4RD1A

Structure of aif2-gamma h97a variant from sulfolobus solfataricus bound to gtp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGAEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 114
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd1A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd1A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd1A01
2FFAA 1E1QD 5IDVA 1FNMA 1A4RA 2ZYWX 5JCZA 4TMKA 4RD3A 4KSCA 1Z5ZA 1GL6A 3GCGA 4I81A 4P32A 5CJPA 2Q9BA 3TUJC 5EJEA 1ANKA 1NVVQ 3Q7PA 3K0SA 4NP6A 3CNOA 4UNQA 1IJEA 2PZFA 4Q4LA 4C0AC 3IUYA 3GLGE 1Q21A 1QHIA 1JJVA 3G82C 2ONKA 4OQFA 1UM8A 1GNRA 5THXA 1XCPA 3KUCA 4BZQA 1K8RA 2NMVA 2EFHB 3RRMA 4BRWA 4ZDKA 4QJ4A 3LO5A 2GEUA 5EP3A 1Z47A 3PFIA 3PUWA 1NKSA 4IEEA 1OXVA 2H7VA 4V0ME 3A1UA 3UWKA 4D0NA 2HT1A 1T8UA 4AD8A 1X86B 5G3YA 1AZTA 1VYVA 4FINA 1E9RA 4IKEA 4AKEA 4EUNA 3SZRA 4TT3D 1XZQA 3VNUA 1U2RA 3ECCA 821PA 3THWB 1GP2A 2F7SA 1A2KC 1AM4D 3DMNA 4PFSA 1YZQA 3A4LA 3THXA 4DJTA 2EWVA 5JZVA 3KQKA 5FL7D 2BJWA 4XTCS 4PC6A 1PZNA 4MRSA 3KB1A 4JLJA 2ONJA 1DAEA 4XWKA 4LDJA 1NLFA 1RJ9A 3TAUA 2QA5A 2PMDA 3L82B 4TLDA 3W2GA 1YR9A 1DS6A 2FZ4A 5AUNB 4Z8YA 4QKQA 1JNYA 2IYZA 3EA5A 4G1UC 2MSDB 4OQXA 5A5GA 4HZUB 1J9ZA 4IVQA 5CYOA 4C0QC 2WTUA 1I2MA 4A6XA 4B32A 1HE8B 5EUQB 5JS7A 3V4FA 2J3EA 3C5CA 3G71B 2YOFA 4ZKEA 2VF7A 3RVBA 3DM9B 5E4FA 3U3MA 4ERNA 5GV7A 2EQBA 2BF4A 1E2LA 3F0TA 1T0JB 3QXSA 1XJQA 2ZAOA 3DDCA 3VX4A 1LW7A 4BLRA 2FSFA 1QHYA 2DB3A 2VF8A 4UNPA 3KKQA 3IPYA 4IDPA 3NBZC 1VQOB 2GCOB 2O0KA 2W6JD 4N0EA 1CS4C 1S9HA 4QBGB 4DSTA 5JBQA 4DB2A 1E2PA 1S2MA 3GJ3A 5FI0B 1QF9A 2C9YA 3LFUA 2GAOA 4QM6A 1KJYA 2QNRA 3NC1C 5LB4A 1Q1ZA 4MUBA 2PT5A 1QHXA 3QXXA 3GD7A 4PZZA 4OI2A 4D4JA 3D31A 3AVTA 2BMFA 3PEWA 5E7JA 4X8LA 2A5YB 1F20A 3CB4A 1NLZA 2XB2A 4QBIA 4FMDF 4OHYA 3ES9A 2GCNA 1QG4A 1O87A 5TY0A 3P27A 1DARA 4I1OA 4B73A 3V4RA 3TUZC 2F1IA 2CXXA 4AWXA 2PLFA 3FMOB 1Z6YA 2A5JA 4KJZA 3GFOA 1UADA 1QRAA 2GXUA 1U0HC 5EP1A 3D7MA 3AF0A 3E5HA 4HAUA 2NQ2C 2WZQA 3MCAA 1SVWA 2IS1A 1CNFA 1MRNA 3NEJA 4PHHA 1PVOA 4HDQB 4RKEA 1OIXA 4BEBA 1E2DA 1XD2B 2VNJA 4G5GA 2PCLA 4TYPA 3AB3A 1P4SA 2A5GA 2CL0X 4XJXA 4DLTA 4LBWA 2YOGA 3U7HB 1KJWA 2OLKA 4XSHA 1QZXA 4XTRA 4P0TA 1Z08A 4C43A 4RZ2A 4JJZA 2GZHA 2OT3B 3GLIA 1Z07A 3H4MA 3E1YE 5FOWA 1US8A 2QPAA 2VHQA 4PC2A 3CRW1 3PCRB 3K0FB 3M4YA 1Z63A 8OHMA 4XVRA 5CDFA 1E2HA 4RJLA 2QSYA 4HLCA 3OW2B 3LNCA 1N0WA 4KLZA 2GJKA 3T1VA 4R2HA 3HR7A 1E0SA 3DM5A 4G5RA 3I92A 4WZAE 3KQHA 1P9WA 2ZE7A 5CM9C 4LYFA 4URZR 5DN6D 4NPHA 3VR2A 2ZS7A 3W5JA 2FGKA 2X1VA 4NYIR 1KI9A 1DPFA 3QPUA 3VAAA 4BFZA 5B57C 5FBVB 3UWOA 5KHOC 1Q3TA 1M1YE 4O25A 1VHTA 4TLCA 3SJBA 1OFUX 4H1VA 2JLXA 2RGAA 2WPDA 4DRZA 1BMFA 2KI5A 5HKKD 1GL9B 5HE8A 1RFLA 3O8DA 3QFCA 3WP1B 3E1SA 2ZUDA 3AM1A 3LRPA 4KITB 1HV8A 2ZEJA 5GV8A 3VU9A 1OYYA 2ZYVX 2QT1A 4R98A 2DEUA 3WMEA 3CMAB 4OQLA 4M1WA 1CJTC 4PQFA 1UKVY 3TQFA 1Z3IX 3JQPA 4UXJA 3K8YA 1MKYA 1N5IA 1TEXA 3OFND 5H68A 3W2EA 2ZRFA 4U5XA 4Q9JA 4WQMA 5DISB 4BASA 3DZ8A 5DH9A 2Q9CA 1MABB 4FCWA 2QBYB 4F38A 3LX8A 3PQCA 1II8B 2PEYA 5CB6A 2JLVA 1CEEA 621PA 1D2EA 1G7RA 4BPRA 1KO8A 3AGPA 2ZETA 1E9FA 1MH1A 4AYTA 1VQ6B 1R5NA 2CVHA 3P4XA 2EFDB 3OAAA 2XTNA 5TXGA 2OG2A 2ZYUX 5J5CA 1ZD8A 5C2JB 4F92B 3PEVA 1UBGA 4HB0A 5IRCD 1FNCA 1G6HA 2KWIA 2NTYC 2V4ZA 5DHAA 1XFAA 2BMWA 2RMKA 5EP2A 1B2RA 2OO7A 5KUTA 2C95A 1NNEA 1JPNA 2NZJA 3AVXA 2ZRMA 1M2OB 2YHSA 2AN9A 1GSIA 3CCSB 1MOZA 3C14C 1OF1A 1RW4A 2J0VA 3KXLA 2QENA 5IK2D 1W2HA 1HA3A 2GJ8A 3CNLA 4LHWA 4QBFA 4I4LA 2F55A 4BPBA 4KSBA 2N46A 4Q9LA 4BLPA 1NVXQ 3BB3A 1G3UA 2QQ0A 2FFHA 4URYR 4BFVA 3GLIE 1A1VA 4BLQA 1ZD1A 4AKIA 2VEDA 2C9OA 1F2TB 5BYKA 1CP2A 1P72A 4URUR 4WW0A 2C8VA 2V55B 3GLFB 5CDFE 2AXNA 4GI7A 2PEZA 4IDOA 4Q66C 4EIWA 3QIAA 3T35A 1B0UA 1G64A 1R5BA 2XX3A 4YXWD 1R0ZA 3U7GA 3NXSA 2BHRA 2V3CC 5FPSA 1CLUA 2FPLA 3HJNA 3QUSA 3KKNA 3A4MA 4L5BA 1Z28A 2Z4SA 1TTTA 1ZU5A 3TBKA 4Z1MD 1E2QA 1W2GA 3GLGB 5BN5A 2WSSA 4TTRA 2CJWB 2IS6A 5IF9A 3JVVA 2JIZA 3WXMA 1G9XA 1N6LA 4B3DA 1DAHA 1P2VA 1UPTA 4JL8A 4MITA 4NDZA 1XXHE 2FA9A 1E9CA 5AJYA 1OLOA 2ZRLA 1UF9A 2VH5R 4JJKA 2BM0A 4ZIRB 2BJVA 2YKGA 3MWLA 2D7DA 3V76A 1NIJA 4LCBA 1Z06A 1HT1E 721PA 3MHPA 4DWJA 4B2PA 2FWRA 2IC5A 1I4TD 2JATA 3I3SR 1TUEA 1W4RA 1WXQA 1ZP6A 4LBZA 4RFSA 4ZO4A 2LKCA 2QORA 4GBMA 4NTZA 1JR6A 3NG1A 2P6NA 1NL3A 4AK9A 2C99A 1JB1A 1L8QA 4P31A 2Z0MA 4LJYA 4V0LA 2QZ4A 3W6OA 2WICA 2O8DA 2YWGA 4C7OA 4AC9A 1J8YF 1E3MA 2W2VA 3CO5A 1IN8A 1FMLA 1IBRA 4Q1CA 4RKFA 3U4QA 2O5VA 3KB2A 4P4TA 1PUJA 2IWRA 4Q5IA 3UMFA 2X19A 4PSKA 2OBLA 3KTAA 3N2IA 4HDCA 1MO4A 1EX6A 3LLUA 3CZQA 1XB2A 2OUKA 3RRZA 5AJXA 5SZKB 1E1RA 3I32A 3L43A 3G6EB 1W47A 2PX3A 3FWYA 3G5UA 4HATA 1HTWA 1LY1A 2GJSA 3IIKA 4Q01A 4RZUA 3QE2A 2KSQA 3EC1A 3M6AA 1K73D 3FE2A 1KZGB 2W6IA 1L4YA 4JLKA 2YWHA 2RGCA 2WWFA 1DE0A 5P21A 2XZOA 3HYTA 1YJWB 4Q9IA 5KSZA 1G17A 2VP5A 1KI7A 3ETLA 4XH9B 1D2NA 5HR5A 3AP2A 3EZFA 1FNBA 2RGXA 4E22A 3W3AA 3AVWA 1OHHD 2F1RA 3BK7A 2X8AA 1CRQA 3LBNA 3IHLA 4IEIA 4RD1A 5TARA 4BFSA 2FEOA 1J7KA 3DPUA 3ZS9A 3QFSA 3A1VA 3TK1A 1DOAA 1G3QA 2G9NA 1E99A 1ZM4A 1W49A 3BWDD 1Q1QA 3FTQA 2MSCB 1F5NA 5FOTA 3GEIA 2GESA 1OIWA 2FV8A 2O8FA 1XMSA 4W7SA 1UDXA 3AF1A 1JB9A 3KX2A 1OGJA 1VYUA 2F43B 1E1QA 4I99A 1E79D 2KB0A 1WBBA 1DADA 1YZGA 5FTMA 2VTKA 1ESMA 3E70C 4YMTA 3QF4B 5KYKA 1E32A 4IDHA 3L8YA 1NSFA 5CITA 1N3BA 3QXCA 3NBYC 3DHWC 2GZAA 4TN1A 4NZYA 4A8JC 4DHEA 2G3YA 3X1ZA 4CT4B 4U02A 4QJ5A 4DB4A 4JBXA 1EXMA 3EA0A 4M1SA 4QHSA 3SU8A 2XOKD 3KXIA 2B92A 4UXHA 5KDLA 4MGYR 4M1YA 4JS0A 1M7HA 1WMSA 1UEJA 2KBFA 4UAJA 3EG5A 3NTUA 1VQMB 2J59A 4DUGA 1W0KA 1ZC3A 3U60B 4JSYA 3ZYCA 5DO9A 4KFUA 3AF4A 3CUEF 4TT3A 2WKRA 2CL6X 2KBEA 4J0QA 1XJ0A 1GRQA 4RCZA 4DDTA 4DZZA 3K0EA 1Q82D 1G8FA 2B7BA 2ZTSA 5FL7A 3SBEA 2FMXA 1KI3A 2G1KA 5FBQB 2VBCA 3QY0A 4HEJA 1XMJA 3NDPA 3W5HA 1K8AD 3KZ1E 4C4PA 1SKQA 1VQ4B 3QI2A 1DAIA 1KO7A 4CEIB 3B13B 3W2HA 1NP6A 4L9WA 1KIMA 1OV4A 3CCMB 1VG1A 5FOVA 4Q1DA 2OFWA 2WVJA 1E64A 2ERYA 2VRWA 3SJAA 4II7A 1XEXB 1AGPA 1SXJD 3VMFA 1UKZA 4O0MA 1Z0KA 2WWWA 1S8FA 2AD5A 3A6PC 1IY2A 1R5OA 1IQPA 4NYJQ 4G5QA 4YMSA 1GKUB 3EW9A 2RH5A 1NI3A 3HDTA 1M34E 1YJ9B 4V0KA 1VQPB 2IT1A 1CU1A 5CB8A 3W5UA 1RE0A 2CCKA 3FYHA 1NN3A 4EKDA 1ZVQA 4Q19A 2H17A 3TJZA 2MSEB 4A8JB 1BX0A 2JJ2A 2ZSFA 4C0KA 2JLSA 5AUPB 3VR3A 1KI6B 1W0JD 5H70A 5EE1A 3WBKA 4BZXA 4DKXA 2C03A 5JJIA 2QRNA 1FP6A 4QXAA 1P5ZB 4BFXA 1GM5A 3AF2A 4YMWA 5EXTA 1GITA 1DAGA 5BYJA 4LOAA 3WYGA 2ZPTX 4QGAA 1SXJC 1ZBDA 2OCPA 3SEAA 1XMIA 4TMTA 3ZIAD 2I1QA 2BKUA 3THOA 4A0GA 2N1BA 1J2JA 2ECKA 1A5TA 4G5SA 5JLJA 4EJSC 3THYB 4DEYA 3PENA 1GNQA 3L0PA 3RNLA 4MYTA 1ZRHA 2X2EA 5SZHB 5E3HA 5KDDA 5G3ZA 4KI0A 1XD9A 1Z0FA 2ZR0A 3LBIA 2ZSAA 1M7BA 1WE2A 3PUYA 1IY1A 2VO1A 5CK4A 4W5JA 2DY1A 5JWRA 2V54A 3I5XA 3QXHA 4XVQA 1AN0A 2HF9A 2ZJOA 2ZRKA 3B9QA 1Q0UA 3CX7A 1E0JA 3PITA 4KFTA 5KNDA 1Z8FA 1I2DA 2FX3A 2GJ9A 3GLIB 3TSWA 4JSTA 2A30A 4GL2A 1IXRC 2QI9C 1NJFA 3GP8A 1VECA 3BRWD 4IXNA 1KK3A 1P60A 4B35A 1WRBA 2HLDD 4HLUA 5A4JA 2PIAA 3JVUA 4C2UA 4A0FA 2A2ZA 4PAMA 2D4HA 3Q85A 1JPJA 4B48A 4LJ4A 1Z6AA 4EPRA 3CW2A 4Q1BA 1HE1C 2AR7A 2R6DA 1XCMA 4JVLA 1W35A 3IEVA 3B9PA 1GR1A 2XEXA 3FHTA 5HXBA 4ZCMA 1D9XA 3F8TA 2CDNA 5B58C 3SYNA 3RHFA 2IHYA 4DDVA 1W36B 1JR3A 2IL1A 3QKUA 3CC7B 4DIDA 3FB4A 3QXJA 3W8NA 2CHGA 4BLTA 1NN1A 2H1LA 2GPJA 3OEED 4JMPA 1EWQA 2CMKA 4KFRA 4GZLA 1CJVC 4RZ3A 1NSTA 3W90A 4V03A 2J0UA 4Q21A 1SXJB 4ASUD 1VMAA 2NO6A 4RVCA 4D25A 1XXHB 3V9PA 2JDID 3EC2A 1OYWA 2QMHA 2ZE6A 4LBYA 3BXZA 5TV2A 1U0JA 1JBKA 2QTLA 3FMPB 4EPXA 1M1KD 3MUFA 4PZLA 4EJSB 3AEZA 2BOVA 4QJ3A 1RRGA 3ZZTA 3HU1A 5H5JA 3L8ZA 3C4JA 1D1NA 3QQ5A 4CW7A 4AG6A 3QFTA 1KDOA 2O8EA 4E07A 1HT2E 5D3MA 1SHZA 4TMVA 1W44A 3BB1A 3L0SA 2FSHA 4QGFA 2V9PA 4FWIB 2XZLA 3TW4A 3GJ0A 2GRJA 5EXPA 2BMDA 2FJUA 1W48A 2CNWA 4QOSA 3OEHA 3R20A 4JVSB 5ELXA 1EFUA 4JKYA 1FL9A 4IOMA 3FJOA 2C98A 1UFQA 1QHSA 1ZM7A 2GCPA 2VP4A 4NYMR 5GJWC 3T5DA 5JJLA 2DWQA 4HE6A 5AJVB 2OM2A 1HYQA 2FF7A 2PH1A 5D3QA 2ZROA 2J41A 5B30A 4K1XA 2IUUA 1HH4A 1HEIA 2JLRA 2O0HA 1W7AA 2D74A 5FOXA 3JQQA 4HLDA 4F4CA 4QBHA 2IA5A 3W5VA 1Q44A 1X6VA 2XTZA 1OKKD 1XWIA 1AIPA 1EG7A 3WNCA 2G77B 2PL3A 3CRVA 4CEJA 1FP7A 4Q02A 1KD1D 1KKMA 2LKDA 1OFIA 4QM7A 2YNMA 2WOOA 2EYUA 3IBYA 3FKQA 5HZKA 3AVQA 3TGPA 1KI4A 1KDPA 2CBZA 1RYHA 2JLQA 1AK2A 2ZE5A 5SZIA 5JHGB 1YQTA 3NC0C 1RRCA 2ZRPA 4XD7D 1A82A 4Q9KA 2P6RA 3WRXC 4MDFA 2G1JA 2DWPA 2CNDA 2N42A 1NBMA 1S4QA 3LH5A 2BVNA 1N5LA 1TF2A 5BN4A 5JSZB 1YR7A 1JR3E 1K5DA 2WJJA 3SBDA 4N3NA 3AVVA 3ND8A 1CRPA 4Q00A 4X8OA 4OI0A 1GVNB 4MKHA 1LS6A 4N0DA 4L16A 4PX9A 4EDHA 3GJ8A 4X8HA 4DLZA 4ABYA 4HSEA 3CC4B 1N0VC 1EFRD 1EP1B 3CLVA 4M1MA 3CM0A 3T12A 3UK6A 4ZKDA 5BN3A 3TVDA 2CLDX 2OCAA 2VP6A 1XDBA 3RSOA 2R6HA 1OW3B 4OYHA 1TAGA 3PUZA 5ANRB 4B74A 1E9DA 3MLEA 3SYKA 3TNFA 5FI1B 1FX0A 4L4UA 1TL7C 3QKSA 4MQBA 5FPYA 5JWHA 3FGNA 2RGNC 4B3BA 1PJRA 2P5SA 1WQ1R 3B1XA 4V0NA 1IY0A 2GQFA 3OZUA 1OFTA 5EE0A 3TIFA 3ZH9B 3ZVNA 2XXAB 2IYRA 4ESHA 3BFKA 3HWSA 4YC7A 1G6OA 5HE9A 1X8KA 2R62A 2GILA 2ZJ2A 4DCNA 5CLLA 2O8DB 4CEHA 4FN5A 1X8LA 1N8RD 1UDWA 4WIAA 3KQLA 3GJ7A 4TL6A 2QEXB 5KPJA 4JYBA 4FK8A 2VNHA 3W34A 2QN6A 4TMXA 3VO1A 1E9EA 2BEJA 3NKVA 3U3RA 2QAGA 1FQJA 4YAOA 1OH7A 1NMZA 3KTAB 5KNBA 1N6KA 2OEPA 2BN4A 2WKPA 3HPQA 1LF5A 1W5SA 1QFYA 5C18A 3P4YA 5AJWA 3DOFA 3WY9A 1H8EA 4LSGA 1KY3A 1K6MA 1QGZA 1SHKA 1VDZA 2EFCB 2R6CA 4RD2A 3NHAA 2L0XA 2WWHA 5HPYB 5TVKA 5FPTA 2X77A 1XD8A 3B8HA 4NKRA 3GEHA 4FI3C 3CCUB 4P4UA 3RRNA 3ND9A 1G5RA 3VHXA 3ZDQA 1RRFA 3REFA 1SULA 2GJAA 1VIYA 3K0CA 4US2R 2ZJYA 2ZRJA 2IWHA 2OK8A 4HUQA 4CGZA 1BOFA 1BKDR 2A7QA 5EUMA 3FPAA 1I4DD 4JL5A 2BBSA 3ZGXA 1NVUQ 3FKSA 4NU0A 1SVSA 1NBME 1YRAA 2BPOA 4JZKA 4D4KA 4OHVA 3W3ZB 3FMIA 3P32A 5FUWA 3D8BA 3CBQA 1XNJA 2UVQA 4B34A 5DIFA 2NO7A 1VCNA 2GEDA 2BGIA 4DCUA 4WAUA 3EWAA 4PQRA 2D62A 4TL7A 4B75A 3LAWA 2IUTA 4MKGA 1SVMA 2IYYA 4M0LA 3S1AA 1GKIA 3EIQA 1EP3B 3WHLA 4Z8XA 1F3OA 2ZRIA 3H0KA 1G5TA 2C9CA 4TLEA 1G19A 1Z2AA 2F9MA 4ARZA 3TRFA 3K70D 221PA 1KGDA 2ZRNA 5JHHB 1R8SA 3RDPA 4TLBA 2XB4A 4ZPXA 5AR1A 2ZANA 3O8RA 1NG1A 1XTSA 1Y63A 1Q22A 1JEDA 2OCYC 1TQDA 2XZPA 2ZUCA 4RFVA 4TYWA 1OXSC 4A0RA 3LQQA 5SZJA 1GKYA 4O2LA 2CEAA 3AKDA 3Q9LA 1N5JA 1QFJA 2QDXA 5KSWB 2QA4B 5GJVC 1AKYA 1E79A 3G4SB 2ZI4A 4IDNA 3AVOA 2FG5A 3MFYA 1D2MA 4N3GA 1S1MA 1X1SA 4CT5A 3DVLA 4M8NE 3BS4A 1AJEA 4DVGA 4C0JA 2HJVA 2A3RA 1KNQA 2QGZA 5J40A 1LS1A 4LX0A 1ZM3A 1P3JA 3ZD7A 3K70C 1XTQA 3NEYA 5HTKA 3QFRA 3CONA 1CR4A 3A36A 3ZVMA 2ZSEA 1NN5A 3QPVA 3K1JA 2IYTA 1TF7A 3DL0A 3N5CA 4LJ5A 2ZJ5A 1JJ2B 1CULC 4YDSA 3SQWA 4ACAA 1VQNB 1U90A 1G8YA 1N6PA 2ZSDA 3CWQA 3Q5DA 3Q7QA 4ZDIA 5L8VA 1NIPA 2JJ1A 2QG6A 4MRPA 4KAXA 4D4MA 4NHOA 2FPMA 3CPEA 4Y9UA 3R9XA 1U9IA 1WP9A 1YZNA 2UZIR 3FMFA 1OSNA 3KUDA 4ZDWA 5K8IA 4YAUA 4OK3A 4BFUA 3PXGA 4RD6A 2IEYA 2J46A 3TR0A 4BFYA 2ODEA 2CHVA 4BZPA 4NYIQ 3BC1A 3I73A 2WJYA 1H42A 1NVWQ 4M9ZA 2OK7A 4H9GA 4HAVA 4OK6A 5AUOB 1ODFA 2QM7A 1UAAA 3TMKA 4PO9A 3CRQA 2O8CA 1R0YA 1ZAKA 3Q72A 1G5PA 2C5LA 3OHMA 5FFMA 2AWOA 3U7FB 3A1TA 1Q86D 1DVRA 4FMBB 2BBOA 3ADBA 4F93B 1R10A 2VPPA 1VKJA 1YI2B 5TDHA 2YYZA 1DELA 4TYQA 4TL9A 2FDCA 3KQNA 4A2QA 1XEFA 2P67A 4MRRA 1A2BA 2OAP1 2ZS9A 3K09A 3CC2B 3TQCA 1SVOA 4PAQA 1G21E 3UMRA 4Q18A 3HU2A 3I4LA 2MMCA 4B4DA 3K70B 2ZVPX 1JI0A 3W5IA 4MGZR 4LUCA 4RCYA 1A8PA 2HUPA 3WMGA 3T1QA 1VPLA 2PJZA 1G20E 4HDOB 2VYQA 4LV6A 4FCTA 4ACBA 1XBTA 1YU9A 4FMCB 4BQSA 3T15A 5J4VA 2H92A 2OESA 4GZMA 1Z6TA 2XNDD 1G291 5JWOA 3CPHA 2WJGA 4M1TA 4HLQB 4P33A 1PLJA 2CLSA 4ZV4A 1AS3A 4QNMA 1YR8A 2FN4A 3OZWA 2WKQA 4DEXA 3REGA 4D80A 2IF0A 2Q0HA 2ZJAA 4MRNA 4TMWA 4PO1A 3MJHA 4JLAA 5L3QA 3I55B 2XSZA 1L4UA 1CJKC 3FOZA 2ZU0C 5FTNA 4ZDJA 2DFKB 2ZVQX 3GLHA 2J7PD 1XF9A 4PANA 4UNSA 4K8OA 4TZ6A 3ICQB 3J81k 3AP1A 4LC1A 2ZYTX 4IHQA 1T3LA 2OCBA 1O3YA 4QGGA 1R0XA 2ASEA 2OSBA 1JALA 1IXZA 3MMPA 1VG9B 2GK7A 3ZZUA 3CNNA 3MWKA 3ADCA 4KHZA 3PJRA 3N2EA 4QGHA 2ATXA 2HLDA 2Z5FA 3TR5A 2W0MA 3SC3A 1G7SA 2CK3A 3WBJA 4LI0A 4LWZA 2QGNA 1TADA 3LBHA 5KSYA 4BECA 4HAZA 1FW6A 1QHHA 1NY5A 4OHWA 4URWR 3SI7A 1JQJC 4D0LB 2RGDA 1NJID 1EFCA 3NH9A 1VCMA 4HAXA 4KVGA 2P0EA 1XRJA 4M9SA 4GSYA 1S1CA 1II0A 2YOHA 2ZRHA 4NCNA 1GL7A 3AH8A 2IS2A 2G83A 1VQ9B 4DCVA 2QUZA 1GDDA 1GNPA 1S3GA 3QE0A 5DI3A 2IYWA 1B23P 2O8EB 3AKCA 4TSFA 4XOIA 1FRNA 4MUAA 3EAQA 3IEUA 4CRWB 1GILA 2IEZA 3L0OA 4DQKA 1G41A 1RPZA 3QEJA 2FSIA 2HCJB 3SJCA 4K81B 4Q4AA 4MDEA 5EMNA 5GADl 4Z54A 3THWA 3EZ6A 5E95A 1S9DA 3X1XA 1C1YA 1IB0A 1AA9A 5AK0A 2QEQA 5KOYA 1COWD 4JVNA 4U7DA 3O8CA 2GKSA 2FGJA 2TMKA 2GVDC 2VLIA 2YC4C 2JASA 4OI4A 3LQRA 4GMDA 3OIUA 2MMGA 2OAQ1 5LB2A 1EWYA 4PPNA 5EE3A 2IXEA 2WIAA 2YJTD 4YAFA 3TE6A 4HZUA 2GF0A 1VQLB 4Q47A 3VHLB 3IILA 1DTSA 1X8JA 1WDTA 3CRRA 3U44A 4A82A 1GZSA 3VFDA 3I61A 2ZU6A 4BUJA 2FFBA 3CCEB 3FHOA 3QF7A 3W6NA 4LYJA 4TZ0A 2R9VA 3EXAA 4AY2A 3GLHE 2GXQA 2BSAA 3G0HA 4HI0E 2WJVA 1KAGA 4NL4H 2GCOA 4KFSA 1G16A 2GNOA 2I3BA 1G1MA 3EPKA 5LD2C 1OKKA 5KO2A 5TR9A 4UQOA 1ZUIA 3ZQ6A 1SGWA 5CJ2A 4UJ5A 3Q8XB 1T4GA 5FBRB 2ZAMA 4C30A 2ZR7A 2QTFA 3A4NA 3SNHA 1E4VA 1HQYE 2JEOA 2PJRA 1AZSC 2KE5A 3R7WA 1KHTA 2GWHA 2JLWA 2IBMA 1EFTA 2D2EA 1FNNA 3U61B 2JLZA 5FA6A 4AKGA 2ANBA 2Y8EA 2RHDA 3MG9A 4DCSA 1E98A 1KC8D 2ZJBA 1FX0B 1XCGB 1TX4B 3AKEA 3UATA 2VP0A 4TQAA 1QH0A 4PC3A 4OK5A 1Y3AA 4D6PA 3FPKA 2RC5A 1W4BA 4DC9A 2AFIE 4BWYA 2AL7A 1MT0A 2DWOA 3SHFA 3THXB 1P9NA 1IXSB 2A5FA 3H86A 5H59A 2PMKA 3IO3A 4EPVA 4O2RA 3RSLA 2HV8A 2QP9X 1X1RA 4DT1A 3B1YA 4CEHB 1SKYE 2OZEA 1RJ9B 2YZ2A 3IQXA 3VR5A 2Q21A 4YMVA 4HYYA 4FXPA 4AKHA 1FOEB 1LFDB 4B6FA 1QHNA 3AF3A 4E03A 4LK2A 3SOPA 5EXSA 3QEOA 1P7CA 4US1R 1W87A 2BMEA 1TU3A 3MJRA 3PEYA 1NLYA 5GJBA 4P4SA 4EPYA 1WA5A 1KAOA 4EFMA 1TLLA 3U3KA 2W83A 1U8YA 4A6PA 2GBLA 2IYVA 5LD2B 4X8MA 4ZI2A 3OE7D 1W36D 1E0AA 4YAWA 5C4GB 4FMDB 4KVAA 4KYIB 1YE8A 4JBWA 1G3RA 2B6HA 3SQXA 3B5JA 5CIWA 1XMVA 1XE1A 1AS2A 1XEWY 2ZRAA 2V8OA 4ILEA 1YVDA 4CVNA 4HE5A 1QUFA 2WPDD 1GWNA 4ZGNB 5L3SA 1BMFD 2CVFA 1ZIOA 4I1VA 2REOA 2QL6A 2F9LA 4QHYA 3B2EA 4HAWA 1DO2A 4IXMA 1WBDA 1ZU4A 4HUQB 4TL8A 1GRRA 2DR3A 5EP4A 2EFEB 1TQ4A 4D4LA 1YZTA 1NDHA 2W58A 5JI3E 3GPLA 5LBIA 2W6JA 3EPJA 1MO5A 1UKYA 1AGRA 1YR6A 4Q7JB 3RS2A 5H8WA 2WM9B 3KFVA 4LBVA 2HJGA 1W36C 1FFHA 1KOFA 5FUYA 3BERA 1N25A 3IO5A 4WVFA 2P65A 1T0HB 1KO4A 2OXRA 4URVR 1NMYA 2BM1A 4XSGA 2ZRGA 3U3OA 3HU3A 1DAKA 3W8RA 4W5HA 2QT0A 4Q9HA 1Q7YD 3RRYA 4ZI3A 1RC8A 2BCJQ 3IPXA 3OAAD 2AFHE 3VNVA 1CXZA 1VQ7B 3FVQA 4NCHA 1BJKA 3GJXC 4G0NA 2V1UA 1U99A 3K0AA 2BBWA 2UZ3A 5CM8B 5DYGA 2JLYA 2QSZA 1SM4A 2PZEA 3KJEA 4Y9RA 1P2SA 3F5FA 3MGCA 5FR1A 1CJMA 1ZJ6A 2QBYA 2C04A 1Q1BA 1GG2A 5BXQC 2NPFA 3UIEA 3SR0A 2VNIA 1U0LA 1CR2A 3DEFA 1II8A 2PBRA 3R8CA 4O3MA 5DGXA 4E5UA 2ODWA 4RD4A 3TVTA 4TYYA 3WNDA 2VZLA 3AQ4A 3CKLA 1E2GA 4A2PA 3NBFA 2RHMA 1Z6XA 4JLNA 2KJQA 1LNZA 2JA1A 1E6CA 1Z83A 5UKDA 4ZCIA 2DETA 1QG2A 3RAPR 1YIJB 1FUUA 1US8B 4IDQA 3T1OA 5J4LA 5KDOA 4QNRA 3MSXA 2EU8A 4ZGQB 2X2FA 4QHTA 1OT3A 1CBUA 2R2AA 2EFGA 2Q3HA 2BV3A 3W6PA 1ETUA 4OBEA 4B3GA 5LDDC 3QJYA 4DIEA 3PV0A 4POAA 5FBWB 1BX1A 3R9WA 3C41J 5EZ5A 4M21A 4XWAA 2AWNA 1XTJA 2VSFA 2ZI5A 4A1FA 1P2TA 3GFTA 3I8XA 4GT1A 5C46F 4HB3A 5J4YA 1CNEA 2LWIA 1QX4A 3MWYW 4MKFA 3ZVLA 1E2KA 1Z0DA 5EZ6B 3UPUA 3RC3A 3WYFA 1TUIA 3GLFA 2IYXA 5JMTA 5FUXA 4U9UA 3KFXA 3RWOA 5M04A 3ADDA 3PUXA 1PUIA 2GDJA 4EPWA 2RGGA 1IN7A 1ONBA 2AK2A 1KI1A 2QP3A 2ZUBA 2O8BA 5KSPA 5FPKA 2Z4RA 3BFXA 5CIQA 1PV4A 1VQKB 1S0UA 4M22A 5DN6A 4JYCA 3VQTA 2O8CB 1IN6A 1OB5A 2QRZA 3P20A 4M1KA 2ZRBA 3C15C 4OQMA 1Z6GA 2DFTA 3VU9B 2EWWA 3QKRA 3BORA 4TLAA 5L3VA 2DHRA 2EIXA 4PGOA 4BLSA 4EPTA 1ZNYA 3ASYA 2OTJB 1KDTA 1H65A 1Z2CA 4LHVA 3WNBA 3N70A 1U98A 3AUYA 2HF8A 3LXXA 1CR1A 2WAXA 1WCV1 4ZIRA 3CPWB 5HKKA 3AVYA 1YHQB 1DBSA 1IAQA 3WP0A 4G3XA 4WXRA 3DOEA 1U81A 3OIVA 4QL3A 3TH5A 4AYXA 1XTRA 4FWTA 4DQLA 1GAJA 3LXRA 4IFBA 3QG1A 4AF6A 3LW8A 1NF3A 1N6RA 3K9NA 4BE7B 5FH9A 2NO0A 1EX7A 2GTPA 3IIJA 2FZLA 3OFNA 1W5TA 5K8LA 3FDIA 1CQXA 1EWRA 1FMJA 1OJLA 3KL4A 5JRJA 2BBTA 2W2TA 1KSJA 2F1HA 1VYTA 4NYMQ 1LVGA 4ITRC 2V7QD 2W0SA 3LWNA 121PA 1AMOA 3H2YA 3QNUA 4PPFA 4RD0A 4Q1EA 4NH0A 4LPKA 2HEIA 2W6ID 3NH6A 3HP1A 4F7WA 3I56B 1QDEA 1KRHA 3U2QA 1XZPA 2D3WA 3OZVA 4EAQA 3ZJYA 4IOLA 5JS8A 3BGWA 5DHFA 2H57A 5IHPA 3QBVA 5L3QB 2B7CA 4C0LA 4R9UC 2A5DA 4IVRA 1RVDA 5JJKA 1KDRA 5IK2A 3BIFA 2JCSA 4DLUA 4CZ2A 3FHCB 3T61A 3TKLA 3NHBA 4LGMA 3DO6A 3Q3JB 4JVMA 3AVPA 3LW7A 1YHNA 3GLFE 3UMSA 3QVVA 3OESA 5FOSA 2OFOA 2BMJA 3F3YA 4URXR 1NVVR 3P1JA 4GFDA 1EESA 2OE2A 1A7JA 3ZVRA 4YXWA 2HYIC 3B1WA 1OPXA 4B2LA 2NZ8A 3BJIC 2XAUA 2QE7D 421PA 1T91A 1C4OA 5L3RA 1YZUA 2J7PA 1JA0A 4LV5B 4XVUA 3P26A 1QHHB 3JQRA 3H1TA 3JZAA 1FTSA 4Z1MA 4OHXA 4LHXA 521PA 1KMHA 4RFSB 3U6KA 1R8QA 4BFTA 2B8WA 4DLWA 2RAPA 4FCVA 2GF9A 1RKBA 2QP4A 1EGAA 5EQTA 1UBEA 1D5CA 1NJGA 2XNSA 2IHBA 5DI3B 1M8PA 2F1JA 3VR4A 4DSOA 3EPHA 2F43A 4RY2A 3IKJA 1ZINA 2FOLA 2DPXA 4DLSA 4C7OB 2QTZA 2RGBA 1M90D 4UNRA 4DUGD 1SKYB 1F2UA 2NOAA 3QF4A 4OJQA 4Q4AB 1W0KD 3EIEA 3TW8B 3U4QB 2PX0A 5F98A 4OKSA 3WHKA 1N0UA 1QGAA 1M74A 1Q3HA 3LVQE 1GJRA 4KYUA 3UANA 4BRUA 4DLXA 2EVWX 1ZYUA 1UBCA 4TWZA 4NCJA 4MKIA 3B82A 2YVUA 2ZE8A 3Q5EA 3CF6R 1OH6A 1M7GA 3CRMA 3OIYA 3T06B 4HUTA 2WIBA 1IN4A 2VHJA 3VKWA 1EFHA 4GP6A 4OQNA 1KJZA 1JAIA 1GAWA 3A1WA 2IUSA 3CX6A 2Z6VA 4G5OA 4CF7A 4MGKR 3A8TA 3JZMA 4JLPA 4DSUA 1VQ8B 1QGYA 3WYAA 1VG8A 2F6RA 2G88A 1JJ7A 2NIPA 4PHTA 1QVAA 4LJ9A 4QRHA 1COWA 1GTVA 4CYMA 4M9QA 3U44B 5G41A 3QBTA 1G3IA 1OXTA 3I1FA 3NIBA 1JECA 1G4AE 3BB4A 5F9FA 2Z83A 1YZLA 4D0GA 4Q4JA 3QKTA 5JEEA 1Z22A 5KTYA 4CEIA 2JJ2D 1VG0B 5G40A 4LC0A 2GBLC 3ZBUA 1ZNZA 3SDZA 1BH2A 2ZJ8A 3C5HA 2ZQ5A 4V02A 1XTKA 5DI9A 1MO3A 4QFMA 1XEXA 2Q9AA 2YC2C 1G8HA 4DDUA 2IYQA 4Q7MB 5DLQC 3R7WB 3QG5A 1ZNXA 4QC2A 1QFZA 3UG7A 2O8FB 2A78A 3IQWA 4D82A 4JLDA 2B5OA 2XITA 2XNJA 4CDGA 2HT6A 1Q1EA 4F91B 4K46A 4BEJA 4C9BA 3EZ2A 1OHHA 3NWJA 4G1VA 1VTKA 2K5UA 3AGQA 5HCIA 4RSGA 1V5WA 3QENA 4A8JA 5CK5A 1IJFA 3BBPA 3FFBA 3UKDA 5C4MA 1E2NA 1KI6A 1KKLA 1FQKA 1ZM9A 3M1IA 2A9KA 2DYKA 1ZUHA 3IDQA 4YALA 2GEVA 1E9AA 4YQFA 3CCJB 3ASZA 2VA8A 2H5EA 3RABA 3B78A 1E96A 2ORIA 4CIDA 4IJMA 4OJKA 4AIIA 1P61B 2C2HA 4C2TA 3T1TA 1TPZA 1XP8A 4F4IA 4DT1B 4MYHA 2JAQA 2QPOA 3E20A 4JL6A 5FTJA 3TSZA 3NDBB 5DSZA 1KO1A 4NCKA 3THYA 3CH5A 2IYLD 4GPTA 1D8TA 3GFPA 1V43A 4XWOA 5DE3A 2PCJA 2WMNB 4IFEA 1LV7A 5CLQA 1UBFA 5JI2E 4W9MC 2J87A 1K5GA 2R65A 2XOKA 3KXKA 4WA7A 2XNCA 4P4SB 3DKPA 3B85A 3BAFA 1VCOA 2QMEA 5BW8A 2D06A 3U7EB 3TSOA 2WV9A 4LZZA 5FL3A 3ZD6A 4OI1A 1JR3D 3PVSA 1BYIA 1QVFB 4MA4A 1D6JA 1UJ2A 4GOJA 4ON9A 2Q3MA 1OFHA 2IXFA 4HB4A 4NE2A 1ZC4A 5B2ZA 5G53C 1HURA 1H8HD 1QG0A 2AD1A 3SFZA 3B1VA 5L3SB 3UG6A 1ZMXA 2NO1A 5KNCA 2ZXUA 1BS1A 1W46A 2OFXA 2QM8A 1L2TA 2CL7X 3K9GA 4FW9A 2WHXA 4HLUC 4Y0AA 1KK1A 3EWSA 1TNDA 3KJIA 3AV0B 3OZXA 4UKDA 4G1BA 1CTQA 1BIFA 3CXCB 1LTQA 1N6HA 2WSMA 2BEKA 1DDGA 3OE7A 1G18A 3CR8A 3BD9A 3PIRA 1NG9A 1XU4A 5TB5A 5HZHA 4B2IA 1SVLA 3U3JA 1E94E 4A9AA 5A0FA 1ELOA 5GVSA 4AF7A 4KLNA 1SXJA 2FPKA 2BC9A 1E2EA 1XXHA 4PR0A 4DXAA 4B3XA 1N5KA 2G0NA 4EQ6A 2IS4A 3TAHA 5JEDA 5CYPA 1VQ5B 4C0BA 5F3WB 4EJSA 1IM2A 3EX7C 2OBNA 2CNWD 3OEHD 1IN5A 6Q21A 5J4KA 1TQ2A 3NBXX 3VR1A 5EE9A 3AKYA 2ZS8A 3ADKA 4Z51A 2ORVA 1YRBA 3K0AB 1W0JA 2I1VB 2QAJA 3LDAA 3LY5A 2ZREA 4WOPA 1T8TA 2XJ4A 5EXXA 2VL7A 4S2EA 2IYUA 4BGDA 3CPJB 3K53A 1XPOA 4PZYA 4YONB 2HXYA 2J0SA 2HDNB 1E62A 2E87A 1CIPA 2IF2A 1F60A 4MYUA 2ZIAA 3LV8A 1E9BA 2VIIA 3E2IA 4HZIA 2XTMA 4B76A 5DNYB 3EIHA 1R7RA 3KJHA 3ZIAA 1KSHA 2EYQA 1DG3A 1QVRA 3OF5A 4KBGA 3RLFA 3ZQJA 5FUVA 1FUKA 1KK2A 3FFAA 4TTPA 4LPSA 4Q4HA 2VYFA 5BQ5A 5K8TA 2G0TA 3MD0A 1E9SA 5JFGA 4KCGA 3EZ9A 4KV9A 1QBKC 1AQYA 2ANCA 2H18A 4Q1AA 2GHIA 3D6TB 1G7CA 2P6UA 3KDSE 1FZQA 3CD6B 4IRUB 4MRVA 4PXAA 4ESVA 4B3FX 1OB2A 2AKYA 1KSGA 4MGIR 4M53A 1VIAA 2R6AA 1KI2A 1II9A 5F9HA 1NBMD 2WBLC 2RB4A 2JLUA 4QG7A 4PC7A 2E1RA 3CH4B 4LHZA 3VKHA 1D9ZA 3B60A 4M1OA 2LCFA 4JBYA 2QROA 1E2JA 2ORWA 1U94A 5JECA 4M4SA 2GZDA 1EP2B 2J0UB 1KTVA 1C9KA 2REBA 2OTLB 3RS5A 1JQLB 1K9MD 1GRNA 2GXAA 3X2SA 2O52A 2O8BB 1I4LD 3GQBA 3VKGA 3SHWA 2PT7A 4FD2A 1MRSA 2BWJA 2J0QA 3LD9A 5JSZA 1N2CE 1G7TA 1W4CA 4L15A 1P62B 4PAOA 4B33A 1IOZA 1AQUA 5JRZA 2ERXA 1Z0JA 1YITB 1NY6A 4IW3B 2J45A 3CCVB 3B7GA 3CR7A 3KKOA 3AVUA 3QKRB 4G01B 1JAHA 3ZBTA 3OEEA 4GNKA 1TQ6A 1ZUNB 3W2FA 1SXJE 1FTNA 2QMOA 4Q7LA 4ASUA 2ZM5A 1P2UA 5D3MB 2JDIA 4B71A 1R4AA 4PSVA 5J47A 2IX3A 2AK3A 5E7IA 4OL0A 3RWMB 5DYIA 2YV5A 3TLXA 3SS8A 3RC8A 2NG1A 3X1WA 1N6NA 3HR8A 2F3TA 2ZI3A 1W1WA 1ZM2A 3V00A 1DAMA 4PHFA 4TMZA 2R6FA 2I4IA 2XXAA 4DLRA 1G8GA 2C78A 4I1UA 2OLJA 2VQSA 3UXMA 2ZITA 2UKDA 4F4JA 4WZ6A 1E69A 1H8ED 3C8UA 1XPUA 1U8ZA 3RANA 2VP9A 2WWIA 1E2IA 3PG5A 1JXMA 2B8TA 4C3ZA 5JCPA 2QMUA 2FNAA 5FOUA 2CRVA 2WWXA 5BWMA 2DBYA 3CWZA 4Y0VA 2PZGA 2OHFA 1ESNA 1G4UR 1G3MA 1GFIA 2QQEA 5FTKA 1DG1G 4PPGA 1S72B 1P75A 1SVKA 1DDIA 2EW1A 1OXUA 2VHTA 4CEJB 1J99A 4B47A 4Y7CA 2QAGC 1KO5A 3LLMA 1RYFA 1FRQA 4NMMA 2ZI9A 4YDHB 4Q48A 3QOFA 2R6GA 2GK6A 2WAYA 4LYHA 3HPRA 1G8PA 3T5GA 3HYRA 1YJNB 4YHBA 2O0JA 3VTKA 4A15A 3O47A 1T5LA 2VP2A 5AJZA 1QHGA 2V7QA 1KQSB 1IONA 1F6BA 3MRSA 2BIFA 3FKSD 1T3SA 2OBMA 3CCRB 4BLOA 3I8SA 5EE5B 2VSOA 4ZCLA 2VNKA 4F7DA 2H16A 3ONWA 3RS0A 1P6XA 1VCIA 1XJCA 1MO6A 3RS3A 2QTVB 1JXOA 4GMXA 2ZI6A 4MH0R 2ZRCA 4HB2A 3IIMA 2QU8A 3R8FA 3U5ZB 1ZW6A 4PPQA 1X3SA 4JT2A 2Z43A 5TMPA 2YWEA 2FFQA 3GMTA 3EASA 3K0CC 4JKIA 3BE4A 1OGIA 2HXSA 4PTLA 2VHCA 4Q1FA 3A37A 4XD7A 1FNDA 1KSFX 3BH6A 5FTLA 3PUVA 2RGNA 2PLRA 1E0KA 2V6IA 5AN9A 1RZ3A 3QKSB 3DMDA 1RRPA 3C7KA 3CMEB 3O8BA 4YLGA 5FR2A 5FPHA 3CF0A 3H84A 2DFNA 1KMHB 3LA6A 4LY6A 1CF4A 1E2FA 1KNXA 4P6VF 2GA8A 3QPWA 1WB9A 2ZR9A 1EFRA 1WF3A 4HAYA 3LO8A 2BGJA 3CF2A 2J9RA 4KXFB 4WXPA 2HMAA 5C1BA 4GOXA 3RS4A 3RYTC 4L8GA 2OXCA 1R0WA 2C96A 3LVBA 1KZ7B 1T6NA 2BKEA 1XPRA 3L2OB 1DO0A 2QE7A 4PQYA 1ZD9A 1W2BB 1F2UB 4D81A 3K9LA 3AUXA 1NMXA 1T5IA 1LF0A 3OJXA 1UMKA 5H1YA 3U6BA 3OJWA 1XD2A 2QAGB 3W2IA 2RGEA 2VSXA 3RS7A 5KSOA 3PR1A 2P5TB 2CCJA 1E63A 1PLKA 3AP3A 1CJUC 1F48A 4TQUS 5IT5A 4Q7KA 1M6NA 2V1XA 5FBLB 4A2WA 2YINC 1J8MF 1P73A 4I1SA 2JJ1D 5LPNA 3KKMA 2G6BA 4D2IA 4GOKA 3EARA 1T3HA 2FH5B 3K0FA 4PO8A 3WMFA 3A1SA 3X1DA 3L0IB 1Q12A 1DEKA 3EZ7A 4DCTA 4WZBE 4C0SA 2ZJZA 5B64A 3OIWA 2D2FA 3KKPA 4KBFA 2X3UA 4LJ8A 4BFWA 2W2XA 3ICEA 4JLVA 4B6EA 3SE0A 2WJIA 3QVUA 4IVPA 4U00A 1XEWX 3IBGA 4RZXA 1GOTA 4Q4JB 2GXSA 2BCGY 1MR3F 2ZRDA 3SYLA 2RKOA 1U9IC 4NYJR 4A4DA 2FU5C 4KO8A 1SQ5A 2IK8A 4LJAA 3ZC3A 2IXGA 4M2LA 3B1ZA 4LRWA 1BQEA 3IGFA 4GDFA 3PEUA 2DFLA 4JLBA 3S1AB 3C16C 1VHLA 1AKEA 4L9SA 2R8RA 3ZS8A 4A0HA 3EPLA 1FDRA 1BYUA 2AX4A 2C77A 3DKVA 4ARZB 2J7KA 1I7PA 1GAQA 1DAFA 1ZCAA 1Q20A 4TTQA 4N1AA 4B44A 3ZLJA 3CCQB 2B21A 1GUAA 1MABA 2JJ8A 1OH8A 1EK0A 5E7MA 1N6OA 2J1LA 1FPMA 3KJGA 4LHYA 2REXB 4MYCA 3SFVA 4DLYA 2ODBA 2OILA 2Q3FA 3K09C 4UNNA 1BO6A 4R7ZA 1NRJB 3CRZA 2QTHA 2HCBA 1Q57A 4NONA 1R2QA 4Q03A 3A58B 2D7CA 2AHOA 3BH0A 1W34A 2XSZD 1SZPA 1E2MA 4OHZA 4FIDA 2DERA 4B3CA 4KU4A 4AI6A 3TUIC 1KY2A 1GVHA 5KU1A 1YKSA 2P2LA 1GIAA 3I62A 1HUQA 1GO2A 4DLVA 4R71A 4A36A 3ZZ0A 4EFLA 4KODA 2V6JA 1F2TA 2CLCX 3BH7A 1S96A 5AUQA 2WSSD 3BFVA 3NVAA 3GJ5A 2JIZD 3LVRE 3MAAC 4UXIA 4D26A 4B43A 2F3RA 1IHUA 1TU4A 1J90A 4H1UA 4WBSA 4EFNA 2FSGA 4US0R 1NN0A 4LJ6A 3QSYA 1HQCA 3VR6A 3I5YA 2CK3D 1OIVA 3GJ4A 1R6BX 4NBSA 2JGNA 4FMCF 4LYAA 2XGJA 1H85A 2QPTA 2BDTA 2HYDA 2CE7A 5HCNA 1MV5A 2FE4A 1UEIA 4LV8B 3GLGA 1KI8A 1UKEA 2CJWA 4R2IA 4S35A 4GP7A 1RIFA 1CR0A 5GJCA 3CX8A 2WWGA 4TYNA 1AS0A 1N6IA 2YWFA 3LX5A 4PSAA 1CKEA 1ZNWA 3VX3A 1TF5A 1H8HA 4A92A 2DCUA 1YZKA 1OE0A 3K9HA 1PLLA 1LB1B 1ZCBA 4TSFD 3T34A 2H8KA 1W4AA 2W00A 1Z0IA 4EQ6B 5J4HA 3CIOA 1OXXK 3D3QA 3GJ6A 2NGRA 4V0MA 5GVRA 1P9RA 1KMQA 3BOSA 4JLMA 4AYWA 4DDWA 1TVCA 2IW3A 1JEEA 1XX6A 4DBLC 5AWFC 2GVZC 1Q81D 2NO9A 1Z0AA 4P3YA 2CCGA 2RCNA 1S3SA 1Z29A 3B6EA 4E09A 2CE2X 4AURA 1KYIA 2P3SA 1E1RD 3CZPA 1XTIA 1E4YA 1J70A 2IYSA 2RC6A 4TQ9A 4YMUA 3GEEA 4C0HA 3W9YA 2AXPA 2ZSBA 2CHQA 4NCIA 1OH5A 1TMKA 1T9HA 2J5XA 4GRAA 4JLOA 4AG5A 2NPIA 2FEMA 1U8AA 1ZIPA 2AKAB 1QUEA 3M0EA 2OV2A 2WOJA 4LJ7A 4Q4HB 4XIGS 3X1YA 2GAAA 2WMOB 2VHUA 4UJ3A 5F2EA 1KK0A 5KPDA 2ODNA 1HY3A 3R9IA 4V0OA 4M9XA 4W5WA 4IOJA 2ZI7A 3WRYC 2R44A 2SHKA 1TEVA 4JT4A 3GLHB 3DZDA 2XNDA 5K8UA 1YJ5A 2WWYA 2ATVA 4JIMA 3MWJA 3IHWA 4PHGA 3SN6A 1SVIA 2GETA 2QY9A 2XJ9A 2E9SA 2Q6TA 1L7VC 3KQUA 1JA1A 3I72A 1NKTA 1QVGB 4IOKA 4PC1A 3SJZA 4DSNA 4EH1A 3VO2A 2WJHA 3CCLB
chains in the Genus database with same CATH superfamily
3RBVA 1NOIA 1VHEA 1E1QD 1VE7A 1MGPA 1PX0A 2YR0A 3GT4A 4PG5A 2EBFX 2ZYWX 4Y2XA 4OH7A 1Z5ZA 3TUJC 1Y5RA 1P9LA 4LDAA 5HHTA 3GJTA 3INRA 1NE2A 3RFXA 2QZJA 4IG9A 4NP6A 5HF5A 1IJEA 1SEPA 2PZFA 2BKVA 1I0LA 4Q4LA 3VYWA 3CURA 1OWPA 1Q21A 2VDUE 3CLKA 4L28A 3GLGE 4N01A 3E8MA 3L6UA 1K4YA 5EHZA 4BWGA 2QN1A 3WDLA 2FMUA 1UM8A 3D2CA 3QKIA 3KWMA 4KAAA 3V8EA 3TTXA 2FUNB 4BZQA 4GOLD 5AICA 1P1JA 1AURA 2GM3A 3AJ9A 4NZZA 1G8KA 2WB2A 2GEUA 1WSBA 1L4NA 3N2LA 4PZCA 4RH0A 4ZI5A 1XNGA 1NKSA 3QELA 5LUBA 2B8EA 1OXVA 2H7VA 2JRCA 3G6WA 4H2DA 3A1UA 1JU9A 3DULA 2V5UA 2X53S 4AD8A 2ZIGA 1BPLA 2YDXA 2R6JA 1Z74A 2FCAA 4BEVA 2XT6A 2Z8YM 1N4DA 1PDWA 3ECCA 3OZRA 3UJPA 821PA 5DW3A 3MCTA 3QX8A 1VL6A 1VQ1A 1RJWA 1AM4D 1L1EA 1UD6A 3DMNA 1NNSA 1YZQA 2XYQA 4MXDA 5IBQA 3EIXA 5F5XA 4J7AA 5FL7D 3AEQB 3HFGA 3QLJA 4UZSA 3OC6A 2BJWA 1PJLA 3PGLA 2AI1A 3HADA 3OSZA 4PC6A 1HWYA 4Q24A 4YT2A 1VKRA 4DLPA 2PL1A 5K0FA 2X6WA 1BFKA 1NLFA 1RJ9A 4LGVA 3ICVA 1SUFA 2AW3A 2W2QA 2R85A 3L82B 5CT9A 3A7DA 2XWQA 1DS6A 2ZJ6A 2OZLA 1JNYA 2H1OA 2JHPA 1EUZA 3EA5A 1NLUA 4BRWA 5EVCA 1H4SA 4LZPA 4OQXA 1I01A 1QIKA 2I4TA 4IVQA 2WTUA 3GRFA 4A6XA 1QAMA 1HE8B 1C1DB 3EBLA 4UFOA 2FETA 1NR1A 2YOFA 3PNSA 5TT1A 2VF7A 3RVBA 3PHBE 1RDFA 5E4FA 1Y89A 4YYEA 3SVLA 4DA9A 1E2LA 4WZAA 3WDKA 4D9GA 1DRUA 1L9KA 1WXGA 3AOEA 5CW2A 1IEQA 2DPMA 3PHJA 4IWXA 2ZAOA 5FAKA 3X43A 4BLRA 2Z5LA 4KQWA 3JD4A 4HRVA 4NE7A 2HOQA 4UNPA 3KKQA 5BVGA 1GG8A 4IDPA 2GCOB 3MXOA 4W82A 2GBFA 4LY3A 1OOEA 3IL2A 2AC2A 4JR0A 5JBQA 3AK4A 1E2PA 3O21A 4DB2A 1NU6A 1QF9A 1TMGE 1M1YA 3T3PB 3RO7A 1VJGA 2GAOA 1CHDA 2HL6A 5LB4A 3NC1C 4CLXA 1Q1ZA 4PICA 4Y98A 2PBZA 4QM6A 1J2TA 2JK1A 4I5FA 3SYTA 5A3QA 1OAOA 1HG1A 2ZWAA 1PNQA 4PZZA 5F4BA 4ZVQA 3G2IA 1ZW1A 2OZVA 3HKBA 3WKEA 1ZX1A 2P2GA 5D86A 4F45A 3L4KA 1KP2A 3CVYA 4B6RA 3LHDA 2UZAA 1NYQA 1X0XA 3BD7A 8ADHA 1B42A 2X3FA 1TYBE 4B87A 3WNVA 2EP8A 3NJ8A 4F3YA 2GCNA 2EQAA 3IA7A 1TM5E 3CVJA 4L7QA 3I28A 3BRQA 1JAYA 2PT9A 4RELA 5AK4A 3ESDA 2XWSA 3DE5X 4LOLA 1NFRA 2F1IA 3OLCX 1CY7A 3IAFA 2PLFA 2RHRA 3O4IA 1IZ7A 2A5JA 3C24A 4KJZA 3AI3A 3K5PA 2M1XA 2DFPA 2C4VA 3NHRA 4R6XA 3D7MA 3HXLA 1ZXLA 5I47A 5BRJA 3MCAA 1SVWA 2X58A 3OOWA 3RTAA 4PHHA 5JZSA 1EFDN 3KQQA 1SG0A 4AZ0B 4NK5A 1B15A 3WAJA 4C5BA 3NASA 4M54A 4PGHA 2VNJA 4G5GA 4GM0A 2IPNA 2P4QA 3BG5A 3P45A 3KAPA 4NNOA 4B6OA 4BL5A 1V2HE 2ZWMA 1EX9A 4Q3NA 2WHYA 1RBZA 3CVVA 1GDTA 5HQ3B 1Z5WA 2YOGA 1HZEA 1R88A 3W8FA 3NCTA 3DAGA 3U0VA 3K20A 3L1VA 2DPHA 3LBFA 1GXSB 2E4UA 4BX9A 2W70A 2AFVA 2R0QC 3GLIA 2EF1A 2OT3B 4ALJA 3H4MA 2JZCA 4CKEB 2VHQA 2VHYA 4JUIA 4TKLA 1HNNA 2G08A 4QBTA 3A10A 1Z63A 2VSYA 4NWIA 1E2HA 4FSDA 4OREX 4WY5A 3LNCA 5DHTA 5ALQA 3BWMA 3QV1A 1PR5A 3HR7A 2QTWB 3T5MA 4HN9A 1FTWA 4LRUA 3TL2A 5H16A 2LCIA 3IR7A 1BCRA 3H4VA 3R6GA 1P9WA 4WZAE 3WLQA 5JYCA 4OFZA 3UBTA 3GJQA 1THZA 1ZUD1 5DN6D 2B1RA 1ZA2A 2V3WA 2YXNA 2AOUA 2O8NA 1KEUA 1OLSA 1OROA 4KXNA 4ADSG 1KI9A 5KNDH 1DC4A 1DPFA 4U63A 3MOGA 4JJ7A 4EMBA 5BSKA 5FBVB 3KT6A 3DBHA 3UWOA 3IP5A 5BMOA 4O4HA 1M1YE 2XOEA 5JXHA 4IGFA 3VYRB 2RGAA 4YMLA 5T5QA 4K7JA 4R1QA 3D6AA 3ITDA 2GZ3A 3FTCA 3E9QA 4M1ZA 4WBNA 2GPSA 1GL9B 2C9ZA 5HE8A 3R5HA 4IH9A 3O8DA 2GB4A 4BWFB 1PNRA 3WP1B 1XHLA 3VTZA 3GO4A 2CZCA 1ULUA 3D26A 1TQHA 2D1QA 2X85A 2VYVA 5B58T 4MIKA 5A5EA 2QT1A 4XKWA 4F9EA 3WMEA 1UPFA 1OLUA 2ZT7A 1JV2B 1PO7A 3L02A 4MI1A 4OQLA 3SVTA 2C7PA 2L18A 1CJTC 2R8PA 1UKVY 5BXYA 1T4CB 4Q34A 2QL9A 4EBFA 1YS1X 1K9VF 2GMWA 4AWBA 5IWCA 3HI4A 2GUGA 4N41A 4U5XA 2GA9A 2QBYB 5DISB 1P1CA 1NONA 4O4HF 4MVJG 1PFVA 2P0AA 1LV8A 3ZHQA 4F38A 2BH2A 1WMAA 4ND2A 2Y68A 1GQFA 1BSVA 3OQIA 1UH5A 1KC1A 3ORQA 3QEMB 5CPFA 4WBNF 1MH1A 4BMPB 2GTHA 1X80B 1QO0D 2CVHA 2P77A 3I9MA 3OLWA 3P4XA 3OAAA 1L7BA 4GE3A 5DLDA 4CU5A 5JAPA 5C2JB 1NT2A 2Q41A 1UBGA 4Z9FA 2KWIA 3F5SA 2BMWA 3TZHA 1H66A 1YO6A 2RB5A 2EJCA 2XUDA 3I01M 3IR6A 4NEQA 3AVXA 1M2OB 4XR9A 1GSIA 1MOZA 2Z2KA 3ZWKA 1ZD2P 3BAZA 1YJBA 1PEDA 3OZAA 5IK2D 1IDN1 3LF2A 1MW8X 5CFPA 2WZBA 3K6RA 4Q9LA 1RLOA 1G3UA 3GLIE 5FOQA 2XNHA 5DCLA 5ALMA 1EVQA 1F2TB 1F8UA 5FLYA 1N1GA 2FXIA 2X23A 3RNOA 2B7LA 2K2WA 1JLMA 1E8MA 4C20A 4WW0A 1Y6RA 2PKEA 2V55B 3D3NA 1V11B 3FNEA 2HCRA 2XADA 4Q66C 2X6XA 5LDGA 3T35A 1B0UA 3ED1A 4YXWD 5LQJA 3U13A 2UZ0A 2BHRA 1MAHA 3AL2A 3V4ZA 1AQNA 1CLUA 1ZY2A 1VL1A 2FPGB 2O2YA 2EG5A 3KKNA 3V1LA 4L5BA 4C04A 5K01A 1Z28A 2V7EA 1TTTA 1JG6A 1KZYC 1ZU5A 1WMDA 4R7GA 2VDOB 2E49A 2EGHA 3JQAB 1H2ZA 3KPJA 2JHFA 2Z08A 5IF9A 2YZNA 5HOQA 2OKCA 2JIZA 3AY6A 3OPVA 4XYBA 3I4FA 4KXWA 3SC2A 1KS2A 2WSYB 4AJEA 3ZCTA 1ZJ5A 2W6OA 3JQDA 3PC2A 4JL8A 3OFJA 3BQJA 4MHOA 1LRKA 1JXQA 1QOQB 1FFGA 3HSSA 2LXNA 3PGMA 1SQSA 3EZNA 3ZBQA 1I1QB 1PD1A 3G02A 3MWLA 3BTOA 1C8LA 1OI2A 2XUGA 3OFKA 4PYJA 1ADYA 1B7GO 4FDTA 2HX1A 2WF9A 4RK1A 2FWRA 3ZDYB 1I4TD 4HNTA 3TNYA 4NJMB 2GO1A 4ND6A 1WXQA 4LBZA 4RFSA 4GPAA 4G26A 4UU7A 4DS3A 5G41A 5GZ6A 2FVGA 3JQ7B 3GDFA 1XA0A 4WDQA 1XKXA 4J4BA 1D1SA 4AK9A 5J5AA 2C99A 4EW1A 1MD9A 3R4VA 4YJ3A 2AXEA 1NJ8A 4V0LA 4X66B 3BFJA 4I9HA 1LXCA 4BX2A 2JF0A 2I6UA 3DQPA 1BE6A 3HB4X 2DM6A 4S12A 3TQQA 4C7OA 3PHLA 2OENG 1CDOA 4URFA 2A59A 4XE5A 1IN8A 3TLGA 5BWCA 4S05A 1F1JA 1Q11A 2O5VA 5TJHA 3U17A 2IWRA 1HT0A 4QT0A 1IC6A 2W37A 3E5MA 3LUAA 3QU2A 3SSAA 2C4HA 3KTAA 1K4MA 3O7WA 4RY9A 1KDYA 4NQRA 3ZWQA 4IZ6A 3STVA 2B4QA 3TOZA 2JGEA 3A3GA 1LU9A 5FEUA 5IT0A 3DD1A 1J06A 4YJ3F 1Z68A 1XLTC 4LFBB 3KWJA 1OZGA 1WR8A 3L43A 1SCJA 4RTKA 3WLSA 5BP7A 4FJ0A 1WKCA 4QO8A 5CLHA 4OLFA 2KSQA 3M6AA 3FE2A 2Q4OA 3T7DA 3CIFA 2HWUA 1V1JA 1JGTA 1KZGB 1NW3A 1L4YA 1TE2A 1U1GA 4H35A 4FLEA 3LCCA 1NVAA 2Q5QA 2BLLA 5EJ5A 2IHZA 4GAEA 3K92A 3KVNA 4Q9IA 4BO4A 5KYWA 2GJRA 2WTXA 4B6SA 4X0CA 4KO2S 1BRMA 1YVPA 3ETLA 3P0IA 3T4PA 5IYZB 3NALA 4R5HA 3GJRA 2QV0A 3C8ZA 3EIUA 3EZFA 1BROA 4E22A 1CZNA 2F1KA 2IVZA 1R6AA 3PDUA 1OHHD 3BK7A 1W59A 3O8OB 2X8AA 4LVOA 1Q0PA 3BHNA 4M36A 2WIJA 5EKXA 2GNAA 1ZD3A 2SICE 3L46A 2EOAA 4BAGA 2DY0A 4OTZA 1Q0ZA 1HYHA 2H9YA 1RRVA 4GXNA 1DOAA 4PXSA 3TK1A 1J8FA 1TECE 4KUGA 4EG0A 1Q1QA 2W6MA 2MSCB 4X05A 4L6CA 5AOBA 1G9SA 1XZGA 4E46A 1ZGHA 4EY8A 3Q0TA 1NRIA 4IHJB 1OGJA 1YIOA 4GQIA 1E1QA 1B8OA 2P9GA 1E79D 2KB0A 3ILSA 3UVEA 3W9BA 2XY4A 4CN8A 3GA7A 5E4JA 3N2KB 4B0OA 1WBBA 2IPAB 4PYRA 2ZKLA 2C2GA 3HU5A 1BMTA 3HRIA 3E70C 3MERA 4N4AA 4OOSA 5CITA 4K6FA 4JB3A 3CFYA 3IDOA 4NZYA 5G4KB 4A8JC 2EKBA 3B3AA 3JYLA 1F8GA 5FJIA 4CM6A 2G3YA 5GZ3A 3X1ZA 4RZIA 4CT4B 2WF8A 4U02A 1I14A 5JAMA 5FPPA 3E61A 5LA6A 4DB4A 2I99A 3CMCO 1GFZA 5FNVB 2QB5A 1LPSA 1SQ6A 2X42A 2OV6A 1RMTA 4QHSA 4IR7A 4B7XA 1T8SA 3VA7A 4RYLA 2HHLA 1DRJA 5LMUB 1JI3A 1JBEA 3QNWA 1CUWA 3ZDRA 1IG0A 1M7HA 1WMSA 3K5WA 3UXHA 5AW7A 5JBIA 2KBFA 3PWSA 2WE8A 3R3YA 2QHXA 3JYHA 3IFSA 2P1DA 4G36A 2JH8A 4TX1A 2V8BA 1YL7A 3C3KA 2BCEA 1ZC3A 2J6CA 3GG2A 5JAOA 2IYEA 3HCBA 5DO9A 5M29A 2Q6IA 4IDEA 1YRYE 1JTEA 2QD1A 2NYRA 4IDGA 3IOMA 1IAVA 3DFUA 4CLHA 4RCZA 1UXKA 2VJAA 5A2QA 3MT8A 1J0BA 1R0RE 2L82A 4G0YA 4YN3A 5LA6F 3WQQA 4DDTA 5FL7A 2FVXA 4OMUA 3SBEA 3RFUA 4HY3A 4KPUB 4AAYA 4F11A 4RXTA 3KBBA 2CUTA 3NDPA 3M82A 1K8AD 4FEYA 4PW0A 2PYDA 4LISA 5A5VA 1X9IA 5AH0A 1HKUA 3PDWA 3P96A 3W2HA 2I2FA 2E37A 3DAYA 1MV8A 2JIMA 1VG1A 1YDFA 2BEVB 4TMFA 3AIMA 1P81A 5I51A 3DV0B 2HSJA 1Q1NA 4P84A 4MW0A 1XEXB 4OSEA 5HJ7A 2YWCA 2Z5VA 3DDOA 2I3ZA 1ISHA 1NRXA 1S8FA 1BWPA 1QU2A 2VAXA 2O06A 4QYSA 4A6EA 1NI3A 2HK8A 3HDTA 5CB0A 1RWOA 2YUTA 1RAGA 1A8SA 1C8VB 3N8DA 1MENA 3RJ5A 1EWVA 3PX3A 4NI5A 1V5FA 1BX0A 2JLSA 4YPFA 3JU3A 4R3NA 1L7EA 2COUA 2QN7A 3SJ7A 4GNRA 5LDHA 3ONVA 1QTIA 5EE1A 4TXLA 5CFOA 4BZXA 4BX8A 5JJIA 2QRNA 3ENKA 3RSGA 4CTOA 3RC2A 1UZMA 3UAWA 4QZVA 1GM5A 3AF2A 4YMWA 1PS9A 1GITA 4B6PA 5BYJA 4XIJA 3RVKA 3G0IA 2RGWA 4Q37A 3J80A 2ZPTX 4QGAA 2R4QA 2DQSA 2HZBA 3KVRA 4TMTA 1K4KA 4PBTA 2I1QA 4A0GA 4H6WA 2YVAA 3A28A 4BRSA 3WI7A 2N1BA 1FVHA 2ECKA 1P5HA 1X2EA 2O7RA 4N7MA 2FPWA 3THYB 1A9OA 2IIBA 3WLKX 3T4EA 1XDGA 2EARA 3RNLA 3X1MA 3VI4B 1TW3A 2A0UA 4FKBA 2FN3A 3KEOA 4FBGA 4L0MA 3DH0A 2HMSA 5C7IO 2PGIA 4M9UA 1KVSA 5CK4A 4DCGA 2JFPA 3I5XA 3T52A 4EZEA 4XVQA 5H7XA 1AN0A 1REQA 2ZJOA 3WYEA 1J8QA 1FCJA 3PITA 1X7XA 4KFTA 5TMEA 1N34B 1DI0A 1KMNA 1Z8FA 4B7UA 1DQNA 2GJ9A 4R0MA 4CE6A 3F6SA 4IRXA 3ZY5A 3LPCA 3AUUA 2NVUB 1ZL2A 1DCMA 4U3JA 2QI9C 3T38A 2R4UA 1NJFA 3ZLTA 1QH1B 2WJZB 1NRKA 3BRWD 4ZRNA 3V8PA 3N8HA 3CF4A 2RKWA 3Q4GA 3RTBA 3NAGA 4CKYA 3IDFA 3FXAA 3PQ6A 5A4JA 1YONA 4DRYA 2XQJA 4PAMA 1E6KA 1JPJA 4EB8A 2PANA 1Z6AA 4EPRA 5I3CA 1YAHA 1XCMA 3GAMA 1QQTA 2W2KB 1FDUA 3LVFO 3ENZA 2O1WA 1JX6A 5L3ZA 3F8TA 4PEVA 1SB8A 2VR1A 3LZDA 2IHYA 3U1VA 4DDVA 1IRIA 2IL1A 3QKUA 4LRYA 1PR9A 3CC7B 3IQIX 3FB4A 3QXJA 4GGPA 3ZIUA 3N8IA 4BLTA 1U2EA 3EVDA 2GPJA 3ROXA 2DUJA 1XR3A 5LZ5A 3ABOB 2YHIB 5AI4A 2WZNA 1CJVC 2B25A 2W90A 5E6SA 4ZAGA 1NSTA 5G4LA 1EJ2A 3VZDA 1GDHA 2PKQO 3NLLA 4ASUD 1XXHB 3AWIA 4P53A 3TX2A 1DU4A 2RIPA 3IH5A 3EC2A 1OYWA 2ZE6A 2Y4NA 2BGRA 2GHQA 3TNDA 1E9VA 1KYQA 4HXYA 2WD9A 3TZLA 3FZNA 1M1KD 3NO4A 1LQUA 4PZLA 5FEMA 2B5WA 3NGLA 4RJ2A 4EJSB 3O91A 2BOVA 2VDLB 5J2TB 2Z57A 1LLDA 1RRGA 3TLZA 1EA7A 1R0KA 5K0GA 3C7AA 2VBVA 1F4LA 4K03A 1D1NA 3DNPA 3QQ5A 4X92A 4BLVA 1Y8QB 2R1VB 3ZZNA 4FYKA 1DQZA 3ZV3A 3K1AA 4KGZA 1XWWA 4P54A 7REQA 4A27A 4ZVSA 4ENQA 4TMVA 3NM4A 4AY4A 3H5TA 3BB1A 3L0SA 1V7CA 2V9PA 4GLLA 3MTEA 5EXPA 3PYLA 3KZOA 1MF7A 4LE1A 1CSEE 1O54A 5AMXA 4BCDA 4OH1A 1OD6A 3IMCA 4CKBA 4JVSB 1EFUA 2ZZGA 3EMKA 4GKKB 2AJ8A 1W76A 5F4OA 4IOMA 3UZUA 4XGQA 1FXWA 1UFQA 2GCPA 4FDMA 4NYMR 5GJWC 5C8YB 5AJVB 1K08A 3PUMA 5G2OA 3HKCA 3WWDA 1P7YA 1HDYA 3M83A 3PTLA 3RVDA 5KOIA 2CYCA 1BDHA 2IUUA 1JEOA 2JLRA 2V98A 3KVOA 4RIEA 1Y1KE 5C81A 5B7GA 3E18A 2O0HA 3F1KA 1OYOA 4NU6A 2A94A 4UHHA 4AXBA 1TVEA 5CUQA 2VTDA 3FMVA 4L0DA 1JILA 2O2JA 2G5TA 5BR4A 4BAUA 3OHPA 2HMWA 3P0EA 3AHJA 2G77B 1QZZA 1XFDA 5A3JA 2VAVA 4V3CA 4K05A 4OATA 1KD1D 3AZOA 3E7DA 2OPHA 1PHPA 1FFWA 1WETA 2I9KA 1FXWF 3T7IA 3FKQA 1T36A 2J3IA 4DA0A 2B20A 1CT9A 1KI4A 2WHRA 5I5EA 4KN6A 3A0RB 3G9UA 3MWEB 3MUOA 4G0XA 4F3TA 2ZE5A 1EM6A 3M2TA 4OHOA 4J1NA 1SK9A 1YQTA 3JY6A 2UV8A 2FEWB 4IYRA 3QPDA 3MM4A 2HJWA 2FCRA 3GQBB 4MDFA 2G1JA 4ZZ3A 3PD1A 2CNDA 2OR3A 1OR8A 2IX9A 1TAUA 2X0EA 2QVYX 1N5LA 2CLIB 4TS1A 4PGAA 3RK0A 3P7MA 3AVVA 1HOXA 4DV2B 1CRPA 3NETA 3PNVA 1NXTA 1LS6A 3EULA 3L1UA 4E4YA 1Q2UA 3MTAA 5BO5A 4ZHQF 3CJQA 4ABYA 1GPH1 5EHXA 5IU6A 4HSEA 2HPAA 2QRVB 2ASVA 1N7JA 3BKXA 1AMNA 3SZGA 1NWHA 1Z0SA 1J5EB 1USKA 1IULA 1SBCA 5BN3A 2R00C 2OCAA 3LUBA 3SLRA 1Z2OX 1EQUA 2R6HA 4MEBA 3AFNA 5K2OA 3DNFA 3AU8A 3D5TA 3KU4A 3PGA1 4PV7A 3MLEA 4JEIA 5ALFA 3TNFA 3P2EA 4ZVLA 3PTZA 4D02A 4MQBA 2HIAA 3ERCA 2J5RA 3FGNA 4NDNE 1SCUB 3LYLA 4B3BA 4KXMA 3B1XA 1WQ1R 3T1HB 2SKEA 1IY0A 1UOPA 3P97A 2E5FA 1FC0A 3Q0EA 3ZH9B 4RPDA 2PRYA 5SICE 4RETA 1I4OA 1J2RA 2WHPA 4P3XA 4I7EA 3GH1A 2FWAA 4YC7A 5HE9A 2H29A 4C6TB 5BR7A 2NN3C 2CNBA 4ND3A 5CLLA 1O4VA 5AM2A 3FRJA 3BT7A 4LXGA 2IEIA 2A14A 4IHKA 4WIAA 1ADFA 3CW8X 4FZ3A 3MEQA 2ZCVA 3UN1A 5KPJA 3H0EA 4FK8A 1I10A 4RY0A 2CXPA 1M1XB 5CVCA 2QN6A 3OF2A 4KDCA 2G40A 4LG1A 1MN6A 5HSGA 4RNCA 3SEZA 1EVKA 4OPVA 2GI4A 4YAOA 5CBKA 1NMZA 4W8GA 1E5LA 4FS3A 2EDAA 4BJ3A 2J9GA 5K8JB 5ENZA 5KIAA 1W5SA 2J5KA 1EFPA 2J3LA 3E48A 4LZLA 1Q2XA 4UMEA 5JATA 1WB6A 5AJWA 3D3EA 1SU6A 4D9KA 1H8EA 4LSGA 3S2YA 1Q92A 3EDMA 1K6MA 1CS0A 1VDZA 2R6CA 1PX2A 4KH1A 4NECA 2WYVA 2PLWA 3EUFA 3LNNA 5JCJD 1EUDA 1TKCA 2JFBA 2VCEA 2KS6A 3AR2A 4RHYA 3EXFB 3CEAA 2H07A 3EDOA 1FVFA 3CCUB 1BVUA 2IOYA 3D02A 3WGIA 1O6FA 3WGTA 4KMRA 3GGPA 3NMUF 1SULA 3ITKA 4LKOA 1G38A 1N8TA 3AYZB 5KWIA 2PXHA 4FT2A 2GSDA 3VSBA 4BHTA 1JFRA 2BHSA 3JSXA 3ESAA 1D6SA 3PP8A 4XN0A 1GHTA 2A0KA 3RRJA 1ZOLA 2UUPA 4HUQA 4RK0A 4R1NA 1K1EA 5FP0A 3O8LA 1V16A 3VYTB 5BQFA 3IEMA 1JQ5A 1I4DD 1ZK0A 4QDTA 3EFBA 3FI0A 4N39A 3FYDA 1VOTA 1YRAA 4ODIA 1KYWA 4GSKA 4IGAA 5DGDA 5CEJA 1L4LA 5TNXA 4DTIA 3JALB 3W3ZB 4ZI7A 4CLOB 4B34A 4P2GA 5IUKC 3ZDDA 1Z6ZA 4B4KA 2NQ8A 3PZBA 4RMIA 3HO8A 1BZYA 3EWAA 1UDBA 3GVCA 3USZA 1KOLA 1QRUA 1D2GA 1FRZA 4FDLA 1SVMA 1UIMA 2X7JA 4Z1OA 4M0LA 2IIPA 1GKIA 1DIAA 5K0SA 1G21A 4XWWA 3RYHB 2ZRIA 1G5TA 1G19A 1ZCZA 1MC4A 2AQIA 4XX0B 1XYGA 3SSOA 1WUYA 2BTQB 2JVKA 4HADA 5ABPA 5GIOE 1E58A 1ZK4A 1DXYA 2XDAA 1R8SA 1JKIA 2BR5A 3M1LA 1C7RA 4I5EA 3D43A 5IYPA 3PQEA 4C08A 1FFCA 2GN9A 2VJPA 1XTSA 1Y63A 3PJFA 4ZI7F 2P2DA 2XZPA 5JO0A 4JI7B 1H0KA 4JEUA 5JALA 1P91A 3DFIA 5SZJA 3MTQA 2WLSA 4TYMA 1Y9EA 4LNUB 3GAZA 4UW9A 1QYDA 3IE0A 2VXCA 1E79A 1U3VA 4IDNA 2DCMA 3DVLA 4IH4A 3CNQS 4FSHA 4M8NE 3WSTA 1V3TA 3I9LA 2Q5IA 1VBFA 3ZV4A 2HJVA 2A3RA 4U2EA 2QGZA 4L2IB 5CFZA 2Z4TA 4CV0A 5BMVA 2WAOA 1M0EA 4ZXFA 3DD5A 3JRNA 4IY1A 4JK3A 1S8OA 4ZP1A 1EFVB 3K70C 3ZD7A 1XTQA 3NEYA 1Z62A 5HIJA 1A3CA 2MYUA 4IVNA 4MPDA 4GZ3A 3A36A 1K7YA 4RADA 1NN5A 1SG9A 1K5HA 5GWXA 2H5JA 2IYTA 4XB2A 4ZT4A 4L75A 1H93A 1GTG1 1CULC 1E20A 2I33A 2ZJ5A 3N76A 3SIXA 3Q7QA 1BKYA 1MO2A 2JFXA 5E0OA 4U8HA 5CR9A 3S2ZA 1N2GA 4DLNA 4YMHA 3CPEA 3JQAD 4NOKA 4QDKA 4O2AB 3EIWA 4C4OA 5EJ4A 1U9IA 1WP9A 5JANA 1YZNA 2YRFA 3BDVA 3KUDA 4MCHA 5K8IA 1M6VA 3HJHA 3O6VA 1G8JA 3TM5A 3ZK9A 4JJ4A 5BMVF 3MTBA 1E7WA 2HADA 4AJ2A 1H4VB 3FTNA 4V0RA 5EZQA 3W9UA 1X87A 3TR0A 4BFYA 4BZPA 1U7DA 1U31A 1AHIA 3I73A 4KKUA 1F8YA 1NVWQ 4M9ZA 4UTVA 2GWRA 4OK6A 3WB2A 2QM7A 3ZKWA 4QASA 1FBTA 3CTAA 1WZEA 4ZOLA 4TGLA 3RIYA 5L4NA 2I7VA 3GL9A 1WZUA 5CVDA 3A1TA 4FE4A 4M0MA 1E7QA 4PWZA 4JV5B 5EOVA 4WZLA 5LYJA 4NY1A 1RJEA 2IV2X 5H02A 4UVDA 4NJEB 2WEKA 3VC2A 4F93B 1IATA 1XVVA 1VBNA 4C07A 5TEVA 3DE7X 3KOZA 2VPPA 1YI2B 1I7LA 4JU8A 1PFGA 1ISGA 1EFAA 1TO2E 3F7NA 4TYQA 1J39A 4HTFA 5J63A 2FDCA 1X7YA 4F84A 2B3DA 3WQSB 2QRHA 1O97D 5IF3A 3NTVA 3T8YA 3TQCA 3GVIA 1SVOA 1G21E 3IVXA 4LSWA 3RBZA 2WDZA 4UUNA 3K2IA 4D56A 4JUBA 3PB3A 2ECFA 2MMCA 3PQ2A 2ZVPX 1LW6E 3G2KA 1V4BA 3LFHA 5LYJF 3H9JA 1I2AA 3P2KA 3ZTYA 2O14A 2XDWA 2ATCA 2CFTA 3WMGA 1PR0A 2B3TA 1VPLA 3GEPA 4HDOB 3M4JA 4FCTA 5JJCA 4MJXA 3M3PA 3ZOKA 4CXMA 2C7QA 4G65A 4KZPA 3INNA 3MINA 2D13A 3IEXA 1GGJA 4KIUA 5J4VA 1Q7BA 1SO8A 2O2EA 1G291 4AO8A 1EUYA 1OCEA 4FDVA 1ODCA 5AXDA 1BC5A 2YWBA 4Q9AA 5IVKA 2H0RA 4M37A 3G79A 4X0EA 2FN4A 2ONCA 2GREA 4WKGA 3REGA 1BLIA 2JFUA 2Q0HA 4INJA 1UD2A 5IYQA 1RP1A 3H4IA 4MQEB 4X41A 4DUPA 3MJHA 4MIEA 1YR1A 1W5EA 4AZ3B 4MTLA 5BWLA 2YWDA 3UCFA 1VI6A 3RK1A 1CJKC 1V7PC 4MV7A 5FTNA 3BE5A 4KE7A 3ABRB 2FUEA 1D2HA 2A0XA 4J0JA 4QRIA 4CM5A 4ZDJA 1Z73A 3KT8A 3LUKA 4ISCA 2J7PD 1C9NA 1FF9A 4PANA 4TZ6A 4M0KA 4OQ4A 4BLWA 2C3YA 3WZMA 2E4VA 3EGDB 3W5AA 2Q3EA 4ND5A 3FNQA 4QXPA 4HDAA 1Y6FA 1WY7A 1XFOA 4JC5A 4ZZ2A 4OP2A 5K3SA 4BB5A 3QZUA 1MXFA 1UWVA 3M4ZA 4R16A 4CKWA 4F9GA 1HMPA 1WOMA 2JJMA 3TGWA 4E1AA 1LH0A 2HJSA 2H4WA 1QYXA 3SX2A 3U7QB 2W0MA 1UBJS 1EFKA 4KPFC 1YRWA 4PN3A 2JCGA 4LI0A 5DW0A 2B1QA 4WI1A 4X9XA 2PUAA 1BMDA 1AE1A 2PRJA 2ZTHA 3A7EA 3DBOB 4BECA 1BEUB 1OBCA 1QYCA 1NY5A 4URWR 3RFCA 2YN2A 4QPJC 3KEQA 4H60A 1PBTA 2RKBA 3R7BA 4KVGA 4ZPJA 2ZYDA 4GSYA 4EWLA 1ZVVA 1II0A 2YOHA 5EIAA 2OA0A 4IILA 3R4CA 1VQ9B 4PAAA 1QKIA 2QUZA 2VDPB 3CF4G 1GDDA 1GNPA 3DONA 1ISRA 3LUDA 3QE0A 4KMOA 3ZW9A 1QTQA 1RJGA 3BCHA 4XOIA 2O8EB 1DXHA 4MUAA 2J6BA 1L6IA 3L0OA 3TI7A 1K6XA 1DNPA 3SJCA 4K81B 2C5FA 4HUJA 1B2LA 1Y1SA 3NX4A 4E12A 1KTIA 3BEOA 1XRPA 5EMNA 4Q3BA 3TTSA 5GADl 4ZVNA 5L6MB 5CAEB 1MPTA 1PW5A 1C29B 4GVLA 5C5EA 1GTSA 1JE0A 3PXBA 1AA9A 3UHAA 1OZAA 3RB8A 3K35A 3VPHA 1COWD 3WRYA 1XZFA 4M83A 2GKSA 3AEQA 4EW2A 2TMKA 3O8CA 9ATCA 2RARA 4O5AA 1OV6A 1DT3A 4OI4A 1L5LA 3VKFA 1WG8A 2AMFA 3ZWVA 1FYDA 2ZUTA 1FRVA 4IIJB 3IUBA 1RXSA 2C97A 4RSRA 2C5BA 3DEIA 5LB2A 3OF3A 1T4BA 4R2KA 2WTEA 4DDHA 2XF2A 4XUGB 2VK1A 1Z2PX 4BV2A 3AI1A 4ECAA 5I9IA 1GNTA 1DC8A 1Y4DE 3GCXA 3NHSA 3TTUA 1ECBA 5LC1A 2WYWA 1VJ5A 1VLYA 2OTCA 1FFYA 2V59A 3PFBA 4YT8A 3Q7EA 1DTSA 3ZHBA 4YCAA 3CRRA 3NFYA 3H94A 3HXQA 4DQUA 2QN8A 3A4TA 5EPOA 2X9QA 4H59A 3WLHA 1PK7A 1B8NA 2HK6A 3DTYA 4Q3KA 3ZDZB 5TGTA 4YUWA 4LYJA 2JS7A 3YASA 1NVMB 4MKZA 2CT8A 4ONEA 4TZ0A 1SU7A 3LL4A 3G0HA 4HI0E 3HC7A 3H3XA 4NL4H 2GCOA 1H3NA 1G16A 4IV0A 4KFSA 2GNOA 3NWOA 4O63O 4AY5A 3FZYA 1PWHA 1WS6A 4MUIA 5MGBA 4O4IB 4UQOA 2NTJA 4OLHA 1JYSA 1T4GA 3Q8XB 4UBIA 4J6FA 2ZAMA 3G7NA 1Y6ZA 3SLKA 4ZVPA 4EJFA 4KNYA 4PFQA 4LF9B 1HQYE 3QUTA 4QD3A 3G2OA 3R7WA 3OTWA 3BWYA 1JSLA 1KHTA 3TIIA 5TQ0B 3O1IC 1UDAA 2JLWA 2IEAA 4E70A 1CUCA 4H1HA 5CU7A 4N82A 1FNNA 3FWKA 2GEKA 4CF3A 5K4GA 4OQYA 3U61B 2YUIA 1FZTA 3MG9A 3R5JA 3GLKA 3G5TA 3LRTA 4WCDA 4QDZA 1Y80A 3OPYA 3AKEA 1XCGB