1H42A

Ferredoxin:nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr and leu 263 replaced by pro (t155g-a160t-l263p)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP+ REDUCTASE
molecule tags Oxidoreductase
source organism Anabaena sp.
publication title Involvement of the Pyrophosphate and the 2'-Phosphate Binding Regions of Ferredoxin-Nadp+ Reductase in Coenzyme Specificity
pubmed doi rcsb
total genus 83
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2002-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1h42A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1h42A02
3VMFA 2YWHA 1DDGA 1ZM4A 1EFTA 4WQMA 1D2EA 1JNYA 2BM0A 1CQXA 2VYQA 4N3GA 2EIXA 2VNKA 3ZZUA 1K73D 4TMTA 4J0QA 1VQ8B 3WBKA 1NJID 1CNFA 3QSYA 3QFCA 4RD2A 3CPWB 1EFUA 4RD1A 3B78A 2QMUA 4FN5A 5AN9A 1VQOB 1S72B 3WXMA 4M0LA 1EP1B 1OB2A 1BX0A 2VNJA 3WYAA 2CRVA 2B7BA 3U2QA 1Q86D 1UMKA 3JQQA 1FRNA 3CXCB 3OZUA 3CC4B 3CCQB 3ZBTA 1KJZA 3AGPA 2BSAA 1M90D 3U6BA 1YJ9B 3ZBUA 1ZM9A 2DERA 2OK7A 4C0SA 1D8TA 3CCSB 4ACBA 3G71B 3W5HA 3CC2B 3ES9A 4PGOA 3AVYA 3CCLB 2EFGA 5EMNA 3ZZTA 3QFTA 3LO8A 1S0UA 4ZGNB 1W2BB 3W5VA 2AHOA 1FRQA 1AIPA 1HA3A 2J7KA 1DG1G 3I56B 3CRZA 4Q7JB 5THXA 4PC6A 4Y9RA 3P27A 4B3XA 2QEXB 1QG0A 2E1RA 1KC8D 4EH1A 2BV3A 1VQLB 4YAFA 1CNEA 4B4DA 5H59A 1F60A 1TVCA 2OK8A 5JBQA 3VO2A 2GQFA 2XNCA 4YAUA 3VNUA 3VNVA 1FNMA 1KTVA 5TR9A 3W2HA 1H85A 1QVFB 1E63A 2VNIA 3V76A 4G1BA 1KK0A 4P6VF 3MHPA 4YAWA 3MMPA 1AMOA 1BQEA 1E62A 2XNJA 1ZM2A 4TN1A 1ELOA 1QH0A 2BPOA 1R5BA 4LBVA 4ACAA 4C43A 1N0UA 1IJEA 1EWYA 2GPJA 1K8AD 1QVGB 3B82A 1JA1A 1OB5A 4LBYA 3LYUA 1GO2A 3QE2A 3W2EA 2BMWA 3WNDA 4TMWA 2D74A 1QGYA 3PENA 1K9MD 2PMDA 3SJZA 1BJKA 2DY1A 4RD3A 3QFRA 3G6EB 4AC9A 1YJWB 1B23P 1FDRA 4TMVA 4YALA 1M1KD 1QUEA 4ZCMA 1DDIA 1SKQA 2PIAA 3A1FA 3LRXA 3WNBA 4K1XA 2DEUA 4UAJA 3OW2B 4R71A 1GAWA 4NBSA 1B2RA 2QN6A 3JQPA 3E20A 2FX3A 3E1YE 3CW2A 1XE1A 3FJOA 4Y9UA 1VQ7B 1VQNB 4DQKA 1J9ZA 1TLLA 1FNCA 1D1NA 5KSWB 4HE5A 3OZWA 1QGAA 1ZUNB 4AF7A 1VQPB 1TUIA 4B48A 1JA0A 3P26A 3AVXA 4PC1A 4RCZA 1H42A 1FNDA 1U2RA 1OGJA 1VQ9B 3CCUB 3ZC3A 1IB0A 2HCJB 1XB2A 4M1KA 4ZCIA 1EFCA 4NCNA 1SM4A 1G7RA 3WBJA 1I7PA 4FWTA 3CD6B 4M2LA 3CMEB 4TMZA 3OJWA 1QFJA 1W87A 1NDHA 3LVBA 2DCUA 4G5GA 5HXBA 4LBWA 4F7DA 4AF6A 1N8RD 2QTZA 4TMXA 3CC7B 3CCEB 4QHYA 5GV8A 1KK1A 1G7CA 3JQRA 3I55B 1EP2B 4P3YA 1BX1A 3W2IA 3CCMB 4RJLA 1YI2B 3W5UA 4PC7A 2DETA 3MCAA 4RD4A 4M4SA 1KK2A 4ZGQB 4LC0A 2HMAA 5GV7A 4RCYA 1EP3B 4M53A 2BN4A 3CCJB 4RD0A 1FNBA 3FPKA 3CB4A 1EXMA 3WY9A 4YHBA 1VQMB 5H5JA 1G7TA 2BM1A 1QFYA 1GR1A 1TTTA 4G1VA 1Q82D 1JB9A 4FK8A 1A8PA 1ZM3A 1R5NA 2RC5A 2BGJA 4PC2A 4MYTA 1QGZA 1GVHA 2B5OA 1KQSB 1QUFA 5DSZA 4QFMA 2VZLA 2BGIA 4YAOA 1IJFA 2YWEA 1W35A 5TV2A 1W34A 3B8HA 2OTLB 3AVWA 2CNDA 3AVUA 1OGIA 4B47A 2QA4B 2YWGA 1YITB 3CCVB 3QFSA 2C78A 3I1FA 4PC3A 1QFZA 1QX4A 1VQKB 4Y7CA 3OZVA 4U9UA 4ZV4A 3AVVA 2R6HA 2ZITA 2PLFA 2OTJB 2QTLA 2BVNA 2HDNB 2BF4A 1JJ2B 2B7CA 1KD1D 4DQLA 2YWFA 2NPFA 1VQ4B 5FA6A 3VO1A 4IW3B 1YIJB 3W2GA 4B44A 1VQ6B 1Q7YD 3CCRB 4BPRA 4N3NA 1F20A 4HE6A 3G4SB 1N0VC 1VQ5B 3WNCA 3OJXA 4H9GA 2VNHA 1G7SA 4LBZA 1DARA 1KRHA 1KK3A 2XEXA 3AVTA 3J81k 2C77A 2X3UA 1GAQA 1R5OA 4ZCLA 1WDTA 3ZZ0A 4MYUA 1Q81D 3AGQA 1GJRA 5TY0A 4B43A 1YHQB 3CMAB 1E64A 3U6KA 2QDXA 1YJNB 3W2FA 2RC6A 4RD6A
chains in the Genus database with same CATH superfamily
2PCJA 4WK4B 2DR2A 2I76A 5DYNA 4N01A 3DKIA 5JJBA 3NG1A 2YWHA 1PR6A 1Q1EA 1R0KA 1TFRA 2ZI7A 3HU2A 3L02A 1I9CA 1Z4NA 1EFTA 4MKHA 4UASA 2GPSA 2A4KA 3STYA 4ZAWA 1MX9A 1FDOA 2KBFA 4JL8A 2NTJA 2VXCA 2EYQA 4OJTA 1K0UA 3C5EA 4UMDA 1E9VA 3H5IA 2AWOA 5JZVA 3PD7A 3TGWA 4EZEA 3R1IA 4NATA 4D3YA 4J43A 1CP3A 5K9ZA 4BVLA 4X91A 3IP6A 3ASSA 1LBHA 2NO7A 3PTZA 1J99A 3AJRA 3L82B 2RJNA 3SDBA 3UWMA 4NBNA 1VSTA 1VQ8B 2GPNA 4FT2A 2OLKA 3WGTA 2HCFA 1SIOA 4JLMA 1FXWF 4QE3A 3H7AA 3C6YA 3Q3CA 4HRXA 2J45A 5CFMA 4L75A 4XKWA 1H1LA 5DXAA 1KAHA 3RASA 1I4LD 1ZMXA 1XMJA 1Z6TA 1CUXA 1OPRA 2GS9A 3NHSA 4E22A 4KKTA 5MN4A 3PFBA 2CJXA 3F0TA 5CAEA 4JL5A 4R2LA 5IDXA 5SYAA 3DEZA 4I1IA 3GJTA 4G09A 4AKGA 4GOOD 4XWAA 4MVYA 4Q3CA 4S04A 3QVUA 3W0LB 3K15A 5CM9C 1ZD1A 3OFSA 3JPYA 2ZAOA 1A9YA 3H9GA 4GZ3A 3GIRA 3JZIA 4ZJPA 2QX7A 1G4HA 2OXFA 2WHEA 3FKJA 3N6RA 5HRUA 2O2HA 4DV5B 3ZEAA 5C3MA 4YB8A 4H2DA 1VBMA 2IC5A 1HF3A 1OTYA 2QVGA 3DWIA 3AJDA 1DCKA 1XJCA 2RJ3A 3B1FA 2JJQA 3HWX1 4IXTA 4OA8A 4W8GA 3RODA 3VR3D 4CL8A 1JR3E 1K3FA 3PEYA 5T57A 3DXXA 3FTPA 3S8MA 1XLTC 3K5WA 3EMKA 4C6HA 3L9XA 5JAPA 4ERNA 3PQ4A 4UE2A 4BB5A 1P4HA 1AE1A 1GYPA 4F2PA 5M7EA 3LXUX 4JUAA 3T0FA 3TQOA 4DV3B 4C0SA 4KQ2A 4TV9B 1CUFA 4L3VA 4WECA 4ZFNA 4DDWA 4M3NA 1U81A 1TKCA 4F56A 1NQXA 2PM8A 1YRWA 3I42A 1GLVA 4OF4A 1O94A 3CC2B 2G28A 2P6UA 2Q6IA 3FMGA 4ERXA 1N2GA 3P0JA 3EVCA 3U0BA 2X13A 1RHUA 1TD1A 2IYZA 3IB3A 5CGQB 2V74B 3VGPA 5DYIA 3LO8A 4L28A 1S0UA 3H11B 5TEVA 3GOHA 1BQ3A 3RJ9A 3RUIA 3W6ZA 5K3FA 2RHDA 3OJEA 3LA6A 1O5IA 1NATA 4MW6A 4A2WA 1EGVB 1OILA 2W4IA 2HY7A 1JH9A 2GKGA 1SOUA 1RYHA 1XZEA 4DDHA 1VHOA 3GAAA 1KVQA 2ATVA 2YIVX 5THXA 1WVGA 3IUEA 4R1QA 5CNIA 4EMSA 3BJIC 4UXHA 2PAFA 3I62A 4QKQA 2AR7A 1ZCZA 1AZSC 3OEED 4U2CA 4YDRA 5EWJA 3L3BA 1NTOA 4LXGA 2XW6A 2YZGA 3IHLA 3JRNA 3TBFA 4DGSA 1XQYA 1FVOA 4IH4A 3DDZX 2C5BA 3ZDEA 1MC5A 3A6JA 4LYFA 3K8QA 1WPCA 5GZ6A 2WTXA 3DPSA 4BBJA 3E3OA 1JQEA 4ZN6A 4B4OA 4BQPA 2JL1A 3KB1A 1Z7WA 1ZCFA 2FUG1 4PBSA 2O3RA 2GNAA 1GD1O 2FQ1A 2PUTA 2PYZA 1U8FO 1V7CA 2FPPB 1DX9A 1BQ4A 1T4DA 3SS9X 4EMUA 1NLFA 1T24A 5I45A 1NQTA 4HPJB 3ZY5A 2FEPA 2A9RA 3TG2A 3VPHA 2GQFA 4YAUA 3AYXB 1FNMA 5TR9A 1X38A 3IEPA 5ED0A 5G02A 2R48A 1PE0A 3DHWC 2A9FA 1H85A 5ADWA 1N2OA 1GRNA 2PQMA 3GUHA 4B45A 3QVJA 2RD2A 4WTOA 3BDIA 4FEEA 3H6GA 1C2YA 1EWTA 4HMOA 2V58A 1PK9A 2O8NA 2FR8C 4GKKB 1K0FA 1VZ3A 3X1DA 2CJYA 3U5TA 4FM9A 1HE4A 2ZJBA 5F7JA 4W5TA 1JYEA 2IHUA 5IMSA 3BGIA 2AN1A 5HMMA 3OQMA 2QV0A 1ELOA 2BCGY 1A88A 3NRCA 2B4AA 1HI9A 1JPJA 3I52A 3QRWA 4UJ3A 3W9UA 3DE2X 4XUGB 4LHVA 2RHRA 4R1PA 3I0ZA 4IWXA 2XZPA 4HFNA 2ZXFA 1YR9A 5EE0A 4MAAA 4DLAA 5KVCA 4NLLA 1ESDA 1TFUA 1X1EA 2BI7A 2J32A 1PT5A 3AHDA 3G8YA 1J2UA 3MJTA 1YCHA 1PUXA 4RA9A 3A1SA 2EFYA 1MRZA 3LYUA 4A6PA 4ZTBA 3V4RA 4XCXA 2R8PA 3QUQA 1O95C 4EJSB 2JCBA 2OM6A 4MVJE 2AE2A 4NNPA 4JP5A 2RHOA 3QU2A 2B83A 3L4BA 2SNIE 2HIMA 1HEYA 4TLLB 3UHPA 3Q3IA 4RHXA 1T2VA 2AK2A 2EKPA 5C1PA 5LXTA 4TKLA 1RLTA 3GEEA 2C9BA 2QP3A 1M8GA 4OA5A 1DBIA 1HM5A 3ZCQA 4F85A 5FXMA 4EYOA 4Z54A 4Q1FA 1POXA 3HNOA 3R3YA 3NJ4A 2GHQA 1Q3HA 3AUYA 5J5AA 3VX3A 3VA7A 4JJ4A 3BGWA 4E7OA 4D0SA 4OHYA 1PG5A 1VA4A 4ND8A 3ENKA 2V7TA 3EULA 1WDWB 1B26A 4N6GA 4EPYA 1HC7A 3PRHA 1MB4A 3W6OA 3RTEA 4EO7A 2Z3VA 5AM1A 4RFLA 4ETNA 4X41A 1H2RS 1BAPA 3CURA 2AXNA 2AV6A 5IYZA 2HA3A 4JLWA 4HSEA 4ZO9A 3UMVA 4BLRA 4G0WA 4H3SA 4O6VA 5LBIA 3SBDA 5ILOA 2P67A 4ZOEA 2R1ZA 2ZWVA 4QUJA 5EXSA 3WSVA 4EMBA 4Z49A 3NTUA 4IP0A 3ZE2B 4BO0A 1I7DA 3KL4A 2AUMA 4GLJA 4PLFA 1G63A 5A4AA 1ZU5A 2RHWA 3SKXA 4J16A 5JU6A 3UJ3X 4Z4FA 3UMCA 1O1YA 3IYLW 1Z35A 3N76A 3QF4A 4OOVA 1GGNA 4B09A 3AFHA 1LJLA 3BXOA 4AROA 1QAMA 3AR5A 1O03A 1FNCA 4PPFA 5K99A 2POCA 3BA1A 2HT1A 4N54A 5BSTA 3H1TA 1QC5A 2NUPA 2RBKA 1OLXB 4IUDS 3M9WA 1NW9B 4C7BA 2PL1A 5GJBA 4G1UC 3S7ZA 2PIDA 4QPJC 4AF7A 1CTQA 3QPWA 3FLBA 4JC0A 3JU3A 2YDYA 3BGSA 2X5XA 3RC3A 1K6MA 4JJ6A 3RYCB 2GMWA 1CRPA 3K09C 3LQQA 4XDYA 1TKBA 5FUYA 1COZA 1CFJA 1W85A 4RS4A 1ONOA 1YRLA 3H4IA 4IS3A 4QL3A 1QJ4A 2OEPA 1ABEA 1OGJA 3A37A 2Y1CA 3BMXA 3D8NA 3IIEA 4XX0B 3I6QA 3LS2A 2VKTA 2YWBA 3QJYA 4K9DA 4NE2A 2NIPA 3M3PA 4UU7A 3LCCA 2PPLA 2XUGA 3NIWA 3WAJA 3NE5B 4MO2A 4AMBA 4LPKA 1OREA 2OFPA 1YZGA 2D3TA 2JFUA 1V2GA 3ONNA 4NHEA 4RPKA 3UXHA 1Z7BA 5ENZA 1U7WA 3FF1A 4EABA 1I4WA 4LGCA 1KZYC 4Q3NA 3DBHA 2WP8J 4IQ8A 4HDAA 3PEUA 1VTKA 2P5SA 2V1XA 3NPAA 1O97D 3HMKA 3Q5DA 1ID1A 5F76A 1QFJA 1NUPA 1IFXA 1ZX1A 4LJ7A 1CETA 4NJEB 1Y1PA 1ZK4A 3UFXB 1YVEI 5T4BA 2QPLA 1YBFA 2IY8A 1XP5A 3T7IA 4S0XA 3U7EB 5INTA 1THZA 2AQIA 5DK6A 1I94B 3U13A 3ON5A 1WSWA 1FJHA 5JZSA 2NQ8A 3TBKA 3BREA 4CM9A 3MWJA 2MWMA 4LYAA 3M1AA 5FLXA 5HK9A 1IBSA 4QVIA 3GGSA 3GNLA 1N08A 4N5HX 5DIZA 3I55B 2HXGA 3VR5D 1VI6A 1SUIA 1T8TA 4NOLA 4BHTA 4QGHA 2Q4OA 1U2ZA 3FPSA 3W2IA 1U8AA 4M37A 2AOTA 4UBIA 1SIWA 1YJBA 1J2EA 3H65A 4C88A 2FZVA 5ICMA 1OI3A 2OKGA 2W2QA 3AB3A 4FFOA 1PV1A 2C97A 3AB7A 4Y8VA 1GU7A 4I9FA 4R0NA 4BMZA 4RD4A 3KJGA 4M4SA 3EQ9A 4BZWA 4JEUA 4N76A 4OLAA 2DHQA 5BW6B 2Q5EA 1YOVB 4BVBA 2C0QA 4IDDA 5TXGA 2JCGA 1MEJA 3DNPA 1KSGA 3VVLA 3OJFA 2M5SA 2FLKA 3BE4A 2XUKA 2QE7A 2X19A 4M53A 3LXRA 2Y93A 4EJSC 4X92A 3BB1A 2P65A 5IJAA 1YASA 1I7SB 2O8FB 1RWNA 3G8BA 5F2OA 3ZQ4A 1P2GA 4E7PA 2I4MA 3IUPA 2F1HA 1P6QA 1YU9A 2IIBA 3MERA 1N2BA 4FFSA 3TQRA 4DVGA 1KFBB 4ED9A 1NAHA 2F1JA 3R7WA 5EZYA 3UJ7A 2VPQA 3ANLA 3D2LA 2DQYA 3BCUA 3P9YA 2X2OA 4TKUA 1OUMA 4FGZA 5DM70 4DABA 1KI9A 4ES6A 5LQKA 2XUPA 5F9MA 4BJ3A 4GXTA 1S9HA 2V3VA 4G65A 3C97A 3DMNA 3OZCA 4RWEA 3NWEA 3NP7A 4TV8F 5B6JA 2GXUA 3LQ6A 3E1GA 4ALLA 4HADA 5DT9A 1C9EA 2Y0DA 4B17A 2XYQA 4OQNA 1KEPA 1FMCA 4E11A 3T9FA 4F9FA 3Q8MA 3OAAA 3PT5A 1XXHB 2BUBA 1Q0TA 4D25A 2OR3A 1H1DA 1SBIA 4FFVA 2J3LA 3LQ1A 1W52X 4HAOA 4KQGA 1ODCA 4LG1A 1VE7A 4CKBA 5JLJA 4EATA 3SR4A 2HPZA 2MDTA 2YXDA 1W36D 3FPGA 7MDHA 1FFAA 4DR5B 5JRZA 1Y8ZA 1P4SA 4LA4A 1W0KA 3WJ1A 4NG4A 5B57C 5AI8A 2I2DA 3ZD6A 3DVRX 1Z07A 1A95A 1B6TA 4CV1A 3PD1A 4JDPA 3JWPA 1PYDA 3O82A 1YJXA 3C3YA 4R40A 3NORA 4FYMA 4CF5A 4DAOA 3NOOA 2L0XA 1ZONA 3MIZA 3R5SA 5EE3A 4KX5A 1DV1A 1YKSA 1NXSA 3M89A 3PKZA 2QD1A 4BMVA 1VXRA 3OX4A 2XE7A 4Y6RA 3A8KA 1FVHA 2GR9A 4HUJA 2XHZA 4LY0A 2E4AA 2AH5A 1D04A 2H2IA 4M7PA 4DWOA 4KR3A 4RVSA 3ZI0A 4YAKA 2GASA 1KU0A 2ZB3A 2QUBA 4DLPA 1WY5A 3ELBA 4ZQIA 2MINA 2NPIA 3RS2A 1XTPA 3E9ZA 4IX9A 4O2AA 1JUDA 3RF6A 3PTAA 1YOBA 1JKFA 3ZHTA 4DMFA 3Q6QA 1HLPA 3EA5A 1HMPA 4ZK2A 4J7AA 4FXUA 4FFWA 4I8DA 4X60A 1MOSA 4FWBA 1KP3A 4HD8A 1G8HA 2B8JA 1CR4A 2R1VB 3PVSA 4ARBA 4D26A 4CLOB 4J4BA 3DJYA 2BVNA 2ZIFA 4Q4HB 4KR6A 2V31A 3P9IA 2BFWA 3VPAA 1I9GA 4HNGA 3RTAA 1W88B 2FGKA 2A9QA 4CL2A 4KRFA 4X3PA 3KJIA 4URZR 4U8GA 1EE9A 4O5OA 2FCAA 1GFIA 3BQJA 3WWPA 5BQ3A 1RJ9A 1MOPA 2Q3BA 1EBFA 2Q5QA 2VSXA 2IX9A 2YWJA 3CGGA 3H2SA 2JH3A 4JC8A 3A6KA 2QAJA 3DLCA 4IXDA 5BYKA 1QR2A 2VQ3A 3ESBA 4LE1A 3V1TC 4BNWA 3GLHB 4M36A 2D59A 2PX8A 2R8YA 4WKPA 3N28A 1QIFA 2QJFA 3LP5A 3T7TA 4EG7A 4MIOA 2XQVA 1SUDA 3MTQA 4FP9A 4D1YA 1W49A 1DIGA 2AF4C 1SOAA 4F3NA 4GEGA 1PR5A 3PIRA 2Q4DA 1R4NA 1CE8A 3CZPA 1GV0A 4D8XA 4OKNA 3LAWA 2ZCJA 1DIOB 3EEFA 2QLLA 1P1KA 4LXXA 5LP6A 2V6BA 1H2HA 3ECAA 1XF9A 2A9OA 2BZ0A 1U5BA 3HZHA 4H7PA 4O02B 3CVVA 3ROTA 2IHZA 2E1PA 2OBBA 1X8JA 3LFUA 4JR0A 1GRQA 2EFJA 1N0VC 3KCNA 1EGMB 2QTWB 5DHPA 3GVPA 1BDIA 1UAAA 1I6KA 3KUKA 4BPBA 4YRAA 3NONA 4BAGA 1WCV1 1N7HA 3M1LA 3X2FA 4I7EA 2IFTA 5EUCA 3THXA 3PFWO 1E0KA 5LYJF 2W2KB 1HNXB 2XH8A 5MDHA 5HIJA 4FYKA 1OXXK 3CNLA 1EEXB 1GGHA 5CD9A 5EG5A 5ENVA 5SV2A 5E1OA 4DMHA 1E6LA 4PONA 3WGIA 3QEKA 1LBTA 2DUJA 2VDJA 1GHTA 2JVJA 4XM0A 2O2SA 4QPZA 3EBLA 5F1PA 4DR6B 2Z2IA 2P9YA 3E4DA 1DCFA 1CDDA 1NW5A 4KQKA 1KDZA 4E5PA 1NVUQ 1RLMA 1MO4A 2AJLI 3K0BA 2JD1A 2PMWB 3P97A 4UHKA 4AJJA 2CV0A 1YVDA 2UZ0A 2ZUCA 5KIAA 2GT1A 1U7ZA 1XMOB 2WHQA 2AN4A 5TY0A 1R88A 5DF1A 2G9UA 3LT0A 3UAVA 5ICSA 1KY5A 3RQIA 2A0KA 1W94A 5JQGA 5K3AA 5BQOA 4Q5IA 4C6TA 2DRIA 3LOPA 1DC7A 1CY4A 4OQFA 1YJNB 3BZWA 3T5BA 1EJ2A 1T26A 4IG9A 1V5IA 2QGNA 1F6WA 2ID7A 1OWNA 3DZDA 4EY7A 2LKDA 3PC8C 5KYXA 3L79A 4FIDA 3WGHA 2ZIXA 1ZM4A 2VHQA 4XVCA 5F3WB 3DFZA 5FORA 2G76A 3MLBA 1NRXA 2HIGA 1T6ZA 1LCIA 1F3OA 2HH9A 4OL9A 3P96A 5B4VA 2WNHA 4B7UA 2WG2A 4V03A 4OKSA 2QTNA 3GFFA 1NQWA 3KDAA 2VP6A 1U2TA 4GLBA 1KS2A 1UBRS 1DBWA 1DIAA 1OHHD 1QAQA 3F4LA 4JB8A 3E5RA 3TD9A 4ALNA 5IBCA 1KMQA 1OJLA 3SNHA 1I10A 3ONEA 3B13B 4F5YA 4YP0A 1BYIA 2PYIA 2YJZA 1LV8A 2A92A 4J0JA 4TL7A 4ZVRA 4BNIA 4D8YA 4BC0A 2HXSA 1Y3HA 2FNAA 1HFWA 3RRJA 3JQAB 1DT5A 5A04A 3TLAA 4AJLA 2BFAA 1MHPA 3I5UA 4R16A 2QA5A 4GC9A 3WX0A 3G2MA 5F3RA 1T1GA 1ACJA 1Y5RA 3S1SA 5AWFC 4YRCA 2RGUA 4PZUA 3W5AA 4IEFB 5GZ3A 3GHYA 1D03A 2HWXA 1ITZA 5CFPA 4RENA 1I7NA 1HPLA 4OB8A 2IHYA 2V7VA 3ELWA 1T3HA 5LWHA 1BE0A 1GFZA 3KK0A 3A0RB 3ZHBA 5A02A 2PFGA 3LLVA 3QQPA 1NW4A 4I36A 4WOJA 1NVWQ 3E9YA 1QB8A 2KB0A 3ZGNA 1M90D 3EWAA 4CODB 3L8ZA 3VOAA 4ASUD 2EP5A 5IEBA 1HE5A 2AC4A 3L6DA 4K9NA 1VMDA 4GXNA 3QU5A 2PV7A 2R25B 4GOXA 1D2MA 4QUHA 2C7GA 1ILEA 4G1CA 4IDHA 3CFYA 4PHHA 1TYZA 5CP8A 4RZXA 3DL0A 1R3UA 4NZMA 4WNAB 1FSGA 1P74A 1JJAA 1LBEA 2QF7A 4MX8A 3VNBA 1QANA 3EA0A 1IK6A 4YP5A 1NGSA 3GT7A 3U3MA 5HRAA 1QKIA 2GARA 2WD7B 4WERA 1IHPA 3UC9A 3IIMA 3P0FA 3T1NA 3IHWA 1XTBA 4D02A 5B3LA 3RAFC 2D5LA 5L4NA 3KB8A 4NPAA 2EJCA 3GFVA 3QLEA 3GELA 2X9VA 2ORYA 1WU7A 2CW5A 1GUYA 1OYVA 2F62A 2WMDA 4ZOCA 5EN4A 2DULA 1HA3A 1AIPA 1JSRA 1RXEA 3ABQB 3F7NA 3N8IA 3CH6A 3N6XA 2PQ2A 3PDUA 4P0TA 3PQ8A 5E38A 1J8FA 5BR4A 4H08A 1YS7A 1W2WB 4BNKA 1K8XB 4DDTA 2FSHA 3UK0A 1NP7A 2Y1WA 3ER6A 3HUFA 1T5HX 4LCBA 3R09A 5ALUA 5J1SB 1ZH4A 2XMGA 3PDHA 5T4HA 1HNWB 5JJKA 1L7DA 4G63A 1KI4A 3DV9A 4IF6A 4D43A 1G59A 4MB0A 5THKA 3SLKA 2YJ3A 2YMQA 3RRXA 4QOJA 2ISCA 2ISQA 1OAKA 1GADO 2ZSEA 1XZJA 4G41A 2FEWB 3A1EA 2OECA 3ICWA 2XGSA 3MOSA 1X8KA 2M9MA 2VQ6A 3JWJA 1VMKA 2PWBA 2ZWIA 3KOWA 5EKDA 3D3WB 4QOIA 3E9QA 5LMZA 1Y8QA 4JT2A 1EIWA 3FWPA 1JTFA 5B30A 2Y0PA 3LZDA 5BRNA 1YZTA 5JBQA 3LPDA 3BCSA 4FR5A 2WFAA 4HPXB 4ZD6A 3KV1A 1ESEA 4G0PA 3WV5A 4P4SB 2AOUB 4AB1A 3EZYA 1ZITA 5BN4A 3KHUA 5I7SA 4UTOA 5CH5A 5AI5A 1U80A 2F17A 2JLYA 1J06A 4CF3A 3NHWA 3Q6IA 4TTSA 3HJUA 2XF2A 4Y2GA 1KHTA 3WMFA 1NI3A 1QONA 4YJ3B 2FXIA 2P69A 3A6GA 3IUMA 2ZK7A 3ROFA 4M1SA 3R9WA 1OX4A 3COVA 1G3RA 1BQEA 1U11A 1NYLA 3G8AA 4WOBA 4JU8A 3UT0A 3UGTA 3VV2A 2YVKA 1CUCA 2XHEA 3U4AA 1O57A 1RXWA 1R5BA 2CWWA 2RAUA 2VJBA 3TLGB 2AR9A 1A2KC 1RYFA 4HZGA 4OO3A 5JLAA 5BNZA 1GFWA 1N2CA 1UPBA 3WHKA 3OBIA 1S8NA 2CF6A 2ZRKA 1FTYA 4X06A 1NBEA 2YZKA 4I55A 1LSOA 2YINC 2ZFUA 1NF8A 2O3TA 3L2OB 4WN9B 2XT9A 2H7CA 4KGVA 2ASVA 2JFZA 2Q07A 3HLKA 3PZBA 4ZAGA 3CUEF 1FBNA 3SDZA 1X7ZB 3TOVA 3QSGA 1FMFA 3WLAA 3K0HA 1TA9A 4TZ0A 1DLIA 1QK4A 2R44A 1F8GA 1ZC4A 3U7JA 4AS1A 3A4MA 4HXGA 3QG1A 5CCXA 4NEHB 2Q0SA 1VE6A 2QZZA 3IRUA 3PSHA 3JWIA 1ZNZA 3PNVA 4ZT5A 2XT6A 4GO1A 4NS1A 2A9KA 5H80A 2Y71A 2GK3A 3OMWA 2PRSA 1VHTA 2BR5A 4NE7A 1II8A 1GZ3A 2PH5A 4DLUA 2P6OA 3OLCX 4LJSA 2R4UA 2RI6A 3ZUGA 2H8KA 3CEAA 3RUDA 3W6NA 4CKBB 5LIRA 4MDFA 1L4BA 3WL8A 1LNQA 4DA8A 1Q57A 4JT4A 1E94E 3U0VA 2P7IA 1LDMA 4O2AF 1RJGA 3PGXA 4RTSA 4V0NA 4YRNA 1ZUD1 1G19A 3DD1A 3TCXB 3SYMA 3TEFA 2BUAA 3F97A 4MINA 1WXIA 2QKYA 4EHHA 5AUPB 4PY2A 1JWAB 3RHFA 1VB5A 2WJWA 3WNBA 4LIPD 1BVYF 2CE7A 4MKRA 5K4HA 4BL5A 3RC2A 3HJRA 2G5PA 2IW1A 1AQ6A 2J46A 1GQSA 2CHEA 1KNXA 1B2RA 2CZCA 2VTDA 3CA8A 4FYYA 1AY0A 4Q9IA 4YRPA 3WL5A 4DCUA 1JDBB 4QLAA 1BIFA 1X7WB 2LW7A 2LIVA 2XD4A 1I2BA 3HXTA 3O3MB 4YMIA 1JQLB 2I71A 1JP7A 5FFNA 4QV2A 2Z58A 2BMVA 3MGCA 1V43A 4BNVA 2QJTA 1CUBA 3HACA 1I4TD 1OZ0A 2QZPA 5CT9A 1XMIA 5FQOA 3FBTA 1M8FA 2WJGA 3KSZO 3OIYA 2QTVB 4MUGA 5TGDA 1XHEA 3A6DA 1XD2A 3ABSB 4MGHA 4GPAA 1NN1A 3ZI4A 1HFEL 3M6FA 4UBLA 4B3BA 3ZJYA 4GHWA 1JLLA 3OM1A 5KNBH 3E27A 4I4IA 1C8LA 1Z4MA 2C5AA 3ZU3A 1JBEA 3H5OA 4ARZB 4R9SA 3EZNA 4BLWA 4RV5A 1H42A 2NP6A 2QGFA 4RESA 1BG6A 3N86A 4K2HA 1RHMA 3VDRA 1QKJA 1RLIA 3ST7A 1TM7E 4L15A 1FC0A 1AZLA 2HCJB 2GZMA 2XAAA 1XB2A 1MNQA 1EFCA 4NCNA 2QTFA 4DIDA 1FFYA 4P2GA 2WPDA 4GOMD 2QD3A 2XY4A 5TQ2A 1A8HA 3PFNA 1CZUA 1IOLA 4GKAA 4WFQA 4PYQA 2V7PA 1IVNA 4L95C 4ZVKA 2HMYB 4JP2A 3PK0A 4MR7B 2VJLA 1DBVO 3I9FA 2QWXA 3QA3E 5AICA 1C7IA 1USWA 2N47A 1O9HA 2FQQA 4UNNA 4UREA 2QROA 3VQTA 4BZPA 1NDHA 5KVQA 1PQUA 4KZKA 5EL0A 5BQXA 3QW2A 4Z3KA 1UDBA 4AYXA 4PPQA 5DTJA 4FI3F 4RW0A 2ZI6A 1WE2A 3INRA 2PUAA 3BC9A 1K6EA 5BVHA 3SYNA 2W6JA 4AF6A 3GFTA 4JIGA 2XVZA 4XWWA 4X1YA 4ZVSA 3VYWA 3QMPA 5BNIA 2NU8B 1QTRA 3UMGA 4NXMB 5T7BA 5FV7A 1FSSA 4QULA 4ZKDA 1RD4A 2JFOA 2R5NA 5B5SA 2HTFA 4YUZA 3OZSA 1GKUB 3D1JA 2D4AA 3HU5A 4FHFA 4JLOA 4PFQA 4QT0A 3D8RA 2A30A 1C30B 3AVPA 4LDAA 3V1MA 2XE4A 5T3YA 1VYVA 1K97A 2GBLA 3FDJA 3AIOA 1MX3A 1N1MA 3DHVA 2YNMD 3IP8A 2CXNA 1YI2B 1WCXA 3PFIA 3FCYA 2DETA 3FGPA 2P9ZA 4YWHA 1OH5A 4EJ6A 3TRIA 1RC0A 3MJSA 1AGNA 1I24A 1PX0A 4UMFA 4Y2RA 3A4NA 5IDQA 4N18A 3FUTA 4QU0A 3A1DA 4MR8B 2AYYA 3R5XA 2VQSA 4MI9A 2ZI3A 1PZNA 1JDSA 5J35A 1IULA 2XOKD 5K7SA 2I29A 2GHIA 2QRNA 3EZ7A 1DADA 1RBYA 4RDCA 3RVQA 1IZ9A 4IQ0A 1JLHA 1GGKA 3C7TA 4FFLA 4M55A 4RSGA 5SYMA 2CLSA 5HKAA 2PN1A 1UK8A 1ENZA 1Z4JA 4HJRA 4U9HS 4O63O 1I6WA 1Y81A 5EKTA 1CDEA 4XM1A 1J0AA 4YHBA 1C4XA 1G42A 1R6TA 1VQMB 2NWQA 2ON6A 3QY0A 1AS2A 4IIDA 4N5LA 5GADl 1YDMA 4P80A 2NZWA 4JA2A 1XVVA 1SG9A 2DX7A 1I1OA 3HKBA 1H1LB 1OCEA 4AK9A 3AOEA 2GYYA 4FK8A 1Z34A 2OZLB 5ALVA 1GPMA 5ADHA 1MB2A 4ESOA 3H5LA 1U9CA 2GFIA 5I7VA 4ZWNA 4I19A 1NXVA 1DEXA 1BX3A 1DQYA 2BE7A 1T9AA 1ZLXA 1LLFA 4R1TA 5TC4A 1ZCAA 2BFMA 1TEVA 4Q4LA 3GNTA 3AHHA 3H9QA 4MVJI 2E4ZA 2E85A 4O2LA 3TRKA 1R8XA 3FETA 4X1IB 3QTLA 4WEOA 1DQZA 1UDAA 3MTEA 4YWJA 3R7NA 1W6UA 5DNYB 3OT4A 1WSVA 1H8ED 2RGNA 1B3RA 1SC9A 1WDKA 1XFAA 1FP1D 1DELA 1EZZA 3GUYA 3ROKA 3RQSA 1J22A 4PGHA 3SNKA 3N1UA 5B1EA 4QFBA 3A70A 1UBTS 2WHPB 1A9PA 2D2VA 2P11A 2Q1SA 3URKA 5HX7A 3C39A 4ZYLA 4QUAA 1AO0A 1BN7A 1CQZA 4W1QA 1UBHS 4KGDA 3PA1A 1N2EA 3P4XA 5BSFA 1G8PA 3L6RA 3SZRA 2IDJA 3AJ9A 4BKQA 4UPVA 1AXRA 1NSYA 2JGJA 4MGEA 4RSHA 4RVCA 5FLYA 5F3DA 3KFLA 3UGQA 2ADFA 4H59A 4RQUA 3OSUA 1JVSA 2JIDA 5HE8A 3K2EA 3N53A 1G3IA 1Q15A 4C05A 4JXXA 2IKQA 4N48A 2ZLBA 3F5DA 1JKIA 1PJ2A 1O0SA 5CVUA 1FJGB 1DO8A 2KQUA 1SIBE 3Q8XB 2YIJA 1OI4A 2IYAA 3C7KA 2X1LA 4Y7CA 3GDOA 3PPIA 3W8RA 3O21A 4FX5A 2GO7A 2J33A 4C78A 4D5GA 2C84A 3GDFA 3HRIA 2GSDA 3HV0A 2ACWA 4IWYA 1PQWA 3FCOA 2OTJB 3HEMA 5I3CA 5DNWA 1NA5A 2A0UA 4GBMA 1KDTA 1Y5IA 1Z8DA 2HA7A 4MRVA 3ZDFA 3IMKA 3WSTA 4RIGA 1L5OA 1XVLA 3LBNA 4E08A 2NXNA 2NUTB 2VYVA 2C3PA 4INPA 1MPXA 2BF4A 2RMKA 3WJ7A 4HX2A 3GEHA 1AK1A 1PTJC 4L74A 3E3MA 5C4MA 1RJFA 3VPGA 1NV8A 1P0CA 3NT4A 5KTTA 4NJOA 4JJGA 4MV9A 5FI5A 5HCNA 1V1MA 2EU8A 2FWMX 2Q3JA 3HBLA 5FBLB 1ISPA 4RPIA 4HX5A 2YH2A 5EJFA 1MV5A 3DKRA 4H3KB 2WQZA 3D8BA 3BMNA 3V8RA 1XQ6A 4N9QA 1U0RA 2CLEB 1SEVA 1EI9A 4OGKA 2H9YA 2IGBA 4NCXA 1ZM7A 1CULC 1N78A 4XEUA 3O95A 1T91A 3QMWA 4H77A 1E5TA 2WIGA 1AKWA 1PV2A 3AR4A 1MW9X 4BPRA 1PS9A 3RVKA 1GSOA 2V6MA 3ZOKA 1MJGM 3DDWA 3QE9Y 5AVJA 1KR5A 1KDYA 1EDEA 4WLFA 3KP1A 2ERYA 4AKIA 4HGZA 3RB8A 4ZYXA 5CX1B 1SCIA 4LWOA 1W88A 3GHHA 4JUFA 4ZCTA 2I9KA 1YC5A 3CWZA 3I5XA 5CB4F 4URWR 5JEEA 4P2NA 3NOQA 4L8LA 2FKNA 2ZZEA 1VF7A 4QUDA 3SR0A 1DARA 1S9DA 2CLDX 3ET4A 5COQA 3G2NA 5IYZF 5JD5A 5B6PA 4FBGA 2NQ2C 1FFHA 1NYTA 5F98A 1G21A 1RAFA 1ZUIA 3IQXA 3ZH2A 5JHHB 2CL0X 4QHSA 2WM9B 3ADDA 1PWEA 2QUAA 1S2LA 2VLIA 3GEGA 2XQKA 3NBZC 3GLHE 3BZUA 4CU2A 3COSA 1E1DA 3ET5A 3CNEA 5HKBA 4EY5A 3UIEA 4PSDA 1NR1A 2H1CA 1ATIA 3L7IA 3NC0C 4MWBA 1J5EB 3FY4A 1E3MA 2YZMA 2NNLD 3WLPA 4MW9A 4JYBA 2WWYA 2H1HA 3DFUA 2FJUA 1PL7A 1ZI6A 5G4LA 2DCMA 1SVWA 2C7OA 2UXBB 4PAOA 4X20B 1N7JA 3NRJA 3LO5A 3GFRA 4KBYA 4FD2A 3MN1A 4PQRA 5BN1A 3UV7A 5BSGA 4HB4A 2H59A 4LFCB 3VMFA 1U2DA 1OOEA 1Z0AA 3DSRA 1PT7A 3EQ7A 3SXUB 4FS8A 4ZO4A 4F6LA 1M6VA 4EG8A 2OUIA 1QNFA 4AX4A 1RPTA 3AM5A 2FY8A 1T3ZA 1CQXA 1MA0A 3ZKWA 5DHSA 3TZKA 1R6VA 2VTKA 4G0ZA 4HB0A 2IWHA 4TZ6A 4B6GA 2XSZA 3JQ6A 4CE6A 1KOJA 2V7WA 3PIDA 3AEUB 5LM3A 3NEPX 3PITA 2AG6A 5LQRA 2DFDA 4MQEA 2HJGA 4ZZ1A 3H05A 3RU2A 4M0DA 4EYKA 1YRHA 1BXRA 2Q1XA 1EX9A 4Z4YA 2H6EA 3F5FA 4R1SA 3FOBA 4Y6SA 1YMVA 3PEFA 5KJCA 2EW8A 3B6MA 2HREA 3R5HA 3RHZA 5L51A 4FHCA 2WSSD 3ZXSA 4PXSA 3GGJA 3LKZA 1P2VA 1XZMA 4O4LB 5E3JA 3TI9A 3ZYCA 2A5GA 3W9YA 4TM7A 4EO9A 1QRTA 3EZGA 3KLOA 1DFHA 3ROGA 3UA4A 1S72B 1LZLA 4HEA6 5FWNA 4F5DA 4LFBB 4N7RA 4PGAA 1KERA 1IDOA 3BBLA 5JZ9A 1Z6QA 3NJRA 4WNIA 2F48A 2Y68A 4Q6WA 1GRVA 4E5SA 2EIHA 4JJAA 1ZK2A 2WAAA 5HDQA 4IINA 5B1HA 3VV3A 3U2QA 4A73A 1QQAA 3ZYZA 3EDQA 3KIPA 4ZT7A 3JQQA 1FRNA 4E5DA 1AV7A 1QRUA 1O2DA 4GBGA 3JASA 2EWMA 3CC4B 4J6FA 3HH8A 4X0CA 4GYJA 5FBHA 4PQFA 1BD4A 1HETA 4JA0A 4TTQA 4DF3A 4I1PA 3JD0A 2G3YA 3TX6A 3UCEA 2M1ZA 3IDQA 4QC2A 5GTDA 1YB6A 4TMFA 2GAIA 4RHYA 1EVKA 1T9CA 3SXUA 5DRYA 4AI6A 1IEWA 2D6FA 1BE1A 2VYFA 2FN4A 5MGNA 1ZRNA 1N5JA 1XQ1A 2O8VA 4D45A 1ZH8A 3TVDA 2QAIA 3JQAA 2LZ0A 4LZJA 3UAGA 2NX2A 4MJ3A 4NPCA 4ACBA 3OX3A 5JCZA 3VUEA 2QRQA 2XCRB 1VKJA 3A3NA 1HNNA 4W5JA 4E2XA 3B20A 3SVTA 5UKDA 3PFCA 2IIPA 4YBZA 2B8TA 1UMBB 1N2XA 4ZTUB 2FF5A 4M8LA 2X0KA 3I61A 2G1AA 4L8VA 1LPPA 4OUDB 4GAEA 3B3QA 3E18A 3F74A 1GNLA 2H5LA 1XLTA 1U7PA 3H4MA 4W99A 3TQCA 2F59A 1GSIA 2WFLB 1H2YA 4M54A 2G08A 2V7GA 4PO9A 1JT2A 3GQBB 3QNUA 2ZYWX 1A8IA 2BHSA 3OQOA 2IZOA 4R05A 4FYPA 3GP5A 4Y9RA 1V8PA 4H6XA 4QSHA 1UOEA 3AW8A 4KACA 4WLUA 4B3XA 2CFTA 3D8TA 4U63A 1RM5A 4W6QA 1GAEO 2HRZA 3CNQS 5BV8A 1JE1A 3WMXA 1X77A 4LFAB 1K8RA 4X3CA 1H2FA 4A8TA 2ZIGA 4AZVA 1ZNYA 3RVDA 4AJOA 2O8DA 3C3MA 3PXGA 2EKZA 1X7GA 3MOGA 1R0BA 3PWTA 1DKRA 5H59A 2Q6LA 2BFBA 2OHGA 2VBFA 5E4TA 3L6OO 3S0JA 3QVGB 2REQB 4XTCS 1IAQA 1SB9A 1VDMA 2FZEA 3OY2A 3E2MA 3DE3X 3T34A 1GCOA 1P2BA 2RAPA 3ZCUA 3I83A 4FPXA 2Y1KA 1UADA 4ZVNA 4YR7A 1NQVA 5TPWA 2WF7A 1UDXA 2ZUTA 1SCQA 2RFLA 4JCCA 5JS8A 3CVUA 1K66A 3O8RA 2VNIA 1A5TA 1D6NA 5FYQA 3U09A 4NYJR 1PGPA 1KSJA 1U3CA 2NZYA 3ZZNA 1WTCA 2OB2A 2HSGA 2J3IA 2RHBA 4ILEA 1T6YA 2VSOA 3OPNA 3LQEA 1F2TB 1XZBA 2OV1A 3AG5A 5CYFA 2ZG6A 3MHPA 1BMFA 4OJMX 4AF8A 3ZW9A 1YNOA 1RHQA 4II7A 4C76A 4UM9D 1SOWA 3T4XA 4AN4A 2I3DA 4ZDJA 3ZXYA 4TPKA 1ESCA 5EJIA 2JLXA 1XTTA 2XJ9A 3MSXA 2H1WA 3WGMA 3IE2A 3NC4A 2VSQA 3EF1A 4TL9A 6GPBA 4IQFA 1NSTA 4HB2A 1T35A 4HEQA 4WZTA 1TO1E 4GRAA 1U6JA 4P58A 3N39C 1EAYA 2CWDA 4Q1BA 1YFLA 5KQRA 3WOHA 2AJCA 4EI7A 5AJVB 3JU4A 1T0BA 5EHXA 1KY2A 4YEJA 1PX2A 3A04A 2IUFA 2P5TB 3GP8A 2M98A 3HDGA 1UMDB 1JIVA 2P2DA 1G3UA 2QSJA 3N07A 3B51X 4OGLA 3T52A 1HRDA 1SU7A 4K8OA 3K9CA 4PYOA 4S3MA 2W2LD 3ZDCA 5HGJA 3CCFA 3FRHA 1TCUA 3QHPA 4LW8A 1KAMA 3DEFA 3PENA 4IGEA 2H0AA 4EHIA 4K0KB 4UVEA 1EFPB 5CJJA 3FOEC 2WTMA 5EMKA 2GZ2A 4I9GA 4MICA 3BRCA 3FTEA 3L6BA 2HHJA 2WU4A 3P5SA 4EUNA 1ZH2A 1W2HA 3K0KA 2KBEA 4YYZA 5LD2C 5FFMA 4DAEA 2WT8A 4WKCA 3LV8A 2NU8A 1A7KA 1NE7A 2Z6QA 4PYLA 4NICA 1LC0A 3LNCA 4R8VA 1DIHA 3R9XB 4UC0A 1Z68A 4ZCMA 1JGTA 4TSRA 4JSYA 1QVWA 1JDZA 1I2DA 2YFHA 3VH4A 2PIAA 1AUPA 1T5OA 1E20A 3L0OA 1IBKB 1PJRA 3EY4A 5EXXA 4XOTA 5TDHA 1S8AA 3EEOA 7MHTA 3C16C 3GPDG 1ZQ9A 2D0DA 2HD4A 4DWVA 5EJ8A 5K8JB 2IS2A 4K28A 4C4ZA 5JXJA 4ZRNA 4RK4A 3THRA 3ZGXA 4LE0A 4F3YA 2QM7A 3ND5A 3K1JA 1DIRA 1M2HA 4NBSA 3ADKA 4KLNA 3RS3A 3FSJX 4J1SA 4R8MA 3TAHA 2FX3A 4DLKA 5AW7A 2BKEA 2EZ4A 2GHRA 3I9KA 3KQLA 2J5QA 3UCFA 1N2SA 2HMVA 3L4JA 3PTLA 2CNKA 2C8KA 1YJ5A 2X5KO 2YICA 4OHMA 3NHBA 1EYZA 2B4QA 2ZJ7A 5DSTA 2A8YA 1SCJA 3WYEA 1MABB 1SNYA 2UUOA 4A6XA 5CEEA 1F38A 4BO9A 4L4YA 4PU0A 2QTAA 2Z2YA 4U02A 4D9CA 4ID3A 5TS2A 1YS4A 3DPIA 3Q4GA 4HE5A 3EIFA 4OOXA 1QGAA 1Q7CA 3IAUA 4JJ8A 5BN4B 1ZR4A 4WEQA 1JFSA 4NEGA 4Q3BA 4NCKA 2K2WA 2OGSA 4L07A 1TVEA 3H2YA 3B1WA 3L05A 5KAMA 2PRJA 3S27A 1FXSA 4ZPXA 1YRAA 1N9GA 2VTEA 4F12A 5ADVA 1L5GB 4K87A 3OWOA 5F4ZA 3QIVA 1VQ9B 2LCFA 3VU1A 3ZTTA 4YJFB 4DLRA 2SCUB 3PQ3A 4GQIA 4N40A 4N4AA 3L0ZA 4PZ9A 3EX7C 2ZTSA 2BFNA 2JRCA 4NDAA 1ZD2P 3HU1A 5EKUA 2G0AA 1S6YA 4L7QA 4UW9A 3P2EA 1C4WA 4G07A 5A6SB 1NV9A 1GPH1 1Q91A 1MJHA 4I1OA 4F8YA 5KSPA 4P53A 3G49A 1E8NA 3D1LA 4I50A 4LRYA 3BF7A 4U7GA 2A7QA 1WMAA 5DM4A 3O9VA 4QBKA 4R81A 4Z0HO 3RTBA 1M8JA 3T3EA 3DLHA 3IFSA 4LZNA 2XNKA 2UZAA 1QO7A 3GZJA 2PSEA 4F7DA 1BFDA 3FSRA 4EJMA 4I4LA 3SMQA 4KX3A 4F6CA 1KDOA 1DG3A 1UFQA 4LQ4A 4YDSA 4BVKA 4B33A 4DANA 4XYLA 2C7PA 3UMJA 4CIAA 4RBNA 1ZBQA 1UKYA 5EZ6B 3H5NA 2B25A 2OGTA 3CWQA 3LJKA 4LJRA 3IRVA 1M7GA 2BE9A 3D2CA 2FJPA 3I2GA 2IEGA 1BX1A 4RQAA 4DXAA 5EJAA 2RAVA 2BKAA 5DOVA 1XDZA 2IHKA 1DXHA 3I0NA 5CBPB 3GQVA 4FOPA 2GPTA 3UATA 4R3UC 5FF9A 1Q20A 2DFKB 3GQBA 3NVMB 3PQ6A 1OFIA 4RFSA 4DLVA 2FDCA 1JDJA 5BSYA 1EK1A 1NXOA 2DLNA 3PXDA 5LUBA 4JU9A 4DTIA 1CR6A 1AK2A 1EINA 3M1YA 5KYVA 3VR4H 4EARA 3ELDA 4RVGA 5COAA 3UV6A 1SXJA 3LT5A 4KYIB 3ESXA 1ZXBA 5K8LA 1OGYA 3A6ZA 1D7AA 1R8QA 1FP4B 1ULSA 2A6PA 2XWQA 3DMTA 3F78A 3L0IB 4LZLA 4CCAA 2GCEA 5JMWA 4QPCA 2FXVA 3ZHVA 5AW1A 1LI5A 4B5KA 2I7CA 2Z3WA 3O8LA 3P4YA 4BDSA 1OZGA 5BWOA 5IYRA 5H5JA 3CRQA 1QF6A 1WSRA 1FYVA 1QFYA 1TPYA 3CCCA 3I30X 3PHGA 4Z7QB 5IHPA 3AY0A 1WZUA 4RULA 1GCUA 4K05A 4IHJF 4PX2A 2P40A 5BMVB 3A9TA 3PHIA 1AB5A 2QENA 1LTKA 3MWEB 8ADHA 1TIKA 2ZYUX 1ZBDA 2RB4A 3N2GB 4KE8A 4WY5A 4WA7A 3NKLA 3WYDA 2XMZA 3ZJ4A 3KJHA 1DIBA 1HE3A 4FKBA 4C14A 4XPIB 1C80A 2I6SA 1EFAA 5IM4A 1ESZA 3DM5A 1RWOA 1E89A 2YQ5A 4FR0A 3DE6X 1M76A 4CDMA 3ND9A 5T4FA 5JNUA 4ON9A 3X1JA 3HXOA 2W70A 4M0CA 3HN2A 1DBRA 3LLMA 4OYRA 4GOND 1KQSB 3IPRA 2XOKA 2ZUUA 3EVNA 1NOJA 1G8AA 4H18A 3HVHA 3SQOA 2CLCX 3G5TA 2BGIA 2JGIA 4QPDA 3FI9A 2NXJA 2PA0A 1GILA 4X7MA 5AJTA 4G7XA 1UP4A 4Z2AA 1XYVA 2JCXA 1W34A 3TTXA 4K6FA 4BQIA 1WUTA 4XR9A 2CNDA 4ZMRA 4HQ6A 1KMNA 5AK0A 1MORA 4AICA 2WLSA 1AKEA 1SOMA 3RIMA 2ZJ8A 4HFRA 4HAVA 4Q00A 2I34A 5AM2A 4EYGA 1FYWA 1RAEA 4JQZA 5IDWA 1N6OA 1RWKA 3B1XA 1M1ZA 1UEIA 2V7EA 4AU1A 4XLZA 1HGXA 4MV1A 3OTQA 4U7TB 1P31A 3NBQA 3D3KA 5TT0A 4EMTA 4MKXA 3T3IA 3WZMA 2XWSA 1J9EA 4CM7A 2OBLA 2VDQB 4BFTA 3N2IA 5B1DA 1HLDA 3K0AB 3HI4A 3UVEA 1ILWA 3VRHA 4CLRA 5HZHA 5IAJA 3K1ZA 3QHQA 5I01A 4IEEA 1IN1A 3A6PC 1YBMA 2Q6VA 2HADA 1W36B 2FFBA 1F7UA 4D81A 2ZRIA 2EFEB 4B7XA 1AKRA 4EFKA 5C5CA 2BFCA 4AMZA 4IRMA 1U0HC 4KQJA 2I6GA 3EXG1 1IUKA 2PPVA 4RPLA 1XX6A 3TLYA 1ADFA 3COWA 5I9LA 4KSCA 1A8SA 2FU5C 4L4SA 3WMRA 4YRKA 2LWIA 3RBAA 4TYWA 5C8YB 1K6XA 1PNRA 3PI7A 1RQLA 3NOVA 4O2BB 1B42A 1TZJA 2CBGA 2BDUA 1JHMA 4PRLA 1VQ4B 2Q6TA 1MMFB 4PLVA 1XAIA 3OURA 4LNHA 5DNVA 3OG9A 1ZCBA 5TQ0A 3RLFA 1RFLA 4EPXA 4FJ1A 2AW5A 5TF4A 5C46F 1OKKA 1VCIA 4IUCS 4JVLA 1E6MA 2CL7X 1J8QA 5K0BA 1WR8A 1CZNA 2ZYAA 4B44A 2RHHA 5IZ4A 2DHRA 1GEEA 3BIFA 4WESA 3EGDB 2D7CA 3JR3A 1BTOA 1S4QA 4R3NA 2X6WA 2EXXA 5WRFA 1AA9A 1E0SA 3PNLA 4LPSA 3HYLA 1M66A 2UUCB 3RUFA 4GU5A 2I65A 1MABA 2W2NA 4ENTA 4Q4JB 3UB3A 2CXXA 2AI3A 4BB0A 5C8YF 1WMBA 2C82A 5H02A 2XKAA 3RAGA 4WGFA 3V7WA 1UFVA 3KHSA 1LDNA 4QJIA 5HDBB 2ABWA 3BWXA 4GW3A 2XBUA 3C3DA 4O1IA 1BOFA 3K9QO 3Q9UA 2JB9A 4HN9A 4O3FA 4C5CA 2VSYA 3PL1A 3V33A 3KZOA 2II6A 2P27A 4GZMA 4K3UA 4FVTA 1Q2XA 5K01A 4ER5A 3VYUB 1JILA 4UM9B 4I4NA 3Q7IA 5ALIA 3WNZA 2J31A 5IAKA 3OWXA 2JIMA 3FUWA 1QVAA 2PNFA 2DG2A 5JANA 5ALMA 3TL2A 1DJNA 3B70A 3BXHA 1ADJA 1E43A 1W5BA 1X14A 2IZ1A 1BHO1 2ORED 3KPYA 4REOA 3UTCA 4X7BA 3P45A 1LRKA 1T8RA 2H4ZA 2WD8A 3UKJA 4DCCA 1RBZA 3BIOA 3K7EA 4ZARA 3VTFA 5ELLA 1YHQB 4X0EA 5IJZA 1MEEA 1C3EA 2VZ9A 2HWYA 3PQFA 3P9SA 4Z3OA 3AKZA 5CVJA 3U81A 5FWXB 5FPPA 4GI3A 5C3UA 5CX1A 4EHJA 3SJ7A 3TL6A 3W6UA 3AIIA 5A05A 1ST3A 3IKTA 1QYRA 3I45A 2QR2A 3EIXA 1E7MA 1E3WB 1B8PA 1AUOA 2QP4A 2XA2A 1NBMA 4XL9A 2HXYA 3EDYA 2IODA 3U4IA 1BE6A 1DRUA 1FRZA 2I80A 3VNSA 1BMQA 2XMSA 3N58A 1CUHA 4JR2A 5CX4A 5MFPA 3N2YA 2C57A 4XJTA 1ADYA 5IH3A 4A15A 1D2AA 1RM3A 4PCVA 4PSVA 4Q9KA 1KNQA 1IHOA 3HFJA 2LD4A 4HWKA 2HW8A 5KX5A 1TCAA 4DNTB 2EIXA 1KEEB 3BSYA 4FEAA 2AG1A 1KZHA 4M49A 2C5HA 3EFBA 1SBNE 4O1HA 4BFVA 2XR1A 4ZZIA 2XMDA 2Q46A 5D3QA 3CPJB 2WPNA 5EHQA 2F8SA 2AN5A 2IYQA 1I30A 3WBKA 1IL0A 1GUBA 3WXBA 2UYHA 3ODGA 2JAQA 3DBHB 2NO9A 4YJHA 4WCFC 2C5EA 1UDRA 2JJ8A 3PF8A 4U3JB 2HDOA 2ZYIA 4OEHA 5AVVA 1HZJA 4DN6A 2NOAA 4HGPA 3BE6A 2K6GA 1T4BA 5AN9A 4I4TB 2P3LA 3CX6A 1OWLA 3C5CA 2CKMA 2YBEA 4NCHA 4DMLA 4F2HA 4CFSA 1H9AA 1QH8B 4V1CA 2O5CA 2C59A 4M0LA 1G21E 3C87A 1T3GA 2RDMA 1Q84A 1M1YB 3GFBA 3JR7A 4MUFA 4YYEA 1B1AA 5J4YA 5JXGA 1V47A 3CP2A 1N5DA 3M5DA 1ZVKA 4BX3A 1S2DA 2HX1A 4M0MA 4D99A 1V39A 5AW5A 3X1MA 1FXUA 3NM5A 1XYYA 2PY6A 4NYIQ 5DGTA 3CCBA 4PNZA 3TRJA 2CNBA 4XR6A 3TRHA 4QTYA 1HTTA 1K4MA 2OV4A 4L8WB 5BWBA 1D2RA 2GEBA 1E0JA 5CT6A 4O33A 5BWMA 4URXR 3ANTA 4OB7A 1CJMA 1OLSA 4PE5B 3U6BA 1J2TA 1YMQA 3DVLA 2JZOA 2R85A 1WOSA 2L2QA 3U37A 4EX7A 1USKA 2Q3EA 4B4WA 4CM6A 2VK8A 1JFRA 4EJ2A 3JRXA 2M2IA 3PJEA 5KAPA 1Q74A 4RF4A 2G5TA 5I7HA 4JEHA 2IYUA 3UWOA 3HE3A 1T1IA 4FGUA 4E5UA 4GX5A 1PFQA 2TMDA 1IQRA 4RNDB 1V9CA 5EP4A 5BQ5A 3TWOA 4G84A 2XXAA 1IOWA 1D4OA 3EJWA 4C4YA 2NPOA 3HYRA 1H3FA 1Y6GA 4HXEB 2ATEA 4NK5A 3LCUA 3TJZA 1R64A 1V8FA 2WOOA 3C24A 4G26A 4K9MA 2WMOB 4IJVA 4Z4HA 5TQVA 1EFPA 4NZNA 5FTJA 3ROZA 2XCSB 1I80A 3G68A 2Y2VA 2Y9PB 3GEPA 4IMPA 1QKKA 3LFHA 2V3CC 4CEHB 2VIIA 3ZE7A 1JDPA 3EUWA 4JKYA 3G6WA 3H16A 3T7DA 3ZV3A 1UBCA 3A8TA 4D8TA 1EDOA 4I1YA 2H7VA 5LBUA 5IAOA 1GN8A 1GRCA 2V55B 4AXXA 4Y1FA 2Q1WA 3KWJA 1SQSA 4KFRA 1B14A 1YQUA 4NWIA 1F4VA 5LU8A 4X7FA 2R97A 3HDJA 2I4LA 4LV8B 4QYIB 1MA3A 4TXJA 4OOSA 2DMRA 1TD9A 4B4DA 2BH9A 3I4CA 3P9CA 4MLDA 4RK7A 2XUQA 3BTSA 4L9AA 4Z9XA 1Z62A 4L51A 3LC1O 2HBYA 5JBNA 1H5NA 2BEUB 5E4JA 3KUDA 1M2GA 2LCIA 3W8NA 4DJJA 2W6ID 1XA0A 2DWCA 4ZVOA 2WE7A 4E5NA 3PE3A 3MMNA 4IIXA 1JQKA 2PS3A 2RI0A 4HQFA 1A8QA 3C4QA 3PF9A 2BZ1A 1V2HE 1I2ZA 1NULA 2MJLA 4HWPA 1SUAA 4LSMA 3C41J 1T6XA 1BEEA 2BD0A 5ALKA 4ZXFA 1QPBA 3LU1A 1XAJA 3K9NA 1CKEA 4E03A 3A3GA 1KZ1A 2EZ8A 4OXQA 5HIMA 1OHHA 1W47A 2BT4A 2ZTUA 1L8AA 4KFUA 2WIFA 2VTBB 3MXOA 5HJ7A 2NZ8A 3LQKA 1B6SA 2G4LA 4HN2A 4ABTA 1QH1B 2VT6A 5BN3A 1KYQA 3TDNA 4BVHA 1Y34E 2Z1NA 3GT4A 1Y1SA 1LFDB 2DUUA 4UBNA 2BPOA 3RJ5A 4QQRA 9ABPA 3COPA 3HB4X 2AQKA 2XLBA 5K0FA 2H1RA 1MGPA 2GCPA 2R66A 3CMCO 3FTDA 3NBFA 3NW9A 4X00A 5JARA 4EI8A 2BFBB 1BZYA 3OE5A 5BURA 2ET6A 1I3KA 1TCBA 2J5XA 2ZJYA 4N3AA 1L3BA 1IYZA 3OPXA 2DKNA 4WD3A 5BWCA 1EB9A 1U28C 2WD7A 1FVFA 2W00A 3V8VA 3ZR4B 4PG8A 4DUPA 5H8WA 3F7TA 4E1VA 3EW9A 3UUFA 3AZQA 1M10A 2PAAA 1RZVA 3W1EA 5EKXA 1JLSA 3BH0A 3LIIA 1M9NA 3W2EA 3GLHA 3IE1A 2F55A 4F2GA 1XRMA 4MVJA 2PUVA 3P5BA 3WG9A 1ZD3A 2WWIA 5LKAA 1U9YA 4LDRA 4XEHA 5E7QA 3W04A 1IN5A 3LL7A 4M88A 3SJZA 5E9AA 3C45A 3INGA 2OM2A 5JZOA 3T8YA 1PN3A 2Z6BD 2VC2B 5LPNA 5B4UA 2CC2A 4UEQA 3WTCA 4B6PA 1M33A 3EZFA 3A1TA 3TLMA 2ZRAA 1YJWB 3B1JA 2WAMA 3CRVA 3EXEA 2BFEB 3FZYA 4PFJA 1OZFA 4D0NA 3KVNA 1G5FA 3V55A 4CIWA 4W5NA 3VZDA 3MNFA 4J75A 4YRLA 3W7AA 4NECA 2C4NA 2ZAYA 1GL7A 1E5XA 1E2DA 4XR4A 2PUCA 2XI4A 3I6BA 3OP1A 1U0LA 3MS2A 2FR1A 4LJKA 4MA4A 3TDKA 5BN3B 3A36A 4URVR 3ZDXB 4MB6A 4N5MA 5BNWA 3EGVA 4IHJB 2BDEA 3OOYA 4NZYA 3M9XA 3HRKA 3WHPA 3EPKA 2WSSA 2FVYA 5GVSA 4QGFA 4DA4A 3M70A 3M1IA 4RDJA 3TQTA 2QUZA 1FUEA 1QBKC 1H93A 1M34E 5ITZA 8MHTA 1JAHA 3BQNB 3E1YE 2AOVA 3CW2A 3NPMA 3ETDA 3GUVA 1AHPA 5JCOA 1A4IA 5JC8A 3IPXA 2BEVB 1DRVA 2CXOA 3EAFA 2P5UA 4N65A 4LEIA 1VI2A 1QIHA 4R2WA 1ECFA 2P2YA 4DJFC 1Y8CA 3C5VA 5REQA 3MTIA 3TSAA 4D9EA 1ZGGA 4C0JA 5JNLA 1XRQA 3KQOA 1AH2A 5A89A 2HU8A 2O5VA 1CUAA 4WNCA 5K4GA 3ZJUA 2OBYA 3FMIA 5CUQA 2C96A 4FIZA 3JD4A 5AKIA 4J7UA 4YUAA 1DFGA 3ONDA 1Y0YA 3RY8A 1E3IA 2R2GA 3ZCPA 3NDRA 3ZK7A 3KR9A 1MQ9A 1Q0ZA 4XM2A 3U40A 3JRWA 1PGOA 2JA2A 1I3NA 2C2KA 5BSMA 3AKCA 3OE7A 5TMBA 3S2UA 2LP4Y 1VHWA 3C3WA 3SKYA 2C04A 2D5CA 3GEBA 1CR1A 1REQB 4TTIA 4CV2A 4DMCA 4DS3A 2XCTB 3RVSA 2QLBA 3PNYA 1G7RA 4EUHA 3WBJA 4HYYA 4YV2A 5JFGA 1R0XA 1KYXA 3CX7A 1PWZA 3DTVD 1CXZA 3D3NA 1BCSB 4TKUB 3QVMA 2Y99A 3FZQA 4JDUA 3FPEA 4HAZA 5HXAA 3LPAA 5COBA 5JS7A 3KTAA 1UQUA 1E9AA 1SA0B 4F3RA 2GHTA 1T8SA 3FRIA 4OBBA 1QX3A 5HZKA 5CIYA 5ALPA 4DBZA 2ZREA 3E82A 3KAPA 4MPDA 3HUDA 1I51A 1A9XB 5DHUA 2QTZA 5SZJA 1SC1A 1NJ2A 1T0JB 3MBIA 1UK7A 4ZDKA 5CITA 5IT4A 4KE7A 3M81A 2BGNA 3GJ4A 1GNTA 1MAAA 2CL5A 4ZOBA 5EAIA 4N7JA 2EDAA 1K4YA 1I4EB 2C9MA 4DKXA 2QMZA 3T4UA 1EMDA 4WGGA 2H18A 2XWJI 4EG0A 3ZWQA 3OQVA 1XFDA 2DC1A 3HXPA 1PJLA 4XCQA 4RTJA 3Q40A 3MWYW 2GF0A 4RJLA 5KNLA 5I9IA 5K0GA 1XDGA 3O4IA 1BCRB 2Q2NA 13PKA 3VBCA 4DGQA 5E7MA 1TADA 1MVOA 2QJRA 1JIKA 1QRAA 2XCOA 5HKOA 4LGMA 2YY7A 4WK0B 1LPBB 3LVQE 1QP7A 4Q24A 1I7LA 1E8MA 3E22A 4GD3Q 3H8VA 4PN3A 3BMNB 1FU8A 4I5GA 1L4GA 4QDJA 4DRYA 3OQNA 4BAUA 2BN4A 1NVAA 1NC3A 4MUKA 4V0QA 4BUJA 5LQNA 5K3FB 2G6TA 2XPCA 3H1EA 2QBYB 4B2YA 3FPKA 1W4BA 1WABA 4RHEA 4XLFA 2QQ5A 2HNAA 5CEFA 5IKPA 1SUWA 821PA 2OOSA 2F2TA 4FMDF 3F6SA 3K5IA 4G1VA 4CFYA 4L4UA 1ZNWA 4TS4A 5B53A 4OBEA 2YCLA 1QF7A 2OYNA 2E6UX 3GLFB 4N5NA 2WLTA 3GK3A 1G5RA 1Z6XA 2YRFA 4OLHA 4R6WA 4GQAA 4ZJZA 1Y3CE 4TV9A 2A57A 4DXDA 1XJQA 1MBZA 1IQUA 3LKVA 3R40A 4N7BA 5HKKA 3ETCA 4OJYA 1ZM3A 3PWKA 5TT1A 3VHRA 5J2TF 2EVWX 2QK4A 1RVDA 3ZUPA 2PL3A 3HJFA 1ZGBA 1SG6A 2PXAA 3R0ZA 1Z5UA 2OP1A 3RYFB 1KY4A 5KNBD 4BX0A 5KBYA 4DK0A 4YJ2F 1XI2A 2FZCA 2RAFA 2KI5A 1QS0A 2FZ4A 3JQ8B 3TSWA 4BQEA 1OWPA 2CB0A 4J9VA 5JAHA 4V1CI 1ORVA 2D1TA 5DW0A 4UBOA 3RBXA 5IVDA 2ZIXB 3TLBA 4PYMA 5LMNB 4ER0A 3I8XA 1BXKA 4HZUA 1CZRA 3AVWA 4UBKA 1MX5A 5ALLA 3KQNA 3FM9A 4L76A 3DMGA 2OPHA 5P8WA 2QLMA 3EJ6A 3U4GA 5JXWA 1ZY2A 1Q11A 4IF4A 2XRZA 3MQ2A 4QJ3A 5IVIA 1QG2A 3T54A 1J2YA 3ITEA 1G1MA 2OBSA 4IDGA 1A27A 1Z0JA 4KVZA 5FLKA 2QXTA 4L4RA 3VISA 2RHCA 2YIMA 3GLQA 4IRXA 1ICIA 1SVUA 3FPHA 3I1FA 3NHPA 4KXUA 1IRXA 2ST1A 3FGNA 3STXA 3OIDA 3WIDA 5ICCA 5L3QB 2Z2XA 1E0AA 1NJ6A 4JVOA 1O77A 2OBMA 2Q6OA 2ZT8A 4JLAA 5IC6A 5BSXA 2ZE5A 4FUTA 4GMHA 3E15A 3AF3A 3PYXA 4HYQA 4RXUA 1RI1A 3K6SB 3V4SA 4BNFA 3NHKA 1E2FA 1KYYA 4CLEA 2R6HA 2ZITA 2AUTA 4I55F 1Z3CA 2KX7A 2B9EA 4R41A 3WLTA 4IMIB 2B37A 4TWBA 5KYYB 1JBQA 1BCSA 2FTKE 4JB0A 2QMHA 4RAOA 4MRSA 5AFSA 5IKEA 2XLCA 1QK3A 3JX9A 4MOWA 1LSUA 3RIXA 2DTEA 2H07A 4MI1A 2AMFA 4Q1DA 3BVPA 4ROTA 3R8CA 3CLTD 3BY1A 3HCWA 5IFLA 1AHIA 3OZDA 4KJZA 1PCXA 4MW7A 1IM2A 3DFKA 1NZDA 2GEFA 2I7VA 2YWFA 4RVNA 5DWQA 4FQ5A 1Q0SA 2DGDA 2WINI 3HUEA 2CCJA 3N3BC 5CXSA 1HK7A 4JOCA 2XEDA 3KBBA 5J9FA 4TYQA 4W1SA 5LBTA 1X1CA 3IAS1 5DHAA 4YT8A 5HEKA 4F96A 3RUAA 1UMCB 1DC6A 2YHAA 1C3VA 2BGKA 2ZWMA 3QELB 4G1MB 4I99A 3T7EA 5E6UB 1CSEE 2QVLA 1IXZA 3DNFA 3TLJA 4HNSA 2Y05A 3LZCA 2JNWA 2LKCA 2XADA 5EYPB 2PJUA 1JIJA 1D5CA 1P1HA 4LXTA 4YQEA 3N3AC 3SX4A 3HP4A 5AESA 5F9HA 5FBZA 1CQJA 3PEWA 1FYFA 2XZLA 2R751 2DSNA 3TPFA 4KPEC 5HP4A 5BQPA 2VP0A 3LKBA 4DV7B 1NNSA 5CNJA 3OJXA 1KZGB 3BE8A 5LYYA 2VNHA 3WKDA 2FPKA 3ZHOA 2WVJA 1RRFA 4DV1B 2YCBA 2VG8A 3ZK8A 4QVAA 5HOQA 2VWHA 3N2GA 5IYQA 1VL2A 3FDZB 4AUMA 2JAHA 2XGOA 4E6EA 1L7PA 3IV7A 5I4BA 4ZKEA 4QBTA 5CA1A 3K6SA 1N33B 2IT1A 4RACA 3ME5A 4MW0A 2XEXA 3AVTA 1JZTA 1SD1A 4KRYA 3J81k 3WKCA 3QGMA 4JITA 2OPBA 4YDHB 3C98A 2ZSHA 5LU9A 4M1YA 3WK7A 3PHHA 1QHHB 2O3JA 2VRCD 3EDOA 3FJYA 1HWYA 3I05A 3IBCA 1R5OA 1B41A 3KYCB 4FDMA 4J6EA 4MQ5A 3ZU5A 4C0AC 1JEYB 3E6AA 3E7WA 3LRPA 3UJHA 1Q81D 1L5HA 2BL4A 2X41A 4ZVLA 4KEAA 5FPQA 4XVUA 2Q49A 2MYNA 3F1LA 1Q17A 1TCVA 1VECA 3PNBA 3VDNB 1JLRA 2G70A 2VAPA 5KCMA 1RZRD 1NMYA 4QOGA 3FHTA 3NI2A 5D3MA 1Y5NA 1L5VA 2PX5A 3H1GA 1J23A 3PQ7A 2KM1A 3BSFA 3FZNA 5HM6A 5JFTA 4RFSB 3UJ6A 4IRUB 2RKOA 4E2YA 3DOHA 5CRIA 2N1MA 2UVDA 4J76A 5JYBA 4RD6A 2Y1LA 2LTAA 4GKBA 1HE1C 1YB5A 1IUPA 3ETEA 4JJZA 4NMXB 1J5PA 3R7FA 1UUFA 1R6BX 4KLCA 4MK4A 3I37X 1XAHA 1CLEA 4A8JA 5LP6B 1JG7A 5ERGB 4Q01A 4NJMB 3TKYA 5KNCH 1IPEA 2W8BA 3UEOA 4RORA 5IUNC 5D85A 3MVEA 5CHYA 4HV4A 5KC9A 1Q5PA 2C58A 3ZE0B 5DHQA 5G4KB 1P5FA 3F4BA 5MHTA 2NW6A 2H1VA 4XX1A 2QVBA 4AM8A 2AVDA 4IQ4A 2VNKA 1JTVA 3ZV6A 5DW3A 1OXUA 221PA 4M87A 3N59A 3ZH9B 1B8UA 4INZA 5F4BA 1JJ7A 5IYNA 3QI2A 1AQUA 2ZB8A 1U1IA 1Y80A 3AHFA 3K4PA 3LX4A 4M98A 3AHGA 1JHRA 2X76A 2Y1GA 4MCJA 1TYEB 5K0ZA 1NXXA 4LXIA 4KI7A 5EIHA 3GUCA 3QSYA 2YMPA 2FW7A 1L7RA 3CG0A 5DIFA 4AYTA 5IANA 1KI2A 1BA2A 1T1SA 2X8BA 1DAOA 3EC1A 4QJBA 1GLNA 5E2IA 2IV3A 4X97A 5ISMA 1VJRA 1P62B 4KMOA 2Z30A 3DVQX 2ZRQA 3QBEA 4GECA 4AUKA 3N8GA 4PR0A 3KQTA 2OWDA 5CDTA 5LQCA 3N2KA 5AO9A 4MPPA 4U5QA 2C2ZA 4QQFA 5CIWA 1L4YA 1RFGE 1YZKA 3D7MA 2IU3A 2CD9A 3EGEA 4DJ5X 3B7PA 6CHYA 2P9BA 2VYNA 1MZPA 5DGXA 3ZHZA 2C2GA 1XOIA 1YIOA 3EGDA 3SS8A 4IMJB 4OPSA 1YR1A 2QZ4A 5LC1A 5F23A 1H8HD 3DAHA 4ARAA 2NO6A 3THYB 2HLHA 1KJZA 4NMHA 3DYVA 2PUFA 4EJ0A 2ZAGA 1ORDA 1Z2PX 1QIMA 2KSQA 2VK4A 1GNPA 5JVDF 2ZZQA 3DP9A 1JG2A 2K87A 1UK6A 5EZYF 2Z1DA 2ZCVA 3NV7A 5A5GA 3IJRA 2MU1A 4PYIA 4XH9B 2NSDA 3IV9A 4C0KA 1C0KA 2GBCA 3O74A 1Y8AA 2PKQO 3DBIA 3FIUA 2NO1A 4E0FA 4JYMA 4BV3A 3OMXA 1P2FA 1VGQA 2VYCA 3B3JA 2OXIA 3ZZTA 3DG9A 1N0WA 3KYIB 4MS3B 1TA0A 1DBSA 5JNVA 2R7KA 4ZGNB 1V6CA 1JFFB 3QX7A 3FI0A 2P35A 3H2BA 4LYEA 3H94A 1X8LA 2C00A 5JMTA 4Q9JA 3V2IA 3BN3A 4BNDB 5KPJA 1GAXA 1PS0A 4JP1A 5KOHB 2OVBA 1ICEA 3A3PA 4WY2A 3G2LA 3TD6A 4BNYA 3PXXA 3L18A 5I3ZA 4S1VA 5E8JA 5EJ2A 2VA9A 2ZSKA 4ARVA 4JC4A 4YR9A 2EKDA 3HBAA 1ZCJA 4P84A 4YUWA 1GLGA 4D9BA 4TYNA 3N05A 2FPUA 1E3WA 3HL4A 1J49A 1P8AA 3RKUA 4UM5A 5A06A 1G8MA 1QCCA 3S2GA 4DADA 3PVZA 2PT7A 3LTNC 2BV3A 1TNDA 1FPMA 4IH9A 5J63A 1WD7A 4HXYA 1NFFA 2OESA 2C7RA 3WWOA 1JDUA 2NSLA 2OQ2A 1Q7EA 2YV4A 2G80A 3OLZA 5BV0A 1L6IA 3ELUA 2ERCA 3RTGA 1XZCA 2AJBA 2VBGA 2W2XA 5HF6A 3BGVA 1YQXA 3A3KA 3DL4A 1J33A 3FIJA 1CUWA 3QWHA 3VNUA 1C9DB 3VNVA 3EVEA 2ASEA 3OZIA 3HHPA 3AL0C 1IPFA 1NVVQ 1IUOA 2O2JA 4FCCA 2GEKA 3RTCA 4G1BA 3WB0A 2B20A 2B4YA 2R4TA 2YMLA 4P6VF 4PG7A 4R1MA 2LZJA 3R9KA 2FPGA 2GD1O 4LNUA 3JZMA 1HEIA 1IHMA 3GRAA 1XYGA 4RSRA 1HL3A 1LF5A 1XA3A 2HEGA 5IXSA 3LBYA 5JCOC 1Z0FA 5FI0B 1FBTA 3HBNA 1GXSB 4IR7A 3HB9A 4NOJA 1CFZA 1D5WA 1VPVA 2RKWA 4FTWA 4L0QA 3WGLA 4TKMA 4J49A 5CLHA 2NSYA 1W8DA 3KSMA 3ROQA 4UDXX 5IFKA 1IRIA 2AOXA 2YHBA 1ACLA 3JATA 4YH1A 2R8ZA 4QD3A 2VJMB 4U2EA 4KNYA 3IJEB 1X86B 5IASA 3NM4A 3HTXA 1OB5A 1M6VB 4GI7A 1E6UA 2I62A 1XTIA 3AESB 2RIPA 3BMQA 3GZNA 2ONKA 2G83A 3N8HA 2FZGA 1YDFA 5D00A 2QI9F 4FNAA 2GCOA 3F8WA 4BC1A 2CDBA 3DLBA 3M4NA 1THMA 1ECPA 3KSDO 4OGGA 4XB1A 3ZN2A 2HEIA 3UJAA 4PX5A 4ZHSA 5A71A 1EXNA 4U7WA 1NKSA 1DB3A 1U0JA 1T3TA 5FUWA 5LQJA 3B5IA 1U5CA 3TTYA 3VC2A 5BR1A 2FP3A 4ER7A 5TMEA 1Z18A 1N06A 4XN0A 3JYOA 3KCQA 4M89A 5L3RA 2X4IA 2BH2A 3PNOA 4TXLA 3BSWA 3WRYC 4A0FA 4D46A 4GVPA 2ZS8A 5GQSA 5KZMB 1SK8A 4PPGA 3F3KA 1YIDA 3E8MA 1OAOC 4G5XA 4M9SA 3Q2OA 4WLVA 4YMWA 4OOEA 3UWSA 2FLWA 1AQNA 1CJTC 1QIGA 1QO9A 1WB4A 2Q2VA 1WJGA 2JFBA 4P9SA 4FNGA 4F1JA 1PFGA 3WK9A 1GGVA 1G60A 1BLIA 4ZC1A 3AB8A 5KC8A 2IDZA 5LKRA 3T0GA 3EE6A 3RC8A 3ULKA 2ZYVX 5AHXA 3DV2A 4MUYA 1KVRA 1Q7BA 1HL7A 2J67A 2JFNA 1EAMA 3EVBA 4B6EA 3A06A 5H82A 3H42B 4X94A 5AW8A 5CPFA 3FOZA 1C9KA 1JG4A 1E7QA 2P0YA 4RH3A 1UBNA 3G5UA 4RJ2A 1E5LA 3AF1A 3LUGA 3OLXA 3NHFA 4XYGA 5IJWA 5CD1A 4HAXA 4FXOA 1SRRA 4NULA 5HUHA 2ATXA 4BNJA 3Q3JB 3SQMA 1FFEA 1OLOA 2VDVE 5SZIA 5C5IA 1ZMTA 3ZDQA 4PRKA 1BS9A 3VYSB 4LYDA 4RKFA 4C7XA 1A1SA 4RQTA 4EQ6A 1CG6A 1WOMA 3NAGA 4IZ6A 4U0KA 3ESCA 4LJLA 2EGGA 3NHJA 3IAEA 4TYPA 5AHOA 3AFNA 1KETA 4TUYF 3GBSA 2QT0A 8GPBA 4DIUA 4UZSA 2K5UA 4BWFB 4S2UA 3K8ZA 2GILA 2IVFA 5D3KA 4CUJA 3BGDA 4EW6A 2O8FA 1MX1A 3MBOA 2Y1DA 3GN1A 3IOEA 4B8YA 3PL5A 5FUQA 2O8BA 4HUQA 4JLVA 2PKRA 3R5KA 3LUHA 1U2QA 4KR7A 3RBVA 1FNDA 2IF2A 1CB7A 3H99A 4JKIA 4E1BA 3VI3B 3ZC3A 1UODA 2B69A 3ZCVA 4HK4A 4KQIA 4TWZA 1DLJA 5A1JA 3TQIA 4V2IA 2P2NA 3IPLA 4GYYA 2PMKA 1ZGHA 1B93A 2XE6A 2D0OB 5BY2A 1C81A 2A88A 4UEKA 5HZAA 4UNQA 1T2FA 2LBPA 2YDXA 1M67A 2QN9A 3KVVA 4PZZA 4URUR 4WFJA 3VBEA 3OJWA 1NVFA 4K2AA 4YCJA 3ASYA 3M6LA 1HVXA 1P73A 1QHXA 3JZDA 4IG4A 4E32A 4A0RA 4OP2A 3T3DA 4AZ0B 4G5GA 1UP6A 2A0YA 5HBRA 2R68A 4AULA 4X62B 2IHNA 3OOCA 1XCMA 3RJMA 1TQDA 4EP1A 3PJRA 4B7CA 4JLNA 1PS8A 2ZTHA 1LI4A 3OFND 4J16C 4C5AA 4B4UA 1ZFNA 3CINA 4EECA 1E7SA 1P61B 1WEKA 3PA8A 4TZTA 3OY7A 2WWVD 1CU1A 5AM5A 3R6GA 4X6LA 2FUEA 4IIYA 4HWOA 3GGPA 1X7HA 3UENA 1Z16A 4YLYA 4DZTA 4GLLA 1H4TA 5TVKA 1NR7A 4N82A 2WJAA 3UMYA 3CCMB 1J90A 2NN3C 2PTGA 5FWDA 4M6WA 3VNRA 4R2HA 5DPMA 4WJZA 4E1AA 2HYDA 5JD3A 4EHDA 2ZJ6A 2Q5CA 5F5XA 4DMMA 4L8YA 1VLJA 4JFAA 3MA0A 3N75A 3KSUA 4PZLA 4Y1RA 3TM4A 2BSQA 4Y30A 1QFMA 3AUFA 4YUXA 4C06A 4LECA 4P0PB 2JGFA 3I5MA 4TUYB 2CXSA 2UUPA 4FGWA 4GX1A 2BGMA 1QFXA 1X39A 2IUYA 1HNZB 3B6IA 4Q9DA 1A9ZA 4JI8B 4DRZA 4ZEOA 3OZFA 3CUYA 1IDN1 1GZDA 3H2HA 4RZHA 4DV6B 4RE6A 4RD0A 3QM1A 5JI2E 2HQSA 3DTTA 2OL4A 3WGUA 3FAZA 1IPHA 4M9ZA 3JD3A 1XCJA 1IWOA 3I2FA 1OA0A 1NN5A 4MQUA 2IH5A 2A58A 3O75A 4UUNA 3JSXA 4AMUA 2D2IA 4W82A 1N5OX 3H3JA 4MUIA 3LZ6A 5FBQB 5LJLA 1S4MA 3WK6A 1ZGAA 3H2IA 4RDHA 3U48A 4H6VA 1ISGA 1EX6A 5LOVA 3DEKA 4ITVA 3AR2A 1DS6A 3RSQA 3S28A 4Z4VA 3I8SA 4COKA 1ISMA 3IBFA 4JI4B 2I2BA 1R5NA 2P7HA 2SCUA 3KG2A 4QG3A 5K0NA 9LDTA 3KJEA 1F5SA 4K86A 3W9SA 5CEJA 4MWTA 1TYDE 1GVHA 3MUFA 4BRZA 3TM5A 4IDOA 2BGRA 4QECA 3QKIA 3LE8A 5DOZA 5E1BA 1UD2A 1XGKA 4LWPA 4CVNA 2PUJA 5EPEA 1LU9A 4ZAZA 1Z8NA 3UN1A 4E70A 2W0MA 1UPUA 5A0VA 4YASA 5G41A 3H5TA 1SHJA 2GLUA 3LP8A 2WT4A 2O8DB 1QYDA 5JSZB 2ERXA 1ZRHA 5CVDA 2F3UA 2C4UA 1HT3A 3AI7A 3OM9A 3R5JA 3AKYA 2WQ7A 3K73O 4C7MA 5JH7F 3HM2A 3Q1KA 4M7RA 5ES3A 2FDRA 4H7FA 2O4UX 4GYWA 2O7NA 3OKFA 1AVTA 2ODEA 4PC3A 4UUQA 3A3BA 4PLWA 4QOHA 1G20A 2PZBA 2JARA 4FEGA 4BGVA 3X44A 5KDDA 1YL7A 2WFZA 4PGFA 4DIKA 2ZPUA 4IKEA 4OYHA 2H1FA 4JJIA 3JQCA 4KO1S 4PICA 4DA9A 2LV8A 3DAGA 1T1EA 3PQDA 4L9RA 3SQXA 1F7VA 4XWYA 2R8RA 1TVKB 3QENA 2PJZA 5SICE 5KX5B 1C0LA 4YJKA 1ZHOA 2OMEA 4YPFA 2F4NA 3RT1A 1VPDA 2O6HA 3BMOB 3IEXA 2G1JA 4R69A 2BFDA 2WZBA 3H19A 1I0ZA 4TWIA 3OMLA 1UCFA 2YHIA 2BBTA 5EA2A 1JJ2B 2VSNA 2B7CA 3H9NA 1E4YA 1T8YA 3BNWA 1V0JA 4CTJA 1FEZA 1GZ6A 1IEXA 4K1LA 1UJ5A 3S4YA 4P6YA 3WB2A 2J7PD 1GCIA 3LQYA 3ZE8A 3EXG2 4DIFA 4FGSA 1VG8A 3L4KA 4II3A 1XZPA 2OCYC 3MTAA 1AKUA 2FMHA 2ZAMA 4UKDA 1LX7A 1LSJA 2HK6A 1RQXA 1LK7A 2HL6A 1T5EA 3PV0A 3RYHB 4I1UA 1MIHA 5IN4A