2QN6A

Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the gtp and the gdp states
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
414
structure length
393
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 103
structure length 393
sequence length 414
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qn6A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qn6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qn6A01
1KJYA 4D4MA 1KI6A 1U9IA 3QFSA 3BFXA 2I1VB 2PIAA 4M9SA 4PANA 2P6UA 3VO2A 2GTPA 1ZC4A 5FTJA 2PCJA 1SXJB 4BRUA 1VQLB 3RC8A 1JR6A 3RRMA 4L9SA 1AGPA 1XD9A 3I4LA 3GLFB 2ANBA 2F6RA 3VQTA 2VHTA 3WNDA 2BVNA 1YRBA 3QBTA 4D4JA 4HAWA 3VR4A 1CJVC 1EX6A 2ODWA 3HU1A 3MG9A 1S3GA 3FKSA 2ZJAA 5BN3A 3AVYA 5P21A 1KGDA 4AYXA 2QA4B 2AFHE 4KBFA 4Q1AA 1TU4A 3PENA 4C0LA 1E9AA 2V1XA 3GJ6A 4ZO4A 2KE5A 4C0AC 3K70D 4QJ3A 5FOWA 4OKSA 1NN5A 3B78A 5E95A 4TZ0A 2D7DA 2R65A 4OQFA 2FU5C 4FMCF 4PZYA 2C03A 4PAQA 2F7SA 4A0HA 4D6PA 2ZE8A 2J5XA 4DBLC 1XJ0A 4IDNA 4Y9RA 2VNJA 4BLTA 4UKDA 1GDDA 1AKEA 4K46A 2X2FA 2W2XA 4GNKA 1LFDB 2ATXA 3HU3A 3K0SA 4UNQA 3UMFA 4LV6A 1QVFB 1DAFA 4PZZA 4PPQA 5J47A 3GLIA 2NPIA 2ASEA 5D3MB 4ZI2A 1E62A 4RZXA 5JWRA 2QROA 2W2TA 4DT1A 2JA1A 1Z28A 3NXSA 2GA8A 5K8UA 2W58A 4QG7A 3TVTA 4QFMA 3P27A 4B47A 2WJVA 3KKMA 2ZJ8A 3LW7A 4DSNA 1R5OA 3LQQA 2QSZA 4ARZA 2HJGA 4HZUB 3ZQJA 1D5CA 4MRSA 4RCYA 1K8AD 1YZTA 2RGEA 2ZI3A 3KJEA 3PITA 4CYMA 4AY2A 1QGYA 4WW0A 2GZAA 3CZPA 1O87A 3PCRB 3GLHA 1IB0A 4EAQA 3W2IA 1E2FA 3IGFA 3WP1B 5SZIA 1E9BA 3THWA 3A1UA 4WBSA 3GJ3A 4Z8XA 4AKEA 3CPEA 4K8OA 2ZUCA 4LRWA 5JI2E 3PJRA 1P9NA 3LVBA 1NN1A 5KTYA 3EX7C 4DSUA 4ZCIA 1W34A 1Q3HA 1N5JA 1UJ2A 4F4IA 3T1TA 1A2BA 2J46A 4Q7MB 1NBMA 5TARA 3CNOA 3KJIA 1GVHA 1D2EA 5GV7A 3LA6A 1R0ZA 1XD2A 4OI2A 4U5XA 4Q1FA 4NYJQ 2FFHA 5JEDA 1DAKA 3G82C 4B32A 3IHWA 4JLBA 5BWMA 3BWDD 5FPKA 2XEXA 4W9MC 4Q47A 5FUWA 2BWJA 2EFDB 1OKKA 1F2TB 1IJEA 1W1WA 4NMMA 1HQYE 1E79D 1E9CA 2FSFA 3K9GA 5AK0A 2FSIA 1MO5A 4Q1EA 3WRYC 4EJSC 5JCPA 1X1SA 1E0JA 1SVWA 2RGXA 4TYYA 5D3QA 4JT4A 3AKEA 4JLOA 2OESA 3E20A 3RS7A 1K9MD 3CX6A 1T5IA 2XNCA 2CBZA 4B71A 1Z0FA 2DWOA 3QPWA 5EE5B 1RJ9B 3P1JA 2WKQA 1EG7A 1E96A 3VR3A 1AN0A 2P5TB 1NDHA 5FPSA 2C5LA 2LKCA 2QP3A 3H2YA 4DHEA 5BW8A 3U7FB 1WE2A 5KDOA 2GQFA 1W0KA 3LBHA 2FJUA 2VA8A 3Q5DA 4MUBA 4AD8A 4AG5A 3W5VA 3OJWA 2FFAA 4PC3A 1E1RD 4JS0A 3QXHA 4L8GA 4POAA 4B2IA 2RAPA 4F7DA 1KI3A 4GL2A 1S1MA 1OGJA 4J0QA 1NL3A 2X2EA 4ZDKA 5AUPB 2HCJB 2IS6A 1P2TA 1IN5A 1XXHB 3RS3A 2DHRA 2C9YA 1YIJB 2OFXA 2QE7A 1YU9A 1VMAA 2ZPTX 1UPTA 4EQ6B 1G4UR 3MHPA 2IEYA 2R6DA 2RC5A 1D6JA 4MH0R 1UKYA 3PUVA 1DELA 1Q82D 1SQ5A 2YINC 4BLQA 2J45A 2AK3A 2MSDB 2OO7A 5BYKA 1YJWB 3KUCA 2O5VA 4R7ZA 1F2UB 4RFSB 1EP3B 2MSCB 2O8EB 2GK6A 2XTZA 5JZVA 1W36C 2NG1A 3F8TA 1EK0A 2W2VA 2R6CA 4LOAA 1GRRA 3H86A 3AF2A 3KJHA 1NVXQ 2OHFA 2QI9C 2FPLA 4DDUA 4F4CA 1NLFA 3ZDQA 4A82A 5A4JA 1V5WA 1R4AA 2BSAA 2FWRA 4S2EA 2WKPA 1ZNYA 2ZRDA 4LHYA 3LVRE 4B2LA 1QFZA 2AWOA 4Q48A 2FMXA 4RSGA 1MABB 2GEUA 3EARA 3W2HA 2BBTA 4W5WA 1IXRC 1G20E 2WBLC 1Z0AA 5AUOB 2XXAA 2HLDA 1K5DA 4DVGA 1DG1G 1VQNB 2OLJA 3AF3A 2WSSD 1LW7A 1CR2A 1KRHA 4EFMA 4DDVA 1DDGA 2E1RA 2PZGA 3FDIA 1Q7YD 1ZM7A 1G4AE 4PAOA 1EESA 1OYYA 1GAQA 3AUXA 4PHTA 3DM5A 3K0CC 1CXZA 1EFRD 4YMVA 2IEZA 4CEHB 3WYAA 3R20A 3FWYA 4BFWA 3GCGA 2X8AA 5G40A 1H8ED 4KBGA 2IBMA 5FR2A 4M1SA 2XZPA 1P4SA 4UNPA 1KI9A 1IY2A 2EVWX 3Q7QA 3U5ZB 1PZNA 1GO2A 2MMCA 3B9PA 3TSWA 2WWFA 4C4PA 4DLXA 1XNJA 3VKGA 3A36A 3HPRA 3THYB 3NBXX 4X8OA 2FZ4A 1DDIA 4F7WA 3HWSA 2F43B 5FUYA 5EUMA 5GJWC 1CQXA 1HUQA 5ELXA 2O8DB 1Q1BA 3BB1A 5H8WA 3X1WA 1EP1B 3ASZA 2BCGY 1IBRA 3KQLA 4B75A 1FNBA 4KITB 1JR3D 1MKYA 2ZUBA 3QXSA 2ZRAA 4DLWA 3A4MA 3ADKA 3UG7A 1AS2A 5FTMA 1U94A 1KTVA 1VQMB 1DE0A 4GI7A 5F9FA 2ODBA 5DNYB 3CCEB 2XX3A 1QHYA 4TYPA 2NPFA 2WWYA 3U7GA 4BLSA 4QM6A 2IWRA 4DLVA 5E4FA 2JLRA 3RS2A 2ZEJA 4H9GA 2ZRGA 3TK1A 4NP6A 1TLLA 1RIFA 1HTWA 1NP6A 2GILA 2ZRPA 4GP7A 3C5HA 1GWNA 3TLXA 2ATVA 2VIIA 2C96A 4BLPA 1QHXA 3VR1A 2YOGA 2OAP1 3ND8A 1KI7A 1WA5A 1F6BA 5EE9A 2QAGA 1M7GA 2JLWA 4ZGQB 3VO1A 3ZZTA 2V9PA 3TH5A 4XWAA 3M6AA 4A2PA 2Q21A 3V9PA 4B74A 2FFQA 5DI9A 3PEYA 1A7JA 1JA1A 3UWOA 1XB2A 1M7HA 5FTLA 4Q4JA 1AMOA 3CCMB 4DCTA 2ZYWX 3AP3A 1G8HA 5EP3A 4YAUA 2OCBA 3AF1A 1F48A 4KSCA 3NDPA 1P73A 3R7WB 4QL3A 1HE8B 2FE4A 2IS1A 2CHVA 1ZP6A 1GAJA 3DEFA 1H8HA 3FTQA 3AVUA 4DC9A 4M53A 4TL8A 1MO4A 3CKLA 2CMKA 3EPKA 4FD2A 1E3MA 2ZR9A 5CM8B 1S8FA 2GBLC 2QP9X 1G7RA 2AD1A 1QVRA 3CMEB 1VQ5B 1QHIA 4JYCA 3MWKA 5TVKA 1VQ7B 1E79A 3EC2A 5KUTA 3ZD7A 3CBQA 3OZVA 4QBGB 2ANCA 4I1SA 4NU0A 4A2QA 3CW2A 1P9WA 1WBBA 5LBIA 4I1VA 3ZVNA 1N8RD 5FBQB 4MGIR 1FP7A 2DETA 2VEDA 3LLUA 5CYPA 4P4TA 3ZLJA 4EPRA 2O8FA 1SGWA 4A8JC 5ANRB 1FW6A 3UWKA 4IKEA 1U0JA 4Q9IA 1OV4A 3JQRA 1OJLA 1QHSA 3NG1A 3I73A 4TQUS 3QBVA 1S4QA 2R9VA 2A78A 1PUIA 5DIFA 2JJ8A 1U0LA 1E1RA 3LO8A 2HYIC 3U3OA 5LB4A 1Z22A 2ZM5A 2WSMA 1D9ZA 2YC4C 5EQTA 4A6XA 4PPNA 4FWTA 4B44A 4ACAA 2OG2A 4L5BA 8OHMA 1ZNZA 2PBRA 2QN6A 1EX7A 1R8SA 3QFCA 1W4CA 1OW3B 2H1LA 4PHFA 4B4DA 2YWEA 4Q21A 4Y7CA 1XJQA 4G1VA 2YV5A 1LNZA 2LCFA 1N6HA 4JBYA 4Q66C 3BGWA 5IK2A 4BFXA 4URXR 3NC0C 2DFNA 4WOPA 1N6RA 3GLGA 2F1RA 1HQCA 4OHYA 1U9IC 3B1XA 1G64A 4HB2A 2XNDD 3CMAB 1OF1A 3RVBA 2VHUA 1A8PA 5TY0A 3BK7A 2HCBA 3ZYCA 2ZITA 4DJTA 1PLJA 2WWHA 4MUAA 1SXJD 5CDFA 3F0TA 2J59A 1IY1A 4OL0A 1TQ6A 5FOXA 1BH2A 4URZR 2FOLA 3JZAA 4F92B 4PC6A 3KKPA 2KI5A 5A5GA 4YLGA 1N6OA 4ZPXA 3DL0A 4TTPA 4LC1A 5JECA 1G291 4JIMA 2QORA 3JZMA 3PUYA 4M1KA 2VBCA 2VP0A 2ZSEA 4WZBE 3SR0A 4JLVA 4RZ2A 3OE7D 1LV7A 2XITA 1XMJA 3T5DA 3VAAA 1ZNXA 4IJMA 3T06B 3LDAA 1R10A 4PO1A 3HR7A 1XZPA 1GFIA 1P7CA 2A9KA 5FOVA 1AS3A 4LV8B 1JPNA 3NBZC 4CEJB 2YNMA 5H59A 1H65A 2YOHA 3TUIC 1H8EA 3U44B 1ODFA 4P32A 1E2EA 4URYR 1G19A 1JXMA 4TTRA 5EXPA 3Q5EA 3PQCA 5B30A 4HEJA 721PA 1WB9A 2J0UB 1QH0A 3K0AB 4PHHA 3UMRA 3GLIE 5J4HA 1P5ZB 1R0YA 1W44A 2IUTA 3IQWA 4RKEA 2OXCA 2NO1A 2JLUA 4US1R 3SYKA 5EP2A 2BC9A 2G9NA 3BRWD 2DYKA 1JQJC 3QF4B 4C30A 4BLRA 4AI6A 1Z2CA 4O0MA 3NDBB 1SULA 1ZVQA 4D25A 4HLQB 1JR3A 1KJZA 2ONKA 1CULC 1M1YE 1E2DA 1JBKA 4UJ3A 1U90A 1XEXA 3R9XA 1VQ8B 1SVMA 1XFAA 4A4DA 4RD4A 2A7QA 2FEMA 2IYZA 1T8UA 1FNCA 2XTMA 2VP6A 4BASA 5K8TA 4NCIA 1XPRA 5JRZA 5KDDA 2ZI6A 4IFEA 3GP8A 2ZVQX 4KFSA 3W6OA 1KSFX 3W6PA 4NONA 4RZUA 3P26A 3CCUB 2ODEA 2R6GA 3QG1A 2ZAOA 2ZSFA 2VZLA 3EIHA 2QUZA 4FXPA 5IDVA 4PQYA 3K0FA 1DG3A 3Q72A 2J87A 1Z6XA 3VHLB 4EKDA 5FI1B 1M2OB 3KXLA 4Z8YA 1U98A 5JEEA 1Z8FA 2FPKA 4RD6A 3PV0A 2GCPA 4MGKR 2GJ9A 3CPWB 3AKDA 2ZSDA 1XMVA 2PMDA 4L4UA 3I5YA 2PX0A 3B9QA 4OQLA 4XJXA 1NSTA 1E9EA 1ZAKA 3AKCA 4UXJA 4BFSA 4JJKA 4AC9A 3U60B 4Z1MD 1B0UA 4NCHA 4D26A 2R6HA 1NBME 4OBEA 3WBJA 1VPLA 4V0LA 1VG0B 1XEFA 2DFKB 1E99A 3I92A 1I2DA 1XU4A 4QHSA 2J41A 2OBLA 1GG2A 2OBNA 3LBIA 4BEJA 1OFIA 3EAQA 5DI3A 5KSWB 3T12A 4KV9A 3Q3JB 2BM1A 1JEDA 4UQOA 2F3TA 3IPYA 4CEIB 3OESA 1E9FA 1YQTA 5FL7A 5G3YA 4A6PA 5EP4A 1FTSA 2VPPA 2JLQA 2ZROA 4UXHA 1JALA 1U8AA 3AP1A 1P62B 2JCSA 2ZSBA 2IYYA 1ONBA 1CU1A 3BD9A 4URVR 1SZPA 1QGAA 1KNXA 1OE0A 4CT5A 1LY1A 3FYHA 3RS5A 1JA0A 1QG2A 3F5FA 2BBOA 2VYFA 3REFA 1JJVA 1Q0UA 3W6NA 5KYKA 1KK2A 5LD2C 3AVQA 2YZ2A 5JSZA 3CCLB 2YYZA 5IHPA 4Q4LA 3SYLA 4M0LA 1KDTA 4M1OA 4PSAA 4ZDIA 1XTJA 1J90A 4A92A 2VL7A 2C98A 2ZRMA 4DXAA 5F98A 3WNBA 2WZQA 1GILA 3QE2A 2IA5A 4UJ5A 2ZR7A 3REGA 3W9YA 4LDJA 4N0EA 4LJ8A 3P20A 4Q4AB 1RKBA 3LH5A 2F9LA 5J5CA 3EA5A 3RWMB 2A2ZA 2L0XA 4YDSA 1NVUQ 3IPXA 4AKHA 2F1HA 2MMGA 1KO1A 3K9NA 4YC7A 5KSOA 3HYTA 4BEBA 3U7HB 4KVGA 3AUYA 2QMUA 1Q44A 3NIBA 2G88A 1G8FA 4Q02A 3ZIAD 1XTIA 1ZUHA 1OXXK 3D8BA 5THXA 1GZSA 2PCLA 3BBPA 2GEVA 1XJCA 2XGJA 3CWQA 3I8XA 4YMSA 1J9ZA 3GJXC 3QE0A 1W5SA 2B5OA 4E03A 1GNRA 2RCNA 3LO5A 4YDHB 1E2HA 2QM8A 3QUSA 2CRVA 3FHOA 3IDQA 3MWLA 4N1AA 4OI0A 2XZLA 3F3YA 2IHYA 3NBYC 3AQ4A 4O2LA 3B1VA 2HUPA 2NZ8A 2XNDA 1W5TA 2ZRJA 3EPLA 4UNRA 4DLZA 3AVVA 3OZUA 4EIWA 4X8MA 4HI0E 3AVTA 1NNEA 2E9SA 2W6JD 2IC5A 1QFJA 2QRNA 4NYIR 2GJKA 4RFVA 2XJ9A 3SU8A 1GVNB 3QKRB 1KKLA 1UBFA 4UNSA 4JVNA 4MYUA 1Z6TA 4C0QC 4K81B 3VU9B 4TYWA 1EWRA 2GVZC 4G5GA 1SVLA 3BB3A 1SKQA 3CPJB 1A1VA 2VO1A 2GDJA 3W8NA 2EWVA 2OM2A 3ONWA 1PJRA 4Q9KA 1VIAA 1CNEA 2JJ2A 4NTZA 3WMFA 1N0UA 4LYFA 4Q7JB 3TSZA 1COWD 3RRYA 1Z5ZA 4M8NE 4TTQA 5HKKD 4JLKA 2A30A 1T3LA 3C7KA 4R2IA 3M1IA 4TZ6A 3A37A 1FX0B 4RY2A 3EC1A 5EXSA 5B64A 1ETUA 1FMJA 5HE9A 2RC6A 4PC1A 1KMQA 2GESA 1RRFA 3AP2A 2ZTSA 1A5TA 1T6NA 2ZE5A 4C7OB 4G5OA 4BFZA 5FH9A 4B43A 1VDZA 2RGGA 2V7QA 1RVDA 4NCNA 1OPXA 1NI3A 4PQRA 2VRWA 1KK1A 1RRPA 2IWHA 2JLXA 1XMSA 1KSHA 2KBEA 5D3MA 5SZKB 5FPYA 3CRRA 4JJZA 1XMIA 2EFHB 1CLUA 3IIJA 4LHWA 1G17A 1T9HA 3SOPA 3RRZA 3SZRA 1N0VC 2J7KA 3LD9A 2WJGA 4H1UA 3ADDA 2I1QA 3FJOA 1DBSA 1FPMA 2QNRA 2RH5A 3N70A 2EW1A 3NKVA 5J4KA 5KU1A 1LF5A 1E4YA 3FOZA 2OE2A 4HLUA 3L8ZA 3TIFA 2OK7A 4HZUA 1CKEA 1FRNA 1Z07A 2OAQ1 5L8VA 5SZHB 1I4TD 1EXMA 4JLDA 3ZS8A 5JCZA 3LXRA 1XPUA 5TV2A 2OEPA 1W4AA 3RRNA 2EFGA 3CRW1 1KMHB 3D7MA 2HF9A 5JWOA 4A0GA 1OXUA 2QAGC 3AKYA 2BMWA 2HMAA 5KPDA 1E9DA 1YZKA 2NQ2C 2JJ1D 4N3NA 2QTHA 1T0HB 5G53C 3WP0A 2WIAA 1GKUB 1T91A 2W0MA 4A8JB 3E70C 2F55A 2WWGA 1OFHA 4CW7A 2CNDA 3VMFA 2KSQA 1YZLA 1Z29A 4DCVA 2OBMA 3IEUA 2XJ4A 3SNHA 4D82A 3RSLA 3SEAA 4Z51A 1SVOA 1NMZA 2ZVPX 1XZQA 1E6CA 2H16A 2IYVA 3FFAA 4JL5A 3WRXC 2PL3A 3KQHA 4A1FA 4Z1MA 3GQBA 5KSYA 4B3GA 4O2RA 1TMKA 2R6AA 2I3BA 5EXTA 3SHWA 3IQXA 1XCGB 3PR1A 4QBIA 3KQKA 2OCAA 1NVWQ 2NIPA 1KNQA 2OLKA 1F2TA 4PFSA 2V54A 2KJQA 1J2JA 4XVRA 2HT1A 4P4SB 1VYVA 2N46A 3ECCA 2IHBA 5H5JA 4NYIQ 3M0EA 1H42A 3RABA 3L8YA 3QVUA 4BPBA 1G7SA 3B1WA 3U6KA 1JJ7A 4LJ4A 3QXCA 5IF9A 5GVRA 1N0WA 1RJ9A 4YQFA 2WOOA 3E5HA 5B2ZA 1KI6B 3QQ5A 1RFLA 2IS2A 1E2QA 5CYOA 3X1ZA 3H1TA 5AJZA 4BFYA 2ECKA 2MSEB 5E3HA 4HDQB 3S1AB 3TQFA 1UKEA 1D2MA 1TQ4A 2CDNA 1BQEA 1E2GA 1FZQA 4A0RA 3LFUA 4MRPA 2GVDC 1GM5A 3W5HA 1BYUA 2VSOA 3TW4A 1KD1D 1KDRA 3NH6A 3H4MA 5HZHA 3E2IA 1N6NA 1W4BA 4IDHA 4RD1A 3I8SA 5DH9A 821PA 1DS6A 4G5QA 5L3SA 2OFOA 1MV5A 3GEIA 3CM0A 1RW4A 1B23P 1KO7A 3A1SA 4LI0A 1KY2A 2BKUA 1N2CE 3LX5A 4IVPA 4LYAA 4EQ6A 5LPNA 2GCNA 2QGZA 4JVMA 2Z0MA 1J8MF 5FR1A 2NZJA 3UATA 1BS1A 4WIAA 4N3GA 3BH7A 1P3JA 1N25A 3ZIAA 3MLEA 4FW9A 5BN4A 5DSZA 3MWYW 4RFSA 3THXB 1OH8A 4MDFA 4KFTA 1DAGA 2GCOB 3TAUA 4U7DA 3EIQA 3GLGE 4DLRA 1QUEA 1OH5A 4QKQA 4FIDA 3TVDA 2QTZA 2X1VA 4LC0A 2BF4A 2CJWA 4TLEA 3DVLA 4QXAA 2Q6TA 3A4NA 3GLIB 4QGAA 1KAOA 1CBUA 1GRNA 4TMKA 4C0HA 4DT1B 3W34A 4I4LA 1ZM9A 3KKOA 4ON9A 4QGHA 4TMZA 2W6JA 3WY9A 4FMCB 4TQ9A 1IXZA 3RC3A 4O3MA 4Q18A 2JAQA 1G3UA 2OUKA 1DAHA 2ZI7A 4BZQA 2WKRA 3NWJA 3P4XA 4M22A 2ZE7A 2ZR0A 2H7VA 2EFEB 4V0MA 3TSOA 3BH0A 4ESVA 5JHGB 2JDIA 1COWA 4DB2A 2ZJ5A 3ASYA 2ZETA 1N5LA 4U00A 2NMVA 1YR6A 3C8UA 1XTKA 3NHBA 5HKKA 2GNOA 5EMNA 3AGPA 1BOFA 1FRQA 2IUSA 2RB4A 3OHMA 3U3MA 1DO0A 2GJ8A 1G8PA 3GJ0A 2R44A 4C0KA 1QHHB 4KFRA 4KHZA 2HXSA 1S2MA 2BKEA 2FPMA 2BGJA 1NY6A 2H8KA 2WIBA 2C99A 3RNLA 2B8WA 3TBKA 2KB0A 3FKQA 4HUQA 4PQFA 4DUGD 1Z63A 1G18A 4K1XA 3THYA 2R2AA 1VQOB 3I61A 3ZBUA 1Z47A 2RGDA 4AYWA 5HE8A 2O8DA 1QFYA 4ILEA 1ZC3A 1IAQA 2QL6A 1CEEA 3GJ7A 3MMPA 4XD7D 1XD2B 2GXUA 3KB1A 3ICQB 3BOSA 4PR0A 3CR7A 2QTVB 1CRPA 4GPTA 1WQ1R 1JR3E 2Q3FA 4PX9A 1AJEA 3NH9A 3WHLA 2FN4A 4HE5A 4R9UC 3KFVA 4B6EA 2BMJA 2PT5A 1MT0A 1HE1C 1M90D 1TF7A 5HCNA 5AUNB 4BWYA 3R8CA 3CONA 2E87A 2VP9A 2PLFA 4Q03A 4RKFA 1TF5A 1QGZA 4XOIA 1QX4A 1NY5A 1A4RA 1PLLA 3NHAA 2FA9A 1D2NA 2WHXA 3JVVA 3NEJA 2DY1A 2PJZA 2IYSA 4IEEA 5JFGA 2FG5A 2PT7A 4GDFA 2JJ1A 5TB5A 1NN3A 5LD2B 1XP8A 4LHZA 3CRQA 4ZI3A 2BMEA 2VSXA 2X77A 1ZRHA 2EWWA 4PC7A 4IOKA 1DAMA 3QEOA 2XOKD 4I81A 3R7WA 5FFMA 3DZ8A 4LGMA 5EE0A 1U8YA 4DEYA 4ZGNB 3J81k 1E2MA 1PLKA 1P2VA 1VQ6B 2VP4A 2CEAA 2X19A 3L0PA 2AL7A 1G5TA 3W8RA 1TUIA 3EZ7A 3B13B 1YHQB 2C2HA 4DDWA 3FE2A 3TRFA 1HH4A 1HT2E 2OK8A 1JB1A 2CCGA 2ERXA 1OH7A 4NZYA 5CM9C 1SHZA 3TE6A 4O25A 3ZZ0A 3HDTA 4KLNA 2VF7A 1J8YF 1W2BB 2GF0A 3EZ9A 3UKDA 2JATA 1VYTA 2AX4A 4FWIB 3EW9A 1E2LA 3SN6A 3O8RA 5FUVA 3U3JA 3ZC3A 1LS6A 3UG6A 1AA9A 5E7JA 1NG1A 1FTNA 3BH6A 3LX8A 2B21A 4M9XA 1GR1A 1D1NA 2QGNA 1HY3A 3AM1A 1UMKA 3QXXA 1S1CA 1X8KA 1Z0IA 5KOYA 4S35A 3AVPA 3QFTA 1OFTA 5L3VA 1ZD1A 2ZANA 4YMTA 1OHHD 1OH6A 4TMVA 3FGNA 5TXGA 1KO4A 1VTKA 1ZU4A 4TQAA 3QOFA 4E22A 3AVWA 4FMBB 5HCIA 2FDCA 1YHNA 1I4LD 2D3WA 3DKPA 5JMTA 3ICEA 3A4LA 1WDTA 4DQKA 4HSEA 2ORVA 2VNIA 1ZCBA 2O0JA 1ZMXA 4MRNA 2FEOA 1XBTA 1XTSA 2AXNA 2QZ4A 3T35A 1XDBA 4IOMA 2RGCA 4HZIA 3U2QA 1ZUNB 1GKIA 3LRPA 1XTQA 1GL6A 5GV8A 2OCPA 2H17A 2W6ID 3W5JA 3MFYA 2C95A 1EWQA 4P6VF 2DWQA 4V0KA 1J70A 5E7MA 4PSVA 4ZIRB 2G1KA 4URUR 4JLNA 5K8LA 2NO9A 3R9WA 3HYRA 2VLIA 2BN4A 3FHTA 1JB9A 4TLAA 4M1YA 5FBRB 1FNNA 2O52A 4HLCA 2YC2C 2JLYA 3HU2A 4JLAA 2WAXA 4KYIB 4TWZA 3W5IA 3K9HA 1Z83A 4ZDWA 4WXRA 5EZ6B 1FUUA 4BECA 521PA 2K5UA 5JBQA 3NTUA 1GITA 4DLTA 4FK8A 1Q81D 4B73A 5C1BA 2PZFA 3T1QA 4DLSA 4AURA 2O8BB 2ZI4A 4YALA 4AIIA 2ORIA 1G8GA 2ZRCA 4R98A 4KYUA 3SC3A 3QPVA 3UXMA 3MUFA 5JS7A 5C2JB 1Q57A 2JEOA 2WMNB 3VHXA 1M6NA 1P2UA 3IHLA 2G77B 4KSBA 3CXCB 4LJ6A 4DDTA 1W87A 4AKIA 3U44A 2QAGB 3TNFA 2P5SA 4ABYA 2QEQA 3L82B 1X8LA 3KTAB 2J0UA 3K0AA 1ZD9A 2EFCB 4TL6A 3EXAA 3TJZA 3U3KA 4Q9JA 5FBVB 4DUGA 3EPHA 3QKSB 2WWXA 2C9OA 4US2R 2IYRA 4LJAA 3GFOA 2CXXA 1OIXA 2C78A 4G0NA 2R62A 1DAEA 1RC8A 4M1TA 1JECA 3KKNA 4HAYA 2VHJA 2IYWA 1OLOA 4Q00A 4XD7A 3QF4A 4HLUC 2UZIR 4M4SA 1OXSC 1V43A 1R0XA 5F2EA 2QBYA 1AGRA 1US8A 3CWZA 4EPWA 3TKLA 3ADBA 2V6JA 2WVJA 3KZ1E 3OFND 2IL1A 4HAXA 2ZU0C 2TMKA 5AJVB 1TL7C 1M8PA 2ZJ2A 2GEDA 2CL7X 2N42A 2F9MA 1GUAA 2J9RA 3OZWA 1E2KA 4GT1A 4MKHA 1VKJA 2O0KA 4FINA 4D4KA 2FSHA 2ZRNA 4MYHA 2RKOA 2WSSA 1TADA 3GD7A 2OT3B 4Q19A 4ASUD 2G0NA 1W35A 3RHFA 1X3SA 1II8B 5E7IA 1G9XA 2O8FB 3EPJA 1YR9A 3ND9A 1AQUA 1EFRA 3CX7A 2QMOA 1KK3A 3C14C 3C41J 2YWGA 4GSYA 1AIPA 3HR8A 3C16C 3CCRB 1L2TA 2YWFA 1ESNA 1MR3F 1WMSA 2WV9A 5KNBA 1QRAA 2REOA 1DPFA 1Z0JA 1CIPA 4Y0AA 4KXFB 4BGDA 2H57A 2VH5R 2ZUDA 2WJHA 4QNMA 3PIRA 4M9ZA 4WZAE 1MO3A 2W00A 1JAIA 2CCKA 3QVVA 2REBA 3WMEA 4M1WA 1EFCA 1VQ4B 1RZ3A 1DADA 1VCOA 3I3SR 1VG1A 1YJNB 1ZBDA 3PEVA 1DVRA 3PVSA 2CLCX 3TR0A 3ZS9A 4AKGA 1L4YA 2ZS7A 4Z54A 3OW2B 1W7AA 1EP2B 4GZMA 4DB4A 1ZCAA 2GRJA 3HJNA 4P33A 221PA 2IXFA 2PZEA 3AH8A 3U3RA 4CEIA 4LYHA 3CNNA 1IONA 4OK3A 5CJPA 1CR4A 1A82A 5DHFA 6Q21A 2CE2X 3QKTA 3ZVRA 4CVNA 1KI4A 1D9XA 2P3SA 1OT3A 3M4YA 3GLGB 4Q01A 4DQLA 4JBXA 4KLZA 1UDWA 1X86B 2WPDD 2ZI9A 1YZGA 1CP2A 2CL6X 4BLOA 4EJSB 1CJMA 1P61B 2ZS8A 3GLHE 3OIVA 1N6IA 4DLYA 3CCJB 4DRZA 3U4QA 3B1YA 1B2RA 2C9CA 2QPOA 3B85A 1XRJA 3GJ4A 4MGYR 4DCSA 4QGGA 1G41A 2H92A 4MKIA 2Q3HA 1PVOA 5CK5A 4NL4H 2BIFA 5CITA 3Q7PA 2GF9A 4TLCA 3CCQB 2D2EA 2D06A 5A0FA 4DCNA 1F5NA 2PMKA 1VG9B 1WBDA 3OIUA 4MITA 1Y3AA 4HAZA 3WMGA 1RRGA 3SQWA 4Q4AA 1OHHA 2B8TA 3KFXA 5FI0B 1GAWA 4DSTA 1HV8A 1KDOA 1UF9A 3KXIA 3Q85A 1ZIPA 4G01B 3PXGA 1QVGB 2QU8A 1Z3IX 4JVSB 1II0A 2V3CC 3NVAA 1QHNA 1F60A 3ADCA 1NKSA 4KODA 4QNRA 2ZE6A 4LSGA 4UAJA 4WAUA 3O8DA 4B34A 4I1OA 1Z2AA 1GJRA 3ZQ6A 1E0KA 1HA3A 4EPTA 2ORWA 1VCMA 4P4UA 2W6IA 1G16A 2IYTA 2G6BA 1T3HA 1W36B 1JNYA 1TU3A 1AQYA 3TMKA 2Z4RA 3OF5A 5L3RA 2BGIA 2P65A 4QBHA 3B82A 1KYIA 4NDZA 5UKDA 1KOFA 3R9IA 4QJ5A 2IYUA 3QKRA 2IW3A 1TEXA 4I1UA 4JZKA 4M1MA 3G0HA 4BPRA 3VU9A 1VCIA 4TMXA 3W2GA 3AVXA 4A9AA 2B7BA 2A3RA 4ZKDA 3I62A 1G5RA 1KJWA 5FPTA 1XEXB 3FPAA 3RYTC 3T15A 4BFUA 5EE3A 5KNDA 2FX3A 3MRSA 4V0ME 2G3YA 2VP2A 4E5UA 2BBWA 1C4OA 1FQKA 1UADA 3CF6R 4IHQA 1YRAA 1XF9A 5AN9A 3EASA 2IX3A 1F20A 1NKTA 2O8CB 4HB3A 2NO0A 4WVFA 1F3OA 1W49A 2VP5A 4W5HA 4UNNA 1FX0A 3DOEA 3OEHD 2GZDA 4LX0A 4LZZA 3K0FB 4U02A 4B35A 3FMPB 3ETLA 3K53A 2OTJB 2X3UA 4Q4HB 2ZRHA 1RRCA 1GRQA 3JQQA 3RS4A 3BAFA 1GTVA 1EFUA 1MRNA 3GMTA 4R71A 3MCAA 3Q8XB 2DBYA 2ZAMA 1Z06A 2PH1A 4I99A 2QRZA 4HDCA 4QC2A 1IN6A 1E0AA 2Q9CA 1IQPA 5DN6D 1SVKA 1SKYE 3DO6A 1XD8A 3X1YA 5EE1A 621PA 1SXJA 5AJYA 3CO5A 2IF0A 4II7A 5DI3B 5G41A 4NH0A 1R2QA 3GJ5A 3QPUA 2FGKA 3GLFA 1SM4A 2F1JA 2HF8A 2JLSA 3CLVA 4B3BA 3QJYA 1FOEB 1EFTA 1R5BA 4OI1A 1FL9A 2YJTD 2ZREA 4HLDA 2UKDA 4DZZA 3DPUA 1LB1B 3K70C 4IVQA 2ZYTX 3WYFA 3LWNA 3OE7A 2ZRBA 4DLUA 2UZ3A 4WA7A 5H1YA 2CK3D 4ASUA 2V6IA 2EYUA 2W0SA 1SHKA 4EFNA 1W0JD 2YVUA 1KO5A 1T8TA 1UBCA 5KHOC 4IOLA 4L16A 3VNVA 3ZVMA 5K8IA 2YHSA 5JJIA 4B3FX 2EIXA 2A5YB 3MSXA 5L3QB 1G8YA 4V02A 1YR7A 4BFTA 4G5RA 3EZ2A 1ZNWA 2PLRA 3UIEA 4G3XA 2ZSAA 4MGZR 1YR8A 2Y8EA 4EPXA 2ZJBA 4DKXA 3W2EA 3SDZA 1G6OA 1K6MA 4C0SA 2CCJA 4LJ5A 2QEXB 2LWIA 1ZM4A 1T5LA 2PEYA 3QEJA 2ZRKA 2QY9A 2G1JA 3RAPR 1NVVR 5HXBA 1LS1A 2C04A 1G1MA 1HEIA 1VQ9B 2ZS9A 4X8LA 4CGZA 1IOZA 1ELOA 1Q86D 1OGIA 4MYTA 4GP6A 4JLJA 1M74A 3PUWA 2QG6A 3TQCA 1W4RA 2FNAA 1E32A 2WPDA 1YI2B 1FNDA 2ZRLA 5BXQC 1NJFA 3NEYA 3CD6B 2QQEA 5EXXA 1M1KD 3PUZA 3LAWA 2XNJA 2J7PD 1KK0A 4C2TA 3TW8B 2VNHA 3S1AA 1IN4A 1NLZA 2A5JA 3IBGA 3WNCA 2GWHA 1C9KA 4QBFA 121PA 2RHMA 2EU8A 3WBKA 2HLDD 2WMOB 1XX6A 1Z6YA 4IVRA 4XH9B 2W83A 4D0NA 3UPUA 3O8BA 4FMDB 4MQBA 3DOFA 3O47A 1M7BA 1ZUIA 2VQSA 4C0JA 4MYCA 1XEWX 3OIYA 3P4YA 3KJGA 2DEUA 5DGXA 3L0SA 1AZTA 2FFBA 4L9WA 2Z6VA 4V0NA 3W90A 3CCVB 3QKUA 1W48A 4PPGA 1FFHA 1N6KA 2QPTA 2GXAA 1T0JB 1FNMA 1VECA 1NRJB 3THXA 4HUTA 1Q21A 4ZCMA 1X8JA 3T34A 2GCOA 1R0WA 2D62A 1TNDA 1JPJA 3SBDA 5IRCD 1MO6A 2IYLD 4WQMA 3TUJC 5TMPA 2J0SA 3IIMA 3QF7A 2HYDA 2R8RA 1KAGA 3CRVA 3GJ8A 3OAAD 4US0R 3X1DA 1OB5A 1OXVA 2ZQ5A 3OIWA 5HR5A 1G3QA 2R6FA 3JVUA 4IDOA 3HPQA 4X8HA 5FBLB 4Q7LA 2QT0A 2OXRA 2QMEA 3V76A 2CLDX 1Q22A 3OEED 3ZGXA 1G3MA 4YXWD 3B8HA 3CH5A 3KQUA 1IY0A 4LPSA 4CF7A 2ONJA 1OB2A 2CNWD 2GETA 2NO7A 4KU4A 5KSZA 3QSYA 2WICA 4G5SA 1UAAA 1VIYA 2DERA 4PHGA 5GADl 1YITB 1XCMA 2ZJZA 3BXZA 5JJKA 4BQSA 4CIDA 2VNKA 4YAFA 5KDLA 3BB4A 1XE1A 3QI2A 2RGNA 4JSTA 3CX8A 1H85A 2F1IA 1XXHA 4PTLA 2IYXA 1W2GA 5G3ZA 1NJGA 2QDXA 2HJVA 4A15A 1Q20A 5HPYB 3VX4A 2DCUA 4TMTA 4PPFA 4F38A 3VKHA 1YKSA 3OEHA 1CR0A 3HP1A 3A58B 4CRWB 5BN5A 1QHHA 3UK6A 1E69A 3LLMA 3KQNA 4TYQA 4LWZA 5DO9A 1AKYA 1F2UA 4OK6A 2BDTA 4FCVA 1QHGA 4PSKA 3RLFA 2O8EA 1G7CA 1S3SA 4BUJA 2JIZD 3SJZA 1FQJA 2JASA 2XNSA 3A1VA 3B7GA 3LNCA 3G4SB 2IT1A 2ZU6A 2QM7A 2J1LA 1NVVQ 1IN8A 1TEVA 4OJQA 3ES9A 1JQLB 1R7RA 4CT4B 3QXJA 1QZXA 3OZXA 4YMUA 1VQPB 2HXYA 1H8HD 5DN6A 2QPAA 5CDFE 4LBVA 1I2MA 4LBZA 1XPOA 2XTNA 1HT1E 1NN0A 3O8CA 2IXEA 5FA6A 2J3EA 2XB2A 3BC1A 1L8QA 1MABA 1N5IA 1RYHA 4PZLA 2WTUA 3K8YA 4TLBA 1I7PA 1JEEA 4P3YA 1WCV1 3IUYA 4ARZB 2V8OA 5J40A 4QJ4A 3SS8A 1S9HA 4YAWA 4KJZA 4D4LA 2LKDA 1C1YA 4JL6A 3H84A 2QSYA 4RD3A 3QIAA 4D0LB 2JLVA 4A0FA 1NMXA 3AGQA 1T4GA 1N3BA 2CK3A 1DO2A 2ZRIA 3GLHB 4CEHA 4KAXA 5DLQC 1BJKA 1WF3A 1W0JA 4QGFA 3LV8A 2GKSA 1AK2A 4OHVA 4ESHA 3UMSA 3THWB 2YOFA 2VHCA 4XSHA 3BS4A 1FUKA 2ZYUX 3WYGA 4NHOA 3FFBA 4IOJA 2HT6A 3W2FA 4LY6A 1JXOA 2J0QA 1N5KA 2IS4A 1SVIA 4B3CA 1E2NA 1GNPA 1K73D 1Z6AA 1UM8A 1IN7A 5J4LA 4TT3D 2GAOA 2REXB 3BFKA 3LQRA 4CZ2A 2F43A 2XAUA 2V4ZA 5L3SB 1G5PA 2AKAB 3EWSA 4HB4A 4IEIA 3W3ZB 2AKYA 3MGCA 1M34E 5SZJA 4ZV4A 5JS8A 3DMDA 1Z6GA 3H0KA 1KKMA 3V00A 2QT1A 4NKRA 4B3DA 2N1BA 3C5CA 4H1VA 4D0GA 3U7EB 3VTKA 2BBSA 4Q5IA 5JRJA 1U0HC 5IK2D 3OJXA 2NO6A 5JI3E 1MH1A 2RGAA 1BKDR 4Q9LA 4A36A 4QHYA 1QDEA 3C4JA 4PGOA 3U6BA 1S9DA 3IO3A 1P60A 2B92A 1E2JA 3IEVA 2KWIA 2CJWB 1UDXA 5LDDC 4U9UA 5H68A 4XIGS 4L15A 2V1UA 1OSNA 2VTKA 5CJ2A 4F93B 4MKGA 3VNUA 3MD0A 2J7PA 4B76A 4URWR 2DWPA 1GP2A 1CS4C 1DOAA 1XTRA 3CIOA 3FMIA 1G3IA 1NF3A 2Q0HA 4D80A 2XZOA 3PUXA 1MOZA 1NLYA 3A1TA 1X6VA 1CR1A 3SQXA 3DM9B 1WP9A 4QHTA 1E4VA 3TAHA 3C15C 2B7CA 2D7CA 4B48A 3V4RA 2CL0X 4Q1DA 4HAVA 1KI2A 4AYTA 2BHRA 4YAOA 3DHWC 1AS0A 1X1RA 4YONB 2CVFA 2FGJA 2IXGA 3B60A 1E1QD 4A2WA 1E98A 5AJWA 1TTTA 2UVQA 3K1JA 3IBYA 3GEHA 5FPHA 1KC8D 1AZSC 4C0BA 1IXSB 3FHCB 1QG0A 4HUQB 5DYIA 1PV4A 5CIQA 1QBKC 3K0EA 4OJKA 2AR7A 3MWJA 5EZ5A 3I56B 3SHFA 3I32A 1W36D 3ZD6A 4ZIRA 3OAAA 4R2HA 5F9HA 1NMYA 1R5NA 3GPLA 1Z08A 4ZKEA 2NOAA 4CDGA 1FDRA 1SKYB 4XVQA 3OEEA 4HE6A 1CJUC 3K09A 1S72B 4G1UC 5DHAA 2CVHA 2RHDA 4YXWA 3SFZA 1G3RA 4JLPA 3I5XA 3DKVA 2FZLA 2CNWA 2PEZA 4NE2A 3SI7A 3A6PC 4LJ7A 5C4GB 1ZD8A 4M2LA 4N0DA 2XXAB 4GZLA 4MRVA 2GPJA 3BIFA 421PA 4NYMR 2O8BA 2GXQA 1U2RA 1E63A 1KZ7B 1P6XA 4RD0A 4ZCLA 1NJID 2CLSA 4ITRC 4PC2A 3W5UA 1J7KA 5DISB 4UXIA 3VX3A 1EGAA 3K70B 1E0SA 1G21E 3QNUA 1BYIA 1W46A 3EA0A 1RYFA 5FOSA 3SE0A 4Q7KA 1JJ2B 1ZIOA 3VR5A 4HB0A 4EPYA 1OIWA 1YVDA 1UEIA 3DZDA 4B33A 5J4YA 4M21A 5B57C 3AF0A 3KXKA 3AVOA 3KTAA 1PUJA 4PXAA 2Z5FA 4E09A 3QKSA 2JIZA 3EZFA 1L4UA 3KDSE 2F3RA 1D8TA 4KFUA 4TL7A 5AUQA 1SXJC 4QOSA 2QAJA 3BERA 4OI4A 5GJBA 4TN1A 1ZM2A 3JQPA 5H70A 3EWAA 1SXJE 1CJTC 1L7VC 2OILA 3IO5A 1Q3TA 4HATA 2QP4A 2IF2A 2QQ0A 5HTKA 4AF7A 3T1OA 3GLFE 4MDEA 3LBNA 4RCZA 4ACBA 5CB6A 5FL7D 5FBWB 4RVCA 1LTQA 4V0OA 3PEWA 4DSOA 5JLJA 2P2LA 2XSZD 3AEZA 1P2SA 2GJAA 5C18A 2WAYA 1CNFA 4D2IA 3GFTA 4OQXA 5KPJA 3MAAC 1QF9A 2GAAA 3I1FA 1II8A 2GXSA 3B1ZA 5DYGA 3L0IB 2GZHA 5BYJA 2VYQA 3TGPA 1LF0A 1KIMA 2G0TA 2P6NA 5FOTA 4TMWA 5FOUA 1ANKA 4OQNA 4CEJA 1DARA 2DB3A 1CTQA 4NCKA 2ZI5A 5FTKA 4RZ3A 2GK7A 4BRWA 4WXPA 3CB4A 1YJ9B 2RMKA 5C4MA 4KVAA 2WM9B 3L43A 4B3XA 1QG4A 2C77A 4JKIA 4Q1BA 3NC1C 4JT2A 1Z0DA 5F3WB 4Q4JB 4DCUA 2Q9AA 2Q9BA 4TT3A 1KI8A 3IKJA 4LPKA 4JVLA 1VG8A 4ZDJA 4GMDA 4D81A 5EJEA 2YKGA 3VR2A 4OQMA 1E2PA 3WXMA 2CHQA 4MKFA 2D2FA 5AR1A 2BCJQ 3TUZC 3ZZUA 3ZJYA 1VQKB 5EP1A 3E1SA 3PG5A 4JSYA 4IDPA 3CRZA 3MJHA 4JKYA 1Q1QA 2QTLA 1BMFD 2HDNB 3IILA 3U61B 3LXXA 2PJRA 3VKWA 3VFDA 4TL9A 1NIPA 2P0EA 3GFPA 2BEKA 1I4DD 1W47A 3PEUA 3LW8A 4EJSA 1P9RA 4EFLA 2Z83A 3AV0B 4EDHA 3QG5A 1GL7A 1YE8A 2CHGA 4OHXA 5FTNA 3L2OB 4NYMQ 1FMLA 1UKVY 4LJ9A 1A2KC 3G71B 3EIEA 4LUCA 4Q9HA 1OFUX 3NBFA 1XWIA 1TF2A 1S0UA 2A5FA 3LY5A 3KL4A 4JYBA 1NIJA 1Y63A 4OHZA 2JJ2D 1Q12A 2FSGA 4OYHA 1TUEA 1YZUA 2GHIA 4LYJA 1DEKA 2QA5A 4XSGA 5DE3A 3FVQA 4M9QA 1R8QA 1S96A 3THOA 4C3ZA 4EPVA 4XVUA 3W3AA 1ZM3A 1AM4D 2A5GA 2XOKA 2IK8A 3AF4A 1R6BX 4JBWA 3SYNA 3ZVLA 1W2HA 3QFRA 1GL9B 3A8TA 1Q1EA 2QTFA 2Z4SA 3CR8A 3K9LA 3A1WA 1E1QA 1KO8A 2BEJA 2OCYC 4HDOB 4C43A 4IDQA 1E2IA 4NPHA 3V4FA 1VHTA 1O3YA 4IW3B 4EH1A 1Z0KA 3D31A 3DDCA 1BX1A 2V7QD 3KX2A 2P67A 2H5EA 3KKQA 4LK2A 1GNQA 4RJLA 2AFIE 3T5GA 4TSFD 4GOXA 5JWHA 5CLLA 4QM7A 3VR6A 5CK4A 5JJLA 1KZGB 2XB4A 2Z43A 4FCTA 4LHVA 2CE7A 2Q3MA 3RWOA 1ZW6A 4TLDA 2QBYB 1KSJA 1US8B 3QY0A 2OSBA 2C8VA 3CF2A 2RGNC 4FN5A 2J0VA 1SVSA 1KY3A 2IYQA 2SHKA 2EYQA 3FKSD 2ZYVX 1KQSB 1ZYUA 3RANA 2BMFA 1ESMA 3WHKA 4GOJA 3B5JA 4OHWA 2NTYC 1TQDA 1II9A 1OIVA 4GMXA 2O8CA 1XXHE 3KUDA 4PO9A 1OXTA 4P31A 3ZBTA 2HV8A 1XEWY 1CF4A 1G7TA 2D4HA 3I72A 4IXMA 5C46F 4MA4A 4ERNA 4Q4HA 1U8ZA 1TAGA 2NGRA 3K0CA 4AF6A 1BIFA 4KCGA 2RGBA 3CC2B 1UBGA 2V55B 3D3QA 2KBFA 3CF0A 4YHBA 4BZXA 1HYQA 5GJCA 3GEEA 3FPKA 2WJYA 2P6RA 2BOVA 5LB2A 3CZQA 4XTCS 3I55B 4GRAA 2O0HA 1DAIA 2ZJOA 4W7SA 1Q1ZA 1YJ5A 3G5UA 5GJVC 3UANA 2PX3A 1E9SA 3RSOA 2OZEA 3P32A 3CNLA 4KO8A 5HZKA 4B2PA 1TVCA 2A5DA 1E64A 2OTLB 1EWYA 3EG5A 2IUUA 4E07A 1UFQA 5FUXA 2JLZA 4LCBA 2AWNA 1CRQA 2FF7A 4YMWA 2BPOA 2VSFA 1MRSA 2QMHA 3BFVA 2ODNA 2AK2A 4NBSA 4F4JA 2AXPA 2BJWA 2XSZA 1JAHA 4EUNA 4Y0VA 1QUFA 2EQBA 3FMOB 5CIWA 3N5CA 3RDPA 3T1VA 4BFVA 2BJVA 2DFLA 1KI1A 3U4QB 3EZ6A 1IHUA 2WWWA 1XCPA 4FCWA 1J99A 2G83A 4PO8A 4LBWA 1IM2A 2HEIA 1E9RA 1ZJ6A 2FV8A 2FH5B 2OV2A 4BE7B 3SJCA 5L3QA 1OYWA 1QVAA 1UKZA 2VHQA 3N2IA 3RS0A 4C7OA 1NSFA 4TYNA 2OFWA 1ZU5A 2ERYA 5CB8A 1YZQA 3E1YE 1NBMD 5TDHA 1E94E 2ZRFA 3TR5A 2BMDA 3ZH9B 1GKYA 5GVSA 2WWIA 3CPHA 3Q9LA 3SFVA 3AB3A 1ZINA 1IJFA 4AK9A 4DIEA 4C2UA 4LHXA 3CC7B 2VF8A 2ZXUA 1N6LA 3QENA 3X2SA 1KHTA 1N6PA 2D74A 2QENA 3CRMA 4IFBA 1TX4B 1OKKD 4WZ6A 2ZJYA 4FI3C 4GBMA 5IT5A 4LBYA 3OFNA 2WJJA 4G1BA 1T3SA 3T61A 2BV3A 3CUEF 4W5JA 5KSPA 4GOKA 1BMFA 5TR9A 1CJKC 1GOTA 3L0OA 4FMDF 5AJXA 5BQ5A 3CH4B 3CCSB 1BX0A 3IIKA 3LVQE 1VCNA 4Q1CA 3R8FA 1JI0A 4AG6A 1VHLA 1NG9A 2YWHA 2GBLA 4LV5B 4MRRA 1EFHA 4LJYA 4OK5A 5M04A 1KMHA 1U81A 1WRBA 3BORA 4NCJA 3KB2A 2WOJA 4JLMA 4XWOA 4Y9UA 2GJSA 2JGNA 3SBEA 1RPZA 5B58C 3CC4B 4HAUA 1VYUA 5FL3A 4DIDA 4HYYA 4IRUB 1TQ2A 1W0KD 2AD5A 5JSZB 3X1XA 1UEJA 3BJIC 4A8JA 1LVGA 4IXNA 2I4IA 2DFTA 4BZPA 2DR3A 4PAMA 2H18A 3N2EA 4C9BA 2BM0A 3B6EA 4XTRA 2JDID 1UBEA 5EUQB 2B6HA 5JHHB 2ZIAA 4DWJA 2QE7D 2DPXA 1RE0A 1TPZA 1G6HA 4JL8A 1U99A 4XWKA 3PFIA 2AN9A 4P0TA 1YZNA 4KI0A 1KSGA 3B2EA 5AWFC 1BO6A 3MJRA 5KO2A 4P4SA 1HURA 4JMPA 4B6FA 3D6TB 1FP6A 3G6EB 1DTSA 1GSIA 4DEXA 4GFDA 2WJIA 1GIAA 1WXQA 4NYJR 4QRHA 1K8RA 4F91B 1P72A 5KNCA 3FB4A 5CLQA 3DMNA 3FMFA 1K5GA 2AHOA 5J4VA 3BE4A 3SJAA 4AWXA 3SJBA 4TSFA 4RD2A 3K09C 4V03A 1KDPA 1P75A
chains in the Genus database with same CATH superfamily
1KJYA 4D4MA 2NO4A 2NXJA 3N6XA 5TJ9A 1WVGA 5HX7A 3IAS1 3QFSA 3BFXA 4Z4IA 3WYDA 1FX1A 2PIAA 3B3GA 2QN2A 4PANA 1CB0A 1QE3A 1SUIA 2NSHA 4LE0A 4GQIA 1JR6A 2OCKA 5FTJA 1I4OA 2PCJA 4YWHA 1VQLB 1V7PC 5J2TF 2J4DA 4L9SA 1T5BA 3I4LA 2QPLA 4F11A 3VQTA 1RTTA 4PZEA 3QU9A 4EB3A 2BVNA 2BFOA 2VLBA 2ZGVA 4D4JA 1RZRA 1V1MB 4W1RA 4B40A 3HU1A 4CV0A 1S3GA 3G7UA 1XCBA 4WZBA 3RQSA 3P5SA 3KYJB 5CBPA 3PNMA 2V8BA 1QZZA 1TK3A 4TRNA 3UMVA 2X4LA 4FHFA 4C4RA 5AIAA 4YRNA 4IDGA 4C0LA 2V1XA 3GJ6A 4C0AC 2KE5A 3PGKA 2FZCA 2P62A 1MAWA 2QNIA 3M1YA 4H4EA 4QU9A 5ELLA 4QJ3A 1I1HA 4B09A 3Q9SA 4A0HA 1KARA 2F7SA 3FIUA 4D6PA 1INLA 4GPD1 1ZI6A 4IDNA 2JKZA 5HF8A 2GN1A 2O3UA 4OYLA 3BJZA 3PXBA 5LZ2A 1WD5A 4NR0A 3HU3A 5E3IA 3NHMA 3QYAA 3TOXA 1QYRA 5AOVA 5DB4A 3DFFA 1JZTA 1NDUA 3HI6A 1QVFB 3G6WA 4NE7A 1VB3A 4GKBA 4PPQA 3PFNA 2R84A 3PGA1 3GLIA 4BJHB 4Y7DA 4G37A 3RY8A 1E62A 2W2TA 1CHNA 2VHWA 4IDBA 5JXGA 3WNVA 2JA1A 4NENA 5HUQA 4QUEA 1U0GA 1ZW1A 1EDEA 3A3NA 4XMYA 4CQMA 4DBVO 4C5CA 2W58A 3AUJB 2UVPB 1Y8RA 3TVTA 4B47A 4RIEA 5KEIA 4HT3B 4K9DA 3STWA 1M1YA 3D3NA 4HQOA 3E7DA 4MYRA 4NPAA 2YMPA 3IP1A 5IDQA 1M2VA 1WUYA 4H6WA 4OFXA 3D6VA 1JEOA 3AESA 2FSVA 2ODQA 2PLWA 1Z5VA 3LKVA 5AKXA 2WJPA 3WZMA 2ZDQA 3RU3A 4AB1A 1YZTA 4ZFNA 1JU9A 2DWUA 3KJEA 4FVTA 4JNKA 4N03A 4O08A 3TMAA 3PHBE 3CC8A 2PE5A 2GZAA 1XTZA 4FX5A 4YEJA 4NEHB 1U0FA 3GUZA 4PPYA 1ZMRA 3BIJA 2Q1WA 3C98A 1T0PA 2SCUA 3OECA 3CP2A 5E2AA 4DGSA 4JYZA 3ZJVA 2IX9A 1NVGA 3ABIA 3IGFA 1EQAA 1DCFA 5DNUA 3THWA 3CU5A 1ZK2A 4WBSA 4AKEA 3RKRA 1ZVKA 2ZUCA 4BAUA 1RMYA 4LG1A 5KTYA 4BQOA 2GLTA 2W6PA 5ECDA 1JE0A 4ALKA 3MJDA 5IH7A 5KNBH 4ZCIA 5CW2A 2FXVA 5MDHA 3H8WA 3QLUA 3WS7A 1N5JA 3H2SA 2VK2A 4A5SA 1A2BA 5B4UA 2OV4A 3ZWKA 5DX1A 5ALZA 3GQBB 2RCYA 2Q2OA 3KHSA 1C2TA 1V8PA 3AUKA 3GOQA 2IEBA 3R7LA 4CKEA 4D99A 5TEVA 4Q1FA 2AIRA 2VS1A 3CNEA 1CF2O 4D4GA 3SMQA 5HKBA 1QRDA 1CEQA 1P1RA 2PKXA 2XEXA 3FZEA 4HPXB 5FUWA 2PM8A 3UAGA 5BWMA 1IEVA 3IE2A 2Q3DA 5J63A 4NOKA 2WIFA 3SICE 4YP5A 4C2UA 3ESBA 1RMQA 1FDOA 1OZHA 1E9CA 5DXJA 2Q7OE 3EFHA 1XDZA 1ORRA 2UAGA 4ILKA 1B6RA 4JT4A 3SR4A 1XF1A 3KQVA 3MF4A 2P3OA 3A05A 3E20A 1P4HA 3GYBA 1K9MD 4IUDS 1QG6A 4TM7A 5F77A 1U4OA 2VJPA 4V2IA 3RS7A 4EO7A 4J2OA 4XIYA 2H9IA 1C3OB 3S0JA 2JC3A 3EDCA 3QPWA 1SG9A 4QU5A 3U49A 5JZOA 2WKQA 2RHHA 1A72A 3P52A 1E96A 3UB2A 3MBOA 1AN0A 5LZ7A 1NDHA 3ZBQA 4CCYA 2Q2QA 1NV8A 3U7FB 4CM8A 2JGLA 3G85A 4W5OA 2OV8A 2FJUA 4DKJA 3S3TA 3NDJA 1Y0RA 2JJMA 3OJWA 1J42A 1B73A 4PC3A 1E1RD 1K5HA 1J00A 2ZOSA 3ETDA 3JRXA 4FEEA 3SM9A 4F9GA 4B2IA 2FPPA 2HJ9A 2GB4A 3DUFB 4F7DA 2BTQB 1KI3A 1VL1A 3QM1A 3WE7A 1R9NA 1B8VA 3ZDXB 3I28A 2L69A 1S1MA 1N7IA 3IELA 4YNBA 3TLYA 4K9SA 1CCWA 1P2TA 1IN5A 1WULS 4BN5A 5KOJB 4KO3S 4UEKA 3RS3A 1L8XA 1PS9A 2O7SA 4J0EA 3WGMA 4XVHA 2C9YA 4BB9A 1TKCA 3C2QA 1ISHA 2DSTA 1I6LA 3EVTA 4FE3A 1EAMA 1UPTA 2Q6LA 3ELUA 1OA0A 4FBMA 4EQ6B 3MHPA 4EJ6A 1E5LA 1SXIA 2NLOA 4P6YA 3ITDA 1T9CA 1UR5A 1D03A 1DMRA 2O57A 2QW1A 4UBJA 4BLQA 2AK3A 1NW3A 1YJWB 3IXLA 3KUCA 1GNVA 4PXYA 1Q0TA 1F2UB 2QX6A 4QULA 4D45A 2XTZA 4JLSA 2O8EB 1TM5E 2JFOA 2NG1A 3PPVA 1GY8A 2NNLD 1WVMA 2Z3ZA 3FNEA 4JD5A 1Y81A 4KAJA 1GRRA 4LOAA 1CDEA 2VAPA 4XCXA 4A73A 1JKXA 2WW8A 4DDUA 2FPLA 2Q2VA 3PNYA 2C2BA 4F4CA 2NU7A 4A82A 3AW8A 3MOIA 2XGGA 1H2HA 3OQMA 3CZ5A 3ZQ4A 1IH8A 4S2EA 1V7ZA 1C9NA 3PZRA 4N3CA 3VKFA 3RJ5A 1JWLA 2FPGB 4R0NA 4OUDB 3RBXA 1R0SA 5CHYA 3KLNA 4W6QA 4X7RA 3EMDA 2O50A 4AP5A 4C05A 5IFKA 2C2WA 3G5AA 4MAAA 2PFKA 1NWHA 4Q48A 3TDMA 3W2HA 3USZA 3HI4A 4W5WA 1Q0ZA 2XKJE 3UUEA 3H5RA 3LY7A 2IHJA 4MI3A 1P18A 4YO7A 2NAPA 1OVMA 1V1JA 2DUMA 4UTPA 4L8WB 3ETCA 3WGNA 2CV1A 3S27A 3LTEA 2ERCA 2O1XA 5L4LA 1NBHA 1PT7A 4RPCA 4K6GA 2PZGA 3E3AA 3GAFA 4MWGA 2Y4NA 2F8TA 2D6FA 1UOQA 4L3VA 2QJRA 1EFRD 2XB9A 2IEZA 3DAFA 9LDBA 1PFVA 3WYAA 2V5AA 3EGIA 1DAPA 1UPBA 4WZKA 1RWNA 3AM3A 3COSA 3GCGA 1YS6A 4K8RB 4Y2RA 1H8ED 3TNDA 3VPBA 4C3OB 4IGIA 5FR2A 1E3WB 1RHUA 5AFSA 2QE6A 6CHYA 1XQ1A 3DW3X 1IY2A 5U4XA 1G5QA 2EVWX 3U5ZB 4UAGA 2PUJA 4DLXA 1XNJA 2PKWA 4PX2A 8GPBA 5IN4A 1F0PA 5ALKA 3JQEA 5AVSA 1YL7A 4X8OA 3NAMA 3G0CA 4OB8A 1CQIB 4UMEA 2FZEA 4F7WA 3EVEA 3CG0A 3DYBA 2F43B 4ZV9A 4LMPA 5LNK6 3MM4A 4XXHA 4XPIB 3X1WA 1PNVA 3L02A 1LLUA 3VAZA 1FYXA 1ZA1A 2BCGY 1IBRA 4RPIA 2VJOA 4RPHA 3MT9A 1MKYA 1LLDA 2J30A 4JKOA 2PUGA 2E4ZA 3A1DA 5I4KA 2ZRAA 1E1DA 5FTMA 2FWNA 1OWNA 1VQMB 5IBRA 1PJQA 3DSRA 2ODBA 5JXWA 2C0CA 3HMQA 1QHYA 2D0DA 3KHTA 1O5IA 3CLRD 2WWYA 4BLSA 4D56A 2R66A 4DLVA 4MHSA 3RS2A 2ZUWA 4H9GA 4LK3A 3CZCA 3RRBA 2AF4C 5ICEA 4QXMA 1RIFA 1PK8A 2GILA 3CY6A 3SX4A 2C20A 1UJ5A 2ATIA 2FW6A 2WFAA 3C5HA 1GWNA 4Y2TA 1E4EB 1IHYA 4YRDA 2VJBA 7ADHA 3KYDB 2RDMA 5JIBA 5DS0A 2FP3A 1WA5A 3U13A 1F6BA 4OGKA 3QGMA 4ZA2A 5EKDA 4E11A 1J1UA 3TBHA 3NDRA 4FHCA 1CSEE 3EGDA 3VO1A 3TH5A 2V9PA 2IDZA 3G9QA 1PG0A 1IE3A 5C5CA 3S68A 2FFQA 5K6AA 1M83A 1QKJA 3H94A 3ESAA 2BP7B 1XB2A 4XLLA 1DJQA 2XGSA 1Z4JA 2ZYWX 2ZUEA 1XTVA 1JEJA 1U2DA 4YAUA 3ET5A 2B4KA 1IZ9A 1F48A 1GZDA 1K92A 3AF1A 3NDPA 4MVJH 4QL3A 1F0KA 1UODA 2VUIB 1HE8B 3FOAA 2QXYA 5EJ7A 1FJ2A 4CL3A 3KE8A 1QYIA 2CHVA 3DEFA 4Y2PA 4LTNA 4GU5A 2PWYA 3PDJA 1MO4A 4LVOA 4ZI7A 3OKCA 2CMKA 2E3JA 3ZK9A 1G0NA 1XCJA 4N7MA 4NLLA 2ZBVA 3NIDB 4LDRA 2GBLC 2GREA 3CMEB 1C30A 1QHIA 1X39A 2C42A 3HEBA 4FGLA 4FYXA 3JYOA 3R7WB 5KUTA 3ZD7A 3BY2A 4D9HA 2ILTA 3ANXA 4RVHA 4QBGB 7MDHA 3ZR4B 2W8ZA 4I9GA 4IRXA 2C54A 2ADMA 5FJJA 1N8RD 5FBQB 4MGIR 2KMLA 5BNFA 1FP7A 2DETA 2VEDA 3GFVA 3LLUA 4I4TA 2VPQA 5CYPA 1HDRA 4JOBA 1H05A 2ZL5A 3ZWYA 3C4VA 4K9PA 5ANRB 4CIYA 4FKMA 4HGQA 3UWKA 2GCIA 4LZJA 1X0VA 4NMWA 1OV4A 1NHWA 1QR2A 4M0DA 2NSJA 3MPUA 3SMVA 3NG1A 3CEAA 3WYEA 1FCJA 2YQ5A 2XUIA 1S4QA 2R9VA 3QBVA 2A78A 2JIPA 1VJTA 2AFRA 1GKKA 1TYAE 2EKZA 4WX2B 1RVV1 5I51A 1YSCA 1E1RA 1JDUA 4ANFA 1EUCA 2HYIC 3VR4H 3U3OA 2ZM5A 3D26A 1Z22A 3SS9X 4G0PA 1ISRA 2X13A 5A5DA 5EJ8A 5KWIA 2O6LA 5KS2A 5AQ1A 4ACAA 2XDYA 2AFHB 3DTNA 1BN6A 3G49A 3DL2A 4MVJE 1XLTC 2Z9CA 2CYBA 2HWKA 2NVWA 3QFCA 1E8MA 4B5KA 1OW3B 4N3BA 4OPOA 3L4BC 1RPNA 1Z0UA 4UPEA 1THMA 4RDKA 3BMNA 5KTNA 4B4DA 3JALB 2WYUA 4CODB 2D1TA 4KPUB 4Q21A 3RWBA 5DNAA 4UM9D 5MFPA 3EZNA 5DNEA 3EISA 2QM0A 2PXAA 5BVHB 2GEJA 4G4GA 2YV5A 1ADBA 1J97A 4QXOA 4YGXB 3SZLA 4JBYA 4RSMA 3RO7A 3WLMA 3T5AA 4YV0A 1WXWA 3C3AA 5EZYB 3R3ZA 4URXR 2R25B 2V7XA 4N6OA 1FEZA 5CA1B 5G02A 3SSOA 4F1JA 3N59A 2IHNA 1U9IC 3II6X 4N4AA 1M6HA 1FFAA 4ENPA 4MULA 1EGHA 3LCJA 4RK5A 1RP1A 4BBZA 2XCSB 3ZYCA 3BK7A 1A8PA 5TY0A 4JU9A 2PUCA 4MV5A 1BFDA 1EGQA 1UXIA 2P9CA 1E3SA 3C3XA 3GGJA 4H6VA 5IT0A 3FPCA 1BS9A 3V2IA 1ILEA 1ESZA 2WFLA 3K9CA 3CB2A 4OLBA 1NXPA 4R1PA 3S44A 3KKPA 1XT6A 3JW8A 2KI5A 4DG5A 2G9ZA 2IDJA 2JD0A 2M6RA 5IF3A 4O4HA 1L5MA 3O8QB 1YS9A 2COEA 3DL0A 1HPLA 1ULZA 4LC1A 3ZV3A 4AAYA 1A96A 4JIMA 5EIXA 2QORA 4Z4WA 5DGIA 5DHUA 3H04A 1R4NA 3BMOB 1B43A 2VP0A 9ATCA 3SR0A 5F35A 3E7WA 4ZVPA 3WQRA 5JROA 4FNAA 1X7YB 1XMJA 2X14A 3GWZA 4IV0A 3R5FA 4YUZA 4MUYA 3U4HA 3C3PA 1V8OA 2RHLA 3TEFA 4YPVA 1HZZA 1DC4A 5FWDA 1J7JA 4V39A 1XVVA 3HN6A 3HYLA 1GFIA 1P7CA 1MU0A 3CG4A 1AS3A 1L3CA 3IS3A 3V8NA 1J0EA 3VHXB 2PO7A 2J08A 5AVOA 5F1KA 4II2A 2FSUA 5HQTA 2YWXA 5IC5A 5KYWA 1H8EA 2GWRA 2H7YA 5JUWA 3U44B 1ODFA 3EGXA 5HJEA 4ZQBA 4YCSA 2H5LA 3Q5EA 1DIRA 4PAGA 3H6GA 3MB5A 1QH0A 1WB9A 5CA0A 1GZ6A 1M1NB 4DOMA 2X53S 3HL4A 2WKSA 3RRXA 2B1QA 4A6DA 4RKEA 1W44A 2XWSA 1M34A 2V9ZA 4OMFG 3M49A 1GGHA 1JG6A 1GV1A 3AUTA 3EQ9A 4IFTA 5EP2A 3SYKA 3IA2A 2D9RA 4BLRA 1JQJC 1IC6A 2FRDA 4G0MA 4G5XA 4O0MA 5A2QA 3B7PA 2XUJA 2XA9A 3ESQA 4X1YA 4DMHA 4D25A 4R81A 3IUMA 1ZH8A 4RO0A 4F3KA 3NHUA 2Z6BD 4W9NC 5IHXA 1GRCA 1LWNA 3E1GA 2OC9A 2AEJA 3B6ZA 4JBHA 4OGLA 4UJ3A 4W7HA 5EQJB 5GONF 3WLFA 4CMJA 1XFAA 1JDBC 2XTMA 2A7QA 4OY3A 5CT8A 2NXEA 2IZ0A 2W2PA 1I1OA 4FC7A 4MKRA 5KDDA 2WINI 1MA3A 3JYQA 5T41A 4RPDA 1I0ZA 1Q83A 2BDUA 1EVJA 1VL2A 1KSFX 1JGTA 2GSDA 3NM5A 3CCUB 4NONA 4RZUA 3UYKA 2RG1A 2E4XA 2PAAA 4IJVA 1ISSA 1ONNA 4PCUA 3GBPA 3FX2A 4ZT4A 1OLUB 2CSUA 3Q72A 4GX5A 4M9RA 3L0CA 3ZWBA 5HQ3A 2RK6A 5F2NA 3KXLA 1J9EA 1Q2XA 1U98A 3R24A 4XYBA 2LZJA 4IQFA 2FPKA 4JC0A 4O5OA 2PUHA 2DHDA 3HA2A 1XMVA 3Q41A 2RH9B 1NI4A 4OQLA 2RBKA 3TLGB 3TTTA 2WQ6A 1H2ZA 3IUSA 3U60B 2Y66A 5FTWA 2OZVA 2ZZMA 1OI4A 4V0LA 3ZGVA 5IAAA 5CX1A 5FO1A 2DFKB 3LGSA 1Z4LA 3DL7A 3I92A 3M3DA 4BZWA 2Q5HA 1A98A 4QHSA 4NICA 2H0AA 4RV5A 1N5OX 4KQHA 3A70A 1U7ZA 3Q3JB 1KVRA 4PLCA 4BNUA 4PBRA 4UQOA 4CEIB 4WK4B 2C9MA 1E9FA 4HRAA 4L2IA 1Y4AE 4I5EA 5EP4A 2C3YA 2VPPA 2AN5A 2ZROA 4UXHA 3V1KA 2RI6A 1SC3A 5ALGA 2ZSBA 2OBTA 3AEYA 1RAGA 2X15A 3JTEA 1QRUA 4KQ9A 5NULA 1FUYB 1YB7A 3N8KA 1H5UA 4NBNA 4O4LB 1JA0A 1QG2A 1L8OA 2VYFA 2M1XA 2ZBQA 3KWJA 5JY1A 5KYKA 5LD2C 1KK2A 4Z4HA 3BMXA 2FZWA 3REQA 1OTXA 4F6LA 1O97D 1D07A 3SR3A 1DBVO 2Q8QA 1AHPA 4J1TA 4GWGA 5HDQA 2XQGA 1XTJA 4G8BA 4A92A 2P6PA 4KOAA 3QEMA 1WZ2A 2XHZA 2M6KA 4DXAA 1VE9A 1QKIA 2COUA 4IR7A 3WNBA 5ESWA 1GILA 2IA5A 2RI0A 4YO8A 3Q3EA 4AO7A 2RHWA 4HDKB 3K71B 3K9QO 3LH5A 3OX3A 2AW3A 2FP4A 3EA5A 1X87A 4YCBA 2OBFA 5J5CA 1FMFA 5FAXA 4AJJA 5L40A 4HIZA 1K8QA 1HGXA 4IYJA 4AKHA 4J75A 2HOQA 5ES3A 1EVKA 5BW5A 5I8WA 2RIRA 3RU2A 4KVGA 3AUYA 4W1QA 4XIJA 2ZXFA 2JGFA 2OCLA 2B2CA 3ZIAD 2G88A 4ND6A 3FAKA 3WWCA 3RFFA 1XTIA 3MA0A 1UBKS 1OXXK 2YV4A 5THXA 4YCMA 1XWWA 1GZSA 1BXRB 2GEVA 4OB6A 5H80A 4EGJA 3EHDA 4X97A 4DV0B 2AYXA 4N0PA 2V98A 5DDIP 4P26A 1GNRA 2RCNA 3CVXA 1XEAA 2QM8A 1Y5LA 3EA4A 3I01M 4CMEA 4L5AA 4N1AA 4QAQA 2DIEA 3R0VA 5J2UA 2HUPA 3PR2B 1DG9A 1OILA 2IHUA 2NZ8A 2ZRJA 2QJWA 5AICA 3DE0X 3LBYA 1DC5A 4X7BA 5DSTA 3AVTA 1PR3A 1NNEA 4EGAA 2IC5A 2FG6C 3G2PA 3JAWB 4FIZA 2F3PA 4RFVA 5AXDA 2QW0X 1V2HE 1PCXA 4A1OA 3PLAE 2BKVA 1WU7A 2GAFA 3AFNA 4L8FA 4OQDA 4RWEA 2C9BA 3QKRB 1IRXA 1UBFA 4UNSA 4UCFA 2J6CA 4JVNA 4KQEA 1K4KA 3PQ8A 1YJAA 4P86A 4Q34A 3SFTA 4C0QC 4DJFC 1QK4A 3BB3A 2I4RA 3CZMA 1SKMA 2LTAA 3I9MA 3IR5A 5E6RB 1A1VA 4M7WA 1GAEO 1USWA 4H2DA 4D4IA 4R8MA 5FFNA 5F4BA 1Z33A 1VIAA 4H7KA 3BE8A 4R8SA 4J16C 1SA0A 3LG2A 3S2FA 1N0UA 3DE5X 3VYWA 3WMFA 5I4IA 3SEQA 2QMQA 3X1KA 3N9IA 5TQ0A 3AY7A 5CVUA 2VHVA 1Z5ZA 1PHPA 3W9BA 2PSJA 1GTSA 1Y9JA 4OHUA 2B4TO 3C7KA 1PW5A 4FXOA 4J7CA 3UAOA 3QKWA 4LRXA 2H4HA 1V45E 1P4RA 2W90A 4DL9A 5B64A 1DFGA 1ZD3A 4Y2HA 3R0QA 4U2BA 1QO7A 4L78A 2GESA 2YN0A 4C7MA 4C21A 4ZHQA 4UFPA 4Z9BA 1YCDA 1V5IA 2ZE5A 5E1BA 1WCYA 4BFZA 2PUWA 3ELBA 2EG5A 3FN4A 4JLWA 4PLTA 2A67A 4UVDA 5IARA 4AZ0B 1RVDA 2WSBA 3PQ4A 4PZAA 1KK1A 2Z3VA 2RGYA 3K5IA 2QLFA 2YMLA 3UMCA 1KSHA 2KBEA 2P11A 3OZTA 5D3MA 5ECYA 3LQYA 5FPYA 3UCEA 2QU7A 3CRRA 4JJZA 1JSCA 4Z4UA 4P12A 2YUTA 2MCFA 2LDXA 2PKRA 1N5MA 2EFHB 1JFFB 1I9CA 1T9HA 2QNBA 3B53X 3DHNA 3SOPA 1N0VC 4HX5A 5A1TA 3P9QA 4RAOA 5DEIA 4Z9XA 4EUSA 3ADDA 3RTEA 3ZW7A 3MW8A 2JGKA 1DBSA 1JZQA 2QNRA 2RHOA 1WKBA 4OOXA 4NU8X 1ZMOA 2DBVO 2Q6VA 5IKXA 3PDCA 1CQJA 2OQRA 3L8ZA 1NUSA 2OK7A 4FZ3A 4G56A 4L75A 5HIIA 3HV0A 3TINA 3ZGZA 1Z07A 3WAKA 1IHOA 3TLZA 4ZEVA 4XKJA 2YJ5A 4O6VA 2Y68A 3BQJA 1P4AA 1W59A 1I4TD 2B69A 3DO5A 4G1CA 1E3QA 5IUNC 3LKZA 4GYWA 3FUXA 2C3MA 3I53A 5IWAB 2JAHA 1FTQA 1YX2A 2R8XA 4TKOB 3SEJA 2OEPA 2EFGA 1KMHB 2Y92A 2HF9A 4MICA 1PGQA 1V2GA 3CVVA 5KX5F 3M1LA 5T3YA 3T0GA 1EBBA 5K7SA 4OSOA 1WF6A 1NRXA 5T4BA 2PKQO 4QXPA 1K9VF 2PX4A 3WQZA 2JJ1D 2QTHA 4N5HX 4V3CA 4YRLA 4YRZA 3OOSA 1Z36A 3F67A 3SLRA 3WP0A 5BVGA 3ST7A 2XZDA 1PW7A 3E70C 4L73A 1PNRA 5AVYA 2KSQA 1CS0A 1GA4A 3SIWA 4LOIA 1Z5WA 3SNHA 4G9BA 3PL5A 2CDAA 4R2MA 5JSQA 1QP4A 1XZQA 3FFAA 3WRXC 4BL5A 4ZYWA 4RIFA 1NNLA 2PRZA 4CKZA 5FWXB 3KPWA 4G1MB 4XD2A 2BJHA 1TMKA 3GFSA 2I3BA 3ZUPA 5EJ9A 2X4GA 1ZAYA 5BRNA 1ODIA 1XCGB 1AMNA 3KQKA 2H31A 3KP1A 1AHHA 4ZJZA 1O89A 4GXRA 3U1BA 4KZPA 1P4MA 4YQYA 3PXUA 1TMGE 5EIOA 5ENVA 1F2TA 5JU6A 1V6SA 4D43A 3A2LA 1H2FA 4QDUA 2XNHA 1E1NA 2NQTA 3G2QA 1YBAA 2JBAA 1OCEA 4H7FA 2F59A 4ZAZA 2NVOA 2IV2X 3M0EA 3D3KA 1H42A 3RABA 3T1NA 2SICE 4E1BA 1WEHA 4IJQA 3U6KA 1CB7A 1Y6ZA 4IDAA 4LJ4A 3WX0A 5BSKA 3GJSA 3AI1A 1ILWA 5IF9A 3FETA 1UKBA 1CUEA 1R5JA 1LBEA 5DFAA 3IOCA 3PPWA 4YP7A 1N0WA 3ZE9A 1EZ1A 4D74A 2CBXA 3NNSA 3D4PA 2X40A 4XDYA 4ZTZB 5B2ZA 3BF8A 4LVNA 3SBXA 2VF2A 4QO7A 3ZHRA 5IJ9A 2G4CA 5CYOA 1L7EA 2BGTA 4HDRA 3MB8A 5AJZA 4BFYA 4BDSA 5ICGA 1GXSA 3S1AB 3TQFA 5IM5A 1PWXA 5JVDF 2JJQA 1BQEA 1BFUA 1FYFA 3LDGA 2HD4A 3GG2A 1FU7A 1HYHA 2O3TA 4UEJA 2PXHA 4MRPA 5F5NA 1PWYE 3LHSA 2Z2XA 1NX9A 3HCDA 1FY2A 3E5RA 3NH6A 3E2IA 4RMHA 2TMYA 2H0RA 1MDFA 1PUXA 3NIWA 3OF3A 3AXSA 4WTOA 4I8IA 5DH9A 2CNOA 2ZIZA 3MC1A 4G5QA 4PLVA 821PA 2H0QA 3QPCA 4LJLA 3QE9Y 4ZOAA 1KO7A 1E1LA 1RW4A 3A1SA 4Q01A 1KY2A 2BKUA 2G8NA 3LX5A 3PSAA 4EG3A 2ZBUA 2HHAA 5D51S 1ULUA 3NONA 1QAQA 5K5EA 1I4EB 1BS1A 4N3GA 3BH7A 1P3JA 2BF7A 3KKEA 5CTAA 3ZIAA 5DT2A 4FW9A 5A6SB 4A8HA 3R3VA 5DSZA 1KGSA 2X6TA 3CUVA 3HJHA 3Q3HA 4KKTA 3AR4A 2GCOB 2QF7A 3JYPA 4P3XA 1JA9A 4RC9A 4BO0A 3EIQA 2EGGA 5D7NA 1XR3A 4ZQIA 5A5EA 4W5QA 1RP7A 1Y8QB 4MS4B 5DX0A 3WOVA 4PYJA 2IH2A 1U7PA 4HZGA 2JGDA 2ZDHA 5KMGA 4QKQA 2R8PA 4DC1A 2QTZA 1KZYC 4LC0A 2AFIB 2JI8A 4TMFA 2HGZA 2QX7A 3DVLA 3A4NA 3K0KA 4RL4A 2BFNA 3JU4A 4QGAA 3RJMA 1KAOA 1CBUA 1KVTA 3OUZA 2C2GA 5AW6A 1V5FA 1EFKA 3L41A 4YRKA 2VHZA 3DOIA 3G59A 4GLLA 4ON9A 4TMZA 4TQ9A 4O3MA 1DHRA 4YFYA 5CFLA 5BUSA 3LUAA 2ZI7A 5ALTA 4BZQA 2WKRA 2HTEA 3A26A 5DTRA 4NMHA 1JTFA 2M32A 4HOYA 4M22A 1D4AA 2WLSA 4OYRA 4WA8A 3WOHA 3RBAA 3R41A 3KSMA 3HBFA 3U17A 2FMKA 4IIVA 5K3FA 2IYEA 3BH0A 4H7DA 1L5SA 2QUHA 1I2AA 1VGQA 4DB2A 3ASYA 2ZETA 1N5LA 1OWPA 3C8UA 3A8JA 5DU2A 1Z0ZA 1ORDA 5JC1A 2PR2A 3NBUA 2GNOA 3EUWA 4L1KA 3LCCA 5AD1A 1GPKA 3V8BA 4LE2A 1YRWA 4CG3A 4E6EA 1OC2A 4RAQA 3L4KA 2GJ8A 2DJIA 3LHIA 4H3KB 5I7HA 1CVIA 3GJ0A 2BHTA 2C5EA 1PNOA 4GC9A 4IJ6A 4AJIA 3L6BA 4X6UA 5JZ9A 4NCBA 2DULA 1S2MA 2W8BA 1BCSA 1NYRA 4LYGA 1A95A 2JFYA 3GFRA 4X00A 2I9KA 4QA9A 4HUQA 4DUGD 2D0PB 1J06A 5FWYA 2HR1A 1T24A 1V0EA 1XVTA 2JAOA 2MYUA 5BMOA 1QCDA 1WMDA 5HKAA 3I61A 2X6RA 4OGGA 4QDKA 1FXWA 4J2TA 4LMAA 3UMBA 3HWWA 1QFYA 4K9QA 4AKSA 4BBJA 1ZC3A 2IU3A 3VR2D 3MMPA 5EHXA 2VZEA 1RQXA 1XD2B 4OHBA 5M29A 2XNKA 3G2HA 3HCAA 4FHEA 4HFRA 1PZFA 3G8CA 3LUHA 4PR0A 4D79A 1CRPA 3LPDA 1WSBA 5IC6A 4GPTA 1SZJG 1C2YA 1XZLA 4TXMA 4EW1A 3L7OA 3NAZA 2YRWA 1P7ZA 4L8LA 2FN4A 1LVHA 4KQMA 3KOZA 4GE3A 1U9CA 1ABEA 2BMJA 3CE6A 4U2EA 1YBHA 4B6EA 1JYEA 3E3MA 4ND3A 5ISMA 1M90D 3WZLA 5HCNA 3HLTA 4YJHA 1L4BA 2A6PA 3R8CA 2E87A 1WCXA 1D1QA 2G0AA 3A4VA 4CTMA 1RWVA 2I8LA 1ZRNA 4Q03A 4RKFA 2UXBB 2O1SA 1L5RA 4EB6A 1TVEA 3PRHA 4RDLA 3NOXA 1U80A 3D43A 1FU8A 1X7GA 1LQTA 2ZBFA 4MS3A 3TAXA 2XWPA 2B99A 3V8MA 2P2CA 4D8UA 5DEOA 4BMNA 3IL2A 3EMBA 5D6NA 2ESRA 2DY1A 4EUFA 4IEEA 4DRYA 1H0SA 1RWQA 3DC2A 2PT7A 1S89A 2JJ1A 2J9XB 2YHUA 5DP1A 4DMRA 5KNBD 1BPLA 2POCA 3LRXA 5LD2B 4TROA 5LQMA 1C0LA 3RYIA 3LQ4A 1TXGA 1MH9A 1ORTA 3A9RA 3R6GA 4QOIA 5ETJA 3RU9A 4YGYA 3BKWA 1K28D 4YYEA 4CTKA 1OJ7A 3TXAA 1UD8A 1TM4E 1DJNA 1P0CA 2R8ZA 1EM8A 1XDDA 5K3DA 3WGJA 1MXHA 5LYJF 2FZ5A 4LNHA 2E37A 1JHYA 3C3DA 4FM9A 3BM5A 3TLEA 3DZ8A 1NX6A 2OGSA 3N2GA 4MUGA 4F60A 1PLKA 1P2DA 3STHA 2XA2A 4EB0A 1NVFA 2VP4A 2CEAA 4Q1VA 4DM7A 1BN7A 2AL7A 1G5TA 2TRSB 1TUIA 1A9SA 1V47A 2Q50A 3B13B 3L0PA 3KWFA 4O29A 3ITKA 4RHXA 4DDWA 5DNDA 5ITSA 3RC7A 3P96A 5K0TA 1VJ0A 2DKNA 4MUJA 1IZ8A 2OK8A 1JB1A 3LNNA 2CCGA 2FG7C 3ONUA 3O7MA 2CD9A 2Q5JA 4L5IA 3ZCVA 5CM9C 5H9VA 2YICA 1A8UA 1CY1A 3A0UA 2PRYA 2LZ0A 5JNVA 4O25A 3HDTA 1LA2A 1W9XA 1W2BB 3K0BA 3LBAA 3UWSA 2RGWA 3D3WA 3QKIA 3ZWWA 4YELA 2JATA 4FWIB 3BSFA 4NJMB 3K6SB 2ZB4A 4M89A 5FUVA 5G4KA 1LS6A 3ZKWB 1NR1A 3P9PA 5E7JA 4RJJA 3IUBA 3T54A 3M8KA 3LX8A 1HRDA 4QGFA 1ZJ5A 1BGVA 1FPQA 4S24A 4EG1A 3QBEA 4MROA 4RTQA 1B16A 1D1NA 2QGNA 2V03A 1HY3A 3ILYA 3NO4A 1UMKA 1GLGA 1EFVB 1LLQA 1V26A 1BEZA 3C5VA 1S1CA 4FPXA 4Q3KA 2RG7A 3RGGA 4C14A 1LGYA 4DADA 5U9CA 4U7FA 3ZDBA 1R4MA 4NFYA 1XKLA 1V16A 2ZANA 4ME6A 3UYLA 4B7AA 3FGNA 2HRZA 3ZX4A 2Q5FA 3QOFA 4GXQA 2QX8A 3RIHA 3EUFA 3T7RA 4CKCB 4DA6A 2BKLA 4GUAA 1XK7A 4O4IA 4V3BA 3CUUA 5CM2Z 3A4LA 1Z17A 4JENA 1Z7EA 3DOOA 4YBZA 4DQKA 4HSEA 4NBLA 4E7PA 1IM8A 1ZCBA 2UZ1A 1IMOA 3D8TA 3DMYA 1E3IA 5FNZA 1M0SA 1BXZA 3G2IA 4PICA 1WU8A 2A94A 3U1VA 2PPVA 1ZUNB 2GI4A 3KQSA 3ZV7A 1XTQA 3C6BA 3OCXA 3DKKA 3ORSA 1YDGA 2H17A 3LYHA 4XASA 3QVOA 4KXWA 3B12A 5BWCA 5E7MA 3F9RA 4OHFA 4URUR 1LNSA 4XWKA 1Q95A 2EJBA 3D59A 2PSSA 3LY9A 2WJAA 2JEYA 1MQAA 4NJOA 2YMMA 2YJ3A 2I6TA 4TV8B 4M1YA 2QG4A 2YC2C 3K5WA 4KYIB 4PVDA 3H1GA 2R1TA 3ZD8A 1S2IA 1Z83A