2QN6A

Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the gtp and the gdp states
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
414
structure length
393
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 103
structure length 393
sequence length 414
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qn6A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qn6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qn6A01
1X8LA 4Z54A 2EFHB 1YRBA 2ZRLA 2IS4A 3UK6A 3AB3A 1GNRA 2QA5A 3W34A 3CRRA 1OXUA 3VHXA 1KJYA 2GBLC 1A7JA 3QQ5A 1LS1A 2WIBA 3AKYA 2ZR0A 2RHMA 1ZUHA 4JL5A 4YAFA 3VKHA 2O5VA 2CHGA 4QC2A 3CRW1 3GLFE 3L8YA 2LKCA 1N6NA 4LV5B 2F1JA 4C0JA 4YONB 1Z0AA 1OFHA 1OHHD 1GTVA 1SVKA 1BOFA 3X1YA 1LF0A 3BH0A 3V9PA 1T3LA 4LBYA 1ZM4A 4OQMA 2D62A 1SVWA 3VO2A 5A4JA 3ZVLA 2BF4A 2NO6A 2PCLA 4C0AC 1E9RA 3NC0C 4KXFB 1QZXA 2GF0A 2E9SA 2WWYA 1KSHA 1YQTA 4NONA 1UKYA 1NMZA 1OW3B 2ZYVX 3OFNA 2XX3A 2CNWD 2YKGA 1ZIPA 2R65A 3FKSA 2OG2A 3FMOB 5L3RA 4OHZA 5IF9A 5DI3A 1W36B 2XOKD 4LHWA 3EWSA 4A8JC 4JLAA 1RFLA 5KNBA 5L3SB 1KC8D 1SVOA 4JJKA 2OM2A 3Q3JB 1HUQA 2HDNB 1T0HB 2NO9A 3EZFA 3OEHD 4QFMA 1UF9A 1UDWA 4BEJA 2P6NA 3REGA 5TR9A 1QVFB 1W44A 4PQRA 5FTNA 3AKDA 1DELA 2WM9B 2YJTD 4LC0A 3FE2A 3IHLA 4JLBA 3UKDA 4F93B 3U4QB 3FMFA 2BV3A 2D74A 2GJKA 1EP2B 2WWFA 1JAIA 2YOHA 4BLTA 3T5DA 2ZI4A 4BRWA 1G6OA 1RYHA 1ZC4A 5K8LA 3DL0A 1GRQA 2FEOA 2QAGB 5EE3A 3KKPA 4P4SB 1OLOA 5FTMA 1E2EA 3WYFA 5JJLA 3RRMA 1XJQA 3NEJA 4AG5A 2Q3MA 4FCTA 3D7MA 5AN9A 3Q7PA 3OESA 4LJAA 1XD9A 3VR5A 1Q1QA 5E7JA 4C0HA 1TVCA 3E70C 3B6EA 3MLEA 1P9RA 3OAAA 3WRXC 1YZKA 1YZTA 2GCOA 2FSHA 1VQ7B 1KI2A 1XTJA 4LHZA 1A8PA 2FOLA 1UBCA 3KXKA 3WBKA 2B92A 3LD9A 5FI0B 5HZHA 2HLDD 5JMTA 3BE4A 1E96A 2A5GA 2ZE6A 4PAQA 4TZ6A 1MABA 5CB8A 1K73D 2NQ2C 1KSGA 3QY0A 3OEEA 2JLWA 4WBSA 4X8MA 3SI7A 2J0UA 4MYCA 4B73A 3W3ZB 4DRZA 221PA 5DH9A 3UMSA 3KXIA 1E9BA 1MR3F 3C8UA 1S8FA 2AL7A 4NPHA 1KY2A 3A1WA 4Q18A 1NN3A 1XE1A 2I1VB 1J7KA 1FTSA 2FPLA 2JLSA 4HLUC 4Q1AA 4WVFA 1QUEA 4Z8YA 3W5HA 1OT3A 3RS0A 4MDEA 1GRNA 2RC6A 1Z83A 3B1YA 4NBSA 4URZR 4W9MC 2ZRHA 5SZIA 3DOEA 4ABYA 1SM4A 3G82C 3RWMB 1WCV1 2CK3D 3DVLA 3UXMA 1KNQA 4D6PA 3WP1B 3QKSA 3W6NA 3HPRA 3B78A 4A92A 1NIPA 4B3XA 2W83A 3TNFA 1US8A 4D4LA 1ONBA 3I62A 1Q81D 4XWOA 4Q7JB 1XMIA 1GAJA 3QVUA 5AJXA 2DY1A 3NDPA 1RJ9B 4PGOA 1UKEA 1ETUA 4DEYA 4AKIA 1TQ6A 1FQJA 4TMWA 2IXGA 1N0WA 1UPTA 4HAWA 2B6HA 3T61A 1UEJA 3T1QA 1M1KD 1T8UA 2DWPA 1N5IA 2QROA 5L3SA 1J90A 1P3JA 2V54A 3ZBTA 5LD2C 2QRNA 1LFDB 5FPSA 4AYXA 1QHHA 1U99A 5DI9A 1X86B 3TE6A 2UKDA 2F3TA 3ZYCA 4IOMA 1TTTA 5J4HA 3I56B 3T35A 1W2GA 2HT6A 5FL7A 1JXOA 3ZBUA 5JBQA 1B23P 2J59A 3IIKA 4HZUB 2DPXA 4IJMA 2ASEA 4EJSA 4G5GA 2CXXA 4HDCA 4Q03A 2QAGA 4G1VA 2O8CA 5FUYA 4BPBA 4WQMA 5HXBA 1I2MA 4YAOA 5JI3E 2OXCA 3WHLA 1F2UA 3A4MA 4DSOA 4L15A 4Q1EA 3GEHA 1XD8A 5FUVA 2WWHA 1P5ZB 2C8VA 1YJNB 1W0JA 2F7SA 5GJWC 2R6HA 4MKIA 1EGAA 2XSZD 3E20A 4FWIB 3TLXA 5JRJA 3U3KA 2YWEA 2FSIA 3TSOA 3W3AA 2GK7A 4RCYA 3T1OA 4LYFA 1FUUA 1YJWB 1WQ1R 3LV8A 1CJKC 3J81k 3CLVA 3QE0A 1G7TA 4ZGQB 1R2QA 1TF2A 2H16A 1GIAA 4LHXA 4PTLA 5AUOB 3SBEA 1DAIA 3JVVA 1ZNWA 3KKMA 5EXTA 3CIOA 3SN6A 3IO3A 4LPKA 2PEZA 3VR4A 1UM8A 3EASA 2XZLA 3P4YA 1DPFA 2PT5A 4BFTA 3KFXA 4M9XA 2FG5A 4CF7A 1GR1A 3WYGA 1KZ7B 4IDPA 4MUBA 3ZZUA 1Z0DA 4RKFA 4DT1B 3NHAA 2MMGA 1E9FA 4LJYA 1S96A 4G1UC 2WJGA 3EAQA 2CLCX 3AVOA 4OYHA 1ZU5A 3H2YA 4Q1CA 5GVRA 721PA 1Y3AA 2C9CA 3VHLB 2FX3A 3A58B 2ZSEA 4QRHA 1G4AE 3HR8A 1ANKA 1AZTA 4RD2A 2WWWA 5GVSA 4PAMA 1TPZA 5ANRB 2Q3HA 4BRUA 2FZLA 4H1UA 2ZS8A 3QNUA 4XD7D 4B4DA 4U02A 2QUZA 1RKBA 2PEYA 2QRZA 4JLNA 1G5PA 3OZWA 4LV6A 1FPMA 4Q4JB 2YWHA 1G21E 3CPJB 5EZ5A 3W90A 3VR6A 4H1VA 3BOSA 3KKQA 1OIVA 3PUZA 2VP9A 4DLUA 1W46A 3CNOA 1GOTA 4DCSA 2BHRA 3QFSA 3OZVA 1E2JA 2ZSFA 1IJEA 3CF2A 3LY5A 1VDZA 3QEOA 4C2UA 3R7WB 5FFMA 2JDIA 3DZDA 1DG3A 4A6XA 4BASA 5FBLB 4KHZA 2QM8A 2IWHA 1N6LA 5AR1A 2FV8A 1QGYA 2QSYA 4C4PA 3I61A 2J7PD 2J0QA 1N3BA 5CJ2A 4OI0A 4DLVA 1RYFA 3KQHA 5C1BA 1UEIA 3HU2A 2E1RA 4JT2A 1BH2A 1TEXA 4TLBA 1WA5A 2A5DA 2R6GA 3BK7A 1YZLA 1MO5A 5J4KA 4TYWA 4TYYA 4LV8B 3DMNA 5F9HA 3GD7A 3MJHA 4NMMA 1FNDA 4LGMA 4XH9B 3AP2A 5CITA 2IA5A 3EA5A 1T5LA 1FMJA 2IXFA 1LB1B 1Z07A 1QBKC 4IOLA 1XB2A 1G7SA 5FR2A 5JWHA 4IOJA 2QN6A 4WW0A 3NH9A 2AFHE 3L0OA 5GJBA 2MSCB 2O0KA 1KY3A 1KHTA 4DDVA 5F2EA 1J8YF 3SFVA 2ZM5A 1VHTA 1CP2A 3SC3A 2VNKA 2WICA 4GP6A 3VO1A 1KMHB 1AGRA 4C0QC 2BDTA 4ESVA 3AF2A 3CCSB 2LWIA 4CEIB 3V00A 1Z0IA 1CJTC 1OFTA 3QE2A 1I4DD 1L2TA 2IF0A 2IYUA 1W34A 2GETA 2O8DA 1MO3A 1DOAA 2DYKA 1W2HA 3O47A 4PSKA 2CCGA 1TF7A 3CZPA 3OJWA 3GJ8A 4XTCS 5KSOA 3SOPA 1EFRD 1FP6A 3HU3A 2XJ4A 3R9WA 1ZNXA 3K53A 3JQPA 2OSBA 2PIAA 2VYFA 4TYQA 3KKNA 4E22A 4B35A 4R9UC 4UXJA 2EWVA 3E1SA 1GP2A 3EC1A 5IHPA 1SKYB 3I3SR 4KVGA 1QRAA 2VH5R 4OI4A 2C9YA 4V0LA 4DCNA 3MJRA 5JEEA 1GJRA 2W0MA 1NDHA 2BVNA 1ZD9A 2RGNA 4JVMA 4C9BA 2XGJA 1V5WA 2ZYWX 4US1R 2BBSA 2QDXA 4Q4JA 5CM9C 1G64A 4LJ7A 2BSAA 1GL9B 2FGKA 2FFQA 1MRNA 4IOKA 3E1YE 2G6BA 3SHFA 1YE8A 2O52A 2ZPTX 5EUQB 4C2TA 2O8FB 1G3MA 1YZNA 3OIYA 4AKGA 5FL3A 1W87A 4MRRA 3HJNA 2NMVA 1COWA 4Q4AA 1GM5A 2OFWA 1E2KA 3CX7A 3AVVA 1FX0A 3CW2A 1XZPA 1VQMB 1AGPA 4HZIA 4JLPA 2WSSD 3ZD6A 1MH1A 4DJTA 4ZCLA 2A2ZA 1DVRA 2CCKA 3K1JA 1YJ5A 4B3GA 1CR2A 4QBHA 4QKQA 5F98A 4PQFA 3A1VA 2KSQA 1BYUA 3SJCA 1X6VA 3BFXA 2W2XA 1E2DA 5JFGA 1XU4A 2VF7A 3KL4A 4IEIA 2WJVA 4NYIR 2AWOA 2ZE5A 3K9GA 3B2EA 1S1CA 4JLJA 4WZBE 4CDGA 1NLZA 4NYMR 1IAQA 4RZ2A 1XBTA 3QSYA 1NVVR 2ZRNA 2H5EA 3CF0A 4JKIA 4BLOA 4B43A 1NN1A 1RRPA 3F8TA 1XF9A 5KNCA 3K0AB 4KO8A 3UMFA 2BIFA 2PZGA 3NIBA 2NO1A 1IN6A 1KMHA 3CPEA 3U3JA 4V0KA 1TQ4A 3OE7A 4YDHB 1H85A 1AQUA 2AKYA 3I92A 1E1RD 1RPZA 4IDOA 4HAXA 2FSFA 3W2HA 4DLZA 3W2IA 5EP2A 4F4JA 3LX8A 3PEVA 3CKLA 4DLTA 1GG2A 2ZI5A 4ASUA 2IX3A 5B57C 2EVWX 4YXWD 3GLIA 2J45A 4TSFA 5HCIA 4Y9RA 1DO0A 2ORIA 4MQBA 4FD2A 2GJ8A 1ZINA 2G0NA 2FGJA 1KGDA 2I4IA 3ICQB 2GK6A 2AWNA 3AQ4A 4PHHA 2QL6A 1VQ4B 4FMBB 3UWKA 2F9MA 2ZETA 3B82A 1NMXA 3ZC3A 2ZSAA 1TEVA 3NG1A 4R2HA 1ZU4A 1QG4A 3ZS8A 3QXJA 1P2TA 1RIFA 3AM1A 1JPNA 2CBZA 4N1AA 3PITA 5EUMA 2V7QA 3RANA 2A78A 3FB4A 4RD4A 3GLIE 3OJXA 1E2NA 5AWFC 2BMEA 4ERNA 1FRQA 2J46A 2VEDA 3PQCA 3K9LA 4HI0E 3IILA 2EIXA 2J9RA 1X8JA 4U00A 4EFNA 1E4VA 4GOXA 1NVUQ 2BBOA 1IONA 2JJ8A 2N46A 4FINA 4G3XA 2GAOA 3OF5A 2JATA 1SKYE 3CZQA 1TNDA 1JR3D 5AK0A 3QFCA 1HV8A 1EFTA 2PMDA 1Z0FA 5J4LA 5E7IA 2N42A 5HTKA 1M8PA 2BOVA 1JJVA 3QG1A 1Z5ZA 2X77A 3FYHA 1G5TA 4JVNA 1Y63A 1HE1C 3O8CA 4ITRC 3CC2B 4DVGA 5IK2A 2FFAA 3JQRA 1GNQA 4CVNA 1YZQA 4JLKA 1E2MA 3GLHB 2B7CA 1UDXA 2GTPA 4A0GA 1U8YA 1VQKB 4NCIA 1YR9A 4UXIA 4B2LA 2ZRMA 2BKUA 2CHVA 4Q7MB 3FFBA 3L0PA 1ZNYA 4EKDA 2IS6A 3GJ4A 1CJVC 3Q5DA 3ZVRA 2IC5A 4EFMA 3GLGB 1HQYE 4JLOA 3THXB 1JJ7A 2EFDB 2GQFA 4IXMA 5H70A 2IEZA 4JBWA 4YMVA 5DN6D 4PHTA 2O0HA 3NXSA 2WKRA 1RW4A 4KBFA 2OO7A 4QXAA 3U44A 1OXTA 5L8VA 4P3YA 4DQKA 2AK2A 1QG0A 3A6PC 2H7VA 1TLLA 4LYJA 3ECCA 2BBTA 1XTQA 4U5XA 1NN5A 3CCLB 2NPIA 1IXRC 4I1SA 1QHIA 5FR1A 1R5BA 1PV4A 3QXSA 2GKSA 1W0KA 3SR0A 5DIFA 3TBKA 1ZRHA 3AF0A 1N6KA 2JJ2D 2V8OA 5FTLA 1SXJC 2G0TA 1S72B 2QPTA 3K09C 1M74A 5BYJA 3WMEA 1OH6A 4MKGA 4KSBA 2CNWA 2B8TA 4ZDIA 2WZQA 2D3WA 4DLSA 1VQNB 1W5SA 2C99A 2ZU0C 4Q9JA 2YOFA 4KJZA 2WSMA 4FI3C 4OQLA 2WWIA 3C41J 3EZ7A 3GJ3A 1G3RA 4L4UA 3BBPA 1N6PA 3HPQA 3OEHA 1VQOB 2OEPA 3EX7C 3AVXA 1L7VC 4MYTA 1OKKD 1N2CE 1R5OA 1OV4A 1OYYA 3TQCA 2XNDA 4PFSA 3TSWA 3K9HA 4IVRA 4LJ5A 2BEJA 4C43A 4M2LA 1XZQA 2FPKA 4TZ0A 2IF2A 3C14C 3RSLA 1KK3A 1E2FA 1SVLA 1VQ6B 2A5YB 2NGRA 1NY5A 3AKEA 4OK3A 1KKLA 3K0EA 5GADl 1H8HD 2QZ4A 5JS7A 3O8RA 2J41A 4HAUA 4IFBA 2ZVQX 2GEVA 3N5CA 4TLEA 3H1TA 1EG7A 5CIWA 1QHSA 3BD9A 5HE9A 4WAUA 3AVYA 4UKDA 2D2EA 1KI3A 3HR7A 1T3HA 4RD6A 4A8JB 1QDEA 3KQLA 4LHYA 4K81B 2ZUDA 1KDTA 4ON9A 4KFUA 3RRZA 4ARZB 1BMFD 3T1TA 1KSJA 2BMWA 2PLRA 1Q20A 3E5HA 4O25A 4PPGA 3AUXA 1ZNZA 1G9XA 1R7RA 2ERYA 1UJ2A 5EXPA 4P6VF 1BX1A 4Z1MA 4TT3A 2BC9A 3A1SA 3AGQA 5G40A 2JLQA 2BJVA 3NDBB 2OCAA 2G83A 4BEBA 2QGZA 3GQBA 1NJID 1NVWQ 2CLDX 1P75A 1HQCA 2QAJA 4E09A 1Q22A 2VYQA 2VHJA 5JS8A 1QFYA 1O87A 3PEYA 1Q1EA 1E1QA 3CCEB 4DKXA 2GVZC 2C5LA 4GBMA 2DWQA 3QKRB 2ATVA 3BFVA 2P0EA 2P5SA 1IBRA 2ZI6A 3TQFA 2QTHA 4UNQA 3LBIA 4PAOA 1CEEA 4F7WA 1RVDA 4BFZA 3GLHE 4XVUA 1L4YA 2O8BB 3RYTC 4TQUS 3BGWA 2VPPA 2R6FA 4YAUA 2GWHA 3GJ0A 1MO6A 3FDIA 2J0VA 5CIQA 4PX9A 1II8A 1PLKA 1GL7A 2QE7A 3PJRA 5JCZA 1IOZA 1KSFX 1U0LA 1G8HA 1G19A 1YR8A 2C03A 2J87A 1IM2A 5B30A 1EFHA 5C4MA 3THWA 2W6ID 5JJIA 1NMYA 3MD0A 4BGDA 4RD1A 4DUGD 4V02A 4URUR 4LCBA 4JSYA 2ODNA 1P2VA 3EC2A 4F4IA 2IEYA 1T4GA 4Q9LA 3LO8A 4IHQA 4TTRA 2J3EA 3QXCA 5EP4A 1KD1D 5SZHB 1E69A 4M21A 5DNYB 5HR5A 4JLVA 2ZXUA 2OTLB 4UNNA 4CEHB 2QPAA 1GNPA 4ZGNB 1SXJD 2CE2X 1Z08A 3IEVA 4C7OB 3PENA 5IT5A 4D0GA 2FFBA 4CGZA 1EWRA 3TUIC 2RH5A 5KNDA 1SKQA 4DCUA 4LC1A 2WBLC 1D9XA 1FL9A 4ZIRA 1ZM3A 1KO1A 1JEEA 4ARZA 1VCNA 3RSOA 3W8RA 5LD2B 1MKYA 1QGZA 1F5NA 3DZ8A 4AKHA 2QT1A 4F92B 2DFKB 3WRYC 2Z83A 3TR0A 3KX2A 2WMOB 1EFCA 1E79D 2OHFA 1D5CA 4GMXA 3UMRA 4KAXA 3U5ZB 1HTWA 1JA1A 3WYAA 1GILA 1A2BA 1ZJ6A 1AKEA 3MRSA 3KQUA 1Q86D 5EMNA 2SHKA 3TVDA 5KPJA 4GZLA 1G6HA 2XNCA 2ANBA 2IYVA 1Z0KA 1BQEA 1EWQA 5DGXA 2WWGA 4AWXA 1KDRA 3QG5A 4B76A 4TN1A 2HMAA 2VSFA 4NCJA 3LX5A 4ZDJA 5DYGA 3BB1A 1XMSA 1Z47A 3RDPA 5KU1A 2EFGA 2OZEA 2VP5A 4HB4A 5D3MA 4MDFA 2JA1A 2NO0A 4MUAA 4ZO4A 4PO1A 4TMKA 2IW3A 5EE5B 3DOFA 4YMTA 1VQLB 4FXPA 3W5IA 3A37A 2KI5A 4JIMA 3NHBA 1WE2A 4V03A 1G41A 5GJVC 4NH0A 3IEUA 3B1WA 3MGCA 5L3QB 3SYLA 1XFAA 4L9WA 3BRWD 3CR7A 5JHHB 2GXQA 4HDOB 3GP8A 5BN3A 2V4ZA 4B48A 3R9XA 3U60B 5H8WA 2PZEA 2BPOA 5EE9A 5J4YA 1J99A 2ZIAA 3LW7A 2FA9A 2VIIA 2X8AA 3CR8A 2C96A 2NPFA 5TXGA 1H65A 1A82A 3RLFA 4LBVA 4A2WA 3CPWB 2VZLA 3BB3A 4QJ4A 4CT4B 1OJLA 1U8ZA 4Q19A 1XEWX 3K0CC 4JL8A 4RZ3A 3SS8A 1QG2A 2R6CA 3AH8A 4KCGA 3TKLA 4P4UA 4EPYA 4RD3A 3AF4A 3FMPB 4BLQA 2RGCA 1RRFA 2NTYC 4W5JA 2IUSA 1Z3IX 1P72A 4ACAA 4O2RA 4URXR 4RFVA 3VR1A 4BZXA 1W47A 3QF4B 4BE7B 3CF6R 1QVGB 2X19A 4X8HA 1BYIA 5G3YA 1QHYA 2ATXA 3SQXA 3MWJA 2KE5A 4YMWA 4MGYR 1BIFA 5J47A 4YAWA 1GO2A 3B8HA 4KI0A 1S3GA 1VQPB 1OYWA 3I5XA 1EX6A 1X8KA 3GFOA 5BN4A 3B9QA 1T91A 1XD2B 3QXHA 2XXAB 3OZXA 2QTZA 2QY9A 3GJXC 3W5VA 1ZD8A 3LBHA 3TUZC 4FIDA 4WXRA 1ZP6A 3THOA 2ZRFA 1QVAA 4Z8XA 4HUTA 1DAEA 5KSYA 4L8GA 4NYIQ 3GJ7A 3B1VA 4L5BA 3U4QA 4G5SA 2HYIC 4IVPA 4QBFA 3TW4A 3RHFA 4Q1DA 4NYMQ 1E2LA 4R7ZA 4XOIA 4M1SA 4OI1A 1YRAA 3LRPA 1VYTA 4P4SA 5J40A 2G9NA 5FTJA 2HCJB 2W6JA 3F3YA 1LTQA 1XEWY 3BB4A 4P0TA 1E9DA 2J0SA 3GJ5A 1M6NA 1CJUC 3VR3A 4B3BA 4YMSA 2X3UA 4TMVA 1XRJA 2ZRPA 3TUJC 1CLUA 1KI7A 5TY0A 2Q9CA 2V6IA 1N5KA 1UADA 5HKKA 1Z29A 5B2ZA 2AXNA 4NP6A 5TARA 4P31A 1QHXA 1Z2CA 4EJSC 1LS6A 1VTKA 2W2TA 2Z43A 4A2PA 4Q1BA 1L4UA 2ODBA 2XEXA 3HWSA 4JSTA 2VF8A 1IN5A 1JPJA 2GRJA 3U3RA 3OFND 3THYB 2BGIA 3ZIAA 3CH5A 5FOSA 3FKSD 4QHSA 1OF1A 4OHYA 2QG6A 2W0SA 2FF7A 4LJ4A 5DHAA 3LXRA 3RS7A 1PUJA 1HT2E 2VNJA 1AS2A 1XJ0A 3FPAA 2WSSA 3CUEF 1IHUA 2CVHA 1FFHA 2JASA 2OAP1 1VPLA 1ZM9A 4QGFA 2F1IA 4TQ9A 1TQDA 1XXHB 2FJUA 2OLJA 1NLFA 3B9PA 4C0BA 1LW7A 1VG0B 3MFYA 1N25A 2IXEA 3W5UA 2XZPA 4E03A 5DSZA 2TMKA 4QOSA 2VSOA 4EAQA 3RNLA 2C77A 1DBSA 1RJ9A 1XCMA 2KJQA 4Y0VA 3EW9A 2G88A 3JQQA 1EWYA 1R8SA 2CL7X 4CW7A 1F3OA 3VAAA 3WNBA 4BZPA 4U7DA 3LVRE 3PIRA 3PR1A 4KODA 2ZJ5A 2YYZA 1T3SA 1XD2A 4NCHA 3FHCB 3OAAD 1N0UA 5FH9A 5FOVA 1M90D 2PX0A 1UBFA 4V0OA 1WF3A 2ZUBA 1R0XA 1Q7YD 2IT1A 2Z6VA 4ZDWA 4EPWA 1FZQA 2RB4A 4Z51A 1RRGA 3W9YA 5FI1B 4LDJA 1CJMA 3TW8B 4LYHA 4XVQA 3VR2A 4DB2A 3AVPA 3OEED 4HZUA 2GCPA 1GDDA 1U94A 2QPOA 3CRZA 3ND9A 2CLSA 4GMDA 4YXWA 1XEXB 2ZRDA 1VIAA 1A2KC 1DAGA 2ZUCA 2H8KA 3H84A 4LZZA 1E0AA 3CMAB 2YWGA 1NJGA 4YALA 3PFIA 4BLRA 4RJLA 1S4QA 4TLDA 3VKWA 4JMPA 2FN4A 2GJSA 4LJ8A 1J9ZA 1CF4A 2B21A 3NTUA 5C46F 1SVIA 4ZV4A 1W49A 3U3OA 4BQSA 2CL6X 2RGDA 1EXMA 1AS3A 3KDSE 2DB3A 4WXPA 1YZUA 1XNJA 2V9PA 2RGGA 3VX3A 4PC6A 3IIMA 2JLRA 3MG9A 2NIPA 2VNIA 1OSNA 5BYKA 2F43B 2G1JA 3W8NA 3QVVA 1EFUA 1IN7A 1ZC3A 1ELOA 2GVDC 4Q21A 2VNHA 2DEUA 3CO5A 2X2EA 3KUDA 3SJAA 3AVUA 3EIHA 3L8ZA 5EP3A 4D0NA 3WNDA 3B7GA 3C7KA 3PUVA 2ZE8A 5FBRB 2IYXA 5CK4A 5KYKA 4M9QA 1LNZA 2WJJA 5FPTA 2UVQA 3THYA 4OBEA 2REBA 1E64A 3AVWA 4URWR 4ZCIA 3K8YA 2ONKA 5JJKA 4N3NA 4D26A 3EA0A 5AJZA 4DT1A 3HU1A 1K6MA 2EYQA 2YZ2A 4LJ9A 5H59A 1CTQA 1KJWA 1U0JA 2R9VA 3L0SA 1GFIA 4B3CA 2OFXA 5TV2A 2ZEJA 3RRYA 2H92A 3VNUA 1GKIA 4JYCA 3VU9B 1P61B 3CC4B 4XSHA 5FL7D 1PLJA 4OKSA 2ODEA 4DC9A 3I1FA 5HZKA 2QNRA 2O8EB 5KSPA 1KTVA 1G8GA 2XJ9A 4Q1FA 1VYUA 4HYYA 2ZE7A 4N3GA 2ZI9A 5FPHA 1H8EA 3QKTA 1NG1A 5GJCA 2IHYA 4MGZR 5K8IA 2NOAA 4KBGA 5DLQC 1BKDR 2KBFA 3TIFA 4A0RA 3U7EB 2B7BA 1KAOA 1ZD1A 4JL6A 2HT1A 2AFIE 3KTAB 421PA 2H18A 2OLKA 1JR3E 1Q1BA 2JLZA 3R7WA 5CDFE 1W0JD 2A7QA 1W2BB 3LAWA 4E5UA 3ADBA 1KI4A 4RVCA 4FK8A 1YVDA 3KZ1E 5FOTA 3PUWA 3CCUB 5FBVB 1TF5A 5FTKA 4I99A 5CYOA 1Z22A 2HV8A 1XXHE 4S2EA 2ZRAA 4EQ6B 4NCNA 1Z06A 4DCTA 3AV0B 3ZZ0A 1TL7C 5JECA 2RGNC 4G0NA 2CMKA 2HYDA 3MHPA 1UMKA 2OTJB 3KB2A 1IY1A 3S1AB 2VSXA 1BO6A 2CJWB 5DO9A 1IJFA 1JALA 3V4FA 4Y7CA 2RKOA 2WPDA 2YVUA 5DYIA 2WAXA 1KI9A 1B2RA 3DM5A 1AZSC 1NVXQ 1W5TA 2BCGY 4KLZA 3BORA 3BXZA 1DARA 5LB4A 3ASYA 2GEDA 2VRWA 1S9DA 4O3MA 1G7CA 4M53A 2UZ3A 2YC4C 4HUQB 3C16C 3K70C 1XMVA 3K0FB 4EPTA 4HEJA 1Z6GA 1RC8A 1KO5A 3D6TB 1AJEA 2ZS9A 1SGWA 4CEIA 4OL0A 3KB1A 3HYRA 3U2QA 3ZS9A 1BX0A 3BS4A 1QFZA 3IIJA 4M1TA 2QTLA 1AS0A 1DO2A 1E98A 4IKEA 1DG1G 3PUXA 4ZDKA 3SHWA 3MAAC 2QORA 4GI7A 2OCBA 3BH7A 2W00A 3AUYA 1QFJA 2PJZA 5EXXA 2GESA 1T8TA 3PCRB 1AM4D 1SXJB 4Q01A 3MSXA 3RS2A 2JDID 1I4TD 1SQ5A 3ETLA 521PA 1JQJC 1LY1A 2R6DA 1NKTA 2IYLD 3MMPA 3FKQA 2C9OA 1XTRA 3FGNA 2JIZA 1K9MD 1I7PA 1Q82D 3FHOA 4PXAA 3IBYA 3KJEA 3R20A 4XJXA 2EFCB 2GJAA 2PCJA 2VA8A 4ILEA 4AURA 3RABA 1XJCA 5E95A 3SJBA 1PUIA 2PMKA 1R8QA 3WMGA 2G3YA 2WOJA 3TAUA 1D8TA 2EWWA 1TU3A 5KPDA 4A6PA 4H9GA 2F6RA 1II0A 4QGAA 1QHGA 3SBDA 4B3FX 1A4RA 2JJ1D 4NL4H 2VQSA 5GV8A 3KJHA 1II9A 4Q9IA 3RVBA 1FTNA 2ZRCA 2DETA 3A4NA 3W6PA 2QBYB 3X1DA 2GNOA 4TMTA 3I8SA 1FOEB 3KUCA 1M7GA 2O8FA 4L16A 1P9NA 1UAAA 4PSVA 5FPYA 2ZSDA 1JI0A 1UBGA 3CONA 3CM0A 4KLNA 4JT4A 1F20A 5JRZA 3CPHA 5FA6A 4UJ5A 3I8XA 1IY0A 4D4MA 3N70A 3FTQA 1JECA 1U9IA 5M04A 3NBYC 4HB0A 4B71A 1XCPA 1ZCAA 3AF3A 4RFSB 2IL1A 5H5JA 2XAUA 2CJWA 1FNCA 3H86A 3DO6A 3U6KA 1JQLB 2GAAA 3BIFA 1NI3A 2ZYTX 1RZ3A 4US0R 2V6JA 4KITB 1KI6B 3L82B 5AJYA 2LCFA 1GZSA 2AHOA 2YWFA 1W35A 2D06A 2WMNB 3ADKA 4ESHA 3BC1A 1D2EA 1Z6YA 2OBNA 2Y8EA 1ZM2A 2KBEA 2C2HA 4JVSB 2OT3B 3QUSA 2QMUA 2WHXA 1NJFA 3K0AA 3V4RA 4DBLC 1Z2AA 2G77B 1RE0A 1UFQA 2W6IA 4A1FA 1T6NA 3SEAA 1QH0A 3RWOA 4CT5A 4E07A 2QI9C 4I1OA 3Q9LA 4UNRA 2GF9A 2CDNA 2PL3A 3QIAA 4NHOA 4GT1A 5H1YA 1OHHA 2B8WA 4POAA 4R2IA 4S35A 1W4RA 2IYYA 3CRQA 4URYR 5FBWB 1OXSC 2ORVA 3DDCA 4B2PA 4DWJA 4Q66C 1XPUA 4HLCA 4LHVA 4TQAA 4I1VA 1AA9A 3AF1A 3N2EA 4M8NE 4LOAA 2DWOA 3K09A 3LQQA 3H4MA 1YI2B 2BGJA 3BWDD 2GDJA 1IN4A 1COWD 4OHWA 1JEDA 1HE8B 1R4AA 3DHWC 4RKEA 3B13B 1MOZA 1QX4A 4FMCF 3K70D 2XOKA 2FH5B 1W4CA 2ECKA 5CJPA 3GPLA 1GSIA 1W48A 4Q4LA 3CWZA 1J70A 4A4DA 1BS1A 3NVAA 1DAMA 2IYQA 3ASZA 3M0EA 2QMEA 4BZQA 2XNSA 5B58C 5EE0A 5TVKA 2L0XA 1Q21A 1E94E 1M2OB 2AK3A 3PG5A 4U9UA 4MITA 3SNHA 4BWYA 4YQFA 3EWAA 8OHMA 2CCJA 3QBVA 1TUIA 4DLWA 2HXYA 4M4SA 2J5XA 2QBYA 1SXJE 3VNVA 2PZFA 1XMJA 3C4JA 4YDSA 5C2JB 3SYNA 4GSYA 5FOUA 1XDBA 2C78A 2ZJAA 4QBIA 1KYIA 3MWKA 5FBQB 1HEIA 1WDTA 3ZIAD 4Q48A 2YINC 4TL8A 5KOYA 4QGHA 2YNMA 4F4CA 3UG7A 2BKEA 1JXMA 4A9AA 3IPYA 2FMXA 1GAQA 3ZZTA 1NSTA 3ZVNA 1WBBA 2OBLA 1IQPA 1E2PA 1G3QA 1FQKA 3CRMA 5EP1A 3ZD7A 4RFSA 4QM7A 1VCMA 4LX0A 1ZVQA 4W5HA 5CYPA 1FRNA 4QL3A 4DDUA 2HLDA 4D82A 3IQXA 2VBCA 2C98A 5TMPA 2JLYA 1HY3A 4B33A 1KQSB 1NBMD 4NYJR 4FWTA 1VQ8B 4M1WA 4ASUD 1HURA 1C4OA 4CIDA 2WJIA 3GLHA 4GPTA 5AUPB 5LDDC 3Q8XB 4CZ2A 1UBEA 5HE8A 4EPVA 2GPJA 4US2R 2ZRGA 4B6EA 4Q9HA 5FUWA 2NG1A 5BQ5A 4GP7A 2ZS7A 3GLGA 4UXHA 1U90A 3X1WA 3THXA 2ZANA 3JZMA 4L9SA 2DFLA 4N0DA 4DZZA 2WTUA 3KKOA 5DI3B 1CRPA 1EP3B 1SULA 4TWZA 2F3RA 2X2FA 4FMDF 3GMTA 1CNFA 1G8FA 2RC5A 2EU8A 1Q44A 4DXAA 4DDTA 4BFWA 2CK3A 1R10A 2ZI3A 1IY2A 4M0LA 1M1YE 2OXRA 5JEDA 1CR4A 1N6RA 1JB9A 1YHNA 2R44A 2V7QD 1EESA 2QEXB 5FOXA 4DLRA 3PEWA 121PA 1G16A 1X1RA 4R98A 3K0SA 3IDQA 4DB4A 2QP9X 2H1LA 2GHIA 2O0JA 1W1WA 1G7RA 3AVTA 3QBTA 3KQKA 4JKYA 3MWYW 2QSZA 2GBLA 2MSEB 3GLGE 3G0HA 1CKEA 1B0UA 1K5GA 2AX4A 3NBZC 4QG7A 4C3ZA 3TK1A 1CR0A 4ZI2A 3TH5A 3KJIA 1KMQA 3I72A 2GCOB 2AN9A 5AUQA 5A5GA 1N5LA 3LDAA 3C5CA 4G5QA 3W2FA 1N6IA 1E32A 5IDVA 1PLLA 3P4XA 821PA 1OH8A 1MABB 2F1RA 3BFKA 3WHKA 4CYMA 4PC3A 1U8AA 1AKYA 1Q0UA 1CIPA 4A36A 2J0UB 5TB5A 2VHQA 4J0QA 3VKGA 4M9ZA 2JLVA 2FZ4A 1XTIA 4O2LA 1N5JA 3G6EB 1VMAA 3IUYA 4AY2A 1E3MA 4CRWB 3QENA 3KFVA 2ZYUX 3EZ2A 2EW1A 1F48A 4TL6A 3NEYA 3SU8A 1ZUNB 1U2RA 3B1ZA 3WY9A 4KSCA 1RRCA 5BWMA 2KB0A 2XSZA 4A8JA 1EX7A 3A36A 4Y0AA 4IFEA 3A4LA 4W7SA 1YR6A 3OZUA 3QKSB 2EQBA 3GCGA 1MV5A 3EPKA 3A1TA 1US8B 3Q72A 3F5FA 5SZKB 1W0KD 4XSGA 1G20E 2VP4A 4WA7A 3FJOA 2A5JA 1QHNA 5HPYB 3U7HB 4K1XA 4I1UA 5J4VA 1W7AA 4HLDA 4TL7A 5FUXA 1P2SA 1N0VC 2HUPA 3QF7A 1Z6XA 4QBGB 2OE2A 1YHQB 3LW8A 4MH0R 4C0SA 1D9ZA 2IUUA 3I4LA 1IN8A 1PZNA 2XTNA 2JGNA 1NN0A 1H42A 1J2JA 4PR0A 1DS6A 3P26A 1W4AA 1QHHB 3QKRA 2ZROA 4ZKEA 4FW9A 4LI0A 2R6AA 5H68A 2H57A 2OCYC 4D80A 2O8BA 2XNDD 4GRAA 4MGKR 4X8OA 4XD7A 4F38A 2Q9BA 4AK9A 5AJWA 4DCVA 1KDPA 3CH4B 1E4YA 3EXAA 4EJSB 5C4GB 6Q21A 4Q5IA 2Z0MA 4A2QA 3LXXA 1OFUX 4PZYA 4D25A 4QM6A 2A3RA 2O8CB 2CVFA 3ES9A 2C04A 4BLPA 4AG6A 2PBRA 4A0FA 1XPOA 2OV2A 1F2UB 4A82A 621PA 3RS3A 1DEKA 3BAFA 2F55A 1CS4C 1X3SA 1WP9A 4UNSA 3TJZA 2P6RA 4MRVA 4HLUA 1G8PA 3FOZA 3I55B 1GITA 3VQTA 1F2TB 1P7CA 3Q85A 5B64A 1WXQA 3M4YA 1GKYA 1O3YA 2J7PA 2JAQA 1P9WA 2IUTA 4I4LA 3TVTA 3EPLA 2GXAA 2NZJA 4OHXA 4PANA 4LK2A 1G3UA 3K0CA 3FVQA 4DSNA 2WVJA 2YHSA 3B1XA 3KJGA 4KU4A 2NO7A 4K8OA 5ELXA 2P6UA 3L0IB 1M7HA 1E2QA 1KOFA 2I3BA 2J1LA 4LJ6A 4Z1MD 2DFNA 4TT3D 4TMXA 3P27A 4CEHA 5CB6A 4Q7KA 1OIXA 4B32A 2CNDA 3W6OA 4C7OA 3LQRA 3T12A 4DHEA 3CXCB 5G3ZA 1J8MF 4Q00A 5BN5A 4FMCB 1E1QD 1SHKA 1E0SA 3TMKA 4PPQA 1NP6A 2QP3A 2QMOA 4PC1A 4QGGA 4XIGS 4RD0A 1G17A 4IW3B 3WNCA 1U0HC 2IYTA 3OIUA 4MGIR 2VL7A 3EIEA 3BH6A 4A0HA 4NZYA 4B44A 2RGAA 2DFTA 1OPXA 1KO8A 1K8AD 3CX6A 3LWNA 4HAZA 3WXMA 1JB1A 4HB3A 4XTRA 3UG6A 2Q21A 1VQ5B 1ZAKA 2V55B 3F0TA 4G5OA 4RCZA 4AYTA 1AK2A 1Q12A 3OIWA 3B60A 4TYNA 2V3CC 1NVVQ 1F6BA 2QE7D 3T1VA 1CRQA 4EPXA 1OB5A 1XWIA 4GL2A 1LF5A 1EFRA 1Z8FA 3R8CA 4M1YA 3FFAA 3TRFA 1NSFA 1W4BA 1W36C 4HAYA 4LWZA 4B6FA 1SZPA 3RAPR 4BFVA 4WZAE 3ICEA 4WOPA 4ACBA 4DIEA 2ZVPX 2NZ8A 2Z4RA 2V1UA 1S9HA 2OK7A 3P20A 3SE0A 3B85A 1SVMA 4P32A 4CEJB 3UPUA 3CCRB 4Q9KA 2V1XA 3WBJA 2GA8A 3N2IA 1YU9A 3ADCA 2BMDA 3A8TA 4P33A 4QHTA 5KTYA 4Y9UA 5L3QA 2QAGC 1V43A 3ZQ6A 3CCQB 1NF3A 1P73A 3HDTA 4KVAA 1R0WA 3G4SB 3OHMA 3ZGXA 2PH1A 1G18A 3DKVA 4PC7A 4LUCA 3R8FA 5JZVA 3OIVA 1F2TA 1ZYUA 2EYUA 4LSGA 4NDZA 3SJZA 3ONWA 3H0KA 4PO8A 2CEAA 4WZ6A 4FMDB 2RHDA 1FNBA 1MT0A 2GJ9A 1U81A 5LPNA 2Q9AA 2A5FA 1R6BX 2HF9A 2ZAOA 3DPUA 1OXXK 2ZRJA 2VHUA 4HE6A 1PJRA 2ZJ2A 5EQTA 1NNEA 2FE4A 1ZW6A 2O8DB 1FMLA 3LLUA 1E2IA 4WIAA 3SFZA 4UNPA 3QF4A 3GFPA 4C30A 2ONJA 4AI6A 2REOA 1XCGB 2BEKA 2OAQ1 1E9AA 3DMDA 4JBYA 2X1VA 3QPUA 5CLQA 2ORWA 1KI1A 3T06B 2ZAMA 3NBFA 1N8RD 3ADDA 4F91B 3FHTA 4B47A 1A1VA 1FUKA 3OW2B 3ZJYA 1ESNA 3CBQA 4B75A 3CMEB 1XX6A 1WRBA 2XXAA 3QPWA 1TX4B 5JSZB 4QHYA 4XWAA 1FDRA 5LBIA 1E1RA 1S1MA 1OE0A 2RMKA 1SVSA 5A0FA 1F60A 1VIYA 2IYSA 2XB4A 5CM8B 2IYWA 3W2GA 1G4UR 1UKZA 2XTZA 3O8BA 4HSEA 4MKFA 2RGEA 4P4TA 2N1BA 3M6AA 4PQYA 4DIDA 4EDHA 3GEEA 2OBMA 1CBUA 2FDCA 3W2EA 1DADA 2KWIA 1OB2A 2JCSA 4GOKA 3QXXA 4DQLA 2BJWA 5C18A 3SQWA 2GZDA 4Q4AB 1G5RA 4OK6A 5FPKA 1E99A 5JI2E 3T34A 3SYKA 2FWRA 2HJVA 1FX0B 2BM0A 3K70B 2PJRA 1LV7A 3AKCA 3G71B 5JWOA 4HATA 4CEJA 2VHTA 2VTKA 3U3MA 4EUNA 3PV0A 3ZDQA 2DHRA 4TLAA 3U7FB 4LPSA 1OH5A 4EH1A 1HT1E 1XEFA 2AKAB 3IO5A 1TQ2A 2JJ1A 5P21A 1I4LD 3MCAA 4QJ3A 2WV9A 3RC8A 2R2AA 4PZLA 2QU8A 2ZTSA 4G1BA 1DAFA 2IK8A 4OK5A 5D3QA 2C95A 4GDFA 1JJ2B 3IHWA 4MYHA 1W36D 5GV7A 3DM9B 3CWQA 2AXPA 1JR3A 2ZRKA 5CDFA 5EZ6B 1TU4A 3AVQA 1NY6A 1VG1A 3MWLA 2ZI7A 3VX4A 3WMFA 5JLJA 1P6XA 3EPHA 2QEQA 4OHVA 1G3IA 2Z4SA 2ODWA 1D2NA 1XXHA 2RGXA 5LB2A 5KHOC 1EP1B 2DBYA 2AD1A 2QT0A 1L8QA 1CULC 3O8DA 1VYVA 1NIJA 3ZVMA 4ZKDA 3NH6A 5AJVB 4Q4HB 3GLIB 1NL3A 1NLYA 1DAKA 3ZQJA 5KUTA 4DLXA 2W6JD 5E4FA 2ZR7A 1TAGA 5KDLA 3I73A 2D7DA 1TADA 4RZXA 2YV5A 3X1ZA 3JZAA 4FCWA 4TTPA 5JSZA 1AMOA 3ND8A 4JBXA 3RC3A 4JZKA 4BPRA 2DR3A 4LY6A 3QJYA 2OFOA 4QNMA 5DN6A 3L2OB 4NYJQ 2HXSA 4TYPA 2P67A 5HKKD 3GJ6A 1G8YA 4W5WA 2QMHA 1DDGA 3HYTA 5HCNA 1VCOA 3EZ6A 1SHZA 1R0ZA 2ZREA 3T5GA 5AUNB 3I32A 1KKMA 1GVNB 2VP6A 2J7KA 1XEXA 2BM1A 3Q7QA 1Q3TA 4YHBA 2BN4A 3REFA 4TL9A 1WMSA 3VMFA 4XWKA 4I81A 2JJ2A 4LBWA 3IBGA 1ZMXA 3C5HA 2IS1A 2F1HA 5EE1A 4LYAA 4MKHA 5BW8A 4O0MA 1OH7A 1E0KA 3AEZA 1PVOA 3A1UA 3SDZA 4V0MA 5KDOA 3CC7B 5KSZA 2BWJA 4Q47A 2GILA 1E9EA 4AKEA 2F43A 3CX8A 1FNNA 3QOFA 2CL0X 4JS0A 4EIWA 1FNMA 1A5TA 3GFTA 1XTSA 1M7BA 4ZCMA 1E9CA 1KNXA 1YKSA 1OKKA 1I2DA 1E2HA 2Q0HA 4KYUA 1Z0JA 3DEFA 4AD8A 2IWRA 1JNYA 1C1YA 1GKUB 1Q3HA 1AN0A 1EK0A 3UWOA 2FNAA 4MRSA 2DCUA 1KI8A 1ODFA 1G1MA 5JCPA 4X8LA 2GCNA 2UZIR 1VG9B 4KFRA 3CCVB 3AP3A 2FPMA 4M1MA 5IRCD 4DDWA 1FP7A 1H8HA 5F3WB 1OFIA 2AD5A 3K9NA 4DLYA 2VHCA 1DDIA 3LFUA 2GXUA 3QEJA 4KFTA 4V0ME 5TDHA 3GEIA 1VKJA 4LRWA 1P4SA 2G1KA 3IQWA 3ZLJA 5DISB 1Z6TA 2QTVB 5DHFA 3FMIA 1VHLA 2ZSBA 1FW6A 3VU9A 1P2UA 2JEOA 3MUFA 2O8EA 3U44B 1S0UA 1KJZA 4D4JA 2FFHA 1BMFA 2FEMA 4DEXA 2BMJA 1NBMA 4N0EA 3T15A 3Q5EA 4M9SA 4KV9A 1IXSB 4Q4HA 2BBWA 5KDDA 1HYQA 4D2IA 3V76A 1UKVY 3M1IA 2D2FA 5JWRA 1CQXA 1JA0A 3LVQE 1OIWA 3R9IA 1GAWA 1U98A 2QA4B 1VCIA 4NTZA 5FOWA 3KTAA 2Q6TA 3BERA 4GZMA 3CRVA 2QGNA 4GOJA 3LVBA 1VG8A 1Q57A 3ZH9B 4BUJA 1M34E 1QUFA 2HF8A 2XITA 3D8BA 3QI2A 4Q02A 4ZPXA 1IXZA 2GEUA 4IDHA 2IYRA 4AYWA 4C0KA 3EPJA 1GUAA 2P65A 2PX3A 2ERXA 3HP1A 3NKVA 3TGPA 4EQ6A 1CR1A 1ZM7A 4GNKA 4TMZA 1XTKA 2BCJQ 3PUYA 5L3VA 4MRPA 1QF9A 1DTSA 4NCKA 1NBME 4V0NA 1KK1A 1N6HA 4A15A 1XPRA 2AR7A 3S1AA 4D4KA 2ZJYA 4XVRA 3TR5A 4OJQA 1ESMA 1ZUIA 2JLXA 2D7CA 2IS2A 2IHBA 4YMUA 3FWYA 4HDQB 5KO2A 1YZGA 1Z6AA 4OQXA 1YR7A 2XTMA 1KIMA 2CRVA 5G41A 3RRNA 1P62B 4LBZA 2OESA 2FSGA 3IKJA 1DE0A 4QJ5A 3TSZA 4BFYA 5K8UA 2IBMA 2W58A 3KXLA 1E6CA 1E2GA 4F7DA 3CNNA 3CCMB 3NC1C 1NG9A 3CNLA 2WKPA 3U61B 1Q1ZA 4JYBA 1X1SA 2OCPA 2GXSA 4HUQA 4IDNA 1ZBDA 1R5NA 5K8TA 3K0FA 2EFEB 4JLDA 2MMCA 2ZRIA 4G5RA 4B34A 1U9IC 2A30A 3E2IA 4DUGA 2ZR9A 4K46A 4DSTA 2ZJBA 3CB4A 5J5CA 3X1XA 5UKDA 5E7MA 2XNJA 2ZJOA 2ZJZA 2WIAA 2GZHA 3G5UA 3D31A 4M22A 4OI2A 2XZOA 3U7GA 1ZIOA 2ZJ8A 3LBNA 4QNRA 1D2MA 1H8ED 2CE7A 4RY2A 1LVGA 1D1NA 1AQYA 1DAHA 1JR6A 3P32A 4OQNA 4PPNA 4EFLA 1K8RA 1SXJA 4JLMA 4OQFA 4B74A 3UATA 3EG5A 3PXGA 2WWXA 2D4HA 2ZRBA 2RAPA 5CLLA 4MA4A 2HJGA 4PC2A 1G291 2CHQA 2OUKA 4G01B 2REXB 1Z63A 2P3SA 1VQ9B 1T0JB 2QQEA 1KRHA 5DE3A 4D0LB 3GLFB 2W2VA 2JLUA 4Q7LA 3TAHA 2R8RA 3CCJB 4PHFA 1NKSA 1KK0A 5BXQC 4AF7A 3KQNA 3LO5A 1S2MA 2QENA 4OJKA 4AC9A 2WKQA 1E63A 3QFRA 1T5IA 2P5TB 5THXA 3EIQA 1E79A 2K5UA 1OXVA 2QP4A 3L43A 5F9FA 2WPDD 4PHGA 3AGPA 2WAYA 1II8B 2PLFA 3QPVA 1YJ9B 2FU5C 1YITB 4TLCA 4D81A 1KO7A 4HB2A 4NU0A 2MSDB 3JVUA 2GZAA 4NKRA 3I5YA 5JHGB 4BFUA 3W5JA 4AIIA 1JAHA 4FN5A 2R62A 2WJYA 3VFDA 3THWB 1C9KA 3IGFA 4HLQB 4AF6A 2VO1A 3OE7D 2LKDA 2RGBA 4DSUA 4UAJA 1KAGA 3RS5A 4PO9A 1NRJB 4JJZA 3FPKA 1KDOA 3D3QA 4C0LA 2RCNA 2E87A 2ZQ5A 1S3SA 2F9LA 1MO4A 1GWNA 2VP2A 2OK8A 1D6JA 4UQOA 2P2LA 4YC7A 1E9SA 1E62A 2B5OA 2ANCA 4MRNA 5E3HA 1KK2A 1KI6A 4M1KA 4TSFD 1P60A 1OGJA 1T9HA 3DKPA 1CNEA 3QFTA 4HE5A 3WP0A 1R0YA 1GRRA 2OILA 4FCVA 4PPFA 2HCBA 2WOOA 3X2SA 4KYIB 4B2IA 4EPRA 1ZCBA 2XB2A 1CU1A 2JIZD 3P1JA 3CD6B 4PSAA 4M1OA 4ZIRB 1JBKA 2YC2C 5G53C 3UIEA 4II7A 2QM7A 5EXSA 3BJIC 2HEIA 5CK5A 1Z28A 2BMFA 1OGIA 1HH4A 2H17A 4JVLA 4IEEA 4YLGA 4RZUA 4IDQA 1XP8A 2Z5FA 3IPXA 2ZU6A 1KO4A 2QTFA 3EZ9A 1GVHA 3VTKA 4GFDA 3NBXX 1N6OA 3LA6A 2Q3FA 4URVR 1K5DA 1YIJB 1BJKA 2PT7A 5KSWB 3RS4A 4B3DA 2DERA 3PVSA 3NWJA 1QGAA 4MYUA 2QQ0A 4IRUB 2WJHA 4IXNA 1HA3A 2I1QA 3B5JA 1WB9A 3QKUA 4IVQA 1WBDA 3AP1A 4TTQA 1QVRA 5SZJA 2ZITA 3C15C 4BFSA 1TUEA 4BFXA 1AIPA 1MRSA 3GLFA 1TMKA 2A9KA 4ZI3A 4BECA 4HAVA 1VECA 2VP0A 3EARA 3SZRA 3UANA 3U6BA 3LH5A 5EJEA 1GL6A 3LNCA 5D3MB 4RSGA 1IB0A 2IYZA 3LLMA 4NE2A 4UJ3A 4PZZA 1CXZA 4R71A 1KZGB 3PEUA 4BLSA 5IK2D 2YOGA 2VLIA 4KFSA 1E0JA
chains in the Genus database with same CATH superfamily
4GU5A 1LSSA 2EFHB 2VAPA 3CHYA 5FA8A 1OBCA 3FI9A 3UK6A 4YPVA 4KE9A 8LDHA 3GJSA 3CRRA 3ED5A 4MMZB 2W71A 3L01A 1CNMA 2ODPA 3A9WA 4UEOA 2YFQA 3SLRA 4KXLA 5AJTA 3W79A 2HK9A 4R1NA 2JZCA 3QTLA 2O5VA 3PPXA 1IULA 4R0VA 3L8YA 3HO1A 1N6NA 2G1PA 5FWNA 2BF7A 4C0JA 2DFPA 4LFCB 1URPA 1Y48E 1XYVA 2ACKA 4R68A 3G2LA 5AO9A 5LXTF 2PKQP 4C05A 2B1IA 4LGCA 2RE8A 3C85A 3Q6MA 1LF0A 2P3LA 2FUG1 3U4IA 5IN4A 2ORYA 2ZBEA 4PNEA 1IBKB 1DKNA 1KFJB 2V7EA 3CS3A 4RV9A 3WTBA 3KZOA 3SD7A 2IH5A 4NOLA 4ZC8A 3KPJA 2II6A 4KX5A 1YVPA 3BSSA 3FLMA 2JGLA 4RLFA 1F17A 2W2LD 4RNCA 1DEOA 1E9RA 2PNJA 1QZXA 1VLLA 5FBZA 4MB6A 4DXDA 1Y1PA 3U9TA 2HA0A 2HIGA 1T5DX 3SF8B 2I6QA 3EC7A 1QC5B 4P80A 4RPHA 1O97D 1NMZA 5J59A 1ZHFA 2VBFA 4G37A 4CKEA 1LPOA 2KW5A 3TDMA 3PBKA 2R65A 3IDSA 4PRYA 3GAZA 1H2BA 3C74A 1NLUA 4IKPA 5CYFA 5IF9A 5EMHA 5DI3A 1PRYA 2Z1DA 3EWSA 3UAXA 4CPDA 3EDYA 1RFLA 4R5MA 2J09A 4D3ZA 1CB7A 1EUDA 1ESDA 2G08A 3IP9A 3K2QA 3MCTA 2UYCA 3GDOA 3F2VA 2W8BB 5IANA 3Q3JB 2HDNB 1T0HB 2HA6A 2YFHA 4QFMA 3OP1A 1H3NA 2J5RA 3WLQA 4BEJA 5LNK6 2QNIA 4AAYA 5TR9A 2FSPA 3ER6A 2VCHA 2CZCA 2GTIA 2WM9B 4UUMA 5E1DA 3RJTA 3FZEA 5BSRA 3P9QA 2D74A 2P2SA 4NPCA 1EP2B 2WWFA 1BS9A 1JAIA 2J33A 1Z4LA 2IYEA 2J3QA 1XOIA 3FCUB 3NM4A 5IBPA 1C5KA 1U0SY 2NSJA 3JSAA 1GRQA 4PLCA 3ESXA 5EE3A 1DL5A 4GSKA 4HDSB 1VJGA 2DZDA 1BWRA 1RMTA 1OLOA 2G9UA 2PQMA 3D4PA 1RE1A 3F5SA 3IAFA 4XPIA 1E2EA 1SXIA 5AOAA 1OXBB 2RAFA 3RRMA 1UK8A 2A0UA 2QZZA 3K32A 2R0QC 4LJAA 3Q9UA 2CLLB 1Q1QA 4IP0A 1DSSG 4Q93A 2XD9A 1EDOA 4Q3OA 2GCOA 5HZGA 4B3MB 1MIOA 2WF5A 1Z6QA 5C2JB 5I4IA 3KXKA 3R5KA 1YQDA 3Q6RA 2B92A 4R4JA 2F9FA 1R9GA 5FI0B 5B7GA 5JMTA 2IHNA 3CEMA 5F9MA 2A5GA 4AZ0B 1D5WA 4OP7A 2SKDA 4TZ6A 3P2EA 5CJJA 4F5EA 2NQ2C 2R85A 1OX5A 4TGLA 1KSGA 1V3QE 3LT2A 4X62B 3MTJA 4BVLA 4EZIA 1EBUA 3WIUA 4E5SA 1RYBA 3HRIA 3P2MA 3WI7A 4CM8A 4WGGA 1E9BA 3WG9A 4AT1A 3C8UA 2E48A 1B76A 2AL7A 4NPHA 2G9VA 2YY6A 1KS2A 2L19A 1XE1A 4MW4A 1LX6A 3DAYA 1YB6A 3CSSA 3RAGA 5BUSA 5HGJA 4HLUC 3V1UA 3RS0A 4MDEA 4X66B 4DJJA 1GRNA 3ZXXA 2RC6A 2YZMA 1EK2A 1W73A 2VJPA 3HDJA 5KC9A 1Y0YA 4ABYA 1SM4A 1ZSYA 4DYDA 4ENUA 2CK3D 2MOKA 1X1CA 3M4XA 2MSNA 2O0LA 1ONSA 3K9FC 4EYGA 3R7NA 3OF3A 1V0EA 4OIFA 3U7GA 1MPTA 3QP9A 1REQB 2BUAA 1NIPA 1YSCA 4MQ4A 1NR7A 3IKMB 5CEFA 3I62A 3A7EA 5ICSA 1BA2A 2JBWA 2DY1A 4IHJA 2DKFA 1A7UA 1A9TA 1FYEA 2AEMA 1XC7A 3WB2A 4I1IA 1UKEA 4BNXA 3DL7A 5A3QA 3D0KA 4ZOBA 3NUQA 1YWGO 1UPTA 4HAWA 1PHPA 4XDGA 5GGXA 1UEJA 3HDQA 5C53B 5LZ9A 2ZAGA 1N2ZA 1UJBA 1YJXA 3WKAA 2F8MA 2IVFA 2YJ6A 3L77A 5LD2C 5A89A 5EKUA 3EHEA 4BV8A 5THKA 1WL8A 3REOA 5DI9A 1X86B 2VA9A 2UKDA 1HDOA 1TTTA 2CXHA 3AR6A 3E15A 4HL6A 3OO0A 4ALNA 3IT3A 3P9KA 4B85A 3AOEC 1TW3A 1JXOA 5C1PA 5JBQA 1B23P 2J59A 2QRLA 4D57A 2JGMA 2LDBA 5HIMA 1T24A 3DKRA 3ZU4A 4IQ0A 2HWXA 5ITZB 5L53A 1WUTA 1TFRA 4GIBA 2E1BA 4U7JA 2WUGA 5FUYA 3PE4A 4IYRA 4W5TA 2Z08A 3Q3AA 1I2MA 3NPMA 3SLKA 1IB6A 1V5VA 3H5WA 5KTKA 1JMYA 4RQTA 3NYWA 1ZICA 4L15A 3GEHA 2C59A 4TRNA 4JI6B 3ZCRA 3VZQA 1XD8A 4OQPA 3IMKA 3TIVA 4E15A 9ATCA 5KNDD 4R3WA 3C3PA 2XSZD 5KCMA 1Z17A 2MTBA 3RD5A 5JRJA 3U3KA 5K0TA 1UD4A 4H60A 4TS3A 5CD9A 3L7MA 1Z38A 2CXRA 3HZZA 4O4LB 2YWEA 2FSIA 4F2WA 2GK7A 1G8MA 2HPVA 4U3JB 1FUUA 1M1XB 1WCXA 3HXKA 5IJ9B 1N3LA 4PTLA 4ZGQB 1T4DA 2I4RA 1F4PA 1GIAA 1XCLA 3CLHA 4LHXA 5AUOB 4V2UA 1DAIA 3JVVA 3KKMA 2V03A 2DHEA 2YR0A 3WC4A 5EJ6A 1P33A 1WXHA 3SN6A 3CIOA 1WW2A 3IO3A 4LYYA 4XDHA 4D5GA 3GA0A 1USIA 2B82A 2BGLA 3EASA 4N5DA 1U0GA 1DPFA 4W1SA 3TIIA 4PNZA 2Y2VA 4Y2PA 3DSRA 3MCUA 2GUWA 4YIKA 1GR1A 2OXTA 3LQFA 2PSSA 5BOSB 1QZUA 3ZZUA 2D3LA 2A0YA 2O2HA 1NW7A 4QYSA 4GC9A 3KHTA 1D7AA 2Z09A 4LJYA 4OUKX 1T5EA 5DBIA 3STXA 3WHLA 2E4ZA 721PA 1XRRA 3DEAA 3GVIA 4J3FA 1Y3AA 2AI2A 2C9CA 3A58B 3KSMA 4PBSA 1EZ4A 5CNMA 2PL9A 5ESRA 2HEGA 2J30A 4I1PA 5P8WA 4EKYA 1AY0A 4JMLA 4KLRA 3FSRA 4TV8F 5EOVA 4KVZA 1VCHA 3PLNA 4YT8A 2HA3A 2Q62A 3HLTA 4INOA 5EJ5A 4JJGA 4AFNA 4UTPA 4L5IA 4QDUA 3S7TA 4D98A 4DA6A 3IQZA 2XH8A 4ZGBA 4MHSA 2C8LA 3C98A 3N3BC 3CPJB 3W90A 2H2AA 4UVEA 3L4KA 4J1NA 3PUZA 1OIVA 2BGMA 1W46A 4K05A 4RU1A 5IDYA 5JNTA 1TGVA 5EXDA 4DCSA 3MTQA 2BHRA 3C6ZA 3IAM1 3R0JA 4HTAA 3LY5A 4BATA 1VPTA 2OQ2A 1O9HA 5KYWA 2C5GA 3DZDA 1WPRA 1DG3A 1YUNA 3HJGA 5FBLB 4KHZA 1K1EA 4MS1B 5K05A 4JYAB 2WUEA 2CNNA 3HY4A 1X0VA 3LKDA 3A2LA 4R9SA 4DY6A 5M3BA 5FFFA 2J0QA 2Y9MB 5CJ2A 3LL4A 5LXTB 2HBRA 1Y6JA 3RKRA 3TN7A 3TPZA 3PD1A 3HSKA 3ZV5A 2Q8QA 3RG2A 2E1RA 3UCFA 3A6JA 3VAYA 1IHDA 3A1PA 4Z9FA 2A5DA 5A1TA 1EFKA 1K06A 3HB5X 3M83A 1F6DA 4E1BA 1SXHA 1ACLA 1DOZA 1F38A 2HK7A 1T13A 3FJ1A 4OQDA 2OP0A 1FNDA 2FN7A 2ZUSA 1MX9A 4IY1A 2IA5A 2ZG6A 3EA5A 1N2JA 4X7BA 3RJZA 1T5LA 1PR4A 5ERGB 1Z07A 3L7KA 4O4IA 4BIIA 1LDBA 2I3ZA 5FQNA 2AFHE 2CXPA 4IIHA 1YOVA 2GEFA 1KBZA 2MSCB 1KY3A 1M76A 1XLTC 2O0KA 2WTBA 4WLEA 1J8YF 2D5CA 2PNFA 2AT1A 1WKBA 1N2GA 4HN2A 2ZIZA 1VHTA 1SXQA 3Q10A 1U6IA 4GP6A 4EUFA 3M9WA 3H5VA 1DKRA 3PGMA 3CCSB 4U63A 4ND1A 5D5PA 3V00A 3ZCUA 3RQSA 4BUCA 2X85A 1CJTC 3UV6A 3QE2A 1L2TA 3CUYA 1M0EA 1W34A 1EWVA 4L1KA 2GETA 2VDQB 3MAGA 1U8XX 3GVLA 4I6EA 2AOTA 4LQDA 3TOCA 1MB0A 4BBJA 4G8DA 2VHEA 3VH3A 4ARAA 3HDGA 5LOVA 1W2HA 3O47A 4GMHA 4OUDA 2CCGA 3CUVA 3H97A 3CZPA 3OJWA 1N75A 4KXWA 3WL8A 3GJ8A 1NUTA 3SOPA 3WAKA 4B7AA 3HU3A 4RHTA 3L49A 3W8EA 1WHSB 2HNAA 1CUZA 4FGWA 3RYCA 1U2TA 1XMQB 2NT4A 2YV2A 1RQ2A 4BO2A 3KZVA 4E22A 3CPXA 2PX5A 4B35A 1I7DA 1RQLA 4WNCA 4X84A 2JHGA 3BMOB 1M2VA 5JSKA 5IHPA 1V37A 3CEPB 1E60A 3DO5A 1GPNA 4FYHA 1QRAA 3ROGA 1OLXA 2PSEA 2X41A 3LHFA 4M76B 3ND6A 4F60A 3UMMA 3PT9A 3GNLA 2HBQA 2V9CA 3BQMB 3ROTA 1N8TA 1IHPA 1ZD9A 3DDSA 2HMYB 3ZWYA 4C9BA 3IHKA 3DVAA 3LUJA 3P7MA 4P0PB 4Q4JA 5CM9C 2BEUB 4Y2SA 1SIBE 4LJ7A 4PWYA 5KYNA 2BSAA 1XAIA 4MRAA 2P4HX 3OWXA 1DKQA 4WBNA 3N8IA 4IOKA 1G0OA 3E1YE 2NU6B 3IVXA 2I6FA 4M1EA 4NEHB 2CHUA 2EAUA 2X5NA 5EUQB 4O59O 4KAJA 3S2IA 1YZNA 4F9FA 2PZMA 5BMVA 5FL3A 3VGPA 3PPYA 3N75A 5THQA 2ZTNA 1DFHA 1W87A 1MUUA 1YV9A 3O95A 5JLAA 5JXHA 5SICE 2NMVA 1COWA 3GPIA 4H6VA 2FKNA 2PR2A 1E2KA 3CX7A 2NZVG 3BL8A 3ZK7A 3AVVA 1P5RA 1FS4A 4GPIB 2I34A 3O9MA 1VQMB 3QGMA 1E8MA 2VJKA 3PNSA 3O38A 2HDHA 3QYPA 1KH1A 3ZD6A 1XVUA 3K8QA 5EHGA 5C5DA 4N41A 1YI0A 1F8GA 1TUBB 3I5UA 4TMYA 1VM6A 2E85A 5F98A 3B3AA 2PIDA 5CT9A 3OCXA 2XUQA 1E2DA 1XU4A 2VF7A 3T3NA 2WJVA 4N82A 3O7MA 4CLOB 2ZE5A 3DBRA 3ANNA 2FOXA 4TTJA 3N6XA 3EE6A 1P2BA 4NYMR 4RZ2A 1XBTA 3QSYA 1Q0HA 2HA5A 2O3SA 3AERB 1ISSA 4G9GA 4BLOA 1RRPA 1XF9A 1P31A 4YS6A 3K0AB 2WAAA 4RQUA 1UWCA 3NIBA 4KQIA 1PVDA 4DV2B 3C6MA 1TJPB 4M9CA 1M0TA 4KYTA 2YV1A 3V8PA 4DNPA 1KETA 1E1RD 2NTJA 3I92A 5FB3A 2WVGA 4HAXA 4KVFA 5D6NA 3MT7A 4QRDA 3W2HA 1QK3A 2FOIA 2I4OA 2IEIA 2QJRA 1Q84A 4FDVA 4L5CA 5EWLA 4CMEC 1I4WA 5ALVA 1A8UA 3CVJA 1USUA 3AFHA 2LGJA 4CF6A 3M1YA 3F4KA 3RVJA 4DLTA 4I2NA 2Y77A 1N2CB 4HDKB 4Y9RA 2ORIA 6AT1A 4MQBA 5A0TA 4FD2A 1IE3A 3E18A 1WAMA 2ZP1A 1OGYA 3ASRA 1ZINA 1CB0A 5BWBA 4D0RA 5K03A 4B6JA 4PHHA 1LBIA 4IQ8A 3S70A 3BFJA 4HNAB 5A9SA 5JH7A 2ZETA 3D8NA 3PC4A 5LYJA 1N0IA 3F9IA 2ZSAA 3BJRA 2SNIE 2VH2A 4R2HA 3T3IA 3WLFA 1ZU4A 1MPXA 1ODTC 1TZCA 2GJRA 1L4BA 3GCWA 3QXJA 4HAOA 1B8PA 1JAXA 3KIPA 3BJEA 3IBFA 5CDSA 3FD8A 3AM1A 4YUYA 3PITA 2ZSHA 2PD4A 3LUGA 5EUMA 1WQ3A 3DP7A 4DQXA 2YMMA 4YQEA 3ENVA 3OQIB 2JLCA 2PGNA 4WI1A 5AIBA 3BIXA 5EJFA 4DNXA 2VEDA 3HCFA 2NYUA 4U00A 4GOXA 2ZAIA 3BA1A 5C8ZA 3BXOA 2BBOA 4BP8A 3OF5A 4JLSA 3ZWKA 5IBCA 3R6WA 4Y3UA 1K2WA 2D1YA 3H6GA 4A27A 4BO3A 1J07A 4R05A 1LWNA 1TNDA 5AKYA 1VLJA 1JZQA 3IB3A 4R8RA 4OH1A 2F64A 2REQB 1IVYA 5E7IA 4WKGA 4J4TA 4QTTB 5DGHA 1P3DA 2X77A 4N54A 4XRGA 2OA0A 3WGTA 4TV8B 1Y63A 2C3UA 2ZCUA 2CKMA 2ZIXB 1HE1C 1HRDA 5KOJB 1FTQA 2SBTA 3FCCA 1NC1A 5B3JC 1XGKA 5JROA 4WECA 4R2LA 1IM8A 4RYLA 4AIRA 3Q8KA 2FVXA 3LWBA 3G9UA 4L76A 1YZQA 4JLKA 1COZA 2C2YA 2OL4A 1BW9B 3AM3A 3LHSA 2B7CA 1JPUA 1VHOA 1HDXA 1U8YA 1UDXA 2GTPA 1YR9A 1MX5A 2W2OA 2ZRMA 2BKUA 3BDAA 2YIVX 3VVMA 1ORTA 3VYSB 3NWEA 2CV0A 4Q7MB 4YP9A 4G4IA 1ZNYA 2OFFA 2IS6A 3KPYA 2PGXA 3DKIA 3GJ4A 4IV0A 1WP6A 3ZZNA 4EFMA 2FVYA 4YX9A 5JATA 3GLGB 4JLOA 1N9KA 5LBUA 1N78A 2GQFA 1NB9A 2HA2A 3NFYA 2ACWA 1U3GA 2IEZA 4ER3A 5CIYA 4GEGA 3MPOA 4LJKA 3QWFA 4YMVA 1TYCA 2ID4A 4FKZA 1U28A 2O0HA 3NXSA 3O1IC 4ZMSA 3RU7A 4WN3A 1R9MA 3ONFA 2OO7A 3PUJA 4QXAA 5AKKA 1GPKA 1SCQA 1RKXA 3WLJA 4QATA 3U44A 1SXPA 1QG0A 4C89A 2H7VA 1E3JA 2B35A 2WSIA 3ECCA 5F4JA 2GSDA 4ZQBA 1XJ5A 2NPIA 2R8BA 3M8KA 1KQOA 1R5BA 1EIZA 3UO8B 1KP9A 2VOEA 4IG9A 3VXKA 3U40A 2BP7A 1ZRHA 3F1LA 2X86A 2JJ2D 1SXJC 1J06A 4K9MA 1W94A 3ROXA 2JFQA 2B8TA 1DOHA 4RMIA 3STWA 3TRJA 4AN0A 4NG5A 4CM9A 4ENVA 5JAZA 5KWIA 16PKA 2R6JA 1UPFA 1NUAA 3URKA 1W5SA 3V1TC 2C99A 2VRCA 4R7TA 1P44A 2YOFA 2C5HA 2FPOA 2WSMA 2Y1CA 1VSQA 2FRVA 2BKLA 1VSVA 5AOBA 5ALIA 3INGA 1G1AA 4H16A 4M86A 2WFLA 1NBWB 2VXCA 2B6NA 1N6PA 3HPQA 4R1MA 1VQOB 2OEPA 3HA2A 4R9NA 2CF5A 4KXUA 1R5OA 5ECWA 2P9QA 4F4UA 1JU3A 3PVDA 4EYKA 2XNDA 2DBZA 2MSWA 2QN7A 1GPDG 4LJ5A 3L8HA 4AY5A 3KVNA 4XR4A 5IYRA 4P4LA 4UMEA 3TXYA 3KKKA 4TZ0A 2IF2A 3GUZA 3P0IA 2Q7OE 2WP8J 4GKKB 4NJEB 1QH8B 1P2GA 4WKNA 5DHTA 3F5DA 1N07A 1HYGA 1MTZA 1NY5A 3AKEA 3HE3A 4OK3A 4X5OA 1H8HD 3O8RA 4FHDA 3FYUB 2J41A 3TQOA 4LXIA 1KZYC 3TW0A 1AT1A 2G28A 3ZVKA 1DKLA 4TLEA 1HE4A 3THYA 1ISFA 2DSTA 5A62A 4JV5B 5ALMA 2A9VA 2FWNA 4YAIA 4XRRA 4JJ4A 4M0DA 1JKFA 3DXXA 1BU5A 1O5IA 1QDEA 3EVBA 3OM9A 1C4KA 4K6FA 4ZYVA 2PUBA 2N3ZA 3ESRA 4LHYA 4D9NA 3AFIA 4OOVA 1GEEA 2NUAB 4B87A 5ECGC 1KSJA 1X1EA 1S2DA 1KYXA 4UUAA 1SCKA 2PUWA 3PHJA 2ERYA 2XUAA 2EOAA 1UJ2A 1BX1A 4BJ3A 2DUNA 2BFFA 4HNRA 1DWQA 5G40A 3ZBPA 2AI1A 3HLYA 2OCAA 1JE1A 1NMEA 2QGZA 4GR9A 3SHQA 1JLKA 3UYKA 4WN9B 1JU9A 1HF3A 2QRVA 3ORFA 1K3FA 3HY6A 1HQCA 2QAJA 5FHRA 5I8WA 2VYQA 2FPIA 1VJDA 4G84A 4U4AA 5C1DA 3ZW9A 4KB5A 3BE5A 4ZRDA 4DWWA 1LI4A 1SKBA 4Z3DA 4DKXA 2QW8A 4XLZA 2EZTA 2C5LA 2OMEA 2V96A 4PPYA 2ATVA 2P5SA 1IBRA 2ZI6A 3TQFA 1CQIA 2QTHA 4YRZA 1DEAA 3WKEA 3SM9A 1UOEA 5D3KA 4JI3B 2ZATA 4XVUA 4XR6A 2WYHA 3DD5A 4AVYA 4PTYA 3IDOA 1UK7A 1VKNA 5AW3A 2DPGA 1NXQA 2Z30A 3HCAA 4LXYA 1UPAA 2Q2VA 2LCIA 3D7RA 4MLPA 4YUAA 3U1BA 3FDIA 2J32A 4EKIA 3SVTA 5LLTA 3ENNA 1S6YA 2ZPUA 4KP7A 5DM60 2JHCA 3SQMA 2A0WA 3IV9A 5ED0A 2H4JA 2FSVC 4B8ZA 1U0LA 1A8QA 1VI2A 2P69A 3E84A 4ZU3A 5IVPA 3TLGA 1DX4A 1MHTA 1Q7EA 2PT6A 2AR0A 2CLIB 4FR2A 2VWPA 5CA0A 2OR3A 2GYYA 2J87A 1IM2A 3LC7O 4HZGA 5B30A 5C4MA 5KWSA 2VAWA 3THWA 1NMYA 2QRJA 4NBUA 2VLBA 4MR7A 3F3KA 1MNAA 3OPOA 4LCBA 5IN5A 3SZMA 4AECA 4N5LA 1KYWA 4X97A 1JYEA 5GQSA 1Z0UA 2ZTGA 1EWTA 2ZWVA 2J3LA 3JPYA 4PIPA 4YLYA 1HSZA 5AKEA 2J3EA 5JC8A 1ZD2P 3I53A 2HL6A 1H66A 4J2HA 3U31A 4TXLA 5BSUA 4LRTB 4EW3A 1P39A 3Q7IA 3F78A 2O5RA 3CUKA 4UZSA 1XVIA 4L8JA 1V26A 1GNPA 1SXJD 3DOUA 3O8QB 3OZCA 4X93A 4DG5A 5FO0A 2W98A 4GECA 4OSOA 2XYQA 4C7OB 1DRWA 2OQVA 1E3LA 3VPAA 5BUQA 5KREA 2GYWA 2RH5A 3G9ZA 5CLFA 2BFEB 4LXQA 2Q0QA 1P0PA 2ON6A 2EGHA 4OREX 3MMNA 3P5BA 4QLOA 3U1TA 3E8SA 4CG3A 1B3BA 4ZIRA 1KO1A 2BMVA 3TINA 4AJIA 4ARZA 1DI0A 1YBMA 5ECDA 2RJNA 3R3YA 4BN0A 3SXUA 4MMXB 5DDIP 3UTCA 1F5NA 4O33A 4AKHA 4EEXA 2DFKB 4E5YA 1EMDA 1NMQA 4KMMA 4FT4A 2OBXA 4DRXB 3VTZA 1G5FA 4LRQA 2WMOB 2NXNA 2OHFA 1JEOA 2VZEA 1JLLA 1PNQA 4UBJA 4DV3B 1CP3A 2FW7A 1SK8A 4KAXA 4MI6A 1T0UA 1RSZA 1AKEA 1M66A 1JFVA 1EJ0A 1HK7A 2QVYX 3F6SA 4OJMX 3MWGA 2OHHA 2SHKA 5DIZA 3TVDA 3WNZA 3VDRA 5KPJA 2IXDA 4TUYF 2FZGA 2GPYA 4L4SA 4Q4CA 2HU2A 2XNCA 5C1OA 4BQQA 1T2NA 1EWQA 4TVSA 4FZ5A 1I30A 5E6RB 4WOCA 4AWXA 3ENWA 1X7XB 4FM9A 2HMAA 4IIYA 4ZANA 5CG1A 3KPUA 5BY2A 3WK7A 1QZZA 2HADA 2IHZA 2PWPA 3L06A 3L8EA 4QU0A 3L04A 4QSMA 1Z47A 3RDPA 2BDUA 1RHUA 4WZZA 3FI0A 3IUNA 1JLMA 4C6TA 2OZEA 5D3MA 1RBYA 5FOQA 1U8UA 1UMCB 3WGJA 4YJHA 1NONA 4RKWA 3W2TA 4TMKA 4MROA 3V4ZA 4RIEA 4KOAA 2E4UA 2WF7A 1LKZA 1Z33A 4RXTA 4PFKA 1VLOA 3A14A 4OVKA 2M9MA 2DR0A 1CUXA 3A37A 1RFGE 3RK1A 3WYEA 2GYVA 4JIMA 3F98A 4H3VA 2P9HA 1WE2A 4V03A 4EOGA 1G41A 5D7NA 5GJVC 5B1DA 3ZNNA 4NH0A 2EKZA 4K3UA 2FDXA 3RO7A 1ZMOA 1E61A 1XFAA 3N58A 4MP8A 3CR7A 2HQ1A 2WTNA 4YJ2F 5JHHB 1HDGO 2W6NA 3T6KA 3ELWA 4I5GA 4BRZA 1I94B 2PN1A 3WLPA 2Q28A 4R9VA 3TLCA 1E7WA 2V4ZA 3TLMA 4HV4A 4HO1X 4C76A 5ESWA 1YF3A 2PZEA 1B3RA 5J4YA 1FTWA 2VIIA 1UC4B 4LE2A 5CH8A 2VG8A 1M8GA 3COZA 2AQ8A 3BWEA 2BFDB 5TXGA 5ICGA 5K3EA 1JUDA 3KWJA 3LBAA 3M1LA 5TNXA 3CPWB 2Z2IA 5FULA 2VZLA 3BB3A 1DJQA 2QUAA 2X6XA 4CT4B 3PXUA 4Z4ZA 2XUFA 2VXOA 2C2XA 3OA2A 2NZXA 3AH8A 3EHDA 4JBLA 3TKLA 3UOWA 5L51A 1W59A 4LHEA 2R6R1 2VYVD 4N0MA 4QU9A 1RRFA 4QUDA 4QYIB 2IUSA 2XPCA 3FSGD 1P72A 1EHIA 3FNIA 3AIIA 3BK1A 3KLNA 3PNLA 2I33A 4RFVA 3VR1A 1W47A 2O7NA 4BZXA 4MPJA 5ADVA 2X19A 4QA9A 2PT9A 4W5RA 1ADYA 1E1DA 4AULA 4AG3A 4IS3A 4N01A 3MWJA 1I24A 4YMWA 5AKGA 5H9VA 2FW6A 5TT0A 6ABPA 3PVCA 5E6TA 2PUEA 4EB0A 4YAWA 1C0LA 3DDOA 3B8HA 1ZJ5A 4YECA 4NV0A 1I5OA 1VQPB 3OTOB 1EX6A 2R97A 3ICOA 5BNZA 3OSUA 2C7OA 1P2DA 1LNQA 2IZOA 3GZNB 4KMSA 4EJMA 5JC1A 3OE1A 1XD2B 1EFVA 2HU7A 1RDFA 2QTZA 2PKCA 3GJXC 1ZD8A 3OZXA 1R0LA 4FHEA 4MARA 2FWBA 4WXRA 4Z9XA 4E5VA 3THRA 3THOA 2YV3A 5JAIA 4RXUA 1CETA 5A4IS 2V3WA 2C29D 1ZIYA 2IQ5A 3GJ7A 5EWJA 4CMIB 4L5BA 4F84A 5IU6A 5DCYA 4G5SA 1GSAA 5GZ3A 1HBJA 2B5WA 4IVPA 1ODLA 1MZVA 1PS0A 1RJEA 3TW4A 3MA0A 4WFQA 4NYMQ 1E2LA 4R7ZA 4M1SA 3UKJA 1J6UA 1GCOA 2CZGA 2GVNA 3LRPA 1VYTA 3U49A 1SUBA 2G9NA 3K0BA 1A1SA 3A3KA 4LG1A 5SYMA 1BFDA 3F3YA 2DR2A 1LTQA 1XEWY 1K8YB 3FIUA 2D6FA 1E9DA 1GZ7A 4OU4A 1M6NA 3LK7A 5IZCA 2J0SA 3OZGA 4DGSA 3HBLA 1IEQA 1XRJA 2ECPA 2ZRPA 1GNTA 1GZ5A 2D5AA 2RHWA 3A3NA 3GGDA 7AT1A 1KI7A 5TY0A 2VQ6A 4XUEA 5CLGA 5KNCH 4FI3F 5LNK1 3ER9A 5AVVA 1RKVA 3D4NA 4CLDA 4FHZA 1XDDA 2V59A 3TNYA 2AXNA 4NP6A 3O21A 1SY7A 4QEDA 2IEBA 4B79A 3BH4A 1QHXA 1Z2CA 3OOSA 2D0PB 4MAAA 1ID8A 1HE3A 2FUNB 4AWBA 4X7RA 1NVFA 1VDMA 4PLGA 5CDUA 5IDQA 4KTVE 2P4SA 2XEXA 2XIJA 3DEHA 2VF8A 4JSTA 2E3JA 4PGFA 4RIIA 3HJTA 1B00A 3UH0A 1IVNA 2A0XA 3ZI4A 5PNTA 2BGIA 1VSTA 5FOSA 4BFCA 1OF1A 5HK9A 1WU7A 2RAVA 2RIRA 4OHMA 2WWVD 4A91A 4OHYA 2J9ZB 3AHDA 1M8JA 3EUWA 2W0SA 4NNJA 3KYIB 5KNBD 3D4LA 3QELA 1L8LA 1OLSB 4HXFB 1L5GB 1R6TA 3PHLA 3BHIA 3A25A 2GFQA 4ZK6A 2FPGA 1U7DA 1N7HA 2JASA 3Q3IA 1ZM9A 2CY0A 4XCQA 2V6MA 3VU0A 1TQDA 3B9PA 2NZ2A 1VG0B 2WR8A 2DSNA 2QYTA 3MFYA 3JD0A 3WO0A 5DSZA 5I3CA 1YH3A 4F8JA 3NBKA 1PV2A 4RL6A 1YI8A 1EVKA 4I1RA 5TJHA 2J5QA 3RNLA 2KJQA 5HILA 4Y0VA 3C3JA 1KYZA 3G05A 3JQQA 1I4OA 1R8SA 1Y3DE 2BFCB 3EW9A 3NHKA 4HS9A 4MVXA 4WLOA 5HS4A 4RF4A 3WNBA 3S27A 2OYNA 3LVRE 3PIRA 1MXHA 3PR1A 4Y1FA 2IV7A 1V48A 2YTZA 2ZJ5A 3KTOA 1SD1A 4A5OA 2C4WA 4H0FA 2I91A 5J2TF 4NCHA 3FHCB 4E3ZA 1N0UA 2QX9A 2C88A 1Z2OX 3BGIA 4DAOA 4DJEC 2RHJA 3EIXA 2O7QA 1UBNA 4FFNA 2Z6VA 3O9ZA 3SHVA 5FNZA 4Q3CA 1NAHA 1E3XA 1CJMA 3DTVD 3JAWA 3VR2A 2OORA 2ZLBA 4ETIA 3QLEA 2QPOA 1DT3A 3CRZA 1E1LA 4JQZA 4GMDA 1Q0LA 2ZRDA 1DAGA 2CGEA 2Z3WA 1JLHA 3V2UA 4O6VA 2IGBA 3CMAB 3FFTA 1NJGA 1H3EA 5F51A 3JQ7B 3BULA 1Y1LA 4RJLA 3G9QA 1S4QA 1WY5A 4O2AF 3SIRA 1RM4A 3SEJA 3OPYA 1CF4A 4FEEA 4U8GA 2V6GA 3JALB 3L7BA 2WD7A 4D3FA 4ZV4A 4BQSA 1U2DA 4DV7B 1AKRA 1LEHA 3KD3A 4YJFA 3KDSE 4ZREA 4R2JA 4JI2B 1WM1A 4PC6A 3FBTA 3IIMA 3ORSA 4MINA 1OSNA 4P12A 2G1JA 2JFFA 1A9ZA 4BGUA 2NAFA 1WUIS 3OCUA 3QVVA 1IN7A 2HQOA 3OW7A 5F2OA 5EI5A 3FPEA 2VNHA 2DEUA 1UXJA 4MPPA 3ILVA 1GY8A 1CQZA 1MB4A 3KUDA 4OGFA 3EIHA 3L8ZA 5EP3A 2BTEA 1QGUB 3AINA 2GHRA 5KYKA 3PQ4A 3LP6A 2QB5A 1DV1A 2WJJA 3ENKA 4Q9NA 4U6SA 5FPTA 2PRIA 4NZOA 4TUYB 5LZ8A 4ZCIA 4I9HA 2ONKA 2D13A 4OOSA 1QKKA 4H1TA 1DWPA 5KZMB 1I9GA 2E21A 2BI7A 4XFKA 1XMPA 3I6QA 3E22B 1BCRA 2P68A 2OPBA 2G36A 1G8JA 3KOZA 1CTQA 1KJWA 2R9VA 1TOAA 3JAKB 1GFIA 2HIMA 1UD6A 3RBVA 1FRZA 2YYSA 4H18A 4UAVA 3TEJA 2X23A 3Q98A 3VU9B 3TZBA 2VJIA 1OTHA 2AG5A 1I5RA 4DC9A 2O8EB 1C30B 1O95A 5KSPA 2JK0A 1G8GA 2OQIA 1R88A 1TTPB 3T4UA 1BFKA 4Q1FA 1VYUA 5JTTA 2NADA 4BWFB 2ZI9A 4E4TA 4M38A 4QUGA 3NRBA 1GCGA 3O03A 5DTIA 4ODIA 3QKTA 3UJ8A 2IHYA 3ITEA 3LLVA 4YJ2B 2VK2A 5DLQC 4AB1A 2KBFA 3O3MB 5D5QA 3V8VA 4X95A 1XL1A 4ADSG 4GC5A 2HT1A 1J0XO 421PA 1JR3E 5C5EA 1XQ9A 4K26A 4JUCA 2PD3A 3CF4G 3S2ZA 3TTSA 1W2BB 3LAWA 1KI4A 3AEKA 4RHCA 4WZBA 3AUFA 3NT5A 3OQBA 5FBVB 4ER5A 3EGXB 5FTKA 1CG6A 1XNHA 5CYOA 3VNRA 3CU5A 1C4WA 3MOIA 3IJPA 4M8KA 4S2EA 3ZWBA 2X9GA 2PUVA 2ZRAA 2Q4RA 5JAMA 3KOMA 4DCTA 3LRXA 1N32B 1QANA 4LSMA 1T1GA 1NRXA 4OXQA 3V46A 3PPVA 1M2HA 4LKRA 5INTA 2FKAA 5EJIA 1Y7LA 2JN9A 2HAEA 4TS9A 3ABRB 4TXMA 5K3BA 2R1VA 1WKVA 2I3DA