1WSVA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
371
structure length
371
Chain Sequence
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aminomethyltransferase
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
total genus 117
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsvA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsvA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsvA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsvA03
1PJ6A 1NRKA 1WSRA 1X31C 4P9SA 1WOSA 3TFJA 3GEIA 1V5VA 3A8JA 3AD8C 4PAAA 3AD7C 3TFIA 3TFHA 3A8IA 2GAGC 1WORA 3GIRA 1WSVA 1WOPA 2GAHC 1PJ7A 1XZPB 5L46A 1YX2A 1WOOA 1XZQB 3GSIA 3AD9C 1XZPA 1VLYA 1PJ5A 3TTGA 4PABA 3GEEA 1VLOA 3A8KA 3ADAC 1XZQA 1VRQC 3GEHA
chains in the Genus database with same CATH superfamily
1IBCB 3GTGK 1H74A 2XHWA 2MLYA 3J7YU 3D3CJ 4TLRA 1KHWA 2NSBA 2H54B 3LP2B 4YHBA 4B3RJ 3G8SA 4JI1J 3EGVA 2RS2A 1Q7YD 3GIMA 1VQ9S 3TUZC 4M5HA 5C4JK 4E0FA 1XNQF 2HIQA 3NGUA 4CLZA 1WQFA 2D69A 3SDEA 4NI2A 4J90A 4YELA 1N34J 4ES2A 3V5RA 2PI4A 4G0WA 2V0NA 3ZUGA 1QGZA 3JS9A 3EICA 4FYXB 2QEXS 2B8QA 2ZH1A 4GRSA 2LQBA 3OBIA 3M8PB 2C28A 2MQPA 4V19J 1DCPA 1Y1WC 1REVB 2GJ2A 1JLFB 1GE9A 3UN3A 3W2WA 2R8GA 5IYWA 4F4WA 1T3NA 5KFXA 4Y9UA 4CRJA 4B47A 4IG0B 5F0WA 1URRA 4JI5J 1L3UA 4DL0C 4F3QA 1NAQA 3I0SA 1XIQA 2AGOA 2Z58B 2UUCJ 4ZPVR 4YG2A 4X4TA 4KKOA 1IJEB 1Q86T 3AB4B 2DHGA 4NOHA 1QSSA 2BRKA 4FKYA 2YKNB 2YWWA 2OKQA 3GPAA 1TK5A 4HYKA 4IDKB 2ALZA 5IC6B 2JA5A 2QL9B 4A3KC 2YY3A 4FVCA 4Q7JB 2VU5A 1WUUA 3BKTA 4OV6A 2RIJA 1K83K 2BE9B 4IH7A 4KGKA 4NLWA 2FJAB 3R7SB 1HBNB 4KDDA 2AEFA 4QU6A 3BO4A 1RTIA 4X4VA 5A2QU 2V2ZA 4USHA 4P71A 4UUXA 1IXKA 4EWTA 1U1LA 4MTPA 1Q81T 1JQWA 3CCVS 4DV6F 1NDLA 3RAQA 3IWLA 1XMOJ 3FEYB 3SZZA 2P3MA 1TV6A 2CQGA 5IS2A 1IM6A 4X6AK 1SKUB 4ILMA 5HK4A 3LH2S 4LBZA 2A18A 4ZHRB 3N0VA 1LWCB 4UZCA 2KM8C 1DLOA 2J9DA 4B3RF 2MKSA 1B4AA 1S4FA 4WJBA 3MCMA 4G7XA 3P3DA 4CI0B 2X1AA 3K8WA 2ZUFA 2RUSA 1GTHA 1YLXA 2QLFB 2V9KA 5J2QB 1N34F 5LSLA 3CMMA 3W2HA 1Y1WA 1E6YA 5C24B 3H90A 2C4TA 3N5BA 1B64A 2Y0SD 4WFYA 2HQCA 4X66F 1N05A 1NMEB 1HARA 3EVMA 2GAGC 2VA3A 3TEGA 4RW4B 1FO1A 3H2VE 3ONYA 4A3IC 4LQYA 5HZAA 1KDNA 2QSFA 3MEKA 2YWHA 5EHHA 4CLYA 4PXCA 4DSJA 4ETXA 4LF7F 3HD1A 2UV8G 4BXXC 1X5OA 1TWHK 5J3OA 2OPSA 1RT1A 1NKEA 2DRBA 1WQGA 4Y0FA 1QVFB 3HKZD 1Q79A 4B3OB 3D2WA 3W5VA 1GO2A 2V2QA 4FNIA 1L3VA 1U1MA 3S1MC 4DL2A 2UUCF 3OEEA 5BJRA 3D28A 2CQDA 4LSNA 3CD0A 4YHHF 4X62F 3RRHA 3HXMA 1R89A 4X65J 3NCPA 2DNKA 1RT2B 3UFCX 3GTMC 4KAWX 2DISA 4B08A 1F93A 2JSXA 4K4UA 2FC9A 3AVTA 3W5XA 4AXJA 3HX9A 3S1RK 1LWXA 3QFWA 4AQYF 3GQBA 4CO2A 4S0MA 4CLTA 5F3ZA 2DETA 4C8LA 4CLKA 2W9BA 2VFVA 3ASSA 4NX9A 5H9FJ 3I1FA 2OK8A 5ETNA 2BW2A 3HFVA 4P2XA 1N0UA 2P8TA 1XMOF 4A8OA 2RS8A 2UXCJ 1LWFB 4YFKA 3S1NC 4RJVA 3IO1A 2DGWA 1I3QK 2NVQK 1Q4RA 3HVRA 5ETKA 3UD4P 3SLNA 1KSPA 2E9RX 1TZ0A 4OIPA 1G7SA 1FDNA 3UN2A 1KJZA 4NI2B 4MIBA 5KT5A 3NGSA 2LDIA 2PMZD 3H40A 4RW8A 1R27B 3B78A 1E3ZA 2YKQA 1DURA 1S0OA 4FP9A 4KBIA 5CHCB 2HBYB 4ZGQB 3DYAA 1CSJA 2CUYA 3PY8A 4KB4A 1H2UX 4RD4A 5CYQA 2M3DA 1B2RA 2FD2A 2B56A 2KI2A 5B0GA 3J80Y 5TMFA 3W2WB 1EJ7L 3N79A 3NY0A 2ZM6J 2R7ZK 4ACBA 2KKHA 2OAUA 3EXYA 4NLGA 3HD2A 5B0BA 2KL8A 1R6VA 2PA8L 4OZ0A 2FVCA 3G87A 3PFOA 1J2VA 3L7PA 3IR7B 1DARA 4YFXA 4UT4A 4DCOB 1JQGA 4DZ6A 1Y7PA 3LUYA 1VHIA 2XYGB 4ZVTB 4YDDB 2GHWA 2NZ4A 3DM2A 2UUBJ 4ECRA 4RW6A 3GTMA 1NZAA 1PKUA 1Y00A 1EXMA 3OJWA 4HE5A 4OHXA 2RDJA 5LSRA 3KYLA 2YKMA 2IFXA 4GTFA 2KB2A 1K8AT 4OI6A 1RTIB 4X65F 4DMZA 1SC1B 3D6FB 4KC6A 1ZQ1C 4OX7A 4DPUA 3V2UC 1P1LA 4U9RA 2LEAA 3QAEA 5THXA 2E1BA 4YR0A 1WNEA 1TV6B 2D9RA 2XNQA 2NVYC 3CWJA 5KFNA 1WG4A 5IWAF 2V94A 4XNFA 2OTLS 3EJMA 4WFNQ 4DSKA 3SKBA 1PYOB 3W2EA 3A12A 5D4LA 2H4YB 3T1YJ 4UZFA 3CJ2A 2DY9A 3J81Y 1DTTA 4R8UA 1U6BA 2W6IA 3S2DC 5FNZA 1CEZA 1IUJA 2HK2A 2OHDA 1DLOB 1VHFA 2CG4A 2IA6A 1QDUB 3SV4A 4PQAA 5C2CA 3HOUC 1T8EA 1KLMA 1O51A 1O25A 4ZVUB 2VOOA 3OREA 2GGPA 4LBPA 3C3LA 3NGDA 5IP7K 1HWLA 5K14A 4C3LA 3QJPA 2VJUA 3H2LA 3W63A 2DNRA 5H1SV 3BH4A 4G7WA 3D0HE 5LXRA 3UR3C 1VRUA 2G2ZA 4M53A 4DV7F 4DXLA 3AVUA 5AT1B 4A3GK 4L74A 2NUUG 1GMWD 4ASUA 4GKJJ 1ROFA 4RNOA 4YQWA 2OYNA 1CJKA 1ZM2A 1G3OA 2PHCB 3CCEB 5EX0A 3LGMA 4A47A 3IA0A 2JEFA 3FMWA 5D4PA 3JQMA 4O3RA 2CWKA 2QJ3A 5D6GA 1V3ZA 1FTCA 1M1GA 1RHQB 4OJHA 1AUSL 1PAEX 2LMIA 2MEWA 4OI2A 2CW0A 2VOPA 4N8OA 4LSNB 2EG1A 2X51A 2BW7A 3EX7B 5DDRC 5B0CA 1YJ9B 2ZEJA 5H9FK 1WTHD 2Z56B 1EI6A 1T11A 1JLAA 2UUBF 5HL8A 1G51A 5LL6d 5IOLA 9ATCB 1FD2A 3DDKA 3TNVA 2V31A 4XLEA 4ANEA 2EFNA 4JI4J 3OT9A 2DY1A 2W01A 3A8EA 5KG3A 2NVYA 1VQLB 1HBOA 3CSKA 2NLWA 4WP8A 2B8PA 3VAGA 2XM3A 3AJ2A 4X8IA 3LGHA 2W9BB 3R5GA 1CNFA 2ATCB 5GAGU 3KUHA 2O66A 3HOYK 5EN1A 1TVRA 2DNLA 2KM8B 2W4CA 5HANA 3M8WA 5DSZA 1NDPA 1VS3A 4LSLA 3AHPA 1FEHA 4N7TA 1M0SA 2VZ9A 3R2CJ 1T05A 1YDLA 3R2DJ 3G2XA 4QHYA 5FDLA 3ILIA 4OZ2A 4RW8B 3T1YF 4DV1F 1TWFK 2V7TA 3UO0A 1DY3A 1JXLA 1EFCA 2Z0GA 4IG3B 4X4PA 3D5MA 5EX3A 1C0AA 3ZZRA 1LWEB 4ECYA 5AJ3J 4TU9A 1GMUA 1VQKS 1RAFB 2VUGA 5CYQB 5KG0A 3H4BA 2AJ0A 2V2KA 4NRUA 1WC3A 4LVNP 3CD5A 1KP6A 3H3VL 4CQJA 1S48A 1SKSA 1P9QC 3I4HX 4KH0B 1I8DA 4GVBA 2ZXIA 4CO3A 1F1BB 2E44A 5IYCK 3VALA 1BC6A 1ZZFA 4GKJF 4KIAA 2YPZA 4C3JK 4WTYA 4F0KA 1U2CA 2BANB 1FXRA 2GK7A 1JKHB 1JLCA 2VJIA 5HP1A 5CJ9A 4G7ZA 1OJ4A 4F7DA 3Q8YA 3OXLA 1VJSA 1UD5A 3KEWA 4H9GA 5EWFA 3BPDA 3DM2B 3BH7B 1VBKA 4RW6B 3CGIA 4N3NA 2IM3A 3UD5A 4QJVA 2XYHB 3CC7B 2VBWA 1L3TA 3LNNA 2NVXK 1SC3B 8RUCA 3MCNA 2ZBPA 3BC9A 4DL5A 3W2VB 1VISA 4Y6IA 4QWCA 3M3YK 1XB2A 3IM9A 3GIJA 1OGJA 2DGOA 3TA1A 1Y5LB 3AXKA 3L4KA 4JI4F 5KFYA 2NZCA 2LFVA 3CIZA 2RF2A 2OUGA 3WNDA 4Y2MA 4NE9C 1YG0A 1PKVA 2HVDA 4R8UB 8ATCB 1NHVA 2Y1RI 2DEIA 3FPKA 1SB6A 1HA3A 1SI9A 2VBXA 1IKYA 1KLMB 2GNKA 2Y1LB 2VZLA 2J0WA 2GGPB 2YH0A 3H5YA 4A3MK 3NOCA 2R3VA 2BRLA 4DL6A 1PCAA 5CAAA 2NR0A 1VRUB 1RAIB 3SQGA 2VFUA 1VHOA 3RGIA 4KATA 1QTMA 4NCAA 1JA1A 4C11B 1UZHA 1TL1A 1E1RA 4ZOSA 4BWJA 5L1IA 4LF4F 4HH0A 3ES9A 1X5TA 3CMAS 4LF9F 3PA1A 1Q7LB 5B0AA 2IJRA 2H5JB 4NLXA 1AROP 1W87A 3KLFA 1CJKB 3BEGB 4ATNA 2C2EA 3EWGA 5C42A 4RW9B 4WE1B 4B9UA 3A1PA 1UPMB 4KH1B 4C98A 1HBMA 2JJ2A 4ECSA 1W0KA 1N8RT 2VC1A 1K9MD 4A3EC 2GX8A 3NGRA 3NMRA 4Z4ZA 4ENOA 4UOHA 1F3VA 3TOQA 3OZVA 1W7WA 2V8VA 2HMIA 1BQNB 1RKIA 2UXDJ 1JLAB 1D1UA 1S9GA 2FHJA 4RCZA 3PJ9A 2FQOA 5E3QA 3A1YG 1JJ4A 1VIXA 4N41A 2DNQA 3FVYA 4ES3A 1WG5A 1SKYB 2YKPA 1ICEB 4EZ9A 2CQ0A 2XMUA 3CJ3A 4HDHA 3HLUA 3L3CA 2DYIA 2XNJA 3OFHA 4MKVA 2CPHA 3BKFA 3OPOA 2G2OA 4P75A 2KFNA 2ZE2A 2IC3B 2WVCA 1N07A 2CJ9A 3UD3P 3G6ES 1TVRB 2DO4A 4DOZA 3CESA 4PKDB 1H8HA 2B9WA 4F04B 5E3RA 3DRRA 3D7SB 3I4MC 1EFWA 4EGLA 1KQKA 4LRBA 3QFCA 2NPIA 2D6FC 1VQPS 1HI9A 3H5XA 3FMBA 1H73A 1T05B 4ED7A 1VQ7S 2PA3A 2J7KA 5FDLB 2MLZA 3BO3A 3HK2A 2BVNA 3HKZL 1P27B 5C3EK 3J81k 5L1KA 4JI0J 3S6EA 2EPIA 2LEPA 2FHOB 3DRSA 1IW7A 4LRDA 1J5EJ 1U1QA 4OFZA 3V81A 1N08A 5H59A 1RTJA 3PW2A 2DHHA 1T5EA 2Z2ZA 3M1VB 3T1HJ 1A7GE 1T6XA 5LXYA 2JHEA 1L3KA 5KFCA 3E8OA 4F02A 4GZYA 4X4QA 2YQ1A 3CUNA 2QDXA 4USTA 3GTPC 3CPWB 1RQ0A 4QYZJ 3SCLE 1JLCB 1A8PA 3T53B 4ELVA 2GA7A 3WQZA 3HF5A 5LMNJ 5HP1B 3DC2A 3BSAA 1COWA 2A0FB 1WF0A 5A2QY 2HVZA 3B6BA 2HAIA 1AYEA 4QJVB 1S1XB 3PRDA 2JA5K 2ALYB 3G71S 4QU7A 2DJWA 3N6MA 3Q8PB 3Q2TC 2BJ8A 2C22A 4DR6J 3MMLB 1JNZB 2UXDF 1I6HK 2GJIA 2K3IA 2GC8A 2EFQA 4YAFA 4C3MA 1F3FA 4OYWA 3T19A 3ITHA 2VASA 3J7A1 3IR5B 5F8IA 1RK8A 1BD6A 1VQOS 5CABA 3JAMU 3POTB 4KY3A 4ZK7M 1HD0A 2RF2B 3J7YI 4Y28C 2FUG9 2C3OA 3CC4S 1Y10A 2DITA 2Y3PA 1EHWA 1YZ6A 2ZBVA 1ITPA 1VC6A 5EWGA 5CQGA 3ENQA 2P6SA 2RT3A 1KQSB 1IKYB 1IBKJ 4KMDA 3OLBA 1I50K 1M1HA 4QVAA 2IPOB 3NWGA 2MB0B 2HLDA 3MPVA 1VCTA 2N3LA 3MPUB 2NXEA 4KHRA 4KN4A 4L72B 4WJ3M 1QAXA 4FZBA 1S6OA 2PDAA 3DOLA 1SIZA 1N56A 3ILLA 3JSMB 2BE2A 4B43A 1Y1WK 4WZLA 5D4NA 4DQQA 2HHVA 3H42A 2M70A 4B3XA 1J98A 1Q1KA 1UEVA 4DK1A 2ZVSA 1KLNA 1EH1A 4KM9A 4ZVGA 1RTHA 3GTPA 1IR1A 1SKQA 4M5DA 1HBMB 2EK6A 5ETOA 1JLBB 3CCMS 3THPA 2ZVIA 5KT3A 4NZ0A 4ACAA 1SFOC 3BZQA 3PIOQ 4ZVQB 1OPIA 3O2IA 3IG1A 4WFXA 3H8YA 1KKHA 2GO9A 2H51B 4RUCA 5LMNF 5TY0A 4P7VA 3R27A 2GREA 2HMIB 3HCXA 4X2BA 3ADAC 2PI5A 3FOFA 2X1FA 1F9HA 3WBKA 1X4AA 4ED4A 1KBRA 1Q9SA 4KGZB 3OR2A 3TFIA 1U48A 3EDRB 2ZH3A 5IORA 4X7FA 1Y11A 2V5HG 2XCQA 4P10A 2BKNA 2EKNA 3I5BA 3R5DA 2ZOFA 4DR6F 2E2IC 3EUNA 1H3DA 4LBWA 4A3BC 3QJLA 2CQ3A 1F9FA 1S10A 2C5HA 2I5JA 1XERA 2XY7A 3AA8A 1IHMA 2PE3A 2CRLA 3DRRB 3ZZUA 3KK3A 1RKJA 4M5JA 2DEUA 3UCZP 2XCOA 1UW4A 4H4OB 1FVQA 4TXSA 4ZPCA 3CTRA 2JL9A 4CIOA 2OTJB 2WVFA 5C4XC 5E7OB 3QRQA 2B9EA 1RA7A 5ETQA 5U47A 5F8GA 2QTWA 2R7SA 1VFJA 3DRSB 2QIFA 1WC0A 4JBCA 1BQMA 4QYZK 4QWEA 3QQCD 1U2RA 3V81B 1EQMA 4CQ1A 1U0SA 1RTJB 1OMSA 5J2PA 2J6SA 2AWZA 3PNIA 2FLPA 5D3GA 3Q0AA 3S17C 3BREA 4A3IK 4B02A 3RR7A 4AXIA 5FO0A 5D15A 5J1EB 1Q78A 4LQ9A 3AH5A 3NS5A 4L8JA 4MEYA 2KVIA 2ZTGA 2Z2MA 2KG0A 3OFNA 2CPXA 4OYIA 3G6VA 4LFAJ 2ILZA 5H5JA 2JLFA 2VPZB 3FZ2A 1YJWS 3W1YC 4BXXK 2DHSA 5FLXU 4NCGA 1SFOA 1ULRA 2AGPA 4LK1A 4MKAA 3ZTQA 1MN7A 3LQ6A 3PACA 3FCVA 3SYZA 2A6MA 2MZQA 2WBRA 2KTQA 1BPLA 3GCWP 3S1MK 4WFZA 4ZLJA 1TU0B 2JEJA 1ZAVA 2E5JA 2M9KA 1EKRA 4LF5J 1RADB 1RACB 1W35A 1ISEA 4IW3B 4HHUA 3DOKA 1RWOB 4I7FB 2BSAA 1S12A 3A4TA 1JLEA 3G9CA 4NXNJ 2OIHA 3RG6A 3I55B 4L76A 4DV0J 1Y1VC 2E2IA 4C3IC 1X8DA 2QYGA 5GAEI 3I6PA 4YB7A 2JJ1A 1BLIA 2ZZMA 1UJ5A 1WDTA 3ITHB 2NVTC 2Y8YA 2MXYA 2DR7A 3HM9A 4ANCA 1O28A 2YNGA 4O3NA 4R0EA 3PIPQ 3KJFB 5DM7Q 2I8EA 4TMXA 1S97A 1X9SA 2UXBF 2AEJA 1XMBA 2XMWA 4DPXA 2WK4A 1UVKA 2J76E 3UI3A 1SKWA 4G1VA 2CVIA 4QQBA 3IM8A 4N47A 3S1NK 4C2MC 3HAGA 2N82B 3MFIA 3W60A 2XI3A 2W2PP 3CCUB 1W2IA 4TQRA 5KT2A 3FBCA 1YITS 2GQQA 2LU1A 3ASTA 3NNCA 3MM9A 1UWBA 2LA4A 3DOLB 5L9XA 5ETMA 1MWZA 4A3FC 1TUVA 1YIJS 5CHPA 3GSIA 1EFTA 1INNA 4HKQA 1S59A 4EK2A 4P22A 4OV1A 3N28A 2ZBCA 3CJTA 2GJPA 4E2FB 1RTHB 3MUTP 2OP5A 2CDRB 1UWAA 1T9WA 4FYYB 2JA6C 2V7XA 2IVMA 5FJ8K 4P73A 4G1BA 4PWWA 2KT2A 1P9YA 2YX7A 4XSZA 3PVDA 3CJKA 3UCUP 4HH1A 2OEJA 4NA1A 3IG1B 1X4FA 2ZZQA 3PG9A 1X7VA 1SPBP 4XMYA 2OBRA 1BWEA 1NSPA 4OI3A 1RT6A 2HQDA 3CCJS 1S0VA 1RAHB 1Y1VA 2GVDA 3DRYA 4G6VB 4F2RA 3W5HA 3OR2B 2R7UA 1YBUA 1DZ5A 4YY3J 4F4KA 4K5RA 4P6VF 1CC7A 3PUNA 4NXNF 2I2YA 1CJVB 1B0VA 2DB1A 4G1IA 2LXFA 2B9XA 3CCSS 5M3MK 2E5LF 3GTOC 2XCPA 2FVPA 4BDPA 4B48A 2QMXA 2DYAA 1ZTWA 2I5JB 3CRZA 4G6IA 4CP5A 3OEPA 4C2MA 3KK3B 4A3DC 4UOGA 3A3GA 1GNKA 2ERRA 1RT3A 3S2DK 4F25A 3I87A 1N5QA 2OD4A 3S01A 3NGTA 1K47A 2B4OA 4RD2A 1S4EA 4B9LA 1HR0J 3KFWX 4OJGA 4J9MA 3HOUK 2NV4A 5J35A 3MR7A 2B7CA 4KV8A 4KHPF 1J6VA 2IVYA 3DFEA 2OPPA 1BLUA 3WDOA 1DJ0A 3KWMA 2QFJA 4FF1A 4U7UK 3HOVC 3ZBUA 4HE6A 3ILJA 3ETMA 4MYUA 2MKJA 5KFBA 2DOGA 2OLWA 4G65A 2R92K 2GAHC 3TX8A 5J2PB 4Q4ZA 5D3GB 4KB2A 1T9XA 2F8HA 3OW7A 4LBIA 3LP1A 3OHAA 3G86A 3W5YA 2JA6A 1WP6A 5GAHI 4XIUA 1VQMB 1H2VZ 1KC8D 1MWQA 4NCGB 1RXOB 2HZCA 2YPYA 2XEXA 5A8AA 5E3PA 1Y0YA 4KPCA 3UWTA 3QWUA 3SEOA 2R9LA 3CD6B 1M5HA 4DQKA 4OHZA 2MQQA 3LPXA 3DOMA 1A0OB 3BBFA 2LEBA 4OIOA 4WFAQ 4NZ7A 3UDEA 3Q38A 2IJNA 4CLFA 3MM6A 2VG5A 3QAUA 3WBZA 3GU0A 5A6PA 2Q1LA 2MHEA 1PYSB 3DOKB 3FSXA 1OIAA 4LREA 2IVFB 2HURA 4IR1A 1S79A 1YJRA 4NBSA 3MMPA 1U4BA 1T94A 2FGCA 4LK0A 3LWMA 4JMQA 5KFPA 4OZ1A 2M8HA 4DZDA 1H85A 5JBQA 3GTOA 3OPFA 1YHQB 2AYBA 2FQTA 3T56B 3CD6S 7FD1A 1NSQA 2XSFA 2YNGB 4E0DA 4DUZF 2FZGB 2J5AA 3D67A 1W26A 5L1JA 3M4OC 4J9PA 4DFKA 5GAGI 1IJFB 1S1TA 4ZCIA 4K7QA 4BS2A 3GTGC 3A3OB 4DBQA 2HBZB 4PUOA 3M2UA 3IAS9 3GONA 3K5LA 4MIAA 5IYQA 2HPUA 4WKRA 3QT8A 2HLTA 3KG4A 1RHKB 5C4JC 1YHQS 2O01C 2VDIA 4TMWA 1K0TA 2IM2A 2NXUA 5LT5A 1SVDA 3B4MA 1TUIA 2DCUA 4RWXA 2JVRA 1UWBB 3CJQA 4Z7YA 3VAHA 1E6VA 4QW9A 4G3IA 2CNKB 4NLUA 5L39A 2G1DA 3NXZA 1W2BB 5IXUA 3DKDA 2BJ3A 2L9WA 4X64J 4F0HA 1WF2A 4A8QA 2Q79A 1S49A 3R5CA 3BGFA 3NBPA 2RAQA 3BUEA 4YB1P 3EVOA 5B0FA 3RRKA 5B7WA 5KFOA 1I6JA 2GO8A 5HI7A 4FK8A 1R8PA 3T41A 2F1MA 2RGRA 4KAIA 3OTDA 1XWLA 3CJKB 5KFKA 1TAQA 4Y3CA 2DGUA 2GW8A 4DX5A 4L6V3 4P3YA 3T9ZA 1XK8A 1TKDA 3HOZC 2E5HA 1EWYA 3QLHA 1RT6B 3TZYA 2GVDB 5ETPA 5DDQC 3SZ2A 3MPDA 5F9NA 3HVTB 4ZMMA 1FRMA 2PFFB 1IBLF 2P9EA 1O26A 1OB2A 3G6XA 3AFGA 1NJXA 5ADZA 4ZVFA 4Y2IA 4LBYA 3FCHA 1F6TA 1E3XA 2BKPA 1AZSB 1F9EB 3H5SA 3KK2A 4QPXA 4HIZA 1Q7YT 1CC8A 3GTGA 3N4WA 3V7AA 3JTPA 3KLIA 1JJ2B 1SJ1A 4B9MA 2IRYA 3MMAA 3FSYA 4DUYJ 3BBCA 1JMTA 1NLKL 2I9SA 4NLSA 3OJSA 2ZHBA 3BCFA 3M2RA 4LBVA 3HHLC 2NXJA 2BOAA 3T1AA 1FJEB 3OAAA 4KM8A 4PXEA 3SCJE 4FXUA 3BS9A 2OPPB 1U1KA 3BO2A 1U49A 2RH6A 4Q43A 4MKYA 1UW9A 2WAQL 3SJZA 1R8AA 1Y3KA 2ZKTA 2FPHX 2R8KA 2CPJA 3TEHB 3PO5A 2L9DA 3SSRA 1N5YA 3GV7B 4NASA 2XZOA 4B44A 3VZHA 1T9VA 2FHMA 4BLAA 1M5VC 3LP1B 3EZUA 3GJSB 4ZH4A 4Z4UA 4DFMA 1M5PC 4UY8T 1SMYA 3NE5B 3HSJA 2D3OR 5B0DA 5TV2A 3N3YA 2I0XA 5G4DA 4EBEA 5D8HB 5G0RB 3OZWA 1QUPA 3S7RA 1NO8A 4A3EK 3ENAA 3DOMB 1VBXA 5K8NA 1O2FB 1HNVA 2G2YA 3IWNC 2WB1D 1XNRJ 4F2SA 3GG0A 2VG5B 3MD3A 4DU8A 3ET6B 3CP2A 2PD1A 3BYRA 1IM4A 5JVGQ 4IFYA 4AL7A 3VR6A 1NDCA 2OBSA 1VLYA 1SQGA 2XZWA 2W2NP 4DR2J 2ZJRQ 4HR2A 2AT1B 2R6HA 1NK8A 5KG2A 1S1UA 4Q8FA 2APOA 1C1CA 1BX0A 1K1QA 2DNGA 4KSEB 1D09B 2GIRA 3GVJA 4WIQA 5DM6Q 3VGSA 4FF3A 2BGJA 3SSSA 3OKXA 1W9XA 2LYVA 4TKOB 1T03A 1S1TB 4XD7A 4WPAA 3VO1A 3THTA 2OFHX 4PUOB 3M2UB 3VWSA 1AFJA 3HHLA 1Z2LA 2BM1A 1GMVA 3CCQS 2OPRA 1C2PA 1WWHA 2JLGA 1WEXA 5KFRA 3PW7A 1MG7A 4OHYA 3BSOA 3IS9A 1OSCA 3CC2S 2DCUB 3RBDA 4JOUA 1E6VB 5IM0A 5IZHA 2E1AA 4JI2J 2W8KA 4ECVA 5EDWA 2RH3A 4KR0B 4ALZA 3WC0A 3DLKA 1E43A 4KTQA 2LQ8A 3E2EA 3ZZTA 2FLNA 1K28D 5CA5A 2BJ1A 3BP8C 4V1Ak 2ZD1A 3CDUA 3NBPB 2F9JA 2RQ4A 3CTAA 1N88A 4UZUA 1C4AA 3K89A 2D3UA 2R7ZC 2WTFA 5JJBA 3W8GA 3GTPK 4K4WA 2VFSA 2DGVA 2MDAA 3SMZA 1O27A 2WONB 4FPIA 3ENWA 4LUBA 1C0UB 1GAWA 1VBZA 5IV3A 1DD5A 3CT9A 4ETZA 2VYQA 5IK2A 2HNZB 1ZVUA 5D0GA 4RD0A 4DX6A 4ZJLA 1DDIA 3MCSA 3ULHA 1TUGB 3BP3A 3C6TA 4DR2F 1DTQA 2NPFA 4M5GA 2CAJA 4OMFG 5F41A 4LLGA 1Q86D 5J2NA 2KVQE 3KK2B 5KG7A 4X4OA 2UVWA 4TQSA 1F2GA 1FRXA 1OYEA 1C1BB 4P2SA 5IYBK 3OL8A 4RPFA 3G4CA 1XE1A 1QVGB 2MKYA 1SM4A 1HQEA 4J9VA 3DNCA 3VHQA 3OJUA 3RYLA 3KLIB 3ILOA 4X0CA 1JXVA 4DV4J 2VHGA 1G7CA 4LF8F 1PJ5A 2UVRA 2ZZTA 1DBDA 3M2RB 1LW2B 1D8TA 1RHUB 5DRKA 4O2DA 1H42A 5KOXA 3PJWA 5J1PA 2HBQB 1Q0NA 4J37A 3GTYX 2P6TA 2HW3A 2A6EA 3KDOA 2CYYA 3HVWA 2MGZA 1GVHA 4LIWA 3FBEA 2R2UA 3S8SA 5FLXY 5IYNA 2J9DE 4Q5VA 5I3QA 3CJSA 4ZVRB 3HOXK 2CWXA 3D1QA 2B7BA 3CXCB 3TJAA 2C2WA 5B6IA 1TELA 4R5PA 2R7ZA 2UP1A 4NWBA 3RZAA 3AT1B 1P4MA 2CPZA 3MECA 3DXBA 4TMTA 4FVMA 3TO8A 4MJKA 1N32J 1OHHA 1T9YA 5CD4A 3A8JA 1GX5A 3FFIA 3MURP 2B5JA 2FTRA 3ZC3A 2X1GA 1SFOK 2MKHA 1MLAA 1VQ6B 2IRUA 5C44C 4USVA 3I56S 2EK1A 3SFUA 5CYJA 3NS7B 4IFYB 3PR5B 1C4CA 4WIIA 2CKWA 4PC6A 2CNNB 1GXUA 2PEBA 1Z1ZA 2ZBRA 1YSJA 1S1UB 3MUMP 3TZZA 5I4MA 1JJCB 1C1CB 2G13A 2E2IK 3UDLA 1TL3A 4RLZA 1J5OB 2ACYA 2V34A 4F3MA 2BPOA 4A3BK 2C2KB 5KT7A 4JYAJ 3M05A 4ECTA 3AA9A 1WC1A 4M4SA 4DJBA 1X31C 4JI6F 2KZZA 4A3CC 5HXBA 2UUWA 1KK2A 1QFJA 3MTKA 1WEYA 3HHLB 1R5NA 3KHGA 5HBMA 1H7WA 4N8NA 1RT7B 4D3GA 3VQSA 3CB4A 1UJ6A 1YZ7A 3R6GB 3C16B 5C4XK 2CRVA 1Z4UA 5M5WK 1TL5A 2K8GA 2O1PA 5I3UA 2IMOA 4KMHA 2JH3A 3W8PA 4FNHA 3IS9B 3IBFB 1X5PA 1AIPA 2ZBUA 3HPOA 5HROB 2CFAB 1YI2B 4ZPTR 3QT6A 2J9CA 3B8HA 5IM0B 1F7VA 3PX6A 1ZAWA 2FVGA 3GTLC 2CQ2A 1FE4A 3DXJA 3HJFA 3DLKB 3J7Z5 3S17K 5IQQA 3ASQA 2CQPA 2PO4A 4MK7A 3MF5A 2ZD1B 1HL6A 4DDQA 4TLQA 4XORA 3N6NA 4QPTA 3MR2A 2BUNA 3CE8A 5JVHQ 4WCEQ 2OJ3A 2ZC4A 4OYBA 3KJVA 1WC6A 2H4WB 4OYMA 4WU3A 5BSXA 1SBRA 3QFHA 2KH9A 2CQHA 1S77D 5I42A 2WBMA 2LLZA 3LW5C 5KFUA 2X53S 2PSZA 1N06A 4IOAQ 1TFYA 3MDFA 1GT8A 2IDLA 4DR5J 4C3HC 2XMVA 1JLQA 1TAUA 3V6DA 4M2LA 1Y1VK 1FDAA 3QJJA 3C6TB 4LR7A 5K9FA 3HMJG 4C3IK 4HI2A 1DTQB 4HACB 1JXEA 4EFAC 2EC0A 5J2NB 2NVTK 4OIQA 3HFZB 1T02A 2QX0A 2JOQA 4O4RA 4P3IA 2F43A 4I69A 1XZPA 2HRTA 3D6TB 2BJ7A 3CF5Q 3LAKA 4QWAA 1EP4A 4NEYA 2WVDA 2R4FA 1SH3A 2HVIA 1HYSA 4YEAA 3OVAA 4C2MK 1G7CB 1VQNB 5KFEA 1XR6A 3G82A 5L46A 1UMJA 2ZUAA 2CQ1A 3BJYA 3IRXA 4OPVA 4ECQA 3MXHP 2VG7A 4Z4TA 1HWKA 1VQ8S 4X4SA 1RQPA 1XQBA 4EZ6A 3MMCA 2WRMA 1P6TA 4QIWL 3VF0B 1GXTA 1UETA 1M90D 2GCFA 2MGZB 3GTLA 3JQKA 1HFEL 1WOOA 1YJNS 3WODA 3ICLA 4A3MC 2V4QA 5EGYA 1HNWF 3M6UA 4XK8C 3F73A 1U24A 1VF7A 1WCMC 1Q5VA 5T7LA 2B7BB 1VQNS 3BKUA 3QFRA 2GIFA 2GSUA 3NS6A 2E7XA 1VK3A 1HBUA 1O2AA 2WR8A 1I5OB 2W6JA 3BB5A 1X4GA 1B70B 3BY2A 5EUHA 2RKIA 4FS2A 2ZZFA 5D0EA 2OGUA 5J2MB 3M32A 1BXNA 2VD3A 3GJQB 3R1LA 4BKWA 1B7YB 2WJYA 1RJJA 4K1XA 2DGXA 2VQEF 4TMZA 2L08A 3N5FA 1I51B 1U0HA 1R31A 5M2RA 2V7WA 4DV2J 1XXCA 3SBMA 2GSNA 4RPDA 4PQUA 3GIKA 1KMHA 3OL9A 3SI8A 2V7UA 2WSSA 6FD1A 2ADCA 1RBAA 1EQRA 4DR5F 2V67A 4N5SA 1TL7A 2G0CA 1N36J 3Q6RA 2AHOA 2WYRA 4PG7A 3TAMA 1HKAA 3ZIAA 2GQCA 4DPOA 2QLJB 3PHEA 3P96A 3EPGA 3UDCA 3KOAA 4Z37A 3D0GE 5CZXA 4Z4SA 1Q95G 1UFWA 3CCRB 2C2NA 3ZZYA 1FRJA 4A3DK 3CMEB 1TKTB 4WWVA 1R0AA 5KFZA 5HBMB 2EBEA 5GV8A 3N9UC 4O4GB 5BR8J 1XNQJ 3ASRA 1RTZA 4GTCA 3X3UA 1EX8A 3H4DA 3DCAA 3AGPA 4PC7A 4A93K 1KVIA 5I3UB 3K5NA 3V6HA 1ZETA 4A3LC 3RR8A 3PVXA 3SCKE 2NYHA 5HZBA 4WILA 2J6UA 1F5AA 2WB1L 1TLLA 1WCMA 2AYMA 4JK1A 3JSRA 1KEKA 1RI7A 2Z30B 1UTAA 2DK2A 2KDOA 4Z1MA 4ZA1A 4FZVA 1UV7A 3R6LB 1SUQA 1UFLA 3I0RA 2ZDPA 3DLEA 4OI1A 3VAIA 1ZA1B 1G4CA 2CPYA 1HMVA 2PE8A 1SIWB 4R0JA 3VR1A 3ZZPA 4WZMA 2R8HA 2RQMA 2G4BA 3SEJA 4YR2A 1YNNA 3RU0A 1OYDA 2Z57B 2OMOA 2NUHA 3AVYA 4X4RA 3M8QA 1JA0A 4CZCA 2V4DA 2HMAA 3LANA 4DN0A 4DNTB 1T9UA 2KYZA 4F36A 1U09A 4GQNA 1NJID 3BGOP 2D3LA 3FC9A 3BPSP 2JRSA 1MWYA 2CJBA 3I31A 3V6DB 5D4DA 4KQZA 4YS2A 1S6PA 3OXFA 1SJ4P 3H3VD 4KFBA 1VQ9B 3B54A 2JVOA 1SKRA 4I2PA 4M5KA 3Q3QA 3M9MB 2LECA 3FBBA 4DV6J 4ZPWR 3AOAA 4EUVA 2HWTA 2BQUA 3U6BA 5HLFA 1I6HC 1UD6A 4LFBF 1VDHA 3KHLA 1XZPB 2DH9A 3F56A 1N36F 3M4OK 2FIUA 4O3PA 1WQHA 2X1BA 1EP4B 4DX7A 2W7PA 3D9BA 2EBGA 2VH7A 1LNQA 3QGGA 2DXEA 2WCXA 5EMNA 2VONA 4ZPDA 2XWYA 1KS2A 2N7YA 1VH2A 1HYSB 3T9NA 3P26A 4RL1A 1X4EA 3G82B 3H94A 2QEXB 3IRXB 2VG7B 4OZNA 3BR9A 4EU0A 2ASDA 2YKAA 5BR8F 4XLNA 4RM0A 2DH8A 4XTTA 2IY5B 1QM9A 4Y2CA 1G1XA 2EBBA 3Q39A 4GTLA 1QGAA 5DS7A 5BYRA 3TW0A 4OX9J 2EEYA 3PKYA 1I50C 3DGVA 4PG6A 2Y1IA 4X66J 1QAYA 3MM5A 5DLGA 2UUAF 1QSLA 3QX3A 4J9QA 3RB0A 1MMDA 1TVCA 1AUDA 3PENA 1S0UA 1RWPB 4QUZA 3TVKA 4LF7J 1FX4A 2CQCA 4C8MA 1XMQF 2U2FA 2VBTA 2NQPA 1Q16B 1FJ7A 2RKIB 3D54A 3L4BC 2DNPA 3KXDA 5LM7E 2YWKA 3P4UB 4KGMA 1P1TA 2GVZA 4WKYA 3CO9A 1JNYA 2XYPB 2MSTA 1D8YA 3O44A 3CCVB 4YHHJ 4TSFA 4X62J 3HOZK 1U0HB 3GP9A 3UNGC 2MQLA 2XMMA 3DLGA 5IV4A 1EZZB 2N3OA 4DLGA 4PQUB 4ZN3A 1TP7A 3CDWA 2LKZA 4OJ3A 1NU4A 1CVJA 2G1HA 3TQEA 5LSOA 3LAMA 5F8NA 1VC0A 2DD8S 3D66A 4PYDA 4OPOA 4ANDA 1NHUA 4AQYJ 2EFPA 2AHOB 1HHQA 3TAMB 2ZKUA 4J91A 2KFZA 4YAWA 4JI3F 2OI2A 2D1CA 4URSA 3WYAA 2YXLA 1S1WA 1VK8A 1WEZA 3KLGA 2FVSA 4LQ3A 2B9YA 1RWXB 1R0AB 1KTVA 3H9NA 3W9JA 2HSEB 3EVWA 4AC9A 1WKJA 4NEZA 2XGJA 2R2TA 3GTQK 1V3SA 4XOPA 5LJ3Y 1I50A 2RRBA 3VAMA 2HS4A 2BQ3A 2FVQA 2V9WA 2PT0A 4F67A 2BE7D 1L0WA 3VNVA 2HQFA 1UEUA 1URNA 3W2IA 1QX4A 1SUQB 3H5UA 4QIFA 4OX9F 4WZEA 4RLEA 2F65A 4ILLA 2YX4A 4M5IA 2F4NA 3FEXB 3A3BA 4OPSA 4DPWA 3DLEB 3EE3A 2A3JA 4AYBL 2WHOA 2XZPA 1HMVB 2XZLA 1NH7A 2EKYA 3W66A 1TMMA 4B17A 2Z4PA 1CJTA 1WKKA 1TK0A 4CM2A 1YJVA 4P1VA 1PBUA 1N5TA 1S72S 2CZ9A 3DU6A 4DSLA 4CLSA 1FDRA 1H72C 4ZCLA 5IT9U 1FE0A 4C8NA 4HI1A 4DQPA 4EBDA 2VKZG 3DRPA 3OSPA 4OYPA 2O3DA 5CH7B 3NCQA 1BY9A 1FKAF 2I1LA 1XFOA 2GQFA 1W34A 1MW7A 1S6PB 3BF4A 1R43A 4G1PA 3HDSA 4KFBB 4M8LA 3FSIA 1R0BG 1TR0A 2MQNA 1NK6A 5GADI 5A0YA 2GMJA 4HL9A 1MU2A 4KHMA 5GAEU 1RAJA 5HLFB 4W92B 3W5ZA 5GMEA 3KDNA 4G7OA 4BY1C 2QTLA 2FJEB 3LP0A 1KK1A 2ZFHA 1FXDA 5IWAJ 3HHKA 2W2OP 2IRXA 3Q83A 4O44A 4M95A 2VFTA 2VJJA 2JFDA 2AGQA 4ZKAA 1IKWA 4FKXA 3OFGA 4GTBA 4C0OC 3M9OB 1F0XA 5FIIA 3ZXWA 2LQ5A 3Q89A 2FZCB 2GV1A 4E8UA 1S76D 3SDEB 1KOOA 5KFLA 3RB3A 1M1KD 2K2PA 1TFWA 4A8YA 3CJRA 2LDYA 3PXGa 4GVLA 2VPWB 2QLBB 1HPZA 1RCXB 1NK7A 4KARA 4GO7X 3HP6A 4DV7J 1UVLA 4FYVB 4OI4A 1NM2A 2AEMA 2L9NA 2VBSA 5HMWA 4BY7C 3RRGA 4USIA 4RUAA 4DQRA 3H98A 4OOVA 5AXNA 4R25A 2QFIA 5AXMA 2JN9A 4USUA 3R6JA 2AV5A 4NLVA 4P7TA 4WYWA 1SL1A 4ID5A 4Y7NC 2K7JA 1RYSA 3U6KA 1FNMA 3GEHA 4LVOP 2KT5A 3G6YA 3KMSA 2VB6A 3I0SB 1H38A 5DLFA 1REGX 5HMZA 4G1QA 4KKOB 4ZVOB 2QA1A 3O1LA 2Y8WA 2FY8A 3DLGB 2WB4A 3N01A 3RAMA 3PEHA 3CPXA 3HHLD 3F41A 2IDEA 2HS3A 3CVKA 4NCNA 2LXIA 5IT0A 2W7OA 2RHSB 2OTLB 2P8IA 2YVSA 1X0PA 1HNXJ 3MCOA 1Q8IA 4B3MF 2O5IA 1C0TA 3BGUA 3SXLA 4QYRA 1QAIA 5F3TA 2XS7A 3GFZA 1IQ0A 2YNHA 1WG1A 5M3FK 4BHQA 4J9RA 2XLKA 1S1WB 5J1NA 1MABA 3MHYA 2MQMA 2CDQA 1PIEA 4ZN1A 3UR0A 1KVKA 3R5AA 3GFXA 2X7IA 2AJQA 5L9NA 4QWBA 1SJFA 2DGQA 1F5BA 1UA0A 4DV1J 3BCDA 4N77A 3FKSA 1FTRA 3HOWC 1FT8A 4QZVB 1YRTA 3ZZ0A 2X6XA 4PR6A 4YAUA 1NKBA 1RDRA 4OYOA 2ZHOA 3LO3A 2QSWA 2HQ3A 3T02A 1S9EA 2AJFE 1VQSA 2B4PA 3VGVA 4H4MA 4O0IA 1KONA 2AYGA 5FJ4A 1QH0A 3OE7A 3V4IA 4B9SA 5FA6A 3DI6A 1E6YB 3WX8A 2I38A 2WSCC 2R92C 1CJUA 1FFSB 2A10A 2IHR1 1CJTB 3FPPA 2FX3A 7AT1B 2VPXB 3Q8UA 2DR6A 1IQTA 5GAHU 3SCIE 1LFWA 5BSYA 4MIWA 3S14C 1R8HA 4ITSA 4U7CA 1GR1A 2OPSB 1FJGJ 1FWKA 2ZH9A 1RT1B 4A4JA 5M2UA 1G6BA 4RNMA 3TFJA 2XLIA 5LOQA 3MD1A 4GFQA 4F4XA 2PMWA 4TYBA 5C44K 4A46A 2QT7A 4U95A 4NA3A 2ZZGA 4TY8A 4ZP9A 3G8TA 3DRPB 1YTYA 4RD6A 2A69A 1KQSR 1U7LA 5KFIA 4UQGA 3NUHA 2E2HC 1I94F 1RLCL 4Z4YA 1N6QA 2E9ZA 2FQQB 4IKAA 3MR6A 2RQCA 5HVGA 1G7TA 5A0YB 1Q82D 1MU2B 5I3PA 1OO0B 2CJXB 4Q8EA 1NHKL 1HNXF 3P5TL 1WHXA 4DCPB 4E98A 3CDAA 3LP0B 3MEEA 3CQZC 4U67Q 3TFHA 3N0BA 3H0PA 5B09A 1ZBSA 4O44B 1RP5A 2HIYA 1BE4A 4A3CK 1HD1A 2HHQA 3BN4A 2BM0A 1VQKB 1DG1G 1HIYA 2H5IB 3NG8A 1EARA 3PYFA 2G0IA 2GS8A 3AODA 1U1PA 3JTNA 3RJMB 4FXVA 2XMKA 2ZC3A 1RLDA 4XKVA 4CLWA 5KFJA 1TMJA 3MFHA 4DR4F 4I0WA 4XN3A 4WJ4A 2XNRA 4Z4WA 2XCAA 4NA2A 2HHHF 4C8YA 3TUIC 2HVHA 1O24A 4A8XA 3VAKA 2BF4A 1HPZB 1XR7A 2XS2A 2DRDA 5KFAA 2R92A 4ZP8A 3GTLK 1NDHA 4TT3A 3DYAB 4NNJA 2RC5A 5AE1A 1KC8T 1WU8A 4LF4J 2QV6A 2EG2A 3GFHA 4DFPA 4LF9J 4QV2A 5IOTA 2C77A 2JDJA 2KN4A 4KB7A 4CH7A 3M2VA 2LQJA 1F20A 1FNCA 4C9DA 2O67A 4UOFA 3R5JB 1VYAA 2ZNYA 4ID5B 2W8LA 2A2DA 4URGA 2KXHA 2CZVC 2MLXA 3OSNA 5HQ8A 1E1QA 2RSQA 5F8MA 1AA1B 1VLOA 5BYQA 2GHVC 4LMZA 3MM8A 1IBMJ 2JDIA 4G1QB 3LGNA 1LOUA 1FJGF 2QA4S 2WW8A 4M0LA 4TVAB 2Q6KA 4K59A 2E2HA 2ZJQQ 4C3HK 4KT0C 2J7UA 2A68A 2CIMA 5IYRA 4RR5A 4KKSA 4LT6A 2A1BA 3GG1A 4IO9Q 2X85A 5IYPA 2YKMB 3CCZA 1L3SA 2MKIA 1C0TB 1TWCK 1NJWA 4DR3F 2CC2A 1QFYA 3CQZA 2CJYB 3QRRA 2YNHB 3RZOK 1F7UA 3AAWB 4U6PA 4Q2LA 2CJQA 2V4RA 4QIVA 8AT1B 2Y0BB 3DDNA 4K4SA 1O8BA 4HT5A 2M52A 1JLGA 3W9HA 2HFVA 1Y0RA 4YR3A 4RNNA 3DMJA 1RWWB 2E7WA 4ILDA 3CCLS 3PFEA 1K0VA 1DTTB 4FXDA 5CDFA 1OQ3A 3KUEA 3VO2A 2WVEA 3CMAB 1ELOA 2DIVA 1IVZA 2EFVA 1WTFA 4G0UA 1S9EB 3NOGA 1PC5A 3ZTRA 4EI2A 2HHXA 4H4MB 4MT1A 1LEOA 5K14B 3V4IB 1NSKL 1WCMK 3DI6B 2GIQA 4F4AA 2MZSA 4M1KA 3K17A 2F1LA 1CJUB 2DNHA 3ERED 1PAUB 4GTEA 3CDBA 3JXOA 4FYWB 3KUGA 4CM0A 2VQFJ 1XC9A 2B6AA 2EI5A 3M8PA 1FFGB 1X60A 1REVA 3OL7A 4DSEA 1FRHA 5ITHA 3IFEA 1AB4A 2DNNA 4JV5F 1XJWB 1U6FA 1JB0C 4IG0A 3TA0A 1IBMF 1A9NB 4TY8B 2VBUA 4WP3A 2QE7A 4B3SF 1WIHA 2KRBA 2HHUA 4NLTA 4ICLA 1IJEA 3G6EB 3PR4A 3BGLA 1R9TK 1N6QB 3Q22A 1VQPB 2IYIA 3SQOP 1VQ7B 2GQ2A 1O2BA 4NOIA 3G8QA 1QE1A 2R8IA 2WZNA 2XS5A 3MEEB 2AJ4A 1HBOB 4USWA 1KWMA 4LFCF 1S4MA 1HBNA 3ISNC 3OLAA 2CPFA 1NXIA 4ECXA 1LXNA 4A8KA 1RSCA 3FNNA 4FF4A 4DF4A 4LR8A 4UAJA 1BGXT 4LSLB 2R7XA 5A89A 2Y3YA 1RAEB 4HVZA 3VNUA 2ZH7A 2A6OA 5F4JA 4A3LK 1SC6A 2WVBA 4DHVA 1X4BA 4ZHRA 3IC1A 5T14A 2ABYA 1XPPA 5KFWA 4XDCA 3US5A 1LWCA 3ONUA 5HATA 1ZAXA 2UU9F 1ZBTA 5C25A 3K2YA 4PEOA 2X6YA 2LA6A 1B23P 1CQNA 3OOCA 1OPZA 3AVWA 3M2VB 3R8YA 3HSZA 2E1RA 2OEMA 5J2QA 2BJ9A 4GVBB 1DHMA 1LK7A 3G71B 1ZH5A 2MQOA 1T9TA 4C8KA 1FVSA 1ZPVA 2BDPA 2WW4A 2E5GA 2VQFF 4BBSC 4RW4A 4CH0S 3MM8B 3HZEA 4KMUA 4YB6A 1KR4A 2E1PA 1RAAB 4X84A 4PG5A 4BLBA 2OK7A 2HDNB 3ENVA 2VNHA 3U7JA 1PILA 1VQOB 1RCOB 4YMEA 1B7FA 5KW9A 3D0IE 5SZTA 3OR1A 1UVNA 4X7EA 3PUMA 2HHPA 4DR7F 3MTJA 2VA2A 3CC4B 1RUSA 3T3FA 3GFYA 4F4YA 2W1BA 3J81j 1ZM4A 3EM1A 3MEDA 1D3WA 1RAOA 3O3LA 3TAPA 5TMCA 1HQ2A 4M5NA 4BBRK 2WPDA 4Y2AA 2W9AA 4QR0A 2HNDA 3PX0A 5IYBC 1JLGB 5FLMC 2ASJA 2NS1B 2AJ1A 3RW7A 3DMJB 2BR0A 4QIGA 3M8YA 5IP9K 4ED6A 3GR0A 3VA7A 3JYTA 1IB0A 1FNXH 3CMQA 3S1QC 1BJTA 1EAYC 1CS4A 4UY85 1LWFA 2IYGA 3CCMB 5FL7A 2DNMA 2MHNA 1NRKA 3VQTA 5AE3A 2ROPA 3RB4A 1WHVA 1S7IA 1U8WA 3SQGB 4K0KF 3LA0A 1QAJA 4C0BA 2GZOA 1TWAC 2J0QD 5K8MA 3U1NA 1TL1B 4RU9A 4RCYA 1FCAA 4OX8A 4LC0A 1YBAA 3L09A 3HOXC 5D4OA 3I5AA 5DQIA 5IT9Y 1ZYRA 2QN6A 2CG8A 1GJRA 3KLFB 4K4ZA 1VI7A 4PWDA 5C42B 2EFOA 2B6AB 3WBJA 4QBUA 2B63C 3IP0A 1RU1A 4XO0A 3QPIA 2MMYA 2D3O1 3C66A 1FRIA 4ZPBA 4AH6A 4AF6A 4JI8J 2RUGA 2IAJA 4QWDA 3K5PA 1NBMA 3FEZA 2WAQD 2B0GA 1TWGC 4ICLB 3JQPA 4OLPA 2DVIA 2JA8K 2RVJA 3NRBA 3PCOB 2XNCA 4X7CA 1S9GB 3THVA 2VICA 1HI8A 2H5EA 4MK8A 2VFRA 4RBVA 1QE1B 4DV3F 1W2BR 4IRKA 2AQ4A 3KNAA 2UXBJ 2R7VA 4NYPA 1SQFA 1W25A 3W61A 4P74A 5HQMA 1GAOA 2W24A 1J6XA 2ZE2B 4XCHA 5ETVA 2YNFA 4ED8A 1NH8A 3DHWC 1UAWA 1M5OC 1DCOA 1YNJA 4LF6F 2HS0A 2QTZA 2XZDB 3PYEA 2YTCA 2XQCA 5AXLA 2PMHA 1YJWB 1XTZA 4PPZA 4PPDA 3GYXB 3W3SA 1RT5A 2ZL6A 3TZXA 2IM0A 1WKLA 3HSDA 4Q45A 2XCRB 4JI1F 1TWAA 2PLFA 5C25B 4RZRA 3HKWA 4O3OA 4PXDA 1DRZA 2GMHA 3RUBL 3P6YC 5BXIA 2O5JA 3IXQA 4Y00A 1LQ9A 5E5NA 3R3TA 3H59A 2B63A 1Y3JA 4ID8A 4PC1A 3CCWA 1UD3A 3ASPA 3Q6QA 4HHHA 2N4DA 3EPIA 5KNLA 4DFJA 4OIRA 1IQZA 3QZ8A 3ZTPA 4XPEA 4KASA 3WC2A 2HLUA 2EXUA 1VHEA 4LRCA 4OOXA 4O0NA 1JJ2R 1PG5B 3W5UA 4RO0A 4YFNA 3S16K 1TWGA 4J9KA 2HFOA 1KRHA 4BC9A 2J0SD 2BYCA 1KK3A 1DFDA 4JI8F 3WIUA 3RY8A 4MFBA 4BC7A 2AJ2A 4JI5F 3IBWA 3OR1B 2KHCA 3D1HA 3QIDA 3O8WA 2B43A 2WSFC 1SQEA 4DU7A 3OW2B 4KGXB 2XY6A 1R0CB 2XULA 2PGCA 2ZWOA 4PXBA 2ZBIA 2DHAA 2HZVA 4F7VA 1AFIA 2Z8QA 1EP2B 3K7AC 1HHTP 5AN9A 3PO3C 4XLHA 3MEDB 2DGTA 2E5LJ 4BY1K 5KFTA 3DHXA 2I1RA 3M8RA 4N76A 1YITB 1YRUA 4XDDA 2P2CB 2HNDB 1KD1T 2PMDA 4XLAA 3MAHA 3TYTA 3BYPA 4TN2A 5JUMA 4G0VA 3TVZA 1YIJB 3Q2SC 2ZL7A 4ILRA 1CPZA 3JYTB 2W7AA 4BCAA 4ROXA 2RB7A 1S9FA 4KHPJ 4PC2A 3CJ8A 2OD6A 2ZWPA 1RQRA 3JU4A 3DLJA 5JXSA 1ZUNB 3PTWA 1CS4B 5HO4A 5DS0A 1NB2A 5D77A 2OPQA 4I56A 1D9FA 2JJ4D 4Y65A 4XAKA 1UEKA 4BY7K 4IG3A 2VC0A 4WXWA 5KFSA 1QLNA 1TQLA 2BE2B 1N5SA 2IIHA 3K7RA 1SL0A 1FNDA 5JMNA 4IH6A 1HWUA 1LWEA 2QZ8A 1TUWA 1OGIA 2QN6B 3H2UB 3OEHA 3CCJB 5CD4H 3S2HC 4M1XA 4PWDB 2RC6A 2ZL5A 4EBCA 2ZH4A 3W2GA 4Y7NK 2OSQA 1UVMA 4UF4A 3ZNUA 2HVEA 4M5DB 2CQBA 1X9WA 2YNIA 3GDZA 3DLHA 3R7NB 1SCJB 1RE1B 3KNGA 3IMQJ 3CJ5A 1RBOB 2FDNA 3TAQA 4Q2MA 1MMNA 3RW6A 2IAJB 3CCSB 2HFZA 3J7ZT 2BANA 1NK0A 4OOSA 2HZAA 1JKHA 1DAXA 4TMVA 2OO4A 2Z2LA 1KN6A 2HKEA 4YN3B 2MQ8A 3VVUA 4ZCKA 3GJRB 1S0MA 4KO0A 2J8AA 3LAJA 5E3CA 3AVVA 4YOEA 4Z4RA 3OFFA 2A6HA 4ECUA 2LZJA 4RD1A 2RMLA 4DUZJ 1S7HA 1TTTA 1QD1A 1U8SA 3K0JA 4GC7A 4RDJA 3FK4A 3W2VA 4TYAA 2V63A 2YNFB 1OSDA 3E1YE 5D78A 4NLPA 4AT1B 4M5MA 3SLDA 3KK1A 1M90T 5E68A 2VBYA 1VRTA 1CBKA 1XZQA 1MMLA 1FESA 3HOWK 3ZZOA 2V68A 3UN5A 2FY1A 5HVFA 1OY6A 4ZDNA 3AD8C 3U1LA 1EKSA 4WBFA 1VJWA 4CLPA 4WFBQ 4A93C 2HWHA 3IN5A 1RT5B 4GTDA 5ETSA 2Y9HA 4LF1A 1BQMB 4XN0A 2UXCF 4AF7A 2PN6A 2HHSA 2F9DA 3SJPA 5DG8A 1I7PA 2FJVA 4Y9RA 5KFMA 4YALA 4IFVA 4AE5A 5KSWB 3BV8A 2AD9A 3IRWP 1HI0P 2JC1A 4YAOA 3W65A 3M6VA 1JB9A 4DEZA 1F9NA 1M5KC 1BX1A 4BBYA 3S14K 3LQVA 4Q5SA 2L3MA 4C11A 3QATA 1FNBA 1G7RA 5GV7A 5DDOC 2EFGA 1QVGR 4OI0A 2GMLA 4HDGA 1VQYA 3I4NC 4B9VA 2D7SA 1XEZA 1CG2A 2GJFA 3T5KA 4RW9A 4WE1A 3EGNA 3MM7A 4C8ZA 3BGRA 3CJ4A 5DZ6A 2ZM6F 1H8EA 3DGPA 1FF2A 4P52A 4MFBB 2E2HK 3PRBA 3CEDA 4P2FA 4RBUA 1IBLJ 3JSTA 3OP1A 1APSA 4QOTA 4K50A 1PSDA 1JLEB 4A48A 4WZQA 2H3EB 3KMQA 4CYUA 5DDPC 4M5LA 3A3PB 3E01A 2ZH8A 1WOSA 3JQRA 2V8DA 4O3QA 2G9OA 4PG8A 3LPYA 2YU9C 1BQNA 3ISZA 5C5JA 3CQZK 1YCLA 3CCES 4LJMA 1YK9A 3CXCR 2XMAA 2DPIA 2OSRA 5D0HA 3SSQA 3ONQA 4RJLA 2GPJA 4IQMA 5TR9A 1L5UA 3Q8VA 2AW0A 5H9EJ 1D2EA 3R97A 4F3OA 2PPBA 1PYTA 1N52B 1ZXOA 7FDRA 1QUVA 3E51A 3GWCA 2ZXHA 2IC3A 4Y7CA 4DQIA 2R7TA 5IOQA 1V9OA 1YJ9S 5GVQA 1RYRA 1TTHB 4P26A 2OPQB 4EO8A 1KQFB 3QGPA 2YWGA 3HXAA 1R3NA 2CPIA 2V7QA 3QT7A 3MM9B 3C46A 1KOHA 1NB0A 2MZJA 1VQLS 1ZM9A 1FRKA 4BLGA 5DG7A 4HTIA 1YQHA 4C0HA 4NMXA 2JX2A 2C78A 3HT0A 2F40A 1RWKB 1W0JA 3AOBA 1HNZJ 4IO1A 4ZP6A 4KYZA 2P5VA 3M1VA 2VNKA 2YNIB 2MY7A 1V6HA 4Z4VA 1NJIT 5CXTA 2PIIA 3MMJA 4C0SA 3PRVA 1B0TA 4YDXA 5MLCV 4KPYA 3QO9A 1GQEA 3TX0A 4QIWD 1OY8A 1UD4A 1TKZA 4DDFA 4NLOA 1WI6A 4CO5A 1IKXA 4ELTA 4KO0B 1FNOA 1N33J 1EQ0A 4PABA 1K73D 2YU9A 1FI4A 1LV5A 4DF8A 1FERA 1RISA 1FRLA 2FJDB 4ZLLA 3S15K 4RW7A 4U7UD 1S1XA 1NPKA 1FXLA 1D1NA 2RQKA 4HLBA 2KO1A 5KFFA 3C14A 3GVKA 1KFSA 4U8VA 2BMWA 1LXJA 4ECZA 4I67A 3M30A 4C6AA 4FS1A 2R9VA 2RU3A 2W7VA 2JA7K 2CZ4A 2LCWA 3AVXA 1YJ7A 3WQPA 3KK1B 5HQLA 1IWAA 1VRTB 3PA2A 1NCLA 1RT3B 1XZQB 1HW9A 3GV5B 4IYQA 3KTQA 1UJ4A 1ZPWX 3POTA 4I2QA 1USMA 3CC7S 1B4SA 2B7CB 3GTQC 4FDFA 4KV8B 4B9TA 4XR6A 4JV0A 2FHKA 4ZVHA 2D74A 1EIYB 3IBCB 2P9CA 4P2MA 2KXFA 3OVSA 3GYGA 4OHWA 3S1TA 3DN9A 3CJ0A 1SC4B 1IBAA 1H6KX 2J7WA 4QR1A 3ZTOA 5F9LA 3MMBA 1IL2A 2XY5A 2IBOA 2R7OA 1ZTTA 3W62A 5SUHA 4GC6A 4WQMA 5AE2A 1PGZA 4B4DA 4IFVB 3CULA 3JQQA 4YP3A 3VV2B 4X7DA 1VOMA 2V7VA 5IYDK 1UD8A 1XBWA 5B0EA 3FZBA 3JSMA 5AJ3F 5BYSA 2F5GA 5K8OA 4NYZA 1HNZF 1N0VC 5CCMA 4CT8A 3TR5A 3GTKK 3BBBA 1U1RA 3MM7B 2DR5A 4A3JK 3BGRB 5HVHA 1E64A 3WIVA 1JLBA 3DGPB 1T0TV 4FPRA 2QRRA 1DDGA 5CZVA 1E79A 2MKCA 3MM6B 3RBXA 5KFVA 3BM7A 1YGYA 4RDLA 5HMXA 1XQIA 5H9EK 5HSPA 3QSYA 2B4VA 1SH0A 4Y52C 3MZIA 4RUBA 4CYUB 4I64A 3MHPA 3E01B 3E3XA 4RKUC 4QVJA 3MR3A 2CJAA 2V2VA 5L1LA 4JB8B 1N33F 3RZDK 3CCQB 5GADU 2QL7B 4Y2KA 1QFZA 2GK6A 3HHNB 3QFSA 4A8MP 4NLQA 4W90B 4J5OA 3DLLQ 2AX0A 2M5SA 3CC2B 3B4DA 1U2FA 1ZZNA 4WU2A 4KGVB 1JK9B 4ZJQA 3EYZA 3TRGA 5A8KA 4XSXA 2E2JC 4YB5A 4LF8J 3TJ9A 2BV3A 4LJZA 2Y0SL 4FXWA 3HO1A 2AX1A 5DQHA 4TKTA 2QGGA 3GLJA 3NMAA 4A8FA 3GTQA 1QUFA 3DLBA 2V6SA 2FJWA 2FJBB 1NPRA 1OS5A 2V4JA 2UV8A 1H7XA 2KVOA 3I4PA 1PJ7A 4WYLA 4H4OA 3CIMA 3KJQB 3OQ2A 3T6JA 3ELHA 3ZFVA 1TL4A 5CCLA 3U27A 2Q6BA 1N5VA 2HG4A 2BA9A 1X9MA 2BXJA 2DGSA 4DS4A 2DT9A 2HFSA 5E41A 2F7VA 2C5BA 1YKWA 4K8RA 2FHJD 1SJ3P 5T41A 2R7QA 5TRDA 1D0EA 4EMDA 5KT6A 1I3OB 2DEJA 4BBSK 4MAKA 3PX4A 1X4HA 5DZ7A 5J1EA 5DGBA 3GTJC 1WHYA 1EFRA 3QGIA 3QO9B 4P12A 3CAGA 5IOSA 4OHVA 3UPFA 2FJXA 4N3GA 1TKZB 1GX6A 1X0FA 3ETOA 3HSGA 2HFNA 3QLHB 1IKXB 3D26A 1RTDA 1O6XA 1KTQA 3EMTA 2JNJA 4ZV4A 2MTLA 2IJFA 4F4ZA 3Q23A 4PCQA 4I7FA 4RW7B 4L73A 2PMZL 5KG4A 3L9ZA 2YKOA 2E9TA 3UVJA 4DQLA 4XM3A 4K4XA 4JI6J 3C14B 2X8KA 4DG1A 4OYXA 5KG5A 3M30B 3A8KA 4ELUA 5FLMK 2QE5A 2HBRB 5K20B 5FD1A 1HHSA 1R7IA 3RAXA 4WXOA 2GHPA 1BS2A 1M1KT 2HHWA 2XB2D 3MMAB 2D41A 3I9ZA 4XLPA 4CT9A 4U8YA 1U26A 1AB8A 2ZUEA 1NB9A 2VF3A 1QTNB 2QO3A 4I2QB 3S1QK 4XLFA 3JB9k 3CNQP 3M9NB 3TP2A 1Q81D 1MRZA 1PO6A 2D74B 3VGUA 2ZDOA 1JX4A 4J9SA 4K4VA 4RWWA 4JUZA 4J9NA 1JIHA 2L48A 5JFEA 3MMBB 1S1VA 2QYCA 4DWIA 1FKOA 1TWAK 5HL7Q 1N5YB 4F8RA 2Q6CA 2B51A 4UOCA 3OUYA 1CNEA 3QE2A 1D8ZA 3N0CA 3I56B 4PRFA 4CCHA 3NNAA 1OB5A 4JI0F 2JZ5A 4KN7A 1RGVA 4NYOA 4LF2A 1RZMA 1NB7A 2B63K 3GTJA 4ZITA 1BJKA 2MZTA 1J5EF 2RU9A 3HULA 3ISND 2XTJP 1EP1B 4UW2A 3TVYA 4OINA 2DNZA 2DIEA 4EO6A 3P49B 4AFFA 3T1HF 3R9LA 4F50A 4G5GA 3EGWB 3PHTA 4C45A 2AIRB 3P8BB 3M6XA 1HNVB 5A6WA 1TWGK 3NGKA 2DO0A 3L4JA 2F8EX 3CO0P 4EYHB 5ETRA 3QSYB 4FBTA 1O0PA 4CH1A 3GZ7A 1HQUA 3KLEA 4A3KK 2CJKA 4AYBD 4X4NA 1XN9A 2F4VJ 1GAQA 3PO2C 1PC4A 3MPWA 4NXMJ 1S6QA 3FQKA 1WACA 1HQMA 1Q5YA 1WORA 4IRDA 2ZJPQ 3H0GC 4URQU 1ACMB 2ZH6A 1LFPA 2DERA 2IMWP 4IUFA 2HHTA 1UP1A 1VR6A 3OTOJ 2JIZA 4ER8A 3VAFA 1NDKA 1HW8A 2JC0A 2W2MP 3I82A 1T03B 3PDNA 2KU7A 4NZ6A 5A8KB 2HFUA 3MI7X 4J7CA 4CLLA 1KZLA 1CJVA 2W25A 2VG6A 4J0QA 4ZVEA 3HJVA 4MQ9A 3TANA 3S0XA 4X07A 2H65B 2BEFA 2OPRB 4ZVSB 1N54B 1QG0A 2V4JB 4NLDA 1HNWJ 2W4PA 1B99A 1NUEA 1KNZA 2DIUA 4LBHA 2XHCA 1RU2A 2U1AA 4IOBA 4L3KA 2KJWA 3GCXP 2J8SA 2AZ1A 1D9AA 4RUHA 2D9OA 1IBKF 1BMQB 2MKKA 3E20A 1HWIA 4DQSA 3WNCA 4QFMA 3FKIC 2BX6A 1BUXA 3OJXA 1HVXA 2AP6A 3CDEA 4OL8A 1EFUA 3IAM9 2C2ZB 3T51B 3LTOA 3QWPA 5RUBA 1AW0A 4UQTA 2NXCA 1IN0A 4PGOA 1X4DA 2C3UA 2OBTA 1EETA 1NJZA 2UUTA 3IPJA 2OEKA 4DPYA 2OTJS 2VQEJ 3X1LB 1DQ8A 1WELA 4DCJB 2VJVA 4X06A 3DRXA 3GIIA 2F3JA 1Q82T 2RNEA 1XXAA 3D68A 2O5DA 2GSOA 1MSWD 1RTDB 4ED1A 2KXNB 3D4JA 2FZKB 4ES1A 2R7RA 2Q6LA 3DU5A 2QA4G 1RBLA 1T95A 3M4XA 2X3UA 5DETA 2V8HA 3K7AK 3PO3K 3H0GA 1VQ8B 4I4BA 2KFYA 1TWCC 3C6UA 3I5CA 4DR1J 3GJTB 3GTMK 2VBVA 3GR1A 3UVJB 3OHBA 1U1NA 2F4VF 3BQ0A 3W9IA 4NXMF 3SZYA 1NEEA 4DG1B 3RZOC 2YWFA 2LXUA 1V3RA 3LAPA 3EDQB 5HJYA 4GT9A 3BDPA 2C2MB 1YJNB 1UD2A 1HQEB 2PC6A 2Q66A 3HT3A 3NLCA 2XMTA 3MEGA 4DV5J 3ZZZA 1BHNA 3OTOF 1EP3B 4ED2A 3AY0A 1KQGB 2GJRA 3P5BP 4AUKA 1CULA 4W98A 2M4MA 1K8AD 4P6YA 2NXNA 4ZIVA 4EH1A 4XL9A 1IJFA 3LF0A 2RHQB 1QVFR 3SIPB 1ZA2B 2H1YA 1NNDA 3BY1A 2ZUGA 4ED3A 5L38A 2JFKA 3I55S 4DSIA 1I18A 1R5OA 3UCGA 1AT1B 3H20A 1KRPA 1MNEA 3BSCA 3GE9A 1S1VB 1NZ8A 1WPCA 5IFMA 4AD6A 1FKOB 3FKIA 2BOPA 3IGVA 3TWZA 3OUYB 1WSRA 4DLEA 1IKVA 2MYFA 4ZLNA 4R5PB 3S2HK 2DXFA 3C2PA 5HKKA 2SXLA 3MECB 2AKWB 4DK0A 5KAKA 2QA2A 4N56A 1S57A 3FFIB 2V8GA 2B5JB 1SV5A 3QNWB 4JV1A 3LQEA 1BWVA 4FYDA 2M7SA 4DNRB 3CCUS 4KE5A 4V19X 2W4DA 1NKCA 1ZM3A 4LFAF 1U47A 3GQCA 1H98A 2N7CA 3QIPA 3GVLA 4LR2A 1WSVA 1HQUB 4HHJA 4R71A 3BDEA 3KLEB 5GMDA 1TWCA 4TU8A 2IM1A 3KHRA 1R9TC 3WZ0A 3AJDA 1S6QB 5DN6A 4LF5F 4LFBJ 4EEYA 1TL3B 2AMCB 2WOMA 1VQ5B 5KTQA 3HVTA 2J9EA 3MPYA 3K5MA 3PW0A 4K4TA 1HNIA 2ROGA 3WX4A 4DR1F 3TUPA 3AXMA 4DV0F 2VG6B 5THWA 1SH2A 3MOZA 4X05A 3LWLA 1AZSA 2NVYK 1X5SA 4DV5F 2CPEA 1IWGA 4F0MA 1DQAA 2PIAA 2HRUA 1RWMB 2HYIB 3V4MA 4QW8A 1UCNA 4CWBA 2DHXA 2CK3A 1WDDA 3FBFA 1GXLA 1VQ5S 3BQ2A 1VQ4B 3AH6A 2K7KA 4Q7AA 1J27A 3QRPA 1WOPA 2UUAJ 1FHTA 3L7OA 2VNIA 5F8HA 2J6TA 2R8JA 5JVOA 4XKWA 1FFWB 4UZBA 1FX2A 4FBUA 3M7VA 2AZ3A 3ZNJ1 4O23A 2XSJA 1XMQJ 3PO4A 4FWTA 3NAIA 3AD7C 3EGZA 2VPYB 1RWVB 5F4OA 2K3KA 2C3PA 1USOA 2X3DA 2ZZEA 1FKPA 3UW1A 1K9MT 3I4NK 5ETLA 1VQ4S 5TJ3A 3KJVB 3K59A 3G4AA 3FDSA 4CDIA 2CNLB 1EETB 5C7PA 5KOWA 4WZKA 3K5OA 4A8SA 5I42B 3T6BA 2H9ZA 1RAGB 2C3MA 2BMBA 3JTOA 3C8YA 5G0RA 4IOCQ 3BR8A 1NK9A 2YX1A 4O3SA 4W4MA 1JLQB 1R9TA 1DCHA 5A88A 1ZS6A 5FIUA 2VUMC 5LJ5Y 4P6QA 3TA2A 1NK5A 3ET6A 4RNFA 1VJEA 2R93C 2YU9K 2M0GB 4JI3J 4TU7A 4I6AA 3C6UB 3Q8SB 3IR6B 1VQMS 4AVZA 5A8WA 5M2PA 1FA0A 4ZCMA 2WZPP 2EWHA 4RDKA 3A8IA 2HGLA 1BMFA 3DDYA 2HAFA 3HFKA 3ISXA 3W7BA 4BBRC 4ZJOA 4C43A 3MEGB 3MOJB 4YY3F 1J6WA 3NWRA 2CW5A 5HJXA 1O5JA 1M5SA 1CULB 3WHIA 1RWUA 5DQGA 4DL3A 1F60A 4LIRA 3M8SA 5IP9C 2X6WA 1SXLA 1LW0A 1HWJA 1OB0A 1Y5IB 1F2HA 2CF4A 2JWNA 2VV5A 1WD6A 4RNHA 2CQ4A 3MMCB 5M5YK 4DS5A 4MKBA 2C2RA 3SV3A 4PAAA 4YUDA 1JOEA 3QT5A 1K1SA 3L95X 4DUTA 2L41A 1HR0F 3I9V9 3T5HA 4XPCA 3FHZA 1KHVA 4ZIWA 5T7LB 1IKVB 2YBVA 4M63A 1XXBA 2HQIA 5KG1A 2DNOA 1IR2A 2LU2A 3GIRA 3BN7A 4CLUA 2CA9A 2ILYA 3ZTSA 2IA0A 3MWBA 3P45B 1HBUB 4C97A 3K8VA 4HTJA 4B3GA 5DJBA 4NMLA 2ZITA 3N6LA 1RT4A 5KFHA 2DBBA 5EWEA 2HEKA 1SV5B 5AXKA 1MROA 3VTIA 3M32B 2E5IA 2QGFB 2OELA 2CXEA 4DPTA 4G7HA 1CLFA 3QIPB 2WONA 2VUMA 1C0UA 2R93A 2FC8A 2JA8C 3KLVA 4ZP7A 3IWXA 1TL7B 1YLOA 2CBXA 2QMWA 2HNZA 3GEEA 4XLCA 2WOMB 6FDRA 2DKOB 5E6TA 1AMOA 1N8RD 2BE5A 4GTAA 1HNIB 1HZEA 2KT3A 2CNDA 1K83C 1B0PA 4QIEA 1KK0A 4YFUA 1S99A 5ETTA 1N4LA 2RRNA 4KJIA 4WK3A 4YEJA 3EZOA 2Q43A 3PZPA 1F5CA 1C1BA 3RTVA 1CQMA 3I96A 3GILA 2QLXA 1UVIA 2X3GA 1FRNA 2MJNA 4H4KC 1Q8KA 1ZYQA 1XR5A 4X6AC 4B9NA 4NPOA 4F26A 2V6TA 2J0XA 1Y0HA 3Q86A 1LW2A 4NLYA 1S72B 4MK9A 5F0UA 3TUJC 2ZOGA 3O5TB 2P9GA 4CO1A 4K5SA 3I32A 2C3YA 1YRXA 4P5AA 3I0RB 3PJXA 1QJHA 1V5IB 6AT1B 3Q8QB 1AXQA 2QG9B 1FRQA 3AJ1A 5KFGA 1WI8A 2R7WA 4OQJA 2XSJB 1VBYA 2K06A 3HI9A 3F44A 4WWSA 1FKPB 4X4UA 1YX2A 1IS1A 4P25A 4RMFA 1RHRB 4NL5A 4USKA 3LOUA 1VC5A 2VODA 1I6VA 4U96A 3M6WA 1SJQA 1R8BA 3M8QB 4X64F 5CYMA 1DQ9A 2ACMA 2KHDA 1Z2ZA 1FD8A 2BQRA 4UUWA 5A8RA 2ATLA 1NBEB 3GMGA 1YJTA 1R6YA 4DL4A 4PZVA 1QUEA 4ED5A 2NREA 3KG0A 3S16C 2BACA 4DSFA 2R2RA 1TWHC 2D3NA 5F8LA 2BGIA 2CFXA 2XOKA 4B3MJ 3FQLA 4Y52K 3ZPNA 2MY8A 2BVZA 1KQ4A 4BPRA 4J9LA 4J3NA 2LVWA 4I2PB 1RA6A 5MAOA 1K83A 1I1GA 1HI1A 5F8JA 4I6WA 5A8WB 3BQ1A 2HCJB 3FJ2A 3OFEA 3RBEA 3JAMY 2CQIA 2Z2YB 4USJC 3AGQA 2LQ9A 3MUVP 4XQFA 3KLHA 2DR8A 3HVAA 4Z2XA 2E2JK 4KRWA 1J5OA 2VKRA 3S1RC 4H4KA 1KFDA 4ZLPA 3FRYA 4TY9A 1F60B 1X4CA 1BDFA 4B3FX 3HHDA 3OVBA 1JJHA 2QMUA 2ZZNA 1LW0B 1NSAA 5HMYA 2CADA 2HNYA 4BWMA 4UTGA 5KT4A 3I4MK 3OZUA 2WJVA 3QYYA 4DI6A 4RU2A 1RT7A 3GSDA 3K58A 4OZ3A 3MGJA 3C16A 4DUYF 4II3A 4ZPAA 4JI7J 2YQ3A 1I3QC 2NVQC 3PKMA 2ZHAA 3MM5B 4IR9A 5LMZA 1QY7A 3B82A 2GFFA 1T6ZA 4OZ5A 3WNBA 4MMOA 1Y9OA 5HROA 2CFAA 4L75A 3G05A 3U2QA 3T00A 3V6JA 5K5MA 2D9PA 5C2GA 2JEGA 3AB2B 5HAOA 3VCDA 4EYIB 1UMKA 1ZOTA 1U25A 1IR0A 2C2DA 1RT4B 2X0KA 1EB0A 2OFGX 3EXCX 3GTJK 4ZVPB 1FK9A 1K44A 4DN9A 1WF1A 1MROB 4C7QA 5LMUJ 1SJRA 2GVZB 3ZBTA 2YQ0A 1TWHA 4IRCA 3R6KA 5DGAA 2ZFZA 1H0HB 3MR5A 1I94J 1Y4ZB 3TARA 2V69A 3NL0A 1YWXA 1NPPA 2FLOA 3D6MB 2G0JA 4LRAA 3NNHA 3HHEA 4PC3A 4GMKA 2KRRA 1T3OA 4TN1A 1FDDA 4WZTA 3FRZA 2ZH2A 3NEKA 4Z7CA 3UQSA 2Z6BD 3P27A 3U02A 4MEXA 2UVVA 3C19A 1XNRF 2E29A 4LRFA 2XGPA 3Q3AA 2ZH5A 1GFWB 1GMWA 5EGHA 4HACA 3KLGB 9RUBA 1GH8A 2C42A 3KG1A 4GKKJ 2WSEC 3FCWA 5M5XK 4U9UA 3M8ZA 4OX6A 1E63A 2GJKA 4DR4J 3RB6A 3CPWR 3DXSX 5A76A 1HLWA 4CNYA 2HHHJ 1S0NA 1RU0A 2K1RA 3QMQA 4AL5A 3WXMA 3AD9C 4QR2A 1I3QA 4FM9A 4J9UE 2EC2A 4NCBA 4P5BA 5F4MA 4I68A 4MYTA 4JI7F 3R1HA 1QGYA 2BJDA 1D9DA 5L8RC 2F4FA 2C2OB 5IP7C 3OD2A 2B3TB 3OPKA 4OYZA 3A13A 4JI2F 2XNDA 1BQEA 2BBEA 1UFKA 1WHWA 4A3GC 2B5OA 5CYMB 3Q8RB 1UA1A 2R2SA 5E33A 3OV7A 1S5ZA 5A8RB 3OXGA 1BGWA 4HEA9 3O6QA 3W64A 2V8PA 2LP4A 1HA1A 1U6ZA 5LMUF 4AL6A 2PEHA 3BNWA 2VDHA 5J2MA 2DTJA 4PYAA 3MAAA 2MZ1A 1U1OA 3J80U 1WC5A 3A35A 5KFDA 4LOWA 4K2JA 4DR3J 1GK8A 3PO2K 3FJOA 4DX8H 4YXWA 2XI2A 4Q0BA 2DRAA 1RHJB 1FX0A 2BABA 4C4WA 2XLJA 3UDVA 2OMLA 1FEEA 4IQXA 2XZTB 4I1TA 3H0GK 1OY9A 2UVUA 4LR9A 3OTBA 2CVEA 1RABB 3KLHB 2FLLA 2M88A 3A3NB 1A6LA 2BKOA 2JEIA 1VQ6S 1Q8BA 2XO6A 4KMAA 1IKWB 2XBPA 1VGXA 1TK8A 4IH5A 2I6WA 1VIOA 3VGTA 1O29A 3KL9A 5E3AA 1PJ6A 3VMFA 2RRAA 2QMUB 3PW5A 4GKKF 3OTCA 2HNYB 4LSZB 3T5JA 2M2BA 2H48B 4OLOA 5E0OA 3J7AN 1TKTA 5HN0A 3TQ1A 2MSSA 4O4GA 3EZ5A 3HOYC 2VIHA 2POKA 4DV4F 2EVZA 4C8OA 2RJZA 4ERDA 1LK5A 1KD1D 2EIXA 2B4UA 1Q53A 3R7BB 4CTAA 1V5VA 2YWEA 1NJYA 1JNRB 1G2EA 2E7VA 1TWFC 2V6AA 2QA4B 1GEHA 3FKIK 5E2QA 3K57A 4C48A 1QSYA 3LVBA 3GB0A 3PEJA 2QLWA 3J81U 3TJ8A 4RPBA 2C1EB 2V50A 4RBTA 2WZ1A 4TNOA 4CNZA 1VGYA 3G96A 1EK8A 3IGNA 3KHHA 4JV5J 1FK9B 4P2NA 3KKFA 4FF2A 4ED0A 1UPPA 2XC9A 5GMKa 4B3SJ 3D1OA 3U1MA 5IYCC 2DR9A 2AU0A 1IE0A 4Q44A 1YI2S 3V76A 4C3JC 1N32F 2KYXA 3CD7A 3QGHA 3BQJA 1VRQC 2W9CA 3CW2C 1BQXA 1J9ZA 4L3NA 4P72A 2IBKA 3CCLB 3V4GA 3QSIA 2KJVA 2F63A 2M5YA 2F1FA 1TKXA 2NCKL 4LFCJ 5IC4B 2HQGA 3S15C 2HGMA 2FB0A 1OQ6A 3FUYA 3TZWA 1VMBA 2NVXC 1R8CA 1YBTA 2E66A 5EGEA 3CCTA 3T5LA 4B3TJ 1FJCA 3D6HB 2Q6OA 1B4BA 3PYGA 3M3YC 4I6YA 2JA7C 1WJ9A 1T6YA 2MJUA 3C15A 1T7PA 2VBZA 2AF6A 2PA8D 5DG9A 2K1RB 1YJUA 2CNOB 4KC5A 4JYAF 1UL3A 2D3ZA 4ECWA 4FN5A 2NYIA 1FDBA 2PFDA 3LP2A 1V0FA 3QZ7A 3RBZA 2Q3PA 2UU9J 1UVJA 4CO4A 3PYDA 4WF9Q 1TWFA 2OH2A 3OW2R 5D0RA 1VJQA 3PW4A 4XONA 3LO8A 1N48A 4A3FK 1RB0A 2RDIA 1FWLA 4D3HA 3GEIA 3CP8A 5IYDC 4OYAA 3BH6B 4JV2A 1S6UA 4H54A 2RDDA 1JLFA 1Y5NB 5KG6A 1UKUA 3ZC4A 4OZLA 2JA6K 4OZJA 1K73T 3GTKC 2BN4A 1MN9A 5FO1A 1UZDA 2HWIA 1CQXA 2RE1A 3T01A 2FGOA 1NK4A 4A3JC 3CW2A 1RHMB 2DCLA 1RWNB 3FOEA 3MAAB 2C4UA 4DR7J 3BSNA 3QFTA 2DPJA 3PM9A 3AQOA 1OWXA 4K2XA 4ZGNB 2YKNA 3KJNB 3WY9A 3NP5A 5IQ6A 4Q0BB 4IDKA 2Q6IA 2NVXA 3D3BJ 3OTEA 3RZDC 1WTBA 2XMJA 4K4YA 5K8PA 1WC4A 2JA7A 3R5BA 4DL7A 1P8GA 3GTOK 3AOCA 1JWWA 2NSCA 4C3KA 2W2QP 4B3TF 3TTGA 1FWPA 3FGVA 3LALA 4USMA 1E62A 4NRTA 2KWAA 2A2CA 4Y34A 3HZGA 2HRYA 4WK1A 3VAJA 1LKZA 3GV8B 2QL5B 5KFQA 4UZEA 3F0NA 2DH7A 4XOTA 4M94A 2ADBA 2DNYA 3JSYA 3QBCA 4J9OA 4CTAB 4K0KJ 1R5BA 5B08A 2ZNZA 2AYEA 3UNYA 3HOVK 5C3EC 2ZOMA 2YH1A 2EW9A 2QC3A 3NAHA 1GTEA 3CCRS 2N4CA 2FVRA 4QCLA 3L7UA 3NKYA 4ZS6A 2MPUA 2RILA 2XG8A 1Q8LA 2XWXA 2COLA 1U02A 3VVTA 3CMES 3H7HB 4PG4A 5C24A 2VL1A 3VZIA 2MZRA 3MAQA 3V6KA 3GTKA 4HT7A 4MH8A 1B3TA 3ZO7A 2P5MA 2M8DB 5DO2A 3G4SB 1SL2A 4WTOB 3NCRA 2CPDA 2E1MC 2E1CA 4KKTA 3MCAA 3W2FA 3Q24A 2UZAA 2KZMA 2V6UA 1H2TZ 4A8WA 5IT4A 3UE2A 4B3OA 2W9CB 2VUMK 3PV8A 2ASLA 2JLEA 3OL6A 4II2A 3LPEA 2R93K 2ROEA 4DV3J 2ASYA 1U45A 3H25A 1V0EA 2RD5C 3JSBA 2HGNA 3FKBA 1TKXB 2VNJA 3SFGA 4CO0A 2DXDA 4DV2F 3DDIA 1RT2A 4GO5X 2F8MA 1JVIA 3AQPA 2JA5C 3G4SS 4OIXA 2KG1A 4WP9A 2R42A 3JQJA 4PWUA 4P9SA 2ZTNA 1YVFA 1KVJA 4OP7A 2ZBQA 4NLRA 4OJ1A 3EQLA 2XO7A 2Y1JA 4RD3A 2BZ2A 1PBAA 2BJEA 3GYNA 2XGQA 4JP8A 4KKUA 3C15B 4LF6J 4RX6A 2FYXA 3TI0A 2HK3A
chains in the Genus database with same CATH topology
1PJ6A 1NRKA 1WSRA 1X31C 4P9SA 1WOSA 3TFJA 3GEIA 1V5VA 3A8JA 3AD8C 4PAAA 3AD7C 3TFIA 3TFHA 3A8IA 2GAGC 1WORA 3GIRA 1WSVA 1WOPA 2GAHC 1PJ7A 1XZPB 5L46A 1YX2A 1WOOA 1XZQB 3GSIA 3AD9C 1XZPA