1H42A

Ferredoxin:nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr and leu 263 replaced by pro (t155g-a160t-l263p)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP+ REDUCTASE
publication title Involvement of the Pyrophosphate and the 2'-Phosphate Binding Regions of Ferredoxin-Nadp+ Reductase in Coenzyme Specificity
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 83
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2002-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1h42A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1h42A02
3E1YE 1QUEA 4NCNA 4M2LA 1TLLA 1E63A 1XB2A 1U2RA 3VNUA 2BV3A 3VNVA 4QHYA 4DQLA 2X3UA 5DSZA 2NPFA 1EP3B 2BGIA 5TY0A 1KK2A 3W2HA 4HE5A 1OGIA 2YWEA 3CMEB 2BGJA 2YWFA 2J7KA 1H85A 4TMXA 5HXBA 3CCMB 4C43A 1ZUNB 2VNJA 2R6HA 1YI2B 1D8TA 4Y7CA 1I7PA 4TMVA 1VQ4B 1IB0A 3OJXA 4TN1A 2YWGA 4R71A 1IJEA 1S0UA 2VNHA 3QE2A 1VQNB 4RD2A 2RC6A 3FJOA 3G4SB 2BM0A 1FNBA 2XNJA 3AGQA 1KK0A 1W87A 1ELOA 3CCQB 2XNCA 4YAUA 2BSAA 1K9MD 3QFSA 3I1FA 3WNCA 2DERA 3W5UA 3WNBA 2D74A 2B7CA 1YJNB 1QX4A 3CXCB 4QFMA 1TVCA 5GV7A 2QN6A 1HA3A 3AVXA 1CQXA 1ZM4A 1QFZA 1Q81D 1KD1D 4B3XA 3SJZA 4M4SA 2OTJB 3W2IA 3AVUA 2B7BA 3VMFA 1QVGB 1VQ6B 4ZCLA 3ZBUA 5KSWB 1ZM9A 3A1FA 4FWTA 4RJLA 4Y9RA 3MMPA 3AVTA 3PENA 1W34A 2B5OA 1KC8D 1EXMA 1DDIA 4M1KA 4RD0A 2VNKA 4Y9UA 2BF4A 5JBQA 1J9ZA 4HE6A 1JA1A 2GQFA 5GV8A 5TR9A 3B8HA 1QFJA 3W2GA 1KK1A 5H5JA 3W5VA 4YAOA 1QGZA 2CNDA 2VYQA 4LBVA 2YWHA 1YJWB 1D2EA 4M0LA 2E1RA 1G7SA 1NJID 2QA4B 4MYUA 1B23P 1E64A 1B2RA 1VQPB 1GJRA 2HDNB 1KTVA 3MHPA 1N0UA 5TV2A 1QGAA 3ES9A 1KRHA 2QEXB 2HMAA 3CCUB 4EH1A 4LBYA 1E62A 1QG0A 4F7DA 3I55B 3CC4B 1FDRA 2C78A 3JQPA 1EFUA 4J0QA 4ZGNB 3QFCA 5EMNA 2QDXA 5THXA 4B44A 1SM4A 3JQRA 1BX1A 3VO1A 4FN5A 4H9GA 2BM1A 1F60A 1GAWA 1EP2B 4B4DA 1WDTA 2VZLA 2BVNA 4TMWA 4B47A 4YAFA 5AN9A 4G5GA 3ZC3A 4B43A 1FNMA 3QSYA 1VQKB 1KQSB 3QFTA 1CNFA 1GO2A 4LBWA 3WXMA 4ZCMA 3E20A 3I56B 1VQLB 1K73D 1JJ2B 3WBJA 1K8AD 3AVVA 3CRZA 3AVWA 1GAQA 1DG1G 4RD4A 1YHQB 3FPKA 1D1NA 4U9UA 1OGJA 4NBSA 3AGPA 3CCVB 2PLFA 5FA6A 1BQEA 4N3NA 2CRVA 1VQMB 4ACBA 1QH0A 4PC3A 1OB5A 1AIPA 4G1BA 2QTLA 1M1KD 4PC2A 3LO8A 4N3GA 1N0VC 4B48A 4ACAA 1GR1A 1JNYA 4YHBA 4YALA 4PC1A 2FX3A 4RD1A 1BX0A 2OK8A 4TMTA 1EFTA 1VQ5B 4P6VF 4RCYA 1SKQA 1YJ9B 3WYAA 3B78A 4PC7A 3U2QA 1QFYA 3B82A 3CC7B 3LVBA 3CCEB 3WY9A 1G7RA 1EFCA 3JQQA 1XE1A 3AVYA 3V76A 3W2FA 1KJZA 3G6EB 4AC9A 1VQ9B 1R5BA 3OW2B 2BN4A 4AF6A 5H59A 2OTLB 4G1VA 4IW3B 4K1XA 1NDHA 3OZWA 4M53A 1TTTA 1S72B 4AF7A 4MYTA 4YAWA 2DETA 3ZBTA 1W35A 3U6BA 3OZVA 1VQOB 1QUFA 4ZCIA 2C77A 1R5OA 1YIJB 4C0SA 1GVHA 4ZGQB 3VO2A 2GPJA 1JA0A 1W2BB 1KK3A 1BJKA 4FK8A 4WQMA 1IJFA 1FNCA 3CCSB 1DDGA 3G71B 2QMUA 2PMDA 1YITB 3CPWB 2VNIA 1EWYA 1M90D 1ZM2A 3QFRA 1R5NA 4TMZA 3CMAB 1QGYA 3CCJB 3ZZUA 2DCUA 3ZZ0A 4BPRA 4P3YA 2HCJB 2XEXA 2EIXA 3OZUA 2AHOA 2EFGA 2DEUA 1EP1B 3MCAA 3WNDA 3WBKA 3CW2A 4Q7JB 4LC0A 3U6KA 2RC5A 2ZITA 4RD6A 4PGOA 2BMWA 1JB9A 2OK7A 3CD6B 3OJWA 1UMKA 3P27A 1VQ8B 1ZM3A 1DARA 4DQKA 1FRNA 1AMOA 1G7TA 4RCZA 1Q82D 4RD3A 3P26A 1FRQA 4LBZA 3W5HA 3CCRB 2PIAA 1N8RD 4UAJA 3CC2B 1Q86D 3LYUA 3CCLB 3ZZTA 1VQ7B 1Q7YD 1H42A 1OB2A 1FNDA 3J81k 1TUIA 1A8PA 4PC6A 1F20A 3LRXA 3W2EA 1CNEA 2QTZA 2BPOA 2DY1A 1G7CA 4ZV4A 1QVFB 3CB4A
chains in the Genus database with same CATH superfamily
1ND6A 1VHDA 2C95A 2PT7A 5I47A 1RZRD 3MBKA 4D79A 3PUZA 1TLLA 4IQGA 2YVQA 2RHCA 2NXNA 4Q34A 4F8JA 4C14A 4GKAA 3GFRA 1A77A 4TLBA 3WL8A 1TF7A 1XZ8A 4R81A 2JJ1A 1N9GA 1NM5C 5K0EA 5FOSA 3DQZA 2HR1A 2QROA 5IAEA 2FDXA 3PA1A 4KQCA 2WJ6A 4C0WA 1COWA 1EP3B 4XH9B 1WOYA 4TT8A 1S2IA 2AUTA 1S7GA 1WQ1R 3FB4A 2W48A 4I5GA 3OZGA 2YJZA 4RDHA 4DRYA 5ICGA 1XDUA 4KI7A 2J7KA 1F4PA 2ACKA 3GOQA 2WA2A 2AV6A 4JLBA 3UH0A 1PG2A 2I1VB 1O9BA 5FWYB 2PKRA 1SCNE 3KU1A 4X7FA 2GPSA 2J46A 2R6HA 2OBMA 2OHXA 3CKLA 4NS4A 1E4VA 2PKQO 3TD6A 4CXMA 4GQAA 1EUCA 3VNSA 3OX2A 2VRWA 1XRQA 1VSQA 3GJTA 3VHXB 1BDMA 4KPUA 3W6OA 1DFHA 5ALFA 2PPVA 2G36A 1D8TA 3EHEA 1BDBA 2ENUA 1IVYA 1UDBA 3FIUA 3HRHA 3KELA 3PJEA 1AV7A 4TXNA 4X93A 1AKYA 2H6EA 4B3DA 1O3YA 3O92A 5D86A 2YWGA 3CEMA 3DQQA 4KG7A 1IJEA 3R3WA 2MSLA 3BE6A 4Y9SA 2FZ4A 3IGFA 4KQXA 3LL7A 4EELA 1UFOA 4YJHA 1H0KA 3SC6A 2V4MA 3FPHA 3NDJA 4EJ2A 1O0SA 4DCOA 3F6YA 3AGQA 1MZPA 5AVJA 2BONA 3AEYA 3LQ1A 3C0KA 3HBNA 4FFPA 4ECEA 4F4JA 3T1VA 1K8XB 1OMOA 3E5NA 3HAGA 2C2ZA 1MRZA 2ZI5A 1QBGA 3O8DA 4BO5A 3ICWA 3IAEA 4K88A 1EK5A 3IUPA 2UYHA 2QNRA 3QBDA 2QJWA 5CVTA 4GC9A 1H22A 3FPGA 3L8ZA 1VMEA 3CPJB 4RLZA 3GO4A 1AKVA 1XYYA 2NU7B 3DZIA 3UPDA 4EHAA 2VZ0A 4E5PA 3FCCA 3PI7A 3ZHYA 1JQAA 5CH5A 1BS9A 3ILYA 1OBCA 4XYBA 3OC0A 1G3QA 1W5EA 2FPWA 4AN0A 4L0QA 4PEVA 1LTHR 2UZ0A 1EEXB 2Y1XA 4LV8B 2XE6A 1IOZA 4O2RA 4TT3D 3KLMX 4L5AA 5AOCA 4MCAA 1C3JA 4CIBA 3TKAA 1N2ZA 3QU5A 3GFSA 3JTMA 3TM4A 4JX9A 3WP1B 2YQZA 1T0PA 2N75A 2RGAA 2X58A 3DAPA 4L95C 2NP7A 2EHDA 1CNMA 2IOFA 5KTPA 4U2BA 2QZ4A 4Z0HO 3UMYA 4GF5A 1A82A 1CP3A 4HDMB 4TOIA 5F76A 5G0TA 4EEXA 1EJ2A 4MEJA 4P7FA 3W2IA 1XDZA 5BN3A 5I7UA 1PR5A 2VSOA 3PA6A 4MW4A 5E7IA 1QVWA 1UPCA 1QR2A 2RHGB 1KY4A 5CUQA 1O95A 4FFLA 2AKYA 3T5MA 3TIGA 3NKVA 1THZA 5JZMA 4MPJA 1C9NA 2IYAA 1D7AA 4PR3A 1ECBA 2ZJ3A 4MVJM 4GBJA 2FN7A 2A2ZA 2Z2XA 4CT5A 1VSBA 4JJZA 1LA2A 4JBIA 2ZWIA 4BKUA 2VCYA 1J0XO 1C3EA 1EG7A 3WAJA 3JQFA 2J9RA 3VKVA 4HC4A 5LC1A 3HKBA 4Z1MD 3BT7A 4IF4A 2BGKA 4GMHA 1XMIA 2YTZA 4NHEA 3TINA 1L4YA 1WETA 2FW6A 2WFAA 3L5OA 3P5BA 2ATEA 1ADFA 5KB3A 1C7RA 1S7CA 3Q5DA 3T5AA 1MLDA 1XLVA 1X3LA 4UBOA 4EGCB 5BSKA 5BV7A 5I8WA 2UZ1A 5KWSA 4RTRA 3A31A 4LDRA 1IBCA 3AUUA 2JFNA 1NQAO 3OTGA 4LIPD 5ECWA 5JAUA 1G3MA 1O89A 1FOEB 3AWDA 4EMTA 4D0LB 1R3DA 1MGOA 2PLWA 1USGA 3GF4A 4GPAA 3TQTA 5GV8A 1NB0A 2BFWA 2PIDA 1NQTA 1PVVA 1SVMA 4ZV7A 2NU8B 4D80A 4WKBA 1VBNA 4UUOA 2BTQB 3ZG6A 1N5IA 1NQVA 1P4RA 3TMYA 2IEAA 3UJNA 4CZ2A 5JDCA 3KJXA 5A89A 1II0A 2EP5A 2YXEA 4S3MA 3L6EA 1QGZA 1EUQA 1PWXA 3V4SA 1GYRA 1ZCBA 4RM3A 2JLXA 4URUR 3ZGYA 3M6UA 3GJ0A 4MUEA 3HP7A 4MVJE 4XDHA 1Q0SA 1ZNYA 3NT2A 2PBRA 2W6JD 4FHZA 4KQGA 4B2YA 1H6DA 2IEBA 1KSFX 2C00A 3G85A 1G4UR 5DRTA 3RJ5A 3L41A 2XNDA 3V6MA 1TO6A 1O6ZA 5DASA 1GTZA 3PQFA 1PTKA 1B2RA 3P9QA 1YR7A 4FMDB 1GZUA 5F5XA 1KYIA 2IXEA 4CMGA 3I45A 2ZBPA 2A86A 5HJ2A 2I29A 5LLDA 3QU7A 2G7ZA 1SUWA 2JN9A 2Z2KA 3QA3E 5COAA 1KZYC 4LF8B 4PABA 1GRVA 3OLQA 4IOMA 4K2AA 2QDKA 4BNUA 4LY0A 5A6SB 1RDFA 4JBGA 2QEXB 3EC2A 1UPBA 1E2LA 5AXBA 3DAYA 3VDQA 3VVCA 3W3AD 1ZH6A 5KS2A 3FCYA 2G77B 4LYEA 1YIAA 3QH4A 4FFNA 2OSVA 4CF4A 2QGGA 1ZVQA 4D9NA 3I55B 1SUDA 2ODNA 5U9CA 2IH4A 1A1VA 2QLJA 3PFKA 4IJMA 2A5JA 1I2DA 1Z56C 2GF2A 1ZGCA 3KPJA 3F6SA 1JBQA 3T5GA 4BZZA 1E3WA 4YPVA 3CVXA 3WBFA 5FOUA 3NXSA 4PLCA 1RWBA 1OH6A 2X9QA 1NGSA 2W43A 1JDNA 1NPDA 1QOQB 5F64A 5FADA 2ZRFA 1SU7A 1OA1A 1QGOA 4YRDA 4R41A 2BHNA 3NC1C 5KDOA 1EDBA 2E3JA 3C8HA 3N8HA 1O03A 4A92A 5D2CA 3V5NA 2J0UB 2P78A 1XEWY 4MV1A 4YRPA 3G6KA 3ZHSA 4E46A 1GGHA 4E7OA 3L8FA 3F73A 4CM6A 3PI6A 2XH8A 1WOOA 2GESA 2RAPA 1HFEL 1HOTA 3QSYA 3IFSA 1F48A 5TMEA 2HL6A 3C4QA 3RRJA 1IU9A 2VJKA 5AW0A 2MYTA 4DR2B 5BSFA 4EGJA 3HBAA 4C4SA 2LGJA 4CF3A 1JYEA 1VLJA 4DE5A 4YCCA 2ACEA 2ODPA 3R5FA 1N2CB 2G9QA 4XFDA 4B40A 1AS3A 1JHAA 3E9MA 5FBZA 2YJ5A 3JARA 3OE5A 1Z0UA 4OBXA 4WBXC 4WWVA 5AI0A 2ZBUA 3C48A 4ZIRA 5KNBH 3AVVA 4H0NA 4JDPA 4DZTA 3L9WA 5KVVA 3CRZA 1P44A 2O8DB 4QQKA 3EOAI 2MSNA 4NKRA 1YR8A 3CVOA 3QLUA 2GCOB 2YV1A 3DFZA 2IPAB 2PRZA 3PUYA 4KXFB 1F9EA 1KMNA 1PFUA 4OL9A 2AVDA 4BATA 1CY4A 3WLHA 3AGPA 1EI9A 3T7CA 4EFKA 5J9FA 4G63A 3A1SA 2FR8A 4D2IA 1BQEA 2Q8QA 1HEIA 1E3TA 1CQJB 1SBTA 3CLUC 4I50B 3VNBA 2F67A 1SJ9A 3QZUA 1R64A 2QD5A 4G1BA 5JBNA 2AOUB 1TJPB 1P1CA 2XZPA 1NR7A 2R1ZA 4QBIA 3H5IA 1HXHA 1QHGA 2YBEA 3DBLA 3IOCA 4HJXA 3AHIA 4R8VA 1HWYA 2BR4A 3D8TA 4AVZA 3D6VA 1E7WA 3GA5A 4FX5A 1WA5A 3MS4A 4QYIA 5LP6B 2XUDA 4AZ3B 2BR5A 3SWWA 3Q8KA 2BI7A 2IZ7A 4KLAA 2QRVB 1NP6A 1FY2A 3NR2A 4ZQFA 3MM4A 3RFTA 4YJFB 2PZJA 4BVAA 1ZL2A 2AE1A 4RK1A 1AURA 3GUZA 2GWHA 3EPLA 4CUZA 1DJPA 1JNYA 3PLRA 5KAPA 3IV7A 3B6JA 2FYTA 3A36A 4I9UA 1YB4A 3KQSA 3PXDA 1CY6A 2YQ4A 4H31A 5FAXA 1IZ9A 3DB2A 3GMSA 4URWR 4XB1A 3NIFB 3IKVA 4O2LA 3U37A 1GGMA 4UARA 3G8DA 4WECA 1DV2A 2RI6A 1WCIA 3D81A 4KQHA 1C4XA 2Z1MA 4KRYA 1Q50A 1K6IA 4QPZA 4ZQEA 1J56A 1J09A 4QDTA 3VZBA 4Y0NA 2DVMA 2WRZA 1W0CA 3I5UA 5K05A 4FXOA 2NSYA 4FFMA 3PRKE 3CC7B 4DOMA 1G7RA 1QC5A 3SF0A 1V5IA 3BL6A 3PNYA 4CKWA 3Q5EA 3ZU6A 5DM70 1AOXA 4AQ7A 3A1TA 4CPDA 4R1UA 3V76A 4E51A 3GLIA 5HF9A 2FUCA 4FZVA 1YRLA 4FS3A 5HZGA 1JQ5A 2C5EA 1JDBB 1F4VA 1Z8DA 2F43B 1SUPA 2FP3A 1PYOA 1M8GA 3QBVA 4CFZA 1R8XA 1RT9A 3LNCA 4R84A 4EG3A 3B1WA 5HQTA 1XL0A 4JVSB 1K7FB 5EHZA 2OTLB 2GKSA 3I52A 4WPGA 4WOBA 5ELLA 5CA0F 4EZEA 3BMOA 3BYZA 4AIRA 4LSGA 7GPBA 3VO9A 4LY9A 1ICEA 3JVUA 4KW7A 1ZH4A 3R2JA 3CX7A 3L7KA 4QGBA 5CLJA 1CS4C 2I6SA 1D8AA 3QVWA 1MO6A 5FI0B 7YASA 1DAMA 4CODB 4DREA 3KOUA 4HXYA 1HX7A 2FSGA 1XMXA 2CXOA 1PR2A 3TAHA 3AUKA 1IRIA 5AKEA 2AMLA 4D9IA 2VYFA 4F2GA 3AC0A 1YO6A 1IZ0A 2V3WA 3O75A 2BKVA 2PWBA 1AB6A 3OJFA 4TXLA 4XVUA 4DT1A 1KK3A 1YOVB 1IDOA 4YAKA 4IF6A 4LJ8A 3L6UA 2VCHA 4ZGBA 2NUPA 3DAFA 1QHXA 3IA7A 4P84A 4HYQA 4EG5A 1P81A 3IIIA 2QXYA 3OG9A 1HKHA 2YWRA 1CR4A 4D0RA 5B5SA 4H7FA 1SD1A 3QE3A 3FTDA 5DWVA 1BVRA 1EGQA 2PMWB 4DN6A 4EQ6A 2LKDA 2PN1A 3CV3A 4E2ZA 1IN8A 4X90A 4NNPA 4DA7A 2Z6QA 2CJYA 2F1LA 1LWOA 3HLKA 5HBGA 3LU1A 4PN3A 5KVAA 3SOPA 4FFWA 1M34E 4HMPA 2G06A 2GZRA 3E3NA 3EAFA 3GVXA 3QE4A 2IHKA 4MGEA 3BGVA 2NSJA 4CEIB 3DTVD 4LJSA 3D8BA 3PHLA 3TQQA 2PEYA 4R8LA 3JQ7A 5I4BA 1WO8A 5BNFA 1M67A 3DOFA 5BQ5A 1O1YA 4FE4A 4HZIA 3FTFA 3ID6C 3BJIC 5FPSA 5ICFA 3STTA 2Q4DA 2MU1A 4AL4A 2GPAA 3ADCA 2PWZA 2DHEA 5HIAA 1FUIA 2ZZQA 1WB6A 1UBMS 4WWHA 3W90A 3T5DA 3ZDRA 1DQRA 3VAYA 2EFGA 2D7CA 2Y2VA 4QBFA 4BNDA 5LD2C 1WLYA 2Q8PA 2W83A 1O77A 4IMJB 2WJYA 3CONA 1XRSB 3BFXA 4J0HA 1BWRA 4UFNA 3QEKA 4PQRA 3VKHA 2BZSA 1JG2A 2HSZA 4BFXA 5L6LB 3A2NA 1ZK1A 4L9AA 4LQDA 5LYJB 4ZHQF 4QT0A 3HVJA 4JITA 1F7UA 2PT6A 4HNAA 1JQJC 4FLEA 5IARA 4F0JA 4HT3B 5LQMA 1WPGA 3PDCA 3DF7A 2ODTX 3ZJ4A 1LCIA 3QIVA 4Q3OA 1QRSA 4PQGA 1S8OA 2H9IA 3IPXA 4LV5B 3F6BX 3RSLA 1YXMA 2V45A 2IYFA 2RHJA 4GE0A 2QX4A 3KZKA 5AOVA 1KO7A 5A9RA 1VMIA 1M6VA 4LYJA 1KOLA 2N1MA 1E89A 3TR6A 3WSWA 2NUBA 4RKYA 2FEWB 1ZITA 4IHJB 4R69A 5HF8A 3GP3A 3TNFA 5KQRA 1HE2A 1MOZA 1QP8A 4GQNA 3NLLA 3PWZA 4LJ7A 5A9SA 1J21A 3W8NA 4UM9B 4JYAB 2WUWE 3KQLA 2DYIA 1YTLA 2QN3A 2VDPB 2GUGA 4QOEA 2PGDA 1QVZA 1Z2EA 5BR1A 4BTVA 3IP5A 2V0CA 2HA0A 4BB5A 5L3VA 4YCMA 1AGXA 1VE6A 3HFSA 4PO9A 2OO5C 4J0GA 3MAAC 3FFTA 2ZJ7A 3QKIA 2IZOA 4QOFA 1SBNE 3OZAA 1IUOA 4MCHA 5A03A 5ITSA 3RRXA 1XLTA 1SKUA 5LOVF 4ZYZA 2AN4A 5LQCA 4QJ4A 4KITB 4TZ6A 1FUKA 3A6EA 4DAOA 3JD3A 4RVUA 3F3KA 4B0PA 3DL7A 1WMBA 1D6SA 5L8VA 1QE5A 4I2NA 2XT9A 5JNVA 1Y8RB 3JRXA 1RQ7A 3TGLA 4OU5A 1XFDA 3IOEA 1YBHA 1W76A 4NS1A 4O2BF 5BOVA 4ZI2A 5BOSB 1XVAA 1EVJA 3GEPA 3Q5GA 4YRCA 3LRXA 4JT2A 1N2EA 3RREA 3EVFA 4G84A 5EJFA 4HAVA 1SCJA 5EIAA 4PX2A 5C7YA 3L4SO 1QUEA 2Q1XA 3P94A 5F3WB 3G1UA 3N74A 2IS4A 2XX3A 1CD5A 1G2PA 3RVSA 4LW8A 4DUGD 1EUDA 1NFQA 5IBCA 4Y6SA 4BO2A 1O96A 3BK2A 3KKQA 2WIFA 1XNJA 3HYNA 4N6NA 3C16C 3TKLA 3D9QX 3EFOA 4KZKA 3ENKA 2ZETA 5DSZA 1HDEA 5T6BA 2F4NA 1MEJA 1T1JA 4W1RA 2P11A 1SC6A 1AQ6A 2R6GA 3CJRA 5HMLA 1WBDA 1FFSA 1NN0A 2IUTA 2V7GA 1G291 3D7MA 4GWGA 4RZ2A 1TF5A 3PKJA 3VSCA 2YWEA 3ZBQA 4UULA 3H13A 3X2EA 3EJ6A 1QLJA 2NT3A 3FE2A 2B8TA 3KEMA 3TW4A 4AMGA 2IGBA 1J70A 3E5RA 3QX8A 2G5CA 2XWJI 3N7AA 3EGCA 3OOHA 4C7OB 4S24A 1C9YA 2P1DA 1OR8A 1DAEA 1S2OA 3AIIA 3CINA 3HUUA 2AR9A 4HN2A 4HQOA 3V48A 2BYTA 2QL5A 4ADSG 2GPWA 5REQB 1E7QA 1GUFA 4A36A 5C7OO 4ZO6A 4PYNA 4DEXA 2Q3DA 2OCYC 3LCVB 4L85A 5DF1A 5C1IA 2PTGA 4MH0R 5K6AC 3O82A 3PV0A 3E3OA 4JUIA 4LRQA 4C0XA 1L4HA 2C2KA 3ITKA 5DTMA 2RKWA 4GD3Q 1Q1AA 2QUZA 3E8SA 4Y7CA 2BC9A 1Q1NA 3JWEA 4UE6A 4IDHA 4GZ3A 4C4XA 3PPIA 2NPIA 1JQKA 1XZQA 1EA7A 3H1FA 5DEIA 5C4GB 3WIOA 4L6CA 1UBKS 3A9SA 1RC1A 2ZYRA 2ZM6B 1G20E 2GO7A 2GHIA 3NTLA 5KTRA 4ROXA 1N7JA 4B6GA 4RD2A 1OFVA 3OJEA 5LR6A 1CUZA 3K1JA 3TE7A 1KAHA 4NCKA 4GWLA 1Z88A 1JYFA 2FPPB 2AJLI 1TD1A 1TUBB 4TL9A 1KMIY 2FY8A 3ICQB 1PT6A 2PL3A 2QM8A 4ON9A 2VN8A 2WC1A 2D5LA 2PWYA 4OHCA 2GJ9A 2LIPA 3H5AA 3OQJA 3V32A 4ALMA 1WSBA 4CKYA 1VRCA 1NB9A 3VPBA 3H8JA 4A26A 3IIJA 2Q62A 3UHJA 4FFBA 4NU8X 1DBIA 1YQ9A 1I3MA 3L79A 3K0CA 3ZKWB 2TRSB 1NQWA 3GT7A 5IH7A 2QYHA 2MYPA 2I3BA 3DZGA 3OZDA 3H0CA 4NQZA 2AKAB 1TUEA 1TGVA 3E53A 3C3KA 4IDOA 3WQSB 2ZJBA 4MRAA 5D00A 5LQJA 5LOVA 2VQEB 4EMUA 1MOSA 4WZLA 1SC4A 2WJWA 5DHTA 5K2MA 4A23A 3CU5A 2XWSA 3AFIA 1TW2A 3P2JA 1ZOIA 2X5OA 3F6PA 5DSTA 3SJBA 2YUTA 3PU6A 3TIFA 1BOFA 1UAAA 5B1EA 4QVKA 3KQQA 3RYFA 4CKBB 2G6TA 1CRQA 2WI8A 4O2BA 3WGTA 4OH7A 1BWSA 1V9SA 1YH3A 4X1YB 3V4ZA 1XN1A 3TTTA 3FPSA 5E4YA 2R00A 1YA8A 3G88A 3T4EA 3ZCVA 2W6OA 2QI9C 4XARA 2EWVA 1FE8A 3C5CA 3LKDA 5FO1A 3L7AA 4S1NA 5FOVA 3U44B 5I9IA 2E48A 1EPUA 3PA2A 1M6YA 4RXTA 3R75A 2WQ7A 3DLPX 5CFLA 2LVBA 2XDQA 4FP9A 1D7OA 4YJ3F 1S4QA 3NOQA 4EENA 1YZLA 3T3PB 1XMVA 4OY3A 1N92A 4FT4A 2VSYA 5IVDA 1XKTA 2HF2A 4ID3A 4X44A 4DQVA 1CUXA 3M5CA 1QIIA 3WZ2A 3JAWA 2NU6B 3ACBA 3BGSA 2R6DA 3GLRA 3MMPA 3AVTA 2EC5A 2ZSKA 1BMQA 4MJXA 4NZMA 5CIQA 4Z3OA 3U9LA 4C05A 5JHGB 3HRKA 2CUZA 3I76A 1DUIA 1IZYA 1WXXA 3K35A 3DKIA 4N0EA 4RXMA 3IR5A 2XNKA 2O2GA 1JNXX 1QGUB 4YQFA 1VPDA 1ZIDA 1SQ0A 3C74A 1PZFA 3B7PA 1E58A 1EM8B 1IEXA 4XXHA 2BF4A 5JBQA 1C5KA 3WGVA 4DCVA 5B1HA 5FKJA 2QB5A 5EERA 421PA 5ILOA 1MX1A 1L8XA 3KTAA 3UGKA 4CN9A 5JNTA 2JLAA 1SBQA 5BRJA 4XM3A 1KYWA 2I1LA 2IS1A 2ZFUA 2A3NA 4A0QA 4I7EA 3KOMA 1KJYA 4NEQA 2FW7A 5FWXB 4QJIA 1SQGA 4LZPA 1XQ9A 5ER6A 3C3BA 1ISIA 3JASA 4FU0A 1J5XA 1VZ2A 3OU7A 1R4NB 2X7HA 5EP4A 4G1UC 2LXNA 1FTYA 1FRFS 4CM4B 2YHIA 5AYVA 5AVXA 3PR3A 4BMVA 3L4KA 1C30A 5I9NA 2EJUA 4FYPA 1XQYA 1DJQA 2P30A 1UADA 2XMRA 4JL5A 3ZK9A 4MI1A 3A0RB 4C9BA 2IYXA 3Q6IA 1UMCB 4OB6A 3ROQA 4D74A 5DBOA 2GM4A 1U7ZA 3F96A 2PXHA 1MJGA 1QS0B 4O4IB 4EY4A 5AVQA 1AGYA 3D8NA 2YYSA 3TLZA 2QTBA 5LZ7A 1LGYA 1UAYA 1AHIA 2PY6A 2RB5A 3LQFA 3MT8A 5CT8A 4BVKA 2O4UX 1ZJ4A 1MR3F 3BH0A 3LUCA 4GE3A 2HI0A 2O2EA 3CCUB 4HUQB 4MB0A 1GKIA 1G8YA 1QG4A 1XN4A 1KAGA 3IR6A 4Q93A 3V1NA 5FOXA 1CUGA 3JWGA 1YVRA 1G9TA 1ACLA 1H1LB 3IBCA 3K9LA 3OD1A 4HYYA 5TB5A 3H18A 4D46A 5CXUA 4PRZA 3OIYA 4LDNA 4YFVA 2NMVA 5I3CA 2V7QA 3PWSA 1P7PA 2E49A 3KYCA 3TLKA 2IIVA 5A7GA 5ICEA 3FTEA 2PUFA 1AU9A 1WY5A 4XM0A 3TL3A 1M2VB 2XGMA 3OIFA 1PF7E 4IH4A 4R8MA 5L6MB 1Y6GA 3A3GA 2BM1A 5FWNA 1ZUWA 1AUQA 2O5VA 3BD6A 2HDHA 1PVDA 4FTWA 2GZAA 1F60A 2R5FA 4OI4A 2CLCX 4DR7B 4OXKA 4DY6A 521PA 2JCXA 4F8EA 4X1OA 3UPUA 3GJRA 3CZCA 1T8WA 5L53A 5KWVA 2O3TA 3V46A 2DBRA 3DBVO 1IATA 1PSWA 3F6RA 4JMQA 4Y2PA 4XQEA 1CR1A 4YJ3A 3V7NA 1MIOA 3DE3X 1E6KA 4DRXB 3LBHA 4F06A 1QG2A 1MT3A 4Z4CA 1FNNA 1XF9A 2GVZC 2YN2A 4PLPA 4C6TB 4EY8A 2ZKLA 1QHHA 1E3LA 3ETNA 3DOIA 1W49A 3HCRA 1SWWA 1CP2A 1R6XA 2PFGA 3WIUA 3K1AA 1FYEA 2I4IA 3SR0A 1VKOA 2ZI9A 3E3AA 3R6KA 1D1NA 3N6XA 2YIDA 3EUFA 4BMPB 1Y9ZA 1U8TA 3TPCA 2AFRA 4MQBA 4O2AB 3ESCA 3LA8A 1E18A 4FC6A 1OTYA 3KKOA 4E1VA 4YT4A 3PL1A 4DCPA 4H3HB 1NVEA 4L51A 1GILA 3K5WA 2OCGA 2QX8A 3H1BA 2HTEA 4K5QA 4QKQA 4OKSA 3DVAA 3UAGA 1TYBE 1IIBA 3AJ8A 2WYRA 1V71A 1RWOA 1VI6A 3JWJA 4U4AA 2WE8A 5PGMA 3RROA 2WMNB 3H2SA 3KLOA 1QGED 3HNPA 4P0PB 3SBOA 3NB0A 2IELA 4II3A 1N2GA 4J7XA 4DCSA 3ENWA 2TMYA 3HLTA 4BLSA 2G5PA 1OWPA 3JAMA 4QGAA 1VHTA 2NO7A 2VJMB 4ECAA 1RRGA 5CG1A 3AFGA 5EG5A 1FP6A 4X6YA 4K6HA 4FPXA 2P41A 1P1KA 2FN3A 3EVBA 3DWIA 4JASB 4PV7A 3L18A 4BVLA 1VYTA 1BW9A 4TKVB 4B4WA 3GL9A 4BJ3A 3TJRA 4CM1A 4EG0A 3SHQA 5CCEA 1HT0A 2YV3A 2FWIA 4KEAA 4PSUA 7AT1A 5C0OE 4KXWA 2OZLB 1DI0A 4ND6A 1ZHHA 5KX5A 1G3IA 1E9AA 3L4BC 3OAAD 2OBYA 4XGIA 1HDOA 1PZXA 3VKWA 1Y80A 4X7PA 5K8IA 1REQB 1NVKA 1ZUD1 3RUHA 4D9GA 4LGMA 2IE8A 5KCZA 3U2QA 4NV3A 1LZKA 1SZCA 2I4LA 5LNK1 4F6CA 1ULAA 1YB1A 3ZCPA 4CMIA 4PGHA 4DPLA 3JYLA 4FCTA 4GZMA 3ZY6A 1CZHA 1XCGB 5LL6P 4RH0A 1PYDA 1ZFNA 2GEJA 2JLQA 5FBQB 3O5AA 4NATA 5AW1A 4P58A 1X7GA 4EJ6A 3MA0A 4B83A 1MA0A 1DAOA 5IULC 1JG4A 3G7NA 5CNJA 1OILA 1NW8A 1XU9A 4WASA 3SZUA 3QSGA 3QWAA 4LGVA 2UXCB 3G89A 3T06B 1PNRA 1Q11A 4JBXA 4QODA 3AR2A 4JQCA 2CCGA 3RRFA 2CV2A 3OCXA 1HDIA 4A5OA 4IFIA 3LC2O 4IXDA 5EZYF 4I5DA 3RCBA 4JSYA 1L7MA 3MJVA 3N2ZB 4BLTA 4F1KA 1WTAA 3LCUA 3IUMA 5EAIA 1ID8A 3T6KA 2DWPA 4W1PA 4UAGA 2GZ3A 3GRPA 4M98A 3FNFA 4LJYA 5I5EA 3KWFA 2F3PA 3AG6A 2CNLA 2BP7A 5G0UA 3OW7A 4LVUA 2O0MA 4PCUA 3DHYA 5NLLA 2J7PD 3L1UA 1V1RA 5HZAA 5HG0A 4A6PA 1KWGA 3W5CA 1RZ3A 3WB2A 1L9XA 3F4BA 5L3RA 5CURA 1S01A 1JA0A 2X76A 2G09A 2WUEA 3AYXB 5FOWA 5DH9A 1TDJA 2NSHA 1TX4B 1UZMA 1CZNA 2QVGA 4Z8XA 4ZV9A 5H4GA 1U2TA 1A5AB 4KIFA 3DE1X 5DGHA 2OG2A 3PHJA 4CT0A 2AXEA 3WK5A 1F8FA 3KETA 1FJGB 1FNCA 2Y9PB 4OMDA 4BNIA 4D8YA 4Q66C 3A9WA 1SCQA 1VI5A 3SEJA 2R6ZA 4XWAA 1KH2A 1N3BA 5DM4A 4AJ9A 5C3MA 2R6CA 1BN7A 4IV8A 3GCZA 1PWZA 2G83A 1PJ7A 2W4MA 1DEAA 1SVWA 5AJXA 1BFKA 3ORFA 1JDJA 1YZVA 2M2IA 1GGNA 3L3BA 2Q99A 4J1QA 4KWHA 5IVIA 1H6CA 3AEZA 2Y8EA 4LXUA 2RCNA 3IEXA 1J4AA 3UMVA 4WADA 1M90D 1GSIA 1MB0A 2BKLA 3HBLA 3ND5A 4NEHB 3CLRC 3OE1A 4UTZA 4Y2HA 1MC8A 1HYGA 1FS4A 1WHSB 1GXSB 4AP5A 2QTGA 2PG3A 5AW7A 1O95C 1NOIA 3COJA 1P7ZA 2Y92A 2PAAA 5KC9A 3HQ4O 4GZ5A 4K9PA 4RPKA 5DYIA 3H05A 1QH8A 3EWIA 1CK4A 2LW7A 1KY5A 5J1SB 2PX3A 4W9MC 1RXEA 3AR8A 1Y98A 4M8IA 3JQFC 1KQ3A 3RWOA 4CBVA 3ONVA 4LNUA 1DQYA 4QPJC 5CT4A 1PTJA 1YVEI 1PL6A 4I1VA 4MXDA 1NG9A 2AMJA 2GBLA 3DEJA 1SA0A 2XB8A 1NURA 2N42A 2P2ZA 2VDQB 3EGDB 3HXTA 5EYPA 1NNEA 2BMWA 3DQPA 2MYUA 2WFLA 4NOMA 4KR7A 2D0DA 1CU1A 3BUSA 1XCJA 3LCJA 4YROA 3S1AB 1Q2XA 4H6VA 1C8LA 1X7YA 2GYWA 2F8SA 2ZIEA 3C8MA 4KUGA 4YQEA 3RSZA 4AJEA 1DWPA 2OC4A 1IRXA 4QJ5A 3ZGLA 4FGZA 3O73A 4QV2A 3OQVA 1M7GA 4DLZA 1NVUQ 1N07A 3AY3A 3PC8A 4FE7A 2H57A 2C9MA 2GCEA 3DKVA 2VYND 3CCFA 4XCXA 3VISA 4BS9A 4EY6A 1E1KA 2GNOA 2ZL6A 2QLFA 1M34B 4H16A 4HVTA 1HYEA 5E6SA 3SLKA 1YZQA 1QNLA 1U11A 3DJYA 1TLTA 4NULA 4L9RA 8OHMA 2M1ZA 3KXDA 4YCDA 3U4IA 3THYA 4BN4A 2H1OA 1ORDA 2VJJA 3PG5A 3F1LA 3RH0A 2W6ID 4CU2A 1Z5GA 5IANA 1ODKA 2WUVA 4RF2A 4XASA 1Z4OA 4Q3DA 2B0JA 5IASA 4DM7A 1DZ3A 4LI0A 2JFZA 2IOQA 1JEQA 4YT8A 3ZZTA 2XIQA 4LTMA 1A97A 5J2UA 4LI3X 2YXLA 3VVMA 3QUAA 4F3CA 3TFWA 2PD4A 4QTZA 4FUQA 2W98A 3GFTA 4XGRA 5TEVA 1QYXA 3GA7A 1OYYA 1LRKA 2JCVA 4NYIR 1IUNA 3FDXA 4J8PA 4P4UA 4Q3NA 1OXXK 3A4LA 3GMTA 4P4TA 4UNQA 4C01A 5FLYA 4RTKA 2ZT8A 3WOVA 5DTQA 1DCKA 1OFUX 1KJWA 1PGJA 3G9TA 4IINA 4IIUA 1D07A 4LISA 2DY1A 1RS0A 7MHTA 1ISMA 4UZSA 5FP0A 5DX1A 3HA2A 1EBFA 5BV0A 2OUIA 2DPGA 3MHTA 4K86A 1LQTA 4EL0A 4RWZA 1XB2A 1SXIA 2ZATA 3BULA 4NMMA 4C3VA 4IRUB 1IEQA 2VDWB 2VXCA 4HPJB 4ZO9A 3UJ6A 5AW8A 3VNVA 3S8MA 1WD5A 4Q03A 5EQFA 1AE1A 1CE8A 1YQUA 2H0QA 3MINA 4I55A 2A9OA 4EUKA 2FW8A 3QW4B 4RPCA 1U94A 1ATIA 3M6MD 4R2IA 3T61A 1H8EA 1FJ2A 1WXWA 1CJVC 3DR5A 3IQFA 1Q1QA 3AO0B 3K20A 2YHSA 4OHFA 3UK2A 1NMSA 2HZ7A 1LNZA 2X8LA 4GI5A 5K4AA 2LIVA 2P2GA 2PRIA 5KCMA 4HKTA 2C7VA 1IQPA 4GR4A 3UVEA 4AJJA 4Z9AA 2NVUA 5J4KA 4WBNF 1XI2A 2V7WA 3F6EX 1PR9A 5JRJA 4RSGA 5DE3A 2H1LA 1UXHA 4BZXA 2X9NA 4IJ5A 2QSUA 3F98A 1DWQA 1T0BA 4AZ0A 4C6SA 2C9OA 3L77A 4Q4JB 5MN6A 4P3PA 4MR7B 1YI2B 1AG9A 2BF7A 2C82A 2GM5A 4KPFC 5JYBA 2OFWA 3AOEA 1JMYA 1PJAA 1BJTA 1H0RA 5IAAA 1XRJA 1J2EA 3AG5A 2FPLA 4HTFA 3QLUC 2VZ9A 4OQFA 2AK3A 1RR6A 3BIOA 1L4FA 1KE1A 5SYNA 3SXUB 4TTRA 1QIFA 1QP7A 3AUJB 4UVGA 2O0HA 4XWOA 1THMA 1H9AA 2XA9A 1XDGA 2EU8A 1VCNA 2ADOA 2FR8C 1HZEA 3EW9A 1EZZA 3NEYA 3NT4A 4PE5B 1T9DA 4OFXA 4WNAA 3RODA 4AKHA 3F78A 4PZDA 5SYAA 2JIOA 1NF2A 4G56A 1NW9B 4K6CA 4YXWD 3IAAA 2F1JA 1OC4A 2HH9A 2OM2A 4P12A 3PTAA 1U0NA 2X8JA 4M7PA 1FXWA 3ANYB 4DQUA 2I4NA 5EWLA 5CB4F 2WZPP 3U4MA 1UMBA 1K9MD 4HRXA 1FCJA 2F62A 3HACA 5ESXA 1KERA 3VZSA 4DIUA 2CMKA 1LV8A 4Z4FA 1JBEA 1JDVA 2P9TA 1AX9A 3A05A 1VE1A 3Q88A 3QX9A 4MEAA 4ZXPA 3VC1A 4WW0A 3AH8A 2Z1DA 1RQLA 2ABWA 3CH7A 1KFBB 1M6WA 2AOXA 1ZK4A 1EFPB 3OWHA 2ASVA 4IXTA 5KEIA 1X39A 4RVFA 3GZTB 1W7AA 3EGXB 3Q7TA 4N5DA 2X6YA 1R0LA 4XX0B 2I0FA 3RFUA 3N3BC 4TVOA 5CCBA 2NPOA 3AV3A 1EFRA 2Z30A 5IYZF 1BGWA 3KUUA 5I7OA 1TJNA 4JLPA 3ZYCA 3EWNA 3JYNA 1X1EA 1V6SA 1JRLA 5H82A 4MW9A 2OCBA 3LGXA 2EZ4A 3LHFA 2ZUVA 3HRIA 4E2XA 3S2UA 1M5TA 4IZIA 4JXZA 1MHPA 4L5IA 1TW3A 1JAYA 2B5VA 1G64A 3KKPA 2ZXHA 4GYJA 4XLTA 3DGFC 4PAOA 1IN1A 5D84A 3WNQA 3A37A 3IYLW 2WB2A 1RP1A 3UFXB 4MS1B 2IV7A 1OOEA 2IH2A 2IZ1A 3A4MA 3FUXA 3R77A 3RWBA 1FNSA 1DKOA 1P19A 4XQ9A 3KCNA 2ZZKA 1V5FA 3BXFA 1VBFA 2BMJA 2PRKA 1KR2A 2IEZA 3FTNA 3KR0A 3NIGB 4PQFA 3GLTA 1LDNA 1SO8A 2FXIA 5EKSA 4Z3KA 3Q2KA 1U0HC 3N05A 5C1DA 4C6HA 3CESA 1F3LA 1FFYA 4F5ZA 4ZO4A 3C15C 4O8ZA 3PT9A 3M9LA 4L0DA 3VQTA 5ADHA 2OAP1 1NUQA 3ETJA 1I2ZA 4JUCA 4JLMA 2NTVA 4LXQA 3QU4A 1WG8A 2VTDA 4WFKA 3RYHB 2QT9A 4ZQIA 2B5OA 1E5DA 2G82A 1T5IA 2LD4A 2Q5OA 2HADA 2ZIAA 1A88A 3H2IA 3ZH2A 5IWAB 1NOJA 5ALIA 4WBNA 5D85A 4WJKB 1Y5RA 1W4LA 3CKKA 5JJCA 1WEHA 1T5OA 4U5XA 1W8IA 3ZWBA 4QX6A 3GLGA 4B09A 5AKGA 3P4UA 4EFLA 1DAHA 1M2OB 4DZRA 2REXB 2VO1A 2B2CA 2O2SA 2WICA 4IVPA 4BWVA 1K3UB 3EIFA 3R0VA 2SCUA 2CSUA 1E5TA 2ZOSA 1RWMA 1SQSA 3CNBA 3EC1A 3LFHA 4LEIA 1V43A 4ZOCA 1GIAA 3FH0A 5EJMA 2OGUA 5LKAA 3HUEA 5F4JA 3DKKA 3GBPA 3UAVA 1RAIA 4DLAA 1RXIA 3BERA 2IYYA 1AUOA 5LLSA 1TB4A 3QF4A 4QOHA 2K2QB 4WLFA 3AP2A 3W9UA 1MT0A 1UBHS 2WHPA 2YRFA 5TC4A 2Y68A 3SXPA 1DJMA 2O3RA 2FSUA 3OM0A 3R5KA 3UJBA 3KB2A 4BCDA 4PYLA 1YF3A 1X9HA 1CCWA 3ME5A 3KBOA 1TUGA 1WVIA 1TU3A 2ZT5A 1PS9A 3MWDA 4YGYA 1I36A 1JHPA 1XQVA 2BHSA 3VR4H 2QRKA 4JJ4A 1UKCA 4MTLA 5K6RA 1F2DA 1DTWB 1HPLA 3FBTA 3GJ3A 4M54A 5FBRB 1J2YA 1JVSA 2WVGA 5KOIA 1FFCA 5MFZA 1C3VA 3MHPA 5E6TA 1NONA 1NTOA 2OMEA 3AB7A 4V3BA 4XUEA 4Q37A 3ZLVA 4NLLA 5BRNA 3A4VA 3CNOA 3KOWA 1YQEA 2AFHE 2H1IA 4MWZA 2IUUA 4NIMA 2EKDA 4MA4A 3OQPA 3KVVA 2OV6A 1ZMBA 3LX6A 5TVGA 3AFOA 4KE7A 5A0TA 5IYZA 1OKKA 2J48A 3PPYA 4XCVA 2O8BB 2ZQYA 3CXUA 3I2YX 4NNOA 5M5BA 3F3YA 5EJAA 1U2EA 5EUQB 4G3XA 2QLTA 1ZD1A 2B30A 3OMLA 1XSEA 4OHMA 2G70A 1XX6A 4QNMA 1ZOOA 2XCUA 5D3ZA 2FK7A 2ZE5A 1RC8A 3TSZA 1NI5A 2JFYA 1NBWB 1CUBA 5KC8A 3UG6A 1OJ7A 3MD0A 2J5KA 4TQUS 2ISSD 4V1CI 1JEYA 2P77A 2C94A 4RNCA 2C99A 1ZOSA 2CB0A 3ROGA 2A67A 1UT6A 1IWBB 4PS1A 5KTNA 1G8JA 1UPXA 2PX6A 3MXOA 3C6XA 2FUNB 4B4DA 4QGGA 1B0PA 2VSFA 4OQYA 4RK5A 3V7AA 4OYHA 4US2R 2QMOA 4MQUA 1JAHA 4IJQA 1MEOA 4PZEA 4BU1A 1TAUA 3CE9A 4RIGA 5JOQA 5BVHA 2QVLA 3R0XA 2W58A 3COPA 2AIRA 2D13A 2Z2YA 3EFBA 4DLUA 4G5GA 4A0HA 4B6SA 1E2NA 3IBYA 1ODSA 1NU8A 3LXUX 1ZQ1A 2ONZA 3RNOA 1CNFA 3UJDA 3PUHA 2DC1A 4H1UA 4OHBA 3C45A 1TIKA 3Q3HA 1BH6A 1S2NA 2E85A 4KYTA 1QCCA 1JHXA 3OPOA 4RUKA 4PHTA 1GQYA 2IYPA 2P2YA 4RETA 1XMOB 4OUDA 1XQ6A 2O6LA 3SGLA 4BMXA 4YP6A 2COEA 1F51E 2IEDA 2FWJA 3OPYB 2FZEA 1MBZA 2PZMA 3OJ0A 1TI7A 3PDIB 2BFBB 3UT5A 3OZFA 3LGSA 1R4MA 2X86A 1MTZA 3EZ2A 4NC9A 1FJXA 1GLNA 5AHOA 3VUEA 2O2DA 1P4JA 4TV9F 4EYSA 5JCZA 3WB0A 5T4HA 1UP7A 4P5PA 1RI3A 2D06A 1XLTC 4HDSB 4RPLA 5IMBA 4HADA 1VQMB 2OCAA 3UZUA 4JV5B 1BS2A 3FXAA 4FDMA 4MKXA 1QIMA 1D1PA 1SCKA 4WLUA 4PN7A 3NRJA 2Z83A 1KIMA 1Z26A 3VXKA 1O6CA 2XD4A 4KWTA 1YHYA 2P62A 3F1KA 4TTSA 5P21A 2WYHA 1T2NA 2A8YA 2IX9A 2O3QA 2JCBA 1L7VC 3E5MA 1B6SA 5HDBB 2OFFA 4JHXA 3QVKA 2IYRA 3KSZO 4NJMB 1XD2B 1ZVMA 3HLYA 1GNLA 3BGOS 3I9MA 4YP9A 1UBEA 1Z0SA 2AZ4A 4IRXA 3RT9A 4IXNA 3T7DA 3K9CA 2R8YA 4W9NA 2ZXUA 5E9AA 1JVBA 1L7NA 2C0PA 3LUGA 3VHRA 3WTCA 3QJ5A 4LGCA 5HKKA 1EHYA 1QKJA 4WE3A 4CI9A 4DARA 4YXFA 1FMTA 3V8BA 1Z83A 2JB9A 4H6WA 2ACVA 1OWMA 2V7TA 2PGOA 3KQYA 4ITRC 4JI6B 3I05A 4RJTA 1MRSA 1UXOA 5EMMA 1XDDA 3WLMA 3OY7A 2JIZD 2ONCA 3IAHA 1U2DA 3HTXA 1Q22A 4P7KA 3Q9UA 1X6VA 1VZ3A 1JN0A 2Y27A 4QQFA 1EFTA 4MQFA 4ZCSA 1J23A 5AVZA 5IEJA 3A9UA 4M9RA 3VVBA 5IT0A 1U0FA 1Q7BA 2DH6A 3EIQA 5LXTB 3FHOA 5EJ2A 1OHHA 3P9XA 1R3UA 4G2NA 5IDXA 3TNYA 1NJ6A 1BEUB 3CLRD 4OXQA 3W06A 3IKMB 4JNKA 3DMRA 5KPDA 3I12A 3CCEB 1G38A 4S35A 4JBNA 1VSUA 4FGKA 4G5OA 5KYGA 4M1MA 1EFCA 4YB8A 4YI3A 1K0UA 4IM7A 1VYVA 1KI2A 3JZAA 1LK7A 2F1KA 3MJDA 2AW3A 3DZBA 4RORA 4AT1A 1P4HA 3ZQKA 4BO9A 4Q7QA 3ZXYA 3QJYA 1NX9A 3JQAA 1JVNA 4X05A 2Q3FA 5BV8A 1KDRA 1V5EA 4EFDA 1TADA 5IAKA 5IKEA 2WZCA 5DWDA 3NHMA 3GJQA 4ZVLA 1YS6A 1RWQA 5BV2P 2HT1A 3EDOA 2WM2A 1FLAA 1O2DA 1XTKA 2BEUA 3B1KA 3OSZA 3CT6A 3TNJA 3T34A 5D5HA 3CBQA 5DIFA 1AMUA 3ZIUA 5COBA 1FVFA 4CGZA 3CE6A 4RMNA 5G4KB 4F4UA 3KE8A 3WV4A 2CXRA 3OZWA 4M53A 3IDAA 4HYEA 2BFNA 2XYRA 4HEHA 4MUKA 3WGGA 4OHUA 3BGIA 3LM8A 4FHFA 1RM4A 5E6UB 1C9JA 2DETA 6ABPA 3H1AA 1T35A 4UNIA 5HR5A 1RC0A 1WTHD 3D59A 3DAGA 1DKNA 1LWNA 3KYIB 4J91A 3SZMA 4DA0A 1AUXA 2WV9A 4LZNA 4FN4A 2IUFA 3EA0A 1Y1PA 1U8CB 3CW9A 3IT2A 1RMQA 4NX2A 5FORA 1A69A 5TLSA 4AX4A 1JKFA 4HH3C 4U2GA 4ZCIA 5ITVA 3GIWA 1YZYA 1R5OA 5CIYA 3W8FA 1RAHA 4HNHA 3VO2A 4A10A 2AZXA 3OQ1A 2HDOA 1PEKE 4AP9A 3BC1A 4Z54A 2GAJA 3MCTA 2IV2X 3BQJA 1WXFA 2H2HA 3EEYA 2FSIA 5FR2A 3RRZA 4WRRA 1NVMB 1FDIA 3ESDA 1PUIA 3LYHA 3PXEA 4Q9IA 3RR2A 2O8CA 4WQMA 1Q3TA 1IOWA 3JU4A 1E2QA 1OLUB 4ENPA 4KNVA 1IWPB 5L3QB 3MWKA 1OX4B 4AJ2A 4EWLA 1BLIA 1DIBA 2MMCA 1BE6A 3RRBA 2YVKA 1HEYA 3CLKA 3RUIA 1A9XB 2NZWA 5L3ZA 3OESA 4LF6B 4MVJG 4KVGA 3UCXA 1NLUA 2DFTA 3QVGB 1A1SA 1DC5A 2C8KA 4JGIA 4RW0A 5K4GA 3UAXA 4ZANA 4M9CA 4CT4B 5F73A 4Y2JA 1DUSA 9GPBA 4XORA 3ORQA 3QKRB 4RIFA 3ZK7A 3ZY4A 1PZMA 1XZJA 1WKCA 3ETLA 2EX4A 5KQMA 2VZ8A 4IIFA 2IX3A 3V2GA 2D1YA 1OWLA 1Y6QA 2WPNA 2QM3A 3B9PA 4Q7LA 1QIKA 3G5LA 4FHGA 2G4LA 4ISCA 1CB0A 1XDWA 3KJIA 1HLDA 3S2SA 3IRUA 4MUNA 1OVGA 4UPVA 1M8KA 3OFKA 4Y1FA 5A04A 4CFYA 3ASUA 5ALKA 3S1SA 2IYSA 4G0XA 5EJEA 4RTQA 2P2CA 4NDZA 4OJQA 2A0XA 3K9HA 4ZO8A 3V1KA 1SK8A 3FG9A 4MLCA 5FO0A 1PQYA 2J0VA 4NZ9A 1UPTA 1GPMA 1D9ZA 2OB2A 2ZB7A 3EVZA 3A0UA 4E5KA 4DWJA 2X2OA 4P1ZA 3ODPA 2IY8A 3RVJA 1M0SA 4REQA 4C5BA 2BBWA 3PNQA 3PUWA 2C54A 1GR0A 1TF2A 2RIPA 2J5RA 2BI4A 3VI3B 5F7XA 5JCXA 1JB9A 3F74A 3AUAA 3HKDB 3KT6A 3S6JA 3BWMA 2Q4OA 5IYNA 5BVGB 4FYKA 2I4TA 2C4NA 4JVMA 3RSOA 3BCDA 1PWEA 4HHEA 3OY2A 1EVKA 1YVUA 2NW6A 4UTRA 4OP2A 3QEMB 1R0CA 3IMCA 4HDAA 3N8IA 4RSRA 1KR5A 5TJ9A 2IW3A 2QZ9A 2Y1LA 4XWWA 3C5HA 4ZC1A 2H7VA 2QWXA 3X1YA 2NZXA 4I4LA 5JXGA 2O05A 1ZSVA 2C04A 3VU9B 1JTEA 5LJIA 1BXGA 1BCSB 1V47A 4O1HA 4CEJA 2YYYA 4AY6A 3JY6A 1Q0UA 3OT4A 1IQRA 1EKXA 1VP9A 3GHYA 2MSKA 1VJDA 4FCCA 2QTAA 5J5AA 2H59A 3EGWA 2WVHA 4BEBA 4IUCS 4J1SA 3L0BA 4JL8A 1V1MA 2BELA 4XTCS 5EUMA 3OLCX 5KKAA 3OLXA 1BKDR 5T4BA 5HVNA 2C4MA 2O8VA 4RABA 2GXQA 1WU8A 2ZEJA 3TQFA 3D7SA 3UWPA 4JQSA 1ZJWA 3O8QB 1X87A 1Y1RA 2BFCA 3H86A 4KVFA 4Q9DA 4US1R 3ZQ4A 1CQPA 2YHBA 5DCUA 4QXMA 3GVLA 5FL7A 1PZNA 2A78A 4FZJA 4BX2A 1PFWA 2R25B 3LSYA 4HSEA 1J9GA 3G0DA 3KSMA 4F2DA 3R6JA 1NIJA 4XLCA 1SD5A 3H3JA 4MKIA 3F4KA 3PD0A 3H9GA 5H02A 1W8DA 3T4PA 1CNEA 4Z99A 4XDZA 1PJLA 4ZVNA 1KRXA 1A9ZA 1JT2A 4REOA 3EIEA 1U8AA 1KKLA 1DP4A 4KQ1A 4NCNA 2NU9A 5H7XA 3RSGA 1GG2A 1R0SA 4YDRA 4YAGA 1TM3E 5JROA 3OTOB 5IK2D 2I3GA 3N2YA 5B1DA 2WM8A 4J4HA 4D9JA 2ODEA 2NV6A 4NE2A 3WYFA 3RU7A 4QHYA 4RHYA 1FP4B 4BP3A 1II9A 4YJ2F 5BMVF 3N6VA 1L5ZA 5AM2A 5LDDC 5T8KC 4MUIA 1Z74A 2W42A 4AULA 3A4NA 3GPLA 3ZXXA 1X1SA 1LX6A 3H2ZA 4CN8A 3GJ8A 4PWYA 3O90A 4INJA 4LF7B 1H85A 2RJ3A 4U3JB 4CLOB 1ZRMA 3DVLA 4Z53A 3ZVNA 2VP6A 4RK7A 2FP4A 2PJZA 3EG9B 1UEIA 1Y3AA 4H7DA 2A9FA 4MKHA 4MTCA 4UFPA 1D5CA 2H85A 5KJCA 1H5UA 3DD5A 3ZD6A 2CMDA 2C8VA 3D2BA 3SVTA 1OB0A 2ZYDA 5CDTA 2P9JA 4C3OB 2LRHA 3B60A 1JU3A 3G8YA 3NV7A 5T57A 3T7TA 4OGFA 1QTIA 2ZAGA 3T9CA 1JW9B 2QRNA 1YK1A 3D4PA 4EZBA 2GBCA 1LEHA 5EZQA 3R7WA 4PQYA 3AF4A 1KAOA 3FWKA 4MARA 4XM1A 4R6XA 3BNWA 3KOZA 3CUTA 4NYMQ 5HSGA 2JCSA 3KLBA 4JCOA 2C98A 1QP0A 3QE2A 3VZRA 3TOZA 1V1JA 1PT5A 2QZPA 1JFFB 1G55A 3O6VA 3IAS1 1Q7EA 5DBIA 2Q5EA 4D0NA 5K3OA 1L4MA 1U4SA 3VC7A 2FKNA 3OLYA 1FNBA 2Y6UA 3WMFA 1CUHA 2VLIA 3FGNA 1EAMA 1VKHA 3OTHA 4KUHA 1PL8A 1YDFA 2OVBA 1CQIB 3BN3A 1AKEA 3MYYA 4UM7A 4XYLA 2IW1A 2NTEA 1OLXA 3I1YA 3X1JA 4LNHA 3VPSA 1OXTA 4OAPA 1E2MA 2G1AA 2VP0A 5FPPA 1GGJA 1D1TA 3MFYA 1O5TA 4LCBA 3RFFA 4N41A 2FTKE 2ZIXA 3G2QA 3ZJTA 4P7GA 1XXHA 1ZEJA 2PLRA 2DHDA 3TPZA 1AZWA 2P9BA 3KX2A 2V7XA 1WWKA 4XYMA 2J67A 3LOQA 4ERXA 1LC3A 3STWA 3COYA 2JLUA 2XZOA 3OQIA 4KFSA 3UAWA 1XPRA 1XC7A 3DMFA 3IP1A 3X1KA 3G3EA 5DYTA 8ABPA 4NECA 1UJ2A 2ZRDA 3NO4A 2AEMA 3V1LA 3PFHA 5HK8A 3SS7X 3X2FA 4AO7A 2NO4A 3AP1A 4Q4HB 2Q1YA 4BN0A 3NPMA 2VTBB 1H4QA 1VMKA 2BBOA 1LB1B 1A9PA 1ZY2A 3UBTA 2F1HA 1VCIA 2JCGA 2AXNA 3UATA 5FHRA 3AY7A 3NVMB 5G1OA 1W48A 2MINA 3DHEA 1Z9BA 4RV5A 5CVCA 3DBHB 5TPZA 5FIUA 4W82A 3UAOA 2VT2A 3I2KA 2ADMA 1U0OC 1KDPA 1GZ5A 1ECCA 3C43A 3GMDA 5BUQA 4B8YA 1DHRA 1HV8A 1EK1A 1GKLA 2EFHB 3KHKA 4IKEA 4W1QA 2WINI 3AHHA 2Q3BA 1Z6TA 3QA9A 5IBQA 4LTNA 4O08A 4C76A 4YJ2A 4X1KA 2VQDA 5KNLA 1UM8A 2KVOA 2WPDA 4BKOA 1C0IA 3N59A 1IQ0A 5CMLA 2ADFA 4ND7A 3PXBA 2OSBA 4HAYA 5DI3B 1O94C 3MB8A 3WDMA 1V9CA 1C9MA 1GZSA 5E8RA 3WKEA 4D98A 1W34A 3T15A 1VXOA 1AQNA 3LWNA 3UB4A 1U7OA 5G3ZA 1NG1A 5C53B 3FOBA 3OA0A 3P9RA 3TEFA 3H7IA 3RG8A 1XZPA 3L82B 4QGFA 3CN7A 2MOKA 2VUIB 5DCLA 2Z9DA 1E99A 4D9EA 3QEJA 3IV9A 1QF9A 3H7AA 4PG6A 4QAJA 3SZRA 3Q8LA 3AM5A 1KJIA 1QO0A 1N78A 2QVBA 5FWYA 1T6YA 4E2YA 3BQ9A 3K09A 2NGRA 4DMMA 4XLHA 3DMHA 2WKWA 1KO8A 4NG5A 2JJ2D 1XTUA 3OPVA 3KPWA 3VHXA 4CQMD 4NAVA 5HZBA 2VYQA 3MW8A 2YWHA 3EIUA 4EHDA 3ASQA 3Q7PA 3L46A 4NESA 3SG0A 4I36A 4E22A 1CF2O 1Q19A 4QNRA 3TTWA 4MYUA 4WLEA 1W5TA 2QORA 2J5BA 2E21A 4RC9A 2BDTA 1ZR4A 3TSWA 4FSXA 1BIFA 2AJCA 1TK3A 4X0EA 1DRWA 1YE3A 1S3SA 2HNAA 4GOND 3TOSA 4YUZA 4OJKA 4WHMA 1CJUC 3QE0A 2X0KA 3GP8A 1NN3A 5FPTA 2I2CA 3PIDA 2O50A 4OBBA 1TE2A 1P2VA 1H3EA 3JATB 3KXKA 4ZGWA 2XF8A 3MWLA 2H4YA 1U9CA 3VPHA 4EH1A 2XWBF 1QYVA 4ZYVA 4B2LA 1VLMA 4IJUA 3BAFA 1LI5A 1H8HD 1XZAA 4X24A 4Z4SA 1GTVA 2B37A 3A4TA 3BCSA 1TT7A 4EW2A 1NI3A 1HTTA 3NYIA 2V3VA 3VPXA 3HFJA 4NYJR 4DLVA 2QA5A 1O6FA 4BNYA 2NU7A 5FD8A 1M10A 4RBNA 5JDIA 3JW8A 3WRWA 3OBIA 5CDFA 3HVHA 3FFBA 2O7QA 2IU6A 4BFLA 4CTOA 1X80B 4RL6A 3Q0EA 3MNFA 2P4SA 2PH1A 3E7PA 2XQKA 4X3CA 4BGDA 3L9XA 1V16B 1WQ4A 1WJGA 4ZOLF 4ZRNA 2F3QA 4J7CA 3RUCA 4ND8B 1RYYA 2NTNA 3U4DA 3U7RA 3W0LB 1ZKDA 5I9LA 1XPOA 4HMOA 3E6AA 3QELB 1N8SA 1Z38A 4XIIA 1C3OB 1RJEA 1TJYA 2OC9A 1UR5A 2AE2A 1IQUA 2MSEB 4K6GA 5DO9A 3B3QA 3KL2A 5DNAA 3WLRA 4W5QA 1ZJZA 4IOKA 4TKLA 4B43A 4MP3A 1FNMA 4GAEA 1KQSB 2IQIA 3PFBA 1I3LA 3QPUA 3QFTA 1ECJA 2DFVA 1U9JA 4HDMA 2JIBA 3BDVA 1FX1A 1MAHA 3LVRE 1AHPA 3WGKA 3GGGA 5CB8A 4MGZR 2AA3A 1NJ1A 2DJIA 2XTAA 4QBKA 2OZVA 1T2AA 5AUNB 5AKKA 4LQ4A 5J4VA 1L4NA 1U2GC 1B15A 1PE0A 2IRWA 3AVWA 3T7RA 4ENVA 1JLLB 4O29A 3KQNA 4BO6A 1YQXA 1B8NA 4JLNA 4WUTA 3G0IA 1NVXQ 2AFHB 3PVDA 4U9UA 2Q6TA 2W0SA 3DL0A 3OUZA 4GM0A 2V4UA 2WU3A 4JB3A 4D7AA 3BSWA 4ODIA 4BQIA 5JMWA 3K4QA 1SUBA 3CRW1 2ZJ2A 2Y1EA 5LU9A 1XWFA 1JXQA 5AVWA 1D2HA 4N3NA 3DNFA 2PNJA 3T99A 2X7XA 2IU0A 3IRVA 5CU7A 2SECE 3ZK8A 3M8KA 3P9NA 3NATA 1KXJA 2Z08A 1UCFA 4YMUA 2QUAA 4ID9A 2C5HA 4I0WB 4EBFA 2QTLA 1GPJA 4GQIA 3RVRA 4CLDA 4GC5A 2P5UA 3CFYA 4B3GA 2SICE 3ZS8A 5K6TA 5CD1A 3VR3D 4JS0A 4PXYA 2C07A 4DMFA 1MEEA 4MP6A 2R4UA 2GJKA 4ZVPA 2NU8A 4YPFA 1XG5A 3O38A 5A4MS 5TARA 2I65A 2FPGB 5D6NA 2BTQA 3WLKX 1EXVA 2ZTMA 4YVFA 1NVVR 2J0EA 3SQXA 1PWHA 4KLRA 4LF4B 5CFNA 4CTNA 2M9MA 4P08A 3P4YA 4OV6B 4HTAA 5DISB 3FLMA 1XHFA 3SD7A 2WU8A 2IC5A 4IJKA 2VVTA 3VAAA 4TQAA 3MBOA 2Q6KA 2ZG6A 3KQOA 2BFEB 3K15A 1JDUA 1HDYA 4P3KA 2FSSA 1X9IA 4HRVA 4IFBA 2W2TA 4XPIB 1P7YA 2ANBA 2IP2A 1XUOA 4YCBA 3ZDFA 1VGQA 3OECA 3RYIB 4P5EA 3TNLA 1SK9A 5GIPE 1QANA 3VZCA 3MVEA 3MSXA 4UHKA 3EPKA 2AI2A 1SELA 2O2HA 3MMXA 2CKDA 1NSFA 1NXPA 3OU2A 3TZQA 5P8WA 1O57A 3T7JA 5A6SA 3LVQE 2G9VA 3QLTA 4J75A 2Z04A 2UYGA 3FPJA 2A5GA 3ZCUA 1QX3A 4PPGA 2CCJA 2IPMA 3LQKA 1JE0A 1XE1A 2IEGA 2Y9MB 3K6RA 4M8SA 4AMBA 2CXQA 5DTRA 4B45A 5CB4B 2RD2A 3DNPA 3LWZA 3AOEC 5DX0A 2FFAA 2XWQA 4YR9A 1DNPA 1YUBA 3O7WA 4MHSA 3UV3A 4F5YA 3H87A 4IL5A 3AERB 1TTQB 2QT0A 2VF5X 2JAPA 3IJRA 3MG9A 4UHEA 1MX5A 2G9RA 3V33A 3Q2IA 4HZUB 5G0WA 4B0OA 4BLOA 5A4FS 1AM4D 1ORWA 4KMSA 4LHYA 1UBFA 4IW3B 4K1XA 1Z4IA 3HKBB 4IGKA 3C3CA 4HEA1 2G63A 3SYNA 4JR0A 1NDHA 3D7LA 4JVOA 1U3FA 4M76B 1HE5A 2P35A 5I9MA 3VJRA 1UOOA 4RVNA 3PNMA 1NI4B 1NT2A 1UDXA 2AZMA 3GJ6A 3VC2A 2I7XA 5IUJC 2J0UA 3S1LA 4FFOA 1WDKA 3JQEA 2JANA 2UZ1B 1E1RD 4HDKB 2BHTA 3TIXB 4RA6A 2WYOA 4R51A 4BJ6A 2RBGA 4TL6A 3HDGA 1I13A 5ILGA 1G8MA 4DJAA 3AILA 4FDLA 5E3IA 2C8JA 1PNVA 2XT0A 1SFRA 1HG0A 4OL0A 4C0SA 1WP9A 1IN4A 1N2CA 4L08A 1HQCA 2PH3A 3JD0A 1H2AS 1L5QA 1NQXA 4TKMA 2WIKA 3MJEA 1Z5UA 4ZQGA 2UV8A 4BVJA 3EOBI 5EXEA 3SQMA 5L40A 2FE1A 2Q5LA 2OWEA 4MRNA 2ZJFA 4PX5A 2GAFA 3C41J 4P98A 4YQYA 2O8DA 2W2VA 1IPHA 3VM6A 1GLGA 1F9AA 3QWFA 1YKGA 2PGJA 1Q21A 1K7XB 3KQMA 2DUUA 2GCOA 2R96A 3H11B 2Z43A 4UOZA 3CCSB 3GHHA 3G71B 3KL9A 5IDWA 1A9RA 1Y3FE 1UQUA 4IMIB 3SHWA 4GU5A 1Q6ZA 3OP1A 5AJWA 2BGWA 1K92A 3BQMB 4PVCA 2M6RA 3K92A 3R41A 3R7BA 4UDOA 1CQJA 3AF2A 5DHQA 3HJGA 4BNXA 5JYEA 2GSWA 5IUKC 1E0JA 1E92A 4I50A 3OOJA 2K6GA 1WBJB 2WP8J 5F3DA 3V3TA 1N4DA 2O07A 3HG7A 3HR8A 1JIIA 2AOUA 2Q4RA 4K3VA 4FZ3A 2DQZA 3C5WP 4HAZA 4Q4LA 3ZWVA 1KVUA 1A8IA 3FUVA 1QBKC 3Q38A 4GOKA 1BFUA 1WUIS 3ZZUA 1XAIA 1ZONA 3DWGA 2JDIA 1T91A 2R1TB 1AO3A 3EDMA 4WINA 5LP6A 5EXXA 4AZ3A 3ZDXB 4BB9A 3BWEA 4QHTA 1NBMA 2L82A 2QZZA 1JSZA 1B6GA 1P9WA 3NKFA 2QMHA 2ZJ8A 1NSTA 4YJFA 5LDGA 4I4TB 5A71A 1U3DA 2BJWA 4KXYA 1J2JA 5KOHB 1P45A 1ACJA 2BMFA 2X4GA 4WK0B 2XB2A 4TYPA 3WBKA 3IJ5A 4HZGA 2JHPA 2WU0A 2FPSA 5IC4A 3R5TA 1CG6A 1YQDA 2VXYA 2RC5A 2JZCA 3IEKA 1YFKA 1LPOA 3TVDA 4H1WA 3R9XB 2BKUA 2VAXA 5A2QA 1YQGA 4G81A 5JFGA 3NS7A 3SSOA 3C6ZA 2PGIA 3WLLA 2OCLA 2F55A 2FUG6 2Y0CA 3TLXA 4H17A 5CRIA 1F06A 1H6AA 4ZJPA 1ZA2A 4B6OA 1FSSA 4ZQBA 5KNCA 1GPDG 5A02A 1FRNA 4LRWA 3SC3A 4LWZA 3TZ6A 4PNZA 2UDPA 4HXGA 1IY8A 1NWCA 4L4RA 1K68A 1F8GA 1LPNA 3FNBA 5LYJF 2Y0DA 3A6ZA 3CUWA 3DXXA 4OHXA 1PQWA 4PFQA 1Z2AA 3EVEA 3FI0A 2UXBB 3P9SA 4BNJA 3QNUA 3VTAA 4Z4UA 4X61A 1E6MA 1NLYA 3AEXA 3K32A 3ZJVA 4R3WA 2NZYA 3KWLA 1FK8A 2JGFA 1JQ3A 4IZHA 1EA5A 1RD4A 4DSAA 4L72A 2J30A 2F43A 1NUTA 3OZ7A 4BNGA 2IY9A 5KYTA 3B1ZA 4YFYA 4C30A 3FOZA 4B9EA 3HR7A 2XA1A 4G97A 2IVZA 4FEYA 5CVUA 1AK9A 1V7PC 3CT4A 3FCAA 3KPYA 5CJPA 1C7EA 4EMSA 1C0EA 3QLEA 4ZVSA 4RVDA 3FPFA 1Q9SA 3ADOA 3CIOA 3LUHA 4W8GA 1Z6AA 1J2TA 3E7XA 3RG2A 3W4JA 2IP4A 2FWMX 3CS3A 1DAKA 2DFLA 4BNTA 3DZ8A 1SKMA 3FA2A 1H4TA 3R3YA 4R2KA 4AM8A 3B20A 1P77A 1G5FA 3DOOA 1QDEA 4M7WA 3VHLB 5EJ7A 5MN5A 4LJ9A 1MJHA 1SN7A 4V0QA 1N5LA 2OLJA 3LP8A 4OOSA 3INYA 4DMKA 1ISHA 1PEAA 3DDHA 3R40A 1KJ8A 3GA0A 3H17A 4MQ4A 4CYMA 4IG4A 4Q01A 2H1CA 3G5MA 3PRHA 5CXXA 3VDRA 3X43A 1T1RA 4RPGA 2FFHA 2X19A 4PG5A 1YOVA 2XYHA 1Z5PA 5D6OA 1MOQA 1IXKA 3VNUA 2WM3A 2D2XA 2PV7A 2P27A 1Z3CA 5JWHA 2ZVQX 3PLNA 1V7CA 4GP7A 2PPLA 3DOJA 4PZPA 4QDUA 4TL7A 3ROZA 3RC2A 3NV9A 2CHQA 4DR1B 4HE5A 2BSXA 4N1AA 3TB6A 1JG6A 1BD3A 5L7YA 4IDPA 1IBLB 5F1KA 5ALRA 2ZTNA 1Q0HA 1Z2CA 3B3FA 4Z9BA 3V8QA 1DKQA 3R4VA 3ZGVA 3GLUA 1Y82A 1TK9A 3B13B 2PO5A 2XE8A 2VNJA 4LX8A 2ZU0C 4QOSA 4QU9A 2FAXA 4Y6LA 4CEIA 4FI3F 1QQAA 1ZXBA 5IJ9B 4MCIA 3GEGA 4C21A 4YECA 5E7JA 4BUJA 2R48A 4GO1A 5GZ3A 3ISTA 4EG8A 4P4SB 3AIOA 5JRDS 1TJ4A 3A27A 1XU4A 3HJAA 5JO0A 1E6UA 5LQAA 4AAYA 2C3YA 5IYQA 4EABA 3ESAA 4Z0TA 1U9YA 4FQ7A 1E9SA 2YCLA 3UK0A 1KVTA 1XR3A 3E03A 5TQVA 2FZCA 1W44A 1UD2A 1H3NA 3QOFA 4TSRA 2HA5A 1CUDA 1NBHA 3STXA 2HBRA 3HU3A 4D0SA 3TAXA 4LOKA 1P31A 5AI6A 2F64A 3K53A 1IHXA 2XODA 5FV7A 3VHQA 5LBTA 4AFNA 4QOIA 4Q9LA 4M0PA 4UUQA 5CP8A 2J85A 4NJEB 1GN8A 4RPJA 4D8TA 2KW5A 3OHMA 2P3QA 1EZ4A 2OECA 1D1SA 3DDSA 5FWAA 5LYJA 4CE6A 5AW4A 1G6HA 2ZJOA 3ZQ6A 1QV6A 1W29A 2CFSA 2IHBA 4FFVA 4YAUA 1HY3A 1GL3A 4UM8B 1SKBA 2VS1A 4PX3A 1Y3CE 5CVEA 3RT7A 5F9FA 2ZR8A 1AK1A 3NNDA 4RFSB 2H5EA 3BRWD 1P4MA 2B9EA 2B4QA 3R0JA 2D5IA 4W9NC 3W5UA 1R50A 3IHTA 3WNBA 4KC0A 4RSMA 2D74A 1Y6RA 3WK6A 5GAJA 3JZIA 5HCUA 4RVHA 2NUPB 2CLOB 2FQWA 4BKPA 4XZ3A 3O2JA 2CFTA 3A1WA 4HBGA 2QBYA 3L6RA 5GV7A 4HB2A 3MIIA 2X4DA 1M74A 1Z36A 1UJ6A 2HJRA 2ZIVB 3KQUA 3TRFA 4F4IA 2NV2B 3OQHA 1MVLA 4EQ6B 2OCKA 1BXZA 3VJLA 5B55A 1ZRNA 1NPYA 2HFJA 3UWOA 1HF3A 4ZZ1A 4LF5B 3FUWA 4Q1CA 3EOZA 1WMFA 3WGLA 1RZUA 3CVWA 1BX3A 3O93A 3ILXA 3P2KA 3QYPA 3F97A 1Y8RA 3IOMA 3QTLA 4KE8A 1RABA 1VHEA 1LFAA 2LTAA 4JYZA 4JIMA 2B7BA 1Y5NA 4HBZA 5BOSA 3BZUA 2MCFA 1BFDA 1KZLA 2ZRPA 1RAAA 4TWZA 4ER6A 3VH3A 5KSWB 3ZE8A 4P6YA 3R3ZA 3VKGA 2XGGA 1FU7A 5F2EA 6GPBA 3A1FA 4Z7NB 2G28A 3EQ7A 3M5PA 3EC7A 1V96A 2AJTA 5F1YA 4K81B 1CYEA 2QMYA 3EFEA 4Y9RA 2JKVA 2ONYA 2XVAA 1AKMA 5FI1B 4AG3A 5LJLA 3K9BA 1FS5A 1B6RA 4IDQA 4Q18A 5BRAA 1I4DD 3ZVLA 1RZRA 3W6PA 2HPHA 1KYQA 5K0NA 3DO5A 3ETEA 5TT0A 4GDFA 3A3YA 1M0TA 1DQPA 1LNQA 1MNAA 1PG0A 4WCDA 1DGQA 3NALA 4BQOA 5C5CA 3W5BA 1GEGA 2PZKA 3FWHA 3WIDA 4Y9UA 3Q9NA 4Z3DA 3II6X 3ULKA 1RQRA 3N2LA 3RRNA 2Y1GA 3D2LA 3OZEA 1AO0A 3LT1A 1PK9A 2YZMA 2GQFA 2DZDA 4ATNA 3M5DA 4C7OA 1KARA 1H3FA 3I0MA 1X1BA 3R7NA 1QFJA 4AN1A 4YWJA 3I9OA 4M1SA 4MKFA 1YRBA 3FCXA 4GG1A 4UUNA 3CTPA 3GR6A 1C0LA 5REQA 3VR1A 1XHEA 3WWDA 2YFKA 3THYB 4BEJA 3NORA 2XMZA 3CG4A 3G49A 4KX3A 3DE4X 5CA0B 1NJID 2D54A 4H18A 4UD6A 1HT3A 1WDMA 1BNCA 1LX7A 2QLNA 2O7NA 1I1NA 4UD2A 3JD4A 4CQMB 5A9SB 1Y5MA 3O84A 1T6NA 4D5EA 4KKTA 4BMSA 2YY5A 4X3OA 4KU4A 5LQRA 1U8UA 2QY6A 1B4DA 1UD5A 5ALZA 1DEHA 2C9CA 4GSLA 4RMGA 5CX1B 2FPPA 3LPDA 3T1HB 1TUBA 4JBWA 2XAAA 5KTTA 2JBHA 1B76A 3RIMA 5BWCA 5FA8A 2FV8A 3IBTA 3KSDO 3R0ZA 2GCGA 4IR7A 3A04A 2HMAA 3GDOA 3DDNA 1UDRA 2AF3C 3DCNA 1TCCA 1UPAA 3KUXA 4H7PA 3UYKA 3EMKA 4RKQA 3W04A 3E9EA 3AI2A 1J8VA 2CLHB 3NTUA 4PHFA 4QU5A 4BFYA 3B8EA 3SAJA 1HO3A 1J0EA 4CHTA 3CC4B 2CEKA 5LUAA 2OORA 5LKRA 1YWGO 1Z0IA 3MK31 3ZKWA 1RXWA 1IY9A 3H75A 1N0WA 3H2KA 3NVKI 5DYGA 2DLNA 1GITA 2JEYA 2UZ3A 1X7ZB 1GSOA 5EMNA 1KQNA 4ESHA 1RPTA 4OHWA 3TWOA 3OPNA 5FR1A 2R5WA 1FTNA 2GBPA 1SUSA 2CVOA 4OKNA 2WOOA 2X1LA 4K2HA 4B1FA 5IAOA 4PNEA 5DRYA 4CU5A 4DB2A 2R2GA 2QRPA 5HMMA 3F7TA 1GFIA 3GNQA 3ETHA 4ISBA 1U3TA 4JOSA 4N82A 4P4NA 4R1PA 5GJCA 5BNIA 3LLSA 4UQLA 4CKBA 1LJUA 2ZBRA 3MGCA 1T2DA 1YJ5A 1EXWA 1OI3A 4YAFA 3FOAA 4X1YA 1X8KA 3MRTA 4QYSA 4R7ZA 1N3YA 2W6QA 1K4MA 1PDVA 1K08A 1W5SA 3R4CA 5K0TA 1XGKA 2I7VA 1GUAA 1RJWA 1D2RA 4TT3A 2Y05A 4NDNE 3BDIA 3ZV6A 1EESA 1KI3A 4WDQA 4ZQHA 1K7EB 4D8XA 2UZIR 1U8ZA 1CTQA 5U1PA 1PZHA 4M8KA 3GQBB 3MFQA 1GO2A 3U44A 3JX9A 1WS6A 1EDOA 1BJRE 1L4EA 3EXAA 4D4IA 1T4CB 5HZHA 2BGMA 2C7OA 5A0FA 5HRCA 3QEBZ 1G19A 2IIQA 1K73D 4Y7DA 1XE3A 3A7DA 5LBIA 1K8AD 3M1IA 2R0QC 1ZH2A 3DCJA 3OT5A 3UMGA 5IXJA 1IPFA 1L9KA 4JQOA 1ZCZA 4I9FA 1T0HB 1Z8HA 5ITWA 4YONB 5BSWA 4BJ1A 4DQXA 1Z7BA 4B3IA 5DU2A 1UXKA 2QRQA 3VUFA 1XVIA 1J1ZA 1EP9A 2JBWA 2YMQA 2G0TA 2NU6A 2Q3EA 3L01A 4NU0A 4ZHQB 4XLEA 1E2PA 2W00A 5DJ5A 3VDNB 3T9EA 3UKJA 4GPTA 5A3RA 3PRYA 1SOAA 1PJQA 2WYVA 5FUBA 2ZI7A 4BXOB 3Q3CA 3EZ6A 4Z1MA 1I01A 3MCZA 1QGUA 4NH4A 1RJ9B 2PUVA 3H2JA 4QJBA 4X8LA 4QTYA 3UBMA 1EM8A 3D4BA 4TQ9A 3ROPA 2WHEA 3D3JA 3L7DA 4IGEA 3NG1A 3KDAA 4DLKA 1YR3A 1WORA 2KI5A 2YN0A 4PPFA 4UU8A 4QHSA 3VO8A 3JYOA 1M7HA 2VDNB 2HIMA 2I4MA 3H9NA 3S8EA 5FWXA 4KR6A 2EDAA 4NDAA 3TDKA 2G8NA 5J43A 3WJ1A 3K4PA 4I2VA 4FFBB 2LZJA 4N3GA 1ZGJA 4XQGA 1N0VC 4N5MA 3ONEA 1R4NA 3OE4A 4LFCB 4B48A 3CG0A 3IEIA 4G0OA 5HF5A 5TPWB 3HFGA 1SC3A 4OBWA 3K0KA 2A84A 4CM4A 3GLGE 1FQKA 1ML4A 2UVQA 4MGKR 1U3UA 3VH2A 4EARA 5LOVB 4DK0A 3M6AA 3NBMA 2BI8A 4B71A 1V2HE 4WXMA 3A1CA 3WLNA 4G0VA 2ZYIA 3ZHBA 3DXZA 1UMCA 1XRLA 2WDZA 3L7LA 3RU3A 2W6JA 2NAFA 5F4MA 3OX3A 4PLZA 1KYTA 4WZAE 2MSCB 1N0IA 4G0NA 4DLTA 1T9AA 1PT8A 1QS0A 1R88A 1V37A 4O4IA 3TTXA 4I1SA 4PC7A 2JZNA 4KBFA 3IA2A 3HJNA 1QH1B 1VHJA 3AESB 4QSMA 4BMZA 2J9YB 4B3TB 4HUQA 2I7TA 4KWCA 1HDRA 3H3FA 2AF4C 4OHKA 1CUFA 4PSCA 5EKXA 3DE2X 1KH3A 3HKCB 2XUJA 3OM1A 3ZX5A 1H1LA 3RJZA 3R3JA 3BORA 3Q10A 2ZAMA 5IVPA 1T1SA 5KNBD 2HRQA 3OW2B 3GK3A 1YOBA 2P40A 1FTWA 1ENYA 1GPAA 1TCBA 3CKMA 3W3AA 4IIDA 4U6NA 4XX1A 4ZAGA 4UHFA 3W4KA 2QXTA 2VATA 3EXHB 4QYWA 1Z28A 1OV6A 2H1RA 4BMYA 1U0BB 3V7FA 3LQYA 1CLUA 1F0YA 1M2VA 1MRNA 1TXGA 2V6IA 2FH5B 2GBFA 1RTKA 3HN2A 3JAWB 4RYLA 4EPTA 4EB6A 4M38A 1GNRA 1Q3KA 4HNGA 1SVSA 1JR3D 1ZMTA 2Q0HA 4YRSA 5DN6D 2ATCA 3C7TA 1T25A 5ALDA 5A62A 4AF7A 3KJGA 4GPIB 3LCCA 4PBRA 1ZSYA 4BNNA 2ZVPX 4DW8A 4G85A 1U1GA 3IOBA 3OZVA 1MQSA 4G5FA 4UEKA 3PICA 4MVJA 1HUQA 1VMAA 3U4GA 5M7EA 4GI3A 3VBEA 4DRXA 2WM9B 1J8YF 1EQ2A 1TECE 1WIWA 2CDAA 2ZI4A 3MQ4A 3PFFA 3FZQA 4WOPA 1X92A 3RVDA 2R86A 3ENZA 1NJ8A 3FY4A 1S1CA 3GX1A 4RQUA 4ZREA 4C6TA 2HV9A 4L4XA 2I6XA 4XJTA 5SICE 1W2BB 1HDGO 3DWFA 3LX5A 2QPLA 2C0CA 2WZQA 3IB6A 4MRVA 3TG2A 3D64A 1Y4AE 2OCDA 3MSCA 1NV9A 3TTYA 3DLHA 4ZCPA 1JF8A 1WPQA 3AKZA 3K05A 2GRJA 3B9QA 3D0OA 4B4OA 5GM2A 4DNOA 1G1MA 2PMKA 2JJQA 1FFGA 2AL7A 2NZUG 3BHMA 3T56B 3L07A 4O2AA 4EUFA 2PMDA 2X8BA 2HB6A 2IXFA 2PEZA 3K1TA 4G24A 1OX6A 2CZQA 4XYEA 2UXDB 4E21A 4RTPA 3Q3GE 3NHRA 2ZDHA 4OQXA 4WZBB 4A0RA 1IWOA 1EWYA 4IQ4A 4AKEA 1ZJJA 1EB9A 4TS1A 3I2GA 1E7MA 1RQGA 2CBGA 1A9TA 4Q7KA 5K8TA 3U16A 1L5WA 1CDDA 3EYWA 1WU7A 2GAIA 3PEVA 5ENVA 2EXXA 3AU9A 2QR2A 3A6LA 4EB0A 4YRMA 5AK3A 3HYTA 1GDTA 1TK2A 1I0LA 2G9UA 2WUDA 1C80A 3SR3A 1TNDA 5AKJA 1R0WA 4ETIA 4QT4A 2JLYA 4BPRA 2QYTA 2VJMA 1HGXA 3V6LA 2WT9A 4XR4A 5C80A 1N9ZA 2JW5A 4RK6A 5DV9A 2DWCA 2O57A 3NRBA 5KHOC 4PG8A 2GLXA 3H2YA