2RC5A

Refined structure of fnr from leptospira interrogans
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
308
structure length
306
Chain Sequence
b'PTREPQINLFKKSNPYKAKVISNVLLTPETGTGKRPKKEGEALVHRIVLAIDHSAYPYVIGQSGGVIPPGEDPEKKAKGLADVGYTVRLYSIASPSYSFGMKEDNIEFIIKRDNIYNGNIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFLLPNTDFSGDIMFLATGTGIAPFIGMSEELLEHKLIKFTGNITLVYGAPYSDELVMMDYLKGLESKHKNFKLITAISREEKNSFDGGRMYISHRVREQAEAVKKILNGGGRFYICGGPKGMEKGVIEEIQKISGNTGTYEEFKHHLEGAHQLFVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-NADP reductase
molecule tags Oxidoreductase
source organism Leptospira interrogans
publication title Crystal structures of Leptospira interrogans FAD-containing ferredoxin-NADP+ reductase and its complex with NADP+.
pubmed doi rcsb
total genus 89
structure length 306
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2rc5A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2rc5A02
3CMEB 4ZCMA 1YI2B 4RD0A 4TMTA 3VO2A 1JNYA 4IW3B 1Q82D 1ZM4A 1VQOB 1TUIA 1JB9A 2BM0A 1BX0A 1D1NA 1BJKA 1E62A 1GVHA 4LBWA 1ZM2A 1EFUA 1S72B 5TR9A 3CCLB 1ZUNB 3CMAB 2DETA 1DG1G 2EFGA 3CCJB 3CW2A 3W2EA 3WY9A 1FDRA 2AHOA 1GJRA 2OTJB 3VMFA 1EP2B 4RCYA 2VYQA 3ZBTA 1NJID 3FJOA 3QSYA 1KK2A 5KSWB 5EMNA 3B82A 3CCEB 2BF4A 2YWEA 1FRQA 3U2QA 3ZZUA 1ELOA 4DQKA 3OZVA 3W2FA 1KTVA 1BX1A 4YHBA 4J0QA 3QE2A 4TMXA 1EFTA 3CCMB 2QN6A 3CRZA 3A1FA 4YAWA 2QEXB 1QGAA 4LC0A 3U6KA 1TLLA 4RJLA 4ZV4A 4PC7A 4G1BA 4AF7A 1VQKB 2B7CA 1VQ7B 3AVVA 2R6HA 1XE1A 3AVTA 2VNHA 1EFCA 2OK8A 3W5VA 1QH0A 5FA6A 2QTLA 1YITB 2PLFA 4M0LA 1M1KD 4Q7JB 1QVGB 4AF6A 4B48A 3W2GA 1UMKA 3OJXA 3CCUB 4TN1A 2ZITA 4WQMA 3OZUA 3CXCB 4N3GA 3W5UA 3AGPA 4M2LA 2PIAA 3QFTA 3CC4B 3VO1A 4QHYA 1KK3A 4F7DA 1E63A 3CCQB 1G7TA 1VQ6B 4M1KA 1ZM3A 1JA1A 4Y9UA 3AVUA 4B47A 1KK0A 1YJ9B 4K1XA 5DSZA 1A8PA 1OB2A 2YWHA 4PC6A 1VQ4B 1YJNB 1W34A 1JA0A 4P3YA 1M90D 5H5JA 2QA4B 1DDGA 4NCNA 2RC5A 1Q86D 2CNDA 4NBSA 1ZM9A 5GV8A 1N0VC 1WDTA 5AN9A 1DARA 4PC3A 4LBYA 4PGOA 4RD3A 4ACAA 3B8HA 1DDIA 2D74A 1NDHA 1S0UA 4TMWA 1QGZA 2BV3A 5HXBA 2VZLA 1GAWA 1W35A 1VQNB 1SKQA 3G4SB 3AVWA 3PENA 1N8RD 4ZGNB 1N0UA 2BSAA 1QX4A 1TTTA 3QFCA 1GAQA 1YIJB 2HCJB 2B7BA 3LO8A 1QG0A 2YWGA 1B2RA 3W5HA 4EH1A 4Y7CA 1K73D 4P6VF 4QFMA 4C0SA 2BMWA 4ACBA 1IJFA 3WYAA 1G7RA 2OTLB 2NPFA 1KRHA 1QFZA 2BM1A 4ZCLA 5THXA 1F20A 4H9GA 1F60A 1E64A 4PC1A 3WNBA 3CCSB 2BVNA 3WNCA 4HE6A 1QUFA 4B44A 1XB2A 3CCVB 3ZZTA 2BGJA 1IB0A 2C78A 4RCZA 1VQMB 4UAJA 3LVBA 4PC2A 4RD1A 1W2BB 3U6BA 5TV2A 1BQEA 1CQXA 4LBZA 2BGIA 3I56B 4MYUA 3SJZA 3P26A 2BN4A 2B5OA 3CC2B 1FNCA 4DQLA 4C43A 1QFJA 1Q7YD 1VQ9B 4FK8A 1KJZA 2C77A 2EIXA 3LRXA 3ZC3A 1H85A 1OGJA 2DY1A 2DEUA 4HE5A 3JQRA 2BPOA 1VQ8B 2J7KA 1U2RA 1QVFB 1Q81D 1D8TA 4Y9RA 3W2HA 1R5BA 3CPWB 2HMAA 5GV7A 1VQPB 1JJ2B 1G7SA 3ZBUA 1D2EA 2CRVA 4LBVA 3I1FA 1YHQB 2QDXA 3I55B 2GQFA 3G71B 1OGIA 1YJWB 4FN5A 1QUEA 2VNIA 4RD6A 3CD6B 2DERA 2E1RA 4B4DA 3AVYA 1FNDA 2VNKA 4AC9A 3CC7B 1EWYA 2XNJA 1FNBA 3OJWA 1EP1B 2FX3A 3G6EB 4G5GA 5H59A 4N3NA 1FRNA 4ZGQB 1R5OA 1I7PA 3WBKA 2XEXA 3LYUA 1AIPA 4G1VA 1KD1D 5JBQA 1K9MD 3ES9A 4TMVA 1H42A 3MMPA 3ZZ0A 1SM4A 4M4SA 1GO2A 1CNEA 4TMZA 2XNCA 4FWTA 1QGYA 3MCAA 2DCUA 1KC8D 3B78A 1QFYA 3E1YE 3QFRA 1OB5A 3W2IA 3OW2B 1J9ZA 1KK1A 3WNDA 4R71A 4MYTA 4YALA 1HA3A 1R5NA 1K8AD 4M53A 3MHPA 3CB4A 4YAFA 2QTZA 3AGQA 4RD4A 4YAOA 2X3UA 1EXMA 4U9UA 2PMDA 5TY0A 1TVCA 3VNUA 2YWFA 1IJEA 4B3XA 3P27A 4RD2A 2HDNB 3WBJA 1CNFA 1AMOA 2QMUA 1GR1A 4BPRA 3JQPA 3CCRB 4B43A 3VNVA 1VQLB 1W87A 3J81k 1KQSB 3FPKA 3V76A 3E20A 4YAUA 4ZCIA 1G7CA 1EP3B 3WXMA 3JQQA 2VNJA 1FNMA 2GPJA 1VQ5B 3QFSA 2OK7A 3OZWA 2RC6A 3AVXA 1B23P
chains in the Genus database with same CATH superfamily
1DINA 1UBSB 2FEMA 3H9BA 4J49A 1OLUB 4QJBA 1MXFA 2CNKA 3MJEA 3BB3A 3G2OA 3BSWA 2HU2A 2O0KA 3IODA 4Q1DA 3VTKA 2ZYTX 2R0QC 1DELA 3UJDA 1KMHB 1DV2A 2HLDD 1E0JA 1X15A 3L6EA 3LVQE 4D8YA 1YDMA 1W2WB 1MG5A 4PHTA 3NFRA 4N41A 3IUBA 4YMLA 4AULA 2P0YA 3PDHA 4O4IF 1ZOSA 1XHFA 1YVRA 1ZM2A 4WJZA 4Q82A 1YKFA 3AHDA 4Q7EA 2HX1A 1VFNA 4ON9A 5C7OO 4ZAXA 3UFXB 2HK9A 4CR7A 5BVHA 2PV0A 5BUZA 1US8B 1WUKS 1Q0QA 3ID6C 1LRKA 5JY1A 4U7WA 3UG6A 1KBQA 4CODB 2IZ7A 2R68A 4GDMA 4MRMA 3CCJB 5EZQA 3WY9A 4BHTA 4BXOB 2JI7A 2V54A 5T7BA 2X0DA 4OHKA 4TSFD 2OTJB 4QREA 2OGTA 4FQ5A 5HF8A 1JIQA 1NF2A 4PQGA 2C4HA 2MSDB 3QFHA 1QQ5A 1IFXA 3AWDA 2CF4A 3H75A 3N7TA 1W4BA 5AI0A 4MKRA 3DG9A 2P5YA 3GXOA 3U4MA 1TYEB 1EBFA 2BELA 1EFVA 1KZ6A 2HA7A 1ML3A 4H1WA 1F12A 5M5BA 1ZQ1A 3UUGA 4BUJA 4OJYA 3H9UA 3K2EA 1P1RA 1SFRA 3MJFA 4U9HS 1RZRA 3PGJA 2IQIA 3TMAA 3UO8B 2B78A 4RTQA 3U2QA 1KP9A 3LC2O 1ZICA 2VBUA 1ADCA 3ETNA 2QUIA 2GNOA 3OZVA 5B3AA 3HJTA 1OHHA 1V3UA 3O95A 4CJXA 3E27A 4D9IA 4JP5A 1KY3A 2GEJA 3EFHA 2Q0QA 4HN2A 4R31A 3UCEA 2QN6A 5JVDB 4E5YA 1JH8A 3H87A 4R1PA 1TX4B 4TMYA 3UUEA 1E0DA 3BG5A 1WMFA 4EARA 2BBOA 5JJKA 1M0WA 2YC2C 4EG5A 1GU1A 3UV6A 3JQ9C 4EY5A 1JHOA 2XECA 3WA7A 3V7YA 4KO4S 5CR9A 3WLTA 3GYBA 1GKIA 1HT0A 2DBYA 2QYOA 3CSDA 1UPXA 3WFIA 1OLSA 2I6GA 1DXHA 2CXRA 2JBAB 2UZ1A 3UWKA 5JLJA 1UWVA 4UM8B 1QIFA 3E7FA 1L7AA 3L4BA 3EXHC 1QHFA 3M6MD 4U1RA 1UMCB 3D81A 4DIBA 2VJYA 1I1NA 1C4OA 4MGIR 3IRUA 1JYSA 3NNDA 2V45A 1JHYA 1PTJA 4KYTA 2YW2A 5AM5A 5FLYA 3SD7A 4DA4A 4AMBA 1T9GS 4MYCA 4BJ1A 5BSUA 3ZDZB 5L6LB 3O8QB 4QGHA 3VU8A 1YITB 3D0KA 1CZKA 1YQUA 3FYCA 3GBPA 4RMIA 1AH2A 3ZXIA 5J2UA 3GLRA 1YVUA 4QEDA 3COWA 3FNIA 2GILA 3PUXA 4KAJA 5EINA 2UYOA 1XBTA 4JP2A 4LDNA 3LRPA 1Z22A 2ZTUA 4TVSA 5AVRA 5KVSA 4GMXA 1NZDA 3NOXA 3S6JA 1VYTA 5JAZA 2PZAA 4R98A 2B0JA 3HKCB 5P8WA 4Z8XA 3OHMA 3BRWA 3LO5A 5JQWA 4JA2A 1X74A 1XVTA 4UOEA 1XKQA 2QD4A 3F0TA 3QVJA 3QVSA 4CPDA 5DCWA 4BEVA 4BVEA 3I8OA 3JSAA 3IIJA 3H04A 2ZVQX 5JMTA 4QJIA 4D45A 1FSGA 1E63A 1CBUA 5F23A 1KKMA 2FSVC 3MTAA 2X6YA 4BNLA 3IBTA 2AXPA 2IVZA 3PGVA 5FI1B 3PG5A 3LP5A 4MV4A 4J0HA 5DHFA 3N7AA 2WQ7A 3OZIA 3UAZA 3HKEB 4AVZA 4UMDA 4O4HB 4RMNA 3IHLA 5EKTA 4PC6A 1VQ4B 1NA5A 4QYWA 5HFJA 1SQ5A 2AA3A 2AIRA 1HG1A 2NO0A 3AG5A 4X8LA 1A8SA 1DUSA 2GGSA 1M90D 4JGGA 3T4PA 2RB5A 3PQCA 4X94A 2NWQA 3WVNA 5FA8A 1XK7A 1PQWA 1D03A 2WB4A 3JR7A 2OMKA 3K0CA 2W42A 2ZPUA 4AS3A 2QTHA 1DKUA 1KE2A 4DQVA 4UFPA 1B42A 3SJUA 3H6HA 1GLNA 1NW7A 2YZMA 3L5KA 5LUAA 2J0QA 3IAAA 3LHFA 5J2TF 1VSBA 1T0JB 5I8PA 2XYPA 3U3XA 1OOEA 1UK8A 1TZMA 1U0RA 2VQ3A 3IJRA 4NJEB 3O74A 4Z1MA 3DM9B 1PWHA 3NC1C 1X7HA 4RM0A 4LBYA 2H29A 3A14A 4BKOA 3FVWA 5LIRA 1YS6A 4JXJA 3HP7A 4M55A 5IYRA 2ACKA 4Q16A 3JQ8B 2JFOA 4QAQA 4IUYA 1VL2A 4E4YA 4IP0A 5KYYB 4XPIA 4NZOA 3TSZA 4JU9A 4H7DA 1M2KA 1NMQA 2AFHA 4FD3A 4LYGA 4LF4B 1MH1A 3MNFA 4RLZA 3P96A 1QIIA 5F4OA 1XXHA 2GRJA 2O19A 4HSGA 4MQ5A 1JB1A 3C6KA 1IN5A 1H05A 3K0AB 4BZWA 4K3VA 5I9TA 5KSYA 2GNPA 1B16A 3CUWA 5TJHA 5DM4A 4BYGA 3IEVA 4YK7A 4DT1B 5LMUB 4NNPA 4FZRA 4MUBA 3OT1A 2AF4C 1KXJA 4X61A 3H6KA 5JTUA 2PGDA 3U7FB 3BMOA 1WHTA 4EAQA 4OYRA 1WULS 2OV6A 3OLXA 4MP8A 2C29D 3CLSC 1U7TA 3PIDA 1DAHA 2NU8A 4KN9S 1EFPA 1II8A 2JFNA 5BW4A 1D04A 3DAOA 5JD4A 1C8LA 1K73D 4AN0A 3T9BA 3RK0A 3BQNB 4QFMA 1IHXA 2Z5FA 5JFTA 3I3SR 4TL6A 2QLNA 2QT0A 1VDMA 3ORQA 1A69A 1GTMA 2HSJA 4FNOA 4QL3A 4YJFA 4QG3A 4H0FA 4F9FA 5BN4A 5A3SA 3BUSA 2NUTA 4OQ4A 2OTLB 4OAQA 2X8BA 3BIJA 3CCBA 1ODSA 2FZKA 1XCLA 3DUFB 4LJ5A 3V34A 1SVKA 4LI0A 3HB1A 4RZIA 1KIFA 4WK4B 2AJDA 4LMPA 4GDFA 2FUCA 2G1UA 4MDHA 4X44A 3WLIA 1Y4SA 1VHDA 1EXWA 4OQEA 1H6BA 1L4BA 2I34A 4EMSA 3MWEA 4HAWA 4AD8A 3EYAA 1UBRS 1YTLA 2IHBA 4TRJA 3FCYA 3T7KA 1SKUA 1Y9DA 4Z9YA 2QRUA 3TSWA 1GPH1 5GIPE 4JJFA 2O0LA 5AOBA 3D54D 1Y9ZA 1MT0A 1SQGA 2B5VA 1V16B 1HE3A 2HC9A 1BSVA 4KO3S 4LZOA 4OLFA 4PS1A 5EGSA 1KPGA 2CBZA 4ZIRA 3ZK9A 2AZ4A 2ZAGA 2W70A 2OVBA 4QT4A 3V7AA 4RCZA 1JPVA 1E7WA 2EBFX 2FLVA 1N6IA 2HQRA 3SJPA 3CVUA 4GBMA 1UDRA 3U56A 3D6MA 5KREA 3THYA 2IH4A 1DAKA 1ODFA 1SUIA 3FUXA 4NYMR 3OOCA 3E4CA 5DMHA 5J43A 4MWOA 1ONNA 3RSOA 3SC4A 5TV2A 5A9RA 1YGYA 3EMVA 4X6UA 5JNVA 2FPUA 1YI1A 2P5SA 2VYNA 1PZEA 1ABFA 3QVMA 4LCBA 5KKCA 3LXXA 1KI6A 1PG2A 2QTTA 1Z5WA 2X7XA 3CR8A 3ELWA 3R40A 4NR0A 4AVYA 3KWMA 2R9VA 2OBLA 3BAFA 5FB3A 4DPKA 4RWZA 5IHXA 5MN5A 1WORA 3EBLA 3BERA 3KR9A 1JXMA 3CC2B 4P12A 2CVOA 3USCS 1VQ9B 1ACMA 2P35A 4XLTA 5EKUA 4C4ZA 3DMFA 3WYGA 3A4VA 2C20A 3K70C 4PR3A 3QNWA 1WAMA 3OD1A 3QLTA 4TS9A 1W9XA 4TWRA 4X24A 5H0IA 1RLUA 5H4HA 3T7CA 1DKRA 4DILA 1J0AA 5G1NA 3K0SA 2XVZA 3VU9B 4P0QB 1PJ4A 4EPWA 1HFJA 4JEUA 1OU4A 4AUMA 1EH5A 1VJDA 4PCUA 3Q41A 4TLDA 2J3DA 3F3SA 3ITKA 3PFGA 3DDUA 3C6YA 1YNSA 1RYHA 4I1SA 4ZZIA 3ICQB 1KGDA 1Z73A 4RHCA 2HA6A 3AERB 4HLUC 3ADOA 4I08A 3V1MA 1ZNQO 2JGKA 2OY0A 4MP3A 2EFJA 5JZ9A 5ILQA 5B1HA 2RKWA 3KKOA 2I71A 5C8YF 2VPQA 4C7JA 5GV7A 2P3SA 4D9NA 4EEKA 1ZYUA 5A5VA 3UFXA 3FWKA 5C8YB 2AH5A 2V4ZA 2QPLA 1CK4A 3A2NA 3A9RA 3LQQA 4IQFA 4UNPA 2NTYC 4YQEA 4C1NA 1VLLA 5DBGA 3PXBA 2R7AA 3DCNA 3Q5GA 5D00A 2LZ0A 3V4ZA 2WILA 1N57A 4H7KA 4IFTA 3BMQB 3WYCA 1N92A 2AC4A 4Q00A 5IAGA 4D98A 2QX4A 3UBMA 3UCXA 1BDHA 2GTIA 3B6KA 4P4TA 4AJ4A 4LPKA 3W6UA 5ALNA 5AVZA 4CIXA 5EJ9A 3F5SA 3TW4A 1FSPA 3L0DA 2QGNA 4QPJC 4U63A 4OI4A 5JQGF 5ALXA 3DOJA 2HJVA 3FA2A 3OPMA 4Y1GA 3TJMA 3KD3A 3EZGA 3HM9A 5ED4A 3G0CA 4LYFA 3O8QA 3WV4A 1P5HA 1T2EA 4CDRA 3ZVKA 3F4KA 5C7LO 3WP0A 2OBSA 3LUBA 1GKYA 3GEGA 3OD5A 3OPYA 5JD3A 3V2IA 1FL9A 2D8AA 4W4TA 4DUZB 1R5OA 1ENZA 2O5RA 3KSUA 2HDOA 3GA0A 3MWLA 1KL7A 4LOLA 1U28A 2YWBA 5ALDA 4AYTA 2GVZC 5CNKA 4YRBA 1L7VC 5K4GA 3UTDA 4J7CA 3DE0X 1KZLA 3DDZX 3L0ZA 2XGJA 3ZU3A 3CEJA 4G1VA 1FZTA 2D54A 2CSUA 4P9SA 2HBYA 5A62A 3MGCA 2B7LA 1I7NA 2O20A 2UZ0A 2OV4A 1I2CA 1XGKA 4FINA 4KNVA 3EEBA 4RO0A 4TKLA 1MDBA 3SY8A 4CG3A 2Q7OE 5B64A 4ZAWA 3E7PA 2FUKA 3L04A 3LP6A 4P9NA 2I66A 4IXTA 2W0SA 2C9YA 4I46A 4W5HA 4B3TB 5GIOE 1CNEA 1I1OA 3OEEA 4RKRA 4WHMA 4PZPA 3RRBA 3I4CA 1RWOA 1Y1LA 2XGSA 1LNZA 1WCYA 2OYRA 2TECE 4MQEA 3RWBA 1ID1A 2R3SA 3UXHA 3L49A 1X7YB 3T5GA 3VH1A 1L4HA 4J16C 4CN9A 1ZX1A 1PVVA 2FMTA 4J94A 3ZN2A 4FFPA 4TZ6A 3L4BC 1XZAA 1H22A 1FPQA 2JLSA 3QU9A 4ZK2A 2O0HA 2FF5A 2IXAA 3JRXA 4KK4A 2ZJ7A 3ZD8A 4PPYA 5AW8A 4TVKA 5LYJA 3OCVA 2WOOA 4R5MA 1G16A 3ESRA 4W1RA 3WIOA 2BFDB 3MHPA 3D6VA 1VL0A 1B1AA 3ESDA 4KBYA 5FQNA 5BUCA 1NE2A 2RDMA 3WNVA 2XB4A 4WA8A 2GYUA 5TQ0A 3MWYW 1FB5A 1E3DA 4C7KA 4O6VA 4FJ0A 3I58A 4UTOA 5MHTA 1E89A 3HBNA 4A82A 1K5HA 2AZDA 2SCUB 1E1MA 1N2CE 4WIAA 4X66B 3E2PA 3RU2A 2GX6A 3NYWA 5BNFA 3N0RA 4IXDA 4KG7A 3DWEX 4Z4UA 1GV0A 3TZKA 2R00A 5J2UB 3NHKA 4YDRA 2YNMD 2ESRA 1D6NA 1YOBA 2OR3A 3FOCA 2Q4BA 1D4FA 1W73A 2WD7A 4QU0A 4S0XA 3W4IA 3TAHA 1VE5A 3ZDRA 4C5AA 3VVMA 1G1AA 2ZSDA 3AY0A 3IQIX 3HVUA 3IHTA 1VQLB 1QHEA 2HM7A 2QKYA 4RS3A 3MMZA 4F60A 1KQSB 1IIRA 4QV2A 2LUOA 4FYHA 4WKCA 2JHFA 4RF5A 3KQOA 5JFOA 2XWBF 5KI6A 2REQA 2WWHA 4EGSA 3QVWA 5JS1A 3IP6A 2WJPA 3DEIA 1K4KA 3RVDA 3CNHA 1AKUA 2Z57A 4F11A 3E7DA 4IO1A 3TO5A 1O58A 1QIEA 2WAYA 1LBQA 3INYA 2VYCA 5BNZA 1DBPA 3BWCA 3W5SA 2FQYA 4JOQA 1H93A 3PXDA 1DZIA 3VDRA 4AMVA 9ATCA 1V37A 1RQXA 1GKLA 4EHAA 5K0TA 4JI2B 3OCCA 4TLAA 5CH8A 3WJAA 4BLPA 2D1TA 1BEEA 1A8HA 1QJ4A 3HCBA 1NBEA 1UP6A 2DFDA 3QFSA 4NK4A 1EWKA 1BDMA 3CV3A 5JV5A 2GHQA 4BAZA 2IOYA 3WB0A 3GT7A 3IP1A 4R2JA 4FP9A 5CFMA 2NZXA 2IS4A 2GFHA 2RC6A 2NUTB 3KYIB 1LLCA 2K7ZA 3LTEA 3N6RA 1S2GA 3A9VA 4RF2A 4YAEA 1J00A 1XLWA 3DBVO 2RH9B 4WNIA 4S3MA 3TTVA 5ETJA 3AJAA 4GR9A 5K3FB 3NVAA 2QV0A 3VRHA 1IWPB 4PGHA 3P9SA 1IM2A 1J06A 3FUCA 5TNXA 1LRJA 4LDPA 1A9XA 2JHAA 3F6CA 3KLOA 1LKZA 2HNBA 3OZAA 1UIMA 1XLTC 1YJ5A 2R1TB 2XYHA 3I9LA 2KB0A 4HUQA 5C4IA 3JAMA 1BCSA 5AM2A 1QS0A 2XAAA 1T3TA 1TUIA 1XFOA 3DWGA 3NTXA 4YJ2A 4MGZR 4DCPA 1JMYA 3J81A 4EMBA 2QT1A 1GPUA 5HEKA 4GWLA 1YD7A 1R9GA 4R2KA 2BMDA 4RPHA 2E7ZA 4Z4RA 4RXUA 4XPIB 5I5GA 3COZA 1JDTA 2YZGA 4WLEA 1ZK4A 4Q9KA 1D2RA 5AVSA 1JG7A 3VR0A 3NMUF 1VBKA 1FDRA 2HU5A 2C8LA 2WTXA 2YHUA 2UUAB 3JARA 2NYVA 4TKVB 1U3VA 5FL3A 1QM5A 2QMEA 4DA0A 1EP2B 2E4ZA 3JALB 3OQIA 2MYTA 3A9SA 2XOEA 1ZAKA 3BXPA 3KOUA 3PP8A 4GXRA 4J0DA 4MS3B 4GGPA 1HFKA 4GI3A 4WFJA 5DH9A 2PUBA 4EMTA 3GT4A 4CYMA 4XR6A 3BQMB 3KPYA 2WK1A 5KNCA 1VLZA 1DAEA 4YONB 1KZ9A 4FDUA 4FQ7A 1I2AA 1MQ8B 1XRJA 2CLSA 1GZ5A 3OFND 4Y1RA 5JRZA 1ZG3A 1KTVA 1BX1A 1T2DA 1YDEA 3NM5A 4YN3A 2BOVA 2HEIA 3LKBA 1UJ4A 2C00A 3TLAA 3BD9A 3MWJA 4MQFA 4ZCQA 4AG3A 5LIPA 1QAOA 4URWR 5LC1A 3UB3A 1T0BA 3U49A 4YRNA 5B2EA 2ON6A 1OLXA 3DE6X 3SHWA 4ZTUB 3D6UA 3OC0A 421PA 4BEJA 1RPZA 1Z6TA 3KO8A 2E85A 2NUPB 1SBHA 3SF0A 1K4YA 3LU1A 1IN8A 1V35A 4IHJB 4LHSA 1PL0A 4P4UA 4Q4AA 1T4CB 1P7VA 3QTTA 3RUHA 2FRVA 1CYEA 2GESA 5HMLA 4RPBA 1LI5A 1VMDA 4M60A 4OPSA 1NVGA 3LPDA 1CX9B 2K5UA 2G5CA 1Y81A 3MAAC 1ECCA 1X13A 4LY3A 4AJJA 2GA8A 2OHJA 3N5KA 3DW1X 3THSA 2DWUA 3WYEA 1VECA 3SR0A 1GEGA 3BJMA 1SPBS 3AIIA 1WDWB 4BO5A 2VNHA 3WGGA 4BNYA 2P9GA 3R3ZA 2DZDA 3N0VA 3LQ1A 3QTLA 4NS4A 1LDGA 3ILHA 4G09A 1ADJA 2IP4A 2ORED 4XNFA 3OIVA 3CZQA 4KJXA 3ZKWA 4B82A 3DMDA 2VHYA 1HEUA 4G23A 3NYRA 4QSHA 2QTLA 3LOUA 2ID8A 2QRGA 3ZHUA 3L79A 1X1CA 4R0VA 3K6SB 2A59A 1RXUA 4PGFA 4P53A 1ISHA 3II6X 5AIAA 3TIFA 4OATA 4E5VA 1WCIA 3WQZA 3WK4A 4BB6A 1P60A 3RSCA 5KOHA 3LPCA 3K2QA 2JVIA 3KYCB 3AK4A 1V8DA 4XZ3A 5ALGA 4L8WB 2GM5A 3NC0C 3ZLJA 1IYZA 4EW6A 1Q1NA 4AZ3B 5LQUA 1QYDA 3OZUA 1HNXB 1RI4A 2ASEA 2OSVA 2XQGA 1Q15A 3I23A 4ND8A 3W5UA 2BI8A 2CMHA 3EG9B 2O3JA 4L4ZA 5BN4B 3ZLVA 1SIOA 3QJGA 5D01A 4CQMB 4LNAA 3H0KA 3SS9X 3UQYS 5K3OA 1ISRA 2BMAA 4QHYA 2GO1A 3QUBA 2QA5A 3PL5A 3RVOA 4F7DA 4FBMA 4LVUA 2FZGA 2CD7A 2DR0A 1XMPA 5CGQB 4DCTA 1HBJA 2Y3IA 2Q2WA 4BTVA 4Y2XA 1ZK0A 3GIRA 1B6SA 1NHWA 1NVVR 1GPNA 2VYFA 3C6MA 3GRAA 4GQIA 4QBIA 3CKKA 3TNLA 2NSLA 1P2BA 4YTEA 3UM9A 1Z6YA 1MO3A 4CT4B 4DA9A 1BFDA 4LK2A 4RV9A 4ZZ1A 3DEAA 1CSEE 2BH9A 1I6KA 5BQPA 1DAGA 2A84A 2R5FA 4TTJA 2Y1DA 5L8VA 4Z4VA 2ORYA 3KJZA 4C0QC 2REOA 4CW7A 4Z4YA 5C7IO 5IC4A 5FL7A 1TECE 1TM3E 2J6BA 3ZY4A 2WYVA 1NVDA 2IYZA 5CLQA 5C35A 3R3JA 3A8TA 5LMNB 4M8SA 5EGNA 3ULKA 3GVIA 4D56A 2O2YA 2XQJA 4KRGA 1JI3A 3ILXA 1PR3A 2VHJA 4XI9A 5KVVA 1KYQA 4YV2A 2I3BA 1B41A 4M89A 4AS2A 2CNWD 4IX1A 3K09C 1SQ6A 5JNSA 4A91A 5KYXA 3PWSA 5HKOA 3N1UA 1N6LA 5DE3A 4TV8B 4AX8A 4F04A 1PFUA 6NULA 3TTSA 1ZRSA 3AHCA 5L3SA 5CLHA 4ACAA 221PA 4FKZA 3K5WA 3E3AA 1K7YA 3H84A 1J23A 1KU0A 1O6BA 1YU9A 3NVDA 3H2KA 3OU7A 3OZXA 1K88A 4XWGA 5CT6A 1S3SA 2JJYA 4KQ2A 8ADHA 1CZRA 1XA4A 1IOWA 3L8GA 4RYDA 1Y6FA 1WV0A 4L5YA 2WUGA 1UBCA 1K0UA 3SYNA 1D2CA 3L8MA 4NCKA 4TMWA 2KI5A 1ZJYA 2PU5A 1PR1A 1J22A 3JQGA 2ZSKA 3RSGA 1S4QA 4CF7A 5E6SB 4KAAA 1XALA 1YDGA 2EKZA 3LDFA 5DYYA 4X8IA 3ZCPA 4DTIA 4OSEA 5B4UA 2QT9A 2AUMA 1KDVA 2RJ3A 4UXJA 4BS9A 5CDFE 1IUPA 3BE4A 3LV8A 4X1KA 2YJTD 4IMIB 4HDKB 3OQVA 4W5TA 3CN7A 3TVYA 4URUR 5FOQA 1N1EA 2PRSA 1RMQA 5CLLA 3SF8B 1F2TB 3UZUA 4BJ6A 2QG6A 1L7OA 1PL7A 1W4RA 3DVSX 4GOKA 5H7XA 5A02A 1Y33E 5BR1A 1W36B 3TB4A 4UDNA 3V6LA 3PYLA 3R8FA 4EYSA 2OD9A 3FLEA 5JAUA 3W7AA 3FB1A 1ODKA 2GZRA 2P2NA 4WZZA 2XOKA 4OHZA 4CNQA 2N0SA 5GZ1A 4NJMA 3IBSA 1Y5RA 1KQFA 2ZL5A 2J08A 3N8DA 1ZVKA 4G7WA 3LNCA 1LF5A 2CJPA 4XIIA 1QLJA 1YZVA 1QV6A 2YMQA 1PQ4A 1QONA 3DDSA 3FPLA 4YJGA 3U9LA 3CPSA 3F2IA 4HOYA 4MA0A 3VQTA 2EL9A 2YY6A 4WXYB 3EAGA 1FDOA 3CZ4A 2W6JD 1TJ4A 3PTAA 3VPHA 3WLRA 4TUYB 5K0CA 1FFXA 2QZJA 3DAPA 2PFKA 4HG2A 3F78A 3RC8A 5EIOA 5EESA 1R66A 1SCKA 3CCSB 1SXJA 1V48A 5FWYB 2QOEA 1NBAA 1UPTA 3H4TA 3OU6A 3ROPA 3WHLA 1ZA1A 3HA7A 5GOZA 3DYBA 4MMYB 1XB2A 3U40A 4CIVA 4FFNA 2GKOA 3HUDA 5GJBA 4HGNA 2RGYA 3HBLA 2AKAB 5LQCA 3C8UA 3UGKA 4XLCA 3LMKA 1EBUA 1YRQA 2E3JA 4V03A 1GSAA 3SJ7A 1Y98A 2Z95A 1YR9A 4IQ0A 2DHRA 2VEDA 1N2GA 1G3RA 3RM3A 4YRSA 4IJ6A 4CEIA 1JI0A 3FPCA 4FOTA 4TTTS 3CFYA 5JS8A 5K9ZA 2VJBA 4D3XA 1PHRA 4HDCA 1MV8A 4ZXFA 1G18A 2OCBA 3KT0A 4MAFA 4IQGA 4G25A 4PYJA 4C2TA 5HJ2A 2J3LA 4DIDA 3O9MA 3CQ9A 3M6XA 4TQGA 3A6JA 1CZUA 2PBRA 3AU9A 4C5CA 5A05A 2AN3A 1SZJG 5BSGA 4MYUA 1JVNA 1M83A 2QLJA 1PR9A 1UXOA 4F7WA 2V7QD 2FU5C 3DDWA 1MHPA 3NHFA 1TF2A 2GEKA 5B6IA 3FCOA 4R84A 5FPTA 2ST1A 1RJEA 2IODA 3WMRA 2QB5A 5B7QA 4GNKA 3FPPA 1P39A 1XN1A 1T9KA 4NEHB 4P80A 3OEED 3NVKI 4G5HA 4KBFA 1SKYB 1QPGA 4BN0A 4D6PA 5LVAA 1ZHOA 2WJ6A 1M5RA 2BTQA 5I7FA 2YFHA 1NXXA 3USES 1OV6A 2XDWA 3KKPA 4XOIA 5DM2A 4RS4A 5KAMA 4D6YA 1T1JA 4ZT4A 3SR4A 1XEXA 3WYNA 1TKCA 3O4FA 3NX4A 4WESB 2N3ZA 2WEKA 4QX6A 4B2YA 1NBWB 4BPBA 3LA8A 1ZK3A 1RYMA 5A3VA 2X8WA 4RGVA 1LK0A 4L2IB 4LY0A 2OKCA 3T1VA 4KR6A 2CXUA 1AGNA 3VKUA 4UNQA 3OM0A 1CF2O 3WZLA 1OYOA 4Y9RA 1R0YA 2B21A 4C7OA 5FFMA 3AFOA 1RRVA 1FF9A 4M0MA 1TEXA 2VVTA 4Q15A 1Z45A 1DQPA 3GUYA 5KWVA 3I6QA 3O4HA 3CBQA 2WVAA 1VC2A 3AY3A 2CRVA 3HVHA 3ROGA 2NTVA 1X0XA 4RTMA 1QK3A 2BFEB 3QKSB 2W6MA 4H31A 4E3WA 1N1DA 1IHMA 1BYIA 4XGIA 4HT3B 3CRW1 1WZ2A 4FM9A 2GQ0A 5FOWA 4WY2A 1P80A 2XQFA 1OD6A 4JBWA 3TI9A 4FOPA 3KJFA 4J6FA 4C76A 4ER6A 1NQVA 2AX4A 1UQRA 4RSRA 2H63A 3LHKA 3Q98A 2FSPA 2QJOA 3A0RB 3PUNA 3DVQX 3GRRA 4RKFA 2FP4B 3RVJA 3WBFA 2RB4A 4MGYR 1MLDA 3AKZA 3MFQA 3D5QA 2OO7A 2A35A 4GFDA 4TWIA 1E79D 4W5WA 5E1OA 1KDOA 4JJIA 4MYDA 4NFHA 4DBZA 4MIYA 2RGDA 5A89A 3JCZA 3I53A 4F3TA 4ZGQB 4GXQA 4RMJA 4CLXA 3ABOB 3CUTA 4P5PA 3IQHX 1TUEA 2R86A 4MSUA 1SC9A 3UH1A 4F6RB 1PK8A 3TDNA 2Z2ZA 5KYNA 1PV4A 1X7XA 1DEKA 2OOKA 4OL9A 2XEXA 2VAMA 3QITA 1WXDA 4E5MA 3DO5A 4PWYA 2VZ9A 2EHDA 4MDYA 3KAPA 4H6XA 3UB4A 3B5IA 6GPBA 3ES9A 1A7KA 4K1LA 1UQTA 2GA9A 4G6IA 4DR5B 2XWQA 1DCMA 3C0KA 3LOQA 3VR4D 3ZEIA 3VKFA 2O2HA 4QDXA 2RSLA 3DPSA 1G8YA 1SM4A 4YXWD 5T4BA 2G3YA 2PGAA 4G9GA 4JNKA 2J9GA 1DKLA 4INPA 1Z8HA 1JJIA 1U3GA 1T4CA 2AUNA 3TGPA 2EF0A 1WF6A 5CG2A 1XDWA 3I2JA 2ZQZA 1M6VB 2AZMA 4PR0A 5B1EA 1GDHA 4HH4A 1J70A 1Y34E 3CCFA 1L4LA 4YCMA 1FXWA 4NSNA 1GLVA 1YR3A 3GP8A 2ZULA 2OFPA 3VR6D 3WSTA 1LPSA 2BKLA 3JRNA 3EQZA 3A1CA 1O5TA 2I4NA 3UAVA 4G9EA 4OOFA 3W1VA 4J4BA 5FTNA 2D7JA 3FOAA 3K05A 3EVAA 3O3CA 4J8PA 4M8IA 5ILGA 1XYGA 4C6RA 4YRTA 1EXMA 1N5JA 1PL6A 4U9UA 1BVUA 1EEXB 1WY5A 2ID4A 4UUMA 5ADHA 2WUFA 4KQ6A 3VXKA 5EUQB 1XV5A 2J4FA 2JHGA 4L08A 4RV5A 3QX7A 5ELMA 4C3OB 1PRYA 2XKAA 4RJKA 4UNRA 3GMIA 3ZNNA 1EM6A 4HUJA 3F67A 5JPCA 5C32A 1N2EA 5KNBA 1MR3F 3QVVA 4HN9A 5KNCH 3VUEA 1C0LA 1RJFA 3JAKB 4N0MA 4YGXB 1Q6YA 3HR4A 3MWDB 3K0BA 4UPVA 3V7WA 4B43A 3N58A 3RTCA 5CB6A 1M1NB 2CF6A 1N07A 3EASA 3O83A 2BFFB 3R0QA 3J81k 2JAPA 3VPDA 1IBLB 1I0IA 2ZSUA 3AF0A 3DHEA 4L22A 3ZX5A 3V76A 4K8RB 1XC7A 3WMXA 5J35A 1UFOA 3MJ4A 3W05A 3W0LB 1FFHA 2X1MA 1FNNA 4DV1B 3GLUA 1XG5A 4FT2A 1QP7A 2VUTA 2DBZA 3T34A 2ZJOA 4OO3A 4IFEA 3ZCRA 5AVTA 4WVFA 3E5RA 1NKVA 1V1RB 3IAUA 3MLAA 3UW1A 2HD4A 2WMNB 2VHZA 4R81A 3BFJA 3F8TA 5BT9A 3JD1A 3KVOA 1SXJC 4CM3A 5A8AA 5E2AA 1Z62A 3FMFA 2CW5A 2G0AA 5JE8A 2VAPA 1NMZA 4DSNA 2IEYA 3BA6A 1PDWA 3JQEA 3O92A 2HMVA 3D3WB 3KD2A 4MYRA 1USVA 4I6JA 3IR5A 4CL0A 5LU8A 2JFUA 4DBLE 4LJKA 5KYXB 1HZJA 1G3UA 2V74B 3N28A 1SXGA 3A6DA 3X2EA 3O7WA 1NP6A 2ZJBA 3BXGA 4QXMA 4A16A 4G81A 2IH5A 5F3WB 2FPOA 3EUFA 1MG0A 5NLLA 1Z68A 5F98A 3EODA 1W36D 4F96A 3I1IA 1VB3A 3L02A 3DULA 3BB1A 1GCAA 5IZ4A 3DCIA 1M2FA 1JNYA 3FM9A 4IDBA 5EXDA 1VYHA 3I30X 5HOQA 4H1HA 3E9RA 1S2MA 2Q8NA 1EFVB 3N2GA 5B37A 1Q82D 3KSMA 4B9AA 1YQ9A 2HHCA 1HDXA 4HXYA 4NAUA 3O8RA 3F6YA 2QEQA 1FXSA 4FHDA 4FT4A 5EE9A 5EPUA 4BJ5A 5JZVA 5A0TA 4ZVTA 4E6PA 2Z5LA 4EUNA 1ZI8A 2VHTA 4LYHA 4W5OA 4YRLA 1TYCA 2HMSA 3WQBA 4GICA 4QPNA 4LFBB 2R6FA 4JQZA 1HYGA 3BRQA 2QF7A 4G4GA 4HDAA 1I5EA 4Z1MD 4CEIB 1N33B 3MLBA 1O9HA 4UEOA 1QF7A 3KHUA 1QK4A 4PSKA 1CQPA 3PFNA 3E3MA 1M8JA 3VMFA 1Y8AA 5LWQA 1ILEA 1JAYA 1A8IA 4BVLA 5CX1B 1HDGO 1Z16A 3ELDA 3QOFA 4DANA 5CDTA 5JDIC 1YBHA 3G2MA 3MTDA 1V8BA 1AOXA 3EZYA 4LWQA 5CHEA 3STWA 2OZKA 3AY7A 1GL9B 2P8JA 2ZRFA 4HB4A 4IDAA 1SHKA 4MWBA 4AJLA 1K7SN 4Z2AA 4QUJA 1U4NA 2JGDA 3JATA 4KQHA 3CCEB 4HYYA 3VZCA 3AOEC 4X20B 2CVFA 2H5LA 2W2VA 4LY6A 4B74A 4MWTA 1GG8A 3K09A 2I6UA 3H2SA 1UBMS 1P2FA 2OV2A 5JSUA 4DNPA 1A71A 4JT4A 1HL3A 5MFPA 1VIVA 3NV9A 4H0CA 1JLKA 4H4EA 2MSWA 2NU6B 4MUXA 4RPCA 3E5MA 1NBHA 5CFOA 4TMXA 1R2QA 4KXLA 3VI3B 2IJGX 3A26A 4NYJR 5JO9A 3VFDA 2I7CA 3ELUA 1R6BX 4QUBA 4HGRA 2PDAA 4DSAA 1YI0A 3QWAA 4O2RA 1BC5A 1CYDA 2XUOA 1YB1A 3S27A 2AC2A 3BRWD 4GBGA 1N7JA 1RRMA 1BOOA 1Q5PA 1XZMA 3JZFA 1KH3A 3IR6A 2WOJA 4JVSB 4F21A 2V4MA 1VM6A 1J09A 3GRCA 1UUFA 4CDNA 3JD4A 4G1MB 1J5XA 1TLLA 5CB4F 3OLCX 4AF7A 2RHCA 3L41A 3BMNA 3EQ2A 5DGHA 4MV3A 4UVIA 2XCTB 2R47A 3DFMA 3KL4A 4NL4H 5AKIA 4YRKA 4C87A 2MYPA 1OI7A 1BN7A 3G2KA 1ZONA 4F1WA 1TK2A 3LXRA 2F7SA 1XMOB 4KAFA 3Q7IA 3LXUX 4FGJA 4WUTA 2EX1A 2D0OB 2V7WA 2QLFA 4I81A 2JN9A 3PDIB 1IEQA 4KGVA 4MRNA 4EFLA 2C7PA 1BQ3A 3V2GA 1OCEA 1H94A 5CAEB 2NZWA 2JGEA 2MSNA 2V7VA 2GD0A 1P7WA 4M9XA 2DSTA 5B1YA 4WZ6A 1ZLYA 1QVGB 1J99A 3NDJA 1YJBA 5A4JA 4CLRA 3A8KA 1J90A 2JEYA 3HHEA 3ORSA 4KC0A 3LK7A 2H3EA 1JEYA 3IUEA 2HRZA 2MINA 3NKLA 4HD8A 1F7UA 3B1XA 4XEUA 4A2QA 4ADSG 1ZVQA 5JS6A 1M1ZA 4CF4A 5KU7A 3NHRA 2NMVA 1YDHA 3GLQA 4YUWA 4EPXA 3UPUA 1NN5A 1JXOA 2WWIA 4JIGA 3BTUA 3V7FA 5AXDA 4QDKA 3IR7A 2CL5A 4ZTBA 1M5TA 2Z4TA 1NJ6A 3DFZA 3Q0TA 2YICA 1XMJA 2ZJFA 3Q3HA 4IDCA 4JKYA 4B47A 4MPTA 4MKIA 4RZXA 3L8HA 4J3JA 1Q1GA 4KKTA 4ZOEA 4JMLA 3T4UA 3KZNA 1A8PA 2JEOA 4AG6A 1L9KA 1ZC4A 2H16A 1DXYA 3IMFA 4PHFA 4XH9B 4MWZA 1UDCA 3F96A 3Q5EA 2PGIA 4UJ3A 1USGA 4F3NA 2X1LA 3G0DA 1SR8A 5EFOA 4A26A 1TVEA 2P1ZA 4B35A 1NYLA 4D96A 4YDQA 1UL1X 3SWWA 2QAJA 1V96A 5BN1A 5FFNA 4QTUB 2K87A 3MZ0A 5E95A 2AG0A 4Q66C 4WOBA 2MWMA 4GXTA 2YWJA 4YAGA 4ZIRB 2DG2A 1VCIA 4NZZA 3TAXA 4EB6A 1XDSA 4ISCA 1ZU5A 1DCTA 2X15A 3ICVA 3LUGA 4DNXA 5LQRA 5KS2A 2RGEA 4PAOA 3FGPA 4EW3A 5LM3A 1NPYA 2YKGA 1MVOA 3WBBA 1N2JA 5TSDA 3W8FA 1XTVA 1QLHA 3PVSA 1V3VA 2DC1A 1JF8A 2EKDA 4OMCA 1IU9A 2AEMA 2ZDGA 2W00A 4HRVA 2JAQA 1R27A 2DHDA 3PHGA 4H1TA 2HBRA 1G59A 4YJKA 1CQIB 5HIJA 4J0FA 3BORA 3FNEA 2D2VA 1QCDA 3PHCA 4IIJB 1P0QA 3PJRA 3KELA 1LDNA 3L1IA 4UUAA 3P9PA 1FIUA 2R1VA 4KX5A 5B3JC 4DK1A 1F0YA 5HZGA 1JH9A 1ONPA 2PRIA 1J4AA 2IXGA 3BMOB 3LECA 3T9EA 4WERA 1KYYA 2R11A 3KVVA 5LJLA 4KO2S 2G88A 1JVBA 2OOSA 3NHMA 3TINA 2II6A 4DS3A 4FHEA 4Y2HA 3CWQA 3LUHA 1VE3A 2XXBA 4HDNB 5DMXA 2IHVA 4WBNF 4B3SB 4L75A 1LW6E 4R1UA 4A8JC 4B6OA 5SYAA 2BFFA 4L4SA 2G4CA 3AF4A 4PLCA 2VKQA 1VHEA 3K4PA 5HS6A 1DKMA 6PFKA 2KMLA 2FSIA 1V7ZA 3M2TA 4PBSA 1TCAA 3HDVA 2OXEA 1PV1A 4D1YA 1SY7A 2XOXA 3C4JA 3F9IA 2ZBRA 3D0OA 4GPZA 4LC1A 1NE7A 5K3DA 3KQHA 5CEFA 2ATCA 1JL3A 1OX5A 5K09A 4NCBA 1RWVA 3ILYA 4PRKA 5EXXA 2FPGA 1AMUA 4J7AA 1B2RA 3KNZA 1PKXA 5KWIA 3M4XA 5LLSA 4RQTA 4HNAB 2ZYVX 1GT6A 1IHPA 4Q19A 3UTCA 1A27A 3ONWA 2RBGA 2B98A 3U0BA 1BDBA 3MRVA 2CXPA 1I51A 1B93A 2GCPA 2O1WA 3IKJA 3D8SA 5IPFA 2LXNA 2WSSD 3FCEA 4PNEA 1HLDA 1UPCA 4AURA 4RADA 5DU2A 5BSHA 1CHDA 4Q05A 4FDMA 1GU0A 3GVKA 2W71A 4N82A 4DMUB 3CF4A 2J67A 3NEYA 3UK1A 3PS9A 1OBVA 4R1SA 1TJNA 1MDFA 2ATVA 2DKOA 2VDJA 3LC1O 2B6HA 5LQNA 3W9SA 1TD9A 2LP4Y 3MJVA 5FWAA 3IBGA 1G291 4FWIB 2I0FA 2ZL6A 4OP2A 5JNRA 4GZ5A 2JFPA 4V0ME 4E09A 2X4LA 1T4BA 3UXYA 4YLYA 3T1NA 2OGUA 4FSHA 1U80A 4LJSA 1C7IA 1PG5A 2NSJA 3IEXA 5BWMA 1LK5A 5C8XA 3PNKA 1P3Y1 2HQSA 1AB5A 1UPBA 2VK8A 1RNLA 2Z56A 3GJ5A 3MA0A 5AYVA 2JIQA 1P7YA 2A5JA 2QP3A 1OX4A 1UJNA 3UMSA 4S12A 5KCMA 5E6TA 1FLNA 1H4VB 1MA0A 1YS4A 3OW7A 2BHTA 3G2NA 2V6MA 3PT5A 2RAUA 1YFKA 5CFPA 2QZPA 2ZIGA 3TG2A 3HYSA 3HVKA 1X8XA 2I6SA 3RO7A 1I8TA 1KF0A 2EYUA 1C9YA 2Y1FA 5ITSA 2F1OA 1EFHA 4PXSA 3D8HA 4TN5A 2IK8A 5HM6A 5JIBA 2GJ9A 4JUCA 2XY4A 3DB1A 2VCYA 3MIZA 5CP8A 1SVOA 1O8BA 1FFAA 3FMIA 2WUVA 3NW9A 2XA2A 4EHFA 1OZAA 2HOQA 2VBCA 2ZYHA 3DSRA 3M33A 2JFQA 2OM6A 2R6CA 2VXCA 1O6FA 3KZKA 1QG2A 1U3TA 3CZPA 4DRYA 2BWJA 2GCGA 2VSFA 4WOPA 3TG8A 1FJXA 2AVNA 2Y0EA 2H7CA 4TS4A 3WLLA 4IIFA 3W8NA 4D7AA 5M2QA 1UAGA 2WV9A 2C77A 2EIXA 3FG9A 3LT5A 4CR6A 3ND8A 2EJCA 2PS1A 3NHUA 2OBRA 1NXWA 5TT0A 4QZVA 2AXQA 2NV4A 4QU9A 4BRSA 1XVAA 4EJSA 5K7SA 4PG7A 4P8RA 1TMYA 3SZLA 2I99A 2PRYA 1EK1A 4DE5A 3K94A 3HO6A 4OXXA 4G8DA 3EFOA 1Z15A 1B7GO 3IT3A 5I9LA 4XONA 2EF1A 5HKKD 2IPXA 5CPFA 4MW5A 3C6BA 4IGFA 3FVRA 3QE4A 4GMHA 4K9OA 3WRWA 4J16A 5JSZB 2FVXA 3A1TA 3ISTA 3M5CA 2F8SA 3IE2A 4Q9HA 4MTCA 1M8KA 2OCPA 1EXDA 4B6SA 4BNJA 1DBRA 1HORA 2E2WA 4I19A 2JBWA 4QAJA 3T7IA 1P8AA 2C5AA 1Y9JA 1U7UA 5I9MA 1SKAA 3T3IA 4CV1A 2O5VA 3Q2OA 4C06A 4P92A 1D2EA 2M1ZA 3FDJA 3LF2A 1KVQA 4GMKA 1GFIA 1BWQA 2Z6AA 3AUXA 3IBFA 2JAWA 3NC4A 3S0JA 3PPXA 3VO8A 2DJ5A 1XTRA 3ZI7A 1WBDA 1T1RA 4C05A 4DKJA 5AW0A 4P2NA 5JR3A 2QM0A 2WSLA 2WU8A 4HDOB 1FNSA 3B2QA 2CWWA 1K2WA 1E1RD 1P1HA 1U9JA 4RD6A 1YVEI 3KDAA 4BGIA 4IFBA 2QGZA 3EQ9A 4R8MA 1D5CA 4DDHA 5AIBA 1KYIA 1DUIA 1L5HA 2WZDA 3NQ41 5FD8A 3SNHA 4DY4A 1ZH8A 1YONA 3E8XA 1U7DA 2AQHA 4INOA 1U63A 5SYMA 1CHNA 4UAVA 2ZRHA 1KAOA 3EWIA 3GCDA 5AI9A 4D4KA 1G8GA 1JMKC 1DP4A 3EBOA 3QPCA 3G6EB 4G5GA 4QC2A 4JLNA 5DNVA 2UU9B 3N2EA 3KJIA 2C9DA 2IYQA 1S2NA 3NRJA 4G4SO 4MJ3A 3UKJA 3WR5A 4UE2A 3HS3A 1EUQA 4WZEA 1V0EA 4UKDA 2BUBA 2XUPA 4NEGA 5J4LA 5AVYA 4TYNA 3GLIA 3WBKA 4KSBA 5LBTA 1W49A 2R6R1 1UJCA 3FMVA 4ND6A 2HKIA 3TFWA 5F76A 3EIOA 3WWZA 4EG3A 1UR5A 1RXVA 3JR3A 1E58A 3TOSA 1P77A 4B3RB 3PPYA 1UAAA 3N2IA 1MO6A 4GLLA 3ACCA 3GJZA 4BBZA 2WY2D 1DAMA 3THWB 4O0LA 2C4WA 4MITA 3RS0A 3DMGA 1VHWA 1WO8A 3ZLUA 3Q12A 4BLOA 5EIEA 1GNTA 2KX7A 3GFQA 1AJEA 2G1PA 4CCSA 5HZKA 4KKUA 3SS7X 4WMLA 2JFZA 3VR5D 5D7BA 1G2OA 3VX3A 3ENNA 2A88A 3I6MA 5JW6A 1RLJA 1Y5LA 2R1TA 3AFHA 3EDOA 4V0SA 4BO0A 3U48A 4MK4A 3PC8A 1UT6A 1O5OA 4C4AA 3F5QA 4QA9A 2WU1A 1JPNA 5MGNA 4GKVA 1X19A 2CSXA 2OVFA 5C8VA 4I50F 4L0DA 1R10A 4U7HA 3OZSA 3RB8A 3ASRA 1WZCA 2QXUA 3RU7A 2D4AA 3B1WA 5JZOA 3JASA 2CVZA 2JJMA 1OAOA 4D4LA 2W0MA 4EAAA 1B15A 2R96A 3FMGA 1ZO8A 1MC4A 2F9MA 3TLEA 4A0RA 1E9SA 1H8ED 5BO5A 4WVLA 2B99A 4FMPA 3E8MA 2P2SA 1I3MA 3DCJA 2IU4A 5KNDA 2BYTA 3TFQA 5K1ZA 1C3EA 1Q0PA 4FDAA 2G40A 3K9LA 2L19A 3L7AA 4YPFA 3I92A 2HLDA 2ODQA 2ZWVA 3OLZA 1E2HA 3CZCA 2FUG6 2FYTA 4FCVA 3GD5A 3I2YX 5AWFC 4FEYA 1DWQA 2IYUA 1ECGA 1YQXA 3CX4A 3K4QA 1Z5GA 3EGXB 2BFCA 3G79A 2QZ9A 4LRUA 4LWZA 5DHTA 1R0SA 2IZZA 1N36B 1FLAA 3M1LA 3ASQA 4FYXA 1L4GA 4BQNA 3EPKA 1EE1A 5GONF 5GJWC 1CDDA 1NUPA 3L3BA 2HJWA 4PZLA 2HLHA 2Z09A 3CJQA 1WXWA 1R00A 1GHTA 3QNUA 4O25A 2ZT5A 3ZNOA 2HA3A 1B8NA 2IYNA 4Y9TA 1W4ZA 2XUHA 5J4YA 1EUCA 1JZSA 1T5BA 3NWBA 2EBHX 2ZBPA 2B6NA 5DULA 4F72A 4Z5XA 3ZDDA 4ASUD 2O54A 1F5SA 2IE0A 3LLUA 2ZR0A 4D4HA 4F12A 2Z2YA 4DDTA 3H7IA 4BKUA 2C96A 4BQEA 4XVQA 4RMHA 4JV5B 3ED1A 1BCSB 4LK3A 2BP7B 3HEAA 2DTEA 1GGMA 1R6UA 3NIWA 3ANXA 2IH2A 5DYNA 4QFDA 3X2FA 4TZ0A 2OHHA 3DGFC 3C5EA 2OGWA 4L28A 5EMKA 4RTLA 5B57C 1GFSA 2Q27A 2W8BB 3HXTA 3OZWA 3RFTA 2TYSB 3WADA 4HNAA 4Q1VA 4FYPA 1KJJA 3OJCA 5F64A 3KQTA 2JLQA 4JI5B 1H3FA 4Z4IA 3HAGA 2PFGA 1T9DA 3SXUB 3IPAA 4ENWA 1KDYA 5SY6A 2Y0BA 3TR5A 1CUEA 1WUYA 1RQRA 3C1AA 1NOJA 4ZO9A 1SC3A 1SUWA 3I6BA 1P9WA 4YMGA 1NUAA 4LXIA 3R9XA 1AGYA 1JRLA 2PIDA 1H65A 3E84A 3ONEA 2Q62A 5C34B 3ZKWB 5I5EA 5TS3A 2WU4A 5FQOA 3OE5A 2W2MA 4FGUA 3ZI0A 2XHEA 1Z4IA 4UASA 1ZM4A 4RJTA 3Q8XB 4IGAA 3SU8A 3KB8A 3ZQUA 3IVAA 4M0UA 3KR1A 3FKQA 5FBHA 3D1VA 2QN9A 1RXSA 2Y1GA 1O87A 1EFUA 3Q38A 1Y9EA 2Z2IA 3UOAB 3VGJA 5DN9A 1R8JA 4P08A 1S7GA 3TI7A 3PFKA 3P1JA 2XCSB 1V8OA 3Q5DA 4U4AA 4NCIA 3GFFA 1CRQA 1XWWA 4X7RA 5EZYB 2W2OA 4DQUA 2FZEA 1ZGGA 5WRFA 2G82A 1MVLA 2WJ4A 3KIPA 4KXUA 3FN4A 2C3PA 3THRA 4Z7NB 2A67A 5EPEA 4PZUA 3D9QX 1KYXA 4EENA 5ITZB 1D07A 2ECPA 2VK2A 3UHJA 1IJKA 1DI0A 1EEHA 3L7NA 4CMAA 4X00A 1VI5A 4CQMA 4ES6A 3KUDA 4ZT7A 1YRAA 3P2EA 1TU4A 1OPRA 4D8XA 4R9VA 2NN3C 2RCYA 1T8RA 3H17A 4ZCPA 1RR6A 2MYNA 4KL8S 2IW3A 1PJSA 2P9QA 3EARA 3EF0A 1HE1C 1YR2A 3IVMA 5F1KA 3PX2A 3Q3JB 1R74A 2GTPA 3R8CA 5JADA 5LQKA 1XD9A 2C9BA 2OZPA 3BN3A 1YRHA 3GFOA 1H0RA 1FRQA 1QTIA 2AG1A 1IUNA 2VHUA 1A72A 4I50B 4P38A 4MVJM 4HP8A 1VZ2A 5AKEA 5HTOA 1SHLA 4CM9D 2FPGB 3LDUA 2O7VA 1XTIA 1VSVA 2OFXA 4XMYA 1PQUA 3EZ9A 5CYOA 3QELB 1OA0A 4ZXPA 3RJ9A 4OHYA 1IK4A 3PCTA 3UMBA 1XEAA 2E89A 4YJDA 1G38A 1YR8A 4KSCA 1OFVA 5F4ZA 2CEKA 3A8JA 3AF1A 3ZQJA 3BHJA 5BVHB 4CCWA 3ZS8A 2QEXB 1DLIA 1G20E 2CVHA 4INJA 5A1TA 2ORIA 4J07A 4W8HA 2ZRGA 4YRAA 1PSDA 4MRMB 5I9NA 1OXXK 1QB7A 3V46A 1NZFA 1TGYA 5CCDA 3PC6A 1VCMA 3QLVA 4LRQA 4NC9A 1TCVA 1EG7A 5TRDA 1Q2XA 2UUPA 3A36A 1NOKA 4R01A 4BN5A 3UMYA 4I1PA 3K1AA 3G02A 2OXTA 1Q7TA 3L05A 2YL2A 1G5RA 1UDAA 1VG8A 3BGWA 4ZQEA 4KREA 4MQLA 4M0KA 4UUBA 3IVGA 3QMVA 4ZK6A 2CHFA 1BX3A 1USUA 1VQ7B 1MX9A 2JL1A 2Q3EA 2J9YB 2GDZA 4QM7A 3RADC 1Z39A 4LNUA 4HQNA 1NUHA 3SFTA 3WB2A 1OPXA 3QVXA 1U8XX 2F9LA 4WKOA 2UKDA 3N8IA 5CCEA 2YVUA 1L5NA 1WY7A 1U4SA 1K8YB 4URYR 2PCJA 3SXPA 3UJ3X 1SU4A 4RHXA 3EOZA 1EAMA 2IPLA 1X7WA 4O4JA 2A9OA 4AF6A 2JBHA 2YN0A 4LCEA 4DADA 5C1IA 4URXR 3TNJA 5JQGA 3OLVA 2OCAA 3E9ZA 1G17A 1OAAA 2H7VA 1XVLA 2GYYA 1TO2E 4YCAA 4NMXB 5DYGA 3O82A 2A14A 5CMLA 5G1OA 3KR2A 5E4TA 1OAOC 3U80A 2RGNA 1S1MA 3AGPA 4M2LA 4OHXA 3FPSA 4Y9SA 1F17A 4P26A 3CC4B 1P44A 2K6GA 4KFSA 2YRWA 4I4NA 4IV5A 5CLGA 2PO5A 4MPJA 4GT1A 3TEMA 1GUBA 5CITA 1NQTA 2VT7A 4EYQA 4ZYVA 1RHUA 4ILEA 3OBBA 4L85A 5IFKA 3QEMA 1L5OA 2CBGA 2XA1A 1UMCA 3JZAA 4OYLA 1XPOA 1ECPA 4ITUA 3AVUA 1LU9A 3R24A 5JI3E 4N3CA 1P6XA 3KTDA 4FILA 4GD3Q 2AQ8A 4TXLA 5FNVF 2VWPA 3SM3A 3SVZA 3X1ZA 2ZT7A 3DO6A 1MW8X 5AJHA 4TT3D 1K3UB 1P4AA 3ZV5A 1KRXA 1YJNB 2YXBA 4LE2A 4P3YA 1T25A 1RRFA 1Q0HA 2VRBA 3ZX4A 4BO3A 2Q6LA 1GZDA 3KBOA 3HV0A 5B6PA 3U3MA 4B46A 1KQGA 2PJRA 3A4MA 3THWA 2JASA 5H5JA 1DDGA 1TE2A 4IXWA 2BDUA 1RWXA 1TNDA 2BE9A 2IEIA 2O2ZA 2Q46A 3LS2A 3LZ6A 1E77A 4OXKA 4NCNA 1Z5UA 3MS4A 4OF4A 3VH2A 4BWGA 1YKSA 3K9BA 1AHPA 1B4DA 1CUBA 2CNDA 4RPKA 3E15A 4XA8A 2GJAA 1NHGA 1GAEO 1OIWA 1PD1A 2A9QA 3C3XA 4ZPXA 4F8JA 3Q87B 5H83A 2GNAA 4N01A 4Y2TA 2D0DA 2QN3A 2YHBA 3RJTA 3GEHA 1IVNA 2SICE 1SC4A 2BW0A 2QRPA 3GIWA 3GLKA 4O2BF 3F7OA 5HFNA 3BMXA 4AUKA 3CLUD 1Y37A 2PGXA 1U11A 1AF7A 1JKFA 4DEXA 1FLVA 2PSEA 3AVQA 2A7XA 2FHPA 2BKUA 3RAEC 2IDMA 5DXFA 4ZVUA 3FFXA 4OXYA 4E03A 2HQ1A 1B6TA 1CJMA 2IHZA 1RXCA 4TYMA 5B3KA 1E3MA 3Q39A 1GZ3A 1I32A 3MJDA 4YT4A 1QCCA 3CVVA 3PR1A 1BMDA 4GECA 3ICEA 1TT7A 2KVOA 4YMWA 4IUCS 3TGLA 1HG0A 2YVKA 4C0XA 5AW5A 3SQWA 2ZZEA 2WAMA 4KO1S 1KOJA 4EW2A 2Y1WA 2JGNA 1E3SA 1QE5A 4Z6KA 5BMOA 4HXGA 1QGZA 2GXSA 4DJDC 4NX2A 1CUCA 4KFUA 2QU8A 1LJUA 3UJNA 1RRCA 4YRDA 2AWNA 3UAOA 5K3EA 2PUGA 4V0MA 1HX7A 1FYEA 4W5JA 4DMKA 5HZMA 1ZITA 2JIRA 4K6GA 2BFNA 3AYXB 1AQIA 3VYRB 3GCXA 1FEZA 5HMMA 3DE4X 3H2JA 3DEYX 5DTRA 4CFSA 4EG6A 2EFDB 1OI2A 4MR8B 4UE6A 2B2NA 1J2UA 2K2QB 3N2NA 4G63A 3S4YA 1BXRA 1UWCA 4V24A 1P3JA 5IDVA 4GL2A 2P9ZA 4P3PA 3IP8A 5I7RA 2XXJA 1O4VA 3H13A 2V65A 4MVWA 1R1DA 2YXNA 4Q3EA 1FMLA 1X9HA 3DT9A 2GRAA 1A8QA 3PL1A 4H27A 4GOND 1KEPA 5IKEA 4HH0A 2HIAA 3TQCA 1L3CA 1RZ3A 2Y05A 4IH1A 1VP3A 4ZAZA 1PQPA 1C50A 2LDBA 1IMJA 1G5IA 4ACBA 1FFEA 4S1OA 2CZQA 4X1OA 2WG1A 2HYIC 4G7XA 3WK6A 4G0WA 4EGJA 3I9V1 2OZLA 4RACA 1SBCA 2D3WA 3JQ9A 4O4JF 3ZY5A 3G8CA 1J97A 5DFAA 1FTYA 1HLFA 2O05A 2OORC 5EUCA 1HTTA 4D8VA 1GAXA 4Q9LA 3K6JA 4PGMA 2BM1A 1AGXA 4G1CA 5D5QA 1BU5A 4KOEC 1HQYE 1X6VA 5C4GB 1W9MA 1J2EA 3S7ZA 4DDVA 3LFUA 1EZ4A 1GRCA 3PE3A 1UC9A 3IQZA 3Q6MA 4RL6A 5H9VA 1ZMBA 4ALNA 5JSFA 1AA9A 2P9CA 3GLTA 2QBYB 2YXDA 4IFIA 1OHHD 1G6Q1 1W29A 3C39A 2PYZA 2PHZA 4JR0A 3IJ5A 4ZARA 1H9BA 2HQBA 1T36A 4AZSA 1ZIPA 1QG6A 4WXHA 3E48A 3A25A 5JDCC 2G77B 4LRTB 4RFVA 4WJLA 3IEUA 3JD2A 3ET5A 3NHAA 4LGMA 1CLUA 1ULTA 5SY9A 2C82A 3WRYC 2GN6A 3DE7X 1VQMB 2D06A 1Q77A 1NBMD 2IPAB 2J0UB 4JZKA 3JYOA 3MD0A 4WXPA 4XLLA 3ZWNA 2UXCB 3WTBA 1X3LA 1KY2A 3LP8A 4B8YA 1ZMXA 4E31A 1XZEA 3G9ZA 1D2AA 3O8OB 4GS5A 1W7AA 2GYWA 1V41E 5F1YA 1SHJA 3Q3CA 1TYDE 4MRRA 2PSHA 4K81B 2CMGA 1TPYA 1YLOA 2V3CC 1KBOA 3IEPA 3L7DA 4BNMA 3QV2A 4IIJF 4WESA 5E38A 1L4KA 3ZWOA 1OR8A 3IIEA 5KSPA 2ID7A 3R6JA 3I2KA 1P1IA 3NPAA 1ACJA 2Y66A 1S02A 3FJYA 4AXXA 1P73A 3B1JA 3CE6A 2VJMA 4C0AC 1GA6A 1P2VA 4PIMA 2H2IA 3KT8A 3MJTA 5H02A 1YA6A 2GR9A 2Z5VA 4Q1CA 4P5EA 3ZC3A 3BK7A 3B8EA 1E6EA 4NPHA 1LLQA 5AQ1A 2QR3A 4JHXA 3W5IA 3ZBQA 2A1TS 3WB9A 3H5IA 1SH7A 2DY1A 1CUIA 4DG9A 1L1QA 2XHZA 3IKVA 2Y0CA 2P6PA 1E4YA 4WACA 3U3ZA 3JVVA 5AQEA 4DEYA 5ESDA 2OHXA 2R8EA 4KFTA 3NGMA 3QBDA 5GJCA 2FHSA 4BDTA 5LDHA 1U3WA 1I7SB 1GQOA 2Y6VA 3D4OA 5I4KA 1Z2PX 4TLLB 3A6HA 5EHQA 4G36A 5KEIA 5IM4A 2JC3A 3OETA 1U6IA 3V8VA 1QO0A 4D0LB 4OGLA 4FHZA 3B1ZA 1H2ZA 3AR7A 5HCUA 1U1DA 1YUMA 4MB0A 3SVTA 2Z6BD 1OH5A 2GN4A 3IVCA 1DQRA 1F8UA 3IUJA 1TB4A 4OBBA 1Z36A 2I1LA 1TVMA 2ZE5A 2WAOA 1GT91 2JIBA 2WJAA 3HYTA 3QXJA 4NU6A 1U8UA 1YACA 1ZD2P 2ZYIA 3OX3A 4GPBA 2C9OA 4ZO4A 2WWGA 4ID3A 3A4IA 5EE0A 2Q1TA 2HL6A 1R6VA 4DLVA 4FN4A 5JRDS 5EE3A 4PFJA 5F35A 1AGRA 3COSA 2ZXHA 2Q4RA 2GQFA 1EXVA 2Z8YA 3MWDA 2QUAA 3EXEB 3HDGA 4RTOA 2VNIA 1U04A 2HRBA 3LH5A 4YMSA 3OZBA 1MX1A 2Y27A 5K6RA 4RVHA 1ZNXA 2V59A 4F5DA 3BICA 1PT6A 1D1SA 1GU7A 4N1AA 2JLUA 3H9QA 4YYEA 4BNFA 3ESCA 4RA6B 4RDHA 4CHTA 2P9JA 1V9LA 1OBCA 1NZJA 4UBNA 1X9IA 3H11A 2FX3A 4O1HA 1X7WB 2HIHA 1TT5B 2A0UA 4N3NA 3DYVA 4C7VA 3EIHA 4M6WA 1H9CA 1G6HA 2ZSJA 1HTBA 2B9VA 2WBLC 4L5AA 5DNCA 1BHQ1 5M04A 2V03A 3L9WA 4KMOA 3HP4A 3UUWA 4MQEB 4PQEA 5CT9A 4B0PA 4PYLA 2R6DA 5H81A 5TGZA 4RNDB 2XTJA 5JBQA 2OHOA 1O9BA 4JYAB 4Z8YA 4DARA 4PG8A 4XX0B 1GZHB 3T12A 1N0WA 1RT9A 4GKJB 3CT6A 2WSBA 3GUUA 1CY2A 3GNTA 2GFIA 1D2HA 3IE0A 1YUNA 2V58A 4C7XA 3U61B 2MR5A 2V5UA 4LJ6A 4AIIA 2ZSAA 2TMKA 3VGPA 3TVTA 1YA8A 2H11A 2RHTA 1PUJA 3WWEA 4M88A 2JA2A 4UXHA 3P0FA 3ZWXA 3NHSA 3GFPA 4Q7LA 4WECA 2RGXA 4D4JA 3WGZA 4DA8A 4DNOA 4EEXA 3OOEA 4Q47A 1SK9A 1C80A 1I0ZA 1AC5A 2PUWA 3HJFA 2FEAA 4ZT5A 4YJ3A 3WYDA 2Y1OA 1KMNA 4X5OA 2H2GA 2A3NA 1HA3A 2QN1A 2WHPA 4Z3DA 5KC9A 1ZINA 2O4CA 1SU8A 4MR9A 1B8UA 1Z0KA 4F2GA 1RTTA 3RABA 3DZBA 3R6TA 4O4JB 4M1MA 2XUFA 2ADOA 3AZOA 4HHEA 4IXNA 2XBMA 1IY0A 5AW1A 2YX1A 3QE3A 1NW3A 3UK0A 5LDGA 4BC1A 3WS7A 5HJ5A 1TVCA 3OP1A 1DX6A 2P2CA 2RJNA 1ZM7A 4G0OA 5CM8B 4G26A 4LFCB 4MCHA 1NI5A 1XE3A 3H9EO 3P27A 4FR0A 4OGKA 4X7MA 3IPLA 2I33A 3G0HA 1KVRA 1DVRA 5AVVA 2RE8A 8ATCA 1IM8A 2ETVA 4BX2A 1QIJA 5LSAA 5JO0A 1GPDG 1JTVA 1XMXA 2G72A 4ZI7B 2A2ZA 4ZRNA 3E53A 4JUIA 3JQPA 3VDXA 3WMFA 2NVOA 5FWXA 3A6GA 4TT8A 3I6YA 1ZN9A 3TOCA 4ZU3A 4R3NA 1E3XA 3IOBA 4IIGA 4XYLA 4DNFA 4MVJI 2NAFA 3QEMB 5G41A 5KMGA 4X90A 2JD0A 3EW9A 1T1IA 1Z4JA 1E0SA 3VH4A 2J0VA 3S3TA 3X0DA 3A9UA 2NZJA 4I2VA 4NDZA 5T57A 1NX6A 3O0DA 2GYVA 2RAVA 1GZ6A 2IGTA 4Y2QA 1B1CA 2DHQA 2EU8A 3EEFA 4XIFA 1R0WA 4U2BA 4F71A 2G1KA 4KOAA 3ERCA 3BT7A 4ZGBA 2X0NA 1QFMA 5JJLA 4IIYA 1TA9A 4D25A 2GDJA 3ZIDA 1N9KA 2FKNA 3AR4A 4BVGA 1NQWA 3CG4A 3DMHA 4KXFB 3M4ZA 2ZUCA 3Q9SA 3BIXA 4B80A 2GBFA 4IIHA 3UAXA 5AXCA 4CGYA 2BGGA 4MMZB 4DIEA 3BF8A 4JHLA 4X8OA 4FC6A 5KQPA 2FW9A 1D9ZA 1GQRA 1T0PA 1DX9A 1B23P 4BU1A 1I18A 3Q6NA 4P86A 1KO5A 3CG0A 1W36C 3JQDA 2AZTA 1Z2CA 3ZH9B 3D4PA 4U5XA 1MQ9A 3COYA 1G0OA 3GJQA 4LOIA 1GUFA 3AJRA 3GUZA 1V1JA 4HS9A 5CAEA 3ILVA 5CTAA 4D4GA 3LZCA 1HPLA 5HR5A 4TKOB 1GWNA 3CLSD 2BFOA 1Y5IA 2IYYA 4XM1A 1DIBA 5EWJA 4YNBA 4CKZA 4HEHA 1OT3A 3DMTA 3FWYA 4LC9A 4C6SA 1LUAA 3PSHA 2IHJA 3NHBA 2F1HA 4TKVA 3ADCA 1U1EA 2CHVA 2VK4A 2L0XA 3QLVC 3WISA 5KQMA 5LYYA 3ZJ4A 1YXMA 2WTAA 5DBEX 3JU3A 3V80A 3W9UA 3QVGA 2JI6A 1D1PA 2XZOA 2CWDA 2A9PA 1U2DC 2GPYA 3G9UA 4DJFC 4MDEA 5D3MA 4KXQA 4YI5A 2TMDA 5FNVB 4WLUA 3PJFA 5KJ1A 4I8IA 5LFAA 4ZVPA 3GIDA 4O8ZA 3GU3A 4JJZA 1E9BA 2E5LB 3DDOA 5I9BA 1JG2A 5U9CA 3GFSA 2GCNA 4ZOLB 3SAJA 1KYVA 5BPHA 5LKAA 4H16A 1KO1A 3BXZA 4KWCA 4X1YB 1U4OA 5HE8A 2W2LD 4I55F 3FJOA 4B3CA 4WK0B 3QK7A 4W9MC 2BF7A 3ETJA 4CCYB 5JOQA 1JFVA 1ZESA 1CDZA 1K8ZB 4LXHA 1UKVY 4JX8A 5J1TB 1YQDA 1SBYA 1NXVA 4YPOA 1P5RA 1CQZA 2FN9A 2XVAA 4WPGA 2O2CA 5A5DA 5BORA 1OXMA 1N32B 4FX5A 5E9QA 1EHCA 2WPDD 5HDQA 1GTSA 2FEXA 1J6UA 4UATA 2I7TA 3QE2A 5HG0A 3PNLA 2BHRA 5H68A 5FAXA 4BNUA 2H2HA 4R8RA 1C3VA 4GIBA 4XSVA 2GPBA 3FVTA 3PDIA 4DDKA 5EP4A 1JU9A 4BWYA 1UP7A 4OB6A 1DIGA 4LSGA 4NAVA 4X65B 1THZA 2DFVA 1TF5A 2YFQA 4KWEA 4MJLA 2V3WA 2GVDC 3R41A 1ZSNA 3BJZA 2FPIB 4JU8A 3U7IA 2ZR7A 3O3OB 4HMOA 4RCVA 4OP3A 3VR2A 4EKYA 1GQFA 1XTKA 2ZJ2A 1LC0A 2XCOA 1XWIA 3HSKA 4JUAA 4S35A 3VR3D 2BFAA 2YUIA 3V4LA 1XZFA 5JATA 1MJGA 2VBVA 2B30A 4LKOA 1WA5A 4DDUA 2I9KA 4DABA 2EV9A 1T35A 4QQRA 1PJ3A 4IZHA 3G8YA 1MAHA 3MTGA 1O95A 2FWIA 4LF6B 3AMVA 1V3QE 4D3ZA 5IU6A 1O4WA 4AZ3A 3WIDA 4YECA 3ASYA 3GAAA 3TS1A 1TTHA 4BB9A 5ALYA 3IVXA 1WX1A 4XARA 4OHOA 4F06A 4Y1RB 4ECEA 1NQ5A 2EBWA 2AG8A 3G0OA 4ZV9A 4NXMB 1UPFA 1ZOPA 3IA2A 4OG2A 4V39A 4D3YA 5AOCA 1FMFA 1NIJA 3F2VA 4EUHA 2WKSA 4M8LA 4ENUA 1DJMA 4Z9XA 1ORDA 3E9YA 3G0BA 4IILA 5EEHA 3SQNA 4BO9A 3KB2A 1YULA 2C94A 1SOUA 5G4LA 2H1CA 2VJPA 3EFBA 4IIVA 4QBTA 4YV7A 2ZITA 1NR5A 2QLTA 3CXCB 5KCZA 5AR1A 5IDQA 3KEWA 5JNLA 2OCYC 5K8VA 3OHSX 2GJKA 4ND2A 2HWKA 2HHAA 2JATA 2YDXA 3O75A 1IQPA 4M1QA 2W9XA 1L5QA 3O26A 1PJTA 1Z3CA 4C0LA 3WKCA 4F9EA 1PEKE 4X41A 4BLVA 1IB6A 1KK0A 2RGAA 1M66A 1CY8A 4OGWA 4CMIB 4X06A 4C30A 1G21A 3Q6RA 1KIAA 3KB6A 3AHFA 3SKXA 5CH5A 4EUKA 3SQXA 4X45A 4DV2B 1K4MA 5KIAA 4C2UA 4ZYYA 4Q3BA 4U6SA 4L72A 4K0KB 3JQ6A 4WN9B 1JA0A 1ZCZA 1NY6A 2R6GA 4IDPA 4PPQA 4YS6A 5TRTA 1T36B 4OUDB 1PFYA 4BQIA 2JLZA 4M9UA 3TRFA 3RUDA 1EVJA 4F0JA 2VJIA 4P7JA 3GRVA 2HCTA 5LP1A 2D1FA 1F1BA 4TXJA 2XT0A 1JR3E 4IIJA 3TW6A 4X1IB 2PPVA 4IICA 4RIEA 1X7GA 2ROQA 3FFBA 4OXNA 1FJHA 2CLCX 4OHRA 1Q86D 2H4JA 1ZPDA 3TYXA 4E5PA 2CDNA 4URVR 3NWPA 1JTEA 3DBLA 4KFRA 1R6DA 4WLOA 5AOVA 1P72A 1N0VC 2Y2UA 4PLPA 1HDRA 4AYWA 5AN9A 1PWXA 3UWSA 1YRBA 3OCJA 2Q4TA 2HCRA 1T43A 3G1UA 3NYQA 2EZUA 2XB9A 2MSCB 3DR5A 3R6KA 2VRCA 3E23A 3WK7A 2BCEA 3I5XA 1KEVA 1LXCA 1SCUA 2GF0A 4GBJA 4PAWA 1LW7A 5F5LA 2HWXA 3LX4A 4MH0R 3RVQA 2O8CA 3TK1A 1L2TA 1MBZA 2D74A 1XZGA 2QTBA 5F3DA 1R9NA 3WWCA 4X85A 3GAMA 1F2TA 4OEHA 4V0QA 3T6KA 1JJVA 2LR0A 8MHTA 1N5MA 2JI8A 1KWGA 2ZT6A 5HXBA 3CKMA 1E2MA 1N06A 2UZ3A 1E7MA 1T2CA 4AS1A 1MNQA 4MO2A 2AEJA 4ESOA 3IBCA 2HQOA 4Q7MB 1NG9A 3BZBA 4US0R 3AKYA 3VAZA 4XDGA 1DCKA 1DC4A 4QOHA 4DAEA 1LVHA 1Q0LA 1WD7A 1RWKA 3IIMA 1U3FA 5B7GA 5AW4A 3QENA 3WMWA 4Y6SA 3G4SB 4M8NE 5AW3A 1I7DA 1WMDA 3N86A 2J87A 3FHOA 1RFLA 1NWHA 1RWMA 2X5KO 3KAQA 1EI9A 3TLZA 2CD9A 1D3AA 2FGKA 2Q3DA 2GXAA 2JHCA 5JANA 3FGZA 3LT2A 3NALA 3O3NB 4AF8A 3FHCB 4EYEA 2X53S 2B4KA 5IJ0B 3O0TA 1SVLA 3PXUA 5DWVA 4I5FA 3IDZA 2Y93A 1ZJJA 4RK0A 4M1EA 2CDRA 1IJFA 2ZE8A 3IMCA 1E1DA 3UKOA 4LFAB 5KQGA 4ZO8A 5TPZA 1EJ0A 4MWDA 1A3CA 4TYYA 2A94A 2CDAA 3R5SA 3FAKA 4JT9A 4M37A 4R16A 5D8DA 4ZRDA 3DL7A 3FSJX 1O96A 2M6RA 5EP3A 4A0SA 3ASSA 3EC7A 4CF3A 2ZRMA 1JG4A 2Q5QA 3GT0A 1YAJA 2DUNA 1C3XA 1MUUA 5FUXA 1L7PA 3DE1X 3PXAA 3LX5A 5B36A 3ANSA 3FFAA 3EXAA 4GKKB 1KH2A 3JQAD 1R3DA 2PXCA 2V6FA 1QRAA 3EEQA 2IWRA 5A4FS 1F2UB 3HCWA 4GP6A 3VYSB 3UH0A 2KSQA 2DT5A 2IEDA 4MGKR 4HC4A 5FPYA 4H77A 3FYSA 4RE5A 3RVKA 3I4FA 5GADl 4Z53A 1S3IA 1NR1A 1B0UA 3NJ8A 1JHZA 3OF5A 2NP6A 5K8CA 5CVVA 3E0XA 3RJ5A 4LZPA 1BMQA 3RWMB 3BGSA 3ORFA 1ZIXA 3CW8X 4QJ4A 4TTIA 2P9HA 3SGLA 1RYBA 2X9QA 2ZU0C 3WSWA 4D0NA 3O84A 1UK9A 3KPUA 3MGBA 5KTPA 1KQOA 5EAIA 1I5RA 1A5AB 1P9RA 3OO1A 1RLIA 3DDYA 1U6JA 3IQGX 3QJYA 5DZSA 3O94A 4OA5A 4ZGWA 1OUMA 3EXG1 2P5UA 1QP4A 4LJAA 1RM4A 1W1WA 3CW9A 5F7ZA 4R51A 4CIYA 2WUDA 2J41A 3IP7A 1JDBB 1I6MA 1ZHFA 4Q01A 3OKCA 3SLKA 3T3GA 3N3BC 5JZBA 1WQ3A 4UAUA 5KJEA 1TQ6A 4IPTA 2Z2KA 4TV8A 4NPAA 4B5LA 2C9MA 2I6XA 4BE9A 2ZB8A 1GN8A 3PX7A 1VMEA 3P0EA 1TC2A 1U7ZA 4TV8F 1T2VA 1W8DA 3N76A 3IHKA 1JJFA 3O9ZA 1PP4A 1WD5A 2Q0HA 4HAVA 4HDSA 4NLLA 4WKBA 4DGSA 2ZBVA 1K98A 4UHKA 1E99A 4OOXA 4XQFA 4N18A 2JH3A 2JF0A 2X2FA 3EEYA 1XVUA 1Z35A 3HGQA 4J2HA 3EH1A 3ZCXA 1G9SA 1Z74A 4Q39A 3IFSA 4BX3A 1NC3A 3OO0A 3TRIA 3FBGA 521PA 2IOQA 3T7JA 1U8EA 4ZYLA 3HXMA 4HE5A 5AVOA 2FK7A 1J20A 3ND6A 4HFRA 2HJSA 4DGQA 5DRTA 5MN6A 2BFEA 3QKSA 2RKOA 4QQKA 5DEIA 3NFYA 4N48A 4R2LA 5BQOA 1U2RA 2O3UA 4HX5A 4G0VA 1HZZC 4HDKA 4HFMA 3GPLA 4MR7A 1YS7A 1FLDA 1WOPA 3LFHA 4OHCA 4E2WA 3FHJA 4LPSA 4IO0A 3KCQA 2GK6A 1JJ2B 1Y8ZA 2FPKA 2ZGVA 1G7SA 4N8SA 1JHAA 1W5EA 1KI1A 3QVGB 4UCWA 1JHRA 4IY1A 3S2YA 1DO2A 1EUDA 3W8DA 4RDIA 4V0KA 4DCSA 3HDTA 1FP2A 5K6AA 4UU1A 4H3KB 2UYGA 5DNUA 4FWBA 3NVMB 1Y89A 4B6FA 3U44A 2Y1LA 2EGHA 4ZOCA 2NTEA 1VLHA 1WJGA 3V33A 4IBOA 4FOLA 2VDNB 3B3JA 4M7PA 4FCWA 2DFTA 1NL3A 1BVYF 1WXFA 1XZ8A 4K3UA 1GUYA 4OQDA 1E1NA 2CLLB 3B36A 3Q7PA 4DVGA 1EP9A 1HEIA 2POCA 4ZV7A 5LLDA 4JXXA 3D3QA 1TZCA 4B4DA 1NVAA 2XI4A 1BU8A 3NNNA 4NMMA 3IUQA 5GTDA 2XCRB 3ZWWA 1UFQA 4MUKA 2J7PA 4AC9A 1KS2A 1GD1O 4RGYA 2GAAA 2J9FA 1KVTA 3OJWA 1TIPA 1OF1A 2XB2A 4NNJA 1OX6A 5CNMA 3TLXA 1L4UA 3U7JA 1FRNA 1Y4ZA 4N5LA 5DGXA 1WSWA 2WHRA 3HU5A 4FOOA 1MCZA 1IRIA 1T9HA 2O2EA 2W4QA 5IAKA 4A3SA 3L0OA 1N2ZA 1GKUB 1VPDA 1ES9A 3K5IA 4K9QA 3DD5A 4RSGA 3NCTA 2ANCA 1OMOA 4JR2A 5HUHA 5TMEA 4RY0A 1DADA 3JU4A 3THXB 2Q3LA 3B52X 2HA0A 1N2IA 3IAS1 4QNMA 4A1OA 4UUNA 1Z6XA 2Q41A 4ZVRA 1ORTA 1K9MD 2WQZA 1R0ZA 3E6AA 4TMVA 4QQNA 1LSOA 4I5DA 3DLPX 4RK4A 1RHMA 5AKHA 2Q29A 3PVDA 1KR5A 3BM5A 3RIXA 1RI5A 5DBIA 3T5TA 3BHMA 4A6DA 1D0IA 4KDFA 1N6KA 3DFUA 3FGNA 3K0AA 1VYVA 3QUQA 5L4NA 3LUPA 1KC8D 1H5UA 4MICA 3NDRA 1BS2A 5E6RB 3ZLTA 4JXZA 3GLFA 1A8UA 3EGXA 4YMUA 1O97C 1ORVA 1R6XA 2AJBA 2YJGA 3HSSA 2VG8A 4U7JA 4ZWNA 5FPSA 5IVIA 4CTMA 3P9RA 4MYTA 5CDUA 1SVWA 4DZTA 1JHDA 3ZD7A 4FCCA 2Y4OA 3STYA 2WTEA 1Y1QA 3IPRA 2QM3A 2Q6OA 1V26A 3LBHA 3PFFA 3ZD6A 1NV8A 1R8XA 3HSYA 2H1LA 3CKYA 3D2CA 3JS5A 4X0EA 3S1LA 1U3DA 3AGQA 2N75A 5JRJA 3EA4A 4ZODA 2O2IA 1QQTA 1WKCA 2GT1A 4UZUA 1KI2A 4R3UC 5TX7A 5C0OE 5A7GA 3RHSA 3RSQA 1BWSA 1K86A 2PLAA 2JJ2D 1BXKA 1MTOA 3VNUA 5FTJA 4F5ZA 4QASA 2BUAA 3M0EA 4YJFB 3RG2A 4DK0A 3K8YA 1G41A 1AHNA 4JLVA 4RD2A 4PW0A 1GNPA 2O59A 1Q3TA 1NLFA 5D5PA 3OJOA 1WB6A 3A3PA 1PUXA 3DE2X 3OZ7A 1MNAA 1FUIA 2WICA 3CURA 1L7NA 3S2UA 3M49A 5HJ7A 5ALVA 3CCRB 1BDJA 4EW1A 4F1KA 1DRUA 4F4CA 2YZKA 3UT5B 3EPLA 1XTQA 4BVKA 1PAUA 1VXOA 4MI1A 1KSHA 3TUIC 5C1BA 3OMLA 2X14A 2