4RD1A

Structure of aif2-gamma h97a variant from sulfolobus solfataricus bound to gtp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGAEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 114
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd1A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd1A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd1A01
2ZAOA 2ZS8A 1ETUA 2EU8A 2FSHA 3HDTA 3IO3A 4Q4HB 5KNBA 1D6JA 2ZI4A 5KPJA 4DEYA 1DAKA 4RD3A 4IFEA 4TLBA 2EYUA 2FV8A 2ZXUA 4PZYA 1IY1A 4A2QA 4D80A 821PA 3LBHA 1RYFA 1DVRA 1ZIPA 4Q1EA 3WNCA 3V4RA 3W6OA 3GQBA 1DTSA 1KO5A 3C5HA 1OKKD 2ZR9A 1JQLB 3TBKA 2ORWA 2AKAB 1UPTA 3Q7QA 3EZ7A 3KKNA 1A2BA 2PZGA 4AKHA 1UBEA 4ZDKA 1A1VA 4II7A 3TW4A 1KZ7B 2O5VA 3RDPA 1CTQA 1U9IC 5JWRA 2W2TA 3K53A 2AWNA 2ZE7A 2NTYC 2NG1A 4P32A 5C4GB 1OYYA 4LK2A 3GLIA 5FTJA 1G1MA 4HDOB 4KFRA 4LJ7A 4LJ5A 4PO1A 1AKYA 1W36D 5AK0A 1LVGA 3PUXA 4ZCIA 5FA6A 3ICQB 3RRMA 2GJ8A 3IIJA 2DY1A 5FBRB 1NNEA 4A0RA 2Z4RA 5DI3A 3I32A 1OH7A 4RJLA 4HEJA 2LKCA 4G01B 5JHHB 4C0HA 5C18A 4F4CA 2C5LA 3X1YA 4G5SA 5L3QA 1CF4A 3PUWA 5D3QA 2F1RA 3KXIA 1VCNA 4QBGB 1IONA 3A1VA 1XDBA 2CJWB 3IKJA 3RHFA 2OTJB 3UANA 4NL4H 1P73A 2ZRMA 4ZKDA 3W2HA 3DKVA 2IS4A 3LXXA 1AZSC 4UXJA 1Z83A 3VR5A 5J4HA 1RRCA 4V0ME 5FUWA 2BBTA 5SZKB 3JVVA 3K70B 4H1UA 1XBTA 4M1KA 4B4DA 1Y3AA 3H0KA 2CNDA 4ON9A 2BCJQ 2JASA 3NBFA 2W0SA 3B78A 4V0NA 3MWLA 2PEZA 5KU1A 2BKUA 2ZYTX 3IEVA 4UNSA 2P0EA 5G3ZA 3QXCA 4Q48A 3QNUA 4G0NA 4OI0A 3GLGB 3M1IA 1N6RA 3QPWA 2CHVA 3SYLA 4D25A 3UIEA 2RC6A 1LY1A 5E7JA 2QTLA 1TF2A 4LC0A 3CRQA 2BMWA 3CWZA 4WAUA 4H9GA 4JIMA 3UXMA 2W6JD 3PQCA 3MAAC 1H85A 2VLIA 1KNQA 3LW7A 1KJWA 3SR0A 1GNQA 2ZM5A 2NO6A 1TADA 1XU4A 3DKPA 3HR8A 3RNLA 3G5UA 3SC3A 1E9SA 1CKEA 3AP1A 3NEJA 1JR3E 1G41A 2ODEA 2QPTA 2WKPA 2RGEA 1JAIA 4K1XA 1G291 1X3SA 2Q3MA 3TLXA 2BM0A 4JLJA 2D2FA 1T4GA 5L3SA 5KHOC 4LCBA 4F4IA 3KUCA 1II8A 2ASEA 4QHTA 2FU5C 4X8MA 4PPNA 4GDFA 4C0QC 4ZV4A 1ZRHA 4TMKA 3QF7A 4TMVA 2WV9A 3V00A 4QOSA 221PA 2WSSD 3CCJB 1N6PA 2F9LA 3SHWA 3THOA 4MDFA 5HTKA 1KI6A 3WHKA 2CL7X 3KDSE 3PCRB 3KQHA 4ZCLA 3U3MA 3PV0A 2QTVB 2IUTA 2O0KA 1NI3A 1A2KC 3OEED 1S9HA 2RHMA 3VR2A 4HAXA 5JSZB 1E2GA 3EAQA 2H57A 1OIXA 4FMDF 1K6MA 5FTKA 1M7BA 1EP3B 3NBYC 5SZIA 2OBNA 1JXOA 2FN4A 2N1BA 1T91A 1MABB 121PA 1ZUIA 3IIMA 3K0AB 2VNHA 4O2LA 3WRXC 3SEAA 3VNVA 4LYHA 4EFMA 3NVAA 4OQLA 3BFVA 3RS5A 2W0MA 4NU0A 2Z4SA 3K0EA 3KJIA 5AWFC 4KBGA 1VQ5B 1GITA 2J7PA 3M4YA 4TT3A 4YMTA 2J41A 1HTWA 4D4MA 1W87A 4US2R 3THYA 2QEQA 2QE7D 4DT1A 1BMFA 3GLIE 1QX4A 1MOZA 1U94A 2CE7A 4OJKA 5L3RA 2ANCA 4C0LA 1AZTA 4ZDIA 3CX6A 1TVCA 1KKLA 1OXUA 3THWA 1N6OA 3P20A 4RZUA 5DIFA 4TQAA 1F2TA 5AJWA 3DVLA 3GFPA 1P3JA 4RKEA 4OI1A 5TVKA 4E07A 1J99A 1ANKA 2J0SA 2CLDX 2OCBA 3PENA 3OJXA 3ASYA 3W5JA 1EP1B 1LTQA 1J8MF 3THXA 1DARA 1NN1A 1KDOA 4AG5A 5FOWA 2GJKA 2GXSA 1W36C 3CMAB 2ZRIA 3T5DA 2JLSA 4PAQA 3KKQA 2GJ9A 2ZE6A 4D4JA 2H18A 4RFSB 1NMXA 1NLFA 3I56B 3QXSA 2XTZA 3EW9A 1FRQA 1DELA 1UKEA 4KVAA 4HLDA 4MYHA 4XOIA 4TYQA 5DYGA 4ZDWA 1DAGA 3KB2A 1US8A 3QVVA 1D5CA 4WBSA 1G7TA 1G7SA 3X1DA 2IC5A 4BEBA 4B6EA 3JQRA 2AR7A 4JBWA 3OEHD 2H1LA 4B3GA 2NQ2C 2IWRA 2SHKA 1SXJD 2GEVA 1YRAA 3VO1A 1ZM3A 2HLDA 4F38A 2IF2A 1QVRA 4US1R 3QG1A 2HT6A 621PA 2DPXA 4Q4JB 1EFCA 1ZMXA 1QHNA 2OFXA 3A4LA 2QN6A 4AF6A 2KBFA 2GCNA 1DOAA 2O8FA 1N5JA 3B1ZA 5EE0A 1ZJ6A 3BB4A 4JLDA 2GEDA 1Z6TA 3T35A 2XB4A 3MWJA 4ASUA 1KRHA 3VX4A 1AS0A 4POAA 3I61A 1KMHB 1IN5A 2D06A 8OHMA 4G1BA 5CIQA 2JLQA 3BD9A 5KO2A 1GUAA 1NBMD 3AH8A 4XIGS 5B30A 1CJVC 4LBVA 2P2LA 1TQ2A 4KYIB 4O25A 1UJ2A 4PHTA 3PFIA 4V02A 2G88A 1G17A 4GT1A 4IFBA 5D3MB 3W34A 5HXBA 3A1SA 4EDHA 1BOFA 3QIAA 1KHTA 3SNHA 1NG9A 1R5NA 3AF3A 3OJWA 1BH2A 1EFRA 2YZ2A 4BFZA 1DG3A 1GAWA 2FFAA 4MRSA 2R6AA 4JSYA 3QSYA 2DB3A 4PQFA 1E98A 5CM8B 1I4LD 3RRYA 5C1BA 2NO9A 4M53A 1NIJA 2QROA 3GJ4A 1R8SA 3VR1A 2PIAA 1RRFA 1A4RA 2DEUA 2Z0MA 1DAFA 1CQXA 1Q1EA 2ZJBA 3GJ3A 2PCLA 1Z0JA 4ILEA 1G5TA 1AKEA 5FR2A 4LDJA 2IT1A 4GMDA 4C9BA 2ZRKA 1AN0A 3QKSB 3P32A 2VNIA 1J8YF 3AUXA 5JS8A 1PLLA 5FTMA 2OFOA 3ZBUA 2WWGA 3FOZA 4KAXA 4LZZA 3RAPR 2JCSA 3KL4A 4NYIQ 4P0TA 1GNPA 2CVHA 3Q9LA 2GF0A 3LV8A 3OE7A 5CB6A 1QDEA 4RCZA 1XD9A 2GCOB 1OXTA 4FINA 2QMOA 3QENA 3RRZA 4HE5A 1VYUA 2QM8A 4TLDA 5KNDA 2HCBA 1XMSA 3E20A 2CNWD 2HDNB 2RMKA 3W5VA 4LJ9A 5FUXA 3NBZC 1GR1A 1OIVA 2ZYVX 4PQRA 3P4YA 3GP8A 2XNDD 3A37A 2VSOA 3ZLJA 2B8WA 1RW4A 3WXMA 5JEDA 2F3TA 4M1SA 1E2DA 3B1YA 3NEYA 4TWZA 5E4FA 1Q3TA 2X1VA 2ZTSA 4Q4AA 4BLPA 1E2KA 1IN4A 2R2AA 2NO0A 1CR0A 2J3EA 3FJOA 1TPZA 1XTKA 4US0R 2E1RA 1KY3A 4F93B 1S2MA 2IX3A 4NHOA 3CC7B 3GJ0A 1YE8A 3O47A 5J40A 1OE0A 3ZS9A 1FUUA 5JSZA 1YR8A 1D2EA 4OJQA 3RSLA 4ESVA 5A5GA 2A5YB 4WZBE 4DB2A 2YKGA 4UJ5A 4A0FA 1Z2AA 2IYUA 2B92A 5K8IA 3NWJA 3BOSA 1YJNB 2YVUA 3LA6A 1C1YA 1G18A 2AK3A 2O0HA 5FPHA 1G4UR 4YAUA 4EQ6B 2AL7A 2MSCB 2ODWA 1ZBDA 2QM7A 3B1WA 3HP1A 4MKGA 1S3GA 1P9RA 2CCKA 5AJVB 1YZNA 4QHYA 4BLTA 1Z29A 3SU8A 1W2GA 4A36A 5HR5A 3TNFA 3GMTA 4U9UA 3SE0A 1VQPB 1YR6A 2P65A 2VQSA 2H7VA 4ARZA 5KDDA 4C7OB 1ESNA 4JT2A 3ZVMA 1NVVQ 1GKIA 1KI8A 3M0EA 4LHZA 3WYAA 1Z08A 1UM8A 1LF5A 2JJ2A 2LCFA 4NE2A 3WMGA 1XEXA 3IPYA 5BN5A 4GRAA 2JA1A 4BFVA 4XVRA 3NKVA 4PO8A 4D2IA 1N25A 5BN3A 3CX8A 4LBZA 2WKRA 4PX9A 4TL8A 3WMFA 1SXJC 1XPOA 4TTRA 5H1YA 2QP3A 2ZJ5A 1G9XA 1Q22A 4RY2A 1QHHB 4UNNA 1P9NA 3PITA 5DN6D 3N2EA 1Q1ZA 4JLVA 3SYNA 4FI3C 1XD2B 1FQJA 4PSVA 3EG5A 3B6EA 4EJSB 4FWIB 1R6BX 2Y8EA 1QHSA 1JR6A 2ZRHA 4UXIA 3SJBA 2DWOA 2HMAA 3TK1A 4NCNA 2C9OA 3ZIAA 6Q21A 2AXNA 3OESA 2ZSBA 4RVCA 3RVBA 4AC9A 3S1AA 1Z07A 3HJNA 1NJID 1U0HC 2OZEA 5FPTA 2QAJA 1GJRA 3T15A 5DHFA 2R6HA 1ZD8A 3B2EA 4HDQB 1M8PA 4Q4JA 4DWJA 4EAQA 2ZEJA 1YJ5A 1Q44A 3AV0B 1E96A 3BFKA 4MH0R 4XWAA 4RD0A 3NH9A 3A58B 4GOJA 1PUJA 4TL7A 1EWQA 1E0SA 4NPHA 4MDEA 1G8FA 4LYFA 5THXA 2D7DA 3HU1A 4N3NA 3UWOA 1GL6A 1K8RA 4A8JC 1FUKA 2CLSA 2FSGA 1F48A 2CL0X 3LWNA 3CWQA 4NKRA 5G3YA 2CLCX 5HCIA 1TUIA 4LV5B 2ZI7A 4RD4A 3C5CA 1QGZA 3GLIB 5FBVB 4QNMA 4DUGA 2Z43A 2QT1A 3IIKA 2IHYA 2X2FA 4ITRC 2GPJA 4URZR 2GNOA 1J2JA 1G21E 2QZ4A 2C9CA 2VIIA 4KV9A 4B32A 2A5DA 4DSUA 2V7QD 5FBQB 5JS7A 2FDCA 1W0KD 1ZINA 1Z0AA 1SVIA 3B13B 3QFCA 1VQLB 2BBOA 1KSFX 3ND8A 1W0JA 2GEUA 3CF6R 1S72B 1GL7A 2I3BA 2PX3A 1PUIA 4C2UA 3GEHA 5DI3B 4PGOA 4GFDA 2W6ID 3SZRA 1OPXA 2Z83A 5L3QB 4OHXA 4D81A 1TQ4A 2ZRDA 2YC4C 4JL6A 4QG7A 3QBVA 4XWKA 1EGAA 2BVNA 1EXMA 4O0MA 2OM2A 1BQEA 4BZPA 4GNKA 3KQLA 3ZS8A 2C77A 4NCKA 4AYXA 2R8RA 1VQ4B 1R7RA 4XVQA 2MMGA 2G3YA 3KFVA 4RZXA 1YVDA 3EA5A 5AUNB 5CYOA 5F3WB 1CEEA 2WJJA 2AXPA 3PXGA 1ZNYA 2VP9A 1YHNA 2BC9A 3SQWA 4L15A 1FNCA 1D2MA 2WJGA 3B8HA 1XNJA 4GSYA 2YJTD 3A36A 4LHYA 1B23P 3BBPA 4IRUB 1E4VA 1GWNA 1E79A 4P31A 2XSZA 1KK1A 1KAOA 4Z8YA 3WYFA 4PAOA 4FN5A 3QFTA 3PEYA 3W2IA 2XZPA 2REBA 2P5SA 4L8GA 1XMVA 5FOSA 1FPMA 2FZ4A 2O8CA 1JA1A 1DE0A 2JLZA 2X19A 3AVUA 3R9IA 2DWQA 5FOVA 4M9QA 1E94E 3QFSA 2QENA 4HAWA 4KLZA 4Q1DA 1ZYUA 5EUQB 4YXWD 5H5JA 1IJFA 3I55B 2GZAA 3OIYA 4S35A 1ELOA 2R6GA 4BEJA 3LQQA 4BLRA 3BE4A 1OYWA 1XJ0A 2BOVA 5GVSA 1XE1A 3K0SA 3U60B 1WA5A 4HDCA 4DKXA 3EC2A 3TR5A 1I4DD 3AVPA 1XTQA 2NZ8A 2A7QA 2F55A 2PX0A 5L3SB 3B5JA 2F3RA 3DOFA 4GPTA 1GG2A 3E5HA 3ADKA 4BRUA 1FL9A 1II8B 1ONBA 1WCV1 1TNDA 1E2QA 1KOFA 3FGNA 3V4FA 1NKTA 2EFHB 4PHFA 1TMKA 5B2ZA 2QRZA 5JJIA 1ZNWA 2VA8A 2AD5A 2ZIAA 3MUFA 4KBFA 4XJXA 2ZS7A 1TQDA 2QI9C 3LY5A 4JL8A 1AIPA 2KB0A 2FMXA 5B64A 5CB8A 1PVOA 2DCUA 4E22A 3OFNA 1VYTA 3B60A 5FPYA 1NN0A 2H16A 1YU9A 1KI6B 2FJUA 1TL7C 3ZZTA 2JLWA 5BW8A 1H8EA 2RGGA 4KFTA 3VU9B 4WOPA 3D6TB 3CBQA 1TQ6A 4U5XA 4Y0VA 1Q1BA 1U9IA 1XJQA 3ZD7A 4R98A 2AN9A 4A6PA 5HZKA 1JPNA 5GV8A 2ZUBA 3KKPA 2G0TA 4IOJA 1E2MA 3AUYA 2JDIA 2BBWA 2Q3HA 1KK2A 3BWDD 1FTSA 3TW8B 5CM9C 1I2DA 2WIBA 1XXHA 1IXSB 1CNFA 3I8XA 2VSFA 3ZBTA 1UKZA 4QGAA 4R7ZA 5FL3A 5EXSA 1QFJA 3NXSA 2FGKA 4DSOA 3R9XA 1KGDA 3L82B 1KC8D 2JJ1A 1YZGA 2BGJA 2ZROA 4A9AA 5B58C 4LHVA 2BJWA 1F20A 2C8VA 4EUNA 1WF3A 4EPWA 4BZXA 1TUEA 1E62A 2FA9A 2EFDB 1XMJA 4Q9LA 4F7WA 4H1VA 4YAWA 1IAQA 3ADDA 1QG0A 3THYB 1OT3A 5DH9A 2KWIA 4B6FA 4B2IA 2D74A 4DC9A 3RC8A 1YZUA 5HE9A 3GLFA 1XD2A 4IDHA 2CE2X 3RC3A 3U7GA 4AY2A 3NH6A 4RFVA 3W8NA 4OYHA 5GVRA 3SI7A 3KTAA 3LXRA 3TMKA 4HSEA 1F2TB 4B3FX 2XX3A 1AQYA 4HLUC 3G4SB 4D0NA 3ZJYA 1EESA 3DM9B 1XEFA 4HB0A 3THXB 4C0SA 2RC5A 1QG2A 2ECKA 2V6JA 3DZDA 2VL7A 4W5JA 2H92A 2FX3A 4TMXA 3CCUB 4LJ8A 1C9KA 1Z28A 1AQUA 1T8TA 2C95A 2ZRAA 4DLYA 3C4JA 1RPZA 3ZVLA 3A1UA 2IUUA 1HQCA 1VIAA 2V1UA 1A7JA 1US8B 3FKSA 3GJXC 2GXQA 5KDOA 3LRPA 4L16A 3VHLB 1G3MA 2ODBA 3MRSA 3QBTA 2VO1A 1EX7A 2J7KA 2PLRA 1CXZA 1SKQA 4Q1BA 5CIWA 5CLQA 3AVTA 3LH5A 2XOKA 2DWPA 3QY0A 3GJ5A 4LBYA 1UBFA 1DDGA 1GRQA 2A2ZA 2J9RA 3E70C 1FNBA 1NJGA 3CR8A 4RKFA 4V03A 1L4UA 4B2LA 2VPPA 1AJEA 3IO5A 3TVTA 4KU4A 4ZIRB 3ADCA 2PBRA 3EARA 2FWRA 5EE5B 2O8FB 3CRMA 3ICEA 1N3BA 3KQNA 3AGPA 2EWWA 1FW6A 1Z6AA 1CU1A 4LBWA 3ZVRA 2ZUDA 1N5LA 3PG5A 3CZPA 4V0LA 1MKYA 2VHJA 1W4RA 1OH8A 4CEHA 1G16A 3R7WA 3BAFA 5JHGB 1R5OA 1Q21A 3ZGXA 4BFXA 1H8HA 2Q9AA 4B35A 1TEXA 4WVFA 3AP3A 2QP4A 2A3RA 2BMFA 1ESMA 2GKSA 3FE2A 1TAGA 5FBWB 2QAGB 1K73D 5E95A 2A5JA 3UK6A 2CL6X 1OXSC 2ZPTX 1N6IA 3C7KA 4AWXA 4M1OA 1T3SA 3NC0C 1H42A 3K0FB 3OZVA 2GJAA 1E9DA 4LWZA 1WRBA 1E99A 1GAQA 3U61B 1M34E 2G0NA 4BGDA 2Q9BA 1KK3A 1FNMA 1G3IA 2IXGA 4CEJA 2GZDA 4UQOA 2GQFA 1BJKA 3CRVA 4IDNA 2JJ8A 5H59A 5JZVA 1EK0A 3PEUA 1OH6A 2RGBA 2ZSDA 3JZMA 3RS7A 2KI5A 1Y63A 4BE7B 5GJCA 3ZDQA 1EFTA 2G1JA 1W4AA 4Q21A 1T3HA 1KIMA 2ZRBA 5JWHA 4B74A 2OILA 3K1JA 2G83A 4HLQB 4BFTA 1SVKA 5HKKA 3AVWA 4TT3D 4Q9JA 3BORA 2N46A 3PUVA 2RHDA 1MV5A 3T34A 5AJYA 1LNZA 4KHZA 2ZS9A 1XXHE 1GOTA 3AVXA 4OQNA 1F60A 1JI0A 1G3RA 1W46A 3LFUA 1E0AA 2EFEB 3TSOA 4EKDA 2ORVA 3AGQA 5FUVA 3VHXA 2J87A 2P6UA 5L3VA 1YZKA 3CXCB 1NL3A 3UKDA 5FPSA 3U4QA 3CZQA 4XSHA 4Q4LA 3UMSA 4Q03A 2AKYA 2AFHE 3PUZA 4PC1A 2P3SA 2Z6VA 4PFSA 2FZLA 5CJ2A 3W2GA 1YZQA 4Q7LA 1TF7A 5JCPA 1GDDA 4CZ2A 4MUAA 4K8OA 4F91B 3GD7A 3AF1A 4OI4A 4Q4AB 4D26A 1KMQA 1MO3A 3UG6A 4C0AC 2VP6A 1EFUA 1IN6A 4M1YA 3GLFE 3VU9A 4JVLA 2QQ0A 4HB3A 4IVQA 4AK9A 3E2IA 1YHQB 1K5DA 2WICA 3ZH9B 3GLHB 3TUIC 4LRWA 1R0YA 3G71B 1YRBA 3E1YE 2QEXB 1E1RA 4GOKA 1EG7A 4MYCA 2ZITA 5IDVA 3QG5A 4NYJR 1Q57A 1CNEA 3QF4A 1U90A 4OHYA 2ONJA 3X2SA 1XP8A 3SHFA 2YHSA 4Q1AA 2HLDD 3W3AA 4P4SA 2RH5A 2YINC 2NO7A 1ZVQA 2UKDA 2O8EA 3X1ZA 2OK7A 4UJ3A 4B47A 1G6HA 1VQ9B 5GJBA 2WJHA 2QSYA 2WVJA 1F5NA 1W47A 4HAYA 1IN7A 3NG1A 2KJQA 4MKIA 4ASUD 4IDOA 3LBIA 1LW7A 5KPDA 1OFUX 3Q3JB 4QJ5A 4URVR 1MR3F 5DO9A 4EFNA 1P2SA 1JXMA 2QMEA 2VNJA 4GZMA 3B1VA 3FB4A 2VH5R 1R2QA 1MO6A 2FNAA 1E64A 1G5PA 1Q1QA 2EW1A 3HWSA 2JIZD 1YQTA 4ARZB 5LD2B 2QRNA 4FCTA 1GRNA 3D3QA 5DHAA 5FI1B 5J4VA 1EFRD 5CJPA 4IDPA 1KD1D 1QZXA 1VMAA 1XEXB 3K70D 2HYIC 2YV5A 5EE9A 1GSIA 3B82A 2W6JA 1XTJA 3ZQ6A 4QC2A 4CIDA 4DLZA 2YNMA 1Z8FA 4TYYA 4GBMA 2QA5A 3SOPA 4QJ3A 1VQ7B 2PCJA 4BRWA 3UATA 3WNBA 3TUJC 4ZCMA 4GP7A 1KYIA 2ZRLA 2YC2C 4A2PA 2RAPA 2H5EA 3UWKA 2PJZA 2QPOA 1D1NA 2I4IA 3TGPA 2WWYA 3IPXA 4PSKA 2ZVQX 5F9HA 4QM6A 1VECA 2BMEA 1J90A 5C4MA 2IS6A 1JBKA 5AN9A 3NIBA 1X6VA 1ZUNB 1R10A 4HAUA 4A15A 5EUMA 4DCTA 1Z2CA 1IN8A 4UNQA 2D3WA 3MJRA 5JLJA 4BFUA 4RD1A 1L4YA 4XD7A 3S1AB 4L9WA 1B0UA 3QKRA 1ZC4A 2WSSA 2ORIA 4W5HA 4JLOA 2V1XA 5FL7A 2AX4A 4CF7A 2EFCB 3A4MA 2REOA 4QL3A 4ESHA 4ZIRA 5EZ6B 1TF5A 3PVSA 1HURA 1T0HB 3W6PA 4OQFA 1UMKA 5H70A 2V54A 2HCJB 5M04A 2IS1A 2DFNA 2BKEA 2GK6A 5E3HA 3M6AA 3RSOA 2DETA 4URWR 3GJ6A 2YYZA 2LWIA 2H8KA 2RGXA 2QTFA 3L0IB 5H68A 4IOLA 3JQPA 4U02A 4JYBA 3Q8XB 4AD8A 4BQSA 3PJRA 4RD6A 2BF4A 4A92A 1N6HA 2X8AA 1FRNA 4B48A 2QAGA 4QGHA 3U3KA 1Q81D 2DFTA 2DHRA 1E6CA 1GAJA 4GI7A 1U8AA 1OB2A 4JLPA 3K0FA 1UKVY 2CK3A 1UBGA 4KI0A 1U2RA 5FFMA 1GRRA 1KSJA 4M9ZA 1M7GA 3KJGA 2OTLB 1SVOA 3VX3A 1UEIA 2C96A 4CVNA 3G6EB 1CJTC 2ZJOA 1OGJA 4HUQA 2I1VB 2GAAA 3KZ1E 1LS6A 5JMTA 5IK2D 1NY5A 4IVPA 3PEVA 4B73A 1S0UA 2X77A 4P4TA 4FW9A 4S2EA 4R71A 2B5OA 2C04A 2G1KA 4PQYA 2JATA 3K0CC 2V3CC 4HAZA 5F2EA 4AURA 4E09A 5JI3E 4NTZA 2IHBA 1FZQA 4LC1A 2EYQA 1RJ9A 5FOTA 1P60A 3CPEA 3EZFA 1U8YA 1HE1C 4LUCA 1P7CA 4FXPA 3CONA 4TTPA 2XZOA 3I5XA 1UDXA 4BWYA 3OAAA 2D4HA 1GZSA 1OFTA 1Z22A 3ZYCA 2WJIA 3SQXA 4QGFA 1U98A 1W48A 3GEEA 3KQUA 3CW2A 2IYVA 2WKQA 4D4LA 2O8CB 1XZPA 1XTRA 1I4TD 2W2XA 1KJZA 4TYPA 4XTCS 2JJ2D 3T12A 3MD0A 1HQYE 2R44A 2IWHA 2ZSAA 4UXHA 3OEHA 3DOEA 1CBUA 1PLKA 3CKLA 3KJEA 1DG1G 1SXJA 1FTNA 3N5CA 1KKMA 4OQXA 2ZJZA 2IYWA 1LF0A 2BGIA 4LJ6A 4LYAA 3U7FB 1QUEA 2EWVA 3T1TA 2J59A 2QNRA 2XXAA 4FCVA 1E9CA 1OFHA 2X2EA 4URYR 4U7DA 3SS8A 2NO1A 3GLHA 3QVUA 3ADBA 1IXRC 4G5GA 3RYTC 3TQCA 1P2TA 1W35A 4B2PA 1G20E 3TR0A 1NVWQ 4PR0A 3VKWA 2O8BA 421PA 1W44A 1R4AA 2CMKA 1XRJA 2WAXA 3KB1A 3KX2A 1ZNXA 2HF8A 3CCRB 2A9KA 2GRJA 1NLYA 2WSMA 2GA8A 4TSFD 4Q5IA 2ERXA 2ZI6A 4ZDJA 4FCWA 1FDRA 3K9GA 4FMBB 4Z8XA 2VYQA 1FMJA 2WOOA 1BX1A 3N70A 2KBEA 1NVXQ 5DISB 4YC7A 5J4LA 1Z6GA 3K70C 2P6RA 4BPBA 1G6OA 4YDHB 2QGZA 1J7KA 1SKYE 3QE2A 1G4AE 2ERYA 1Z06A 4PSAA 4A8JA 5EP2A 1COWA 1MH1A 4CGZA 1JQJC 3SDZA 4MUBA 3QXJA 1SM4A 2RGDA 2O8DA 3TSWA 1EWYA 4NZYA 5AUPB 2MSDB 4DUGD 1XXHB 3FHTA 4QFMA 5KSWB 1ZD9A 1QG4A 2BMJA 1IY0A 3C14C 3MJHA 4DLUA 3FDIA 4R9UC 4DHEA 2QSZA 3WP1B 2NGRA 3BERA 4JYCA 2Z5FA 5EXPA 3WRYC 1CRPA 2FFHA 4I99A 1W0JD 1E9FA 1LB1B 2VSXA 1WQ1R 4DLVA 1JEDA 4PHGA 521PA 4PPFA 3RABA 2QU8A 3AVOA 5E7MA 2F9MA 4Q01A 4TQUS 3VNUA 3I4LA 4GL2A 1E2NA 2IK8A 1BYUA 1BO6A 1NIPA 5KSZA 2PT7A 2CNWA 3SJCA 2HYDA 2V8OA 1DEKA 2ZJ8A 1KK0A 1BYIA 3GLFB 4ZI3A 1VHLA 2WBLC 4KO8A 2J1LA 1ZM2A 2BM1A 3HR7A 5JJKA 2XNDA 2IYSA 4DXAA 1E2FA 3KTAB 3CC2B 1CRQA 5KTYA 1P2UA 1P5ZB 4MRPA 2C78A 2J46A 1IY2A 3JVUA 3CRZA 3IDQA 1CP2A 4C4PA 4EFLA 1R0ZA 1C4OA 1RYHA 5EP3A 4DLWA 2J5XA 3R8FA 2XSZD 3LQRA 1XZQA 2CCGA 4WW0A 5EP1A 3K9HA 4ZGNB 3TRFA 1VIYA 2FSFA 2PZEA 2QG6A 4Z1MA 1S96A 2DFLA 3W6NA 3IILA 1LS1A 2ZYWX 1GKUB 3AVQA 1M2OB 3O8RA 4LOAA 1ZU4A 2ZJ2A 3K09C 3QKUA 3DL0A 1VQ8B 4UAJA 1Z47A 2FPLA 4K81B 4BFWA 3P26A 2OCAA 1E4YA 4JMPA 4YLGA 4B3DA 3QPUA 2VP0A 3AKDA 3HU3A 4OL0A 2ZREA 4D82A 1NP6A 5DYIA 2AHOA 4G1UC 2V9PA 1P2VA 4XSGA 4Q7MB 3I1FA 3KKMA 1TX4B 2B6HA 2XAUA 1OIWA 3SBDA 3ZQJA 3FYHA 4I1OA 5CDFA 4CEIB 3KFXA 5JECA 4JJKA 1II9A 3EIHA 2ZYUX 2V4ZA 3CPHA 3E1SA 1E9RA 4NCHA 2XITA 1SXJE 1JJ7A 3R7WB 4CEHB 2FEMA 3LDAA 2FH5B 3O8BA 2WOJA 3KXKA 2GVZC 3FMFA 3OIVA 2G77B 2ZQ5A 1OHHD 4YQFA 4QBFA 4O3MA 1XCGB 1XJCA 3OFND 2WTUA 4MKHA 4BPRA 2ZSEA 3TE6A 1XMIA 4LJ4A 3LLUA 4BLOA 1YR7A 2BSAA 1IOZA 1UAAA 1VDZA 2P67A 3CRRA 3GLHE 4C43A 4JSTA 3U6KA 2C9YA 2REXB 2OXRA 2FOLA 1N6NA 2GWHA 5KSOA 3QKTA 2FSIA 5G40A 2VHQA 2ZR0A 2VHTA 3TJZA 4CEJB 5BN4A 1XTIA 5BQ5A 1JR3D 5FOXA 2JEOA 4QXAA 2QP9X 4NCJA 2F1IA 2IBMA 1Z0FA 1AGRA 5G53C 2F7SA 3H1TA 4A82A 2ZJYA 2HJGA 4MRRA 3R20A 1VG1A 2DBYA 1IXZA 2VZLA 1HE8B 1E63A 1G8GA 1QBKC 1ZIOA 2JJ1D 4MRNA 4DLRA 4B3XA 1WB9A 1XFAA 3L0OA 1P62B 3AKYA 3AQ4A 3A8TA 3GPLA 4OHZA 1E2HA 5HE8A 3VFDA 5KUTA 1DAEA 3EPHA 1N5IA 1E1QA 4G5QA 2YWEA 3HU2A 1HEIA 2ZI9A 4DDUA 2ZE5A 4FMCB 5E7IA 1GILA 3BK7A 2OK8A 2HT1A 1XB2A 4N3GA 5GV7A 1X8LA 1BX0A 4WQMA 2BIFA 1V43A 5KOYA 2HF9A 3OZXA 1GIAA 2RGNC 4DEXA 4W7SA 2EVWX 4QKQA 1M7HA 2X3UA 5CYPA 1KO7A 4NBSA 4ZO4A 3T1QA 1KSGA 4I81A 2IYXA 5EJEA 3K8YA 4DDWA 5LPNA 2PJRA 4JVNA 4LHWA 1Z63A 1YI2B 1F2UA 2YOHA 4A4DA 4KSCA 4AG6A 4BLSA 4Z54A 1PLJA 3TIFA 1G7RA 4JT4A 4Q9IA 4TYWA 4W5WA 5AJXA 2V7QA 3IHWA 2GBLC 1W0KA 3LVRE 2BCGY 1DO0A 4AYTA 4YAOA 1XTSA 5EP4A 1OV4A 1Z0KA 3TH5A 1JPJA 4JKYA 2NPIA 4RSGA 4TZ0A 2B8TA 4MGZR 2XNSA 4PTLA 2W6IA 3PEWA 4PC3A 4ZKEA 4FIDA 5AUOB 2VP5A 5AUQA 1T8UA 2ZU0C 3QQ5A 4WXRA 4F7DA 4DIDA 4URXR 721PA 2QBYB 1QVAA 1AS2A 1U8ZA 2VRWA 3CH4B 3QF4B 2PL3A 2WPDA 4OK3A 1OH5A 2PMDA 2J0QA 3MMPA 4D6PA 4Y9RA 3P1JA 1XEWY 4BFYA 3U44A 4P4SB 1AGPA 1KI1A 2IF0A 2O8EB 4M2LA 3NC1C 3L2OB 1OJLA 5TXGA 5DSZA 5HPYB 2HUPA 2GJSA 2WWWA 3CF2A 2GK7A 3PR1A 1OW3B 2WWHA 2XJ4A 4GP6A 4Y0AA 1D9ZA 2KE5A 3AP2A 1N0VC 4FD2A 3TAHA 3AKEA 4HE6A 3OZUA 1VTKA 2OEPA 4LI0A 1QHXA 2NPFA 1Z5ZA 4TL6A 2FEOA 1XWIA 1MRSA 1HT1E 2PMKA 3Q7PA 2PZFA 1UADA 1OFIA 2ODNA 2EIXA 1WBBA 1CULC 3O8CA 4A1FA 4Y9UA 4B33A 4EPXA 3U5ZB 2I1QA 3H84A 5TR9A 3CPWB 4YALA 4Q02A 1NN5A 4XH9B 4KSBA 5CDFE 2VP4A 1O3YA 1XF9A 3LW8A 2W58A 2ZSFA 1OGIA 4AF7A 1OXXK 1RIFA 1RVDA 4IXNA 2ZU6A 3NHAA 2JAQA 1S1CA 1DS6A 2QMUA 3EIEA 5LB4A 3L8YA 3FHCB 3U6BA 1N6LA 1W49A 5F9FA 2B7BA 2RGAA 3L8ZA 1SKYB 2WHXA 4M1MA 2D2EA 1CR4A 4LV8B 5FTNA 4A2WA 2XZLA 3L43A 1PZNA 4BZQA 5HKKD 1RRGA 1UFQA 4KXFB 4C3ZA 1G19A 1VG8A 3BGWA 2WM9B 5EE3A 4Q1FA 1FMLA 3A1WA 3DMDA 3QKRB 2XTNA 4OK6A 4PZZA 4OQMA 2QA4B 1VQKB 4IXMA 1JNYA 2OUKA 4V0KA 5KSYA 5SZHB 1S4QA 3QFRA 2R6DA 5LBIA 4TZ6A 3F8TA 4DSTA 1XX6A 1FNDA 4DSNA 1JB9A 4WA7A 3REFA 4F4JA 1KZGB 3WYGA 1ODFA 1BS1A 2NIPA 4CEIA 2ZRCA 1DAIA 1II0A 1H65A 1ZD1A 3MGCA 4TQ9A 4YMWA 1QUFA 4LJAA 1EWRA 2WIAA 4D0GA 1G8HA 4KLNA 2WJVA 4IKEA 3RWMB 1E32A 4LY6A 1IM2A 3C15C 4EH1A 3MG9A 3EIQA 4L5BA 1VG9B 3G0HA 4AI6A 5KSPA 2QUZA 2J0UA 1KQSB 4C2TA 2VNKA 1M74A 3CUEF 4YMUA 4P6VF 3AVYA 1OLOA 1X8KA 3H2YA 4JLKA 4L9SA 5DLQC 5IF9A 1ZW6A 4G5OA 1JB1A 4M8NE 1E3MA 1T5IA 3C16C 3WNDA 1KNXA 2GZHA 3RS0A 1FX0A 4ABYA 4RZ2A 1QHYA 1WBDA 1UKYA 3LVQE 2MSEB 2VEDA 1JECA 3LX5A 2JLRA 4LHXA 1N0WA 1E1RD 1QFYA 1VYVA 4WIAA 2WMNB 2CRVA 4A0GA 3TVDA 4HUQB 4MQBA 5DNYB 2BEKA 4B76A 2CHGA 3LLMA 3X1XA 4NMMA 4MGYR 4P33A 4LV6A 1SVLA 2VF8A 4EJSC 3AF2A 1Z0IA 2BMDA 3CR7A 4JJZA 3VTKA 4NCIA 3WHLA 3CNOA 3VKHA 4HZUA 2J7PD 3FTQA 4B44A 1VCIA 3FMOB 2R6FA 3LX8A 4HB2A 4KYUA 1RZ3A 3VR4A 1RJ9B 4G3XA 3MHPA 4JBYA 3BC1A 4PPQA 1OKKA 1Z6YA 1BMFD 1NMZA 2WWFA 1XCPA 1GKYA 1ZP6A 3CH5A 3TSZA 1U99A 1E0KA 3MLEA 4JLAA 4TMZA 2OSBA 1DADA 1DAHA 4LJYA 1NRJB 2GILA 4BECA 1KO1A 2XTMA 1SZPA 3EPKA 3DM5A 3RWOA 5LDDC 4A6XA 2D62A 1FOEB 4DVGA 2RKOA 2OE2A 1OSNA 1T6NA 1ZAKA 4JVMA 3FPKA 3ND9A 3RRNA 3W90A 3B9PA 3ZVNA 2ZRNA 4NYJQ 4DIEA 3TUZC 1SXJB 4IVRA 1PJRA 3D31A 3W2FA 2BDTA 2N42A 1G64A 2R62A 2Q9CA 1E2LA 3UMRA 4C0JA 1VPLA 1R8QA 1Z6XA 2XXAB 2W2VA 2Q0HA 2QDXA 4DLXA 3LO8A 3NBXX 2H17A 1RKBA 3Q85A 4FMCF 1QHGA 5G41A 3TAUA 1DDIA 2TMKA 4M0LA 2VP2A 3W5HA 2QBYA 2O8BB 1G3QA 4WZAE 1Q82D 1U0LA 4XD7D 5JRJA 5DI9A 3CCVB 2Q21A 2IA5A 1WMSA 2QT0A 1JJVA 5FL7D 5IHPA 2FF7A 1CR1A 3KXLA 4TLCA 4DQKA 1EFHA 1ZM7A 4IJMA 5HZHA 2WMOB 3OIUA 4PANA 3R9WA 2O0JA 2R9VA 4N0DA 1W4CA 4TN1A 4X8LA 5EXTA 2O52A 4ZPXA 4A8JB 2FG5A 4CYMA 4GZLA 3RS4A 1QFZA 4AYWA 3OZWA 1IBRA 1P75A 2GF9A 2GXUA 3HYRA 2O8DB 5JI2E 4EPTA 4AKGA 2AD1A 3IQWA 2ZRGA 5JEEA 3ZD6A 3GJ8A 3EC1A 3LAWA 2ZUCA 5JRZA 3BH0A 5DE3A 2IXFA 3K9NA 4HYYA 1AK2A 1A8PA 2RGCA 4LX0A 3Q5EA 1JJ2B 1MT0A 2IUSA 3A4NA 1NSTA 3FWYA 2XJ9A 3CX7A 4KODA 1DAMA 4R2IA 4JVSB 4BUJA 2P5TB 3EPLA 1VKJA 1WXQA 2CK3D 4JBXA 2OG2A 3CCEB 3BH7A 1RRPA 2ZAMA 2QORA 1NDHA 3KQKA 2ZRJA 2JLYA 3ES9A 1S3SA 3GCGA 4OK5A 5AJZA 5GADl 1IJEA 1TU4A 3P4XA 2P6NA 4UNPA 3VR3A 1P72A 3P27A 3CF0A 4JL5A 4Q66C 4HUTA 3CO5A 1N2CE 3K0CA 3QE0A 4IOKA 5ANRB 1E2PA 4LYJA 3CD6B 4Q4HA 3EZ2A 1E2JA 2GTPA 3D7MA 3T1VA 1W2BB 4QGGA 3VMFA 1HUQA 1Q3HA 2CVFA 3BJIC 3IQXA 1WE2A 5KDLA 4B71A 1G8PA 2QL6A 1CJMA 2VTKA 3IBGA 1D8TA 3IUYA 3MCAA 1AMOA 3IBYA 3CCLB 3OE7D 3W5IA 5K8UA 1E0JA 3DDCA 3OAAD 4QJ4A 3ETLA 4E03A 4MGKR 1N6KA 3C41J 3FHOA 5JBQA 3OEEA 1DBSA 5EE1A 4IW3B 3T06B 3LO5A 1UEJA 4RCYA 4MYUA 3W2EA 1U81A 2VBCA 5IT5A 2PT5A 3VQTA 4I1UA 4PC2A 3FMIA 1K9MD 1G8YA 2K5UA 3DHWC 3KJHA 1XPRA 1VCOA 4DQLA 1KDTA 4KVGA 2PEYA 3AF0A 4PAMA 3RS2A 1NG1A 5FOUA 1BKDR 4HB4A 4TL9A 4ZGQB 3MSXA 4QHSA 1GFIA 5FTLA 1Z3IX 2B21A 3DEFA 3HPQA 1NLZA 2MMCA 5CK5A 3SN6A 1JEEA 4EIWA 3EX7C 1CLUA 4IEIA 5JWOA 3ZC3A 1WP9A 3T61A 4P3YA 2ZE8A 2JLVA 3F3YA 3U2QA 3REGA 1W1WA 2BBSA 3FPAA 3ECCA 4A0HA 3CM0A 1NKSA 4PC7A 1GTVA 3Q5DA 3FMPB 2QE7A 2W00A 4YAFA 2GAOA 3ONWA 1NY6A 2CJWA 1VHTA 3GFTA 1YZTA 4MGIR 1P6XA 4PC6A 5IRCD 5FUYA 2JIZA 3B7GA 3U7EB 2OHFA 2OXCA 3WMEA 4CRWB 4LPSA 2CDNA 2IYYA 1CIPA 3OF5A 2AFIE 3TQFA 4W9MC 4EPVA 4JKIA 3W3ZB 1PV4A 1QGAA 1GNRA 2UZ3A 3KUDA 1VQMB 5FI0B 4QBHA 2WWIA 4KFUA 1UDWA 3O8DA 3BS4A 5SZJA 3X1WA 4GMXA 1TLLA 2C03A 1KI4A 1P4SA 3I72A 4AKEA 5KYKA 1YJWB 1QH0A 1X1RA 1COWD 4GOXA 1NN3A 3QPVA 5EZ5A 2L0XA 5BYKA 3V76A 1YR9A 1GVHA 5J4YA 4ZI2A 4MKFA 5FH9A 2ZVPX 4R2HA 1X86B 3LNCA 4KITB 2GDJA 1CJUC 3EXAA 4I1VA 3GLGA 1KSHA 2VHCA 1W5TA 3V9PA 2HV8A 4DZZA 2A5GA 3PUYA 5BXQC 1YJ9B 3SFVA 1YKSA 3QOFA 5TV2A 4IHQA 2IEZA 2AWOA 3UG7A 5EQTA 3DMNA 4M22A 2IYLD 2JLXA 4X8HA 4WXPA 3NDPA 1UF9A 3A6PC 4BASA 1FP6A 4XTRA 1N5KA 2UZIR 1HY3A 1FNNA 1KY2A 1LV7A 4LPKA 4DLTA 3VAAA 1VQNB 1E9AA 2WWXA 2W83A 1KAGA 2GHIA 1QF9A 2FFBA 1SQ5A 1T0JB 1OB5A 3U3RA 2OFWA 4DBLC 1B2RA 4OKSA 1A5TA 2OAP1 3VO2A 4HATA 3ZZ0A 4ACAA 2J45A 2BJVA 3BIFA 1NBMA 4AKIA 1RFLA 3WBJA 3ZIAD 1F2UB 3AKCA 5FPKA 2OLJA 3L0SA 4NYIR 4JS0A 1R0WA 4Q47A 5FBLB 1R0XA 4IOMA 4RD2A 2F43B 1EP2B 1SVWA 1W34A 1VQ6B 1AM4D 2XNCA 2GETA 3F0TA 4M1TA 1L8QA 2QAGC 4DCUA 1SULA 4MRVA 4Z1MD 3W8RA 1ZCAA 1J9ZA 3CMEB 3DPUA 4EPYA 4G5RA 3SFZA 2VHUA 2WZQA 1KI2A 1WDTA 4FK8A 1AS3A 3K09A 5K8LA 4D4KA 3NHBA 1OXVA 5CITA 4NDZA 2C99A 4URUR 3QXHA 4F92B 3CRW1 3ASZA 3FVQA 3T1OA 2GESA 1M6NA 4PXAA 1MABA 3OHMA 1AA9A 5IK2A 4CT4B 3EASA 2R65A 1N8RD 3Q72A 3K0AA 2ZRFA 1E9EA 2DR3A 2PLFA 4HZIA 4M1WA 1ZC3A 3CNNA 2OT3B 5P21A 4DCVA 3U44B 2YOFA 3FFAA 5F98A 3B85A 1CR2A 2QTZA 1G3UA 4HI0E 4M21A 4YDSA 3SYKA 4C0BA 2EQBA 1TTTA 4YONB 2ANBA 1CS4C 2RB4A 3G82C 1ZU5A 4RZ3A 2HEIA 4MYTA 3QI2A 4Q19A 1QVGB 4B75A 1D9XA 2A30A 2NZJA 5UKDA 1A82A 4B3CA 2OBLA 3I5YA 3MWYW 1D2NA 2VF7A 2F1JA 3JQQA 2QMHA 4CT5A 2ZR7A 4DCSA 2ZI3A 3QUSA 4X8OA 3C8UA 3DO6A 2OAQ1 3CLVA 4JLMA 4HAVA 3SJAA 1Q20A 1QVFB 2ZRPA 1T5LA 2FGJA 2Q6TA 4E5UA 1JALA 1MO4A 4J0QA 2XNJA 1JAHA 2WAYA 1YIJB 1F6BA 3MFYA 2JLUA 5C2JB 4OBEA 5KNCA 5K8TA 1E79D 2ONKA 4TYNA 1ZCBA 1P61B 2A78A 1ZNZA 4NYMQ 4RFSA 1M1YE 1ZUHA 4PHHA 4Z51A 1QGYA 5J5CA 2XB2A 4Q7KA 1XCMA 1YITB 3EWSA 4TLEA 1M1KD 1BIFA 1SVMA 3H4MA 1G7CA 1NVVR 1SGWA 4BLQA 1S9DA 4NH0A 4LSGA 1CJKC 2BV3A 2HXYA 2FPKA 4QBIA 2KSQA 3QXXA 1HV8A 3D8BA 2J0VA 4L4UA 4I4LA 5TDHA 1KTVA 5H8WA 5JJLA 1JA0A 2FPMA 1GVNB 1KDPA 4XWOA 4TLAA 1DPFA 4YHBA 1E1QD 3DZ8A 4QM7A 1V5WA 4YMVA 3CCSB 1MO5A 4TSFA 4DB4A 1Q86D 2NOAA 4NYMR 2C2HA 1NF3A 2ZI5A 5A0FA 2RGNA 3NDBB 1Q12A 1Q7YD 1SHZA 2C98A 3AB3A 2HXSA 3CB4A 4NP6A 5TARA 2DERA 3GLGE 2IXEA 1HT2E 2LKDA 2OCPA 5LB2A 2FFQA 3SJZA 3JZAA 1KMHA 3EZ6A 3EZ9A 1HYQA 1KI7A 1HH4A 3KKOA 3EPJA 3AF4A 1F3OA 3BRWD 3N2IA 3CCMB 1GL9B 2CXXA 4DDTA 4Q9KA 1LFDB 1FP7A 5D3MA 1MRNA 5A4JA 3FFBA 2XEXA 4D0LB 5FR1A 1IQPA 1W2HA 2GBLA 1ZM9A 1KO8A 5BYJA 2J0UB 5LD2C 3U7HB 1N0UA 2F1HA 1KJYA 2DFKB 1NSFA 2IYTA 4IDQA 3BB3A 4N0EA 2GXAA 3F5FA 2AK2A 1H8ED 5GJVC 2QPAA 3I62A 4DJTA 3W5UA 2ATVA 1FQKA 2WJYA 3H86A 4CW7A 5J4KA 1FX0B 1XEWX 3BXZA 4M4SA 1W4BA 1EX6A 3RANA 3LBNA 1KI3A 1NBME 1Q0UA 2JDID 1DO2A 1S1MA 1O87A 3I92A 3NTUA 3OIWA 5DN6A 3U3OA 4DCNA 1T3LA 4B43A 2WPDD 2VYFA 3BH6A 1NJFA 5TMPA 5C46F 5HCNA 3CCQB 4QRHA 1KI9A 4IEEA 2IW3A 3QKSA 1OF1A 3CPJB 4DDVA 4MITA 4KJZA 2V55B 1SVSA 1VQOB 2RCNA 2ZETA 5CLLA 4EPRA 4HZUB 1GP2A 2OBMA 4V0OA 2Q3FA 2V6IA 3A1TA 3GJ7A 4FWTA 2CEAA 2F6RA 1E9BA 2ZANA 2GCOA 5ELXA 1IB0A 2OO7A 5GJWC 5EMNA 4KCGA 3B9QA 3ZZUA 3OW2B 4TMTA 3J81k 4C0KA 3QJYA 2IEYA 2IYQA 3BB1A 4DRZA 4M9SA 1NVUQ 2HJVA 4CDGA 3UMFA 2XGJA 3FKQA 2E9SA 2OV2A 4HLUA 2OESA 2IL1A 1SHKA 2YWGA 2OLKA 1E69A 4UNRA 3WBKA 2DYKA 2R6CA 1X1SA 4PPGA 1W36B 4Q9HA 1KDRA 2B7CA 3RLFA 4B34A 4FMDB 2F43A 2BN4A 2CBZA 4V0MA 2E87A 4Q1CA 3LD9A 3IHLA 4NONA 3PIRA 5JCZA 1S8FA 1IHUA 1GO2A 3GFOA 3B1XA 1Z0DA 2ATXA 2EFGA 4B3BA 5DGXA 1UBCA 1L2TA 2IYRA 4TTQA 5TY0A 3FKSD 3I3SR 1U0JA 3CC4B 2PH1A 1VG0B 4JLNA 3W9YA 3T5GA 1K5GA 2QGNA 5BWMA 5JFGA 3UPUA 4LGMA 2BHRA 3RS3A 2BPOA 3TKLA 3L0PA 4OHWA 5AR1A 1OHHA 3AEZA 4EQ6A 1I2MA 3MWKA 2YOGA 2G9NA 1E2EA 4U00A 2XOKD 4TMWA 1XD8A 1J70A 1P9WA 1KO4A 1RC8A 2IS2A 3AVVA 1T9HA 1G5RA 4JLBA 2QY9A 4P4UA 4I1SA 2ZJAA 4MA4A 4QNRA 1I7PA 1E2IA 1ZM4A 3R8CA 3QEJA 2JGNA 4G1VA 4YMSA 1JR3A 4K46A 3HPRA 4AIIA 1XPUA 1L7VC 4C7OA 1TU3A 3QEOA 4Q18A 1W5SA 1H8HD 3HYTA 4M9XA 1TEVA 1W7AA 1M90D 3BFXA 1R5BA 3I73A 4JZKA 4Y7CA 3K9LA 3U3JA 1NMYA 3IEUA 4UKDA 2BWJA 3VR6A 3VKGA 2BEJA 4ACBA 3WP0A 2GVDC 3SBEA 3U4QB 2UVQA 1X8JA 2YWFA 2GCPA 4O2RA 2G6BA 5CK4A 3CIOA 2QQEA 4PZLA 4YXWA 4OHVA 3IGFA 3LVBA 2D7CA 5B57C 4HLCA 4ERNA 3EA0A 4Q00A 2QTHA 4BFSA 4Q7JB 3WY9A 1QHHA 4PO9A 4DT1B 2IYZA 1FFHA 1QRAA 4C30A 5J47A 3CNLA 4N1AA 2CHQA 5TB5A 2A5FA 5EXXA 2OCYC 1GM5A 1RE0A 1K8AD 1YZLA 3AM1A 2YWHA 2CCJA 3GEIA 4XVUA 3THWB 4EJSA 4OI2A 2NMVA 3I8SA 5L8VA 2FE4A 3EWAA 4WZ6A 4KFSA 1VCMA 1QHIA 1HA3A 4DLSA
chains in the Genus database with same CATH superfamily
1LX7A 1ETUA 3QVGA 3IO3A 4A5SA 3H1BA 2V5AA 1OX5A 4CG0A 1FXWF 4CG3A 2NXNA 2W6QA 1AXGA 1DAKA 5B6JA 3PU6A 3U1TA 3VR4D 2ZXUA 4JXXA 3FOBA 4AU1A 4D80A 821PA 2V7EA 3V4RA 1ZIPA 3HBMA 4ARUA 3WNCA 3C98A 3H0EA 2JD0A 3K6SB 1D2CA 3AK4A 4IYRA 1JQLB 4PTYA 5TSDA 3QIVA 2H1CA 2ORWA 3TBKA 1KERA 3GIDA 3EZ7A 4CMBA 2YBEA 4PR3A 3QW4B 2EC5A 5FI5A 4ZDKA 1GU0A 1PDVA 1AK1A 1ZFNA 4ZEVA 4J43A 2Z9BA 2RDMA 3LUDA 4HTFA 4L76A 5F4OA 4ZXPA 2REQA 2JG3A 1MAUA 4P32A 2R6ZA 1N9ZA 3E22A 2JFPA 4ZZ3A 1DV2A 5HUQA 1YL6A 4LCJA 4HDOB 4LJ7A 4PO1A 4QQRA 3JY6A 4G25A 3ESQA 1LVGA 3LDHA 4X1IB 4LF6B 1VRWA 2XQKA 3FD8A 1QRDA 2VR1A 2WSYB 1PQYA 4LOLA 3RRMA 4CM3A 4BMNA 1EYZA 1H6AA 3IIJA 1NF9A 4TXHA 2BHSA 1NBEA 4X6LA 3TI7A 3ACCA 3H7IA 4XN0A 3OU7A 3C7AA 5HUJA 5IJZA 3ENVA 1OH7A 4RJLA 2HBYA 3EYWA 5JS2A 5LOVF 2M6LA 3HA2A 2E82A 1HSOA 3P4UA 4F4CA 5JHHB 4J7UA 1K8YB 5B4VA 2YDXA 1CF4A 4RPKA 1LBQA 3PUWA 5CLJA 1U7UA 5D3QA 1C8BA 1RXCA 2J5KA 4OPVA 3G23A 2R6R1 3JV7A 1CDDA 4WKCA 3WLAA 4G0XA 3KHSA 1BU5A 2P41A 1N3LA 1SH7A 2X4LA 4AUEA 1QQ5A 3DKVA 4N82A 2R8BA 4WN9B 2R1ZA 3BHIA 5J4HA 1Z83A 4URYR 3VYVA 4GF5A 4V0ME 2VDWB 3ORRA 5FUWA 5SZKB 1NBAA 4BNZA 5CA0B 1EUQA 1PAUA 3A8KA 4LW8A 1W5BA 1RKQA 2CV0A 1RWMA 3FNQA 4M1KA 3H0KA 1U2PA 2HMTA 3PK0A 3LBYA 4XFKA 1JDUA 3UCFA 5BSVA 4GKKB 2YUTA 4YROA 2DPLA 4KGDA 3Q2KA 3NHLA 2OPHA 4GKBA 5FWYA 2ZYTX 3L6CA 1KAHA 4X20A 1V45E 2Q4BA 2WI8A 3KYDB 4CM8A 4KPYA 3QNUA 4JEIA 4GR5A 1CUJA 4BBZA 4G0NA 4MLPA 3TE7A 2VXOA 3ZK9A 2JC3A 5AI6A 4W5NA 3EODA 2Z1MA 2CHVA 2Q7DA 1LY1A 1KAMA 3WGJA 1TF2A 4CDMA 4G26A 3D3NA 3IUJA 4JB2A 4PTZA 3PQ2A 4JIMA 4Y2SA 2W6JD 3PKJA 3PQCA 3UMCA 4CFZA 2VLIA 3A35A 5IBCA 2BFEB 3JTEA 3DKPA 1RI5A 1O0SA 3UMVA 2ZM5A 3C3DA 3A8IA 4BWFB 2QG9A 3ZWQA 1G21B 3U5TA 3DR3A 4IILA 1CKEA 2QRGA 3I5MA 1QTIA 2JPDA 1JR3E 2I54A 2OCGA 2C8LA 2ODEA 2WKPA 3NEJA 5E4TA 1G291 2NU9B 1X3SA 2J08A 4L8LA 4IIYA 1PJBA 4U1RA 3R3ZA 4EATA 1GA6A 4JLJA 1NW6A 2CUZA 3K2BA 1EZZA 5L3SA 4ARAA 3QVTA 4NS4A 1MB9A 4LCBA 4J3NA 4EHFA 4EI2A 1OAKA 3LE8A 3GCXA 1E77A 3S0JA 4C2AA 4QHTA 3QWIA 3HJFA 4F86A 2WYWA 4GDFA 3NB0A 2JFYA 4A23A 1Q0RA 4TMKA 1S2LA 3UKJA 4KMRA 5B4TA 2WV9A 3Q0IA 4QOSA 3AF5A 3O3MB 1O94C 1YZYA 2KM1A 1N6PA 4XSVA 4RKRA 1MC4A 4YUVA 4EG4A 1G9TA 2EAUA 3KAJA 1LI7A 2IGTA 3KDSE 1JIVA 3GGGA 4NMWA 2BONA 2ZPUA 4CTMA 3WL3A 1EDBA 1NI3A 1A2KC 2QT9A 3NAGA 4HNHA 5IX8A 1MA3A 1V1MA 5JNRA 5BV7A 3VKUA 2OMEA 4KLRA 1ITZA 2E1PA 4HAXA 5KVCA 1KQ3A 5LQKA 2C3PA 2HBZA 5EESA 4BO7A 2ZXEA 3DCNA 3NBYC 2GAIA 3DZJA 4RJTA 3TW8A 3UYLA 3B36A 4OQZA 3ASVA 3VTAA 2FAXA 4IKPA 2N1BA 5H82A 2XDWA 1MABB 4A8PA 3PLAE 2BFOA 1GLNA 3HM2A 4O2LA 4HXFB 5FF9A 3W4KA 4MS1A 5AI9A 3RS5A 1GGMA 3IDOA 3EDCA 2YY7A 4MVJI 3DLHA 3UHPA 2Z4SA 3OWXA 3TJMA 4KBGA 4GUDA 4KPGA 4V38A 1XTVA 4NFLA 2XB9A 1CEXA 3U4DA 1QE5A 4FMPA 2V4DA 5JAZA 3MCVA 3THYA 1BMFA 4X7BA 4NV0A 2IHTA 3E7PA 1U94A 3RAEC 1LDEA 3GFFA 5L3RA 2JVJA 1BE8A 4QREA 1NW8A 1RSZA 3CX6A 3KSUA 1KKLA 5K0FA 1EJ6A 2O8BB 1OXUA 5H4HA 5DIFA 2AF3C 1L3CA 3DVLA 3GFPA 5D51S 4OI1A 4XPIA 3VZPA 4AP5A 4W1RA 1JILA 4MWDA 1O54A 5EQJB 1V0JA 2ZPAA 3ASYA 2INGX 4DK0A 3CX4A 4G5YA 1DARA 1NN1A 4O5AA 4WGFA 3MELA 4PEVA 1X7XA 5KYWB 3GV0A 4DQXA 1WUKS 3W0LB 3T5DA 1WEHA 4PAQA 3JARA 3LC0A 1PWXA 1XZFA 2VPTA 4LTNA 2ZE6A 1NT4A 3OTOB 2QVCA 4UU8A 3UVEA 1FRQA 1XE3A 3AI2A 4FFNA 2X76A 3WLPA 4ZDWA 4B7ZA 1WOYA 4HNGA 4QTYA 3BPSA 3C24A 2YZMA 1QYRA 1P4JA 2VXCA 5CXUA 1L3IA 1SWWA 1IJKA 5LZ5A 1YDHA 4B6EA 4K88A 2BGGA 1UK6A 1NAIA 1RWQA 1QOPB 4MR9B 1EDDA 3UNXA 4CCSA 2H08A 1LK7A 2HO4A 1GGJA 4QYSA 4ZT7A 5K99A 2IE8A 4MVWA 3UBTA 2GEVA 1IMOA 2V7UA 2M1ZA 2Q3LA 3VO1A 2HLDA 3ZWXA 1SC4A 4US1R 4NJEA 1TZJA 1GUFA 3QG1A 5DP1A 621PA 1EFCA 2JW5A 4AF6A 2KBFA 4XX0A 4EF5A 4UFPA 1JKMA 1D4OA 3SOZA 4LRUA 1Q0QA 3B1ZA 4MQMA 4LDZA 5EC8A 2BW0A 2B1QA 1ZJ6A 4HQ0A 3VR5H 1CETA 5IYZF 4JUAA 2GEDA 5K0SA 3G89A 5K6TA 5MGNA 4M98A 3R5SA 4F04A 3I61A 1AUVA 3CUSA 4D4HA 5HVNA 3I01M 3G5AA 1UEXC 1ZH2A 3SMQA 4BZZA 2JLQA 4EO9A 4LMAA 8OHMA 2IY7A 1NBMD 3B1FA 1K0UA 2FUNB 1CJVC 2P2LA 2O6LA 1TQ2A 1M1YA 4O25A 1UJ2A 3T7AA 4F3NA 2IH4A 2NU8A 1G17A 1IXKA 2YW9A 1ZJ5A 2II6A 3A2KA 2D1YA 4TVOA 1U8FO 3R76A 2ZOSA 2EDCA 1I01A 2F1OA 3AF3A 2JBHA 2NV4A 4WHMA 4KLAA 1EFRA 1WORA 4BVAA 4G8DA 2EF0A 2Q27A 1GAWA 3IA7A 1XCOA 1XLTA 1HBJA 4NBVA 4MRSA 1L1FA 4D9GA 3ZDBA 3L6BA 5A7GA 4D9CA 1NYLA 4UQPA 5IJ0B 1VHJA 2DB3A 4PQFA 4C1BA 2HSGA 4HC4A 5EMLA 4ERXA 5FO1A 3RV4A 1T9AA 1FDVA 1I4LD 3IAS6 1T15A 3PDJA 3PDIA 1HG0A 5JXGA 1I33A 1K86A 3VHQA 5EJ5A 1JLLB 3EQ8A 5C1BA 5DLEA 3PC6A 3V1TC 1NIJA 2QROA 3EWNA 4L7QA 2Z0MA 1RRFA 5CFRA 3QA3E 2QTNA 1CQXA 2LGJA 5IDWA 1I6LA 3N2GA 5LP6B 1XFOA 5J43A 3CJTA 1HOXA 1U6IA 3ER6A 4LDJA 5CX1A 4E46A 4BYMA 5L7TA 5EZYF 1RZUA 4L8VA 4C9BA 2ZG6A 2ZRQA 3GGPA 3T5MA 4ZRDA 1Y33E 3QKSB 5DNWA 1Z2EA 3VU8A 2VH1A 3ROGA 3L9WA 2X7HA 4CDNA 4EMSA 5ITZA 1ZGCA 2IDJA 2QJWA 2TYSB 3F6YA 3FVWA 5HCUA 1MN6A 2WWGA 3U4AA 2GI4A 5DNUA 1Y8RB 1L4FA 3OZRA 5IT0A 1QGUA 3HN2A 4P0TA 2R79A 3GJSA 2GF0A 3MRVA 5CB6A 4MLZA 1XD9A 2GCOB 2IPXA 1GFWA 5TQJA 3VGPA 2EZ8A 1XMSA 5HEKA 3GNLA 3E20A 1RCTE 2HDNB 3AINA 3O38A 5EIWA 1TTHA 2ENWA 1CUUA 4L7VA 1A9XA 4RIEA 2V6BA 3D54D 4PQRA 4JNKA 1J97A 2A7XA 5AFSA 3GP8A 4RJIA 4HS9A 3JU3A 2A57A 3B1KA 3ZX5A 4M60A 4LOIA 2HA7A 2VSOA 2YL2A 4MA0A 2C4HA 5MN4A 1RW4A 2DKFA 1Y34E 1M6HA 4ID9A 1FVHA 5AICA 1BMQA 2IODA 3Q1KA 4JOSA 5FJJA 3OHSX 3QVMA 5E4FA 3PFFA 4G2NA 2X1VA 3A3YA 4Q4AA 1USWA 1E2KA 3UOWA 2R2AA 3PHIA 4QYTA 3AJ9A 2GPYA 1QJCA 3WLTA 2DLDA 2HLHA 5SYNA 1XTKA 2PA0A 2QTVA 5BY2A 1KY3A 3V1YA 2VDUE 1S2MA 4NFHA 3CC7B 3O47A 1YE8A 4J9VA 1M9NA 2ACVA 1FUUA 1YR8A 1I2ZA 3DD1A 4NQZA 4ESVA 1PS0A 2A5YB 5CB4F 3CW8X 2QR2A 3WLOA 3BXHA 2JVIA 1ZGAA 5HYVA 2YKGA 4L6IA 3SQMA 3X2FA 4P7KA 4WVLA 1R1DA 1DCMA 2YWBA 4CV3A 5IANA 3LA6A 1E59A 1C1YA 1FF9A 1G18A 2QYTA 3MBOA 1A9QA 4YAUA 5FPHA 2AL7A 5HFNA 1QNFA 3WL7A 4E13A 3DZIA 1ZBDA 1S7GA 2QM7A 1N4DA 3B1WA 3I23A 1V39A 1SURA 4KYVA 2FSUA 5T3UA 1HRKA 1D4AA 1YZNA 2B5WA 4DJAA 4KR3A 2GKOA 3AKZA 1JG2A 3PA8A 5JO0A 4A36A 1J0AA 2WD7A 7REQB 1G1AA 2QGFA 3GMTA 1QIHA 5AVOA 1WW3A 1HM5A 1A4UA 4U9UA 2IHKA 3WGNA 3SE0A 5ALWA 3RSGA 3OX4A 1T9DA 3HJTA 1RXIA 1L5NA 2CV1A 4EL5A 3KQQA 1E60A 4UU7A 1WXGA 2H7VA 2FQWA 5KDDA 4MPDA 5AO9A 3C3AA 1EM8A 5A5EA 1C0EA 3ZVMA 4O4IA 2R86A 2V59A 4D9JA 4ZHQF 1LF5A 4NE2A 1U8CB 2Z58A 5DMHA 4KI7A 3WMGA 3IPYA 4L2IA 1GDHA 3DVQX 5FBHA 2Q4RA 2OOSA 4BFVA 1D2AA 1RHJA 2I29A 3HCWA 4PO8A 5F64A 4DBLE 4D2IA 2C2OA 2F1LA 3BQJA 2MSWA 4RTJA 1LLQA 3EIOA 1GQRA 1CIVA 1DFHA 3NNSA 1C3LA 1JU4A 2B4QA 4BGUA 4DQDA 4MYRA 3QY9A 5DGIA 1YKFA 1Q22A 3VPHA 4CLEA 4NABA 3T3NA 4ZQHA 1VSBA 3PITA 4IINA 1U4NA 4CCAA 1G5HA 4CIYA 2ICAA 3N2EA 3OCCA 3C8ZA 3O8OA 1YDMA 4JLVA 3FPHA 5DB4A 3KSAC 4MUNA 4MS3B 4PSVA 1TUBA 1YK1A 4RA6A 4PN3A 1RI3A 3ZU4A 1QRUA 1LK0A 1NW4A 1TK3A 4LXUA 2EW2A 3MWDA 1KVTA 2Y8EA 4W8GA 4UXIA 3PPIA 4MP8A 4I4CA 2HMAA 3TCKA 1AC5A 4CKEB 2YXPX 2ZWVA 1TYDE 3ZIAA 2C9OA 2QTGA 4TXJA 2R1UA 1NTRA 2ZSBA 2HXGA 3IE2A 4DW8A 3CRNA 1XFDA 1EK1A 4KXNA 5FDFA 4NJMA 1U0HC 3CO0S 3I0MA 3KS9A 2UVDA 1OGYA 3GQBB 1V5VA 5DHFA 1QZZA 5ALQA 4Q4JA 2XUKA 4EAQA 2HY7A 1T34A 1YJ5A 4EGFA 1Q44A 1E96A 1PEDA 3AEKB 4U0KA 2QUIA 3G1UA 4BP3A 4RD0A 4RNDB 4TL7A 5JZMA 1U3TA 3AW9A 2QRPA 1EUYA 2FZEA 1NSYA 4RPLA 2YWDA 1G8FA 1LNQA 5HX7A 4IDDA 4YX9A 1OZFA 2C83A 4N3NA 2G63A 3G9UA 4X1YB 3RUDA 3DTVA 3VVCA 1U3UA 3V2UA 1F48A 1Y8QB 3O92A 3CWQA 2VBVA 2ONZA 4NKRA 5G3YA 5B58T 2HDHA 4F60A 4RD4A 4PFKA 5C8XA 3GLIB 4JDUA 1JJIA 2Z43A 2YVAA 4S1TA 1V47A 2DSTA 2X2FA 4ITRC 1Y6GA 4RX1A 3LQ4A 4PAWA 4URZR 3VH2A 2QZ4A 4DSUA 2C9CA 1OWMA 1XN1A 2IHZA 4OLFA 2FKAA 4HQFA 1CEYA 5BPFA 2G4CA 3MINB 3TTTA 5BQPA 3CF6R 4XGRA 1S72B 4C7MA 2I3BA 4G0ZA 5A3JA 4C2UA 3GEHA 1WUYA 5BSUA 1KFBB 4OAQA 1MC8A 4AB1A 3UY4A 3E53A 1OPXA 5B5SA 3W05A 1ZIXA 5L3QB 3ZEAA 1Y89A 4F3TA 2O06A 3Q3GE 4TUYB 3SX4A 2VJMA 1TQ4A 5KYUA 2YC4C 4D81A 4DR4B 1T0IA 4FGLA 3QBVA 3KPJA 3DVSX 4UOEA 2PRJA 2OENG 3ZS8A 2C0CA 3H4IA 2WM3A 3M3DA 4XVQA 2Q7OE 2F59A 4UU1A 4RZXA 1KKUA 1YVDA 1EFPA 2QPLA 5AUNB 1CEEA 2NSYA 4XQFA 3TQOA 2Z1DA 3G8DA 3LYLA 1QPBA 3QLUC 2FF5A 4V2UA 5CVCA 5K0BA 2KMLA 3KUUA 1RYYA 2BGTA 4MVCA 4GPIB 1UWKA 5LJIA 4DOMA 1UBOS 3DUFA 1D2MA 3L7CA 2E5WA 4AJ4A 1PGOA 2YJTD 4LHYA 3WK7A 5CU7A 4L0DA 2V74B 5ER9A 1TLFA 3A3NA 1QH1B 3HZRA 4OUDB 5AKLA 2L19A 2ZWAA 5GP1A 3NE5B 2AA3A 4CPDA 2FZCA 1KK1A 4Z8YA 4ZV7A 2HAEA 3ZCTA 3JQFA 1QLJA 1VMDA 1F3LA 2C9MA 4MVYA 2NZUG 3NP9A 2WA1A 5A5DA 2GA9A 3G8YA 3DBHA 1XMVA 1YOBA 1FPMA 2XLCA 5FOSA 3OETA 1JA1A 3FTPA 4QDXA 1X13A 3KV1A 4KO1S 3AVUA 4HNUA 4YCCA 3YASA 5FP0A 3SC2B 3KQTA 4P98A 1L6RA 1LBTA 3KUXA 4RPJA 5A9SA 1NTOA 3BL5A 3EXHC 3I55B 2GM9A 3O3NB 3NAMA 1KEUA 3OIYA 4I4NA 5ALMA 2BELA 1UPUA 4R1QA 2HA6A 3A14A 1OYWA 2QLTA 3RG2A 2BOVA 1YXMA 3QGMA 1XE1A 4XOTA 3K0SA 3IP6A 3U60B 4Z4EA 4MPTA 5IH3A 4I1RA 1U6JA 4G89A 3AVPA 1XTQA 3PDUA 4K9MA 4PZUA 3DMHA 4QELA 1VMKA 4BY9E 2A9FA 4F2PA 1PWHA 3O91A 4LF8B 2CZQA 2F3RA 5JXIA 2M6SA 5K0NA 2JFQA 1FL9A 1II8B 1WCV1 1TNDA 5EERA 1KOFA 2OYRA 1FC0A 3FPSA 3NGMA 1GCOA 3WLQA 4PHFA 2VRCD 2DPMA 1PJ4A 3FR8A 2PD3A 5BNWA 1XK6A 3GIRA 3O4VA 4KBFA 4QO7A 1XDDA 1TQDA 2QI9C 4JL8A 1MXFA 4JR2A 2KB0A 4KK3A 1QMGA 1SBQA 2C57A 2DCUA 5CB8A 5I3CA 5KMGA 1RZRA 4WFQA 1NN0A 1YU9A 2FJUA 1TL7C 2JLWA 1HYBA 2D59A 4KFTA 1E3QA 3KVRA 2VUIB 4OCZA 2Q5OA 5MFPA 1HK7A 5LL6P 3STWA 4CQMD 1Q1BA 1T9BA 1U9IA 4PE5B 4R98A 3LUAA 5JNUA 1WY5A 2EXXA 5ITVA 4KR2A 2XRZA 4PRLA 3KKPA 1HDCA 2O5CA 1EGVB 2ZSKA 3PNPA 2JDIA 2BBWA 2FSPA 2Q3HA 3EVGA 4B6JA 1WXIA 2BFFA 2BMAA 2WIBA 3ICCA 3K2QA 2VSFA 5ALFA 4B3SB 1TJPB 3CISA 2Q1SA 3ZBTA 1UKZA 3EISA 5FL3A 3TQSA 3L4BC 4YRMA 1VLMA 1UD3A 3DDUA 4E5KA 5ADUS 2XE8A 3DLBA 1KC8D 1BCSA 1ODJA 2BGJA 1FNSA 2CD9A 3I3OA 2HGSA 3DUWA 2YZ7A 1W2WB 4LHVA 1V3VA 1WXFA 4E15A 4RZHA 1VZ2A 1ZK0A 3VVMA 2AFVA 1WF3A 2VZEA 4MXDA 2XV1A 3OQMA 2IE0A 5HOQA 2FA9A 4R2XA 5FA8A 5GM2A 2Z2ZA 1GSOA 5LZ8A 3V1LA 4F7WA 1IAQA 3E9MA 3ETJA 4A16A 2Z6QA 3RT7A 1OT3A 2IHUA 4B6FA 4B2IA 1D1QA 1PF7E 1DT5A 4D8UA 2QJRA 4F85A 4DR3B 1YA6A 4PZ0A 3DV2A 1FS5A 1L7OA 2JJQA 4AZVA 3A9UA 2HZ7A 2OGTA 4GOLD 3U3DA 5EVJA 3A2NA 3IEVA 3GQVA 3HCBA 1IVNA 5GVRA 3WLIA 1U0EA 1IBSA 4G56A 4ML3A 4PHCA 4LXHA 4G5HA 4MAFA 1F2TB 3RSCA 2WF5A 2VNAA 4HF7A 2GYUA 1YL5A 2CLIB 3K5HA 2XCQA 1QH8A 1XEFA 4D56A 5DOZA 4DG8A 1N57A 1QO7A 4UTNA 4QATA 3DYBA 4YIHA 3THXB 1LK5A 3T3DA 1NBIA 5B3JC 2VL7A 1PFUA 3RRJA 1ZCZA 1MJ5A 2H92A 4OATA 4C4YA 4H1WA 4WBNB 1JFSA 1Q1NA 2BGMA 1ULBA 2Z8XA 3OZCA 4NAUA 3I0ZA 2QW0X 1AQUA 1ZA1A 3I1IA 5KVQA 2IEBA 5T8KA 3UOGA 1HORA 2G5CA 3LWBA 4QXQA 3DWEX 1UFVA 3O93A 3O90A 1ISMA 3DLAA 2C8KA 1US8B 2I71A 3GJXC 2P6PA 3EDYA 3INNA 3RVPA 3G13A 1X1TA 1TKCA 3MRSA 4CU2A 1UKBA 3PQ8A 2XMRA 3KWMA 2VO1A 3MMSA 2XQGA 2J7KA 4BLVA 1CXZA 5MN5A 5CLQA 2CVQA 2DGDA 1HETA 2CXOA 4PLHA 5K0ZA 3T7KA 4L0CA 4RTLA 3GJ5A 4LVUA 1M2HA 4A03A 2R1TA 3H8VA 3G8BA 3G3EA 4RHYA 3FTCA 3TVTA 4RYDA 2PBRA 5DZSA 4MW4A 5EUBA 4YAEA 3CRMA 2AR0A 3SDSA 1DEHA 1N3BA 3AGPA 2YZGA 1L5RA 1MMFB 3LYUA 5L7WA 1H2FA 1KZ1A 2W2NA 1FQWA 3JQ9C 1N5LA 3CZPA 1W4RA 4G4JA 3FVRA 3H5WA 2DHQA 1MEOA 3R7WA 3BAFA 3CVYA 1U7HA 4Q9AA 4FW8A 4XFJA 4RSRA 2ZL6A 3AYXB 4IIDA 4BFXA 1L4GA 4DXHA 4G67A 4EB6B 2GLTA 5DP2A 1YFJA 3NCHA 4TV8B 4BO6A 1ESMA 3ZR4B 3G8AA 5FBWB 5FQOA 3LF1A 5JZOA 2CW5A 4FFPA 2A5JA 1UANA 3PYMA 4YRLA 5B37A 3RBZA 3IRUA 3WNQA 1H42A 4F4UA 2PGOA 2JAOA 2GSWA 4CMCA 1D6NA 1UDCA 5BSGA 3HVKA 1GAQA 2B1RA 2I55A 4YMHA 4WCFA 2CDRA 5IPFA 3U61B 2JI8A 4MTLA 1FNMA 1FJ2A 1O2DA 1Y7IA 4UQOA 2GQFA 3O4RA 3CRVA 1M10A 2A1TR 4RF4A 4RF2A 2FP3A 3A31A 4FFSA 1IEWA 2PO5A 1PK7A 4N40A 3SK0A 2MDTA 3PEUA 4MQUA 3ASSA 1YIDA 2HH9A 5KINB 1S2OA 4XYLA 3ZWCA 3HKDB 2GO1A 2ZCJA 1YRHA 3JPYA 1CY6A 2UAGA 5GGXA 5CVEA 4MVJE 2VQ6A 6YASA 1N32B 3HR4A 4B74A 1D5WA 3UAGA 4HLQB 1SVKA 1KVUA 3AVWA 4TT3D 4Q9JA 5COQA 2ZW9A 2ZZKA 4KQ6A 4I5DA 4U39A 1QYIA 1RWPA 1VRCA 1Y3IA 2BISA 2N46A 3BORA 3MA0A 3PUVA 4KAJA 3OICA 4K9RA 4MLCA 2NVUA 4QEZA 2AYZA 5CB4B 3BL8A 2WYRA 1LNZA 2PWBA 4KHZA 5HP4A 3G7NA 2YN0A 3AVXA 2CFRA 1N5DA 2IDMA 1G3RA 1NPTO 1QH9A 1K75A 3KYIB 2EFEB 1TYBE 3FSRA 2NO4A 3L8HA 2ORVA 3AGQA 3PNLA 3PQEA 3GRAA 5CLHA 3FOFC 5BNZA 5L3VA 3BCSA 4U8GA 1MQ9A 3CXCB 3PDCA 4FSXA 1GT6A 1E5XA 4JWTA 1XTZA 4MVJH 4QRIA 3NIGB 3QITA 1SEPA 2AC7A 2R68A 2AFHE 4F72A 4PC1A 2P3SA 1ND6A 5CJ2A 2FZLA 3WGMA 3W2GA 4D8YA 4RTNA 3DFUA 1I3OA 2XYGA 1QO0D 4FFRA 1GDDA 2ST1A 3PCTA 4CZ2A 2XYQA 1Q7CA 4K8OA 1JG7A 1PW5A 2H0AA 4L73A 4KOEC 2XOXA 3EEOA 2H1OA 2DR2A 2WTMA 3CR3C 3EOZA 3FCXA 4PG6A 4BMSA 1PSWA 3R6WA 2WU8A 3EEBA 4M1YA 1PV1A 3WQQA 3N8IA 3DWIA 4F2HA 1YNSA 4R1SA 2WD8A 5LVAA 3ID6C 5AHKA 1KP3A 3U1VA 3ZH9B 4B85A 1CUHA 1E1YA 3FOAA 4C4OA 2ZWOA 1SNYA 9ABPA 1QYVA 4KPFC 1R0YA 1ARZA 3PIDA 4GOKA 1SOAA 4HQNA 4NYJR 3ZZMA 1Q57A 1U90A 4OHYA 2Y1KA 3X2SA 5LSAA 3SHFA 2D2XA 5BSYA 4Q6WA 4QXPA 3OD5A 2YHSA 1P77A 3W3AA 2YINC 5IKOA 1JTVA 3T9DA 3TTYA 5A3QA 3QKWA 1K8XB 4QUJA 1ZCJA 4UJ3A 5EVCA 5C3UA 1DAOA 4B47A 3X1ZA 1G6HA 1Y80A 3KTOA 5GJBA 2WJHA 3OOEA 4E2YA 1QOQB 3P0JA 4UNIA 1USUA 2E5FA 2WUFA 4M55A 3UKOA 4N0PA 2JK0A 5CEEA 4TQGA 2KJQA 4ASUD 2NLOA 3GA5A 1YKGA 3AUFA 3RT1A 2XH8A 3QU9A 2VPZA 1JG3A 3QI7A 5HXAA 1NT2A 1Y4AE 1ZOPA 4GW3A 1KR5A 4JOCA 3BIJA 2GCEA 5IJXA 3B1VA 4HFNA 3GFVA 5A05A 1G5PA 3HWSA 2EW1A 3AI3A 2JIZD 1EHCA 4X93A 2IV2X 3CY6A 3Q41A 3IBTA 3D3QA 4H7KA 4NRDA 2CXHA 5CJPA 3G1TA 5BV8A 4L4SA 1AHNA 1QZXA 1VE9A 3KKEA 2JH9A 4LVOA 1GRCA 1JLHA 1XEXB 1M2VB 1QIKA 4OH1A 4XEUA 1OI3A 1GSIA 3B82A 4QSMA 2O0LA 3A25A 1UXKA 2B9VA 1AKRA 4KDFA 4EMBA 1P4MA 2QA5A 2CMGA 3SOPA 2VBTA 1VQ7B 1OT5A 1QJ4A 2PCJA 3GEPA 4XWGA 3RSFA 3TUJC 1BXRB 1BA3A 3KK0A 4AZWA 1L7XA 2GCIA 1Z18A 4Y6LA 4QSHA 1EUZA 5CT9A 2RAPA 2H5EA 2AHRA 4GECA 2YJGA 2I4IA 3NU1A 1MGPA 2WHPB 4H7FA 3UAZA 3CSUA 4K6KA 4PSKA 1FVOA 2BMEA 4OKIA 4DF3A 3D4PA 4F45A 1Y3BE 5F9HA 4QM6A 3PQDA 1ZUNB 1KQOA 1R10A 2BRUC 2JFUA 5DEOA 1Z5UA 5EUMA 4DCTA 1W85B 3C0KA 5TGZA 3S2IA 4B5KA 1FZTA 1JZQA 3WYDA 2D3WA 3ROTA 3N8GA 3H99A 3MJRA 3WJ1A 3IT0A 1NYTA 4D7AA 2FJ0A 3U13A 2R7AA 4NEHB 2VOEA 4L9WA 3USCS 2WSSA 4ZYTA 1NJ2A 4AMBA 4A5OA 2V1XA 4I5EA 4CF7A 3AB8A 2EFCB 3T4UA 5F7ZA 3S2YA 4RIIA 3BFPA 4UEQA 4EHNA 4ZIRA 1LRKA 3WDSA 1HZZC 3HP4A 2ILTA 3IT2A 4JA0A 4LHSA 2VBIA 4M7PA 4MW0A 2WU3A 4IV5A 3PXXA 3RHTA 3RB8A 5GAJA 1YA4A 1YGYA 2HCJB 2V54A 3ENZA 4ZOEA 2DFNA 3RIXA 3UMGA 3PRJA 2GK6A 4IGAA 5DSTA 4TV9A 5KYTA 2BP7B 4QTZA 4URWR 2BDUA 3IP5A 4BQNA 2P2YA 2H8KA 5G0VA 5BMVF 5FBZA 5T64A 3IUSA 4U02A 1Z33A 5I9BA 4AD8A 4BQSA 3DLPX 4EECA 4EGSA 2VDPB 3FAKA 4RD6A 5K4GA 1Z4IA 2W70A 5THQA 4XWWA 3TLGA 4QGHA 4PYMA 4R9RA 5KCMA 4HDRA 2QN8A 4H1HA 4ESOA 1GAJA 1S2DA 3K0FA 4TTVA 3V32A 4EGCB 5LDHA 2NYAA 4PGHA 5LN1A 3S8YA 2FR8C 1P3DA 4BVLA 4TXMA 5HW0A 3LNNA 1N07A 1Q6YA 2D13A 5DCWA 1M6YA 2X5KO 3RJ5A 4UUNA 5CVUA 4C89A 3G6EB 4PPYA 1W29A 3GUHA 4XA8A 4CVNA 2ZJOA 4HUQA 3G02A 4YXFA 4OQ4A 1U2EA 3WGGA 4WFIA 4ZA2A 4CR7A 3N3BC 3AI7A 3DT9A 1NY5A 2GZ3A 2CDCA 2VDNB 1EA5A 2X58A 2WJ3A 4R71A 5H7XA 1Z7WA 3OOHA 1VJGA 2C3OA 4JB0A 1QDLB 2AOTA 2W42A 4HAZA 3EVNA 3E82A 1QM5A 4UHDA 3M6IA 5I7AA 5JI3E 1FZQA 2P9CA 3OPXA 4FYJA 3M34A 1Q0LA 2OL4A 4OIFA 1RJFA 4DUZB 2A4KA 2E4VA 3CINA 4F9TA 4RHUA 1E7WA 1LJ8A 2Q2NA 2FUKA 2R8PA 2XRMA 3CONA 3HRKA 3KHKA 4MR7B 4BWYA 2I9KA 3LZDA 5I9SA 3OAAA 2V45A 4B80A 4AMZA 3BVPA 3DD5A 1OFTA 2OV3A 2TECE 2WJIA 4Y6QA 4MX8A 3OFKA 4HDNA 1MZPA 4UEKA 2O3QA 4D4LA 2O8CB 4ZZIA 1XZPA 2BFDA 2W2XA 4Y2HA 2JJ2D 5K01A 5D84A 4FYVA 5BT8A 2V03A 5LQDA 1WQ4A 1H2YA 4BVEA 1CBUA 3KJEA 3CKLA 1SUPA 1SXJA 3O9ZA 3R1IA 3CSSA 2VQEB 3TZQA 1RWBA 1KYQA 2NT4A 1UXIA 4IICA 5KNCD 2ZJZA 4PWYA 1N05A 1WDMA 3QU2A 4EF4A 4YPVA 1Y1SA 2WFLB 2XTAA 4MP3A 2NWQA 4I2VA 2EWVA 4NV1A 4EL0A 5KQPA 3U7FB 2ZBPA 4W6ZA 4PG5A 4RQUA 4FCVA 2DZDA 1OFHA 2H1RA 5SYMA 5MN6A 5GIPE 3EXG1 3ZI0A 1JDBB 3SS8A 2C7PA 3GLHA 3QVUA 3TSAA 2IPNA 3HXQA 2SKEA 1X74A 4JODA 4B2PA 5HIKA 4KIFA 2FMHA 2WJ4A 1DL5A 2Y0EA 4Z0HO 1NVWQ 4PR0A 1L5ZA 4DC1A 2HUNA 3ROPA 1OLXB 3G8CA 2FRXA 2CMKA 1XRJA 3KB1A 5EZSA 2RK4A 1NMSA 2P8SA 4G07A 4YMLA 3CCRB 2GZ1A 4KPUA 1EIZA 2HJWA 1NLYA 2WSMA 4G86A 4CIAA 2ERXA 3WYCA 3CXRA 4FMBB 4FM9A 2WOOA 2F3PA 4FNGA 3IXQA 2HPVA 3H9EO 4YC7A 2EJWA 4OHFA 4YDHB 2QGZA 1J9EA 3T54A 5LUAA 3O4HA 4A8JA 4BU1A 5HKOA 1OBCA 1YA8A 1SFRA 5BSWA 1PHRA 3A7DA 4JQZA 4N3CA 5FRDA 4V1CB 3OEYA 3SDZA 3WGOA 3GVIA 3A6FA 1GQSA 4EBBA 3FF4A 4FFOA 4RHTA 1EWYA 1I0IA 5BNIA 4TWJA 3SY8A 5CBKA 4OEHA 1U5BB 1XZGA 3C3KA 4RVSA 2VT7A 5SY6A 4QFMA 5KSWB 3REOA 3RFXA 2GOYA