1WSVA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
371
structure length
371
Chain Sequence
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Aminomethyltransferase
total genus 117
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsvA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsvA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsvA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsvA03
1XZPA 3GEEA 1PJ6A 3TTGA 1VLOA 2GAHC 4P9SA 1XZQA 3A8JA 1VLYA 1XZPB 3TFIA 5L46A 3TFJA 1WOSA 3ADAC 3A8IA 3AD8C 1PJ7A 1WOPA 3GSIA 3AD7C 1WOOA 2GAGC 3A8KA 3GEIA 1V5VA 1WSVA 1WORA 1VRQC 3TFHA 4PAAA 3AD9C 4PABA 1PJ5A 3GIRA 1NRKA 1X31C 3GEHA 1WSRA 1XZQB 1YX2A
chains in the Genus database with same CATH superfamily
2ZZTA 4DDQA 4OZ0A 2CYYA 1BGWA 1OO0B 2YNIA 5HMYA 2OIHA 4DR6J 4A3EK 2YU9C 2HRYA 4A3IC 4XONA 4Z4UA 4TLRA 3HOZK 2NXJA 5GAHI 5CXTA 2LA4A 5GV7A 4FVMA 1K0VA 2ZHBA 2EG1A 5M2PA 3M2UB 2GJPA 2BMBA 2NZCA 3BS9A 1JLQA 4ANEA 2LQBA 5C2GA 3BYRA 2RQCA 3IBWA 1FNBA 4PQUA 3N5BA 2CVEA 2J6SA 2AGQA 3MGJA 3M6XA 2JJ4D 3P27A 4NL5A 1AZSB 2W9AA 2BE2A 1RADB 2MQPA 5EHHA 9ATCB 1ZZNA 3DRYA 3H94A 2GVZA 4TN2A 4I56A 3AD7C 2ZXHA 2AX0A 3FHZA 3PO4A 4G0UA 3AVYA 3C6UA 1YHQS 1D1NA 3QFRA 4CCHA 2GVZB 3TNVA 2A1BA 2ZD1B 4JI7F 3W2FA 3M6UA 3QAUA 4TLQA 3I5BA 3QWPA 4XSZA 2VNKA 3MPDA 4KHPF 2CQCA 1OWXA 1HI1A 1RWVB 2RU9A 1SQEA 1G2EA 4JI1F 1R9TC 1TK8A 2GIRA 2ZUGA 4RNNA 1D1UA 2E2JC 3O6QA 3QFCA 2D3OR 1CJVA 1VBKA 3K8VA 4Y9UA 4QYRA 4G6IA 2CFAB 1OPZA 4NLDA 4DZ6A 1S6PA 3HULA 1Y1VA 2FQTA 1RP5A 3MEGB 4TVAB 2GVDA 1BMQB 2FPHX 1R6YA 1P6TA 2LECA 1G51A 5H59A 1NBEB 3GTQC 4MFBA 1WQHA 5D4OA 3AJDA 4I4BA 2Q6OA 3T56B 5J2NA 4JYAJ 2MSSA 1BQNA 2H48B 1TR0A 4ZIWA 3T1AA 4LT6A 3D5MA 2XOKA 1TK5A 2K06A 4IDKA 5DLGA 4NA2A 2DT9A 2OP5A 3S15K 3P49B 2JL9A 1R89A 3M3YK 1IQTA 4ZLPA 1U6BA 2PD1A 5CABA 3H7HB 3S14C 2XO6A 1I7PA 4DFMA 4C11B 2ZZQA 3H3VL 2HEKA 1QVFB 3W61A 1HWJA 4CP5A 2Y0BB 5TMFA 4DL3A 1O25A 4JUZA 1HWUA 1UMKA 2P9EA 5IYBK 4BC9A 4PGOA 2ZBIA 3DDNA 1D8YA 2IIHA 2Z2MA 1FFGB 4ZPBA 3ICLA 5HJYA 4HHJA 1OB5A 2QL9B 5B6IA 1KJZA 2QEXB 4ZPAA 3GIRA 3PYEA 4OI0A 1TWFC 1DD5A 3RZOK 3AAWB 1RT2A 1NH8A 3THVA 4J9RA 1Y5LB 3EXYA 1XMOF 2H5JB 2BZ2A 5LJ3Y 4Q7AA 2HFZA 5IZHA 4RM0A 4DQRA 4DF4A 3TAPA 4DQIA 2LP4A 3KK2A 1HWIA 3G4SS 4KASA 4TKOB 1F9FA 2KFYA 1ZTWA 4Z4SA 2OFHX 3GU0A 3FFIA 1UEUA 5C25A 1FKPA 2VONA 3RYLA 1D3WA 3W9HA 1DDIA 3OTEA 4X4RA 4FZBA 3OZWA 4X4VA 5E0OA 4NCGB 3MMAB 4CH0S 3FDSA 1KONA 6AT1B 3PRVA 1WDDA 4ROXA 1OGJA 3QFSA 1TU0B 4XPEA 3GVLA 1W35A 2V2KA 3S01A 3KLVA 1FTCA 1AA1B 2QLFB 2MMYA 3PYDA 3THPA 4NLOA 4YP3A 1VHFA 2W8LA 2XULA 2B8QA 2DHAA 1S12A 1Q95G 3PNIA 1EXMA 2AGOA 4NBSA 2JA5C 3VF0B 3D68A 2RC5A 2XZWA 1RWUA 2CF4A 2MYFA 4RW7B 2DEJA 1E3ZA 4ZS6A 4DX6A 1PJ5A 4DEZA 2CPDA 2XS2A 2GV1A 4TNOA 2XMUA 1MLAA 3I5CA 2YVSA 4ZJOA 2O3DA 3E20A 4WZQA 3PO2C 4Y2AA 3GTGA 3ZNUA 3FJOA 1YI2S 4AXIA 5IM0A 2V4JB 3CCLB 5DJBA 2WJVA 5IQ6A 5KG2A 2R9LA 1E79A 2GAGC 2AJ0A 2SXLA 2C22A 3LWLA 4OP7A 2Z2ZA 2CZ4A 2CFXA 3I4HX 4X66J 2VBYA 4JP8A 3MTJA 1NB2A 2GHWA 2A68A 4A93C 3K5OA 5I42B 1B99A 2PI4A 3GYNA 1LKZA 1Y1VK 2BACA 4B3XA 4G3IA 4DPOA 2QYCA 3S1QK 1YRXA 3AB4B 3CJQA 2ZFZA 2JEFA 4ELUA 3IPJA 1NK9A 4JI1J 4OYWA 2LDIA 4RJVA 1FDNA 2HNZA 2V2QA 1T9YA 4OZ5A 2JA8C 4P6YA 2DIUA 2KXFA 2DH7A 5EN1A 2V50A 4HACA 2FVRA 2DRBA 2MSTA 4PYAA 2FVPA 1UFKA 4CO3A 3A3PB 3SV4A 3I9ZA 1WNEA 4GTBA 2ATLA 4U95A 3MPYA 1Y00A 3KG0A 1FWKA 3A35A 2BJEA 4DQSA 3E01A 3S7RA 1GAWA 1FTRA 1N0VC 3IWXA 4U8YA 5KFJA 1BMFA 2VNIA 1SXLA 3TANA 1N08A 2Y8YA 1VQ8B 2QLBB 3CCTA 3IO1A 3GVJA 2A2DA 3EGNA 3VWSA 4B9MA 1TP7A 5IQQA 4IQMA 2YH0A 3ZC3A 4DV6J 3QIPA 4ILRA 1FWLA 5AE1A 1M5SA 4P2FA 4L73A 4L76A 1FJEB 1JJ2B 4EI2A 3TFJA 3TZXA 1FEEA 3W5XA 1RAAB 4LF1A 5DM7Q 4L74A 1RT5A 1JQWA 2HS4A 4OYMA 1HQEB 3CPWR 3PRDA 3GR0A 3W2EA 2RT3A 3S17C 2VC1A 1RYSA 2ZHAA 1ITPA 4IYQA 3GTLK 1H0HB 2XS5A 3CJ8A 1S9GB 4OHZA 2JA5A 1LXNA 1E1RA 3EVMA 4ECSA 1R8CA 5CQGA 1NPPA 3DHXA 1WCMA 4QUZA 4WJBA 2X85A 2DXDA 5DG9A 3SFGA 5KOWA 4XOTA 2OPPB 5HP1A 4YB6A 5M3MK 1S99A 4YY3F 2GJFA 2D74B 1VQ8S 3J7A1 2CQ2A 2E7XA 4MT1A 4DV2F 1KS2A 5LJ5Y 1NSKL 1KHWA 4G7HA 5D77A 1MG7A 2VBSA 2M3DA 2CPHA 3AQOA 3SKBA 1VI7A 1SIZA 3I96A 3H90A 3V6KA 4ECTA 1RA6A 2IRYA 3M05A 4JI8F 3CCSB 3VALA 5KOXA 1YRUA 1K9MT 3V4MA 2DRDA 2OPSB 1JLGB 3QGGA 4CO4A 4DR7F 4WU3A 2DR7A 2KRRA 2EFNA 2BMWA 3VCDA 1VBXA 4PPZA 3A1PA 4GTLA 1IR1A 2NVXC 1WOPA 3TJAA 1YI2B 4XLAA 2X0KA 4LBYA 1N36J 4Q44A 4CLTA 2AWZA 4PQAA 4ASUA 1H85A 8AT1B 1Q4RA 2R4FA 2FLOA 5D0EA 3EWGA 4F50A 2IRUA 5IOSA 5L39A 3QX3A 1REGX 4X4OA 1KQ4A 1JJ2R 1EHWA 5IYDK 3FJ2A 2KG1A 4ID8A 3CMAS 2K2PA 1GTEA 1VHEA 2I1RA 2J9DE 5HSPA 5HL8A 3HOUK 2ZL7A 5IOLA 4IG0A 1FFSB 3VAGA 4UOCA 3I87A 5THWA 2C5HA 4A47A 2BQRA 3CO0P 2CDQA 4H4MA 4FVCA 4B9VA 1VQKB 3O1LA 2QGGA 1IKXB 2D3O1 5CYQB 5AJ3F 1S9FA 4C97A 1QX4A 2W7AA 1S10A 2ZD1A 1RHUB 4OIRA 1RT6A 5J2PA 3T5JA 3IR6B 2Y0SD 2OGUA 3FMBA 5KT7A 1ROFA 3JSMA 2IDEA 4Y52K 4XPCA 3ET6B 5C44C 1APSA 4C3LA 4P7TA 1BS2A 4YHHF 3EE3A 1WKLA 2ZZGA 3QT8A 1ZPVA 1S1UB 5GAEI 4MIAA 3JSRA 4A3MC 3KLFA 1EP1B 1UVLA 1ZYQA 2HBYB 2W2PP 2JC0A 1YVFA 1VQ7B 3PUMA 3I0RB 2MKKA 2OSQA 5CYMA 2I6WA 2KJVA 1FRHA 5KFXA 3OR1A 2ZH2A 2YPZA 3WC0A 2JVOA 1DZ5A 4P2MA 3BQ0A 3CC7B 5HQMA 3ENAA 3UFCX 1HYSA 1NRKA 2GC8A 3H4DA 4ZVEA 2ZZNA 4FP9A 1W87A 1KFDA 3CQZK 3HX9A 4DUZF 2YKOA 1S6PB 2GSOA 2Y0SL 4DSFA 3O5TB 1TQLA 2CQBA 3S1RC 2OI2A 4LF6J 4QW9A 2FJXA 3DU5A 2BXJA 1NHVA 1FE4A 4P52A 3UR0A 2XMVA 2ZZFA 3CTRA 3JAMY 2W4DA 2C3YA 4LFAJ 2DGSA 1ZTTA 4ZITA 4ZN1A 4KC6A 3DRRA 2BKOA 3MUMP 1AUDA 5LL6d 3M6VA 3Q8VA 3TA0A 1HBOB 1KFSA 4AD6A 3DLJA 1KSPA 1Y4ZB 2ACMA 1T9VA 3OEPA 4QHYA 3KTQA 4YFNA 2CWXA 4HDGA 3J81Y 1WHYA 2OH2A 3OOCA 4Y2MA 3TX0A 1P27B 2BOAA 1IUJA 5HXBA 3L4JA 5I4MA 3GWCA 4PQUB 2VV5A 3ZZYA 3LP2A 2GGPA 3MCSA 5C7PA 2YQ1A 1WORA 3GSDA 2BN4A 1Y9OA 1HQEA 3CCMS 3FCHA 3FBFA 3MM6A 2V0NA 1B0TA 3C6TA 3IWLA 2XMWA 3PW7A 5EUHA 1NKBA 2X51A 3I4NK 2EFGA 2Q6LA 3OR1B 4B4DA 3OEEA 3FBCA 5FJ4A 3OKXA 1GMUA 1FT8A 2XNDA 2X3UA 5DQIA 1OJ4A 3DLLQ 3GV8B 4J3NA 3GTQK 1HWKA 2LU1A 1F2HA 4LRAA 1FNXH 1W25A 1O28A 5C2CA 2QLWA 3JQPA 2CQGA 3DGPA 1UWBA 2GVDB 2HBZB 4KHRA 2MLYA 3U2QA 4Z7YA 3EGWB 4XKWA 2FY1A 1WC6A 4P1VA 1S6OA 2Q3PA 1HHSA 4CLFA 1CS4B 4Y0FA 4R5PB 1V0EA 1PG5B 1W0JA 1C4CA 1E63A 1O51A 3JB9k 4XTTA 3BSNA 1RHMB 3KLIB 2IJFA 3BY1A 4P12A 5ETNA 1UZDA 3NS7B 3I0SB 3QO9A 5IYWA 4KB2A 2YXLA 3QATA 3JQQA 4KGXB 3KLHA 3M8PA 4GTEA 4YHHJ 4MJKA 4AC9A 5MLCV 5I3UB 2RGRA 2V9WA 4JI6J 4E0DA 1V9OA 3MAAA 2GMHA 3M9OB 3PHEA 3G6XA 1OB2A 3GR1A 1L3TA 3GYGA 1WG1A 6FDRA 1X5SA 3A12A 3NGDA 4QR1A 5AXLA 4M5GA 1EFUA 4LQ9A 4X4NA 4J9SA 3BUEA 1QE1B 2ZC4A 3GQCA 3K0JA 2O5DA 4C45A 1S49A 3ISND 1V0FA 3HP6A 4HHUA 1NK0A 4Q5SA 2CNDA 2HQIA 1W2BB 2ERRA 4OI2A 1YLOA 1BQEA 3W64A 3AQPA 2R7WA 3QRPA 1FX2A 5GAGI 4F7VA 1VCTA 2VJIA 3U7JA 3QFTA 4USTA 2R8JA 2E9ZA 4DQLA 1WACA 2FVGA 1YRTA 4WWSA 1Q86T 5LXRA 5C24B 4LF5F 2NXEA 2BSAA 2VPXB 4A8SA 1QAXA 2WONB 2F4NA 4GFQA 3W5YA 1S0MA 3S2DK 1REVA 2CDRB 2MDAA 1W2IA 3FMWA 3DLHA 4ANCA 4K4XA 3PO3K 2HRUA 3CDWA 1OIAA 4OFZA 2ZWOA 3DRSB 1YLXA 3TJ8A 2QFJA 4NI2B 3VAMA 1JA0A 2IRXA 2R7SA 4HE6A 1RI7A 4LBWA 1LW0A 1LW2A 4GZYA 1T5EA 2FUG9 4RW8A 1DDGA 1KLMA 4EO8A 5ADZA 2VICA 4IR1A 1VQ9B 2JA6C 3IBCB 4OIQA 4P5AA 2OTLB 2UUWA 2LQ8A 1IHMA 3Q39A 2C2ZB 1T03A 3OXLA 5C4JC 4ZP9A 3H9NA 4Y2CA 5E3QA 1S72B 2NXUA 5E3AA 1RLCL 1R3NA 1OY9A 3UDCA 8RUCA 1VJEA 1E6VB 2HQDA 3CO9A 3BO3A 4KPCA 2DGVA 2KVOA 3DLEA 2YQ0A 1HR0J 1KR4A 4A4JA 2UU9F 1MMLA 5IOQA 1ZAXA 3AD9C 3LUYA 2J6UA 3M30A 1IJFA 1MMNA 3HFZB 1T9XA 1Y0YA 1AT1B 4UOHA 1GXUA 5KFYA 1D8TA 2CQPA 3N28A 3M4OC 3PW5A 3LW5C 3CRZA 2GZOA 4HL9A 2RKIA 3TZWA 1M1KT 4PUOB 4RD0A 1AYEA 2C4UA 2WZ1A 2I38A 2YNFB 2OBSA 3MM5A 3NY0A 1P1TA 5LMNJ 3Q8QB 4WE1B 4QPTA 3PKMA 1N32F 4YG2A 2RRNA 3MM7B 2H54B 2HIYA 2MGZA 3D1OA 3L3CA 2D9RA 3W2GA 2V4RA 5ETOA 1FHTA 4NLSA 4GRSA 1T9UA 1PC4A 2P2CB 3DOMB 1ZXOA 3ISZA 3MPVA 5KFTA 1L5UA 5IYPA 1NPRA 3HD2A 3POTB 2R93A 2R6HA 2Z58B 5LM7E 4NCAA 2VFRA 3JSBA 4KQZA 3MPUB 5EGEA 4CT9A 2UXDJ 1VQ5S 1JQGA 2XMTA 1TV6A 3IR5B 2V67A 4MKYA 2C2NA 1I3QC 1TUWA 2RAQA 5F4MA 4ZVSB 4ZCKA 3HHLC 5G0RB 4YR3A 2V94A 4QBUA 3QNWB 1JXLA 3QPIA 4O3NA 2BOPA 1F5AA 1I5OB 5D0RA 3RRGA 4YFUA 4XD7A 2BW2A 2RILA 4OOSA 2ALYB 1MROA 1UAWA 4PXBA 5BYSA 4YY3J 1JMTA 2ZVIA 2BUNA 3P45B 1HL6A 2P5VA 1D0EA 4DXLA 1X9MA 4C2MA 4IFVA 2PEBA 1HPZA 3PY8A 2A0FB 2F8EX 3OJSA 1NEEA 2BANB 5C42B 3HOWC 1MWYA 4F26A 1DLOA 4ZN3A 1AW0A 3MUTP 1N0UA 1JLAA 5FLXU 1F6TA 4NLGA 1BDFA 3GJTB 4DL5A 4PWDB 3GONA 2J76E 3H0PA 4PXEA 1KK0A 2DITA 1XMOJ 3FCVA 3KK3B 4DR1J 4LJMA 1Q7YD 4I6AA 1JNZB 1VQ7S 4XMYA 4OOXA 2KKHA 1K1QA 3TJ9A 4XLFA 4LF7F 1TWFA 3TP2A 3IRWP 2Q6CA 4DG1A 1X0PA 3K59A 1TMMA 4X7CA 3PG9A 2CJQA 3MD3A 3R6JA 2R7ZC 1GO2A 1N8RT 1EQRA 3OW2B 3H2LA 3WX8A 4DCOB 2XGPA 1EJ7L 2ZUAA 3JSMB 4QWEA 4LUBA 3POTA 2BQ3A 3LP2B 2MKCA 1VHIA 2CQ3A 4F36A 1WIHA 3HF5A 3HK2A 4K8RA 3J7Z5 4B9TA 2Y3PA 1RT3B 1UVNA 5F8GA 1NPKA 1PYSB 3FUYA 2ZH7A 3L7OA 1SKUB 1HA3A 4HACB 4JBCA 2CC2A 1DG1G 4UOFA 2PDAA 1MN9A 1S6UA 3GSIA 4O3SA 1IKYA 4X4PA 3SZ2A 1BHNA 4RW8B 1T02A 4J9UE 3LAMA 4N3NA 4DDFA 1K83A 1RISA 2N4DA 4NI2A 1AB4A 3V81B 3NAHA 4LSNA 1PBUA 3QGHA 1EI6A 1KRPA 2WZNA 1Y3JA 2EEYA 2JA6A 2KJWA 2JEJA 1NSPA 3MUVP 1XMQF 1UD6A 3HHLB 3ZTPA 4DZDA 1KVJA 3LAJA 3S1RK 1YJWB 3V4IB 5BSYA 3RBXA 2AEMA 1Y1VC 4O0NA 3UCGA 1E3XA 2HGNA 5CCMA 3HVTB 3PJXA 5HQ8A 1Z1ZA 4PG6A 1EK8A 2DGOA 1B0PA 3MMCA 4LK1A 1DLOB 3QMQA 2EK6A 3QLHA 2VZ9A 3SQGB 3QRRA 1HW8A 4DUYJ 4ES1A 2F9DA 2BABA 3UO0A 4NXMJ 1LW2B 3AVWA 1HBMB 3ZZOA 2E5LF 3MMJA 2DERA 1JVIA 3W65A 2DY1A 2NVXA 4HVZA 2EKNA 2QTZA 3D9BA 2MHNA 2DNLA 1NNDA 3TEHB 3H98A 1U1OA 4K50A 2E1MC 4OX7A 2A6MA 2R2RA 3RW7A 2NZ4A 4CH7A 4Q4ZA 4J9KA 2XMAA 3KLEA 5KG1A 1U49A 3KKFA 1FCAA 1B2RA 3Q6QA 3HHLD 1EZZB 1V3RA 4FF4A 4JI0J 1U2CA 4NOIA 3B54A 4OIXA 3Q8UA 1U26A 4B3MF 4G7WA 3V6HA 1DURA 4DL2A 1QTMA 5FIUA 5BSXA 1IL2A 4B17A 4KB4A 4DF8A 3H25A 1FKOB 4X8IA 4I64A 5F0WA 1N06A 1BC6A 2CJAA 2ZNZA 5HJXA 4O3RA 3ZZZA 4WFXA 4LFCF 4XOPA 2BPOA 2XZDB 2XSJA 1GT8A 2XCAA 4UY8T 3MEEA 3G05A 2C4TA 3ITHB 4LBPA 4AL5A 4F02A 3RJMB 4NASA 5FD1A 4IRKA 2IAJB 2E5IA 2BM0A 1M1HA 5JJBA 1IBMJ 2NUUG 2D6FC 3ITHA 4WFBQ 3ZZPA 1CBKA 4YDDB 3CIMA 4A8YA 2JLEA 3AGQA 3V4GA 2KDOA 3W2WB 4KHPJ 1VRTA 1SUQB 2FZGB 1C4AA 1EQ0A 1FXLA 4FXVA 2UUBF 1LWFA 4KM8A 2ASLA 2AJFE 1K0TA 1U2FA 3E8OA 1AZSA 2F9JA 2B7CA 5HVGA 2LYVA 2L9NA 5IYNA 4UZFA 4PR6A 1RAGB 1R8BA 3J7AN 3FZBA 3CDBA 2LU2A 2R92C 2JDIA 2G1DA 2E1AA 3G82A 1XXCA 3SXLA 1RDRA 1A0OB 1WCMC 3VAJA 5H9FJ 4NXNF 1WU8A 1DQ9A 4QWAA 1RZMA 4HR2A 2IHR1 4FPRA 4X6AC 2V34A 3DRPA 2PA3A 3A1YG 2GJ2A 3R7SB 4PXDA 4EBEA 1SKSA 2HNDB 4FK8A 3C66A 4W4MA 3JSYA 4JV0A 2E9TA 3LQVA 3K5NA 5IWAF 2FD2A 4A8XA 1WOOA 3NLCA 2Q6IA 3WY9A 2XMJA 4L72B 3W60A 3U6BA 3DHWC 3MM6B 3RTVA 3QJJA 2GCFA 4OJ1A 1XBWA 3GG0A 3HZGA 4MIBA 3ZPNA 2QFIA 1YZ6A 2D41A 4KFBB 5E7OB 4KDDA 1MWZA 3NMRA 3ENVA 3AT1B 4GKKF 3JXOA 3U6KA 3M8QA 4KGVB 4CT8A 1IWAA 2NVTK 5ETRA 1IR0A 3ZZRA 1WPCA 2V5HG 2C3OA 4RR5A 3HVTA 1SFOC 3G87A 5AXKA 1PC5A 2GIFA 3I0RA 5EWEA 3OHAA 2QE5A 1TAUA 1VGYA 2CG8A 1T0TV 4R25A 2R92K 2CJBA 2MKIA 1S9EB 2HNYA 3HXAA 1R5OA 3GJSB 3CTAA 3WDOA 4GVBB 4ZP8A 4B3MJ 2EIXA 4P10A 3PTWA 3N0CA 4CLWA 1JXVA 4TXSA 2B7BA 3ZZTA 4JV1A 3UI3A 3RG6A 4E2FB 4YUDA 2QL7B 2VUGA 2R8HA 2MB0B 3N0BA 2NVYC 2KH9A 5CYJA 4DPTA 5KG3A 4FF3A 4RU9A 4ZVUB 1B4AA 4DV2J 3ASQA 2HLUA 1HNZJ 5KFGA 1FNCA 1M5PC 4X4QA 3RB4A 1QSSA 2X1FA 1Y7PA 1AXQA 4PZVA 5B0GA 1JLQB 4TU9A 1VQ5B 3FKIC 4PXCA 3J80Y 2HVHA 2ZBCA 2DGTA 3CXCR 3G6ES 3Q3QA 2HHTA 4P22A 2GNKA 2PN6A 3K7AK 2KYXA 1GXTA 4U7UK 2MGZB 4D3HA 3FC9A 2IM1A 4BXXK 3RZAA 3G6EB 1S0UA 1YJNB 1VIOA 4O4GA 4NLYA 2Z2LA 5H9FK 7FD1A 4WE1A 2YNGB 3DU6A 2ZXIA 5HO4A 5F4OA 1EP2B 1R31A 2YU9K 1CQNA 5KFDA 1TL3A 1XC9A 3PUNA 3TQ1A 2LCWA 4U7UD 1U0HA 3B82A 1VQLS 3M3YC 1B70B 4M4SA 4X7EA 3LGHA 3G71B 4EZ9A 4J9LA 3CJKA 4U9RA 1S4MA 3VVTA 4DV0J 2V4DA 1RWXB 3AY0A 1QM9A 4BC7A 4BBSK 2JJ2A 5IS2A 1J9ZA 4XLHA 2VZLA 1HLWA 4H9GA 3SJPA 1B4SA 1LXJA 5J1EB 3WIVA 2BRLA 3UNYA 5F3ZA 1K83K 3HOUC 4OX9F 1S4FA 3LP1A 3W5VA 1E62A 2W4CA 3KLGB 2MZ1A 1CJTB 2JLGA 4RD3A 4A3FK 2JA6K 2OEKA 2AW0A 3VQSA 2HQCA 5GV8A 2JA7K 2V2ZA 3UR3C 3OJWA 3Q22A 1R0AA 3HOXC 3ZC4A 3WBJA 2O5IA 4BY1C 4USVA 1OQ6A 3PHTA 3M8SA 4G7ZA 2H5IB 2LQ9A 3NP5A 1UJ4A 1UFLA 3GV7B 2YWHA 3MEEB 2C2OB 3RW6A 1EFRA 1S57A 2DNKA 4F3OA 3BPSP 3SZZA 3HFVA 3EDRB 4J0QA 1SJ3P 1VH2A 1TWGC 3P8BB 1RJJA 3MMBA 4XO0A 2R8KA 2W2OP 2AF6A 1PCAA 3Q2SC 4NLVA 5CZXA 2XY5A 3PZPA 1A6LA 4K0KJ 4K4ZA 4A3DK 2MQ8A 3H2VE 2PIIA 2WK4A 3OP1A 1KWMA 3W63A 1CLFA 1LWFB 1NJWA 3NCPA 5HANA 4DFPA 3OR2A 4FNIA 1UPPA 3N5FA 2QA2A 3CE8A 1TL1A 2OK7A 3HFKA 4WZTA 1RE1B 4F4AA 1HQMA 4IOAQ 2E7VA 2LXIA 4M5KA 5A89A 3D26A 2E66A 3M9MB 4ZP6A 4J90A 4OPVA 2HLTA 1QFJA 3WC2A 4L75A 3PA2A 3NE5B 1JOEA 2XTJP 4WILA 2YH1A 4QU6A 3QT5A 5IYCK 2XBPA 2N7CA 1RTHA 3GTKK 1DTQA 3I82A 3TO8A 5H9EJ 1KKHA 4BLGA 1SB6A 3R1LA 3DM2A 4TT3A 1IW7A 2ZE2A 2I2YA 3QSIA 2V6SA 4ACBA 3TRGA 3S16K 2W25A 3KMQA 5A8RA 4J9VA 1VK3A 1LK5A 1FKOA 1HYSB 2DR5A 4KGZB 2IA6A 3ZTRA 2R7RA 4M5IA 5EGYA 1XJWB 5IP7C 2DO0A 4B3SJ 3NL0A 2C2KB 1FVSA 3H2UB 4LRBA 2FQOA 2J9EA 3AJ2A 2Q79A 3BR8A 3K7AC 1RHKB 3IC1A 1R8PA 4LF6F 4ELTA 1DFDA 4TN1A 3T01A 2UP1A 3VQTA 1VRQC 2DCLA 4YHBA 4HKQA 3SBMA 3FGVA 3JYTA 3E1YE 4ZV4A 1EH1A 1N88A 1RTJB 1YDLA 2HYIB 1QDUB 4I2QB 4B9SA 3CIZA 4WFNQ 4MKAA 3CCES 3D6HB 4QWDA 3O3LA 3RUBL 3U02A 3IMQJ 3ZTQA 5AXNA 2VKRA 4NLUA 4Y7NC 4DS4A 1M90T 1TKXA 1TVRB 1TTHB 1YHQB 4DR2F 1KVKA 3A8KA 3IR7B 1QFZA 1R0CB 4ECYA 2EWHA 3KHLA 5HKKA 1UJ6A 4OYIA 3UQSA 4GVLA 3VV2B 2HZAA 1NK4A 1RB0A 1S1TB 3PR4A 4IH5A 3TEGA 5FO0A 3GTGC 3MOZA 1YITB 5KFHA 2Q43A 2AU0A 3ES9A 4C8MA 1C0UB 1QGYA 3TARA 3BSCA 4F04B 5K8NA 3CD0A 1TLLA 5CHPA 2NS1B 1X4BA 3DMJA 4M5LA 1G6BA 2KFZA 2ZFHA 4C2MK 3IS9A 2AD9A 1K9MD 5L1KA 1QUVA 1SFOK 2OAUA 4DSJA 4M94A 2VOOA 4WIQA 3CMEB 3K5LA 4MEXA 2OBRA 1X0FA 3OFHA 4GKJF 4L8JA 3EDQB 5KFVA 3KMSA 1X4CA 2CWKA 4F0MA 3OJXA 2B4UA 2E2IC 1RABB 3C16A 4OHWA 1HNIB 2F63A 1N6QA 5K8PA 4YAFA 3FVYA 3VAKA 4WFYA 4C3JK 2K7JA 2Q6BA 3CJ0A 2BJ7A 2JC1A 1H72C 3DLBA 5D78A 2QYGA 4A3LC 2XSFA 1PGZA 2E5GA 1TWFK 2DR8A 5DSZA 4G65A 2ZNYA 1TWAK 3GTPA 5D3GA 4F2SA 1MU2A 3UCZP 2MEWA 2U2FA 1UA0A 4DR2J 2CQ4A 1ELOA 2RD5C 4ZLJA 3LGMA 1OSDA 2DGXA 4CLPA 4ER8A 4M5NA 5IP9K 3RR8A 1Q8IA 2L08A 1W7WA 2ZWPA 1S1VA 1RU1A 3TZYA 3R6LB 1DY3A 3O8WA 4RD1A 5F9NA 2NXCA 4A46A 3MFHA 1Y5IB 1A7GE 5K14A 4N3GA 4FZVA 3ZTOA 2M7SA 2R2UA 1JLCA 1VQMB 2XQCA 3SCKE 2B9XA 2XC9A 2CG4A 3CCUB 1HHQA 1KTQA 2F3JA 1CJVB 4LREA 2E9RX 3R2DJ 2E2IK 2P6SA 4XDDA 3WXMA 3GEIA 5CYQA 1O0PA 1RCXB 2VL1A 3C15A 1COWA 1K73D 1TFWA 3A13A 3MD1A 2DCUA 1HBUA 4R8UB 3M8QB 1NJZA 3OZUA 1QUEA 5CYMB 3C15B 3X3UA 4RW6A 5J2NB 2Z57B 1JK9B 2RS8A 3KL9A 5HLFB 4F4KA 1LWEA 4LVNP 3EX7B 4FM9A 3SFUA 1N5VA 2E2JK 4JI0F 4USIA 1IM4A 3ZTSA 3H0GC 5G0RA 2KYZA 5JVGQ 4ID5A 4II2A 1LOUA 2VNJA 1BGXT 1HKAA 5E41A 1TUIA 3W9IA 4LF8J 1RAFB 3T00A 1EFWA 1RAJA 3GJQB 2ZUFA 5F3TA 2HHHF 5M5WK 4HH1A 5B0EA 2VQFJ 4P3YA 1O2BA 2LKZA 5KFOA 5E2QA 5T7LB 3G2XA 3FPPA 3MMLB 4PWWA 1VQLB 2PIAA 2A3JA 5ETSA 4K1XA 4ZIVA 3I4PA 1GAOA 2Y1IA 3U1NA 1F60A 1FRQA 2QTLA 5FLMC 4JI4F 1A8PA 3IG1B 2GPJA 3CCQS 1S1WA 4M1KA 1FRIA 1FDAA 4ZPCA 4CH1A 4X2BA 2IMOA 2CPFA 4KAWX 3H5UA 2RRAA 1KQGB 2FYXA 3DCAA 1EB0A 3W1YC 4PCQA 3HOVC 1S72S 3CAGA 4A3MK 3SQOP 1H2VZ 2B3TB 5HMXA 5L38A 1T6XA 4RD4A 4X07A 2V4JA 2MTLA 4GKJJ 2HHSA 1QGAA 1RWNB 3C8YA 2DHGA 3VGSA 1UD3A 5C5JA 3GTJK 4ECVA 4DX8H 2VG5A 5F8IA 4DNRB 5FDLB 2DIEA 2X1AA 2YKNB 3S14K 1A9NB 3ELHA 3CW2C 3FFIB 4NLXA 3V2UC 2HZCA 5C4XC 4RW6B 1K47A 4Z4ZA 5KT2A 2BJ8A 1JJHA 2XY7A 5A0YB 4NLRA 3KWMA 5DM6Q 5TV2A 1BJTA 2F43A 4YAOA 1UPMB 2PFDA 2F1LA 4DUTA 1LWCA 4B48A 4DFKA 4JK1A 3S0XA 4EO6A 4B3FX 1N34F 1FI4A 2LEPA 1OPIA 2J9CA 1D9DA 2E1CA 3T9NA 2OFGX 1LWCB 3ILLA 5MAOA 5CD4H 4KHMA 1REVB 1UVMA 4B9NA 2G2ZA 3P5TL 4NMXA 5J2QB 2CXEA 3KDNA 3TX8A 1E6VA 2ZC3A 3A8JA 5DQHA 4A3KC 2ABYA 2HFUA 1RWOB 1NMEB 3NMAA 1SUQA 4JI2J 2EBGA 2IVFB 1SH2A 1D8ZA 2O1PA 4BKWA 1J6WA 5DS0A 4CO0A 2UZAA 2NREA 2HSEB 2JFKA 3SLDA 3BBFA 1VBZA 2GMLA 2Z0GA 1U8WA 1YJUA 5BR8J 3OPOA 4LFBJ 2XLJA 2HW3A 4TU8A 1VQOB 3GDZA 1BWVA 3AVVA 4NZ6A 1YJTA 4M5DB 4DPYA 4X4SA 4ED3A 1EP4A 3I4MC 4OPSA 3UVJA 4CLUA 5DN6A 5IXUA 4NMLA 2D74A 4U7CA 3QT6A 2CAJA 4QR0A 3TI0A 4C8KA 1I1GA 4GO5X 4J9QA 1IKVB 4QYZK 2WVFA 3MURP 2JEIA 1QFYA 1QY7A 4Q43A 2HAIA 2E1RA 3C2PA 4I6YA 1Y11A 4ED4A 4LQ3A 1GNKA 1CJKB 2RC6A 4H54A 1TVRA 3ET6A 4USHA 2UV8G 2R93K 5KFWA 4DBQA 3D1QA 1WP6A 1W34A 3VO1A 3TZZA 1VRUB 2GGPB 1WUUA 5D4NA 3HI9A 3G4CA 4IKAA 4C3JC 5F8MA 2H1YA 2DISA 2KT3A 4ZHRA 3F0NA 2BYCA 3M4XA 3GLJA 1C0AA 4WK1A 1I94J 2DD8S 1G3OA 4IRDA 4ZCLA 3K5PA 3R6GB 1KHVA 3IFEA 1R9TK 1I94F 1Y1WC 4XR6A 1ZQ1C 4K2JA 4USKA 3PW2A 3D28A 2KWAA 5J1PA 2QJ3A 1M90D 4J37A 1S9EA 3HZEA 2ZOMA 3D54A 4DV4J 2PMDA 2MZRA 2OPSA 2CJXB 4CZCA 3HHNB 3ENWA 5TJ3A 3NBPA 1OQ3A 3HD1A 4ILMA 2J0QD 2OEJA 4DHVA 2ZKUA 2CQIA 4EEYA 2BX6A 1C2PA 3M7VA 1O5JA 4URQU 3CXCB 4DN0A 4BLBA 4K7QA 1CJUA 4OIPA 1HMVB 4ICLB 4GTDA 3GIJA 3VNVA 3DOKA 4A93K 2ZH4A 4UZBA 3IGNA 1FJGJ 2KM8C 1JKHA 4CYUA 4RWXA 4TY8A 1W0KA 1UW9A 2X6WA 3LQEA 3FKIK 5HAOA 3R5DA 1JB9A 2VOPA 4KIAA 4B02A 2QGFB 5D0GA 3RAMA 4GQNA 2HZVA 5DDOC 3ONQA 3BZQA 3H59A 3DRPB 2M9KA 3UCUP 1F5BA 4OV6A 4DV6F 1RQRA 4DV4F 1WTHD 1SCJB 4PYDA 1EX8A 1UMJA 2ZJPQ 1H8HA 1IBKF 2RQ4A 1RTDB 4BDPA 2HNDA 3ZO7A 3TOQA 2H5EA 3MFIA 1ZM9A 1FWPA 3V5RA 4ZHRB 1WDTA 1UZHA 4WWVA 3VZIA 1CPZA 1FFWB 1UL3A 1EWYA 2H9ZA 3TQEA 2V31A 3H0GK 1RT6B 5J2PB 4X05A 4HYKA 3GEHA 2NVQK 3PJWA 4FXDA 1LFPA 3EICA 4AQYJ 1UA1A 2RDIA 4B47A 1XZPB 5LSLA 2MKYA 2OD4A 1NB9A 5T41A 3NOCA 2YKMB 1G7CA 2IY5B 3R7BB 1T6YA 2N3LA 1S48A 2DOGA 4ED2A 2QRRA 4TYBA 4G7XA 2VKZG 1HQUB 2FGOA 3C14A 4OX6A 4IOCQ 3M2VA 2W01A 3P5BP 3LPXA 4LBZA 2C77A 3DGPB 5L8RC 4K4YA 2D3UA 4LF5J 1CVJA 3T1YF 4WP8A 5GAEU 4KARA 1FK9A 4DI6A 2DYIA 2JZ5A 5K8MA 2IAJA 3MR2A 4NYOA 3MECB 2RH3A 2AQ4A 5L1JA 4DU7A 2VBZA 2AZ3A 4EU0A 1VMBA 3OUYA 2NVYK 1KD1T 4HDHA 4WKYA 4XK8C 2LDYA 2QC3A 1O27A 2AYBA 2DNHA 3D6FB 2R8GA 4RW4A 2CVIA 3MWBA 1IN0A 1Y5NB 2WB4A 4LBIA 3EXCX 2ZOGA 4C3HC 4NCNA 4U6PA 3D6TB 3D3CJ 1Q16B 4KO0B 3VGTA 2ZH8A 2V2VA 4ZDNA 1V5IB 3BB5A 5D0HA 4P2NA 2HWIA 1N5SA 5K14B 3LGNA 2VU5A 1RU2A 1X4EA 4ZPTR 2G4BA 4OI4A 3G8SA 3QZ8A 2VFUA 4QIVA 4OZ3A 2PO4A 3LWMA 1P9QC 4U96A 4YB7A 2DRAA 4F0HA 5JVHQ 1FXRA 2IYIA 2F1FA 3VR6A 3QT7A 2HK3A 1CEZA 3SEOA 4M1XA 2ZITA 2RKIB 2YWEA 4KN7A 3O44A 3W2VA 1S6QA 1R5BA 3CB4A 1SC3B 4FPIA 1OSCA 4WYWA 1NJID 3K7RA 5C24A 4RLZA 4RKUC 1F3VA 4ANDA 1HNVB 2HVIA 3F41A 1XZQA 2VPZB 4RDJA 3M1VB 3H20A 2DNYA 1QD1A 4GO7X 4EBDA 2DJWA 2V68A 3GTLA 4FYXB 2VODA 2UVRA 4HTJA 2DNGA 5HK4A 4R8UA 1HBNB 2XM3A 3V81A 4DWIA 2Z4PA 1LV5A 3LF0A 3Q23A 1WCMK 5DZ6A 3LANA 3I5AA 2XHWA 3ZZ0A 1XXBA 3T9ZA 4XL9A 5B08A 2EG2A 2CKWA 5K8OA 3Q2TC 2W7VA 2XG8A 4RNMA 3KLFB 3CCMB 2DEIA 4ZGNB 1SM4A 3NGUA 1ZUNB 2MZQA 4HE5A 3VAIA 2QMUB 3WNDA 4DSIA 2CQ1A 2WJYA 1PILA 4Z37A 2G13A 3S15C 2DK2A 3K57A 5F8JA 1U1NA 3CPWB 5J1EA 1RU0A 4K4TA 1F9EB 3OVBA 3HSDA 4JI6F 4NNJA 2B7BB 4RJLA 4C3IK 3WNCA 3I55B 2YKQA 2DNPA 4KMHA 4C0BA 1XR5A 3PA1A 4KKOB 2V8PA 1YBTA 4C8LA 3QWUA 1GAQA 3KNAA 4YQWA 5IV3A 2AZ1A 1RBLA 7AT1B 3RB3A 3FPKA 4WXWA 2M52A 3AJ1A 1KMHA 4YR2A 4DR3J 4X4TA 4A3FC 3BSOA 1AB8A 2ZBPA 1IWGA 3M2UA 4ZVQB 3CD5A 2CPXA 2E2IA 1JXEA 3TUPA 3K17A 4Z4RA 3NG8A 2QE7A 2J5AA 5A0YA 1FDDA 2ZBRA 2YNGA 3GZ7A 3ZNJ1 1HZEA 2B9WA 4H4KA 1X4FA 2ZBQA 3K5MA 3NCQA 1VHOA 5D6GA 2R92A 4RU2A 2HCJB 1N5TA 4NPOA 4ZGQB 1RTHB 1J98A 2FIUA 3T5KA 1XXAA 2E5HA 2F65A 2BR0A 3RY8A 4I69A 1G4CA 5E6TA 3VR1A 1YTYA 3BGRB 1P9YA 5KFMA 2HVDA 2VIHA 4BY1K 4XIUA 3HT0A 4DSEA 2GHPA 1G7RA 2OO4A 1TVCA 3OLBA 3BM7A 3D67A 2PA8L 4ERDA 4OMFG 3TUIC 4KMAA 3BKFA 1BQMB 3DI6A 2G0IA 1FF2A 1BUXA 5KFPA 1SC4B 1LK7A 1NZAA 4JI8J 1RCOB 3B4DA 1MSWD 1JWWA 4OJHA 2B5OA 4NRTA 2C3PA 3A3OB 2VUMA 4O44A 2W7OA 4LIRA 1S4EA 3HSZA 4CYUB 3HHKA 1GMWD 4Q0BA 3G82B 3BC9A 4ES3A 2X1GA 1O2FB 4EK2A 2F4VF 3G8TA 5DETA 1AUSL 2V7TA 3WBZA 4TMVA 4ECZA 1XMQJ 2BANA 3CCZA 2KT2A 4AE5A 3GV5B 4RLEA 4TY8B 2BE5A 2VH7A 4FYYB 1M5VC 1H73A 1WC5A 4WTYA 3FEYB 4I0WA 2NUHA 4QR2A 2R7QA 1R0BG 2FGCA 5FA6A 1VDHA 4O2DA 5B7WA 4X66F 3IRXA 5A2QY 2LVWA 1P4MA 4UW2A 1S6QB 2R7ZA 4XORA 3IM8A 1IJFB 2LXUA 5IM0B 2JWNA 3RBEA 4ECUA 1E43A 2YBVA 4PWUA 5IFMA 1H38A 4PG8A 5AE2A 1Q8KA 4AT1B 1N52B 1DTQB 5CAAA 3GFZA 2LEBA 2YTCA 4Q8EA 2YWGA 4J7CA 2XWYA 4LF9F 2NVTC 4MEYA 1WC4A 3AXMA 1HNWF 2ATCB 2UXBJ 3E3XA 1TWCA 3ZIAA 3DI6B 1UTAA 5KG0A 4K4SA 4USUA 2ALZA 3WQZA 3U1MA 4PPDA 1I51B 1S0NA 1HI0P 1FRXA 3M8ZA 4QIEA 2V6TA 5JBQA 1LFWA 3EZUA 3L9ZA 5KG4A 1N5YA 2JDJA 1YCLA 3FSXA 3KYLA 3KUGA 4KAIA 5BXIA 3HT3A 1TWHK 3CJKB 2JJ1A 3SV3A 1SJFA 1EP3B 4F2RA 3GYXB 3OPFA 5GVQA 4R0EA 2QA1A 4LSNB 2QMUA 3LNNA 4M63A 4PAAA 3A4TA 2DEUA 1SBRA 1QVGB 2ZUEA 4G1QB 1BQNB 4EZ6A 1PJ6A 5A8KA 3S1NK 2FLNA 3M4OK 1Z2ZA 1GK8A 5HATA 4UQGA 3MHPA 1VQ4B 4B3GA 1U1LA 4AUKA 4DV7J 4G1VA 2J7UA 2WB1D 4PUOA 4ICLA 3GPAA 3ZXWA 3CDAA 4KBIA 5GAHU 3KJQB 3QLHB 3CD6S 1S76D 3VAFA 4OV1A 3SDEB 4RUHA 2E2HA 3RZDK 4G0VA 1SH0A 4LSLA 5FLXY 1HPZB 2F4FA 4CQJA 1I6HC 1RQ0A 4K2XA 3QBCA 1R0AB 2LMIA 2GFFA 3J81U 1U8SA 2VC0A 4LRFA 3PEHA 3LOUA 1JB0C 4A3BK 1INNA 2VJUA 2UU9J 1FX4A 3BGUA 5I3UA 4NLTA 3UNGC 1YJWS 1LQ9A 3MM9B 4GTAA 2ADBA 3CCVS 4DR5J 2XZPA 2MZTA 3CDEA 3PX0A 4QIGA 3OV7A 3MTKA 2CW0A 1H42A 3MM9A 2AT1B 3KUEA 2HMIB 5A6PA 2FY8A 3KDOA 2HQFA 3J7YI 1U1KA 3G71S 4H4KC 1NBMA 2E5LJ 3EGZA 1RAHB 4O3PA 2KI2A 1VLOA 2JA8K 4NCGA 4B3OA 2OMLA 4RCZA 3CT9A 1FKPB 3WQPA 3CMES 4RW9B 2EC2A 4WYLA 1SKWA 4RCYA 4XNFA 3FK4A 3CC4B 3LH2S 5BR8F 2OPRA 4LFBF 2V8HA 2PA8D 3JS9A 5JVOA 1I6HK 2I9SA 4RWWA 3MMCB 4U8VA 1I3QA 2RF2B 5J2MB 4BLAA 4NA1A 3CC4S 2Z2YB 1RBAA 3RR7A 3RAQA 2AEFA 2HQ3A 2R2SA 1H2UX 3ILJA 3GQBA 3IAS9 1X4HA 1RAOA 4WF9Q 3OTOF 1WKKA 1HIYA 5ETMA 5A2QU 4IO1A 3SZYA 3W9JA 2XCPA 1Q5YA 3D1HA 1XR7A 1FRNA 2B63C 3QJLA 4LRDA 1XNQJ 1O2AA 1NDLA 4UY85 4Y34A 1X7VA 4DR3F 1FXDA 4DV5J 2XI2A 1IS1A 4KGMA 1F93A 2QN6A 1B7YB 4NRUA 4XQFA 4ED5A 3IP0A 2ROEA 1EKSA 3PACA 1N33F 1U6FA 2ZHOA 1S1VB 4E8UA 1XERA 4ETXA 1I8DA 1BWEA 4IG0B 2X6XA 2W8KA 1OS5A 3S16C 4QIWL 4RD2A 3GTGK 2I8EA 3D0GE 2J8AA 3ASPA 1WELA 5ETLA 1TKZA 4LK0A 4KKUA 3CCUS 1FEHA 4FS1A 4M8LA 3D3BJ 4RX6A 5KFIA 4OLOA 3QSYA 2ZJQQ 3LQ6A 2A6HA 4II3A 3BV8A 3MM7A 3R6KA 1CC7A 1YJRA 2AGPA 4HLBA 2CZ9A 4PKDB 3LP0A 4K5SA 3OL8A 4ZK7M 5HP1B 3DYAA 5KFFA 4C2MC 3MM5B 1HBUB 3GIMA 1RACB 2J6TA 3DOMA 4F4XA 4LBHA 3BQ1A 1TL7B 1KK1A 2PHCB 4PC1A 2PGCA 5SZTA 3D0HE 2WOMA 1BD6A 4LLGA 5M2RA 1VQNB 5KFAA 1FJGF 3TA1A 4G5GA 4AL7A 4EUVA 4I68A 4C0HA 2OTJB 3HLUA 2VPWB 4JI4J 2DTJA 4FDFA 2MLZA 4QFMA 3OSPA 3OUYB 1QVGR 4CNZA 2BVNA 1NZ8A 2M0GB 3MCAA 4EYHB 1KLMB 2L9DA 3TVYA 1RAIB 4FS2A 1H7XA 1SI9A 2JX2A 1IJEA 1SIWB 3ILIA 1VQPS 4P7VA 2VQFF 2FJBB 4L6V3 3ZBUA 5KSWB 1TV6B 2CNKB 1R5NA 2UUCJ 2CPYA 3P3DA 2NPIA 2NR0A 3AOBA 3B6BA 2IMWP 3HCXA 4DU8A 4RPDA 1U47A 1Y0RA 1Q9SA 4W92B 3FNNA 5T14A 3CJ4A 4WZLA 4UAJA 3SCJE 3DLEB 2UXDF 2FHMA 1VQKS 5B0DA 4A3KK 5M3FK 4AF6A 3OL9A 2W2MP 2K1RA 2CNOB 1S1TA 4ELVA 4X64F 2OTJS 1L0WA 3C46A 5KNLA 1NSAA 1XQIA 4BY7K 4G0WA 2RQKA 5EDWA 2B7CB 2PLFA 1N32J 4F3QA 1K28D 3S2HK 1NB7A 5IC4B 4ENOA 4XKVA 1M0SA 4Z4TA 3T51B 1TL3B 3GMGA 4NWBA 1QTNB 4P9SA 3PO3C 5LMNF 2XNQA 4XDCA 3I4MK 2N82B 3WBKA 3BF4A 1FVQA 1LNQA 2IC3B 3NGKA 1FE0A 5KFQA 1VQSA 5IT9U 4KYZA 4Q45A 4QU7A 2LZJA 1RSCA 2ZM6F 2ACYA 3PCOB 3L09A 1H74A 4TMZA 3GE9A 2IVYA 4NCBA 3PW4A 2F4VJ 4QVAA 3PIOQ 4OYZA 2PMZL 5DG7A 3LVBA 2XO7A 1YWXA 4GTFA 1KZLA 4RD6A 1C1CB 1BY9A 4KKSA 1I6VA 1TL5A 4P75A 5EX0A 5KFEA 4V19J 1YNJA 4DX7A 4WK3A 3AOAA 3M2RA 1C1CA 3SI8A 5KTQA 2IVMA 3A8IA 2BV3A 1S7IA 4MAKA 1UEVA 2Y8WA 3HSJA 1ICEB 2D3ZA 3IM9A 3I6PA 3X1LB 3OLAA 4IH6A 1VC5A 4ED8A 5DQGA 1JLEB 1HFEL 2EK1A 3RAXA 1E6YA 4O3OA 2X53S 1I50A 3KG4A 3OXGA 3C16B 3OFFA 4KB7A 2AHOA 3GIKA 3GFHA 1RT1A 2KXHA 4JI5F 2YWWA 1S77D 1VRTB 3DGVA 3EYZA 2YY3A 2AV5A 2FJWA 1UVJA 1WC0A 4FBUA 3BBCA 2Y1JA 1SH3A 2JNJA 4WZEA 1F9HA 1HNXJ 1CNEA 2DNMA 4Q7JB 3DLKA 4I6WA 1TTTA 1NHUA 1K1SA 3DKDA 1RT7B 4XLNA 4C3MA 1X60A 4D3GA 3T53B 3R5CA 4Q2LA 1BE4A 3T1YJ 3DDYA 5LMZA 4EGLA 2AJ1A 4A3CK 1C1BB 2DNRA 1VJWA 2POKA 1QGZA 2IBKA 2F7VA 1Q8LA 2KZZA 1OYDA 4C3HK 4URGA 4K5RA 2V8DA 1QVFR 1JA1A 1KQFB 4WTOB 4A3GK 2Q1LA 3LTOA 1VQ6S 4XN0A 1NSQA 3MXHP 2DNZA 2OPQB 3FKIA 4RUAA 3G6YA 1VS3A 4ILDA 2IYGA 1S0OA 2WSCC 2WHOA 3MR7A 1YG0A 2XEXA 1RQPA 2RJZA 3HKWA 2FVSA 3PX4A 2C3MA 4OZ1A 1IKYB 1GX6A 4B3RF 5KW9A 4IUFA 1U24A 5DO2A 1T05B 3ETMA 4W90B 2RF2A 5J2MA 1SPBP 3CCWA 2CK3A 2NPFA 2ZDOA 2BQUA 3VGVA 4A3EC 4RUBA 3K89A 1YKWA 2M88A 5AJ3J 4N47A 5HLFA 3HO1A 4IFYA 4ZJLA 1XR6A 3FEXB 1DQAA 5KFBA 3ZBTA 1WG4A 3SDEA 2OUGA 3GP9A 4XAKA 4E0FA 3IG1A 3S2DC 1HI8A 3QFWA 3J81j 3KK1B 2G2OA 4G1PA 1UJ5A 4DN9A 1QE1A 1K8AT 4CO5A 1XQBA 1S1XA 3H40A 1U48A 4NEZA 1HARA 4QOTA 4OIOA 1FNOA 2IJNA 4HEA9 2GO9A 3GTOC 2YKAA 1SL2A 4R0JA 2GK6A 2HMAA 1U4BA 3J7YU 2R7TA 1UW4A 4ED6A 3WODA 4TMXA 1U6ZA 2GQ2A 2PEHA 2DH9A 1R27B 4QW8A 3BKTA 2E7WA 2J8SA 4TY9A 4J9NA 2HMIA 2JN9A 1UKUA 2A69A 2XI3A 4BBRC 3NNCA 4NZ7A 1J5EJ 2N4CA 2DHHA 4NLQA 3RBZA 2YWKA 2KO1A 2WYRA 5J3OA 3JTOA 2V8GA 1G1XA 1NDCA 3S6EA 1U25A 3RRKA 3RB0A 4A3JC 2FZKB 2MQMA 3PKYA 4IQXA 2XLKA 5LOQA 2AYGA 3MCOA 5U47A 1RTZA 3SMZA 1PKVA 2HVZA 3CCJS 3E2EA 3W8PA 1PYOB 1RT4B 1J6XA 4LR7A 3PEJA 5KT6A 4KE5A 1K8AD 4F0KA 4JYAF 2QSWA 4KO0A 2DYAA 2VJJA 2ZOFA 4KSEB 3BCDA 3W5HA 3OE7A 1R43A 2L9WA 3JQJA 2QMWA 4NEYA 3B8HA 3AD8C 3T5LA 3CW2A 2KU7A 3Q6RA 2EBEA 3SLNA 3GJRB 2DCUB 4WKRA 3OHBA 2FHKA 1WJ9A 3ASRA 4Y3CA 2V7XA 3MEKA 1BLIA 2C3UA 1VQOS 3VZHA 2HBRB 3CNQP 2C5BA 1ZH5A 5C44K 1WTFA 1BQXA 2ILYA 1FD8A 3BPDA 5IOTA 1GMVA 2J0XA 1HD1A 2A6OA 1X5TA 2P8IA 2HWHA 5DLFA 1BPLA 3TW0A 1L3VA 3N0VA 4RMFA 1HWLA 3MAHA 2PI5A 2AHOB 2M8HA 2VASA 4FXUA 2BE7D 2PT0A 4ZPWR 4QWCA 1F7VA 2DKOB 2A18A 1T11A 3SSSA 4LBVA 4XLEA 1TL1B 3OFGA 2B8PA 5KT3A 1MABA 2GHVC 4WFZA 2NSBA 1TWCK 2N3OA 1TWCC 1YITS 2HHUA 1XFOA 4C6AA 4J9PA 2O01C 4H4OA 3I56B 1MWQA 1S59A 2CADA 3H42A 4WCEQ 3JU4A 2WZPP 1T05A 2HLDA 5EWGA 5EWFA 5FDLA 1SC1B 4W98A 1XN9A 3VHQA 1Z4UA 4Y6IA 2H51B 4PG5A 2XMMA 4Z7CA 1UD5A 3CD6B 3N4WA 3TUZC 3UN2A 1JLGA 6FD1A 3J81k 1WF0A 3GCXP 2XNRA 4A8QA 2QX0A 2XYHB 3VMFA 2V7UA 1WTBA 1RXOB 5KT4A 3AODA 2CA9A 1HD0A 4MYUA 3I4NC 2HG4A 4WQMA 3FRZA 5C25B 3GTYX 3DNCA 2WOMB 2HK2A 3BO4A 1TK0A 3BGFA 2CPJA 4MKVA 5GMDA 1TZ0A 1ZBSA 2G0CA 3DMJB 4GKKJ 2F5GA 1WSVA 1DTTB 2CPEA 3NOGA 1YJ7A 1G7CB 3UD3P 2YNHA 4MYTA 4X65J 5LMUJ 3PVXA 1FD2A 5F9LA 4ETZA 2FC9A 1JKHB 1T8EA 3BN7A 2KN4A 4DLEA 3CGIA 2QSFA 4OYXA 4IFYB 2C2WA 4USJC 5K20B 4YFXA 2HAFA 3PR5B 3R1HA 3RU0A 3MCMA 2BE9B 2DH8A 4OJGA 3SCLE 1KTVA 3HOYC 4ZP7A 3OBIA 2CJYB 4I2PB 4I7FB 4J5OA 1Q82T 1RTDA 1X9WA 4F8RA 1BX1A 1TKDA 3UW1A 1IKWB 4GTCA 1WSRA 3WZ0A 2ASYA 4ED0A 4KC5A 1T94A 2OJ3A 3AVTA 4N8OA 3DOLA 4OHXA 2LQJA 2OPPA 5DDPC 3NWGA 1SL1A 2W2QP 1UD2A 2PMZD 3KLHB 2PE3A 3M1VA 1SV5A 2A10A 2HKEA 4NA3A 2KFNA 4BBYA 2BA9A 2RIJA 3CF5Q 1N8RD 2O5JA 1B0VA 2KT5A 4FYVB 3IS9B 5IV4A 1BXNA 5A76A 1TL7A 1F5CA 1EETA 4M5JA 2WTFA 1VISA 3A8EA 4RBVA 3T1HJ 4YELA 2AP6A 4B08A 3DN9A 3L95X 1Q79A 5IYBC 2UVWA 4CLSA 1B23P 2IM3A 3D7SB 2MQOA 3GTJA 1FK9B 4V19X 4N56A 1Q82D 5ETKA 2G9OA 3GFXA 4OJ3A 4BXXC 4QQBA 4JI2F 3GTMA 1NK6A 2DR6A 3HVAA 2ZBUA 1H2TZ 1V5VA 3QGPA 3M30B 2LQ5A 4YB1P 3N79A 5E5NA 1TFYA 2PPBA 2VBWA 1TKTA 2DHXA 1E6YB 1Y1WA 1F3FA 2FVQA 4AH6A 1QH0A 2ZH6A 4USMA 2ASJA 2ROGA 4DQPA 3OW7A 1NO8A 3BCFA 5A8WB 4V1Ak 2O66A 2HGLA 2F40A 3HHEA 3NGSA 2B63K 1ZOTA 1Q5VA 1WHXA 3IAM9 2KM8B 4FYWB 4DUYF 4UUWA 2BJ1A 1VBYA 1RGVA 4IH7A 5BYRA 4J9MA 1KOOA 1O8BA 1IQZA 5DG8A 1SQGA 4B3TF 1NKEA 4LIWA 3KOAA 3AXKA 5FIIA 1XWLA 3CESA 1O26A 2JA7A 1T95A 4TKTA 3CMQA 1ZVUA 1HHTP 2J7KA 4LSLB 4X06A 1EP4B 1X4AA 4DSKA 1HBOA 2OTLS 3F44A 4DG1B 4QPXA 2YNFA 4ZLNA 1GJRA 1NU4A 5HVFA 3SSQA 2ZVSA 1CULB 3KHRA 3C6TB 1RYRA 4ZA1A 4R71A 3FBBA 5L9NA 5E33A 4K4WA 3AVXA 4C0SA 2X3GA 3PDNA 3BQ2A 4O4GB 1FERA 3OJUA 4WBFA 2GREA 5J35A 3NGTA 1NJYA 4N7TA 1D09B 2R8IA 2B4OA 1Q8BA 1EKRA 3W2VB 2FDNA 1CG2A 1O6XA 3KK2B 2W7PA 1WF1A 1M1KD 3SJZA 5A8RB 4ATNA 4OYAA 2HS0A 1S97A 2IPOB 1VQNS 2FHJA 2JEGA 4B3OB 1ZS6A 3F73A 2GIQA 1T9WA 2HS3A 4KJIA 2FJEB 3G6VA 2V4QA 2QLJB 4UUXA 2MQNA 5KG6A 4F7DA 3LA0A 2KHCA 3MCNA 1F60B 3NKYA 5HBMB 1F1BB 1RWKB 4FBTA 2X8KA 1LWEB 4P2XA 3EZOA 1HNWJ 4C3KA 4CNYA 1BQMA 3M8PB 4ES2A 4NOHA 2BW7A 2DHSA 2QEXS 4AL6A 4K0KF 3IWNC 3JTPA 2RB7A 4ZVTB 1X5OA 4IRCA 2DGUA 2HWTA 1C0TB 5FO1A 3GTMC 1FKAF 2VG6B 4XLCA 2LFVA 1USOA 2YX7A 1SJ4P 4C0OC 3MECA 4X84A 3IRXB 3PYGA 1DHMA 2ZBVA 5AE3A 2Z56B 1OB0A 1XPPA 2ZDPA 1O24A 3J7ZT 1HNXF 4YAUA 2CIMA 3TFIA 4DR6F 1GFWB 5F41A 2BJDA 1VOMA 1VQPB 1N36F 4BBRK 1TWHC 1S1XB 1WQGA 1EARA 4XM3A 3P6YC 1CULA 4A8WA 5M2UA 2APOA 2FHOB 4MK9A 3FQKA 2GS8A 2CZVC 3MAQA 4F4YA 1IXKA 3CMMA 2AJ4A 3GTOK 2GK7A 2HFSA 2KZMA 2ZTNA 2V9KA 2HHVA 2B0GA 4DV3J 3CQZC 4CLZA 5EX3A 2VQEJ 1T6ZA 1AFIA 3M8YA 4G6VB 2B51A 8ATCB 3P4UB 2JOQA 1RT3A 1C1BA 1Q7YT 3R5AA 2JSXA 2BBEA 4ZVGA 3CCRS 3LPEA 1LW0B 2DPIA 5B09A 4CO1A 1JJCB 2FHJD 5C4XK 1ZPWX 3M2RB 1W9XA 1J5OA 5A8AA 2VDHA 1KEKA 1XNQF 3MR3A 1S7HA 1FRJA 1SC6A 1NUEA 4M95A 3BDEA 3BEGB 3PIPQ 3V76A 4EFAC 2HFVA 1RKJA 3HOYK 4FN5A 1CS4A 1SQFA 2G0JA 1Q78A 3T6JA 2CQDA 2CBXA 1NK7A 4N76A 4ECWA 1FESA 2BRKA 4FKXA 1VLYA 3V6DB 4DUZJ 1IBLJ 3JTNA 2F8HA 2GMJA 3DLGB 3HVRA 4RO0A 4AVZA 2DNOA 4XCHA 2E2HK 3AHPA 3EUNA 3WX4A 1J27A 5CJ9A 2GQQA 2A6EA 4B3SF 1R6VA 4NLPA 1NDHA 3QYYA 2RDJA 2IA0A 3BH4A 4OZJA 4MTPA 1BLUA 5C42A 4M53A 2FVCA 3KEWA 3ZUGA 4RDKA 2DY9A 4Z2XA 4KTQA 1TKTB 3TTGA 2VNHA 4JV5J 1JNYA 1JLFA 3S1MC 2FTRA 5FNZA 2MKSA 4OQJA 1N54B 5A8KB 4F67A 2RE1A 4O3QA 3OD2A 4USWA 5A8WA 1IKWA 3S1TA 4IG3A 1QJHA 4I2PA 4I7FA 3KLEB 3MOJB 1V6HA 1FNMA 3GTOA 1CSJA 2V63A 1NB0A 3CWJA 1NJXA 5IK2A 4YR0A 1RWMB 2OPQA 4CTAA 1RK8A 2BEFA 5LXYA 2MQQA 3Q8SB 1ZAWA 3CVKA 3BYPA 1FX0A 4X7FA 2IBOA 1HBMA 3D6MB 1IBCB 4ZCMA 2V69A 1HBNA 1NM2A 4X62J 3UDLA 3W5ZA 3PJ9A 4OPOA 1PAEX 1SV5B 2UUAJ 3CJ3A 4DQQA 3P96A 3W2HA 1X31C 2CNLB 3TAMA 1IB0A 2LEAA 2IC3A 2E29A 3GTKA 2CRLA 1C0TA 2HPUA 2E5JA 3HSGA 5KFCA 3DOKB 5IT4A 3LO3A 4DS5A 3BGOP 1PJ7A 3LAPA 4BY7C 1H98A 3PO5A 3CQZA 2QZ8A 3R5BA 3MM8B 2LA6A 1CJUB 2IDLA 1T9TA 3NRBA 1EFTA 1IVZA 5L9XA 2QLXA 2I5JB 4PEOA 1Q81T 2YU9A 3GB0A 1F7UA 4JI3J 1YX2A 3KJFB 4ZVPB 5KFZA 1U2RA 3PV8A 1HR0F 2KL8A 4JI5J 2PE8A 4LJZA 3P26A 1M1GA 4RL1A 4Y2KA 3QIPB 1N4LA 2JHEA 3OTCA 4L3NA 3AOCA 2FJDB 4KPYA 1L3SA 5DS7A 5HMZA 1NJIT 4HI1A 3HXMA 3JQMA 2M5SA 3KLGA 2W9CA 4C8OA 4DX5A 4DV3F 1S79A 2VUMC 1XTZA 2YKPA 4Y28C 3THTA 3NUHA 3M8WA 4DOZA 2D1CA 4B3RJ 2XY6A 4U67Q 2ADCA 2NQPA 2WVBA 2VDIA 4QJVA 5FL7A 3N9UC 1OYEA 2NSCA 5I3QA 3WIUA 1JLBB 4ZLLA 3KLIA 5BJRA 1N5QA 3ISXA 3TA2A 1SKRA 3I0SA 4C9DA 4BHQA 2QO3A 3KHGA 1RLDA 3SQGA 2ZH1A 5THXA 5GAGU 1ZZFA 4RPBA 3NWRA 4M2LA 4BPRA 3JQKA 3UN3A 2RVJA 5F0UA 4YOEA 2MJNA 4FXWA 4ZVHA 2EBBA 1FRMA 3W2IA 1W26A 4A8FA 4OYPA 1YJ9S 3FKBA 4UTGA 4DV1J 2H4WB 4F3MA 4HTIA 4AXJA 2DNQA 1GVHA 4C48A 1DRZA 2R7OA 3NGRA 3RB6A 5A88A 1QUFA 1XEZA 2P9CA 2D3NA 4N8NA 1TKZB 1WEXA 2ZH5A 2NVQC 4DK1A 1PIEA 4FYDA 1MMDA 2C42A 3DDKA 3SSRA 1PBAA 2AEJA 2NYHA 1HQ2A 2Y9HA 4ACAA 1FDBA 2KB2A 2OHDA 1DBDA 2VF3A 1I3OB 3QJPA 4A3LK 4GT9A 1NLKL 3JQRA 3AGPA 3GVKA 1PYTA 3HKZD 3DLGA 1DQ8A 4P6QA 4MMOA 2VBXA 3H5XA 5KFKA 5D4LA 1WOSA 4HH0A 1QSLA 2ZE2B 1H8EA 2MY8A 3OL7A 2CJ9A 3T19A 4E98A 5TR9A 3EJMA 1VR6A 1SJRA 2CJKA 1KP6A 4O44B 3FOFA 1ZA1B 2B4PA 3BQJA 3CC7S 1N56A 2CW5A 1BX0A 1D2EA 1YNNA 2C2RA 3PW0A 2QA4S 1B3TA 1K44A 4QCLA 2GJKA 2ROPA 2OK8A 1UWAA 5KFRA 2A2CA 5T7LA 5E3PA 4KKOA 1E64A 2D3LA 4AFFA 2VG6A 3D2WA 4OZ2A 1TWHA 3A3NB 5HZBA 4F4ZA 5AN9A 3J80U 2F1MA 2Q66A 3I32A 3UDEA 2B6AA 4DL0C 4QIFA 1IQ0A 3BY2A 1EIYB 2KVIA 1S1WB 3G9CA 2B4VA 2UUTA 2MJUA 3OW2R 2ZZEA 2GJRA 2XLIA 4YS2A 3CCVB 3N6LA 2R7XA 1EQMA 4UT4A 3DYAB 5DGAA 1QSYA 1VC0A 3Q89A 4QZVB 1L3UA 3ADAC 1WQFA 1J6VA 4X0CA 1VFJA 4NLWA 1LWXA 2WVDA 3WHIA 4HT5A 1HNZF 2VD3A 4YB5A 3QIDA 2GAHC 3R3TA 4NXNJ 4B3TJ 4DPWA 2G2YA 3B4MA 3BKUA 4YN3B 3PENA 4ZVOB 1P1LA 2WW4A 2V7QA 4F25A 2JRSA 2P3MA 4RPFA 2QT7A 2JIZA 5AT1B 5IYRA 3BGRA 3T02A 4DCJB 3FZ2A 4QJVB 3HM9A 1X8DA 3KG1A 2R7UA 3I9V9 1NHKL 4GVBA 1AMOA 2WPDA 2R2TA 2OEMA 2B43A 5E3RA 2DVIA 1UVKA 4CRJA 3K2YA 3RZOC 2W9CB 2QV6A 4WU2A 2PC6A 4RW4B 4A3GC 2CRVA 3NCRA 1AFJA 3CULA 2BKNA 2WCXA 4WJ4A 4ED1A 3OTOJ 4MK7A 4P2SA 2OD6A 1HNIA 2HHPA 1DCPA 1N48A 3GTKC 2JA5K 3ONUA 3BR9A 3BGLA 1GEHA 4Y2IA 5IYCC 5IC6B 3CCRB 2HURA 2YX4A 3JAMU 2DPJA 4LVOP 2M4MA 3SEJA 1NK5A 1XE1A 2JH3A 1H6KX 3F56A 3M6WA 4LMZA 2Y3YA 5E3CA 5RUBA 1NDPA 4DPUA 2FLLA 2VA3A 2UV8A 4QV2A 4HT7A 2IM0A 4K4UA 2GX8A 2HIQA 3GCWP 2QMXA 1TWAA 2AIRB 2KRBA 2EPIA 4X62F 3CCLS 4LQYA 2WBRA 2V7VA 2VBTA 2WRMA 3DLKB 5GADU 3PM9A 3Q0AA 4WP9A 3OAAA 3MR5A 4O23A 2P9GA 3DXBA 4KGKA 1J5EF 1T3NA 1TUGB 4IG3B 3MPWA 3OPKA 4EYIB 1LEOA 3DOLB 3HDSA 1GXLA 1YBUA 2DB1A 2J0WA 3HJFA 3ZZUA 4ZKAA 2MLXA 3OFEA 3TVZA 1USMA 3RGIA 2RU3A 3MMPA 2YX1A 3QQCD 1N6QB 2RRBA 1PAUB 1D9FA 4ALZA 2D9PA 2EW9A 3EM1A 1N34J 1T03B 1D9AA 4PG4A 3HJVA 1WKJA 2YWFA 2UVUA 4Y7CA 3FEZA 2BM1A 3OTDA 4IO9Q 3H4BA 1E1QA 2FJVA 2W9BA 2HNYB 3FOEA 3AH6A 2LLZA 3G4SB 3PXGa 3TFHA 4CM2A 3MMAA 2RSQA 1RHRB 2D69A 5KAKA 3W2WA 1ISEA 2PMWA 2RHSB 2I5JA 2AKWB 2J9DA 3LPYA 1Y10A 3FCWA 2HDNB 4URSA 2MPUA 2CPZA 1RTIA 2CQ0A 2ZL5A 3QRQA 1Y0HA 2X7IA 3R5JB 3GTPC 1HVXA 2VYQA 2MZJA 1WC1A 5C3EK 3GTPK 1XNRF 4DQKA 4GMKA 1KQSB 1SJQA 3G8QA 4DMZA 2VPYB 2DR9A 1CNFA 1WD6A 3DRXA 1JX4A 2R9VA 4P5BA 3ZFVA 4FWTA 2WAQD 2XZOA 1JLBA 1QG0A 4QYZJ 5B0CA 1UETA 3M32B 2DO4A 2XNCA 1NXIA 3OREA 4DNTB 2ZL6A 4M5HA 3ISNC 2XCQA 4A3IK 3MZIA 1UVIA 3BP8C 1KNZA 4WPAA 4GC7A 4OHYA 1FNDA 3CCEB 2BDPA 3MMBB 4G1BA 2XCRB 2JFDA 5ITHA 3BDPA 4ZPVR 2DBBA 4HHHA 3OZVA 1OHHA 2B56A 4A8OA 4UZCA 3S17K 4WZMA 4DR4J 1R8AA 4NXMF 1T3OA 4WJ3M 2DNNA 1OY6A 3UE2A 2ZM6J 1TWAC 2VFSA 1DTTA 3TVKA 4UZEA 1UD4A 5ETVA 4LFAF 3TAQA 4UOGA 1EETB 4KV8A 1TL4A 2K7KA 4A3JK 3VVUA 2E1PA 2KG0A 1MN7A 1SL0A 3KJVB 4IFVB 4PC6A 3CD7A 1JIHA 1G7SA 4XLPA 2Z8QA 4F4WA 5HMWA 1GQEA 1VC6A 4DV1F 1XIQA 2WONA 2VG7B 2LXFA 4Y00A 3H3VD 3TYTA 3S8SA 5CH7B 3I55S 1IBLF 3TWZA 2IM2A 2ZH9A 4EWTA 2BVZA 4OX8A 2ZEJA 4FF1A 1X9SA 5IP9C 1DAXA 3CCJB 5HROB 5IYQA 2OBTA 1HMVA 3CDUA 3ENQA 5D4DA 3BNWA 4B43A 1K73T 3BP3A 5F4JA 2GA7A 1F20A 3R97A 2BGIA 4WIIA 4JOUA 2JVRA 4KM9A 4AQYF 3CJ5A 4TSFA 3V6DA 1EAYC 1M5HA 1RT1B 3CP8A 1V3ZA 5G4DA 3IBFB 1TAQA 5HBMA 1V3SA 3TR5A 2AJQA 3OVSA 1YIJB 4YFKA 5DDRC 1MRZA 5EMNA 3T41A 2EFPA 3M32A 1ZAVA 4KY3A 1SMYA 2ZJRQ 3N3YA 4MFBB 1CQMA 4DFJA 3FSYA 4Y7NK 2QN6B 3RBDA 2VUMK 3IGVA 3OEHA 1CQXA 4JV5F 3CUNA 5M5XK 3AA8A 2NV4A 4AYBL 4WZKA 3CC2S 3KK3A 2C28A 4IDKB 1YJVA 2E2HC 1VRUA 3ETOA 2X1BA 3NS5A 2ZTGA 2R3VA 2Y1RI 1YGYA 2VG5B 2WSFC 3W5UA 1M5KC 3SYZA 2V7WA 4WXOA 2KVQE 2L48A 2XMKA 3T1HF 3FKSA 3HKZL 3N6NA 1RT4A 3AH5A 5DGBA 1DCOA 1ZM2A 3L7PA 1SFOA 2OPRB 3CCSS 3Q38A 4KMUA 1Y3KA 3US5A 3HHLA 1WI6A 2C78A 3K8WA 4WFAQ 3LP0B 2AJ2A 1C0UA 2MQLA 3VO2A 3VAHA 4RZRA 5IWAJ 1VQ6B 3GEEA 2DETA 3UD5A 1VK8A 4DL6A 1HA1A 2EVZA 1MROB 2I0XA 1I18A 2H3EB 1MNEA 2ZKTA 4ZVRB 2HHWA 3ULHA 2NVXK 4BWJA 1IBAA 1KVIA 1Q0NA 5HVHA 4ECQA 2VBUA 2NYIA 3R7NB 3QO9B 4YALA 2XB2D 2GSUA 2HHXA 3HVWA 5DDQC 4RUCA 3HPOA 2M8DB 2UXBF 1KQSR 2C1EB 2R93C 4DR7J 2OSRA 3QE2A 1DCHA 2EFOA 3DFEA 2QA4G 1B64A 1K83C 5B0FA 2H4YB 2HQGA 4DLGA 1GTHA 4B44A 2UXCJ 3KK1A 1RHJB 2G1HA 4MIWA 4TYAA 4DV0F 5F8HA 1UV7A 1I50C 4DR1F 2W24A 3G86A 1KBRA 2QL5B 2B5JA 5LMUF 4OYBA 4X65F 1I6JA 2FX3A 4CI0B 4KKTA 5LT5A 2AYEA 4LFCJ 1JLAB 3RZDC 1QAYA 4CLLA 5IORA 1RTIB 4LF4J 4ED7A 2DGQA 3DXJA 1JLCB 1WWHA 7FDRA 3R2CJ 2WAQL 1XZPA 1N05A 3R8YA 1TWGK 3GTLC 1HW9A 2VG7A 4DCPB 4EMDA 4LF4F 2WVEA 1S9GA 5KFUA 4ZJQA 1RAEB 3PRBA 2KTQA 2RS2A 4Q8FA 4DR4F 4P6VF 4HI2A 4BCAA 4OYOA 3C6UB 4ZH4A 2PMHA 5L1LA 3QSYB 1WF2A 2JA7C 5IYDC 2J7WA 1CC8A 1HQUA 5KT5A 3IXQA 1Q1KA 3HOXK 2BKPA 3KJVA 1EFCA 1WG5A 2WBMA 1PKUA 3N01A 4FF2A 1IR2A 2VFTA 2HFNA 4KV8B 4O0IA 1GMWA 4EH1A 1U7LA 4CLYA 1R9TA 4JV2A 2NCKL 1MW7A 2M70A 3I1FA 3H0GA 3WYAA 3DDIA 4MK8A 1IJEB 1NCLA 4XSXA 3W3SA 2W1BA 1CJTA 3I31A 3NXZA 5C3EC 2MKHA 1S1UA 1U1MA 2EC0A 5GMKa 1JNRB 3QFHA 5CA5A 3C19A 3DRSA 2BF4A 2PFFB 5DZ7A 1QUPA 1Q81D 4Q2MA 3PO2K 4MQ9A 1IKVA 5EGHA 4JB8B 3NS6A 4WP3A 2HRTA 3GG1A 3SIPB 3GTJC 3AB2B 1U1QA 4A3CC 4KR0B 4YEJA 2C2MB 3KNGA 1YSJA 4MH8A 1YQHA 2FZCB 2XYPB 5JXSA 4OZLA 2GSNA 1RUSA 4H4MB 2FQQB 4FKYA 1U09A 2RUSA 3T5HA 2QTWA 3UVJB 4RBUA 1T7PA 1R7IA 2HVEA 4DL4A 4M5DA 1TELA 3DC2A 3T3FA 3M9NB 1WEZA 2DXEA 5KG5A 2Z30B 4DSLA 4DV7F 2WB1L 1TWGA 3NNHA 5AXMA 2JLFA 3Q24A 4CM0A 1PO6A 3Q8YA 4OL8A 3GTMK 3FRYA 4YEAA 2YKMA 4BBSC 2X6YA 1FJ7A 4ZOSA 1FRKA 2MKJA 3A3BA 4LRCA 3PVDA 4CQ1A 1HI9A 3NBPB 2WW8A 1N5YB 2VFVA 3HAGA 1KK3A 2UXCF 2XGQA 3GIIA 4IR9A 1L3KA 1KN6A 1NH7A 4NYPA 1VQMS 2VQEF 4P26A 2M5YA 1ZA2B 3K58A 2YQ3A 2ILZA 1ZM3A 2MY7A 1W2BR 2V6AA 1XMBA 4A8KA 4H4OB 3W8GA 5KFLA 2U1AA 1QAIA 4Z4WA 2K8GA 2HHHJ 2WSSA 3CP2A 3AVUA 2OELA 4GC6A 2FLPA 5M5YK 1ZBTA 1CJKA 5H1SV 4RDLA 1URRA 1WHVA 3UDVA 2E1BA 3TUJC 2QG9B 3G4AA 3OTBA 2COLA 3D0IE 3MHYA 2W9BB 3OVAA 2ZZMA 5B0AA 5IT0A 5HL7Q 1UD8A 2XZTB 5FJ8K 4MKBA 2J0SD 3SCIE 1UFWA 1P8GA 2Z6BD 3DM2B 1I3QK 3QZ7A 2RDDA 3BBBA 3S1MK 1Q7LB 2RHQB 4DK0A 2Y1LB 3GFYA 5J2QA 4DJBA 3S1QC 3QAEA 3CPXA 1ZYRA 3GTQA 3MEDB 2XNJA 4NYZA 3PX6A 2RH6A 4P25A 3OXFA 3KHHA 3T6BA 1RWPB 4RW7A 4EBCA 2MZSA 4KT0C 3R9LA 2R42A 1ACMB 2O67A 2R7ZK 4OINA 4A3BC 2FJAB 3OQ2A 3C14B 3CJ2A 3FBEA 1U0SA 3PFEA 3MAAB 3N6MA 2I1LA 2WVCA 4OX9J 3V6JA 4C98A 2QA4B 5LSRA 4LF9J 3CSKA 3OL6A 5JUMA 2XS7A 3OSNA 2KXNB 3W62A 3KJNB 4PC2A 1X5PA 2C2EA 3FQLA 3MF5A 4RNHA 1N33J 4PABA 3OR2B 1VJQA 2EFVA 4Z4YA 2XGJA 2K1RB 2GJIA 3MR6A 2V6UA 3AA9A 1WEYA 2D9OA 4TQRA 4QIWD 1UP1A 4Y52C 2KHDA 4L3KA 2HFOA 4A48A 4ECRA 1ULRA 3CJTA 1Z2LA 1JJ4A 3WNBA 3EVOA 3GILA 3U1LA 4DL7A 1UWBB 2YKNA 3NEKA 4KFBA 1X4DA 2XSJB 4O4RA 4Y9RA 4C8NA 3CJRA 4YXWA 5ETTA 4FNHA 3Q83A 5GMEA 4CDIA 1VIXA 4OI6A 1OY8A 4LSZB 2QIFA 2DGWA 2CUYA 3LP1B 1FJCA 3UPFA 2CFAA 4CWBA 5ETPA 3E51A 4JI7J 4Y65A 2L41A 3EZ5A 1RBOB 4TU7A 2AX1A 5LSOA 3RRHA 1U02A 4C11A 4QVJA 4X64J 3PYFA 2XHCA 4DR5F 5TY0A 2GQFA 3M8RA 5HQLA 3EVWA 4UF4A 5SUHA 3BO2A 4NZ0A 3EMTA 3U27A 1HNVA 3VNUA 5JFEA 2EXUA 3H5YA 3VGUA 2B5JB 3KXDA 1KD1D 3R5GA 1KC8D 4A8MP 1RHQB 1IBKJ 5D4PA 3FSIA 3C3LA 1Y1WK 3ONYA 5D15A 4C7QA 2RUGA 4RNOA 1KK2A 5K9FA 2UVVA 4LF7J 3L7UA 1FA0A 3CCQB 2P5MA 4UQTA 2GO8A 2BE2B 3DRRB 3EGVA 4ZVFA 3MI7X 5KFSA 2B63A 2CPIA 1U1PA 4U9UA 2UUBJ 1QAJA 2P6TA 2VA2A 4KATA 1H3DA 5A6WA 1X4GA 4P73A 1RA7A 5C4JK 1XNRJ 2EI5A 4KRWA 1RT7A 1KOHA 5J1NA 3LALA 1S0VA 1KDNA 4AF7A 3KUHA 4PG7A 2ASDA 4B9LA 4YMEA 5KFNA 2N7YA 4YDXA 1BJKA 3EPGA 4JMQA 2YNHB 1F0XA 2PSZA 3HOZC 4RBTA 4BS2A 5TMCA 2WSEC 3LAKA 4ILLA 2AYMA 5IP7K 9RUBA 2L3MA 4TMTA 1VF7A 2XYGB 5CZVA 3EPIA 4KH1B 3BN4A 1RT2B 3VA7A 1F9NA 4NE9C 5CDFA 5L1IA 4QWBA 3H5SA 4X6AK 3M2VB 1GE9A 4BWMA 4LF2A 2IFXA 1B4BA 4CLKA 4DPXA 3CC2B 3UN5A 4Q0BB 5H5JA 1JLEA 3ASSA 2Q6KA 2K3KA 4K4VA 2B6AB 4OLPA 5ETQA 4I1TA 1SKYB 2P8TA 1JLFB 2M2BA 1DARA 1VJSA 4J91A 3D4JA 1XB2A 4K59A 2B9YA 3MEDA 3QGIA 3DXSX 4M5MA 4KMDA 2UUCF 4R5PA 2K3IA 4LC0A 1TKXB 5E68A 3D66A 4ID5B 1GH8A 1IBMF 1FRLA 1AROP 2XCOA 4KN4A 3UWTA 5HROA 1RWWB 4DV5F 4C4WA 5D3GB 3L4KA 5F8LA 1QLNA 1I50K 4JI3F 1WHWA 4I2QA 2OKQA 4J9OA 4C8ZA 2QDXA 3JSTA 2IJRA 2W4PA 4RNFA 2E44A 3Q8RB 5BYQA 3BJYA 1U0HB 2GQCA 1SVDA 3BREA 5H9EK 1M5OC 1GR1A 3PFOA 5I42A 3NAIA 3NNAA 4ITSA 4B9UA 4PRFA 1YZ7A 4I67A 2RMLA 1URNA 4IW3B 4ECXA 2CNNB 4C3IC 1OGIA 1NAQA 3ILOA 2R7VA 4OZNA 5JMNA 1NDKA 1YJNS 3HHDA 2UUAF 3MM8A 4C8YA 2HHQA 4X4UA 2XZLA 3I56S 1XZQB 4LR8A 2NLWA 3OFNA 4RW9A 4KH0B 4CIOA 1KLNA 4C43A 1NK8A 1J5OB 1KRHA 1GX5A 1R8HA 5I3PA 1OMSA 4G1QA 2EKYA 1WI8A 1ZETA 2HBQB 4LOWA 2HNZB 1TUVA 3ASTA 4TMWA 4G1IA 4NX9A 2AMCB 4PC3A 4P3IA 1NKCA 2HGMA 2RNEA 1UCNA 2NXNA 4PC7A 1IE0A 1B7FA 1VQ9S 4Z1MA 2VB6A 1YJ9B 2FC8A 4LR9A 1YBAA 1DJ0A 2VJVA 2RQMA 3A3GA 1VGXA 5GADI 4OI1A 3S1NC 3L4BC 1AIPA 3HOWK 4HIZA 2B9EA 1PSDA 4PWDA 1XK8A 3KFWX 3W66A 5CCLA 1SKQA 4TQSA 3HMJG 3IA0A 1MU2B 2BGJA 4AYBD 4OOVA 3OT9A 5B0BA 1IKXA 2W6JA 1FDRA 2VHGA 1TMJA 2OMOA 4CO2A 2MHEA 3ERED 4A3DC 2F8MA 1U1RA 5HI7A 1KQKA 1N07A 1KC8T 1VQYA 5TRDA 5HN0A 4ZMMA 1IM6A 2OYNA 3O2IA 1S5ZA 4G7OA 4IOBA 2H65B 5K5MA 1RKIA 1RTJA 2ZH3A 1G7TA 2MXYA 4XN3A 2W2NP 5CHCB 2YPYA 3JYTB 2D7SA 1J2VA 1SJ1A 1Q53A 3MDFA 3V7AA 3Q86A 4P72A 2VBVA 3B78A 2EFQA 3CEDA 4N5SA 2GW8A 4P71A 5DRKA 1RT5B 4YAWA 4X7DA 3EQLA 3R27A 2C2DA 1H7WA 4CTAB 4M0LA 3LO8A 3Q8PB 4N77A 3S2HC 5L46A 1Q86D 2FB0A 2BJ3A 2DXFA 3HOVK 2XWXA 1UEKA 3CMAB 4Z4VA 3TAMB 5HZAA 3BH6B 4UZUA 3G96A 1F2GA 1YK9A 2WR8A 2BJ9A 1WC3A 4LF8F 1YIJS 5D8HB 4ZCIA 1VQ4S 3W7BA 4OI3A 3E01B 5IT9Y 4P74A 2X3DA 4S0MA 2OLWA 3V4IA 4LR2A 3BSAA 1O29A 2W6IA 4ZPDA 5FLMK 2CQHA 1VYAA 3BH7B 3Q3AA 3UD4P 5KG7A 1FO1A 1U45A 3H8YA 3IN5A 5F8NA 2V8VA 3MEGA 2YNIB 5CD4A 3AFGA 3CJSA 1ZM4A 2NVYA 4OHVA 3VTIA 4N41A 4Q5VA 2DIVA
chains in the Genus database with same CATH topology
1XZPA 3GEEA 1PJ6A 3TTGA 1VLOA 2GAHC 4P9SA 1XZQA 3A8JA 1VLYA 1XZPB 3TFIA 5L46A 3TFJA 1WOSA 3ADAC 3A8IA 3AD8C 1PJ7A 1WOPA 3GSIA 3AD7C 1WOOA 2GAGC 3A8KA 3GEIA 1V5VA 1WSVA 1WORA 1VRQC 3TFHA