1H42A

Ferredoxin:nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr and leu 263 replaced by pro (t155g-a160t-l263p)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP+ REDUCTASE
publication title Involvement of the Pyrophosphate and the 2'-Phosphate Binding Regions of Ferredoxin-Nadp+ Reductase in Coenzyme Specificity
pubmed doi rcsb
source organism Anabaena sp.
total genus 83
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2002-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1h42A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1h42A02
3AVVA 4IW3B 1FRQA 4TN1A 1OGIA 2CNDA 2VYQA 2QN6A 1VQ5B 4R71A 2BSAA 1S72B 1R5NA 3P26A 3QFSA 2DEUA 1JNYA 3CC7B 1EWYA 4QHYA 4NBSA 1BJKA 4Y9UA 1S0UA 4TMXA 2BPOA 3QSYA 1DARA 3I55B 4RD1A 1VQ8B 3CCLB 1KK3A 2VNKA 4PC2A 1TTTA 1YHQB 1N8RD 1UMKA 4G1BA 4TMWA 4M2LA 4PC6A 1ZM2A 3WYAA 5DSZA 1WDTA 2HCJB 3AGPA 2RC6A 1QVGB 4M0LA 3WBJA 4RD4A 4U9UA 3B82A 1JA0A 2CRVA 4HE5A 5TR9A 4YAOA 2OTLB 3OW2B 3CCEB 2QEXB 4QFMA 4UAJA 3PENA 1TUIA 4LBVA 4RD3A 1VQPB 4H9GA 2BV3A 1AMOA 3OZWA 3ZBUA 3W2GA 3CCQB 1DDIA 4B48A 3CCSB 1JA1A 1VQ4B 1ZM3A 2BM1A 3U6KA 5GV8A 4G1VA 1YJNB 4ACBA 1ZM4A 2BGIA 3CB4A 3E20A 2C78A 3QFCA 5HXBA 3U2QA 3B78A 3G71B 4EH1A 1IB0A 1E64A 1EFTA 2B7BA 1YJ9B 3W2FA 2C77A 4C0SA 1TVCA 1N0UA 3SJZA 2YWGA 2ZITA 3CMEB 1W34A 4K1XA 2VZLA 1QG0A 1ZUNB 1VQ7B 1FNMA 3MCAA 1R5OA 1D8TA 1EXMA 2DERA 4N3NA 3AVXA 2DETA 1XB2A 1BX1A 2VNIA 3VMFA 3J81k 1KQSB 3CC4B 1E63A 4P3YA 4B4DA 1R5BA 1YIJB 3AVTA 1K73D 3WNBA 5KSWB 4J0QA 3W5VA 2DCUA 4ZCLA 3V76A 4ACAA 2QTLA 3W2HA 4AF7A 3JQRA 3CRZA 1EP2B 1GVHA 1QX4A 2R6HA 5H59A 1GR1A 1KD1D 3LYUA 3MHPA 1N0VC 2FX3A 1KK0A 3W2EA 1B23P 2DY1A 4ZGQB 1B2RA 2J7KA 2HDNB 1H42A 4PC7A 4YHBA 2BF4A 1OB2A 1E62A 1F20A 1M1KD 4YAWA 1YJWB 4ZCIA 4FN5A 3LRXA 3ZZTA 3CCMB 4FWTA 3AGQA 3E1YE 3CCVB 3I1FA 3OZUA 1QGZA 4RJLA 1G7TA 3ZZUA 1KC8D 3OJWA 4LBWA 3OZVA 1QH0A 3ZBTA 1ELOA 3W2IA 4F7DA 2OK8A 2VNJA 3W5HA 1JB9A 3P27A 1EP3B 1K8AD 3JQQA 4B44A 4YALA 4WQMA 3WBKA 3U6BA 4RCYA 4MYTA 1QUEA 1Q86D 4MYUA 4TMTA 2XNCA 2QTZA 5JBQA 1YI2B 1J9ZA 1IJFA 1H85A 3AVYA 1VQOB 3AVWA 3AVUA 1IJEA 3QFTA 1GAQA 2PLFA 2BM0A 1KJZA 3G6EB 2B7CA 4PC3A 1FNCA 1DG1G 1OB5A 4NCNA 1QFJA 3WNCA 2BGJA 1CNEA 4PGOA 5GV7A 1BQEA 2OK7A 2VNHA 5FA6A 5TY0A 1Q7YD 4M4SA 1QUFA 4TMZA 4N3GA 1CQXA 4HE6A 4ZGNB 2YWHA 1ZM9A 4FK8A 2PIAA 1GJRA 3ZZ0A 1KRHA 5THXA 1W35A 1EFCA 4M1KA 1GAWA 1NJID 1G7RA 1AIPA 3VO2A 1FRNA 1BX0A 3VNVA 1Q82D 1M90D 1GO2A 2QMUA 3CXCB 2EIXA 1D2EA 3CPWB 2OTJB 3W5UA 4Q7JB 2HMAA 1VQ9B 5AN9A 3FPKA 1D1NA 1QFYA 1FNDA 1F60A 4RD0A 1G7SA 1Q81D 3MMPA 3CD6B 1EP1B 2PMDA 2AHOA 3VNUA 2RC5A 1W87A 4LC0A 1KTVA 4YAFA 3CCUB 2D74A 1NDHA 3ZC3A 1CNFA 3FJOA 4BPRA 3B8HA 1JJ2B 4RCZA 1XE1A 1KK2A 1TLLA 1KK1A 3VO1A 1QGYA 4RD6A 1VQKB 3I56B 2EFGA 3WXMA 4PC1A 4RD2A 2XEXA 1K9MD 1W2BB 4G5GA 1SKQA 2XNJA 1FNBA 3CCJB 1VQ6B 4Y7CA 4TMVA 1FDRA 1HA3A 3CCRB 3A1FA 1G7CA 1VQLB 3ES9A 3G4SB 4LBYA 4DQKA 3QFRA 3WNDA 2BVNA 4B3XA 4C43A 1YITB 4B43A 4AC9A 1VQMB 3WY9A 3CW2A 4P6VF 2X3UA 4LBZA 1A8PA 3LVBA 1QFZA 3QE2A 2YWEA 2GPJA 4Y9RA 1DDGA 3OJXA 2GQFA 4AF6A 2BN4A 1QVFB 1SM4A 1QGAA 4M53A 5TV2A 1I7PA 5EMNA 2B5OA 4DQLA 4ZV4A 1U2RA 2QDXA 3JQPA 2E1RA 2YWFA 4ZCMA 1EFUA 5H5JA 2BMWA 3CC2B 2NPFA 3CMAB 2QA4B 1VQNB 4YAUA 3LO8A 4B47A 1OGJA
chains in the Genus database with same CATH superfamily
3ROKA 3F3KA 5ERGB 4WCVA 4GBMA 1L5GB 5JASA 1CETA 2QT9A 4R16A 2WZDA 5JADA 2VYQA 1NZFA 4ARVA 3ZW7A 4ZO4A 4MHSA 1A1VA 1O9GA 4M88A 4TXLA 1I6MA 1TIBA 4BKOA 4KC0A 1BE1A 1N3BA 1Y33E 2FPLA 4GHWA 3EZYA 3LBYA 2D5AA 3TMKA 1ULZA 1APBA 2PZAA 1A9RA 3CF0A 3P7MA 4NNPA 5KX5B 4YXFA 1N2SA 1C5KA 3T61A 3N2ZB 5H70A 1XTTA 4MS1B 2GEFA 2WLTA 5SZJA 4K81B 1TMOA 3IH5A 1Q12A 4Z99A 4LXTA 1HT1E 1VBFA 4FKMA 4F9EA 1PBTA 3DV9A 1IUOA 3I1JA 4R1PA 2FUG1 4DZZA 4EO4A 3W5BA 4I14A 1TTHA 2ECKA 3D7RA 3OPMA 4MIEA 5AKXA 3SMVA 3DD1A 3OFSA 4ID3A 3H5OA 2HHAA 1YOVB 2Z5VA 2O7VA 2YH2A 3HCNA 5A5GA 5BW8A 4E2ZA 3G1TA 2GASA 2XSZD 1N8RD 1SG0A 4YGXB 2I1QA 1XTZA 3TW6A 3ZQJA 3EYWA 3PPWA 4DMFA 3S8EA 3GG2A 4DK0A 1JSXA 3FUVA 4Q00A 1YCHA 3KR2A 2UKDA 5JE8A 1PDVA 1Q3TA 4F4CA 4FXOA 2G17A 3HKCB 4GI2A 4LTMA 4QBFA 3RB8A 4ND3A 2DQZA 4WLOA 4H59A 3VPCA 5GGXA 4L16A 4P98A 4RKQA 4DRXB 3STTA 4QVJA 5L95A 3UHFA 4L2IA 2H2WA 2PGAA 3E5NA 1P17A 3PUXA 1H93A 1O0SA 4GM4A 4LZNA 3JALA 3PC7A 3W77A 4C7XA 4IJWA 1M10A 3EBPA 5JXJA 2MYTA 1GGFA 4KN5A 3MOSA 5D1NA 3TEFA 3FKSA 4AD8A 4M9SA 4I8XA 1E4VA 3MLBA 3ZV7A 4RZXA 1FTNA 1Z56C 3AUXA 4WHMA 4XTCS 4MGYR 4MWZA 4GLFA 3FPAA 1UBEA 3QEJA 2J85A 4G0OA 4ODIA 4WZBB 3SNKA 1KI2A 4HWSA 1JXQA 1J9EA 1KETA 2RHGB 5D6NA 4CQJA 2FSPA 1JHZA 3FJ1A 1K88A 5JNUA 3IPLA 2C57A 1IK6A 1WAMA 2HWXA 1HEIA 4UJ5A 5CM9C 1H94A 3SHOA 5K3EA 3VV3A 4QAQA 2GN0A 2ON6A 1EMDA 2GZ3A 3OPYB 3TXAA 4IIDA 3N2GA 3BSWA 3D1LA 3Q2KA 4ON9A 2WILA 2YINC 4UOQA 1E20A 4KXQA 2FSIA 4UVGA 4X6LA 3AILA 5IHPA 4RTMA 5CT4A 3FZQA 4W8GA 1AF4A 2WM9B 4Z4HA 3RKUA 1VI6A 2CCKA 4ALIA 2O3UA 1HYEA 3KSZO 1JFFA 1Y1PA 3LIIA 4NMLA 5C0OE 3LFTA 3SCZA 5A2QA 4DA7A 4QM6A 3HAGA 5DHRA 4JB8A 4FHDA 3HEMA 1KH3A 4JBHA 2ZRBA 4DCMA 3FSGD 3G6WA 4UBLA 1ECLA 2FF5A 1U63A 1U9ZA 3ZD7A 1D1QA 3GLQA 4UEKA 5DGXA 4MINA 5DVZA 2CYCA 3VO9A 4IIVA 5H9VA 2XUDA 2K87A 4RPHA 3NB0A 4PXSA 1IN6A 4M7PA 5F35A 2FFAA 4X90A 1U3WA 3ASVA 4LNUB 1R3DA 4ZT3A 3Q4GA 4C7BA 4XVHA 4P12A 1UFVA 1VOTA 4XX0B 1TM5E 3WZLA 5BWCA 1F4PA 3ZY5A 1RRMA 3HJRA 1USWA 2OE2A 3UB3A 3SVTA 2Z3ZA 3IX7A 4RTKA 2Z95A 2PH5A 3EVAA 2PNJA 3QLUC 2C5EA 1MRNA 1CUUA 1FXUA 3G9XA 3SYTA 1RPJA 1UIRA 4FFWA 3KWMA 5BR4A 2PKQO 4Z9AA 4UTXA 4DUGA 4MARA 1XDDA 1X7YA 3ONVA 5F5XA 4J1QA 1WXXA 3QUTA 3NHJA 3E4DA 4K8RB 3UFXB 2WICA 2DUNA 1TF2A 4O2RA 3MG9A 2J4FA 3U4MA 4UQOA 4EB0A 2C4UA 1I36A 1M6EX 3O94A 1NW9B 2EW1A 2VWPA 4D8UA 2NTJA 1P9OA 5HUHA 4FI3C 1L4GA 3BCRA 4N9QA 1UKZA 4HFJA 3QWBA 1NNEA 2VN8A 2YZMA 3O6VA 1GKYA 1EHYA 3BXHA 2GRUA 3SPXA 3UAOA 2VBIA 4GOMD 3RWBA 3ZKAA 4HUJA 1K8ZB 2WZNA 3E3AA 3L43A 1JN0A 3NIWA 2GPWA 2RG7A 3AETA 4NPAA 4PTZA 4S1PA 4COKA 1B6RA 2X0JA 4L5BA 4AF7A 3S28A 4BO6A 3DWGA 4QXAA 3TQCA 2GTHA 1AA9A 1Z0ZA 2F7SA 4N6NA 1GVHA 1FUIA 1G5QA 1PZEA 4LCJA 4EDFA 2O6LA 5EIHA 5ADUS 4KV9A 4S35A 3EAQA 2GF0A 4ZI5A 2VHCA 3KVNA 3X1XA 4CDMA 5IFKA 1OH7A 1YR3A 1IBKB 4I6EA 2GM4A 3K8ZA 1ATIA 2BDEA 3L8EA 2ZJ3A 3ZU5A 1S9DA 2J3EA 2JFZA 5LQJA 5K4HA 4Q4HB 4F1WA 4R5MA 1JEQB 1GGJA 1J33A 1HV8A 4OREX 4HIZA 3DDWA 3MTBA 3VOTA 2HQRA 5BSFA 1ZPDA 2Y77A 5BUCA 3DM5A 4TWZA 8ABPA 1Z5GA 4C7OB 5A0TA 4GT1A 5JNVA 5DRYA 1EUQA 3CVVA 1V6SA 2JLZA 4V0LA 4URVR 1U98A 3GI1A 4HNAB 3GZJA 3WLIA 1WKBA 1E8NA 2AZ4A 4M9CA 1JVBA 4GYKA 4G7XA 4DV6B 4OK5A 3ONWA 1GUFA 2ID7A 2BF4A 3NTUA 4PINA 3V9AA 2DWQA 1GRCA 1LBIA 5BUSA 1ZUNA 3QLVA 3B7GA 3DS8A 1M1KD 2WOJA 1MX3A 5KSZA 2R2GA 3VU0A 1R12A 4ZCIA 1RKQA 3H9QA 4AMYA 2HCTA 1U2TA 3IPCA 4J0EA 3K05A 3LI2A 4NU5A 3ICOA 1QH1A 1R6AA 3GU3A 3IQXA 4MVJM 4I5DA 1RPNA 1GA6A 4MW4A 2QGFA 5EPUA 3RVBA 4KKSA 4DHEA 2CFSA 2FVGA 3PIIA 3WWPA 2C2KA 2ADMA 1ZSYA 1AV7A 3H5TA 4CLEA 3G0HA 4U7WA 2PL9A 3DJFA 5EQTA 1VE6A 2PS1A 2CDCA 4G5OA 3ROGA 4BO4A 5IXJA 1GQOA 2OHHA 3RSHA 1PR4A 1Y8QA 1LBSA 2I2XB 4IP0A 3GJTA 1IOVA 3U9SA 3IKVA 1UWVA 1YACA 2ZIWB 4M7OA 4ZGWA 2JAXA 3ODGA 3LDAA 4G0YA 3ZWVA 1GTRA 2CJWA 2D3NA 1L5WA 3W2IA 2W6IA 1F5NA 1U65A 2RI0A 2BLNA 1TK2A 3AZPA 1PEDA 5H1YA 4NPHA 3MMZA 2WMYA 1JB9A 1T10A 3FDJA 3IA7A 2NU9B 1KH2A 1MZVA 4KAFA 4Z1MA 4PYLA 1EP3B 3V6LA 3UJ7A 1JFSA 2LUOA 4MUGA 4DV7B 3MWFA 3UCEA 4E30A 1MDFA 4M9QA 5BYBA 5TPZA 4AICA 2J48A 3HCOA 3O82A 2ABWA 3WGUA 1MO3A 2C07A 3ECCA 3LBAA 3PG5A 4PR0A 5DBFA 4JBNA 2GHIA 3WHLA 5JCPA 3LQQA 4JK3A 5A0FA 2CMFA 2AKAB 3E7XA 4YR9A 3QQ5A 4RCYA 3N8KA 4PNPA 5IPFA 4Y9DA 1WXQA 1E3ZA 1RTKA 1B76A 1NJ6A 2EJBA 2NNLD 4ENRA 1D7AA 1RKVA 1YDEA 4D6XA 3Q5EA 1AXGA 3VSEA 4DG8A 3JAMA 4TQUS 2Q28A 4UD2A 2Y99A 4MROA 4JVMA 3QU5A 4JQZA 1XROA 1FTSA 2J9RA 3MNFA 2G5GX 1C9MA 4JKYA 2O0HA 2D62A 3ABZA 4KXYA 5HTOA 3CGWA 3A32A 2CBGA 3JPYA 1BCRA 3SFTA 1KVUA 1DC6A 4D96A 2HT1A 4B8WA 2WU4A 2HK8A 5DHTA 2EFHB 1ZUD1 1QH8A 1QFJA 1TGVA 2C7GA 2DRIA 5FBLB 3OBBA 3EGWA 4BB6A 3GWZA 3MJTA 1OBHA 4ZAYA 4K40A 3BJMA 3JVVA 3IPXA 1L5NA 4ER0A 4U2GA 1JT2A 5IEJA 1XMPA 3HL4A 5LR6A 3LQ1A 2DLDA 2I87A 4TRNA 1CQWA 5K2OA 1RYFA 4B3GA 4WJKB 5BWOA 1FYXA 4IDCA 2X8LA 3H0EA 1Y1LA 2QMOA 4ZOLF 1TLTA 8LDHA 2CYAA 5HQ3B 1WF6A 2CEKA 3KOUA 2PFSA 2DUMA 3F8SA 1O96B 2Z1NA 3NPMA 2AHRA 4AZ3B 3DC7A 2VPWA 1NQXA 4K87A 4H17A 1GPJA 4Y1EA 1PQUA 2BMDA 1XD2A 2RAFA 1NRJB 1TCUA 3HDHA 4ENTA 3IUBA 1DWUA 4Z9XA 2YWHA 3JQEA 4RIHA 1RMTA 3WYNA 2OLEA 1TZMA 3U3OA 2I3AA 3MTQA 4GLLA 4TGLA 1H3FA 3GY0A 5DT9A 1I7LA 3BXPA 1QJ4A 1DPFA 3L1UA 1ADBA 4N0DA 2O5RA 2QW0X 1FVFA 3TL6A 2ET6A 2VZ8A 3F3MA 4YK7A 4H18A 1QQTA 3ZLJA 3LT5A 2NSDA 3FA2A 2Y05A 4HQOA 3IUNA 4YBRA 2KS6A 2QR2A 1C8KA 2ONZA 1AKRA 1QHFA 1YS1X 3DZJA 3VO8A 5JYEA 8ADHA 5LMZA 1XZMA 3V33A 3BKWA 3F8TA 4EG1A 1KEPA 3ND9A 4D3XA 1SQSA 2ZDQA 1M90D 2HXGA 4KQMA 1Z5NA 1H9BA 1DJLA 3AHCA 4KE6A 5G1NA 1NF2A 2MINB 3BFJA 1W4BA 4IG4A 5JSYA 2GNAA 3CNLA 3KWLA 4EX6A 2ZRCA 5M2QA 4Y18A 5K3SA 1U7DA 2YXLA 3BMOA 1GLNA 3GG9A 3GO4A 3FTEA 3CG0A 5C8YF 4ARZA 3D2AA 3GRFA 2DYKA 3AR6A 4OI4A 1JHRA 3FTPA 1Y5MA 3Q9SA 1N9KA 1NNUA 1P39A 4MX8A 5ELMA 1WG8A 5JZMA 1U7ZA 1Q15A 2CXPA 2XOEA 1YHNA 1QIJA 3F3SA 3KYDA 3MUNA 3VZPA 5AQ1A 1Y5NA 2G08A 3KOYA 3V1NA 3RHTA 4FNGA 1OR8A 121PA 4OXNA 2WHPA 4L4SA 4A0SA 3LBHA 2PT6A 4O63O 1XD8A 3MT7A 5CTAA 5E7JA 4B4KA 5BMVB 1H2YA 1DBVO 5AM1A 2WYHA 2ACKA 2X41A 3U31A 5IAKA 3CNEA 4C3OB 1JE0A 1LC0A 2QY6A 3ZWKA 3CC8A 3TZHA 2X53S 5JZBA 4R1OA 1KTVA 4FYHA 4GRDA 1LDMA 3HB5X 1SO8A 3MK31 4D2IA 2QTAA 3ZHRA 2HIMA 1CBUA 3OE7A 5EUQB 2C00A 2R96A 2Q5IA 3SEZA 3HVJA 1NHGA 2QAGB 3DVAB 1M34E 2ZUVA 1NP7A 4BKPA 2WOOA 4M99A 4BP9A 4ZMSA 1HLPA 3TMYA 1YRYE 2IYQA 4OQFA 3I1IA 5TJHA 1RKUA 3JZAA 1GGVA 3OI7A 1UOPA 4F84A 1QR6A 2EQBA 4YV7A 1UD5A 1I0LA 1T8PA 3ECAA 3TW0A 2WTMA 4HXGA 4COOA 4Y30A 3R41A 5JBIA 2Q3FA 5T4FA 3E9RA 3PX7A 2VYNA 1U2DC 2HEIA 2QG4A 2VT7A 3D6JA 3QKIA 3AVQA 4P83A 1CB7A 2H4ZA 2O2EA 3SR4A 3BERA 1PEKE 4PANA 1ADGA 1E3WB 1RHQA 2HRCA 5DYTA 3U7QA 2GZ2A 4G5GA 3IQHX 1OBFO 2Y2VA 2DC1A 2ZZQA 1SB8A 4MYSA 2BDUA 4NE7A 3NIDB 2QZPA 1VQ6B 5E4JA 5E8JA 3HXMA 3QBDA 3EC7A 3JXEA 4NBVA 4LEIA 3LQKA 4RV5A 4AROA 1G7CA 1M2EA 1DADA 1DKOA 3A1UA 3K0CA 4HQLA 4B76A 3A2MA 1VE3A 2V3WA 2IPOA 3WSWA 4NPCA 5HEKA 2R7NA 3AY6A 3OHMA 2ZB2A 1IM5A 4QHTA 4A0HA 1NYQA 3W5AA 3OT1A 1H4SA 1HE8B 3R6LA 3HFSA 3T1YB 3WY9A 1ADCA 2PA3A 3D8HA 3FWKA 3GDHA 1E9BA 3T52A 4CMEA 4K46A 2PKWA 3IQDB 4N6OA 1LNSA 2ORED 3GHHA 5BN4A 3D0QA 3AWDA 2GPJA 1EFDN 4JV5B 3FUUA 5BV8A 1CUBA 4HYTA 3F6CA 1IVSA 3N05A 4AF6A 2BN4A 3PDJA 5LL6P 1KE1A 2F9FA 3ZXXA 4I4TB 3CLKA 4EFDA 3JYHA 4RDCA 4F9FA 3JSXA 1MPXA 4HFRA 2GJKA 1VPDA 5AJWA 1NUPA 4F38A 4GRAA 1B0AA 2CSUA 5A4JA 4PX2A 1E9CA 1XVIA 2JAWA 3ADDA 1M72A 4E5UA 4H7EA 1Y8RA 2N42A 3AF3A 4IWXA 4L6IA 2CLKB 2GHRA 4FYWA 2HGZA 5C4MA 2WUGA 1PYDA 5JY6A 4OPMA 4PCUA 1UOOA 3R44A 4HD8A 5AVRA 4YDHB 3JU3A 5HKKA 1RRVA 4B7XA 1KJ8A 2BKLA 5ULLA 3T3NA 4JXZA 2GN2A 2DY0A 1MOZA 1Y5RA 3MTGA 4NYIR 4V0QA 3PR3A 2GJSA 4XN3A 1LU9A 3L02A 4HAUA 4ND7A 1MA3A 4XH9B 1NKTA 5L9AA 3ENQA 4M49A 1A98A 2GZRA 1RJ9A 3D6FA 4ZODA 1W36D 3FGOA 2P4EA 2NU6B 2BFCB 4P35A 1SZPA 4MMZB 9LDBA 4I1VA 1PF7E 2B7LA 1Q1AA 1VMDA 4P3NA 1ZONA 1HE4A 3OZ7A 4X1YA 5DWQA 4RTOA 1V3VA 1H5UA 4GUDA 3HI4A 1JDTA 1RHRA 4K9QA 4F04A 4B47A 1KMHA 2ZVPX 1M54A 2ZWAA 4KRYA 3VH1A 2WZBA 1ES9A 4GXTA 1Q1BA 1F0KA 1IXSB 3KZVA 1U1GA 3VDXA 2B8WA 1F48A 4FQ8A 1HDIA 1TYDE 5A4KA 1MMFB 4NK5A 2Q3HA 3MIIA 2BSAA 1C41A 1D1SA 4TQAA 1SBCA 1E6WA 2B92A 5KTSA 2QRMA 2AFRA 4NOKA 1AKYA 2F8LA 4IH4A 1LRKA 3PD0A 3CVOA 3KJGA 1EFRD 4H7JA 4KI7A 1QAMA 2B6HA 2VPXA 3C6YA 4ZOLB 3GD5A 3RJTA 2X19A 4MW7A 4B3RB 3M6UA 4CG1A 4Y9UA 1Q3KA 4P3IA 2ZRPA 4TSFA 5DTEA 1N2ZA 3MINA 3M9WA 4HT3B 1IBLB 1SC9A 621PA 3I55B 1NC1A 3L92A 4U1RA 4OL9A 1Z0SA 4TKLA 5FLEX 1WV0A 4RV4A 2HFJA 2YKGA 4M1ZA 4D74A 1Y0BA 2CCJA 3G9UA 3I0NA 1QVWA 1RWNA 1BW9B 2VDOB 3BULA 5CPBA 2YZNA 3GGJA 3MB5A 4E12A 1P2TA 1UJMA 2BKUA 3DXXA 5I9BA 2X8AA 1QRUA 2O8VA 3FCEA 1I2MA 3VKWA 3F7OA 3KT0A 2H9IA 4HEQA 2WDZA 3WWDA 1M6VA 4XDZA 3IJ5A 4J3FA 4EFLA 4NBKA 4KXVA 2QK4A 1MBZA 3G2HA 5JCJD 3ZDXB 1JLLB 1U04A 4QO8A 1TL7C 5AXBA 4OX9B 3C8MA 3G0IA 4S1WA 1UPFA 1W9XA 2HCJB 4FHCA 1QPBA 5DI9A 2R00A 5BR1A 5K8JB 4YWJA 1QVGB 1QV7A 4RDHA 3EHDA 3FNQA 3M3DA 3ZWCA 2XBMA 3CNOA 1Q21A 2HIAA 2PH1A 3NGLA 3N5KA 2ECFA 5EKSA 3MWEA 2J3MA 1XWIA 2LVBA 1YJCA 2V5AA 1CJVC 2YVLA 5K8VA 3LC1O 5EFOA 4BVEA 1NXXA 1KBZA 4HPWA 1EFLA 3PC8A 2K2QB 4C2UA 2JLWA 2ZPTX 2RKWA 1TZBA 2AS0A 1C9DB 1MC8A 4INPA 1TD1A 4RD3A 1R1DA 4CCYB 1TNDA 2ODPA 3AUTA 3PCTA 5P8WA 1CUJA 2RK3A 2WFLB 2DPMA 3EQZA 2O2DA 4LAFA 3I2FA 1Z38A 4MAFA 2OHVA 3UAZA 1CDEA 3H5VA 4V24A 2A5DA 1F06A 1T0HB 3H7IA 2G82A 3NDIA 4V39A 2ZR0A 3RRNA 3THOA 2G77B 3LVFO 4FBMA 2FXIA 1RU3A 2WJ6A 2ZVQX 1I1QB 3K0AB 3L6UA 3KL9A 4BFWA 4IF6A 1WKVA 3CS3A 1V8ZA 5J5CA 1VLJA 5T7BA 3G5TA 2D7CA 1N5OX 2H1WA 3AUKA 1J2YA 1UKCA 4MNTA 5BW5A 1ZJ5A 4XPZA 1NNI1 4XN0A 4D4HA 2HJHA 1X7ZB 4O4IF 1FK8A 1R0SA 1YO6A 1V1MB 3FOBA 1Z8NA 2PWZA 1WPGA 2WWWA 1RXEA 1QS0A 1U5BB 3A36A 4ZYLA 1SHKA 5K45A 3S8YA 2QT0A 3GL9A 4DSAA 3NUQA 3O0DA 3HYNA 3IMKA 2PTGA 2QQ0A 2YN0A 1XP5A 4OHBA 4QXPA 5E1OA 3USZA 3V2HA 4WKNA 4I55A 1ZC3A 1MA0A 1N0UA 1PRYA 3E2PA 3W34A 2YWGA 4RIIA 4QXMA 3AV3A 2B78A 4TZTA 4ZK6A 2OBMA 2W6ZA 3AONB 3MQ2A 5EYPA 1ZJWA 3RAJA 3ZCTA 5CBPB 2PUWA 3ZPNA 2X6QA 4DMGA 2H4FA 1XCLA 1OAAA 1QK3A 1XN4A 2H8KA 3H8SA 3LH5A 1MC4A 1A82A 2C42A 3RVRA 3ZE0B 2EEPA 3UCFA 2I7CA 3QVVA 4G9GA 4YCLA 1VPEA 1ZL2A 3AVXA 1B3RA 3Q3JB 1TK9A 2OVBA 2JDIA 2WHEA 3C7AA 1WW2A 2ZJBA 4GG1A 5A05A 2DHRA 5K2MA 5LDGA 5C3UA 4GMKA 1N5RA 4GLOA 4BO0A 2MYPA 2WVAA 2EBUA 2IU4A 1FFAA 4DG5A 4RMGA 4TKUA 2FW6A 3W5VA 1NM5A 1KKUA 3DLAA 2P67A 4F2GA 4ACAA 3H2IA 4QGAA 1WY5A 2G80A 3A1PA 2OV2A 2YIMA 3HUEA 5IKMA 2PLRA 3DMNA 5LQSA 1QX4A 2HD4A 4CV1A 1G0NA 3MJHA 2P68A 1RI5A 1TCAA 2GYYA 3FMGA 5H59A 3UAVA 4AJPA 3FFWA 4ZXFA 2D4AA 2AB0A 3W7BA 2C61A 4MA0A 1L5FA 2FDRA 4MUBA 4ARUA 4OHYA 1JHYA 3DMRA 5JDIA 2IWRA 3KEQA 3MGBA 1COWD 2YX1A 3VTKA 1FFWA 2DPXA 1Q17A 3W2EA 1ECJA 5F9FA 2TMDA 2H9AA 1TT5A 2FMIA 2IGTA 4CUZA 4ES6A 2OFWA 1X70A 3N7UA 1P0FA 4RC9A 2AI1A 1M33A 4X24A 4YCDA 5FWYB 4R84A 5B1EA 4ZGQB 1DMRA 1NE7A 1RQGA 1N0IA 4MV1A 3R8XA 2R7LA 5DLEA 3TIIA 3O9VA 3W04A 4I1IA 2QPTA 3EUFA 4QWMA 4KDRA 2X0RA 4Z4EA 4EELA 2Y4NA 1BKSB 5CLIA 3IXQA 4IDNA 1NQUA 4YHBA 2XTZA 4DCNA 2ZJ2A 5JXHA 1CFJA 1TU4A 3JWIA 3E58A 2A33A 3ZKWA 3PHJA 1VG9B 4IV0A 4X8LA 4NYJQ 4PPNA 4OA5A 4MTCA 2YTZA 4HEHA 4OQPA 1I1HA 1RHJA 4JP5A 3PK0A 3CCMB 2IE0A 3TZKA 3VM6A 5IKPA 3HTXA 2V96A 1GQRA 3SJPA 2VJNA 2DBVO 4GOKA 4F3TA 1DQYA 2B8EA 1E96A 3PJGA 1L4KA 2QX9A 3CCVB 1BMDA 2AYXA 1J9GA 2PMFA 3EAGA 5IM4F 1SXJE 4YP0A 1KO1A 4AQ7A 5G40A 4GOOD 3ET4A 4TL9A 2UVDA 3HJCA 2Z2KA 3GDOA 3I64A 5FUMA 2WSYB 3O21A 2M1XA 2RHTA 3G5MA 3OZFA 1RIIA 2OMEA 1G8JA 1YJ8A 3X1YA 2Y27A 3MWLA 2PUCA 3PFCA 1J8QA 2DFKB 3PHLA 5EZYB 4YUVA 1ATZA 3DHYA 3GQVA 1HTWA 3COPA 3RV3A 1MCZA 3DL2A 4U39A 1SR8A 4ZYZA 5EQFA 1J8DA 2B1IA 1MW9X 2QN8A 4JB0A 4NCJA 1PFUA 1AZSC 5D84A 3RC7A 2AGVA 1XEXA 1PUXA 3PHHA 3QWAA 3W06A 3WAJA 4J91A 4MR9B 3M4JA 4YXWD 3A14A 3R7AA 4ZVLA 4FB4A 1FDVA 1XRPA 2I6TA 4RFSA 4JLDA 5FPQA 5FI1B 5G4KB 2CB0A 1PR0A 1PUIA 4HUTA 2MWMA 5A3SA 3K6KA 3C5HA 3NGXA 4I50F 1U28C 3UNXA 2DM6A 5TRTA 4LRYA 2WTNA 3I45A 1SK8A 4FC7A 4BJHB 1R74A 1D0SA 5ANRB 1XZAA 1WP4A 1C3XA 3RSCA 2XNCA 1WWKA 4OHMA 4CXMA 3WP1B 4EI2A 1QWSA 1V35A 2BR3A 1UDAA 2CJYA 4FD3A 3WLLA 1BD3A 2I8AA 2QENA 3H2HA 1TVKA 4YIHA 1DIRA 2ZOSA 4XIJA 3O26A 1NX6A 3KHSA 3GBPA 2DPLA 1RJDA 1M2FA 5KJ6A 4LYAA 1FRVA 1P7ZA 2YQ4A 3CZPA 3IOCA 3MGCA 3KX2A 1L7EA 2V6BA 1JEJA 4OAOA 4DCOA 2EFCB 4JVSB 1R64A 2WJHA 3GX1A 1QC5A 1DIOB 4P84A 3W79A 4D9HA 3WGHA 4B4VA 3KIPA 1KTIA 4KMOA 1ZH6A 4UVIA 1JYFA 4IKPA 4D9KA 5ILGA 3IJRA 2ZRIA 4QTTB 1CY0A 1M7HA 3DB2A 3M5CA 1L3IA 4WWHA 5A71A 4BFLA 1FB5A 2QNRA 3E48A 2VTVA 3CRMA 1FFDA 2IHTA 3KB1A 2E3JA 3M9XA 4P93A 4R6WA 4QVKA 2YVKA 5TDHA 1D0VA 3LC7O 3RT9A 2I8LA 4B3JA 1J5EB 2XDQA 4Z4GA 1YZVA 2FUNB 2OCPA 5JG7A 2EX0A 3KQMA 5DOVA 1Y9JA 1KY2A 2I22A 3ILSA 3HZZA 4TYYA 2Z2XA 5HE8A 1M7BA 2HWUA 2LTAA 3WGNA 2PU5A 3CV3A 1JHOA 4OEHA 1ZITA 5FYQA 1KDVA 1OI3A 1PJ6A 3S2GA 3WL5A 4AY3A 1H4QA 5KC8A 5K01A 2COEA 5E6RA 1W0KD 4EBFA 1NVXQ 4MUJA 3CT6A 5EIEA 3QX9A 3I4LA 3DV0B 3NTVA 1KWGA 5DBOA 3SHFA 1NJGA 5K0CA 4BO9A 2QYHA 1U7TA 5DB4A 4ILEA 5TSDA 5L6LB 1GJRA 3HO8A 1EQ2A 3ZZ0A 1M2JA 4QYTA 4XLAA 1G5PA 3JQGB 3PDCA 2PQ2A 5I7AA 1IJKA 2O8EB 3T3IA 5TQ2B 4OMUA 2XQKA 2BFWA 4FW9A 3Q8WA 1U1EA 5HILA 2FWAA 3S99A 5K8LA 2JGMA 2HRBA 1T0BA 3NASA 1HLDA 3ZDQA 3KAQA 1KO4A 3KQPA 3LTNC 5IAGA 2QE7D 1PQYA 1SWVA 4YP1A 2OM2A 5D51S 3OU2A 3BK2A 4NFHA 4EVRA 2XUIA 1WORA 1XUOA 5ADHA 4ZRNA 1BCSB 2IBSA 1ZDMA 4PSUA 3T34A 3ZHQA 3BQMB 2Q50A 2NZWA 2QY9A 3W4JA 3U44A 2V7BA 1Q22A 3KEOA 3OD1A 2XGJA 1V8PA 1I13A 4HQNA 4NDAA 5EJIA 1E79A 4MEAA 5J4KA 2HLPA 1LPSA 2VH5R 4V0NA 1RYYA 2PS3A 2VUUA 3RARA 4JP1A 3DOOA 4CKWA 1KI3A 1J23A 2X2OA 5B2EA 5DNYB 1E2PA 1TM4E 1WU7A 5FHQA 4I1UA 3CZCA 1L2TA 4CIAA 1PL0A 3HN6A 4G0XA 2EATA 5IYZB 2CXHA 5AN9A 1NMZA 3L4JA 1DZIA 1ZHFA 3EEIA 3DLIA 4EG3A 3ZU4A 5FNVA 2GERA 1KFCB 1F60A 1Q81D 2V6JA 1XQXA 1CF2O 3K3PA 2WUFA 4FYYA 4N5NA 4E09A 1T4GA 4O2AA 3SLKA 1RP7A 2E4AA 3G79A 3A0UA 3R6JA 1XU4A 2BEVB 2WK1A 4KACA 1VMIA 1CR0A 5AM3A 2RC5A 1P9WA 1UBLS 2WSLA 3OIVA 2AJBA 3AW9A 3L07A 4G84A 5G1OA 1IY2A 3B6ZA 3WFJA 1BWRA 1K5GA 1Y1QA 4GLJA 3H17A 4AP9A 2JRCA 1YQQA 2VNSA 4EYSA 1DZ3A 2F48A 4MB2A 3ONNA 5FV7A 1R66A 4CWAA 4X1IB 5FR1A 2OXTA 1S2OA 1NLUA 2O7QA 3N28A 1Q0TA 2WRZA 4GSYA 4E0BA 4EG6A 1N2CE 3LQFA 4G01B 1XPOA 4X1KB 5F3WB 1G66A 4IIUA 4XW2A 2PWBA 4Y2JA 5CX4A 2OC9A 4LXHA 4UUQA 3PCRB 5K4AA 3EFOA 2UYOA 1K4YA 3D4OA 3R1IA 3C3MA 4FEAA 4GVXA 4NL4H 4W63A 1I0ZA 3E3LA 3QU2A 2HXYA 3M1AA 1RHUA 2J30A 3GAAA 5IF3A 3TR5A 1JAIA 5CH3A 4ZAZA 5J1TB 2FJ0A 4MRPA 2NUPB 1QDEA 4Y6GB 3HRKA 1U2GC 3GC6A 3F5SA 1I94B 5AVZA 1OFTA 1RM0A 3QOYA 4Z9YA 1UEXC 1I6LA 3CT4A 4GZMA 1J2EA 1QG2A 2DAPA 4GI7A 4H08A 5TQ0B 2OZEA 4F5EA 5A03A 1RKBA 1UC9A 3ASZA 4V38A 1WW8A 4DRZA 1LV8A 4Q3BA 3ABOB 4CKXA 4TVKA 2W2OA 2QXYA 1XOIA 5A8AA 1J7KA 4LMAA 5K99A 1SVLA 2WV7A 4N39A 2IYVA 1TU3A 2YXBA 3HLTA 4C03A 3O1IC 4TSKA 3WX0A 5JR3A 4EENA 1YITB 2JIBA 4JJGA 3N5CA 2QLJA 1B1CA 2QL7A 4CQNA 3CW2A 4DQUA 4AY6A 1GUDA 5JSZB 1A8PA 3EVZA 5KEIA 1CUVA 3QE2A 2CFIA 2LGJA 3HV0A 4CFZA 3QY9A 4U6QA 2XDWA 1SKBA 2JAPA 1V7ZA 4ESVA 5KOIA 2YY6A 5JYBA 4OBWA 3K0HA 4GLBA 1M0TA 1U6JA 4QBHA 3HFRA 5K3FB 3BB3A 3F1KA 4M55A 4Z3DA 1OGYA 4CPDA 2WSIA 3EVCA 4BMZA 1VECA 2QGZA 3BE8A 3IULA 3MEQA 3C41J 3AOEC 4UNPA 5LUBA 2I91A 3HSKA 1Z2OX 1I14A 4DIOA 2ZAIA 1T3ZA 3AW8A 4NZ9A 4WCDA 4YPVA 3DZHA 5E1DA 4D8XA 4LRUA 3W6UA 1KZYC 4J7XA 1OW3B 2XD9A 1W19A 3HKDB 1AC5A 1PFKA 2X14A 1C9KA 1UMDA 1R6VA 2VSXA 3C14C 1E0KA 3Q7SA 2H00A 3LUDA 4AMZA 2JJ2A 3A4VA 3AM5A 1FFXA 1G2IA 1ZW6A 3GR6A 3KJQA 4XOIA 1OXBB 4E5YA 4ZC1A 4ZCMA 4XR6A 1NRXA 5IAOA 4ROXA 1W4ZA 1TCBA 1U0HC 2IOQA 2PL3A 4R2XA 1ICEA 2VLIA 4Q7LA 4ZZ1A 2JFOA 4TQ9A 1N0HA 5HNKA 4HEJA 3RFVA 1E0JA 1NP6A 1EINA 1YA8A 5HS6A 2D3TA 3PHCA 3RYIA 4Q9NA 1R2QA 1SPXA 1Q0ZA 4ZZ3A 2PGXA 4R2LA 3WS7A 1CUCA 1J56A 5I4BA 4TN1A 4X6XA 2O05A 5I9SA 3S8MA 2ZYRA 1AK9A 4PFKA 5IZCC 3H11A 4C4RA 1E2MA 4DDWA 1Q0HA 1S72B 3PF8A 1QFXA 2WWFA 3AJEA 4CEJB 3LDHA 3Q3IA 4GXNA 3TJRA 2V7XA 1AV6A 4HNSA 4BTLA 4RULA 5CCEA 2KB0A 2Y1EA 1DTSA 1OHHA 3DEYX 3U9LA 2B37A 1NI4B 4JBXA 4BKMA 1SUPA 3QBEA 4JY7A 3I3OA 4FE4A 4QECA 5D01A 2O4CA 2TSYB 2R4QA 2F3QA 2XKBA 4GO1A 3ETLA 3WISA 3ZHXA 2GVZC 4CTMA 2XAAA 5HXAA 3ESRA 3GEPA 3UKDA 4EY6A 4IZHA 4LQLA 5AW2A 3DP9A 4P25A 1VCMA 1P4AA 1CUIA 3TVYA 3CTAA 3NZEA 4U7GA 1A5AB 4Y0VA 4E21A 1PLLA 2JLAA 4C08A 4R2KA 1O4VA 2H06A 4MVJE 5C34B 2CLMB 1UMKA 2A35A 1VL0A 2B98A 3HJAA 1J99A 1QANA 4JDPA 4OHPA 1EVKA 3L06A 1OPRA 4PVCA 1TZKA 3LOPA 3ORHA 2VJLA 1KS2A 4BJ1A 5KNBH 2HJVA 4J6EA 3KWJA 2VDQB 4HLUA 1KE2A 5DZSA 3ROXA 4HC4A 3SR3A 1TEVA 1XA0A 4ETNA 1YB7A 3AGPA 1UEIA 3GZNA 4HLDA 3L8HA 4M1QA 1KY3A 1R5JA 2Q2NA 3DJYA 4K9OA 4BNUA 1XRSB 4BCCA 4K6CA 4NJOA 3AJRA 5HTKA 3UF0A 1NW5A 1G1AA 2J9YB 4UREA 3UWMA 1PUJA 3HFJA 3ADBA 4M6WA 3C3PA 5G0VA 1VPWA 1WBJB 3T12A 1CRZA 1MPTA 3DKVA 2P0EA 4JAVC 3PKIA 1IN1A 2WD7B 2H7XA 1ZKMA 4PY2A 4FJ2A 4ZD6A 4OLBA 3Q40A 4IIGA 1MVOA 4Q03A 4DWVA 5KQMA 4YNBA 1Y0YA 4B0PA 3EGIA 3IBYA 2GPTA 4N12A 1RZRA 1CY8A 1BVRA 3DMTA 4I9HA 4D1YA 1KMQA 2BONA 4AJ4A 3VVCA 4JSTA 4OHOA 2FZ4A 3W2GA 3F6YA 4O08A 5AI4A 1XXLA 2FW9A 3V4LA 5IAAA 4DXDA 3SLGA 4WFQA 3IOBA 4X1OA 2C7OA 3I83A 4WA8A 4ER7A 1E6KA 1FPMA 1M0WA 3HU5A 2HMSA 2R1VA 4MXDA 1D4AA 3TSZA 2HMTA 1K2VN 2IYPA 2JFYA 3JX9A 4RDKA 1BYIA 1NUAA 1BHJA 3H19A 3OPVA 3SFVA 5EWMB 1X9HA 4D56A 1OY1A 2A0YA 2P2CA 3VVBA 2BH2A 1UWKA 2WJVA 5E2BA 3E20A 4BNWA 1U8CB 1KQGA 3QFCA 4HPJB 1QCCA 1SXHA 3IYLW 4G37A 4JJAA 4NONA 1H66A 4X71A 4ZRDA 4AJHA 1E1KA 1WB5A 1VCOA 2CL7X 3HMQA 4O2BA 1P0PA 4CLRA 5FTKA 5T4HA 4HQKA 1GGKA 2YMPA 2GYWA 2ZULA 4J1NA 4Q4AB 4RH1A 3D4PA 4S2EA 4US0R 1YJ9B 3WNQA 3WGZA 4BX2A 4ZCTA 2Z04A 1V1RA 2ERCA 5BURA 4B71A 1TVCA 1X3LA 1YUMA 3BZBA 4JLSA 3C97A 9ATCA 4QXQA 3WNZA 4K1LA 1GPWB 2MSCB 3T8YA 1TVMA 4FM9A 1KYZA 3CMEB 1ZJYA 1NDUA 2CY0A 4KW7A 3UJ9A 3A3GA 1A7AA 4OH7A 2FJUA 2J1LA 1G2QA 3GAMA 3HWX1 5ALWA 1PS9A 2GM3A 3GLKA 3O31A 4HEA1 3RHSA 1AA6A 1Z2CA 3JQ7B 3JVDA 1PZFA 4IDBA 3WTCA 2HNKA 1B43A 5CLQA 3FZGA 1AUPA 4N3NA 1L4YA 3KQVA 4G1MB 5DYWA 1NSFA 2QVCA 2H8GA 4F9GA 1WCIB 2W8BA 4P0QB 1V16B 5H81A 4IJKA 4AO7A 1CIVA 2UUOA 3LSTA 1INLA 1J2RA 4KN8A 4UXJA 4Y2RA 3NKLA 1IHYA 3VHXB 4DF3A 5I45A 5GIOE 2HQOA 4ICIA 1BOOA 1XZDA 4LS3A 2DLCX 4C0JA 5TXGA 4RA6A 3K1ZA 2NU8A 1PNTA 1D1TA 2Q0XA 5AXCA 2WEKA 3CZAA 4EA9A 1WOMA 4FZ3A 4JBGA 4OQLA 3CKYA 2PVSA 4R31A 1AKTA 5FBQB 2JCVA 3I6YA 4LE2A 2IV2X 3TOSA 4AUKA 2RGCA 1TO6A 3V4FA 3L6RA 4IXNA 3F9CA 4NEQA 2VCHA 2UXDB 3NEPX 5BR7A 2YHBA 4URUR 4Q9LA 5EE9A 5E3HA 3T5TA 2I2CA 5BSVA 2WIJA 1AGRA 1KK0A 1S8FA 1DAIA 2J7PA 2OZKA 2IYZA 2JASA 3RU9A 3F5QA 3RSFA 3SKYA 4E08A 2O0MA 4AW9A 4F6CA 1FXWF 2CVPA 3M49A 1NI3A 1MQ9A 3RM3A 1JJIA 4GBJA 5EJFA 2A7QA 5FLKA 2QTMA 2GN8A 3CZ4A 3Q9NA 1XV5A 2XMPA 3L82B 1CW2B 4P4GA 1DJOA 1ZK1A 2I3BA 4QHSA 3TCKA 5JXGA 1KRXA 3CURA 4FOPA 4IMJB 2O3QA 3DEFA 2EIHA 4JITA 4KTVE 3SC4A 3UUEA 1MORA 1W5EA 2Y1DA 4IKEA 1E1MA 1RKXA 4JS0A 4NMXB 5B7PA 4WN9B 1JPVA 1R6XA 2EQAA 3NAQA 4X3PA 5ALFA 4YAWA 2ESRA 1CS0B 1YJWB 2ZUCA 3A37A 3DE2X 3NTLA 4JQOA 4YDQA 4MLDA 3IBSA 2AQKA 2MT9A 3Q7EA 2FOXA 1JECA 2AF4C 4FWTA 3WLFA 4PCAA 1TYBE 4OUDB 2P0AA 1KOLA 1QTIA 2Z3VA 2C04A 4Z4VA 2BC9A 1WR8A 3C3EA 3EIQA 3LT1A 4ZARA 5LDDC 2JC3A 1SU7A 1NW6A 1ZMRA 3CRNA 4LHZA 4MO2A 4NI5A 3UHPA 4EA6A 4PICA 1ZLYA 4CRWB 3H4MA 5U4XA 5DX1A 1G7TA 3ZZUA 4DIMA 1CE8A 1OBVA 2OBRA 1XRRA 3QE9Y 3ZWPA 1EUZA 2ALJA 3TZEA 3Q6QA 3OJWA 1PZMA 3B9RA 4HK4A 4YFVA 4C7MA 5BT8A 2R84A 1SVIA 1H65A 3OZSA 4G4SP 2PV7A 3OOHA 4IXDA 1GVNB 4O29A 4OY3A 3F49S 1YZQA 3C4JA 3BTSA 3CIFA 4FINA 4J90A 3GROA 3WWZA 2IX9A 1VRCA 2WSBA 3EWAA 3ST7A 1JE1A 2PUVA 2MYUA 4GDFA 1YC5A 5M3BA 4NXNB 3JD3A 4FCTA 4G5FA 5J2TB 4A2PA 2HJGA 1UMCB 3IEIA 3EDOA 3NONA 4JB3A 4GR5A 3L6OO 3WB0A 2GK3A 5AMXA 4UARA 5EI5A 4ALKA 5B1YA 4PRZA 4MV0A 5HIIA 4RF5A 5A9TA 3A7DA 4WZKA 1I3LA 1OXSC 4TWBA 3IE0A 1JKJB 4TVBA 5JEEA 1KRWA 1OBOA 1WZUA 3ZWAA 4U9IS 3EWSA 2GCGA 3PUZA 4GPBA 5AW4A 4PHGA 4UMVA 3LYAA 4XVQA 3R6GA 4C0HA 2EJVA 1KL7A 2C2GA 3ELYA 4J0IA 4LV8B 3CEPB 2DT8A 3EBOA 2K4MA 3UWSA 4KPYA 3ENKA 3PUKA 3VA7A 5B1IA 4Q9DA 5EKXA 3WLTA 3VR3D 3BSFA 1AKNA 3EGDB 1BE6A 2XOKA 1UJ5A 5BN3B 4GOJA 1KZGB 1AK1A 2ZB3A 2PUBA 1GTL1 1U0EA 5T4EA 4CM4B 3RABA 3BBPA 4XM0A 3Q9LA 1D2MA 3VZSA 1Q9SA 3FVRA 2HAEA 1M9NA 1SG9A 4LY3A 3RVPA 2RHLA 3JARB 4H4CA 3A9WA 3L0IB 4ZYXA 4D42A 2ZJ4A 3FOAA 3NBZC 1J4AA 3K16A 2WABA 1CNEA 3I8SA 2CXSA 5FTWA 1DKPA 2NZ8A 3M6FA 4ND4A 2C9YA 4LXUA 5KNDD 3KO8A 3Q38A 1FLDA 2FYTA 1UPAA 2WJJA 3BRWA 3Q3CA 3B6MA 1UP4A 4KR7A 2N46A 3NOOA 3U16A 1AD2A 3S2IA 4OOSA 2AFHB 3NTRA 5EVJA 3TLKA 5E95A 2IYYA 3HXTA 4MRMA 5IRCD 3WB2A 3G85A 4QRHA 4DL9A 3C3BA 4H1UA 1CEQA 5L7YA 4L5JA 2V74B 1X1RA 3NFRA 3VYSB 3OEHA 4IO0A 4C4AA 2C97A 4NTZA 2E5WA 4P9NA 2I7XA 2DT5A 2YHAA 1O8CA 2WVJA 4C9BA 2ZR7A 1LF0A 4FCWA 1J2TA 3KEFA 1VB3A 3V2IA 3ET5A 2IP2A 4B6GA 2R6AA 3THSA 3CKLA 3F6RA 4L07A 2IU6A 1GU1A 2WP0A 3HJHA 5CB4A 2PD4A 3LV8A 3NNDA 4YRIA 1O9BA 1YFKA 5ITZA 4AJNA 2ZRAA 4IJQA 5JFTA 4PU0A 1SXGA 3EQ6A 3JWEA 5HOQA 1XKLA 1LTQA 3PQFA 5JJCA 5T41A 1Y34E 3UIEA 5T6BA 3VNBA 1S2MA 2VPZA 4RSMA 4OOVA 4HTAA 3WB9A 3G6KA 1FRNA 3ICPA 1RCTE 4S1VA 3E2MA 2NZYA 3DR5A 4S1TA 4UHDA 1PNRA 3USCS 1YCDA 5DISB 1Q82D 4D4IA 1LPNA 1OXUA 1UOQA 1TEXA 4WACA 1C7ZA 3TUZC 1T91A 3GA7A 4MYDA 1ZMTA 4HI0E 2AXQA 4B33A 1CEEA 1I5OA 1XZPA 3D2LA 4OU5A 3OIUA 4ZOEA 5HCIA 4WNAA 4DLNA 3IERA 3P9KA 1R37A 3EA4A 3Q7TA 4LHVA 4F12A 2VHZA 3KJIA 2CUNA 1GARA 3UW1A 5KSPA 2VQFB 2P69A 1S01A 3GIWA 3WDKA 2RAUA 4UXIA 2BEUB 2FOIA 2R86A 3MT0A 1J0CA 4LK3A 5IC6A 3TOVA 1JLRA 4IZIA 4Q3LA 1BDMA 1Y4ZA 3CEJA 2C2MA 3L4BC 1H1DA 4JI1B 5BRAA 3PTAA 1VHOA 4AKIA 5FHRA 3L8CA 3VR5H 1Z8FA 2NIPA 2QN3A 4IV8A 4KXWA 3R3WA 1N5MA 5K3AA 4CM7A 5THKA 1OCEA 2ZWVA 3IP6A 2OYNA 4J4BA 5G0TA 2NUBA 2I2AA 4OHWA 4B73A 1HOTA 1WVMA 2EBHX 2XH8A 4Z9FA 3UMRA 2ZM6B 2WA2A 1UKEA 2IF2A 3CO5A 3LP5A 3TOCA 3LUBA 5ICGA 1JEYA 2OC4A 1X1AA 3IPRA 2PGNA 4GFDA 2Y66A 3VPXA 1KFBB 3JAKB 3ZOKA 3K9CA 3QKRA 2BZ0A 5DNCA 1SUFA 3C6MA 4X8HA 5CA1F 2Y92A 4QUAA 4NBUA 4I4IA 3GFGA 1T6YA 1G4UR 2FWNA 4LIPD 3ZCQA 3H16A 2AEEA 4X7DA 1AGYA 4FP9A 1DOZA 1Q57A 2AWOA 2GXSA 3MGAA 1PFQA 2G4CA 1TLLA 2HT6A 1KK1A 1Z08A 4BFSA 1RC1A 1DKUA 1H6DA 5CLFA 3DULA 3VRHA 3F96A 4TKVB 3WXMA 2QYSA 2ZI6A 4PC1A 3EZFA 3ITDA 3ON5A 2F1HA 2W0MA 4GKKB 2HY7A 4BPBA 3QPDA 3N2KB 4OOXA 1C4WA 2AWNA 3CUKA 2AJDA 1SVKA 2CBXA 4D8YA 3IVMA 1RQNA 3QELA 4WUTA 3LZ6A 1LUAA 4Z4TA 4B31A 4OLAA 3E7DA 4ZV7A 1XF1A 3C1OA 3D59A 1FNBA 4FFBB 5EMMA 5K0SA 4MPDA 2BFFB 2FPSA 2GSDA 3HQ4O 4M1YA 5SICE 2DWOA 1QFMA 2QVXX 3A1FA 1P2VA 3QG5A 1PV2A 5J5VA 1Z68A 4G8DA 4XPIB 1V7QA 1FFBA 2A9FA 4B6OA 1ADJA 4GVLA 1WMFA 1U9JA 3G59A 4MQMA 3AKCA 5AUOB 5JO0A 2GF2A 4WN3A 1HRKA 2GCIA 3PUYA 2C8JA 4RKEA 2H4XA 3OLWA 2I6FA 1YIDA 1XEAA 4N7BA 4RANA 3TBKA 3VTZA 1TF7A 3TN7A 4LBZA 2GEDA 2NO6A 4F86A 3O8DA 5GONA 3KBOA 3FCUB 2R1TA 3GOQA 1FSSA 1XTBA 1R4AA 2VSFA 2A7XA 5A3VA 4Y2YA 3VMMA 4L4ZA 1E2QA 4AJ1A 4QICA 1UWLA 4U5QA 1USVA 5IAEA 1JU9A 1RMQA 3NBFA 5E38A 3ZDRA 1JUDA 2PXAA 3BWMA 2ZJFA 4TXNA 2H1VA 5B12A 1SUWA 3AH8A 4RK0A 4F3RA 2H3EA 3GEHA 3AEZA 4KAJA 3HHEA 3N0TA 5CNMA 5L3VA 2I4MA 5K3DA 1F3LA 2VP3A 2H4YA 4P92A 2DOGA 3CRVA 4FHEA 5KAPA 2AMYA 2L0XA 3IVRA 1FMJA 4Y6QA 5IH3A 1I7PA 3OP1A 4O4JA 3SEJA 5K05A 3KPYA 2GGSA 2QQFA 2AK3A 3RBVA 3NJRA 2C9DA 2XX3A 4HQ6A 2XI4A 4WZBA 4AMGA 1H22A 4LDJA 4PLZA 4ZOCA 3ZCVA 5JMOA 2ZZNA 4RTPA 2JIZA 1JVNA 2D5LA 1ADFA 2DPGA 2P9QA 3D3EA 4BFUA 2OYCA 4MHTA 4B2YA 1SVOA 5EGSA 1KNXA 3SKVA 4ZHQF 5AJZA 3M1IA 3DOIA 4V0ME 2CVHA 3O73A 2L2QA 5H0IA 1T2VA 1F6BA 1J8MF 1SKAA 4KMSA 1VPTA 1NPYA 1SUCA 2FRXA 4G81A 4PG4A 4PRYA 5CLJA 4LNHA 1GKLA 5FAXA 1PHRA 5I9TA 1GUYA 1EJBA 1F4VA 2QLFA 3MFQA 4NX2A 4WEQA 5J5AA 2F1MA 2DFVA 3IV7A 3Q87B 5BSTA 3V1YA 4F2WA 3AEQA 1CRLA 1W44A 4DA6A 4LF8B 1VQ5B 4B82A 1AX9A 1QHGA 4DDTA 1T9DA 5JLJA 2DBYA 3BHNA 2HOQA 4N49A 5EWLB 4B80A 1N9GA 1IQPA 5KVAA 1JNYA 3GRPA 1OLUA 2HSWA 1YQGA 4ZQGA 4HCJA 3D8TA 4LNUA 1EVJA 5HA5A 5A3QA 2IYTA 3W5DA 2DBQA 4PG5A 3VPFA 2H5IA 3FHJA 4O0MA 1SCUB 2HSZA 5IFLA 5D1HA 3IJEB 3EHEA 5TVGA 1J7JA 4G4IA 3G8CA 1MJ5A 1C7EA 1M1YA 1JKIA 1ONPA 2CUKA 2FW7A 1NRIA 3E8MA 5ERYA 2HHCA 4ALNA 1YR6A 2QMEA 3TNFA 3TAHA 4LSGA 4G1BA 4F5DA 7MDHA 2DCMA 4L4XA 5JI3E 4NV0A 2XITA 2QRUA 4YLGA 3LXXA 8GPBA 2HGSA 2QL9A 5D3QA 3FR8A 3W0LB 1DX6A 2AX4A 1HTTA 1F8YA 4MCHA 3ASSA 3O4JA 2P65A 1OTYA 2XRYA 2Y1CA 3GP3A 3N7TA 1UR5A 1NT2A 4PYKA 1YUBA 1G3RA 5EGNA 1XK7A 2IODA 3HNRA 3RHFA 1I24A 2EKQA 3ZI4A 4RZQA 4ISCA 3MTIA 1XRMA 3THWA 2I6XA 3MSCA 4M0LA 3WBJA 1O8BA 4RD4A 3AV0B 1HNXB 3LY5A 3T0IA 3AY0A 3FMVA 3I2IA 5FPKA 1JA0A 1HQCA 1P9LA 3H2ZA 5JOQA 2QF7A 1CXZA 1E2DA 3FMIA 5KYVA 1C7QA 1FU4A 5LBTA 2QVYX 3B6IA 3KDSE 2ZTNA 5KHOC 4JEHA 2OTLB 9LDTA 1L5SA 1NVTA 3SKBA 2Z2JA 4IIYA 5H3LA 4MZDA 2IFTA 4TL8A 2ZIXB 2VBCA 3S29A 4QUEA 1WA5A 2UUPA 3CVYA 5ALNA 1JLHA 4WFJA 4HRXA 4Y1RA 4D0LB 1ONBA 3FYSA 1L0BA 3U40A 4V1CB 1EU1A 3PVSA 2IHNA 4OQYA 3M3HA 1KGDA 1AUQA 4DR4B 1D2CA 1T6BY 2QSUA 4LXGA 2FXVA 2BFDB 1DBWA 3OKAA 1Z28A 3GJZA 5L3SA 4I19A 1P3Y1 4O4LF 3AJ8A 1QF6A 2W37A 2GJRA 1G41A 2ZUEA 1CUEA 2R48A 4G0WA 1EBUA 4KNWA 3B89A 3ZW8A 4RY8A 4ZO9A 4LK2A 1JDBC 2C5HA 2L69A 5CDFE 3ZXIA 2AC4A 3G2KA 3CGGA 2RGXA 1VGVA 3PJFA 2R8ZA 1GAJA 4BYGA 1RRFA 5EP3A 2FQYA 2ATXA 4QJ3A 4TXMA 4JQYA 4I4LA 1EFKA 4ILKA 2P6NA 1WZIA 3OMLA 2WWVD 5CA1B 5FR2A 2LKCA 3NMUF 1USKA 4HFNA 1KJQA 2VBSA 4ECAA 3HWRA 1P31A 4LF5B 5GQSA 3C1AA 3DFKA 4II7A 4MVJD 5DTIA 4B81A 4IDPA 4AG3A 2LWIA 3T1OA 3ABSB 1EFTA 3BWEA 4DAOA 4LGMA 3CUUA 4Y67A 5D2CA 3SZRA 1GXSB 4KMRA 1L8QA 2A5JA 2YNMA 2VJCA 3UJ8A 1B0PA 3U9TA 3N1UA 1ISIA 3ORYA 3A28A 3KAPA 1IEXA 5EXEA 4BXOA 2UZ3A 4LOHA 3I53A 2X4IA 2XUAA 3EF0A 3SIXA 4KIFA 5EE3A 3OZXA 4PYRA 4RF2A 1HZEA 4Z1MD 4H0CA 3BXFA 1EXVA 2VTDA 2XUQA 4US1R 1XZLA 2OGTA 3DZIA 3JV7A 5DP2A 3REQB 5KOHA 3PPYA 4AS1A 4ZXPA 1Q77A 3LM8A 1FP2A 2VNIA 2QLNA 1KYQA 4BMVA 4WOKA 1LVGA 3N2NA 4P08A 3W9SA 4J0KA 4P3YA 2PBLA 2FWJA 3KZMA 3OLVA 4QEZA 4QU0A 5HFJA 3PEFA 2P90A 5GOZA 5LLSA 3AM1A 1HETA 1QRTA 4TS1A 4ZAWA 2GBIA 3V76A 4GSKA 3HXQA 3H05A 2DX7A 3JQAB 3LGXA 3TLCA 1K6IA 2AQ8A 5KOJB 2H3HA 2I71A 1P1FA 3Q3EA 4ZC8A 1LBHA 3DMHA 4ZEVA 2HWKA 4GSLA 2BM8A 3U5ZB 4FGWA 5G53C 5BUQA 3MJVA 3U60B 1WOYA 1TA0A 1XDBA 3MHPA 1KORA 4KE8A 4X7CA 5IUKC 2X0FA 3M7IA 3GPIA 4CDGA 4FE7A 5KAMA 5G2OA 2I65A 4IHAA 4KP7A 4QUHA 4E1BA 4ZDJA 1GG9A 4NJEA 4E2WA 1US8A 3QUAA 5LJIA 1TJYA 5EUBA 3PITA 2CT8A 3JATB 4O1HA 1P60A 1H1TA 5EZQA 2YJGA 2NUTB 1TMYA 3EG9B 1XU9A 2HBRA 2H7CA 3QLVC 4KWEA 4TTQA 3VZDA 5C5EA 2XHZA 2IEGA 1VSVA 4P34A 1A9PA 2OMKA 1P45A 3FWPA 2SECE 3JQBC 3RR2A 4JB2A 1JG2A 4P81A 3KVYA 4F2DA 1T4BA 4IH1A 2G0AA 2FEMA 3LNTA 3BMQB 2C2OA 1LWOA 5AI0A 3R5JA 2D59A 3F8WA 1J8FA 4YBZA 2CLOB 3E9CA 3VPDA 1PL6A 1ESCA 1JHUA 1ZCAA 3A6DA 1G18A 1KO7A 2CLSA 2IV3A 4ZHQB 3A1DA 2WHQA 1E7RA 1VB5A 3NLLA 2PBRA 2YHIB 3TCXB 1T34A 2WE7A 2VOEA 3WOVA 2PSEA 2QLBA 4GX5A 3FCOA 2A67A 5BNZA 1XVAA 3DOCA 4MOWA 3OZUA 2H5JA 3JYLA 4INJA 3T3HA 4BVAA 3BWBA 3V8QA 4BN5A 3WDLA 1YASA 1AZWA 3K96A 4OP3A 4RZHA 5IMBA 4PLGA 1P81A 3BTOA 3QVGB 1GZ5A 1VIDA 2YVAA 4JC0A 2FAXA 4EQZA 2CSXA 1QHNA 4LBWA 1BXRB 5JRDS 3VUFA 5FH9A 5H3CA 5E9JA 3QVMA 1U11A 4P3KA 4X3OA 5FF9A 3LX8A 1OSNA 2PM8A 3V8PA 3CH5A 2Q0HA 4RV9A 3RSLA 4XYLA 4DS3A 1ZEMA 1EAYA 4UJ3A 3ZG6A 1GG8A 3E7WA 4G5RA 4LJ5A 5C8ZA 4D0SA 3KQUA 1DGQA 4MWTA 2I6GA 3ZWMA 5LQUA 1HDRA 2Z2ZA 4PABA 4MQBA 1KI6B 3IDSA 1H4TA 4H1TA 3ZIDA 3O3OB 5KZMB 4IVQA 4PXYA 4P7JA 1XQBA 4Z7OB 4EY3A 5EHIA 1X15A 3HSSA 3TTXA 3WYCA 2GXUA 4G26A 1WXFA 1ZZEA 4JLBA 5B7GA 3LQYA 2D4HA 4YRAA 2IOFA 3TRFA 3RH0A 4ER5A 1X39A 3STHA 4BFVA 1POXA 4EUSA 1P0IA 5FPHA 3GRRA 2XNHA 1AVTA 2RCYA 3GJ5A 1YIAA 2IYEA 2GNOA 1TPZA 1VE5A 4MEBA 1XDGA 3GK3A 4ZCQA 1Z75A 1V48A 4RPJA 1SC4A 2QTWB 3RBAA 2PRZA 2ZI5A 6PFKA 4MR8B 2H57A 1SCNE 4X9XA 4N01A 1IJEA 1NMXA 2O57A 5KNCH 3UMMA 1GLVA 4OYRA 3SMQA 3IQGX 3H42B 4EUEA 3TQQA 3GLFA 2VYVD 3JPWA 4W1SA 3WHPA 5TQVA 1R0XA 1WPRA 3BD8A 3L8FA 3VX4A 4WZAB 5JQGF 3ONFA 1NOJA 2DSNA 4PWYA 4WY5A 4ED9A 5BWMA 4ZVQA 5LIRA 3AEKB 3KS9A 3OE7D 4IIJF 4N5HX 1OXXK 2IXBA 2BFBB 4L5AA 4I5FA 3H4TA 3GQBB 5AKIA 1Q2XA 3GVCA 2GA8A 3K6SA 2KI5A 4QGFA 4AMVA 2GHQA 2AOTB 5FI3A 2C7VA 4AP6A 1UBTS 1E0SA 3E03A 1IMJA 1V5VA 2V9PA 5FLYA 4HDRA 2M5SA 3JQFA 2ZYDA 3VHRA 1JJFA 4JQSA 3VH2A 3KLBA 3EZ6A 4IBOA 4CV2A 1MO6A 3HCPA 4RXMA 3R40A 2VYND 4L15A 3BXZA 5F12A 1Q3HA 3EGEA 2G8NA 5FFNA 2GREA 5U1PA 5ESDA 1PJ5A 4O4LB 1XTIA 4UTVA 4X97A 5FUWA 5A7HA 1BA3A 3BJIC 2V55B 2EFDB 3ZHSA 1KYVA 1OIXA 1ZN2A 2X77A 1X0XA 3IPYA 1YVPA 3G0DA 5KKAA 3FSEA 5IYQA 3G5UA 4PYNA 1Y3AA 2GDJA 4MQFA 3ELWA 1UBMS 5AKJA 4AURA 4HNVA 4M1KA 3E7PA 1U0TA 1R0ZA 1U7WA 2QA5A 1K7CA 1P2SA 3V55A 2DE0X 4HB2A 3X2EA 3KT8A 4UNIA 1YVUA 2XXAA 3OAAD 4HUQA 2J67A 2ZJZA 1Q83A 3K0KA 1FF9A 1R00A 5F4JA 2QRVB 4RGBA 2P1RA 5L3ZA 2AXEA 1T13A 1VBMA 5BV1A 2Z56A 5CA0F 1KFEB 3UGQA 1CK4A 1KPGA 4F4UA 2ORVA 4HYQA 5I6DA 4BAGA 1L5QA 2E21A 4NY1A 3V1LA 3R7WA 1YAHA 3ICVA 4TTSA 5KYXA 2F8MA 4C5AA 2Q6IA 1JSLA 3MJRA 5F5NA 4EL5A 4C1BA 5I7VA 1YB2A 3LY7A 2OBSA 3VDMA 1GRNA 2YUIA 1V45E 1WOPA 4CHTA 4QPZA 2FX2A 3CKMA 4Y6OA 1HL7A 4XLTA 4KDCA 3NWJA 3UT5A 4AJIA 4RTLA 1Z4NA 2X4LA 2ZBQA 2JHFA 2AH5A 3HRHA 4MW0A 2NV0A 1JPUA 5FPSA 3ZUPA 5I4IA 5DRTA 2AG6A 3O1JC 1VL2A 2ZTSA 4XRGA 3AIIA 2Z57A 1EQAA 1ZX1A 4TRJA 5AKLA 4EPXA 4U3JA 5FBKA 3RYHB 1I5EA 4E31A 3R74A 3OFJA 2HEGA 3CO0S 4DUZB 1N2JA 2REBA 5ECYA 4KFTA 5I01A 1I10A 3DXFA 3G5AA 2P2LA 1UD4A 4UFOA 4C07A 2OZPA 5CXQA 1EVQA 1XMVA 5HKKD 1CVIA 3EAFA 4M1WA 3I30X 1G3MA 3EJWA 3P9YA 3PFGA 4Y2QA 3OZGA 2OR3A 2O6HA 4BVFA 3E3MA 1W73A 4TYPA 3U49A 3A26A 3CX3A 3OP4A 5JTTA 3OQHA 4F8YA 4QQRA 4UAGA 3O03A 1W87A 1Y0RA 1ISJA 2PX2A 3EEFA 5AKEA 2XQJA 3HL0A 5TPWB 1ML3A 1FUUA 2JCXA 3K2IA 1M6WA 2OB2A 3V3KA 3VH3A 4NYJR 3LF2A 2O1SA 2WUEA 3Q88A 1E9RA 3R20A 1SOMA 4L7VA 3W90A 2G07A 4WIAA 2KX7A 2JGDA 3L0ZA 4DM3A 2BFCA 2WM2A 1KK2A 3DXYA 1H5NA 3MJFA 1LA2A 1AURA 4G6IA 3OM8A 1H2HA 2PL5A 1QTNA 4JR1A 4RTSA 3ZBQA 5JRJA 2GOYA 1NW4A 1SA0B 2QD1A 3MTAA 2AX3A 2W00A 5CK5A 2P6PA 4B9AA 4AJJA 3FTFA 1J97A 2QR3A 3IHTA 1E1LA 1PGPA 5F76A 1CY2A 3N8DA 4CTNA 4FZJA 2H4HA 4Z2YA 1E3SA 4WRRA 5JS1A 1OA1A 4OV6B 1NLMA 3K0CC 2BJWA 3R0ZA 5SV2A 3PUJA 5GPBA 4CM8B 1SKQA 5I51A 2WWHA 2HDHA 3H9UA 4X44A 3H94A 4BZXA 1JIVA 1N7GA 5DHAA 3OJOA 2QPOA 1XZCA 3DMFA 3OCCA 4FD2A 5CB8A 1NUQA 2CJPA 4Z5XA 4TQGA 4ZOLA 1VQLB 1HFKA 3BQJA 5AP9A 5GP1A 4DQKA 1JQAA 1TUEA 4M7WA 4B3FX 1KSFX 2GXQA 1SIWA 3ELUA 4IJ5A 1Y6GA 5CLLA 5EIXA 2ZS7A 1PR9A 1R0CA 3KKKA 3JD0A 4NYMR 3STXA 1ZJZA 3I9LA 2WWRA 1JXOA 3ZCPA 2PG3A 4YMSA 1SCJA 1TCVA 4KKTA 5CH8A 2O3RA 1OX6A 4QQFA 3WB1A 5FI0B 4MI6A 4RELA 3NYWA 5JJBA 1BW9A 4NCAA 1J5XA 1ZEJA 2LDBA 2Z9CA 3AB7A 3MA0A 1WSAA 3S3TA 3MB8A 4IEFB 3KOXA 4FLEA 4TS3A 1Y4DE 1LX6A 1T15A 2NSHA 2XF2A 3Q11A 2ORYA 3AJ9A 5IDYA 4DXHA 1E7SA 3P0HA 4HB0A 2C9CA 1AQIA 3WGVA 1ZMOA 3L0DA 4W7IA 2OY0A 1NPDA 3G2PA 1KZ7B 3NIGB 4H4DA 5EKDA 3HYTA 2GN4A 3BC1A 4EHJA 4QDZA 2P78A 1I3OA 2R8PA 3JZIA 3TSWA 1TKBA 2I2FA 3N0RA 2C20A 3AQ4A 3QX3A 1QKIA 2CEAA 1AO0A 3TECE 4NC9A 1KAEA 2RHRA 3LPCA 3IMFA 1FMTA 2OFFA 1RE1A 4AKHA 1A88A 3OIYA 1D6JA 3DFIA 4IO1A 3ZLVA 4DNPA 1PFGA 3DT8A 4YX9A 1LI4A 3MJCA 1FS4A 1WVIA 1CRWG 5F9HA 4OQXA 4Z4ZA 1XYYA 4Y6RA 4ZU1X 5A3RA 4L2IB 2FEPA 1EWTA 3QTBA 4Q3DA 3SU8A 5C8YA 3JALB 2BMWA 4IJMA 4RQUA 3A2KA 3S27A 2Q3LA 4CCYA 3W78A 1I01A 3MCUA 4FHZA 4L3VA 1CB0A 3QTLA 3KRTA 4MGZR 4RVUA 2V4DA 4A8HA 1QO0A 3GJYA 3WBFA 1X1BA 3HMKA 4AX8A 3CCFA 2JVIA 3LVQE 2RARA 3ZGZA 4WWVA 3HCDA 1T5HX 4RWZA 1IZ0A 1XYVA 1XF9A 4DVGA 2C2ZA 5FYDA 2YJTD 3FPJA 5DDIP 5CFNA 4RKWA 4MJ3A 1V9LA 2VRBA 1VIMA 4BLVA 2W2MA 4B87A 4UC0A 4KSBA 4EGCB 3O95A 3N2GB 4RWEA 3UUGA 3K9FC 4JLVA 4PG8A 3PXXA 4GZ6A 3ZE1B 3QFSA 1V0EA 3S7ZA 4FCVA 1G291 4M0CA 2WFZA 1CY7A 1R8JA 3TM5A 5C37A 4XLEA 1U5BA 5I8PA 4OSOA 3L6CA 3NS7A 4WH0A 1FMCA 1JFFB 4LVUA 4BO5A 1KI7A 2DU8A 4B2PA 4UUNA 4KH0A 1UINA 2C88A 3RS3A 3R3XA 1M1XB 4GL4A 1UC8A 3UK7A 3C3JA 3TRIA 1X77A 4ETIA 4K6OA 2J3KA 3WRVA 2PCLA 1Z0FA 4JVOA 2UZIR 4JI3B 1TADA 4B6RA 4MR7A 2G09A 3ANTA 3SS9X 3ITKA 1NX9A 4MDEA 3B3QA 3C8UA 3GHYA 1U2ZA 2IP1A 3OLZA 4MGHA 1QM5A 2JDID 2R00C 2I76A 1JDBB 1MC5A 3DEIA 5DNUA 1D5CA 1QB7A 2AYZA 2FN4A 3W6ZA 3CRQA 3WK6A 4AVYA 1J8VA 1T0IA 2D0OB 4DLWA 2E18A 3C3XA 1SKYB 4OG2A 5AQEA 3NTOA 1C9YA 3ILYA 1IEVA 3B1JA 4Q82A 1JHMA 5JNLA 3CYFA 3RNOA 3C6BA 3CN9A 1XIVA 3KL2A 3O8QA 4RW0A 3PC8C 4G4GA 2B8JA 4ENWA 3VAZA 1OWOA 1IHDA 1Y1SA 2QU7A 2IZ6A 2W93A 3SF8A 3SN6A 3T1TA 1PR2A 4HPXB 3TH5A 4AN0A 3UOAB 1PV1A 3PP8A 2FLKA 3EEBA 4AY4A 1F12A 1SNYA 2PZKA 1TM7E 3KTFA 1ILWA 4H1WA 5IKEA 2VHXA 1P8AA 1ZOOA 4R40A 1BRTA 4FMDF 4RGVA 1ZICA 3SZ3A 4A8PA 2J5XA 2GAAA 2ZT6A 3U4IA 5JNTA 3R76A 3T06B 4GF5A 5B53A 4FMPA 5GVSA 1KJ9A 3WYFA 2AXPA 3KXPA 2PMBA 5D87A 4X8IA 2XCLA 3UICA 4O25A 4MRAA 1AMOA 5DYGA 2OILA 3BX1A 5ALQA 1L1FA 3C3KA 1U7UA 4PS1A 1ICIA 2GA9A 3UC9A 1E5TA 1QP0A 2GBLA 3AETB 3NDRA 2P0YA 3I2GA 4LF9B 2GVNA 2QUIA 2GBPA 1K3TA 4JX8A 5JIBA 3DNFA 1W46A 3LZDA 2BM1A 1UXIA 3AKYA 3ASQA 4FILA 2HXSA 3U19A 1PKXA 3ZE9A 4K05A 2IUFA 3FIUA 3HV2A 5C8DA 2CC2A 2ZJYA 4HVAA 1C14A 1YR2A 4BNXA 4MLZA 2X0EA 1YWGO 3S4YA 1EE9A 1U0SY 2I29A 3CVJA 2CMGA 5JDCA 4BKQA 4LHEA 5AVKA 3RVDA 5HF6A 2V7WA 3HB9A 1N2OA 1VIVA 1NWCA 4YACA 4HAXA 2CF4A 1K4KA 5G3YA 3O93A 4HX2A 2W48A 4BMNA 3LQ6A 1I32A 4DV1B 3G0GA 2K7FA 1ANKA 1DQSA 2PZLA 2WU1A 1RXUA 3DTVB 2PGJA 4KV7A 4TLAA 1W34A 1T8UA 3NGMA 3Q7IA 4EVQA 3KDPA 3F9RA 1ZUNB 1BAPA 3NJ8A 3OU6A 4HH1A 3ZJVA 3K72B 3MRXA 3U7HB 4PZAA 3EWNA 1UD3A 1NJFA 4QQNA 1CZNA 2AN3A 5BXYA 4MVJG 4BEWA 3C16C 1TM3E 4E5SA 2F3RA 3OKPA 1QH1B 5TNXA 3BA1A 2QYTA 4CEHA 3QNMA 4KBGA 1NM5C 4J94A 4KXXA 2D0DA 2EQ5A 2YIDA 3VPSA 1BX1A 1ZG3A 2O5VA 3DPIA 3H6GA 4ENSA 3INRA 4YECA 2A88A 3V97A 1A8QA 2PUDA 3F5MA 4GM0A 3WICA 2X4GA 2C54A 4ANFA 3FZNA 4JHXA 2ZRNA 2GEUA 2ZSDA 1ST2A 5F64A 1QP8A 2P9EA 1Z5VA 3KVRA 1FX1A 5G4KA 1JQ3A 3B1ZA 4P38A 1A4IA 3B1YA 4ZVSA 3V7FA 2FF7A 5JDIC 2GK6A 2GPYA 1W85A 1J20A 1NE2A 2JHCA 4PW0A 5C3MA 1I1NA 4EPYA 1KPHA 1UK7A 1NRKA 4LX8A 1FMFA 3OFNA 4QT0A 3BJZA 1U0FA 1BDIA 4X94A 4RF3A 2CK3D 2FX3A 2JL1A 1GCOA 2NG1A 4JT4A 2HN9A 1GPLA 1AKUA 1H5QA 3PWKA 2QN9A 5EJEA 4UTOA 5FOUA 5KVVA 3C3CA 2R0QC 1SOVA 3C7DB 3VAYA 3PX3A 5AM2A 2DY1A 1IC6A 2AR0A 3FDIA 3H2JA 1MQ8B 3V8VA 5KWJA 3B9BA 3H65A 4PWZA 4YMHA 4RZ2A 3QHQA 3E53A 1HGXA 4XGKA 3K1JA 1BEUB 2FN8A 2PU7A 5ITSA 5CT8A 5FXMA 3D7SA 2VO1A 5T6MA 1PJ3A 4HX5A 4E6PA 4G6ZA 4HRYA 3VOAA 2B9VA 4HMPA 2Z9BA 3E5MA 1FQKA 5F52A 3EE6A 4EI8A 1FLVA 2V98A 2V7PA 3ETHA 3LE8A 1L4HA 5DCUA 5C31A 2BGWA 1NYTA 2XE4A 2YW9A 3BICA 5HF9A 3CWZA 4DIKA 3QQPA 4FMBB 1ECCA 2SICE 4JP2A 3O8LA 1LPOA 3CLRC 3AFMA 4ZVUA 1IBMB 3AL0C 4KFCA 1QV9A 4AIRA 1CLUA 1QH8B 1WNFA 3JWGA 2OCLA 5HZMA 3U4QB 5ALKA 1Z2NX 4BFCA 3R7BA 1UKBA 3K09A 2GK4A 4XKWA 2PD3A 4KEAA 4HSEA 2B2XA 2C4WA 3FXAA 1P1KA 4GI1A 2JHPA 2R6GA 3QOXA 4QSMA 3C5WP 3G02A 1Z5ZA 2QXTA 3NIBA 1M2KA 4QXOA 3BCFA 1VE1A 3D2CA 2OXFA 4M0EA 1RRGA 2EDAA 5FTNA 4D9MA 2A9KA 3JQGA 5U4QA 3WFIA 1K7XB 1NY6A 1ELOA 5TQ2A 3DT6A 1BVHA 1O3YA 1DXHA 2OXRA 4KQXA 4O4IA 4RGYA 4V2IA 3IP5A 5DT2A 1P1BA 2RGNA 2IPAB 1JP7A 2XT6A 1B8VA 1Z5WA 3GLTA 3GMTA 3ORSA 1DAKA 2FFRA 3Q15C 1UXHA 3E70C 2FGJA 1KF0A 2FWRA 2R9VA 3M82A 5B2ZA 3KTAA 2VBTA 4L02A 4HH3C 4FYIA 1GOTA 4I4CA 2Y1KA 4F46A 3LIPA 1VHEA 3A6EA 3S2EA 2ZYTX 1N4AA 1NBME 5K0FA 3GBVA 1JLKA 5KYTA 4XUGB 1B42A 1QO7A 3BFKA 5D8DA 5D3ZA 4ZO8A 3OZBA 4RTRA 4OGFA 4TMTA 2DP4E 2WUWE 1A04A 4PXAA 5TIIA 2PYIA 5BN5A 5KB3A 4C21A 2A9PA 3UQYS 1CFZA 3R0XA 2VUTA 3LX6A 4N5LA 1U2DA 4EEXA 3DBHA 2BAGA 4LECA 1F0YA 5TF0A 3KT3A 1RVDA 1V41E 2EAUA 2XB4A 1DC3A 1GQ2A 1X6VA 3KFLA 2VXCA 1E1DA 1TPYA 4IHQA 4ARBA 1AQLA 1MOPA 2GJAA 3JWHA 2WHXA 1CU1A 2X3YA 3V8EA 2PZMA 4C20A 4DAEA 4EJFA 1UPCA 5KVQA 3HABA 4XUEA 1PTKA 3BTVA 3B20A 1KEKA 4CM9A 1CJMA 3C7KA 1GKKA 2I4IA 4MVJH 3L18A 3U7EB 4TYWA 2AN4A 4GXRA 1A27A 2BGJA 2I4TA 1D5WA 4IIXA 1USUA 1W2HA 1XRLA 2CUZA 4OUKX 4EYEA 2Q5HA 2D7JA 1A9OA 1DLJA 5A7FA 4WKBA 3BD9A 2M1ZA 3K35A 4O8CA 2CCGA 1R0KA 2CGEA 3KTOA 4YRLA 4BKUA 2ECQA 5B2FA 1RLMA 4EWLA 1U9YA 2B5VA 3IJPA 1TYZA 2WHPB 4NAVA 3PGA1 1RBQA 4BU1A 1FYWA 4DIUA 3E4CA 1JFTA 1QIEA 3DPUA 2DQ4A 4B7UA 5F2EA 3WLRA 4JYZA 3PPXA 4BFYA 4CZ2A 1I6KA 4E5PA 1EWRA 4D99A 4DV5B 4HH0A 1NAHA 3FBTA 2LCQA 4DR2B 1ZR2A 1USGA 1NURA 1OWMA 4X91A 3TLAA 4A6EA 3C1UA 4D9CA 5I7OA 4TTPA 4CLXA 3OTIA 1VXRA 3QMPA 5JAZA 1LQTA 2HU2A 1ODIA 3GSIA 2N1MA 3QV1A 4FFSA 3TUIC 4YRJA 3RVKA 2RDMA 5EUMA 2QOEA 3C85A 4ZZ0A 3LS2A 1Q84A 4ZAFA 2FKNA 3SBEA 4J4TA 1TOAA 3KJHA 4O1IA 4L75A 2J0SA 1NATA 2ENWA 3FLEA 5ENVA 5JNSA 3P0JA 2ZSIA 4O8ZA 2DGDA 2YFHA 5EHGA 4A3SA 1GR0A 1VZ2A 4ZOBA 4AKSA 4Z4CA 4Q05A 5JVDF 2HMUA 3NOVA 3QU7A 1BX0A 4LOIA 3LHFA 4C01A 1VA4A 3UZUA 3K5HA 4CFYA 1FW8A 1C3LA 4LQCA 5IM4A 4R2JA 3U7QB 4M37A 4YYEA 2AZXA 5JFGA 3OC0A 4JNCA 1GEEA 3EF1A 3CPWB 3IBGA 2OTJB 3SHTA 3RSQA 1Z18A 3TKYA 3AR4A 1V2GA 1AK2A 1KU0A 1ZIOA 1GFZA 3C4VA 4IG9A 2ZTMA 4RY9A 1Y5LA 5JNRA 4DC1A 4V3BA 3QYFA 4H7PA 3WL4A 3SGLA 2B4TO 1QIGA 2YDYA 1Z9BA 3ABRB 1BTOA 2ZRLA 1J22A 3O91A 3HXLA 1YLOA 2PMEA 3A11A 4NJMA 1SPBS 1YZTA 2HA6A 3OT1B 3VGPA 3HBFA 1HT3A 1G7SA 4Z4YA 1QDLB 1Y89A 2JJ2D 2ZQZA 1U0LA 1ZGAA 2R8EA 4IDOA 4RLQA 1JDSA 1IY8A 4UNRA 3HO6A 3CMCO 3ENWA 3PFFA 3CVWA 5LQDA 4KX5A 5BN4B 3ZPXA 4I50A 1FW6A 3B5EA 3NM4A 2DKNA 2ZSAA 4DLVA 2VZ0A 4GE0A 5ALHA 1NDHA 1IIBA 2ZJ0A 3DBRA 1GZ7A 3OEWA 3IDFA 1GFSA 4H27A 2H0RA 2Y0DA 3JSAA 2OBYA 2M98A 2V3CC 3B1KA 3YASA 2VDLB 3O75A 1JJ2B 4Q48A 4BE7B 2CW5A 4GNRA 1JEOA 3PDWA 4U0KA 3R5SA 4X92A 2UXBB 1Y8RB 4KODA 4DUPA 5AW0A 4OQMA 4RPKA 2VPQA 4R8MA 4ZPXA 4AU1A 2G9VA 2WW8A 3QA9A 2UUAB 3O9ZA 3A9VA 4BNYA 1DAOA 1XVTA 2M6SA 2EJTA 3N6VA 1REQA 4AO6A 4I3FA 2WG0A 1PR1A 3U80A 2MSDB 1W2BB 5B7QA 1CIPA 3HB4X 1UAAA 4ROSA 1RJ9B 3KSDO 4C6TA 4AMBA 5ALLA 1W88A 4MKZA 1M8PA 1XTPA 2A84A 1Y37A 4OXIA 4X1YB 4QZVA 2FU5C 3A31A 4RVNA 3MUFA 4V0OA 4W7SA 2GD0A 1KMHB 2WF8A 3C43A 4PZ0A 3H3JA 2BMFA