3WYAA

Crystal structure of gdp-bound ef1alpha from pyrococcus horikoshii
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
423
structure length
396
Chain Sequence
KPHVNIVFIGHVDHGKSTTIGRLLYDTGNIPKFAWVMDRLKEEHTKFETPHRYITIIDAPGHRDFVKNMITGASQADAAVLVVAATDGVMPQTKEHAFLARTLGIKHIIVTINKMDMVNYDQKVFEKVKAQVEKLLKTLGYKDFPVIPTSAWNGDNVVKKSDKMPWYNGPTLIEALDQIPEPEKPIDKPLRIPIQDVYSIKGVGTVPVGRVETGKLKVGDVVIFEPASTIFHKPIQGEVKSIEMHHEPLQEALPGDNIGFNVRGVSKNDIKRGDVAGHTDKPPTVVRTKDTFKAQIIVLNHPTAITVGYSPVLHAHTAQIPVRFEQILAKVDPRTGNIVEENPQFIKTGDSAIVVLRPMKPVVLEPVKEIPQLGRFAIRDMGMTIAAGMVISIQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Elongation factor 1-alpha
publication title Molecular insights into the interaction of the ribosomal stalk protein with elongation factor 1 alpha
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
total genus 108
structure length 396
sequence length 423
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3wyaA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3wyaA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wyaA01
3IUYA 1M90D 3ICQB 1OIWA 5DN6D 2RGEA 4M1WA 1KI9A 1NY6A 1XEXA 1UKEA 3BS4A 3ONWA 1HV8A 4XH9B 3I72A 4Q1CA 1SXJD 4BZQA 1J2JA 1S1CA 1SGWA 3CC2B 5HCNA 4TYPA 2W2TA 1C4OA 4TLAA 1S3GA 3W2HA 1QHNA 2ZYWX 1UF9A 4XVUA 3UMSA 3VMFA 4BFTA 1XMJA 1E3MA 2ZUDA 4KODA 4B73A 4YAFA 1VCNA 5J5CA 2GKSA 3RWMB 3GFOA 4TLCA 5JSZA 1D9ZA 2D62A 2JLUA 2DPXA 1FTSA 1CJTC 3T06B 1RYHA 2X19A 2YHSA 2ZRKA 4FMDB 5IF9A 1N5LA 5F9FA 2AD1A 2QENA 3GJ3A 2WAYA 5JWOA 1IBRA 1JQJC 1CP2A 2VSFA 3OEED 1XTKA 3GP8A 3CF0A 3EZ9A 1P2UA 2FG5A 3IPYA 1EG7A 4OKSA 3ADDA 4PAMA 2P65A 2ZRHA 2C9OA 5CIWA 4F4IA 2CCKA 1XCPA 5J4VA 4GRAA 5DE3A 3RLFA 3JQPA 5SZHB 4TMVA 2ERXA 4FD2A 1Z47A 4AKEA 1QUFA 2JDIA 4TMKA 5DI3A 1NY5A 3BFXA 1TMKA 1Z2AA 3IO5A 1GOTA 4G5SA 1ODFA 4AD8A 3PFIA 5BXQC 3WYAA 5AJYA 3EZ7A 1FNDA 1R8QA 4URVR 1IHUA 3FPKA 5L3SB 3A6PC 3EARA 1RZ3A 4HZUB 5GADl 1KO1A 3OEEA 3U6KA 4HLCA 1R0ZA 2Z4RA 2B5OA 4HDOB 5LBIA 5JRJA 4FCWA 3FHTA 1N6HA 1BX0A 4Q4AA 4DRZA 4A15A 2P3SA 3FWYA 4D4JA 4NMMA 5GJVC 2OFOA 2CRVA 2BVNA 1H8HD 3A1VA 1XP8A 4M1OA 4FIDA 4M9XA 2SHKA 2HXSA 3ETLA 5FH9A 1T3LA 4Q4HB 2QEQA 2AXPA 2BIFA 3D6TB 1ZM7A 1G3QA 4B35A 1CQXA 1Q0UA 1W5TA 1FTNA 3EC1A 4HLQB 5L3RA 3U3RA 2PLFA 3U6BA 1OIVA 3B1ZA 3CBQA 3TUZC 3FJOA 3W9YA 1HH4A 2WSSD 1NIJA 2OSBA 3L43A 4MRPA 3RYTC 1W0KD 3OZXA 4KLZA 4M8NE 4DSUA 4B44A 4Q66C 1GAWA 4L8GA 2F6RA 1TF2A 3WNCA 1KSGA 2IS4A 2CL7X 2D2FA 1EFTA 2RCNA 1E63A 1Z22A 2XX3A 4PX9A 3SJAA 1CTQA 4GPTA 1NBMD 2A7QA 2KB0A 1SKQA 1YU9A 3SR0A 2O52A 4BLOA 2YWGA 2XZPA 2GAAA 3ADKA 3C5CA 4LBYA 2DETA 2BV3A 2XSZD 4H1VA 1JI0A 1WP9A 2FOLA 2GRJA 4G5GA 2OUKA 1W4AA 2OEPA 2QQ0A 4LY6A 4EJSB 4ZI3A 2OESA 3GLIE 5ELXA 3AH8A 1T8UA 2WICA 5SZKB 2GZHA 2ZTSA 3T34A 1W0KA 1ZD9A 2GILA 4LK2A 4HI0E 1LS6A 3LAWA 3U60B 2MMCA 2XNJA 3RC3A 4CVNA 2BMWA 4Q47A 1NBMA 5TDHA 1VCOA 3I1FA 5H1YA 3UG6A 1X1SA 1MABA 4W5JA 1I2MA 1TNDA 3UWOA 2QTZA 3LX8A 3QE2A 1G7SA 1YJ9B 2XSZA 4JSYA 2RGGA 1JR6A 4KSBA 4QNMA 2VP4A 4TLEA 2C8VA 4AKIA 1T0HB 1S2MA 2BDTA 2C2HA 2VP2A 4NE2A 4LRWA 1Q82D 4AF6A 1G8HA 3CC4B 1QHSA 4IVQA 5FBRB 1E2NA 4WQMA 4BQSA 5LD2B 1PVOA 2J0UA 3VQTA 2YV5A 3P32A 2X3UA 2LKCA 1E9DA 1L4YA 1IY1A 3LV8A 1F2UB 1OV4A 1UBGA 1KI7A 3A1UA 4C0QC 3W6NA 4R71A 4R2HA 4PHTA 4HATA 4LJ9A 1MO4A 4XD7D 4C0HA 2GZAA 2ODNA 3KJGA 5CLQA 3TR5A 4ZDIA 2REBA 2ZR0A 5FBWB 2NGRA 3O8RA 5M04A 1X8LA 2V1UA 5EP2A 3SQXA 4HUQB 1D8TA 3P26A 3CPJB 3NC1C 5KSOA 4K8OA 5KTYA 2V4ZA 4NYMQ 4ZPXA 4C0KA 3ZZUA 2KBFA 2ZAOA 4C4PA 1W47A 1YJWB 3X1YA 2QMHA 1G9XA 4W5WA 1JA1A 3RS4A 4Z1MD 1VG9B 4YMVA 1J9ZA 2QTFA 4CEIA 4F91B 4W9MC 2IXGA 2P2LA 1AMOA 4U02A 3TE6A 4A2WA 5TY0A 2QTLA 4BFXA 1QVRA 1QUEA 4XD7A 1PUIA 2VHCA 1QHIA 2FSHA 2ZJ8A 2X2EA 3GJ4A 4MGYR 4PC1A 2BM0A 2PMDA 3K70C 2EWWA 2ASEA 2GJ9A 3P4YA 1DVRA 4KXFB 5EZ5A 2NPFA 2OHFA 2W6JD 3CR7A 2OG2A 4MGKR 4KSCA 2GCNA 4OHWA 1UBCA 2R44A 4KBGA 1Z5ZA 1FW6A 4CEHA 2EU8A 1IAQA 1N0UA 1NVUQ 2PBRA 4YXWA 1KSFX 3OFNA 4JLDA 1E2MA 4DLWA 4IFEA 4M53A 3AVUA 3TH5A 3I5YA 2VQSA 5DHFA 2ZI6A 3OF5A 4QM7A 2WJVA 2QAJA 2ZE8A 1W49A 1AS2A 4PC6A 1GUAA 2F3RA 2VTKA 3PUZA 4KHZA 3BE4A 2BF4A 2PIAA 2NO7A 3FMOB 3T1OA 3VTKA 2A3RA 1XRJA 2J9RA 3F8TA 3FVQA 4BEBA 3DMNA 2OBNA 1G7RA 4TN1A 1RFLA 4TT3D 3GLFE 2BM1A 1XD9A 3L0PA 1N5KA 1PUJA 3LW8A 4BASA 4B3BA 1Z07A 1SHZA 5FPKA 4PPQA 1GO2A 1D9XA 4UKDA 1DAIA 4LHYA 4US0R 1P5ZB 1IJEA 1XXHA 4BLRA 1CKEA 2AX4A 1Z6TA 1FRQA 2ZS8A 3MJHA 1N0WA 3QF7A 2FPLA 3KQKA 1VQLB 2DEUA 1U90A 1G8FA 1AM4D 2AL7A 2O8DB 4NYJR 1CJKC 5KSZA 4TMWA 1W36D 1G1MA 4NL4H 5CB6A 2ZUBA 4TT3A 1T5IA 4ZI2A 1S3SA 4UXIA 5JLJA 4E07A 3I73A 2PCLA 1YZLA 4RJLA 1E2QA 2EVWX 5HKKA 4IDPA 4IXNA 3REFA 4C7OA 1D1NA 2PX0A 3AKEA 3I8SA 2V55B 3WY9A 2VF7A 4Y0AA 2R6FA 4B75A 1R5NA 2BMEA 5H5JA 1GNPA 2QGNA 1RPZA 4ZCIA 2FU5C 1SVLA 2GVDC 421PA 4RZ2A 5FL3A 1E2KA 1U81A 4A8JA 2FPKA 2JASA 2OT3B 1ESNA 1G20E 1KO4A 2W83A 4TTRA 1N6OA 1T3SA 2QPAA 4DWJA 3A36A 1O3YA 2G88A 5FR2A 1U0LA 4B3XA 2HLDD 1KNXA 4OJQA 4LJ4A 2CK3A 5FFMA 2DWPA 1N6IA 3CX8A 2O8CB 3AKYA 2YWEA 4QGGA 2X77A 2D7DA 1CRPA 4D26A 2ZRBA 4O3MA 2I3BA 1U94A 3IEUA 1FMLA 1HTWA 2HYDA 2FGJA 4C43A 1L4UA 1V5WA 1ZD8A 4LYFA 3JZAA 2RKOA 3K0FA 2FX3A 3TQFA 2NMVA 1BH2A 1M2OB 4W5HA 4A6PA 1ZJ6A 1NVVR 2B6HA 1N2CE 2F9MA 3D8BA 4HE5A 3HJNA 4GZMA 4G3XA 2ZVQX 3K9HA 5DNYB 2HLDA 1T9HA 1UKYA 3KTAA 3A58B 1Z0AA 4O2LA 2QPOA 3NTUA 1N8RD 4U00A 1PV4A 3NIBA 4FMCF 4BRUA 5JCPA 3EC2A 2F55A 1M34E 4GMXA 4OI4A 5AUNB 3B1YA 3FMPB 3E1SA 3Q8XB 4TMZA 1UKVY 3Q7QA 1JA0A 3RWOA 4PHGA 1IN5A 1FNNA 1KSHA 2QQEA 1EWQA 2EW1A 1Q3HA 2XZOA 3X1XA 2QORA 1Z0FA 1UDXA 1XTRA 1R2QA 3V9PA 3EIHA 3LFUA 1AS3A 2XGJA 2QRNA 4K81B 1QH0A 5JZVA 3T1QA 3C5HA 4BRWA 4HAUA 5JS7A 4U9UA 4V02A 4IDOA 1XWIA 1KNQA 4IOKA 1KY3A 3SOPA 4A4DA 1AZTA 4M9QA 5KDLA 3RNLA 2WMOB 4RKFA 4M0LA 1KI6A 2WOJA 3IBYA 1IM2A 1AIPA 1P3JA 4BGDA 1Y63A 1WMSA 3OAAA 1ZIPA 2C5LA 4LZZA 1KHTA 4PSKA 3UMFA 3ZYCA 1XF9A 1VG1A 3KXKA 4I1OA 1RW4A 1UADA 1VHLA 1PLJA 4XVRA 3PEWA 2VLIA 3CPHA 1OT3A 1W46A 3KQHA 1VQMB 2Q9BA 1R0WA 3K9NA 1E0SA 1NVWQ 1LS1A 3HWSA 2CNWD 2EWVA 4WOPA 4LBWA 1QG4A 3FPAA 3WMEA 2V54A 4QL3A 4IW3B 4ESVA 1T0JB 4B34A 1A2KC 5THXA 5H59A 2RGCA 2GCOB 3DM5A 3SNHA 1EP1B 4NYIQ 2FSFA 4JIMA 2JEOA 2EFGA 4PTLA 4IDHA 5JBQA 1E94E 1QG0A 3HR7A 2D4HA 1DDIA 5GJBA 1F2TA 1SULA 3AP2A 3VO1A 3V76A 2IF2A 1E9EA 3RS5A 1TF5A 2VNJA 2NO9A 3UPUA 2ZIAA 2CNWA 3IO3A 1OKKD 3EZ6A 3N5CA 3OZVA 1GP2A 3DDCA 4X8HA 4B3DA 1N5IA 1M7BA 5EXSA 2A5FA 1DTSA 3Q5DA 5HZKA 2IEZA 4Y9UA 2XTMA 2CEAA 1W34A 1SXJE 1QFZA 2XOKD 4BE7B 3GLIB 3THWA 1E32A 2UZ3A 5FUVA 1KJYA 3AF2A 1HUQA 3LO5A 1WB9A 5GVRA 3LXXA 2C03A 5GJCA 1XZQA 4N0DA 2E9SA 3IBGA 1VQNB 2H8KA 1OW3B 1U0HC 3ECCA 1SVMA 3SBDA 2GXUA 2C95A 2PH1A 3GJXC 3K0EA 4TYQA 3U5ZB 2ZUCA 4QBIA 4EPRA 4HAZA 2VRWA 3QE0A 1XTJA 4DVGA 2GJAA 4JMPA 4URZR 4FWTA 4B2IA 3T1TA 1Q1EA 2WZQA 4M22A 5FUXA 2JLYA 3VFDA 1G19A 1N25A 5KPDA 3NBZC 2CJWA 2XAUA 3CNLA 3AVVA 4QGFA 3W2IA 2FV8A 2R2AA 2KE5A 1SHKA 2Q9AA 3WNBA 2ZRPA 2PL3A 1JJ7A 3BIFA 3WBKA 1NJID 3W5VA 4Q4JA 1KQSB 2HT1A 1E96A 3MJRA 2G77B 1QF9A 2NQ2C 4F4CA 1NRJB 3CMAB 3SYLA 1N5JA 3WBJA 1U98A 4JLJA 3AVTA 1VIAA 1KO7A 5G53C 3RANA 2P5TB 2RH5A 1YR8A 3AM1A 2FA9A 2B7CA 1S1MA 3HDTA 2BMDA 3W8NA 2FFHA 3CONA 2IXFA 4UNSA 4KAXA 1G41A 4ESHA 2IYQA 2E1RA 1AQUA 1DAMA 3H1TA 3TAHA 5AJZA 3GEIA 2G6BA 1XB2A 4OQMA 4AG6A 1WRBA 3VNUA 2F1RA 3I92A 4URYR 1E0KA 2ZI7A 4JS0A 1OB5A 4MGIR 2V8OA 2CVFA 4CYMA 1VQKB 4HAVA 5D3MB 3CMEB 4WZAE 2ATXA 3WHKA 4FI3C 4JLMA 3RVBA 1E6CA 4BUJA 1GNRA 2W6ID 2C78A 3CCJB 2IYXA 2H57A 2RGNA 4TQAA 1EP2B 2PMKA 2JCSA 2ODEA 4NYMR 5AK0A 3W5JA 4NDZA 5IHPA 3FFBA 3QKSB 4DKXA 4AK9A 1MKYA 1KYIA 3W2EA 3A4LA 4LJ8A 1KOFA 2PEZA 4DLXA 2H5EA 3J81k 4I99A 1DG1G 1TVCA 2QDXA 1NNEA 1EP3B 4RFSA 2VZLA 1GNQA 4TQUS 3TUIC 2WAXA 4TWZA 4IKEA 2ZJBA 5F3WB 4HLDA 2ZRFA 4OI1A 1G17A 3I61A 4MYCA 4DCUA 4GZLA 2A5JA 4JL6A 5EE3A 5L3VA 4N3NA 3SFZA 3OIUA 2AR7A 2QTVB 2WJJA 1KZGB 3GLFB 1QG2A 1QBKC 1JR3A 2FH5B 1JEDA 1P72A 1ZNWA 1UAAA 1AA9A 4LX0A 2VPPA 5KSWB 3IHLA 3X1WA 1B2RA 4QG7A 3RS2A 3CF6R 3SC3A 4M9ZA 1GAQA 3OIVA 1P9RA 3GLHA 1FP7A 1CEEA 4UXJA 5AWFC 1E2DA 4O0MA 3ZGXA 3L0IB 1AGRA 3C4JA 3K1JA 2NO1A 3QF4A 4JVNA 1DAHA 2YOGA 5FPTA 2WKRA 4F7DA 1I2DA 3WMGA 5C1BA 1GIAA 1II9A 5K8UA 4P6VF 2ZRGA 4JZKA 1ZYUA 2BMFA 2HF9A 1F48A 3W90A 1OHHD 4GP6A 1QDEA 5L3QA 4V0MA 4LWZA 3R7WB 3U44B 4TYYA 4ZIRB 1FL9A 3JZMA 2H1LA 4IFBA 1SVKA 2HUPA 5FTJA 3TW4A 1QGAA 4DLZA 3THXB 1KDOA 2B8WA 2V9PA 4A2PA 1XPOA 3Q72A 3O47A 4M1TA 4QKQA 2RGNC 1P9WA 4FXPA 3R20A 2QAGB 2J0SA 1OXTA 1Z6GA 1FUKA 1OJLA 4DLUA 1MRNA 3CD6B 2IUSA 2WPDD 2WSMA 3QFSA 3TNFA 3QKTA 3MCAA 2OXCA 2QSZA 3LDAA 4RZUA 4EPTA 2ZJ5A 3BK7A 4C9BA 2QBYA 4JVLA 1ESMA 3OE7A 1CS4C 2P5SA 2IYYA 5DGXA 1DAKA 1GRRA 2FPMA 4NKRA 1VKJA 4KFUA 2H92A 4POAA 1FFHA 4QJ3A 2GEDA 3Q5EA 2FF7A 1NIPA 3S1AA 4CW7A 2R8RA 1A82A 2GESA 3LRPA 5BYKA 3A4MA 3RS0A 3OIWA 1ZUNB 1SQ5A 2ZJ2A 2XTZA 3IPXA 4TSFD 2IS2A 1KY2A 2PT5A 2WPDA 4HYYA 1UDWA 4EFLA 2IYTA 1W5SA 1GFIA 4LGMA 2QG6A 5HPYB 1ZM4A 3WXMA 2VHQA 3QXCA 3TVTA 3DL0A 4Q21A 3AVQA 5EE9A 1EWRA 1TF7A 3CC7B 2A5YB 2ZRLA 3SHFA 4A0GA 1YQTA 1Z3IX 4WVFA 1ZM3A 1XEFA 1E0JA 1GR1A 1IN6A 2Q0HA 5DLQC 1OH8A 4CF7A 3SEAA 3U4QB 2CL6X 2LWIA 2BWJA 1L7VC 2VSXA 3D7MA 4TSFA 5DHAA 4L4UA 3GLGE 1LB1B 3SU8A 3B2EA 4FN5A 4QJ4A 4DCNA 2GTPA 1E9FA 1IOZA 4DBLC 3MFYA 4NHOA 3CCEB 3WHLA 2GXQA 4GOKA 3B1WA 3UG7A 4Q5IA 3NH9A 2P6RA 3JVVA 2D2EA 4YMSA 5JWRA 3ZBTA 1YJ5A 4YMUA 2OFWA 3TGPA 2ZJAA 1E64A 2QEXB 2JDID 3L2OB 4JJZA 1IQPA 1ZM2A 4NZYA 2QMEA 2R6DA 4JL5A 2GPJA 4AF7A 1EX6A 4YAWA 2QA5A 4IRUB 4B74A 3DEFA 4HZUA 2RAPA 3PUWA 4AG5A 1BJKA 1H8EA 4DIEA 1HYQA 2ODBA 2ANBA 3DMDA 3P4XA 1QHHB 2C98A 2WIAA 5BN3A 5IRCD 5EXPA 1R10A 2D3WA 1JEEA 1Z28A 3KFVA 4LHWA 1M8PA 4EKDA 3AF0A 4ARZB 1UPTA 1ZU5A 1Q1QA 5EZ6B 3SYKA 4PO9A 4PPNA 2XB2A 1NI3A 4DJTA 4Q4HA 1WBDA 3ZVLA 4A36A 3DZ8A 4WBSA 5A4JA 3KKOA 1DG3A 2AFHE 3SJCA 1FUUA 3I32A 4Q4LA 1G7CA 1WF3A 3AB3A 3N70A 1TQ6A 3T35A 3CLVA 3E20A 1N6NA 1NLFA 1OXSC 1XMSA 1AQYA 3ZJYA 5FOXA 2G83A 1R8SA 4LJYA 1J99A 4Q01A 4WAUA 4BFVA 3H86A 5BYJA 1UEIA 2HJVA 2OV2A 2G0NA 3G82C 3K53A 3X1DA 2O8BB 4QHYA 4S2EA 4KO8A 5CYPA 3F0TA 1B23P 5JSZB 4EJSA 5J47A 2GCPA 1XTQA 4D82A 4ZO4A 1TADA 1ZNZA 5GJWC 4EQ6B 1ZMXA 2NIPA 3EXAA 3MRSA 2J1LA 4DC9A 1W4RA 2YNMA 1K6MA 3EZFA 4WZ6A 1PJRA 3RRZA 3MWYW 3W2FA 3QFCA 4BFWA 2WWHA 1W2GA 1R4AA 4NYIR 5JWHA 5P21A 3K0SA 1SXJB 4NU0A 4XJXA 1W48A 3NKVA 3QY0A 3K70D 3WRXC 2GZDA 1XU4A 1TUIA 1Q1ZA 2HXYA 4NCKA 1IXSB 5DI3B 1L8QA 2QI9C 5FTMA 3W5IA 4XOIA 2BN4A 2ZRDA 1T8TA 3VHLB 1KK0A 1N6RA 3PCRB 2XXAB 4MRNA 2H16A 2RGAA 2BGJA 1TEVA 4B6FA 4FINA 4MITA 1A4RA 1UMKA 3DPUA 4US2R 4MDFA 3HU3A 2NO0A 3RSOA 4OQNA 4KFTA 2GDJA 1E2GA 1XMVA 1P73A 3OZWA 3CCUB 2DERA 2HV8A 2J41A 2WJYA 1KKLA 4AI6A 2HEIA 3LXRA 2TMKA 1N6PA 3NBFA 2QZ4A 1S8FA 1F2UA 1MV5A 1KO8A 2VNIA 4D0NA 5HXBA 2OAQ1 3TBKA 1UFQA 1KAOA 1AN0A 1SVWA 3QBTA 2J7KA 4YONB 4I1SA 2REXB 1U8ZA 1DELA 1M1YE 5A5GA 2HMAA 3NC0C 1IN8A 2BSAA 2R9VA 1WE2A 2CLCX 4PZLA 1RRFA 3Q3JB 1Y3AA 1PLKA 2Q9CA 3QKRB 4TL6A 5CITA 5CDFE 4XTRA 2OCBA 3VKHA 2FGKA 4QFMA 2N1BA 3LWNA 1VG0B 1P61B 2GJ8A 2K5UA 1II8B 3G6EB 1VQ4B 4EJSC 2PJRA 2QY9A 4G5RA 3EASA 3W6PA 1GZSA 4D4MA 1OH5A 1B0UA 3QBVA 5DIFA 2O8FB 2AN9A 4J0QA 1ZD1A 3W6OA 6Q21A 3CCSB 1XTSA 5J40A 4KYIB 2VYFA 1A1VA 1ONBA 4ACAA 2QTHA 5F2EA 5EUMA 1E4VA 2EIXA 3HPRA 3K0AB 4YALA 3Q9LA 2QMUA 2YWFA 3R8CA 1FQJA 2ZU6A 3BFVA 3VR1A 3GD7A 2FE4A 3QPWA 2O0HA 4B32A 4LYAA 3RS3A 2YYZA 3AV0B 3MHPA 2J45A 3FGNA 1XCMA 4N0EA 4PAOA 1CR2A 2VYQA 3RRYA 1E99A 1Q7YD 2NOAA 2B92A 3IHWA 4US1R 5AJXA 4YXWD 3OFND 1BYIA 1XD2B 2IXEA 3CF2A 4TYWA 3DHWC 4EFNA 3KDSE 3NXSA 4LBZA 5LD2C 3HP1A 2WM9B 4YDSA 1AZSC 1QVGB 1G5RA 2Y8EA 4CT4B 1DO0A 3CR8A 3G0HA 3FDIA 3SJZA 4HB0A 4K1XA 2HDNB 1F5NA 1GKYA 3W2GA 3DOEA 3GQBA 1KMHB 4HAWA 4URXR 2QP4A 3UATA 5CIQA 5G3ZA 1Q86D 3P20A 1G3RA 2WBLC 3BH0A 4DB2A 4EPWA 1K8AD 1FZQA 3ZVRA 1KDTA 4EDHA 1ZVQA 5EE1A 3U7HB 2QNRA 2BBTA 3H2YA 3VR6A 3DO6A 3QSYA 3ASYA 4MUBA 4A6XA 4FK8A 3VR3A 4GOJA 3U7EB 3KKMA 2BEKA 3OW2B 2RGDA 3G4SB 1BO6A 2EFDB 2PZGA 4I4LA 2O8DA 2CXXA 1CU1A 2FSGA 2R62A 2RHDA 3A1TA 4BLPA 4YC7A 1U8AA 4UNPA 4CRWB 1NG1A 4YMTA 4LV5B 2OCAA 2DFNA 3HR8A 3V4RA 1C1YA 3GFTA 2QT1A 4V0KA 4ASUD 4BFYA 2VEDA 4DCVA 3VNVA 4I1VA 2AK3A 4PHFA 4OHVA 1AS0A 1YIJB 2KI5A 5HKKD 3GEEA 4ERNA 1VG8A 3SDZA 1Z0JA 4LHZA 4PFSA 3O8BA 3RC8A 2BCGY 4HAXA 1ELOA 1E62A 4B71A 2CNDA 2WWIA 3SBEA 2DYKA 3EA0A 4PQYA 1W0JA 1UJ2A 5JMTA 1TLLA 4DCSA 2JATA 4QBHA 1E79A 3X2SA 3ZQ6A 1D6JA 1Q57A 4PANA 4ASUA 4AIIA 3A8TA 4LPSA 4MYUA 2A5DA 3KKPA 4QGAA 4CEHB 3QENA 1OFHA 2GXAA 4R98A 2W00A 4FWIB 4MYTA 3MG9A 2R6AA 1NN3A 1EXMA 2VHJA 2AD5A 2QE7A 2CK3D 2O8CA 1H65A 2ZR7A 5EJEA 3OZUA 5CJ2A 5G40A 1X86B 2CE2X 4DEYA 4B47A 1JB9A 1CBUA 4NONA 4LPKA 4DUGD 3TLXA 3QJYA 3BAFA 1SVSA 1XZPA 5FTNA 2WJIA 4CDGA 4M1KA 3B9PA 3KJEA 1JXOA 1OB2A 5IK2A 1FNBA 3T12A 4V03A 1TL7C 4URUR 4Q9IA 4AYTA 3VU9A 4CZ2A 2BHRA 1UM8A 2OXRA 5FI1B 1EFRD 3VR5A 2A30A 2I4IA 2IL1A 2ZI4A 3VX4A 5KDDA 2O0KA 3QNUA 1A2BA 2P6UA 5FOWA 2XTNA 4LYHA 3DZDA 1MO5A 3ZH9B 4A92A 3ES9A 4F7WA 2ZSAA 2V3CC 2RGXA 4UNNA 4DUGA 3U61B 1H42A 1WXQA 4Q19A 3CWZA 4DDTA 3GLGB 2H18A 1NMZA 1R7RA 2PJZA 1E2LA 1YZQA 1YR6A 4DDUA 3A1SA 4PR0A 4LC0A 1US8A 3C16C 4GMDA 2AKYA 1OGIA 3SZRA 4MQBA 2J87A 1VECA 1EESA 4XWAA 1EFRA 1M7HA 2YWHA 3A4NA 4GSYA 5LPNA 2ZR9A 1LY1A 1OH7A 3LW7A 1G6OA 2UKDA 2YOFA 4JVMA 2RB4A 4TZ6A 2CHQA 4PO1A 2JJ8A 3CX6A 1KI3A 1YHNA 1W36B 1G3UA 4NH0A 4LHVA 3T15A 3OAAD 4O2RA 1Z08A 1R0XA 3TSWA 4JVSB 5EUQB 4EH1A 2ZYUX 2PLRA 2X2FA 2QM7A 2ZI9A 2WIBA 4FW9A 1IXRC 1FOEB 1NSFA 2ZYVX 1IN7A 2LKDA 4HE6A 4LHXA 4TZ0A 3TW8B 4A8JC 1E9CA 5K8IA 4LCBA 5FTKA 1E2FA 4F93B 2QUZA 5LB4A 1XTIA 2IYUA 1UKZA 1X6VA 2CVHA 4AKGA 2EYUA 1YZUA 2JJ1A 3MGCA 3U3MA 2IYSA 2VP6A 2XJ4A 4IDNA 3K9LA 2J0QA 3PUYA 3E70C 4V0NA 1NLYA 4BECA 1DAEA 3FMFA 3CRRA 2BEJA 3LNCA 5FUYA 4GI7A 4XVQA 4FMDF 1HY3A 3IILA 2J0VA 3QUSA 1FNMA 1TX4B 1QZXA 1OH6A 4QJ5A 4BPBA 1NMYA 2DWOA 2AK2A 5FOUA 4A0RA 5FBVB 3U7GA 3G71B 5HR5A 4WA7A 3K09A 4P4SB 1CXZA 3CXCB 2BC9A 5FOVA 1NLZA 2JIZA 2ZETA 221PA 3QXJA 4OI2A 3CCVB 4BWYA 5FTLA 4QBFA 4TLBA 5G41A 1CULC 2JLSA 5BQ5A 3R9WA 5FA6A 2XNCA 2DWQA 1MO6A 4C3ZA 2O8EA 1YI2B 2G9NA 4R7ZA 4CEJB 3T1VA 2C77A 5KDOA 1S0UA 1E1RA 1T91A 2C9CA 2D74A 2GF0A 4RVCA 2F43B 2NPIA 2DHRA 5H8WA 2WVJA 3MWKA 4PZZA 3U7FB 2GVZC 4M9SA 5FPYA 1P62B 4HDQB 1SM4A 2OM2A 3KUCA 3QQ5A 3I56B 4LUCA 3D31A 2YINC 4JKYA 4Y7CA 4OQFA 3I5XA 1GJRA 1JB1A 1R5BA 1Z0IA 2FZLA 2ZRAA 1U8YA 1MOZA 4TTQA 5KSPA 1Z8FA 3ZD7A 1HEIA 2V6JA 5K8LA 1HURA 1RJ9B 2ZSFA 2L0XA 1WQ1R 3PJRA 3KB1A 4Q03A 1VCIA 4NBSA 1VPLA 2JJ2D 1VQ9B 3U3OA 4JT4A 1VQ8B 2B7BA 1BYUA 1LV7A 3RHFA 4LYJA 4GP7A 5KYKA 1GVHA 1XE1A 3QOFA 5AR1A 3FOZA 1A8PA 1KO5A 3B6EA 3CCLB 1TPZA 2JLWA 2N42A 4DDWA 2ZJOA 1Z6XA 3CCQB 2IF0A 3SE0A 3O8CA 4E22A 4RD2A 5BN5A 2BMJA 1MRSA 4ILEA 3E5HA 1KD1D 2HF8A 2PT7A 5FL7D 3K09C 2GHIA 3W34A 1KC8D 721PA 3GEHA 4YQFA 4DZZA 2ZXUA 3AVYA 3BC1A 4TLDA 1H85A 1E1QA 2WWGA 2JJ2A 3KL4A 4Z54A 5KO2A 4X8LA 2F3TA 5JS8A 3OEHD 4DT1A 2XNDD 2HYIC 3NDBB 1W87A 3EG5A 1LVGA 3PVSA 2KJQA 3PG5A 4B2LA 2BPOA 3TJZA 5DH9A 2JLZA 5JRZA 1XMIA 5HE8A 3LO8A 2GJKA 4DQLA 2BOVA 2PX3A 2VF8A 1N6LA 3PUVA 3QKSA 5FL7A 1NN0A 4A9AA 1BMFA 1LF0A 3QG1A 3GFPA 2XEXA 3LBIA 5J4HA 3UIEA 2EFEB 3ND8A 5FPSA 1JJ2B 3FTQA 1XBTA 4CIDA 3BJIC 2IW3A 3OEHA 2XNDA 3OIYA 1GDDA 3QPVA 1KAGA 1E2IA 2IYZA 2ZSDA 4Q1AA 4PC2A 4GBMA 4MGZR 4KJZA 2RC6A 3WP0A 4IEEA 1AKYA 1G6HA 1NBME 3IQXA 5TVKA 4BLSA 4JLBA 3QEOA 3PITA 2GNOA 4JL8A 3UANA 2OLKA 1JR3D 1X8JA 1G4AE 2H7VA 4G5OA 5J4LA 2P6NA 1J70A 4AURA 4EPYA 4DCTA 2JAQA 1YJNB 1DBSA 2GBLA 5TMPA 4HB3A 2F7SA 2IT1A 2ZANA 2OAP1 3U3JA 4F4JA 1W1WA 3QI2A 3EIQA 4V0OA 1T4GA 2JLXA 1VQ7B 1K5GA 4R2IA 3REGA 1CLUA 3U3KA 5B2ZA 4N3GA 3LVRE 3R7WA 1G16A 4Q7MB 2WKPA 1D2NA 3QPUA 4URWR 5EE0A 4DXAA 4ZIRA 3KQLA 3P27A 2VIIA 3VR2A 1NG9A 4IDQA 3GJ0A 3LBHA 3THXA 2G1JA 1TEXA 2GEUA 1BKDR 4EUNA 1I4DD 1OSNA 4AY2A 4QM6A 3OHMA 3FHOA 2QAGA 4GT1A 5AJVB 1RE0A 3BXZA 2H17A 5EXXA 1T6NA 1OGJA 1GVNB 1YZTA 3M4YA 3R9IA 4Q1EA 5D3QA 5IDVA 3TIFA 4XWOA 2MMGA 5EP1A 1O87A 5JJKA 4TQ9A 1ZAKA 5H68A 5JFGA 1QGZA 3EPHA 1I4TD 2VO1A 3OE7D 5UKDA 1VMAA 2BJWA 1JPJA 4XIGS 2ZSBA 5KOYA 2Q21A 2CHVA 4B2PA 4FMBB 2F1HA 4OL0A 4PQRA 3CUEF 1M74A 2X8AA 4YAOA 1W4CA 2FZ4A 3AEZA 4RFSB 1YRAA 5CLLA 4EFMA 2OFXA 3H84A 4GDFA 1RC8A 3RAPR 4JBYA 1SZPA 1QFYA 1MT0A 3KQNA 3CPEA 3GPLA 3CPWB 3AVOA 4D80A 2BBWA 2GBLC 1VCMA 2DCUA 3IIKA 1DAFA 2AHOA 1P2TA 4QNRA 2ECKA 3VKGA 1FX0B 2EFHB 1VQOB 3AUYA 4JKIA 3LX5A 1NKTA 2ZRIA 4JJKA 1P6XA 2R65A 2FFAA 1NSTA 4MYHA 4QGHA 5CM9C 2JLQA 4NTZA 1GL7A 3U4QA 2WWWA 2ZPTX 3A37A 4Q9JA 5KPJA 3EX7C 1OXXK 2FN4A 3BH7A 4L16A 4PC7A 5LB2A 1SKYE 2Z83A 3QF4B 4P0TA 1LF5A 4Q18A 2QRZA 5DSZA 2BCJQ 3NWJA 4L15A 4F38A 2B8TA 4D2IA 5L3QB 3AVXA 1GWNA 2A9KA 1NDHA 1S72B 1VYVA 1XJCA 1KZ7B 2QAGC 5SZJA 1XXHE 1SVOA 1ZM9A 5EE5B 5IT5A 4JSTA 3ZDQA 1IJFA 1RRGA 4B76A 3JVUA 1KJWA 2QP9X 2IYLD 3LVQE 4IOMA 2ONJA 4Q9HA 2FEMA 4HEJA 4K46A 3T5DA 5AUOB 5C4MA 1T5LA 2AFIE 3UXMA 1TTTA 2OCYC 1QHHA 1H8ED 3FYHA 4FMCB 2WJHA 1X1RA 1E4YA 1LNZA 1TQ4A 2CMKA 3TUJC 2ZM5A 2BJVA 2JGNA 1BQEA 5J4KA 2GA8A 4ARZA 1CR4A 2WWFA 3ICEA 3THYB 2QBYB 2QA4B 3MD0A 3B60A 2CCJA 2Q3HA 2ORWA 4S35A 3SFVA 3AUXA 1QFJA 3UWKA 1V43A 1CR1A 3S1AB 2BBOA 5L3SA 1Z06A 2WOOA 3B78A 3TK1A 4C0AC 3EPLA 3T61A 1KSJA 4HDCA 3E2IA 2R6GA 1QVFB 4C2TA 1UBFA 1RVDA 4ZGNB 3EWAA 4XTCS 4BEJA 1YRBA 2ZROA 3UK6A 4NCNA 3B1VA 4JYCA 4L9WA 4UNQA 4MDEA 1VIYA 4E5UA 2GEVA 1BOFA 3B85A 3JQQA 1HE8B 2O8BA 2V6IA 3W3AA 4DLTA 1WDTA 3E1YE 1G8GA 1F60A 3FE2A 2QPTA 4KVAA 3LLMA 2D7CA 4ZKEA 1KKMA 1ZNYA 4LBVA 3UKDA 1VDZA 3AF1A 4EQ6A 4OBEA 4U7DA 1ZCAA 4CT5A 5DN6A 1DPFA 1CNEA 2AWNA 1TQ2A 2PZFA 4H1UA 2Z4SA 3BB3A 1EWYA 3GJ7A 4MKIA 2OTJB 1XEXB 2ORIA 3QXXA 3TQCA 1SXJA 3V4FA 3PQCA 3BFKA 1UBEA 3IEVA 2PEYA 3RRMA 4ZDKA 1G64A 5A0FA 4DLYA 1MH1A 2R6HA 1XEWX 4AYXA 5KNCA 2IX3A 3LA6A 3W8RA 1Z6YA 2XXAA 4ACBA 1Q1BA 1TU3A 4PPGA 4LDJA 1LFDB 4MRVA 4PQFA 4AYWA 2IEYA 4L5BA 4XSGA 4RD6A 3I55B 4UJ5A 4P4TA 2CL0X 2REOA 4Q02A 1KI1A 2OE2A 1KRHA 2VNKA 4YLGA 4D6PA 4W7SA 2VP5A 4LC1A 3LY5A 2QSYA 1T3HA 2HT6A 3PV0A 1XJ0A 1YZKA 4GOXA 1IB0A 2PZEA 3KFXA 4KV9A 2I1VB 2ODWA 1EX7A 521PA 5GVSA 3V00A 5JHGB 2CE7A 3ZVNA 3NG1A 2UVQA 4Q9LA 4PGOA 3NEJA 1A7JA 5BW8A 2BGIA 2QN6A 5LDDC 5F9HA 1GRQA 1J7KA 3HYTA 1DAGA 3IKJA 3WYFA 4DLVA 1X8KA 4DSOA 2JLVA 4D0LB 4ZCMA 3HU1A 2AXNA 3QKRA 2FSIA 2ZQ5A 4PAQA 3TSZA 2FNAA 3ZS9A 2G1KA 1W35A 1II0A 2R6CA 1NKSA 2QGZA 2EFCB 1VQPB 3WP1B 3PUXA 1OYYA 1II8A 4Q4AB 1W44A 2IC5A 4RCYA 2W58A 2YZ2A 2Z5FA 1Q20A 1H8HA 4NPHA 1W2HA 2UZIR 2O8FA 3CX7A 4LJ6A 3O8DA 1L2TA 4PC3A 1S96A 2P0EA 4Q7KA 5AUPB 5BWMA 5EQTA 3K0CA 2NZJA 1Q21A 3QKUA 4XWKA 4MKGA 1SXJC 3FHCB 3K0AA 4IHQA 5F98A 2OZEA 2MSDB 1MR3F 3N2IA 4HUQA 2WSSA 1JALA 3TRFA 4MUAA 1E9BA 1G21E 2W0MA 5JJLA 4C2UA 2XZLA 4RSGA 3KZ1E 5SZIA 5TV2A 2A5GA 3QEJA 4ITRC 5HE9A 4A2QA 1OPXA 1XD2A 4LV6A 1QVAA 8OHMA 1FMJA 2QM8A 2RHMA 2GWHA 3BGWA 4LJ7A 2C04A 4ZDJA 5C46F 2J59A 2ORVA 4OHZA 3NVAA 4PZYA 5EXTA 3KB2A 4OYHA 5G3YA 3MWJA 1CJUC 1G5PA 3MSXA 4MKFA 3ZIAD 4DHEA 1GL9B 1KMHA 2RMKA 3MUFA 4C30A 1OXUA 2V1XA 3A1WA 3D3QA 5CM8B 5JI2E 5CK5A 1E2EA 2YC4C 3SYNA 3K70B 3NHBA 1ZCBA 2ZI3A 1YE8A 1Q44A 1Z6AA 1MABB 3THOA 1LTQA 3H0KA 4QBGB 1E0AA 4YAUA 2JA1A 4IOJA 3LBNA 4ZCLA 5DISB 5DO9A 1R6BX 3HPQA 4BFUA 3ZIAA 3R9XA 1KMQA 3SJBA 3MLEA 2MSCB 3EZ2A 4KI0A 4IVRA 3IDQA 2FJUA 2J0UB 4PSVA 2VSOA 2FWRA 3K0CC 2GK7A 1GITA 1R5OA 3QFTA 3OJWA 1ZIOA 2ZE5A 4HSEA 2WKQA 2ZU0C 1E98A 3N2EA 3SHWA 3M6AA 4DIDA 4OHYA 4KCGA 5E7MA 4Z51A 2XITA 1KIMA 1DDGA 4D4LA 4AC9A 5JHHB 1CIPA 4ZV4A 5E7JA 2ZE7A 5ANRB 3B7GA 3TR0A 3QVVA 3ASZA 1W0JD 4KFSA 5EMNA 1G18A 1M6NA 1LW7A 1E79D 4YMWA 1GKUB 1X3SA 1P75A 4EIWA 2IWHA 1YZNA 1W4BA 4QRHA 4Z1MA 5JI3E 2WJGA 3FKQA 3NH6A 3M0EA 1IN4A 2V7QD 4OHXA 3VHXA 1KI2A 4LV8B 4B6EA 1NL3A 4CEIB 4DSTA 1YHQB 1FDRA 2WTUA 5DYGA 2ZEJA 1Z0DA 2YJTD 2G3YA 2NO6A 1HQYE 2QP3A 2QE7D 1P2VA 2AKAB 4I1UA 4OJKA 4F92B 1OLOA 1RRCA 3ADCA 4ON9A 5KUTA 3H4MA 1I7PA 3VO2A 5TXGA 3F5FA 4OI0A 2DFTA 2A2ZA 1M7GA 3T5GA 3CW2A 2W6JA 1OF1A 3VX3A 2OLJA 5GV7A 2IUTA 5IK2D 2CLSA 1GKIA 4G1UC 5JECA 1F6BA 4KBFA 3CZQA 3GJ8A 2V7QA 1XJQA 3AF3A 4RD1A 3KJHA 4OQLA 4D25A 2HCJB 4E03A 5JEDA 4HAYA 1YVDA 2FMXA 5FOSA 2ZITA 621PA 3I8XA 5HTKA 4G0NA 4M1YA 4DQKA 3CCMB 4G1BA 1ETUA 3PIRA 2QT0A 1A5TA 1G5TA 4DDVA 1GILA 2IYVA 4QHTA 2J46A 5K8TA 3GLGA 4DB4A 2ZRCA 1SKYB 3QXSA 1PZNA 3AGPA 3AQ4A 1XPRA 3F3YA 1VQ5B 1JR3E 3DM9B 3I3SR 3RSLA 2I1QA 4JYBA 2WV9A 1HA3A 3CRZA 4BPRA 4BLQA 2WMNB 3BOSA 4C0JA 4QHSA 1KJZA 3LH5A 3CB4A 4RFVA 4MRSA 1XXHB 3GJ6A 1XDBA 3EA5A 3GLHE 3WRYC 1E9AA 1VTKA 2NZ8A 2C96A 2DR3A 3BWDD 4DLRA 2QL6A 2VHUA 4UNRA 1NJGA 4UJ3A 5FI0B 2IHYA 2ZRNA 4BLTA 2DB3A 5E3HA 4V0ME 3P1JA 1NF3A 1XPUA 1JBKA 1XEWY 2DY1A 3BB4A 1CJVC 1EFHA 4WXPA 1WBBA 2VP9A 4ZDWA 3FKSD 3PEUA 3CM0A 2J7PD 3AP1A 5GV8A 2VNHA 4C0LA 1FRNA 1ZBDA 2ZVPX 3DOFA 4A0FA 4C7OB 4C0SA 1FPMA 4P4UA 1Q12A 4Q1FA 3C41J 3ZD6A 2ZJYA 1CJMA 1J8YF 1P9NA 3I62A 1ZU4A 2HJGA 4KLNA 2XB4A 4JLVA 2W2VA 2ZS7A 1K73D 4YDHB 4IEIA 4PPFA 2Q3FA 2JJ1D 3MAAC 4NCHA 2QMOA 4MKHA 4II7A 2ZRJA 2ZJZA 4A8JB 3KQUA 3FFAA 2F1JA 2XJ9A 1UEJA 2OK7A 1GAJA 4M21A 3VU9B 4UAJA 4PO8A 4PSAA 3FKSA 4ABYA 4CEJA 5CYOA 5EP3A 4HZIA 2J7PA 5C18A 5CB8A 1EFCA 4IXMA 1Q3TA 1OXVA 4NCIA 4Q7JB 4A0HA 4KU4A 1K5DA 2QU8A 3KX2A 4P4SA 3I4LA 4DSNA 2RGBA 1VQ6B 3EWSA 4WXRA 3IIMA 2F1IA 4I81A 2GCOA 2O0JA 1GRNA 2JIZD 2VA8A 2PCJA 5KNBA 1CR0A 3RABA 1N6KA 4WZBE 3B13B 1BX1A 3W3ZB 2KSQA 4B33A 5KHOC 3K0FB 1US8B 1FP6A 2AWOA 1QX4A 2FEOA 2XNSA 1Q81D 3IGFA 3ND9A 4HB4A 1G3IA 5FR1A 1QHXA 1GL6A 5FUWA 4Z8XA 2F43A 1E1RD 3QIAA 1QRAA 2WHXA 1W36C 1E69A 3KTAB 2ZE6A 4IJMA 5CJPA 2LCFA 4MH0R 4RZXA 2GETA 3DVLA 1Z63A 3CCRB 3KXIA 4A1FA 2X1VA 4L9SA 2RC5A 4OK3A 1EGAA 5B58C 2IHBA 3GLIA 2ZRMA 1KDPA 4GFDA 3ZZTA 3AGQA 4GL2A 3EW9A 2FFQA 1FQKA 2NG1A 3K8YA 3NBYC 4JLNA 1S9DA 1BIFA 3ZBUA 3WNDA 3LLUA 5KSYA 1J90A 3U2QA 4P3YA 4KITB 1EFUA 4U5XA 1ZP6A 1QHYA 2ANCA 4BZXA 1C9KA 1RJ9A 4DEXA 4Z8YA 1AK2A 4E09A 1QHGA 3L0SA 3CNOA 4HLUA 4JBXA 1HQCA 3AVWA 2WWYA 1KGDA 1YR9A 2YC2C 4RCZA 1Z29A 2IYRA 4TMTA 1NJFA 3QVUA 4D4KA 3PEYA 1I4LD 3WYGA 5JEEA 2YOHA 2JLRA 1N3BA 2GF9A 3SI7A 1KI6B 2NTYC 5CDFA 1BS1A 4NCJA 4O25A 4B48A 1JQLB 5AUQA 1DOAA 1COWD 4TYNA 2Z6VA 1DO2A 3BORA 3LQQA 1JECA 1SVIA 5DI9A 3CRW1 2VBCA 1K9MD 3BB1A 1ZNXA 2DFKB 1ZW6A 3GJ5A 2OO7A 4X8MA 3ZS8A 821PA 3EPKA 1ANKA 1GG2A 1E1QD 3CRMA 2ZI5A 3VKWA 2IS1A 1DADA 1D2MA 2QROA 4TTPA 5AJWA 5EP4A 3AP3A 2BKEA 1DARA 3QXHA 3OESA 3LQRA 5J4YA 1IY2A 3L0OA 4JLOA 1P4SA 5TARA 5FOTA 2BKUA 2GQFA 1KK3A 3W5UA 1XNJA 4M1MA 3FMIA 2OCPA 4Q00A 1ZUIA 3B8HA 1COWA 1XCGB 2MSEB 4G01B 5E95A 4HB2A 2O8EB 2VL7A 5JJIA 4Q1DA 4CGZA 1CF4A 3CRQA 5CK4A 5TR9A 1DS6A 4LSGA 4G1VA 3ZZ0A 1BMFD 1IXZA 1F2TB 4LJAA 4X8OA 3GCGA 5C2JB 4DLSA 1XFAA 2YKGA 3B82A 3BERA 3TAUA 2DFLA 1OKKA 5D3MA 1YKSA 4D81A 4RKEA 1Q22A 3CKLA 3Q85A 4QC2A 2XOKA 3IQWA 1TQDA 3MWLA 2IWRA 3CZPA 1E2PA 3THWB 2G0TA 4HLUC 4M4SA 2O5VA 3ZC3A 1U9IA 1ZRHA 1KK2A 3C7KA 4OK5A 3EAQA 3ZVMA 5C4GB 3NDPA 3OJXA 1W7AA 3L82B 3QG5A 1RYFA 1AKEA 2OK8A 2WWXA 3DKVA 3CH4B 2Q3MA 4EPVA 2IBMA 4NP6A 3NEYA 2DBYA 2IA5A 4JT2A 1OFUX 3RDPA 2HCBA 1IY0A 4LOAA 2J3EA 5KNDA 1P2SA 3M1IA 2CHGA 3CNNA 1KI8A 2W2XA 4PXAA 4P31A 1KDRA 2YVUA 4M2LA 1YITB 1TU4A 1R0YA 3LVBA 4LI0A 3GLFA 3WMFA 1G291 2CJWB 3VAAA 1Z2CA 3SS8A 3EPJA 4RD3A 2GJSA 3BH6A 4P32A 2ZYTX 3RS7A 3UMRA 2D06A 5HZHA 1E9SA 1VYUA 1FNCA 2F9LA 3PR1A 1GTVA 2KBEA 1D5CA 2KWIA 2ZS9A 4Q4JB 1ZUHA 2IUUA 3AVPA 1CNFA 3B1XA 4JBWA 4KYUA 2OILA 3B9QA 1QGYA 3IIJA 4MRRA 2CCGA 5B30A 3C14C 4DT1B 1AJEA 2CLDX 1EK0A 4WIAA 1WCV1 1OFIA 2VHTA 1HT1E 4ZKDA 3KXLA 1RIFA 2ERYA 2OBLA 1NN1A 2C99A 1JPNA 1WA5A 3PXGA 4TL9A 1P60A 3KUDA 4UXHA 3QFRA 4P33A 1ZC4A 3TVDA 3BBPA 1G8YA 4MA4A 3HU2A 4D0GA 1U0JA 2E87A 1Z83A 1DEKA 3BD9A 4RD4A 2C9YA 4FCVA 2Z43A 3TKLA 3ZLJA 1M1KD 1YR7A 3AKDA 4ZGQB 121PA 1JXMA 1XD8A 5B64A 3C15C 1U9IC 2W6IA 4B3CA 3K9GA 4M1SA 4AKHA 2FFBA 3L8ZA 5KU1A 1F3OA 4FCTA 3CH5A 1KTVA 4IOLA 1JAHA 4YHBA 2CBZA 1S4QA 1GSIA 1FX0A 3DKPA 2VH5R 3KJIA 4Y9RA 2P67A 3PEVA 2Q6TA 1RRPA 1W2BB 5BN4A 4TMXA 1G8PA 5E4FA 1NMXA 2IYWA 4G5QA 4RY2A 3U44A 4TL7A 1N0VC 1XX6A 1E2JA 3NBXX 4JLKA 4Q48A 2W0SA 4JLPA 4NYJQ 3B5JA 3SN6A 1F20A 3W5HA 2CDNA 4BFSA 5L8VA 1GM5A 4B3FX 3GMTA 1U99A 2GXSA 3KKNA 1NN5A 4KVGA 2EYQA 2FDCA 4OQXA 4C0BA 1VHTA 3AKCA 2ONKA 1TAGA 3JQRA 4RD0A 1OE0A 3ZQJA 2Z0MA 4LJ5A 2GAOA 4GNKA 5FBQB 4A82A 2ZAMA 3LD9A 4JLAA 1HT2E 4PHHA 3VR4A 2A78A 1J8MF 5FBLB 3HYRA 1JNYA 5B57C 4QXAA 3PENA 2J5XA 4RZ3A 2IS6A 4B3GA 4IVPA 2VP0A 1VYTA 3GLHB 1E2HA 2ATVA 1NP6A 3BRWD 4OK6A 4H9GA 4XSHA 4EPXA 3KKQA 3SQWA 3MMPA 1IONA 2IK8A 4BFZA 2N46A 1OHHA 5H70A 4QOSA 1HE1C 1P7CA 4EAQA 2EQBA 3THYA 5JCZA 1JAIA 4BZPA 2GK6A 3AF4A 1KK1A 5AN9A 1DE0A 1G4UR 2B21A 2OTLB 1G3MA 1KI4A 1S9HA 4UQOA 3C8UA 3Q7PA 2ZSEA 1OYWA 1AGPA 2ZREA 1U2RA 5DYIA 1RKBA 1TUEA 3CWQA 4AWXA 1K8RA 4Q7LA 3R8FA 1PLLA 2OBMA 3X1ZA 3EIEA 3RRNA 3ADBA 1OFTA 3G5UA 1JJVA 1ZC3A 3L8YA 4WW0A 4KFRA 4Y0VA 4Q1BA 1ZINA 4V0LA 5FPHA 4Q9KA 1NVXQ 1NVVQ 1Z0KA 1CRQA 3CO5A 4TL8A 4B43A 1YZGA 2BBSA 1D2EA 1E9RA 1MO3A 3NHAA 3CIOA 4N1AA 4HUTA 3TMKA 5E7IA 4B4DA 5TB5A 3TSOA 3FB4A 1G7TA 1OIXA 3CRVA 4R9UC 5HCIA
chains in the Genus database with same CATH superfamily
2C97A 2I8LA 1KOGA 3ASUA 5HGXA 1QH9A 1FVOA 4O6VA 1WD5A 2E1BA 3K6JA 3OMWA 4M1WA 5LBUA 1NY6A 4Z4UA 3AXTA 4CMIB 4Q1CA 2ZZEA 1S1CA 1SGWA 5HCNA 1C3OB 3DMTC 5KVQA 4E1AA 3N0TA 4S1WA 2PUBA 3CVUA 5I4CA 1J21A 5BN4A 3RUDA 3AILA 2YRWA 4BFTA 2FRXA 4EA8A 1RMYA 2EZ4A 4KODA 3HA7A 4OUDA 4Q3AA 5K2OA 2VJYA 4V24A 2F59A 4QQNA 4YRMA 3GFOA 1ODIA 5JSZA 5HQTA 4RHCA 4O29A 2X19A 5F9FA 2LUOA 4XIIA 4UOEA 2QENA 4GAEA 1YR1A 1YACA 2OPBA 2XB9A 4CL8A 5JWOA 3ICCA 2GNAA 1XTKA 1CV2A 2HQBA 1WXIA 2O7RA 1P2UA 3H1FA 1ZGHA 3B6KA 3GAAA 3I0ZA 3JX9A 4OKSA 5J5AA 4AUNA 4KO2S 5HUJA 2WSBA 4B1FA 4G0UA 4DIKA 1XCPA 5ICMA 4OTZA 1QNLA 1YQGA 3JQPA 1BHO1 2ZQYA 3HKCA 5HQJA 5SZHB 4DJFC 1EM6A 1O1YA 3PGMA 5L3ZA 1NX9A 1NY5A 1PV2A 5C7YA 1M5RA 1BE6A 4YI3A 4BQRA 2HTEA 1U8CB 3KJXA 3FG9A 4WLFA 3ILYA 4JROA 3USES 4H6VA 5AJYA 2NSHA 3EZ7A 5LLDA 1BH6A 3KTOA 5LYJB 4OCZA 4URVR 3D6MA 5BY2A 1E7MA 1F0YA 2HA5A 2J5KA 4HXFB 3P94A 4QOEA 4BVEA 1MORA 5KQGA 3U6KA 1VIMA 1KVSA 1ZGZA 1V16A 1V1RA 1PGNA 3WGHA 5JRJA 4LYYA 3KJFA 4FILA 3ITNA 3G3EA 4L8LA 2XLCA 4A15A 1YTUA 2XGOA 1Z5NA 3D8UA 3FWYA 5CLGA 2SKEA 5TGTA 2OFOA 5JNWA 3OQIB 2XUPA 1H8HD 4MUYA 3A1VA 1QF7A 2C3MA 3U56A 3BL6A 1XP8A 3PUJA 4BO6A 2ONZA 1RJFA 1F6DA 1VMIA 4Z53A 4E2YA 1E4OA 3K9FC 3L77A 3FCAA 1B41A 5FH9A 2EW2A 4YYEA 2AXPA 2BIFA 3D6TB 2GXAA 3M5WA 3RQSA 2G28A 2PLFA 1OIVA 2JBAA 2IS6A 1T8RA 3FJOA 3W9YA 1O8BA 3RYTC 1FY2A 1W0KD 2GD2A 1ZGBA 4MI3A 5BQOA 1VL6A 4ALNA 4B44A 2FP4A 3BMQA 2IYPA 4CV1A 4YCAA 2ZTNA 1R88A 2ZXEA 1JPUA 1EFTA 5AW5A 2CXSA 4UBJA 3SJAA 1FLNA 1H4SA 3IMKA 3DFFA 3TI9A 2OXFA 1NBMD 2A7QA 2KB0A 2WTXA 4W6QA 3IE2A 4BLOA 1DL5A 2O52A 3I01A 3CE9A 2ZIXA 3RV3A 4QREA 1VSBA 2POCA 3T9CA 1HBJA 1PR0A 1KZYC 4BC0A 3R3WA 2PV7A 1G8KA 4W8OA 2DETA 4WY2A 4BO8A 4H1VA 4IIJF 2X76A 2C2BA 1JWAB 5KTPA 1KAMA 2AOXA 2FOLA 4G5GA 2GRJA 2I9PA 2OEPA 1H9BA 3F4KA 4TTSA 3LG2A 1D0SA 3Q3CA 3AUAA 4ZI3A 3CW8X 1T8UA 1O54A 2GQ0A 2WICA 5B4VA 1TAHA 3T34A 4IHJA 1W0KA 2YN4A 2GILA 2Y3IA 5LQSA 1V2HE 3QHAA 1PR2A 3K72B 2BHLA 3UAVA 3ORHA 4DLKA 2XNJA 3RC3A 4QECA 3E15A 1CHNA 1RM5A 4FOSA 3W9SA 1NBMA 1ATIA 3I58A 2C57A 2C7GA 1S8NA 2O7QA 5H1YA 3KRTA 4Z7NB 1ZOOA 3ROQA 3GG9A 4QFBA 5HBGA 2F8MA 3LQYA 4LYDA 4B6PA 1YJ9B 1OOEA 2J9YB 3T3OA 3T5TA 5DCLA 1RAEA 3QTLA 3VVBA 2CB9A 2D7JA 3JQ7B 5AI0A 4BVJA 5CCEA 3HI6A 1ID1A 4NE2A 4BQIA 1MDBA 3CPXA 1C8VB 2CXPA 3E35A 4GM0A 3OQMA 3ZN2A 4IVQA 4RPHA 5FBRB 1E2NA 3V80A 4R1MA 2L17A 5LD2B 1WCYA 4I55F 3AJDA 1RBQA 3H42B 3GRPA 4S05A 1E9DA 1L4YA 3TD2A 1UBGA 1GQ2A 3A1UA 2QF7A 3C6KA 3GDHA 1PTJC 2AXQA 2PAFA 3GNSA 1MN6A 4R2HA 4YPVA 3IDOA 1VSVA 2OHHA 1K9VF 1MO4A 3DYVA 4J90A 3Q2OA 1VI5A 4DUZB 2XYGA 3HBNA 1CUGA 3BL5A 1EBUA 2CD9A 3O8RA 5M04A 4GWLA 2V1UA 1NR5A 3NJ4A 3LP8A 1GGEA 1UZLA 2DT8A 1IM8A 3NDRA 3I76A 1FZTA 5KSOA 1O77A 3ZE2B 4FI3F 2V4ZA 4NYMQ 4C4PA 1YJWB 1TZJA 2QMHA 3KJZA 4FW8A 5IXYA 1MXHA 2OO5C 3N2KB 4ND1A 5CNMA 4YMVA 3FUUA 4WD3A 4CG3A 1SU4A 4F91B 4W9MC 4U02A 2A0FA 2DH6A 4UU1A 5TY0A 2QTLA 1MVLA 3DMGA 2NO5A 3USZA 2H1RA 3IDFA 3CR3C 1IOWA 2ZJ8A 2AC2A 3GJ4A 4HGPA 5BUQA 2PMDA 1V96A 4FX5A 4M60A 5JSHA 2EWWA 1DVRA 4WBSA 2B1QA 3GZNA 3FPBA 2NPFA 2A1UB 2OHFA 1A4IA 1ZS9A 2PXHA 2XQVA 1UBNA 3VU3A 1DIGA 3RIHA 3U62A 2X86A 2O14A 5HZMA 3IXLA 3ZLUA 1TOAA 4M9RA 4G4IA 3S2GA 1NHGA 4BNNA 4L5JA 2NSYA 1XTUA 4JLDA 1RWXA 1E2MA 1FXUA 3TH5A 5LZ7A 2B9EA 2W2LD 3OCUA 5KX5F 2UVPA 2AFRA 2IOHA 2W4QA 3OTOB 1XTTA 1KPHA 3OD1A 4EBBA 1VE5A 2WK1A 1W49A 1BA2A 1SBHA 3HL0A 2F3RA 3BXGA 3L49A 3NU1A 4MA5A 1F51E 1XCBA 1A9PA 3H8SA 3RIXA 5CAEB 3VVCA 5TLSA 1E8NA 1NXXA 2J9RA 3F8TA 3OU2A 2CVQA 4ARIA 1G7RA 3GLFE 2BM1A 2H63A 2FR0A 1ILEA 1PKVA 3DAPA 3HFSA 3K1TA 4B3BA 1JMVA 1ZVKA 1T0BA 4KK4A 4PPQA 4UKDA 2HMUA 5JDIC 2YV2A 1DAIA 4UATA 5AKZA 5FORA 4G0YA 4GM4A 4JD5A 1J1IA 1P5ZB 1XXHA 1T1IA 5IP5A 1CKEA 2Z2XA 5AD1A 3K7EA 2YY5A 3MJHA 4I9UA 3JCZA 1X7XA 2FW7A 2FPLA 2ILTA 4M0PA 3UB4A 1VQLB 4C06A 5G0TA 3QY9A 2AMFA 1D7OA 3F6YA 4TMWA 3RV4A 5AW6A 3BILA 2BHNA 4NL4H 4X94A 1HOTA 3NDIA 2WD8A 1S3SA 2Y9MB 3R6DA 4C6HA 1EGQA 5CA0B 4E07A 1V3QE 2WI8A 4KN9S 2PCLA 3Q1LA 1C5KA 1YZLA 2HBQA 1QIGA 3M6WA 4I9GA 4ZEVA 1T9KA 2GWRA 4D8WA 1JQ5A 2LZJA 1P0CA 1AGXA 3ID6C 4IDPA 2C31A 4ZOBA 3Q7TA 1XI2A 3FVRA 3BE8A 3CRNA 3KZNA 4UUNA 2F8TA 3ASRA 3CEHA 2HLPA 4Y0AA 1XQVA 2R6FA 4JUFA 1RZRA 3PNQA 4B75A 2ZXIA 2PPVA 3D64A 5KQSA 3TFOA 4F1KA 2C61A 2GZ2A 3VDXA 1RPZA 3O2SB 3V3KA 3EXFA 2FU5C 4PZCA 5K4AA 4KDRA 2RGWA 1U81A 5AHRA 2QGFA 2W48A 1CRLA 1MZPA 4N54A 1N6OA 3LUBA 5DS0A 3DE2X 3FBGA 4MVWA 3U39A 1OFUA 3A36A 3IMFA 4HN9A 2H1IA 3AESB 3TR6A 5LR6A 3DV0A 5THQA 4F0JA 4X6YA 3CZ9A 3H9EO 5FFMA 4REQA 4B40A 2DWPA 2NXEA 3LUKA 3TTYA 4AP6A 1F5SA 1G60A 4BVHA 1XZHA 3SK0A 1UXOA 2G5PA 3R5FA 4QGGA 3KV1A 4IIBA 2D7DA 1RQNA 1N2HA 5GQSA 1DRWA 1DB3A 2OQ2A 4O3MA 4OVKA 1G0NA 2I3BA 3WGJA 3IEUA 4BQEA 5JVDF 3PRYA 5JD4A 3L7LA 3S5UA 2FGJA 1L4UA 1V5WA 1ZD8A 3C3DA 3C5VA 3HUTA 3O92A 5DNDA 3D1LA 3U49A 1R0CA 2HPHA 3JZAA 2FX3A 5J3OA 4ZZIA 1M2OB 2H2DA 4O4IA 4A6PA 3BPSA 4PABA 1ZJ6A 1G9TA 2B6HA 2GLUA 3H5WA 4DIBA 1VI2A 2F9MA 3L1VA 3NIDB 4F4UA 4KQ1A 2EX1A 4L74A 2VDRB 3HVUA 5DNYB 1HK7A 1UKYA 1Y5IA 1QOPB 2HPZA 3DUFA 3UMBA 1BVUA 2R5FA 4BNDB 1PFYA 3N0RA 4EF4A 3C3WA 3CEPB 1Z0AA 2X6TA 4S1NA 1AHIA 3LCUA 4JX9A 1PV4A 4BRUA 1Y5LA 4UASA 3DDNA 2IHJA 4CQLB 4TVSA 5AUNB 1XLTA 3U37A 2K7FA 4TMZA 1MIOA 4JR0A 2CVPA 4CFZA 5KYXB 1YIAA 3IJPA 4BFCA 2LIPA 5KYYA 1RP7A 3DFKA 4PHGA 3CLUD 2QQEA 2VYCA 2XZOA 1Z0FA 3J80A 2X4IA 3V9PA 4CLRB 2F4VB 3W77A 4K9DA 1NI5A 1QH0A 4MJ7A 1VJRA 3E9NA 4ZGBA 5JZVA 3IFSA 1P3Y1 3HVKA 3LPMA 4ODIA 3RASA 3T1QA 2HHAA 4B87A 4BRZA 4N7MA 1GPJA 3BWEA 4DQUA 4ZHQA 1V5VA 3VOBA 3PC3A 1ZRMA 2Q5QA 4IOKA 4M7WA 3RU3A 3W1EA 2NSLA 3D4BA 4KQ6A 3SOPA 4DJ5X 1J9GA 2OFPA 2DQYA 2HKIA 1KI6A 2GPWA 1XRLA 4XM2A 3W06A 1P3JA 1MMFB 1SB8A 1Y63A 1YC5A 2EGHA 2XXBA 3IVXA 1DQZA 1S7GA 1IUKA 1UFOA 4LZZA 4OGWA 4FB5A 4RXMA 1PLJA 2WJ4A 1L5SA 3FUWA 1KBZA 4PIPA 2VJPA 5JNVA 4ALMA 3LWBA 3KQHA 1VQMB 2JCVA 2Q9BA 3NTQA 4FGJA 1NVFA 1R0WA 3DOUA 4Q4DA 1M67A 1TDJA 2D2IA 3DTVA 1NVWQ 2H1HA 4OEHA 2XDAA 3KU4A 1W4ZA 3JQEA 1QG4A 3WMEA 3G1TA 2ZTMA 4QL3A 4IW3B 4L28A 4CM5A 1YGPA 1TU0A 4B34A 5FWXA 5ALIA 1DJOA 2FYTA 2GCOB 2VJMB 2XEDA 2YW9A 4HS9A 1K7EB 3SNHA 5KQLA 3Q87B 4L3VA 4NBWA 2EFGA 4LXUA 5ALYA 3IBFA 3PGVA 5KIAA 2J3HA 4EY7A 4IR7A 1CEYA 2D4HA 3IB3A 4NENA 1NB9A 4LOJA 5GJBA 4L57A 1SULA 2YXEA 2ZUSA 4L50A 1C1DB 4DNXA 1EIWA 5C8VA 1NQUA 1Z16A 3NC4A 2NO9A 1XDDA 2DUUA 2XE7A 4X1YB 1JFFA 1GKLA 2VAVA 3G2MA 1M2FA 3N5CA 4I3FA 3LYHA 4X8HA 4XLTA 5HDBB 1M7BA 1SUIA 1ADJA 3ILXA 5EXSA 1JN0A 3WNZA 4Y9UA 1F4LA 3EG9A 2I55A 4A1OA 1I33A 1H3FA 4ENVA 2CFCA 1Y0RA 4WLVA 5KTOA 5D1NA 1JTEA 1HUQA 4FHEA 4Y3UA 1WB9A 4AS1A 3A8JA 4RSHA 2A9RA 3LIIA 3FGPA 5EIWA 2C42A 3PX7A 4D3SA 1U8FO 1Y3BE 1XZQA 2YYYA 3UT5A 1KF0A 2P6MA 4L4RA 2QD4A 4HXGA 2E9SA 4FGLA 4PG8A 1N2JA 5L6MB 1VQNB 1EB9A 5K01A 1DRUA 3CVJA 5FULA 4E5SA 2JD2A 3UOAB 2GXUA 4HN2A 3T4UA 1H9CA 3O73A 1VKNA 4IHAA 3BSWA 3VSBA 4DPKA 2ZUCA 2YZNA 1PYOA 4QBIA 4QDUA 1K5HA 4HAZA 3VXKA 1Y1KE 3N28A 1GEEA 1XTJA 2GJAA 1CZKA 2QRQA 3M34A 3A3BA 4FWTA 5HILA 4AG3A 3BGOS 1Q1EA 2G06A 3KEGA 3UKOA 3KE8A 3IMEA 3NYIA 1ZCJA 1C3XA 1ISSA 1UT6A 2KS6A 3JALB 4MRAA 2CJWA 1XUOA 2XAUA 2F8LA 2Q8PA 2GNPA 2R2AA 4G09A 2O5RA 1C1HA 1J06A 4CV2A 1SHKA 5E6RB 3O4FA 2ET6A 3WWDA 2PL3A 5CXQA 1D03A 3W5VA 1TYAE 2M1ZA 3O75A 3FETA 1QF9A 2NQ2C 3LQKA 3CMAB 3LCMA 4PAAA 3ILSA 1CW2B 1T24A 1YCHA 3NBKA 5FBKA 3TEJA 5B6PA 3S8YA 3FBWA 1GZ4A 2P5TB 4ZQFA 2PX6A 3TTXA 2FZGA 3TGLA 2B7CA 1EXNA 3RVDA 4IL5A 1C2TA 6GPBA 4KH1A 3A4IA 2FFHA 3DMYA 3KOZA 1J0AA 2JCGA 3VNQA 2DH5A 3W8NA 2WVAA 3ZI7A 1NTOA 3V4ZA 1G41A 2FSVC 4NBUA 4MI6A 4ZMBA 1BPLA 4OFZA 1CY4A 1PG5A 2QW1A 2HMSA 2G6BA 2EW8A 4NCBA 4QVAA 3IOYA 1WRBA 3I92A 3L0CA 4URYR 3BDIA 4N9QA 5E4YA 3S44A 1T9CA 4AICA 4P38A 1L8XA 2P4HX 2ZI7A 4PZDA 4QT4A 3K16A 2PR7A 3BSSA 2HMWA 2CVFA 3A2LA 4MGIR 5D3MB 5TSDA 4XPIB 3G6WA 3OT1B 3CMEB 1JPVA 2ATXA 4HJXA 3WHKA 1HDRA 4BUJA 3GMIA 1WZEA 2J9FA 2XYPA 5JZOA 4UHDA 1WTHD 3KR1A 2PT6A 1EP2B 4TQAA 2AG1A 3LBAA 3NFRA 2ODEA 2OP1A 4ZYUA 1T13A 4JP8A 3CO0S 4NAHA 3JS5A 4TOIA 3TTTA 3DHNA 2JFYA 5EAIA 4F85A 2X2OA 5HVNA 3GGPA 1XL1A 2QR3A 4MXDA 5D5PA 1NGSA 2H5EA 5CW1A 2VDJA 4U63A 3J81k 1NBWB 2EP7A 3A31A 4DCPA 3LF1A 1MF7A 4TQUS 4RX1A 4DW8A 3FLMA 5B2EA 4TWZA 4IKEA 3V4SA 5DM60 2AT1A 2X1LA 3I61A 4K9MA 4KE9A 3O8OB 4K9PA 4ZVSA 1AKTA 3K9WA 1SXQA 4FNMA 2IP1A 2GZRA 4GZLA 4R8VA 2WF6A 2PRZA 5I9TA 3UW3A 3VGPA 4DJDC 2A5JA 4YAKA 5JNUA 4EENA 4QV2A 2UYQA 3PVDA 1VMEA 3C24A 5KOJB 2O0MA 1JDJA 1E5QA 2VDLB 5AM3A 1IBLB 1KZGB 3GT0A 3D9QX 2IY9A 1QBKC 2CJYA 3E22A 3Q8KA 1JEDA 2OHVA 1LNQA 1ZG3A 4LX0A 4OO3A 3X1WA 1GPAA 1V1JA 3MT7A 3JWPA 4QG7A 1W8IA 2HLHA 2Q5FA 3CF6R 2QK4A 3HUUA 2VUIB 1GAQA 1UDBA 3E23A 4KTVE 2F8SA 3VDRA 1QO0D 4ZYWA 3GFFA 2P9ZA 3NJRA 4GOLD 4X00A 3IOCA 2BP7A 3L0IB 1AGRA 1R74A 2CLEB 1ARZA 1P29A 1JHXA 1ZFNA 2JZOA 1COZA 1K2WA 2MYNA 3C4JA 5FPTA 3CLHA 1ZN2A 2Y2VA 2BUAA 1RJDA 3WMGA 2R7KA 5CVEA 1XRPA 3DTNA 5DTJA 3W8EA 1W5FA 1GD1O 1XG5A 4V0MA 4LWZA 4IHKA 3VKVA 4XWWA 2IH2A 4ZIRB 1UM9A 4PFJA 3RUAA 1RFGE 1GXSA 2Y0CA 2H1LA 4H0CA 4YRKA 5AVWA 2PH5A 4DM4A 3X2EA 3PRHA 2AEFA 1U2GC 2X3FA 4MAMA 4QYXA 4XARA 4KR7A 2XXJA 3LXMA 4A2PA 1NJ8A 2VPYA 3BCRA 1RHKA 1MIHA 5KAPA 3K73O 4MJLA 1P9WA 2G7ZA 1HDZA 2YICA 3R20A 3ET5A 5KOHA 1CDEA 2H9YA 1P45A 1RAIA 1OJLA 4DKJA 1HNWB 1FTYA 4JVOA 1R3DA 1SCBA 3DZIA 3TNFA 1GADO 4WCFC 5D7BA 2FSSA 1WHTA 2HNAA 4DDKA 2Q28A 1T10A 4C22A 1PBTA 3DLAA 2ZJ5A 2MR6A 5B7GA 1FPQA 3V1TC 4C9BA 3DE6X 3CWCA 4JVLA 5EWMA 4GLLA 3OE7A 2QVBA 1CS4C 1Y9ZA 2P5SA 5G0VA 5DGXA 1G20B 3ISJA 3IUBA 3BGVA 1DAKA 1VKJA 3GGSA 2H92A 4QNNA 1FFHA 2C7VA 3V8EA 2LXNA 3GLRA 3Q5EA 2FF7A 3S1AA 3ZXSA 4CW7A 2R8RA 1A82A 4BFLA 4BIIA 1HZEA 1RPJA 1LBHA 2PYIA 3OIWA 4MA0A 4V39A 3ZWPA 2XTZA 3L7MA 2GCGA 3SJ7A 3QVGA 1VGQA 4PQEA 3V4RA 4X05A 1UDWA 3H4VA 2IYTA 3T7DA 1A9XA 3NVKI 2NQ8A 3ZK7A 1GFIA 3FH0A 2QG6A 1XTBA 4X60A 1UD8A 3RROA 1MXFA 4GXTA 5LQKA 1FRVA 3PPXA 3S7ZA 3TVTA 2PGXA 4RTRA 5EE9A 1UJBA 4DMFA 4YUZA 5JXWA 5DYYA 4U5QA 2J32A 2ZXHA 1YMQA 2A5YB 3AW8A 4DRXA 3OW7A 3GDGA 4CMEA 1HOXA 4XDGA 3W5CA 2V7VA 3GZTB 3BA1A 3OIYA 3A9RA 4QGSA 3DEJA 4JLWA 2FW0A 2EHJA 3SEAA 1AX9A 3D7MA 2CNOA 4U2DA 1M8KA 2VPQA 3FFTA 1W85B 3GVHA 2P9BA 2YFQA 3IT2A 4RULA 1VPEA 4RENA 1E9FA 1ZJ5A 3E8XA 1JDUA 3CCEB 5KJ6A 4C4AA 1YRHA 3QKWA 4I6GA 1CE8A 1UODA 2JH9A 5BSRA 4R1SA 2P6RA 2PZLA 3MJFA 4QA9A 3RE1A 5FD8A 4XLAA 1FFAA 1L0BA 1E64A 2VHEA 1NZDA 2X9QA 3IE0A 4FLFA 5HZGA 3WL8A 4FFDA 4RXTA 3GK3A 3GCDA 2PYZA 4JJZA 5J23A 2JFPA 3ZWXA 4NZYA 4WGGA 2QMEA 3DHEA 4AF7A 3TMYA 4B4OA 1Z6PA 4YCSA 5BSWA 2AHRA 4B2YA 4OGFA 3GGCA 3ZCTA 4WJLA 2A0XA 2V0NA 2FZ5A 1M2VB 1VC2A 4I50B 2JFWA 1MB2A 1RXUA 3FNBA 5EMMA 1OLSA 3PUWA 3KQQA 3STUA 4DIEA 1JILA 1HYQA 3SXJA 4CKWA 3NOQA 1QHHB 4MYSA 3QU9A 3ITEA 5EXPA 3H3JA 2G25A 3INNA 4RACA 4WK4B 5J2UB 5SYAA 4ZO7A 3B52X 1GPLA 3RJTA 3F4LA 4C1NA 1C7QA 1ZU5A 4ZRNA 5EZ6B 3SYKA 3BIXA 5FAKA 1JXQA 3ANMA 3BA6A 2PKRA 4L72A 4Q4HA 4CG1A 1N06A 5A4JA 1JDPA 5I7RA 2GM9A 4KHPB 4L3OA 2W8ZA 1JIQA 1JLHA 2X23A 1DX6A 2IYAA 3FOBA 3E20A 1ZGAA 4J0IA 4X91A 3T1NA 1FDIA 3UAXA 1TZMA 2G5CA 4P8RA 5FOXA 1W5AA 1L8AA 4CR7A 2G83A 1TCUA 5JDCC 2W42A 1A9TA 1R8SA 4TS1A 3WNQA 2CT8A 3B1FA 3O95A 2ENWA 5K6AC 3L84A 4WAUA 4BFVA 3H86A 1F1BA 4GHWA 4FYVA 2V65A 2XIQA 4RNDB 2G0NA 4HUJA 1VLOA 3N7AA 4MO2A 4KO8A 2XPCA 2WYIA 1W94A 1T0UA 4OJTA 4MR9B 5CT4A 2QW0X 1WXFA 1RC0A 4IJVA 4EJSA 8ABPA 1XTQA 2M32A 2P3LA 1TADA 1ZNZA 2WKWA 3KSZO 1Z68A 4LCJA 4NNPA 4FGSA 4ZO4A 2I1WA 2ZUTA 1GSOA 1UIMA 2IVFA 3MRSA 2D1RA 1ADYA 2YNMA 1YL7A 2BLLA 2P5UA 3EZFA 3BMNA 1LXCA 1T2EA 3T53B 2WWHA 1R4AA 5JWHA 4MUKA 4GMHA 5P21A 4EGSA 3GRUA 1U7XA 3D3EA 3QY0A 4NU0A 1QRRA 1RQRA 2GZDA 4RTSA 2DFDA 5CX1A 2LD4A 1TUIA 1PTKA 4ZHSA 5DX1A 1M8GA 9ATCA 1RYZA 1IXSB 2C84A 2WMDA 5BQ3A 5FTMA 1DC4A 4YDQA 1THZA 2R1UA 1ZZGA 2BN4A 4J94A 1F06A 1Y4SA 3KZVA 4X3PA 1KK0A 5IJZA 2XXAB 4B3RB 3ELBA 3KOMA 2D0DA 2HHLA 3WI7A 3AHEA 4B6FA 4E5VA 3FDXA 1XHLA 4J2OA 1WUJS 4IJQA 4MDFA 1P7YA 1YDFA 3HU3A 2NO0A 4JP2A 1VHQA 2E4AA 3K5HA 4KFTA 2G9UA 3DKRA 2GDJA 1ZJJA 3E7PA 2DR0A 3CCUB 2C2YA 2HV8A 3GEGA 3ZZ1A 2PXAA 2HEIA 2I2FA 5ER9A 2TMKA 1N6PA 2NZUG 2R48A 2QZ4A 1S8FA 1F2UA 2VWGA 5IYZA 3C7DB 3GAFA 4CLOA 3HMKA 3Q3EA 4Y9DA 4NCAA 3GBPA 3IA2A 1U6IA 2A58A 1O6BA 3QBTA 4YONB 2A6PA 1AC5A 3G05A 4IX1A 2TMDA 4DA7A 4A03A 2L19A 2B2NA 3ZNQA 2ZBVA 4MB0A 1J9EA 4PYOA 3DBOB 3IJ5A 4TKVA 5DYWA 3PBKA 5CFQA 4J1TC 1JKJA 2BSAA 1TM1E 2YHUA 1WE2A 3OCYA 1RRFA 2Q9CA 3QKRB 4TL6A 4Y9TA 3RFFA 2Z6UA 2QLLA 3KQTA 4D8VA 4WVLA 5IWAB 2V7BA 4YJFA 5AM5A 2FGKA 3LP5A 4CG0A 1K9SA 1AUPA 1NVTA 5HF6A 4QQRA 4DK0A 3QTTA 2GJ8A 2PJRA 1J0DA 2QY9A 4G5RA 3SICE 5CDYA 1H93A 3W6PA 5L4LA 5DXAA 4LVOA 1IEQA 1UMDA 5FPPA 1EFVB 3F7TA 3ND5A 1SUEA 3UAWA 5KVVA 5DIFA 2AN9A 3FCYA 1Z2DA 1CUVA 3CCSB 5J40A 1S2IA 3TI7A 1GV0A 2JGDA 2W6ZA 4KYIB 1YAHA 2L2QA 1XRSB 4TWRA 4BX0A 5JH7F 3DJYA 5JAMA 5TGZA 2EIXA 4EO9A 3W5BA 4PS1A 4Z0PA 3K0AB 3Q9LA 1C9EA 2FAXA 3ISTA 3R8CA 3RODA 2ZU6A 5DXJA 2C5AA 5J3JA 3I34X 4ZANA 4BWFB 2FE4A 3WRVA 4B79A 5JSQA 5KVSA 2ZT5A 4B32A 3AB7A 4LYAA 3URMA 4CM8B 1F17A 3PX2A 2VCEA 3AJ9A 2J45A 5M34A 1XCMA 2K7ZA 4MB6A 4Y8VA 1GQOA 1NLUA 2MTBA 2NOAA 3C39A 4US1R 5B6IA 4XUCA 4TPKA 4V0QA 3L1JA 1B6GA 2IXEA 2X9VA 3N2NA 3ZHCA 4OP3A 1BJRE 1WX1A 4N48A 2Y27A 3DHWC 4O5OA 3NXSA 4LBZA 1JEQB 3F74A 1CJCA 3HP1A 4EA6A 1Y8ZA 1AZSC 5J63A 1W6UA 3BHMA 2QTWB 3LK7A 1SC9A 2WJWA 2AW5A 4C3UA 5JW6A 2VQ6A 3PUKA 3GGOA 4QUJA 2GTHA 1JMYA 3CURA 1KY5A 2GZMA 3DUWA 2HBZA 2XDYA 4C4XA 2DWCA 1Q86D 2EHDA 2WBLC 4R1LA 4EL5A 2WFZA 1ZIYA 1EE9A 1K8AD 3Q3GE 3I9MA 4EM6A 1WXWA 5COAA 5EE1A 4EDHA 2QNRA 4EY3A 5ERGB 1XAGA 1NE7A 1ZH2A 1TC2A 2IEDA 1Q2UA 3SQMA 4A6XA 1YZVA 4B0OA 2C9ZA 1KJ8A 3OW2B 1G8JA 2RGDA 4IWXA 1E20A 3H8JA 4KGVA 4GQIA 1JL3A 3AHIA 4RDIA 5KYGA 3A1TA 4BLPA 3T3PB 5FQOA 4YC7A 3R9XB 3C4QA 2YV1A 3UAYA 4GKAA 1GL3A 3SZUA 5CD9A 3UBTA 1TTQB 5BSXA 5KNLA 2QT1A 1I18A 4ASUD 4BFYA 1YJCA 1FF9A 2PVSA 3RY8A 2NPOA 2R7LA 5AKXA 1VBMA 4BO9A 3O0TA 3GRYA 1JSXA 1YIJB 3IUMA 3P0JA 1P77A 3GFQA 4OHVA 1XCOA 3OTHA 1VG8A 5JMPA 4ZGWA 5HKKD 4ESOA 3ROZA 2MWMA 2NSJA 4M7OA 4RFLA 4H3VA 4BX3A 1DXHA 1H6DA 1T9BA 4P12A 1TA9A 5BUSA 2O2CA 1E62A 3B9BA 5TC4A 2I3DA 2ADFA 3ELYA 3SBEA 3EA0A 4PQYA 1I36A 4P1VA 1MX5A 3P2MA 1E1CA 1QP0A 3G9ZA 4K9QA 3JYQA 4XB2A 3SHOA 3UTDA 3RO7A 3X2SA 4EWLA 1KHHA 2REQB 1D6JA 1PT8A 2VYNA 3MFQA 4QYIB 4W9RA 4ASUA 4CL0A 4XYLA 4MRNA 2V7XA 1HRDA 1TTHA 3L6DA 2GH1A 3GT3A 5ITSA 3ZOZA 3WDLA 3NWPA 3OBIA 2QJWA 5AVRA 5F2NA 3JD3A 4LDZA 5C34B 3RAEC 1KR2A 1Q7TA 2VDWB 3LOUA 2VHJA 2AD5A 3ACCA 3GC6A 3JD4A 4RM3A 2CK3D 3OZUA 2PMFA 5G40A 2F3UA 1X86B 4KQXA 5AHXA 1Z25A 3VI4B 4CV0A 1JB9A 1A9QA 1CBUA 4LPKA 5KJEA 3VYTB 1FW8A 3BAFA 1XQBA 1XZPA 3C43A 2D1SA 1H66A 3QPAA 4IDGA 4M1KA 4KAJA 5IJ9B 4JMQA 1W19A 3GEPA 3KJEA 4YP5A 1QHEA 3G8CA 4F5EA 1X13A 3T12A 3JVIA 2QL5A 4XVHA 4QZVA 5LWHA 4AYTA 4NC9A 2UYGA 3IUEA 2IGTA 4EW1A 1XZLA 2P9CA 1UM8A 2HO4A 4QAJA 2BGWA 2I4IA 4AJLA 1KMCA 4QDJA 2IL1A 1WMDA 3DPSA 3FNEA 3FRHA 1T2CA 3WQSB 4CODB 2R87A 1RMTA 4JIGA 3ZH9B 4LYHA 4XXHA 1MO5A 3HZRA 4JP1A 4A92A 5ECYA 4F7WA 2ZSAA 2GS9A 3BTOA 4ZCPA 2AQ8A 3BD6A 4HNSA 4O4JB 3VDNB 1H42A 4N5DA 4GBED 4DDTA 2IOFK 3N53A 1R7RA 2GLTA 1YR6A 2G63A 4HX5A 4PR0A 4DDUA 4LC0A 2NN3C 4CIWA 3C16C 1PWYE 4UBMA 3ZBPA 1EX9A 1T5BA 3S0JA 2OBBA 2J87A 3U4CA 2HK8A 2QVYX 5EPOA 4RJIA 4EJ2A 3EGDA 5AKEA 2HLNA 1JSZA 4CJXA 1FQOA 1JGTA 2GR9A 1IBCA 1NVKA 2PSHA 4YP7A 3X44A 4LQLA 3B48A 3ZWWA 2WHEA 1AMNA 2P2GA 1F2VA 1PEDA 3BEOA 3CC8A 1I01A 4CCSA 2FHPA 4FBLA 3EXIA 1C9DB 1RYNA 5JPIA 1MQSA 4Y7DA 3ZE0B 2WE8A 5TQVA 5I4KA 4BNJA 4U3JA 2RB4A 1Z2NX 3G1UA 5EMKA 2AA3A 4D9HA 2A9VA 2O8VA 1T0IA 1Y3CE 2JJ8A 1KI3A 1YHNA 1DKQA 1W36B 1PSDA 4R1NA 1SIOA 4JJ8A 1FP2A 1ZXLA 3P0IA 2X5OA 1NULA 1SIUA 1Z5PA 1QK5A 5EUQB 2JFGA 2ATEA 3DBLA 3I4FA 4JITA 5JC8A 1KZLA 2PGOA 1IDN1 1VJ5A 4H59A 3TJRA 1FOEB 1NSFA 1O9GA 1KMMA 5KJFA 1H2XA 1JHAA 3AETA 5CYGA 1CC1S 5INTA 4N0QA 1QTNA 1DT5A 3WYCA 4LCBA 1E2FA 4MS3B 2XA9A 4F93B 4R9SA 5E4TA 1XTIA 3LM8A 2CVHA 2AFHB 2JJ1A 1YZUA 1RQXA 1T8PA 4YH1A 3U3MA 4AKGA 2IYSA 2GD0A 2VP6A 3OOCA 3VC1A 3ENQA 3PUYA 4BP9A 3CUVA 2XQJA 1QV9A 2B9VA 3DT6A 3U3ZA 5C8XA 1SBQA 3VC7A 2Q0SA 4GI7A 4ER6A 3N59A 2XY4A 3MCUA 3AR4A 3ZXYA 3EC7A 3QUSA 1FNMA 4OH1A 1QZXA 1OH6A 2HMYB 1NMYA 1RQGA 3NEPX 3QA9A 1JU9A 4OXKA 4JI6B 4S1VA 5HR5A 1XYYA 2I8CA 1IHPA 2LZ0A 4P4SB 2W6NA 1X70A