1WSVA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
371
structure length
371
Chain Sequence
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Aminomethyltransferase
total genus 117
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsvA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsvA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsvA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsvA03
1VLOA 3GEHA 1YX2A 3GSIA 3AD9C 1WOSA 1WSRA 1WSVA 2GAGC 1VRQC 4P9SA 4PAAA 1V5VA 3A8IA 4PABA 5L46A 1WOPA 3A8KA 1NRKA 3GIRA 1PJ6A 1XZPA 3GEIA 3AD8C 1WOOA 1XZQB 3ADAC 3TFHA 3TFJA 1X31C 2GAHC 1VLYA 1PJ5A 1PJ7A 1WORA 3TFIA 3AD7C 3A8JA 3TTGA 1XZQA 3GEEA 1XZPB
chains in the Genus database with same CATH superfamily
1JQWA 3TO8A 1KHVA 4JBCA 1RQRA 2DD8S 3GV8B 3U7JA 3RZAA 1VGXA 2FQTA 2ZZFA 1TVRB 3F41A 3TX8A 3QE2A 3DXSX 4TMWA 4FPIA 3G82B 3W5ZA 4Q0BB 4KB2A 1R0AB 3KK1A 2DNKA 4Q2MA 2FVGA 1UD8A 2LA6A 4OI6A 2QL9B 1WHWA 2CNNB 3Q8SB 1YLOA 1NJWA 1IS1A 1YZ6A 4KGZB 2RF2B 1GE9A 1SMYA 3I9ZA 4C0BA 3S1RK 5D8HB 1S4EA 4ZLPA 1PCAA 5ADZA 2AZ3A 3CC2S 2AYBA 1IQ0A 4H4KC 2ZH7A 3UCUP 5TRDA 1YJTA 3OEHA 4GT9A 4G7XA 1DURA 2D9OA 1R5NA 3H5UA 4NLSA 3BC9A 1T95A 2NS1B 1RT7A 2CDRB 5C42B 1VOMA 5CJ9A 1FNMA 3LP1B 4DL2A 2EFGA 1LWFB 2EKYA 2ASJA 2QE5A 4B9TA 4Y2AA 4LBWA 4DV3J 3PIPQ 1K1SA 3GTPK 2DR6A 2A0FB 2V7VA 2P2CB 2J8SA 3CQZC 5DN6A 4ALZA 4EUVA 1U26A 2JA6C 5LT5A 2FJDB 3AJ1A 3KMQA 4K4SA 1DTTA 2VODA 5L1IA 2JIZA 1UP1A 1WF0A 3CAGA 2KWAA 4JI8J 3OHBA 4K4ZA 3C15B 3PEJA 4DUZJ 4RBUA 1MRZA 3ISXA 2GNKA 1TK0A 3CE8A 3CJ0A 3CMEB 1U0HB 2PN6A 3S2DK 3KOAA 4M1KA 3MPWA 4FYVB 4N7TA 1NJID 3K8WA 1VQPS 5DQIA 1S6QB 4P7VA 4WE1B 4A3CC 4Y2KA 1TWAA 5E33A 2OBSA 2PT0A 3Q8VA 2ZH4A 3WBZA 2ZH5A 4P26A 5KFSA 4NL5A 5KFHA 4NLXA 2GHWA 1S1XB 4BC7A 1RU1A 3PO4A 4M2LA 3K7AK 1WEYA 5CYMA 4BBRK 3H8YA 1S76D 4WFNQ 2V9KA 1QSYA 3W3SA 4H4MA 2GC8A 1N34F 4A3BK 4Y00A 5A6PA 3KLFB 3HOUC 1YRUA 2V2QA 3WBKA 2MGZB 2Z8QA 4OL8A 5KG5A 1RTHA 3P27A 2E1MC 5KFNA 3WIVA 1K28D 4KFBB 1TV6B 3I6PA 3LF0A 2DNPA 3EXYA 5KFLA 4Z7CA 2KHDA 2YPZA 3W2VA 3D6MB 2AGPA 3MGJA 4PG5A 2P9EA 3DN9A 5E3CA 4MIAA 3U1NA 3ADAC 4J9RA 4OX9J 2BQUA 2B4OA 4B43A 1Y1WK 3W1YC 3M4OK 1U2FA 1U2RA 4L3NA 4DX8H 3HHLA 4WYLA 4XO0A 3N0BA 1ULRA 4ICLA 4JB8B 1RI7A 2FZCB 2AZ1A 3WODA 2GVZA 1M1GA 2PA8L 2ROEA 2RH6A 3AD7C 2VNKA 2XCPA 2KZMA 2ZOFA 2XI3A 3P5BP 1N05A 2VOPA 1V3RA 1WI8A 3ETOA 2P6SA 4WBFA 4Q2LA 5KG6A 2XNJA 4LBHA 2RDIA 2APOA 4BLAA 4RNFA 1HHQA 2IM3A 4DV5J 3FSYA 2YVSA 3CMMA 4JI6F 2DH7A 3HVTB 4ZVPB 2O1PA 3K5MA 5KFUA 3DDKA 1U45A 2RC5A 2ZBRA 3JSYA 2MQPA 4AQYJ 1R5BA 4PCQA 3P5TL 2CNLB 4ER8A 1J98A 2MSSA 2XGQA 1TWHC 3S0XA 4B9VA 4KO0A 1RWOB 2UXCJ 3HVWA 1S49A 3MEEB 3LAJA 2MKCA 3NCQA 4LJMA 4DEZA 6FD1A 3TEGA 1J9ZA 3IFEA 5BYQA 4G3IA 2R7VA 1OHHA 1SKQA 3Q6QA 2IAJB 3PKYA 1A6LA 1UJ4A 2ZXIA 7FDRA 4HVZA 4A93C 2D3NA 3KLHA 4ED1A 1BD6A 4Y65A 2DCLA 4KJIA 4H9GA 3W2WA 5ETRA 2L9NA 3DKDA 1F5BA 2K7KA 3FDSA 2E5JA 3LALA 4QYZK 2CQ4A 2IBOA 3IGNA 3BKFA 3WBJA 3FQKA 1G7CA 2FJAB 2AEFA 4QJVB 1EFUA 5H9EJ 3AVTA 2VB6A 4A3EK 2PO4A 1CULA 5J2NB 2RU9A 1B4AA 1B99A 4UF4A 4KMHA 1QFYA 1KN6A 3MMBB 4OYIA 2BW2A 5LXRA 3CC4B 2RMLA 4KGMA 2JC1A 1V5IB 2JJ4D 3DRYA 3S15K 3GJRB 5I3QA 1R31A 4B9LA 1RT7B 4GFQA 1BDFA 3MPDA 1XNRJ 1E6YA 3B8HA 5LJ5Y 3MR2A 2OD6A 4KFBA 5D0RA 2IRYA 2R7TA 3Q2SC 4KT0C 4B08A 4EU0A 1BJTA 4RD4A 4KASA 2RUSA 4PUOA 1TL7B 3AVXA 2FLPA 3AY0A 1S1VB 1XZQB 1NHKL 3D1QA 2RS8A 3RU0A 2C78A 2VH7A 5K9FA 1RCOB 1I18A 4HT5A 2NZCA 3HDSA 1AFIA 4PRFA 1AZSA 4F3MA 4FBTA 2OPSB 4ZS6A 1IJFA 5I42B 1U1RA 4FF4A 5A8WA 3LQ6A 4F4KA 2J9EA 3H0PA 2KT3A 1FFWB 3EZUA 1QAXA 2CVIA 1W7WA 4HT7A 3C19A 1DQ8A 2QX0A 1XIQA 1CSJA 4ANDA 4WFAQ 1KJZA 5D4NA 2J6TA 5EX3A 1WC6A 1T9XA 1F20A 2XULA 2MLYA 3SBMA 1EETB 1RACB 3MFHA 2PEBA 4ERDA 4BY7C 2XCOA 3Q6RA 1RQPA 5CYMB 3IPJA 3DOLA 3R6JA 1YDLA 2KXFA 4B3TJ 3PA1A 4JI5F 3G4SS 2IRXA 1EH1A 3LQVA 2QA4B 5LSOA 5M3FK 3M2RA 1S5ZA 2Z2YB 4DR3J 2NXNA 4KR0B 2ATCB 1AW0A 2B9XA 3M1VA 2A10A 1YI2S 3T6BA 3KHLA 2XMKA 1T9VA 5RUBA 3I56B 2OTLB 1G51A 4ELUA 5ETPA 3NOGA 1W2BB 1C1BA 3RZOC 3ZZPA 3HHEA 2W24A 3FEYB 2RIJA 5IV3A 1HR0J 1Y0RA 4Z4ZA 1LXNA 1VRQC 1VBXA 1QE1B 1CJTB 3M4OC 4L3KA 1I6HK 2RSQA 2DIEA 4XTTA 3BUEA 4QQBA 1GAWA 1IBLF 2FVRA 2CQ0A 1UD2A 4USIA 2IVMA 3QQCD 4WZLA 5U47A 3ASQA 1GEHA 4CLZA 1VF7A 1F2HA 3ZNUA 4ZGNB 4OPOA 1UFWA 4BLGA 4EBEA 1KK0A 4FS1A 1WC0A 2KVIA 2HNYB 1N8RD 3HM9A 4IRDA 1HBUA 3L95X 4A3BC 2QTZA 1K1QA 3CJKA 1GAOA 4MK8A 4J91A 4EYIB 1AUDA 1KWMA 1RP5A 4DR6J 4DBQA 3MOJB 1QTMA 4DL6A 3J7Z5 1P9YA 2M52A 2BVNA 3PXGa 4KMAA 1VQ9S 2QSWA 4B3FX 2RH3A 2B8PA 4X2BA 4PR6A 2IJNA 1ZS6A 1U7LA 1VQLB 4PQUB 2L9DA 1K83C 3OXLA 2QC3A 5CQGA 2VG7A 2F1FA 5IM0B 2BGIA 1BX1A 3M8WA 5EHHA 1TWAK 2R93A 1NKCA 4QHYA 3T56B 1J5EF 1TK5A 4X07A 2W1BA 2BF4A 4AYBL 4Y9UA 2HWTA 4G1QA 4IOBA 2BJ1A 3E1YE 2N4CA 3SKBA 4ETXA 1RKIA 2MZSA 3KK2B 1CQXA 1HPZA 1NB2A 2CQHA 1QUVA 4USMA 4YR0A 4NA2A 3PZPA 2E2JC 5C4XC 1D9AA 5I42A 4U7UK 2CJAA 5G0RA 3OW2B 1N0VC 3DRSB 2D6FC 4KV8A 1GVHA 3HOYC 1NDHA 2YNGA 1H72C 1TUWA 2ZWPA 2JVOA 2KU7A 4UY85 1K8AD 1B0VA 3W9IA 4PXCA 3TUJC 2QYCA 3KLGB 2XZOA 3RBEA 4TSFA 1T5EA 4RJVA 4G1BA 2DY1A 3EX7B 1K0TA 3IR7B 5G4DA 2O01C 5KT4A 4U7UD 2IHR1 4Z4VA 1H2UX 2P3MA 4UZUA 4DQQA 3US5A 2XTJP 4DV2F 4K2XA 1TWGC 4YFXA 2VQFJ 3V2UC 3SQOP 4ES2A 1WWHA 3CRZA 5DDPC 2QLBB 1AA1B 4MIWA 3S1RC 1IWGA 1S6OA 2VPXB 2V7WA 3AHPA 1HW9A 3M3YK 4KM8A 5GMKa 2FC8A 1PJ7A 3FPPA 1N52B 2DCUA 1R8CA 2RKIA 5D4DA 1RWVB 4WIIA 3D1HA 2FY8A 4X4PA 1YHQS 3FEZA 4OZ2A 1ZOTA 1EFWA 2XLIA 4HHHA 2J9DA 1RAJA 4G1IA 1N0UA 1T7PA 5C24A 3MUMP 2DPIA 5SZTA 4F0HA 2ZE2B 1Y5LB 4OIXA 3BH7B 4A47A 1FRJA 3T5LA 3ZTSA 4P5AA 1ISEA 2HHPA 2W2NP 3GTGC 3O44A 3GTQK 2HHXA 3PO2C 2WB1D 2I1LA 2JA5A 1U6FA 2C28A 4P3YA 3N5FA 3JS9A 2V68A 2XQCA 3VNVA 1NZ8A 3TAMB 4RJLA 1H85A 4QIEA 3OP1A 1OYEA 2F4VF 4DJBA 5LMNF 5LM7E 1TWFA 5F0WA 2GVDB 2ZC4A 2K1RB 1TKXB 3GVLA 2D9RA 1YLXA 3KEWA 3V6DA 2OO4A 3R7NB 1LFWA 2C3UA 4GKKJ 4HR2A 2XY6A 5E0OA 2NYHA 1JLCB 3T9NA 1SKSA 2KDOA 3OSPA 2V5HG 4QIFA 2XGJA 5A88A 3M05A 4U95A 4LR8A 1FVQA 2R2RA 1L3TA 2VUMK 2V4QA 2VJVA 2A1BA 1V5VA 3IRXB 3RRGA 1DLOA 3ZC3A 1JLFB 2VZ9A 3FZ2A 1WHVA 4G7OA 1KTQA 2KVOA 1AZSB 2XS2A 4O3QA 5D4LA 1UMJA 4QV2A 2RJZA 4DV7F 4BXXK 1E43A 3ENAA 4WZEA 1T6ZA 1WUUA 2B7BB 2HHTA 4CLLA 5B0AA 3H5XA 4DK0A 2XS7A 4KPCA 3CD0A 4AE5A 1XR7A 4XLPA 1CJTA 4B3XA 3CCVS 3QZ8A 1FWLA 4B3GA 1NSKL 3MI7X 1UTAA 5KFCA 1R5OA 3RW7A 5L1KA 3PACA 2IBKA 2HS0A 5DRKA 1T05A 5DM7Q 4XD7A 2ZVIA 1TLLA 2GQFA 4CH0S 1JNYA 5B08A 1I3QC 1W2BR 4ECXA 5E3AA 5DGAA 3C14B 4CTAA 3DDIA 3F44A 4NI2A 1D9DA 1C0TB 2GO9A 4E8UA 4JI4F 3HVRA 2OPPA 3I1FA 3D26A 2YWEA 1D8TA 3AA8A 2RGRA 4XLFA 4DPOA 1HQUA 5ETKA 4F26A 4XPCA 5HL7Q 3D3BJ 3QO9B 2H65B 4X06A 3B54A 3Q83A 1KZLA 1Q1KA 4O4RA 3BKUA 4CWBA 1EIYB 3ENWA 1B7YB 3MDFA 2V69A 1M5VC 2PI5A 2XY7A 4KMDA 4RD6A 3MMPA 4L73A 2WRMA 3CMES 4DV4J 5C24B 1RU0A 3T1AA 5F8JA 4AL7A 2BKPA 3UR0A 4FZVA 3GTYX 1XXCA 4WK3A 4MEYA 3N9UC 4C2MA 2QFJA 2VBSA 4RDJA 4YG2A 2BOAA 5E3QA 5L9NA 3G8QA 5DDQC 5HN0A 3MEEA 4Q7AA 2KZZA 1ZTTA 2E5IA 3PRDA 2M88A 2CZ4A 4DX5A 1P4MA 4P2FA 4L75A 2QA4S 2W6IA 2G2ZA 3PYEA 4KKTA 3KLEA 5JUMA 1M90T 3M6XA 3A35A 5CAAA 1MWYA 2X1BA 4YQWA 4WQMA 1U1QA 1ZH5A 3MD3A 1HBOA 2XNCA 3UW1A 2NVTK 2ZKUA 4QU7A 2CQCA 4J3NA 4FN5A 3LAKA 4ZMMA 1QE1A 2KL8A 4C8NA 3K17A 4IG0A 4G1VA 1F93A 1F9NA 4JP8A 1EFTA 1Q4RA 4NLGA 1HWJA 1LEOA 4MYTA 3QJJA 5LSRA 2UUAF 5HK4A 1U2CA 2CNOB 4Q43A 4KC5A 3TOQA 3MCAA 3MMAB 3ZTPA 3A1PA 2DRDA 2PA3A 4DLGA 1RHJB 2HWIA 3MM5A 3TQ1A 3RB0A 3T6JA 2ZHBA 2MZ1A 1NH8A 5F8LA 3S16K 4KARA 4GMKA 3OVBA 2OPRB 5IXUA 1HD1A 2AKWB 3BKTA 3ZFVA 4ETZA 3BM7A 4ZJQA 4AXJA 2FJWA 1GAQA 3W2VB 2OSQA 3R27A 4WE1A 3FBEA 4F36A 1KC8D 4ACBA 1X9WA 3U6BA 3G82A 3JSBA 2CPXA 1I94F 1WDTA 3LP2B 1YJWB 2DK2A 5K8OA 5HANA 2YX7A 4EEYA 1M0SA 3IO1A 3HSZA 2QZ8A 2FTRA 4IKAA 2D74B 1EQRA 1RLCL 3FBFA 1F9EB 1PC4A 1S1WA 2M3DA 2MQ8A 5LMUF 4O4GA 4C3HC 1TWFC 4P6YA 2P8IA 2GREA 1ZM3A 1FEEA 3ZBTA 4X7FA 4XK8C 3EMTA 4X84A 1SV5B 2MJNA 2YY3A 2CBXA 2R8JA 1SL2A 2ROGA 3FEXB 1WKKA 4PEOA 1IM4A 3QT8A 1LWEA 4M5JA 3CPXA 2EWHA 1WP6A 1UVJA 2CWXA 2R93C 4PPZA 3S17C 3G71S 1X31C 2HVDA 3BH4A 4MT1A 2Z4PA 2AQ4A 1RZMA 4N8OA 2DETA 1LV5A 3T01A 1KQSR 4RW4B 2W2MP 3UN5A 4RD3A 2VPWB 3EGWB 2RQMA 4DSEA 4B9NA 2IY5B 4GTEA 3BBBA 3IP0A 1ZM2A 3GTLK 1PYSB 4JI7J 2DKOB 5J1NA 4X4RA 2R8KA 3DLKA 3CW2C 1FXRA 2MZJA 2UZAA 1UWBB 2VUGA 2WVCA 3S17K 4LSLB 3HO1A 2PIAA 1NB7A 3QNWB 3SZZA 3GTGK 3PFOA 4IDKA 4K7QA 2LKZA 4HHJA 3W61A 2N7CA 4A3LK 2GIRA 2QEXS 3KLIA 3I0RB 3HI9A 3QRRA 3H4DA 4WP8A 1JVIA 3SSRA 2OJ3A 4NRUA 2E66A 3NS6A 3KFWX 3LANA 4Q5VA 2NR0A 3O1LA 1TL3A 4QIVA 4TMVA 2ZHAA 1OQ6A 2H54B 3CSKA 3CDBA 1OYDA 3UNYA 4ILDA 2BJ9A 5A8AA 1F3VA 4Y52K 3VTIA 5HXBA 2Y3YA 2BQ3A 3VR6A 5KFXA 2BRKA 2VG7B 3QAUA 3VQSA 4E98A 2GVDA 2XB2D 1S1XA 4F3OA 2AJ1A 2VG5A 2ERRA 5H1SV 1NKEA 1YBUA 5ETOA 5KW9A 1W35A 4F0MA 4TLRA 4CO0A 2JA5C 3PG9A 3OJWA 1HNXJ 1BE4A 1FO1A 4DF4A 2VDHA 3NAIA 3IBWA 3SCIE 2NZ4A 2VKRA 1W87A 2CJQA 3R3TA 4I4BA 1UPMB 4LVOP 4ED2A 1XNQJ 1GX5A 3M4XA 1QGAA 4RDKA 2XHCA 2W2PP 1TUGB 5A8RB 4A93K 4B02A 5HZBA 4EYHB 2R92A 4Q44A 3MR3A 1I3QA 4WPAA 3V6JA 3T1HJ 2IDLA 3NGKA 1Z1ZA 2V34A 1WG4A 3Q8YA 3P26A 3BGUA 3TZYA 3EZ5A 2IMOA 5K8MA 2OI2A 2WVBA 2R93K 1VQNS 4J9MA 2VU5A 1HLWA 2UXDF 4CLUA 3PFEA 3Q39A 3I82A 3E51A 2RAQA 3CC2B 1VLYA 2C2MB 4Y2CA 1IJEA 4XONA 2HMIA 3LTOA 2RRBA 1N5YA 1QVGR 2LXUA 3AJ2A 1Q8KA 1F60B 2CFAA 1O2AA 1T6YA 2VZLA 1ZXOA 2CJYB 4C6AA 2E9ZA 2W6JA 1K9MT 1L3SA 2EFQA 4ED5A 3BREA 3FNNA 3BP3A 3Q8PB 2R7XA 2RB7A 2GJIA 4R5PA 1X60A 1D2EA 4BCAA 3FKIA 3CQZK 2IMWP 2ZE2A 5AE1A 1ZETA 4RW9B 2WONB 1M5PC 1Q7YD 1LWCA 4LR2A 4RUHA 2Q6CA 2YWGA 3A3PB 5IYBC 1S0NA 4LF7J 1I8DA 3LAPA 1A7GE 1SUQA 2R92K 5HKKA 2XYGB 2HFZA 4DR3F 1F7UA 1XTZA 3MCNA 2GIQA 2J7UA 4MH8A 3CCUB 2AX1A 4NXMF 4WJ3M 3X1LB 1GXLA 3SLNA 3FQLA 3W63A 5KFYA 5JVHQ 2FHJA 2FHKA 3BO2A 2DIVA 1X0FA 1Y1VC 2X6XA 1UL3A 2CQ3A 1ELOA 5AN9A 4YFKA 1TKZB 3L4BC 3A3GA 1WEXA 4IR9A 4CLWA 1I3QK 4NI2B 1FA0A 2RRNA 1T03A 4YHHF 1WKLA 3T1YF 2ZD1B 2VHGA 1SH2A 2E5LF 1UKUA 4YHBA 3QPIA 2O5DA 1OY9A 3DM2A 4TQRA 4EGLA 3N6MA 5HJYA 4MKAA 4KAIA 4JK1A 1HQMA 3VF0B 1R0CB 4I6WA 3EGVA 4FZBA 3SSQA 2B63C 2CPZA 1H98A 3D4JA 1NZAA 2VUMC 4PYAA 1SKUB 3LGHA 1RISA 2J9DE 2B0GA 3N3YA 3F56A 2MQLA 3G71B 1ZVUA 5ETNA 2QA1A 3JU4A 1D8ZA 5CD4H 1UAWA 1XZQA 4X66F 1KFDA 3OW2R 2HG4A 4TY9A 2EEYA 2YWFA 2ILYA 1H0HB 3D54A 3DRXA 2A6OA 4WFXA 3OV7A 3R9LA 4DI6A 2GCFA 5IK2A 5AXKA 2ZKTA 4X62J 2AW0A 5KFRA 1UW4A 3DLLQ 1TWHK 3M8PB 4Y28C 4DSLA 1XNQF 4A3MK 1RAAB 4HDGA 3CCMS 4TY8B 2HVZA 3K8VA 2F4FA 4A3JK 2NVYC 3SCKE 1FNXH 5TR9A 4OV6A 2LP4A 3SXLA 3KLFA 3DYAB 2GX8A 2HMAA 5AJ3F 3FCVA 3PTWA 2RDJA 4ZPBA 4WWVA 4CLKA 3MHYA 1TU0B 4I69A 4GVBA 2M5SA 4YUDA 4XR6A 3OTOJ 2HBRB 2H5IB 4ZVTB 4P2MA 5LMZA 1C4CA 2YWWA 2B9EA 2RD5C 2OHDA 5LMUJ 3G8SA 4X4VA 2VNHA 2XNRA 1G6BA 3GONA 3ILLA 3RZOK 2OBRA 2BJDA 1Y4ZB 4PWUA 1S12A 1RCXB 3PYGA 1HNZF 4WU3A 3CCQB 3K0JA 1IXKA 4U8YA 4KGVB 4C98A 3CJKB 1X9SA 3M9OB 1UFLA 1TWCC 1QG0A 5C42A 2MKKA 4NYPA 2DGWA 5KFTA 1W26A 2DGVA 4IO1A 3LO3A 3HCXA 4DPUA 1L5UA 5K5MA 1SFOC 4K4UA 1E62A 5THWA 3EQLA 3M8SA 1ZYRA 1QH0A 1N6QA 2KM8B 2DXEA 3W7BA 3V7AA 1QVFR 2X53S 3GE9A 2UVUA 2DHXA 3R6KA 4XLAA 1TL4A 3WXMA 4ZVSB 4NRTA 1XQIA 3SZYA 3Q3QA 4DV6F 2MLXA 4JI1J 2GA7A 3FCHA 3Q23A 3WDOA 3FRZA 1MLAA 3QATA 4UZEA 2FIUA 2OAUA 4DLEA 2WBMA 4G65A 4ID5A 2IPOB 5DG9A 1O25A 2WW4A 2M5YA 1VK8A 2OTJS 2RVJA 5EGHA 2GPJA 4OZ1A 2EBBA 1R9TK 2XMJA 3AB2B 2MKJA 4JV1A 3L7PA 4DFPA 2XO6A 4I7FB 1YHQB 3E01A 3QLHA 3BZQA 1PJ5A 1WG5A 3GFYA 3T53B 1VMBA 2DB1A 3UDEA 4LVNP 4ZA1A 3OZWA 1X4GA 2YU9C 4OYAA 1HR0F 3DLJA 2GZOA 1NRKA 4RW6B 2F63A 1OMSA 3OFFA 1UA0A 3P96A 1YIJB 3ICLA 1C0UA 3GIJA 3SIPB 5J2MB 1S9GA 2ZXHA 1KEKA 2C1EB 3RZDC 3RB4A 2XSFA 2Y8YA 2JOQA 1J6WA 3H3VD 3GV7B 1K83K 5LMNJ 2HZCA 4A3DC 1N88A 1FFGB 4M53A 3MEKA 3C66A 1EZZB 1NSQA 2O66A 1VFJA 5HLFB 4ZJOA 4DCPB 4OZJA 4DSIA 4DFKA 3EUNA 3ETMA 1FRXA 2AF6A 4NEYA 1F7VA 3HT3A 1S1VA 3BB5A 1XZPB 3TJAA 3VZIA 4DV1F 3ASRA 4DX6A 4DCOB 5KNLA 2NPFA 3CD7A 6FDRA 1SFOK 4M63A 5J2QA 2CNDA 2VNJA 1TK8A 5K14A 2XNDA 2FHOB 2WZPP 2DHSA 5KT2A 2R7SA 5BR8J 3GLJA 2NCKL 1J5OB 3W2FA 3E8OA 4AVZA 1SVDA 2CG4A 1QSLA 3IRWP 3G86A 2YX4A 5IZHA 5IP9C 3KL9A 2XYPB 3N0VA 1HNZJ 1VK3A 3NP5A 2GMHA 1HZEA 5B0DA 3GILA 3UVJB 1HHSA 3R5JB 2QLJB 1I50K 4FXWA 4DG1B 4CH7A 3H2LA 5JBQA 2JLEA 2BKNA 4W4MA 2DY9A 4DUTA 4USTA 2IC3B 2NQPA 4QJVA 2L3MA 3W2HA 3OR1B 3HLUA 4WWSA 3W66A 4P2NA 2DNLA 2B4UA 3IS9A 1SJ4P 3Q38A 1I50C 4KGKA 4OMFG 5FIIA 1HFEL 4IQXA 1Z2ZA 3OXFA 1NB9A 3G87A 2CAJA 2M2BA 2MGZA 3CF5Q 2BM1A 4RLEA 3A13A 1C0TA 3MURP 1ZZNA 3UE2A 3HSGA 1NJXA 4FYXB 2EFPA 1GX6A 2MHNA 1QD1A 4J9PA 4OZ5A 5FDLA 5A76A 3L7OA 5A0YA 1FRMA 4TY8A 2VFSA 2WAQD 5HMYA 3B82A 3S1QK 1NK6A 1WCMK 1TFYA 5KG1A 1X4HA 1EFCA 4A3IC 4DR5F 1DCHA 1VHOA 2N4DA 5IFMA 4QIGA 4JI8F 1D8YA 2E44A 4B44A 4RWWA 2IM0A 4RU2A 2I8EA 5KOXA 3HSDA 4L76A 2DTJA 3H5SA 3FKIC 5BSYA 3RB3A 2IC3A 1WJ9A 1O26A 4PC1A 2D41A 4GVBB 1WC1A 5HZAA 1U0SA 4EBCA 1FFSB 3SV4A 5E7OB 1R6VA 5HVHA 4B3MJ 1KQGB 1IN0A 4XDDA 4K0KJ 5D6GA 2EC2A 3TR5A 2XMUA 5EMNA 4QR2A 1VBYA 1Y00A 3QFSA 2VBUA 1RT3B 2E5HA 1S1TA 1WKJA 2E9TA 2CPYA 4YFUA 1P1LA 2W8LA 2HLTA 2HSEB 4A8KA 1Q81T 4ZVRB 1ZTWA 3AJDA 4XOPA 4DV2J 1Q86T 4WZTA 3S7RA 4ILMA 1BUXA 1INNA 2POKA 2D3OR 3DI6A 1IKWA 1UJ5A 3PV8A 5J2QB 3ZZOA 3TZWA 2JA8C 4LFAF 4DV0F 4GKJJ 1VRTA 4LSZB 2C2OB 3ONYA 3ITHA 3J7ZT 4HL9A 1HNXF 4YP3A 3UFCX 1S0MA 1NBMA 3H40A 3MM6A 2GO8A 4I6YA 1S6UA 3KUEA 5F3ZA 4UT4A 4UOCA 3SCLE 1TP7A 4AF6A 1MW7A 1WQFA 2H5JB 1LWEB 1S97A 1JB9A 2QMXA 3CMQA 2PDAA 4PXBA 1WIHA 1IW7A 1APSA 1VRUA 1DRZA 2FC9A 4BBYA 3GVKA 1OIAA 5J3OA 2ACMA 4KBIA 3OT9A 4B9MA 2YBVA 2VFVA 1QY7A 5F8GA 5B0FA 2U1AA 4OHVA 3NCPA 1GTHA 2ZH6A 2Y8WA 1TKZA 2IFXA 2ZH2A 4N5SA 3EYZA 3AXKA 2XZTB 1MU2A 1VGYA 2LQ8A 3GP9A 4Q0BA 2RRAA 3K57A 1SJQA 3TA2A 4E0FA 4M4SA 1VIXA 2YWKA 4I7FA 4CTAB 5B0BA 2PFFB 4B3RJ 3KHGA 1IWAA 1LW0A 3EPIA 1FRNA 4DR5J 4IFVB 1ZM9A 3CXCB 3CMAB 1R8PA 3C8YA 3S1TA 2FVQA 2LDYA 4M0LA 5C5JA 4MYUA 3HAGA 2XLKA 1T05B 3NMRA 2Q6LA 3VGUA 3TTGA 4TN1A 3IAS9 4ZCIA 4QW8A 3M2VB 4ZCKA 1NPPA 5IV4A 3T1HF 4P12A 4B3OB 4QVAA 1JOEA 1UETA 2W4DA 1ZZFA 1WTHD 4MKYA 4ZOSA 3TI0A 1OWXA 1XXBA 3GDZA 1KVJA 2HPUA 4KHMA 2UVRA 3GR0A 1IKXA 1XNRF 5H9FK 5IYNA 1RT3A 3TJ8A 4OFZA 2EFOA 3CCZA 4NOHA 1RB0A 3L9ZA 3OZUA 2YXLA 5FJ4A 4MFBB 1VQSA 2YKMB 2Y0SL 2O5IA 4M5KA 2HIQA 2V7TA 3A12A 3D3CJ 4P75A 2HBYB 5HAOA 2WZ1A 1B2RA 1S1UB 4O23A 2BMBA 1WQGA 2VG6B 2R7OA 4WF9Q 1KS2A 3ELHA 1SQEA 4I2PB 1X0PA 1WDDA 1K0VA 2HFVA 4USJC 1SC3B 4AXIA 2CG8A 4NLDA 4OYXA 2E1AA 4CYUA 4GKKF 4WK1A 4LJZA 5LOQA 1BX0A 2ILZA 3LQEA 4LFAJ 3KJNB 4BWMA 1OB5A 1TR0A 1NJZA 1G1XA 3THVA 4ROXA 6AT1B 2AHOA 3EVOA 4CO1A 2NSBA 4MQ9A 3OJXA 2AX0A 3TVZA 2BE5A 3VV2B 1P6TA 4QIWD 1N33F 4HDHA 4X6AK 2NVXK 1SH3A 1QUEA 1XR6A 1VQKS 3QIDA 5IYRA 5IWAJ 5F8HA 1IKVB 4OZ0A 2ZITA 3RJMB 4UOHA 2KH9A 1TTHB 3KWMA 2MSTA 1FNCA 3OD2A 2WTFA 1KTVA 4Y9RA 1HWLA 1FX0A 2AYEA 2YU9A 2DHHA 2CQ2A 4GTDA 3UI3A 3ASTA 3E01B 3OVSA 1C2PA 2D1CA 4YB6A 4RZRA 2HAFA 1URNA 1XN9A 5D77A 3L4JA 3TAQA 3OL8A 2Z2ZA 5HMXA 5C7PA 3M32B 3OVAA 2PMZL 3VALA 2ABYA 3NBPA 2ACYA 5EWGA 1WACA 1WOOA 2AU0A 1VQ7B 4OINA 4Z4UA 2JEIA 5KT6A 2YNHA 1RT1A 2DJWA 3EDRB 2KXNB 2BN4A 3V76A 1UWAA 2B63K 3DOMA 5KFFA 4WXWA 1JA0A 2BDPA 3J81k 5CCMA 1IM6A 4JI2J 3DDNA 3DLEB 4OLOA 2UVWA 2V2KA 2FZGB 4NMXA 5HLFA 1YRTA 1NDLA 5FO1A 3OLAA 4ZPAA 3MMCA 3HKZD 2BGJA 3OREA 4EZ9A 3DYAA 1EETA 3QGPA 2WVDA 4FWTA 2WB1L 3GTJK 1RQ0A 2B5JB 3ENQA 4LT6A 4OYMA 4ZLJA 3OTCA 5IT0A 4XN0A 5C4JK 5DS7A 4FP9A 3M8PA 4ZVHA 4C97A 1OS5A 1FK9B 4RCYA 4XMYA 2D9PA 1AUSL 2K7JA 5KFGA 5HMZA 3CD5A 4ANCA 4Q8FA 2I6WA 5IOTA 4WILA 3D9BA 2E1RA 2MY7A 1N48A 3FRYA 1IJFB 1E3ZA 3TP2A 1PGZA 4LF2A 3V4IB 4ED4A 5GAGI 2J76E 3C6TB 2H4WB 3IXQA 3HHLC 2DGTA 3UPFA 2H4YB 2H5EA 2MB0B 5IORA 1G7RA 1R6YA 2HZAA 3HPOA 2HHQA 3D5MA 3CCJB 3ILJA 4TU8A 4K5SA 2F8MA 4HLBA 1K47A 3V6HA 3H90A 4C7QA 3LWMA 1VJSA 5T7LB 2ROPA 1Q7LB 3PW5A 1Q82D 1U24A 3R2CJ 4AD6A 1VQPB 4LF4J 1VQMB 3FGVA 4MEXA 4N41A 2FHMA 5EGEA 2HHWA 1G3OA 1LWXA 5B0GA 1KONA 3M9NB 2Q66A 5CYJA 4X7EA 1W2IA 2KYZA 3GYNA 2GK7A 5M5WK 4ILRA 2CJXB 2J0WA 2Z57B 3B78A 1YBAA 4C0OC 3FKSA 2F7VA 3SFUA 3C16B 2C2RA 4O0IA 2V6UA 3AH5A 2Z0GA 4H54A 1Y9OA 4A8XA 1A8PA 1LK7A 4UZCA 1SIWB 3AGPA 1CG2A 2MKHA 3LP0B 1YRXA 3PENA 4EMDA 4OI0A 1H2TZ 2AEJA 3DXBA 4W98A 1VR6A 2F8HA 4BHQA 4L6V3 2E2HA 2V7UA 3KLHB 4PG4A 4WP9A 2CPEA 4TLQA 3MCOA 4ZLNA 2LZJA 4RPBA 4CQJA 3D6TB 5HSPA 1Y1WA 2GQCA 1DCPA 4BY7K 2DXDA 4ZP8A 5D0GA 1UD3A 3J81j 1DFDA 4YB1P 1SBRA 2UUBJ 4C8KA 4P9SA 1K73T 3OUYA 3FJOA 2LVWA 4H4OA 1FNDA 2M8DB 2B7CB 1FJEB 5KG7A 2CIMA 3TFIA 3CJTA 1EARA 4HI1A 2IM2A 4DL5A 1S6PB 2VG6A 4H4KA 4ZIWA 5BR8F 4DQLA 3JQQA 3CC4S 3BCDA 1S0UA 1DBDA 3G6ES 2UXDJ 2E2HC 3DRPB 4NLTA 5H5JA 2HNZB 2WZNA 2HBQB 1WG1A 4MKVA 1SM4A 4MK9A 1N54B 2OGUA 3NE5B 3HJVA 2DVIA 1A0OB 1ZAVA 5B6IA 2A3JA 1HVXA 1S0OA 1MN7A 3BYPA 1EJ7L 3U2QA 2G0IA 4LC0A 2CZVC 4FPRA 2V7XA 5IYQA 4C3IC 1UEUA 3BCFA 4OJHA 2V8GA 1FDBA 1S4FA 2YNIB 4LRCA 2F65A 3Q8QB 5IC6B 4P71A 1I50A 4X7DA 4Z4WA 4CLTA 4XLNA 1Z4UA 1VBZA 2YNGB 5GVQA 2FJVA 2G13A 4I2QA 5M5XK 4A8SA 4DSJA 4B3SJ 3GQBA 1CS4A 4Q4ZA 1XB2A 1QAJA 2BOPA 2ASYA 3ILOA 3TVYA 4CLYA 3KJVB 2WR8A 2QO3A 1RA6A 2GAHC 2ZBCA 5IP9K 1S72S 4XPEA 3GWCA 2BJ7A 2I5JA 2GSOA 3IN5A 1FJGJ 2XI2A 4HTIA 4YEJA 1HMVB 3PO3K 1FJGF 3DM2B 5KG0A 1BGWA 4J9KA 1J6VA 3MTJA 3OEPA 1QSSA 2BA9A 4N3NA 2DO4A 4R25A 1IKYB 3T9ZA 4DZDA 3BN7A 3T5HA 5AXNA 2YNFA 2L08A 3J81U 3H42A 2MY8A 1T9TA 1HQ2A 4DL0C 2BE9B 2B51A 1X4BA 3W2IA 3HMJG 1Y0HA 2CJ9A 4C11B 4C8ZA 3THTA 2CWKA 2JH3A 4N8NA 2DR9A 1U48A 1E1QA 5CXTA 1I3OB 2PPBA 2MYFA 2MMYA 4GTFA 1V0EA 3DRPA 1XQBA 4JI1F 3HFKA 4Y52C 3HXAA 1RBAA 4M5GA 1Q16B 1Y1VA 5KFMA 1TUIA 2JA8K 2ZZMA 2X6YA 2QJ3A 4L72B 4ZKAA 3K7AC 2EFNA 4K8RA 1U47A 1QTNB 3AFGA 4LF1A 5IM0A 1VCTA 3CQZA 4ECRA 2C2EA 1AT1B 4C0HA 1X5TA 2KTQA 3L09A 4KHRA 4PC3A 3CESA 2RKIB 5ETVA 2BANB 3VCDA 3THPA 1NK7A 1GT8A 2OMOA 2CJKA 3IBCB 4DV1J 4RD0A 3DC2A 2LXIA 4ZN3A 2DHGA 1BWEA 1BMFA 4IG0B 4R0JA 1GMWD 3PJ9A 1RT2A 1R43A 4DQKA 4MKBA 1KFSA 2XYHB 1DTQB 3HOUK 3V81B 3Q22A 3GTLC 1B0PA 2DERA 1Q9SA 5AJ3J 2D3ZA 1JNRB 3HHDA 4Z4TA 1VJQA 3G4SB 4A46A 5KFEA 2QA2A 1HMVA 5JXSA 1U6ZA 1VRTB 2RT3A 2G9OA 4G6IA 4QCLA 3GCWP 1N32J 4J9QA 3PHEA 2H9ZA 1B64A 1REVB 1EP1B 1UWBA 3RR7A 4U9UA 3VAFA 2C42A 1USOA 4P72A 2XMMA 2FJBB 1EP4A 3OLBA 1O24A 1TFWA 4RNHA 4ZJLA 1Q79A 3SMZA 3OFNA 4HI2A 4WFYA 1N36J 3CEDA 1P1TA 3KK1B 2YX1A 3G96A 2XEXA 2B4PA 3PYDA 4M5NA 3VQTA 3CJ3A 1GJRA 2OLWA 4UOFA 2DR7A 3JQPA 1YQHA 4OOVA 1RAFB 1MWZA 1PBUA 2OPRA 4I68A 2QLWA 1SV5A 2GQ2A 1LWCB 4ZITA 3R1HA 2A2DA 3HD1A 3FVYA 4ZK7M 3MECB 3CB4A 3PJWA 3ULHA 2VBXA 1RTIA 3W65A 2NXJA 1U8SA 1NK4A 3R7BB 2DISA 4A3GC 3NS7B 8RUCA 1X4CA 2QSFA 2U2FA 4A3EC 1Y7PA 3ZPNA 3UD4P 2VJIA 1XR5A 2GFFA 3W64A 1WELA 5H9EK 3S1MC 2HVHA 3CW2A 1RUSA 4AUKA 1YITB 3BGOP 3OUYB 3OPFA 5DM6Q 2VBWA 3BP8C 1RAGB 4YR3A 4RO0A 4FYWB 2VA2A 5A89A 2K3IA 1K73D 1JLBB 2C3OA 3PUNA 3SEJA 2Y1IA 4QR1A 5GADU 3CIZA 2FLLA 4DPWA 2V4JA 2XY5A 1E6VA 3JXOA 3C46A 1JK9B 2Q6IA 3BY2A 3RBDA 4UTGA 3GEIA 4P6QA 1F1BB 4ILLA 2RHQB 5FL7A 4DR7J 1JLAA 2LU1A 2LECA 2C3MA 1C1CA 2LQJA 2PMHA 1MROB 5M2RA 2GJFA 3R5BA 3WIUA 1DY3A 4X62F 1W34A 2D3O1 1DQAA 1NSPA 4DSFA 4RPDA 1VC6A 3JB9k 3IWNC 2DEIA 1R7IA 5HVGA 3MPYA 5DZ7A 4LBPA 3S1NK 3ZXWA 3NGSA 4PXDA 2X1AA 2AWZA 4AT1B 2W2OP 1HYSB 4LBZA 1YTYA 4OZ3A 3WYAA 1FDAA 1KVIA 2Q6KA 2JNJA 4AH6A 2NLWA 4C2MK 2GHVC 3Q86A 2R9VA 2B5OA 3PVDA 4U9RA 2OPPB 5CHCB 1VC0A 5C44K 4CT9A 1FHTA 3V4GA 1HHTP 1O0PA 4O44A 1ZUNB 1SQFA 3KUGA 3G6YA 1CQNA 2CYYA 3PW7A 3KTQA 2FJXA 3FZBA 3SFGA 4OYPA 2W7OA 2R9LA 1NK5A 1UZDA 5IYDC 1JLGA 1XJWB 3TUZC 3QYYA 1RU2A 1FKAF 2D3LA 2DH9A 2OPSA 4M5LA 1HD0A 3HOYK 5DDRC 3VR1A 1VQ5S 4A48A 1R9TA 1CBKA 3CD6B 1KKHA 4TT3A 5J1EB 4DCJB 2UUTA 3CCRS 2DXFA 3A8IA 3RAMA 1TL1A 4NCGA 3W8GA 4M95A 5IOSA 2ZL6A 1XMOJ 3H3VL 1GMUA 5DJBA 2FVPA 3GTQC 1X5OA 3J7AN 4I6AA 1CJUA 1FEHA 2R7UA 1F9HA 2E1PA 4MFBA 2JZ5A 1RWNB 5IYPA 2KRBA 3MZIA 3QWPA 1OPZA 5BSXA 2DR8A 4M5DB 1QFZA 1VQ7S 3H20A 3P8BB 1NK9A 2E29A 4GTBA 1T9WA 2YH1A 3C3LA 3W5YA 4C3MA 3WZ0A 2VV5A 2MTLA 2F1MA 2YNHB 1PJ6A 1WQHA 3TARA 2EPIA 3TFHA 4A3FK 3FOEA 2OIHA 5K8NA 1R27B 2UUCF 4BC9A 4K1XA 2V6TA 3TAMA 1UVMA 3WQPA 4DPYA 3J7YU 5HL8A 1WC5A 3SDEA 2F40A 2ZM6F 3DGVA 1VHIA 4XORA 4J9UE 1RXOB 3K7RA 3UN2A 1TAUA 4DN0A 5FLMK 4DG1A 1AROP 1UCNA 1UV7A 3EJMA 2M4MA 4P5BA 2UXBJ 2YPYA 3UVJA 3MPUB 2W2QP 3ZZRA 1VQKB 1IB0A 4PXEA 4YMEA 3WC0A 4O4GB 2BQRA 1P8GA 3H5YA 4OHXA 1YNJA 2CXEA 1Q95G 4DR6F 1E6VB 4K50A 3KNAA 3TVKA 2XCRB 4WZKA 4DF8A 1T03B 1WOSA 1C0UB 3CPWB 3BPSP 4II2A 1S6PA 4PG6A 3NGRA 4DR2F 2NUUG 1QX4A 1HL6A 4QW9A 2JA5K 4LF5J 3LO8A 1NXIA 3G6VA 1TMMA 2KG0A 4H4OB 2EIXA 5ETQA 2IIHA 5A2QY 1VQ6B 2HRUA 3S01A 1FI4A 1H7XA 2L41A 3QLHB 2E2IC 2HS3A 3Q0AA 4FYYB 5IYCC 1N5SA 1Q86D 1UVKA 3TZXA 4IOAQ 4RLZA 1HWUA 3FCWA 1RLDA 2C5BA 4JI3F 2CADA 1Q81D 3O6QA 4CYUB 2ZZNA 5DZ6A 1O29A 1S57A 4ZCLA 3DXJA 4PQUA 4GQNA 3M30B 1BQMB 3S14C 3JAMY 5F9NA 4RPFA 4ZVOB 2FB0A 3W5VA 3HHLB 4ZP7A 2ATLA 5T41A 3WNDA 1Y1VK 1UD6A 1TL7A 1GO2A 3CT9A 4LRAA 4USHA 4BPRA 2C5HA 3HSJA 2LQ5A 2B43A 2WHOA 3GYXB 1K44A 2Q1LA 4U7CA 1DLOB 1H73A 4KE5A 4A3MC 2C4UA 2CW5A 5E68A 4A3DK 3WHIA 1KQFB 1FRQA 1WHXA 1O6XA 4LBVA 1NUEA 3DRRB 3QGIA 2VQEF 4XIUA 2WVEA 1Y3KA 3K5PA 5D3GB 1ZPWX 3MUVP 1JLAB 2OEKA 4LF6J 2OUGA 4GTCA 2ZWOA 3FPKA 5DSZA 2GSNA 1OQ3A 2HGMA 1OY8A 1JNZB 4LF4F 4NMLA 3MMJA 2CRVA 3LPEA 1TWFK 1N07A 3I4NK 1ZQ1C 4EH1A 3VVUA 3PYFA 3GU0A 3MEGB 4M94A 2UXBF 3UO0A 1YX2A 4P25A 3CP2A 1KP6A 2VPZB 4LBIA 4YS2A 2NVXC 3N0CA 4CLFA 3M6UA 4I64A 2ZOGA 3KK2A 5FDLB 1FNOA 2QA4G 2BUNA 4DPTA 4QPTA 4YXWA 1UEKA 5FO0A 1EFRA 4XQFA 1S9EA 1WTBA 4Z1MA 2DGSA 1PAEX 4PAAA 1D09B 3CNQP 3IWLA 1T11A 1DARA 4JI7F 3JSMA 2EVZA 1BC6A 1W0KA 4PYDA 2CW0A 3QWUA 3OFEA 1HNWJ 5GMEA 1TWGA 4KM9A 4KATA 2QV6A 1EK8A 3A8EA 4LF6F 1IE0A 4BY1K 2BJEA 2HBZB 3GTOK 3Q3AA 3I5AA 3OTEA 2Y1LB 1X4EA 4XLCA 3OL7A 5E6TA 3G8TA 4B17A 4GTLA 4F3QA 2O67A 1JMTA 3CCSB 3JTNA 3FFIA 4Z4RA 4IRKA 1SPBP 3KNGA 4WP3A 2FLOA 1W0JA 4A8OA 4TYAA 1RYRA 2FY1A 4UZBA 5IC4B 1FE4A 4BBSK 3PO3C 1KK1A 3QFRA 4TQSA 5DETA 4F4AA 4ZPWR 4DR2J 5EUHA 3VAIA 1RTDA 4MMOA 2VL1A 5LL6d 3GFZA 4KKUA 4X65J 1CVJA 1FD8A 4DWIA 2A68A 5I4MA 2DRBA 3W8PA 4IFYA 3MM8A 2ASLA 4FXUA 3CDUA 1K83A 1FJCA 4LK0A 1IBCB 3FBBA 1KRHA 1UD4A 3P4UB 1Q78A 3R5AA 4NYOA 3M8QB 1Z2LA 3TFJA 2V7QA 5KFIA 1RDRA 3CJ4A 1QUFA 2VDIA 3QIPA 3M8QA 1E79A 5DG8A 1J27A 4ECSA 4PG7A 4LK1A 3VGSA 5FLMC 2B4VA 3G9CA 1WF1A 1T6XA 3PA2A 2BACA 4DR4J 2JLGA 2LQBA 4WJ4A 2VASA 4B3RF 2NVTC 4URQU 2XOKA 3NAHA 1XC9A 2C2NA 2NVQK 4ECVA 2DBBA 4XN3A 3HXMA 2ZEJA 4AC9A 2LA4A 2M0GB 1DQ9A 2VBYA 4CNZA 3MM7B 2D69A 4PGOA 4MTPA 2EI5A 3DOKA 4FF2A 3RB6A 2CJBA 4Q5SA 1RWWB 3AOBA 3OE7A 1M5SA 3FK4A 5IT9Y 2MKYA 3CTRA 4NX9A 4JI4J 4WJBA 3JTOA 3AODA 3NEKA 3G05A 2QLFB 3PW4A 3C6UA 3PHTA 1VQ5B 2OSRA 1FKOA 2X51A 3R6LB 2V31A 3R97A 3TANA 2HKEA 5DO2A 1DCOA 3IS9B 3H0GA 1HW8A 2AV5A 3I0RA 4A3CK 5IYCK 3EICA 4RMFA 1IQTA 3BO4A 3S15C 3ONUA 1FCAA 1V3SA 2DYAA 2HS4A 3TUIC 2QG9B 4OIPA 4W90B 2R3VA 4K4VA 4PWDB 2CFAB 2I5JB 2HRTA 2QGGA 4K2JA 1WCMA 3HF5A 4NLVA 3IM9A 1VQ4S 1OJ4A 3H2UB 1I1GA 2PHCB 1IJEB 2HFSA 3UDVA 1J2VA 1SJFA 1LW2A 1OPIA 1CJVB 3M7VA 5A0YB 4JUZA 4X4QA 3KLVA 2CPIA 4V19X 2QEXB 2H1YA 3CIMA 4L74A 1KHWA 4FYDA 2P5MA 1KRPA 4KO0B 3W5UA 3IC1A 2ZZQA 3BSNA 4HEA9 1UMKA 2X1GA 3KK3B 2R8GA 3BR9A 4C9DA 1IL2A 1D3WA 1ZAWA 1PG5B 2X3GA 5HBMA 3DMJB 3TNVA 1OGJA 1ACMB 1RK8A 1T94A 3AQOA 3DLGA 5T7LA 4ZN1A 3BH6B 1N32F 2KB2A 3CCLS 2IA6A 3BGLA 3GMGA 3OR1A 3GPAA 3FUYA 1YITS 2XBPA 2NV4A 2QT7A 3U1LA 3CC7S 1UVLA 4PPDA 3V4MA 2BBEA 2BE2B 4FK8A 1BPLA 2F1LA 5JVOA 2HURA 4ACAA 5C3EC 4BKWA 4YEAA 2AP6A 2M8HA 4WKRA 4HIZA 1YJRA 2DGQA 2PE8A 3E20A 5KSWB 2AJQA 3U27A 2R6HA 2PGCA 4KQZA 2WW8A 3VNUA 5M2PA 2XG8A 3RRHA 2EW9A 2MZTA 4NZ7A 3QRPA 4KB7A 4JI0J 4YALA 1ZYQA 3HJFA 1WSVA 2PI4A 1N5YB 3M3YC 5F41A 1FTCA 2OEMA 1YJWS 4EFAC 4BBSC 3UQSA 1JXLA 4OOXA 4LRFA 2LMIA 2CPDA 4IUFA 2YQ3A 4RBTA 3RAXA 1Y3JA 5KTQA 4I2QB 4L8JA 1VJEA 2NVYK 1HBNB 1REGX 3GTKA 1V3ZA 4DL4A 3FKIK 1KOOA 3HP6A 3Q24A 1JKHB 1NH7A 1HNWF 1SI9A 4GZYA 1NNDA 3BBFA 1M1KT 5F3TA 1KOHA 3I32A 4AL5A 1R9TC 2YNIA 4XKVA 1HA3A 3MMBA 4Y6IA 3QFCA 1OB2A 4X66J 4CO2A 2OH2A 4LIRA 3HOVC 3SQGA 1EWYA 3HZEA 2P6TA 2ASDA 2W9AA 3H0GC 5J2MA 4F2SA 2CVEA 3MTKA 3M32A 3GB0A 5KFPA 4RW6A 3DLKB 4A8YA 1V9OA 2R7RA 2UV8A 2VKZG 2A2CA 4Y7NK 2PMDA 2D74A 3D7SB 1HARA 1SJ3P 4P52A 5BXIA 4Z7YA 3OXGA 4DMZA 1PC5A 2BEFA 2C2ZB 2NXUA 5KFQA 4TVAB 3M9MB 4OPSA 2HQGA 2HHHJ 1GFWB 1EP4B 2A6MA 3A3NB 3I4HX 2VA3A 1VHFA 5F9LA 3OZVA 1DTTB 4IO9Q 1G7SA 1USMA 3DLEA 1B3TA 5HVFA 1O51A 1ZM4A 5HBMB 3GR1A 2XC9A 2CFXA 3NWGA 4LBYA 2FUG9 4ZPDA 4F25A 3ILIA 1I51B 3NY0A 2I9SA 4CQ1A 3NGUA 2Q43A 5JMNA 4KGXB 4OYWA 2R8HA 3BBCA 3U1MA 4XSXA 1HI1A 3FJ2A 4G6VB 2JA7C 5BJRA 4KTQA 3CJSA 1FD2A 3D67A 4JV2A 2CUYA 2R7ZK 2AYGA 3MEDB 1VQOS 3K5LA 2YKAA 5ETTA 3HOVK 2HWHA 4F50A 4E0DA 1UVIA 2KFYA 1RTZA 2GAGC 3D2WA 5GMDA 1FX2A 3PO2K 1CJUB 3OFHA 3N4WA 2VIHA 3ZZZA 2R7ZC 1ICEB 2EFVA 2XZDB 1YBTA 5ITHA 2DGOA 2JEFA 2ZBVA 3R5DA 3G6XA 2KFZA 3GTMA 4TMTA 4RW8A 1RKJA 5F4JA 2MHEA 3GTJC 4YHHJ 4G1PA 2C2DA 3PEHA 4RUBA 4TKTA 3T51B 4RUAA 4ZPVR 5H59A 4ECQA 2F9DA 4BS2A 2FVSA 2Z2MA 2ZBPA 1X4FA 3AAWB 1L0WA 3W62A 1BLUA 3W5XA 5HROB 4WXOA 2DGXA 2ZL5A 3HOXK 2JEGA 2KG1A 2JJ1A 3HK2A 2CQ1A 2YU9K 3A1YG 3H2VE 4HACA 2CPFA 1XK8A 1RBOB 1EQMA 1S9GB 4PABA 3SI8A 4DV4F 2MZQA 4LFBF 1CC7A 4X0CA 3I87A 5AE2A 3QJLA 2VBZA 2DNNA 4JMQA 4G1QB 1FWPA 2W9BB 1JLGB 1S1UA 4DQRA 1JJ4A 3K5OA 2OPQA 3VO2A 2R8IA 1FKPA 1SJRA 3OR2A 3R8YA 2WONA 4OIOA 2XWXA 3K59A 1XMOF 1J6XA 5HP1A 4NLQA 2EKNA 3A4TA 4OYBA 5IP7C 2OEJA 4R5PB 1YJNS 3IA0A 4NCNA 2E1BA 2ZHOA 3MM8B 3PKMA 1W25A 4C0SA 4ECTA 4QR0A 3MR7A 3BN4A 3O5TB 1X4DA 1CNFA 3MAQA 4KB4A 3DDYA 3QSIA 1HQEA 4Y34A 4XSZA 4USKA 1NU4A 2OTLS 5KFWA 2PMWA 2D3UA 5KAKA 4IH7A 1LWFA 2V4JB 4LQ9A 1FERA 2KJVA 4DS5A 4FNHA 1RBLA 3PO5A 1YJ9B 3NGTA 2LYVA 4ELVA 1NBEB 5EGYA 1S0VA 4W92B 3AOCA 1FRHA 3QT6A 3C16A 4LREA 1A9NB 4DXLA 2UU9J 1OSCA 2YH0A 4YR2A 2GW8A 2MKSA 3GFXA 3ZTRA 2LXFA 1F9FA 3IR5B 1I7PA 5CDFA 4BWJA 4FF3A 2GHPA 1MMDA 4LSNB 4K4WA 1RHQB 3IM8A 1HWIA 4X64J 2K8GA 3H4BA 4J0QA 2GMJA 3C6TA 4EZ6A 3V5RA 1RSCA 3MECA 4G0VA 1HNIB 5I3UA 1KLMA 2R4FA 3C6UB 1OY6A 2BE2A 4ID8A 3DHXA 3GIKA 2WJYA 4NCBA 2UUCJ 2GK6A 1S9EB 1X5PA 3CO0P 1SFOA 1GR1A 1JJCB 4OHYA 4F2RA 1U0HA 5GAHI 2RILA 3TUPA 1TKXA 4IRCA 2C4TA 3ZNJ1 3SCJE 5FLXU 2GV1A 2AJFE 1R89A 1UEVA 3HKWA 3BGFA 3HD2A 3AA9A 3TA0A 3LNNA 3MCMA 3CDEA 4R8UA 4G0UA 4Y3CA 1RTJB 1LQ9A 2QL7B 2YTCA 3BGRA 1FVSA 5HROA 2G0JA 5KG2A 1JX4A 2IDEA 2DR5A 2VJJA 4QWEA 2ADCA 2C2KB 4C3IK 3MUTP 4G7WA 1S1TB 1QDUB 1HNVA 1FT8A 1OSDA 2E9RX 1NHUA 3DGPA 3T19A 2RHSB 2KI2A 4A8MP 1LOUA 4DV6J 3KLIB 4P73A 1CJKA 2CK3A 1C1BB 2B6AA 1M5HA 2XO7A 1P27B 1EKRA 1EXMA 4XM3A 2Q3PA 2UV8G 1X9MA 3BDPA 1BY9A 4DZ6A 1OO0B 2LQ9A 1COWA 3GTPC 4GO5X 3M8ZA 1N33J 5L9XA 3MXHP 2W7VA 4KAWX 3G2XA 2ZH1A 2DYIA 1RTJA 2OK7A 2V63A 1H38A 5AE3A 1UPPA 1BQEA 3W2GA 1TKTB 2CQGA 2YQ0A 1M1KD 2ZD1A 2YQ1A 2HHUA 3GIMA 1XXAA 3MCSA 3N6NA 4U96A 1B0TA 1E6YB 3LOUA 2NPIA 2HIYA 2IVYA 2V8HA 1MMNA 4LMZA 3IWXA 4O3NA 4USWA 4KN7A 2ZH3A 3VAMA 2CZ9A 2DNQA 1JJ2B 4P3IA 4YN3B 3POTB 3NXZA 3NOCA 4FS2A 3FFIB 3LWLA 1XFOA 1GXUA 1U02A 2ZZEA 3CCQS 2VICA 1H6KX 1VISA 3PY8A 2J7WA 5HQMA 4FDFA 4EI2A 2YKOA 3QO9A 3ERED 2V6AA 4QYZJ 2V8PA 3MEGA 5KT7A 1JJ2R 4I1TA 2ZJQQ 2ZFZA 1ZBTA 2OYNA 4DR7F 4KH1B 1O2BA 3A8JA 4M5MA 4J90A 4OLPA 3BY1A 5F4OA 3UCGA 4NCAA 3ZZTA 2PE3A 3T00A 3GTMC 3R2DJ 1DG1G 1TELA 2E2IA 1JLEB 2UUWA 4OI3A 1ZAXA 1L3VA 1BS2A 1N56A 4CZCA 4PWWA 3S8SA 1KC8T 5DS0A 4PC6A 5A8KA 5A6WA 4RW8B 4QZVB 2B7CA 2G1HA 1WNEA 3VMFA 2KHCA 1CC8A 5I3UB 5B0EA 4OJGA 1RA7A 4TXSA 2BYCA 4CRJA 3MFIA 3Q2TC 4P2SA 3DOMB 5CA5A 1CEZA 2J8AA 1VC5A 2JFDA 2FQOA 5CZVA 4A8WA 1UA1A 3NNAA 4TMXA 3JYTB 5ETLA 2QN6A 2NXEA 4B48A 4Z4SA 4EWTA 4GO7X 1EB0A 1I6VA 1SB6A 4LF5F 1H2VZ 3OBIA 1RWMB 3LP0A 2WCXA 3IAM9 1PYOB 5IWAF 1RWUA 8ATCB 1EQ0A 4ED3A 2CPJA 4A3FC 2ZZTA 3LAMA 3UCZP 2AHOB 1JA1A 2JRSA 2HW3A 5M5YK 1F6TA 1O28A 4ZVGA 4ZHRA 2PIIA 3OR2B 2AIRB 2V9WA 1YKWA 3D0GE 1KNZA 4NZ0A 3KHHA 2VC0A 5I3PA 2RQKA 3LVBA 5L46A 4QU6A 1RT5B 2RQ4A 2AD9A 2GSUA 2DNZA 5M2UA 1CULB 2GMLA 4KC6A 1PYTA 3GEEA 2DNRA 4ECYA 1IBMF 2AJ0A 1SC4B 1RAOA 2EC0A 3PX6A 1LK5A 4V1Ak 2EK1A 2CA9A 1XBWA 5GAEU 3M30A 4CH1A 1VQNB 2JSXA 1ZBSA 2HHSA 4ZLLA 2X3UA 3O2IA 2BKOA 3OFGA 5J2PA 2ZZGA 4PQAA 4KIAA 5CCLA 5SUHA 4OV1A 4C3JK 2RQCA 3UR3C 5EN1A 2E7VA 5L38A 4PZVA 4A3JC 5L8RC 3M1VB 5F0UA 3CXCR 4LFCJ 3OL9A 4JI3J 2R7ZA 4LSNA 3G4AA 2J9CA 2L48A 3CDAA 4A3LC 3DMJA 3I0SB 4FVMA 3OPOA 3K5NA 3P45B 1VQ4B 2WVFA 4RU9A 4OHZA 1PILA 1L3KA 2CF4A 2HEKA 4OX7A 4MAKA 5J1PA 1QGYA 3PW0A 3FBCA 1SKRA 4CDIA 3PX4A 2RE1A 3Q8RB 1EP3B 4DU7A 3WX4A 4DQSA 4ZVQB 4I0WA 5H9FJ 1U1MA 5CYQB 5B0CA 2F3JA 2YKMA 2J6UA 1U8WA 1KK3A 3NLCA 1JQGA 3M6VA 1AFJA 2VF3A 4RNNA 5LXYA 2HLDA 1M5OC 3I56S 2HGNA 4DHVA 5BYRA 4LQYA 2Z2LA 2J6SA 2C22A 3CUNA 2GVZB 1OB0A 3M8RA 2HCJB 1JLQB 1WEZA 1FNBA 1MSWD 4DR1F 3IMQJ 2K1RA 2Y3PA 3DI6B 2ZJPQ 3S14K 3VHQA 1SKYB 4DOZA 2E1CA 5EWEA 1NB0A 4CO4A 3HOZK 2FQQB 4P1VA 4ZIVA 3RW6A 3MF5A 3UWTA 2HQDA 1JLFA 1DHMA 2AJ4A 1GNKA 4C8YA 2I0XA 2BABA 2PSZA 3GYGA 2P8TA 3H59A 3H7HB 4KV8B 2XGPA 2W7PA 4U8VA 1VQ8S 4JV5F 4CI0B 2DNGA 4QWDA 3GQCA 2F4VJ 1VJWA 5F8MA 4YOEA 3D66A 4DNRB 2RC6A 2HZVA 1URRA 1HI0P 1YJNB 2ZNZA 4OZLA 2VBTA 1RTHB 4EO6A 5MAOA 2OKQA 4WZMA 3NGDA 1KK2A 1FX4A 3SEOA 4FM9A 5KT5A 4KMUA 1VQ8B 4QIWL 1IBLJ 2XCQA 3MD1A 2HNDA 1RT4A 3GVJA 2MQMA 1NCLA 4DDQA 3ISZA 3QGHA 1NKBA 2Q79A 3QT5A 4JOUA 4IFYB 2ZJRQ 4GC6A 1TL1B 1I94J 4OIRA 2QTWA 5FIUA 2E5GA 3WQZA 4NWBA 1EP2B 2DPJA 1YGYA 1VYAA 4UQTA 1Y0YA 5EDWA 3GV5B 4CP5A 2ALYB 3NL0A 2MQQA 4PWDA 4P74A 2COLA 4LOWA 2V2VA 4UY8T 1T8EA 3AVWA 3CO9A 2CRLA 3OSNA 2CKWA 4RDLA 5HJXA 1T02A 2P9GA 1WCMC 3EDQB 1NDKA 1I6HC 3QIPB 1M1HA 1CJVA 3OPKA 2BPOA 2J0QD 3HVAA 3EVMA 5D0HA 3UDLA 4CIOA 4G7HA 1TL5A 3KJQB 1NPKA 1BQNB 1T0TV 1RHRB 4RL1A 3I5CA 1KQKA 1T9YA 2XZPA 2QE7A 4IDKB 4C3KA 3OTBA 1Q8BA 4DUZF 3ITHB 5D0EA 1VQ9B 2R7WA 2XMTA 4CLSA 3TQEA 1AXQA 2JL9A 3GJQB 1IVZA 1H42A 1HI8A 3HT0A 1TMJA 2VQFF 4X4UA 2QRRA 5GAEI 3SV3A 1CS4B 4FVCA 4R71A 4IG3A 5J2NA 5KFVA 4UW2A 4QPXA 3MAAA 4P7TA 2RS2A 2LCWA 5KFKA 3I0SA 3CCEB 1SL0A 4NLRA 1EX8A 4EK2A 1IBKJ 4FBUA 2ZTGA 2WBRA 2QL5B 5CHPA 2QMWA 3GJTB 3ISND 2HDNB 3T1YJ 2FPHX 2NUHA 4URSA 1RJJA 4IR1A 2NXCA 2C2WA 2BVZA 1FWKA 1FDRA 4GRSA 1OGIA 1RHKB 4Q8EA 4LF9F 4PC2A 5C44C 1PIEA 1TVRA 1Q7YT 4ES1A 3M2VA 4RW9A 1XE1A 3DRSA 2I38A 3DLHA 4QWBA 4B3SF 2VC1A 3GTLA 3DLGB 1U49A 7AT1B 1KVKA 1U1PA 3E3XA 1R3NA 1NK0A 2V50A 4FNIA 3MR6A 3D6FB 4KKOB 5DGBA 3L7UA 3RG6A 1EHWA 4WIQA 4NLOA 1M5KC 2ZUGA 2WB4A 4RCZA 1KR4A 4F8RA 4NLWA 4OX9F 2OPQB 8AT1B 4UOGA 3QFTA 1Y5NB 3BF4A 1AB8A 4GKJF 4KKSA 4LIWA 3MM7A 3FSIA 3OTDA 3BJYA 1TWCK 1MWQA 3ONQA 4ECUA 2HNDB 4C2MC 3C15A 1FDDA 1JXEA 3LGNA 4NE9C 2OP5A 4H4MB 3QT7A 5EWFA 5GV7A 3TRGA 1TVCA 4KKOA 4B9SA 1X5SA 2UU9F 3CCRB 2HFOA 1KLMB 2ZBUA 2VOOA 4IW3B 5L1JA 1TKTA 2VG5B 4LF9J 2PA8D 3RYLA 1UW9A 4X7CA 2ZC3A 1NEEA 1DDIA 3SZ2A 3KDNA 3DCAA 5D15A 4OI1A 1Y10A 3NG8A 3AVUA 2HVEA 1S6QA 3R7SB 1TWHA 4M5HA 1FRLA 2B3TB 1QVGB 3N79A 1YIJS 1TKDA 2ALZA 1I6JA 1VQMS 3RGIA 1DTQA 1BQMA 1BQNA 1MROA 3MAAB 1JLQA 1XPPA 4WFBQ 2R92C 1RADB 3CD6S 2F8EX 3W9JA 1S77D 3GSIA 2VPYB 1KD1T 4C8MA 3AQPA 3EZOA 1D1UA 1EI6A 4DK1A 3VA7A 1IQZA 4D3GA 2B56A 1RAEB 3P49B 4KHPJ 3PCOB 5CYQA 3BQ0A 1B23P 3F0NA 1RWPB 1VQ6S 4NXNF 1QLNA 1E64A 1W9XA 3AT1B 2M9KA 2V6SA 5ETMA 9RUBA 1G7CB 3T5JA 3IG1A 5J1EA 4K5RA 4ZVEA 4A8FA 1HI9A 2KM8C 3KG0A 1G4CA 2M70A 1RT6B 1SXLA 4KSEB 3BQ1A 2N3OA 1QAYA 3RUBL 1MABA 3D68A 3FHZA 2X7IA 2BV3A 3GTMK 1Y5IB 4S0MA 3SSSA 4TKOB 3CCLB 1X7VA 4ZP6A 2N3LA 5HQLA 1C4AA 2CNKB 1V6HA 3KUHA 3D0HE 3ASSA 4DX7A 3NMAA 5C2CA 1G2EA 3O3LA 2MKIA 1DZ5A 2J0SD 3ES9A 4YELA 2NSCA 4Q45A 3TZZA 2W4CA 2Z6BD 3C14A 5AT1B 3A3OB 2RU3A 2HAIA 2OELA 2WSEC 1GMWA 1NM2A 4HE6A 5D3GA 3AD8C 2BJ3A 4K4YA 3I9V9 2KT2A 4MIBA 1S7IA 3VGTA 2YKPA 4OX6A 3UD5A 2W9CA 4ZP9A 4ED0A 3M8YA 1B4SA 3HFZB 4YDXA 2AMCB 4CM0A 1TWCA 4P2XA 2K06A 3GG0A 3L3CA 1WTFA 1JXVA 2KN4A 3K58A 3WNBA 2VFUA 3CCTA 4QFMA 4HE5A 4XDCA 5IQQA 2KJWA 3QSYA 5C25A 2DHAA 2VJUA 3NNHA 3T02A 3OAAA 2WSSA 3GCXP 2V67A 3HHKA 2B9YA 2MEWA 1RYSA 3LP1A 2A18A 4ITSA 1U4BA 3NKYA 4LR9A 4NPOA 1TZ0A 4ZDNA 4Q7JB 5KG3A 4ZCMA 2HYIB 4LRBA 2RF2A 4IOCQ 4YY3F 2ZL7A 4OJ1A 2G2YA 2X85A 1BWVA 1S72B 2KKHA 1KQSB 5F8IA 1QUPA 2IM1A 4LLGA 4DSKA 4NLUA 4C8LA 2ADBA 4C43A 3I31A 1YSJA 2WAQL 4O2DA 2GGPB 1F2GA 1LFPA 3WNCA 2CPHA 2DITA 3MR5A 3AXMA 3KDOA 2W8KA 9ATCB 1NPRA 4LR7A 4NXNJ 4OI4A 2ZFHA 3AB4B 5TV2A 2WOMA 1RABB 3V4IA 2D7SA 4M8LA 1NJYA 3G4CA 4QVJA 2DGUA 3SJPA 1FF2A 3MHPA 1FESA 2YKNA 4XLHA 1H74A 2VD3A 1J5EJ 4UAJA 4DS4A 2Z30B 2X3DA 2VNIA 2XMAA 4OX8A 2MJUA 4LFBJ 2Y1JA 4CCHA 2IYGA 2HFNA 3CGIA 2AGQA 3HX9A 3CC7B 4M5IA 3HZGA 5THXA 3HKZL 4NZ6A 1RT4B 1N4LA 2ZUAA 4P10A 1FRIA 2BZ2A 5HMWA 3LP2A 1KBRA 3BR8A 4DV5F 3MMCB 2Q6BA 4HH1A 4OJ3A 4O3RA 1S7HA 4F67A 1VQLS 4OYZA 2B8QA 3GSDA 2V2ZA 1PKVA 4ECZA 3I4MC 3ZTOA 3D0IE 2WSFC 2XHWA 2LDIA 4IG3B 3JYTA 4II3A 1KSPA 2VFTA 3H98A 4Z4YA 3IBFB 2R42A 1H8HA 3AH6A 5FD1A 2JWNA 3BQ2A 3NWRA 3NCRA 2F4NA 5C25B 3QSYB 5IOQA 4F04B 4FXDA 2UUBF 3PUMA 1XZPA 1XMBA 2JEJA 2HQIA 3GTQA 3MPVA 1TUVA 3VO1A 1BQXA 4N47A 2ZM6J 5KFDA 5KFAA 2BJ8A 2GIFA 5TMFA 4RNOA 2FYXA 4DV3F 3PW2A 4C3LA 1J5OA 4C4WA 3RTVA 4Y0FA 3GTGA 2BRLA 3CJ2A 4U6PA 1SL1A 4NCGB 3WY9A 2GJRA 1F5AA 1VI7A 3R5GA 1JLBA 1S48A 1WD6A 1N36F 3BPDA 3BV8A 2BANA 2AEMA 4XNFA 5DLGA 1N34J 3A3BA 2M7SA 5DQGA 2RNEA 3GFHA 2DNOA 2B9WA 4IFVA 5KFZA 1HPZB 2VFRA 4JV5J 3BSAA 3M2RB 1WC3A 5EX0A 3ZZUA 4J7CA 4OQJA 1IBMJ 4EO8A 2IJFA 1N5TA 2KXHA 3DOKB 1S9FA 3M2UA 5AXLA 4JI0F 2LEBA 2HRYA 2B5JA 1RWKB 3EVWA 3NRBA 4C8OA 3GTJA 1NK8A 1VHEA 4A8QA 1WU8A 3HOZC 4X4TA 3GTKC 2DOGA 2LU2A 4B3TF 4BXXC 2QLXA 1L3UA 1XMQJ 1FXDA 2MZRA 2KT5A 4URGA 2NREA 5CABA 5JJBA 4ICLB 3CJ8A 1RHMB 3HOXC 2JDIA 2OK8A 4X4NA 4OOSA 2ZBQA 4DNTB 4BBRC 3I96A 3EM1A 2XCAA 1NJIT 2B7BA 1SQGA 2Z58B 2V8DA 4ATNA 3DLBA 2B63A 1F60A 4O44B 3NBPB 3VWSA 2LFVA 3B6BA 5KFOA 3CCSS 1YVFA 3JQMA 5GADI 3UD3P 2DH8A 5L39A 3A8KA 1TV6A 3ZBUA 4YAUA 1QVFB 3KMSA 1Q53A 4AL6A 3OOCA 1U1KA 3J80Y 1RT5A 5D78A 1IHMA 4KYZA 2AT1B 3QGGA 1TWGK 2R7QA 4LF7F 3CCVB 2BM0A 4LFCF 1N08A 2W25A 3NNCA 5IYBK 5TJ3A 3DHWC 1RT1B 3RBXA 2DEJA 3AOAA 2QMUA 5AXMA 2L9WA 1RTIB 3S6EA 5HATA 3PR4A 5L1LA 1NAQA 3FSXA 4YB7A 5KG4A 2AJ2A 2BX6A 3HHLD 2IA0A 4NA3A 1SKWA 2XZLA 2X0KA 2FGCA 3TEHB 4JI2F 2OFHX 1RWXB 1T3NA 1SC6A 1SUQB 2Y9HA 2V4RA 4X05A 1MN9A 4MJKA 3ET6B 2V8VA 2UP1A 2YWHA 2CQPA 2K3KA 3P3DA 4NNJA 4AFFA 4LF8J 3CPWR 4USVA 1M90D 1BMQB 1ITPA 3HFVA 3VZHA 3ASPA 2HHHF 5TY0A 4WCEQ 2MQOA 1N06A 1HA1A 1HQUB 5DG7A 4J5OA 1S1WB 3EGZA 4NBSA 3F73A 3HOWK 4O3SA 4JV0A 4FKYA 1NMEB 2G2OA 2GQQA 2DRAA 3GTPA 4Y2IA 2VYQA 1RE1B 4C3HK 2GGPA 1KQ4A 4ZGQB 4IYQA 1LKZA 2HMIB 1JWWA 1YI2B 4N77A 3OHAA 2KVQE 2ZDOA 5IQ6A 4RM0A 1JIHA 4RKUC 2E5LJ 4F4YA 1CQMA 3MM9B 3BEGB 3EGNA 3DNCA 4RWXA 3SDEB 4K59A 1NDPA 2HFUA 2ZUFA 4J9LA 1H3DA 3J80U 2QDXA 3T41A 4CNYA 1C1CB 3BYRA 1Y1WC 1ZA1B 3CTAA 1QFJA 3KXDA 3KYLA 2K2PA 3OJSA 2G1DA 4G0WA 1K8AT 1AYEA 1YJVA 3BGRB 4ZH4A 2EBGA 3QJPA 3CP8A 2HLUA 4PKDB 3ENVA 4F4ZA 5M3MK 5DDOC 4J9NA 2V94A 5CZXA 2B6AB 5FA6A 2Q6OA 4QWCA 3ZZ0A 2X1FA 1HBOB 5GAGU 2JHEA 3NS5A 2FJEB 1UVNA 4TU9A 1QM9A 2W9CB 3W5HA 5TMCA 1IKXB 3IR6B 4PG8A 1YG0A 1S99A 3FMBA 5C3EK 4RUCA 3JQKA 4F0KA 5CH7B 1U6BA 1BHNA 4O0NA 4U67Q 4KH0B 4Y2MA 3LPYA 3JAMU 3N6LA 1LNQA 4HTJA 2PC6A 3S16C 3T3FA 2UXCF 1SIZA 4TYBA 3H0GK 4IH5A 3GEHA 4NLYA 3NUHA 3WX8A 5DLFA 2NYIA 5BYSA 2DO0A 4KPYA 2QTLA 4PC7A 1HBMA 4KRWA 4X4OA 2MXYA 1B7FA 1IBAA 1B70B 1Q82T 3GTKK 4ED7A 2NVQC 3MMLB 3POTA 3S2HK 4YAOA 4AF7A 2HQCA 1TL3B 2WPDA 4YFNA 1SC1B 4QOTA 2Y0SD 3AGQA 3GIIA 5KFJA 1VBKA 2HQ3A 2QFIA 1U1LA 3W9HA 5GAHU 4ANEA 2R2SA 5IOLA 3PDNA 3D28A 1Q8LA 2MLZA 1S10A 1PKUA 2HNYA 1MNEA 4J37A 1AIPA 2BMWA 4B9UA 2X8KA 2FZKB 1XERA 3SQGB 2KFNA 4FKXA 3CCJS 2CQBA 5E3PA 1YCLA 2AYMA 3VAHA 3U6KA 1K9MD 5HI7A 1UJ6A 3PX0A 2N7YA 2P9CA 7FD1A 3DRRA 3QRQA 1CJKB 3ZO7A 2OMLA 2VBVA 3K89A 3V81A 4RW4A 1NO8A 3LPXA 4C48A 3P6YC 4I67A 4AYBD 3MM6B 3BS9A 3EXCX 4NXMJ 3I5BA 1VLOA 5CD4A 1IKYA 5A8RA 2FDNA 2Y0BB 2P5VA 1R8AA 4N76A 4FF1A 1E3XA 4NOIA 2OD4A 3QFHA 4NASA 3VAKA 2W9BA 1N6QB 4YB5A 1MU2B 1VQYA 3KLEB 3I4PA 5G0RB 4B4DA 1BJKA 2NVXA 3EWGA 3CCMB 2XS5A 1SCJB 4RW7A 3DOLB 1WHYA 2Y1RI 3I4MK 1IBKF 3H25A 4KDDA 2MQNA 3OJUA 1HIYA 2LEPA 1B4BA 1X8DA 4X64F 3SLDA 2N82B 5K20B 1SH0A 2CDQA 1HNVB 4DN9A 3TX0A 5HP1B 4ZPTR 3J7YI 2H3EB 1GXTA 1FXLA 1PBAA 3G6EB 2C77A 3Q8UA 1O8BA 1D1NA 4XKWA 5IS2A 4AQYF 1BLIA 1S79A 1G7TA 1DDGA 3ZIAA 3JSTA 3ZC4A 5E5NA 4XCHA 4BY1C 3QX3A 4OI2A 1UFKA 3CCWA 4DQPA 4DR1J 2I2YA 1HNIA 3Q89A 4ZPCA 2FHJD 4C45A 3MM5B 4HH0A 3LGMA 4XLEA 1HWKA 2QIFA 5C4XK 2E2JK 1RGVA 1V0FA 1FK9A 2YNFB 3GJSB 3OL6A 3R5CA 2RUGA 2HNZA 3W60A 1XWLA 2JN9A 1FKPB 3SYZA 3CJQA 3HULA 1O27A 3KG4A 3TAPA 1HKAA 1IUJA 1MMLA 3M2UB 5FNZA 5HO4A 2ZOMA 2HK2A 1UD5A 5B7WA 4JYAJ 1NLKL 1JLCA 5KFBA 4RD2A 3ZZYA 1VH2A 1S4MA 2XMVA 2XNQA 4CO5A 3PJXA 1HYSA 4F4XA 1KDNA 3FOFA 2DNHA 4LF8F 3MMAA 3QZ7A 3CMAS 2ZTNA 3PRVA 3PIOQ 1IKWB 1JKHA 2FGOA 3H94A 1O5JA 2KRRA 4A3IK 3S1QC 2MPUA 2EG1A 5LSLA 4F4WA 4RBVA 3BQJA 4CO3A 4LQ3A 4YY3J 3X3UA 3PVXA 4DV0J 2OFGX 3PRBA 4JI5J 3MOZA 5A8KB 1N5QA 1YNNA 1N8RT 2VUMA 3JQJA 1DJ0A 2H51B 4ED6A 3JSRA 4O3OA 5E41A 1LW0B 4KHPF 1RAHB 4UQGA 3TWZA 1RAIB 2CQIA 3K2YA 2RDDA 2V4DA 4A3GK 3S1MK 2KO1A 3ZUGA 2A6HA 1PO6A 4UUXA 3RBZA 1YJ9S 3GTOC 5IYWA 1O2FB 4DDFA 4RNMA 1R8HA 4XAKA 4DPXA 4KY3A 4USUA 2YKQA 1KMHA 1S59A 3HVTA 1JLEA 3TYTA 1GTEA 4YDDB 4ZHRB 3GZ7A 3I55S 2WYRA 4BDPA 3BDEA 3ET6A 4J9SA 1EAYC 4OYOA 3RZDK 2ZVSA 2HQFA 3EPGA 2JJ2A 1AB4A 4IH6A 4DV7J 5T14A 1H8EA 4LUBA 2ZUEA 2XLJA 1WOPA 3KJFB 5J35A 2EG2A 4ASUA 1JJHA 1AMOA 1IR2A 2CQDA 2VQEJ 4DFMA 2JX2A 2A69A 3ZTQA 2X6WA 1GK8A 4CM2A 2IRUA 4XL9A 4WU2A 3B4DA 2XSJB 4NEZA 4TN2A 1U1OA 3ISNC 3AVYA 3PR5B 3UDCA 1WF2A 1LXJA 4X8IA 4DL3A 2FD2A 3DU5A 1GMVA 5JVGQ 2FVCA 4CLPA 4N3GA 2LLZA 3M6WA 5KT3A 1Q5VA 5GV8A 1NHVA 4YAWA 3KJVA 3GTOA 4GTAA 2KYXA 4B47A 4A3KC 1LW2B 2O3DA 4QWAA 3CCUS 4A4JA 2AGOA 1PSDA 1YZ7A 2PMZD 1F5CA 3GIRA 4DL7A 1CNEA 2IYIA 1MG7A 3KKFA 2PLFA 1Y11A 4KN4A 2GJPA 1YJ7A 1R8BA 2E7WA 2LEAA 2JC0A 5B09A 5F8NA 4YAFA 4A3KK 3R1LA 1TAQA 5C2GA 3BO3A 3HOWC 4Z37A 4GC7A 1CPZA 1TWAC 1U25A 3RRKA 1YJUA 1E1RA 4B3OA 2W01A 1IKVA 4JYAF 3IRXA 3J7A1 4C3JC 3IGVA 1FKOB 3BNWA 4F02A 4K4TA 4WZQA 5LJ3Y 4ECWA 4OZNA 1Q5YA 3MAHA 3LUYA 4DFJA 4LRDA 2E2IK 4Y7NC 4F7DA 4ENOA 2QYGA 4BLBA 1P9QC 2ZH9A 2EK6A 2WOMB 3HHNB 3JQRA 4ZVUB 1X4AA 3CVKA 4GVLA 2XM3A 2NVYA 4DU8A 3V6DB 5J2PB 5KOWA 4OIQA 2DT9A 3OW7A 1C0AA 3LH2S 2DIUA 2G0CA 2J0XA 4HKQA 3OEEA 2R2TA 4ZVFA 4R8UB 2F9JA 4NYZA 4N56A 4RW7B 2VONA 2E7XA 1SJ1A 2UUAJ 1T3OA 5K8PA 3B4MA 3N5BA 3L4KA 1YK9A 1BGXT 3MWBA 4QBUA 4RX6A 4UUWA 3H9NA 2YKNB 4IQMA 1XEZA 2WK4A 1Q0NA 5HQ8A 2XMWA 2BR0A 1WORA 1YWXA 3DFEA 4WFZA 2CC2A 1KLNA 1VRUB 2ZH8A 1KD1D 2JA6K 3CDWA 1VS3A 1FTRA 3U02A 4X65F 1FJ7A 4MK7A 3WC2A 4F7VA 1HBNA 2GS8A 1EKSA 2C3YA 4NLPA 2HGLA 3S2HC 2HHVA 3QFWA 4TNOA 3PM9A 3V6KA 3IG1B 2BW7A 2J5AA 4R0EA 3OTOF 4E2FB 3D6HB 4I2PA 4M5DA 2PFDA 3KK3A 1VQOB 4G5GA 1PAUB 1REVA 2OBTA 2JA7A 3S1NC 3FC9A 2V0NA 3VAJA 2F5GA 3VVTA 2QN6B 3AD9C 5A2QU 4EBDA 3GG1A 2PD1A 3CULA 2A6EA 4WTYA 3FKBA 2QGFB 2ZDPA 1GH8A 2BXJA 2OTJB 4J9VA 4WKYA 3CCES 1DAXA 2BSAA 3OKXA 3OQ2A 3QBCA 3S2DC 2SXLA 2XSJA 3DGPB 3MM9A 1IR1A 1GQEA 1CLFA 4OPVA 3N28A 2R2UA 4OHWA 1FRKA 1E63A 1I5OB 4ELTA 4X4SA 5FJ8K 1NSAA 5MLCV 1WI6A 2JDJA 1D9FA 2FX3A 1Q8IA 4M1XA 1H7WA 3KHRA 3T5KA 4I56A 2EBEA 4B3MF 2C3PA 4K0KF 2WJVA 5JFEA 2E2HK 3W2WB 1ZA2B 3E2EA 3R6GB 2F43A 4WTOB 2FLNA 1U1NA 5D4OA 2JFKA 4FXVA 2DNYA 2I1RA 1DD5A 1QJHA 2IVFB 2DCUB 2O5JA 4PUOB 3CJ5A 2ZNYA 2DEUA 4QYRA 4ED8A 1R0AA 3VAGA 2W4PA 2JA7K 2PEHA 3KG1A 2JVRA 1HBMB 3J81Y 2JA6A 3RR8A 5ETSA 1BXNA 4WYWA 3D1OA 3BSCA 2XZWA 4ZV4A 2HK3A 4RR5A 3I55B 1HBUB 4NA1A 1ROFA 1RT6A 4C11A 4TMZA 4HACB 1XMQF 5A8WB 4JI6J 4TU7A 2GJ2A 4O3PA 4G7ZA 3TW0A 5F4MA 1NDCA 3RAQA 2WSCC 1TTTA 1TQLA 2UVVA 4X6AC 1WSRA 4OP7A 4QUZA 5K14B 4Y7CA 4ID5B 1HQEB 2QMUB 1F3FA 2IJRA 4ES3A 3QAEA 5IT4A 1VIOA 3UNGC 3SJZA 4P22A 2ZBIA 3CJRA 3TA1A 3LA0A 1VDHA 5C4JC 1D0EA 1UZHA 5E2QA 3W2EA 2HVIA 3KLGA 5IT9U 4LSLA 2DNMA 1WC4A 2XWYA 4HYKA 3N01A 1F0XA 1U09A 4V19J 4DUYJ 1FE0A 1R0BG 4D3HA 3I4NC 3VGVA 4CT8A 4DUYF 2G4BA 2H48B 1QAIA 5E3RA 4P6VF 4DR4F 3O8WA 3LW5C 1RHUB 1RT2B 3MEDA 3QMQA 3BSOA 4UZFA 1T9UA 5D4PA 2J7KA 5IYDK 3JTPA 3C2PA 3EE3A 2IAJA 3UN3A 2BE7D 3JSMB 2JLFA 5IP7K 1QGZA 1RTDB 4DQIA 5DQHA 4RD1A 2Z56B 3TJ9A 1IR0A 2W7AA 3AVVA 2GJKA 4J9OA 2EXUA 4Z2XA 3DU6A 1FDNA 3FMWA 1JB0C 2MDAA 3RY8A 1N5VA 1ZPVA 4K4XA 4HHUA 4XOTA 5FLXY 1WPCA 3CWJA 3PNIA
chains in the Genus database with same CATH topology
1VLOA 3GEHA 1YX2A 3GSIA 3AD9C 1WOSA 1WSRA 1WSVA 2GAGC 1VRQC 4P9SA 4PAAA 1V5VA 3A8IA 4PABA 5L46A 3A8KA 1WOPA 1NRKA 3GIRA 1PJ6A 1XZPA 3GEIA 3AD8C 1WOOA 1XZQB 3ADAC 3TFHA 3TFJA 1X31C 2GAHC