2RC5A

Refined structure of fnr from leptospira interrogans
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
308
structure length
306
Chain Sequence
PTREPQINLFKKSNPYKAKVISNVLLTPETGTGKRPKKEGEALVHRIVLAIDHSAYPYVIGQSGGVIPPGEDPEKKAKGLADVGYTVRLYSIASPSYSFGMKEDNIEFIIKRDNIYNGNIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFLLPNTDFSGDIMFLATGTGIAPFIGMSEELLEHKLIKFTGNITLVYGAPYSDELVMMDYLKGLESKHKNFKLITAISREEKNSFDGGRMYISHRVREQAEAVKKILNGGGRFYICGGPKGMEKGVIEEIQKISGNTGTYEEFKHHLEGAHQLFVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin-NADP reductase
publication title Crystal structures of Leptospira interrogans FAD-containing ferredoxin-NADP+ reductase and its complex with NADP+.
pubmed doi rcsb
source organism Leptospira interrogans
total genus 89
structure length 306
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2rc5A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2rc5A02
2HMAA 2VNIA 2BV3A 3VO2A 2B7CA 1BX0A 1YI2B 1KK0A 1IB0A 1W87A 4RD1A 1D8TA 2YWEA 4NCNA 1KK1A 3AVTA 4RD6A 2QDXA 2BMWA 3WYAA 1QVFB 1VQNB 1G7TA 1VQ9B 1KTVA 4C43A 1DDGA 4RD0A 4LC0A 1QFZA 1UMKA 2BPOA 4P6VF 3I55B 3CCJB 1G7SA 3E1YE 2BM1A 4PC3A 3PENA 4ZV4A 1R5BA 2DEUA 3G4SB 1JA0A 1VQ4B 3FJOA 4WQMA 4PC7A 5TY0A 4B4DA 2RC6A 1YIJB 4EH1A 3AVXA 2BVNA 2VNHA 3QFCA 2CNDA 3LVBA 4AC9A 2HCJB 2J7KA 4ACBA 2PIAA 1I7PA 2XNJA 1KJZA 4HE5A 1VQKB 3E20A 3JQPA 1SM4A 1TLLA 1GO2A 1FNDA 4B48A 4TMWA 3CCVB 1NDHA 4G5GA 1QGZA 2AHOA 1D2EA 1NJID 1AIPA 1GVHA 3WBJA 4G1VA 4ZGQB 1W2BB 1EFTA 4M1KA 1QUFA 2D74A 2C77A 3CC4B 3AVWA 1EP1B 3JQRA 3CCLB 3LO8A 1SKQA 2VZLA 4DQKA 1R5OA 3MHPA 4ZGNB 4RJLA 3LRXA 1FNMA 1QFJA 2DCUA 4AF7A 1B23P 4J0QA 3CB4A 1HA3A 4PGOA 4H9GA 2BM0A 2HDNB 5FA6A 3ZC3A 1XB2A 1JJ2B 4MYUA 1BQEA 1VQ6B 1CQXA 3CMAB 1D1NA 3CXCB 1FRQA 2CRVA 3CCMB 1U2RA 1EFUA 4B43A 1JA1A 3QFTA 1J9ZA 4LBWA 3W2IA 3OJXA 1CNEA 3WNDA 2QA4B 1ELOA 3U2QA 1JB9A 1S72B 3VNUA 3I1FA 4NBSA 1VQMB 2BGJA 3OZWA 2E1RA 4ACAA 1IJEA 3B8HA 1VQ7B 5H5JA 3CC7B 2QTZA 1YHQB 1EFCA 1M90D 3W5VA 1DARA 2VNKA 1QX4A 2XNCA 1KD1D 2DY1A 1AMOA 1ZUNB 1YJNB 4N3GA 4TMZA 4M2LA 3U6KA 3AGQA 1TUIA 1VQOB 4LBVA 3CW2A 4B3XA 1K8AD 2C78A 2NPFA 1VQPB 1DDIA 1BX1A 1OB5A 1Q82D 4FWTA 2PLFA 1E64A 3WY9A 3JQQA 3V76A 2BGIA 4TMVA 1FDRA 4F7DA 4PC2A 4YHBA 4Y9RA 2YWFA 1R5NA 1E62A 1M1KD 3VO1A 5THXA 3B78A 4YALA 4AF6A 4IW3B 4RD4A 3LYUA 1N0UA 1EP3B 2OTJB 1BJKA 4M4SA 1YJ9B 5AN9A 4M53A 2GPJA 3ZZUA 4Y7CA 3OJWA 5TR9A 3CC2B 1A8PA 5EMNA 3WNBA 1KK3A 1S0UA 1H42A 3CCSB 5KSWB 4C0SA 1FRNA 2XEXA 4B44A 4RD2A 4RCYA 2RC5A 1F20A 1YITB 1YJWB 3WBKA 1ZM2A 3G71B 1ZM4A 3WNCA 4LBYA 1K9MD 5JBQA 3W2FA 3CCRB 5TV2A 5GV7A 1FNCA 1E63A 3QSYA 1OB2A 2GQFA 1VQ5B 3ES9A 3FPKA 3I56B 3CCUB 3SJZA 2EFGA 3QE2A 4PC6A 1QVGB 3CMEB 2QMUA 2QEXB 5H59A 4YAUA 1GR1A 4B47A 3MCAA 3W2HA 5DSZA 1QH0A 2OTLB 3OZUA 2YWHA 4PC1A 4YAWA 1QGYA 2OK7A 1XE1A 4QHYA 3AVUA 1QGAA 5GV8A 3VNVA 2QTLA 2QN6A 2BF4A 5HXBA 3AGPA 4M0LA 2VNJA 1QG0A 1VQLB 1KQSB 1W35A 1DG1G 3B82A 2EIXA 1KRHA 3P27A 3CD6B 3G6EB 1TVCA 3MMPA 4FN5A 2B5OA 1OGJA 1JNYA 3AVYA 4P3YA 4YAOA 3QFSA 3W5HA 4G1BA 4RCZA 4Q7JB 3A1FA 4RD3A 4DQLA 3U6BA 4HE6A 2R6HA 1EWYA 1GAQA 3P26A 3CPWB 4ZCLA 2VYQA 1G7RA 1W34A 3OW2B 1QUEA 2FX3A 2BN4A 3VMFA 4QFMA 4TMTA 3OZVA 2OK8A 1Q86D 1GJRA 1EXMA 4UAJA 2DETA 1Q81D 4ZCIA 4TMXA 1B2RA 1EP2B 1F60A 1G7CA 3QFRA 3J81k 4K1XA 1KK2A 3ZBUA 1N0VC 1FNBA 1CNFA 1ZM9A 1H85A 4R71A 2YWGA 4TN1A 2BSAA 1ZM3A 1QFYA 2DERA 3W2GA 3CCQB 3WXMA 1GAWA 2ZITA 3ZBTA 2PMDA 3CRZA 1IJFA 3ZZTA 1VQ8B 1WDTA 2X3UA 4BPRA 3W5UA 1K73D 3W2EA 4YAFA 3CCEB 4LBZA 4MYTA 1Q7YD 2B7BA 1OGIA 3ZZ0A 4N3NA 4U9UA 4ZCMA 1N8RD 1KC8D 4FK8A 4Y9UA 1TTTA 3AVVA
chains in the Genus database with same CATH superfamily
5DNCA 1NT4A 3ACDA 4RWZA 3R5FA 2OO5A 3LHKA 5DI3B 5F2OA 4CKEB 1RHUA 4EECA 1T6BY 5A0FA 1RJDA 2YICA 1RWQA 3V8MA 2GTIA 1VHOA 1ORTA 1OXSC 1Z4MA 2BFCB 4KYUA 4OKIA 3WK5A 3X1KA 5CB6A 1V0EA 3CEJA 2H52A 4O2AA 4DA8A 3OHPA 5D6NA 1VOTA 3UENA 4J29A 3OD1A 1ZFNA 1WE2A 3N70A 3CNQS 1QVFB 3MGKA 4IYJA 4UC0A 2PFGA 1G7TA 4KGZA 1TFRA 2Z3WA 1E7QA 2IS1A 2XNKA 3KKNA 2BH2A 2QZ9A 2ZUDA 4J91A 2X5NA 1FRZA 2EBUA 2WVJA 4NCBA 3HCBA 4BNFA 1BOFA 1PTKA 1YA8A 5I4KA 4JIGA 3Q9LA 2VA9A 4D0NA 2WABA 1BA2A 3HSKA 4EYGA 2YC2C 1A69A 1IY9A 2XECA 1P1KA 3NC4A 3T9FA 4IIEA 2WLSA 4ZV4A 1GQFA 2G9RA 4P4TA 2Q9UA 3R75A 3OEHD 5DK4A 1C3JA 2VUUA 2I87A 3N7TA 3FW1A 3PV0A 5BWBA 4X6LA 1KZHA 1HZZA 4XA8A 3NJ4A 2RAPA 1QV6A 3AR5A 3SZOA 3E5RA 4DG9A 3CO5A 2H4HA 4YJ3A 1KP2A 3A1EA 2IZ0A 3EEFA 3KSZO 2Q8NA 3T9BA 4E51A 5HW0A 1HQKA 3LHSA 3E22A 4A2QA 2ACWA 3ZX4A 1NR7A 4UPDA 2JGIA 3W5CA 2V9PA 4Q3AA 3FZNA 1RXWA 2Y1XA 3IQEA 1RPZA 1W36C 4N3BA 3UMBA 3HGTA 3IP6A 5B3LA 1EVKA 2ODBA 5JCOC 1HK7A 2QA5A 3PX3A 2ZSDA 4TKUA 4YO7A 3T1QA 2HK8A 4K6OA 5AO9A 1ADCA 2FPWA 5C4GB 2HCBA 4AC9A 2PZBA 1GT6A 2JI9A 4DQUA 3G2KA 2HGSA 3PL1A 3H17A 2HJ9A 4JBYA 4DVGA 3S8EA 1NRIA 1A4IA 1NASA 3ZDDA 2DB3A 2BUAA 2HU5A 3IESA 4YYEA 2P1DA 1Z7EA 2Y1OA 1U3VA 2IOFA 3N75A 2X6WA 3IBGA 1Z4JA 3BH6A 5BSXA 1R6DA 3O8LA 2GEJA 4UBMA 1WUIS 1SK9A 2HREA 3T54A 1DXQA 1NKTA 4R2HA 5CJJA 1L4LA 4CEHA 3IDAA 4HX5A 4KYIB 4LY9A 3LUGA 2G1PA 3PXXA 3INNA 1NBMD 1N2GA 5GY7A 3LL7A 5C0OE 4MV0A 3ENNA 3L07A 5BQPA 6CHYA 9GPBA 1XMQB 2IL1A 1NDHA 4JJEA 3ZDEA 3L0OA 2V8BA 3I2GA 3VVCA 1PEKE 3H5VA 2OGTA 1TCAA 3AQ4A 2YASA 1W44A 4LMAA 2QGFA 4WN9B 2ZRAA 2FKNA 3FOEC 2QMOA 3IAEA 1E61A 5HE8A 2PT7A 3ZXYA 4DF3A 3E23A 2Q6IA 2XAAA 3P45A 4H7HA 4NCHA 2QUHA 3DE1X 4WMLA 2C2GA 5IH7A 4EHIA 1XFOA 2PWYA 5DP1A 2E49A 4I50A 1G55A 4JLAA 2H1OA 2LTAA 3KEMA 4G1CA 2IYRA 4L9SA 1ZWLA 3H19A 4MH0R 4EY5A 2FGJA 2C98A 3IERA 2VJQA 3LC2O 1VMEA 2H2FA 2IP1A 3L82B 4FCCA 3I2KA 3F5DA 2KI5A 4OK6A 1IM2A 1AH2A 2P1RA 3A9SA 1R5JA 4IMJB 4BV3A 2C0QA 1QO9A 2GAIA 4WJKB 4DV7B 2BKLA 1D04A 4MYUA 4M9ZA 2Q2VA 1P91A 1WSAA 3OZGA 3PQ5A 4BO8A 1CQXA 1TYDE 4LHSA 1VL6A 3CBQA 1E79D 3D8NA 3WK8A 1CRWG 1KZLA 1UEIA 3EWSA 4Q3OA 5AUOB 3D43A 1WUHS 4NE2A 5KS2A 1P74A 2QR5A 4QXAA 4D1YA 1GFWA 4WLOA 4E32A 4HO1X 4WFJA 3N0RA 1IXYA 1NN0A 2JFUA 3A4TA 3QWHA 1ZONA 2DGDA 3B1XA 2JATA 3F7MA 3IQWA 4OU5A 4QHTA 2ZFUA 3SNHA 3ZHXA 4TLMB 3UUGA 3KQPA 1FFWA 1JIVA 2QL7A 3NXKA 1I7QB 1ZESA 1L5YA 1XTRA 3FGZA 5IJXA 2BTEA 4OBEA 4X8LA 3IE1A 1P72A 1I3CA 3I52A 1LA2A 3UIEA 5FULA 1G3RA 2PA0A 5JRJA 2D9RA 1I2ZA 4OHFA 1RAHA 5F1YA 1P4HA 5FAXA 1O03A 5T67A 3RS7A 4WD3A 5HM6A 3EVDA 4Q4LA 3ICPA 1QPZA 4KPFC 2FPRA 2IVZA 1X86B 3D5QA 1XQYA 3P9KA 1P1CA 2W2NA 4M38A 2VSNA 4WK6A 5D00A 3U3MA 3UMGA 2H9AA 2ZIUB 1G21E 3WGZA 2YYSA 2WE7A 4H6WA 4Z3OA 3WWOA 5KMGB 4F85A 3HDGA 1E9RA 3J81A 2VRCA 3D64A 2VPQA 1GKIA 1TT5A 2IIBA 3W6NA 1GTSA 1MEJA 2YINC 2XB9A 4AKIA 4QOHA 1QZ3A 2P9FA 1C50A 2BL4A 1D7AA 3EFOA 1Y8RA 1J0DA 2POCA 4FVTA 2ZBGA 4K1LA 4QDKA 3ICEA 4BKPA 4EYEA 2ZL5A 1YR7A 3FMGA 3Q39A 4N12A 3K16A 3MLAA 5E4TA 5LYJF 7YASA 4CIXA 5ALRA 3H0EA 4ZI2A 4F3RA 1NZFA 2JBAB 3IKJA 4BNNA 2EWVA 1L5QA 4I55F 3RS5A 1ETUA 1U0TA 4CTKA 3HI6A 2CE7A 1SOUA 1AO3A 3M0EA 4QO7A 5K4AA 1AV7A 4KNYA 2GHIA 3HLTA 3IE2A 2OCYC 1FFGA 4FNGA 4MGHA 5KUTA 3BZBA 1Z73A 4FT4A 4IQGA 4WBSA 4B3XA 2GAAA 1GNQA 2XNHA 1NVWQ 3UM9A 2D4AA 4KRGA 4UM9D 4DC1A 1DUIA 2X6YA 1ZC4A 2CXXA 4KLNA 1QIKA 5E2AA 2PUCA 4LF7B 3DWIA 4YRZA 3PITA 4XKJA 4YDSA 4WJLA 5I48A 2BHTA 1JHOA 1NAHA 4HDRB 4EY3A 3TOSA 3N9IA 1TKCA 1WVMA 2J32A 4QVAA 1WXGA 3TB4A 2WKRA 5KVSA 2DKOA 1Y7TA 2JGAA 1K2VN 1TYCA 2HRQA 1SXJD 2RIPA 2XCIA 3KYBA 1XRQA 2YWJA 2BFEB 3KRTA 4EUHA 5JADA 1BA3A 3SQMA 1OFGA 4PEVA 1S02A 1YFJA 3IVGA 3AFGA 4RIEA 5HGJA 1K27A 4GX2A 2FAXA 4AF6A 5ARDA 1SCBA 4YCBA 2WV7A 2WJ6A 4JUDX 4I4TB 4LOJA 7MHTA 3DH0A 1FU8A 3GCZA 1MABA 2DTEA 5J2TA 3ZWQA 4TVBA 4QARA 4ZO8A 3PNYA 1MJNA 1SA0B 1SY7A 3L4BA 4ZODA 1N2SA 1I3LA 2VF7A 2XUKA 3LYUA 4OM8A 3UC9A 4J16C 3OOYA 3VKUA 2OTJB 1TMGE 3O1LA 3R5SA 4MW7A 3HYRA 4NNOA 3UG7A 5TQ0B 2Z30A 3OQBA 4RSHA 4KLRA 1VYTA 5AVRA 3G5LA 1PJ8A 3PKZA 2D8MA 1YOBA 3G0CA 2QW0X 3IQGX 2QE7A 3GEGA 1P8JA 3HVIA 2XRYA 3Q7SA 3D2LA 1NUUA 3L7OA 2OO7A 3VVMA 4Q4CA 3V4RA 4WZAA 1BROA 2GPJA 1ADYA 2HJSA 3UHPA 3T5DA 3TRKA 3W0LB 4IZIA 2GN9A 1X3LA 5L40A 3RTGA 2I6GA 4IS3A 1VCHA 2GZ2A 4GOND 3FKJA 4QM7A 5JATA 4UARA 1E7YA 2WHQA 4KXFB 4EGQA 4ARSA 2JAUA 2PRIA 1BXKA 1T0JB 1TCCA 3PQ4A 4RKYA 3RC9A 1GNLA 4CM3A 2BM9A 2GZAA 2Z4SA 3SIRA 5HSGA 2DFKB 4B0OA 5I7RA 1LBIA 1ZNZA 2P90A 3TRIA 5F5LA 1HT1E 2PVCA 3RLFA 1Q7BA 4RETA 2Z5VA 1K9MD 4H31A 4F60A 3DMHA 5HF9A 1CQPA 1CY7A 1Y8AA 2X2FA 4ZVKA 1JHRA 4BEVA 1LQTA 4E5NA 1G5IA 1P6QA 5KYXB 1MV5A 3KO8A 1H3NA 4HDMA 3C1OA 2MU1A 3PE6A 4RIHA 1QH1A 2J3HA 2R47A 4CN8A 1U3TA 3OZTA 1ZA1A 4G63A 2FSGA 4WDRA 4RF5A 3SF8A 4V1CI 5AI8A 3NBXX 2YQ4A 2XKAA 3KDAA 2W6NA 4HAVA 4AF8A 3HBMA 4F4UA 4R51A 3VR6A 4CGYA 2V5AA 1OA0A 3T7RA 1IN1A 2GCIA 3C39A 3NRJA 5K0TA 1QIFA 3QRWA 5IHXA 1EIWA 1H65A 4FOPA 1EHYA 3H6HA 3QEMA 4IH4A 4NBRA 3SC6A 4B5KA 3RIGA 1WB6A 3MTAA 1QORA 3N39C 4QPPA 4QVJA 1P1BA 1B6TA 3EXFA 3A1WA 4Q3EA 3DZIA 3HXLA 1F8FA 4QUHA 2VT2A 5JNVA 5ED4A 4J0IA 1RM3A 3QEKA 4EPXA 2W42A 4OG2A 3KXKA 3AJ8A 4ZVSA 4G26A 3V1NA 1JLKA 1KY5A 1SVMA 4YROA 3EUAA 2GZSA 1F6BA 4YJ2B 2FLKA 1UPTA 2VA8A 5A62A 1RC0A 3DYVA 4MWCA 1E0JA 3RVRA 2PAFA 4IUBS 1JILA 2PE5A 4IKEA 1GQSA 2HF7A 3I42A 1ENYA 2Y0BA 3RRNA 1AB5A 1EUCA 4Q37A 4RLQA 1A9PA 5D51S 1SEPA 2ARKA 5JBIA 5CVEA 5EWLB 2D4HA 5MN5A 1XJ0A 3JWPA 4Z0NA 3KL2A 3KOMA 4M9CA 1Y9DA 3BSFA 1DLJA 3DKKA 5AKJA 3O4IA 2A78A 4WLEA 3BRSA 5HRUA 4DW8A 4D4HA 4IPTA 1PHRA 1MDFA 2GA9A 2P5TB 4RHXA 4ZAXA 3Q8LA 1E2MA 3PSHA 2DFPA 5T4FA 1NI5A 1I2CA 5ALMA 5DW3A 2PLRA 3G13A 3WI7A 3MMPA 4XOIA 2H4YA 3K2QA 1Q14A 1WSWA 2GKOA 4OSOA 3B38A 1UD5A 1TF2A 2C2OA 1M7HA 1DJNA 3QFSA 1IBSA 1N5RA 1Z5WA 2C0CA 2GZ3A 1NZJA 1QFSA 2AJ8A 1SVUA 2G8NA 2ONCA 2QL6A 2QJRA 3EG5A 3FROA 3GJ7A 3PWKA 3AJDA 5A88A 1OQAA 2WJVA 4Z4UA 1Q50A 3AY7A 3E0XA 3Q7QA 2HL6A 4FUQA 4IHJB 5FOUA 5FPQA 3MJTA 4AKEA 3WSTA 4CL3A 1KAEA 5A4FS 2WTUA 2WNSA 4EY6A 2YZGA 2NNLD 2EIHA 2IJGX 3TRJA 2AUNA 2QUKA 4X61A 1XFDA 2XITA 4IZHA 3N59A 3Q6IA 1JXQA 4TYPA 5DHPA 3SY8A 3THRA 4M54A 2VYQA 1YR9A 4HRAA 2UYHA 2IZOA 3DFUA 1GQYA 2ZAYA 4LXUA 5A06A 1NFRA 1QGUA 2G25A 1Y4ZA 4KQHA 4B8ZA 4A36A 2RI1A 3GJXC 2VNAA 5BR4A 4CM1A 3T4UA 4UHKA 2W4IA 1QYRA 1P1FA 2VDJA 3IJEB 2HA7A 1UOQA 1X13A 4CQMB 1G3MA 1AXGA 3IR7A 3QKUA 3Q9UA 5EPEA 1EXMA 1DQNA 1IVSA 5AUQA 1UDRA 2Y0CA 2NP6A 1WSBA 1IQRA 2BDTA 1ZJ5A 2GPTA 3IEKA 5JNTA 3LLMA 1I80A 4X63A 1A8QA 4XQEA 5AESA 4IEEA 4I8DA 4KXMA 3FNFA 5AW9A 1USGA 5KTNA 1GGFA 4E09A 1HYHA 1Q19A 2YYZA 4JI1B 3SIWA 4YT8A 1JHMA 3HTXA 5K03A 1FNBA 1BCRB 1JPNA 3ASSA 1PKXA 2OO3A 1U7XA 3KT8A 1ZIYA 1TLTA 2TMYA 3F2VA 4DIKA 4DXHA 4JV5B 1QIMA 4JYCA 4CF4A 1JIUA 1X7WB 3LQ1A 4NBKA 2IHUA 4FE3A 4HAWA 3ESXA 2NU6B 5L6LB 3LDUA 3WLLA 2MYNA 3AU8A 2QD5A 4J7CA 4KPUB 5IC5A 2O3RA 2EJUA 4G5FA 3DLHA 1KEVA 4S2EA 4UTZA 3CCQB 1ZD9A 1ZUHA 4ZVVA 5T8KA 4F0JA 1T4CA 1XC7A 3ZBTA 3LT4A 4N0PA 4QICA 1W0JD 4W1PA 3KQQA 1Z63A 4IOJA 1M1YB 1IDN1 3B53X 3K0EA 4EFLA 1PJ3A 4B31A 5DXAA 3NNSA 3CEHA 4L9AA 3TPCA 3ZQUA 5TPZD 2FW6A 3BCSA 4G0WA 1O5OA 4PHTA 2C2ZA 2P11A 1JT9A 1ZBQA 3AUJB 4R1PA 4ZU3A 5JVDB 3LUHA 4R5MA 2MSCB 3ZH9B 2VTKA 4BLQA 5AHKA 2DH5A 4EHJA 2G0AA 1XJQA 3JRNA 3HJNA 4R8SA 4UVEA 4FWBA 4QQRA 1KO1A 1XRJA 1QHGA 3OWXA 4Y2RA 2P9ZA 4IV0A 3UUWA 4ARAA 5HRAA 1V1JA 2CNOA 1V5GA 1NM5A 2BTQB 2EWMA 2ECPA 2PZLA 3FOBA 3FWNA 1VMAA 2YJ4A 2HLDD 1ABFA 2CLHB 2PVSA 3G23A 1MORA 3WISA 1ZN8A 4RIFA 3ZY6A 1CJKC 5EJMA 4BB6A 3ETCA 1N8SA 4JP2A 1UZMA 5TDHA 3IAM1 1KPHA 4UMDA 3WICA 2VVTA 5EP4A 1EDDA 3CF2A 4FQ5A 4DILA 1ODFA 2GXQA 3RPEA 1O6BA 3H04A 3AHDA 4BLOA 1YJ8A 2JI7A 4LZZA 1W49A 1IN5A 4V3CA 5E3IA 2YWEA 1FYEA 2NADA 2WP0A 4IMPA 1I7DA 1M0WA 4NCNA 5ESWA 1P39A 1R6UA 2IZ7A 3F8SA 4M0FA 3A6KA 3S1AB 5J43A 1B74A 3AF6A 4EOGA 3EVFA 1HL7A 4CHTA 1EM8A 2OKCA 5BRAA 1SXHA 3OY2A 2JHAA 5ULLA 4C43A 2DHEA 4MVJM 1S3IA 4E5MA 3T9AA 3VO9A 2TS1A 1IQ0A 3GQBA 4I9UA 5C3MA 4RJTA 1TAQA 3AIOA 3CRQA 4Q4JA 1PJTA 4EX6A 4WERA 2Z2IA 4IJQA 4OP2A 1KOFA 4DJDC 4YHHB 1SC6A 4YP7A 1XRPA 4BVAA 3QPBA 3QXGA 3R0VA 2Z2YA 3LUBA 4FLMA 2A1TR 4KZPA 4WVFA 2D2VA 2VJKA 1A04A 1SD1A 4HGQA 5KZMB 1J0XO 1ECCA 1HY3A 2VWGA 4WDQA 1S2NA 2WD7B 5DGDA 1R37A 3U40A 4G0NA 1X1EA 4RTNA 2PMCA 2SECE 3L3BA 5BW4A 4DQXA 3G5UA 2GDJA 2O0KA 3K0FB 3TFWA 4K2HA 1J2UA 2V97A 1XXHE 4TTPA 1IRIA 3Q8MA 4XI9A 4V0MA 1X7DA 3AB8A 4ALNA 1JA9A 4KHPB 1PWEA 1G3QA 4K9SA 3V9PA 4M0KA 3M4NA 2B94A 2L42A 3BFVA 3SFVA 4EG7A 4DCOA 3E81A 4IDGA 5TVGA 3AR6A 1D4ZA 5EYPB 5A5FA 4P36A 4LHVA 1VKOA 2VDVE 2FF5A 5ALEA 1JP7A 5FOVA 5TIIA 4IDQA 5ELLA 4BAUA 1Z13A 3BE8A 4HDKA 5L6MB 5H82A 3S2FA 1QAMA 3JATA 4G0ZA 1CZKA 4GXNA 4E0FA 1GN8A 4BCBA 2J9FB 1KJZA 4NMMA 1W19A 4ZK6A 1XCGB 1DBQA 3GN1A 3OC6A 2IYOA 3HO8A 3RABA 2XJ9A 4C1NA 4CPDA 1TXGA 4HI0E 3GFGA 3ND6A 5CH3A 3FIJA 3VM6A 2IE0A 2GD0A 5HK9A 3H5NA 3K9HA 2RKOA 1U3UA 3BH7A 1E2FA 4KV9A 3LVQE 3VAAA 3VMMA 2HTFA 5AW6A 2V7XA 4U39A 5E6SA 1JYFA 4NR0A 5IZCA 3WL8A 1ID8A 2NUTB 2V9ZA 1Y1TA 2YV3A 2B8TA 4TKOB 3A6HA 5T4HA 1WUTA 4JJ8A 1E89A 1RTKA 2WJWA 2Q5HA 4DR3B 2DFLA 5MN6A 3U4AA 4BVHA 1VM6A 2O5RA 4Q7EA 3V3TA 1OC4A 2HDOA 1Z68A 2OSBA 2WAXA 3E7PA 4KQ6A 4YGXB 4FB4A 1U5BB 3OA2A 5HYVA 3CCLB 2Z3ZA 3GT3A 4DMLA 1XZKA 1JMVA 1JH8A 3ZV6A 5J2UF 1FSPA 3G1WA 1ZCZA 4QKQA 1GFIA 3SM3A 3ZTTA 4EKIA 3OPOA 4QPZA 2OAQ1 3L04A 1DKOA 3B9BA 3W4KA 5BWCA 2R25B 3E8MA 1CUEA 1PAUA 2OQIA 3D5TA 4QXOA 5EIOA 1KKLA 3LY7A 1ZVKA 3L1IA 2OE2A 1P6XA 1G63A 1RP7A 3VHRA 1MZVA 4WCDA 3V00A 2BSQA 4LAFA 2OOKA 2DTDA 5IVDA 1ZLXA 1OBCA 3DDWA 1PDOA 2XADA 5BWMA 2DJ5A 3R9XA 3KOZA 5F1OA 3OIUA 2JD1A 9LDTA 5MN4A 1FW6A 3HL0A 2BHNA 1K0FA 2CGEA 3MCWA 4G6IA 2D5AA 5COQA 5DK6A 4BMNA 1KA9H 1FY2A 3GU3A 2WJYA 1J2TA 1Q21A 1UXGA 2NSYA 4ITVA 4LMRA 2E5WA 1V9LA 1M2WA 2NXCA 1BSVA 2NZJA 2HV8A 1KJQA 4LJ6A 4M22A 4OHBA 1F5NA 4K6MA 4AG3A 3KETA 1N7HA 1TJYA 5B1SA 4JY7A 3H2GA 3RTBA 2FCRA 3REOA 3W77A 5A4IS 2X85A 4JJ7A 2ZYRA 3NV7A 1EUDA 2A1UB 2QUJA 1II0A 2R8PA 3I0ZA 5LYJA 5ERGB 2E6KA 3L0BA 4N5LA 2GEVA 5T3UA 3NHSA 1ESDA 2AI2A 3K20A 1BXRA 3K05A 4RDXA 2V7UA 4WK4B 1JG2A 1JIIA 1C2TA 3L4JA 2TMDA 2L0XA 2YDXA 1JB9A 3CKMA 3T5GA 4XDYA 4HK4A 5CLIA 3R0ZA 4A73A 1NYLA 3MB5A 3U61B 2G17A 2BRUC 3HG7A 1OYOA 3LT0A 1XROA 4MDHA 3HCDA 1HPLA 4LMPA 4OHVA 5KTOA 3IBCA 4MUBA 4AG6A 3CRW1 3DZFA 1H2WA 2OM6A 3WLAA 4AJ1A 1ZJJA 1QONA 3UV7A 1WUYA 3WQZA 5FI5A 4C4AA 4XLEA 1C4OA 2QTCA 1GP2A 3IXQA 5HKOA 5KYKA 5K0SA 4YB8A 1DINA 5A6SB 4OLAA 4EKGA 4B6OA 1M1XB 1VLHA 2OBMA 1KBQA 2QZZA 3EW7A 5LVAA 2YJNA 1Z39A 2DBVO 4Y6SA 3WYCA 4OJMX 1V11B 1X94A 3E61A 4J90A 1S4MA 2QMHA 4XFKA 2BGKA 4BRUA 1ZOIA 4BOYA 3ADKA 4FGLA 2JH9A 4D3FA 2PGOA 3D5EA 1PTJC 1VZ3A 1KR5A 5K6AC 1ST2A 2R8BA 4Q1BA 3TW0A 3LOQA 1LH0A 2EWWA 2H2WA 1X77A 4ZD6A 3S2ZA 4LIPD 5DHSA 3K9FC 3OQOA 1ULBA 5LUBA 2R1TA 2HSZA 1GKKA 1R9NA 2CUZA 3O4FA 3ZV5A 5KTSA 1WOPA 1PJ4A 1SOAA 2Y1EA 5ALKA 1B2LA 1TE2A 3KLMX 1P4RA 1UPFA 4PR3A 4DG8A 4J7AA 1VXOA 3GJSA 4MYHA 4ZOCA 4URFA 1QIIA 1JIKA 2JFXA 3WZLA 3KZNA 1G5QA 4UM5A 4EJ6A 4HFMA 3O8DA 3PGXA 3Q72A 4MVJI 4PZ0A 2IV7A 3WP0A 3C5EA 2BJHA 4LXQA 1UKCA 2VTBA 1E64A 3WIUA 1D9ZA 1DTEA 2OUIA 1GRQA 4WLNA 4ENSA 5LP1A 1PNRA 2HXYA 1K8YB 2GZRA 5JPIA 1A1SA 1MAHA 3GY0A 1WNFA 4JQYA 2ZRHA 4MP3A 3NHBA 1QHYA 3OCXA 3CG4A 4YRDA 2YWFA 3JQ7B 4KBYA 5DNWA 5KVVA 1M10A 3D4BA 4NKRA 1HE8B 2ONJA 4LF4B 4AJOA 1CT9A 2XSZD 5JYDA 1G8FA 1KAQA 4HB4A 4NCAA 4EAAA 3H5AA 4NIMA 3W1EA 1J8MF 4K5QA 3WK4A 5DJ5A 2J3QA 2PS3A 4HFNA 1TYAE 4NYMQ 5KINB 2APJA 1QTQA 4HNHA 3DEZA 3PUIA 2MYPA 1VL0A 4WEOA 3UT5B 4M1YA 1P4GA 1OILA 4ARUA 3VOTA 1JDNA 1MOPA 2FSVC 3CE9A 5IDYA 1EBUA 1Z6QA 1N36B 3DZGA 3TL6A 3A3GA 3H2YA 4NRDA 3TLGB 3AXTA 5HJ7A 2ZREA 3VPBA 3KDSE 1WPXA 3PU6A 5CXSA 2DR2A 3FKQA 2CVHA 3KQNA 1EFHA 1Y89A 1QF9A 3MCTA 4N39A 1REQB 1UKYA 3LC0A 1V43A 1RQGA 1MENA 3HWX1 4UTPA 1IY1A 3S2GA 2KB0A 3UK0A 1DAOA 4MARA 1OWMA 1C9KA 3Q2IA 3TNJA 5JASA 4ZYYA 2XKBA 3TZ6A 1C0LA 3BA1A 1KK3A 3JQ8A 4ALJA 3Q6NA 5ITWA 3NHPA 5HQJA 4NU0A 3U7EB 3VH2A 2CYAA 2FEWB 1N5LA 2I76A 1JG1A 3FTDA 4UZEA 4IDCA 5DMHA 4ZKEA 1MOQA 3VC3A 3IALA 5BNTA 4YBRA 1HMPA 3DB2A 3EPRA 1F8XA 3KZKA 4IAOA 2IXAA 2ASVA 1VPEA 3ZJYA 2HBYA 3FR8A 4B44A 1LRKA 2HNKA 4WNAB 1IZ0A 1MTOA 1UK9A 1YJCA 1XVVA 1BH6A 4KFRA 3SEQA 2PJRA 3NKFA 2JFBA 3ESDA 2Z5GA 4EKEA 3U60B 2W90A 2JCXA 4JASB 3LOUA 3NX4A 2QN9A 4Q47A 1I4EB 4JI8B 2F3TA 3PKJA 1NW8A 4A27A 3W2FA 1AX9A 3DHYA 3KWLA 5C7LO 2VBFA 3Q38A 4GICA 2ZZFA 1NULA 2IOHA 3NNNA 4O2RA 1RLMA 3K09C 5D5HA 5KNBD 5IKMA 3UXYA 1CQIA 2KJQA 2EFJA 5CFMA 1GKLA 4X7FA 2AR7A 2CNNA 2VDRB 4LTMA 5KYVA 1EXDA 4GC5A 5B6PA 2YZNA 1B8OA 2GXUA 3BN3A 2JA2A 2Q4OA 3PWSA 2AI3A 4J3JA 3DA8A 4ECEA 4DTCA 1JHXA 5DTRA 4HH4A 3VU1A 1XLTA 4UBNA 1P6UA 1USWA 2BRUA 4X1YA 1ZK2A 3HCEA 3VC1A 1XA0A 2F2TA 2WHPA 2J0SA 1JX6A 4LDJA 1DJMA 1XHEA 3EFHA 1FZTA 3GEEA 3C5HA 3COWA 2REQB 2WJJA 4U2GA 4PLFA 4GMHA 3PHHA 4ROSA 1UXJA 1ZGJA 4MS4A 1HNNA 3ANMA 1S8NA 2GB4A 5AIBA 4QUJA 5ALGA 4N6OA 1FQKA 1N1MA 4KO4S 5TB5A 3TSYA 1CF2O 3PDIB 4G5XA 2IYUA 1L5MA 5JZMA 2PL9A 4MV4A 5ESRA 1HOXA 1G64A 2JH8A 3KVYA 2I3DA 3OX3A 1G20E 3RTCA 4ENRA 2V0CA 3N7UA 5K45A 4C0BA 3Q9SA 5A2GA 2OBSA 3LVFO 3I9LA 2IIPA 2A5JA 1KH1A 2AMYA 5G1PA 3WO0A 3EIHA 3UMSA 5CJPA 2D1RA 2O07A 3I2YX 1H8ED 2H1HA 3KBBA 5EE5B 4N47A 3QX9A 3S7TA 5DN6D 1PL6A 1H8HA 1QBKC 2AC2A 5FO1A 1DQZA 2JI8A 1RBZA 1J24A 2VK2A 4A16A 3H4TA 1DAEA 2ZSFA 3ZCTA 3HAGA 2NAPA 3E48A 4ZVRA 5KSPA 4AO6A 4YCCA 1OROA 3UGTA 4IHJF 4C0QC 3D7NA 1VIMA 2ZTGA 1ZIDA 2GPYA 3B1JA 2VHJA 3WHPA 1NWCA 3JQGA 5K6TA 3SX2A 1UODA 1F4LA 1KRHA 1XMPA 2FG7C 3SVZA 3IKMB 3L6CA 2PX8A 4CCAA 2XT0A 3HU5A 5AI6A 4BY9E 1GKYA 1TGYA 1OXKB 2AW3A 1CW2B 1P4JA 2BGUA 2H08A 3AY6A 3MXOA 4BO4A 5FWXB 1Z6GA 3WFJA 3RSCA 1JR6A 1S9DA 2GCOA 4Q34A 2Z2JA 1P81A 2IXTA 1UPXA 2NQ2C 4WX2B 1BLIA 3KZXA 4P3YA 1A71A 4BWVA 3IO3A 1SXJA 2IOQA 3IVMA 4H7IA 3AM3A 5JSZB 1FBTA 5KTMA 1UMDB 1UFKA 2A3RA 2QYHA 3NBMA 5H16A 1J8QA 4DJFC 1BDMA 3V2IA 1KYWA 1ZJZA 1PNQA 1X8JA 4BO3A 1ML4A 2PANA 3FMPB 4WESA 3NWEA 5BSYA 4GAEA 3ICCA 1Q9SA 1V2HE 4MQFB 1OLXA 1TA4A 3NP7A 3OW2B 4OIMA 1H0HA 1FDWA 2HA3A 3THXA 3EC1A 2XYHA 5TGTA 1YI1A 3THOA 3BD8A 1GPDG 2CUNA 3EOAI 2OC9A 4TZTA 1TD9A 5K1ZA 1Y9ZA 4DSNA 2WZCA 5ELXA 2IXDA 4UAJA 2BFCA 2QTHA 2DETA 2C7BA 2DX7A 2QUIA 2DULA 3P2OA 3DOIA 1K88A 2A7QA 3QPUA 5JSUA 4Y1RB 4GP9A 5EMLA 1GAJA 1L7QA 1X9IA 4AD8A 1Q16A 4OHCA 1X7YB 2QMQA 4ND6A 2HMSA 4PSDA 2RHGB 3AH8A 5K5EA 4KVZA 1N2CB 1DB3A 1U8CB 4HN4B 2ZE5A 4X71A 2CLLB 4UEQA 621PA 3H2KA 1XNHA 2WSSD 4P3IA 1NLZA 2OHHA 4H08A 1L5VA 2NSHA 2PUVA 4RNDB 5HFNA 4DRXB 1MEEA 3AILA 3I45A 4MV9A 4NMLA 2EYUA 5K51A 2MCFA 1EGAA 5ES4B 1C7JA 1XDUA 3DR3A 3BMCA 3OEWA 4GWLA 5EWJA 4IDHA 3V33A 2J4FA 3ONEA 4AJEA 1OAAA 1I7NA 5A4AA 3KQUA 3NVKI 1ZAYA 5CCXA 4K03A 1Y0YA 2FQXA 1P2SA 2H1RA 4L8WB 1Z12A 4JR2A 4KWIA 5ALVA 2V6GA 5L7TA 5SZHB 1GTL1 2F4VB 1O08A 4FYXA 3J7TA 3K2EA 4B6EA 4D8TA 3LK6A 1JVNA 3U31A 1PU2A 4N8SA 1CU1A 3PEFA 3OTHA 1YZYA 2JAHA 2SCUA 4D96A 3TW4A 4EFKA 4EGJA 2BKUA 3FOZA 3OKXA 3NWJA 4FXOA 3ZD8A 1N2BA 1KL7A 2PJZA 1HMYA 3OLXA 1WSDA 2ENUA 3D9QX 5I7OA 1AT1A 4OX9B 1GYPA 5JD6A 4BGUA 4XEHA 3HWSA 4C07A 4RBNA 2B7BA 5ITVA 1RZUA 3VVBA 3U3ZA 3SSMA 4ESHA 3PNLA 2DPHA 4NCIA 3JY6A 5IK2D 2AZDA 3CTMA 4DBZA 1D8AA 1D0IA 5AKZA 1Y6GA 4CF5A 4DL9A 4PO3X 4TXMA 3OZXA 2IHNA 4P2GA 4FBGA 1J25A 2HJWA 2R48A 4AMYA 4MR7B 4JB2A 1JECA 1IY0A 4GZLA 4L3WA 4QVKA 3VU3A 1WW8A 4E5DA 4A9AA 2H18A 1GR0A 3QF7A 3AINA 1T9GS 4ZMSA 5E8JA 2YVQA 2HUPA 3M3DA 2ZVJA 4MDEA 5DLPA 1KYXA 3EXEB 3R3ZA 1C1XB 2IXGA 2ZULA 5GZ6A 3WLOA 4D81A 3ISTA 3LNCA 2OLJA 3T3IA 2R5FA 3G2JA 3PC3A 4JLSA 5DSXA 3B3GA 3PUWA 3G49A 2VF2A 2UZAA 5K3EA 2FUG1 2O3UA 4ABTA 3TE6A 1E1CA 1K63A 1L5SA 3NAMA 3AVTA 1C80A 3H9QA 4MEBA 4YC7A 2PV0A 3T7IA 4ESOA 4R3WA 3T1OA 1OAOC 1WMBA 4WN9A 1C0EA 2WDZA 4BZQA 1I14A 3IR6A 1USIA 2GBLA 3DGEC 4G9BA 1JLSA 3RH0A 2X77A 3PFBA 3SBDA 5H83A 1ZRHA 1TQ6A 2XUHA 1J90A 1NLMA 4UNNA 3NANA 1WXWA 3PUMA 1YAJA 5ENVA 5GVRA 2Z6UA 4AP9A 2TYSB 3NALA 2QB5A 3RAJA 2YMMA 4KRFA 3M6FA 5J40A 3RVKA 3L0CA 3SD7A 4ZYWA 2P3SA 4CF3A 5AJZA 3KQWA 1NKVA 1VGRA 1GUAA 4X85A 1E6UA 4BTVA 2SKEA 1SUWA 4LJAA 4G67A 5AHRA 1KMIY 1OX4A 4JHXA 3T3PB 2PMBA 4ENQA 1IAVA 1ZU5A 3GD5A 3HBLA 1NUPA 2QXUA 4NVRA 5EI5A 2NO5A 4TQAA 3VSAA 2GBPA 5BN4B 2JAWA 1Y7HA 3D8HA 1LUAA 2WV9A 1N1DA 3F6RA 3QKIA 5J2UA 1MFPA 3P0IA 4J3NA 4JKYA 4Z86A 2CMGA 2CWDA 3G7UA 1IULA 4K05A 4KGXA 1TF7A 2XNJA 4ITRC 4LJ4A 3L7MA 2YMPA 3ZG6A 4OHMA 3OJLA 4BNWA 2W2VA 5JW6A 4EL5A 4W9NA 3A06A 4IFEA 3D2CA 3UAOA 3E20A 2H11A 3Q7EA 4IDNA 3JQPA 1X92A 2REXB 4BFXA 4BPBA 2AOWA 2PZFA 2VXBA 3ZDRA 4PX5A 1PKEA 3A6FA 1E6CA 4ZA2A 3JQFA 3WDKA 1E2JA 4GPIB 4YRPA 2PSSA 5ECYA 1V2GA 1NVDA 3H3XA 4M1KA 1TMYA 4RFVA 3L7DA 4J75A 1F2VA 1Q7EA 4XGNA 4EY8A 4XX1A 3MYYA 3ND8A 3LQEA 1CDEA 3AVWA 1UQUA 2I3BA 4IQ4A 3RUEA 2QBYB 1O95D 2AA3A 1SVSA 1GYQA 4RMHA 1XZMA 1JSXA 1R1DA 1ODIA 3D54D 4MQEA 3NUGA 2H54A 4DQKA 1XNGA 1RQLA 1F2DA 3RAFC 1R0BA 3GUHA 1OYVA 1RBYA 1OFHA 3P9NA 3T7EA 4FC7A 3WA7A 5J3JA 4BO7A 4FYVA 1PUXA 4FSXA 5G4LA 3TIIA 1J6UA 1CTQA 5FEUA 2DCUA 4W82A 4WTOA 4Z49A 2VZEA 3C3AA 3ZD9A 2X7JA 1HYQA 3QHAA 5COAA 4BU1A 4P22A 3FVQA 2FHSA 3MT9A 1IC6A 1U3GA 2V74B 4N82A 5D3MA 4ZFNA 2HBZA 4ZQEA 4EHLA 3PPXA 4OB6A 3RBAA 3COPA 1XB2A 1ZIPA 3PRJA 1BXGB 3JWGA 1G21B 1GGEA 3G9TA 4M6WA 2AFRA 4MQUA 4XR4A 3CC8A 3R3UA 3A0RB 2I2FA 3ZWCA 4CMIB 4BVJA 2ZSJA 4IQFA 4GM0A 4GRDA 2IOYA 2EARA 3GJQA 3QENA 1Y7LA 4ZVQA 2BMDA 2M1XA 2H4FA 2AYZA 5FCDA 3A2KA 1CULC 1O6GA 2RH9B 3BL8A 3DBRA 4HP8A 5IAJA 1U3DA 2OR3A 2XBUA 3UV6A 4HWRA 1E1MA 4FLFA 4KQXA 3BEOA 3HA3A 4C0AC 2XZTA 4JHLA 1ZRMA 1XQ9A 3GFVA 2ZAGA 2ZOSA 3VZQA 4M0EA 4M36A 3FSGD 5IVPA 4OXYA 5J58A 3W2IA 1J5EB 2FPMA 1K5DA 2IOFK 2FOIA 2VJOA 2RHWA 3E9EA 1E1QD 1PLLA 4BB0A 2FGKA 3OZEA 3QU7A 3NOVA 1Y9AA 4WADA 2NV0A 7REQB 4LQ4A 3AJRA 3GBSA 3GLVA 3C1AA 1L3IA 1P17A 4EA6A 2C9ZA 2WMDA 1VLMA 1GEEA 2E1RA 2ZI7A 4FHGA 2AE2A 2ZYAA 1RKBA 4UUNA 3OLQA 3QBJA 1SBCA 4P4SB 2Z2ZA 3U3DA 2FPOA 2ZIFA 1L3BA 2I2AA 1DRJA 1BJRE 1O6CA 1YB6A 4C5CA 4CCYB 1SUSA 2EHJA 3OZAA 4R8KA 1DUVG 3CPSA 3D4OA 4WECA 4ENTA 2GN2A 1Z4PX 4BFSA 5TLSA 3JD3A 2A0KA 4NG4A 4ARVA 5ARBA 1N78A 3PA2A 2H4ZA 4BFWA 1E5LA 2EBFX 4O08A 3VAYA 5G4KA 5AW4A 1M90D 2RHMA 3LX4A 4W8HA 2XGGA 1JKJB 3TI9A 3BH0A 4GR9A 1JMYA 1S1CA 2AFIA 1F9AA 3E4DA 2CBXA 2WTBA 1WMSA 2LIPA 1SIOA 4ILEA 3QX8A 2WW8A 4HX2A 3UGQA 1L7BA 3HHPA 1B0PA 3ZVLA 3L8MA 2ILVA 4EARA 4XLZA 3NBUA 2C00A 3Q3IA 5CU7A 5AWFC 4M2LA 1Q77A 1F5SA 3EQ2A 2ZYSA 1X7HA 2C8VA 1D4OA 3FSRA 3ADPA 4PQEA 2RFLA 3L8GA 5CYPA 3TS1A 1GZ7A 1J9EA 2QQEA 2V8OA 3CW2A 1T9KA 1TEZA 5FL7A 2VRNA 1H2YA 1VQPB 2JCSA 5T3YA 2OORA 2RCYA 3LRTA 1Q2UA 4Y98A 3U44A 4E33A 3M6AA 4BLWA 5K0EA 1LFDB 4DB2A 1TW2A 4XWWA 2YN2A 3IKVA 4ZOLB 5DOVA 1IEVA 2JRCA 4IJ5A 4URUR 3UWOA 3JZAA 1L4KA 1M2JA 5GTDA 3RS8A 1XA4A 4P3PA 1XA3A 1U8YA 1MOZA 1T8PA 1RQXA 3E5MA 3P8ZA 4YDHB 4C3ZA 2NVUB 2GMWA 2AOUB 1QVRA 3EGWA 2A9PA 4CR8A 3SSAA 3HRHA 4Q4HA 4MPDA 2IDKA 3BK2A 4X8MA 3G9UA 4K88A 2MMGA 4B3BA 4KIGA 4EG0A 3PI7A 4ZAGA 4IW3B 4J7UA 2IYEA 4RD4A 4YRBA 4I4NA 7GPBA 2J45A 1QX3A 5A5GA 3A14A 3ZW8A 3U1BA 4HKTA 1OASA 3GGJA 3IV6A 5I7AA 1VYVA 3X2EA 1M66A 2Q3MA 4HVTA 3S99A 1FA9A 3HPRA 3L7NA 3ZHYA 4ZI7B 4JJ6A 4CMCA 3L7CA 2O8DB 3UJNA 1PCXA 4KODA 3KZMA 1GPLA 1Z3IX 2QLTA 3WL3A 2J33A 4JBHA 1KSFX 5JFOA 3DYIA 1E2IA 2X0IA 1VI5A 3EIEA 5CFOA 3GJ6A 4TQUS 3KYDA 5AW2A 4OUKX 4P2BA 1YONA 2EZ8A 1NI4B 3P19A 3F4KA 4UM9B 2K2QB 4UQOA 3GH3A 1OH5A 3CC2B 2AEJA 4F71A 4ZVMA 1ONPA 1CNMA 3CUSA 1YRQA 3ETLA 4BWGA 4E70A 1U0RA 1JSZA 4YO8A 3C8UA 3D7SA 4C0KA 2G88A 2Y77A 3HBAA 3HRIA 1NPYA 3I6YA 3WADA 4B0PA 2C2XA 3F6CA 4EDFA 2R8EA 5I7WA 3R5HA 2GJKA 4GOXA 3AHCA 5EFZA 1G42A 1XK7A 3FGPA 3MBIA 3JRWA 3S5JA 1Z34A 3ABIA 3O3MB 1F20A 4D5GA 3OZRA 3L8EA 1PD1A 3LT5A 2XHEA 3C16C 4FNMA 4QBHA 4UHFA 5DOZA 3RF7A 1OFUX 1AKEA 3GC6A 4J6EA 5FPTA 2D3LA 1XKQA 5DCLA 3CWZA 3F3SA 3TTUA 1YE5A 2O2YA 5JPDA 5CK4A 1SBIA 1WMAA 1X0XA 1FNCA 2BFAA 1G9TA 2HZBA 2X0NA 2VJMB 1Y63A 2YIDA 3GRFA 2VWQA 3QPDA 3K0CC 4G8DA 5I7VA 4DV4B 4I5EA 2E4VA 4CIYA 5KAMA 1JHDA 2J0UA 1U4NA 2IV2X 4C7JA 3I56B 2A9RA 1ZA2A 2HMVA 3OPQA 5JY1A 1O8CA 4IF6A 1JDSA 3WYGA 1F4VA 2EFGA 1PQPA 3CRRA 3H6KA 4NEQA 2HNAA 1RLOA 4IHJA 4OMDA 2YZ7A 2Y99A 3AB7A 3ESQA 3HBJA 1MRSA 3E9NA 4PSCA 5DT9A 5DNVA 3FPEA 4RLSA 4B45A 1HGXA 2N75A 1OU4A 2B6HA 5DDIP 4L08A 4EHNA 3GVJA 2F1KA 5BQFA 5GZ3A 3F6PA 3RG2A 1DBRA 4PFKA 2AKYA 3BHMA 2OPHA 2H7CA 3QVLA 3S2YA 1BU8A 3LYHA 1PT6A 4JDPA 3QXCA 2YWHA 4EITA 1I94B 3FYDA 1VCIA 1YSCA 3N8IA 5JTUA 1VYHA 1W581 4GYJA 2FETA 4ODIA 5KNCD 4D2IA 3GLGE 4IXMA 3G1UA 3UYLA 3TINA 3QVWA 5B64A 2AFHE 2ZYGA 2WNIA 2DVMA 3N6VA 4BNXA 1GQ2A 4TGLA 2JLXA 3KS9A 4GWKA 1DFHA 1I4WA 2JKYA 4PNHA 4MW4A 2PJUA 3TM4A 4JI4B 1FYXA 1XDZA 2GHTA 4L7VA 4NNPA 4NOLA 3TCNA 4M0LA 1ODCA 1QG0A 4I6EA 3VNBA 4BQEA 1DC3A 1SVLA 2HF9A 1UBNA 3KVNA 4RMNA 4QYWA 2ZZEA 2QLBA 2VT6A 2CHEA 2YHIB 2ZBPA 4G97A 1AZLA 3I72A 4KAFA 3CBGA 4KIWA 5BT9A 3ONUA 1N1EA 8OHMA 4JB0A 5ENZA 3OMXA 3OI7A 3ABRB 2P9GA 1C0KA 1XL1A 3AXSA 4BLPA 4NLLA 4YMUA 1M34A 5MDHA 3F4LA 1JRLA 2O57A 2O6HA 3D7KA 4E94A 5IF9A 3FOCA 4JGBA 3K70D 4KQGA 3MJVA 4AKHA 2W6JA 2C2WA 3GGOA 4YUWA 2Q5CA 1ENPA 3X43A 3BL6A 5SYNA 2GXSA 4LY6A 1U0BB 2J5QA 4D4KA 1M1ZA 3GA5A 1C14A 3NIWA 3QVSA 1HLGA 3LG2A 3WHLA 1M1YA 4ZJUA 5IMSA 4QATA 3OT5A 1W85A 2PQMA 2YIMA 5DI9A 3ZGVA 4HPWA 1AHPA 3OIVA 4OOXA 2G7ZA 3DVRX 1U9JA 1YNSA 3GIRA 1KH2A 3HK2A 4QUBA 3QLTA 1M2FA 1G0OA 1WBJB 1DKNA 2J3DA 1IXZA 5DEIA 4JL6A 1J00A 5DV9A 5GOZA 4L73A 3T1NA 3VNSA 4ZYVA 3ZDCA 4B7XA 3TIGA 3TKAA 2NO6A 4R68A 4XGRA 5D5PA 5SY4A 2O8VA 3SHQA 1PJLA 1M0TA 2AQ8A 5LPNA 1LFAA 2BTQA 4ZRMA 3F8TA 3PYLA 4A2WA 2FSSA 2DH6A 4L5IA 1HTBA 3VYWA 1U0NA 3KELA 3L0IB 4YIKA 4QYTA 1VSUA 1F4PA 2F64A 1H23A 1QCDA 3Q7IA 4PLTA 1WD7A 2FG5A 2RARA 1KJIA 2ZCUA 3A1PA 1A9TA 1JI0A 1L4GA 1YCHA 2BP7B 3Q11A 3D3KA 3VGPA 4DIOA 3OZFA 5SZJA 3VISA 2Z1DA 2WJAA 1ZH8A 2XB6A 3HV0A 1J09A 3IPCA 1X9GA 1UWCA 1WM1A 2QTGA 3EAQA 5G3ZA 1SAYA 2HJRA 3A37A 4CFSA 2NTYC 1QXSA 2G63A 4BNKA 5JZOA 4E2YA 5LDGA 3S1AA 4Y9TA 4I9NA 5J5VA 4YMVA 2ANCA 2P4UA 1RLJA 2H1SA 5CDYA 1MAUA 4KKXB 1F6DA 3PXCX 2XUDA 1ODJA 1USKA 1CNFA 2CNBA 5H3HA 4LJYA 4C2TA 3MGCA 1U9CA 1UBSB 1LQ2A 2GERA 4PLHA 3S1SA 4MROA 4BVFA 1NQAO 4R71A 2YY5A 4RMIA 3ZJVA 2BWJA 2P27A 1T36A 4ZMBA 5AM4A 1TZBA 2WIAA 3WDLA 3KB1A 1BRMA 5FUYA 5JXJA 3WIVA 1CIJA 1RI4A 2YTZA 1GZHB 1IHOA 1L7PA 5C31A 1GCGA 4IJ6A 2I99A 4MJXA 4U02A 3WKDA 1XLWA 3B3QA 1ILWA 2QSUA 2RBEA 2V4UA 3A2NA 3DTTA 3E9DA 4LYDA 3UJAA 3B89A 1E9EA 2BDEA 2PZGA 2WD7A 4CMEC 3WAGA 4CXMA 4RHTA 4LYEA 4TRMA 2D3NA 5A5DA 5F9FA 4AMGA 4C6HA 4Z4CA 1EP9A 4RZXA 2A5FA 1UD8A 2A30A 4Q9AA 1FQJA 5AVSA 3DZHA 4R2WA 4ZP1A 3ZGXA 4RH3A 4S04A 5JNRA 3OWOA 1S5PA 1C4WA 2FZWA 1R9JA 4YJDA 5FLEX 1NQVA 2EL9A 1EPUA 1FDIA 4CQLA 2VPZA 3RVSA 1UDAA 2OFOA 5ICGA 1XEFA 2BCEA 1XZNA 4QEZA 3CSUA 3OPNA 3P9RA 4FT2A 4MA4A 3TMYA 3TQIA 3WJAA 4XNFA 2JFHA 1NNI1 3DZCA 2YCBA 3C41J 1Z82A 4XTCS 3SHFA 1MOSA 1Z2CA 3V4ZA 2RBKA 1HXHA 2YL2A 1X14A 2JLCA 1RXYA 1ARZA 2BV3A 2H2AA 3BIWA 3B9PA 2B7CA 4FOOA 3BQJA 1EQUA 4JLVA 2GWRA 1T2UA 1ISMA 2XA9A 3KPJA 4J9VA 3SE7A 4XN0A 2HRZA 1N0IA 4XDGA 3SHVA 1CVLA 2VYND 1LBTA 1VPTA 1XXHB 1MG5A 2W48A 4FCVA 1EMDA 4TSKA 1CFJA 1X0VA 1FVFA 3FYUC 3W9SA 2NUTA 3EUWA 3FYCA 4TOIA 4UM7A 2F1LA 4FS8A 1Z6AA 3UW3A 5GGXA 5HP4A 2VYVD 4PCVA 3ISVA 3WYAA 4WXMA 2PGAA 4YS6A 1IATA 4DIBA 4PZCA 1VQ9B 3DGFC 3UF0A 3AIKA 3O31A 2JGNA 1DDGA 1D6MA 2HXSA 4PPYA 1Y42X 3KDPA 3Q0TA 4RD0A 1U5BA 3GNQA 1IRXA 3AF2A 3SAJA 3OJOA 4BNUA 1Z6YA 4C4OA 2VATA 2GARA 4C20A 1P0FA 2MSLA 5F64A 1XQ6A 4NU6A 3OAAD 5F7JA 5JSFA 2XE6A 4WKNA 3EQZA 4L8GA 5EUCA 3UA4A 5IYZB 3TOXA 4X93A 4NABA 1XZLA 3EDOA 4IR7A 3MINA 2G4VA 4D4LA 3CN9A 3KL4A 1YU6A 3AUTA 2XB2A 2O7NA 3OP1A 4B1FA 1VA4A 3GEDA 4P4LA 2QYOA 5L3QB 2JJ2A 3IJ5A 4G4SP 5C46F 4PC7A 1VHTA 4RULA 3M1LA 5GMOA 3HU3A 1BOOA 1E3JA 1EK0A 1FTQA 3QVVA 3ZWMA 1AV6A 1BYIA 1SQ0A 4O4IF 1H22A 4JC8A 1I24A 1SVIA 4NDNE 4CLXA 5U9CA 5L3VA 4YUAA 4MGZR 1ZSYA 3OPYA 4OQEA 2P3LA 2IU6A 3GOQA 1MEOA 4R41A 3PTZA 2JDIA 3QG1A 3QEJA 3SBEA 1TK3A 1R7RA 2HCRA 3ASUA 2ZUCA 1N9ZA 2GRJA 1VMIA 2NYAA 1SZDA 2WUVA 3ABOB 1E2NA 3CUWA 4CEIA 5FTMA 4F2HA 1FXWF 2J9YB 3A36A 3DBLB 4UMVA 4HTAA 4QJBA 2WU4A 3H13A 4AN4A 4L5JA 3OCUA 5B1YA 2RGYA 1NYTA 2ZYTX 4I1YA 2OG2A 2Q4DA 2HDHA 1CK4A 1P4MA 2OOSA 4KFTA 2QPTA 2XMDA 2OVFA 2PMFA 2F3UA 2XV1A 3CH7A 3NHYA 4L0CA 3T4EA 5ALOA 1AK1A 1AS2A 1T5SA 3AC0A 3BWVA 3HUDA 5A3QA 2UZ3A 3F49S 1W1WA 1E2HA 2R00A 2FWRA 4YTEA 1ZUIA 4AKTA 3GHHA 1I18A 1PKVA 1NR5A 4TMWA 2P0AA 4HRVA 4J4BA 5JYCA 1NGSA 2A84A 3O7WA 5FFNA 5FNVA 2IEIA 3T5CA 1D2EA 3HSSA 5FI3A 5EJ2A 3HWWA 3EZGA 1Z4KA 2PPLA 4Q1EA 4R7GA 3UB2A 3U9LA 1NXPA 1E8DA 1MO5A 1RI3A 1NW3A 2ASEA 3T0FA 2XNDA 1GGKA 1YBAA 1XN1A 4C6RA 3DONA 2OZLB 3O75A 3BWEA 3CEMA 1S2MA 1W30A 3R6GA 1NBAA 3RVBA 4QPNA 1MKYA 2YJ3A 3INRA 3QITA 1Q0RA 4U00A 3AJ9A 1FVXA 1V11A 1FX0B 4FFSA 4XYGA 1MQSA 4DCGA 3IT3A 3O8QB 1JDUA 1N6IA 1WSVA 4O3MA 5HWSA 3EXHA 3WMRA 1WF6A 1NXVA 4L07A 5KNDA 3UPUA 3MB8A 4XUEA 3RRZA 3WGQA 2Q6LA 1I2BA 3GJ3A 3S8MA 2C5AA 4Q1DA 1DJLA 4QLOA 2XQIA 1DAHA 1RLIA 3BM5A 4ZPJA 4PAAA 3RYHA 4ZHSA 3IP7A 3EPHA 2ZSIA 5B1HA 2EBHX 4Z3KA 1X15A 3CF4A 1U6KA 4HTFA 4GNRA 2HHCA 2Q49A 4B81A 1OLUB 3L41A 2OHIA 3JZDA 4LHZA 3FVWA 2XGSA 4XN3A 5IK2A 5AI4A 4AW9A 5E2BA 2CF4A 3ECCA 5GP1A 4IGEA 2V7VA 1ONOA 1RYFA 2MINB 3H9BA 4JI0B 4FMCF 4MVJE 4MMZB 4I36A 4ZVNA 2JGJA 4MI1A 3TH5A 4B43A 2DYKA 4YV2A 4ZI3A 4NS1A 1QWSA 2X3YA 3MWGA 4JJGA 4Y1GA 1YKSA 3KQOA 4C76A 3JQAA 5KWVA 3HDJA 4QG7A 1JEAA 2R5WA 2P9TA 4M37A 5DHTA 4DSAA 5HZHA 2R2AA 2P69A 2VQ3A 4A2CA 4LZLA 1E2GA 3EWNA 4EB6B 5T5QA 5I5EA 3BWDD 5KYUB 1WEHA 2P7HA 5IXYA 1T0PA 4RGBA 3BX1A 3K32A 1IE3A 1GOTA 1ODSA 3VJMA 4DSOA 2BGJA 4CV3A 3R5TA 1UC9A 5A4JA 4L5BA 3W6PA 3ZWPA 2B61A 4AMVA 1T2NA 5JXGA 1FW8A 1IJEA 1I7LA 2RHDA 2OAGA 3AFNA 4R0NA 2UZ0A 1SKYE 5D5QA 5EHZA 2FXVA 3TLGA 1O87A 3P9PA 1VSBA 1JTFA 1TD1A 1SU8A 3G0BA 2IV3A 4D80A 1OWOA 4DQDA 4ZKDA 1FOEB 1OUMA 4HGNA 3ZS9A 3DF7A 4XJTA 1T43A 2VTEA 2P9YA 6LDHA 4AXBA 3P9ZA 1BDHA 4D43A 4EHBA 5HFJA 3W5JA 1JL3A 4JJFA 1QRAA 4RVHA 1SPBS 2XJ4A 4FFNA 4KUEA 4MVJP 2QY9A 3SQWA 3HKCB 4ZOLF 3I37X 1RRMA 4YASA 4URWR 1P3DA 1V4BA 3PPYA 1VLYA 2FMHA 2XDQB 4C6TA 3R8FA 4UHHA 3HU1A 2ATCA 1EWKA 1F1BA 1AKYA 2PL3A 3MJ4A 4IXNA 4NDZA 3BH4A 4WASA 1ZH2A 5DCWA 4I9GA 5K4HA 3U4QA 2BFFB 1ORIA 4RXUA 3IX7A 3JVUA 4WNAA 3AGQA 5DBFA 5IAKA 3RI3A 1KI6B 4K3VA 4GQNA 3KWFA 2P6OA 1AUPA 1M6VA 3E3MA 1LJLA 1NXOA 3H97A 2XZOA 2BGNA 3FUXA 1JEOA 4ESVA 1QQ5A 3R8CA 1BX1A 3P32A 1QM5A 2FK7A 3PRKE 5CD1A 1CG6A 1YI0A 2DUMA 2HI0A 3DHEA 2A5DA 1G16A 1ZCBA 3DHVA 1V5EA 3WNQA 4TYWA 2PZEA 1S2DA 5IYWA 3JQEA 4POOA 5IFKA 2XGJA 4OGWA 2VHVA 4I14A 2VKQA 4Q6WA 4M7PA 2H2IA 1YZFA 4Y6RA 5C8YF 1H9BA 5ITZB 3CKYA 1M1KD 1JLMA 2BFPA 2JLAA 3RW9A 4KR3A 3VO1A 5AK3A 3AP2A 1CZLA 1V3TA 3ZHUA 4E11A 5A3VA 3OCWA 4UZSA 1MF7A 3VR5H 1TZKA 5NULA 4WZKA 4R1OA 1G6Q1 1CUGA 2AFVA 1EINA 1NVUQ 1Z06A 2BSXA 3WBBA 3UJ3X 4OLFA 2UXDB 3BULA 3LUCA 1NVBA 2C96A 1UM9B 5TRTA 2O05A 1NJ5A 1Y9EA 1OXBB 2ZUFA 3A3KA 3I9V1 4QHSA 4M0UA 3V7YA 2PJDA 1FRFS 1YK1A 4EMUA 3H75A 3LAWA 1HV8A 1WV1A 4MZDA 4NE9A 5B1EA 1GLNA 1Q0PA 2DECA 4EZEA 4C7KA 2Q2OA 3VH4A 4XOTA 2BMEA 3IIKA 3KR1A 4PAMA 5K8VA 1A9QA 3GFOA 1VG1A 5LMZA 4XW2A 4UHDA 4CL8A 4KPEC 5JJKA 3WNBA 2IYQA 3DUFA 3HB9A 2VQFB 3HFJA 4NZZA 1P3Y1 2ZDQA 2XBLA 1MH9A 3AUAA 4U2DA 3JPWA 3V6LA 2WJPA 5G41A 1HURA 1WPGA 7MDHA 5BQ5A 1A9OA 1M83A 2OCLA 1CUUA 2D54A 4YJFA 3W04A 1Z5OA 3WL5A 4EG5A 5KKNB 2IHJA 3FBGA 1K0UA 3NV9A 1LLDA 4MR8A 1YJWB 1J99A 1A82A 1VE3A 3GL9A 3O03A 4JUFA 3DLIA 2EX0A 2OBTA 2ZTVA 5E9AA 1PIWA 4RANA 2VWPA 3L0PA 1BS9A 4EY4A 4BE9A 1V5WA 4J2TA 1G20B 1Y6JA 1O5IA 2YHUA 1GZ3A 1UBRS 1LBQA 4IWNA 4J0FA 5FWXA 2E2WA 2LCQA 3RYFB 3PL5A 2YXEA 4IVNA 3UN1A 2IVFA 4V02A 1R74A 1I0LA 1NF8A 1PG2A 1QLJA 1YRWA 4XLCA 4LCBA 1ZI6A 1NR1A 4BLUA 4GPEA 1H2FA 5JAZA 4ND8B 4Y0VA 3V2UA 1AGPA 2FHPA 1KMQA 3ANXA 4XM0A 4CJXA 4CYMA 1Y5IA 4OQLA 3VKHA 4RA9A 2H0AA 1JE1A 1DEAA 3IILA 3CO0S 3GV0A 3UJHA 1UMBA 4UOZA 2DG2A 4P7GA 1P0CA 2C5FA 2OCBA 4INZA 5ALQA 1T15A 3RUHA 4Z4ZA 1X1QA 4D8WA 1R9MA 2EP5A 5H4GA 4G0VA 2QR2A 1E2BA 4FKBA 5FADA 2HKIA 4BRZA 5A03A 5DSZA 5HUQA 2Q2QA 4IFTA 4LISA 3OOCA 4QUIA 5CLFA 2OK7A 2VP5A 3C5CA 1W47A 3AVUA 4QHYA 4REQB 2O7VA 1M9NA 3CVJA 1Y1RA 1DIRA 2JJQA 1ZD4A 2CCJA 2R6R1 4WXEA 1PVOA 1N2EA 4B8WA 3TLYA 2PH3A 3ANSA 3RK1A 4ZQFA 3R5KA 5E4FA 2C7OA 1WW2A 1KQPA 3HCRA 3WNZA 1QR2A 1QTIA 3DV9A 3K4HA 2AX4A 2NXJA 1K98A 1N2CA 4QAQA 4XFJA 3AV0B 4TKLA 4CMBA 1JE0A 2V3CC 2VWHA 1ZZGA 3NHUA 4NI5A 1K1EA 1AUQA 4D42A 1T8YA 2D6FA 1DG1G 1E20A 2I03A 4GVPA 5F7XA 1OBVA 3PZRA 4LF8B 1UJMA 4IWYA 3B82A 4EW1A 5I7HA 1TO1E 2EIXA 1WXFA 2RI0A 2WMYA 2XQVA 3D0RA 3E84A 4C4ZA 2Y68A 1X3SA 3KJNA 4OREX 4TUYA 1Z28A 4MHSA 3UFXB 4Z4YA 3LKDA 5GIPE 1WHTA 3JR3A 3P9XA 4TWAA 5BOSB 3EY9A 3MJRA 1UP7A 4W6QA 3ILVA 3LXMA 3W3AH 3WIDA 1OGJA 2R4TA 4GRIA 1WCYA 3I2IA 5C37A 4M1ZA 4OQPA 5ER6A 4RF2A 4EX7A 3TXXA 4LTNA 3ZIAA 1BH2A 1QVVA 1XTTA 1W4BA 3HN6A 2B1QA 2WINI 4DQLA 2O1SA 4RV9A 3U6BA 5EPUA 4XWTA 2PQ0A 1HO3A 2Y0PA 1I3MA 4Q21A 4JYPA 4MWZA 1G3UA 5JAPA 1SWWA 3HNRA 2WG0A 5DGCA 4ZCLA 4D0SA 3PCRB 3ZBPA 5J23A 2X41A 2RDMA 3AP1A 1JVBA 3R3XA 3MTDA 2RD2A 1BXZA 3LBIA 4M86A 4KRXA 2XXAB 1V8ZA 1LPNA 1T2CA 2ZQYA 1Q3KA 4MR7A 3UHFA 2R11A 3D6JA 4HAIA 1K7YA 3AETA 3LQRA 4HOYA 4EJ0A 1I51A 4KH0A 1XT6A 5GQSA 5AFSA 4BX3A 3A2MA 1MQ9A 5LB2A 5EXEA 3SXUA 4P0TA 3EYWA 5AKEA 1XKTA 2YIJA 1GD1O 1AU9A 2YWBA 3EXEA 3NR2A 2YUTA 3VHLB 3SS9X 4LZNA 1SIUA 2V1XA 2R7LA 1YJBA 3A9UA 3LCMA 4K8OA 1R50A 2CJFA 2RAUA 2W2OA 4MGEA 4C3UA 4BQOA 5BNWA 4P3NA 5LQDA 5BPHA 3DWGA 3LCRA 3MGAA 1EWTA 5JD3A 4US0R 5IDQA 2CHGA 2OHGA 4PGFA 5C2JB 2H0RA 2FWPA 4HZGA 2IYTA 3VNAA 2P4QA 3SYNA 4FFOA 2FR8C 5IRCD 4W1RA 1PVDA 1E0SA 1U8UA 2HHLA 4RM0A 3EZ9A 3PS9A 4L8FA 4RZUA 4K2AA 1ACLA 2YS7A 2HK9A 3QU5A 4KIFA 2HY7A 4ZO4A 1U8FO 1Z7WA 1N05A 1FMJA 1W25A 3OECA 1SKUA 4M99A 1TUBB 2BSAA 2IX3A 4KSCA 1WZUA 3T41A 3O2SB 4FCTA 3BSSA 3KVRA 2PT5A 1N8NA 3JYQA 1QHHA 3WXMA 2JVJA 5ESDA 3VR2D 4D5EA 1VB3A 3WLFA 3GFPA 2V3VA 4R2KA 1YZVA 4OK5A 1RRPA 3CNOA 1A5TA 1Q0UA 2Y92A 3D4LA 3QYJA 2Z6AA 3EZXA 5FBQB 3SYKA 1KVTA 3SEFA 3EFBA 4AYXA 1YKGA 4JLJA 1PJZA 4DEYA 4DY4A 2YR0A 3QKRB 4KG7A 4ZDIA 5ERYA 5CDGA 4D8XA 4WFKA 3PICA 4H4EA 4RDLA 5EP1A 4Y6PA 1SCUA 3QTTA 5A4MS 1GILA 721PA 4F2PA 1VJ1A 3TWOA 2F8MA 4QO8A 5CR9A 2DFNA 2XB8A 4F11A 1DAMA 1OHHD 3L0ZA 3SYRA 1TTTA 2O1XA 5E95A 2C7QA 2OB2A 5FQNA 3AVVA 2GFHA 3KJEA 5K9ZA 5K8CA 2C2MA 3C3KA 3L7JA 2W70A 1DC4A 1SBQA 2HMAA 4HQKA 1S2LA 2JVKA 3ZCQA 1O0CA 3VO2A 3SNKA 3SMVA 3TNLA 1EFAA 1XMIA 4DLTA 5KTKA 2NZ8A 3HKBA 4OGFA 4GE3A 1LZKA 5IYZF 4E3ZA 4JSRA 4O4IA 4QWMA 2V4MA 1XZPA 5CG2A 5BR8B 3TD2A 2BGRA 3B36A 3MJCA 4G5RA 2C4WA 4Z5XA 2FSUA 3LF1A 2FJ0A 5CB8A 5FUVA 2IDJA 3F5QA 5AQ1A 4UMFA 1KE1A 2ONKA 3OY7A 4KVGA 1VQNB 3JR7A 4LDQA 3FBWA 3Q3CA 4RVFA 1C8BA 1TTQB 1N3IA 2X9LA 4HNAA 3CN7A 1KFJB 1LC3A 3C6XA 4LHEA 1FFXA 5C4IA 4DQVA 4D4JA 1I6LA 2Q41A 3FX2A 3SFZA 2AXEA 2VF5X 1U7WA 1UDXA 3TRHA 1TGVA 2GVNA 4MUHA 5G0TA 2X8BA 4V0KA 1IU9A 1IHPA 1Z33A 3OTOB 1JQKA 4L95C 1SCIA 3B70A 4QEDA 4XWGA 3LIPA 3N3BC 3C87A 1CPYA 2RGRA 4E14A 5L4LA 1GG2A 3F4BA 2AW5A 4KPGA 1K4KA 3CE6A 4TKVB 1GZVA 4M7OA 3A70A 4ZT4A 3WLHA 4WQMA 1KKUA 1AK2A 3AERB 2VH1A 3ZVMA 3PK0A 4JC0A 2QYTA 2QV0A 4QREA 4CV0A 2GJSA 4EGSA 1Y5MA 4X91A 2CFOA 2BAGA 4HVAA 4B6GA 3IB3A 4DEXA 1DKLA 3GJ8A 5HZKA 1B6SA 2ISSD 1M6EX 3HNOA 1VHLA 4RIGA 1VJSA 4GE0A 2OAEA 3AVXA 2Y1WA 3GRRA 1JYEA 4L6IA 4HSEA 2Q9CA 3CCFA 4R1QA 1HQCA 1B76A 1NUAA 1NZDA 3PEWA 1OVMA 2FZEA 3OZBA 2OHOA 3W8NA 4F1WA 4UE3S 3CMMA 1VYUA 4OBBA 4DT1A 1SXGA 2QTWB 2J59A 1GV0A 2WTEA 2ESRA 2XMQA 3EJ6A 3IPYA 4KR0A 5HJ5A 1PWZA 1MW8X 1YAHA 4F5ZA 1AKTA 1EVZA 2NTNA 4D0RA 1V25A 1W52X 2NU7B 4EDHA 5K0GA 3SQNA 3H1BA 2HIGA 1KQFA 4WBNB 3HO1A 1NNUA 1EFLA 3LY8A 1L5WA 4CQJA 1B73A 1MIOA 3KYIB 4J9UE 4K9MA 1P7VA 2I78A 5CW2A 3U7GA 5HKKA 3GBVA 3PUZA 1DEXA 4IV8A 1NE7A 4B6RA 2NT3A 3G9ZA 2DWUA 2IT1A 4TL9A 4Z0TA 3UXEA 4B48A 3R4VA 4EMBA 3V7WA 4RM3A 4G5GA 2I22A 3G7SA 2V0GA 4PSAA 1EX7A 2W6MA 2AHOA 1ISIA 2C88A 2HIHA 2G08A 2A35A 3CRMA 3IQXA 4CM8B 4W5OA 3CVVA 4G1VA 2O8EA 2IYXA 3PHJA 4BNHA 3JQBC 4UQPA 1WVIA 3SYTA 5EJFA 4CM9A 1YD7A 5AVOA 4CCYA 1Z7BA 3E7WA 1I3NA 3QLEA 4JITA 4FGZA 1KORA 1OPRA 4UHJA 4RIIA 4DR1B 4FX5A 1KXZA 2RONA 2W5UA 3NBQA 1PFWA 3JD1A 1E92A 1ES9A 2FEMA 3R3YA 4IEIA 3D8TA 2RJOA 2RMKA 4XYLA 3HXOA 4RZSA 4RTRA 1RYEA 3VX3A 1G8PA 4M7WA 4WY8A 5CVUA 1BE1A 3K9LA 5KQMA 4ZICA 1M0EA 1G5RA 1ZIOA 1NKSA 4ZEWA 5JYEA 3VPSA 4BDTA 4DWOA 4H9GA 1C30A 1OKKD 5ICCA 3VH3A 5AVTA 4AQ7A 2IYSA 3I5MA 3DYBA 3A6GA 5JWHA 3C3EA 1DTSA 3PNMA 1I4LD 2O59A 3DW1X 3FPAA 3C2QA 1Y3DE 3SFTA 1HDRA 5HM8A 3L1KA 3PC2A 1M6YA 2SKCA 4BNGA 3RYIB 2NXEA 3WOVA 4F8JA 1U5CA 5C5EA 3Q88A 3P9QA 2A4MA 3EASA 1DS6A 3AHIA 1EJ6A 4G0YA 1W4ZA 3G5AA 4F4IA 2C99A 2B0CA 1PFUA 1DAFA 2ZB4A 3R7FA 1XCPA 4PYMA 3WC4A 5B2FA 2GN4A 1KHHA 1GL3A 4P84A 4TV9B 4PRKA 1ELOA 2H4JA 2IW3A 3OTQA 2HR1A 1CUAA 2OLKA 1KKMA 3WGJA 1RWWA 1J8DA 3JARA 2WU0A 3C4VA 3L6BA 4BMVA 1VQMB 4A92A 1Z0DA 1GUBA 2IPNA 2FJPA 2XXJA 4ARBA 1R0SA 1E8MA 3VX4A 4DDKA 3ZZMA 2RHBA 2VYVA 1VQ7B 4AJ4A 2GCNA 2VQ6A 4DNXA 4CNQA 4OHZA 1VMKA 3HY3A 1ESNA 3QU9A 2OMEA 5FO0A 3OM9A 5CFLA 3E15A 3DTVD 5C80A 1RFGE 3ILHA 2DMRA 1OCEA 2ZJYA 1AGRA 1E77A 2BF7A 1Q0LA 2Q45A 4PXSA 4R1LA 4EJFA 5HTKA 4YCSA 4XB2A 3M8KA 4CKXA 4MQMA 2PRKA 5C8YA 4JEUA 2YWCA 3EVCA 3M1AA 3P7MA 4V39A 1YCDA 2FUG6 2EKPA 3OCZA 4MW2A 3RODA 3TMKA 4A5OA 5I9LA 1M6NA 2VNKA 4C08A 2R6FA 3C3YA 4KRYA 4EHFA 4GI3A 3R6KA 2ZB3A 4EUKA 1Y1PA 1JWAB 1LD3A 2HCFA 2QK4A 2O2GA 3NXSA 3PG5A 3RUIA 1P5HA 2YZKA 4UU7A 5IBQA 4TL6A 2VBCA 1VKRA 1WXEA 1RD4A 4BVBA 4WY2A 2Z8XA 4BKRA 5LQAA 3KZVA 4WXPA 1FNSA 1Q95A 4IS2A 4BVEA 2CF5A 1ZZEA 2CKMA 2CFCA 1V9SA 4MCHA 4ASUD 5B36A 1G1AA 2FMUA 6YASA 2D59A 2EV9A 4GW3A 4ON9A 3TZBA 2LGJA 3TSCA 4D26A 4X06A 2OV1A 3TD6A 3DDNA 1CJCA 4HH0A 4KWTA 2FQWA 1Q82D 2QG6A 3HXQA 3N2KA 1GUZA 1U8EA 2VOJA 4R5HA 3TMAA 3I3OA 5FV4A 3LPAA 4MUIA 4UD2A 1MAVA 2B3DA 5BOVA 1PLJA 3BUSA 5AW1A 2VJMA 2MMCA 4QZVA 2CXNA 2GYWA 1Y6QA 1RM4A 2DFTA 4Y9RA 3M6XA 4CV1A 1NU6A 2Q1UA 4FINA 3NBYC 2CN1A 2DKFA 3PFWO 4XRGA 1T13A 1Z4LA 2Y1GA 3D3QA 2G9NA 3I1IA 2ODEA 3ECSA 2C4NA 4EVRA 3VHQA 1ANKA 3U7QB 4DLWA 2P9HA 4L4SA 3LY5A 3X1ZA 4FGSA 2R0QC 1OH6A 3RU2A 4FJ0A 2ACEA 5C8DA 2ZXFA 4ZOQI 4Z1MA 1C7IA 2CJWB 3MMXA 4QTTB 3ZI7A 5IS2A 2V55B 3LKZA 3WRXC 3SR3A 2QX7A 4G07A 4RKRA 3U3OA 1DCTA 4EI7A 4ER6A 1GDHA 3RAPR 2R8OA 3DQQA 2JC3A 3LLCA 5TGDA 2IHBA 3R3SA 1EX1A 1WP9A 4HYYA 4BO1A 1CRZA 3O47A 5FOSA 4ENPA 5BW5A 4RZQA 2PS1A 2PD6A 2WJHA 4UE2A 1P2TA 3PHLA 5KDOA 4EA9A 1ZHOA 1QVZA 1SC3A 2CV0A 1TJPB 1P1JA 3Q98A 2Q99A 1TZ2A 3M6IA 2XUQA 4K86A 3U3KA 1DEHA 5HRCA 4LPSA 2BKXA 5AD1A 1JH9A 3CX4A 3P4XA 5KDDA 1WMFA 4FC6A 2GT1A 2YHIA 2A0YA 4C2BA 4DCTA 1CUJA 1PLKA 1Z2EA 3DKRA 2ZWPA 1Y5LA 4UDYX 3QSGA 4UREA 5SZKB 3PQ6A 1CWUA 1Y4AE 2GD2A 3DQZA 4FI3F 4CM6A 2QP9X 3I05A 2E1BA 3G71B 1WPRA 4OMFG 1QGOA 5CLHA 3CF6R 1WORA 1B0ZA 5DHRA 1EVYA 2VYCA 1QZZA 3DSRA 3ICWA 4S35A 4W7IA 3GLGB 1PZXA 3AR7A 3PGVA 4Z99A 1ZJWA 2Z0MA 5KQLA 2AFHB 1G19A 4QC2A 3TR0A 2WIJA 3VPCA 4ZCRA 4CMGA 5M04A 1VJ0A 1HUQA 3OVMA 3VR5A 1MB4A 1MBZA 2B8JA 4NQZA 2FZCA 3D3WB 1BGVA 3QE4A 1CYEA 1FE8A 3KAQA 2B9EA 4R8RA 3HXMA 1IN7A 4IV5A 2FA9A 1TM1E 1YE8A 1R6VA 3FPKA 4G5SA 3KUUA 3EE6A 1PQWA 4JP5A 5SY6A 1PW7A 1H93A 1ODLA 1WXIA 2YOGA 4KE8A 3RJTA 3HUTA 3RS0A 5MGNA 4XB1A 3BJEA 3CM0A 4UTNA 2XQJA 4NZ9A 2E87A 4PNPA 3AYXB 4FM9A 5K3FA 1V95A 1IHUA 5JJIA 3OWHA 1AA6A 2WAMA 4MS3A 5P21A 2RHHA 2ST1A 2WJGA 3K0BA 1ZGAA 2CB9A 1OW3B 1SIWA 2V3WA 2E4XA 3NRCA 2CCKA 4FHCA 3DTNA 4RCVA 4EABA 4RSGA 1ZLYA 2J3LA 3O4VA 5EINA 5B2ZA 3T7JA 3U7FB 1NL3A 3WL6A 3RIXA 3S8YA 3PDJA 5AVYA 5AJWA 4DJEC 2CDNA 2R8RA 3CWQA 4G89A 1EGMB 3V3KA 2QI9F 3NWBA 2B35A 1S6YA 2KLBA 3SJCA 3V97A 3MFYA 1QK5A 5EIEA 4ZPXA 4C4SA 1K08A 1XDWA 3EOZA 2AR0A 2XQFA 1HNWB 2WIGA 2HADA 3H5WA 4KQEA 4O4LB 1O4WA 4NYIR 5HDBB 3JD4A 3RROA 1JG3A 1KJ8A 5LFAA 1IBMB 1PO7A 1UFRA 2QQFA 2QVGA 1UPCA 4TS9A 5IKXA 4HV4A 3DAYA 4MJ7A 2DP4E 4CI0B 2WWXA 4EJSB 4Y2UA 3AEXA 1V45E 3A9RA 3T5BA 3DO5A 5CYOA 2I66A 2DE0X 4HDNA 1TO6A 5MF6A 5C7YA 1K8RA 4EL0A 1T8RA 1QAQA 3D4IA 1Z2NX 4Y6QA 4KACA 1XJWA 1PWXA 4H35A 3C85A 3Q8KA 4KSBA 4XD7A 1FP1D 3UATA 3G6EB 1YMVA 1JEEA 5FYQA 3OE1A 2QPAA 3EVEA 4MB0A 3C3XA 5TXGA 1KHTA 1ZR2A 1IN4A 1Q6ZA 4KWEA 3RYCB 2VDMB 4FN5A 1T3GA 2DZDA 5K0ZA 3HFGA 4KE6A 4BMPB 4G0PA 3AHFA 1HDIA 3NUZA 1RRKA 3MQ4A 1FP4B 2AOXA 2NACA 2FX2A 3EZ2A 3K6JA 3UJBA 4A8HA 2JJ1A 1C1DB 2ZDHA 2WT4A 2X9VA 4XUDA 4DLZA 3K94A 2XTMA 2HU2A 3A1FA 2UZ1A 3ET5A 3SJUA 2FWAA 1MXFA 6NULA 4MI9A 2YNMD 4DIDA 3EMDA 1LCIA 3OT4A 2JJYA 4KE9A 3PUKA 4JCOA 1FVOA 1LK0A 3IJRA 1JR2A 3SZMA 2CLMB 1YS6A 3WYBA 4Q66C 3PX7A 3ODGA 3OKFA 5BV2P 4HLDA 3C3BA 4R6WA 1SBYA 4RKEA 3BFKA 3DCYA 4F8EA 2P4EA 4EENA 4OYRA 1IEQA 2VRBA 4FW8A 2WF6A 3ZGNA 4CT5A 3ZCPA 4WINA 3RIEA 3A1NA 2PUAA 5BN3A 3BCFA 1E43A 1NVTA 2GZHA 1L4FA 3ROPA 521PA 3FJYA 4Y18A 3RNLA 5H7XA 1JLLB 1CUYA 1ULZA 1GJRA 1Y3FE 4HJXA 1CJSA 3DAOA 1IZ8A 2FJUA 4H3SA 5FFMA 2R6ZA 2LXNA 2VC2B 3MWFA 4FD2A 1TOAA 1XQXA 5BSRA 1M0SA 4BE4A 1UL1X 4XIYA 3PD1A 3QKSB 4N6NA 5DM4A 4QECA 3T52A 4EEXA 4CNBA 1EX6A 4ZJYA 4N5HX 4R01A 4YJKA 3QUSA 3WBFA 3KUDA 3E8SA 2ZRNA 3F46A 4IIBA 4YI5A 2DBRA 4OH1A 3KD3A 3WRYA 2H9IA 4AP6A 3TM5A 3H5OA 5GWXA 1LW7A 1K06A 2C9DA 5DNUA 2XODA 1JEQB 2YVLA 5IARA 5GJCA 2R2GA 1YIAA 3CFYA 3W3AA 1G4AE 3A8KA 3R20A 4W7HA 4QL3A 4BYMA 3UBTA 1C3OB 5IYZA 2C58A 2VDKB 1K5GA 5DX8A 3E2PA 4QVIA 2UVPA 4RS4A 2J4CA 2EHDA 3SE0A 5CVJA 1PT5A 4Q7MB 1KYIA 5INTA 1SOVA 4M1WA 5CDFE 3GLHA 1WDTA 2I7TA 1XALA 1MP0A 5GZ1A 1K73D 1HORA 3CUUA 2J3IA 1K8XB 4IVQA 1YIDA 2F1MA 1PYOA 4NJMB 4NCXA 4CFZA 1SQFA 4KEAA 3GRVA 1V4VA 2X2EA