2QDXA

P.aeruginosa fpr with fad
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
257
structure length
257
Chain Sequence
SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLVTREPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDDRAMICGSPSMLEETSAVLDSFGLKISPRMGEPGDYLIERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin reductase
publication title Biochemical and Structural Characterization of Pseudomonas aeruginosa Bfd and FPR: Ferredoxin NADP(+) Reductase and Not Ferredoxin Is the Redox Partner of Heme Oxygenase under Iron-Starvation Conditions
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 82
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qdxA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2qdxA02
1DDGA 2GPJA 1OGIA 1J9ZA 1EFUA 2FX3A 4LBVA 3WYAA 5H59A 4BPRA 4LC0A 1QUEA 5HXBA 1K9MD 1VQKB 3W5HA 1QVFB 2QEXB 1DG1G 4ZCLA 2BGJA 1GAQA 1YJNB 3W2HA 1Q86D 4RD2A 1S0UA 2BPOA 1OB5A 2J7KA 3AVXA 4M4SA 2VNJA 3QFTA 4RD4A 4LBZA 1F60A 1TLLA 1KD1D 4LBYA 2DERA 1GO2A 3VO2A 4C43A 3AVUA 4ACBA 4B4DA 3B78A 1FNCA 3WNDA 4U9UA 1ELOA 1YJ9B 4RD0A 1NJID 1ZM4A 1QGAA 4YAFA 2HMAA 4FK8A 1CQXA 4TMTA 3ZZ0A 5EMNA 3CCEB 3QE2A 1QGYA 3W2IA 2C78A 2VYQA 3LYUA 3AVYA 1KC8D 1JA0A 2YWGA 2DETA 3CCLB 4F7DA 1QFJA 3OJXA 1JJ2B 3W2FA 4Y7CA 3MMPA 5TV2A 3CCUB 1W87A 2BGIA 1VQPB 4YALA 4ZV4A 2PMDA 4B43A 2BF4A 4B48A 1GR1A 3W2EA 1H85A 4PC1A 3VNUA 4EH1A 2VNIA 1EWYA 3W5UA 2OTLB 2VNHA 4PC2A 1HA3A 1JB9A 1FDRA 3VO1A 3E20A 1EP3B 3ZBUA 4WQMA 4YAOA 4UAJA 2RC6A 4RD3A 1VQ5B 3CB4A 5TY0A 5TR9A 2OK8A 1SKQA 3JQPA 4HE6A 4M53A 1KK0A 3VMFA 3VNVA 2EIXA 1ZM9A 4TMVA 4G1VA 2QDXA 3CCSB 1GJRA 4Q7JB 1S72B 3WXMA 3P26A 1H42A 4TMXA 4G1BA 1B23P 1YHQB 1G7RA 3SJZA 1D8TA 2B7BA 1UMKA 1QG0A 3ZZUA 5KSWB 2B5OA 1BX1A 4C0SA 1K8AD 3U6BA 1QGZA 3W5VA 1QUFA 2DCUA 1A8PA 1XB2A 1EFTA 3CC2B 1EP2B 3ZC3A 3CCQB 3JQQA 1VQLB 3ZZTA 1IJEA 4AF6A 1N8RD 1CNEA 1YIJB 4RCYA 2XEXA 2BVNA 3OZWA 3G6EB 3LVBA 1D2EA 3W2GA 3ZBTA 3E1YE 4H9GA 4QFMA 4QHYA 1KQSB 3FJOA 1OGJA 1ZM3A 2GQFA 4M1KA 2BM1A 2BN4A 1AIPA 4RD1A 3AGQA 3CXCB 3LO8A 4PC6A 4FWTA 3A1FA 3CD6B 2DY1A 1FRQA 1I7PA 1KJZA 1R5BA 4NCNA 2C77A 4P3YA 1W35A 3AVWA 3CCRB 3B8HA 4K1XA 1EP1B 1Q7YD 1GAWA 2DEUA 4FN5A 2YWHA 3CRZA 1DARA 1FRNA 4DQLA 3B82A 3QFRA 1SM4A 2QMUA 3I1FA 1KTVA 1B2RA 1E63A 4ZGNB 1FNMA 1ZM2A 4DQKA 1F20A 1M90D 1W34A 3MCAA 1ZUNB 3CC4B 2B7CA 2HDNB 1TTTA 4PGOA 1CNFA 1AMOA 1KK2A 3QFCA 2QTZA 5GV7A 1VQ7B 4YAWA 1DDIA 1G7SA 3CMEB 1IJFA 2X3UA 5FA6A 1VQOB 2AHOA 1D1NA 2NPFA 1XE1A 5GV8A 2BMWA 1N0VC 1VQ6B 1YJWB 1QFZA 3WY9A 2VZLA 4NBSA 3LRXA 3OJWA 1YI2B 2QTLA 2RC5A 1KK3A 1QH0A 3P27A 3WNCA 1N0UA 4ACAA 1EFCA 2YWFA 2EFGA 1R5NA 3WBJA 4TMZA 1BJKA 4PC7A 2VNKA 1Q82D 1K73D 4RCZA 1E62A 3WNBA 4HE5A 4B44A 1VQ8B 4MYTA 4IW3B 1QVGB 1VQNB 4AC9A 3PENA 2BV3A 5AN9A 2QN6A 4M0LA 1JA1A 4RJLA 5THXA 1VQ9B 2OTJB 4LBWA 2OK7A 2PLFA 1IB0A 1EXMA 4R71A 4YAUA 3QSYA 1FNDA 1E64A 3I56B 2CNDA 1U2RA 4J0QA 4TN1A 1QX4A 1OB2A 5H5JA 3CC7B 4ZGQB 2BM0A 1BQEA 1R5OA 2QA4B 1GVHA 4Y9UA 1WDTA 3I55B 3CW2A 2ZITA 1NDHA 4TMWA 3AVVA 4RD6A 4YHBA 5JBQA 3OW2B 3CCVB 4G5GA 4N3NA 1YITB 1M1KD 3QFSA 4ZCIA 3U6KA 2PIAA 3AGPA 3G4SB 3V76A 3CCJB 1G7TA 3OZUA 2D74A 4N3GA 5DSZA 2XNJA 3FPKA 2CRVA 1TVCA 3G71B 1BX0A 1JNYA 1VQMB 4B3XA 4Y9RA 1KK1A 3WBKA 4ZCMA 1KRHA 3MHPA 3CCMB 2XNCA 1TUIA 1Q81D 4P6VF 1G7CA 2E1RA 3J81k 1QFYA 3OZVA 3ES9A 4AF7A 4B47A 3AVTA 3CMAB 1W2BB 2HCJB 3CPWB 2YWEA 1FNBA 2R6HA 3U2QA 4MYUA 1VQ4B 2BSAA 4PC3A 3JQRA 4M2LA
chains in the Genus database with same CATH superfamily
4KI0A 2VYCA 3MF4A 1K63A 3QIAA 2FVGA 3PC4A 3Q12A 4QQRA 3WK9A 4X1IA 1RWKA 1EE1A 2VJBA 1RVDA 3PB3A 4O29A 4DWJA 5JCPA 3UK7A 2P2SA 1ABBA 5BSWA 3WYAA 1R0ZA 4A0RA 1HMYA 4LC0A 1R6TA 4HNVA 5CX1B 3C3PA 5A2QA 2VJNA 3VR1A 5CD1A 2I1VB 1ACJA 1GAEO 3HB7A 4MV0A 1RXIA 3GWGA 1XZDA 3IUEA 3MNFA 4QOJA 1M6VB 1VQKB 1NT2A 3EVEA 4Y1EA 2LGJA 1DZ3A 4YMGA 1YL5A 4O3FA 1W5AA 4RLZA 1SHJA 1SG6A 3ZWCA 2ZBRA 3B5EA 3DBLB 1X42A 4NQZA 1E8MA 1GG2A 4OQNA 1DG1G 4OXKA 3KTFA 4BWFB 2GO1A 5JNVA 5EXSA 2AZXA 4F6RB 1YQEA 1KEVA 3BAFA 4KX5A 1GKKA 2PK3A 3HCRA 2NV2B 1DINA 1JLRA 2WKRA 2OAGA 4GECA 4P53A 3T12A 3ZCPA 4E2ZA 3HWRA 2QG9A 2JIRA 4C4TA 3UMYA 3MSCA 4FFBA 4DR4B 1MDFA 1U2GA 3QJ5A 1UIRA 3GJ7A 5BRNA 4F4CA 3ZDCA 1IM5A 3IKJA 3MWFA 5EI5A 4KO8A 4AECA 2QM7A 4X8HA 2F3QA 5AJUA 5DWDA 3MCUA 2G4CA 4MWOA 2XTAA 5HS4A 1KBZA 5CM2Z 1DBVO 3R6GA 1O9HA 2O2YA 1NPDA 1VKRA 1W5EA 1KD1D 2ZI5A 4UUPA 2O8BB 13PKA 1PR0A 2EFEB 3FYSA 3O8RA 1M83A 3W8FA 1K2VN 2C98A 3ZVNA 4IS2A 3CZQA 4MRVA 4UEOA 1KZ7B 5B36A 1YS7A 4ND8A 1ZCJA 1PP4A 2V6MA 3IPRA 1K66A 1IN6A 1G5TA 2QE7A 5CB8A 1EUCA 3WIOA 3NYIA 3OMXA 2BFCA 3CVWA 1NJID 4G6ZA 4ALJA 1QOPB 4GLFA 1ZM4A 4JJAA 5F51A 4WK0B 2J85A 5JSUA 3VYTB 2EQAA 1K5HA 2J9ZB 3D3QA 1QC5B 1UMCB 4RJ2A 5BYAA 2VK2A 4U3JA 3WRWA 3A10A 2XJ4A 1E1CB 1MENA 1P4RA 3TQSA 2OZPA 2RHLA 3G05A 3BE8A 2B3DA 4PPNA 3ANTA 4YQZA 2HLHA 3ANNA 4BFXA 1DZIA 1VLHA 1ZVJA 2DT5A 4JSYA 1SD2A 2WUFA 1ISFA 1D9ZA 1Z2OX 3CBGA 3CU5A 3PD7A 2PXAA 3RRFA 3ZX5A 4EO9A 2JFPA 2JGKA 3R77A 4RZ2A 1JVNA 3A9UA 1ONPA 5KB3A 3WGGA 1LDNA 3FKSD 3I62A 3KEWA 2H59A 3KKEA 1QVVA 5ELXA 1QTIA 2EYUA 1ADJA 3FWZA 4WOPA 2ZZQA 4CKEA 3A3GA 5BWCA 3IO5A 3RQIA 3W5IA 4D9JA 1E4OA 3H2KA 2VJCA 5ALHA 3HDJA 3OZGA 3IUBA 5AW3A 1D1PA 3KXPA 2H4HA 2QUKA 3IQWA 1ZISA 1FVOA 4CM8B 1E0AA 4G1EB 5B3JA 2KM1A 4H59A 1N9ZA 3BMXA 4MUMA 3Q9NA 4O08A 1NJSA 2QL5A 1FF9A 3V8PA 3TUIC 2H9AA 3KKPA 5AKXA 3RVKA 3VYWA 2H1LA 1EFRD 5JE8A 5KSPA 2JHPA 4MO2A 1GR1A 1I4WA 3JARA 3IR5A 1WCYA 3LHIA 1KKLA 2PFSA 2O50A 3RU7A 2I6SA 3B3FA 2FZCA 3HCWA 5L51A 3U3MA 4TZTA 5IASA 2SKCA 2ZT8A 2DBQA 3I9LA 1EWYA 4H35A 1HX7A 3W5UA 1C7FA 3TG8A 1A4IA 1PN3A 5IAJA 3BMNB 5B2ZA 2YHSA 3NTUA 3G2MA 3V1UA 1ZJ6A 4R6XA 4US1R 4CBVA 5LYJB 4BTLA 3E7WA 1W4ZA 2YFYA 1X15A 2DBYA 1R8XA 2XSZD 4QOGA 1UJ4A 1ZBQA 5KOIA 1JKFA 1MD9A 2FN3A 3HE3A 2ZP1A 3RB8A 3UJPA 4H3KB 5CLLA 3FRIA 3PQFA 5JZSA 1EK2A 3FB1A 3A6DA 2VK4A 2FPXA 2IBSA 2BM9A 3CRW1 3D8NA 3E0QA 2NO7A 1T25A 1US8B 2R8OA 2QRQA 2UVPB 2OCIA 2RGUA 1EDZA 2F8LA 3ETCA 3U81A 3VFDA 3A58B 1NA5A 4J0IA 1J0CA 3T0FA 3T9FA 4RTJA 1GTZA 3L01A 2G63A 1QGUB 5B58T 1XTPA 3DZKA 4ZCTA 1QB7A 3DM5A 4O8CA 3T0IA 2R7KA 5IT4A 2XVMA 2OK8A 2O8EA 4HFJA 4MB6A 3SF8B 4I3FA 4M53A 1FOEB 1XC7A 1HDOA 3A05A 4I2VA 4V0OA 4XR9A 5TF4A 3RSQA 1BE8A 3SYTA 4CM4B 3KG2A 4LF8B 1ZM9A 3BGVA 3ZKWA 3DO8A 2BL4A 1YZNA 1CUVA 2F59A 3MTQA 5JJBA 1H4TA 2ZSFA 1CX9B 2QDXA 2XW6A 2GXUA 4JLJA 4WNYA 1YIAA 5AVRA 2B8NA 3ROFA 3ANLA 1O0CA 3RBXA 5DGCA 3PQEA 1WL8A 2FPLA 2WJJA 8AT1A 4XB6B 1E9VA 4LDQA 3MWJA 4TMXA 1PVDA 2OYNA 2AMJA 1G2PA 4DWWA 1BXGB 1HQDA 3LPLA 2IP1A 5F4MA 1HTWA 2JFYA 2QN8A 4Q4JB 1ZJ5A 3FNIA 3NETA 1C1YA 3NNSA 5JCOC 2A14A 2GM5A 4BJ5A 3CJQA 4I1YA 1OFUA 2A0FA 3DF9A 2HF7A 5DBIA 2X3FA 3K8ZA 1U1CA 4M36A 5D00A 2BCGY 4I1OA 4NCBA 1JXMA 1BHQ1 1XLWA 3GHYA 4MNTA 4FR2A 1XZLA 1K8AD 2RAVA 1NVDA 1UJNA 3C6KA 2D54A 4N0QA 3L8DA 1PJ5A 3MWEB 2CNNA 5HWSA 4C89A 3PIIA 4HQNA 5DM0A 4OBBA 3PDIB 4URHA 2WUEA 4ZOQI 3QWBA 5LD2B 1C3OB 5BMVF 2QTHA 1XXHA 1LW6E 2AV6A 3LLVA 4HWKA 3O4VA 3U3DA 5JQWA 3HWWA 2O0HA 1UT8A 1HYBA 1A5AB 2Q5LA 1P2DA 5JSYA 3DB1A 2GZHA 3DBVO 5KYYB 3LLMA 1SZCA 4KPFC 4CRWB 2Y0PA 3AEUB 3OJLA 2VKTA 3MYRA 1V4VA 4AQYB 3EDRA 3V4LA 2Q1YA 4IEIA 3R0IA 3QYPA 3VR5H 1NBIA 2Z3WA 3THWB 1ONBA 1RI4A 2TECE 3L8HA 3PJDA 1XZHA 4IZHA 2W98A 3IR6A 5J23A 1E6CA 2IVZA 1MEOA 3PNYA 3CX7A 4AUKA 2ZROA 4DA6A 3OBBA 1LX6A 4S3MA 3JRXA 5C8YB 3LGSA 3ASYA 1AD2A 3W04A 3INTA 4JLSA 5BWNA 4IS3A 3SX2A 1M1XB 1DSSG 1JTEA 4JUBA 4QM6A 4RD1A 3M6MD 2ZTUA 2C84A 3A1FA 2ZCJA 2ZIEA 4IV5A 3OA0A 1FFSA 3ON5A 4RPGA 5E6SA 1P4SA 1PT8A 4DDWA 1ND5A 3CUSA 4S04A 3OPNA 1ULUA 1KO5A 2CVQA 3M49A 1JLHA 4LYGA 4UOQA 4A15A 1SCUA 4O2AB 3F3KA 1NRKA 3DMTA 4G26A 4LI3X 3KYCB 2JGJA 3R23A 4DYVA 4E5NA 3GVJA 1MRNA 5ADUS 4BMXA 4N5NA 1MP0A 3FUVA 1A8IA 3OU6A 4FLEA 5AXBA 1EGMB 1Q14A 4ZIRB 4G4IA 3GB9A 3B13B 2VN8A 4MVXA 4PGGA 1ZI9A 1OFUX 3SEQA 1HY3A 3VX3A 1J99A 3KV3O 4MPDA 3Q8MA 4QDXA 3IQXA 3PS9A 4WZAB 5A0FA 2OXRA 3ZE7A 2JDIA 4I1VA 4Z4FA 1QKIA 1V5GA 1HOXA 3KUUA 4RKWA 5FOVA 4BGEA 1YJQA 2EJUA 4V1CA 2UZ3A 2QT1A 3G88A 5IYNA 4ND2A 3WLOA 2CJYA 3JZFA 4FJ0A 2VP9A 2Z95A 3MUFA 3QFFA 1KZ4A 4LHYA 3K2EA 4ZVVA 4BLOA 4C3ZA 1USUA 4N12A 1UD2A 2JIPA 5IRCD 1Y4ZA 2PUVA 2HM7A 1M90D 3CRQA 4XLEA 4PBRA 2A5GA 2XNKA 2GD0A 1QJCA 2G67A 3G85A 4K2AA 4BS9A 1PJQA 4KSBA 5ERYA 1WY7A 4HXYA 2ZIXA 3R8FA 1X7GA 1JH9A 3NHUA 2E1BA 1H2XA 1ZOOA 1PZNA 2MYPA 1DKQA 2PR2A 3E48A 4XCQA 1CNFA 2WD8A 5EFOA 4KU4A 3K0EA 5CW2A 3GAZA 3DBRA 4JA0A 4TKOB 1BMFD 3B9BA 3PC8C 4LZOA 1IPEA 3UAZA 3I5YA 3PUVA 3K70D 2ADMA 2NSYA 2C5LA 4QFDA 3QVLA 1VJDA 4XJVA 2JFFA 1WIWA 4YJGB 3V1YA 1AO0A 1T0IA 5JSHA 4CT5A 3Q72A 1YOVB 4EY7A 1UOEA 3U7QA 2X77A 1Q17A 5A0TA 4J75A 4XN3A 2EHJA 1DDIA 3FFWA 5DFAA 2K2QB 4IDNA 4M0EA 3U19A 4MUGA 2X3UA 4Y2SA 4U8GA 2DT8A 2ZAIA 4Z1MA 2DPLA 1WMBA 4G5FA 1H23A 1R4NA 4L8JA 2YVKA 4G56A 3UZUA 2OESA 5I7VA 2HCRA 3GNTA 1FW6A 4EG6A 3WJ7A 3UUEA 4CG0A 5AUOB 3HA3A 1NIJA 2JH9A 4TTIA 2W2LA 4NU5A 5DWVA 1UMDA 3HLKA 1IPFA 2CMKA 3L18A 3R3JA 4NBSA 5M7EA 1TTQB 3OJWA 5GJCA 8GPBA 1WWKA 1GRNA 3OT4A 1OTHA 2Q3DA 4XR4A 1D2GA 3Q0TA 4DBZA 2IIQA 3NMUF 1U7DA 4LSWA 5ICMA 5BYKA 2OYRA 1QH0A 1TJPB 4PPYA 5EQTA 4YMWA 4KMOA 1U9IA 3R0JA 2NUAB 3A1VA 3UHAA 1SHKA 4LDAA 4WXMA 5U1PA 4W1PA 4DMKA 3QVXA 1QM5A 5GVSA 1PK8A 2I29A 2BHRA 3IVGA 2BFNA 2ZE7A 4GYKA 4LRUA 4DABA 1EMDA 3V97A 1KYXA 2I0FA 1RI5A 2PL9A 5EP2A 1IG3A 5CNMA 1DRUA 1IHPA 2GEVA 4IIGA 2WHQA 4MV5A 1W36B 1H2EA 2HBYA 3N76A 4NDNE 2PNFA 3A27A 1BOFA 3PICA 3SBEA 2WTUA 3C0KA 1FA9A 5TNXA 2X4GA 1IK6A 4KFUA 4O4LF 4RMJA 3ZXSA 8ABPA 2KLHA 3KDSE 4K6CA 1MR3F 1O4WA 4KO2S 5THXA 1JHXA 3NM5A 4LSGA 3WIUA 4WWVA 2D2XA 3L0PA 4NK4A 4YRLA 5A5DA 3K9QO 3LI2A 3VR0A 5JD5A 3L7AA 5EWMB 4RADA 1RW4A 2C5EA 3IP3A 4NYIQ 5DZSA 2M6LA 3UJNA 3GLIA 2R66A 5A05A 5A3QA 2O19A 5JG7A 2G1UA 4QYSA 2MSDB 1WF6A 3K9LA 2R8XA 4EY5A 5LMNB 2DHQA 1WQ3A 4AN0A 3A4IA 1ZCZA 1F2UB 4YUYA 4CXMA 3OO0A 2Q45A 3NEAA 2V3WA 1Q2UA 2OP0A 1D6MA 4IBOA 1P62B 5HCUA 1ZINA 3RD5A 1Q0LA 2HWYA 1QRSA 2PMEA 5EZ6B 3LDAA 3DV9A 3GFFA 3IBSA 5FA8A 5G2OA 4L5IA 5C7IO 4EW1A 2BKEA 4B71A 4HLQB 2Y76A 4P54A 1FBNA 1LK7A 4JJGA 4PX3A 4ZZ0A 3QH4A 1R00A 4YUZA 1KQOA 4LFBB 1C5KA 4P25A 2I2AA 4OCZA 1YUBA 5EWJB 3C39A 3ZHYA 3U9SA 5KKNB 4NY1A 5ESRA 2CT8A 2WT9A 3K0HA 3ICEA 1DBQA 4BVFA 3N8HA 4TQGA 3UBTA 1FFXA 3UHOA 3TXXA 3QZUA 3H5VA 3OD1A 1DEOA 1JEAA 1V1MA 3GPDG 4R68A 4Z7QB 5KNDH 3H2YA 3Q1KA 3KQUA 4J0JA 1AGRA 4ZOLF 5AM0A 2VKQA 2RHRA 1B6RA 2BKLA 4M0DA 4PR0A 4C6TA 1LTQA 5KSYA 1U7XA 1OI4A 2XAUA 1SUIA 4AM8A 2GESA 4EKNB 2YUIA 3RKRA 1JILA 4CKWB 4TV8B 1ZDMA 3PUMA 4LXGA 4R1QA 3NQ41 4GXRA 3JVIA 5HX7A 2C4NA 2QZSA 4JEIA 1NBMA 3STHA 3AKEA 5TS2A 4EDHA 3N58A 2PMKA 3CUVA 2BDUA 5IJAA 3MJRA 1GYQA 2HJRA 4LF9B 2GJPA 3CNEA 5K99A 3BC1A 1T4BA 2JI9A 4MGYR 3ERCA 5F5XA 3EAQA 1HUQA 4I9HA 5COQA 3MGBA 3BH0A 1YE5A 3KQPA 3ZIUA 3O3OB 3UMMA 2J0QA 2CXNA 1CEXA 5CRIA 3PL1A 3VZQA 4BQRA 3B3QA 1E6WA 2JFGA 3HLYA 1EBBA 1FDWA 2CXOA 3HWSA 2Z56A 3RFFA 4BEVA 1BZYA 3GA7A 4CG2A 2R1VA 5HKOA 1A8HA 1SU6A 2FTKE 3K0KA 3KVOA 4D96A 3GW8A 1CQIB 1TT5B 2C2GA 3EYAA 5FWYB 2J31A 5LC1A 1OA1A 4C2BA 5CFZA 1SHZA 5EYPB 4GEGA 3DS8A 1GPLA 1PGPA 2PH5A 2I7XA 3X1MA 1R74A 4YEDA 1PGQA 4Y2QA 2POCA 1HE1C 1O9GA 1JG1A 3G0IA 4IIYA 1JTFA 1ODSA 4D8TA 4F04A 1V1RA 2Z98A 4D98A 1G19A 3H7AA 2XMCA 3MRSA 1XTBA 4C0QC 1H4QA 1ID8A 2J6HA 4OI0A 4B47A 2QW8A 1VIVA 2A2ZA 3PU6A 3ZGXA 5DW3A 1GPBA 4D43A 4XRGA 2GTIA 4ZCRA 3TKYA 5HCIA 3UPTA 5JDIA 2NUTA 3R5HA 5I9LA 5LQUA 1QIGA 3CNOA 3HDGA 3OPYA 4XB1A 2PSEA 3BD6A 1PJAA 2ZUSA 4EMUA 1A50B 4Q1FA 3AIIA 3TO5A 3T7CA 3I2YX 1JZQA 4KIFA 3ZHUA 4JYZA 2PTHA 3UWPA 2WJWA 1R9GA 1VKZA 3V34A 3I6QA 1MJ5A 1M6NA 3P2EA 3Q6MA 4LJSA 5EEHA 1RP1A 5TGDA 4INOA 4FWBA 4O33A 2UUAB 3OIGA 1H3EA 1P2SA 4JP1A 1XSEA 3HFRA 4F56A 1CZHA 1OKKA 3PCRB 3WK4A 4UDNA 3KQKA 2NZ8A 4NJMB 4WLFA 3Q7EA 1SVKA 4Z4CA 3EAFA 3ZQ4A 3KWLA 1AKRA 2PT5A 3WFJA 2GZMA 5AW7A 4LE0A 4Q1VA 4ZVPA 4EWLA 1CPYA 1UFOA 1C30A 2X8LA 3B2NA 3N75A 4CUZA 4E4RA 1E1RA 3ECCA 4UNPA 1MHTA 3N7AA 2AI1A 3QU2A 4PW0A 4RVUA 3KTAA 3VOAA 3KYJB 2CDAA 4NONA 4EELA 4ZO7A 1Z0IA 4PNHA 5FD8A 1N0WA 4IJVA 2NLOA 4GP7A 1QDEA 4FZJA 4QGHA 3RJZA 2IA5A 3RTCA 3VV2A 1VCNA 1YJNB 2VHZA 4C3UA 5KYWB 3IVAA 3PZRA 4MPPA 2G9QA 2VF4X 1S0UA 3M6UA 3FHTA 1OB5A 2RG1A 3CNHA 2J7KA 2C7BA 3SVZA 3QFTA 2FZEA 3ICVA 2ZJYA 1PZGA 4XM0A 4EL0A 4LRXA 3WGKA 1TLLA 3MJCA 3RKSA 4E5PA 5TEWA 1TGVA 3D81A 3TIIA 1R6XA 1G8YA 3GY0A 4L50A 1Z4IA 4WOCA 1LDMA 1G4UR 1DRKA 3HKCA 3N6VA 3AG5A 1KFBB 1YS4A 3M7IA 1UPXA 3FPLA 3L6CA 4LI0A 1U8TA 2ZBPA 4EVIA 3B78A 1PSDA 4UBNA 4EHDA 3JZMA 3SSOA 5HTOA 2ZRHA 2V7TA 5BOSB 4DDTA 2A59A 4DNTB 4ZYWA 2Q4TA 1P31A 2FRDC 4HGZA 4M8IA 3ZE6A 3DOFA 5JSZA 1JR4A 1CQXA 2GI4A 5BSKA 5ICCA 1U0BB 4TMTA 3S44A 3C6MA 2CLDX 1UZNA 3IQGX 4FFWA 4O2BB 1ECGA 3SC3A 3VH1A 3W2IA 2ID4A 5FWXB 3E8SA 2H6EA 3LYUA 1ZFNA 2IW3A 2XMZA 5CT6A 1OVGA 3EQZA 3VU1A 5JDIC 2YWGA 2OO3A 4PE5B 2B6HA 2ZIFA 4MHSA 4R0MA 3SMVA 2O8DA 1ZBDA 3SHWA 4LK3A 5TJ9A 4A26A 1TFRA 3I23A 4XQEA 1J4AA 1BWRA 2QD4A 2X22A 2XWQA 3AJDA 4LKOA 4YTEA 4ZHQA 4EDFA 4JEUA 5E1BA 5F78A 5FUQA 3R7BA 1UFVA 4CL2A 1V9CA 1C3LA 1QFSA 1LI7A 1YCFA 3E9RA 5CJ2A 4ESEA 3IEIA 1KH3A 1TVKA 3UC5A 2CUZA 1UR5A 4WZ6A 5FI3A 3PDUA 4OUDB 4TXJA 1R2QA 3IBYA 4AKGA 1A27A 1L1FA 1CHNA 1DBRA 4DIBA 1FJHA 3HKBB 3AKDA 3RTEA 3OIFA 4LVNA 3PI7A 3CG0A 1L4HA 2B1RA 2FY8A 2IODA 2PZBA 4E07A 3MIIA 1RQNA 5BSRA 5A3JA 1W2WB 3G5AA 2P35A 4JB3A 3DTVA 4KE9A 3C45A 1H85A 3MGKA 3HXOA 4BV8A 3KJIA 1L5RA 2XMSA 4EEKA 5KYVA 3M6VA 1E4EB 3QPDA 4W63A 1AMUA 2RHJA 2QDKA 3H3FA 5ALFA 1M6WA 4C4OA 4UZSA 3SIXA 1XEWX 5K0JA 2VNHA 2CYAA 2I7DA 4NAUA 2BFEB 3NHSA 1WKBA 2RK6A 3PEWA 1UJ6A 2YBEA 2VDVE 1LJUA 3GF4A 2D13A 2G0AA 3ZBUA 2GR9A 4A0FA 3C14C 3R24A 3TB4A 4IUDS 1UXHA 1NXSA 5A6SB 1PT6A 4PU0A 3JWEA 4WE3A 3KL2A 1E77A 2C7PA 3FDFA 3NXKA 3UXMA 3V4SA 3EPLA 1MB9A 2AWNA 2FK7A 3ZBQA 3QVMA 2VIIA 3LS2A 2HWWA 2XLCA 3BE4A 3JCZA 4NLLA 1MBZA 1NW6A 1XJWA 2FKAA 4W7HA 3ZWQA 4BGIA 3HHPA 4N0MA 1PRYA 2CB0A 3G13A 3RLIA 1P9RA 5ICGA 4Q66C 3O2SB 3QVUA 4PX9A 4B80A 1R0CA 4B3CA 5C5DA 2HDWA 1H94A 3D0RA 4JMLA 2RJOA 5C80A 2IYLD 2ZRAA 4D80A 4G0UA 1SKQA 2NN3C 4HRAA 3AI3A 4UUBA 4DARA 3U39A 4LNUB 1J9EA 5ITZA 2JCVA 4LRQA 5B4TA 4OQLA 5AHKA 4N5IX 3REFA 5B6PA 3JVVA 1T5BA 1UZAA 3F5DA 4P0TA 4YJ2A 1N36B 1AN9A 2OWDA 2ZJFA 3BF8A 1D0VA 1DWQA 2J30A 2L19A 4L0DA 1BXRB 4F2WA 4D44A 4Q37A 3P26A 1CUHA 1VPLA 4RDIA 5LM3A 3AX6A 1MX3A 3Q0IA 1NBWB 3FDXA 4AZWA 2P0AA 3PJEA 2G08A 4RXMA 1ECBA 4CI0B 1KYVA 1RLUA 2WF9A 1F2TA 2I3AA 2RJNA 4ZJYA 2VP2A 4FC6A 3K6SA 2XE8A 3RS2A 4NESA 4UVDA 1D8TA 5K8CA 4IEEA 4Q7MB 5KZMB 2C9BA 2AMLA 2ODPA 5G02A 3CE6A 3ZGNA 1JKJA 4U2FA 5ALTA 5K0EA 1T1SA 2C9OA 4FZVA 5DWQA 4K86A 1M2KA 3DEIA 5HBRA 4D57A 2Z9CA 2ET6A 5E7MA 4LHEA 1RTKA 5JANA 2WT4A 4MOWA 2AJTA 3OIDA 5AM3A 1EFTA 3BCUA 1QVWA 3GRPA 5DT2A 4ED9A 1EIWA 3AUFA 3ROEA 3RYFB 3V2HA 1YT5A 5GPBA 1CRPA 4TX1A 4I9UA 4J9VA 2YJGA 5I7AA 4DN6A 4E7PA 1N8RD 1Y3AA 3OE1A 1U6JA 3HEAA 3OKXA 4X3CA 2H1FA 3KEOA 4U2DA 3HCOA 4QUEA 1YAJA 2D2EA 3GARA 3OZWA 1WSVA 5C9ZA 4Z4RA 5LQMA 2GZ2A 3NTVA 5TX7A 3RQSA 4DIOA 1GNRA 3FOAA 3MTBA 3R8CA 4YMUA 1UBEA 2W48A 4NBKA 4WKPA 2P30A 2O2SA 3TLCA 5F23A 5KTYA 2M2IA 1IBSA 3R0QA 4P36A 3VZPA 2Y1DA 2I55A 1NRJB 1TMYA 3SE0A 3OSZA 1QR2A 1CJTC 2FP4A 1Z0SA 1MTZA 2OP1A 3GQVA 2HU5A 3QKSB 2YDXA 4WZEA 4TUYF 4BOYA 1UAAA 1Q9SA 1G42A 2WKWA 5DM2A 3WMFA 2IHVA 1DKRA 4FCCA 3U31A 1VI5A 4Z7NB 3KD2A 3LJKA 1JPJA 2GBPA 3SYMA 1KS2A 2BN4A 1AIPA 2FF5A 3AERB 4IOMA 3I0MA 4PC6A 4JZYA 4Z0HO 1V0JA 4B2IA 4GBGA 1XMXA 3K0FA 3MIZA 1F8XA 2R44A 5FKJA 3SLKA 5IT9A 1U0FA 2NPIA 2DY1A 1EFPA 2Q9CA 2X8JA 2E5FA 4FP9A 5CR9A 2WM2A 1H6AA 2OR3A 4B73A 4YX9A 2OFWA 3CIOA 4EGQA 1TZKA 1GQSA 3HCBA 2WR8A 3QXXA 5HYVA 4A8TA 4DMFA 4DIUA 3AOEA 4DRYA 1DTSA 5FAKA 1FXWA 1C7EA 3HCCA 3ENKA 2C5GA 4ENPA 4MVJG 5ICSA 2OCYC 1OWPA 2XZPA 2KHZA 2FHPA 2R62A 3EMVA 1L7BA 2FPRA 3C2QA 3ZQ6A 4DUPA 5IWCA 3K16A 3NIWA 2ENUA 4UXJA 1Z6TA 4B83A 5B1IA 2CVOA 2JGLA 3F6YA 3CEMA 3JXEA 3MJDA 2B2NA 4BBZA 1MABA 3SYNA 1R12A 1R6BX 3UWOA 2BEWB 2OBBA 2F7SA 2XADA 3AFOA 5CDFA 4TL7A 1DC8A 1UKEA 7MDHA 5TPZD 1EH5A 4P92A 3LW7A 1WE2A 4JP5A 1JAHA 3K0BA 4QU5A 4WV3A 4XOUA 3SFTA 4CN8A 5CDFE 1J2TA 5KVVA 1D6NA 1ABFA 1S1MA 4MICA 5FPYA 3EZXA 1U0EA 3R5FA 1ZM2A 3FHLA 1VLZA 1G60A 1U6IA 4BCBA 1FDTA 3TX6A 2RGWA 4BKOA 2F43B 1KY2A 1F9AA 2B9VA 3CEPB 1F6DA 1PV2A 1ZUNB 5IX8A 3OKPA 4JKOA 3T99A 1YZKA 2XCSB 3HVHA 4MJLA 3PEYA 3L77A 4YCNA 4OLBA 5FL7D 3WDKA 5AVVA 1JBKA 3KXIA 4PSVA 2FLWA 2H4YA 2H0QA 3FMIA 5ES4B 3QPBA 1PJLA 1FPQA 2QMHA 4ASUA 2J45A 2PEYA 3BD9A 1IBMB 2P2LA 4QTTB 3UV3A 2ATEA 2YWBA 2IH4A 1V41E 2B35A 3P2MA 5HKKD 5EZSA 3WNZA 1SD1A 3ESQA 3VC1A 4F4IA 2ZSDA 4PTZA 1M8KA 3SJAA 1HTTA 2GCIA 2GJAA 4ESHA 1BU8A 5K0GA 3IVXA 3I1YA 2REQB 2PWPA 3FZNA 1OFVA 2QXTA 2AHOA 2OVFA 4HTFA 4HVAA 1IM8A 2L2QA 3GVPA 4M21A 3UGQA 2IJGX 1NUQA 4IDHA 3TOCA 1IXYA 3EVZA 4Q4CA 4GZ5A 4M9RA 4HXFB 1YJWB 1P4MA 4XJXA 2YICA 4DC9A 3AUSA 2X8AA 3HCPA 1II9A 2V96A 3JPYA 4OMCA 1WNFA 3X1ZA 4WW0A 5IW8A 1PBTA 2JFOA 3KUDA 4L0CA 4E3ZA 1KIAA 4NNOA 3RABA 2XZDA 3F7OA 3FTCA 2CXUA 3H17A 1AB5A 5E8RA 2VQ3A 3JW8A 2W8ZA 1N0UA 2OC9A 1G1AA 2FYTA 1L9XA 4I66A 1R0RE 4JLMA 3G5LA 3DDCA 3GG2A 3GUZA 2EAUA 4R2XA 5AESA 1J8FA 5B12A 3E2PA 5LP6C 4D6YA 5B64A 1S2OA 5AHOA 3QRWA 4FR0A 4YMTA 1UK8A 3HS3A 1YS2X 5F5LA 4L4SA 1B0ZA 4CQMA 5IYZB 1JLMA 4OGKA 4W7IA 3UJCA 3O8NA 4WY8A 2CW5A 1XWFA 2C9YA 1D07A 4U2BA 2C5HA 5B7QA 4B87A 3AJEA 4J3JA 2F9FA 1R6DA 3SHOA 3EA4A 4JCCA 3TD2A 1VHJA 4L27A 5FFMA 4DBVO 2PMBA 4NS1A 2H5JA 4G5RA 5REQA 1A82A 1EXMA 1ZRSA 4RESA 1NRWA 4G1CA 2PUCA 1D0SA 4JP2A 3F4LA 3CUEF 1L3CA 4JDUA 1GNPA 2FCAA 1RWXA 3O3MB 4J2HA 3A70A 3WLFA 3PFFA 2CNDA 1SBZA 3Q7IA 2CFOA 4J0QA 2QIPA 4CKCA 5CT8A 1UK9A 3LT5A 2WOOA 5FBQB 5IS2A 2ZRDA 4G86A 1I1HA 3DXFA 3T4XA 3FSGA 2GEFA 3QU9A 4BNJA 2ZWPA 5MF6A 1BQ4A 3H8WA 4DUGD 3AR5A 2IXDA 1EVEA 4P4SA 1Q7BA 2Y0EA 4AROA 1M2WA 1O6FA 1WOPA 4OP7A 3UAGA 1RXSA 2VLBA 5HQJA 4JP8A 3CISA 1W9XA 3UBMA 3H9CA 1D4FA 4J7UA 4WKOA 2Z8XA 2BFBA 4V1CI 4KDEA 2EP7A 2AB0A 3K09C 1O87A 1OR8A 4HOYA 4IVPA 4L5CA 5HF6A 2X0EA 3DFUA 3RUPA 1R9NA 4X24A 5E3JA 4FMDB 5BNWA 4XDYA 3E8XA 3JAWB 3T34A 4D4JA 4RD6A 1GRQA 4EM6A 3JQCA 5JYCA 5L7TA 1TM2A 3KQYA 4BE4A 4D0RA 5SZKB 3TEFA 3U7HB 4ZEXA 2R68A 1PLJA 4MR8A 1Y63A 5IBPA 2QVCA 3U1VA 1FMFA 4ARSA 1WLYA 3QITA 4OLHA 2EP8A 4GI7A 2AFHE 2PT9A 1FNNA 3RVPA 1ZKMA 4OLJA 5DCWA 4GPAA 1L8AA 3FFBA 2V4UA 2HMYB 3C5CA 3CCJB 3KR0A 3F9RA 1B0AA 3OKAA 2FW7A 4OHZA 1B8NA 1G3RA 1AV6A 5IFKA 3JAMA 1LJLA 3OTHA 3WGNA 2EVWX 2PKCA 1T5HX 1GPH1 1E7YA 1XBTA 2I78A 1TM7E 4IDDA 4MYRA 4Y2HA 1GLGA 3TOXA 3HYSA 4NDZA 4B9EA 4L16A 2ZJ5A 5LP6F 2HYIC 1EVZA 3COVA 2CDRA 1P7ZA 4OI2A 3UT5B 3PPXA 1KH2A 1Q1ZA 3CESA 1WM1A 1QLJA 3H1AA 3KU1A 3ONDA 1PJZA 5DHPA 3QVGA 1IXKA 2QRJA 4LMBA 2VDNB 1QO7A 1ISSA 5HQ3A 2PPVA 2IEDA 5EP1A 1EBUA 1L7QA 2GEJA 1I6WA 1OU4A 1ZGBA 3CB2A 4Y9RA 4Q6WA 1E8NA 2X19A 5IDQA 3KQOA 5DOZA 2V3CC 3V33A 4DDMA 1XEFA 1TUIA 2P8SA 3DDSA 1ZOIA 3NNDA 3GFQA 4KXWA 4WA7A 3KCNA 5SV2A 1AZWA 2IHBA 1QRRA 2Q6TA 3J81k 3AEQB 3Q85A 3OZVA 1AXRA 1XQ6A 2ZSAA 4AT1A 1AMNA 1ZS9A 4HN9A 2ARKA 1FYVA 2R60A 2YHIA 3SNHA 1DX4A 3SFZA 4D6PA 3THXB 4IIVA 1ND6A 4MYCA 4RKEA 2EKLA 1ZXLA 1E2HA 2RHMA 3WLIA 1SC6A 1TU3A 2V97A 3NFYA 3I9NA 3AHIA 1Q50A 2HCJB 3GROA 3ZGVA 5FUBA 4P7KA 5F7XA 1OX5A 1WBJB 1EEHA 2Y92A 3MCTA 4IXMA 4ECEA 4YXWD 1XPOA 1XRPA 2Q6OA 4DPLA 1YV9A 3ZQKA 4K81B 4N3AA 3ZJ5A 1G8KA 4KMMA 4M99A 4CQNA 3SIWA 4OI4A 3QLUC 1RRFA 2HJSA 4K40A 2GVNA 4EVSA 4KQCA 2A9JA 3VJMA 1ZITA 4NXNB 3U4MA 2AE2A 3UYLA 2P6PA 2F3PA 4NCKA 2CKMA 4E46A 3SEJA 2GFHA 3GGCA 1Q92A 2EF0A 4GP6A 1U28A 2JHAA 2NU7A 3DVSX 4ZRDA 5FNVA 3RHTA 3SXUB 2V7VA 3IIEA 3O4IA 4HC4A 2GPWA 1WZCA 1Z5WA 1RRVA 2FH5B 5DIFA 5FOUA 1J90A 1CD5A 4QO7A 3TW6A 5DX8A 5TB5A 3T7EA 1XEXB 5K5EA 2FUNB 5J2UA 5KPDA 3PHCA 2VAXA 2X8BA 2XDAA 3T3MB 1S9DA 4ZAXA 2AGVA 4LVCA 4ZCLA 1PNTA 4XGIA 1CRWG 2FUKA 5EJ9A 3EXHC 1SEPA 4OFBA 2XKBA 3DC2A 3ZU4A 3FE2A 4LJAA 3PDCA 4HMQA 4E22A 1TYAE 4OQYA 2P6NA 1FSGA 1K98A 4LMAA 3JU3A 3DNMA 3P9NA 4EFMA 4PQRA 3D3JA 3HMQA 5EJMA 3X1DA 3L0OA 1XNRB 4IH4A 2WI8A 3ILSA 3BDIA 1A9SA 3DE7X 4KQ2A 2ANBA 3THOA 3V2UA 2D8MA 3KOXA 4UREA 1PWZA 3WLLA 1NYLA 2NQ8A 3ZHXA 4B32A 5BVHA 3NM6B 3W6NA 5IDVA 1WXXA 5GINE 1JJFA 4D9KA 1CY0A 1DO8A 3RVJA 1RYHA 3HCEA 4HUTA 3UJ7A 3D7MA 1XT6A 1CJSA 2BGKA 4XVUA 4GQBA 3R3HA 3TDMA 3JQBC 3ZZ1A 4RVDA 4IJ6A 5IANA 3ZCUA 1XK6A 1ZNZA 5BSTA 3RUEA 1KSJA 4Q4AA 2D5CA 1BEUB 2P79A 3MT8A 4I8XA 4YP1A 2XCIA 4HI0E 1P8JA 3C74A 3DZJA 3IS3A 3ISTA 2EATA 4G4GA 3IMCA 4IGIA 3RAJA 4AKSA 4DV2B 1KF0A 1IU9A 3D59A 1X2BA 1OW3B 3LIIA 4H08A 3RVDA 1NMQA 1AHIA 3G2IA 4AZ0A 2CYBA 4EUSA 4CR6A 4ZI7F 5JQGB 2EARA 4P1ZA 4P81A 4W5QA 2JLYA 1QGYA 4RPDA 4MUYA 4Q3DA 5EZYF 4E13A 4URXR 2F1KA 2C78A 1N92A 3A9TA 4BRSA 4MXDA 5I9NA 1VHTA 3I34X 4FYXA 4ZK6A 4FMBB 4IXWA 4JVLA 4V0LA 1JDBB 3G17A 3UEOA 3P8ZA 4OQZA 3FMGA 3EIHA 4GRIA 5FOSA 4UAVA 1G20E 221PA 5G3ZA 2Q7OE 4BQIA 1Q1AA 4GZ6A 4BE9A 1X7WA 4DLXA 4DV3B 1PK9A 1F3OA 4NSNA 2V7XA 4YACA 2XB6A 2UVDA 4M7RA 3GFRA 3VNBA 5L8VA 2ZUEA 4DR2B 2XWJI 3SM3A 1CWUA 4G0QA 1MNAA 1CUCA 2HPVA 2JIOA 1JAYA 1EFHA 2BGIA 1KBOA 1OBVA 1Y1TA 1P81A 2Y68A 2K7FA 2JI6A 3QKTA 5DKFA 3TW8A 2WPDD 2ZE6A 3R6DA 3DB2A 1HI9A 2ZYWX 4C7XA 1PWYE 3WDLA 3PL5A 4WFJA 4BLTA 3OPYI 4B43A 1U02A 5HK9A 2BGUA 3GCGA 2ZRJA 2GAJA 3EF1A 4UD6A 2E89A 4RL6A 1LJ8A 3CSDA 5EQJB 4YRTA 2I4IA 2QI9F 4JFRA 1HSZA 2PNJA 5AOAA 3UOAB 4LQ4A 2W90A 3LA8A 1VGVA 1V25A 4DCMA 3WHLA 3R1IA 1TF2A 4CNQA 3U44B 2YVAA 3HKEA 2B69A 2PKQO 1J7KA 1Z8HA 1T36A 3ANYB 3I01M 3C85A 4N41A 2OTLB 5DI9A 3KUCA 4R8SA 1HVXA 3I3OA 1ZR2A 1R6VA 2P5TB 5CNJA 5EGSA 2OXTA 3T6KA 4H3SA 1Z88A 3QMMA 1SIUA 4Y2XA 2FN7A 2AC4A 2G83A 5AK6A 4UBIA 4NZNA 3RJMA 3SIPA 4QBGB 1WDKA 4ZU6X 1VGRA 4JLUA 1Y82A 2NVBA 4KP7A 5CBKA 5ADVA 2F8SA 2XCOA 5D87A 1QHYA 4A5OA 2XHZA 3MELA 4ZA2A 4R1MA 5LVAA 4TOIA 3AL3A 3BZUA 1GR0A 5ELLA 3TI7A 3ISXA 4RD3A 4BTEA 2Q99A 1KZ9A 2QTVA 1KVUA 3CB4A 4G0OA 5G41A 3M9XA 4D25A 3LQRA 1FE8A 1NYQA 2YYYA 5H80A 3A04A 5TR9A 4TROA 1JQLB 1I80A 1O7JA 1HR0B 1JI0A 1WCXA 4Q9JA 3A1CA 4FFLA 1LQTA 1NVMB 2C03A 2YN4A 3EUAA 5EHGA 1C14A 2HI0A 2IP2A 2R3SA 3AJAA 3UMRA 1OV4A 3LYHA 4DCUA 1IN7A 3M6IA 4LISA 4HE6A 2WG2A 3IA7A 1DUSA 3R3ZA 3HEBA 2SKEA 4XIFA 5LA6B 1Q7CA 3H9NA 2VVTA 4G1VA 4MGIR 4CTMA 1ZIXA 3HNPA 1RZRA 3SQDA 1XCGB 5BR8B 2CHQA 1GT6A 5I3CA 2DGDA 3MTEA 3TRFA 4D02A 4JLBA 3BMOA 4Q1EA 3OE5A 3Q5DA 3ZJ4A 3M4XA 1LBQA 4YRGA 1E4VA 1NVVQ 3HRHA 3MT0A 2WE8A 3E27A 1L7PA 2Q4OA 4TYMA 4L75A 4BVJA 5KTRA 1MO5A 2WU3A 1N0IA 2Y1GA 4I50B 4Y6PA 1N9KA 1QIIA 5ALDA 5FNZA 3RF7A 2FSSA 5H70A 4EJSC 2R86A 1JEYB 5DGHA 1Z47A 2BTQA 2UAGA 2P4UA 5H16A 3D26A 3WRVA 1Z7GA 2VRBA 5I9TA 4OAQA 3AI1A 2HO5A 2D7DA 1VF7A 1BX1A 4AS3A 2FQ1A 1I2ZA 2DUMA 4BGDA 4QZVA 3U6BA 3FA2A 4HH0A 1F0NA 2AFIA 1GWNA 3GPLA 1QUFA 1QTRA 1PTJC 3PFWO 3BRCA 3NIBA 2C2YA 1EP2B 1ZMTA 3RAGA 3CX6A 2OUKA 2EQBA 3L4BA 4EB6B 4HEJA 1WP6A 1O0BA 1JB1A 3F7MA 3NCTA 3OX3A 2UV8A 4PNPA 1CNEA 1JT2A 3BORA 4QBHA 3VC3A 3CUWA 5CT9A 3MHTA 2NUBA 1B26A 2BVNA 3K20A 5HIKA 3U61B 1HQYE 2ZL7A 1YBMA 3T3IA 2BH9A 3LFHA 2BBOA 4MUKA 2O8FA 3LOPA 4PAWA 4RPKA 4NIMA 4U6NA 2Q6LA 3GMIA 4PAQA 1AQJA 1G0OA 1VIMA 1R4AA 2ZDGA 1P0MA 1RIIA 3GRYA 4G89A 4KKVA 3ZNQA 3S8YA 2V5VA 2PQ0A 2VUUA 3FGNA 3DMDA 4M9SA 4WT7A 2XZOA 4ZK2A 4LNHA 3QELB 4NZOA 4FXUA 1E3WB 3B70A 4FGSA 5CMLA 1GL6A 5HZMA 5ITVA 1KJWA 2JGMA 3U4DA 3EZ9A 3ORHA 3ETJA 2VDMB 3OPOA 2ZR7A 2DWCA 4HAXA 4DGSA 4BMCA 1ORWA 5CCEA 3LQ2A 3ZG6A 4LCBA 2IUSA 3KLPX 2HJWA 1M1YE 4WN9B 3AJ8A 1JIQA 1U2GC 1POXA 2X2PA 3TEMA 2A9QA 1S4QA 3L0ZA 1G4HA 1MNQA 3IR7A 4ER7A 2ZYGA 5AK4A 1B15A 1LKZA 2AK2A 2H5EA 2JGFA 2QAIA 4L78A 3UMJA 2ODWA 4UQOA 1BEEA 3R9WA 2PZGA 3DOOA 5HIMA 1I6KA 1H2FA 4E1VA 1RZUA 2FAXA 4WFIA 1P33A 3AZQA 2QENA 4R05A 3BL6A 3FXAA 4Z6KA 1DARA 4ZOEA 5HDQA 2Z8ZA 1A72A 3OTOB 4O2LA 4WTOA 5EJIA 4FKMA 4B6EA 3GN1A 1SQ6A 1W46A 4FYYA 4ZT5A 4TTRA 1T8WA 3D3NA 3I1FA 3LTNC 2AEFA 2V45A 2J32A 3AT1A 2DKOA 4UCQA 5DCUA 4EQ6A 5TRDA 4M46A 1FNMA 5FTKA 1ODKA 3FMPB 5H8WA 4DIEA 2P8JA 4HUQA 3PUZA 1R9MA 5ESWA 3T0GA 3CMCO 4JGIA 4OG2A 3MCAA 1E2DA 2P9EA 2I2DA 3AKYA 3MMZA 4K87A 4B7ZA 1M34A 2QRVB 4N8DA 2J9FB 4UEQA 5KJEA 3VOBA 4Q1CA 4IAOA 3L8FA 2PR7A 4RHCA 1JQ3A 1JDZA 3HBLA 4I1SA 2EZ9A 2RAFA 4KKTA 2ZJ6A 4Z4WA 3GRVA 3BFPA 3TR6A 4U7DA 5A5EA 4GH5A 4Q01A 1P0CA 1N5IA 1YC2A 2NW6A 2ZCVA 3H7IA 4EPVA 3IOCA 1XHFA 2JLVA 2HL6A 1PFYA 2HMVA 5JPDA 2ZB8A 3ND8A 3NBQA 1BXZA 1OMOA 1YQ9A 4NG5A 3P2OA 5GVRA 5HMLA 4FOPA 1ZLXA 1U3VA 1PFWA 1Z22A 2GJ8A 1Y1PA 2H2AA 5L3ZA 5LDGA 2QKYA 1THTA 3H84A 3VPXA 2XUHA 1OI2A 4AG6A 1YZLA 5JWOA 3E81A 5DRYA 3W1EA 1CS0A 2FFAA 4TLLB 4N3BA 3LHSA 2ZYDA 1YRAA 5CCDA 2W6NA 3PT5A 1K0UA 4KHZA 4F4FA 1JHAA 4JN6B 3RTGA 5T7BA 2G8NA 7GPBA 2WD7A 3VMMA 3PG5A 1RNLA 3TUJC 5GQSA 2V8OA 4MUIA 2DBRA 4I5IA 3H8VA 3HVJA 3K9CA 3QHAA 3P1JA 2CHVA 4XASA 1LX7A 1X1EA 4Y18A 1XD2A 3GRZA 4XLTA 1XE3A 4DR5B 1NQXA 3KHTA 4XLCA 1WXGA 2QGZA 1LSOA 3FVVA 1WU7A 4LX0A 1R8SA 4F12A 1F6WA 3WBJA 1GSOA 1Z4PX 3BCDA 2L82A 2LRHA 3F5FA 3EA5A 2VNKA 3GRRA 4RPIA 4RK6A 2PA3A 5AUNB 1SC1A 2OV6A 4MCIA 4AS2A 1Z0ZA 2XVAA 3E15A 4HVTA 4GLJA 5F3WB 2EWWA 4B44A 1VQ8B 1RLMA 5AJZA 3ZQUA 2PUFA 1Q7RA 4M7OA 1SBHA 1KJ8A 4QBTA 1E98A 1VLQA 4LZAA 5DTIA 5AJTA 3R2JA 5KCMA 1V45E 4BMSA 1D6SA 1BS1A 2X9QA 4X93A 3DDHA 2V58A 1X19A 1P4HA 3SMQA 5HZBA 1CUZA 1TJ5A 1W29A 4Q6BA 4RM2A 2GZ1A 2IQ5A 5FPKA 5LP6B 4GU5A 1WMEA 3IAM1 1YTUA 3VJRA 1FTNA 3BYZA 2DUWA 3IO3A 4JUDX 4QUKA 3DMYA 3ND5A 4C7BA 2A5YB 2MTBA 4H16A 2PUEA 1WCIB 2LD4A 3S4YA 3CSSA 4UHCA 4O4IF 3FJYA 5HHTA 4JYAB 2ADFA 1AT1A 1PZHA 2ORWA 3GFVA 2AWOA 2QAGB 3IOEA 2F2TA 5KDLA 3ZY2A 2NACA 3L02A 4HN2A 4OQEA 2IWRA 1SFRA 2ZRMA 2YN0A 3KWMA 3W7AA 2WHPB 4RF5A 5LQRA 4RIHA 2QGGA 3NHJA 4L3OA 4XIIA 3PJRA 3ENWA 3ITDA 1YK0A 1ZOSA 5GIPE 4AJ1A 1P60A 4KFRA 4OQXA 1YB2A 2DR0A 4AXBA 1YI0A 3WB9A 3HFSA 3T7JA 1Z0DA 4QV2A 2GCPA 4ZGQB 2BM0A 2XXBA 1EUQA 3IAFA 2ZRGA 3QM1A 3T1YB 1SXQA 2IXAA 1QONA 4QBKA 4C5AA 1XTZA 2QL7A 1JFLA 2QL9A 3WWEA 3LFTA 1KEEA 4EX7A 1YO6A 5K3OA 2F9LA 1NFFA 3A26A 3LF2A 2ECPA 5C37A 5FTLA 3KSBC 1QHHA 3WQHA 5FWDA 3G2JA 1Z5ZA 1Y7HA 4FGKA 3GDFA 1W44A 2RB5A 4GPEA 5U9CA 4YT2A 4KKSA 3HB4X 3W2TA 5E0KB 1ULSA 1CFJA 2IY8A 2P11A 3GNSA 4QQKA 1N1MA 2WT8A 1UDXA 4J90A 4OV6B 4CT0A 4DCPA 1S01A 3FETA 3QOFA 1HT1E 2NZUG 1DO0A 4QYIB 2VHVA 1RI3A 4D2IA 1TOAA 4WL0A 2QJOA 1FP4B 3GN2A 1QAOA 3PE6A 4TTQA 5EPEA 4YLYA 1PFQA 2WRZA 4YONB 2W6MA 3OECA 5CTJA 4HV4A 2DTEA 3MILA 2PVPA 1N6LA 1PJ4A 5A3RA 3U16A 1A7JA 1Z7EA 3LF1A 5I4KA 4RE5A 4U2CA 3OCXA 3OY7A 4MDYA 2G5PA 2J3DA 1T3GA 4HDMA 4J76A 3KQTA 4NFHA 3QPAA 3N86A 3OPXA 4UXIA 3CBQA 4TXHA 3DNFA 3NPMA 3P9KA 2YZKA 3CZAA 4TM7A 3HO1A 2RHTA 5IMSA 1UJCA 3B1YA 1Q91A 2GAIA 3PGMA 4LQDA 3UJDA 2ORIA 4OP1A 4BNTA 4E03A 4IDEA 4N7JA 2I3BA 2CV1A 1C3XA 5ALNA 4BNNA 2Q5QA 5BSHA 3UA3A 3D8UA 5TEVA 1TW2A 2BSQA 3QLTA 4L4UA 2VWPA 1YJBA 1CY6A 2UUOA 4RFLA 4X62B 2BBWA 2FG7C 5HJEA 2XOKD 2VF2A 3TN7A 2CL5A 1GNTA 1FLVA 2VCHA 3GRKA 5EWLA 1H6BA 4ZT7A 3AEYA 5EJFA 5HM8A 3AVTA 4QJIA 3D02A 1O94A 3FGZA 4JBNA 5FPTA 1KDPA 4AWXA 4CVNA 1QHEA 1N75A 1XZFA 5K9ZA 4JQSA 3C8DA 1YDMA 3B12A 3PXUA 4UBMA 3ZY3A 2IC5A 3C87A 3ZDXB 2WF7A 3B5JA 2IKQA 1P7WA 1UOOA 3NKVA 2BSAA 1NVFA 1XRLA 3B48A 1P0PA 4CIAA 3PPIA 5M04A 4Z4QA 1PL0A 1WPRA 3HFGA 3NTQA 5ILOA 1I24A 1XZPA 2H06A 3K2BA 2BKUA 4PCUA 5EIHA 3ZWNA 3T3DA 5CM8B 4R9VA 1U8AA 3OJ0A 4RK5A 2FLKA 2Y77A 3VHXA 3CP8A 1T13A 5D1NA 4K3VA 2CNWD 2QTWB 4O5AA 2NGRA 4CQMB 1RWPA 2GBLA 1JDNA 2O20A 6REQA 3P96A 4M0UA 3TFOA 2QRKA 1DUIA 2C3MA 2SKDA 3HY6A 3P71T 4RHUA 1RKUA 2HV8A 5DW0A 4KDCA 4ZOLA 3RBZA 3WWOA 4YBZA 4NFYA 1IOWA 1FTWA 5ANRB 5ED4A 4TSFD 4F85A 5K4HA 1C0LA 4LGCA 1ZONA 2R4QA 3ELWA 3JQAA 3TWOA 4YMIA 4PF1A 2OBYA 1PGJA 2WM9B 3IP1A 1XAJA 1SVOA 2SNIE 4JOBA 5MFZA 2GA9A 3H9QA 3WLEA 2GM3A 4D26A 2H65A 1U98A 1NF2A 1R0LA 2G07A 1BN6A 2W2XA 1TU0A 4LZZA 2M6RA 4NZPA 3ANXA 4CETA 4JBXA 4KWIA 3IMEA 1QBGA 1UKBA 3EDYA 2HEGA 3EK2A 5FI0B 4WFKA 5EXDA 4L08A 2IL1A 4TLEA 2FPGA 4GHWA 3OQMA 1JBQA 3K73O 4ZREA 5JEDA 3RO7A 4DLTA 2VPTA 2CNKA 5DP2A 2PE5A 4AS1A 4IMPA 3VO2A 1TC2A 3F7TA 2Q6IA 4C43A 2JBHA 1NXVA 2VPPA 3IMKA 3GRFA 2QX8A 4S1TA 1JLKA 1KY4A 1PSZA 3QE4A 5KAMA 4C0JA 1VPWA 4ALMA 1W52X 2CHUA 1U0OC 3R75A 4E14A 2XEDA 1U3FA 2GXAA 4LYYA 3CLKA 1PFKA 4GC5A 3QEMA 1F2VA 4G4SO 3H19A 4Q0MA 5DXJA 4XYLA 2Y6UA 3T9AA 1P2GA 4MVJF 1FLAA 2GKGA 1ESZA 3TTVA 1U9IC 4E31A 2X3YA 4GKVA 1PZXA 2NZYA 4YIKA 2HBRA 4JL5A 5L6LB 2OCKA 1A95A 3EXEB 3TZBA 2X6YA 1U7OA 2C95A 5LQSA 4ZKDA 3AILA 4W9NC 2J0VA 4G1UC 1RKBA 4FDTA 4PYQA 1HDZA 1TKAA 5CIYA 2V1UA 4F3TA 1KMCA 1X77A 4YRIA 3G3EA 2VXCA 3D8TA 1UPUA 2HD4A 2I80A 2XT0A 1T0UA 3L0SA 3ABIA 1SOMA 2YY7A 4J1NA 3L0BA 1J7JA 4DEVA 3T1TA 4LOIA 3ZVLA 3A3KA 4EECA 3NP7A 1VMEA 2E48A 3G2KA 3STXA 2JFQA 2VJYA 2B2CA 4EJMA 1NNUA 3EODA 5A7FA 1VE1A 3TBHA 1QP7A 4DT1A 4Q9NA 2FR8C 3JQFA 3HZZA 2KX7A 3T5DA 4W8HA 2QPOA 1JI3A 3I72A 4MUHA 3PCTA 5I45A 1Z45A 3MINB 2QMOA 3GLRA 4UUQA 4RF3A 1LI4A 4PC1A 1R37A 4LXHA 2KWIA 2BTOA 4NE7A 4HNAA 1XU4A 3DOJA 4MULA 1GN8A 2PWBA 1I2AA 1N5MA 3SXJA 1HXHA 3C6YA 3OZBA 2DQ4A 1KEPA 1W4RA 3AVOA 3LX5A 4CEIB 4UUNA 1RYYA 3L4SO 4V02A 2REXB 2QM0A 1BVHA 2BMFA 1EP3B 5A71A 1N8KA 3NKLA 4XW2A 3M4YA 2GCGA 5T8KA 1Z7YA 3FZGA 1P0IA 4YAOA 4X20B 3S2FA 5KJ6A 2FZVA 1U1DA 2CFCA 3MWLA 3SQXA 4DL9A 3HJCA 2PX6A 1FTSA 4HAZA 1XF1A 4MP8A 4K9LA 2JKVA 5KAPA 1M2EA 5M29A 3H4TA 1DJMA 5DCLA 4MJ3A 3OQVA 1DG9A 4AY4A 2ZIWB 3D4PA 2ESRA 5J58A 5E6RB 2RD2A 1ZHHA 1MDBA 1AG9A 1WXWA 2PKWA 1V1JA 3OUTA 4KBFA 4G97A 4LQLA 4MLCA 4PG6A 3ET4A 4F11A 2UXBB 1KAEA 1DIHA 1R8YA 1WB4A 2C20A 4M9CA 5LJIA 2CSUA 1OOEA 5JVDA 3DE1X 2ZBEA 2AI3A 3OQBA 3KTDA 2QTAA 1J1IA 3GGPA 3G6KA 4JWTA 5FOTA 1SUFA 4ZU3A 3NWBA 1GZVA 3KSDO 4K88A 1YBAA 1JFRA 2AQKA 3MWDA 2X6TA 4R8KA 5JRZA 3B20A 2QP3A 3QP9A 2OGUA 3JATB 4IRMA 1E2GA 1XHLA 2WJAA 4LEIA 2NZJA 1GIAA 1KEUA 3A9VA 3EG5A 3HV2A 4MLPA 1S72B 5EQFA 4AUMA 2Q0XA 2Q3EA 4D92A 1I7QB 1D5CA 4MA0A 2E4YA 3WGMA 5EESA 4YMHA 1Y0RA 2C5AA 4CEHB 3U40A 5DGXA 3KX2A 4E6PA 1IVYA 4AIRA 4WKGA 5KX5A 1N2HA 1N7HA 3OLQA 1ZRHA 3MUEA 3QX7A 2GEBA 1N6IA 4FGZA 2B2XA 2HQBA 2CLMB 4J0EA 1LVGA 3DEJA 1SK8A 3JQ8A 1M75A 1NE7A 2R2AA 3D6MA 2CF6A 4ILKA 1PL6A 1TF7A 2I8LA 1UM9B 3ADCA 5BPFA 4LWZA 4D45A 3PFIA 3F9CA 3MTJA 5C7LO 4FYKA 3EGEA 4JVNA 3ZXXA 2PUHA 3LL4A 3RW9A 4QXPA 4CLHA 2XNDD 3PWTA 2QD1A 3CCQB 4B4OA 3KT8A 5D7NA 3ZWKA 5KO2A 1T9BA 1N3IA 1EB9A 3ZIDA 4HPWA 4F5YA 1IJBA 1EFVB 1NLUA 3ILHA 1GAXA 5GP1A 1W0KD 4E5YA 1ULZA 1QB8A 2J9XB 4KKUA 3JR3A 1JLSA 4HQFA 5EC8A 2ZVJA 4UVEA 5HIAA 2C8KA 3IJ5A 4YP9A 1ZD9A 2BZ0A 4OQQA 1II8A 5IJ9B 4AP6A 4H4CA 3RTAA 1ZQ9A 1DNPA 4JXKA 4WZAE 1IHYA 1X8KA 3V6MA 1FFHA 5I5GA 3QUAA 5CFLA 2IIBA 2J7PA 3GZNA 1Z39A 4FW9A 4CLRA 5KOHA 1JDJA 1W5BA 2FXIA 1ZW6A 5G0UA 4H60A 3R3VA 4DXDA 1X92A 1K7CA 1S7GA 5FLYA 2ZUUA 4ZJPA 1W94A 1O6ZA 3HP4A 3N7TA 4LJ6A 4OGFA 2ID8A 3K1YA 1QHFA 3KQVA 5DI3A 3C5VA 5LB4A 1KQNA 2D2IA 3EGCA 1G8FA 1SXJD 3NOXA 4R31A 3RASA 5T5QA 1D8AA 1KDRA 3N5KA 4J4TA 2O4UX 1YI1A 2DBVO 2C4UA 1V9SA 1T2CA 2PLRA 2NO5A 3EIQA 3DR3A 1E3JA 1MO4A 1I7PA 3QU7A 3RBAA 4Y9SA 3P9PA 1R5BA 1SQSA 1BDBA 2WJPA 5I47A 4IDCA 2PS9A 4WFQA 3A4MA 4LSZA 1E2MA 1N3YA 5KTKA 1F1BA 3RREA 3VPAA 1A04A 2RGNA 3CCBA 5T57A 1LRKA 5DHRA 4KLRA 3AR3A 1T5LA 1OLUA 4P7GA 2XE4A 1I2MA 5ILGA 1Q7YD 2PQ6A 3INNA 4UD2A 4EFNA 1U5BB 4HAWA 1J09A 3RJTA 2HPHA 5K6RA 4COKA 2Q9BA 1SA0B 2V1XA 2I1LA 1E3MA 3GLHB 3E03A 5CXXA 1Q0QA 4YELA 4YGYA 1F14A 3RWBA 4HLUA 1ZESA 4B3BA 4F86A 2Y93A 4CLOA 1L5SA 2GBGA 3AETB 1XYGA 2CDBA 4FDAA 1ZHOA 1HNWB 1BDJA 1WHSA 2BE7A 2XJ9A 2WVGA 3X2EA 3F73A 1B2RA 1ZNWA 5C3MA 4Z4ZA 3IRUA 4E2WA 1T26A 5FIUA 4QGBA 3MQ4A 4GX0A 3KXKA 4V03A 4YJ3F 5TC4A 5E4YA 2HU8A 2FJUA 2WVHA 4GBED 1TJYA 1G8PA 2MHCA 3WV5A 3LWDA 1VMKA 3ORYA 4CKZA 2XPCA 1KERA 4NYIR 4PTYA 2B7CA 2HDNB 4KN8A 4JNCA 4PNZA 5K45A 1DDOA 2QVGA 4XDZA 5AQEA 1H0RA 1T5IA 2POQX 3RS4A 4MMYB 2VSFA 3PXAA 4IO1A 3T7IA 3FY4A 3ZCRA 5KQGA 4WRRA 4X60A 1A7AA 3EZ2A 1CERA 1RXUA 2EJCA 4XSGA 3AM5A 3REQB 3ZGYA 3ND6A 1JDTA 1GNQA 2D0IA 4M9ZA 1ADCA 1IZ8A 4ZCPA 5FX2A 5ISMA 2IEZA 2IE8A 3EGDA 1KO7A 3EF0A 5F4ZA 1COWD 4TXNA 2W6IA 5AWFC 5H02A 5DB4A 2AMFA 1PEKE 3QTTA 4GAEA 4WUVA 2Z83A 4ETWA 3K8OE 2W22A 4IFTA 4PO8A 4BNMA 4EPRA 5CDGA 5I8WA 2IZOA 4OHFA 3L7KA 4OBWA 1P18A 5CA1A 4EA8A 2BZGA 1U9CA 4TUYA 4BMOB 2R8YA 3OQOA 4C4AA 1ZD1A 2P9BA 3L4EA 3PQ8A 2JARA 4FUTA 4KYIB 1QFZA 2V7QD 1Y7PA 3WY9A 1DIBA 1MUUA 4PGAA 2GF0A 3WK5A 1EK6A 5JQGF 3A9CA 1S96A 5IEJA 5E9AA 1BHO1 3CM0A 2E5WA 1P29A 4RGBA 2YIMA 1QHXA 3VISA 2PLWA 1XZIA 2HX1A 1EUDA 2NYAA 1PAUA 2J4FA 1BVUA 3COZA 3X1JA 4WBNF 2HF9A 4QHTA 3LT1A 4EFDA 4HWGA 1QF6A 1ZCFA 2C2MA 2AOVA 2EOAA 2EP5A 3L6RA 4RHXA 2AR7A 2GTHA 5BWMA 1N5DA 1O0SA 2VFAA 4BZXA 3AXTA 1WPQA 3EZYA 1XYYA 3ZLVA 4YBRA 5DM4A 3PXCX 3EEFA 5DK4A 4BFLA 3IPLA 4L2IB 5HJ5A 4HE5A 1W581 4FMPA 1I1NA 5LZ8A 5HUJA 4OSPA 4ZZ2A 5KVAA 3B6KA 2HLNA 1AUOA 4RDLA 3MVEA 4US2R 2FG6C 4PYNA 1VQNB 1K4YA 3K4QA 4GVPA 4O1IA 4AJOA 1UQTA 4GG1A 4GOXA 1JVSA 3CTPA 3O90A 3OA2A 1JA1A 3FG9A 3BS4A 4XZ3A 2PZLA 3NT4A 1OI3A 4LF4B 2ZAMA 5SYMA 2JJ2A 5IYRA 3KKZA 1K1EA 2SHKA 3NS7A 5KJCA 4F8YA 1HDEA 4O59O 2ZCUA 4WDQA 2HBQA 4X6UA 2ZATA 3HR4A 3ZCVA 4MPRA 4EHFA 4AJLA 2A0WA 3PFCA 1GTG1 2QF7A 4KWEA 2B0JA 4L22A 1N1GA 2X0NA 4BQSA 2H2DA 2VYND 1RLOA 1VKOA 3CY6A 1QLHA 1FNDA 3I56B 1AGYA 1P6UA 1BMQA 2V98A 2UZ1B 1QZXA 2XBLA 2GCOB 4N49A 1RABA 2CXQA 2OKCA 3GO4A 3KQWA 1K6IA 3NFRA 3PDJA 4OD0A 1P5RA 5E6UA 2ZXIA 3JWIA 3SLGA 1PUXA 3OLXA 2EKZA 4KIWA 5DHFA 1FDIA 3WYEA 5MGNA 4W6ZA 4OHUA 2QS9A 4RM3A 5D3KA 2IH2A 1NT4A 4AJNA 1F8YA 1DIGA 1F8UA 1BQEA 1YRYE 4M8SA 1EAYA 4NZMA 4Q02A 2FQYA 3P9ZA 4MAFA 2WAYA 3QXGA 4WZBB 3PFBA 4I4NA 2JLUA 1JRLA 4RNDB 1VKJA 2WJIA 3H5RA 3IKMB 4OF4A 4ZAYA 2VDWA 1YFKA 3NTLA 2CE7A 4O4HB 5JAPA 2BD0A 4TMWA 1XAIA 4TQAA 2DB3A 3GFPA 1LNQA 3QNUA 3H11A 5C8ZA 3ER6A 3AR9A 5DE3A 5ERXA 3S2UA 1SG0A 1CDZA 4Y1RA 3C48A 4FQ7A 4EHIA 2Z9DA 4MVJM 4NNPA 4V38A 5FV4A 3BQMB 1VSVA 3ASSA 1E2QA 1INLA 1HFEL 2JAPA 2BFPA 3G2PA 1IMOA 3BL5A 1X1TA 1KO8A 4CUKA 2OHXA 2VUTA 1TIPA 4BL5A 3GFTA 4CMIB 3WL4A 1RYMA 3AP3A 4ZICA 3AW9A 3I4LA 2D1RA 2DY0A 1USGA 1DKLA 1G7TA 1VG1A 1U0NA 3QY0A 4MUEA 2IS2A 2J4DA 4R8VA 1ETUA 2PHZA 1J0DA 1E1MA 1IAQA 1OFGA 3D9QX 1OUMA 1P4JA 2J5BA 1VPVA 2FZ5A 2YVLA 5LUAA 4A27A 2BE9A 1MA0A 1HDRA 3G2NA 3OOJA 2XD9A 2VQEB 3AY6A 4EA6A 4GI1A 2GBCA 2P0YA 3ZD7A 2HQRA 1GTL1 5JD6A 2E4ZA 4NMMA 4YY3B 5CYOA 1N5OX 1KY3A 3FPKA 2PGDA 1ES9A 4BFCA 3BIFA 2OFFA 4DYDA 5KU1A 1XHEA 1YZFA 3UENA 3ZIAD 1JNYA 3V7FA 1NR5A 1JR3D 4KZPA 1O95A 3PR3A 1VA5A 4HK4A 4HZUB 1J5PA 3JYLA 2GJSA 1XLTA 2C31A 4RTLA 2QVZX 4ZZ3A 2JIZD 2VZEA 5TS3A 5TQ2A 1IDN1 2IZ0A 4UNNA 2QRUA 5DNUA 1XVVA 2XA2A 1QCYA 2E1RA 3DUFB 3QBVA 1KEWA 4MEJA 4URVR 4IJMA 2MMCA 3HDYA 3ULKA 5F33A 1KJYA 5D5PA 3RSHA 1M8JA 1FDOA 4DSAA 1FYXA 2D9RA 1BU5A 2Z4RA 3S1AA 3WSWA 4D4LA 4QLBA 3IAUA 3AOEC 4X1KB 1ISGA 1EPUA 3C4QA 4I1RA 5IK2A 4PYKA 2YWEA 2BM8A 4IIJF 1VJGA 2V6FA 4NBUA 4PINA 3HY4A 3K9FC 2D3TA 2FSIA 4ID9A 3VNSA 4G9EA 1NQ5A 3I9JA 3OMLA 3P9CA 4O02B 5EKUA 4YWJA 3V4PB 4ZMRA 3K70B 4H7KA 2H11A 2ZSIA 3DDYA 2H29A 3CXRA 3I1JA 3PJGA 3HN2A 1CUWA 1ILEA 1YUNA 2WJZB 3HDQA 4KFCA 2EFHB 3A2KA 2VUSA 4HGRA 3T94A 1GZ4A 1R0BA 3BGSA 2BZSA 2VJPA 3OCWA 5HXBA 2X5KO 4KH1A 1E66A 1VB5A 4REOA 3U9TA 1R3DA 3QHQA 3UK1A 1KS9A 3N2ZB 3BHMA 4YS6A 2D8AA 5CDSA 2JJMA 4GP9A 3MFQA 3IOBA 3KHKA 4MGZR 3UH0A 4AK9A 1BE1A 1G3QA 5JH7F 3KR1A 2PV7A 3H99A 1TPZA 4B9AA 4DZTA 5CDUA 1Q0TA 4PABA 1OWOA 3WL6A 4BWYA 4MTLA 2Z8YM 4QPDA 1SY7A 4XLZA 1SIOA 2X0KA 1P1RA 3AR8A 3CLTC 4LOKA 5AKEA 2H1CA 3C7AA 4JC8A 2R4UA 1VG8A 1UZUA 3IJEB 4A4DA 2E5LB 4B6JA 2WA1A 1NW8A 4RX1A 2I3GA 2IYSA 2FETA 3JYHA 1B7GO 3ROXA 2ZBGA 4HRYA 4YK7A 2BHTA 2B1GA 2GK6A 3IKLA 5CVUA 5ALQA 1HORA 1N3BA 5TPWA 4YASA 1JWLA 4OB8A 4F2PA 2NYUA 1QPBA 3FUUA 4C7OA 4M0PA 2UVQA 3LQ1A 3BXGA 4MITA 5HNKA 1MH9A 4BKUA 3WQBA 4CCYB 3LC0A 1TA9A 3BGWA 3IEVA 2PYIA 1GPYA 2PMFA 5GGXA 3DEFA 3JRWA 1XKTA 4J29A 4XSHA 4ZAZA 4FNMA 4QUAA 3L8YA 4RPJA 5E1DA 8ADHA 5DPMA 2PRKA 3USZA 1YD7A 4WEQA 3W4IA 1S2MA 3BK1A 1X74A 4QG3A 1I10A 1XEWY 4HDNB 4J1TA 3EH1A 1X7HA 3P20A 1CRQA 1X1AA 1H6CA 4EW2A 1OPXA 3I2HA 1TJ3A 1E99A 3E4DA 1B93A 4ZOCA 2ZXUA 1YULA 4BO3A 5C53B 1R4NB 2ENWA 3BJZA 3HVIA 3W6UA 2HZ7A 3DE5X 3T1NA 2XD4A 4NBVA 1NV9A 2OSBA 5HPYB 4MRMA 1KE1A 4R2IA 1EHCA 3ENQA 3UF0A 1TDJA 5BRJA 4KMRA 5KTSA 5LQDA 3BMQA 1SBTA 5JAMA 1WOYA 4F3RA 2OB2A 1GQQA 4JROA 1KJ9A 2ZVPX 2O8VA 4CLDA 1WG8A 5EEGA 3H94A 2CBGA 2J9RA 3BICA 1BDHA 3C6QA 4AO8A 2GZ3A 5K0SA 1MO2A 1TKCA 1ODLA 3O7MA 3DFZA 1UBFA 3M70A 4MV8A 4F9EA 2C7QA 4YYZA 4AX8A 1ICEA 1UC9A 4JENA 4KRYA 1EVIA 3I2FA 1IBKB 3D3WA 1IUKA 5DBHX 1IQPA 3KDAA 3K8YA 1ISJA 4KXYA 5EJAA 2SICE 1D4OA 3TTTA 3IP7A 4GR5A 4BIMA 2R6R1 2Y71A 1OTYA 4QDJA 1AGPA 2XUQA 2QN9A 2VTDA 4JKIA 4BY9E 3WGJA 3GU3A 4A2CA 4PR3A 1I3KA 1P2TA 4QDOA 5FBRB 4JBLA 1DAKA 4MQBA 1J97A 3RC3A 5E7QA 4EVRA 2FWAA 2NV0A 1C7QA 3PCXA 1TT7A 4RKRA 3GWZA 3ESYA 4ZQFA 4LF6B 4FUQA 4OJNA 4QELA 1BS9A 3MUOA 3H13A 5JS2A 4RTSA 1LNSA 1ISRA 1CG6A 4GMDA 5TT1A 1QK4A 1RWQA 5H4GA 2CEKA 2EW1A 3I05A 4RMHA 4GNRA 2X2EA 2GHIA 2PJUA 2O2DA 1LZKA 3M1LA 4KTTE 1O5OA 1UBJS 5IDWA 3EVNA 3DOCA 1C7RA 1NMEA 4ENUA 5DO9A 5BUSA 1UBTS 2GUWA 3A6ZA 1TAUA 2Q1XA 3ORSA 2F1IA 2B92A 2TSYB 2X0RA 2ZRPA 2EX4A 3KEQA 4RABA 2WILA 3T9EA 3MWKA 1CDOA 5AVWA 1XVTA 4M22A 2FWPA 2ZJ2A 3IE1A 2V6GA 1DRWA 1ETHA 1R4MB 2R6DA 1M2JA 4JYMA 3K0CC 3UUFA 3JASB 3I30X 2C4KA 1WSRA 3PNBA 3QVVA 3HL0A 2N1MA 2OD2A 4MO9A 4IIFA 2NSJA 1NX6A 3A8KA 1E3EA 1VIAA 1A9XB 4MVYA 3WGUA 3A25A 4XJSA 3J81A 3JALB 3FOZA 1FRVA 1WOOA 4DAOA 1E3ZA 4JLWA 3STYA 1NX9A 3VMFA 1VG0B 1S4MA 2OV8A 2W4MA 4RV9A 4ZT3A 1UFKA 2HJHA 5EZYA 2IHTA 2XMGA 5BYJA 1SUPA 3AQIA 1NASA 5JPIA 4OQDA 2JL1A 4L4RA 1FFWA 2OFPA 3TB6A 1NKSA 3WL3A 2QHXA 4QT0A 3E9NA 4HN4B 3RFVA 3RVMA 1YZQA 4UE6A 3JS5A 4KPUB 1REQB 2IBMA 1QZ3A 4PVCA 1SXPA 2HMUA 1JHYA 2CDNA 3RVNA 2ZT7A 5JYDA 2H4XA 2FVYA 2BHNA 1CQJA 4Z9XA 3SJZA 5FA5A 1E3QA 1WZ2A 2G4VA 2J09A 3ECAA 3U9LA 1QG0A 3ZZUA 3KKMA 4GPZA 1DEAA 2Q5EA 3KJGA 2IYZA 5INTA 1NYRA 2BIFA 1YKSA 1AKTA 2ALJA 3ONFA 4P38A 4QPJC 1YA6A 3JAKB 1Z4JA 5C0OE 2OM6A 2QV7A 2DTXA 2X6XA 3TM5A 5CD9A 2C92A 5JNTA 1X94A 1GZ5A 1LDBA 4XIJA 5AHWA 1JECA 1UKCA 4HDRA 1IOZA 4B2YA 1P17A 5C81A 1E79D 3ZZTA 2WFAA 4KV7A 3KZKA 5SZJA 2OKGA 3ZS9A 1RCUA 1P1HA 3HJNA 4G85A 1RHRA 1NR7A 1U80A 2VJOA 4C01A 3MLEA 3DVLA 3USES 5ALRA 3EVBA 2DYIA 1B14A 2BJWA 2XEXA 1C1XB 3KBBA 3G6EB 1JXOA 2FLVA 5T6MA 3PUWA 3DZ8A 4LJ7A 1M2VA 3V1NA 4RA9A 1ZUWA 1MQ8B 2IU6A 1NTOA 4EPWA 3WYBA 2RCNA 3O84A 4BX2A 3TG2A 5J2TB 1U28C 1OJ7A 4LC1A 1W93A 4HDCA 2V31A 2I2XB 1XQ1A 4M54A 2I6XA 1CJMA 2P7HA 3DDOA 4JHLA 2JAXA 3L6OO 2RH9B 1Z4OA 2VUIB 5J9FA 1IHOA 3TR0A 3L04A 5EPUA 4EEXA 2JGDB 8MHTA 1OGJA 1NLMA 2Q8PA 3BG5A 4HDSA 2GQFA 2PYDA 1GCIA 4ZEWA 7ADHA 5KKAA 1RQPA 2OBMA 4AKHA 3ROTA 5K0FA 5LMCA 2REBA 9LDTA 3DO6A 4FCTA 1JMYA 4ZFNA 1NE2A 1GPWB 1GA4A 4LE2A 2OZVA 3EAGA 1QP4A 3O7WA 2ZTHA 3A9SA 3O3NB 1T3ZA 2Y8EA 5AKJA 4CEJA 5K3EA 1P6XA 1Q83A 2G3YA 4I5GA 4Y6SA 1PR2A 1LFDB 4RXUA 4AUEA 2WYOA 3S2ZA 4RUKA 3EW9A 3KB2A 3ACBA 2ECQA 4QOFA 1N4AA 1ZOPA 1R88A 4AB1A 1QU3A 3VAYA 3ZTWA 1HETA 3O3CA 1T5EA 3SFVA 4C03A 2HLDA 2CBXA 4GVLA 3L06A 4KMSA 4CV0A 1UPAA 4WZTA 1T2AA 3DEYX 1B8VA 4OHXA 4YWHA 4BZQA 1OZHA 1F3LA 4I9NA 1E0KA 3CUYA 1T4CA 3CWCA 1ADYA 5JUWA 4S1PA 1MVLA 4RK1A 1O8CA 3IPYA 4WECA 5AI4A 4H0CA 3F2IA 4F72A 2ZWIA 1QQ6A 4EI9A 1JF8A 2DSNA 4IM7A 5JSQA 2FPIA 4XX0B 1MG0A 2OQ2A 2VDKB 2WTEA 4BRZA 1YGPA 4GVXA 1NQUA 2G36A 5FFFA 5L3VA 3S5JA 4LVUA 4ZTZB 1Z5OA 2XV1A 3GVIA 2HQSA 4C7JA 4Q4HB 4LRYA 5TQ0A 5SYNA 3TSYA 3D8HA 4QVKA 5CA0A 4EW6A 1Y33E 3FPSA 3C3CA 1KIMA 1I0IA 1V48A 3LKBA 3AM1A 3N0VA 1KGDA 4L0QA 1L5HA 1E20A 1OHHA 3IA2A 1RC0A 1CEYA 4NFLA 4Y6RA 1G6Q1 3BCFA 4XMYA 1SURA 2C29D 2JGEA 2OXFA 1J8YF 3N8GA 4YUXA 1L8OA 1Y0YA 2TMYA 4ZDIA 2PWYA 2QWXA 1C7ZA 2W37A 4CIBA 4AZTA 4CV2A 2LR0A 4QGFA 5AJYA 1ZIDA 1JIJA 2PMWB 5D51S 2JBAB 4BP8A 2FQWA 3ZDQA 4C5BA 4BNDA 2YKGA 2JJQA 5FA6A 1HNNA 1JQEA 1WEHA 2NVOA 1KYQA 1THMA 2Z5GA 5HW0A 4YAJA 1EDOA 4F4UA 1ZNQO 3L7IA 1FQKA 1DPFA 2NTJA 4I19A 4UU7A 1XDSA 2ZR0A 4NOLA 3OJCA 4NMXB 5DMXA 1OYOA 4AY2A 2PGLA 3T61A 3S8EA 3T7KA 1RWBA 4NE2A 4TRMA 3FW1A 3ETDA 2MSLA 1H8ED 4PYIA 3WAJA 4N8EA 2IYUA 1EXDA 5KNLA 2ZAOA 2V74B 4DZZA 1S6YA 3FR7A 2JHFA 3OF3A 1U4OA 4MS4A 3TGWA 1KXJA 2ZL5A 1IG0A 1TTHA 2J4CA 1FSSA 3LXXA 4GSKA 4IUCS 2CK3A 4B7CA 5JCJD 4IG9A 1KZYC 1SVIA 5EUQB 5H68A 2ZYHA 3G59A 4Q1AA 3PNLA 5A7HA 1JG7A 3CURA 4C6RA 4A1FA 2FW8A 3DLAA 4K6MA 1OT5A 1SQ5A 4N6OA 1X1SA 5MDHA 3QWFA 3EMBA 4G8BA 3BTUA 1ATIA 2FEAA 3MUNA 3LIPA 2A86A 4AJ9A 4F3YA 3VR2D 1QCCA 3GIDA 2FPMA 3PUJA 4IUBS 5F4BA 1M1NB 2HA5A 2JGNA 3KR2A 3U62A 1OX4B 2IYXA 4I6JA 4IJWA 4BFWA 3OQPA 1DCFA 4BBAA 1OE0A 4RJLA 1Z73A 3ORFA 3WLNA 2AUMA 4MZXA 2DFNA 3A8TA 1LLCA 1DEKA 1QNLA 3GRAA 3Q88A 4KIJA 4KH0A 4MP6A 1G38A 5TQVA 3H0CA 1VBMA 4AY5A 3IL2A 1V11A 3IBCA 1EJ6A 3CO0S 3BXOA 3IFSA 4PGFA 3HMKA 2Q50A 3IHTA 2IDMA 1X9GA 2M5SA 1Z36A 1F4LA 1LPAB 3NV7A 4BUZA 4OATA 4U7FA 5F2KA 4EZEA 1NW4A 3H87A 4MQFB 3EVCA 1QYDA 2AFHA 1TGYA 4LYHA 1LUAA 1YRHA 1UEJA 4FYWA 1AS3A 4PRKA 1K5PA 2RHHA 1W30A 3QMWA 2I03A 4CMEA 5EXTA 3I9V6 1JUDA 5KREA 2ZB2A 3CVVA 4LVOA 4J7XA 1GPMA 3WKDA 3TZ6A 1KSHA 3K1AB 4YJ2B 1LPOA 1G8MA 3T53B 1P1BA 1RSZA 1YZHA 2EL9A 2BLNA 4P4UA 4Y0AA 5JBQA 4R2HA 1KZGB 4M0FA 2B25A 3KVNA 3I5MA 3Q1LA 1OD6A 3PKIA 4KOAA 1RXCA