2QN6A

Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the gtp and the gdp states
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
414
structure length
393
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
total genus 103
structure length 393
sequence length 414
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qn6A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qn6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qn6A01
4D25A 3L0OA 4TQ9A 3HR7A 2WJVA 1SVLA 1VMAA 2REOA 3RC8A 3VKGA 5B30A 1TEXA 2G1KA 4O3MA 3LO5A 1JJ7A 3TAUA 2ODEA 3L43A 4BEJA 2RHMA 4QC2A 3UMRA 3SQXA 1JJ2B 3CBQA 4UXHA 1G17A 1VECA 4QNRA 4MGKR 3VO2A 4W5HA 3CH5A 5FBRB 1VQPB 4JLNA 1MT0A 3KJEA 3U2QA 1QHIA 3DO6A 5K8LA 4CDGA 1IY1A 1MO4A 2GXSA 2WWGA 3FE2A 4YALA 3M1IA 1XPUA 2GZDA 4KSCA 2QSZA 1KMQA 5D3QA 1IHUA 4ZIRB 1NY5A 2QM8A 1M8PA 3NDBB 2QPOA 3RS2A 2R2AA 4KFUA 3DMNA 4WA7A 1H8HD 2AWOA 2BJWA 1EFHA 3RVBA 1E79D 2RAPA 4AY2A 3TRFA 1OSNA 2RGAA 1IN8A 1R2QA 3JVVA 4H1UA 4DSTA 4JLVA 2VEDA 3SE0A 4BFZA 5CB8A 3VR1A 2GZAA 2C9YA 1DTSA 1FMJA 1SHZA 5HR5A 4OQXA 3ETLA 1H85A 3JQQA 2E1RA 4MRNA 4QGHA 2IYSA 4M8NE 3W5IA 5JCZA 3UPUA 3G4SB 3CPWB 5B64A 3T12A 2EWWA 4MKGA 3RANA 2LKCA 1E9CA 3FFBA 3IIKA 4LY6A 5L8VA 1TQ2A 2EFEB 4LOAA 2BKEA 4OHWA 4URYR 3K70B 1OHHA 4EFMA 1NG1A 3KB1A 2P2LA 3VX3A 2Z4RA 4NCJA 2QAGB 2HF8A 4XSHA 4JKYA 2Q21A 3PUYA 3HPQA 2ZVQX 2ZSAA 2CNWA 3IBGA 1U81A 2FNAA 1T8UA 2D2EA 5FOSA 3ZS8A 2XNDD 1QX4A 2A5YB 5E4FA 2WZQA 4FMBB 3OEED 1VQ5B 2EFHB 3U60B 1N3BA 4KVGA 5TB5A 3EPLA 3A1UA 4US0R 1D2MA 2BEJA 1GWNA 1KIMA 2RKOA 3EWAA 3CM0A 3EC1A 3IIJA 2P0EA 1EFUA 5P21A 2D2FA 3Q72A 4M1OA 1KI4A 4TTRA 3B2EA 5JHGB 3VTKA 1NMZA 3B78A 1VG0B 2QDXA 3LVBA 2JLUA 5HTKA 4UXJA 1KD1D 2J59A 3CNLA 3LBHA 2VNIA 4O2RA 3I56B 2R8RA 3CIOA 2IXEA 4TL6A 5FOUA 5FPSA 2FN4A 2VP0A 2AXNA 2JLZA 4A92A 1NI3A 2CBZA 1W0JA 4PQYA 1AK2A 3R7WB 3H0KA 1D2NA 3LVQE 1QHHA 4TTQA 5IDVA 5C1BA 2D7CA 1W0JD 4QBGB 2PMDA 4M2LA 1IN7A 1E9BA 3BAFA 3I8SA 2H92A 2JLQA 3QI2A 4Q4JA 3QIAA 2JIZD 1E62A 4DZZA 4EQ6A 1UMKA 2ZM5A 2QAGA 5KSZA 4EKDA 2BF4A 2J0VA 1YQTA 1EWQA 2IWHA 4ZPXA 4Q19A 4PPNA 1LVGA 4P6VF 1W0KA 3X2SA 4E5UA 2ORIA 3WNBA 4G5GA 3PV0A 3R20A 4DLWA 1FX0A 1NBMD 2JJ2A 1ZM3A 1M2OB 2H7VA 3NBYC 3W2EA 1FP7A 4JIMA 4OYHA 4XOIA 4CEIB 2HLDD 4Q4AB 2HYDA 3QPVA 2ZI6A 1DG3A 1FQJA 2BPOA 4B43A 1K5GA 3DPUA 4ITRC 5GJCA 2ZPTX 1K5DA 2BMJA 1X3SA 3LLUA 1VQ4B 3CH4B 2F9MA 3CNNA 3QF4A 2Z5FA 3KUDA 2NGRA 2WSSA 4BASA 4B3FX 1LF0A 4B73A 2YOFA 1AZTA 2XB4A 3KDSE 4PPGA 4AURA 4GMXA 2V7QA 1EX6A 3S1AB 4G1BA 1KMHA 4WOPA 2VA8A 2ZJ2A 2C96A 5TXGA 5JJIA 1FFHA 2QGZA 3KL4A 4HAZA 2R65A 5JLJA 2B7BA 4LBYA 4UAJA 2AK3A 4ACBA 4IKEA 4B4DA 2G9NA 4OQNA 1SXJB 4WZAE 2R6GA 2RGXA 4LGMA 2QBYA 1TLLA 2F1HA 3GPLA 3ZYCA 2ZI9A 2OTLB 1JR3E 1NJFA 3P32A 1EWRA 5FR1A 3SDZA 4RZ3A 1G8GA 3U7GA 1E63A 3D7MA 1H8EA 3ZQJA 2JLYA 1MH1A 2GCNA 4TLAA 3R8CA 4DLTA 2FSGA 4RFVA 3LXXA 2RH5A 1GJRA 1VCNA 1OFHA 1UEIA 3WNDA 2CHGA 1M6NA 2GAOA 2PJZA 3EZ9A 3UKDA 4B47A 2WJYA 2A2ZA 2IT1A 3BBPA 1Q1ZA 1VQNB 3GLIB 2AL7A 2HEIA 5DH9A 1P2SA 1FDRA 3MD0A 3RRNA 2MSCB 5F9FA 3KZ1E 4CF7A 2GXAA 4TSFA 3K0CC 4P4UA 1DOAA 2O0KA 2QENA 3OE7D 4UNRA 2QMOA 2BV3A 1T3LA 4EPTA 1IBRA 1ZC3A 1PVOA 1BOFA 2W2VA 4CT5A 2BSAA 1LFDB 3U3OA 4HE5A 3GLGE 3H1TA 1QHSA 3OESA 3QSYA 5KSYA 3MRSA 2ZRFA 1E2NA 1XEWX 2NO0A 4JVNA 1E4YA 1E1RA 3CCJB 2IXGA 3SI7A 4AG5A 5DLQC 1PZNA 5CJPA 2BBSA 2B7CA 4A1FA 1X8KA 3A4LA 1W47A 2F6RA 2R62A 5LD2B 1KDRA 2HCJB 2VF8A 3FWYA 1CNFA 2VP6A 3K09C 2YINC 3W5UA 3V4FA 3RS7A 4LC1A 3V76A 5CITA 4LJ6A 4URVR 1VQMB 1D8TA 1JI0A 2VP4A 4P31A 2ZUBA 2OCPA 3KFVA 1F3OA 5GVSA 3ZQ6A 2XTNA 3W9YA 4DLVA 2WKPA 1HTWA 2IYZA 3SJCA 4DB4A 2O52A 5BW8A 4ARZB 1W36C 2QEXB 1D5CA 2CHVA 1P62B 2BVNA 4ZO4A 1FTSA 3ND9A 1Z07A 1RYHA 4JLBA 1J2JA 4WZBE 1QHGA 1ZUHA 3RS5A 2FZ4A 2GXUA 3P4XA 1W1WA 4B35A 2ZR0A 3GLFE 2ZRKA 2OSBA 1MO6A 4OQLA 4RFSA 2VNHA 2F43A 1LB1B 3PJRA 3PQCA 4KAXA 4Q7KA 3A6PC 3B1VA 2ZJ8A 1E9AA 3CCUB 4DSUA 5AJYA 1NLYA 2FPLA 4IFEA 4IW3B 2J1LA 3QKTA 3CCEB 3IIMA 1XFAA 1N6PA 1N5LA 1AKYA 3AKEA 1NDHA 1KI1A 3AUXA 4ZGNB 4LV8B 4AG6A 1M34E 2OAP1 2V1UA 5DN6D 2C9CA 3OIWA 3PITA 2BOVA 2IYXA 2A5JA 2G3YA 3E1SA 4Q1BA 1BH2A 4MYTA 1E9FA 2A9KA 2GK7A 3LBNA 2OCYC 4EQ6B 4LHWA 2WWYA 4PPFA 5FUWA 4DEYA 1GILA 1FNDA 3IHWA 2QAJA 3TUIC 4Y9RA 1DAHA 3PEVA 3IQXA 1G41A 1XB2A 2QROA 3QBVA 2OBNA 4KLNA 4MUAA 2IUUA 1FQKA 3W3ZB 2GILA 1X1RA 2VZLA 5K8IA 3DMDA 5HPYB 1GG2A 4FMDF 3GFOA 1Z2AA 3NIBA 1ZCAA 4DWJA 1N5JA 4ZKEA 4Q21A 1KDOA 1DDGA 3WMGA 2AXPA 1N6RA 4AD8A 3K9LA 3CX8A 2DFNA 2PZEA 2OBLA 4RFSB 2H5EA 4BLPA 3MHPA 3CRRA 3I5XA 1F20A 2ZSBA 1RJ9B 1T5LA 2JGNA 3AEZA 5HE9A 5KNCA 1RPZA 1ZM4A 1IXSB 2PZGA 2YJTD 1E2HA 5FTMA 4XWKA 4GT1A 4QGGA 1FUUA 1JNYA 2SHKA 2VSXA 3W6PA 3MSXA 3A1SA 3GJ0A 4Q5IA 2Q3MA 1XX6A 2ZI3A 1XE1A 1AKEA 2YNMA 4PXAA 1SKYE 3P20A 1Q81D 2QT0A 4IDHA 4DCNA 2QM7A 4CZ2A 1VG1A 1UJ2A 4TQAA 1SVKA 1JA0A 4I1VA 2W6ID 4R2HA 3BB3A 1XJ0A 3CZQA 1OH7A 4LHZA 1I7PA 3T15A 1IJEA 1TMKA 2KWIA 1VQ8B 2WPDD 4E22A 1P3JA 1Z29A 4V02A 4OQFA 2WVJA 1E6CA 5CM8B 4URUR 1N0VC 3EA5A 3SBDA 3QXSA 5ANRB 1BJKA 2OBMA 3JZAA 1KZ7B 1XCPA 3QXHA 1OXXK 1G8HA 3CC2B 4WXRA 1QF9A 2X77A 2WMNB 1YRAA 2ZJYA 2QMEA 5JCPA 3NKVA 3TUZC 2PBRA 4NCKA 1YJ5A 4Q18A 4QBHA 1HV8A 3AKDA 4NYIR 5D3MA 2WWXA 2DPXA 1BIFA 1E99A 2XB2A 1GIAA 4M9QA 4X8MA 4BFUA 1COWA 4GL2A 1Z6TA 3QQ5A 4Z8YA 4BEBA 1D9XA 4E03A 4N0EA 1G18A 1IQPA 2YKGA 5JRZA 4P0TA 1EP1B 3W6NA 5JECA 1VQLB 4QXAA 3TJZA 2JJ8A 1I2MA 4DUGD 4PC7A 2WSSD 3IO3A 5A5GA 1FMLA 1WE2A 5E7JA 2WJJA 1G3RA 1RKBA 1IN5A 2GJAA 4HUTA 4M4SA 5TR9A 4W5JA 3IEUA 2FA9A 2XSZD 4BPBA 1CR2A 2P6NA 4L8GA 4DUGA 5FOTA 621PA 5DSZA 1S9HA 2F55A 4MYUA 4C0JA 3QFRA 5L3QB 3GLHB 2QAGC 4PC6A 1JEDA 3CRQA 3H4MA 3FDIA 2HJGA 1E79A 3E1YE 2TMKA 1T0HB 2REBA 3AVPA 1L7VC 1UBFA 4NTZA 421PA 4NPHA 1W4RA 1OIVA 3ICQB 1EP2B 4EFNA 3KQHA 1EFCA 3A1TA 1OW3B 1Z6GA 3X1DA 5K8UA 2GBLC 1GAQA 1GNRA 4DC9A 2CK3D 4EPWA 3CCRB 1OYYA 2NOAA 4JSYA 1XD9A 1W4BA 2OT3B 5AJZA 2WWFA 3F8TA 3QNUA 3T5GA 3GLGA 3ASZA 1XBTA 4O0MA 1JQJC 1RJ9A 1OE0A 4JBWA 3LQRA 4JSTA 2GAAA 3ZJYA 1T6NA 2BKUA 3HU1A 5KO2A 2QBYB 4LYHA 5JFGA 1G7RA 1CBUA 1W4AA 1AS3A 1A2KC 2ZYVX 4NE2A 2NZ8A 4BLSA 1LS6A 2BIFA 3FFAA 5FA6A 3TR0A 2O8FB 3OW2B 4MKIA 4TMWA 4KBFA 1VQOB 821PA 2FG5A 1ZYUA 2PIAA 3U44B 5EE5B 4ABYA 4E07A 1S4QA 2FJUA 1GAWA 3FPAA 1E2LA 5DI3B 4LRWA 3RLFA 3QEJA 4ERNA 1MRSA 1OKKD 4CW7A 4Y9UA 5CB6A 1XMVA 3BS4A 2CEAA 1LV7A 4JMPA 2W00A 3EZ7A 4Y0VA 5BYKA 3U5ZB 1DG1G 1ESNA 1W2GA 2IUTA 3O8CA 2QU8A 1GKUB 2RCNA 4KLZA 4DLUA 5FTJA 2I4IA 1TU3A 4ZCLA 3CONA 3CWZA 3RHFA 1WB9A 2RC6A 4ZCMA 3W5HA 4PHGA 3DM5A 4GP7A 3GLFA 3LW7A 1R0WA 1N6NA 3QKSA 4ZKDA 4M9XA 4M1SA 4RKFA 5EE9A 3WMFA 3PIRA 3CPHA 4F4IA 2C77A 3G5UA 5KTYA 4B34A 4MDEA 4F7DA 5EMNA 2IYYA 2VHQA 5B58C 1CS4C 5F2EA 4CEHA 2ZYUX 3OFNA 4B75A 2CCJA 2QY9A 5A4JA 2WIBA 2FEMA 3BE4A 4BFSA 4P33A 1G5RA 3T5DA 2ZQ5A 1MV5A 3GCGA 4JL5A 4P4SA 4YONB 4F92B 1XMJA 3I4LA 5AUQA 4Q1DA 3WP1B 2ZS8A 1QGZA 2C78A 4NYMQ 2AR7A 2OXCA 4R7ZA 1NG9A 2IW3A 3K0FA 4ZDKA 2BM1A 4YAUA 2ZI5A 3KX2A 1Q3TA 2XXAA 5E7IA 2J46A 3GJXC 4LWZA 2DY1A 1IXRC 4ON9A 5EXTA 1H42A 1ODFA 3GLIA 2OXRA 5ELXA 2VP5A 5EP4A 2GDJA 3E70C 5GJVC 3TIFA 2UZIR 3LV8A 4U02A 3WRXC 4YMSA 4PC2A 1NJGA 1D2EA 5FPHA 4GSYA 3TSZA 3NEJA 5AUNB 2IK8A 2IXFA 3LNCA 1R6BX 2Z83A 2D74A 1OV4A 2KSQA 2ZREA 2XNSA 1D9ZA 2GRJA 3BFVA 2ODWA 3K0CA 1VG8A 1VKJA 1P9RA 3PXGA 1XPOA 3W2FA 4ZV4A 4PQFA 3TSOA 4X8HA 4Q1AA 2XSZA 4O25A 2XX3A 2I1VB 1II9A 2IBMA 4PZYA 1RRPA 1NJID 2GVZC 3VAAA 3GLHE 4M1MA 3THYA 4HATA 3TQCA 4G5QA 3GJ5A 1G5PA 2EIXA 4FXPA 5KDOA 2GJKA 4B3GA 1AJEA 1R4AA 3O47A 1MKYA 2WM9B 1W46A 2XGJA 3IPXA 4YDSA 4WW0A 4AYWA 1EK0A 4C2UA 1GL9B 1Q1QA 2O8FA 5JWOA 3EPHA 2VP9A 4B6FA 1Q1BA 2R6AA 1G8PA 3KKNA 4URWR 5L3SB 2VHTA 4EJSB 4JLMA 1XPRA 5FFMA 2PCJA 3T1VA 1KO7A 1TNDA 2CE2X 2A78A 2IC5A 1CJTC 2EU8A 3U7EB 4OJQA 1A82A 1J8MF 4LJ4A 2IS1A 5TMPA 3A8TA 1QBKC 4XD7A 4TZ0A 4ZIRA 1SKYB 4U00A 1GR1A 4A8JA 3BH0A 2ORVA 1DAIA 4IJMA 2W83A 4IVPA 2ZJZA 2BMFA 2Q9BA 2ZU0C 4HI0E 3FMOB 3W8RA 1DDIA 3LX8A 2BEKA 2CJWB 4A15A 4AWXA 2AN9A 1G3UA 1J7KA 1N5KA 3RS3A 2ZE6A 1KSJA 1YKSA 2GK6A 2VQSA 3ECCA 1SXJC 4KBGA 1LY1A 3QVUA 3KUCA 5CM9C 2PT7A 2JDID 2OFOA 4KSBA 4C30A 4G5SA 1YRBA 4BFYA 3CRMA 1XU4A 3EW9A 2JLWA 3KTAA 1VYUA 4AK9A 1AM4D 3WHKA 2FFAA 3IGFA 1P2UA 4HDCA 4GP6A 1V43A 1OPXA 1HURA 1AGRA 1UKYA 3A1VA 1A7JA 1ZP6A 2O8CA 1KK2A 2H1LA 4D4MA 4LK2A 5JJKA 3LO8A 2CCGA 5BN3A 3BWDD 4TMKA 4GOJA 4IOMA 4AYTA 1DVRA 2XEXA 2W2XA 2HV8A 5FI0B 3SHFA 4BLTA 3IPYA 4EPVA 1EG7A 3K0EA 2H57A 2P6UA 2QUZA 4LV5B 2MSEB 3CXCB 3T61A 2GCPA 2FE4A 4TYPA 1WRBA 2ZRHA 5FBLB 2ZJAA 3SFZA 3AVWA 4TYYA 2BGJA 4GOXA 3THYB 1IOZA 4DJTA 5L3QA 2VSFA 4HUQA 4AF7A 1SHKA 1YR7A 2V54A 2ZRNA 1W49A 4HLDA 4Z54A 2CNDA 1XZPA 2XJ4A 1E9SA 4B33A 3CX6A 5FTKA 1OFUX 4IFBA 2PX0A 1M1YE 3CCSB 2XTMA 4U7DA 5DE3A 2NMVA 4EJSA 1U98A 2V7QD 1Q1EA 4UNNA 4DXAA 4JKIA 4LJ8A 1A4RA 4KXFB 4FCWA 4CGZA 1E2GA 2OLKA 1ZNYA 4E09A 1XXHB 1P61B 3KQLA 3CMAB 3VR5A 1RRFA 3VU9A 3TBKA 4DEXA 2YWGA 4HYYA 2REXB 1KQSB 4LX0A 1I4DD 4XVUA 5FL7D 2DBYA 4PHHA 1Z0JA 2IYUA 2HLDA 4B32A 2KI5A 3VHXA 2ZAMA 1O3YA 2QPAA 1PUJA 1QHXA 5BXQC 5CJ2A 1R8QA 5EXXA 4D6PA 4LZZA 3CF6R 4GFDA 4W7SA 4TQUS 1G8YA 3T1QA 2KB0A 3IBYA 1GL7A 2CHQA 4QG7A 1Q21A 4FINA 4PZZA 3I8XA 3SYKA 2JA1A 4MUBA 3FYHA 4EUNA 1HT2E 3VKHA 2YVUA 4XTRA 4B2PA 1KAOA 1GRNA 1D1NA 3KQUA 2ZRPA 1OYWA 4DQKA 1CULC 2V8OA 4WAUA 4C0HA 4WZ6A 4PAQA 4WVFA 1HE8B 3OIUA 2WV9A 3TH5A 4JL8A 5IT5A 2AD5A 3AP3A 4IEIA 3LW8A 1U99A 2ZAOA 4LBZA 2P5TB 3MUFA 3TW8B 3LDAA 1Z47A 4MRRA 3ADKA 4DCUA 2MMGA 2FFHA 4Q03A 2DWOA 1PLJA 2OCAA 3RS0A 1KJWA 4QL3A 3RSOA 1G3QA 3B9QA 2AX4A 1KI3A 4I99A 3RNLA 1CJVC 2IEZA 1E2IA 3ZBTA 1OF1A 2NQ2C 3ZVRA 3ADDA 2NO1A 2A5GA 5F98A 1Q86D 5CLLA 4D0LB 2Z4SA 3UANA 4A82A 1JECA 1JXMA 4C9BA 3R9XA 1QZXA 5TDHA 3RYTC 4N0DA 1G20E 4MGYR 1X8JA 2ZSFA 4I81A 4LSGA 5BWMA 4LJAA 3Q7PA 3EWSA 5IK2A 4DBLC 3GLIE 5FUXA 1NP6A 4A8JC 5SZJA 4W5WA 4DCVA 2WTUA 1OH6A 4TSFD 2YC4C 2BN4A 2I3BA 3AM1A 1E9DA 4QKQA 3I61A 4YAWA 2CNWD 1N6OA 1Q12A 2B5OA 2BJVA 1YR8A 2PH1A 1NVWQ 3RWOA 1DO0A 1G3IA 1IJFA 5LPNA 3SEAA 2EFDB 2J0QA 1NVXQ 3JQRA 1KDPA 1UFQA 4OI4A 3GLGB 1P2VA 4TLBA 1OGJA 4NP6A 5JMTA 1FP6A 2A5FA 2WWIA 4KO8A 5KSOA 4OK5A 2EFGA 3E20A 3B1XA 4ASUD 4OI2A 1OFTA 1U0JA 2G77B 2JCSA 2ZU6A 4IVQA 3GLHA 4PSVA 3ADCA 1KO1A 4HAXA 3U6BA 4ZGQB 3DOEA 3QF4B 5HXBA 2AKAB 3TQFA 5C2JB 4QBFA 4GPTA 3E5HA 2IYWA 4MA4A 4GDFA 3K8YA 1T8TA 1C4OA 2J0SA 2OZEA 2WSMA 3CB4A 3MFYA 2EFCB 3L8YA 1JB9A 4AKHA 1AQUA 4FWIB 4D81A 4B3BA 1JALA 1G1MA 3QXCA 1DE0A 4MRVA 5H8WA 3AF0A 4G1VA 2QE7D 2IX3A 2GVDC 3DKVA 2FEOA 4UJ5A 2EQBA 2BBTA 4PC1A 5EP1A 1A1VA 3VMFA 2CE7A 2Z43A 4M0LA 1RW4A 2QZ4A 3AVOA 3ND8A 1ZC4A 3REFA 4C7OB 3VKWA 4KJZA 1Q0UA 5FUYA 3QY0A 5EE1A 2ZUDA 3B1ZA 4OHZA 1MABA 3CD6B 3RRYA 3SOPA 1VCIA 3K1JA 5D3MB 3CPJB 1TF5A 2QSYA 2XZPA 1CXZA 2JASA 3QKRB 2JJ1A 2HMAA 4FCTA 1D6JA 1G4UR 3EG5A 4YQFA 2QTLA 1E98A 1V5WA 4PSKA 1XEXA 5SZKB 3UMSA 2D3WA 2BGIA 1HT1E 4TYWA 1KSHA 5BQ5A 4RZ2A 1VIYA 2AKYA 2ZS7A 2QMUA 1SVSA 4A2WA 1OB2A 1SULA 5EZ6B 1LNZA 3S1AA 1BO6A 4BECA 1CQXA 1ZW6A 1G64A 1HY3A 1FNBA 5JSZB 3LX5A 3NC1C 3W3AA 2F9LA 5KU1A 1AZSC 4YC7A 1F5NA 2D7DA 3D3QA 4XVRA 2MSDB 2B92A 1P72A 1VQ6B 2ZRGA 2F1IA 1HYQA 4GBMA 1JA1A 3MG9A 1QG2A 1UM8A 4JJKA 4K81B 2PEYA 2WWHA 2JLXA 2P5SA 4Q7JB 3P1JA 3K9NA 1Q44A 1XD2A 2Y8EA 3QKUA 4BLRA 3K09A 4QGAA 1KI7A 1IN4A 3WY9A 3PG5A 4B71A 2D4HA 5JEEA 4TYQA 2ZSEA 3TGPA 4G5OA 3GEHA 2AWNA 2VNKA 2ZJ5A 3NXSA 1DARA 2G1JA 4JVSB 4DDWA 1CNEA 3B1WA 3NBZC 2FV8A 2QP4A 3NTUA 3DDCA 4KCGA 4M9ZA 3U3JA 4EPXA 3TMKA 5B57C 3KQKA 4POAA 5AJVB 3F0TA 4S2EA 5CK5A 1YITB 5L3RA 5HKKA 3KXLA 4HEJA 1Z5ZA 1TF7A 4V0ME 4FK8A 2JJ1D 3AH8A 4LV6A 4OKSA 2FX3A 3CLVA 3M0EA 1B2RA 4NMMA 2VBCA 2V3CC 4UQOA 3MWYW 1JXOA 5KNBA 1YR6A 5CYPA 1QHYA 1Z0DA 3D8BA 4ZI2A 1Z0IA 5TY0A 3W2IA 4FMCF 1AIPA 1YZNA 1P9NA 2GBLA 3OAAA 2GJSA 2C98A 1WA5A 3P26A 1X86B 1YJ9B 3AGPA 4HLUC 3BD9A 1ZM2A 1F2TA 4Q01A 3ZD7A 2IWRA 5EQTA 3M4YA 4A0HA 1KNXA 2PMKA 2ZVPX 4N1AA 5LB2A 4DRZA 2RGNC 4A4DA 1PLLA 3AB3A 4MKHA 3ES9A 3VNVA 2CK3A 3QJYA 5AJWA 1R7RA 5KPDA 1R5BA 4CEIA 2CLDX 2IYQA 4RZXA 3KTAB 1U90A 5F9HA 4PTLA 1E4VA 4YMUA 4AKIA 5LB4A 4MGZR 1QFZA 1RRCA 2DEUA 4NDZA 5CYOA 1GO2A 1Q3HA 3NHAA 2XNDA 1Z6AA 1KI8A 4QBIA 3SQWA 1DO2A 3QFSA 1VQ9B 1T9HA 3OHMA 2KBEA 2J41A 5IRCD 3QFTA 3MAAC 4HLQB 4FN5A 3K0AB 1M7HA 1RYFA 1CJMA 1J70A 1NN0A 1NVVR 2NTYC 1BKDR 2IA5A 2WKQA 4JT2A 1KJYA 3SBEA 2ERYA 4YXWD 1UKEA 3PEWA 2H16A 1LS1A 4R9UC 3K53A 4HAUA 5M04A 1W34A 4AI6A 3AVTA 1P60A 2ASEA 4LBVA 2OK8A 3QENA 4A0GA 5EZ5A 2QE7A 2Z0MA 2RB4A 1UDWA 5H5JA 4IDQA 3P27A 1W36D 4B48A 1F6BA 1SXJD 2YYZA 2ZRCA 2GJ9A 1GM5A 1CLUA 4JVLA 3HJNA 2J0UA 2BM0A 4C0SA 4MYCA 2XNCA 5FBVB 4J0QA 1CKEA 3CX7A 1QUEA 1AQYA 1M74A 4I4LA 5DYGA 1UKVY 2J5XA 4QRHA 3PEUA 1TVCA 2ATVA 2J7KA 2NO9A 4NBSA 1XXHA 2D62A 2GESA 4JLKA 5FPYA 4V0OA 4C0AC 1OXTA 4ESHA 2VHCA 2V55B 5JWHA 2J45A 1O87A 2VPPA 3BFXA 4Q9HA 2O8EB 1FNMA 2AHOA 1YHQB 1E2PA 1N8RD 3NWJA 1N6HA 1UKZA 4HDQB 2FZLA 4M1YA 4TL9A 5AK0A 1GL6A 3WXMA 5EP2A 5G40A 4R71A 3FVQA 3GP8A 2RGGA 1NBME 2C03A 4UJ3A 3CW2A 5EXSA 5L3VA 4S35A 4CEJA 1WXQA 1BMFD 1Z0KA 1P4SA 2ZYWX 3B85A 4FCVA 4R2IA 4A6PA 5A0FA 2ATXA 4A36A 4XD7D 2G83A 4NH0A 1MABB 4Q1EA 3AKYA 4EJSC 3O8RA 1JBKA 2HYIC 4A2QA 721PA 2J87A 3Q5DA 2FPMA 3UWKA 1OH8A 2V4ZA 5THXA 1NY6A 1XTJA 2Z6VA 1DAGA 1NSTA 5AWFC 1DAFA 3EA0A 4EDHA 4B44A 4TLEA 3JZMA 2OUKA 4K8OA 2FDCA 1KAGA 3AVXA 1N6KA 4GZLA 2JIZA 2J0UB 4OHVA 3FTQA 3AF4A 3L0PA 1KTVA 3ZGXA 1SGWA 1XWIA 4JBXA 3D6TB 1PUIA 1TADA 4PSAA 4TLCA 4BFXA 2RGEA 2W6IA 1QGYA 3U44A 1KY3A 2FGJA 4PO1A 3IHLA 4RCZA 1YZGA 3FJOA 4EIWA 4UNQA 1WBBA 2O8BB 3X1XA 2IHYA 4HE6A 4IDOA 1E64A 4PO9A 4QFMA 1W4CA 2IYVA 4P32A 3AUYA 3SC3A 4Q7MB 2GXQA 5FPKA 1IXZA 3C5CA 3OFND 4AIIA 1S72B 3AVVA 2C2HA 2D06A 3IQWA 1G6OA 1NN3A 3GJ7A 2ZRIA 2WJHA 4KI0A 5AUPB 3IKJA 1HQYE 1JR3D 1GTVA 4CRWB 1VTKA 3BB4A 4ARZA 4X8LA 2B6HA 4Q02A 3OEEA 3G71B 4Q00A 4Z8XA 1SKQA 3NVAA 4B3XA 1AN0A 2QTVB 1Z83A 4Q9IA 4UNSA 3WMEA 5KPJA 5EXPA 4LC0A 4BQSA 4GI7A 3I55B 4IXMA 4XWAA 3K0SA 1W5TA 1Q57A 2IEYA 6Q21A 3SYNA 2NPIA 4LI0A 4M21A 1OKKA 1F48A 4Q66C 3ZZTA 3ZDQA 1KO4A 5HKKD 2J7PD 2OFWA 4FI3C 1KC8D 1S9DA 3WP0A 4DDUA 1GOTA 3PUWA 2BBWA 3AVYA 3LA6A 4KYIB 4TL8A 2A3RA 3Q5EA 3U7HB 1R5NA 1T5IA 1W44A 4OK6A 1IY0A 2ZTSA 3MCAA 5EP3A 1OB5A 3V4RA 2CDNA 4FIDA 2QNRA 3OAAD 4LUCA 2PCLA 4B3DA 3CC7B 1CJKC 4MRPA 1E2JA 1E9RA 4TT3D 3K70C 2YHSA 2ZRDA 4LPSA 5CLQA 5FL7A 3O8DA 4P4SB 4JT4A 4P4TA 3CR7A 1MO3A 3HYTA 3SFVA 4Q1FA 1EFRA 5EE0A 1LTQA 2LKDA 3RRMA 1I4LD 1G291 2CMKA 3T35A 3WRYC 1W5SA 3WHLA 1SVIA 3KB2A 3CF0A 2C8VA 1J8YF 1KK3A 4OK3A 3THXB 1KRHA 3U61B 3C5HA 2YOHA 3VX4A 1E96A 1Z08A 1Z28A 3EIEA 3Q8XB 4JLJA 3F5FA 5UKDA 1GUAA 3TR5A 3MWKA 3FOZA 2ZJOA 1IONA 2W6JD 3QKRA 3RS4A 1E32A 2DYKA 2WAYA 4I1OA 1ZRHA 1OH5A 4IRUB 5KUTA 2GA8A 2O0HA 3RABA 3MMPA 3HPRA 3U3MA 2BWJA 4F91B 1PJRA 1VDZA 1S1MA 5DI9A 4OHYA 3PVSA 2VNJA 1TU4A 2CCKA 3BOSA 1OJLA 3K0AA 3BK7A 5B2ZA 5KSPA 2E9SA 2KJQA 2QQ0A 3A58B 4UNPA 1ONBA 1I2DA 3BH6A 4DLYA 3QFCA 5CIWA 1T3SA 4YMVA 2ZRMA 2BMWA 2ECKA 4NONA 1M1KD 4L4UA 3TAHA 1WQ1R 3V00A 1EGAA 4HB2A 4ESVA 2W0SA 2CL7X 2JLSA 1QGAA 2OM2A 3X1YA 4QNMA 8OHMA 3OJWA 3Q9LA 3B5JA 1DS6A 1JEEA 2VIIA 3GEEA 4MGIR 1GITA 4CYMA 5IK2D 1ELOA 2CRVA 1QG0A 1XJCA 1ANKA 2IYLD 1TQ6A 2CJWA 3THWB 1ZIPA 1UADA 2UKDA 2B8TA 3CCVB 1GNPA 1NIJA 2GWHA 4I1SA 4OL0A 1IY2A 1ZNXA 2B8WA 3UK6A 5E3HA 2N46A 3H84A 2CVFA 1E2MA 1E69A 1GKIA 1CU1A 3EXAA 3VR6A 3U4QB 2HCBA 1XRJA 1ZVQA 4LCBA 4LYJA 4OI1A 2QMHA 2A5DA 1IB0A 1Z0FA 3DZ8A 3OZXA 4HB3A 5J4HA 3EC2A 4HB4A 3OIYA 4WIAA 4F4CA 3VFDA 5JI3E 1KKMA 1NKSA 3HDTA 3CZPA 1U2RA 1WCV1 2QTHA 2E87A 3L0IB 1XF9A 4NYJQ 2F3RA 1ZUIA 3WYFA 5KDDA 4HZIA 4Q1CA 5FL3A 4CVNA 1G9XA 2BC9A 1ETUA 3KJIA 4HB0A 3VR4A 3A1WA 1NL3A 2IYTA 1TAGA 3NBXX 2XNJA 5KHOC 2O0JA 3D31A 1Z3IX 3SS8A 2QQEA 1J99A 2DFKB 4LDJA 4OJKA 1E2DA 1S2MA 4Q4AA 3FKSA 4BFVA 4A0RA 4HZUB 4L5BA 4YMTA 3FKQA 5DN6A 2ORWA 2R6HA 2X2FA 5KDLA 5G3ZA 2Q9CA 2HJVA 4PHTA 4PO8A 4EFLA 3QF7A 4JLAA 4TTPA 1F2UB 1CP2A 1FZQA 1P2TA 3DOFA 1ZU5A 1E9EA 1Q20A 1QRAA 2OHFA 2P67A 5EE3A 1N5IA 2ZSDA 4JLPA 3NBFA 3WBJA 1GRRA 1LW7A 3R9IA 2BHRA 2ZIAA 1AS0A 5JBQA 4V0NA 3LH5A 1M7GA 2XXAB 3GD7A 4BZXA 2O5VA 3QXJA 1RFLA 5GV7A 1S3GA 2X8AA 4OI0A 4A2PA 2Q3FA 4QM6A 3KKPA 4GNKA 2XAUA 2HDNB 4B6EA 4AKGA 2X3UA 1FOEB 1G16A 2Q9AA 3PCRB 4JJZA 5J4YA 2N42A 1Z6YA 5KYKA 1KI9A 1GAJA 2EWVA 2AK2A 4V0MA 2KE5A 1XNJA 1XTRA 3AF3A 4Q47A 3BXZA 4NZYA 2QG6A 4M9SA 2RC5A 4JZKA 5FTNA 1L2TA 1N2CE 2VHUA 4GRAA 4C2TA 3W5JA 1ZIOA 3N5CA 2DB3A 1EESA 3OJXA 1ZM7A 2X19A 4Q7LA 3VU9B 1ZJ6A 4YMWA 2ZI4A 1FNCA 1N25A 4EH1A 4F4JA 3LLMA 4L16A 5KOYA 1CJUC 4XTCS 3B1YA 3Q85A 4LJYA 1FNNA 3HP1A 4V0LA 4CEHB 3ZVLA 2F1JA 4HAWA 1YHNA 3AF2A 3UG7A 3J81k 2NIPA 3CMEB 4YLGA 1KO5A 4DT1B 3FKSD 2AFHE 3WYAA 2ZR7A 3HU3A 5TVKA 4ZDJA 3ZD6A 2PL3A 2XJ9A 3ONWA 4LYAA 4KITB 3I5YA 3G82C 4PQRA 3TK1A 1BX0A 3EPKA 1G7TA 4OBEA 5FI1B 1KK1A 4A0FA 3TSWA 1UAAA 1NLZA 3CPEA 3ICEA 1CF4A 4N3GA 4IVRA 4AKEA 4CIDA 1WBDA 2X1VA 4BLOA 1AMOA 3MLEA 4KFTA 3FHTA 3SU8A 4P3YA 4B76A 2VYQA 3SNHA 1E2QA 3EZ6A 1VPLA 1GDDA 1XDBA 4K46A 4RSGA 3G0HA 1CRPA 4YAFA 3LVRE 5CIQA 3KFXA 3PENA 1LF5A 2VSOA 2IYRA 1W2HA 4IOLA 3CF2A 3ZLJA 3GJ4A 5J4LA 4TMVA 1K8AD 4B3CA 2CL0X 2BCJQ 3FGNA 3QXXA 4Q9JA 1ZAKA 3A36A 1H65A 4QJ4A 4Q9KA 3SJAA 3X1ZA 1EP3B 3W34A 2ZE7A 3MGCA 3ZBUA 3OIVA 4HAVA 1QVFB 5HCNA 5H70A 1CR1A 3RSLA 1QVGB 1RZ3A 1NSFA 4FD2A 3VR3A 2GEUA 3F3YA 1KHTA 2PT5A 4IOJA 2ZI7A 3ADBA 2IHBA 1KY2A 1DADA 3P4YA 1IN6A 1R10A 2ZRBA 4MRSA 3BERA 1GFIA 3UWOA 5J5CA 1R0YA 2WJGA 4RD0A 2H8KA 3RDPA 1U0LA 2XZOA 4D80A 4DB2A 1HH4A 1KNQA 2R6FA 4PC3A 1N6LA 2KBFA 5IF9A 1G21E 3DHWC 1YVDA 4JYCA 3L8ZA 1EFRD 4RD1A 2VLIA 3W2HA 5CK4A 1NNEA 3AGQA 1W87A 1MR3F 5JI2E 4BGDA 1OXVA 2ZROA 3NEYA 4C4PA 3AKCA 3HWSA 4GMDA 1Q22A 3RC3A 3BRWD 4KFSA 3B13B 1RRGA 4BFWA 2GCOA 1E0AA 1Z8FA 3FHOA 1BMFA 4D82A 4F93B 4UKDA 1P75A 2W6JA 4Y7CA 121PA 1KOFA 1Q7YD 2C9OA 3EIQA 2QORA 4V0KA 2NO6A 5L3SA 3QOFA 1BS1A 2C5LA 3CRZA 1JPNA 2ZYTX 4QOSA 1ZINA 2J3EA 3OE7A 2YC2C 2OESA 1G8FA 4C0LA 4URZR 1T4GA 2ODBA 3QG5A 1R0ZA 5LBIA 4CEJB 2IF2A 1BYUA 1G7SA 1VHLA 2EYUA 3EZFA 3L2OB 3QPUA 3KQNA 1II8B 4OHXA 2DHRA 1A8PA 2WAXA 4UXIA 2RMKA 1W48A 1RIFA 3KJGA 3VHLB 3SHWA 4Q4HA 5J4KA 3TW4A 1XCGB 2FU5C 1E2FA 2BCGY 3LBIA 2O8EA 1T3HA 5H59A 1M7BA 4TLDA 2DWQA 3UXMA 1NRJB 5FTLA 1FUKA 4D26A 2PX3A 1VYTA 2DCUA 5FH9A 2PJRA 3IO5A 4C0BA 2WOOA 5AR1A 1JPJA 1OGIA 3L0SA 3EX7C 1J90A 3AP1A 4HSEA 4JYBA 4XH9B 1ZNWA 2FFBA 1EWYA 4KYUA 1OIXA 2LCFA 1P7CA 1P9WA 1WMSA 2AFIE 4HUQB 221PA 4DDTA 5DNYB 2FSFA 4TMTA 2GJ8A 4RD4A 3PUXA 4PFSA 1S8FA 3AQ4A 5H68A 1TF2A 4NKRA 1NVVQ 1GVHA 1YZQA 3IILA 3KKMA 3RWMB 4Z1MD 1Y3AA 4DT1A 3EPJA 1G3MA 2C99A 2XTZA 3MWJA 4KU4A 1NN1A 2CLCX 1U9IC 2X2EA 1SZPA 1YE8A 1L4YA 1UF9A 5FBQB 4MITA 3THXA 5FPTA 5LDDC 4M1WA 1K8RA 4F7WA 3LAWA 3ASYA 3LWNA 4II7A 4BWYA 4DVGA 4ZDIA 4NCIA 5FOWA 3HU2A 3LXRA 3OEHA 1U0HC 3W90A 5EJEA 2GF9A 2F7SA 3JVUA 1Z6XA 2OV2A 3U4QA 2NO7A 2QTFA 4F38A 3FMIA 4JVMA 4Y0AA 1ZNZA 3C4JA 4BPRA 4BRUA 1S96A 3ZIAD 3B7GA 2CVHA 3TUJC 2HUPA 3VNUA 2W0MA 5HZKA 1XP8A 4FW9A 2O8CB 1Z22A 4IEEA 4DLZA 4JS0A 3TVDA 1K6MA 2PEZA 2VHJA 4US1R 3QEOA 4FMCB 3EIHA 4PX9A 3GFPA 1F2TB 4IDNA 2ERXA 5BYJA 1GKYA 2G0NA 1XTKA 4QJ3A 3B6EA 1AA9A 1AS2A 1AGPA 1G5TA 1NLFA 2OO7A 5GJWC 1KMHB 5FUVA 521PA 4DIEA 2ZXUA 1FPMA 4QHYA 1CIPA 1T0JB 3CRW1 4RY2A 1G19A 3H86A 1TEVA 1DAKA 4Q4JB 5C18A 4HLUA 4RZUA 2VYFA 2G6BA 2DWPA 3A37A 2F43B 3U7FB 2OCBA 3EARA 3KJHA 1KYIA 4Q48A 5GVRA 1S1CA 3NH6A 2HT1A 1TUEA 2Q0HA 2GEDA 2P6RA 3OEHD 1ZD1A 4V03A 2F3TA 1E0SA 1Z63A 3BH7A 2G88A 1X6VA 2V6IA 1H8HA 4FWTA 1QVRA 5J40A 4D4LA 5IHPA 3A4NA 1T91A 5H1YA 3B60A 4X8OA 4MDFA 1OXUA 3ZVMA 1QVAA 5DO9A 2ANBA 2JDIA 2VF7A 3I32A 3B82A 1Z0AA 4LBWA 2ZEJA 4JLOA 2IF0A 1UPTA 3KKOA 1GP2A 3W2GA 3AVQA 5DISB 3R8FA 3WNCA 2A30A 2YWEA 1BX1A 4YAOA 2WHXA 3AP2A 3EASA 4AC9A 2C95A 1P5ZB 3C16C 3GJ6A 1K9MD 1L8QA 3NHBA 1E1QD 2HXYA 1R8SA 3ZZUA 1KK0A 4Z51A 5AUOB 1E2EA 1SXJE 2HF9A 2JATA 1DAEA 1GSIA 3FB4A 4DLSA 1VYVA 4PHFA 4I1UA 1NIPA 2RGNA 2OTJB 1XEWY 2VL7A 1XMIA 3CKLA 1JQLB 2ZJBA 4PANA 4C43A 5CDFE 4KODA 3ZC3A 2FSHA 2WKRA 2QN6A 2JLRA 2P3SA 3B8HA 2FF7A 2NG1A 2C04A 3BB1A 4PZLA 4A6XA 2DERA 2WMOB 2QL6A 3X1WA 4WBSA 4NL4H 1W36B 4ACAA 3PFIA 3C8UA 2ONJA 1U8AA 1XXHE 5TV2A 1KSFX 4DIDA 2O8DA 1YI2B 4QHSA 2ZRJA 5G3YA 4D4JA 4O2LA 1E2KA 1RVDA 2L0XA 1KDTA 2GKSA 1XTQA 2EW1A 2VP2A 1TL7C 3AF1A 1CTQA 4BUJA 3REGA 3CUEF 2OLJA 3VR2A 1VCOA 1EXMA 1COWD 1X8LA 2J9RA 3C14C 4M1TA 3WYGA 1CRQA 2G0TA 1KI6A 1M90D 4BFTA 2OG2A 4GOKA 4JLDA 1NBMA 4D0NA 3IEVA 4WQMA 2CL6X 2XZLA 1U8YA 1QDEA 1XZQA 1QH0A 4RD3A 2GEVA 3TVTA 4KFRA 5C46F 2Q3HA 2DFLA 3K0FB 4NHOA 1E94E 4H1VA 4DCTA 3FPKA 1U9IA 5HE8A 4DCSA 2QP9X 4AF6A 3QKSB 1UEJA 4B74A 1PLKA 2MMCA 2Q6TA 1BYIA 2F1RA 2CXXA 3T06B 2ZRAA 3W5VA 2ODNA 3VO1A 1YJNB 4LHVA 1ZCBA 1YZLA 1Z2CA 4QGFA 2BBOA 1YU9A 3I1FA 4C3ZA 3SJZA 4EPRA 2WJIA 4PAMA 2P65A 3OZUA 5EUQB 1S3SA 2QRZA 2W58A 3SYLA 4MH0R 2FOLA 2FH5B 1S0UA 1KI2A 4BZQA 2RGCA 1NKTA 3CCMB 2W2TA 5FOVA 1II0A 3QE2A 4YDHB 5E95A 1HA3A 1FX0B 4DHEA 5FBWB 2BMDA 1QHHB 1SVOA 1EFTA 2QTZA 1YZUA 3U3RA 5LD2C 2YOGA 1EX7A 1HQCA 1XEFA 2VTKA 2LWIA 2UVQA 3EZ2A 2J7PA 3WBKA 3DZDA 3Q7QA 4RVCA 2IS6A 2XOKD 2JJ2D 2FPKA 1UBCA 2A7QA 3GFTA 4G5RA 3H2YA 1TX4B 3GLFB 2XOKA 5DYIA 5BN4A 2B21A 3W8NA 2JLVA 3OZVA 1YIJB 1DPFA 4DLXA 1GVNB 1Z06A 2H17A 4W9MC 3NDPA 1OFIA 3FMPB 2UZ3A 4XWOA 1CR4A 1IAQA 5AN9A 2VRWA 4LJ7A 4PPQA 3B9PA 2IS2A 5DGXA 4US2R 1SVWA 2OE2A 3BORA 4EPYA 1QFYA 4JL6A 5DI3A 5SZIA 2OILA 5JEDA 3CC4B 2QEQA 5C4GB 1R5OA 3CO5A 3DKPA 4B2LA 1IM2A 1VG9B 1ZD9A 1HEIA 1J9ZA 2ZRLA 3LFUA 3BFKA 1FRNA 2GPJA 4M53A 3BC1A 3R9WA 1TPZA 2QA4B 3I62A 1W7AA 3HYRA 5HZHA 1OT3A 2OEPA 4B2IA 1ESMA 5JS8A 3QG1A 4OQMA 1OHHD 4GZMA 4DSOA 4C7OA 5JJLA 1DAMA 2O8BA 1HE1C 2JEOA 3GMTA 3SJBA 5J4VA 2R9VA 5JHHB 2FSIA 4TYNA 2VH5R 4ASUA 4EAQA 3QVVA 2R6DA 2YV5A 3E2IA 3DL0A 3AVUA 3KKQA 2XITA 1B0UA 1XMSA 4HDOB 3LRPA 2PLRA 3UIEA 5C4MA 1FL9A 1W2BB 4XSGA 5KSWB 1BQEA 4TWZA 1XEXB 4RCYA 2DR3A 1JR6A 4BZPA 3UG6A 2WWWA 3PUVA 2NZJA 2FWRA 4D0GA 1XCMA 3KXIA 3I92A 2QRNA 1SM4A 1TTTA 2OAQ1 1MRNA 5JRJA 1VCMA 1DEKA 3C41J 3AV0B 3NG1A 4D4KA 3N70A 2O8DB 3IUYA 2VO1A 3PUZA 3U6KA 1JAIA 2ZE8A 4HLCA 4MQBA 2GQFA 1CEEA 2ZS9A 2YZ2A 4NCNA 2PZFA 2ZUCA 4AYXA 3N2EA 1UDXA 2V9PA 5E7MA 1PV4A 1SVMA 1YZKA 4DQLA 3DM9B 2EYQA 4U5XA 1H8ED 3QBTA 3FMFA 4DLRA 1WDTA 1VQKB 3CR8A 3QUSA 3G6EB 1E1QA 1NN5A 3CCQB 3FHCB 3OZWA 3LY5A 2YWHA 4XVQA 4YXWA 3CRVA 1WP9A 3L82B 1QHNA 4PAOA 3TNFA 4L9SA 3GJ8A 4PGOA 1DELA 2ZITA 1ZU4A 1Y63A 1WF3A 3QE0A 1ZUNB 2WBLC 5K8TA 3K9HA 1B23P 4L15A 1XJQA 3PEYA 2QT1A 1TUIA 5J47A 3T34A 4M1KA 1X1SA 2QGNA 2ANCA 1E0KA 1NVUQ 3TE6A 1UBGA 1II8A 1KZGB 2GCOB 2R6CA 3I3SR 3MJHA 1KJZA 4ZCIA 1SXJA 4NCHA 3ZH9B 2AD1A 1HUQA 1QFJA 1ZMXA 2BDTA 2QA5A 3ZVNA 1OXSC 5JZVA 3THWA 1XD2B 4FMDB 4G0NA 1NMXA 5F3WB 1E3MA 3O8BA 3I72A 5CDFA 4RJLA 2GZHA 2WPDA 1G4AE 5FR2A 2WIAA 4RKEA 3QPWA 1N6IA 1OIWA 4R98A 2OK7A 1Q82D 4N3NA 3M6AA 4BRWA 2QP3A 1W0KD 4XJXA 1NMYA 3NH9A 4QHTA 4C0QC 4C0KA 5GJBA 4A8JB 4LJ9A 4NYMR 3BIFA 3BJIC 3TLXA 1K73D 1U8ZA 4TMXA 3LQQA 3I73A 3MJRA 2GTPA 1N0WA 1C9KA 3LD9A 2CLSA 1P6XA 2V1XA 3VQTA 2HXSA 3ZZ0A 1JB1A 4JBYA 4ILEA 3CWQA 3K70D 1F60A 4YHBA 2GF0A 4U9UA 3C15C 1TQ4A 1A5TA 3DVLA 1P73A 4URXR 1XTIA 4LHYA 5G53C 1KSGA 1US8B 4IOKA 1GZSA 1FTNA 5DHFA 3HR8A 4BLQA 1FW6A 2DETA 3A4MA 3KXKA 1QUFA 3R7WA 2BMEA 3EAQA 3THOA 1UBEA 5GV8A 3SN6A 4TL7A 5JS7A 2EVWX 4KV9A 1QG4A 1DBSA 3Q3JB 4Q4HB 4G1UC 3JQPA 3U3KA 2HT6A 4MYHA 1FRQA 1KGDA 1OLOA 2ZETA 3CCLB 3MWLA 1N0UA 2GNOA 1U94A 4NU0A 3K9GA 2ZANA 1XD8A 3ZS9A 4Z1MA 4Q4LA 4LPKA 5HCIA 5SZHB 4IHQA 5JSZA 4A9AA 4RD2A 2H18A 1C1YA 3V9PA 4TMZA 4K1XA 2IL1A 5G41A 4NYJR 1NF3A 3W6OA 1W35A 2FMXA 3N2IA 4KHZA 3BGWA 2K5UA 4L9WA 5DHAA 1JJVA 4MKFA 3GQBA 1L4UA 1RE0A 2WICA 1VQ7B 3DEFA 4QM7A 3OF5A 4IXNA 5BN5A 1KI6B 1ZM9A 4WXPA 4LJ5A 4TT3A 1XTSA 1GRQA 1G7CA 1MO5A 5GADl 2IUSA 3T1TA 4M22A 1F2UA 1ZD8A 1G6HA 2FGKA 4PR0A 3ZIAA 3CNOA 2YWFA 4IDPA 5TARA 1CR0A 2N1BA 4ZDWA 2R44A 2FFQA 4DKXA 4TZ6A 2OFXA 1JR3A 1E0JA 1US8A 4D2IA 1KO8A 2ZR9A 2GETA 4KVAA 2RGBA 3RRZA 1TQDA 4BE7B 2NPFA 4HZUA 1YJWB 3UMFA 4Q9LA 4HAYA 2PLFA 4CT4B 1I4TD 3T1OA 1VIAA 5FOXA 3RAPR 3GJ3A 4DSNA 1GNQA 4H9GA 4TN1A 3GEIA 4G3XA 5JWRA 2QI9C 2RGDA 4NYIQ 2ZE5A 3UATA 5DIFA 4LYFA 1SQ5A 1MOZA 1KKLA 1A2BA 4LHXA 4DDVA 3SZRA 2RHDA 1R0XA 4G01B 2GHIA 2I1QA 1ZBDA 2V6JA 2WOJA 4XIGS 1E1RD 3NC0C 5AJXA 5KNDA 1RC8A 4RD6A 4QJ5A 1VHTA 1YZTA 5EUMA 2ONKA 3SR0A 1YR9A 3C7KA 3TKLA 4ZI3A 3IDQA 2QPTA 3PR1A 2JAQA 2DFTA 1JAHA 2IS4A
chains in the Genus database with same CATH superfamily
3A4YA 1I9GA 3U9LA 3VR5H 4RBNA 2VHYA 4DJEC 3RC8A 4K1LA 1KEUA 1KS9A 5CBKA 1TEXA 5M2QA 2ZT7A 3D7RA 4O3MA 2GUWA 2V6GA 3M6LA 4CQLA 3EXEA 3IT3A 4BEJA 4P80A 1H0HA 3R3VA 4E88A 3GPIA 2B1GA 3AZPA 3NV7A 3VDQA 1NPTO 1G17A 3OUUA 2JAXA 4M1ZA 4F5DA 1K4KA 1X1QA 2Q4DA 4YCCA 2ZVDA 2RARA 3FOAA 2YQ4A 5JV5A 2QJWA 2FQ1A 2JANA 5CAEA 5I3ZA 5EESA 1IY1A 2GXSA 3TNDA 1H2BA 2H1VA 2O2SA 3EY9A 1RQPA 2GZDA 2WIGA 2PM8A 2NZWA 4EHKA 2HLPA 1QGUA 4PX5A 2OGWA 1C1XA 2QM8A 1TE2A 3HP4A 2ZT6A 2QPOA 4UEQA 1UP6A 1TM5E 2B37A 2I8AA 5AYVA 1T5HX 4KFUA 2H2FA 3RIYA 3ANMA 1SO8A 3RKRA 4R8VA 3GA0A 3IP1A 5HZBA 2I6UA 4GF5A 2W2OA 1VL6A 1CHNA 2N75A 1WHTB 2HWUA 1ORHA 1QOQB 3SHTA 1HNZB 1EFHA 5ETJA 5B1DA 4CQLB 4DC0A 1XRMA 1R6DA 1ZJ5A 2MR6A 2RGAA 3GFSA 1R2QA 2BEWB 3Q10A 1W73A 3AXTA 4KP7A 4W99A 5TT0A 3RSHA 3SE0A 4D8UA 1TCCA 2GK4A 2QTCA 2XGSA 3GRRA 4M6WA 3UJHA 5LVAA 1YBVA 1SHZA 4HTFB 3EIUA 3TXXA 3ETLA 4MRNA 2E1RA 4LXHA 3UPUA 3D6UA 1ZGZA 3ROFA 1L8AA 2PUWA 2EWWA 5ALZA 1EDDA 4MUGA 4EO4A 1E9CA 3IIKA 5L6MB 2EFEB 2JHPA 3E9ZA 1JT9A 3JU3A 4URYR 1V1RA 2WP0A 4LYEA 4OX9Y 5BSTA 2C84A 1NG1A 4P36A 2O7RA 5HJ2A 1Q7EA 2BTQA 3ZWWA 3VX3A 2Z4RA 4FYPA 2QAGB 4DMLA 2F48A 1ZVVA 4C7XA 2AG8A 5FPQA 4JKYA 4QJBA 3UAVA 2I4OA 1FRFS 2Q21A 2XR1A 1HC7A 2XIQA 4RMHA 5C7LO 3K2IA 1C8LA 3G2PA 4YO7A 5KX5A 1F0PA 2Q62A 5IYWA 1U81A 5DBIA 3PUNA 3ENKA 4G97A 3COYA 4GM4A 1QX4A 2ZSIA 1BRMA 5E4FA 2JEZA 3OEED 1VQ5B 4Y2TA 1PNRA 1N3BA 1RLTA 5TB5A 4XWWA 1POXA 2ROQA 2J3JA 3ZE1B 1C3OB 1D09A 2CZQA 5LYJF 2I67A 3IIJA 2BH2A 3EC1A 3ZCPA 1FVFA 2P0EA 5FA8A 4AJPA 3Q72A 4V1CI 5K8UA 2BHTA 2XUKA 5F4JA 1OLSA 3OF3A 4RJKA 3THSA 2KPOA 2A0UA 3TCXB 3VTKA 2IOFK 2X13A 1VI5A 3E58A 3SKBA 4KMOA 1VG0B 2QDXA 4OGWA 1ACJA 3V1KA 4F1JA 1DKRA 1PR0A 5HZGA 5E38A 3MOIA 3A6EA 3ONEA 1KD1D 1E1DA 2J59A 3I56B 3CIOA 2GLUA 1F51E 5FOUA 5I9IA 2FN4A 2VP0A 4R1SA 4RK0A 3IPLA 4MV4A 4BO2A 4Z3KA 4UUPA 3E03A 4R2LA 4TV9B 2K7FA 3ZY3A 4CWAA 2FR8C 3OJFA 3I9LA 3N58A 4YMHA 2X76A 1QHHA 1MW9X 4WUVA 4QBGB 4PN3A 3JZDA 5DM70 4DCGA 1Y9ZA 1RYDA 3VUFA 3MCUA 4YB8A 5CH8A 1AKUA 4H1TA 2B8JA 3QI2A 2V7VA 1E62A 1CDOA 1LZKA 3PC8C 1WG8A 1GYQA 1FA9A 1I2ZA 1FX1A 2YWCA 3A7EA 5SYAA 4HGPA 4GW3A 1EWQA 2AN3A 2G9VA 3W8EA 3FTPA 4FMPA 3TFWA 1RS0A 2WU0A 4PONA 2GREA 3X2SA 4E5UA 3PCXA 1UD8A 2O2ZA 4UFNA 3RAJA 2QJRA 3ZE9A 1JZSA 4G0WA 4PGMA 4MUMA 4BKRA 2VBUA 4ROTA 4DLWA 2A9OA 4AJNA 2H2AA 3HB9A 1UPUA 4LAFA 2I8CA 4DMHA 2JJ2A 3OMXA 1L7AA 3KOYA 2H0QA 3HZHA 4WGGA 2EF1A 3FVVA 3C6BA 4XOIA 4LHSA 4Q4AB 4RLSA 3R74A 4DUYB 1D2GA 4LZNA 4RVHA 1SRRA 4BCDA 3A26A 1Z5PA 3L92A 3VXKA 5TMDA 4K9PA 2HHJA 2C92A 1AGXA 1LXCA 2DC1A 2NGRA 1V96A 1LF0A 1LI7A 3KSZO 3JSXA 3WHPA 1AZTA 4QO8A 1R37A 2JAOA 2VATA 4GMXA 4MQUA 3S1AB 2AEJA 3GZTB 1KU0A 2C58A 1K92A 2Z98A 1PRYA 4MV1A 1CS0A 2VPWA 4CMCA 3ZDFA 2ZJ2A 3A1FA 2V3VA 5JJIA 1YE3A 2QGZA 4MV7A 5BVGA 4RDXA 2AK3A 4LBYA 1KF0A 1UQRA 4IKEA 4KN9S 1WZCA 4OQNA 4EX6A 3WISA 3R3UA 3DMFA 3FTEA 2R6GA 4LCJA 1VKZA 1ZKDA 4MWEA 3I9KA 1J33A 3MJDA 3ZYCA 2BZ1A 4R4JA 2HQRA 4OQZA 1NJFA 1EWRA 2VPYA 2WILA 5A8AA 2VWQA 2ZYAA 3PGKA 1DUSA 4OHPA 3HFGA 2ZJ1A 1E63A 3GCWA 4WGFA 1ZHHA 4JOSA 5A02A 1XTTA 2XRMA 3NOVA 4QDJA 4CMGA 2GO7A 4L08A 1Y6QA 2C0PA 2CLFB 4TLAA 4YT8A 1DCTA 4OD0A 1W5BA 2ET6A 3QQPA 1PDVA 3QX8A 2PHZA 1I4EB 2H4ZA 1OFHA 4W1PA 3RVNA 3WNDA 1UXIA 2GAOA 1ZI9A 2DQSA 3EZ9A 4L8FA 4WEQA 5EHIA 1M8GA 4RGVA 3VPFA 3BBPA 2MTBA 1YOBA 3NRBA 1VQNB 4FQ5A 2HEIA 3F49S 3QEKA 1KBOA 4MVJE 4OOFA 4G8JA 5TJ9A 2A0WA 3GMIA 2HI0A 1FDRA 3DMPA 3K72B 3TPZA 4CCYA 3RRNA 4O4LF 1U31A 2BZGA 3P2OA 5F9FA 2HDOA 3L7KA 3R09A 1TEHA 4PINA 3K0CC 3WQBA 2REQB 2QENA 3OE7D 4NAVA 3ET4A 3LFTA 2QMOA 3P0RA 2OQVA 2BV3A 3R7DA 4P1VA 5IXSA 4G8DA 2PKYX 2B4KA 3K20A 1BOFA 1E8NA 4MVJD 3SMVA 1A9XA 2ODTX 1FDWA 2TYSB 4NECA 4J91A 3IRVA 4JY7A 2TRSB 1ZOOA 3H1TA 1QHSA 3OESA 3DDUA 1E2NA 5B4UA 4S24A 3MAGA 1YK1A 4JBNA 2M1ZA 1UM9A 1Y3HA 3OZGA 2QL5A 3H13A 4J8PA 1E4YA 3ROXA 4CLXA 2FWBA 4EEZA 1YBMA 3OLYA 3SI7A 5DLQC 2I87A 4AG5A 1CUWA 5CJPA 3T1HB 2ECPA 2BBSA 3EDRA 1TCBA 2FPPA 3M1LA 1X8KA 3VNBA 3A4LA 3C3MA 1XIVA 1JEAA 3IMEA 3PGMA 4MCAA 4N0MA 4COKA 4EG8A 1KDRA 2IP2A 1ZH6A 4TMFA 3S29A 3V4ZA 3W5UA 1USUA 3R75A 3RS7A 1GYPA 1LKZA 3V76A 4YCSA 2V9ZA 3EF1A 2NSDA 1FFEA 3N2GB 3QH4A 4FS8A 1V1MB 1KMNA 3NBAA 1RFGE 2V7EA 2NVUB 1ENZA 2VP4A 3NYRA 3QVJA 1I33A 3TI9A 2ZUBA 2OCPA 1F3OA 2HV9A 4UTZA 3WLMA 3KB8A 3P2MA 2XTNA 3ZQ6A 4DLVA 4DSAA 2WKPA 2IYZA 3SJCA 4ARZB 2RAFA 4GPEA 3NHMA 5K20A 4GPD1 4QXQA 2B8NA 4JITA 1N0HA 4NWIA 4YJHA 3TOZA 5IJ9B 2G1UA 1J2JA 4WZBE 2Z9DA 1QHGA 2I5PO 3K9QO 1FU4A 1Q7RA 1SG6A 3K4QA 3WYBA 1LI5A 2H2WA 4XARA 1H5UA 4B3IA 4OQLA 1AV6A 2VNHA 2DRIA 2IEAA 3GUVA 4ZO8A 4C05A 1TRHA 1W4LA 1ZO8A 1OZHA 4NSNA 2V6MA 1XRLA 1PEAA 2J3HA 4L4ZA 4RFLA 2B4YA 3FF1A 1PJCA 2Z95A 3VGPA 3OA0A 4L4RA 1LSOA 3JWGA 4C0XA 1L7XA 1RQNA 1XFAA 2GKGA 4MB2A 1P91A 4XCXA 1E5LA 1NHWA 2WWRA 1WOMA 4QTTB 3S1LA 4ZYWA 5LUBA 4ZGNB 4LV8B 3OPXA 4QPNA 5D6OA 1DTWB 1JBEA 5KTSA 3LC0A 2V1UA 3BAZA 1RWVA 3OIWA 4JI8B 1WAMA 3D3EA 4QEZA 5CVUA 1BDIA 1VKHA 4E1AA 1IL0A 2NYAA 2A5JA 2G3YA 3E1SA 4Q1BA 5M34A 4WXMA 2OCKA 1GCAA 3AI3A 3N6RA 3DEIA 4LHWA 3QVWA 3IDOA 5ESXA 2J48A 1GILA 3E8SA 4J0HA 4M87A 5CEFA 1U9CA 2UVPA 5HA5A 3IHWA 3TEJA 4BQIA 3OQOA 1KZ9A 1AK1A 4Y9RA 1ULBA 2AA3A 3COSA 4HH3C 3WLAA 1DAHA 1RPNA 2GM3A 2OBNA 2IUUA 3W3ZB 1TLFA 4PYLA 5HJEA 4HFMA 4LGCA 1E3WB 4J4HA 2DBQA 3F8SA 3GGSA 3KKEA 2CXHA 3DMDA 3NHSA 5LMUB 3E1GA 4AJOA 1NYRA 3NIBA 4AZ0A 2F8LA 1EVKA 1OOEA 3CZ9A 4X7DA 3AEQA 3HHPA 4JROA 4BWVA 2C97A 1F0YA 1Y3FE 2E89A 2FE1A 3PNSA 4JZYA 1Y4UA 4AD8A 4Z49A 5L51A 5TEVA 4NHEA 2VDWA 3HBFA 3Q87B 4WV3A 1DNPA 1JYFA 3TLAA 1PW7A 3I5XA 1F20A 3T0IA 2V7UA 2JGNA 4EWLA 1RPZA 1OLSB 2PRZA 2PJDA 4ZQGA 1FQWA 1Z4QA 1JIKA 4NMHA 3DR3A 3DQZA 3GWGA 3D6MA 4RNDB 1K98A 2JFXA 2WYUA 4XWKA 4GT1A 3IP8A 2SCUA 3M7IA 4QGGA 4DF3A 2C2WA 4NESA 4FXOA 2WHYA 4W8HA 3MSXA 2OORA 3QGMA 3GJ0A 3W6PA 6REQB 3KJQA 2I6FA 1XN1A 2FPWA 1UBOS 1SKYE 2QGFA 1FVHA 3ENVA 3P20A 3R77A 4MS3A 4X54A 1RBYA 1FSSA 3C87A 5DMHA 3EZYA 3C97A 4IDHA 4N82A 5KX5B 4KZPA 3IAUA 4LK3A 4DDMA 4CZ2A 2AVDA 3M6UA 4EGQA 3WK5A 5FA5A 2V7XA 3BB3A 5B3LA 4LHZA 4LZWA 1OH7A 1UKAA 2YHIA 1IJEA 1MFZA 2BUBA 2OOKA 1ARZA 2BI7A 3PE3A 3B8EA 5DGDA 3DBHB 1ZXBA 5EMLA 3EA5A 5HQTA 1EUDA 1I2BA 1BJKA 3COJA 3NVMB 1VIVA 5CDYA 4FEEA 4DV4B 2YJNA 1W6RA 5LMZA 3IQFA 1IVSA 3TOVA 3FTDA 1EEHA 3GUUA 1P81A 2WMNB 4DBLE 2YFHA 3G68A 4B9AA 3VVCA 4O4HF 4TKVA 3NKVA 5KYXA 3D6AA 1B8NA 3TUZC 4ER0A 2ZL7A 2Q1XA 1NXPA 4Q18A 1RADA 1JYSA 4GXQA 5EJGA 3UB4A 4HDSA 4AZWA 1T2EA 2X8JA 1DX6A 4X8MA 4H17A 1COWA 5G4KA 5JDCC 3GR6A 1Z6TA 4Y2YA 5CA0F 4Z8YA 2MR5A 1YTUA 2FDRA 1UC5B 4BEBA 2C2XA 1X7YA 1G18A 1NVBA 1IQPA 3CF4G 5IANA 5H81A 1MO2A 1XMXA 1U0TA 2ZIFA 1VQLB 4ZT6A 1J56A 3TJZA 3OFSA 1I2MA 1IBSA 3K6RA 5ALTA 5MN6A 3P9ZA 1ZL0A 1QGDA 5HDQA 1TVMA 1IN5A 4EY8A 1PJAA 4MI6A 4W5JA 4L0DA 2Y1FA 3OOWA 3RUHA 2FA9A 3B5IA 3D2BA 3FNIA 1CR2A 4LQDA 4DUGA 1O4VA 1Z5GA 4LNHA 2O8VA 1KOJA 1G1AA 3JYPA 3Q15C 621PA 4IDDA 4C0JA 5JU6A 3P97A 3VMMA 4EKIA 3NHLA 1PR2A 1B42A 2QAGC 3E7PA 4JWTA 3T1NA 4Z4QA 4LFAB 1F4VA 2E82A 3MJFA 4QELA 3O1IC 3SDSA 4KO3S 4ENTA 1EMDA 3L4KA 4XN0A 3MTEA 2TMKA 1MOSA 3RFFA 3MCWA 2FPIA 2REBA 4RM2A 2EATA 1J42A 1L7VC 3AI1A 3RHSA 4CIAA 3RROA 421PA 4U7FA 5DNVA 3SSAA 3V8MA 3N39C 1ESDA 4L8YA 1QS0B 1YMVA 1WKVA 4MWTA 1PO7A 3LF2A 5THQA 4EFNA 1A0OA 1QP0A 1TZKA 2V58A 1OW3B 1YJQA 2PNJA 5JIBA 3NEPX 3S7ZA 1GNRA 3CUSA 2CK3D 3HB0A 4I5EA 1OYYA 4IMIB 5GM1A 4YYZA 2ECFA 4NVRA 4Q0MA 3HCPA 5EKUA 3GLGA 2BHNA 3T7CA 1NURA 2CB0A 4O0MA 1RJ9A 2V59A 4JSTA 4JBWA 2VAXA 3AZQA 2I0FA 4HVTA 3VVMA 1HR0B 3RIHA 2QBYB 1G7RA 3E9YA 3NFYA 4IDAA 4IR7A 4MZDA 3ZWDA 2Z6AA 4BLSA 2ZYIA 3I0MA 4LECA 1YJCA 5AKHA 4QSHA 2FSSA 3TR0A 4DV5B 3OW2B 4QYXA 4LOJA 1BHJA 3N8IA 4X91A 4ZYXA 1DIHA 4RGYA 4TMWA 4NENA 1RKVA 1P1FA 2AOVA 2QUKA 3D64A 2FG5A 4JB3A 1L4EA 4KXNA 4UVHA 4WK4B 4CM5A 821PA 1G2PA 1CEYA 4E07A 4IXTA 4WD3A 1QQ7A 2FJUA 1GAWA 3FPAA 1E2LA 5CB6A 4GOOD 2OY0A 4CW7A 1CUGA 4Y9UA 3FX2A 4DGQA 1PQWA 1XMVA 2NW6A 1LV7A 3QBDA 2VUUA 3G0BA 4TRMA 4EB6A 5LIPA 3U5ZB 3MGGA 4YT5A 1W2GA 4PSDA 2IUTA 5C35A 2PGIA 3O8CA 4U7PB 5KNCD 1GKUB 2QTWB 2RCNA 3DL4A 3G9UA 1Q7GA 4XEUA 3R0ZA 5FTJA 4AQDA 4F2HA 3UCFA 1T0PA 4M99A 4DQXA 2HK9A 1L5OA 3CWZA 1Z36A 3A3OA 3RHFA 1JKMA 5DGIA 4ZCMA 3W5HA 4EEXA 2ID8A 3DPIA 4GP7A 3LW7A 3RVJA 1R0WA 3V8QA 5AFSA 4FOPA 4FM9A 4M9XA 3ZHQA 1JG6A 2Q8PA 1IUPA 1AD2A 3DQPA 3PIRA 3ZHUA 3OKAA 4WLNA 2FMTA 1I51A 1UK6A 2J6IA 2Q4OA 1CW2B 2JD1A 2Q4EA 4CG2A 1YWGO 1GEGA 5EWLA 2IYYA 5I4KA 1CS4C 3CH7A 3L4BA 5F2EA 5EWMA 4CEHA 2XUGA 2ZYUX 3NTOA 4XLFA 4Q15A 2MYUA 4RV9A 4YJHB 2CCJA 3IR5A 4ONEA 3WB9A 4NC9A 4GHWA 1W85A 5A4JA 4CMBA 1KOGA 2BRUC 4PRZA 3PYMA 4P33A 1ZXXA 3KAQA 4QU9A 2FP4A 3T5DA 2ZQ5A 3EGDB 5BSKA 3GCGA 4JL5A 4P4SA 1DQSA 1XEAA 3HG7A 2HGSA 3KR0A 4HQ0A 1JL3A 4OXQA 5AUQA 4A03A 1JIXA 4F92B 4HGRA 4Q1DA 2NUTB 4ZQEA 3TRDA 3D4BA 3EUFA 2ZS8A 4E7OA 3F6YA 4MCJA 4HCJA 1DBIA 4R7ZA 4ALJA 4AP9A 2IW3A 4ZDKA 2BM1A 3RGWS 3IQHX 3I5MA 1GG8A 1XTPA 3BC9A 3L7BA 4P3XA 3JY6A 1V9LA 3V42A 3GLIA 4JMQA 1G60A 2FLVA 1H42A 2ICAA 1TA9A 1W0CA 2OXRA 4CFZA 3E9MA 1SZCA 4JFRA 2VP5A 5EP4A 5AVKA 4KXXA 2GDJA 4ZV7A 3E70C 3TEMA 2AYZA 2ZIWB 3LV8A 4LRXA 4U02A 3WLIA 3TLJA 4PC2A 1ADYA 5FPHA 3E6AA 5JXHA 1DWQA 5TVGA 1B0PA 2YRXA 5IH7A 1SCJA 5DIZA 3U7IA 1R6BX 2GPAA 2JI9A 1PVVA 4NFSA 3PF9A 3F7OA 3RSQA 3ERCA 5IMBA 2MYTA 4JI2B 4XN3A 3GJSA 3L4EA 3W0LB 5CW2A 2Y1LA 4YPVA 1D9ZA 2ODWA 4I19A 1VG8A 1P9RA 3GSIA 2TMGA 5LMCA 5HIJA 1MPXA 3RYCA 2W6OA 3N3BC 1JFTA 4NG4A 1W2WB 4O25A 1T5TA 4HWOA 4EUHA 1II9A 1XNGA 4GR4A 5FORA 4V24A 4JXKA 3K30A 1NJID 4H7HA 3GLHE 3JQAA 2QRLA 1GRCA 1KR2A 4M1MA 5GAJA 2HRDA 3DMHA 2WRZA 3GJ5A 1M10A 3E61A 4QNNA 4ZHQF 2HNBA 3FRHA 1AJEA 4N0PA 2X9NA 2QJFA 4K9OA 2BEVA 2L42A 1IIBA 1MKYA 3N53A 1X9IA 1NBEA 4OHRA 1U5AA 4Z4VA 3ZOZA 1GL9B 3T7RA 1KY4A 5IX8A 4BLUA 3ZE2B 1WSRA 5E1MA 3FY4A 5L3SB 3WWDA 1EIWA 5HW0A 1JXQA 4UATA 3TZBA 3T1VA 1GD1O 1VE3A 3DBVO 1C9NA 3RH0A 4N5LA 2CE2X 5DK6A 5B37A 3DEKA 3EIFA 1CJTC 4AJLA 1CS0B 4RTRA 3TRKA 2D0DA 1QRUA 1S8OA 1UMCB 2PAAA 3SZMA 4OBBA 3TNYA 1CF9A 1L5QA 3VNRA 4AG3A 4FFBB 4CE6A 1JJFA 3DS8A 1SKYB 5T3YA 1Y5MA 3HKEA 5JSYA 3LE8A 4HQRA 2JCGA 2ORVA 4X7FA 1DT3A 2W83A 4HFNA 4PNPA 4JODA 4MIOA 2PIDA 1MC1A 2Z58A 1Q2XA 2ZJZA 3G8CA 4B6PA 3L8DA 2APJA 4DXDA 3A9RA 4UHFA 2FN9A 3H4IA 4NK4A 3B3QA 1DDIA 3W8RA 4MRMB 3IXMA 2CJWB 4C01A 1Z12A 5HIAA 4YJ2B 2ZE6A 1G66A 3H8VA 4CGYA 1KSJA 2PUFA 3RIXA 1UDBA 1SCUA 1XRPA 1Z7EA 2PL9A 1JLSA 3KEQA 3ECCA 1GGMA 2R85A 4KBGA 3QVUA 5CM9C 3KUCA 2A0KA 5FAXA 5FV7A 4IGKA 1L8OA 4OB7A 3K71B 4XA8A 4RPBA 1TAHA 1SVUA 6YASA 4CI0B 4CR7A 3NIGB 4PLTA 4XIJA 5KTPA 4IHJF 3LPNA 5HF8A 4D99A 1VYUA 4AK9A 2Y71A 4KSYA 3WHKA 3T53B 3ZIDA 1ADBA 1QLWA 3STTA 3UPTA 1HURA 3EZNA 3IE2A 4D4MA 1Z26A 3K15A 4HRAA 2MYPA 2ZSJA 4TMKA 4Y2RA 2OBBA 3IQDB 1DVRA 4IOMA 4EO7A 1W5EA 2XYHA 5FI0B 4BLTA 1QQBA 5DX1A 2AJTA 3BKXA 3K0EA 5EHNA 2H57A 2QUZA 3T61A 4LV5B 2MSEB 3EVEA 4IGAA 4R0NA 1K6XA 5REQB 4RKWA 1CUUA 1OYVA 1J25A 3SFZA 4WERA 1N2EA 2HBRA 2BGLA 3DXZA 3F71A 2AXEA 3GFGA 3CP8A 1IOZA 1VL0A 3NPMA 3KK0A 2WF5A 3K8ZA 4GOXA 4L7QA 5AHKA 5AVYA 5L3QA 1WIWA 4LDRA 1W49A 4IHKA 4HLDA 4K9KA 4BVHA 4AMVA 4YUWA 1XZPA 5E8JA 1D6MA 4PW0A 4YRBA 4PZAA 4B33A 1N8TA 4P3PA 1V6AA 2GMWA 4BE9A 3ZI0A 4CCAA 3ZVKA 2G04A 2NU6A 1MBZA 3IXLA 5H3CA 2V7WA 3JQ8A 2IU3A 5DE3A 5K0JA 2HQSA 4RL4A 1L1RA 4WOJA 3WFZA 1U98A 1Y3BE 2V7QD 2XOEA 4NBVA 4UQPA 4LJ8A 5JJBA 4GX1A 1DU4A 4TTIA 4MEJA 1QB8A 3IIIA 4KXFB 3V8BA 5AW8A 5JNTA 1QLHA 2P77A 4CTKA 1XXHB 1S4MA 2FCAA 1KP2A 3KQLA 1JIQA 4L5CA 3OZRA 4DEXA 4PZEA 3I53A 4M76B 4HYYA 4MXDA 3GFRA 1XHFA 1I4DD 2WWVD 3BA6A 1EQAA 2CXUA 1TC1A 1ZIYA 2HLDA 1ADJA 3H2GA 2KI5A 5K2MA 4B32A 3VHXA 3BTUA 3IEKA 1O3YA 1YRYE 2QPAA 1FC0A 2RFLA 1CZHA 1G9TA 2AEMA 4P5EA 5CGZA 5CJ2A 3HI6A 3WB0A 1QE5A 3H5RA 4W7SA 3CF6R 4IYRA 3TLMA 1QAMA 3UPDA 3Q7EA 2BHLA 1VLVA 2Y99A 3QK7A 4TQUS 2EBUA 3F8WA 2OOSA 3T1QA 3SCZA 1B73A 2KB0A 3TXAA 5CDSA 4JV5B 1JLHA 1Q21A 3OZEA 3I8XA 4B3TB 3ACDA 3SSMA 1ZS9A 1ZJYA 1R00A 5HK8A 1RBZA 2YVUA 4B2PA 3D3WA 3PR2B 4KXWA 5LU9A 4MQ6A 1MJ5A 1RWBA 5EEGA 1FFYA 2WKSA 4E5NA 10MHA 4DQKA 2V8OA 4WAUA 1U1DA 2FW9A 4MGEA 4PAQA 5EIWA 3S3TA 2EJWA 3OIUA 4MTLA 5EZQA 3TH5A 4HDRB 3X2EA 4P84A 4EGCB 5D7BA 5IT5A 2DR2A 2VNAA 2ZAOA 3MOGA 1Y7PA 4XQEA 3LDAA 1I1QB 1Z47A 2ZZEA 3E22A 2LUOA 2XXBA 2FEKA 5JTTA 2XCOA 2I7VA 4P7KA 1KJWA 1KZ1A 2NN3C 4AZ3A 1G3QA 2Z09A 3F6RA 3RNLA 1BDJA 3ZBTA 1RI3A 2B1QA 2BI4A 3LECA 3MUEA 3SBOA 5ALFA 2A5GA 4BWGA 1Q86D 2C7PA 4D0LB 4NMLA 4B3MB 3L07A 5DFAA 5CAEB 3UANA 1YI8A 1GPYA 3R9XA 2WA1A 3HVIA 4ND6A 1TO6A 5SV2A 3LUGA 4PFJA 3SZGA 1G20E 3I2YX 1O89A 5E4JA 4XGRA 1XPJA 2Y9PB 2GYUA 4LSGA 4EI8A 4JMLA 4BN5A 2I91A 4NAUA 4DWWA 4JQOA 3SAJA 1WV1A 1VLOA 1L7QA 3EMDA 5A6SA 2CF6A 1ZZEA 3CZ5A 1MNAA 1O6CA 3AYXB 4YUZA 1WD7A 4RIIA 4DCVA 5JFOA 2WTUA 4M86A 4TSFD 1YQQA 4N3BA 3F3KA 3LUAA 1U2ZA 2I3BA 1MJNA 2Z5VA 1K8QA 4HXEB 3I61A 2WTEA 4YAWA 2CNWD 3QUBA 4E5DA 3HP7A 3D0OA 1QJ4A 1ZN7A 3EDQA 3TINA 2PH1A 4IJ5A 1EAMA 1MAHA 4EI7A 1DWUA 1NXOA 3UGJA 2VZEA 1L3IA 4FDUA 4Z4ZA 1NVXQ 1W581 3VA7A 5C7IO 1C3EA 1JR2A 1KDPA 3DLCA 1UFQA 3HZRA 3QVXA 3W77A 3GLGB 1T15A 1NZDA 3FNFA 1SBZA 4NOLA 1N36B 1GUZA 1OGJA 2XBLA 2J67A 1FP6A 2I4RA 3RBAA 4KUGA 3EOAI 2A9JA 4OU5A 4R81A 5K3AA 4DZTA 5BQ3A 2ZQYA 4OK5A 2EFGA 3B1XA 4ASUD 5F76A 3LCVB 4C4RA 1EBUA 4KMMA 4EHDA 1OFTA 2FVXA 2ZU6A 2P4EA 1T4DA 1CIVA 3UGQA 4PAAA 4XVHA 4B79A 4BB9A 1J0DA 1Y34E 2XMSA 1QFXA 4HAXA 1Z62A 3ILSA 1SELA 4PG8A 4QJIA 1Y8RA 3HEAA 4RK4A 1XQXA 4AMGA 5IJWA 3VH1A 1MQSA 2AKAB 5CU7A 3GEBA 4I2NA 5CFNA 2Q6IA 4JJ4A 2E2WA 4YMIA 3ZZMA 4MLZA 1F6WA 1J22A 1X9HA 2IYWA 4GDFA 1T8TA 3DNFA 2GPWA 4JUIA 4NXMB 2XDWA 4EO9A 1E1LA 1XO1A 2BFDB 5C80A 7YASA 3CB4A 1UZAA 3E15A 5TQVA 2PH5A 1ILEA 3GCDA 1VQ1A 5K09A 4FU0A 4FWIB 3CY6A 4D81A 3RYIB 4BAUA 4WFIA 1G1MA 1J07A 3EBLA 3M83A 4BKOA 1LLFA 4TKOB 2F90A 2ZIGA 4AY3A 2Z57A 5JAPA 5K0GA 3VVBA 3ESBA 5BT8A 1OAAA 4UJ5A 5EP1A 3VMFA 4TOIA 2DHEA 3H5VA 3FNHA 3ME5A 3WKEA 2QZ4A 4CKEA 1T6YA 1DIAA 4FUTA 4R7GA 3TAXA 2ZIXA 3VKWA 1NP3A 3OT4A 4C7OB 5D5QA 2Y1OA 1Q0UA 3OCXA 4LG1A 3DONA 3A4VA 5EE1A 2ZUDA 2P4QA 1P29A 3B1ZA 3GVIA 4D92A 4Y9SA 2A9QA 3CD6B 2OPHA 1UD2A 3C6MA 3TM5A 3DCJA 3K1JA 1OQAA 1EVIA 1Y37A 2VJKA 1PR4A 5AOVA 4J03A 1FFBA 4XD2A 3R6DA 2J8ZA 4FCTA 1JDNA 4D3DA 4YQFA 2XT6A 4IQGA 1V5WA 3C3DA 5AOBA 1GAEO 4G1CA 3M6MD 5LOVA 1KH2A 2R1VB 4I9GA 4NRDA 1NW6A 2D3WA 3AESB 1HT1E 4S3MA 5E7QA 5K3DA 4TYWA 4F56A 4RZ2A 5GONA 3ZDBA 2AG6A 1GNTA 5TGTA 2QMUA 3ONYA 1JEJA 1FBNA 5AI0A 4RMIA 4YCAA 2WHRA 2WC1A 1G64A 2DBVO 3ZWKA 4M54A 4WL0A 1A4IA 2MSNA 3RYHB 2B30A 3LX5A 3NC1C 2J6HA 2QRVB 1NRXA 2IV2X 3C85A 1F5NA 1CDZA 4YNBA 3BYZA 3D3QA 3F74A 3R7NA 2B92A 4IF4A 4KAAA 4OYLA 1VQ6B 4WOKA 3ZQUA 1JEYB 2FN8A 2F1IA 2WJWA 3H5IA 4GBMA 2VC2B 4J90A 1QG2A 3L93A 1U4SA 2F1KA 2KMLA 1ZBQA 1RI4A 2AN4A 3DG9A 1YOVB 3G8DA 3PD7A 3P1JA 1XD2A 3K09A 4KXYA 4QGAA 1EP9A 3SZUA 2D4HA 3TS1A 4WKOA 4JB8A 4G5OA 3TGPA 3F73A 1R9JA 4ETNA 1T8YA 2CKDA 3K9CA 2M5SA 3OPOA 5GINE 2G1JA 3N2NA 4B4WA 1I7NA 1ML3A 4B6RA 3U3JA 2IVZA 1U0GA 1X7ZB 1EQUA 3NT2A 3QVGB 4RH3A 4YYEA 3KQKA 4POAA 1KYYA 1ISPA 4QUEA 4S2EA 1KR5A 3SS9X 5CK5A 3PLAE 3L18A 3TGLA 4HIZA 3KJFA 3QYFA 4V0ME 2JJ1D 2VK4A 4HBZA 1X42A 3H2KA 2FX3A 8AT1A 4JOCA 3V7FA 1B2RA 4BNLA 1GPWB 2VBCA 2V3CC 2MSWA 4JDPA 1SXPA 2JL1A 1KQNA 3HJFA 4ENWA 2XOXA 3V7AA 2I29A 4BUZA 5CYPA 1WJGA 1Z0DA 2OSVA 3HGQA 4XYMA 3H9QA 3U7QB 3W2IA 1GAXA 1PR3A 3F4BA 3H1GA 1RAAA 4JGGA 7REQA 2FP3A 4HTAA 2GJSA 4OJMX 1WA5A 3P26A 1YJ9B 3KOXA 2DXIA 2HSGA 4EW3A 1NC3A 3FPGA 5EQTA 1GPKA 2YMPA 2AYYA 3BXOA 1D0SA 4UHKA 3QVOA 4KXQA 4EB0A 2RGNC 3QVMA 2G63A 3O4VA 5LQKA 3SHOA 3DCIA 1R7RA 1TUBB 5KPDA 4XASA 1P4RA 1OBCA 2CLDX 1S2OA 2IYQA 2WT8A 3I2GA 4H0NA 4PTLA 1XRSB 3N8KA 3EHDA 2HSDA 1FRVA 3AESA 2JFVA 1PYGA 1RRCA 1ULHA 3H94A 3A28A 3DBOB 2BMAA 3IMKA 1TZ2A 2CJYA 1Z6AA 1Y9EA 5MGBA 4M7WA 3ZJTA 1O57A 2QMZA 5EYPB 5FF9A 4TS3A 3QHAA 4HDMA 1VQ9B 1T9HA 2KQUA 3N2LA 3LHFA 5DM1A 4DPMA 1U7WA 1H4SA 3UWPA 5IRCD 2QSJA 3QFTA 3MYRA 3M70A 3GQVA 3RCBA 4HLQB 2NTYC 3O1JC 2G25A 1BKDR 2HO4A 2O7NA 1KJYA 2BEUA 3EHEA 3VISA 1L5FA 4A0QA 1ZD5A 1TM2A 2ASEA 4FVTA 4JXJA 4RAOA 1I2AA 5F5XA 2XE7A 2HD4A 2OUIA 1TAQA 3ABQB 5DP1A 2WDPA 3F2IA 2W6PA 1CQJA 2Z1DA 4JX8A 3IQIX 4ZC8A 2O7VA 4TXHA 4JVLA 4IICA 3L4JA 1EJ0A 3HJNA 1EGMB 1UQTA 2QX4A 3AEYA 3FI0A 4I1RA 2XNCA 3G5TA 4K5QA 5LA6A