3WYAA

Crystal structure of gdp-bound ef1alpha from pyrococcus horikoshii
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
423
structure length
396
Chain Sequence
KPHVNIVFIGHVDHGKSTTIGRLLYDTGNIPKFAWVMDRLKEEHTKFETPHRYITIIDAPGHRDFVKNMITGASQADAAVLVVAATDGVMPQTKEHAFLARTLGIKHIIVTINKMDMVNYDQKVFEKVKAQVEKLLKTLGYKDFPVIPTSAWNGDNVVKKSDKMPWYNGPTLIEALDQIPEPEKPIDKPLRIPIQDVYSIKGVGTVPVGRVETGKLKVGDVVIFEPASTIFHKPIQGEVKSIEMHHEPLQEALPGDNIGFNVRGVSKNDIKRGDVAGHTDKPPTVVRTKDTFKAQIIVLNHPTAITVGYSPVLHAHTAQIPVRFEQILAKVDPRTGNIVEENPQFIKTGDSAIVVLRPMKPVVLEPVKEIPQLGRFAIRDMGMTIAAGMVISIQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor 1-alpha
publication title Molecular insights into the interaction of the ribosomal stalk protein with elongation factor 1 alpha
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Translation
total genus 108
structure length 396
sequence length 423
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3wyaA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3wyaA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wyaA01
1YR6A 1Z6TA 1E0JA 3QXXA 4NMMA 2ZU6A 4OK6A 3BB3A 4KJZA 4RY2A 1RPZA 2W6IA 4QRHA 2DEUA 2PEYA 2WV9A 1GRNA 1QUEA 4LRWA 4Q9IA 3HU3A 2XX3A 3Q85A 1NG1A 3G82C 5JCZA 1GILA 1R0YA 2IYSA 3K70D 3BAFA 4LJ8A 3GFTA 1QZXA 4JLBA 1A7JA 1OH5A 3D3QA 4K8OA 1LFDB 1WBDA 3QF4A 5LD2C 3IIKA 2OCAA 3Q7QA 4HAYA 3GLHE 2FPKA 2VNKA 2J7PD 4A0HA 5KSOA 1FP7A 3KB2A 4TYWA 2WPDD 5L3VA 2J87A 4HB2A 4QBFA 4EPVA 5FTNA 3AVPA 1VQKB 3MHPA 1SVOA 2IYZA 1W4CA 3TR0A 4ARZB 4ZI2A 3AP2A 5KDOA 5L3QA 4TMKA 4V03A 4F7WA 5K8TA 2HXYA 1QF9A 4D82A 1ZINA 2HF8A 2QRNA 5GJVC 4KCGA 1VQ8B 4MKHA 1KSFX 2PEZA 3TK1A 1ZW6A 2CVFA 4QGAA 1JI0A 1DAMA 1TADA 2FPLA 3W5JA 3CF6R 3BH6A 1E2HA 5JEDA 1K73D 2QENA 1JJ7A 1NP6A 2CL6X 5CJPA 1WMSA 2XEXA 1XEFA 5AJWA 2XXAA 4PHTA 4ZCIA 4RVCA 3CMAB 4C0AC 2AHOA 5LB4A 3B7GA 3EZ7A 4POAA 2XSZD 1NY5A 2F9MA 1W0JA 2CL7X 4GMXA 1KK0A 5EE5B 3RSOA 1Q3TA 3DOFA 1GL9B 2WKQA 3HYTA 4GNKA 1E79A 1TF5A 2RAPA 2QNRA 4KBFA 4ZCMA 3VO2A 3MUFA 3WYFA 2J0UB 2XXAB 2C03A 3JVUA 1AZTA 1XTKA 2J59A 4JIMA 3V9PA 5F3WB 5BN4A 4LC0A 4TWZA 3R9WA 1G16A 2IYTA 2D62A 4RZ2A 5AJYA 4EFMA 1YITB 5B2ZA 1I2DA 5L3RA 1RRPA 2GEDA 3K09C 1GTVA 4EPRA 4YQFA 1U0JA 1YZKA 1EX6A 2FFBA 5KPDA 4BASA 4OBEA 1CIPA 3CCVB 2YYZA 1YZGA 1US8B 5C46F 3ZD7A 5B57C 4YDSA 4RKEA 3ADKA 1K8AD 4ARZA 2PT7A 3SE0A 4B2IA 3GP8A 4OQXA 2GPJA 4BFYA 2TMKA 4TT3A 2XNSA 2OT3B 3TSOA 4AYTA 5JRZA 4Q9LA 1TU4A 2WSMA 1KO7A 3BBPA 4MUBA 3AVYA 2GXUA 1WDTA 1CLUA 4DEXA 4UNPA 2OK7A 4DUGA 2EVWX 3HPRA 1KY3A 2IYWA 3V4RA 2R6HA 1SVIA 2GILA 1YHNA 2G0NA 4JMPA 4TMXA 3LW8A 1FMLA 3IDQA 4A8JB 3BFXA 4JL6A 1LS1A 1JR3D 4PPFA 1FFHA 1XMIA 2YKGA 3EZ9A 3AVTA 5HE8A 1XPRA 1H85A 4TTRA 2ZTSA 4PZZA 4CEHB 4MRSA 1QG2A 3EC1A 1E9CA 5HCNA 5G41A 2QPAA 4G5RA 2J0UA 5FBQB 3X1WA 3ZVLA 3KZ1E 4GSYA 5JZVA 5KSYA 3GLGE 3BK7A 3W2EA 4Z1MA 4LCBA 4Q9HA 4IXNA 4JBXA 2FPMA 2E87A 5JI2E 3CPJB 4LPKA 4O25A 1XJQA 3GLIB 1KSGA 4DCVA 5JJKA 5BW8A 1VQMB 4G5GA 4NONA 2BWJA 5KSWB 1E32A 1NVXQ 2AFIE 3E70C 2QT1A 4PSKA 4AYWA 3X1DA 1US8A 2FJUA 1FW6A 1EP3B 1G8YA 4G1UC 5EXTA 1Z06A 2I3BA 2RHDA 2ODEA 2WOJA 5AJXA 1DADA 5DHFA 4M1MA 1G21E 2BIFA 3NXSA 2WSSD 1VMAA 4FMBB 5DHAA 1Q20A 2OCBA 3EIHA 4YMTA 4IOKA 3IQXA 1I4DD 2EU8A 1VQ6B 1S3GA 2KB0A 2ZRJA 1FL9A 5E7MA 2ZRKA 2ERYA 4L8GA 1EWQA 5CM9C 1NF3A 4KSCA 4IHQA 1DARA 2ONKA 5DLQC 2YC4C 4B35A 2H7VA 4Y0AA 1H8EA 1F48A 3CM0A 3IUYA 1NVUQ 2EYQA 1ONBA 3ICQB 1E94E 2QG6A 2YWGA 3CWZA 3EPHA 4A8JA 2ZROA 3TSZA 2XTNA 4WXPA 4YAWA 3T12A 1VQ7B 2RGBA 1KGDA 2ZEJA 3ZZTA 1AZSC 2QTLA 5DN6A 1L7VC 2X8AA 2YV5A 4GI7A 4TLCA 4C0SA 4CEHA 1T3SA 5UKDA 2DFTA 1FUKA 2ZRFA 3B8HA 4WOPA 2B7BA 2C99A 1W2BB 1I4LD 1VTKA 1CQXA 4HYYA 1P3JA 2IF0A 1BJKA 3U3RA 3CPWB 3KJHA 3LO5A 3NHBA 3T1VA 3UPUA 4MGZR 1XPUA 3U5ZB 4A2WA 2V6JA 1ZUHA 1KK2A 2HF9A 4W7SA 3CH4B 1SKQA 4BFTA 3SFZA 2DWPA 5BN5A 4NPHA 1COWD 2FSFA 4HAZA 1DG1G 2WWFA 4ITRC 4RFVA 4DLWA 4LYHA 2H92A 1UADA 1Z83A 4LDJA 4CIDA 2NZ8A 3W2FA 2ZRIA 4DLXA 2DWOA 4PXAA 4V0KA 3UWKA 3IQWA 1GL6A 4RFSB 1T9HA 2OG2A 1S2MA 4F38A 3M6AA 4B6FA 2ZETA 3OESA 3IHWA 4C0QC 1RVDA 4IFBA 1NKSA 4Q7MB 4JT2A 1W0KD 2GAOA 1L4YA 3IO5A 1OGJA 4LY6A 1N2CE 2C77A 2P5SA 1JALA 4OHVA 3K9HA 3L0IB 4FMDB 2WZQA 3GQBA 3G5UA 2ZPTX 2I1QA 5B58C 4MKGA 3R20A 4WZ6A 2J7PA 3W90A 4Q03A 4Q9KA 4BLPA 2VHTA 5TXGA 4OI4A 1UKVY 5EE3A 4DWJA 1MKYA 2NIPA 1QFJA 1WBBA 5H8WA 4NCHA 1N6HA 4JT4A 3GLFB 2C5LA 3P27A 2E9SA 2PLFA 1JEDA 5KDLA 1VQOB 5F98A 4URVR 4U5XA 3QUSA 2DFKB 3CRQA 1Z3IX 2PZGA 2BMDA 2YJTD 4DCSA 2ZR9A 1KNQA 1P4SA 4JBWA 5DI3B 3SYKA 2G0TA 4B3CA 4OHYA 2OILA 2WWHA 3TSWA 1W35A 1W34A 2BPOA 1M74A 1ZRHA 2HUPA 2ZE8A 4NYMR 4ZGQB 1SQ5A 3AVQA 1E64A 5D3QA 1ZYUA 1K5GA 3E1YE 1U8YA 1ZCBA 2P65A 4JKYA 5EP2A 2XSZA 1XJ0A 3BORA 1EK0A 5EP1A 4F92B 2BJVA 3KKMA 3QFSA 3L0SA 2UKDA 4RFSA 5TR9A 3GEIA 1KO5A 3RLFA 1OXUA 4IDNA 1KSJA 1KZGB 2P67A 1KRHA 1IN8A 2V54A 2CDNA 4Q19A 4X8HA 4BZQA 2VPPA 1LS6A 4Q01A 4DB2A 1PJRA 4RD6A 1NN5A 1P72A 2ZQ5A 4Z8YA 1Q22A 5AR1A 3CC7B 1KYIA 1JQJC 2RB4A 2JLZA 1OXTA 3ZS9A 3RDPA 2QQEA 4B44A 1FNNA 1U81A 3F5FA 1SULA 2HLDA 1EFTA 3GLFA 3LAWA 4HE6A 2QEXB 1SHZA 4L5BA 4PR0A 4HAWA 1JJVA 3PEWA 3PEYA 3HPQA 2C9OA 4RZ3A 5J5CA 4D6PA 3NEYA 2OTLB 1IONA 4NL4H 4YHBA 1P9NA 5K8LA 5TMPA 2VBCA 2REXB 2X2EA 5DI3A 4ABYA 4AKEA 3K09A 4G3XA 1UJ2A 3AVOA 3UATA 2ZYUX 3QXJA 4PC6A 1U0LA 3LVRE 2JDID 1XFAA 3CLVA 4EDHA 3ZIAA 4CT4B 2BJWA 1YJWB 1DAIA 5BN3A 2FU5C 1Q1BA 2X1VA 4HEJA 5FOSA 2O52A 3W8NA 1XTJA 2JLXA 4Q7JB 4ESVA 3T1TA 2D2EA 4AWXA 4C4PA 3A1TA 3Q5DA 4QGFA 2A9KA 3S1AB 5DSZA 2IW3A 3EZ2A 1E4YA 4DLUA 4RCZA 1Z47A 2OEPA 4R2HA 2Q3MA 4XVQA 2R9VA 2OHFA 3B9PA 4BWYA 2OFWA 1HQCA 3B13B 4KYUA 1KO1A 3CPHA 1VECA 4MGIR 4PO1A 4CEJB 1IXSB 3SZRA 1MT0A 5IDVA 2ZYTX 2FSIA 1DPFA 2QGNA 2JASA 2VNHA 2WJVA 4GFDA 4C7OB 1Q1QA 3FHTA 4ASUD 2GK7A 1CRPA 1XMJA 4JLJA 4EQ6B 2AWNA 2IX3A 3N2IA 4HZUA 1N6KA 1IBRA 2XGJA 4II7A 1XXHE 3FGNA 2VTKA 3M1IA 2O8FB 1Z0DA 5BXQC 1ANKA 4F4CA 1KHTA 4KV9A 1OF1A 1AA9A 1XD8A 2IYYA 4TMZA 3UMRA 2XNJA 1UM8A 3A1VA 2VLIA 2WSSA 3PFIA 4EIWA 2RGDA 2GKSA 2J0SA 2ZJ5A 121PA 1D5CA 1O3YA 2JLVA 4X8OA 2IHYA 1YVDA 4MYHA 5JCPA 2G88A 1D2MA 2JLWA 2OESA 1S9HA 5L8VA 1A1VA 3L8YA 1P60A 4V0ME 4IFEA 3U7EB 2NPIA 3PITA 2GDJA 3LDAA 4L15A 2AK2A 1P9RA 1G18A 1KAGA 2RKOA 4Z8XA 2F7SA 3OJWA 3W2IA 1LTQA 4Q1DA 1KO4A 5SZHB 1E1QD 1AS3A 4JZKA 1N6NA 2IK8A 2X2FA 1U94A 3AV0B 3JQQA 4LOAA 4KXFB 1L4UA 4G5OA 4E07A 4QG7A 4WBSA 3AP1A 5FUWA 3S1AA 1E2QA 1S1MA 3QG1A 4ZO4A 4AF6A 3VU9B 4S2EA 4CEJA 5EE0A 1Z0KA 1HQYE 2J46A 2KBEA 2ZUBA 1DO2A 2VYFA 3W6NA 1H8HD 4C7OA 1FZQA 3OEHA 1K8RA 5FL7D 2BKUA 5IHPA 1HE1C 1EFHA 4MKIA 2O8CB 1UEIA 4A82A 4EQ6A 1COWA 1YU9A 2ORVA 2VP6A 5JLJA 1E2FA 2ZSFA 2CCKA 2RHMA 3PJRA 1X8KA 2ZANA 1FP6A 3R9XA 2O8FA 3ZZ0A 4W5WA 2A5JA 3G71B 5KSPA 2CVHA 3MFYA 4PZYA 2GXAA 2ZS8A 3VNUA 4XSGA 4LSGA 4C30A 2QA5A 4NE2A 5KSZA 4KFUA 1ZBDA 1CS4C 2R44A 1GKIA 3IIMA 1W4RA 3N5CA 1YZTA 3N2EA 1Z63A 2FWRA 3KQHA 3MJHA 2O0HA 2PCJA 1AQUA 1QHNA 1T8UA 3QQ5A 4IVRA 4EFNA 1YJ5A 2ZI5A 3AVWA 5AWFC 1GNPA 1OJLA 3RANA 4N0DA 1XCMA 1FQJA 1G5RA 1D6JA 4A0FA 4MA4A 1M8PA 1OE0A 2RC5A 1V43A 4KHZA 3ZZUA 2IUUA 1G6HA 3CMEB 2QPTA 1X3SA 2XAUA 2YZ2A 3EAQA 5JWRA 2XOKD 3B1VA 1TAGA 5CLQA 4EPXA 1KTVA 3PXGA 3CR7A 3HR7A 4JLKA 4HUTA 5HXBA 1VCIA 1NN1A 3FHCB 5EXSA 2QDXA 4DDTA 4HB4A 2AXPA 2VF7A 1OPXA 5BWMA 4NDZA 1G5TA 4OQFA 1SKYB 1SVMA 3RS5A 3P26A 5JFGA 2VP0A 2IC5A 2H16A 5A0FA 2IUSA 2MSCB 2O8CA 1KO8A 4YAOA 2F9LA 1GDDA 3O8CA 4PC7A 1XWIA 1QBKC 1WRBA 3T15A 3ADBA 3NVAA 4DLSA 4YAUA 4DLVA 4JLOA 1ZU4A 4KODA 3IHLA 4XIGS 4B76A 4DLTA 3WRXC 3B6EA 3VX3A 4M9ZA 4UXHA 5LDDC 2HYDA 1OB5A 3BIFA 1II8B 3SS8A 1IAQA 1D1NA 3AF1A 3I32A 3KB1A 1G7RA 3RVBA 4CVNA 4LBVA 3I55B 4YMUA 3GMTA 3EX7C 1HURA 4QM6A 2H5EA 4V0NA 3P4XA 2D3WA 3I92A 4RSGA 3FOZA 5FOXA 2KSQA 1QH0A 1VCMA 4AK9A 2IWRA 2DETA 1SVWA 2ODNA 2Z5FA 2ZYVX 4JJZA 1OV4A 1SXJC 4A6XA 4HLQB 1DBSA 1KI2A 1NSFA 1WF3A 3PIRA 4US0R 3R8FA 1GOTA 1GWNA 1QG4A 3K9GA 3IKJA 4UKDA 3TR5A 1N5KA 3ADCA 1JAIA 1Z6YA 3PQCA 2ZI7A 4Q9JA 4NZYA 2D7DA 4L9WA 3CNLA 2FEMA 3RS7A 3CX7A 5GVSA 2QN6A 2JDIA 1E98A 5EXPA 1SVKA 2F1IA 4BEBA 2I1VB 3SYLA 3SJBA 2JJ8A 4B3XA 1W4AA 4KITB 5GV8A 2XB2A 2C9YA 4W5JA 2ZRGA 1W2HA 3DHWC 2G1JA 1SXJD 2EWWA 2LCFA 3TAHA 3HYRA 5HPYB 2VYQA 2GCOB 1TPZA 3BE4A 2A7QA 3NG1A 2BBOA 3C8UA 5FOVA 3THOA 2CCJA 1NJFA 5D3MB 1II8A 2IEZA 1GVHA 1B23P 4Z51A 3W5HA 4ZV4A 4GL2A 1DOAA 4NBSA 2P5TB 3B60A 1AQYA 1G17A 1FOEB 3I56B 2IHBA 4G01B 4QNMA 4TLBA 3ZQJA 1ZJ6A 221PA 5EP3A 1G3MA 3D7MA 1J8MF 3ECCA 4HLUC 2QU8A 3CRVA 4OL0A 1IOZA 3QXHA 4FXPA 2QMUA 2FF7A 3EIEA 1X6VA 3SEAA 4BZXA 3CR8A 2AXNA 1Q82D 2GA8A 3A36A 3SR0A 1MV5A 5JJLA 4U9UA 1R0WA 3VX4A 4OI2A 4BLTA 3Q5EA 4A0GA 2P2LA 3KJGA 3O8BA 4TYPA 3CRW1 1IXRC 2V1XA 4B71A 1IN7A 2CE2X 1OYWA 2OAQ1 2WAYA 1CJUC 4LJYA 1M6NA 1VG9B 5FUXA 1NLZA 4ERNA 1E1QA 1S72B 1JJ2B 1U8AA 3CX8A 4XTCS 1F2UB 3DMDA 4MGKR 4FWIB 1XRJA 1DAGA 2F55A 3ZLJA 1W47A 3PUWA 4KU4A 2GHIA 4XD7D 4B2PA 1JAHA 1QVAA 1Z0FA 4IJMA 2V7QA 2BGIA 2WJJA 2GCOA 2RGCA 5HZKA 4GOKA 4RD1A 1GAQA 5E7JA 3G4SB 2ZI6A 4KLNA 2UVQA 3GEHA 4OI0A 3WNDA 1AM4D 3FPAA 4DCNA 1G8GA 2HDNB 3RS2A 1Z0IA 1CNFA 1H8HA 1HY3A 1GNRA 1Z2AA 3MGCA 5D3MA 1R5BA 3GCGA 5EE1A 3WRYC 4ZDKA 3THYB 3I62A 4BRWA 4FCWA 4BFXA 1NMXA 1ZNWA 3A37A 2ANCA 5G53C 2YHSA 1DEKA 4ON9A 4US2R 1HTWA 1YRBA 3ND9A 1N6OA 3NBZC 3UXMA 2CLDX 2A2ZA 2BM0A 2LKCA 3K9LA 4EPTA 3LBHA 2WJIA 3T1OA 1R4AA 3ZVMA 5A4JA 1FUUA 3MRSA 4Q21A 4QM7A 3PEVA 1XMSA 3TBKA 1EG7A 1WQ1R 3GLIE 2BDTA 1LF5A 4XH9B 4KFRA 2CHGA 4B3DA 3CRRA 1V5WA 2VP2A 2HCBA 3NWJA 1YRAA 1P73A 4PQRA 2VHJA 1M2OB 1P5ZB 2XZPA 3A1SA 4LV8B 4URWR 3KUCA 4CF7A 4JYBA 1GUAA 2B21A 3ASYA 3FFBA 3KKNA 4LJ4A 3U7FB 1Z5ZA 2V6IA 4TQAA 4ZGNB 4G5QA 2FSGA 1KC8D 3H86A 4ESHA 3MWKA 1I4TD 1CU1A 1F2UA 4XOIA 2G6BA 3TUJC 2AWOA 3SI7A 2XOKA 2CXXA 3UKDA 2GESA 4HDCA 3SQXA 3UMSA 3U60B 3VO1A 1BIFA 3BERA 5LBIA 5H68A 1J9ZA 5H5JA 3CPEA 1VQ5B 3ZS8A 4ZIRA 2EYUA 1XPOA 1TF2A 1YR9A 3B1YA 3X1YA 3BFKA 3K1JA 2FDCA 3FMOB 3THYA 2CMKA 2ZAOA 4WAUA 3FMPB 4ACBA 4EH1A 1NMZA 2A78A 5CK5A 1TU3A 2JLYA 4DQLA 1SXJB 4C2TA 3HU1A 5CJ2A 4K81B 4LYAA 1FPMA 3PVSA 5FR2A 3LNCA 1NVVQ 2FV8A 2G9NA 2A30A 3WNBA 3EPKA 2CNWD 2N1BA 4C0KA 3AF2A 4RD0A 1UKZA 1FTNA 2VRWA 4A15A 4YAFA 1G8FA 5CITA 4KVAA 2LWIA 1G8PA 1VPLA 5GJBA 4Y9UA 2A5YB 3O8RA 2E1RA 5JS8A 5CK4A 2R2AA 4E5UA 2RCNA 4RD4A 4IEIA 3GD7A 5EUMA 2JJ1D 1KKMA 4BLOA 3KJIA 4AG6A 1FDRA 1ZP6A 2ZRLA 5A5GA 4JSTA 3IBYA 3C5CA 4K1XA 2GXSA 1BMFD 1X86B 2YVUA 3O8DA 3FYHA 3RS3A 4M53A 3VR4A 1CEEA 1E2JA 3B1ZA 1LV7A 2MMCA 3NH6A 1IJFA 2ZRHA 1N6PA 2EFDB 4P33A 4I99A 3F0TA 3NH9A 4LV5B 1NBME 1F6BA 1NIPA 4MQBA 2IWHA 2OE2A 3TNFA 2V55B 1AS2A 3GLFE 3LV8A 1RKBA 4D81A 4A2QA 1PUJA 1EFCA 1TUIA 4G1BA 3UWOA 2PZFA 1SXJA 3HDTA 1KMHB 1YKSA 1OFHA 4EFLA 1OIWA 2K5UA 4JVNA 1Z0JA 2DFLA 4XWOA 4M1KA 1N6IA 1OH8A 4CRWB 3CNOA 1NSTA 2OK8A 2GZDA 3FMIA 3QFRA 4KO8A 1JPNA 2IA5A 3KXIA 1E2DA 1U9IC 3K70B 1T0HB 1UBGA 2BGJA 2ERXA 3H84A 5KHOC 3RYTC 5HR5A 4NYJQ 4AKGA 2ZS9A 4M1YA 3QVVA 5G40A 2D2FA 1P7CA 1YI2B 4JL8A 1KY2A 5JS7A 2DR3A 4FMCF 2QTHA 2W2XA 2QAGC 2PL3A 1UMKA 1NG9A 3KKPA 3QNUA 1SVSA 4PANA 4WXRA 2XNDA 2QUZA 4QFMA 1UFQA 3E5HA 3CWQA 1MO6A 1R2QA 3K0CA 4HATA 2QMOA 2OM2A 2WMOB 1UKEA 3M4YA 5DISB 5FTLA 4IDPA 2DFNA 2OZEA 3OW2B 1ZD1A 2PX0A 1UF9A 4MRVA 5HKKD 3ZBTA 5J4YA 3ZC3A 2ASEA 4GDFA 4M0LA 4TYQA 5LD2B 3U3MA 1WXQA 1JNYA 3QKSB 3VR6A 4HLUA 3OAAA 4DSNA 4MDFA 3CCMB 2HMAA 3CF0A 1G9XA 2QTZA 3LVBA 1A4RA 1HH4A 2RGXA 4ZDJA 1ETUA 5K8IA 4X8LA 2GZAA 1JR6A 3F3YA 1AMOA 3E2IA 1KMHA 1OXSC 4LYFA 2IXFA 5DE3A 1P75A 721PA 3AM1A 2R6CA 2GRJA 2O0JA 3CUEF 1ZM2A 3AP3A 1GAWA 4UJ5A 3A1UA 3TMKA 4DHEA 4A4DA 1GZSA 4RD2A 4BFSA 1UBEA 3KQLA 1Z0AA 4A92A 2NPFA 5DYIA 1Z08A 2XITA 1RC8A 3IILA 2P6RA 1T4GA 4AKHA 2LKDA 1T5IA 2JJ2D 4LJAA 1E9DA 5DO9A 1ZVQA 3MG9A 2J0VA 5KNCA 1FRNA 4CGZA 4E22A 3E20A 1YZQA 4Q4HB 4B75A 4WIAA 3NIBA 2V4ZA 2IBMA 2ZM5A 2AD1A 1XNJA 1QHYA 2R6DA 3BC1A 2WPDA 2OBMA 5AK0A 4Q1FA 1W5SA 2AD5A 1CP2A 2SHKA 3EWSA 4TL9A 4PPGA 5J4HA 2R65A 4N3GA 2Q9CA 4NKRA 3TGPA 4HLDA 3MD0A 2FGJA 2XNCA 4DIEA 1GKYA 4TTQA 3TVTA 2H1LA 5FFMA 1Z8FA 2CK3D 4LHVA 1E62A 1VCNA 3IEUA 2Q21A 2V8OA 5SZJA 3NBXX 3H2YA 1Z29A 5GVRA 1GG2A 4LHXA 4BRUA 4IXMA 4ILEA 4DCTA 4B3GA 2GF9A 1N6RA 2QE7D 3VFDA 2W0SA 1G3QA 1U0HC 4Q1BA 1CJKC 2QL6A 3PUYA 2ANBA 3QKSA 4MUAA 4EKDA 3GLGB 2C9CA 3Q8XB 1AGRA 1W5TA 3C41J 2VEDA 2X77A 1QFYA 3I1FA 1EFRD 1S96A 2ZJBA 2REOA 2F3RA 3DZ8A 4IDQA 5G3YA 1F60A 1N5IA 3W5VA 2NO9A 1C9KA 3K53A 3BOSA 2ZJAA 5IK2D 2ZITA 4HSEA 1W7AA 2QPOA 2WKPA 1W1WA 5HTKA 2OSBA 4W9MC 2B5OA 2WJGA 5JHGB 2NO1A 4DDVA 5JSZB 2OLJA 2BM1A 4IEEA 3LXRA 3FKSD 3Q72A 5CIQA 5KDDA 4FK8A 1LW7A 2CEAA 2F3TA 3EG5A 3SJZA 4LX0A 2QTVB 2WJHA 4ZKEA 1DS6A 1BH2A 3EXAA 4Q4HA 4HZUB 1ZUNB 4OQLA 5FTKA 5AN9A 2BOVA 3DM5A 1ODFA 4KLZA 3R9IA 1GIAA 3OHMA 3ONWA 1TUEA 1W87A 2ZJ8A 4JKIA 1BS1A 1JA1A 4JSYA 4Q7KA 2NO6A 1PVOA 2OCYC 3SBDA 1Q7YD 1KI9A 2ZSBA 2CNWA 3W5IA 4DC9A 5H1YA 4BGDA 2NMVA 3CXCB 3AF0A 3OEED 3LRPA 2BMWA 2ZRPA 1NJID 5FBRB 3KUDA 4EJSC 4RZXA 1QHHB 3EZFA 3EA0A 1Q81D 1M1KD 1QHSA 2EIXA 2D4HA 2HV8A 2NQ2C 3AH8A 3MAAC 4MH0R 5FPKA 3SQWA 1MRSA 1NMYA 2FOLA 1L8QA 3LQRA 4I4LA 4NP6A 1XP8A 2GCPA 3KXKA 2JJ1A 2KWIA 1XZPA 4Z54A 4WZBE 2ZU0C 3GLGA 2QROA 4TSFD 2AX4A 4J0QA 4H9GA 5CYPA 1QHGA 4N3NA 4OHXA 4Q18A 1JR3A 3CCSB 2VP4A 4PAOA 4DB4A 2VNJA 3LO8A 3L0OA 4JVMA 5FOUA 3K0EA 4B43A 2GJKA 4M1SA 3T35A 3LBNA 3QF7A 3VQTA 1F2TB 4G0NA 3CRZA 2P6UA 2VSOA 4PAMA 1G4AE 4OHZA 2QP4A 2JGNA 3P4YA 1T3HA 1A2BA 2N42A 1GKUB 1G7CA 1SM4A 3U6KA 3Q3JB 4QJ4A 5JSZA 1E4VA 5J47A 1KJZA 3GJ7A 1ZNXA 2VP9A 4P32A 1KK1A 2CBZA 1R7RA 4C9BA 1N0VC 4RZUA 2VZLA 3MSXA 1M1YE 4B3BA 1TX4B 4DDUA 2VHQA 3GPLA 3MWYW 1E1RD 3AVXA 2GZHA 1F20A 4QJ5A 2GEVA 1RIFA 4JS0A 1RJ9A 1SKYE 2J9RA 2O8DB 1KK3A 4Q4AB 5JMTA 3RS0A 4Q4LA 5FPYA 1QHHA 3OZVA 2WWGA 1R6BX 1YHQB 4FD2A 4URUR 5TY0A 2C04A 3RRMA 3QSYA 1KI4A 1HE8B 2PBRA 2RGEA 4H1UA 1TEXA 1G19A 4KFSA 1HT2E 4NYIQ 4PHFA 3TIFA 4NCKA 2RH5A 1YZLA 3FTQA 3P20A 4BFZA 5KUTA 1K9MD 2Q0HA 3L82B 2VF8A 4M4SA 3GJ4A 4NCIA 3TQCA 4R7ZA 2B7CA 2B8TA 1QGZA 1KDPA 2IYLD 2RGNC 5CLLA 4DJTA 4KSBA 3U7HB 3CB4A 2ZJZA 3LY5A 4R2IA 3TLXA 3ZVNA 3L8ZA 3ZBUA 1OB2A 2WBLC 1DAEA 5FOTA 1U9IA 2QMEA 2R6FA 2JEOA 3OIWA 4UNSA 1F2TA 4LC1A 3WBKA 2PIAA 1E0SA 1OKKD 3MLEA 3WMGA 1E0KA 5EXXA 1TL7C 3DMNA 3NC0C 2GK6A 1QG0A 1O87A 2BBTA 3KKOA 1LVGA 3R7WB 1II0A 5B64A 2GETA 3ZD6A 2H18A 4D25A 3JZAA 3ZDQA 1BKDR 1XEWX 2Z0MA 1HYQA 2QAGA 5CDFE 1VIYA 2DPXA 3V00A 5EP4A 2WWIA 4HB3A 4DDWA 3C7KA 3FFAA 1VQLB 3PV0A 4MITA 4AF7A 5EZ6B 5M04A 1C1YA 3K0AB 3TVDA 1II9A 1KI1A 1N0WA 3AF4A 5JJIA 1UBFA 1W46A 1MOZA 2P3SA 3CNNA 4URYR 2J3EA 3CC2B 2W58A 1KIMA 2O8DA 1S4QA 1HEIA 2VIIA 2JJ2A 2NOAA 3DO6A 3QPUA 3G6EB 4HUQB 4Q4AA 4LUCA 1W0KA 4NU0A 4MRPA 3FE2A 3VHLB 4C3ZA 2YNMA 4BE7B 5AUNB 4Q47A 1YZUA 3FMFA 4P4SA 3JQPA 2YOHA 3OF5A 1OFTA 2F1JA 3GJ6A 2PJRA 2PMKA 3B1XA 4CT5A 1AIPA 1VG0B 1UEJA 4QXAA 4M1TA 2YWEA 2DBYA 2BMFA 3PUXA 3KQUA 4IKEA 1G7SA 5GJWC 3AKYA 1X8JA 4JL5A 2EFGA 3C16C 2QZ4A 4PC1A 1JEEA 4IVQA 1D9XA 2FN4A 1NRJB 3RAPR 3KQNA 2Z83A 3BWDD 1TF7A 2ZSAA 1AGPA 2WWWA 4F4JA 2IEYA 2QE7A 2ZI9A 3KL4A 5HCIA 2CL0X 2IYRA 1GJRA 3R7WA 4DEYA 1OXXK 1MO3A 3CBQA 2Y8EA 4LHZA 3CF2A 2ZI4A 1IY2A 1Q44A 1EFRA 4ZI3A 3GFOA 2OTJB 1N8RD 2WIAA 1QVFB 3C5HA 3QPWA 4EAQA 1NI3A 1W4BA 1NVVR 3KTAB 3CCJB 2GJ9A 1XJCA 4I1UA 1BYIA 3DVLA 1W0JD 2KE5A 5IK2A 3TH5A 3K0AA 3QG5A 3IEVA 1QUFA 3WBJA 4QC2A 3VKHA 3TW8B 3ND8A 4BPRA 3PEUA 4KAXA 4MDEA 4AKIA 4EUNA 1N0UA 3CD6B 1X1SA 4HUQA 4M21A 2XJ9A 4D4JA 5BYKA 3I5YA 3EPJA 3I72A 3KXLA 1QX4A 1NKTA 3I4LA 4P31A 3TAUA 1AKYA 4PSVA 3NTUA 4RD3A 1CR0A 4R98A 3CW2A 3JZMA 2FSHA 3WYAA 3IIJA 3U6BA 5FBLB 4LGMA 4NYMQ 5DGXA 2CE7A 5FA6A 1N3BA 2NGRA 4AY2A 4Y9RA 1Z2CA 2L0XA 4IVPA 3GJXC 1NJGA 3L0PA 3PG5A 4B32A 1TQDA 4OJKA 4BLQA 4Q7LA 2QGZA 3KDSE 3RS4A 2MSDB 2I4IA 3VHXA 5ELXA 4TT3D 3QXSA 4V0OA 2GWHA 2G77B 4NTZA 4WQMA 2DB3A 4ZPXA 4BUJA 1EXMA 2FE4A 1F5NA 3A8TA 4R9UC 3X1XA 4DUGD 1LY1A 2BMEA 3AKEA 1N5LA 2WOOA 1ZAKA 4LJ6A 4TSFA 4TMTA 1DDGA 4QGHA 5KPJA 2BF4A 1WCV1 3WHKA 1ZUIA 2ZUCA 3BFVA 3FHOA 4O2LA 5FTJA 4OYHA 2O5VA 3QEJA 4UNNA 2P6NA 3KTAA 3PR1A 4O0MA 4DVGA 3GJ3A 3DOEA 4YONB 1OLOA 1FNCA 1CTQA 2WMNB 3UG6A 4I1SA 1XXHA 2EWVA 1KI3A 4LBZA 4FINA 3FJOA 1EFUA 2GNOA 2HT6A 3D31A 1RE0A 2JIZD 4P4TA 2FFHA 5J4KA 3A58B 1VHLA 1E99A 1X1RA 2VH5R 1CNEA 4IW3B 4YXWD 4ASUA 5G3ZA 4LZZA 2C8VA 2H57A 1R8QA 3J81k 1KAOA 4FI3C 1KZ7B 1ZNZA 4LPSA 1XX6A 1JECA 2HYIC 1FMJA 5EE9A 5GJCA 1P2VA 4V0MA 1G3RA 4TLAA 1GSIA 1RRCA 3ZQ6A 5IT5A 1GR1A 1Q1EA 3GEEA 4XSHA 2GXQA 4DXAA 3VAAA 1E3MA 1IM2A 1IHUA 3U3OA 5C4MA 2OFOA 3RSLA 4HDOB 4U02A 3RRNA 3RWMB 1BOFA 3KJEA 4HAUA 4JLDA 4PPQA 2PZEA 2QP3A 4RJLA 3T34A 3EIQA 1NLFA 3QBVA 4HB0A 4PQFA 3PENA 1DO0A 2VHUA 1P2UA 3CZPA 1IN4A 3E1SA 3OZWA 1XF9A 2OCPA 4DZZA 2OV2A 4OQNA 2V9PA 1U8ZA 2QA4B 1Q21A 4CZ2A 2F43B 4TTPA 1GP2A 4MRNA 5J40A 1AJEA 5TARA 2ZI3A 3I61A 4BPBA 4URZR 1E2KA 3BXZA 2IXEA 1VQNB 5DN6D 1OIVA 1U98A 1OKKA 3DZDA 1G8HA 3I3SR 5TB5A 5AJZA 2REBA 4LBYA 1PLJA 4ZIRB 1KNXA 4BZPA 1ZIOA 4Y0VA 2IYXA 3REFA 3D6TB 2VHCA 5FL7A 1C4OA 2ODBA 5IRCD 1NIJA 1KJYA 2C2HA 2KBFA 1H65A 2RGNA 3SNHA 2MSEB 1TVCA 4TLDA 2KJQA 1FNDA 2OXRA 3B5JA 5SZIA 4A6PA 2V1UA 4FWTA 2OLKA 4JLPA 3U3JA 1MABB 2GF0A 1YE8A 2GJ8A 2W2VA 4GPTA 4YMVA 2HT1A 1G7TA 4HDQB 4O2RA 1VQ4B 4BECA 2ZSEA 1U2RA 1TQ2A 2QI9C 1RW4A 4IOMA 3ICEA 2R62A 3QJYA 4TMWA 2AKYA 4CEIB 5FI0B 3W34A 3BH7A 421PA 1JPJA 4WA7A 1E96A 2CRVA 1FRQA 3QE2A 2BBSA 2ZAMA 4DIDA 2EFCB 4IOJA 1D8TA 1QFZA 1W49A 1NN0A 2IT1A 1JBKA 1KMQA 5BYJA 2F43A 2OUKA 4Y7CA 1HUQA 1JQLB 4A9AA 2Q9BA 3EWAA 1RZ3A 5F9HA 3NEJA 3H4MA 3MWJA 3C4JA 3CIOA 3QKRB 4B74A 1B0UA 4DSOA 2ATVA 3SJAA 3B9QA 5AUPB 1KI6B 4PO8A 1G20E 3LD9A 1NL3A 1TTTA 5JWHA 3BJIC 1AK2A 3OIUA 4OJQA 5TV2A 1K5DA 1SZPA 1X8LA 2NZJA 2GAAA 4PFSA 4WVFA 4N0EA 4AIIA 1Y63A 4BFUA 5TDHA 3CCEB 3B1WA 2Q9AA 4HAVA 2XZLA 4MKFA 4ZDWA 5CB6A 1MR3F 4Q1CA 3U3KA 4QOSA 2VP5A 4HZIA 1J70A 1E2GA 2O0KA 3LLUA 5JBQA 1XB2A 1MABA 1W48A 3MWLA 3X1ZA 1XMVA 3K9NA 1SHKA 2PCLA 3QIAA 1KOFA 2IYVA 1OH6A 4AC9A 1VKJA 2CNDA 1QRAA 1DDIA 3QKUA 1BO6A 3OIVA 4C0JA 3QFTA 4BFWA 1KDTA 1CJTC 1G3UA 1CULC 1IQPA 1R0ZA 4TQUS 4AG5A 3BB1A 3KFVA 1KI7A 2HCJB 1WE2A 3TRFA 4B34A 4UJ3A 4CEIA 1A8PA 4FW9A 3VMFA 2GJAA 4OKSA 5CM8B 1T3LA 1KQSB 1A2KC 4C0LA 3UK6A 3QY0A 4OQMA 1LF0A 4CW7A 4OK5A 4IDHA 2HLDD 3W3ZB 1NBMD 2ZS7A 1AS0A 1KJWA 3AVVA 3NDBB 1XEWY 3CCUB 1JXMA 1RFLA 3GFPA 3EASA 1RRGA 1JB1A 4L4UA 1PUIA 4QBIA 1E2MA 3SN6A 3DEFA 1P61B 2RMKA 1GRQA 3F8TA 5DH9A 1EGAA 5F2EA 3QOFA 3QKRA 4A0RA 5E3HA 3K0SA 1YZNA 1KI6A 4LJ9A 5JRJA 1YR7A 2JLRA 2ONJA 2OBLA 2JLSA 5DI9A 2JATA 3LFUA 4QGGA 3SOPA 3V4FA 4CYMA 3ZVRA 2O8BB 3ZIAD 2WIBA 2WJYA 5JECA 3TUIC 1ZNYA 3NBFA 1OT3A 5H70A 5EQTA 2FZ4A 1G3IA 2JA1A 4JVLA 1OIXA 4KVGA 5L3SB 3OZXA 2AKAB 1QGYA 2ZYWX 4YALA 1FQKA 2A5GA 4H1VA 4B48A 4EPYA 3GLHB 5K8UA 2C95A 3H1TA 2A5FA 2FZLA 1Q1ZA 3LX5A 2WTUA 4TN1A 4IOLA 1OSNA 1CKEA 4F93B 2BC9A 2EFHB 2JIZA 1N5JA 2R6AA 1D2NA 1S9DA 4PPNA 3QEOA 4NYIR 4XJXA 3U61B 1YR8A 1RYFA 3DPUA 4YXWA 4DBLC 3TKLA 1QHXA 4CDGA 2ZJ2A 3Q7PA 1JR3E 1ZD9A 1M90D 1CXZA 1M7GA 1EX7A 3KFXA 1B2RA 2BBWA 2F1HA 1WA5A 2Z6VA 4UQOA 3MCAA 5FUYA 4GP6A 1S0UA 4TL8A 4B2LA 1QHIA 5EJEA 3A4LA 2GEUA 4FMCB 5FBWB 5HE9A 1XCGB 3I8XA 2GTPA 4D2IA 3HWSA 3FDIA 3U4QB 2XJ4A 3WY9A 1KD1D 1GVNB 3NKVA 3P1JA 4FIDA 2FG5A 3NDPA 5DIFA 2QBYB 1AN0A 1DAFA 2OBNA 2G1KA 2ZJYA 3DM9B 3EC2A 2IS1A 3VKGA 4JYCA 2OXCA 4Q48A 4M9XA 2H8KA 2O8BA 1M7BA 3GJ5A 1H42A 1S3SA 2JAQA 5FTMA 1XTIA 3UMFA 2A5DA 3Q9LA 5FL3A 2ODWA 2FMXA 1IN6A 1CBUA 4XD7A 4DLZA 5L3SA 3NC1C 4UNQA 2AK3A 2MMGA 3GLHA 1KI8A 1OH7A 4PO9A 2ECKA 4MGYR 1T8TA 5FPTA 3WP0A 2BHRA 3ZGXA 2W00A 1OGIA 2ZSDA 1J99A 1FNMA 3AGPA 2QEQA 5KOYA 1XTQA 4Q02A 5FBVB 3OEHD 4RKFA 4V02A 5BQ5A 1HV8A 3A4MA 3GLIA 1Z6GA 3CO5A 3PUZA 8OHMA 3UG7A 5KYKA 1UBCA 2W6JD 5C1BA 3CKLA 2XTZA 4M8NE 1OHHD 3L2OB 3RC8A 1LB1B 4KI0A 1G6OA 1E0AA 4JLNA 3QKTA 4F91B 4PQYA 2R6GA 1EP2B 4NH0A 1TEVA 3W8RA 4LWZA 1VQ9B 2F1RA 4DLYA 3RC3A 3NHAA 3T1QA 3U4QA 1EP1B 4TYYA 1CRQA 4OHWA 5ANRB 3QBTA 1GO2A 5AUQA 3BB4A 4FMDF 1BX0A 4D4LA 1P2SA 1DAHA 3CX6A 2Q3FA 3B2EA 1XU4A 2QBYA 5GADl 1OXVA 3SJCA 1N6LA 2ZRMA 1GFIA 4HI0E 4TZ6A 3HJNA 3B82A 2J45A 2PT5A 3AUYA 4GZMA 2FGKA 5JWOA 4V0LA 1E6CA 2ZUDA 1VG8A 3W2GA 4B4DA 5C2JB 3KKQA 1DVRA 2J0QA 3QVUA 2PH1A 4JVSB 2PLRA 2WM9B 3WMEA 1AKEA 2W83A 3QPVA 2RC6A 2RGAA 1D9ZA 2WHXA 3UANA 1VIAA 5HZHA 2ZE6A 2Q6TA 4KFTA 4WW0A 2VSFA 4BFVA 3OIYA 3I5XA 4B73A 1KKLA 2QRZA 3P32A 2NTYC 5B30A 2IXGA 1NDHA 3LQQA 4MRRA 1G41A 4JLAA 5DYGA 1JXOA 4RCYA 1IXZA 5EUQB 2BMJA 1TMKA 2D7CA 3RWOA 4M22A 1QGAA 2BVNA 2FNAA 1CR1A 1M7HA 2QORA 4MYCA 3OFND 3RNLA 1EWYA 3GJ0A 1F3OA 1YIJB 2RGGA 2DY1A 1NY6A 1DELA 2FFQA 1ESMA 4W5HA 1ELOA 4D26A 3T5DA 1ZIPA 1Q3HA 1Z6XA 2C96A 1EWRA 3RHFA 2ZR0A 4LI0A 1MH1A 1RJ9B 3AB3A 3LVQE 4L9SA 2XTMA 3B85A 5SZKB 3VKWA 1YJNB 821PA 2ORIA 3EPLA 2CCGA 2JLQA 3CZQA 2YWHA 1P9WA 2X19A 4U7DA 4YMSA 1ZCAA 3LA6A 3OE7D 4F4IA 3C14C 1W36D 3W6OA 2VQSA 3FB4A 1OW3B 4F7DA 2VNIA 4D0LB 1E9EA 2J41A 1J7KA 4MYUA 1VQPB 1WB9A 4TMVA 2N46A 2XZOA 1NBMA 1E9SA 3QE0A 2J1LA 5JHHB 1BMFA 2UZ3A 4PC2A 1Q0UA 5DNYB 4LHWA 2WVJA 2XB4A 2YOGA 2QT0A 1Y3AA 3TW4A 2HEIA 1QVRA 3SHWA 1DG3A 4L16A 3ADDA 2GVDC 2ZRAA 2YWFA 1E9BA 3WP1B 4MYTA 2VO1A 4C43A 1XE1A 2VA8A 3VR2A 2ZXUA 5FI1B 3NBYC 3TE6A 1IY0A 1XTRA 3AKCA 1E2EA 1VYVA 1FNBA 3KX2A 4AI6A 2QAGB 3K0FB 4D0GA 4M2LA 3A4NA 1TQ6A 1WP9A 3VR1A 1E9AA 2EQBA 3W3AA 1T0JB 4U00A 3ETLA 2EFEB 3DKVA 1P6XA 2BEJA 3HR8A 3SU8A 4Q1EA 4Q4JB 3H0KA 4QHYA 5CIWA 5KNBA 2GQFA 2OAP1 4HLCA 3U44B 4XVUA 4D80A 4DKXA 1U99A 1E63A 2GBLC 1XEXB 1MO5A 1KSHA 3M0EA 4PHHA 4UAJA 4OI1A 3U7GA 2NO7A 4PGOA 4QBHA 4TZ0A 3EA5A 1I2MA 1ZMXA 1W2GA 2QTFA 4WZAE 1ZU5A 3WNCA 3V76A 4P4SB 4TL6A 1TQ4A 2HJGA 1XD2B 2VL7A 3BS4A 5IF9A 1XBTA 2Z43A 4GRAA 1OYYA 4JLVA 1LNZA 1RRFA 1PV4A 5LPNA 2BEKA 4KYIB 2BCJQ 4QNRA 4LJ5A 2AFHE 2QM8A 3VNVA 5J4LA 3WXMA 3B78A 4DRZA 2QSYA 2B92A 2FX3A 2JCSA 4YDHB 3BGWA 4D0NA 1R5OA 3TQFA 1GM5A 2DCUA 1Z28A 2GVZC 3AF3A 1G4UR 3GJ8A 3WMFA 5AJVB 2NG1A 3IGFA 5HKKA 3MMPA 1NVWQ 3CRMA 1T91A 2IYUA 2ZR7A 2FA9A 1E2PA 5KO2A 3R8CA 4FCTA 2NO0A 3PUVA 3SBEA 2QP9X 2ZRDA 3FKQA 3K0FA 3CCQB 1GRRA 5FUVA 1PLKA 4TLEA 4BQSA 1PLLA 3LLMA 3BD9A 4A36A 1RYHA 2G83A 2Z4SA 3RRYA 4YC7A 4I1VA 5P21A 3HU2A 3W5UA 1CR4A 1A5TA 4JBYA 2WKRA 2PMDA 4YLGA 4Q4JA 3LW7A 4M9QA 1UPTA 3U44A 2V7QD 3THWB 6Q21A 3FVQA 2J5XA 4X8MA 2ZE5A 3AQ4A 1XEXA 2JLUA 2W6ID 3DL0A 2DHRA 2ZREA 4GZLA 1VYTA 4LYJA 3T06B 1W36C 4Q66C 2AN9A 5C18A 4LK2A 5AUOB 5CB8A 4GBMA 4PTLA 2ORWA 4TQ9A 2V3CC 2QM7A 3AGQA 4E03A 2B6HA 4P0TA 2W6JA 1XD2A 4G1VA 3MJRA 1MO4A 1OHHA 1GITA 3T5GA 1ZM4A 3IBGA 4UNRA 4I1OA 4UXJA 1G64A 3AUXA 1Z6AA 1UDWA 3OZUA 3EZ6A 1Z22A 1VDZA 1FX0B 2W2TA 3UIEA 4ZKDA 2CK3A 2Z4RA 3W6PA 3JQRA 3FWYA 4BLRA 1XD9A 3ZJYA 4NCNA 1A82A 2UZIR 2OFXA 1J8YF 2ZRNA 2PX3A 3LWNA 5TVKA 4DT1B 1HA3A 4XWAA 2O8EB 4DLRA 1E9RA 2QQ0A 4QHSA 5EMNA 4S35A 4AURA 1VHTA 4DSTA 5KTYA 1Q86D 2YINC 3BH0A 1IY1A 2EW1A 4C2UA 3AVUA 4PSAA 1XZQA 4P6VF 1E9FA 1S8FA 2D06A 4PX9A 4C0BA 1QDEA 4PZLA 2KI5A 3SFVA 2QSZA 2YOFA 2GJSA 1IJEA 4LBWA 1YJ9B 1CJMA 4AYXA 4DQKA 1G291 3WYGA 5F9FA 1U90A 2WICA 5KU1A 1E69A 1S1CA 2ATXA 2B8WA 2HJVA 4K46A 1XDBA 4EJSB 4P3YA 1ESNA 5E7IA 2QAJA 2DERA 1XXHB 3THWA 1NNEA 4FN5A 2Q3HA 1E79D 3SC3A 3VR5A 4UXIA 3VU9A 2J7KA 1QVGB 1GL7A 1M34E 1TNDA 1XCPA 3JVVA 2R8RA 3FKSA 4M1OA 2BN4A 1K6MA 3EARA 3SHFA 4OK3A 1IB0A 1BQEA 3N70A 2DWQA 3I8SA 2CHVA 2ZJOA 4QHTA 2IYQA 1E2NA 1UDXA 521PA 3OFNA 4ZDIA 4B47A 2ZVQX 2WWXA 1R10A 5FH9A 5E4FA 2ZRBA 3O47A 4N1AA 1MRNA 5CYOA 3LBIA 4HE5A 4LJ7A 2D74A 4HAXA 5KNDA 5GV7A 4LHYA 4GOJA 4XVRA 5FR1A 1EESA 2ZVPX 1CF4A 2BV3A 5H59A 2W0MA 3CONA 3OEEA 3QFCA 1FX0A 3ZH9B 2AL7A 4Q1AA 5E95A 1R5NA 3KQKA 1OFIA 1D2EA 1ZC4A 2X3UA 3X2SA 4DT1A 3W2HA 2GCNA 5JEEA 3THXB 2O8EA 1N25A 4G5SA 1TLLA 2BSAA 1OFUX 1IN5A 3A6PC 1XTSA 3D8BA 1T5LA 2AR7A 3EW9A 3OE7A 4IDOA 3SYNA 1ZM7A 4B6EA 2DYKA 1Q57A 1E2LA 4GT1A 1Z07A 1YQTA 2CHQA 1P2TA 4I81A 1G1MA 4P4UA 4QKQA 2VSXA 2YC2C 1VCOA 2FH5B 1BX1A 2C98A 3VTKA 4IRUB 4BEJA 5FOWA 2ZE7A 2FEOA 1VYUA 3IO3A 2CJWB 4EJSA 2C78A 1SGWA 2P0EA 2IF2A 4URXR 4BLSA 1JB9A 3C15C 3I73A 4A2PA 1HT1E 3FPKA 1DTSA 1GAJA 2G3YA 3IPYA 3CCLB 3QI2A 4B33A 3VR3A 3ASZA 1W44A 1E2IA 1ZM9A 4NYJR 2HXSA 2ZIAA 1SVLA 1ZC3A 4PC3A 3QENA 4Z1MD 5LB2A 2BCGY 3A1WA 1J2JA 3QXCA 2CLSA 3LH5A 2IL1A 4FCVA 4GP7A 3ZYCA 4E09A 5C4GB 1BYUA 3CH5A 3L43A 1NN3A 4O3MA 3LX8A 2QY9A 5FPSA 3DKPA 4US1R 3ES9A 4Q5IA 4LV6A 4ACAA 1GNQA 3RABA 2IS4A 3HP1A 1P62B 1E1RA 5EZ5A 4D4KA 4TL7A 1CJVC 1DE0A 3K0CC 1ZM3A 2FFAA 4A8JC 3U2QA 1KDOA 3REGA 4R71A 1R8SA 3BRWD 3WHLA 3DDCA 1UAAA 1DAKA 5JI3E 4JJKA 1KDRA 2WAXA 1SXJE 3THXA 2IUTA 1J90A 4GOXA 4QL3A 1UKYA 2ZRCA 3QF4B 1PZNA 3SDZA 1ZD8A 3IPXA 4XTRA 2CLCX 3LXXA 4EPWA 2IS2A 4KBGA 5THXA 1L2TA 4AD8A 4DCUA 4M9SA 4DSUA 2OO7A 4GMDA 2BKEA 4PHGA 1NLYA 3K8YA 1H8ED 5FPHA 1FTSA 2PJZA 4TYNA 2GBLA 3G0HA 5L3QB 1Q12A 2XNDD 5CDFA 3T61A 4Q00A 1VG1A 2A3RA 4JLMA 3CC4B 4QBGB 1R0XA 3AEZA 4NHOA 3RRZA 3AKDA 2CJWA 2F6RA 4ZCLA 2WWYA 2QMHA 1W36B 4M1WA 1CR2A 4QJ3A 4XWKA 4YMWA 3PCRB 2IS6A 3OJXA 3CCRB 1JA0A 4B3FX 621PA 3TJZA 3K70C 2H17A 3OAAD 4A1FA 1T6NA 5J4VA 1G5PA 1I7PA 4PAQA 3TUZC 4D4MA 4C0HA 3W9YA 4NCJA
chains in the Genus database with same CATH superfamily
2PV7A 1ESCA 1DINA 4MWZA 3KOZA 5JNUA 3AC0A 2ZB2A 3QXXA 2HMWA 1UXOA 4RADA 1YI1A 4NMMA 2W11A 4QUEA 3SWWA 4RTNA 4C4OA 3NANA 1X13A 4FDTA 2RK4A 2FJPA 2XQVA 1F5SA 4FEEA 4OK6A 2O14A 4BNTA 1ZITA 2Z58A 5HMLA 4EB0A 1RPZA 5LQAA 3DE6X 3M34A 2PEYA 1P33A 4OXQA 5H7XA 4JP2A 1QUEA 2FLVA 3ROMA 4ZU1X 3RTEA 1IM5A 2BAGA 4LRWA 9MHTA 3RRJA 3R7FA 2REQA 1JGTA 1NG1A 5JCZA 1R0YA 4RKYA 3S2YA 5F1OA 1PBTA 2QV0A 1IATA 5JYBA 2LV8A 1QZXA 3GFTA 4KXXA 4LRQA 2VK1A 2RAUA 5HF8A 3D3QA 4K8OA 1WBDA 4UC0A 4KOEC 2Q8QA 4PYRA 4HAYA 5HW0A 3RYHA 3B3AA 1H4TA 1RD4A 5PNTA 1ICIA 3W7AA 1XO1A 2WPDD 5CVUA 2C4KA 1X9GA 2J87A 5L3VA 2A3NA 2JHFA 5FTNA 2WR8A 5LMZA 1VQKB 1I33A 1MA3A 4WZTA 3PUMA 1X1CA 1W4CA 1SVOA 3AJ8A 4IYRA 3K2QA 3RUPA 3CXUA 1JU9A 3AP2A 4TMKA 1P19A 5K8TA 3BDVA 3EXFA 3WNQA 3OQVA 4PS0A 1ZINA 5GJVC 1J97A 1KSFX 2PEZA 1N7IA 1ZW6A 1YOVB 5EJ5A 3SKYA 5CYFA 4ZVTA 2ZXEA 2FPLA 3IMCA 3LUAA 1L5LA 5JEDA 5TNXA 1K73D 2QYOA 1JJ7A 1TJ3A 3FJ1A 4IQ0A 4KEAA 5CJPA 2R25B 2XEXA 4IQGA 2HXGA 1BVUA 5E0KB 3RGWS 1V0FA 2Q4EA 4RLSA 1LDGA 3AT1A 2FWBA 4AS3A 1TI7A 2JVJA 4H27A 2HHLA 1KR2A 1L6IA 2H9IA 4JEHA 4QRIA 3WISA 1XZDA 3WJAA 1RLTA 4C0AC 1EK5A 1TTPB 1Q16A 3GPBA 4HFNA 1WB5A 2C57A 1AU9A 1W0JA 4GMXA 3RSOA 2PSSA 2C4VA 1LXCA 1Q3TA 3IAUA 2KLHA 3EY9A 2WKQA 4FNMA 4GNKA 1E79A 4E0FA 2RAPA 1XNGA 2QNRA 4JGBA 3WYFA 1AZTA 5F3WB 2J59A 4JIMA 4ZT4A 4ZC1A 4WMLA 3FOWA 5BORA 4PR3A 2I3DA 3GUYA 3I9V6 1E6KA 1MA0A 1G16A 1TLFA 4ARBA 3C1UA 2O9JA 1Y3IA 2FQQA 4JCOA 1YITB 3RROA 5B2ZA 3VOTA 4EFMA 1I2DA 1DCFA 2R6R1 5A6SA 2NNLD 3WV4A 5T6BA 3K09C 1OZFA 4OBXA 3DEYX 2R66A 5D7NA 4C0XA 1NVEA 4F5ZA 2W6QA 1MB3A 5KINB 4N49A 2YIDA 3O92A 4BASA 1YIAA 1GCAA 3OQJA 3CCVB 1KEKA 4RF3A 2NQ8A 3W6UA 4O4IF 4BAZA 4A8HA 4EF4A 3CEAA 5B57C 3L1UA 1KIFA 3ZD7A 5FBHA 3QE4A 2AOXA 4RKEA 4WUVA 3VU8A 4B2IA 5A8AA 1WY7A 2MIIA 2PT7A 4ARZA 4YCAA 1CY2A 1T6BY 1YS4A 4BFYA 5DNAA 4TT3A 1TXGA 1A7UA 3EGDA 2OT3B 2X1LA 1J6UA 2LBPA 3RBZA 4WCFB 3ZE1B 5KQMA 5IDWA 2WC1A 3CUTA 5CM2Z 2GXUA 4INAA 3QITA 4MQFA 4MCIA 5JC1A 2H1RA 3I9MA 4UNPA 1QGDA 5JDCC 3ZWVA 2WZCA 5KOJA 2EVWX 1O6CA 4Y18A 4L3WA 2F8TA 3ZZ1A 3PWSA 3T7SA 1I0ZA 1QK3A 1SVIA 4R2KA 1VLMA 5EMJA 2G0NA 3UQYS 4C87A 3FMGA 4BO9A 3ROXA 3KUKA 4U7WA 1CUUA 1ZHOA 4EM6A 3BFXA 1NA5A 1SUEA 3HYLA 3MGGA 3PXDA 1HE2A 4X1OA 1LS1A 4X94A 1JR3D 2O2EA 4YECA 3VNBA 3LUDA 1XQXA 2FPIA 4Q4DA 2C0QA 5EMMA 2AZ4A 4CEHB 3IQFA 1YS9A 3ORSA 4D9FA 4OLFA 2QQGA 1E9CA 1JMYA 1YR1A 2G08A 1ZLXA 4CF3A 2J0UA 3GT4A 4RTKA 3KZ1E 1BOOA 3A4YA 5D8DA 2QUAA 5BUQA 1P7ZA 3CUUA 3PXCX 3CIFA 3IAM1 1U0FA 5JI2E 3KRTA 4YRAA 1YI8A 2VG8A 1ZW1A 3FZGA 4LPKA 3GLIB 4EJ0A 3MHTA 1KSGA 1HQDA 5G4KB 1XI2A 1KJ8A 2V45A 1YI0A 4G5GA 2YBDA 3GWZA 1XRLA 1YFLA 2AFIE 2AR9A 1N32B 3M81A 1YZFA 2A59A 4KIUA 1RJFA 2EQ5A 3TFQA 4AYWA 5C8DA 1MEOA 1KFEB 2IVZA 3PC8C 4Y1FA 5EIBC 1HDEA 1FQOA 1ORDA 1G8YA 5EXTA 5C8YA 2G67A 4O4IA 4PVCA 3L92A 4UEKA 3PA1A 3G13A 3UMYA 2ODEA 4IDFA 2WOJA 4IGIA 3ZIDA 2BIFA 3NXSA 1FLVA 1M67A 2NUBA 3CLRD 4YMTA 4BP9A 1M0EA 4IOKA 1NZDA 1OTXA 4K26A 2EU8A 1SUSA 3GQBB 3T61A 1Q74A 3BCFA 3UFXA 3WIUA 3L7BA 4JA2A 5AK4A 2H0QA 1W30A 2L2QA 2ZRKA 1CZUA 4GVPA 4MK4A 4OHPA 3BHNA 4UPVA 4ZC8A 1RHMA 1MQSA 2D0IA 3MS2A 5CVTA 4OGKA 3D4BA 1X87A 4P38A 1KFBB 3ITEA 3GVPA 3TQRA 2BGRA 3RAFC 5EIXA 1CUAA 2XLBA 3OPYB 2R8ZA 2AH5A 3NT5A 4M87A 4MUFA 1MH9A 5GONA 2ZTUA 2NVUB 1SOUA 2YW9A 3N3BC 3CWZA 4D56A 4ARSA 3EVNA 1KYZA 2PD4A 2MT9A 3P9KA 2HCTA 4UUOA 2RGBA 2ZEJA 4NCBA 1W0CA 4Y1EA 1AZSC 1U0SY 2UYCA 1ITZA 1HDOA 2B1IA 2X8AA 5IMBA 1T8YA 1T9AA 4GI7A 2EDAA 4C0SA 3L6OO 1T3SA 1DC7A 1O5IA 4L7VA 4OP3A 2DFTA 1FUKA 5K0NA 5AFSA 3KEWA 3B8HA 4B17A 4WOPA 4U0KA 2B7BA 1LV8A 2Y66A 1VTKA 4FHFA 4MS1B 4ECAA 3VTAA 2V3WA 3CPWB 2G1UA 2GPBA 3TPZA 4KXVA 1JE0A 2JF0A 3U5ZB 4BNJA 2HHCA 2PWBA 2FW7A 5B55A 3LOPA 5BN5A 3CH4B 1SKQA 3D26A 3WG9A 1DQZA 2OECA 1COWD 3R3HA 5KVVA 2WWFA 2EOAA 2H4XA 2H92A 1UADA 3MAGA 4GS5A 1CY1A 1A9XB 4PXAA 4NG4A 1YBAA 4YT8A 2AZMA 4GOOD 5IDYA 4RFSB 4ZU3A 1C30A 3RYIB 3M6AA 3TEMA 2ZETA 3W3AH 5J2UB 4F38A 2P2ZA 2KLBA 3IHWA 5IYNA 5BSUA 3FSGA 1RVDA 3TLEA 4IFBA 1S2DA 1YAJA 2DLDA 4Q7MB 3RVJA 4F5DA 3UGJA 1GPWB 3UB2A 3RIXA 5IMSA 2DC1A 4LY6A 3DAOA 2FEPA 3L7CA 4FMDB 5F4JA 4BKUA 4BNWA 2WZQA 3A2NA 3G5UA 3QW4B 3R7AA 4CTJA 3COJA 1I1QB 1SUAA 4MKGA 4AS1A 5JSUA 4WLEA 1PR0A 3HKDA 4PF1A 4OQZA 5DK4A 4BLPA 1QTQA 3OPYI 3V1YA 1H94A 1N6HA 2NSYA 5F2KA 2C5LA 3P27A 1PD1A 1JEDA 1VE1A 5K6RA 2PPVA 2D1FA 5JLAA 2E49A 5HF9A 3TSAA 2P9GA 2B36A 4P98A 2DFKB 2F9FA 3ESQA 3OE1A 2BMDA 4FDAA 4CUZA 4HJXA 4I55F 1LLFA 1T3GA 3DSRA 1T2CA 1NE7A 2AMVA 1AVTA 2Q1UA 3AK4A 3CESA 2VDWA 3SJUA 3SYKA 2H9AA 3BQNB 1DNPA 1IXKA 2OILA 2Z9DA 5A89A 2XWPA 3F90A 2CDAA 3BL6A 1W34A 1K9VF 1M74A 4RZIA 3PDJA 2L82A 2YMMA 2W8BA 4NYMR 1JBEA 1VJTA 3DTVD 1B6GA 2UZ1A 3C7CB 1RXCA 4BTEA 1RLJA 3ZE6A 4JD5A 2P65A 3E1YE 4ITUA 2PNJA 2WYIA 2Q0QA 4FILA 2Q9UA 2XSZA 2FEWB 4K05A 3L7LA 2GN9A 2WKSA 1QM5A 1WD5A 1J9EA 1UC9A 3L18A 4L8FA 1WCIA 2BJVA 4R8SA 1NQAO 1FUYB 1FCJA 5JHGB 1LZKA 4R31A 1DIRA 1VPVA 3KEQA 2Q5FA 3WLSA 3UKJA 1NR1A 1FJGB 4H16A 3RLFA 4C2AA 1KSJA 4CIBA 2YXNA 4CKXA 5HFAA 5L6LB 4OOSA 1IN8A 3WGKA 1Z6QA 2CDNA 1HFKA 3F1KA 3QVMA 4Q19A 5IVIA 1VRWA 4BZQA 2UUOA 4RMJA 3OLWA 3QHPA 1LS6A 2VQDA 4MIEA 4K9RA 1T1GA 3NTXA 4PIMA 1IUPA 4N0PA 1NN5A 1FFWA 1P72A 1PJRA 2CB9A 2JFUA 2ZQ5A 2ZSUA 1Q22A 2XA9A 3I28A 5HUJA 4DR2B 5AR1A 2DKFA 1OXTA 3WK5A 5JAPA 2FUCA 3WAKA 4DIBA 2HL6A 1BJRE 1SULA 1EFTA 1ZD5A 3GLFA 3LAWA 4X85A 3JASA 4DLBA 4YRMA 3DOHA 5CHEA 4PR0A 4L5BA 2F1OA 1ZS9A 2XCQA 3NAZA 2R1VA 4I4CA 1GGEA 3PEWA 3D8HA 3GLUA 3PEYA 1NDUA 1F6DA 3HPQA 3JWHA 4YRBA 4RZ3A 1XEAA 2VXCA 3LUPA 3M83A 1HFEL 4AG3A 4BQOA 1P9NA 1N8SA 1M1UA 1QLJA 3JSXA 2X2EA 4KWCA 4AKEA 4I55A 4MW9A 3IL2A 4NU6A 2IOQA 1S8NA 2Q2OA 2F17A 4RPBA 1DX6A 2VT7A 1VE9A 2XUFA 3BWVA 3OCUA 4GHWA 4I5FA 3BWMA 5K09A 5KTNA 1QXSA 1GA4A 1Q77A 1XFAA 3HCOA 2EL7A 2FHPA 1F7VA 3BK2A 4QYMA 3L01A 3L7DA 4JOQA 3LDHA 5JPIA 4HEJA 4CM4A 1FP4A 1C7FA 1V39A 4Q7JB 2EJUA 2IP2A 3I6MA 4WGGA 4ESVA 2RHBA 3GIRA 4C4PA 3Q5DA 4O08A 4R83A 4GNRA 1WXWA 4MQEB 2IW3A 4EB3A 3ICWA 3JALB 2PO5A 3B9PA 4BWYA 2QMZA 4ATNA 4L57A 4YRTA 1VECA 2EKZA 3IKVA 1DKRA 4PO1A 2FHSA 3K9QO 3M5PA 5IDVA 1VB5A 2PL1A 2WZNA 1OVMA 3JTEA 4YO7A 4C6HA 2BY4A 4NJEB 4C7OB 2E1PA 1YDMA 2R8OA 1Q1QA 1U11A 1ZI9A 2AQKA 3BJZA 5F7JA 1TZCA 1G38A 2EZ8A 4NDAA 4EQ6B 3MWGA 4HDMB 3NVKI 1R50A 4QDTA 2PFKA 1VLYA 5CR9A 3KR1A 4YRKA 5ILOA 4II7A 5AIBA 2O8FB 1CF2O 1Z0DA 2WMDA 5ALZA 3V7FA 5EXDA 3KSBC 2OQIA 3URKA 1CNMA 3ZHCA 2FUG1 4ID3A 4HH1A 1Y0RA 4XN3A 2CXPA 1OF1A 4CUJA 3ANXA 1J1ZA 1AA9A 1XD8A 4ZJYA 2IYYA 4TMZA 2X23A 1U1DA 1U3VA 1IMJA 1IUNA 1P4RA 2FK8A 3A1VA 3GA7A 2VLIA 3LSYA 5AKJA 3OO0A 2H6EA 2QNBA 1T5BA 3WKBA 121PA 4QASA 4MVJE 4MYHA 2WABA 1PP4A 4HJRA 2YN2A 3DQQA 1B0ZA 3Q6MA 4X65B 2B7LA 1TIBA 2XT0A 4YP9A 1AQIA 1A1VA 3L8YA 3H65A 4LOHA 4NNOA 2C5AA 1GT91 2CUKA 4LRUA 3DLAA 1VFPA 2AK2A 1P9RA 3LDAA 4EW6A 2ZCJA 2A0YA 3M1LA 3OJWA 3H05A 4UAGA 4ENPA 1SXIA 5EZSA 1AS3A 3PC8A 4ALNA 1T2AA 4JZKA 1J1UA 1M8FA 1EBUA 3P52A 1ZDMA 3HUTA 4BYMA 4UTVA 4ZICA 1L4UA 4JSRA 4AZ3A 1NAIA 4E13A 2O1XA 3RGGA 5A3RA 4OAOA 2PJUA 3DS8A 2OPHA 1ORVA 2OR3A 2XPCA 1KYXA 1H23A 1UWKA 4IFIA 1NMQA 2V9ZA 1S2OA 2WVGA 4AJEA 2V7VA 3BF7A 4CEJA 3CLUC 3EC7A 1Z0KA 3U0VA 2JH3A 2M6KA 4PCAA 5K0CA 1DO2A 2GBPA 2XA2A 3GRCA 3IUSA 1UEIA 3WLMA 4E4TA 3FTDA 1L7RA 5H4HA 4ERXA 3BNWA 1W93A 5FT9A 5MF6A 2ZSFA 2CCKA 3D6HA 1RXIA 3WLEA 3PJRA 2ZANA 3L0DA 3ZHZA 4EB6B 2XHZA 3I6ZA 4OQDA 2PTGA 1PQ4A 2A5JA 5F76A 4G1EB 1P6UA 2XE7A 3I58A 2RKBA 1FDWA 1XG5A 1S02A 1YSCA 2ZS8A 1W75A 5DBEX 4RPHA 5KSZA 4LSGA 3FPEA 1DL5A 3KBBA 3MINA 4GYKA 4KFUA 1CS4C 1QF6A 1GKIA 3I9FA 4ZCSA 1ACJA 1QQ6A 3GIDA 2IV3A 4ZYUA 2RG7A 7GPBA 3FOBA 2IITA 3HKEB 3TXXA 3U39A 1T8UA 2IJGX 3BEOA 2SICE 3R0IA 3AVWA 4CMEC 2GWRA 4N0DA 5IYQA 4BNMA 2WW8A 2JGEA 2WG2A 4I50F 3RUAA 1N77A 1GQFA 5GQSA 2IUUA 1G6HA 5JWRA 2BP7B 3AV3A 3LBAA 3B1VA 4YRSA 1QR6A 4PXYA 2C4UA 1BGWA 4YJFA 4JLKA 5HIIA 1X74A 2ZBFA 4JU8A 5SICE 2ATIA 1SPBS 4DDTA 1WG8A 2HADA 1PJSA 1PVVA 4NDNE 1YJAA 4WINA 5ALRA 3CUSA 4CG3A 4NDZA 1WZEA 3TQIA 5BWMA 3FWPA 1IUOA 4MDHA 1AKWA 1NR5A 2ODAA 3E4CA 1N2EA 4MB2A 1NI4B 1SKYB 4KUGA 4WXYB 1RAIA 3RS5A 5KVCA 4YJHA 4KR9A 2GD1O 1LCIA 3QVWA 1NUQA 2Z2IA 2IUSA 2MSCB 1KO8A 4GH5A 4OMDA 4EFDA 5J3JA 2P4HX 3EEQA 1ZISA 2QX7A 3O8CA 4PC7A 2H2WA 2O3TA 4IHAA 3RV3A 4BO1A 3I2JA 2Q6KA 3T15A 4CHTA 4J8PA 4J0JA 3ADBA 2CWDA 4J0IA 5EJMA 1Z74A 3A3PA 4JLOA 2VXOA 3GPDG 4B5LA 4XIGS 4O1HA 5JROA 4CUKA 4KQXA 1ZVVA 5K2OA 3PQ3A 4J0GA 4M9ZA 4IO0A 2AFHB 3HCDA 4G5YA 1XVUA 5K99A 4DGQA 4FE4A 3BMOA 3PB3A 4OQPA 5C31A 3ZWNA 3RVBA 4CVNA 3BXFA 4R4JA 2BGWA 3I55B 3U4MA 5AW8A 1TK2A 3EY4A 4UHJA 3O5AA 4KMSA 4ER6A 4LXHA 1KJQA 5EFZA 3IV9A 4GXRA 4V0NA 4AULA 3P4XA 2D3WA 4KSYA 2VCYA 3FOZA 4RORA 5IU6A 1XYYA 1QH0A 1KJJA 1ISJA 2IWRA 5SYNA 2I7CA 2O3RA 2ODNA 2IHJA 1NQOA 1MD9A 3BILA 1DRKA 3CZMA 1OV4A 2Q4DA 3Q9UA 2Z4TA 3PLNA 4JJZA 1VM6A 4U7JA 4HLQB 1T4MA 1DBSA 3ANMA 2Y1OA 3PHBE 1M6WA 4E1VA 4N40A 2C8LA 2R11A 3BF8A 3LQ4A 1WNTA 2HAEA 2OZLA 1N2SA 3K9GA 3HMQA 4UAVA 1N5KA 2A58A 3ADCA 3ZE8A 2WHPA 1EUYA 1Z6YA 3PQCA 2ZI7A 1XVIA 3E2PA 1M6VB 4NZYA 4BGIA 5ED4A 2FPRA 3CNLA 2YRXA 3KKLA 3Q6IA 4IJKA 1ODKA 1YB2A 2JDIA 2QN6A 1E98A 3U4DA 2A1TS 1V5EA 2VDNB 4JJEA 5EXPA 1XTTA 2PGXA 3MJFA 2I1VB 1U65A 5AKZA 3SJBA 1AKNA 4D8WA 3KU1A 1DZIA 4FCCA 3AXTA 2ZRGA 5EPEA 4BQNA 2DRIA 1SXJD 4WZAA 5C52B 2FOXA 2LCFA 4OB6A 4EO7A 4GBED 4EMTA 2VYQA 5ERYA 1MQAA 3DV9A 1M73E 2VDLB 3BE4A 1DLIA 1UC4B 2G1AA 2YY7A 2A0XA 2Q50A 3PEEA 3NG1A 4Z4SA 4PZCA 3NEAA 2NU6A 4OYYA 2KYRA 2ZYSA 4W9RA 3P2KA 1B1AA 4DJ5X 4RMIA 2CCJA 1NJFA 1II8A 3DFKA 5G0SA 4XX0B 1GVHA 3OPNA 1B23P 5K05A 3W5HA 1NBOA 2OYRA 2WVAA 4MUMA 1JHRA 1OU4A 3E35A 4RGVA 2C3PA 1BS9A 3QRWA 2X4IA 4NECA 1D1PA 1BXZA 1XZFA 4GD3Q 1N33B 2IXDA 3D7MA 3DEAA 2ZSKA 5ALGA 1JKFA 1XWWA 4KDEA 1D7OA 3T4PA 3CKMA 3USCS 1I7SB 3S0JA 1YZYA 4CN8A 3QMPA 4S2UA 2B61A 1B2LA 1LSSA 2RI1A 4M98A 3D43A 4MI6A 2QMUA 4TL9A 3ZPNA 1XYVA 3DJYA 4GLJA 1ZGBA 4YB8A 4BZXA 1X6VA 3K6RA 2FUNB 3VYRB 2GA8A 3WIEA 3PWZA 4TWJA 3SR0A 4C78A 1I3KA 5JJLA 4U9UA 3AW8A 3HUUA 2AG8A 3R3UA 4QOJA 1GG8A 3T5BA 5DB4A 2P2LA 3O8BA 1ID1A 4I9FA 3WIBA 3H99A 1A9YA 1XXLA 1FFSA 3DBHA 5M7EA 4UUNA 1MV8A 3ZI4A 2WAAA 3I0NA 3QWIA 1DQPA 1CJUC 4H18A 4HX5A 5DULA 4CI9A 4E4RA 4N76A 1M6NA 1VG9B 3EODA 2HLPA 2X9LA 2P9ZA 3D4IA 4FT2A 4PX5A 3VR6D 1EFAA 5AD1A 3CX8A 2H29A 4LDAA 3W1EA 3DMDA 1LDMA 3QX7A 2QAIA 3RD5A 2QVLA 2F55A 3JYQA 3PUWA 2JZNA 1JAHA 4MWSA 4QPCA 4BBJA 2FWJA 2V7QA 4YUYA 2BGIA 2WJJA 2NWQA 4MWDA 4I4IA 5IBRA 5LOVF 4ENUA 1CQPA 4JQSA 4WI1A 3TTUA 3AESA 1XOIA 2UVQA 4W99A 3ZCUA 1MXHA 3FPAA 4DCNA 1HM5A 3B51X 6REQA 3D5QA 3RS2A 1HY3A 3CMMA 1H2HA 2DTXA 3PTLA 3QKIA 1CCWA 4OQQA 4ZDKA 3THYB 1GLGA 1LC3A 3TRHA 2CVOA 1E1YA 2EKPA 2H1VA 4X05A 4DDHA 1ZNWA 2IOFK 4PTZA 3ZV5A 1Z6ZA 2HCRA 2PU5A 2YHSA 3UT5A 4FFBB 1U3DA 1YRBA 3E9QA 4PZ0A 3A1NA 1N6OA 3NBZC 1WHTB 2HWYA 2CLDX 1VC2A 4CV3A 2BM0A 2LKCA 4EPTA 3Q3IA 1VP9A 3EIXA 4FEAA 2I33A 1PNRA 3KPUA 3T1OA 4LXIA 1R4AA 3W8FA 1S2LA 5LQMA 4FYJA 1BDIA 1Z4JA 4Q21A 1Z2NX 2PRIA 2R96A 4QQRA 5LYJF 3K9CA 1WQ1R 4PFKA 1EM6A 4KQ1A 2IODA 1P0MA 4UW9A 2JK1A 3SM9A 3ZD9A 1CRZA 2HMSA 4B3DA 2H31A 2P4SA 1V5WA 3CRRA 4H7DA 4LQCA 1Q1NA 1G6KA 4C5CA 3ADPA 3P9ZA 2ZRQA 1YRAA 1EVLA 1TCUA 1QKKA 4CF7A 4LV8B 1M2OB 1P5ZB 3A1SA 2IZ6A 4URWR 1ZR4A 4JYBA 2JAUA 1T1RA 2I6XA 3HSYA 4EL5A 2V6IA 4N0MA 4C4AA 3VJMA 1AE1A 4YT2A 3NB0A 1CEYA 5K2MA 4YNBA 4QO7A 2O0MA 2AWOA 3SI7A 2XOKA 2CXXA 2GQ0A 1G63A 3NCHA 1VKRA 3UAXA 2VBIA 2PKEA 1Y7TA 5H5JA 1V0EA 2VTDA 5D5HA 3IB6A 1VQ5B 3LZCA 3W8DA 3EDMA 1E8DA 1RIIA 5LOVA 1YR9A 4KW7A 3E5MA 1RYNA 1AF7A 2DLNA 3NJRA 1Z36A 4I5EA 4F46A 2B6NA 1WP6A 3FMOB 3LCUA 4CMEA 4UE6A 2XKKA 3JRNA 4WAUA 2AYXA 5CK5A 4QXOA 3O3MB 1TU3A 3CEMA 5HUHA 3OTQA 4UHKA 2JA2A 4R9RA 1BX3A 5CJ2A 2ZKLA 2P40A 4IGEA 2RJOA 4AJ1A 1XP5A 2DH6A 1KAMA 1I7NA 3PUKA 4OFXA 4ZANA 5DJ5A 5J2TF 1NVVQ 2FV8A 1SK9A 2UXCB 3LOQA 2XMCA 1QIKA 3ESAA 4R1PA 5DYTA 1ESZA 4HHEA 4JI6B 5HIAA 4GI3A 5GM1A 3M2TA 3U09A 3FPSA 2D9RA 2JFFA 3AINA 3WHIA 4B3IA 3EMVA 5CITA 1U8UA 2LWIA 4KVAA 5JS6A 1VPLA 5GJBA 2VPTA 3DL2A 1C7RA 3O8RA 3RAGA 4K6FA 3BRQA 4R68A 2SECE 3MPUA 5CK4A 2R2AA 1RI1A 1Z5OA 4UMVA 1PV1A 1EYZA 1AMNA 4YPVA 1YBMA 3P8ZA 4EYGA 4AG6A 3NMUF 1FDRA 2H4HA 3B8EA 5A5GA 3G8CA 2LE0A 4F5EA 3TG8A 3IBYA 3LT0A 4L4YA 3VNQA 4JFAA 1EA5A 4K1XA 3N0RA 3N7AA 5K01A 1BMFD 1X86B 3CBGA 1L5OA 4PG8A 4X00A 3RS3A 1CEEA 1A0OA 1E2JA 1BGXT 1LV7A 1ZJZA 3KB8A 5A4AA 3EZLA 4ZO6A 3KALA 3MFQA 1OMOA 1Q17A 2GNAA 2XGGA 3FOFC 2QJWA 3UT6A 2HU7A 2XYQA 2Z3VA 3CT6A 3M4NA 1U7DA 4ODIA 2ZRHA 2NU7A 3H4VA 1RJDA 2Y0DA 5AO9A 4P33A 5DLYA 3F0TA 2WJ4A 1O96A 3ON5A 3A04A 2Y4OA 1RZUA 1F6BA 3H16A 3JZDA 4L07A 4L6AA 4LV5B 4MQBA 4RM3A 4NCAA 4Z0HO 3PSHA 3I04A 1RKBA 2JC3A 4A2QA 2N47A 1EFCA 1ZY2A 1XDGA 2Q3CA 2X4LA 1TUIA 4V3CA 4G1BA 1X7DA 4XLLA 1OGYA 3JW8A 4ER5A 2JGJA 1NZFA 1JU3A 3HUEA 4EY4A 4AW9A 1YKSA 1OFHA 4K0RA 1OIWA 2K5UA 1HR0B 3NFRA 3STVA 1KC3A 1UINA 3F6CA 4RAQA 3V97A 5HWSA 1O9BA 1F17A 1W5EA 3TIIA 4ND1A 4CRWB 1GL3A 3FMIA 4JLUA 4U3JA 5ESRA 8AT1A 1HL7A 2CNOA 2IA5A 3I01A 4AMBA 1U9IC 3PNVA 2ZWOA 2BGJA 3ISTA 4FXUA 5DMXA 3E9MA 4KE9A 4WCDA 1T0UA 2AZDA 3JQ8A 4E12A 2ZTGA 3DE3X 4J6FA 3SZUA 3OCCA 1YI2B 3HKDB 5DBFA 4ZT2A 5LL6P 3ZOKA 1T5DX 1UBUS 4U4AA 1PS9A 1B41A 1KZ6A 2AC7A 2IIPA 2Y77A 3JQ6A 4FOPA 4KTVE 4ZVRA 4C01A 3RW9A 1SVSA 2XNDA 1CUVA 1B4DA 3W1WA 3E5HA 3CWQA 4NCIA 1Q0LA 1R2QA 4UZSA 2WMOB 2XT9A 1S4MA 3SOZA 3TJMA 4DARA 3G6WA 3FVVA 2HMTA 3QUQA 4L7QA 3UM9A 3AY0A 3BY1A 1CUJA 3KBOA 2X6YA 2PX0A 1T9KA 1MJNA 1XAJA 3KSUA 4OJTA 5LBUA 4BMVA 4PLPA 3K8ZA 2C7VA 3Q3HA 4QDZA 4BVBA 3HLTA 4TMFA 4EKNB 5J4YA 3GL9A 4XQ9A 2LCQA 3R5TA 3HXLA 6ADHA 2CJFA 3OG9A 2ZR8A 1XVVA 5AW3A 1A4RA 2BGKA 5MGBA 2BFOA 2H5IA 2I99A 1H3NA 4ZDJA 4K40A 3RUHA 1R6UA 2GZAA 2PIDA 3WRWA 1I30A 2PSHA 1JR6A 3A06A 5LJLA 5IVDA 1FC0A 4AM8A 3PFWO 5DE3A 3WC4A 721PA 1TRKA 4DYDA 3MOSA 3AP3A 3P0EA 4YA6A 2CKDA 2BHLA 4A4DA 1GZSA 3QIVA 3KQLA 3ICVA 1JQEA 1RC8A 5HQ3A 3A1EA 3GFQA 4AKHA 2LKDA 1RWVA 3U7RA 3X3HA 1E9DA 5TE9A 3MG9A 1FRNA 2YJGA 4QXPA 4CGZA 5I7RA 1VZ3A 1JHPA 2GRUA 3WZ2A 1F8YA 3AX6A 3R5JA 5IVPA 1QHYA 4KO4S 3BC1A 4OHCA 4C6SA 5IDQA 1G42A 1TAUA 4OX9Y 1RRKA 1L5WA 3B38A 2AD5A 3BMQA 3EWSA 2IKSA 3BTVA 3H3XA 3L5OA 1Z7YA 3OKCA 4KIJA 4N3GA 3PNMA 4NKRA 4ZAXA 4CNBA 3BIJA 3L7AA 2XNCA 1BWSA 2W6MA 4H4DA 1ZGCA 3OTWA 1VPWA 4RL6A 2H1LA 3RHZA 4RY9A 2R1VB 5GMOA 2NO4A 2JFBA 1Z8FA 2CK3D 4HBGA 2LCIA 4LHVA 4X1IA 4CMJA 1RADA 4EG0A 2GYVA 1J09A 1ZK0A 2L17A 3L8GA 3H2YA 3SXPA 2Q5JA 2EERA 1TZ2A 5B12A 9ATCA 1EUCB 2P6MA 5IJ9A 1J2EA 3PX3A 4B3GA 1P80A 2EEZA 5J35A 1IHYA 1GZ5A 3KXPA 3V3KA 2W0SA 4LZNA 2B2XA 4MICA 1U0HC 4BVLA 4Q1BA 5KYYA 2QL6A 5C81A 4MUAA 5KQSA 2ZIGA 1PQWA 3V1LA 2HHAA 2O1EA 3UVEA 3L4KA 1CWUA 3LQ2A 3LGXA 4G0ZA 5K0LA 5LUBA 2VEDA 3UJDA 4DL9A 1RE1A 2QUKA 2ZJBA 2UVDA 2ZUVA 4IDQA 1TUBA 4KUEA 4EARA 5A4FS 2HTEA 3L1JA 3NORA 3NAGA 2ZG6A 4KQEA 5CYGA 2VRNA 4YP1A 2GBFA 5I6DA 1C9KA 1VHJA 2SCUA 3K53A 3NONA 3O94A 4FFRA 4JXKA 2I8LA 1J7JA 2AFIB 2AV6A 5IK2D 4B45A 5I4IA 2ZITA 4D8VA 1SUBA 1JHYA 1W1WA 1LX7A 2HIMA 2X8LA 4XQGA 3IIIA 2CMDA 2B5OA 2WJGA 3VR5D 2GZ1A 4W9MC 2AG0A 1AKUA 5A5DA 2BM1A 3LXRA 4HGNA 3DYIA 3H1FA 4X24A 2B69A 1LW7A 3PGKA 2BSQA 1KQ3A 3EG5A 4LX0A 3TRKA 4U39A 2XY4A 1RBMA 5K3AA 1LSUA 3NTQA 4EW3A 4EZIA 2DKNA 4ZKEA 1BH2A 4Q4HA 4LMBA 1XN1A 2NYRA 4ZAWA 1EX1A 3ZBPA 1EVKA 5AN9A 2Z09A 4ZAZA 3RSCA 1E66A 1W9MA 2Q1SA 3MJEA 4PN3A 3ONWA 2VJIA 5L46A 2HK6A 1Z5UA 3IIEA 3R0VA 1BS1A 5ALLA 4UCQA 4HH4A 2VOEA 1RS0A 1SA0A 3JYHA 1Q7YD 1I2CA 3N8GA 2BFEA 1QO0A 3W5IA 4CG2A 2TS1A 4DC9A 4FEGA 3PXEA 4I66A 3OOCA 2IPNA 4HNHA 4BGDA 2NMVA 3QZUA 3LRPA 2BMWA 3H11B 3C8HA 5E2IA 3A6KA 2HWUA 2HX1A 1MJGA 1ISHA 4RZXA 3U3OA 3AH8A 1M1KD 2HV8A 3MAAC 4BNKA 3SQWA 5FPKA 1AKTA 4NP6A 3DR3A 4LSWA 2NVOA 5BWNA 1Z25A 3PT9A 2V0NA 3PHGA 4RA6B 1P9OA 4ZI7F 4Z54A 3ZLJA 1M6YA 4TN5A 1CZNA 1KAQA 1SU8A 4H7HA 5KAMA 5T4HA 1OWLA 5CYPA 1Q1GA 2WMYA 3PHHA 4RHYA 2O8NA 3OT1A 1X7XB 5HKLA 4B81A 1QYIA 4PAOA 3JAMA 4R8MA 2VNJA 2HK9A 4FU0A 4EO9A 1O5OA 2GJKA 3A9UA 3HA2A 3K0EA 3LBNA 3ZNNA 2Z6QA 1W8IA 2PRYA 3R74A 3FWNA 2VSOA 5LLTA 1G4AE 3FPHA 3KG2A 2QP4A 4H7PA 2QV7A 3P4YA 1T3HA 1A2BA 2N42A 4LE1A 1ML3A 1N3LA 4PM4A 3QWBA 3F4KA 3A6GA 3VI4B 2EG5A 1UP6A 2A9FA 3COWA 4TVSA 1H2EA 3QGMA 3GJ7A 3OQIB 1IDN1 4DPKA 4JFRA 2QTCA 4R5MA 4P32A 1J0CA 1ZUNA 4MW5A 4Z3DA 4CM6A