1H42A

Ferredoxin:nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr and leu 263 replaced by pro (t155g-a160t-l263p)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Involvement of the Pyrophosphate and the 2'-Phosphate Binding Regions of Ferredoxin-Nadp+ Reductase in Coenzyme Specificity
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP+ REDUCTASE
total genus 83
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2002-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1h42A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1h42A02
2NPFA 2BM0A 3PENA 2GQFA 4RD4A 1VQMB 4B43A 1KRHA 3AVWA 1KTVA 1Q82D 2BV3A 4PC7A 4YALA 1M1KD 4TMWA 4UAJA 3LVBA 1J9ZA 1FDRA 1R5BA 1AMOA 4TMZA 5H5JA 4FK8A 1KK2A 4BPRA 3A1FA 1QGZA 2QEXB 2PMDA 4B44A 4P3YA 2VNHA 1N0VC 1EWYA 4K1XA 4RD6A 5TR9A 4H9GA 2RC5A 1FRQA 3G6EB 3VO2A 2X3UA 1QUEA 3QFRA 1KC8D 4RD0A 4U9UA 4DQKA 4YHBA 1QVFB 2VNKA 3W5VA 3FJOA 1FNBA 1BJKA 4G5GA 5H59A 1CNEA 3WXMA 1QGYA 1QGAA 3CD6B 4C43A 1GO2A 4LBVA 1VQPB 3CCMB 1S72B 3JQRA 5GV7A 1SM4A 3V76A 4N3NA 1JJ2B 3VNUA 1D2EA 1IB0A 3ES9A 1E63A 1GJRA 4YAOA 1BX0A 3W5HA 1R5OA 3VNVA 1DDGA 1JA0A 4RCZA 1QFJA 5JBQA 1Q7YD 4RD1A 1EP2B 3MHPA 2XEXA 3I56B 1E64A 2C77A 3J81k 1Q86D 1TUIA 1ZM3A 4R71A 3WYAA 5DSZA 2PLFA 1CQXA 1KK1A 1TTTA 4FWTA 5THXA 3W2EA 1KK0A 1S0UA 3AVTA 4IW3B 3ZZ0A 5TV2A 4ZGQB 2VNJA 3QFSA 3G4SB 1GAWA 1OB5A 3CCLB 1EFCA 1VQ4B 4J0QA 4B3XA 1VQ7B 4C0SA 2DCUA 1I7PA 3WBJA 1YJWB 1ZUNB 4HE5A 4RD2A 3OJXA 2HCJB 4QFMA 4NCNA 1ZM4A 4YAWA 1ZM2A 2DETA 2D74A 3CC2B 1HA3A 3P27A 1QUFA 2E1RA 4N3GA 1AIPA 1W35A 2OTLB 2EIXA 4RD3A 4HE6A 3CB4A 5AN9A 3VO1A 1IJEA 2YWHA 3ZBUA 1A8PA 3OZVA 1YHQB 3WBKA 2QTLA 2FX3A 3LYUA 2HDNB 3W2HA 4LBWA 3CXCB 1GR1A 4M53A 2BGIA 1VQ8B 1W2BB 1TVCA 1KJZA 2BPOA 2QN6A 2C78A 1FNMA 3WNDA 1W87A 2OK7A 2EFGA 3LRXA 1VQOB 1B23P 1DARA 1BQEA 3ZZTA 4MYUA 3SJZA 1EFUA 4ACAA 2OK8A 1YIJB 1N8RD 3B78A 1QFYA 1M90D 4F7DA 5GV8A 1GVHA 4RCYA 1R5NA 5FA6A 3W2GA 2XNCA 4ZCMA 4B47A 4G1VA 2GPJA 4TMVA 1YI2B 3U6KA 4B48A 3CCQB 1G7RA 4ZCIA 1ZM9A 1IJFA 4M1KA 1D8TA 2B7CA 3LO8A 4MYTA 1DG1G 4ZV4A 2HMAA 1B2RA 1K73D 3AVYA 3QE2A 3W2IA 2YWEA 3JQPA 2BM1A 2R6HA 1VQLB 3JQQA 4B4DA 1U2RA 4WQMA 4DQLA 1SKQA 1G7TA 4Q7JB 2CNDA 2YWFA 4P6VF 4RJLA 4ZCLA 1QVGB 4ZGNB 3CRZA 1VQNB 1EXMA 3FPKA 2BVNA 2VNIA 1DDIA 1KD1D 3WY9A 1W34A 2VZLA 3OJWA 2ZITA 3P26A 3OZUA 1YJNB 3AGPA 1F60A 1QX4A 3E20A 2QMUA 3MMPA 4YAUA 3AGQA 1VQ5B 1XB2A 3B82A 2YWGA 3ZZUA 3B8HA 3CC7B 1FNCA 4AC9A 3CCRB 2QA4B 1EFTA 1JNYA 1E62A 4AF6A 1F20A 1OGIA 3CCEB 3CPWB 4PGOA 4NBSA 1VQ6B 2BMWA 2QTZA 4PC3A 2AHOA 3U6BA 3E1YE 1UMKA 2B5OA 3CMAB 1JA1A 5HXBA 2CRVA 1N0UA 3G71B 1QG0A 1QFZA 1FNDA 2BGJA 3W5UA 2J7KA 4M4SA 1OGJA 1ELOA 3OW2B 2DY1A 4LC0A 3CCUB 3ZC3A 2DERA 4Y9RA 4TMXA 4G1BA 1XE1A 1VQKB 3AVXA 1EP1B 5KSWB 3CW2A 1G7SA 2PIAA 1EP3B 3CMEB 3CC4B 3W2FA 4AF7A 3CCJB 4PC2A 3MCAA 4M0LA 4TMTA 2XNJA 2OTJB 5TY0A 1GAQA 3QFCA 1K9MD 3QFTA 1JB9A 1FRNA 2BN4A 1H42A 3WNBA 4Y9UA 3AVVA 1KK3A 1WDTA 3QSYA 2QDXA 1KQSB 3CCSB 4Y7CA 2VYQA 1G7CA 1OB2A 1VQ9B 4PC6A 3I1FA 4M2LA 3U2QA 3AVUA 3WNCA 1YITB 3CCVB 1QH0A 4TN1A 1K8AD 2DEUA 1CNFA 4LBZA 1BX1A 3VMFA 1H85A 4FN5A 4QHYA 3ZBTA 1TLLA 3OZWA 3I55B 1NJID 1YJ9B 2B7BA 4YAFA 1Q81D 5EMNA 2BF4A 1D1NA 2RC6A 4PC1A 4EH1A 1NDHA 4ACBA 2BSAA 4LBYA
chains in the Genus database with same CATH superfamily
2ZVJA 4TWJA 3TL2A 5CDHA 4M0PA 4P5EA 4JELA 3ZDDA 4H3KB 1VQMB 2CHGA 2G07A 3L8EA 2OHJA 3O7WA 5H82A 3TSYA 4RQBA 3BYZA 2VJLA 3QYAA 4TZ0A 2YJ3A 5A4AA 4JB8A 5CLIA 1V3UA 1GUZA 2AEJA 1YS7A 1IAQA 2HPHA 2POQX 3PSHA 4RZ3A 2VQDA 1V2HE 4AQ7A 4PLVA 1TM2A 2ECKA 3ZOKA 4KR2A 3ZNPA 4JC0A 5ALGA 1ULTA 3H6KA 5HKLA 5B30A 2Y2VA 4KW7A 3CBQA 3R09A 4JBYA 4B87A 3GGDA 3PT9A 4PZYA 3BA1A 4GI1A 2IEDA 5JD5A 1IH8A 1N8SA 2PMCA 3S81A 1J9EA 1LJUA 3LS2A 5HOEA 2PUBA 4L74A 1TMOA 2HF9A 2WT9A 1YB2A 4G26A 1Q0ZA 2H17A 2ZCVA 1G3IA 2QV7A 3GDWA 4FQ8A 4XMYA 2QN3A 4EW2A 4OP3A 3I53A 5KREA 5JY6A 2VF5X 1EWYA 2QMZA 1GFZA 1U8XX 3FMGA 1VKNA 4YECA 7AT1A 1X7WA 2ZB2A 3KAPA 2RC5A 4ZQBA 3U4GA 3AUAA 3CUKA 4DAEA 1GPYA 1GPBA 2OESA 5KQMA 5IH7A 4PRZA 1RJ9B 2DGDA 4WDRA 2W70A 4PV7A 4EB6B 1JG7A 2H6EA 2VSOA 4CLOB 1SMKA 2WZCA 3HRHA 2G0NA 5T3YA 3GFBA 1A98A 2A8YA 1YHNA 2EFYA 1LLUA 1X9IA 2VHWA 3SC2B 3WAGA 3IULA 1RHKA 3TOVA 1NDQA 4HL6A 4I55A 4JUBA 4NWIA 1HRKA 1UC4B 3UMBA 2AFIB 3H9QA 5FWXA 3RHZA 1QZTA 1J2UA 1S6YA 1W4AA 1P5FA 1L5SA 3WBFA 3RVPA 2BFDA 2R8OA 1E2PA 5C1PA 3EVZA 2B8TA 4EA9A 3OPYB 4HLCA 3IRVA 4A0SA 4HSGA 2M98A 2JH8A 5CA1F 4X7RA 5FPPA 1NNSA 4JB2A 1BA3A 3W5JA 3SYTA 4DC9A 3H7AA 5DNUA 1OBCA 1DINA 2I3BA 2GS9A 1GUFA 1PJ6A 5L46A 1U2EA 3FPJA 4UTRA 2GF9A 3MJRA 5KYWB 2O2SA 2PY6A 3NG1A 4RMHA 2BGTA 2GD2A 5AVUA 1K0FA 1JVBA 5EXTA 3KX2A 4CWAA 1NQXA 5CEFA 1OREA 1SVUA 3BHJA 2JAHA 3L8CA 1JQLB 1NSTA 2MINA 2OCGA 2OLJA 4HRXA 4ETWA 1GNLA 1QGED 2WU0A 4JLWA 1QHFA 3DKKA 5B12A 4OYRA 2YN4A 4FMDB 1M33A 3KV3O 2HBQA 2AOTA 5KU1A 5H70A 2F55A 4CTKA 3B53X 1H0KA 4QOFA 4RZSA 3JQ8A 2QMHA 3CLRD 3R8XA 4IRMA 3PQCA 2Y8EA 2GXQA 2VAPA 3OBIA 4JBXA 3Q8LA 4K3VA 2Z98A 4Q6WA 1ZJZA 1GL7A 5B4UA 2O1XA 5IARA 2VBUA 1KYQA 3I56B 2V5UA 4NBTA 3NHRA 1SKYE 3OQIB 5CK5A 1RHQA 2ASEA 2ZTLA 4MCHA 4JCOA 2D3LA 4H15A 2VI5A 5F21A 3J81k 1ZM3A 3T51B 3SXUA 3IOYA 4CM9A 1GTL1 5C8YA 2BH2A 4KRFA 4CM8B 3N8HA 3BMQB 2CLKB 5IDQA 2JAOA 1Z12A 3DE0X 4R1UA 3QFFA 3GRCA 2DU8A 1KBZA 2DR2A 2Z8ZA 2OZLA 2IH2A 4PHTA 4LHZA 3AT1A 2AI2A 2RKOA 2ORVA 3VZSA 2INGX 3X1MA 3C3DA 4K9DA 3R4VA 1JR3E 4HX2A 1A9ZA 5KI6A 1CUJA 3UATA 1E3IA 5A88A 2QP9X 3CLSD 2AG6A 3SQNA 1ZCFA 4CR8A 6ABPA 2BTQA 2QQGA 1D0SA 1U3FA 3LAWA 2REQB 4INZA 3T1TA 2ZUDA 4L15A 4NZOA 3EDOA 3PCTA 4DFDA 1Q57A 4F6RB 5JO0A 3BGDA 4I6EA 2AVDA 1IY9A 3EAGA 1DCFA 3VXKA 4A16A 3YASA 1Z6ZA 4ALMA 2VYND 4BCBA 1YZVA 1PFVA 3X1JA 4WBSA 3O82A 1AUPA 1MB0A 2WKQA 3AQ4A 3NNSA 3P2EA 4TWBA 4ZQGA 1A69A 1KYYA 5FI3A 1K8XB 4B09A 1JHMA 2JD2A 4EFLA 1NPTO 7GPBA 2OBFA 4J4HA 2C2OA 2QZSA 3UMSA 3W5IA 4CL2A 5AJUA 2PX3A 2WDZA 1ZD9A 2W71A 4KXMA 1JEJA 4KNVA 1MX5A 5E6SA 4PQGA 1VIYA 3GJQA 5F1YA 1PLKA 1HM5A 1NW5A 2PKRA 3WP1B 1FU7A 5JFOA 1N75A 5MFZA 1GZDA 3F4LA 4IHAA 3P9ZA 4WGFA 3ZQ6A 4EF6A 5HZBA 3EDQA 4N7RA 4IDCA 3IKJA 1N6KA 4LAFA 1AIPA 1ULSA 2V45A 2R6DA 4LK2A 1GZ7A 3D26A 3FNEA 4RTOA 4OK5A 4V2UA 6Q21A 2QQFA 4R0NA 4DBLE 3DZHA 4TQUS 1ZMBA 5DM0A 1SXPA 1RE0A 4Y6QA 4HX5A 4DCNA 3JQDA 3L2OB 5KMGA 2Q49A 2HK7A 2LCIA 5KKCA 2WTEA 4KO3S 1B8UA 4LGVA 2VTDA 1DRVA 1LFDB 3LYUA 3CXCB 4LBWA 5KNLA 2YFHA 4EB3A 5C8ZA 5E7IA 3H5VA 2MCFA 1C0EA 3FUWA 1HQYE 3RREA 4X05A 1F51E 1W1UA 4KI0A 3U1BA 4EYQA 3T7JA 4XVHA 3PRJA 3TAXA 1SCIA 2QXTA 3R1IA 3TE7A 5KSZA 4BP3A 1SKAA 2BPOA 1PS0A 2H1LA 4NZYA 2MOKA 2C78A 4LF9B 2VRCA 3WB9A 2WE8A 3NJ8A 3LWZA 4KGXA 2ZSBA 3NOOA 2GERA 1PWYE 2JF0A 4MYDA 5D1HA 2FPPB 4BP9A 3LRXA 4XARA 3RS3A 3E7FA 2GNPA 3ROZA 4OHFA 4ACAA 3WGKA 5JLAA 1QGUA 3DTNA 4MI1A 4WX2B 1WBBA 4F5ZA 1GA1A 1MB2A 1RAIA 3LOQA 3CA8A 3DMRA 1QFYA 1D5WA 4BV2A 4Q4JB 4DBZA 1OYOA 1IY1A 2LDBA 3ABQB 4P58A 1JKXA 3CG0A 4RNDB 1WKBA 2WWFA 4BNTA 4G8DA 4XLAA 1D8AA 2FUCA 5BYKA 4WTOA 2WJVA 1E6WA 1RYEA 2VWPA 2Z2YA 4OXKA 5CAEB 2FF5A 2W6MA 3E3NA 1D1PA 3L5KA 4PO9A 4LRQA 4Y30A 1TO6A 2FXVA 1NJFA 4FFSA 3K3PA 4RJTA 4DQUA 4BCCA 3V8RA 2FZEA 4CMJA 1TT5A 4A2PA 3HXOA 1PVDA 5D87A 3HJFA 1Q3TA 1RC8A 3KALA 4I1PA 3GXOA 1DTWA 4BZQA 1WTCA 2V6IA 5BVGB 4HATA 1NRKA 3WJ1A 1CQIB 1FFBA 3T7IA 4IX1A 1ZS9A 4Z54A 4PCLA 1QU2A 1QZ3A 1LDMA 3EVGA 4TTQA 4HAUA 5A6SA 2DPGA 3DMHA 3FDZA 3I52A 5ALZA 5JCOA 1LF5A 3K9BA 5EI5A 1AVTA 1XPJA 2HDWA 1IUOA 5JYBA 4X97A 1OBFO 1P31A 1CV2A 2I5PO 3VNAA 3SJBA 3A1NA 5B6JA 4O2AA 3KWLA 3HYLA 4NMHA 2WU4A 3LNCA 5F76A 4OX9B 1ZG3A 2YYAA 2YZ7A 1R8QA 4E6EA 4Z4QA 3OOSA 1WDKA 3IE2A 3OA0A 3W3AH 4RV4A 5T57A 5BW4A 3R7SA 4GZLA 4RDXA 3BHMA 2VJNA 1Z2OX 2CNDA 1TW3A 3KKMA 3VV2A 4DA0A 4DK0A 1RS0A 2B9EA 2OXRA 2VCYA 3ZK9A 2H0QA 2DBQA 3DJFA 1JLMA 1ZNWA 4B3HA 4JYMA 1KJJA 3I9LA 3QXGA 3SLRA 3QVTA 1DX4A 2R8RA 3QKSA 1NBMD 4RS4A 1RYMA 2EFJA 1U1FA 4KQ2A 1PHPA 3KHTA 1DJPA 4UEKA 1U2PA 3SY8A 4AZ3B 1DDIA 4AYXA 4EUHA 1KD1D 5DTQA 2I78A 1XVTA 3H2JA 5MHTA 3THWA 4CEIA 2OHIA 5B6PA 2YH2A 3OCYA 2PWAA 1B14A 3GJ0A 3U44B 2GNAA 2HO4A 3HXMA 1T24A 1I13A 2I54A 3DAGA 5I9MA 4RORA 1PV4A 4LV6A 2QSYA 2R751 4YAJA 4B6QA 1UPUA 3P26A 1X7YA 2ZJYA 5EE1A 4BTVA 2R7AA 3T5PA 1XNQB 1SQFA 2VAVA 3AY7A 3EBPA 4FHGA 1U8FO 1MEJA 2QR2A 2HI0A 4O8CA 5K3FA 1R74A 1A8SA 2X0NA 4DGQA 4COKA 3BEOA 2W00A 2JKYA 4OHVA 3R24A 1GR0A 4Z4TA 2PXXA 4D5GA 3R5JA 3SJAA 1DUVG 1YJ8A 4O33A 4XGQA 3PC4A 5KVVA 1ZK3A 4AW9A 5BQ3A 3OJOA 5MN5A 3HA7A 2BMDA 5LIRA 1B0ZA 3U4QB 4LKOA 4QUEA 2P6RA 3GRRA 3G2IA 4R2KA 2V6BA 3WZ2A 5BSUA 1LPMA 4EOGA 3WL5A 3KCNA 4RH3A 3F6EX 1Q1GA 1MAWA 4E94A 4MVJF 2GPYA 4TWAA 5JIBA 1O87A 5BPFA 1Z8DA 2XUKA 3KP1A 4CQMA 4V02A 5G4KB 1SIWA 2QI9C 2X6WA 4F04A 3PT5A 1W88A 3T7KA 1IXKA 1E3XA 1E2EA 3CC7B 2BFCB 2R1VA 2YFYA 3C1AA 4JKYA 5FI0B 5F73A 1Y6ZA 2WMDA 5JSUA 1NW8A 2Q7XA 1ECJA 3UMFA 3B1JA 1G59A 4GE3A 2VHTA 3KVYA 1YZFA 2XNDD 4MRPA 1NZJA 5J2UB 4P2NA 3QVKA 3HJRA 4UOEA 4L22A 1ZGJA 2Q3EA 2WNIA 3E22A 1OOEA 3WHIA 3ISJA 4OKNA 4IPTA 3O7MA 1SY7A 4TOIA 1PWZA 1AGYA 2HJVA 4CKCB 3TLKA 3RFFA 3U7IA 2JJ2D 3PGJA 5H16A 2VUUA 2BMWA 1I4TD 1MFZA 3CURA 3NNDA 4MKZA 4MKIA 2GAIA 2XZDA 5EQFA 5CU7A 5AW5A 4Z86A 3VYSB 4DUGA 2X6QA 1B1CA 4DNTB 1M6WA 3BX1A 2AHOA 5JQGF 3GG9A 5JZOA 1GHTA 4B3RB 1CCWA 3V8VA 1O6GA 3WNVA 4E07A 3FSGA 4LFBB 3FLMA 5TMPA 5DE3A 5LP6A 5CTJA 5EVCA 1P80A 4IX9A 4XIYA 5CM8B 4FXOA 3S44A 4IO1A 1F1JA 3OQ1A 2JW5A 3GEIA 4G4IA 1ORDA 1NM5C 1OVMA 2HFJA 2GN9A 4GS5A 1Q7RA 1U0SY 4W1SA 5EKUA 4YHHB 4CM6A 4K40A 1ESMA 3DHWC 2FUKA 5M34A 3K9LA 3L43A 2QEQA 2QYHA 4YRCA 2EGGA 3EF0A 3B85A 3HCBA 3A14A 1Y7PA 2XWQA 4DG5A 4DS3A 3WV4A 1MMFB 2XXJA 1LBIA 3V7YA 1VJRA 3IPAA 5JWRA 3Q2KA 2WFZA 5ELXA 5D3KA 4K05A 3DVLA 1E92A 1TO2E 3AR6A 4FFNA 3PQDA 4KV9A 3OIWA 5HVNA 2GCEA 3A06A 2BYTA 2FRDC 2QRMA 5AHOA 3CMMA 3OC6A 4LC0A 3ESQA 3W3AA 4OQMA 2WYUA 1Z2AA 2OZKA 3N2KB 4WACA 4G1BA 1XLUA 5HRUA 5C8XA 3VZPA 3PYXA 4JIMA 4LOLA 3RABA 1OIVA 2OA0A 1HDRA 2C2WA 3RRZA 4BO3A 5I7FA 2W42A 4KTTE 4HGPA 4Z1MD 5JC1A 2R6JA 2CMGA 5CCDA 4M6WB 2WUFA 2XXAA 1QKKA 4EKNB 3F97A 2PKCA 1AKRA 1TIBA 2XCLA 1B0UA 4TV9B 3AEQB 4AF7A 5BSGA 2RGCA 5IKXA 1AF7A 4D4HA 3KR0A 1A27A 3HCRA 1L5HA 3EVAA 1E7WA 4BKRA 4UNRA 5A5DA 3QUTA 3KSBC 1SQ5A 1VBNA 3SM9A 3BM5A 1BSVA 4GPBA 5F23A 3V9AA 3UV6A 3M9LA 3F74A 2PRIA 2Q99A 2D0IA 2C59A 4M22A 2JCVA 2QLLA 16PKA 1QCZA 4BNUA 1XPRA 3GZNB 3BF7A 5IDYA 4A0HA 3UCEA 1H42A 1JAYA 1ZN9A 1ICIA 4KUGA 1G5HA 8AT1A 2CCJA 4G85A 1OWPA 3OZDA 4QJBA 2QDXA 4TROA 1KQSB 1SUSA 4PXSA 2YYZA 2RHHA 3DMTA 1HZEA 1ZNXA 2QTNA 5GM2A 4NMWA 3VOTA 4A6EA 3AKCA 1NF8A 1ZD3A 4M9RA 4RKEA 2WV7A 1TCCA 1QFXA 4KE8A 3EXG2 4GXRA 2H7XA 4ICIA 4HB4A 1N9KA 2CXHA 4XSHA 1JHVA 2GT1A 5CPBA 2JZCA 2C9YA 4P12A 2OG2A 4G3XA 2DBZA 4Q66C 3THYB 3AILA 1SHZA 4EHIA 4X0CA 3K70D 4YCLA 1RFGE 4JI7B 1R0ZA 3A6HA 3GMIA 1N2CE 1P29A 4GPEA 1RLTA 1Z74A 4FN5A 1VL1A 1PLLA 1Z2DA 3LUKA 3N59A 4GI7A 2RBGA 4AICA 2VLIA 2W6QA 2KMLA 1KETA 4OSOA 3FDJA 4YGYA 3EIEA 4P3NA 4D4LA 3UAWA 3LDGA 3E23A 4CLEA 3V4SA 5AW4A 1SBZA 3CONA 1YJ9B 1EM6A 1KVTA 5ALFA 1AMUA 3PE4A 4J29A 4B3DA 121PA 1QK5A 2QG4A 2WABA 3AY6A 5DI3B 3VVMA 2SHKA 5IT0A 1JTFA 1NXXA 2D3NA 1PK9A 1Y81A 3S8EA 2D8AA 1NVVR 3OEYA 4R69A 2ODNA 1VJDA 4EH1A 1E1RA 4ZOAA 4GWLA 2RKBA 2Z6AA 3AP3A 3ONYA 4QT0A 1WDLA 4NNJA 1RM4A 1VBMA 2X2PA 3TJRA 4A6DA 2DG2A 3U3OA 4QARA 4D3XA 9MHTA 2V1XA 3GELA 2AXEA 5E9JA 3T3EA 4NH4A 2PJRA 3ENWA 5FWNA 4M7WA 4RXUA 4X3OA 2OSVA 4HRAA 2IP1A 4B85A 2NNLD 3O5AA 1FW8A 4YALA 2WOJA 2ZJOA 5HQ3B 3MBOA 3TRJA 3ORHA 5F9MA 1KPHA 4YQFA 3O21A 3PEWA 1TKCA 4JX8A 1XDWA 1N5MA 2O2HA 4NOKA 3CPXA 1G3MA 2VATA 3I92A 3W6PA 4D74A 3PU6A 3S1AA 5C3UA 3V7FA 1WMEA 1N25A 3KTAB 4GLFA 5ICFA 4RKWA 4DIOA 1OF1A 3U3DA 4U0JA 1HMYA 4CKBA 2GUGA 1THMA 4N3AA 3BXHA 3V1NA 4EUEA 2XRMA 5JAIA 4OHRA 2AZXA 1OBHA 3TSOA 3K9HA 5A9TA 1KZ4A 4EUSA 2YV1A 4EI7A 4Z0PA 3OHPA 4M7PA 5BR7A 2OXTA 3ENNA 3FOFC 4POOA 2PMFA 1RXYA 1MOQA 1DBQA 2HNAA 3L1UA 2O2IA 3KVNA 2OOSA 3MB5A 1J70A 4GX5A 5K0LA 3T9DA 3BGIA 3GQBA 3QTLA 5EFZA 2AMLA 4DWJA 4KE9A 4MLCA 2I6TA 2X3UA 2B8JA 1N2ZA 4OLHA 4BIMA 1MUUA 2Q8NA 2QL5A 3EHEA 5FTMA 1QVFB 3MOSA 1W52X 3VJLA 1N7JA 3M6UA 3FSEA 1MQ8B 4G5GA 1U8UA 1RZVA 3GUVA 1O7JA 3HABA 5BW8A 5DULA 3S0JA 5K6RA 3IO3A 5I9IA 1NG9A 1P17A 3VR2A 3LCJA 4H16A 3C6YA 2PKQO 2AFHB 2KBFA 1KP2A 2DFKB 2NUAB 4CCWA 3MCVA 3OEEA 4Q4DA 5KYKA 2BEWB 1JAZA 1BAPA 4DMRA 4D8UA 4DRYA 2Q62A 4JKIA 1EH5A 4ND6A 1MR3F 3L77A 4ND1A 1CJUC 2NSLA 4X5OA 4A0QA 4D9JA 5A6VA 4Z4YA 3MA0A 3TCXB 1W59A 4BJ6A 1I8TA 4OOVA 1V71A 1DAKA 2DSTA 3BWCA 3FRJA 3GEDA 4FOSA 4KH0A 5FWDA 3OLZA 1C50A 1XT6A 4IIEA 1BE8A 1HLGA 2JVJA 3KZ1E 3NGMA 5ESDA 4NECA 3A3KA 1H66A 2H2FA 3IUNA 5GIPE 1XELA 3Q6NA 5F9FA 4EPRA 1NFRA 4ARUA 2IY8A 2ZSEA 5IABA 3DR5A 1JLSA 2NV2B 1BXRB 3G8YA 3N53A 4IQ0A 5EHIA 4Z2YA 1U7HA 3PKZA 2PA0A 3QK7A 2YUIA 1IMOA 4IGAA 3KKEA 4K88A 3DXZA 5KAMA 4CL0A 1E63A 4BJ3A 3GEEA 4AIIA 1JDVA 1PTJC 3H3XA 5CITA 4S04A 2P4SA 2VN8A 1I6LA 4L2IB 5TSDA 4XKJA 2J7PD 5I9TA 3I0ZA 3DBHB 2QYSA 4UNIA 4O4HF 3KDAA 4ADSG 4B4WA 4WXRA 2UUBB 3ET5A 3BQ9A 1J1ZA 4LPSA 3K1ZA 4XGIA 1A1VA 5L9AA 1TCUA 1R6TA 1TZCA 1CQZA 4PLGA 2ONCA 3PD7A 4IMRA 4BVEA 1R0XA 4RCZA 4CZ2A 3DHYA 2DPMA 3GC6A 3OCWA 3WLHA 1QFJA 3FUTA 4R81A 1DMRA 2AK2A 1EVIA 5A89A 4KJXA 7ADHA 2XEXA 2JLYA 2ZYUX 4X8IA 1EE1A 3OX2A 4OXNA 2YUTA 4AXBA 1SCNE 3DZDA 1I01A 2UZAA 3JQ9A 3QHAA 4TXHA 3EZNA 4PPGA 3PCRB 1CZKA 4WXPA 1MDFA 3GA5A 1SCJA 1FQJA 1I36A 1UBSB 1YB1A 3ASRA 3MOIA 3QIAA 4UCXA 3R9IA 5JYCA 4U39A 5ICCA 4F8YA 1W1IA 3G2JA 5EPEA 1MB4A 2ZBEA 3BXPA 4ZXPA 1TQ2A 3CZQA 1YMUA 2ZE8A 5HZMA 1MAHA 4YBRA 2JLQA 4JP2A 4RS3A 1V4BA 3GEMA 4LOAA 4RC9A 4Y2TA 4KKXB 2Q07A 4NTZA 5D84A 1SGWA 3KUCA 2XTJA 5ED0A 5ALNA 3ZZ1A 1WEHA 4CT4B 1FC0A 2RGBA 2XUIA 2ZRHA 4OI4A 5BSEA 3M6IA 2A7XA 1INLA 3V9PA 3ZHBA 1TL7C 4Y6PA 3ANLA 1CUCA 1EHYA 3NFRA 4Z7OB 3IDOA 4FNGA 1F8FA 3ZXIA 1JJ7A 5FUYA 4BO5A 5FXMA 1TLFA 1NTOA 4DAOA 3C5WP 4DIDA 3CZ4A 1IPEA 2C2XA 4PW0A 4HB2A 4K2AA 1ULZA 4AQYB 2Z95A 3F49S 4JUFA 2YZKA 3OJLA 4CF7A 1LTHR 1UJ2A 1CRQA 2P69A 1JLLA 3ZX4A 3G9XA 3K05A 1RKVA 3N2LA 3LKDA 4PG8A 1SUEA 2PU5A 2JHGA 3N5KA 1RWKA 5L3SA 2MMGA 5KYXA 2QIOA 4F46A 1BDMA 4YEDA 1F48A 2Z5VA 1IM8A 4B40A 4J03A 1GCGA 4W6ZA 1WD5A 2AOWA 4PLPA 4B2YA 1BJRE 4J1TC 1I7QB 1A8IA 1SUIA 1M73E 3MPOA 4MV0A 4TRRA 3K53A 2BGNA 1QMPA 4NENA 4EA8A 3SYKA 1LK0A 1CF9A 3IR6A 1W35A 1XA3A 4E51A 2GN0A 3CRQA 4N4AA 1QF9A 3DDHA 3FA2A 4FMBB 1VTKA 4X1IA 4BLRA 4CRWB 1WB6A 5L4NA 4F7WA 3UNXA 1HE2A 3U81A 5JRJA 3M83A 4FDTA 1C3OB 1PR0A 1XP5A 3ZBUA 4KQWA 2B4AA 2NADA 1K6XA 2VL7A 4KMMA 3OZVA 2FZKA 3JWGA 1MLDA 2G36A 2XTNA 5J2TF 4XM3A 1KI3A 3ZWBA 3AL0C 4HZUA 1BDJA 2FGJA 1V16B 3PFHA 3KEWA 2HNBA 3BCSA 2X5JO 4IF6A 4Q15A 4UZFA 4OOFA 1BA2A 2JLBA 4JBWA 4ZZ0A 5CA0A 5IF3A 1VJ5A 3ZDAA 1SURA 1DEHA 1M6NA 2V7EA 2XADA 3GBSA 4OVKA 4QD3A 3SAJA 3ZH9B 4KEAA 1S7GA 4QELA 5M2QA 4ZVLA 4AMUA 1JQEA 1J09A 4G97A 1D04A 3BZWA 3R3ZA 2HA3A 3B60A 4HADA 5TQVA 2I1LA 4GQNA 1P9OA 3TR6A 3KFLA 4NE7A 3WICA 3ZKWA 4EF5A 3ZZTA 3IP6A 2HRQA 1BKDR 4KMRA 2G7ZA 1VF7A 2J0UB 3TK1A 4Z3OA 1NULA 3RJ9A 1R0WA 3ZE0B 3H2GA 3ZJ5A 3ZWPA 4KFTA 2QVCA 3JVDA 2R47A 3ZD6A 1OLSB 1TZJA 4CDMA 3DW3X 2EFCB 1QH8A 3KC2A 3GLSA 1C14A 2O54A 4YQYA 1BKSB 4J75A 1PD1A 4PYRA 3W2GA 4PO8A 2ATIA 3NOXA 3O9VA 3VC1A 4YRBA 3HJTA 5E4FA 4A36A 2QM7A 2AI1A 2RI6A 3HI6A 1K6IA 1VLZA 2FOLA 3EJ6A 3FB1A 3FSJX 2CXSA 4O4LF 4EG3A 1UDCA 5HCUA 4QU5A 3F6RA 3I9KA 5A5VA 1FDTA 3K0SA 4O59O 5JSZB 1MX1A 1XQ9A 1T8YA 3FCSB 1IDN1 5G1PA 4E88A 1D8TA 2PSFA 4W99A 5HZGA 4PGMA 4TTSA 2RB5A 5DGDA 4RXTA 4G0XA 4XIGS 4YRPA 3VPSA 1FSPA 1TJYA 4EEKA 2ORED 4MCIA 3VJRA 1EUQA 3W2IA 4OP2A 5CYOA 1NM5A 4GYWA 3ZWNA 2HU7A 5J47A 4PINA 2VWQA 1SXQA 2GZ3A 4TTVA 3HSSA 5D8DA 3ITEA 1U7ZA 2YDYA 2P9ZA 4MPDA 1XTQA 3QHPA 4R9UC 3KXDA 1RPNA 5EWJB 4CQJA 5HILA 1JPVA 5BN1A 5TEVA 5LP6F 1DP4A 1KSFX 2NZJA 4WQMA 4M1WA 1WVGA 1T5DX 3W05A 4XD7A 2Y1LA 4UASA 1W6RA 2OHVA 2Z9CA 3PDCA 4LJ8A 3VTKA 4Q7JB 4JC5A 2Q8QA 4POAA 1ISIA 4U7DA 4AURA 3O8OA 3H5AA 4L78A 1J49A 1OA0A 3KJQA 4RJLA 4Q48A 3C4VA 3EGXB 4S35A 4U7TB 3MILA 1YK0A 3IXQA 1U7UA 3RRFA 2AE1A 1CLEA 1X3SA 3OM0A 1B0PA 1EYZA 4B46A 2C98A 3V4LA 3ONNA 5CW2A 2FMFA 4D8XA 3GPCA 5K0BA 1ULAA 3LD9A 3VNBA 4XIFA 1QRTA 3WY9A 3V33A 2AI3A 5C80A 3LDAA 3NBQA 4BMPB 4O2BB 3WSTA 4BNDB 3OLCX 4H0FA 1PZMA 4ESOA 5C52B 4JR1A 3ANMA 1OXSC 2WM3A 4MWSA 3SBDA 4EJMA 1HTTA 3JQ9C 3MC1A 2KB0A 2COUA 4OJNA 1NJ1A 2ERCA 4G5SA 2KI5A 2PJUA 3C0KA 3OE1A 4BMZA 4WN3A 4JGGA 5ERYA 1DJMA 4FR2A 1TAGA 4EL0A 5AI5A 4ANFA 4B17A 2J32A 4C22A 3PGLA 4GI5A 2DPLA 3D31A 4AZ0B 4F3CA 5LIPA 3ETCA 3I1YA 4HQNA 1RMYA 2V6GA 1Y37A 5ALSA 3HYTA 4KXYA 4EX7A 1KKLA 1NDUA 4RM3A 4NZPA 2Z3VA 4EG7A 3ASPA 1B8VA 4YAUA 1C9EA 1DIGA 2C95A 2OQ2A 3AGQA 1U8ZA 4U2CA 3RIEA 3ZWOA 4ML3A 4BB9A 4FUTA 1JBKA 2DECA 3ZZUA 2HMVA 4ER6A 4WJLA 3WLIA 4D92A 4URFA 2XAUA 5EP4A 1DBVO 4P83A 3I3OA 1PR1A 1Y1SA 3H7IA 4ZRDA 2GD1O 2PH1A 1IY2A 2HA4A 2IV3A 4E7PA 1SQGA 3QE4A 5IM4F 3MS7A 4G5OA 1Y3BE 2MYTA 3R7BA 3ZR4B 4GUDA 5I51A 1K7EB 1CJVC 2P77A 1E1NA 4B4UA 1Q7EA 4YXWD 2J9YB 1Z7YA 4XW2A 2VHVA 2W2LD 3GVLA 1OJ7A 1PV2A 4UCQA 2O2GA 3MXOA 3GNLA 3DTTA 3IHTA 4D4IA 3H8JA 4RA6B 4A6XA 2ZVDA 3VU1A 1YTLA 2FWBA 5JS6A 2QE7A 1J2YA 3FPBA 1XLTC 2UZIR 4QPJC 5IJAA 4S05A 2WKPA 3Q6MA 3AXSA 1N3BA 4G6IA 4TXLA 4R9NA 3IUBA 3TR5A 1FVFA 2XR1A 1LF0A 1WLYA 3LZCA 4YRMA 2P7HA 4QV2A 3EWIA 1BXGB 1J0EA 5HF6A 1AQ6A 4YP7A 2G1AA 3ZNQA 4AF8A 3ZHTA 4FFBA 1VLYA 3V8QA 1OWLA 4O25A 1VKRA 4HF7A 1Q0PA 3IRUA 4IILA 4C0HA 4B5LA 1WNTA 1AGRA 1YR7A 2QD2A 1W19A 2B6HA 3WGGA 2WUGA 2A0UA 5H9WA 2GVDC 2IDMA 2ENWA 1HETA 3O95A 2OOKA 1MV8A 1S9HA 1UXHA 2BDTA 1WETA 1QFZA 1KZ7B 3E9RA 2V3VA 3L7JA 1RQXA 4URYR 4N5DA 5FUWA 1F9AA 1EB9A 1ZZEA 2DLDA 4A82A 3X1YA 1EZ1A 4LNHA 2B4KA 1C9MA 3HM9A 2P90A 2J6CA 5CM9C 3AF0A 2NYAA 3BZUA 1P62B 4IZIA 6ADHA 3P2IA 3BTOA 4FSDA 2ZIXB 1BH2A 2D1FA 3ZC3A 1TO1E 5BSRA 3IO5A 4C3ZA 3BREA 1QPBA 1YFZA 3HB9A 1PIWA 2XB6A 1Z08A 2PWPA 2VJQA 3F9RA 1UBEA 4LSWA 4Y6GB 3AVXA 1WPRA 2OKGA 3CCCA 3TOSA 5AKYA 3ZNNA 1XKXA 2R9VA 3L0BA 5KSWB 3NFYA 1V11A 2VIIA 4H27A 4L5AA 3SOZA 5KOJA 2AA3A 2IZ7A 1ADCA 3I58A 4ENTA 1FQOA 1LI4A 1PX2A 3R3SA 4NATA 1N9ZA 4TS4A 5B53A 4D9FA 1OTHA 4O4LB 3A1DA 3EFOB 3VA7A 4FEYA 3T9FA 2BGWA 1Y8QB 4LHYA 2PPVA 2XTZA 2RAPA 1RI1A 2ZRQA 421PA 2I4NA 3NBYC 3QXXA 4LZJA 2Q3FA 1NLFA 1TC1A 3OKPA 4XLTA 1O03A 3R7FA 2I2DA 1TTQB 2GARA 1XZ8A 2QVYX 1DCKA 3GJZA 1CDDA 3FAKA 1F0KA 4GQBA 4G5HA 1Z38A 1MENA 2FDRA 1DHRA 4BFUA 2ORYA 1F9EA 4FHZA 4XWAA 1ORHA 2BBTA 5EIFA 4PWZA 1GRNA 1LPBB 2IDKA 2V59A 1QQAA 3R6KA 1O54A 5I5EA 3C5EA 3GGPA 3SXPA 4ATNA 5JD4A 2WMYA 4KPEC 3HJHA 2IS6A 4R2JA 3CG4A 3ZV6A 5HZAA 2XHZA 5DB4A 2OP1A 1KE1A 4M2LA 1U1IA 4DOMA 1OT5A 1I7NA 3N28A 5EP2A 1YITB 1JR3A 4Q03A 5AOBA 4C04A 5AKIA 1K3UB 4JBLA 2J9XB 2XTMA 3LY8A 1C0LA 2QN7A 3Q15C 4DUGD 5AXCA 2IKSA 1FJGB 1FMFA 4IIFA 2QX8A 1EM8B 1W4BA 1IDOA 1UKZA 2XE6A 5F12A 2MSWA 4BQEA 4EBBA 3CVWA 3P71T 1AJEA 4U1RA 3HBFA 2E21A 2UVPB 3GN1A 2X5NA 2FN7A 1ZFNA 2EW1A 4GEGA 1GZHB 4QE3A 4Y2JA 1UZMA 2WTBA 5K3EA 2P35A 2G5TA 3AEQA 5HDQA 1SU8A 5CFZA 1MABA 3WGYA 2I0FA 2LBPA 3A2NA 4D9EA 3BCFA 3EPLA 3EG9B 2IY7A 2Q3MA 1IQRA 1K06A 1KIFA 5L4LA 2VBIA 3RFTA 1N9GA 5D5QA 5C7IO 1ODSA 3I37X 1WDWB 1C7RA 1G16A 5GMOA 4X45A 1F7UA 4D8TA 2XJ9A 4D5EA 3T53B 2QMQA 3TVDA 1FUUA 4C3VA 4ZC1A 2QAGB 3KR9A 1GGFA 3COVA 3OWXA 4JGBA 3RVLA 4ZI7B 3DXFA 4JLSA 3OMWA 1XRLA 2J0SA 4G0UA 3OCCA 4KTVE 2PGDA 4D8VA 1TYZA 2EXXA 3LOUA 4OHUA 2C9OA 3ZHSA 2C5LA 1JALA 1OBOA 4PX2A 2LV8A 4DL9A 5B57C 1MQAA 4YK7A 3ZCXA 2C99A 5JS8A 3S2GA 1M6VA 1XYYA 4UAJA 1GPLA 3T0FA 3CXRA 3PKIA 5LM3A 1K3FA 1H2EA 1PKXA 2PV0A 2RGXA 2FVYA 3RVDA 3LT4A 2IVZA 2E6KA 2WTXA 1CRWG 1OPRA 5DCYA 5A7GA 4YMLA 4EI9A 3OEWA 1EGHA 1P81A 4WA8A 1Y8RA 2BEKA 3D8SA 4L5BA 2O1WA 4YASA 4A73A 2PZAA 3LBIA 3OM8A 3VU0A 5AMXA 3B38A 3Q8WA 1QE3A 2PUTA 1VSTA 1TAUA 1Y98A 4WKBA 4B8ZA 1JQKA 5KZMB 2Z5LA 3M1IA 2C3UA 1W5AA 4IXWA 5AUQA 2ZIXA 2AX4A 4DSNA 4Y1GA 4EKEA 2G9RA 1F4VA 1IRIA 4YAIA 1JEQA 3WVNA 1JIIA 3G6EB 1NQWA 3CW8X 2BZ0A 4NESA 4U2BA 2WG1A 5DJ5A 4RPCA 1L4BA 2IGTA 2ZATA 2OBXA 4KXQA 3IAFA 2XT6A 4NQZA 5FKJA 2FFJA 3PVZA 4I2VA 2GCOA 1ZUIA 2QY9A 2R85A 2HLDA 4QXQA 1YZGA 3WGIA 4KREA 1DXQA 3ICCA 1BMFA 2YY6A 3Q6RA 1KA9H 4JLBA 4L85A 2XDAA 2XUPA 2GVZC 2PH5A 4MRVA 3BB1A 2R79A 3PICA 1T8WA 2HMUA 2OUKA 5EPOA 1EMDA 2ZI7A 4TWIA 3O2JA 5K3CA 5DGTA 4DTCA 4RDJA 1T9KA 3CLTC 4RF4A 5LMCA 1B76A 5CNKA 3UPTA 5TRTA 2GAFA 4O08A 4I6JA 2ZL6A 4UHJA 2ZZMA 2CT8A 4PCUA 4IKEA 4TLEA 3U3MA 3G0HA 1E79D 4RIFA 3MCUA 1XYVA 3MRTA 1D6SA 1MVLA 3QH4A 3E7XA 5C5EA 2Q6OA 5LQCA 2EWMA 4I7EA 1Z3IX 3AUJB 1M6EX 2WLSA 4TTTS 3DMPA 3RRNA 1P2UA 2WWYA 4Z9XA 4E5PA 3LCVB 2DLCX 2CXUA 3P32A 2I87A 4B83A 1GPNA 4F91B 3KOYA 1U63A 1R8JA 3RHFA 1AKNA 1JG6A 3WDSA 4UBJA 2OLKA 1FQWA 2OM6A 1DAFA 1HFKA 4HQOA 1NRIA 2C7BA 3I6QA 1FLNA 5BW6B 4YJDA 3NORA 1R5OA 3LU1A 3LQ6A 1XU9A 1I4DD 2E55A 2FSSA 5K3FB 4BB0A 4DRZA 2D4HA 3EFEA 3Q12A 1KP3A 4G81A 4PBTA 1BE1A 1H2ZA 1K5GA 4FX5A 2OWEA 4Y1EA 5FT9A 3ASVA 3TL6A 4B3IA 1UXIA 2NUPA 1UD8A 3ONFA 2ZBFA 3GT3A 2R7LA 1H69A 3B8EA 3MJCA 5ALUA 3SMVA 3KHUA 1ZKDA 3LQEA 1LBHA 3DVAB 6REQB 4RD1A 5AHXA 1OPXA 3TIFA 1XL0A 5DF1A 2EZ8A 3GLHE 5L4SA 2O4UX 1QCDA 2GASA 2YJTD 4ZVKA 1BG6A 1FFYA 1EVQA 4B45A 3TXXA 4Z51A 5CA1B 1TUIA 1POXA 3PJRA 1W96A 2G8NA 4OU4A 2YXNA 4XA8A 4YAEA 1V3QE 2GKOA 2PLFA 2Z8YM 5AW6A 4DDKA 3WRYA 4KIFA 4FWTA 1RWNA 3E4DA 4Q3CA 5L7WA 2P8SA 1XZEA 5LXTB 5CIQA 3UT5B 4P1ZA 1NV8A 4P4SA 4BMCA 1MEOA 1WB4A 2YXEA 4C4TA 4JSRA 3GEPA 4G2TA 3LT5A 3CPSA 2J09A 3MJVA 3FRIA 1YJ5A 1GAWA 4UBNA 1N92A 2KVOA 3OFNA 4HDOB 3B6EA 5IBRA 2YZMA 1VYTA 4CUKA 4ER0A 2R65A 1L1QA 1Z83A 3DDNA 3N2ZB 4EEXA 2QRUA 1MRZA 4ZMBA 5HXAA 1RLUA 1TM5E 1UZNA 2ZTNA 3OIYA 3UV3A 4D8WA 2IV2X 4M0DA 1FYXA 3VSBA 4IWYA 5JSYA 3ROTA 2IZ0A 1Y4UA 1ZX1A 1KU0A 2VP2A 2XCQA 1JECA 3HGTA 1VQ7B 2P9EA 1T0BA 3G1TA 3K20A 4HMPA 4WVLA 4CLDA 2BONA 1AUOA 3B3GA 5AVTA 3UG7A 1E9RA 4N40A 1E4EB 4F4DA 3NNNA 4OQXA 4F2GA 1ZA1A 1UKBA 3CF2A 3EEYA 1RHRA 3GUHA 3HXKA 4RVSA 2WHPB 2P62A 2WW8A 3PTAA 3MUEA 1D2MA 3RC2A 4UDNA 4Q7LA 4A8JA 2EW8A 2ZUWA 1GUYA 5F5XA 3EYAA 3ZCRA 4Z5XA 1ML3A 3LC7O 2F3QA 4RD2A 2PRZA 4B3GA 3BILA 4G4SO 5IUKC 1LDYA 4BZWA 4WXHA 1UK9A 2COEA 4KRXA 4HKTA 4M9XA 2ZGVA 2AUTA 1ZM2A 4J90A 1II8A 3OZEA 1TA4A 2JIPA 5KJCA 1GKIA 1XZJA 2QY6A 3QLUC 4R3WA 3EPKA 5YASA 3STHA 4DCPA 4RPLA 1YE5A 3RTCA 2I6QA 3VKFA 1UJ4A 3EMBA 4TV8F 3HR7A 4TTIA 4DC0A 3LFHA 3LP8A 4X60A 2BC9A 2VPQA 4B6PA 1B42A 2N0SA 4C0WA 3OZBA 2HPZA 5LYJF 1B26A 1FTNA 3A2MA 2VK8A 3NVKI 1ORTA 2I6SA 3PXCX 5F1OA 2WSSA 5LOVA 5L3SB 1EVLA 2OUIA 4GOLD 3GYGA 3NONA 1B73A 1VHEA 2QTLA 2DWUA 2Q3BA 4XJSA 3KCQA 2IYTA 5CDFE 5ERGB 1G5QA 6NULA 4GL4A 5EL0A 3Q3IA 1RP7A 3HWRA 2HSZA 3VJMA 4MAAA 3COPA 4TKUB 1F5NA 2VPIA 4AN1A 4XWOA 4DLPA 3RO7A 3HDYA 3WB2A 3AP1A 3BXZA 1XCPA 3M3HA 3AR2A 2H9AA 1Y9ZA 4QUIA 4CI9A 4EZIA 4M37A 3HVIA 3HVUA 2B1GA 3K5HA 4IDFA 4YRAA 2QW0X 3ZWMA 1W0CA 2SICE 1ZAKA 3BE4A 3DT6A 5BMVA 1E5QA 1WHTA 3H11A 4BFYA 4HIZA 1KYWA 3G9ZA 3QUSA 3FNRA 3EX7C 5CLFA 2W2LA 1GZVA 4MVJG 1GTSA 4WFKA 2Q29A 2IYWA 1N8RD 1CWUA 3UYKA 2ACWA 3B78A 2Q1XA 3PC8A 5K0FA 2ZJ0A 3CVJA 1UZUA 4QG3A 2ZFUA 4WKGA 5ENZA 1VL2A 1XEXA 5FBQB 1VPWA 4BX8A 1P1KA 2AC7A 3Q3VA 5F7JA 2HRZA 1JU4A 4WGGA 4MUKA 1SOMA 2Z6QA 2GUWA 1NVUQ 2HOQA 2V31A 1HVXA 1IEQA 2C5AA 4B47A 3SI7A 1NC1A 2P2LA 3Q6IA 2WF9A 4Q4LA 3SF0A 1LBSA 1C41A 3NANA 3PFIA 2A5FA 4P38A 3U48A 2UXCB 1DKOA 1J2JA 1N8KA 1HSZA 2B99A 2WV9A 2X77A 1X94A 3LXUX 3PIIA 4G8BA 5ILGA 2BI8A 1FW6A 4PYKA 2F3UA 4UUQA 5F4OA 2NU9A 1JMYA 1V1RA 3P9NA 3BMCA 3QUCA 2R1UA 5CW1A 5HCIA 1XMPA 1Z5VA 1KPIA 3GZTB 3R0XA 5B3AA 1PZNA 2HN9A 3X1KA 1RXIA 3IOMA 3NTXA 4QU9A 1T0IA 2NUAA 3AERA 3QV2A 1E69A 5BWMA 4ROXA 2RHRA 3L4KA 5ABPA 1TA0A 1KTIA 3G0IA 1G3RA 1S2DA 4PIMA 2R6HA 3T54A 5IVPA 2GD0A 1W9HA 2XXBA 3R0ZA 4PSAA 4I5IA 3PL5A 4UXIA 5FRDA 3ZW9A 4EUNA 1N2SA 2WIFA 2PIDA 1KO4A 2QRLA 2E4VA 4K9NA 2J6HA 2NTNA 3NUQA 4WK0B 2OXFA 4K9LA 3Q7SA 3B9PA 4Q16A 5AVRA 1VJ1A 1SKQA 4HGYA 1G7TA 4X71A 3ZPXA 3C8UA 3AMVA 4DY6A 2DMRA 2Z8XA 5KPJA 4C7XA 1YV9A 1C8KA 2HRBA 3A9CA 1BDHA 3SGLA 2JIZA 3D6NB 1SELA 2C9CA 4MDHA 3ER6A 3KKZA 4K2HA 2AUNA 1W2HA 1XMIA 1LGYA 1E5LA 3ELYA 3AHFA 2CUKA 1XTTA 5ARCA 3RTAA 3TWOA 1CUAA 4BMXA 1T3HA 1DOHA 3FPKA 5EJ4A 2WEKA 1VSVA 2OCPA 3L1VA 1YQEA 2YYYA 2C0PA 2DWCA 5FWAA 3H5IA 1U0RA 2IZ5A 4PFQA 1GGMA 1VE9A 3T1VA 4FEAA 4KBGA 3R7NA 4F0JA 3FHLA 5CTAA 3SHQA 1Q1NA 3BKXA 4WCDA 1WB5A 1ZDMA 2J6IA 4HRVA 4WZBA 2WQ7A 2J9FB 1K97A 3ONVA 5AKKA 4ARAA 1KO7A 1RJWA 3RK4A 1IVYA 2WWHA 3FFWA 4FFLA 4GU5A 5H3LA 4C4AA 2OB1A 1T2UA 3H2IA 4L8YA 2V6FA 4R0VA 2ZXFA 4RLFA 5GWXA 5C9ZA 5KYUB 3UOGA 4B7CA 3PUIA 2C2YA 2FWIA 1IN6A 1P1HA 1X1EA 3PRYA 1MOSA 5CVVA 2VOEA 3WLOA 1UUFA 3HYCA 3UB2A 2BMFA 3BFVA 3KWFA 4YMHA 2F8TA 4JXKA 4OPMA 1C9KA 1RAEA 3BWVA 1SKMA 1RAFA 4QX6A 3JD3A 1TFUA 1VP9A 1I4WA 2OM2A 4Z8YA 2QMUA 2EL9A 4JI5B 3V1UA 4FMCF 4FX2A 4J7XA 1HYBA 1TF5A 4UVGA 1FS5A 2WFMA 1HDZA 3B1YA 1Y9JA 1BMFD 2UDPA 3PWKA 4AWXA 4C5AA 3KK0A 5A3VA 1FP1D 2F62A 2ZSFA 2Q5OA 2QZ9A 4BRWA 3BRCA 1B8NA 5EHQA 4UNQA 1DNPA 4BNYA 1OILA 2DHQA 1R6BX 2R2AA 3WWYA 2PX2A 3EXHC 3M9WA 5I9SA 2I8CA 4YDHB 4Q02A 4XJVA 5AR1A 5A03A 2EEPA 4ZTUB 3RUEA 5C1OA 2VXYA 3CO0S 2PD4A 3N6RA 3MGGA 3PE6A 3QUQA 4US0R 5AK5A 1RYHA 1PJ2A 2R25B 2SBTA 3AM5A 3EBOA 2I2AA 4MP8A 2IBTA 4JOQA 4C76A 4F06A 2NO6A 3D6TB 1HDCA 4LE2A 5B36A 3ZEAA 4FYVA 2AW5A 1AO3A 1X1BA 4Y9SA 3FLEA 1FFAA 2Z58A 4QDJA 1UMCB 2PKEA 3NBFA 2AZMA 2QAGC 3IVGA 2AZ4A 2JCXA 2XDQA 4BUJA 4HN4B 4IEEA 3BMCB 2BFCA 1NQVA 2H92A 5TF0A 3F3MA 4EY8A 1HT2E 1UMKA 3IDAA 1JB1A 2GO7A 3T34A 4NZZA 1XQWA 1OFVA 3AM4A 3IVAA 4E15A 3P2JA 3DV0B 5LL6P 4ARZA 4PHHA 4C0JA 1NIPA 3M6WA 2C3YA 1Q77A 4FCVA 4QYMA 5EC8A 2BFFA 2WHEA 1USIA 5TQJA 3TN7A 2HJHA 2WFLA 3VAAA 4ARCA 3G71B 4AB1A 5GPBA 3L0IB 5DYTA 2FQQA 4N6NA 3HSYA 4DLUA 4RHTA 5FH9A 1KY5A 1RNLA 1CQJA 1PUIA 2OD9A 4JA0A 4M0KA 1WXGA 5HE9A 4ES6A 4LI0A 3R0JA 1V4VA 5BWLA 4R1LA 1JDTA 2FLVA 3B6IA 1KE2A 5SZIA 2HADA 3U9SA 2WUVA 1APBA 1P0PA 3UJDA 1KMCA 1XF9A 3CU5A 3NALA 2CBXA 2ST1A 1QO7A 3GDHA 3QVXA 4MUHA 2W6OA 4JOCA 4XM2A 4L8LA 4EVSA 4RA9B 4O4HB 5IDVA 4LMPA 3KB1A 5EUQB 1DZ3A 2ZRJA 3D8RA 4MIYA 3PFBA 5HE8A 1HNWB 2GWHA 1AUVA 4FDMA 4EPTA 3EWAA 1Y3HA 3KL4A 1WXIA 2YRFA 3WFIA 3GJRA 3I64A 4ZWNA 5AW8A 2ODQA 1L7BA 2Q5IA 2YWBA 1S3SA 1M2FA 3CC4B 5JAMA 1QHHB 5JQGA 1Q5PA 3O4RA 4LJAA 1M9NA 3OCUA 3W2FA 3WK5A 2VF8A 3CCJB 1H5NA 4V39A 4A7PA 4REOA 4DLNA 2I65A 4P4GA 1YDWA 2D5BA 1DTSA 1JDJA 1X39A 3R5HA 2HU2A 3EIQA 5F9HA 2DQSA 2FSPA 1AV6A 1JXQA 2XT0A 1QNLA 3IKMB 3QFTA 3ZI4A 1X7YB 2PMEA 4CT5A 5CT8A 4M1SA 5A4IS 1JS1X 5CVCA 5C81A 4MIKA 4Z4SA 2VTVA 1UC8A 4O4JB 1B43A 1JHOA 3AVPA 1TZKA 3IIMA 1RLJA 1YRHA 1PQPA 1MJGM 2DWPA 3TCKA 3I62A 3FH0A 2CFSA 1ZJJA 4JNCA 4RKFA 3I9MA 3OJFA 2G0TA 5IYQA 3GLQA 2J4FA 3U60B 1XBTA 3SSMA 1GSHA 3E22B 3HWX1 2WVAA 4Q3LA 1C2TA 1TYEB 4F71A 1DV2A 1JTEA 4INPA 2IP2A 5H83A 2EQBA 1NT2A 1UK8A 1F12A 3CCFA 4ZYVA 4MCJA 1I18A 4LBZA 1HUQA 3G0GA 2XKJE 3ECAA 1R4NB 3PGKA 3WRXC 5HKKA 3QPDA 4I8XA 4MYRA 1N5RA 2FDCA 4FE3A 4RK0A 1UKVY 1GFWA 2GBLC 2ZIEA 2QL6A 3EG5A 3KJIA 3RAJA 1RIIA 1USVA 4BX9A 2IU0A 4RU1A 3VKGA 1XCOA 4MVJI 2NP7A 5ALYA 4UU7A 3PUKA 3WI7A 1PT5A 3K0CC 4NXNB 3VKHA 4P3OA 3ROQA 2P68A 1M83A 1D1NA 2O8VA 4JEMA 5AI9A 2V7XA 3BIJA 2OV6A 3ZHVA 1OH5A 4L4XA 2LCQA 5KIAA 5HDBB 1NDHA 1A5TA 3B9RA 2AFIE 2VP6A 4OFBA 1PJZA 3OTIA 2IRWA 2VHCA 1OMOA 5EIAA 1QYCA 2EU8A 3CE9A 3WL8A 5HF5A 3MT7A 1JEYB 1M8JA 3M89A 3BH7A 4GR4A 4XLZA 3TB4A 4IIGA 1NMYA 1O5TA 4JT2A 3BXXA 1P0QA 4D0NA 4EO7A 4DA4A 1GM5A 2EWWA 4Z3DA 2VH1A 4CODB 2L82A 3SLNA 2A33A 5BV1A 1IXRC 4CG3A 4QZVA 3BD9A 1J0BA 1G21B 4NHOA 4GEKA 1EKXA 2A5YB 5HIJA 4FK8A 6PFKA 1KOFA 3P94A 1MORA 4R2MA 1V11B 1LVHA 3A9WA 4BV8A 4HNAA 4EGFA 2IE8A 1JXAA 1Z07A 3DDSA 5H81A 4KVZA 4QM6A 4PAAA 5EE9A 1R00A 2D2EA 1G8KA 2HHCA 2L18A 4P5PA 3EUFA 4HNTA 1YH3A 4II7A 3LVFO 4BP8A 3LZ6A 2A9JA 4YCSA 4B44A 5CFPA 4I8IA 1BX3A 2GBCA 1FXWF 3NRCA 3Q3JB 4LISA 4MR9B 4N7BA 4PYOA 1SVKA 1U2GA 5DNDA 4CU2A 1QGDA 1NW6A 1XFOA 2AJBA 3TNYA 4H6XA 2RSLA 3AHJA 4J4TA 2VSXA 4CN8A 1M6YA 3MZ0A 3WC4A 4CMEA 2V74B 2P0AA 1MAVA 1DXOA 5FYQA 4NC9A 2BR3A 3TZBA 2E85A 5DH9A 3K96A 3KD3A 1SK8A 1ZEJA 2VNKA 3W5VA 1Z17A 1ZNQO 3NUZA 3R5TA 1E3TA 1ZKMA 2NQ8A 3E15A 1XVIA 2FFRA 2ID7A 2QTWB 3FCOA 3MIZA 3PNOA 4H7KA 4UVHA 3SU8A 4BKUA 2VPPA 4RZXA 2VH5R 4ZQCB 3AL3A 3AR3A 1HFWA 1EGQA 2DY0A 2UUOA 1S5PA 1QGYA 2GEJA 2B83A 3KYDB 1CZNA 2GCPA 3AVOA 4B4VA 4C43A 4KODA 1EM8A 3ROFA 1R1DA 3WJ7A 5IBQA 2AN3A 5CCXA 4HXFB 1BVUA 2CY0A 3H9UA 4AVZA 3VHXA 2ZYWX 3BBPA 4KIWA 2IWHA 3A1SA 3BMXA 4TMFA 1XHLA 1AM4D 1L7PA 3MPUA 4GE0A 3R74A 5E6UA 5AUNB 1HYQA 4P0QB 1D2NA 2YZNA 3AG5A 2B4TO 1KYIA 3JQAB 5LWQA 3RYIA 1AO0A 1E3LA 3TUIC 4E5MA 1YU6A 2ADMA 4IIJA 1QRRA 1BX0A 4PICA 3ILYA 1VKJA 2AG1A 3U3XA 4YPOA 4U8HA 4MNTA 3LPNA 1AQLA 1Y7TA 1JEQB 2O7QA 3C45A 4IKPA 2HTFA 4RL6A 3T12A 3TFOA 2DJ5A 2QW1A 3BRQA 2Q21A 3AI1A 1BW9A 4YO8A 1M0EA 2ZI4A 2BFPA 3GVHA 3O8NA 3BQJA 4FDVA 3GCXA 3MTIA 4C4ZA 1W0JA 5JAUA 3UH0A 3QJYA 2HBYA 1ATIA 1E94E 1QE0A 1KAHA 3ADOA 4DEYA 4MVCA 1E1MA 2DTXA 4MHOA 1G9TA 2JBHA 3EUWA 3UPUA 3K0FA 5KJEA 3D6FA 2WQ6A 1Z6YA 2REXB 4ZOLF 1Q86D 3Q5DA 3BJMA 3M6LA 4LWQA 1YRQA 1NFQA 5BUSA 2ZI9A 2CLOB 4K87A 5ICSA 2CK3A 4XJTA 5IYZF 2VP0A 3FGNA 2JBAA 3C6QA 3PEVA 5FI5A 4OXIA 2WU8A 2ZT5A 2IUYA 4KHPB 3W2EA 1S0UA 5JHGB 1HY3A 2JA2A 2UVQA 5JAOA 4QTTB 3AXTA 2RGEA 4QGGA 4NCXA 4QRIA 4KYUA 3CR7A 3EZ7A 3MMSA 3JV7A 1XO1A 3GLUA 4WZBE 1KZHA 3VVBA 2XITA 4I81A 4KYVA 4XD2A 3ZU5A 3QVLA 4Y2YA 5AUPB 4HUQB 4CL8A 3PEEA 1QQ6A 3LL4A 1VSQA 1N5JA 3GHYA 4ZVPA 2HREA 2AEFA 3K0CA 3U0VA 3FTCA 1JHRA 5GONB 1JF8A 1SA0B 3DCIA 3BBLA 3F4BA 3GDFA 4JVMA 4MQBA 5D3MB 3WYBA 3WIEA 3EFBA 4GBMA 1OAAA 2GRUA 4OBBA 4IJKA 2AWOA 3E1SA 4WESB 2QSZA 1L5GB 1JMVA 5I7HA 3WISA 2HK8A 3GGSA 1MQ9A 1YB7A 1VMEA 3OBBA 3CE6A 4DWWA 1P39A 4QQ8A 4XWYA 4BVGA 4Z4IA 1I80A 4BVJA 3GX1A 3EZFA 3H6HA 3DXXA 1A9SA 2K2WA 3HJUA 1AB5A 3HLKA 3KOZA 3NDRA 3CKMA 3O2NA 4BY9E 2H48A 4EZBA 3VPBA 4G0YA 4H1TA 4ZJYA 3COJA 4GT1A 2X5OA 3N2YA 4LZZA 4UEQA 3GZ4A 1XI2A 3FOCA 5KX5A 4KOEC 2DX7A 2DQYA 2BZGA 4ASUA 1JG3A 3OF3A 4HAYA 1P61B 4NOJA 3REFA 1I3OA 4GGMX 4DE5A 1R6AA 4X94A 2W6ID 2BGKA 1JQBA 4XVQA 3OZXA 3ETLA 4HX9A 4AD8A 5CYGA 5BWOA 3PHJA 5FUMA 2P4QA 1MJNA 4IBOA 2YWHA 1QIGA 2I22A 4IDOA 2IEAA 2AL7A 4JGIA 5CHEA 3RWMB 4G4JA 3CRW1 2OHOA 4H3VA 2BJHA 4X6UA 1ES9A 4KAFA 1A5SB 1RTTA 4HVLA 1KVRA 4D0SA 2YVUA 2HDNB 1Z8NA 5AK3A 1ZK0A 2PS1A 4JODA 3QIVA 3QVWA 4CGZA 5AVWA 2P3OA 1XQ1A 1Q0RA 1DC6A 2ZSKA 4QPDA 3G13A 2BGIA 4HXEB 3NIWA 3FNBA 1H9AA 2BMVA 3T5DA 4GG1A 4LJRA 4CKEA 1GGEA 1RI5A 3J80A 2H1WA 4MS1B 3WGZA 1PDOA 2D0PB 4LZPA 2QN6A 2HJRA 2IHYA 5HQ3A 1L4MA 1B3BA 5C53B 4LX0A 3T1HB 7REQA 2VQSA 1X7WB 1JXOA 5EKDA 3TDMA 2D0OB 3K4HA 4B82A 2PWBA 4MYUA 3QMMA 4FYHA 4KDRA 5I4IA 2REBA 1YIJB 3ACDA 2HLNA 3HJBA 2XYGA 3FBTA 3QKUA 3UT5A 1R10A 2GYYA 4DN6A 1VHWA 3RY8A 1GTG1 1G8MA 3A8KA 4F7DA 1AX9A 2I1VB 2JFBA 3CZ5A 4G0PA 4LQDA 1JNXX 1JR4A 3NHWA 5KNBD 4OQLA 1T4DA 4BX0A 4FFVA 3W9UA 2CHUA 2UU9B 3B2NA 4JR2A 3OE7D 4LRYA 5NULA 3DFFA 2DKFA 1SBYA 4OQPA 3GHHA 1M34E 1GPMA 1YCGA 4I55F 3L7DA 3CKKA 4XLEA 1T2EA 3GDGA 2GOYA 3PGXA 3U6KA 3OTHA 4YACA 4N9WA 5EJ2A 5EMLA 3QF4B 4EIWA 2YVKA 3Q7EA 3EQ2A 1N1DA 1WX1A 2Z6VA 2CCGA 4E5SA 3BERA 2C92A 2CB0A 4M1KA 2EP5A 3KM0A 2W6CX 3C8DA 3KFVA 4E33A 4EY7A 2FXIA 3DMDA 1DQNA 1PGOA 2I29A 1KEZA 2CYAA 3EAQA 2ANCA 1JWBB 2WNSA 1ZN2A 4MULA 3UK2A 3WWPA 1A7KA 3OIGA 1M67A 1T4MA 2YWEA 3MN1A 4I4LA 5HBGA 1ITZA 3T5CA 2FWNA 3X2EA 4CJXA 3JQQA 4B4DA 3JSAA 3EA4A 1DTEA 4YRGA 4YV7A 3OEHA 3V2UA 2HA2A 1SNYA 3K0EA 5EMHA 2H11A 2I2BA 1U7PA 3NWBA 1SZCA 1ZQ1A 3HGMA 5C8VA 1Q3KA 4YRIA 1LW7A 3E2MA 5KTYA 5EJ9A 4G0WA 1C4WA 2WI8A 4JFRA 4WD3A 2QRKA 4ND8B 1IWBB 2V7WA 2ZJAA 1X15A 2YOFA 2ZE5A 3EQ8A 2A30A 1PEDA 3GAFA 3NW9A 3I9JA 3FTEA 3HPRA 4YWHA 2ZT7A 1KY4A 3FNHA 1PYGA 4HGRA 5EXSA 2BH9A 1DLJA 2FW9A 2H4JA 3CLHA 4ITRC 4EJ2A 5L3VA 1YFLA 2RHJA 2X5KO 3GNSA 2B3DA 5IC4A 3S1AB 3OC0A 4I50B 1U8EA 3EPRA 1GXSA 5CNMA 2AN1A 3NHZA 4YQEA 3GLRA 1K86A 4J16C 1DX6A 4HPWA 1NN3A 4JS0A 2F59A 3GJTA 2V6MA 1G18A 3DVAA 1Z8FA 4M60A 1E2MA 3BORA 2QE6A 3FBWA 1UKEA 1TUGA 3KBBA 4QPZA 3RANA 4CDRA 1L7QA 4R16A 1MT0A 5ADHA 2DBVO 4B7ZA 1QP0A 2AGVA 3PWSA 1CXZA 3H6GA 3JQAD 4ZK2A 3QM1A 1OY1A 2WJ6A 1YJNB 1TW2A 1V0JA 2DF8A 3EGOA 4FP9A 4IV8A 1DAMA 3NPAA 4JQZA 4UD6A 1E8MA 4ZPXA 3NATA 2ZJBA 5E4YA 5AP9A 4CM8A 3PFNA 5CG2A 3LGSA 3VU9B 3R5FA 1J4AA 1LPAB 2X5XA 4CF3A 1Y5NA 1XDBA 2WAXA 2QTCA 1G6KA 1SOAA 4FDUA 4DNXA 1P73A 2PLWA 4LF6B 4IRXA 3GP3A 1OYVA 3Q10A 1K6MA 1FXSA 3AW8A 4IEFB 1HI9A 2JNWA 2IYUA 5F52A 1DIOB 1IY0A 2BMJA 4RH1A 4WECA 2IPMA 2CL0X 5THQA 3DV0A 1MOPA 4KPGA 4C1NA 4FFBB 4PO1A 2NIPA 3B82A 3AUKA 1K27A 5GVRA 4RHYA 4IV0A 2Z3WA 2O5RA 3IBSA 1XVLA 4PNHA 3B8HA 4ALJA 2JD1A 1QGOA 2LPMA 1PJ5A 2GAJA 2PDAA 3ND8A 3UW3A 4ZAGA 3OTWA 4HWGA 4Z1OA 3I01M 3N87A 2VJPA 2XI4A 2FR1A 3ENQA 1GNVA 3HJGA 2IYOA 4MVJM 4RDLA 3WDLA 4TTRA 2F48A 5K20A 1E79A 1JRLA 2HSWA 2QUHA 4U0KA 2A5DA 1KORA 2ORWA 1UD2A 3KQSA 3UJPA 2RHGB 1MRSA 4NBSA 3M5WA 3HR8A 3EOZA 2E18A 1CETA 3QE0A 4MRNA 4PLTA 1YRBA 1XAHA 2ZUUA 3CT4A 4ZALA 1VJSA 2QTZA 1FDUA 1NASA 2GEDA 3HNRA 1AA6A 1N08A 3D3JA 4PSDA 1ID8A 4QOSA 3GLIE 3H5RA 5DK4A 1YJQA 1N1EA 4J16A 1F17A 2Z83A 1JH8A 2EQAA 3A7DA 4MTCA 1IB6A 4US2R 2O19A 2B20A 2E0IA 1Z39A 3AR7A 3JVVA 1T0HB 2RGUA 1RQNA 3FYUA 4CEJB 1JT9A 1IEWA 1THZA 2IHVA 2HIMA 4P82A 4PFJA 4PX9A 1VC2A 1ABBA 2V7VA 5AM3A 2E1BA 2WR8A 4IH4A 3TD6A 2HC9A 2ZDGA 3ZDQA 4DLRA 5BV8A 3L9XA 5CVDA 4A03A 5LQNA 3GLIA 3UFXB 3UVEA 2IS4A 2VAWA 1C7FA 3MAAC 2HA6A 2KHZA 3N5CA 3ND6A 4FNAA 4OQ4A 5EG5A 4YH1A 3M9XA 1G21A 2KS6A 2QN2A 3QYFA 3QF7A 4U5QA 3SX0A 5HRCA 3CISA 1AE1A 1GKKA 3CVYA 2BGJA 1CLUA 1R8SA 3R6WA 1UBMS 1NQAO 2P2YA 3ZS9A 2M2IA 2C4KA 2B1IA 4GMKA 1GGNA 3JPYA 1GPUA 4OU5A 4E2YA 5AKHA 2DT8A 4KAXA 2YWJA 4OCZA 1QGUB 3FUUA 4ZTBA 3WGOA 2O06A 4EQZA 1WPCA 2OHHA 3A4NA 1Y0RA 3P5SA 3F7OA 1W25A 2IOFK 3E3MA 1KOLA 3WG9A 1LTQA 1XRNA 1S2MA 2XE4A 3DOHA 3Q39A 1I1HA 3B20A 4QO8A 2DERA 2NTJA 3Q1KA 1HZJA 1WCV1 4FMDF 1BNCA 1JFVA 4Y9RA 1PJQA 1TOAA 1WY7A 2Q9AA 3C5HA 1BMDA 4NYMQ 4BMDA 2YINC 3DYBA 3ROEA 4ENUA 1EP1B 3LDFA 3NVMB 1Z7BA 3I9OA 4WXEA 4YJFA 5CYFA 3OE5A 5BMVF 4NZMA 3P0JA 3F3SA 1YL5A 2PD3A 4XTRA 2NYVA 4X1KB 1FA9A 3U1TA 2QWXA 4QYSA 5EJAA 1P74A 1D0IA 2V1UA 4UARA 4MB2A 4RESA 2XTAA 4ZOCA 2VA8A 4W82A 3RAPR 1AGXA 3MOGA 1MXHA 4MW0A 2FWAA 5EMJA 4YC7A 4BVHA 3SFTA 3CR8A 3FMOB 3QFCA 1AHNA 1O58A 1DIHA 2J9RA 3L6UA 2CEKA 2GZ1A 4XM1A 4N01A 5AXAA 1P9RA 2WJAA 1JQDA 2ZAOA 4Q19A 4WERA 2FN3A 5EXEA 1NW3A 3HS3A 3JD4A 4X20B 4D0LB 4DMUB 3GA7A 2KPOA 2MYPA 3OU6A 5FP0A 3T0IA 1XRQA 2J3HA 1KJ9A 2WICA 1RRPA 4M8LA 4YEJA 2GA9A 4ETIA 3I3SR 4Y6OA 2G67A 3ZWCA 2F4VB 1COZA 2Q0SA 4RANA 3QTTA 4ZQEA 1TA9A 5BYBA 5WRFA 4NNPA 2XBUA 5SICE 1J0CA 5CVEA 1HURA 4J91A 4DNOA 1DKMA 1W75A 4HH1A 4QYIB 3MTJA 1KDTA 3AKDA 1UM8A 1YVRA 1K2WA 4K6CA 3W8NA 1PJ3A 1FL9A 3T6KA 1Z2NX 5FBWB 1VXRA 2UUCB 1XZAA 2WF6A 5ITWA 2QPAA 3AUUA 4P8RA 1LRKA 2A3NA 4XFDA 3RRXA 2BBSA 3E5NA 3JWEA 4BVAA 2D1RA 2J3IA 4P3XA 1HKHA 2A6PA 2YWCA 4GICA 3JQBC 4HLDA 2XDWA 4NVRA 4KRYA 1EUCA 2RGGA 4EHAA 4ZZ3A 1G4HA 1H65A 3CVOA 1BH6A 1DQYA 3V4FA 2RB4A 1G6Q1 3INRA 1XFDA 1KMIY 3NP7A 4M1TA 4MUJA 3EAFA 2BUCA 3B1VA 2AMFA 3NBAA 4K6KA 2VQFB 3T52A 1EWRA 2V7BA 3ZY3A 1OH7A 4Q37A 3GQBB 2ZBUA 3VDMA 3T7SA 2IZ1A 4OFZA 1BU8A 2VS1A 3D2LA 1MO6A 3ZQKA 1CB7A 4HWPA 4Z9YA 5EZ6B 2R96A 3RRYA 1AQIA 3BIOA 4PC7A 3C8MA 3I9FA 4OOXA 1VIMA 4TXNA 3WQSB 3P9CA 2RIRA 2J9ZB 4LJKA 4YLGA 4D4KA 5DMXA 2WWGA 1X1DA 2X8JA 2RAVA 1NLZA 4AX8A 3C3AA 2GJ4A 3KD2A 2WFLB 3KZVA 1RACA 4CQLB 3GJ6A 1KJNA 3MINA 5J23A 1Z4MA 3VU9A 4GM4A 3OLXA 1NJ8A 1O95C 1SEPA 3BCHA 3BGVA 1JEOA 3NTQA 1QGZA 2GJ9A 3CLUC 4BX2A 5TMEA 2V7QD 2H1CA 3IBCA 3PYLA 4J6FA 5BUZA 4TRNA 2VQ3A 4H7EA 4CIDA 1DPFA 5DEIA 3SHFA 3TLJA 3EEOA 1QRAA 4P4UA 2EKLA 2BTOA 1JE0A 2BE9A 2YASA 4H1VA 1PG0A 1Y8CA 2FPUA 5HTOA 1ZU4A 3IPXA 3OOWA 4B31A 1NHWA 1YZUA 3CQ9A 3A2KA 4ZAFA 3QFRA 1GN9A 4RD0A 4YT8A 5D2CA 5ERXA 3ZS8A 1XZIA 4D98A 4HB0A 2YOHA 5IVIA 1R6DA 3D6MA 4J0DA 4R98A 4Y0NA 4J0CA 3TDNA 4Z7JA 1ZSYA 3ADPA 4C0BA 1BGXT 1JI0A 1NXOA 1U90A 1JG1A 4UUNA 5JFTA 3TDKA 3EZLA 3D54D 1EBFA 3O4IA 3VPGA 3R2JA 3K5PA 3CB2A 4KDEA 2JIQA 1WSRA 1C7IA 1FDVA 2QAJA 2RG1A 4QULA 3L02A 1IJBA 4WWHA 5DHRA 4Z8XA 2NSYA 3ME5A 5KC8A 3HO1A 1Q0QA 1VRCA 5HJ2A 3H1GA 3HVHA 5ICGA 2ZUBA 3NXSA 1R8YA 1V7ZA 5EKTA 1TYAE 4HN9A 4HTFA 4YI3A 1KVUA 2W2XA 3EEBA 1WMDA 3GI1A 1UQUA 3N7AA 4MO9A 3PEYA 3A4LA 5JD3A 4LWZA 1L3IA 1M2EA 4JYCA 4FE4A 4QBIA 1U81A 4MDYA 2G82A 5JECA 1KMQA 1WM1A 4R8MA 4OOSA 1GU0A 2CHEA 2DFPA 3DP9A 4DA6A 4N0EA 2OMEA 2ASVA 2HJSA 3PUXA 4ZAYA 1Y5LA 4HPJB 5DS0A 1MIHA 3E9QA 2RJNA 4QGBA 4TUYB 4N3NA 3T1OA 3KPJA 1CK4A 3GLVA 3EW9A 3HKCB 1DKUA 5IJXA 3T1QA 2IEBA 2JDIA 3IXLA 3ZBPA 4Q4AB 4NOLA 3P9RA 1P6QA 4JLKA 4ZIRB 4QVIA 3UB4A 3HB4X 1MC5A 3JYNA 3A3NA 1ARZA 4RYDA 2B0JA 5DLDA 2GDJA 2R8XA 2RKWA 3PL1A 2F90A 4K9QA 3QVOA 1I94B 2WJ4A 3G2NA 4M88A 1V5WA 2PZFA 5G0TA 1GVNB 1VQ1A 3C8HA 1J42A 1C29B 2P6MA 1JAHA 3KELA 3WE7A 4WESA 4YMGA 4W9RA 1E1LA 5A3SA 3EFOA 3U7HB 4ZU1X 5C5IA 4TV9A 3VPDA 3QKWA 4NMLA 1W36D 3V42A 1NVFA 1LQUA 5JS2A 3MELA 1JX6A 3UC5A 4FOLA 1ZONA 2ZWPA 5E3IA 4U2GA 5KCMA 4H4EA 4KWHA 1VLMA 4HDNA 2OPHA 1EDOA 1RCTE 2XUFA 4YJFB 3WYAA 2EG9A 2RAUA 2I2XB 3C6BA 3Q0EA 2BKAA 1DQRA 3RIGA 5INTA 2W6JD 3SC6A 4EUKA 5HA5A 2I6UA 3LUBA 4YJHA 1WHSA 1Z25A 2P65A 5K8VA 2GH1A 4KIGA 3UC9A 2D62A 3B12A 2OG1A 3N0WA 1FTQA 3RKUA 4NAUA 5IN4A 3AF6A 4L1KA 4WKCA 1KZYC 1SBIA 1RQLA 2VNJA 4A27A 4UTVA 3AHEA 3SHTA 3O2SB 4NE9A 5B4VA 1EFPA 5D00A 1A2KC 1PZEA 2GD6A 2FSIA 5FNZA 2W90A 4PAGA 4DQXA 4YXFA 1Y6FA 3V7WA 2GXAA 4XB1A 1E1CA 2VJDA 3RUPA 2ZJ6A 3FTNA 1OWMA 5H0IA 2YJ4A 2Q2NA 3E9DA 5C4MA 3R76A 3D1LA 4AZ3A 3QY9A 5J35A 3AK4A 4F2DA 3TBKA 2XQGA 4JLPA 4J3NA 4RLZA 1NVEA 4HAXA 4IJMA 1HT3A 1YCHA 4YP5A 1PNVA 1KI1A 1MO4A 2L0XA 4QTZA 1A4XA 1QU3A 5FBLB 1BXGA 2XV1A 4BO7A 3QITA 1AHIA 3O4JA 4IEIA 4YJ3F 1H05A 2CCKA 1M2OB 4ZHQB 2IITA 2HWYA 3NPMA 3THYA 1NB9A 4QYIA 1NC3A 1FXUA 4B6SA 2NUBA 3ZI7A 5DFAA 1P0FA 3FUVA 2PGXA 3C39A 4U00A 2J3EA 1VG8A 4MRAA 2QD3A 3E03A 3P2KA 1YDFA 1W4RA 2ZQZA 2D5CA 1WPQA 1Q7CA 3FFBA 5KWSA 5EWLA 4XE5A 2VG8A 3Q0TA 4XWGA 4EJSA 4G23A 1DAEA 2H1OA 3IILA 1E0AA 5K8CA 2CJWB 4P81A 4BHTA 2ENUA 2QK4A 3ANSA 4HE6A 3D2BA 3PNBA 4OBWA 4HAVA 2AMVA 1IVSA 1CF4A 4S1OA 2VBVA 1E2QA 1PJLA 2YHUA 1HFEL 3JVUA 3QVSA 1OFUA 4X6XA 3W5AA 1L5WA 3BE8A 4JBHA 2IYXA 3EQ6A 1Z0DA 2AXNA 3O0DA 4XIIA 3EZ6A 5FV7A 4BIIA 5CGQB 4XI9A 3IKTA 4JQCA 4G5FA 1CJBA 1E98A 4LDQA 3LBYA 1P1CA 3P2MA 4UU1A 4ZO8A 1LTKA 4M53A 2FMUA 1FS6A 3GPBA 4O2RA 1IHOA 2GX6A 4G8CA 5IUJC 2VZ8A 1TVCA 1KJZA 3FKSA 2AF4C 2X7JA 1Y1TA 3AUSA 4F4UA 5H7XA 3I8SA 4JP1A 2FPLA 1YQDA 2XYPA 3IB6A 2VJYA 5ALTA 4EMBA 2W6JA 4HDQB 2OQVA 4HAZA 2ZPTX 1UQTA 2XMBA 1SC4A 1ZOIA 1QF7A 2C9DA 1FNSA 3CX6A 2FUEA 1SKUA 2X40A 1NYLA 2AEMA 2WU3A 2EWVA 2Q2WA 3PEFA 4UAVA 1W5SA 4OLFA 4JI3B 1RCUA 4M8KA 1KIMA 5LXTA 2PA3A 3AI7A 5KVSA 2HTEA 2IY9A 2MYNA 5KVAA 3RU3A 2O6HA 4HWKA 1HE5A 4IF4A 3T3IA 1PWEA 4RCYA 4XM0A 5EHZA 3VSEA 1UIRA 5CJ2A 4MV5A 2CBZA 2E7ZA 4MARA 3K0FB 1TZBA 4HEA1 2WG0A 5FHRA 2PT9A 3UICA 5K8UA 1HG1A 3ANYB 3C48A 2GJRA 1Y34E 2ESRA 3BEDA 2B8NA 3DMFA 2XB4A 3N86A 3GJ3A 2V65A 4P5DA 2IW3A 4XUCA 5EIWA 2VHUA 3OQ6A 3QYPA 3RIMA 1NIJA 3MYRA 3ZX5A 3LWBA 1E6MA 1S8NA 2J30A 4PPQA 4N41A 1I2AA 4N6OA 4FEGA 4HQLA 4V0LA 4CCYA 4JJAA 4MPJA 3DWEX 1MIOA 4ZV4A 5DHPA 3FDIA 3ICEA 1XCMA 1CS0B 1FSFA 1SXHA 1T0UA 3L1KA 4QQKA 5IVDA 3WKDA 3GMSA 4CHGA 4DIKA 5FOQA 3E5HA 5LN1A 4UD2A 2BM1A 3P9XA 4X66B 4DNRB 3FOWA 3PR1A 4Y1RB 2WWXA 3ROGA 1YI8A 4I5EA 4OYLA 5CNJA 4ITUA 3VDRA 3W3AD 1ESEA 4UMFA 3K1JA 3KR2A 3HXPA 2FHPA 2C2KA 4NFYA 4E2XA 4DJEC 4PCAA 4INJA 3VR6H 4TTAA 5B1YA 4KXWA 1OI7A 1ND6A 2HK9A 1N2XA 4V0ME 5HKAA 2DR3A 2VSYA 1IU9A 5GZ1A 4W5QA 3UWKA 4ZCLA 4M49A 3F7NA 4AO7A 1O4VA 3LM8A 1E3DA 1QSGA 4KQ6A 2A0FA 2WFAA 2G08A 3VZQA 3UJHA 3VRHA 3GVXA 4OI1A 1GQOA 3LHKA 3U4IA 1KYTA 4X8MA 2LNDA 3HDTA 2IX9A 4HLUA 4X7CA 4I1IA 4RDIA 3TMKA 5FAKA 3K8QA 3W9SA 3IEMA 1E7YA 2H16A 2HCRA 2C83A 1WF3A 3PDHA 4NV0A 2PE5A 1D7OA 3G0BA 4NZNA 3EPPA 2W0SA 3CUUA 4JP3A 3JZIA 4BASA 3GUUA 1GLGA 1JQ5A 3MJDA 2YHBA 5GIOE 3VAZA 5F98A 1W5FA 5CRIA 2W6IA 4M98A 5TJHA 4BBPA 2BELA 2CJYA 2ZBGA 1K1EA 1I32A 2GN1A 2ZITA 2VH2A 3CXUA 2Q4RA 1AXRA 1JIVA 4JVOA 1VECA 1UFQA 1FP4A 1TJPB 4BEJA 4FS3A 3BNWA 4LF8B 5LZ4A 3HB7A 3I05A 4BP1A 1ORVA 2JBAB 2OPBA 3DNMA 4MWOA 2WIBA 1EXWA 1MH9A 1PZHA 2BKLA 4NEHB 4PAWA 4BZZA 4E09A 3GP8A 3FVWA 4DDMA 5KVCA 3C74A 1ZD4A 1DC3A 3M34A 1VCIA 4JLJA 4MITA 4JEHA 1EX7A 4JEIA 4UU0A 3TPCA 5GP1A 4BO9A 5L3RA 1UODA 2NVWA 2XOXA 3EGEA 3EVBA 2XA9A 4TSFA 3L7AA 3X1DA 4XRGA 5J43A 4KO1S 3Q6QA 1O9HA 1JHUA 3KTDA 1DS6A 1G2IA 3BQMB 4HWSA 4V0SA 4W6QA 3UJAA 5BSFA 2IYYA 4RH0A 4JHLA 3OQBA 4AJNA 1YZNA 3PQEA 4G7WA 1R4AA 1DI0A 5CURA 1ZNZA 3ADDA 1JDZA 3IUYA 1K7SN 2DYKA 2Q5QA 5BSHA 2QTBA 2QTAA 4FW8A 1IN8A 5IDWA 2OAEA 2QIPA 4MGIR 2NUTA 3ZJYA 2GZSA 5LWHA 2JLXA 1WP4A 1UPXA 3L05A 2DHEA 4G9BA 4KO8A 5K0TA 1ONSA 2VBSA 5TVGA 2Q8PA 1KQ3A 3NAQA 4LUCA 3T7AA 2G1PA 4D3DA 1VQ6B 2X8LA 3D7NA 3QZUA 4H6PA 4UNNA 1NBEA 1TADA 3Q7RA 5E38A 4C07A 1OWNA 1K5DA 3S8MA 4ZAWA 4W5TA