4RD1A

Structure of aif2-gamma h97a variant from sulfolobus solfataricus bound to gtp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGAEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 114
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd1A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd1A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd1A01
1XP8A 2OCBA 2VNKA 4PQYA 3G4SB 2WAXA 4I81A 2TMKA 4BE7B 4N3GA 1ZNYA 2ANBA 3BRWD 4AYXA 3T15A 1SXJC 2PX0A 4G5QA 4MGIR 1XTQA 4W5WA 4WXPA 4DB4A 2ZRBA 1YZLA 3DHWC 4TL6A 2VSFA 1G8FA 1N6HA 5EE1A 4B32A 4R2IA 4C0JA 3EIEA 3SQWA 1TEXA 4DLWA 2GJAA 1OB5A 4NDZA 1A82A 1DS6A 3ES9A 2OXRA 3TR0A 2Q3MA 3CX7A 3VHLB 2ZU0C 2VO1A 3QG1A 2ZJZA 2ZRNA 2LKCA 2IEZA 4G1UC 3RVBA 3DM5A 5EE0A 4DCSA 1VQKB 5AWFC 4O2LA 1D5CA 5CK4A 1IXRC 4B43A 1XTKA 1TTTA 2EIXA 3L0SA 4YQFA 3P4XA 1R5OA 1IBRA 2AR7A 5GJBA 1LS6A 2LWIA 2GA8A 3P20A 1KOFA 2GXAA 1ZUIA 3GLFE 2YWHA 2NO7A 4JLVA 3CH4B 1YIJB 5CB8A 3K0CC 3O8BA 3OFND 1NN1A 2DHRA 3LD9A 4EFLA 3GPLA 4LI0A 4UKDA 3HR7A 4RZXA 1AJEA 4L16A 2C9OA 4QL3A 2ZE5A 1CIPA 4HB0A 4V03A 1E3MA 4YDSA 2F9LA 1QFJA 3AF4A 1ZVQA 2QEQA 5DISB 3MFYA 4NYJQ 3M4YA 2WHXA 1OIXA 5FUYA 3RSOA 3AKCA 3Q7PA 2CLCX 4M1SA 4LDJA 1JPNA 2FGJA 3AF0A 4GI7A 4PC7A 1T3LA 2ZRDA 3PCRB 1GIAA 3WYFA 1C4OA 1HQYE 3VKWA 1GL9B 1KO5A 3MWJA 4LHWA 1DELA 2O0HA 2YOHA 3EARA 1DE0A 4NCHA 3UG6A 2O8BA 2HV8A 4BFSA 1SXJB 4PAQA 2ZE6A 2QMEA 3BERA 3AH8A 1KZGB 2Z0MA 3WYAA 1XJQA 3PQCA 4HLQB 3ZVNA 4CDGA 2VNIA 1CR1A 4GOXA 4JZKA 4ZCIA 1M2OB 2OTJB 4Y9UA 1E79A 1COWA 1YE8A 4MQBA 3GEEA 1T0JB 3TW4A 1P2VA 1QUFA 1NSFA 2C03A 3CO5A 4JL5A 1KO8A 1PLLA 4OHVA 4UNQA 5DGXA 2WKPA 1EWYA 3AKDA 5HCIA 4HLUA 1E2MA 2JA1A 3PVSA 4MRNA 2QM7A 5CJPA 4Q4LA 1LV7A 2IEYA 4QM7A 2GF0A 1L4UA 2F1RA 3WHLA 3QJYA 4HAXA 3HYRA 5UKDA 3T61A 2A5YB 2XNDA 4NKRA 3QQ5A 1YR8A 1HT1E 2YHSA 2YYZA 4CIDA 3KB2A 2FFHA 4DT1A 1MR3F 5BWMA 1XD2A 5C4GB 3EG5A 2ZJYA 3FYHA 4P0TA 4KFSA 3FHOA 1FRQA 4EPRA 4BZXA 1VG8A 2GWHA 3LLUA 2WBLC 4JLOA 3OEHA 4QHSA 4HAZA 2KBFA 1EP1B 1E9DA 2NG1A 2XB4A 4PPNA 1SVMA 4Q1CA 3RYTC 1IONA 4LBVA 1VKJA 1Z0JA 3B2EA 1ZBDA 1ZD9A 3LO5A 4NCKA 2X1VA 3P27A 1SVWA 4BFYA 5HPYB 4YAFA 2IHYA 2B7CA 5JJLA 5CDFA 2Q3FA 5EP3A 4IXNA 2XAUA 4IW3B 3WMEA 5KTYA 2H7VA 3RS3A 1G7RA 2PZGA 3TIFA 1P6XA 3LAWA 1QG2A 4TSFD 1ZIOA 2W2XA 4MKGA 4JBYA 4LHXA 1ZM2A 1MKYA 2FH5B 1II8A 3B6EA 4BECA 5EXPA 2XXAA 2AFIE 4OK3A 4UXIA 1NDHA 1KDRA 1BH2A 3W5IA 3M0EA 2WSSD 3PEUA 4FCVA 1Z0DA 2V6IA 1ZM9A 3FPAA 2YV5A 4C3ZA 1CTQA 3REGA 3VMFA 1IN7A 5JRZA 1R10A 3U7GA 4Q66C 2FZLA 5FUWA 3FPKA 4NONA 3WHKA 1KO4A 3O8RA 5F9FA 1VQNB 1TMKA 1M1YE 1JI0A 4C7OA 1S3GA 3FGNA 3IO3A 4HUQA 1I4DD 2OE2A 4Q48A 5TV2A 1NLZA 4IVQA 4O3MA 2BN4A 2XGJA 2BMEA 5KSWB 2QRZA 4C7OB 1W36D 2QNRA 1SXJA 3I73A 3KTAB 3MAAC 4Q01A 1WB9A 3MJRA 2AL7A 1NLYA 3W5HA 2DFLA 2ZRCA 2AKYA 2WWGA 4HLCA 3TQFA 5L3RA 3X1YA 3AVWA 1KNQA 3LY5A 4V0LA 2ZRFA 2GVDC 3VR5A 2XITA 2BMWA 2G1JA 4JT2A 3AKYA 4BLOA 1OKKD 2YZ2A 4Q4AA 3H0KA 2JLUA 2VH5R 2GJSA 2WJJA 1XU4A 3DMNA 4WBSA 1VMAA 1AS0A 1KAOA 2VNHA 1E9BA 1N8RD 3AB3A 4US2R 4CEHA 1KO1A 1B2RA 4HEJA 2ZRKA 1KQSB 1F2TA 2OK7A 2BEKA 1G16A 4PC2A 4M1KA 3DOEA 3FKSD 1R5NA 2OBLA 1RZ3A 2HXSA 2V1XA 2BMJA 3QY0A 4M21A 1N6IA 2IK8A 5EUQB 4FCTA 5SZKB 3NKVA 3QXXA 3NBYC 1OH6A 1OHHD 2J87A 4LYAA 4YMSA 3OHMA 2P3SA 5FL7A 1N3BA 2PBRA 1W47A 4TMZA 1YR6A 1GNPA 4ZPXA 5DNYB 2ZI4A 3EXAA 3HR8A 1B23P 1TF2A 1W4AA 1OB2A 2GBLC 2BJVA 2BOVA 2GCOB 4FMDF 4KFUA 1NRJB 2E9SA 2NIPA 3TW8B 4C9BA 3I62A 4RZ3A 1G19A 2A5FA 2Q9CA 3A8TA 1AZSC 2CCGA 4LPSA 4PO9A 3X1XA 5KOYA 1N2CE 2HUPA 1OE0A 3QKSB 3ND8A 1I7PA 5CIWA 4Z8XA 4FK8A 4IEEA 3PEWA 3UMFA 2FA9A 2FFBA 1EX6A 1KC8D 3A36A 1Z5ZA 4Q47A 3ZVRA 4KBFA 4MKFA 3IGFA 5SZIA 1BKDR 3PFIA 1OXSC 3U44B 2WICA 1FDRA 4NCIA 1YJ9B 4IFEA 2D74A 5KNDA 4ZKEA 2PLRA 1SKYE 2GTPA 2VP2A 4GRAA 4RZUA 4XWOA 1XD8A 2ZREA 4B6FA 2R2AA 2H8KA 1DAEA 1RC8A 2P5SA 1CJVC 1PJRA 1K6MA 4A2QA 4MDFA 2P6NA 3ETLA 4LBWA 4FWTA 2CRVA 2ZI9A 1YZNA 1P9NA 4QXAA 1GTVA 2J0UB 5TXGA 5CB6A 1PLKA 3CBQA 2ZE7A 2H57A 4HB4A 4LK2A 1US8B 1C9KA 1UBFA 4A0GA 1CJMA 2EWVA 4MYUA 4TLBA 1E9EA 3H86A 4MGZR 5FOUA 1T4GA 4A0RA 3QKUA 1QGYA 3EZ9A 4NHOA 4KBGA 2BCJQ 1NG9A 3VO2A 1VPLA 3E1SA 3MJHA 3WY9A 1Z6GA 1COWD 4GSYA 3S1AB 3Q85A 1U81A 5CYOA 2GZDA 4URUR 1AK2A 2FEOA 1JR3A 4GP7A 1ZC3A 2GPJA 3LH5A 1ZCAA 1U98A 4U9UA 2D62A 2X2EA 3ZS9A 5B30A 1KRHA 1TQ2A 2P67A 3L2OB 4CVNA 3QFRA 1E1RD 2N46A 2KE5A 2VSXA 2ZM5A 1RE0A 4HLDA 4CGZA 1GJRA 2WWFA 5HXBA 1RYHA 2WIBA 2ZVQX 1E9CA 3KJEA 1TEVA 3F3YA 3OZXA 1SZPA 1YVDA 1N0WA 3BH6A 4Q1EA 2ZRMA 1Q1BA 1XEFA 3RRYA 3ZQJA 5E7JA 2VP5A 2W6JA 1ZUHA 3SFVA 3PUYA 5HZKA 4AG6A 3CWZA 1Q21A 1G5TA 221PA 2VHTA 2GJKA 4ZDWA 1JEDA 4YXWD 2ZRGA 2CVFA 2ZITA 1SVOA 3CLVA 5GV8A 4A2WA 3C5CA 3ZDQA 2PZEA 4DC9A 3KQKA 3DEFA 4I4LA 1BS1A 1ZNXA 4G5SA 1ZJ6A 4Q9HA 2RGCA 2NGRA 2RGAA 2BM0A 3RWMB 4QGHA 1M7GA 4V0NA 5DYIA 3N2EA 1G5RA 2JLYA 1KKLA 2C8VA 1SQ5A 4NYMR 3O8CA 2O8DA 5GJCA 3R9IA 3I92A 2QE7D 3KKMA 2IYXA 1P2SA 4PX9A 1GRNA 1KSGA 4M1MA 4J0QA 2CL6X 2XTMA 3IBYA 2BDTA 4DIDA 3EPLA 4TYYA 1HEIA 2A7QA 1VQ7B 2NZJA 1H42A 2WJVA 2Z43A 3MWKA 3RS5A 2O8EB 2ZJOA 4HZIA 4DSOA 2EW1A 2VHJA 3G82C 4LUCA 5L3SA 1G6OA 1N0VC 2JLVA 2C98A 3DZDA 3NXSA 5TDHA 4HDOB 4JLMA 1Q81D 1F2UB 2O8EA 1CRQA 1G5PA 4D4KA 2YWGA 4C0KA 1GDDA 1ANKA 4P4TA 3GLIA 1J9ZA 1KDOA 5C2JB 2RHDA 3THXA 4HAYA 1KSJA 1P5ZB 2ZPTX 5DYGA 1NNEA 3JQQA 3FJOA 1XEWX 3B1ZA 4FINA 5L3QA 5DI3B 4HAUA 2QT1A 4MH0R 4BPBA 4IOMA 3TAHA 4DVGA 2VLIA 5B2ZA 3GLGB 3Q72A 4Y0VA 1KNXA 2RB4A 3AM1A 2ZIAA 2JLZA 1XNJA 2ODWA 4PPGA 2Z6VA 3VR3A 1LF5A 4TQUS 1VQOB 1IY1A 2QZ4A 3UMRA 1H85A 1G6HA 2Q6TA 4B3CA 1DDGA 1CJKC 3THWB 3RHFA 1KK0A 4LYHA 1X8JA 3GLGE 4QBFA 4EQ6A 1G3RA 1GO2A 1P73A 1TADA 1XTIA 5K8TA 4JLAA 4TQ9A 5BYKA 1OH8A 1KMQA 2OK8A 3GFPA 2D3WA 2DFTA 1G3MA 3KZ1E 2ZRHA 1N6RA 3LBHA 4TYNA 1NI3A 3RS2A 1S96A 2AXNA 5EZ5A 1JEEA 3VFDA 1G4UR 5DI9A 4D81A 2GEVA 1Z28A 3CC2B 3IDQA 3K53A 5FPHA 5JSZA 1EG7A 4B47A 4QG7A 2GCNA 1JNYA 4BEJA 3EASA 3KJHA 4HAVA 2BV3A 3KQLA 4MGYR 2QT0A 3ZS8A 1M1KD 1XTRA 1FNCA 1XCMA 3SZRA 521PA 2KJQA 2AD1A 5AJVB 4QOSA 2QGZA 2BIFA 2O8CA 3SYKA 3P26A 4B4DA 3K70C 3BAFA 1EFUA 1YRBA 3RS0A 1Q86D 4Z1MD 4YC7A 2QBYB 1GSIA 1T8UA 4EAQA 1OH7A 1T6NA 3NEJA 1TL7C 4B75A 1J90A 1A1VA 3CF0A 5ANRB 2CXXA 2I1QA 4OHXA 2IS2A 2VYFA 3JZMA 4JLNA 2QG6A 3AVVA 4JS0A 1KI2A 2EFHB 2ZUCA 4LJ5A 1Z6YA 1Z08A 1GWNA 1DTSA 1G7TA 2DEUA 1HQCA 3AP1A 5JLJA 3B8HA 3W6PA 2OG2A 3B60A 3SEAA 2NO0A 4GFDA 2G0NA 2QP4A 1IAQA 4Q4HA 2PCLA 4PO8A 1KIMA 1S4QA 3QF4A 1Q12A 3B7GA 3AF2A 4XSGA 4D6PA 2IC5A 5K8LA 1PLJA 2X2FA 1U0JA 3P4YA 3AVQA 1R6BX 4NU0A 1G8HA 1OSNA 5FL7D 2JJ1D 3U3MA 2PEYA 3KX2A 4B2LA 3FOZA 2OAP1 4M8NE 2OO7A 1QDEA 4L9WA 2QENA 2QSYA 1MABB 1JA0A 3CCMB 2QPTA 3KXIA 3BGWA 2BGJA 4KI0A 2UVQA 4NP6A 3IQXA 3DMDA 1E94E 1UKZA 2GXSA 2EFEB 5AJZA 3ONWA 2VP6A 4ZIRB 3WP0A 1NVUQ 3LX5A 2F3TA 5JBQA 2UZ3A 2ZXUA 1UKYA 2ZJ8A 3HP1A 3SHFA 1HE1C 2VSOA 3RRMA 1GKIA 2G0TA 1OFTA 4A4DA 2CCKA 1QVGB 1Q57A 1U0LA 3LVRE 4JLJA 3W5UA 1QUEA 5JECA 4Q9IA 1SXJD 1PVOA 4XVQA 1P62B 4UAJA 5LD2C 1XZPA 3NBZC 1E9AA 4ASUD 5JHHB 5H8WA 1YZUA 3MLEA 2OV2A 4DCNA 2ZS8A 1LFDB 2Z4RA 4DSUA 2B8TA 1UPTA 2G83A 2OT3B 2ZETA 3ZZ0A 3I56B 2ZRIA 3REFA 1FX0B 4YHBA 5JRJA 2R44A 3LW8A 2JIZD 1Z6TA 2DB3A 3OZUA 2BSAA 1EFCA 3OJWA 1X8LA 3T5GA 1R2QA 2OTLB 1TX4B 5KHOC 2W6JD 4MRVA 4DUGA 1W4RA 3Q3JB 1QHYA 1UFQA 4UQOA 5FTKA 1FRNA 3K9HA 2EYUA 3SI7A 1EWQA 4NCJA 1G64A 3C14C 3BJIC 2ZR7A 5F9HA 3HU1A 1SM4A 3KUCA 4WW0A 1OHHA 3GCGA 3SN6A 3UWOA 2FE4A 5FPTA 4C0QC 3ADCA 2O8FA 2ATVA 3JVVA 2GNOA 2W83A 1Z2CA 2QE7A 3CIOA 1J99A 2V8OA 3IPYA 3ZD6A 3W3AA 3A58B 5EXXA 4QFMA 3C4JA 2V55B 2EWWA 4WOPA 3CC4B 5CJ2A 4JLKA 1E2QA 1KI3A 4FMBB 4A82A 4UJ5A 4NTZA 3K0EA 4BFZA 2ZU6A 4PPFA 5AJWA 3QVUA 4MUAA 2N1BA 2A5DA 2EVWX 1W2HA 1UJ2A 2PIAA 1DAIA 4ZI2A 2A5JA 2VBCA 1S1CA 3A37A 1GAWA 1F20A 5JWOA 2R8RA 4C2TA 4AURA 3X1DA 3RRZA 1KGDA 5G3ZA 2FSHA 3W9YA 2WM9B 4F7WA 4F4CA 4BGDA 4U5XA 1VCOA 3TK1A 4ZIRA 4AKEA 2GJ8A 1TNDA 1ZM7A 3C5HA 4U7DA 3WNDA 1G3UA 1U8YA 4MITA 2CMKA 4B73A 2ZAMA 1CS4C 3WP1B 2HLDA 5KDOA 3VNVA 2WMNB 4US0R 2XB2A 2WIAA 1KKMA 1CU1A 1XJ0A 4AKIA 4C0LA 1QVRA 1S0UA 1UDWA 2JDIA 1E98A 2E87A 4Q7JB 1ZINA 5C1BA 1R0ZA 5E7MA 1MOZA 4ZI3A 4DKXA 3IEVA 4OI1A 2ZYWX 2R6GA 5E3HA 1D1NA 4RFSA 1KD1D 1QHSA 1SVLA 1KI7A 1SXJE 4YMVA 1I4TD 1E1QA 2WWHA 2JGNA 4LHYA 4OHWA 2OFOA 2VEDA 1XMIA 3MSXA 4DEXA 2FN4A 5J4LA 3L0OA 1OIWA 1W44A 4NCNA 3JZAA 4X8HA 3V4RA 1W2BB 3EAQA 4B34A 2IUSA 4HZUA 2VYQA 1YHNA 3QF7A 1C1YA 3U7EB 3TAUA 3QE0A 1Q3HA 1ETUA 2C95A 4PSVA 4YMWA 3R7WB 2O8FB 4TZ6A 1JR3D 1FFHA 2WKRA 4D82A 1X1RA 3MD0A 4PQFA 4TZ0A 3E20A 4TLEA 5EQTA 4F92B 1CQXA 4LJAA 2ZROA 4P4UA 1Q0UA 1VQPB 4DLXA 1Z07A 5A5GA 5C46F 1XD2B 2YWEA 1YJWB 4JMPA 2RC6A 3WNCA 1D9ZA 2GBLA 1Y63A 2X8AA 3I5XA 2CVHA 1GRQA 3QI2A 1L2TA 3LNCA 3QEOA 4Q4JA 3R8CA 4EPTA 2GILA 3K0CA 1WXQA 3EZ6A 3CXCB 4K46A 1K73D 3H1TA 1VG0B 2IWHA 2DBYA 1AQYA 3A1TA 5DHAA 3PIRA 4JL6A 2Q0HA 2WKQA 3BB1A 4KHZA 2R6AA 1IY2A 2EYQA 2IA5A 3K0AB 3QXHA 1NBME 2IW3A 3I32A 1XTJA 4LJ8A 1GUAA 1KI6A 2DY1A 1BIFA 3TKLA 2XZOA 4WVFA 2B92A 1J70A 4RCYA 4DDUA 3SE0A 3AUYA 3CRZA 1YU9A 3A1VA 3NBXX 4JBXA 4OBEA 4KYIB 2JEOA 5H1YA 3VX4A 2HJGA 3HU3A 1U8AA 4RVCA 4AD8A 1K8RA 2J7KA 3H2YA 3VX3A 1W4BA 2QTZA 3D6TB 3K1JA 2ZYTX 4KSCA 2GDJA 3QUSA 3EWSA 1HH4A 3E2IA 3PEYA 4TT3A 2XOKA 5DSZA 5H70A 2I1VB 3SHWA 4S35A 5IK2A 4B3FX 1HUQA 2IT1A 5BQ5A 3I55B 1YHQB 1VYUA 1CRPA 5LBIA 2XNJA 3SJCA 3V00A 3R8FA 4EPXA 2WJYA 8OHMA 2DCUA 4EPYA 4RKFA 2VNJA 3TSWA 1XE1A 4DSTA 2B5OA 4DQLA 4RD1A 2O0KA 1E2LA 4AYWA 3BS4A 4JJZA 3D8BA 4YLGA 3AF3A 1IXSB 2PCJA 4TWZA 4NYIR 4OQLA 2ZSBA 4C4PA 5AUQA 2D2EA 2JLSA 1JJ2B 1WF3A 3W8NA 5JCZA 1VQ9B 2W6ID 4JVSB 2ZR0A 3QKRB 4PAMA 2GJ9A 2QEXB 1CJTC 3IEUA 5KO2A 3GMTA 3V4FA 4GZMA 3BORA 1W5TA 3EW9A 4N0EA 2QAGB 1M6NA 1W5SA 3VKGA 2IYUA 2H16A 3O47A 3QNUA 1DAHA 4JIMA 4A15A 2GXUA 1GFIA 4URVR 3NH9A 1B0UA 5HR5A 4LV5B 2FPMA 3NBFA 4ASUA 2BWJA 5E95A 4BFXA 4BRUA 4E5UA 2NPFA 2BVNA 1XZQA 3LBIA 3ADKA 4IJMA 3I1FA 1MRSA 2XTZA 1NMYA 3JQRA 2GCPA 3NC1C 1H65A 3ZLJA 4DUGD 1G9XA 1Z0IA 1UBGA 5LB2A 2NPIA 1ZUNB 3PUZA 1I4LD 4ZGNB 4M9SA 3Q9LA 2D7DA 4DIEA 2JIZA 3QG5A 4WXRA 4AF7A 1SKYB 4GZLA 1E63A 1IN6A 1K5DA 4BFTA 2YOGA 3NDBB 4YAOA 2FV8A 3BK7A 3PITA 1M90D 5EE5B 5FL3A 5GVRA 2BF4A 3E70C 4AG5A 1G291 1E4YA 2IYWA 3KL4A 3FMFA 2QGNA 1KK3A 4KLZA 1T5LA 1W4CA 3BD9A 1KI9A 3TH5A 3W5JA 2JLQA 2FPKA 1G7CA 3TUJC 3E5HA 2HCBA 2REOA 4D0GA 1E79D 2OCYC 1PV4A 1W48A 4DDVA 4ZV4A 1IOZA 4B2PA 4GNKA 4KO8A 1XMVA 1RYFA 4OJKA 1U9IC 1QFZA 5D3MB 1EESA 1FPMA 1AKYA 2MMCA 3ASZA 3ZIAA 3HDTA 4ZDJA 5EXTA 4UNRA 2OXCA 1H8HA 3AQ4A 4POAA 1XXHB 1M74A 1OXUA 4QNMA 3CF6R 1AS3A 4LRWA 1XMJA 3RSLA 4A9AA 4AIIA 5IF9A 1QHHA 1AIPA 3F5FA 1E32A 3SJZA 3SQXA 4RD6A 1W0KD 1A7JA 2J0VA 2ECKA 5G41A 5IT5A 4JVMA 3GLHA 1TF7A 4LBYA 3EC1A 1D2EA 1F2UA 2DFKB 3T1OA 4II7A 3CX8A 4JLBA 3IO5A 4URZR 1YQTA 1TUEA 1E64A 1A5TA 3BFKA 3KDSE 4ILEA 4KV9A 5FUXA 2DWQA 4JKYA 1UADA 3FB4A 2CL0X 1XEXB 2IYSA 4DLYA 2HDNB 4R9UC 2YWFA 4B2IA 4QGGA 1I2MA 2RGDA 3CCLB 2XNCA 1CKEA 1BQEA 1KDPA 1YITB 1M8PA 1P9RA 1Q22A 1WMSA 3HYTA 3IIKA 1KK1A 4HUQB 5DLQC 1GZSA 2J46A 5H5JA 1GP2A 2QTHA 1UBEA 4G3XA 3CD6B 2GAOA 4KVAA 3IQWA 1E2IA 4MGKR 4QGAA 3TVTA 2C9YA 1VCNA 2BM1A 3CRQA 3P32A 2X19A 1SHKA 1Q20A 3CNNA 2RH5A 4P32A 4PSAA 1ZP6A 4D4JA 1OFIA 5B58C 3MGCA 4M1TA 1QVFB 3CF2A 2VL7A 4LBZA 1CP2A 2QA4B 2VHCA 4LZZA 4XH9B 5B57C 4PANA 2R6HA 2Q3HA 3QFSA 4Q4JB 1Q44A 3SYNA 5GJWC 1OV4A 4HE5A 1A4RA 2OLJA 5FTMA 2ZUBA 3WMFA 3LFUA 1KI6B 4IVRA 1AGRA 1NLFA 4LHVA 5DN6A 2XNDD 1XPOA 1VQLB 2CHGA 4JJKA 2FSGA 4ACAA 1JAHA 1VQ4B 4C0BA 1V43A 1DAMA 2V7QD 2JATA 3CNOA 4Q1AA 2IYZA 4HE6A 3KJGA 1E2FA 1FP6A 1E9RA 1Z06A 4EH1A 1E1QD 3GP8A 1GL6A 3CMEB 1T3SA 3N2IA 4MYTA 2FGKA 2EFGA 1W34A 3RRNA 3R9XA 5DIFA 2PJRA 3BB3A 2MSDB 1QG0A 2ZS7A 4XIGS 1L7VC 2OBMA 4EJSB 5B64A 1GAQA 2H18A 1ZW6A 3KFXA 3IHWA 2CLDX 3GFTA 2OUKA 4ZO4A 3GJ8A 4TT3D 3TUZC 3CB4A 1H8ED 2WPDD 4JYBA 3FMOB 4OI2A 3MCAA 1W0JA 3ECCA 1DAGA 3X1WA 2IL1A 4RZ2A 2XZPA 2H92A 4LJ7A 2Z5FA 2HF9A 3I8SA 5L8VA 4EFMA 1XXHA 3W6OA 5FOXA 1MV5A 1N5IA 4GDFA 4YAUA 4WIAA 3LO8A 2DERA 2KI5A 3K9LA 4BLTA 1IQPA 1T91A 1FOEB 1OH5A 1UKVY 3EA5A 3CPWB 2BMDA 2IF2A 4D26A 2F1HA 1RRFA 3WNBA 2J41A 4OK5A 2JAQA 4LC0A 3OEHD 4XTRA 4GL2A 4HDQB 1FUUA 2WWIA 5JHGB 1FL9A 3T06B 5EZ6B 3RNLA 1EK0A 2W6IA 4URWR 3Q5EA 2FDCA 3U4QB 4LV6A 2F1JA 3V9PA 3ZBUA 2ODBA 3DZ8A 4UXHA 3SBDA 3DDCA 3E1YE 2DETA 4TMXA 2F43B 2JLRA 2VA8A 3F0TA 4QHTA 5FOTA 4D0NA 4CRWB 4OL0A 1MO6A 4JSYA 4M9ZA 2GZHA 2W0MA 1KSFX 3CM0A 4NL4H 4B35A 3EC2A 2ZTSA 2ODEA 1XCGB 4DLVA 1X1SA 1II9A 3VR4A 2QL6A 1E99A 1NJID 2FPLA 2KBEA 1MRNA 2A9KA 1WDTA 1N5LA 3QPUA 4LC1A 4A36A 3GQBA 5CLLA 4FIDA 1QZXA 2I4IA 1SKQA 3JQPA 2XJ9A 3KKNA 2RAPA 5IK2D 5FBWB 2CE7A 3A1SA 4G5GA 1GL7A 2REBA 4R98A 2DWOA 4RSGA 2B21A 2ZYVX 3CNLA 4BASA 4BEBA 3EZFA 4DJTA 5D3MA 5C4MA 4B71A 4Q9LA 4Z51A 4XD7A 3OAAD 1TF5A 4KFRA 1JB9A 3L82B 3QIAA 1HY3A 3NH6A 2D06A 2VP9A 1FX0A 4LX0A 4TTPA 4Y7CA 1SHZA 3RABA 3FFAA 1CF4A 5HE8A 4FXPA 3AVOA 4DCVA 4EPVA 3U44A 4UNPA 2IS1A 4MRPA 3NTUA 4Q00A 5FOWA 3MHPA 3R20A 2WZQA 3ZIAD 5J4KA 5AJXA 3VTKA 5J5CA 3W2IA 4JYCA 4BFVA 2OESA 4WA7A 4A2PA 4D80A 1OKKA 1HURA 3BE4A 4DZZA 3K8YA 4ESVA 5SZJA 1O3YA 2O5VA 3IKJA 1P9WA 3GLHB 2IYRA 3MMPA 4RD2A 2IXEA 2BKEA 1VECA 1RIFA 2CK3A 621PA 2ERXA 2NOAA 3BB4A 5LPNA 3T1QA 1E0KA 3RLFA 2WWYA 4TL7A 1J8YF 1OXXK 2WOJA 4EDHA 1Q1QA 1RVDA 1SVIA 2FG5A 3CC7B 3JVUA 1F6BA 4V0MA 2OHFA 2C96A 2QQEA 2P6UA 3QXJA 1KJYA 1NVVR 4RFSB 5KSZA 3PR1A 3PUWA 3KFVA 3A1UA 2FJUA 1Z22A 1GAJA 4AKGA 1FMLA 2RCNA 5KU1A 1JA1A 4IOLA 3VR1A 2VIIA 4QJ5A 5J4HA 2XEXA 3BH7A 3OEEA 3UATA 1QF9A 4LWZA 2ZUDA 2XOKD 1Z0FA 2AD5A 3AGPA 2CDNA 3CR7A 3X1ZA 4CEIB 1XDBA 1OT3A 3LX8A 3UG7A 2HYDA 3HU2A 5JMTA 3W2EA 3EX7C 1GILA 4M2LA 1FTSA 2JJ2A 1N0UA 3BWDD 4TL9A 4JSTA 2HT1A 1R8SA 2JLWA 1TVCA 2F43A 3U6BA 2CNWA 4Y9RA 1DDIA 3TVDA 1QG4A 5JI2E 1I2DA 5E7IA 3QPWA 1MO3A 3KKPA 3QOFA 4NBSA 3UWKA 4BQSA 4BFUA 2WJHA 1HTWA 5E4FA 5KPJA 4CEJA 1U94A 1ZNZA 4PC3A 3BFVA 4BLSA 2WWWA 4R71A 3GLFA 4FD2A 2V6JA 3NHAA 2J7PA 5BYJA 3R9WA 1X8KA 1M7BA 3IIJA 3I72A 3DKVA 1FUKA 4C0SA 4XVRA 4EFNA 2CBZA 1TU4A 1JALA 5EXSA 1CR2A 1KMHA 2XSZA 1YJ5A 4ACBA 4OJQA 3M1IA 3CCRB 5JEDA 1IN5A 1OJLA 1P75A 2V1UA 3UANA 2G77B 2HJVA 1G8YA 1RKBA 2W58A 5TVKA 3L0PA 4URYR 4BLRA 2J0QA 2PT7A 4ARZB 4A0HA 2QAGC 3GEHA 3U60B 2IUUA 3GD7A 2VHUA 2G1KA 1IJFA 4Q9KA 3SJAA 2P65A 2VQSA 4QM6A 3CRMA 1P3JA 2YNMA 3ZZTA 4FW9A 1R4AA 5FR1A 1DOAA 1Y3AA 4BZQA 2LKDA 4OHZA 4KAXA 4I99A 1NMZA 4PO1A 2GEUA 2IWRA 1XEXA 3IILA 2AXPA 3QFTA 4LCBA 3WXMA 4TMVA 3LQQA 4Z54A 3ZJYA 4LJ4A 1W0JD 2IX3A 3OIYA 2O8BB 3AGQA 5TY0A 3G5UA 4BPRA 1VG1A 1SVSA 4KODA 4TLCA 3S1AA 5BN5A 2UZIR 2J0SA 2ZSDA 5LD2B 1XX6A 1GM5A 2VP4A 3Q8XB 3CZQA 3ASYA 3FWYA 4RFVA 3LVQE 5FOSA 1KYIA 1AMOA 2A30A 1E9FA 1H8EA 1P4SA 3B85A 3CH5A 3UXMA 2HXYA 4Q9JA 1DARA 1NIPA 3MUFA 4YDHB 1A8PA 1S72B 4WZBE 1E2JA 1EWRA 4ZDIA 3NG1A 3UMSA 3TR5A 3VU9B 4DLSA 5ELXA 2SHKA 1WA5A 1XCPA 4HI0E 2NQ2C 1S9DA 5J4YA 2V7QA 4NPHA 3LA6A 4DLRA 2KSQA 1JQLB 4C2UA 721PA 4OI0A 1ZCBA 4P6VF 3TSOA 4IOJA 2WSMA 4C43A 3LW7A 2PLFA 4Q1FA 4IKEA 3K0FB 3FMPB 2ZRPA 4M9XA 3TBKA 2ZSEA 2PEZA 2AFHE 4B3XA 1L8QA 2GRJA 5DO9A 2OM2A 1QRAA 2R6DA 1KTVA 2HF8A 4CF7A 2VP0A 3ZGXA 1G8PA 4A92A 1ZM3A 2QRNA 3HPQA 1HV8A 1G3IA 1WQ1R 2ZI6A 3IUYA 4XOIA 5EP4A 3WYGA 4QJ3A 1NBMA 3HPRA 4M22A 1J8MF 5GJVC 2ORWA 3OE7D 2O0JA 4TLDA 3ICEA 1RJ9A 2Q21A 2AKAB 2YINC 5DHFA 1II8B 1D8TA 4M4SA 4ZCLA 3N70A 3LWNA 4DCTA 2IHBA 4G0NA 4PPQA 2CCJA 3EPHA 5TARA 5AUNB 1AN0A 3TE6A 3PENA 5CYPA 5F98A 5AR1A 3IBGA 1ZMXA 2C04A 3CUEF 3OIWA 3THOA 2GZAA 4M1OA 1DPFA 4S2EA 4PZZA 3KXKA 3OAAA 5G53C 4K81B 5K8IA 2OILA 3W90A 2IXGA 2FFAA 3DVLA 3OF5A 4LY6A 1W36C 4Q1BA 1WCV1 2GEDA 4OQXA 1QH0A 4H1VA 4M53A 1MH1A 4QGFA 5DN6D 4LJYA 2IYLD 5EE3A 2XXAB 5DI3A 1YKSA 3CRW1 5H68A 1X86B 2G88A 4HDCA 4Z1MA 2ERYA 1WBDA 1GVHA 5FTJA 2QTFA 5IDVA 4P4SB 2B6HA 1ZU5A 1XD9A 3SS8A 3K70B 3GLIB 2REXB 4C30A 3B82A 2YJTD 3GEIA 5JJKA 4AI6A 1LF0A 4MDEA 1JJ7A 2ZJ5A 2QP3A 3THWA 1XB2A 4CEIA 3RC3A 2P2LA 4ERNA 2CK3D 1NVXQ 1JQJC 3CCSB 1SVKA 5FI0B 4IFBA 1E4VA 3OFNA 1FMJA 3GJ6A 3CCUB 3BXZA 3OEED 4TQAA 2AHOA 4ZCMA 1E6CA 2WJGA 4HB3A 3NIBA 4BLPA 1DG3A 2IYYA 2HLDD 2QY9A 2GETA 5FPYA 3VU9A 3NDPA 1GKUB 5THXA 1NVVQ 3KKQA 3KQHA 2JJ1A 4P4SA 1ZAKA 3EZ2A 2JDID 1QHIA 1EP3B 2QI9C 1OPXA 3B1XA 1QHXA 1G7SA 1YR9A 2EU8A 2CNWD 4JLPA 2W0SA 1WRBA 1W46A 1BYUA 2JASA 1ELOA 2EFDB 2QUZA 4UNSA 3OZVA 3VKHA 3CW2A 2HCJB 3NHBA 4JLDA 1OGJA 3B9PA 1BOFA 1P2TA 5BXQC 1IN4A 1E2DA 2NO1A 3AF1A 5FPKA 4NH0A 1EX7A 5HKKA 4EJSA 4HUTA 1T8TA 5KYKA 1R0XA 4IDPA 3TRFA 4JBWA 1CEEA 4AF6A 2YVUA 1Z3IX 4JL8A 1DO2A 4RD4A 1CR0A 5FFMA 4EKDA 1IM2A 1HE8B 3U6KA 1T9HA 3EA0A 5EP2A 2N42A 1N5JA 4IEIA 5L3VA 1Z6AA 2CHVA 4ARZA 1CR4A 2FFQA 1RRGA 4MYCA 4RD3A 4TN1A 4YMUA 4DLUA 1J7KA 1XF9A 1RRCA 3KQUA 1LTQA 3OIVA 3U61B 1NKTA 2ZSAA 5KNCA 2ONKA 1KI1A 4ZDKA 4Z8YA 5KNBA 3WBJA 4DBLC 5G3YA 4DCUA 1AM4D 2ZS9A 4M1WA 4URXR 3FMIA 4V0KA 4ON9A 2WWXA 4FI3C 1AQUA 1PUJA 2K5UA 5EMNA 3U2QA 3LQRA 4TMKA 3QE2A 1UAAA 1DO0A 1NL3A 3HWSA 5CM8B 1VQ5B 2C78A 2ZJBA 3W3ZB 5KDDA 1KAGA 1DAFA 1OGIA 1SGWA 1JBKA 1VDZA 3U3KA 1R0YA 1VTKA 2ORVA 2FMXA 1U99A 1UMKA 1JXMA 4TTQA 5F2EA 3BC1A 3AUXA 1Z0KA 3CRRA 1W87A 3A1WA 3OESA 1UF9A 4PR0A 4QJ4A 4D2IA 2ANCA 1LW7A 3CPEA 1CULC 3G71B 1YI2B 1TPZA 2B8WA 1CXZA 2I3BA 2OBNA 2P0EA 2GAAA 4ESHA 4DDWA 4LYFA 1NVWQ 2R9VA 2RGBA 3H4MA 3LXRA 2DFNA 1KJZA 2ORIA 4HYYA 4CT5A 3WRYC 3D7MA 1MABA 2BGIA 1IY0A 1E62A 4U00A 3L43A 3NC0C 4DLTA 5JI3E 2R62A 2BJWA 3LDAA 1KI8A 1R7RA 2D7CA 4W5HA 2H1LA 4DLZA 3DM9B 1DAKA 4HATA 4CEHB 5F3WB 1TAGA 4GP6A 1MO4A 1GITA 4JKIA 4X8OA 4N1AA 5JJIA 2FU5C 4U02A 4TL8A 3AP2A 4AKHA 1QVAA 3QBVA 5IHPA 2RHMA 4KJZA 1G41A 3CCQB 1II0A 1IXZA 5IRCD 4PQRA 2E1RA 1JECA 1P60A 1Z2AA 2MMGA 2Y8EA 3B1WA 1TU3A 3SNHA 4DXAA 4B3BA 4IDHA 3AVUA 5JZVA 4EJSC 4O25A 4A8JB 1CBUA 3CCJB 1TLLA 2PL3A 1W49A 4XJXA 4GPTA 3GJXC 3VR2A 3ICQB 2QTLA 4K8OA 2AK2A 3T1TA 3TNFA 4L8GA 5FTLA 3QFCA 4FCWA 3B78A 1KSHA 3SFZA 4MUBA 1KY3A 4X8MA 1NN0A 1AGPA 3VNUA 3QPVA 3FE2A 4NZYA 4OHYA 4PSKA 4TSFA 1U2RA 2QMUA 4N3NA 2BKUA 1S3SA 4V0OA 1ODFA 2NO6A 4RCZA 1GRRA 4UNNA 3M6AA 1FNBA 1NN5A 2ZSFA 4XTCS 3NEYA 4MKHA 1KMHB 1QGZA 4MA4A 5J47A 1GKYA 1NJGA 3NVAA 4UJ3A 3ZQ6A 5JSZB 4BRWA 1KI4A 4RD0A 1E2KA 4R7ZA 3T35A 2QMHA 4A0FA 1FNMA 1KHTA 5AN9A 1YZGA 2J7PD 3IHLA 5SZHB 2OEPA 4B74A 4KITB 4IVPA 3IPXA 4YXWA 1CLUA 3KTAA 1BYIA 1FP7A 1G3QA 1ZNWA 3PUVA 4M9QA 3K70D 1A2BA 1DVRA 1E0AA 1FNDA 3AVPA 4A8JC 1AKEA 1OW3B 1P72A 2DWPA 2FSIA 2GK7A 1Z8FA 3UK6A 4TYPA 1JXOA 1YZKA 1S8FA 4NYIQ 3OIUA 1FQKA 2F3RA 2OLKA 3FTQA 2F9MA 3U3OA 1BO6A 4OQMA 4YAWA 4B3GA 4D25A 2RGEA 3AVTA 2QROA 5HZHA 5FBVB 1E1RA 4KU4A 1CNEA 2ZJ2A 3RWOA 2Z83A 1BMFD 1UDXA 2PMDA 1G17A 2F1IA 3K9GA 3QXSA 2GQFA 4Q7KA 4BFWA 2D4HA 1HT2E 5EE9A 3L8YA 2A2ZA 1Z29A 5K8UA 2PX3A 5CIQA 1F60A 1VQMB 5CLQA 3GJ3A 3THXB 1NBMD 2JLXA 2QMOA 4D4MA 1XTSA 1FNNA 3OZWA 4C0AC 4PHHA 4BLQA 2W2VA 4TLAA 4K1XA 1VQ8B 3RAPR 3SC3A 2BPOA 2QDXA 4KVGA 2GKSA 2MSCB 4ZGQB 3CRVA 1N6LA 4JVNA 4RY2A 1GR1A 2B7BA 2FOLA 2G6BA 3T5DA 3CX6A 1RFLA 5J4VA 1J2JA 821PA 3FHCB 3SJBA 2F55A 1D2NA 1U9IA 1IB0A 4A8JA 1RRPA 2WTUA 3VHXA 2IS6A 1JR6A 2UKDA 2OZEA 3MRSA 4LSGA 1W1WA 1WE2A 5FBLB 1M7HA 4N0DA 1FTNA 1GVNB 2OCAA 3NWJA 4Q21A 3W8RA 1XPRA 1UM8A 3CCVB 3KB1A 1ESNA 3KKOA 2O8DB 4IRUB 4RJLA 4QRHA 4BWYA 4ZKDA 1SULA 3R7WA 4QC2A 2BBSA 3RANA 4F91B 3F8TA 5AUPB 4FMCB 4E22A 4KCGA 1RW4A 1EP2B 2QBYA 4JT4A 2GHIA 5J40A 2P6RA 5EJEA 1E2NA 2QM8A 3THYB 2VF8A 2FZ4A 1NIJA 3L0IB 2QAGA 1VHLA 4LGMA 4OI4A 5FBQB 5HCNA 3Q5DA 2G9NA 4C0HA 3TGPA 4TYWA 5FA6A 1VYVA 3A4LA 1S1MA 3WRXC 2CNDA 1XRJA 2D2FA 3TQCA 1W0KA 2C2HA 2BCGY 4HB2A 4I1SA 2C99A 1YR7A 4EPWA 2PJZA 2FF7A 1LB1B 3QENA 5FBRB 1FW6A 2ASEA 1T3HA 1E2GA 5EUMA 4IXMA 4YMTA 2R65A 2PZFA 3LVBA 1GNQA 4Q4HB 1US8A 3RS7A 5KSOA 3J81k 1VCMA 4AK9A 4HAWA 1YZQA 4WAUA 3PV0A 1N25A 1EFRA 1ZD8A 4FMCF 1KDTA 3CZPA 4B44A 1E2EA 4V0ME 2V9PA 3EPKA 2OCPA 2QPOA 3EZ7A 5HKKD 1Q82D 1TQ6A 5GV7A 3C15C 4IDQA 5M04A 3K9NA 4LOAA 3O8DA 4XSHA 3RDPA 3QF4B 2GCOA 3P1JA 2EQBA 2GESA 4P33A 3ZVLA 2WMOB 4A6PA 5JFGA 3I5YA 3I61A 4PZYA 2V4ZA 1E0JA 1A2KC 2ATXA 2BBWA 1OYWA 5JEEA 2AX4A 2Q9AA 4B6EA 4BUJA 1AA9A 3QKSA 2YC4C 1P2UA 3X2SA 1RJ9B 1Q1EA 3CCEB 3G0HA 1F2TB 2NZ8A 2QP9X 4YALA 3GLFB 1UKEA 4PGOA 1TUIA 5G40A 4IDNA 1JB1A 5A0FA 5P21A 2F7SA 4O2RA 1QHHB 1NKSA 1TQ4A 2P5TB 2ZYUX 1Z0AA 5GVSA 3KXLA 4AY2A 2CEAA 4Q7LA 2X77A 4KSBA 2IS4A 4L9SA 2ZI5A 2QQ0A 3RS4A 1T5IA 2QORA 3OW2B 1EXMA 2A78A 3VO1A 3FDIA 3SDZA 4TYQA 4O0MA 1XWIA 2J1LA 1RPZA 3TSZA 3U3RA 2XZLA 1ZYUA 2NO9A 2YKGA 5H59A 3VQTA 2ZI7A 2W00A 3LLMA 4F38A 5CDFE 2QSZA 3B9QA 4LPKA 5EP1A 3GJ5A 2FX3A 1FZQA 1LS1A 3BH0A 1UBCA 1W35A 4XWAA 1MT0A 4PTLA 2O8CB 4WZ6A 2BC9A 1VQ6B 3THYA 3OJXA 3LBNA 1D2MA 3AVYA 3K0AA 2ZEJA 1K5GA 5KUTA 3U7HB 4PC1A 2QU8A 5DH9A 4ITRC 2PT5A 4TMWA 1XFAA 4FN5A 1K8AD 2ZJAA 5BN3A 2IYVA 4OQFA 1NY5A 4PXAA 4PFSA 5HTKA 2NMVA 4AYTA 4QNRA 1UEIA 1ONBA 2OAQ1 2LCFA 5CITA 2OFWA 3W2FA 2VRWA 3D31A 5FPSA 4M0LA 3KUDA 1U8ZA 4QBHA 1W36B 5TR9A 2CL7X 4ABYA 1LY1A 3VR6A 2L0XA 2XNSA 4QBIA 4UXJA 2W2TA 2VPPA 3CKLA 3FKQA 3WBKA 4F93B 4QKQA 5BW8A 4DDTA 2RGNA 3EWAA 2AN9A 2ONJA 1S2MA 2R6FA 4GOKA 4DQKA 3ZC3A 3QBTA 4I1VA 4MRSA 2CE2X 1IN8A 1U90A 2WJIA 4L5BA 1GNRA 4B48A 2MSEB 3AKEA 1R8QA 3PJRA 2BHRA 2VHQA 4F4IA 3LV8A 4MRRA 1BMFA 2H5EA 2QA5A 5CM9C 3K0FA 1XPUA 2A5GA 5JWHA 1S9HA 1KZ7B 1OXVA 3GJ0A 5GADl 1ZD1A 5FR2A 3RC8A 3TMKA 2DPXA 5BN4A 5FH9A 3A6PC 4DSNA 1D9XA 1PZNA 2AWOA 2FEMA 4G1VA 3BOSA 3ZBTA 3PG5A 5C18A 2IUTA 2J59A 3PUXA 3CPJB 4RKEA 4A6XA 2YOFA 2AK3A 2C5LA 4MKIA 1UEJA 4H9GA 2CHQA 1KO7A 4LYJA 4LV8B 4W5JA 4E07A 3ZD7A 4L15A 1D6JA 3SOPA 4NMMA 1JR3E 3GLHE 4KFTA 1G1MA 2ODNA 4IOKA 4DT1B 1DBSA 2F6RA 2AWNA 3QEJA 3AP3A 3LXXA 1XJCA 2H17A 3Q7QA 3QXCA 2X3UA 1VIYA 4PHTA 3ND9A 2GK6A 3MWYW 4V02A 3BIFA 1VHTA 2WV9A 4OYHA 4BZPA 4HLUC 1Z63A 4QBGB 4W9MC 4G5RA 4OK6A 1CNFA 1YRAA 1AS2A 3DO6A 2PMKA 4GOJA 2KWIA 2QN6A 2WSSA 1NG1A 1VIAA 1G8GA 3N5CA 1KY2A 1F48A 2J3EA 2HEIA 2YC2C 1N6PA 2VTKA 1EFTA 5FI1B 3B1YA 1P61B 1N6OA 4EQ6B 3SR0A 2HT6A 5FUVA 4WQMA 3A4NA 4A1FA 4CW7A 3EIQA 4GT1A 1WBBA 1HA3A 2J5XA 4DWJA 3FVQA 1BX0A 2WPDA 2C9CA 2O52A 4M1YA 2ZVPX 3ZH9B 5AK0A 4Q19A 2BBOA 4CEJB 5KSYA 3AEZA 3DPUA 4G1BA 2VF7A 5FOVA 1OFHA 4P3YA 1QHGA 2WAYA 2CJWA 4B76A 3W2HA 3KJIA 1OF1A 4NE2A 4FWIB 4B3DA 3V76A 4E03A 5JS8A 1F3OA 3ADBA 2WOOA 1DADA 4GBMA 1X6VA 3C7KA 3UKDA 2JJ2D 1OIVA 5JWRA 1HYQA 3CR8A 4GMDA 1P7CA 4DRZA 5JS7A 3KQNA 4NYJR 3G6EB 2JCSA 1E69A 1NN3A 2BEJA 2HMAA 3T12A 1G18A 3C41J 1N5KA 2Z4SA 3SU8A 4PAOA 4CZ2A 3PXGA 3MWLA 4IHQA 6Q21A 4LHZA 2IYQA 1O87A 1Q1ZA 3BFXA 1X3SA 2Q9BA 4HSEA 4EUNA 1LNZA 2CJWB 4G01B 4HZUB 1WP9A 5TB5A 3TJZA 3TUIC 3W34A 1BJKA 1ZC4A 2DR3A 3DOFA 2R6CA 1GOTA 3DL0A 2J9RA 3GJ7A 4AWXA 4E09A 2WVJA 1G20E 4PHGA 1DG1G 1G4AE 2J45A 2ZI3A 3CONA 121PA 1VYTA 4XWKA 1VCIA 4W7SA 3DKPA 3B1VA 3U3JA 3GFOA 2FWRA 4OQNA 4Q7MB 1TQDA 2ZQ5A 3SBEA 2KB0A 2BMFA 1NMXA 2XSZD 2QTVB 3H84A 2HYIC 4KYUA 5A4JA 4Y0AA 1XXHE 5LDDC 3K0SA 421PA 2V3CC 1XEWY 3QKRA 2EFCB 4EIWA 4US1R 4OKSA 3GLGA 2V54A 1M34E 3W5VA 1E2HA 5CK5A 2RGNC 1R5BA 4XD7D 4I1UA 3AVXA 5HE9A 3FFBA 4D0LB 1CJUC 2IYTA 2ZRJA 2RMKA 1VG9B 1XMSA 3PEVA 1MO5A 1OYYA 1PUIA 1YZTA 3L8ZA 4NYMQ 2ZR9A 3SYLA 3MG9A 1FQJA 1OFUX 2ZE8A 2J0UA 3ZVMA 4Q5IA 4PZLA 2ZRAA 3WMGA 3U4QA 4IDOA 5AUOB 1JAIA 1KK2A 4MYHA 3T34A 3QSYA 3TLXA 4LJ9A 4R2HA 4G5OA 1U0HC 4DHEA 1K9MD 3K09A 3UIEA 3U5ZB 4KLNA 4X8LA 2FSFA 2QAJA 1NF3A 3QVVA 1NP6A 2IF0A 3D3QA 1QX4A 3FHTA 2GVZC 1ZM4A 3QKTA 2OFXA 1QFYA 1F5NA 1Q3TA 4TMTA 4QHYA 2IBMA 3BBPA 1IHUA 1EFHA 4I1OA 3I4LA 3VAAA 1DEKA 1L4YA 1KJWA 4Q02A 3C8UA 1N6NA 5D3QA 2RC5A 3FKSA 3GLIE 1EGAA 4JVLA 3C16C 3I3SR 4KXFB 1IJEA 4GMXA 3U7FB 1JJVA 2IXFA 4Q1DA 3UPUA 4TTRA 3CWQA 1QHNA 1YJNB 1BX1A 3GJ4A 2RGGA 1XBTA 1W2GA 2ZAOA 1E96A 1W7AA 3AV0B 1ZIPA 3W2GA 1GG2A 4F4JA 4PHFA 5KSPA 3ADDA 5TMPA 3ZYCA 2VZLA 3ZZUA 2RKOA 2XTNA 3LRPA 4XVUA 4WZAE 1Q7YD 5KDLA 1V5WA 1Z6XA 2A3RA 5AJYA 5LB4A 2CLSA 4L4UA 2ZANA 5DE3A 3T1VA 2BBTA 2NTYC 3I8XA 1QBKC 3CPHA 1EFRD 4LJ6A 5JCPA 2GF9A 1NY6A 1NJFA 1ZRHA 2RGXA 4CT4B 3CMAB 2OSBA 1QGAA 1JPJA 4FMDB 1LVGA 4P31A 1E2PA 3K09C 4CYMA 4F7DA 1AZTA 2FNAA 2XJ4A 2DYKA 3EIHA 5FTNA 1G21E 5L3QB 3EPJA 2GXQA 1ESMA 2PH1A 1Z83A 3B5JA 2C77A 1OXTA 1H8HD 1E9SA 1Z47A 3OE7A 1ZU4A 4YONB 3W6NA 3IIMA 4D4LA 2G3YA 4H1UA 4Q4AB 4DEYA 1NSTA 2QPAA 1N6KA 4DB2A 2JJ8A 1T0HB 5KPDA 3HJNA 2ZRLA 4B33A 1R0WA 3A4MA 3B13B 5L3SB 4AC9A 1E0SA 4PC6A 2XX3A 4Q18A 1OLOA 4Q03A
chains in the Genus database with same CATH superfamily
2ZTVA 4WMLA 2OCBA 3SIRA 3W3AH 3HO1A 1YNSA 3O82A 3R3HA 4I81A 2TMKA 2Q2NA 1ZNYA 4AYXA 1R15A 3WWPA 2PHZA 5E7QA 4C3VA 2QXYA 1TYBE 2E4XA 5H0IA 1K9VF 1T1JA 2B4KA 3CQ9A 2YQ5A 1TZ2A 3ELWA 4TL6A 4XCXA 1USVA 4IIBA 4O29A 3ZE7A 4B32A 4XCVA 3PDCA 4PYRA 1LI5A 2O06A 3PGA1 1MAVA 2HI0A 3G2HA 4WXYB 2R96A 3GP5A 3ES9A 2OXRA 1RCUA 1J07A 2V7BA 4MR8A 3QG1A 1YACA 1ZD3A 4CM6A 2O23A 3PD0A 3RVBA 3V32A 3CUWA 4BX8A 5HILA 4KI7A 3O8LA 2IZ1A 2P9QA 2NU9B 5FNZA 3CUTA 5E6RA 2DT5A 4K03A 2EIXA 1ODLA 1KS9A 4F56A 5JS2A 5BR1A 3RRJA 3EHEA 4EECA 4TMYA 3UJ3X 5JBIA 3CVWA 5GJBA 3WWOA 3P20A 2GXAA 1E3LA 1KOFA 4BO6A 1A9XB 2P9GA 3BMOB 4HAIA 1UD4A 5IVIA 1P4MA 2DWUA 1YIJB 1I2CA 2NQ8A 3CH4B 3UJBA 2FQ1A 1NT2A 2V6FA 5CB8A 3HCBA 3STVA 5C37A 4LI0A 3HR7A 3BMXA 5LQUA 3S3TA 1CE8A 1VBMA 2FF5A 2HPVA 2EKDA 1SXHA 2F9LA 1PN3A 1QQ6A 3AF4A 3D0KA 3PWZA 1N57A 4YRDA 1FYVA 2YJNA 4NDAA 5FX2A 1N1EA 4UCWA 1NGSA 5DISB 4MIYA 2C5HA 1CDDA 1XFDA 4L0MA 2WHXA 3L4EA 3N2ZB 4ZD6A 1N34B 4Y2HA 4ECAA 2WF9A 1IWOA 3AETA 5CFPA 4H6VA 4ARUA 3R6LA 3REQB 3WISA 4KQJA 1DFGA 2D9RA 1DT3A 1GIAA 2D7JA 4M8KA 2R751 5THQA 1W94A 4D56A 2L2QA 1MF7A 2VDPB 3GV0A 5IC5A 3K31A 1GL9B 4M0CA 4YMHA 4DS3A 1WVIA 4CQLA 3EIWA 4YRIA 4R3UC 2O0HA 3D8UA 3GN1A 1IK6A 3EARA 4FHCA 1AG9A 1PT6A 4UMDA 5EI5A 4K5QA 2UVPB 1DXQA 4TZKA 1GQSA 3BERA 3AH8A 2Z0MA 3PQCA 3T6KA 1XJQA 2HIGA 4CR6A 4DCJA 2Z8ZA 3TJMA 1FIUA 5HM6A 1CR1A 4D9IA 3HSYA 1TKAA 1VL8A 3AJRA 4TRRA 1T0JB 4AMZA 1YQGA 3SS7X 4ETIA 4YHHB 3I9V1 3FOEC 1BDIA 4JL5A 2WKPA 4I5GA 1VB5A 2P4EA 3MT0A 3WKBA 4AZSA 2X8JA 5HCIA 1JF8A 2P27A 4I9GA 1DEXA 1LVUA 3AHEA 4MRNA 3AUAA 5CJPA 1RM4A 4B6GA 4WINA 2O2ZA 3IR5A 1Y1SA 4WDRA 4PRYA 4GOMD 4W8HA 2F1RA 3L6OO 1HEUA 1R9JA 3RARA 3EDRA 3T61A 4NKRA 2Z58A 4IF4A 2XPCA 4WE3A 3ZZNA 2FFHA 3RADC 3BX1A 2AW5A 1WUKS 4M89A 1XD2A 3NHSA 2QTWB 1W1IA 2ZJYA 3DWIA 2E82A 3FYHA 1A88A 4TWIA 4KFSA 3FOAA 5FUMA 1RBMA 1FRQA 1EB8A 1EDEA 3CBGA 4KWTA 2O7QA 4EPRA 2PS9A 4JT8A 2GERA 2WBLC 2QNBA 4CM3A 4JLOA 1SBZA 3JSAA 1ZONA 1P29A 4MWZA 5ARCA 1N2SA 1ZBDA 3A4YA 3LO5A 4JR1A 4R8RA 1ZHHA 3A1EA 3P27A 1NMQA 3M81A 2CUNA 2C2GA 2RHRA 4KO3S 3S2GA 4LDQA 4B6OA 4BU0A 1U8CB 3GT7A 1TKRA 3BUSA 2Q3FA 3KVYA 5EP3A 4ESOA 3RS3A 1JIIA 2AFHA 6ABPA 2RSLA 2PZGA 5JAQA 1RBYA 3KYCB 5KAMA 4UTRA 3LAWA 2Q6LA 4J0KA 4TSFD 1HQDA 1J0AA 1GNLA 4P5DA 5A5DA 1BXRA 5CURA 1MKYA 3L8EA 3B6EA 1CQJA 1II8A 4BECA 4DMGA 4I8DA 5F4OA 1XZMA 4UXIA 1BH2A 1ZHOA 1ICEA 2ZYRA 4UM7A 4YJ3F 5T41A 1FJHA 3D8SA 2X1HA 2PUVA 3NTOA 4F72A 3KJQA 4RLFA 2WTNA 3FPAA 1MJNA 2YV5A 3G23A 4LQ4A 2BGMA 4JITA 4U7FA 3BL6A 3BCRA 3LI2A 3UVEA 5JCJA 5JRZA 1VKOA 2YMLA 5A03A 4L4YA 1OWMA 2P3LA 3D7SA 2FZLA 3CEAA 2IOFK 4YJDA 3UYKA 1DX6A 1RAGA 1KO4A 1XNHA 5K6TA 1M1YE 2JFNA 4DVJA 3JQ9C 4JEIA 2QQ5A 3SHQA 2A7XA 1Z74A 3DLPX 3EVNA 4KIFA 1LPPA 1I4DD 3JYPA 5E0OA 1ORHA 5DSTA 4CIYA 1PYDA 1F38A 5ARDA 3ZV6A 2BGRA 4AJ1A 5JNVA 4G41A 1WD5A 5BMVA 3I73A 3FB1A 1O96B 2Y3IA 3MWDB 4Y2VA 4HX5A 3SXUA 1P7WA 4ARSA 2ZRCA 4HLCA 2IXDA 3AVWA 4Y2UA 4G7XA 1ORDA 2OZLA 2XITA 3OQHA 3Q6IA 2D54A 2R4UA 3AU8A 1PGNA 3E35A 4LDPA 3AKYA 1BAPA 4BLOA 4YVFA 2VH5R 4FHZA 2WJJA 3DMNA 4IGAA 4HDRB 4BS9A 1KAOA 2VNHA 1DEHA 3AB3A 3UF0A 2VTDA 3U4IA 3WWZA 3DOCA 4JR2A 1U6IA 1QMPA 3K4HA 2NXCA 3L77A 3N0VA 3WGMA 3CH6A 3KTOA 3PFCA 4Z4HA 2BEKA 2YY6A 4PC2A 3PHBE 5C7YA 3QY0A 2OBLA 2HXSA 2V1XA 4JH0A 1K6XA 4EI7A 4NRDA 4LMRA 5SZKB 3OP1A 1NQWA 2RHLA 4R7GA 1RKXA 2HFJA 4LYAA 4XGRA 3OHMA 4YMSA 2WABA 3AYXB 1BD3A 4N3CA 1POWA 4D4IA 2DKNA 2H1WA 2PBRA 4F9TA 3WS7A 3IQIX 4P4NA 4S0XA 1ZZGA 2ZI4A 3M1AA 5AVYA 1SXGA 3HR8A 1T6BY 4JC0A 3IVGA 1GV1A 1CYDA 2KVOA 1NRJB 3UV7A 1HOXA 5JJ5A 3A25A 4C9BA 4X0EA 3I53A 1I3CA 4MVYA 1FP2A 1SHJA 3DNPA 3I62A 1G19A 1GY8A 3I28A 2PKRA 1AZSC 4RTPA 4LPSA 2QRGA 5A9RA 3OFKA 3I2GA 3WQBA 3AFHA 4HWTA 2DGDA 2HUPA 2Q3DA 4EG0A 1DCTA 3OJ0A 3CLKA 3CNQS 4O2BF 2HSEA 2PQ6A 1C0LA 4EL5A 4J0IA 1E4EA 5CIWA 4YTEA 4BRZA 4Z8XA 4FK8A 3CGWA 1XWFA 2XUQA 4B81A 1LPNA 4MQLA 1CG6A 1XU9A 4IEFB 1HX7A 3PEWA 2V5UA 4NZ9A 3G9XA 2WQ7A 3QVGB 2NAPA 2PMBA 1EX6A 4H17A 3JU4A 3A36A 3EA4A 1L5VA 4KBFA 2HMSA 2VDWB 4MKFA 1KAHA 1J23A 5KQSA 1S2IA 1BKDR 3PFIA 4QDUA 3ET4A 4IFEA 2D74A 3BSSA 2HKIA 5DHUA 1SKYE 1Z73A 2AG8A 3ZLTA 3T7IA 4YRSA 4YMIA 3W1WA 2P4QA 2B1IA 4U9IS 4YCNA 3TZKA 1XQ1A 1CJVC 4KXVA 1JA9A 1CW2B 1O97C 4QEZA 1R4ZA 2P6NA 3ETLA 2M6KA 4AJ9A 4XM3A 2HK6A 1GPYA 4GUAA 2FPOA 3MBOA 3KLNA 3ECAA 1A8QA 2ZI9A 1YZNA 4WDQA 1PG5A 3T1NA 5TXGA 1OBCA 1ZXBA 3MWEA 4ZP1A 3H75A 5ILGA 3BRQA 3LXUX 3CF4G 4I4NA 2ZE7A 3HGMA 3M49A 3KO8A 1GQYA 2H7CA 2HQ1A 3IPAA 4A0GA 4MYUA 3L40A 4TLBA 3EGEA 1P1HA 1E9EA 3ADPA 3GCWA 3U19A 4MYSA 2I99A 3PRYA 3QU4A 2FUKA 3Q39A 3AZQA 3SJPA 3PICA 1QXSA 4A0RA 1Q1AA 4QVAA 4OF4A 1VPLA 3E1SA 5LQAA 1NXQA 2ZTMA 1COWD 1S2OA 3L7DA 3M5PA 1F1BA 3ON5A 4N7MA 4Q3BA 3JQCA 4U0KA 3RTCA 3UHOA 3ZZMA 1WCWA 5JC1A 5J1TB 5FEMA 1YQQA 3J7AC 1QKKA 1JR3A 1X7XA 4OB7A 4C5BA 5FWAA 2EJCA 1ZCAA 3LOQA 2X2EA 2YCLA 3F8WA 2ST1A 4O63O 2P67A 1QLJA 2V7WA 1KQOA 3CJRA 4RV5A 2O57A 5BOVA 3SQOA 4GMFA 5BWOA 1JIQA 2EL7A 2FZVA 4CT0A 3QNWA 5KYYB 5F2OA 2Q0QA 2OECA 2VHEA 2ZAGA 5HJEA 1WW3A 3AEQB 2ZWMA 1J25A 1V4NA 1SKBA 5HXBA 1KHHA 1RYHA 2A0UA 2DQKA 1WXWA 5IP5A 5BY2A 2A58A 1DT5A 2BLNA 3R5TA 3NYQA 1XKTA 2PKCA 4J1QA 3RRYA 4DRYA 5E7JA 3MINA 4GUDA 4NU5A 4HKTA 1UD3A 5EHNA 1KA9H 1ZUHA 2DUJA 4YR9A 5HZKA 2FY8A 1W25A 4AG6A 3NNDA 1ADFA 1OXMA 2VHTA 3H4VA 3HUDA 3TWOA 4YXWD 3OCUA 2ZRGA 4V38A 3WWEA 1MXFA 4QUDA 3ROGA 4WY5A 4W5NA 1SVOA 3BN3A 3CLVA 3PXBA 4YFYA 4I6EA 2ZUWA 1JJIA 3P9NA 1NQUA 1WF6A 2PKEA 4JASB 3I3OA 5E9JA 3VC7A 3WMRA 4L9AA 5EJGA 5KTRA 4G0WA 1HO3A 1NLUA 4BB0A 2IV7A 4G5SA 5KYGA 4DJDC 4OUDB 1A8UA 2RGCA 1Z12A 4V0NA 1M2FA 1U4SA 1ECCA 4L95C 5GJCA 3R74A 1NRIA 4O4JF 3SBOA 3W7AA 3I92A 4ZA2A 2EG5A 2NMVA 2JFHA 2QZSA 3W3AD 4NJMA 1IZ9A 1ULSA 1KSGA 4FB5A 4G1FA 3BZUA 4K9RA 3KQTA 5IYQA 2PU5A 5K3SA 3CLRC 4V0SA 3NGLA 4BYMA 2ZYSA 4KQCA 2VQFB 4FYXA 4TYYA 2A7QA 1HEIA 2Z43A 3OQVA 1H42A 3IE2A 3Q0IA 1OR8A 3RS5A 2ZJOA 3UUWA 4BGUA 2PPLA 2BE9A 1JWAB 2EW1A 4LUCA 5T67A 5A4DA 5L3SA 1VYHA 2C3OA 3GEDA 1CR6A 1ZIDA 5LOVB 2C98A 3DZDA 3HTXA 2E48A 3TS1A 3D2LA 1Q81D 1F2UB 2W2QA 4FC6A 1CRQA 3Q2OA 1G5PA 4ZV9A 4OUDA 3EN0A 2VATA 2PMFA 2C4NA 3V1LA 3A28A 3Q2IA 3OJLA 4QOEA 4CM9D 5CA1B 2DLCX 1D1SA 2WNIA 1R0CA 2R85A 2YVLA 4MVJD 5CLIA 2P9TA 2OBRA 2Q3BA 5B1EA 4O02B 4OMFG 3VYWA 2E1PA 1XEWX 3E8XA 5KYWB 3DFKA 4GECA 5DI3B 4HAUA 2YXPX 4BPBA 4UTXA 2C1EA 5THKA 5IMSA 1EXNA 4C4TA 5B2ZA 5A5EA 5AW3A 3RR2A 4DV7B 1TXGA 3GLTA 2I65A 4ODIA 3P9QA 1QPBA 2VPYA 1CUJA 1ZIXA 1VE7A 2AVDA 4PPGA 1EHIA 1RR6A 2Z6VA 4TQUS 1VQOB 1IY1A 1FX1A 2QZ4A 1BE6A 3FI0A 4QFBA 3REOA 1AH2A 1Z75A 3PHCA 3GZNA 4DNTB 3MIIA 1DDGA 1KPHA 3MHTA 2ZZQA 1KK0A 3RHFA 2NUPB 4LYHA 2VJDA 5GONB 5EKTA 4EQ6A 1Z4KA 3OIGA 3AR4A 5HOEA 4W5OA 3ZDCA 2QIPA 4JMQA 1CY4A 5K8TA 4OGWA 2DMRA 3HCWA 4RS3A 3H2IA 5KNLA 1KMQA 1IMJA 1BC5A 3GFPA 3RFFA 2IHJA 5CT9A 2ODAA 5JCOC 4UUMA 2IBSA 2JGMA 2ZRHA 3LBHA 5A1JA 4WOCA 1P0QA 3FKJA 4TPKA 2YZNA 3ZDBA 2AOXA 3T53B 1S96A 4OHKA 4JQCA 4CQMD 5F3DA 5D5QA 5CM2Z 3L7JA 1Z28A 3UAXA 4PWYA 3VDNB 4EP1A 1N8KA 4JN6B 4YP6A 1WDKA 4UHBA 2MSLA 3H11A 2BGTA 4CKBA 1UOPA 4HAVA 4PTYA 5F73A 1F8XA 2B3TA 5PGMA 1JDSA 1JEQA 1ODIA 1YOBA 4MGYR 5KKCA 3VJLA 1FSGA 1XTRA 2JD0A 3LKVA 4OHUA 3WIOA 4C03A 3JYQA 5FNVB 3BWBA 1TDJA 3JW8A 4KE6A 3E9QA 4GPIB 1Y6ZA 2AD1A 3NHUA 4QOSA 2N3ZA 4YRZA 5I9TA 1SPBS 3K70C 1FBNA 3BAFA 1YRBA 4Z1MD 2H2AA 1ZWLA 4YC7A 1F2DA 3CJTA 2PYIA 3L8DA 4TKLA 1OH7A 1VJSA 1K75A 4MI9A 5JG7A 4B75A 1V1MA 3BFPA 3OJOA 5AKLA 5DPMA 5ANRB 4HEHA 5JFOA 5AHKA 4MW2A 1HM5A 1I5EA 4CTNA 1KU6A 1ST2A 4JS0A 2EFHB 2ZUCA 1XZAA 1Z2OX 1WCYA 1DKRA 4MWGA 3SDBA 1NP7A 1GWNA 3WRXA 4CMAA 4F21A 4YV2A 1CHDA 2DEUA 2WFMA 2L17A 3CLSC 5MGBA 3SNKA 3B8HA 1SAYA 2OGWA 2G0NA 2QP4A 3WK7A 1EIWA 4TWAA 3WWDA 3ZE8A 2PCLA 2RJ3A 5DBOA 4CM4A 3M83A 3VUFA 1DQYA 3QSGA 1AKUA 4XSGA 4YEJA 1U0JA 3WLAA 1R6BX 4OIMA 1G8HA 3KOYA 4RJTA 5C5EA 5K45A 2XVZA 5FL7D 3BEOA 4X7CA 3ECSA 3KUUA 3MS4A 4DXDA 2XA1A 1Q0RA 1M66A 1P33A 3UH1A 2OAP1 2IFTA 2OO7A 3LRTA 3TNJA 3A2LA 2Z57A 5G4LA 1GFSA 3W9SA 1JA0A 2C4TA 4Q9NA 5E1DA 3HJUA 3KXIA 1S5PA 5E6SA 4E5SA 9MHTA 1XAIA 2JS7A 1KARA 3LT0A 3O3NB 3V3TA 4RPDA 2IDKA 2UVQA 4NP6A 5LFAA 4LK3A 3DMDA 3PTZA 2HHHB 5F4BA 1E94E 1PBTA 1UKZA 1Y5MA 2G09A 1TZMA 2GXSA 4MPJA 4MMYB 5DNUA 5E38A 3RU9A 1NVUQ 3KPYA 3LX5A 1DEOA 2F3TA 5IH7A 5JBQA 2ZXUA 2WDZA 2ZJ8A 3KZVA 4XWYA 2O2JA 4DBZA 4MV9A 2Y1XA 1OD6A 1RZVA 2ZCJA 3IXMA 1J1UA 1QVGB 13PKA 4JLJA 3F5MA 5KWVA 1SXJD 1AKMA 2H08A 1P62B 4UAJA 2QUJA 1TUBA 5DP1A 2VI5A 1RYZA 1DNPA 1XZPA 2JAHA 4NFLA 5LD2C 3KVOA 4CN9A 4G85A 1CJSA 1YZUA 3FPCA 4LGVA 3JQDA 2ZS8A 4XIYA 4COKA 1VMKA 3AF6A 3EVZA 3SQMA 2J67A 2OT3B 4P7KA 2HK8A 5LR6A 5HX7A 2ZRIA 1MMFB 3FIUA 2R44A 1PJZA 3JD0A 2V7TA 2JIZD 3KSUA 3LW8A 3FNIA 5CVCA 4Z0TA 4XX0B 4NPAA 1GPDG 2GKOA 4KRGA 3T5GA 5FD8A 1R2QA 4CMIB 4FE4A 1QJCA 2Q99A 3DDNA 1TX4B 1ZH0A 1LRKA 1U0RA 2GX6A 1EAMA 1ZOPA 3SI7A 1GTMA 1KDVA 4ZYTA 1D2RA 1YTLA 2WM3A 1T6XA 1G64A 3C14C 1PJTA 4FFBA 4ZI5A 1EDZA 1EJ2A 2X0DA 2RD2A 1KVUA 1HYEA 3ZE1B 3UWOA 1OHHA 3ZXSA 2FE4A 5DFAA 4C0QC 4C21A 4ZYYA 2ATVA 5CXUA 3ER8A 4MUXA 3G8AA 1Z2CA 2VAWA 1K4MA 4K6KA 2V8OA 3ESXA 3BG5A 4MS3A 2BTEA 1JEOA 3C4JA 3BQ9A 1JZTA 4WOPA 4RDLA 3CC4B 4JB2A 2C2KA 2FPXA 4FMBB 4JLKA 3UT5B 1XQ6A 4UBMA 2IRWA 3G1TA 2ZU6A 5LQDA 5AJWA 3WLPA 3AFMA 1GKLA 4E11A 2EVWX 3VR5H 3WAKA 2ZSHA 3DULA 1RZRD 1RHRA 1DBWA 2EFJA 1WSWA 1CZKA 1JBEA 1PT8A 2I7TA 3A37A 3V48A 2UXCB 4U6SA 4U2BA 1Y5LA 4RM3A 3GD5A 1IL0A 3AHDA 1WUIS 2FR8A 4J91A 2WZBA 2FSHA 2OD7A 3KSBC 3I0NA 4F4CA 3M1YA 4BGDA 1XSEA 2HBRA 2B94A 2AFIA 1O9BA 1XRRA 1ZK0A 3BE6A 3WNDA 4G56A 2FMTA 1U8YA 2OAGA 2XA9A 3DZIA 4EEXA 1U4NA 1Q91A 4RETA 3OCYA 4B73A 3WYDA 4EFKA 2HLDA 1SCBA 4UEOA 4YRCA 2X5KO 1KJJA 2WMNB 5F78A 4CG1A 4US0R 2WIAA 2ZL5A 1CU1A 4AKIA 4MV7A 4YUYA 4C0LA 1UDWA 1O5IA 1UFVA 2Z98A 1G2OA 2JDIA 3LUFA 2P9EA 3N2NA 3HRHA 5EWMB 3W77A 2E87A 2YJZA 3BK1A 1FEZA 4X06A 3RVKA 1M72A 1ZINA 1UIRA 4B7XA 5E7MA 3VRHA 3HJCA 3E1GA 2WZCA 4DKXA 2ODQA 3IEVA 5DM0A 3GNQA 3FJYA 4A5SA 3ADOA 3GRYA 1MHTA 2H4ZA 3L1JA 4I19A 1QHSA 1YTUA 5D87A 2VDMB 3KS9A 3L4KA 2GTHA 3WL7A 1TCUA 2ECOA 2JI9A 3JZDA 2GEBA 1I4TD 4YMVA 4XB1A 1E1QA 1W19A 1XL0A 2X6YA 2FB9A 2HK7A 2VQEB 2H0AA 2J0EA 1USKA 1GPAA 2P8SA 4FYJA 2VEDA 4LSMA 1XMIA 5EMLA 3DAHA 2FN4A 4IZHA 3SX0A 1G6KA 1UT8A 1VJTA 1Z0UA 4HGZA 1FFDA 1ZMOA 3EAQA 4LRSB 4HZUA 4S2UA 1P9LA 1DC4A 1YHNA 4XUCA 3EH1A 2IUFA 2FQYA 2JVKA 3QE0A 2HDOA 4QXMA 1RAFA 1NI4A 4YMWA 4AS3A 3SS9X 1DWOA 2Y99A 5BN3B 4OTZA 1E6MA 1QNFA 5GY7A 3SX4A 3OU2A 4OJNA 3V8VA 2QZ9A 3K72B 3KPVA 4C0WA 1O77A 4P9NA 3U3DA 5KNBD 4EARA 3GXOA 4RPHA 3QVMA 4URHA 4EJFA 4IJVA 3GVIA 4UHFA 4Z4CA 5K0EA 4WADA 3AHFA 3B6MA 3LGXA 4OSOA 1OQAA 1XD2B 2YWEA 1WXHA 1NV8A 1LLUA 1H1LB 2EKPA 1CCWA 1D9ZA 3I5XA 2GBGA 4ARVA 4R16A 5J5CA 3OP4A 4KMOA 2Z9BA 3GDFA 3LTEA 3K0CA 3MPUA 3GELA 4FT4A 4BO1A 3EZ6A 3T9CA 3OQMA 3A9UA 4I5IA 1S01A 3H1TA 5TMEA 1B3RA 1CZHA 1Q92A 2DBYA 1UZMA 1F8YA 1Y5NA 1O57A 3PIRA 4JL6A 4RTSA 1RLOA 2Q0HA 4KHZA 4ER5A 3IEMA 3GAZA 1IY2A 2IA5A 2ZXIA 3QXHA 2BI7A 4HQ0A 2X8JB 1L4MA 2G67A 3JV7A 1XVIA 3DXYA 3ASUA 4JBHA 1CSEE 4LNHA 5L6LB 5PNTA 4J3JA 3BF7A 4KDRA 3EC7A 2C42A 1ENYA 1U3UA 3F5SA 3KDPA 4LJ8A 5KOIA 2ARKA 1GUAA 1KI6A 1NOIA 1XKXA 4EW2A 4ITUA 2XZOA 4FOPA 3V7WA 4B84A 1HETA 4PYOA 4HPWA 4XPIB 1IDOA 2OO5A 3C7DB 3D3NA 2OCGA 3HJAA 5LQCA 3CZ4A 3PYLA 2O3SA 4ALNA 2I3DA 3A1VA 2I87A 3NBXX 2UUPA 5AI9A 4ZXFA 5B6IA 4B4OA 1NAHA 5H1YA 1L7EA 4QUGA 4W1QA 4IGIA 2LPMA 2IW1A 1V3TA 3Q7EA 4TUYB 1XVVA 3H2YA 4F6LA 3VX3A 2WIKA 3KU1A 4E5NA 1BFDA 1Q0PA 5EMJA 1YA6A 2EERA 1NT4A 3QU7A 3KG2A 3LHSA 3RIEA 5KJ1A 2BCEA 4Y2YA 1T2VA 3VZCA 5HW0A 2GDJA 3QUSA 4LNAA 4EOGA 4GEGA 1OV6A 3E2IA 2CFSA 1O6FA 2I1VB 4IMRA 3ZBQA 1RHQA 2YQ4A 4LZOA 2ZDHA 2WUGA 3ICCA 4X65B 1R4MA 4B3TB 3I55B 1VHWA 2X85A 1BHJA 4D7AA 4O4LF 5LBIA 3T1YB 3SJCA 1ENPA 3LZ6A 4EPXA 5BVHB 3R8FA 4PPYA 2XKAA 5CUQA 2GEFA 5CX1B 4EPYA 4RKFA 1RXWA 4GKJB 1ZVMA 2VNJA 1A5AB 3LIIA 1DAPA 4HGOA 1HDOA 2PQ0A 2VXOA 1OX4B 3I76A 3TSWA 3VR2D 4DSTA 4KLAA 4RD1A 1XLVA 4E2YA 3VTAA 5JXWA 4M7RA 3GMIA 4JJZA 2R60A 1ZY2A 2VTBB 2PCJA 5SY9A 1Z4JA 2FUEA 4KWCA 4QVKA 1QWOA 1U65A 4RDIA 2IIBA 1QV7A 4UQPA 5AVVA 4X6LA 2QYSA 1JFFB 2OVBA 2YH2A 3QW4B 4INJA 2Q1SA 4JQZA 3ZNOA 4C4PA 4E88A 4DA4A 3HCPA 4I1YA 1JJ2B 3AG5A 1JR2A 4BB6A 1SU6A 4IRMA 2CXUA 2XDQB 2ZR0A 3QKRB 1XN4A 3IEUA 4PAMA 3VPCA 2AZ4A 4QTTB 1RPTA 5KHAA 4Z1OA 1FMCA 2QAGB 4JKOA 1HC7A 3NNSA 1YGPA 3O47A 5KOHA 3WGZA 4HN9A 4V2UA 2XYPA 3NU1A 4YN3A 5BSWA 5HR5A 2D5CA 4EUSA 5IT9A 2UDPA 4ASUA 5E95A 4BRUA 1XZQA 3BDVA 4Q4DA 3ILYA 4CDRA 3LC7O 3ZLJA 4P92A 1G9XA 1Z0IA 3O84A 2I6TA 3ZIDA 1DQPA 1M0SA 2NPIA 5DP2A 1JE1A 3L4BA 2VJMA 5BVGA 4GNRA 2X4LA 4DV3B 2DKFA 4ZGNB 5H80A 1PG0A 2ZBFA 2C3UA 1NRKA 2IEBA 1P5FA 1IN6A 4BFTA 4NJMB 3ESBA 5AKGA 5TNXA 4BC1A 5A4IS 5J1SB 1Z4PX 4LMBA 4QPCA 1M90D 5EE5B 3VYVA 2VYCA 3X1MA 4G0YA 4C20A 4QODA 4GWGA 1CZUA 2NTNA 2YV4A 3F49S 5IC6A 4AWBA 8GPBA 3TNDA 5J3OA 1G291 2WVAA 1X9IA 1CUIA 3TIVA 1U5BB 4M60A 2W2KA 6PFKA 4KLZA 3DTVA 3NCTA 3WSVA 3JD1A 2JLQA 1M0WA 1I80A 1PJBA 2HCBA 3UUFA 1B6SA 2P2CA 4YA6A 1V45E 1W48A 4KAJA 3ELBA 4R54A 3OPXA 4X24A 5LNK1 1T2EA 2SICE 2FLWA 3LPDA 1IN1A 4YV1A 3PC6A 4RVDA 2APJA 3ZTTA 1XMVA 1LPBB 1TKCA 3EEIA 1TFUA 3GPDG 1QFZA 1HSZA 3N74A 5D3MB 2MMCA 3ULKA 3ZU6A 1FLAA 1PZXA 5I4CA 2ADMA 1N2HA 1SRRA 1N2BA 4MB2A 2OXCA 2ZTLA 3V8QA 2HOQA 4I4TA 5IEBA 5KQPA 4BEVA 2I6GA 3EGXA 4OGKA 5F7ZA 3LDUA 4ARCA 1M74A 1Y5IA 4QNMA 4AIIA 1AS3A 1GUZA 1NNUA 1DKQA 2WTBA 3ZWPA 1QHHA 1AIPA 2WZPP 3LPMA 4EUHA 5IF3A 2CYBA 3T5PA 3SJZA 1VLHA 3P2OA 3ZI7A 3D5TA 1W0KD 1K86A 1YHYA 3HVUA 5AICA 4C4OA 1O0CA 1OI7A 1P9OA 2FSVC 4LTMA 3GLHA 2P9JA 1TF7A 4YRFA 1YDHA 2H54A 3RSZA 5KS2A 1WPQA 1NBOA 3C0KA 3LNNA 1LDNA 2OY0A 3V4LA 1X92A 1UPAA 2GI4A 1J21A 2FXVA 4JLBA 4D46A 4GRDA 4W99A 4AP6A 1O6CA 2GASA 4ILEA 4NBUA 2PL1A 2XVMA 3NYIA 1ZR2A 1SUBA 4N65A 2JPDA 4R9UC 1DWPA 2YWFA 1GYPA 3AJ9A 4E2XA 4UTPA 4QGGA 2YNMD 3DYVA 1KDPA 1ZI6A 1REQA 1BQEA 4HUQB 1M8PA 1O1YA 1P9RA 2BF7A 1TJYA 1WMSA 2VDLB 5AI8A 4FBGA 5K4GA 2QTHA 1GP2A 1MVOA 3O3MB 4ZT3A 1KTIA 4M55A 2F17A 4B6PA 1JLLB 1CUXA 4JROA 2DKOA 2O3JA 4HCJA 1O95C 1Q7CA 1DQSA 3D2BA 4TV8B 1ECBA 3CRQA 1C9EA 2X19A 3DHEA 1EBBA 4UZEA 4P32A 2Z3VA 1UFKA 4PSAA 5A5FA 1ZP6A 3R09A 5FEUA 1C1XA 1J0DA 1QVFB 2VK1A 3BHJA 3AR7A 3E9MA 3ESDA 4HLNA 4E5VA 3C6XA 2QA4B 1GGKA 2J3MA 2VHCA 2ZT5A 1XZGA 2AEMA 2Q3HA 5HRUA 1FDSA 3H2JA 1NXPA 3HKBB 3HZHA 1E6UA 1TLFA 3WRVA 2DTXA 2DUNA 4R05A 2ZUBA 1AKNA 2CSUA 2YJ3A 5LBUA 4LEIA 4K87A 3D7RA 3JY6A 4LHVA 5CTJA 5L7YA 3BA1A 1NXVA 3WAJA 4R2JA 4LS3A 4RV9A 1JAHA 1IHYA 4JI7B 2Q5IA 1P1CA 2IYZA 3KJGA 1HFJA 3T7RA 5HGJA 1FP6A 4QV2A 1B00A 2ZJ0A 4EH1A 3G2QA 4DYDA 1P81A 3GP8A 1GL6A 1T3SA 5JD6A 3N2IA 2X22A 1UCFA 3DBLB 2FJPA 1W34A 1PFGA 1MPTA 3E22B 4BNYA 1LQTA 3F74A 4BJ5A 1YJQA 4QTXA 3D7KA 2ID7A 1L7VC 1BMDA 1E5LA 2H18A 5BSUA 1YR2A 2O3QA 3GFTA 1RTTA 2N47A 4R84A 3ONVA 3AJ8A 1DSSG 2Q2VA 5DDIP 2PVSA 3QYAA 2XB6A 1H8ED 5E0KB 1TTQB 4OI2A 3F9RA 4K28A 3V2IA 2Z2XA 3X1WA 3HBFA 4GF5A 1OROA 1LXCA 3R3ZA 3WA7A 1U11A 2Z5FA 1SRQA 2Q2OA 3CEJA 2HF9A 3BCHA 3LK6A 3WLNA 1RWBA 5L8VA 2GFQA 3FJ1A 3GNLA 3W6OA 4J75A 4RTRA 1BXGB 2FHPA 5FOXA 4GDFA 4B6QA 1T1EA 1EEXB 1UBHS 4IIJB 3E5MA 4ZYWA 4QTUB 1UL1X 4LOKA 5FWYA 2KI5A 4HWPA 3LGSA 1C9JA 5EFZA 1T91A 3AV3A 3PJGA 8ABPA 3PFBA 4W4TA 4MRMA 3L92A 1QVZA 3WHPA 5JXJA 4D26A 4PVCA 4J1SA 3VHXB 1BQ4A 2J41A 1GG8A 4XTRA 1F6WA 4CU2A 2JG3A 3GFFA 2VYVD 2WWIA 2QLLA 5JHGB 3AERB 3R77A 1LLDA 1ZUNA 1NM5A 3S99A 2VXYA 2X4GA 4IQFA 1DEAA 1U80A 2YV3A 2OXEA 5BPHA 2WVHA 4ND8B 4Z4UA 1Z6QA 2CEKA 3NHWA 4QHTA 3Q8LA 1ORVA 1PK8A 3IAM1 2JLRA 3F0TA 2G28A 5IDQA 3JU3A 3QFFA 3WZ2A 4FVTA 4OL0A 2QN8A 4M9ZA 4NL4H 4B35A 2I3ZA 4L3VA 4RMGA 3VC1A 3KKEA 2ZTSA 4WL0A 1XCGB 2RI0A 1ULUA 3OPNA 3UHFA 3CLRD 2QMQA 4LNUA 2QL6A 1E99A 1NJID 4U0JA 5C51B 1MRNA 3FWHA 1WDTA 1N5LA 2A67A 4LC1A 4PVDA 4A36A 4HPXB 3GQBA 1T9GS 2CJPA 2HA0A 1GA6A 4FIDA 5CLLA 1IZZA 2VT2A 1V16A 5IBQA 2PSHA 1SKQA 4XOTA 2QTRA 2IPLA 5MN5A 2CV1A 6REQA 2RAPA 4E70A 2Q0SA 1A77A 4R98A 5ICMA 2FVYA 4J3NA 5AM3A 2DWOA 2B21A 1Z37A 2ZYVX 2EW8A 2O2YA 3AJDA 3CNLA 4BASA 1RMTA 4MJ7A 2HEGA 4KSYA 4XD7A 1Y6RA 3LKBA 1FFEA 4IH4A 1TF5A 4ZJUA 3L82B 3QBDA 4X8IA 1HY3A 1Y4SA 1V95A 4LE1A 2D06A 2PGOA 1FRVA 4TTPA 2M6RA 5HG0A 1CF4A 5HE8A 2XBLA 5SYMA 4GKKB 1VL0A 3A6FA 2Z04A 2PA0A 1K06A 3AVOA 3JRNA