4ZGQB

Structure of cdc123 bound to eif2-gammadiii domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
102
Chain Sequence
LPNIYTDIEINYFLLRRLLGVKTDGQKQAKVRKLEPNEVLMVNIGSTATGARVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWRLIGWATIKKGTTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division cycle protein 123
publication title Cdc123, a Cell Cycle Regulator Needed for eIF2 Assembly, Is an ATP-Grasp Protein with Unique Features.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 16
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4zgqB00
1JA1A 1W35A 1YI2B 3VO2A 1K73D 4P6VF 1EP3B 1YJNB 1G7RA 5KSWB 3CC2B 1JA0A 2QN6A 1QUFA 2EIXA 4C0SA 3U6KA 3ZZ0A 2BMWA 4AC9A 1K9MD 3W2HA 4FN5A 5DSZA 4RD0A 4Y7CA 2VNKA 3WY9A 1SM4A 4TMZA 1FNMA 3QSYA 5THXA 1VQ5B 1E62A 2BF4A 1TLLA 4ZGNB 1N0UA 1EP1B 1JJ2B 4RD2A 3AGPA 3OJXA 3JQQA 3WNBA 2HCJB 3B78A 1QG0A 4B43A 3FJOA 2VNIA 1Q7YD 3MCAA 3VO1A 4AF7A 1VQNB 2X3UA 3ZC3A 1EP2B 1M90D 3WNDA 2DEUA 3I1FA 2XEXA 1YJ9B 2QDXA 1SKQA 1TVCA 1BX1A 2VZLA 1E64A 4M2LA 1W87A 1GO2A 1ZM4A 4G1VA 2YWHA 1N0VC 5HXBA 1W34A 4RCZA 1EWYA 1BQEA 2GQFA 3AVYA 2XNJA 2HMAA 1H85A 3AVWA 1ZM9A 4YAFA 2C78A 1GJRA 2QEXB 4ACAA 1FRQA 1AMOA 4LC0A 1OB5A 1B23P 4P3YA 4LBVA 3CCJB 4G5GA 2VYQA 1YIJB 1QFJA 1VQ7B 3CCQB 1E63A 4G1BA 4LBZA 2YWGA 3OZVA 1EFUA 1VQ9B 1QFYA 4Q7JB 4FWTA 1F60A 2FX3A 3JQPA 3P27A 1S0UA 3ES9A 4TMVA 3WXMA 2DERA 4BPRA 2QTLA 2BPOA 1I7PA 2PIAA 1IJEA 3CXCB 1BX0A 1QGAA 3LVBA 4HE5A 1XB2A 3QFSA 3W2FA 1QVGB 3G71B 1CQXA 3FPKA 4R71A 1GVHA 1KK3A 1QH0A 3CRZA 3OZWA 3VNUA 1VQKB 3AVVA 3WNCA 3U2QA 3CC7B 3W5VA 1FRNA 4ZCIA 1FDRA 1QGYA 3JQRA 2BGJA 3PENA 1D8TA 5TR9A 5EMNA 1EFTA 3MHPA 1WDTA 2DY1A 4DQLA 4EH1A 4MYUA 1KK2A 3CCEB 1QVFB 4F7DA 3WBKA 5H5JA 1DDIA 5TY0A 5JBQA 3SJZA 3WYAA 3ZZTA 4M1KA 1VQ8B 2R6HA 1KC8D 1Q81D 4HE6A 2BN4A 1CNFA 1NJID 3ZZUA 2DCUA 3ZBUA 3OJWA 3LO8A 3CB4A 1JNYA 2E1RA 1QFZA 1IB0A 4RD1A 1DDGA 1NDHA 4MYTA 2BSAA 2YWEA 4RD4A 3W5UA 3B82A 4M0LA 1XE1A 2GPJA 4DQKA 1KK0A 3E1YE 2OTJB 1QGZA 3CCVB 3OZUA 2RC6A 1AIPA 4QHYA 3QFTA 1U2RA 3W2EA 1VQ4B 4FK8A 2VNHA 3W5HA 4AF6A 1R5OA 2C77A 5FA6A 4U9UA 4YHBA 4M4SA 4LBWA 1KQSB 4TMWA 2ZITA 4TN1A 1VQ6B 2RC5A 4B4DA 1KK1A 2J7KA 1ZUNB 3ZBTA 1R5BA 4YAOA 3OW2B 3QFRA 2BM0A 1YITB 3AVUA 3CCUB 3CCSB 5TV2A 2HDNB 4YAUA 1VQLB 1Q82D 4B44A 1OGIA 4UAJA 1BJKA 1J9ZA 4TMTA 1TTTA 1G7CA 1W2BB 3B8HA 2PMDA 1ELOA 1Q86D 4C43A 1QX4A 3E20A 1R5NA 1ZM3A 4PC3A 2QA4B 5AN9A 2NPFA 1UMKA 1OB2A 4YAWA 4ZCLA 3CD6B 3CCRB 1H42A 2B7BA 1IJFA 5GV7A 1YJWB 4ACBA 1D1NA 3V76A 3J81k 4IW3B 3QE2A 3AVXA 2OK8A 3G4SB 2B7CA 4PC2A 1FNCA 1GAWA 1YHQB 4PC7A 4ZGQB 3CC4B 4LBYA 2AHOA 1G7SA 1N8RD 4PC1A 2CRVA 1FNBA 4N3GA 3WBJA 1G7TA 2PLFA 4B48A 4K1XA 4RD6A 3I56B 3U6BA 2BV3A 3VMFA 3W2IA 2CNDA 4RJLA 3VNVA 4B3XA 1CNEA 4ZV4A 2OK7A 5H59A 1M1KD 3MMPA 3AGQA 4RD3A 3W2GA 1KJZA 1VQOB 3CCLB 4Y9RA 1KD1D 1K8AD 1EXMA 4M53A 1VQPB 1VQMB 4H9GA 1FNDA 3CPWB 4NCNA 3AVTA 1JB9A 5GV8A 4Y9UA 1QUEA 4PGOA 1KRHA 2XNCA 4TMXA 2BVNA 2YWFA 1B2RA 3QFCA 4N3NA 1D2EA 2B5OA 4RCYA 4PC6A 1EFCA 2VNJA 1OGJA 1F20A 1ZM2A 1A8PA 4WQMA 4J0QA 1TUIA 1KTVA 3CCMB 1DG1G 2QMUA 4QFMA 4NBSA 2BM1A 2DETA 3CW2A 2OTLB 1GR1A 2D74A 2EFGA 1S72B 3P26A 2BGIA 4ZCMA 4YALA 3I55B 1DARA 4B47A 3G6EB 1GAQA 1HA3A 3CMEB 2QTZA 3CMAB
chains in the Genus database with same CATH superfamily
2VBVA 1JA1A 1W35A 1W0JA 3ASSA 1YI2B 3VO2A 4XOPA 1K73D 2ZXHA 1MABA 2GJRA 1EP3B 2V4DA 4P6VF 1YJNB 1G7RA 1T6ZA 2ZXIA 5KSWB 5BSXA 3CC2B 1JA0A 2PE3A 3BCDA 3T53B 3CMMA 1Q9SA 5A89A 1XQBA 2QN6A 3CPXA 1QUFA 2EIXA 2X0KA 4C0SA 1E1QA 2V7WA 4RPDA 3U6KA 3ZZ0A 1WSRA 2BMWA 2F43A 4OOSA 4AC9A 2ZZEA 4Z4ZA 4QVAA 4RDKA 4ASUA 1K9MD 3W2HA 2W6IA 4FN5A 5KNLA 5DSZA 4RD0A 4Y7CA 2VNKA 3WY9A 5BSYA 1SM4A 4TMZA 1FNMA 3QSYA 4Z1MA 4TT3A 5THXA 1VQ5B 4RDLA 1WOOA 4XORA 2VJIA 1E62A 2BF4A 1TLLA 4ZGNB 1N0UA 1EP1B 5CDFA 4P26A 1JJ2B 4Z4SA 4RD2A 1I18A 3AGPA 3OJXA 4P22A 3JQQA 3WNBA 4DK1A 2HCJB 3B78A 1QG0A 5FIUA 2GREA 3FJOA 5FO0A 2VNIA 2LZJA 4B43A 1Q7YD 2JJ1A 3MCAA 4WZEA 3VO1A 4AF7A 1VQNB 2X3UA 4XMYA 1V0FA 2F1MA 4OPVA 4XKWA 1EP2B 3ZC3A 1M90D 3WNDA 2DEUA 1T6YA 2E1BA 3I1FA 2XEXA 1YJ9B 2QDXA 1SKQA 1TVCA 1BX1A 2VZLA 1E64A 2XGJA 1PJ6A 4M2LA 1BLIA 1W87A 1GO2A 1ZM4A 4G1VA 1VF7A 2YWHA 3H94A 4AVZA 3A8KA 1N0VC 5IYNA 2V31A 5HXBA 2JDIA 3LQ6A 1W34A 4RCZA 2P3MA 3ZUGA 1EWYA 1BQEA 2GQFA 3AVYA 4KKSA 2XNJA 2HMAA 3BC9A 1H85A 3AVWA 3A8IA 1ZM9A 3PVDA 5DN6A 4YAFA 2C78A 2I1LA 2WJYA 1GJRA 2QEXB 1H8HA 4G6IA 4ACAA 1FRQA 1V0EA 3ONYA 1AMOA 4LC0A 1OB5A 4UZUA 1B23P 2WJVA 1H8EA 4P12A 4P3YA 4LBVA 3CCJB 4G5GA 2VYQA 1YIJB 1QFJA 1VQ7B 2GK6A 2ZZGA 4DNRB 2V7VA 4XM3A 3OEEA 2OBRA 3JU4A 4OOXA 3CCQB 1E63A 2ZTNA 3OFNA 4G1BA 3OPOA 4LBZA 2XZLA 2YWGA 1Y0RA 1EFUA 3OZVA 1VQ9B 1QFYA 4Q7JB 1N06A 4FWTA 1F60A 4II2A 2FX3A 3JQPA 3P27A 3WQZA 1S0UA 1E79A 1BMFA 1COWA 1UD3A 3ES9A 2GJPA 4TMVA 3A8JA 2F1LA 3WXMA 2DERA 4BPRA 1E43A 2QTLA 2BPOA 1I7PA 3GVJA 3PUNA 2PIAA 1IJEA 3BH4A 3CXCB 1BX0A 4E0FA 2XZPA 4P25A 4P3IA 1WPCA 3SLNA 1QGAA 5E6TA 2R9VA 3LVBA 3ASPA 4HE5A 1XB2A 2V7QA 3QFSA 5FO1A 1PKVA 4FXUA 3W2FA 2WZPP 2FVGA 3ASQA 2CW5A 2XZOA 2Z6BD 4B3FX 1QVGB 3SJPA 3G71B 1S4MA 3CP2A 1CQXA 1N07A 3FPKA 3V7AA 4X7EA 4R71A 1GVHA 1KK3A 1QH0A 4XN3A 3CRZA 3OZWA 3VNUA 1VQKB 3AVVA 5IYQA 4HIZA 4OPOA 4XNFA 3WNCA 4X7CA 3U2QA 3Q39A 2ZZQA 3H9NA 2VJJA 4PAAA 3CC7B 2WPDA 3Q38A 1FRNA 3W5VA 3A35A 3OP1A 4ZCIA 1FDRA 1QGYA 5A88A 2D3LA 3JQRA 3PUMA 2BGJA 3PENA 4L8JA 1BPLA 2OBSA 1D8TA 4XLCA 2DOGA 4II3A 4YELA 1E3XA 5TR9A 3PA1A 1EFTA 5EMNA 3MHPA 1WDTA 2DY1A 2DYIA 3A1PA 1OB0A 4DQLA 4X05A 4EH1A 4MYUA 1KK2A 4P9SA 3CCEB 1QVFB 2ZBUA 1KZLA 4F7DA 3HAGA 5J35A 1EFRA 4WZKA 5B6IA 3CP8A 4Z4TA 3WBKA 5HZAA 3OAAA 5H5JA 1DDIA 5TY0A 3R6JA 3SJZA 5JBQA 2JN9A 3WYAA 3ZZTA 1XFOA 3ISXA 4M1KA 1VQ8B 2R6HA 4X07A 4JMQA 1KC8D 3ASTA 1E3ZA 3A3BA 1Q81D 4HE6A 2BN4A 1CNFA 3T56B 1NJID 3ZZUA 2VBUA 4X0CA 1W0KA 2DCUA 3ZBUA 3GIRA 2C5BA 2DIEA 3OJWA 3LO8A 3CB4A 3A3GA 3ZIAA 1JNYA 4Z4VA 2ZZFA 1WP6A 2E1RA 1VLYA 4YXWA 1QFZA 1IB0A 4RD1A 2ZL6A 1DDGA 1NDHA 4MYTA 5DS0A 2BSAA 2YWEA 4RM0A 2X6WA 4RD4A 3ZPNA 1WSVA 3W5UA 3FPPA 3Q3AA 1XE1A 3B82A 4M0LA 5F4MA 2GPJA 4DQKA 1KK0A 2X8KA 3E1YE 5A8AA 2OTJB 1QGZA 2M5SA 4UZFA 2X53S 3CCVB 3OZUA 2RC6A 1RQRA 4ROXA 4XR6A 1AIPA 5IK2A 4QHYA 2NV4A 3QFTA 1U2RA 1NB0A 3W2EA 5KW9A 1WOPA 4FK8A 5IYWA 1VQ4B 1WORA 2VNHA 3W5HA 4AF6A 1R5OA 1MRZA 2C77A 2CC2A 5FA6A 4U9UA 3PA2A 4XLEA 4YHBA 1VHEA 4M4SA 1I8DA 4RLZA 2X6YA 4RPBA 4LBWA 1RQPA 3NE5B 1KQSB 4TMWA 1WTHD 4WZLA 5L46A 2ZITA 4TN1A 1VQ6B 2RC5A 4B4DA 4QV2A 1KK1A 2D3NA 1ZUNB 2J7KA 5IYRA 3ZBTA 2GK7A 1R5BA 4YAOA 3OW2B 2QE7A 5LMZA 4OPSA 4XN0A 5J3OA 3QFRA 3OE7A 2BM0A 3GVLA 5HKKA 1YITB 3AVUA 5IYPA 1V5VA 1NBMA 3GVKA 5FNZA 3CCUB 1P4MA 3BY1A 3CCSB 5TV2A 2OBTA 2OYNA 4XLFA 2HDNB 4DNTB 4Z4UA 4YAUA 1T6XA 1E1RA 1VQLB 3OKXA 1Q82D 4B44A 4B3GA 1OGIA 4UAJA 1BJKA 1J9ZA 2CBXA 4X7DA 2JJ2A 4TMTA 1TTTA 4OP7A 1G7CA 1UD8A 1PJ5A 2W6JA 2ZBVA 3B8HA 2PMDA 4XLAA 2VBSA 3CMAB 1W2BB 1ELOA 1Q86D 1WU8A 4C43A 1QX4A 5HZBA 1UD2A 3E20A 2C4TA 1R5NA 2X85A 1ZM3A 3D26A 3DDYA 4PC3A 2QA4B 5AN9A 2F4NA 2Q6KA 4XKVA 2NPFA 1UMKA 1OB2A 2CK3A 3BQJA 4KKUA 1N08A 1W9XA 3CTAA 4YAWA 4ZCLA 3CD6B 3CCRB 1H42A 2B7BA 1IJFA 5GV7A 1YJWB 4ACBA 1D1NA 3KEWA 2HLDA 3Q6QA 4P2NA 3OEHA 4X06A 3V76A 1VHOA 2C5HA 1YX2A 2Q6LA 2Q6IA 4IW3B 4XL9A 4DK0A 3J81k 3QE2A 3AVXA 2ZL7A 4X8IA 2WZNA 2OK8A 3G4SB 2B7CA 3LNNA 4PC2A 3BNWA 2C2WA 4PABA 4CQJA 4G7WA 2KVOA 1FNCA 4TSFA 4XONA 1GAWA 4RDJA 1YHQB 4PC7A 5F4JA 4ZGQB 2WSSA 3CC4B 4LBYA 3BCFA 2AHOA 3FKSA 1G7SA 4WWVA 2V7XA 1N8RD 4WZTA 4Z4RA 4PC1A 2WR8A 2CRVA 3ASRA 1FNBA 4N3GA 3WBJA 1YLOA 1G7TA 2Q6OA 1HZEA 2PLFA 4B48A 4K1XA 4RD6A 3GSIA 2XOKA 1UD6A 4YEJA 3I56B 3U6BA 2BV3A 3VMFA 1IHMA 2VBTA 3W2IA 4X7FA 2CNDA 4KKTA 4RJLA 3VNVA 4B3XA 3SLDA 3CESA 4GQNA 3VR6A 1CNEA 1PJ7A 1VJSA 4ZV4A 3LQEA 2OK7A 5H59A 1M1KD 3MMPA 3AGQA 2JIZA 4RD3A 2XNDA 1KJZA 3W2GA 1VQOB 2D9RA 3CCLB 2V7UA 1VLOA 4Y9RA 1KD1D 3GQBA 1K8AD 1EXMA 2QGGA 4UZEA 1WOSA 4M53A 4TKOB 3RY8A 1UD4A 1VQPB 3SKBA 4G7XA 3OW7A 1VQMB 4H9GA 1T5EA 4QUZA 4NNJA 1FNDA 3CPWB 4NCNA 3AVTA 1JB9A 5GV8A 4Y9UA 1QUEA 5FL7A 4PGOA 2V7TA 1FX0A 1KRHA 2XNCA 1KMHA 1OHHA 4TMXA 2BVNA 2GJKA 2YWFA 1B2RA 2C4UA 3QFCA 4N3NA 3G05A 3ONUA 5F4OA 1D2EA 1N05A 2B5OA 4Z4WA 3KL9A 4RCYA 3OOCA 4PC6A 4OOVA 4QVJA 1NRKA 1EFCA 3Q6RA 4XLHA 2VNJA 1OGJA 1F20A 4P6YA 1ZM2A 1A8PA 2ZTGA 4XOTA 3SEJA 3BY2A 4WQMA 4J0QA 1K28D 1TUIA 4P1VA 1KTVA 3CCMB 1DG1G 2QMUA 4QFMA 4NBSA 4XQFA 3T51B 2BM1A 1SKYB 2DETA 1NB9A 2WYRA 3CW2A 2OTLB 1GR1A 2D74A 5TRDA 2EFGA 1S72B 3P26A 2BGIA 4ZCMA 1HVXA 3R6KA 4Z4YA 2X6XA 4YALA 3I55B 1DARA 1UD5A 2ZL5A 4B47A 3G6EB 1GAQA 1HA3A 3CMEB 2QTZA 4XD7A 2CF4A 1Y0YA
chains in the Genus database with same CATH topology
1JA1A 1W35A 1YI2B 3VO2A 1K73D 4P6VF 1EP3B 1YJNB 1G7RA 5KSWB 3CC2B 1JA0A 2QN6A 1QUFA 2EIXA 4C0SA 3U6KA 3ZZ0A 2BMWA 4AC9A 1K9MD 3W2HA 4FN5A 5DSZA 4RD0A 4Y7CA 2VNKA 3WY9A 1SM4A 4TMZA 1FNMA 3QSYA 5THXA 1VQ5B 1E62A 2BF4A 1TLLA 4ZGNB 1N0UA 1EP1B 1JJ2B 4RD2A 3AGPA 3OJXA 3JQQA 3WNBA 2HCJB 3B78A 1QG0A 4B43A 3FJOA 2VNIA 1Q7YD 3MCAA 3VO1A 4AF7A 1VQNB 2X3UA 3ZC3A 1EP2B 1M90D 3WNDA 2DEUA 3I1FA 2XEXA 1YJ9B 2QDXA 1SKQA 1TVCA 1BX1A 2VZLA 1E64A 4M2LA 1W87A 1GO2A 1ZM4A 4G1VA 2YWHA 1N0VC 5HXBA 1W34A 4RCZA 1EWYA 1BQEA 2GQFA 3AVYA 2XNJA 2HMAA 1H85A 3AVWA 1ZM9A 4YAFA 2C78A 1GJRA 2QEXB 4ACAA 1FRQA 1AMOA 4LC0A 1OB5A 1B23P 4P3YA 4LBVA 3CCJB 4G5GA 2VYQA 1YIJB 1QFJA 1VQ7B 3CCQB 1E63A 4G1BA 4LBZA 2YWGA 3OZVA 1EFUA 1VQ9B 1QFYA 4Q7JB 4FWTA 1F60A 2FX3A 3JQPA 3P27A 1S0UA 3ES9A 4TMVA 3WXMA 2DERA 4BPRA 2QTLA 2BPOA 1I7PA 2PIAA 1IJEA 3CXCB 1BX0A 1QGAA 3LVBA 4HE5A 1XB2A 3QFSA 3W2FA 1QVGB 3G71B 1CQXA 3FPKA 4R71A 1GVHA 1KK3A 1QH0A 3CRZA 3OZWA 3VNUA 1VQKB 3AVVA 3WNCA 3U2QA 3CC7B 3W5VA 1FRNA 4ZCIA 1FDRA 1QGYA 3JQRA 2BGJA 3PENA 1D8TA 5TR9A 5EMNA 1EFTA 3MHPA 1WDTA 2DY1A 4DQLA 4EH1A 4MYUA 1KK2A 3CCEB 1QVFB 4F7DA 3WBKA 5H5JA 1DDIA 5TY0A 5JBQA 3SJZA 3WYAA 3ZZTA 4M1KA 1VQ8B 2R6HA 1KC8D 1Q81D 4HE6A 2BN4A 1CNFA 1NJID 3ZZUA 2DCUA 3ZBUA 3OJWA 3LO8A 3CB4A 1JNYA 2E1RA 1QFZA 1IB0A 4RD1A 1DDGA 1NDHA 4MYTA 2BSAA 2YWEA 4RD4A 3W5UA 3B82A 4M0LA 1XE1A 2GPJA 4DQKA 1KK0A 3E1YE 2OTJB 1QGZA 3CCVB 3OZUA 2RC6A 1AIPA 4QHYA 3QFTA 1U2RA 3W2EA 1VQ4B 4FK8A 2VNHA 3W5HA 4AF6A 1R5OA 2C77A 5FA6A 4U9UA 4YHBA 4M4SA 4LBWA 1KQSB 4TMWA 2ZITA 4TN1A 1VQ6B 2RC5A 4B4DA 1KK1A 2J7KA 1ZUNB 3ZBTA 1R5BA 4YAOA 3OW2B 3QFRA 2BM0A 1YITB 3AVUA 3CCUB 3CCSB 5TV2A 2HDNB 4YAUA 1VQLB 1Q82D 4B44A 1OGIA 4UAJA 1BJKA 1J9ZA 4TMTA 1TTTA 1G7CA 1W2BB 3B8HA 2PMDA 1ELOA 1Q86D 4C43A 1QX4A 3E20A 1R5NA 1ZM3A 4PC3A 2QA4B 5AN9A 2NPFA 1UMKA 1OB2A 4YAWA 4ZCLA 3CD6B 3CCRB 1H42A 2B7BA 1IJFA 5GV7A 1YJWB 4ACBA 1D1NA 3V76A 3J81k 4IW3B 3QE2A 3AVXA 2OK8A 3G4SB 2B7CA 4PC2A 1FNCA 1GAWA 1YHQB 4PC7A 4ZGQB 3CC4B 4LBYA 2AHOA 1G7SA 1N8RD 4PC1A 2CRVA 1FNBA 4N3GA 3WBJA 1G7TA 2PLFA 4B48A 4K1XA 4RD6A 3I56B 3U6BA 2BV3A 3VMFA 3W2IA 2CNDA 4RJLA 3VNVA 4B3XA 1CNEA 4ZV4A 2OK7A 5H59A 1M1KD 3MMPA 3AGQA 4RD3A 3W2GA 1KJZA 1VQOB 3CCLB 4Y9RA 1KD1D 1K8AD 1EXMA 4M53A 1VQPB 1VQMB 4H9GA 1FNDA 3CPWB 4NCNA 3AVTA 1JB9A 5GV8A 4Y9UA 1QUEA 4PGOA 1KRHA 2XNCA 4TMXA 2BVNA 2YWFA 1B2RA 3QFCA 4N3NA 1D2EA 2B5OA 4RCYA 4PC6A 1EFCA 2VNJA 1OGJA 1F20A 1ZM2A 1A8PA 4WQMA 4J0QA 1TUIA 1KTVA 3CCMB 1DG1G 2QMUA 4QFMA 4NBSA 2BM1A 2DETA 3CW2A 2OTLB 1GR1A 2D74A 2EFGA 1S72B 3P26A 2BGIA 4ZCMA 4YALA 3I55B 1DARA 4B47A 3G6EB 1GAQA 1HA3A 3CMEB 2QTZA 3CMAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JA1 A;  1W35 A;  1YI2 B;  3VO2 A;  1K73 D;  4P6V F;  1EP3 B;  1YJN B;  1G7R A;  5KSW B;  3CC2 B;  1JA0 A;  2QN6 A;  1QUF A;  2EIX A;  4C0S A;  3U6K A;  3ZZ0 A;  2BMW A;  4AC9 A;  1K9M D;  3W2H A;  4FN5 A;  5DSZ A;  4RD0 A;  4Y7C A;  2VNK A;  3WY9 A;  1SM4 A;  4TMZ A;  1FNM A;  3QSY A;  5THX A;  1VQ5 B;  1E62 A;  2BF4 A;  1TLL A;  4ZGN B;  1N0U A;  1EP1 B;  1JJ2 B;  4RD2 A;  3AGP A;  3OJX A;  3JQQ A;  3WNB A;  2HCJ B;  3B78 A;  1QG0 A;  4B43 A;  3FJO A;  2VNI A;  1Q7Y D;  3MCA A;  3VO1 A;  4AF7 A;  1VQN B;  2X3U A;  3ZC3 A;  1EP2 B;  1M90 D;  3WND A;  2DEU A;  3I1F A;  2XEX A;  1YJ9 B;  2QDX A;  1SKQ A;  1TVC A;  1BX1 A;  2VZL A;  1E64 A;  4M2L A;  1W87 A;  1GO2 A;  1ZM4 A;  4G1V A;  2YWH A;  1N0V C;  5HXB A;  1W34 A;  4RCZ A;  1EWY A;  1BQE A;  2GQF A;  3AVY A;  2XNJ A;  2HMA A;  1H85 A;  3AVW A;  1ZM9 A;  4YAF A;  2C78 A;  1GJR A;  2QEX B;  4ACA A;  1FRQ A;  1AMO A;  4LC0 A;  1OB5 A;  1B23 P;  4P3Y A;  4LBV A;  3CCJ B;  4G5G A;  2VYQ A;  1YIJ B;  1QFJ A;  1VQ7 B;  3CCQ B;  1E63 A;  4G1B A;  4LBZ A;  2YWG A;  3OZV A;  1EFU A;  1VQ9 B;  1QFY A;  4Q7J B;  4FWT A;  1F60 A;  2FX3 A;  3JQP A;  3P27 A;  1S0U A;  3ES9 A;  4TMV A;  3WXM A;  2DER A;  4BPR A;  2QTL A;  2BPO A;  1I7P A;  2PIA A;  1IJE A;  3CXC B;  1BX0 A;  1QGA A;  3LVB A;  4HE5 A;  1XB2 A;  3QFS A;  3W2F A;  1QVG B;  3G71 B;  1CQX A;  3FPK A;  4R71 A;  1GVH A;  1KK3 A;  1QH0 A;  3CRZ A;  3OZW A;  3VNU A;  1VQK B;  3AVV A;  3WNC A;  3U2Q A;  3CC7 B;  3W5V A;  1FRN A;  4ZCI A;  1FDR A;  1QGY A;  3JQR A;  2BGJ A;  3PEN A;  1D8T A;  5TR9 A;  5EMN A;  1EFT A;  3MHP A;  1WDT A;  2DY1 A;  4DQL A;  4EH1 A;  4MYU A;  1KK2 A;  3CCE B;  1QVF B;  4F7D A;  3WBK A;  5H5J A;  1DDI A;  5TY0 A;  5JBQ A;  3SJZ A;  3WYA A;  3ZZT A;  4M1K A;  1VQ8 B;  2R6H A;  1KC8 D;  1Q81 D;  4HE6 A;  2BN4 A;  1CNF A;  1NJI D;  3ZZU A;  2DCU A;  3ZBU A;  3OJW A;  3LO8 A;  3CB4 A;  1JNY A;  2E1R A;  1QFZ A;  1IB0 A;  4RD1 A;  1DDG A;  1NDH A;  4MYT A;  2BSA A;  2YWE A;  4RD4 A;  3W5U A;  3B82 A;  4M0L A;  1XE1 A;  2GPJ A;  4DQK A;  1KK0 A;  3E1Y E;  2OTJ B;  1QGZ A;  3CCV B;  3OZU A;  2RC6 A;  1AIP A;  4QHY A;  3QFT A;  1U2R A;  3W2E A;  1VQ4 B;  4FK8 A;  2VNH A;  3W5H A;  4AF6 A;  1R5O A;  2C77 A;  5FA6 A;  4U9U A;  4YHB A;  4M4S A;  4LBW A;  1KQS B;  4TMW A;  2ZIT A;  4TN1 A;  1VQ6 B;  2RC5 A;  4B4D A;  1KK1 A;  2J7K A;  1ZUN B;  3ZBT A;  1R5B A;  4YAO A;  3OW2 B;  3QFR A;  2BM0 A;  1YIT B;  3AVU A;  3CCU B;  3CCS B;  5TV2 A;  2HDN B;  4YAU A;  1VQL B;  1Q82 D;  4B44 A;  1OGI A;  4UAJ A;  1BJK A;  1J9Z A;  4TMT A;  1TTT A;  1G7C A;  1W2B B;  3B8H A;  2PMD A;  1ELO A;  1Q86 D;  4C43 A;  1QX4 A;  3E20 A;  1R5N A;  1ZM3 A;  4PC3 A;  2QA4 B;  5AN9 A;  2NPF A;  1UMK A;  1OB2 A;  4YAW A;  4ZCL A;  3CD6 B;  3CCR B;  1H42 A;  2B7B A;  1IJF A;  5GV7 A;  1YJW B;  4ACB A;  1D1N A;  3V76 A;  3J81 k;  4IW3 B;  3QE2 A;  3AVX A;  2OK8 A;  3G4S B;  2B7C A;  4PC2 A;  1FNC A;  1GAW A;  1YHQ B;  4PC7 A;  4ZGQ B;  3CC4 B;  4LBY A;  2AHO A;  1G7S A;  1N8R D;  4PC1 A;  2CRV A;  1FNB A;  4N3G A;  3WBJ A;  1G7T A;  2PLF A;  4B48 A;  4K1X A;  4RD6 A;  3I56 B;  3U6B A;  2BV3 A;  3VMF A;  3W2I A;  2CND A;  4RJL A;  3VNV A;  4B3X A;  1CNE A;  4ZV4 A;  2OK7 A;  5H59 A;  1M1K D;  3MMP A;  3AGQ A;  4RD3 A;  3W2G A;  1KJZ A;  1VQO B;  3CCL B;  4Y9R A;  1KD1 D;  1K8A D;  1EXM A;  4M53 A;  1VQP B;  1VQM B;  4H9G A;  1FND A;  3CPW B;  4NCN A;  3AVT A;  1JB9 A;  5GV8 A;  4Y9U A;  1QUE A;  4PGO A;  1KRH A;  2XNC A;  4TMX A;  2BVN A;  2YWF A;  1B2R A;  3QFC A;  4N3N A;  1D2E A;  2B5O A;  4RCY A;  4PC6 A;  1EFC A;  2VNJ A;  1OGJ A;  1F20 A;  1ZM2 A;  1A8P A;  4WQM A;  4J0Q A;  1TUI A;  1KTV A;  3CCM B;  1DG1 G;  2QMU A;  4QFM A;  4NBS A;  2BM1 A;  2DET A;  3CW2 A;  2OTL B;  1GR1 A;  2D74 A;  2EFG A;  1S72 B;  3P26 A;  2BGI A;  4ZCM A;  4YAL A;  3I55 B;  1DAR A;  4B47 A;  3G6E B;  1GAQ A;  1HA3 A;  3CME B;  2QTZ A;  3CMA B; 
#chains in the Genus database with same CATH topology
 2VBV A;  1JA1 A;  1W35 A;  1W0J A;  3ASS A;  1YI2 B;  3VO2 A;  4XOP A;  1K73 D;  2ZXH A;  1MAB A;  2GJR A;  1EP3 B;  2V4D A;  4P6V F;  1YJN B;  1G7R A;  1T6Z A;  2ZXI A;  5KSW B;  5BSX A;  3CC2 B;  1JA0 A;  2PE3 A;  3BCD A;  3T53 B;  3CMM A;  1Q9S A;  5A89 A;  1XQB A;  2QN6 A;  3CPX A;  1QUF A;  2EIX A;  2X0K A;  4C0S A;  1E1Q A;  2V7W A;  4RPD A;  3U6K A;  3ZZ0 A;  1WSR A;  2BMW A;  2F43 A;  4OOS A;  4AC9 A;  2ZZE A;  4Z4Z A;  4QVA A;  4RDK A;  4ASU A;  1K9M D;  3W2H A;  2W6I A;  4FN5 A;  5KNL A;  5DSZ A;  4RD0 A;  4Y7C A;  2VNK A;  3WY9 A;  5BSY A;  1SM4 A;  4TMZ A;  1FNM A;  3QSY A;  4Z1M A;  4TT3 A;  5THX A;  1VQ5 B;  4RDL A;  1WOO A;  4XOR A;  2VJI A;  1E62 A;  2BF4 A;  1TLL A;  4ZGN B;  1N0U A;  1EP1 B;  5CDF A;  4P26 A;  1JJ2 B;  4Z4S A;  4RD2 A;  1I18 A;  3AGP A;  3OJX A;  4P22 A;  3JQQ A;  3WNB A;  4DK1 A;  2HCJ B;  3B78 A;  1QG0 A;  5FIU A;  2GRE A;  3FJO A;  5FO0 A;  2VNI A;  2LZJ A;  4B43 A;  1Q7Y D;  2JJ1 A;  3MCA A;  4WZE A;  3VO1 A;  4AF7 A;  1VQN B;  2X3U A;  4XMY A;  1V0F A;  2F1M A;  4OPV A;  4XKW A;  1EP2 B;  3ZC3 A;  1M90 D;  3WND A;  2DEU A;  1T6Y A;  2E1B A;  3I1F A;  2XEX A;  1YJ9 B;  2QDX A;  1SKQ A;  1TVC A;  1BX1 A;  2VZL A;  1E64 A;  2XGJ A;  1PJ6 A;  4M2L A;  1BLI A;  1W87 A;  1GO2 A;  1ZM4 A;  4G1V A;  1VF7 A;  2YWH A;  3H94 A;  4AVZ A;  3A8K A;  1N0V C;  5IYN A;  2V31 A;  5HXB A;  2JDI A;  3LQ6 A;  1W34 A;  4RCZ A;  2P3M A;  3ZUG A;  1EWY A;  1BQE A;  2GQF A;  3AVY A;  4KKS A;  2XNJ A;  2HMA A;  3BC9 A;  1H85 A;  3AVW A;  3A8I A;  1ZM9 A;  3PVD A;  5DN6 A;  4YAF A;  2C78 A;  2I1L A;  2WJY A;  1GJR A;  2QEX B;  1H8H A;  4G6I A;  4ACA A;  1FRQ A;  1V0E A;  3ONY A;  1AMO A;  4LC0 A;  1OB5 A;  4UZU A;  1B23 P;  2WJV A;  1H8E A;  4P12 A;  4P3Y A;  4LBV A;  3CCJ B;  4G5G A;  2VYQ A;  1YIJ B;  1QFJ A;  1VQ7 B;  2GK6 A;  2ZZG A;  4DNR B;  2V7V A;  4XM3 A;  3OEE A;  2OBR A;  3JU4 A;  4OOX A;  3CCQ B;  1E63 A;  2ZTN A;  3OFN A;  4G1B A;  3OPO A;  4LBZ A;  2XZL A;  2YWG A;  1Y0R A;  1EFU A;  3OZV A;  1VQ9 B;  1QFY A;  4Q7J B;  1N06 A;  4FWT A;  1F60 A;  4II2 A;  2FX3 A;  3JQP A;  3P27 A;  3WQZ A;  1S0U A;  1E79 A;  1BMF A;  1COW A;  1UD3 A;  3ES9 A;  2GJP A;  4TMV A;  3A8J A;  2F1L A;  3WXM A;  2DER A;  4BPR A;  1E43 A;  2QTL A;  2BPO A;  1I7P A;  3GVJ A;  3PUN A;  2PIA A;  1IJE A;  3BH4 A;  3CXC B;  1BX0 A;  4E0F A;  2XZP A;  4P25 A;  4P3I A;  1WPC A;  3SLN A;  1QGA A;  5E6T A;  2R9V A;  3LVB A;  3ASP A;  4HE5 A;  1XB2 A;  2V7Q A;  3QFS A;  5FO1 A;  1PKV A;  4FXU A;  3W2F A;  2WZP P;  2FVG A;  3ASQ A;  2CW5 A;  2XZO A;  2Z6B D;  4B3F X;  1QVG B;  3SJP A;  3G71 B;  1S4M A;  3CP2 A;  1CQX A;  1N07 A;  3FPK A;  3V7A A;  4X7E A;  4R71 A;  1GVH A;  1KK3 A;  1QH0 A;  4XN3 A;  3CRZ A;  3OZW A;  3VNU A;  1VQK B;  3AVV A;  5IYQ A;  4HIZ A;  4OPO A;  4XNF A;  3WNC A;  4X7C A;  3U2Q A;  3Q39 A;  2ZZQ A;  3H9N A;  2VJJ A;  4PAA A;  3CC7 B;  2WPD A;  3Q38 A;  1FRN A;  3W5V A;  3A35 A;  3OP1 A;  4ZCI A;  1FDR A;  1QGY A;  5A88 A;  2D3L A;  3JQR A;  3PUM A;  2BGJ A;  3PEN A;  4L8J A;  1BPL A;  2OBS A;  1D8T A;  4XLC A;  2DOG A;  4II3 A;  4YEL A;  1E3X A;  5TR9 A;  3PA1 A;  1EFT A;  5EMN A;  3MHP A;  1WDT A;  2DY1 A;  2DYI A;  3A1P A;  1OB0 A;  4DQL A;  4X05 A;  4EH1 A;  4MYU A;  1KK2 A;  4P9S A;  3CCE B;  1QVF B;  2ZBU A;  1KZL A;  4F7D A;  3HAG A;  5J35 A;  1EFR A;  4WZK A;  5B6I A;  3CP8 A;  4Z4T A;  3WBK A;  5HZA A;  3OAA A;  5H5J A;  1DDI A;  5TY0 A;  3R6J A;  3SJZ A;  5JBQ A;  2JN9 A;  3WYA A;  3ZZT A;  1XFO A;  3ISX A;  4M1K A;  1VQ8 B;  2R6H A;  4X07 A;  4JMQ A;  1KC8 D;  3AST A;  1E3Z A;  3A3B A;  1Q81 D;  4HE6 A;  2BN4 A;  1CNF A;  3T56 B;  1NJI D;  3ZZU A;  2VBU A;  4X0C A;  1W0K A;  2DCU A;  3ZBU A;  3GIR A;  2C5B A;  2DIE A;  3OJW A;  3LO8 A;  3CB4 A;  3A3G A;  3ZIA A;  1JNY A;  4Z4V A;  2ZZF A;  1WP6 A;  2E1R A;  1VLY A;  4YXW A;  1QFZ A;  1IB0 A;  4RD1 A;  2ZL6 A;  1DDG A;  1NDH A;  4MYT A;  5DS0 A;  2BSA A;  2YWE A;  4RM0 A;  2X6W A;  4RD4 A;  3ZPN A;  1WSV A;  3W5U A;  3FPP A;  3Q3A A;  1XE1 A;  3B82 A;  4M0L A;  5F4M A;  2GPJ A;  4DQK A;  1KK0 A;  2X8K A;  3E1Y E;  5A8A A;  2OTJ B;  1QGZ A;  2M5S A;  4UZF A;  2X53 S;  3CCV B;  3OZU A;  2RC6 A;  1RQR A;  4ROX A;  4XR6 A;  1AIP A;  5IK2 A;  4QHY A;  2NV4 A;  3QFT A;  1U2R A;  1NB0 A;  3W2E A;  5KW9 A;  1WOP A;  4FK8 A;  5IYW A;  1VQ4 B;  1WOR A;  2VNH A;  3W5H A;  4AF6 A;  1R5O A;  1MRZ A;  2C77 A;  2CC2 A;  5FA6 A;  4U9U A;  3PA2 A;  4XLE A;  4YHB A;  1VHE A;  4M4S A;  1I8D A;  4RLZ A;  2X6Y A;  4RPB A;  4LBW A;  1RQP A;  3NE5 B;  1KQS B;  4TMW A;  1WTH D;  4WZL A;  5L46 A;  2ZIT A;  4TN1 A;  1VQ6 B;  2RC5 A;  4B4D A;  4QV2 A;  1KK1 A;  2D3N A;  1ZUN B;  2J7K A;  5IYR A;  3ZBT A;  2GK7 A;  1R5B A;  4YAO A;  3OW2 B;  2QE7 A;  5LMZ A;  4OPS A;  4XN0 A;  5J3O A;  3QFR A;  3OE7 A;  2BM0 A;  3GVL A;  5HKK A;  1YIT B;  3AVU A;  5IYP A;  1V5V A;  1NBM A;  3GVK A;  5FNZ A;  3CCU B;  1P4M A;  3BY1 A;  3CCS B;  5TV2 A;  2OBT A;  2OYN A;  4XLF A;  2HDN B;  4DNT B;  4Z4U A;  4YAU A;  1T6X A;  1E1R A;  1VQL B;  3OKX A;  1Q82 D;  4B44 A;  4B3G A;  1OGI A;  4UAJ A;  1BJK A;  1J9Z A;  2CBX A;  4X7D A;  2JJ2 A;  4TMT A;  1TTT A;  4OP7 A;  1G7C A;  1UD8 A;  1PJ5 A;  2W6J A;  2ZBV A;  3B8H A;  2PMD A;  4XLA A;  2VBS A;  3CMA B;  1W2B B;  1ELO A;  1Q86 D;  1WU8 A;  4C43 A;  1QX4 A;  5HZB A;  1UD2 A;  3E20 A;  2C4T A;  1R5N A;  2X85 A;  1ZM3 A;  3D26 A;  3DDY A;  4PC3 A;  2QA4 B;  5AN9 A;  2F4N A;  2Q6K A;  4XKV A;  2NPF A;  1UMK A;  1OB2 A;  2CK3 A;  3BQJ A;  4KKU A;  1N08 A;  1W9X A;  3CTA A;  4YAW A;  4ZCL A;  3CD6 B;  3CCR B;  1H42 A;  2B7B A;  1IJF A;  5GV7 A;  1YJW B;  4ACB A;  1D1N A;  3KEW A;  2HLD A;  3Q6Q A;  4P2N A;  3OEH A;  4X06 A;  3V76 A;  1VHO A;  2C5H A;  1YX2 A;  2Q6L A;  2Q6I A;  4IW3 B;  4XL9 A;  4DK0 A;  3J81 k;  3QE2 A;  3AVX A;  2ZL7 A;  4X8I A;  2WZN A;  2OK8 A;  3G4S B;  2B7C A;  3LNN A;  4PC2 A;  3BNW A;  2C2W A;  4PAB A;  4CQJ A;  4G7W A;  2KVO A;  1FNC A;  4TSF A;  4XON A;  1GAW A;  4RDJ A;  1YHQ B;  4PC7 A;  5F4J A;  4ZGQ B;  2WSS A;  3CC4 B;  4LBY A;  3BCF A;  2AHO A;  3FKS A;  1G7S A;  4WWV A;  2V7X A;  1N8R D;  4WZT A;  4Z4R A;  4PC1 A;  2WR8 A;  2CRV A;  3ASR A;  1FNB A;  4N3G A;  3WBJ A;  1YLO A;  1G7T A;  2Q6O A;  1HZE A;  2PLF A;  4B48 A;  4K1X A;  4RD6 A;  3GSI A;  2XOK A;  1UD6 A;  4YEJ A;  3I56 B;  3U6B A;  2BV3 A;  3VMF A;  1IHM A;  2VBT A;  3W2I A;  4X7F A;  2CND A;  4KKT A;  4RJL A;  3VNV A;  4B3X A;  3SLD A;  3CES A;  4GQN A;  3VR6 A;  1CNE A;  1PJ7 A;  1VJS A;  4ZV4 A;  3LQE A;  2OK7 A;  5H59 A;  1M1K D;  3MMP A;  3AGQ A;  2JIZ A;  4RD3 A;  2XND A;  1KJZ A;  3W2G A;  1VQO B;  2D9R A;  3CCL B;  2V7U A;  1VLO A;  4Y9R A;  1KD1 D;  3GQB A;  1K8A D;  1EXM A;  2QGG A;  4UZE A;  1WOS A;  4M53 A;  4TKO B;  3RY8 A;  1UD4 A;  1VQP B;  3SKB A;  4G7X A;  3OW7 A;  1VQM B;  4H9G A;  1T5E A;  4QUZ A;  4NNJ A;  1FND A;  3CPW B;  4NCN A;  3AVT A;  1JB9 A;  5GV8 A;  4Y9U A;  1QUE A;  5FL7 A;  4PGO A;  2V7T A;  1FX0 A;  1KRH A;  2XNC A;  1KMH A;  1OHH A;  4TMX A;  2BVN A;  2GJK A;  2YWF A;  1B2R A;  2C4U A;  3QFC A;  4N3N A;  3G05 A;  3ONU A;  5F4O A;  1D2E A;  1N05 A;  2B5O A;  4Z4W A;  3KL9 A;  4RCY A;  3OOC A;  4PC6 A;  4OOV A;  4QVJ A;  1NRK A;  1EFC A;  3Q6R A;  4XLH A;  2VNJ A;  1OGJ A;  1F20 A;  4P6Y A;  1ZM2 A;  1A8P A;  2ZTG A;  4XOT A;  3SEJ A;  3BY2 A;  4WQM A;  4J0Q A;  1K28 D;  1TUI A;  4P1V A;  1KTV A;  3CCM B;  1DG1 G;  2QMU A;  4QFM A;  4NBS A;  4XQF A;  3T51 B;  2BM1 A;  1SKY B;  2DET A;  1NB9 A;  2WYR A;  3CW2 A;  2OTL B;  1GR1 A;  2D74 A;  5TRD A;  2EFG A;  1S72 B;  3P26 A;  2BGI A;  4ZCM A;  1HVX A;  3R6K A;  4Z4Y A;  2X6X A;  4YAL A;  3I55 B;  1DAR A;  1UD5 A;  2ZL5 A;  4B47 A;  3G6E B;  1GAQ A;  1HA3 A;  3CME B;  2QTZ A;  4XD7 A;  2CF4 A;  1Y0Y A; 
#chains in the Genus database with same CATH homology
 1JA1 A;  1W35 A;  1YI2 B;  3VO2 A;  1K73 D;  4P6V F;  1EP3 B;  1YJN B;  1G7R A;  5KSW B;  3CC2 B;  1JA0 A;  2QN6 A;  1QUF A;  2EIX A;  4C0S A;  3U6K A;  3ZZ0 A;  2BMW A;  4AC9 A;  1K9M D;  3W2H A;  4FN5 A;  5DSZ A;  4RD0 A;  4Y7C A;  2VNK A;  3WY9 A;  1SM4 A;  4TMZ A;  1FNM A;  3QSY A;  5THX A;  1VQ5 B;  1E62 A;  2BF4 A;  1TLL A;  4ZGN B;  1N0U A;  1EP1 B;  1JJ2 B;  4RD2 A;  3AGP A;  3OJX A;  3JQQ A;  3WNB A;  2HCJ B;  3B78 A;  1QG0 A;  4B43 A;  3FJO A;  2VNI A;  1Q7Y D;  3MCA A;  3VO1 A;  4AF7 A;  1VQN B;  2X3U A;  3ZC3 A;  1EP2 B;  1M90 D;  3WND A;  2DEU A;  3I1F A;  2XEX A;  1YJ9 B;  2QDX A;  1SKQ A;  1TVC A;  1BX1 A;  2VZL A;  1E64 A;  4M2L A;  1W87 A;  1GO2 A;  1ZM4 A;  4G1V A;  2YWH A;  1N0V C;  5HXB A;  1W34 A;  4RCZ A;  1EWY A;  1BQE A;  2GQF A;  3AVY A;  2XNJ A;  2HMA A;  1H85 A;  3AVW A;  1ZM9 A;  4YAF A;  2C78 A;  1GJR A;  2QEX B;  4ACA A;  1FRQ A;  1AMO A;  4LC0 A;  1OB5 A;  1B23 P;  4P3Y A;  4LBV A;  3CCJ B;  4G5G A;  2VYQ A;  1YIJ B;  1QFJ A;  1VQ7 B;  3CCQ B;  1E63 A;  4G1B A;  4LBZ A;  2YWG A;  3OZV A;  1EFU A;  1VQ9 B;  1QFY A;  4Q7J B;  4FWT A;  1F60 A;  2FX3 A;  3JQP A;  3P27 A;  1S0U A;  3ES9 A;  4TMV A;  3WXM A;  2DER A;  4BPR A;  2QTL A;  2BPO A;  1I7P A;  2PIA A;  1IJE A;  3CXC B;  1BX0 A;  1QGA A;  3LVB A;  4HE5 A;  1XB2 A;  3QFS A;  3W2F A;  1QVG B;  3G71 B;  1CQX A;  3FPK A;  4R71 A;  1GVH A;  1KK3 A;  1QH0 A;  3CRZ A;  3OZW A;  3VNU A;  1VQK B;  3AVV A;  3WNC A;  3U2Q A;  3CC7 B;  3W5V A;  1FRN A;  4ZCI A;  1FDR A;  1QGY A;  3JQR A;  2BGJ A;  3PEN A;  1D8T A;  5TR9 A;  5EMN A;  1EFT A;  3MHP A;  1WDT A;  2DY1 A;  4DQL A;  4EH1 A;  4MYU A;  1KK2 A;  3CCE B;  1QVF B;  4F7D A;  3WBK A;  5H5J A;  1DDI A;  5TY0 A;  5JBQ A;  3SJZ A;  3WYA A;  3ZZT A;  4M1K A;  1VQ8 B;  2R6H A;  1KC8 D;  1Q81 D;  4HE6 A;  2BN4 A;  1CNF A;  1NJI D;  3ZZU A;  2DCU A;  3ZBU A;  3OJW A;  3LO8 A;  3CB4 A;  1JNY A;  2E1R A;  1QFZ A;  1IB0 A;  4RD1 A;  1DDG A;  1NDH A;  4MYT A;  2BSA A;  2YWE A;  4RD4 A;  3W5U A;  3B82 A;  4M0L A;  1XE1 A;  2GPJ A;  4DQK A;  1KK0 A;  3E1Y E;  2OTJ B;  1QGZ A;  3CCV B;  3OZU A;  2RC6 A;  1AIP A;  4QHY A;  3QFT A;  1U2R A;  3W2E A;  1VQ4 B;  4FK8 A;  2VNH A;  3W5H A;  4AF6 A;  1R5O A;  2C77 A;  5FA6 A;  4U9U A;  4YHB A;  4M4S A;  4LBW A;  1KQS B;  4TMW A;  2ZIT A;  4TN1 A;  1VQ6 B;  2RC5 A;  4B4D A;  1KK1 A;  2J7K A;  1ZUN B;  3ZBT A;  1R5B A;  4YAO A;  3OW2 B;  3QFR A;  2BM0 A;  1YIT B;  3AVU A;  3CCU B;  3CCS B;  5TV2 A;  2HDN B;  4YAU A;  1VQL B;  1Q82 D;  4B44 A;  1OGI A;  4UAJ A;  1BJK A;  1J9Z A;  4TMT A;  1TTT A;  1G7C A;  1W2B B;  3B8H A;  2PMD A;  1ELO A;  1Q86 D;  4C43 A;  1QX4 A;  3E20 A;  1R5N A;  1ZM3 A;  4PC3 A;  2QA4 B;  5AN9 A;  2NPF A;  1UMK A;  1OB2 A;  4YAW A;  4ZCL A;  3CD6 B;  3CCR B;  1H42 A;  2B7B A;  1IJF A;  5GV7 A;  1YJW B;  4ACB A;  1D1N A;  3V76 A;  3J81 k;  4IW3 B;  3QE2 A;  3AVX A;  2OK8 A;  3G4S B;  2B7C A;  4PC2 A;  1FNC A;  1GAW A;  1YHQ B;  4PC7 A;  4ZGQ B;  3CC4 B;  4LBY A;  2AHO A;  1G7S A;  1N8R D;  4PC1 A;  2CRV A;  1FNB A;  4N3G A;  3WBJ A;  1G7T A;  2PLF A;  4B48 A;  4K1X A;  4RD6 A;  3I56 B;  3U6B A;  2BV3 A;  3VMF A;  3W2I A;  2CND A;  4RJL A;  3VNV A;  4B3X A;  1CNE A;  4ZV4 A;  2OK7 A;  5H59 A;  1M1K D;  3MMP A;  3AGQ A;  4RD3 A;  3W2G A;  1KJZ A;  1VQO B;  3CCL B;  4Y9R A;  1KD1 D;  1K8A D;  1EXM A;  4M53 A;  1VQP B;  1VQM B;  4H9G A;  1FND A;  3CPW B;  4NCN A;  3AVT A;  1JB9 A;  5GV8 A;  4Y9U A;  1QUE A;  4PGO A;  1KRH A;  2XNC A;  4TMX A;  2BVN A;  2YWF A;  1B2R A;  3QFC A;  4N3N A;  1D2E A;  2B5O A;  4RCY A;  4PC6 A;  1EFC A;  2VNJ A;  1OGJ A;  1F20 A;  1ZM2 A;  1A8P A;  4WQM A;  4J0Q A;  1TUI A;  1KTV A;  3CCM B;  1DG1 G;  2QMU A;  4QFM A;  4NBS A;  2BM1 A;  2DET A;  3CW2 A;  2OTL B;  1GR1 A;  2D74 A;  2EFG A;  1S72 B;  3P26 A;  2BGI A;  4ZCM A;  4YAL A;  3I55 B;  1DAR A;  4B47 A;  3G6E B;  1GAQ A;  1HA3 A;  3CME B;  2QTZ A;  3CMA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...