2QN6A

Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the gtp and the gdp states
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
414
structure length
393
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 103
structure length 393
sequence length 414
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qn6A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qn6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qn6A01
3I72A 3GJ4A 4G1BA 3BC1A 4UNNA 1YJ5A 3NHBA 4B3BA 3ND9A 3OJWA 1LTQA 2DETA 1KGDA 1YZNA 3EX7C 1Z8FA 2JLVA 1G9XA 1N0VC 1CJVC 5AUPB 4YAOA 4XVQA 4JLBA 3AF0A 1HV8A 1JB9A 3AVOA 2BKEA 1K8RA 2XSZD 1E9RA 2ZS7A 2O8CB 1MO6A 1A4RA 3QFTA 4TLCA 5DI9A 3CPJB 4DIEA 3I5XA 4C2TA 4GZLA 121PA 1ZP6A 1M7BA 2ZU6A 2IF0A 1SZPA 4MH0R 5BXQC 3ZQJA 2ZRGA 3WMEA 5KSYA 1Z0DA 3QXHA 4TYWA 3MAAC 3EPLA 3AB3A 3QI2A 2A9KA 3IPYA 3RDPA 3UWOA 4Q1AA 4EPVA 1KMHA 1ZRHA 2FWRA 1FW6A 1R7RA 1K9MD 1OF1A 5HCNA 4G5GA 1Q44A 1U9IA 4AF7A 1XMJA 1ZC3A 4Q1DA 5CYPA 3EPKA 1GO2A 4NYMQ 4MGKR 2J7PD 3Q7PA 4ON9A 3IILA 1NLFA 1KY3A 3PFIA 3RRZA 2RAPA 1EP1B 1W87A 2WIAA 2ZE7A 4IVQA 2EU8A 2GZHA 3OEEA 4YMUA 3KQUA 1Z07A 3N2IA 1VG1A 5HR5A 3C14C 2VZLA 3EZ7A 3K8YA 5FI1B 2ZJ8A 1QRAA 2RKOA 4Z1MA 3RWMB 3BK7A 3ECCA 3REFA 1EFUA 3PEWA 1G8YA 2WAYA 4XSGA 2A78A 2NPIA 4Y9RA 1MT0A 3CX7A 4PO1A 4QGHA 4KXFB 2CEAA 5C18A 4RZUA 2WJIA 3GEHA 1WBBA 2CL0X 3TH5A 1JR3D 4HLUA 1CNEA 1K73D 1VPLA 1W2HA 5IK2A 1XE1A 1KZGB 3KJGA 4EH1A 4LV6A 5C2JB 3ASYA 1DAKA 2WJYA 4KU4A 3R8FA 2ZROA 4YMVA 4FINA 3I73A 4YMSA 2IYVA 4JVNA 4TL9A 1U0JA 1YVDA 5DN6D 4WOPA 1FP6A 3CCLB 2ATXA 1I2DA 3TUZC 3BH7A 1TF2A 5TVKA 2IK8A 3GJ0A 4X8HA 2BWJA 4DUGD 5BWMA 2O8CA 5DIFA 2BMDA 4BFUA 1TNDA 3ADCA 1M7GA 1B23P 4AWXA 1T8TA 2BCGY 1SKQA 1N5IA 3REGA 3X1DA 1WE2A 2Q3HA 3AV0B 4ZCIA 3EC2A 2GHIA 3RVBA 4M53A 3W5VA 2YV5A 4RVCA 3SZRA 4TLAA 2OO7A 5AR1A 3GQBA 4BRWA 5JJKA 1KI7A 3CNLA 3NH6A 3QBTA 4GI7A 3KKQA 1PLKA 1QHHA 1T3HA 3FFBA 4ZCMA 1G5TA 5FI0B 3ZC3A 3W34A 1CJTC 3EPJA 3K9LA 2BMJA 1KTVA 1FPMA 2NO7A 3BB3A 1P61B 4TSFD 5FTKA 4RD1A 5AJWA 3VFDA 3EPHA 2WJHA 3NC0C 2QTVB 1W49A 4LOAA 1HT1E 2J59A 5FBQB 1E79A 3K0FA 1OH6A 1JA1A 3Q7QA 5FTNA 3T1QA 4ASUA 1Q86D 1OW3B 1IBRA 1VCOA 4MQBA 3B9PA 2J0UB 3K70C 1VIYA 5SZIA 3B1VA 1T6NA 1TL7C 2OBMA 2VLIA 4M21A 1IY2A 2IW3A 4M8NE 4DQLA 1IJFA 2R62A 4URZR 4P4TA 3ZIAD 1XMVA 1NY6A 5ANRB 2H1LA 3OIVA 2QP4A 4NP6A 2I4IA 5EMNA 4TQ9A 4DB4A 1XPOA 1ANKA 2EFHB 1PLLA 1EFRD 4B32A 1HTWA 1XJ0A 5EP4A 3L0OA 4I1UA 2XITA 4Q4JB 1Z6YA 3OE7A 1DDIA 1XTJA 5E7JA 5J40A 2QT1A 4FWIB 5SZJA 3LW7A 4LBVA 2ODWA 4NBSA 1S0UA 4HAYA 3WHLA 2O8BB 4PC1A 4HEJA 1E2JA 2KE5A 2B8WA 3PV0A 2IBMA 2QROA 3I3SR 4WXRA 1JI0A 4OHVA 1RYHA 4ZDJA 4BGDA 2LKDA 4NTZA 4RJLA 2MSCB 2GCPA 3LD9A 4IDPA 4CVNA 3ZS8A 1HA3A 3CBQA 1M1YE 1VYTA 3CZQA 4M2LA 2FH5B 3MLEA 3ZVRA 1VCMA 2FG5A 1ZU4A 2FPMA 2W2VA 2ZUCA 1NBMA 1AGRA 3M1IA 3SJCA 4QG7A 4F38A 2VP2A 2P6UA 5FBVB 3SNHA 1YIJB 3HU1A 4LBZA 2ZI4A 1Z06A 4BUJA 1YRBA 3CCJB 2BKUA 821PA 3FWYA 4M9ZA 2A5GA 3V4RA 2BHRA 3D31A 4E09A 2Z4SA 2GJAA 2FGJA 3KJIA 4DJTA 2V7QA 2QM8A 2XNDD 3TR5A 2J0UA 3IO5A 3EZ6A 5BN5A 1LFDB 2D4HA 1Q22A 3A4LA 1GKUB 2C5LA 5KPJA 3LLMA 5D3QA 4G1VA 3WY9A 4AG5A 2OTLB 2IA5A 2YKGA 5KSWB 5FOTA 2WWHA 1YZUA 2W6IA 3B85A 3QXXA 4EUNA 4YONB 2G0NA 1IXRC 3OF5A 2DR3A 1OIXA 1ZMXA 1TF5A 5DYGA 1ZNYA 2YC2C 4QHYA 2OFXA 4RFSB 3RABA 2PJRA 3T15A 2ZJ5A 5LB4A 3IEVA 1COWA 1CR4A 4HAVA 2QE7A 3CRQA 1FNBA 1QVRA 1XBTA 2F43B 4L5BA 4BLOA 4BFSA 2ZRAA 1JPNA 4Q4JA 1MH1A 3GEEA 2A30A 3H4MA 1H8HD 3CC7B 2ATVA 2CLDX 1OHHA 3QG1A 4IXMA 3NBFA 1WCV1 3TUIC 2O8BA 1GSIA 4DCNA 2GDJA 5CB6A 1B0UA 3QE2A 4XD7D 4TYNA 3LVRE 1A1VA 2AK2A 2ZE5A 2YNMA 2IXEA 4D81A 3P20A 4AF6A 3EW9A 1RFLA 2D06A 2GEDA 4NZYA 3QFSA 3U7EB 4DLXA 4OHZA 1ZM3A 1IAQA 4LRWA 1G7CA 1R0WA 4LI0A 3VO1A 4PFSA 1F20A 4B3DA 4MKFA 5JCZA 4LHWA 5JI2E 1W4RA 1NMYA 3FFAA 2ORVA 2WMNB 1BX0A 1AS0A 1XEWX 4RZ3A 5KDLA 4A4DA 4OJKA 1GNPA 1E9FA 4C7OA 4B44A 2OILA 3VR3A 4QFMA 2GBLA 3KJEA 1TTTA 2RH5A 2ZYVX 3CMEB 1E9CA 3L0SA 1TEXA 2G88A 8OHMA 4ZV4A 4TLBA 1CXZA 1G17A 5JZVA 1HURA 3C5HA 3NVAA 1G3IA 1QDEA 3U7HB 1JNYA 5B58C 4DLSA 2FGKA 3CX8A 1J8YF 3U7GA 4CGZA 3NG1A 4RFSA 2IXGA 5FUVA 3OEHA 2GVZC 1N6PA 2PJZA 3C16C 2Z43A 4NYJQ 2FE4A 5CB8A 3P4YA 5DHFA 4DQKA 4PX9A 2DFLA 2HYDA 4IOKA 3GLGB 3A36A 2F43A 2O8EB 3ZD7A 4RFVA 3ZVMA 3E5HA 3VMFA 3A58B 2R6FA 1JQLB 4OQNA 3W6NA 3IHLA 4UXJA 4KV9A 3LXXA 1OXVA 2XNSA 4QGGA 4LJYA 2QUZA 3N2EA 4E5UA 4E03A 2FSFA 4QL3A 3WNDA 2VNKA 3BD9A 3LLUA 1OH7A 1N6KA 3AUXA 2PX0A 1W4BA 3T12A 2UVQA 1KDPA 1XEWY 2YZ2A 3EWSA 3GJ8A 3KB1A 1EG7A 3L43A 5G3YA 3HWSA 2ZRNA 1SVLA 1QG2A 4F91B 4M9SA 4TT3A 4KITB 2VSOA 1LVGA 1T0HB 1VCNA 2FN4A 5JSZB 4WW0A 2QTLA 3W5HA 1BYUA 5K8IA 2OFWA 4Q03A 4EPTA 2WWXA 1RYFA 3QOFA 2J0QA 4N0DA 4FCVA 3EIHA 2G1JA 2BDTA 2J7KA 4OI4A 2VYQA 2RGDA 2YOFA 3GJXC 1BJKA 1NVVR 1G5RA 2ZYUX 1QF9A 3QF4A 2VNHA 3PUZA 1KK0A 1J8MF 2OBLA 3FYHA 5FL7D 1SVMA 2A2ZA 2W2TA 1Q57A 4DBLC 1G4UR 3I56B 1QVFB 1H85A 4NCKA 1BMFD 3LX8A 4BQSA 4B48A 4CYMA 2C95A 3ZGXA 1FNNA 2QEXB 1TQ2A 4KBFA 1IXZA 2OSBA 3FPKA 3GLGA 1NNEA 4RD4A 1YJ9B 1Q1QA 2PT5A 2O8EA 5B30A 2DPXA 1TU3A 1VYUA 3QXJA 1TLLA 5KHOC 2WKRA 1P60A 1CR1A 2ZRPA 3QKTA 5AWFC 4DRZA 2O0KA 3FJOA 1Y63A 5L3VA 1KK2A 5F2EA 4AC9A 3J81k 1E1QD 1F3OA 3BERA 4E22A 2SHKA 5G40A 1CR2A 4KJZA 2IYYA 1KJYA 1L7VC 3NIBA 1W0KA 4LY6A 3B7GA 1IONA 1VG9B 2ZUBA 3WP0A 2V1UA 5JS7A 3CRW1 1X8LA 3FMPB 4C3ZA 2ZRBA 4GL2A 4JT2A 4L9SA 2B8TA 1XTKA 1Z63A 1A2BA 1OKKD 4MRPA 5JSZA 3CCSB 2J5XA 2QDXA 3P27A 1OV4A 4BFXA 3FMIA 3ZZ0A 1GIAA 2CDNA 2PMDA 2V55B 4G5OA 5EP1A 5LPNA 2QA4B 1DEKA 3AF2A 1FX0B 1EWYA 1MRNA 2OUKA 3TAUA 4IRUB 4TLEA 5EP2A 2EFGA 4LBWA 1N5LA 5FBRB 3UPUA 1NRJB 3KX2A 3D6TB 3F8TA 3IBGA 1RZ3A 2FFQA 3B6EA 3JZMA 3TBKA 2JDID 5L3SB 3HP1A 4YAUA 1E1RA 4DB2A 2JATA 2VQSA 2EWVA 2BEJA 4D0GA 4GFDA 1ONBA 5L3RA 2PT7A 1X3SA 3E1YE 1NP6A 1R8SA 1GOTA 4GRAA 2NZJA 3AVXA 1GRRA 1XB2A 3UKDA 4KFSA 2IYSA 1YI2B 2CNWD 1DADA 6Q21A 2W83A 3CR8A 5EE0A 2RGXA 1GITA 3K70D 1CF4A 2CHQA 1W5SA 2IHYA 5AJZA 5JWRA 2GKSA 2QL6A 2OZEA 1RW4A 4P6VF 1A2KC 2QAGC 1DVRA 4GMXA 1NMXA 1G6HA 1R0XA 1UADA 1E2QA 5JFGA 4IVRA 2IS4A 2Q6TA 2XEXA 3KKOA 3IGFA 3DM9B 1GL6A 4D0LB 3O8CA 4OI1A 2ZITA 4DLVA 2Q9BA 4U02A 2FNAA 2IT1A 2IL1A 2BCJQ 4PPNA 1VYVA 4QBHA 3I8SA 5JS8A 2FFAA 1MABA 2X2EA 5FOSA 2PEYA 1E2EA 4ACAA 1D9ZA 4KI0A 5HKKA 4G0NA 4GDFA 1FNCA 4R2HA 1NJID 1G291 1Z08A 4LZZA 4BEBA 3P4XA 1RJ9A 2ERXA 4W5HA 2D7CA 1BQEA 2CJWB 4W7SA 1FNMA 1K8AD 1Q3HA 2CE2X 4RCZA 4GZMA 5GVRA 1S1MA 4JIMA 2IEZA 1UBGA 1U81A 4D2IA 1KI1A 1IOZA 1FX0A 3UANA 3QQ5A 1QFJA 1G8FA 3RANA 1Z47A 3UMRA 2FX3A 2C9OA 4BWYA 3CCVB 2VHJA 2G9NA 4HAZA 1CTQA 5L3SA 3VQTA 1R8QA 4NMMA 2CCKA 5KSOA 3CPEA 4FW9A 3ZQ6A 2AD1A 1UBCA 1FDRA 2C9YA 2FV8A 4A0FA 1G41A 2JCSA 4K46A 3I92A 3OIYA 3PEVA 3TSOA 2OFOA 4ABYA 1SGWA 2OESA 4M9QA 2J45A 2ZM5A 1XRJA 3THWB 1DE0A 3IQWA 1BO6A 4X8LA 4A2WA 4C9BA 5IK2D 4F4JA 1I2MA 3KDSE 4DLRA 1PV4A 3DEFA 2DCUA 4QGAA 1Q1BA 5FOUA 1KI6B 5AJYA 2XB4A 2BBWA 3H0KA 1ZD8A 4DT1B 4WZBE 4LHZA 3K0AB 4I1OA 1AJEA 3BOSA 4O2RA 1JAHA 1KMQA 2C98A 1ZUHA 2B5OA 3AKYA 4GNKA 421PA 1Q20A 2V54A 3P32A 2QMHA 5IT5A 2ODBA 4Q9JA 1P2UA 1U98A 4Q1FA 5FUWA 1X1SA 3RAPR 3UG7A 3AKCA 1HE1C 4NCIA 3BBPA 4C30A 5UKDA 1KO1A 4HUQB 5JRJA 1NI3A 3HR8A 3Q3JB 4MRSA 5M04A 2CE7A 2CBZA 2D2EA 2W0SA 3MUFA 2QZ4A 1GZSA 3V76A 1KI4A 3OAAA 3B1ZA 2CJWA 2HEIA 4A8JA 2E87A 4NCNA 2ZI6A 2DWQA 4ACBA 3A1SA 1NVXQ 2ZAOA 2NG1A 2J0SA 2QA5A 1BYIA 3PUXA 3B5JA 2CMKA 4PO9A 4QRHA 3JQPA 3PUVA 2GAAA 3EC1A 2GZDA 1G5PA 4U9UA 4Q1CA 2KSQA 2BSAA 1UKEA 3AEZA 1XEXB 3Q5EA 5KPDA 1VQ4B 1RRCA 3BIFA 1SXJB 4YXWA 4IEEA 3VR2A 1BKDR 2BBOA 2OCYC 4EPYA 5CDFA 1G8PA 2MSDB 2B6HA 2BMEA 4AK9A 1SVIA 3CNNA 2VNIA 3THWA 3NWJA 1QX4A 3B1XA 1Q82D 4ILEA 2ECKA 3C15C 1WA5A 3FVQA 2YVUA 2IUUA 5G3ZA 3G4SB 3GCGA 4M9XA 1KI6A 4S2EA 5AUOB 2WPDA 3TW8B 4DT1A 3CWQA 2H17A 2FOLA 3K0AA 3W5JA 3GMTA 5HZHA 1YHQB 2ZI5A 2Q9CA 4BPRA 5CK5A 1G18A 4DDVA 2DERA 4YMTA 4Q02A 1BOFA 1XP8A 3DKPA 4ZDWA 4NCHA 4POAA 4GOXA 3IPXA 1H8ED 4HUQA 4EJSC 5B64A 1NBMD 2BEKA 5CK4A 4HB3A 4EFMA 4QM7A 4PSKA 1EESA 4GOJA 4XTCS 3ZDQA 1T5LA 1VQ9B 2WBLC 1KO7A 3BS4A 4LYFA 2PZFA 2GCNA 3K09A 3T34A 4K81B 4LJ8A 4I99A 5TR9A 4C2UA 4HE5A 2QP3A 1XF9A 4A0HA 2XAUA 1EFTA 2QG6A 3G82C 2ZSEA 3TNFA 3SR0A 3W8RA 4MYHA 4Q01A 1Z2AA 2DWOA 2JGNA 2IS6A 4DDWA 1IY1A 4US1R 3AP3A 1XEXA 4M0LA 4DLZA 2RC5A 2GJKA 2IXFA 5IRCD 1SXJA 3BE4A 2MSEB 1LS6A 3GEIA 3M0EA 4WIAA 1OYWA 1N6HA 3BFVA 5H8WA 2ZVPX 4TLDA 3K0CA 1HUQA 3O8DA 4JLKA 5FL3A 4HUTA 2ZI9A 3RS4A 1R5OA 4XWKA 3RS2A 1XFAA 2VP4A 1KKMA 4F4IA 5CLLA 3AVWA 2VO1A 3B13B 4KSBA 1VECA 1DBSA 1OHHD 2ORWA 4G5RA 4A36A 3K53A 4PQFA 4PO8A 3SYKA 4H9GA 2WSSA 3PXGA 2EYQA 1FUUA 1QFZA 3JQRA 1VQ7B 2ZRLA 3GLIE 1ZIOA 3R9IA 4GPTA 1YR6A 4PZZA 5GV7A 2WZQA 5FUXA 3RHFA 1NJFA 3FKQA 2ZS8A 4B3CA 2R8RA 2V9PA 4EPRA 3VR5A 4MRNA 1WMSA 1FQKA 2OEPA 2RB4A 1EP3B 1L2TA 1W4CA 2FF7A 2JAQA 2KWIA 5CITA 2QTZA 1SKYB 3T5GA 4QM6A 3D3QA 3U6BA 2OCPA 3NXSA 1DAMA 1DELA 4HDOB 2ZE6A 2F1HA 4DCTA 1N0WA 5A4JA 3CM0A 1QHHB 4EIWA 2VHTA 1P3JA 3O8BA 1B2RA 3CKLA 1JA0A 3U7FB 1OH5A 2FZLA 4M1WA 2A5YB 3WYGA 4EQ6B 4AKGA 3EASA 1VQLB 3K0FB 4Q7JB 1NF3A 1ZC4A 2F3TA 4QXAA 3SFZA 4JLDA 5EXSA 3VKWA 4MRRA 4R7ZA 3A37A 4OQMA 1PVOA 3HPQA 2PCJA 1F6BA 1CR0A 2YWFA 2C03A 4JBYA 4Q7KA 3CCEB 2AN9A 2ZYWX 3GFPA 2F7SA 1R4AA 2IYUA 1TVCA 2C77A 2VPPA 3OEHD 3U3KA 4UXIA 1A7JA 1CIPA 2CLCX 2NMVA 3ES9A 2Q3MA 1S3SA 4LPSA 2DFNA 2EFEB 1U8ZA 2AXNA 2I1VB 1WBDA 5E7IA 1CJMA 4IDNA 4LHVA 1NVUQ 4ZKEA 1RPZA 4B2LA 4IW3B 1RVDA 1U8AA 3MWJA 4JBWA 5EUQB 2F55A 2IS2A 2H18A 4PANA 3TUJC 1KO8A 5C1BA 1W47A 1S72B 1P5ZB 1ZM9A 1AKYA 3T1VA 4PC7A 3DDCA 1G1MA 1JR3E 3NDPA 3I32A 1YJWB 2Z4RA 1M34E 3CCQB 1E64A 1UDXA 4AD8A 5JWOA 3PJRA 1Z83A 4UNQA 4JT4A 4GMDA 5BN4A 1ZCAA 3LRPA 5FA6A 4PQYA 5DISB 2IWHA 4NPHA 2P5TB 1W46A 5HTKA 1HEIA 1Z2CA 2IWRA 5EXTA 1K6MA 4NDZA 3S1AB 2P3SA 3GFOA 3ADDA 1Z0JA 4M1YA 4A82A 1WRBA 1P4SA 4IOJA 2AKAB 3ZH9B 3SU8A 1SXJC 3C5CA 1AK2A 3THOA 2EYUA 1I4DD 2ZYTX 4E07A 1EK0A 1ZU5A 5EXPA 3R7WB 4PC2A 3BFKA 1U2RA 1NDHA 2ZJAA 4EQ6A 3CRVA 3NEJA 4QJ4A 5TARA 4FN5A 5JI3E 4J0QA 4LJ6A 4WA7A 4QJ3A 1YZTA 4KFTA 1GWNA 3MWKA 3H86A 3NBYC 3ZZTA 1FMLA 2G0TA 5KDDA 3AGPA 5L8VA 1NMZA 2FMXA 1NN5A 4U00A 1NIPA 3THYB 4LHYA 4A2QA 2F6RA 5A5GA 4KHZA 2R6GA 3U5ZB 1AQUA 1LB1B 4B33A 2RGCA 5FUYA 4RKEA 2HMAA 3CPWB 2JLQA 5JHHB 4EPWA 1OGJA 2OHFA 1JJ2B 3BWDD 2PH1A 2VEDA 2WICA 2QEQA 4GP7A 4PHTA 4QOSA 1GRNA 3BGWA 4B43A 3BRWD 3V4FA 2AR7A 2WAXA 4GT1A 5LD2B 3FOZA 4V0KA 2GK6A 4FI3C 3LO5A 4F4CA 4D4JA 4M1OA 1GM5A 3ICEA 4M1TA 2V1XA 4NYIR 2BV3A 1OFHA 4LWZA 4CRWB 4EKDA 4M4SA 3G71B 3MG9A 4JVMA 1KO5A 1JXMA 1XCGB 1W0KD 1TUIA 4M1MA 3F5FA 1U9IC 2WWFA 2D2FA 2KJQA 1DAGA 3L8ZA 2C8VA 3DZ8A 2HT1A 3FPAA 4BLPA 4OKSA 4MGIR 1XWIA 3U44B 4Q7MB 5C4MA 4LBYA 2NGRA 5KSPA 3S1AA 4A9AA 3GLIB 2NO9A 3FMOB 2AKYA 4L4UA 4YALA 5CIQA 2BGIA 3LX5A 5FTMA 4M22A 3PUWA 4A0RA 4UJ5A 4C0HA 3Q9LA 3R7WA 2JJ1A 2ZAMA 3CRRA 1N6RA 1Z28A 1KYIA 1XJQA 1E1RD 2PMKA 3SQXA 3VO2A 3LFUA 4C7OB 2ZI7A 2C04A 3CWZA 4HLUC 2BBSA 4UJ3A 2QQ0A 4HAWA 4FD2A 1YR8A 1UKYA 3K9HA 4B34A 4KVAA 521PA 5AJVB 2GILA 3CF0A 2YWHA 3PQCA 3GLFE 2AFIE 3E70C 4NE2A 1N3BA 2O8DB 2BJVA 2AWNA 1GAQA 4C0LA 4CW7A 3THYA 1Q3TA 3CRMA 4B2IA 4OI0A 3Q8XB 1II9A 5BW8A 4S35A 2DHRA 2F1RA 1E32A 5KUTA 3LQRA 2BOVA 3LBIA 3KQKA 1F2UB 3FGNA 3L2OB 1Q21A 5FPTA 5BQ5A 2R2AA 1DPFA 3HR7A 1NIJA 1KJZA 2GXUA 4HB2A 4ITRC 1DAIA 1E2NA 1XTRA 2LKCA 1N25A 4IVPA 4XWOA 1G64A 3IUYA 1KDRA 5CJ2A 2ANCA 1JPJA 3WNCA 3IBYA 3D7MA 1VTKA 3QEOA 4P32A 721PA 2CRVA 2OTJB 1AZSC 2V6IA 3OZVA 1ODFA 5DI3B 1OJLA 1Q0UA 5E95A 3N70A 5JCPA 3CO5A 3TLXA 4DZZA 3U44A 1VG0B 1ZM4A 1EFCA 1GJRA 4C4PA 3GLIA 2GXQA 1S8FA 3QENA 4QHTA 3WXMA 2H5EA 1P73A 4TMWA 3LVQE 4B6FA 5H68A 5KNBA 1K5GA 4ERNA 3X1ZA 3CR7A 1U99A 4DCUA 2EVWX 3BB4A 2Z5FA 4LYJA 3CF2A 4Q48A 2IX3A 3Q85A 1VHLA 1ZYUA 1MKYA 3CONA 1Q1ZA 1ZUIA 2OXRA 2RGGA 2WWGA 2XSZA 2ZJ2A 4PPFA 3ZZUA 5FPSA 2Z6VA 3E1SA 3NKVA 4NU0A 1WB9A 3KUCA 1J99A 4Q00A 3N5CA 3U3JA 3KKNA 2MMCA 4XIGS 2O8DA 2CVFA 2CK3A 3M6AA 1NN0A 4FK8A 2EQBA 2QPTA 3QF4B 2OCAA 3AUYA 2JLRA 4IDOA 1OXSC 1UFQA 4CT4B 3SJZA 3JVUA 3RC3A 4KSCA 2PLRA 3ADKA 1OXXK 1E2LA 4D4LA 2H16A 1F2UA 2QRZA 2ZTSA 1OSNA 1CLUA 2FSIA 5G53C 4OQXA 1G4AE 2ZETA 1GUAA 2J7PA 2EWWA 2OK8A 2WVJA 1N5KA 4WXPA 3GLHE 3CB4A 1AQYA 3EXAA 4A0GA 1BIFA 4PTLA 3U3OA 1E2PA 4RCYA 4A15A 1W44A 4Q4LA 4BPBA 2BN4A 1LS1A 3T5DA 4B75A 3FB4A 4DEXA 5EXXA 1SVSA 2Z83A 4KFUA 4HB4A 3U60B 3WMGA 4BFWA 5DI3A 2OT3B 1P7CA 1JJVA 3SS8A 1P72A 1QVGB 1Z6TA 1FMJA 1L8QA 3KQLA 1WP9A 3OAAD 3TQFA 2OAQ1 4P33A 1KRHA 2ZSBA 1W36B 1AN0A 1XZPA 4DLWA 1TX4B 4JYCA 5FTJA 3BORA 4HI0E 3G5UA 4LK2A 2OK7A 2DFTA 1CEEA 4YQFA 2ORIA 2KBEA 1E9SA 1CKEA 2GXSA 5CIWA 1NG1A 2Q3FA 2HLDD 3VR4A 3ZJYA 1JQJC 2GETA 4ZI3A 3AP2A 4Z51A 1J2JA 2EIXA 2BM0A 1G3UA 2IUTA 2IYQA 2QTHA 4DUGA 1E2DA 2QSZA 1GVHA 3EAQA 1EX7A 4JSYA 4LPKA 2QT0A 4PPGA 2KI5A 1X6VA 2ZR0A 3HU3A 5B2ZA 1MRSA 3QKUA 4I1SA 3ZBTA 1DAEA 2F9MA 3A1TA 1E9AA 4HAXA 3EZ9A 1YJNB 5K8UA 1OE0A 4DEYA 4YDSA 1Z0FA 1P75A 1P9WA 3DZDA 3VHXA 2J87A 2WPDD 2R65A 2C9CA 3GLFB 3A4NA 4BZPA 1LNZA 2LWIA 4C0SA 3TE6A 1QGYA 4WBSA 1XJCA 4TQAA 2P6NA 5KSZA 5JJIA 1CJUC 1VQNB 2HV8A 5D3MA 1XTSA 3PITA 3M4YA 4TMZA 2VHCA 4AKIA 3I8XA 1F48A 3F3YA 2BC9A 4RKFA 1E9EA 1A8PA 1E96A 4QKQA 5L3QA 5JHGB 2D62A 1TADA 1JB1A 3EIQA 5IDVA 4JS0A 4X8MA 2UZ3A 1CQXA 5IF9A 2HCJB 1MABB 3GJ5A 2GBLC 4N3NA 1OLOA 5H1YA 3ZIAA 2O8FA 2OBNA 3LAWA 3L0IB 4IFBA 2DBYA 4V0ME 1DOAA 5JBQA 1GILA 1RJ9B 3WP1B 4TYPA 1E62A 221PA 3AM1A 1YR9A 3GJ3A 4QHSA 3IO3A 1ZBDA 3ZBUA 4L9WA 4Q47A 4TWZA 4MYTA 2IUSA 3SC3A 3FDIA 5FOVA 3NEYA 3AVUA 3KKPA 4PHGA 5ELXA 4ZDKA 2QM7A 3WBJA 3QNUA 3GJ6A 3UG6A 2NO6A 3TVDA 2A7QA 5C4GB 1KK3A 1II0A 3B2EA 1SXJD 2IHBA 1K5DA 1T0JB 2H7VA 4D4KA 2N46A 1QG0A 2REOA 4PC6A 4Q5IA 4II7A 2XZLA 1TF7A 1SVOA 5J47A 1YZQA 4QNMA 2F1IA 3GLFA 3U3MA 1MV5A 3MWLA 4OYHA 2FA9A 1GNQA 4RZXA 1VHTA 2GJ8A 1SULA 3I55B 5K8LA 2XXAB 1O3YA 3A4MA 1TPZA 2GCOA 5KYKA 4DKXA 2QTFA 2WKPA 4NCJA 4IKEA 4BZXA 1HQYE 1JXOA 1VQOB 1CS4C 3F0TA 2F9LA 4RSGA 2AXPA 2I3BA 3HYRA 1TQ6A 4FMCB 1W1WA 4KODA 3W8NA 3GP8A 4OK5A 1VQKB 1W35A 1NY5A 2YWGA 1XD9A 1AS2A 2VSXA 1NN1A 1NKTA 2VF8A 3ICQB 3LY5A 1N6IA 3U4QA 2ZIAA 3RRMA 2WMOB 1Z22A 3EZFA 3CZPA 1OB5A 4F92B 1IN6A 1ESNA 1NVWQ 2H57A 5K8TA 2RMKA 1IJEA 4A8JB 2DFKB 2BM1A 1GFIA 3KJHA 3PUYA 3O47A 2XTMA 1Q7YD 1IY0A 4OQLA 3OEED 1H8HA 1OXUA 1TUEA 2ZJZA 1RRPA 3JVVA 4DLTA 2J46A 1WDTA 1L4YA 3I5YA 3X1YA 1ZJ6A 2ZSAA 1FOEB 2EW1A 2Y8EA 3K1JA 2NZ8A 4JLPA 1JBKA 2JASA 4Z1MD 2XOKA 3X1XA 4TMKA 1E9DA 3ZYCA 1MO4A 2C96A 1U0HC 4ESHA 5TXGA 4Q66C 4OHXA 3TIFA 4CIDA 1CBUA 4HDCA 4MYUA 2FEMA 4IXNA 2QI9C 4P3YA 4V0NA 4NHOA 2BJWA 4BECA 2J41A 5H70A 1CNFA 1JAIA 1G3QA 3PG5A 1GAJA 3OZWA 1KSFX 2GWHA 5SZHB 2DEUA 1KD1D 3QKSB 4BE7B 3NBZC 4KVGA 3CF6R 2D3WA 4EDHA 5GV8A 1KO4A 2XXAA 2NPFA 1W36C 1E69A 3R20A 1YZLA 2GF9A 4QBFA 2EFCB 1D2NA 5KNDA 2C2HA 3MWYW 1FUKA 2P65A 1VQ6B 2HF9A 3LV8A 4US2R 5AJXA 1E2HA 4NONA 2RGNA 5GJVC 1Q1EA 4NKRA 5BYJA 3UMSA 1EXMA 1QHIA 3V00A 5CM9C 3U2QA 2A5FA 1Z0AA 2GF0A 3LW8A 4P4UA 4Q7LA 3A1VA 4TTPA 4DIDA 3OHMA 2W00A 1OIVA 3T61A 3U3RA 2ASEA 4LJ4A 1AZTA 1ZIPA 3R9WA 2QORA 4B73A 3FTQA 4UNRA 1PLJA 3K9GA 1E79D 2HUPA 3E2IA 1FTSA 4ASUD 4KBGA 4FMCF 1XCPA 4LYHA 2PZGA 5B57C 5FPHA 4URXR 4MDEA 2RGAA 4C43A 3GJ7A 1TAGA 4QJ5A 4Q18A 4DSTA 1KSGA 2VP9A 4DHEA 3ZD6A 1F2TB 4D4MA 3G6EB 1E0AA 4JBXA 3BH6A 4WQMA 1PZNA 4B76A 1D8TA 4P0TA 3H1TA 5DH9A 5HZKA 2QRNA 4JLOA 5SZKB 1KI3A 1NG9A 4Q9IA 4Q9HA 2D7DA 2RCNA 3C7KA 3TGPA 5AK0A 1T91A 2MMGA 3QKSA 3V9PA 1L4UA 3OE7D 1OH8A 3GD7A 1XPUA 5C46F 5EE3A 1YU9A 1N8RD 4JL5A 1GTVA 2JIZA 2PL3A 3TK1A 4A6PA 4URVR 1E0JA 4W5JA 5EE1A 3AF1A 1ZUNB 3QY0A 3IEUA 2QENA 3VR6A 2KB0A 5LBIA 4O25A 4OQFA 2N42A 4H1VA 4TTRA 2K5UA 3WYAA 2VRWA 3P1JA 4BEJA 1YKSA 1PUJA 4FMDB 5H59A 1DARA 1ZD9A 1J9ZA 2ZUDA 2ZJBA 4KLNA 1E0KA 1XD8A 2G6BA 2IC5A 3QBVA 4NH0A 1ZW6A 1AS3A 4ZGNB 3HPRA 3OZXA 4WZ6A 1HE8B 2QY9A 1EGAA 3L8YA 5JEEA 1GVNB 2RGEA 4EPXA 1G7SA 5J4HA 1JR6A 2DY1A 3E20A 1NBME 2WJGA 5HE9A 5THXA 2YOHA 4DVGA 3CNOA 3RSLA 1ELOA 2B7CA 4KO8A 2V7QD 3VNUA 3KB2A 5TDHA 3AGQA 2WHXA 4X8OA 3KZ1E 4G1UC 4NYMR 4G3XA 4K8OA 4L8GA 4LJ9A 2ZJOA 1XU4A 2ZQ5A 1F2TA 5GVSA 3ZVNA 2W6ID 2V8OA 3IKJA 1SHZA 3CX6A 3KTAB 1FZQA 3TAHA 3IIJA 3QKRB 5KU1A 1R0ZA 3HU2A 4I4LA 4JKYA 1E2KA 1OKKA 4ZKDA 4UKDA 5FBLB 1COWD 3W2FA 2QSYA 4CT5A 2WOJA 1OYYA 2QE7D 3PEYA 1XMIA 4AIIA 1G7RA 2ZRJA 3ND8A 1R6BX 4BFYA 2IYTA 3MFYA 2JJ2A 2E1RA 1JEEA 4PSVA 1M74A 2O5VA 1RC8A 2ZRKA 2JDIA 2IYLD 1S3GA 1KI9A 3HJNA 2G83A 2OCBA 4JL8A 5CM8B 3AVQA 1X8KA 4A8JC 4MGZR 4HB0A 3C4JA 1XPRA 5GADl 2BF4A 3I1FA 2Q21A 2WSMA 4OL0A 5GJWC 3CIOA 3QG5A 5HE8A 4DSNA 4PGOA 4KFRA 2N1BA 5LDDC 4RZ2A 3CCRB 2R44A 4IDHA 4C0JA 4HLDA 1EWRA 2CNWA 2H8KA 3QPVA 3TMKA 5FTLA 2ZRDA 4LUCA 3I61A 2VSFA 4L16A 4TZ6A 1KDOA 3JQQA 3SJBA 4FCWA 4XH9B 3JZAA 3EIEA 3B60A 3EA5A 2I1QA 1T9HA 4YMWA 4Y9UA 4BFZA 2XNJA 3CC2B 3OZUA 3CRZA 1WF3A 5TMPA 1QHSA 1SM4A 1M2OB 3NHAA 3QVUA 3L0PA 3UATA 4FMDF 4G5QA 1QFYA 4TMTA 5E4FA 2CK3D 1T3SA 2BPOA 1E98A 1D1NA 1VQ5B 1KOFA 1SVKA 4CZ2A 4CEJB 3AVTA 4JZKA 2ZPTX 3KTAA 1OXTA 3W6PA 2OM2A 1QGZA 4W5WA 3QKRA 4EFLA 1XEFA 1S96A 1YR7A 2W6JA 4LC1A 4B35A 1YZKA 1CRPA 5FOXA 4FCTA 4O2LA 2ZSFA 1KAGA 2PEZA 4C0KA 2GNOA 2P2LA 2A5DA 4HZUB 3BH0A 4N0EA 2A3RA 3LBNA 3LQQA 3NDBB 4XJXA 3OIUA 2GEVA 4PR0A 1VG8A 2C99A 2HJGA 4XTRA 2XTZA 3SE0A 4CF7A 3CXCB 4BRUA 1E4YA 2REBA 1QG4A 4TMXA 3RRNA 5J4LA 2PLFA 2FSGA 2VBCA 2ZR9A 3K09C 4Q4AA 3UMFA 2VIIA 2ERYA 1YZGA 4KYIB 4D0NA 4RD2A 3NH9A 2FJUA 1W48A 1ZNXA 4U7DA 4IOLA 3KUDA 4RD0A 1N6OA 4YAWA 4AKHA 3NBXX 4TT3D 3ZVLA 5BN3A 5J5CA 1E2MA 5KDOA 2GJSA 5TY0A 2NTYC 3P26A 4Z8XA 3C8UA 3OJXA 3R8CA 3W2HA 1ESMA 4BFVA 4GP6A 2IEYA 4LJAA 3RS7A 2WTUA 2ZRIA 3CMAB 3EARA 1U8YA 1XXHE 3FMFA 3K0CC 1JALA 1W0JA 4LV8B 4HYYA 2UZIR 2WWIA 2VA8A 2BBTA 1HT2E 3DO6A 4Z8YA 2NO1A 2PBRA 1VIAA 4PZYA 5F9FA 2XZOA 4CEJA 2AL7A 2A5JA 5J4KA 2WWYA 3CCMB 2DYKA 2PIAA 3HDTA 3QPUA 2RC6A 3KKMA 3SN6A 5CYOA 4RY2A 4A2PA 3T1TA 2QMEA 2QPAA 4MITA 1GKYA 4TYQA 3SYLA 4JL6A 2YINC 4HZUA 4CEIB 1YITB 2D74A 3THXA 3AVPA 4D82A 3K9NA 4ZGQB 3AVYA 1NSFA 3SFVA 2FPKA 4JMPA 3VTKA 1XX6A 2WM9B 3CH5A 1E3MA 1ZVQA 1J90A 4D80A 3QXCA 5KNCA 3B1YA 3BAFA 3UK6A 4PAQA 1R5NA 3GLGE 4CEHB 5DNYB 5EP3A 3KL4A 4BLTA 3AF3A 4C0AC 1C9KA 4DLYA 2WKQA 4MA4A 1F5NA 3QSYA 3AKDA 2R9VA 1W4AA 2QN6A 4DDTA 1W36D 1IB0A 2ANBA 3W90A 1YRAA 2ZE8A 4PQRA 2GJ9A 1N6NA 1Q12A 3AQ4A 3H2YA 2AFHE 4C0BA 4DDUA 1QHYA 4Q21A 5CLQA 2O52A 1W7AA 2ONKA 2X77A 3W9YA 2QBYB 1XZQA 3A8TA 4LCBA 1U90A 4UNSA 3LH5A 2X2FA 2ZVQX 1JJ7A 2HXSA 3IIKA 3MD0A 1NL3A 4A92A 1Y3AA 3WNBA 1XNJA 1ZNZA 2OG2A 5FPKA 3WHKA 3MSXA 1YHNA 2OLJA 1DG3A 3TRFA 1KC8D 2QU8A 2OE2A 1CULC 2B7BA 1HY3A 4C0QC 2NOAA 1C1YA 2G3YA 2YHSA 4JVLA 4N3GA 2CL6X 5JRZA 1LW7A 1UEJA 3DVLA 4ZO4A 3SJAA 4V0OA 3MMPA 4BZQA 1H8EA 1QH0A 3A1UA 4HZIA 1H42A 3MRSA 3PVSA 3DPUA 2RGBA 1D6JA 1J70A 4QGFA 3RS0A 4BLSA 3ADBA 2QQEA 3PR1A 2QPOA 3PCRB 4CEIA 3K0SA 1N6LA 1II8B 2GA8A 3O8RA 4OHYA 2ONJA 4JYBA 1YQTA 3W3AA 5J4YA 2BMWA 3UXMA 2ODNA 3VKGA 2F1JA 1KHTA 1G16A 4NYJR 3MCAA 4IOMA 3WRYC 4DSOA 2BMFA 4D25A 2GXAA 2GK7A 3I4LA 2IYWA 4TN1A 2CVHA 5E7MA 1QHGA 4CEHA 1XCMA 2NQ2C 1FP7A 2E9SA 1GR1A 3UWKA 3OFNA 4US0R 1FQJA 3QIAA 1T4GA 4HE6A 4AY2A 5HKKD 1TQDA 1G19A 3RRYA 1BH2A 2VH5R 3FKSA 1C4OA 1XTIA 1G6OA 1NLZA 2IF2A 1OB2A 3W3ZB 4NYIQ 1ETUA 5TV2A 1GNRA 2P5SA 1FNDA 4LHXA 1X8JA 5F3WB 4LJ7A 1DS6A 2QBYA 1UKVY 1TEVA 2JJ8A 2V6JA 4Q1BA 4Q4HB 1P6XA 1E0SA 1M8PA 3ETLA 3QFRA 2B21A 2QNRA 2AK3A 4LV5B 1V5WA 4F7WA 4EFNA 2JLZA 3DMNA 4DLUA 3A6PC 1KZ7B 3DOFA 3KXLA 3FE2A 2W2XA 2Z0MA 3VX4A 2ZRCA 2XOKD 3Q5DA 1Z6XA 4L15A 4URYR 1A5TA 1NKSA 4QC2A 4V02A 4Y0AA 3RYTC 3RC8A 4JLJA 5DO9A 2PX3A 2QAGB 4TL7A 2BIFA 3WYFA 4QBGB 3ZLJA 2H92A 4V03A 4FXPA 2RHMA 4MGYR 2ZREA 4AYTA 1XXHB 3QE0A 1D2MA 5EE5B 1S4QA 3BB1A 4EAQA 4WAUA 1GP2A 2G1KA 2B92A 4JLAA 2PCLA 1UBFA 4G5SA 2IS1A 1II8A 5HCIA 4IJMA 1JECA 2XTNA 4XVUA 4ZPXA 4A6XA 3NC1C 1W5TA 4B2PA 5D3MB 1ZM7A 4UXHA 3SHWA 2ZRMA 5AN9A 2WOOA 4FWTA 4NL4H 3VAAA 3KFVA 1FL9A 4I81A 1P62B 5L3QB 4LDJA 3WBKA 3TW4A 5FH9A 4TTQA 2HDNB 2ZJYA 4WVFA 2XJ4A 1RIFA 1GDDA 2O8FB 4OK6A 1VDZA 2GESA 4LGMA 2YOGA 5AUNB 1JR3A 5DE3A 3W2IA 3LXRA 3T35A 2GPJA 4ZI2A 4R71A 1QHNA 1E2IA 1Z29A 2FU5C 1KSHA 4Q4HA 4BLRA 4CDGA 5F9HA 3W2GA 5FBWB 4UAJA 1KIMA 2YJTD 3TVTA 3VX3A 4F7DA 5DHAA 3QUSA 3BXZA 4YC7A 4BASA 4PPQA 1CJKC 1IN5A 2X1VA 3IQXA 4H1UA 5DN6A 5P21A 4DC9A 2O0JA 1EWQA 4AURA 1DTSA 3PENA 1IHUA 5LD2C 1KK1A 1LV7A 2AD5A 2QAGA 4LYAA 4Q19A 4QNRA 4YXWD 3QPWA 3VNVA 4JLVA 3SOPA 1S2MA 1XXHA 5EJEA 1MR3F 1GAWA 3SBEA 1UAAA 1BS1A 4P4SB 2VHQA 3QFCA 4XVRA 1MO3A 1UBEA 2F3RA 3IIMA 4HSEA 1GKIA 3VKHA 4JJKA 1D9XA 3CPHA 3W6OA 1W2GA 2Q9AA 2VHUA 1QGAA 2WJJA 4UNPA 2CHGA 5KO2A 1OFIA 2VNJA 1R0YA 2ZU0C 3FHOA 2FPLA 1T8UA 4OJQA 3VHLB 5CDFE 4ZCLA 5IHPA 2JIZD 1ZAKA 3H84A 4TSFA 4AG6A 2FDCA 4I1VA 4KCGA 1RRGA 2OXCA 3G0HA 1P9NA 4DWJA 3GPLA 2GCOB 1G21E 1P2SA 1BX1A 1M90D 2ZXUA 5DSZA 1SHKA 2XB2A 4LX0A 2CNDA 2HT6A 2BGJA 4HDQB 4MYCA 1VQPB 4XSHA 4GOKA 3B78A 4AYWA 4AI6A 4QBIA 2AX4A 1GG2A 1CP2A 2FFHA 4TL6A 1IM2A 4MKGA 3VU9B 3UIEA 3CC4B 2R6AA 1ZCBA 2ODEA 3WMFA 3TSWA 3U4QB 1P2VA 5F98A 1UPTA 4KAXA 1M1KD 3KXIA 5GJCA 3W2EA 1KNXA 1ZINA 1EFRA 4TQUS 4A1FA 1X1RA 1W34A 1UDWA 2GVDC 3AVVA 1KKLA 4R2IA 2XGJA 2ZR7A 4MUAA 5KOYA 1UMKA 3OW2B 2WIBA 1KNQA 1OIWA 1Z6GA 4OBEA 1KY2A 1I4TD 3AP1A 4BFTA 2HF8A 2NIPA 4DCVA 4DXAA 2V4ZA 5DYIA 5E3HA 1SVWA 1OFUX 1TU4A 1E2GA 2RHDA 3FHCB 4F93B 1AIPA 1KQSB 2GQFA 3LVBA 1QUEA 4P4SA 2P67A 5FOWA 5A0FA 1IXSB 1AGPA 4Y0VA 2P6RA 3NTUA 2X19A 1S1CA 4R98A 3FHTA 3A1WA 1XTQA 2JJ2D 2L0XA 1SXJE 5DLQC 1NVVQ 1HYQA 4JLMA 3SI7A 4BLQA 3EWAA 2XZPA 4EJSB 1KAOA 4Y7CA 2WSSD 1P9RA 2FEOA 1NN3A 1KI8A 2YYZA 4B6EA 4YAFA 4HLCA 1M6NA 2V3CC 3OIWA 5FR1A 2OAP1 2XNDA 2QAJA 5G41A 2XNCA 5FPYA 3QXSA 1US8B 2P0EA 3W5UA 4AYXA 1NJGA 2WWWA 2XX3A 3RS3A 2AHOA 2VTKA 4JSTA 2UKDA 3B1WA 1Q81D 5TB5A 1AA9A 2AWOA 2JLYA 1DO2A 1KDTA 3GLHB 2O0HA 1T5IA 2J0VA 4PZLA 2ZRHA 3DMDA 4B47A 3VU9A 1R2QA 5JEDA 4B3GA 4TYYA 2DB3A 3B8HA 3MHPA 1DG1G 3KFXA 4JLNA 2JEOA 3W5IA 1H65A 4B71A 4DSUA 1QZXA 2GEUA 1V43A 2GZAA 1W2BB 1E94E 2YWEA 4O0MA 3IDQA 4M1SA 2QMUA 3LO8A 2X3UA 3CH4B 3QEJA 3GFTA 1LF0A 1DDGA 1ZNWA 3LDAA 1TQ4A 1X86B 2KBFA 5KTYA 1Z3IX 5BYKA 2J1LA 3X1WA 4XD7A 3SEAA 1UEIA 1UJ2A 5EE9A 4W9MC 5EZ6B 1PUIA 2CCGA 4PHHA 1O87A 2ZSDA 1EFHA 2CL7X 1FRQA 2W6JD 1R10A 1MOZA 4YDHB 2CXXA 4PXAA 4HLQB 4MUBA 5HXBA 1N5JA 3CD6B 1GL9B 2NO0A 4UQOA 1Z6AA 1I4LD 5AUQA 4PC3A 3BJIC 5FR2A 1OFTA 1QVAA 3OESA 3Q72A 4G01B 4U5XA 5JMTA 2REXB 1G7TA 5LB2A 2ZS9A 4PAOA 3SBDA 3RWOA 1IN8A 5CJPA 3DM5A 1QBKC 2JA1A 4EJSA 3EG5A 2VP5A 1E63A 1HQCA 3B9QA 1QUFA 4IDQA 5DGXA 4AKEA 4ARZB 2FSHA 4ZIRB 2YC4C 4B3XA 4JJZA 4ESVA 3AKEA 1G3RA 3ASZA 2JLUA 5JECA 1E4VA 1ZD1A 3BFXA 1G20E 1J7KA 4URWR 3SYNA 1CU1A 2C78A 4RD6A 3ZS9A 1US8A 1OT3A 1D5CA 1NLYA 4TZ0A 4O3MA 1S9DA 2PZEA 2G77B 5EZ5A 3RNLA 3RS5A 4P31A 1IN7A 2HXYA 3GLHA 4DCSA 4MDFA 1IN4A 1XDBA 1CRQA 3LA6A 3CCUB 1DAFA 4LC0A 1KSJA 4KYUA 3KQHA 3DL0A 3SHFA 3EZ2A 4Z54A 4IEIA 1Z5ZA 4Q9KA 5EUMA 4V0LA 1G8GA 1W0JD 3LNCA 1SKYE 2Q0HA 2R6CA 3EA0A 4TL8A 4RD3A 5FFMA 3X2SA 1IQPA 1DO0A 4K1XA 4B74A 2VL7A 3C41J 4GBMA 3THXB 1Z0IA 1TMKA 2ZI3A 1U0LA 1P2TA 1N0UA 1AMOA 5GJBA 4XWAA 4D26A 4D6PA 5HPYB 5H5JA 1VCIA 1UM8A 4Q9LA 2JLWA 2HCBA 3AH8A 1PJRA 2QGNA 4B4DA 1M7HA 1F60A 1EX6A 1A82A 1T3LA 3K0EA 2VF7A 3QF7A 3QJYA 4YHBA 1RRFA 3U6KA 2FZ4A 2BVNA 2HLDA 1G3MA 3D8BA 4GSYA 2QGZA 3LWNA 2FFBA 3U61B 1GL7A 4ARZA 2JLSA 2IYZA 4ZIRA 3CW2A 1DAHA 1KI2A 2OV2A 3MJHA 2IYRA 1U94A 2XJ9A 3PEUA 4N1AA 3TSZA 1XD2B 4KLZA 4URUR 4TMVA 3CLVA 2ZANA 2R6DA 2VYFA 4OHWA 2CCJA 1MO5A 5FL7A 2TMKA 1LY1A 4Q1EA 4IFEA 1UKZA 2CHVA 1BMFA 1VKJA 2CLSA 1FTNA 3K70B 4LJ5A 4PAMA 3TKLA 1SQ5A 1FFHA 3KXKA 4HAUA 3VR1A 5JJLA 4WZAE 2JJ1D 3PIRA 3DHWC 4MKIA 3SDZA 1GRQA 3T06B 2LCFA 2OLKA 2IYXA 4ZDIA 2JLXA 1E2FA 2EFDB 4MKHA 3QVVA 4FMBB 4OI2A 4V0MA 3RLFA 3DOEA 2ZEJA 1FRNA 1E1QA 1HH4A 1WXQA 2QP9X 3TQCA 1VQMB 3KQNA 2W0MA 3LBHA 1LF5A 1XMSA 3I62A 1RE0A 3HYTA 2GRJA 1E99A 2W58A 3L82B 2WJVA 4JVSB 1VQ8B 4HATA 1AKEA 1YE8A 1OPXA 3AF4A 3IHWA 1KMHB 4JKIA 1I7PA 4YLGA 2GAOA 1VMAA 4PHFA 1S9HA 1D2EA 2J3EA 3MGCA 5J4VA 1WQ1R 3ONWA 4OK3A 5JWHA 3B82A 3CUEF 1G8HA 1UF9A 2RGNC 2QMOA 2X8AA 3RSOA 3T1OA 2WV9A 5JLJA 3DKVA 3TJZA 3R9XA 4XOIA 2DWPA 1OGIA 1EP2B 1ZM2A 4MRVA 3WRXC 1RKBA 2VP0A 1E6CA 3OFND 4LSGA 5EQTA 2GTPA 2J9RA 4M1KA 1AM4D 1N2CE 1XD2A 2ZRFA 2VP6A 4Q4AB 4R9UC 3TR0A 4FIDA 1E9BA 1QHXA 1Z0KA 3MJRA 4IHQA 4PSAA 1JEDA 3FKSD 3SQWA 4B3FX 2HYIC 1NSTA 621PA 2R6HA 2HJVA 1R5BA 1KJWA
chains in the Genus database with same CATH superfamily
4LDZA 3J7AC 5J58A 1UQTA 4G1BA 1NR5A 1LTQA 1YZHA 4TXMA 5AVJA 1QV9A 1NJ2A 4R83A 3JQGA 3ZEIA 3U1TA 5K4AA 3FHLA 4DNPA 1XMQB 1N0VC 4JGIA 4E3ZA 3DH0A 3M6WA 2P1DA 4XVQA 2ZB2A 1TYEB 4QO7A 1HV8A 4UTRA 1JB9A 1IHDA 3V42A 4EVSA 2HLHA 2WIFA 3AVOA 3JQAD 3LG2A 5ES3A 3HCFA 3RUCA 2XSZD 1NUSA 1BXZA 1W5AA 2OHGA 3M9WA 2D54A 3CPJB 4IV5A 3I5XA 4C2TA 4RTMA 2EX1A 1XZDA 3GDWA 3NTXA 4MUJA 2QLNA 4CM8B 5AVYA 3W5AA 5F52A 5EHGA 3NAMA 2JS7A 3TZHA 3TVYA 1MJGA 3VSCA 2ZRGA 3WMEA 3ZQJA 5FA8A 1WTHD 1Z0DA 1IOVA 3I0NA 2X0DA 1WP6A 3IRVA 3RRFA 1KZ4A 1X1EA 4MTLA 4TYWA 3EPLA 4CR7A 5LP1A 1P7VA 3AB3A 3B53X 3QI2A 1NA5A 1GPDG 3GMDA 1KMHA 4BFCA 2FWRA 2NTNA 1K9MD 5IYQA 1Q44A 4B40A 4B87A 5CYPA 3IDSA 3EPKA 5BSXA 1GO2A 1Y33E 1BA2A 4RGQA 3ZNPA 4ON9A 1KY3A 1TVKA 2GHRA 3F2VA 3H2IA 1W87A 4IXWA 4I3GA 4IVQA 4CDRA 2BFPA 2AQIA 1N2IA 1VG1A 1A88A 1OBFO 2LUOA 2QX7A 4XQFA 4FI3F 4QSMA 2D5AA 4R31A 1EJ6A 4RY0A 4FQ8A 5FI1B 3Q7SA 3T7CA 1QRAA 2RKOA 3UICA 2XCUA 4WJKB 4BHTA 1N33B 4Z1MA 2BCEA 5FPQA 1NVFA 2FUG6 2UYYA 1MA0A 1EPUA 1KR2A 3JQ7A 3ME5A 2NPIA 1UZAA 1QFMA 3OWXA 3DL4A 3L46A 4Y9RA 4RDJA 3R41A 2O1XA 4PO1A 5JNVA 2CEAA 4AS2A 1I9CA 4RZUA 5AW2A 4GXTA 2CL0X 2OV6A 1UJ5A 5CURA 1V16A 4HDNA 3TH5A 3RRBA 5LQAA 1K73D 3VI3B 5IK2A 4J16A 3PLNA 4UTOA 3AESA 4EHIA 3DTVD 2GREA 1RI3A 1U3WA 2JCBA 3LQYA 3NT4A 4IIEA 2ZROA 3I6IA 3R8FA 1N78A 4KQFA 4YMSA 2IYVA 4JVNA 5BNIA 1S5PA 4CFSA 3TFOA 1C30B 2CLMB 1YZVA 1XMOB 3ENZA 2G4CA 3NHWA 4EENA 2V7BA 2UVPA 3IKLA 1H4SA 3TUZC 3BH7A 1TF2A 1EWTA 3GJ0A 4TQGA 2BWJA 4X8HA 3UHFA 1HSZA 2O8CA 1EFKA 1TNDA 1VE7A 4KQ9A 1B23P 1U4SA 5CP8A 2V74B 3CZCA 1T8TA 1CZKA 2TRSB 1SKQA 1N5IA 4GG1A 3GELA 1I2AA 4L7QA 1WE2A 1Y4DE 2Q3HA 3AV0B 1TO1E 4WZAB 4CJXA 2GHIA 1DCMA 3OZTA 4Z3OA 3T41A 1F0KA 1YD7A 4GLBA 4RVCA 4DMRA 2AKEA 4OH7A 4L28A 4R0MA 4EMBA 4BRWA 4B8WA 5CEEA 4TXNA 2X4DA 4EI8A 3GCWA 3KKQA 1PLKA 1T3HA 4EY4A 3LP8A 1G5TA 4HWRA 5ICFA 4H1TA 4DDMA 2A1IA 2JI8A 5FTKA 3ZLTA 1A2OA 4CKEA 2WJHA 5HQ3A 3ZHTA 1AQLA 1EM8A 1W49A 5LXTB 3HVKA 5EPOA 1E79A 4NNPA 3H8WA 5JBIA 1NWCA 5E0KB 1NW7A 1ULBA 2FPXA 3B9PA 4ID9A 5HS6A 4E12A 3K70C 1R66A 3B1VA 1TL7C 3FUVA 2V7PA 2VLIA 3HH8A 4M21A 1QIFA 3BXPA 1IJFA 1J9EA 2R62A 3M5CA 3RBAA 5HKOA 3ED5A 1SXPA 3ZIAD 2JG3A 1NY6A 4W1SA 5ANRB 4AX4A 4BMZA 3OIVA 1T0UA 3WK6A 4HVAA 2BI4A 4NICA 2Q4DA 5EMNA 3DLCA 1P8JA 1U28A 3CUUA 3ORHA 2BR5A 1V8FA 1EFPB 1TECE 2WAMA 4MLZA 2YWBA 1HTWA 3E35A 3R3VA 3L0OA 5EP4A 5H4GA 4XPZA 1WCIA 3ZX4A 1Z6YA 3OE7A 4IIDA 2RCYA 1Y9EA 5J40A 5CIYA 2QZ9A 2BFMA 2L82A 3ON5A 2C3YA 2OV8A 2WF9A 2A1UA 1TUGA 2O8BB 3TLGB 1NLMA 1MOSA 1YIOA 3PV0A 4X3OA 4B31A 1GGVA 1I4WA 1YVPA 4WXRA 1P0FA 3ELDA 3LL4A 1JI0A 4UUNA 4EJ0A 1SPBS 5GY7A 2XUJA 4RJLA 4UM9B 4CVNA 2DRIA 1M1YE 2C29D 3CBQA 3MLEA 2FH5B 5JVDA 1KEUA 3ZEAA 4EUEA 3OCVA 1WQ3A 2Q5JA 1AGRA 3ZKWA 1NBWB 2YBDA 1YR3A 4O63O 1MXHA 2VP2A 2P6UA 3RU9A 2NZWA 1V1RA 4X65B 2C1ZA 5HZGA 5FA5A 3LHDA 5B1EA 1Z06A 4GUDA 1YRBA 1OC4A 3X3HA 3JYPA 3DMHA 1ZH4A 1NC1A 821PA 1BWPA 2A5GA 1OU4A 1ZWLA 2ZUWA 2D9RA 2QTVA 1HNWB 4E09A 1J09A 3LU1A 1ZQ1A 4KOAA 2V7QA 1NT4A 3JVEA 3TR5A 4C7BA 2J0UA 5JVDF 3EZ6A 4OPMA 5BN5A 2D4HA 2YBEA 2HK7A 2C5LA 3SQMA 4G1VA 3KB8A 3W79A 1EK6A 2OTLB 1GTG1 2YKGA 4IMPA 5E9JA 4EUNA 2W6IA 4XGKA 5G4LA 4EG8A 2G0NA 1ZITA 4JJ4A 4LA4A 2CD7A 1ZONA 1LBEA 4KK4A 2B0CA 3KOMA 4MRAA 3S5UA 2OFXA 2GBFA 4XGRA 2ZJ5A 3BZWA 2WQ7A 2VFAA 5LB4A 3Q8WA 1JVBA 1FNBA 2G71A 3LX4A 3ZGYA 4NY1A 2MINB 5CHYA 5IXJA 1QYCA 2A4MA 1IEXA 4Q4JA 3P94A 1DUSA 5CAEA 3PDJA 1MH1A 2OO3A 3GEEA 3H4MA 1H8HD 1ACMA 1I24A 4OGWA 1TJPB 1NM5A 4LJSA 2O3SA 3QG1A 4HQNA 4DRXA 4JJFA 4DWVA 3EEOA 1XR3A 1GSIA 2C1XA 3D0KA 5CB6A 2FWPA 4H6XA 1FRVA 1ECJA 1W75A 2IXEA 3H2GA 3DAOA 5J2TF 4AF6A 3U40A 3EW9A 1LNQA 4P5DA 1KJQA 4DLXA 1NJ6A 3ZN2A 1AA6A 4QUGA 1R0WA 2ZB8A 2W90A 4B3DA 2EKDA 2GCIA 2R87A 1B43A 3ZXIA 4EM6A 4LHWA 2DPMA 1FLDA 4X3CA 2X3FA 1DCFA 1AO3A 3K5WA 2VRCD 2ORVA 2O0MA 1BX0A 3A1FA 3H9GA 2W2LD 1C3OA 1Q7EA 3NHLA 4Q16A 2V7GA 4OJKA 2D0OB 4E2WA 4OBBA 5LUAA 3Q12A 2Z5GA 4X9XA 3A8IA 2QZSA 3I9OA 4Q9DA 4AIRA 3I1JA 5LYJF 2OILA 3KR1A 4DCJA 4D3SA 5JXGA 2GBLA 3DKIA 4I08A 4CT0A 4EI7A 1TTTA 2QLJA 5K2MA 2ZYVX 3CMEB 3TB6A 4MUNA 4PRZA 4NZNA 2IIPA 3LPMA 4U7TB 2CWWA 5KVAA 2JFXA 4ZV4A 1Q0SA 3P2IA 5LP6F 2UYGA 4Z3DA 3JAMA 1I6KA 3ETEA 3C5HA 3H18A 3NVAA 1H93A 1QDEA 3U7HB 3EXEB 4MW0A 3ZWYA 4B4OA 4KIWA 1J8YF 3N07A 3G7NA 4GYKA 3TX2A 3S68A 2CWDA 4RFSA 1ZMBA 1N6PA 3EXHB 5AJTA 3C16C 3GN1A 5D8DA 2HBQA 3HN7A 5ED4A 2FE4A 3ZU2A 1MDBA 3E82A 3P4YA 1ISJA 5JFTA 4PM4A 2HYDA 3QI7A 3GLGB 3A36A 2F43A 2O8EB 3ZD7A 3NHFA 3HSSA 1XZLA 4J4TA 4RFVA 4IJQA 3E5HA 4AZSA 3VMFA 2R6FA 3M5PA 3OOJA 4F9EA 3LE8A 2CVPA 3DZKA 4O4JF 4YDRA 3W4JA 1GKKA 3C3CA 3IHLA 2PUFA 3WGMA 1YLOA 4FFWA 1QRRA 4E03A 4AZ3B 3URMA 1NAHA 4QL3A 5JYBA 3EEFA 4XDYA 5F76A 1ZK0A 4ANFA 3VKVA 1CEXA 4AN1A 4LWPA 1G59A 2UVQA 1KDPA 1XEWY 2FVYA 1P4GA 3KB1A 1JE1A 1EG7A 4F04A 3CIFA 3HWSA 4LEIA 1A7UA 1MG0A 4M9SA 5IS2A 1QGOA 3K1ZA 1T0HB 3NV9A 3U9SA 2Y92A 4WW0A 3ZK9A 2QTLA 2WYIA 1RQ7A 2OFWA 4R1NA 1YXMA 3IMCA 5HFNA 4HRXA 4Q03A 5BUSA 1OFGA 3QOFA 1RYBA 1M1YB 3EW7A 4FGLA 4LNAA 3EZNA 3EIHA 3VC1A 3T7RA 4WK0B 1WUIS 3A25A 1RPAA 1HMYA 2GN1A 2VPYA 2O2ZA 3GHYA 3H65A 4TMFA 2ZYUX 1GZ4A 5C7IO 5CFLA 2C9MA 3AZQA 1R1DA 3QF4A 3VAZA 1J8MF 1L4LA 3FYHA 3U1VA 1GGJA 3HEAA 2K87A 2BFEA 2QTBA 4DBLC 4FKMA 4JOQA 3QA9A 4XLCA 1QVFB 1DJLA 1KXZA 2PO7A 2P1RA 1BMFD 3SAJA 3ZY3A 2CDCA 3MVEA 5I9MA 5I01A 2EKQA 1JQEA 3PTZA 1KJJA 1ZIXA 1XWFA 2P91A 1TQ2A 3ECAA 1RPJA 4O1IA 4E2FA 4AY4A 2RIRA 3H3FA 1DQYA 1QH8A 3L07A 3MCZA 4ITVA 4O4LB 3RLIA 1O89A 4ENQA 3FROA 1TU3A 3WQHA 2WKRA 3ASVA 3DEHA 5C9ZA 1P60A 1FTQA 2JIQA 1Q7TA 2Z2IA 2O0KA 1COZA 1Y63A 4FONA 4IDEA 1A8SA 3V1LA 4X64B 2PUHA 5HOQA 1UXHA 1RWXA 5F2EA 1GQOA 1F3OA 3J81k 1E1QD 3K05A 5DGIA 2ZXFA 1I10A 1Z8DA 3FDJA 8ATCA 4Y67A 3JD3A 1KPIA 3RTCA 3LT0A 1W0KA 3PVDA 3C3DA 4LY6A 4D4HA 3N0TA 3B7GA 2ZUBA 1ZSVA 4GRIA 2IPOA 1V6AA 3AHIA 3ONVA 5HBGA 3FMPB 5FNVA 4IJVA 3IB6A 2K7ZA 1JYSA 2ORED 3AWDA 1JAZA 1DKMA 1M83A 1QCDA 1XTKA 4Z7JA 4EARA 1FVFA 1ZDMA 4HEA6 2SKDA 3GRYA 5JSZA 2OC4A 3WQZA 2J5XA 2YV1A 3HU5A 3KT3A 3P27A 1OV4A 2QPLA 3KZKA 1USWA 3QJGA 2VQ3A 5A05A 5DCLA 4WXMA 1U3VA 3TLYA 5IFLA 1NONA 1FSGA 1Z4OA 2A9JA 4MWZA 2EBHX 2OUKA 3L1VA 3OCUA 3TAUA 1YBFA 2Y1XA 3G13A 4TLEA 2BFFA 3RSHA 3F8TA 1UWLA 1PJ7A 1QX3A 2X0KA 2FFQA 5H83A 5ESRA 2JDID 5L3SB 2X6XA 4KRGA 4YAUA 3HBNA 1R12A 3V6MA 2PA0A 2VQSA 4P4NA 1MW9X 2X4LA 4UHKA 1ZNQO 3CEJA 3LUCA 4G6ZA 5DCYA 5L3RA 3BK1A 3VGPA 1UD3A 3E1YE 2AI3A 1W2WB 4FHGA 4BUCA 1HL7A 1QVZA 1Y1RA 1F8XA 2NZJA 2ZJ1A 2F8TA 1PSZA 3QA3E 2XTJA 2IYSA 1JLKA 3S0JA 3UJ7A 2G4VA 4RF3A 4B3JA 4LZAA 6Q21A 1OMOA 4P4LA 2W83A 3CR8A 2AVDA 4Q0MA 5AJZA 1W5SA 3DWIA 4TVOA 4LQDA 4P6VF 4HDRB 3EQ8A 3MGAA 1A5ZA 2JFGA 5AKKA 1ISGA 4MQ4A 3UY4A 2JJYA 1Q1NA 4ARUA 5JFGA 4IVRA 2QLMA 3HZHA 4D9IA 3KKOA 3OCXA 4X93A 2VA9A 2AV6A 4UUOA 5TQ2B 2O59A 3GT7A 3EGOA 4D0LB 3O8CA 2NACA 3UH0A 2ZITA 5HEKA 1HE4A 1Z12A 5I4KA 1PRYA 4TRMA 1N77A 1ZG3A 5FPPA 2G1PA 1GT91 1D4OA 1C9EA 2XAAA 4PPNA 1HI9A 3AM4A 3OKCA 1Y0BA 2FFAA 5T4EA 5JS8A 3KZNA 3BJZA 3OY2A 1B42A 1U1DA 2JEZA 1E2EA 4ACAA 4RKQA 4JT9A 5HKKA 4BY9E 4UZUA 3RKSA 1GA1A 3TLCA 4C7KA 5E4YA 1FK8A 1USVA 3DNMA 4LZZA 4MUFA 4BEBA 1GL3A 4U7HA 3HACA 1ZEMA 3P4XA 2ERXA 1IDOA 2I2BA 5BQ3A 2D7CA 1DGQA 3GAMA 4KQHA 2F48A 3O26A 4QULA 4POOA 2YWCA 4D2IA 5B7QA 4JIMA 4ZU3A 5I9LA 3G2LA 5IZCC 1IOZA 5AW6A 5K0CA 1Z47A 2HIMA 5EUBA 4KK3A 3FBWA 4HAZA 2EL7A 3NVDA 4MINA 4OF4A 4BTEA 3KK0A 3PL5A 5ICEA 2J32A 5DIZA 2DF8A 3OIDA 4RIFA 3H5IA 2AD1A 2C9YA 3MWGA 4Q4DA 1ENYA 2P69A 1GV1A 4WKPA 3WMXA 3OP4A 4LGYA 1O08A 2JCSA 1L4MA 2PRSA 1OLSB 3IDFA 5LKRA 4V3CA 2XD4A 4DR6B 3I92A 1NRIA 3SXUB 3L6DA 4IX1A 4CPDA 1OBHA 3IB3A 2OESA 4M9QA 1N7GA 2J45A 2ZM5A 4TV8F 1XRJA 4WACA 1XDGA 5TRTA 1UD2A 3EJ6A 5IK2D 1GYRA 1I2MA 1KJNA 1ZZGA 5G4KA 4DLRA 4QGAA 1Q1BA 5FOUA 3WLOA 4A73A 5JMPA 4LF5B 4I19A 4KN6A 2XT6A 1VKNA 4XE5A 5EYPB 2CY0A 3BCDA 1REQA 1ZD8A 2G63A 3A06A 4NBVA 3GK3A 4INAA 1FYFA 1JAHA 1HTBA 4O2RA 3HL4A 3WLIA 3DBRA 2CN1A 1BMQA 2XHZA 5CDSA 3HUDA 3EMBA 2IZOA 3QVJA 4MARA 5IT5A 4TS3A 3A32A 4Q1FA 3RAPR 1E1DA 3DT8A 3H1AA 2DY0A 4NCIA 1HE1C 1QU2A 5UKDA 1RXEA 4N5DA 1X15A 4RTKA 4YP1A 5MF6A 2Q5OA 1C3EA 1LZKA 2CBZA 4EHDA 2D2EA 2OBTA 1NHGA 1GZSA 1CS0A 2BH9A 4ZO6A 4E6EA 3OAAA 3Q3AA 1AKUA 3O3CA 3O9VA 1C4WA 1PWZA 3UT5A 4AVYA 5BWNA 4MCJA 4JC5A 1JDJA 1N1MA 3T3EA 2IE0A 2FUKA 1GN9A 4L51A 2XRYA 5ED0A 2ZI6A 3D3WA 3IRUA 4CM7A 3NANA 4NCXA 2V3WA 2ZAOA 4GOND 2QA5A 5J23A 4D8UA 2O1SA 1ZJ4A 3GJYA 1Z8NA 1KEEA 3T4PA 1FSSA 3N2KB 1GPWB 3EVZA 4R40A 4OAOA 3VYVA 2GZDA 4JD5A 2BTQB 4LSWA 2LRHA 5CX4A 3G8YA 4XUGB 2KSQA 3D4PA 3KPWA 3BZBA 4QQFA 5MN4A 1XEXB 1RRCA 1EEXB 1V9CA 4EFDA 1ZZEA 2BBOA 2OCYC 1QU3A 3P0HA 5CDFA 2ECFA 4FBGA 4FX2A 4RTRA 2BMEA 4MKXA 4Z0NA 3CX3A 4AK9A 4EF6A 1RDFA 3ZHBA 2EP5A 1KETA 2EGHA 2NNWB 2YVUA 1XXLA 4H2DA 4MV8A 1W5BA 4B79A 2D00A 5L4LA 4RU1A 3AHDA 3TCKA 1KI6A 2G04A 2DHCA 3AT1A 3TLAA 3OQOA 2WFAA 4MUIA 2RDMA 3N2YA 3TW8B 3K9BA 1SG9A 2H17A 3CWQA 4KN5A 4LRXA 4QOFA 4MEAA 4QPCA 4WCDA 3STWA 3BVPA 1BEUB 4MQFB 2OO5A 3AUSA 2Q99A 3K4PA 3WXBA 3ZNOA 5AKHA 4ADSG 1C4XA 1T25A 2Q9CA 4MIYA 1G18A 1LA2A 1UPCA 1CJBA 1UH5A 3DF9A 2Z3ZA 3ZCXA 2XUQA 4EYQA 1XDWA 1WW8A 1CWUA 5LQUA 3HCPA 1UXJA 2PJDA 3CURA 4JP8A 1U7WA 4U2KA 4NCHA 2RH9B 2VPIA 4B81A 5DTRA 3Q39A 1PJ3A 2HNAA 3GUUA 3M3HA 4YECA 3W04A 1VB5A 4PGFA 1U7PA 3SQLA 3WWZA 3ZDFA 4YMLA 5F33A 3BIOA 5CK4A 5K1ZA 4AP9A 4L73A 4PSKA 4YHHB 3ZBQA 1EESA 3SF8A 2NVOA 4LGVA 4BNNA 2WBLC 1KRWA 2NTJA 2W2OA 3BS4A 3UMGA 3X1KA 3ZE6A 2AC2A 4NDAA 2GCNA 2UU9B 4XX1A 1ZGJA 4IPTA 2QRPA 5HIMA 5T3UA 5SYMA 4HAIA 4C2UA 1JIJA 4A0HA 1NMSA 2C0QA 2QG6A 3FNQA 4OFZA 5A3JA 1R3DA 3DLAA 2YS7A 4IBOA 5EKUA 3RTBA 3WLKX 3W8RA 2H1VA 4MYHA 3ZXXA 1Y4SA 2R25B 2Q3LA 3FTNA 3AC0A 4IH1A 1PR6A 5F35A 2ECOA 3SEQA 1TC2A 4DLPA 1TYDE 4DK1A 3ZV6A 4BV8A 4DDWA 1IY1A 2FX5A 3ZHYA 4CQJA 1ADFA 4JJ7A 4IIGA 2IXFA 2BGGA 3LHFA 1JX6A 3GEIA 1FTGA 3HYCA 1CQJA 3M0EA 4RA6A 3H0EA 4R4JA 2G36A 3N2LA 5ITZA 3AW9A 5CA1B 1N6HA 1TCVA 3PRYA 1N2SA 1KS9A 1PO7A 1MF7A 1RM3A 4HUTA 4JLKA 4MS4A 1GHTA 1H94A 2DSTA 3QTTA 3LOQA 1KC1A 4ZQEA 3K4QA 3RS4A 4GYYA 3HS3A 3B3GA 4J90A 3RS2A 5H8WA 2EEPA 1YK0A 1KKMA 2OV3A 3PPVA 3ESCA 1VECA 4C03A 2ORWA 1ND5A 4F71A 2WTMA 4ZEOA 1E1CB 3K53A 4PQFA 4A36A 2HA4A 4I6GA 3DBLA 1GEEA 4L07A 4FDTA 5CCXA 1M8GA 2ZAGA 3ISTA 2BD0A 4RESA 3T94A 2GNPA 5IHXA 3R9IA 3SYMA 3Q6RA 2VXOA 4E1AA 2I34A 4H7KA 4PZZA 1H6BA 1RKVA 1GQ2A 3UB3A 3IDZA 4B5KA 4I9FA 1L1FA 4B3CA 1WMAA 1RM0A 2V9PA 1UT5A 3NIDB 3I2YX 3L8CA 3Q87B 4HH3C 1HKUA 4EPRA 2RB4A 3S8EA 1EP3B 1L2TA 1MPXA 1W4CA 4OYLA 4QPPA 4R6XA 5DMXA 4Z5XA 1M72A 3O4JA 4ROSA 1PR2A 2QTZA 4KACA 4GSKA 4YP7A 5KMGA 1GTJ1 5AXDA 4QM6A 1RJDA 1XJWA 2VUIB 3B38A 3RADC 3I9V1 1Z33A 1XZBA 4CUJA 2F1HA 4Y7DA 3IAS6 2PSFA 5E6TA 3Q7EA 4EI2A 3O8BA 3V3KA 3B6MA 4EG7A 4HO1X 1JA0A 1PT7A 4FYHA 4C08A 4GQIA 1AH2A 4IIJA 1IZ9A 2OZKA 2NUPB 4M1WA 4QSHA 3WYGA 2C5FA 2PO5A 2WJPA 4ER3A 2J6CA 4NMLA 1ZC4A 2F3TA 2JHAA 3HQ4O 4DUZB 1WMFA 4W5RA 1WVMA 2QVYX 1YI0A 4MRRA 5JS2A 3WLRA 4XN3A 3LNNA 1RMTA 4Z1OA 1CR0A 2YWFA 3BHJA 4G07A 1GFWA 2WU8A 3TMAA 5TPWA 2F7SA 2VPPA 1FE8A 3BXOA 3N39C 1V2HE 2FG6C 1CIPA 1ARZA 2GZMA 5DM4A 1R15A 3WKDA 2CUKA 3WB1A 4IQ0A 4L2IA 1Z5GA 1JWAB 1S3SA 3L6CA 2DFNA 2ID4A 2I1VB 4TWBA 4C14A 1I01A 3UMCA 4IDNA 1G20A 2ZBGA 1U8AA 4UE3S 4DIUA 2F55A 4F6RA 3F6EX 2EJTA 4CLRB 4PAGA 3TUJC 4YYEA 2PZBA 1W47A 5C1BA 2A5LA 3AERA 4G0MA 2ACEA 2WZCA 4I6JA 3O4FA 4PC7A 1G1MA 3GVXA 3ZR4B 2CW5A 3EZXA 5CX1B 3H5OA 1J2EA 2FR1A 3EA4A 4AD8A 3PJRA 4UNQA 4U6NA 5ALEA 4WZBA 1RMYA 4I4TF 5FA6A 5DHSA 5DISB 5FBHA 4NPHA 1CIVA 2OV1A 2P5TB 2NU8B 2BFDB 4IDBA 1ULHA 4MQ5A 3WIOA 5LFAA 2JIMA 3TM4A 4MV9A 2PRZA 3WRYA 1JLMA 4NDZA 4R68A 3ST7A 4PFKA 2JCXA 1NBIA 2P3SA 1Z0JA 4M1YA 1GTZA 4A82A 1P4SA 4PXSA 2C0CA 2AKAB 2Q7XA 3FIUA 2ZWOA 3C5CA 1Y4AE 4MVJM 4W7HA 1WS6A 2EYUA 1I4DD 2ZYTX 3MPOA 2OCGA 4OO3A 3T9CA 5HTOA 3R7WB 5CM2Z 4B6OA 1U2RA 1S89A 2H31A 1PF7E 3JD4A 4FN5A 3JZIA 1DHTA 1Y8QA 4MVJG 4CHTA 2NU6A 4FE4A 4KFTA 1GWNA 1FU8A 1XU7A 1A95A 1TGYA 4B80A 3ZZTA 2G0TA 5KDDA 4W8GA 1D3AA 1U7ZA 2FMXA 4HBGA 3W1WA 2BKXA 2R60A 1TD9A 3DOCA 4LHYA 3X2EA 3THYB 5A5GA 2VRBA 4OVKA 2R6GA 1LB1B 3C43A 4R51A 5AK3A 5FUYA 2QRLA 1ISMA 3CPWB 2JLQA 3OPYA 4Q93A 1NXSA 1Y5MA 2OHFA 2QRKA 2OGTA 2Y27A 3BWDD 4GP7A 3VI4B 4E5MA 5FWYA 3IOCA 3PGA1 2WU3A 4KPUA 4QQRA 3KEOA 1JQDA 2V0CA 3DFZA 4GT1A 4L9AA 4YRPA 5DM70 1ONNA 5CDYA 1N2CB 3KVYA 3T4XA 2QRVB 4LE1A 2BISA 3UMJA 3ICEA 4RTPA 2A3NA 1T4MA 2QJWA 2V1XA 4MKRA 2BFOA 1ZIDA 2I7DA 4CRWB 3EBLA 4EKDA 1CRLA 3T9FA 1BA3A 3FDFA 1PT6A 4JVMA 1PZGA 1KO5A 3HWRA 1JXMA 2FWIA 3D1VA 1XCGB 2F1OA 3ZDEA 4DWWA 1W0KD 2R6R1 1TIPA 3F5FA 2VUUA 1PEKE 1RWNA 1U9IC 4MMXB 4BNDA 4ZMSA 3LUPA 2KJQA 2QRUA 5I47A 4FFDA 2HT1A 1KFJB 4BLPA 4NJEA 3BA1A 3P9NA 3C3MA 2NGRA 2JFHA 4I1RA 4TT8A 3FYUC 1FXWA 2NO9A 3WVNA 2AKYA 1NF2A 4KO4S 1JFTA 5M5BA 2CD9A 1OZGA 3MS7A 5FEMA 3TXXA 2JW5A 4A0RA 4RBNA 2FPGB 3JQFA 3HMKA 3RJTA 1H66A 1KZ6A 4K9SA 1Z28A 1XDSA 2PMKA 4JI7B 3SQXA 1KH1A 3IQFA 1CHDA 2E5FA 2JCYA 5LZ5A 1FUIA 3L1UA 2C04A 4HLUC 1RI2A 4ER5A 2Q2VA 4FD2A 2Q29A 4B34A 521PA 5AJVB 1R8YA 3CF0A 5E9QA 2AFIE 3E70C 1A77A 4NE2A 4BVKA 4QLOA 4WFJA 4C0LA 1J8VA 4CW7A 3C0KA 3OOYA 1GA4A 1IUPA 1KP3A 4J07A 2F1RA 4DE5A 5L7WA 5CA0A 4IZOA 3C7AA 3JAKA 3NPAA 5AW5A 1SQGA 2VJJA 4BO2A 5KYGA 5BR4A 1F2UB 2PD4A 4BMOB 2EFJA 1TU0A 4F96A 1I8TA 1KJZA 1NIJA 3CZ5A 3KR0A 1Z7YA 1XHFA 4XLAA 3K30A 1DAIA 1XTRA 1P1JA 2VN8A 4M0EA 4NZZA 3QPBA 1KXJA 1WTCA 3E6AA 1E3QA 1N25A 4BRZA 5JY6A 1Z45A 4X41A 2OBYA 1CC1S 3RG2A 1SXHA 3PA8A 1MJFA 4RQAA 1QDLB 3WFZA 4U8GA 1I7DA 1THZA 1I51A 4F60A 2ZBFA 1UZNA 3KVOA 3KYIB 4N3AA 3ZZ1A 1E5XA 1FFXB 2WTXA 3OTHA 5JCPA 1P80A 2DQZA 4UBLA 4XOPA 1GFSA 1LPBB 4FGSA 1XTBA 2XI4A 4A0SA 1ZM4A 3OC0A 9ABPA 1CD5A 2GD1O 2VBUA 2NZUG 3CZ4A 3DAFA 4GWGA 3A27A 3INGA 3LZ6A 3H04A 4J0EA 1GNTA 4UEKA 1MFPA 1P73A 3BH4A 1K5GA 3VXKA 3G6KA 3VSEA 3X1ZA 1MQ9A 2O0LA 1YFJA 4YQZA 2NZYA 1HGXA 3A6GA 3K6JA 1SEPA 3MILA 3BB4A 4E4TA 2AJLI 4LYJA 2P41A 2UUAB 1BZYA 3CUKA 3KB6A 4OGFA 2JIRA 4JJEA 3F7NA 1CQPA 2HWXA 4M8KA 1DJMA 4EYEA 3LBAA 4F6CA 4B4WA 1GQFA 5FPSA 2E4UA 2AF4C 3CLRD 3ILVA 4G2NA 3SS9X 3CFYA 4DHWA 1K8XB 5E7QA 1J99A 3U3JA 4Z86A 2MMCA 1HM5A 3IAHA 2CVFA 5CD9A 2O8DA 1W85B 3PD1A 4ZHQA 2OCAA 1NVDA 2SECE 3QUAA 2OWEA 2XRMA 4UD2A 1NQVA 1WWKA 4L08A 4OJNA 3TOZA 3RC3A 4DMFA 3P0IA 4IJUA 1JV2B 1T1IA 3GFQA 1OXXK 4D4LA 2CMDA 1QONA 3K16A 2W22A 4RK5A 3HABA 2NUTA 4AROA 5JXWA 4DZTA 2ZTSA 4G56A 1CLUA 1SQSA 2X3YA 3WLLA 1QKIA 4QELA 1G4AE 2J7PA 3NIWA 3O82A 4FMPA 4J75A 5LLSA 5A4FS 1N5KA 1KPHA 4OP3A 3GLHE 1AF4A 1GLVA 1AQYA 2C92A 4ZAWA 3LJKA 2FZWA 2Y1WA 4IDGA 4HS4A 2W70A 1BIFA 3OCZA 4P7FA 5FV4A 4ZALA 1Z74A 4Q4LA 4BPBA 3BTOA 1LS1A 1MIOA 1Z38A 3BSYA 3DBHA 4OU4A 3ZHVA 1SVSA 2H63A 4KFUA 5BQPA 5DI3A 4Q3DA 1S8NA 3OA0A 3WL7A 1LPPA 2YV3A 3KL9A 1QVGB 4R2MA 1Z6TA 1RTKA 4BGVA 1JHXA 4LOIA 3IA2A 3OAAD 4M6WA 4R2WA 1K7EB 1PV2A 4H17A 3MOIA 2AOTB 1W36B 5KX5B 1AN0A 3DONA 4LY9A 1ZJ5A 2PG3A 1TX4B 1Q2UA 3KEQA 2X41A 4JYCA 3G5UA 4FFOA 2POQX 4YP5A 3ZHRA 4FE7A 5C52B 2ZTMA 2ORIA 4YQFA 2YIJA 3N59A 3MLAA 1GRCA 3JWGA 3PR2B 1NG1A 2HLDD 4KQXA 3U3DA 1TJ3A 4R7GA 4ZI3A 4Z51A 1D2RA 4R9SA 1J2JA 4RM2A 1EUQA 1GU7A 1K7CA 2IUTA 2BM0A 3ZHSA 2QTHA 3QEAZ 5BWOA 4C4OA 1OWNA 1X7ZB 1DOZA 3K92A 4XKVA 1NMQA 1Q77A 5ALGA 1QB8A 2D3LA 4ZI7A 4JWTA 5L40A 4KR2A 3WIBA 3NRCA 4JSYA 3FUWA 2R79A 3GT4A 3H2SA 3RIMA 4PPGA 2KI5A 1FX1A 3OUTA 3QKUA 3G0BA 4CGYA 4LNUB 2F9MA 1VRCA 3TLMA 1E9AA 1NVEA 4HAXA 4KKSA 5G1PA 4N9WA 4WGGA 3SEJA 5K8UA 1WPCA 3M6XA 4Q15A 4ZHSA 3M1YA 1XNRB 2A57A 1Z0FA 4M0FA 3RC9A 1UD8A 2QD3A 2RJ3A 4IHJF 1P9WA 2I6XA 3VHXA 3U16A 3EIOA 2DAPA 4FB4A 1NRKA 3HMQA 1VJDA 3ROQA 3A4NA 4C2BA 4DDKA 3HA7A 4F06A 4TYMA 4N01A 4UASA 2VBSA 1CUSA 1QGYA 4PZEA 3V3TA 1TXGA 2EC5A 5KSZA 3IL2A 4ZI7F 1VQNB 5D3MA 3D6FA 4YRSA 1C0IA 1XTSA 1RQRA 3PITA 3M4YA 4G63A 3TGWA 4BKOA 1IEVA 4EELA 4AKIA 4XYGA 3F3YA 5L7YA 4R6WA 4RKFA 3TQHA 4O2BB 4QKQA 1T1RA 2B2CA 1JG2A 2E2WA 4Q3CA 1R37A 1L8LA 3GDHA 2V65A 4QXOA 4NOLA 4Z7OB 4WINA 4X8MA 4FFVA 5CH5A 3O2JA 3FYDA 1MABB 2GD2A 1MHTA 1FVXA 2OBNA 1UDRA 3L0IB 2OQVA 3BQJA 3NE5B 5IH3A 4TYPA 4AF8A 5AW7A 1P5RA 5KVSA 4EYGA 4JP5A 3GJ3A 2Z98A 4MNTA 2RFLA 1ZBDA 3ZKAA 1BOOA 4CFZA 4ZZ3A 3IMEA 3OJFA 3HJTA 1RADA 4YMIA 4LVUA 4BQIA 2ZPUA 1JDBB 1YRYE 4TSRA 2QI9F 2DT8A 2QM7A 3WBJA 5A8AA 1