1WSVA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
371
structure length
371
Chain Sequence
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 117
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsvA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsvA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsvA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsvA03
1XZPA 3AD8C 1V5VA 3ADAC 3TFJA 1PJ6A 3GIRA 1X31C 1WORA 5L46A 1NRKA 2GAHC 3AD9C 1WOOA 1WSVA 1XZQB 3TFIA 3A8KA 3A8IA 1VLYA 1VLOA 2GAGC 1PJ7A 3GSIA 1XZQA 1WSRA 1WOSA 1WOPA 3AD7C 4PAAA 1VRQC 3TTGA 1PJ5A 4PABA 1XZPB 3GEHA 3TFHA 1YX2A 4P9SA 3GEEA 3GEIA 3A8JA
chains in the Genus database with same CATH superfamily
2RDDA 4H4KC 5KOWA 3OTCA 2BOAA 2RT3A 3OBIA 1C1CB 4JV1A 2ZBCA 2K2PA 3GLJA 4X8IA 3MOJB 4LFBJ 3S6EA 2DXDA 2VG6B 1W2BB 1S9FA 3PRVA 1JJHA 3PYEA 5HVGA 5LMNF 1SKSA 4HHJA 3K59A 1N33J 3NCPA 4V19J 4ZN3A 1VFJA 2VC1A 2KVIA 4UZEA 1YZ6A 2ZFHA 1XC9A 4KMAA 4PWUA 8ATCB 2I2YA 5AT1B 5A0YB 2V4RA 4AL5A 2X7IA 3R7BB 2VU5A 2DEIA 4YR2A 3A1PA 4K5SA 4OYXA 2QFIA 1L3TA 3LP2B 4A3KC 3CJRA 2A3JA 1U48A 3QRQA 1CNFA 2N4DA 3T5KA 2XLIA 2QMUA 1I7PA 1DTTB 3JB9k 3CO9A 3E51A 1XZPA 5KFFA 2LEAA 4P71A 2LQ5A 4LSNB 2VNHA 1HBMA 2IHR1 1R7IA 3TYTA 1YGYA 2E9ZA 1KQFB 2ZH2A 4K4TA 4AH6A 4DR6F 4BY7C 1FRIA 1J6VA 4YMEA 1XBWA 3EJMA 4CLPA 1CJVA 3HI9A 4LREA 2MKIA 3G05A 4KASA 2K3IA 1HNWJ 1VLOA 2VPWB 2HHPA 2OFHX 2Z0GA 3TUPA 3HZGA 3U1NA 2AV5A 2KH9A 3JTPA 4C4WA 1TV6B 2QO3A 5B0DA 1S6OA 1T03B 1NB0A 4O3OA 4O3SA 5E3CA 3HHNB 2R9LA 1UAWA 3PW4A 2MDAA 1UW9A 2FQQB 2XGPA 3HAGA 5AXMA 1T6YA 3MZIA 1K9MD 1HBOA 3GIMA 3ZTRA 2CPXA 4JV0A 3RW7A 2J6TA 3GVLA 2EFNA 2VV5A 2G2YA 3SJZA 1TL7A 5D0GA 4MJKA 5DQHA 4OI1A 3FCWA 3M32A 1KVKA 4M1XA 3OR1B 4X4QA 2J0SD 1PKVA 1USMA 4BWJA 1TMJA 3ZTOA 2QA4G 2DRAA 1ZOTA 2CPZA 1YJTA 3KTQA 3W3SA 4C3HK 1YNNA 1QY7A 2IJRA 3OEPA 5DETA 2GIRA 5L1IA 3H0GA 3DI6A 2H48B 1CBKA 1EP4A 1LWFA 4ED4A 3M9MB 2VODA 1WKJA 2FGCA 3HSGA 3L7UA 4QPXA 2XMWA 3JYTB 3GJQB 3UWTA 2GVDB 1C0TB 4IG3A 3JAMY 2KFNA 2WB1L 1CG2A 5HMXA 4FDFA 5E6TA 1DDGA 5FO0A 5C5JA 2X51A 1IBKJ 4XLPA 1KEKA 3DRYA 1BWVA 2MHEA 2J6SA 4X65F 2GAHC 3DDIA 1VQNB 5BYRA 5LL6d 2WB1D 3TJ9A 2HMIA 5K8NA 3CCVS 5D4DA 4HDHA 1CJVB 4A8OA 3NL0A 5M5WK 4OFZA 3PACA 2DK2A 2HNZB 2NS1B 2VG7B 1BX0A 2DNGA 4DOZA 3D3BJ 5L9NA 2M2BA 4QV2A 2M8DB 3RZDC 4DG1B 5A88A 4N5SA 2F4VJ 4USUA 3VA7A 3GDZA 2DH7A 3IRWP 4HI1A 3G8SA 2B43A 1S6PA 3JQKA 3GTJC 4Y2KA 2R3VA 3DRPB 4WZKA 1FTRA 3UVJA 4JYAJ 4CRJA 3BGRB 5KOXA 4DMZA 4XCHA 4HEA9 4WP3A 2XO6A 2CNKB 3U02A 4RUHA 4NLUA 1Y5LB 2XNQA 4NWBA 2O01C 2QL9B 2BXJA 4MH8A 4PXBA 1B70B 3UCZP 5GMEA 1RBLA 4B47A 2RD5C 3QFHA 1WCMC 1BC6A 1PBUA 3H8YA 3MTKA 2VFSA 3ZZUA 1JNYA 1D8TA 2XSFA 3BDPA 2X3DA 4UAJA 2X85A 4U96A 4Y6IA 4C11A 1YIJB 4DV1J 4PR6A 2RJZA 1M5SA 3I0RA 4JV5F 1ZAXA 3OQ2A 2RH3A 1W26A 2BANB 1S9EB 2MPUA 4N7TA 4PRFA 2HYIB 4KH1B 1F9NA 1FDDA 3BQJA 1S7IA 2E7VA 3QGHA 4LOWA 1GMVA 3KLIA 3C16B 5FIUA 2FZCB 4U7CA 4J9PA 5C3EK 3ZC3A 2I6WA 4LFBF 4BBSK 2GZOA 2J8AA 3Q38A 4NZ7A 1WD6A 1BX1A 2R2RA 1EFUA 4WXWA 4ZCLA 1K83K 3S1NK 9RUBA 1N33F 3WBJA 4G7OA 1GQEA 2GX8A 5TY0A 4YDXA 4NA1A 2HHXA 2W7OA 3RR7A 1F0XA 4KR0B 2V94A 1RTIA 1IM6A 4B9VA 4XL9A 4MFBB 1F5CA 3HOYC 2KYZA 3VAGA 4UY85 3MHPA 3WYAA 5KFCA 2RE1A 4DV0J 4YB7A 3TFJA 3M4XA 4C8YA 2JX2A 1IWAA 5FLMC 2CFAA 3G6EB 1WG1A 5FL7A 2R8IA 1JLCB 3N01A 3M8WA 4LVOP 3WIUA 2HRTA 3VAHA 3QFRA 2GQ2A 3RRKA 4CLKA 4W4MA 2RRAA 4ELUA 1VCTA 2BYCA 3NRBA 1HA1A 5KG3A 2VA2A 1AROP 3OJWA 1GTEA 3CQZC 3M8QB 1RJJA 4F7DA 3KFWX 2QN6B 4C0SA 3NS6A 1FF2A 3DC2A 3A3NB 1HNWF 2OGUA 1VQ5S 4K4ZA 4F4WA 4FYVB 5JVHQ 1P1TA 1VQOS 4KMDA 2XCOA 2QTLA 3L4KA 3GCWP 3CD6B 2PN6A 1R0AB 3GFZA 2MQ8A 1N36J 4R8UA 4DL3A 4KM9A 4H4OB 3PENA 1VJWA 2IYIA 3R1HA 3PW5A 4WJ3M 2F1FA 1U1QA 2NXUA 4C0HA 4J90A 1X4AA 3GTLC 4DFKA 5CQGA 3H2UB 4LRDA 2GHPA 3PEJA 4K4YA 2KN4A 4ZVUB 1U6FA 2CG8A 4O44B 1FKPB 2XCAA 1LQ9A 4ALZA 3M7VA 2EW9A 5L9XA 3T5HA 1S9GA 5D3GA 1CPZA 1BQMA 3NUHA 3GJRB 4PC1A 4DL4A 2VUGA 4WJ4A 4J9SA 3O2IA 5HZAA 2NVXK 2NZCA 2ROPA 3IBFB 3TRGA 1GMUA 4A8XA 4B3RJ 5HK4A 3HPOA 3PJ9A 4J9OA 4F4ZA 4ED7A 1U1KA 2AJ1A 2OPQB 3SCKE 2VH7A 2MQPA 4CT9A 2HWTA 3UDCA 2PMDA 3KHRA 2CQ1A 5AE2A 2PSZA 1SVDA 1TKXA 5F4MA 3ZNUA 3N79A 4PEOA 1H38A 1S1XA 3G71B 1PAUB 1FWKA 2RKIA 1CSJA 1WSVA 3S1MC 4OPOA 4PG4A 3IAS9 1D3WA 2LA4A 2EFPA 4GTAA 2HNDB 2VZ9A 4C2MA 4HACA 3PHEA 2NXJA 3E01B 3I87A 4OZ2A 4F4YA 2EKYA 1RAJA 4UQTA 2ATCB 1RTJA 1GX6A 3WQPA 2F4VF 5C25B 2Y1RI 2IFXA 1MU2A 1U1OA 1HI8A 2V7VA 4TT3A 3MFHA 1V3SA 1WKLA 2JRSA 3DDYA 3R6KA 2ZWPA 2UV8A 4WFAQ 1QGYA 3MR3A 4JYAF 4DFPA 3GV8B 1VH2A 3GQCA 1W9XA 1EETA 1UVIA 3W62A 1TU0B 1H6KX 1YTYA 1WC6A 1FX4A 1BMFA 4Q8FA 3SYZA 1E1QA 3EICA 4IOAQ 2R93A 2DOGA 1JJ2B 2J76E 2XQCA 5D8HB 3RW6A 3CCMB 3CF5Q 4U67Q 1IBCB 2HVEA 5EGEA 3OJXA 4FYDA 4Q8EA 1FRHA 4C45A 3I5BA 4Z2XA 1YJNB 1UW4A 1ZETA 4OQJA 1SKQA 4ECRA 1TL3B 4C3KA 2BMBA 2R2SA 1SH3A 1C0UB 1NHVA 2BZ2A 2HVZA 2UUCJ 2WW4A 1VC0A 1FA0A 3F41A 2Q3PA 4CT8A 1HWKA 3AVXA 3D6MB 4JI7J 3S1TA 4HDGA 5KG6A 5KT7A 4DN9A 4HTJA 5JMNA 2WOMA 3IR6B 5ETMA 2ZZTA 1JXEA 4LF4J 2OHDA 3GYNA 1VQLB 1UEVA 5EDWA 4U9RA 1VBXA 4CO5A 3EZUA 3EDRB 1PC5A 2MQLA 5K8PA 2BE5A 1RT6A 2I0XA 3OFGA 1U1LA 4AFFA 3BBFA 5FO1A 2ZZFA 1FDRA 3QZ8A 2CPHA 1WP6A 4O4GA 2HQGA 5KT2A 4P72A 2KU7A 4C0BA 2B63K 1ZM9A 5KG2A 1VR6A 3OL6A 3R5CA 2FJDB 1HI1A 4DV0F 5ETRA 2I8EA 3CJ3A 4WE1A 4EI2A 4RD1A 2YNHB 1N5QA 3QIDA 2XMUA 4A3FC 3ZFVA 5J2QA 3J7YU 4AQYJ 2ASYA 2KT3A 2R7UA 3MXHP 2MJUA 3MM9B 4HLBA 1TQLA 1R9TK 2JN9A 2DJWA 3JSYA 4B9UA 4UZBA 2HK3A 2Q43A 4G7WA 3S17C 3LPYA 4ZPAA 1KSPA 5C24A 4P2XA 3W2FA 4NLOA 2R8JA 1WC1A 3I6PA 4FP9A 1E6VA 1PSDA 2R2TA 1WC5A 3KNGA 2N82B 3NGTA 2R4FA 3Q8PB 3OP1A 5LT5A 1VQ4B 2WONB 4WYLA 4M95A 2L9DA 4C0OC 2OTJS 4DSFA 4ECZA 3M8PB 3GPAA 1N36F 1E63A 5KNLA 2EK6A 4F2RA 2E1RA 1LWEB 2P9EA 3W66A 2B7CA 3A1YG 2K7KA 5CA5A 2YY3A 3ILJA 4USJC 2VJVA 1QD1A 1O28A 1VK8A 5J35A 3MECB 4MEYA 4M5IA 2WOMB 4A3CC 3QQCD 1RWPB 3US5A 4XLHA 1MN7A 3GSIA 4Z4WA 3C6UB 4F25A 3BGUA 4RNMA 2JA6A 1U09A 3TX0A 1G2EA 3ILLA 3NAHA 4URGA 4FS1A 4WZEA 2B0GA 5HROB 5CAAA 1GVHA 4DL7A 2G2ZA 1EX8A 5EN1A 4X84A 1KKHA 4N3GA 2OPSB 2QE5A 3C15B 1LFPA 1S5ZA 4I2QA 4CO0A 1ZYRA 5J1PA 2Z2LA 3LWMA 2CPYA 2EVZA 4B3RF 1KOOA 1IJFA 4DQQA 1JQGA 3BN4A 3OEHA 1CJUA 4WZQA 1IVZA 3K17A 3DOLB 1WSRA 3I4PA 1PYOB 1M90D 3GTGC 4NEZA 1X4DA 2XM3A 2FVPA 2HHHJ 4ILDA 3MR7A 2XHCA 4FPRA 4BBRK 3PA2A 2A6OA 3A8KA 2GNKA 1Y3JA 2E2JK 3B8HA 1YVFA 2XULA 4B08A 3D9BA 1C1BB 1S0VA 4TQRA 4TXSA 5ETSA 4F4XA 4QW8A 3GIJA 3N28A 4YOEA 1WOOA 3CMEB 4OZLA 3OREA 1F60A 3HZEA 4IH7A 4RLEA 2O3DA 2KI2A 4ZK7M 5KSWB 2C78A 4KRWA 5A8WB 3PYFA 3BY1A 3LGNA 5T7LB 3VAJA 1OWXA 3W65A 2D6FC 3FCHA 5T14A 3WX8A 1W25A 1EI6A 3TJ8A 2PFDA 2NUHA 1TL5A 2Y0SD 1RKJA 4FK8A 1HA3A 2CDRB 4EMDA 5H59A 4A8KA 2NXNA 4UZUA 1G4CA 4AE5A 1RBOB 5SZTA 4ZGNB 2RQKA 1UVLA 1QFJA 2OLWA 3I4MC 4B3OB 1F93A 4IH6A 4KN7A 2H51B 1FFGB 3G4CA 4HL9A 1H42A 1WOSA 4QIVA 2MQQA 3BQ1A 2DPJA 4NI2A 1VQPS 2Q1LA 3PUMA 2GIQA 3AOBA 3GTMC 2R7XA 2FHJA 2HGMA 4WK1A 5M5YK 4IRDA 2GREA 3GTOK 5GAHI 3J80U 2HLUA 2X1FA 3QBCA 3LP1A 4FF3A 3LAPA 2P8TA 4N3NA 1M1HA 3EDQB 1DTQA 1EIYB 3PM9A 2A68A 3SZYA 1V5IB 4NA2A 4ZP6A 2F8MA 3W9IA 3MGJA 3N4WA 4PUOA 2VBUA 1WEXA 5IYDC 2HFVA 3JSMA 4JI7F 2VF3A 2B3TB 2XGJA 4ATNA 4WWVA 1NDCA 1IN0A 4F0MA 4GO7X 4M5DB 4IDKB 5HJXA 2FTRA 4XN3A 2V6UA 3NBPA 3FVYA 3NCQA 3M9OB 5DSZA 3SCIE 1NK7A 2KM8C 2E2IC 4KHPJ 4P2FA 4OIRA 3JSRA 4J0QA 2MKSA 2DH8A 2VQFJ 3V81A 3JTNA 2RRBA 4OYMA 3O5TB 3QSYA 5DO2A 1G51A 3BP3A 3S2HK 1S99A 3GB0A 3QIPA 1QDUB 1JLQB 4ZVHA 3G2XA 4USMA 4BY1C 5HQMA 1L3SA 2UXDF 2DIUA 2DIVA 2E5LJ 3KWMA 1HHTP 2XWYA 5BYQA 1ZM4A 2CQ2A 2KXFA 5KT5A 1O29A 3K7RA 2ZVSA 3PY8A 1YJ9S 3H90A 1B2RA 3MMCA 2JWNA 2MZTA 1UVNA 2EFGA 2FX3A 1TTTA 3J80Y 2F7VA 2DRBA 2ZJPQ 4OOSA 4AQYF 2XMVA 4FZBA 4QU6A 4UQGA 4NLTA 3H42A 1XJWB 1B7YB 2CJQA 1P8GA 1WIHA 3JSTA 2M7SA 2F8EX 5CYJA 5FNZA 2QT7A 4BWMA 2KL8A 1Q7LB 4ZN1A 1Q81D 3LGHA 3LPXA 1ZAWA 1BLIA 4HR2A 3UNYA 5F3ZA 4LSZB 3PYDA 3TZXA 1IJEB 2V2ZA 3Q6RA 2CQGA 2V68A 3DOMA 1WNEA 4KYZA 3O44A 4PG8A 2NVQC 1DDIA 2DNMA 2IRUA 2LZJA 1HMVA 3Q86A 2GGPB 4LQ3A 2CJBA 3RRGA 3BO3A 5TMFA 3CGIA 4KMHA 2CWKA 2ZBQA 4JMQA 4L3KA 3UI3A 3G87A 5CABA 1TMMA 3FBBA 3H5XA 2LU2A 4F36A 2MZ1A 3TVZA 2FHJD 2JLGA 4II2A 5I3UB 4NOIA 3C2PA 3EWGA 3FFIB 2VUMA 4X7FA 3M1VB 2PI4A 1UD6A 2AJ0A 3MEDB 3GQBA 2H5JB 1KONA 3L95X 1HR0J 1T8EA 1KN6A 2AYBA 2YKNA 4RNHA 3V6DB 4KO0B 2N7CA 3CJTA 2WAQD 3OXLA 1N52B 2VQEJ 4NNJA 2JJ2A 2A2DA 4ZHRB 2D69A 2CRLA 4GKJJ 1U49A 4YAWA 3H2LA 1Q0NA 1U2FA 2QA2A 4A3KK 1VYAA 4JP8A 5HQ8A 5KFPA 4RUBA 5B0GA 4FKXA 1VF7A 1SIZA 3EMTA 3AD7C 3CJKA 1DAXA 3W2GA 4D3HA 4UUWA 3VMFA 1XMOJ 2XCPA 4F7VA 2GO8A 2J5AA 4OHXA 3I0SA 1GMWA 4OJHA 2HHHF 2V7QA 2XG8A 3HSJA 2AJ2A 4YAOA 2R7ZC 4Y7CA 4A3EC 4ID8A 2ASJA 5CYQA 4Z4VA 1YQHA 3MM8A 3VGSA 4B9LA 2CQIA 4RJVA 4X64J 4P2MA 3H40A 3CCQB 3WDOA 1Q8IA 1XB2A 1U4BA 3ZXWA 2D7SA 4ZPTR 3S01A 2F1MA 5AJ3J 3W5HA 2CQPA 4RL1A 4PQUB 2CBXA 1CS4A 2B9XA 4A3GC 4ES1A 1QVGB 1U0SA 4QJVA 4RW9A 4PC3A 2DTJA 2C5HA 4QZVB 4N8OA 3IMQJ 3MEGA 1I18A 2WSFC 3N0BA 3P6YC 2X53S 3HKZL 2ZTNA 3PJWA 1S79A 3HVRA 4EU0A 3MMLB 5AN9A 5KFHA 5KFOA 1FESA 1X4EA 2CZ9A 4GVBA 2IBKA 2IJNA 1N8RD 3DMJB 1VRTB 2FVSA 5KAKA 2YKMA 1UPMB 4LRCA 5IV4A 1VGYA 3W63A 1VHOA 2XMJA 3D5MA 2CPEA 3SBMA 3RAQA 2JOQA 4EEYA 2BW7A 2HS4A 4QCLA 3G96A 4P6VF 1ZH5A 4FNHA 2PA3A 2B4PA 1VQ8S 2FHOB 3UD5A 4ES2A 1TWAA 2IVMA 2GSOA 4OLOA 2GCFA 3P4UB 3T5LA 3V2UC 4MKAA 1S1UA 1FRJA 4ZV4A 2ZKUA 2RNEA 2LXFA 3AJDA 4MMOA 2V8HA 2W9AA 1A8PA 3QJJA 4O0NA 2Q6LA 2D3OR 1RTHA 1XNRJ 5B0EA 4NLGA 2VBVA 4Y7NC 1YCLA 4QWBA 4IQMA 3CCEB 4IOBA 2W9CA 2IM1A 5M2PA 1EAYC 3GYXB 2OKQA 4ID5A 2JLEA 3RZAA 2WHOA 2HZAA 2BSAA 2FUG9 3BO4A 2DR7A 2VQFF 1EARA 2JNJA 2XEXA 5F8NA 1I6HK 3HT0A 3Q39A 1B0PA 4FYYB 3RZOC 2WB4A 1RISA 4DQRA 2BPOA 4XLCA 2NUUG 3HOUC 2H9ZA 3A13A 2XLKA 3H94A 4ASUA 4WPAA 4RD0A 1R31A 3CCSB 2CNOB 4RU9A 3PVXA 3RZDK 1OJ4A 3PG9A 3X1LB 2E5LF 2E29A 3OZVA 5LMUJ 1A6LA 4B9TA 2ZZMA 1RSCA 1CC7A 3QLHA 5KTQA 5AE3A 3BF4A 3GTJK 3E8OA 2R92A 3GJSB 2WJVA 2Y1LB 3V4MA 4NX9A 4NCAA 3C6TA 2QE7A 1TUWA 4ILLA 1FRLA 4EGLA 1BD6A 1IWGA 2M70A 4C97A 5FD1A 2AGPA 2FD2A 1MW7A 3UDEA 3VV2B 2ASDA 4X7EA 3R5DA 3K7AC 4WXOA 4DR3F 2ZXHA 3TFHA 4XN0A 3CCLB 1WCMK 4LBVA 3T5JA 3MAAB 1E3ZA 2V7WA 1G7RA 3MD1A 4FYWB 4ANCA 1SUQA 3AJ2A 1VHEA 5F8IA 1FE4A 3DN9A 3J7Z5 2FJAB 2KJVA 2MJNA 3I5AA 4B3FX 4YR0A 4EBCA 2K1RA 2BDPA 3ASTA 2EFQA 5D0HA 4DV6J 2FVQA 2NSBA 4ED2A 1U6ZA 1F7VA 4QR1A 1Q81T 5HSPA 1EQRA 4Q5VA 3ISND 2RS8A 1VIOA 3QFWA 1WTHD 3OPKA 5CZVA 4ZCIA 2W4CA 2LKZA 4FF4A 2LECA 2CDQA 2W2PP 4R5PB 3FKSA 1RT7A 3NXZA 3CCUB 3BH6B 4CO3A 4TKTA 4OIOA 2P8IA 1FKOA 2KXHA 2D74A 1GE9A 2XNDA 1LV5A 2ZE2A 3CXCB 4P10A 3NEKA 1LKZA 1B4BA 4QIWL 3QYYA 5DDQC 4TY8A 4RPFA 2BR0A 1M5OC 1S97A 2H1YA 5HATA 1HR0F 1B7FA 3HHDA 3KK1B 2OMOA 3AY0A 2HK2A 1RTDA 1KFSA 1TKZA 4A47A 1UD5A 4DK1A 1HNIB 1T05B 1HBUB 3LVBA 2VQEF 1GR1A 3ZZ0A 3NLCA 2DO0A 3RB3A 2ZHOA 3RTVA 2G4BA 3Q8SB 2RC5A 1SKYB 3N6MA 4GKJF 1VRUB 4F04B 3TQ1A 3BJYA 5GMDA 5G0RB 5IT9Y 3HOYK 4OV1A 3HO1A 5DDOC 1VQKB 1I6VA 3L9ZA 1DBDA 3TAQA 1FXRA 2OSQA 4PXEA 1JLFB 1XMBA 4DX7A 3OZUA 1KTVA 3DLKB 4DCPB 1FXLA 4P7TA 5FLMK 1XMOF 1LWCB 4I2PA 3KG0A 1DCOA 5I4MA 2WZ1A 1O27A 1HWIA 4ZPDA 1FNMA 2FVCA 2IM0A 4B02A 3LO3A 2XZWA 2Z2YB 1Y1VC 3CQZK 3M2VB 3B78A 5C44C 1WOPA 1B23P 3I1FA 2YWKA 4K7QA 1NKEA 2VNKA 3CIMA 3BKFA 4GO5X 1WKKA 2OPPB 1HD1A 5DGBA 4WP8A 3LQEA 3POTB 3DXSX 5AJ3F 4RWWA 4DPOA 1RQ0A 3RG6A 1QAIA 4RD4A 1YITS 3TUIC 5IZHA 4J7CA 1H2UX 1UTAA 2V7TA 3LW5C 3HOWC 4RKUC 1OPIA 4W90B 2FVRA 2V2VA 4QWCA 5BJRA 5JFEA 4N8NA 1QH0A 2RVJA 3BBBA 2QGFB 2F40A 3IXQA 1YJWB 3MOZA 1MMDA 2AU0A 4F67A 1TL4A 2V50A 3RR8A 1TWGC 1SJFA 1GXLA 2L9NA 3GTLK 4NPOA 3PW7A 2OBRA 1X0PA 4QYZK 2RUGA 3QJLA 2E1PA 1OGJA 4DQPA 1OIAA 5IYNA 4EUVA 4C8OA 4TU7A 5HP1A 4DQKA 4PXCA 5J3OA 3BSNA 5CYMA 5J1EB 2V34A 4HH1A 3ZZOA 1N5TA 2HNYB 4N47A 1HARA 1YHQB 4OI3A 4KGKA 2MXYA 4Q4ZA 3AVUA 2KB2A 3OVBA 1RXOB 4JI8J 2DPIA 5HMYA 1KS2A 2VBWA 1Q82D 2W8LA 1VJEA 2VG5A 4CWBA 4M5NA 3DRXA 4YS2A 2HS0A 5FJ8K 2GVZB 4G0UA 2HEKA 1RHQB 5CCMA 4LJMA 2IY5B 3CCLS 4C2MC 2KT2A 1RT5A 3NY0A 1XNRF 3TTGA 1WF1A 4AVZA 2C4UA 3KKFA 3VWSA 4EFAC 3NWGA 4QVAA 4LLGA 2VL1A 2QZ8A 1IR2A 3S1MK 4XR6A 4X4UA 4G6IA 3FQLA 1N6QA 4DV3J 1WPCA 1S72B 3AVVA 4KE5A 3IR5B 1SH2A 3CPWR 4V1Ak 5B6IA 3CMQA 1AA1B 4PKDB 4RD2A 3OVSA 5HLFA 1X4GA 5LMUF 1O24A 1TAQA 2R93C 1KTQA 1CULA 3T53B 1DCHA 1TVRB 3P8BB 1FX0A 4C7QA 2BKNA 2F43A 5L46A 2ZD1A 1FJGJ 4AXIA 4DLEA 5IP7C 4QQBA 2WVFA 3JQPA 1BUXA 2I1LA 3KUGA 4YFNA 3G8TA 4KIAA 2PD1A 4RW4A 4QW9A 4ED6A 1GJRA 1TP7A 4GTCA 1NNDA 2HRYA 1PJ6A 4OOXA 4P2NA 1IUJA 2ZEJA 3EUNA 4OJ1A 5A2QU 3VR6A 1RT1B 1BPLA 4K4UA 3MMBA 1W0JA 6FDRA 1TKTA 1U47A 3ZO7A 1U0HA 4YY3J 1S0NA 2ZHBA 5CD4H 1CQNA 2XYHB 4A3JK 1NKCA 4DV6F 3VO1A 1NSAA 2ZH6A 2NVYC 2VG5B 3H7HB 4OJ3A 1FWLA 3DM2A 3G82A 1WUUA 2QLBB 3MMAB 5GVQA 2JDJA 2A6MA 5F41A 3HHLB 2LMIA 4I68A 4CH0S 2C2EA 4LF7J 3T6BA 1TWFC 1SKRA 2D9RA 2E7XA 1TFYA 2AD9A 2HHTA 3AH5A 5F8HA 2DCUA 2P5MA 1FK9A 1WDTA 2C77A 4X4SA 1G1XA 3MEEB 1ZXOA 3TI0A 3Q22A 1VJQA 4XPEA 4X4TA 3RB4A 1OY8A 4G1QA 3PIPQ 3CULA 3UNGC 3GTLA 2RILA 1N05A 1NM2A 4RW8A 3HJVA 1RYSA 3HDSA 1YBTA 3ILIA 3UE2A 4G7XA 2DGVA 2DHSA 4ZKAA 4FS2A 1HNXJ 2YKAA 5A2QY 2RF2B 4YUDA 1IR1A 4AF6A 4HYKA 3Q8UA 3MPWA 2C3PA 2LXUA 5L1JA 4Z4ZA 4H4MB 2CW5A 1YLOA 3KYLA 3BY2A 2DNRA 2YNGB 2Y8WA 4RDJA 5AXLA 4A3FK 3M2UB 1IKYB 5IYCC 3BYPA 1RE1B 5TV2A 4KGXB 4OYOA 1G7TA 4CYUB 3GEHA 5A8AA 1BHNA 3QFTA 3DGPA 4DFMA 1X31C 3S17K 2BE7D 4EZ9A 1KLMA 2NYHA 1CJTA 2HFZA 1JOEA 2EFVA 1Y7PA 1DQ8A 2NCKL 1G3OA 1OPZA 1KK0A 2HZCA 3BC9A 3HHKA 1HYSB 3BZQA 3H5SA 3KK2B 3VF0B 1V0EA 1MROB 2J7WA 4IFVA 1RWXB 4WYWA 3GG0A 5CD4A 5JXSA 3J81U 3KDOA 4CNZA 2ALZA 3KHGA 1MNEA 2JA6C 3QT6A 4RCYA 4NL5A 1J27A 5L39A 1B0TA 5HQLA 1HNVB 4BCAA 3N3YA 3AD8C 4KKUA 1FKAF 2W4DA 3FC9A 2JVRA 5K8OA 1X9MA 4ETXA 2PIIA 2V4JA 3MEKA 2MTLA 1BQXA 2OD4A 1JLEA 1SXLA 2OAUA 4ER8A 2E44A 3CT9A 2AYGA 4YAUA 2O5DA 3UN5A 4I6WA 5KG5A 1RAFB 4YEJA 4QWDA 1RCXB 3HXAA 2BMWA 2PA8D 3CPXA 1S10A 1KZLA 1I5OB 2QIFA 2OTLS 1NKBA 2A69A 4JI8F 2VKRA 3R5BA 4J9MA 2FY8A 3KLEA 2QSFA 3QWPA 1HD0A 4J9UE 1S6QA 2HFOA 1RAOA 3GJTB 4R25A 1I3OB 3GFXA 4U7UK 5F4JA 4MK7A 2CWXA 2IAJA 3KHLA 3GTGK 3FGVA 1M1GA 1XXBA 2UUTA 1HWJA 4L74A 1ACMB 1K0VA 4Q45A 2PPBA 4DUZJ 2QEXS 2B4VA 2CK3A 2DCLA 3J81Y 5F8GA 1O5JA 5LSLA 1Q82T 4JI5J 3BR8A 5ETVA 3PO2C 2AYMA 1HKAA 4A8FA 4ECSA 3NNAA 1PC4A 2Y0BB 1RT3B 1IBMJ 4PG7A 1TK5A 1NSPA 2ZZQA 2M0GB 3RJMB 1F6TA 3CNQP 3LTOA 4DV3F 3D2WA 5IC4B 2XNCA 2V9WA 4YFUA 2JC1A 3DYAB 3TW0A 4XSZA 2J0XA 2FC8A 4R0JA 4O0IA 1XQBA 4KHMA 3BUEA 1UCNA 3FJOA 3TARA 4BS2A 3GWCA 4DX6A 2Q6CA 3OUYB 4EBDA 2HBQB 5I42A 3S16C 2OEJA 3ITHA 2RUSA 2CQHA 1FJGF 3LAKA 3AQPA 3CE8A 4NCGA 1HQUA 1ZVUA 4KPCA 1NRKA 5KT6A 1Q4RA 4RNOA 5A8RB 2C2DA 2OBSA 2JFKA 2JEGA 3AAWB 2V6TA 2PLFA 1D1NA 4ILMA 1HWLA 4GTLA 2XZDB 4DS4A 3VO2A 2WBRA 1SI9A 3GTMK 2DNLA 4NA3A 2DH9A 3C19A 2LQJA 5D77A 4ZPVR 3D3CJ 2IDEA 4YY3F 3RBXA 4ICLB 3B6BA 4GTBA 2UUBJ 3HHEA 5ETPA 3V4IA 4PPDA 5HBMA 4X4PA 2YTCA 3V6KA 4WFXA 2X3GA 1R43A 2HQIA 2W2QP 4NXMJ 1HW9A 2W2OP 3N5BA 3QPIA 3KMQA 5IYDK 4Q0BB 1DURA 3MCOA 2R2UA 3J81k 1OO0B 4KBIA 2HQFA 2JC0A 4I6YA 2PMZD 1LXJA 4LF7F 1VQMB 4LFCJ 5E3RA 4Z4YA 3G4SS 3TANA 2E2IK 5EMNA 2O67A 5JJBA 3KLHA 2EBEA 3WQZA 1YBAA 3Q83A 2XMAA 3BKTA 1XTZA 2AX1A 1IKVB 1AB4A 3K0JA 2CNNB 4GKKJ 3IWXA 3QGIA 4A8MP 4LIWA 3TA2A 3G86A 2I5JA 3QAUA 4I7FB 4DLGA 1Q53A 1J5OB 2QLXA 4DDFA 3OTOJ 5IYWA 3PRDA 1WELA 3IS9B 2CJ9A 1HNXF 4MYUA 4Z37A 1UKUA 4P12A 3CC7S 3RB6A 1G7CA 3DRSB 3HCXA 1K1QA 5ETKA 5EUHA 4TKOB 1FVQA 4H54A 4RBUA 4J91A 2OYNA 3SDEB 4Q43A 4K1XA 1IKXA 3GVJA 4QVJA 2AHOB 1VRQC 1FX2A 3HK2A 5FA6A 4RW7A 1TFWA 2UVWA 2BE2B 4KV8A 1Q8KA 2HPUA 4A3IC 3KOAA 2NZ4A 4L76A 1VQ9B 1L3UA 1XXCA 1RT2A 2VFRA 1NCLA 3A8IA 3WBZA 4P5BA 3P5TL 5E0OA 3G6YA 3BGFA 2K3KA 3EQLA 1RAHB 4AYBL 2L41A 1ZTWA 3DXJA 2I38A 3QX3A 4ZVEA 2HFNA 4UTGA 3RUBL 3CC2S 2G1HA 4ZDNA 1UA1A 1OHHA 2ZNZA 3NNHA 4C6AA 2VUMC 2NVQK 2GHWA 2R8GA 4LF6F 4U8VA 2W9BB 4WFNQ 4E0DA 3I56S 3VALA 2YKQA 3HM9A 3TZWA 5HMWA 3W1YC 5CXTA 3AH6A 2JA7A 3DGVA 5AE1A 2AKWB 3PFOA 3BS9A 2R7OA 3DOKA 3H3VD 1JXVA 1VQ7S 1URRA 4IUFA 5IOSA 3HT3A 4A4JA 3TAMA 1J5EF 2KJWA 2IC3A 3ADAC 1JLAB 3MM6B 4GC7A 1FFWB 3W60A 3VNUA 5TRDA 3OEEA 2OBTA 1T9XA 2UZAA 2YH0A 1SQEA 1BQEA 2LQBA 4OI6A 2V7UA 2QTZA 2MZJA 4J3NA 2NPFA 1CNEA 3CEDA 3ELHA 1BGXT 1FJ7A 1NBMA 5GAGI 5KG7A 2DERA 3BV8A 4OX8A 1EHWA 2NVTC 1DARA 3CCRS 1TLLA 2R42A 2VFTA 5U47A 2HIQA 3G8QA 4PPZA 1LW2B 2JJ1A 1RWNB 4NLPA 1UFKA 2B4UA 3ONYA 4O4RA 4ED0A 2R7TA 1RK8A 4OZ1A 3GTMA 4DV5J 5AXKA 3DLGB 1SMYA 2PC6A 3FBFA 3BPDA 3MWBA 4OYIA 1C1CA 4DUYJ 3FZ2A 2U1AA 1XWLA 1F3FA 3FPPA 5HAOA 3NNCA 2D9PA 1YBUA 2F5GA 2R7ZK 4JI5F 2VG6A 4A3EK 1J98A 1BQNB 3IG1B 1IBMF 1W2IA 3OHBA 4YELA 1T94A 1F7UA 1RAGB 2MKCA 5A0YA 4WU2A 2XNJA 5K5MA 3QWUA 1QUVA 1KR4A 4L3NA 4TU8A 3X3UA 1UEKA 1QVFR 4A3GK 1N07A 2FHKA 3HKWA 3LP2A 1U6BA 3DU6A 3K57A 5EX3A 3PXGa 3FZBA 4HKQA 3WC0A 1IQ0A 4M5LA 2DT9A 3E3XA 4OYAA 4L73A 2AW0A 2BJEA 2FYXA 4DR5J 3SMZA 3OFFA 1DTTA 4NEYA 4XOTA 3ERED 4YEAA 3MPVA 3DLBA 3I4NK 1U2RA 3T41A 5MAOA 5HANA 3EYZA 1R6YA 4LSNA 1DZ5A 4R0EA 1U7LA 4Y9UA 1TWAC 4DF8A 3QE2A 3NE5B 3CDBA 2L3MA 2XOKA 1JQWA 1D9FA 1FI4A 2L48A 4WTYA 1RACB 1JNRB 4Y3CA 3GTKA 1NEEA 5CH7B 4E0FA 4IYQA 1TV6A 4FVMA 4XORA 3CJ4A 4PCQA 2UUBF 5C4XK 3DDNA 1H7XA 4DCOB 1T03A 1X4BA 2ZC4A 3AXMA 4YQWA 2FLLA 1NHKL 1BJKA 3KLGB 4NXMF 2GQQA 1OYDA 1HQEB 2YH1A 4LMZA 2C2OB 3RBDA 1MMNA 3HX9A 3VZIA 1KK2A 3GIIA 4J9NA 4ZCKA 2XSJB 1SIWB 3FNNA 3PDNA 2UUAJ 4Y7NK 3CTAA 3OR1A 1YNJA 2VKZG 1CVJA 1I1GA 1K73D 2GQCA 4CQJA 3OV7A 5KFKA 5ETOA 3N6LA 1RHMB 5TJ3A 5IFMA 5F9LA 4D3GA 1KC8D 4LBYA 1YSJA 5J2NB 4X62J 2VBTA 3RZOK 2R92C 2DNOA 4DR7J 3FSIA 3HOUK 1N06A 3VGTA 4NXNJ 1E1RA 1VI7A 5LXRA 1VS3A 2UXCJ 2GQFA 3UN2A 3OTOF 1SJ1A 3SQGB 2FIUA 4GVLA 2A2CA 3TEGA 2J9EA 2J9CA 3JYTA 2GVDA 1C0TA 1QUPA 4M5GA 5DG8A 2P2CB 2PEHA 3A3PB 4RPDA 4ZVTB 3W5UA 3DFEA 1D2EA 4E8UA 2GMHA 3K7AK 1RCOB 2E5GA 3J81j 3OFEA 4F50A 3GP9A 1G7SA 1TR0A 1H2TZ 2VFVA 2B7BB 4HIZA 3JAMU 3S14C 3JSBA 2HNZA 2VG7A 3HOXC 2CAJA 4OI4A 3AQOA 2EKNA 5DGAA 1TAUA 1ISEA 2R7ZA 4DG1A 2KRRA 1EP1B 2G1DA 2VBZA 4IFYB 2OK8A 2CF4A 3SFUA 1O25A 4PWDB 3DRPA 3K5LA 4C3LA 3V5RA 1OB5A 3BGRA 4ZVPB 3AGQA 2M9KA 1KHWA 2GMJA 5GAEI 4EWTA 2NQPA 1T9VA 5DQIA 1VQ6S 2D3UA 4O3QA 2AX0A 2BBEA 1D8YA 5C42B 2N4CA 4DR1J 2DGXA 4LRBA 3IRXB 3ZNJ1 4ECYA 2F3JA 5E5NA 4DSKA 4LRAA 1NZ8A 1RA7A 2DRDA 2KHCA 3PW0A 3LP0B 3GTQC 2HS3A 2D3NA 2D3ZA 1KJZA 4K4SA 2RS2A 1TWHA 2ZBIA 2HFSA 3KLFB 2FLNA 1F5BA 5E41A 5L1LA 1WQHA 1B3TA 2K06A 4P25A 2FLPA 3PX4A 2UU9J 3S1RC 3MHYA 3UDLA 3SEOA 1RT4B 4ECTA 2BANA 4MAKA 4KPYA 2DISA 2HBZB 1S9EA 3PJXA 2KFZA 3MCNA 4QPTA 5J2MB 3CAGA 4URQU 2YU9C 4K0KJ 2VYQA 1SPBP 4Y0FA 3C16A 1UWAA 4DUYF 2V7XA 4C8LA 1AT1B 1WC4A 3MPYA 4L8JA 3PR5B 3I32A 2EG2A 2JLFA 1JXLA 3K5MA 5C44K 2K8GA 2FY1A 2Q6BA 3Q6QA 3A3GA 2LFVA 2DR9A 4G7ZA 4EYIB 4G1VA 3AOCA 4TMWA 3OR2B 2XY5A 3PA1A 4C3MA 1DFDA 4ED3A 4MFBA 3F0NA 2M8HA 2B51A 3N9UC 1OB2A 1ULRA 4MIAA 1I50A 3HOWK 3MR2A 2XY7A 4NLVA 3OOCA 3R6GB 3VGUA 2KG1A 3ZTQA 3LOUA 2OFGX 1BDFA 4DR5F 3CJSA 3D6FB 1JLCA 1TWGK 2SXLA 1AFJA 3BPSP 2U2FA 1KVIA 4JI1J 3ZZPA 4G1IA 2HVHA 2ZTGA 1PYTA 3M8QA 1UJ4A 2YNFB 4PABA 2IPOB 3SQOP 2YWHA 2QN6A 3FDSA 2CKWA 4DL0C 2C28A 2YWFA 4TYAA 3B4DA 4C8NA 3FSYA 3GZ7A 2FVGA 1VJSA 1DCPA 2IVYA 3PCOB 3CESA 5IOTA 4WIIA 1R0AA 2C4TA 2K7JA 1IBLF 1MSWD 2RDIA 5LJ3Y 3EZ5A 1LFWA 4H4OA 4OZJA 4BXXC 1SJ4P 5DDPC 2DGSA 3Q2SC 1OGIA 2GJPA 4CLFA 2NSCA 3TUJC 1Z4UA 5H9FK 1AXQA 4AC9A 4CLZA 4WFBQ 5KFBA 4WWSA 4C2MK 1N5VA 2RIJA 2OO4A 4OHYA 5EX0A 1FDBA 1S1TB 3VZHA 3AB4B 4O44A 2CNDA 2YPZA 5E3AA 3AA9A 1FKPA 1R5BA 2RH6A 1JA1A 4GQNA 2VASA 2BUNA 5B0FA 3VQSA 1N5YB 4LR2A 2J9DE 4MIWA 4DR7F 3L4JA 4UZCA 4KN4A 3T3FA 1W87A 3ZC4A 3T1YJ 5GADI 1DG1G 1AZSB 1K73T 1SV5B 3TP2A 4FF1A 2KZMA 3P5BP 1RLCL 1WHVA 3QFSA 1Q86D 3S1QC 2R93K 1LK5A 1KC8T 5HN0A 4KB2A 2OPQA 1U24A 4X7CA 1H98A 3CCTA 5IP7K 3OW2R 4IH5A 2UVRA 5B08A 5EGHA 2W1BA 1IKWB 4NLSA 2DETA 2VPXB 3TVKA 5BR8J 4LVNP 2ZXIA 2ILZA 1RWKB 2IM3A 4M5JA 5TMCA 2FLOA 3D1QA 4IRKA 1R27B 1J6WA 2MSTA 4Y2AA 2DGTA 4B3GA 2V67A 2W6IA 3LQ6A 4KC5A 2GJFA 3TZZA 2PDAA 3ET6B 2XS7A 2HNDA 1Y00A 3NMRA 1BMQB 1M5HA 1EJ7L 1T6ZA 4W92B 2HGLA 1NDKA 3E01A 1N88A 1N4LA 1N0UA 1WC0A 2DXEA 4YAFA 1MWYA 2OELA 3W2WB 4KY3A 1Y1VA 4OI0A 3RBEA 1XE1A 2XZPA 5FDLB 5C25A 4X0CA 5B09A 5J1NA 3BP8C 4JI2J 5I3QA 4CLSA 4AT1B 2V0NA 1VQNS 2B5JB 5KFGA 2P9CA 2BGIA 4F0HA 4O3NA 3MM7B 1TWFK 1RU2A 3RAMA 3V4GA 5KFRA 4K5RA 4LF9J 5IC6B 3R5AA 1YRXA 4RD3A 3I55B 4NLRA 5K14B 3KMSA 3CCWA 3ENWA 5HVHA 2X6WA 1EQMA 3QO9B 1K9MT 3AOAA 2CQ3A 2ZOGA 1TWGA 5F3TA 3G9CA 2KWAA 4ZLNA 1K8AD 3TJAA 3V76A 1TL3A 2HBRB 3EGNA 5E7OB 1C0UA 4LF5J 1EXMA 2GSNA 3HVTB 3S0XA 3A3BA 5HXBA 1CJKB 1JLGB 2CJXB 3C3LA 4P22A 3EGVA 1ZS6A 5KFSA 2QC3A 1T3OA 2VICA 4AXJA 3ASQA 3VAIA 1UWBB 1HLWA 1Q7YD 1IBKF 5IYCK 1NK4A 4MTPA 2X1BA 2XZLA 4ECWA 2JA5A 2ZFZA 4PAAA 1QE1B 3DRRB 2RHQB 4OYWA 1MWQA 2ZM6J 2C42A 3A8EA 4DL2A 3FEXB 3OTEA 4XO0A 4CO2A 1REVB 2W7PA 2MGZB 3C46A 1YIJS 3MI7X 4PC7A 3FBCA 2WVCA 3OZWA 4XKVA 2BVNA 1H8HA 3L4BC 1LW0B 4Y52C 2HCJB 3M8YA 4RW6B 3ZPNA 2XY6A 4X4VA 4J9KA 2R7QA 3FSXA 4RNFA 4RO0A 2JIZA 1XZQB 5H9FJ 4ACAA 2VNIA 3SJPA 4IR9A 4JI0J 3QRRA 4DX8H 1TK8A 2JA6K 2ZVIA 4NE9C 4DL6A 2V8PA 4QU7A 5CCLA 2YNHA 3ISXA 1H73A 5IYRA 3N0CA 2OEKA 4X6AC 2MLYA 2IYGA 3MM9A 3HLUA 4JI1F 4B48A 4AD6A 2DIEA 3OKXA 3U7JA 4YXWA 1AFIA 4XKWA 3UR3C 4FM9A 3CD0A 2QLFB 5JUMA 4X06A 4P74A 1JA0A 1UVMA 1VC6A 4DS5A 1RA6A 3LGMA 2EK1A 2ZC3A 1T02A 2P6SA 1V6HA 2XYGB 1VISA 2WONA 3G6ES 1KWMA 4W98A 4XOPA 3CB4A 4DV1F 1HVXA 3M8PA 4X4RA 2VPZB 1UMJA 2E2HA 4O3PA 1YI2B 4WTOB 2LXIA 5GAHU 1KK1A 1LWEA 4IKAA 3GSDA 1V0FA 1FHTA 1T0TV 4K2JA 3LALA 4TMTA 4NMXA 1XPPA 4HHUA 3MECA 1HHQA 4LT6A 4YALA 4DK0A 2BACA 1LK7A 4ZP8A 2B9WA 2NVYA 3MD3A 5DM7Q 2BF4A 3C6UA 3PO2K 5J2PB 4UF4A 1XERA 3CD6S 3CC4B 3OL8A 3IR7B 1QAJA 3AVTA 2QGGA 3KJFB 5HROA 1TWFA 3MUTP 2GK7A 3O8WA 4ILRA 4DZ6A 3T1YF 2OPSA 3C15A 1E62A 1Z2ZA 2O66A 3NGKA 3BO2A 4WZTA 5THXA 1SH0A 2DO4A 4Z7CA 2E2JC 3S16K 3DOLA 2V4QA 4LFAJ 2HWIA 5G4DA 1U8WA 2W6JA 1D1UA 2GMLA 1Y1WA 1GFWB 1X5SA 3HVWA 3P96A 3PO3C 5BR8F 5KFDA 1Y0RA 4QYRA 3W8PA 4MKYA 3ZBUA 2VJUA 2RQMA 1JK9B 4DFJA 1EWYA 3KG1A 2W7VA 1UD3A 4ED5A 1C1BA 2M52A 3LQVA 3ASPA 2O5JA 1KD1D 2V8DA 2HURA 4B3SJ 4X05A 4L75A 3GCXP 1USOA 3E1YE 1A0OB 1JKHB 5DDRC 2DYIA 4K2XA 3UCUP 4ZVOB 2DHHA 3HD2A 2DEJA 1P4MA 5A8WA 5T7LA 1XQIA 2DYAA 4RUAA 3E2EA 1O26A 1K47A 1WHWA 5IK2A 5IT4A 2UVUA 2WW8A 2CPFA 3KHHA 2PMWA 4JI2F 1SJRA 4A93C 1KQ4A 3G6XA 3G71S 1E6YB 3M30B 1H2VZ 2I9SA 1MLAA 1KMHA 4ED1A 3M8SA 3GTOC 3UD4P 4CLUA 2X8KA 4XM3A 3IAM9 3CUNA 4DR2J 4WKYA 2OUGA 3THTA 1HBNB 4B3OA 4XLNA 5D4OA 1ZZNA 2V31A 4WK3A 1NJZA 1ROFA 2DB1A 3K5NA 2J0WA 1XXAA 1E43A 2GIFA 5T41A 4TSFA 1D09B 4DN0A 3D0HE 3MR5A 1JWWA 1S1VB 4NASA 2PEBA 3DLEB 4USKA 4PWWA 2B6AB 4RU2A 3D6HB 1GH8A 1MMLA 3FPKA 2A18A 4ZLJA 4YFXA 1WACA 2LYVA 4UT4A 4TVAB 5B0AA 1JLBB 2DNNA 5IM0B 5L38A 2MZSA 3CCMS 2VZLA 2DHXA 3N5FA 3EPIA 1KQGB 4M5DA 4IDKA 1UJ5A 3BCDA 1X60A 1U25A 2XGQA 2AF6A 4A3IK 4IRCA 2WSEC 4J9VA 2ZM6F 1TL1B 3R8YA 1YJNS 5DS0A 1YK9A 1OY9A 3H25A 2OPRB 3HSDA 1Q7YT 2JA7C 3LO8A 3M05A 1V5VA 2HWHA 3J7A1 3CTRA 2M5SA 1KDNA 2Y0SL 1JLQA 3GV5B 3DU5A 3EM1A 1DLOB 2VUMK 4XMYA 1VBZA 4BC7A 4C8ZA 3IFEA 4P9SA 5D15A 2EEYA 3QT8A 2IMOA 5DN6A 1M5KC 3AA8A 3I4HX 4JI0F 3NWRA 2J6UA 1VLYA 1RAEB 3MCSA 1S12A 1VQLS 4Z1MA 3VAMA 1TWCA 4J9QA 3GE9A 5KFUA 3CC4S 4KATA 3Q89A 3NGSA 4RPBA 3CCVB 3MCMA 4ECQA 2HAFA 1S0MA 2Y1IA 2JDIA 3EZOA 5B0CA 3KUEA 1VMBA 4X2BA 4Y00A 1M5VC 2ZBRA 3DKDA 4KKOB 3SFGA 4JI6J 2BOPA 2MZQA 1WQGA 2C3OA 3KJVB 4EH1A 4EYHB 4DI6A 4NRUA 3IA0A 3MTJA 1IJEA 3FKBA 4PC2A 1BY9A 2F4FA 2NVTK 1PO6A 2QJ3A 3U1LA 1IHMA 2F9DA 1M0SA 4P6QA 4CTAB 1P9QC 1D0EA 1REGX 2GGPA 4UY8T 2UUCF 4P1VA 3SCLE 1HW8A 2AEMA 5HZBA 5L1KA 2PO4A 4NMLA 1HPZB 1DRZA 2E1AA 3NGDA 4URSA 5I3UA 4GC6A 4A3LC 3FFIA 3M2RB 4K4WA 4LBIA 3M1VA 2EXUA 3C14B 3EPGA 5ETLA 4LF4F 1JJCB 3MEDA 5HI7A 2KM8B 4Q2MA 3PKMA 3WXMA 4QIGA 4TY9A 1YG0A 2FQTA 5F0UA 1YLXA 3IGVA 1VQ4S 2G9OA 3V6DA 1NJID 4KO0A 3CCJB 1Q16B 3GTPA 4QR2A 2FB0A 1TUVA 3OLBA 4ZHRA 3ONUA 4OHVA 4DU8A 4FVCA 1EK8A 4OX9J 3HMJG 1T9UA 3MM5B 4IG0B 5EWFA 1PKUA 2Z57B 5B0BA 1S1WB 2Y8YA 4K4XA 1WEZA 2XMTA 4KFBB 4B9SA 2CFXA 5A8KB 4ANDA 1C4CA 4HI2A 4LSLB 3OVAA 4FNIA 3TNVA 4WF9Q 2KVOA 3VAKA 2RU3A 2WZNA 1YRUA 4KKTA 4LFAF 4BKWA 3SKBA 1O2AA 4DF4A 3GTKC 3BCFA 1VDHA 4YB6A 2A6HA 5M3MK 1R5NA 4KQZA 2KG0A 4GZYA 2XMMA 2XNRA 1WDDA 4C48A 2CA9A 2HVDA 2G0JA 2DHGA 2O1PA 2MZRA 1TWAK 2Z58B 2ZJRQ 4ZMMA 4TLQA 2VONA 3GIRA 3L3CA 2YNIB 4G0VA 4M53A 4LF1A 1UVJA 2B56A 4BDPA 3VVUA 2JSXA 2L9WA 2GHVC 5IYQA 2OEMA 3IM9A 2A0FB 2LVWA 2H3EB 2JH3A 3Q3QA 1APSA 3HF5A 2XCQA 2VBYA 2NXCA 4B3SF 4B9MA 1SC6A 3FEZA 1RGVA 4PQUA 3I82A 3IGNA 1PAEX 1R8CA 1EFTA 3D6TB 4OHWA 2FZGB 4YDDB 2C5BA 3CJQA 1QLNA 1YX2A 3MR6A 1M5PC 1WQFA 1KD1T 1NB7A 4EZ6A 3MCAA 1QSSA 2QMXA 1T9TA 4OPSA 2WAQL 1Y10A 4NBSA 1RAAB 4DEZA 3VCDA 3RBZA 3DMJA 4HHHA 1VRTA 2BM0A 4YFKA 1QTNB 4DR2F 4L72B 3CMES 1JMTA 4XDDA 1KOHA 1O0PA 3H98A 4RDKA 1EKSA 2NYIA 4GFQA 1VQ5B 1T95A 2QDXA 2R92K 1VQOB 7FDRA 2QMUB 4ECVA 5A6PA 2HFUA 1XZPB 3GIKA 2Y3YA 2HRUA 2ADCA 3T6JA 1HBMB 1T3NA 2YX1A 4XLFA 4Y2MA 3IN5A 4LK0A 1NU4A 5D0EA 2RB7A 4YP3A 2VBXA 3T9NA 3FKIA 2ZKTA 2Q6OA 2XZOA 3ZIAA 3HOZC 3HXMA 1WHYA 1I6HC 2OH2A 4CZCA 5H9EK 2CQ0A 2ZH9A 4Y2IA 1N08A 4PC6A 4BLAA 2QV6A 4OYBA 2QLWA 3I31A 2ZL6A 2NR0A 4BY7K 1RI7A 2J8SA 3A35A 5LMZA 1SC1B 1M90T 3S14K 3I96A 1I51B 3HOXK 4XQFA 1Q5VA 2QL5B 1NXIA 2J0QD 1FRQA 2D1CA 3R7NB 1HBOB 4MEXA 2YPYA 1DD5A 1SJQA 1SB6A 1NK6A 1TL7B 2N3OA 3FEYB 2HQCA 5LSOA 1NPRA 3SSSA 3M32B 4KJIA 3LANA 3WIVA 3ES9A 3W2IA 2ACMA 4GTDA 4CLYA 4UOFA 5H5JA 2WK4A 4F4AA 2BJ1A 1IE0A 4ZVQB 2ZOMA 3EGZA 3CCJS 5D4NA 4DQLA 1TWHC 2JEIA 5HMZA 1BJTA 3DI6B 3BH4A 3ZTSA 1EP4B 2ZZNA 1LWFB 2DD8S 1HWUA 1RU0A 2V69A 3CMAB 2VC0A 3VVTA 2QLJB 2UP1A 3SLDA 3H9NA 4JI6F 1B0VA 4IG3B 3MAAA 3GTQK 2PFFB 5M2RA 1EFWA 4Y65A 4TU9A 3T01A 2VDHA 4KGZB 1RWMB 4KTQA 3NS7B 4DV7J 2H5EA 3IP0A 4PZVA 3PKYA 2OK7A 4M4SA 2JHEA 4X4NA 3S1RK 2HMIB 1EKRA 1F2HA 1S0UA 1SFOC 4UOHA 2JEJA 2MYFA 2BJ3A 4R5PA 1ELOA 2ADBA 2ZNYA 3PV8A 2YU9K 2Z2MA 1MABA 4QFMA 1W7WA 4KAIA 1HFEL 3T02A 4Q7JB 1I8DA 3D1OA 4WJBA 4OL8A 1WHXA 2AEJA 4QOTA 3OFNA 2LQ8A 4KHPF 3KK1A 1COWA 1I50C 2C2RA 3K8WA 1Q9SA 1HNIA 1T05A 1S6PB 2CQDA 1HBUA 1WF2A 3UN3A 1T9YA 2XB2D 9ATCB 3UVJB 3NG8A 4OX9F 4ELTA 3PUNA 1NB9A 3RRHA 4IO1A 2N3LA 1VRUA 4DCJB 4YB5A 4QIEA 3LPEA 3TWZA 1NJYA 5G0RA 4IQXA 4ANEA 5IYBC 4ELVA 4B43A 5KFAA 1NJIT 1UV7A 3PR4A 1LXNA 3SLNA 5JBQA 3R2DJ 5KFMA 4KMUA 5EHHA 1RHRB 5DG9A 4HTIA 3WNCA 1JLFA 2V6SA 1Y11A 3H4BA 2YWGA 2ZUGA 3D0GE 3DLKA 4C3IC 3OAAA 4L6V3 4USWA 3O6QA 1LWCA 1FNXH 2AJQA 2YKOA 2BQUA 2WPDA 1NHUA 4Y34A 3SV3A 1OY6A 4C8MA 3BEGB 1QGZA 4F2SA 2DR6A 3P49B 1KP6A 2I1RA 3LNNA 1X0FA 5HJYA 3G4AA 4C11B 3OE7A 1NMEB 4KKSA 3M2VA 5IT9U 1B99A 3K5OA 4HH0A 5AXNA 3R7SB 3I0RB 3PFEA 5GV7A 1WWHA 2LU1A 1WTBA 2ZZGA 1DJ0A 2QSWA 1H74A 1DY3A 1JVIA 3CW2C 2OPPA 4B3TJ 2IMWP 3GVKA 3POTA 4FXUA 1N54B 2XYPB 2B4OA 3KLIB 2D3LA 4YHBA 2IJFA 1OB0A 4C98A 1F9HA 4KB7A 4LBZA 1V3ZA 4NZ0A 3RU0A 3QAEA 5H9EJ 1RKIA 4BXXK 2CPJA 5F8LA 1NO8A 2PT0A 3TZYA 4ZOSA 3NOGA 2ABYA 1FD2A 4RM0A 4GMKA 3CCQS 3OTBA 4DWIA 1RTIB 1XNQJ 5DRKA 2RMLA 1JJ2R 4WCEQ 5H1SV 4LF2A 1RHUB 5J1EA 5EWEA 3F73A 1SBRA 3T1AA 3GU0A 1OSCA 2CFAB 3GTYX 2HNYA 1R0CB 1T7PA 1NPKA 4DNRB 2WZPP 2OTJB 2ZH7A 1U26A 1Y3KA 2ZWOA 5D0RA 4Z4SA 3ZZTA 4G0WA 4OIPA 3S1QK 2IDLA 2BV3A 2WBMA 3CJ2A 3P45B 2XLJA 2DKOB 1QUFA 3P3DA 3GTQA 1NDHA 1PILA 1IQTA 2GVZA 3CMAS 1HL6A 1VHFA 1KQKA 1RZMA 3GR1A 2R7VA 3BKUA 3PEHA 1I6JA 4M1KA 3KJNB 4B9NA 3QSIA 4FXWA 2E66A 2EIXA 4DR4J 5KT3A 1RUSA 4KH0B 4K59A 2IRXA 1RP5A 4USIA 1O2FB 3QZ7A 3CDUA 1UFLA 4R8UB 1K83A 1XR6A 3OTDA 1ZAVA 1IB0A 3H2VE 3MAHA 4X64F 2MLZA 2YU9A 1VBYA 2P9GA 1U8SA 4C3JC 3HSZA 2VDIA 4EK2A 3M4OC 4ZPWR 4P75A 5SUHA 3NGRA 4RWXA 2BJ9A 1ZA1B 3VAFA 1E79A 4A3BC 1CQMA 4YG2A 2BQ3A 3CCES 4TMVA 1Z1ZA 1TVRA 5HKKA 1RU1A 2JEFA 4P7VA 1S9GB 4P52A 1XIQA 4RUCA 5D3GB 1O2BA 1BQMB 2ZUEA 5JVOA 2YQ0A 3ENAA 3A3OB 1SL2A 3MDFA 3SSQA 1EB0A 4B3MJ 1NH8A 1QFZA 1BXNA 2LDYA 4A3JC 3CCSS 4Z7YA 3TO8A 1RT1A 4UOGA 2W25A 4RBTA 2CVIA 5ADZA 3ZZYA 3CVKA 1VC5A 2LEBA 4LUBA 1N8RT 4O23A 4WQMA 1O6XA 2DNHA 2JFDA 3BNWA 3VQTA 4DV7F 2JA5C 1E3XA 1TKXB 4X66J 2V5HG 1VK3A 1NJWA 1P6TA 4RMFA 5FLXU 1S1XB 2GA7A 1FDAA 1Q5YA 4I1TA 1WC3A 2RKIB 3QGPA 5I3PA 1L0WA 3SV4A 3OPOA 3MMAA 2D41A 2MHNA 5IYPA 2EC2A 4XAKA 3AFGA 4HACB 3HHLA 1IBAA 2DGOA 2YX4A 1SC4B 4KM8A 2UXDJ 2G13A 1YWXA 2Z8QA 2PMHA 2W24A 5ETTA 1RTJB 1VQPB 1Q78A 4CM0A 2DNKA 4ENOA 3MEEA 3W64A 1MU2B 1U1PA 5IWAJ 4JOUA 1SKWA 2F9JA 1RYRA 4NCNA 5IXUA 1FNBA 1FXDA 5C2CA 3PYGA 5D6GA 4Y52K 1EETB 1LNQA 4ECXA 1R8HA 4WKRA 3LA0A 2B5OA 2R6HA 1GAQA 1YKWA 2NVXA 2Z2ZA 3EGWB 3QJPA 5D78A 1NUEA 3CCUS 2YQ1A 1EP2B 2RF2A 1P9YA 3LAMA 4NYZA 2KFYA 1TELA 4PYDA 3WBKA 3ASSA 4ZA1A 2AQ4A 4DSIA 3QNWB 1B4SA 2KZZA 1I94J 4H4MA 5THWA 1FE0A 3E20A 4IR1A 2YNGA 1MG7A 3OD2A 3M2UA 4G6VB 1IKYA 4X6AK 3Q8RB 2QA1A 5IOLA 4ZVFA 2GC8A 2DNYA 4G65A 5FLXY 4CYUA 6FD1A 3NP5A 5DJBA 5C7PA 3A12A 3BDEA 3M3YC 4F0KA 4DL5A 2WRMA 2E2HC 2MMYA 1Q79A 2DVIA 3JQMA 2RU9A 1VQKS 4B3TF 5F8MA 4OHZA 3QT7A 1FERA 1HYSA 8AT1B 1NH7A 3KK2A 3BH7B 1KBRA 1MROA 4UZFA 4DV4J 1YJ9B 2GFFA 2HAIA 2ZH1A 2WYRA 1MN9A 1GO2A 3FQKA 3OL7A 1I3QC 4NCBA 4ES3A 2IA6A 2Q6KA 1UZDA 1HNVA 1RT6B 5KFNA 2ZH3A 3CPWB 4P2SA 2AP6A 3L7PA 3MPUB 4O4GB 1U2CA 3BSOA 2HHWA 4S0MA 2CJAA 3OJSA 1XNQF 4XSXA 4MIBA 3H59A 2R7SA 1HIYA 3QGGA 3W7BA 3Q8VA 3ETOA 4ROXA 3THPA 3PZPA 2FJWA 5KFLA 1KHVA 4WE1B 4GTFA 2C3YA 1Y4ZB 2E9RX 3HHLD 5J2QB 4Z4UA 1Y1WC 2KYXA 6AT1B 4LBPA 1YJWS 2AZ3A 3R6JA 2YX7A 3WHIA 3K89A 2N7YA 4LJZA 4A3DC 3SEJA 3FMWA 1KFDA 3CP2A 4KDDA 2H4YB 1W0KA 3W8GA 2YQ3A 2RQ4A 5DM6Q 1D9DA 4OX7A 2H65B 3EXYA 4J9LA 3TUZC 5C24B 4G7HA 2KO1A 3FMBA 2E5IA 1SC3B 1E6VB 4HVZA 4ZCMA 3P27A 4N41A 4NLWA 1U1NA 4J9RA 4JI3J 2AZ1A 3W2EA 5BXIA 3PO3K 2BE9B 1FCAA 4DR4F 1YHQS 1TTHB 5ETQA 3VNVA 1IL2A 1PYSB 3KXDA 3N0VA 2G0IA 1RT3A 1FT8A 3T51B 1WORA 3FRYA 2VA3A 3BYRA 2XI3A 1E64A 4A3MC 2DNQA 3DLLQ 4ETZA 2B7CB 3S15C 5BYSA 2ZITA 2DY9A 1X9WA 1BLUA 2MSSA 3C66A 3DYAA 4ZJQA 1CEZA 2F63A 5C2GA 2RSQA 4OINA 3PX6A 1FO1A 2D3O1 1QSYA 2ALYB 4FBTA 2B63A 3D28A 2HHSA 1NDPA 4CQ1A 4RDLA 4CCHA 3OUYA 4FWTA 3OJUA 5F9NA 4A93K 3CRZA 5B7WA 3OSNA 3F56A 1MWZA 4YB1P 2PHCB 2GSUA 4OOVA 5IT0A 4CH7A 4U95A 2XZTB 3LUYA 1U02A 2IIHA 4B44A 4FYXB 4ZPCA 4A3CK 4ZGQB 2X0KA 1QTMA 2PA8L 1S72S 1IR0A 3J7AN 5KFIA 2WTFA 4B3MF 5A8RA 1R9TA 2ACYA 4I2QB 2HW3A 1OMSA 3NAIA 2BGJA 4ACBA 4RX6A 3A8JA 2P6TA 2CJYB 1IJFB 2BJDA 1CJUB 3H0PA 2DR5A 1BE4A 1FVSA 2MKKA 2R8KA 1PG5B 1INNA 1YZ7A 4ICLA 1FFSB 3NGUA 4A8QA 3TX8A 4OIQA 4N56A 3UO0A 1JB0C 2ERRA 3UDVA 3RY8A 1KRHA 4X66F 1AUSL 2XS5A 1EFCA 3DDKA 5GAGU 4Q0BA 1TVCA 4B17A 2NV4A 2HIYA 2BRKA 3ICLA 4A8WA 2F8HA 2VPYB 4OZNA 1F60B 4E98A 3KK3A 3HOVC 2ZDPA 4JB8B 1RLDA 3UPFA 3J7YI 3ZBTA 3ILOA 3AVYA 1R8PA 4DJBA 2OJ3A 3GYGA 5LXYA 2BJ7A 3MUVP 4OYZA 4PQAA 2JA7K 5IWAF 1IKVA 2PE3A 1VQ8B 2E5JA 4I56A 3J7ZT 4WZLA 4XLAA 2F4NA 5D4LA 4KARA 1S4EA 1FWPA 4MKVA 4I7FA 1ZPWX 1TWCC 3R27A 1KLNA 1J5OA 2ZJQQ 7FD1A 4CH1A 1FDNA 4Y2CA 3IS9A 1X4FA 1UETA 4X07A 5E2QA 3DRSA 4F3QA 5LSRA 4DR3J 4TMXA 4MQ9A 2WSCC 3FBEA 4EO8A 2E5HA 4I69A 1C2PA 1I94F 1PJ7A 4G5GA 4NI2B 1JB9A 3SDEA 4B4DA 1H3DA 2AHOA 3GEEA 4DNTB 2Z30B 1QG0A 2E1CA 2JA8C 4JBCA 2BE2A 3CIZA 3LP1B 3M6XA 3I4MK 1X4CA 2WVDA 1DTQB 3DHXA 4KC6A 2WJYA 1SKUB 2EWHA 4M5MA 2HQDA 5M3FK 3FK4A 3JQRA 4XONA 1UFWA 1NLKL 4PUOB 3N6NA 1NAQA 2IRYA 5IP9C 2HLDA 3JSMB 3VGVA 2MQMA 2RHSB 1J2VA 3HVAA 1ITPA 4EBEA 2CQBA 2W9BA 1S4MA 4DV4F 2PMZL 2AIRB 3NBPB 2ILYA 4LC0A 1QVGR 4OYPA 2NREA 3ASRA 1YDLA 2J7KA 2PIAA 2ASLA 2BA9A 4AUKA 3TFIA 1GNKA 2WR8A 3V81B 2LDIA 3GTPC 1SCJB 3QSYB 4A3LK 3NKYA 3QIPB 5HL7Q 3W2VA 2QYGA 2QA4B 3KK3B 1XMQJ 4YN3B 4DV2J 1FTCA 1R5OA 3TQEA 4Q5SA 1JLAA 3MM6A 1NB2A 1QAYA 2WVBA 2Z6BD 2OSRA 3ZTPA 4Q2LA 3MMCB 1LOUA 3U27A 1D9AA 3U2QA 5C4JC 1AIPA 3GTOA 3T00A 4DU7A 4BY1K 2RRNA 3K8VA 4I0WA 4PGOA 5GV8A 3CCZA 1LW2A 3V7AA 5A89A 3M6WA 3IO1A 4DZDA 2QFJA 1RB0A 3DLGA 4LR8A 1VQSA 2DR8A 2CG4A 3L7OA 2Q66A 3GTKK 4F02A 4RBVA 1X9SA 5KFTA 5GMKa 4P73A 4JI3F 1UEUA 5KFQA 1K1SA 4J37A 3DOMB 3MFIA 4CM2A 4C8KA 5BSXA 1FNOA 1RADB 1HMVB 1IS1A 1NZAA 4NOHA 1TKDA 3BSAA 1BQNA 2VHGA 1IXKA 3IG1A 3KUHA 1FNCA 1WI8A 3O1LA 1WTFA 4G3IA 1H72C 3G6VA 4P3YA 2BJ8A 3H3VL 3B54A 1S59A 1S76D 3D67A 1GXUA 4N77A 3I4NC 4CO1A 1RHJB 4JI4J 3M6UA 4ERDA 2M88A 4DPUA 3H0GC 2ZUFA 4MK8A 3CDEA 2V2QA 1Y9OA 1R8AA 1RBAA 3HKZD 2YKNB 2QYCA 3D26A 5IS2A 3R2CJ 4P6YA 3WNDA 3ZZRA 2CNLB 2IBOA 3T9ZA 5HO4A 3W2VB 4HE5A 4BLBA 1PBAA 3MMJA 2UVVA 2M4MA 3B4MA 2GO9A 5FIIA 2FJVA 5C4XC 2B8QA 1L3KA 3S2DC 4X4OA 3CJKB 5GAEU 1G6BA 2A6EA 2KVQE 3CMMA 3FKIC 4I67A 2KDOA 5HL8A 1LEOA 3OXFA 4CLTA 2VNJA 5DLFA 1YITB 1XK8A 4U6PA 3I0SB 1SQGA 2HMAA 2YBVA 2DXFA 4USTA 5KFZA 4F26A 1MRZA 2JZ5A 3Q23A 2XBPA 4OX6A 2HBYB 3KLGA 4CLLA 1BWEA 2RC6A 1HQEA 5CYQB 3MM8B 1ZM2A 1FRMA 2Y1JA 2MY7A 3HOZK 4H4KA 1N0VC 4U8YA 4ZS6A 2DNPA 3OHAA 2XSJA 1YJ7A 2XCRB 2GAGC 5KFWA 3PVDA 4ZITA 3UW1A 4WZMA 1NPPA 1GMWD 2VJIA 1UP1A 4DUZF 3GG1A 3BQ0A 1F1BB 4WFYA 1CS4B 2VIHA 4QJVB 1A9NB 3CXCR 4RW9B 5KT4A 2A1BA 2M3DA 1VQYA 1N48A 3UFCX 3MEGB 4N76A 2LCWA 5J2NA 4FZVA 5IV3A 2CRVA 4K50A 1NDLA 3BBCA 2Q79A 3AODA 2GPJA 3TOQA 2Q6IA 3JTOA 5RUBA 2IA0A 2BKPA 5LOQA 1R3NA 4FF2A 4GVBB 1ZPVA 3SQGA 2YKMB 2CPIA 4DBQA 1PGZA 1VQMS 2QA4S 2HGNA 1DQ9A 2O5IA 1Y0YA 4ZVSB 4M2LA 3QRPA 3ISNC 4M5HA 3PO4A 1N5SA 2EBBA 3T1HJ 4DPYA 1V9OA 2IM2A 2XO7A 5TR9A 3I5CA 1GAWA 5EWGA 2PGCA 1TWHK 2YXLA 4OV6A 4CLWA 2AMCB 1CLFA 4C43A 4Z4TA 4GT9A 2OD6A 3JS9A 1F9EB 1OQ3A 5A6WA 2NPIA 2KTQA 1S1UB 3PTWA 3ZUGA 4LQYA 2B7BA 4LF8J 3MUMP 1V3RA 2BM1A 4OLPA 2C22A 3QT5A 4O2DA 1RTHB 3BREA 1L5UA 5KFEA 4I64A 2W9CB 2ZHAA 4ID5B 4IFYA 3EVOA 2UXBJ 1VQ9S 1RWOB 4PWDA 1SFOK 1QGAA 1TUGB 3VR1A 1VOMA 4C3HC 4QUZA 3BN7A 5E33A 2EC0A 3Q2TC 3KJQB 4ZP9A 1H8EA 3V6JA 5MLCV 1QVFB 4LFCF 4QIWD 2CVEA 4CP5A 1XMQF 1EZZB 1RABB 3HFVA 4GRSA 4XK8C 5C42A 4P26A 4DV2F 1R6VA 2YVSA 2V2KA 1AMOA 4WILA 3GEIA 2BX6A 3IRXA 5E3QA 2FPHX 1UD4A 3CDAA 3W5YA 1I50K 2Y9HA 3QLHB 2GJIA 1GEHA 4ZIVA 3TEHB 4M94A 3LP0A 4QIFA 2LA6A 2X1AA 4GKKF 3GMGA 2XWXA 3BM7A 1N34J 7AT1B 4YR3A 3HFKA 5DZ7A 3C6TB 1ZUNB 3KLFA 3OSPA 1ZBSA 4BHQA 1CC8A 2HSEB 3FUYA 5IYBK 1RTZA 5CHPA 2MEWA 1X5OA 2LQ9A 1M1KD 2P5VA 4WU3A 1RT4A 2DGQA 2DEUA 1H85A 3ISZA 4UOCA 4C3IK 1IQZA 5GADU 5E3PA 5J2MA 3PRBA 3LWLA 3M8ZA 4ED8A 1IW7A 4XTTA 1SUQB 4DXLA 1KNZA 2HLTA 2QX0A 3W5VA 1QAXA 1IM4A 1NSQA 3GILA 2ROEA 2K1RB 4FN5A 3RGIA 4A48A 2B9EA 2CIMA 3EVWA 2XMKA 4KT0C 3BSCA 2R7RA 5KG1A 3WODA 2IVFB 4WIQA 2ZL7A 2M5YA 1A7GE 2LEPA 3GFHA 3LH2S 1Q8LA 3M6VA 2ZH4A 2KHDA 2BN4A 4F8RA 3OR2A 1RT7B 1H7WA 3Q3AA 1FKOB 4QHYA 3ENVA 3WC2A 1FEHA 2D74B 4ZPBA 1HQMA 2CYYA 3ETMA 4JI4F 2ZE2B 1S49A 4RZRA 1PIEA 1FD8A 1ZA2B 4TY8B 4G1PA 2F65A 3K58A 1AW0A 4A8YA 2AJFE 3R1LA 3GTJA 1CQXA 5IQQA 3AB2B 1RTDB 1TKZB 1UL3A 3ZZZA 4OI2A 3PIOQ 1X7VA 3HP6A 2FGOA 3SXLA 2OI2A 2CW0A 3UQSA 1KQSR 2DNZA 2V4DA 3PX0A 3SZZA 2ZBPA 1WCMA 1FEEA 2HHVA 2YNFA 3TAPA 2OIHA 4DPTA 1JIHA 1SQFA 2C2MB 3DHWC 3D7SB 3B82A 3NOCA 3QATA 4I2PB 1FJEB 2CZ4A 2VFUA 3TVYA 4NLYA 1EQ0A 3WY9A 1QUEA 2VOPA 4BBYA 4FBUA 4KHRA 3QFCA 5C3EC 3AVWA 3UD3P 4BBSC 2H54B 4XLEA 1EFRA 1K83C 4DV5F 3S1NC 3D54A 4RNNA 2D9OA 4OZ5A 3BQ2A 2H5IB 1XFOA 1S1TA 4M63A 4HE6A 2BQRA 1Y1VK 2GJKA 2NLWA 4YHHJ 1ZBTA 2MKHA 4XPCA 1UD8A 2AGOA 1SFOA 2MKJA 5F8JA 4LRFA 1N5YA 2FHMA 4X7DA 4I4BA 1NJXA 3JQJA 2HG4A 1YJUA 4OIXA 3NMAA 2JVOA 2CQCA 4TN2A 1RWUA 2OTLB 2PE8A 3K2YA 2WSSA 3ULHA 4C3JK 2ROGA 2MY8A 1PCAA 4G1BA 1KQSB 1X5PA 2E1MC 2RQCA 3M4OK 2G0CA 1AZSA 1SL1A 2AEFA 5DG7A 1XN9A 1SV5A 2GW8A 4Z4RA 2H4WB 5K9FA 4DUTA 2MB0B 5KG0A 4A3BK 3H4DA 1S48A 5HP1B 1EH1A 3IBWA 2CJKA 3W61A 3IWNC 5CYMB 4F3MA 1FRXA 3R3TA 3IWLA 2QEXB 3T1HF 4XDCA 2CZVC 3OL9A 1IKWA 2FJEB 4MK9A 4OP7A 4LQ9A 3R5JB 3RB0A 2E7WA 3IBCB 5KFYA 4ZVRB 3CQZA 2APOA 3AXKA 1YJRA 3MF5A 4OZ3A 1QSLA 1RQPA 2R7WA 4UUXA 1WEYA 3ET6A 1OYEA 5BSYA 4A46A 4LF8F 3O3LA 2C2NA 4ECUA 2V9KA 2FJXA 1ZZFA 1F5AA 1L3VA 1EP3B 4ZVGA 2ZUAA 1Q1KA 3OW7A 2FQOA 5KFVA 3HHLC 1RT5B 3W2WA 2VD3A 5K8MA 1T11A 5FDLA 2JA5K 3W5ZA 3D66A 4ITSA 1N32J 1SM4A 4WFZA 2GJ2A 3BGOP 4OPVA 2EBGA 3BGLA 3CW2A 3S8SA 2UXBF 2B5JA 1ZQ1C 2R8HA 1N6QB 1F3VA 1U1MA 3MM7A 2CXEA 2HHQA 2J7UA 2W7AA 3FRZA 3KDNA 3OPFA 2UUAF 2V6AA 3R97A 1ZYQA 5K14A 2NVXC 1HHSA 3R6LB 5HLFB 1RQRA 4ZLPA 1O51A 3CD5A 4NLQA 3QO9A 1CULB 1QM9A 2HKEA 2XS2A 4X62F 1F9FA 4QYZJ 2KRBA 2ZD1B 2E9TA 1N34F 1HQ2A 2C2WA 4WBFA 4Q44A 3AGPA 4NXNF 1Y5NB 3FOEA 2UXCF 4RW4B 1WG4A 4OJGA 1Q95G 3HVTA 5DQGA 1WI6A 5CDFA 4Q7AA 1CJKA 1JLGA 4ZP7A 1Y0HA 3GONA 2KT5A 1GXTA 2ZDOA 4II3A 3D68A 1UWBA 1J6XA 2KXNB 3MMBB 4NYOA 1TKTB 1Y5IB 1QJHA 1GTHA 3DLJA 1U0HB 3I9ZA 3G4SB 1Q8BA 2QTWA 2YKPA 4LBWA 4FXDA 1ZTTA 1QE1A 3DRRA 1VBKA 2XC9A 4LF6J 2ZOFA 1M1KT 3WNBA 3M3YK 2FJBB 3MAQA 1ZM3A 4KAWX 2OMLA 1REVA 4RLZA 2MGZA 4IO9Q 2COLA 2E2HK 3MMPA 2CUYA 3DM2B 4CI0B 3G82B 2BVZA 4PG5A 4Y9RA 2EFOA 3SI8A 3I9V9 2BABA 4DPWA 2YWWA 1LW0A 4RW6A 1J5EJ 2HQ3A 4TNOA 2JJ4D 2L08A 3CC7B 2RDJA 1WU8A 3JU4A 3HULA 5LM7E 1R0BG 2DITA 2BKOA 1XZQA 3TA0A 2NVYK 4DQSA 2DCUB 1FK9B 3CP8A 1I3QK 3TA1A 3DXBA 3KLVA 4RJLA 1T5EA 4M5KA 4FXVA 4G1QB 1NBEB 3WX4A 1S77D 1YRTA 1YJVA 3LF0A 1HNZJ 3ONQA 3EVMA 1B64A 2V63A 4RR5A 2ZBUA 5HVFA 2DGWA 4RW8B 1HI0P 3Q8YA 1S57A 3R5GA 1XEZA 2MLXA 2VB6A 1WJ9A 1KRPA 4DR1F 4EO6A 2CPDA 2MQOA 4FKYA 3Q0AA 3THVA 5LJ5Y 4MYTA 1UMKA 1UD2A 3CC2B 2A10A 1R89A 3RYLA 2ZBVA 3OW2B 1LWXA 2C2ZB 2AT1B 1RDRA 3T19A 3V6HA 3I56B 2UUWA 2JL9A 3OFHA 1Y1WK 3PO5A 2VJJA 4LBHA 8RUCA 1TUIA 1GAOA 3AHPA 4A3DK 3FJ2A 1FNDA 1K44A 3SSRA 2UU9F 1WG5A 1VQ7B 1S0OA 1U1RA 3DGPB 2DGUA 2B8PA 2W2NP 4HT5A 5L8RC 2BRLA 1KLMB 3H5UA 1CJTB 3CJ0A 4K0KF 2G2OA 5IORA 2C1EB 2EG1A 2Z56B 2XTJP 4IFVB 4UW2A 4V19X 5J2PA 4CDIA 2P3MA 1HZEA 4YHHF 3CJ8A 2B63C 4DX5A 4DSLA 3GFYA 3M8RA 4KB4A 3AJ1A 1FRNA 3S7RA 1F2GA 2VBSA 4A3MK 3S15K 2XI2A 3CSKA 3CCRB 4ZH4A 5A76A 4B3XA 3D4JA 4AL6A 3KL9A 1XR7A 2EI5A 2V8VA 3OXGA 1X5TA 4XIUA 3T56B 1RWWB 2HDNB 4BC9A 5KFXA 2Z4PA 4PXDA 4JV2A 2GJRA 1R9TC 2B9YA 2V4JB 1JLEB 3SIPB 1KVJA 1NK9A 1W34A 4KGVB 4JUZA 1K0TA 4WP9A 1T6XA 2ZZEA 1Z2LA 5IQ6A 2QG9B 5F4OA 4NZ6A 3VTIA 1OQ6A 4LK1A 5DZ6A 1URNA 1JJ4A 3KLEB 3L09A 5KW9A 4BPRA 1S6QB 2NXEA 3EXCX 1NK8A 1NK5A 2POKA 4XD7A 1UJ6A 3CJ5A 3NCRA 2IAJB 4TYBA 1C0AA 2HZVA 2AYEA 4QBUA 3SCJE 3RAXA 2R9VA 3KG4A 5JVGQ 1JKHA 2RAQA 2GK6A 2CADA 3DNCA 2VOOA 3CDWA 2C3UA 4NRTA 1N32F 4TN1A 3DLHA 1SL0A 4CO4A 3DCAA 4TLRA 1KK3A 5DS7A 5LMNJ 3Q24A 1PJ5A 3IC1A 4NLXA 1J9ZA 1E6YA 2MKYA 3K5PA 4NYPA 3M30A 4ZJLA 1RAIB 4CNYA 3HOVK 3MPDA 1HBNA 1R8BA 2UV8G 1I3QA 3TR5A 2DY1A 4IW3B 2EPIA 2RGRA 1X8DA 2X1GA 2LLZA 5I42B 3FOFA 1B4AA 3ITHB 4PG6A 2HVIA 5D4PA 3KEWA 3IPJA 4RCZA 1S1VA 3DLEA 1TWCK 1RWVB 2GV1A 2B6AA 1UZHA 4NCGB 2HHUA 1HQUB 1P1LA 5K20B 4BBRC 4DSJA 4DR6J 1AB8A 2E1BA 4DSEA 2PI5A 4M0LA 3BB5A 1SJ3P 5IOQA 3PW2A 2V8GA 1JLBA 5ITHA 5IM0A 4A8SA 3I55S 1O8BA 3GTGA 1D8ZA 3U6KA 4R71A 1FJCA 4QWEA 3ENQA 1VIXA 2JA8K 3P26A 4USVA 1Q86T 2AGQA 3V4IB 2ATLA 3UCGA 1TL1A 3F44A 5KFJA 5HBMB 4MT1A 2ZL5A 4LR7A 3CD7A 1OS5A 4P5AA 2QMWA 1DQAA 3GV7B 1VHIA 2QL7B 3Q8QB 4AYBD 2OPRA 4TQSA 3VHQA 3U6BA 5IP9K 1JNZB 2AJ4A 4U9UA 4F4KA 3HFZB 4DPXA 4NLDA 1DLOA 1N56A 4KGMA 4QWAA 1S7HA 3PHTA 1BS2A 4LIRA 3JXOA 3CWJA 4OZ0A 1UPPA 4TMZA 4K8RA 3KLHB 3GTPK 1DHMA 2GS8A 3W9HA 3EE3A 4P3IA 2FDNA 4AF7A 2I5JB 4KSEB 1HNZF 4BLGA 5EGYA 4JK1A 3C8YA 4LR9A 4XNFA 2AWZA 4LF9F 5F0WA 1C4AA 1T9WA 4RD6A 2W2MP 5ETNA 4QR0A 4KKOA 1XR5A 5KG4A 1G7CB 3KJVA 3R9LA 3LAJA 3H5YA 5C4JK 1NSKL 3M9NB 5CJ9A 3AT1B 2W8KA 1IKXB 3A4TA 2X6XA 2OP5A 3JQQA 1VGXA 3IM8A 4X65J 3D0IE 3MURP 4RW7B 2KKHA 4CTAA 4KV8B 4LF5F 4ZJOA 4ZIWA 4GTEA 3EX7B 1RT2B 2BW2A 1W35A 1K28D 3CO0P 1QX4A 3FHZA 1S6UA 2J9DA 2W4PA 1HPZA 3QMQA 1ICEB 4I6AA 4K4VA 1S4FA 1GX5A 3UR0A 1VQ6B 1K8AT 2X6YA 2DHAA 3S2HC 3M2RA 2C2KB 4F3OA 3C14A 1HI9A 2ZH5A 1NK0A 2FC9A 2BEFA 3AD9C 1U45A 3U1MA 2CC2A 4FPIA 2Y3PA 5M2UA 2E2IA 1QFYA 4OMFG 3HD1A 1AYEA 5FJ4A 1W2BR 2XHWA 4J5OA 4U7UD 3HJFA 3BR9A 1AUDA 1BGWA 4M8LA 1JX4A 1F20A 2MQNA 3DOKB 1YI2S 1GK8A 3MM5A 4IG0A 3NS5A 3W9JA 5E68A 1GT8A 3TAMB 1S1WA 4ZLLA 4IOCQ 3D1HA 2QRRA 1TK0A 2IC3B 4KFBA 5A8KA 1RHKB 2WCXA 3H0GK 5CHCB 3SZ2A 4LSLA 1TZ0A 4PYAA 1WF0A 2W01A 2YWEA 1UVKA 2WVEA 1FRKA 1H0HB 5CZXA 4H9GA 2C3MA 4O3RA 1OSDA 4CIOA 4Y28C 2X3UA 2ZH8A 2CQ4A 4MKBA 4AL7A 3W2HA 4USHA 4HT7A 3GR0A 3W5XA 4C9DA 2FZKB 3OLAA 3H20A 5DLGA 3OT9A 1P27B 1IBLJ 3PNIA 4DHVA 4DQIA 2YNIA 3KNAA 4DDQA 3WZ0A 3S2DK 4JV5J 5M5XK 2F1LA 2DBBA 4E2FB 1X4HA 1UA0A 3FCVA 3FKIK 2LP4A
chains in the Genus database with same CATH topology
1XZPA 3AD8C 1V5VA 3ADAC 3TFJA 1PJ6A 3GIRA 1X31C 1WORA 5L46A 1NRKA 2GAHC 3AD9C 1WOOA 1WSVA 1XZQB 3TFIA 1VLYA 3A8KA 3A8IA 1VLOA 2GAGC 1PJ7A 3GSIA 1XZQA 1WSRA 1WOSA 1WOPA 3AD7C 4PAAA 1VRQC