2RC5A

Refined structure of fnr from leptospira interrogans
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
308
structure length
306
Chain Sequence
PTREPQINLFKKSNPYKAKVISNVLLTPETGTGKRPKKEGEALVHRIVLAIDHSAYPYVIGQSGGVIPPGEDPEKKAKGLADVGYTVRLYSIASPSYSFGMKEDNIEFIIKRDNIYNGNIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFLLPNTDFSGDIMFLATGTGIAPFIGMSEELLEHKLIKFTGNITLVYGAPYSDELVMMDYLKGLESKHKNFKLITAISREEKNSFDGGRMYISHRVREQAEAVKKILNGGGRFYICGGPKGMEKGVIEEIQKISGNTGTYEEFKHHLEGAHQLFVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Leptospira interrogans FAD-containing ferredoxin-NADP+ reductase and its complex with NADP+.
pubmed doi rcsb
source organism Leptospira interrogans
molecule tags Oxidoreductase
molecule keywords Ferredoxin-NADP reductase
total genus 89
structure length 306
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2rc5A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2rc5A02
1EFCA 4ZCMA 1OB2A 2E1RA 3B78A 1B23P 1SM4A 2NPFA 4ZCLA 1Q82D 3W2GA 3WNBA 2XEXA 4R71A 2QTLA 3ZZTA 3G6EB 3I1FA 4J0QA 1AIPA 1KC8D 2XNJA 3QFRA 3AVYA 3OJWA 3OJXA 1HA3A 2HMAA 1H42A 3G4SB 4RCYA 3G71B 1E63A 1EFTA 1TTTA 4PGOA 3AVVA 2QMUA 2BM0A 4P3YA 4B43A 2B5OA 1N0VC 1B2RA 2C77A 2VZLA 2RC6A 1F60A 3CCMB 2XNCA 5TY0A 3AVXA 4AF6A 1A8PA 4ZV4A 1G7RA 3CCRB 1GAWA 3AGQA 2EFGA 1ZM2A 1FNCA 2PLFA 3CMAB 1XB2A 2QEXB 1R5NA 3CW2A 1KRHA 3OZUA 1FNDA 2BGJA 1KK0A 4YAOA 2GQFA 3MCAA 4LBZA 4UAJA 3WYAA 4H9GA 1QG0A 3CB4A 3E20A 3QFTA 2YWEA 5DSZA 5TV2A 4ACAA 1W34A 5EMNA 2HCJB 1CNEA 4F7DA 1VQ8B 3WNDA 3WNCA 4AF7A 5GV7A 1AMOA 1VQ4B 1BX1A 2VNIA 3A1FA 4MYTA 3CXCB 2OK7A 3ZBUA 1FNBA 1S0UA 4YAUA 1SKQA 2OTLB 4RD6A 3W2HA 2AHOA 4RD3A 1YIJB 5HXBA 1JA1A 1VQMB 1FDRA 3W5HA 3CPWB 4Y9UA 1U2RA 5H5JA 1E64A 4ZCIA 1EP1B 3VNUA 2VYQA 4IW3B 4G1BA 1QUFA 1FRNA 1G7SA 2YWHA 1QVGB 4TMWA 3P27A 4Q7JB 4LC0A 2YWFA 1QVFB 4TMXA 4MYUA 3ZBTA 1XE1A 1VQ9B 2DCUA 3CMEB 2VNJA 3CCQB 3QSYA 1WDTA 1Q86D 1IJEA 1EFUA 1GR1A 4DQLA 1IJFA 1CNFA 5FA6A 1KK3A 4PC1A 1J9ZA 1GVHA 2B7CA 1D1NA 1QFZA 4M53A 2GPJA 4P6VF 3LVBA 1CQXA 2PMDA 4NCNA 2BPOA 2OTJB 4EH1A 1GJRA 1R5BA 2DETA 3CCLB 3WXMA 4LBVA 4Y7CA 4G1VA 1W87A 3W2FA 3ES9A 4B47A 1ZM3A 1QGYA 4YHBA 1IB0A 2OK8A 4QHYA 1EWYA 1VQLB 2DY1A 4WQMA 4Y9RA 4ZGNB 3JQQA 1EP3B 4TMZA 4AC9A 1EP2B 1VQKB 3VNVA 3U6BA 3QFSA 1D8TA 1KD1D 4B44A 1K73D 3CC4B 1VQ5B 3V76A 1D2EA 1VQPB 3LO8A 1GAQA 1JB9A 4RD0A 2DERA 1DDIA 4B48A 3OZWA 4TMVA 5H59A 4G5GA 3W5VA 3AVUA 2VNKA 1E62A 2VNHA 3B82A 3WBKA 1TUIA 2PIAA 2J7KA 3JQPA 1BQEA 1G7TA 2ZITA 4DQKA 3I55B 1QUEA 1QX4A 1OGIA 3FPKA 4RJLA 4BPRA 1BX0A 2BGIA 4M0LA 4QFMA 1M1KD 1VQNB 1BJKA 1W2BB 4M4SA 2C78A 3LYUA 5THXA 3J81k 4FN5A 3VMFA 2HDNB 3B8HA 3P26A 1VQOB 1KJZA 3OW2B 4NBSA 3OZVA 1DARA 1QFJA 1UMKA 3MMPA 1FNMA 1OB5A 1I7PA 1K8AD 1W35A 1DG1G 3QE2A 4HE5A 4M2LA 1VQ6B 4C43A 3CCVB 4RD1A 1QGZA 1K9MD 1N0UA 1M90D 3CD6B 2BVNA 2FX3A 3WBJA 3QFCA 2X3UA 4HE6A 1FRQA 1EXMA 2BM1A 4FK8A 4YAFA 1QFYA 1G7CA 1KQSB 4N3GA 1F20A 2BMWA 5JBQA 5TR9A 3JQRA 1H85A 4M1KA 1YJWB 4PC2A 3W5UA 1N8RD 1YI2B 2BSAA 3SJZA 1QGAA 1GO2A 2BV3A 3CCSB 3ZZ0A 1ELOA 1YJNB 2QDXA 4ACBA 3CRZA 1TVCA 4U9UA 1ZM4A 3VO1A 3CCUB 3CCEB 4TN1A 4K1XA 1KK1A 1KK2A 1JNYA 5GV8A 1DDGA 1S72B 4B3XA 1JJ2B 3PENA 3ZZUA 4PC6A 2BN4A 1YHQB 2CNDA 3AVWA 3MHPA 1OGJA 4FWTA 4TMTA 1Q81D 1ZUNB 1Q7YD 2QTZA 4RD2A 4YALA 1NJID 1TLLA 3U2QA 5KSWB 3LRXA 2DEUA 1QH0A 4N3NA 3CC7B 3AVTA 5AN9A 3FJOA 4PC3A 4RD4A 3I56B 2QN6A 4LBYA 3CCJB 2R6HA 3WY9A 4YAWA 3U6KA 2CRVA 2B7BA 3VO2A 1YJ9B 1VQ7B 2YWGA 1YITB 2QA4B 4ZGQB 4B4DA 4RCZA 1R5OA 2BF4A 2RC5A 1KTVA 1ZM9A 1NDHA 3E1YE 1JA0A 3AGPA 4C0SA 2D74A 3W2IA 3W2EA 3ZC3A 4LBWA 4PC7A 3CC2B 2EIXA
chains in the Genus database with same CATH superfamily
1ONOA 4I4LA 5JJBA 3LSTA 3U4DA 2AFIE 1WRBA 3NS7A 3BH4A 5A3QA 5KJ6A 3PA8A 4YEDA 5DNWA 5E6UA 1JR6A 1Z26A 4QL3A 1NA5A 2YXBA 4AZ3B 5NLLA 3N5CA 5KX5B 1BLIA 3PNYA 5JD4A 4H3HB 4EY3A 4AUKA 3AEXA 5ICSA 5H4HA 1XVLA 1UDBA 3QQPA 3R3UA 3W6ZA 4LCJA 3FNGA 4GWLA 1NUTA 2X2PA 4QOSA 4Z4QA 5H8WA 2G71A 1H6BA 1N5KA 4G2NA 1KC8D 4ISBA 2BTQA 4UNPA 3T3DA 4B40A 4YIKA 2QUIA 2XDAA 4YIHA 5HWSA 4ZU6X 3L4BA 1TLFA 4YJDA 3OJXA 4AQYB 3DLBA 5J2UB 3J80A 3PFNA 3PPVA 5I5GA 2HJHA 5CX4A 1B41A 3TWOA 4L7VA 1DLJA 4AQ7A 3OT1A 3TBKA 2JLWA 4ZI5A 5JH7F 4RZ3A 2VPXA 1TVEA 3D2LA 4FDAA 5AVXA 2Q29A 4GXTA 3N75A 2WF6A 2Z4SA 3F5SA 3L3BA 5TQJA 1PEDA 2EDCA 2WWFA 1XZNA 4QGSA 2TECE 2XDWA 4ZV9A 1M2HA 1B3BA 3ASZA 2WMNB 1EXVA 1YUNA 1K68A 4PG6A 3FGNA 3RK4A 2W98A 2Q4RA 3FWNA 1X86B 3F6YA 1RACA 1WTHD 3F47A 1ZK2A 1TC1A 2CYAA 1G59A 2PVSA 1SQ0A 3G0OA 5D8DA 1ZD5A 4E14A 4CEHA 3Q39A 1X1TA 3DONA 4DADA 5BWCA 4IGIA 4JX9A 4Q9AA 3A9WA 4Y2YA 1XU7A 2HSEA 5ESXA 3TKAA 4F8YA 3GJ6A 1YDGA 2AOUB 3NOVA 3L1KA 4JH0A 1KQ3A 2H5IA 1WW8A 1M6HA 3UPTA 3EPJA 4OOSA 2NUPA 4DLAA 2PBRA 3TQQA 5DCYA 2WHEA 1MA0A 1UDAA 3GBSA 2HQRA 4JUBA 3LT1A 1EJBA 3ASPA 3Q3EA 3D6TB 4IEIA 1X38A 4LC9A 4EF4A 3GK3A 3WRVA 4XGKA 2AKEA 4TL6A 3SXUB 1T9DA 1RBYA 3AR5A 1E9RA 4H77A 3WA7A 3ZKAA 2WD7B 3M70A 5DH9A 4N5IX 4YEJA 2ALJA 5T6BA 2XSZD 2PD4A 3WBFA 3GLKA 3I4CA 4JEIA 4N47A 4X00A 4EPRA 3MYYA 3GIRA 8GPBA 5EMJA 2Q1WA 3RAPR 3CNEA 4BDSA 3X1YA 5BWBA 1UC8A 4QFDA 5HCNA 4BKPA 4ALMA 1PR3A 1ZIYA 2BOVA 1UP7A 2PTHA 3CURA 3EXFA 3I2JA 4RHUA 1AB6A 1PQPA 3QVMA 4HFRA 1JIVA 1IBCA 1MPXA 4URWR 3TLJA 4BNZA 2BP7B 1URPA 2FWPA 1F0KA 5KNCA 1A69A 5HZGA 4L0MA 1T9BA 5LOVB 4GI1A 2I67A 3JQAB 3E3OA 4BO4A 1NJGA 3Q8LA 3BMQB 1E3DA 1XF1A 3OHPA 3HVIA 4U3JB 1DIRA 5F3RA 5CB4F 4ZCRA 1EESA 1QYXA 5LA6F 2YX1A 4O4HB 5K1ZA 1ZH2A 4KO2S 1USGA 3I8XA 4EF5A 4TKLA 5JWHA 2A58A 4BC1A 4Y6OA 5C35A 1DC7A 2A78A 1W9XA 1O9BA 3A25A 3AR6A 2FQWA 2ZRLA 1I80A 4YXWA 5I7WA 5JALA 1ICEA 1FYDA 4IS2A 4ENPA 1KS9A 5B7NA 2BCEA 3VZQA 3S7ZA 1HMYA 3I28A 4E51A 4FOLA 4ZI7F 3CXCB 2EG9A 2WE8A 4LYAA 1GZ3A 3DMHA 1ND5A 3K1AB 4Y1RA 4Y6RA 3TIVA 1ODKA 2H1WA 2HIAA 4BEWA 2ZYWX 2GJKA 3LIIA 1P60A 2ANCA 2C82A 2GN1A 3ZTTA 4BGUA 1Y37A 4LF7B 4UE2A 2X13A 3OT1B 1IIBA 3ZS8A 2HYIC 2GN9A 4Z86A 5A4DA 2D5IA 3QVSA 4ALLA 4BECA 2JARA 5JO9A 3QX7A 5DYGA 2R8PA 1FDRA 4JSRA 1N34B 3BQNB 2G04A 4UM8B 1KMIY 1V6SA 1WORA 4MJ7A 4TTVA 1OZHA 3GGJA 4XA8A 1UD2A 4MB0A 2PUCA 2ZUFA 1VKJA 4X6YA 4V03A 5BSRA 1D6NA 1E8DA 4UDYX 4YRSA 3OLWA 4JNKA 5IU6A 5LLDA 1NBEA 1LNQA 4OTZA 3JAMA 2H1SA 3EOZA 4IXTA 3IESA 1XZCA 2EFYA 1QIFA 2VDVE 3OEEA 1RJDA 1YBVA 4HWGA 1EVYA 4RMGA 3C6MA 1Y3IA 5E9QA 2YMPA 1NUHA 1CHNA 1TAGA 2DBRA 1GT6A 1WJGA 4MQLA 3WAGA 4J4TA 1V16B 4UAGA 4JXJA 4FC7A 2A2ZA 2NVWA 2V9PA 4QECA 1XL0A 3OE7A 1Y7LA 1KSFX 1GCOA 1Z6PA 2ZRHA 1P2FA 3C5HA 1BFKA 3P2IA 4GU5A 1NIJA 3I39X 3S2ZA 3U49A 1CQIA 1SBTA 1PK9A 4WASA 3VH3A 1JF8A 5L3VA 1Q86D 3N5KA 2NV4A 4OOEA 3WGLA 1EGQA 2V3CC 1XELA 1YC2A 1DT5A 1GOTA 5FWYB 1FX1A 1OXUA 5C7IO 3NMUF 3EQ8A 2Q3BA 3R7SA 1RI4A 3LX4A 1GPH1 4G0QA 2R2GA 3RSFA 1ZW6A 3QLEA 4HBZA 4GEGA 1ENOA 4Y98A 4P6VF 4RJTA 5FAKA 4A15A 3F0TA 1FIUA 3S55A 3DYIA 1Z83A 1SHTX 4P7FA 1EVZA 1LBEA 1K28D 2BMDA 2C58A 2JATA 4M1MA 1BNCA 1T9ZA 2FFAA 2BPOA 1QIEA 1Z34A 5BSGA 4KC0A 2FW1A 1T36B 3LMKA 3S2IA 5EQJB 4X05A 3MTIA 5J63A 3LVQE 2OZEA 3ZU6A 1EMDA 5K6AA 5KBYA 3FJ1A 5K09A 3ZBQA 2D1TA 2W0SA 4BLOA 1E2HA 3HI6A 3QU5A 1SULA 4IR7A 1T9AA 5TEWA 2HXGA 2XRFA 1OGYA 1QHSA 3KOXA 3T8YA 5JVDF 3LY9A 3F1KA 3R7FA 3OCCA 4WXMA 4X8HA 3PR3A 4XWYA 3WB1A 1FTGA 1EWYA 2FUG1 1VQLB 1X74A 5HVNA 1PEAA 1OLOA 2IZOA 1U31A 3O6VA 3D8HA 3CUWA 1K75A 3HU2A 1X80A 3L0DA 3LXRA 3HCWA 4NZNA 1TMOA 2GPBA 3FB4A 4QOHA 4CU5A 1JJIA 3U7FB 4FFBB 1E6UA 4KN6A 1EGAA 4LKRA 4Q02A 1QB8A 3T51B 3DC2A 1EP2B 3DR3A 4QXAA 2I2BA 1G3IA 2AJTA 3HXTA 3B38A 3L7OA 4KE7A 2NTJA 3F7OA 5BW5A 2PLNA 1MU0A 4TN5A 1M67A 5LDGA 1KSGA 2OILA 2NTNA 1RVDA 2ZSDA 5DE3A 3TCNA 2WAOA 3V76A 1Z2OX 5DO9A 4KBYA 4OAOA 4GX5A 4IQFA 2I3DA 2J09A 4NP6A 4E5NA 1U2QA 2ZUUA 1JSXA 2C5GA 1PZEA 3QXCA 2B8WA 1O5IA 4BO7A 4ZZ0A 4TRJA 821PA 2JI9A 1TZCA 3UMJA 5GZ1A 2XB6A 1YVEI 5CLLA 1G8FA 1JWAB 2OO5C 1QBGA 5DTJA 1HFWA 2O20A 3TLAA 1TUIA 4R5MA 3ROQA 4JI3B 1O95C 2J7KA 4HX2A 4ZVNA 5C1BA 4HS4A 5AW2A 5J2UA 1A97A 4OM7A 4Z7NB 1NT2A 4S35A 2JFFA 1SZJG 2ZIAA 4HXFB 2YYZA 3NYQA 1UPBA 1N8KA 2RGNA 3C3WA 2JVIA 5D1HA 2Z6VA 2G67A 2RK4A 2XHEA 4GAEA 2JIZD 4HSGA 3HDVA 5D86A 1C9EA 1K7FB 1KBOA 2FWNA 4RO0A 4TGLA 4YREA 3L6CA 1O4VA 1BZYA 1LPBB 2QLFA 4KQJA 2CFIA 1I9GA 1K5GA 1LDNA 1VB5A 4NMHA 1V3QE 5FO1A 4FYKA 1XHFA 5C5DA 4DNFA 1KZYC 4LCBA 5DBFA 3MJCA 2QB5A 4O4IA 4EF6A 2CHQA 4IQ4A 4D1YA 1L1FA 4H6WA 4RVCA 4DIKA 3WIVA 4KMRA 3P1JA 1EFVA 2BGTA 4OQLA 1AZTA 3G5LA 4PHCA 2CK3D 5I01A 4O2RA 4ZRDA 3CEAA 1WA5A 3R6LA 2ZT5A 3DVAA 2KYRA 2BGUA 1GRCA 3LDHA 2AMJA 4IDQA 1PYDA 3U3RA 4B4VA 2P9QA 2DWUA 4WOJA 5LKAA 2QLJA 1N2ZA 1ZJ4A 4NBSA 1ZN8A 1GD1O 2G5PA 5FI5A 1RC8A 1MZPA 3EJ6A 3NHMA 4JBHA 2CL5A 2O4UX 1BH2A 2WOJA 3OCZA 4KV7A 4UEWA 4ZYTA 4D7AA 1YZYA 1RWQA 2DQKA 5KOJB 1EGHA 5LWQA 3P9SA 1EYZA 4J7AA 1T5TA 4M8IA 5L53A 4CWAA 4WERA 5FT9A 1A4IA 3JU3A 3VV2A 1GFIA 5TVKA 3ETNA 1DG1G 1KKMA 4G0MA 1TPZA 1HETA 5FQNA 3ADDA 1C4XA 1V1RA 4MCAA 1V25A 4B6SA 4NCAA 1QVWA 1NVDA 4HLCA 5IYZB 1WDMA 3PC3A 2OTCA 4W82A 4J43A 2PUHA 3UC9A 3U44B 2J3DA 5JHHB 2GTPA 4IAOA 3SMVA 2CZQA 1Y1TA 1VL5A 2WZQA 1RHKA 2YL2A 3EXEB 4P3IA 3IQIX 2PD3A 3VR3A 4EARA 1US8B 2OYNA 2NNLD 1DXQA 3M4NA 5EKUA 5JYBA 3W5DA 3FYHA 2HJSA 3G68A 2RHCA 4JGBA 5KOJA 1U0HC 2P69A 4MUJA 3R5KA 2QTBA 1FFXA 3W5AA 2BI4A 3DZJA 5F9HA 3HBNA 4YUYA 1DG9A 1NUQA 3A1VA 2M6RA 3HY6A 4DMUB 4OPVA 2FVGA 4DIOA 5IRCD 3WLKX 2VBCA 3CEMA 3BJEA 3C2QA 4QHTA 1WP6A 1NKSA 1UR5A 1Z06A 1FNSA 3CYFA 3F2IA 3IP7A 4G8DA 2WDZA 4M1KA 3ZXIA 2MR6A 2OPHA 4YAGA 1OKKD 1Z2NX 2CNOA 3E05A 4OFZA 2IYQA 5D01A 3SF8B 3LTNC 4OB8A 1VLLA 1FUYB 1I2ZA 1LNSA 5C5EA 2C1ZA 4BGEA 5CM9C 4YP5A 2C8KA 4IDOA 2RGAA 5ICEA 4MDEA 2VAVA 2RH8A 4IY1A 5H83A 2PKQP 5K3OA 1P4GA 1Y33E 3CQ9A 4POAA 1GCGA 2BSXA 7REQB 1I4EB 2EBWA 4LNAA 4X8MA 4EM6A 1JA9A 4KG7A 5M3BA 1JAXA 1XZQA 3KEMA 4E2WA 2C96A 2O19A 1KJ8A 4MUHA 2ZZQA 2A0WA 2B21A 2IUYA 3T4UA 3CRZA 1I3CA 3MCUA 3HCEA 3QKWA 1KVSA 3SJCA 1GUDA 5F73A 1ZK0A 4MUBA 3EASA 4BPBA 3AHCA 3CR3C 4JC0A 3VO1A 2AV6A 4XM1A 2D0DA 1YHNA 1QLHA 1XCMA 4I2VA 1YB7A 1GEGA 5CM2Z 2OP0A 2ZB8A 1Q0QA 2A94A 2PH3A 2ZBRA 1KK2A 5AICA 1IC6A 1X9HA 3RIXA 2XTMA 2WEKA 1IMOA 4A6PA 2YS6A 2WTXA 4X20B 1W85A 3PC8A 3DEJA 4D0NA 1UK8A 2VPPA 3GJZA 3OM9A 4AVYA 2ZJ6A 1KYQA 1JEEA 2GSWA 3OZXA 1ZGAA 4J9VA 1WMBA 1PL6A 1PQUA 3VBEA 3CT4A 3FWZA 5LA6B 5HA5A 3OMLA 5HHTA 3L0BA 4IIJF 5D5PA 4IEEA 3VU1A 1NG1A 5EUMA 1NW9B 2EP8A 2YZKA 1A3CA 1DHRA 5C18A 3PHHA 4UEJA 2DR3A 3G9QA 3MT0A 1IEWA 2BCJQ 4L5YA 4AMZA 4EKEA 4IXNA 4DXDA 2H8KA 3RBAA 1AU9A 2OLEA 3VZSA 4B82A 4CM6A 2DOKA 3W7BA 2QE7D 1HX7A 1RXYA 3GA5A 1E0DA 1SOUA 3LUAA 5HK8A 1YDFA 3WNQA 5EE5B 2AZ4A 2XUKA 5KYUA 1KIMA 4ERNA 4YRZA 1B43A 2YY5A 3I9V6 1GL6A 1CQZA 1TMKA 3UM9A 4QGAA 3ISJA 4S1WA 2BGKA 1C7FA 2VP4A 5EERA 4A0HA 3CP8A 5CD9A 121PA 1WF6A 2YFHA 3MSXA 2IKQA 1VHTA 4BX9A 3I92A 2AR0A 3FA2A 3GRAA 3M1IA 4U8GA 4E4YA 4LRWA 5ARDA 3E3NA 1PTJC 1KL7A 4JCCA 2I54A 4CN8A 4EMSA 2I87A 4OL9A 2XTAA 3P71T 1AKTA 2IVFA 1SUWA 1JEQB 1MB2A 2PKWA 3WK6A 5LQAA 5JDIC 2AFHE 3IMFA 4EK9A 1FLVA 4UZEA 3NHLA 4DV3B 4X9XA 1ZL0A 4B4DA 1NXQA 3R7WA 4YQFA 4ECAA 4QVJA 4NJEB 1BE1A 1KTVA 3K6JA 3X1JA 2JGDB 4KRXA 2NYRA 3RUPA 4FFNA 1HDEA 1A8QA 3P32A 3IO3A 1GHTA 4JD5A 2L69A 5DYNA 5GGYA 1ZVKA 3SYMA 4BN5A 3U4QB 4E5KA 5LBTA 3NHPA 5E2AA 3N0RA 2VDOB 2XB2A 3W2IA 1G8PA 4R8LA 3LQEA 1NNLA 2F9LA 2IW1A 1HVXA 4JT9A 1R12A 3V00A 4X7PA 4ADSG 1JKIA 2OYSA 1X3LA 4BLQA 4EDFA 2Q3FA 4Q16A 2QRVB 4KR7A 2I6XA 2Y8EA 1VIDA 4OYRA 1Z45A 1GEEA 3AERB 3ZU4A 1G8HA 1KQNA 1OZAA 3EULA 2WSSD 1QOQB 4F45A 4PQGA 3EVDA 1WEHA 2BY4A 5F21A 4PQRA 1U6JA 2VPYA 4AS3A 4NJEA 3A4TA 3QTTA 4ISCA 1R0WA 4RHCA 2IQ5A 1H2HA 4P7KA 1P3JA 1HOXA 4NENB 1UKZA 2HK7A 5LLTA 1PBNA 2I8AA 2RHJA 4X71A 2IHKA 5TF0A 4BQNA 3QF4A 3Q98A 4FHZA 1RJFA 1RLMA 2H2AA 1ZXXA 4L76A 4TRRA 1IZ9A 1U3UA 3TM5A 5AI9A 3IRVA 3CH4B 5IFKA 4EYEA 3IMGA 1WCWA 2QSYA 3LCJA 3U7GA 1PUXA 2PMBA 3LV8A 3WZMA 1IN6A 3CGGA 1FL9A 2IU3A 3T6KA 3BD7A 5L4SA 3K70D 4PGOA 1EVQA 5KPDA 4NXMB 1FC0A 5BWLA 1KPGA 1ENPA 1KBQA 3D5EA 3S6JA 5DISB 5FOXA 3CVXA 5EWMA 1DX6A 3G2LA 2M2IA 3VR6D 1GQSA 4JCOA 5DU2A 2QK4A 4OL0A 1I5RA 3Q85A 2JLZA 3GW8A 2ST1A 3V80A 3HTXA 3NDPA 2YBDA 4C9BA 4M49A 4JMLA 4YRTA 2FX5A 1YE5A 2HMSA 2J5BA 1DAOA 3GEPA 4IINA 4JB2A 3RS7A 5JD5A 1IY8A 1H6DA 1Q3KA 3DBOB 5ALOA 5M2QA 1XRSB 3AFIA 3I9V1 1MRZA 4UPEA 5JS2A 1PSDA 4MLZA 3KQPA 5A1TA 1MO2A 3P9PA 4Y6PA 5EIBC 4PLWA 2P2YA 4UJ5A 5LP6F 1G7RA 3IJPA 3QXXA 3TIIA 4AWXA 5U4QA 1XQYA 2QAGC 1XRRA 3OAAD 5EVJA 4BLSA 4CLRA 2AL7A 1GAWA 3H16A 4M1SA 5G0TA 3D1LA 3FWYA 4FS3A 1N1DA 5IYZA 2R9VA 1ENZA 3IS3A 4G63A 2M6KA 5K0SA 1NUUA 1TTPB 2YIMA 1L5YA 3F90A 4RYLA 3H11A 4G36A 4G01B 4OHCA 3EB9A 5LIRA 3D6JA 1AH2A 1SNYA 5GONA 3OF2A 1I7NA 3OWHA 2CLCX 4HVCA 3MMZA 3C39A 3NIWA 4IIFA 1H5QA 2NXJA 2ZJ5A 3V1TC 5BNWA 5CBKA 1N5RA 4QDOA 1Q12A 3TRIA 1ABBA 3PPYA 4YT5A 1KRHA 4I5DA 3CUUA 3DTVD 1GAJA 2FQQA 2Q4DA 4P08A 2ZBDA 1ZM7A 2QP3A 2WI8A 5BT9A 3ZEIA 2OBRA 1RKQA 3FIJA 2NSYA 3ZU2A 3RUFA 4UAJA 5LQJA 3MLAA 4XB6B 1QK3A 1USWA 2F90A 2MR5A 1H8EA 3ESAA 4M0UA 2GCOB 2OVFA 3PUHA 2FR0A 3FNRA 4RX1A 3RUAA 1TO2E 1N92A 4CQJA 3SFVA 4ARZB 1CDOA 1V41E 2QG9A 4NOLA 3CZMA 3IMEA 4OI2A 1MD9A 2FCRA 3WZLA 4K6GA 4OFXA 5L95A 5BVHA 4ZAWA 5REQB 3PQDA 1CUCA 4OLBA 2Q5OA 3Q2IA 3OEWA 4L5BA 1JALA 1ORDA 4K0RA 5IN4A 4AZTA 3QE4A 1HSZA 1X1BA 3ZHBA 3JVVA 3R7LA 1F3LA 4MGIR 3DE6X 4B31A 4CR7A 2ODBA 1TCAA 3OX4A 4RVOA 1RCTE 2ZBVA 2VP0A 1U9CA 1QHGA 2P8JA 3RWMB 1PJCA 3BXZA 3GDGA 3GNSA 2MDTA 2EL7A 3HNOA 3N2LA 4H59A 4LX0A 4PO9A 3ZBUA 2FN7A 1NF8A 4M0PA 4Y2TA 3NRBA 1BGXT 4UU1A 3RYFB 2JS7A 4QOJA 4ARZA 2ODEA 1RQPA 4YJ3F 5TEVA 4F96A 1Z0IA 4GD3Q 1H9BA 2LNDA 1H4VB 1XN4A 4RETA 2F3RA 4D4JA 2GM4A 3PVCA 2JLQA 2YR0A 3Q11A 2H5LA 2KB0A 2D3WA 3IAEA 1X0VA 2ZYAA 4BVJA 1AA9A 2RGNC 4B6EA 1BRMA 4C3UA 3K9QO 3W5IA 2PZMA 2JFYA 1QUFA 4HZUB 4IWXA 4BLRA 5IH7A 1XXHE 1MIOB 1NJ2A 4JJ4A 4D9JA 3CEPB 1SCJA 2LDBA 1LLQA 3H1TA 2ISSD 4HATA 4YJKA 1JPUA 2YJ3A 1C4WA 1GGMA 3ZX5A 2ATCA 4TTSA 1Y6FA 4TLCA 4RBNA 2VDWB 5F9FA 4GVLA 1E4VA 1LKZA 3OFND 1QIDA 1LC3A 3DE5X 4NCXA 5BNFA 5I7EA 4W9RA 2FKAA 1A1SA 2RAPA 3MJTA 5HNKA 3S1AB 3CZPA 1MTZA 2O48X 1K97A 3E4DA 4KAFA 2QYTA 1JHPA 2EFJA 3WWOA 1YRQA 4OXRA 3B2NA 3NC4A 3QY9A 2XGMA 1OT3A 1YL6A 1U3CA 1E1MA 3EWNA 5CLHA 1Y8ZA 2C20A 3R7WB 2D7CA 1D7OA 1UKAA 2JFQA 4CMJA 1R8JA 1PTJA 3A6FA 3EXAA 4HPJB 1NVAA 1PK8A 4OXKA 1N05A 3VDRA 3DXZA 5H80A 3CH7A 4OH1A 3W4IA 1Z12A 1GCUA 1JTFA 3N6RA 2BFPA 4CNBA 4O4LA 3K15A 3ORSA 5A5EA 1EIWA 1JHVA 3TZKA 4DCOA 3V7FA 5EJ6A 2DIEA 4KRFA 1QU3A 2GLUA 3ZW7A 3AV0B 4EH1A 4LOJA 2RDMA 1GJRA 5HDBB 3WAKA 5GTDA 1GQYA 4LBVA 4L3OA 3COYA 1ZRMA 3Q5DA 2D1YA 3NC1C 3UJBA 3W8RA 4DKJA 3CN7A 3AVPA 5DBHX 1VXOA 5DV9A 5FTJA 3GLIB 3W2FA 1WIWA 5F3DA 1KC1A 3WRYC 2GJSA 1K89A 1FQKA 5FCDA 4TKVA 2VRCA 3EMDA 4RGBA 2B4RO 4XUDA 3TTVA 4WZZA 1QDLB 3EOBI 2W6ZA 3GELA 3PJFA 4K3VA 4MQFA 3REQA 3W5BA 4DV1B 4GIBA 5B3AA 4G9EA 4ZYXA 2CVZA 1YB2A 2R62A 3I9KA 4TZ0A 4LA4A 3BE8A 4AECA 4CIBA 3O0DA 4I50F 2BR4A 4PX2A 2JA1A 3WQHA 4PGMA 3V48A 2CDRA 3GVCA 1LTQA 3TZCA 4H15A 5JS1A 2A30A 4IHJB 3DV2A 4DPLA 4J07A 3IT0A 4BFYA 4DN6A 4EO4A 1KAOA 3RS9A 3VHRA 1JJVA 2JJ2A 2ZRGA 1NMSA 1CQJA 4P4SA 2IZ0A 3R5FA 6NULA 2F1IA 4IZHA 1EGMB 1TYAE 4KQEA 3LO8A 3C85A 3G8DA 3JAWA 2OY0A 3LWBA 1TFRA 3WFZA 4EW6A 1VRWA 4NS1A 1S4QA 1TA9A 4DA8A 1WKCA 4EUSA 1RYNA 3PD1A 3RUDA 1M8PA 3Q6IA 4C30A 5EP4A 1RLTA 3SX4A 1IOVA 3FDJA 3LYAA 4QUZA 2R8RA 3A3BA 3H2ZA 4Q19A 1OBFO 2FFRA 2H6EA 4QKQA 4RKYA 5J2TB 1BDMA 2D8AA 2JGDA 3DOOA 1QHHB 2HPHA 3DMRA 1XLTA 4AKSA 1XCJA 2WF8A 5E7MA 1XZLA 2N9UA 1E3TA 3LVFO 2ZITA 4Z4CA 4JQYA 1TAUA 3C14C 3UJPA 2IELA 2CEAA 3QUTA 3KB2A 4RVSA 1U3FA 5K99A 5IX8A 3SBEA 5DM60 2BUBA 2QRZA 1L1EA 1RWPA 1CB7A 4GX0A 4KQGA 4TLAA 4KFCA 1FF9A 2NVUA 2B8TA 2GKGA 2JH8A 1QG2A 2MSLA 1VB3A 1GZDA 2WAAA 3CKMA 2VHJA 3EZGA 3KXDA 4FDMA 4P2BA 3DBRB 4KVGA 1AKNA 1TL7C 4KN8A 4KFUA 3F6SA 3TRKA 3TR5A 1K8XB 1LDEA 2LIVA 3A6EA 2I8CA 4P3PA 1VKRA 3BZUA 1UJ4A 5T4BA 3M82A 2O8DA 4R2JA 3VTZA 2BLNA 3EWSA 3FFTA 1N6IA 3H9UA 4I8DA 3JWGA 5FLYA 5KTYA 1W2WB 4A7PA 2VBGA 4NK5A 3KT0A 3QVVA 1FJ2A 2YKGA 4CMEC 4ZGBA 5IP5A 3D3JA 3ZWYA 1DQSA 3EJWA 4LC1A 3T95A 3THOA 3U62A 1XQVA 4C7KA 1FRZA 2JEZA 4EGSA 2Y1LA 1GU1A 1AE1A 2QXTA 3AY7A 4FNMA 1XWWA 2ZQZA 4JUFA 4Q15A 5BOVA 4H4EA 5JZSA 3SQOA 5HBGA 3BOSA 3W6PA 1Z8FA 2QUZA 3HYRA 1KBZA 2QXUA 3HKEB 1SHZA 3P0FA 1DO8A 4OGKA 1BN7A 4HQFA 4RZUA 3WK7A 1YVDA 1SK8A 1GKLA 4DNTB 4RHEA 1XP8A 2BHNA 3KL9A 4ETIA 1FLAA 1FSSA 1TEXA 4D8UA 4L50A 4DR5B 5AW8A 3RSLA 1Q91A 1B8NA 4MZDA 1FE8A 1DKLA 2GEDA 3COVA 2Z5GA 5EJ2A 3T7KA 4DPMA 5FOUA 1E2UA 1P4HA 3AH8A 3MINA 4OXQA 5C53B 2OHXA 1RRVA 3OM8A 2FX2A 2R7AA 5TF4A 1DC8A 1AM4D 4G4IA 1FPMA 3IV7A 5I7SA 1LW7A 2ID9A 3GLTA 3IVAA 4ER5A 2R4QA 2Z9DA 4I1PA 1A8UA 2WTNA 4DCMA 3UMYA 3LK7A 1PJSA 1PJRA 3P19A 3SC2A 2ILVA 3CB2A 4BV3A 5ILOA 3M6UA 2C5BA 3ILHA 3NP7A 3WGVA 3GCDA 2FLWA 2OL4A 3RC9A 1V9CA 1YQWA 2R6R1 4R01A 4E33A 1NTOA 3ONUA 3KYIB 4RA6A 1RLUA 4CLEA 3WTCA 4Q4CA 3ZVNA 4I9GA 3KSAC 3IAUA 5DTIA 3AY6A 2BBSA 3AU9A 5A7FA 2FEPA 2QE6A 2QL9A 3E22A 2RARA 4M37A 3WL8A 3LC2O 4MCIA 4O2AB 3F71A 1EINA 3ZY4A 2BFWA 4L27A 1U99A 1WCXA 4JP5A 4KYIB 4LOHA 2OBYA 3A4LA 1N25A 5G53C 1GNPA 3Q9LA 3SC2B 4J6FA 4AIRA 4RM3A 2V55B 3CINA 4CPDA 4GEKA 4B0OA 3KJXA 1M1XB 3M3DA 1GDHA 4RJJA 4DCCA 3KXKA 2H31A 4NMXB 2FEXA 3TQFA 4ENVA 1O4WA 1G5RA 2ECKA 1GG5A 2CBGA 3WMFA 2RHHA 1IY9A 3GPBA 3EQ6A 4HKTA 3ZWMA 4AY5A 3T7TA 1Q3TA 3IUSA 3PUZA 4IUDS 1RKBA 2P4SA 4KYTA 4MPDA 5EY5B 2Z6UA 1CR6A 1LBTA 4LVNA 1CEXA 1FDVA 3EW7A 5CPBA 1Q20A 2YDXA 1FP1D 1K8RA 1KQPA 1ZIXA 3Q7RA 3RS8A 4C0AC 2APJA 4TMFA 4L4RA 1QG4A 4HAUA 4EFLA 1OD6A 3A27A 4KO4S 4AQDA 2H00A 3MTBA 4Z1OA 3C4QA 3DF7A 2QRKA 2O52A 1ONNA 3UEOA 5KTSA 1IEXA 4QO8A 4YT4A 4C6RA 5TS2A 1JXMA 2FB9A 4I3GA 4F5YA 1RYFA 2XOEA 3OPOA 2I99A 1N7JA 2VAMA 2AN3A 1E8NA 1ODIA 2VDQB 3K0KA 4JHXA 1GDDA 3KAQA 4RV5A 4PZEA 4NSNA 4Z0PA 2WTEA 4AW9A 2C0QA 4PLFA 3LSYA 3RANA 4B6FA 4F1JA 1E5XA 4V38A 2X6YA 1AHHA 2ZXEA 1MOQA 1XDUA 3NZEA 1GPNA 2H1CA 3IQFA 2ZSAA 3NBXX 1E9VA 4Z0HO 2H4WA 4IV5A 1BPLA 2Z6QA 4P7GA 3LH5A 1PJBA 3TNFA 4P25A 2I2WA 1YUMA 2V6IA 3I45A 2H9YA 3N2GA 5TQ2A 1LVHA 2CY0A 1ECLA 1HDRA 3INNA 3DL7A 3UYLA 4HVAA 1X7WA 3RVOA 1XAGA 4DZZA 1SXJB 5FNZA 4C6TA 5JSFA 4LOLA 1SCUB 2O3JA 3E9CA 3UK0A 2DEUA 2XSZA 4HEJA 4IFTA 1JV2B 2Z95A 2CSUA 3W04A 2BFBA 4MW1A 3EA4A 1XDGA 3B1XA 2R2AA 1VMIA 3JATA 1N7IA 2VK2A 3N0TA 4P5PA 4EJMA 3CF0A 4RD4A 1DXYA 4RCVA 4E21A 1CEYA 3CXRA 4POOA 5KVVA 2R6HA 1U0SY 1RLIA 3HJNA 1QQ5A 5KYVA 4YAWA 3KYDB 3E81A 3EK2A 3RI3A 3VO9A 1E1DA 3TLMA 4E5MA 3PXBA 4JBIA 1WQ3A 3R6KA 1ACMA 2DLCX 5DHQA 1QIIA 3IB6A 1T1JA 1YDMA 2VUTA 1XWIA 2FWJA 1J1ZA 1D07A 4MRMB 4N54A 4WH0A 5CP8A 5CFRA 5HQTA 2XA1A 3PPXA 4EP1A 4LXXA 1Q77A 1I7SB 2AVDA 3KOWA 4IJUA 2MT9A 2OC9A 3L79A 4G6IA 1ZIPA 2IHTA 2Y6UA 3NUZA 3G2JA 3ND5A 1RM3A 3R8CA 5JSHA 4HDNB 5B5SA 3LQKA 4FKMA 1QAMA 4M9QA 3F3KA 4H16A 3AJEA 3NHBA 1N0HA 3R9IA 1RIIA 1K2VN 1W73A 3A7EA 4DM7A 4HAXA 3OD5A 1YVPA 1TNDA 1IWOA 4AZ0A 1GTJ1 4CEHB 1Y63A 2ZAMA 4B8YA 4MVJP 5KTNA 1SIOA 3C7DB 4EB6A 3IKMB 2H29A 3GUHA 4HQ0A 2MYUA 3B85A 1L4BA 3C3AA 4XYBA 3THWA 5JAMA 3OZAA 1Q0UA 3OQNA 5JQGF 1EK2A 4B09A 4HNVA 1X70A 3OETA 2GEJA 2HUNA 2VK1A 2D7DA 1IB6A 4X65B 1UPTA 4XUGB 2F8SA 1WMSA 2ZETA 1TJYA 3HDJA 4Q21A 1IONA 1TQDA 3EGOA 3REQB 3R9WA 3MD9A 1R0LA 1DBRA 4GX1A 1N6RA 1JSRA 1LV8A 4Z99A 4YMUA 3U4GA 3U13A 1ESNA 3KAKA 4BFCA 2F4NA 4J0QA 3WB2A 1PYGA 4NDNE 4UZSA 1T1RA 4L73A 4A91A 5DCLA 1JFTA 1K1EA 3PC7A 2V7BA 4XGQA 2NPIA 3OFKA 3MQ2A 1K8YB 1VKZA 5BWNA 1GPKA 4E3ZA 4FX5A 2ZVDA 5IM5A 4BUJA 3ZHUA 4JODA 3L8FA 4IZOA 2J3EA 3FPLA 5JJIA 3GYGA 3OFNA 2XYPA 2QRVA 1BA2A 3SZMA 4ZO4A 5EZYF 1KVQA 1Z08A 1KAEA 1PD1A 3AEKB 3D6MA 1LZLA 2R66A 5ILQA 4JSTA 4WOBA 3F6EX 3UUFA 4LJ6A 2WWVD 1QHEA 3C6BA 1ZN2A 2QMUA 5FTKA 3W9UA 4P3YA 1SPBS 5FEUA 4OOFA 3V7UA 1YACA 3AOEA 5FTMA 2NPOA 3JZDA 3JQFC 4BAGA 1E18A 3S0JA 3R5HA 4YP0A 3R4VA 2CB9A 3IAM6 2PR2A 4CEIA 2O1WA 1QIKA 1F0YA 4HGYA 4WINA 2O2ZA 1XKTA 2NX2A 4LWQA 3ZDCA 4H17A 4YTEA 3D4LA 3QMVA 3QLTA 1L4YA 1TO1E 3A32A 5EMLA 3PD7A 4XAQA 2XMGA 2HTEA 3MQFA 2AFIB 2D2FA 2NGRA 5TY0A 2PGLA 1DRVA 1NUAA 1GGNA 3JXEA 3H5VA 5CCBA 4H31A 4U2GA 1EJ6A 4Z4EA 3CR8A 1NKVA 2H1LA 3LUDA 4KAXA 1N07A 3O9ZA 3H6GA 4IV8A 2D6FA 4GLOA 3EFHA 3V46A 4D8YA 4W8GA 2NP6A 3AGQA 3GPDG 4BNDA 3GRKA 2JRLA 3LFUA 5LZ7A 1H8HD 1Z25A 5A88A 4M86A 4YJGB 4BB5A 2NN3C 4EI2A 1I7DA 2YS7A 1DO2A 4AX4A 1ONSA 1DTWA 1R0RE 3PGJA 4M8NE 2CXOA 1JZQA 2RB4A 2HA3A 2KM1A 1MRNA 2PX2A 4EMBA 4PBSA 2PLFA 4PPNA 3BD9A 1O8BA 4Q3AA 5EJ9A 5FX2A 2AG5A 4H18A 2VDJA 3L1JA 3OU2A 1TEVA 1V7CA 2HEGA 1DAMA 5ABPA 2MJLA 3D2AA 4GQAA 5K0JA 5M34A 4HH1A 2W8BB 3AFOA 2D1QA 4BJ6A 1VJSA 1CUGA 3V97A 3SS9X 2Z3WA 4KH0A 4ZVTA 2DH6A 1U7DA 4LNHA 1Q11A 1GQQA 3P20A 3TO5A 5A02A 1SUPA 2VRBA 3MLBA 1HE8B 1FP7A 4H2DA 3KQSA 2H4HA 1R8YA 4KNWA 1K4YA 3MFYA 2JJ2D 3OQPA 5DRTA 4RULA 4R1PA 4HEA1 2R00A 4LQLA 3WLQA 2VHZA 1KGSA 1M74A 1Y3BE 2XHZA 3MGAA 5SYNA 4B3IA 4ETMA 4DC0A 1E1QD 1V8FA 3EA5A 3HCAA 3MUNA 1UMBA 3O93A 3RC2A 4YH1A 1L4MA 1LBIA 1N5DA 3BIXA 3ROPA 3ZWQA 5HS4A 2W58A 3EG9A 3FPGA 1R8XA 3C6QA 3LUPA 4NE7A 5AR1A 5FPQA 3UGQA 1LDMA 2QUBA 2OAEA 3CNOA 2GESA 1W0JA 1WD5A 4WX2B 1K3FA 3SM3A 4NCJA 4DCVA 5BR7A 1UQTA 4RTNA 1A71A 4ENSA 2QRNA 3KRTA 3OY7A 1EK1A 4IUYA 5JAZA 1YF3A 4TYMA 5A5GA 2I9PA 5AI6A 3FFXA 1SQGA 1E7MA 2CL0X 3FTDA 4FMDB 3LPCA 1X19A 4HWSA 4KX3A 4AJ4A 3U3KA 1X1DA 3ETLA 1M6WA 2FN8A 4ZQEA 2OQRA 3ZH2A 4HAWA 1UM9B 1VQMB 3OTGA 1XDZA 4LXIA 3COWA 3WA6A 2QZJA 2E1PA 1GWNA 3LW7A 2I0FA 4N5MA 3ZWXA 1E4OA 4G5HA 3ZZMA 2WDPA 1WDLA 1C7ZA 4JI7B 1KJYA 4P9SA 1A72A 2I4TA 1Q1QA 1EM8B 1LPSA 2WFAA 5JNUA 2NZ8A 1GYQA 2OG2A 5DSXA 2G7MC 3KSBC 2AK2A 5L45A 4BJ5A 3HYLA 4CYMA 2QX7A 4G4GA 4ZYLA 4B87A 3OOYA 3W3ZB 1PK7A 1K06A 1Q83A 3DEZA 3U7QA 5JAIA 1L3IA 3FUWA 4OSPA 5A4KA 5AI0A 3RFTA 5K2OA 5ERXA 4UOQA 2DCUA 1QK5A 3SYLA 1T3HA 2YHSA 3FFBA 2VC2B 4ZOBA 4UOEA 1M6EX 2FG7C 4GLLA 4ZO9A 2Q0XA 5AVQA 1LQUA 1MJGA 1AUXA 3SX2A 1PQ4A 3RIHA 1NU8A 4HAZA 4WBXC 3U80A 4JX8A 4MVYA 2O7NA 4ONEA 1TJPB 3BREA 5JZMA 2C1EA 4H1HA 3G2IA 1CNFA 3MRVA 3TZHA 3DT8A 3K5PA 3EZFA 3DVRX 4V0NA 3PU6A 4XM2A 2B7CA 3VPGA 5JJCA 2H2WA 1TAQA 4D80A 1Y9ZA 1U3GA 2QS9A 2X9VA 4R3UC 3V2GA 4C5BA 2VDKB 2ZCUA 5FPTA 4MITA 1UKEA 2QR2A 3MT7A 2VJLA 1VFNA 2CHUA 1OTYA 1YJQA 2H4YA 3KD3A 3VYUB 5I4CA 4XEHA 3NE5B 1Y4DE 1UEJA 3WWYA 1AQYA 2H92A 2MINB 4JBWA 2ZS8A 2J5RA 3DOUA 1WG8A 2F64A 3MRXA 3WS7A 4EA8A 4FMDF 2TMGA 5HG0A 2AOTA 3VO8A 4KAAA 5D51S 1PI3A 3B6EA 3C15C 4G1VA 4RA9A 1MP0A 4S0XA 4OHXA 1M0EA 5BURA 1KOJA 2XGJA 1S5PA 3O7MA 3VC3A 1C8VB 1Z38A 2OV3A 5SV2A 2TSYB 4MVJH 3V4FA 4CTNA 4RTSA 2PZFA 3DQZA 2FMHA 1FXWF 1Y6JA 3GMIA 3O9MA 4PPFA 3S2SA 3SPXA 3ELBA 1BXRB 3P9YA 3BH6A 4Y2GA 2PFGA 1MUUA 2DY1A 2QI9F 3E1SA 5ALJA 1P3DA 2REXB 3EZ6A 2A35A 2QAIA 1OA0A 2VHTA 4TTIA 4ZK6A 3HB9A 4FW8A 4B7UA 1PHRA 1BDIA 4ZHQB 1QTQA 3VJRA 4TMZA 1BDHA 2NYAA 3HP1A 3LZ6A 1NN1A 4LHYA 2YASA 3OH8A 4D9FA 3JAKA 2ZRNA 1LXCA 2YWCA 3KUUA 3AEQA 1ZGBA 1Y80A 3PXGA 3SIPA 5D5HA 4KVZA 2O50A 5L3SA 2RCYA 3H2KA 3P9RA 3B3GA 2JD2A 2GARA 1GPLA 2J6CA 1Q84A 3HB7A 3T3NA 1Z6GA 3GIWA 3DEKA 4YHHB 3IR5A 5D7NA 2Q6KA 2R1UA 3RYCA 2QD3A 2WB2A 4OX9B 1Y9EA 1K3TA 1DG3A 4WCDA 2AEJA 1QO7A 3GZ4A 2WIJA 3GVHA 1V0EA 3OCVA 1B6RA 2P65A 2X9GA 3QELB 4B3FX 1DCMA 3F5MA 2C4WA 5GOTA 3U60B 3E1KA 3NUGA 1BDBA 3S2GA 1JFSA 1K7EB 1NY5A 4JBLA 1UBFA 2GM9A 3LBNA 2B1RA 4RLSA 5H9VA 4JUCA 3UAOA 4RKQA 4F6RA 2GCOA 4Y2JA 4QELA 3T52A 4U8HA 2JDID 4WVLA 3UAXA 1R4AA 4M1YA 5COAA 4IGKA 1OGIA 3LDAA 3C3DA 3HR7A 4F04A 3G6WA 4LJ5A 3JQBC 2H59A 5JNRA 4LZAA 2G70A 4G86A 5AQ1A 4L9WA 2C4KA 3ESBA 2OXRA 4BNDB 3N2NA 2NVBA 4GYWA 1G1AA 1T8TA 3VHXA 1MAWA 1ZC4A 2BGLA 4M4SA 4QG7A 4XLCA 1JDBC 1HNZB 1R3DA 2VJNA 1BFDA 1JIIA 3KOOA 4NYJQ 1J07A 2IOHA 1N75A 3HA3A 2IY9A 4MSUA 5LJIA 4QBGB 3KTAA 2IYPA 1JB1A 3HNRA 3LKZA 3I2GA 1WPGA 4JGGA 1VQOB 2CHEA 3NHUA 1KZ4A 3CX7A 3ZH9B 1JMKC 1PE0A 1N9GB 3A9TA 3OE7D 1P77A 1NE2A 3A4VA 3JQGB 2ETVA 4AKTA 2R87A 4IRXA 4YCCA 1NT4A 2CUZA 3PEFA 1T15A 3KQLA 4RW0A 3CVVA 4YAIA 5J2TA 4X1IA 2W2LA 4EYKA 1ZMTA 3ANNA 3EVAA 3IAHA 5K20A 1F2UA 1GSHA 3UUWA 3AESB 1H9AA 1H2YA 1L8AA 1UKCA 2BI8A 2KHZA 3OICA 4OAPA 5ULLA 1G98A 1ST3A 8ABPA 4NE9A 2HHAA 3LLCA 1M5UA 1OXVA 1SVIA 4DOMA 5JMWA 4CXMA 4LQCA 3T5PA 1IZ0A 2AYXA 3AVQA 1Z0JA 4IJ6A 1B73A 1D2RA 4JUDX 3VVCA 3QVKA 1CZLA 1N5JA 1H1TA 1W5EA 3CG4A 4LRTB 3JZMA 4XUEA 4CL8A 5JBNA 4MVJE 4GDFA 1RBMA 4KGDA 1Z5VA 1NPTO 3T7IA 3THRA 4QJ3A 4FYWA 5CVJA 5LBUA 1WB6A 3M7IA 4NZPA 5HJ2A 3RD5A 2NU9A 1NN3A 4FHGA 1L5HA 4YMTA 4F92B 4WESA 2A1IA 1AZSC 2CMFA 2G1UA 4L51A 2X5OA 3RHZA 1R64A 1CRZA 5I8WA 1GGFA 4ZTUB 4ITRC 4DLWA 2PTGA 5LQNA 4AY6A 4URHA 1WZNA 2WU4A 3FHCB 1JPJA 2P79A 2VF2A 2ZRKA 3A3PA 2LZ0A 3OZIA 3PLRA 4MIYA 3U1BA 2PZEA 2J0EA 3PX3A 5DN6A 2GCGA 4DUGA 2ZQ5A 5EJIA 4PSDA 5J43A 4A5OA 3Q0EA 1BVRA 2ZRMA 3ZQJA 3D59A 4ZQGA 1H85A 4Z4TA 4B3DA 3B1KA 3FZNA 1AY0A 2XTZA 3O3NB 4Q3DA 2OCIA 5HE9A 4YFVA 3PKIA 3RYIA 1CR4A 3T56B 2VSOA 3SJZA 2B8EA 1SHUX 1QGAA 1HLFA 1W59A 3DGFC 1T9GR 1EH5A 3IUPA 3JYLA 3O92A 3RHFA 3TTXA 4OF4A 4K7JA 4P3NA 1II9A 4J0HA 4WL0A 5A1JA 1LRLA 3HA7A 4PQEA 2QV0A 4IRMA 3T5BA 4LYJA 3NIDB 3ON5A 3G0HA 2GJAA 1U0FA 4U1RA 4YN3A 5THKA 5HM8A 3B2EA 1WKVA 1XRLA 4N0DA 3RR2A 1ZM4A 1VIAA 1E5TA 2DUJA 1WABA 3GX1A 3CCUB 2P2SA 3D3WB 3ELDA 3GEHA 4A6EA 2MSNA 2YZGA 4NFLA 1KDOA 3CSDA 4PN3A 3T1HB 1DJMA 3MXOA 3T3EA 5LD2C 4P3OA 3VU9B 4ND5A 1XTJA 2UXDB 3Q88A 2JBAA 2PVCA 5C2JB 4MR8A 4F21A 1I3LA 3LNCA 1RHUA 3ORRA 1LLFA 2QRMA 3OLVA 4OCZA 5DOVA 1TQHA 1KMCA 2QMZA 2ZIEA 4BNUA 1JHMA 4GPBA 1NVKA 1EFHA 3SQDA 4JQZA 3KUCA 4MINA 1RRCA 5BYBA 2Y6VA 4H1VA 3LUJA 1IXZA 5DBIA 4C0QC 2JIRA 4EO9A 5CXQA 1Z5NA 1UJ5A 3L49A 4GT1A 5CDFA 3JS5A 6GPBA 4WI1A 1GSAA 2A9KA 2OCPA 1WR8A 3UT5B 1JHZA 1P7WA 2PV7A 1BMTA 3M4XA 5F76A 1DRWA 1VQ1A 4IX1A 3H0KA 3RUCA 1VA5A 3PGXA 2M9MA 3T0IA 3WMXA 4BL5A 4CL2A 1NJID 2GEKA 1X7YB 1XNHA 4F3KA 3CVYA 1Z3CA 4Z4VA 1TUBA 3ROZA 1DIOB 2IL1A 3LT4A 3EEIA 4LV5B 4AXBA 1NOKA 2OGSA 4A6XA 2QRQA 3F2VA 4EJ0A 3AXTA 4XWGA 1RPNA 3UF0A 3G88A 4ROXA 2G7ZA 1UWCA 2IHJA 2ZROA 2MYTA 1ZD9A 2ZSKA 4EAAA 4M3NA 4N3NA 2CE2X 2NLOA 3TFQA 2JGLA 2JFNA 3RFVA 2I1WA 2KVOA 1BC5A 1T9HA 4BJHB 2IX9A 2NU8A 4YFYA 3U7QB 1PJ4A 3SOZA 4LZWA 2HD4A 3DD1A 2Z98A 4UU8A 1DAHA 2O6HA 2QN6A 2CXPA 4QUEA 4GMFA 3T5TA 3WICA 1ECFA 4ZZ1A 1GCAA 1N8TA 3MEQA 3GFBA 3OOJA 4CG0A 4EG7A 1T6XA 1R0XA 5CBPB 1NUPA 2BUAA 2GWRA 1NVXQ 3LKVA 3ENZA 5JNWA 1O96B 1XVAA 1B8OA 1E6LA 4EKNB 2X8AA 4UNQA 3L7KA 3SWWA 1U8XX 2NXWA 5E0KB 1TZ2A 1CUBA 2LCFA 2VUIB 2QORA 2X23A 2ZJ4A 4XIFA 1J21A 4Q3EA 4CV1A 3L06A 2CFTA 4D9MA 4I55B 4P38A 3RFFA 4KZPA 2J0UA 4RPGA 4Q6WA 3OLZA 4GOLD 2PVPA 5I5EA 5ITSA 1JKXA 2VYNA 2F3UA 3P4YA 4YT2A 1WSBA 2G36A 3CMMA 3N1UA 4D46A 1QGUA 1BJTA 2RHGB 4LMRA 3RU2A 2WKPA 4NBNA 4PC7A 1UINA 5H1YA 5IAGA 2OV1A 4J16C 3U4CA 1USKA 3U7IA 3T7EA 4O33A 5J40A 3DBHA 3VJKA 2WT9A 2ORYA 1UD3A 1NB9A 2NPFA 1CFJA 1HTTA 1XJ0A 2QMYA 2Z1NA 4U6NA 3V5NA 2C5AA 1ZI6A 4BB9A 4DG5A 1W25A 1YT5A 4DS3A 1HG1A 1OU0A 1UT5A 2ABWA 5JFGA 3M4YA 5D84A 3BA6A 2YMQA 1PN3A 2CL6X 1AT1A 4FE3A 1C9DB 4NL4H 5E6SA 3R0XA 3S4YA 4C0JA 5I8PA 1N5OX 2AFRA 3S8MA 4YGXB 4MTCA 3DR5A 2OHFA 3BSFA 4FQ5A 4AIIA 1XAIA 2D7JA 2XNJA 2QZ4A 4PTZA 5E3IA 3GFQA 3IHTA 2OB2A 1O0BA 3NWJA 1U8AA 2HMAA 2VJKA 1YOVB 1QS0A 4P4LA 2CN1A 4RFSB 2DB3A 2H07A 2VI5A 2AC4A 2QY9A 1MG5A 3U4HA 2AN9A 1EFTA 1VPEA 3DE1X 1UDCA 1WLSA 3E23A 1F2UB 5B36A 2C7QA 5HILA 3ESQA 4IUCS 5JJ5A 1JSCA 2BMFA 3AHIA 5B58T 3ZKWB 4IL5A 2HAEA 1SVSA 1WUKS 3UMFA 4MDYA 3DF9A 4MAFA 4BVKA 5K3FB 3E5NA 5AESA 1M2EA 2FE1A 1H4TA 3I53A 4MA4A 2J3JA 3COJA 1ECPA 1EEXB 2DFNA 2EKDA 1H3EA 4UZFA 2BKVA 1KDYA 3IXQA 3AJDA 5TGZA 4UVGA 2GZDA 3TI7A 1PT5A 2QUKA 2Y0EA 3WLRA 4TM8A 2XODA 2VWQA 4YUVA 3C3KA 3TRFA 3W1VA 4B6RA 1QTNA 2IS6A 2V7VA 2HWYA 1QGDA 1Q7BA 4CJXA 1DBIA 4HUQB 5CT4A 5JD3A 3A0UA 5CA0A 1TU0A 1LW6E 3NH9A 4L78A 4TQGA 4PG5A 1KWKA 3I42A 4M98A 4PBTA 1UC4B 3Q3VA 4Q7LA 2F62A 3RHTA 3R9KA 3EXG2 1ABFA 4RPIA 1JQ5A 2AW3A 3K9NA 5BPFA 2WU3A 3W8NA 3LDFA 1JNXX 3ICCA 3FWPA 3WIDA 1OY1A 3HGMA 5B2FA 1TE2A 1MOZA 1XEFA 3OZFA 3BC9A 4PAAA 1R9JA 5EZYB 3GEGA 3QX3A 1VJ5A 2XUHA 4CM8A 2DR2A 3H0EA 4R31A 4S0ZA 4Y8VA 3MWJA 1E4EB 4EFMA 1CNMA 4BV2A 1LPPA 3KK0A 2GBLC 3UJCA 3O4IA 3PVZA 3CMAB 1XB2A 2PXXA 4NMWA 2B0CA 2FG6C 3NYIA 4GW3A 3TSWA 3UJ9A 4BNMA 1O97C 2EERA 3AFGA 5DBGA 5BQ5A 5A4IS 7AT1A 2DM6A 4UNRA 1E89A 1OXKB 2Q5FA 5BV2P 2QN3A 3GD7A 5CB8A 2WJVA 2O7RA 2ZS7A 4Z4FA 3MCAA 4KPUA 2BJVA 2AJCA 3PC2A 2H5JA 3OQBA 1ZK4A 4Y1RB 1M8JA 2R44A 4J1SA 3VI4B 1JAHA 4F5DA 4RIHA 1UMBB 2ZI4A 4P3KA 1T5BA 2IZ1A 2ZTHA 1PGPA 2FK8A 1ZONA 4ZALA 1K6JA 2CFRA 5A2QA 2FEOA 1QZUA 5TV2A 3P2YA 3JARA 3FB1A 4GH5A 1OFUX 5C32A 4QIHA 2WA2A 3KWLA 3DEHA 3GGGA 4AMBA 4CDRA 2CWDA 3D8UA 2PBLA 2BCGY 3PICA 3AHFA 2VHEA 3EMVA 1TECE 1RLOA 4YAEA 3DGEC 4GRIA 4LAFA 4GM1A 1ZCZA 1VHEA 2H2FA 4YACA 2FYTA 2VP5A 2VTKA 521PA 2CC2A 1HTWA 1I5EA 3ZCXA 1CUUA 1TGVA 1Q21A 2YIVX 4DG8A 4MHTA 3IOEA 1DJQA 2RGBA 1A2QA 4P33A 5L6MB 4DR6B 1L1QA 1CJMA 1VGRA 4LECA 4U4AA 3UHFA 4YAUA 4IIYA 3EBPA 2V9CA 3I9FA 3UBMA 4E31A 3HKCB 2RJ3A 2PUVA 3GWGA 3KDSE 3E0XA 1RRFA 3ETEA 1MPTA 5HXBA 2P2ZA 2XDYA 2WSSA 1C14A 4KXWA 4MW0A 4B34A 1CLUA 3FG9A 1ZJWA 3PFGA 3I9MA 4A16A 2G5TA 2ZB3A 1HE4A 5AXCA 4ENTA 4Y9UA 4E46A 2WTBA 3ZCUA 3GG9A 1TQ8A 4AVZA 1XTTA 4G24A 1N32B 1DKQA 2R1TB 3VYVA 1CRWG 2AYYA 3H87A 3NYWA 4MW9A 1M6NA 1J33A 1WZEA 4BJ3A 4CLDA 4HEQA 1G5IA 3LL7A 1H2AS 2W2XA 2A9PA 4MYUA 3M0EA 5AK6A 5DTEA 1CTQA 5T3UA 4XOUA 3TLGA 2C5SA 4PIMA 1NNI1 1BMFA 3V7AA 2HRBA 5IHPA 3UMRA 5C1IA 3ZDEA 1YO6A 1F6WA 3LHKA 4KW7A 3FMGA 4H0CA 1IAVA 4XD7D 3VJLA 1U2DA 4XSGA 1R0CA 1G9TA 3IDSA 5JCPA 2F48A 5BN3A 3WGJA 4ZKEA 4RTQA 3TZBA 5ALPA 1RWBA 5UKDA 3EG9B 2ZYHA 2J59A 4BKMA 3HR8A 5A3RA 2EKQA 2JZOA 4LXTA 5I48A 4RL4A 1JWLA 5C37A 3KJEA 4BBAA 3C3BA 1WBBA 1IJFA 3DNFA 2XOXA 2IYZA 2W2KB 4A0GA 5EESA 1PVVA 4PSUA 3PJGA 3GLGB 4WDQA 2GAJA 1Y42X 4Z1MD 2OC4A 2PMDA 2FMKA 2PFSA 1C1XB 3FWHA 1QFXA 3U81A 4URVR 1JPNA 5J3OA 2GZHA 4DC9A 4NCNA 1XJQA 1I6MA 4KPUB 3RQIA 2O8FB 2XMBA 3TPFA 4DLVA 4Z2AA 1Q6YA 2DFVA 5FA8A 3UV7A 3AV3A 4ZMSA 4QPZA 3OECA 3OAAA 2DETA 2X2FA 3WXMA 1FQWA 1KAQA 3SR4A 5AUPB 5BQFA 3CRVA 5EUQB 4B84A 2OBLA 2YICA 4EYQA 3N76A 2CFSA 5FYDA 4PR3A 1J0DA 2YVAA 1RI3A 4R9VA 1NZJA 3ZV5A 1V95A 4ALNA 2OUIA 1SQ5A 2BEVA 2H1FA 1Y7HA 1E43A 1NL3A 1XZBA 2Y0BA 3D3EA 4FR5A 4GDMA 2D1FA 3KLOA 4NATA 2ZL5A 1ZM3A 4Q7EA 1GFSA 4WPGA 3DL0A 3DQPA 4PFQA 4A03A 4CT5A 4MVJF 4IDAA 3PITA 4LXQA 4WKBA 5DYWA 1TD9A 2Q9BA 4TVBA 5C5IA 1A8SA 1X2EA 2X7HA 3OKPA 1JX6A 1Z6XA 2YOGA 2ZFUA 3DTVA 4IIBA 3VSBA 5G0VA 4JVLA 3QU7A 5G1OA 3E58A 1P4RA 1V4BA 1HT1E 4ZVRA 2PLWA 5G3YA 2FVXA 4RANA 5K3AA 3CIOA 4C6SA 1KP2A 2GZAA 1N7HA 2WICA 4PYNA 4ZQHA 3UHAA 2ACKA 3CZ9A 1SVOA 1OWLA 1PGOA 2EYQA 2KI5A 4ND2A 1HDYA 2Z9BA 3AHHA 3BMCB 2NYVA 1Q95A 3WOVA 3IR6A 2HU8A 1S2DA 1Y0YA 3BCHA 4R84A 1D5WA 3VYWA 2NIPA 3QY0A 2AQHA 4EHFA 3CLSC 4KOEC 5LXTB 6ADHA 4BMYA 2F1KA 5CK5A 2G1JA 3RRBA 1QF6A 3H1AA 3MS2A 3CJTA 1N9ZA 2DG2A 3AUTA 3ZWOA 4CTOA 2X9NA 1ZU4A 1P1IA 5AUNB 5K03A 4PYLA 5B7QA 4FP9A 2GYUA 4AUEA 2GASA 2J9RA 2UZIR 2Z8YA 1E60A 3PP8A 1YKSA 5BVGB 4X06A 1QS0B 5DIZA 3KR1A 4DMKA 3H86A 3HWX1 5ELMA 1Q7RA 1JR2A 2COUA 1XEAA 3SC6A 1BXKA 4QVAA 2ZXHA 1L4NA 3B6MA 2GJRA 3BYZA 3ESCA 1R4ZA 4LHXA 3NX4A 1XUOA 5A03A 4DV7B 2R1VA 2ODTX 1J6UA 5DPMA 3PEWA 2ZGVA 3FPKA 3RRNA 1O97D 5T57A 3V4OA 2JI6A 4EBBA 4BPRA 1EDBA 1KDVA 4L57A 3ZCSA 5IC6A 3BRWA 1DRKA 2BFCB 4FD2A 4HGRA 4XORA 3WL5A 5JISA 5JH7A 2Q6OA 1FUEA 3D8BA 5AK4A 2FPPB 2X8JB 4IIJA 4MI9A 5JAOA 5HZHA 1Z6TA 1EVJA 1NB0A 1SUFA 5LB4A 3HUEA 4QYSA 3IBYA 4DVGA 2C8VA 4EY5A 1BXGB 4Q1EA 3FVQA 4ESVA 2GJ9A 3J81k 1U04A 3NT5A 2PUEA 1SU6A 1TM4E 1KY4A 4CR6A 1BAPA 2OHIA 2HSDA 1PWZA 4UHEA 3B8HA 4NCBA 5SZJA 4P4TA 1UEIA 3IEPA 2GK6A 1I51A 1MJFA 2BKUA 3O26A 4ZODA 3T7AA 3UO8B 1U2EA 4B6PA 3A8TA 6REQB 1WCYA 2NUTB 1XT6A 4CIYA 4DARA 2Y27A 1PNVA 2DU8A 3PJDA 4LVUA 3TB4A 3U3DA 4OHPA 2ZSJA 2GTIA 2BFCA 3ZCRA 4K40A 5L3QB 4QQRA 2JH9A 5JT1A 1B0UA 1TCUA 3MMSA 3TNYA 2QJOA 4BMSA 2W4QA 3HBFA 3IFSA 5KNDH 3QPCA 4ZYUA 3I2YX 4WWVA 5KYYA 4BXOA 4XJVA 4OBEA 3QE2A 2JFOA 1JILA 5KWJA 1T4CB 4WEOA 3OQVA 2CNKA 2YY6A 1U2DC 1PFVA 2R25B 1B26A 4Q9NA 4C43A 2ZJ2A 3AI1A 3I1YA 4YJFB 1R3UA 3GY0A 4IJQA 3RRYA 4JJEA 4LRYA 4EPVA 3U4IA 4OSEA 1XLVA 4OO3A 3WBJA 5DMHA 1ISSA 4HE6A 2O0MA 4MQFB 3RE1A 1XC7A 3VAAA 5JVDB 1UOEA 3QVXA 1X6VA 2OBFA 4YUAA 3KETA 1MGPA 3B5EA 2K4MA 1NQAO 1V5VA 3E48A 4ENUA 4QTYA 4G67A 5HOEA 5KQMA 3C48A 1A4XA 4MHSA 5T8KA 2B98A 4MH0R 5AXAA 1QFSA 3A26A 1A9OA 3OWXA 4S1OA 4M88A 2XXBA 4P92A 4TL7A 1BIFA 5T67A 1KRXA 1P1HA 2LW7A 3KFLA 2Y0CA 1ZA2A 4JJZA 2QJRA 5CU7A 3KPWA 4CCAA 3V4RA 1U2GA 3OLYA 4QAJA 4ARCA 4FOPA 4WKCA 5LA6A 3HCFA 1JTVA 1VXRA 2H18A 5HGJA 3SHOA 3AEQB 3G49A 2EF0A 2Q8PA 4PNZA 5EIHA 2HQOA 2XVZA 4QYTA 2DC1A 3RK0A 3USES 1VCMA 3L6UA 4B4WA 3S1SA 1AXEA 3JAWB 1W0CA 1ZH0A 5BORA 4G0XA 4L6CA 3PEUA 1LBQA 1FMCA 1OI3A 4N4AA 5ES3A 1YI2B 2GS9A 2JFBA 2PT9A 3GUCA 2Q07A 3QKSA 4L75A 4QXMA 3R7BA 5ER6A 1SC6A 2RMKA 7ADHA 3D7NA 2BV3A 3ZEAA 4AJNA 1JH9A 3W5JA 4ESHA 1XEXA 3TRHA 3K70B 1VI6A 1KEWA 4R05A 4FLFA 4HLUA 2HI0A 3LRTA 3L2OB 3D31A 1ZNQO 3LD9A 4GMKA 4G26A 4N5DA 4ZXFA 4U9UA 1R2QA 3LZDA 3KNZA 3FDIA 1DAPA 1DJOA 1RHQA 1WXGA 3IPRA 4UXHA 2PX0A 2GPTA 3M89A 2LWIA 2QENA 2ZJYA 1D0VA 3KP1A 4L16A 2B6HA 4KXNA 4DRXA 1TF2A 4TN1A 1ZXLA 3FPFA 1HZEA 3RROA 5C7LO 4TPKA 1SJ9A 1YU6A 2RHLA 1P0QA 1JQ3A 3OUZA 4ZCQA 6LDHA 1G5FA 2V03A 1ATIA 1OZGA 3AR2A 1R4MB 1UBMS 2HYDA 5CW1A 4QDKA 1WMAA 2CB0A 2A92A 2ZYRA 4B32A 1IHXA 2EQ5A 2O1EA 1ADGA 1NJ5A 4BQPA 3EDRA 4XFDA 1CY4A 3P45A 1JYSA 4EJFA 5ELXA 3MOSA 2VNSA 3L8CA 3RU3A 3SYRA 3GFFA 3FBWA 1KH3A 2FPKA 2UUPA 1PJZA 1N6NA 2ZR7A 3TOCA 2BDUA 5B1SA 5BR4A 1MDFA 2R6DA 4MWGA 4EB8A 2EATA 3WADA 4R3NA 4NYJR 1E1KA 2MYPA 4I36A 3QWFA 4XTRA 1BMDA 2C95A 3HADA 5BSXA 5LUAA 4BX8A 3DCYA 3FPAA 1SCKA 1N0IA 3AY3A 1MQ8B 2PA3A 1OVGA 2QNIA 3AK4A 3GZJA 1TLLA 3OFSA 4JP2A 3T3GA 4DIBA 5LN1A 3CGWA 4HYYA 9GPBA 4EZBA 2ZZMA 1RZRD 3JWJA 4FE4A 3F4LA 4DJ5X 5ALIA 1U28C 4FINA 4HZIA 1I4LD 3SKBA 1JQDA 1MXHA 1PG5A 2BI7A 2BRUC 1LI4A 3IUMA 3QG5A 4P1VA 4Y9SA 5JXGA 3K9BA 4DUZB 3NO4A 5DNVA 3TIGA 3PRKE 1LLUA 4O4HF 3EGXA 2P3MA 2J30A 1XVIA 1E9EA 3WGYA 3O7WA 3AFNA 1NXTA 2QJTA 3E5RA 4M89A 2GUWA 3QF4B 3GP8A 2PBZA 4IYRA 5G1PA 4FOTA 4YR9A 1RDFA 2PEYA 4JC4A 3MVEA 4NBUA 4WZAE 4JA0A 4B76A 4AJEA 4R5HA 5ECYA 1TYCA 2AZDA 1RC0A 3LWZA 3VO2A 3UJNA 5AM4A 2D2XA 3KJNA 3VR4A 1I6KA 3IOCA 3NONA 3QKTA 4GXNA 3VR5A 1WCIB 1YCFA 1W44A 4NK4A 3UKOA 1B74A 1UOQA 3WNVA 4B3BA 5EJ4A 3FAKA 2L18A 2ZWVA 4EHHA 1SB9A 3E9NA 5H3LA 2DZDA 3BB1A 3NM4A 2G09A 5TGTA 5IVPA 1KQGA 4AO8A 1KY5A 2HJRA 2OHGA 1UXGA 3T4XA 3HUDA 5BWOA 3W2EA 2YUIA 3BG5A 4OQ4A 4LBWA 3O2SB 5C8YF 1V5GA 5K0FA 1MIHA 2H08A 3HBLA 2WWGA 2X6QA 2VT7A 3FMOB 3O94A 4L9SA 1RYBA 3S28A 5C1PA 2CNLA 4IHJA 4QD3A 2JFXA 1CJUC 5FBLB 2PDAA 3BMQA 4DLSA 5FBHA 4LF4B 4J1QA 3TB6A 1QYWA 1KR5A 4MYSA 4DV2B 2OXIA 3KZNA 2D62A 1DMSA 2JIMA 2H9IA 3PGVA 4UUMA 4FT4A 2VL7A 3ZTWA 3E27A 3CC8A 2POCA 4ME6A 1KMMA 3H4MA 4N3BA 2JJ8A 2Q7XA 4NFSA 3ZZTA 1V11B 4R8MA 2DPYA 1JFFA 1Z82A 4QUKA 2C4MA 1G1MA 3JU4A 1A98A 2EHDA 3FPPA 2G0NA 3JQ7B 3LX8A 4B6QA 3FNQA 4K9SA 5FLKA 3MMNA 1O94A 1V43A 2FTKE 2XGGA 3E9DA 4OIMA 5DGHA 1ZJZA 2XQGA 4PYMA 3EIEA 4ZIRB 2QSUA 4CM5A 1RQNA 2JKVA 1RRKA 1TZJA 2PZLA 1UIRA 1XAHA 1ZJYA 1Q5PA 3L05A 2Z5FA 4H3SA 1MLDA 1OVMA 3BWVA 2AMLA 4BNXA 3TD6A 1Z3IX 3R3XA 1KEPA 2D1SA 2WM9B 2Z5LA 5KJFA 3A2NA 1LEHA 1DC3A 5TS3A 3EBOA 1KYVA 5HF5A 1P0MA 2C7GA 3HGQA 3EZ9A 1HRDA 2GBGA 3PXUA 4G5SA 1S96A 1T5OA 2P4EA 1ZY2A 4AK9A 1FDWA 2W2NA 2IS2A 4JL5A 3R7AA 3TNDA 4JC8A 4TLMB 2C77A 1OXMA 2A1TS 2AQ8A 1TM3E 1YR1A 2CT8A 3LLUA 3HH8A 1PZNA 2PKCA 4JZKA 4HN4B 2NV0A 4P7JA 5IDYA 1OSNA 1R4NB 1A9ZA 1YHZA 4EBFA 2XW6A 4F4FA 5FUYA 1HDIA 3A7DA 1I18A 1CB0A 1I1OA 4CMGA 2IZ7A 3WYDA 1RQGA 5IJAA 3WOHA 1MEOA 4CBVA 5KC9A 3DUWA 2DPHA 3KUXA 2PAAA 3O4GA 5DHFA 2WZDA 4AF6A 1NM5C 2PJUA 3BL8A 3QTLA 3VR2D 3CONA 3ND6A 2Q5CA 2EJWA 3CCRB 3PB3A 4LZOA 1N9KA 4UCQA 1NMXA 4D79A 5HTKA 3NOXA 4IFEA 2R6JA 4YAJA 4RGVA 1ISIA 1MC8A 1ZP6A 2VT3A 3N8NA 2FJ0A 4CKEB 4R0MA 3D8TA 3KHTA 4JWTA 2V7TA 3BHJA 2XMDA 3E5MA 5T8KC 1EWVA 2YQ5A 2GEUA 3BMOB 4DZRA 3W5CA 1EK5A 3BY2A 4WWHA 3BMNB 4P54A 4O2BA 3JPWA 3GUVA 5P21A 1CRQA 3FW1A 4WKOA 4V0LA 1QZ3A 4PYJA 2H4FA 3OEHD 3K9WA 3PA6A 3IELA 4AY3A 4K3UA 3UIEA 3E7XA 3PC8C 4JXXA 2A4KA 3L40A 3WTBA 3DDNA 4YECA 3LX6A 1GZ5A 3A3YA 3D7KA 3FPCA 1IK6A 1MVOA 2D54A 3NPMA 3JYPA 2C3YA 4Y18A 4RQTA 3H5LA 5DFAA 2GLXA 3G85A 3NG1A 4DCTA 4R1NA 3AM1A 3CB4A 2FPGB 2AYZA 1MBZA 3I5XA 1VGQA 2GI4A 3MTDA 1B8UA 1ZHHA 1NVGA 1OWOA 1CRLA 1ZYUA 1GRQA 1S2NA 2BMEA 2PRJA 3EISA 3U3XA 1DEOA 2VQDA 3LOQA 3ZGLA 1VQ8B 1R10A 1NMZA 1V2GA 1Z16A 2QIOA 3WNCA 4Z9FA 1ZQ1A 1LUAA 3AG5A 2PMWB 2L0XA 4ESEA 5EE3A 5GV7A 3NRCA 4FB4A 3W79A 3PZRA 2VH2A 4KGVA 4EQ6A 3SBDA 5FBRB 5AH0A 3ELUA 2VLIA 3DBVO 3MTJA 4QNRA 1W36C 4MYTA 2ZG6A 2FOLA 3HXLA 4EHJA 2ODPA 2FCAA 4EG6A 4AXXA 1D2GA 4HTFB 4LXUA 3PX7A 2XWJI 5JIBA 3ZNPA 1P5FA 2HA4A 4I9UA 1WAMA 1ONPA 3BKWA 3O8NA 3MJSA 4ID3A 4JLPA 3I76A 2XGSA 4E1AA 2TMYA 4IP0A 5EZ5A 1ZJ6A 4IF6A 5LCXA 1EXDA 1J0EA 1RPJA 3TMKA 3AZQA 5E9WA 3BFXA 2J9GA 3GPLA 3OKFA 5GJCA 3L4KA 1G8YA 1JVBA 3QFHA 3JQCA 4ZCIA 3E9RA 4KYVA 4QU5A 2AR9A 2UZ1B 2JJ1A 3AW9A 5DHRA 4C4AA 4AJ2A 4ZN6A 2HXYA 2YWHA 1T3LA 3N2EA 2Q1XA 2G8NA 3R7NA 2XKJE 5AK3A 1Q15A 2FI1A 3H5IA 4IWNA 1QVFB 3ZE6A 2HF9A 3PNPA 2ZYDA 1BW9B 4TTJA 4ASUD 4CQMA 3BQMB 3AHJA 3ZBTA 3HB4X 4Q66C 5L7WA 3K9GA 3DAOA 3G59A 3NHJA 4NDAA 2XBUA 3H1PA 2P6PA 3VC1A 3CMEB 3ZJVA 3T34A 3AEUA 4KRGA 1SU8A 4ARIA 4B3JA 3FMPB 4G8BA 2PU7A 4PN7A 5TGDA 2L2QA 2MTBA 4UMVA 4Q5IA 3KCNA 1I0IA 4CF6A 3CESA 4J1NA 3RKUA 3QUBA 2B7LA 1UUFA 1NP7A 2PSJA 3IUJA 2P6OA 2W2LD 3RU9A 1UD5A 5CW2A 5DMXA 4CMBA 2YWDA 4BYMA 1FU4A 1P0PA 2IPNA 2GF2A 3F5FA 2R79A 4XD2A 4QX6A 3ZHCA 4PC1A 4U7DA 4CDMA 2CJXA 2CFCA 4ILKA 2XUAA 3ASSA 3GRYA 3EXIA 5A4FS 1PHPA 3IXLA 4U2CA 2MSEB 2IW3A 2RGWA 1C3XA 3L7AA 2XYRA 4IZ6A 2G8LA 2QSJA 2ZP1A 1TCVA 1C30A 1OYYA 2AS0A 1T2NA 2JH3A 3CCLB 1JAIA 2CVPA 3IHLA 4O5OA 4RZSA 3UNXA 3WHLA 1BGVA 1HWYA 3JQEA 3LUKA 3PNKA 4QDZA 3A05A 3NIBA 5D2CA 4ZVMA 2OXTA 4HDRA 1UJ6A 2DBVO 2YC2C 4FDTA 1H8HA 1G18A 2Q7DA 1AJEA 4U2DA 1HYEA 1KYIA 2GN0A 2PHZA 3FYSA 5DYTA 4R0VA 4AJIA 1Q7GA 2WZPP 5B3JA 1QGYA 3Q9SA 2VEOA 4GPAA 4J29A 2WYWA 4L8GA 5JNVA 5HPYB 2FSUA 2GEBA 4K6MA 5JAHA 2XKKA 5CIQA 4DR2B 1KSJA 1OJLA 5EJAA 3T5CA 5AVOA 3GLGA 1SVUA 3JQQA 2FH5B 6YASA 3A9VA 5AI4A 4EA9A 5B12A 1JIUA 2BMAA 1R6XA 1A1VA 1ZHOA 2WOOA 3N2YA 4NH4A 1GUYA 1UOOA 4NESA 4L8VA 1KO1A 4PCVA 3TBHA 4A8JB 5KTPA 3ND9A 2WVHA 2WBLC 4DJFC 1NDQA 2C00A 4IMPA 1HFEL 3FDFA 4E5SA 1QJCA 2J3KA 2WTMA 4I50A 4X3OA 3K9HA 4G56A 4XPIA 4F8EA 4KIGA 5G02A 4X7CA 5HX7A 2XMZA 3PWTA 5KINB 1L9XA 3LRPA 1VQ5B 3PQ4A 3RARA 5JNLA 3UG7A 2OESA 2W2KA 3NXKA 4TV9B 2ZRFA 3DPIA 3K2QA 5EWJB 1JB9A 1E1QA 1E94E 1VJDA 2AK3A 4MQ5A 1KFEB 2QTCA 3BVPA 3PTAA 1XA0A 3WIEA 1GIAA 4G07A 4O0LA 1QC5B 3HJGA 4LV8B 3DE3X 5H59A 3CISA 3GLFB 1Z33A 3BCDA 3AILA 3X2EA 2H5EA 4M0KA 3WKDA 4QT4A 1W0JD 5J4KA 4X64B 4Z4IA 2NU7A 1W94A 4KQMA 4IIUA 3JQ9C 3UA4A 4IIDA 3ZK7A 2PRIA 4FGZA 5IUJC 2NO6A 2ZL7A 3OOHA 4H35A 3BWEA 2VDRB 4WNYA 3UG6A 4DIMA 4CTMA 1RQ2A 4BVBA 5ADUS 2COEA 3TQTA 3CWZA 3WAJA 3BX1A 4BYGA 4F60A 4WVFA 4IDCA 5KW9A 3JZAA 3CNQS 5DW0A 1NN5A 4UTPA 4OB7A 3ENNA 3M6FA 5CT9A 4ZV7A 1QX4A 1N36B 4G1UC 4E70A 3A06A 1EFKA 4OGLA 4N5NA 3VAYA 3RGWS 5K0BA 1V3UA 1NW4A 1YJ8A 3JWHA 3K2EA 5IH3A 4EPXA 1PSWA 4UAUA 2J3HA 1LPMA 2QIPA 3HKEA 1L7XA 1M54A 2ACWA 4FOSA 4Y2VA 1DC6A 3SQNA 1VQNB 1R6DA 4KSCA 1SXJD 5G40A 4NZ9A 4EPYA 2XBLA 4KXLA 3KEWA 1PGNA 1V7PC 1ZX1A 2G25A 4FFMA 3HV0A 3SSNA 2B5WA 2G4LA 4EMTA 3DMTA 1CU1A 2RJOA 1DAKA 3L9XA 1GNTA 4L4XA 4QT0A 4UM5A 1DBVO 3V1MA 1HKHA 4IDPA 5KJEA 1RYMA 2A9RA 4NOKA 2VAPA 2Q2WA 1Y4AE 4ALJA 4B81A 4O2BF 3IP9A 2I3BA 1IQ0A 2E4ZA 3ITEA 3NAMA 2IU4A 5MDHA 3BGSA 1IPFA 3OBIA 4KI7A 1SKYB 2B20A 4F9EA 3GRPA 2RAVA 1UPFA 1FNMA 1TOAA 3RW9A 2HU2A 4WV3A 4Q9IA 3EDMA 1OXSC 3DMPA 1OB5A 4OGFA 1N4DA 1ORTA 5IAJA 4BLPA 4CF3A 5JLJA 3DMDA 4C7VA 4JJAA 1ES9A 1PR9A 2DYKA 3OT4A 3T9EA 1FZTA 3A70A 1W30A 4LDJA 3AM5A 3QNMA 4N41A 1A88A 3G5MA 1E0AA 2G5GX 3ICPA 3CD6B 4OGWA 4YRMA 4A0SA 4A4DA 4HDKA 1OI4A 1G0OA 1NAIA 1OI2A 3E4CA 4NBWA 2QUAA 1IH8A 1FRQA 2WU8A 5K3SA 3UMSA 4KO8A 4V1CB 1JU3A 3ABSB 1VG0B 2GBLA 2P30A 4BLWA 2F59A 1XOIA 3SMQA 5B6JA 1CD5A 5FTNA 4N7MA 4FBGA 1VLJA 5FF9A 4CMEA 1J2UA 2H1OA 1QPGA 2FW6A 2Z04A 2OVBA 2PPVA 3DEAA 3HBJA 4WFQA 3F3YA 1NTRA 2QYHA 1LQTA 1YRHA 1XZEA 2XVYA 3BORA 3NLLA 5D5QA 1M73E 3G2PA 4CE6A 3ZJUA 2WV7A 1J97A 3ZZ1A 3PT5A 3G0IA 4RS3A 1HDOA 3CLRD 4N3GA 3KVNA 4PANA 1KMNA 1TA0A 5JBQA 1E2MA 5TR9A 1R27A 2G5CA 5EE1A 3FNEA 4KYUA 4R3WA 5K9ZA 4AKIA 3OFJA 2C4NA 5KB3A 4IXWA 2Y71A 1B8PA 1X1EA 3NCTA 2DHRA 4KO1S 4UXJA 2ZIGA 3I73A 2X6WA 4BMDA 3KKMA 1AS3A 4DVJA 3OO0A 2BFAA 1J2YA 4KKTA 3UMVA 3GGPA 3THYB 1BA3A 5F1OA 2W6MA 4X94A 3VPBA 1N6KA 3ZJ4A 4IIXA 1QCZA 3K9FC 3QUSA 3HZZA 5DS0A 1EZZA 3QF7A 3VKWA 1EFPA 4QPCA 3QYFA 4M21A 4W5OA 3GPCA 3HYTA 2SKCA 3B6JA 2Z4RA 3QI7A 1HZJA 3TSAA 5IF3A 1G9SA 1CYEA 2R1ZA 4G9GA 4RVGA 4XWWA 2LUOA 3G9ZA 1THZA 3LYLA 1XO1A 4X07A 3WDLA 1WM1A 1G4HA 1YDWA 2VEDA 3AUJB 3K0HA 1XU9A 2JLRA 4B3TB 1T1GA 3KHUA 3NBAA 3E3LA 4LJ7A 1PFUA 4BV9A 5BOSB 5BR8B 4K1XA 5C8YA 4LGMA 3FIUA 2QG6A 3H97A 4PAMA 4RU1A 4ZAZA 4F4HA 1SWWA 3WWDA 2IKSA 1QB7A 3A1WA 3I1IA 3ONNA 4NBTA 1FYVA 2IPXA 3NPAA 4O4LB 3PXEA 4AP6A 4EQ6B 1YDEA 4KBFA 1PR5A 2HRDA 3E7WA 2FJUA 4EEZA 3VKGA 3EYAA 4D2IA 5TC4A 2ZPAA 2R5NA 1YR6A 4F5EA 2KJQA 3KYCA 4UAVA 4ER7A