1WSVA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
371
structure length
371
Chain Sequence
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Aminomethyltransferase
total genus 117
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsvA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsvA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsvA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsvA03
1VLYA 3GEHA 1WSRA 1XZPA 3TFIA 1WOPA 1X31C 1WOSA 1WSVA 3GSIA 1WORA 3TFHA 1PJ7A 3TTGA 1PJ6A 1NRKA 1WOOA 1V5VA 1YX2A 4PABA 1XZQA 3ADAC 1VRQC 3A8KA 5L46A 3GEEA 3TFJA 1XZQB 3AD8C 3AD7C 1PJ5A 4PAAA 1VLOA 4P9SA 3GIRA 2GAHC 3AD9C 3A8JA 3GEIA 1XZPB 2GAGC 3A8IA
chains in the Genus database with same CATH superfamily
4I0WA 1NJYA 5H9FJ 4YDDB 3IG1B 2YVSA 2B51A 5I3UA 1NCLA 3AVXA 2F65A 2R42A 4TNOA 1KK1A 2ZUEA 3R8YA 4N41A 1DJ0A 2V7QA 3QRRA 4BBRC 1Q86D 2Z6BD 5DS0A 3NEKA 3VAHA 3D6HB 1RT7B 1HBNA 1F9HA 1BHNA 1YJTA 2VUMK 4LFCJ 2NUUG 3BP3A 3BJYA 4M1KA 1BX1A 5LL6d 4V19J 3M2UA 2FVPA 3PO2C 3Q83A 3W64A 4J9UE 2DIUA 1FFWB 4FYVB 4KB7A 3RU0A 2XGPA 1HA1A 2VG5A 1NSPA 1IR2A 4JV5F 2CYYA 3VALA 1RI7A 1AXQA 3POTB 3ICLA 4WXWA 1Q7YT 4BXXC 2R7WA 2J0WA 1IN0A 1Z2ZA 2EVZA 3HXAA 4LR9A 2BEFA 2YKNA 1CC8A 3BP8C 2LFVA 1RHJB 2YKMB 1QSSA 3N3YA 2IAJA 1O25A 3JXOA 1RT1A 3MECA 3OAAA 3KHLA 4AH6A 8ATCB 4RUAA 2HZVA 3ENVA 3W2IA 3FEZA 2MGZB 4MKVA 3BR9A 1WHYA 3ULHA 2CQ0A 3MM5A 2J9CA 3NUHA 1COWA 1Y11A 5GAHU 1T3NA 2DR6A 3RZDC 1NDCA 1TWAA 3LAKA 3M1VA 3TA1A 2K06A 2UU9J 4KKOB 2KG1A 2XOKA 2BMBA 2GVZA 1GX5A 4ZVEA 5DSZA 1M5VC 4TT3A 5BYSA 3PIPQ 5IS2A 1HQMA 4OX9J 4RU2A 3R27A 2RT3A 2ZOFA 4DQLA 2ZFZA 1WTBA 3OBIA 4NCAA 5ETPA 2ZD1B 5T41A 3SIPB 3NBPB 4P9SA 4DBQA 3BCDA 2Z56B 1PAUB 3CMMA 4M8LA 3B78A 2JLGA 4QV2A 3ET6B 4PUOA 2MB0B 2CRLA 4QIEA 2CC2A 1ULRA 2IM1A 3T1AA 3PVXA 2C3YA 5KFUA 4JI2F 3WBJA 1KKHA 1O2AA 2R3VA 3UCGA 1CQMA 2ZHOA 3SDEA 6FDRA 2CQPA 4LR2A 3A13A 3SZ2A 4U9RA 1CPZA 2LP4A 4WTYA 1O28A 2BGIA 2DVIA 2DYIA 3CW2C 3VWSA 3NAHA 3PJXA 3AA8A 1XXAA 1CULA 2HS0A 1VMBA 1W0JA 2RKIA 1LWCA 4F3QA 2R7XA 5HL7Q 2L3MA 1FVSA 1JXLA 2HQGA 1S4FA 3GV7B 2V68A 2RUGA 2VZ9A 4RPFA 3BGUA 4GTLA 1WSRA 8AT1B 2I1LA 3QWPA 4MFBB 1HFEL 5EGEA 4RD0A 2V6AA 3JAMY 4NCNA 1BJTA 3MEDB 2VODA 1AUDA 2KI2A 4TY8A 3FFIA 3KK1A 3PA1A 2RRBA 4FZBA 4ZPTR 2WZ1A 1SXLA 3GJQB 2ZTNA 2D6FC 1IKYB 1F60B 3IG1A 4IFYB 3FK4A 2PC6A 5ITHA 2PO4A 1VQ5S 1QTNB 1R8CA 1X60A 4C8LA 2DY9A 3BSCA 2HFZA 3T5JA 3BS9A 1S9EA 2DR7A 1Y5NB 3QGIA 4Y7NC 1FNOA 4F2RA 1U1PA 3PR4A 3OXGA 4B02A 2P5VA 1SKRA 3DRPB 4IFYA 4P25A 1ZPVA 4WFNQ 4C3IC 3FFIB 2DR8A 2XHCA 4PABA 4QIWD 2P5MA 2L9NA 2D3LA 1RWWB 1BMQB 4QWCA 4KB4A 2G2OA 1TUGB 1A8PA 1HNWF 2JEIA 1WSVA 3MCAA 2FLNA 1SI9A 5T7LB 4PYDA 1HYSA 3AOAA 4PPDA 3VAIA 1MROA 4PWWA 2B43A 4OYMA 1HHSA 1KHVA 1XFOA 4DV6J 1YHQB 1WD6A 2VKZG 4ATNA 5TRDA 4IH7A 1YJ9S 2XY5A 3P26A 1USOA 2RD5C 2AX1A 2HHHJ 1OSDA 2CPDA 3R7BB 2VPWB 4XR6A 4KGKA 1BQNA 2J9EA 3P27A 2YQ1A 3ETOA 4AVZA 3AVUA 2AZ3A 2R93A 3UDVA 2OPSA 5ETNA 4A8FA 4QZVB 1HWIA 3B4MA 1OPIA 2W9BB 2W7VA 2DNYA 4ZPVR 1RBOB 1V6HA 1O2BA 5JVHQ 2DGQA 4B44A 2RB7A 4G6VB 1GXUA 4X65J 5JXSA 4JI0J 1LW2A 4C48A 3ZTOA 2BDPA 4ZGNB 2CBXA 5F4MA 2JA8K 5E33A 4NLUA 3NP5A 5IYBK 3L9ZA 4PWUA 2B9WA 2JFDA 4NE9C 2RS2A 5B0CA 4B9MA 3MM7B 1V9OA 1RT5A 2BJ1A 1UP1A 1EKSA 4DV2F 3FCVA 2R7SA 1QFJA 4XDDA 2J5AA 3KUEA 3PUNA 2CJQA 4Q43A 3E20A 2XNQA 4M94A 5C24B 1RLDA 4WJBA 3D2WA 1TUVA 4QQBA 3ISXA 2K7JA 1TUIA 4KV8A 4NRTA 1H72C 4DV6F 4JMQA 5DGAA 4RD2A 2O5IA 2JC0A 3DC2A 2UUWA 2W25A 4DDQA 4FP9A 3OFFA 3QLHA 1F9NA 4FYYB 3M30B 3HHNB 1IKXA 3FEYB 3EICA 2C42A 4ZVRB 1FTRA 3QQCD 1NPRA 2CADA 2J0SD 4OYXA 2W9AA 1OJ4A 5F8JA 1S48A 1U0HB 2NPFA 3CMQA 1OB5A 1J5EF 1QGAA 2XNCA 3JSMA 4EBCA 2QIFA 1NK9A 2W7PA 2GFFA 3VAMA 3K5NA 2VBUA 3WXMA 3PW4A 4OIQA 4HE6A 1Y0HA 1APSA 4DK1A 2CJBA 5ETLA 2VF3A 1G2EA 3GDZA 2RGRA 5GV8A 3I56B 3ZZPA 4HH1A 4BBYA 2ADCA 2E2IC 4X64F 4TU7A 1F9EB 5BYQA 1S99A 1KJZA 4HL9A 3JYTB 5CH7B 1EZZB 3K7AC 3BO2A 1S1VA 2EFOA 3I6PA 3Q22A 5GADU 3SZZA 4A3LC 4HYKA 3W66A 2PFDA 3DOLA 5KG0A 1RAJA 3CTRA 2HQCA 3MOZA 1RTHA 5M2RA 5HN0A 1B0TA 1A7GE 3WX4A 3OR2B 4ZIWA 2XO6A 1VQ9S 2C2OB 3W2WA 1IQZA 1FTCA 1ZOTA 5A6PA 4OMFG 1USMA 1H74A 3Q39A 2NSBA 3Q8YA 2DHHA 3OTEA 3KK2B 5DM7Q 1VRUB 2E1AA 4O3QA 3R5CA 3J7YI 2V7WA 1BLUA 2NVQK 3H25A 1VBZA 3KNAA 4U95A 4FM9A 3T1HF 2C78A 1REVA 1KFSA 1U7LA 4N8OA 5IWAF 3RRHA 3OHAA 3CE8A 3DRYA 3W9JA 2KVIA 1K8AD 3HXMA 4UQTA 3FJ2A 1WC4A 1XE1A 3FQKA 2XMTA 4ANCA 1SB6A 2GMJA 1O5JA 1RP5A 3IBCB 4PQUA 3A3NB 3S1NC 1HBUA 1X31C 2KG0A 1VS3A 5C44K 2WW8A 4XAKA 4RNFA 2NVYC 3MM9A 5KAKA 4TU9A 2ILYA 3DGPB 3OW2R 2YH1A 2LDYA 3ENWA 1CJKA 1ISEA 1UETA 2O66A 1RA6A 3MEKA 2QFJA 3WNBA 3H5SA 2GZOA 4OJ3A 2KT3A 3BEGB 4Z1MA 4R5PA 3OFNA 4C97A 2JEGA 1Y5LB 4HLBA 5KFJA 1GJRA 2C2ZB 3QJJA 4B9NA 2X3DA 5J2PA 2Q3PA 3QJPA 4IOCQ 1FA0A 3CJTA 2E7XA 4LUBA 1TKTB 2KZMA 3W2WB 5IQ6A 3ETMA 1NAQA 3OR2A 1S79A 3ERED 2VQEF 4C45A 3I4PA 2JC1A 1XZQB 4DR1F 2XSFA 1A9NB 2J7UA 4D3HA 2JRSA 1DFDA 1OYDA 4C3KA 4F02A 1AFIA 2F1MA 5B0EA 2GMLA 1P1LA 3GTMK 2IM0A 4NA2A 4CRJA 2C2DA 2WB4A 4F4KA 1OGIA 2EK1A 4TVAB 3H3VD 1TWFK 2RQ4A 2BJ9A 1C0TB 4AF7A 1H98A 5D6GA 2CQ4A 1WORA 1JLEA 2GQQA 4N5SA 1SJ3P 4F36A 2KM8B 4TYBA 2LU1A 4RDLA 1Q7LB 4Y0FA 2J9DA 3SEOA 5HQMA 4DQKA 1GTEA 2BA9A 5H9EK 2A3JA 4I2PB 1O6XA 1Y1VK 2HKEA 5IOLA 4G7WA 5B09A 4HT5A 1KR4A 2I5JA 2ZH1A 2D9OA 1G7CA 3PO3K 1S72S 1N06A 1JNZB 3V4GA 3BH4A 2KYZA 4PYAA 3D68A 5C4JK 1VQ9B 3OXFA 4M0LA 2G2YA 1IUJA 2YX4A 3SBMA 1VQLB 3GTKA 4BXXK 3MMPA 5FIUA 1Y0YA 1BY9A 2L08A 2MHEA 5KFHA 2DJWA 2QGGA 1JA1A 3H90A 3GJSB 1LK7A 1XXBA 3A35A 3QO9B 1T9YA 5A76A 1XTZA 2HEKA 4DR4J 3AA9A 1KK3A 2HBQB 1XMQJ 3DLKA 3CCVS 4WILA 2Y8YA 4DLEA 4X7EA 4EK2A 1DTQB 2ZE2B 1FRXA 2E9TA 4FVCA 2DD8S 2YNFB 2WBMA 3M2VA 3PW7A 4J9PA 1S9GB 3RGIA 1RWUA 3RG6A 3VQSA 2KFNA 1T3OA 2UVUA 2G2ZA 4MT1A 2IC3A 1IJEB 4LFBF 1CJVB 5F0WA 4URQU 2BKNA 4FF1A 2GCFA 3FSXA 2NYIA 4II3A 3H20A 2Z58B 3HK2A 1J6WA 2CPIA 1L3UA 1K9MT 8RUCA 5A8WA 3ZUGA 4OQJA 2ZBUA 3GQBA 1HD1A 4YR3A 4OV1A 3CDUA 3NCPA 5KFGA 3GEEA 2Y3PA 1M0SA 4LREA 3K5LA 2BACA 4OL8A 2YQ0A 4JI7F 2WRMA 1P9YA 1PYOB 1VQKS 2BJ8A 1HBOA 3KDNA 1JLAA 4WE1B 2HWTA 3D5MA 2YTCA 1BJKA 3AVWA 4M1XA 3JQJA 1RT3A 1SIWB 2K1RB 1Y0RA 2LKZA 3HDSA 3NGUA 3TZWA 3KG4A 4U7UD 2CG4A 2KXHA 2Y1JA 2XY6A 3AJDA 2D7SA 1AB8A 4EZ6A 2FJWA 4CLZA 1UD2A 1N36F 1KNZA 1E3XA 4IDKA 4C8MA 2UUBJ 1REVB 3LAPA 3BGFA 2KO1A 3C14A 2HCJB 1TL4A 4ZVGA 3BKFA 2ZXHA 4OIXA 4PQAA 1BC6A 2M5YA 3F0NA 2E29A 4GZYA 2XLJA 4ID5B 4QBUA 2R8KA 2XQCA 2OH2A 2VBVA 3OXLA 3RZAA 1TAUA 4URSA 3AD8C 1IBLF 4LSNB 4WIIA 3KEWA 5M2PA 5BSXA 2HLTA 4KRWA 3MMBB 5M5WK 1X7VA 5KFRA 4JOUA 4F25A 3I4HX 2G0JA 3M6VA 4CH7A 2BOPA 3TI0A 5EX3A 5KT2A 4X06A 1VJEA 4R0EA 5KFQA 2DGOA 2KH9A 4Z4YA 4DV0J 3HVWA 5TJ3A 1S76D 1HNVA 3OJWA 1DBDA 3M8WA 1XNRF 4LBVA 1TWGC 4LF9F 3NWRA 1P4MA 2BANA 2VBTA 1HD0A 2RKIB 4IOAQ 4E8UA 4JI5F 1RT2A 1FX2A 3N5BA 4WFBQ 2WHOA 5C44C 3BDPA 5GV7A 4GTAA 1M5KC 2G1HA 2GVDB 1YZ6A 3JS9A 4OHWA 3CCZA 1VRTB 1Z2LA 3OFEA 1XEZA 2N7YA 1JJHA 4DR6F 3H59A 5AE2A 1M5SA 3IWLA 4YHHF 4Z4SA 1EAYC 2C3UA 1GNKA 3HM9A 4QJVA 2KT5A 1IQ0A 1IKXB 4P12A 3EVWA 4YR0A 3RW6A 4J9QA 2JA5K 1R8AA 2B6AA 3KLEA 1LKZA 2BJ7A 3ZXWA 3BQ2A 3VR6A 3I96A 3LGNA 3BBCA 5ETQA 4WFZA 2YX7A 2MQLA 3I0RB 3LWMA 4TKOB 4KN7A 3T53B 2EC2A 5J2QB 1VLOA 4JI5J 2PA3A 4G7HA 3UQSA 3NS5A 1H7XA 5M3MK 3S15C 3HMJG 1GMWA 4H4OB 2I2YA 4PWDB 2WAQL 2NVXC 5G4DA 2PI5A 4EBDA 4XKVA 4A48A 2Z2MA 4JI4J 2EFQA 5KFBA 2VNKA 1TR0A 3H9NA 1FFGB 1DCPA 4RWWA 1E62A 3W5ZA 1GMVA 3SCJE 2OFHX 2DT9A 3CCQS 1OMSA 4QJVB 2F8MA 4U9UA 3AVYA 4DV5J 2IFXA 3ZC3A 4LF4J 1VC6A 3ZBUA 2HG4A 1NKCA 4M5GA 4PG6A 1EETA 3AD9C 2ILZA 3WBZA 1KLMA 1VGXA 1U02A 4B3OA 2RDIA 4C4WA 1YNJA 2DXEA 1SJQA 2AYMA 2GVDA 1WEZA 3US5A 4XD7A 1KC8T 1EK8A 5I3QA 2M3DA 2B7BA 5HROB 5D15A 1T03A 1SJFA 2GA7A 2Y3YA 4GC6A 3MMAA 7AT1B 2BZ2A 4DV1J 2L9WA 3MAAA 4B3TJ 3ZZRA 1I3QK 5IWAJ 3KLFB 2B0GA 2P6SA 5I42A 1KD1D 5KFWA 4TXSA 1HYSB 2F4VF 1QUPA 2WW4A 3U27A 3DDYA 1FX0A 3V81A 2B63C 4URGA 4H4KC 2KDOA 2ZL6A 3NS7B 2H1YA 2ZJRQ 4ZK7M 2QMXA 4DSEA 2D9PA 3CCQB 4ER8A 4KB2A 1YQHA 4NLVA 2WVEA 3GTJA 3N0VA 3AB2B 3G05A 1LXJA 1WC6A 1VJQA 1K83K 2EPIA 2WZNA 3CT9A 4XOTA 2YNGA 1CG2A 1LW0A 4OYPA 3Q3QA 3D9BA 3GQCA 1S9EB 4AE5A 5KFEA 1LW0B 2N3LA 1LOUA 3MMCB 3HOXC 3IRWP 2EFVA 2PHCB 4P1VA 2MQPA 2DNOA 1MNEA 2H65B 2M2BA 5EN1A 3G9CA 1WC1A 1XB2A 3A1PA 3W60A 1N4LA 3BYRA 2F9JA 4X66J 1Y10A 2ROEA 3WNDA 1VQMS 2X7IA 4BBSK 2FVGA 1T9XA 5I42B 1Y1VA 3M2VB 3I82A 3O8WA 5IOSA 2ZE2A 4KQZA 4C8YA 4FKYA 3V4IB 1L3KA 1CQNA 1YDLA 2BF4A 4OHVA 3I55S 2XYPB 3QFRA 2OSRA 1ZETA 1ZBSA 1VQ5B 5HJXA 5F3TA 2XMWA 3HZGA 3G6XA 4WXOA 4B08A 2FJAB 5GAGI 1P27B 1KLMB 5DDQC 3MURP 1WU8A 1RBLA 1CJTB 3SDEB 2XGJA 2IC3B 4WK3A 4X6AC 2BKPA 3FOEA 1TAQA 4DV7J 2YY3A 1BQXA 2B3TB 4IR9A 4GKKF 1EB0A 5D4OA 1S49A 4J9RA 5HJYA 3LTOA 3J81j 1EQRA 1NHVA 1X5OA 1QAYA 4ASUA 3OQ2A 3BQ0A 1JXEA 3J81Y 3TX0A 2JX2A 2HIQA 3DNCA 2R7ZC 1SJ4P 3KFWX 3OL9A 4A3JK 2AGPA 4QPXA 1HLWA 2WB1L 4NI2A 1N5YA 4JB8B 2XNDA 3QT6A 3ZBTA 4WFXA 2VL1A 2VBSA 2JH3A 2IRUA 3UD5A 3M9OB 2AJQA 1KK2A 2GJRA 5C25B 1ROFA 1EJ7L 2MQ8A 5DO2A 1N33J 5LMUF 2X6XA 3PW0A 1QAJA 3D26A 5CCLA 3PYDA 1JLGA 4GTEA 3HSJA 3GIRA 2YNHA 4M5NA 5KT5A 4WJ4A 2PT0A 4BPRA 1FWPA 2AJ1A 2DRDA 4TMWA 1IBKF 2W2PP 4Y7NK 3QSYB 1UD4A 1EWYA 1E1RA 5IZHA 3D54A 3M8PA 5KT7A 2BPOA 5HKKA 1W2IA 2HZCA 5IP9K 4O44A 3HT0A 2DHSA 4F8RA 3UDEA 4OZ3A 3CQZA 4NZ7A 2XI2A 4RJLA 1KONA 3IRXB 1GFWB 1B70B 4DSIA 4A93K 3IC1A 3OL8A 4NXNF 2B4VA 2NPIA 3QIPA 4KMAA 2VPZB 4MEYA 4O23A 3GTMA 3MM6B 3O5TB 2JIZA 4UZFA 5LM7E 3FBCA 1RAIB 4KGZB 4IG3A 3G82B 4DR3F 5DG7A 1RAOA 3M3YC 3MFIA 3HPOA 1TK5A 5FDLA 4GVBA 4RR5A 4A8XA 4J37A 2VC1A 1NUEA 2XZTB 4P26A 4YB6A 1UJ4A 4OIRA 4DX6A 1SPBP 2WOMA 4XL9A 3WBKA 2DEJA 2LU2A 2U2FA 3UFCX 2YWGA 4X4RA 3CJSA 3P5BP 3SCIE 1NB0A 4CYUB 2Y1IA 2MJUA 1ZAXA 3S1QK 1S1XA 2CPFA 3C6UB 2RVJA 1NK6A 4CLTA 4J90A 2H5JB 2BM0A 3LP0A 3HHKA 1YBAA 1WF2A 1SH0A 2KVQE 1GAQA 4QPTA 1JQGA 4P3IA 1UVLA 5HL8A 2PN6A 2AHOA 1W0KA 3LQVA 2W4CA 3MD1A 4OINA 3CDEA 4RBVA 4Z37A 3QRPA 2BKOA 4KPYA 1H2UX 2LQJA 4ZCKA 1SQFA 3DRRA 3GU0A 2J6TA 3I5BA 4QVAA 5C7PA 4OJHA 1FHTA 3RYLA 1HKAA 4P7VA 2WB1D 3HOWC 2VQFF 2R9VA 3HP6A 1Y9OA 2HDNB 4IG3B 2ZBQA 4ZCMA 2BQ3A 5IT0A 2HNYA 2VB6A 2FJEB 1T05A 1D3WA 1QFZA 2DBBA 3UCUP 4ECYA 4C7QA 4G1BA 3CD6S 2V7XA 3M2RB 5HO4A 2QL9B 4XOPA 1PJ5A 3IWNC 1VC0A 4C3HC 3I5AA 4TMZA 4NXMF 1TWHC 4DV3J 5AN9A 1Q78A 5CZVA 4CO1A 3EMTA 5C4XK 3CIZA 4KMDA 2HAFA 4ZVFA 1AFJA 3IFEA 1U1RA 1X4DA 1WF0A 2A18A 2OBRA 4OYZA 1D8YA 2P9GA 3ASRA 1VOMA 4X4NA 4IKAA 4XMYA 4W92B 4PG7A 2OUGA 3BV8A 2BW7A 3ZPNA 3S1NK 5L9NA 2OGUA 3W2VB 4HDHA 1FERA 1FWKA 2HWHA 3CAGA 3HOWK 1GXLA 2FTRA 1QE1A 3M8ZA 4DSFA 3W9HA 1DTTA 2YWHA 3QT7A 1S1VB 1TV6A 3OL7A 3RUBL 2OEJA 2W4PA 1WOSA 5E3PA 2E2IK 2FYXA 4P5BA 3TFHA 1BUXA 2R2TA 2ZZMA 1KP6A 4KFBA 5EHHA 2QX0A 1W25A 3OJSA 3CB4A 4X4SA 3R5GA 2CFXA 3MHYA 4AL6A 4OX8A 3E8OA 1HI0P 2V4DA 3PO2K 3PKMA 5J35A 2VJJA 2BJEA 3JTNA 4RD4A 1N5YB 4ED2A 3AJ1A 1ZZNA 2YNIA 3WYAA 2I5JB 1RT5B 3CCMB 4DX8H 3RBDA 1UKUA 4N77A 4A3DC 3H5UA 3DOKB 5ETOA 4RWXA 2V8PA 3K5MA 3GTJC 1I8DA 4GMKA 2CNOB 3EPIA 3W61A 4PC2A 4UY8T 1RADB 2RJZA 3TYTA 5H59A 5FNZA 1TWAK 3M4OC 4DU7A 5HMZA 3OREA 1WG1A 2FHJA 2DNLA 3TOQA 2QYCA 1K83A 3TA0A 2E5IA 4DR7F 3M9MB 1R0BG 1VQ4B 4CQ1A 1CS4A 1YTYA 3SZYA 4Q4ZA 2ZOMA 3I5CA 1YSJA 2D3UA 4Q45A 4DN9A 4FZVA 3MR2A 1K1SA 1Q5VA 3W2VA 1YBTA 5J2NA 4YB1P 4QIWL 3L3CA 1KTVA 1NK8A 3KJNB 3RY8A 1B64A 1E3ZA 2WCXA 2AW0A 1UZDA 4XPEA 4RJVA 4Q0BA 3AY0A 1B0PA 2BGJA 1S12A 1MROB 3QFSA 1Q7YD 4E98A 3HHLD 2VU5A 4QWBA 3O44A 1MG7A 3DRSA 3MUVP 3O1LA 1ZM2A 3CCRB 3S15K 1FKOA 4Q44A 3L4JA 4B3RF 1TELA 4Y2IA 4ED5A 3S1MK 1BGWA 3P6YC 1FDAA 4ZHRA 1VBXA 1K9MD 3HVAA 4WU3A 4X4VA 2GJKA 3BQ1A 1RU1A 2YKQA 2C2EA 3UR3C 2DNKA 3CJRA 4GC7A 2DB1A 2GS8A 3I32A 4ZA1A 2DERA 3P5TL 4HHHA 4QYZJ 1BQMA 3JQRA 1URRA 4OHZA 1T05B 2H48B 4X4UA 1U26A 4FXDA 1NHUA 4TLQA 2RQMA 2G1DA 4K5SA 4MAKA 2X3GA 1XR6A 5THWA 3EZ5A 4B4DA 6AT1B 2AMCB 4DUZF 3MWBA 2E5JA 4LQ9A 1NJXA 2ZNZA 1JLQB 2YWWA 2V7TA 1MN9A 2HURA 1TZ0A 1F20A 2DXDA 4KMHA 5M3FK 1MU2B 4ZCLA 3G82A 4CO5A 3D6TB 2QTLA 1QVGB 1E6YA 1HQUB 1DLOA 2GPJA 3MM6A 2HGMA 4J91A 5IYCK 2F5GA 5T14A 2FVRA 2B4UA 1X0PA 3DDIA 1QFYA 1S1XB 1HVXA 3IRXA 4QR0A 3NOCA 3MF5A 4OI4A 3OL6A 1ITPA 2CNKB 2ZWPA 3K17A 3Q3AA 4CLWA 2GX8A 2VFTA 4Q5SA 4N7TA 2GMHA 4Q8FA 3C16A 1F6TA 2E7WA 4IQXA 3OPFA 3OFGA 2XCAA 5LMZA 2WJVA 5FDLB 5GAEU 2A0FB 2AJ4A 3HHLB 5DJBA 4G0WA 2X8KA 1UPMB 5KFKA 2OPRB 3BN7A 3GIJA 1UVNA 2DRBA 2NVTK 4LR8A 2PEBA 2VFSA 5L1LA 2ZUFA 4AL5A 3ASSA 4PUOB 2C4UA 3KHGA 4USVA 4ZVHA 4YALA 3JYTA 1KDNA 3IAS9 3Q24A 3FKIK 3R5JB 2CQCA 2VBZA 4O44B 4DXLA 3PHTA 2MY8A 3BF4A 2BQRA 5EMNA 3DDKA 2C5BA 2B4PA 4P2XA 3LH2S 2ZM6J 3EZUA 1YJVA 4P22A 1JLCA 1FNMA 1SC3B 2IHR1 1JKHB 2ZZNA 1TL5A 4C3HK 2F1LA 3A8JA 1H8EA 3P49B 2E9RX 3QX3A 3T9ZA 3LWLA 5H9FK 2DIVA 3CCVB 3W5XA 4EEYA 4NLGA 1KSPA 4ZGQB 1FJGJ 4PC6A 4DR4F 3ZTPA 2W2OP 1IQTA 5IOQA 3CUNA 4X66F 1YJNB 1FXLA 4F4YA 3MECB 4X0CA 2YQ3A 1H38A 2YX1A 4U6PA 1TKXA 2CJAA 2IBKA 4O4GB 5SUHA 3MXHP 5C4XC 5HVFA 5IFMA 4Y52C 1I5OB 1VCTA 5EX0A 3N6NA 3GIKA 3G6EB 3D1QA 2G0IA 2Z8QA 3Q8VA 1RHUB 5AJ3F 1C0UB 2HRYA 2EI5A 1DAXA 3BDEA 3D66A 5L38A 5CABA 1KMHA 3C46A 1U6FA 2DHXA 4JV2A 3QZ8A 4ZOSA 5KT6A 2MMYA 4ZPBA 2WK4A 4UZUA 1UVIA 4LF8J 1HWKA 1VIOA 3OUYA 2L9DA 7FD1A 4EZ9A 1WC5A 3FBFA 1NZAA 4N3GA 5KG6A 4USMA 2EW9A 4TU8A 2HZAA 3BUEA 4J9KA 5D4DA 4Y28C 4DSKA 1IBMJ 2BJDA 2BR0A 1ZA1B 5AXLA 4HT7A 4YUDA 1R8HA 2QEXB 1XXCA 3BGRB 2Q1LA 1Y1WC 4DL6A 3T1HJ 3DMJA 3TJ8A 4Z4UA 3HKWA 2AJFE 3CW2A 3CO9A 5BSYA 1QUFA 2UZAA 1MWYA 3K7RA 2PIIA 1SFOA 4EFAC 3OTDA 3T1YF 3RB4A 1HWJA 1NDHA 1GH8A 1I3OB 1RQ0A 2DH8A 3QFTA 1FXDA 4A3LK 2K3IA 1HL6A 3FSYA 2W1BA 1SJ1A 2HLDA 4O0IA 3V81B 4A3FC 4I69A 4PZVA 1XJWB 1SH3A 5K8MA 1VQOS 1KQKA 3DMJB 2FJBB 4NA1A 4OI6A 4UY85 1VF7A 3S2HK 1YZ7A 1PKVA 3QPIA 2PD1A 4WJ3M 1D1NA 4PG8A 2H4WB 2X3UA 1BQMB 4A3KC 2ZH2A 3JTOA 4A3EC 2DHAA 1EXMA 1EQMA 3KHHA 2NVQC 2FC9A 1SJRA 2K7KA 3W2FA 5DG8A 4ZHRB 1NO8A 1Y00A 2A69A 4H4MA 3AT1B 3QYYA 4HHJA 4P5AA 1EETB 3GTQC 1GO2A 1RWNB 1DDIA 3TZYA 2XYGB 3FMBA 4ACBA 3LNNA 3CDBA 1QVGR 3HSGA 2BX6A 2M88A 4LVOP 4J9OA 2XC9A 3CF5Q 1SC1B 5CHPA 3D0HE 2EXUA 1Z1ZA 3V6JA 1EKRA 9RUBA 1WC3A 3CCMS 1Q4RA 4DR5F 1XNQF 3H5XA 2XCQA 1LEOA 3MAQA 2GO8A 2LECA 4ES3A 1WNEA 3NKYA 5CYMA 3H4DA 1VQOB 3OVAA 1WTHD 3BSNA 4O4GA 3MTKA 2VFVA 2Z30B 1W7WA 4ZN1A 3QSIA 4YY3F 1RAAB 4LOWA 2WVCA 1SL0A 1UMKA 3GSDA 3H2VE 5KFFA 1TVRA 1F3VA 3ILLA 4BCAA 4YHHJ 1YRTA 1FE0A 5B7WA 2RQKA 1RT4B 1BXNA 1G7CB 3LOUA 4HI2A 1MW7A 4TSFA 1KVKA 3WY9A 2UUAF 4ECQA 4HH0A 5B0DA 3GIMA 1NB2A 1ZZFA 3MR6A 4KSEB 3GTQA 4J9LA 3UE2A 1YX2A 1X4BA 3HI9A 4H4OA 3K8WA 3EVOA 4PWDA 1JKHA 5KG4A 2J9DE 1R5OA 2CDQA 3FJOA 3W8GA 1TWFA 1U2CA 4DG1A 4NA3A 2HFUA 2J8AA 1J5EJ 2APOA 4P73A 4FXWA 5L1KA 2V2ZA 3VGTA 1SKYB 2CA9A 3DLHA 2FQTA 5TR9A 3QRQA 3L09A 3ASPA 3KLEB 3H5YA 3EUNA 4X07A 1SH2A 2QE5A 2FZCB 2DNMA 3H8YA 1FJCA 2FHMA 2RRAA 4RNOA 4TQSA 3CJKB 1KEKA 2XZLA 4A8WA 4QWDA 1ZYRA 4DLGA 3AODA 5TY0A 1LWEA 5K14A 3ZFVA 1R31A 1RWOB 3NG8A 2JL9A 1U49A 2CQDA 4XN3A 3N9UC 4CLYA 4ZP7A 2HHXA 5C2CA 2R2RA 4FF3A 1S7HA 4WP9A 3BM7A 3D6FB 2DR5A 4K59A 3QGHA 1FFSB 1IBMF 5ADZA 3ITHA 3N4WA 4ZJQA 2UXDF 3BB5A 1RT7A 1KQ4A 3PXGa 2J6SA 3DGPA 2WVBA 5DLGA 3F44A 1U1KA 1K83C 4AF6A 2CPHA 1XMOF 3G8TA 4NZ6A 3KLIB 5IV3A 2PMWA 5EWGA 1EI6A 3AXMA 3R6JA 3TRGA 2DO4A 4PC1A 3DFEA 4KASA 3EVMA 2R8JA 4G7XA 3BY2A 3NCRA 1F2HA 4K2XA 2A68A 2JVOA 4ID5A 3JQMA 4C3LA 1BD6A 5HSPA 3PDNA 1YHQS 2VD3A 3IS9B 3B54A 3C6UA 3MI7X 3G8SA 1JJ2R 1RDRA 2FLPA 3OR1A 4ECZA 2XLIA 2L48A 2PLFA 1U8SA 1TL7B 2JJ1A 4DX7A 4ECWA 4UAJA 4S0MA 4X4TA 4EUVA 2ZWOA 3KK2A 1FNDA 3D3CJ 4LIWA 4F67A 5AJ3J 1FD8A 3B4DA 2QG9B 5K9FA 1X4EA 2C3MA 4YEAA 1KRHA 1PCAA 1NU4A 2Q6CA 1N88A 2GJFA 1R8BA 2E5LF 3VAGA 1B7YB 1AZSA 4DEZA 1T6YA 4GQNA 1UTAA 2GGPB 2NZ4A 3PUMA 5FLMK 2RC6A 3QIPB 2MEWA 3ISZA 4LMZA 1N5QA 1FE4A 1RABB 3T00A 1T9TA 4UQGA 4K4SA 3ASTA 3S17K 4IRCA 1QY7A 3MFHA 1CS4B 1SCJB 4NLSA 1EHWA 1UW9A 2E2HK 2KN4A 4M5HA 1FI4A 3GTJK 5B0BA 3VQTA 2GIRA 1IJEA 3LQEA 3CCWA 3R6GB 5RUBA 2RNEA 5DM6Q 1S9GA 1NPPA 4UZBA 2UXBF 1G7RA 4PC7A 3NMRA 1GMWD 2IDLA 4LF1A 1SM4A 4WPAA 3THPA 1K0VA 1S1WA 4XDCA 4USIA 2HHQA 1HBMA 2A6MA 1FDBA 3DLKB 4P2FA 4ZS6A 1QUVA 4M5KA 2IPOB 3TR5A 1J6XA 2YPZA 3IP0A 4OJ1A 4ECXA 2YWFA 5DQIA 3GP9A 3J81k 1W34A 4DF4A 5DETA 4F2SA 1R0AB 4GTDA 1JLEB 4OYWA 2UV8G 1FRJA 4BY7C 3L7OA 1QVFR 2H4YB 4AC9A 1UD8A 3UW1A 2QSWA 2QE7A 4BBSC 2E7VA 3M9NB 2RDJA 4KGVB 1L3VA 2ASLA 4P71A 4P74A 3HT3A 4LK0A 1UA1A 1F5BA 4K50A 1YRUA 4FBTA 1QDUB 4P6QA 1N33F 3GMGA 4MKAA 4BLGA 4Y2KA 3L4KA 1IBCB 1NDKA 3HSZA 4ALZA 2B5JB 4A46A 2WTFA 2UXCJ 2VQFJ 2Y0SL 1JQWA 4YAFA 4RBTA 1PO6A 4V19X 3KMQA 5HK4A 4NL5A 1VRQC 5K8PA 2UU9F 2VJIA 1WHXA 2MSTA 4A8QA 1TVRB 3PACA 1NH7A 4YAWA 5IYDC 1NSQA 3V2UC 4FS1A 3GIIA 1MMNA 5IP7K 2ZBIA 3D1HA 2IJFA 1XK8A 3H7HB 2DY1A 5L1JA 4C8ZA 4BY1K 1WQFA 3J81U 1HNZF 5HXBA 2R8GA 2MLYA 1OB2A 4CH1A 1NBEB 5C5JA 4XKWA 1SVDA 3LO8A 2W6IA 2QLJB 2HNYB 3AFGA 1S0UA 2CVIA 4DL3A 3I87A 2GJPA 3P45B 4Z4VA 3ZO7A 2XHWA 2CNLB 4EWTA 1XQBA 1T6XA 2CKWA 2Z2LA 4DR1J 1I18A 2UP1A 1YITS 3S7RA 3ZZUA 1RU0A 2IYGA 5J2PB 2ZM6F 4MYUA 4Y52K 1GAWA 2NR0A 3RZOC 1NSAA 5KFDA 1GXTA 1S6OA 1X9SA 4CZCA 2HMAA 4M5DA 4OYIA 2R7OA 4YOEA 3R6LB 3K59A 5H9EJ 4LBPA 4ANDA 3BH6B 4CYUA 1J2VA 1TWGA 4L3NA 3TP2A 2XEXA 4B48A 4OLPA 1M5PC 4TY9A 2VUGA 4WBFA 2XZWA 3GG1A 2IYIA 4C98A 4DMZA 5F3ZA 5KFCA 3T41A 1J5OA 2FJXA 5M2UA 2V50A 5KG7A 2HGNA 3KLVA 5FL7A 2ZH6A 1S6UA 1U0SA 3FKIC 1C0AA 2FJVA 1TK0A 4BDPA 1RKIA 3MMJA 2UUCJ 4Z2XA 5KFTA 4XONA 2RU9A 1RCXB 2JDJA 4WP3A 4YP3A 4LQYA 3CIMA 4C6AA 1SMYA 1B4SA 2A6HA 1BWVA 4CP5A 4B3XA 5LXYA 2R4FA 4P3YA 5KFLA 2DGWA 2FY8A 3DXBA 3G4AA 1JK9B 4B3SF 1ZTWA 2JDIA 2D3O1 3U1NA 4R0JA 2WSSA 1N36J 1RJJA 3CNQP 3FC9A 4ZLNA 3T5KA 4XCHA 5GMEA 2RAQA 2ZH3A 1OY9A 3G86A 1T03B 3M8PB 4ILDA 4I6AA 2FVSA 3FRZA 2U1AA 3JSRA 1TKZB 3U7JA 5F8LA 3HCXA 3GCXP 2QTZA 1YLXA 5EGHA 1YJUA 3OUYB 4W4MA 4JI1J 3I1FA 4UUWA 2MQMA 4XK8C 3CJKA 1S10A 2QA4B 1JJ2B 1DHMA 5DRKA 4XN0A 1N32F 2MDAA 2QT7A 2ACYA 4BC9A 2XTJP 1R3NA 1UZHA 1C0UA 4AQYJ 5HP1B 1U1QA 3V6DA 3I55B 2VA3A 4FXVA 3OHBA 2LXFA 4KV8B 2CW5A 4A8MP 1WDDA 4C11A 1JNRB 1X9MA 3R97A 2J0XA 3LF0A 2YPYA 5FJ8K 2ZKUA 3D6MB 4RUBA 4I6YA 2OTJB 2WPDA 1RZMA 3LPXA 4GO7X 4K0KF 4LF2A 1RYRA 3M1VB 4DS5A 5D0EA 5F4OA 1HWUA 2VG7A 4RDJA 3PRVA 3OW7A 1BE4A 3CCES 3P3DA 2FUG9 3MUMP 4KKSA 1TVCA 2IVFB 4UF4A 3KLGB 1UD5A 2B6AB 5L46A 1X5SA 1UJ5A 3RB3A 9ATCB 2VBYA 4CO3A 1I94F 2IAJB 2I38A 5CZXA 3R3TA 2Y8WA 4OPVA 1WKKA 3RR7A 2KZZA 1X4GA 3KG0A 5AE3A 3K57A 3WIUA 2KHDA 3GYXB 1M1KD 4L73A 5HAOA 2VH7A 3D0IE 2R7ZK 1CQXA 1A0OB 3SQGA 1TK8A 4O4RA 3VV2B 1LFPA 2ZZQA 4XQFA 2QTWA 4OX9F 1Q5YA 3DDNA 3H94A 3K58A 3D67A 3PO5A 2IJRA 1VQYA 3GLJA 3MPVA 2GQFA 4DPUA 1TFYA 4RL1A 2JHEA 1R7IA 3MMLB 2XSJA 3WDOA 3FZ2A 1YG0A 2E5HA 4ZMMA 4FN5A 3PYGA 1VGYA 1B23P 1WKJA 4DR3J 2G13A 1U47A 3M8QA 3HULA 3LGHA 2QC3A 3RRGA 5IM0A 5DZ7A 3PO4A 3HHLA 1ZXOA 1BX0A 2ZJPQ 2MXYA 1G1XA 4A3DK 4YHBA 3N79A 3H0GK 2ZDOA 4DV1F 1B0VA 4Y2MA 2RF2A 5IYDK 3QIDA 4PR6A 2PMZL 1ZVUA 4LJZA 2YNGB 4RW4A 1CNEA 3KUHA 1WCMK 1OYEA 3JB9k 5HQ8A 3NS6A 5B0AA 2CAJA 1IKYA 2CW0A 1UCNA 1K28D 1KRPA 1T6ZA 1GAOA 2MHNA 3NRBA 4B3MJ 2GQ2A 3WHIA 3J7YU 3RRKA 3J7ZT 1HQUA 3MZIA 2I6WA 4CTAB 1D9AA 1SKUB 3LW5C 2O01C 2XYHB 4Z4ZA 3DRPA 4ELUA 4OYOA 2YXLA 4IFVB 4A3GC 2M7SA 2XCPA 1WPCA 3MAAB 4WYLA 4NLPA 3MMAB 1U1NA 3HFVA 3W2GA 1IB0A 4FPRA 2ZVSA 1CULB 2HYIB 3G87A 4DQIA 1OIAA 4P72A 3N5FA 4OYBA 4CIOA 2CQ1A 3K2YA 5JMNA 4KGMA 1WELA 5DQGA 4C9DA 2ZUAA 4Y3CA 4L75A 4FYDA 4JYAJ 2J8SA 3JSBA 3M8QB 2AWZA 2V7UA 2WR8A 3OV7A 1TL3B 1HMVB 3ILJA 4M95A 3I9ZA 4OOXA 2P3MA 3HHLC 1EP2B 4DPYA 2XNJA 1QM9A 1UPPA 3H0GC 1HQ2A 3IWXA 2QO3A 1PGZA 2FZKB 4Q0BB 2ZZGA 1NB7A 2Q79A 3KK3A 4DNTB 1LWCB 2AEJA 4DCOB 5J2NB 4C8KA 3Q8RB 2F4VJ 3H4BA 1NM2A 2MZQA 2HW3A 2D3OR 1G7TA 1RTDA 2FZGB 1EFCA 5K20B 1Q16B 3OTOF 2W01A 4Z7YA 1WHVA 3EDRB 4J9NA 2NQPA 3KDOA 2OMLA 4NOHA 1Q81T 3J7A1 4U7UK 1LWFA 2GW8A 1U09A 2V9WA 3CP8A 3SEJA 2IJNA 5KFMA 2RU3A 1AYEA 2W7AA 4NEZA 4LRCA 4Z4RA 2E1BA 3KLGA 2ABYA 2HNZB 5IT9Y 2ROGA 4JI3F 3ZZTA 5I3PA 1NKBA 2BBEA 4OZLA 2E2JK 5BR8J 1QLNA 2NCKL 3RAMA 1VYAA 4F50A 3FGVA 4F3MA 3LP2B 4OHXA 4CNYA 4ANEA 2K3KA 2ZBPA 3SJPA 3AH6A 5D78A 1Y1WK 4C11B 2VJVA 2R7ZA 3ISND 3MM5B 1GE9A 1NLKL 2R8HA 3OLBA 3IXQA 1M90D 4FVMA 4CT9A 4L76A 2X85A 4P6YA 3JSYA 1FDDA 4L3KA 1W2BR 1IBKJ 1VHIA 2OFGX 1AROP 4AYBD 4FK8A 5KW9A 4LLGA 1DTTB 2A2DA 1I3QC 3IR7B 4PXEA 1EP4B 3R5DA 2YKPA 2AYEA 3CCSB 2YKMA 3MGJA 2OPQB 4X7CA 2BN4A 2YKNB 3GYGA 1HR0J 3IM8A 5C3EC 4MK8A 4EH1A 1FK9B 1IKVB 2X1BA 2JEFA 3PFOA 5KOWA 2BYCA 2JJ2A 2C3OA 1O26A 3W8PA 1C1BB 4TYAA 2I8EA 2XMUA 1H2TZ 1RYSA 3CJ8A 1YJRA 2GV1A 2HHWA 2XMKA 4XORA 3OVBA 3HVTA 3VF0B 2WVDA 1XERA 4ED7A 1GEHA 4C0OC 5IOTA 1JB9A 1HBNB 3ENAA 1FDRA 3N0BA 1V5VA 2FLOA 5L1IA 4KIAA 5EUHA 2GIQA 3VCDA 4ROXA 2DGVA 5GAHI 3ILOA 4RBUA 3SYZA 5BR8F 2VBXA 2GGPA 4QIFA 3DLBA 4B3RJ 4M4SA 1KBRA 3GVLA 3PW2A 4F4ZA 2VUMA 3VNUA 2R92K 3CQZC 4ACAA 1VQ6S 2ZH9A 3TFJA 3GE9A 3OE7A 1XQIA 2MJNA 1OB0A 3VHQA 1UVMA 2GSUA 4OFZA 4ILRA 2OI2A 4BC7A 2M8HA 3GFZA 2X1FA 1S1TB 3CJ5A 3M32A 4E2FB 2IA6A 1HBOB 2AHOB 2NS1B 4P75A 2GHVC 3SV4A 1RB0A 1RTZA 3J80Y 3HOXK 3SCKE 2NV4A 3W2HA 5AXKA 4I56A 3LP0B 3M7VA 2NSCA 1VQNS 3PEHA 4LSLA 1IXKA 3J7AN 1FRHA 2C2WA 4JI1F 1TTTA 4XIUA 2QFIA 4QW9A 4DR2F 4MEXA 1H0HB 4FS2A 4G1VA 2WAQD 3QATA 1S1TA 3M32B 3I56S 5GAGU 2LEPA 1VFJA 3SLDA 2OPPA 1LQ9A 3DRSB 2FQOA 2W8KA 3CCTA 2DIEA 3OT9A 5KFZA 2YNFA 5ETVA 4HE5A 2EG1A 3CC2B 1HHQA 1VJSA 2WSCC 3E01A 3BPSP 2HGLA 2ZC3A 5CD4A 2BQUA 2YWKA 2AU0A 1FX4A 4ED8A 4LQ3A 2VG6A 5ETKA 3G96A 4YB7A 3DOLB 1Q95G 4XNFA 3M8RA 4ETXA 3QO9A 4OV6A 4RU9A 5KOXA 2HRTA 1VQ8B 4M63A 4K1XA 4XSXA 1W35A 2R8IA 3D0GE 1WACA 3RAQA 3BR8A 3S2DK 2WYRA 3WQPA 1U2RA 2G0CA 4Y00A 3UDCA 5CAAA 2PI4A 3RR8A 1FESA 4ED0A 1NJIT 3JQQA 3KJFB 1N5TA 3SSRA 4KO0A 5IYNA 2H51B 4M2LA 5GMDA 4IW3B 2HSEB 1C4AA 1BGXT 3CRZA 1V3RA 3TA2A 3KWMA 3SI8A 5CYQA 1GK8A 2DPIA 3S1RK 1PJ6A 3AHPA 1AB4A 5BJRA 3TAPA 4I2PA 1F9FA 1DD5A 3BQJA 4I64A 5F8MA 3VMFA 2P9EA 3LP1A 3QLHB 1FNBA 2D3NA 1YI2B 3I4MK 3H40A 2X6WA 1FKPB 1ZBTA 2HQ3A 2NVTC 2LQBA 1ZAWA 3ISNC 2IM3A 3OZWA 3FBEA 2HVZA 5C25A 4WZEA 3S14K 1Q86T 2KTQA 1Y1WA 4LFAJ 1U1OA 5JVOA 2PE8A 4X64J 3MCMA 4AYBL 3W5YA 3Q8SB 1SL1A 3RZOK 4TMVA 4Q2LA 5J1PA 3R9LA 2G4BA 4QU6A 4GVLA 2WZPP 4I4BA 4L8JA 3RBEA 4OZ5A 1ELOA 1QSLA 3C15A 2E2IA 4Y2AA 4ES2A 4RUCA 3H98A 3GZ7A 2QRRA 4PKDB 4EBEA 2BABA 4NRUA 2MQOA 4G1QA 1S4EA 1TKTA 1ZYQA 1FF2A 1LW2B 4CI0B 4DV2J 1I6HC 2VDIA 2R7QA 3SXLA 3QAUA 1NHKL 2CWXA 2DCUB 2NZCA 2UUAJ 1DDGA 3HD1A 5KT4A 4M53A 2XG8A 3MCOA 4IO9Q 3M2RA 3ONYA 4NYZA 4IUFA 4GKJF 2HBRB 2B8QA 4R8UA 4DL5A 1HNXJ 1U2FA 4C43A 4ECVA 5IYPA 3TNVA 4JI3J 5IT4A 3MDFA 2HVDA 5HMYA 4K2JA 4ZKAA 1Y4ZB 1QSYA 1N5VA 5FLXY 5D4LA 2LQ5A 3PIOQ 3T1YJ 4LC0A 4KKUA 1U45A 4RD1A 3PNIA 1AA1B 2IBOA 1VQ7B 2YKOA 2Y0SD 1Y7PA 4USKA 3S17C 3CULA 1VBKA 1BDFA 1T9UA 2O1PA 1XMQF 4ZIVA 3HF5A 1VBYA 4J9VA 1EFWA 1DURA 4WCEQ 3R1HA 1V3SA 2EEYA 3JQKA 1IJFA 1P1TA 1KOOA 1DZ5A 3BGLA 4LSLB 2RUSA 4K4VA 1RQPA 3CCJS 2G9OA 1FCAA 2MYFA 4CQJA 2C28A 2RRNA 4AT1B 5IV4A 2KB2A 3CD0A 4NXNJ 5H5JA 3K89A 4B9TA 2Q6KA 2DGTA 1MMDA 5AXNA 2KL8A 2NXNA 4X4PA 4FF4A 1VQ6B 3KJQB 3CTAA 1ZAVA 3NNAA 2ZL7A 1RWPB 3DM2A 4E0FA 1EQ0A 4P10A 2OMOA 5KFVA 4MFBA 4BHQA 1VQPS 2EBEA 1E43A 4G65A 1L0WA 1HPZB 4OYAA 1F93A 2BVNA 1MMLA 2MTLA 3WQZA 3Q86A 4EMDA 1Q8KA 3W5VA 3ITHB 1TMJA 2GAHC 2MY7A 3TARA 3CCEB 4I2QA 3HKZD 2XMJA 2QL5B 1X4FA 5KSWB 4NLWA 1ZA2B 1LFWA 3VAKA 4HACB 2FHOB 5H1SV 2AV5A 3OKXA 4ZVOB 3CCRS 2Q66A 4NOIA 4DUYJ 3K8VA 5LMUJ 3FNNA 1RCOB 2UUBF 4LFAF 2R92C 3LVBA 2UVVA 1RTJA 4B9UA 4ENOA 5E7OB 1B7FA 4G6IA 1YJ7A 1VK3A 4B47A 5DDPC 1H2VZ 1UMJA 2GIFA 3P4UB 5D3GB 1Z4UA 1RISA 1PBAA 2C2RA 3G4CA 1OGJA 3TWZA 3ZZOA 4ZLLA 5IP9C 5G0RA 1NK4A 4RW9A 2OIHA 4U7CA 2O5DA 3T3FA 2MKJA 3BKTA 1WCMA 4A47A 4X62F 2GO9A 2ZD1A 4KBIA 1Q0NA 2V4JA 4KR0B 3VGSA 2HBZB 1OO0B 4DCJB 4LVNP 2LA4A 1S1UB 4PRFA 4TN1A 1N5SA 4J9MA 1K73D 3UVJB 4KPCA 2VJUA 2AEMA 2IIHA 4NI2B 3LA0A 1WOOA 2GVZB 3FUYA 3LP2A 4OX7A 3H3VL 3EZOA 4I6WA 1DQ8A 1U48A 3DLGB 5E6TA 2N4DA 3S1MC 3J80U 3HHEA 4N47A 3DHXA 4LRDA 1RSCA 3M6UA 3PCOB 3BREA 1VI7A 4ZN3A 1KZLA 2KFZA 1WJ9A 4RZRA 4Y34A 2I0XA 3FMWA 5KFSA 4KGXB 2CQGA 4NWBA 1NJID 1NB9A 1ZS6A 4GTFA 1BQEA 3R1LA 1QAXA 2BE2A 4X6AK 3EQLA 4QYZK 3A3BA 1WG4A 2FGCA 1TMMA 1S4MA 1JJ4A 2MKIA 3NGSA 4EO8A 3EGWB 3PKYA 4PC3A 4A3CC 3IGNA 1UWAA 3POTA 2DPJA 4CO0A 2KYXA 2D41A 2HWIA 3MEEA 2XS5A 1HNZJ 2B4OA 4JK1A 3V4IA 2VOOA 3CD7A 2K2PA 3M2UB 3EGNA 2M52A 2XWYA 1R5BA 3CJQA 2R7VA 1L3TA 1GVHA 4KH1B 3SV3A 4K0KJ 1RAGB 4U67Q 3KJVA 1NH8A 3QE2A 3CMAS 1HNVB 2V6SA 2C77A 2HFVA 4KM8A 2QMWA 4RNMA 2P8TA 5F8GA 2BW2A 3G6ES 3HKZL 5KFYA 4ID8A 1UD6A 2CQHA 4YDXA 2UUTA 1VQPB 2OPRA 2AGOA 4WZTA 2V2VA 3UNGC 1VLYA 1KWMA 5CHCB 5K8NA 3TX8A 2V2QA 4MQ9A 2XM3A 2N4CA 3KMSA 3OSNA 2CJKA 3Q6QA 3KLHB 4A8SA 2H3EB 4BY1C 2EKYA 2NXUA 2CZVC 3NXZA 4J5OA 4YN3B 1N48A 1OHHA 2W2QP 4A3GK 1Y3JA 3LUYA 1IVZA 1XZPA 2CJYB 2N82B 1MN7A 1HQEB 1WQHA 2CPYA 3SJZA 2RILA 3GG0A 4WK1A 1Y3KA 2BXJA 4Y2CA 1XWLA 1PC4A 2C5HA 2ERRA 4TY8B 3KK1B 1IBLJ 2MKHA 4OOVA 4B43A 3EGVA 4CNZA 1MABA 4CLLA 5IXUA 2IVMA 1DLOB 3G8QA 1O0PA 2HPUA 1IL2A 2HS4A 1RWKB 3SFGA 3Q8QB 1MU2A 2EG2A 2MKSA 3GR0A 4DV5F 2JFKA 5A8AA 2E5GA 3QMQA 1N6QA 3ZTSA 2WSEC 4AXJA 4QIGA 3OEPA 1U1MA 4HR2A 3T56B 3AD7C 1RWMB 2Z0GA 2E2JC 1DRZA 1XZPB 2Q6OA 3KLFA 2ZVIA 3OPKA 1IM6A 1E6VB 1KOHA 1N34F 1WIHA 4M5LA 4OI0A 3WNCA 4ELTA 2JEJA 2ZC4A 5JVGQ 4X4OA 4OI3A 2JLEA 1WF1A 1E64A 3T51B 4DQPA 5J3OA 3T5HA 5IYQA 3LAJA 4ILMA 3TQ1A 2GHWA 3HJFA 5ETTA 2VNJA 1FRNA 2A6OA 5E3RA 5ETRA 3GTMC 2GJ2A 3M4OK 2XULA 3CPWB 3BCFA 3MEGA 1C4CA 2UVWA 5A2QU 1M5OC 2NXJA 2PEHA 2YWEA 4YMEA 3HOVC 3O3LA 2FJDB 3SSQA 1T11A 3H2LA 2M8DB 3NBPA 2OO4A 3PRDA 4C0SA 1K47A 4YFNA 4O0NA 3Q8PB 5DQHA 1KVIA 2EFNA 1H3DA 1KTQA 2XCOA 1TKXB 4ECUA 4NCGB 3MPWA 5LMNJ 1RBAA 2DRAA 4G1IA 2BE2B 3CMAB 2RHQB 4A3MK 4ED4A 4DQSA 4Y65A 3O2IA 4G1PA 4RW7B 3PZPA 3RB0A 2XZPA 1J27A 4HDGA 3Q23A 1VJWA 4QYRA 1W2BB 2DNPA 2OTLB 4O3PA 3R5BA 3CC2S 1KHWA 2HHHF 3CC7B 3F56A 1BLIA 2JZ5A 5KFAA 1IW7A 3QNWB 2E5LJ 5LT5A 3GEIA 2R7RA 2E2HC 4ZP9A 2D74A 2VG5B 4LRFA 4W90B 5HBMB 2B9XA 3W2EA 4M5JA 4B3SJ 5EDWA 1RQRA 4UOGA 1CSJA 1SQGA 3IBFB 1FKPA 5M5YK 3S6EA 2QN6A 2CVEA 4RW9B 4C0BA 2J0QD 3LGMA 2UVRA 5IT9U 2KWAA 2VV5A 3BN4A 5B0FA 1P8GA 1TV6B 2FQQB 5C2GA 1D1UA 4KN4A 3GB0A 2WJYA 5KG1A 2V94A 1LXNA 3EJMA 5EWEA 1PSDA 4X2BA 1RUSA 3WODA 2HHVA 2OK8A 4DDFA 1H73A 2CZ4A 3I0SA 3CD5A 3PVDA 4IR1A 1XC9A 1BWEA 1B2RA 2ALYB 4B3GA 1TKZA 2DNNA 2KHCA 4KHRA 2ZHBA 1WCMC 1G7SA 4RW8A 1K1QA 3CSKA 4YXWA 4PCQA 1NJZA 4Y6IA 3PG9A 1OY8A 2ZZTA 4ICLA 1S7IA 2AYGA 2RC5A 4R5PB 2GAGC 2CPJA 3I4NK 1VQ7S 2BE5A 2JNJA 3OPOA 2Y1LB 2Y1RI 4B3MF 5A8RB 1SV5A 2V34A 2BRLA 2E66A 3HSDA 2Y0BB 4IO1A 4WZQA 4A3CK 4KHPJ 4P2NA 4CLPA 3W1YC 2ZKTA 4EGLA 3UDLA 4IG0A 2PE3A 2BV3A 5SZTA 4XSZA 3ZZYA 1JVIA 4DQQA 4G5GA 2V7VA 1YIJS 4WWSA 1R6YA 2YH0A 4FKXA 3CCUB 1H6KX 3Q2TC 1S9FA 2DH9A 1Q82D 2DH7A 2K1RA 1MRZA 2VA2A 2AZ1A 1RT3B 4EU0A 2CNDA 5E3QA 4QHYA 5HI7A 2FD2A 5A0YB 2V6TA 4KMUA 4Y7CA 3TVZA 3UR0A 4OPSA 3MM8A 1M5HA 4NX9A 1TWGK 3PV8A 2F63A 4HHUA 4A8YA 4QCLA 4K8RA 1QTMA 3AAWB 3FHZA 1QD1A 4KAIA 2RDDA 2ZH8A 5L8RC 1K0TA 5A8WB 2CXEA 4DHVA 1I50C 1DARA 3CESA 2XZOA 3DLJA 4DUYF 2VKRA 1FKOB 4FPIA 3U6BA 1PG5B 7FDRA 3THTA 4IYQA 4MIAA 2MLZA 1D9FA 3GVKA 4DL2A 3GFXA 5FD1A 2DGUA 3LAMA 3UN5A 1YITB 2CQBA 4GVBB 5B0GA 2V63A 4ZCIA 3V76A 3I0SB 4IOBA 2I9SA 1FJGF 3KG1A 2F9DA 1JLFB 1OSCA 2CPZA 3KLIA 4LSZB 1FRIA 2ZFHA 1JWWA 2HVHA 2OTLS 4LRBA 3N01A 3A8EA 3R2DJ 1W26A 1NRKA 2DCLA 1S0NA 3GTOC 4DSJA 3L7UA 4UOHA 2AEFA 1ICEB 3AXKA 1GTHA 4BBRK 3OEEA 1VDHA 1UFLA 3R7NB 1LK5A 1O2FB 3NNCA 3UD3P 2OSQA 1HA3A 2Z2YB 4ICLB 1V3ZA 1F5CA 2DEUA 2AT1B 3QSYA 2D74B 1C1BA 4H9GA 4DFPA 4YY3J 2PMHA 2F8HA 2KRBA 2V8VA 1VQNB 5F8NA 1U0HA 1DQ9A 3CWJA 2LQ8A 3KYLA 2VIHA 2XWXA 5IK2A 2B56A 4NASA 4HTIA 1YWXA 2RH3A 1EP4A 2D3ZA 1FO1A 1SQEA 2PDAA 2YNIB 4A3IC 4A4JA 2W6JA 2V2KA 4LT6A 4BLBA 1TWCK 3T9NA 4AL7A 2HHSA 2MPUA 1FXRA 2CIMA 2I1RA 1VQ4S 4LF9J 4L74A 1SIZA 4B3TF 3LALA 1NZ8A 4HI1A 3PR5B 2HRUA 4AD6A 1U6BA 5HBMA 2PMDA 5DG9A 5LJ3Y 2E1CA 4RO0A 3A8KA 3DI6B 5L39A 4C3JK 1HI9A 1NBMA 2W8LA 3TEGA 1X0FA 3CMEB 3N0CA 2AIRB 3TTGA 2YU9K 1X4CA 1W9XA 2MKYA 4PXBA 2B63A 5KTQA 1QE1B 3DLLQ 1XBWA 1HR0F 2WONB 4DFMA 4CM2A 3N6MA 1TWCA 1HBMB 4ZVQB 2MZTA 3E3XA 2IRYA 3FZBA 5F8IA 1IE0A 5CDFA 2HNZA 3FKBA 4JV1A 4RNHA 3OP1A 1OQ6A 3Q2SC 2NXEA 2HFNA 2HMIB 1PC5A 1FJEB 4RPDA 1RACB 3NMAA 1J6VA 1GT8A 3CXCR 5J2MA 2KFYA 3U6KA 1FNCA 2ZITA 4BWJA 1Q79A 4DZ6A 3FPPA 3DHWC 1CJKB 2LXIA 4YB5A 1D0EA 1LWXA 1UEVA 3VA7A 1IKWB 3GTKC 1CJUB 3C6TB 2VG6B 2V4QA 4ERDA 4UT4A 4LBYA 4ES1A 4PQUB 3VNVA 3E1YE 3CMES 1I6JA 3V6KA 3DRRB 4HVZA 3MHPA 4BKWA 3NL0A 1I50A 4A3EK 5D77A 3IBWA 3CJ2A 3ZC4A 2X51A 2J6UA 4FXUA 4DR5J 1XNQJ 4A3FK 5HANA 1PKUA 4P52A 3FPKA 4DUTA 2ZZFA 2JOQA 3C19A 3D4JA 1ZH5A 3ES9A 2QSFA 1R89A 2XY7A 3VAJA 3GEHA 5IP7C 5EWFA 2MKKA 3DGVA 3Q0AA 4LF4F 2W9CB 3MMCA 1L3SA 4F4AA 3LPEA 2ZH4A 3HOYC 1QH0A 3MAHA 2ZL5A 4ZLPA 2F43A 5A0YA 4YR2A 3BSAA 5KFPA 3C2PA 2ZXIA 1AT1B 4C3MA 4M5IA 1F60A 3QFCA 4KJIA 4LBHA 4BY7K 1HZEA 4DV0F 4WQMA 1WTFA 1MLAA 3CQZK 2EK6A 1RAFB 1RHRB 3IN5A 1RTHB 5ETMA 1N07A 4RLZA 3NE5B 3MEDA 3BC9A 4U8YA 4PXCA 2VZLA 2WVFA 1VQKB 3OW2B 1XN9A 5D8HB 5JUMA 4RPBA 3GSIA 2XS2A 2BOAA 3GCWP 2E2HA 4DF8A 3UD4P 2FX3A 2LMIA 3DCAA 2GSOA 4NLRA 2NVYK 2KXFA 4QFMA 3BGRA 3CJ0A 4WFYA 2H5EA 3SSSA 2FHJD 1H7WA 1S6PA 2X0KA 3IO1A 1FNXH 4KTQA 4PG5A 4CLUA 1FRLA 3E51A 2SXLA 3LANA 4O2DA 1LWEB 2DR9A 1IKVA 1I3QA 4UOFA 4I1TA 3I31A 1R5NA 3IPJA 3P8BB 4LF5F 4MTPA 2PPBA 2CUYA 1NPKA 3QGGA 1I6HK 1UV7A 1VQ8S 1JLBB 1KN6A 3ET6A 1DCOA 1HI8A 2XSJB 5HMWA 1WDTA 2BE9B 2MQNA 3T01A 1AIPA 3HZEA 4DL7A 4RW6A 4LF8F 3ZTRA 3OTOJ 4LBWA 4DPOA 3MOJB 1RWXB 4NYOA 3UN2A 4JI2J 1VQLS 4FWTA 2OKQA 2W2NP 3S2DC 2P8IA 5FIIA 1REGX 1KFDA 2QLBB 3DXJA 5J1EB 2QLFB 3BY1A 4XLEA 2ZEJA 3HOVK 2QZ8A 3GTOK 1IWGA 2VC0A 4PXDA 3TAMA 3VAFA 3JQPA 5DDOC 2VFRA 2ADBA 2DGSA 4DI6A 4RW7A 1QGZA 5CA5A 1QUEA 3N28A 3OOCA 4Y9UA 2HNDB 1RA7A 4O3OA 2NLWA 2GHPA 1N52B 1UFKA 2ZH7A 3ONQA 2QJ3A 3RB6A 6FD1A 4J7CA 3IAM9 2LDIA 2VG7B 2VYQA 5F41A 2RH6A 1J98A 1H42A 3CVKA 2IM2A 3MR7A 5F9LA 2AYBA 2W24A 2ATLA 4LBZA 3V6HA 4A93C 4C0HA 1X9WA 2JA7C 2FLLA 1H8HA 1JA0A 1RTDB 3QFHA 4OX6A 4DX5A 2HHPA 3PFEA 4N3NA 2QDXA 4OIPA 4EI2A 1S6PB 2IRXA 2C22A 3A4TA 2BANB 2ZBVA 1UAWA 4RLEA 3BZQA 1QVFB 4C3IK 4ETZA 4B3FX 3V6DB 4J3NA 2AKWB 4DFKA 3CD6B 4DV4J 1AMOA 1YJWS 2Q6IA 5HZBA 2H9ZA 4CWBA 3W65A 2FC8A 3SMZA 2AJ0A 1Y5IB 4DNRB 4YFUA 4OP7A 4II2A 2V69A 4KHMA 2X53S 1C1CB 3V5RA 1TFWA 3FKIA 2X1GA 3QGPA 1TQLA 5D0RA 4BS2A 1OQ3A 1QGYA 5I3UB 4FNIA 3MMBA 2KVOA 3N6LA 3ASQA 3CC4S 4ECRA 1N8RD 1RTIA 3NOGA 4LSNA 5FLXU 4GO5X 2HK2A 3DYAB 1UWBA 3S01A 2JA6C 5CCMA 2MKCA 1CLFA 3I9V9 2ZNYA 3BBBA 2VPYB 3DYAA 4OHYA 3CGIA 4IFVA 1SKWA 2DNZA 1FRKA 5K8OA 4ZJLA 2W9CA 1WUUA 1VHOA 5CD4H 1V0EA 1HHTP 1N6QB 1N32J 4JP8A 2J76E 2CZ9A 1GQEA 4TMXA 1C1CA 4UTGA 1N08A 4CCHA 2XZDB 4XPCA 5A89A 3UO0A 3CCLB 4CLKA 3SLNA 3SCLE 3M8YA 3BPDA 4XLAA 3T6BA 4P6VF 1YJWB 3G71S 2W7OA 2BMWA 4MJKA 3GTGA 1J5OB 3AOCA 3FEXB 4XLFA 3G2XA 4OIOA 4TLRA 1DCHA 3A1YG 4Q7JB 4KY3A 4MYTA 5KG5A 1CBKA 4A3MC 1BMFA 3C6TA 2AF6A 2ZZEA 3AJ2A 4DQRA 4C8NA 3TJAA 4GTCA 1PAEX 2B7BB 2AP6A 1LV5A 3QZ7A 4NNJA 4PPZA 5KFOA 4O3NA 1SFOC 1D8ZA 4X7DA 5IM0B 3V7AA 4F0MA 2FDNA 5E0OA 2C1EB 1YIJB 2LEBA 5JFEA 2A1BA 5I4MA 3WC0A 3AQOA 1EP1B 2HMIA 3PW5A 3HOUK 2GJIA 4I68A 4RX6A 4N56A 3GTQK 4MKBA 4GKKJ 4A3JC 3W63A 2OAUA 1DTQA 4WIQA 4Y9RA 1WHWA 4F0KA 3DKDA 5IC6B 2C3PA 2ASDA 1UL3A 1V5IB 4XLHA 4N76A 4ZP8A 3MEEB 1FD2A 3HX9A 4X8IA 1F2GA 1B4BA 3F73A 4ZPWR 1RKJA 1CVJA 3DN9A 3OFHA 4OZJA 3W62A 1U6ZA 2CFAB 2ATCB 2DCUA 3PYEA 3GPAA 1TL1A 2QA4S 4WKRA 3I0RA 3U02A 3TFIA 1WOPA 1DQAA 4RW6B 2VNIA 2HNDA 3M05A 1TWFC 3U1LA 1TWAC 2HVEA 2ROPA 1S6QA 1XMBA 4RKUC 2QYGA 2XB2D 4USHA 1F3FA 2HQFA 3VGVA 1VR6A 1EH1A 2B5JA 2XGQA 3DOKA 1ACMB 3T5LA 2UXBJ 2MZRA 1R9TK 5J1EA 3DLEB 1E63A 1FRQA 5A6WA 2P2CB 3DXSX 1KD1T 1U4BA 1TKDA 1B3TA 1UW4A 4OZNA 4U8VA 4OPOA 4KM9A 5AT1B 1RLCL 1EIYB 1S1UA 3GTYX 5LJ5Y 2J7KA 4HEA9 4EO6A 3AOBA 4ZITA 2IY5B 3RTVA 5KFNA 4KFBB 4PAAA 2RIJA 5G0RB 4ECSA 5HP1A 3IMQJ 3LP1B 1R27B 5C42B 1JLBA 1O51A 3S1RC 1I51B 3EPGA 1MWQA 3S14C 4Z4WA 2OHDA 5DN6A 1HI1A 1G6BA 5CQGA 1YLOA 4KH0B 4XLPA 2JA5A 1FRMA 2XBPA 3EGZA 1S1WB 2PA8L 1M1HA 1XPPA 1RHQB 4A8KA 4OI1A 3JSTA 5CYQB 4PG4A 3CDAA 3H0GA 4DZDA 3I4MC 1HIYA 4C3JC 2HFSA 4M5MA 2AX0A 2E9ZA 4HACA 2JLFA 1NXIA 2VASA 3W3SA 4TMTA 5GADI 2V8HA 1WG5A 1DY3A 5E3AA 3C14B 2B7CB 2DNHA 4X4QA 2DNGA 1Q8BA 3B8HA 5HLFA 2V8DA 5CYJA 4HKQA 2QLXA 1BPLA 3FCWA 3CPWR 1Q1KA 1HW9A 3MM8B 2RE1A 2B9YA 3MR5A 2DISA 4TN2A 4ECTA 2E1MC 1YNNA 1E6YB 4DV4F 1HNIA 1S77D 2OYNA 4DV3F 3C66A 4RD3A 5TMCA 4ILLA 2KXNB 1GX6A 5D4PA 5AE1A 2COLA 2E1RA 3W5UA 2MZ1A 1T95A 2IDEA 1YRXA 2OBSA 4K4TA 1F7UA 1WP6A 3S16C 1NK5A 3CCUS 2CG8A 2UXDJ 1T94A 4CT8A 3BO3A 3LPYA 3FSIA 1TL7A 4F04B 4KATA 1IKWA 2PIAA 2XI3A 5IYBC 2C2MB 3OR1B 4WKYA 4ZDNA 5HLFB 1JOEA 4Q8EA 1IJFB 1FKAF 4NLDA 3VGUA 1F5AA 1TP7A 4KDDA 1GR1A 5A8KA 3D3BJ 4K4XA 4C2MA 3IS9A 2R92A 1U8WA 3R5AA 1SV5B 1WKLA 1O27A 3GTLA 4U96A 1VRUA 1WC0A 2WOMB 2VONA 2N7CA 1CJVA 1WEYA 4OJGA 2JA6K 4USWA 3VVUA 5J2MB 4I7FA 5GAEI 3QFWA 3K5OA 3MUTP 4LF6F 1P6TA 4QWAA 1RK8A 4MIBA 5BYRA 4QOTA 3OZVA 1FK9A 3PX4A 2EFGA 1HNWJ 3Q6RA 1JXVA 1IR0A 4LRAA 3PJ9A 4J9SA 2OPQA 4YEJA 1CJUA 3E2EA 5LSOA 4H4KA 4NPOA 2HBYB 1NKEA 1EFRA 4KYZA 1PYTA 1OWXA 5C42A 3G6VA 3DU6A 4WTOB 2JA6A 4Q2MA 4Q7AA 3FDSA 2K8GA 3H2UB 1UA0A 2QN6B 3ZTQA 4A3IK 3DI6A 2CWKA 2DOGA 2YBVA 5L9XA 3C8YA 2JSXA 2M0GB 1G51A 5C4JC 1R0CB 2KM8C 1I6VA 5KFIA 2WSFC 1INNA 1UFWA 3NGKA 2R93C 1F0XA 4LR7A 3JSMB 4DPWA 4P7TA 5E3CA 4L6V3 1LNQA 2BJ3A 1S5ZA 2O5JA 4AXIA 1Q81D 3TAQA 1TU0B 1UJ6A 4KC6A 4DL4A 1W87A 3CP2A 4PEOA 3OJXA 3M30A 5KG3A 4WU2A 2GREA 3MD3A 1S6QB 4EYHB 4F4XA 5C3EK 3EXYA 2HK3A 3GTPA 2LXUA 1NDLA 2JWNA 5KG2A 4GTBA 4DCPB 4FF2A 1TL1B 5F8HA 4ELVA 5C24A 5FO0A 2D1CA 1G4CA 4DS4A 2CFAA 1S59A 4NCBA 1JMTA 1XR5A 2AQ4A 3EE3A 2OK7A 2R7UA 3KOAA 1XZQA 1AUSL 5J1NA 4DL0C 1I50K 3CCJB 4QVJA 4KARA 3IR5B 2HS3A 1N05A 2GK6A 1FDNA 3VR1A 1RT4A 1G3OA 4RNNA 3HLUA 1I94J 2XNRA 1F1BB 4DR2J 2V4RA 5DZ6A 2F3JA 1KQFB 4DUZJ 3GVJA 3MEGB 2E1PA 4A8OA 3AVTA 3GJTB 3CCLS 3L4BC 2V31A 1RU2A 5TMFA 1FWLA 1B4AA 4KKTA 3CPXA 1EARA 2HHUA 4ZLJA 2BUNA 4Z7CA 3OEHA 1R9TC 1JNYA 2LCWA 4CLFA 2W4DA 3GTPC 1N0UA 3QT5A 1E6VA 2RS8A 2CDRB 4WP8A 3RBXA 2LA6A 3GV8B 3T19A 2QLWA 3HFZB 3KNGA 3DOMA 4X62J 5T7LA 4JV5J 2VPXB 4G0VA 2ASYA 1TL3A 5HVGA 1UD3A 2ZBRA 2ZHAA 4CTAA 1HNIB 3FKSA 1X5TA 2QMUA 4ZPCA 4DSLA 4UW2A 3KL9A 4XM3A 1T02A 4IRDA 2ZBCA 3PYFA 1S0VA 1RAHB 5F0UA 2RHSB 1WI8A 2QEXS 1FJ7A 1XIQA 3FCHA 1E79A 1B99A 3R2CJ 5BXIA 4C2MK 3B82A 3Q8UA 3HAGA 2MZJA 3UN3A 1FEEA 4DU8A 5GMKa 2PMZD 4JI4F 5HQLA 3GFHA 2M9KA 3PX6A 4CM0A 5HMXA 5MLCV 5THXA 1C2PA 5DDRC 4USUA 1T9VA 2E44A 3BNWA 2JA5C 2CF4A 1KVJA 1EP3B 1IBAA 1Q53A 2F7VA 2V67A 2QV6A 1YI2S 3GILA 2HHTA 1KQSR 1R9TA 4K4WA 3KJVB 2VICA 3PO3C 3UCZP 2OD4A 3NGRA 2UXCF 3M3YK 5A8RA 3GTLC 3BO4A 3X3UA 1I1GA 4ED1A 2LVWA 3HVTB 3B6BA 3BYPA 1OPZA 5HROA 3WC2A 1SL2A 4RW8B 1D09B 2DNQA 3EDQB 2GQCA 3CO0P 2L41A 3ZZ0A 2LYVA 2HVIA 2UV8A 3R6KA 4TQRA 2ZH5A 3HOZC 2PSZA 1JX4A 4UOCA 4B3OB 3U2QA 3K0JA 3EXCX 3ELHA 2X6YA 2DKOB 3DLEA 1E1QA 1NSKL 2YNHB 2EBBA 3L7PA 4W98A 4Z4TA 1EX8A 2V6UA 4A3BK 3QJLA 3T6JA 2QA4G 1SKSA 1RHMB 2EBGA 4JBCA 3OLAA 4EYIB 2XMVA 4L72B 4JI0F 4X65F 4K4ZA 2NYHA 2W2MP 4NBSA 3HFKA 3EX7B 1J9ZA 1NK0A 3S0XA 2YU9C 3ZIAA 1KQSB 1X5PA 4E0DA 1R8PA 3VZIA 4NYPA 4R25A 1KLNA 4OZ1A 3SQGB 5LSRA 2F4FA 3HOUC 3UVJA 3UI3A 5E68A 5J2QA 2DHGA 3MM7A 2FGOA 2PA8D 4B9VA 4NLQA 2Q6LA 3NWGA 4WFAQ 2VOPA 2V4JB 3K7AK 4IH5A 3FRYA 2CJ9A 1N56A 4G3IA 5KT3A 2P9CA 4LBIA 4LIRA 2LQ9A 4QW8A 4K7QA 3RZDK 4F7DA 1RT1B 3MPYA 5IYWA 1LWFB 1WQGA 4NCGA 2R93K 4UZCA 2W9BA 2FVQA 3IA0A 1SC4B 2WBRA 5LXRA 2OJ3A 5F9NA 4ZPDA 3PEJA 2F8EX 1RXOB 2OPSB 4YQWA 5IORA 1JB0C 4LJMA 4D3GA 4CO2A 3FQLA 1QG0A 3VZHA 1WWHA 2EIXA 2QA1A 5IYRA 4TKTA 1TLLA 1N54B 4I2QB 3GONA 2Y9HA 2CNNB 3TVYA 3TZXA 1A6LA 4LK1A 1HARA 3HHDA 2O3DA 3H0PA 4XO0A 3SFUA 1VQMB 4G7OA 2R2SA 3H42A 2ZOGA 1HMVA 4K4UA 1T5EA 3NCQA 2GC8A 3TUIC 4GFQA 4N8NA 1S0OA 2DITA 4MH8A 4DR6J 1U25A 1VK8A 4LFCF 1PYSB 3VO2A 3SQOP 3NLCA 4USJC 3ENQA 4LF5J 4JI7J 3KKFA 4RM0A 2OEKA 4HTJA 1HQEA 4G7ZA 4A3KK 1HW8A 1Q8LA 3LQ6A 1D2EA 1K44A 2AJ2A 1I7PA 2V8GA 1JIHA 1P9QC 2IA0A 1K8AT 1U1LA 2PFFB 4NLTA 5B08A 4YFXA 4FDFA 2FPHX 1IR1A 2ALZA 4RD6A 4AQYF 5KFXA 4Q5VA 1N34J 3JTPA 3I4NC 1V0FA 4IDKB 2Z4PA 3GWCA 2GK7A 3HD2A 2CPXA 1FEHA 5IQQA 1VQSA 2CRVA 3JU4A 2HQIA 2QMUB 2DNRA 3GYNA 4KE5A 5E5NA 2LEAA 3KXDA 3RJMB 2V9KA 3EYZA 1SFOK 3CXCB 4CLSA 3CDWA 3VTIA 1JLQA 1UVJA 2ZTGA 2EKNA 4BLAA 4RW4B 2OLWA 3ZZZA 2HLUA 3BKUA 2R2UA 1N0VC 1Q9SA 2JJ4D 3CJ4A 3EWGA 4IRKA 2Q43A 3S1QC 2BE7D 2OBTA 3OTCA 3PRBA 3KLHA 3QT8A 1QJHA 4JV0A 3J7Z5 3GTPK 3CC4B 1Y1VC 3OJUA 2JA7A 1R43A 3G71B 3W9IA 1S57A 1PJ7A 5HZAA 4X7FA 4M5DB 1ZM3A 1YCLA 1TWHK 2DYAA 4NLXA 4NEYA 1RWVB 3FVYA 4C2MC 1VH2A 1AW0A 1F7VA 5LMNF 2XS7A 4X05A 1NMEB 1M1KT 3HOYK 1VC5A 3BGOP 1KC8D 3R7SB 1PBUA 2CQIA 3PJWA 4MKYA 4FYWB 3TAMB 1ZTTA 1T8EA 3PTWA 2ZDPA 2VBWA 2NVXK 2C4TA 3DLGA 2YKAA 3PENA 1O24A 4RMFA 1TWHA 4KKOA 4WF9Q 3ONUA 4AFFA 2DK2A 3A3PB 3AB4B 3GJRB 4G0UA 2NXCA 2MLXA 2FIUA 3WX8A 3AQPA 4LF6J 4DK0A 5A2QY 3A8IA 2P6TA 3LO3A 3M6WA 2M70A 1RAEB 3NY0A 4WZKA 2MGZA 4QUZA 4O3SA 4OOSA 2J7WA 2BM1A 3TUPA 1S97A 4JI8F 4NZ0A 4QR2A 5D3GA 3BBFA 2NVXA 1TUWA 2AD9A 5B6IA 1CC7A 3A3OB 4F7VA 1ZQ1C 3S1TA 4CH0S 4OZ0A 2HFOA 2ACMA 1RTJB 3OVSA 4KC5A 3GTLK 2PGCA 1JLCB 4ED6A 4YAOA 1VRTA 4ZP6A 1KK0A 2QGFB 1NNDA 2OTJS 3HJVA 4KO0B 1O29A 2D69A 3AGQA 5HVHA 1D8TA 4A3BC 1RT2B 1SUQA 1TWCC 2H54B 4F3OA 3BSOA 2B63K 2VHGA 3Q38A 2ZJQQ 2CPEA 1R0AA 5HATA 4WYWA 2BVZA 3T02A 3D1OA 1KS2A 2QA2A 4R71A 4X84A 1HPZA 3V4MA 1IM4A 3HVRA 1X4AA 4DOZA 4J0QA 1ZM9A 1YVFA 1N8RT 2CQ3A 2KU7A 3NAIA 4K4YA 3S2HC 3DM2B 4IQMA 4C8OA 2QL7B 5ETSA 1SKQA 3DU5A 3P96A 4NLOA 5FA6A 2KT2A 4WZMA 3ILIA 1IWAA 2BSAA 4DFJA 4OI2A 2A6EA 2NREA 3C16B 4P2SA 1M90T 2FVCA 1OY6A 1SC6A 3M8SA 3JAMU 4ZH4A 2IMWP 2HQDA 2DO0A 1T9WA 3O6QA 2VQEJ 3CCSS 1TTHB 3MCSA 4XTTA 5DGBA 2KRRA 4DPTA 1UVKA 4F0HA 4DV7F 3G4SS 2O67A 5A8KB 4HIZA 2LZJA 4WWVA 1XR7A 3M4XA 3IR6B 3G4SB 3MM9B 3TANA 2ASJA 4ZVTB 2C2NA 4CDIA 2XMMA 5FO1A 1VIXA 1UEUA 3TUZC 5TV2A 3MPDA 1MSWD 2KJVA 5JBQA 4B9SA 4JYAF 1BS2A 1OS5A 5GVQA 1HWLA 3Q89A 3PHEA 3GTKK 1DG1G 2B8PA 2GSNA 4GKJJ 3DOMB 2CJXB 3KTQA 4JUZA 1KQGB 3TUJC 5FLMC 2FB0A 1JLAB 1YBUA 4WE1A 2Z2ZA 3HO1A 3RAXA 1CEZA 3ZNJ1 4P2MA 4R8UB 1L5UA 5M5XK 2FY1A 3PM9A 1RHKB 4IG0B 2JA8C 3WZ0A 3DRXA 5LSLA 4XLCA 1VISA 3FOFA 5F4JA 3QAEA 2B7CA 2R7TA 3TVKA 3MPUB 4F4WA 1X8DA 2AGQA 5K5MA 3VO1A 1ZM4A 1H85A 2H5IB 4YS2A 2EWHA 4NMLA 3UNYA 5LOQA 2GNKA 2KKHA 2OELA 1X4HA 4RCYA 1ZPWX 4DJBA 4FYXB 5CXTA 2MSSA 2XO7A 4DR7J 2BRKA 4YAUA 3M6XA 3QWUA 4XLNA 3CEDA 2FHKA 4GRSA 4QWEA 3NNHA 1R6VA 1UEKA 3F41A 4I67A 3OZUA 4NLYA 5AXMA 3CC7S 4OLOA 4PGOA 2B9EA 3C15B 2EC0A 5CJ9A 1MWZA 1NDPA 4JI6F 2WONA 4QU7A 1IHMA 3C3LA 4B9LA 5U47A 3X1LB 2OP5A 1T0TV 3VVTA 5E2QA 1M1GA 1NK7A 4QR1A 4MK9A 1HNXF 2DXFA 5KNLA 1XMOJ 3PY8A 3OSPA 3ZNUA 3D7SB 3UWTA 2LLZA 1O8BA 4IH6A 3CJ3A 1EFUA 3NGTA 1CNFA 3A12A 4USTA 3PA2A 4KHPF 2V5HG 1SUQB 3PX0A 1RE1B 4KAWX 5D0GA 3GTGK 1EFTA 4ZV4A 3MTJA 1YJNS 2F40A 4MIWA 1XNRJ 4B17A 3RW7A 3QBCA 4DG1B 5D4NA 2NUHA 1QAIA 5K14B 1QX4A 3OTBA 4G1QB 1Q82T 1PILA 1RT6B 5FJ4A 4MK7A 2KJWA 2X1AA 2A10A 4K5RA 4MMOA 1YJ9B 4F26A 1ZUNB 2OD6A 3TW0A 2VDHA 2Q6BA 3D28A 1JLGB 4RCZA 1RT6A 1YK9A 2R9LA 1D9DA 1RGVA 4H54A 1YKWA 4YFKA 4JI6J 3AGPA 3MCNA 3KUGA 1C0TA 5D0HA 3BH7B 3TZZA 5MAOA 4O3RA 2DGXA 2DEIA 3OD2A 2NVYA 2CK3A 5A88A 5DLFA 3GTOA 1VHEA 4ZJOA 4ZPAA 4CO4A 3IGVA 2XMAA 3NGDA 1WI6A 2DETA 1VHFA 3KK3B 4NXMJ 2IVYA 1S0MA 1JLFA 5IC4B 2B5OA 4JI8J 4LF7J 4QIVA 2XLKA 2A2CA 4RDKA 4YG2A 4DN0A 4I7FB 3GTGC 2ZUGA 2M4MA 2RMLA 4AUKA 1CJTA 1U24A 2RSQA 3IM9A 3S8SA 3FBBA 1WEXA 4H4MB 4FBUA 3W7BA 2YU9A 1GMUA 3A3GA 3KHRA 3EM1A 1Q8IA 2R6HA 3L95X 2UUCF 2V0NA 4ED3A 1S72B 4OZ2A 1BQNB 5CYMB 4UZEA 1SBRA 3WIVA 2HAIA 3W5HA 3RBZA 4KT0C 4GT9A 5IYCC 1AZSB 2EFPA 1YGYA 2JA7K 3U1MA 3S16K 1HBUB 4RUHA 2POKA 3GFYA 3E01B 3SKBA 1IS1A 4ZVSB 5DS7A 3TO8A 3AH5A 4WZLA 2RQCA 4DPXA 3MR3A 2N3OA 1PIEA 4LF7F 2OPPB 2XCRB 2MQQA 2JVRA 3GV5B 2F1FA 3UPFA 2F4NA 2DTJA 1JJCB 4NMXA 4LFBJ 2IMOA 3TEHB 1URNA 3ADAC 5EGYA 2Z57B 4ZVPB 4DWIA 2VUMC 2D9RA 3K5PA 5E41A 4FNHA 2MZSA 3HOZK 5JJBA 2VNHA 2C2KB 3THVA 1NEEA 4V1Ak 3G6YA 2M5SA 2HIYA 2OEMA 1NJWA 3TQEA 3TJ9A 1FVQA 2RF2B 1FT8A 1T7PA 4ZVUB 4BWMA 3AVVA 2CQ2A 4UUXA 1UWBB 2VFUA 2JN9A 1K73T 4YELA 1RTIB 3GR1A 4ITSA
chains in the Genus database with same CATH topology
1VLYA 3GEHA 1WSRA 1XZPA 3TFIA 1WOPA 1X31C 1WOSA 1WSVA 3GSIA 1WORA 3TFHA 1PJ7A 3TTGA 1PJ6A 1NRKA 1WOOA 1V5VA 1YX2A 4PABA 1XZQA 3ADAC 1VRQC 3A8KA 5L46A 3GEEA 3TFJA 1XZQB 3AD8C 3AD7C 1PJ5A