4RD1A

Structure of aif2-gamma h97a variant from sulfolobus solfataricus bound to gtp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGAEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 114
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd1A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd1A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd1A01
2P2LA 1EP2B 4TYWA 2GK7A 3Q3JB 1EP1B 4JSYA 2GCPA 2WMNB 2WSSA 3G71B 1XEWY 4L5BA 2HT1A 5H1YA 2VRWA 2J7PD 1JR6A 1Q21A 4RD4A 2LKDA 1JJ2B 2VH5R 4G5SA 1GDDA 4DDWA 2H16A 3F0TA 1AS2A 3LO8A 2GWHA 3KJIA 3U44B 1HY3A 4JLBA 4G5OA 3A8TA 4OK6A 1SKYB 4ZDIA 1FZQA 1HE8B 1EX6A 1NBME 2WJYA 1NN1A 2IF2A 3R20A 2VO1A 4A2WA 1XRJA 4XTCS 5HXBA 2LWIA 1WDTA 1FDRA 4AF6A 5TARA 2PMKA 2G0TA 3VNUA 1FPMA 1SVIA 4IDNA 3VHLB 3U7GA 2J0QA 4PO1A 3ADKA 1XJ0A 5JJIA 3DKPA 4C0LA 3X1ZA 5JI3E 1YU9A 4S35A 1R5BA 5H5JA 1UBFA 4L4UA 4P31A 3W9YA 3FKSA 3CLVA 4DJTA 1GUAA 1D1NA 2QORA 2J59A 1LVGA 1J99A 3CR8A 1QHHA 4BGDA 3W6PA 1XTSA 2GAOA 2MSCB 2HCJB 3GEHA 1Z0KA 1CIPA 1YZQA 1XCGB 1S2MA 4Y9RA 2KSQA 5B58C 1AZSC 1QZXA 3CCUB 1N0WA 1UBCA 1KO4A 4HLUA 4Z54A 1NVVQ 2GZHA 1HYQA 4M1YA 3QVUA 1J8MF 1B23P 1ZAKA 4PZLA 5TXGA 2P0EA 3DKVA 4IXNA 5DHFA 5GJVC 4LRWA 5EMNA 2CLSA 4WA7A 3BD9A 1IXZA 3O8CA 3W3AA 1R0ZA 4PZYA 5EP3A 3AGQA 2HMAA 3CWZA 4L15A 5FPYA 4B2LA 3QNUA 3I4LA 2QY9A 3AP1A 4CZ2A 2GA8A 2IK8A 2BJWA 4H1VA 4HDOB 5HKKA 1BYIA 3CRQA 4YC7A 4YMVA 3LH5A 2P65A 3ZQ6A 1B2RA 3OEED 3CM0A 2DHRA 4IVQA 1NDHA 1LTQA 2CNWD 1G3UA 5BYJA 4B43A 4MDEA 3GLGE 4K1XA 1FQJA 1BO6A 2JJ2D 5BXQC 3K70D 1VKJA 2OE2A 3B82A 3B78A 3BOSA 5GJWC 1YHQB 5E4FA 3O8RA 4AKIA 3J81k 2ATXA 4BFZA 1XPRA 3ZD6A 4LJ4A 3RRMA 4Z51A 4CEIB 5BN4A 4R2HA 5FUXA 5CB8A 4W5WA 1D2NA 1MO6A 4RFSB 2GILA 2IT1A 1I2MA 4LZZA 4DCVA 2OTLB 1U0LA 1YZUA 1UAAA 2QTLA 2JLVA 4LJ7A 3UMSA 2XZLA 1ESMA 4PX9A 1II9A 1P9NA 1YJ5A 4JVSB 2YOFA 1VQ4B 4HB4A 3TMKA 2BWJA 2QT0A 2RC6A 5KPDA 1FL9A 1H8ED 2HCBA 3ICQB 1CR0A 3KQUA 5BW8A 3EPJA 1VQPB 3GQBA 3LQQA 2IC5A 3LVQE 5JJKA 1FW6A 4A0RA 5BN3A 3C5CA 5FUYA 4IFBA 2AFIE 2ATVA 3EA5A 5FUWA 3KKNA 1HT1E 1AQUA 2WMOB 3V00A 2ZI3A 1C1YA 3CR7A 1F20A 1PZNA 3CCMB 4DSNA 5GVSA 4X8HA 2X77A 4ZDJA 1P5ZB 2GTPA 4LYHA 5EZ5A 1OXSC 3EZ2A 1DOAA 1KTVA 1IONA 5A4JA 4OKSA 4BECA 4BRUA 4LY6A 1W34A 3ND9A 1F5NA 2FWRA 1VQKB 1KI8A 1PLKA 4M4SA 1XWIA 3GLHB 4X8LA 5FR1A 1CJUC 4EJSC 3CONA 1KI7A 5LD2C 4BLTA 4EQ6B 1TQ4A 2KBEA 1G8FA 3I5XA 2WM9B 2H17A 4JVNA 5JWOA 4Q4HB 1G3RA 3WYGA 1E62A 4B3DA 4MKFA 4YDHB 3CO5A 1E9FA 3ZIAD 3T5GA 4TZ0A 4A6XA 1YKSA 2QP3A 4XVQA 1NF3A 3IEVA 4C0KA 2F3TA 1NSFA 4Q66C 3VHXA 3VX3A 3Q8XB 1KSJA 4QBFA 5FPSA 1TNDA 3WBJA 4GOKA 4Q9LA 1GAQA 4TYPA 3OFNA 1Z28A 3F8TA 5IHPA 5J4HA 4B71A 3AUYA 2HXSA 4G1UC 3IILA 3PUVA 1W0KA 1E4VA 2RCNA 3IBGA 2REBA 3B1WA 1DE0A 1E9DA 4G5RA 3VR4A 4CRWB 1JEDA 4DZZA 1RJ9A 4NP6A 2RGNA 1QG2A 1Q0UA 4RD3A 1DADA 3EARA 4M1SA 4D0LB 4F7DA 1D9ZA 3WNBA 3BFVA 4OBEA 3FFBA 2QBYA 4B6EA 3SZRA 3GJ6A 2ZAMA 3N2IA 3AF4A 4OQXA 4Q7KA 4H9GA 3OHMA 2BHRA 3AF3A 3THYB 4OHYA 3I8XA 4Q1DA 4HAVA 2VL7A 2VA8A 2ZROA 4IEEA 3MWLA 4Q4AA 2OHFA 3R8FA 1WXQA 1YJNB 2CDNA 4F38A 2AD1A 1S9DA 4LPKA 3KTAB 2FN4A 2ZSFA 3EA0A 4M1MA 2BEJA 5DSZA 1JB9A 2ZANA 2W2VA 3H4MA 1EFHA 3UG7A 1FNCA 5AUNB 1ANKA 2WJVA 1QUEA 3O47A 4BFSA 3OZXA 3ND8A 3ZVLA 1EFRA 4M1WA 3REFA 3PIRA 3IEUA 2ZE5A 2HJGA 1E1RA 1Q1ZA 4AC9A 3L0SA 4XWKA 2DY1A 1CLUA 3NBXX 5DI3B 4DSUA 1CS4C 1N3BA 1TAGA 3A37A 4URUR 4NZYA 3CUEF 4EPRA 1II8B 2W83A 1QHSA 2B8WA 3OEHD 2G0NA 4M9ZA 4MUAA 1EFTA 2VZLA 2BIFA 1FNMA 4TL7A 4NCJA 5DI9A 2WWIA 5E3HA 1JAIA 1G19A 2IF0A 4N0DA 1NRJB 3CKLA 2CCGA 1K5DA 3QBTA 1RZ3A 2YWHA 2PZFA 4IVRA 4R71A 2N46A 2CE2X 2KB0A 3VU9B 3W3ZB 5JSZB 4NYMQ 2PLRA 3DZDA 1U99A 1E0AA 4JZKA 3A4LA 1IXRC 4M21A 1I7PA 3U4QA 5KSOA 1QGAA 5DYGA 2VBCA 3QIAA 2CHGA 1QFZA 2SHKA 1OHHD 3LBIA 4BE7B 4MGKR 4P33A 3BH7A 4A2PA 3ES9A 4OQLA 3E1SA 1KKLA 4A4DA 5H59A 1A2BA 4GZMA 1E79D 1E1QA 1T5IA 4LJ9A 3ADDA 4B35A 2IHYA 3BGWA 2QPOA 1NN3A 5KSPA 2IYUA 5F3WB 2C8VA 3CWQA 4EIWA 4B47A 1QBKC 4YMSA 3V9PA 3EPHA 2NZJA 1MT0A 3RNLA 2CXXA 2AKYA 1US8A 4PAQA 3OIVA 4DEYA 1SXJB 4BQSA 4ACAA 1MO4A 4BPRA 1W4RA 2CVHA 1JR3A 1TF2A 5JZVA 4MQBA 3KXIA 3X1XA 2GXAA 3D8BA 1HT2E 1SXJC 3MUFA 1U9IC 2DPXA 2OFWA 1IJFA 5IK2D 4NE2A 4M53A 3SHFA 1SHKA 1C4OA 1Z8FA 3RS0A 5JEEA 5JBQA 5JS7A 1P75A 3AVVA 1GP2A 3P1JA 4GI7A 1CTQA 1XFAA 3O8BA 4ILEA 3GPLA 4KBFA 1Q7YD 4UAJA 2XXAB 1AMOA 2RGGA 5GADl 3CNOA 1OFUX 3KB1A 5FPHA 1F2TB 1W35A 2IXFA 1VG0B 5F2EA 2FF7A 1JI0A 1N6NA 1XCPA 2NG1A 2UVQA 2DWQA 1CBUA 3TUJC 2Q9BA 1X3SA 2YZ2A 3SBEA 2HYIC 3WP1B 3HYTA 1VG1A 1I4LD 3FE2A 4RZ2A 221PA 1YZLA 1A7JA 4B76A 3AEZA 4ZKEA 2IYRA 2WWHA 3QXHA 2XJ4A 2JLZA 4POAA 3AVOA 1IHUA 3UANA 4JKIA 1G3IA 2A2ZA 1GAJA 4A6PA 5J4KA 2O8DB 1N6PA 3MCAA 4ZI3A 3G5UA 1AKEA 2JIZD 4CT5A 2C04A 2ZR0A 4X8OA 2CRVA 2PX3A 3LQRA 1JA1A 1KKMA 3RHFA 5EP2A 3OE7D 2JLWA 4KFTA 4B33A 1Z0IA 3CW2A 1NLYA 1VHTA 1ZUIA 2C9OA 3BIFA 2LKCA 1GJRA 2IBMA 3JZAA 2AD5A 5CK4A 1M7GA 3SYKA 1W2BB 1A2KC 3KQLA 5D3MA 4MA4A 1SVWA 1EX7A 3WNDA 1DO0A 3W2EA 4B34A 3RS7A 2GJAA 4O2LA 3HDTA 2C9YA 1KSHA 1GKUB 4KLNA 5KDDA 3B1VA 3B9PA 4LHWA 3NBZC 4PHTA 1W2GA 3OIWA 1X8LA 2XJ9A 4UNSA 1N2CE 3L8ZA 1CR2A 4U02A 5LB2A 3FWYA 3K0CA 2A78A 1I4TD 5DLQC 4LHYA 1G7TA 1T5LA 1AM4D 3DOFA 1S8FA 4HE5A 1F3OA 3GLGB 1NIPA 4GL2A 1G21E 2QG6A 4JYCA 2GEUA 2F1HA 1CRQA 2NO7A 1CULC 4ASUD 1KDOA 3GJ8A 4AYXA 2ZR9A 1YRAA 1Z83A 1E2JA 3LV8A 4B74A 1Z3IX 2IEZA 4BEJA 1OH5A 4M9QA 1XEWX 2HF9A 1A4RA 4M1TA 1G7RA 3ECCA 5SZKB 2EFHB 2BF4A 2HLDD 2V7QD 4V0LA 1F2UB 2IS4A 2JJ2A 4GP6A 5C4GB 1KO5A 4DT1B 2YJTD 4HUQB 3CRW1 2QNRA 4QBGB 1XZPA 5FOSA 2F6RA 4C9BA 2F9LA 1P2TA 2NQ2C 1XTIA 5G41A 3VR6A 2YWFA 3KFVA 5E7IA 2Q21A 2NMVA 3KQNA 2XNJA 1UF9A 4DIDA 1X8JA 1T3SA 5ANRB 1JR3E 2WAXA 1UJ2A 2YC2C 2Z4SA 2WIBA 3IDQA 2J46A 1RVDA 3Q72A 1O3YA 3NEJA 5GV8A 2EVWX 5IT5A 2ZYUX 1WBDA 2QAJA 4XOIA 1P61B 1CNEA 4G3XA 1E94E 2VF8A 4US0R 2QMOA 4OL0A 1UKYA 3OW2B 4DKXA 1H8EA 1BH2A 2J0SA 4MYCA 1YE8A 4II7A 2XNDA 1G3QA 1CR1A 3B1YA 1VQ7B 1G18A 2ZRKA 2WWWA 2BBWA 4XSHA 5DISB 2RAPA 2ZRIA 3AVQA 2O8CA 1X1SA 2CHQA 4XD7D 4LV8B 4G5GA 3OAAD 3GJ5A 4AKHA 3K0SA 4IDHA 4L9WA 5KNDA 2ODBA 4DLUA 1YVDA 4BFXA 4XVRA 3E1YE 5FOVA 2FSHA 4DLTA 1W0JA 1GM5A 4FIDA 3UWOA 4LPSA 1KI2A 1ZD9A 1Q20A 2ZRDA 3HYRA 4DIEA 2OCAA 3OIUA 2X2FA 5AN9A 2VP0A 2GCOA 4QHTA 3ASYA 3FB4A 3SJBA 3H86A 2GAAA 5TV2A 1E9EA 1YZGA 2B6HA 3AKCA 3UKDA 3CPJB 4C43A 3EASA 4KJZA 4DDVA 2K5UA 3PUZA 3BXZA 3TE6A 3TQFA 4DUGD 1NMXA 2A5DA 3I5YA 1M1YE 4PHFA 4TL8A 4IDPA 2CE7A 2OFXA 2VIIA 4BZPA 4KAXA 3FHCB 4NDZA 4OK5A 2QUZA 4HLUC 1ZM7A 2NPIA 3JVVA 1KO1A 1KI4A 1WBBA 4HEJA 4M0LA 3PEVA 3ONWA 4QJ5A 2X1VA 4WZBE 1W4CA 2XB2A 3CMAB 4NMMA 1CU1A 4FXPA 4MRNA 3TSZA 3JQQA 3L0OA 8OHMA 4I4LA 2WTUA 3E2IA 4JMPA 4G01B 2XGJA 5TY0A 2ZI9A 2JLRA 2N1BA 2D7CA 1E9CA 3WXMA 1H42A 2WKQA 4FI3C 4JLNA 5C1BA 4WOPA 2QT1A 1XEXA 2FPMA 3FTQA 3QG5A 4GPTA 1CEEA 4QBIA 1TLLA 4Y7CA 1DAHA 3QF4B 4N0EA 1IXSB 3GLIB 3CCJB 2F55A 1KJYA 5BWMA 3T61A 3RS3A 2X3UA 1NNEA 3LVBA 4YXWA 1QGZA 4RKFA 4V0MA 2ZEJA 2O8EA 1D5CA 2ZUBA 1E0SA 3T1TA 1WF3A 5K8LA 3QEOA 1PV4A 2NIPA 5J5CA 4D4MA 1UKEA 1MH1A 2ZPTX 3K9NA 2B7CA 3K0EA 3IIMA 4RFVA 3M0EA 2DFNA 2W6JD 3AP3A 1EESA 2GESA 4DLVA 1E96A 3W2HA 4HZUA 1DAGA 4PC7A 2QTFA 1ZM2A 1H8HD 1EXMA 2R6DA 4MGIR 1E2PA 5P21A 2JLUA 4ZKDA 1EWYA 1G64A 5K8IA 1Q12A 3RS2A 2BMDA 2X8AA 1E2NA 3EIEA 1J8YF 3SS8A 3GEIA 3G0HA 4MRVA 1U98A 3OEHA 4QHSA 1JA0A 3Q7QA 3VR3A 2RGCA 1TF7A 1QFJA 3I55B 2ZI6A 2ZRPA 5LDDC 2ZM5A 1KDPA 5EZ6B 3MMPA 4DCNA 4MYTA 2JLQA 2P5SA 3L82B 2ZVQX 3NH9A 2IUUA 1VDZA 4ZIRA 4RD1A 1R7RA 5GVRA 4KHZA 3LFUA 2QE7A 1X6VA 2WOJA 4TWZA 1E99A 1GKIA 1ZYUA 2R65A 2RGXA 4H1UA 4DVGA 3CRVA 5TR9A 3CCLB 1KAOA 3CNLA 3MRSA 2FU5C 4PSKA 3FJOA 1B0UA 1VQ8B 1ZBDA 2R9VA 3W5VA 5GJBA 2DWPA 2ONJA 3FKQA 2YOGA 4UNPA 4JSTA 4KFSA 5EXSA 5DN6D 4GOXA 3DZ8A 1E79A 4Q9KA 3ZQJA 1RPZA 2O52A 2VP5A 2RH5A 2C78A 1U8ZA 4MRSA 2UKDA 3B6EA 3Q7PA 5AWFC 1E3MA 4LJAA 1PVOA 1ZU5A 2Z83A 2CJWA 2GBLA 1DAFA 4QC2A 4OI0A 3U6BA 1QVRA 2G83A 3LVRE 2ZU0C 4MKGA 2ZYTX 4CEJA 1KYIA 2ZUDA 4XWAA 2W58A 1W7AA 3ZBUA 1N6OA 2VSOA 4BWYA 5KUTA 3AM1A 4ZCLA 3D6TB 3WMEA 1FNBA 1AA9A 3AQ4A 3OJWA 1RJ9B 3AKYA 1VMAA 4KLZA 2PIAA 4W5JA 2R44A 4BLOA 2CK3D 4F4CA 1BX1A 1PUJA 1L7VC 2X19A 2GJKA 3LAWA 2B7BA 1YR6A 1YR9A 2RGNC 3QFCA 2W2XA 2J1LA 1FP6A 1EK0A 1ZW6A 3W2FA 1XTQA 5JMTA 2QZ4A 1Q1EA 1TUIA 1HE1C 1SQ5A 3VO1A 4HB0A 3GFTA 3QVVA 4US1R 2RGBA 3OJXA 2V4ZA 2WKPA 1W46A 2JAQA 2OV2A 2BVNA 4C0AC 2JJ1D 4NH0A 4Q4AB 1E63A 2ZRBA 4NL4H 2XNCA 4FK8A 4V0ME 1OH6A 1FFHA 2Z0MA 3CX8A 1T6NA 2AKAB 2O8BA 2C03A 1G20E 3I3SR 2B92A 1ZJ6A 3I72A 2PBRA 3LY5A 1VIYA 2ASEA 1CP2A 2GKSA 3FMPB 3NXSA 1KAGA 1IN7A 1DAEA 2JIZA 5CIQA 1N6IA 2EFEB 3UATA 2DBYA 1Q44A 1O87A 1OT3A 4C0HA 2Z5FA 4N3NA 1K8AD 1KZGB 3K9HA 2IYXA 1DVRA 1R2QA 5G53C 4RCZA 1GNRA 1JEEA 2J5XA 3R8CA 2X2EA 3ZVMA 4Q9IA 4P4SA 5E7MA 1Q1BA 2CLDX 1OKKA 4C30A 3CCSB 4TTPA 3V76A 2P6UA 1XP8A 4TYQA 1OJLA 1UBGA 5CIWA 1JBKA 3U4QB 2ZI4A 4PAMA 3B1XA 2Z4RA 5JFGA 3WYAA 3LWNA 3NEYA 2C2HA 3NBYC 3WP0A 2DEUA 2GETA 2FA9A 5DNYB 4W7SA 4A36A 1KK1A 4B3CA 4XTRA 1GNQA 1IN6A 2DERA 1BOFA 2G3YA 4AG6A 5A5GA 1COWD 2ZUCA 5FI0B 3ZGXA 1FMLA 1V43A 2C9CA 4GOJA 4DCTA 4PAOA 4ASUA 2BOVA 1SZPA 3REGA 1EGAA 1FTSA 1M8PA 2MSEB 4PC2A 4LC1A 5CLLA 2XSZA 1LF0A 1XTKA 1WB9A 1TMKA 4Q7MB 1US8B 4K46A 5FBLB 2E1RA 3TH5A 4Y0VA 2AWOA 2Z43A 3AVWA 1P72A 4JLKA 1QRAA 2GJ8A 3MJHA 4KBGA 5UKDA 2PLFA 1T8UA 4Q01A 1VECA 1XMVA 4YONB 4Q21A 1Z63A 5TB5A 5JHHB 4ZGNB 1KNXA 1T0HB 1YZNA 4RCYA 3GLFA 1FNNA 3U3OA 2GJSA 3TR5A 5IDVA 1J70A 3KKQA 3I32A 4DXAA 3A58B 3FHOA 1E6CA 3IGFA 4TMKA 2PJRA 4CGZA 2MSDB 2FOLA 2XX3A 4IOLA 1XJQA 1NI3A 4QG7A 4B44A 1G41A 4DC9A 3PVSA 2ZJ2A 2DFKB 3A1SA 5KTYA 1YZKA 4JLPA 3TUZC 3SQXA 3T12A 1BQEA 4B3FX 4BEBA 4ARZA 1OLOA 2ZSBA 4LBZA 4YMWA 1E2LA 2RB4A 4LK2A 2VHUA 3LBNA 3QI2A 5DHAA 3WYFA 1Z29A 2QTZA 3KKPA 1KQSB 4LI0A 1KDTA 1M6NA 3I61A 2RKOA 1DARA 1ZC4A 4HSEA 3W90A 3U7FB 4P6VF 1W2HA 1P2VA 1FOEB 1YQTA 2ZTSA 2A5YB 2BBSA 4LX0A 3TKLA 3QUSA 1VCIA 3RRNA 3AKDA 5DE3A 1FQKA 4ZGQB 1IY2A 5D3MB 2QQ0A 3NH6A 4IVPA 1MO5A 2G88A 4DUGA 3LDAA 1G5RA 3R9IA 3P4YA 3GFOA 3VQTA 3BJIC 5H68A 4EJSB 1UEJA 2JLSA 4OHZA 1OFHA 1XNJA 5LD2B 4US2R 1DTSA 2OXCA 2WPDD 2Q9CA 1OYWA 3ZH9B 2BCJQ 3IPYA 4YQFA 2OILA 4FCVA 3K0CC 1LS1A 1QHGA 1X1RA 4NYJR 4OJQA 2Q6TA 1E2HA 621PA 1Z08A 1YI2B 1N6LA 1YZTA 4V0NA 3QXSA 2IS1A 2VNIA 3VAAA 1Q3HA 3R7WA 2QI9C 5FFMA 5FL7D 1HH4A 1ZNYA 5K8TA 1P9WA 2CCJA 2WJGA 4IJMA 3SE0A 4D81A 4A92A 1QX4A 2REOA 2QA4B 4HDQB 4KVGA 4LYAA 3F3YA 4JVLA 4B73A 5C18A 2D74A 5SZJA 2IYSA 3GJ4A 4TL9A 5KSZA 3U3MA 1G1MA 4D4LA 2HDNB 3AV0B 4KODA 4DCUA 4F7WA 4TLCA 1Z0AA 1OSNA 3EC2A 1E4YA 3TLXA 2FNAA 4NCIA 3RC8A 1NMZA 2W6JA 4JVMA 3B1ZA 2BCGY 5L3VA 1XMIA 2FGKA 4TLAA 3GLFE 5EXPA 3KXLA 3FOZA 4MRRA 4N1AA 3UXMA 3KQHA 2V9PA 4FN5A 5CJ2A 1H8HA 2GNOA 2J0UA 3LNCA 2WJIA 4MYHA 2G77B 5EUMA 1X86B 2O8CB 3I56B 3THWA 3DPUA 3VNVA 4TT3A 4RD0A 4LSGA 3M6AA 3SYLA 4XWOA 1TVCA 3I1FA 1W44A 2QRNA 2XOKD 4KV9A 3DL0A 4M2LA 2QAGA 5FI1B 3D3QA 4DEXA 3ADBA 1CJMA 3LLUA 3N2EA 3W5UA 1K8RA 2FFHA 3BFXA 3EZ6A 5L3QA 3QKSA 2GQFA 4F91B 2DETA 2ANBA 2XAUA 3BAFA 5H70A 1T9HA 4Y9UA 2JJ8A 5AUQA 3SHWA 1U2RA 2JDID 1KI9A 3GFPA 5DYIA 1KSFX 2GCOB 2HJVA 5BQ5A 1VG8A 1N5JA 1JJ7A 3C5HA 4P3YA 3WHLA 4TMWA 3SU8A 2C98A 4NU0A 4BFUA 2NO6A 4RVCA 5CM8B 2G9NA 1TQ2A 2WWYA 3LW8A 2CNDA 1VTKA 2OT3B 4EKDA 2BMWA 2GZDA 1NBMD 3CX6A 5DN6A 2IA5A 1WE2A 2WV9A 5LB4A 1AKYA 3RC3A 4ACBA 4ZCIA 5G3YA 4LOAA 1I2DA 3EC1A 3V4RA 2HT6A 4C0SA 2VHQA 2P5TB 2ZJ8A 3EIHA 2BBOA 3O8DA 4JBYA 3BERA 1Z07A 4QFMA 1V5WA 1MV5A 3FGNA 4I81A 4EUNA 2BMJA 3LA6A 1GVNB 4NONA 3E20A 1Z47A 1ZUHA 1XDBA 4ZDWA 1SGWA 5HE8A 4MGZR 4E07A 4F93B 4BFVA 4C2UA 4WQMA 2PCLA 4ZO4A 4AF7A 1QVFB 3QKTA 1R4AA 2YOHA 1Q57A 4GMXA 1E2DA 3VMFA 1K5GA 2HYDA 3OESA 4KO8A 4QNRA 2CMKA 3B2EA 1G9XA 3LRPA 3SBDA 1ZUNB 1Q86D 3L0PA 2BMEA 4EFNA 2AK3A 1Z6TA 2O8EB 2I3BA 4OHVA 3KL4A 4EPXA 2V1XA 2JJ1A 3UK6A 1HV8A 4XSGA 2O5VA 3VR2A 4CYMA 5J4YA 3X1DA 3DO6A 3TBKA 4PC6A 1AIPA 1LNZA 2ZRGA 4TMXA 1JECA 1R8QA 2ZS8A 1KSGA 1ZM3A 4EFMA 1IN8A 4O3MA 2J7PA 5G3ZA 1Z22A 3THXB 5IRCD 1TPZA 3IBYA 2R62A 1KOFA 5AJZA 2REXB 2BN4A 4WBSA 2EYUA 4OK3A 5KU1A 5FOUA 2XB4A 1I4DD 4Z8YA 1DG3A 3W5IA 2F7SA 5M04A 2P6NA 5C4MA 4W9MC 2ZSAA 4Q7JB 5L8VA 2VNHA 2AL7A 1KC8D 4DLYA 4ZI2A 5A0FA 4FMDF 3GJXC 5FTNA 4Q19A 1E2IA 1GG2A 1KJWA 2FE4A 1AGPA 2QRZA 4KSCA 4LYFA 3RSLA 2ZI7A 1S96A 3QXJA 4HAXA 4Q47A 3IPXA 2WOOA 4DLZA 3THOA 2YKGA 2NO0A 2ZITA 2OBLA 4C4PA 4V02A 1II0A 5HE9A 4K81B 4WXPA 1XPOA 2NPFA 1VQ9B 1XXHA 5KYKA 1N5KA 2NTYC 3TW8B 2AFHE 4LJ5A 1W4BA 1ZCAA 2JA1A 1NP6A 1QG0A 5EE5B 4OI4A 1D6JA 1ZCBA 5AUOB 4RSGA 1COWA 4KITB 3TVTA 1J9ZA 1S1CA 5KNCA 1JPJA 3CH5A 2ZRNA 3BRWD 3LX8A 1W5TA 4BFYA 4RY2A 1ZD1A 2CJWB 3SJAA 1ZC3A 4QJ4A 2WKRA 2H1LA 2FPKA 1TX4B 2QENA 3A1UA 3EZ9A 4IOKA 1NKTA 2QDXA 3KX2A 4OHWA 4BFTA 2GBLC 1CXZA 1NLZA 1QDEA 4G1BA 5FBRB 3B13B 1R5NA 1LV7A 3Q9LA 5JLJA 1XTJA 2ERXA 1QHYA 2YINC 3EG5A 4U00A 3K9LA 3KQKA 1J7KA 3U5ZB 3EW9A 3B9QA 3GJ7A 1RRPA 2JEOA 2YC4C 3FDIA 3GD7A 3OEEA 5FTLA 3NDPA 3FKSD 2O0JA 5E7JA 3QEJA 3ZDQA 3A1TA 4F4IA 3WMGA 1G8HA 2VP4A 1FUKA 2CNWA 2BEKA 2YVUA 3MLEA 1D2EA 3RS5A 3UMFA 821PA 1GTVA 3VKHA 5FA6A 1ZIOA 4ZDKA 1OIXA 3QE0A 4DSTA 3PUWA 1KI3A 1OW3B 5GV7A 3AB3A 3RLFA 3IO3A 4KVAA 1U0HC 3P27A 3Q5DA 4TN1A 1W1WA 5DIFA 3FPKA 2ORIA 2O8FA 3DMNA 2WWFA 2P6RA 1GAWA 4DQKA 4EPTA 2MMCA 1DG1G 1CKEA 5EP4A 2O8BB 1ZD8A 2JLYA 2MMGA 1IQPA 2QPAA 5HZKA 4B48A 4C3ZA 1OFIA 2NGRA 2OG2A 2GVZC 1KIMA 2BV3A 1Y3AA 3NC0C 3UMRA 4C7OA 4Q00A 3EWSA 1NVXQ 2ZJYA 2PT5A 5EE9A 2GEVA 4HLDA 2IXGA 2B21A 2ODWA 4TLDA 4DLRA 4L9SA 1S4QA 3K09C 2JLXA 3MWJA 2FZLA 2A3RA 2ZSEA 2ZJBA 2BC9A 1M34E 5FR2A 3SN6A 4FMDB 4P4SB 1RC8A 3CF2A 2ZAOA 1SVKA 3PITA 1VQOB 2VLIA 3GEEA 4EH1A 3FFAA 2ZE7A 1FRQA 3A6PC 2GDJA 4Q4JA 5J47A 5F9HA 4NHOA 3TAHA 4AK9A 5FL3A 3K1JA 3ZS9A 5IF9A 1QHHB 4CF7A 4HZIA 1GRRA 4AWXA 4Z1MD 2WPDA 3LBHA 1IN4A 1RFLA 3QF7A 1EG7A 4A8JC 4CW7A 1AK2A 3NVAA 4R9UC 2HXYA 5FOTA 1XMJA 3WMFA 1XXHE 2QL6A 3IHLA 4A82A 2CL6X 4Q1CA 4HUTA 5F98A 4N3GA 4TQ9A 1GIAA 2WIAA 3AUXA 3WNCA 3VKWA 3ZIAA 2OTJB 5HPYB 2RMKA 4HB2A 2VHJA 1HQCA 4KI0A 3OZWA 3P32A 4RD6A 4I1OA 5KDOA 3EX7C 4V0OA 2VPPA 5DI3A 2PZEA 2FH5B 5JWHA 2DYKA 1P2UA 4HAZA 2R6AA 2IX3A 5TDHA 4R2IA 4Q03A 1Q81D 1YHNA 5EXTA 4YDSA 1G8YA 3AP2A 4G5QA 4Q1BA 2L0XA 4GNKA 2DFLA 1UDWA 3M1IA 4QGFA 4JYBA 4JS0A 2RGEA 4B4DA 1NMYA 3VU9A 2GF0A 4KFRA 2RHDA 3GLFB 3PQCA 4FCTA 5EUQB 5JSZA 4QGGA 1RRCA 1EFCA 1MO3A 4B3BA 1DAKA 5KSWB 1G8GA 3ZS8A 1AQYA 1QHNA 1E0KA 1KK3A 1E98A 3B8HA 4M8NE 4K8OA 1JQJC 1W4AA 1ZMXA 2R2AA 3PCRB 4AYTA 2QMUA 1Z5ZA 5CM9C 3A1WA 3CC4B 4IHQA 4DLSA 4AKGA 2CLCX 1CNFA 4ARZB 3QBVA 5KHOC 2D4HA 2BGJA 2B8TA 2QROA 4LUCA 5TVKA 4W5HA 2QQEA 4TYYA 2BKUA 2ZRHA 1NN0A 1E32A 2RHMA 3BB4A 3AGPA 1DO2A 1XPUA 3L0IB 1VG9B 4PSVA 2WJHA 3OFND 1Z0FA 4BLQA 2J41A 3H2YA 4GBMA 1KMHA 4AG5A 4LBVA 1E9SA 3QOFA 3QPWA 3MHPA 3RSOA 1DS6A 4BZXA 3BORA 4QNMA 1KJZA 2PX0A 1BX0A 2EWWA 2PJZA 3D7MA 1RYFA 3W2GA 1N8RD 4A0FA 4GDFA 2EFCB 2D2EA 2D3WA 1L4UA 2I4IA 5K8UA 1D2MA 4PR0A 4JT2A 4I1SA 4NYJQ 1UBEA 1VCOA 3H84A 1G17A 2PL3A 3AKEA 4WZAE 3P20A 4JLMA 4OQNA 4IFEA 4LJYA 4CT4B 5J40A 2EYQA 1HUQA 3TUIC 1OH8A 1OHHA 4IOMA 4QXAA 121PA 2GJ9A 4DSOA 2JATA 3TW4A 1QG4A 4DWJA 1EP3B 1PLLA 2O8DA 3G4SB 2HEIA 1M7HA 4PHHA 3P4XA 2OAP1 5JWRA 1IY1A 4EAQA 5KOYA 4QBHA 1E1RD 1G5TA 2QM8A 4R98A 1T3HA 1Q1QA 4ON9A 2EIXA 2WJJA 4I1UA 2GXSA 2RC5A 3BC1A 2QEQA 4U9UA 4AYWA 3BFKA 3SC3A 1QHIA 1U8YA 4A2QA 1XD9A 4LV6A 4E22A 3PEYA 1LS6A 2J9RA 1U81A 2ZS7A 2XTNA 4ZPXA 5IK2A 4DHEA 4TSFD 2ZJZA 1Z0JA 1QVGB 2ZRMA 3EZFA 4MUBA 4AI6A 1R6BX 1Y63A 4JL6A 3QPUA 3HP1A 3F5FA 2OAQ1 4BRWA 2F9MA 1YRBA 4KU4A 2QBYB 2A7QA 2NZ8A 3P26A 3AF1A 5FBVB 4EFLA 3A1VA 3PFIA 1KNQA 2BJVA 5G40A 1ETUA 4DQLA 2IS2A 1XF9A 1P7CA 3FVQA 2OCBA 4UXJA 4Q1AA 3THWB 2OCYC 1AS3A 1ZNZA 4MH0R 4F92B 3TAUA 4HE6A 2XEXA 4NPHA 4Q1EA 3ICEA 1OB5A 2QAGB 2V1UA 2DFTA 4HYYA 1J2JA 4NBSA 2OM2A 5KPJA 4WAUA 2AWNA 5B64A 2OK7A 5L3QB 2YWGA 2QAGC 3QKSB 1JR3D 4R7ZA 3ADCA 1N0VC 1AGRA 1G6HA 5HCIA 4B6FA 2YWEA 3U6KA 1A1VA 3CCQB 5L3SA 1FX0A 3K09A 5DO9A 1KZ7B 3OE7A 1DELA 3SFZA 3WBKA 1CQXA 2WSMA 3MWYW 5ELXA 4LC0A 3DDCA 3HU3A 1GNPA 3KKMA 5CK5A 4XIGS 2A5JA 3QKRA 4JBXA 2ORVA 3G82C 3VR1A 1T91A 3SEAA 2V3CC 2VP6A 5KO2A 4IOJA 1T4GA 4NCHA 2V6JA 1M90D 2W0MA 4A0HA 4D6PA 1R5OA 4PPGA 1L4YA 2WVJA 1GR1A 4Y0AA 4A8JA 3SOPA 5C2JB 4IW3B 2C95A 2BPOA 1LFDB 3CF0A 2AXNA 2OBMA 5AK0A 4G1VA 4YALA 4G0NA 4IKEA 1JJVA 3B5JA 3CNNA 2CVFA 4L16A 4OQFA 1ZIPA 3EAQA 5KNBA 2FPLA 4P0TA 2XTZA 1SVOA 1NJID 1Z0DA 2A5GA 4JLDA 1UKZA 2XZOA 1M1KD 3HU1A 3KJHA 3ZC3A 1FP7A 1NL3A 2VYQA 3X1WA 3CIOA 4PANA 2Y8EA 4ZV4A 4ABYA 5JJLA 4GMDA 4WIAA 2CBZA 2HLDA 2V7QA 4PZZA 4RKEA 1XX6A 2QA5A 1OYYA 1W36B 1D9XA 3QXXA 4GFDA 2W00A 3CZPA 5FTMA 3PR1A 3MFYA 3CC2B 2GK6A 3X1YA 3NTUA 1SHZA 2ANCA 3VFDA 1R10A 2FSFA 3K0AA 1IAQA 4JT4A 4A0GA 4QM7A 4MITA 2BBTA 1GFIA 1IB0A 1W36C 5F9FA 2F43A 4YMTA 4Q9JA 1CR4A 1MOZA 3CB4A 1Z6AA 4PPQA 3RRYA 3RYTC 2GEDA 2D62A 4HDCA 2KE5A 3FMOB 1G3MA 5D3QA 4UJ5A 1ZP6A 2WICA 1FUUA 2WAYA 2IEYA 3SFVA 3W8NA 3WY9A 2AK2A 2EQBA 4HB3A 3HU2A 3H1TA 3T1OA 2IYQA 4F4JA 3AF2A 4S2EA 2FEMA 2C5LA 3CD6B 2P3SA 5DGXA 2ZRCA 4C0BA 4WZ6A 2F3RA 1Z2CA 1W47A 1A82A 4D0NA 3TVDA 1VYVA 3C41J 3WRYC 2FFQA 4PPFA 1XJCA 1GVHA 1G7CA 4XD7A 3OAAA 3IO5A 4CVNA 3OZVA 3W5JA 3CCEB 3QF4A 2GF9A 3GLIA 3CPEA 4QRHA 4PC1A 1PLJA 3I8SA 2ZS9A 1QHXA 3WRXC 4UNRA 4BPBA 4DRZA 1QVAA 4CEHA 4JKYA 1S3GA 3HPQA 1KI6A 1P6XA 1NVWQ 1XTRA 1XXHB 1JALA 4BFWA 2XZPA 2BM0A 3DVLA 2IYZA 3IIKA 4Z1MA 2J0VA 3K9GA 5GJCA 5FPKA 4TL6A 3IHWA 2VSXA 2VHTA 3KUDA 1JXMA 3W5HA 3CRZA 5B30A 3E70C 4BUJA 4U5XA 4DDUA 1KY3A 4M1OA 1Q3TA 1LW7A 3FYHA 3TGPA 4O2RA 3VX4A 4EPWA 2J3EA 4XJXA 1MRNA 5JCZA 2ZE8A 2QGNA 2CCKA 1XB2A 4ERNA 2XNDD 3JQRA 4B2PA 4AKEA 1W87A 2A5FA 4MDFA 3AVUA 1BIFA 1KO7A 3HWSA 4IEIA 4KSBA 1NIJA 2QTVB 3NC1C 4LDJA 2CL7X 4LV5B 1N6RA 4TTQA 1KK2A 1GRQA 4JJZA 1QGYA 1DPFA 3A36A 1VIAA 3BB1A 3EXAA 2D06A 3NHAA 4O0MA 1AS0A 3DM5A 3Q85A 2V8OA 4DLWA 3KXKA 1W0JD 1CJKC 1ZNXA 4LGMA 2EW1A 1ELOA 3RANA 1N0UA 4DLXA 3AVTA 1BS1A 2OFOA 1K9MD 3SJZA 3MJRA 4LHVA 3K0FA 3L2OB 4PO8A 2ZYVX 3K70B 1YR7A 2ZVPX 3B7GA 4IDQA 4AURA 1TQ6A 2IL1A 2PH1A 2IYYA 3AVYA 4GZLA 2FDCA 3W2IA 3K70C 2V6IA 2NOAA 2ZJOA 3CBQA 2JGNA 5J4VA 2PEYA 4D2IA 4TMZA 2R6CA 3KZ1E 4XH9B 1ZM9A 4NCKA 3U3RA 2O8FB 4BASA 2UZIR 1OFTA 4LHZA 3QKUA 2QM7A 4FD2A 4RD2A 5EQTA 1E64A 2QEXB 2VF7A 1GL6A 3T06B 4URXR 4QL3A 1XD2A 3W6NA 4BLSA 3TNFA 5AJWA 3TSOA 4EPVA 2QSYA 2ZYWX 4C7OB 4YAOA 4UNQA 2WZQA 1RRFA 4M9SA 2OZEA 5FPTA 3I73A 1MABA 1WP9A 5H8WA 3ZD7A 4BZQA 4TZ6A 1U90A 2AXPA 1ONBA 2WHXA 3BWDD 3GJ3A 1G291 4RZUA 2GXQA 1PUIA 1C9KA 3NBFA 2FMXA 3UWKA 3T5DA 2NO1A 4B75A 1OXXK 5CYPA 3S1AA 5HTKA 3QFTA 4KCGA 1EFUA 1DAMA 4TMTA 4D0GA 4I1VA 1KK0A 2VTKA 1J90A 5J4LA 5FTJA 1SXJD 1D8TA 4MRPA 2DCUA 2FFBA 3PUYA 4Q4JB 4YXWD 4HAUA 1TU3A 1YR8A 1VYTA 1X8KA 3GLIE 3W34A 1G4UR 2P67A 2E87A 3AF0A 2QGZA 2FV8A 2WWXA 2I1QA 2ZIAA 1BMFD 1DAIA 3TQCA 4I99A 4BLRA 1GZSA 1LY1A 5JEDA 4D80A 3PEWA 1U8AA 4P32A 5DH9A 3MSXA 2N42A 4MGYR 3SI7A 3IIJA 4JLAA 2XTMA 3KJGA 4Q4LA 3A4NA 1P2SA 4NYIR 3T1VA 1XU4A 2ZREA 4GP7A 1TEXA 2IUTA 1OGJA 3M4YA 3RS4A 3C16C 3U44A 1P73A 4M1KA 1VPLA 2AX4A 3QY0A 4LCBA 4WW0A 3L43A 2Q9AA 4E03A 2VP2A 1XMSA 3BH6A 3H0KA 3NHBA 3CXCB 4Z8XA 4OHXA 2ZJAA 3EIQA 4V03A 1K6MA 3TIFA 2FGJA 1CF4A 1Z2AA 3QFSA 1VCMA 4XVUA 2HUPA 2EFDB 1VYUA 1U94A 4HAWA 1RW4A 2DB3A 1XEXB 4TSFA 1NSTA 2JASA 4LYJA 2CK3A 3CPHA 2KI5A 1SVMA 2VNKA 2EWVA 2QE7D 3R9WA 4JL5A 3E5HA 1TADA 4PGOA 4B3XA 1Z6XA 2W0SA 4URZR 2OXRA 2R6GA 4CIDA 2RGAA 3T34A 3KKOA 1OXTA 3QE2A 3MG9A 4ESVA 1R0XA 1LB1B 3KDSE 2FFAA 1A8PA 1JB1A 1ZNWA 3FMFA 3L8YA 1TF5A 4PPNA 3RABA 5LPNA 2FEOA 4TYNA 3CF6R 4E09A 4A1FA 2ODEA 3I92A 3QENA 4WXRA 3SDZA 4PFSA 1ZINA 4FWTA 1NY6A 2EU8A 1M2OB 2IUSA 3NDBB 4TTRA 2ECKA 3Q5EA 1HA3A 4MYUA 4JLJA 3BH0A 4KYIB 1HURA 3IKJA 1DDIA 1OGIA 4PSAA 2BDTA 5FOXA 2WBLC 2ZETA 1F60A 4HZUB 1UADA 1KMHB 1GITA 3CPWB 3CZQA 4LWZA 4TQAA 4OI2A 3QXCA 3RDPA 3WHKA 4PQRA 1NVVR 3JQPA 5THXA 2ZQ5A 3ZZ0A 2VHCA 1VQ5B 1KRHA 3U7HB 2FZ4A 4YMUA 1UDXA 4ITRC 2ZXUA 4QHYA 1Z06A 1N6KA 3CRRA 5CYOA 3T15A 1DEKA 1JPNA 3C14C 2YNMA 1SM4A 5CDFA 4CDGA 1W5SA 2D7DA 2PT7A 2ZRJA 4A9AA 4PQFA 3C8UA 2GPJA 3D31A 1HQYE 2CEAA 3GCGA 3PV0A 4X8MA 2W6ID 5AJXA 1G6OA 4IRUB 3EWAA 4ZIRB 3C15C 4V0KA 2W2TA 3DHWC 1E9AA 5FTKA 2GHIA 4CEIA 3TK1A 3UIEA 3NWJA 6Q21A 4TLBA 5B57C 1SULA 3TJZA 721PA 2CL0X 2G1JA 1E2FA 2OLJA 2R6HA 1W49A 4RFSA 1QF9A 2WSSD 4NTZA 2WWGA 1VQ6B 2QSZA 1VQNB 4NCNA 3AH8A 1RE0A 4QGHA 1PJRA 2J87A 4D82A 3TSWA 2YYZA 3QG1A 5AR1A 3FHTA 2BSAA 1ZM4A 2H57A 4D4JA 1IN5A 5JRZA 2IW3A 1YJ9B 1XZQA 1KHTA 3G6EB 2PZGA 4FMBB 2IYLD 1R0YA 4CEJB 1JQLB 4D26A 3B85A 1NG1A 2OK8A 3BBPA 2KBFA 1N6HA 1YJWB 1OKKD 4B2IA 5JI2E 1SKYE 3CC7B 2IYTA 3MAAC 1ODFA 3MWKA 3NKVA 2XITA 1NJGA 1OV4A 3QSYA 2VYFA 2XNSA 3IUYA 2RGDA 4FCWA 4EJSA 1GRNA 3NG1A 3DEFA 4JLVA 3ZZTA 4YHBA 1YIJB 1Q82D 1M74A 4MKIA 4DCSA 3GLHA 3N5CA 1BJKA 2C77A 1NY5A 2ZJ5A 3PJRA 4DBLC 1T3LA 3K53A 1E2EA 1GILA 4C0QC 4EQ6A 4TLEA 1AZTA 3SJCA 4M22A 1DBSA 1UMKA 1E9BA 5CITA 4Q4HA 3PXGA 1WQ1R 4D4KA 5HZHA 4L8GA 2OUKA 5CB6A 2F1JA 5FOWA 2HV8A 4HLQB 2OEPA 2XSZD 3PEUA 4YAWA 3BE4A 2PCJA 4D25A 4Q1FA 4AIIA 1E2QA 2KJQA 4YAUA 4NKRA 3ZBTA 2H7VA 4P4UA 2HF8A 1S9HA 3PENA 5E95A 2IS6A 1G5PA 2ODNA 1UEIA 5B2ZA 1T8TA 4A15A 4JJKA 3LO5A 5L3SB 1FX0B 1IOZA 1E9RA 3HR7A 4M9XA 1WMSA 1FRNA 3KJEA 3OF5A 4EDHA 3ETLA 5SZHB 5AUPB 5HKKD 1KDRA 4LJ8A 2B5OA 1IM2A 2OSBA 4FMCF 1VHLA 3QKRB 1TQDA 2Q3FA 2G6BA 2ERYA 2QMEA 3CRMA 1EWRA 2H5EA 3KB2A 5EE0A 1IY0A 2V55B 4HLCA 4Q48A 1L8QA 3LXRA 2OESA 3LXXA 4LJ6A 2FSIA 1S0UA 2VQSA 2ZSDA 1AJEA 3CH4B 1F6BA 4Q02A 1ZU4A 3FMIA 3ZYCA 5CDFE 4A8JB 3SQWA 5FUVA 2OLKA 2CHVA 4U7DA 4UNNA 1G16A 1GKYA 3SYNA 2GZAA 2H18A 4PC3A 1JNYA 3THYA 1OE0A 2GXUA 2VEDA 1S1MA 2ZE6A 4RZ3A 2R6FA 2VSFA 3VR5A 2I1VB 2F1RA 1QFYA 2QN6A 1OIWA 2DR3A 3KTAA 3KUCA 4HATA 1KI1A 2KWIA 3LX5A 3C7KA 1CJVC 1P60A 2YV5A 1OXUA 2IXEA 5JRJA 4LHXA 1U0JA 2OCPA 4TMVA 1FNDA 3VTKA 3GP8A 1VQMB 1LF5A 1MKYA 3BB3A 1G8PA 1IBRA 1TEVA 2F1IA 2YHSA 521PA 1VQLB 1KY2A 1SVSA 2LCFA 2QU8A 1MRSA 4PQYA 4URVR 1L2TA 1OB2A 2Q3MA 4TQUS 3R9XA 1CRPA 2A9KA 4QGAA 5CJPA 5FL7A 2GRJA 3UG6A 3B60A 1WRBA 3X2SA 5AJYA 3NIBA 3RAPR 1R8SA 3QFRA 1CJTC 1UKVY 3W8RA 1II8A 5JECA 2UZ3A 4JIMA 1KD1D 3K0AB 4C0JA 4IXMA 1GSIA 3I62A 3ASZA 2IYWA 4QM6A 1BKDR 2F43B 3SNHA 1HEIA 1A5TA 4OJKA 3TRFA 1SKQA 4B32A 1K73D 1M7BA 1EWQA 1GO2A 1XCMA 5EE1A 1RRGA 5L3RA 2C99A 1XD8A 2EFGA 3CCRB 4AD8A 3EPLA 2FSGA 2R8RA 5SZIA 2ONKA 1FMJA 2Q0HA 4RZXA 3ZZUA 2VP9A 3GMTA 2IYVA 1E2KA 2O0KA 1N25A 1TU4A 1ZRHA 3GLHE 5FBQB 4OQMA 4AY2A 1OPXA 5BYKA 1W48A 4PO9A 4UXHA 4JLOA 2FJUA 2QP4A 4NYMR 2GVDC 4OI1A 1NVUQ 3AVPA 3VO2A 1TUEA 2G1KA 3HJNA 5EJEA 1E2MA 1DDGA 2FX3A 2XOKA 3AVXA 4GT1A 1RKBA 3FPAA 3SR0A 5KSYA 1NN5A 1P3JA 4CEHB 1SXJA 1U9IA 4URWR 3W6OA 4QKQA 1KI6B 1QUFA 4UXIA 3LW7A 3T35A 4EPYA 4QJ3A 4OYHA 1W0KD 3IQXA 3OIYA 4E5UA 3C4JA 4IDOA 2JDIA 4HAYA 2QMHA 1E2GA 3RVBA 4ESHA 2ZU6A 3IQWA 4Q7LA 2DWOA 1BMFA 5FBWB 3V4FA 2J45A 1XBTA 3HPRA 3QPVA 3LD9A 4URYR 1N5IA 3A4MA 3JVUA 2PEZA 2BM1A 1GL7A 5HR5A 4Q9HA 4FMCB 2IWRA 1E69A 5HCNA 4GSYA 2ZI5A 1BYUA 2XXAA 1NBMA 1WA5A 2H8KA 3THXA 2E9SA 4LBWA 2BGIA 1F2TA 4RJLA 1YITB 1N5LA 1JXOA 4UKDA 1G7SA 3U3KA 3VKGA 5AJVB 2QTHA 3DM9B 5FH9A 4Q5IA 1JAHA 4TT3D 3RWOA 1R0WA 2BMFA 1P62B 2IHBA 4BLPA 2JCSA 4YAFA 4HI0E 1G4AE 5KDLA 3PG5A 3N70A 4KYUA 1RIFA 2H92A 1TL7C 2TMKA 2IWHA 3QJYA 3ZVRA 4MKHA 3T1QA 3U2QA 3MD0A 1EFRD 1H85A 3R7WB 1IJEA 2VNJA 4KFUA 3CCVB 2PMDA 2ZRFA 4LBYA 3GJ0A 3K0FB 3ZJYA 2QP9X 4FW9A 3U3JA 1S72B 4WVFA 2OO7A 2A30A 1F48A 3LLMA 5TMPA 2AR7A 3ZLJA 4B3GA 2NO9A 4PTLA 1T0JB 1NKSA 2AHOA 3KFXA 2Q3HA 1Z6YA 1H65A 4DDTA 3DMDA 2C96A 3RWMB 2QPTA 3U61B 3OZUA 1NG9A 3HR8A 3ZVNA 2ZRLA 1P9RA 1NJFA 1XEFA 1TTTA 1UPTA 5JHGB 1RYHA 4P4TA 2ORWA 2V54A 4KXFB 4UQOA 5JS8A 1XD2B 3QQ5A 1S3SA 1GOTA 1NLFA 4O25A 1AN0A 4YLGA 3TR0A 2O0HA 4J0QA 1UFQA 1MABB 2Z6VA 5LBIA 3DOEA 1UM8A 4QOSA 5EP1A 1Z6GA 2J0UB 2OBNA 2J7KA 3BS4A 1SVLA 5EXXA 3JZMA 3GLGA 1E1QD 3U60B 3K8YA 4C2TA 4JBWA 5CLQA 1GL9B 5C46F 1ESNA 3S1AB 1KMQA 4UJ3A 3CMEB 1ZVQA 1HTWA 1KGDA 1KO8A 4PXAA 4Q18A 1OF1A 4FINA 1P4SA 2ZR7A 1WCV1 1Q22A 4JL8A 4FWIB 2D2FA 2FG5A 421PA 5JCPA 1GWNA 3U7EB 3MGCA 1OIVA 3UPUA 1F2UA 4PHGA 1QH0A 1XE1A 2AN9A 3EPKA 1W36D 4DT1A 4HUQA 3RRZA 1VCNA 3CX7A 4ZCMA 2W6IA 4DB2A 2ZRAA 4GRAA 3EZ7A 5EE3A 4DB4A 2BKEA 1E0JA 1FTNA 4NYIQ 1OXVA 3BK7A 3PUXA 1OH7A 2GCNA 1MR3F 5BN5A 1SXJE
chains in the Genus database with same CATH superfamily
4Y2SA 4M0MA 1EP1B 4XEUA 2JFXA 1Z73A 4I5GA 2N0SA 3G71B 1DTWB 5EOVA 4PICA 5C1OA 1H69A 2HT1A 5JO0A 1L1RA 1LVUA 2HSZA 2QYOA 3IAFA 4RA9B 2VZ0A 3WYDA 2PUDA 4N4AA 3FUWA 1IDOA 2AFIA 4G5SA 4ZCQA 4GH5A 3TD9A 4ABTA 1QPGA 4U3JB 3UFBA 1C7JA 4DUYB 1RC0A 4MUYA 3F0TA 4CBVA 3AI7A 1HY3A 1HG1A 1X7WB 2C97A 2X0NA 3A8TA 4G5OA 4IHJF 4JLBA 3PE3A 3KLPX 4ZDIA 2V6BA 3A6DA 5FV7A 1YH3A 1NN1A 4I5EA 2I9PA 1Y4UA 2DQ4A 2VO1A 4A2WA 4E2FA 3COZA 4KN5A 1KDVA 2P9JA 1I3LA 2LWIA 5K3SA 2IV3A 5TARA 2ZXEA 4DANA 3IJEB 3KZKA 3KTDA 4F1WA 4DV5B 4KQIA 2FPWA 2V6MA 3VHLB 3U7GA 1RQXA 4PO1A 4HOYA 3NIDB 1GPNA 5DP2A 3UF0A 3FX2A 3U19A 5CDYA 2EFJA 1WDWB 1P7ZA 2PR2A 3AEUB 5JI3E 3DE7X 4HAOA 5DFAA 4I9HA 4KAJA 4QSHA 1CC1S 4KPFC 3W9YA 3OE5A 1Y7PA 1GUAA 3KOYA 1LPAB 3JQAA 2HRZA 4MR8B 3O8QA 2VJLA 1PI3A 1QHHA 3CR8A 2PNJA 3ZW9A 2WVGA 5KSYA 5BW4A 2JEZA 4FGLA 2BE9A 3EIUA 1SKBA 4U5QA 5JC1A 5HUHA 1F8UA 2YL2A 2XKJE 2HCJB 2PLNA 1EIZA 2VSQA 4NQZA 3OCXA 1AZSC 5HIAA 3DXXA 4JQCA 4OJNA 3C2QA 4ZN6A 1QZXA 4MW5A 1DJPA 2ONYA 3UUEA 3NW9A 5F73A 1KO4A 4HLUA 1KWGA 1NVVQ 4L75A 1E7SA 1Y3BE 2B5VA 5KNCD 3S70A 1CY4A 4PZLA 4P1VA 4CDNA 3ZNOA 1E3ZA 3LF2A 5GJVC 1AK1A 1MW8X 3KOOA 3ODPA 3UA3A 3L8CA 3I28A 4BKOA 3JQ6A 1ENOA 1BC5A 3BD9A 1OB0A 1IXZA 2IYEA 3FH0A 3NR2A 4OAOA 4RIIA 4PZYA 2J09A 2Q3DA 2HMAA 2WYRA 4H7IA 1BA3A 3H7AA 3SY8A 3QNUA 3GU3A 1SXPA 1QH8A 2ZIUB 3AP1A 2WY2D 3KBBA 4GWGA 1CZRA 2EZUA 3HB9A 5LA6A 3T0IA 3UJ9A 5JATA 2BJWA 4G65A 4H1VA 5HKKA 4G0MA 5FPPA 3TQSA 4YMVA 4XKVA 3M6LA 1JUDA 3L7MA 3PXBA 3ZQ6A 5JXHA 1Q3KA 4OUDA 2F1MA 3M3PA 3AUUA 4ZU3A 4IVQA 1LDYA 1UPXA 5B4VA 3R74A 3FUCA 1FQJA 3GLGE 2GPNA 4S1VA 4NJEB 4G7WA 2EQ5A 5BR4A 1QSGA 2C20A 1SC6A 3B20A 1UPBA 2H2WA 2WUGA 1Q7BA 1Y1PA 2J3QA 4IDAA 4X1KB 5HQ3A 5E4FA 3AEQB 3J81k 4P2BA 3G2JA 3HADA 4XDGA 4H2DA 1XYYA 2FUEA 3BZBA 4KXXA 4R2HA 5JD5A 3K1ZA 3NOOA 4S2UA 3SC4A 1WV0A 2C4HA 4PZEA 3GCZA 5JS1A 1U0TA 3EF1A 3NB0A 3QIVA 1CY6A 1M6WA 4G8BA 4MI9A 3RODA 1VL5A 3BIWA 1UAAA 3SFTA 2JLVA 1V25A 1WDKA 3UOWA 1NNSA 5IN4A 4PX9A 3ROKA 1KF0A 1P9NA 4KK4A 5HOQA 1YJ5A 1F7VA 3TL6A 1UKBA 5KPDA 1DKMA 5BV2P 4YUWA 1H8ED 1OBOA 3NASA 3ICQB 4DSAA 1NP3A 3OOWA 5L53A 4PZ9A 5IYRA 3A3KA 1UWCA 2FJ0A 1PSZA 2O48X 4PWYA 1C9DB 2AFVA 1D3AA 4IFBA 5FUYA 3TTYA 1UMBA 1YOBA 2MYUA 3OZDA 4X5OA 2W4MA 1JG3A 1FY2A 1V11A 1ZD5A 3EA5A 1NA5A 4QUKA 5FUWA 5BORA 2I71A 1AQUA 5ICFA 4B0OA 2WD7A 2E5WA 2FLWA 1F20A 2WP8J 4J16A 4XPIB 5JNTA 2X6RA 3QELA 1EK2A 3FW1A 1ZISA 4HQFA 1P5ZB 5KQRA 1O77A 3RVJA 4LYHA 2HLPA 3COSA 3EZ2A 3CLRD 4BEWA 1YFJA 2HX1A 1KTVA 5A4JA 2NVWA 5EMMA 4LY6A 3VC1A 1RLUA 3D8UA 2DQYA 5IYZA 3E8XA 2AJDA 3RC7A 1NRIA 4L8WB 4F9GA 2P2ZA 5K4GA 2R60A 4OP7A 1ZKDA 4PEVA 2F1OA 6ADHA 3TM4A 3OZ7A 4OOXA 1I5OA 4JP1A 4ENTA 5LD2C 1L8OA 2KBEA 4EG1A 4CKEA 3NYRA 4JVNA 1QE3A 4JDPA 1FSGA 1KMMA 2J67A 2D5CA 3WYGA 2HXGA 4FJ2A 4I55B 5DSXA 1WQ3A 2J3IA 5JH7F 5LQUA 3LPLA 2P9BA 4JJIA 3F2IA 4EUSA 2PKQP 5A06A 3OCWA 4A6XA 2QP3A 3KUXA 4ITVA 5IWAB 3I39X 2F3TA 2NU6A 4KB5A 4BO4A 3BXGA 1H5QA 1HDCA 3LP6A 4GLFA 2HY7A 4MUIA 2ZJ4A 3EPRA 4PG4A 4Q9LA 5JCOA 2ZUTA 1F4PA 4KIFA 1B6TA 4TYPA 5B3AA 3E2PA 4FXOA 2I6TA 1TMYA 5DCUA 5IHPA 3OZBA 4B71A 2DUNA 2BD0A 2ILTA 5ALWA 3EXHA 1W4LA 1MP0A 3F8SA 3JRXA 4FZ3A 4YNBA 3UJHA 5BPFA 1B7GO 2WP0A 3IBGA 3B1WA 2ISSD 1R8JA 2JF0A 4KG7A 4JHXA 3AR4A 5DCYA 4Z99A 1T1IA 3PHBE 1Q0UA 4MHSA 1DADA 2NXNA 1N2SA 3EARA 3L41A 4F7DA 1WPQA 1XTZA 4AZ0A 3MN1A 1D9ZA 3ICWA 3WNBA 3FLMA 4O4JF 1CUHA 3P7MA 4NBRA 2O2SA 1U9ZA 4BOYA 5LMZA 1ZZEA 4RXTA 1P1CA 1V37A 3VVBA 2NQ8A 2J3KA 4K6HA 5BOVA 3EOZA 4EHAA 1RKUA 3BH4A 1SEVA 4W99A 1AK9A 3L4JA 3AF3A 1FC0A 1XQBA 3Q98A 1YF3A 4OHYA 3T0GA 2CXHA 4UHDA 4EW2A 2VA8A 4Q4AA 1V45E 2ZROA 3D4BA 3PU6A 5LMNB 4F38A 1ICIA 2WTBA 3H9JA 3KTAB 2IPMA 2FN4A 2ZSFA 1BVUA 3H18A 3KHKA 4M1MA 2BEJA 5EVJA 3RGWS 4BE9A 1JB9A 1FNCA 4G5HA 4PFQA 1BKYA 2CWDA 5HK8A 1ANKA 1QUEA 3TQOA 1W73A 5IVIA 3ZK7A 4EEKA 5EESA 1QTRA 3ZVLA 4RDKA 4DDUA 4IS3A 1Y9AA 4KUGA 2DP4E 3TQTA 3DT6A 5EJ4A 1EUYA 4AC9A 3L0SA 4MUFA 4XJVA 4ZRNA 2HLNA 1FEZA 4PXYA 3RASA 1DIOB 3OE1A 3T9AA 2C5HA 1L6IA 1TK9A 2HD4A 3NBXX 4BX8A 5DI3B 1CS4C 2O2ZA 3D6FA 4UBIA 3CUEF 3DPIA 4EA9A 2PUCA 3E61A 1QHSA 4U7GA 2G0NA 4RE6A 1K1EA 1IK6A 1EAYA 4JOBA 4MUAA 3TX2A 2VZLA 2BIFA 4G0YA 4TL7A 4XFDA 3ZOZA 1K5DA 4L4RA 1RZ3A 2YWHA 4IVRA 1WLSA 4R71A 3W3ZB 2CE2X 3WYCA 5BSVA 2H4XA 2PRKA 3U31A 5JSZB 4FOOA 2BEVA 3NTQA 1E0AA 2NYVA 2PPLA 1IXRC 2D00A 1I7PA 1GTL1 1N8SA 1YL6A 1QBGA 1Y0BA 1QGAA 1LFAA 1G21A 3GZNA 2OV8A 2K6GA 1FRVA 3HN7A 4NK4A 4TV8F 1QFZA 4CLOA 1Y3DE 3JX9A 3N6RA 3LBIA 1NTRA 5EMKA 3V8EA 1QKKA 3SNKA 4A2PA 3ES9A 3ZHQA 4OQLA 1OJ7A 4A4DA 4O4LF 3RJZA 1A2BA 1DBQA 2GRAA 5CHEA 3FCUB 3ITNA 1E1QA 2OV4A 4REMA 1KQ3A 3VJLA 5IJWA 1KEEA 3ADDA 2E2WA 2EV9A 2I66A 2W2LA 4NJMA 3D6UA 2QPOA 3DDUA 5LR6A 2IYUA 2P1RA 5F3WB 3ZBPA 3CKYA 1C1HA 1I18A 4PLPA 3TBHA 4ZJPA 4UFNA 3EPHA 3L9WA 4IGEA 3PICA 2NZJA 4UMFA 3N58A 4EO4A 1US8A 4PAQA 2Z8YA 3OIVA 3I12A 4RLHA 4BQSA 5K3BA 1PNRA 5CP8A 4BPRA 1QC5B 2CVHA 3OTIA 4MQBA 4CM3A 2GXAA 3N75A 5BUCA 4XWWA 1TYZA 1FVHA 4AP9A 2VPWA 3LZDA 3R44A 2H2DA 4NR0A 2R8PA 2AF3C 3BN3A 4M53A 1T1GA 2G72A 3EUFA 2CLHB 2EGHA 2H8GA 1Y4ZA 3AVVA 4JITA 3TLMA 2DE0X 1SOMA 3BFPA 3P1JA 1JYEA 3VZPA 1RRVA 1CTQA 4FWBA 2VPQA 2WR8A 5EIFA 2WTNA 1VF7A 2W6PA 2Q7DA 4CQLB 4XKWA 3GPLA 1ZPDA 3CFYA 4UAJA 2W8BB 1AMOA 3EXFB 2B4KA 4L5YA 5FNVA 3CNOA 1G8JA 1OFUX 3PGKA 5GADl 3QU4A 2Z5VA 3ICCA 5KAPA 1JI0A 2NG1A 1XCPA 3A6GA 4EZIA 2OV6A 3IUBA 5L7YA 3UMYA 3HJFA 5HJ2A 1P4MA 2NYAA 2FP3A 3OTOB 2UXBB 3WXBA 1JIQA 1M73E 1VG1A 2C4MA 2GN0A 2Q4RA 3R0QA 4TKUB 3UT5A 3ER8A 1M2FA 4XARA 1EEHA 2IYRA 5I4BA 3QXHA 2JLZA 3H4TA 1T4MA 1N2EA 1ZOOA 3GA0A 3UANA 2QRVB 4A6PA 1YDWA 2AZXA 1N6PA 3IQZA 4YWJA 4ZI3A 3QVGA 5C8YF 3ENKA 3G5UA 3I01M 1AKEA 4JEMA 3IVRA 3V2UA 3N2YA 3TL2A 2C04A 2R4UA 4HH3C 4KQ6A 2P2SA 3VKGA 3EBOA 1JA1A 2DULA 4B7CA 2BHTA 2X9NA 4M60A 3OE7D 4N6NA 4KFTA 5DTMA 2VR1A 3DOOA 1Z0IA 3MWGA 1KETA 1VHTA 3I09A 3JZAA 4HN9A 4DCNA 2LKCA 4ENPA 3PWZA 1VMIA 2WHQA 4H27A 1IZ8A 1K2WA 4R9VA 1NC1A 2X76A 3P0JA 1Y3IA 4X0CA 5FWAA 3HEAA 4S1OA 2LIPA 4LF8B 1XLTA 2HJHA 1IULA 2EKPA 2F59A 4AJ2A 3NGXA 3WG9A 1XVLA 2GJAA 3HDTA 3P2JA 4O2LA 4B31A 3S8EA 4F5DA 5FLKA 3FA2A 3K35A 3ZGZA 2JCGA 3L4EA 5E7QA 2FP4A 1O97D 3IAEA 4Y3UA 3ZZNA 5C37A 3SVLA 1DNPA 3VNQA 2XJ9A 2K2QB 2ZZEA 3G88A 3NIFB 2ZKIA 5AKJA 4J4TA 1J5PA 3L8ZA 4QDOA 4G07A 2RB5A 3E48A 2E7ZA 4E15A 1I4TD 2ZT5A 3VPGA 4GO1A 1I4OA 2JFBA 1K5PA 5KVAA 4HCJA 2RK3A 3DVQX 3NJRA 4MPJA 4B3JA 3UYKA 5JY6A 5LOVB 4JXXA 1RKVA 4OBWA 3GLGB 4BMZA 1NIPA 3M82A 2C7RA 3EHDA 2ZFUA 2XXAB 3G89A 2GEUA 2F1HA 1CRQA 3E9DA 6CHYA 4LDAA 4MB0A 1GPMA 3OO1A 5D3KA 3Q0TA 3BM5A 1WUTA 4IMIB 5GOTA 4NAVA 2ZIXB 2AIRA 4I8DA 3D4LA 4D8TA 4YMLA 2O7QA 1N5DA 2HF9A 4M1TA 3ECCA 3O2SB 3RAJA 2IS4A 4J0JA 2BSXA 2W2KB 3H3FA 2YJTD 2ZUUA 1XZPA 2CLIB 1M67A 3M5DA 1LPBB 3O1JC 3QMMA 5KYYB 1W52X 2YMPA 1DI0A 1FS6A 2ENUA 3OM1A 5E7IA 5F2KA 3AWDA 3HB0A 3T4EA 2QR2A 4RK5A 2XNJA 4UTOA 5BN5B 1AG9A 3OJOA 3KQNA 3MBOA 1WULS 2W11A 4UEQA 2C4VA 4W8OA 1JR3E 2WAXA 2WNHA 4X71A 3WADA 3IDQA 1DJMA 3IAS6 1RVDA 3Q72A 5LQRA 1O3YA 1LTHR 3OKCA 1CE8B 4WZLA 2GHRA 3LX6A 4N5IX 1CNEA 1T6YA 1JBQA 4G3XA 4PG7A 3KRTA 5SYMA 4Z86A 4OL0A 3TOZA 1GA6A 4DKXA 3IX7A 2CJFA 2VUHB 3NFYA 1BH2A 4KGZA 1EH5A 4MYCA 3VJMA 3ZX5A 1CQWA 1YE8A 3L04A 1EB8A 5J2TB 4DR2B 1REQA 1ULAA 3P9KA 4JBLA 3B1YA 1VQ7B 3WGHA 3VYRB 3ZGLA 2QVXX 2Q4DA 2BBWA 1SR8A 5CH3A 2RAPA 2ZRIA 3E8SA 1SKAA 1X1SA 1O96A 4XSVA 4LV8B 3OAAD 2NLOA 3H2IA 3PUMA 2MYNA 4P36A 3K0SA 4CM9A 2YV3A 2H63A 3A3YA 3NHWA 4NZ9A 1FUYB 3I9MA 4F04A 3WA7A 1ZHOA 2G4VA 1AKWA 1OZ0A 1C0KA 3HA2A 4B82A 4LMRA 4H6PA 4JR0A 5AMXA 3O9VA 5FOVA 3LCVB 1NAIA 1UAGA 2I2WA 5HOEA 1GM5A 4FIDA 1KI2A 2ZOSA 4AW9A 4FQ7A 3TTSA 1WHTB 1EFPB 2FPIB 5H81A 4DIEA 2OZLB 2VP0A 2W6NA 2BGMA 3NHSA 3ED5A 3HBFA 1PG2A 3H86A 2GAAA 1E9EA 1IDN1 1NJSA 3I34X 1PR5A 2IOQA 2AXQA 3M6WA 4U39A 3W7BA 4KJZA 1XMOB 1T0UA 1W4ZA 3PUZA 2WD8A 3TE6A 3EWIA 2W42A 2QYTA 1M1YE 3RIMA 4PHFA 1E7RA 3LC0A 4BZPA 4UTVA 2V6GA 3DP9A 4OK5A 3KYBA 4D56A 4LSWA 3G85A 4GWLA 1DQZA 4GGOA 4BB6A 4CQMA 1YK0A 1AO3A 4RM0A 5TEWA 3PZRA 1JSXA 4JVOA 1E2BA 4D96A 4LOJA 1XKQA 2FPGB 1TD9A 2A86A 5HVNA 3A4TA 2NT4A 3GVLA 4FXPA 4MRNA 4DM4A 3JQQA 4XDZA 2KW5A 2G09A 4B4WA 4FOTA 8OHMA 4I4LA 4JMPA 4P3IA 4G01B 1QU2A 3Q6MA 5ITSA 1IVYA 2J6HA 1L4FA 2D7CA 3HXPA 3A6ZA 1IHXA 2WKQA 1H42A 5C1BA 4WOPA 1XRSB 3E0XA 3QG5A 3OLXA 2YDYA 4QBIA 2R00C 1DAHA 3DXZA 3QF4B 3WJAA 5BWOA 1IXSB 3GAZA 4DWOA 3ILSA 3MTIA 4JEIA 1ONPA 4DR4B 5A9TA 1A7UA 1JIJA 3I6MA 1V9LA 3L7YA 4YJ2B 2NUAA 3RS3A 2DCMA 4BZZA 2F00A 4V0MA 3LXUX 1BE6A 2ZEJA 3L8MA 4PO3X 1JEOA 4BGUA 2CJYA 1L4KA 4WFKA 5AH0A 3TDKA 3VYUB 4IDBA 1ODCA 1M72A 3SQLA 4ETMA 2HF2A 4N5DA 2XZDA 3ISVA 3WLKX 3A8JA 1E0SA 1ISIA 2H11A 2XQJA 1MPXA 2AQHA 4K26A 2ZWIA 3MJSA 5J5CA 5EKSA 4D4MA 1UKEA 1JJFA 5F9MA 1ODLA 1X9IA 2V8BA 2ZPTX 3BMCA 2PSSA 2XECA 3JSXA 5EKDA 4E7PA 3K0EA 2YR0A 3M0EA 2DFNA 2WIGA 4X7RA 5K1ZA 3WLHA 3ZKWA 4C3UA 2FPPB 4RPDA 2C7BA 2O50A 3L0BA 4UARA 4DWWA 2WE7A 1KY4A 1ZM2A 4YIHA 2C3YA 5EGSA 4KN8A 4R81A 4BLUA 2HIAA 4ZANA 5K8IA 2O3UA 3SK0A 2DR0A 1PZFA 2W22A 4RBNA 2XWQA 5CTJA 3RS2A 5LQMA 1X38A 1E2NA 1MXHA 1UBKS 1YB7A 4D3YA 2JFNA 3GEIA 5AKYA 5EJ2A 3WNQA 1ECCA 1XNGA 4MTCA 1DIHA 4MRVA 4P81A 1N9GB 3HWRA 2W6QA 3TEJA 1JAYA 3WQBA 3OEHA 3RPEA 2G0AA 3DL7A 3FYCA 4ZI7B 1ONNA 5KYVA 3KJNA 1UDCA 2ZI6A 1VC2A 4DV2B 4RK4A 5E6RA 2B99A 4K5QA 3GMIA 4Y1RB 2ZM5A 5EZ6B 2I7DA 1WUYA 3DB1A 4MP8A 4D3XA 4QOFA 1TCUA 2LDBA 4GPEA 5ADUS 5K0FA 1L9KA 1R7RA 3NT2A 3ZCRA 4WEQA 3T3IA 3NHUA 2H9YA 3LL7A 4KLCA 3GZ4A 3QVWA 4DVGA 2RGXA 1PL7A 3ZTTA 3SDSA 2Y1LA 5EA2A 1LJUA 4KE8A 2I91A 3AUAA 1VQ8B 1I6WA 1Q1NA 2GT1A 2X22A 1IHMA 3PYMA 2R9VA 4G63A 4ZREA 4S1WA 3U26A 3OM9A 1W59A 2ONJA 2YOGA 1GQFA 4KFSA 4DKJA 1NHWA 1TT7A 2JCXA 3R4VA 4GOXA 3DZ8A 1PEKE 1B8PA 1RSZA 1TIPA 3MLBA 4L6IA 4LZJA 3WTBA 1RPZA 2JFYA 2C78A 1Y9JA 2HHLA 2QVLA 4MA5A 1GZ5A 1ZXXA 1IFXA 4J9UE 1F5SA 1YZ3A 4ZJZA 5EFZA 3NORA 3A6LA 5E2IA 4QC2A 4MLZA 1V8DA 2G83A 1QVRA 3G2PA 3KSUA 3LVRE 4KO3S 4OI0A 2O7SA 4MKGA 4CEJA 3I37X 1BWSA 1KYIA 3I58A 6REQB 3N1UA 4XWAA 3OG9A 1W7AA 2XRMA 3FBTA 3M49A 4PGHA 4AO8A 1TO6A 3ZBUA 1NMSA 2XCUA 1IPEA 1ZRSA 1Z6PA 4BWYA 3KWFA 3C3KA 5FIUA 5CVUA 3AM1A 4RWZA 5ALUA 3VNAA 5LIRA 3AQ4A 3IBFA 3OJWA 4ND8B 5HIJA 2R44A 3DGEC 3O9MA 1W29A 1R4NB 4TWJA 4YACA 2D54A 3ZHRA 5BVGA 2X19A 5JO9A 5A4FS 2E3JA 2XKKA 1C9EA 3LAWA 1YR6A 4LXYA 2V3WA 4X3CA 4ZRDA 3UWDA 2W2XA 5A7FA 1FP6A 1SZCA 1ZW6A 4QO8A 3CVYA 2ZZQA 2FR8C 1SQ5A 3VO1A 1YQQA 5LQCA 1IC6A 1JTEA 2YY6A 2G04A 4K28A 4UHEA 1Q7TA 4US1R 1YCFA 3DAOA 4WESA 3OJXA 5A88A 3IDAA 4JR2A 3V1KA 5TSDA 4MB2A 1GYQA 4IZOA 3GDGA 2XOXA 3BDAA 1F6DA 4GKAA 4NH0A 3TI9A 3MOIA 4N7JA 1EVKA 2ZRBA 3KOMA 1YK1A 5C34B 5B4TA 1LLDA 1N1MA 3WFZA 2Z0MA 4C07A 4BTVA 4RIFA 1VBMA 2AVNA 2I34A 2Q5OA 1G20E 3W8FA 2XCTB 1PDOA 3JQGA 2GGSA 1V1MB 2WK1A 3HYNA 2Z57A 4BRSA 3AHEA 3AR5A 4XCQA 2X0EA 1CP2A 1MQSA 2QVYX 2MSNA 2GKSA 3JQ8A 2JIZA 1DAEA 3UATA 1N6IA 3FPLA 1I2CA 1J06A 1Z75A 1MC8A 3L8GA 3OT5A 4QBKA 4R2KA 4U2FA 3FIUA 5EJMA 1OT3A 3RFFA 4C0HA 4CG1A 3K6SA 3KVVA 1KZGB 4JXZA 1ZDMA 5HFNA 2IYXA 4MVJH 3AM3A 1A9OA 2FQWA 1V6SA 4DREA 3A32A 1JEEA 2P9TA 3EVZA 4DIFA 4MV8A 4CM8A 1WR8A 4DV0B 2CLDX 1OKKA 3F4LA 3CCSB 1S2GA 1WUJS 4Z4RA 1K27A 1KP3A 2FMIA 1UBGA 4WFIA 4FDTA 3HXMA 4D8UA 4RMNA 1ZHFA 1T0PA 3AI2A 3SXPA 3VYVA 5HNKA 3WGQA 2Z4RA 1I0ZA 2E4WA 3WLTA 3WP0A 3LYAA 4X63A 3EEQA 5BV1A 5KJ1A 2R8EA 2XRZA 3ZOKA 1YFZA 2LGJA 2FUCA 3DKKA 5IAJA 3WSVA 5IHXA 3EAFA 4DYHA 4YPOA 2WTXA 2VT6A 5KX5F 5A5GA 1COWD 1V4VA 4RPHA 5FI0B 3WAKA 1V43A 1GA1A 1L7AA 4DCTA 3QJ5A 2BOVA 4JC4A 5IJ9B 3P97A 1T6BY 4PC2A 1H23A 2WVHA 4GBGA 4CTMA 3B3AA 4LFCB 1E3IA 1RYMA 1XTKA 3MINB 1N2GA 4LNUA 3WQSB 1IWBB 4LXHA 3SZGA 4K46A 3AINA 2E1RA 1ZMBA 5ESDA 3M8KA 5JNSA 5LYJF 1QRAA 3MJHA 2FQYA 5FHRA 1RQLA 3OX3A 5JPDA 4RTSA 5FBZA 4FONA 3UYLA 1C4WA 5GMOA 1Z5OA 4Q21A 2ZWVA 2JJQA 4NX2A 4ZGNB 1TRHA 2AOVA 4UREA 1FPQA 2C5GA 2R00A 5ILQA 3H8JA 1T9KA 4PG6A 4WASA 3RUFA 3AB7A 1CLEA 2WFAA 4RCYA 2DU8A 3TIVA 3KR0A 1KMIY 3S40A 3U3OA 2Q2VA 3MS2A 1T9CA 2GJSA 3TCXB 3TR5A 2NXWA 4QASA 2NN3C 3KKQA 3I32A 3A58B 4TMKA 5AW0A 2COUA 4QECA 2FOLA 3NHFA 5I45A 5T3UA 1PDVA 1NI3A 1IHPA 3GN1A 4EQZA 1EFVB 5AW7A 1EIWA 1VIVA 3HGMA 3CW9A 1IQRA 3L40A 1L5ZA 3SCZA 1QHFA 4YJ3F 4KXYA 3FMVA 3E53A 5T7BA 4M54A 2AYYA 4KQ2A 2YZKA 3VPBA 4O08A 2R96A 4BEBA 4ARZA 1OLOA 2WQ6A 3G8DA 2XCRB 3TECE 4YMWA 4LK2A 1U7UA 2VHUA 1P1KA 2Y1OA 3ESAA 4OHBA 1EG2A 3CMMA 4B4VA 3IAAA 2DLCX 3EVGA 1ZNQO 3S4YA 4CCYA 1JHOA 1KDTA 4IJQA 1M6NA 1DARA 4HSEA 1W2HA 1OREA 5A3RA 1FOEB 3DW3X 1DQYA 2A5YB 3KKLA 4ZVRA 1YB1A 3H42B 3QRWA 1I51A 1M1YB 1UR5A 4CMKA 2O2DA 3E05A 4K9KA 4DDMA 5T4FA 4OJYA 3ST7A 7ABPA 3DZKA 2ODAA 4K9MA 3KOWA 3KVNA 3F7OA 2G28A 2JGAA 3DR3A 2C7VA 2QQ0A 1EKXA 3IQDB 2WM3A 3NH6A 1JGTA 1MO5A 1R5JA 3E9NA 2OQRA 3IALA 1L5NA 4CETA 4DUGA 3NC4A 3E3AA 4JFRA 1G5RA 3VV2A 4BJ6A 3R9IA 5JAHA 3ZHCA 2OQ2A 2J4FA 2IEGA 1M2GA 3WOHA 1J8QA 1UEJA 2PFSA 3HJCA 2XYRA 4G8DA 1XNJA 4B4KA 5J2UB 3A2NA 1X7YB 6GPBA 2ZYRA 4L27A 1JQAA 4ZP1A 5CFRA 1P3Y1 3PQEA 4AJLA 2GN9A 1BQ3A 10MHA 3RU3A 1OI7A 3EY4A 2GDZA 3IPYA 4IH9A 4GU5A 1MOSA 4GI5A 2YFHA 4WFJA 4WJKB 5GPBA 3THSA 2VHXA 4NYJR 2WEKA 2EIHA 1NUUA 3A3PA 3HHEA 1QAMA 1U63A 5LKAA 2EG5A 4RDLA 1J2TA 1WZIA 5ARCA 1PWYE 4RTNA 1RWOA 3M2TA 5FL7D 1SCBA 1HH4A 1P4HA 1W94A 3RVOA 2OCXA 4RPCA 4MMYB 3A6KA 4IJMA 4WOJA 1JHRA 3QUQA 4D81A 4OQYA 4EMUA 4V1CB 4QPDA 2PSJA 1QX4A 4L0DA 5DIZA 3FYSA 1USIA 2EBFX 3AEKB 3SZMA 2D74A 3WSWA 1DFHA 3LQ1A 2WE8A 4ZCTA 3E18A 3EMVA 3ESQA 2UYYA 5H4HA 4X7EA 5DX1A 5LP6C 4KODA 2UXDB 4F7WA 1Z0AA 5K99A 1JFRA 5JZSA 2UYQA 2FW6A 1E4YA 2FNAA 4I4CA 4NXNB 4L8JA 2V45A 1T2VA 1YFLA 3EMKA 1EUDB 5AD1A 1NUPA 4C7KA 1QR6A 4MVJI 4E14A 2H48A 2PH3A 3LCUA 1XMIA 4FGWA 4WUVA 2FGKA 4L9RA 4Q24A 5EXPA 2YW2A 3FOZA 2CF6A 1U5AA 3ZGOA 5BT9A 1ACJA 1UBJS 2VS1A 1HOXA 1RWPA 1C8LA 1VGQA 3CQ9A 3KVOA 2XE4A 3LNCA 1ZN7A 2UYGA 2VXBA 3KQSA 3Q5GA 1UP6A 2PGNA 3SLGA 2O8CB 5HG0A 3IAM6 4TT3A 4RD0A 1OPRA 3M6AA 4BBPA 4E5PA 2TS1A 4XWOA 5FI1B 1U2TA 5C7LO 3UPTA 2B9EA 3DL0A 3IJRA 3A9SA 1NI4B 4ZC8A 4F5ZA 1QZUA 2R5WA 1Y8RA 3N2EA 1K8RA 3T95A 2I54A 3ZEIA 3HGQA 4D9NA 4PG8A 1D2RA 2JG3A 1ADYA 4GI3A 3E23A 1ZJJA 3MTJA 1FXWA 1UJCA 3AY6A 4ZQCB 2DETA 2ANBA 2XAUA 3I23A 4R5MA 5ICGA 4IDFA 3DR5A 4Y9UA 2JJ8A 5AUQA 3IUSA 2ON6A 4ZHSA 2C5BA 2Q6KA 1HZZA 2C0CA 2GCOB 1VG8A 1N5JA 2A1UB 1LXCA 3TBFA 3WHLA 4I2NA 3MFQA 4W7HA 1NOIA 2PTGA 2C98A 2OHXA 2W4QA 3IP8A 3ETNA 3UZUA 3MHTA 1YHYA 4UQLA 4CG3A 1R00A 3AU9A 3LW8A 1EUCB 5IKEA 2XMGA 4MGHA 1SBIA 2OT3B 3LKVA 3CX6A 2FQQA 2ZIZA 5BSFA 3MT7A 3BG5A 1I5RA 4ZCIA 5G3YA 2E21A 3CISA 4EWLA 4P98A 4TWIA 4KR2A 1Y5MA 2HT6A 4AUMA 4BC0A 4JC8A 1VM6A 1YS4A 2BBOA 4IJUA 4IUDS 1Z07A 2BTQA 4J2OA 4JBYA 3FGNA 1NAHA 1VL6A 2W5UA 3UTCA 3V6MA 4ZHQB 1RADA 2PUWA 3LQYA 5T6MA 1ES9A 3P2OA 3E20A 1ZUHA 4GECA 4J90A 2AQ8A 2NTJA 5K3CA 1E4EB 1UOEA 4QPCA 4LOKA 3C3CA 2HHHB 4MARA 3QI7A 4NPAA 4X6LA 1U3UA 1LDGA 1H2YA 2L2QA 2O2GA 3CMCO 3MRVA 4EY6A 1E3JA 2C8JA 1H2ZA 3V2GA 3IKMB 1NP7A 1Q57A 3L79A 5TQ0B 4P4LA 3VMFA 1K5GA 3SZLA 3OESA 1OBCA 1NVEA 4C0WA 1YB5A 1YAJA 2JCBA 1B4DA 1N2IA 1G9XA 3SBDA 1ZUNB 4W5OA 2BMEA 1IE3A 4MINA 4FGKA 2QGGA 3S8YA 2E6KA 2JBAA 2R8BA 4EPXA 3SGLA 1IWPB 3CHYA 4XSGA 2O5VA 5FA8A 5FHQA 2VHWA 4KXVA 4CYMA 3AHJA 5CGQB 1QCCA 2EW2A 3X1DA 3ZE8A 1F1JA 1SHJA 1Y6GA 2NZVG 3RVDA 2ZS8A 4GOND 5DLPA 1N75A 3NCTA 4F2HA 3SXUA 3MPUA 4JLUA 1X87A 1Z22A 2Q50A 3IUEA 3O8OA 5I51A 2ZJ0A 4DUZB 3TVYA 3THXB 3AJAA 1YZVA 5KJEA 2EZ9A 3HJTA 4GLBA 3LPAA 1XZJA 4HNSA 4BAGA 4QWWA 3AO0B 5FOUA 4ZCRA 2J0SA 3W5IA 3O3OB 5M04A 4W9MC 5DNWA 3AFIA 5AT1A 2O23A 3OT1A 4ZI2A 1KC8D 1P7PA 4BNJA 4FMDF 5FTNA 5DPMA 1OLXB 2G5CA 1E2IA 2YXPX 3ABOB 3V8NA 3JRWA 1GG2A 1KJWA 3LOPA 1GZVA 3ICPA 1YKGA 3P9YA 5H9WA 3WRXA 4E4TA 1DQPA 3IPXA 1ZN9A 2LDXA 1OTHA 1U9CA 2NNLD 3NTRA 5JAOA 3A6HA 3DCIA 2WOOA 2FRDC 1FQWA 2ZVDA 2HTFA 2VFAA 4MVJG 3RS8A 1YCDA 2OBLA 2VJOA 1CUYA 4C4PA 1ORDA 2VBVA 1AKQA 1GNLA 2H1WA 2IKSA 1E3QA 4OPOA 2E0IA 3HZOA 4GL4A 1DLJA 1UXHA 1N5KA 4KSYA 2WWVD 2QXTA 3BY1A 3G6WA 4EKIA 1QTNA 4WDRA 3PC3A 3C6KA 3H8WA 2VBUA 3UMBA 4ZIRA 5JUWA 3VPDA 5IZ4A 4M8KA 3JZIA 3E7PA 2JA1A 3K32A 3O82A 3L7DA 3OFVA 2I3GA 1I1OA 5I6DA 3TGLA 3E3LA 4R7TA 4ZU6X 1O0BA 1D6JA 1DRWA 2PJUA 3DOJA 4QYIB 2Z2KA 4DM3A 1T2UA 3GOQA 5HYVA 2Q3CA 3IPAA 4JCOA 5IUNC 5DHRA 1TAUA 2NZYA 2ZRNA 4OGLA 3BRWD