1VLYA

Crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
323
structure length
323
Chain Sequence
b'FTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLHIEPLPYSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Unknown protein from 2D-page
publication title Crystal structure of Unknown protein from 2D-page (Spot PR51) (b2898) from Escherichia coli k12 at 1.30 A resolution
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 84
structure length 323
sequence length 323
ec nomenclature
pdb deposition date 2004-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.160 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1vlyA03
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1vlyA02
3.30.70.1630 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vlyA01
1WOOA 1WOPA 1VLYA 3A8JA 1PJ7A 1WSVA 1WSRA 3A8KA 3GSIA 4PAAA 3GIRA 1V5VA 1VLOA 1PJ5A 1WOSA 5L46A 4PABA 1PJ6A 1WORA 3A8IA 4P9SA 1NRKA 1YX2A
chains in the Genus database with same CATH superfamily
2BYCA 4DS5A 2RIJA 1B99A 1Y7PA 4C8YA 3I9V9 3K5OA 3AVYA 4ZK7M 5HBMB 5JVHQ 2HWIA 2QMXA 4AQYJ 1GT8A 3NMRA 5CQGA 4DX8H 4TMXA 3A3OB 2EFQA 4QR0A 4RWXA 1M90D 2C42A 2SXLA 3PM9A 4Z4UA 1H7XA 3LGHA 4ZPWR 4Y00A 4KTQA 2V7VA 2EK1A 1IUJA 3VMFA 3HSDA 4CQ1A 1FRMA 3QT5A 4RDJA 4IQMA 5F8NA 4P2SA 4K1XA 3AOBA 4DR6F 2V7UA 4NCNA 1FCAA 2VG6A 2JEGA 1OO0B 5AT1B 2Y1RI 2XULA 4ES2A 5D8HB 3KKFA 3QGHA 3NEKA 2HHHJ 3QT8A 4C8LA 3OXFA 4O4RA 2VFSA 4PABA 5CXTA 5E7OB 5F4OA 4E0DA 4EO8A 5L9NA 5DS7A 3IBWA 1QAIA 3D0HE 1HD0A 2C5HA 3G86A 5T7LB 2OD6A 2G2ZA 4I2PB 3M8WA 2RF2A 3IR7B 3QFHA 3RBEA 1KQKA 3RU0A 4IFVA 3MPDA 5IYPA 2MZTA 2OO4A 3BN4A 3AFGA 4OYAA 4P2NA 5EGYA 1R8PA 1BQXA 2Q6CA 3JTNA 4JI4F 4OI6A 1YQHA 1K9MT 2ZZQA 1NBMA 4OQJA 2XWYA 1UVMA 2CW5A 1SQFA 5GAGU 3GIMA 2QA4B 4PRFA 4LRDA 3VVUA 1NJWA 1PIEA 1PAEX 1UZHA 1RT6A 2WOMB 2IHR1 4A47A 4CM2A 5IT0A 2XC9A 4AL5A 4JOUA 4ED1A 4D3GA 3EWGA 4C8KA 2M8DB 4WFZA 1YBAA 4FBUA 2BPOA 4LR7A 2ASLA 1HNXF 1LFWA 4G1VA 2GVZB 1V0EA 5LL6d 4ZVGA 3OTDA 3WX4A 1EB0A 1LKZA 3TQEA 5DDPC 4U7UD 1NH7A 2FHJA 1OJ4A 1Y4ZB 4DUZF 3K5PA 1TMMA 1YLOA 2KJWA 2MKKA 4N41A 1XQBA 2IMWP 3DLKB 1EZZB 2OEKA 1FVQA 3UR0A 4RD3A 3IBCB 4DUYJ 2MQQA 3ZZOA 4X0CA 4USHA 4YB7A 2RB7A 4XQFA 1RT3B 2F9DA 1EARA 5C42A 3A8IA 1SJRA 2VUGA 1IHMA 3EVWA 4DWIA 2HAFA 2KT5A 3GMGA 3MD1A 3UDVA 1FRIA 4ZITA 1NHUA 4A8YA 4TSFA 5D3GA 1UEUA 2DXDA 2MLYA 2DGSA 1WACA 2J9CA 1N5YA 3JQRA 3W2WB 4K4UA 1B7YB 1YRUA 4X7FA 2GJRA 1I5OB 5HP1B 5HMWA 2FJXA 2GJKA 3BYPA 2FX3A 3JSRA 2G13A 2R7TA 2W4DA 2F4NA 1D9AA 3U7JA 3NCRA 3MECB 5GMKa 3MR6A 4BHQA 1RT4A 2DR6A 4YB1P 2GIRA 1IQTA 3TW0A 3Q8SB 3GQCA 4EBCA 1FERA 3T19A 4DPWA 3BJYA 1T6ZA 1O51A 5LJ3Y 2IMOA 3CRZA 4ZVSB 3H5YA 1YRXA 2OSRA 1QSSA 2V9WA 1FWLA 1N52B 3T1HJ 4DL4A 3MAAA 2UZAA 4P7VA 3UFCX 1HW8A 3PYDA 1FWPA 3WXMA 4C0BA 4CP5A 3M6UA 2V34A 4XDCA 5IT9U 5DN6A 1GO2A 3MUTP 4A8SA 3A8JA 2DH8A 1MG7A 1QVGB 3BREA 5E41A 2DNMA 2VA2A 2OP5A 1KP6A 3Q8RB 4ECZA 1VS3A 3VGVA 2D3NA 4X64F 1NUEA 3G4SB 3CCRB 2ZJPQ 1GH8A 1I3OB 4UOCA 4DR3J 1VQNS 2NXCA 3TR5A 1TAUA 4I64A 2BZ2A 1H8HA 1UTAA 1X9WA 4EWTA 2AD9A 1RUSA 3WHIA 4WZLA 1HBMA 4RUAA 2NZCA 3T6JA 2CVIA 2XNCA 4YALA 1RB0A 2V8DA 2LFVA 1W25A 4QU6A 2RRBA 5HQLA 5CZVA 1JNYA 1NSQA 1F3FA 2DHSA 3FRZA 2VC0A 4IOBA 3MF5A 4TLQA 3WNBA 3C16B 3GFYA 3OR1B 4JI6F 1KVIA 1OMSA 4OZ5A 2ZBRA 5AE3A 4PG8A 4NLDA 5IS2A 4PC1A 2HFZA 1QTMA 3LW5C 2AU0A 4F02A 4K4XA 1DAXA 1VBYA 4JV2A 3K7RA 5G4DA 3D6TB 2RAQA 4QPTA 1WKLA 5EMNA 5KT3A 3NLCA 3N0VA 1UD4A 1U1KA 4PQAA 2JN9A 1YBUA 3PA2A 1E6YA 3EJMA 1CEZA 4OLOA 5CH7B 4OHXA 4I2PA 4LBPA 4FS2A 3CJ2A 4OZ1A 2BM0A 4J9VA 4KQZA 4HE5A 2V94A 2VG5B 2DBBA 4RU2A 1HWJA 5IC4B 4IO9Q 3U1NA 1U2CA 4ELVA 2CG8A 5KSWB 1D1NA 4LREA 3UD5A 2XI2A 3B78A 4DV0J 1WWHA 4DDFA 2PD1A 2JLGA 1EIYB 3BBBA 1JLCB 4PG5A 3X1LB 2WOMA 1Y5LB 3DXSX 3UNYA 2VBVA 2X1AA 4HKQA 1T9TA 3NGUA 3D4JA 1U6ZA 1W87A 4KGMA 1YHQS 2RU9A 3PJWA 3C19A 2YPYA 2KKHA 3I6PA 4RJLA 5GADI 5HKKA 3D5MA 3CDWA 2LVWA 4ZJOA 2DNHA 4M1KA 3WBZA 4FKYA 3ENAA 1G1XA 1VC0A 2CQ0A 3JU4A 1LW0B 3DLKA 1PJ5A 2JDIA 2XBPA 4ICLB 5HN0A 3DU6A 1E1QA 3PIPQ 3RB4A 4JI0J 3LQEA 1MMNA 4UY85 1VQ4B 1RBOB 2OELA 3FEYB 4M63A 3W62A 4ZGNB 5L1KA 4B3MJ 4KO0B 2DB1A 1JLEB 4BC7A 5KAKA 4AXJA 3H2VE 4P75A 1SJ1A 4ENOA 1JXVA 3OL7A 3AGQA 1F1BB 3HKZD 3TJAA 4OX6A 3PX0A 2LA6A 2NREA 2FYXA 4DSIA 3AD8C 1XIQA 4FZVA 1QUEA 1JLAA 4CM0A 1Q0NA 4ECRA 3UVJB 4RUBA 4DR2J 3RUBL 4P52A 4F2RA 4JI1J 1NZ8A 1F5BA 1FNDA 3SQGA 2M5SA 3MCOA 2LLZA 1UZDA 4Y34A 2ADCA 5IT9Y 1S1WB 2NLWA 1VJQA 2O1PA 5C2CA 2VDHA 3MECA 3JSBA 3VNUA 4P3IA 2PMDA 2Z56B 4XORA 4OV6A 1YJ7A 4Q43A 4HIZA 3NY0A 1R31A 4NXMF 2M4MA 1UCNA 1TL7B 1UJ5A 4XO0A 3PNIA 2WZPP 2IM1A 5BSYA 1UFLA 1YZ7A 1A0OB 4OYOA 4LR8A 1SH2A 1NAQA 1XNQJ 1KNZA 2B8QA 2AHOB 4KV8B 3J7ZT 1HI0P 2V50A 1XBWA 1ZM9A 5IWAJ 2QE7A 1VQYA 1Z4UA 5KFDA 3KDOA 2DK2A 1B64A 2BJEA 2YQ0A 4K4YA 4F4XA 4TMZA 5D0HA 1R6VA 1RQPA 2ASJA 1YI2B 1IM4A 2CWXA 3MMCA 1V0FA 4EZ6A 3P96A 1FEEA 4TMWA 2HQ3A 5E5NA 4F4ZA 3PFOA 5DQHA 1DJ0A 1GAQA 5A0YB 1XMOF 2DRBA 4OX8A 1ZETA 2G4BA 1T5EA 4X7DA 2C3PA 1F9FA 4OJ3A 1WC1A 1CSJA 1FFSB 1NNDA 1VHOA 3OEEA 5DDQC 2DGTA 1XTZA 4PXEA 4WKYA 1KC8T 4LRCA 3H20A 3G71B 2E9TA 4HR2A 1L3TA 4KT0C 3EGZA 4I69A 3PDNA 4FKXA 1CC8A 2CNLB 4HHJA 3WBJA 1DDGA 4LMZA 3CP2A 1K1QA 2C4TA 3OTCA 1T6YA 3C16A 3DLBA 1D8TA 1PO6A 4A8MP 2CJ9A 4OI3A 3A13A 1DZ5A 1YJ9B 4G65A 1SM4A 5CD4H 4TN2A 1NK6A 3VAGA 2C77A 1S72B 2XCAA 2F4VF 4C97A 2FPHX 2B7CB 2BOAA 4X4QA 4LBIA 4HE6A 2R7VA 3ILOA 1B7FA 3DDKA 2BW7A 2CQCA 2GJIA 3GIRA 3SMZA 1ZPWX 3QT7A 4II2A 4J91A 4P10A 2DIUA 3GCXP 2BANA 2XLJA 3GFZA 2K2PA 2QIFA 1OY9A 5C25B 5J1NA 3CCLB 3U02A 3ZBTA 2CAJA 2VG5A 3RG6A 2WZ1A 4YN3B 4UT4A 2D9RA 4Z7YA 4ID5A 4B3OA 5A8AA 1Q95G 1FJEB 4Y2KA 4GO5X 2PFDA 4C3KA 4ZVUB 2BE2B 2E66A 2BX6A 2DEJA 1GR1A 5IQQA 1X5TA 4HI2A 1N05A 2FDNA 4P73A 1RLCL 4K50A 4R0EA 1N5QA 5T14A 3TNVA 2RQ4A 1FNCA 5EWGA 2OPSB 1YJTA 4J9PA 3ZZRA 2KT3A 4DQRA 4L3NA 1JLBB 2OSQA 2CPFA 1NJIT 2AGQA 2NUHA 4U8VA 4LBHA 2ZZFA 1KK1A 3DN9A 1TZ0A 4O44B 4WXWA 3P49B 4FXVA 3MMJA 2CPZA 2HHUA 9RUBA 4FVMA 4QWAA 5KFWA 2CNOB 1QFZA 1HD1A 2GNKA 3PIOQ 4Z2XA 4DNTB 3J80Y 1WNEA 4ICLA 1P27B 4ZHRB 3ASSA 2K3IA 3SSSA 1P6TA 4MYTA 1V6HA 4B3RF 3M05A 4O0IA 4WU2A 4DJBA 3CXCB 3IC1A 4MJKA 5F8GA 3A3PB 3W2HA 1JLEA 1NCLA 4JYAF 2KJVA 2MZ1A 2RT3A 1S5ZA 1ZS6A 3CCVS 3Q86A 1KDNA 1ICEB 4P3YA 1WU8A 4PUOA 3Q2TC 2QEXB 3L9ZA 1E1RA 1S57A 3HHLB 2HHPA 4IG3A 4CLUA 2VU5A 3V6KA 4ILMA 1WUUA 1X8DA 2O3DA 4DV7F 2FHOB 2NXUA 4YDXA 5EWEA 3AT1B 1VRUB 3UVJA 4TVAB 3ITHB 1C0TA 3IN5A 3KLVA 2FZKB 5DZ7A 3VWSA 1QVFR 3AQOA 2Y0BB 3PHEA 4FNHA 3QPIA 3Q8QB 2OTLS 3FKBA 2IBKA 1NB7A 4RDKA 1S1WA 4DL2A 1N32F 4QIWD 2ZJQQ 1JMTA 5K9FA 1VI7A 4ZS6A 3LH2S 1VOMA 4B17A 4U7CA 3ZNJ1 3I56S 5L46A 1PG5B 4G6VB 3UCZP 4A8XA 1TL7A 1YZ6A 2QV6A 5KFYA 4DSFA 1R0AB 4XLHA 4DX6A 1R5OA 4KKUA 2CQDA 3RB6A 3W63A 2ZKTA 4YEJA 4ECVA 2HHQA 3MUVP 1RTZA 3MM6B 4RW7B 2CK3A 1RBLA 1ZBTA 4CO0A 5J1PA 5KT4A 2ADBA 4NI2B 3FDSA 3IR6B 2V69A 2IA0A 1S77D 2A6MA 3HJFA 2UVWA 2P6SA 3QGIA 3I55S 3AVWA 2FLPA 2UU9F 2N3OA 3EUNA 5ETSA 1UD8A 3LA0A 4BLGA 2R4FA 3IS9B 4Y7CA 2V4RA 2XYHB 1YJNB 3ONQA 1Q78A 1QGAA 2FVQA 2WPDA 1GMWD 1YWXA 1R8AA 2Z57B 1GTEA 3D6FB 2ZWOA 6FD1A 4QWCA 4ZVTB 4K4ZA 5IQ6A 2ALYB 4P6QA 1VMBA 3HAGA 1K1SA 3BO4A 1BXNA 2QLBB 3QFRA 5D6GA 5C2GA 4AL7A 2O67A 1QFYA 2OPQA 2BQUA 2NCKL 1NSPA 4J9NA 4KGKA 3GVLA 5F8MA 4GKJF 1FWKA 2GQCA 5EUHA 3IBFB 1HL6A 4K5RA 3DRSB 3K5NA 1TQLA 2IC3A 3MM5A 2BA9A 2BABA 3PR4A 3HVAA 3BGLA 2HKEA 2ZH6A 1RHMB 3KK3A 4F4AA 3IR5B 5KFMA 2HBQB 1WF2A 2ZZNA 3NGRA 4ID8A 3BSOA 2I6WA 1U4BA 1YJUA 4DR4F 3GJRB 2KFYA 2MQ8A 2HS4A 4YFUA 2B7BA 4NBSA 1I18A 1TKZB 4KH0B 2B7CA 1HHQA 3RW6A 2HK3A 1RI7A 3CMAS 1TVCA 3BPDA 1R27B 1UPMB 2QGFB 3QFTA 3OFEA 3KNGA 4NLWA 4G1IA 2HNZB 2GQFA 3EVMA 5FLXU 2WRMA 1CULB 2B51A 3N9UC 5C25A 1VQMB 4PXBA 2HEKA 3DRRB 5DM6Q 1F9HA 3DLGA 1RWVB 1ZZNA 2GQ2A 2FQQB 2Z2YB 1BWEA 4WIQA 2IA6A 3CD7A 2W7PA 3BDPA 2K1RB 3W5UA 1FRXA 3BQ0A 4NLRA 2LEBA 2FY1A 2BE7D 2MKJA 3CDEA 5KT7A 5LMUF 1G7CB 4BS2A 4FYVB 2COLA 2OPSA 3BGRB 2FLLA 1VYAA 2GGPB 2W8KA 3MZIA 2WW8A 4DCJB 5KG1A 4P9SA 2OMOA 4O44A 2PA3A 4Y2CA 3JYTA 1JXEA 3NGTA 2GA7A 2VA3A 4P1VA 2RHSB 3DM2B 2VFTA 2A18A 2ZM6F 2R7WA 3OW2B 3TA1A 2XGQA 5DG8A 3SLNA 2HLUA 4X4TA 3N6LA 2P3MA 2V4QA 4QR1A 3NG8A 3BPSP 4RNNA 2F1LA 3TP2A 2B9WA 4TKOB 4TQRA 4ZDNA 2Y1IA 2KH9A 1JX4A 3FQLA 4MKYA 2R8KA 2GAHC 1SC1B 4JI7F 3JSMB 3NNHA 2QT7A 3ULHA 1U25A 2VNKA 3MEDA 3FZ2A 1N6QB 4UOHA 2CQ2A 4DV4J 5FL7A 2QRRA 5G0RB 1IJEB 1Y0YA 2J8AA 3AXKA 4B9MA 2ZH7A 3JQJA 3ITHA 1I1GA 3DRPB 3GWCA 3ZPNA 4ELTA 1VFJA 2GO9A 4ILLA 4YP3A 3PW5A 2RC5A 2VQFJ 4OYPA 3SV3A 1K28D 1UW4A 2YKPA 2D7SA 3D68A 1VQLB 1FRHA 3QT6A 1Y5NB 2O01C 4Y28C 1RKIA 4ZLPA 5FIUA 4OX9F 1X9SA 1IBMF 3FPPA 3JSYA 2M8HA 2JOQA 1XR5A 3O8WA 4NRUA 1PAUB 1KJZA 3I82A 1U1QA 2MZJA 2CQPA 4MTPA 1R0AA 1T3NA 2XSJB 2AJ2A 5H59A 4WU3A 2L9DA 2KL8A 1BX0A 2ILYA 4DPTA 3G6XA 5J35A 2KN4A 2OBTA 4HHHA 1K73D 4RD6A 2DY9A 1VQKS 4HACA 2ZL6A 3VF0B 3LQ6A 3GJTB 2X51A 2I1RA 1TMJA 2VNIA 1NXIA 1KQSB 1WF1A 1YSJA 2CPEA 2PO4A 2H54B 1HYSA 1F60B 3BO3A 1H3DA 2R7UA 1TV6A 3HT0A 3SCIE 5IFMA 1S1VB 3M8YA 2NYIA 1X9MA 4USJC 5IM0A 1HPZA 2W6IA 2XSFA 2YQ3A 5ETNA 1O5JA 4HEA9 2HMAA 2YX1A 4NYZA 5K8OA 2DERA 2HLDA 3L4BC 1GK8A 4NXNF 4QZVB 2QYCA 3LAMA 4KSEB 1E79A 3HD1A 1R89A 2GMHA 1NO8A 3ZZUA 2OYNA 1JIHA 2JFDA 4FWTA 4R0JA 1K8AT 4X62J 1S4FA 2BQRA 5H9EK 5B08A 4K4SA 4DV6J 1FXDA 2GQQA 5CCLA 2QMUB 2XMMA 5I3QA 2GJFA 1W35A 2ZVIA 3UQSA 2RU3A 1TL5A 2B4UA 2DOGA 3DRSA 4C0HA 5H9EJ 4URGA 3JB9k 3DYAA 2XCPA 4XONA 3OL6A 2CJBA 4WF9Q 4IRCA 3H8YA 2N3LA 1X7VA 1SQEA 1M90T 2DGXA 4RNHA 1NB9A 3AA9A 1T05B 4P22A 3CCTA 5KG4A 2V2KA 4YXWA 5KFVA 1TL1A 2MQNA 1VQPS 2R2RA 1TK5A 4WK3A 2ZH5A 3C14A 2X1GA 1TKZA 4LF1A 4LC0A 2QTWA 3RRGA 2RJZA 3LQVA 2WJYA 2MMYA 2M0GB 3UN5A 5D0EA 3ENVA 1NK4A 1DG1G 1VGYA 1G6BA 2DNLA 1Y0RA 3CD5A 4LSLA 2E5JA 3MPUB 3F41A 1FJCA 1CULA 4FK8A 4OHZA 3WBKA 4RPBA 1H74A 2DNGA 1RYRA 2JZ5A 3MHYA 2DGOA 2E5GA 2OEJA 2RE1A 1LXNA 4I7FB 4AT1B 2CDRB 4KHRA 3MEKA 2AW0A 5LMNF 2HYIB 2CPXA 2VICA 4YQWA 3H4BA 1BX1A 2C3MA 2BQ3A 2KG0A 1RBAA 2YNHB 2V2QA 2L3MA 3OZVA 3ET6B 1TAQA 4JI3F 5KFPA 5CA5A 2H51B 2HGMA 1G7CA 3ENWA 2GPJA 1S9EB 3LALA 2IPOB 2LZJA 4TQSA 2GGPA 5M2UA 3QZ7A 3HX9A 1HQUA 5HSPA 5DO2A 4OYWA 2RKIB 4JP8A 1T9YA 1WG4A 2RS8A 1VQ9S 2EW9A 1U1MA 3DM2A 3CCQS 5HZAA 1COWA 1CG2A 2VBXA 2IDEA 4EH1A 4B43A 2BRKA 3BM7A 1U2RA 1NM2A 3AQPA 3Q8VA 1BUXA 3SEJA 4B3SF 4HVZA 4NA2A 4NLVA 2LQ5A 1XMQF 4LF7F 2KYXA 1MMLA 2UUCJ 2EKYA 4ECTA 3TQ1A 1GJRA 3HVTB 4XR6A 2I0XA 4WZTA 2F65A 2GJ2A 3IM9A 2BR0A 3AJDA 2CVEA 2MQMA 4QVJA 3OJSA 5G0RA 4ZJQA 1IJEA 3CCWA 4A4JA 2RQCA 4N47A 1IWGA 1FVSA 2JEJA 3KJVA 3T56B 1E43A 3DRPA 1R8CA 2VOPA 4DU8A 3BH7B 5HMXA 2MQOA 1RHRB 1FNMA 2RSQA 2BKPA 3B4MA 3K2YA 4DN9A 4IH5A 3FJ2A 1XC9A 2CNNB 1HNWF 3I4PA 4FF3A 2BGJA 2DNPA 4P71A 3CVKA 2QG9B 4CO2A 1TELA 4W90B 3KMQA 2LA4A 1GXUA 1N08A 1X4EA 5LXRA 3GILA 2VDIA 1QVGR 3QLHB 5A8KB 3M2UA 2J0XA 4DF8A 2XLKA 1B70B 1HARA 3QZ8A 1U8WA 2ZBIA 4YAUA 1FTCA 5A2QY 3GG1A 3HSJA 4OMFG 1T9WA 3I9ZA 5FIIA 5C5JA 2C2MB 3CMES 4NWBA 3ONUA 4F3QA 3MCNA 2GW8A 3T41A 2AV5A 2V2ZA 4WE1B 4RO0A 2J7WA 3W9IA 4LF6J 2YNFB 4F3OA 5KT2A 2PFFB 1RWUA 2FHJD 4ZPTR 2X1FA 2ZTNA 2HS3A 1E3ZA 5F41A 1F60A 4EBDA 3SSRA 2RQKA 3BF4A 3LAKA 4B02A 1S1VA 1SC3B 3NMAA 2DHAA 1T6XA 2V4JA 3RBDA 1T03B 4QOTA 3N01A 2EC2A 4N5SA 2NUUG 2UUBF 2CNDA 2ZVSA 2X6YA 4F0MA 4XNFA 2J0QD 1WHVA 3CJ8A 3QWUA 4TU7A 4OYIA 4B3RJ 3HHLC 1RT7B 2PIIA 4TYBA 3DI6A 1Q4RA 5J1EA 4OYBA 5L1JA 4JYAJ 4WBFA 4ZPCA 4GMKA 4HYKA 2QMUA 1FJ7A 1J5OB 1V3SA 2J8SA 4MKAA 2LDYA 2Q6BA 4YY3F 1FXRA 3QJPA 2ATCB 4OPSA 4ZIWA 3G82B 4K2JA 4LFAF 2W7AA 1FNOA 2Q6KA 2DHGA 2ZOFA 3GSDA 4DZDA 1VBZA 7FDRA 4UOGA 2ZZGA 4USIA 5KFUA 2DNOA 1O8BA 2B43A 1N54B 3UI3A 3PO4A 1VQNB 1GX5A 4BC9A 4DXLA 1HA1A 1E64A 1EJ7L 3EICA 1OB2A 1F2HA 3D1QA 4GRSA 4B9UA 4TKTA 1Q1KA 2LXIA 2GS8A 2GX8A 4M5LA 2R2UA 5D77A 3N6MA 4RW6A 4LF4F 1NJYA 2V63A 4Y2AA 4HHUA 3KLGB 2ZITA 1E63A 2W2PP 3R5CA 4QYZJ 1FTRA 2QL5B 2F9JA 2KHCA 2XY6A 4OYXA 2VC1A 3FCVA 2OLWA 4FPIA 4PG4A 1ZOTA 1WJ9A 3KJQB 5KFQA 4I7FA 4UZBA 1FKOB 1Q79A 1RAAB 2BJ1A 3GVJA 4ROXA 2XNRA 3OUYB 3VALA 3R6GB 5EN1A 4F0HA 5HROA 2V8GA 4DR5F 2QA1A 2WVEA 3T53B 2V7TA 3NRBA 4N7TA 2YNGB 4DPXA 1LFPA 3RBXA 1LXJA 2G1HA 5IK2A 4RW8B 4KE5A 4NLYA 4V19X 4IH6A 3MR2A 1S9EA 1LWEB 5CYMB 3TANA 2H4YB 2HHVA 1DQ9A 2D41A 2ZBPA 3K17A 4X4OA 4NEZA 2VJIA 1NK7A 1NDCA 5AE2A 1EAYC 1RZMA 3BY1A 3ZC3A 2YNIB 3AVTA 4RD4A 2JHEA 3GCWP 4MT1A 3MCMA 4KH1B 3KLHB 1VJWA 3T6BA 2MKCA 1KEKA 4XLAA 5J2QB 3TZWA 3OFNA 1FRKA 3O44A 1H0HB 5KG3A 5KOWA 1Q5YA 2VNJA 1VC5A 2K7JA 1OYDA 1U26A 3HVTA 3M2RB 3BKFA 3CCJS 1YHQB 2XHWA 4ZA1A 1WSVA 1WSRA 2H5EA 1KD1D 5HL7Q 1C1CB 2HRYA 2XLIA 3BSNA 3T5JA 2OK8A 1T3OA 3OQ2A 2AZ1A 2V8PA 2VKRA 3H94A 4ZN3A 2UUAF 4DR4J 4OOVA 4A8OA 5GVQA 2OBRA 1TKXA 1IKVB 3CF5Q 4DFKA 2VL1A 4IR9A 4M5KA 3OJXA 4DQIA 1N36F 2GMLA 2D9PA 2YX7A 2AEJA 4FS1A 1RTIB 1WTFA 2Z4PA 3QFSA 2HPUA 2F5GA 5KFHA 2QSWA 3AAWB 3CW2A 4WJBA 2KB2A 4ED4A 2XZDB 2HFUA 4IUFA 2CJQA 2DHHA 2EXUA 4XPEA 5A8RB 3QLHA 5A8KA 2V0NA 2DVIA 2KG1A 1FD8A 4GC7A 5CYQB 2LECA 2YKMA 4X84A 2VPZB 5KT5A 4HT7A 2QE5A 3G2XA 3CC4B 2IYIA 3B4DA 4DR1F 3IP0A 4PXDA 4ITSA 3VAHA 3SJZA 5BYSA 1MSWD 3TX8A 4DNRB 1Q81D 1W0KA 4WE1A 5B0AA 4CYUB 3KHLA 3G05A 2YNFA 4UZUA 3DU5A 5LMUJ 4OJGA 2VBUA 1WG5A 2ZC4A 2FJVA 5KG5A 1TTTA 1R5NA 3LO8A 2AWZA 3OLBA 1QAXA 2PEHA 1CC7A 1NPKA 4P72A 2DETA 4AYBD 4PGOA 4F4WA 2MYFA 5TRDA 4C4WA 1FJGF 2J6SA 3MEGB 4U67Q 3DGPA 4NLTA 3MFHA 1PC5A 1WP6A 1RQ0A 4HL9A 3VQSA 1RT7A 2JNJA 2CXEA 1R3NA 3W2IA 1BQNB 4HH0A 1HI8A 2BMWA 3VZHA 1RQRA 3NBPB 1DQ8A 2ILZA 1WHYA 3QE2A 2KT2A 2V8HA 3KUEA 2OKQA 3HMJG 2E9RX 3LPEA 3IWNC 1RT5B 4JV0A 1J5OA 5DRKA 4X06A 3RAXA 4WXOA 1EP1B 3MPYA 1RDRA 3S6EA 1WOSA 3T1YF 2C3UA 3BS9A 2R3VA 2FJAB 1U8SA 2HQDA 3J7YI 3PCOB 2W9BA 2XO6A 1GX6A 3U1LA 1UVNA 2DR5A 1RT2B 2KDOA 1FEHA 4JV5F 3BCFA 1R0CB 1IBLF 3EXCX 1FT8A 2YTCA 1W0JA 1SC4B 2E7XA 3QGGA 1MMDA 3M2VB 4YEAA 2GJPA 4OI4A 1IR0A 3K0JA 3QO9A 3T51B 1RAIB 3WNCA 4LF2A 1R43A 3ASRA 3UN3A 3G6YA 2DCLA 2XZTB 2Q6IA 2ZXHA 4NCBA 2QA4G 2XMWA 4II3A 2RH3A 3A3NB 4QWEA 1UFWA 1EP3B 1YGYA 3SCLE 3KLGA 2QO3A 4H4OA 1EXMA 2Y3YA 3KUGA 3V76A 1E3XA 3PTWA 1WC0A 3LWMA 2OI2A 4F04B 3GTYX 5ETPA 3VCDA 4WZMA 4J9OA 4RX6A 5E3CA 3GIIA 1FKOA 2B56A 3HPOA 2I8EA 3TWZA 4Z37A 1R5BA 3OUYA 3QBCA 3CXCR 5J2MB 1IN0A 5BSXA 4DSJA 3PKYA 1RWOB 2LQJA 1IXKA 3GPAA 4B3TF 3OFFA 1DHMA 2YNGA 3J81j 2XG8A 4JI2F 4RW8A 5D0GA 2V4DA 2AIRB 2BSAA 5IV4A 4WCEQ 1HI1A 3GV7B 5JXSA 1H73A 5CYMA 5JMNA 3ONYA 3HJVA 2ROEA 1NSKL 3SZ2A 2W1BA 2DNKA 2V7WA 5F0WA 1SIWB 2VZLA 1U02A 1K9MD 2YNIA 2ACYA 1U09A 1LWFB 1WC4A 1UMKA 5HZBA 3CJRA 1UVLA 3FPKA 1MU2B 1X4HA 3RRHA 4O4GB 3GU0A 2Z2MA 2W2NP 5MAOA 2AQ4A 2R8IA 2OD4A 3W65A 5GAEI 3GIJA 5J2QA 5KFZA 1PJ7A 1RYSA 3TEHB 1BMQB 1LK7A 2YWKA 4MIWA 3WNDA 1FHTA 2RVJA 4RZRA 2LXFA 2VHGA 2MB0B 4KBIA 1XB2A 3M2RA 2RF2B 4TU9A 2NXJA 2JC0A 2WBMA 4DQQA 1C1CA 4NASA 4PKDB 1RAEB 4HTIA 4PEOA 3CDAA 1VRQC 2ZNYA 4QVAA 3I96A 4CNYA 2QL7B 3T5KA 5M2RA 1IR1A 3S1TA 5DGAA 3DDYA 2CPDA 4AUKA 2C1EB 2G0CA 4YB5A 4B48A 3Q6QA 3HVRA 4CLWA 3VO2A 1IKVA 4PWDB 3UWTA 3DDNA 2MKSA 3CEDA 1RTJA 2AT1B 5LSLA 2AJQA 2WVFA 2MKIA 3PX4A 4XOTA 4ANDA 4WWVA 3BBFA 5HAOA 1RTIA 1FNXH 2DXEA 1WEZA 4AF7A 1RT6B 1RGVA 4K4TA 2VBSA 1HFEL 1WEYA 1NPPA 3Q6RA 3R97A 4ZCLA 3CCVB 3LF0A 1PBUA 3TZYA 1T0TV 1W2IA 5CYQA 3GYGA 1S79A 1ZPVA 4LFCJ 2VPWB 1KTQA 2LQ9A 4MMOA 1ITPA 1RABB 5E6TA 2N7CA 5LMNJ 4M0LA 3KOAA 1SXLA 2IFXA 1S9GA 1APSA 8AT1B 4QU7A 3SCKE 4FP9A 5B7WA 3GV8B 1JJ4A 4JI3J 4B3XA 3VGTA 2DNNA 1S6PA 2W9AA 1TFYA 1FDRA 1T7PA 2LYVA 1MN9A 3I56B 3DDIA 5IOLA 4Q8FA 3RW7A 4CRJA 2WSEC 3CSKA 6AT1B 3LP0A 3D9BA 1NB2A 4QW8A 4J9UE 1DFDA 2OBSA 1N5YB 3H5XA 2BJ8A 5FA6A 4AVZA 4WFAQ 3KL9A 2XM3A 3P5TL 4B3SJ 2MXYA 3EE3A 2HBRB 2HRTA 4EFAC 3M8RA 1XMQJ 2QSFA 4DR7F 3EZOA 4LJMA 5IC6B 3I55B 1Q7YT 4DU7A 3OFGA 2ZOMA 3PENA 3H2UB 2C2RA 3KJFB 2CUYA 3CIMA 1S59A 3CD0A 2PI4A 2XY5A 1RT4B 2M5YA 1E6VB 2QFJA 1O0PA 2B9YA 4RNOA 4DV1F 4K4VA 2QLJB 3M6WA 5BR8F 1DTTA 3IAS9 4M8LA 2MEWA 2XZPA 1BJKA 4EO6A 3MAHA 5GADU 4PG7A 1RTHA 1RT2A 5AJ3F 2BN4A 1QGZA 5I4MA 2BDPA 1EFTA 1KBRA 2DGUA 4Z4TA 1N07A 2RC6A 1GMUA 4TY8B 1S0UA 1U24A 3C2PA 4C48A 3MURP 1S10A 3MAAB 2V5HG 3IM8A 4NCAA 5L1LA 3PYEA 4G5GA 1B0PA 2CDQA 2JWNA 2MDAA 3AVVA 4IDKB 1XN9A 3DFEA 3CO0P 5I42B 3NWGA 3M1VA 4O3SA 2HNDA 2BJDA 2E7VA 4IH7A 4M94A 1XWLA 4X4PA 1H85A 3MR7A 4OZ0A 3R2DJ 3T9NA 2YXLA 2JRSA 2HZCA 5TR9A 1V5VA 3CCSS 4XN0A 3OW2R 4LF9J 4PYDA 4I4BA 1IBKF 3T5HA 4QBUA 2KXFA 4Q0BA 1M1HA 1GNKA 5J2MA 3SXLA 3QQCD 3HSZA 2ZXIA 4ED5A 5KFKA 1OSDA 5KW9A 1HBMB 5A6WA 1N8RT 3PVDA 1JXLA 3MPVA 4RDLA 1MRZA 1W2BB 2MLZA 1IM6A 3FKSA 3CMAB 2FY8A 2M52A 2UXDF 2PSZA 1CJTA 3FCWA 5F8IA 2DYAA 4DN0A 1FK9B 2GHPA 1LV5A 2LEPA 2HDNB 2BVNA 4DL6A 2UUBJ 2I1LA 4FYWB 3LOUA 5K20B 3E51A 3JTPA 4URQU 4USUA 1FX4A 4ZVOB 1UJ6A 5U47A 1LWFA 3I4HX 4ZPAA 4DPYA 5HXBA 2HWHA 5DSZA 1QAJA 1GTHA 1MU2A 3MM9B 4B4DA 1HNIB 4ZKAA 4O4GA 1TUIA 2XZLA 4RUCA 3L3CA 1HWLA 5F9NA 4QJVA 1JJ2B 2E5LJ 2CADA 2KVQE 3OTEA 1FRLA 2R7SA 3CTRA 1KOOA 4JBCA 4LSNA 4X4UA 4YY3J 2H65B 1E6YB 1GFWB 3MGJA 3J7AN 4QV2A 2DH9A 3L09A 3GSIA 4FYDA 1S4EA 5BYQA 3OW7A 1OWXA 2H5IB 4YELA 4LFAJ 4CLPA 4J9QA 4ZLLA 1G7RA 1OYEA 3R8YA 2P6TA 4DS4A 1QSLA 5CZXA 4WFNQ 2FLNA 1U48A 2CQ1A 2G2OA 4OFZA 2C22A 3D6HB 2E5HA 3H4DA 4PG6A 4PWDA 1IJFA 4G1BA 3THVA 4KHPF 4DSKA 3NOCA 2AZ3A 5TY0A 1UVIA 3QFCA 2KM8B 2YQ1A 1KQSR 4B47A 4R71A 3TYTA 4LF4J 3EGWB 3W2EA 2QFIA 1Z1ZA 3TVZA 4AXIA 1TK0A 3M6XA 3KLEB 3G8SA 4GC6A 2R7QA 1XQIA 2R8HA 2YWWA 3SEOA 4HDGA 4ANEA 1TUGB 3D67A 1FRJA 3MMPA 3CJ4A 2YH1A 3G6ES 2DIEA 4ERDA 4UZEA 1KVKA 2GMJA 1YITS 1LOUA 2YPZA 1F9EB 2V7QA 7FD1A 4LBWA 3R5AA 2RNEA 2WONA 1UEVA 2E29A 1SC6A 1IB0A 1N0VC 2JC1A 3G6VA 2Q66A 4KKOB 1QLNA 1HBNA 3IRXB 2AJ0A 2XHCA 5LJ5Y 1BGXT 4F8RA 1NK0A 4Z4RA 2HQCA 1DY3A 4OZJA 1MLAA 1K73T 1X4FA 4MFBB 4L6V3 3ZTQA 2JVRA 2W4PA 2MSSA 1C1BA 3MXHP 3D2WA 4RBVA 1BPLA 3MR3A 1Y5IB 3NKYA 1Z2LA 4Z4YA 1UETA 2A2DA 3CMQA 3CJQA 5ETRA 4ZVFA 4ETXA 4K4WA 1JLAB 3V81B 1H2UX 2H3EB 3TAMB 2I9SA 2UVUA 3SQGB 3O3LA 4EI2A 1KFSA 3IGNA 1SBRA 2ZL5A 3HHLD 4X8IA 1H42A 4YOEA 2R42A 1FNBA 1VQKB 2W2OP 3EZ5A 4JB8B 1FX2A 3HFKA 4C11B 1D2EA 1MN7A 4HDHA 3KG0A 3ZTOA 1VBXA 3F73A 4P25A 4XPCA 1E6VA 3V5RA 4WZQA 2G1DA 2L08A 4KHMA 1WPCA 3AXMA 3VAMA 1NKEA 3BV8A 5GAHI 2XGJA 1IVZA 2VBYA 1G7TA 3ZC4A 3CCZA 3I5BA 3LGMA 4XOPA 1I6JA 1UA0A 1VQ6S 5KT6A 5E3AA 3ZBUA 2WB1D 4TY8A 2JH3A 2UV8A 1NKCA 4LVNP 2HIYA 5KOXA 5B0GA 3KLFA 1U1OA 3MMCB 2YWEA 3U27A 5JBQA 1JB0C 1RCXB 3QRPA 1QTNB 4IDKA 2CZ4A 2KXNB 5I42A 1GAOA 2W24A 1OB5A 3G96A 4DUYF 1JK9B 4J9KA 2AYEA 4C3LA 1VLOA 3AODA 3ISZA 4NA1A 1UJ4A 1MROB 4DR1J 3TO8A 4UAJA 4H4KC 2PE8A 2YKOA 5LT5A 3ASQA 3BO2A 1S1XB 1BWVA 3OBIA 4RD0A 3TA2A 3IWXA 3P27A 1FO1A 3CCLS 1CPZA 1DDIA 1QY7A 5AXKA 2C2OB 1RAJA 4X4RA 1VQPB 4WFYA 4RD2A 1YJRA 1TP7A 4Z4SA 4FF4A 1ZA1B 1P9QC 8ATCB 3W8GA 4E98A 4A8QA 1KK0A 2GFFA 1RE1B 1I7PA 3DOMB 3JQQA 2HW3A 3MCSA 3PUMA 3NGSA 3F0NA 3UD4P 2Z58B 3TRGA 1FJGJ 1FK9A 5F4MA 3J81Y 4DV2F 3QRQA 2VZ9A 4NLOA 2C2DA 3AVUA 1L3KA 2IRXA 1U1RA 4M5HA 3MM9A 3BDEA 1HNIA 4NYPA 5DGBA 2LQ8A 2HGNA 4ED3A 4PWUA 2FVGA 3NWRA 3MMBB 5HVFA 2FTRA 3TZXA 4A8WA 4M5NA 2KVOA 2XNDA 2IVMA 3ZTRA 3TI0A 3T1YJ 3H5SA 3LGNA 3U2QA 1HR0J 2AYMA 2BANB 2UVRA 3CJKB 5F8JA 2RS2A 2U2FA 2W7OA 2CJYB 4JI8F 2WZNA 2Y0SD 5KG0A 1RHUB 4YAOA 1N0UA 4PC6A 2AYGA 3T1HF 2WW4A 3Q0AA 4JV5J 1NU4A 4KGVB 2MPUA 4QFMA 4ID5B 1IBLJ 4B3OB 1M5SA 4IR1A 3O5TB 1VQ9B 2WJVA 3CCQB 4IRDA 2Q6LA 4NRTA 2OH2A 2OHDA 3GQBA 3DLHA 1EFUA 1RT1B 2VFVA 5H9FJ 5JJBA 2HHXA 4RW9B 4DQPA 2DCUA 1Q82D 2AMCB 3Q8UA 3HM9A 4RCYA 4BWJA 1V3RA 1RKJA 3Q3AA 4Y9UA 3ICLA 1DARA 2JJ2A 2VFRA 4DR3F 3KLEA 1GMWA 2C2WA 1VK3A 2YY3A 2RQMA 3W5ZA 5HVGA 1HKAA 2ZHBA 2J6UA 1D8YA 2KRRA 3GJQB 4PYAA 5F8LA 4WWSA 1X60A 3V2UC 1YX2A 2OTJB 3BH4A 3CD6S 3WC0A 4QIVA 3B54A 1N5VA 1HA3A 4K8RA 4ZPVR 4DV3F 1VQ5B 3PACA 3VVTA 4DX5A 1BE4A 2VB6A 1P4MA 4ZGQB 3FCHA 4I67A 4RCZA 1ACMB 1W9XA 4KKOA 2MZRA 3O6QA 3IRXA 3W9HA 2XNJA 1I94J 3KHGA 3D3BJ 2VQEJ 2VKZG 3SJPA 2N82B 1RAHB 3ISND 4CLSA 2IAJB 3CNQP 2OFHX 1S48A 5THWA 2FIUA 2PA8D 4PUOB 4MFBA 1KOHA 1G2EA 4R5PA 4IG3B 2NSCA 8RUCA 3MOZA 2RMLA 2YWGA 3BN7A 1CLFA 3CMEB 3V81A 4CLZA 1C0TB 2B9EA 1RISA 4QIEA 2IRYA 1RAGB 3CJSA 3TAMA 1ZAWA 3DGVA 3QMQA 4P2XA 3A3GA 3EGVA 5M2PA 2XMAA 1PCAA 4P6VF 2KHDA 4C11A 3J80U 2E44A 1PKVA 2HSEB 4YUDA 2BW2A 2HRUA 3L7UA 3R6JA 1D09B 3G87A 5I3PA 1N88A 5LXYA 2XI3A 3TAPA 4KIAA 5D4OA 3I0SB 4KR0B 1OPIA 3OTOJ 1UKUA 2IJNA 4WYLA 1CQNA 2FJBB 2DPIA 1IQZA 4XDDA 1CJUB 2Z8QA 2BXJA 2MGZB 3H40A 3K5MA 2RRNA 5B0BA 3H59A 3GB0A 2V9KA 4WP3A 2KO1A 1KWMA 4ZCKA 2AJ4A 4DLEA 1FKPB 4MK8A 1YJVA 2H48B 3NS5A 1T95A 1FE4A 2BACA 4AC9A 1Y9OA 2Y1JA 1RTDA 4DQKA 3VQTA 2PMHA 4O3RA 3RR8A 2EWHA 2FGCA 3RBZA 4DFJA 1UL3A 3D28A 4OJHA 5A76A 4JI0F 3JAMY 3HZGA 1MROA 3PUNA 5A89A 5E2QA 5L39A 4Y3CA 3H7HB 4URSA 4ACAA 3Q22A 4J9LA 1S1XA 2VBTA 1H7WA 4NNJA 4P26A 2DH7A 2KZMA 1B0TA 4CO3A 1ELOA 3RJMB 4KFBB 2OPQB 5IYNA 1BQMA 3KWMA 4EBEA 3OLAA 3TEGA 1MW7A 2HZVA 1S6QB 4OZ3A 1LW2A 4S0MA 1K0VA 4PZVA 4DI6A 3EX7B 4DR2F 5CDFA 4ECUA 2IC3B 1I8DA 2YKQA 3DOMA 1GVHA 4JI1F 2G0IA 3MM5B 5E0OA 1TL3B 2G2YA 3UCGA 5CYJA 1MWQA 3WQZA 2WSCC 3LPYA 2DD8S 1PILA 1W26A 3KK3B 3K57A 2NS1B 2F40A 2MZQA 2ZOGA 2IDLA 3THTA 3DKDA 1JLQB 3VNVA 4DR7J 1KTVA 4OHWA 2B7BB 3K59A 4GVBB 3ASPA 2J0SD 3DOKA 4RD1A 4OLPA 3MMBA 3IG1B 4DV1J 5HI7A 3ZZZA 2KTQA 5IWAF 3CJKA 2CG4A 4F3MA 1N06A 3ZXWA 3FC9A 3CP8A 1IKXA 3RB3A 2YWFA 2MKHA 2ZUGA 1U6FA 4IQXA 1R7IA 3DLGB 5F4JA 3V6HA 1YIJS 2RRAA 2YH0A 4WYWA 2HQFA 1DRZA 3WY9A 4ZVQB 2HVZA 3Q8PB 3J7A1 1SKWA 4LRFA 1TUVA 4LSZB 1RT1A 1A8PA 4LFBJ 3ZZ0A 5RUBA 4X65J 3TA0A 3BQ2A 2FVRA 3I5CA 4RW9A 3LP1B 4LQ9A 2GIQA 2P9EA 4ED7A 4U9UA 1T94A 4X07A 2F43A 1AFIA 2MZSA 3AVXA 4B9VA 1YLXA 5T41A 2MY7A 2XZWA 2Y9HA 4L3KA 3CCJB 2ASYA 1Q8LA 4XAKA 2VJJA 2V6AA 2KI2A 3US5A 1KONA 3JYTB 2PMZD 3M30B 3PZPA 2DEIA 3WX8A 2N7YA 2XGPA 1IBKJ 1X0PA 2HVIA 5E3QA 1WDTA 2D69A 3KG1A 4M53A 2BJ3A 1V5IB 2ROPA 1BHNA 2NXNA 2EBGA 4NA3A 5AN9A 5HQ8A 2ZH8A 1UMJA 1YG0A 4IOCQ 1FDBA 4B44A 3W2VA 1S99A 4J0QA 1REVA 3HVWA 2UXDJ 3VV2B 1F5AA 3GYXB 1AUDA 1DBDA 3L7OA 1H8EA 2E9ZA 2WBRA 4OPOA 3SIPB 2IAJA 2QDXA 1X4DA 2DR9A 1J9ZA 1YKWA 1YK9A 2NPIA 2FD2A 2NQPA 2HS0A 4NCGA 4C8MA 3MEDB 2H9ZA 1QUFA 2AKWB 2L41A 4EYHB 3S8SA 4DR6J 4CZCA 3DMJB 4M5GA 2X85A 1GXTA 4G1PA 4ZLNA 4RLEA 3PXGa 3DHWC 2YKAA 2WVCA 1Q7LB 3OPOA 2BGIA 5KFCA 4NPOA 2KFZA 4ED6A 5KFJA 4L75A 4OHVA 2OPPA 3G8QA 3RGIA 5BYRA 3O2IA 3PYFA 1SUQB 2WR8A 2XMVA 4ZV4A 4OI1A 2FLOA 3JS9A 3ZFVA 3ZO7A 1Q86T 4DG1B 5K8MA 4ZP8A 1L3SA 1L5UA 1RWMB 3M8PA 2DT9A 3QWPA 3H42A 1X5SA 3BY2A 3MDFA 5KFFA 3I0SA 3SQOP 1KZLA 4JI4J 4LBYA 1VK8A 1JLGA 1AZSB 3H5UA 4KHPJ 1XK8A 1CJUA 1HNVB 2MGZA 3DLLQ 1D9FA 4USKA 1K8AD 3EDQB 2K8GA 4N76A 4PQUB 4LQ3A 1Q8BA 2IJFA 1FKPA 2GK7A 4HACB 2Y1LB 1D1UA 3HULA 1X5OA 3FBCA 4Y6IA 1UA1A 2J7KA 1IBCB 3CDUA 4DL5A 1HNXJ 3ELHA 1HYSB 1P1TA 1TV6B 1M1KD 5H1SV 3VR6A 1PC4A 2X3DA 1FRNA 3THPA 2WTFA 3DXBA 2D74B 3I0RA 5IM0B 1SKRA 1HPZB 2HMIA 4WQMA 4DUZJ 1M0SA 1OQ6A 2RDIA 4KAIA 1S12A 1WELA 5HK4A 1K44A 2ZHAA 3MMAB 3R1LA 4PWWA 1NDPA 3HHDA 2IJRA 3DNCA 1L3VA 4KFBA 1CJVB 3R1HA 3UD3P 4IKAA 4L73A 3I31A 2FHMA 4J9RA 1YJWS 1S6QA 1F5CA 4O0NA 1QDUB 3CE8A 2FJEB 3QJLA 4JUZA 3PVXA 4FNIA 5DZ6A 2HVEA 4KPCA 2B6AB 3DYAB 4ZMMA 5DLGA 1TL3A 1P1LA 3P8BB 1NSAA 4WZKA 1HWUA 2C2NA 1PKUA 3NS7B 2QLWA 4F0KA 2GAGC 2PGCA 1REGX 1RXOB 1BQEA 4DQLA 1U0HA 4YR0A 4WIIA 1RWWB 1OSCA 1TL1B 3TVYA 5C7PA 1JLQA 4NMXA 3OV7A 4I68A 2P8IA 1EHWA 3C14B 4GVBA 3OT9A 3M9NB 1NDLA 1NJXA 4I2QB 3A35A 3IG1A 2ZL7A 2UUTA 4M95A 1HZEA 5D78A 4J7CA 4LSLB 1TKDA 4ALZA 4R8UB 2XB2D 1HQEB 1JA0A 2V67A 2DO4A 1F0XA 3N28A 3HF5A 5GMEA 1FFWB 2P2CB 2EVZA 3DC2A 5J2NB 1G7SA 4E0FA 4QHYA 1PBAA 3SLDA 4B9LA 3FJOA 3X3UA 2Z0GA 4C2MA 1CJKA 3QSYB 2LU1A 2P5VA 1TU0B 3W5XA 4HLBA 3CESA 3GFHA 4RL1A 3LP1A 3TAQA 1S1UB 2LQBA 2PMWA 4ASUA 3TUPA 3G9CA 1P8GA 4P7TA 4QR2A 5ETLA 1R8HA 3MM7B 5ADZA 5IXUA 3GLJA 4ANCA 2L48A 1G4CA 4IO1A 5DG7A 1HQUB 2ABYA 3D0IE 2AEMA 4GKKF 3FQKA 4X64J 4DPOA 1KVJA 1RA6A 4DX7A 3K5LA 3M30A 1QUPA 3P5BP 2OIHA 2RDJA 5EX3A 2JEFA 1FKAF 1AW0A 3MTKA 4HI1A 4FF1A 2HFNA 2B4PA 1H2TZ 3QSIA 2PEBA 1VCTA 4Z1MA 2AGPA 1LWCB 3FBFA 4QUZA 2CZ9A 3PV8A 1MWZA 3SKBA 1NK5A 4U96A 4P2MA 3BSAA 5EX0A 4ZVEA 1KK3A 5THXA 2CBXA 4DV2J 1QH0A 4JI6J 1Y11A 3FSYA 1JWWA 1CVJA 2FB0A 5F9LA 1PYOB 3CGIA 3ILJA 4W92B 4CH7A 4ER8A 4ZVHA 1RWNB 1LEOA 4HTJA 2ZH9A 3DMJA 2W9CB 4Q2MA 4CT9A 3QATA 3KJVB 1WDDA 2NSBA 4UUWA 2R9VA 1VBKA 5L9XA 4YMEA 3RR7A 1XNRF 1X4GA 1SKSA 2M3DA 4XIUA 1SUQA 2FZCB 2OFGX 4NL5A 2XS7A 5DDOC 4MAKA 4JI8J 4DG1A 2CQHA 4RBUA 2XOKA 3OVAA 2D3O1 2ZKUA 2DRDA 3M2UB 2ZFHA 2N4DA 3GYNA 1WC5A 4TMVA 3CC7S 1AZSA 3W5YA 4QYRA 3T1AA 4OX7A 1RU1A 1HNVA 1XMBA 3PY8A 2F63A 3ZZPA 4ZIVA 3E01A 4QWDA 3T5LA 4PQUA 3ZZYA 1TR0A 5KG7A 1N48A 2V2VA 3BC9A 2EG1A 4BPRA 4LRBA 2QZ8A 3ADAC 3EXYA 5HBMA 2FGOA 1RHQB 1W2BR 4OZNA 2HG4A 3C6TB 4U6PA 3Q89A 3FUYA 2D74A 3W7BA 3HO1A 2V4JB 1GAWA 2D3LA 3Q38A 4DV3J 1AT1B 2X6WA 2F8MA 1VIXA 2XMTA 1UVKA 4EYIB 3MMAA 3MR5A 2DO0A 2C28A 1KHWA 2XYPB 5A2QU 2Y8YA 4CO4A 1YBTA 1JB9A 4LRAA 1WHXA 1JJ2R 3DI6B 1DQAA 5J1EB 2OJ3A 1N5TA 1CJVA 3PJXA 4DV4F 2DIVA 3HI9A 1M5OC 1F6TA 3J81k 4E8UA 4TMTA 2ROGA 2CQBA 3OHBA 4PC7A 2MLXA 3IGVA 1FD2A 1VLYA 2B6AA 2VQFF 3D6MB 2Z30B 3V7AA 3IFEA 1R8BA 1SCJB 3HHKA 1NZAA 4CDIA 1NRKA 2HWTA 4WTOB 5T7LA 2I38A 2XMKA 3VGSA 2GC8A 2D3UA 1JQGA 1HMVB 3M4XA 3CCSB 5KFEA 1OB0A 3BZQA 5A6PA 4F36A 4O3QA 4DBQA 1KS2A 3AHPA 3MWBA 4MIAA 1H2VZ 1F20A 3FRYA 3AB4B 3ZIAA 1ZAVA 4DCPB 2XMJA 1R0BG 4I2QA 4TNOA 1IWAA 2B0GA 2JIZA 4TY9A 4RW6B 3CB4A 4NXMJ 4YAWA 4ED8A 2NYHA 4R8UA 4CT8A 2CJXB 1HQEA 5E3RA 3EGNA 3E1YE 1X4CA 2QC3A 2X7IA 4DFPA 5J2NA 1NH8A 3KLIB 1N56A 2GVZA 1WTBA 4CLLA 3HDSA 1I51B 3R7BB 3QSYA 3WC2A 2ZZTA 4CLTA 5HROB 3LNNA 3LWLA 2JL9A 3EYZA 2W01A 1S1UA 3QAUA 4IFYB 3ZZTA 3ILIA 3FK4A 1FFGB 2C2ZB 2B3TB 4OI0A 3IAM9 3MEEB 3MM7A 4RNMA 4FDFA 5E33A 1XMOJ 2HCJB 1LNQA 1RT3A 4X62F 2CQ4A 3UPFA 2VJUA 4X4VA 4DV6F 1QFJA 2J76E 3J7YU 4CNZA 4NZ0A 5KTQA 3Q8YA 2I5JB 4RU9A 2CRLA 3T9ZA 5B0CA 4G6IA 2XEXA 3W66A 2FHKA 2A2CA 3QIDA 4CLFA 1BC6A 3R7NB 4Q5VA 2HBZB 2VBZA 3CC4S 3W5VA 1Y3KA 5KFOA 2C78A 4FXWA 1CBKA 3W2WA 3UW1A 3R6KA 1LWCA 4P2FA 4ZVPB 2B4VA 2W2QP 4CQJA 5HP1A 3MTJA 1HBUB 3WYAA 1VQSA 2Y8WA 5B0EA 1HHSA 2JLFA 3CCES 1X4AA 3CCUS 4MH8A 1X0FA 3K58A 3G6EB 4ECSA 2GIFA 3M8ZA 2W9CA 3ES9A 3HXMA 3I1FA 2AF6A 4FN5A 3NAHA 1TKXB 1YITB 1AB8A 2UVVA 2F4VJ 4KKTA 4OHYA 4P74A 2CPJA 5IYQA 3OL9A 4RNFA 2O66A 4RBTA 1RJJA 4G3IA 3ILLA 2A0FB 3BQJA 1RLDA 5MLCV 2GCFA 3TUIC 2BKOA 4P6YA 3B82A 3CTAA 2YKMB 3W8PA 5AXMA 4ELUA 1NDKA 3PEJA 3HHEA 1UD5A 2VASA 1JNRB 4PR6A 4ES1A 4DL3A 1XJWB 4LR9A 2JFKA 4CCHA 5KFSA 2QYGA 1YRTA 1UWAA 4AF6A 3C6UB 2VONA 4OZ2A 2HGLA 2Q1LA 2CNKB 4DQSA 5KFBA 9ATCB 2CPIA 5GAGI 2DR7A 4QIGA 3HHNB 4K5SA 1J5EF 1T02A 1VQOS 2DY1A 2M2BA 5GAEU 3QNWB 4GO7X 4RJVA 3C6TA 3NNAA 2PE3A 4KGZB 2H1YA 2Q6OA 3IXQA 3QYYA 3AD9C 3OOCA 5EDWA 2XYGB 1T9XA 2QX0A 2EIXA 2NV4A 2FC8A 3SI8A 4X7CA 3AH6A 3DGPB 3GP9A 3PRBA 5EWFA 5HMYA 3CJTA 1S9FA 1KR4A 2UUCF 4NLXA 4YS2A 4M5DB 2QGGA 1ZM4A 1RU2A 3CJ3A 1FDDA 3OR1A 1VQ6B 1Y3JA 4NMLA 4R25A 2HNYB 5B6IA 2XS5A 4BBYA 3R7SB 1OGIA 3OZWA 1QUVA 3C15B 2WSSA 3R6LB 3A1YG 4FXUA 1BLUA 2VBWA 1H38A 4DCOB 2K06A 4ATNA 2V8VA 2NZ4A 3CMMA 4RWWA 2WCXA 4DV7J 5HMZA 1EWYA 4ZVRB 1WKJA 2ZH4A 4CLKA 5IV3A 2W9BB 3WDOA 2VODA 3K8WA 4U9RA 3NGDA 4IRKA 3PRDA 1HMVA 2HVDA 2AX1A 1T11A 3D3CJ 5FD1A 3B6BA 3QAEA 1FX0A 1J2VA 1EFCA 2WAQD 1NKBA 1N32J 4F7DA 5FNZA 3QO9B 4LIRA 1FDAA 4OJ1A 3ZNUA 1NK8A 2VPYB 1JJHA 3LTOA 2BJ9A 4QYZK 4Q7AA 2KU7A 4CIOA 2C2EA 5D0RA 1JLCA 4RR5A 1ZTWA 1SH0A 1CNFA 5LMZA 5HJXA 5KFLA 3GVKA 1ZAXA 4LF6F 4A48A 3KG4A 1O6XA 4NLQA 4H4OB 1C0UB 1KRHA 1D3WA 2DNQA 2X8KA 2HFVA 3KLIA 4PC3A 1VDHA 2BOPA 3PA1A 2ZBQA 4BCAA 2G9OA 2MSTA 1RWPB 3OE7A 1X31C 1SL1A 3TUZC 1QAYA 1SL0A 3VAIA 3HT3A 4TT3A 2UU9J 4WP8A 3OXGA 3E8OA 4ZN1A 1LW0A 4IFYA 3U6BA 4PCQA 3VGUA 3KHHA 2KVIA 2VJVA 3MEEA 2E1PA 3RZAA 1N34F 2HHSA 1WEXA 4G7XA 3GG0A 2W6JA 1Q82T 2WVDA 2Z2LA 4KO0A 2DEUA 4BWMA 4Q7JB 4LF8F 3EM1A 5BXIA 3P45B 3OSPA 2J9EA 2F3JA 5JVGQ 2HBYB 1HWIA 5K8NA 5HANA 2I5JA 1VQ7S 3EPGA 3I5AA 3QFWA 3W60A 4J90A 1EP4B 5C24B 1U1NA 3A12A 4GKJJ 1EP2B 2ZC3A 1B4SA 2RHQB 4H4MB 4WFXA 2PI5A 1NK9A 1HBUA 2F4FA 5F3TA 5CAAA 2WHOA 3CCMS 4NX9A 3E3XA 2YVSA 2DPJA 2YBVA 1U45A 4UQGA 1WD6A 2VIHA 2VNHA 2VG7B 1U6BA 4NYOA 4LBVA 4J9SA 4KPYA 2BUNA 3JXOA 3MUMP 2AJFE 3I87A 1RHKB 4ZLJA 3CD6B 4NLGA 1EKRA 3PEHA 1WOOA 4AD6A 3PG9A 2E1RA 4X66F 4WPAA 3WIVA 1VQ8S 1RTJB 4W4MA 2APOA 2GVDB 3N6NA 4WKRA 3CPWB 1BD6A 2DGWA 2B9XA 4OL8A 2ZH2A 2MKYA 2AHOA 4KV8A 5LOQA 1C4CA 3A4TA 4DZ6A 2ZWPA 1JKHB 1QM9A 2UV8G 3TVKA 3KUHA 4UUXA 1NMEB 2UP1A 2ZUAA 3FBBA 4N8OA 4B9SA 3R5DA 1B0VA 1SQGA 4MIBA 4DUTA 4B3FX 1S9GB 3FZBA 4JI5F 5A0YA 1HQ2A 2RUSA 4XK8C 3C6UA 3L95X 1SJQA 2R8GA 1Q7YD 4O3NA 1S6PB 1IKWB 2GV1A 1HBOB 1CS4B 2OEMA 2E1CA 4V19J 5HVHA 3ISNC 1DTQB 5AXNA 5HJYA 1AMOA 4GKKJ 4YB6A 1R6YA 3LP0B 3DRYA 1XFOA 2X3GA 3CDBA 3W64A 4FYXB 3SFGA 2LU2A 2VFUA 2ZM6J 5L38A 4L72B 4DSLA 3GR1A 1YVFA 2C4UA 4M5DA 3CC2S 3C66A 5DS0A 2AEFA 2CJKA 4IW3B 5KFXA 2HNYA 1U49A 1UD3A 2ZE2B 1FI4A 5I3UB 3C15A 4JI7J 3KMSA 1RADB 2A3JA 3OAAA 2BVZA 3NP5A 4HT5A 2GREA 3MFIA 1Y0HA 2ZBCA 3LUYA 2D3OR 2RUGA 2CRVA 2DNRA 4LIWA 2QLFB 1DTTB 3W61A 2CQGA 2NPFA 2PLFA 4B08A 1RTHB 2LMIA 2ZZEA 3ETOA 2Q3PA 2FVPA 4DLGA 5DLFA 4KB7A 5D15A 2QTZA 1XNRJ 4M5JA 2PN6A 4MK9A 4F4YA 1N8RD 1D8ZA 2WSFC 4Z4ZA 5KNLA 4JV1A 1NHKL 2EFNA 4USWA 4ED2A 2CPYA 3F44A 2HHWA 2BE2A 4OX9J 4Z4VA 1IBMJ 3BCDA 3P6YC 3TOQA 2N4CA 3VTIA 2EK6A 5A88A 1Y10A 2KFNA 3W5HA 4N56A 3M1VB 4Y2MA 2HNDB 1JNZB 5ETOA 1RA7A 3A3BA 1Q8IA 3W1YC 4TN1A 4USVA 5D4NA 4WZEA 3UDLA 4G1QB 1C0UA 3HP6A 4EEYA 3U6KA 4ECWA 1JLBA 1LK5A 2JSXA 3AY0A 3BGUA 4XD7A 3I32A 4UZCA 5LSRA 3RAQA 4H54A 4RUHA 2UUWA 4O23A 2FVSA 3W3SA 2IVYA 4Q0BB 1W7WA 3BKUA 2R7RA 1PGZA 3MPWA 1QE1B 3E20A 2B8PA 2QA4S 1PJ6A 2R8JA 1RHJB 4ZHRA 2UXCF 4C6AA 1CJTB 3BSCA 4PAAA 5ETTA 4CTAB 2CZVC 4XKVA 2LXUA 1TUWA 2LKZA 4NXNJ 1X4BA 3Q2SC 2ALZA 5HQMA 2Z6BD 1YIJB 3HSGA 5GAHU 4YHHF 4E2FB 1S0VA 5L1IA 3HHLA 3VHQA 5JUMA 1WC6A 2DJWA 1N33F 4P12A 3CT9A 1C2PA 4LVOP 4W98A 3UN2A 1EP4A 5C24A 3CULA 2C3OA 4LF5F 3NCPA 4LT6A 4N3GA 2IBOA 1VRUA 1VHIA 3GV5B 4LSNB 4H4MA 5D4LA 4DFMA 1E62A 1F3VA 1M5KC 5KG6A 3DCAA 3NL0A 1TTHB 4NE9C 5K5MA 1URRA 1CQXA 2J9DA 3AD7C 2VG7A 1KQGB 1KKHA 3VAJA 4EU0A 2DRAA 4Y9RA 2DNZA 3K89A 2GO8A 4F50A 1NBEB 3D0GE 2L9WA 1HNZF 1MNEA 5DG9A 4RPFA 1D0EA 4KJIA 3S7RA 1IJFB 2L9NA 3V4IB 2GVDA 1SL2A 3OKXA 3SDEB 2IM0A 4Q2LA 4OZLA 4RW7A 3MM6A 2ZD1B 5FO1A 5IZHA 1EKSA 3ISXA 4NI2A 3TUJC 4XTTA 4C98A 1JKHA 1OY6A 4MYUA 2MHEA 4ZPBA 3PR5B 3UO0A 2CIMA 2DXFA 4F7VA 3IS9A 4RM0A 1SI9A 1Q53A 1VF7A 4Q8EA 2JX2A 3KFWX 4FF2A 4K2XA 2A6OA 2RDDA 3R5BA 2YKNB 5LSOA 2R2TA 4K0KF 2WONB 1SV5B 2P9CA 2B5JB 2OTLB 2QL9B 2XTJP 1HBNB 3VZIA 4UTGA 1IKWA 2IYGA 3SSQA 1HBOA 3GE9A 4YHBA 1CS4A 2XS2A 1EFRA 3NCQA 3VO1A 1QG0A 1DTQA 3UDCA 5GMDA 3IRWP 1U1PA 1WI6A 2RD5C 2RILA 3MOJB 4CH1A 1C1BB 5ITHA 5FLXY 3HCXA 2FJWA 3HZEA 3RYLA 1UP1A 3E2EA 4C8NA 1OS5A 2BBEA 2BEFA 3H0PA 5DJBA 3KYLA 1M1KT 1VC6A 1V3ZA 3AGPA 4USTA 4ACBA 3OTBA 4RKUC 4F25A 1WG1A 4EGLA 2UXBF 3UE2A 5AXLA 2W2MP 1UD6A 2ZE2A 4LF7J 3G4SS 3CCRS 4M2LA 5CD4A 5I3UA 1CQMA 3BGFA 4OYMA 4ILRA 2WVBA 2XMUA 2IM2A 3CWJA 4USMA 4I0WA 3M6VA 1VR6A 3UNGC 3Q23A 4C9DA 1KLMB 1NDHA 1RACB 1KSPA 4F4KA 2F1MA 1K47A 2QMWA 3CW2C 5DQIA 1Q9SA 5B0FA 3AJ2A 3BEGB 2AYBA 3D54A 2HNZA 4DK0A 3BBCA 1J27A 4DV5F 3UCUP 3OZUA 3DRRA 4TXSA 1HNWJ 1BLIA 3ASTA 4LFCF 4FXDA 2PIAA 2CF4A 3D66A 2D3ZA 2BF4A 2ACMA 1A7GE 1S6OA 5DDRC 2M70A 3KEWA 6FDRA 3LVBA 4QW9A 1YJWB 2M7SA 2PDAA 3KLFB 1NPRA 2VPXB 3PW0A 4KKSA 2DYIA 2FJDB 2K1RA 3FMWA 3C8YA 3ZTPA 1K0TA 2DGQA 3H25A 4N77A 4F67A 2KRBA 4GQNA 5ETQA 4X2BA 4G1QA 3BGRA 2VV5A 1QD1A 2E1AA 1IKYB 4C3MA 2LP4A 1W34A 3TZZA 4K59A 2BV3A 4UY8T 2R6HA 3SV4A 5HO4A 1J5EJ 2X0KA 1TFWA 3WQPA 2EFPA 1QE1A 2BMBA 4XL9A 4ZCIA 3BR9A 4B9TA 3W2GA 2C3YA 1LWXA 4MK7A 2LCWA 4CTAA 1UPPA 3OJUA 3HLUA 2QTLA 1NB0A 2CWKA 3KHRA 3TJ8A 3BNWA 3JSMA 3FSXA 4CH0S 2I2YA 2ASDA 1T9UA 3ETMA 4KY3A 2BM1A 4EMDA 2JJ4D 3KK1B 1UAWA 5LM7E 1N6QA 5IYRA 2OTJS 1TKTB 3R9LA 3OR2B 2MHNA 3DLEB 1B23P 1S0OA 3FGVA 1VQ5S 2F1FA 4FPRA 4AFFA 1QJHA 4NLPA 4Y0FA 2ZTGA 1S1TB 1OHHA 4FVCA 4DEZA 4YDDB 5A8WB 1DLOB 5J2PB 4MKBA 4KRWA 1S7HA 1VQ4S 1KK2A 5EHHA 5CHCB 5KFTA 1H72C 4OIXA 4QQBA 2CJAA 2KYZA 1VHFA 5HATA 2EFGA 4DSEA 3NE5B 1QSYA 2XZOA 3OXLA 3H9NA 2X1BA 4OOSA 2PT0A 5KFNA 2BJ7A 2W8LA 2CC2A 2DTJA 3PW4A 3KNAA 3J81U 5BJRA 2V31A 1WTHD 2EC0A 4AL6A 3V4IA 3QGPA 2JVOA 5AE1A 2DCUB 1G3OA 2XSJA 3SDEA 4OV1A 4XMYA 3IA0A 1S7IA 4U8YA 3HK2A 3QIPB 3LANA 2ZD1A 1HW9A 3FNNA 4LF9F 2AP6A 3RAMA 5CCMA 4C43A 4XKWA 4AQYF 1ZA2B 3MHPA 4KC5A 3WIUA 1TL4A 2QN6B 4ED0A 3R5GA 3CIZA 2F8EX 3ZTSA 1SH3A 3T3FA 4OPVA 2KZZA 4BDPA 3JQPA 3QRRA 2YKNA 3N4WA 2HIQA 3D26A 2VF3A 1S6UA 1ROFA 4DR5J 1DURA 3C3LA 2OPRB 1SV5A 4UQTA 2B5JA 1VRTB 1NEEA 1UWBB 3FSIA 1AROP 2ZH3A 2QJ3A 2K3KA 2H5JB 1N34J 3KDNA 2PC6A 3V6DB 2J6TA 1SVDA 3OVSA 1KQFB 4LF8J 4R5PB 2IM3A 1YI2S 2K7KA 2E5LF 1S4MA 2HHHF 1A6LA 2AX0A 2X3UA 2HZAA 4NZ6A 3CC7B 3N79A 2VH7A 1MABA 4LBZA 3FEZA 1M5PC 3M8SA 1ULRA 3OL8A 4XLEA 4IG0B 2HAIA 2CA9A 2HK2A 3IMQJ 1T05A 4GVLA 2E1BA 1WORA 1SPBP 1SB6A 4PPDA 3ZUGA 4X05A 5ETKA 1FDNA 2XY7A 2WB4A 4EK2A 2E7WA 1B2RA 3KK2B 3VAKA 4IOAQ 4J9MA 1KLMA 5SZTA 3G71S 4XN3A 1N5SA 5DETA 2W25A 3LP2B 4UOFA 4M4SA 1JA1A 5D4PA 4YR2A 4KYZA 2X6XA 2DISA 2UUAJ 1Q16B 4UF4A 4DPUA 1TLLA 1L3UA 1QX4A 2WYRA 4KGXB 4X66J 3W9JA 4G7WA 1N36J 2YWHA 1TVRB 2ZNZA 1UW9A 3FEXB 1KC8D 1S97A 4A8FA 1XERA 1PSDA 1YJ9S 2R9LA 5DM7Q 1ZTTA 4EUVA 1S72S 1RTDB 3F56A 4RPDA 2YX4A 4RLZA 3FFIB 2YNHA 4I6AA 4D3HA 2HVHA 3O1LA 4AE5A 3ET6A 4Y65A 3V6JA 5K14B 1YTYA 1KFDA 3M8QB 4L8JA 3HFZB 1FF2A 1XR6A 1RAFB 1WKKA 1EX8A 1A9NB 4O3OA 4JI5J 3LO3A 1IKYA 2O5DA 3SYZA 4ECYA 4PC2A 3MI7X 5KFGA 4ES3A 2MY8A 2RKIA 2D9OA 2GK6A 4B3GA 1BQMB 4OP7A 3D1OA 2Z2ZA 3RB0A 3R2CJ 1KRPA 2IRUA 4C8ZA 1LW2B 1RK8A 1Q5VA 3MCAA 3OHAA 3M32B 5F3ZA 2VOOA 3NOGA 2GHWA 2F7VA 1KN6A 2HURA 1RSCA 3CUNA 4Q45A 2C2KB 3H98A 2EBEA 4QPXA 2HFOA 3PW2A 2ZEJA 2Q79A 3BH6B 3HD2A 3GONA 2C5BA 2MJNA 3GJSB 2HHTA 5ETMA 1NJZA 4ECXA 2POKA 2WK4A 3JAMU 5K8PA 2DITA 3KK1A 4A8KA 4OI2A 2CYYA 1T8EA 1TKTA 1FE0A 1IR2A 3A1PA 4J5OA 3M9OB 3OR2A 4EZ9A 3DLEA 3SBMA 3DOKB 4I1TA 1H98A 4HH1A 2EPIA 1S1TA 4XLCA 2HQIA 1WI8A 1OGJA 2DR8A 3PFEA 5A8WA 1DLOA 5J2PA 1NJID 2EG2A 4O3PA 3EZUA 2ZBVA 1SJ4P 2EKNA 1IKXB 2A1BA 1ZZFA 3GFXA 3MD3A 3HFVA 1ZUNB 3DOLB 2LEAA 2AGOA 5H9FK 2AJ1A 2QEXS 3RY8A 3NGKA 4L76A 1EQ0A 1XEZA 1EETB 3BQ1A 1OY8A 1GEHA 4ZCMA 2ZDOA 3P4UB 1BY9A 3KTQA 3CJ0A 4DMZA 5GV8A 3S01A 1AXQA 4IYQA 1VHEA 4V1Ak 3QIPA 4DOZA 4NZ7A 3QJJA 1WOPA 1MWYA 1TK8A 3CCEB 3OD2A 2DKOB 3AA8A 3CCUB 2QN6A 3P3DA 3P26A 3CJ5A 2XNQA 4CO5A 3EDRB 3BB5A 5FO0A 2E1MC 4WP9A 3JQMA 1D9DA 2G0JA 1UVJA 1FRQA 2OMLA 2XO7A 5HLFB 1SJFA 3CO9A 1T03A 1NHVA 3OFHA 2JDJA 3GZ7A 4ZP6A 3PJ9A 3NAIA 1S76D 2OPRA 1S49A 4XM3A 4YAFA 4U7UK 4B3TJ 4DF4A 1VRTA 1UWBA 4I56A 1FESA 2V68A 4JI2J 2DHXA 3W2VB 3OEHA 2HLTA 1JLFB 1REVB 4J37A 2UXCJ 5FDLB 1Q86D 2A10A 4UZFA 1RWKB 3V6DA 3C46A 4OOXA 2DGVA 4H9GA 4FBTA 1WHWA 1U0SA 4NCGB 3POTB 4ZP7A 2GHVC 3EMTA 3Q83A 1AFJA 4F26A 4YHHJ 4U95A 4ZOSA 1YJNS 1N33J 1U1LA 2OUGA 4N8NA 1HR0F 2EEYA 3G82A 4LF5J 3IWLA 2M9KA 4L74A 3SCJE 4IG0A 2FVCA 4RW4B 3CPXA 5F8HA 3KXDA 5KFAA 1BMFA 2OPPB 5IYWA 1RP5A 3MAQA 3JTOA 2R2SA 1VQOB 3GR0A 1QVFB 5TV2A 1RWXB 3R27A 3M8PB 1YDLA 4DV0F 3KK2A 3H2LA 4CLYA 1KMHA 3L7PA 3HKWA 2NXEA 2BKNA 2IVFB 3MM8B 4A46A 5L8RC 4ZPDA 5IT4A 3LP2A 4Z4WA 2J0WA 4C8OA 1HNZJ 7AT1B 1XR7A 3J7Z5 1JLGB 2OGUA 1LQ9A 1ZH5A 2ZHOA 3PW7A 1AYEA 1HVXA 3BGOP 1VJSA 3G8TA 1TVRA 3OVBA 1ZYQA 4M5MA 2W4CA 4DHVA 4F2SA 5ETVA 3VAFA 2OAUA 5J3OA 5B0DA 1UEKA 3OSNA 3JQKA 3I0RB 3FFIA 4FYYB 4DL0C 4I6YA 4TU8A 2HQGA 2NR0A 2HMIB 2CPHA 4LUBA 4ETZA 5K14A 3M8QA 2FC9A 4TYAA 3M7VA 4CWBA 1I94F 4B3MF 4C0OC 2VQEF 4K7QA 4NLSA 1LWEA 4K0KJ 5KFRA 3TJ9A 3AOAA 1VQMS 4C7QA 3R5JB 1C4AA 3Q24A 4DK1A 2CFXA 4WFBQ 3NXZA 3N5BA 1Q8KA 2M88A 4QWBA 2QA2A 4Y2IA 1NLKL 4X7EA 3EPIA 2VG6B 1KHVA 2R7OA 3R3TA 2J5AA 1VIOA 2XWXA 3M32A 3FVYA 1ZM3A 1PYTA 1X5PA 2MJUA 3KLHA 3FMBA 3DHXA 4CI0B 1FXLA 2B5OA 1EQMA 2KXHA 4ECQA 2ZH1A 3BR8A 2J7UA 2JJ1A 1U0HB 4ZP9A 3Q39A 4IFVB 1RCOB 2UXBJ 1OPZA 2F8HA 4UW2A 3CPWR 1CNEA 1M1GA 2VD3A 3D1HA 5SUHA 1FA0A 3PRVA 3WZ0A 3H90A 1AIPA 1VISA 1M5VC 3OTOF 1F2GA 2R7XA 3UR3C 4NOHA 2ZJRQ 4DL7A 2X53S 1HWKA 2EFOA 3KJNB 1XNQF 1UFKA 4ZJLA 2GZOA 1QGYA 1T9VA 2E5IA 2CKWA 5BR8J 1JJCB 4JMQA 4B9NA 2H4WB 3PO5A 3M9MB 2FUG9 1B3TA 1WC3A 1M5HA 5AJ3J 3RTVA 3DOLA 1KLNA 4N3NA 5B09A 4DV5J 5A8RA 5KG2A 3A8KA 3BKTA 3OP1A 1VQ7B 1EETA 1KD1T 5GV7A 1CJKB 2U1AA 4YR3A 4I6WA 1ZM2A 4M5IA 3TARA 2ZBUA 3NNCA 1RAOA 3PX6A 1U47A 4CYUA 3CCMB 2D1CA 5E3PA 3RRKA 3W2FA 1GMVA 4PPZA 3FBEA 1XE1A 1VQLS 1SIZA 5C42B 1S0NA 4H4KA 3U1MA 3UDEA 2QLXA 1AA1B 2P9GA 1Z2ZA 1N4LA 2MQLA 5DQGA 4X4SA 3PKMA 3PYGA 5HLFA 2BE9B 4NLUA 5D3GB 2JEIA 1VQ8B 3AOCA 2V7XA 2CQIA 3MEGA 1SKUB 4PXCA 2MTLA 1OQ3A 2BRLA 3VR1A 1JLFA 3TX0A 4NEYA 1AUSL 3PHTA 5FDLA 4X4NA 3SFUA 4QCLA 2Q43A 4OYZA 1BQNA 1UD2A 1U7LA 1HLWA 2IIHA 3NBPA 4QIFA 1Q81T 3DRXA 3B8HA 1OIAA 5CABA 2JLEA 1RT5A 3A8EA 3POTA 1GXLA 2MQPA 2FZGB 3D7SB 1SJ3P 3NS6A 2J9DE 1P9YA 4WK1A 3AB2B 5F0UA 1H6KX 3OPKA 4Z7CA 1PYSB 2ATLA 5H5JA 3ENQA 1SKYB 1U2FA 3IO1A 1S0MA 2CQ3A 2IY5B 3GIKA 4RW4A 2EFVA 4WTYA 3N5FA 2ZDPA 1URNA 1HIYA 2OK7A 2XQCA 2EI5A 3BYRA 2DNYA 2B4OA 3V4MA 1SKQA 3M2VA 1Y00A 2LDIA 4CO1A 4LFBF 2KM8C 4X65F 5KFIA 2ERRA 4MKVA 3MM8A 4TLRA 3EVOA 1HHTP 2ZZMA 2VYQA 4Q44A 1WF0A 2HFSA 3AJ1A 3OJWA 1V9OA 3CC2B 4XLFA 4C0SA 3DLJA 3E01B 3K8VA 1GQEA 5FJ4A
chains in the Genus database with same CATH topology
4YQWA 3H4BA 3ICLA 1DARA 2C3MA 2JJ2A 2VFRA 2BQ3A 2BYCA 4DR3F 3KLEA 4DS5A 2KG0A 1VK3A 2YY3A 2RQMA 2YNHB 2RIJA 4MIBA 4B3FX 1S9GB 1Y7PA 2L3MA 3FZBA 3I9V9 4JI5F 5A0YA 3K5OA 4C8YA 2ZHBA 1TAQA 4ZK7M 5HBMB 5JVHQ 4JI3F 2J6UA 4XK8C 5CA5A 2HWIA 2KRRA 2QMXA 5KFPA 1D8YA 5F8LA 2HGMA 3C6UA 3L95X 1GT8A 3V2UC 3NMRA 1YX2A 1SJQA 5CQGA 3ENWA 3LALA 1S9EB 4DX8H 3BH4A 2LZJA 3CD6S 2R8GA 3WC0A 4QIVA 4TQSA 2GGPA 5M2UA 4O3NA 1N5VA 3QZ7A 1S6PB 2EFQA 1IKWB 2GV1A 4QR0A 4RWXA 2C42A 4ZPVR 1HBOB 4DV3F 3HX9A 1HQUA 2SXLA 5DO2A 2E1CA 4V19J 3PACA 3ISNC 2RKIB 1DTQB 2VB6A 3PM9A 1H7XA 3FCHA 1WG4A 2RS8A 4I67A 1W9XA 5AXNA 4KKOA 2MZRA 3O6QA 4ZPWR 4Y00A 3IRXA 1VQ9S 4KTQA 2EW9A 1U1MA 3DM2A 3CCQS 1COWA 3KHGA 2EK1A 1CG2A 1IUJA 4YB6A 1R6YA 2VKZG 3LP0B 2N82B 2VBXA 3DRYA 2X3GA 2BRKA 3CDBA 4CQ1A 1FRMA 3BM7A 3SFGA 3ISND 2LU2A 2IAJB 1U2RA 2OFHX 3AQPA 1S48A 2VFUA 4IQMA 2FIUA 2PA8D 4P2SA 5THWA 5L38A 5F8NA 4B3SF 4L72B 4DSLA 4PUOB 4HVZA 3GR1A 4MFBA 1YVFA 1KOHA 1G2EA 4R5PA 4NA2A 4M5DA 3CC2S 3C66A 4NLVA 2LQ5A 4DR6F 1FCAA 2VG6A 2JEGA 4IG3B 1XMQF 4LF7F 2KYXA 1OO0B 1MMLA 2NSCA 2Y1RI 2CJKA 2XULA 4ES2A 3MOZA 5KFXA 2RMLA 2EKYA 4ECTA 2YWGA 2HNYA 3TQ1A 1U49A 1UD3A 5D8HB 3KKFA 3HVTB 3BN7A 3QGHA 2ZE2B 1CLFA 4C8LA 4XR6A 2I0XA 3OXFA 4O4RA 2VFSA 3V81A 4PABA 5CXTA 5E7OB 5I3UB 1C0TB 1RISA 2GJ2A 4QIEA 4E0DA 2BR0A 4EO8A 5L9NA 2CVEA 5DS7A 3KMSA 2IRYA 3IBWA 2MQMA 3TAMA 1ZAWA 1QAIA 3D0HE 2A3JA 3OAAA 1HD0A 2BVZA 3NP5A 3QMQA 3OJSA 5G0RA 4HT5A 3A3GA 3CCWA 3G86A 4A4JA 2RQCA 3MFIA 5T7LB 1Y0HA 2ZBCA 2OD6A 4I2PB 4N47A 5M2PA 2RF2A 1FVSA 3IR7B 3LUYA 3RBEA 2D3OR 1KQKA 2JEJA 3RU0A 4IFVA 3KJVA 2RUGA 2MZTA 3T56B 1E43A 3DRPA 2OO4A 1R8CA 2DNRA 2KHDA 4C11A 3BN4A 2VOPA 4LIWA 2E44A 5HMXA 1PKVA 2MQOA 1DTTB 4YUDA 2CQGA 1FNMA 2BW2A 2HRUA 5EGYA 2RSQA 1R8PA 1BQXA 2NPFA 2Q6CA 4B08A 3JTNA 3B4MA 3K2YA 1RTHB 5I3PA 2LMIA 2ZZEA 4JI4F 3ETOA 4OI6A 2Q3PA 4DN9A 5BR8F 2FVPA 4DLGA 1N88A 4IH5A 5LXYA 1YQHA 3FJ2A 1XC9A 1K9MT 1HNWF 5DLFA 2XI3A 3TAPA 2ZZQA 1NBMA 4OQJA 4KB7A 2XWYA 4KIAA 1UVMA 3I4PA 5D4OA 3I0SB 4FF3A 4KR0B 5GAGU 2DNPA 3GIMA 4PRFA 3CVKA 4CO2A 1OPIA 1NJWA 1UKUA 2PN6A 4W90B 3KMQA 4MK9A 2LA4A 4F4YA 1GXUA 1X4EA 5LXRA 3GILA 2IJNA 4WYLA 1QVGR 1CQNA 3QLHB 2FJBB 2DPIA 5A8KB 1D8ZA 1IQZA 1RT6A 2WSFC 2WOMB 3M2UA 5KNLA 2J0XA 4XDDA 4JV1A 2IHR1 2EFNA 4A47A 5IT0A 2XC9A 4ED2A 4JOUA 2Z8QA 1HARA 2BXJA 2CPYA 4D3GA 2MGZB 3QZ8A 3F44A 3H40A 3K5MA 2HHWA 2RRNA 2BE2A 5B0BA 2ZBIA 4C8KA 3H59A 1FTCA 3GB0A 2M8DB 5A2QY 3GG1A 3BCDA 2V9KA 4WFZA 1YBAA 3P6YC 3TOQA 2N4CA 2KO1A 3VTIA 4ZCKA 2EK6A 2AJ4A 4OMFG 4DLEA 4FBUA 5FIIA 3I9ZA 5C5JA 2KFNA 1FKPB 4N56A 4MK8A 2ASLA 1YJVA 1HNXF 3CMES 1LFWA 3M1VB 3NS5A 4NWBA 4Y2MA 2HNDB 1V0EA 5LL6d 4ZVGA 4F3QA 3OTDA 1JNZB 2GW8A 1T95A 1RA7A 1FE4A 3WX4A 3A3BA 2BACA 1LKZA 5DDPC 1Y9OA 2Y1JA 1Q8IA 1RTDA 3VQTA 2PMHA 4O3RA 1NH7A 2AV5A 3RR8A 4WE1B 2EWHA 2FGCA 5D4NA 4G1QB 1C0UA 3UDLA 3HP6A 4EEYA 2FHJA 2J7WA 4DFJA 1Y4ZB 4DUZF 3K5PA 4ECWA 1JLBA 1UL3A 1LK5A 2KJWA 2JSXA 3D28A 2MKKA 4N41A 2IMWP 3AY0A 2YNFB 3BGUA 3DLKB 4OJHA 4XD7A 4F3OA 5KT2A 4JI0F 3I32A 2PFFB 5LSRA 1RWUA 3RAQA 2FHJD 4H54A 4ZPTR 2X1FA 2ZTNA 1FVQA 2HS3A 4RUHA 3JAMY 3HZGA 2UUWA 1MROA 4O23A 2FVSA 3UR0A 1E3ZA 3W3SA 5F41A 2IVYA 5E2QA 5L39A 4Y3CA 4Q0BB 4EBDA 3SSRA 2RQKA 4URSA 2MQQA 3ZZOA 3Q22A 4J9LA 2R7RA 1S1XA 4USHA 3BF4A 1H7WA 3LAKA 4B02A 1S1VA 1PGZA 4YB7A 3NMAA 4NNJA 3MPWA 2DHAA 2V4JA 3RBDA 1QE1B 2RB7A 4XQFA 1RT3B 1T03B 4QOTA 2F9DA 3N01A 2QA4S 2DH7A 1PJ6A 5C42A 2KZMA 3A8IA 4N5SA 2R8JA 1SJRA 2VUGA 4ZHRA 2UXCF 1B0TA 4DF8A 4CO3A 1ELOA 2NUUG 2UUBF 4KFBB 4DWIA 2OPQB 3KWMA 1BQMA 3BSCA 4PAAA 2X6YA 2KT5A 2ZVSA 4XNFA 4EBEA 4CTAB 3OLAA 2CZVC 3GMGA 2J0QD 1WHVA 1MW7A 3MD1A