4RD1A

Structure of aif2-gamma h97a variant from sulfolobus solfataricus bound to gtp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGAEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 114
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd1A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd1A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd1A01
3LX5A 1EX7A 4A1FA 5H8WA 2GESA 3B9QA 4M4SA 3QI2A 4U7DA 5A0FA 3R8FA 3SYNA 1OGIA 3L8ZA 2D7CA 1G7SA 3L2OB 4HSEA 4AYWA 1R0XA 1COWA 1N6RA 2RGEA 3K0AB 2OLKA 3QBTA 2GZAA 2EIXA 1N2CE 1VYVA 3IO3A 4PAQA 3RHFA 1XE1A 1DARA 3ES9A 3FE2A 4G5QA 3LXRA 3QG1A 2WM9B 2D62A 1OH6A 3OHMA 1FMJA 1TEXA 1LNZA 4M1SA 5FOUA 1OFHA 3AKYA 2Q3HA 1VMAA 2G88A 3A1SA 3AQ4A 4DC9A 3SQXA 1NSTA 4QM6A 1H85A 1ZD9A 5KPDA 1EXMA 1FOEB 3N5CA 3KJGA 3FKSA 4DSNA 1G4AE 4HZUB 4TYPA 4MUBA 4ZCIA 2F1RA 2KE5A 4FK8A 1YQTA 2XTMA 1BOFA 3NBZC 1FPMA 4CT5A 2FH5B 3KQKA 3TSWA 3ADDA 3M1IA 2OFXA 3SJBA 1N6PA 3H0KA 4TLAA 4B3DA 3SEAA 4EQ6A 3VR1A 3VNVA 4CEHA 1GFIA 3EPLA 3I32A 2BVNA 3T5GA 2MMGA 4R9UC 2V6JA 2XTNA 3VO2A 1OH7A 4WAUA 1NJID 1UADA 1E1QA 1SXJC 2CMKA 1U99A 3W6PA 2OCYC 3BFVA 4M9XA 3WMGA 3B78A 1GNRA 2QA5A 3VHXA 1KI6A 3CBQA 2PCJA 4C2UA 2PT5A 1QHNA 1QHHA 1DO2A 2ZJ5A 1E2QA 4FMDB 5JCZA 1OIWA 5K8UA 4L5BA 4RY2A 4NYJQ 2GXSA 5FH9A 2O8BA 5JSZA 3K0CA 3R9XA 3BAFA 3KUCA 4MYHA 4QBFA 4EQ6B 1E9AA 3A36A 1US8B 4Q4AA 5GJWC 4MUAA 4TYYA 1NLZA 3KJIA 3DOEA 1KK0A 1HQCA 3K9NA 4G5RA 3VR2A 4Q1CA 3R7WB 4TWZA 1V43A 4DT1B 1KO4A 1G16A 4FXPA 4JLDA 2AK2A 1IY0A 1HA3A 1DPFA 1NLYA 2ZYVX 3TUIC 3W8RA 5DNYB 5SZIA 3PG5A 4B71A 4JJZA 4B73A 1XEXA 4YONB 1GR1A 3I5YA 1Z0FA 4PC3A 1AS2A 1ODFA 5TVKA 1FQJA 1N6HA 2FPLA 4I1OA 4HAWA 4KO8A 1QHHB 4BRWA 3TIFA 3FJOA 2HF9A 2RGXA 3P20A 1KSJA 2XZOA 5CK4A 1XMJA 2OCBA 4GSYA 2AX4A 1IM2A 3K70C 4OKSA 1Q1QA 2IYUA 2YWGA 5FTKA 3N2IA 3NBFA 5DH9A 4KYUA 1KI1A 2IUTA 4DCSA 4L9SA 1Q1EA 3ECCA 3RS4A 4BZXA 2QBYA 4L15A 3C5CA 2VYQA 1H8ED 3F8TA 4OBEA 2V9PA 3VNUA 3B13B 3GJ7A 3F3YA 4LUCA 4OL0A 4MYCA 4TMVA 3RS5A 1D2MA 2CJWA 2OBLA 3HR7A 4NCJA 2IYSA 3PIRA 3AGQA 1IN8A 1GNPA 1JXOA 3HP1A 2XSZD 3HYRA 1UAAA 1R2QA 2DERA 3BH7A 3IIJA 2JJ2A 4P6VF 3LDAA 1QHIA 1FQKA 2C98A 3ZVNA 3CCSB 2P5SA 1XFAA 2FDCA 1QF9A 3NHBA 2REXB 1W46A 3CPHA 4C4PA 1P2SA 3QFSA 3WMFA 4DJTA 4Q1AA 2CNWD 2QAGA 2FFBA 2WJVA 1DAIA 4BFZA 5L3QB 1ZNYA 2VHUA 2ZS9A 3ZIAD 3OEED 2E1RA 4D0GA 2CK3A 2QQEA 4Q01A 1NVUQ 4HLCA 4UXIA 1G6OA 4E07A 3UWOA 4KSBA 2QBYB 1D8TA 3A4LA 4M1MA 3WBJA 3CRVA 5AWFC 4ZV4A 3KZ1E 4YAWA 4Z1MA 2X2FA 2JDID 2BCGY 2FEOA 4RFVA 1E9SA 1E9DA 2RHMA 3ZJYA 3U2QA 2QY9A 4KI0A 4ZGQB 4IDPA 4QHSA 3QSYA 2ODNA 3ADBA 4HAUA 3RRYA 2RGDA 3THYA 2QT1A 2QI9C 5FUYA 1FFHA 5J47A 3V76A 1XJ0A 1ZD8A 2C77A 2XJ9A 1IN6A 2YVUA 4KSCA 5G3YA 821PA 5IK2D 5LPNA 2IYZA 2ORVA 1SULA 2W6JD 4Y0AA 2ZIAA 2ZM5A 2RGGA 1RYHA 1Q86D 2O0JA 5KDLA 4PQFA 4UJ5A 4YDHB 2ZI6A 4ARZA 3QF7A 1KZGB 3JQPA 5KSZA 5BYJA 1W0KA 3FFAA 4LJAA 3LD9A 2WSMA 1XCGB 3SFZA 2GBLC 1LFDB 5JHGB 2QTLA 1E4YA 1Q44A 2GWHA 2WWWA 4EPYA 1YZUA 2F3TA 3GLGE 2O0HA 5EXPA 4IW3B 4Q9KA 3VTKA 1OB5A 2CBZA 5C46F 4BLSA 3LBIA 4MGIR 2EWWA 3HPRA 4R71A 1KO8A 4LJ8A 3A37A 1B23P 2BDTA 1P72A 4POAA 3BERA 4A8JC 1XCMA 1E62A 4AG6A 4LBWA 3EZ7A 1VCNA 4LC1A 2WWYA 2HT1A 3GQBA 3GCGA 4LV5B 5CM9C 1R6BX 4KBFA 4RFSA 4EH1A 3PFIA 1M34E 4C0SA 5P21A 4D0LB 2DR3A 3VR5A 2IEYA 2OCAA 5B64A 1G18A 3CC7B 4B44A 1OFTA 3THOA 3PEYA 1JA0A 4YAFA 1N5KA 1J70A 1A2BA 2C95A 2NG1A 2GJ8A 2G77B 4BECA 2G1JA 3ASYA 2C03A 1P2UA 2QL6A 4RSGA 3FVQA 1W2BB 4QJ3A 2N46A 4Q1DA 3DM5A 4PGOA 1LVGA 1O3YA 2QRZA 2BMFA 4NL4H 2OM2A 3WBKA 3BB3A 4R7ZA 4Q00A 3SYKA 1Q21A 3VU9B 2B21A 5CJ2A 2JGNA 1FTNA 3H1TA 5JJIA 4NCIA 1SQ5A 2F43B 1ZNZA 3SR0A 3FPAA 3OE7D 4FCTA 2OBMA 3KL4A 1KI2A 4RFSB 3EZ9A 1P2TA 1AMOA 5C4GB 3GFOA 5FBQB 2ZRJA 1RFLA 1ZNWA 4MKGA 1Z6TA 4DUGD 2J7PA 1FX0A 1EP2B 2PJZA 3W3AA 2HUPA 2MSDB 2PZEA 1E2NA 2GAAA 2ZI3A 3G82C 3GJ4A 3QE2A 4TLCA 2WPDA 2GJ9A 2WV9A 1LV7A 2FOLA 3ZVLA 4TQ9A 1CRPA 2CLSA 4AKHA 4MGZR 3QUSA 4DDUA 4QJ4A 2HV8A 1OE0A 3DOFA 3PJRA 1PUIA 1TADA 3DHWC 1NBMD 1N8RD 3C14C 4ERNA 1G3RA 1R7RA 4TT3A 1VQNB 2PMKA 5BQ5A 2L0XA 4DDVA 1JR3D 1KMHA 3CONA 3K09A 4EFMA 4PHHA 2ZRIA 4Q7MB 1Z08A 5CYPA 1Z3IX 1UBFA 3CWZA 3EXAA 1XPRA 2GF9A 2ZI4A 4YQFA 1HT2E 5J4LA 2IUSA 4YMTA 1Z0IA 1FX0B 1EG7A 1FNMA 1CJUC 1U9IA 3ZS8A 3A1UA 2XB2A 4DVGA 4MA4A 3CCMB 1NNEA 1YR8A 1Q12A 4A2QA 1E1RA 2IYTA 2EFCB 1KO7A 2NPFA 1EFRD 5EP3A 2ZPTX 4RD0A 2DEUA 4IXMA 4LYJA 4DWJA 1U98A 3QXCA 1X8LA 2VP2A 2CCJA 4QNMA 5JBQA 2NO7A 2OE2A 4TL9A 1E2GA 2ZRGA 3FOZA 2XXAA 4FMCF 3FWYA 1VQ7B 2QRNA 1ZM4A 3CF6R 2VP5A 2IXGA 2D7DA 1FP7A 3KFXA 3MJHA 3VR4A 3P27A 1VHTA 2LWIA 5IDVA 4PQYA 3TBKA 5DN6D 2BOVA 3L0SA 1WRBA 3K0FA 4YMWA 4RD3A 3PITA 1S1MA 2FV8A 2YJTD 2ZE5A 5KYKA 2VP4A 2ZU6A 3WYFA 3AUYA 5L8VA 3KKNA 1Q82D 1DADA 2ZRLA 4HLQB 1JAHA 2A5YB 2P0EA 1KKMA 2ZR0A 1NN5A 1KTVA 2IW3A 1II8A 3NTUA 2OEPA 3MWLA 4DLYA 4Q1BA 1VHLA 4B3FX 4DLSA 3OIWA 2GXAA 1KO5A 3GLIA 4IDOA 1W4AA 3LV8A 3W6OA 3T61A 2P6NA 4A82A 1XD8A 3REFA 4DLXA 2DY1A 3H4MA 4V0NA 5D3MB 1CJVC 2FWRA 4TMZA 2Q3MA 1E2PA 2VIIA 1DELA 3QE0A 1EP1B 3H84A 4G3XA 1IBRA 1G41A 1KQSB 2X8AA 4KFTA 2QSYA 3KQLA 1UM8A 3Q5DA 1NL3A 4LPSA 4IEIA 2B8TA 8OHMA 1Z5ZA 2XJ4A 4AURA 3KFVA 4O2RA 3L8YA 4Y0VA 3QVUA 3JQRA 4D80A 4ESHA 4W9MC 2BKUA 4NYIR 2EQBA 2ATVA 4Q1EA 4DLTA 4DSUA 4E09A 3O8RA 4O3MA 3OIVA 1YE8A 3CLVA 4JJKA 1KJZA 2OXRA 3LAWA 3Q9LA 4LJ5A 1Z6YA 2GJSA 3OFNA 3UXMA 1E9EA 1ESNA 1Q22A 4A8JB 4BZQA 1Q0UA 2QNRA 2IYXA 3SBEA 1T8UA 4PO8A 4NHOA 1W49A 2LKCA 3LXXA 1OH5A 2NMVA 4QHTA 2GPJA 2KWIA 4Z8YA 4QBHA 5GJCA 3GFTA 1QGYA 1QFZA 2AK3A 2NO1A 1KOFA 1Z0JA 2RAPA 4PAOA 5L3VA 4XOIA 5J4YA 1AS3A 4M21A 1VQ9B 2ZUDA 3Q72A 4YMUA 3GJ8A 5HZHA 1L8QA 3AVXA 1LY1A 1ZCBA 1EWRA 2BBOA 4MRSA 1II9A 3FDIA 4EPVA 2JLWA 4IVPA 3CMEB 1W0JA 2AXNA 1VYUA 1W4CA 2OXCA 3HU3A 1U8AA 3L43A 3EARA 2DFNA 1SVOA 2IXFA 4GPTA 4HAZA 5FL7A 4NTZA 3WHLA 4Q4LA 4IVQA 3CPWB 2GZDA 3EW9A 4UNPA 3AUXA 1Q1BA 1UPTA 1E69A 2IC5A 2Q21A 1X3SA 3RRMA 5JLJA 3W2FA 1IOZA 1K6MA 5HCNA 4O25A 4NCKA 5F2EA 1P9NA 1NF3A 4FMBB 3BORA 3UG6A 2FG5A 2ZSEA 3ZLJA 3PUZA 4ASUA 3IIMA 2JIZA 2VHQA 2R6GA 3GPLA 3HWSA 2VL7A 2GQFA 4F91B 4DSOA 1UBGA 4RD4A 2WSSA 1F60A 4RCYA 1EK0A 4JLKA 4N0DA 4QGGA 2JLUA 1YITB 1Z0AA 5KSWB 1E3MA 3LW7A 1AGRA 5EE5B 4LHVA 3QKSB 1S4QA 3BFXA 2QN6A 1KI7A 3KB2A 4OQLA 1KYIA 2FX3A 1RJ9B 1T3SA 3KKQA 5B30A 3PUYA 3IDQA 4K1XA 1NP6A 1YKSA 4HATA 4XIGS 2F9MA 1UF9A 4C9BA 2FU5C 3QEOA 2YWEA 2CL0X 1H65A 4EPWA 1FMLA 2JLVA 3IUYA 1KI8A 3A8TA 3EWAA 3I61A 1Q3TA 1KI9A 1VQPB 2BMJA 5JJLA 4TYWA 4Q7LA 4QKQA 4LHXA 1NSFA 3TMKA 3GLIE 2VNHA 4C43A 2PZGA 5F9FA 3ADCA 2A2ZA 1T5IA 1IXSB 1N6LA 2QT0A 5CIQA 2B7CA 1DAKA 5D3QA 2J45A 221PA 3LFUA 1KMQA 2OV2A 3CMAB 2AHOA 2XOKD 5JWOA 3NVAA 4LI0A 2JJ1D 1KSFX 3U44A 4C0QC 4KHZA 5CJPA 1QBKC 1YRBA 3LWNA 2H1LA 4NZYA 4HI0E 3SFVA 4EJSA 3ZQJA 4IHQA 3THXB 1N6IA 1XMSA 4GP7A 1MOZA 1DG3A 4LYAA 1B0UA 1PLKA 5EP4A 3T35A 2A5JA 1Z47A 3QPVA 4HDOB 3HPQA 4KLNA 1N0UA 2EU8A 3EZ2A 1NVVR 2JA1A 2F1JA 2YOGA 1ZYUA 2Z43A 4XSGA 3WRYC 2ODWA 4YXWD 1K73D 4TLEA 4D6PA 4P4SB 1E99A 2RGCA 2ASEA 1X8KA 2GA8A 3TH5A 2FGJA 1RVDA 4HE6A 1B2RA 3VO1A 1W4RA 4QC2A 3K53A 1OLOA 1VQ6B 2FNAA 4M8NE 1TQDA 4A6XA 3NH9A 4MDEA 1S72B 1BX1A 4XD7D 4AKEA 2R6HA 1AM4D 4IFBA 3U44B 2CLCX 1IY1A 3E20A 4ABYA 1G4UR 1FDRA 1NKTA 3IQXA 4KXFB 2QPOA 4TYNA 1CF4A 4M1KA 1Z6XA 4EJSB 1EFHA 4JLJA 5DISB 1G5PA 1KZ7B 1UEIA 1OGJA 2JATA 3Q8XB 4OK3A 4UJ3A 3OIUA 4X8LA 1GRRA 5EMNA 2TMKA 3TKLA 2ERYA 1GJRA 4JL5A 4CDGA 1E64A 2OBNA 1TF2A 2QM8A 3NIBA 2EWVA 3Q85A 2KI5A 3K0CC 4OJKA 1ZMXA 3BWDD 1J99A 1UBCA 2GJAA 1TX4B 4DCTA 1EP3B 4KITB 3ZDQA 4DLZA 2FN4A 2IA5A 4AD8A 4WVFA 4PC1A 3A1TA 1NVXQ 4M0LA 3MFYA 5CB6A 1NG9A 2Z83A 2PLRA 2ZS7A 3L0PA 4S35A 3AP3A 3AV0B 2AN9A 4JT2A 5JS8A 1F6BA 5L3RA 5EZ5A 3LX8A 3U4QA 1UMKA 2OO7A 2QMOA 4LV8B 5EE0A 2RC5A 1CR4A 4HZIA 4V0OA 5SZHB 5KHOC 1MT0A 1M1YE 1N5JA 2CL6X 4HDQB 3CCUB 1VCMA 3U3KA 1GDDA 4ESVA 4HLUA 2RB4A 5IRCD 5CYOA 3DKVA 3THWB 4CEJA 4JL8A 5E7JA 4BEJA 2F9LA 1D6JA 4I81A 4MRPA 1H8EA 1CLUA 3LA6A 1KDPA 3CR7A 3W5UA 2VPPA 3L0IB 1RYFA 3KQNA 4AKIA 4XWAA 3T1QA 3X1ZA 4XVUA 4DEXA 1T5LA 1P5ZB 4E5UA 2ZRCA 4RZ2A 1JECA 1GZSA 4KVAA 1KAGA 3MMPA 3D8BA 4Y9RA 2QSZA 4BLQA 2IYVA 3MD0A 4N1AA 1UKZA 3GFPA 1XEFA 5FPTA 1Z83A 1NKSA 1WA5A 3ZH9B 3HR8A 1XRJA 1J8YF 3I8SA 4GRAA 5FOTA 1M90D 4Q21A 3MLEA 2CNWA 3E1YE 3LRPA 2PZFA 1YR7A 4V0KA 3ZZ0A 4HUQA 4C0JA 2CL7X 1GKYA 3W3ZB 4Q47A 1KHTA 3ZIAA 1JPJA 3OEEA 4MKIA 4DB2A 2O8DB 1YZNA 4GZLA 5DGXA 1KK3A 2QAGC 3T12A 4LK2A 5FOVA 4TL6A 5DO9A 4M9QA 1P3JA 2X19A 2JDIA 5B57C 2FE4A 5THXA 3VFDA 5KOYA 4DRZA 3ZBUA 2OK8A 3EC2A 4GOJA 3VQTA 4US0R 4I4LA 4NU0A 5AJZA 5FPKA 4PQRA 2OAP1 4A0FA 2F7SA 3P4XA 4Q66C 4DCUA 2IYWA 1Z2AA 3KB1A 1GWNA 1OW3B 3C8UA 1QVFB 2A78A 3UG7A 4RCZA 1N6NA 5IK2A 1TF5A 1MO3A 1OIXA 2W6JA 4P4TA 2OLJA 4L16A 3K0SA 2MMCA 3TSOA 4FCWA 3W34A 4HUQB 2Q9BA 2DWOA 4X8HA 4AYTA 3U6BA 1CIPA 2N1BA 2J0QA 1E2DA 1I4LD 2BEJA 4JSYA 2QTHA 1NRJB 2QPTA 3BE4A 4TTRA 4WBSA 2PH1A 1M6NA 3KXLA 1Q7YD 1VIYA 1CBUA 4ZI3A 1P2VA 1XJCA 3KUDA 2WICA 1GTVA 2Z6VA 5CDFA 5EJEA 4CYMA 4HB2A 3TNFA 121PA 2J0UA 3SQWA 2IS1A 5A5GA 2OAQ1 1CJKC 4FWIB 3VKHA 2E9SA 2GCOA 1EGAA 1YZQA 1ZIOA 1Z63A 4Q19A 4HUTA 2VYFA 4TTQA 1E32A 1AK2A 2G0NA 3EIEA 1R0YA 2QUZA 5AUPB 3GLFE 3SZRA 4Q9JA 2QENA 4C30A 1XB2A 4A36A 3IKJA 2ODBA 1G5TA 4KODA 1I2MA 1JQLB 5FBWB 2LCFA 3SHFA 3EWSA 2VA8A 2YYZA 4CEHB 2AFHE 3LY5A 4WZBE 3KQHA 1ZRHA 4BZPA 1Z28A 2CRVA 4I99A 2B6HA 1QH0A 3RC8A 3X1DA 3P32A 2WKRA 3GLGA 1VIAA 3T1VA 3PV0A 2QP4A 4J0QA 1TEVA 2ZSBA 1Z6AA 2W83A 2C9CA 2FA9A 1GITA 3BBPA 4XH9B 3OZVA 4JS0A 4JVMA 5M04A 4IDHA 1DE0A 5KPJA 3BFKA 3AVPA 1JALA 1JEEA 4V0LA 5HE8A 5KO2A 3ZD7A 1N5LA 2WOJA 2FPKA 2EVWX 2ORIA 2EFDB 1KI6B 1TQ4A 2HDNB 4JBYA 2WKPA 5AUQA 3RAPR 4P33A 3CCJB 1CTQA 2ZANA 2ZJ8A 4BFVA 2A5DA 3EA5A 1BIFA 2V3CC 1XD2A 3TE6A 2O8BB 3S1AA 4H1VA 3OE7A 5JSZB 3EZ6A 2CDNA 2V6IA 1VQLB 2PEYA 4Q4AB 4GOKA 5FBVB 3QXSA 4BUJA 5IT5A 1XBTA 2EYQA 2R9VA 2NZ8A 1OKKD 3VR6A 5JCPA 3RS2A 3UATA 5EXSA 4DUGA 3B1XA 2BPOA 3GLGB 4CRWB 1AQUA 1RE0A 2ZSFA 1XPUA 3BB4A 2CE2X 2FEMA 4JVNA 3W5JA 4QFMA 3KKPA 3PR1A 3KXIA 1GL7A 1XEXB 3NBYC 3CRRA 1H8HD 5EXTA 5CLQA 1DG1G 2REOA 5FPYA 1GL6A 3IEUA 2IS6A 4TN1A 1NBMA 1K8RA 3I4LA 2NOAA 1IJEA 3GEEA 3B8HA 3UMRA 2V7QA 1ZD1A 3NH6A 4G1UC 4DEYA 4US2R 3Q7QA 5EXXA 3S1AB 3NDBB 1JR3A 1P75A 4C7OA 3DVLA 5KSYA 1KK1A 1AQYA 1NVVQ 3TQFA 4U5XA 2NO0A 1VYTA 2W2XA 2IBMA 2PCLA 3SJZA 1UFQA 1GIAA 3K09C 1AIPA 3O8DA 3BC1A 5DI3A 1NDHA 4CIDA 2VLIA 1ZAKA 2CJWB 5JEDA 5KDDA 3AVOA 1KAOA 3CRMA 4TQAA 4E22A 1U9IC 1EFRA 2P5TB 3TVDA 4A9AA 4JLOA 4HB3A 1GUAA 1KY2A 1U0LA 3SJCA 3CX8A 1N3BA 5CDFE 3WMEA 4EKDA 1J7KA 1DOAA 4S2EA 2KBEA 2BGJA 2X2EA 4B2LA 1G1MA 1D5CA 2QM7A 3I62A 4KYIB 3I1FA 1KD1D 2HCJB 2QG6A 3B85A 1DVRA 3JVUA 1KSHA 3QVVA 1XTSA 1LS1A 1NN3A 2J0VA 2BM1A 4P32A 1GVHA 5KSPA 1Z29A 1IAQA 1TTTA 4TMKA 4C7OB 1K5GA 2G3YA 2QAGB 3PEWA 1L7VC 2GXQA 1PZNA 5DN6A 2PLFA 3EPHA 3N2EA 4AIIA 2KB0A 5DLQC 2FPMA 1CKEA 1XMIA 3CPJB 3FKSD 3ICEA 1RRFA 1XNJA 4KAXA 3TW4A 1ZM3A 3B1WA 4HB0A 5DI3B 4ZIRA 4PPQA 2ZJZA 3QPWA 5F98A 2DB3A 4ZDJA 2VSOA 1SGWA 3N70A 4Z54A 3PEVA 4R98A 2RC6A 1JJ7A 1RPZA 4G5GA 3RDPA 5EZ6B 5HE9A 4C0AC 3THYB 5LBIA 1ZM2A 1N25A 2D2EA 4LZZA 1T4GA 2R6AA 1R5BA 4CEIA 5JI2E 4PTLA 1AJEA 1M8PA 3FPKA 3SJAA 1F2TA 1XZQA 2HT6A 2VZLA 3EPJA 2ZYTX 2MSEB 3CKLA 2OSBA 3AB3A 3OF5A 4XJXA 2H16A 5DE3A 2X3UA 4XSHA 1IQPA 5JZVA 5IHPA 1R8QA 3RNLA 2BMEA 1WBBA 2BM0A 4ZPXA 1MO6A 4ARZB 1S96A 1QX4A 4PSKA 3ETLA 4BPRA 1U94A 4B33A 2X1VA 4M9ZA 4ZIRB 3IEVA 3PENA 3AVVA 1ZC3A 4TLBA 1W4BA 4EUNA 1MR3F 4C0BA 2GKSA 3TQCA 4DXAA 1FW6A 3IPXA 5FBLB 3CZQA 4CGZA 1TAGA 1UEJA 3OESA 4NH0A 1ZU4A 2UVQA 1N6OA 4TYQA 3DZDA 5GADl 1G19A 5SZJA 3V4FA 4V02A 4CEIB 4H1UA 3RRNA 4ACBA 1Z06A 4AF7A 2Q9AA 4MDFA 1F2TB 1U8YA 1W5SA 2ZREA 5G40A 2IEZA 2ZI7A 3GLHA 3OEHD 4YAUA 4PZZA 4KJZA 1NBME 2WIAA 2QTZA 1P73A 3EAQA 5EUQB 1P9RA 4M1WA 2OHFA 2JLSA 4LPKA 5H68A 3SN6A 4JMPA 1CNFA 1Y63A 4JIMA 3EASA 1Q57A 1JR3E 2VNIA 2BMDA 2WKQA 3GJ3A 3MAAC 5CLLA 5EP2A 1NY6A 3QNUA 3I8XA 2FJUA 2DFTA 2OCPA 3GMTA 3GJ0A 1UKYA 5KTYA 3F0TA 1E2MA 3W2HA 1E4VA 3UPUA 3ZGXA 1JJ2B 3TUJC 3A1WA 2ZRPA 1P6XA 5HPYB 3KXKA 4IOKA 4DLUA 3KTAA 3W5VA 1AZTA 3IO5A 1TVCA 2GK6A 4GNKA 4OK6A 4JKIA 3FMFA 4EPTA 4UNRA 3MCAA 2IYQA 5J5CA 1Q3HA 2VP0A 5TR9A 3NDPA 4US1R 1HURA 3CB4A 2WWGA 2ZEJA 3TJZA 2ZJ2A 1G8YA 1C4OA 3T5DA 4I1UA 4LDJA 2JAQA 4FI3C 3MHPA 2HJGA 5AJXA 4DQKA 3HDTA 3SE0A 2BSAA 3ZBTA 1N5IA 2GEDA 4NKRA 4Q9IA 1FRQA 5JI3E 3HJNA 4BLTA 2W0MA 2EW1A 2OTLB 1NI3A 1R10A 1FTSA 1HY3A 1ZW6A 3AVYA 2ZITA 1ZC4A 4FMDF 4QL3A 4LBZA 3QF4A 1GG2A 4RVCA 2MSCB 4UXJA 5FI0B 1SKYE 2ANCA 1NIPA 1QHYA 3DPUA 5TV2A 3KTAB 2RH5A 2RKOA 1TPZA 4CVNA 4BFWA 3U60B 1OXXK 3GEHA 4OQXA 1MO4A 3FHOA 3TRFA 2NQ2C 4PHTA 2R8RA 1F3OA 3IIKA 4B2PA 2RGNA 1KJYA 1KMHB 1S9DA 4P31A 1SXJE 5KNBA 1HV8A 2ZRAA 1SVMA 2OILA 2BBSA 2G83A 2JJ1A 5FR1A 5ANRB 3GP8A 5FA6A 5GJVC 5JS7A 4CT4B 5A4JA 1E2FA 1OXSC 1XMVA 2BKEA 2FSFA 3CPEA 4Q4JA 4Z8XA 4EIWA 2CCGA 1AN0A 3C15C 1E79D 3LO8A 1XTQA 2K5UA 4D4KA 3JVVA 1VCIA 3OZXA 2HYDA 2DCUA 2JLZA 1XD9A 4EPXA 3M4YA 4AK9A 3BRWD 2OG2A 2J46A 4QGHA 3TAHA 1E0SA 1WP9A 4EJSC 4D26A 4PHFA 1NY5A 1G5RA 2WWFA 4TQUS 4IJMA 4YXWA 1GKUB 5G41A 5BN3A 2XXAB 1G20E 4JKYA 1SXJD 4A15A 2OESA 1LS6A 2WJGA 1HTWA 1TMKA 3A58B 4RKEA 5JEEA 3LLUA 1LB1B 1UBEA 5AJVB 5FBRB 5FUWA 2H17A 2F6RA 3KJHA 4L8GA 5KNDA 2KSQA 421PA 2IS2A 4QG7A 1BKDR 3CD6B 4P4UA 1GILA 1QHXA 3CIOA 1TLLA 3GLHE 3K0FB 3OIYA 4XD7A 1A8PA 4G1VA 1JJVA 2C04A 5DSZA 2ZS8A 1X1SA 2D3WA 4NCNA 5FL3A 4LBVA 1QVRA 1CS4C 2ECKA 4OHVA 3C4JA 3QENA 2VP9A 1II8B 2WAYA 2AWOA 4M1OA 5AR1A 1EWQA 2G6BA 2ZRMA 3GLIB 5BW8A 2Q6TA 3BJIC 2D06A 2FFHA 3B7GA 5AUNB 3LVBA 3SBDA 5CIWA 5DYIA 4F4JA 3D6TB 1G3MA 1GAJA 2ONKA 4Y9UA 1W35A 2Y8EA 1G3QA 4B74A 1KNXA 1K8AD 4D81A 4KFSA 5E3HA 2R6CA 3MUFA 2QZ4A 5HCIA 4LCBA 1R0WA 2KBFA 4GT1A 1WF3A 1VTKA 1TQ2A 1LF5A 2OUKA 4QM7A 1VQMB 2BEKA 3LQRA 3M0EA 4E03A 4WIAA 3QOFA 2O8CA 1T3LA 2YNMA 1GO2A 3QXHA 3K70D 2P6RA 4AC9A 1NG1A 1PLLA 1FZQA 2R62A 2ZR9A 1IONA 3DO6A 2BJWA 3V00A 3G6EB 1YVDA 3CH5A 2J9RA 2ZU0C 3IHLA 3VR3A 1MRSA 5C2JB 2N42A 2ZUCA 1JQJC 5E7IA 1R8SA 2JCSA 2XNSA 1S3SA 2CVHA 2QEQA 5FTNA 4GBMA 3WYGA 5L3SA 4AI6A 5IF9A 4OK5A 4CW7A 2J7PD 4ITRC 2OFOA 4TL8A 1QG2A 2VRWA 2P6UA 1KI4A 2QMHA 2A30A 4HLUC 3RVBA 1W36B 4B2IA 2DHRA 2VHJA 3FMPB 2CLDX 5DIFA 1Q20A 4AWXA 4WZ6A 1W1WA 2FSIA 2RGAA 4NYJR 1DAEA 1MRNA 2RHDA 2ZJOA 1E2HA 1MV5A 4NPHA 5FOSA 1S9HA 4AG5A 5BYKA 4R2HA 5KSOA 5F9HA 3FHCB 3GJ5A 1VG9B 1U2RA 3CNLA 3TUZC 2GVDC 1DAMA 1U81A 1XX6A 4KVGA 4MITA 1EESA 3UK6A 4KFRA 1D1NA 1YZLA 2RCNA 3UWKA 2HMAA 3PUVA 4RZXA 1M7HA 5LB4A 3RS3A 1VQ5B 1L2TA 2QTVB 3OAAD 4G5SA 3A6PC 4C3ZA 3U3JA 3CM0A 4Z51A 1MO5A 1ZM9A 2J1LA 2WHXA 2XITA 4CZ2A 4JL6A 4MRRA 1KGDA 4N3NA 4GI7A 2O8EA 1FRNA 4Q1FA 1EFCA 1CU1A 1HQYE 1T6NA 2ERXA 3GD7A 4PX9A 2W6ID 2VP6A 1OYWA 3E2IA 1EFTA 3V9PA 4DHEA 1KDTA 1KC8D 2FSGA 1RIFA 1KDOA 4PC7A 4V0MA 4Q9LA 1G3IA 2EFGA 4QGFA 5BWMA 4LJ9A 4PSAA 4PO1A 2D2FA 4GL2A 2QGZA 2Q9CA 2VQSA 4B43A 2P3SA 1QHSA 3D7MA 4IOJA 2VHTA 4LSGA 4PPFA 2PMDA 3AF0A 2H5EA 1J90A 4D0NA 4PXAA 3X2SA 3UMSA 1UDXA 4AF6A 1E96A 1YIJB 4HAYA 3HYTA 3H86A 1WQ1R 1CRQA 1WDTA 3AEZA 3X1XA 1R5NA 1M7GA 4BEBA 2BGIA 4NP6A 4C2TA 4KLZA 3RSOA 5EE3A 1YI2B 2DPXA 5GV7A 1WB9A 4FW9A 1T91A 3AP1A 4PPGA 4LRWA 4AYXA 4JVSB 3AKCA 2PBRA 1VECA 3VHLB 4B47A 4PFSA 3RRZA 1QRAA 1D9ZA 3B1VA 5DHFA 1VG8A 2QTFA 1JXMA 4YDSA 2C8VA 1QGAA 3H2YA 4IOLA 1RC8A 1ETUA 5CITA 1R0ZA 1KY3A 3AVWA 3J81k 1OF1A 3LW8A 4IRUB 1WCV1 4PZYA 4QOSA 1PV4A 4YC7A 4IVRA 3ND8A 2GZHA 2W2VA 1E0AA 1CNEA 3AF4A 1KRHA 1OPXA 4BGDA 5TARA 4RD1A 2RGBA 4ZDWA 3W5HA 1DTSA 1JAIA 1CR1A 4Q18A 4BLOA 5GV8A 3HU2A 3BK7A 4Q48A 5AJYA 1GOTA 2VTKA 2ANBA 3LQQA 3CX7A 2DYKA 4GOXA 2ZE7A 2IX3A 4LY6A 3I55B 2CHQA 4K8OA 5KUTA 5CK5A 3NC1C 3IPYA 4UAJA 1IN5A 3FYHA 1M74A 3NC0C 3IGFA 4LJ4A 1IXRC 4DBLC 4L9WA 4K81B 4V03A 2H57A 4WXPA 3GLFA 3P26A 5H1YA 1F2UA 2H18A 3GEIA 4D2IA 4Q7JB 3QKRA 4IOMA 4B35A 1U0HC 4B34A 1G21E 5FPSA 2IWHA 1Z6GA 2V8OA 4A0RA 1SHKA 5DYGA 1IN4A 3VX4A 4B4DA 4YAOA 1F48A 2A9KA 1N0WA 2IYYA 4A0HA 1OKKA 4ZKDA 4BPBA 4F4IA 4NYMR 3KQUA 2IS4A 4UXHA 2ZROA 4BQSA 4G0NA 1NJGA 3IILA 1G3UA 1YRAA 1II0A 2D74A 2BF4A 3L0OA 2PJRA 4JLPA 2ZTSA 3I3SR 1XEWY 3UMFA 5DI9A 1T3HA 3DM9B 2BMWA 3ZVMA 1BH2A 1U0JA 1M7BA 4KCGA 1X8JA 2XSZA 2OZEA 2P65A 3CF2A 2YKGA 2XX3A 4ZDKA 4QRHA 4B76A 4YHBA 3GLFB 2O5VA 2QQ0A 4TSFD 1H8HA 3VKWA 3D3QA 5HKKD 3LVRE 3QKRB 1OYYA 3Q5EA 5B58C 1RZ3A 4ON9A 1P62B 1I4DD 3K0AA 2BJVA 3BOSA 4K46A 5EE9A 3U4QB 4V0ME 2Q0HA 2QORA 1ZU5A 2CE7A 1S8FA 3PCRB 4LOAA 3SU8A 2BV3A 2UZ3A 3AP2A 4C0HA 1E9RA 1AZSC 4BRUA 1XTJA 4U9UA 1SVLA 4KBGA 5E95A 3ZC3A 4URXR 4CEJB 2GTPA 1BMFD 1JB9A 4G1BA 4PR0A 2BN4A 4ZCMA 1Z22A 2Q3FA 3P1JA 2QPAA 4HZUA 3T15A 2ZRDA 4A92A 2EYUA 1OXVA 3JZAA 1Q1ZA 1VQKB 1OIVA 4B3GA 3TR0A 3RYTC 4EPRA 3CNOA 1S3GA 4U02A 621PA 1XXHA 4MKHA 4NYIQ 1NVWQ 2XTZA 3CCVB 5GJBA 2AFIE 3VMFA 2WJJA 4UNSA 3DEFA 2BBWA 4QJ5A 5JMTA 1K9MD 1D2NA 3B60A 2J7KA 2QP3A 2NIPA 5EE1A 3UKDA 4Q4HA 4LHYA 4DLRA 1HE1C 1KIMA 2C5LA 3PUWA 2ZE6A 1LTQA 4NMMA 3FTQA 4LV6A 3HU1A 5FTJA 4EDHA 4O2LA 4PC6A 3U3RA 1A82A 1N6KA 2HCBA 2WIBA 3MSXA 2B92A 4PHGA 4TMXA 4JBXA 1MKYA 1T0JB 4HEJA 1ONBA 3C16C 1XXHB 2CXXA 3F5FA 4X8OA 2H8KA 2I3BA 3WP1B 1DDGA 1US8A 1VPLA 3JZMA 1W87A 1OHHD 1S2MA 1G8GA 2HXYA 3ZD6A 4GZMA 4A0GA 4M1TA 3R7WA 1Z0KA 4DT1A 1NLFA 2OTJB 2FMXA 3CW2A 3MWKA 2VEDA 1RRPA 2ORWA 4Q4HB 1JNYA 4FWTA 1GRNA 521PA 4PPNA 1PVOA 2HLDD 4JLAA 4IXNA 4LJ7A 4M22A 2XGJA 2GDJA 2QMEA 3W2EA 2ATXA 1DAHA 3VAAA 1GRQA 4JYBA 1FUKA 3AVQA 3I56B 1ZIPA 4DB4A 4HDCA 4UQOA 5DHAA 2AD5A 1S1CA 2FGKA 3KDSE 2WTUA 3NBXX 4GMDA 3SI7A 1OFIA 3RS0A 1ANKA 4W7SA 2J0UB 3QBVA 4ZCLA 3KX2A 4URVR 2J0SA 1X1RA 1MABA 4GMXA 3ICQB 4MRVA 4BFXA 4FMCB 2GCOB 4ACAA 3EZFA 4B3XA 2E87A 2J87A 4JLBA 1HT1E 2NO6A 5TY0A 1OV4A 4AKGA 1T0HB 2KJQA 3OEHA 2WVJA 4Q9HA 4XTCS 2BHRA 3CXCB 2AR7A 2YHSA 3ZVRA 1CXZA 2XNDD 2FFQA 4MQBA 3ASZA 1F20A 1NMXA 4BLRA 2YC2C 3CC2B 2CCKA 1GKIA 1WMSA 1SVSA 1DAGA 3U3MA 1PUJA 3JQQA 1R4AA 2QGNA 2QE7D 2WBLC 1VKJA 2AKYA 1OSNA 1ELOA 5K8LA 2D4HA 3WY9A 4ZO4A 1Q81D 3G0HA 2C9YA 4JSTA 1VCOA 1EX6A 3NHAA 1XZPA 3SS8A 4QHYA 5FFMA 5KDOA 1W47A 3FMIA 2J41A 4WW0A 1MABB 4OHZA 4B6FA 3EX7C 1OXUA 3W90A 1K5DA 3LNCA 5L3QA 1KSGA 1XXHE 2EFHB 2CHGA 5G53C 3K1JA 4JT4A 3B1ZA 1XD2B 4YLGA 1G291 1IN7A 4D4JA 1J8MF 4O0MA 2SHKA 3CCQB 1A4RA 2IYRA 5BN5A 1WBDA 5JRZA 2V1XA 1G8FA 5K8IA 2IHYA 3AGPA 5LDDC 2ZI5A 3QXJA 2JEOA 5F3WB 1LF0A 3QFTA 1YJ5A 3C5HA 3X1WA 3U7EB 1YJ9B 1F5NA 1XF9A 4B6EA 4WOPA 4M53A 3TSZA 2PEZA 5HTKA 5HXBA 2GILA 1E9CA 2R6FA 4RD6A 2DFKB 5H5JA 4P3YA 3IHWA 4BWYA 3K8YA 4MGKR 3DDCA 4DLVA 1QG0A 4B48A 3DZ8A 3NG1A 5HZKA 2A7QA 2ZUBA 1I4TD 4PSVA 1COWD 2B5OA 2H7VA 3I5XA 4F92B 1VQOB 4PC2A 6Q21A 1FUUA 3KJEA 4RZ3A 5J4KA 4F7DA 1TNDA 2QDXA 2YOHA 2YINC 1N0VC 5SZKB 1IY2A 1OJLA 2RGNC 1E2IA 1W2HA 2C96A 4LJ6A 4TTPA 3QKTA 1KJWA 4OJQA 3W2GA 1I7PA 3FFBA 5AJWA 3U3OA 3U6KA 3BH0A 1NN1A 4EFNA 1QFYA 2PX0A 2VBCA 2R2AA 1E79A 3OJWA 2IXEA 1FNDA 1DAFA 1J9ZA 2HEIA 3D31A 2JJ8A 3B1YA 1MH1A 1HE8B 3Q3JB 4MYUA 1A2KC 2GF0A 1YR6A 4ZKEA 3CR8A 1W44A 2F1HA 4WA7A 1Z2CA 3K9LA 5JWHA 1M2OB 1SXJA 2P2LA 1XEWX 2WWXA 4OI2A 5FTLA 3KKMA 1YZKA 1BYIA 3KKOA 3CNNA 2QEXB 1E0JA 1NIJA 2HXSA 3U61B 1FNCA 2QA4B 1E1QD 1VG1A 2CVFA 1G9XA 2WMOB 2JLXA 1KO1A 3PUXA 4URZR 1P60A 1QUFA 1ZCAA 2FF7A 1JR6A 4JVLA 4F93B 1VQ4B 2HJVA 3PXGA 4NYMQ 2O8FA 4TZ6A 1XCPA 1DS6A 5TMPA 1SZPA 2V4ZA 2X77A 1ZM7A 1ESMA 5FTMA 3PEUA 1GAQA 1SKYB 3VU9A 4M9SA 1JPNA 3CRQA 2F43A 4F7WA 3R9WA 4U00A 4Q02A 1OFUX 5FR2A 4DQLA 1YU9A 1UDWA 2JASA 4CF7A 4F4CA 3B2EA 2NZJA 1SXJB 3ZYCA 2ZE8A 1AGPA 1E9BA 1SVKA 4EAQA 3C7KA 2GVZC 1YHNA 1L4YA 1G64A 1HYQA 1S0UA 1GVNB 2F1IA 3CRW1 2RMKA 3RANA 2FFAA 1SVWA 3RS7A 1GL9B 1I2DA 1XDBA 4BFTA 1W5TA 2FZ4A 3RLFA 3FHTA 2IYLD 5UKDA 3SOPA 4G5OA 4XVRA 4OHWA 4Q7KA 2O8FB 3E1SA 3REGA 2XZLA 2Z4SA 2GEUA 4DCNA 4HAVA 3AVTA 3QFCA 4N3GA 4EFLA 1ZUHA 1G7TA 1D9XA 1CR2A 1NJFA 3RWMB 4KU4A 4FIDA 1CR0A 2NTYC 1G8HA 4DZZA 4BFUA 3O8CA 1XTKA 4RD2A 4TMWA 2JLQA 2R65A 2O0KA 2XB4A 2HF8A 1QFJA 3W6NA 1U90A 4A2WA 1PLJA 3X1YA 5LD2C 3B9PA 2AXPA 5CB8A 2UKDA 3U7GA 1QVAA 1QUEA 1DBSA 1JA1A 3GJ6A 1E2LA 2PIAA 3GLHB 3B82A 4WZAE 3MRSA 2O52A 1G7RA 4ILEA 3T1TA 3LO5A 2VHCA 5KU1A 2GNOA 2F55A 3RC3A 3SNHA 2ZAMA 3LBHA 1FNBA 4FN5A 1E9FA 1SHZA 2ODEA 1Z8FA 2JJ2D 2IHBA 5K8TA 5CM8B 4DSTA 4B75A 2H92A 3K70B 5J40A 2VNKA 2YWFA 3WRXC 1XTRA 1W2GA 1YZGA 3VX3A 1JB1A 4LC0A 1W34A 1DEKA 1AKEA 1EWYA 2V7QD 1Z07A 1NN0A 2AKAB 2J59A 5GVRA 2VSFA 5LB2A 3NWJA 3CX6A 2ZR7A 4WQMA 4H9GA 1YZTA 2W00A 1ZUNB 2G0TA 4C0KA 3LLMA 2ZRFA 2Z5FA 3OAAA 1U8ZA 2CK3D 2FSHA 2WZQA 4LBYA 1P7CA 2ZSDA 3CUEF 1KI3A 1KDRA 3VKGA 3CH4B 1BQEA 2AD1A 4BFYA 4Z1MD 1YHQB 1L4UA 3T1OA 1W48A 1DDIA 2V54A 1TUEA 2XOKA 1JEDA 1X6VA 2VSXA 2W6IA 3IQWA 3PVSA 4PZLA 1HEIA 2GK7A 4GDFA 4X8MA 2AWNA 4I1SA 4FCVA 1XP8A 2OT3B 3A4MA 2ZETA 2QP9X 1TU3A 4HYYA 4QBGB 3ZS9A 5D3MA 2WAXA 4D4MA 3OJXA 3ZZTA 2ZJBA 3WP0A 2ZJYA 2NGRA 4JBWA 5E7MA 2IK8A 3O8BA 3QF4B 4TL7A 4JLNA 2W0SA 2YOFA 3WNCA 1P4SA 3CWQA 3MWJA 5TDHA 4LX0A 3ND9A 2GBLA 1YJWB 2GEVA 2J3EA 4G01B 1ZNXA 1C1YA 3QKUA 2WJHA 4YALA 4Q03A 1W0KD 4DIDA 2YC4C 4FD2A 1E63A 4AY2A 3T06B 1W7AA 1E2KA 3ZQ6A 2GETA 4C0LA 3PQCA 2I1QA 1UJ2A 2YV5A 2ZAOA 3QG5A 1BO6A 4A8JA 5BN4A 3QQ5A 3RSLA 1KNQA 2G9NA 4PO9A 2P67A 3FKQA 4XTRA 3MWYW 3TR5A 3DMNA 2IUUA 4Q4JB 3RWOA 5FI1B 3WNDA 2QROA 2REBA 2W58A 1ZJ6A 2BC9A 4M1YA 4LGMA 3U5ZB 1BJKA 2BIFA 2WWHA 4WXRA 4IKEA 1CJTC 3FB4A 1GM5A 2IF0A 4Q5IA 3SDZA 1KK2A 2B7BA 3AVUA 1VDZA 3MGCA 4LJYA 4QNRA 4W5WA 4A2PA 2R6DA 4YMSA 3AM1A 2JLRA 3W2IA 1E98A 4LWZA 5KNCA 1CP2A 4R2IA 3CF0A 1VG0B 1O87A 4IDNA 3W8NA 2W2TA 1XJQA 4PAMA 1ZBDA 4IEEA 3RABA 3GJXC 4OQMA 5E4FA 3NKVA 4GP6A 5TB5A 1NMZA 1TF7A 2IF2A 2ZVQX 3CO5A 1A5TA 4OHXA 3W5IA 3MG9A 2BCJQ 3LBNA 1EFUA 2IWRA 2B8WA 4DIEA 1QZXA 3BIFA 1WE2A 2GJKA 4OYHA 4NBSA 1AS0A 2XZPA 4MGYR 2ZRNA 2CHVA 3LH5A 5G3ZA 3MJRA 4D82A 2V1UA 2QU8A 5TXGA 3T34A 4TZ0A 3OZUA 1W36C 1XU4A 3WHKA 4NE2A 1CJMA 1QVGB 3WYAA 2J5XA 5AN9A 4M2LA 1CQXA 4UKDA 3BXZA 3QPUA 2C2HA 1QGZA 4HLDA 3QKSA 1P61B 1TL7C 1FP6A 3EPKA 3AF3A 3IBGA 5EUMA 4DDTA 4B3CA 2ZQ5A 1RJ9A 1UKVY 3SHWA 3OZWA 3Q7PA 1FL9A 2DETA 1GNQA 2VF8A 5FOWA 3K9HA 2WPDD 3DL0A 1X86B 2IL1A 1Y3AA 4YMVA 721PA 3BS4A 3P4YA 4LHWA 3O47A 1V5WA 1ZVQA 4I1VA 3NEYA 3CZPA 3EG5A 1GP2A 5C18A 5JRJA 1OH8A 4D25A 2O8CB 3ZZUA 4TSFA 3OW2B 4ZDIA 2Z4RA 5HKKA 4L4UA 3R9IA 1Z0DA 3AF1A 4ZGNB 2OFWA 3QJYA 3I73A 4TT3D 4URUR 5B2ZA 5AK0A 4OI1A 5LD2B 3QXXA 2ZRHA 1LW7A 2DBYA 3CC4B 3A1VA 4QXAA 3R20A 2ONJA 3C41J 3V4RA 4RZUA 3EC1A 3TAUA 5GVSA 5L3SB 3WNBA 5J4VA 2AL7A 1BMFA 4PANA 2G1KA 2PL3A 3K9GA 2WOOA 1H42A 4MRNA 4XWOA 5BXQC 5FUXA 2I4IA 1AKYA 2WJIA 5EP1A 1GAWA 2HYIC 1E6CA 1G8PA 1GSIA 4BE7B 2GCNA 2A5FA 3THXA 1E1RD 4II7A 3G71B 2XAUA 4OHYA 2QMUA 3IBYA 4JLMA 1ZUIA 1ZINA 4Y7CA 5JECA 1J2JA 2PX3A 2YWHA 3EIHA 4P0TA 5C1BA 1E2JA 4P4SA 1JBKA 1OXTA 4KFUA 1AA9A 3EA0A 4QGAA 2ZXUA 4B32A 4NDZA 2A3RA 1T9HA 2CNDA 2DWPA 1IJFA 3QFRA 3CRZA 1BX0A 3E5HA 3SYLA 3UANA 2GCPA 4TMTA 3BB1A 2ZRBA 4FINA 4A4DA 4DKXA 3G4SB 2ZYWX 2C99A 3B6EA 3NXSA 3DKPA 1TUIA 3A4NA 2O8EB 4RJLA 1RKBA 1SM4A 2UZIR 2ZRKA 4JZKA 4KV9A 4DDWA 3TK1A 5HR5A 2ZJAA 2XEXA 4HE5A 2VNJA 5H59A 2BBTA 2WMNB 3TLXA 4GFDA 2YZ2A 4MKFA 2C9OA 1QDEA 2VF7A 4OQFA 1FNNA 1RW4A 4ZI2A 5AUOB 1RRCA 1G6HA 3I72A 3TVTA 2F3RA 2WWIA 2Z0MA 1OHHA 3WXMA 1ZP6A 3W9YA 2A5GA 4XVQA 4MH0R 2JLYA 2VH5R 3FMOB 5EQTA 3LVQE 1IHUA 2NO9A 2QAJA 5FUVA 1TQ6A 2HLDA 3E70C 4MYTA 2DWQA 3SC3A 5JWRA 2GHIA 1T8TA 2VO1A 2ZVPX 4TLDA 4XWKA 3I92A 1SVIA 1C9KA 1SKQA 1R5OA 2V55B 4HAXA 1E94E 1P9WA 3ADKA 3UIEA 1XPOA 1BYUA 3OFND 2GRJA 4URYR 5J4HA 1IXZA 1YR9A 5JFGA 4OI4A 4QBIA 3TW8B 1A7JA 4BFSA 4DCVA 1TU4A 3AKDA 3DMDA 3R8CA 1D2EA 2FZLA 3QIAA 3THWA 3M6AA 3BH6A 4LYFA 3B5JA 1DO0A 1RRGA 4UNQA 3AH8A 4LHZA 4BASA 3K0EA 3ONWA 2I1VB 4BLPA 2XNCA 1W36D 4A6PA 3AKEA 4D4LA 1G17A 1OT3A 2IT1A 4NCHA 4NONA 2XNDA 1CULC 1JI0A 2LKDA 4LYHA 1W0JD 3CCRB 3G5UA 4N0EA 1KKLA 3QEJA 4OQNA 1G7CA 2DFLA 1HH4A 2OK7A 2QE7A 1M1KD 1XWIA 3TGPA 3EIQA 4W5HA 5JJKA 1HUQA 5FL7D 1CEEA 3CCEB 5H70A 2GXUA 4DLWA 1E0KA 2XNJA 3BGWA 4IDQA 3QY0A 4HB4A 4UNNA 4RKFA 3NEJA 2R44A 1PJRA 1E2EA 3L82B 2CEAA 1VQ8B 2ZSAA 2GAOA 1F2UB 2ZYUX 2EFEB 4F38A 4OI0A 3FGNA 4ASUD 5JHHB 2JIZD 1OB2A 4IFEA 2O8DA 5C4MA 1WXQA 2BWJA 1A1VA 5ELXA 2WSSD 5FOXA 1XTIA 4B3BA 3BD9A 1UKEA 4W5JA 3U7HB 1IB0A 1BS1A 1QHGA 1NMYA 2ZI9A 4URWR 2PT7A 2NPIA 5FPHA 1QG4A 2WJYA 2C78A 1YJNB 3AF2A 3CCLB 3U7FB 4JLVA 4JYCA
chains in the Genus database with same CATH superfamily
3SZMA 1XJ5A 4RTQA 5FV4A 2FZCA 4RF4A 2PY6A 4RWZA 4QDJA 4M4SA 4QZVA 1R8YA 3OTHA 3QI2A 1XVVA 9MHTA 2EL9A 5A0FA 2WF8A 3KBOA 2WY2D 3RGGA 4DS3A 4ETIA 4ZCRA 5LOVF 3VU3A 4DA6A 3L8ZA 4WNIA 1YE5A 1M54A 3OCWA 5K5EA 3SR3A 1E8NA 4AYWA 1R0XA 2IS2A 3QBTA 2RGEA 2HAEA 4H0NA 4MMXB 2GZAA 3IO3A 1VYVA 4R3UC 3N39C 3OT1A 2DAPA 2JS7A 3UN1A 3URKA 3GP5A 3ES9A 5K3FB 1P1HA 1USUA 3KXPA 4XDZA 1V7CA 2OB2A 1OH6A 3RBZA 1LNZA 4FSHA 4I19A 1GY8A 2QD4A 1JFFB 3HYSA 1BA2A 4M1SA 3I2IA 5DW0A 3EVTA 4KKVA 4ODIA 1WB4A 3AQ4A 5T4FA 1HSZA 3E7PA 3CCCA 4XEUA 4G4SO 4I8IA 4QM6A 3NYIA 4P80A 4KEAA 4EJ0A 3GC6A 4D3FA 5LFAA 4TYPA 4CETA 3A10A 1BVRA 1KAEA 3V8NA 1PFGA 4FSXA 3DMTC 3EEIA 5FA8A 1PJ4A 4ARCA 1BROA 1FPMA 1PQPA 2VJMA 1IEXA 5EJFA 2HWUA 3TMAA 1Y0RA 3BHJA 1QCCA 3I5AA 5KVCA 2DSNA 3VPHA 3M1IA 3OJEA 5EJIA 1J0EA 2PM8A 2ZDQA 3AEXA 5C7YA 1UXJA 3BK1A 3SEAA 1L7OA 1GFIA 1AUPA 1ZRMA 3LDGA 1Q1NA 4IDGA 2I8CA 5EMJA 4JGBA 4CODB 3A4IA 3CEHA 3HZZA 3EPLA 4KE6A 3B7WA 3TNYA 1QQTA 4ZVQA 1BQ4A 4NS1A 1L8XA 4H6VA 3KQYA 2VK1A 1OH7A 3CVOA 1Z5GA 4TS3A 4WAUA 1QVWA 1KDYA 2WHQA 1K98A 2TMDA 1UADA 4K0KB 3O8LA 5EWMA 4M36A 2JLCA 1F12A 1QDUA 4Q4CA 5JZSA 5COAA 1NJ8A 2ETXA 3MRTA 3AEUB 3GUZA 4JT8A 1O4WA 4YJDA 4LHSA 1K89A 3ORSA 3TXAA 3VHXA 4X7FA 5JAUA 4C1BA 1NZDA 4XLAA 1QAOA 4BQQA 1QIIA 5JXWA 1DO2A 1E2QA 1ICIA 4DA7A 3KR9A 4CMIA 2V7GA 3I1IA 4DLLA 3CQ9A 2H54A 4L5BA 4RY2A 1EKXA 1GN9A 2AQIA 3G0BA 4J9VA 4YJKA 2HRQA 2IV2X 3KUCA 5JSZA 2CUKA 3NZEA 4Q4AA 5GJWC 4KXXA 5JSFA 3SHOA 4MUAA 1L5OA 2WFZA 2FSVA 3DVSX 3FUCA 1JQEA 3KJIA 1DLJA 1V2HE 1ZGCA 4P58A 2GAJA 1KK0A 4RMGA 4CMJA 3Q9SA 4Q1CA 3A3PA 1PT9A 4OXRA 5KTMA 2IP1A 5TRTA 1F2DA 3WGIA 4FI3F 2HO5A 1DKPA 1NVFA 2JI8A 3W8RA 4E5KA 5SZIA 3PG5A 4MVJG 4GKBA 4KK3A 4GX0A 5LNK6 1Y6QA 3F8SA 2P75A 4I6EA 1XEXA 4YQEA 4B73A 4IMJB 4YCNA 1GR1A 1RWQA 1Z0FA 1C2YA 4PC3A 1AS2A 1YZYA 2I3ZA 4HAWA 3EQ2A 4KO8A 3QUQA 1NUAA 1SCIA 4J1TA 3JWPA 4BRWA 2JZCA 4XCVA 3AX6A 4XUEA 1KSJA 5CK4A 3PEFA 3OQMA 2DQZA 3E0XA 3WLOA 2FOXA 4OKSA 2B1JA 4DPLA 3OZ7A 1NVDA 2BLNA 2YWGA 3WA7A 1Y8ZA 5DH9A 2GMWA 4KYUA 5IJWA 5K0BA 3CVJA 4DCSA 3WGQA 2YHAA 3QHQA 2FW7A 4Q3AA 4UOEA 4Q3LA 5LQSA 3ICQB 3WL4A 4BZXA 4OBEA 3D2LA 2FDXA 3ZDDA 4N8EA 3C2QA 4PICA 4QNNA 3GJ7A 5K4AA 1JQ3A 1YCDA 3TB4A 4M55A 1N7IA 3BWCA 4OL0A 1WHTB 3RS5A 4XWTA 2DFVA 1OD6A 4JI6B 3PZBA 3L77A 2YWJA 2IYSA 4FE3A 3PIRA 4C08A 1GNPA 4K9KA 1UAAA 3LGSA 2PD6A 4D42A 1CNMA 3FDFA 4FT2A 4QPJC 3BWMA 5EINA 5GPBA 3COZA 5KEIA 3VZQA 1K9VF 4YRKA 2PUCA 4GI1A 1JT9A 2X42A 3E58A 1ESDA 4ZCPA 4EBBA 3SJPA 2AEMA 4NZNA 1RKUA 1QF9A 3C1AA 4HWTA 1NQTA 4C4PA 4DJTA 3EGXB 1KYYA 3LL7A 4M6WB 4N41A 1WPXA 5KQGA 1H2BA 2QY6A 2W2MA 4OXQA 3TBHA 1MEEA 3EXFB 3H9JA 3PC6A 4YRJA 2VQEB 1K7XB 2WJVA 4LZLA 3CN7A 4N7JA 4KBYA 4NAVA 1ZNYA 4D0GA 1V3QE 3LG2A 5BOSA 4MA5A 5A62A 2CK3A 2QQEA 2QBYB 4HLCA 1G6OA 1JIVA 2PS3A 4KSBA 5EIHA 3UWOA 3AETA 4ZV4A 4BVGA 4IDFA 3H9UA 5AI6A 1YQEA 3IPAA 4NX2A 4PZUA 1NF8A 1AK9A 2JDID 1E9SA 2O2CA 3BCUA 2QY9A 4ZGQB 2I2XB 4Y67A 5ALNA 5DHRA 3RRYA 1HDYA 2EZ9A 2RGDA 1VIDA 2VT2A 3HVIA 1GCIA 3P2YA 4NCAA 5BVHA 4WXMA 4KXQA 4LZWA 5CA0A 2HI0A 3SNKA 3AUKA 1MH9A 1IN6A 2VBFA 5G3YA 5IAKA 2IJGX 1T0IA 5NLLA 4G6IA 5JQGF 2P3LA 1RMYA 2VBGA 5LPNA 3W7BA 1TVMA 4H08A 2WEKA 1SNYA 2NV4A 2O0JA 3G5LA 2UYCA 1BRMA 1W8IA 1Y82A 4YDHB 4YRQA 5BVGB 2MYTA 3ZXIA 1IUNA 2QJTA 2P91A 2ZI6A 1C2TA 3CLHA 3KU1A 1NC3A 2OC9A 5KX5A 3E1KA 3JQPA 4K2AA 1ISGA 1SOAA 5KSZA 4Q3CA 1QGUB 4N3BA 2HB6A 4KL8S 4LJAA 5IKXA 3EWIA 4FLFA 2H5LA 4W8OA 3VNAA 2BFCA 5D5QA 2WWWA 3ESRA 3RE1A 3CRNA 1XLTA 4GOMD 4P0QB 5EXPA 2QRQA 4EGQA 2HN9A 1CDZA 1LPPA 1M2NA 2CBZA 3EIUA 4Q9KA 3ESZA 3M6UA 2VCYA 3HPRA 4Q6BA 5CTAA 1KO8A 1GZDA 1NJ1A 1O6ZA 1VJGA 1YA8A 3K94A 4MYRA 3RK1A 3SKXA 1R9GA 1YVUA 2WMYA 4RUKA 4LTDA 2CMFA 4WVLA 1I0ZA 1XCMA 1E62A 3JQEA 7REQA 3H42B 5AKXA 5DT2A 1LNQA 3ZY5A 5EPOA 2BTEA 3GQBA 2Q5JA 4ER3A 5CM9C 3P96A 1R6BX 4KBFA 2Y4OA 4GSKA 2VUSA 1M2FA 2APJA 4C0SA 3WXBA 3UGJA 1SQFA 1I6WA 3RFFA 2A94A 3FA2A 3G17A 4FOSA 3COJA 2V6FA 1C1DB 3IULA 2BHTA 2EDCA 4G9BA 1OFTA 2JF0A 3T3EA 5HMLA 4YAFA 2AMLA 2D4AA 2GM5A 1J70A 1A2BA 1YZHA 4ER6A 3GLKA 2VTEA 3FYSA 3LK7A 1EFKA 1P2UA 2I7TA 2QL6A 3C24A 3RYFB 1O95A 4UULA 3TQOA 1IBLB 2N46A 4C04A 5T4BA 4ECAA 1J0BA 3DM5A 1PD1A 1THGA 1SC1A 2BMFA 2NSLA 3A4TA 1QZZA 3BB3A 1QP0A 3VU9B 5CJ2A 4C0XA 5HRCA 1W9XA 4M8KA 1SQ5A 2F43B 5FI3A 3SR0A 4ZYXA 3OPMA 4R83A 3ZWCA 3T6KA 3VBCA 2XYQA 1DIBA 1AMOA 4FJ2A 2VSQA 3FF1A 3GFOA 5FBQB 3VR6D 3WWOA 3ZWVA 1J9GA 2BR5A 1O9GA 2R84A 2PT9A 2HDOA 1VLVA 4DUGD 1FX0A 4K6FA 2OB1A 4QUBA 3KOUA 3VSDA 3OOHA 1ACMA 1ST2A 3FNIA 1CY0A 1BLIA 3G82C 3EG9B 3QE2A 3P71T 4MUNA 4C7MA 4JI4B 1MJFA 3AJDA 2R11A 2ACVA 3HY3A 1TM5E 1HLFA 2WV9A 3I1YA 4Y2VA 2VYND 1OLXA 2V5AA 3SG0A 3UICA 3HB0A 1T2NA 2FOLA 3OG9A 4GM1A 2XEDA 4OAPA 4E2XA 3FTNA 4GLFA 4MGZR 3QUSA 4IMPA 5F33A 4DDUA 4H1TA 2DQ4A 3D8HA 3O7MA 3WJ1A 4B5KA 2CLFB 3I12A 3PJRA 3K72B 4P26A 1Q15A 3DHWC 3JW8A 4TRRA 4AJEA 1UMDB 1DPGA 5AVTA 2V98A 2YXNA 1TZBA 4OGFA 2PMKA 5BQ5A 4F85A 2IIBA 2L0XA 3COYA 3GO4A 3HO8A 3RRZA 3SPXA 5KKCA 3K09A 4HLNA 2EJBA 4PHHA 2ZRIA 1VJTA 1UBKS 3MOSA 5CYPA 3SYRA 4CTJA 1YBVA 1FXUA 1UBFA 2QRKA 3EXAA 3OSUA 4GD3Q 1ICEA 2F8LA 4WFIA 4LF7B 1FQWA 1GG5A 1UDAA 2H2WA 2QG9A 2ZB8A 3N7UA 4P84A 1OX6A 4U9HS 3USCS 4YMTA 5CEJA 1FNMA 4FFBA 4O4IA 5FLKA 5JAHA 2SBTA 4R8SA 2DFPA 2XB2A 4DVGA 2ZYHA 4EHAA 1NNEA 2NP6A 3HWRA 3SFTA 4LNHA 2E4UA 1DX6A 1KEVA 1Q12A 4JC5A 5IXJA 4GAEA 3IC5A 1BE1A 1KO7A 1H4VB 3L7KA 1F8XA 2DEUA 1HG0A 3JQAA 4IXMA 1MW8X 4RMIA 5KKNB 3V46A 2VP2A 3U39A 2HF2A 1Q92A 4U2DA 1OBHA 2QE6A 2ZRGA 4FMCF 4LOKA 3T54A 2LZJA 2YL2A 3O73A 1PFWA 5HX7A 2VP5A 4U7FA 2XKJE 1RYYA 4EZEA 3OLYA 2D7DA 4D79A 1C8VB 3Q8KA 2A88A 1EX9A 1FP7A 3USZA 6REQA 3VM6A 4QXPA 3K6KA 5E2BA 1V0EA 1A98A 3ZU3A 3HGMA 2IPAB 1HE2A 4DY4A 4W1SA 1GCOA 5COQA 3O6VA 3MCUA 2AVNA 4YUWA 2VH2A 4D9NA 1HWYA 3BX1A 3PITA 2FETA 1GA4A 1H6BA 4N01A 1S1MA 2FMIA 1GUYA 1XZAA 2PNJA 3OTGA 1HDXA 1LLFA 2QLBA 2BZ0A 3DOIA 1N2SA 2TECE 4HJXA 4QUDA 3WYFA 3DH0A 4HNTA 1XTTA 2IXDA 2PSHA 5L8VA 4UFPA 2ZRLA 1DAOA 4HLQB 2V7UA 2A5YB 1ZJZA 4YRNA 3QPDA 1NJ5A 2IW3A 1II8A 2QX4A 3GXOA 4RO0A 1AHIA 3CZ9A 4DLSA 2MHCA 2WUFA 4QXOA 4ADSG 1TRKA 2DPLA 3K9FC 5KQLA 4REQB 5F1OA 1BWRA 3IP9A 3REFA 4DLXA 1LBQA 5CYGA 5JTUA 4Z7QB 2HLPA 2DY1A 1U3GA 4TTIA 5D6NA 4YYEA 1CJVC 2FWRA 4G3XA 4RTSA 2VIIA 3HBAA 4H7DA 3H84A 2R6JA 4J91A 4M0CA 4MULA 1G41A 1MA0A 1KQSB 1NM5C 3KJFA 4RYDA 5M7EA 2HMUA 4LPSA 2B8TA 2JH9A 8OHMA 1WTCA 3LYAA 4JLUA 3L8YA 4Y0VA 5A9TA 3ROQA 2ENUA 4D80A 1LDGA 3U56A 2Y1DA 2BFEA 4MOWA 4RESA 4HF7A 4LXGA 1ODJA 4LGVA 4C05A 4YJFB 3O8RA 2I4MA 4LNAA 2E4WA 2X5NA 3C3DA 3OIVA 4FZ5A 1P6UA 1FFYA 1KJZA 3RH0A 3KE8A 3WA6A 4D9HA 3JX9A 1Q22A 1KMCA 4XPIA 1Q0UA 2QNRA 4EZBA 5HKAA 1HNXB 3HJTA 4LOIA 2G1AA 4EM6A 1W49A 3LXXA 4BO4A 4D41A 4FEAA 4B6RA 1T5DX 1NP7A 2VAPA 4UU8A 2GPJA 2FPRA 2KWIA 4QBHA 1CE8B 4Z8YA 5GJCA 4TV8B 1H4QA 5E1DA 4X3OA 2RAPA 1Z0JA 4ZHQB 4E46A 5J4YA 1C3XA 4RPDA 4AJPA 3PC2A 5HZHA 5H4GA 1LY1A 3ILXA 3BM5A 2I6UA 2W7TA 1XCJA 3EFOA 2KVOA 4MRSA 4OM8A 3MGBA 4EPVA 1FQOA 2VNSA 3NM6B 3H3FA 5IZCC 2VOJA 4F97A 1V5FA 3JAKA 3EXIB 3TIIA 1MO2A 4CKXA 3FOBA 3H5AA 2OXCA 5HF6A 2J9XB 4J2HA 4LXIA 3L43A 3EARA 1PAUA 4HQNA 4HAZA 3MTQA 1U63A 3KOWA 4JDPA 1V0FA 2ON6A 2Y1EA 1B00A 4OHUA 2QLNA 3AUXA 4TVBA 1FYVA 1E69A 2E6KA 2Q1WA 3T5MA 5C9ZA 3RRMA 3AM5A 4AUEA 3JRNA 3OUZA 1T15A 3U3XA 5HCNA 5EPUA 1T4DA 1NF3A 4N49A 3RKSA 4B6GA 2VJJA 3I6ZA 2C5HA 3ZLJA 3PUZA 3QHPA 1YDMA 4LXTA 1D09A 2AZMA 2Y2UA 2VHQA 4TWRA 3JR3A 4BNZA 1Q7TA 1NFFA 3HWSA 2VL7A 3H04A 4FGKA 5C1DA 4L7VA 1SCDA 1RNLA 3SMQA 1UBGA 4BNMA 5KNCH 4RAQA 4HVCA 3FJYA 5HCUA 2V0CA 5L4SA 1U28A 2IV3A 3WAGA 1E3MA 4F2GA 3CURA 1W5BA 1RQXA 1S4QA 4ZCQA 5E7QA 5CW1A 3RS4A 1L5HA 1IDOA 4EKEA 4KXNA 3MCWA 1KI7A 3KB2A 1WZNA 3A1CA 3KKQA 4LMRA 1EFPA 3HKBB 4FYHA 3PUYA 2FQWA 1NP6A 2I91A 2R00A 2F9MA 4CTOA 4C9BA 3L7MA 3O3OB 3QEOA 1FFEA 4EPWA 4NE9A 2P62A 1GYPA 3AIKA 4EATA 3IUYA 4R01A 4ZYVA 1KI8A 1O94D 1AMUA 4LFBB 1Q3TA 1WXGA 2JFBA 1CUSA 2FJ0A 3OQIB 2J6CA 2W98A 1Y7TA 2C1ZA 2O06A 1NSFA 5IWAB 1RT9A 3EAGA 2CHUA 3DSRA 5F9FA 3ADCA 4HWSA 1DXYA 1T5IA 3WMRA 2PKXA 3AG6A 4NICA 4C87A 1KRXA 1SK9A 2QLFA 5CIQA 3CR3C 1XUOA 4LE0A 3QX7A 1UM9A 2QS9A 5JS1A 4EB3A 3C1OA 1KMQA 2OV2A 3LFUA 1DV2A 1Z7BA 1VKZA 2O20A 1CQJA 1MP0A 1JMVA 1HDRA 2L2QA 2XOKD 4RDKA 4MAFA 1M76A 3BL8A 3DZFA 3ENWA 3JVIA 4O2AA 4PSCA 3AFIA 4P3IA 5ALRA 5CJPA 3U44A 3GZJA 2X9GA 5F4ZA 4CG0A 4KR7A 1YRBA 3V1UA 3O2NA 4H3KB 3YASA 1IIBA 4N0MA 3H5IA 4YRLA 3R0JA 5FBHA 3SFVA 3CLRD 3JATA 4EJSA 3ZY4A 5CXQA 1UBSB 3S7TA 3LX4A 1K66A 3M6VA 4GP7A 1B0UA 1PLKA 1YHYA 3IVCA 4WGFA 3T35A 5LQKA 3QPVA 4CWAA 5ICEA 2CFIA 1ZCJA 2JD2A 4IUCS 1KYVA 1LU9A 2YOGA 2Z43A 1K73D 1JAZA 3UJ9A 3RRFA 1XRPA 2HQSA 3TIXB 2NZVG 1T9GR 4DIMA 2O8BA 4LF6B 3TH5A 2YBDA 2AMFA 5J35A 2ZB7A 3VO1A 2NUPB 3EQ8A 4OSOA 2FNAA 5GY7A 3EDCA 5JD3A 4UHHA 4RVFA 3ZDXB 4MDEA 5C7LO 1IMJA 4RLHA 3RVQA 4L22A 2H48A 1Z39A 3E20A 1MPXA 4EB0A 4LDNA 5HS6A 3H4VA 1E3SA 5DLYA 1I14A 1NKTA 2AV6A 5E0KB 1C9JA 1COZA 4QYIA 2FEXA 2E7ZA 1EFHA 2Q4EA 5DISB 1G5PA 1KZ7B 2PWYA 4ND1A 3HM9A 4UREA 4YMGA 5I51A 1L4BA 3U4CA 1QS0B 1HZJA 4DDHA 1SOUA 4C7KA 3TKLA 1PKEA 3DYBA 1YVPA 4PONA 4DNQA 4WJLA 4E7OA 1GDTA 3Q85A 4G4JA 4KDCA 1OAAA 4K9RA 3K0CC 2ADOA 3E27A 1NVAA 1KOLA 1B41A 3BT7A 2WJAA 2VT6A 4Q9DA 4DCTA 4PX3A 4X3PA 1L7DA 4JB8A 5KYYA 3ZDQA 1B6RA 1I9CA 3PF8A 3ZXXA 3H5WA 4DV4B 4X60A 2J09A 4L4RA 4M0LA 3HYNA 3D8UA 5IX8A 3HB5X 4U7HA 4ZT4A 2PLRA 3TB6A 4L4SA 3ZHSA 3IT2A 3KR0A 1XE3A 3AP3A 3AV0B 4WCFB 1V7PC 2AN9A 2JG3A 4QDZA 2IZOA 4L08A 1E6EA 2CC2A 2C94A 2E4XA 3LX8A 2X8WA 3QWFA 4IHJB 4XSVA 5G0TA 4P7BA 3Q6MA 1N8NA 1PR4A 1CUEA 4I1YA 1VSVA 2Q2QA 4MICA 4JOSA 4CM5A 5JD5A 2DVMA 1CR4A 3OA0A 5DK6A 1K92A 2K6GA 3RNOA 2CL6X 4CM7A 3V1TC 3LIPA 5A4AA 1GDDA 2R7MA 3R3ZA 3C8DA 5EC8A 1GTZA 2RB4A 1JDUA 1WNTA 5IRCD 3KT3A 3THWB 3RG2A 2J3IA 1YRHA 3SK0A 4XLEA 3WOVA 2Z1MA 1D6JA 1KP2A 4I81A 1H8EA 1VE7A 4TSKA 2JKZA 3W5UA 3CR7A 4X0EA 1RYFA 5EKXA 5ELLA 3W05A 1SKAA 2JD1A 4KQ1A 3X1ZA 1BDIA 2JGEA 5EMMA 1BDBA 1HL7A 4DEXA 1T5LA 2P1RA 5HGJA 1KQOA 3M33A 3ZU6A 2GERA 1LRLA 1ISPA 1YRQA 2IHKA 1GZSA 2OCKA 2PWZA 4KKSA 1DEXA 1DOZA 3IUSA 3PQ8A 4KVAA 1KAGA 3MMPA 4PABA 1CZKA 2OXEA 3C85A 3LBAA 3L7DA 5JCJA 1O6FA 3SC4A 4BLQA 4EENA 4F72A 2JKYA 1C8LA 2D8MA 4PQGA 4BKOA 4KR9A 5C1OA 2GOYA 1UKZA 2DKNA 1XEFA 3GFPA 2PUEA 2Q1UA 4MJXA 1Z83A 3DBLB 3AHEA 3C3MA 5LYYA 4FZRA 3OZTA 1VP9A 2QPLA 4GRAA 1M90D 2DQKA 5HUHA 1F8FA 4RPCA 2MYNA 3R7NA 3DOJA 2FZKA 2O5EA 2PZFA 3PE3A 1YR7A 2ESRA 1N7GA 1WLSA 3W0LB 3Q41A 1N9GA 4C0JA 4Q47A 5JNRA 3DMRA 4RULA 3OEEA 4YRDA 3CF4G 4DB2A 4GZLA 4K6MA 2CYBA 2OORC 4DTIA 2QAGC 5FOVA 2CJFA 2IBTA 4TL6A 4Y2JA 5HXAA 2WD8A 3NHKA 2JFZA 1RR6A 1O5TA 5THXA 4J0FA 3L0YA 1A4XA 4ZVLA 3ZBUA 4GOJA 1AZWA 4U8GA 4CKCA 1V8DA 1E1NA 3L02A 5LZ2A 5FPKA 1RYDA 4PQRA 1XCLA 2F7SA 3T3MB 1Z5VA 2EJWA 1VRVA 2BCEA 3E7DA 1RXVA 1L7NA 5SV2A 1OW3B 2OQIA 4JYAB 2R4UA 4RCZA 1W6RA 3D4BA 1MO3A 5LYJF 1OIXA 2W6JA 3IDSA 2Y93A 4YI5A 5ALOA 1Y9JA 3TW0A 4WNAB 5EIBD 3B12A 3ED1A 3MJEA 3PNMA 3K0SA 3H2HA 1NYTA 3GIWA 3BTUA 4HUQB 1T5SA 2DH6A 2PV7A 2RHHA 3H9EO 1W581 2PTGA 4G8BA 1CIPA 3P9QA 1I4LD 3UFBA 4NK4A 3F3SA 4JSYA 3EISA 3BMXA 1DTWB 1R74A 1Q7YD 1VIYA 2G71A 4DK1A 1P2VA 3KUDA 3PWTA 2WICA 4KMOA 3WNQA 5EFOA 4OIFA 4MI3A 1WUJS 4GQIA 3HCCA 2R7KA 1KXZA 1L5RA 1FY2A 2GHTA 3FNGA 1X87A 5ED4A 2IOQA 3EY4A 2JCGA 4BO6A 5A5GA 4NNPA 5EWLB 1CJKC 1VBNA 3P0EA 3PNVA 3SXUB 5BXYA 4PFQA 2E9SA 3WC4A 4DV1B 1QBGA 1YZQA 1Z63A 4WEQA 4EG4A 1SAYA 4R0NA 4IIXA 4LTMA 2HRRA 3C74A 3EDOA 5AUPB 3ZV4A 1FE8A 5BV0A 1XB2A 1WB5A 1G5TA 2HBYA 3F1KA 3HABA 2Q4OA 1JQLB 3A9WA 4HNGA 4G0ZA 4I1RA 3GLVA 5FBWB 2RHTA 1YI0A 3NBUA 3LY5A 5JZOA 1KQGA 1V35A 2FY8A 2WWVD 2FX2A 1Z38A 1ZRHA 2EJVA 2GK4A 1Z28A 4XLZA 3QELA 3VPFA 3MTGA 2K7FA 3ZDCA 4I99A 2GN6A 5DOVA 1SUDA 3RC8A 3BC9A 1KAQA 2PVPA 2EQAA 4CQJA 4GIBA 3L1JA 2DBRA 3ZGOA 2XCSB 5AKEA 3T1VA 1GTL1 2Q2OA 1BCSB 4E1VA 4FEGA 2H0RA 2JAWA 2DG2A 1GITA 1HSOA 3P2JA 3H5VA 4ERXA 1SOMA 2Y1WA 2Z2KA 1ZH0A 5ALGA 3CH6A 5KPJA 4X7CA 3G05A 1QAMA 4ML3A 3RJ5A 1PZFA 1X70A 1T4BA 3KTFA 1V8ZA 2ORIA 3LUFA 3A3BA 2ABWA 4R2JA 1DRWA 3UPTA 5IYRA 2FRDA 2PUFA 4IH4A 4E1BA 2G8NA 3CCJB 3A4VA 5FKJA 1VA4A 3WGLA 4WLEA 1EX1A 2FW0A 3AF5A 3B7PA 2A1TR 2XWBF 1DQPA 5IYQA 3CT4A 4IPTA 4I55F 1L1QA 2NT3A 3ZDEA 2Z58A 5T5QA 2GYYA 4GOKA 4D46A 4BUJA 5KSYA 2C0QA 2WI8A 2PUVA 2IKSA 3PXDA 1SQ0A 3VPBA 4S2UA 3RUEA 3LP5A 2B34A 4Y1RA 1T9KA 1VM6A 2JGIA 1DC5A 4MB6A 3JWIA 5C8YF 1LPMA 2ZUWA 1UD2A 3OZRA 4FONA 4FYJA 3UFXA 4G0MA 3WB2A 2C5GA 2XF2A 1VMEA 3KXIA 1GL7A 1WXXA 3CRRA 5EXTA 4BBPA 5JRDS 5REQB 5I4KA 4DJ5X 1M1NB 5CLQA 3OE5A 3OQHA 2AI2A 3EDMA 1D2RA 2G9QA 4J0HA 9GPBA 1TCBA 1TZKA 4FUQA 1DCFA 1M34B 5KYVA 5CH3A 5GONB 1IIRA 2FDRA 3PSHA 5CD9A 1NXWA 4C7OA 1P75A 1RAIA 4GPAA 4R1PA 4D4HA 2FZ5A 4FYVA 1GPAA 4I3GA 4WZZA 3GU3A 3BWXA 3IR6A 3VJLA 3DONA 1GKKA 2WD7A 1VYTA 3C70A 2OBTA 1K6EA 4J0KA 3C4QA 1H6AA 4GR5A 2W6CX 4TKMA 5FPPA 4DR2B 1VLJA 3BHNA 3U13A 3HDQA 2G72A 3AR5A 2O2EA 1NDHA 2Q3BA 1P7VA 2CJWB 2FLVA 2OPBA 1AGXA 3MJTA 4BX2A 5KDDA 2IIVA 4TQAA 4NENA 2A57A 4QUGA 4K86A 4MR8A 4KGZA 4HB3A 1E2UA 1QV6A 3TVDA 1KY2A 1U0LA 4RVGA 3CX8A 1Y4DE 4FNAA 4GPEA 4LJLA 4NARA 4EKDA 1J7KA 4S2EA 1XQYA 5KTKA 1D5CA 1I2CA 1L3BA 1DC8A 1R8XA 1RI3A 1K7CA 3LPDA 2HCJB 3GWGA 3JVUA 3MCVA 4BV2A 5KYWB 1KSHA 4UMDA 4XM3A 5KS2A 2GBPA 4OKIA 5EQDA 3EB9A 2J0VA 3HLTA 5BSHA 1GVHA 3R0VA 2C8LA 1U1GA 1K5GA 2G3YA 1HNWB 4I9GA 5HJEA 3WL3A 1GRCA 2PLFA 5HVNA 4YECA 1SA0A 3VH4A 1Y8QA 5TPWB 3O74A 4ZI7B 3CPJB 3FKSD 4Z3DA 7MHTA 4BBJA 3GOHA 1RRFA 1XNJA 1IEQA 1KH2A 4HB0A 1V4NA 4RX1A 5K99A 2ZJZA 3AWDA 3G2QA 4MRAA 1VDMA 2UZAA 2W4MA 3RKUA 4ZDJA 2NV6A 3HNPA 1SGWA 4KDFA 2ZWOA 2R8OA 4G4IA 4G5GA 1KVTA 1VL5A 3IE2A 1QO7A 3EZYA 3PFFA 3PJFA 5HE9A 3THYB 5I8PA 1ZM2A 1N25A 4MCIA 2D2EA 3M2TA 1G4HA 1T4GA 1Z45A 1USWA 1XU7A 2R6AA 2VJYA 2X4IA 1R5BA 3NIDB 3EVNA 3I04A 4H1HA 3R76A 4CEIA 5JI2E 1C0EA 3KLNA 4PTLA 5JTTA 1JHXA 1M8PA 5TQ2A 2GYVA 2PFGA 3SJAA 5C53B 1FFCA 1XZQA 5JAIA 2OM6A 2VZLA 1DQYA 2OV3A 1P1FA 3V4ZA 4ZTBA 2OSBA 2H16A 1MNAA 2JGDB 3R24A 3X1MA 2X3UA 1XJWA 1Z4QA 3KSUA 3M9LA 3NM4A 4KN6A 1NNLA 5FBKA 2HXGA 3UO8B 5JZVA 3RNLA 1N5OX 3IAEA 3R6TA 4MIKA 2AF4C 2WUEA 4QYTA 1L9XA 1TA4A 4NBVA 2V7TA 4HVLA 3IEVA 2ZPUA 1JEYA 3PENA 5KJ1A 1XWWA 1JQ5A 3OWOA 4G25A 2XDYA 4HDMB 3RSGA 2ZXHA 1EUDB 1ZCFA 2IZ5A 1REQA 5CVCA 1V9CA 1FSGA 1TA0A 1JDVA 3CZQA 4CLHA 4N7RA 4CGZA 3VNQA 2UVQA 3G8DA 4PG5A 4P92A 2Q2NA 4RQAA 4R84A 1DQSA 3DZDA 3LL4A 1WSWA 5JSYA 5GADl 2C54A 1OXKB 1JSRA 1TIPA 1Z06A 2QG4A 1I6LA 2Q9AA 3CY6A 4GRIA 4J75A 1U8YA 3ED5A 4JB3A 2AC7A 1ENPA 4LJRA 2IU4A 3EIWA 4BVHA 3GLHA 4MW1A 1UFVA 4YAUA 4B4WA 3KVNA 3PDHA 1UPBA 2GASA 2AEEA 2J3KA 2P7IA 4I5IA 1NBME 1Q84A 2WIAA 3OLCX 2QTZA 1BTOA 1P73A 4DABA 4HDSB 4Y1FA 5AVWA 4YCJA 2D2VA 2PWAA 3BPSA 3PI7A 3TTVA 2JLSA 4YVFA 2LDXA 1CNFA 3BIXA 3SC2A 3WDMA 1W36C 1JR3E 3GJ3A 3Q2KA 4H0FA 1NY6A 1JSXA 3QNUA 3I8XA 1BNCA 4E2WA 5K8JB 2AG5A 3GJ0A 3GMTA 5KTYA 1UIRA 3IPCA 3F0TA 1HZEA 5JYDA 1E2MA 2WUGA 3W2HA 2QN9A 3UPUA 4ZMBA 2JIRA 3ZGXA 2WDZA 4RDIA 1MU0A 2VN8A 4UTZA 4YIKA 3WK7A 4XN0A 2YHUA 4EHFA 2ZRPA 3BDAA 1NZJA 4ZVKA 3KXKA 4MPJA 3H8VA 3N2GA 3COWA 4EKNB 1Y6FA 1NQUA 1E4EA 3PHHA 4C4OA 1SD5A 3G68A 4OHRA 4NC9A 3G0GA 4JI3B 3FMFA 2P0AA 3E5RA 3WLNA 1Q0TA 3VR5H 2OGWA 5J5CA 1Q3HA 4OOXA 2QT9A 3WIDA 5B1SA 1WZUA 3TJZA 1DJLA 1G8YA 2ZJ2A 1ORRA 3OOJA 4P12A 2BDEA 3FDJA 3IKLA 1RBYA 4EK9A 4Z0TA 4HQFA 5AVJA 4NCXA 1G55A 3U4HA 3PKJA 5K0ZA 3D4NA 4WOJA 3HDTA 3SE0A 4QPCA 1L4GA 1N5IA 4WKNA 1FRQA 3ERCA 4K6OA 1MEJA 4BLTA 2ZKIA 2W0MA 1Z5OA 2DJ5A 4TVOA 1Y42X 2QX7A 4I4TB 3TRHA 5JDIC 4BQIA 1NI3A 2JVKA 3D3WB 4FFMA 4M8LA 5COBA 4ENRA 5BSWA 3LCRA 3CGWA 4MVXA 1GGKA 4ZANA 3IL2A 4FMDF 1BKYA 1ZC4A 4KQXA 1GG2A 4RGBA 7ADHA 3C6QA 2ANCA 1QHYA 2I29A 3DPUA 2QVXX 4WZLA 1IB6A 3KTAB 2RH5A 3OHPA 2ZW9A 1TPZA 5D00A 3ZGLA 3HBJA 4CVNA 3NI2A 3LUGA 1M6WA 4DV2B 2VAMA 3GEHA 5J43A 1X7WB 1MO4A 1FP4B 2HJSA 3FHOA 4L6CA 2R1VB 4PHTA 2R2GA 3IIKA 3IODA 4J9UE 5B1HA 2RGNA 4B2PA 1MORA 4BDTA 3W3AH 1BXKA 4KAJA 1KMHB 4N3CA 4KC0A 4RU1A 5B6PA 5KNBA 4KGXA 2ZRAA 1WVIA 4ZK2A 1SXPA 2BBSA 2JJ1A 2ZZQA 4ZCTA 5F5NA 5ABPA 1P4RA 5FA6A 4YACA 5GJVC 1CS0A 3UMMA 2H1CA 2C3UA 4MP8A 3BEDA 2BKEA 1Y1SA 2Y9PB 3EIFA 1S2DA 4D4KA 3OZXA 4S3MA 3DAOA 5HIIA 1XD9A 3V3KA 1N2XA 5H16A 5IJ9A 1VB5A 3LT4A 1VKHA 1C9EA 4A8TA 3KOXA 1VXOA 1D0SA 3VZSA