4ZGQB

Structure of cdc123 bound to eif2-gammadiii domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
102
Chain Sequence
b'LPNIYTDIEINYFLLRRLLGVKTDGQKQAKVRKLEPNEVLMVNIGSTATGARVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWRLIGWATIKKGTTLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division cycle protein 123
molecule tags Cell cycle
source organism Schizosaccharomyces pombe
publication title Cdc123, a Cell Cycle Regulator Needed for eIF2 Assembly, Is an ATP-Grasp Protein with Unique Features.
pubmed doi rcsb
total genus 16
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4zgqB00
2FX3A 4RD4A 2CRVA 2OK8A 3JQPA 1AIPA 3PENA 3U6BA 2BF4A 3W2FA 1S72B 1VQ6B 1TLLA 2QTLA 1KK0A 1F20A 1KC8D 2BGJA 3B78A 4PC1A 3LO8A 3CC7B 4NBSA 1GAWA 3B8HA 3VMFA 4YALA 2DETA 5DSZA 3G71B 1S0UA 4B4DA 1GAQA 1QG0A 3W2EA 1VQ7B 4FN5A 4YAOA 3E1YE 4YAWA 1YITB 4B48A 4QFMA 1M1KD 3OJWA 4K1XA 5JBQA 1VQNB 2BM1A 4TMWA 2VNHA 3QFCA 2QTZA 1EP2B 2HCJB 2XNCA 4TMVA 3CCMB 3AGQA 4RD1A 4QHYA 4Y7CA 3QSYA 1ZM2A 4U9UA 5TY0A 2QA4B 4B47A 3AVTA 2XNJA 1B23P 1YI2B 1GVHA 5H5JA 4RD0A 3WYAA 1B2RA 1H42A 4P3YA 5AN9A 2BSAA 3OW2B 3AVWA 5GV8A 3VNVA 1KK2A 3J81k 5GV7A 3QFRA 3OZWA 4H9GA 1EFCA 4ZGNB 4TMXA 1GR1A 3W5HA 1Q7YD 1VQKB 1BJKA 1R5OA 2VNJA 1U2RA 1BX0A 4M2LA 1Q82D 1VQ9B 2BN4A 1OB5A 1UMKA 1G7CA 2J7KA 2PLFA 3AVUA 3CCQB 3AVYA 1QGAA 1G7TA 3SJZA 1K9MD 2B7BA 2BPOA 3MHPA 1BX1A 1YHQB 2C78A 1JB9A 1EFUA 1WDTA 2YWEA 4IW3B 3CW2A 3OZUA 3P27A 4M1KA 4ACBA 4M0LA 1G7RA 1JA0A 4AC9A 4RD2A 3CC4B 3CCLB 4B3XA 2EIXA 4YHBA 4HE5A 1BQEA 1GJRA 1KK3A 4RD3A 1XE1A 3CCEB 1YIJB 1QFZA 4RJLA 1EFTA 3ZZUA 3CMEB 4B44A 4DQLA 1VQLB 2X3UA 1W35A 1TUIA 1DDGA 4C0SA 4YAUA 1KQSB 2QEXB 1DARA 1N0VC 2ZITA 3CCUB 3CCRB 2DCUA 1D8TA 3VO2A 4MYUA 3W2HA 1YJWB 3WNCA 4RCYA 2E1RA 4NCNA 2AHOA 1HA3A 3W5UA 1VQ4B 4LBZA 3U2QA 2VNIA 1EWYA 3WBKA 3VO1A 3I1FA 1QGZA 1QVFB 4HE6A 3CB4A 1CQXA 1G7SA 3AVXA 4LBYA 1FNMA 1W87A 1QH0A 2CNDA 2PIAA 2DY1A 1OB2A 5TV2A 1FRQA 4G5GA 2YWGA 2B7CA 4Q7JB 2RC5A 3W5VA 4G1VA 3CCVB 3ZBTA 4LBWA 5THXA 3I55B 2B5OA 4PGOA 1ZM9A 4PC2A 3OJXA 1N0UA 2RC6A 3WXMA 2OK7A 4C43A 3CCJB 1KJZA 1JA1A 1NJID 2R6HA 2D74A 3WY9A 2OTJB 3W2GA 2HMAA 3G6EB 3W2IA 1KK1A 4M4SA 3ZZTA 5HXBA 1TVCA 1W34A 4F7DA 1FDRA 2C77A 1GO2A 1DDIA 4TMZA 1IJFA 3JQRA 3CXCB 3QE2A 4ZV4A 1SM4A 1CNFA 3FJOA 3U6KA 1ZM4A 1FNBA 4TMTA 1Q81D 3JQQA 3CCSB 4RCZA 4ZCLA 1K73D 1IJEA 5H59A 1EXMA 4PC7A 1QFJA 1QUFA 5EMNA 1JNYA 1ZM3A 1A8PA 3QFSA 4RD6A 5KSWB 4LC0A 3MMPA 2DEUA 1VQ5B 1XB2A 1ELOA 3ES9A 1OGJA 2DERA 4EH1A 1OGIA 2NPFA 3LVBA 3CC2B 1M90D 3E20A 3WBJA 1VQ8B 1R5NA 2BVNA 1SKQA 4ZCIA 4N3GA 1EP3B 4G1BA 3CMAB 3MCAA 3AVVA 1Q86D 1NDHA 1JJ2B 4LBVA 3VNUA 4ACAA 2VYQA 1E63A 1H85A 1VQMB 1CNEA 4PC6A 4TN1A 4AF7A 3CRZA 3V76A 4PC3A 2VZLA 3ZZ0A 4ZGQB 3I56B 1VQOB 1TTTA 1FRNA 1QX4A 1YJ9B 4J0QA 1E64A 1AMOA 1D1NA 3WNBA 1J9ZA 2QN6A 1R5BA 5FA6A 1IB0A 1VQPB 3B82A 1W2BB 4WQMA 3G4SB 1KRHA 4M53A 2BV3A 1FNDA 4N3NA 3CD6B 5TR9A 1KTVA 1YJNB 4MYTA 1EP1B 1I7PA 1DG1G 1D2EA 2YWHA 1F60A 2GPJA 3AGPA 4Y9RA 2EFGA 2QDXA 1N8RD 4DQKA 3QFTA 4ZCMA 1QFYA 4B43A 2VNKA 4FWTA 3FPKA 4UAJA 1QVGB 2BGIA 1FNCA 2GQFA 2QMUA 3ZBUA 1K8AD 2HDNB 3ZC3A 2BMWA 2OTLB 2YWFA 4R71A 1QGYA 4AF6A 3OZVA 2PMDA 2XEXA 1QUEA 4P6VF 1E62A 4BPRA 3CPWB 3P26A 4YAFA 3WNDA 1KD1D 4FK8A 1ZUNB 2BM0A 4Y9UA
chains in the Genus database with same CATH superfamily
2FX3A 1PJ7A 2JN9A 4RD4A 4OPSA 2CRVA 2OK8A 3JQPA 1AIPA 3PENA 2VJJA 3U6BA 4XM3A 2BF4A 3W2FA 3WQZA 1S72B 1VQ6B 1TLLA 2X6XA 3D26A 3PA1A 2QTLA 1KK0A 3BQJA 1F20A 4X7FA 1KC8D 2BGJA 2DIEA 3FKSA 3B78A 4PC1A 5IYNA 3LO8A 5FIUA 4RPDA 2W6IA 3CC7B 2V7WA 4NBSA 1GAWA 3B8HA 3VMFA 5F4MA 2X85A 4YALA 2DETA 2ZL5A 2ZTNA 2V31A 1Q9SA 2CC2A 3LQEA 4QVJA 5DSZA 3RY8A 3V7AA 3G71B 3CESA 1S0UA 2E1BA 4P22A 4B4DA 1GAQA 5TRDA 1UD2A 2WJVA 1QG0A 3A3GA 3R6KA 4X05A 3W2EA 2GREA 5DN6A 1HVXA 3G05A 1VQ7B 4FN5A 5HZAA 4YAOA 3HAGA 3E1YE 4WZEA 2WZPP 1I8DA 4TT3A 4B3GA 4YAWA 4E0FA 4NNJA 1YITB 5IYRA 4B48A 3BNWA 4QFMA 1M1KD 3OJWA 1E1RA 2OYNA 4K1XA 5IYQA 5JBQA 2BM1A 1VQNB 4TMWA 2VNHA 3QFCA 2QTZA 2WZNA 3SLDA 2WR8A 2D3NA 1EP2B 2C4TA 2HCJB 2XNCA 4TMVA 4UZEA 3CCMB 5L46A 3CMMA 3AGQA 4RD1A 2ZL6A 4QHYA 4XN0A 1ZM2A 4U9UA 4Y7CA 5TY0A 3T51B 2OBRA 4B47A 2QA4B 3QSYA 2XNJA 3AVTA 1B23P 3FPPA 1YI2B 2F43A 1GVHA 5H5JA 4RD0A 1UD4A 3WYAA 1WPCA 3T56B 3JU4A 1B2RA 3SLNA 1OHHA 1H42A 4P3YA 5AN9A 2BSAA 3OW2B 1V5VA 2ZZQA 2Q6OA 1OB0A 4WWVA 5J3OA 3AVWA 1E79A 5GV8A 4P25A 5B6IA 3VNVA 1KK2A 4G7WA 1Y0RA 4QVAA 5GV7A 5IYPA 3J81k 4L8JA 3QFRA 5LMZA 2NV4A 3OZWA 4OOVA 2OBSA 2KVOA 4H9GA 1EFCA 1VLYA 4ZGNB 4TMXA 1GR1A 3W5HA 1Q7YD 3LQ6A 1VQKB 1BJKA 1R5OA 2VNJA 1U2RA 1IHMA 1BX0A 3ASRA 2R9VA 4G6IA 4M2LA 1UD3A 1P4MA 1Q82D 4XQFA 1VQ9B 2QGGA 4Z4UA 4PABA 4XD7A 2BN4A 1OB5A 1UMKA 2LZJA 4X7DA 1G7CA 2J7KA 2PLFA 4XR6A 1NB9A 3AVUA 1NBMA 3CCQB 3AVYA 1QGAA 1G7TA 1VHOA 3SJZA 1K9MD 2B7BA 1YLOA 2BPOA 3GVKA 2F4NA 3MHPA 1BX1A 1YHQB 5HKKA 2C5HA 2C78A 3ONUA 2ZBVA 2JJ1A 1JB9A 1EFUA 3OFNA 1WSRA 4XMYA 2GJRA 3OE7A 1WDTA 2X53S 2ZZEA 2YWEA 4IW3B 3CW2A 3OZUA 3OOCA 3P27A 3A8JA 4M1KA 4ACBA 4M0LA 4YEJA 4X8IA 1E3XA 1G7RA 1JA0A 2X0KA 4AC9A 4RD2A 4XLFA 3BCFA 3CCLB 4B3XA 4UZFA 3CC4B 4Z4YA 1VHEA 2EIXA 4YHBA 3OP1A 2XGJA 2GJPA 2V7TA 1BQEA 2WJYA 4HE5A 4Z4VA 1GJRA 1KK3A 4RD3A 1V0FA 1XE1A 3CCEB 1YIJB 2I1LA 1QFZA 1KMHA 2D9RA 4RJLA 1VJSA 1EFTA 3ZZUA 3T53B 4TKOB 3CMEB 2OBTA 1WORA 3PVDA 1UD6A 5IYWA 4WZLA 4X0CA 4II3A 4B44A 4DQLA 2JJ2A 2WYRA 1EFRA 1WU8A 1VQLB 4X06A 2X3UA 5J35A 2XOKA 3OPOA 1E43A 1W35A 2F1LA 2F1MA 1N06A 1TUIA 4PAAA 2V7XA 1DDGA 3BC9A 1E1QA 2Q6IA 4C0SA 4YAUA 1KQSB 3R6JA 2CW5A 1RQPA 2QEXB 4XONA 1DARA 1N0VC 2ZITA 3CCUB 3ZUGA 4AVZA 5IK2A 3CCRB 2DCUA 5FL7A 1D8TA 1FX0A 3VO2A 4MYUA 2V7UA 3W2HA 2QE7A 1YJWB 2M5SA 3PUNA 3WNCA 4FXUA 4RCYA 2E1RA 2X6WA 4NCNA 2AHOA 1HA3A 3W5UA 2VJIA 1VQ4B 2V4DA 4LBZA 3SKBA 3U2QA 2VNIA 2HLDA 1T6ZA 4P9SA 2VBUA 1EWYA 5FNZA 3WBKA 3A35A 3VO1A 3I1FA 3PUMA 4OPVA 3ASSA 4XKWA 1QGZA 1QVFB 5CDFA 4HE6A 3CB4A 1CQXA 2P3MA 1G7SA 3AVXA 4KKUA 4LBYA 4HIZA 1FNMA 1W87A 4XNFA 1QH0A 2CNDA 2PIAA 2Z6BD 4RDKA 3ASPA 2DY1A 1OB2A 3ISXA 3ASTA 1N07A 1W9XA 1N08A 4DK0A 1UD5A 4II2A 5TV2A 3BY1A 1FRQA 4G5GA 2CK3A 3SEJA 3OEHA 4OP7A 5A88A 2YWGA 2B7CA 4Q7JB 4RDLA 3Q38A 2RC5A 3W5VA 1Y0YA 4G1VA 3CCVB 3OW7A 4ASUA 3ZPNA 2CBXA 3ZBTA 1I18A 4GQNA 4LBWA 5THXA 2B5OA 4DNTB 3I55B 4PGOA 3A8IA 4X7CA 1ZM9A 2VBSA 3BCDA 4P6YA 4PC2A 2X6YA 3OJXA 1N0UA 5KNLA 1E3ZA 5A89A 1YX2A 2RC6A 3WXMA 1H8EA 2OK7A 2ZZGA 2C2WA 4C43A 3CCJB 1BPLA 1KJZA 1WTHD 2XNDA 2W6JA 4XN3A 5F4OA 3OEEA 1JA1A 1NJID 2R6HA 4Z4SA 2D74A 1XQBA 2GK6A 3WY9A 2OTJB 3W2GA 2HMAA 3G6EB 3W2IA 2D3LA 2V7VA 1SKYB 1NRKA 4YELA 1KK1A 3DDYA 3OAAA 4M4SA 3ZZTA 5HXBA 3BH4A 4Z4ZA 1TVCA 1NB0A 1W34A 3PA2A 1KZLA 4P26A 4F7DA 1FDRA 2C77A 1GO2A 1DDIA 3GSIA 4TMZA 5DS0A 1IJFA 3JQRA 2FVGA 3QE2A 3CXCB 1S4MA 4XOTA 1SM4A 4ZV4A 3KL9A 1CNFA 3H94A 1PJ6A 3FJOA 1ZM4A 1FNBA 3U6KA 4TMTA 1Q81D 3CP8A 3JQQA 1T6XA 3KEWA 3CPXA 4P12A 4QUZA 3CCSB 3CTAA 4RCZA 4ZCLA 1K73D 3CP2A 1BLIA 4WZTA 1IJEA 2GK7A 1EXMA 5H59A 4OOXA 4PC7A 1QFJA 1QUFA 5EMNA 1JNYA 1ZM3A 4DK1A 1A8PA 4XKVA 3QFSA 4RD6A 5KSWB 4RM0A 4LC0A 3MMPA 3Q6QA 1VQ5B 1XB2A 2DEUA 3ZIAA 1ELOA 2VBTA 3ES9A 3GQBA 1OGJA 4ROXA 3Q39A 2DERA 4DNRB 4EH1A 1OGIA 1WSVA 2NPFA 3LVBA 2XZPA 3ASQA 4UZUA 3CC2B 1MRZA 1M90D 3E20A 3WBJA 2JDIA 1VQ8B 1R5NA 2ZL7A 3SJPA 2BVNA 3GVLA 1SKQA 1WOOA 1MABA 3A8KA 1W0KA 4N3GA 4ZCIA 4OPOA 1EP3B 4G1BA 3OKXA 4TSFA 1T6YA 1V0EA 3CMAB 3MCAA 3AVVA 1Q86D 1VF7A 1NDHA 1HZEA 4LBVA 1JJ2B 2XZOA 3VNUA 2VBVA 4ACAA 4XLHA 2C4UA 2VYQA 4P3IA 1RQRA 2JIZA 4XLAA 3H9NA 1E63A 1H85A 1VQMB 1CNEA 2ZZFA 2ZBUA 5FO1A 4JMQA 4PC6A 4TN1A 4RDJA 4AF7A 5KW9A 4XOPA 4Z4RA 2WPDA 3CRZA 4G7XA 4PC3A 2PE3A 2VZLA 3V76A 3ZZ0A 4ZGQB 3NE5B 1UD8A 4WZKA 3I56B 1VQOB 2CF4A 4Z1MA 5BSXA 3GIRA 1WOSA 4QV2A 1TTTA 1FRNA 1QX4A 3LNNA 1YJ9B 1PKVA 4J0QA 1E64A 1AMOA 1D1NA 3WNBA 4KKSA 2C5BA 2DOGA 1J9ZA 2QN6A 1R5BA 5FA6A 1IB0A 1VQPB 1WOPA 3B82A 1W2BB 4WQMA 2XZLA 3G4SB 1KRHA 4M53A 2BV3A 1FNDA 4N3NA 4XLCA 3CD6B 1H8HA 5TR9A 1KTVA 2ZXIA 1YJNB 4MYTA 1EP1B 1I7PA 4RPBA 1DG1G 1D2EA 2YWHA 2Q6KA 1F60A 5FO0A 2GPJA 2DYIA 3AGPA 1W0JA 4Y9RA 1N05A 2V7QA 2X8KA 2ZXHA 1XFOA 2EFGA 2QDXA 3Q6RA 4YXWA 1N8RD 5F4JA 1VLOA 4DQKA 3QFTA 3VR6A 4B3FX 4ZCMA 3ONYA 3Q3AA 4XLEA 1QFYA 4KKTA 4B43A 2VNKA 3BY2A 5A8AA 1COWA 4FWTA 3FPKA 4UAJA 1WP6A 5BSYA 1QVGB 2BGIA 1FNCA 2GQFA 1BMFA 4P1VA 2QMUA 3GVJA 4XL9A 3ZBUA 4Z4WA 1K8AD 2HDNB 2GJKA 3ZC3A 2BMWA 4P2NA 1PJ5A 2Q6LA 2OTLB 2YWFA 4XORA 4R71A 1QGYA 4AF6A 3OZVA 2ZTGA 5E6TA 4CQJA 2PMDA 2XEXA 3A3BA 4X7EA 1K28D 1T5EA 1QUEA 2WSSA 4RLZA 4P6VF 1E62A 4BPRA 3CPWB 3P26A 4YAFA 4X07A 4OOSA 3WNDA 1KD1D 4FK8A 1ZUNB 5HZBA 4Z4TA 2BM0A 3A1PA 4Y9UA
chains in the Genus database with same CATH topology
2FX3A 4RD4A 2CRVA 2OK8A 3JQPA 1AIPA 3PENA 3U6BA 2BF4A 3W2FA 1S72B 1VQ6B 1TLLA 2QTLA 1KK0A 1F20A 1KC8D 2BGJA 3B78A 4PC1A 3LO8A 3CC7B 4NBSA 1GAWA 3B8HA 3VMFA 4YALA 2DETA 5DSZA 3G71B 1S0UA 4B4DA 1GAQA 1QG0A 3W2EA 1VQ7B 4FN5A 4YAOA 3E1YE 4YAWA 1YITB 4B48A 4QFMA 1M1KD 3OJWA 4K1XA 5JBQA 1VQNB 2BM1A 4TMWA 2VNHA 3QFCA 2QTZA 1EP2B 2HCJB 2XNCA 4TMVA 3CCMB 3AGQA 4RD1A 4QHYA 4Y7CA 3QSYA 1ZM2A 4U9UA 5TY0A 2QA4B 4B47A 3AVTA 2XNJA 1B23P 1YI2B 1GVHA 5H5JA 4RD0A 3WYAA 1B2RA 1H42A 4P3YA 5AN9A 2BSAA 3OW2B 3AVWA 5GV8A 3VNVA 1KK2A 3J81k 5GV7A 3QFRA 3OZWA 4H9GA 1EFCA 4ZGNB 4TMXA 1GR1A 3W5HA 1Q7YD 1VQKB 1BJKA 1R5OA 2VNJA 1U2RA 1BX0A 4M2LA 1Q82D 1VQ9B 2BN4A 1OB5A 1UMKA 1G7CA 2J7KA 2PLFA 3AVUA 3CCQB 3AVYA 1QGAA 1G7TA 3SJZA 1K9MD 2B7BA 2BPOA 3MHPA 1BX1A 1YHQB 2C78A 1JB9A 1EFUA 1WDTA 2YWEA 4IW3B 3CW2A 3OZUA 3P27A 4M1KA 4ACBA 4M0LA 1G7RA 1JA0A 4AC9A 4RD2A 3CC4B 3CCLB 4B3XA 2EIXA 4YHBA 4HE5A 1BQEA 1GJRA 1KK3A 4RD3A 1XE1A 3CCEB 1YIJB 1QFZA 4RJLA 1EFTA 3ZZUA 3CMEB 4B44A 4DQLA 1VQLB 2X3UA 1W35A 1TUIA 1DDGA 4C0SA 4YAUA 1KQSB 2QEXB 1DARA 1N0VC 2ZITA 3CCUB 3CCRB 2DCUA 1D8TA 3VO2A 4MYUA 3W2HA 1YJWB 3WNCA 4RCYA 2E1RA 4NCNA 2AHOA 1HA3A 3W5UA 1VQ4B 4LBZA 3U2QA 2VNIA 1EWYA 3WBKA 3VO1A 3I1FA 1QGZA 1QVFB 4HE6A 3CB4A 1CQXA 1G7SA 3AVXA 4LBYA 1FNMA 1W87A 1QH0A 2CNDA 2PIAA 2DY1A 1OB2A 5TV2A 1FRQA 4G5GA 2YWGA 2B7CA 4Q7JB 2RC5A 3W5VA 4G1VA 3CCVB 3ZBTA 4LBWA 5THXA 3I55B 2B5OA 4PGOA 1ZM9A 4PC2A 3OJXA 1N0UA 2RC6A 3WXMA 2OK7A 4C43A 3CCJB 1KJZA 1JA1A 1NJID 2R6HA 2D74A 3WY9A 2OTJB 3W2GA 2HMAA 3G6EB 3W2IA 1KK1A 4M4SA 3ZZTA 5HXBA 1TVCA 1W34A 4F7DA 1FDRA 2C77A 1GO2A 1DDIA 4TMZA 1IJFA 3JQRA 3CXCB 3QE2A 4ZV4A 1SM4A 1CNFA 3FJOA 3U6KA 1ZM4A 1FNBA 4TMTA 1Q81D 3JQQA 3CCSB 4RCZA 4ZCLA 1K73D 1IJEA 5H59A 1EXMA 4PC7A 1QFJA 1QUFA 5EMNA 1JNYA 1ZM3A 1A8PA 3QFSA 4RD6A 5KSWB 4LC0A 3MMPA 2DEUA 1VQ5B 1XB2A 1ELOA 3ES9A 1OGJA 2DERA 4EH1A 1OGIA 2NPFA 3LVBA 3CC2B 1M90D 3E20A 3WBJA 1VQ8B 1R5NA 2BVNA 1SKQA 4ZCIA 4N3GA 1EP3B 4G1BA 3CMAB 3MCAA 3AVVA 1Q86D 1NDHA 1JJ2B 4LBVA 3VNUA 4ACAA 2VYQA 1E63A 1H85A 1VQMB 1CNEA 4PC6A 4TN1A 4AF7A 3CRZA 3V76A 4PC3A 2VZLA 3ZZ0A 4ZGQB 3I56B 1VQOB 1TTTA 1FRNA 1QX4A 1YJ9B 4J0QA 1E64A 1AMOA 1D1NA 3WNBA 1J9ZA 2QN6A 1R5BA 5FA6A 1IB0A 1VQPB 3B82A 1W2BB 4WQMA 3G4SB 1KRHA 4M53A 2BV3A 1FNDA 4N3NA 3CD6B 5TR9A 1KTVA 1YJNB 4MYTA 1EP1B 1I7PA 1DG1G 1D2EA 2YWHA 1F60A 2GPJA 3AGPA 4Y9RA 2EFGA 2QDXA 1N8RD 4DQKA 3QFTA 4ZCMA 1QFYA 4B43A 2VNKA 4FWTA 3FPKA 4UAJA 1QVGB 2BGIA 1FNCA 2GQFA 2QMUA 3ZBUA 1K8AD 2HDNB 3ZC3A 2BMWA 2OTLB 2YWFA 4R71A 1QGYA 4AF6A 3OZVA 2PMDA 2XEXA 1QUEA 4P6VF 1E62A 4BPRA 3CPWB 3P26A 4YAFA 3WNDA 1KD1D 4FK8A 1ZUNB 2BM0A 4Y9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FX3 A;  4RD4 A;  2CRV A;  2OK8 A;  3JQP A;  1AIP A;  3PEN A;  3U6B A;  2BF4 A;  3W2F A;  1S72 B;  1VQ6 B;  1TLL A;  2QTL A;  1KK0 A;  1F20 A;  1KC8 D;  2BGJ A;  3B78 A;  4PC1 A;  3LO8 A;  3CC7 B;  4NBS A;  1GAW A;  3B8H A;  3VMF A;  4YAL A;  2DET A;  5DSZ A;  3G71 B;  1S0U A;  4B4D A;  1GAQ A;  1QG0 A;  3W2E A;  1VQ7 B;  4FN5 A;  4YAO A;  3E1Y E;  4YAW A;  1YIT B;  4B48 A;  4QFM A;  1M1K D;  3OJW A;  4K1X A;  5JBQ A;  1VQN B;  2BM1 A;  4TMW A;  2VNH A;  3QFC A;  2QTZ A;  1EP2 B;  2HCJ B;  2XNC A;  4TMV A;  3CCM B;  3AGQ A;  4RD1 A;  4QHY A;  4Y7C A;  3QSY A;  1ZM2 A;  4U9U A;  5TY0 A;  2QA4 B;  4B47 A;  3AVT A;  2XNJ A;  1B23 P;  1YI2 B;  1GVH A;  5H5J A;  4RD0 A;  3WYA A;  1B2R A;  1H42 A;  4P3Y A;  5AN9 A;  2BSA A;  3OW2 B;  3AVW A;  5GV8 A;  3VNV A;  1KK2 A;  3J81 k;  5GV7 A;  3QFR A;  3OZW A;  4H9G A;  1EFC A;  4ZGN B;  4TMX A;  1GR1 A;  3W5H A;  1Q7Y D;  1VQK B;  1BJK A;  1R5O A;  2VNJ A;  1U2R A;  1BX0 A;  4M2L A;  1Q82 D;  1VQ9 B;  2BN4 A;  1OB5 A;  1UMK A;  1G7C A;  2J7K A;  2PLF A;  3AVU A;  3CCQ B;  3AVY A;  1QGA A;  1G7T A;  3SJZ A;  1K9M D;  2B7B A;  2BPO A;  3MHP A;  1BX1 A;  1YHQ B;  2C78 A;  1JB9 A;  1EFU A;  1WDT A;  2YWE A;  4IW3 B;  3CW2 A;  3OZU A;  3P27 A;  4M1K A;  4ACB A;  4M0L A;  1G7R A;  1JA0 A;  4AC9 A;  4RD2 A;  3CC4 B;  3CCL B;  4B3X A;  2EIX A;  4YHB A;  4HE5 A;  1BQE A;  1GJR A;  1KK3 A;  4RD3 A;  1XE1 A;  3CCE B;  1YIJ B;  1QFZ A;  4RJL A;  1EFT A;  3ZZU A;  3CME B;  4B44 A;  4DQL A;  1VQL B;  2X3U A;  1W35 A;  1TUI A;  1DDG A;  4C0S A;  4YAU A;  1KQS B;  2QEX B;  1DAR A;  1N0V C;  2ZIT A;  3CCU B;  3CCR B;  2DCU A;  1D8T A;  3VO2 A;  4MYU A;  3W2H A;  1YJW B;  3WNC A;  4RCY A;  2E1R A;  4NCN A;  2AHO A;  1HA3 A;  3W5U A;  1VQ4 B;  4LBZ A;  3U2Q A;  2VNI A;  1EWY A;  3WBK A;  3VO1 A;  3I1F A;  1QGZ A;  1QVF B;  4HE6 A;  3CB4 A;  1CQX A;  1G7S A;  3AVX A;  4LBY A;  1FNM A;  1W87 A;  1QH0 A;  2CND A;  2PIA A;  2DY1 A;  1OB2 A;  5TV2 A;  1FRQ A;  4G5G A;  2YWG A;  2B7C A;  4Q7J B;  2RC5 A;  3W5V A;  4G1V A;  3CCV B;  3ZBT A;  4LBW A;  5THX A;  3I55 B;  2B5O A;  4PGO A;  1ZM9 A;  4PC2 A;  3OJX A;  1N0U A;  2RC6 A;  3WXM A;  2OK7 A;  4C43 A;  3CCJ B;  1KJZ A;  1JA1 A;  1NJI D;  2R6H A;  2D74 A;  3WY9 A;  2OTJ B;  3W2G A;  2HMA A;  3G6E B;  3W2I A;  1KK1 A;  4M4S A;  3ZZT A;  5HXB A;  1TVC A;  1W34 A;  4F7D A;  1FDR A;  2C77 A;  1GO2 A;  1DDI A;  4TMZ A;  1IJF A;  3JQR A;  3CXC B;  3QE2 A;  4ZV4 A;  1SM4 A;  1CNF A;  3FJO A;  3U6K A;  1ZM4 A;  1FNB A;  4TMT A;  1Q81 D;  3JQQ A;  3CCS B;  4RCZ A;  4ZCL A;  1K73 D;  1IJE A;  5H59 A;  1EXM A;  4PC7 A;  1QFJ A;  1QUF A;  5EMN A;  1JNY A;  1ZM3 A;  1A8P A;  3QFS A;  4RD6 A;  5KSW B;  4LC0 A;  3MMP A;  2DEU A;  1VQ5 B;  1XB2 A;  1ELO A;  3ES9 A;  1OGJ A;  2DER A;  4EH1 A;  1OGI A;  2NPF A;  3LVB A;  3CC2 B;  1M90 D;  3E20 A;  3WBJ A;  1VQ8 B;  1R5N A;  2BVN A;  1SKQ A;  4ZCI A;  4N3G A;  1EP3 B;  4G1B A;  3CMA B;  3MCA A;  3AVV A;  1Q86 D;  1NDH A;  1JJ2 B;  4LBV A;  3VNU A;  4ACA A;  2VYQ A;  1E63 A;  1H85 A;  1VQM B;  1CNE A;  4PC6 A;  4TN1 A;  4AF7 A;  3CRZ A;  3V76 A;  4PC3 A;  2VZL A;  3ZZ0 A;  4ZGQ B;  3I56 B;  1VQO B;  1TTT A;  1FRN A;  1QX4 A;  1YJ9 B;  4J0Q A;  1E64 A;  1AMO A;  1D1N A;  3WNB A;  1J9Z A;  2QN6 A;  1R5B A;  5FA6 A;  1IB0 A;  1VQP B;  3B82 A;  1W2B B;  4WQM A;  3G4S B;  1KRH A;  4M53 A;  2BV3 A;  1FND A;  4N3N A;  3CD6 B;  5TR9 A;  1KTV A;  1YJN B;  4MYT A;  1EP1 B;  1I7P A;  1DG1 G;  1D2E A;  2YWH A;  1F60 A;  2GPJ A;  3AGP A;  4Y9R A;  2EFG A;  2QDX A;  1N8R D;  4DQK A;  3QFT A;  4ZCM A;  1QFY A;  4B43 A;  2VNK A;  4FWT A;  3FPK A;  4UAJ A;  1QVG B;  2BGI A;  1FNC A;  2GQF A;  2QMU A;  3ZBU A;  1K8A D;  2HDN B;  3ZC3 A;  2BMW A;  2OTL B;  2YWF A;  4R71 A;  1QGY A;  4AF6 A;  3OZV A;  2PMD A;  2XEX A;  1QUE A;  4P6V F;  1E62 A;  4BPR A;  3CPW B;  3P26 A;  4YAF A;  3WND A;  1KD1 D;  4FK8 A;  1ZUN B;  2BM0 A;  4Y9U A; 
#chains in the Genus database with same CATH topology
 2FX3 A;  1PJ7 A;  2JN9 A;  4RD4 A;  4OPS A;  2CRV A;  2OK8 A;  3JQP A;  1AIP A;  3PEN A;  2VJJ A;  3U6B A;  4XM3 A;  2BF4 A;  3W2F A;  3WQZ A;  1S72 B;  1VQ6 B;  1TLL A;  2X6X A;  3D26 A;  3PA1 A;  2QTL A;  1KK0 A;  3BQJ A;  1F20 A;  4X7F A;  1KC8 D;  2BGJ A;  2DIE A;  3FKS A;  3B78 A;  4PC1 A;  5IYN A;  3LO8 A;  5FIU A;  4RPD A;  2W6I A;  3CC7 B;  2V7W A;  4NBS A;  1GAW A;  3B8H A;  3VMF A;  5F4M A;  2X85 A;  4YAL A;  2DET A;  2ZL5 A;  2ZTN A;  2V31 A;  1Q9S A;  2CC2 A;  3LQE A;  4QVJ A;  5DSZ A;  3RY8 A;  3V7A A;  3G71 B;  3CES A;  1S0U A;  2E1B A;  4P22 A;  4B4D A;  1GAQ A;  5TRD A;  1UD2 A;  2WJV A;  1QG0 A;  3A3G A;  3R6K A;  4X05 A;  3W2E A;  2GRE A;  5DN6 A;  1HVX A;  3G05 A;  1VQ7 B;  4FN5 A;  5HZA A;  4YAO A;  3HAG A;  3E1Y E;  4WZE A;  2WZP P;  1I8D A;  4TT3 A;  4B3G A;  4YAW A;  4E0F A;  4NNJ A;  1YIT B;  5IYR A;  4B48 A;  3BNW A;  4QFM A;  1M1K D;  3OJW A;  1E1R A;  2OYN A;  4K1X A;  5IYQ A;  5JBQ A;  2BM1 A;  1VQN B;  4TMW A;  2VNH A;  3QFC A;  2QTZ A;  2WZN A;  3SLD A;  2WR8 A;  2D3N A;  1EP2 B;  2C4T A;  2HCJ B;  2XNC A;  4TMV A;  4UZE A;  3CCM B;  5L46 A;  3CMM A;  3AGQ A;  4RD1 A;  2ZL6 A;  4QHY A;  4XN0 A;  1ZM2 A;  4U9U A;  4Y7C A;  5TY0 A;  3T51 B;  2OBR A;  4B47 A;  2QA4 B;  3QSY A;  2XNJ A;  3AVT A;  1B23 P;  3FPP A;  1YI2 B;  2F43 A;  1GVH A;  5H5J A;  4RD0 A;  1UD4 A;  3WYA A;  1WPC A;  3T56 B;  3JU4 A;  1B2R A;  3SLN A;  1OHH A;  1H42 A;  4P3Y A;  5AN9 A;  2BSA A;  3OW2 B;  1V5V A;  2ZZQ A;  2Q6O A;  1OB0 A;  4WWV A;  5J3O A;  3AVW A;  1E79 A;  5GV8 A;  4P25 A;  5B6I A;  3VNV A;  1KK2 A;  4G7W A;  1Y0R A;  4QVA A;  5GV7 A;  5IYP A;  3J81 k;  4L8J A;  3QFR A;  5LMZ A;  2NV4 A;  3OZW A;  4OOV A;  2OBS A;  2KVO A;  4H9G A;  1EFC A;  1VLY A;  4ZGN B;  4TMX A;  1GR1 A;  3W5H A;  1Q7Y D;  3LQ6 A;  1VQK B;  1BJK A;  1R5O A;  2VNJ A;  1U2R A;  1IHM A;  1BX0 A;  3ASR A;  2R9V A;  4G6I A;  4M2L A;  1UD3 A;  1P4M A;  1Q82 D;  4XQF A;  1VQ9 B;  2QGG A;  4Z4U A;  4PAB A;  4XD7 A;  2BN4 A;  1OB5 A;  1UMK A;  2LZJ A;  4X7D A;  1G7C A;  2J7K A;  2PLF A;  4XR6 A;  1NB9 A;  3AVU A;  1NBM A;  3CCQ B;  3AVY A;  1QGA A;  1G7T A;  1VHO A;  3SJZ A;  1K9M D;  2B7B A;  1YLO A;  2BPO A;  3GVK A;  2F4N A;  3MHP A;  1BX1 A;  1YHQ B;  5HKK A;  2C5H A;  2C78 A;  3ONU A;  2ZBV A;  2JJ1 A;  1JB9 A;  1EFU A;  3OFN A;  1WSR A;  4XMY A;  2GJR A;  3OE7 A;  1WDT A;  2X53 S;  2ZZE A;  2YWE A;  4IW3 B;  3CW2 A;  3OZU A;  3OOC A;  3P27 A;  3A8J A;  4M1K A;  4ACB A;  4M0L A;  4YEJ A;  4X8I A;  1E3X A;  1G7R A;  1JA0 A;  2X0K A;  4AC9 A;  4RD2 A;  4XLF A;  3BCF A;  3CCL B;  4B3X A;  4UZF A;  3CC4 B;  4Z4Y A;  1VHE A;  2EIX A;  4YHB A;  3OP1 A;  2XGJ A;  2GJP A;  2V7T A;  1BQE A;  2WJY A;  4HE5 A;  4Z4V A;  1GJR A;  1KK3 A;  4RD3 A;  1V0F A;  1XE1 A;  3CCE B;  1YIJ B;  2I1L A;  1QFZ A;  1KMH A;  2D9R A;  4RJL A;  1VJS A;  1EFT A;  3ZZU A;  3T53 B;  4TKO B;  3CME B;  2OBT A;  1WOR A;  3PVD A;  1UD6 A;  5IYW A;  4WZL A;  4X0C A;  4II3 A;  4B44 A;  4DQL A;  2JJ2 A;  2WYR A;  1EFR A;  1WU8 A;  1VQL B;  4X06 A;  2X3U A;  5J35 A;  2XOK A;  3OPO A;  1E43 A;  1W35 A;  2F1L A;  2F1M A;  1N06 A;  1TUI A;  4PAA A;  2V7X A;  1DDG A;  3BC9 A;  1E1Q A;  2Q6I A;  4C0S A;  4YAU A;  1KQS B;  3R6J A;  2CW5 A;  1RQP A;  2QEX B;  4XON A;  1DAR A;  1N0V C;  2ZIT A;  3CCU B;  3ZUG A;  4AVZ A;  5IK2 A;  3CCR B;  2DCU A;  5FL7 A;  1D8T A;  1FX0 A;  3VO2 A;  4MYU A;  2V7U A;  3W2H A;  2QE7 A;  1YJW B;  2M5S A;  3PUN A;  3WNC A;  4FXU A;  4RCY A;  2E1R A;  2X6W A;  4NCN A;  2AHO A;  1HA3 A;  3W5U A;  2VJI A;  1VQ4 B;  2V4D A;  4LBZ A;  3SKB A;  3U2Q A;  2VNI A;  2HLD A;  1T6Z A;  4P9S A;  2VBU A;  1EWY A;  5FNZ A;  3WBK A;  3A35 A;  3VO1 A;  3I1F A;  3PUM A;  4OPV A;  3ASS A;  4XKW A;  1QGZ A;  1QVF B;  5CDF A;  4HE6 A;  3CB4 A;  1CQX A;  2P3M A;  1G7S A;  3AVX A;  4KKU A;  4LBY A;  4HIZ A;  1FNM A;  1W87 A;  4XNF A;  1QH0 A;  2CND A;  2PIA A;  2Z6B D;  4RDK A;  3ASP A;  2DY1 A;  1OB2 A;  3ISX A;  3AST A;  1N07 A;  1W9X A;  1N08 A;  4DK0 A;  1UD5 A;  4II2 A;  5TV2 A;  3BY1 A;  1FRQ A;  4G5G A;  2CK3 A;  3SEJ A;  3OEH A;  4OP7 A;  5A88 A;  2YWG A;  2B7C A;  4Q7J B;  4RDL A;  3Q38 A;  2RC5 A;  3W5V A;  1Y0Y A;  4G1V A;  3CCV B;  3OW7 A;  4ASU A;  3ZPN A;  2CBX A;  3ZBT A;  1I18 A;  4GQN A;  4LBW A;  5THX A;  2B5O A;  4DNT B;  3I55 B;  4PGO A;  3A8I A;  4X7C A;  1ZM9 A;  2VBS A;  3BCD A;  4P6Y A;  4PC2 A;  2X6Y A;  3OJX A;  1N0U A;  5KNL A;  1E3Z A;  5A89 A;  1YX2 A;  2RC6 A;  3WXM A;  1H8E A;  2OK7 A;  2ZZG A;  2C2W A;  4C43 A;  3CCJ B;  1BPL A;  1KJZ A;  1WTH D;  2XND A;  2W6J A;  4XN3 A;  5F4O A;  3OEE A;  1JA1 A;  1NJI D;  2R6H A;  4Z4S A;  2D74 A;  1XQB A;  2GK6 A;  3WY9 A;  2OTJ B;  3W2G A;  2HMA A;  3G6E B;  3W2I A;  2D3L A;  2V7V A;  1SKY B;  1NRK A;  4YEL A;  1KK1 A;  3DDY A;  3OAA A;  4M4S A;  3ZZT A;  5HXB A;  3BH4 A;  4Z4Z A;  1TVC A;  1NB0 A;  1W34 A;  3PA2 A;  1KZL A;  4P26 A;  4F7D A;  1FDR A;  2C77 A;  1GO2 A;  1DDI A;  3GSI A;  4TMZ A;  5DS0 A;  1IJF A;  3JQR A;  2FVG A;  3QE2 A;  3CXC B;  1S4M A;  4XOT A;  1SM4 A;  4ZV4 A;  3KL9 A;  1CNF A;  3H94 A;  1PJ6 A;  3FJO A;  1ZM4 A;  1FNB A;  3U6K A;  4TMT A;  1Q81 D;  3CP8 A;  3JQQ A;  1T6X A;  3KEW A;  3CPX A;  4P12 A;  4QUZ A;  3CCS B;  3CTA A;  4RCZ A;  4ZCL A;  1K73 D;  3CP2 A;  1BLI A;  4WZT A;  1IJE A;  2GK7 A;  1EXM A;  5H59 A;  4OOX A;  4PC7 A;  1QFJ A;  1QUF A;  5EMN A;  1JNY A;  1ZM3 A;  4DK1 A;  1A8P A;  4XKV A;  3QFS A;  4RD6 A;  5KSW B;  4RM0 A;  4LC0 A;  3MMP A;  3Q6Q A;  1VQ5 B;  1XB2 A;  2DEU A;  3ZIA A;  1ELO A;  2VBT A;  3ES9 A;  3GQB A;  1OGJ A;  4ROX A;  3Q39 A;  2DER A;  4DNR B;  4EH1 A;  1OGI A;  1WSV A;  2NPF A;  3LVB A;  2XZP A;  3ASQ A;  4UZU A;  3CC2 B;  1MRZ A;  1M90 D;  3E20 A;  3WBJ A;  2JDI A;  1VQ8 B;  1R5N A;  2ZL7 A;  3SJP A;  2BVN A;  3GVL A;  1SKQ A;  1WOO A;  1MAB A;  3A8K A;  1W0K A;  4N3G A;  4ZCI A;  4OPO A;  1EP3 B;  4G1B A;  3OKX A;  4TSF A;  1T6Y A;  1V0E A;  3CMA B;  3MCA A;  3AVV A;  1Q86 D;  1VF7 A;  1NDH A;  1HZE A;  4LBV A;  1JJ2 B;  2XZO A;  3VNU A;  2VBV A;  4ACA A;  4XLH A;  2C4U A;  2VYQ A;  4P3I A;  1RQR A;  2JIZ A;  4XLA A;  3H9N A;  1E63 A;  1H85 A;  1VQM B;  1CNE A;  2ZZF A;  2ZBU A;  5FO1 A;  4JMQ A;  4PC6 A;  4TN1 A;  4RDJ A;  4AF7 A;  5KW9 A;  4XOP A;  4Z4R A;  2WPD A;  3CRZ A;  4G7X A;  4PC3 A;  2PE3 A;  2VZL A;  3V76 A;  3ZZ0 A;  4ZGQ B;  3NE5 B;  1UD8 A;  4WZK A;  3I56 B;  1VQO B;  2CF4 A;  4Z1M A;  5BSX A;  3GIR A;  1WOS A;  4QV2 A;  1TTT A;  1FRN A;  1QX4 A;  3LNN A;  1YJ9 B;  1PKV A;  4J0Q A;  1E64 A;  1AMO A;  1D1N A;  3WNB A;  4KKS A;  2C5B A;  2DOG A;  1J9Z A;  2QN6 A;  1R5B A;  5FA6 A;  1IB0 A;  1VQP B;  1WOP A;  3B82 A;  1W2B B;  4WQM A;  2XZL A;  3G4S B;  1KRH A;  4M53 A;  2BV3 A;  1FND A;  4N3N A;  4XLC A;  3CD6 B;  1H8H A;  5TR9 A;  1KTV A;  2ZXI A;  1YJN B;  4MYT A;  1EP1 B;  1I7P A;  4RPB A;  1DG1 G;  1D2E A;  2YWH A;  2Q6K A;  1F60 A;  5FO0 A;  2GPJ A;  2DYI A;  3AGP A;  1W0J A;  4Y9R A;  1N05 A;  2V7Q A;  2X8K A;  2ZXH A;  1XFO A;  2EFG A;  2QDX A;  3Q6R A;  4YXW A;  1N8R D;  5F4J A;  1VLO A;  4DQK A;  3QFT A;  3VR6 A;  4B3F X;  4ZCM A;  3ONY A;  3Q3A A;  4XLE A;  1QFY A;  4KKT A;  4B43 A;  2VNK A;  3BY2 A;  5A8A A;  1COW A;  4FWT A;  3FPK A;  4UAJ A;  1WP6 A;  5BSY A;  1QVG B;  2BGI A;  1FNC A;  2GQF A;  1BMF A;  4P1V A;  2QMU A;  3GVJ A;  4XL9 A;  3ZBU A;  4Z4W A;  1K8A D;  2HDN B;  2GJK A;  3ZC3 A;  2BMW A;  4P2N A;  1PJ5 A;  2Q6L A;  2OTL B;  2YWF A;  4XOR A;  4R71 A;  1QGY A;  4AF6 A;  3OZV A;  2ZTG A;  5E6T A;  4CQJ A;  2PMD A;  2XEX A;  3A3B A;  4X7E A;  1K28 D;  1T5E A;  1QUE A;  2WSS A;  4RLZ A;  4P6V F;  1E62 A;  4BPR A;  3CPW B;  3P26 A;  4YAF A;  4X07 A;  4OOS A;  3WND A;  1KD1 D;  4FK8 A;  1ZUN B;  5HZB A;  4Z4T A;  2BM0 A;  3A1P A;  4Y9U A; 
#chains in the Genus database with same CATH homology
 2FX3 A;  4RD4 A;  2CRV A;  2OK8 A;  3JQP A;  1AIP A;  3PEN A;  3U6B A;  2BF4 A;  3W2F A;  1S72 B;  1VQ6 B;  1TLL A;  2QTL A;  1KK0 A;  1F20 A;  1KC8 D;  2BGJ A;  3B78 A;  4PC1 A;  3LO8 A;  3CC7 B;  4NBS A;  1GAW A;  3B8H A;  3VMF A;  4YAL A;  2DET A;  5DSZ A;  3G71 B;  1S0U A;  4B4D A;  1GAQ A;  1QG0 A;  3W2E A;  1VQ7 B;  4FN5 A;  4YAO A;  3E1Y E;  4YAW A;  1YIT B;  4B48 A;  4QFM A;  1M1K D;  3OJW A;  4K1X A;  5JBQ A;  1VQN B;  2BM1 A;  4TMW A;  2VNH A;  3QFC A;  2QTZ A;  1EP2 B;  2HCJ B;  2XNC A;  4TMV A;  3CCM B;  3AGQ A;  4RD1 A;  4QHY A;  4Y7C A;  3QSY A;  1ZM2 A;  4U9U A;  5TY0 A;  2QA4 B;  4B47 A;  3AVT A;  2XNJ A;  1B23 P;  1YI2 B;  1GVH A;  5H5J A;  4RD0 A;  3WYA A;  1B2R A;  1H42 A;  4P3Y A;  5AN9 A;  2BSA A;  3OW2 B;  3AVW A;  5GV8 A;  3VNV A;  1KK2 A;  3J81 k;  5GV7 A;  3QFR A;  3OZW A;  4H9G A;  1EFC A;  4ZGN B;  4TMX A;  1GR1 A;  3W5H A;  1Q7Y D;  1VQK B;  1BJK A;  1R5O A;  2VNJ A;  1U2R A;  1BX0 A;  4M2L A;  1Q82 D;  1VQ9 B;  2BN4 A;  1OB5 A;  1UMK A;  1G7C A;  2J7K A;  2PLF A;  3AVU A;  3CCQ B;  3AVY A;  1QGA A;  1G7T A;  3SJZ A;  1K9M D;  2B7B A;  2BPO A;  3MHP A;  1BX1 A;  1YHQ B;  2C78 A;  1JB9 A;  1EFU A;  1WDT A;  2YWE A;  4IW3 B;  3CW2 A;  3OZU A;  3P27 A;  4M1K A;  4ACB A;  4M0L A;  1G7R A;  1JA0 A;  4AC9 A;  4RD2 A;  3CC4 B;  3CCL B;  4B3X A;  2EIX A;  4YHB A;  4HE5 A;  1BQE A;  1GJR A;  1KK3 A;  4RD3 A;  1XE1 A;  3CCE B;  1YIJ B;  1QFZ A;  4RJL A;  1EFT A;  3ZZU A;  3CME B;  4B44 A;  4DQL A;  1VQL B;  2X3U A;  1W35 A;  1TUI A;  1DDG A;  4C0S A;  4YAU A;  1KQS B;  2QEX B;  1DAR A;  1N0V C;  2ZIT A;  3CCU B;  3CCR B;  2DCU A;  1D8T A;  3VO2 A;  4MYU A;  3W2H A;  1YJW B;  3WNC A;  4RCY A;  2E1R A;  4NCN A;  2AHO A;  1HA3 A;  3W5U A;  1VQ4 B;  4LBZ A;  3U2Q A;  2VNI A;  1EWY A;  3WBK A;  3VO1 A;  3I1F A;  1QGZ A;  1QVF B;  4HE6 A;  3CB4 A;  1CQX A;  1G7S A;  3AVX A;  4LBY A;  1FNM A;  1W87 A;  1QH0 A;  2CND A;  2PIA A;  2DY1 A;  1OB2 A;  5TV2 A;  1FRQ A;  4G5G A;  2YWG A;  2B7C A;  4Q7J B;  2RC5 A;  3W5V A;  4G1V A;  3CCV B;  3ZBT A;  4LBW A;  5THX A;  3I55 B;  2B5O A;  4PGO A;  1ZM9 A;  4PC2 A;  3OJX A;  1N0U A;  2RC6 A;  3WXM A;  2OK7 A;  4C43 A;  3CCJ B;  1KJZ A;  1JA1 A;  1NJI D;  2R6H A;  2D74 A;  3WY9 A;  2OTJ B;  3W2G A;  2HMA A;  3G6E B;  3W2I A;  1KK1 A;  4M4S A;  3ZZT A;  5HXB A;  1TVC A;  1W34 A;  4F7D A;  1FDR A;  2C77 A;  1GO2 A;  1DDI A;  4TMZ A;  1IJF A;  3JQR A;  3CXC B;  3QE2 A;  4ZV4 A;  1SM4 A;  1CNF A;  3FJO A;  3U6K A;  1ZM4 A;  1FNB A;  4TMT A;  1Q81 D;  3JQQ A;  3CCS B;  4RCZ A;  4ZCL A;  1K73 D;  1IJE A;  5H59 A;  1EXM A;  4PC7 A;  1QFJ A;  1QUF A;  5EMN A;  1JNY A;  1ZM3 A;  1A8P A;  3QFS A;  4RD6 A;  5KSW B;  4LC0 A;  3MMP A;  2DEU A;  1VQ5 B;  1XB2 A;  1ELO A;  3ES9 A;  1OGJ A;  2DER A;  4EH1 A;  1OGI A;  2NPF A;  3LVB A;  3CC2 B;  1M90 D;  3E20 A;  3WBJ A;  1VQ8 B;  1R5N A;  2BVN A;  1SKQ A;  4ZCI A;  4N3G A;  1EP3 B;  4G1B A;  3CMA B;  3MCA A;  3AVV A;  1Q86 D;  1NDH A;  1JJ2 B;  4LBV A;  3VNU A;  4ACA A;  2VYQ A;  1E63 A;  1H85 A;  1VQM B;  1CNE A;  4PC6 A;  4TN1 A;  4AF7 A;  3CRZ A;  3V76 A;  4PC3 A;  2VZL A;  3ZZ0 A;  4ZGQ B;  3I56 B;  1VQO B;  1TTT A;  1FRN A;  1QX4 A;  1YJ9 B;  4J0Q A;  1E64 A;  1AMO A;  1D1N A;  3WNB A;  1J9Z A;  2QN6 A;  1R5B A;  5FA6 A;  1IB0 A;  1VQP B;  3B82 A;  1W2B B;  4WQM A;  3G4S B;  1KRH A;  4M53 A;  2BV3 A;  1FND A;  4N3N A;  3CD6 B;  5TR9 A;  1KTV A;  1YJN B;  4MYT A;  1EP1 B;  1I7P A;  1DG1 G;  1D2E A;  2YWH A;  1F60 A;  2GPJ A;  3AGP A;  4Y9R A;  2EFG A;  2QDX A;  1N8R D;  4DQK A;  3QFT A;  4ZCM A;  1QFY A;  4B43 A;  2VNK A;  4FWT A;  3FPK A;  4UAJ A;  1QVG B;  2BGI A;  1FNC A;  2GQF A;  2QMU A;  3ZBU A;  1K8A D;  2HDN B;  3ZC3 A;  2BMW A;  2OTL B;  2YWF A;  4R71 A;  1QGY A;  4AF6 A;  3OZV A;  2PMD A;  2XEX A;  1QUE A;  4P6V F;  1E62 A;  4BPR A;  3CPW B;  3P26 A;  4YAF A;  3WND A;  1KD1 D;  4FK8 A;  1ZUN B;  2BM0 A;  4Y9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...