4ZGQB

Structure of cdc123 bound to eif2-gammadiii domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
102
Chain Sequence
LPNIYTDIEINYFLLRRLLGVKTDGQKQAKVRKLEPNEVLMVNIGSTATGARVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWRLIGWATIKKGTTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Cell division cycle protein 123
publication title Cdc123, a Cell Cycle Regulator Needed for eIF2 Assembly, Is an ATP-Grasp Protein with Unique Features.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 16
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4zgqB00
4YAFA 3WNDA 3OZUA 2EFGA 1DDGA 1XB2A 1BQEA 1QX4A 2R6HA 2VNKA 2HMAA 4YAOA 3WBKA 3CCUB 4TN1A 1EWYA 3W2GA 1TLLA 4QHYA 1GAQA 3B82A 1VQKB 1YJWB 1S72B 4ACBA 4B43A 5FA6A 3CXCB 5JBQA 1ZM4A 1VQ4B 1OB5A 1W35A 2XEXA 4TMZA 1VQ5B 1W34A 1ELOA 3SJZA 4P6VF 1IJFA 1AIPA 4M4SA 4R71A 4FWTA 3FPKA 3CCJB 1YJNB 4J0QA 4BPRA 4WQMA 3OJXA 1M1KD 5THXA 1GAWA 1E62A 2XNCA 4C43A 4PC3A 4EH1A 1D2EA 3G4SB 1EFTA 3MHPA 1F20A 3LVBA 2XNJA 5AN9A 2CNDA 1VQ7B 2VNHA 1N0VC 3CC7B 1VQ8B 1G7CA 4B44A 1GJRA 4FN5A 1JJ2B 4H9GA 3OW2B 1QVFB 2C77A 1CNEA 1ZM2A 2HCJB 1QGYA 3AVVA 1QG0A 5TV2A 4PC7A 1QUFA 4AF7A 1CQXA 2QDXA 1KC8D 3AVTA 1VQMB 2OK8A 4RD6A 3WXMA 1FNDA 2PMDA 5DSZA 2BSAA 2PIAA 1EFUA 2BGIA 1D8TA 3WNBA 1QGZA 4UAJA 4TMWA 1NDHA 4LBZA 4ZGQB 4PC1A 3CCLB 1YJ9B 1EP2B 1EP1B 4ZV4A 2DETA 1KTVA 1JA0A 2GQFA 4TMVA 4ZCMA 4TMTA 3AGPA 4G1BA 1GR1A 1QFZA 1SKQA 1JNYA 3OZVA 1K9MD 4RD4A 3W5HA 4M0LA 4TMXA 1R5BA 1E64A 2DY1A 4RD2A 1I7PA 1VQ6B 3VNUA 5GV7A 5TR9A 3FJOA 4LBVA 4Y7CA 2GPJA 3W2HA 1FRNA 1JA1A 2C78A 3CCVB 1ZM9A 3E20A 3JQPA 2OK7A 4Y9UA 1KK3A 1BJKA 1EP3B 4RD3A 1VQ9B 3WBJA 1B2RA 1Q81D 3AGQA 4NCNA 2DEUA 1W2BB 2VNJA 2QA4B 3CCRB 1TUIA 1TTTA 1ZM3A 3I56B 3CC2B 1FNBA 1YHQB 4RCYA 1J9ZA 1B23P 2YWGA 2BM0A 3OJWA 1VQNB 3QFRA 4C0SA 2DERA 4G5GA 1G7SA 3U6KA 4G1VA 2E1RA 1K8AD 1JB9A 1K73D 1QVGB 4YHBA 4N3GA 1BX0A 4P3YA 1KK1A 5H5JA 2YWEA 3JQQA 2BPOA 1F60A 3WYAA 3J81k 4Q7JB 4AF6A 1GO2A 4DQKA 4MYUA 4M1KA 4PC6A 1H42A 2OTJB 3W5VA 2BV3A 2QMUA 1D1NA 3ZC3A 4ZCLA 2QEXB 1YI2B 2HDNB 1OGIA 2B5OA 3ZZ0A 1QFYA 3G71B 1FNMA 4YAUA 2YWHA 3QE2A 2B7CA 1VQPB 1OB2A 5EMNA 1G7TA 1CNFA 3B8HA 2QN6A 4FK8A 1OGJA 2YWFA 4PGOA 4ZCIA 1KJZA 3I1FA 2J7KA 1VQLB 2VNIA 1N0UA 3E1YE 4MYTA 4B4DA 4ZGNB 2EIXA 1KD1D 4Y9RA 1E63A 4RCZA 3JQRA 3WNCA 4YAWA 2DCUA 2B7BA 1M90D 3ZZTA 1BX1A 4M2LA 1FNCA 3QSYA 3W2IA 4F7DA 3OZWA 3CC4B 1G7RA 1KK0A 1QH0A 1H85A 3MCAA 3VO2A 1Q82D 2RC6A 4M53A 3B78A 3CMEB 4PC2A 1EXMA 3PENA 4HE5A 3ES9A 4RJLA 2VZLA 1FDRA 1Q86D 3VMFA 4K1XA 2QTZA 2CRVA 2AHOA 3U2QA 3V76A 1KRHA 4DQLA 2BVNA 3VNVA 4LC0A 3MMPA 1UMKA 3AVXA 1R5OA 3AVYA 1KQSB 3P27A 1DDIA 1QGAA 1ZUNB 1U2RA 3ZBTA 3QFCA 1QFJA 5HXBA 1IB0A 4B3XA 3U6BA 4LBWA 2BN4A 3W2FA 1YITB 3LO8A 2VYQA 3I55B 4HE6A 1VQOB 2OTLB 3WY9A 3CD6B 4YALA 3ZBUA 3CCSB 1DARA 1FRQA 1AMOA 1Q7YD 1N8RD 2BMWA 3G6EB 1W87A 4RD0A 1HA3A 3W2EA 2RC5A 3CCEB 3QFSA 1SM4A 1IJEA 3P26A 1WDTA 1EFCA 2ZITA 4U9UA 3QFTA 1A8PA 2BM1A 2PLFA 2X3UA 4LBYA 4QFMA 1DG1G 2FX3A 4AC9A 3CB4A 3CPWB 4B48A 3CCQB 3CCMB 1TVCA 4N3NA 2NPFA 3AVUA 3CMAB 3CRZA 5H59A 1R5NA 1QUEA 4B47A 4IW3B 2QTLA 1YIJB 3W5UA 2BGJA 4RD1A 1XE1A 5TY0A 5KSWB 1NJID 3VO1A 1KK2A 2BF4A 3ZZUA 3CW2A 1S0UA 1GVHA 4NBSA 2D74A 4ACAA 3AVWA 5GV8A
chains in the Genus database with same CATH superfamily
4YAFA 4WZLA 3LQEA 3WNDA 1H8HA 2EFGA 1DDGA 1XB2A 3OZUA 1E79A 1RQPA 3RY8A 4P6YA 4XOPA 4P25A 4B3GA 4X07A 1BQEA 1QX4A 2R6HA 5HZAA 2VNKA 2HMAA 4YAOA 3WBKA 3CCUB 2R9VA 4KKUA 4TN1A 1EWYA 3W2GA 1N08A 4Z4RA 1TLLA 4QHYA 1GAQA 3B82A 2DYIA 1VQKB 2C2WA 2XOKA 2V4DA 1YJWB 1S72B 1K28D 4ACBA 4B43A 5FA6A 2Q6IA 1WPCA 4XKWA 3SLDA 3CXCB 3BC9A 5JBQA 1ZM4A 1VQ4B 1OB5A 1W35A 4WZKA 2XEXA 2QGGA 2WJVA 4P26A 4TMZA 1VQ5B 1W34A 4FXUA 1ELOA 3SJZA 4X7EA 2WZNA 3R6KA 4P6VF 1WORA 3ONYA 1IJFA 2VBSA 1AIPA 3GVKA 4M4SA 2VBTA 1COWA 4R71A 4XKVA 4FWTA 3FPKA 2C4TA 1WOPA 1VF7A 3CCJB 1YJNB 1YLOA 2Q6LA 2Z6BD 4J0QA 3G05A 5IK2A 4BPRA 3LNNA 5E6TA 4WQMA 3OJXA 4X8IA 1M1KD 4WZTA 3A8JA 5THXA 3PVDA 4X7FA 3PA2A 1MRZA 1GAWA 4TKOB 4KKSA 1E62A 2XNCA 4C43A 1YX2A 4PC3A 5FO0A 5IYWA 4EH1A 1D2EA 1E3XA 2P3MA 3G4SB 1EFTA 1WSVA 3MHPA 1F20A 4RDKA 3JU4A 1VLOA 3LVBA 2XNJA 5AN9A 4AVZA 2CNDA 1VQ7B 2VNHA 2DIEA 2WZPP 1N0VC 2ZL5A 1E43A 1E1RA 4XLAA 1I18A 2Q6OA 3ASTA 2XZOA 3CC7B 1VQ8B 1G7CA 2KVOA 1GJRA 4FN5A 1KZLA 4B44A 5IYQA 1JJ2B 4H9GA 4X0CA 3OW2B 1QVFB 4P1VA 2C77A 1CNEA 1ZM2A 2HCJB 1QGYA 4Z4WA 3AVVA 1QG0A 5TV2A 3SJPA 4PC7A 1QUFA 2WSSA 3BNWA 2DOGA 4AF7A 1CQXA 2QDXA 4P9SA 3WQZA 1KC8D 3AVTA 1VQMB 4OPVA 1V5VA 2OK8A 3ONUA 4RD6A 4XOTA 4II2A 3WXMA 2D9RA 1FNDA 2PMDA 3ASRA 5DSZA 2X85A 2BSAA 2PIAA 1EFUA 2BGIA 2ZBUA 1D8TA 2JJ2A 3WNBA 1QGZA 1WU8A 4UAJA 2GJPA 4TMWA 1NDHA 4LBZA 4ZGQB 4PC1A 4OOXA 3CCLB 3ASSA 1RQRA 3Q38A 3Q6RA 1EP2B 1EP1B 1YJ9B 2WYRA 2OYNA 5CDFA 4ZV4A 2DETA 4XLEA 1KTVA 1JA0A 2V7TA 2GQFA 4OOVA 4TMVA 1S4MA 4QVAA 4ZCMA 1NRKA 1UD6A 4X05A 3ASQA 3CPXA 4TMTA 5HKKA 3AGPA 4G1BA 1GR1A 3FKSA 1QFZA 1SKQA 1JNYA 4L8JA 3OZVA 1VHEA 1K9MD 2ZL7A 3GQBA 1V0EA 4RD4A 3BCFA 3W5HA 4M0LA 3OOCA 1HZEA 4TMXA 1R5BA 3OEEA 1E64A 2DY1A 3BY2A 4RD2A 1I7PA 5TRDA 2D3NA 1UD2A 2GJKA 2ZZFA 4P22A 2D3LA 5B6IA 1VQ6B 3VNUA 3NE5B 5GV7A 5TR9A 3FJOA 1Q9SA 4LBVA 4Y7CA 3PA1A 3CP8A 2ZXIA 2GPJA 5DN6A 3W2HA 1N07A 3OW7A 3KEWA 1FRNA 2GK6A 1VJSA 3ZUGA 1JA1A 2C78A 3CCVB 1WTHD 4DK1A 3OAAA 1OB0A 1ZM9A 3Q3AA 3E20A 2VBUA 3GVLA 3JQPA 1WSRA 2OK7A 1HVXA 4WWVA 2X6XA 4Z4YA 4Y9UA 2VBVA 5F4MA 1KK3A 3SKBA 1BJKA 1EP3B 4XN3A 4RD3A 4G7XA 1VQ9B 3WBJA 1B2RA 1Q81D 3AGQA 2ZBVA 3OE7A 4NCNA 2DEUA 5F4OA 3KL9A 3ZIAA 1W2BB 3GSIA 2V7QA 4XM3A 5HZBA 2VNJA 4Z4UA 4XQFA 2QA4B 3CCRB 1TUIA 1TTTA 1ZM3A 3I56B 3CC2B 3CP2A 1FNBA 2X6WA 1YHQB 3OP1A 4RCYA 1J9ZA 1B23P 2YWGA 2BM0A 4RM0A 2X8KA 3OJWA 1VQNB 1PJ7A 2QE7A 3QFRA 4UZFA 4C0SA 1UD3A 2DERA 3A1PA 2V7WA 4G5GA 1G7SA 3U6KA 4G1VA 4PABA 4XD7A 2E1RA 4XLHA 1JB9A 1WP6A 4XORA 1K73D 1K8AD 1SKYB 1QVGB 1PJ5A 2ZXHA 4YHBA 4N3GA 1BX0A 4P3YA 1KK1A 5H5JA 2YWEA 3FPPA 4OP7A 3JQQA 4QUZA 1W9XA 2BPOA 1F60A 3WYAA 3VR6A 3J81k 1KMHA 4Q7JB 4AF6A 1GO2A 2OBRA 1V0FA 3GVJA 4MYUA 4RLZA 4DQKA 4M1KA 4PC6A 1H42A 4TT3A 2OTJB 3W5VA 2BV3A 3ISXA 4B3FX 4RDJA 2QMUA 2CK3A 3H94A 4XMYA 2GREA 1E1QA 1D1NA 3ZC3A 2I1LA 4ZCLA 1NB9A 2F1MA 2V7UA 2LZJA 2QEXB 2WR8A 2VJJA 3BY1A 3OKXA 1YI2B 2X53S 2HDNB 1T6XA 1OGIA 2B5OA 2FVGA 4HIZA 4PAAA 3ZZ0A 2CF4A 4RDLA 3Q6QA 1QFYA 3G71B 1FNMA 4YAUA 5KNLA 5IYNA 2YWHA 3D26A 3ZPNA 3PUNA 3QE2A 4CQJA 2B7CA 2CC2A 1VQPB 2ZZGA 5L46A 1OB2A 5EMNA 1XFOA 1G7TA 1CNFA 3B8HA 4Z4SA 2QN6A 3CESA 4FK8A 3R6JA 1OGJA 2JN9A 2X6YA 2YWFA 4PGOA 4XLCA 1KJZA 1N06A 4ZCIA 2ZTNA 3I1FA 2J7KA 1VQLB 2VJIA 2VNIA 1N0UA 3A8KA 2CBXA 1N05A 3PUMA 3DDYA 3E1YE 3SLNA 3A8IA 1NB0A 2ZZQA 4G7WA 2EIXA 4MYTA 4B4DA 4ZGNB 1WOSA 1KD1D 4Y9RA 5IYPA 1OHHA 1E63A 4RCZA 2XGJA 3OFNA 4GQNA 3JQRA 4XNFA 2ZL6A 5FO1A 4X06A 3WNCA 4YAWA 2DCUA 2X0KA 2B7BA 5F4JA 1M90D 2ZTGA 3ZZTA 2Q6KA 4Z1MA 5A89A 1BX1A 4M2LA 5FL7A 2JIZA 4X7CA 1FNCA 3QSYA 3W2IA 2F4NA 4F7DA 3OZWA 4Z4VA 1G7RA 1KK0A 4YEJA 4XR6A 5LMZA 3CC4B 1QH0A 5KW9A 1H85A 3HAGA 4DNTB 3MCAA 3GIRA 3VO2A 1Q82D 1T6YA 5FIUA 2RC6A 2W6JA 3A3GA 4XLFA 1PKVA 4M53A 3B78A 1UD8A 2C5HA 4PC2A 3CMEB 1EXMA 2JDIA 5IYRA 3PENA 4HE5A 3ES9A 3BQJA 4RJLA 5DS0A 2VZLA 1PJ6A 1FDRA 4X7DA 1Q86D 3BCDA 3VMFA 4TSFA 2XZLA 3CMMA 2XNDA 4K1XA 2QTZA 2CRVA 2F1LA 1W0JA 2AHOA 2V7VA 4P12A 3CTAA 3U2QA 4JMQA 3H9NA 4ASUA 4YELA 1KRHA 3V76A 5A88A 2NV4A 4DQLA 3OPOA 2GK7A 2BVNA 4ROXA 4UZUA 3VNVA 2F43A 4RPDA 4LC0A 3MMPA 1UMKA 3AVXA 5BSXA 1R5OA 2HLDA 3AVYA 2V7XA 1MABA 4QVJA 2WJYA 4XONA 1BLIA 1KQSB 3P27A 1DDIA 4DNRB 1IHMA 1QGAA 1ZUNB 1EFRA 2C4UA 2PE3A 4OOSA 1U2RA 3ZBTA 3QFCA 1QFJA 5HXBA 4QV2A 1IB0A 4B3XA 3U6BA 3A3BA 4LBWA 1FX0A 4XL9A 2BN4A 2E1BA 3W2FA 5J3OA 1YITB 3LO8A 3T51B 2VYQA 3I55B 4HE6A 1VQOB 2OTLB 3WY9A 4XN0A 3CD6B 4YALA 3ASPA 3ZBUA 3CCSB 1DARA 1UD4A 1FRQA 4DK0A 2W6IA 2XZPA 1AMOA 1Q7YD 1N8RD 2BMWA 3G6EB 3Q39A 3A35A 1W87A 1E3ZA 5J35A 4RD0A 1HA3A 1W0KA 2OBSA 3W2EA 4G6IA 2RC5A 3CCEB 3QFSA 4II3A 1I8DA 4KKTA 3T56B 1SM4A 1T6ZA 4RPBA 1BPLA 5BSYA 1IJEA 3P26A 1WDTA 1EFCA 1VLYA 2ZITA 4U9UA 1XQBA 3QFTA 4WZEA 1A8PA 2BM1A 2PLFA 2X3UA 4LBYA 4QFMA 1DG1G 1P4MA 2FX3A 2JJ1A 4AC9A 2GJRA 3CB4A 3OEHA 3CPWB 2M5SA 2WPDA 2ZZEA 4B48A 3CCQB 3CCMB 1TVCA 2C5BA 4N3NA 1Y0RA 2OBTA 2NPFA 4OPSA 3AVUA 4UZEA 3SEJA 3CMAB 5FNZA 2CW5A 3CRZA 5H59A 5A8AA 1NBMA 1R5NA 1QUEA 1WOOA 4B47A 4IW3B 3T53B 1BMFA 3V7AA 1UD5A 4YXWA 2QTLA 4Z4ZA 4NNJA 1Y0YA 4P3IA 1H8EA 2BGJA 3W5UA 4RD1A 4E0FA 1YIJB 3BH4A 4OPOA 1XE1A 5TY0A 5KSWB 1NJID 3VO1A 1KK2A 2BF4A 3ZZUA 1VHOA 2V31A 3CW2A 1S0UA 1GVHA 4NBSA 2D74A 4Z4TA 4ACAA 3AVWA 3LQ6A 5GV8A 4P2NA 1T5EA
chains in the Genus database with same CATH topology
4YAFA 3WNDA 3OZUA 2EFGA 1DDGA 1XB2A 1BQEA 1QX4A 2R6HA 2VNKA 2HMAA 4YAOA 3WBKA 3CCUB 4TN1A 1EWYA 3W2GA 1TLLA 4QHYA 1GAQA 3B82A 1VQKB 1YJWB 1S72B 4ACBA 4B43A 5FA6A 3CXCB 5JBQA 1ZM4A 1VQ4B 1OB5A 1W35A 2XEXA 4TMZA 1VQ5B 1W34A 1ELOA 3SJZA 4P6VF 1IJFA 1AIPA 4M4SA 4R71A 4FWTA 3FPKA 3CCJB 1YJNB 4J0QA 4BPRA 4WQMA 3OJXA 1M1KD 5THXA 1GAWA 1E62A 2XNCA 4C43A 4PC3A 4EH1A 1D2EA 3G4SB 1EFTA 3MHPA 1F20A 3LVBA 2XNJA 5AN9A 2CNDA 1VQ7B 2VNHA 1N0VC 3CC7B 1VQ8B 1G7CA 4B44A 1GJRA 4FN5A 1JJ2B 4H9GA 3OW2B 1QVFB 2C77A 1CNEA 1ZM2A 2HCJB 1QGYA 3AVVA 1QG0A 5TV2A 4PC7A 1QUFA 4AF7A 1CQXA 2QDXA 1KC8D 3AVTA 1VQMB 2OK8A 4RD6A 3WXMA 1FNDA 2PMDA 5DSZA 2BSAA 2PIAA 1EFUA 2BGIA 1D8TA 3WNBA 1QGZA 4UAJA 4TMWA 1NDHA 4LBZA 4ZGQB 4PC1A 3CCLB 1YJ9B 1EP2B 1EP1B 4ZV4A 2DETA 1KTVA 1JA0A 2GQFA 4TMVA 4ZCMA 4TMTA 3AGPA 4G1BA 1GR1A 1QFZA 1SKQA 1JNYA 3OZVA 1K9MD 4RD4A 3W5HA 4M0LA 4TMXA 1R5BA 1E64A 2DY1A 4RD2A 1I7PA 1VQ6B 3VNUA 5GV7A 5TR9A 3FJOA 4LBVA 4Y7CA 2GPJA 3W2HA 1FRNA 1JA1A 2C78A 3CCVB 1ZM9A 3E20A 3JQPA 2OK7A 4Y9UA 1KK3A 1BJKA 1EP3B 4RD3A 1VQ9B 3WBJA 1B2RA 1Q81D 3AGQA 4NCNA 2DEUA 1W2BB 2VNJA 2QA4B 3CCRB 1TUIA 1TTTA 1ZM3A 3I56B 3CC2B 1FNBA 1YHQB 4RCYA 1J9ZA 1B23P 2YWGA 2BM0A 3OJWA 1VQNB 3QFRA 4C0SA 2DERA 4G5GA 1G7SA 3U6KA 4G1VA 2E1RA 1K8AD 1JB9A 1K73D 1QVGB 4YHBA 4N3GA 1BX0A 4P3YA 1KK1A 5H5JA 2YWEA 3JQQA 2BPOA 1F60A 3WYAA 3J81k 4Q7JB 4AF6A 1GO2A 4DQKA 4MYUA 4M1KA 4PC6A 1H42A 2OTJB 3W5VA 2BV3A 2QMUA 1D1NA 3ZC3A 4ZCLA 2QEXB 1YI2B 2HDNB 1OGIA 2B5OA 3ZZ0A 1QFYA 3G71B 1FNMA 4YAUA 2YWHA 3QE2A 2B7CA 1VQPB 1OB2A 5EMNA 1G7TA 1CNFA 3B8HA 2QN6A 4FK8A 1OGJA 2YWFA 4PGOA 4ZCIA 1KJZA 3I1FA 2J7KA 1VQLB 2VNIA 1N0UA 3E1YE 4MYTA 4B4DA 4ZGNB 2EIXA 1KD1D 4Y9RA 1E63A 4RCZA 3JQRA 3WNCA 4YAWA 2DCUA 2B7BA 1M90D 3ZZTA 1BX1A 4M2LA 1FNCA 3QSYA 3W2IA 4F7DA 3OZWA 3CC4B 1G7RA 1KK0A 1QH0A 1H85A 3MCAA 3VO2A 1Q82D 2RC6A 4M53A 3B78A 3CMEB 4PC2A 1EXMA 3PENA 4HE5A 3ES9A 4RJLA 2VZLA 1FDRA 1Q86D 3VMFA 4K1XA 2QTZA 2CRVA 2AHOA 3U2QA 3V76A 1KRHA 4DQLA 2BVNA 3VNVA 4LC0A 3MMPA 1UMKA 3AVXA 1R5OA 3AVYA 1KQSB 3P27A 1DDIA 1QGAA 1ZUNB 1U2RA 3ZBTA 3QFCA 1QFJA 5HXBA 1IB0A 4B3XA 3U6BA 4LBWA 2BN4A 3W2FA 1YITB 3LO8A 2VYQA 3I55B 4HE6A 1VQOB 2OTLB 3WY9A 3CD6B 4YALA 3ZBUA 3CCSB 1DARA 1FRQA 1AMOA 1Q7YD 1N8RD 2BMWA 3G6EB 1W87A 4RD0A 1HA3A 3W2EA 2RC5A 3CCEB 3QFSA 1SM4A 1IJEA 3P26A 1WDTA 1EFCA 2ZITA 4U9UA 3QFTA 1A8PA 2BM1A 2PLFA 2X3UA 4LBYA 4QFMA 1DG1G 2FX3A 4AC9A 3CB4A 3CPWB 4B48A 3CCQB 3CCMB 1TVCA 4N3NA 2NPFA 3AVUA 3CMAB 3CRZA 5H59A 1R5NA 1QUEA 4B47A 4IW3B 2QTLA 1YIJB 3W5UA 2BGJA 4RD1A 1XE1A 5TY0A 5KSWB 1NJID 3VO1A 1KK2A 2BF4A 3ZZUA 3CW2A 1S0UA 1GVHA 4NBSA 2D74A 4ACAA 3AVWA 5GV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAF A;  3WND A;  3OZU A;  2EFG A;  1DDG A;  1XB2 A;  1BQE A;  1QX4 A;  2R6H A;  2VNK A;  2HMA A;  4YAO A;  3WBK A;  3CCU B;  4TN1 A;  1EWY A;  3W2G A;  1TLL A;  4QHY A;  1GAQ A;  3B82 A;  1VQK B;  1YJW B;  1S72 B;  4ACB A;  4B43 A;  5FA6 A;  3CXC B;  5JBQ A;  1ZM4 A;  1VQ4 B;  1OB5 A;  1W35 A;  2XEX A;  4TMZ A;  1VQ5 B;  1W34 A;  1ELO A;  3SJZ A;  4P6V F;  1IJF A;  1AIP A;  4M4S A;  4R71 A;  4FWT A;  3FPK A;  3CCJ B;  1YJN B;  4J0Q A;  4BPR A;  4WQM A;  3OJX A;  1M1K D;  5THX A;  1GAW A;  1E62 A;  2XNC A;  4C43 A;  4PC3 A;  4EH1 A;  1D2E A;  3G4S B;  1EFT A;  3MHP A;  1F20 A;  3LVB A;  2XNJ A;  5AN9 A;  2CND A;  1VQ7 B;  2VNH A;  1N0V C;  3CC7 B;  1VQ8 B;  1G7C A;  4B44 A;  1GJR A;  4FN5 A;  1JJ2 B;  4H9G A;  3OW2 B;  1QVF B;  2C77 A;  1CNE A;  1ZM2 A;  2HCJ B;  1QGY A;  3AVV A;  1QG0 A;  5TV2 A;  4PC7 A;  1QUF A;  4AF7 A;  1CQX A;  2QDX A;  1KC8 D;  3AVT A;  1VQM B;  2OK8 A;  4RD6 A;  3WXM A;  1FND A;  2PMD A;  5DSZ A;  2BSA A;  2PIA A;  1EFU A;  2BGI A;  1D8T A;  3WNB A;  1QGZ A;  4UAJ A;  4TMW A;  1NDH A;  4LBZ A;  4ZGQ B;  4PC1 A;  3CCL B;  1YJ9 B;  1EP2 B;  1EP1 B;  4ZV4 A;  2DET A;  1KTV A;  1JA0 A;  2GQF A;  4TMV A;  4ZCM A;  4TMT A;  3AGP A;  4G1B A;  1GR1 A;  1QFZ A;  1SKQ A;  1JNY A;  3OZV A;  1K9M D;  4RD4 A;  3W5H A;  4M0L A;  4TMX A;  1R5B A;  1E64 A;  2DY1 A;  4RD2 A;  1I7P A;  1VQ6 B;  3VNU A;  5GV7 A;  5TR9 A;  3FJO A;  4LBV A;  4Y7C A;  2GPJ A;  3W2H A;  1FRN A;  1JA1 A;  2C78 A;  3CCV B;  1ZM9 A;  3E20 A;  3JQP A;  2OK7 A;  4Y9U A;  1KK3 A;  1BJK A;  1EP3 B;  4RD3 A;  1VQ9 B;  3WBJ A;  1B2R A;  1Q81 D;  3AGQ A;  4NCN A;  2DEU A;  1W2B B;  2VNJ A;  2QA4 B;  3CCR B;  1TUI A;  1TTT A;  1ZM3 A;  3I56 B;  3CC2 B;  1FNB A;  1YHQ B;  4RCY A;  1J9Z A;  1B23 P;  2YWG A;  2BM0 A;  3OJW A;  1VQN B;  3QFR A;  4C0S A;  2DER A;  4G5G A;  1G7S A;  3U6K A;  4G1V A;  2E1R A;  1K8A D;  1JB9 A;  1K73 D;  1QVG B;  4YHB A;  4N3G A;  1BX0 A;  4P3Y A;  1KK1 A;  5H5J A;  2YWE A;  3JQQ A;  2BPO A;  1F60 A;  3WYA A;  3J81 k;  4Q7J B;  4AF6 A;  1GO2 A;  4DQK A;  4MYU A;  4M1K A;  4PC6 A;  1H42 A;  2OTJ B;  3W5V A;  2BV3 A;  2QMU A;  1D1N A;  3ZC3 A;  4ZCL A;  2QEX B;  1YI2 B;  2HDN B;  1OGI A;  2B5O A;  3ZZ0 A;  1QFY A;  3G71 B;  1FNM A;  4YAU A;  2YWH A;  3QE2 A;  2B7C A;  1VQP B;  1OB2 A;  5EMN A;  1G7T A;  1CNF A;  3B8H A;  2QN6 A;  4FK8 A;  1OGJ A;  2YWF A;  4PGO A;  4ZCI A;  1KJZ A;  3I1F A;  2J7K A;  1VQL B;  2VNI A;  1N0U A;  3E1Y E;  4MYT A;  4B4D A;  4ZGN B;  2EIX A;  1KD1 D;  4Y9R A;  1E63 A;  4RCZ A;  3JQR A;  3WNC A;  4YAW A;  2DCU A;  2B7B A;  1M90 D;  3ZZT A;  1BX1 A;  4M2L A;  1FNC A;  3QSY A;  3W2I A;  4F7D A;  3OZW A;  3CC4 B;  1G7R A;  1KK0 A;  1QH0 A;  1H85 A;  3MCA A;  3VO2 A;  1Q82 D;  2RC6 A;  4M53 A;  3B78 A;  3CME B;  4PC2 A;  1EXM A;  3PEN A;  4HE5 A;  3ES9 A;  4RJL A;  2VZL A;  1FDR A;  1Q86 D;  3VMF A;  4K1X A;  2QTZ A;  2CRV A;  2AHO A;  3U2Q A;  3V76 A;  1KRH A;  4DQL A;  2BVN A;  3VNV A;  4LC0 A;  3MMP A;  1UMK A;  3AVX A;  1R5O A;  3AVY A;  1KQS B;  3P27 A;  1DDI A;  1QGA A;  1ZUN B;  1U2R A;  3ZBT A;  3QFC A;  1QFJ A;  5HXB A;  1IB0 A;  4B3X A;  3U6B A;  4LBW A;  2BN4 A;  3W2F A;  1YIT B;  3LO8 A;  2VYQ A;  3I55 B;  4HE6 A;  1VQO B;  2OTL B;  3WY9 A;  3CD6 B;  4YAL A;  3ZBU A;  3CCS B;  1DAR A;  1FRQ A;  1AMO A;  1Q7Y D;  1N8R D;  2BMW A;  3G6E B;  1W87 A;  4RD0 A;  1HA3 A;  3W2E A;  2RC5 A;  3CCE B;  3QFS A;  1SM4 A;  1IJE A;  3P26 A;  1WDT A;  1EFC A;  2ZIT A;  4U9U A;  3QFT A;  1A8P A;  2BM1 A;  2PLF A;  2X3U A;  4LBY A;  4QFM A;  1DG1 G;  2FX3 A;  4AC9 A;  3CB4 A;  3CPW B;  4B48 A;  3CCQ B;  3CCM B;  1TVC A;  4N3N A;  2NPF A;  3AVU A;  3CMA B;  3CRZ A;  5H59 A;  1R5N A;  1QUE A;  4B47 A;  4IW3 B;  2QTL A;  1YIJ B;  3W5U A;  2BGJ A;  4RD1 A;  1XE1 A;  5TY0 A;  5KSW B;  1NJI D;  3VO1 A;  1KK2 A;  2BF4 A;  3ZZU A;  3CW2 A;  1S0U A;  1GVH A;  4NBS A;  2D74 A;  4ACA A;  3AVW A;  5GV8 A; 
#chains in the Genus database with same CATH topology
 4YAF A;  4WZL A;  3LQE A;  3WND A;  1H8H A;  2EFG A;  1DDG A;  1XB2 A;  3OZU A;  1E79 A;  1RQP A;  3RY8 A;  4P6Y A;  4XOP A;  4P25 A;  4B3G A;  4X07 A;  1BQE A;  1QX4 A;  2R6H A;  5HZA A;  2VNK A;  2HMA A;  4YAO A;  3WBK A;  3CCU B;  2R9V A;  4KKU A;  4TN1 A;  1EWY A;  3W2G A;  1N08 A;  4Z4R A;  1TLL A;  4QHY A;  1GAQ A;  3B82 A;  2DYI A;  1VQK B;  2C2W A;  2XOK A;  2V4D A;  1YJW B;  1S72 B;  1K28 D;  4ACB A;  4B43 A;  5FA6 A;  2Q6I A;  1WPC A;  4XKW A;  3SLD A;  3CXC B;  3BC9 A;  5JBQ A;  1ZM4 A;  1VQ4 B;  1OB5 A;  1W35 A;  4WZK A;  2XEX A;  2QGG A;  2WJV A;  4P26 A;  4TMZ A;  1VQ5 B;  1W34 A;  4FXU A;  1ELO A;  3SJZ A;  4X7E A;  2WZN A;  3R6K A;  4P6V F;  1WOR A;  3ONY A;  1IJF A;  2VBS A;  1AIP A;  3GVK A;  4M4S A;  2VBT A;  1COW A;  4R71 A;  4XKV A;  4FWT A;  3FPK A;  2C4T A;  1WOP A;  1VF7 A;  3CCJ B;  1YJN B;  1YLO A;  2Q6L A;  2Z6B D;  4J0Q A;  3G05 A;  5IK2 A;  4BPR A;  3LNN A;  5E6T A;  4WQM A;  3OJX A;  4X8I A;  1M1K D;  4WZT A;  3A8J A;  5THX A;  3PVD A;  4X7F A;  3PA2 A;  1MRZ A;  1GAW A;  4TKO B;  4KKS A;  1E62 A;  2XNC A;  4C43 A;  1YX2 A;  4PC3 A;  5FO0 A;  5IYW A;  4EH1 A;  1D2E A;  1E3X A;  2P3M A;  3G4S B;  1EFT A;  1WSV A;  3MHP A;  1F20 A;  4RDK A;  3JU4 A;  1VLO A;  3LVB A;  2XNJ A;  5AN9 A;  4AVZ A;  2CND A;  1VQ7 B;  2VNH A;  2DIE A;  2WZP P;  1N0V C;  2ZL5 A;  1E43 A;  1E1R A;  4XLA A;  1I18 A;  2Q6O A;  3AST A;  2XZO A;  3CC7 B;  1VQ8 B;  1G7C A;  2KVO A;  1GJR A;  4FN5 A;  1KZL A;  4B44 A;  5IYQ A;  1JJ2 B;  4H9G A;  4X0C A;  3OW2 B;  1QVF B;  4P1V A;  2C77 A;  1CNE A;  1ZM2 A;  2HCJ B;  1QGY A;  4Z4W A;  3AVV A;  1QG0 A;  5TV2 A;  3SJP A;  4PC7 A;  1QUF A;  2WSS A;  3BNW A;  2DOG A;  4AF7 A;  1CQX A;  2QDX A;  4P9S A;  3WQZ A;  1KC8 D;  3AVT A;  1VQM B;  4OPV A;  1V5V A;  2OK8 A;  3ONU A;  4RD6 A;  4XOT A;  4II2 A;  3WXM A;  2D9R A;  1FND A;  2PMD A;  3ASR A;  5DSZ A;  2X85 A;  2BSA A;  2PIA A;  1EFU A;  2BGI A;  2ZBU A;  1D8T A;  2JJ2 A;  3WNB A;  1QGZ A;  1WU8 A;  4UAJ A;  2GJP A;  4TMW A;  1NDH A;  4LBZ A;  4ZGQ B;  4PC1 A;  4OOX A;  3CCL B;  3ASS A;  1RQR A;  3Q38 A;  3Q6R A;  1EP2 B;  1EP1 B;  1YJ9 B;  2WYR A;  2OYN A;  5CDF A;  4ZV4 A;  2DET A;  4XLE A;  1KTV A;  1JA0 A;  2V7T A;  2GQF A;  4OOV A;  4TMV A;  1S4M A;  4QVA A;  4ZCM A;  1NRK A;  1UD6 A;  4X05 A;  3ASQ A;  3CPX A;  4TMT A;  5HKK A;  3AGP A;  4G1B A;  1GR1 A;  3FKS A;  1QFZ A;  1SKQ A;  1JNY A;  4L8J A;  3OZV A;  1VHE A;  1K9M D;  2ZL7 A;  3GQB A;  1V0E A;  4RD4 A;  3BCF A;  3W5H A;  4M0L A;  3OOC A;  1HZE A;  4TMX A;  1R5B A;  3OEE A;  1E64 A;  2DY1 A;  3BY2 A;  4RD2 A;  1I7P A;  5TRD A;  2D3N A;  1UD2 A;  2GJK A;  2ZZF A;  4P22 A;  2D3L A;  5B6I A;  1VQ6 B;  3VNU A;  3NE5 B;  5GV7 A;  5TR9 A;  3FJO A;  1Q9S A;  4LBV A;  4Y7C A;  3PA1 A;  3CP8 A;  2ZXI A;  2GPJ A;  5DN6 A;  3W2H A;  1N07 A;  3OW7 A;  3KEW A;  1FRN A;  2GK6 A;  1VJS A;  3ZUG A;  1JA1 A;  2C78 A;  3CCV B;  1WTH D;  4DK1 A;  3OAA A;  1OB0 A;  1ZM9 A;  3Q3A A;  3E20 A;  2VBU A;  3GVL A;  3JQP A;  1WSR A;  2OK7 A;  1HVX A;  4WWV A;  2X6X A;  4Z4Y A;  4Y9U A;  2VBV A;  5F4M A;  1KK3 A;  3SKB A;  1BJK A;  1EP3 B;  4XN3 A;  4RD3 A;  4G7X A;  1VQ9 B;  3WBJ A;  1B2R A;  1Q81 D;  3AGQ A;  2ZBV A;  3OE7 A;  4NCN A;  2DEU A;  5F4O A;  3KL9 A;  3ZIA A;  1W2B B;  3GSI A;  2V7Q A;  4XM3 A;  5HZB A;  2VNJ A;  4Z4U A;  4XQF A;  2QA4 B;  3CCR B;  1TUI A;  1TTT A;  1ZM3 A;  3I56 B;  3CC2 B;  3CP2 A;  1FNB A;  2X6W A;  1YHQ B;  3OP1 A;  4RCY A;  1J9Z A;  1B23 P;  2YWG A;  2BM0 A;  4RM0 A;  2X8K A;  3OJW A;  1VQN B;  1PJ7 A;  2QE7 A;  3QFR A;  4UZF A;  4C0S A;  1UD3 A;  2DER A;  3A1P A;  2V7W A;  4G5G A;  1G7S A;  3U6K A;  4G1V A;  4PAB A;  4XD7 A;  2E1R A;  4XLH A;  1JB9 A;  1WP6 A;  4XOR A;  1K73 D;  1K8A D;  1SKY B;  1QVG B;  1PJ5 A;  2ZXH A;  4YHB A;  4N3G A;  1BX0 A;  4P3Y A;  1KK1 A;  5H5J A;  2YWE A;  3FPP A;  4OP7 A;  3JQQ A;  4QUZ A;  1W9X A;  2BPO A;  1F60 A;  3WYA A;  3VR6 A;  3J81 k;  1KMH A;  4Q7J B;  4AF6 A;  1GO2 A;  2OBR A;  1V0F A;  3GVJ A;  4MYU A;  4RLZ A;  4DQK A;  4M1K A;  4PC6 A;  1H42 A;  4TT3 A;  2OTJ B;  3W5V A;  2BV3 A;  3ISX A;  4B3F X;  4RDJ A;  2QMU A;  2CK3 A;  3H94 A;  4XMY A;  2GRE A;  1E1Q A;  1D1N A;  3ZC3 A;  2I1L A;  4ZCL A;  1NB9 A;  2F1M A;  2V7U A;  2LZJ A;  2QEX B;  2WR8 A;  2VJJ A;  3BY1 A;  3OKX A;  1YI2 B;  2X53 S;  2HDN B;  1T6X A;  1OGI A;  2B5O A;  2FVG A;  4HIZ A;  4PAA A;  3ZZ0 A;  2CF4 A;  4RDL A;  3Q6Q A;  1QFY A;  3G71 B;  1FNM A;  4YAU A;  5KNL A;  5IYN A;  2YWH A;  3D26 A;  3ZPN A;  3PUN A;  3QE2 A;  4CQJ A;  2B7C A;  2CC2 A;  1VQP B;  2ZZG A;  5L46 A;  1OB2 A;  5EMN A;  1XFO A;  1G7T A;  1CNF A;  3B8H A;  4Z4S A;  2QN6 A;  3CES A;  4FK8 A;  3R6J A;  1OGJ A;  2JN9 A;  2X6Y A;  2YWF A;  4PGO A;  4XLC A;  1KJZ A;  1N06 A;  4ZCI A;  2ZTN A;  3I1F A;  2J7K A;  1VQL B;  2VJI A;  2VNI A;  1N0U A;  3A8K A;  2CBX A;  1N05 A;  3PUM A;  3DDY A;  3E1Y E;  3SLN A;  3A8I A;  1NB0 A;  2ZZQ A;  4G7W A;  2EIX A;  4MYT A;  4B4D A;  4ZGN B;  1WOS A;  1KD1 D;  4Y9R A;  5IYP A;  1OHH A;  1E63 A;  4RCZ A;  2XGJ A;  3OFN A;  4GQN A;  3JQR A;  4XNF A;  2ZL6 A;  5FO1 A;  4X06 A;  3WNC A;  4YAW A;  2DCU A;  2X0K A;  2B7B A;  5F4J A;  1M90 D;  2ZTG A;  3ZZT A;  2Q6K A;  4Z1M A;  5A89 A;  1BX1 A;  4M2L A;  5FL7 A;  2JIZ A;  4X7C A;  1FNC A;  3QSY A;  3W2I A;  2F4N A;  4F7D A;  3OZW A;  4Z4V A;  1G7R A;  1KK0 A;  4YEJ A;  4XR6 A;  5LMZ A;  3CC4 B;  1QH0 A;  5KW9 A;  1H85 A;  3HAG A;  4DNT B;  3MCA A;  3GIR A;  3VO2 A;  1Q82 D;  1T6Y A;  5FIU A;  2RC6 A;  2W6J A;  3A3G A;  4XLF A;  1PKV A;  4M53 A;  3B78 A;  1UD8 A;  2C5H A;  4PC2 A;  3CME B;  1EXM A;  2JDI A;  5IYR A;  3PEN A;  4HE5 A;  3ES9 A;  3BQJ A;  4RJL A;  5DS0 A;  2VZL A;  1PJ6 A;  1FDR A;  4X7D A;  1Q86 D;  3BCD A;  3VMF A;  4TSF A;  2XZL A;  3CMM A;  2XND A;  4K1X A;  2QTZ A;  2CRV A;  2F1L A;  1W0J A;  2AHO A;  2V7V A;  4P12 A;  3CTA A;  3U2Q A;  4JMQ A;  3H9N A;  4ASU A;  4YEL A;  1KRH A;  3V76 A;  5A88 A;  2NV4 A;  4DQL A;  3OPO A;  2GK7 A;  2BVN A;  4ROX A;  4UZU A;  3VNV A;  2F43 A;  4RPD A;  4LC0 A;  3MMP A;  1UMK A;  3AVX A;  5BSX A;  1R5O A;  2HLD A;  3AVY A;  2V7X A;  1MAB A;  4QVJ A;  2WJY A;  4XON A;  1BLI A;  1KQS B;  3P27 A;  1DDI A;  4DNR B;  1IHM A;  1QGA A;  1ZUN B;  1EFR A;  2C4U A;  2PE3 A;  4OOS A;  1U2R A;  3ZBT A;  3QFC A;  1QFJ A;  5HXB A;  4QV2 A;  1IB0 A;  4B3X A;  3U6B A;  3A3B A;  4LBW A;  1FX0 A;  4XL9 A;  2BN4 A;  2E1B A;  3W2F A;  5J3O A;  1YIT B;  3LO8 A;  3T51 B;  2VYQ A;  3I55 B;  4HE6 A;  1VQO B;  2OTL B;  3WY9 A;  4XN0 A;  3CD6 B;  4YAL A;  3ASP A;  3ZBU A;  3CCS B;  1DAR A;  1UD4 A;  1FRQ A;  4DK0 A;  2W6I A;  2XZP A;  1AMO A;  1Q7Y D;  1N8R D;  2BMW A;  3G6E B;  3Q39 A;  3A35 A;  1W87 A;  1E3Z A;  5J35 A;  4RD0 A;  1HA3 A;  1W0K A;  2OBS A;  3W2E A;  4G6I A;  2RC5 A;  3CCE B;  3QFS A;  4II3 A;  1I8D A;  4KKT A;  3T56 B;  1SM4 A;  1T6Z A;  4RPB A;  1BPL A;  5BSY A;  1IJE A;  3P26 A;  1WDT A;  1EFC A;  1VLY A;  2ZIT A;  4U9U A;  1XQB A;  3QFT A;  4WZE A;  1A8P A;  2BM1 A;  2PLF A;  2X3U A;  4LBY A;  4QFM A;  1DG1 G;  1P4M A;  2FX3 A;  2JJ1 A;  4AC9 A;  2GJR A;  3CB4 A;  3OEH A;  3CPW B;  2M5S A;  2WPD A;  2ZZE A;  4B48 A;  3CCQ B;  3CCM B;  1TVC A;  2C5B A;  4N3N A;  1Y0R A;  2OBT A;  2NPF A;  4OPS A;  3AVU A;  4UZE A;  3SEJ A;  3CMA B;  5FNZ A;  2CW5 A;  3CRZ A;  5H59 A;  5A8A A;  1NBM A;  1R5N A;  1QUE A;  1WOO A;  4B47 A;  4IW3 B;  3T53 B;  1BMF A;  3V7A A;  1UD5 A;  4YXW A;  2QTL A;  4Z4Z A;  4NNJ A;  1Y0Y A;  4P3I A;  1H8E A;  2BGJ A;  3W5U A;  4RD1 A;  4E0F A;  1YIJ B;  3BH4 A;  4OPO A;  1XE1 A;  5TY0 A;  5KSW B;  1NJI D;  3VO1 A;  1KK2 A;  2BF4 A;  3ZZU A;  1VHO A;  2V31 A;  3CW2 A;  1S0U A;  1GVH A;  4NBS A;  2D74 A;  4Z4T A;  4ACA A;  3AVW A;  3LQ6 A;  5GV8 A;  4P2N A;  1T5E A; 
#chains in the Genus database with same CATH homology
 4YAF A;  3WND A;  3OZU A;  2EFG A;  1DDG A;  1XB2 A;  1BQE A;  1QX4 A;  2R6H A;  2VNK A;  2HMA A;  4YAO A;  3WBK A;  3CCU B;  4TN1 A;  1EWY A;  3W2G A;  1TLL A;  4QHY A;  1GAQ A;  3B82 A;  1VQK B;  1YJW B;  1S72 B;  4ACB A;  4B43 A;  5FA6 A;  3CXC B;  5JBQ A;  1ZM4 A;  1VQ4 B;  1OB5 A;  1W35 A;  2XEX A;  4TMZ A;  1VQ5 B;  1W34 A;  1ELO A;  3SJZ A;  4P6V F;  1IJF A;  1AIP A;  4M4S A;  4R71 A;  4FWT A;  3FPK A;  3CCJ B;  1YJN B;  4J0Q A;  4BPR A;  4WQM A;  3OJX A;  1M1K D;  5THX A;  1GAW A;  1E62 A;  2XNC A;  4C43 A;  4PC3 A;  4EH1 A;  1D2E A;  3G4S B;  1EFT A;  3MHP A;  1F20 A;  3LVB A;  2XNJ A;  5AN9 A;  2CND A;  1VQ7 B;  2VNH A;  1N0V C;  3CC7 B;  1VQ8 B;  1G7C A;  4B44 A;  1GJR A;  4FN5 A;  1JJ2 B;  4H9G A;  3OW2 B;  1QVF B;  2C77 A;  1CNE A;  1ZM2 A;  2HCJ B;  1QGY A;  3AVV A;  1QG0 A;  5TV2 A;  4PC7 A;  1QUF A;  4AF7 A;  1CQX A;  2QDX A;  1KC8 D;  3AVT A;  1VQM B;  2OK8 A;  4RD6 A;  3WXM A;  1FND A;  2PMD A;  5DSZ A;  2BSA A;  2PIA A;  1EFU A;  2BGI A;  1D8T A;  3WNB A;  1QGZ A;  4UAJ A;  4TMW A;  1NDH A;  4LBZ A;  4ZGQ B;  4PC1 A;  3CCL B;  1YJ9 B;  1EP2 B;  1EP1 B;  4ZV4 A;  2DET A;  1KTV A;  1JA0 A;  2GQF A;  4TMV A;  4ZCM A;  4TMT A;  3AGP A;  4G1B A;  1GR1 A;  1QFZ A;  1SKQ A;  1JNY A;  3OZV A;  1K9M D;  4RD4 A;  3W5H A;  4M0L A;  4TMX A;  1R5B A;  1E64 A;  2DY1 A;  4RD2 A;  1I7P A;  1VQ6 B;  3VNU A;  5GV7 A;  5TR9 A;  3FJO A;  4LBV A;  4Y7C A;  2GPJ A;  3W2H A;  1FRN A;  1JA1 A;  2C78 A;  3CCV B;  1ZM9 A;  3E20 A;  3JQP A;  2OK7 A;  4Y9U A;  1KK3 A;  1BJK A;  1EP3 B;  4RD3 A;  1VQ9 B;  3WBJ A;  1B2R A;  1Q81 D;  3AGQ A;  4NCN A;  2DEU A;  1W2B B;  2VNJ A;  2QA4 B;  3CCR B;  1TUI A;  1TTT A;  1ZM3 A;  3I56 B;  3CC2 B;  1FNB A;  1YHQ B;  4RCY A;  1J9Z A;  1B23 P;  2YWG A;  2BM0 A;  3OJW A;  1VQN B;  3QFR A;  4C0S A;  2DER A;  4G5G A;  1G7S A;  3U6K A;  4G1V A;  2E1R A;  1K8A D;  1JB9 A;  1K73 D;  1QVG B;  4YHB A;  4N3G A;  1BX0 A;  4P3Y A;  1KK1 A;  5H5J A;  2YWE A;  3JQQ A;  2BPO A;  1F60 A;  3WYA A;  3J81 k;  4Q7J B;  4AF6 A;  1GO2 A;  4DQK A;  4MYU A;  4M1K A;  4PC6 A;  1H42 A;  2OTJ B;  3W5V A;  2BV3 A;  2QMU A;  1D1N A;  3ZC3 A;  4ZCL A;  2QEX B;  1YI2 B;  2HDN B;  1OGI A;  2B5O A;  3ZZ0 A;  1QFY A;  3G71 B;  1FNM A;  4YAU A;  2YWH A;  3QE2 A;  2B7C A;  1VQP B;  1OB2 A;  5EMN A;  1G7T A;  1CNF A;  3B8H A;  2QN6 A;  4FK8 A;  1OGJ A;  2YWF A;  4PGO A;  4ZCI A;  1KJZ A;  3I1F A;  2J7K A;  1VQL B;  2VNI A;  1N0U A;  3E1Y E;  4MYT A;  4B4D A;  4ZGN B;  2EIX A;  1KD1 D;  4Y9R A;  1E63 A;  4RCZ A;  3JQR A;  3WNC A;  4YAW A;  2DCU A;  2B7B A;  1M90 D;  3ZZT A;  1BX1 A;  4M2L A;  1FNC A;  3QSY A;  3W2I A;  4F7D A;  3OZW A;  3CC4 B;  1G7R A;  1KK0 A;  1QH0 A;  1H85 A;  3MCA A;  3VO2 A;  1Q82 D;  2RC6 A;  4M53 A;  3B78 A;  3CME B;  4PC2 A;  1EXM A;  3PEN A;  4HE5 A;  3ES9 A;  4RJL A;  2VZL A;  1FDR A;  1Q86 D;  3VMF A;  4K1X A;  2QTZ A;  2CRV A;  2AHO A;  3U2Q A;  3V76 A;  1KRH A;  4DQL A;  2BVN A;  3VNV A;  4LC0 A;  3MMP A;  1UMK A;  3AVX A;  1R5O A;  3AVY A;  1KQS B;  3P27 A;  1DDI A;  1QGA A;  1ZUN B;  1U2R A;  3ZBT A;  3QFC A;  1QFJ A;  5HXB A;  1IB0 A;  4B3X A;  3U6B A;  4LBW A;  2BN4 A;  3W2F A;  1YIT B;  3LO8 A;  2VYQ A;  3I55 B;  4HE6 A;  1VQO B;  2OTL B;  3WY9 A;  3CD6 B;  4YAL A;  3ZBU A;  3CCS B;  1DAR A;  1FRQ A;  1AMO A;  1Q7Y D;  1N8R D;  2BMW A;  3G6E B;  1W87 A;  4RD0 A;  1HA3 A;  3W2E A;  2RC5 A;  3CCE B;  3QFS A;  1SM4 A;  1IJE A;  3P26 A;  1WDT A;  1EFC A;  2ZIT A;  4U9U A;  3QFT A;  1A8P A;  2BM1 A;  2PLF A;  2X3U A;  4LBY A;  4QFM A;  1DG1 G;  2FX3 A;  4AC9 A;  3CB4 A;  3CPW B;  4B48 A;  3CCQ B;  3CCM B;  1TVC A;  4N3N A;  2NPF A;  3AVU A;  3CMA B;  3CRZ A;  5H59 A;  1R5N A;  1QUE A;  4B47 A;  4IW3 B;  2QTL A;  1YIJ B;  3W5U A;  2BGJ A;  4RD1 A;  1XE1 A;  5TY0 A;  5KSW B;  1NJI D;  3VO1 A;  1KK2 A;  2BF4 A;  3ZZU A;  3CW2 A;  1S0U A;  1GVH A;  4NBS A;  2D74 A;  4ACA A;  3AVW A;  5GV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...