2QN6A

Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the gtp and the gdp states
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
414
structure length
393
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
molecule tags Translation
source organism Sulfolobus solfataricus
publication title Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states.
pubmed doi rcsb
total genus 103
structure length 393
sequence length 414
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qn6A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qn6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qn6A01
4Q4AA 2YWGA 3W5HA 3NBXX 2G3YA 4I99A 2ZRMA 3A8TA 1Z0DA 2GBLA 1GNPA 5L3QB 1E6CA 1NG9A 3DL0A 1N6LA 1SGWA 1XEXB 3RLFA 3PJRA 1KDTA 5JI2E 2O8EA 4UNPA 5CLLA 4IOKA 4FWTA 5LBIA 1MT0A 3O8RA 4BLRA 2QTHA 1U0JA 2R62A 4GOJA 4NU0A 3UMFA 4ACAA 4F4JA 3CNNA 3H2YA 2AKYA 3RS5A 2DFNA 1SVKA 2P65A 2V1XA 4QG7A 1F2TA 1GILA 5J4VA 4Q1FA 5J5CA 3OHMA 3W5JA 4MGKR 2NO1A 1G8FA 4QNMA 3AEZA 4TTQA 1WDTA 4CVNA 4GSYA 4KFRA 4XIGS 4G5OA 2FH5B 3QVUA 2ZRDA 5JJKA 2VF8A 4GP6A 4Q5IA 1W7AA 2FNAA 1EG7A 4Q18A 1AMOA 5DI9A 3LD9A 5AWFC 2CJWB 2W0MA 2CLCX 5BYKA 2DWOA 2F43A 5BN4A 5AJZA 1TVCA 4Z8YA 4PSKA 2NGRA 2X2FA 3AP3A 4DHEA 3P20A 3W8NA 4MA4A 4EPTA 4Q02A 4QGGA 2Q21A 5F9HA 4OQLA 3L0SA 1QGYA 1RJ9A 2GNOA 1F20A 2V4ZA 4IHQA 2IWHA 1Z2CA 3AVVA 5H8WA 4KJZA 3AKEA 2OM2A 1YR9A 3FB4A 5FUWA 4C0AC 1MKYA 4O2RA 4HATA 1WCV1 5TVKA 1XU4A 2OILA 4DLUA 3RDPA 4A82A 2G0TA 4EIWA 2O5VA 2PH1A 1T3LA 1N2CE 2BMEA 2QM7A 1HA3A 2XX3A 3WYAA 3RANA 3WYGA 2OO7A 4ZGQB 2VHQA 3C4JA 3C5HA 4MRVA 4BLSA 2FOLA 4PANA 3AVTA 2G9NA 3RS3A 2EVWX 2ZE7A 4D2IA 1VQNB 1OSNA 2WJVA 2JLVA 4EH1A 2GA8A 3K0AA 1QVAA 1NF3A 3BERA 3ICQB 4D4KA 1HT1E 3L43A 4Q1AA 5EZ5A 4A8JA 4URVR 1KI2A 4LHVA 1B23P 2FFBA 3CCRB 1TADA 3PVSA 3ADBA 3F0TA 4QKQA 4KU4A 3UG7A 2ZI5A 3IKJA 4OK6A 4TTRA 4ESHA 3R8CA 4B3BA 2AN9A 2V55B 4HSEA 1JXMA 3CRZA 2GKSA 1KMHB 3HJNA 1VYUA 1OB2A 1D1NA 4A6XA 2ERYA 4RD2A 4DUGA 1JJVA 2FA9A 1DDIA 3NH9A 2JLWA 4ACBA 4X8OA 5HCIA 1ZD1A 2QEXB 4Q01A 5AUOB 2D2EA 3Q3JB 2ZR0A 1K73D 1LF0A 4NKRA 3R9IA 2C96A 1Q82D 2W83A 4Y9UA 2AXNA 1Y63A 4L15A 4QOSA 2OFWA 3TAHA 1HURA 1W34A 1XZQA 4D26A 1CNEA 2V8OA 1KO8A 1UJ2A 2ODEA 2VSFA 4Q00A 4JIMA 2JLXA 4FCTA 2IYYA 2NZJA 2RGNA 1Q1EA 2ZE5A 3SHWA 3TJZA 3QXCA 2OCAA 2EIXA 3LVQE 5KHOC 1LY1A 3RS0A 1DAKA 1KO5A 3ETLA 1FRNA 1K5DA 1TUIA 4F38A 3U2QA 4NP6A 2OE2A 5C18A 3CC2B 4UKDA 1G19A 3D8BA 1QHXA 4HEJA 4YDHB 3KDSE 4M8NE 4BFSA 2A30A 5KDLA 4M22A 1FP6A 5JHHB 5CYPA 1W46A 2ZU6A 1ZIOA 1C4OA 2G1KA 2PMKA 4NDZA 4WW0A 4Q9HA 3KJGA 3QXSA 3WNBA 4LBZA 3EZFA 1F6BA 1NG1A 1A4RA 2MSDB 3CC4B 2JCSA 3AP1A 1PZNA 2ZROA 1SZPA 4DCTA 2QMHA 3EW9A 2NO6A 3SS8A 4MKFA 2BSAA 3BH0A 3W8RA 3THYB 2J0UB 2PJRA 1UEJA 3QXHA 2WBLC 1JA1A 3CCVB 2FGKA 3I4LA 3I1FA 3THWB 3MCAA 3CZQA 4Q48A 3MJHA 1DADA 4R98A 2DYKA 3B60A 2QSYA 1SVMA 1EP3B 4C2UA 3DDCA 2A5JA 3Q5EA 4Q4LA 5FPYA 1JB1A 3B1ZA 2WAYA 4JVSB 3OEHD 4FXPA 4KHZA 1G7CA 3AGQA 3U6KA 2QP4A 2YYZA 3U7EB 2Q9BA 1SKYE 4OK5A 1S96A 1DS6A 5EUQB 3A58B 5FOSA 2J0VA 1R8SA 2X77A 4Y0VA 4PAQA 2GEDA 1RYHA 3IQWA 5B2ZA 4LBWA 3QBVA 5L3SA 1A2BA 5DYIA 2WICA 1JI0A 1Q3HA 4NCIA 4Q9KA 4DCVA 4OHYA 4PPQA 4JJZA 5HKKA 1C9KA 3CCSB 2QI9C 1P75A 3K0FA 1CQXA 3T5GA 3GFPA 4DLSA 1NMZA 5BWMA 3CKLA 3QKRB 4MDEA 3A6PC 5FOWA 5JHGB 5DO9A 1BMFD 3EA5A 5L3SB 4P0TA 1E9BA 1P4SA 2CXXA 3EZ7A 3RS4A 3PENA 3IIMA 3CCUB 3K09A 1G3QA 5FR1A 5B57C 5DNYB 1WBDA 1AN0A 4NL4H 3I8XA 1RPZA 4NCNA 2E9SA 1CRQA 3THOA 1P6XA 2HYDA 2R6FA 1WRBA 1D2NA 3K70D 3I61A 4RD3A 5D3MB 2IYWA 4I1UA 5DH9A 3T1VA 3KL4A 4ARZA 4LJ9A 5TMPA 4C7OA 2GK6A 4CEJB 2QPOA 3A4MA 2A9KA 1Z6YA 3OEEA 2H17A 5CLQA 4D0GA 4TZ0A 3MAAC 1GKUB 1XPRA 3B5JA 2ZR9A 4ASUD 4JZKA 2BMJA 2BM0A 1KZGB 2GF9A 2J9RA 2ZJ8A 2ZJ5A 4GOXA 2OT3B 1Z3IX 3K8YA 4KAXA 4K1XA 1VG1A 2ZYWX 4JVLA 4F92B 3OEHA 1EWYA 2BBOA 1FUKA 3BBPA 3A37A 1FMJA 3LVRE 1E2GA 5FTKA 3QQ5A 5EXSA 4IVPA 4AWXA 1LFDB 1ZC4A 1SXJB 1GAWA 2YWFA 5J4HA 1KIMA 3OW2B 5HZKA 3AKCA 3U3RA 1DDGA 4CDGA 1GFIA 5JLJA 4PO8A 4PQYA 4CT5A 4G3XA 1WXQA 4G1VA 1BQEA 4EKDA 1N8RD 4DLTA 1M7GA 4A15A 4HLUC 2BMWA 2VRWA 4Y7CA 1R5NA 2Z43A 1KI4A 4LSGA 1W0JA 3B8HA 1TU4A 2F3TA 3P1JA 1XMJA 3ADDA 3C16C 1VCOA 4JLPA 2F9MA 1YRAA 4UAJA 3BOSA 3QF4B 1Z63A 1PLKA 1COWA 4IJMA 1E9EA 3MD0A 1XJ0A 3MLEA 5FPTA 4IEIA 2VNJA 1CJMA 2DCUA 3SJCA 1Z5ZA 5F98A 2XGJA 4LJ4A 5J4YA 1US8B 2ZRJA 2YKGA 1W36D 2QGNA 1M1YE 2QTZA 2AK2A 2H5EA 4PO9A 2RB4A 1NVWQ 2VTKA 2BCJQ 4FCVA 3LW8A 4IKEA 4IVRA 1CULC 3AUYA 4XTCS 2HF9A 3W3AA 4D0NA 2RHMA 1HQYE 2H57A 1HE1C 4WIAA 2FWRA 4BLPA 4XTRA 4YHBA 2JLYA 2IT1A 3LY5A 1RRFA 2C98A 2W6JD 2C03A 3K0CC 1V5WA 1JR3A 2J59A 3R9XA 2ZRIA 1T9HA 1UMKA 4FMCB 1XB2A 1YZGA 4WAUA 1E0AA 3Q5DA 1XTJA 1SXJD 2A3RA 3RC3A 4TMXA 2HEIA 4PHTA 4GT1A 2JJ1A 2HYIC 4B4DA 3IILA 4N0EA 1Q1ZA 1TMKA 1AKEA 2BV3A 1YRBA 2ZRNA 1J90A 3REGA 2DFKB 2P5SA 1N0VC 2YWEA 1OFIA 5GJCA 4BEJA 1E9FA 3ZVNA 1N5KA 5EUMA 1II8B 2WMNB 1OB5A 4G5GA 4B2PA 5IK2D 1R7RA 1NSFA 3MWYW 4OJQA 1P62B 2YC4C 4ZDWA 4TYPA 1IN5A 2X1VA 4A0RA 3GJ3A 1Q3TA 3JQRA 4H1VA 1WQ1R 3U44B 2IBMA 3SDZA 5A0FA 3T35A 3OE7A 3EWSA 1W36C 3BWDD 4BQSA 5FOVA 3W6NA 1DAIA 2WAXA 2NQ2C 1SVSA 1BJKA 2ZS7A 4HZIA 1W36B 1AIPA 1TQDA 2ZI9A 3DVLA 4MQBA 5C4MA 1KO4A 2VHCA 3TH5A 1VQ9B 3R9WA 2VP6A 3L2OB 1IB0A 1KKMA 4DQKA 3JQQA 1GTVA 1TX4B 4F4IA 4JBYA 4A2QA 4BZQA 1GIAA 1XF9A 3IDQA 5DYGA 1BH2A 1DVRA 1H8HD 5CIQA 1FTSA 3AKYA 5K8UA 1ESMA 3U7FB 1KOFA 3S1AA 4U7DA 1MO4A 4LHZA 2PZEA 3G0HA 3ND8A 3VNVA 5F9FA 3VMFA 3CC7B 4PR0A 4HE6A 5AR1A 2PLFA 3BFXA 1EESA 4RCYA 3AVPA 2R6CA 2QE7D 5AJWA 2REXB 3QFSA 1AKYA 2CEAA 4LJ8A 3TMKA 3AVOA 3BFKA 3GP8A 4LC0A 4FMBB 2HDNB 1XD2B 2REBA 3ES9A 4M1SA 1E3MA 3BH6A 3FMFA 5DHFA 2XTMA 1YZQA 3A1VA 1U8ZA 1OIWA 2YOGA 1IY1A 5JCPA 3THWA 1A5TA 1HY3A 4OL0A 1VIAA 3VR1A 4KFTA 4PFSA 121PA 4LDJA 1PV4A 2AX4A 1Q20A 4Z54A 2GXAA 1R0XA 2Z5FA 5E7IA 1VQLB 2AFIE 1E96A 1KDRA 4A4DA 2ZETA 2BBSA 2QTVB 3WMGA 1CXZA 3CRMA 2A78A 4TLCA 5JJIA 1Z08A 1OE0A 4P4SB 4Q47A 2BDTA 4URUR 4MUBA 1VECA 1IONA 3W34A 4FMDB 2JDIA 3VO2A 3LO8A 2PZFA 1COWD 2ZIAA 4YMUA 4JKIA 4URZR 3EAQA 1E2JA 2W00A 2Z4RA 4NH0A 4FCWA 3SN6A 4OHZA 4AYTA 4B3FX 3RAPR 2P3SA 1DO0A 2HXSA 2E87A 4A92A 4J0QA 3U3MA 2XSZD 3ASYA 5TY0A 4BEBA 3T12A 1HE8B 1RKBA 3B85A 4PPFA 2WKQA 3RC8A 3R7WA 2IS4A 2PT7A 4XD7A 4D81A 1TF7A 4LZZA 5CK5A 4TYWA 4P33A 2C9CA 4PAMA 3RS7A 4ITRC 1E9AA 3F3YA 2JLSA 1NVVR 4NYMQ 4RD0A 2YNMA 4TN1A 3CCJB 2O8BB 2GAOA 2QMUA 2QTLA 3LXRA 4AD8A 1ZW6A 3I5YA 1AZSC 1WMSA 1KK2A 2QN6A 2CK3D 1QRAA 2UZ3A 4R9UC 2ZSAA 2CCJA 3FTQA 2CMKA 3Q7PA 5TB5A 1Q22A 1ODFA 1EXMA 1L4UA 1LS1A 1T8UA 1UBEA 4HB2A 4V0NA 4ASUA 2IF0A 5HE9A 1IJEA 1UBFA 4M9XA 3ZC3A 1KI9A 3OEED 1XPUA 2WTUA 1OHHD 5KSPA 4II7A 4L4UA 1G7SA 2J1LA 2ZYVX 4FN5A 4JL6A 4JLBA 1FX0A 4W7SA 3AVUA 1NVVQ 4XSGA 1UBCA 5FBLB 1Z6TA 2OUKA 1EFTA 2ZJAA 3H1TA 1NN3A 5B30A 2W0SA 4KI0A 1NKTA 1OH7A 4M1YA 2EWWA 1H8EA 2EYQA 2CNWA 2D2FA 2PCJA 2WWHA 3SOPA 5SZKB 3K1JA 1QUFA 4TTPA 4CIDA 2A2ZA 3EPLA 2OAP1 4ZCIA 3RYTC 1IXZA 1FNBA 1XCGB 2WWXA 1W0JD 3HU3A 2PBRA 1RFLA 2CNWD 2WPDA 1ETUA 4PC2A 2YZ2A 2HXYA 1GAQA 5CIWA 2QAGC 1MO5A 1AZTA 1XZPA 4OHXA 4UJ5A 4M9QA 3SZRA 1G64A 1C1YA 2TMKA 3SC3A 2NMVA 4D82A 2GJAA 1L8QA 3AVYA 3P32A 1NJGA 4IOMA 4QM7A 1CRPA 3ICEA 3SQXA 2WSMA 3PCRB 3EPKA 3WY9A 1CR0A 5FPHA 2Q6TA 3FWYA 5AK0A 3GLFB 2ZE6A 1UPTA 5GV8A 4A36A 1E1QD 1WE2A 2ZUCA 1BX0A 1Z0AA 3THXB 1M1KD 3K9GA 2CK3A 3K9LA 3CX6A 3MUFA 1KQSB 1UDXA 2BMDA 3OFNA 1EFHA 1U8YA 1Q57A 1OXVA 2O0HA 2WWIA 3P4YA 1JEEA 2X2EA 3GLFE 4MRRA 1NRJB 1NDHA 3NIBA 3TNFA 3T06B 4OKSA 2Q3HA 5F3WB 1E2NA 1G8HA 2ZR7A 1W5TA 3QFTA 2HMAA 3EZ2A 4B73A 2FEMA 3Q8XB 2GWHA 2HLDD 5DI3B 3KQKA 3BJIC 3RABA 3CWQA 4LK2A 2Q3MA 5HZHA 5KUTA 1P7CA 2HJGA 521PA 1MO6A 2AL7A 2ATXA 3GD7A 4M4SA 2ONKA 4Z8XA 4CEIA 3DM5A 4FI3C 3CXCB 1M34E 1T8TA 4KXFB 2P67A 1NIJA 2WJYA 1KY2A 2GBLC 2QP3A 1T3HA 4JLVA 1DEKA 2O52A 4RKEA 1ZM2A 1KO1A 4DLVA 1TEXA 4N3GA 1D5CA 3B1WA 4KYIB 4UXJA 1BO6A 1MV5A 4HZUA 1QBKC 3K70C 2JDID 1N5IA 3KB2A 1KJZA 1I4LD 3IEUA 2VBCA 3AF0A 2ERXA 4V0ME 3U4QA 1Z0IA 2R2AA 1CLUA 1YR6A 3W6OA 1DAMA 4BFWA 4N1AA 3MJRA 3NBFA 4R2IA 2YHSA 5FOTA 3U60B 5GJBA 2NO0A 4TMVA 5CDFE 3WMFA 5JS7A 2KB0A 1HEIA 2CBZA 2FSGA 1GZSA 3NH6A 1Q1BA 3TW8B 4BZXA 2W6IA 5IHPA 1CP2A 4GDFA 2RKOA 3DZDA 5TARA 4QBHA 3QKSB 5JBQA 2D74A 3EIEA 4ILEA 1SVLA 3TGPA 2QL6A 2VSOA 4JJKA 3QKSA 1VQ6B 1B2RA 4LYFA 1ZM9A 1IM2A 3QF7A 2ZQ5A 4L16A 2IS6A 3AQ4A 1MRSA 1TNDA 3KKPA 5EMNA 2HUPA 2PT5A 3MG9A 4C4PA 1GNRA 2ODNA 4PHHA 3SYKA 3ZH9B 4P3YA 1OFTA 1YZUA 1NY5A 1RYFA 4XD7D 2A7QA 3WHKA 4C0KA 3X1ZA 1EGAA 2QROA 1A7JA 2WOJA 2ZRLA 4DDUA 2ECKA 3WXMA 1NMYA 3ZLJA 3EG5A 2FPKA 3P26A 3PV0A 3EA0A 5AUQA 1KZ7B 4TYYA 1VQOB 5AUPB 5EP2A 2ZPTX 2VO1A 1JB9A 2HJVA 4KVGA 4HLDA 4PXAA 4BASA 4AKGA 1D6JA 1OV4A 1VQ5B 4Q9IA 1VKJA 4LYJA 2A5GA 3KJHA 4X8LA 5DLQC 1JR3E 1OGJA 1F5NA 2GJ8A 3KKMA 1VCNA 4TMZA 1S2MA 4QHSA 2GILA 3EZ6A 4LX0A 2DETA 2OTJB 1GRNA 4M1TA 1BYUA 2YOFA 3PUZA 4NCHA 4Q66C 2AD5A 4OI4A 5DN6A 1I4TD 5TDHA 1T91A 3K0SA 3UATA 2QA5A 2QT0A 3GJ8A 1E2MA 1NBMA 4DIEA 3QFRA 4HZUB 3WRXC 5JMTA 1TL7C 5JWOA 1FP7A 1DAEA 3QF4A 4PX9A 1P9NA 2FPLA 3CPWB 4B48A 3MFYA 4AG6A 4B3XA 3O8CA 5CK4A 2OAQ1 4US0R 1KTVA 4FMCF 1ZNXA 2EFEB 1XD8A 4LPSA 2DWPA 1G3IA 1GRRA 4ERNA 5KU1A 3OESA 2E1RA 1NN5A 2LCFA 4QRHA 1OIXA 2RCNA 4K8OA 4YAOA 4ZV4A 2BC9A 5EE3A 2ZXUA 2AHOA 3LVBA 4I1VA 1XNJA 5HTKA 1Z6XA 2EFCB 4U9UA 3FPKA 5FL7D 4DCNA 4XOIA 4HUQA 4JSTA 4V0LA 4BLTA 3KJIA 4PC7A 3CMAB 3VKHA 2RGAA 1QFYA 3JVUA 5F2EA 1D2EA 2VP5A 3GJ5A 2J0SA 4EPVA 4HAZA 2R65A 3U7HB 2YWHA 1H8HA 4CEHA 2QM8A 2GXUA 3K9NA 3A1SA 1FUUA 3LH5A 5EXPA 5LD2B 3AGPA 2EFHB 4TT3D 1P5ZB 4ZCMA 1Q21A 2NO9A 1EFRD 4D4LA 4LC1A 3H84A 1D9XA 1J99A 1NBMD 1UBGA 2XTNA 3ECCA 3O8DA 4ARZB 1E2DA 1EX6A 1GL9B 3D7MA 3KKQA 1OKKA 5D3MA 3OAAD 4MGZR 1NMXA 3K0CA 1H8ED 3FKSA 5JRJA 2O8DA 1P2VA 3V4RA 3W5UA 4TMTA 4YAUA 1SM4A 3CBQA 3NBZC 2AWNA 2WIBA 1E2EA 4QC2A 1YU9A 2WJGA 2ZRHA 4ZDKA 4LRWA 3CRRA 3T15A 5CJPA 3D6TB 4FWIB 1AJEA 1AK2A 3CNOA 4B6FA 1ZU4A 3UIEA 2ZRCA 1BKDR 5JCZA 2N1BA 5JEDA 1GUAA 4MKGA 3QKRA 3PUYA 1IXRC 1E4YA 3TVDA 4TYQA 3ZD7A 4HAWA 5BYJA 1X1SA 1VMAA 4GOKA 3RRMA 5CITA 1R4AA 1E9RA 3KXKA 1G5RA 4LHYA 1SQ5A 5LB2A 2QENA 4AK9A 1II9A 4OYHA 5CYOA 4P4UA 4W5HA 5ANRB 2Z4SA 3CNLA 4CYMA 3F8TA 1DAGA 3KTAA 3PIRA 1ZM3A 1KI7A 2ZSEA 4OHWA 4RJLA 3U6BA 1ZU5A 1FOEB 3VQTA 1U0LA 2ZVQX 1CJUC 2B5OA 2FZ4A 2GJKA 2J87A 2FX3A 2W6ID 3IUYA 2CRVA 3Q9LA 2R6DA 2VHJA 3JVVA 3QG5A 4JVNA 4L5BA 4JVMA 2IYTA 4F7DA 1NN1A 5J40A 2WWGA 3NBYC 1KK3A 2PIAA 3VX4A 1U8AA 3CIOA 2RGDA 4A0HA 5DE3A 2ZVPX 5H5JA 3O47A 4KO8A 2GCOB 4DLZA 2P6NA 4G1UC 2VP2A 4PAOA 1M7HA 5C46F 2QT1A 1W35A 4V0MA 3LA6A 1ESNA 1CR2A 1GAJA 3L0IB 4OQXA 1P72A 2VP0A 1I7PA 1NI3A 1PLJA 3PEVA 2OCPA 2PEYA 1DO2A 4AG5A 1A2KC 4JLKA 3FKSD 3W90A 1B0UA 1AA9A 1FX0B 1Z6AA 4WZ6A 4PC6A 1U98A 4MYTA 2RGEA 3GLGA 5EJEA 1VPLA 5GVSA 3I73A 1OYYA 4QHTA 4DT1A 2DWQA 1U90A 2K5UA 4LYAA 4MYUA 2OBLA 3RS2A 3LO5A 2ASEA 2DERA 4C0JA 2F3RA 1DG1G 3RWMB 4M1WA 1AQYA 1YZKA 2UVQA 2EU8A 2Q9CA 1E62A 2Q9AA 3TQCA 1M90D 1T5IA 4I81A 4PC1A 4HUTA 1OXXK 4BRWA 1IXSB 3SBEA 2C95A 1ZCAA 3NG1A 2B7CA 1GVNB 3BB1A 5JJLA 5FH9A 1VIYA 2JIZA 3KZ1E 3U3OA 821PA 4QBIA 2CCKA 2JAQA 4ZKEA 3MWLA 1CTQA 3DHWC 4JMPA 1VCMA 4IW3B 1QHHA 1XMIA 4L9WA 4Z1MA 1V43A 2JASA 4WOPA 4PTLA 2NZ8A 4LPKA 1N6RA 1G5TA 1XD2A 4B3CA 4BLQA 3VTKA 2JIZD 1CBUA 1CKEA 4U02A 2ZJBA 1ZM4A 2QZ4A 1XX6A 2FSIA 4OHVA 3EWAA 5AJXA 4NBSA 2GZAA 1EWQA 4TZ6A 5KNDA 2WOOA 4JLMA 3L0OA 3I56B 3WP0A 2H16A 1TTTA 1XWIA 2JJ2D 3QEOA 1DAFA 3JZAA 2H1LA 5L3QA 1RRGA 3BIFA 4FK8A 4MRPA 4BFZA 3CCMB 1HUQA 4TQ9A 3EPHA 1TPZA 2KBFA 2D62A 2IUTA 4QM6A 3JQPA 4L8GA 2NPFA 2JA1A 1W49A 2GZHA 3FGNA 4DT1B 2MSCB 5K8LA 1W87A 2RGGA 4LJ5A 2FFAA 3Q7QA 1G8PA 3VR6A 1E2LA 2AK3A 4B74A 2VF7A 4OBEA 1NVUQ 3L0PA 3SNHA 3QI2A 2BHRA 2WKPA 1S72B 4OQNA 4WZAE 3KQHA 3CR7A 3W2EA 1II8A 1XXHE 1KI6B 4QJ4A 4TL6A 1S1MA 5EQTA 4DLYA 2N46A 4AI6A 2R9VA 3QIAA 1KK0A 3RWOA 4EJSA 3PG5A 3QPUA 4Q7MB 2VQSA 3AVQA 1U81A 2ORVA 2B6HA 1HYQA 2QORA 2ZRKA 1E2QA 2GPJA 1G16A 3UWOA 1FZQA 1G20E 1VYTA 2KWIA 5L3RA 1XPOA 5HE8A 2CVHA 4KVAA 1SHKA 1CNFA 4TL8A 1IHUA 2OSBA 3S1AB 1G291 1DARA 2G1JA 3X2SA 5C4GB 3ONWA 2P6RA 2C78A 2A5DA 1GKYA 1G1MA 4Z1MD 2JLRA 2P2LA 2OHFA 4DJTA 2F7SA 4EJSC 3CX8A 3NDBB 4NYMR 1AQUA 1BX1A 2OEPA 3QUSA 2G77B 2VEDA 4HYYA 2W2VA 1KK1A 3I32A 2IYZA 2A5YB 4GP7A 3RVBA 1N3BA 4FW9A 4BFXA 4EQ6A 2WWYA 2IYUA 4KSCA 4Z51A 5BN5A 4BGDA 3TSWA 4TMKA 4RFSA 4BFTA 4ZI2A 4DQLA 4XVQA 2PCLA 4BZPA 1UADA 2BJVA 1Z0FA 3LBIA 2RC6A 4D4JA 4HI0E 1N6NA 2PZGA 5EE5B 1E2PA 4YC7A 1JAHA 2WSSA 3E70C 2R6GA 1GDDA 1XCMA 1S3GA 1YZTA 4YMSA 4DLXA 1IOZA 1KNXA 2J7PD 3TE6A 3QKTA 1ZBDA 4FMDF 4C0HA 5E7JA 1R0ZA 3BS4A 3DM9B 1IN8A 1BMFA 1TAGA 2KJQA 2HCJB 1Z47A 2CE7A 3C5CA 1VQPB 2JLUA 1US8A 4NHOA 1OH6A 3AVXA 1FFHA 1KD1D 2VSXA 2JJ2A 2Q3FA 2WWFA 3V76A 4Q4AB 4IXMA 3PFIA 1RRPA 4Q9LA 3LLMA 3FKQA 1Z83A 4M1OA 2P5TB 1XTSA 3QEJA 5LB4A 1VDZA 2CL0X 3M0EA 3ZZTA 3DZ8A 5DGXA 3SBDA 3T34A 5JSZB 2BF4A 1J9ZA 1X8KA 1FQJA 4UJ3A 2B8WA 4EFMA 1E9DA 1T0JB 1H85A 1YHQB 4LHWA 2BMFA 1CR1A 5FTNA 3V9PA 1E79D 3FPAA 1KAGA 5G41A 2O8FA 2AFHE 1PVOA 3UMRA 3GPLA 4IEEA 1CS4C 5JS8A 5CM8B 5E7MA 1IAQA 3SQWA 2QG6A 3P27A 2J46A 1ZRHA 4DCUA 4ZDJA 2FF7A 5FOXA 5B64A 1OH8A 4C9BA 2FDCA 3IQXA 2D7DA 2D06A 1SXJA 3KKNA 4CZ2A 2PL3A 4M1KA 3SHFA 1TQ2A 1VG8A 3IO5A 1AS3A 2C9OA 1GITA 4C2TA 4Q1DA 4US2R 4P6VF 3OJXA 5FI1B 3W2HA 3A36A 5K8IA 1Q81D 3MWKA 1NLZA 2XEXA 1IY0A 3FVQA 2VHUA 4GI7A 2C04A 3IO3A 4LY6A 4YMWA 2CL6X 2OXRA 2QBYA 1Q0UA 2DB3A 3SEAA 4B44A 2V7QD 4DCSA 1QFZA 4PZZA 1QVGB 2YV5A 4B3DA 1NN0A 4JLAA 2IC5A 3TVTA 2QTFA 4PPNA 1D8TA 2IEZA 3M4YA 3VU9A 4XVRA 2ZANA 3DOEA 3GQBA 4DC9A 2ZAMA 4PQRA 4QL3A 2ZS8A 3P4XA 3VHLB 3K0FB 2XNDA 3BORA 3NC0C 4ABYA 5B58C 3B1XA 1GR1A 2I1QA 3B78A 3AF2A 1QG0A 1KSHA 1XE1A 2EW1A 2P0EA 3BE4A 4KBGA 4LV6A 4DSTA 1G5PA 3CPHA 4ZCLA 1QHIA 4B76A 1A1VA 1N5LA 2UKDA 3K53A 3QENA 4GRAA 5CB6A 4TLBA 1GKIA 3LX8A 5EE1A 1WB9A 3FJOA 3LLUA 2G83A 2QAGB 2QY9A 3EIHA 4BFUA 3GFOA 1SKQA 1PJRA 2IUUA 3D3QA 1ZUNB 3NHAA 4NYJQ 3IIJA 3L82B 1OJLA 4IOLA 4EQ6B 5JRZA 1NBME 4W5JA 4D4MA 5CB8A 1XJCA 3J81k 5H70A 3OZXA 3CPEA 4UXIA 3VR3A 2FV8A 3GJXC 2BOVA 3U5ZB 1KDOA 4M1MA 4E07A 2GEVA 5H1YA 4DUGD 2QE7A 4EAQA 1QVRA 2IYXA 2WWWA 1NY6A 1TEVA 4BWYA 2XXAB 3KXIA 1GM5A 3KJEA 4LUCA 1E0KA 2NOAA 5TV2A 3CMEB 2IYQA 4Y9RA 1UKVY 3QPWA 5KTYA 4GFDA 5IT5A 2XXAA 1NL3A 3IHWA 4D80A 2ANCA 2SHKA 1QH0A 1CEEA 5K8TA 3N2IA 1OF1A 1QZXA 3CCLB 1YJ9B 2OV2A 3ZJYA 5LD2C 2RH5A 1RW4A 2VLIA 5FR2A 3IEVA 4JT4A 1AS2A 1E2FA 3HYRA 2GAAA 4B3GA 3ZD6A 2IXEA 1GNQA 1FNDA 4XJXA 1JECA 3GLHB 2R6HA 2BWJA 3UWKA 1P61B 5J47A 4B43A 1MOZA 4M21A 5E3HA 2OESA 3OAAA 2W2XA 5J4KA 2QSZA 1K5GA 2WM9B 3NEJA 4OQMA 2FPMA 2GK7A 1KJWA 5FPSA 1MO3A 3AF3A 2PEZA 2RGNC 4M9ZA 1EFRA 1IN7A 2D3WA 4TT3A 2V7QA 3A4NA 1KDPA 1G7RA 1ZNWA 4BUJA 4YXWD 3T1QA 4URWR 3IIKA 4JSYA 4CEIB 1IQPA 1ZD8A 4IVQA 2ZSFA 1TU3A 4N3NA 1Z0KA 3BC1A 1NNEA 2HLDA 4DSUA 5IK2A 1LB1B 1KC8D 5FBRB 2O8BA 4E22A 3REFA 1Q44A 4YMVA 1YE8A 2AR7A 3AB3A 1R0WA 5FL7A 2OLKA 3FDIA 4S2EA 1IJFA 5KSYA 2H92A 2J41A 2QMEA 4O0MA 1KMHA 1VG0B 4PSVA 1K6MA 2QBYB 1OIVA 2IYVA 2HT1A 1RIFA 4XH9B 1SKYB 3L8ZA 5A5GA 4LBVA 1E79A 2H7VA 2EFGA 2X3UA 3W2FA 4AIIA 1AS0A 2JLZA 4KLNA 3ZZUA 1VHTA 4DEYA 3WBJA 1W4RA 2MMCA 1N5JA 1FTNA 2ZRGA 1OPXA 2ZTSA 2ZJZA 4QGFA 1P60A 4QNRA 1UKYA 4LHXA 3R7WB 2D7CA 4H1UA 4HB0A 3ZBUA 1VQ4B 4LWZA 2ZYUX 3U7GA 3CCEB 2WPDD 1XEWY 3DMDA 4JLNA 1E2KA 3UPUA 4LYHA 2PX3A 2OG2A 4OJKA 1KJYA 2AWOA 1YQTA 1KI1A 3GLGB 2J7PA 4DVGA 4PGOA 5GADl 5DHAA 2ZJOA 1BYIA 2WSSD 4WQMA 3V00A 4JL8A 1OW3B 4LCBA 5KNCA 1G6OA 3SU8A 3U3KA 1G18A 3RSOA 5FI0B 5EXXA 5KYKA 4XWAA 3ZIAD 3ADKA 2IXGA 1Q7YD 2OFOA 3EARA 1HH4A 4H9GA 4DWJA 1JNYA 1W4AA 4US1R 3WRYC 3GJ7A 4MYHA 3UK6A 3BFVA 4ZKDA 4BPRA 1OGIA 1F3OA 1KAOA 3U3JA 3CCQB 5EXTA 1QHGA 2I4IA 2VL7A 1IBRA 4LJAA 2C77A 3DOFA 3CRW1 5L3VA 1G3UA 3ZVLA 1RC8A 1EK0A 3DPUA 3W5VA 2WIAA 5SZHB 2BN4A 3ZBTA 1MABB 2FFQA 2FMXA 2VA8A 4Q1BA 4RFSB 4Q7JB 1DG3A 4XWKA 2FFHA 3GLIE 2X19A 2IWRA 2OCBA 3B2EA 2BGIA 4EUNA 4DDVA 4NYIQ 4C30A 3CWZA 1NKSA 1U2RA 2QEQA 5AJVB 1SVWA 1XEXA 2Z0MA 4RVCA 3RRZA 1GO2A 4QGAA 2ZITA 1AGRA 1YHNA 2ORWA 3HP1A 4IDNA 3RNLA 4I1OA 4URXR 1KI3A 4DLRA 1JJ2B 3LV8A 1G6HA 2XOKD 3Q72A 4Q4HB 5FBVB 1EFCA 3QE2A 1TF5A 5KNBA 1KGDA 4V0KA 3HPRA 5BQ5A 4DXAA 3N5CA 3U44A 3I55B 1JPNA 2ZSDA 1OXTA 1G8GA 1DELA 2GEUA 5CJ2A 2O8DB 4URYR 3OIUA 2WMOB 4WZBE 3CUEF 2J0QA 1W4CA 4HAUA 2AXPA 4GPTA 5G3ZA 1WF3A 2OXCA 1YJWB 2V9PA 2VPPA 3HU2A 1F2UB 3UMSA 2IX3A 4TQAA 2XJ9A 2D4HA 3SFZA 1W44A 1YR7A 2ZYTX 721PA 3A1WA 2HT6A 2XB4A 1LV7A 2CLDX 3CLVA 4K46A 4EPRA 1D2MA 4AY2A 2C99A 1J2JA 1OHHA 3OZVA 2RC5A 4Q4HA 1TF2A 3KQLA 3B1YA 1DAHA 2GJSA 3E1SA 4QGHA 1KKLA 2CJWA 1MH1A 4YALA 2OFXA 3KFVA 4BFVA 5KDDA 4LJYA 1XXHA 4EFLA 1GVHA 1LNZA 1E1RD 1ZIPA 2YINC 3CRQA 5UKDA 5EE9A 4X8HA 4JBXA 4G5RA 1GWNA 3TW4A 2VZLA 4R2HA 1G41A 1KI8A 3LBHA 3N2EA 3VKWA 4TSFA 3EXAA 5JFGA 3KUCA 1YITB 2J5XA 1MABA 1F2TB 2ZI4A 4XWOA 4JYCA 1DE0A 3SE0A 3FFBA 3LW7A 3BH7A 4KCGA 2ODBA 3OIVA 1XTQA 3VNUA 4P31A 2ANBA 4MKIA 1NSTA 3PUWA 2VHTA 2YVUA 2ZI3A 2IW3A 2XAUA 5DSZA 1ZD9A 3NWJA 4WXRA 2XTZA 3G6EB 2DBYA 1UDWA 4HAVA 3VU9B 2O8CB 2IS1A 3QNUA 2ZM5A 1QG2A 1UEIA 1CF4A 4RD6A 4B47A 1ZM7A 3AH8A 4ON9A 3AM1A 1P9RA 3IBYA 3OE7D 4IDHA 1SXJE 4CW7A 2V6JA 5GJVC 5HKKD 3FFAA 3SJZA 4RZ2A 221PA 2ZEJA 3NTUA 4B35A 5A4JA 4HDCA 2KSQA 5P21A 3WYFA 3NEYA 3WNDA 3F5FA 1GG2A 1KMQA 3FMIA 5EP1A 4CGZA 1VHLA 2GVDC 5C2JB 4E03A 1XRJA 4IDOA 5H59A 2OK7A 2XNSA 4TLAA 4ESVA 3ADCA 1ZVQA 2FSHA 3GLHA 1IY2A 1O87A 3QVVA 2N42A 2BM1A 4HB3A 3CZPA 3MGCA 1JR6A 2BCGY 3VR4A 5J4LA 4E09A 4AKEA 1ZYUA 2GCOA 4JYBA 3BAFA 1RE0A 3QG1A 1T0HB 2CL7X 5JWHA 2PLRA 1H65A 1OYWA 1XTIA 2FG5A 3MRSA 4K81B 1YVDA 4Q7LA 4QBFA 4Q7KA 3RSLA 1JR3D 1G4AE 1ZUHA 1DPFA 1K8AD 3CH5A 4TSFD 2F6RA 1J70A 2DFLA 3ASZA 1G17A 4M0LA 1ZINA 4ZIRA 3HYTA 4W9MC 1R2QA 3UANA 3GLIB 1DTSA 3OZUA 3W9YA 3TIFA 2ZUDA 4RFVA 1GP2A 4DDWA 1E1RA 1HT2E 2ODWA 2QMOA 5KSWB 1SHZA 3N70A 4C7OB 2ZRFA 3EC1A 4PQFA 4NYJR 3FHOA 3TUJC 3QPVA 4G0NA 1VQ8B 4EFNA 1DOAA 1G21E 3LAWA 2OBMA 2GXSA 1Z8FA 4RKFA 1U94A 5FUVA 1S0UA 2OK8A 5KPJA 3GMTA 1S4QA 1OKKD 4IFBA 2QAGA 4IFEA 2WJHA 3AF4A 2QAJA 1P9WA 3LRPA 4OI1A 3B82A 4AF6A 1KRHA 2B8TA 4YQFA 4QJ5A 621PA 4OI2A 3OF5A 3QE0A 1W4BA 4HE5A 4CF7A 1MR3F 4A9AA 1U0HC 2RGCA 5FFMA 3G82C 4PC3A 2XNJA 2WV9A 2VIIA 1CJVC 2W2TA 5G3YA 4F4CA 2F55A 1UAAA 2ZAOA 2NIPA 2AD1A 3SYLA 2QRNA 2GDJA 2Y8EA 2F1RA 1E63A 2VNKA 1TLLA 1IN4A 1M6NA 3CO5A 3UKDA 4LJ6A 1FRQA 2XJ4A 2XZOA 5TXGA 1XCPA 4V02A 5KDOA 3I5XA 2JJ1D 4HLCA 1QX4A 4B32A 1XD9A 5IRCD 3W2IA 3PITA 3ZS8A 2GHIA 4FINA 3WBKA 2F1HA 3GJ4A 1ONBA 1W2BB 4GMXA 1KHTA 1CJKC 2FN4A 2G88A 2F9LA 4MGYR 2WVJA 1ZCBA 5BN3A 4EPYA 1JALA 3CRVA 3B13B 2Z83A 3GEIA 5SZIA 3TR0A 1NLFA 3LNCA 1UFQA 3E1YE 3W2GA 2JEOA 2B7BA 3X1DA 1QHYA 4TYNA 3FHTA 4MRNA 4C0LA 5FTJA 3E20A 1CR4A 1XEWX 3B6EA 1QF9A 3PUXA 4OQFA 3KQUA 2W58A 2ORIA 8OHMA 4HAXA 5SZJA 2O8FB 1L2TA 3JZMA 1NIPA 4QHYA 5DN6D 3TAUA 3I72A 3C41J 1R6BX 1ZP6A 3AKDA 2IHBA 1M74A 1A82A 3EASA 3IPXA 3KX2A 2ZI7A 4GNKA 1LS6A 3EX7C 5G53C 1T3SA 3VFDA 3T1TA 4HDOB 1VQMB 2V3CC 2KBEA 2RAPA 4IXNA 3HWSA 4IDPA 1LF5A 1QFJA 2UZIR 3UG6A 2LKDA 1E98A 2QRZA 1XFAA 3NKVA 2CHVA 1X1RA 1F48A 1N6PA 2IXFA 3QBTA 5GJWC 4B33A 4B2IA 4Q1CA 3KQNA 4GZLA 3CW2A 3AP2A 4RZ3A 1KO7A 3CM0A 1KSGA 3H4MA 4KLZA 4Q9JA 3MHPA 1U99A 4CT4B 4ZGNB 2GZDA 2J45A 2KE5A 2Z6VA 2ZI6A 3QXXA 4PZYA 2GTPA 1Q86D 4Q03A 2XOKA 1SVOA 1JA0A 3Q85A 1PLLA 2AKAB 2J3EA 4TL9A 4DIDA 4F93B 2ZSBA 2VNIA 5E4FA 4KBFA 1ZUIA 2OBNA 4Q4JA 2H8KA 3THXA 5ELXA 1A8PA 1OFUX 2GQFA 3FMPB 2FJUA 2RMKA 4HLQB 4BE7B 2VYFA 4RCZA 4LI0A 3IBGA 5FUYA 3K70B 2BGJA 1E9SA 2W6JA 2XB2A 3RRNA 1ZMXA 1L7VC 2NO7A 1XBTA 1IN6A 3IHLA 4Y0AA 2GESA 1SVIA 4A8JB 1OH5A 2QU8A 3PXGA 1P3JA 2CLSA 2YJTD 4RSGA 4A1FA 4LV5B 1M7BA 1E94E 3GLGE 1GL6A 5BXQC 1E0JA 3BK7A 2OZEA 5IDVA 5CM9C 4LGMA 3BXZA 1FNNA 4B75A 3VR2A 2ZU0C 4UNRA 4MRSA 3FOZA 3TUIC 1P73A 3KUDA 3HR7A 1EWRA 1OT3A 3VX3A 2A5FA 2WHXA 1Z6GA 5FPKA 1HQCA 3CF2A 4I1SA 2FU5C 1X3SA 3K0AB 1LTQA 3WHLA 4M9SA 3WMEA 1YKSA 1J7KA 5E95A 4EJSB 5FA6A 3DKPA 3ZQJA 3LDAA 3SI7A 1QGAA 3ZVRA 4JT2A 3WNCA 1XEFA 4WA7A 3ZYCA 3KXLA 3E2IA 4QFMA 1Z29A 3OIYA 1OXUA 3GFTA 4A8JC 3HDTA 4JL5A 4QXAA 3AV0B 4PPGA 5FBWB 3ZS9A 1E4VA 1JAIA 2HF8A 2V6IA 5H68A 4D0LB 4UNSA 4PHFA 3ZQ6A 3SJBA 3LWNA 4KYUA 3PUVA 1X8LA 1JQLB 1Z07A 4ZDIA 1N6HA 2FZLA 2MSEB 1UKZA 1N0WA 2HCBA 4BRUA 4W5WA 2CCGA 1XDBA 4M53A 4B71A 1I4DD 1NP6A 3L8YA 3X1WA 3OFND 3UXMA 1SXJC 2P6UA 4R71A 3LFUA 2F43B 4AURA 1BOFA 1Q12A 2DR3A 3KTAB 5KOYA 2QUZA 3LQQA 3KKOA 1QGZA 3U61B 5DI3A 2XNCA 1J8YF 5KSOA 1JQJC 1YIJB 3VO1A 4AC9A 2VH5R 5EP3A 2O8EB 2GVZC 3EC2A 5BW8A 2OTLB 4MUAA 3VKGA 3PR1A 3A1TA 4DBLC 3GCGA 1JBKA 2PX0A 4B6EA 5HR5A 1LVGA 4KITB 2C9YA 1GOTA 5EZ6B 1NJFA 1VQKB 3O8BA 2BJWA 2EFDB 4JLOA 3IPYA 1S1CA 2DHRA 1XTKA 3DKVA 4NE2A 2GF0A 3FYHA 1Z2AA 2CNDA 1I2MA 5JECA 4AF7A 1KYIA 4ZO4A 1E99A 3EIQA 1E2HA 1VQ7B 4R7ZA 5KO2A 2ZUBA 4MGIR 4RZUA 3FHCB 4B2LA 2GRJA 2ZS9A 5THXA 1E64A 3G4SB 1YJ5A 2RGXA 4E5UA 1SULA 2R8RA 3B7GA 3W3ZB 1MRNA 1W2GA 4P32A 1XMSA 4DKXA 3I8SA 2ATVA 1W2HA 1KSJA 1X6VA 1HTWA 5EE0A 421PA 3TSOA 4TQUS 2O0JA 3C14C 1RJ9B 5C1BA 1E9CA 2QPAA 3B1VA 3HR8A 1G7TA 4WBSA 1R10A 3CB4A 2JATA 3SYNA 1OXSC 1Y3AA 4A2WA 4WXPA 1S8FA 1JEDA 1T4GA 4HUQB 4YMTA 1II0A 2JGNA 4U00A 2GCNA 4XVUA 1CIPA 2BVNA 4M2LA 2B21A 1BS1A 1GSIA 1Z28A 3EPJA 1E0SA 4A6PA 2PJZA 4RD4A 1EX7A 2QDXA 5KPDA 2XZLA 2JLQA 3I3SR 2ONJA 2REOA 4AKHA 2IUSA 2ZRPA 4MYCA 4LJ7A 4GMDA 5JWRA 3E5HA 1K8RA 4RZXA 1GRQA 1U9IA 2WZQA 4A0FA 4UNQA 1P2TA 1FMLA 1W1WA 2VP4A 3TK1A 2PMDA 1E2IA 2F1JA 2CE2X 4TLEA 1QHHB 3QFCA 2FEOA 5FBQB 1EP2B 2OCYC 3W5IA 3H0KA 1NLYA 1OLOA 4C43A 4HB4A 2XSZA 1R5OA 3QXJA 5JI3E 1RZ3A 1GJRA 3CPJB 4NZYA 1Z06A 2C8VA 3NDPA 3D31A 2X8AA 3CH4B 3NC1C 2QA4B 4PO1A 5G40A 5DIFA 1RVDA 2EYUA 3RHFA 3W6PA 3B9PA 3ZGXA 4DDTA 1JJ7A 5HCNA 4DSOA 5AUNB 2OLJA 3QOFA 4YONB 4Q4JB 4O3MA 5KSZA 5FTMA 1YI2B 3IGFA 2H18A 1CJTC 1H42A 3T1OA 4UXHA 2BKEA 3CD6B 2R44A 1M2OB 4GZMA 4PHGA 4CRWB 1KY3A 1KNQA 2NTYC 3K09C 3GJ0A 3SJAA 2IEYA 1HV8A 2C5LA 2FSFA 3A1UA 1YZLA 4KODA 1S3SA 4I4LA 4LOAA 3V4FA 3A4LA 3LBNA 2EWVA 3TUZC 2WJJA 2GXQA 4A2PA 5CDFA 1FW6A 2RHDA 5IF9A 1VYVA 5FOUA 1P2SA 1YZNA 1OFHA 4XSHA 1QVFB 2C2HA 1XTRA 1Q1QA 2BBTA 4P4SA 5GV7A 1QUEA 2ZRBA 2HV8A 3LX5A 4G1BA 1TUEA 2CDNA 1K9MD 3PEYA 3T61A 4Q1EA 1FNMA 3C8UA 3TBKA 3WP1B 4CEHB 3ZVMA 1G9XA 3FMOB 4HDQB 3TRFA 5AJYA 2ZJYA 4NPHA 1GL7A 3PQCA 4QJ3A 4S35A 1Z22A 4ZI3A 3BRWD 1DBSA 1WA5A 1NVXQ 4CEJA 3DMNA 1E32A 1D9ZA 5EP4A 1YJNB 4DZZA 2BPOA 1FDRA 3DO6A 4LV8B 3QSYA 3RRYA 3U4QB 5HXBA 1JXOA 5LDDC 5GVRA 2FE4A 3SFVA 2DY1A 1E69A 4KV9A 2DFTA 1X86B 4C0QC 2ZREA 4MITA 1QDEA 4WVFA 3CR8A 3R20A 3TKLA 2ZJ2A 2VNHA 2BKUA 3QJYA 4BFYA 2V54A 4TMWA 2RGBA 3CF0A 3VAAA 3G71B 4EPWA 1YR8A 4EDHA 2VP9A 3G5UA 3GJ6A 2WJIA 3ZIAA 4JS0A 4D25A 3ZZ0A 3NXSA 4NMMA 1ZJ6A 2XNDD 4BECA 4TL7A 2O0KA 1JPJA 4NONA 4LBYA 4G5QA 4MKHA 1T6NA 5FL3A 4AYXA 4YLGA 1PUIA 1WBBA 1KSFX 4IRUB 4U5XA 1FNCA 4YAWA 1U9IC 2DPXA 2IYRA 1AGPA 1VCIA 2BEJA 1G3RA 2NG1A 4JBWA 3T5DA 3X1XA 3PEUA 3MSXA 4P4TA 2IF2A 1BIFA 1R5BA 4KFUA 2QGZA 2GCPA 3AUXA 4AKIA 5JZVA 5M04A 1ZAKA 4C0SA 1G8YA 4DB4A 1S9DA 4IOJA 3PEWA 2BBWA 4QBGB 1VTKA 5DISB 4L9SA 2CHQA 3KFXA 4YDSA 2CVFA 2J7KA 2EQBA 3GLFA 3AVWA 1O3YA 3TQFA 4A0GA 4V0OA 1ZC3A 4YAFA 2GJ9A 5TR9A 2QNRA 4TLDA 3I62A 1F60A 2DEUA 3BB4A 2IHYA 3FE2A 1TQ6A 2G0NA 3M1IA 2I1VB 1X8JA 4NCKA 3MWJA 3GEHA 4ZIRB 1N25A 3I92A 4KSBA 3X1YA 1W0KD 4O25A 4BLOA 1S9HA 5HPYB 1RRCA 4DB2A 6Q21A 1R8QA 4NTZA 4OI0A 1UKEA 5FUXA 1E1QA 4IDQA 3THYA 1VG9B 4MH0R 1P2UA 4TWZA 3SR0A 4HLUA 3BD9A 3TLXA 3CX7A 4POAA 3M6AA 4BPBA 1G4UR 2BIFA 2JJ8A 4KFSA 2QQ0A 3GLHE 5FTLA 3GEEA 2VYQA 3ZDQA 2QQEA 1UM8A 1FL9A 1Z0JA 1N6OA 4DSNA 1PUJA 1FQKA 2G6BA 3C7KA 3DEFA 4AYWA 1WP9A 3HPQA 1XP8A 2YC2C 5LPNA 2NPIA 2BEKA 3HU1A 4UQOA 2MMGA 1R0YA 2V1UA 2IA5A 4YXWA 1LW7A 4OK3A 3B9QA 4RD1A 4N0DA 2LKCA 4NYIR 1QG4A 1ELOA 4G01B 2B92A 5AN9A 4B34A 1W47A 1W48A 1QHSA 1FPMA 2ZE8A 2I3BA 3CF6R 2QP9X 4JKYA 3K0EA 3LXXA 4RY2A 1J8MF 4EPXA 2IS2A 1T5LA 4Q19A 2O8CA 4HAYA 4F91B 2XZPA 2F1IA 3VHXA 4D6PA 3TR5A 4X8MA 1I2DA 3AF1A 4DEXA 1W0KA 2FGJA 3BB3A 3MMPA 4Q21A 3EZ9A 1UF9A 2ZRAA 1AM4D 5L8VA 3GLIA 1CU1A 3BGWA 1N0UA 3OIWA 4JLJA 2IL1A 3QKUA 4NCJA 2QPTA 4G5SA 4PZLA 1EFUA 2J0UA 5D3QA 3OJWA 1XJQA 3ND9A 4JLDA 1N6IA 3NVAA 4ZPXA 1N6KA 1NJID 5JEEA 1TQ4A 2XITA 4FD2A 5JSZA 4MDFA 2IYLD 3NHBA 1ZNYA 1G3MA 4GL2A 4O2LA 2R6AA 3KB1A 4UNNA 2L0XA 1F2UA 2Q0HA 4C0BA 3QY0A 1XMVA 2YOHA 2LWIA 1XXHB 3C15C 1ANKA 4C3ZA 1W5SA 4FIDA 4DRZA 1KI6A 3H86A 1L4YA 2IYSA 3VR5A 4V03A 3OZWA 1ZNZA 1EP1B 3CONA 3K9HA 3R8FA 2KI5A 3TSZA 1QHNA 4F7WA 4PSAA 2CHGA 1M8PA 3LQRA 4DLWA 2IK8A 2WKRA 2GETA 4GBMA
chains in the Genus database with same CATH superfamily
3VDMA 2YWGA 5CBPB 4RPDA 3MJSA 4RFLA 4Y2GA 1MV8A 5AVVA 2G3YA 2CYAA 1SQ0A 3E3OA 1PQPA 821PA 3HNPA 1CT9A 3LOUA 5IDYA 5L3QB 1K97A 4MVJI 1GY8A 3AHIA 4O1IA 3EIOA 4G9GA 2I7DA 3H9BA 3FTFA 1YAHA 1JRLA 3QYFA 1YDGA 5THKA 1RTKA 2BFAA 2QN2A 1KYYA 3O1HB 4WFQA 3AMVA 5J3OA 1X1BA 1DKPA 1K8XB 3V8EA 4XYEA 4RELA 1KH1A 1MT0A 1P0IA 1SR8A 2D1QA 1GGHA 1TAQA 3OLCX 3PC8A 4J2OA 1Y1PA 4Y6QA 5HF9A 3WNVA 4BLRA 5CDUA 4MS1A 2F1OA 1Y1SA 1HNZB 3UMFA 2IHKA 2FWAA 4RH0A 3ZR4B 2DBZA 3OM1A 1L7QA 1SUBA 1ZCFA 3CHYA 1NWHA 3G2MA 2C57A 2V1XA 1NOJA 2PUJA 2I78A 4Q1FA 3SICE 3COZA 4MGKR 2NO1A 2JK1A 1ZAYA 1DJQA 3MTGA 4C4TA 1EUDB 1H4TA 4D9JA 8ADHA 3AEZA 4TTQA 4WNCA 1RLJA 4CVNA 2R3SA 2DHQA 4P9NA 4IRMA 4KQWA 3E3NA 5SICE 4HTAA 2YWJA 1B3BA 3IBCA 3QVUA 3IUJA 4HH0A 4OHRA 4Q5IA 1W7AA 3C7CB 3G2LA 1EG7A 4IILA 4PAAA 1RMYA 1AMOA 2J07A 2REQB 4IZHA 4FHZA 5AWFC 5DB4A 5K3BA 5BSUA 5B1DA 2F43A 3SQDA 5JAMA 5BRJA 1Q14A 2RB5A 2WUDA 2BDUA 1RXCA 4G26A 4DTCA 3W8NA 4MVJM 4LY3A 5KOJB 3KJFA 2CDCA 3ETDA 1EUCB 4EF4A 3GWZA 3MGBA 4OQLA 1GFSA 3JATB 1BPLA 5HKBA 2R79A 5IJ0B 4OREX 1EX1A 3D8NA 2V4ZA 3DF9A 3FTNA 4GUAA 4X71A 3AVVA 3ESRA 1IULA 3GPBA 5DPMA 2ZAGA 3RARA 2IWHA 2OM2A 2VJCA 3S44A 1RQRA 1DUVG 3D2LA 3ORHA 5FUWA 4C0AC 3PX7A 1XU4A 2HGZA 4NK4A 3RDPA 3EUFA 4BNDB 1QRTA 4EO4A 5JNSA 3GT7A 4N8DA 1T9DA 4XLFA 2CF5A 3ZY2A 5C8XA 3A25A 1VJ1A 4KSYA 1N2CE 2XX3A 4M0DA 1Y8ZA 3VZPA 1D1TA 3ORQA 4N6NA 4AN4A 1XROA 3C4JA 5K9ZA 2ZUTA 2ZB4A 4MYDA 3ICQB 2VSQA 2G9NA 2HADA 3PU6A 1VQNB 1EAYA 3M6LA 3R77A 5A3RA 3K0AA 5FCDA 1C7FA 5F35A 1U4OA 1YE5A 2X0FA 3URMA 2EV9A 2XXJA 4UCQA 1FE8A 4N54A 1FF9A 5TC4A 4URVR 2VQDA 3QW2A 4ZN6A 5C80A 1WLYA 3DQZA 2G82A 2ZPUA 3NTXA 4E0FA 5DKFA 1TGYA 1JH8A 1VKOA 2AMJA 2HEGA 4JITA 4KU4A 4OK6A 3COWA 4BMPB 5BV2P 2AN9A 1JV2B 4HSEA 2VOEA 1T9GS 3G8BA 2GKSA 1BHSA 3BJRA 4S0XA 3VPSA 2ERYA 4NBWA 2J3QA 4DUGA 3ANLA 3LT2A 4LDQA 5I7OA 3PI7A 2AIRA 2FA9A 1GCAA 3KSBC 3NH9A 4XCXA 2ZUEA 4ACBA 3W04A 1ISSA 3P97A 2Q8PA 3PC7A 2ZSUA 1B16A 3Q3JB 4PTZA 2ZR0A 4RADA 2QMZA 1CVRA 4Y2TA 5EA2A 3MJDA 4Y9UA 1Y63A 1UIMA 3I34X 3DBHA 4FB5A 1HURA 5AIBA 1BKSB 1GPUA 2CFTA 3WR5A 1RYZA 4DMMA 2VSFA 3VZQA 4JIMA 2VJMB 3RUPA 4WH0A 2ZE5A 4IHJB 3SHWA 2BMAA 2ZQZA 3OP1A 5A2QA 2DRIA 1EA7A 4OX9B 1XRQA 3GT0A 5KHOC 1DAKA 1KO5A 4OHFA 1FRNA 1K5DA 1Z5PA 1TUIA 1TM2A 2O2CA 1ZK3A 4F38A 2FZEA 2HNBA 3SQNA 5HUJA 1R9JA 2Q1WA 3F5DA 3O8OB 4Z4IA 1RBQA 1QHXA 3VBCA 5E6RA 3D3WA 2FRDC 4YJ3A 4RLZA 1YHYA 5C51B 1YQEA 4ZOLF 4D74A 3KZCA 4DGSA 3PL1A 4ZCTA 4AN1A 5JHHB 5CYPA 3CF4A 2O8VA 4WJLA 1G8AA 1W46A 1J9GA 4FILA 4C6TA 5BW5A 4H7IA 4NDZA 2G1KA 2PMKA 4WW0A 5ELLA 3W1WA 1PJSA 4FGZA 1NW4A 1TA9A 4LBZA 1U7UA 1XVTA 5CNKA 3RFUA 3EZFA 1F6BA 4V3BA 1PZNA 1E3XA 2ZJ1A 5K0CA 1SZPA 3NC4A 4Z2YA 2AOUB 2QMHA 4M8IA 1BQ3A 5JH7B 1DFGA 2TSYB 2ZUFA 2YTZA 4JBGA 4B5LA 3W8RA 4LHEA 3I2GA 2C7VA 4DOMA 2PJRA 1V5IA 2AJDA 4DNPA 2XTJA 4PSDA 3HLYA 5DCWA 4MLCA 5TF4A 2X3YA 3MCAA 3CZQA 3KETA 3THWB 1E6KA 3MJHA 4KPUB 4MUFA 3E82A 2DYKA 3F49S 3CVWA 2RHJA 3SHQA 1S5PA 2IYOA 4UDYX 1VC2A 2Z2IA 1W9XA 4QPZA 1G5HA 1VKNA 3ACBA 2B25A 4BJ3A 1PR9A 4JVSB 2VUUA 3GRKA 1T9KA 4KHZA 1GGNA 3VR4D 2PAAA 1E3LA 3AGQA 2H59A 4Y6OA 5DX0A 2PVSA 2YYZA 4DGQA 3U7EB 2VHYA 2H2IA 4AO8A 5B4VA 1SKYE 1MX3A 1OJ7A 4OK5A 5A3VA 1DS6A 3A58B 5L4LA 2J0VA 1R8SA 2X77A 4IY1A 1DBQA 4Y0VA 2OPBA 5GM1A 2UZ1B 4ZP1A 3IQWA 4ZJUA 1OPRA 1WIWA 1PFQA 4J6EA 2UYOA 1EKXA 2VXYA 4E46A 2ZYGA 4YP7A 3ENKA 3M89A 4J1TC 4DABA 1EUQA 1M2WA 4Q9KA 4DCVA 4B4UA 5ENZA 4JJZA 3NM4A 3QOXA 1V8PA 4JH0A 4KRFA 4YAGA 3TTXA 2CEKA 3K0FA 3PTZA 2Q29A 3O26A 3WLLA 4BO2A 3T5GA 4DLSA 4WLEA 2VQ3A 2BFDA 5ALYA 1ZJJA 4Y1RB 3ZV3A 4XM0A 3A6PC 5DO9A 4II3A 4PFQA 1HVXA 4N9QA 3DLHA 2Y6UA 5G4LA 3TRIA 3CCCA 1P4SA 2CF6A 2CXXA 3FWNA 3ZI4A 3VYTB 4DV2B 2XUQA 4PYLA 2H9YA 2XDQA 2XCOA 3TEJA 1O5IA 4MYRA 2JG3A 3VC2A 1G3QA 4M36A 4F9TA 2EP8A 5FWAA 5DHRA 2PD3A 4YEDA 5FR1A 5HVNA 2WUEA 1WBDA 4Z4GA 2JFYA 4D46A 2H2HA 2E9SA 1ZZEA 3S6JA 3CMCO 1P6XA 2NU7A 1W93A 2TS1A 1WRBA 1D2NA 4MVJH 4RD3A 2B5WA 2A1TS 1IAVA 2ENUA 2EX4A 3HDGA 3KL2A 2GNPA 2AC4A 4HEA6 4Z9YA 4ARZA 5TMPA 1THGA 2C83A 3OZ7A 3A4MA 5AKHA 1T0BA 3FLEA 1RI4A 5CA0B 1WDKA 2A9KA 2Q5LA 4EELA 5JSQA 2IY7A 1GKUB 2PSJA 5K0SA 1K6IA 1RWOA 3PSHA 1XQ6A 3ENWA 2X0RA 4PBRA 1BXZA 1CRZA 3ZWKA 2HM7A 4K6CA 5KYYA 3PXAA 4W5RA 1Z3IX 4F92B 3PQDA 1VSQA 3AHDA 3AJRA 1FB5A 2BBOA 4N03A 4ZWNA 3A37A 4ZI5A 2WR8A 4K9KA 5KYYB 2PX4A 2HI0A 3FW1A 2QKYA 1FLAA 1RZUA 3QQ5A 1WG8A 5D7NA 1CUZA 1JWAB 2CKMA 4AJ9A 4DMFA 2AN1A 2YWFA 5J4HA 4R8RA 2Q4OA 1KIMA 3OW2B 4TKOB 1XZGA 3GK3A 4CDGA 5JLJA 2V31A 1IEXA 3G7SA 1AO0A 4PO8A 1PR0A 5KYWB 1KF0A 3FVRA 1N5MA 1RU3A 3DFMA 3QOYA 4G3XA 2XQJA 4CT5A 1HDEA 4D1YA 3T3DA 1M7GA 4A15A 4X07A 2VRWA 3EBOA 1JS1X 3IULA 2BI8A 2W48A 2CZQA 2X0NA 1QYRA 2VNSA 1AHNA 1KI4A 1NMQA 4CDMA 3LG2A 3P1JA 1QU3A 1K7XB 1PQYA 3ADDA 1J2UA 1Z63A 2Z3VA 4J16A 5BSEA 4MAMA 1XRMA 1PLKA 1CIJA 1JLLA 4AS2A 1Y5IA 3R41A 4BXOA 2P79A 2BKLA 2YNMC 4KXUA 3N3AC 4JR0A 2J5RA 1CJMA 2WFLA 2DCUA 1JE1A 5EKXA 2JVIA 1FSFA 2EJTA 3F3SA 3R3XA 2I4NA 3SJCA 4CLXA 1ND5A 5I7SA 1DBWA 1US8B 4ZQBA 5KCZA 1HSZA 5TLSA 3ER8A 3L6RA 4IM7A 4N5IX 2Z57A 2QTZA 2XAAA 4U6NA 4WD3A 3VNAA 3MGAA 4QNNA 4XTCS 3W3AA 4OA8A 1Y4AE 4MV4A 1HQYE 2H57A 5K3OA 5MFZA 2H08A 1QAOA 3D2AA 3L6DA 2WD8A 4BX9A 2ZJ6A 1MXHA 3KQWA 2PS1A 3K0BA 3LY5A 2QLMA 3ETJA 3PFFA 1WPQA 4FFPA 1TCUA 2FMHA 2HA7A 1V5WA 4KQKA 1OWOA 1SRRA 3R9XA 1NXWA 1RYYA 2GA9A 4IGIA 1EZ4A 1M10A 2XVAA 2DQZA 3VDNB 5FV4A 1YZGA 2NV2B 2PTGA 2GM3A 5JCJA 3ZDEA 2HJSA 4WLFA 2BE7A 5B36A 2DTEA 4LNAA 5HMMA 3L7CA 1JSRA 2XKBA 5KTTA 4PHTA 2JJ1A 2ZTGA 1YGYA 1E59A 3REGA 5LXTA 4WRRA 5G0UA 1N0VC 1OFIA 3W05A 4BEJA 1E9FA 2EHJA 3UOGA 1N5KA 5EUMA 1IRIA 3ZCSA 2EBUA 3PFHA 1II8B 4F46A 4PG7A 1I7SB 4B2PA 3O83A 5IK2D 2CZGA 4DSZA 3GP3A 3OCUA 3H4VA 4G24A 4PZPA 1T9BA 1C8LA 3R6JA 3AFNA 1N0HA 2IZ1A 4K8RB 5AW9A 2YC4C 1Z2DA 1S3IA 5DDIP 4ZDWA 3TNLA 1UOOA 5K3FB 4B9AA 3R5XA 4FJ2A 4RKRA 3GJ3A 2GRUA 3E0XA 2C1EA 4H1VA 1WQ1R 5KVSA 1M73E 2F3QA 3W2TA 3SDZA 5A0FA 3O82A 1QZ3A 2P1ZA 5AYVA 3HXOA 3K71B 3UHPA 3FSJX 2AI2A 3W6NA 1DAIA 4I50F 2WAXA 3DZJA 2FUG1 4KAJA 3WYEA 1G4HA 3GRYA 1TQDA 3DVLA 1T6BY 4OKNA 4KQ6A 4P7FA 3H5OA 3GLVA 3Q39A 1NUTA 1SG6A 1JSZA 2O7SA 3WK5A 3LK6A 4UVEA 5KTOA 1ECLA 3JQQA 2NSHA 3GNLA 4HJRA 2VDNB 4F4IA 1QSGA 1T8YA 1W75A 3L9WA 5G1OA 4A2QA 4EYSA 3KQTA 4H77A 4MJLA 1O4VA 1ADJA 5I9NA 1TRKA 1RHMA 1H8HD 4NJOA 3R6KA 2G1UA 2VXCA 3ED5A 1ORVA 4GOMD 4KQIA 1WDMA 3BILA 4GWLA 1I4OA 3G0IA 3ZUGA 2R8ZA 3Q3EA 4KR3A 5EZYA 2CHEA 4TTJA 1JNXX 4PR0A 4LTMA 4HE6A 3KWFA 5AR1A 4GM1A 8MHTA 3DHYA 3IVRA 3AVPA 3H5IA 1Z5GA 4B3HA 4G6ZA 4AKSA 5AVUA 5K0EA 1VFNA 5JCPA 4MIEA 5KI6A 4C4SA 1Q19A 1SKBA 4LC0A 4R0NA 2R66A 1W8IA 5CLHA 3RSSA 4L2IB 4ZCQA 1XD2B 3ES9A 4YJ2F 1XLUA 1U4SA 5IYWA 1YZQA 2VN8A 2SKDA 3IV9A 3AOEA 3SSOA 5DLYA 4X41A 3A28A 1A5TA 1UC5B 2NQTA 1VIAA 3KZMA 4OL0A 4PFSA 121PA 1LEHA 4RK6A 3GA5A 4BIIA 1SXQA 3BGDA 1I2ZA 3N6RA 3NBKA 4ZQIA 2AFIE 5LXTF 1UMDA 2ZOSA 5P8WA 1F7UA 4NNOA 2JGMA 1C41A 3GGPA 3H05A 3CRMA 2A78A 3GJRA 4TLCA 4FXOA 4Q47A 4RHYA 1CDEA 1UBTS 3R5KA 4FUTA 3IEMA 5LQKA 2I1LA 1VECA 2E4UA 3ZDDA 2HIAA 1U2GA 1TZJA 4LQDA 1L4MA 2ECPA 3OOEA 4XIJA 4ESEA 1O03A 2X9VA 1X7ZA 3TZHA 3AR7A 1CZNA 4G56A 3HXQA 3PGVA 2HPAA 5A9TA 5IBCA 3Q3CA 3B36A 4X7MA 3M70A 4NH0A 5BQOA 3I04A 4X91A 1J07A 3ZWXA 4S1VA 1ZH8A 3RAPR 2HWWA 1YONA 3EDYA 5ER6A 4EX7A 3V55A 1V6AA 2XSZD 4N0QA 5AVJA 1RJFA 3R7NA 3T12A 2ZB3A 4JMQA 4MHOA 1O08A 1OXBB 2WKQA 2IS4A 3PX2A 1TF7A 5EJ8A 4HTFA 4NSNA 5BW4A 5HZBA 2C5GA 2JIOA 2JGFA 3ZWPA 4ITRC 4YRMA 4Q0MA 2F48A 3NM6B 2IPAB 4NYMQ 5U9CA 3NR2A 4FE4A 5IEJA 4UUOA 3CCJB 1KYQA 2AYZA 3HADA 4ETNA 1Z2PX 1MXFA 2GAOA 3LXRA 1R6UA 1WHSA 2MYPA 5LMZA 2B9VA 3S0JA 1P7VA 3IR7A 3A3KA 1LKZA 1AUXA 1H2BA 2CK3D 3BBLA 4KLAA 2G71A 2HBYA 3IQIX 1LRLA 4FUQA 4RX1A 3FTQA 4TRNA 1MW8X 2Q7DA 2M98A 4BNJA 4P93A 1LS1A 1UBEA 3CVXA 5LZ4A 1B93A 2RGYA 2XD9A 1CJBA 4HWKA 4M0PA 3ZC3A 2Y0BA 4XL9A 4M9XA 4YRQA 3VYSB 4CUKA 2WTUA 1Y9JA 3Q3HA 1CUDA 1USVA 2X9GA 2OPHA 1E1DA 3I58A 5AJUA 1UXGA 4BOYA 2J1LA 3JVIA 1I1HA 2ZYVX 2Q3CA 3BKXA 1DIAA 4H4DA 2FEKA 2IH4A 4QV2A 4BNNA 4UEWA 3PR3A 1UBCA 5FBLB 5AQEA 5B3JC 3H1TA 3Q6MA 1U0GA 1JQKA 1ECGA 4KI0A 2Q0SA 3ELDA 3IOBA 4XWYA 2EWWA 4BU1A 1H8EA 2WWHA 2WYOA 2PWPA 4RLFA 2TMDA 3SOPA 1KRWA 1L5RA 3D0RA 1GSAA 3SYMA 1QUFA 3EPLA 4DLNA 3OLXA 1DT5A 1Q1GA 4LTNA 1IUNA 5LBUA 2GAIA 2OHJA 4F3TA 1R6VA 3ZEAA 1FNBA 2Y0PA 3K6KA 1L1EA 4PBTA 4WN9B 1KRXA 4TUYB 5L45A 4RM0A 2W2KA 3I9OA 3FNGA 5DU2A 1KMCA 2CNWD 5LLDA 2YZ2A 3L01A 4JC0A 1WL8A 2YHBA 5CIWA 3ZHOA 2H4HA 2CXQA 4KXNA 1XZPA 1K6XA 4XR9A 5CW1A 4GICA 3FD8A 2NMVA 2XUIA 4Z4FA 2GJAA 4KQCA 5GONB 4QM7A 2BKVA 1GLVA 2FX2A 3QTTA 4DA4A 1J56A 2MDTA 4BNLA 4F72A 3PUIA 4FQ8A 5AK0A 2VHVA 4O59O 1Q0LA 4CHGA 4GX0A 5GV8A 4M6WB 3VR5H 3JZFA 1E1QD 2O0MA 4NU8X 2F8TA 2I2FA 4A36A 2D0PB 1DEAA 3K9GA 4CKXA 1NQ5A 1FLNA 3K9LA 1OX4B 3CX6A 1B8OA 4LVUA 3CEAA 1YKFA 5T41A 3TQQA 3IAS6 3A6GA 3UGTA 2O0HA 4C7XA 1E2UA 4OOFA 3R9XB 1T9AA 1YS6A 3O3MB 4ZVKA 2LUOA 1NDHA 2Q3HA 1E2NA 4B87A 4FLMA 3U13A 4DV3B 1VJTA 3EULA 4KLRA 4N7JA 2G4CA 3QX3A 3FCEA 2PBZA 2GWHA 1RI2A 1H9AA 1Y8QB 3CWQA 3RABA 2ZP1A 4LK2A 3O38A 2DLDA 4DMUB 2AN4A 1IH8A 5KUTA 2F00A 521PA 1MO6A 2ATXA 5LM3A 3OKAA 2BZGA 4EJFA 1K6EA 1XYYA 4FI3C 1B43A 2I66A 3IP3A 1M0SA 1V8ZA 3SM3A 5FBKA 2C3YA 3R6LA 1X1DA 3HCBA 2I62A 4C5BA 2UVPA 4JLVA 3B3JA 7ADHA 4RKEA 1XALA 3RVQA 1ZM2A 3NIDB 4YIHA 1A2OA 3FIJA 1NBOA 4KZPA 13PKA 4YYEA 3B1WA 1H66A 1PZGA 1W52X 1AQ6A 2UXBB 4P54A 4AS3A 1Q7GA 2JDID 2EKBA 4KPYA 4KR7A 4JC8A 5KU7A 3VC7A 1FYVA 4EVQA 4V0ME 3U4QA 1A76A 1M8KA 5GPBA 5DXAA 5IKOA 2VWQA 3W6OA 4FBGA 4U8HA 1UJ6A 1YL5A 4DR5B 1EHYA 1XKQA 2XMCA 3PKZA 5G0TA 2B20A 3E53A 3Q3IA 4ZHQB 4REMA 5ITZA 3A11A 4Q93A 3S7ZA 1B26A 4D3ZA 3WMFA 1XN1A 3H2IA 1IBLB 1DCTA 2CV0A 4R2LA 1MENA 3JD0A 1LPBB 3THSA 1AKTA 1ZH6A 3D1VA 4OATA 2FUNB 4L8FA 4WXHA 3WLKX 5TMBA 4OLJA 5BSHA 1CP2A 4GDFA 4O4IA 1SY7A 3PD0A 4IIUA 3EIEA 1T9CA 2POQX 2NNLD 4ILEA 1C81A 1PSWA 3KYIB 4MPDA 2QL6A 3TGPA 1DDOA 5KX5F 4C88A 3QKSA 2ZCJA 1B2RA 2I6UA 5A6SB 5K05A 3RBXA 1F8GA 1V39A 2WYUA 1RMTA 3IP9A 4IP0A 4PF1A 2UU9B 2ROQA 3CQ9A 3KEOA 2AJBA 4KV7A 1K8QA 4WUTA 2HF2A 1F9EA 2XDWA 3IQDB 1KQ3A 5FUBA 3ZXXA 4BVJA 2QX9A 3ZH9B 3C6QA 4P3YA 4XD7D 3WADA 3TGLA 3WHKA 2X9NA 5IWAB 2QROA 1LSSA 1GKKA 2HHLA 2PXAA 2HBRA 2WOJA 4CFSA 3O91A 3IE1A 2CT8A 5ULLA 3WXMA 1NMYA 3EG5A 3ZE1B 3EA0A 2XB6A 4TYYA 3H9NA 5AUPB 5FD8A 1D4OA 2XGMA 3OQ1A 2LCIA 1QWSA 3FWHA 3SGLA 5KNCD 4HLDA 2JZOA 4YR9A 1D6JA 1OV4A 2CBXA 2CWDA 3KJQA 1AUOA 1CG6A 3KJHA 3WQQA 4X8LA 2X4IA 2R6ZA 1B8PA 2GHRA 4D3XA 4DANA 3D6HA 4H6XA 3IVMA 3IAAA 4I6EA 1WUTA 4CCYA 1Q0ZA 8ABPA 4X64B 2EKDA 1L4HA 1PJ3A 1D0SA 2LDXA 2GILA 3UCXA 2ZTVA 1GRNA 4NCHA 1WZCA 2KX7A 4LZPA 1A5SB 4P1ZA 3LF1A 1T91A 5FFNA 5TDHA 4FQ7A 2X5NA 3UATA 3MT7A 1NBMA 1ZSVA 2PRJA 3PGMA 2H0RA 4HZUB 5LP6B 4K6OA 1DB3A 1GADO 1M34A 1TM3E 1TYEB 1ODLA 1WXHA 2H9AA 3O4JA 2FX5A 2XA9A 4JBIA 4K26A 3GRCA 5IMBA 4B3XA 1PI3A 2GK3A 3GB9A 3GZ4A 4C07A 3K6SA 2D6FA 1ZJWA 1N08A 4DYDA 4G5XA 1T29A 2EFEB 2X8LA 3FVVA 2C4NA 3RT7A 3KE9A 2YXDA 5IBPA 2KYRA 1EFAA 2DWPA 3H1PA 3PHGA 1L5HA 5BR7A 5A8AA 2G8LA 1NN5A 3DZHA 4F9EA 1MGOA 3P2OA 3QEMB 3H1GA 3LM8A 1J09A 4YAOA 3DE3X 3G8DA 3OQIA 4RMNA 1HDOA 2DBVO 2Q1SA 3JQFA 4L4RA 1XNJA 5HTKA 3L6BA 1WTCA 5CT8A 3ABIA 4CR7A 1YFLA 4XOIA 4V0LA 1H4SA 4BLTA 3H3XA 2G76A 2YXEA 4DC0A 5EMLA 4INAA 3R7BA 1CUEA 1U2EA 3OWXA 4EQZA 1E3ZA 2RH9B 3Q1LA 2J0SA 4HAZA 2R65A 3WWYA 3T7JA 5FLXA 1Y3HA 2V7UA 3HFRA 5TVGA 1EBFA 4CEHA 4YJKA 1N2HA 5F1PA 3A1SA 1LNSA 1LLUA 3NEPX 1Z12A 3FCOA 1P5ZB 5CA0A 4D4LA 1EFRD 1RHQA 4GBGA 4B17A 5KYUB 3OZDA 1WXGA 1BA3A 3ECCA 1NBMD 3QVSA 2GF2A 1U8TA 3SXUB 3UAVA 4ARZB 3ZCQA 1UQUA 1T26A 1GL9B 3DV9A 3F7MA 3Q0EA 4AMYA 4EEZA 4EI8A 1MEOA 2NU7B 2Q5EA 5EC8A 3FKSA 3C5VA 3T4EA 4TKVA 4ZK6A 5HFNA 3AG6A 3GMSA 1L5KA 4H2DA 5A02A 4YAUA 1SM4A 3AKZA 2QZ9A 2FFJA 3M9XA 4K9NA 4QTTB 4HRAA 1BA2A 3IMFA 1B0ZA 1F2VA 3L49A 4YRAA 4ZDKA 1M2KA 1GA4A 2WZDA 3PCTA 4A5SA 3ZV5A 1ECCA 1JYEA 4LWOA 3PUMA 1HC7A 1QYCA 4FWIB 4WOBA 4XOUA 4ZT5A 3T7KA 2J8ZA 5CR9A 3ESAA 1X1QA 4KNWA 3ONYA 2YMLA 3QVJA 5JSHA 1FX1A 1BKDR 4QUGA 2D1SA 2N1BA 3JARB 1QPGA 2JBHA 2M32A 1OBCA 3L5OA 1Y7TA 4FEAA 3BQ9A 4OP2A 4QSMA 4KKXB 4P3PA 2ZDGA 3QHPA 1X13A 4TS3A 4Z86A 2WKWA 2DULA 2CGEA 4LY9A 1VMAA 5CITA 4LMBA 5IDQA 3WKAA 4L8WB 1WSDA 1IHYA 2JCYA 4FDMA 2UYHA 5LMUB 4ZTBA 3QE4A 2PU5A 3CW8X 3HI6A 1OYVA 3QEBZ 4OYHA 3VR3D 4TXNA 4QTUB 2GN1A 1AQLA 3AETB 3PC4A 2YQZA 1YZYA 3F8TA 1EDEA 1DAGA 1I1OA 1MCZA 3K4QA 3QKWA 2ZSEA 5EJMA 3R7FA 5H4GA 1ZU5A 3GZNB 1XQBA 2H4ZA 1I0LA 3KV3O 1ACMA 2D1RA 3WGVA 4QDZA 1FFBA 1C0LA 4C78A 3QGMA 1WOOA 2VAPA 3U7QA 4DDKA 2R6DA 4EY8A 3QG5A 1XMOB 2CW5A 1JQBA 4IZOA 1WABA 1L6IA 2ZUUA 1THMA 2L18A 3FZGA 2AMVA 1UK6A 3VKFA 1ZDMA 2RKWA 1KK3A 4UVHA 2RGDA 2F90A 2ZVPX 2IXAA 1MDBA 3SVZA 1Z39A 4X8IA 2YWRA 4PN3A 2P6NA 4G1UC 5EKSA 3B2NA 3K1AA 1ZVKA 3LA6A 1S2IA 5ADVA 1CR2A 5A3QA 3S8EA 2X6QA 4EGFA 3TN7A 5K99A 3U16A 3PEVA 1HDYA 1T8PA 4MQEB 2YZMA 1A2KC 1E8NA 3FKSD 1BG6A 3EB9A 1TD1A 4MCAA 3V4PB 3DEKA 2QRUA 2NT3A 3M4NA 2QRKA 3W3AH 3F6RA 1M1NB 3Q15C 3CZ9A 5A4AA 5EJEA 4U4AA 4D8YA 5GVSA 1BGXT 1NP7A 3I73A 4QHTA 2FN9A 1Z34A 4JLWA 3NYIA 5A7HA 2K5UA 4LYAA 1MNAA 1DZ3A 2Q7XA 4LEIA 4Q9AA 2OBLA 4WCFB 3QBJA 1XTZA 2VWHA 3LO5A 1QR6A 4JUAA 1U0RA 2F3RA 2IX9A 3OOJA 1J2YA 4QYSA 5JMPA 2UVQA 3OSUA 3LUGA 2Q9CA 3TGWA 4M87A 4MPRA 3R7AA 4DA7A 3TQCA 2PUBA 5FXMA 1T5IA 4HUTA 3A3BA 1JEAA 3RUIA 1IXSB 1OX5A 1YA6A 2C95A 3MPUA 2B30A 4IG9A 3BB1A 4JP1A 1WJGA 5FH9A 3QUQA 3HVJA 2JIZA 5E8RA 3KZ1E 1R1DA 4F86A 4HV4A 4DNQA 4YRFA 5LUBA 4JXXA 7YASA 1G0OA 3DHWC 9LDBA 1LA2A 2IKQA 1UK8A 3P0IA 1JVBA 4L9WA 4Z1MA 1U7TA 4OGWA 1ODCA 1V43A 4QXPA 2H3EA 2GSWA 3K7EA 1VJGA 2DWUA 2O2YA 3B3FA 4PTLA 2CMGA 1N6RA 2A9JA 4EHNA 3QUAA 1QKKA 3OX1A 3BVPA 4KR6A 3H94A 3S2UA 4P38A 4U02A 1ZM4A 2OHGA 1V0JA 1ODIA 2P2ZA 3UFBA 4YDRA 5A04A 4NBSA 4OQZA 1QTQA 4LRTB 1PHRA 5FLYA 2UZ4A 1ZD3A 2NUPB 3LYHA 1O5TA 2H16A 2JJ2D 3QEOA 4BU0A 3JZAA 4KK3A 4WCFA 2WE7A 3ZU3A 2VBIA 3LP5A 6ABPA 2KBFA 3HGQA 1YCDA 4BO0A 2D62A 2F67A 4FNGA 4CQMB 5IWCA 3L4KA 2ZXFA 4QM6A 2NPFA 5CHEA 4OOVA 2PQMA 3FGNA 4YAEA 2E1PA 3WSVA 4D79A 2RGGA 3DFUA 5LSAA 2J33A 4OPSA 3QITA 4LJ5A 4K9RA 4W5TA 3UK2A 3GFQA 3CJTA 2O0LA 5FHQA 5K3FA 1RKUA 4OBEA 3VSAA 1TU0A 3HLKA 1KY5A 2B5VA 4J9VA 2BHRA 1YS9A 4QUJA 4ZT4A 3V33A 2WKPA 4HHEA 1BU5A 1LK7A 3Q10A 3V7FA 4BNTA 1A9ZA 3VSBA 1NXTA 2EZUA 1DP4A 1PR5A 1UWKA 1UPXA 1XKTA 1KQNA 3QIAA 5TQ0B 1KK0A 3CX3A 4OSEA 3RWOA 2RGRA 1I32A 1WEKA 3OFVA 4GQNA 4O2BF 4TVOA 1YIDA 2V7EA 4I50B 4CL2A 5KINB 1G16A 3VRHA 2BSXA 1FZQA 1VYTA 2NO4A 3KOZA 3L7MA 5L3RA 4ARCA 2CVHA 3U7QB 5CG1A 2R7NA 1CNFA 5IN5A 3T3EA 1FVHA 1IHUA 4BGUA 1EYZA 5JRDS 2FPGA 3S1AB 1NF8A 3GVKA 1X7YB 3ONWA 2ZUSA 3L8DA 5C4GB 3UPDA 3S2FA 5I9IA 4F6RA 3WI7A 2C5AA 2WILA 3ASQA 1DLJA 2JLRA 2P2LA 4TV9F 3REQA 4Z1MD 2F7SA 4Z0TA 3KSMA 3QQPA 4NYMR 1BX1A 3OIFA 1RFGE 3OKCA 4G2NA 4PCAA 1U2QA 1PL0A 1P31A 1QIGA 3FBGA 4HQNA 1HR0B 3HJCA 3PXXA 3VBEA 1KARA 1N3BA 1JJBA 3EMDA 4TTVA 4PEVA 2I8CA 1F12A 4CF3A 4KQ2A 3WV4A 1J0DA 2NTNA 3DP9A 4TMKA 3T7RA 3TSWA 1VPDA 2VKTA 5JV5A 5GM2A 3OTIA 4F5EA 5EWLB 5EWMA 1PCXA 4D4JA 3VV2A 1BCRB 5KIAA 1N6NA 2PZGA 5CT9A 1E20A 4YC7A 1JAHA 3ZIDA 1D0IA 4EHKA 4L3OA 1U4NA 4QUKA 5FORA 4YMSA 1ZVJA 3BGIA 1IOZA 1KNXA 2JI4A 2ZIWB 3GGCA 4AZWA 3FAKA 1UKAA 2FYTA 2P90A 1R0ZA 3BS4A 4N7BA 1C8BA 4FU0A 3DM9B 2Q6LA 1IN8A 1J2TA 1X39A 1WOPA 3RVKA 5CG2A 4OIMA 2RE8A 2E49A 4PIVA 4NHOA 3DDYA 1QTNA 3KWMA 2NSDA 3M2PA 3RFFA 4QRDA 3V76A 4BVEA 4CI9A 5M2QA 1Y4ZA 3S2IA 1RAFA 1RRPA 3KPJA 3U3XA 2H5JA 3PGKA 4A0QA 2R8BA 2AFHB 1H5QA 3RJZA 4IFTA 4F84A 3GCDA 1J2RA 1N1GA 3GN1A 1V16B 1JKJA 4MPTA 2Y1OA 1SCQA 4MJ3A 1YZVA 4UE6A 4GIBA 3R09A 1QH1A 2RHOA 4EFMA 1RYNA 3SC4A 1T0JB 1YHQB 2I7CA 3HLTA 4MWEA 3K73O 1T1JA 4RZHA 2AFHE 4BMSA 1XYVA 3SG0A 2PGOA 2W9XA 5AM2A 2BL4A 3A3YA 3N2ZB 4LIPD 1OWLA 2XD4A 4XOPA 2J46A 3H65A 1T1GA 3OMLA 3SC6A 4QXRA 4DCUA 5FLKA 4NU5A 1OH8A 3IAFA 4IQ4A 4NXMB 2D7DA 3BMCA 1KU0A 3N1UA 1SXJA 2OCLA 3ONEA 2ZWMA 4ZYLA 4CZ2A 3Q9UA 4FDAA 5MGBA 1VG8A 1AS3A 3HUEA 4C2TA 4US2R 5K8IA 3BHMA 3A36A 3ANTA 3NIGB 4UMDA 3EJ6A 3GX1A 5HK8A 5KCMA 1AH2A 1ORTA 4YUYA 1WULS 2CC2A 2VHUA 5DCLA 1J25A 3K8QA 2I80A 2HUNA 3PPIA 4ZVQA 1R64A 1ORWA 3PVZA 5CD9A 1RLIA 2DZDA 1QFZA 3IQHX 2ZCVA 5I4CA 1RWVA 2XYGA 1LK0A 4RA6B 2CB9A 4C4YA 4QFBA 1TUBA 2QNBA 3U48A