1WSVA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
371
structure length
371
Chain Sequence
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 117
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsvA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsvA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsvA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsvA03
3TFIA 1YX2A 1WSRA 3A8IA 3AD9C 1PJ7A 3GSIA 3ADAC 1V5VA 1PJ6A 1VLYA 2GAGC 3TTGA 4P9SA 4PAAA 3GIRA 1VRQC 1XZPB 1XZQB 2GAHC 3TFHA 1WORA 1XZPA 1XZQA 1WOSA 3GEIA 3GEHA 1WOPA 3AD7C 1VLOA 1WOOA 3AD8C 3A8JA 5L46A 1WSVA 4PABA 1NRKA 3A8KA 3TFJA 3GEEA 1PJ5A 1X31C
chains in the Genus database with same CATH superfamily
1Z1ZA 4C2MK 1SL2A 4JI1F 4OYBA 1DTTB 4KB4A 4A3GC 2J7KA 1TL4A 5IP9C 1XXBA 4XLNA 3PX0A 4RM0A 1GXLA 3P45B 2G0IA 4FF1A 4QWDA 4KMUA 3T1YF 1W2BR 2JEIA 3DDYA 3T1AA 3H0GK 1WPCA 3KLEB 2E9TA 2DXFA 4LRBA 4KC5A 4LRFA 4J90A 3FBEA 1BMFA 1LW0A 2C4TA 5BYSA 3MHPA 3LP1B 3E20A 3FKIK 4A3IC 4CLLA 1KLMA 2R92C 3T02A 4FF3A 1F0XA 5BR8F 1D8ZA 5KFMA 4G5GA 4Q7AA 4FWTA 5B0DA 2RH6A 2J7UA 3EDRB 3HOXC 2ZDPA 3VAHA 3Q3AA 4IRKA 2W6JA 2GA7A 5IYCK 3KMSA 3AQOA 3FKSA 4YN3B 4WYWA 1VQ9B 2N3LA 2A2DA 4OOXA 2HG4A 3KKFA 4A3KC 5F8LA 2DNZA 3M8QB 4RD3A 4DR6F 1V0FA 4ZH4A 1O2FB 1YQHA 2DHGA 2D6FC 2X1BA 4LF8F 3DXBA 2A0FB 4Y7CA 1R89A 3B82A 4KPYA 3NWRA 4P74A 5EHHA 5HZAA 3D0IE 2DCUB 4DQKA 3KWMA 2WPDA 2ZFZA 1UWAA 4NPOA 1Q8KA 1PYTA 3GTPC 4B02A 1F3VA 1VC0A 1J2VA 5LMZA 2VG6B 3HXAA 2YKPA 3BEGB 4IUFA 1DZ5A 4DZ6A 1U1QA 3OTOF 4J9NA 4MJKA 1RU2A 1FNMA 2JJ2A 4ZV4A 1OIAA 2J76E 4Q5VA 1HARA 2IHR1 1TKXB 1IR2A 1UJ6A 4XMYA 3DOLA 3E8OA 3HSGA 3IR7B 4KBIA 3VVUA 3G71B 3DLGA 2V7VA 3DRPB 3P5BP 2QG9B 2H4YB 4O3NA 2XS5A 4B3TJ 2D1CA 4QYZK 2QLBB 3PYEA 3E01B 2DRDA 4N5SA 2WR8A 3BKTA 1EP4A 1YNNA 5I3PA 3CQZC 1SJQA 5HANA 4PUOA 2F9JA 4IG0B 5FIIA 4OI6A 4KRWA 4Q2MA 2VBTA 3AJ1A 1O6XA 3OEPA 3CCLS 2QL7B 4IG3A 1WCMC 5KFHA 5CZVA 2WSEC 4ZLJA 3LP2B 2DYIA 1WF1A 1XFOA 1X4AA 3R97A 1CQNA 2G2ZA 1S57A 1XBWA 4M5LA 2YPZA 1SFOA 1IL2A 2VFSA 2V63A 2VUMC 2F1FA 5FO0A 2V6UA 5HZBA 1DQ8A 1E1RA 5HN0A 2ACYA 4URQU 5KFLA 2HQIA 1FDAA 5HMYA 2FD2A 2EEYA 2DH9A 4UQTA 1OGJA 4LSLA 2JA8C 4USHA 2H9ZA 1B7YB 3LH2S 4G1IA 3MAQA 5DGBA 4HHJA 4BY7K 3GILA 4XQFA 2IAJA 3VAKA 2CPEA 2FLPA 4LF7F 5A88A 3FSXA 1K83A 4DV3F 3TRGA 2HGLA 2L9WA 1W0KA 2FC9A 1X4DA 1WG5A 4X8IA 4A3EK 2FVPA 1MWQA 4WU2A 4FS2A 5L1IA 4FYYB 5AE2A 1FKPA 2QE7A 4O3PA 2OPSA 1FRNA 1IKYB 4JI4J 3CIZA 3HX9A 1ZZFA 2NVXC 1TKZB 4KO0A 4ECYA 1PYSB 3BSCA 2AYGA 4CLKA 4DZDA 3CC7B 4LMZA 2KI2A 2B51A 1C0AA 1LQ9A 4LJZA 2XMTA 1T94A 4M5GA 1N8RD 3T56B 2ZDOA 4HDHA 1L5UA 1ZAWA 2AJ2A 1S0NA 2ZUGA 1IWGA 2AZ1A 2J6TA 2W2MP 4JI8J 3CGIA 4Q8FA 4OYAA 1VISA 1GE9A 4PG6A 3LO8A 3L7UA 1U1LA 5FO1A 2E2IC 4I6YA 2HNYB 1HBUA 4PXBA 4MYTA 4G7ZA 3W5VA 2HVHA 3OZVA 4RNFA 3C2PA 1F7UA 4F50A 4WYLA 4HACA 1SJRA 2IPOB 1EQRA 4CLZA 3WNCA 2CVIA 5EX0A 2JA5C 3N28A 4GTCA 3H42A 3Q86A 4EI2A 4NLVA 5CABA 2MKJA 1FO1A 4Y2MA 1X60A 5KFIA 3RRGA 4BBSC 1IR1A 2E5LF 4OJHA 1U02A 4FP9A 1GAQA 2XYPB 5HMZA 5J2PA 1RHMB 1BQNA 1XIQA 4WK3A 1FNCA 4HIZA 5B0BA 2FZCB 4NL5A 4AF7A 2B6AB 4LF1A 2W9CA 1WJ9A 1H42A 2LA6A 2XHWA 1WD6A 4KR0B 1DJ0A 1LWCB 2EPIA 2JLEA 1HMVB 1EP3B 2XNDA 2VFUA 4F67A 2ZZMA 1UD5A 4E0DA 3CDUA 1VQKS 4ED2A 1N0UA 4KATA 1U1MA 3MFIA 2HHVA 1FTRA 1R7IA 3MM8B 3U2QA 1KD1D 5K14A 4XLCA 3FNNA 1IBMJ 1IBKF 5EMNA 2Y1LB 4KASA 3CUNA 3QWUA 5GAHU 1HBMA 3SIPB 1KC8T 2HEKA 3PFOA 2NVYA 1CNFA 3ZZOA 4NXNJ 2HQGA 1EP1B 4B43A 4I2QA 2FHOB 3HVAA 4Z4WA 2VG7A 4A8SA 3O1LA 4QIGA 4A3DC 2RD5C 3AOCA 2JRSA 3HOUC 2CFAA 3C46A 1N33F 2WJVA 3UDCA 4B9NA 2V4JB 1FDBA 4KHPF 3MEDB 4DG1B 4ED0A 2BACA 1AUSL 3RZOK 2GREA 1NDCA 4U9RA 1WQFA 3L9ZA 4AVZA 4X06A 4E0FA 2HBQB 2DD8S 5KFAA 2DNPA 3M4OK 1NK4A 3G8TA 2Y3YA 2H5IB 2AWZA 2FUG9 1JLFA 4G1QA 1O8BA 1RI7A 3H9NA 3Q6QA 1FNXH 4GQNA 2FY1A 2UXCF 4ZVFA 4DV5J 4ZVOB 3A35A 5DG9A 4CLYA 3VNVA 3N9UC 2WHOA 5C3EC 3M6XA 3JTNA 2UUCJ 4B9UA 3I4NK 4G7WA 2XG8A 4K1XA 3QMQA 3PW5A 3PDNA 3GEEA 2G0JA 2EBBA 4JV1A 1JKHA 5IQQA 5DQIA 2DR6A 1UMKA 3K2YA 3HOVC 3CXCB 5HROB 3A3NB 3O44A 1I6HC 1F9FA 1VBYA 1J5EF 1R3NA 4QBUA 2XZLA 2RIJA 1BE4A 1HPZB 5D4PA 3FEXB 4PC1A 3LW5C 3SMZA 1HNIA 2W2NP 1SJFA 4K4SA 3MURP 1L3UA 1WQHA 1RT1A 4EO8A 4KH1B 4YP3A 4C3IC 1S9EA 4P2NA 3OLAA 2IJRA 3CP8A 2LLZA 3GFZA 4L76A 2HGMA 1NNDA 1FA0A 4L6V3 1KHWA 1TWAA 3CCZA 4IFYB 3EICA 3GJQB 2AQ4A 4NOIA 4HL9A 4J9RA 4K4XA 3GMGA 1O2AA 4P52A 4TMXA 4NA1A 2UUAJ 2HFVA 4K5SA 4NRTA 2VFRA 2J7WA 4M5DA 1WC4A 3BKFA 5LMNF 3T41A 4DR7J 5KTQA 5AE1A 2AF6A 4A93C 4I67A 4OV1A 3RBZA 3KNGA 5B09A 2CG4A 4Z1MA 5E0OA 2ZOMA 4IOAQ 2COLA 3HOZC 4DXLA 2QC3A 2RH3A 5KSWB 1DAXA 4DN0A 3H4BA 1RGVA 4OPVA 3K5LA 1KNZA 3T00A 4Z4SA 1NB2A 2MMYA 2U2FA 2EC2A 2Z56B 5J2MA 3MM6A 4E8UA 2VJVA 1TMJA 4WE1A 4OJ3A 3ET6A 3MECA 1LNQA 1K83C 1S6QA 5FL7A 2F9DA 1PBAA 1FRHA 3M8WA 3FSYA 3SQGA 2NLWA 3KK1A 3M05A 3SV3A 2OMOA 2E1CA 2VNIA 2BANB 2UUBJ 2R7QA 1U0HA 8AT1B 4IG0A 4P2SA 5E3QA 1VQ4B 4F25A 5JUMA 8ATCB 4Q45A 2OEJA 2IJNA 5D6GA 1B0VA 3BR8A 1IKWA 1Q4RA 4URSA 3D6FB 1W26A 3KJNB 5CYMB 5IOSA 1KQKA 1TK0A 4AH6A 2GJFA 4WILA 3VGVA 5IOLA 2R9VA 1HQEB 4A3MC 1Y0YA 2VFVA 3VCDA 3JSYA 1RT7B 1E6VA 1TL3B 1B4AA 5M5XK 2Q43A 2M8HA 5U47A 4Z4UA 1JLQB 1S48A 1ZTTA 4R8UB 2DNOA 4JOUA 3HK2A 3V4MA 4U7UD 1ISEA 2FYXA 3KLGA 3LUYA 2RAQA 4OHYA 3QPIA 2UU9F 2XHCA 3QLHB 3D26A 4DBQA 1WHYA 1WI6A 4K0KF 3E1YE 4C11A 2CQ2A 1MRZA 1RB0A 4JI7F 1D09B 2HWIA 3PO3K 5EN1A 4RW7B 3DOKB 4XLPA 5H9EK 4RLZA 4P3YA 3OXGA 4JI2J 2JDJA 3RB0A 4A3JC 3CIMA 3DGVA 5IZHA 1ZOTA 5J35A 2WW8A 3H5XA 1U8WA 1IJEA 1BLIA 1K9MD 3PO5A 1S1VB 4A3CC 2LMIA 2GMJA 1CJKA 2RMLA 4P26A 4CO4A 5CCMA 3R2DJ 4BY1K 2UVUA 1XK8A 4CQ1A 4RW8A 5JXSA 3TA1A 5EGEA 2GO8A 2LXUA 1S6PA 4M5NA 4NLYA 3S2HK 3ZTPA 1G2EA 4FVCA 2W2QP 2HURA 1JLEA 4Y3CA 1ZXOA 2ZFHA 4ILRA 1CVJA 2B7BB 1VRTA 2JVOA 2D9RA 4J9UE 1G1XA 1F2GA 4DUYF 3H2VE 4HHHA 3MPWA 3KLFB 2CPYA 4AYBL 3KDNA 3HSJA 4CCHA 4I64A 4X7EA 4RW6B 3VQTA 1TK8A 5D4OA 3GG0A 3CCRS 4ZCMA 3K58A 2E2HC 4OI2A 1TWFC 5KG7A 3BSAA 3AAWB 1UL3A 4USKA 4B9LA 3DLEA 3IN5A 1RT3A 2YY3A 1Q82D 4RX6A 1M5VC 2F8HA 3EXYA 3MMPA 4ILMA 2YNHA 1DFDA 5CD4H 2GAGC 1SQFA 2BJ1A 3S1MK 1KFDA 2BGJA 1BXNA 3KK2A 2IA6A 1ZPWX 2VPWB 2ERRA 3MPYA 3W5YA 1F3FA 4DSLA 5C25B 2F5GA 3DN9A 4DQIA 4ZVEA 2D9PA 4PQAA 3CDEA 3DOMB 2BJ3A 3K0JA 2RT3A 1OSCA 2RKIA 2ZL7A 3CTAA 1RYSA 4U67Q 1YGYA 2XBPA 3ILOA 5KAKA 4ZVHA 1O29A 3LAMA 1SQGA 3CJ0A 2CFXA 4DL5A 2JJ4D 3PVXA 4N8NA 4N7TA 2B5JA 2N7CA 2NXNA 3UCGA 4BWJA 1NHVA 5ETLA 2VZLA 5HXBA 2WVCA 1UVNA 1ITPA 2G9OA 5IOTA 3GTJK 4GTEA 3SSRA 1FXRA 3S17C 5DSZA 2R8HA 2NQPA 2JN9A 5BJRA 2R2UA 2AD9A 4UY8T 3JQPA 3H3VL 5A8RB 4IR9A 1FE0A 1KRPA 2CQIA 3B6BA 3EPIA 4XPEA 4F4KA 1I50A 1S6UA 2HYIB 3G4AA 5EGHA 3FMBA 3C3LA 3T19A 1COWA 1VH2A 2OAUA 2BN4A 1RUSA 1UVLA 1EFUA 3RB3A 2WTFA 2PMZL 2DHSA 2JZ5A 1SH2A 5I3UA 5E6TA 2X1AA 3NGSA 3OR1B 4RNMA 1N48A 2GW8A 3GVKA 1LV5A 3TJAA 3CPWR 1Z4UA 3W61A 4NWBA 4C43A 3J81Y 1NZ8A 2MQMA 4NCNA 1X4GA 2MZJA 1PCAA 5DLFA 4OZ5A 3UO0A 2PFFB 2O1PA 4Y52K 2V6AA 3ES9A 4ZN1A 5TMFA 3V5RA 2LDYA 4DCJB 2LECA 1FNDA 1Z2ZA 1RCXB 3OSPA 1UFKA 1V3RA 3HAGA 1URRA 2RUSA 3ITHA 2HQFA 3K7RA 4ANEA 4OI4A 4OYIA 2VOPA 5HVHA 3ZC3A 4PG4A 2KM8B 3GU0A 3M8ZA 4KQZA 3EJMA 1UA1A 1KEKA 1DLOB 1NSQA 2HZVA 2DIEA 2XGJA 2Y8WA 2OPRB 1TQLA 1S72S 4P25A 4OYWA 2ZWOA 4B9TA 2RQMA 2FQTA 1JLBB 2OUGA 2K3KA 3TWZA 1Y1VK 4WFAQ 3SKBA 3SCLE 1XERA 3Q38A 1JWWA 2DT9A 2KRRA 4GO5X 2IDLA 1TL7B 2KVIA 1YZ6A 2FIUA 1G7CA 3EX7B 4C97A 1D8YA 2HHUA 5T41A 4LREA 3AB4B 1RQ0A 1TL1B 1F5CA 4FNHA 1LFPA 4YUDA 3EUNA 2BKOA 4TT3A 1XB2A 4YB6A 1M1GA 3I1FA 1RT6A 4WIQA 1T5EA 4QU7A 2X1FA 3Q8UA 2MZQA 1TWCC 1XZQB 3UDVA 2HPUA 5HBMA 2HQCA 5A0YA 2E44A 2HFOA 4RDKA 3RBDA 2OEKA 2QFIA 2YKMB 1TP7A 2MJNA 1RTIB 1N5TA 4J9VA 3GFHA 4CO0A 1QSLA 2HVIA 4Z4RA 4TNOA 4DU7A 1I51B 3ULHA 3V6DA 4RUBA 5F4JA 3F41A 4Q0BA 1T6XA 4W98A 4F2RA 3BCDA 2RRNA 1SV5B 4TKOB 1YBAA 1W9XA 3TVYA 2GQCA 5CYQA 1YJ9S 2BBEA 2BM1A 1HNWJ 3CSKA 1M5SA 1APSA 1DBDA 1IKVB 5THXA 4XKWA 1HNVB 2DNNA 2BANA 4Y2IA 1S1UA 4TXSA 3VVTA 4IRDA 3NNHA 1VQLS 2W4CA 3ZZRA 1KSPA 1BQEA 2CG8A 4YMEA 4KN4A 4WP9A 4R0JA 1O51A 2HK2A 2Z58B 1HHSA 1RE1B 1RT2B 2PIAA 2AGOA 5GAGI 1T6ZA 1NSAA 2Q6OA 2PHCB 1O0PA 1MSWD 3OVSA 3CF5Q 1UWBB 3T1YJ 2ABYA 1VQ7S 2ZWPA 3K59A 1F5BA 2XCQA 4M4SA 2KO1A 1SKWA 4F02A 1ICEB 4ES2A 1QVGB 4Y9RA 5DDQC 1C0UA 1UVIA 3HD2A 5G0RB 2AYBA 4USUA 3OHBA 3D66A 1KK3A 4TMZA 3NCPA 2XSFA 1UEKA 2D74A 3F0NA 4CLFA 1D3WA 1JLCA 3PA1A 2Q1LA 4ED4A 3MM7B 2HGNA 3OTEA 4DN9A 1QG0A 4C8YA 3HD1A 4KH0B 2K06A 4OL8A 1FE4A 4GVBA 4MQ9A 1MG7A 1NMEB 5G4DA 5FLMK 1NLKL 3GTMK 2WB1D 1X9SA 3PJXA 3V7AA 3J7ZT 2JWNA 2QMXA 1KVKA 4JV5F 4XM3A 3TEGA 1J6VA 2GCFA 4FDFA 2MPUA 3A12A 3RY8A 2DIVA 4DR6J 4DDFA 4QJVB 3BGLA 3BO3A 1A9NB 3VF0B 4C3JK 1FVSA 3HO1A 2ZC3A 2V6SA 3IWXA 2ATLA 1I3QK 1CC8A 2HLTA 1UD8A 2FB0A 4ITSA 1RCOB 3I5BA 2QV6A 2DPJA 5D0HA 4CLPA 4C3HC 3M2VA 4ZVRB 3S7RA 4TY8A 1WF2A 3KLHA 2K1RB 5IT9Y 4YHBA 4B3XA 1K1SA 2N4CA 3OTOJ 4A3FK 3KJVB 2XGPA 4QWEA 3AVXA 3S14K 2C3OA 4QZVB 3OJWA 2DEJA 1EKSA 2NXUA 1FEEA 4J9OA 4RW6A 5DS0A 1VDHA 4XR6A 5BXIA 4KHMA 2QX0A 4DPYA 4ZVTB 2NZ4A 1RHRB 2QMUA 3V81B 1CULA 2GK6A 2J6SA 2R8IA 1VC6A 1KC8D 4OLPA 3MMLB 1P27B 4C45A 4QOTA 1JNZB 1C1CB 4ZVPB 2M5YA 3CEDA 3HSDA 1UJ5A 1LWFB 2M52A 1RTJB 1JA1A 1U6ZA 1MMLA 4OLOA 2YH0A 3NBPB 3CMMA 3QSIA 1N5SA 1VGXA 3EGWB 1I50C 4DEZA 4O2DA 4F04B 4YHHF 4M63A 4EGLA 4X7CA 1LW2A 4K2XA 4DV7J 2QL5B 3GEHA 2QDXA 4BPRA 3OLBA 2Z2ZA 3UWTA 1R6YA 3RRKA 5D4LA 2RRAA 4RZRA 1VQOB 2J0XA 3LWLA 4BLBA 1RWKB 1BUXA 2KXHA 1VS3A 1ZBTA 2OPPB 4KGKA 4J9PA 4FS1A 4UAJA 1VRUB 4LK1A 1CJUA 1TWGA 3K8WA 1J5OA 5L9XA 4CDIA 1P8GA 2BJ8A 3RAMA 2QTZA 3A4TA 3OW7A 1VBXA 3PW7A 3R6KA 1GJRA 2E1AA 4DV3J 1F93A 2O66A 4B4DA 4KARA 2ZH1A 4PG7A 2XCOA 2YWWA 1XZPB 2ZXHA 3PG9A 2XMAA 5CHCB 4CYUB 4G65A 3I55B 5ETMA 2JLGA 1ZVUA 3HFKA 4DFJA 2HHPA 3GDZA 1Q9SA 4PC7A 2CJ9A 3Q22A 4J9MA 2KXFA 1SC6A 1V5VA 2DGTA 2ZJPQ 1UA0A 1G4CA 5KG2A 3OTBA 4C8LA 1NPKA 4LQYA 1N05A 1SQEA 4C8NA 4FPRA 3SFGA 5C44K 3GZ7A 3J81j 3DDIA 2BE9B 2A2CA 4PC6A 5IV4A 2DHXA 2XO6A 4LF5F 4DV0J 5B0GA 1TAQA 2ROEA 2V8DA 2GMLA 4HLBA 4OV6A 4RW9A 1GEHA 3GG1A 1JIHA 2ILZA 5C7PA 1VLYA 3R5BA 5HL8A 4RU2A 1HR0J 3M1VB 1L3TA 3FBFA 1XN9A 3AFGA 4X4PA 4ZP8A 2E5LJ 5KFPA 1YCLA 1SKQA 4X0CA 3GWCA 3MMBA 3LF0A 3ENVA 3VGTA 2YU9C 3IS9A 4GO7X 3D0HE 1CJTA 4A3GK 2AYMA 2R7VA 3ZZTA 5IP9K 2XYGB 1VF7A 2ZH8A 1UFLA 1OSDA 5LSLA 5LT5A 5D0GA 2HBZB 3PXGa 1GMWA 1G51A 5M3FK 2ZC4A 3DMJB 2C2EA 1B70B 5EGYA 5E7OB 4HR2A 1EETA 3HOYC 3N6NA 2CWKA 1TL1A 4A3IK 2R92K 4ZVSB 3PENA 2O5DA 3Q8VA 1IBKJ 4ECTA 1X4FA 3KXDA 4JP8A 1DTQB 2HWHA 4QIWD 3HOXK 3NEKA 2UVWA 3C15A 4DUZF 3NE5B 3PR4A 3Q24A 1VIOA 3AH6A 3JSTA 3R5JB 3OR2B 4NLPA 2GVDA 4A3KK 1G7RA 1MROB 3C16A 3L95X 4HHUA 3JS9A 4PQUA 3I31A 4LC0A 5ETSA 4KHPJ 3FK4A 3AVTA 1S59A 3BR9A 2XCPA 5A8AA 1WI8A 1URNA 1P9QC 1RZMA 4X4NA 3SDEB 1ZYQA 1WDTA 4G6IA 4ZJLA 3GTPK 1PAEX 5J1EB 3I4MC 2QEXB 3PW2A 3CCJB 1NK6A 4DL3A 1HNVA 3W65A 4UOFA 2KFZA 4JV0A 4KHRA 4IRCA 5E3CA 1X7VA 2EIXA 2E7WA 3GCXP 2DGOA 4MK8A 3Q8QB 1EQMA 2FVSA 3HVTA 1S9FA 1DDIA 4OYPA 5DM7Q 2E9ZA 4NYZA 2VBWA 4BKWA 3ZBUA 2C78A 2CW0A 4EU0A 3AGQA 3H5SA 4LBYA 3HKZL 3VAFA 1Y1WC 4CT9A 4ZIVA 4TYAA 4P6VF 4EFAC 1IBCB 1UWBA 5C24B 4XKVA 4ASUA 3LQVA 2WVEA 2X53S 1PILA 1PSDA 3GQBA 3CQZK 1QGZA 4ACAA 1K8AT 2B4UA 2AT1B 3AVYA 1EH1A 3BV8A 2ALZA 1E43A 3FFIB 4WFZA 1N0VC 3CCUB 4BDPA 5GVQA 1D1NA 2BV3A 1NKCA 1WCMK 3CDBA 1DCHA 3TOQA 4AQYF 2GSUA 2IRXA 2VYQA 4YS2A 2HDNB 2BZ2A 3SI8A 1L3SA 2AHOB 4CH0S 2C2NA 2QRRA 3M30B 3VZHA 3QT7A 1T9VA 2VUMK 2V69A 5B0EA 2C5BA 5A89A 3CO0P 1ACMB 1DURA 2MQPA 1AZSB 1Y1VA 1W2IA 4OMFG 3CVKA 5KT7A 4WTYA 3H90A 2CNNB 2CNKB 3BH4A 4MH8A 2JA8K 1YKWA 2PT0A 3ETMA 5HATA 3OL9A 3KEWA 3R9LA 1YI2B 1OQ6A 3OE7A 1QFJA 2V6TA 1REVA 5KFTA 4YAUA 2CZ4A 3TX8A 3GTGC 1ZM2A 1H3DA 1NJWA 3FDSA 1FK9A 2W9AA 1FX4A 4EZ9A 2R7OA 1EFCA 5IWAF 1DQAA 1TV6A 4MEYA 5CCLA 2ZM6J 3GTKK 2V2QA 3PX6A 4FK8A 1SJ3P 4YY3F 3S15C 4ZPDA 2B5OA 5KFOA 1TWGC 5FJ4A 3IA0A 2VV5A 5HP1B 3S16C 2NVXK 1J6XA 4B3SF 4I0WA 1PYOB 2X1GA 4WFYA 4I7FB 5D78A 3D1HA 1HNXF 3GTOK 2XMMA 1O25A 2FZKB 3BREA 4I2PA 2OH2A 1OHHA 4DR4F 3LAJA 1TKTB 4ZLNA 4EK2A 2VJUA 1I1GA 5L1JA 4CH7A 4DNTB 4M5JA 4KV8A 3NUHA 3BGRA 3J7YI 2WOMB 1WOOA 3BN7A 1S0OA 4RL1A 4U8YA 2VL1A 5A8KA 3N6MA 2XMJA 2WVBA 2E2IK 4RJLA 1TTTA 1WC1A 3GB0A 4C8MA 1WKLA 2XNJA 4ZPVR 3KG4A 3EZUA 4DV2F 2XCAA 1IXKA 2ZUAA 3W8GA 2JA5K 1UCNA 2RGRA 1PG5B 1YBTA 1RU1A 1RWXB 2V34A 3MEEB 3WODA 5T7LB 4A8XA 3JQRA 1YWXA 4RBTA 3W62A 3PYDA 4BBSK 4CH1A 2M4MA 1MWZA 1QGYA 2B4PA 1Y3JA 3DRRB 5HL7Q 1FRIA 1UV7A 3OQ2A 5KOWA 2VOOA 1YIJB 4G7HA 2KDOA 1K1QA 3SZ2A 2C2DA 2OMLA 3R6LB 2ZBVA 4PXCA 2N3OA 2B8QA 5KFFA 5HLFB 4JI7J 1I18A 1RP5A 2M70A 4QYRA 2W25A 2KL8A 4QW8A 2AV5A 2O67A 5HSPA 5C42A 2KM8C 3VMFA 2DJWA 3QX3A 2R2TA 3CDWA 2Y8YA 2WAQD 3MCSA 1I3OB 4WBFA 1EKRA 5D15A 1WC5A 4ECWA 4LBIA 2DNQA 4FNIA 7FDRA 1HBNB 3GTMA 3QIPA 1RWMB 4A8KA 4IFVB 3CJ3A 1VGYA 2ZUFA 3CCQS 3QRRA 1GFWB 2BOAA 3BY1A 4IH5A 2P9EA 2VJIA 2AEJA 3L09A 4HKQA 3CJQA 2AZ3A 4A3DK 4YB1P 2XY7A 1XE1A 4UW2A 2XMUA 2QN6A 3OL7A 4F3OA 3TFIA 1QFZA 1I3QA 3KK3B 1BY9A 3HOUK 3QZ7A 4O4GB 4DUYJ 4YEAA 2AEMA 5M2UA 1BS2A 1R8PA 2IM3A 2DHHA 4ZHRB 3AVVA 2Y0BB 2BYCA 4P73A 3RW6A 1HYSA 2PIIA 4ACBA 1BQMA 3G82B 4MKYA 3CXCR 4DCOB 4DFMA 3WHIA 1NKBA 2PMHA 3GYXB 3SCJE 4XL9A 2V0NA 4KFBA 3UI3A 3WYAA 2JEGA 1RT5A 4P5AA 2XZTB 1WUUA 3OT9A 4F4AA 4QVJA 3FEYB 1PC4A 4P75A 5FDLA 3FC9A 4USJC 4IH6A 5T14A 4ID5A 1U6FA 2WZPP 2XI3A 1NZAA 1CQXA 1RTZA 3FPKA 4PZVA 2BQUA 2VICA 4DX8H 3TAQA 3I87A 5KNLA 5C3EK 2ZL6A 4UF4A 2DH8A 4Z7YA 4Z2XA 3B4MA 2AU0A 4ZOSA 4MIBA 2Z8QA 1NDPA 3EGVA 1VQYA 3X3UA 4F2SA 2QLXA 4DU8A 2NVQC 4X4QA 1RA6A 4RW4B 4YFXA 3T9NA 2BABA 4EBCA 2JL9A 3R27A 2HCJB 2BA9A 3FPPA 4M95A 3M9NB 3FJ2A 3HOVK 1UFWA 3H8YA 4IOBA 3EE3A 2MKSA 1I6HK 4OZ3A 2NREA 1AT1B 3GPAA 3MM5A 3T5JA 2ZH7A 2GV1A 4PXEA 2D3O1 4WZQA 1GX6A 5K8NA 2RILA 4R71A 3QNWB 3FCHA 3N79A 3U7JA 4RR5A 2LFVA 4TMVA 5CZXA 4DV6F 3HHKA 2VQFF 2ALYB 5CH7B 1YITB 1RBOB 2DYAA 3G4SB 1K0VA 5E3AA 4C3IK 4RBUA 4IYQA 2V67A 3LNNA 3PZPA 3MEKA 5I42A 1UD6A 2L3MA 5F0WA 2B63C 1FKOA 3L7OA 1RWOB 2ZHOA 1JLGA 1T11A 4GTFA 2EFOA 4IR1A 1SFOK 1HWLA 7AT1B 2UVVA 3PEJA 1LXJA 3CPXA 1VMBA 1R5OA 1XNRF 1HNZF 3QRQA 2J0WA 5E5NA 3LP0A 3IRXB 1N34F 4YEJA 2BMBA 4YR3A 3PO2C 2KT5A 5TV2A 2ZBPA 3CCEB 2MZSA 4CNZA 1DD5A 2F8EX 3HOZK 3H5UA 4P2MA 2JHEA 1MN7A 4Q44A 4U9UA 2APOA 2QTWA 2FHJA 3EYZA 3OUYB 5IC4B 2Z0GA 2KRBA 4H4MB 4ZCKA 1QX4A 2FLLA 1N32F 3ETOA 1KOHA 1NXIA 4TKTA 2QFJA 3TP2A 4RCYA 3MM9B 1K83K 4QR2A 4KC6A 3DLKB 3GFYA 4NCGA 2HFUA 2XNCA 3LALA 1TAUA 2R7UA 2CBXA 4ZVGA 4QIEA 2JEFA 3P4UB 2F4NA 4A48A 3R1LA 4DF8A 3W2VA 3WZ0A 2OSQA 3DLLQ 1SH3A 1TU0B 3T1HF 3SSQA 3R1HA 3BH6B 5KFBA 2WYRA 5D3GA 3D28A 2BW2A 1IM4A 2HRYA 5BSXA 3FSIA 2B9WA 2JSXA 1OO0B 4U7UK 2R7ZC 2KFYA 3OP1A 1U25A 2W7VA 3I56B 3U02A 2C5HA 1W2BB 3CCWA 5GAEI 1UVKA 3IO1A 2XMWA 4WP3A 4P6QA 1KJZA 2W7AA 2LQ8A 4ZA1A 4DL2A 2UUWA 4A3MK 4GKJF 2M88A 5KT5A 3FVYA 1TWHA 2BE5A 4O3RA 1D1UA 1RISA 2YNFA 3MMCB 2HHWA 1PGZA 2FJBB 1N06A 3ICLA 3EGZA 3IM9A 3ILIA 2Q6KA 5ETVA 1NJYA 3BNWA 4CM0A 2YBVA 2Z2YB 1VC5A 1NM2A 4WZMA 3QO9A 1LWEA 4ECZA 4TLQA 1T3OA 1F60B 4AF6A 4CI0B 4J0QA 1I5OB 2ZBIA 4A3LC 4WQMA 2ACMA 5KG3A 4MIWA 1JXVA 3RR8A 4LSNA 1D2EA 5IYDC 4A3JK 2R7XA 4A3CK 4ECRA 2A10A 2WONB 1TVRB 2IBOA 3ZPNA 4ED1A 5HP1A 3UE2A 4PXDA 1T03B 3CAGA 3ILJA 3QFWA 2BF4A 2LKZA 5DO2A 3QRPA 1XMBA 2AJFE 2QA1A 3FCWA 3HOWC 2YVSA 4ZLLA 4WXWA 5AXKA 4FZVA 2BUNA 4UY85 4IO9Q 2XZPA 3QFTA 1SVDA 1WQGA 4X4SA 3TZXA 3OREA 4QWAA 1FRMA 3M32B 1IKXB 5IOQA 2GVZB 1UKUA 2I1RA 1R5BA 1TKDA 3SQOP 3GTPA 4M1KA 2QLFB 1WACA 3N5FA 1S9GB 3ZIAA 3HI9A 4ZJQA 2NVYK 3D3BJ 1Y9OA 2EFGA 1HBOA 3NAHA 1JMTA 3CJ8A 2H54B 2P3MA 2HS4A 4ZP6A 4ED6A 2E2HK 1NK7A 4FKYA 3PV8A 2MKIA 3GIJA 1QAXA 3DGPB 2EG1A 5TJ3A 1B3TA 3LPYA 4DPTA 1N36F 4L75A 1TWFK 3O3LA 1UMJA 3FKBA 5B0CA 3K57A 4DS4A 4PWDB 2MYFA 4OYZA 2HHTA 2XNQA 3HT3A 2DNLA 5F9LA 1X4EA 2XSJA 5KG0A 5KFQA 3A3GA 1EP2B 4KKSA 1CLFA 4YFNA 3QT8A 4LRDA 2O3DA 3AVUA 3CQZA 3UD4P 4BBRC 1UVJA 2VU5A 3BO2A 2W8LA 2VB6A 3ZTRA 5GADI 1DDGA 2YWHA 1RHQB 4EYHB 3TAMB 4WFBQ 2OO4A 3T5HA 3SZYA 1G7TA 3AD8C 5LXRA 1JQWA 2HFSA 3FOFA 2WVDA 4ETZA 3BYPA 2FLOA 3E3XA 2CPJA 4C3MA 3TTGA 1XQBA 5D8HB 2EBEA 4GTLA 1GNKA 1U45A 1ZBSA 4DHVA 4Z7CA 1XTZA 5KFZA 3QSYA 1QVFB 4OP7A 4G7XA 2I5JB 3ZZ0A 2GPJA 3J80Y 3UR0A 2RF2A 1HZEA 3TEHB 1EK8A 2EC0A 1FDNA 4KKTA 3RB4A 1KWMA 1Y5NB 4N8OA 1JX4A 1RADB 1OJ4A 2ZZQA 3KLVA 3WX8A 3IG1B 2RDDA 1HQUA 5J2NB 3MZIA 1P1TA 4FYXB 1S7IA 2WB1L 3WNDA 4RUCA 1Y4ZB 1OPIA 2MZ1A 1EX8A 1K9MT 4O44A 4DF4A 1BMQB 5F8HA 3DRSB 3P26A 2NYHA 3MPUB 4CLTA 3S17K 3BN4A 2AP6A 3O5TB 2CPZA 5DN6A 2XZDB 4ZGNB 5F9NA 1YJWB 4XLFA 2IDEA 4RKUC 1F9NA 1XWLA 1ZAVA 3VZIA 2XO7A 1B4SA 4LF6F 1WWHA 3TAPA 3BP3A 1S1XB 5K8PA 2NVXA 4NA3A 4PG8A 1GAWA 3SZZA 1TWAK 3FMWA 3DC2A 2EXUA 3T53B 4W4MA 3EMTA 1C0TB 1R5NA 3OTCA 4ZKAA 4PYAA 4CTAB 1VI7A 3A1PA 4MFBA 4II3A 1AB8A 1S0UA 2WBRA 3AD9C 1B99A 1U0SA 2EFVA 2ZZGA 4X66F 4QWCA 2V7QA 3EM1A 3MDFA 1X5OA 3WX4A 1YRTA 2E2IA 2GAHC 1IWAA 1X9WA 2AGQA 4N3GA 1L3VA 3G6EB 3CCLB 3SYZA 1VJSA 3G9CA 1N52B 1D9DA 2BXJA 2X6WA 1Q82T 3NP5A 4K4UA 4DQSA 1BGXT 2XULA 2W9BB 2NXEA 4RPDA 3V4IA 3HKWA 1Y0HA 4ELTA 4ZMMA 3MPDA 1VQ8B 1RYRA 5IT9U 1NB0A 2ZD1A 2QLWA 3MMAA 1G3OA 4V19J 3VA7A 2ZJRQ 1U48A 3ERED 4JI3J 5IM0B 4PC3A 4RJVA 5SZTA 4AT1B 2C2MB 4PRFA 1Q5YA 2VNHA 1KBRA 3ZO7A 4RUHA 3M4OC 4NMLA 4JBCA 4ICLB 2YNGA 2EFPA 2RUGA 3M8RA 3M8PA 1NK8A 4LFCJ 3SJPA 5B0FA 3UDLA 4CLUA 2PI5A 4XOPA 3J7Z5 5ETQA 4DPUA 4NI2B 1TWCK 1SKUB 4WWSA 4DSEA 3TA2A 2K8GA 3TUPA 2WVFA 2XLJA 4TLRA 1F2HA 4B3TF 2ZOGA 2E2JC 3IBFB 3ZTQA 4PEOA 2R2SA 1TWHC 3ZFVA 3MR7A 3MPVA 4WJ3M 5ETOA 1IN0A 1IW7A 2GGPB 2NUUG 4NZ6A 4YOEA 3MAAB 1U2CA 4HTJA 5D4NA 2HK3A 5KG1A 3OUYA 2PEBA 1NB7A 1XJWB 3T51B 5EWFA 2OJ3A 4LF5J 4C3KA 3C6UA 1QVGR 3C14B 1U8SA 3W2WA 3W5ZA 3UNYA 5LMUF 2QJ3A 2FVCA 1VQOS 4FZBA 1XMQF 2AJ1A 4NRUA 1XEZA 3W2GA 4OX9F 4AD6A 4J9KA 2FDNA 4DV4J 2XC9A 4AE5A 4A8MP 4XOTA 1VBZA 1REGX 2VFTA 3VV2B 2L9DA 4OHWA 4BHQA 1WP6A 1CPZA 3D0GE 1FNBA 4KDDA 4A8YA 4YAFA 2F65A 4DX6A 2OBRA 1MMNA 2C28A 2GQFA 1DY3A 3GTLC 4KN7A 3J81k 2ZH9A 1QDUB 5E68A 2DBBA 3I55S 1VHIA 1T9UA 3G6YA 1FX0A 3CC2S 1YG0A 2HHXA 2LXIA 1FRLA 2GS8A 1HHQA 1TR0A 1S1WA 5KG5A 2BQ3A 2A6EA 5A8WA 4E98A 1RLCL 3DRYA 5JVGQ 3HFZB 1WOPA 3NNAA 4XSZA 2V4DA 1RWUA 5TMCA 4KMDA 2GZOA 3GE9A 3T3FA 1R0AB 2HMIB 4JI4F 2OLWA 1PIEA 1AFIA 1VQKB 5KT4A 1RJJA 2BEFA 4DV1J 3QFHA 1H7XA 3ASRA 2BE2A 1H8HA 2ZTGA 3GV5B 4AC9A 4XDDA 5ETTA 1IJFA 4DUZJ 4BLAA 3JAMY 1RAEB 1FERA 5CDFA 3CD6S 2ZE2B 3GJSB 4JI8F 3D4JA 4X6AC 1VRQC 3M2UB 1AIPA 3TA0A 1WKKA 2MGZA 4KGVB 3POTB 2X0KA 1ZUNB 4N56A 1OQ3A 2ILYA 3G2XA 4X64F 2FVQA 1NDLA 3H20A 3CCVB 5BYRA 4NCAA 2MQLA 4TU8A 1OWXA 1RT4B 4MMOA 4LK0A 4XCHA 1WC0A 2DXEA 3DXSX 3IBCB 2Y0SL 4G6VB 1FRKA 1QTNB 1NH7A 1RKIA 1HWKA 1NEEA 1WG1A 4C3HK 1N08A 2K2PA 2P9CA 1IKXA 2KVOA 3HM9A 4C8KA 5C4JC 2G0CA 1C4AA 3DHXA 2QO3A 2V8PA 4ANCA 4WZKA 1JJCB 3I82A 4K4YA 3K5NA 4YAWA 3BGOP 3VWSA 2V7UA 4RDLA 3GSIA 1OYEA 3NMAA 4CNYA 4YR0A 3I9ZA 4J3NA 3PUNA 1TUGB 2BOPA 7FD1A 4X4UA 1PKVA 4LFBF 3F56A 4O3QA 2NVTC 1U24A 1DHMA 3T5LA 2FLNA 3PJWA 4OZNA 3UPFA 3ONYA 5RUBA 1T9TA 4ED5A 2M0GB 2ASDA 2ZKUA 4G0WA 3FJOA 2DB1A 3HT0A 3MEGA 3NRBA 3EWGA 3JQMA 4Y9UA 4Y7NC 5DLGA 4M94A 1ZZNA 1QGAA 3GEIA 1I50K 3UVJA 4AQYJ 4C3LA 4UOGA 2HVZA 3I9V9 4NXNF 4FM9A 5LOQA 4K7QA 2ZZNA 4N47A 3EXCX 1N6QB 3AXKA 4I6AA 3U6KA 1GXTA 3CJRA 2EG2A 3D3CJ 3ENAA 3M2RB 3KUGA 1SUQA 3MMJA 1NKEA 1NDKA 3CMAS 4J7CA 1TK5A 2QEXS 3CCJS 4LR8A 3D5MA 2YKNA 3OFNA 4ZLPA 4X4OA 2RHQB 1X4BA 1M5OC 2IVMA 1VK8A 3DFEA 2AKWB 4LIWA 2VJJA 1N56A 5J2QB 5IYBK 3JSMB 4R5PA 2ZNZA 4XLHA 4RU9A 3MUVP 4P2XA 4TU9A 2BJ7A 3DKDA 5IWAJ 4P71A 4Y65A 1H0HB 4PGOA 4DSKA 2IC3A 4YY3J 1YX2A 1XQIA 5KFVA 2GNKA 1IUJA 1R31A 1W34A 1H2TZ 3GIIA 3GIRA 1U2RA 4B3SJ 3GTYX 3CCUS 5HQMA 3WC2A 2PGCA 2LU2A 3QBCA 2RE1A 4BCAA 1EAYC 4NOHA 3R2CJ 1HNXJ 2DNGA 2P5VA 2RU3A 4RNHA 2VODA 4YG2A 4KM9A 3RRHA 1ZA2B 3BBCA 2JA7C 3ZNJ1 4DR4J 4DSJA 4JV2A 3IGNA 4P7VA 4QIVA 3JSBA 3QFRA 1FF2A 5AXNA 1U1KA 2DCLA 2X85A 1B23P 3SLNA 3CCTA 3NGDA 4DR5F 2NSCA 3LGHA 2X6YA 2E1PA 2QE5A 4G7OA 3LPEA 2PA8L 2A68A 1HFEL 3FQLA 4NLTA 2J5AA 2NS1B 2YWFA 3JYTA 3CC4B 1CS4A 4G1PA 3AODA 5E3PA 3GTQA 3S1TA 1ZPVA 4GC6A 1T05A 3PW0A 4LBPA 2M8DB 1F20A 1IR0A 1H74A 4XO0A 2DTJA 3QWPA 5D0EA 4YALA 1RAJA 3I4HX 1S1TB 4GFQA 4OX8A 1PAUB 1QH0A 1T8EA 3BGUA 4C0BA 4UQGA 3CD5A 2WCXA 3CMES 4I68A 2E2HA 4YFUA 3MWBA 1WEXA 2B7CB 4IDKA 2C1EB 4LF9J 3I0RA 1TWFA 2YU9K 4RMFA 3MD3A 2R8KA 3CCSB 2MDAA 3P49B 3MCAA 1IBLJ 3ZTOA 2CRVA 1Q53A 2OTLS 2XI2A 3S2DC 1Q1KA 2WZNA 4Q2LA 4DR7F 2WRMA 2QIFA 3ELHA 5AXMA 3NG8A 2DR9A 3C6TA 1VLOA 4FXUA 2C2ZB 2IM1A 2ZTNA 1N5YB 3DLHA 4ICLA 3H4DA 1V6HA 3CJKA 1CJVB 2CVEA 1O28A 1KQ4A 3HOYK 2E5HA 1BPLA 2PMWA 5MLCV 2IFXA 3AGPA 1WC6A 1MU2B 2W2PP 3DI6A 2HNDA 2RU9A 1VHFA 3DM2B 3KLIA 1GXUA 4NASA 4DK1A 3N5BA 5KFXA 2Z4PA 3PACA 2YWGA 2FJEB 1DTTA 3HHLB 3RZDC 2BSAA 3RB6A 4B44A 2V2ZA 2RS8A 3GFXA 1T9YA 1KTQA 4RDJA 1O2BA 3BSNA 1I6JA 1E6YB 2R4FA 3QQCD 4UZEA 5IYRA 1GO2A 4WPAA 5IV3A 2HAFA 2UUBF 3M4XA 1GX5A 3KLEA 3I0SB 1E62A 3KDOA 1RACB 2GJRA 1UTAA 2YNIB 4KKOB 2ZITA 1PKUA 4I1TA 1W0JA 4NYOA 3LP1A 2E1BA 1OPZA 1YJTA 4RNNA 4ZPTR 1VQMB 1RWWB 3K17A 2CQ0A 3OOCA 4X65F 3LOUA 4D3GA 4U6PA 3THVA 4QR1A 4ZGQB 2EFNA 2E5GA 2IVFB 3I4MK 2MKYA 2I2YA 3CJ2A 1KLNA 3CPWB 4K50A 1Q7YT 3FHZA 1WTHD 3ASQA 3V2UC 1GQEA 3J7AN 1LW0B 3ENQA 1VOMA 2RC5A 3M8QA 1Y0RA 4WK1A 1KLMB 5HMWA 4WXOA 3OZUA 1U4BA 5IP7C 3KUEA 3PYGA 5KFKA 1NBEB 4K8RA 1BC6A 1U1NA 3S8SA 4B3FX 2DCUA 1Q81D 1MN9A 2ADCA 1UETA 4ID8A 3WIUA 1R43A 2J9DE 4M53A 2GJ2A 2BDPA 2FGCA 4JI0F 4U7CA 1HLWA 5DDRC 2H48B 2Z6BD 4YB7A 1BWEA 2VG6A 1VFJA 1H8EA 1XPPA 1EXMA 1RLDA 2V9KA 1A8PA 2CJBA 2ROPA 4Z37A 1R0AA 4AYBD 2HHQA 3W64A 3OJSA 3TR5A 1C4CA 2XS7A 2H3EB 4L73A 2BM0A 1GTEA 1TKXA 2HHSA 4OPSA 3KL9A 3IGVA 3DRPA 4UT4A 2VQFJ 4OZ2A 5H5JA 4MK9A 5A6PA 2KVQE 1S76D 2EK6A 4ED8A 3D1QA 2V5HG 3E01A 4ZVUB 2MKCA 2WK4A 2RQCA 1WHXA 2GQ2A 4RBVA 3JTOA 4CZCA 4GT9A 1KN6A 5AE3A 1RWNB 1HW8A 1T6YA 4LR7A 4A8FA 4G1BA 1WEYA 3LP2A 1XNRJ 2GMHA 3DOLB 2XQCA 2F4VF 4F0KA 4ZPCA 1HNZJ 4QU6A 4Q43A 3DLGB 4LF4F 1V3SA 2MHEA 4AL7A 3OAAA 1FX2A 3GTGK 1N34J 1SB6A 4OYXA 5KFGA 1X5PA 2VG5B 2KZMA 1TWCA 1EP4B 3AJ2A 4O4RA 1NSKL 4PUOB 1ZM4A 2ZH5A 3S15K 4KJIA 4JYAJ 1XXAA 1TWGK 3F44A 3FBCA 2KG0A 3VAIA 3S16K 3M3YC 3IAM9 4IG3B 1N32J 3RBXA 4OOVA 3RBEA 3A8EA 5I3QA 4DK0A 2VBYA 5DJBA 4DQQA 5GAHI 2WW4A 3A3BA 3Q8YA 4JI6J 1WDDA 1EB0A 3OXLA 3M6UA 1UEUA 3MUMP 2C2WA 3T1HJ 4AFFA 4X7DA 2D69A 3G4SS 4LLGA 1UEVA 3DLBA 2C3MA 2VQEF 1Q8LA 1PC5A 4LSLB 4WZEA 3W9HA 2HBRB 5AXLA 3UD3P 1IKYA 3H3VD 3R6JA 2HZAA 3OKXA 5GV8A 1TKZA 3CJTA 4IQMA 3VNUA 1QUPA 1JXLA 2V4RA 2IAJB 5C2GA 3V6HA 9RUBA 4GKJJ 2CIMA 1NK0A 1X4HA 1M90D 3GCWP 2VBVA 3PJ9A 4O23A 2GFFA 3KHHA 3M2RA 3CW2C 1BX0A 1SMYA 1KQSR 1IB0A 1B0TA 5EWEA 3GTQC 1LEOA 1FKPB 4MTPA 1S79A 3HXMA 4HE5A 2OPSB 2O01C 2XCRB 1S0VA 2V8GA 4MKVA 4J9SA 1R6VA 2HNYA 1TUVA 4NLGA 4KO0B 2C22A 2CJAA 2VF3A 3WQZA 1VQNS 4M2LA 4GTAA 1FESA 1WHWA 2YXLA 1B0PA 5F41A 5HAOA 3G96A 2R42A 2N82B 4YR2A 3D7SB 3I6PA 3D54A 3LPXA 1G6BA 3TW0A 4MEXA 2JEJA 1CC7A 3PYFA 1O26A 1VHEA 1V5IB 2XWYA 2DOGA 3OL8A 2V8VA 1Y11A 1HBUB 1H2VZ 5KT2A 1FJCA 2C2RA 4P7TA 2UV8A 3MR2A 1T0TV 2DR5A 3CULA 4DL0C 2B4VA 2B6AA 3QIDA 4HACB 2EI5A 5B6IA 2MZRA 2W7OA 2P9GA 1UAWA 1W35A 2K7KA 3S1RC 3WBZA 1LWCA 1HMVA 1HQ2A 4LJMA 2NV4A 3H40A 1KOOA 1VK3A 2YX7A 3MM8A 5J2PB 1YJ9B 1BQNB 4K4WA 1HVXA 3Q23A 2AJQA 3U1LA 3PX4A 2OFHX 1U26A 5IYNA 2VC1A 3QATA 1D8TA 3IWNC 4GZYA 4CO1A 3H7HB 2W9CB 4CLWA 1VQLB 2L48A 4KE5A 4DFPA 2X3GA 5EDWA 3D67A 5HK4A 5HQ8A 4QWBA 4F7DA 3CD7A 3HHNB 5IC6B 3QAEA 3M8SA 3MR5A 1KONA 4B9VA 5K14B 4CRJA 2V4JA 2D3UA 1I94J 3MEDA 4DG1A 8RUCA 1VQ7B 2JDIA 1HBMB 4DR1F 3O8WA 4IKAA 4NMXA 1U1PA 1P1LA 1RAOA 2NVQK 1FRXA 2ADBA 3E2EA 3PNIA 1Q86D 1CG2A 2HIQA 2DGWA 3CP2A 2VG7B 1RAGB 1KK0A 3OW2R 4ZCIA 3UW1A 2B8PA 4RD1A 3TYTA 4PR6A 4FF2A 4U96A 1G7SA 1F9HA 2HW3A 4CQJA 2H5JB 2ATCB 1T02A 2DIUA 3FBBA 4NXMF 3C19A 1YDLA 4OIQA 2MY8A 5D4DA 5LM7E 5DGAA 2KYZA 2I0XA 2JFDA 1JLFB 4G1QB 3KHGA 3AVWA 3PRDA 3TUIC 1M1HA 1INNA 4HEA9 3MF5A 1KQFB 2IM2A 4OIOA 2B63K 1T9WA 1R8HA 4C98A 1SPBP 4KKOA 2W4DA 2MQQA 1JK9B 3AOBA 4DJBA 3O2IA 2EWHA 2H5EA 1SKYB 3ZZUA 3OZWA 1VYAA 5HROA 1IQZA 4J5OA 1F7VA 3HPOA 3SSSA 4A3BC 4LF6J 3NNCA 3N3YA 1HPZA 2HFZA 3PO2K 4PWUA 3QGPA 4OI3A 4OHXA 5CD4A 4LFAF 2GK7A 2M5SA 5E33A 3GYNA 2PC6A 3HP6A 1JKHB 4ES1A 3U1MA 1NB9A 4WZTA 2YH1A 3X1LB 4IFYA 3V6JA 1SJ4P 5DQGA 1KZLA 1CNEA 3PO4A 2Y9HA 1SKRA 3SCIE 2ZBUA 3J80U 4ERDA 2HVEA 4KB7A 3RUBL 2JOQA 4X66J 1GMVA 4HT7A 2M3DA 4USWA 3QJLA 3IFEA 1HNIB 2UZAA 4P1VA 2QGGA 2DRAA 1RT1B 2WBMA 1S9EB 3S1QC 2RS2A 4ILLA 2F1MA 3BZQA 5FLXY 4DS5A 2I9SA 1NO8A 3SEJA 5J1NA 5KFEA 4X4RA 2AX1A 4NLSA 2G1HA 1ZETA 2R7ZK 3K5MA 1D9FA 2OD4A 2NYIA 1IE0A 1EFTA 4XN3A 3NOGA 4QQBA 4YAOA 1NHUA 1FJGF 2YU9A 4M5DB 2J9EA 1OY8A 3H5YA 3BY2A 3UNGC 1YJWS 3KJQB 4II2A 1BQXA 2IYGA 5HKKA 3C8YA 5GMKa 1KKHA 5K9FA 4YB5A 4YXWA 3PRBA 1AA1B 3HULA 1UVMA 3THTA 3ZNUA 4IW3B 3LANA 5FA6A 1DARA 4WZLA 4HI2A 2XGQA 5J2MB 3MM6B 2V4QA 4WE1B 4A3LK 5CYMA 4WCEQ 1D9AA 4DL7A 2ZBCA 4JI1J 3ET6B 3MECB 1A0OB 3NY0A 1S6QB 2XMKA 3T5KA 1BDFA 1Y5IB 3EQLA 3SQGB 4E2FB 5DQHA 3KK1B 1YRUA 4WJBA 3QYYA 5IYDK 2VG5A 2E1RA 1HQEA 1WIHA 1S49A 4XPCA 1RT7A 3KJFB 4L74A 1KMHA 1TL3A 4GMKA 1U0HB 3QFCA 2NSBA 1FWLA 3R7SB 5F3ZA 2IVYA 1K28D 1BWVA 1JLQA 1RHUB 4N41A 4J91A 3A3PB 4HH1A 4R8UA 3G6ES 2FZGB 3NGKA 3AA9A 2KFNA 3ZXWA 3TJ8A 5F3TA 2CJQA 5F8JA 3SLDA 3QLHA 1IKWB 5LMUJ 4GKKF 3LAPA 3MXHP 5BR8J 3HOWK 1VQ8S 1XMQJ 4OX9J 1YK9A 4Q5SA 3BO4A 3FUYA 2KHDA 4DV7F 1VQPS 4RW7A 3DOKA 1S7HA 2KKHA 4PAAA 2R93C 4F4WA 3TX0A 1RXOB 1E6VB 2CQHA 3BKUA 4N77A 3OVAA 4HTIA 3RJMB 3B8HA 2CF4A 1X0PA 1S1VA 3MD1A 3KLGB 4KTQA 3OPOA 4QHYA 2PE3A 2BJDA 4OOSA 1QVFR 1AMOA 4LF8J 4OPOA 4RD4A 4ANDA 1AW0A 2ZHBA 4C11B 2MEWA 4WP8A 4A8WA 4RPFA 3B4DA 3P8BB 3JQQA 3P3DA 1E3ZA 4MKBA 3ZZYA 4WJ4A 3JXOA 3AOAA 2PPBA 2V50A 2B7BA 4O0NA 1FNOA 1Y1WA 4OZLA 2I8EA 2GSOA 3GTKC 2ZUEA 1IJEB 5EX3A 1RAFB 4TN2A 2G2YA 1CJKB 4X62F 3OTDA 4BBRK 1YJNB 3TFJA 3KLFA 2IM0A 5HQLA 2DVIA 1HKAA 4RW8B 4M8LA 2V2VA 1NK9A 2QTLA 3GSDA 1S6PB 2BQRA 1JQGA 1Q16B 2VPXB 6FDRA 5THWA 3GTOC 5SUHA 2BRKA 3K7AC 1JLEB 3HVRA 5E41A 1VRTB 4USTA 4K4VA 1VQ6B 2UVRA 4DPOA 1OGIA 4DV0F 2EFQA 3G05A 2DEIA 3W7BA 3EZ5A 4X64J 1FDDA 3H25A 3BGFA 2OK8A 4DQLA 4K59A 5L1LA 3LWMA 1VQ9S 5KFUA 2CAJA 2PMDA 2CWXA 4BC7A 2YKOA 1HR0F 4Y2CA 3MI7X 5DZ6A 2H4WB 2DHAA 4ZPWR 5C25A 3DLEB 4ZCLA 1RT3B 3GTGA 4FYVB 2LEPA 3CT9A 2W6IA 4DSFA 5HVFA 3DOMA 1CSJA 3MR6A 1HI0P 2VIHA 2PSZA 3HHLC 1HWIA 3HCXA 3IP0A 3V76A 3BCFA 1C2PA 2YNHB 3HFVA 1XR5A 2P6TA 3HJVA 4PPDA 1A6LA 4KAWX 3OL6A 3KK2B 4LFBJ 2OGUA 4A8OA 3PIPQ 1BJTA 1RHKB 4LF7J 1IBAA 2P8TA 3PHEA 3JAMU 3G71S 2WSFC 3PVDA 2QMWA 1K47A 4ATNA 3HHLD 3OVBA 5FD1A 2JA6A 4JB8B 4X4VA 2RKIB 2LP4A 2CPIA 3VO2A 4B08A 1E63A 4NLQA 3PY8A 5A8RA 3MTKA 4HE6A 3W63A 1KFSA 4YDDB 1I8DA 2R7RA 3CCVS 3I5AA 3AA8A 1K73T 4RLEA 3D68A 1GH8A 3DCAA 2B5JB 2CYYA 4DPXA 3ISNC 1NPPA 3A8JA 4F8RA 3OV7A 2MQOA 5ETKA 1P6TA 2YX4A 5HJYA 1Q7YD 3OR1A 2OBSA 2CJKA 5KFRA 2ZH3A 2WSCC 3LGNA 4Y2KA 2MXYA 1RKJA 3LTOA 5DS7A 1YJVA 3HZEA 4GC7A 4AUKA 2E7VA 4S0MA 1TMMA 2M9KA 4KGMA 3ENWA 4BC9A 4M1XA 3HKZD 4TSFA 2XLKA 3ISND 4XNFA 5F0UA 4I6WA 3HVWA 2KWAA 2VHGA 2E1MC 4IOCQ 1USMA 5I3UB 2UV8G 5K8MA 3A8KA 5KFDA 1SH0A 2HIYA 2FJDB 1TUIA 2LEAA 1FWKA 1DLOA 1Y5LB 5A6WA 2AX0A 1LK5A 2WZ1A 1R0CB 1SBRA 1LOUA 2PFDA 2OPRA 2E2JK 1TWHK 1S4MA 4FPIA 1JLBA 3S0XA 1U7LA 1VCTA 4PYDA 3Q83A 4P10A 2OHDA 3R8YA 1QSYA 3WY9A 3OJXA 2R3VA 3ITHB 1CQMA 2YKAA 1TL7A 3KUHA 4KMHA 1S12A 3ISXA 3HHDA 5ADZA 4DR3F 3CC7S 3PHTA 4MK7A 1XR7A 2I1LA 4DR5J 4ED7A 4ZP7A 6AT1B 3MFHA 3ONQA 1EIYB 2MQNA 4BWMA 1FEHA 1YNJA 5L38A 3OEEA 1S97A 2D9OA 3OFHA 1OMSA 2M7SA 3TFHA 1UW4A 2FPHX 4IO1A 5M2RA 1XZQA 1NRKA 2W2OP 5CJ9A 5F4OA 2Q6IA 4B3RF 3JQKA 3WC0A 4XK8C 3N4WA 2YKMA 3G87A 1EWYA 1G7CB 4NLXA 4LVNP 1RTIA 2AYEA 4ECXA 4OINA 5GMDA 1N33J 1XMOF 3P5TL 3WXMA 4NYPA 1RT6B 3WBKA 1SFOC 2P5MA 1RBLA 1SV5A 3GTLK 4XORA 5IK2A 2QGFB 2C77A 4XLAA 2HQDA 4DWIA 5K20B 5HBMB 5A0YB 5BYQA 3KYLA 2DPIA 2MLXA 5CA5A 1IKVA 1L0WA 3PCOB 2ZM6F 4XAKA 1MMDA 4X7FA 2KH9A 1USOA 4DCPB 3V6DB 2B9XA 2UXCJ 4Q0BB 2LA4A 1RSCA 2LU1A 4LRCA 3W5XA 1U6BA 3MCMA 1R9TA 2EK1A 4USMA 3VR6A 4ECVA 1SCJB 1RT2A 5CYQB 1M1KT 3Q0AA 2YQ3A 3M8YA 3EPGA 1FXDA 2G4BA 2CXEA 5D77A 3R6GB 6FD1A 3CC4S 1YJRA 2NR0A 3ZZPA 2O5JA 4X6AK 2DH7A 4CO3A 1JVIA 1S1UB 2H51B 2HBYB 3FZBA 3W2FA 1WKJA 1NJIT 3CCQB 4ELUA 4Y34A 3UCZP 5G0RA 3PUMA 2R6HA 2VC0A 2KHCA 5LSOA 2B63A 1J5EJ 3ZZZA 4X65J 5JMNA 2AEFA 4ES3A 3MM7A 4P72A 2WSSA 3CCSS 1W7WA 1J27A 4EBDA 2FJXA 3MOJB 2HHHF 5C4JK 4C2MA 3CCMB 3CJSA 5FJ8K 3KG1A 4OJ1A 5H9FJ 3MR3A 2XY5A 3MCNA 2FHMA 1C0UB 2HVDA 4P2FA 4QV2A 1SIZA 3T6JA 1HW9A 2PE8A 3Q2SC 3NGTA 2VKZG 1FHTA 1PJ6A 5JBQA 2BR0A 3H0GA 4QJVA 1ZTWA 2D74B 1RU0A 1QAYA 1HA3A 2NPFA 1JLCB 2WJYA 1WOSA 3CNQP 3DYAB 3PTWA 3EZOA 3D6HB 2DITA 3P27A 5IORA 1RTHB 3FKIA 2HS3A 4GVBB 2NVTK 3WDOA 2DKOB 5LMNJ 1KP6A 3ZUGA 2DGUA 3GR1A 1R8CA 4JI0J 4DUTA 5DZ7A 4QIFA 2DY9A 1HWUA 1OB2A 4M5KA 1SM4A 2XLIA 2K1RA 1F5AA 4Y7NK 2LYVA 1PJ5A 4OIXA 2HRTA 1EQ0A 4P12A 3KJVA 2LQJA 3P96A 5EUHA 4NBSA 4P6YA 5A2QU 1FD2A 2R7ZA 2CDRB 2CKWA 3C66A 3V81A 2RDIA 2CPHA 1VQMS 2BJ9A 2CJYB 1GMUA 1YSJA 1WU8A 3WQPA 3M2VB 4WU3A 4RO0A 2JA6C 5F4MA 4TY8B 3KLHB 4LIRA 1C1CA 1ZYRA 2LEBA 3G86A 4G0VA 3VGUA 4K2JA 1VBKA 3S1NC 1LWFA 2AMCB 4DLGA 2NVYC 1RTJA 3D1OA 3BQ0A 4LT6A 3U27A 3FEZA 3NBPA 4QUZA 2AW0A 3Q8RB 2F4VJ 5LSRA 5ETNA 4DL6A 4LF4J 2QMUB 3GVLA 1CULB 4DFKA 3A1YG 1QTMA 2V7XA 1QE1B 2RNEA 4EWTA 1FKAF 2G13A 2XWXA 4CLSA 1UZHA 1JA0A 2J8SA 2ZZFA 2JH3A 3LVBA 3F73A 3CWJA 2GSNA 3BDPA 1UJ4A 2XOKA 3ILLA 5CHPA 3CJ5A 1SI9A 2XY6A 1FDRA 2IRUA 2OPPA 4Y0FA 2IIHA 2UU9J 5M2PA 1VRUA 1JNYA 3W66A 3LGMA 5GAGU 4TU7A 2Y3PA 3W2HA 4K0KJ 5CQGA 3FGVA 1I6VA 3NCRA 4Q4ZA 2JA7K 2OPQB 1OY6A 2RQ4A 4DR2F 1LW2B 1SJ1A 1OB0A 4K5RA 1FT8A 4I4BA 4PCQA 1VJEA 2J6UA 5F8GA 5IS2A 1P9YA 3NMRA 2OK7A 1V3ZA 2YWEA 2QSWA 4Y2AA 4KPCA 1Q79A 4OZ0A 1R0BG 1XZPA 4NE9C 3VAGA 2VQEJ 2IYIA 4CYUA 4XDCA 2DNYA 1CJUB 1H6KX 1QAIA 3K5PA 1J5OB 2X3UA 3BP8C 2JNJA 1VQ4S 4LR2A 3OFGA 4Z4YA 2RSQA 4KKUA 5ITHA 2GIFA 4V1Ak 2F43A 4NX9A 2E66A 1H98A 4EUVA 3V4GA 4C48A 3UDEA 2Q3PA 1CBKA 1FJ7A 4C8ZA 1JXEA 3LQEA 1EHWA 2YQ1A 2X8KA 2HRUA 2KJVA 5C4XC 3GVJA 3L4JA 3CTRA 4I56A 1P4MA 1T95A 1B64A 3G8SA 1JJ4A 3R7BB 3S2DK 1OY9A 1QY7A 4WKRA 1M5PC 3A13A 4F7VA 2HSEB 3AJDA 4A8QA 1IHMA 1RTDB 3AB2B 1MWYA 2A1BA 2IJFA 1KVIA 1VJWA 3M1VA 1RAIB 1TWAC 2D3NA 2D7SA 2OI2A 1KQGB 4I69A 1J9ZA 3HHEA 2MSTA 3UCUP 3KNAA 1FJEB 4RWXA 1WC3A 4W92B 3MTJA 3T9ZA 2OTJB 1JJ2B 5C2CA 4RW9B 2C3UA 4DPWA 3W9JA 4DOZA 3RZDK 4BBYA 2FY8A 5TR9A 4C0HA 3NGUA 2W4PA 3Q2TC 5KFJA 1R27B 3TZWA 3CDAA 1JJHA 2HLUA 2FJWA 2J9CA 3RU0A 1J6WA 3PA2A 2QZ8A 4BXXC 3LA0A 2MY7A 2ZBQA 3DMJA 3AHPA 4PABA 2KN4A 2Y1RI 1LXNA 3MMBB 1JOEA 1R9TC 1YHQB 3IS9B 1Q95G 1CJTB 1EFRA 2VH7A 1DTQA 2ZVIA 4A46A 1EZZB 2FVRA 3GIKA 1ZAXA 4UTGA 4USIA 4HVZA 4OHVA 4LOWA 1N54B 3OR2A 2PLFA 3R5AA 1EETB 2MLYA 2QT7A 3PM9A 1MROA 3L3CA 4ZK7M 2Z2LA 3I96A 2CJXB 4Q8EA 1ZQ1C 1VQ5B 5IP7K 3S6EA 2XZWA 3DXJA 3OPKA 3PKMA 3PRVA 4DR1J 2VNJA 3D6MB 5CYJA 4C2MC 4KM8A 2ZNYA 4M0LA 3SDEA 3C15B 2IBKA 2X3DA 5J1EA 1AXQA 4Y28C 2QA4B 2CZVC 2W7PA 4A93K 4UZBA 5KG4A 3IWLA 5IQ6A 5HJXA 2GVDB 2BKNA 4GTDA 1JLAB 1SIWB 3H0GC 1B4BA 3C16B 3OEHA 4PQUB 2R7SA 2PEHA 1L3KA 4KSEB 5L1KA 3UR3C 1TUWA 1S77D 4NLDA 2DEUA 5KFCA 3FKIC 3BBFA 5HO4A 4NXMJ 4K4TA 2KG1A 3NS7B 5F8NA 4LBWA 2ZOFA 2VASA 2LZJA 5C24A 4C8OA 3DU6A 2CQGA 5IYCC 3GJTB 2V7WA 4MIAA 3VGSA 3FFIA 9ATCB 5GV7A 1NPRA 3BUEA 1Q8BA 1WNEA 2CZ9A 4P3IA 3DDKA 1XC9A 3D2WA 3BDEA 3HVTB 2DY1A 1RA7A 2BE7D 3CRZA 1DG1G 1U09A 1WSRA 4JI5F 1NCLA 2AHOA 3BC9A 5B7WA 3VAMA 4BS2A 3M30A 3SCKE 4LFAJ 2LDIA 1WTFA 2MZTA 4O0IA 2SXLA 4JMQA 3H94A 1FRQA 1KS2A 2DGSA 3RG6A 1XNQF 4DSIA 1AZSA 1UD3A 2YPYA 3BYRA 2A3JA 2CRLA 4OYMA 4KB2A 3M3YK 2HNZB 2YTCA 4A4JA 2POKA 4J37A 1IQTA 3W1YC 4B48A 2GO9A 3TI0A 3UFCX 4L3NA 1F1BB 5LJ5Y 3DYAA 2PDAA 4OI0A 1RTHA 2X7IA 2BGIA 2CPFA 3KHRA 2MQ8A 1SC3B 3JTPA 1WTBA 3DHWC 4WWVA 1FFGB 5KFWA 2DGQA 2A18A 2BJEA 2Q6CA 5AJ3F 5DETA 2UXDF 2CQBA 3R5DA 3W2IA 3Q3QA 1IQ0A 4H4KA 2ZHAA 4NLUA 3GJRB 2IMOA 4EYIB 5KG6A 1HL6A 1RK8A 2ZVSA 2FHKA 1Q81T 4UZUA 2GHPA 4XD7A 4I7FA 1REVB 2VD3A 1FJGJ 4LR9A 2P8IA 4URGA 5GMEA 4LUBA 1OYDA 1FK9B 2ZXIA 4WIIA 1YRXA 2J9DA 3GTLA 1TKTA 1TV6B 2ZEJA 2CQCA 3H2UB 1UPPA 4QFMA 2O5IA 3M6VA 3PKYA 2ASLA 2WOMA 4OIPA 2ZL5A 3VR1A 2E29A 3GTQK 2VKRA 3M9MB 5I4MA 2V68A 1A7GE 2VZ9A 4KY3A 3HZGA 4DX5A 5HMXA 3MHYA 1HA1A 2FQOA 4GRSA 2V8HA 1RQPA 2CUYA 4I2PB 1QE1A 4ZPBA 1FFWB 3V6KA 1U49A 3IM8A 4BY7C 2KTQA 2Z30B 1WG4A 3MEEA 4UZCA 5LXYA 5E3RA 3JSRA 4KV8B 5T7LA 5JVHQ 3BGRB 3TZZA 4KGZB 1RAAB 4RNOA 5L9NA 1H38A 4PG5A 1K73D 4DLEA 5A8KB 3W2EA 2LVWA 3DRRA 4O3SA 4A3EC 1W87A 4PPZA 5FLXU 2Q66A 2Q6LA 2X6XA 1EJ7L 4ELVA 2J0QD 1FD8A 2DGXA 1FTCA 3A3OB 2VONA 4GKKJ 3FRZA 4BLGA 4ZIWA 4FVMA 4X84A 4ECQA 4M5MA 2OPQA 2AGPA 4B3MF 3T6BA 5HLFA 3S1RK 3CO9A 2K7JA 4R25A 2F63A 5LL6d 3QJJA 2LCWA 2DGVA 3ONUA 3LQ6A 2BMWA 2EBGA 3CD0A 2FGOA 5TY0A 4JV5J 2GHWA 3UN3A 4DL4A 3BF4A 1HBNA 3BJYA 4X07A 4FXVA 1UD4A 3G8QA 4TVAB 4JI3F 4R0EA 2XYHB 1D0EA 4IFVA 4GTBA 4HH0A 1OS5A 5KFSA 5IYBC 4FXDA 2B9EA 2ZZEA 1HI8A 1GK8A 4LQ3A 4OYOA 1PO6A 5C42B 4F36A 1O24A 2JFKA 3QT6A 4OHZA 3HSZA 2DXDA 1S4FA 2R9LA 4LFCF 2UXBF 2NCKL 3KK3A 4YDXA 4O4GA 2CQ3A 3ASPA 1SXLA 4UOCA 4X62J 3CC2B 4ALZA 3BQJA 3QIPB 4ZHRA 4ZN3A 3Q8PB 3JQJA 3G82A 2DK2A 2HKEA 4ZITA 3VHQA 5IT4A 3Q6RA 3ZBTA 1RTDA 2NXJA 3KHLA 2CC2A 1M90T 4QCLA 1H73A 4F3MA 1Q5VA 2B0GA 2QN6B 2F3JA 3TUJC 1B2RA 2R8GA 1BD6A 1IVZA 4P5BA 5B08A 3GP9A 5FNZA 2RC6A 1S99A 2ASJA 1AFJA 3R5GA 3SFUA 4QR0A 3M6WA 3TVKA 1HYSB 3HDSA 4F4YA 4IQXA 4FBTA 1BQMB 2HLDA 3HF5A 3CD6B 2HZCA 3QGGA 1RQRA 3Q89A 1NSPA 2OYNA 4UZFA 3IMQJ 4DV4F 4YHHJ 4KFBB 4TQSA 4TQRA 1ZH5A 1RT5B 4RW4A 2OIHA 3J7YU 1GTHA 2B3TB 2JC0A 3Q39A 1U47A 2HAIA 2Y1IA 3A8IA 1MNEA 5FDLB 3UD5A 4ID5B 2V9WA 2BPOA 1U1RA 2OD6A 3QT5A 4A3BK 4OIRA 5JVOA 1E1QA 3G6XA 3GONA 3IC1A 4CP5A 3RZOC 3W9IA 1BHNA 2EKYA 1YJNS 1LKZA 2RJZA 4F3QA 1JB0C 1ZM3A 4LBZA 4QYZJ 1M1KD 4MAKA 4B3OB 2RDJA 3BS9A 2JA7A 4WKYA 4CWBA 2E5JA 4M5IA 5L39A 2LQ9A 2N7YA 1VQ6S 1NJID 3MM5B 3BH7B 4KIAA 2EW9A 4AXJA 4QW9A 1QM9A 3KG0A 4DV1F 2A6HA 2DR8A 2Y0SD 3NWGA 1E64A 1GR1A 3TUZC 3G6VA 3IRXA 5FIUA 1S0MA 3I4NC 4G1VA 3S1QK 3PIOQ 2VA3A 3TO8A 2P6SA 1QLNA 2FTRA 1JLAA 4NEYA 1N07A 4C0OC 5I42B 2V7TA 3ASTA 1FKOB 3I4PA 2KZZA 5TRDA 1JLGB 4H4MA 1DCOA 2W01A 3AH5A 5KT3A 3DU5A 2DRBA 2VPYB 4XTTA 3EVMA 1WEZA 3GIMA 3GTJA 3WNBA 1XXCA 1Q86T 3W5HA 3MM9A 2F8MA 2ZBRA 3BB5A 3LP0B 3DLKA 2R8JA 2DO0A 3CMAB 2XM3A 2ZH4A 2NUHA 1KTVA 1RWPB 1QSSA 5AT1B 4H4KC 2XS2A 5DDPC 1TL5A 3GV7B 2OFGX 2EKNA 1J98A 4WTOB 2YX1A 4LSZB 5KOXA 4RPBA 1Q78A 1U2FA 4LBVA 4ENOA 2ZKTA 1TVCA 1X8DA 4NCGB 4DX7A 3THPA 1VR6A 1FCAA 1TZ0A 2DO4A 3OFEA 1X0FA 5C5JA 1ZA1B 2MB0B 1QJHA 2C3PA 3T01A 1BJKA 3W2VB 2V31A 4HYKA 2UP1A 3MMCA 4DR3J 3OJUA 1NHKL 5D3GB 2HNZA 2KT3A 2VBZA 3GQCA 3FQKA 1BX1A 2MTLA 1X31C 2CA9A 4RD6A 4F4XA 4AXIA 2HMAA 4HDGA 1F60A 4N3NA 1H85A 5KW9A 4D3HA 2EVZA 1X5TA 1WORA 2FC8A 2R2RA 2R93K 1QUFA 4B3RJ 4CO5A 1HI9A 2DETA 1VQSA 2YNFB 2ZH2A 1IM6A 2ZJQQ 2G1DA 2V94A 4YFKA 1R8BA 4O3OA 3DLJA 3D6TB 4YQWA 3D9BA 5EWGA 2WONA 1XMOJ 1TVRA 1R8AA 4WFXA 4N76A 1AYEA 3QO9B 3R5CA 1WSVA 1LWEB 2GIQA 2FX3A 1AROP 1T03A 3FCVA 3U6BA 4QIWL 5KFYA 1PJ7A 3GYGA 3CMEB 2I38A 4NLWA 5MAOA 4F0HA 2VPZB 3R7NB 3BM7A 2K3IA 2ASYA 5IXUA 1FFSB 4LSNB 4H9GA 2RQKA 4Z4TA 1GT8A 3M32A 4F0MA 2GVZA 5L46A 1NJZA 1E79A 1FWPA 5HI7A 2BW7A 4M5HA 2OTLB 2QSFA 3NOCA 4DMZA 4FYWB 1QD1A 1S9GA 1NDHA 3M7VA 2PA8D 2RB7A 1FI4A 4IH7A 1IS1A 4FN5A 3K7AK 4NNJA 2QYCA 3DGPA 1QFYA 4RD2A 2CNLB 1NH8A 3PO3C 2DISA 3RGIA 2FQQB 4PWDA 1DQ9A 1FVQA 4KMAA 4C7QA 1QUEA 4KT0C 1HBOB 1IBMF 3MOZA 4H54A 4BY1C 3UQSA 3TAMA 4NLOA 3SXLA 1HI1A 2AJ4A 3OHAA 3S2HC 2HHHJ 2MHNA 5IYPA 4XIUA 5KT6A 1F6TA 1S6OA 2DNKA 2MSSA 1TTHB 3IR5B 4LF9F 2XSJB 2W24A 3K5OA 1S5ZA 2I5JA 4XN0A 3TARA 4X2BA 1E3XA 3H2LA 1IBLF 1TLLA 5GAEU 4G3IA 2GX8A 2JVRA 3H59A 4J9LA 4QPXA 2Q79A 2MKHA 3IG1A 1N5QA 5J2NA 3BBBA 1AUDA 3L7PA 4U8VA 1Q0NA 3K89A 2P2CB 5H9FK 2CNOB 3RZAA 4QVAA 5JFEA 3QSYB 3EVOA 3IXQA 2MLZA 1SL1A 3DRSA 2R7TA 2HS0A 4DV5F 1NUEA 3DRXA 1H72C 2RF2B 2XNRA 1YVFA 2PD1A 5M3MK 1X4CA 3OXFA 4WFNQ 4NLRA 4DQPA 1K0TA 4RCZA 4H4OB 1ZS6A 3TQEA 2Z57B 3VALA 1S1XA 2H65B 1HQUB 1WF0A 2UUCF 3MUTP 5K8OA 5F8IA 1KQSB 2FJVA 1RABB 3S1MC 3LAKA 2CQDA 2KXNB 2VBUA 3NCQA 1UZDA 4PWWA 1C0TA 2MJUA 4XONA 4CT8A 3HLUA 4O44B 4RWWA 1EI6A 2JX2A 4RD0A 5H59A 4ETXA 3CCMS 2D3LA 5DM6Q 1GMWD 1V0EA 4CTAA 3PW4A 3CW2A 4TMWA 4B9SA 2C2KB 5DG8A 2LQBA 2CQ1A 1N8RT 4DV2J 3NXZA 3W8PA 1WHVA 1M5HA 2HQ3A 4J9QA 4KGXB 3U1NA 4OZ1A 1GAOA 2PO4A 1YI2S 4ER8A 4DNRB 2OEMA 1V9OA 1M5KC 4CIOA 4LRAA 2W9BA 1O5JA 4Y6IA 4TYBA 4G0UA 4MFBB 4L72B 3GTJC 4EO6A 4DQRA 3NGRA 2A6OA 2UUAF 5IM0A 1Q7LB 2W1BA 4ZJOA 2D3ZA 2C42A 1T7PA 2JJ1A 4DR2J 4LBHA 3L4KA 2HWTA 1KR4A 4PKDB 5HVGA 2BVZA 4B3OA 1JB9A 2CPDA 1UD2A 2PN6A 3J7A1 3JB9k 3V4IB 4ZVQB 2Q6BA 3EGNA 1RAHB 3N6LA 3NLCA 4F4ZA 2C2OB 3ZTSA 2DNMA 1CEZA 3QGHA 4X4TA 5GADU 3NL0A 2CQ4A 2VBXA 2ZD1B 1HHTP 3MMAB 2CW5A 3O6QA 3SV4A 2BKPA 3CESA 4Y52C 4NI2A 4LVOP 1NU4A 3EDQB 2IY5B 5KFNA 1C1BB 4Z4ZA 1KHVA 4OX6A 2CPXA 1Y00A 2Y1JA 2G2OA 2QYGA 3UN2A 4AL6A 4B9MA 2GGPA 3S01A 2YNGB 2WAQL 3TQ1A 2XTJP 3M8PB 3MAAA 1KD1T 3BQ1A 2B56A 2XEXA 1QUVA 4ECUA 2RHSB 3CB4A 3VO1A 2CNDA 5M5WK 2ZZTA 2CADA 2HFNA 1QAJA 1NAQA 3C14A 3KTQA 4HI1A 2BX6A 3QAUA 3QGIA 5A2QY 1NK5A 2KT2A 1PBUA 3N0CA 2CK3A 3OW2B 4C9DA 2NZCA 3QE2A 2DNRA 2D41A 2IRYA 1Y1VC 2F40A 1YIJS 5K5MA 2MKKA 1H7WA 2AIRB 5H9EJ 1BLUA 1VHOA 2F7VA 1EARA 2VDHA 2VDIA 2PI4A 4JYAF 3KOAA 4ILDA 2B9YA 4ECSA 5M5YK 3DDNA 3CCRB 2L9NA 4FXWA 3C6UB 1AB4A 2LQ5A 4WF9Q 1VQNB 5AN9A 4NZ7A 4Y00A 3W2WB 4EMDA 2OBTA 1T3NA 4FKXA 2PA3A 4NCBA 3BPDA 1WELA 4HT5A 2CDQA 1YZ7A 3TJ9A 2R7WA 4YELA 1Y1WK 3QJPA 2F4FA 1VJQA 2GJIA 4JI6F 4NEZA 3GR0A 4MT1A 3MGJA 3ZC4A 3M9OB 4JI2F 1N88A 1I7PA 1YJ7A 4UUWA 2ZH6A 1MABA 3W3SA 3TZYA 2BVNA 3BQ2A 2V2KA 4TN1A 2E5IA 4ZS6A 2J0SD 3PEHA 2HMIA 2DERA 1Y7PA 3AQPA 2J8AA 3CE8A 2KJWA 3L4BC 2M2BA 2KYXA 3PR5B 4JUZA 3N0VA 4DV6J 1RWVB 1TFYA 1S1WB 5A8WB 1YLXA 2JC1A 2YWKA 2ZE2A 3M2UA 1GVHA 4NZ0A 3POTA 4UOHA 3B54A 2ROGA 5A76A 3KMQA 4XSXA 1EFWA 2QA4G 1RT4A 2W8KA 3J81U 4XLEA 5D0RA 5J1PA 2OTJS 5DDOC 2BE2B 4CM2A 4FBUA 2R92A 1SL0A 1IJFB 4EEYA 4LF2A 3RYLA 4DI6A 2D3OR 4DDQA 4EH1A 5LJ3Y 3ISZA 5DRKA 3GLJA 1TFWA 1ULRA 2MGZB 3QFSA 3IR6B 3OFFA 2QLJB 3NKYA 4Z4VA 2L41A 4B47A 2DNHA 2RVJA 1TELA 1N4LA 3AXMA 1F9EB 3VTIA 1X5SA 4QPTA 4LQ9A 3FZ2A 3RW7A 1YHQS 3OSNA 2GIRA 3AD7C 2JA6K 1FRJA 4FYDA 2VBSA 4EBEA 5FLMC 4JK1A 3GTMC 3NAIA 4OI1A 3S1NK 1YJUA 1YITS 5BSYA 3AY0A 1ELOA 1JNRB 4USVA 4PC2A 1RBAA 2AJ0A 4U95A 4C3JC 5IFMA 3BSOA 4JI5J 1VQ5S 3MCOA 1SC4B 4ED3A 2DR7A 1I3QC 1ZM9A 4ZPAA 1O27A 2IMWP 2VNKA 4C0SA 1N6QA 4W90B 3OBIA 3OD2A 3IPJA 3FOEA 1Q8IA 1DRZA 1XNQJ 3MEGB 3N0BA 5ETPA 3NS5A 3R3TA 1S72B 2PMZD 4K4ZA 4ROXA 2QA4S 4P9SA 4RUAA 3IRWP 3CCES 1I94F 3N01A 1UP1A 3UVJB 1ROFA 4A3FC 1T9XA 3S14C 3PFEA 4OQJA 1WCMA 3DNCA 2JIZA 2L08A 5J2QA 3JSMA 1HWJA 1DCPA 3GV8B 1S10A 3SBMA 1B7FA 1LK7A 3IAS9 1K44A 4CO2A 4ZP9A 3ASSA 5J3OA 2C3YA 3HMJG 5F8MA 1SUQB 1U1OA 2VUMA 2LXFA 2KB2A 5AJ3J 3MAHA 2UXDJ 2R93A 2CQPA 2YKNB 3K8VA 1LWXA 1NBMA 1H2UX 3TNVA 5DG7A 3VQSA 4H4OA 2B4OA 1JJ2R 1KVJA 1VIXA 4R5PB 4B3GA 2QL9B 3TANA 3CMQA 4C4WA 3ADAC 2OP5A 2A6MA 4C6AA 3I56S 2C4UA 4KYZA 2E7XA 4FF4A 4OJGA 2I6WA 2XB2D 1M0SA 1MLAA 3RTVA 5C4XK 2IC3B 4MYUA 1RDRA 2FVGA 2GQQA 2H1YA 3GTKA 1YLOA 2Z2MA 1RHJB 3WIVA 3IBWA 1Z2LA 1KDNA 3G4CA 2YKQA 2N4DA 3WBJA 2XMVA 1NJXA 3RAQA 3AT1B 4OX7A 3EVWA 1N36J 1S1TA 3OPFA 2IA0A 1HQMA 2OELA 3SJZA 3GTOA 1HIYA 1UW9A 4UUXA 3B78A 2B7CA 3Q8SB 3H98A 3E51A 1LFWA 2YQ0A 2VUGA 3KFWX 4OFZA 3I32A 1SC1B 1Y10A 5IYQA 3JYTB 1HD1A 1CS4B 2RRBA 1YTYA 2UUTA 1HD0A 1KRHA 2QA2A 1UPMB 4EZ6A 1T05B 1OB5A 2NXCA 5E2QA 1KK2A 3FRYA 4TMTA 4B3MJ 4NA2A 4I2QB 1S4EA 1N5VA 3NS6A 4L3KA 3US5A 4BXXK 4OZJA 3QZ8A 3SEOA 4B17A 1N5YA 2F1LA 2GJKA 4MKAA 5CXTA 3W5UA 5IYWA 1CJVA 2JA5A 4IDKB 4L8JA 2GHVC 5CAAA 4ZDNA 1R9TK 3I0RB 1YBUA 5JJBA 2GJPA 2X51A 4TY9A 4V19X 2CFAB 3I5CA 1BGWA 3CJ4A 5C44C 1MW7A 5IT0A 4A47A 3W60A 1MU2A 3RAXA 3HJFA 2BRLA 1VQPB 4F26A 2FJAB 3DM2A 2VA2A 3VAJA 5L8RC 2FHJD 3JU4A 4GVLA 1C1BA 2NPIA 2E9RX 3RR7A 1SKSA 2KU7A 1XR6A 3HHLA 2WB4A 4KAIA 1HNWF 3C6TB 1Y3KA 2JLFA 3P6YC 3BPSP 2XZOA 2B43A 4AL5A 2GC8A 1E6YA 3CJKB 1X9MA 5B0AA 3LO3A 1W25A 2UXBJ 1KK1A 2OKQA 3H0PA 3I0SA 4X05A 3UN5A 5H1SV 2OSRA 1K8AD 2U1AA 2YNIA 3DI6B 2HNDB 4Q7JB 4P22A 1FXLA 5ETRA 3KLIB 2A69A 3TVZA
chains in the Genus database with same CATH topology
3TFIA 1YX2A 1WSRA 3A8IA 3AD9C 1PJ7A 3GSIA 3ADAC 1V5VA 1VLYA 1PJ6A 2GAGC 3TTGA 4P9SA 4PAAA 3GIRA 1VRQC 1XZPB 1XZQB 2GAHC 3TFHA 1WORA 1XZPA 1XZQA 1WOSA 3GEIA 3GEHA 1WOPA 3AD7C 1VLOA 1WOOA