1WSVA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
371
structure length
371
Chain Sequence
b'VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
total genus 117
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsvA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsvA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsvA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsvA03
3GEIA 1VLYA 3GEEA 1WSRA 1VRQC 3TFIA 3TFJA 1V5VA 1PJ5A 4PAAA 1NRKA 4PABA 3AD8C 1WOSA 3AD9C 1WOPA 1PJ7A 1XZPB 3A8JA 3TFHA 1WSVA 1WOOA 3ADAC 2GAGC 1PJ6A 1XZQA 1XZPA 3GIRA 3GEHA 3AD7C 1WORA 1VLOA 3TTGA 4P9SA 1YX2A 3A8IA 1XZQB 2GAHC 5L46A 1X31C 3GSIA 3A8KA
chains in the Genus database with same CATH superfamily
2IMWP 2KJWA 3D5MA 1B0VA 1YKWA 2DCUB 2K7KA 4C8ZA 3EUNA 3ONQA 3WC2A 5CYQB 3VAHA 3BQ0A 1L3SA 2W8LA 1FX4A 3W2FA 2ZBIA 1R8AA 2GJ2A 1UVKA 4JBCA 2EFGA 3TAQA 1BPLA 3UCGA 2H3EB 3E3XA 1UPPA 1RT5B 1W34A 4FKYA 4YEAA 3K5NA 1P1LA 2E2IK 3I4NC 1CLFA 3T53B 3LANA 3LQEA 5H9EK 1SUQA 2Y1RI 4I0WA 1I94F 2A6MA 3K5LA 3DLLQ 1VHEA 5I3UB 2AD9A 4C8NA 5C4XC 4WP9A 3PZPA 2MQ8A 3LP2B 1WF2A 3CGIA 3AVWA 3LPEA 4QWAA 2KXFA 4CH7A 3UN3A 3PDNA 4GTAA 2W9CB 2XZLA 3U1MA 2UUAJ 3VGUA 1Q82D 2BKNA 4ZGQB 2DIEA 4W4MA 1PKVA 4M5MA 2GV1A 5KT5A 2PT0A 2CDQA 1B0PA 3QGGA 5E68A 4TN2A 4DUZF 1HQMA 3CCUB 3M8RA 2VOOA 5FDLA 3MR3A 1FFWB 2PA3A 5IV3A 1SH3A 1FESA 3OL6A 3KDOA 3D0GE 3QQCD 5J3OA 3H42A 3ES9A 3QWUA 1YZ7A 3N79A 2CBXA 3MM7B 4AT1B 4NZ6A 2OLWA 1C4CA 2A10A 4IH5A 4FS2A 2DKOB 3FKIA 3OPOA 3PFOA 2U1AA 2HS0A 2ZD1A 4DR6F 1SIWB 4XIUA 3T1HF 1NB9A 3BR8A 1VJQA 2UXCJ 1WQHA 3DOLA 4F04B 2R7ZK 3Q83A 1RAOA 5K14B 3QRPA 4DSIA 2XI2A 3ET6B 1L3VA 2NCKL 2XY5A 1P8GA 2CQ4A 3VTIA 1MN7A 1T9WA 1M1HA 1EFCA 3HOVC 1VQPB 3MEDB 1UD8A 1TUWA 3FEXB 1F20A 1LQ9A 3Q38A 4NLDA 1J5OA 2J9CA 1RAIB 5H1SV 3MMCB 2QMUA 4Z4VA 1GT8A 4UW2A 1I6HK 4Z4SA 3WY9A 3W5YA 1SMYA 1UJ5A 1WUUA 5E3RA 2EKYA 3OFHA 3FRZA 1YX2A 3LP2A 3DXSX 4WK1A 4YMEA 2LQJA 4EGLA 3V5RA 5KG5A 2QTZA 3OW2R 4J37A 4RD3A 3KLGA 3QFWA 2MKJA 1N5YA 5JVHQ 4KMUA 3IWNC 2BXJA 3A1PA 4O3OA 2QE7A 3IR5B 1IBMF 4A3JC 1U1RA 1WI8A 4OI1A 4J9OA 4A8KA 1R9TK 3W5VA 3U1LA 3PO2K 4XMYA 4XONA 1FNDA 4Z4RA 4DV1J 1ZM4A 2CZ9A 3ZC3A 2BE7D 2IRXA 1X0PA 4HHJA 5HK4A 3GR1A 2PO4A 4BY1C 2NSBA 2ZHOA 3CMAB 3IWXA 4JI0J 4LBYA 2G2YA 2BQUA 1NKBA 2Q6IA 3TYTA 2HIYA 1JLBA 4C3LA 2GS8A 5BR8J 4DK0A 3OXLA 1VBKA 4FYDA 3S6EA 3DRYA 2JVRA 2VFVA 3DMJB 2YNHB 4R5PA 1FNBA 3FOEA 3SCJE 1CNEA 2A2CA 2GMLA 2ZBCA 4OYOA 1HD1A 2QX0A 3TP2A 4DR2F 2XMTA 4KHMA 4EO6A 4KBIA 1Q7YT 1HVXA 3MMBB 1F6TA 4ZN3A 1TL3A 1FWPA 1MLAA 2DR5A 3SMZA 2W6IA 4ZVUB 3TWZA 2K06A 4K4YA 2QT7A 3G96A 2W4CA 3D67A 2C2WA 2D9RA 4XM3A 1NDCA 4A3FC 3FOFA 1Q7LB 1DTTA 2CQBA 2BQ3A 5FIIA 4ZGNB 2W4PA 4GC6A 4WJBA 3BSNA 3LP1B 1TK5A 2B5OA 3FQKA 1IQTA 2G9OA 2CRVA 2ERRA 1IL2A 3QATA 3FFIB 1BC6A 2CW5A 4DR7J 3GTJA 4C0SA 2BE5A 2V8PA 1Q78A 4EBCA 3TR5A 4MJKA 2NVXK 3MM9A 5H59A 2JFKA 1UAWA 3OJWA 3ZC4A 4ZPCA 1FRXA 4CP5A 2ZJPQ 4C3JK 5KT4A 3GE9A 1Y11A 2YY3A 4HR2A 4X66J 3J7A1 3W2HA 3PO4A 2DH9A 1IKYB 4H54A 4BLAA 1SC6A 2E1AA 4YFNA 4DQIA 1VHOA 4HI2A 1LXJA 3FPPA 1D8ZA 2ZDPA 3VWSA 5DRKA 3P96A 3GCWP 2K3KA 3KHGA 2KYZA 4K4VA 2GJKA 1SL1A 1R0BG 4ZPAA 1WU8A 4QPXA 3NGDA 5IP9K 2IC3B 1PIEA 2ZZNA 1LW0B 4F25A 1XXCA 5GAEU 4J9UE 3DLKB 4UZFA 5F3ZA 3UR0A 2OK7A 3PNIA 3OLBA 3W2EA 3Q8RB 3M7VA 2JSXA 1VQ9B 2RRNA 3NS7B 2H5EA 4U7UD 3HO1A 5AT1B 3D54A 2KXNB 3DOKA 3B6BA 4RL1A 2ZXIA 2CQPA 4MQ9A 3SQOP 4XD7A 3GTOA 1LKZA 3JXOA 3EXCX 5F41A 4ZPDA 4NXMF 3DNCA 3FVYA 3DKDA 4DHVA 1PO6A 4DPXA 3HMJG 1XMOF 4C9DA 2A2DA 3L4KA 4QJVA 3UD4P 3DDIA 4QQBA 2E5LJ 1UW9A 5D4OA 5F4OA 4M5DA 3TOQA 4LQ9A 4BS2A 2HLUA 4URSA 4ILDA 3VALA 4DPTA 4RW7A 1TWAA 2HBYB 2DH8A 2W2NP 2WJVA 1S1UA 2IAJA 1DLOA 3VR1A 2GJFA 1NJIT 3Q3AA 2FGCA 1JLCA 2B56A 4DDFA 5IWAJ 3QRRA 4HIZA 5IYWA 5KSWB 2FVPA 2W24A 3I5BA 2RRAA 4OJ1A 2JFDA 4NEZA 5L38A 3LALA 1FRQA 3C2PA 2AGOA 2V6SA 4YN3B 3FEZA 3GTKC 3BDEA 1HBOB 4DQQA 2OKQA 1JLAA 3KDNA 3GTMK 1JMTA 1Y1VC 2C3MA 4DX5A 4K4SA 4MKBA 3GMGA 3OFNA 1GMVA 3I55B 1ICEB 4A8SA 1U09A 1TWHC 5J1NA 3HOZK 3PV8A 4A8YA 3OTOJ 1RTDB 3RB6A 4L3KA 4NX9A 3OBIA 2GJPA 3O1LA 1SJ1A 1UA0A 3FBFA 4KM8A 4XLEA 2F8EX 3BH7B 1RQRA 1TV6B 2A1BA 1MW7A 3GJSB 4PWDA 2D9PA 2QA4B 2HHHJ 1X4FA 5DDRC 3NL0A 2J6TA 2FZGB 4AVZA 5A8WA 2V50A 1HNVB 3F56A 5TMCA 2JVOA 4G1QB 4TN1A 3DU6A 2OP5A 1L3TA 4DV4J 2HHUA 3Q23A 4A3GC 2V69A 3GU0A 4OYAA 3MDFA 4G7WA 4B44A 4MKYA 3PXGa 1NPRA 4OIOA 4C98A 2QMUB 3Q2SC 1URNA 4TY8A 4XK8C 4HDGA 2AV5A 4OI3A 1VS3A 3GEHA 1Q81D 2RF2A 5CYJA 3L7OA 5CYMA 1XK8A 4Y2IA 2RILA 2BJ9A 3T01A 3ZTPA 1V5IB 5H9FJ 2UXDJ 2GSUA 4ZS6A 3KLGB 4YR2A 1NKCA 1N0VC 1FI4A 1QX4A 1U26A 2KO1A 2DXDA 2VG5A 1SKUB 1RTJA 3ENWA 1HWLA 3KLEB 1S1TA 2E7XA 4G0UA 5RUBA 4M4SA 3HK2A 5E3AA 3NCQA 4X62F 2N7CA 3VQSA 2AIRB 2MZQA 2JEJA 3TW0A 4Q8FA 3HT0A 2WVFA 2F65A 4KV8B 4D3GA 2YKAA 2ZTNA 1UVJA 2DHAA 1USMA 2VV5A 1VQOS 5IYNA 2ZNZA 2E5IA 1HNZJ 3IM8A 4LIWA 2W7VA 1IKVA 2BANA 1A7GE 3I6PA 1XNQF 4LRFA 3UE2A 1X4GA 2DR7A 4I6YA 3NCRA 3J80U 1XWLA 4FF3A 3WBKA 4V19X 4ZMMA 3HM9A 4EBEA 3M30B 1BWEA 2VG7B 1S1WA 3OR2A 4ELVA 3WXMA 3LO3A 4HHUA 1YHQS 1QFYA 5K8OA 5B09A 4ZLJA 3TFIA 2BACA 4C8MA 3W61A 4DF8A 1HWJA 2D69A 4RWXA 1ZM9A 1Q7YD 4ZPBA 4BDPA 5F0WA 2AMCB 3HFZB 2WHOA 3TARA 1EB0A 3RG6A 1YJVA 1NK6A 5KFHA 2VZ9A 2HHXA 2XSJB 1WC0A 2A6EA 3RBEA 4KRWA 5B0DA 2XULA 4FF4A 2WAQL 4DQSA 2UU9F 2X1GA 4I2QA 2QLBB 4DQLA 1I1GA 2OAUA 2ZE2B 1TKDA 3OXGA 4IG0A 4B3SF 2RS8A 3O44A 2PA8D 4GQNA 1G2EA 1C1BB 4KB2A 2AX0A 3S15K 2XHWA 1Q86D 4KH1B 3HT3A 3CSKA 3T9ZA 1LK5A 3IBFB 1S0MA 1UVLA 2MJNA 3IRWP 1V3ZA 4KY3A 1Y1WK 5L1LA 2G1DA 3ILLA 2NUUG 4C0HA 4DR1F 2ZZQA 4Y00A 4UTGA 3TQEA 2J7WA 1PBAA 2GIFA 3AVTA 2DRDA 4BBSK 4P52A 1MROB 1YLOA 1KN6A 4PQUA 4B9UA 4JMQA 2IA6A 5HZBA 4EZ9A 1IKYA 5CYQA 3M8PA 4LSZB 4M5GA 2WB1L 3W9IA 4Q2LA 3THVA 2YQ3A 4Y52C 2AEJA 5F9LA 1WOOA 3ZZTA 3V6JA 2ZUEA 4P7VA 2KJVA 1NPKA 5BSYA 3LAMA 4DUYF 4RUHA 1MN9A 4U8YA 3V6KA 1OYDA 1KWMA 1P1TA 3B82A 2GC8A 2B3TB 4XKVA 4R0EA 4IRKA 1JQGA 5DZ7A 2DGXA 4NRTA 2DEIA 3FEYB 3SDEB 1ZYRA 1LFPA 1KK3A 3WNCA 3PFEA 2E1CA 1WD6A 2LP4A 5BYRA 3FMBA 1DDIA 1DAXA 2QLXA 1RU0A 1FTRA 2DHHA 4YFUA 2OO4A 3IR6B 2HHPA 3S1QK 3RZDC 3R7SB 1HYSB 2YKNA 5E0OA 2V68A 2O5JA 3M8QB 1KHVA 1FTCA 3AOAA 3GTGK 5HVHA 2RKIA 1VLOA 5ADZA 3UDVA 3I9V9 5HZAA 1N36J 2R92A 4ECWA 5AE2A 3S1NC 2V7XA 2ZL5A 3A3OB 2J7KA 3LUYA 3T1HJ 3V76A 4IG0B 3A1YG 2V2QA 1NK5A 3WYAA 4PC1A 2XS5A 5ETPA 3AJ1A 4K50A 3ZZZA 2FHJA 1LEOA 2CF4A 2IRYA 4OHYA 1B23P 2IRUA 3UVJA 1K1SA 5AN9A 4PWUA 1YJ9S 2AJ4A 2CIMA 4LFBF 4RUBA 1IM6A 7AT1B 3DOLB 3GZ7A 1MROA 4K4XA 3CPWR 3FRYA 2DHSA 3FCVA 2VICA 2CPFA 2EFOA 1APSA 2PHCB 2HFVA 1NKEA 1RSCA 1VFJA 1JA1A 1JLQB 3PO3K 4A3LC 4JI2F 5DQHA 2VUMK 1O26A 3BO2A 4XOTA 4W90B 3R5CA 1JKHA 1RE1B 2XCAA 3VGSA 5U47A 3QZ8A 3MGJA 1XMBA 1UWBB 2KVIA 3J81j 1QH0A 4ZVTB 3Q39A 5BSXA 3HOUK 4C8KA 1BD6A 2N4DA 5E7OB 2BRKA 4IUFA 3WBJA 4AXJA 2Z2MA 3TUZC 4DSEA 5FD1A 2J9EA 4EBDA 2V4QA 4IFVB 4IFYB 4DPYA 1HARA 1RXOB 2PI5A 3MUMP 2WVEA 3BQ2A 2B7BA 2I9SA 3DLEB 3PVXA 3V4GA 2B8PA 2C5HA 4TT3A 1N5YB 3JSRA 3F41A 3AA9A 4WFXA 2GQCA 5CQGA 1DY3A 1YJ7A 3P4UB 3QIPB 5T7LA 4G1QA 3NUHA 4DL7A 3TRGA 3W60A 5KFPA 1Q82T 1O6XA 4J5OA 4EFAC 2AU0A 1YJWS 4XLAA 3VCDA 2QN6B 3R27A 3NE5B 2FD2A 3QNWB 3JSMB 3VO2A 3SSSA 2RIJA 1TWGC 2UUCJ 4FZBA 3TA0A 2AYBA 3QWPA 5L1JA 2IDLA 1RLDA 1ZPVA 1XR5A 5I42B 3GIMA 1LK7A 4KO0A 3AQOA 2HRYA 3TA2A 2FQOA 4WFBQ 3HOXK 4TKTA 1VQ6B 2GVZB 4A8MP 2LQ9A 3BDPA 5J2QB 1B70B 2WB1D 4TMTA 4TYBA 3CW2C 4FM9A 2UVVA 4N8NA 3CCES 4A8WA 1IM4A 4LBWA 2P9GA 2M70A 3DRSB 2NXEA 3MPVA 2EBBA 3JQPA 3C6TB 5GAHI 3HULA 1ZAWA 5THWA 4RLEA 3CCTA 3RTVA 4II3A 2AYGA 2GHPA 1NB0A 1JX4A 2AJ0A 4EUVA 4ID5B 1REVB 5KG4A 1BJKA 3CJKB 2ASYA 3S17K 4UZBA 3SQGB 1NXIA 1SV5B 3IC1A 2CXEA 4A3DK 3GJRB 5A2QY 1XJWB 1UD4A 4CLYA 2IPOB 2FVSA 3CCJS 2B63K 4IFYA 1UD5A 1VJEA 1VF7A 3DM2B 4DR2J 5D0GA 5LXYA 3ZZRA 4MAKA 2ZEJA 1O51A 4DMZA 3BO4A 1RA7A 3HP6A 5H9FK 2AQ4A 4FBUA 1T7PA 3PKYA 3P5TL 4X66F 2Q1LA 5D4NA 3PYFA 2JA7A 4Q43A 3PJ9A 2OSQA 1Q95G 2XZWA 3OTOF 1CPZA 2ZZTA 2ZBUA 4QYZJ 1P9QC 2QYGA 4FPRA 2HLDA 5D4PA 1N06A 5THXA 4I67A 4N5SA 3M32B 1N05A 2LECA 3MAQA 1SJRA 2HAIA 4JV2A 4N77A 3BR9A 2XWXA 1NDKA 1ZBSA 3SJPA 2A69A 4K4WA 1U02A 4MYUA 1ITPA 4TYAA 5IYCK 3CTAA 2K7JA 1CJUA 1GAWA 2HKEA 1U24A 1Y0HA 5KW9A 3MEEB 2OTJB 4FYYB 3JYTA 2NXJA 4WZKA 3PHEA 3LH2S 4WE1A 4AXIA 2QGGA 1H8HA 2HNZA 1F9EB 2DR8A 4N3NA 3SV4A 2CQIA 5E5NA 2FVQA 5FLMC 3I5CA 2WYRA 3OLAA 3G71B 1G7CA 2FLLA 1RWMB 4JV5J 2HVIA 4A3BK 1WHWA 1UL3A 1PYOB 1RUSA 3IMQJ 3ENVA 2JA8C 4OOXA 4OV1A 2AHOA 3HSGA 4FVCA 3RZDK 2MSTA 4YDXA 3I0RA 2LYVA 3V2UC 1VBXA 4ETXA 4N3GA 1WG4A 3QFCA 4QJVB 2YPZA 3RUBL 1AIPA 4JI2J 1JJ2B 5EUHA 2FJWA 2GMJA 2ZE2A 4F7DA 4DEZA 2XM3A 5B6IA 2WJYA 1WTFA 4X4QA 3AHPA 4X06A 3R1LA 4C8YA 4KHPF 2VKZG 1VBYA 3CC4S 2QV6A 3FBEA 2MKHA 1DTQA 5M2RA 1K0VA 1KQGB 4MEYA 2RQCA 3R3TA 4XORA 2Y1IA 4B9LA 1Q5VA 4Y52K 4ZP6A 3U2QA 4PG6A 1KLMB 4EEYA 1FRLA 1NH8A 3M4XA 2KKHA 5CD4H 3US5A 4RW9A 4ZOSA 1N88A 2MQMA 5IYBK 4XKWA 3S0XA 1O27A 2HEKA 1N33F 1Z2LA 3OW2B 2UP1A 1GXTA 3NLCA 4TKOB 1DQ8A 1YRTA 2DNKA 3TFHA 1SKQA 4WP8A 1N56A 3DCAA 3OUYA 4P75A 1OQ3A 2APOA 2QA2A 1F2HA 1AT1B 3JTPA 4YY3J 2KWAA 1YVFA 1QUFA 4CLSA 1ZTTA 1VISA 2AJ1A 3K5OA 2ZBVA 5KFOA 1U1PA 1RHMB 1JXEA 4ANEA 2ASJA 5JVGQ 2XNDA 4KGMA 5D4DA 1S79A 4B47A 4GKJJ 1F5AA 3V6HA 4F4YA 4X84A 2PIIA 1IKWA 3G2XA 1WKLA 5LMUF 2MDAA 2PD1A 1N5SA 1TMJA 4CO1A 2V4JB 1FJEB 3SEOA 5GMDA 1H38A 2VH7A 1ZTWA 4CLZA 1I5OB 3DXJA 3H3VD 4JUZA 2GQFA 5IYQA 3CO0P 1R5NA 4PC3A 3MAAB 3SV3A 1XPPA 5A6PA 1KK1A 4PXCA 1CJVB 4YP3A 1RT6B 1N8RD 4JYAF 2NVTK 4KN4A 1RT3B 1HI1A 4H9GA 4DFPA 2WR8A 3Q22A 5DG8A 2MKCA 3W8PA 4B17A 1F5CA 4HE6A 1E1QA 3S8SA 1EJ7L 4DV3J 3W3SA 3WHIA 4E8UA 4I68A 4G7HA 1PKUA 4PXBA 5L1KA 2DGSA 4B48A 1I6HC 2LFVA 3VGVA 3C6UB 2LMIA 1T6YA 1PILA 2YNFA 2CZVC 2XGQA 1U1KA 1QLNA 4UZUA 3I0SA 2YPYA 4U95A 4KFBA 3S01A 4FK8A 1XBWA 1H74A 4NYOA 1FDRA 3OFGA 4A8FA 2NXNA 1O2BA 2Z2YB 1TWHK 2F5GA 3ZO7A 2HVHA 4K5RA 3ENAA 5HROB 3KK3B 5TRDA 4P5BA 2V2KA 1IKXA 4A8QA 2V6UA 2X1AA 4F3MA 2VDIA 4B3TJ 2FZCB 4RW4B 3UNYA 2WAQD 3E20A 3RR7A 3CCQS 4ZVOB 2GVZA 3FSXA 3M2VB 2YTCA 3AOBA 4OZ2A 1VC6A 4ZPVR 4RDKA 2F4NA 4IH7A 4RDJA 1F3VA 5ETRA 2EBGA 3DXBA 1YJRA 3BGRB 1M5VC 3AODA 5DM7Q 2BANB 5HLFB 3N28A 3DHXA 4B08A 1EARA 5ETOA 1SJFA 2V4JA 3GDZA 2IC3A 1H42A 1U47A 2ZH3A 2KN4A 2P5MA 5CA5A 5FL7A 2OBRA 3BPSP 3TVYA 4CO0A 4OJHA 4DV6J 1ZA1B 1FXDA 5IYCC 2NS1B 2BW7A 3O8WA 2FJAB 2W7PA 2R3VA 1UMKA 1NHVA 2H5IB 2BKPA 3W5ZA 2ROPA 1WIHA 4NI2A 3G82B 2X0KA 3DDYA 1TL4A 1IN0A 3KTQA 2ASLA 1X9WA 4CNYA 2FHJD 1VH2A 4CDIA 2QIFA 3ZNJ1 1E64A 2ACYA 5KFSA 4AH6A 4QUZA 1N32F 1UVIA 4CT8A 2VJUA 5IXUA 4DSKA 2RH6A 2HWIA 1KC8T 2VD3A 4I4BA 4WXOA 5B0AA 4N8OA 4L75A 2VBYA 1GX6A 5BXIA 3FBBA 3IS9A 4USTA 4JI7J 3VAJA 3VF0B 2V7QA 1EK8A 1RP5A 1VRTB 4G7OA 3MR2A 1S77D 4P3IA 2KM8B 1FX0A 1VQ8B 2M52A 2PEBA 3U7JA 3HVTB 3GQCA 4AUKA 2UZAA 4ZVEA 2BGJA 3BSAA 5AXNA 1CNFA 2E5JA 3CD6B 2O3DA 1WI6A 3PIOQ 4II2A 1TU0B 1H0HB 1PG5B 2HPUA 3UD3P 2KFNA 3PEJA 3ASSA 1KFDA 1E1RA 3EICA 4A3GK 2CNDA 3MEEA 1PYSB 4D3HA 5DG7A 2HQIA 4GO7X 2FY1A 1NK8A 3MD1A 4LRBA 3D26A 2KYXA 3TI0A 5KFXA 3OSNA 4GKKF 1W9XA 4P2XA 4O44A 2PI4A 1R7IA 2JEIA 3VZHA 1K83A 3FC9A 2VBWA 3H20A 2KM8C 5TMFA 2ZC3A 4OIRA 1VK3A 4L74A 5TY0A 2W7AA 2LU1A 5I3QA 2XZOA 2WONB 2VZLA 4AF7A 1YWXA 2Q79A 2E2HC 3AAWB 2CDRB 1N5VA 4A3CK 2A6OA 2RH3A 4DI6A 1YIJB 3SLNA 1PC5A 3ILJA 3KJVA 4LR7A 3RGIA 3CDWA 2N7YA 5J2PB 2DB1A 1W26A 3W5UA 5LSLA 4YDDB 2G2OA 5C4JK 4LFAF 1DTQB 1UVNA 3CVKA 2OUGA 2V9KA 1X9SA 2BGIA 1VQ7B 5M5YK 4WPAA 2V8GA 3DLGB 3FHZA 1CS4A 2RQKA 3EPIA 4AF6A 4ECYA 5H9EJ 4KKTA 3CDUA 4NCAA 3CPXA 4Q5SA 1C4AA 3LGNA 3CESA 3MECA 3R5JB 4LBZA 1W2BR 2AKWB 1UP1A 4ACAA 2CJ9A 2GW8A 1S9GA 3N3YA 2FHOB 3HOUC 1WELA 3SCIE 4USIA 5A6WA 2UV8G 1I3OB 1FFSB 4XCHA 3R5DA 5MLCV 2HMAA 4TXSA 1M5HA 2MGZB 3JSTA 3BGFA 1N08A 4FPIA 1JKHB 2P9CA 3C15A 1C0TA 3PO3C 2GVDB 1RZMA 2DGTA 3S1MK 3LP0B 1Y4ZB 5DGAA 4MEXA 1WQGA 3IFEA 1TKTB 4WXWA 1Z2ZA 4A4JA 3OZVA 1SJ4P 1DFDA 2BOPA 2NVXA 2GO8A 1SQFA 1SC4B 1I6VA 1B4BA 1FJGF 4TU7A 1IBLF 1CSJA 4J9PA 2VUMA 2E5GA 2EKNA 4K4ZA 3NGSA 1ZQ1C 2EPIA 2AW0A 4NXNF 3OE7A 2GJIA 2R42A 1UFWA 4LT6A 3OUYB 2PPBA 4YHHJ 4LSLB 4JP8A 1UD3A 4LF2A 1HNWJ 2OPPA 3DI6B 3M3YC 2HWTA 3MMPA 1RAGB 3L4JA 1DQAA 2DGUA 1XB2A 4JI8F 4JB8B 4OPVA 2YQ0A 1Y7PA 1R8HA 4IRDA 4XN0A 2KXHA 1JK9B 3D1QA 2E1PA 4KV8A 1WQFA 1Z1ZA 2IA0A 1HW9A 4NLSA 5FNZA 2XZTB 1WACA 1I3QA 4NL5A 3RW7A 2CPZA 3SXLA 3GTKA 1VCTA 4FKXA 4F4WA 3MM6B 2ZUGA 2D6FC 4A3LK 3R6KA 4NLTA 1X9MA 4RW8A 4XOPA 4MIAA 3CD0A 2VG7A 4USMA 3C6TA 4YB6A 5J1PA 5KFMA 4IR9A 2UUWA 1QVFB 4MFBB 2IJRA 4OI0A 2MGZA 4KHPJ 3KLVA 3EGVA 1YJTA 2XLJA 4ZLLA 2DYAA 3MEDA 2W8KA 2OPSA 3SEJA 3FSIA 4ILMA 4CT9A 3S2HC 4GRSA 3S2HK 4QYZK 4BC9A 4ZJLA 5CABA 1JXVA 2B9XA 3BGLA 1V0FA 2CJXB 5HQMA 2V7UA 1KD1D 2R8GA 3LWLA 2VFTA 2BVZA 4Y2MA 2JNJA 4RNOA 3SIPB 2R93A 2F7VA 1PSDA 5EWEA 1RCXB 2BX6A 3BCDA 5F8GA 1Q1KA 2GMHA 4QWBA 4ZDNA 1MU2B 2QYCA 4HL9A 3S15C 4U67Q 2E1RA 2C2KB 1EXMA 1AFJA 4GT9A 1R8BA 4ZKAA 4F67A 3JQMA 3AB2B 4KB7A 4WTYA 3VVTA 3KMSA 1F0XA 1RLCL 4CM0A 1HWUA 4BBYA 2H48B 2XZPA 1TL7A 4IQMA 4DJBA 2ZJQQ 1NJYA 5JBQA 3NBPA 4LF7F 1V5VA 3M3YK 4DV2F 1C1CA 1WOSA 5KT6A 2K8GA 4OQJA 3MCNA 2CUYA 1CULA 3VAIA 3A13A 2CWKA 4LBPA 2XGPA 5HO4A 1L5UA 3NGTA 1F5BA 2H9ZA 3FQLA 4F02A 3UN5A 2HVEA 4IOCQ 1JIHA 3NXZA 2OFGX 1XNRJ 1VQ4B 3QGIA 4WYLA 2HBZB 5FO1A 3QMQA 2LDIA 3EZUA 1RU2A 3M9MB 4WKYA 5B7WA 4UAJA 4AFFA 2HGNA 5LMNJ 2BOAA 2NYHA 2EC2A 2LXFA 4TSFA 3K5PA 1R8CA 4HVZA 1KRPA 3SFGA 2HQ3A 4X65J 4KT0C 1NJWA 2D3UA 2AHOB 2VPXB 3VGTA 3H2LA 1T03A 2C3YA 1R6VA 3BSCA 3D28A 3QIDA 2JA5A 1CG2A 4P71A 2IM1A 2B6AB 2UXCF 3N9UC 3Q86A 2R9LA 1T95A 3PRVA 4LF1A 4PC6A 4EU0A 4OIQA 5DDPC 4BLBA 1MRZA 4KAWX 1NLKL 4XPEA 1UEKA 2X3DA 2RKIB 1RHUB 2JWNA 4RUCA 1E3ZA 1TWGK 1CBKA 1G4CA 2ZH1A 2VFRA 4U9RA 1PAUB 3CTRA 4XLNA 3WX4A 3A8EA 4XN3A 1Q79A 5J35A 2CQ0A 4DR3F 1VRTA 4NRUA 1TWHA 1XZQA 1KLMA 1RTZA 1HQEA 1KVJA 1LOUA 1XR6A 2OH2A 4M5HA 4RUAA 4UZCA 5KFEA 2PA8L 1FX2A 1IBLJ 5KFUA 3VV2B 4YAOA 2XSFA 1YI2B 4KGZB 4QFMA 2VIHA 2CZ4A 4JI5F 3D1OA 3RZOC 1OY9A 3S2DK 5C3EK 5HANA 1KDNA 1B7YB 4P73A 3GV8B 2D1CA 5DJBA 2PMZL 3HHLB 3ITHB 3PX0A 4WWSA 1IJFA 4M63A 1X4CA 2CNKB 3BP8C 1C0AA 3MUVP 4DX6A 4A93K 1K83C 4XLFA 3V4MA 2OFHX 4LJMA 2JL9A 3DRPB 2MLXA 1N6QA 1Q8IA 4KC6A 3CCRS 4FNIA 1QUVA 4PGOA 3G6YA 3MECB 3ZFVA 1PC4A 2O66A 4YELA 4MK8A 4K4TA 4FYWB 4IW3B 2B4VA 5HP1A 3TVZA 2XMUA 1EKRA 1Y9OA 3T6JA 1K9MD 4OZLA 1TKZA 4JV1A 1Y00A 2VODA 2UXBF 2ZM6J 1IUJA 1OGIA 3QJPA 5DS7A 2QN6A 3EE3A 3HZEA 3IRXB 5KFGA 2CPEA 1NMEB 4NXMJ 1NZ8A 5L8RC 1VQNB 3LP0A 1O8BA 3RAXA 4IG3B 4QZVB 2AJFE 3CJ0A 2E5LF 3L7PA 2E9TA 4ANCA 1AUDA 1P9YA 1WSRA 1WTBA 2JLGA 3H3VL 2E7WA 3D2WA 2OMLA 1JJ2R 3ASRA 4AQYJ 3SLDA 2WBRA 2DNGA 4N47A 3N6MA 3R2DJ 2CNNB 2GGPB 3C6UA 4DR1J 1S9GB 3JU4A 3LVBA 5LSOA 2RE1A 1QJHA 3CJTA 4LF8F 4DFKA 4Y2CA 4LSLA 5F4MA 2YKPA 3MMAB 1GO2A 2BQRA 4ZCLA 2W01A 3HOYC 3PCOB 2D41A 1SPBP 1VGXA 1S49A 4OHVA 2G0JA 5L46A 1S99A 5IP7C 4B3MJ 1VR6A 3SQGA 3OZUA 1DBDA 2RC6A 2WZNA 4PQUB 2QC3A 4NLWA 3CIZA 1S1XB 5KOXA 4O0IA 3R5BA 3K59A 2KB2A 3OZWA 2FLPA 2BABA 2HQCA 1T9TA 1O28A 4P26A 3H0GK 1HZEA 4GTLA 4AL6A 3ENQA 4NZ7A 1QM9A 2CJAA 3EQLA 2G4BA 1Q8KA 5D4LA 3CCVS 2VG6A 3G9CA 4AL5A 1UEVA 2GAHC 2OYNA 3JAMY 2ROEA 2CPJA 1D1UA 2H5JB 4MH8A 3H8YA 4DL0C 1VJSA 2K2PA 4GTCA 2CWXA 3BV8A 3HSZA 4KHRA 1NJXA 2EW9A 1N36F 5K8PA 3SSRA 4QU7A 1YBTA 4LBHA 3VMFA 3OR1B 4ECXA 1C0UA 2G1HA 3UW1A 2W1BA 3PRDA 1HHQA 2OBTA 4NCGA 2NR0A 3RR8A 2DNPA 2G2ZA 4OOVA 3MTKA 1N0UA 1RT7B 1EH1A 3RY8A 3QLHA 1XEZA 3C66A 2QEXS 2DNHA 1WEXA 4C2MA 1S10A 3LAJA 4Q4ZA 2P3MA 1FKPB 2UVUA 3FFIA 2FUG9 1R0CB 1QE1B 2HFUA 1UWAA 1OSCA 4AE5A 1N5TA 3VAMA 4DQRA 1GXUA 4Q2MA 4LR8A 1KTQA 2CADA 2UVWA 4Y0FA 1Q4RA 1M1GA 1HWIA 4K2XA 5K8MA 4ZV4A 2RQMA 2P6SA 5D6GA 1TVRB 1S72B 3EXYA 4IR1A 4LF8J 3A35A 3GJTB 4BY7C 3T6BA 2ROGA 4F3OA 4G0VA 3FMWA 4ECZA 4P7TA 1HD0A 1Y1WC 3ETMA 1S1XA 4O23A 1PBUA 1IBCB 1KTVA 1WG1A 1S76D 4PCQA 4F7VA 1IKVB 3IAM9 4DPUA 3OTCA 2B63A 4XL9A 4DNTB 3GG0A 1VMBA 2OIHA 3BEGB 4P74A 2YWWA 4CH0S 2WK4A 1U6ZA 1D2EA 1N07A 3HVWA 1SFOK 4QVAA 1IBAA 4L72B 3W2VA 4X8IA 1KBRA 4DR4J 2MMYA 2BE9B 3G4AA 1XE1A 1T0TV 1TWFA 3CMEB 1ZAXA 2YNIB 4XLCA 4QW8A 2OJ3A 4WQMA 4ZVSB 1V9OA 2PSZA 3OEEA 2X7IA 2BDPA 1M5PC 2UUCF 3UNGC 4RD6A 1NDLA 5J2PA 5F0UA 4YAWA 1QSLA 1ZM3A 1SKSA 2V2VA 3KLIB 4LR2A 3B78A 4ECUA 1F7VA 3OHAA 5B0CA 4NLYA 2B5JB 1MWQA 3T41A 1WSVA 1SKYB 2X1FA 2R8HA 3H94A 2C3UA 1RISA 4DPOA 2OEJA 1ZM2A 3I96A 2U2FA 2MTLA 3IGVA 1UTAA 2KVQE 4A3KC 3P27A 1Q16B 3KNGA 2DNQA 1RBOB 3MOJB 4C11A 2IMOA 4MT1A 1QGZA 2DXFA 3T5HA 2R7UA 2DNZA 3DDKA 1F9FA 4X4PA 1F1BB 2XYHB 1OYEA 4PEOA 4OX9J 4QWDA 3CPWB 5IYDK 4WTOB 2ALZA 3T00A 4J7CA 2C2OB 3CO9A 2KG0A 2B9WA 2FTRA 3HOVK 1K73T 4YB5A 2V6TA 3R7BB 2XMWA 1VQSA 1J5OB 4MMOA 2HW3A 2JJ2A 4DLGA 4KPYA 1TAUA 2QMXA 2YX4A 3V4IB 5F8HA 4RNMA 4BLGA 4O4RA 1SQGA 1OY6A 5T41A 2M8HA 1DZ5A 2J8AA 2QFJA 1IBMJ 4RW6B 2D3OR 1TKTA 4KH0B 3EYZA 1FD8A 4BPRA 3MEGB 3DM2A 2LXUA 3MWBA 3SFUA 4DV1F 2CQ2A 4A3JK 4KPCA 2QSWA 2CW0A 4QR0A 1R27B 5TV2A 4Y65A 3KHLA 3O6QA 1RWXB 1BWVA 4R25A 1QDUB 3GIKA 3O3LA 1BGXT 2HFNA 4KGXB 1G51A 4ZJQA 1QAXA 4DU7A 4TQRA 2JX2A 4YR0A 4JI1F 4GO5X 1JA0A 1ZS6A 4X7FA 2DNNA 2DR6A 1QTNB 3HI9A 1I8DA 2RSQA 4NMLA 3I4MC 3IBWA 5J2NB 1RTDA 2Z30B 1RAHB 4E0DA 5CYMB 3M8ZA 5GMKa 3GTMA 1TAQA 5AXLA 4F26A 2I38A 1XXAA 4ANDA 2UUAF 2ZHBA 1R89A 3OV7A 1U0SA 2R7SA 4ZVQB 1T9YA 4RW8B 1WEZA 1RDRA 1LWFB 1O5JA 4GTDA 4UQTA 3K89A 1U2RA 3OAAA 4X4RA 2OI2A 2V8DA 1RTHA 1RT4A 5EGEA 3M4OC 1BQMA 1JJCB 4USVA 3EDRB 5AE1A 4FXVA 3E2EA 2O67A 1I50A 4FVMA 1U1MA 2HK3A 5IWAF 2BUNA 4OX9F 2HHSA 1PJ7A 2XZDB 3BNWA 4CRJA 4KIAA 4Z4ZA 1ULRA 2LQ8A 1S1VA 1DCOA 2CRLA 4Q0BB 4DV3F 4B3OB 1DTTB 2CQ1A 2Y9HA 4WU3A 5KG1A 3CCMS 2LA4A 1RQ0A 2E1BA 3O2IA 2VPWB 4ED8A 2IM2A 1BLIA 5FA6A 5CJ9A 3H7HB 1YNNA 2GNKA 4TMVA 2CVIA 3JS9A 1N34F 1YZ6A 5F8JA 2Q43A 4PQAA 3IS9B 3MM9B 2XLIA 3AB4B 3LW5C 4YFKA 3TA1A 4CLKA 3T1YJ 1U1OA 4MYTA 3DGPA 5GV8A 4WCEQ 1VRQC 4RW9B 2HVDA 3PW0A 3MPUB 4ED4A 4ZVFA 1BJTA 3LAKA 2ILZA 2WW4A 3I4NK 2L3MA 3RZOK 3M2RB 5E41A 1MWZA 1HKAA 2ILYA 4P1VA 4IQXA 2HNYA 5EDWA 3KLFA 1JJHA 1VDHA 2D7SA 2RT3A 3ASTA 1Y1VK 4F4AA 4YHHF 1J5EF 2VBSA 5DLGA 1TKXB 3D1HA 1RYSA 1N8RT 5HQLA 2CA9A 4KN7A 3KG1A 1WNEA 3S7RA 4Q8EA 1LWXA 3ERED 1EI6A 5SZTA 3G86A 1VQ4S 2C2EA 3SZYA 4V1Ak 2VUGA 5J2MB 2VB6A 1FO1A 1RWVB 1K0TA 1JLEB 4FP9A 3ZIAA 3CJQA 4PXDA 1LV5A 2NVXC 2EFNA 3LAPA 3H4BA 2BN4A 1HQUB 4C43A 4CQJA 2Y1JA 5KFDA 3KYLA 2PC6A 4OHXA 1BMFA 1XQBA 1NM2A 3ZBTA 1CC8A 1FEHA 3KJVB 2WSEC 5K14A 4QWEA 2BVNA 4B43A 1FKAF 4WZQA 5AE3A 1C1BA 3KUHA 4PG8A 1FWLA 2BF4A 1RT6A 2CQCA 4A3FK 4RW7B 4ECRA 2BJ8A 1X5PA 2VA2A 1XMOJ 2MPUA 3RRKA 3SDEA 1EP1B 3W63A 1NHKL 2EFVA 3IXQA 2HWHA 3MR6A 2WRMA 2QL5B 1TL1A 4K1XA 4QU6A 4Z1MA 2F4FA 1VQKS 1FT8A 3U27A 4OLPA 1HA1A 2XOKA 1RWOB 2ZH5A 3LWMA 3R5GA 4N56A 5HL7Q 5IOSA 1RQPA 2D3O1 2X8KA 4JI1J 2DVIA 4KAIA 2L48A 1RYRA 2BKOA 3M4OK 3BH4A 1SJQA 3SBMA 1RKIA 4BBRC 1C0TB 4O3QA 1N6QB 1VRUB 4WYWA 1H2UX 2BE2A 2X51A 3CCZA 4B9MA 3N6NA 2CG8A 4DV2J 3PG9A 2ZM6F 5GMEA 2DITA 3TZXA 3G87A 4OX8A 4R0JA 1I18A 5HLFA 1HBNB 1YITB 2CVEA 4TU8A 1VOMA 1FJ7A 3GLJA 3QT6A 1AMOA 4NNJA 1X4DA 3BJYA 1TKZB 3DMJA 4I64A 3I4MK 4CLLA 1HL6A 4G1VA 1C2PA 3H98A 3BGOP 2ZOGA 3CJ2A 2WTFA 5KFNA 4LFAJ 3VNVA 5I4MA 1BX1A 4IOAQ 2HHHF 5C5JA 1RHQB 1WP6A 2HCJB 3GCXP 4KE5A 4X4OA 3I4HX 2OPQA 3D6FB 4OPSA 1KK0A 3HOWK 2DGWA 3U6BA 2RDIA 3N01A 2V31A 5A8AA 3TFJA 2P9EA 2DJWA 2E2HA 4HYKA 2JC0A 1WC1A 4JI7F 3MPYA 2X53S 2VC1A 2XB2D 1RHJB 4B3RF 5C24B 1EETB 3PVDA 4R5PB 3H0GA 2V94A 2DEJA 3OEHA 2ZH2A 3E51A 3AY0A 4ACBA 3I56B 1RHKB 3KLEA 2IVYA 5L9XA 2MHEA 3OJUA 1JOEA 1S1TB 2OPSB 2IYGA 4B9VA 1SFOA 4M5KA 5HMXA 2BYCA 3HHKA 3L3CA 2XC9A 2OD6A 4ZIWA 2SXLA 1N33J 4F4XA 3A3PB 4KO0B 1U7LA 1FCAA 3ADAC 2JA5C 1S4MA 2JA6K 2LVWA 3LPXA 1WF0A 3HX9A 4DN9A 4Z7CA 1E6VB 3CD5A 4Q7AA 3A3GA 2BBEA 5M5XK 3KG4A 4L76A 5EN1A 2NV4A 3DRSA 4HDHA 4X4NA 2MQPA 1OWXA 2COLA 3GTYX 2HIQA 3BYPA 5FIUA 3M30A 1YG0A 4QIWL 4J9MA 2WSFC 5LJ5Y 5F8LA 2Y1LB 3AA8A 2I1LA 1W0JA 1TP7A 3QE2A 1VGYA 1K1QA 2AYMA 4NLRA 5LM7E 3NOCA 1KQSB 3R6LB 4DN0A 4Y34A 3NRBA 2C1EB 1CC7A 1DCHA 2GSNA 1GTEA 3T9NA 2WONA 4IO1A 4A8XA 3KUGA 7FDRA 1Y10A 3HSDA 4C0OC 2DISA 4OYBA 5C4XK 3OHBA 3E1YE 3KHHA 5A0YB 2VQFF 1YIJS 2LQ5A 3C14A 4U6PA 4KJIA 3GEEA 4QVJA 3H25A 5EHHA 1U45A 1UFKA 5EX0A 4M95A 4OX7A 4NASA 4OI4A 5KFIA 1K44A 2KHDA 3NNAA 3K0JA 2GX8A 5F4JA 4EWTA 2BJEA 3PYDA 2MKIA 4BKWA 4RU9A 1PGZA 4OYWA 1EETA 4TMXA 2K3IA 3J81Y 2FQTA 1RAAB 2HGMA 1M0SA 4Q5VA 1J2VA 2MHNA 1SM4A 4YEJA 5D15A 4R8UA 3M8WA 1WF1A 3FKBA 2XHCA 1VQLB 1G7SA 4ENOA 2R6HA 4KARA 2A6HA 2WOMB 2VJIA 4I2PA 1SV5A 3DHWC 5B0BA 4OHZA 2GREA 2Q6OA 2HRUA 1D0EA 2RJZA 1H7XA 2N3OA 1FRKA 2EFQA 5HBMA 1IJEB 4OYPA 4RPBA 1RAEB 2GCFA 3JAMU 3I56S 4J9QA 3BS9A 2EIXA 2ZZMA 3AH5A 3VA7A 4RDLA 3AJDA 3M6WA 4K4UA 2V7TA 1XQIA 2R8KA 2J0XA 2C3OA 1HA3A 1J27A 2J0SD 4WZTA 4H4MA 4U7UK 1FEEA 4U7CA 1FXLA 4GTFA 5KG7A 2CNOB 4USWA 4YY3F 2HHVA 1BHNA 3S1MC 3HOYK 4ZA1A 4OZ1A 5C44K 4P72A 2YVSA 1JLGA 1NNDA 1JLCB 1YQHA 1QSYA 2DO0A 4ED0A 3UN2A 2CQGA 2LKZA 3HOZC 1JLEA 2UUBJ 2D74A 3PEHA 3ZNUA 4P5AA 3IG1A 4C48A 4WZEA 2VQEF 3AFGA 3G82A 4TVAB 1BX0A 1SC1B 4QOTA 5F8MA 1WC3A 4BBRK 4DR4F 4NA2A 4DV6F 2RD5C 3AXMA 1M1KD 3CDEA 4OYZA 4AL7A 1WKJA 4A3BC 4BWMA 1S57A 1NAQA 3KNAA 1KEKA 1XXBA 1RHRB 2XO7A 5C42B 1YITS 1UVMA 3QGHA 2B8QA 2B4OA 3AH6A 4DPWA 1O29A 1XZPA 4WJ3M 3GB0A 2I5JA 2ZZFA 4QIFA 2ZOMA 4MTPA 1RT1B 2HSEB 3NAIA 2HBQB 1NO8A 2B7CB 1UCNA 4ZHRB 2WVCA 1E3XA 4X6AK 3GTOC 3IGNA 2CKWA 1FXRA 3NWGA 4XLPA 5HATA 1YI2S 2E2JC 1COWA 3WIUA 1OQ6A 1JLQA 3R6JA 3QJLA 2MJUA 3HHDA 3ZTOA 1Q8LA 1G7TA 2QA4G 1NUEA 3N0CA 5C7PA 2VUMC 3HCXA 2PMZD 2GQ2A 4NLUA 2AWZA 1AA1B 1EP4A 2KDOA 2F8HA 2CJKA 2LU2A 2E66A 2BM1A 2HZVA 3CT9A 4LFBJ 4AC9A 4DV0F 1WKKA 1IQ0A 2VDHA 3QT7A 2R2RA 5AXMA 1VQKB 4L8JA 1ZOTA 4DF4A 4X0CA 1KMHA 2H51B 3S1RC 4P2FA 2POKA 3GTPC 3KLHA 3DLEA 8RUCA 3TTGA 2PMWA 1GMWD 2D74B 3UFCX 3L95X 3PIPQ 4RNHA 2RAQA 1I3QC 2YX1A 2M5YA 2B7BB 5A8KB 2EWHA 4ZIVA 4ED1A 1ZH5A 4A3DC 3GTGC 4JI5J 5HN0A 4B02A 2C77A 3ISZA 3IP0A 4AD6A 3FNNA 4P25A 1MWYA 3GFHA 1I7PA 3S1QC 3MMAA 1KK2A 3K58A 3MCAA 1ZAVA 1VC5A 1Q8BA 2QL7B 3DYAB 5CZVA 2HBRB 2Y3YA 5KFYA 3ISND 2OPQB 1HWKA 5E2QA 3I5AA 2Y0BB 1PJ5A 2XY7A 2BA9A 4ZCIA 1X4BA 5J2QA 3JSYA 3TVKA 2KZZA 1BMQB 5LL6d 2J6SA 1E6YB 2V8VA 5K20B 2RS2A 4JI6J 1E63A 1SXLA 4IDKB 1U6FA 2VHGA 4OZNA 4F0HA 1TVCA 3I32A 3TEGA 2IJFA 1RK8A 5FO0A 3MXHP 3HOXC 2R93C 4G3IA 1FRJA 3QLHB 4RD0A 5A8RA 4L3NA 1S1WB 1FA0A 3TZYA 4PPDA 2E2JK 2W9AA 4ID8A 5D3GA 3NS5A 4DSLA 1GFWB 4FF2A 3BBFA 1GJRA 3MAAA 1RA6A 3IWLA 1D3WA 4LREA 5TJ3A 4J9NA 1TWFC 2DXEA 4QWCA 4JK1A 3MD3A 2O1PA 1TVRA 2H4YB 2IDEA 3G6VA 3OPKA 1AXQA 4Z7YA 2XTJP 5JJBA 5D0HA 2JDJA 4TLQA 5L9NA 2I6WA 1SL2A 1SH0A 3KLHB 3R2CJ 3LO8A 1NJZA 3R7NB 1PAEX 1L0WA 3FCHA 2XO6A 3TAMA 1KC8D 3A8JA 4G1BA 1UA1A 2DO4A 4DR5J 1RJJA 1H85A 4CYUB 2YU9K 1QE1A 4C3MA 2EI5A 1DLOB 2V7WA 3CC4B 2EG1A 2OPPB 4C6AA 3GTQA 1N52B 4J9LA 2KU7A 4USKA 3M6VA 3RAQA 5KTQA 1TWCK 4NXNJ 4F3QA 5IORA 5LSRA 2B4PA 4Z4YA 4Y7NC 3PO2C 5BYQA 1B7FA 1SB6A 2ZH6A 5IZHA 1U1NA 5KFAA 1WCMC 3QSYA 3WODA 4GZYA 2YKQA 4Y9UA 1RWWB 1QAYA 4QW9A 4IKAA 3OD2A 2Z8QA 3MM6A 3OOCA 2YNGA 3FK4A 2VBVA 3PX6A 3M6UA 2R4FA 1ZVUA 1YK9A 3PR5B 3UPFA 3D6MB 3UDLA 2L9DA 3UCUP 1HW8A 4RU2A 4X4SA 2EBEA 3OREA 2P8TA 4YAFA 2O01C 4F0MA 4CLTA 2QLJB 1OB2A 2H65B 4Y7CA 4USHA 3AVUA 1KQSR 4QPTA 2JA6C 1S4FA 3ETOA 1SC3B 1SKRA 4C3HC 2OTJS 4OV6A 1HPZA 1I50K 2F8MA 4XNFA 4WFZA 2UXBJ 5F8NA 3BF4A 5ETLA 2R7TA 1HIYA 1EHWA 2ZTGA 2DNMA 2YU9A 5G0RB 2Z4PA 2DHGA 1GAOA 3DN9A 4FF1A 3UQSA 2R7ZC 2ZKUA 4K2JA 1RT5A 3AVVA 4LVNP 5CAAA 4ER8A 4H4KC 7FD1A 4RLZA 2BSAA 3W1YC 1Q81T 4A47A 1K28D 2M9KA 2DYIA 5FLMK 2ZOFA 4TY8B 3CDAA 4I7FA 2EXUA 3SYZA 3NP5A 2ZUAA 1OJ4A 2ZHAA 3D6TB 3T3FA 2W25A 2KL8A 5B0GA 3MTJA 3M05A 2CG4A 4K59A 1ZYQA 4CZCA 3G05A 2A68A 2QLFB 3CCWA 4UOHA 1T5EA 1CULB 4DL5A 5IYBC 2F9JA 2NVQC 4K0KF 3WNBA 5JXSA 1FK9B 1O2AA 2X6XA 4NLGA 4KMDA 3SKBA 1X5OA 2KT3A 4MK7A 4LF6F 4BWJA 2ZH7A 4P10A 1TK8A 1MSWD 4I1TA 3P8BB 5F3TA 3GYNA 1UV7A 5ETVA 5ITHA 1M90D 5KFVA 4DS5A 2EEYA 3PA2A 3IBCB 9RUBA 2V63A 1X60A 1S7HA 3DLGA 4MIWA 4QHYA 3G6XA 5B08A 4QIWD 2RB7A 4WKRA 1OPIA 4DCOB 1SQEA 1AW0A 3CCUS 1FRNA 3DRXA 2FLNA 5IYPA 1IE0A 1NDPA 1VYAA 1QTMA 2D9OA 3MEGA 1HBNA 3RB3A 1A0OB 3Q8YA 5ETSA 4OIPA 1A6LA 2B6AA 4XLHA 4JYAJ 3FJ2A 2IHR1 2RU9A 5KNLA 9ATCB 2B63C 3JQJA 3W65A 3A3BA 2GIRA 5M5WK 4O4GB 5ETKA 1OGJA 2YKMB 4G7XA 1S5ZA 1CJVA 3VQTA 2HFOA 3EPGA 1GNKA 2R7VA 3JSMA 3DRRB 2XMMA 4BXXC 1S12A 4M1KA 3KMQA 2GHWA 5GAHU 3GIRA 2LCWA 1IR2A 1F60B 3G8TA 2JRSA 1QVFR 3OTBA 1HMVA 2R7XA 4MIBA 4EO8A 1U6BA 2OD4A 2OELA 1T8EA 4JI4F 1IXKA 1GK8A 2DR9A 5C24A 1SI9A 3KOAA 3E01A 2DBBA 2HFZA 1T05A 5FJ8K 1ROFA 5HMYA 1FVSA 1S6PB 1BQXA 4KB4A 5KT7A 3OL9A 1X4AA 2Z58B 1TWCC 1NB7A 4WIIA 1BQMB 2ZWOA 2MY8A 1JLFA 5GADI 2QE5A 3GG1A 3MMCA 3QZ7A 4F4ZA 4Z4UA 2JLFA 2WW8A 3BM7A 2VPZB 4XDCA 1S72S 3X1LB 4F8RA 2R7OA 4IRCA 3WQZA 3WIVA 2VYQA 3VR6A 3M2VA 2E29A 1WDDA 4FDFA 2QRRA 2XNQA 1QAJA 3M8PB 1VBZA 4RBVA 3PX4A 3K7AC 4OL8A 3BKTA 3PTWA 4ED6A 2JJ1A 5L39A 4A48A 3POTB 3NS6A 3TUJC 2ZFHA 1EAYC 2YNHA 5A8RB 2UVRA 2X6YA 2VQFJ 3BZQA 3K7AK 4X64J 4C2MC 3RB0A 1KZLA 1RCOB 1FRMA 5C2GA 2ZWPA 3PKMA 1SCJB 2Q66A 4A3EC 5M2UA 2XCQA 4PC7A 2VFUA 4KM9A 4KQZA 5J2MA 1RBAA 4CM2A 5A0YA 5IS2A 1NEEA 5BYSA 4FN5A 2HNDB 1FNOA 4MK9A 2DGOA 5FJ4A 2OGUA 3OVAA 4NYPA 2FHMA 3BH6B 3KEWA 3OT9A 1FDBA 1JLBB 1Y5LB 4NLVA 2VJJA 3E8OA 1VJWA 2KZMA 4GVBB 3CUNA 5E3PA 3NAHA 1Y1WA 4W98A 1UJ6A 4OYXA 1KFSA 1H6KX 5KFRA 1USOA 1KOOA 3PW5A 3G4CA 4GTBA 4ES1A 2EK6A 4RD2A 2GIQA 1TKXA 1QUEA 2IFXA 2F43A 3PW2A 1QAIA 3CNQP 1OS5A 1R31A 5HJYA 4JI4J 1NZAA 3MZIA 1ZXOA 2ZBRA 2GO9A 2WCXA 3W66A 1VQYA 1HFEL 1JLFB 3F0NA 4CNZA 1X5SA 4R8UB 4BXXK 3H40A 3L9ZA 4X7EA 1WC5A 2KI2A 2IVFB 1NPPA 4JV0A 2YXLA 4ED5A 1S0VA 3FCWA 3GTMC 1KOHA 2DTJA 3GONA 4RM0A 2MKSA 3T1AA 4DL2A 4C97A 4CWBA 4WZLA 3V7AA 2Z0GA 4TNOA 2WSSA 2NPFA 1HNXF 5D8HB 5HKKA 3GFXA 1KQKA 4BCAA 3KWMA 4FNHA 4K7QA 5KFKA 2W7OA 1RTIB 5AJ3F 3NNCA 4LC0A 4M5NA 4H4MB 3TJ8A 3AGPA 2HURA 1FNXH 2KTQA 3DOMB 4KKSA 4LMZA 1TL7B 1S0UA 5GVQA 1FJCA 1K73D 1S97A 2BEFA 2QEXB 1SVDA 1E79A 4P12A 5GAEI 2NZ4A 2F40A 3ZZYA 1HLWA 3TAPA 2CQDA 1DD5A 2A3JA 1TL1B 3PR4A 2VFSA 1NB2A 3RAMA 2F1LA 1T11A 3KFWX 1K83K 5DQIA 2XI3A 5KFJA 2A0FB 1FD2A 4P2SA 1KQFB 2XLKA 3CCSB 4G0WA 4UUXA 1F2GA 1IS1A 3OFFA 3V81A 3GEIA 2PE8A 1TQLA 4GVLA 1NK0A 1H72C 1KSPA 2PMDA 3MM7A 3H2UB 2XS7A 4XAKA 3IPJA 2H54B 3CJSA 1B4AA 2Z6BD 1BQNB 5ETQA 3CCVB 3G8QA 5IP9C 1GMWA 4ELTA 2GFFA 2B51A 4PZVA 4I69A 2ZNYA 2ADCA 3LOUA 3FZ2A 4DCJB 1DARA 3T56B 4C0BA 5JMNA 5H5JA 2C28A 3N0BA 5E33A 3A8IA 4ES2A 2QJ3A 4N76A 5DSZA 1I6JA 1IVZA 3OW7A 3K8VA 4OZ0A 4OIXA 2XNRA 5DLFA 5IYDC 5MAOA 4PXEA 1EQ0A 4EZ6A 4LF9J 1O2FB 1RTHB 2HQGA 3C16B 4U8VA 1U2CA 2OK8A 4QIEA 4O0NA 4IOBA 1XMQJ 1S6UA 4QR2A 1X31C 1REVA 2FGOA 3JSBA 2IM0A 3GTJK 2FJEB 4KSEB 1U0HB 4RW4A 3JQRA 3BP3A 2Q6CA 3GTLC 3MCOA 3ZZUA 3V6DB 1T3NA 4R71A 3MM5B 4EMDA 3T1YF 1IW7A 4DX7A 2QG9B 3FPKA 3D6HB 3K5MA 3S14C 4P2NA 1EWYA 3W5HA 4ECQA 2AZ1A 1YDLA 1RT2B 1FERA 4LK1A 3VZIA 1VQNS 1FNMA 4USJC 1RKJA 3EX7B 2WPDA 4GKKJ 5L1IA 4M8LA 2KRRA 3DRRA 2JA7K 3DI6A 2V7VA 2DNOA 4LQYA 4DQKA 4WILA 4AYBD 2DPIA 5JVOA 1IKXB 1U48A 4ZVGA 3MM8A 3W62A 1BQNA 1UD2A 1GXLA 3MR7A 2X3UA 2UUBF 2D3LA 2RF2B 2OEKA 3NWRA 1B99A 1HMVB 2YU9C 3FGVA 3MCMA 3HXMA 4NWBA 3KLFB 4CO2A 1E6YA 2YWGA 5LMUJ 4ITSA 4KMAA 2R9VA 3CWJA 1T05B 3CCRB 3JYTB 3ASQA 3ILIA 1S6PA 4ILRA 4CCHA 3GV5B 3GP9A 3TZWA 1H98A 3BB5A 1BS2A 1TFYA 3Q6QA 1S59A 5AXKA 2DPJA 1JNZB 4BY7K 2D3ZA 4WJ4A 1OO0B 5KFCA 3GYXB 3CC2B 1H3DA 5DGBA 3MHYA 1RWPB 2CC2A 5HAOA 2AZ3A 4B3FX 3BN7A 1EP2B 4XO0A 1HQUA 4J9SA 1KHWA 3QT5A 4BBSC 3QT8A 5F8IA 1D09B 1W0KA 2YQ1A 1FKOA 3E01B 1I51B 2DGQA 4G7ZA 4M1XA 4CYUA 2JA5K 2M3DA 1D1NA 3DC2A 2VC0A 2Y0SL 1XTZA 3HHEA 5LJ3Y 1SUQB 2W2MP 5KFQA 4DU8A 2M4MA 3T02A 3H5UA 4FYXB 2HAFA 3CRZA 3D0IE 1CVJA 5I3UA 3QPIA 4DFJA 2V8HA 2Z2ZA 2W9BA 5CD4A 1NU4A 1R6YA 2RHSB 4RNNA 1U8WA 2J9DE 3OTDA 3R97A 3HVRA 2LEPA 4X07A 1HHSA 3QSYB 2IY5B 1Z4UA 5LMNF 6FDRA 5JFEA 5EGHA 3OL8A 2OHDA 2MZ1A 5B0EA 2MZTA 4OYIA 3AXKA 2E1MC 2NQPA 1RAJA 4C3HK 2HZCA 2P8IA 3OR2B 3D0HE 4DV4F 2AF6A 3W7BA 2VG6B 1HNWF 1DURA 3DLKA 4YS2A 3CQZA 2ZC4A 3FBCA 2MY7A 2C42A 3MCSA 1TTHB 2P2CB 4G65A 2J0WA 3DU5A 4B4DA 3OP1A 4QBUA 1D9AA 1X0FA 4LQ3A 4GTEA 3HVAA 5IFMA 3HFKA 1VHIA 3W8GA 3BPDA 1C0UB 3CMES 1B4SA 2XY6A 2XSJA 1AUSL 4KKOB 2QGFB 2FIUA 4YQWA 1MMNA 3D4JA 5IK2A 1HI8A 2B9EA 3LTOA 2XCOA 2N82B 1J6VA 1ZUNB 4RWWA 2MLZA 1QG0A 4ED3A 2ATLA 3BC9A 3MOZA 3W64A 3HSJA 2PEHA 2HRTA 5JUMA 3K57A 5K9FA 1O25A 3KK2B 5IQQA 1X8DA 1E43A 1X5TA 4X4TA 1DJ0A 3I87A 2L9NA 2M2BA 1HQEB 2MKYA 2LXIA 3JB9k 2VNHA 1XZQB 2ZVIA 3AD9C 2V34A 3HKZL 2VBTA 2VF3A 4OX6A 2AX1A 2DIUA 4Z37A 1HBOA 3Q8QB 3U6KA 4HT5A 2WB4A 5KG3A 3GTKK 4FXDA 3CJRA 3PYEA 1T6ZA 2W4DA 1TUVA 3M8QA 1UW4A 5C4JC 1TWFK 4KASA 1YGYA 1FK9A 3MR5A 4DWIA 1HI0P 2DK2A 1ACMB 3CB4A 1WTHD 2ZKTA 3BBCA 1YSJA 3R8YA 3Q8PB 2PGCA 4ZVRB 5KFLA 4A46A 2XYPB 4E98A 2G0IA 2MXYA 5IP7K 2QZ8A 4WP3A 4NCBA 1RWKB 3TX8A 3QYYA 4L6V3 1ELOA 2C4TA 6FD1A 4CO3A 2MZRA 1GAQA 4LFCF 4EH1A 3HHNB 3JQKA 4URQU 3J7ZT 1VQ7S 1M5SA 2GZOA 2ZH4A 1V3SA 3OXFA 4W92B 4P2MA 3CW2A 2YKNB 1HR0J 4KKOA 2KFYA 2LDYA 5IM0A 4PC2A 5CHCB 4BHQA 1Q86T 1DG1G 3I1FA 4RZRA 1VQ5B 1KP6A 2KRBA 2I8EA 1P6TA 5KG6A 3SCLE 2R2TA 4ELUA 1G3OA 3P3DA 3IR7B 1RWNB 4X4UA 1FFGB 2Y3PA 1MABA 4F2RA 1O24A 4NLXA 3EZ5A 3Q8SB 1Q0NA 1U1QA 3BN4A 4C8LA 4DDQA 4KTQA 2DNYA 3CE8A 1QD1A 4DR6J 4O3PA 3Q3QA 2GGPA 4P6YA 3FKIK 2GJRA 3M2UA 4OFZA 1WCMA 1TR0A 2AGPA 5IOTA 1IR1A 2BMBA 3TAMB 1UD6A 3S1RK 4NLPA 3KUEA 3BCFA 4WBFA 3AQPA 5B0FA 4J3NA 5IT9U 3S1TA 4B3XA 4Y6IA 3HPOA 4NEYA 4FWTA 3I9ZA 1RTJB 1F9NA 1NSPA 3SCKE 3M8YA 1IB0A 2JHEA 1VQPS 3BSOA 1D9DA 2JA7C 1DCPA 2EFPA 5J2NA 3ZBUA 3IAS9 4DV5J 3HDSA 1U0HA 1U49A 3AGQA 4LVOP 1BQEA 2HS3A 1NBMA 1YJUA 1YNJA 2H1YA 1VQLS 3V6DA 1J6WA 5D0RA 3A4TA 4WIQA 2JIZA 1LWFA 4GC7A 3NOGA 4RR5A 4ED7A 3WQPA 1TMMA 3RBZA 3NMRA 2OSRA 4QCLA 3PJXA 3KJQB 4LRDA 4RO0A 3HHLC 3Q8VA 1XIQA 1Q5YA 3MURP 4G5GA 1WORA 5CCLA 2C2NA 3N4WA 2RQ4A 2X1BA 3PM9A 1R43A 1KONA 3W2GA 3PUMA 2K1RA 4HTIA 3QFTA 2F63A 3EVMA 2V6AA 3IG1B 4HKQA 4C3JC 1TTTA 5ETTA 3QFSA 3AD7C 2NYIA 2FY8A 2MQLA 1JVIA 2HNDA 3B54A 3GWCA 5ETMA 3OR1A 1EKSA 1LW2A 2Q6LA 1URRA 1BGWA 2NREA 2E44A 3MMJA 3A12A 1M5KC 4ZVPB 1IWAA 3H0PA 8ATCB 1FKPA 3ZZPA 2VONA 3H9NA 2YWEA 1T9UA 2I2YA 4EYIB 2VBZA 4KATA 2HFSA 4XQFA 4DK1A 3PUNA 4M5JA 3BKUA 4DNRB 5HVGA 2P6TA 2XS2A 4PYDA 1NSKL 3HXAA 4CTAB 2FQQB 1CS4B 4DL4A 3R1HA 4HTJA 3T19A 1SKWA 2V4RA 4ZHRA 4DG1A 2HQFA 3GV7B 4KGVB 1QUPA 5E3CA 3UR3C 3GTLA 3QFRA 3CXCB 5KOWA 2BR0A 2IJNA 4E2FB 1JQWA 3Q6RA 3UDEA 5CHPA 3UD5A 1H8EA 2W2PP 4G6IA 5KFWA 2HYIB 4KMHA 4IYQA 2ZJRQ 2JH3A 1PJ6A 4E0FA 4X4VA 3NCPA 3ITHA 1S0OA 2L41A 3AVXA 3D66A 4XSXA 2W6JA 1R0AA 3K2YA 4UT4A 2DERA 3T51B 4X62J 4HE5A 3WZ0A 1BE4A 4NOIA 3NMAA 4ECVA 2DY9A 4N7TA 3BKFA 4RBUA 3AOCA 4OINA 2V0NA 4LF7J 1IBKJ 2HGLA 1UMJA 1VQ9S 3PW4A 4DUYJ 4OZ5A 2WZ1A 5A88A 2ADBA 3FSYA 4JI8J 3F73A 3CIMA 3FDSA 3SSQA 2Q6KA 1QFJA 4U9UA 1HYSA 2Z2LA 3UCZP 4ETZA 4LOWA 3K17A 3S17C 2WVBA 2YKMA 3TUPA 1GQEA 3N0VA 3Q8UA 3V81B 4RX6A 4M94A 4ERDA 2CPDA 1OSDA 2B5JA 4G6VB 3QBCA 2AP6A 2HHTA 1KVIA 2HMIA 3RYLA 2OMOA 2Y8WA 3DRPA 5IT9Y 4LF9F 2F1FA 1F60A 5A2QU 4A3CC 4DG1B 2FPHX 1UFLA 2FVCA 3ISXA 4C11B 4RD1A 2VBXA 2R8JA 1A9NB 2GSOA 2RHQB 1IWGA 1WC4A 1OY8A 1NK7A 4LF4F 4PUOA 2M88A 5KFTA 2FC9A 4PPZA 5KG2A 3OJSA 4HHHA 4N41A 2WBMA 2PIAA 1INNA 5A89A 4XR6A 3C3LA 2E5HA 1UWBA 4V19J 5IC4B 3MEKA 1U8SA 2YBVA 1N34J 4AYBL 1GEHA 2M7SA 3UI3A 1UETA 4O3RA 4UQGA 1MG7A 2CPIA 3CJ5A 3FKIC 4NE9C 3M8SA 1KD1T 4NZ0A 1BY9A 1T9VA 3KHRA 4FS1A 1EX8A 3V4IA 4C2MK 1S9FA 4DX8H 1KJZA 1U1LA 3J80Y 2MYFA 2CAJA 1FRHA 4DR7F 4NOHA 1AZSA 1R3NA 5K8NA 4LIRA 2JOQA 4ZH4A 2W9CA 3RU0A 1EFRA 4J9VA 3L4BC 4IH6A 5IM0B 4F4KA 1RT2A 3SI8A 3MM5A 2DRAA 2H4WB 4GMKA 5F9NA 4TQSA 3CULA 4ZP7A 4H4KA 5KAKA 3QIPA 5T7LB 4YR3A 5LOQA 4K8RA 1K47A 3TNVA 4EK2A 4TMWA 1QVGR 4WU2A 4C3IC 3MM8B 4B3GA 4PG7A 2ZZEA 1OB0A 4YFXA 4OJGA 4C8OA 3IM9A 5DQGA 2GPJA 5IC6B 3G71S 3LGHA 1NH7A 3TZZA 2KG1A 1IHMA 3S16K 3HD1A 5KT2A 2J0QD 2OTLS 2C2MB 1TFWA 3GVKA 5EMNA 3POTA 5C2CA 4PKDB 4OLOA 3K7RA 4M5IA 5BJRA 3I0SB 5C3EC 4J9RA 2M0GB 3ET6A 2Z56B 3GPAA 2E2IC 2J9DA 2PLFA 3H59A 1RADB 1JNYA 2M8DB 4H4OA 4OMFG 3CDBA 4Z4WA 1LWEA 1RT4B 2XCPA 4LF4J 2BV3A 1RT3A 1L3KA 3S1NK 2CJBA 4HH1A 1FHTA 3OTEA 2AEFA 1P4MA 1WDTA 1I3QK 1FKOB 1Q53A 2P5VA 4NCGB 1BUXA 2AJ2A 1FVQA 2DCLA 3WX8A 3BGRA 2EVZA 2LZJA 2OEMA 2OPRA 3H5XA 5KFFA 2LEAA 5G4DA 5A8KA 5DM6Q 2NXCA 2G13A 4NPOA 4NA3A 3BUEA 2XMJA 2NUHA 4Y2KA 2MQNA 4NMXA 3PACA 3CCMB 3ILOA 3MAHA 3IN5A 3DOMA 3MUTP 3CQZK 2VA3A 3CJ3A 2W9BB 3KK3A 3CCJB 3FUYA 2MQQA 1VQMS 4ECSA 1W35A 2BJ3A 4RPFA 2ZUFA 2V5HG 3M32A 4FBTA 4NCNA 2FJVA 4LF6J 3AVYA 3M2RA 1CQMA 3QJJA 2BM0A 3IA0A 2E9RX 3KJNB 4DZDA 3TX0A 3EGZA 2HS4A 2FX3A 3H90A 2HNYB 1MMLA 2WVDA 1JLAB 1LW2B 2OTLB 4ZLNA 4O3NA 4ECTA 4LLGA 2I1RA 3SJZA 4UUWA 2CFAA 2QL9B 4A8OA 5CDFA 2R7ZA 1HNIA 4A3MC 2RUSA 5C25B 3CXCR 3HF5A 1X4EA 2ALYB 4PR6A 1W7WA 2ZH9A 2RDJA 4P9SA 5CH7B 2F3JA 5EX3A 1LWEB 1G7CB 1IQZA 1VQ6S 4QR1A 2K1RB 2BRLA 4ZLPA 4DS4A 5IQ6A 2JJ4D 4I2PB 4DSJA 4X7CA 4ZPTR 3OJXA 2J6UA 4M53A 3OSPA 1RI7A 2XYGB 3RZAA 1F93A 3C14B 3NGUA 1Y0RA 3CMQA 5GAGI 1JB9A 4FZVA 2C2RA 1IJEA 2XG8A 3KK1A 4J90A 3J7Z5 2IBOA 1M1KT 5IOLA 4CH1A 2KT2A 2ZFZA 1VIXA 4ILLA 4J9KA 1YJWB 3D7SB 2UU9J 2RU3A 2HZAA 4BY1K 4B3RJ 1PYTA 1GR1A 1WWHA 1K8AT 4F0KA 1HI9A 3H4DA 4CO4A 4B9SA 4ZN1A 1D8TA 4LBIA 2IM3A 1VLYA 3EM1A 3KJFB 4X7DA 4A93C 2VU5A 4CLWA 2UXDF 4LUBA 1FE0A 4X05A 5IT4A 4EYHB 4JI3J 1V0EA 4URGA 1SJ3P 3RBDA 3GTOK 3PRBA 4X6AC 3HVTA 4P6QA 4UZEA 1OMSA 2YKOA 2NVYK 1FWKA 3Q89A 1FJGJ 3HHLD 1B64A 3JTOA 2J8SA 3RRGA 4Q44A 2WZPP 5DN6A 4TU9A 3Q2TC 3RW6A 2DIVA 1AFIA 3CCLS 4TMZA 3C19A 3AD8C 1HNXJ 2NLWA 1QGAA 5ETNA 2NZCA 4CIOA 2C5BA 5C42A 2CQ3A 5AJ3J 3R6GB 1AYEA 2DHXA 2QDXA 1EQMA 3P49B 1R0AB 4O44B 1F7UA 4OI2A 3D9BA 4C3KA 4USUA 1NCLA 2FDNA 4G1PA 1JLGB 2C4UA 3ONYA 3W9JA 2PDAA 2FJDB 1RT1A 2B7CA 5A76A 1HPZB 3RB4A 3W5XA 4DXLA 2KFZA 1RU1A 3MFHA 2FJBB 3EGWB 3DOKB 1YBUA 2JLEA 3Q24A 3EWGA 3ULHA 5BR8F 3GIIA 1Y1VA 2CYYA 1ZBTA 2C78A 1YJNB 4OZJA 4X65F 5M3MK 2MZSA 1EP4B 4Q45A 1N32J 5M2PA 1ZZFA 2YH1A 3G4SB 1CJKA 1R9TA 3HOWC 1JB0C 1KVKA 4ATNA 1Y5NB 1N4LA 1HBUA 3LQVA 1REGX 3GSDA 3WNDA 2FB0A 5DDQC 4OP7A 4A3KK 1S6QA 3LNNA 1TWCA 4UOCA 3MF5A 1XZPB 4ID5A 4I7FB 1GVHA 4RCYA 4I6AA 1BLUA 1EIYB 3MPWA 2KH9A 1R5BA 4B3SJ 4FXWA 4EI2A 4XPCA 2QTWA 2E9ZA 4DFMA 1N54B 2BJ7A 3TQ1A 4HACA 4PG4A 3TANA 3MPDA 4PUOB 1J98A 2QSFA 2DY1A 4DV5F 3ELHA 4RD4A 4B3TF 4DLEA 3DLJA 1KR4A 1D9FA 2NPIA 3NY0A 4YG2A 2DT9A 1J9ZA 2BJDA 2ZVSA 4KFBB 4WFAQ 3QO9A 1FDAA 5GADU 4RNFA 3DYAA 2FLOA 2JEGA 5HI7A 2F4VJ 3BGUA 1ZETA 2LQBA 2MEWA 3P6YC 1B0TA 2R7WA 3HJVA 2R2SA 4KC5A 3U1NA 4ZPWR 5M3FK 1Y5IB 2L08A 1ZPWX 2R92K 2OBSA 5HMWA 1A8PA 6AT1B 1S1VB 1E6VA 2AYEA 1W2IA 2C3PA 2RVJA 4Y9RA 1PCAA 1G7RA 4IDKA 2JDIA 2VQEJ 4JOUA 1TV6A 3GFYA 2YWHA 3UDCA 1BDFA 1XFOA 2QMWA 3J7AN 3H0GC 4DUZJ 1YJ9B 1WOPA 1RTIA 1M5OC 3PHTA 1Y3KA 2LLZA 5GV7A 2NVYA 3N6LA 4LK0A 4WE1B 2PE3A 1CJTB 4ASUA 3DFEA 4O4GA 3W2VB 1ISEA 4Y28C 4KR0B 3JTNA 3U02A 1S48A 4NLQA 1NRKA 2MZJA 2YNIA 3J7YU 1TL3B 3T5LA 4ZVHA 4FYVB 3T5JA 4P22A 5IYRA 1WCMK 3CEDA 3KL9A 1YBAA 2ZBQA 4NI2B 4LJZA 4IG3A 2ZH8A 4G1IA 5HQ8A 4GKJF 1DHMA 2JC1A 3D3BJ 5E6TA 1EQRA 2HG4A 3THPA 5HJXA 3CF5Q 3KLIA 4UF4A 3M1VB 4NA1A 4UY8T 2EK1A 4DOZA 3C46A 2YH0A 4MKAA 1SL0A 2X85A 4Z4TA 3T5KA 3BY2A 3LQ6A 4MFBA 5LT5A 5D3GB 1XC9A 3VO1A 3RBXA 4AQYF 4LBVA 3THTA 2HVZA 5DETA 4DR3J 3EVOA 4DL3A 3UVJB 3QO9B 4JI3F 3GYGA 1AB4A 1I50C 3CJ4A 4CTAA 3GSIA 3PY8A 5HMZA 2VNJA 4P3YA 1U25A 2V67A 2EG2A 3EVWA 1VC0A 3OKXA 2Y8YA 3PO5A 1NSQA 2WOMA 4P6VF 1OIAA 3R5AA 1XMQF 1DRZA 1JXLA 1WHYA 1JNRB 5HBMB 3HKZD 2OPRB 2PN6A 1YLXA 2HHWA 3ISNC 2ZBPA 3ASPA 2CFAB 1MU2A 1IBKF 4HH0A 3VVUA 3NG8A 2IYIA 4YOEA 1TWAK 5C25A 1EFTA 4I6WA 3ZTSA 3X3UA 1EZZB 1HNZF 3WDOA 1AB8A 1XERA 3GVLA 2R93K 4PAAA 5HVFA 1TUIA 3OQ2A 5D0EA 1XNQJ 3HD2A 2GA7A 2XNJA 4B9NA 1QFZA 1VQ5S 4RW6A 4RPDA 1SH2A 1KS2A 4OOSA 3GILA 1C1CB 3HKWA 2C2DA 2C22A 3DLBA 5EWFA 1CEZA 1IKWB 4A3EK 2KT5A 1FF2A 2QO3A 3H2VE 3I4PA 4ICLB 3MFIA 2O5IA 4J91A 2JN9A 5FDLB 3CC7B 4NYZA 4YALA 3MHPA 4PG5A 3M1VA 2E2IA 4YHBA 3QAUA 4ZK7M 2IVMA 4DUTA 4M5DB 1RT7A 2VPYB 3RJMB 1M90T 4ZCMA 3ZZ0A 3QSIA 3ZUGA 1T3OA 4HI1A 1K8AD 3OPFA 2VNIA 2RNEA 3CAGA 3CD7A 2VNKA 5E3QA 2IAJB 2R7RA 1YHQB 4ZCKA 1G1XA 1VRUA 4A3MK 2F1MA 1KKHA 2ZD1B 2J5AA 1GTHA 4Z2XA 3CMMA 4LRCA 4JV5F 3GQBA 4OHWA 2YWFA 4UOGA 4DV0J 3A3NB 1XR7A 2AGQA 3GTPK 1Y3JA 5G0RA 3SZ2A 3H5SA 1P27B 2G0CA 4PYAA 4WFYA 4LRAA 3OFEA 1FDDA 5DO2A 4CI0B 1V3RA 3LF0A 4GFQA 3HHLA 3HAGA 2V4DA 5DZ6A 2MKKA 3CQZC 2GVDA 3GVJA 3DLHA 5J1EA 4YB1P 1HHTP 4YAUA 3CJKA 1NK4A 2F4VF 4HEA9 2CJQA 2DNLA 3VAGA 4B3OA 1AZSB 3HLUA 3G6ES 2CQHA 1HBMA 3BYRA 2NVTC 2CPYA 2FHKA 4QIVA 3G8SA 4UY85 3M2UB 3N5FA 1RBLA 1WJ9A 2ZZGA 2ZL6A 1N48A 3N5BA 5LXRA 3HFVA 3VHQA 3FKSA 1CQXA 2XEXA 2YWKA 3VAFA 2E7VA 3HZGA 4X64F 2AJQA 2VASA 3CCEB 2VJVA 2ATCB 4RJVA 1KQ4A 1WG5A 3DGPB 4CQ1A 2FVRA 3W9HA 2V2ZA 3G4SS 2Q6BA 3R9LA 2QFIA 2HLTA 1RWUA 1YJNS 3VAKA 1J5EJ 1XN9A 2AT1B 1RB0A 4ZP9A 1ZZNA 1J6XA 2L9WA 2XMKA 2HQDA 4KYZA 1S9EA 4KGKA 5D77A 2RGRA 3D68A 1FE4A 2BPOA 5HSPA 3NGRA 2HHQA 3SZZA 2EC0A 4KKUA 2RRBA 5HP1B 2MLYA 2XMVA 5C44C 1FRIA 2KHCA 4LR9A 1EFWA 2IIHA 4JI0F 2LEBA 1WHVA 2QLWA 2I0XA 1TWGA 3C16A 3B8HA 1HQ2A 4JI6F 2BW2A 4H4OB 1UEUA 2O5DA 2W2OP 1Y0YA 1GMUA 1S0NA 2GK7A 5CZXA 5FLXY 3MMBA 4UOFA 4M2LA 5HL8A 2DD8S 3G6EB 3PA1A 1QVGB 1UJ4A 1DDGA 1OB5A 3TJ9A 4IFVA 1WC6A 4MKVA 4Q7JB 1IR0A 1LWCB 3AT1B 2ZDOA 2KVOA 3ZTQA 4Y7NK 2R7QA 3WBZA 4RCZA 1VIOA 1E62A 1B2RA 1ZA2B 2XQCA 2FC8A 5DG9A 1NJID 2XNCA 2R92C 2DOGA 3LP1A 3OEPA 3PYGA 1NBEB 1CJTA 3CC2S 1TK0A 1YRXA 5SUHA 2XMAA 3OL7A 2PFDA 1V6HA 4F50A 2BMWA 1SFOC 3W2WB 8AT1B 3JQQA 4NLOA 5KFZA 2Z57B 4OI6A 2JA8K 5D78A 5I42A 4CLUA 3TEHB 3GIJA 1VHFA 2CK3A 2VOPA 1WEYA 2YNGB 2PFFB 3GJQB 1K9MT 1H2VZ 5KT3A 1R9TC 1O0PA 2RUGA 2CFXA 1W2BB 4OZ3A 4ROXA 3K8WA 2Q3PA 4RKUC 3BREA 3QAEA 5KG0A 3O5TB 4M5LA 3GTQC 3IO1A 1HNIB 5IV4A 3CC7S 5GAGU 3BY1A 1DQ9A 1LW0A 1G6BA 1OPZA 4DV7F 4WFNQ 4KDDA 1F3FA 3CMAS 2BJ1A 2NXUA 1XNRF 5FLXU 4X2BA 4WK3A 1H2TZ 3ZTRA 5I3PA 2B43A 2VL1A 2F9DA 1NDHA 1KNZA 3M6XA 1T03B 1TELA 4Q0BA 3EJMA 5IT0A 1YRUA 4ES3A 3CP2A 2FZKB 2W2QP 1T6XA 4GVBA 4ED2A 2Y0SD 3GFZA 1NHUA 4WF9Q 3TUIC 2FYXA 2LA6A 1KRHA 2XWYA 4CO5A 1AROP 1VQMB 4J0QA 2GHVC 3LA0A 2JA6A 2PMHA 4LF5J 2CPXA 2JEFA 2ZXHA 3EGNA 2DRBA 4QV2A 1T9XA 4DCPB 2I5JB 1TZ0A 1YCLA 3ZXWA 4BC7A 1UKUA 3RRHA 1S6OA 1R8PA 2CNLB 3KXDA 2UUTA 2C2ZB 1L3UA 2M5SA 2DH7A 3OVBA 4DSFA 2R2UA 2UV8A 1BXNA 3S14K 1S4EA 4S0MA 2AEMA 2ZL7A 1W25A 3MMLB 1UZDA 3CP8A 1TL5A 4U96A 1CJUB 3A8KA 2NVYC 4DR5F 1UZHA 2CJYB 3F44A 3OVSA 4C7QA 3GTLK 1H73A 1N5QA 1WPCA 2E2HK 3NGKA 2WSCC 4XSZA 3CJ8A 3DGVA 3ONUA 3ZPNA 5HROA 3PENA 3TJAA 3C15B 3QFHA 2IBKA 1I94J 3GTJC 2CPHA 3UWTA 4OPOA 2DEUA 1IJFB 2HNZB 2GK6A 1LXNA 1B3TA 4K0KJ 1NK9A 3B4MA 1H7WA 1VI7A 3D3CJ 1RAFB 1S7IA 3BQ1A 2FJXA 3CCSS 2GQQA 3BO3A 4TY9A 2QTLA 5A8WB 3M9NB 4ICLA 1YTYA 5DDOC 3AJ2A 3I82A 1HNVA 4PWDB 3I0RB 2J76E 4XDDA 4PRFA 1CJKB 4DV7J 2R8IA 4B9TA 4FXUA 4L73A 3VNUA 2XCRB 4RMFA 4XTTA 1UPMB 1Q9SA 1S6QB 3TO8A 1U4BA 1X4HA 4CLPA 2FVGA 3J7YI 1U2FA 1HBUB 3KK2A 3IRXA 2X3GA 4DBQA 3KKFA 3LPYA 1JJ4A 4TLRA 4QYRA 1VQOB 5TR9A 4LSNB 4PWWA 2B4UA 3L7UA 2MQOA 3DDNA 1EFUA 4K5SA 4Y3CA 1HBMB 3W2IA 3FJOA 4LF5F 1EP3B 2HDNB 1D8YA 2HK2A 1R5OA 3WC0A 2GAGC 3PW7A 3MI7X 2N4CA 3BQJA 5CCMA 4HACB 2DETA 3QGPA 3S16C 1MMDA 3ZZOA 3HJFA 3I31A 4A3IK 3P26A 2YX7A 4A3IC 4CLFA 4OJ3A 2XBPA 3J81k 3QX3A 2VG5B 1X7VA 2B0GA 4NBSA 1RABB 5J1EB 1OHHA 3KG0A 5CXTA 5LMZA 4YXWA 1TWAC 4DQPA 3CD6S 3QRQA 2VKRA 5IOQA 3PJWA 2DCUA 2XGJA 2MSSA 4RBTA 3S2DC 4C45A 2BE2B 1RGVA 1VQ8S 5T14A 2RC5A 2DGVA 4DL6A 1S9EB 2N3LA 3FZBA 3BBBA 5HXBA 3LGMA 3H5YA 1LFWA 4YB7A 5K5MA 3M9OB 3P45B 1QGYA 1FDNA 1MNEA 2B9YA 3EZOA 2VBUA 1T02A 3GTGA 4B3MF 2JZ5A 4WWVA 4ZITA 4M0LA 2NSCA 3UO0A 4LFCJ 1W87A 3EDQB 1WHXA 3ICLA 1T94A 2ASDA 2BZ2A 1CQNA 1GX5A 1JWWA 4IO9Q 2A18A 2ZITA 2QA4S 5DS0A 5KFBA 2ABYA 1HR0F 3NKYA 4O3SA 1SIZA 1KLNA 4YUDA 1SBRA 3NBPB 2RMLA 2V9WA 1GE9A 3B4DA 5EWGA 4LSNA 2D3NA 4PABA 1LWCA 3KK1B 4ZJOA 3GR0A 1LNQA 3L09A 4Y2AA 1GH8A 4ALZA 4I2QB 3I55S 1FNCA 2QA1A 2RDDA 4QIGA 4ZP8A 3NNHA 2X6WA 1TLLA 2DNRA 4O2DA 3P5BP 1NSAA 4WZMA 1VK8A 4I56A 3NEKA 3CCLB 1QSSA 2YNFB 1RACB 4F36A 4OYMA 4F2SA 2J7UA 4DZ6A 3EMTA 1S1UB 1QY7A 2NVQK 1TUGB 4C3IK 4HLBA 2HMIB 2MB0B 1F9HA 4HT7A 3J81U 3C8YA 3W2WA 3CCQB 5EGYA 3GTQK 3Q0AA 4RJLA 2ACMA 4C4WA 3GTPA
chains in the Genus database with same CATH topology
3GEIA 1VLYA 3GEEA 1WSRA 1VRQC 3TFIA 3TFJA 1V5VA 1NRKA 1PJ5A 4PAAA 4PABA 3AD8C 1WOSA 3AD9C 1WOPA 1PJ7A 1XZPB 3A8JA 3TFHA 1WSVA 1WOOA 3ADAC 2GAGC 1PJ6A 1XZQA 1XZPA 3GIRA 3GEHA 3AD7C 1WORA