2RC5A

Refined structure of fnr from leptospira interrogans
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
308
structure length
306
Chain Sequence
PTREPQINLFKKSNPYKAKVISNVLLTPETGTGKRPKKEGEALVHRIVLAIDHSAYPYVIGQSGGVIPPGEDPEKKAKGLADVGYTVRLYSIASPSYSFGMKEDNIEFIIKRDNIYNGNIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFLLPNTDFSGDIMFLATGTGIAPFIGMSEELLEHKLIKFTGNITLVYGAPYSDELVMMDYLKGLESKHKNFKLITAISREEKNSFDGGRMYISHRVREQAEAVKKILNGGGRFYICGGPKGMEKGVIEEIQKISGNTGTYEEFKHHLEGAHQLFVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-NADP reductase
publication title Crystal structures of Leptospira interrogans FAD-containing ferredoxin-NADP+ reductase and its complex with NADP+.
pubmed doi rcsb
source organism Leptospira interrogans
molecule tags Oxidoreductase
total genus 89
structure length 306
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2rc5A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2rc5A02
4QFMA 3G71B 1DDGA 4RD3A 2BN4A 4G1VA 2YWGA 1IB0A 4B47A 1VQ5B 4RD6A 3CCRB 3AGQA 1OGIA 4RCYA 5EMNA 3ZZUA 1KD1D 3CMAB 2FX3A 2QTLA 3WBJA 1VQ4B 2PMDA 3WBKA 4LC0A 4TMZA 1A8PA 2R6HA 2RC6A 1D8TA 2XNCA 3CCUB 3LO8A 1E63A 1K8AD 4ZCIA 1BX0A 2BGJA 4N3NA 1GO2A 3VNUA 3I56B 3E20A 4M4SA 4RJLA 1EP2B 3AVVA 4RD1A 1R5OA 5H59A 1TTTA 5JBQA 3MCAA 3U6KA 1CNFA 3CD6B 1FNMA 1GJRA 1DARA 3U2QA 3CRZA 4UAJA 2VYQA 1EP1B 3A1FA 4LBVA 4B48A 5TY0A 1J9ZA 2XNJA 2GQFA 1GVHA 1FDRA 4ACBA 3OJWA 1VQMB 4P3YA 1N0UA 4NCNA 3JQRA 1BJKA 1G7TA 1U2RA 4RD0A 1Q82D 1BQEA 4ZV4A 1VQLB 2VNHA 4PGOA 3I1FA 4YHBA 1KC8D 4ZGNB 1QX4A 2YWFA 3E1YE 3WNDA 2BGIA 3OZUA 1QVGB 2PIAA 4M1KA 2AHOA 3CW2A 4DQLA 1IJEA 1N0VC 4Q7JB 2B5OA 3FPKA 4IW3B 4DQKA 3CMEB 1QGAA 1YI2B 3B78A 1W34A 1QUFA 4QHYA 1EFUA 3CXCB 3ZZTA 1KK1A 4RCZA 2EIXA 1TLLA 4AF7A 2BPOA 3W2EA 1BX1A 5AN9A 3AVWA 1DG1G 1NJID 1KQSB 4Y7CA 3ZBTA 1ZM2A 1B23P 1VQPB 2PLFA 4FWTA 3B8HA 1R5BA 1Q81D 4F7DA 3WYAA 3VNVA 4G5GA 3QE2A 3QFSA 4P6VF 5DSZA 2QTZA 1R5NA 1YHQB 1VQ6B 4LBYA 2HDNB 2CRVA 4TMTA 4WQMA 3I55B 1F60A 3MHPA 3W5VA 1KK0A 1HA3A 3OJXA 4LBWA 1VQNB 1YITB 1K9MD 2DCUA 2DETA 5THXA 1NDHA 4PC7A 3G4SB 4EH1A 4FN5A 1JA0A 4ZGQB 4M2LA 1JNYA 3LVBA 4YAFA 1QH0A 3PENA 1VQ7B 1XE1A 3CC7B 2OK8A 1ZM4A 1QG0A 1UMKA 3CC4B 1VQOB 1YIJB 1EWYA 4ZCMA 2BM0A 3ZBUA 2BVNA 1E62A 3CCMB 1QGZA 1W35A 3MMPA 2XEXA 4PC1A 2DEUA 2VNJA 3OZWA 4N3GA 2QEXB 4TN1A 2YWEA 2ZITA 4R71A 4TMVA 4YAWA 1W2BB 3CB4A 1GAQA 4C43A 2E1RA 1CNEA 3U6BA 3LRXA 1KK3A 3CCVB 3WXMA 1K73D 4LBZA 1ELOA 4PC6A 4U9UA 3FJOA 5HXBA 2BSAA 2BMWA 2HCJB 2DERA 3AVTA 3ES9A 3OZVA 3B82A 5KSWB 3G6EB 3CCLB 4RD2A 2C77A 2OTJB 4TMWA 3AVXA 3P26A 1OB2A 1ZM3A 1EP3B 1F20A 2VZLA 4ACAA 2CNDA 1QGYA 1JB9A 3ZC3A 3CCSB 3QFTA 3CCQB 1ZUNB 2D74A 2B7CA 4MYTA 3VO2A 1FNBA 1QFJA 4Y9RA 1H42A 4B3XA 4M53A 1EFTA 1FNDA 1QFYA 1FNCA 1OB5A 1KK2A 1S72B 3JQPA 1FRNA 1WDTA 4M0LA 4YALA 2BV3A 1EFCA 3OW2B 2J7KA 1IJFA 1N8RD 4C0SA 5FA6A 2B7BA 2NPFA 1Q86D 1M90D 1AMOA 1G7CA 3W2HA 5GV7A 2HMAA 2GPJA 2OTLB 4YAOA 3CCJB 4FK8A 1KTVA 2EFGA 1KJZA 1XB2A 1B2RA 1I7PA 2VNIA 3W5HA 4G1BA 1QVFB 4HE5A 1QFZA 1DDIA 3W2GA 2QDXA 1Q7YD 1TVCA 1G7RA 4PC3A 2YWHA 1GAWA 1TUIA 2BM1A 4BPRA 1EXMA 5TV2A 4ZCLA 2OK7A 1H85A 1JJ2B 3AGPA 3CPWB 4K1XA 3V76A 2VNKA 1G7SA 1W87A 4H9GA 4J0QA 2X3UA 1GR1A 1E64A 3W2IA 1S0UA 3QFCA 3QSYA 4B44A 4Y9UA 3ZZ0A 4AF6A 3P27A 1YJWB 1VQKB 1YJNB 1SM4A 3JQQA 2C78A 5GV8A 3LYUA 3W2FA 2BF4A 4HE6A 3VO1A 1AIPA 1OGJA 3CC2B 4YAUA 4PC2A 5H5JA 3W5UA 1QUEA 1CQXA 4AC9A 3WNBA 1FRQA 2QN6A 4B4DA 1D2EA 2QA4B 4B43A 3WY9A 3AVYA 1YJ9B 1KRHA 2QMUA 3CCEB 4TMXA 2RC5A 1VQ8B 1M1KD 3WNCA 4MYUA 3QFRA 1ZM9A 3SJZA 3AVUA 4RD4A 4NBSA 3J81k 1VQ9B 2DY1A 1JA1A 1D1NA 3VMFA 5TR9A 1SKQA
chains in the Genus database with same CATH superfamily
2C2MA 4GMDA 1JIXA 1GDDA 2QRNA 3CTPA 3AB8A 1GSAA 5FQNA 4I4CA 4PAGA 5CTJA 1NMEA 3G2QA 1V5EA 1NQOA 1ECBA 4INJA 3GW8A 3HUTA 3RB8A 2ZJOA 4WI1A 2F1MA 1A96A 4BLQA 4IDHA 5CDTA 1QTRA 4D4GA 3C3DA 5KSZA 4LGVA 1PJSA 4KH1A 1LFDB 2IE8A 3PUNA 1HV8A 2I0FA 4GVXA 5FDFA 4QNRA 3T7IA 4UCXA 4TWJA 1N6IA 2OLJA 3GNLA 3CO0S 1X80A 4JLDA 2QVGA 1NYTA 4KXMA 1VYTA 4HDMB 1NG1A 4UATA 1NPDA 3QU4A 1NVBA 4KE8A 2AXPA 4J0EA 4QU5A 1IE3A 1VJ0A 2IYWA 3BH7A 1WOPA 1IOZA 2P9BA 3ISJA 4KQFA 4RLQA 5TQ2B 3QLUC 1T0PA 2DR3A 2PXCA 3K8OE 3SX2A 4B2PA 2XCOA 1Y5RA 1XXLA 1ZD8A 4NV0A 3NHFA 2AC2A 2CSUA 1UOPA 2XT6A 1ZIPA 9ATCA 1YZYA 2PFSA 4D5EA 2Q28A 2GRAA 5I7AA 3MJHA 1NB9A 2WABA 1YULA 1RPAA 1MZVA 1ZD5A 2AW3A 1Z2EA 5DBGA 3TI7A 2F6RA 4BLSA 2G17A 4QNMA 4QULA 4TQGA 4YT8A 3O2SB 2JGAA 1NVFA 3DDOA 2H5JA 1CJTC 1UEJA 1VLYA 3DFZA 1QYWA 3ER6A 3NOOA 4MJLA 5L3QA 1QAOA 4IX9A 2PQMA 2VJOA 2WVJA 4X8OA 4RD1A 1FRFS 1LLUA 1SK8A 4JL6A 1II8A 2YFQA 3R0JA 2ASVA 2CXRA 2PANA 3JAWB 1U1EA 1W2WB 4GWGA 3UWPA 1D6SA 1QHNA 4CYMA 1ZMOA 8AT1A 4DF3A 1PJTA 2PA3A 2FWPA 3G1WA 5EP2A 1FBNA 1G6KA 1RCTE 2IDJA 2O5CA 3TGWA 3RSQA 2AFVA 3ZWOA 3H11B 3K0BA 2O0MA 5KMGB 4X3PA 4JYAB 1RYZA 1T9CA 3F96A 3TH5A 4N8DA 4FFSA 4Y1RB 5K3FB 1JLKA 1M7BA 2YN2A 2FHSA 3D8SA 3DVLA 4MEAA 4DMGA 1XCJA 1ZJYA 4LBVA 3HBJA 3IP8A 5CMLA 1Y0RA 3SZLA 3GA5A 2COKA 1NLZA 4FDAA 2AW5A 1K5DA 1J9ZA 3VYUB 2RKBA 1NR7A 1DCFA 3M1LA 4RF2A 3O4FA 3V2IA 1N36B 4UU1A 2QQEA 4RM0A 3OJWA 3UKDA 5JWRA 3UY4A 4KO3S 3NI2A 5EE5B 3PVDA 1N3LA 3PF9A 4EG0A 4CM6A 3PBKA 4IXDA 2DU8A 2QSZA 3LCMA 1FFYA 2R25B 3ZX4A 4M6WA 1LBQA 1W0KA 4B3FX 1N77A 3ZGNA 5CJPA 3OD5A 1PWEA 1LWOA 3O82A 4N54A 4EARA 1LPSA 2Q6OA 3T9AA 1W88B 3VFDA 1I2BA 3IP7A 2MR5A 1C4OA 4KVGA 4QTUB 5JRZA 2HKIA 1Q3TA 3WLRA 1NJ1A 5BQXA 2IDMA 1ZX1A 2A14A 4H6VA 3G1TA 4H1WA 3WNDA 1A4UA 5FPHA 2XWQA 4AZSA 4MHSA 2WPDA 1TKCA 1XF9A 3AHHA 1GNRA 5K45A 1KFJB 3KL4A 5AXDA 1XLTA 4EYOA 1SGWA 4KPUA 1ACLA 1WCYA 3N07A 3QUAA 4LXIA 3SDZA 3H84A 3IUBA 5ESXA 5K0NA 5JY6A 2CK3D 1X1QA 5COBA 3RVDA 3WKBA 3ZCXA 2XCRB 4RLFA 1QV9A 4MYRA 4WKOA 3WMXA 5TXGA 1NXTA 4I81A 3WLEA 3OFVA 4F5DA 1JVBA 3IP6A 3CMEB 1JDPA 2C3OA 2VT2A 2QMYA 2UUPA 2ZVJA 4UM9D 3L6OO 2PKYX 3SMQA 1QGAA 4MA0A 3TBHA 1YI2B 1PR1A 2VG8A 1Q0PA 2P4QA 1PJCA 4B4KA 2OORC 1K28D 4UHHA 4CMAA 4L4RA 3CXCB 4RAOA 4QOSA 1KK1A 3DFFA 1EKXA 2HUNA 3Q0EA 3R74A 2XYGA 3GUCA 5EIWA 4Y2TA 4YCMA 2PJUA 3NHBA 3SFVA 3DEJA 3IHKA 3OPNA 2DFKB 1TB4A 2QMQA 3BDIA 4EF6A 1NYRA 2J45A 3FYSA 3PYMA 4D9KA 3B1KA 2AI3A 4C0QC 1POXA 2FE4A 1Y1SA 4G1FA 5TS3A 4DLTA 1B23P 1K98A 1VQPB 1R4MB 1Q7GA 1ZD3A 4KXQA 3GIWA 1NXPA 2CVHA 1EGAA 3HYTA 2FN4A 3KZNA 3KR9A 3RTBA 2G0TA 2P68A 4C5AA 5I8WA 5EIBC 3TZQA 4Y6GB 1EK0A 1XQWA 4FUTA 4JR0A 1E2JA 5CLFA 1CQPA 4KACA 3ZZ1A 1RRVA 1JE1A 1YBVA 5LVAA 2JASA 3DFUA 3FTDA 3ZY5A 3RTGA 1BKYA 5A5EA 5LQJA 3NWBA 2JLBA 2OVFA 2JRCA 3D2LA 3OURA 2RGNC 2RB5A 1FIUA 2KLHA 4FGLA 1YHQB 4AP6A 5ALUA 1JIKA 3CLRD 3DMDA 5J4LA 4G4GA 1MHPA 1OXKB 4I46A 3N74A 1XVIA 3TLBA 3SC3A 2QZZA 1D6MA 1JH8A 3DZIA 5BURA 1I3KA 1WPRA 1H9BA 5LYJB 2CLFB 3FYDA 2KHZA 3GYBA 5DDIP 2ZLBA 4OUDA 1TOAA 4KDRA 4TSFD 2IOYA 1C81A 3F67A 1KETA 1G8KA 1L5VA 3EYWA 4KYUA 5DYGA 4BP3A 1EPUA 2O2SA 5K2OA 4G0WA 3VSDA 4XDHA 3WGZA 3B53X 2GARA 4N12A 2B9EA 5THQA 5LNK1 4YEJA 2Y92A 4UHDA 3EPJA 2IZ0A 3C3YA 3ZHZA 4PC7A 4UPDA 1IWOA 5KYXA 2O8EA 2JA1A 1MW8X 3MTAA 2HN9A 3EQ9A 3NHPA 3C8UA 4U6NA 3KR0A 3U3RA 5HQTA 2Y05A 2D59A 5HPYB 3RK4A 4B1FA 1CIPA 3CINA 4YT5A 3PENA 2VA9A 3D02A 4CDMA 4V0RA 3U60B 2WG2A 1A5ZA 1I3OA 1G3UA 4IZHA 4YQYA 4X7FA 4D80A 5KVCA 1A9XA 4HRYA 3C98A 3R3XA 4JX8A 2QWXA 3OEED 3RUEA 1XCOA 4U8GA 3GEBA 3UCXA 1QG0A 3EXG2 1OAOA 4PG6A 5HBGA 4F8JA 2P0EA 1UFVA 3VKFA 3GJ0A 1K0UA 2FSGA 2IZ5A 3SLRA 1DAEA 3A6HA 5IKXA 2J5KA 1H23A 2WUWE 5AVKA 2ZUSA 4U5XA 3U7QA 1EWYA 4GYWA 3TGPA 1GU7A 3AJDA 3MJRA 1DO0A 2E9SA 4RCVA 1UINA 1IUOA 1ORTA 2PMBA 3ZBUA 4FCWA 4P3KA 2Q41A 2C2BA 5F9MA 3V8RA 1LK7A 1IXKA 2O52A 3MFYA 1RJ9B 3QMPA 4BUCA 5IANA 4EL0A 3HC7A 4YI3A 1XL0A 3GT4A 2JCVA 2QW1A 4H17A 4NF2A 3WYCA 1AA6A 3OKPA 4AIRA 4C0AC 2BEUB 2J4CA 2XYPA 2P79A 3D0QA 3UZUA 4JI0B 1XVVA 2R6GA 1ESDA 4JT9A 2W2PA 3WLAA 3H9EO 3OIDA 4TN1A 2YFYA 1COWD 1NQWA 1QNLA 2VWGA 3AHJA 1R4ZA 3JQ7A 1QWSA 3Q9LA 4R71A 4MI3A 5JS6A 1OWNA 3OZBA 2TMGA 3LX6A 5D5HA 1T25A 5DWQA 2OCAA 4RHCA 2D7DA 1JBEA 2HOQA 2VRCD 4D6XA 1KY3A 3DHEA 2C4HA 4OHBA 2VK1A 3RG8A 3OIUA 1K73D 2CK3A 4B83A 1I4LD 2V3WA 3OI7A 4X0CA 4BFUA 2A9KA 2D3WA 1GLVA 4IGFA 2CL0X 3NIDB 4BEWA 5KWSA 4Q7MB 3L4KA 2YIVX 4KXWA 3WSVA 3ZDBA 4KYTA 2W83A 1L8QA 4EJSA 2OA0A 1NGSA 2HUPA 2I4LA 3M1AA 4TV8B 3CN9A 1QJ4A 3TQFA 2ODQA 4EYEA 1N7GA 1I2AA 2HGZA 3FNQA 3P2MA 5EXPA 1JIVA 3I04A 5AI9A 4CHGA 2Y1OA 4KXLA 4Z4HA 5BSRA 3PEWA 4YUYA 2WM3A 1CWUA 2GEBA 1SKYB 1NAHA 2ZTMA 2X4LA 3DBOB 2X8AA 3Q7SA 3SGLA 2FPPB 1BU8A 1TIBA 2QVLA 5AM1A 1M6HA 3UGTA 4RTQA 1GAJA 3UN1A 4R84A 3Q3IA 1YBFA 3I5YA 2R5FA 2Z57A 3R8FA 4K8OA 3LY9A 3E4CA 1UODA 2VJNA 2OQVA 2O0JA 2ZYRA 5FLKA 2CJXA 2AD5A 5KINB 2O8BB 4B0PA 3A2NA 1EIZA 1TJ4A 2XQJA 5TRTA 4NBNA 1PP4A 1Q15A 4IZIA 2BCJQ 4GIBA 4GPAA 4XOTA 3VO2A 1M67A 2JEYA 2Z9DA 5KDDA 3L7JA 1QS0B 2C92A 3DLPX 4HWKA 3GT0A 2GN1A 3NM4A 3BTSA 1EFPA 1OIWA 4RZHA 3ND9A 3UEOA 4DC9A 1YR9A 5EIHA 2XDQA 3RLIA 4G1CA 1AHPA 2ZXFA 3G8CA 4NHEA 3PC3A 2H08A 1KOFA 2NO9A 1J70A 2WUVA 4OJMX 3TMYA 3D26A 1MQ8B 2YHSA 3EGEA 1SCKA 4LQLA 3UT5A 2J87A 4AU1A 4WESA 4DMLA 1IBMB 1M5TA 1PWXA 5G0UA 3DPSA 2AF3C 2RGGA 5CVTA 4FGSA 4CCYB 4XB1A 2PLNA 3C4VA 3GUVA 5C4MA 1O97C 2QPAA 4QBIA 5IAKA 1M90D 4L76A 2RGAA 2JGIA 3SJ7A 4TSFA 1ZSYA 4BGUA 4URUR 1C2YA 1O4VA 1DV2A 3FMOB 3L84A 1RRKA 2XCQA 4P4TA 4XWWA 2PE5A 2PVCA 1YX2A 2QXUA 3BY2A 4I3FA 4LQDA 4D4LA 1NLUA 4QGSA 2JVKA 4U2DA 1XLTC 3ZNQA 1JQ3A 1O7JA 3H19A 1G20E 1I5OA 4TS1A 2GYWA 3ZU3A 2N75A 4CI9A 4E14A 1D6JA 1T1GA 4RLSA 3SEJA 2ZIXB 1VXOA 4NFSA 5T64A 3IBCA 1OVGA 1QF9A 3EBLA 4A91A 2E1BA 2V4DA 1XMPA 4RXTA 1LTQA 1C8VB 2QEQA 3BXXA 4MVJM 5ALPA 5AKZA 3KYDA 1YZ3A 2W6NA 3M6MD 4D4JA 4DJ5X 2XWBF 2DUUA 2PMWB 3UJDA 1AMNA 2O07A 4IIFA 1V16B 3GLFE 4E08A 3CRRA 4K40A 3AEQA 3OEEA 1HGXA 1LKZA 2O7QA 4KR6A 2Q4EA 4IWNA 1L4LA 2X8JA 2JGRA 3PGKA 4YHHB 2QGNA 2YVKA 3FPGA 3EIEA 4Z4FA 3RS0A 3OICA 4K1LA 2ZTLA 4TKUB 1FZTA 3S81A 1FX1A 1KJ8A 4F3NA 1HBJA 4LPSA 1J6UA 2FMTA 2OHFA 1DEHA 5K7SA 1RNLA 2N46A 4PBTA 4ZOAA 4X07A 1D04A 1W9MA 1QO0D 1KWGA 4A82A 4H6PA 3V8MA 1GCAA 3H94A 2I4MA 1A4IA 2NXWA 1N8NA 3I9V1 3OU7A 1XEXA 1GQ2A 4JLJA 3K32A 4HFRA 4N0PA 1VA5A 5DPMA 4HF7A 1OTXA 5IN4A 3Q3EA 5BSTA 4LF9B 3UK7A 1JTVA 3T15A 1UDCA 1D2CA 3GLUA 4P32A 1MG0A 3HBNA 2WU1A 1I3CA 3VISA 1ENZA 1JQLB 1MO5A 4WDQA 3RWMB 4K9PA 4DBLC 5HKLA 1NKTA 3MF4A 1COWA 5AJHA 2E4AA 4N5LA 3D59A 3HLKA 4N8EA 5GY7A 3HTXA 3RK0A 3UIEA 2W6OA 4NJOA 1F0NA 5A02A 2IYOA 2VJAA 2W0SA 4JEUA 4PO8A 3P27A 1EUCA 1TEHA 3ENZA 4WKNA 1YJNB 3QELA 4BMPB 2ZVDA 1Y9JA 1RLUA 2VRCA 3Q2IA 3UOGA 1OBCA 1DIRA 3KJHA 5AVQA 2FXVA 621PA 1YBHA 3IQDB 3K53A 5BSGA 3TL3A 3VTAA 4JBLA 4WLNA 3TINA 2J6IA 4H7DA 1BCSA 2QOEA 1SUCA 3M34A 5EE1A 5A9TA 5L40A 4MUGA 1YD7A 2NSJA 5LQKA 1Q9SA 5IVPA 2P2GA 2HI0A 2NM0A 2VUIB 1OWOA 3IDQA 3N2ZB 1KI2A 3EWNA 2ZSIA 2QM8A 2ZRHA 3P2YA 5CYOA 1BWQA 1NAIA 1XROA 5JMWA 2H16A 1J1UA 4YYEA 2UUBB 2X2OA 3INRA 3HLTA 4D56A 3LPNA 1EBUA 1RC0A 1B76A 5K3DA 3D3WA 3E7PA 1FSSA 2WFLB 3OQBA 3QEOA 4YQZA 4DYVA 1AURA 2XE4A 1UPXA 1EFVA 1Y6GA 1ND6A 1AKEA 1OV6A 2QA4B 3IKVA 2JK0A 1WIWA 3CZ4A 4MYDA 4Q01A 4S2EA 3ZV4A 2HBRA 3NPAA 4WGFA 5IYWA 1ZA1A 2I34A 4Z0PA 3DL2A 4HQ0A 3ETCA 3BSWA 1C9DB 2V5VA 4HB3A 4A26A 3F1LA 1YZTA 5EJFA 1UBKS 3TOCA 5BP7A 5LQAA 1VG8A 1XMIA 1Z73A 4KV9A 4GOND 2FZKA 4FYJA 5AW7A 4WOCA 3QUBA 2QZSA 4QXAA 8OHMA 3BH6A 2Y6UA 3CE9A 3MUNA 4YRSA 1K68A 3IUPA 4JOSA 1TEZA 1AH2A 3C45A 4DAEA 2IYRA 1XQ1A 4PU0A 5DASA 3SBDA 5AW4A 1A9OA 1ZRNA 4Z1OA 1ECFA 4GWLA 3TGLA 3R5HA 3RNOA 2XITA 2XYRA 3LZ6A 4LDNA 5AM5A 3E3LA 4IDGA 3SIXA 3VJMA 1KMCA 4XXHA 2J5BA 1HTTA 2GTIA 4KFSA 4LXTA 3QA3E 2V7VA 2Y66A 4WA7A 2W6CX 2X2PA 1KY4A 1ODJA 2FZWA 4JKOA 1GGMA 3B7GA 4XW2A 3D8TA 4HPWA 4GZ6A 4YPOA 2HXYA 4JQCA 3LC0A 4R98A 4ENTA 2QI9C 2CLHB 3NX4A 5GONB 5JZSA 4C2TA 4C4YA 4X00A 2CV2A 2VJJA 4M3NA 2I1QA 2XE7A 3ZZUA 1G38A 1FMFA 3QVKA 4CQMA 3R7FA 1RRGA 4P86A 1GQSA 4V0QA 4EY3A 2C7BA 2ODWA 3BWBA 4HZIA 4RA9A 5A3JA 1N7IA 2WMDA 3RYFA 4M0FA 4U7JA 4FHCA 4I55F 3HEMA 3HMKA 3VX4A 3ZE2B 5IZCA 1XZFA 2D1FA 3MLBA 5E7JA 4BX8A 3PIRA 2O54A 5JSHA 2B4AA 2WTEA 4JCCA 4Z9BA 1NNLA 4ALNA 3QVWA 4OJKA 1GPNA 1NU6A 2XQFA 2ZIXA 2VDOB 4BE7B 1YACA 5AK3A 2NO1A 1ZISA 5IUJC 5JS7A 1P2SA 4OO3A 4Z3DA 1RJWA 4FYXA 4X63A 5D6OA 1MX1A 2FPGB 1SIUA 4QSMA 4HDNB 4EJSC 2WTMA 4MGKR 5JVDF 4P4NA 4Y7DA 4WXYB 5MF6A 4IIEA 4Q7KA 1EBBA 4EGCB 4ZYZA 4XM1A 1KKUA 4MPDA 4EMTA 5I45A 5KQPA 3L7BA 3FPAA 3HKCB 4DMCA 3UCFA 4E1AA 1BX0A 1ZYUA 2NQTA 2JAPA 3GGSA 4EG1A 4M60A 4OREX 5ES3A 1XNJA 4KPFC 4E5PA 2J0SA 4PIVA 3FPJA 3EGIA 3PT9A 5KSYA 2NAPA 4FCVA 4DPLA 2XBUA 2WTXA 3AVVA 1Y8RA 2VZ0A 3FLMA 3T4UA 1ZHFA 2P2ZA 3OF5A 1GPAA 4MDFA 4AP9A 3KOUA 3OPYA 1QWOA 4OI1A 2VXYA 1YZHA 4DC1A 3M49A 2CMDA 4UDOA 3V33A 4DR3B 1QO0A 1GYPA 1UOQA 2GAIA 5AKLA 3ZLUA 1U5BB 3IUEA 5JQGA 2CDBA 1AXEA 1PSZA 5TMEA 4XLTA 1HZZC 4AT1A 3U2QA 4N48A 2JD1A 2BZSA 3ETGA 3IEKA 2CJWB 1ZIXA 3PUWA 1QGDA 1QNFA 3SFTA 3CNBA 2TSYB 2WZPP 1IZYA 1K06A 2Y93A 1LRJA 3T5BA 4AZ3A 1FPQA 2CDRA 5EQDA 3BXOA 4IQFA 3RSCA 3F7OA 4QBHA 1QH8A 5A1JA 5I01A 4I0WB 4YMWA 1CUXA 4A10A 4DWJA 1E9AA 3RC9A 5KTMA 4MUYA 1FDRA 2XT0A 5KOHB 1QXSA 4F46A 5AM3A 3DEYX 1OH8A 2WI8A 4MVCA 1X7HA 4F06A 1DC8A 3CLRC 2A2ZA 3GA0A 4ESVA 1PJ8A 4KSCA 1GZDA 1RHMA 2JBWA 2AEEA 2QLLA 3JQRA 1Y3CE 3OQ6A 2ZR0A 3A3OA 3PIIA 2A0WA 3V32A 4UW9A 3V8EA 5EE9A 4AKEA 1PV4A 4TQUS 2PX6A 3QMMA 4HYQA 5CBPA 1JFVA 2OESA 3WAJA 1MZPA 4MAFA 1Y8QB 4DLBA 3WVNA 4G89A 3ZXSA 3I23A 1KO5A 1NLMA 1BEZA 3G68A 4YP1A 5B6PA 4FE4A 1G63A 1D7OA 1JDSA 2WICA 2YL2A 3BB1A 3LY7A 4NMMA 3UH1A 4I5EA 3GRZA 1TKRA 3UMVA 4R2KA 4FIDA 1QE5A 2X85A 1DKNA 4OMCA 4WZBE 2VCYA 4J7UA 2ZRJA 1S8AA 2QTHA 3DDCA 3TIVA 1MOQA 1MDBA 1TK3A 2IPMA 2A33A 1Z6GA 3HRIA 1V5FA 4WCVA 2VRNA 5G02A 2ZUWA 2ZRAA 1M8JA 1VHJA 3UW3A 1D4AA 1N25A 4HFMA 5KOJA 4LOHA 4Z7JA 3ZJVA 4CM1A 3E61A 3RC8A 3P97A 2O6HA 3EFEA 5DMXA 4AO6A 3RAFC 5GGYA 2CXUA 5C5EA 4HGZA 2WF6A 2AMYA 1IDN1 3AP2A 3E22B 4IICA 3D0KA 4QDXA 4KXUA 4WT7A 3LWZA 3VX3A 3M4NA 4F0JA 2PUBA 4TZ0A 3ASTA 3IDSA 5E2BA 3ZCPA 3FVVA 1FK8A 3GRRA 4C4PA 2GT1A 5FUVA 5KTTA 4OA5A 4MW9A 3KV3O 3KKQA 4PXAA 5HCIA 4KUGA 4A8JC 3BCHA 3F46A 1URPA 3FYHA 1I0IA 2CCKA 5LMCA 4KMMA 4WBNB 4GS5A 4YT2A 2I7VA 2D06A 3KR1A 3TLEA 1U4OA 1W6RA 3T5AA 3GN2A 4XMYA 3ZBTA 1HOTA 3LWNA 4KZKA 4M7WA 4PG8A 1VPVA 2GKOA 5TT1A 2V5AA 1R4NA 2X0NA 4QC2A 2PLFA 2WJWA 1XZ8A 4K6OA 2JAQA 4J0CA 2IV2X 5CBKA 4F86A 4BPBA 2WY2D 1UBCA 5KNBH 2XB4A 1OREA 2FY8A 2QR3A 3A1EA 1Z28A 3D8HA 4RWZA 5A5VA 2ODAA 3BIJA 3SF0A 2ZAOA 2OGSA 5SZJA 4XASA 1NM5A 3ONUA 3T1NA 4RTSA 4GKJB 2EP5A 4K6CA 4OHUA 3J81A 3W6PA 4PG7A 3QLVA 3QV1A 1UZLA 4BMXA 3NWEA 3ZGXA 4B32A 1SVUA 2HIHA 2C1EA 4MUAA 3SNHA 1JEJA 4NOMA 2YY7A 1RIFA 4JA2A 4B8WA 4BNXA 1F5NA 2H1RA 2R7AA 4H6WA 4L5YA 2JFNA 1ONOA 4WQMA 3K96A 2VPPA 5L7YA 2H7CA 3PNLA 3JZFA 1F60A 3QXCA 2SHKA 1VJ1A 2B4YA 2YV5A 3HNPA 3JYQA 3PD0A 3PK0A 4XX0B 5J4VA 1V5GA 2E4WA 2QORA 2WMOB 3EIQA 3GZTB 4FDTA 3VBCA 3OECA 1JHUA 1TU0A 3ZJUA 2JARA 1GUAA 2IEGA 2C0PA 3ZU2A 1B42A 3DMFA 3NWJA 1W4AA 1HLPA 3OOWA 4PZPA 4E0FA 5FFMA 2PVSA 2QLMA 1W5BA 1KYXA 3FCOA 1GNSA 4LYGA 3WGQA 3D5EA 1SCJA 5AVWA 4M2LA 1T13A 1D2MA 4JB2A 3AIMA 2B4TO 4RX1A 2G9QA 2HRQA 5BQ5A 5K0SA 1IJKA 1GPDG 1Y6RA 4FLFA 4G0VA 2V3VA 2XF2A 1ZGCA 3FROA 2JHGA 3OFSA 4GOJA 2WYWA 2GOYA 4QUBA 4HEA6 2X5OA 2PEZA 3NEAA 4GX1A 3AWIA 1BE0A 4ZVSA 2DFVA 2Q1UA 1ID1A 3N0TA 3PIDA 1QHGA 1WPCA 4LRYA 3MMZA 2WAOA 2YZKA 1HE5A 1SB8A 1PJAA 3LBYA 2PZJA 1B8NA 2PSEA 3LCJA 2YDXA 3N2GB 1IU9A 2XZTA 1DBWA 3DTYA 1V7ZA 4FYHA 4RDIA 5L8VA 5HWSA 3WA7A 2CZCA 4YROA 4BLTA 2AEMA 5C51B 3KL2A 3TSZA 2BFDA 5HIIA 3AM3A 2JVIA 3EOAI 4XJVA 2BVNA 1GVNB 3SEQA 3VR5H 2IVFA 5BVHB 1KOGA 1BOOA 1LGYA 3T95A 2QZPA 3AXTA 3R2JA 3WK7A 1K7EB 2WZDA 2GK4A 4PG5A 3THYA 1NMYA 5ALYA 1SHZA 4MZDA 4BU0A 2NUBA 1XZDA 2OMKA 4WACA 2YINC 1ORWA 2PWPA 4GEKA 5AI5A 5AR1A 4E88A 1L7AA 1ZK4A 2AFIE 5F33A 2YWEA 5JFGA 3MPOA 5C8DA 4ZT6A 3F73A 1MHTA 3NDPA 1PEDA 1UJ6A 4X0EA 4TMVA 1ZBDA 5ENZA 3U4QB 1VGRA 2J48A 2MMGA 3VAYA 4LQ4A 4LFAB 1U5AA 1OE0A 1WCV1 3UFBA 3F4KA 1SEVA 1NWHA 3FPHA 1IHXA 4RELA 4BS9A 3VKVA 5IT4A 3UKJA 1GA6A 1O1YA 1WLSA 2J32A 3C7DB 3DB2A 3IE0A 3NT5A 2CXOA 5F2NA 1W9XA 3LX8A 5KYKA 3RK1A 3ER9A 3SLGA 3AYXB 5F7XA 3QF4B 3N28A 2AQHA 4PS1A 9LDBA 5HXBA 3C7TA 1VLLA 3V7NA 1PHRA 5K6RA 1QYVA 2Q49A 4QGBA 1C4KA 1M2GA 1W19A 3DOUA 3HHPA 2XYVA 2IYUA 3HP4A 4M1WA 1M1NA 5JCXA 1RIIA 2QX4A 4NAHA 4G5RA 3OQMA 1UWCA 1C7IA 1R74A 4ENSA 2D3LA 2OCIA 5JNWA 1JU4A 1LNSA 2P1DA 3NBKA 5F1OA 4BO2A 5DLEA 3DSRA 1HFWA 4JD5A 1I14A 4LJKA 1DRWA 1AHNA 4REMA 3DZDA 3LMKA 3P26A 4MSUA 1FDVA 1G18A 1HPLA 1T9GR 4NJMB 4Z4QA 4U9IS 4DOMA 4UARA 4X1KB 3VPHA 4LW8A 5JNUA 5BUZA 4DJAA 3W9YA 3BMQB 3D3QA 2QT9A 1F20A 2NVOA 3O6VA 4TM7A 3UPTA 5GJWC 1DIHA 1VG1A 2JW5A 2IWHA 4ARBA 1IQUA 2Y9PB 3I6ZA 4P4SB 4YJGA 4OATA 2WSIA 4XGIA 5DXJA 1N75A 2BMVA 1KI6A 3HO6A 3WO0A 3DCIA 4WZ6A 4B73A 4YRRA 3QH4A 2IV7A 4EA8A 2QL9A 3FTCA 4IJ5A 3ZE8A 2GYYA 4CFYA 4TV9B 3DC7A 3CX8A 2XNSA 3I2IA 1ONSA 4UE6A 2CVFA 3ZHSA 1SURA 3NEJA 2W2OA 4XFKA 2HL6A 5JECA 4PTZA 3ZEAA 4BO8A 4ZMBA 5GVRA 4BV9A 3WP1B 5KNCD 1H9CA 1A9PA 3WLQA 4I3GA 1F5SA 3RDPA 4KDCA 2AEJA 3HRHA 1MFZA 1CDOA 2WFMA 5AK4A 4YACA 1GPMA 2NPFA 4YP7A 1K7SN 2DIEA 1M2WA 1XAGA 2VTVA 4PCUA 4GQNA 1LH0A 4M98A 4XIYA 1YHNA 1Y9ZA 2BKUA 3ZV6A 1KVRA 4WFJA 3GCZA 4GPEA 1DZIA 1JIIA 3VKWA 3CF6R 4MRMA 3LJKA 1LLQA 4R1LA 4EVRA 3BBPA 4PZZA 1WP4A 2HIMA 2NZYA 4OQDA 4RBNA 4WUTA 3UICA 4QM6A 3O4RA 3AONB 4Q9JA 4V38A 1JQ5A 2SKCA 4EQZA 4QQFA 4EG4A 4LZJA 1NQAO 1L5RA 4PGHA 1TZKA 4EYSA 1XB2A 3D7KA 1EJBA 2R9VA 2ESRA 2OQIA 3QGMA 3E7WA 5EZYB 1XSEA 2VNIA 1N2CE 2WYRA 1GTVA 1SD5A 2GASA 1ZNXA 3OOHA 2K7FA 1W36D 1MRZA 1WXXA 1EHIA 2V7TA 1U6JA 1VMDA 2GAJA 4QYXA 1ISRA 3VZPA 1Z22A 2P3MA 4ZO7A 4YAJA 1WJGA 1T3TA 2ZGVA 2L18A 1N08A 2P9FA 2GESA 2VUUA 2GJSA 5CCBA 2IKSA 3HCOA 2WJ3A 1T5EA 2VJQA 1JR3D 3RS4A 2K5UA 3IP9A 1UZAA 3GNSA 3PX2A 3DO5A 4MTLA 4LZZA 2ZTSA 4KR3A 1GAWA 3IHWA 2I76A 2FWIA 2XB8A 4CPDA 4BPRA 1HQYE 5IW8A 1VJRA 2V7EA 3NHAA 4FDUA 5KU7A 4FI3F 3D7SA 1F2UB 3IAS6 2CHUA 2NU9A 3WNVA 4BWYA 1TW2A 4B4WA 3GLIE 2O2IA 4ZCRA 1RI4A 1FJ2A 4WY8A 1Y3DE 4YCLA 4UMDA 3FDXA 1MABB 3IXMA 1CJCA 4OHWA 1G8JA 2XYHA 3F6YA 3SHQA 1XRJA 3VU0A 2PUCA 4LSZA 2HRDA 1JA9A 1ZD9A 5L6LB 4R8KA 3ULKA 1ZNQO 4DZTA 1RFGE 1AS0A 1L4UA 3GUYA 2Y0DA 3ADDA 1L5LA 3SXJA 4X90A 5JSZA 5FFFA 1KFCB 1BA2A 1YJAA 1WO8A 4TV8F 3A10A 4AMVA 1GR1A 1NM5C 2G71A 2RGEA 2XRMA 4I19A 5AHXA 1FUKA 1GARA 1E20A 4HN2A 4M21A 2JGDA 1GNPA 3HY3A 3WMRA 4W5WA 2W37A 4EJFA 5ER6A 3S7TA 1CUZA 1ZVVA 1ENOA 3D2BA 1H2BA 2EZ8A 3LA8A 1DQSA 1YJWB 1YHZA 2OHOA 3OSUA 4LNHA 3M4XA 4BMCA 2VUHB 4OI2A 5JARA 2BGWA 3TEFA 3KQWA 4Q4JB 4GQBA 1U1CA 3MWEA 3DNMA 2CB9A 1QFXA 3ZE0B 5BXYA 2NU8A 2IU0A 5IVKA 2PV7A 4DCUA 1UAGA 1R8XA 3R5KA 5JZMA 3TMKA 2QSYA 1RHKA 2GXUA 4EEXA 5EJ9A 5ADHA 3H0KA 3UJHA 4BFZA 1KO4A 2QL5A 4ZVOA 3BTOA 3BG5A 1EE9A 4DT1B 2K2WA 2ZANA 2AYXA 1IEQA 1IWBB 1S3SA 3KT6A 4HN4B 5A9RA 1UBMS 2W22A 1NIJA 2R6ZA 3DV2A 4PAOA 4HDSA 2C20A 3QBDA 2PSDA 2WINI 4I6GA 4UEOA 4YAIA 5EHZA 1EJ6A 2R1VB 3TM4A 3MWJA 4RKYA 2PBZA 1I9GA 5HFJA 1CR2A 1F3LA 2HSEA 4HNSA 1K5GA 2W2MA 3SF8A 1DT3A 3EISA 4HTFA 2V59A 2OCDA 5DYNA 1NJ2A 1VBKA 3CPSA 1T4CB 2AJDA 1M33A 1M0EA 4HDQB 4ZYTA 2HYIC 3CCEB 3PWZA 3RFCA 4TYNA 1XZCA 4MYCA 1LBHA 4X20B 2O1EA 3LLSA 1Q7RA 4RPKA 5H3HA 1TT7A 1N0WA 3HA3A 3N0VA 8GPBA 3N7UA 4MAMA 2G6TA 4XSVA 1A5AB 2H1IA 4WIAA 4OAOA 2H9IA 4Z4SA 1Q1QA 2BFFA 2I6SA 2MIIA 2OZVA 2XLBA 3HKDA 3ZPXA 4E1VA 5C7IO 4P26A 3B9PA 5TVKA 3Q3GE 3RREA 4BMYA 5GWXA 3SDBA 3ENVA 2EX1A 2V1UA 2XADA 2NSLA 3NHLA 4QYIB 1UBJS 2H7VA 4HT3B 2CFIA 3R44A 4KXXA 4AUNA 2FQYA 4GD3Q 1N6RA 1P2TA 2I03A 3ECCA 5KNCA 2PT6A 4I1RA 4HI0E 2BN4A 4LK2A 4MVJP 3W6UA 3G0GA 3EPLA 4AL4A 4KXNA 1RQLA 1ZUWA 2HPHA 4B47A 3MILA 2FZLA 2QYHA 3ELBA 4MPPA 4Y2SA 1R0RE 5EE3A 4M38A 2H3HA 4MWBA 3ZXUB 4EGJA 4BV2A 1IMJA 2HMYB 3W5BA 4YRJA 3ONFA 2OYCA 5HZGA 4Q3OA 3I5UA 3OPVA 1C14A 2WJGA 2FPIA 3AF5A 3U61B 3KDSE 1X9IA 1SXJE 2HXSA 2PPVA 3ZHCA 4GX2A 4Q16A 4XVCA 4W9MC 2J4FA 3EZ7A 5K01A 2MYPA 1UMDA 4HZUB 3B60A 3MXTA 5GJBA 5ITZA 4LJ6A 1RHUA 4OAQA 3V00A 3OQOA 1SEPA 3MZ0A 4LC0A 1VRWA 2PSFA 4QO8A 3RROA 5LQUA 1VHOA 3FW1A 4NBUA 4EI7A 2EERA 3E35A 1M74A 3B1JA 3GD5A 4J1QA 3VU9B 4Z4GA 1ZMBA 3CF2A 4MQFA 3NDJA 2R4UA 2FEWB 1EAYA 3QY0A 1FQJA 2W6QA 1JAZA 3L05A 4NYJR 2UVPA 5BSKA 3T41A 2CXTA 1E94E 3H13A 1JR3A 3TQOA 2WYVA 5BWNA 2L42A 1P7YA 1XWFA 1X94A 3OVMA 1U0EA 2GSDA 5CAEB 3KEMA 1II0A 3OJOA 4KGXA 1PS0A 2BBOA 1I4TD 3UWSA 2ZWMA 2DR2A 2YX1A 1PDWA 4YUXA 2FFQA 1CQJA 3KQNA 2EBWA 3PC2A 4XM0A 4CIDA 1XEFA 4KQMA 1FDOA 2AMLA 3FMGA 4XWYA 5EHXA 2H2WA 4P2BA 3CW9A 3UMBA 1UBTS 1WVIA 1MRSA 4PAAA 3V4VB 3PA1A 3Q9UA 2UYHA 3N8IA 1ZOSA 2D2VA 4HP8A 1H3EA 4UAJA 4LC9A 1GT91 4F71A 4OG2A 1FYEA 1W4ZA 4HEJA 1XZIA 3FYUC 1EP1B 4LGYA 1P1JA 5ALHA 4JDUA 4JXXA 1X7YB 4NNPA 3BWEA 1RE1A 1NUQA 1A8UA 2H4XA 1FFBA 4TTVA 3BC9A 1CR0A 1B6RA 4LY9A 5AFSA 1VQMB 4EY4A 2HU8A 1Z39A 1P6UA 1T4GA 2IIBA 1VL1A 1XIVA 3JWPA 1CUSA 1LJUA 5DWDA 4LWQA 1CUCA 5I8PA 1XLUA 2H1HA 3KNZA 4IS2A 1G19A 1H4VB 4HXFB 4YO8A 1NXSA 1EFAA 3EVAA 5BPFA 1SVOA 2WM8A 2OECA 2REQA 3SHTA 2IJGX 1ZOIA 4DBVO 1MVOA 4UHJA 3ZH9B 3E9EA 3LKVA 2CVOA 3JQBA 4KQ2A 2TMKA 1E6EA 2N9UA 1GCOA 3U0VA 4E33A 1EWVA 4M55A 3LA6A 1JECA 1HEIA 4WGGA 4DNOA 4CTOA 2OL4A 5B7GA 4G09A 4JU8A 3B6ZA 2AHOA 4FS3A 1XNHA 5KWEA 3TPCA 2XQVA 1X3LA 5G1OA 2V1XA 5EKTA 4EHIA 2W6PA 1J8DA 3A06A 3K9WA 4MH0R 5I8ZA 4EATA 1OHHD 5F2KA 1EE1A 2PM8A 3W5CA 2P0AA 1QV6A 1A5SB 1E0JA 5FTLA 4PO9A 3R7DA 5A4MS 3IE1A 1BH6A 4HDOB 4KAFA 3GVLA 4FX2A 3FZYA 1FMTA 4N3CA 3N6XA 3FDIA 4R7ZA 2O3JA 3C87A 1EFUA 2Z8YM 5I51A 4Q3BA 3DWFA 2X6RA 5H68A 5HJ2A 3JAKB 4G85A 4UNSA 5MFZA 1GY8A 1VMAA 3OCJA 2IW3A 5D84A 3EEOA 4MGZR 2P27A 3WIBA 3MB5A 2BWJA 3OOJA 1R6DA 5ICEA 2AMFA 3TPZA 1WETA 1BX1A 2Y68A 1X1BA 3NTQA 1BQ3A 5EVCA 3MELA 3L0CA 1MOSA 1X9HA 3HNOA 4NE2A 1SBQA 1CUWA 1FX0B 2NTEA 1WP6A 4R7GA 3HO1A 2B99A 1HORA 5DLYA 4CL8A 2ZEJA 3KSMA 1G1AA 4O4IF 2NV4A 1OI7A 1HZEA 3RRMA 1H2AS 1UT8A 1T91A 2RMKA 2QX8A 4F72A 2I78A 1ZGGA 2ZVQX 1KDTA 4KOAA 5D86A 3KLNA 5CLIA 4X05A 2EWMA 4KI0A 5G0TA 2FN3A 3K7EA 3G23A 1PWYE 2GCPA 3U44A 1FXWF 3GGJA 4R2MA 4XJSA 3OUTA 3AIIA 1R27A 3M6WA 1Y0BA 5KYGA 5DSZA 1GNVA 1I2DA 1G8MA 1V0EA 4GAEA 4TS3A 1U4NA 4XH9B 3QYFA 2WYIA 2XQGA 5I3CA 5J1TB 2C1XA 3E82A 4GRDA 4D9EA 1KERA 3CLHA 2ZBRA 1S01A 4DILA 3AINA 3HSKA 3B1VA 2HDNB 1L1EA 1NV9A 4JQSA 4QHSA 5L3RA 1RWBA 4EZIA 2CRVA 1W48A 1X42A 2WKQA 1KQ3A 4XFJA 5C37A 2I2BA 1DELA 4O6VA 1K2VN 1H1TA 1SZDA 1E1NA 3LQ1A 2XECA 1T35A 3T5GA 1IVYA 2VBCA 2GBLC 4M88A 4UOEA 2QNBA 2GETA 1FYFA 1YVUA 3HEAA 1WORA 4FT2A 1P3Y1 1BRTA 2GJAA 5L95A 5LBTA 4IHQA 3WMFA 4DB4A 3TF5A 1FYXA 2P35A 2EJVA 4NVRA 4N40A 5JFOA 4PLHA 1P1IA 1F8UA 1IEWA 2PMEA 3TLZA 4L5BA 1P61B 2FPSA 1IBRA 1PL7A 1N5LA 2VH2A 4E5NA 2LKDA 3SKYA 2ERYA 1M10A 1T3SA 1Z68A 1FPMA 3AO0B 1DUVG 3GJRA 3OA2A 3OCYA 3LVBA 1FQKA 2F48A 1Y1QA 4OH7A 4TL7A 2PLRA 2X0EA 1I0ZA 1CUAA 2D00A 2YTZA 5DHQA 3RSLA 4CM8A 1QCZA 3KZCA 2VOJA 2JATA 4QBKA 4UFPA 3F2VA 1KHHA 5CX4A 2OO7A 4KN9S 4OYRA 4U8HA 4EW3A 4CMCA 1SWVA 1XPOA 4QVIA 1YOVB 1H3FA 5JZVA 3PVCA 3LV8A 1KAGA 4UTRA 5ICCA 2JH9A 4IPTA 2IY8A 3GAMA 3HB0A 3PDWA 4D9BA 4CXMA 2CMFA 4PFKA 3ZI4A 4YYZA 4JOCA 2REBA 3WIDA 4OP7A 1NW5A 4JBHA 2OFFA 4AK9A 2BM0A 7MDHA 4WCDA 3DPIA 4MNTA 5LKRA 1PGPA 4RVCA 4DNXA 4QFCA 5CUQA 3L93A 3A1VA 3PUIA 5M34A 3IQIX 4IILA 3HBFA 2ZYDA 5MGNA 2GR9A 3ISXA 1VI2A 4FOLA 5E2IA 4PVCA 2XLCA 1PEYA 3UATA 3JATA 2D5IA 2OV1A 3W34A 3HXMA 2OOSA 1Y1KE 1YI8A 2WSYB 3PP8A 1X19A 2EKBA 2EDCA 3ILYA 3A9CA 5AXBA 4CN9A 1ECLA 2QM7A 3IR5A 3OHPA 4IKEA 5GP1A 3I2JA 1J20A 4DUPA 3GZJA 1I94B 4BYMA 3WS7A 4RSGA 2I8LA 3F97A 3H6HA 4LZWA 3RODA 2BR4A 4PRZA 1MB2A 4WBNF 1RC8A 4YFVA 4NESA 4D92A 1U8YA 3EFOA 3MNFA 4BMNA 2BKVA 1E92A 2FLWA 3DNFA 4JELA 4LRWA 5HGJA 2NU6B 2GCOB 3PEFA 1PNVA 2VT6A 3U0BA 4C1BA 2Q4OA 5A9SA 1XKQA 2XXJA 4CCAA 2PBLA 1OHHA 2ZYHA 5CFLA 4FJ0A 4DIMA 1PW5A 3IRUA 4E09A 5TPWB 5IDXA 4ZN6A 2IYTA 3MCUA 3TTYA 3UBTA 4L8FA 1YQQA 1SOUA 5TNXA 2F1IA 3ZCRA 1PYDA 3ORHA 4R3UC 1QP4A 3NDBB 1IC6A 2YIDA 3PA2A 1YVRA 3FM9A 5DTMA 2VQFB 3G6EB 1NTRA 1SRQA 4PBRA 4URVR 3O7MA 4E2ZA 1G41A 4C0LA 1DKMA 1TAHA 1SCQA 3KVRA 4JJ7A 2FSVA 4TLLB 3PT5A 1PG2A 1EX7A 4KQIA 1F38A 2X4GA 1A2BA 4N65A 3OKXA 2I2XB 3KEOA 4M1TA 4PCLA 1YZLA 4Y2XA 2IUTA 1NQUA 3AEKA 5BQPA 2Y1XA 4WEQA 3S5UA 2R6CA 3JSXA 1W0CA 4UM7A 3T3PB 4F04A 1ZDMA 2QP9X 4RTKA 3IIIA 2VZLA 1JHQA 1KBZA 1MN6A 4LYFA 3UOAB 2X7XA 1ULHA 2D8AA 2VWQA 4E3ZA 1JB9A 3HPRA 2DTDA 1DCTA 1XWIA 4AYTA 5DU2A 4CMJA 1DTWB 2EHDA 4X93A 1STOA 3QKUA 1MC8A 2NLOA 3NV7A 5CFPA 3L6UA 2NUAB 3MT9A 5A4AA 3KKPA 3R9XB 2B2NA 3HUDA 4UUBA 4Y0AA 2HMUA 1QFYA 2HA0A 3JWGA 3P2KA 5JAQA 3RV3A 4AG3A 3JQPA 1FRNA 2GK7A 3OZRA 2F1KA 3RH0A 4D8WA 1GGNA 3KQUA 1DJLA 2XUOA 4H0NA 5IASA 4C0SA 1VJCA 2VQDA 1ES9A 4ILEA 5GOZA 3LOUA 2YMLA 2GILA 4Z4YA 2GN9A 3PFBA 4C29A 4ZYVA 2R8BA 4LSMA 4DRYA 4MUKA 2D54A 4NCJA 1SBCA 4O2BB 4V2UA 2KE5A 2I6QA 3MT8A 3NJ4A 2ICAA 5HZAA 1B1CA 3JQBC 3LPAA 1L7PA 3GYGA 3DEKA 1CC1S 2CWDA 4WBSA 3IMFA 2OTLB 4X64B 2Y1KA 4N47A 1ZGBA 4FGZA 2A9OA 1N2ZA 2LNDA 4XWOA 1RYNA 2IKQA 1R0WA 3GLHE 4QX6A 4RHEA 1N5DA 2NT3A 2WIGA 3WFZA 4B4VA 3WK4A 4D45A 2R60A 2NNWB 5C7OO 4MQLA 4DIBA 1KEWA 1R8JA 2LCIA 4F4HA 4HY3A 3EVTA 4EI2A 3MM4A 2MSWA 4OM8A 3SU8A 1RWKA 3OZTA 4V24A 5F3RA 2F3SA 2ILTA 1SOWA 3VHXB 4I55A 2WYOA 2LDXA 3UANA 1ECCA 3WC4A 5JDCA 1LXCA 5KHLB 4IGKA 2B5VA 2ATXA 4J4BA 1ZK0A 2ZE5A 1JKFA 3R4CA 3CCFA 1IPFA 3S2YA 3PQ6A 5SY6A 1O94C 3NOVA 5ARCA 4IOLA 5BW4A 3FBWA 3JU4A 4K05A 2CLOB 4ND6A 5LXTB 3C85A 4KAJA 2EVWX 2BM1A 5I5GA 2PH1A 1WZNA 3M83A 2OBSA 3LDGA 3RTDA 1H5NA 4CKYA 3VZQA 2OK7A 3UAOA 3PPWA 3EXEA 1VCNA 4IRUB 2HJSA 4L4ZA 4DNRB 4IJMA 1KL7A 3OZFA 4QUDA 4H7HA 5CHYA 2JLSA 4J07A 4MGIR 2A4MA 1EXNA 2A6PA 3TBKA 1OZHA 4EENA 1MPXA 1R88A 4HEA1 1AGRA 3FGPA 2EZ9A 5J47A 2XF8A 4MX8A 3O5AA 3JAMA 4YJ2F 2IEAA 2ZRFA 1C1DA 1OA1A 1WXQA 1ISIA 3ANXA 3H2JA 4BNJA 4OV6B 3PRYA 3QF7A 1QIEA 2RJNA 1U3CA 2O0HA 3WMGA 2A5GA 3KUXA 3M4YA 1EK6A 3HXOA 3NHYA 4KYVA 2V4MA 1KWKA 3WGMA 4NARA 4EVSA 1TCBA 1YUBA 2EW2A 4HDKA 1UBSB 1C8LA 5DI3B 2PZEA 5G53C 4HLCA 3L8CA 4EAAA 5HDBB 1EB8A 3K73O 3I2YX 4GMHA 4CU5A 1XXHB 3JZMA 3GLKA 1WKCA 3IDOA 4ZK6A 1NBMD 1V1MA 2G1KA 2ATIA 3JQEA 4UOQA 1SZCA 4RIFA 3VV2A 2NMVA 3GX1A 1NU8A 3DDYA 4Y2HA 1XYVA 3QKRA 5AM4A 3IAFA 3KEQA 3B6MA 1J2YA 3VO1A 1E9EA 2I2WA 4IIJF 4BJHB 1AIPA 5FWNA 1T6ZA 3CC2B 2REOA 2BMJA 2BEVB 1PZHA 4TV9F 1JFRA 2NWQA 4YNBA 5IN5A 4RHTA 2LWIA 3EZXA 3IJEB 1J2UA 2GS9A 3MMSA 3GLGB 4HEQA 2QN6A 4NH0A 3BSSA 3DFIA 4RTRA 2W11A 4G7XA 2EF0A 3P71T 1ESZA 1NVAA 2WE8A 3UTDA 4EO9A 4TKOB 2L2QA 2ZYVX 3EGWA 3AJEA 2WZNA 2QMUA 3VDMA 1W47A 3AY6A 1OZFA 3UHFA 1EJ2A 1I2ZA 2R1TA 3FCEA 2RC5A 3PE3A 1MAVA 4Y0VA 3CH6A 5F5XA 5CH5A 5LB2A 1M1KD 3RSOA 5JANA 1KJNA 1N2JA 1NDQA 2P8JA 4MYUA 2Q6TA 3ANLA 2FG7C 3Q87B 4PLPA 2CLEB 2EFHB 3HR4A 4V3BA 1L8LA 4C7VA 2NV6A 4RD4A 1X14A 2O1SA 4DCOA 1QV7A 4TYMA 4FEAA 3UAZA 1DC5A 2IQ5A 2V03A 4H18A 4Q9DA 2BTQB 1PE0A 3O8RA 1ZVJA 2ZTGA 3AQIA 4AKHA 1HF3A 1QQAA 3VC1A 3CEMA 1WPQA 2GGSA 1G3QA 2P3OA 3PNMA 4FOPA 1SOAA 3KCNA 4JVOA 4QGGA 4QL3A 4HAYA 1CE8A 1I8DA 1R7RA 3R7AA 2J9ZB 1IATA 4QASA 2F8TA 4IHJB 4JJEA 5K05A 3JYLA 1LPNA 5KNDH 1CYDA 1JALA 2B69A 3EIXA 2V96A 3L41A 5EZYF 3DHWC 4C7MA 2IBSA 1RZVA 3E8MA 1COZA 2YWGA 4PV7A 5GJCA 3B3GA 4L78A 5CT5A 2G67A 3D6FA 3H3XA 4LYAA 3UUFA 2QN8A 2FEOA 3IEMA 3NUQA 2RD2A 5F4OA 3A4IA 3D3JA 1OGIA 3DKRA 3F47A 3PPVA 3PS9A 4RCYA 1V35A 1YH3A 2DHCA 2HK6A 4XQCA 5KKCA 1XMOB 3R1IA 4O2BA 4CLHA 2VKQA 5HGXA 4FYVA 4CR7A 1KD1D 1U1IA 3K6SA 5HNKA 2XCTB 3ZHQA 1C80A 2F3PA 3PHHA 4C3ZA 1Z63A 2W6JD 3B52X 1O8CA 2B7LA 4G56A 3PNQA 5EWJA 3CMCO 2PGIA 1KEZA 1Q7TA 3ZV5A 2IEIA 2QP4A 4Q4DA 4XKJA 4OXYA 4Y2RA 1EA5A 3CT6A 1YVPA 3OCWA 3PQCA 5IEJA 1QQ5A 1SVNA 2Z4TA 3UYKA 4ARCA 3CCUB 2PZMA 1T5TA 4R7TA 4HHEA 4UNIA 3LO8A 2EGGA 4BWFB 2C7PA 4BN4A 2NZ8A 1DNPA 1EXWA 4P8RA 3ORRA 4L4XA 4RS3A 4A9AA 5HM8A 4K2HA 2R85A 3IR6A 1JX6A 1K8AD 3DV0B 5EJGA 2OBNA 5DRYA 4EAQA 3U31A 5LOVF 3DAYA 2I3AA 3NFYA 3WYNA 2FSVC 4C0HA 1C9YA 1V7CA 2BFBA 3SEZA 1RCFA 1SBNE 3M4JA 1E8DA 5C81A 2N0SA 3IQZA 1SCDA 2CHVA 2ZJFA 4J94A 3VOBA 2JCGA 1IXRC 1A27A 2QU7A 3L7DA 4J0FA 5H59A 1T9KA 2FW8A 1YL7A 2J3IA 3PB3A 4N7JA 4RV9A 4BFXA 3W6NA 1NQ5A 2DPYA 3AMVA 3CJRA 1DQYA 1NP7A 2J41A 3ETNA 1R9MA 1Z4OA 3FCCA 3SC2A 5CEFA 3G0OA 1B8UA 3EVZA 3GRVA 3VR6H 1ND5A 3UMMA 3W77A 3C3BA 3ET4A 1LQ2A 5FI3A 3EIHA 1Z13A 4OHVA 3PSAA 5JZ9A 1N9KA 4HDCA 3U3OA 3ANMA 4JI3B 2PXAA 2I3DA 5FNVB 4DJDC 4QREA 5LWHA 1N7HA 3IPLA 3HSYA 2FE1A 1GZ7A 5AKYA 5EWLA 1V2GA 3VVLA 4QLBA 2GPAA 4L50A 2FHPA 4FINA 3TIXB 2KW5A 1T26A 1ZRMA 2HWKA 4D41A 5KC8A 3U17A 3C3WA 4X7MA 1JVNA 1WCWA 3I4CA 2YV4A 2EYQA 1YA6A 1JLSA 2HY7A 2R5WA 5PGMA 4G0ZA 1PQWA 4NCNA 2IPLA 4WN3A 4ZOLF 2CXXA 1T8YA 2ZT6A 4AJPA 1NW4A 1A98A 4B3BA 1LY1A 5KHOC 3WV5A 3BEOA 1U1GA 1K5HA 3FYCA 5HVNA 3GJ7A 1NBMA 3QENA 4RK6A 3BHJA 2JFFA 1DADA 1T0HB 2IOFA 4BUJA 1NN3A 3VU8A 4ESOA 3WNZA 2WHXA 221PA 2C58A 5DGTA 4UAUA 4FFDA 4LK3A 4R1TA 4DUZB 4HGQA 5J1SB 5ESWA 2JJQA 2F43A 1CPYA 4FJ1A 3OW7A 4DK0A 1UMCB 3MRVA 4CHTA 3B7WA 2PIAA 2PG3A 3FMIA 3BMNA 3KSZO 3DCYA 5F77A 1UKYA 3S2UA 1UDBA 3V34A 2FMUA 2HWXA 1GNTA 3F9IA 3K70C 2J3JA 1HETA 3CF4A 4MI9A 2GD2A 2WVHA 2YQ5A 4ZMSA 3OTQA 2P62A 5BNWA 4IQ0A 4JXKA 2H48A 2SNIE 3C8HA 3U3MA 2ID9A 2PE3A 2CYBA 4PVDA 1VOTA 1NMZA 3O8OB 1ZFNA 1A76A 1F2TA 1J0DA 4K9NA 2GJKA 1UIRA 1SOVA 2YHIA 4PHTA 4BLOA 1KO1A 1R15A 3GH3A 3ENKA 3GFSA 3IIKA 1LPAB 2BFAA 2W2KB 2UZIR 3K6RA 1YTLA 4OPOA 3LP8A 4DQDA 1C30B 3DTNA 4M7PA 4JMLA 3RHFA 1ID8A 1NSTA 1M6VA 1DAFA 1TA9A 2YY6A 3ILXA 4PZ0A 3GQBA 4WH0A 1QYRA 2J09A 1KC3A 4YXFA 4ND5A 1WXIA 3BGSA 4CL2A 5K4HA 3FFBA 4HNGA 2P3QA 3LYLA 1HDCA 5JO9A 7REQB 3TVTA 1FP4A 1Q1EA 1THZA 1KP3A 4NYMR 4UMFA 4F6LA 1Q21A 3W8RA 4DWOA 3HJGA 5A5DA 2NN3C 3IB6A 3O47A 3PQFA 3N7TA 2AYYA 3DTVD 1XA0A 4GRAA 4DEXA 1ZONA 3RGWS 5HUQA 2NUPA 3G79A 4CFZA 5J43A 2JN9A 2G5GX 1E60A 1G8GA 4A6PA 1BXZA 4C7KA 5KOIA 4R05A 4YJ3A 3AB3A 1H6CA 3L8DA 3G0CA 4BDTA 1CJVC 4K86A 4J7AA 4ZQIA 2QGFA 1EFLA 3H9BA 2XTNA 3G2MA 4I99A 2BUCA 2ZBDA 3M9XA 5BN3A 2WWIA 3ADBA 2EJWA 3HJRA 2WDPA 4QXPA 4CTJA 1XMQB 2X2FA 2W6JA 2J3QA 1WAMA 4JQZA 2EWWA 3V7UA 4B79A 3BCDA 1WTAA 1FBTA 3DG9A 1Q20A 2LKCA 4O02B 5GMOA 4CFSA 3Q8KA 3HFJA 2IYNA 2X7HA 5CB4A 2F00A 1G4AE 4P33A 4DK1A 2H4YA 3G88A 2FI1A 3I5XA 1ZY2A 5ELLA 4ITUA 3Q8MA 4Q93A 5BOSB 4LBWA 3EIUA 4MAAA 3OT5A 2XE6A 2FP3A 1Q95A 3EZ9A 4G63A 4DRZA 4S04A 1VQNB 1DIGA 2ECQA 5JAHA 1OBVA 3RHTA 1RQ7A 4LZAA 1K9MD 1QO7A 9ABPA 4OX9Y 4KK4A 5J2UA 1EVKA 4FZVA 4IIHA 1NDHA 2YWBA 3G1UA 3RR2A 1WDMA 2FWMX 3D7LA 3RVNA 1E0DA 3M1IA 2IHZA 4MV7A 4DPKA 3UHAA 2BSXA 1J4AA 3FDJA 3THRA 3RRZA 2B83A 2AG5A 3KZOA 1NRKA 1S1MA 1S3FA 2NTYC 3ZWPA 2VAXA 4U3JB 1ACJA 3IVMA 3UMCA 3WK6A 4B75A 5T7BA 1C4XA 1MTOA 1MC4A 1YBAA 4DDUA 1NW9B 3WADA 1RLJA 2BBSA 2FR8A 3NHKA 1YR6A 3WB1A 1TA4A 3K2QA 4N7MA 4CG0A 1I1NA 4FB5A 2V65A 4D9MA 4DANA 1NBWB 3QVLA 3AEUB 3R3ZA 5EJ8A 4I5IA 5KI6A 3WGLA 1SMKA 5BOVA 1Z7GA 5KVVA 2OLKA 1T29A 5IJAA 3K72B 4TTSA 1CR6A 1QMGA 3EVCA 1P17A 2HGSA 2P2YA 3KT0A 3QHAA 4FYMA 5IAEA 4BBZA 4D42A 2RH8A 3PUMA 3DYBA 5K6AA 1OH6A 3AU8A 1Z6XA 4D3ZA 2AT1A 4EG3A 1EDBA 1MXFA 2QF7A 3I2KA 4PGGA 4XOUA 1Q0HA 4LRUA 4XLFA 4RKQA 3CVOA 4C04A 3OMXA 2VIIA 1U8FO 1Y9AA 3JRXA 1R0YA 3EC1A 4TZ6A 4GOOD 1WXHA 2VF7A 4DUGA 1RBMA 4Q1EA 5DO9A 3CVYA 1YFLA 5HKKD 2B8EA 3D5QA 1OSNA 3HBAA 3AUAA 3R0IA 3OOCA 4PO1A 3A1DA 4R69A 4X60A 5DLDA 1SG0A 4IVPA 3LY5A 2QEXB 4ZO6A 3TLCA 3FDFA 2RG7A 2MMCA 4KR0A 2R48A 3MLEA 4UXHA 4MULA 4GVPA 3I9FA 2Z4SA 5HCUA 5CITA 2P6MA 3X1WA 1AB5A 1TJPB 2PEYA 5KX5F 2J6HA 4HVCA 1J9GA 2C3UA 4J76A 4J1TA 4WKPA 4KN6A 1K6XA 3RNLA 2E1RA 4FMPA 4Z4IA 3U6BA 3D0OA 1KK3A 4DIFA 5J23A 1SBIA 1JDVA 3NAGA 4JC4A 3E6AA 4TVKA 3DBRA 1G8AA 1Z34A 3OSZA 3MWYW 4N6GA 4WZKA 3ENNA 2AKAB 3ESRA 2HJHA 4NBTA 2DERA 4R6XA 3W90A 3PFGA 1RJEA 7ADHA 1N1GA 2PGLA 4AG5A 3EUWA 5HIJA 3EXG1 1YS6A 2FFRA 4GP7A 4HNHA 2QT1A 1BN7A 2X15A 2Q2WA 3G5UA 2X41A 3BPSA 1GTG1 4M87A 4I1SA 4TXLA 1E0AA 2PUJA 3LBHA 2Q3JA 3S6JA 3S1AA 4W8OA 3EY4A 2XCLA 4C4OA 2X4IA 3CPEA 4OQYA 5FXMA 4AQDA 4E2FA 4GT1A 1J7JA 1Q91A 2HSJA 5F2OA 4MV6A 3R5XA 3GZ4A 4ZCTA 4CW7A 4ER3A 4QJ3A 1L1FA 4GVLA 4EG7A 5BMOA 1PNOA 4MRSA 2CXQA 2PRKA 5JBNA 4NK4A 4WNCA 2DQYA 2WZQA 3F6RA 3FD8A 4KMRA 5G3ZA 1ZUNB 4W99A 5KSPA 1HMYA 3DTVA 4EHFA 4OQPA 4X41A 1SQ5A 4MYTA 1W4RA 2COEA 4LJLA 5M29A 4Q00A 5A06A 1CVLA 5K8TA 3CZ9A 1CRPA 1J2JA 2C3MA 4KKUA 3FF4A 2EFJA 3KJGA 3A6PC 2PTHA 2P77A 2H1WA 2X3YA 4QBFA 2GCGA 3T9CA 5G4LA 1QH1B 4M0LA 1ZRSA 2CNOA 3DXYA 3V42A 4EPRA 1DVRA 1T2VA 3AF4A 3ODGA 4DGQA 4ZK2A 1GCGA 5FOWA 4FXOA 4OLAA 4A5SA 4GLBA 2R6FA 2FW7A 5TQ0B 2BP7B 3U9LA 3ZW9A 2D1SA 4UE3S 2MSDB 5IUNC 5K2MA 2B7BA 1CUEA 4B5KA 3AH8A 3C1OA 1P7WA 4XQEA 1VRVA 2VUTA 4PS0A 4JLKA 5LSAA 3BEDA 1P0PA 2AC7A 3R0XA 3RS7A 1UDWA 4DWVA 1EHCA 2AOWA 3ORFA 4RF5A 5LBUA 3Q6QA 5IT9A 1SUEA 3G8DA 5CHEA 2B36A 3EBOA 2WFZA 3HZOA 3DHYA 3FWZA 5HEKA 4BNWA 5FOQA 1NW3A 3OP4A 4PN7A 4ZOBA 3QKWA 1C1XA 3JWHA 4EY5A 1AUQA 2WSMA 3KXLA 4Q9LA 1CY2A 4M86A 4AMGA 4B85A 4RF3A 3VSEA 2W8BB 2HV9A 5E9JA 2QROA 2YQZA 3OFKA 1JPNA 4TTJA 3USZA 1FLNA 5AOBA 5JCJD 4PTYA 4LMAA 1QVFB 2Q1WA 3N3AC 4L0DA 2ZYIA 3IBTA 4PRLA 3WGKA 1CD5A 1XRMA 4YRKA 3W2GA 1V1RA 2BY4A 5AI0A 3TDMA 5BUQA 2ZTVA 1I4EB 4GBMA 5GJVC 4Z51A 1ULUA 4TS4A 2EARA 2IU3A 1P6XA 1ZJ5A 4DA6A 5H9WA 3DDZX 3DEFA 4V3CA 1F3OA 4IRMA 1QSGA 1KQNA 1DC4A 3BAFA 1L7VC 2D2FA 4KHZA 1JEOA 2K6GA 2FUG6 2OM6A 4PQEA 5JH7A 2JI8A 3PNKA 1QIGA 4K9MA 4D2IA 1UK6A 2ARKA 4YH1A 2CMHA 3A1SA 4RJJA 1GU0A 1P4SA 1JLLB 4UTPA 4BZQA 1I7LA 5KTSA 2W5UA 4KFCA 2YS7A 3L77A 3WMEA 3NYWA 4PBSA 4BGIA 3I32A 5IAJA 3AFIA 5LYYA 2VJCA 3C3XA 5G0WA 4ZHSA 3SE7A 4NXMB 4FNOA 5H83A 1RYFA 3CTMA 3QU2A 3P5SA 3JTEA 4K26A 5EY5B 2VJLA 4ZAZA 5HKKA 1NT2A 4MP3A 1HNZB 4FBLA 3DZ8A 4BB9A 1VTKA 2XOEA 3OM1A 4IEEA 3LQFA 4GXTA 1GSHA 3PHIA 3RVBA 5LQMA 4NXNB 1Q44A 2JHPA 3FGNA 3N0XA 5CLHA 3EGXB 3HYNA 1KJQA 2JFXA 2LRHA 1G20B 1LV8A 1W7AA 3WL4A 4WXHA 1TT5B 3ONNA 3SYKA 5KEIA 2QMOA 2QVXX 4MKGA 1NSYA 1Z47A 3K09A 1ZR4A 3FCYA 3GWZA 1NHWA 4P2NA 3SS9X 3I42A 5B1SA 3C15C 3CLTD 3NHWA 4P7GA 5GV8A 1AD2A 1ZOPA 2JEZA 3MS7A 4AFNA 4IIXA 5C8YB 1VP9A 2J8ZA 3KBOA 3PD1A 4P9NA 2CJYA 2ZJAA 2LW7A 3K94A 1MA3A 1BC5A 1U0HC 1Y3IA 2PT7A 3AY0A 3D81A 3LYAA 3FE2A 5K0EA 2CGEA 2BONA 3GJ6A 2FOXA 4YR9A 2IA5A 2QAIA 1T36B 5BSHA 1H2FA 1U31A 1PGNA 4IP0A 4TTQA 4WPGA 1FRQA 1MT0A 3GVIA 4HR7A 3UXHA 2QX7A 1GEEA 1W85B 3P19A 3CX4A 4FD3A 2BLNA 1UFQA 1CJUC 1YS7A 3Q9NA 4RXMA 1BDBA 3A3PA 4JI4B 4B3RB 3ZUGA 2Z0MA 3DMTA 4KXYA 3IBGA 4I1UA 2DSTA 3EYAA 4OHPA 2H92A 5BO5A 4BLRA 2Q5CA 1G2IA 1Q57A 1B1AA 1CXZA 3ZWQA 4TMXA 3G2HA 4BVGA 3K30A 4BNYA 1K1EA 1ISHA 2GZAA 1P4MA 3BUSA 3L7NA 2FG6C 2QYOA 3QYPA 3T61A 3WKAA 2WF7A 2D4AA 2PMKA 2R6DA 1RTKA 1C9KA 2ZSDA 2YXNA 4BQIA 4FM9A 4EELA 4XARA 1QH9A 2NO5A 3I1JA 5F7JA 1KQFA 1WMEA 4WXMA 4J3NA 1P5HA 4CODB 1L8OA 3I8SA 4JJAA 3TTXA 4GL4A 4B3JA 4E46A 4ZDKA 4D9CA 2VJKA 3PHCA 2B6NA 3GPIA 1DQPA 2W2QA 5HBRA 2Z58A 2E4XA 4J16C 5C5IA 3EEYA 1ZCZA 2QK4A 3HVKA 3RVMA 3WQHA 1HNXB 3ZJ4A 1PJ5A 1UBUS 1VKZA 4FI3C 3GVHA 2J9FA 1T2CA 4ZODA 5E4FA 1Z08A 3O84A 3FTPA 4K9RA 5I48A 1Q14A 1R37A 1SCIA 1TVKA 1ISGA 2O8FA 4WNIA 3G2IA 4O4IA 4G0NA 4CLOA 3GT3A 1JSRA 2UVDA 3BZBA 4JJFA 3PEVA 2X9GA 4LSGA 1ZXBA 5EG5A 4KAAA 2OD2A 3HYLA 1QPZA 1ZQ9A 1G5PA 2DE0X 2J0UB 3HXTA 4J1TC 4MRNA 1S89A 5LXTF 2G07A 3GZNA 4RXUA 3H5TA 1FXWA 3OESA 4R8MA 1L1QA 1M5UA 3ZIDA 1ORRA 3KB2A 4Y8VA 4N6NA 3S0JA 1O0SA 2UUOA 2F3RA 3PYXA 4U5QA 2C42A 2POQX 3LQRA 1HDGO 5JCJA 4CM4B 1TLTA 1TM3E 4CLEA 5EUBA 3EVDA 2ZBUA 1AZSC 1L4NA 1CP3A 1Z07A 5CT8A 4UMVA 4K9OA 4YTEA 3IQWA 4G8DA 1D1PA 2ZPAA 3H75A 2X23A 1C7EA 3KYCA 1R66A 1WDWB 1EIWA 2WJ6A 5E6SA 4QHTA 1T8PA 3SFZA 1FTWA 1QHYA 2A3NA 2I4TA 4RH3A 2IF2A 4B6RA 3SEAA 1T9BA 3GIDA 2YJNA 3OE5A 3W79A 3WGNA 4DWWA 1B00A 2PH7A 1EZ1A 1BROA 1E9DA 3B1WA 3W3AH 3H3JA 3VRHA 3FY4A 1M0SA 2P5TB 1KKLA 1MF7A 2O2EA 2V0NA 1SXPA 2PNJA 5EQFA 4BO9A 3HJHA 3GLQA 4L0CA 2ORIA 4AB1A 1TTTA 2C5SA 2A9QA 3MWFA 2QAGB 4GPZA 5JCZA 1W96A 2C2YA 1PLLA 1PR3A 1WQ1R 1PWZA 4I8XA 3EEBA 2WP8J 3BRQA 4EQ6B 3VPFA 3CNNA 3R6TA 3C6YA 1DJMA 3P9ZA 2UV8A 4LUCA 4MV1A 5ENDA 2VYQA 5E6RB 1VJTA 1Z45A 5AUPB 1QFSA 3A1FA 1Z15A 2B8TA 2AX3A 1AQUA 4DG8A 3OG9A 2PKQO 1SKYE 1WY5A 3IC5A 3KXKA 1P5JA 2IHUA 3U40A 1NRXA 1NOJA 3N2NA 2H9YA 3LXRA 4BTVA 1REQA 3PTAA 4HK4A 4RPCA 4TTAA 1X38A 5C4IA 1ZSNA 3SZMA 4AW9A 4TLDA 5HE8A 2L17A 4D0LB 3HBLA 3JY6A 3CG4A 4IH1A 4FT4A 4BP8A 5AJUA 3ZDRA 1D2RA 1QCYA 2HYDA 4OQFA 3DE7X 3G9ZA 2B30A 1YC2A 2QHXA 4HEHA 1N6KA 3COVA 1TFRA 3A7DA 4JOQA 4L8VA 5K0TA 2DQZA 4DA4A 2A57A 3BT7A 1CF9A 1XZMA 3EAQA 5TDHA 2X4DA 2JIPA 1GPUA 4V39A 3B70A 1B6TA 1K63A 5E8JA 5KKNB 2JGMA 3QE3A 4NRDA 4PZAA 2LDBA 1K08A 2O50A 3L0BA 4RORA 2Q3BA 3C6KA 1G3RA 1F8FA 3FUWA 1TK2A 1ZGHA 3A3KA 4Z4ZA 4M1KA 1ZCAA 3A4TA 2QJOA 1CU1A 3BKXA 3GG9A 4A2CA 2OZLA 1EZZA 2RHGB 1H6DA 2YNMD 4XB6B 4UPEA 4B2YA 2B5OA 3GFGA 4OQLA 4L5JA 3L8ZA 4MUXA 2ZUVA 5K1ZA 1NVXQ 1XQYA 2QB5A 3NZEA 4BIIA 1PQPA 1H9AA 5JSFA 4DUYB 4ZJZA 4X3CA 4NMHA 1P75A 1Z5OA 5CH8A 1GN8A 5FWXA 3GDFA 2Z9BA 4OQ4A 1AHHA 3K9NA 4HNQA 2JLYA 4EJ6A 4RCZA 2P9EA 2E5WA 2YW9A 1GTJ1 4XD2A 4DQUA 2B3DA 4X8LA 2PUGA 1WB6A 2BPOA 1H5QA 1W0JD 1C0LA 5TF0A 2O19A 2R4QA 2H2FA 2CF5A 3EXIB 4M0PA 3T0GA 2RI0A 1GITA 1YB1A 4J91A 1HYHA 2PT9A 4ZYUA 2ERCA 3R6WA 5HTKA 4NZNA 1ZUD1 4OIMA 2QQFA 4IOKA 1KJWA 1KOJA 4S1OA 4KRYA 3M81A 4DFDA 4Y6OA 3KWFA 1G2QA 5EP3A 3FR7A 5K6TA 3KQHA 3CR8A 4I14A 4ZXFA 4FKBA 2QZ4A 5IBPA 2WNIA 2VVTA 3UFXB 1OXXK 3H8SA 4G8JA 1W6UA 4H1VA 3F4LA 1PEKE 1IN6A 2H5EA 3HCWA 4B74A 3LK7A 1X7XB 4BO4A 2HMTA 4X5OA 3ZJYA 1YQTA 4JLOA 4MR9A 5KPJA 5FD8A 4TTIA 4Y2VA 4P6VF 2CJFA 2Q5OA 3A4VA 3B3AA 1U4SA 3CU5A 1ZD2P 2GF9A 3LLUA 4HLNA 4Q3LA 3MRSA 2F9LA 4W6ZA 1EA7A 1ZS9A 2WR8A 2P5YA 3L49A 5SZHB 3I8XA 3ZDAA 1YUNA 3FNGA 1M2JA 3NE5B 1E58A 4Q1VA 3L8GA 4A8HA 1XMXA 4UVDA 3H1EA 1LSOA 2X40A 3C6BA 1JW9B 2J0UA 3OWHA 1HQDA 5DBEX 2PLWA 3BCSA 3H2HA 4K03A 1ST2A 3FHTA 4L3VA 4BEJA 3TG2A 1P1RA 5D3ZA 4HWPA 3MHPA 4MR8A 4Q6BA 4LJ8A 1EB9A 2E48A 2R96A 2O2YA 1Z12A 1Z8NA 1JAHA 3LUKA 1UC8A 3M8KA 3T5TA 2OCKA 4LZPA 2A9PA 3JQGB 4A2QA 4KBYA 3G4SB 4QUAA 1HRKA 4GPTA 4RU1A 1Z5ZA 3O8NA 4EH1A 2D1RA 4EW1A 4H7PA 3PU6A 4N49A 2FRXA 3K1ZA 3DMTC 3UBMA 1X70A 2Q6KA 1KMQA 2VYVD 4I6JA 4W7IA 4BXOB 3KEFA 4JS0A 2BFPA 3VNBA 3HS3A 1GPWB 3SM3A 3UHOA 4B3TB 4AJEA 1ZUHA 4J4HA 1R6AA 3S7ZA 1YDEA 4M1SA 3E1GA 5HUJA 5L51A 3NHZA 4F6RB 4ZVKA 3V8PA 3QIVA 4EHLA 5FYDA 2BBTA 4EQ6A 4A8TA 4RE6A 1L0BA 4TKMA 4ZANA 5KAMA 4EPTA 2ZU0C 1WL8A 3NJRA 4GLJA 1A95A 2ZREA 4LY6A 2RARA 4QEKA 4WFKA 2JLAA 4YP5A 1JSCA 1R8YA 4C5BA 4ZYWA 2IH4A 7GPBA 1X77A 1MG5A 3A1PA 4QOJA 5GOTA 3C6ZA 3BD9A 2PU7A 2OY0A 1PFGA 1J5XA 3A58B 1IJBA 3D64A 1XDZA 1G9SA 4OGKA 4V0SA 1QG2A 4B8YA 4C22A 1X2EA 2H52A 4CM5A 4KNYA 2OFOA 4F5WA 1VPWA 3V5NA 3NIFB 1N2IA 2R6AA 1QHXA 3KTFA 1XZEA 3HB5X 4C3VA 1ZK2A 4CG1A 1C7QA 4G9GA 1L7MA 2W6ID 3GGOA 3DBHB 1A7AA 1FA9A 2QJRA 4CR6A 3GFOA 3PJDA 4MQBA 2EXXA 3FVTA 4IQ4A 5TVGA 4AO8A 1V48A 2FZCA 3HJBA 2PK3A 1WX1A 3EOZA 4RJKA 3GWGA 1YL6A 3V6LA 3KAQA 1E2PA 5HZKA 3P0IA 4Q9AA 2JIQA 2FPLA 3EFHA 1UT6A 3U4HA 3NTOA 4PANA 4C5CA 3QOXA 4G0QA 4OOFA 1OILA 1GFSA 5JLAA 4YJ2A 2CUKA 1T3GA 7YASA 1GIAA 4Q34A 4Q6WA 2AZDA 1X1CA 4RNDB 5EJ4A 1P7ZA 5AOVA 2RJ3A 1E8MA 4LBZA 2YNMA 2GJ4A 4RE5A 2OZPA 3WWCA 5AW0A 1MPTA 3REQA 2BSAA 3SG0A 5IZ4A 1TF7A 4Z99A 5AXCA 3HU5A 3PJEA 1K8YB 1XK6A 4HATA 3I3OA 4QZVA 3FCSB 2IUUA 2QY6A 3QVGA 2EKPA 3SN6A 5DX8A 4NYIQ 3RYCA 3EMVA 1RYEA 2AOUA 2QR5A 5DB4A 3WWEA 1JWBB 3BFKA 4GXRA 3ZIAD 3O9VA 1TIKA 1EX9A 2DTEA 1ML3A 3GOQA 1XEWX 3O3MB 3PG5A 1EUDA 3PD7A 5I4BA 3IRVA 1KZGB 3ST7A 2FPXA 3GUZA 1W0JA 4UREA 1SRRA 1QRAA 2QQ5A 4IIJA 3VPXA 1GPLA 4D5GA 1ISMA 2DFTA 4EB0A 1J25A 1KAQA 2DY0A 2G88A 2JBHA 1XZBA 2XOKD 1PT5A 4P1VA 4JB8A 4EMUA 4ZHQF 1RS0A 1ADGA 1CZLA 1DG3A 3QXHA 1BW9A 4L8GA 1L4YA 4Q4HB 2G9VA 4XN0A 1KU6A 1E7MA 3IEUA 3ERCA 3LQ6A 1PQ4A 2HSGA 4HX9A 1CZNA 4BUZA 3KRTA 4DXAA 1WMFA 1FOEB 3DDHA 4Q37A 3MINB 4NBKA 1S3IA 4PYIA 4RDCA 2C31A 2WPNA 5ALEA 1XAHA 3FUVA 1V7PC 4GGOA 1EZ4A 1UM9B 1HDRA 1K2WA 1QDUA 3EODA 1WDLA 3HU3A 1FMJA 2AFIB 2WAXA 4N39A 1CRQA 4BEVA 3WQRA 4R51A 1EFTA 3STVA 4DKJA 1RP1A 4ISBA 3HA2A 3N9IA 3QW2A 1ZQ1A 4XDGA 4LXXA 1WDTA 4G5FA 2FPMA 3JARA 2YRXA 5FCDA 1P19A 1DKQA 2R8OA 2O8DA 5JAIA 3BFPA 3PITA 2ZZNA 1HE2A 3NGMA 1Z0DA 1T1EA 2B61A 3NAQA 1VC2A 4IFEA 4LY3A 1SC3A 4EY8A 1E5QA 1M66A 5B5SA 1XDSA 4XL9A 2JJMA 4CMGA 2QZ9A 3FCAA 4MARA 2RBEA 1OIXA 3AR6A 3CLTC 2JFOA 1GGJA 3DM9B 2YFKA 4W1SA 4LTMA 3JYNA 5BQOA 4G8CA 2DWPA 5FQOA 4L6IA 1K86A 4BJ5A 2FDCA 1ZPDA 1GTRA 1OROA 3TVDA 3WGYA 2WUFA 1L5WA 2ZL5A 3CZCA 5IJ0A 3WGJA 4RH0A 3Q40A 3OH8A 1MFPA 1YI0A 1Z06A 1KTVA 5GZ3A 2PZAA 1UXGA 2WKPA 3JD3A 1XTBA 1Y42X 1TYAE 4G97A 3UMYA 1OU4A 4QRHA 4XN3A 3F6PA 1SUFA 3OX4A 3C3EA 3DBIA 3UAYA 2AN1A 1D4FA 3GI1A 5E1OA 1I7PA 2GFIA 1JG2A 1TCCA 2RHJA 2OYSA 3FWHA 3TLGB 1XAIA 2VYVA 2JBAB 1XVTA 2YV1A 3U56A 1DDIA 4OBEA 3PXGA 1NUSA 2PMFA 3RKRA 2JKZA 3KDPA 5D1HA 3RT7A 4PNHA 4NLLA 3ZCQA 2DUWA 2VPWA 3DT9A 4YGXB 3SYLA 2B1RA 1G7RA 1ESNA 1PI3A 4K28A 4PC3A 1ZNWA 3CN7A 4BQQA 2HJRA 3B1YA 1MJ5A 4H35A 1DFGA 2ET6A 5LJLA 1W5AA 4TVOA 5LL6P 1RLMA 2VQ3A 2JJYA 3HDHA 3KTAA 4PFQA 5EVJA 3TLYA 5FH9A 1YSCA 2H4HA 3KHSA 3NTVA 3TKYA 3ZHYA 3WO1A 4JT2A 1E7RA 3O1HB 1K88A 5DCUA 5K4GA 1VIAA 2A1UA 3SQXA 4ZCLA 4JI6B 3LLVA 4EW2A 3FFTA 2OLEA 1QORA 1VA4A 5LOVA 2C7RA 2HQOA 1ORHA 3IAM1 4HDRB 2P2CA 4WN9A 3ZQ4A 5JC1A 1KOLA 2B2XA 2B25A 5IVHA 1FZQA 1PK7A 3ACDA 3IKMB 2XB2A 4BMVA 1CY6A 4DMRA 3DCNA 5F52A 3KQYA