZWA 4LQ9A 4ITSA 4GKKJ 3TUJC 1F2GA 3KUEA 2VQEJ 1VJWA 1IM4A 4DXLA 3R5JB 3SEJA 2VYQA 1K28D 4X7EA 2E1PA 2WVEA 4CNZA 3PX6A 1DTQB 2RQMA 3QBCA 4Y2KA 5LMNF 3PVDA 2IDEA 2WB1D 2WVCA 3V4IA 4B3TF 3V6HA 3ITHB 5B0CA 4OX7A 3VWSA 1S0NA 3ISXA 2CUYA 1I3OB 3GFZA 1B64A 4WP8A 3ENVA 2A2DA 4M5NA 5KG2A 3KG1A 2BOAA 2MLYA 3CMES 3M8QA 4MMOA 4MIBA 3HHEA 2YY3A 1RHKB 2UVWA 4A4JA 3BS9A 2R2SA 3JQMA 3BH6B 2YWFA 4GKJJ 3N5FA 3LF0A 1UZDA 2O3DA 2XWYA 1Q78A 2FJWA 1FNDA 2G4BA 2B5OA 4XO0A 1FDBA 1UFLA 4RPDA 5D0HA 5KFAA 2Q3PA 5DGAA 3O2IA 5DGBA 3ASRA 3ISNC 1JLFB 1S76D 1WOPA 3UO0A 5J2NB 4XL9A 2GJFA 1D8TA 3Q8PB 1YJ7A 1YJTA 3OW2B 2RILA 2A2CA 3DYAB 4QIEA 1M5OC 3G8QA 2F9JA 1IBCB 4JI6J 5CYQB 2ZM6F 3IRXA 2UU9F 2WZPP 1M90T 3Q0AA 1WI6A 1KOOA 4LBWA 1HI8A 1UTAA 3M30A 1FNOA 2HAIA 2YNFA 3CD0A 1X4HA 3V4MA 4Z7CA 1EHWA 2WK4A 2GJPA 4R0JA 3HHLB 1TKDA 3HSDA 1IWAA 4F3MA 1JLBA 5BSXA 3IS9A 1W26A 2LQBA 4ERDA 5DLGA 1JJCB 4XLCA 1QUEA 4JI8J 2D3LA 1L3VA 2PE3A 5BJRA 4KFBB 2FLOA 3L9ZA 2X3UA 2HBZB 5DM6Q 2AW0A 4B9VA 2C3UA 4YAOA 3QJJA 2IA6A 2V69A 3CXCR 4CNYA 2FVQA 2Z58B 4M5HA 5HAOA 2AGOA 1XQBA 4DS4A 2VJUA 5ETOA 4B3SJ 1GX5A 4K4VA 1JJ2B 1FI4A 2UUAF 1CNEA 1S1TB 1VFJA 2VG5A 2DR5A 4M0LA 4P3YA 2C3PA 3BDPA 4G1IA 2CNDA 2Y1RI 1RT1A 3BPSP 1XR5A 4XN0A 1FKPB 3KYLA 2OUGA 2CQ1A 3CXCB 2BQUA 4UQGA 1FNXH 1N36J 3TVZA 4CRJA 2AJFE 4KV8A 2X1GA 3ZTPA 2J7WA 5A8KA 1R27B 3HULA 3MECB 2UVVA 1LK7A 4HR2A 1BLUA 2Y1IA 3OVSA 3TUIC 2CRVA 3DMJB 3RBXA 2KT3A 1EKRA 3VNUA 1S6OA 3MFIA 2B9WA 2R2TA 3EJMA 4RLEA 2P5VA 2CQCA 1TAUA 1CBKA 1S77D 1AFJA 4F7DA 1HWUA 3PKMA 2VIHA 3QIDA 1Q9SA 3L7UA 2NSBA 3CJKA 3G86A 3DLGA 1NK0A 1XE1A 3ICLA 2MKIA 2N3LA 4RBUA 2R4FA 3VR6A 4IR9A 1UW4A 4DL2A 4IFYA 2OIHA 3D3CJ 3KOAA 1RGVA 3P5BP 1D09B 2FVSA 4USJC 1TL7A 3ASSA 2HFNA 1E6VB 1R31A 1QJHA 2GIFA 4N77A 9RUBA 3CCQS 3ETOA 2MPUA 2XZDB 2KFNA 4DQPA 2V7QA 1VBZA 2YQ0A 4NLQA 4UT4A 2J9DA 3OFGA 2XMVA 1RBAA 1QX4A 5I42B 2JC1A 4A8QA 2WSSA 4A46A 1UA1A 3DLLQ 3WY9A 4AXIA 3IC1A 2M88A 4IKAA 3GFHA 5H59A 1TL1B 2BM1A 2KXHA 3A8IA 2IHR1 3A3GA 2LXFA 5DQIA 2QG9B 3BR8A 1BQMA 3NMAA 3BSCA 4X65F 4OIXA 4F4YA 1SB6A 4HVZA 3MUVP 3G4SS 2DH7A 2HHUA 4YDDB 3ZBUA 2MSTA 4R71A 1GXLA 2W2PP 4TT3A 4DX7A 5LSOA 1U1NA 1S4MA 3MWBA 2MKHA 4ZPTR 4F26A 4ED2A 5B6IA 4FYXB 3CD7A 4CT8A 2BSAA 2CG8A 1NSPA 2BM0A 2YQ3A 5LXRA 2ZDPA 1SCJB 4DF4A 3MM5B 4U95A 3KLFA 3TR5A 2GW8A 4Q45A 4MYTA 2NREA 2DH9A 2PA3A 1KK0A 2NXNA 1FERA 2LQJA 4KHMA 2J9DE 3OL6A 2B51A 2AX0A 3SDEB 4DFJA 3HZEA 3CTRA 3T56B 1RT4B 3C16B 1N52B 4ZVRB 1X5PA 2E5LF 1KNZA 3BO2A 1S9GA 4ZVHA 4FZVA 2D3ZA 4DMZA 1MW7A 1HBNB 1LEOA 1V3ZA 3QT8A 1IR0A 2IC3A 1SL1A 2LDIA 3JU4A 2IAJB 1YHQS 4MK9A 4ZJOA 3H25A 2QLFB 4C8MA 4WFXA 3M9NB 1VQ6B 3MZIA 2HRYA 4C3LA 3AVYA 4JI7J 4JMQA 3DLKA 5D0EA 4RWXA 3DOMB 5H5JA 2GMHA 3SCLE 4F7VA 3GYGA 3FEZA 2X3DA 1VQ8B 3MXHP 4LT6A 4DR1J 4OMFG 2JRSA 3ADAC 2NV4A 3HHDA 2FJVA 3HMJG 5EWEA 3NNCA 1VHIA 1FX4A 3QFHA 2CQIA 2K3IA 2HVIA 5KTQA 3D67A 1VBXA 3MHYA 1GAOA 3OW7A 4KGKA 3C2PA 4DR7F 1R0BG 4M63A 3KUGA 2HG4A 4YY3F 1FKOA 1L3SA 3OLBA 4DL5A 1VCTA 2FX3A 3AVUA 1Q7YT 2QDXA 2XM3A 4EUVA 1XNRF 1RKJA 1WKLA 1LWCB 5HATA 4CLYA 4PUOB 1K0VA 4RD3A 1P1LA 1ULRA 4IG3B 2UXBF 2XNRA 2CKWA 5HN0A 3DC2A 1DFDA 2VBUA 1VJSA 3M8SA 2HRUA 3UN5A 2H5IB 2KU7A 2PN6A 3PENA 3H2VE 3MM8A 2DPIA 4PUOA 3MFHA 3N5BA 3G2XA 2ASDA 1KQFB 1LXNA 3PY8A 3UW1A 2V8VA 2HLUA 2I0XA 4XD7A 4NLSA 1B4SA 1OB5A 5EDWA 3HHLA 4N5SA 1R7IA 3DLEB 5KFSA 1E1QA 2A10A 2XI2A 1CS4B 1T02A 4RL1A 2H5EA 3CJRA 2CQ2A 3MR6A 3RBZA 2ZTGA 4IO9Q 3C6UA 5CYMB 1IKWB 5FIUA 4OHYA 1RWKB 2V4JA 2IAJA 1MU2A 4TMWA 1IN0A 3MUTP 3KTQA 4OZ5A 4NYZA 1I7PA 4E0DA 4H54A 3GYNA 5HBMB 2WAQD 1KEKA 1FO1A 3KHGA 2VG5B 3AODA 1NJWA 3IMQJ 1P27B 4YB7A 4J9VA 4ATNA 5L9NA 2V7WA 3HI9A 3PJWA 3W5HA 2XY5A 3BZQA 1IKYA 1JKHB 1IJEB 5KFRA 5KFMA 1R6YA 1NB2A 3P4UB 2P6SA 2OTJS 2V63A 2XB2D 3JQKA 1NHKL 2F4NA 5KT3A 4HEA9 1UPPA 2HW3A 5E3QA 3I56B 2HMAA 5FIIA 3EMTA 4JV2A 4DR7J 3IM8A 1ZYQA 4EFAC 2YX1A 2MTLA 3CCSB 4IH5A 4C43A 3HHLC 1KSPA 3B4DA 4YR2A 1Q8BA 4QYRA 3BCFA 2IBOA 5CDFA 3HKZD 4Z1MA 3HVTB 4G6IA 3RR8A 3DHXA 2CXEA 4W90B 1CULA 3MMBA 4ECWA 2VBWA 3CCJS 3TRGA 4LJMA 4ZHRA 2N7YA 5CYJA 2AP6A 3OD2A 1H2UX 4NEYA 5LMUJ 3CVKA 1E6YB 3W66A 2ZNYA 1R8PA 3NKYA 3G05A 1XMOF 4F25A 1JNYA 5J2MB 1PBUA 2CQ0A 4RD1A 5C24B 3TAQA 2XHWA 4NMLA 4WU2A 2BDPA 3LWLA 4WZMA 1X60A 3DOMA 4DF8A 4NE9C 2AEFA 1YIJB 4I6WA 2FB0A 3OR2B 4K50A 4LRAA 2B4OA 1TKZB 3QSIA 2E1RA 4Q43A 4DV7J 1Y11A 1HNIB 3KLHA 4R25A 1KRHA 3MEGA 5E0OA 1RI7A 1EKSA 4P10A 3KK2B 4L75A 3FZBA 3W62A 1P8GA 3BKTA 5KFOA 3FKBA 3O1LA 1FWLA 4RUBA 3N6MA 1W0JA 3IM9A 4CQJA 3HD1A 1C0UB 2H4WB 4P7VA 1NLKL 1S1WB 3DLJA 2Z56B 2ROEA 4LRCA 2KVIA 2HEKA 3BB5A 1S1UA 1SKUB 3SKBA 2XS7A 4KKSA 4W4MA 2B7BA 1Q86D 3NGSA 1FXRA 3R1HA 1NKEA 2FUG9 3KDOA 2C78A 4DSIA 3FFIA 2MKSA 3K58A 4I56A 3SFUA 3Q6QA 3QFSA 5GAHU 2YKMA 5D0RA 3FRZA 1CG2A 4EI2A 1HIYA 2QSWA 1NK9A 5KFCA 3RW6A 3IWNC 3IXQA 2FDNA 1SJ4P 2QGFB 4JB8B 1W25A 3P96A 3NXZA 1S1VA 2J7KA 2QT7A 2Q1LA 3OAAA 2CJ9A 4QIVA 4O3OA 4ZIWA 2OPPA 5MLCV 1YX2A 4HHUA 4O0NA 3CCWA 5KG6A 3FCWA 1AROP 2H4YB 2VA2A 2CDQA 5BXIA 4CLZA 5C25A 3N01A 1K1QA 4CCHA 5TR9A 2GO9A 4DV1F 1SPBP 3I6PA 1CJTA 2YX7A 1C1CB 1CLFA 2CJYB 2ZH4A 4Y65A 3ET6A 1LKZA 4XMYA 5JXSA 1HWJA 4G5GA 2DHSA 4OOXA 1WKKA 1SKSA 2BVZA 3AD8C 4N76A 1KQSR 4LR8A 2DY9A 5IV4A 1UW9A 3I31A 4KPCA 2UU9J 2IC3B 3HVAA 4L73A 1YJWB 4PZVA 4C9DA 4IG0B 1Z2ZA 2ZL7A 3OSNA 1FK9A 1VDHA 1LW2B 4LBHA 4TMTA 3FPKA 3QFTA 4HH1A 4OL8A 2DY1A 3ZZTA 4ZP8A 2AX1A 2WJYA 3W9IA 2CPHA 4CO2A 4C8OA 2KFYA 3SFGA 3GP9A 1RQ0A 2DCUA 3EVOA 1N32F 3HFKA 2LQ5A 1FNCA 1N06A 3KDNA 2Y0BB 3IAS9 5GADU 2EG1A 3FK4A 4RUHA 1M5HA 2NXUA 3OJUA 1VK3A 3OSPA 1NBEB 3KLEB 1SKRA 1PCAA 1NM2A 5HLFA 4DU7A 3NOGA 4F0HA 3VZHA 2VQFJ 4J91A 1HWIA 3PCOB 2UXDF 4P26A 4NZ0A 1S97A 2XMJA 4TMXA 2N4CA 1IQTA 3A1PA 2WZ1A 2JEIA 2GK7A 1Y3JA 4AL6A 3AOBA 3ZIAA 1VS3A 2IVMA 4X4OA 1S7HA 4QFMA 2IJNA 5LSLA 5K8NA 3QYYA 2DISA 2ZHBA 5CAAA 4DR2F 4M94A 2EFOA 3GILA 4NLOA 4KHRA 2OEJA 4UZEA 4K4XA 4PYDA 1EP4A 3Q2TC 1JJ4A 1UD4A 2XSFA 5KFXA 3NMRA 1UAWA 2XO7A 2M9KA 3FQLA 1QFJA 3R6JA 2E5JA 2W9CB 2WOMA 3W63A 4IOAQ 3T1YJ 3UFCX 4CLWA 2D3OR 2QA4B 1RTDA 4JI3J 4PG4A 3HSJA 8AT1B 2DO0A 1N36F 3QRQA 2HMIA 3SJZA 3DGPA 1F0XA 1OYEA 3ITHA 3P3DA 4DCJB 3TAPA 4KFBA 1U48A 2ZJRQ 5EGYA 4Q5VA 2ZKUA 2QC3A 1FD2A 1VMBA 2XYPB 2KJWA 1AUDA 1REGX 1FXLA 5AN9A 4P6YA 1Q81T 1VQ7S 4L6V3 3M32B 4IDKA 1SV5B 1ZAXA 4WK1A 3AJDA 3G87A 2C22A 3RAQA 2VFSA 2HHWA 1T94A 4OYBA 3VGTA 4PPDA 2KXFA 2V68A 4DR4J 2X1FA 3SIPB 3BBCA 4ZPAA 2AYGA 2DD8S 4G7XA 1RT6B 4YAFA 1NAQA 2BKPA 4F4KA 3RW7A 1RT7B 1GH8A 4X4PA 1IBKF 2HMIB 1KBRA 3VVTA 2F65A 4NA1A 1SXLA 1TLLA 3D68A 1YSJA 2ZH6A 1XMBA 2GIQA 1EIYB 2DHGA 3CCLS 3DU5A 1FRQA 4LF7J 3BN4A 2DR6A 2OBRA 4LFAF 4R5PB 4TLQA 2QTWA 4DR3F 3TZZA 1S9FA 2HQ3A 2V6AA 4JBCA 4TSFA 4YEJA 1U26A 4PC7A 3PYDA 1W2IA 1Q82T 1R8HA 3K8WA 1MWYA 4NEZA 2VG7A 1ZAVA 1N34F 1RT3B 1CJVA 4KKOA 3AA8A 3JAMU 2GA7A 1RHJB 3EPGA 1PIEA 4OHXA 3ZZ0A 3W65A 4RW7A 4DV6J 2F5GA 4IOCQ 4WFNQ 3UN2A 3N0VA 3RRKA 1H72C 2ZBIA 3J81Y 1ZUNB 1F6TA 1JLQA 2XYHB 2PI5A 2XWXA 5EWFA 2J9EA 2AIRB 3W8GA 1NKBA 5I3UA 4FXUA 4ZCLA 3VALA 3CP2A 3BGRA 4M5MA 3DGVA 1UEKA 3AGQA 3BY1A 1K47A 3KK1B 3NRBA 5GMDA 1UVMA 1CQXA 1ZM2A 4OPOA 1Y0RA 4RDKA 1KK1A 1XC9A 1N32J 2B4PA 3PW4A 3PNIA 4F3OA 1S0UA 4F04B 4YN3B 2HFOA 2JZ5A 3OR2A 3B6BA 1T05B 2RC5A 3WIVA 2ZWOA 3BF4A 2JEFA 4B9UA 2IVYA 1VF7A 4YHHJ 4FVCA 5LMNJ 3R5DA 5DRKA 4B9NA 3KJVB 1WTFA 1B7FA 5T7LA 4OZ2A 4WPAA 3TEGA 1VQSA 1OB2A 5DDQC 2YKMB 2QA2A 5DS0A 5KFYA 3IBWA 1HMVB 3A35A 1ITPA 3D66A 2DNPA 1RTDB 1HMVA 2PI4A 4P73A 1TUIA 1F2HA 3PW7A 3A3NB 3BPDA 3ZFVA 1DY3A 1HI1A 2UUBF 2EEYA 2XTJP 4YAWA 4WF9Q 1URNA 5T41A 2BE2B 4NA3A 1W0KA 4QW8A 3EGNA 1T3OA 2YKQA 1JLGA 4JV1A 2NZCA 2WOMB 2RH3A 2W9BA 3CJSA 3VVUA 1BD6A 3T1YF 2C3YA 1UA0A 3ES9A 1AA1B 3QJPA 2JFKA 2QEXS 4PC2A 4P22A 4ZK7M 4NXNF 2PMHA 3CDUA 5BR8J 1N5YB 2NXEA 5F8NA 5ETMA 2OHDA 4GC7A 1GAWA 3BGRB 5JUMA 3T1HJ 1HVXA 3UNYA 1GMVA 3P26A 2UXBJ 1NJXA 1CS4A 4ECUA 4U8VA 2CQ4A 3T9ZA 1TL1A 1C1BB 3QZ8A 3SJPA 3FMBA 1UFKA 1SJ1A 1SI9A 4KH0B 3NNHA 1U49A 1PSDA 4G3IA 2DNNA 1CJUB 2D7SA 4Y6IA 4ANDA 2DERA 3FCVA 4NLTA 3M2UA 1S1WA 2YNIA 1F5AA 4QBUA 2HSEB 3SCIE 5IT0A 5CD4H 3R2CJ 4OLOA 2IDLA 3C6UB 1EFRA 3TVKA 2VBVA 1NB0A 1R5OA 1OIAA 2WZNA 2R8GA 2HHSA 4XONA 4LSNB 1FXDA 4JI8F 1U1RA 3GE9A 4LIRA 3UCZP 1C2PA 1RAFB 4DV7F 2EIXA 4LSNA 2ZBRA 1RA7A 3MR7A 1FT8A 3KLIB 3M8PA 4QWAA 4MT1A 2MJUA 5KFPA 1XB2A 3OEHA 2ZVSA 2ZBVA 3RB3A 5IC6B 3RUBL 1MMNA 1T95A 1IBMF 1TVRB 1ZPVA 4QVAA 3T19A 1WWHA 3HK2A 2R42A 4DR6J 1OPZA 3OVBA 5FL7A 4LFAJ 2GAHC 3R6LB 5A8KB 2MSSA 1GO2A 5TV2A 3FBEA 2M8HA 4NWBA 2HLTA 3L4BC 1R5NA 4IRCA 2JC0A 1V6HA 1QFYA 1IWGA 1FKPA 4QV2A 3I87A 1EB0A 1KWMA 4QVJA 2FHJD 2BBEA 5LT5A 5BR8F 2BRKA 2R7OA 2MZSA 4NL5A 4DQKA 2VPYB 2DGVA 2J76E 2QLWA 4IH6A 4WTOB 2C3MA 1HNZF 2YPYA 3PX0A 1BX0A 4FNHA 3BN7A 2OTLB 4F0KA 2ZHAA 1VQ6S 4DX6A 3BDEA 1N5VA 2RRAA 1ZETA 4RCZA 1U45A 2YWKA 4B44A 3JS9A 3N6LA 1B0VA 1JLCA 4CLUA 1YZ7A 2UUCF 2F4FA 1T9YA 2OPSA 3OTCA 1ZM4A 2MYFA 2W2NP 4ZJQA 3CC2S 2CA9A 2F7VA 4B47A 5FDLA 3O3LA 1WUUA 4A8XA 4G65A 4U96A 3OR1A 4HT5A 3H0PA 2MQNA 4PQAA 1VQNS 4QHYA 4KKTA 1RT7A 4HH0A 1X4FA 1S1XA 4E8UA 2H1YA 1RT6A 4YR3A 5KFFA 3CCEB 3J7Z5 1SKYB 1T9UA 4P6VF 2XSJA 5H9EJ 2XYGB 1IJFA 4NX9A 2CJQA 2QL5B 4CLLA 1S7IA 1ZA2B 5KT4A 2AJ4A 2LVWA 3R6KA 3LTOA 3MPVA 4BPRA 4USWA 5IV3A 3HFVA 3PO5A 3HVRA 2VNHA 2YNIB 4UQTA 3S1TA 1GMWD 2RD5C 3THTA 2C4UA 4RD0A 1Y7PA 4JI5F 1VHFA 1KMHA 4UY8T 1H0HB 3KK3B 4JYAF 4HDGA 3PYFA 5IOLA 1UVKA 3CJ8A 4PR6A 3C19A 4IG3A 1HBMB 4PXCA 5HZAA 2BGJA 3PFEA 4E0FA 4PG5A 4QWEA 2GV1A 2YKAA 4QZVB 1D1UA 4RWWA 3DM2B 2QA4G 4KIAA 4LRBA 4YEAA 4IOBA 1G2EA 2FLLA 1WF1A 1YJVA 2LQ8A 4IQMA 3MR3A 4N8OA 4DLGA 2FPHX 3NGRA 3LNNA 5J2PB 4II2A 4OJ3A 2HPUA 2E29A 3BREA 2VDIA 5D3GB 2KKHA 1ZPWX 4GVBA 3F73A 2PIAA 1HPZA 2ZWPA 4RNOA 2QEXB 3GVJA 3EZOA 1RHMB 3DDNA 5GMEA 2YWWA 2B3TB 2C2OB 2DXEA 2V4RA 1XMQJ 1NDCA 3KMQA 1MABA 1RWVB 3PG9A 4RUAA 2A1BA 2VBSA 3AGPA 2MY7A 4QU6A 4WYLA 3OOCA 4G1QA 4PQUB 4ENOA 3DDYA 2P2CB 2E44A 1LWEB 2Q6BA 4O3RA 1OY9A 4Z4VA 2ZKTA 4N7TA 1QVGR 5E33A 1VQMB 2OELA 1N6QA 4WE1A 4DV2F 2BW7A 4DG1B 2O01C 1KDNA 3DRSB 1S1VB 3ULHA 2R8KA 3HCXA 4J0QA 2KM8C 3QGIA 4KJIA 4WP9A 2UVUA 2VQEF 4B3OA 4X7CA 1JA1A 4LRDA 4X0CA 3J7ZT 5F8LA 4KB7A 1KHWA 3HT3A 3OXFA 2XHCA 3SLNA 2FY1A 5HROA 5KFKA 3E1YE 2VOPA 3K5LA 5KFIA 4TQSA 3DNCA 1S0VA 4LFBF 2DBBA 2AYEA 1QSSA 4YY3J 5KFQA 2WW8A 1U1LA 2NXCA 4QYZK 4ED4A 5ETRA 1C1BA 4ZCKA 1WORA 2GHPA 2ZOGA 4BC9A 5HVHA 1WHVA 3D0GE 4TN2A 1EP3B 4P2NA 2V2KA 2DHAA 4OZ0A 4I2PA 1KQSB 3PA2A 2CPZA 2MKYA 1N54B 3FBBA 1T8EA 2ZBQA 1Y5LB 2KT2A 1WEZA 1CEZA 3VAKA 1JXVA 4PXEA 4DV4J 3LP0B 4LF1A 2JLGA 5A8WB 2PLFA 1OY8A 2CZVC 4JI2F 3GB0A 3BYRA 3BBFA 5G4DA 4Q0BA 1VQ9B 1PG5B 4MFBA 3ZTOA 4J9RA 4ZCIA 4X62J 2LEBA 4PG8A 2V67A 4WJBA 5IZHA 1YJ9B 4EBEA 4FK8A 3PJ9A 4KQZA 1NO8A 2GJ2A 1JNZB 3MF5A 1SIWB 1N08A 3ZTRA 3LPYA 2VV5A 3EGZA 2CF4A 3AVTA 1T9WA 2IYIA 1TUVA 4JI4F 4NXMF 1S1UB 4DUYF 2XNJA 3DDKA 1VQKS 2D69A 2I38A 5HMWA 3OBIA 3HO1A 5IYQA 2I6WA 1M1KT 3GMGA 3GJQB 3RTVA 4LF4J 1GVHA 1T6ZA 4Z2XA 4CWBA 2Q6KA 4HACB 1YITB 2IA0A 2XMWA 5B0FA 4TXSA 3QPIA 2KZMA 4XIUA 1YWXA 4Z4RA 4N3NA 3GTYX 4EZ9A 1SQEA 4KGZB 5D6GA 3M6XA 1LWFA 1FJ7A 4E98A 1S12A 2LMIA 1LV5A 2OMOA 5F41A 2E9ZA 2LEPA 1WELA 2B9EA 3PYEA 1V5IB 5HBMA 4I0WA 3FMWA 5DLFA 1U8SA 3UQSA 4DL0C 4LF5F 4EWTA 4Q0BB 1IKWA 2QIFA 5C42A 1JLBB 4HLBA 2A6MA 3CJTA 3CB4A 2YWHA 4QCLA 2VZ9A 2ZH9A 1XNQJ 1N0UA 2RJZA 4A47A 5HVFA 4B3GA 2F3JA 4DV5J 5GMKa 2FC8A 2HFUA 4JV5J 1AMOA 1VQOS 2ZH3A 1AUSL 4B4DA 1BGXT 4X62F 1NK5A 5F3ZA 3CJQA 4DZ6A 2AZ3A 2LYVA 3QAEA 4ZMMA 4Y2IA 1RT5A 4PCQA 4G1BA 2GPJA 4URQU 1HI0P 2ZOMA 3AAWB 3MMCB 4TU7A 2OGUA 4YMEA 2K1RA 3FNNA 1YBAA 4OOSA 4K2XA 3JB9k 4H4MB 1YLOA 1ZBTA 1OHHA 1OO0B 1NEEA 4PAAA 4XPCA 3D0HE 1NU4A 5CQGA 1X4CA 1HNWJ 5F0UA 4LF9F 1GXUA 1VC5A 3G8SA 2NZ4A 4QR2A 2F63A 1V3SA 4YHHF 2HIQA 5C42B 5A0YA 3KJQB 1FRIA 3HJFA 3LVBA 3TP2A 2PMWA 2VBZA 2FTRA 3M1VB 2XC9A 1SJ3P 2CPYA 4BS2A 5JVHQ 5GV7A 3GONA 2Z2ZA 2D41A 4BLGA 5EX0A 2AWZA 4UW2A 4TKOB 3VAFA 2AJ2A 1E62A 2GO8A 2LXIA 4NA2A 1IBMJ 3C6TB 2D3NA 5KFBA 2Y0SD 1M5VC 3VAIA 4IR1A 1FTCA 5ITHA 4ZS6A 1SQGA 2V94A 3ZZYA 2V2VA 5HSPA 4A48A 3KLVA 4ZJLA 1U6BA 2AT1B 2X0KA 4ED0A 3AD9C 1XBWA 2CYYA 1YRXA 3LAMA 5C25B 3OPOA 5IK2A 1FRHA 1RQPA 1S9GB 2C28A 5DM7Q 1J5OA 2B8QA 3D9BA 1QM9A 1PAUB 4NXNJ 1CQNA 2ZH7A 3DOKB 1NK8A 2XMTA 4A8SA 5KFTA 2CDRB 2ZH2A 1GNKA 2WCXA 5ETKA 4M95A 1E79A 5J2PA 2R7TA 5JMNA 4L3NA 4LR7A 2MLXA 3G8TA 2FHMA 1S72S 4TKTA 3M7VA 4ID5B 3J80U 4ZGNB 4NXMJ 1MWZA 1S4EA 2PDAA 1K44A 3MDFA 2HZVA 1RKIA 1AZSA 4PPZA 5LJ3Y 1X4EA 1BLIA 2OFHX 1HHQA 3V6DA 1ZZFA 2KG1A 1WP6A 3D54A 1VQNB 1AIPA 2W2MP 3JSMB 3SQGA 4DNTB 1RACB 3DRPA 4DSEA 1SUQA 4DEZA 1QAJA 1Z1ZA 3T5LA 1KJZA 3HHLD 4OX9J 4M53A 2WBRA 4C2MA 5RUBA 4WBFA 2GGPA 1SUQB 2ZC3A 4AVZA 2OTJB 2OKQA 4GVLA 3O44A 1I18A 1IBLJ 5K8OA 5KT7A 2ZL6A 2W1BA 3ONYA 4C8ZA 4ZVTB 1KLMB 4S0MA 1WC3A 5J2NA 4ID8A 2X8KA 4I2QB 1CVJA 3MEDB 4ED8A 1L5UA 4IG0A 2QSFA 3W5ZA 3AVVA 4B9TA 1UP1A 1O6XA 2OPSB 1H7WA 3QQCD 5LM7E 1DLOB 1FJGJ 4F36A 3TUZC 5FO1A 2ZZMA 5GAGI 1RT3A 1RAEB 4I6AA 3JTNA 5AJ3F 1QTNB 4DV0J 1O8BA 1WJ9A 1G7SA 1B0PA 2BE7D 3G6ES 4RW4B 4DL4A 2QZ8A 1OQ3A 2BMBA 3PV8A 3T9NA 5F9NA 3R5CA 1YK9A 4CM0A 1VC6A 1Y0HA 3AT1B 4WFYA 3GIJA 4Y9UA 4X4VA 4DK1A 2QTLA 3SI8A 4TYBA 5KG1A 2AHOB 4FKYA 4ZDNA 1TUWA 3FVYA 3BM7A 4RJVA 4CTAB 1WC0A 7FD1A 5CZXA 3CCJB 3NAHA 2WSEC 5K20B 3H20A 1WG4A 1HWLA 2RS2A 2C5HA 1M0SA 1YG0A 4ZVEA 3G6VA 2QE7A 2PFFB 3KNAA 2DTJA 1HBMA 1WC1A 2H9ZA 4J9PA 3CJ0A 2V7UA 3QSYA 1I51B 3Q3AA 4J90A 2B7BB 1QAIA 3R8YA 3QGGA 4P74A 4C3KA 5AE3A 1NB7A 4XOPA 4OX9F 4DX5A 4DR4F 2WONA 3FDSA 3FC9A 3CJ2A 3QFCA 1WSVA 1VQMS 2CW5A 2HKEA 1UVNA 3UE2A 2C2KB 4TQRA 3J7YU 1NJYA 2YPZA 3PACA 3UDVA 1OPIA 2OO4A 5A0YB 3GIKA 4J9KA 4U6PA 3PW2A 3HAGA 2OH2A 2M0GB 1D9AA 3M8RA 4ZN1A 2D3UA 4DUZF 5KT6A 2APOA 3RG6A 2C77A 3MM8B 5C2CA 4ECRA 4K7QA 2RC6A 2ZD1B 1S79A 4ZKAA 4A8WA 2B0GA 3LOUA 1CJVB
chains in the Genus database with same CATH topology
4ICLA 1TFYA 4DSIA 2ABYA 3FFIA 2MKSA 5DDPC 4LIWA 2XNQA 2FLNA 1RT5B 2CK3A 3K58A 4I56A 3SFUA 1KQGB 5T7LB 1TR0A 6FD1A 2MJNA 2ZITA 3KLIA 5JJBA 3IS9B 2DVIA 3H2LA 2F8MA 3LP2B 5GAHU 3PIPQ 3OHAA 4TY8A 2ZZFA 2ZTNA 5F3TA 2YKMA 2CVEA 3FRZA 3THVA 5J2MA 2X1BA 1CG2A 2QSWA 3MEGB 1IKYB 1NK9A 5KFCA 3RW6A 3IWNC 3IXQA 1Y5NB 2MZRA 2FDNA 1SJ4P 4B3FX 3N6NA 4ZPWR 2ADBA 3FPPA 1W25A 4NLVA 3P96A 1RJJA 3K5PA 4KSEB 3LH2S 4B3OB 1WG5A 2RE1A 2AQ4A 1KFSA 4Q2MA 4NCBA 4AYBD 3MCSA 4NLPA 1S1VA 2J7KA 5AXKA 3OFNA 2CQPA 2EG2A 2HNZA 2QT7A 2Q1LA 1DARA 4ZP7A 4N41A 5L8RC 1PJ7A 3CJKB 1JWWA 3OAAA 1HWKA 2CJ9A 3R27A 1R0AA 4QIVA 3HVWA 4O3OA 2OPPA 5MLCV 2F40A 5L38A 1YX2A 3FZ2A 2ZZGA 3DRRB 4JI0F 3SSRA 3CCWA 5KG6A 2RRBA 4RW8A 5SZTA 2Z6BD 2DGOA 3AH6A 2NYIA 3PFOA 1AROP 2VA2A 1JLAA 3OFHA 2CDQA 3U27A 4C98A 1K73T 3D5MA 2X85A 2F8EX 3SCKE 5C25A 1S6PB 2I8EA 3IRXB 5GAEU 1U1OA 3N01A 4DSLA 1K1QA 4CCHA 2K7KA 1BWEA 1BQMB 3E01B 1UVJA 4IYQA 5F8IA 1N0VC 2GO9A 3UWTA 2X6WA 3MM7B 4DV1F 1Z2LA 3GV7B 1REVA 2KO1A 3I6PA 4OJ1A 2YX7A 1WTHD 1FVSA 1C1CB 4I7FA 5K5MA 4YXWA 2CPFA 1CLFA 1O51A 1UMJA 4B3MF 3UDLA 4Q8FA 2ZH4A 5J1EA 4Y65A 2MXYA 1LKZA 2RSQA 3L7PA 4PQUA 4XMYA 2PIIA 5JXSA 1KZLA 2LU2A 4GO5X 3Q2SC 1HWJA 3Q23A 1JJ2R 3RR7A 2DHSA 4ZOSA 4BWJA 3ZZZA 1NH7A 4EO6A 2N82B 7FDRA 4I6YA 1SKSA 1WEYA 2BVZA 1IKVB 2OAUA 2XY6A 4N76A 1KQSR 4X2BA 3B4MA 3O6QA 1HW8A 2FVCA 4CH7A 4MKYA 3FGVA 2DRAA 2N7CA 1HARA 1S9EA 2P9EA 2XBPA 3I31A 4IO1A 1SH0A 2IC3B 3HVAA 2UZAA 4JI1F 2VOOA 2MQMA 4C9DA 1JLEA 4IG0B 1Z2ZA 5L9XA 4DS5A 3OSNA 4YUDA 3BC9A 1FK9A 1LW2B 2IMWP 2NUUG 1MNEA 2ZH5A 2B56A 3GQCA 2AJQA 2PC6A 3FEXB 1HHTP 3CCTA 2JEJA 4HH1A 1TL3A 4NPOA 2MGZA 1TKXB 2OD4A 4NYOA 4K5RA 2DR8A 2CVIA 4OL8A 4Y0FA 1QTMA 1UEVA 1PC4A 1LQ9A 3CEDA 2V0NA 2GQQA 1W2BR 3MTKA 3IWLA 2M70A 3ZZTA 1FK9B 4B17A 4ZP8A 3EZ5A 1T7PA 2AX1A 2GCFA 1RTHA 3OL8A 4YFUA 2WJYA 2VFTA 3CIMA 5HI7A 2CPHA 3T51B 1WHWA 3GSIA 2KH9A 2DNGA 2HGLA 5BYSA 2MB0B 3CC7S 4UZUA 1HFEL 1NJZA 4DN0A 4CO2A 1I1GA 4C8OA 4F2SA 3V81A 2KFYA 4F8RA 2QLXA 3SFGA 5ADZA 3V4IB 3DLBA 1RQ0A 4MKAA 5D8HB 4X4SA 3WQZA 2HWTA 2E9TA 1N32F 3EZUA 3HFKA 2YVSA 1LW0B 2LQ5A 1UFWA 4NLUA 4B9SA 3DLGB 3ISND 4FF3A 1CPZA 3M2VB 3ZC4A 3LO3A 4DFMA 3IAS9 5GADU 2EG1A 1BPLA 2VC0A 4RUHA 3OTBA 3BEGB 1M5HA 2BA9A 1X0PA 2NXUA 3OJUA 1RTJA 1VK3A 4DDFA 4MH8A 3OSPA 2P9GA 1YJRA 4LF6F 3KLEB 1SKRA 2D1CA 4KKUA 2BANA 4I64A 1BQNA 3D1QA 4QWCA 2VD3A 5HLFA 2VJJA 4FXDA 1NHUA 1YVFA 3M2UB 3VZHA 3RU0A 5DJBA 2E66A 1E43A 1HWIA 3MECA 1UJ5A 3PEJA 3PJXA 3B82A 3FJ2A 2RQ4A 3FSXA 1VRUA 2GHVC 3K2YA 4RW7B 2UXDF 1JLAB 1JNRB 2DNHA 4NZ0A 2I2YA 1S97A 2XMJA 2BANB 2WTFA 3H4DA 4QQBA 3IR6B 4PG6A 2BRLA 5FLXY 2N4CA 4RU2A 1H38A 2V4JB 2FIUA 3CCMS 1IQTA 3DHWC 4I2QA 4JV0A 1RT2A 1AFIA 2JEIA 2GK7A 1Y3JA 4AL6A 1K0TA 3BQ0A 1TV6A 5B0BA 5M2PA 3ZIAA 3ZPNA 1VS3A 2IVMA 4OX6A 1M5KC 4X4OA 4WFAQ 1S7HA 3TO8A 3M2VA 1SV5A 1LWCA 3DI6B 1VI7A 1X5SA 4WFBQ 1YTYA 1HR0F 5AXLA 2IJNA 2UVRA 5LSLA 5K8NA 2ZOFA 2DISA 3QYYA 4F4ZA 1L3TA 2ZHBA 1RT2B 2MKKA 4DR2F 1N56A 4M94A 2EFOA 2UV8G 4PG7A 5LJ5Y 3GILA 5HP1A 3RB6A 1AXQA 4Q44A 3KK1A 3V81B 4NLOA 4KHRA 1FJGF 4K4XA 4LSLA 1J2VA 1EP4A 3Q2TC 2MQPA 1JJ4A 3MD3A 2IYGA 4WKYA 5EX3A 1UD4A 2XSFA 3DOKA 5KFXA 3NMRA 2M7SA 1UAWA 3IR5B 2VPZB 4TY8B 1QY7A 5IFMA 2HHHF 1TP7A 2M9KA 2RVJA 2XO7A 3FQLA 3ZZOA 3B78A 3MR5A 2AGPA 4B9LA 2E5JA 2W9CB 2WOMA 4IFVB 5BYRA 2RF2B 5E2QA 1C4CA 1BQXA 4IOAQ 3GVKA 1AW0A 3UFCX 3M9MB 2D3OR 2DITA 3IGNA 1RTDA 2F4VF 1V9OA 5U47A 2AJ0A 4PG4A 4PKDB 2DO0A 3DXSX 1N36F 4HTIA 5I42A 1OB0A 3OXLA 2IRYA 1V0EA 2HMIA 1E3ZA 1HBOA 5F8MA 3IO1A 1Q4RA 3DGPA 2IVFB 1F0XA 1XR6A 2KN4A 1S0MA 1FDDA 3ITHA 4NLRA 4FPRA 3P3DA 4H4OA 4EEYA 2HNYB 4KTQA 4G7WA 3OW2R 4YB6A 4C97A