1VLYA

Crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
323
structure length
323
Chain Sequence
FTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLHIEPLPYSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Unknown protein from 2D-page (Spot PR51) (b2898) from Escherichia coli k12 at 1.30 A resolution
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Unknown protein from 2D-page
total genus 84
structure length 323
sequence length 323
ec nomenclature
pdb deposition date 2004-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.160 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1vlyA03
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1vlyA02
3.30.70.1630 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vlyA01
3A8KA 1PJ5A 1WOSA 1WSVA 4PAAA 1WORA 3A8IA 1VLOA 1WOOA 4PABA 1V5VA 4P9SA 5L46A 1VLYA 1NRKA 3A8JA 1WOPA 3GSIA 1PJ7A 1WSRA 1PJ6A 3GIRA 1YX2A
chains in the Genus database with same CATH superfamily
3LQEA 1FX0A 3I0SB 4GC6A 4YB7A 2B9EA 2AX1A 2FVRA 2YKNB 5D4PA 3MR3A 4GKJJ 5B7WA 3DYAA 2KDOA 3U7JA 5E3PA 4DQSA 4LMZA 1D8YA 4WKRA 1YI2S 4WYLA 4N3GA 4ETXA 2FC8A 2Y8WA 1LW0A 4K5RA 2JJ4D 2PI4A 2RH3A 3LOUA 2EVZA 2V69A 2K1RA 4QVAA 2OGUA 3THTA 2X6XA 2UUAJ 2XBPA 3W65A 3PYGA 3QT6A 3MF5A 2KRBA 4BC9A 1KBRA 2HDNB 4KKOA 1WKKA 1N34F 4EZ9A 1H74A 1QVFB 1Q81D 1KEKA 1JJCB 2V7UA 1KFDA 4XORA 1U6FA 2N82B 2JC1A 3M9MB 2GPJA 3G8SA 4P52A 4KKSA 4NASA 3G82B 3ZO7A 4NMLA 2DNHA 5ETRA 1T7PA 3I6PA 1D1UA 2N4CA 2VBZA 4H4MB 3JQKA 4DFJA 3GZ7A 2PA8D 4RNFA 2Z2ZA 1E6VA 2DRAA 4JUZA 1FTRA 4G1IA 1DQAA 1EFCA 1X4DA 3OTOF 2B4PA 4O3OA 3VQTA 1Z2ZA 4P73A 1X5TA 4DSKA 1P4MA 3P26A 4RLZA 4X4QA 4OYXA 4XAKA 4OV6A 4XLHA 2HHHF 5J2NA 2EC0A 1Y5IB 1E1RA 2AZ3A 2DNNA 2JEFA 2AGQA 1DJ0A 1R5BA 2JOQA 4AFFA 3I4HX 1J27A 4LR9A 3K89A 4DG1A 4GKKF 3KWMA 1U1LA 3WC2A 2VDIA 4K5SA 1M5OC 4PUOA 1OGJA 4C43A 5KFVA 4NLGA 3KLHA 1SKQA 1IQZA 2BKPA 2E1CA 2IY5B 4X06A 4B3FX 5D3GB 2PD1A 3FNNA 3PY8A 3A1YG 3GR0A 5KT2A 3AA9A 4OPOA 3FPPA 3RBZA 4WXOA 3CSKA 1VR6A 1ZETA 1SIWB 4ECRA 2W8KA 3DDNA 2RKIB 2F1MA 3BY1A 4FS2A 3VCDA 2O5DA 2N7CA 4AQYJ 3CW2C 2CQIA 3PYDA 3BR8A 3OR2B 3DFEA 1NB7A 3TJAA 1JNZB 4J9MA 1RDRA 5KFCA 2OJ3A 2YWGA 3MR7A 1D8ZA 2YNIA 4F3OA 3I87A 1RTJA 2M5YA 4F4WA 1B7YB 1NK5A 3MM5A 2HLTA 1C2PA 3D1OA 3ZNUA 4ED4A 1GMWD 2LXFA 3OD2A 2JEJA 2HNYB 3Q89A 4X62J 1HMVA 2V67A 2PDAA 2RU3A 1MWZA 1JLEA 3DLEA 2VG5B 1U1RA 5BXIA 3RG6A 2UU9J 4KBIA 3HFKA 2HQCA 2HIQA 4F25A 5LMNJ 3TVZA 3TAQA 4EBCA 2C2WA 4XOPA 3MURP 3A8JA 1ZAVA 1NUEA 3FQLA 4TLRA 4DNTB 3PFEA 4IOCQ 3ENQA 2IC3B 3FFIA 3GFXA 2CJKA 2V2QA 5F3ZA 1DDIA 1S7HA 1IWAA 2YKMA 1B99A 2KXHA 3P6YC 3MZIA 2OH2A 2VNJA 4B9UA 5AE1A 1R89A 3PDNA 4OV1A 3ZTQA 4MMOA 1PIEA 3UCZP 3BGLA 3SSSA 2OPQA 4URSA 1OGIA 1U7LA 3BGRA 1F60B 4HVZA 2FVQA 1W34A 4B9NA 1E79A 2GJ2A 3GB0A 3LAKA 4V19J 2R2SA 2FYXA 1BQMA 3W2VA 2L9DA 2HHUA 5KFQA 2DPJA 5E3QA 5C2GA 3NGDA 3IBCB 4RJLA 3MFHA 2BSAA 4F3MA 1EZZB 5LT5A 4NCBA 1R8PA 3MOJB 2IHR1 4P26A 4ICLB 4YB5A 3ZZRA 4CLUA 3A1PA 4OHVA 4RW4A 4TT3A 3NOGA 3OXFA 2HBRB 3HHLA 2GO8A 1YHQS 2CADA 1BJKA 5LSOA 2ZBIA 2XLKA 5CYMA 4V1Ak 2F4VF 3HKWA 2DEUA 1OJ4A 4B3MJ 2E9ZA 2CNKB 4USTA 3BN7A 3ZTRA 1HMVB 2HS3A 5ETLA 1R7IA 3SXLA 1GK8A 2VNIA 2LU1A 4II3A 2QA4S 3GJTB 1SJQA 1LWCA 1WF2A 3DRSB 4ZJQA 1U0SA 5ETMA 3CCES 5D0EA 1NBMA 3DGVA 1P9QC 3KJVB 4DCPB 3FUYA 2RU9A 1NK0A 5KFHA 1YSJA 3QZ7A 5T7LA 2DNYA 1WTBA 3BCDA 2WOMA 5FDLB 3RJMB 4KYZA 1N06A 4ZJLA 3Q8UA 1JJ2B 3ZTSA 5KFFA 4C2MA 5KFGA 1H2TZ 4UOCA 1LW0B 2CNLB 3EZ5A 3BDEA 3ISZA 4AQYF 4ZVRB 3M8QB 1FCAA 3NGKA 5HQLA 2KT5A 3O44A 4A48A 4N8OA 5IC6B 1LV5A 5HN0A 3OJXA 1FX4A 3GIIA 4L3KA 4Q43A 4DSLA 2HGLA 5HZAA 3CCRS 1GMUA 2VFSA 2J9DA 4KC5A 4ZLJA 2V31A 4RBVA 4G6IA 3DOLB 1IBMJ 4X62F 1NCLA 1NSPA 4JP8A 4B9TA 2H48B 3GONA 4FYVB 4XDCA 5F8NA 4JV2A 5LOQA 4CO4A 4LVOP 4IDKB 3T6BA 1N4LA 3HVWA 3AODA 1OO0B 2GAHC 2P8IA 3FBBA 1U02A 2KO1A 3TUPA 4RUAA 2MZ1A 2VBXA 2QSWA 1QUPA 1BHNA 3FSYA 2VBVA 2J7KA 3EDRB 4QW9A 1G7SA 4N56A 5KOXA 3VAKA 1RT2A 3VR6A 1S9GB 4LSNA 2V8VA 2B5JA 1T6ZA 3OR1B 5JMNA 3A13A 4N7TA 5IT0A 2ZOMA 4X05A 2DRDA 3QPIA 4OZ0A 4B4DA 5IV4A 3GV8B 3W66A 2HVZA 4U95A 2V4JB 3NRBA 1NU4A 1TMMA 4Z1MA 2QLBB 4IQMA 1Q8IA 3TOQA 1IUJA 5H9FK 3QT7A 4NLTA 1N0VC 1CJKB 1RT3B 3KK2A 4LR7A 4PXBA 2V8GA 1I94F 5KFNA 3R1HA 1RLCL 4Z4ZA 4B48A 2ROEA 1TP7A 3I82A 4YXWA 4KAIA 1T02A 2OELA 1GQEA 2Y8YA 2KVQE 4L72B 4QPXA 1Y9OA 3K57A 1WG4A 2JDIA 1URRA 4LFBJ 3JQJA 3GJQB 1VQ7B 2Z6BD 4RNOA 3LGMA 2X8KA 4X65F 1C4CA 4CM2A 5MAOA 2VG7A 1FWKA 2VPYB 1NPRA 4OZ3A 2XMJA 2ZZNA 5CXTA 1JLAA 3EXYA 3OP1A 4ED2A 3OTOJ 2CQPA 3VZHA 4DR3F 3ENVA 2QEXS 2FX3A 1HA3A 1V9OA 3DLKB 1S1WA 4ZIVA 1I7PA 1TLLA 3BBCA 4LSNB 1NK8A 2VA3A 3IWNC 2MQPA 2VJUA 1UJ5A 3HX9A 3SYZA 5HVFA 1SH3A 3L7OA 3CTAA 3HK2A 1F60A 3VWSA 1RISA 4TKOB 3ASSA 4G1PA 2X85A 4P10A 1BUXA 1XIQA 1Y11A 2GQ2A 2B6AB 5FLXU 2RS2A 3RW6A 2Z30B 4J9LA 1P6TA 1H7XA 1NHUA 5HP1A 1QAJA 1H0HB 2KHCA 2PMZD 4N5SA 4R8UB 3N9UC 3U1MA 5F0UA 4PC3A 4I68A 4IH5A 3VR1A 1IN0A 3S6EA 2OI2A 3D4JA 1R43A 4ZVUB 2PLFA 2PIAA 4IO1A 1AT1B 4B17A 2A18A 3CCQB 5JBQA 5KFIA 4CT9A 1MU2A 3T1AA 4NLPA 5DN6A 3PEJA 3NMAA 3JSMA 2UV8G 1NJYA 4FYYB 2NUUG 1EP1B 3I5BA 2CQ3A 1UEVA 4FK8A 4LRCA 3R5BA 2M7SA 4OX9F 1GT8A 5JUMA 1T9VA 4F4AA 1KK0A 3P4UB 4BPRA 3K5LA 3OUYA 4IKAA 2YQ3A 3R7SB 4ZVPB 2EFGA 3PJWA 3EGZA 2C2EA 4JI8J 1V6HA 4ZGQB 2OD6A 4ZN3A 3V6DB 2DERA 4X7FA 3FDSA 4PC1A 1JXEA 1W0JA 4ZK7M 5IYWA 2LMIA 2OD4A 2B7BA 2B3TB 2DNPA 4HR2A 3WXMA 3E2EA 3I0RA 2JJ2A 3PO5A 2QYCA 4KV8A 5IZHA 3QIPB 4OHYA 3TZYA 5CD4A 3JSRA 3UW1A 1UD4A 1QVGR 1FKPB 3G8QA 4H54A 1NSAA 5FL7A 4OJHA 3SFUA 2E44A 3BPSP 2BACA 3PHEA 4Y2KA 1I5OB 1IKXB 4DMZA 3ES9A 3PW4A 5HATA 1JMTA 4FKYA 1XNQJ 4ECYA 3RAMA 3W5HA 3B4MA 1DTQA 3M30B 2GQCA 4C8OA 2HQGA 2D69A 1B0VA 2CJAA 3U1LA 4AT1B 5GAHI 1SL0A 1JA1A 2DHSA 1KZLA 4HHUA 2J6TA 5GAEI 1RAGB 1S1UA 5BYRA 4IG3B 2XOKA 2C3MA 1R6YA 4B3OB 1FKAF 2X1AA 4O3SA 4F4YA 4ES3A 4DV7J 3QWPA 4N47A 1NSQA 3LWLA 3TR5A 5U47A 1LXNA 3BQJA 3RB6A 3OXLA 3MAAB 4ALZA 1HA1A 2ACYA 5FLXY 1HHSA 3H94A 1RT4B 3KG0A 1RACB 2OPPB 3IRXA 3FPKA 1M0SA 4C8ZA 4P6VF 2D3ZA 4TY8B 2VIHA 2PE8A 1FXRA 2MKCA 2NR0A 3OJUA 1N6QA 2ZJRQ 3BBFA 1XFOA 1Q0NA 1F6TA 4O0NA 4EZ6A 1REGX 3C15A 4RUHA 2AQ4A 5J1EA 1OHHA 1UCNA 2YNIB 3DM2B 4M53A 5LM7E 4P9SA 3RW7A 3O3LA 4D3HA 4J9OA 3SZ2A 2NXCA 2QFJA 4ZS6A 2CJBA 1P9YA 3HLUA 1WACA 2OMOA 4BC7A 1V5IB 2X7IA 3VAFA 3E20A 3VMFA 4B44A 1HNZF 4LF6F 3N79A 2C3PA 2LU2A 4Q5VA 3N6LA 5HL7Q 4LFAJ 2BQUA 4USVA 1T03A 3KK2B 1SQFA 4EO6A 5GVQA 3IBFB 3TO8A 2XWXA 2YNGB 1QFZA 5JVGQ 2OTJS 2O01C 2Q43A 2ASYA 3W5XA 1XERA 1VQLS 3K0JA 4N3NA 1JB0C 2WK4A 7AT1B 1VBZA 1HI1A 3IS9B 3W5YA 2QMUA 1A6LA 5BR8F 3I56S 3M32A 2C3OA 3H40A 3D0HE 3DYAB 2CNOB 1M90T 3BH4A 1B23P 4UOHA 5IV3A 1U47A 3SJZA 3VTIA 1EX8A 3W2VB 2XHCA 3BH6B 3AVTA 4RD4A 1M1HA 4YHHJ 2BE9B 3KLEB 4QWBA 3NS5A 2BN4A 2BV3A 4Z4WA 4NRUA 2RHQB 1VQLB 2ZTNA 1FNXH 3C2PA 2CF4A 4EI2A 4E0FA 4NCGB 4K4VA 3ONYA 3VO2A 5F8MA 2O1PA 4OLPA 4EYHB 3ONQA 3FCWA 2MHNA 4X64J 5GAGI 5CDFA 1KJZA 4QWDA 2MGZB 4LFCJ 3FFIB 4F0MA 4ZLLA 2V8PA 2DT9A 3BREA 2Q79A 4DFKA 4TQSA 2KB2A 5ETTA 4QU6A 1WTHD 3LP1B 2DNKA 3K5PA 3G6YA 3N6MA 2YX4A 3THPA 1NEEA 5KAKA 3GQCA 4MFBB 1IKWA 2C2OB 2Q3PA 3V2UC 3J7AN 5ETOA 1YJWB 1Q7LB 1YQHA 5DGAA 3D3CJ 4RPBA 3W2IA 1NB0A 2QG9B 4USIA 1S6QB 1E3ZA 4M5DA 4I1TA 2I1RA 3HHKA 2ZEJA 2ZH4A 4RL1A 1KDNA 2BOPA 2XYPB 2B4VA 1KQGB 4DUYJ 2JDJA 2V2KA 2DH8A 2FHMA 2IFXA 3UDLA 1RAOA 4C4WA 3I4PA 5KFAA 3ZXWA 4RD2A 2ZBRA 3OLAA 5A0YA 3BZQA 2QC3A 4M5KA 1CQNA 2IIHA 4FPRA 2WVDA 2W9CB 2DRBA 2GX8A 3BC9A 3FQKA 1Y00A 5J2QB 3B82A 5IYQA 2RQKA 3MAHA 3FVYA 2JLFA 4WK1A 3C66A 1NKCA 1E64A 1M5VC 4Y0FA 4KB7A 2MZTA 7FD1A 1HR0J 2DHXA 4ID8A 4DV1J 1FKPA 2ZWOA 4LF6J 1D3WA 1RWXB 4J9KA 1J9ZA 2M52A 4AC9A 1NAQA 1YITB 2ZVSA 4LQ9A 4Y9RA 2XWYA 2KT3A 2RRBA 5C5JA 4IO9Q 1Q79A 3MPWA 1RHKB 2R7TA 2W7PA 4ELTA 4QR2A 4A47A 4RW9B 1LWFA 2GAGC 3OBIA 5KG7A 5E3AA 4I56A 1TL1B 1U2FA 3L9ZA 4MKYA 2LQBA 4K4ZA 1AFJA 3CJ8A 1RT2B 1S9GA 2BJ8A 3BYRA 4DI6A 5E7OB 1LWFB 2WW8A 3KDNA 1AUSL 4C0SA 2HRYA 2IPOB 2F7VA 1VQ7S 4C97A 3PW2A 2R8HA 2WJYA 2RE1A 4LBZA 2E9RX 2OKQA 2EKNA 3KDOA 1Q81T 3R27A 2VKRA 1QH0A 1U09A 2MDAA 4M5MA 2OBSA 1I3OB 2Y1LB 3OW2B 1VQKB 3H5YA 3T1HJ 3CJSA 3MMPA 1FEEA 3UQSA 4U9UA 2RKIA 3NNAA 2GQQA 2YKNA 2Z0GA 4ASUA 1KTQA 1RAFB 1WSVA 2MY8A 2DYIA 2PIIA 3R7NB 3K5OA 2JLGA 3CNQP 2HBQB 2OTJB 2I0XA 2DNLA 1HD0A 3DXSX 2N4DA 2UVWA 1Q8KA 4Y34A 2ZHOA 3BSOA 5FA6A 1VQKS 4Y00A 5HAOA 1R0CB 5AXNA 3QRQA 2BYCA 2HFUA 2E1PA 2HZVA 3PZPA 3QIPA 2VHGA 3RRKA 1WJ9A 2FJDB 1S0NA 4KHRA 4ZVOB 2YQ1A 4RJVA 4B02A 5HMXA 1U4BA 3OFNA 4X84A 3VAMA 5EUHA 1RHUB 4O23A 1RA6A 1WOSA 3IMQJ 1MRZA 5B08A 4OX7A 4E2FB 3QGIA 2UVUA 3Q8QB 4X4TA 1KRPA 1XBWA 4ZCKA 3TAMA 4KJIA 2DD8S 4FF2A 1TL4A 3M32B 5HBMA 1KTVA 5LJ3Y 2UUWA 3IWXA 2CRLA 2IRYA 3M2VB 3LWMA 3NNHA 2ABYA 1VC5A 3M8PB 3LW5C 3X3UA 4U7UD 1RYSA 2VG6A 1XMOF 1S4FA 1YTYA 1ZUNB 5DSZA 1HNIA 4AUKA 2FD2A 3KXDA 2E5LF 3WX8A 3W61A 3Q2TC 4DV2J 4ES2A 2P5VA 3B78A 1RABB 2FHKA 2GGPA 2LP4A 2YX1A 4E98A 2C42A 2I38A 2FHJD 2KVIA 1H98A 1OB5A 4DCOB 1S72B 2BKOA 1O6XA 3H4DA 1GNKA 4X7DA 4TVAB 2CPZA 4P7VA 2ZL7A 1U1KA 1QSSA 2XZLA 3AAWB 5LSRA 2CK3A 3FK4A 4A8QA 2XGPA 2XI2A 1KC8D 4YOEA 1VQ4B 2IVMA 2QA4G 3K17A 4U6PA 1HNWJ 4I6AA 4O3PA 1OB2A 5H59A 4FN5A 3VGUA 3HSDA 4XONA 5GMEA 3TUZC 3PKMA 1Y0YA 3IRWP 1TKZB 4DZ6A 2DNGA 4QOTA 4NLQA 1E6VB 2N7YA 3VGVA 1K73D 3CCMS 1ZOTA 3OJWA 4QIVA 4X7EA 2VFUA 1Q82T 2C1EB 3GMGA 2XY5A 1U24A 2HHTA 5LXYA 2OP5A 1HYSA 1R0AB 4WP8A 3GLJA 3WQPA 1SC3B 2RDIA 4YEJA 1YZ7A 2GREA 1O0PA 2MQQA 1HI0P 1IBKF 1VISA 2ZD1A 3KLGA 1F20A 2XZPA 1X0FA 3OW7A 5TY0A 1RTDB 3CTRA 3CPWR 1VC0A 1ZM4A 2COLA 4PQUB 2FJAB 5HK4A 2L41A 4DR6J 4ILMA 4UT4A 4C0HA 4OIXA 3I0SA 4NBSA 2DEJA 2CQ4A 4ACBA 4Y6IA 3K58A 2DGQA 4OZNA 2AJ1A 4DQKA 1S1TB 1S0MA 4UY85 3EGNA 3V7AA 4OX8A 3W1YC 1A8PA 2AEMA 3RR8A 2IYGA 3QT8A 2XNDA 1WD6A 3IXQA 1TFYA 5A8KB 5GAEU 3UPFA 1OPZA 5K8MA 3Q38A 4JBCA 4NLXA 4DF8A 1OB0A 3ENAA 3HD1A 3OZVA 4YHHF 3QIDA 3FKSA 5KFJA 4LIRA 5KG0A 3IN5A 3OL6A 5IWAJ 2R2RA 5EX0A 2I6WA 5HI7A 2KJWA 2DK2A 3QO9A 1EP4A 2Q6CA 4X4UA 3VNUA 4TY9A 3MR6A 1U49A 2DIUA 3D5MA 1HHQA 2IJRA 3JU4A 1DLOA 5FNZA 1G7TA 4DR2F 1I8DA 1TKXA 2AV5A 4TY8A 2D3LA 2HFSA 3G82A 2KXNB 4NA1A 1ZH5A 4QJVA 4ZVFA 5L38A 2HG4A 4X66J 2G9OA 4H4KA 2DO0A 3T41A 3GSDA 2HFZA 3M8QA 2ZH1A 2V4JA 1Q8BA 1HBMB 5MLCV 1T05B 4GVBB 2WZPP 2FVSA 4WU3A 2W2NP 3UD3P 3IM8A 1RWUA 5DDQC 1CVJA 4TN2A 5FO0A 1RAJA 3BBBA 5HKKA 5DDOC 3FJOA 2MQLA 5HQ8A 2MJUA 3GIJA 3OTEA 5K8NA 2G0JA 3J7A1 1YJVA 4QQBA 2DB1A 5F8JA 2AYBA 1UETA 4IW3B 3PTWA 2XS5A 4FBTA 3PYEA 1H2UX 2XCPA 4Q2LA 4LQ3A 2XLJA 3NCQA 3DU5A 4DK0A 2KRRA 4AVZA 1S1TA 2GV1A 3BYPA 4RLEA 1RI7A 4O0IA 2VBTA 3FC9A 3TA0A 5DO2A 1TL7B 4ED7A 2KXFA 3W5UA 2A2CA 3D67A 4TU9A 2MB0B 2Q1LA 3PJXA 1QAYA 4K4WA 2ALYB 3TUJC 4NYZA 3CUNA 3KNGA 3T1YF 1YIJB 4TU8A 3LGHA 2ZXHA 2GJKA 3OXGA 3BR9A 2R8JA 1UVIA 1CBKA 4OHWA 3KEWA 4UQGA 3V76A 5L39A 3GVLA 1Q7YT 3WIUA 4TU7A 2GJFA 1RAEB 3KLEA 3EMTA 4NLYA 4CNZA 4HEA9 2Y1IA 2VFRA 3NNCA 4C3MA 4RD1A 4USWA 1JB9A 3BB5A 3K8VA 1QVFR 4ECZA 2YWEA 2VC0A 4ENOA 1U2RA 3GSIA 4O4RA 2EIXA 1VQSA 2VD3A 1QJHA 3QZ8A 4L74A 2ZM6J 3OFEA 2D3UA 1QX4A 3BEGB 2YBVA 2IDEA 3DRPA 4XN0A 2BF4A 2QLWA 3I55S 2W6IA 4FWTA 3HULA 1PBAA 2W2QP 1TUWA 3V6DA 4IOBA 1NHVA 1NK9A 3E01B 3P49B 5KFMA 3DRPB 3AB4B 4ZA1A 4FNIA 2ZHAA 1QG0A 2ZZQA 1PSDA 2XHWA 3OR1A 4RDJA 3ZZPA 1V0EA 4B9LA 3OLBA 5F9NA 3IA0A 2MKHA 2OLWA 2PEBA 4LBHA 4QZVB 1TMJA 2HIYA 5DZ7A 1N34J 4YALA 3I55B 1RP5A 1ZAXA 2KI2A 2QZ8A 4M5HA 2CNNB 2DHHA 2YNHB 5D0GA 5THXA 3AT1B 4ITSA 1QUEA 4K4TA 1A7GE 4XLCA 3IC1A 5M2RA 1JK9B 3HKZD 5CYQA 1RTJB 4DFPA 1E43A 3VF0B 3QSIA 1VHFA 4XOTA 5BYSA 1FESA 1TZ0A 2JC0A 4RKUC 2XEXA 3RGIA 1SC1B 4K2XA 4MK8A 5JJBA 3BKUA 2UXBF 4M2LA 1ZM3A 4M1KA 2VBUA 1EETB 4NZ7A 1OWXA 2XZDB 2Z58B 3QATA 3A35A 2ERRA 1RK8A 4P72A 3PX6A 2WZNA 1EKRA 1GMVA 3G2XA 3OW2R 1GX6A 1RZMA 3MR5A 3D68A 2AJ2A 1UPMB 4USUA 4RU9A 2B6AA 3IR6B 4R71A 5IQ6A 2UUBJ 4XPCA 4DL4A 2HK2A 4JV5J 1RTZA 1VQ6S 4EYIB 3HFVA 4DS4A 1QDUB 4R25A 2K2PA 3HCXA 1JNRB 2VG6B 4F2RA 1VQ8S 3MMBB 1TFWA 2IJNA 3SQGB 4TNOA 5GV8A 1N08A 1NKEA 3JQRA 1WUUA 3KLHB 2ZH7A 2DR9A 5DETA 3L7UA 4WP9A 4RNNA 4H9GA 4HI2A 2FHOB 4HT5A 3VV2B 5M2PA 1BGXT 2GMJA 3FSIA 2EKYA 3PW5A 8RUCA 1WEYA 1QAIA 1IJEB 1U45A 1RQ0A 2R3VA 2J0WA 3OUYB 4AL5A 3GU0A 2FGOA 4II2A 3NKYA 1P1TA 3BGOP 2WBRA 2AMCB 4TKTA 2CVIA 3C14B 2WONB 3LP0A 1Q5YA 2XYGB 1T9WA 1CJTB 1SXLA 3D9BA 3ZBTA 4HH1A 1CEZA 1RB0A 1VLOA 2JLEA 5TRDA 1JLCA 4P22A 3ASRA 3CIZA 1X4GA 4DS5A 4FKXA 2FJEB 3DU6A 4Z7CA 4KKUA 2HURA 4NXNF 1TV6B 2J9EA 5AJ3F 1TL1A 2L9NA 2OTLS 3JB9k 2K8GA 3AJ2A 3V4IA 2E66A 2R8IA 1N5QA 4CLWA 2Y0SD 2AKWB 1VQOS 2HFNA 2BQRA 4J91A 4XKWA 4OI1A 4Y28C 2DR6A 1RHJB 3HJFA 2C4UA 3CRZA 3L09A 4A8MP 3PW7A 2KM8C 4OZLA 2ASJA 3HMJG 1S0VA 1XN9A 2YPZA 2G0CA 2OHDA 4XIUA 4RW7A 1OS5A 1S1XB 3KLFA 5EWGA 3DHWC 3CDUA 3IO1A 2VYQA 1AZSB 2LEAA 4J9RA 1W9XA 2IMOA 2VBWA 1GH8A 1YJNS 3NS7B 3O6QA 1B2RA 3QNWB 4I6WA 5CZVA 4NPOA 2EK6A 2JL9A 2BGJA 1I6JA 1AA1B 1TQLA 4B3XA 3F56A 3QFHA 1F9EB 3KMQA 3BGRB 2DPIA 2X3GA 2ZUGA 3T53B 1KWMA 3G9CA 4F4ZA 2IBKA 1VJSA 3SMZA 3LP1A 1AIPA 1U25A 3ISXA 2QL5B 4Z4VA 2KL8A 2A2DA 2F63A 4MFBA 1MLAA 2ZKUA 4LFAF 4C9DA 2OMLA 5ETQA 4EFAC 1FE0A 4JOUA 5L9XA 2DXDA 3OV7A 3G6VA 5B0AA 3HSGA 3CJRA 3Q8VA 3RB4A 4PYAA 3DOMA 1NDCA 3F73A 1LFPA 1E6YB 3H2VE 1QSYA 1EJ7L 3V4MA 3EXCX 4D3GA 3OL9A 2X6YA 1FDAA 3NP5A 3QAEA 4EH1A 5BR8J 2XSFA 2ZOFA 5IWAF 4H4KC 4YS2A 2LVWA 3UN2A 3BKTA 3BCFA 2HKEA 1RU2A 4ZIWA 2G1DA 2NYHA 1WOPA 3MEEB 2JN9A 2H51B 3OEEA 2DY9A 1VQ6B 4MIBA 4NEYA 3RYLA 5HBMB 2XY7A 1TK0A 4FF1A 3CJ3A 2KZMA 3HHLB 2CG4A 3M2VA 5E0OA 3ZZUA 4PQAA 3SDEA 1SJ3P 4B3TJ 5DGBA 3N01A 1FERA 4R0JA 3M6WA 3MMAB 2XY6A 5CH7B 4NEZA 2W4DA 2HYIB 1VQPB 5GAGU 1Y3JA 2VC1A 3PM9A 4XO0A 1HWJA 4DPXA 1S97A 5B0EA 3D2WA 1EWYA 2AD9A 1S1VA 3DNCA 3A3OB 3BO3A 3DCAA 3OEHA 2A3JA 4N41A 4CO3A 4LF4J 4ZPVR 1FD8A 1N54B 5T7LB 2YKAA 2OEJA 2GO9A 4ZP9A 3DLBA 1WF1A 5KT6A 4C8YA 3TZXA 3FGVA 4JI3F 4HHJA 2Y3YA 2KVOA 3UI3A 4ANEA 3G86A 3CESA 2OPQB 5C42A 1IKVB 2M4MA 4DV0F 1M90D 3KHRA 5AJ3J 4DSIA 3CCUS 1FT8A 3AVYA 1SIZA 2YNFA 2WRMA 1G3OA 4BHQA 5J2QA 2NXJA 3F0NA 3TI0A 2AF6A 2BW2A 4ZP8A 3QFRA 5SUHA 1FO1A 3VAJA 4NCAA 4RNHA 1M1KT 3DXBA 2BDPA 1NBEB 2IA6A 1JLGB 1RBAA 3TVKA 1NHKL 3NMRA 1T9UA 4NXMF 3J81U 3SQGA 2HGNA 2XO6A 2U1AA 4ZITA 1Q9SA 4YAUA 2FHJA 1S49A 2QDXA 1RGVA 4IG0A 4ED6A 1I51B 2QGGA 1SH2A 3FMWA 2VNKA 4Q0BA 4KFBA 4YAOA 1S1UB 2BJ9A 2V50A 4MIAA 4U67Q 1HBNB 4PWWA 4J9SA 2RQMA 4F04B 4PC6A 3ASTA 4M5NA 4QWAA 5ETKA 3ISNC 2BJ3A 3CCSS 2J76E 3Q0AA 1U48A 1PG5B 2GFFA 3Q8SB 1BQNB 4ZPWR 3LPEA 1T9XA 1KHVA 1OY6A 1Q78A 2MZRA 2XZOA 3MM5B 1VQOB 5KG2A 4C8MA 2ZBQA 2ZNYA 1RWWB 1TVCA 1GAQA 1F1BB 2C2MB 2QMXA 1DQ9A 4DR5J 3Q8YA 6FDRA 1DG1G 5RUBA 4HI1A 4V19X 4K50A 3EVMA 2LQJA 1G7CA 2V7VA 4DL0C 2ZDPA 4RBUA 2CQBA 2JSXA 4YY3J 4YP3A 3J7YI 1WPCA 4F02A 4DJBA 3J80Y 2ZL5A 2E5GA 1KR4A 2IBOA 4DV1F 2AJ0A 1RAAB 3PRVA 3NWGA 1D9AA 5I3UB 5I42B 1I18A 2CA9A 1W87A 2NQPA 1XNRJ 1S1XA 4DPUA 3ILJA 5EWFA 4IDKA 2HPUA 5DZ6A 2IA0A 3RR7A 1YITS 3D28A 4ED0A 2VODA 4X8IA 5THWA 3MECA 1CS4A 4CDIA 4F67A 2BANB 1L5UA 2MSTA 2Z56B 1ACMB 4NOHA 1CULB 3QQCD 2U2FA 1AYEA 2XNJA 1WDTA 1UAWA 3UDEA 4J0QA 2FPHX 2CPEA 1U1NA 4GO7X 1N32F 1VQPS 4IYQA 4WFNQ 1PKVA 4Y3CA 2SXLA 5H1SV 4MKVA 4NI2A 4JI3J 2BW7A 1KN6A 3KFWX 1BLIA 3TJ9A 3UE2A 4DV0J 5J2MA 2F4VJ 2ZC3A 2FLPA 4JI0F 4DZDA 3CC7S 2IJFA 1LW2B 3T1HF 2J5AA 2HEKA 1KK1A 3M8PA 2V4RA 3PA2A 4OOVA 4WJBA 3ET6B 1E1QA 2PGCA 5A8AA 4K2JA 3D6FB 5KT4A 3W9IA 3CJTA 1E62A 3CCJS 4KR0B 2B9XA 2J9DE 2W25A 4N76A 1RWVB 4X4OA 4I64A 3R6LB 4FPIA 5T14A 2JVOA 2M3DA 4QWCA 1S4EA 2CAJA 2B9YA 1X9WA 1K1QA 5DDPC 4NYOA 1H7WA 1XMOJ 2V7TA 3CVKA 3SV3A 5A0YB 3L3CA 4WXWA 1UA1A 3NGTA 2HRTA 5DS7A 4X2BA 3HZEA 1Y10A 3BO4A 2ZDOA 2Y1JA 5T41A 1B64A 2H4YB 2IRUA 3HDSA 4NMXA 3VAIA 3VO1A 1CC8A 3OT9A 2Q6BA 4ED3A 1NJZA 2DNZA 3NGRA 2HAIA 1N88A 4CNYA 5IFMA 5DM6Q 2G4BA 3LVBA 4AYBD 2HHSA 4JI6J 5KFRA 1LWCB 1DDGA 2OAUA 2ZH2A 1NXIA 4LC0A 2Z2YB 4P2SA 1RWNB 1VQ4S 1U1OA 4B47A 1XMQJ 4DXLA 5HVGA 2R7SA 2ZBUA 1KVKA 4O3NA 3UO0A 2QIFA 1UZHA 1QE1B 1Q8LA 2DNQA 3GP9A 4LF8F 1M5KC 2R7UA 3MM8B 3J7YU 1EQMA 3ZTPA 3GCWP 2AW0A 1QE1A 4Z7YA 1N5YB 2BMBA 2QLFB 3Q86A 2V34A 1FE4A 2IMWP 4DBQA 4UW2A 1TK8A 1J5OA 2H65B 3UNYA 3TUIC 4NA3A 1GMWA 1X4BA 3ZNJ1 2Z4PA 2FVGA 1LNQA 2ILZA 1NO8A 4KRWA 4P2XA 4PWDB 1I94J 3W9JA 3CP2A 5F8HA 1OQ6A 3OFHA 4QU7A 5G4DA 2K3IA 4KGKA 1KVJA 4XMYA 1BPLA 3JS9A 2DNOA 2W9BA 3GILA 3BN4A 4YN3B 1Z2LA 3PXGa 2ILYA 4P2NA 4DX8H 4DHVA 1NJID 2X0KA 1Q86D 1X4AA 1L3TA 3FJ2A 4B9SA 4IG0B 2BKNA 4IQXA 3DMJB 1L3KA 1HD1A 3HPOA 4Z4SA 1BWEA 4JI1F 2V4DA 2J8SA 3OZWA 5F4OA 4P71A 4X07A 1DTTB 3CT9A 3QJLA 2DTJA 2BXJA 2XMWA 1HLWA 4ACAA 1YJ9B 2BOAA 3RB3A 1HQUA 3RUBL 1ZPWX 1X5PA 2ZHBA 3SCJE 1SV5B 4N77A 3U02A 2PN6A 3VGTA 1JLFB 1GTEA 2HHXA 4LUBA 3OHAA 3UVJB 2V4QA 2XC9A 4NA2A 5B0FA 4WQMA 2GHVC 1VF7A 1XNRF 3K5MA 3R5DA 2YKPA 2R2UA 2HBZB 2GJRA 2NCKL 3Q6QA 3GCXP 4EWTA 1HYSB 4B3RJ 3CXCB 1N33F 4I2PB 3NWRA 4OYIA 3JAMU 4OHZA 3FRYA 2W9CA 1L3VA 4OYPA 3PACA 2J9CA 5F8IA 1NDPA 2HWHA 5GADU 4EU0A 4AD6A 3WY9A 3OSNA 3DRRA 3KK1B 1ICEB 3KNAA 3T9NA 2LECA 4WYWA 3H59A 1RU1A 3M2RA 2KFYA 4DR2J 2PMDA 1NB9A 1MN9A 1EP2B 2OPRA 3OOCA 3HXMA 5IOLA 5KFYA 3WDOA 3T3FA 1Y5NB 2P9GA 4DV3F 3CO9A 5KFDA 3BGUA 3CCVB 1PAEX 4G5GA 4K7QA 4B3SF 3T1YJ 2WHOA 4MK7A 3Q22A 2UUTA 2F8MA 2LA6A 1M5PC 1YRTA 1S1WB 1ZZFA 3LQVA 2QTWA 2N3OA 1RCXB 1FFWB 3D6HB 4IFYB 3TX0A 4ECWA 2JHEA 4FXWA 5FD1A 2O3DA 4MKBA 2VFTA 5DG9A 4PYDA 3V6JA 3C8YA 1FJGF 5J35A 4Y2IA 3D0IE 3KLIA 4OYOA 2RF2A 4ATNA 2OYNA 3MI7X 1T3NA 4FXUA 2NPIA 2DY1A 5KT3A 1P1LA 1J5EJ 2GNKA 1R0AA 4OJGA 4CI0B 3ILOA 1JXLA 4PG4A 4I67A 2V8DA 3TEGA 2K3KA 3GFHA 4R8UA 4AF6A 1GFWB 2ALZA 2KZZA 3I9V9 4YFUA 3TA1A 3BS9A 2P9EA 4L75A 3MEDB 1TL3A 2DNMA 3H2UB 3U6KA 4CLZA 3VAHA 1SKRA 1UVJA 3OVAA 1HNXJ 3CD6S 1VQMS 1CPZA 1RTIA 4JI6F 3EPIA 3J7ZT 1MABA 3C16A 4LF1A 1IKVA 3W60A 1RWKB 5C42B 2MKIA 1K73T 4JI1J 5AXMA 1IBCB 4PUOB 4B3GA 3ELHA 3KLFB 5J2PA 4ZVGA 4DU7A 4BS2A 5M2UA 3ZZ0A 2V7XA 2BANA 1YLXA 2R6HA 3US5A 1HNVB 4X0CA 4QYZK 2AU0A 4ICLA 4DOZA 4J9UE 3LGNA 3KJQB 1HQEA 2HLUA 3TP2A 3PNIA 4PCQA 2AEJA 4Z4YA 4QR0A 4ZPDA 1KOHA 2MKJA 2RSQA 3EVWA 4ID5B 4RNMA 3Q8RB 3OFFA 1T3OA 2CQGA 2H5JB 1R5OA 2F1FA 1KOOA 1JJ2R 1NJWA 4WCEQ 3GFZA 1S6PB 1QTMA 2LA4A 4Y2CA 2WB4A 4PPDA 2NXNA 2WSFC 2LDIA 4K1XA 4ID5A 4PABA 1PCAA 3HHDA 3OTDA 4KHMA 4Q2MA 1C0UA 5A8RA 2PC6A 3CP8A 4LBYA 3MGJA 1NJXA 2O66A 3V6HA 4DL5A 1XWLA 1E6YA 4WK3A 2UV8A 5E2QA 4YMEA 5HROB 1FKOA 3KLVA 2QE5A 2H9ZA 2E5IA 2BJ7A 2F9DA 5CD4H 4A8FA 2R9LA 1UVLA 2MXYA 1T05A 2HQDA 4G7WA 1PGZA 2WCXA 3M8SA 4F50A 2AJ4A 1GR1A 1FRKA 1D2EA 3T5JA 3RAXA 4WE1B 2VICA 2VV5A 3LH2S 4DCJB 1XQIA 1UEKA 2F8HA 3NBPB 1IJFB 1NNDA 4QHYA 3MEKA 5A8WA 2DO4A 1K0TA 2MYFA 4N8NA 3AD7C 1NK7A 4RW6B 1KD1D 2AYEA 3CEDA 4M63A 3MEGB 2BM1A 4B43A 4NWBA 4MTPA 2Q6OA 1T11A 3GIKA 2GCFA 3KLGB 3DLLQ 3DDKA 1IVZA 2UXBJ 4B3SJ 3C3LA 1B4SA 2M5SA 3RY8A 3MEGA 2EEYA 2KG1A 4ZDNA 4OYAA 1K8AD 1OY8A 3W64A 5C24B 1F5BA 2HBYB 2BGIA 3M7VA 3BSCA 3R9LA 3R3TA 1N5VA 3DKDA 3PIPQ 4XK8C 4CM0A 1SV5A 3ETMA 1JKHA 3P5BP 4EK2A 4IR9A 4JV5F 2ZNZA 4NLWA 4ZKAA 3TEHB 2HS4A 2E9TA 5KFKA 2XMTA 4L3NA 1NH7A 2AZ1A 4Y65A 3SLNA 4HDHA 1H72C 1R8AA 4DPOA 1L3SA 1DTTA 1H3DA 3N4WA 1CG2A 1Q53A 2DH9A 1IHMA 4UZFA 4RW7B 5ITHA 5B0BA 7FDRA 4ILRA 3NLCA 1TUIA 3KUEA 1A0OB 1VIOA 2PFFB 4UUXA 2FVCA 2GMHA 1FKOB 4RW4B 5ETVA 5IT9Y 1QGYA 1VHOA 4RD0A 2R7XA 1C4AA 1SC6A 2CDQA 4KSEB 4F26A 5DLFA 1HNXF 4XLFA 3M8ZA 2ZJPQ 1JLGA 4GO5X 5AXLA 2GHWA 4L8JA 4YAWA 1VYAA 9ATCB 4LFCF 2ZBCA 2J6UA 4YDXA 3TAPA 3L95X 4DPTA 1BY9A 4LF2A 4DV3J 1AB8A 2ASLA 2WONA 5IYPA 1VS3A 1K9MT 3AGPA 2GQFA 3IS9A 2LXIA 5ADZA 3LP2A 2B9WA 2A6OA 3DRXA 5F3TA 1UD8A 3TYTA 4A8KA 1AW0A 1TAUA 3CCMB 2QA2A 3FBEA 1HBUB 1ZZNA 2PMHA 1H73A 1M5HA 1DY3A 3M8YA 3HF5A 3SCLE 1WU8A 2VDHA 4FZVA 4AE5A 1GJRA 3HVTB 1DLOB 5HSPA 2AIRB 8ATCB 5IXUA 4BWMA 1G7RA 5H9EK 1LXJA 1S48A 3SEJA 1RKJA 1F3VA 1Y7PA 2NXUA 5C7PA 4KHPF 4WZKA 1SPBP 2J7WA 3HHLC 2VKZG 4LBVA 5K14A 2BQ3A 2UXDF 2CPJA 2Q66A 4G1VA 2FB0A 3PW0A 3CMQA 1PILA 2VU5A 4P3IA 3AVUA 3A3GA 3TX8A 1FNMA 1TL3B 1YLOA 3BV8A 3HHEA 3W2HA 5K14B 2ZZMA 5KW9A 2ZBPA 1YJ9S 1F9HA 2CKWA 1D9DA 2B4OA 2KH9A 3OPOA 2C2NA 5G0RB 4F7DA 2C28A 1I1GA 1S6QA 1FJCA 2M0GB 3UN5A 3RRGA 4OYWA 4DV4F 3SSRA 2WTFA 1W0KA 4KH0B 1R8BA 5J2PB 1N56A 5KFLA 1CJUB 1RT7B 5KG6A 3IGNA 4WIIA 4DR3J 1S9FA 3EJMA 1OQ3A 2XQCA 3TW0A 1G2EA 2VJJA 5DDRC 1DRZA 3CJKA 2C3YA 2FIUA 4C11B 1FFSB 1TR0A 2ZZFA 3DLKA 5BYQA 2ZUAA 4LF4F 1EFTA 3ZC4A 1APSA 1NSKL 1TUGB 1RT6B 2J8AA 4Q7JB 4ED1A 1T0TV 1X4CA 2CWKA 1UMKA 4KO0A 1R6VA 3MPUB 2LEBA 2W1BA 1LK7A 3NGSA 3RAQA 1F9FA 3HVAA 4FYDA 2RUGA 3MXHP 3JTNA 1N05A 2RQCA 1U6BA 4LBPA 2H4WB 2WAQD 2RJZA 5D4NA 2VPWB 4ILLA 1V0FA 4XD7A 2E1MC 3JQMA 3HI9A 2F4FA 4LSLA 4CLPA 1JLCB 1KP6A 2L9WA 3OVBA 2MZSA 1DFDA 3KLIB 1X8DA 3CCSB 1P8GA 2XYHB 2KM8B 1JLBA 5CYQB 1TUVA 4C3KA 3QMQA 3WNDA 3JTOA 4JI4J 4X4SA 2XLIA 1CNFA 4LBWA 3OAAA 3CCWA 1RT1B 4RPDA 3PENA 2HQFA 1S59A 3CW2A 2V5HG 5KFZA 3ASPA 2KTQA 2R7WA 1T8EA 2V2ZA 1HQUB 4QIGA 4OX9J 2XTJP 2V94A 5G0RA 2MQ8A 2QTZA 3MDFA 4E8UA 2OK7A 1AZSA 4K0KF 2EG1A 5E3CA 3WIVA 3P27A 1NDHA 4ZOSA 4P2FA 4OI4A 3EGVA 2D3NA 3UR3C 2VA2A 2MTLA 1NRKA 5EWEA 4JI8F 4WWVA 3Q24A 2ZH8A 1VQMB 1N48A 4ER8A 1MWYA 1RBLA 3MMCB 2YY3A 3VAGA 2MLYA 2QMWA 1UA0A 2HVHA 2M9KA 2YNGA 4QIFA 1WORA 4DR1J 2YWWA 2DIVA 1FVQA 1YJ7A 3TRGA 4RU2A 3I56B 4LT6A 3OFGA 4YHBA 4F0KA 1XR7A 3IR7B 2CW5A 4PG5A 3PA1A 5IC4B 4DN9A 4DPWA 2FJXA 2D74B 3ASQA 3H9NA 4FYXB 2BA9A 2MJNA 2VZ9A 4PKDB 1W2IA 1ZYQA 3L4BC 3CB4A 3BF4A 1S9EA 3IFEA 4ANCA 3GYGA 2DGXA 3AQOA 4CYUB 4DV2F 4HDGA 2JEIA 2B7CA 2YPYA 3UR0A 1NK6A 3M2RB 4UY8T 4TMWA 1KONA 4ZPCA 2X53S 2RHSB 4WFXA 4CQ1A 2YVSA 3DOKA 3FZ2A 1UVKA 4ECXA 1X7VA 3W2GA 3KG4A 2Y1RI 2WVBA 5EX3A 4WU2A 4F4XA 3DI6A 1S6OA 1HNWF 3FBCA 4RM0A 3P8BB 2AT1B 2LQ9A 3G6ES 5H5JA 3EWGA 3C46A 2Z2MA 1WHXA 3QJJA 1WC4A 3KG1A 4FNHA 4ECTA 4TMXA 2B4UA 4XKVA 4A8OA 1S12A 3CPXA 4KIAA 4DEZA 3JQQA 3QWUA 3LNNA 2KJVA 1N32J 2B5OA 4O4GA 4USKA 2I9SA 4ANDA 1EHWA 1WSRA 1Q5VA 3UNGC 2FQQB 4DR7F 5A2QY 4CLKA 1IKWB 1HBOA 2NLWA 2WOMB 2VOOA 2HHQA 2RUSA 3NG8A 1FHTA 3E3XA 3QSYA 4TQRA 3A8IA 2W9AA 5E3RA 2CWXA 2G1HA 1VMBA 3MM9A 1KMHA 4Y2MA 1Y5LB 1XB2A 4HH0A 2VQEJ 1IQTA 4WZQA 1KVIA 4XLEA 3H7HB 4YQWA 3M6VA 2WPDA 3MM9B 3W3SA 1B0TA 3C6UA 4LR8A 1UMJA 4ED5A 3NAHA 5J2NB 4ZHRB 3PVDA 3RBDA 1JNYA 1FNOA 2XI3A 5GV7A 3CPWB 2L08A 4PRFA 2HHHJ 5D8HB 4I6YA 2WW4A 3HAGA 2ZTGA 4C98A 1FDNA 2C78A 2NUHA 2AJFE 2MSSA 2KG0A 2HRUA 2ZH3A 3ILLA 4MIWA 2CVEA 2XG8A 3T51B 4LRDA 1ZA2B 3DOKB 4TYBA 1X0PA 3BKFA 4K4SA 1Q86T 4DUTA 4ROXA 2VQFJ 2FY1A 3CCVS 2OBTA 5CHCB 1TAQA 2JFKA 5ETSA 2UXCF 5CZXA 1YVFA 2XS2A 2RQ4A 3SSQA 4MYUA 4Q44A 2DHAA 3TANA 4G1BA 2Y0BB 4GC7A 2GVZB 1FA0A 4OI6A 1PYTA 4NLDA 2FUG9 4WZLA 1GAOA 1VI7A 2E7XA 1GVHA 1T6YA 3K7RA 1T5EA 3AVVA 3GIRA 1JA0A 1EP4B 2RC6A 1YWXA 5F41A 2RB7A 1UFWA 3MM8A 3R5GA 3VVUA 3I1FA 5HROA 3CDEA 3J80U 5J1EB 1PO6A 2R8KA 3P45B 4FDFA 5F8LA 5KFXA 1PKUA 5B09A 5I3QA 4UF4A 1X4HA 2AEFA 3NL0A 4WKYA 4X7CA 1U8WA 4ZVSB 2FZKB 2QGFB 3H42A 4WFYA 1J5OB 1B3TA 5D78A 3E8OA 1WOOA 1S1VB 1X31C 2ZITA 4J9QA 1JIHA 4FF3A 3MCAA 3WYAA 2MKSA 4IFYA 3CMEB 3PEHA 1G1XA 2ZFHA 1BLUA 1RHQB 3R5CA 3MUVP 1QVGB 1BQNA 3GWCA 2R4FA 1VFJA 3MWBA 3VALA 1FWPA 2CPIA 2GIFA 4YR3A 2K06A 3W2WA 4PG7A 1X4EA 3GIMA 3CJQA 2Y9HA 5J1NA 4NXNJ 1G7CB 4K0KJ 1PC5A 2XMUA 5HVHA 4JI2F 2QMUB 4AXIA 4OLOA 5KFBA 4KQZA 1VQ8B 3OR2A 2XS7A 2G13A 2B56A 3LALA 3DM2A 3DRSA 3ZFVA 4P25A 1LOUA 5IM0A 1RT1A 1EXMA 4CH7A 4WTOB 3NXZA 2IVFB 1RXOB 1TVRA 4KH1B 3CCEB 1HL6A 1L3UA 5K9FA 2ZZTA 9RUBA 5A76A 1FK9B 4C3LA 2FZGB 2X51A 5B0GA 4HTIA 4PAAA 4Q0BB 4ZV4A 3IM9A 4YELA 4K4UA 2HFOA 4IH7A 3GFYA 1GO2A 3LAMA 3ZIAA 4C8LA 3NOCA 4OZ2A 1VQYA 4ZVTB 4ZVEA 2WB1D 1WI6A 4LRAA 2CQ0A 3OL8A 3KOAA 1FRIA 1BD6A 2HFVA 4C8KA 1HPZB 3CC4B 4HACA 2CJXB 2ZM6F 1NZ8A 4I0WA 4JV0A 4PC2A 3M8WA 4Y9UA 3G4SB 1S4MA 1ZAWA 1FRQA 4RUCA 2R42A 4RCZA 3G05A 4BWJA 2H5EA 1IKXA 3QFCA 2YH1A 3MCMA 3CD5A 4DX6A 4B9MA 4NLRA 1M1GA 3AA8A 4DV5F 2VPXB 4I69A 4IFVB 3CC7B 3LPYA 2OIHA 3VHQA 1N0UA 5LSLA 3FBFA 4B3RF 5L9NA 3EM1A 3AY0A 2XSJA 3EVOA 1JLBB 1MU2B 4UQTA 3W2WB 5IT9U 4RBTA 4FP9A 1OIAA 5IK2A 1Q82D 2CFXA 2CPYA 3HFZB 4DR4J 5KSWB 2YKQA 4A8YA 4FVMA 2V6AA 4DQIA 1EP3B 2PT0A 1BQMB 4XLAA 4DR7J 2HZAA 2D9RA 4RWWA 1JJHA 5I3UA 1WEXA 4OI3A 4JI7F 4PEOA 3V81B 1ZTTA 1TK5A 2HZCA 1K1SA 2E1BA 3DI6B 1R8CA 1YG0A 3LTOA 4OPVA 4YR2A 5H9EJ 4DSJA 2VG7B 4X4NA 2V2VA 1F3FA 3I5AA 3WBJA 1PYSB 3AQPA 1KC8T 1RJJA 2Q6LA 3MECB 1N5SA 2OTLB 2UUCJ 4CTAB 4MK9A 2EI5A 2M8HA 2PO4A 3W2FA 4LF9J 1UTAA 5LJ5Y 3DHXA 2GZOA 4F7VA 3NAIA 4OZ1A 1FX2A 3MM6B 1HZEA 2J0XA 4OJ1A 1O51A 1C1CB 2K7JA 1FJGJ 3ZUGA 3BPDA 1YJUA 1C0UB 5A8RB 3G71B 4DL2A 2M70A 4EEYA 2EWHA 4YB6A 3MEDA 1UW4A 1G4CA 2X6WA 4J90A 1F2GA 2ZZGA 3WNCA 3MHYA 3GYXB 4OL8A 1R31A 2AYMA 1CLFA 5CCMA 1S0OA 1GAWA 3AVWA 1KFSA 1SJ4P 1QUVA 1NDKA 1VJWA 3D26A 4C8NA 1F5AA 1H8HA 4LREA 4U96A 2BE2A 4FS1A 1H6KX 4UUWA 1F5CA 2KKHA 2VQFF 3MMBA 2QRRA 4CQJA 3I0RB 2WSCC 3N6NA 3PKYA 4X4PA 5F9LA 4EMDA 1WTFA 4OI0A 3Q2SC 4OJ3A 2AGPA 1IJFA 4P2MA 4RO0A 4FF4A 3H20A 4IRDA 2RDDA 5A8KA 3UD5A 3P5TL 3QFTA 2F9JA 2NXEA 2WJVA 2D1CA 4BLGA 4RX6A 2PE3A 3SV4A 2I5JA 3MPVA 2L48A 4CLLA 4ELVA 1N8RD 2EBGA 2CC2A 2CUYA 1J5EF 4FYWB 2VZLA 3HM9A 2OEKA 2ADCA 3G8TA 4DX7A 4CP5A 2DGTA 1MMDA 1R27B 3VQSA 2KFZA 2AWZA 2ZXIA 4CLYA 2FJBB 3LP2B 3D0GE 2F3JA 1IM4A 1RUSA 2JH3A 2HLDA 1XR5A 3HT3A 3T5HA 3LANA 2D41A 2YKOA 5D77A 1UWBB 4OP7A 3PJ9A 4Q45A 1SQEA 4RD3A 4ZPAA 1A9NB 3DGPA 1FRXA 3OKXA 4HYKA 2ZH6A 4MAKA 1N52B 2Z2LA 5IQQA 3I32A 4CT8A 3G6XA 1KS2A 3HT0A 2RVJA 1HIYA 2QL9B 5CQGA 3G87A 1HWUA 3C19A 3DLEB 4HIZA 1S0UA 3TZZA 2J0SD 2LEPA 3M9OB 5GADI 2J7UA 3MD1A 3UCUP 4RPFA 4ECVA 2CDRB 1RHRB 3MHPA 1WKLA 3SCIE 1WG1A 2K7KA 5HO4A 1CC7A 1QTNB 1VQNB 3PRBA 3DOLA 2YWKA 1EFRA 2GW8A 3DRRB 3K8WA 4IR1A 2AGOA 1NMEB 2NZCA 5L1JA 1REVA 1R8HA 4F36A 4M5LA 2GK7A 3J81Y 1CJUA 5D0HA 2M8DB 1WP6A 4YUDA 2WYRA 4RW9A 1C1BB 1SJRA 4RW8B 4LF9F 2DNRA 2JWNA 4WWSA 3ZZYA 3QLHB 2O67A 2DIEA 4DR6F 4DPYA 1K44A 2D7SA 1IKYB 1FNBA 3UDVA 5EHHA 3IWLA 4URGA 3F41A 2IM0A 3IR5B 4W90B 3CMAB 3M6XA 4C48A 4DV5J 3AB2B 1VRTA 4NRTA 3KJFB 2POKA 4JI0J 1HW8A 5ETPA 1WC0A 1CJVB 4IFVA 3CMAS 2C2ZB 3BY2A 4K8RA 5D4LA 3FZBA 2X1BA 1GEHA 1C0TA 2VG5A 5CYJA 1YI2B 3S1TA 4DR4F 1HFEL 1FI4A 4OI2A 1V5VA 3E51A 3CMES 4U7CA 1PJ6A 1D9FA 2CPDA 4RCYA 2MGZA 3H90A 2BABA 3O5TB 1O5JA 3C14A 4HLBA 4TLQA 5A6WA 2Z57B 2Q6KA 3X1LB 2EFVA 2CNDA 3HHLD 4FXDA 1M1KD 2IM2A 3KJVA 1YZ6A 2HSEB 1GXLA 2P2CB 6AT1B 5L8RC 3R6GB 1PJ7A 4YEAA 5KT5A 1TKDA 3AOAA 3W9HA 3MM7B 5AE3A 5DQHA 2IRXA 2ZKTA 3NBPA 4DUZF 2E5HA 2AX0A 5AN9A 1AMOA 1HBMA 4OHXA 4C0OC 4CO0A 5E5NA 4IH6A 3D1HA 3KHHA 3GTYX 4DFMA 2XMVA 1HVXA 3W62A 2ZWPA 4ZVHA 4UZEA 3CCTA 1HQEB 5D15A 3V81A 4M5IA 2DEIA 3KTQA 2A1BA 2LDYA 4KGZB 3KKFA 1DARA 1WG5A 3ZPNA 4O4GB 4AL7A 2CYYA 1W26A 3M2UA 1D09B 2RMLA 3BO2A 1HBOB 3AFGA 4NXMJ 4Q8EA 4K4XA 3U1NA 1KNZA 2KN4A 2HHWA 2ZL6A 2UXDJ 2HMIB 1NZAA 4B08A 2QN6B 2YQ0A 1JLQA 3CJ0A 2GVZA 4ZLNA 4LF8J 2QX0A 4XN3A 1GX5A 3D6TB 2W7AA 3T6JA 3R2DJ 3OTBA 2LYVA 4M95A 1S6PA 2RF2B 4DSFA 3PYFA 2WVEA 4UOFA 2XSJB 2BMWA 4C11A 3QJPA 1FD2A 2EPIA 3CCLB 2WSEC 5F4JA 2XCAA 4DV4J 5B0DA 1NPKA 3T5KA 4GMKA 3TARA 1SUQB 4RW6A 1HQ2A 1SKYB 5BSXA 4ZMMA 1EQ0A 4S0MA 1OYDA 1S76D 1E3XA 2PFDA 2EW9A 3D3BJ 1H2VZ 5DG8A 4U7UK 2XB2D 4WF9Q 3TVYA 3AHPA 2BE7D 4L76A 2HHVA 1WKJA 1LQ9A 2H54B 3N28A 5CYMB 4YY3F 3THVA 3V6KA 2JEGA 3CXCR 1ZS6A 4M8LA 4AF7A 3UWTA 3AVXA 2E1RA 5B6IA 1S72S 3UDCA 5KG4A 1AXQA 3PCOB 4IRCA 1LKZA 2GA7A 2D9PA 4JI7J 2NYIA 1HNZJ 1NK4A 1PJ5A 3R2CJ 3MMAA 3CD0A 3W2EA 2F4NA 5KG3A 3MCNA 3UD4P 2QJ3A 4J5OA 3ILIA 3MCSA 4WFBQ 1SKSA 3LO8A 1HWIA 5HMYA 5SZTA 1IM6A 2R2TA 3FKBA 2CJQA 3CWJA 1BX0A 3A12A 1RT7A 2QT7A 2JRSA 2FLNA 5IM0B 4HKQA 5HLFB 1N6QB 2RD5C 2GJPA 3HP6A 1TVRB 3C6UB 2RRAA 4PG6A 5LXRA 2HNDA 3MOZA 3DGPB 3JSBA 2HVEA 1PAUB 4NZ0A 1JLAB 2YWFA 1S99A 2F5GA 1LWEA 4TSFA 1N5TA 3GJSB 1WC6A 3QT5A 2JNJA 2P6TA 1X5SA 1Q95G 1YRUA 4J9NA 4PGOA 2WBMA 1MNEA 3W8GA 3MR2A 4CWBA 3QGGA 5IT4A 2FZCB 3OVSA 3RB0A 1RBOB 2BJEA 4PZVA 2IM3A 3K5NA 3LUYA 2DR7A 3CDAA 3GG1A 2NPFA 3CC2B 3Q6RA 2B8PA 5DLGA 1T95A 5DG7A 3A3BA 3NCPA 1FNDA 1BMFA 5TV2A 1MW7A 1DAXA 4X64F 5A2QU 4NZ6A 4ZGNB 3H4BA 1D0EA 3Q39A 4RR5A 2CG8A 1SB6A 4ZCIA 3H8YA 1RTHA 3POTA 2C22A 2CPHA 1ITPA 5A6PA 4J9PA 1RT5B 4HE6A 4M94A 3VNVA 1YBUA 1WI8A 4CO5A 1UW9A 4YAFA 3Q83A 3PV8A 3S7RA 4LVNP 5C25A 3M1VA 3CO0P 3R5JB 4ES1A 1IR2A 1UD3A 4RD6A 1WF0A 1FNCA 1YJNB 4QIWD 1LWXA 3VVTA 4CH0S 1UEUA 4OMFG 2WR8A 5E41A 4YR0A 2CBXA 1HARA 4CLFA 4P6QA 4I2QB 1TKZA 2DYAA 5L1IA 4DUYF 3R97A 2FJWA 5E33A 3CE8A 1HWKA 1SKUB 2DITA 4ED8A 2OFGX 1W35A 1KHWA 4G65A 2W4CA 2XNCA 1CQMA 1PC4A 1TELA 1N36J 3QSYB 3U6BA 2ADBA 1V3SA 5KT7A 2DCUB 3W5ZA 2WVFA 2YKMB 2YH0A 1RA7A 1TV6A 2BVZA 2F8EX 3GVJA 4W98A 2C2RA 1S9EB 2MQNA 3N5FA 3H2LA 3ZZOA 1SBRA 3D6MB 2VONA 1MN7A 3SQOP 4PG8A 3R1LA 1HWLA 1HNVA 3JYTB 4P12A 3H98A 3NCRA 1ZTWA 2DOGA 1VK3A 2F40A 2BX6A 1WELA 2GC8A 1UVNA 1Y3KA 2BR0A 1SKWA 2V0NA 2ROGA 4I7FB 2LQ5A 2GVDA 1KLMB 2WVCA 5IYNA 3CCLS 3OSPA 3W5VA 2OO4A 4F8RA 1SJ1A 2VBYA 3M1VB 2OPSB 4UAJA 3EUNA 3CJKB 2YWHA 2CQ1A 4ZCMA 5D4OA 1S7IA 1YJWS 2LXUA 4NI2B 1XJWB 1FRHA 1VOMA 1RYRA 2YXLA 1XMBA 3MD3A 4JV1A 4IG3A 2LZJA 2I2YA 2OBRA 1IWGA 2RIJA 3S01A 2GK6A 5KOWA 4XDDA 5KFSA 4OYBA 1R0BG 3WX4A 2FDNA 2M88A 1YIJS 1KRHA 1SUQA 1SI9A 1X9SA 3I5CA 2UZAA 2UP1A 4JI5J 2GMLA 4IOAQ 3QFSA 5KNLA 1QD1A 1B7FA 5HANA 2VQEF 3ITHA 4C6AA 2JVRA 1VHEA 5JXSA 1UWBA 2CZ4A 3HO1A 1FJEB 3OPKA 3B6BA 4LF7J 4EO8A 1BQEA 5LMUJ 5F4MA 1ZM9A 3GQBA 4DL3A 2X1FA 1UD5A 4M5JA 4QR1A 1MROB 4WP3A 3IG1B 3P96A 4C7QA 1U26A 4WE1A 3CJ4A 3BQ1A 1RT3A 1WC1A 2A6MA 3AXMA 1NB2A 4H4OB 4DDFA 3HJVA 4LRFA 2D3OR 4Z4UA 4NE9C 4G1QB 4DUZJ 1QGAA 4OZJA 3EZUA 3GG0A 3M6UA 4HACB 3SDEB 3T9ZA 4OQJA 4KTQA 3SCKE 1N33J 5K8OA 3TJ8A 2IAJA 3A8KA 3MUMP 1S5ZA 3HVRA 1RWPB 1U1QA 1KSPA 1VHIA 5KTQA 1VC6A 3IAS9 2MLZA 5DQIA 3U2QA 3BSAA 1SJFA 1GTHA 2UXCJ 2OPSA 5KFPA 4TMZA 2CQ2A 2VASA 4P1VA 1UKUA 5E6TA 2A10A 4ECUA 1IBMF 4B9VA 4KO0B 2R7VA 4F4KA 1IR1A 2RS8A 4OOXA 4WPAA 1TL7A 4ZHRA 2EFNA 2V9WA 2HNYA 2BE2B 3DN9A 1UD6A 2DETA 2QA4B 4XR6A 3R7BB 5B0CA 1HKAA 1FK9A 2CPFA 2IYIA 4QIEA 5LL6d 4DWIA 1IBLJ 3EX7B 1FRJA 1ZM2A 1HNIB 2VUGA 2HWIA 4W92B 2EXUA 3JAMY 2XM3A 2ZH9A 1EAYC 2F43A 4ECQA 2AHOA 1J2VA 2X3DA 4TMTA 2N3LA 1KQFB 3ITHB 4WZTA 3UN3A 3BSNA 4NLVA 1U0HB 1DTQB 3M30A 2MKKA 2IC3A 1U1MA 3OQ2A 2EFOA 3OL7A 4GRSA 4A46A 4WFAQ 2C77A 2AHOB 3ZTOA 4LSZB 4DG1B 2UVVA 3BGFA 2B5JB 3KHGA 2ZZEA 3JTPA 4I2PA 1LFWA 3H0PA 4YDDB 1YGYA 3ZBUA 3AD8C 4P75A 3JQPA 4ELUA 1CJTA 4MJKA 2AJQA 3CCQS 3HZGA 4KKOB 3J81k 4NX9A 5KFUA 1V3RA 2PMWA 4WTYA 4K4YA 1YK9A 3Q3AA 4HE5A 4DV7F 3AGQA 1MMNA 3AXKA 2FVPA 3WBKA 2IAJB 2R7QA 1H38A 3R6KA 3SI8A 1IKYA 2A0FB 1RT5A 1TTTA 2B43A 3DLGA 1X4FA 1TKXB 1N36F 3HSZA 4YB1P 1M5SA 4DR5F 1PBUA 4QBUA 1QY7A 2QSFA 1X9MA 2FLLA 2EFPA 4L6V3 3KK3B 1IBKJ 2ZE2B 3DLGB 2IM1A 3A4TA 2R7OA 2PEHA 2CQHA 3I31A 4L73A 4QCLA 1JWWA 3G96A 3PG9A 1FDDA 3O8WA 1KD1T 4OYMA 4DLEA 3ZZTA 1KQKA 1EFUA 3LF0A 4P3YA 2RT3A 4P7TA 1VLYA 4Y7CA 1LW2A 2QO3A 4MKAA 3B4DA 2OFHX 3SFGA 1VBKA 1U0HA 2GIRA 3GV7B 4QWEA 2B8QA 2KHDA 1AROP 3ZZZA 3DDYA 2DCUA 1LK5A 4K59A 5HMZA 4RW8A 4G7XA 3CC2S 1JLQB 2E1AA 2HK3A 1FVSA 4A8XA 2XMAA 2RDJA 3AOCA 2XO7A 5BJRA 1VDHA 5CCLA 2UUAF 1B70B 1Q1KA 4Z4RA 4Y2AA 1AFIA 3ULHA 1QFYA 8AT1B 2ZD1B 1Z1ZA 2XZTB 1BX1A 3QO9B 1BWVA 1TKTB 2CQDA 1RE1B 4R0EA 3D66A 4CYUA 2APOA 5KG5A 5C25B 4FBUA 3OJSA 4U9RA 3KUGA 3G71S 1VRTB 2CJ9A 1KQSB 3FCHA 2CQCA 1X5OA 3MCOA 2CRVA 3W8PA 3ET6A 3ETOA 4I2QA 2DJWA 4Z4TA 4O44A 2RNEA 2V9KA 1QLNA 4OZ5A 2HNZA 5KFEA 1QM9A 1RWMB 1MG7A 4ETZA 4LF7F 2ZE2A 1U1PA 4OFZA 4WFZA 1KLNA 4O3QA 3PR5B 4JI4F 4BDPA 4A8SA 1YJRA 6FD1A 5EMNA 4WBFA 3W63A 2IVYA 2EG2A 1U6ZA 2MY7A 5I4MA 1REVB 2I8EA 2C2KB 5J3OA 1Y4ZB 3MM7A 1S10A 4DL6A 1EIYB 2E5JA 3GE9A 1OMSA 1W2BB 4HT7A 4R5PB 1S57A 3WQZA 3HSJA 2WSSA 4HTJA 1RQRA 4AXJA 1EARA 2V8HA 1ZA1B 3H5XA 1NJIT 1Q16B 4GKKJ 2ZVIA 3ENWA 2LQ8A 1UPPA 4RZRA 2DVIA 4A8WA 3ICLA 1T94A 4KGVB 1ROFA 1XTZA 2EFQA 3GVKA 2VF3A 1XK8A 3ZC3A 3IG1A 4G3IA 3NEKA 2W8LA 2KYZA 4DQRA 1T03B 4DR1F 2CPXA 2QYGA 1DHMA 2QE7A 1DQ8A 1RLDA 3PHTA 1R3NA 1LEOA 1VRQC 4DX5A 1VBXA 4G6VB 3MMCA 5LMNF 1XMQF 4PWDA 3KHLA 5CAAA 3BDPA 3OE7A 2AYGA 1HW9A 4LBIA 5KFWA 1XNQF 2JFDA 4NLSA 4QPTA 1WC5A 3EPGA 2B7CB 2XNRA 3EZOA 4DQPA 3OZUA 3CCRB 4H4MA 2M2BA 4XTTA 5C2CA 3PRDA 1D8TA 3IP0A 2IDLA 1TU0B 2BJ1A 5HLFA 1UJ4A 5DQGA 1FFGB 4JMQA 2GGPB 2C2DA 2H1YA 1VQ9B 1K9MD 4ZPBA 4EUVA 3O2IA 3M05A 3WHIA 3U27A 4DK1A 2J0QD 4KFBB 2XGQA 2W2OP 3UCGA 2HQ3A 3A3PB 2LCWA 4Z2XA 1H85A 3CDWA 2XZWA 1VRUB 4PPZA 5L46A 2RC5A 5D0RA 3QYYA 3K2YA 4U8VA 2VB6A 2KU7A 4KHPJ 2DGWA 1URNA 4GVBA 1MWQA 2QLJB 3UVJA 3EGWB 1WHYA 2NSCA 5DS0A 3A8EA 1SL2A 5BSYA 4PR6A 1K28D 2FY8A 3C15B 1GXUA 2QL7B 3N5BA 3GPAA 4UOGA 1WDDA 1F2HA 1NLKL 1BXNA 3RU0A 4KE5A 5LMUF 3CJ5A 4NYPA 4PC7A 1X60A 4B3MF 2JX2A 4QFMA 2J6SA 1EETA 3R6JA 3M4XA 3NY0A 2FC9A 4E0DA 2G2OA 3S8SA 3GV5B 4MH8A 3B8HA 2LKZA 3CCUB 4J9VA 4A4JA 1QFJA 1ZPVA 3BQ0A 4EBEA 2CZ9A 3EE3A 1Q4RA 1WWHA 1JLFA 5L1KA 3CCZA 3BNWA 2C4TA 3DRYA 2W4PA 3CMMA 2NZ4A 3FEXB 1XQBA 2W2MP 3JYTA 2VL1A 2UUBF 1NPPA 3NS6A 5I42A 2HQIA 4LRBA 2CXEA 4P6YA 2HGMA 4J7CA 1FWLA 4URQU 3RBXA 2P9CA 3FEYB 4TN1A 5F0WA 3ISND 1SL1A 1VGYA 2BJDA 1JJ4A 4KPCA 4I7FA 3KK3A 3GR1A 2OK8A 3A3NB 4B3OA 2MPUA 1CS4B 4HL9A 3PUNA 1FXLA 3HHNB 1FXDA 3RBEA 3WBZA 2W9BB 3MUTP 3E1YE 2DR5A 5D3GA 3PVXA 5HQMA 2CZVC 4HHHA 4QUZA 4UZUA 4JYAF 3QAUA 5ETNA 5KFOA 3CDBA 3KMSA 4NLOA 2DKOB 4Z37A 1S6UA 1UFKA 2DXEA 4KKTA 4KT0C 3E01A 1Y0RA 3AJ1A 3JSYA 3CULA 4RUBA 5GAHU 2VBSA 2E5LJ 1HBUA 2HHPA 1HBNA 1FRMA 2BRKA 3EICA 4EBDA 3MM6A 2XNQA 1TKTA 1XEZA 3SJPA 4C0BA 4NL5A 3TWZA 5EDWA 2GVDB 3QRPA 4LJMA 1MSWD 3H5UA 4J37A 3SBMA 2HCJB 3NE5B 3CC4S 2GHPA 1WEZA 1ZBTA 2Z8QA 4QYRA 1MROA 1H42A 2ZC4A 1VCTA 2W6JA 1R5NA 1YX2A 1UJ6A 2MKYA 2CIMA 1YKWA 3MMJA 3F44A 4FVCA 5FIIA 1NDLA 2NV4A 5DM7Q 2QV6A 3OHBA 2MQOA 3L7PA 1FF2A 2BUNA 2P6SA 4WIQA 3CD7A 3M2UB 1JLEB 1VIXA 5HJYA 2WZ1A 3DLJA 2HNZB 2FJVA 2XULA 3OTCA 4QYZJ 4KY3A 4ECSA 4X4VA 1RADB 3LP0B 3O1LA 4AL6A 4CCHA 3SLDA 2NREA 1T9YA 1N8RT 4ZPTR 1AUDA 3QBCA 3D1QA 5D6GA 1RAHB 1EKSA 1JQGA 2KT2A 3IAM9 1HR0F 3V4IB 2D3O1 1SQGA 1VK8A 1N5YA 1T9TA 3VZIA 4GVLA 2OEMA 1V3ZA 3TNVA 5AXKA 1DZ5A 2V7WA 1HPZA 1IXKA 1OY9A 1UFLA 3MFIA 2DXFA 5J1PA 1K47A 2G2ZA 1TL5A 2LLZA 5IYRA 3T19A 5AT1B 1C0TB 2BZ2A 3SKBA 3RZAA 5CABA 4USMA 1SC4B 2V7QA 2DBBA 2BM0A 4XPEA 4CRJA 4QV2A 4DQQA 4M4SA 1MMLA 1WC3A 4NNJA 1VQ5B 1D1NA 2ATCB 3PX0A 2W2PP 3MEEA 2R8GA 2C5BA 1RQPA 3KK1A 1RT4A 4RDKA 2ZH5A 5DRKA 1CJVA 4O44B 2D74A 4CLSA 4ERDA 2EBEA 3DMJA 4LFBF 2B0GA 1JX4A 1ULRA 1H8EA 2X1GA 3CF5Q 1YBTA 2QLXA 1FRNA 1S79A 2VJIA 2ROPA 5DJBA 3PR4A 4X65J 3KUHA 2PSZA 1VRUA 3FCVA 4B3TF 2JIZA 5A89A 2HAFA 1QUFA 4I4BA 2X3UA 4O3RA 4OOSA 1FDRA 2JZ5A 3WNBA 3TZWA 2K1RB 3H5SA 5TR9A 3I9ZA 3WZ0A 4DF4A 1OSDA 2MEWA 4R5PA 2QFIA 3FEZA 1RSCA 4CTAA 2XMMA 2OUGA 4OPSA 2RAQA 3MPYA 3LQ6A 1LWEB 4M0LA 4KPYA 3J81j 4MT1A 3BM7A 4MYTA 1OPIA 3QRRA 1W2BR 2E7VA 1C1CA 4ZP7A 2FTRA 4CH1A 2QTLA 2G2YA 4DNRB 1XE1A 1CJKA 1RHMB 2VOPA 1SCJB 5C24A 4WZMA 1WNEA 3V5RA 2I1LA 3MPDA 4LF5F 1Q7YD 1GXTA 2E29A 5FIUA 1SM4A 4CO2A 2OSRA 3MTKA 4TMVA 4KGMA 4OYZA 4ZVQB 5FO1A 4NCNA 2PI5A 1VJQA 1QSLA 3IBWA 1IR0A 1HI8A 2YTCA 3M8RA 2MQMA 3I96A 1XC9A 5I3PA 5CA5A 5HZBA 4DL7A 2DH7A 1RCOB 3JXOA 4DV6J 3AJDA 3DOMB 3MAAA 4CIOA 1C1BA 3RTVA 3HVTA 1NM2A 4JYAJ 2FGCA 2XGJA 3H25A 5AE2A 3CJ2A 3ADAC 3UFCX 3B54A 1CNEA 1G6BA 4X4RA 2OSQA 4U8YA 2MZQA 3PFOA 4OX6A 1IJEA 1KK2A 4USHA 2NSBA 1WHWA 1FRLA 2H3EB 4USJC 3QFWA 2P3MA 4RWXA 3ONUA 3DLHA 1BMQB 1YJTA 2HVIA 1TTHB 4G1QA 5JVHQ 2G0IA 4GKJF 4UZBA 5L1LA 4ZCLA 4NCGA 3AOBA 3POTB 1U8SA 2VPZB 2ATLA 3QGPA 2MLXA 2B51A 1K0VA 1YDLA 2VFVA 4JI2J 2DGSA 2BRLA 3M9NB 3KJNB 1HHTP 3WC0A 4CO1A 4F3QA 1BE4A 4EGLA 4DQLA 3FRZA 2C5HA 2VH7A 1B0PA 2HWTA 3SIPB 3N0VA 4TYAA 2QA1A 3C6TA 1VQNS 3G4SS 4XNFA 4Q7AA 3RRHA 2MZJA 5FDLA 3TA2A 1RTIB 2YX7A 3AD9C 1SH0A 4JI5F 4M5DB 2QN6A 1VQ5S 3IGVA 2KYXA 2DCLA 1BQXA 3FSXA 4CLTA 1O8BA 2Q6IA 1RKIA 2H5IB 4ZN1A 1CULA 2GIQA 1VBYA 1VQ9S 1UD2A 2PA3A 2UVRA 2ZOGA 1W25A 1RTDA 5F8GA 4P74A 1NKBA 2KFNA 5EN1A 2W01A 3J7Z5 1T6XA 2DHGA 2QEXB 1UZDA 5GMKa 4WZEA 3AH6A 2MMYA 4UTGA 3DDIA 2R7RA 4XQFA 5IS2A 2L3MA 3KL9A 1YRXA 1CSJA 3PIOQ 3MAQA 2HS0A 4PWUA 4CZCA 1RTHB 4F2SA 1UP1A 1FTCA 2BEFA 3Q8PB 2GJIA 1K8AT 2E7WA 5J2MB 2I5JB 2B7BB 4PXCA 4JB8B 1YHQB 5HP1B 1RWOB 3FMBA 3EYZA 4FXVA 1YBAA 2HMAA 4ZP6A 2JJ1A 5FJ4A 4LF5J 5KG1A 3CD6B 3GYNA 2DR8A 4PXDA 3BQ2A 1NH8A 3PO4A 2C3UA 2NS1B 4KV8B 1UWAA 2MHEA 2V68A 2OPPA 3IRXB 2ACMA 2RILA 4QW8A 4IUFA 2ZJQQ 4DLGA 3PUMA 2OPRB 1P27B 2DGVA 3MTJA 1COWA 3C6TB 3T56B 4X66F 4PXEA 1SVDA 2VJVA 5H9FJ 2BBEA 4LIWA 3CIMA 2BPOA 3BJYA 3JSMB 3LA0A 4M5GA 4DU8A 2UUCF 3DC2A 2LFVA 4IRKA 2HNDB 2F1LA 1N07A 3NGUA 4LSLB 3D7SB 5HMWA 4XL9A 3CCJB 5A8WB 1DURA 3LO3A 2HVDA 1Z4UA 3SEOA 2EC2A 1ELOA 3TQEA 1OYEA 4TXSA 1KK3A 2EK1A 5K8PA 2R9VA 1KKHA 4RDLA 5GMDA 4F0HA 1U2CA 3VGSA 1DBDA 3D54A 2GS8A 2ZBVA 2W24A 3C16B 4PQUA 1FEHA 5K5MA 3QE2A 4KGXB 3EDQB 2UU9F 4BCAA 3K59A 2YNHA 1BC6A 1QGZA 4QVJA 1IBLF 3T5LA 5LMZA 3R5AA 1JKHB 4H4OA 2HW3A 2DISA 1KLMA 1JXVA 3QLHA 3GJRB 2BVNA 5HJXA 3CGIA 1RT6A 1EB0A 2RRNA 1WHVA 1OSCA 3KYLA 2YNFB 3W7BA 2DGUA 4BBYA 2FLOA 1UVMA 5KFTA 3TQ1A 2V63A 2D9OA 5EGYA 2VNHA 4XM3A 1UL3A 3HD2A 3Q23A 3PX4A 4UZCA 4ZJOA 2W7OA 1Y0HA 1KQSR 2AP6A 1CQXA 4Q8FA 4DV6F 3G6EB 5HXBA 5A88A 3QGHA 1F0XA 4GQNA 1FJ7A 1PYOB 3P3DA 2XMKA 4DN0A 1S77D 1W7WA 2CJYB 4DSEA 3R8YA 1IB0A 1FDBA 3BH7B 2ASDA 4ZLPA 1RAIB 3TAMB 1E63A 1XR6A 5K20B 2HMIA 1QAXA 4NLUA 2DGOA 2F65A 4W4MA
chains in the Genus database with same CATH topology
4NLWA 4ZKAA 2FJWA 3I0SB 1FX0A 5E33A 4GC6A 4OX8A 4YB7A 3CE8A 2HS4A 2AX1A 3RR8A 1HWKA 2IYGA 2E9TA 5KFKA 2XMTA 2FVRA 2YKNB 4L3NA 1NH7A 2XNDA 2DITA 4ED8A 1WD6A 2OFGX 3IXQA 4Y65A 5D4PA 3MR3A 5B7WA 3DYAA 1TFYA 5A8KB 2KDOA 1KHWA 4HDHA 3U7JA 2W4CA 1R8AA 4DPOA 1L3SA 1DTTA 5E3PA 5GAEU 4DQSA 1D8YA 1H3DA 4LMZA 1CQMA 1PC4A 3N4WA 1OPZA 1CG2A 4WYLA 5K8MA 1Q53A 2DH9A 4ETXA 2FC8A 3UPFA 1LW0A 4JBCA 4NLXA 4DF8A 4K5RA 4RW7B 5ITHA 1OB0A 2JJ4D 2PI4A 5B0BA 2RH3A 7FDRA 3LOUA 3NLCA 4ILRA 2EVZA 1VIOA 2PFFB 2K1RA 4YHHF 2ADBA 1V3SA 5KT7A 2DCUB 4UUXA 3QIDA 3FKSA 3THTA 5KFJA 2X6XA 2XBPA 4LIRA 2FVCA 5KG0A 3IN5A 3OL6A 2YKMB 2GMHA 2R2RA 2YH0A 5EX0A 1RA7A 3MF5A 1FKOB 2KRBA 4RW4B 5HI7A 1TV6A 2KJWA 4BC9A 2DK2A 5IT9Y 2BVZA 2F8EX 3QO9A 1EP4A 2R7XA 1C4AA 2Q6CA 4X4UA 4KKOA 1SC6A 3GVJA 2C2RA 2CDQA 1S9EB 1N34F 4KSEB 4TY9A 3MR6A 1U49A 2MQNA 2DIUA 3D5MA 4F26A 4EZ9A 3JU4A 1DLOA 3N5FA 5DLFA 3H2LA 1KEKA 1HNXF 3ZZOA 4XLFA 1SBRA 2ZJPQ 1JLGA 2VONA 4GO5X 5AXLA 4DR2F 2GHWA 1I8DA 4L8JA 1KFDA 1TKXA 4XORA 4PG8A 3R1LA 2AV5A 4TY8A 2D3LA 1HWLA 4LFCF 2KXNB 1HNVA 1U6FA 2ZBCA 4NA1A 2J6UA 1ZH5A 3JYTB 3H98A 4QJVA 2N82B 4ZVFA 4YDXA 3NCRA 2JC1A 3M9MB 5L38A 3TAPA 3L95X 1ZTWA 2HG4A 3G8SA 1BY9A 1VK3A 2F40A 2G9OA 4H4KA 2DO0A 4KKSA 3GSDA 1WELA 2GC8A 2HFZA 1UVNA 4NMLA 1Y3KA 2DNHA 2ASLA 2WONA 3M8QA 2ZH1A 2BR0A 1SKWA 1T7PA 2V4JA 1Q8BA 1HBMB 5MLCV 3I6PA 1T05B 2V0NA 1D1UA 1VS3A 2N4CA 2VBZA 2WZPP 2FVSA 4H4MB 4WU3A 2ROGA 4DFJA 1K9MT 3GZ7A 2PA8D 4I7FB 3UD3P 4RNFA 1RWUA 3IS9A 2LQ5A 2LXIA 5DDQC 1CVJA 1E6VA 1KLMB 5ADZA 2DRAA 4JUZA 1FTRA 4TN2A 4G1IA 1DQAA 1RAJA 3CCLS 3LP2A 3OSPA 2B9WA 1X4DA 3OTOF 2B4PA 4O3OA 1U1NA 2OO4A 5HKKA 3VQTA 5DDOC 4F8RA 1SJ1A 2MQLA 1Z2ZA 3DRXA 1UD8A 2MJUA 2VBYA 3M1VB 2OPSB 5F3TA 3TYTA 3OTEA 3GIJA 4A8KA 3EUNA 1X5TA 5K8NA 1AW0A 3CJKB 3J7A1 1TAUA 2QA2A 2YWHA 2CQ1A 4ZCMA 4DSKA 1HBUB 5D4OA 1ZZNA 1YJWS 1YJVA 4QQBA 2DB1A 2LXUA 2PMHA 4X4QA 5F8JA 4XAKA 1M5HA 2AYBA 1UETA 2XS5A 4FBTA 2XCPA 4XLHA 1H2UX 1FRHA 4Q2LA 1VOMA 1RYRA 2HHHF 3HF5A 1XMBA 3MD3A 4LQ3A 2XLJA 4JV1A 3SCLE 4IG3A 3NCQA 2LZJA 5J2NA 2I2YA 3DU5A 2EC0A 1Y5IB 4FZVA 4AE5A 1E1RA 3HVTB 4DK0A 2DNNA 2KRRA 2JEFA 4AVZA 1DLOB 2AGQA 2RIJA 3S01A 1S1TA 4KJIA 2GV1A 1DJ0A 4RLEA 1RI7A 2JOQA 2GK6A 5IXUA 4O0IA 4AFFA 4BWMA 3I4HX 5KOWA 4XDDA 5KFSA 3TA0A 5DO2A 1LXJA 1S48A 4ED7A 2KXFA 3WX4A 2FDNA 2M88A 4DG1A 1RKJA 4GKKF 1Y7PA 1YIJS 2NXUA 3KWMA 2A2CA 1U1LA 3WC2A 1SUQA 4TU9A 1SI9A 4K5SA 4KHPF 1M5OC 1X9SA 3I5CA 2MB0B 2Q1LA 2UZAA 2UP1A 4PUOA 3PJXA 2GMLA 2J7WA 4IOAQ 5KFVA 3HHLC 4NLGA 5KNLA 3KLHA 1QAYA 4K4WA 1B7FA 2VKZG 1IQZA 2VQEF 5K14A 3ITHA 3TUJC 4NYZA 3CUNA 3KNGA 2JVRA 2BQ3A 3T1YF 2UXDF 4TU8A 2CPJA 2E1CA 2Q66A 4B3FX 5D3GB 2ZXHA 2GJKA 5JXSA 2PD1A 3FNNA 1UWBA 2FB0A 3BR9A 3OXGA 2CZ4A 2R8JA 3PW0A 3PY8A 3HO1A 1PILA 3A1YG 3GR0A 5KT2A 1FJEB 1UVIA 3OPKA 3A3GA 3AA9A 3TX8A 4EO8A 1FNMA 1TL3B 3HHEA 4OHWA 5K14B 3KEWA 3FPPA 4UQGA 5L39A 1ZM9A 3GQBA 2ZZMA 4DL3A 2X1FA 4WXOA 3GVLA 1UD5A 3CSKA 1YJ9S 4QR1A 1ZETA 1MROB 1SIWB 1Q7YT 2CKWA 1D9DA 4ECRA 2B4OA 4TU7A 3DDNA 2RKIB 2F1MA 3IG1B 2W8KA 3P96A 4C7QA 3KLEA 3OPOA 2KH9A 1U26A 4NLYA 4WE1A 4CNZA 4HEA9 2Y1IA 2VFRA 3CJ4A 3BQ1A 1RT3A 4C3MA 3NNCA 5G0RB 4FS2A 3VCDA 2O5DA 2N7CA 1I1GA 1S6QA 2C28A 1FJCA 3BB5A 3K8VA 1QVFR 2CQIA 4ECZA 3BR8A 3OR2B 2M0GB 3DFEA 1NB7A 4H4OB 3RRGA 4DDFA 2YWEA 2VC0A 4DV4F 3SSRA 1W0KA 2WTFA 1R8BA 1U2RA 3GSIA 5J2PB 2D3OR 1N56A 4O4RA 5KFLA 1JNZB 1RT7B 4G1QB 1VQSA 4OZJA 1RDRA 2VD3A 3EZUA 1QJHA 3GG0A 3M6UA 5KFCA 4J9MA 3QZ8A 3SDEB 5KG6A 3T9ZA 3IGNA 4OQJA 4WIIA 2OJ3A 2YWGA 4KTQA 3OFEA 3SCKE 5K8OA 1S9FA 2IAJA 3A8KA 2D3UA 3MUMP 3BEGB 1OQ3A 3HVRA 1U1QA 1KSPA 3DRPA 4XN0A 1D8ZA 3TW0A 2YNIA 4F3OA 5KTQA