2QDXA

P.aeruginosa fpr with fad
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
257
structure length
257
Chain Sequence
SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLVTREPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDDRAMICGSPSMLEETSAVLDSFGLKISPRMGEPGDYLIERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin reductase
publication title Biochemical and Structural Characterization of Pseudomonas aeruginosa Bfd and FPR: Ferredoxin NADP(+) Reductase and Not Ferredoxin Is the Redox Partner of Heme Oxygenase under Iron-Starvation Conditions
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 82
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qdxA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2qdxA02
2X3UA 1YHQB 1TLLA 1W87A 1VQ6B 4B44A 3ZBUA 3CB4A 2HMAA 3LVBA 3CCSB 4DQKA 4U9UA 1VQPB 1QUEA 1S0UA 3AVUA 1AMOA 4H9GA 1FNMA 1H42A 4IW3B 1VQ4B 1F20A 4BPRA 4Y9UA 1W2BB 4LC0A 1E62A 1HA3A 2DY1A 1QGZA 1D2EA 4QHYA 4B3XA 1YJNB 1FNCA 1S72B 1EP3B 4LBVA 1QUFA 4B4DA 1NDHA 4M2LA 1OGJA 4NCNA 3I56B 3CCRB 2OTLB 1TVCA 5DSZA 3G6EB 1Q7YD 2D74A 2EFGA 1ZUNB 2DERA 1DDGA 3AVWA 3JQRA 4PC3A 5H59A 4FWTA 2PIAA 1N0VC 5GV7A 3W2IA 2GPJA 2QTLA 3W2FA 1KQSB 1GO2A 1KJZA 3QSYA 2C78A 1EP2B 2VZLA 1QVGB 2VNKA 1GAQA 4PC6A 4MYUA 1E64A 1CNFA 2R6HA 2BVNA 4M0LA 3MMPA 2BV3A 1EFTA 1KRHA 3P26A 2B7BA 2BN4A 2QTZA 1H85A 3E20A 2YWEA 4B48A 1KK3A 2VYQA 5TV2A 4ZV4A 1U2RA 1YITB 2B7CA 4PGOA 3LRXA 3B78A 4YAFA 3MHPA 4WQMA 5EMNA 5KSWB 4B43A 1CQXA 5TY0A 3V76A 2OTJB 3VNVA 3CCQB 3CCJB 2YWHA 3OJWA 1K73D 4RD4A 3ZBTA 1EFUA 4ZGQB 2BGIA 1VQ9B 4ZCLA 4LBWA 1YJ9B 3U6KA 1IJFA 4RD2A 1R5NA 2E1RA 2XEXA 1JNYA 3WBJA 4G5GA 4TMWA 3OZUA 1QGAA 5GV8A 4ZGNB 2YWFA 3ZC3A 1CNEA 4RD3A 3VMFA 1BX1A 3QE2A 4M1KA 2BMWA 1EWYA 4N3GA 1KTVA 1UMKA 1KD1D 2C77A 2PLFA 1JB9A 5HXBA 3CCEB 3OZVA 2J7KA 3MCAA 1FNDA 3WYAA 2DCUA 3QFTA 3A1FA 1B23P 4RD6A 1OGIA 3OJXA 1BQEA 1YI2B 3AVTA 1ZM2A 4P6VF 4TMXA 4YAOA 4P3YA 4DQLA 3ZZ0A 4M4SA 3CCVB 4C43A 4YAUA 3CXCB 4UAJA 1YJWB 3AVXA 3CC2B 1QGYA 4G1VA 2BM1A 1N0UA 3VNUA 2QA4B 1VQ7B 1VQLB 2EIXA 1R5BA 1DDIA 1AIPA 1NJID 3W5VA 1QH0A 3FPKA 4Y9RA 2GQFA 4LBZA 1GVHA 1XB2A 2YWGA 2DETA 4TMVA 1JA1A 1EFCA 3QFCA 1FRQA 1G7CA 1J9ZA 5H5JA 1GR1A 1G7RA 3AVVA 1EP1B 4YALA 3OZWA 3CCUB 1KC8D 3G71B 3AVYA 1N8RD 4TN1A 1VQ5B 3WNCA 4ZCIA 3JQQA 4YHBA 4RD1A 3SJZA 1OB5A 3CCLB 1VQNB 4M53A 4Y7CA 3WXMA 1BJKA 4FN5A 2BGJA 4B47A 1Q81D 3CRZA 3PENA 5TR9A 1K9MD 1VQKB 2QDXA 3WY9A 5AN9A 1JA0A 2BPOA 2BM0A 4QFMA 2FX3A 4RCZA 2QEXB 2OK7A 1GJRA 4RD0A 1TUIA 5JBQA 3ZZTA 1R5OA 4MYTA 1W34A 3B8HA 1M90D 1Q82D 2QN6A 1W35A 4R71A 3P27A 1IB0A 3AGPA 4ACAA 1D1NA 1FNBA 1ELOA 2B5OA 4AF6A 1VQMB 1D8TA 3LYUA 2AHOA 1BX0A 4N3NA 1G7TA 2XNJA 4PC2A 2RC6A 3W2EA 4AF7A 4HE5A 2DEUA 3ZZUA 4AC9A 1QVFB 3FJOA 1VQ8B 4Q7JB 3WNDA 2PMDA 1IJEA 4K1XA 3VO1A 4NBSA 1K8AD 4ACBA 1ZM3A 1YIJB 1F60A 3CPWB 1QFJA 4YAWA 1OB2A 4PC7A 2HCJB 3ES9A 3W5HA 4F7DA 3CMAB 1XE1A 4PC1A 3I1FA 3CC7B 1EXMA 4C0SA 3AGQA 1QX4A 2OK8A 1A8PA 1JJ2B 3CD6B 2BSAA 1B2RA 3U6BA 1VQOB 2CNDA 1Q86D 3W2GA 3CC4B 1TTTA 4ZCMA 4TMTA 3W5UA 3J81k 1ZM4A 1E63A 2VNHA 1FDRA 3OW2B 2VNJA 1G7SA 1QG0A 4HE6A 2ZITA 5THXA 3VO2A 2RC5A 2VNIA 1KK2A 3B82A 2XNCA 3QFRA 3CCMB 1I7PA 2NPFA 3W2HA 1DARA 1QFZA 3I55B 1SKQA 1WDTA 5FA6A 3JQPA 3E1YE 4J0QA 1SM4A 1DG1G 1FRNA 1KK0A 2BF4A 3CW2A 4RJLA 3QFSA 4FK8A 3WNBA 2HDNB 1QFYA 1ZM9A 4RCYA 2QMUA 3U2QA 1M1KD 4EH1A 3LO8A 4G1BA 4TMZA 3G4SB 3WBKA 3CMEB 4LBYA 1GAWA 1KK1A 2CRVA
chains in the Genus database with same CATH superfamily
2GR9A 4WUVA 1JH8A 2YN4A 3BIOA 3AFIA 3QPBA 1KFCB 1W73A 3GEDA 4TLCA 4X1YB 1M5RA 1XF1A 5I7UA 3FB4A 1GQRA 1QRDA 1ANKA 4JB3A 4BUJA 2C5AA 4Y2PA 1AQNA 2Y1OA 2QGFA 3GVKA 2JCSA 1SN7A 1L8XA 3A06A 2QZ9A 3NJRA 4YJ2F 4EI8A 5CB6A 3ZD6A 2C7OA 4QJ5A 2B30A 5K0NA 1Z5GA 4CM5A 4B2LA 1Z06A 2XD4A 3K0SA 1VSUA 2ZIUB 4XSVA 2EIHA 1ZS9A 1X7XA 1KZLA 3CLSD 1Z2PX 2P9TA 4DSUA 5FEMA 1KERA 4PRLA 4JUFA 1T8PA 1MR3F 4ZKEA 2ATIA 3O9VA 3SHTA 2VUUA 5EXEA 3NIDB 3F4BA 4HNGA 4ZU1X 2VPTA 5REQB 4NABA 1BDBA 3GVIA 4IKEA 1SA0B 2ZUVA 5L40A 5A3JA 1IN5A 1HLDA 5AW3A 4BNVA 2PE3A 3I28A 2WIGA 2PZKA 2XTMA 3O1JC 4TRRA 3ROMA 5KVSA 1CQJA 4JLBA 1Z2CA 4KZKA 3PKZA 1W1WA 2XGOA 3TLBA 3WWDA 2X6RA 4KU4A 3DZDA 1ULAA 2WABA 2QUZA 2AZ4A 1KDRA 4J9VA 1NR5A 4QGFA 3WIOA 3M9XA 1DWUA 1MB4A 2XUHA 5JISA 1FFYA 1DSSG 2SNIE 3K8ZA 3NBYC 4MJ7A 3FTEA 2N0SA 2WHXA 3K72B 4TMKA 4OV6B 3P0IA 4A23A 4ZMRA 3VU1A 3T6KA 4OQEA 1A1SA 2M1ZA 4M0DA 3E5NA 2WOOA 2AMYA 2AFIB 1NKVA 4I9UA 4EJ6A 1N2XA 3INTA 1JPJA 3EYAA 4WVLA 1ZUNB 2VPXA 4WK4B 5FL7A 4LSZA 4E31A 4EYGA 2E7ZA 4YJHA 1X77A 4XSGA 2JAHA 1YAHA 4XLAA 4RTKA 3MTAA 2GCPA 2YFYA 6ADHA 1FS6A 3LCCA 3T9EA 4DBLE 2R96A 3C8ZA 3PFWO 4EFNA 4I4TA 2REQB 1D4ZA 2AXEA 2XMGA 3BWEA 2YC2C 1D1QA 1MQAA 3D4LA 3DZHA 4HJRA 3FHCB 4Y1EA 4ZOLB 5JDCC 5MN6A 4Q4LA 2QTLA 1VRVA 3CLRC 1YQ9A 3E22B 3JQGA 3LSYA 3TPCA 4F5DA 1PV2A 4MUGA 4Q4AB 1HF3A 4RH1A 1AK1A 1RYDA 2DWCA 4GDMA 2C78A 1E7QA 3EAGA 5FJIA 3EC7A 3SNHA 2ZQ5A 3IHKA 1COWD 1ZAYA 1KEKA 5EZSA 1QVGB 4WFIA 1GAQA 1LLFA 4UZFA 3RWOA 4EJFA 5BRAA 1XNRB 2IK8A 3HBMA 5IULC 2VQ6A 2YV3A 2WU0A 2FE4A 5F76A 4ETWA 3TG8A 1ECGA 2PS1A 2SICE 3UATA 4OIFA 4UCXA 1YZTA 3KV1A 1S6YA 3A4IA 3MXTA 3V2HA 1MXHA 2C2YA 4QZVA 3BRWD 3GNSA 1OLSA 2IHTA 2WUFA 5CDHA 4TWBA 1XQXA 1F4PA 1YL7A 1L5HB 3MWEB 1BU5A 3ENVA 4NBWA 2QTTA 4AMVA 2CL6X 4ZVOA 4LF8B 2TSYB 5B64A 2UXDB 3MB8A 3LIPA 3T7JA 3E20A 3KR9A 4HNSA 3A3BA 1R15A 1ICIA 4N5LA 2AKEA 2QE6A 1NA5A 2YASA 4PWYA 4F2GA 1L4UA 1JFFA 4XM2A 1N2GA 1XCMA 3FMOB 4MKZA 3ZBPA 4DRYA 2XCRB 3A1TA 1RWOA 3GBVA 3RSHA 4ZV4A 4DIOA 2HO5A 3QNUA 4EVRA 3LX8A 4BNGA 4E07A 4QFDA 4KO8A 1W0JA 1NDQA 2HAEA 3K1AB 5IAEA 1WXXA 4R8RA 1FVOA 5E1BA 3MHPA 4KJZA 4OL0A 2R2AA 1KAEA 1P2GA 3TAUA 2XVXA 5FT9A 3SLRA 2I2AA 4LF5B 3KSBC 4UHEA 2ZRBA 3ZU2A 3OJWA 9ATCA 4WNIA 1QCYA 1U0TA 3LCUA 4C9BA 4G5OA 5T4EA 1UFOA 3BF8A 2E3JA 3FNRA 1QYDA 1EUQA 1OAOA 4JBNA 3PA1A 1CY0A 1L7DA 2GVDC 1NI5A 1TD1A 3A4TA 3FPSA 2IZ7A 3HU2A 2OV8A 4U2EA 5C31A 1QO0A 4EYOA 1HRKA 1L5ZA 2ID8A 2R8RA 1EHYA 2HRCA 3EXEB 4QXOA 4AJ9A 4LDNA 4TZ6A 4DEXA 4MW7A 2QG6A 3SSAA 3NX4A 1IJFA 2G9VA 1A3CA 1HE4A 2MSCB 2MWMA 2GJRA 5ERYA 1ECJA 1N2HA 2JGDA 2NYVA 5B2EA 1K5HA 3QVKA 5CNKA 4C4RA 5AW5A 3JALA 1G8AA 5HBGA 4CV3A 5EAIA 1IUOA 1X1BA 2FPUA 2R8EA 1M8FA 3TLZA 4HVCA 1PJRA 3GJZA 3KKLA 3OZBA 4LQLA 4DYDA 4BDTA 4UTRA 4F3TA 1C0IA 3IDOA 4KI7A 4NZZA 4EFLA 2YUTA 2PSHA 4PINA 1CRQA 4U7GA 3AJAA 1LX6A 1PJSA 3E3NA 4LJSA 1PEAA 4ROTA 3GJ7A 1CDEA 4QYIB 3DBOB 4FT2A 4FHGA 1NB9A 4PSDA 7MHTA 3VOBA 5L51A 2ZRKA 4C7KA 5CYGA 5E2IA 1A5ZA 5ICCA 5JTUA 3HDQA 2H65A 3K4QA 2ZJ7A 2I76A 2FP4B 1Q44A 2PU5A 3ZEIA 1HT2E 4ZRNA 4GRIA 2LW7A 1J0CA 5CX1B 1RWWA 2EATA 2LIPA 2R6JA 4LG1A 2OBTA 4D9KA 1KD1D 1PJLA 1FTWA 3AUTA 1R8SA 1SO8A 1EQAA 3A1WA 3IEPA 3QKTA 1E96A 4JU8A 4UULA 3ETDA 1SKMA 4YREA 4EDHA 5KTKA 2ZDGA 4N12A 3IYLW 2HA4A 4ID9A 4PZLA 4XYEA 1Q83A 3WLNA 3ZI0A 1GPDG 7REQA 1R8QA 2N1MA 3PI6A 4Y0AA 4BBPA 3WAJA 5HQ3A 4NPHA 1NMSA 5DNVA 4RD6A 2EJUA 1SU4A 2D2XA 3C8MA 3LAWA 5BW4A 5LQJA 1FOEB 1ZM2A 2NZVG 3CXUA 3PPVA 2YS7A 4FUQA 3RUHA 4AP9A 4CQMD 5I01A 4KHPB 3WADA 4P3YA 1IN7A 8ATCA 1M5UA 2IHNA 2E18A 1V37A 1V3VA 3I3SR 3MINA 4B73A 2M6LA 2F62A 5L7WA 2EFJA 1AXGA 1U6KA 4TKMA 3VFDA 3ZWBA 2GT1A 2ZULA 3H11A 4OO3A 4UM9B 3KJQA 4DNTB 2WV7A 3RYFA 2QRQA 4JLUA 3W9BA 3AVXA 4RNDB 4TVBA 1WZ2A 2XUOA 4E09A 1PJBA 1DLJA 1P2DA 1SQGA 3VHXA 1LTQA 1R6AA 4OSEA 1XTIA 4YRBA 1ECBA 1JHMA 1N57A 1MJGM 1YAJA 3ZWMA 5FUMA 3CTAA 4K88A 3WDSA 1ADBA 1QVWA 1Y8CA 3KDSE 3EISA 4P34A 4LN1A 3GI1A 1VQLB 3DBIA 3W3AA 4Q03A 4WZ6A 1R5BA 2AJTA 1AIPA 5CA0A 4BLOA 4O25A 4PGMA 1E9AA 1N2ZA 2GJAA 2QLFA 2UZ1B 1PL8A 2WLTA 3NB0A 4CEHB 1SQ5A 2M6SA 2PANA 3FM9A 3G0OA 2BONA 2XGGA 2JIOA 4AMBA 2J9XB 5FWYA 2NTNA 4JV5B 3O5AA 3R40A 1G3UA 4F4HA 2P9CA 1DAKA 1JXMA 3MWDB 3GFBA 3JD2A 4Z4GA 4JJKA 2ZSJA 2YC4C 4Q48A 2FF5A 3M1IA 5JE8A 2XJ4A 5CLFA 2BFDA 2BMEA 4W7HA 2E37A 1RHJA 2PKEA 1K6EA 4I81A 1ZUWA 1NYLA 5ALIA 1FUUA 5IP5A 4JYBA 4PTLA 2W42A 3JAWA 3B1KA 2ZJFA 3V1UA 9MHTA 1QU2A 4L6IA 1MZVA 1CUSA 3EF0A 4R6XA 1N6NA 5K0ZA 3GAAA 4OLHA 1EDEA 5CVCA 2XF8A 4BQFA 2NMVA 5CEFA 3RVKA 2HWWA 3QVGB 2XV1A 1KC8D 3B9PA 4TUYA 4DMUB 3T38A 4HPWA 4BCDA 4KR2A 5TQVA 2CJXA 2HPZA 1CR2A 2FQWA 1RRVA 3SIWA 4GMGA 3B6EA 1ID1A 1H1TA 1D03A 3K8YA 2HADA 2JD0A 2IYNA 4OGLA 3JWJA 1QFSA 2NU7A 2ZTVA 4GOMD 1OB5A 3TL6A 1DFHA 4MUNA 3NHRA 3EJWA 3IC5A 3D3WB 3H8JA 2X5OA 2P27A 4Y7CA 1GA6A 5J23A 2W2XA 2WU8A 4KLNA 2OHVA 5TS3A 1AN0A 1NI3A 1P5RA 5E7QA 5A9SA 2P6RA 1PUIA 3IMKA 1W4AA 3SLGA 5CLJA 3NHPA 4BDSA 1RJFA 2ZSAA 3AILA 2SCUA 4JYMA 4NEHB 1OQAA 3A8TA 3V4SA 2X41A 2OGUA 4QVAA 4BFZA 4TSKA 3KHSA 2NU9A 4NCXA 1JBQA 4BPBA 4R31A 4M38A 4XGRA 1AV6A 2NVWA 3A7EA 4OK3A 1Y5RA 3EFOB 5JLJA 2YQ4A 3UOWA 2ZATA 5GONB 1BJRE 3VU9A 4KDEA 3O82A 1NBAA 4YJ3A 5CM8B 4XKWA 4PY2A 1BDJA 1DX6A 4A0RA 3OZXA 1FU7A 4OI1A 3G9XA 3SQXA 4EGFA 3U7QA 1PJZA 2VR1A 3ZUGA 3PGJA 4R51A 4UHKA 4JXXA 4S2EA 4WY5A 5LC1A 3BXXA 2ZVPX 2Q4DA 3LQEA 1VYHA 3AZQA 1C0LA 4LV8B 4P98A 4Y0VA 3FPPA 1EWTA 3NATA 2NUAB 2F4NA 4Z49A 4CHTA 4B3TB 1DJMA 5BV7A 1CC1S 4L95C 4A2QA 1E9BA 1JZQA 1ZH6A 2PR7A 1EGAA 2VF7A 4OHCA 5JXJA 1MBZA 4G4SO 4MWOA 4D0LB 3NVKI 4KO4S 3EZFA 2B5OA 4DR6B 2CCJA 4LY9A 4R1TA 4EIWA 2A57A 3QG1A 3P4UA 4MB2A 4QEZA 3UO8B 5HSGA 2I2FA 2O2ZA 5A3QA 5TMPA 2QQFA 4GM1A 2MOKA 1XTQA 2FPWA 2W6QA 4KDFA 2WEKA 1SWWA 3VVLA 4ZYTA 5LPNA 1FVXA 1YE3A 3WO1A 3D26A 1VPEA 3BF7A 4BVKA 5IT4A 2CBGA 1I2AA 1DNPA 1NIJA 3PT5A 2VHVA 1EX7A 1C7EA 3MOGA 1PTJA 1D0VA 3IQZA 1WA5A 5B3KA 1HDYA 3H2ZA 4Y18A 2VJIA 3VZCA 1FBNA 3OQVA 4MAAA 4C0XA 3WB2A 5DN6A 1OKKD 1B6TA 3GY0A 1PBNA 2GGSA 1GG2A 3NU1A 3U62A 4OUDA 2YCLA 4PLFA 5K0BA 4P25A 3KM0A 3IP7A 3OUTA 2CVQA 3OOJA 5LP6A 2G5PA 1GKIA 2J46A 3EBLA 1AK9A 1IWPB 2AOTB 1M8PA 2EAUA 3UUGA 4JI0B 4B7AA 1H8HA 5K3DA 2HRBA 3H87A 4FFLA 4YIKA 1IJEA 1AD2A 1CETA 3P9PA 3GEMA 2ZTNA 1FEZA 3ZE9A 1E89A 3KOUA 2C9YA 1PZHA 3EHEA 5KOYA 4JLWA 1UZAA 3C1AA 4QQ8A 4AURA 4C07A 4ASUA 1CZLA 4ZQEA 4Y2GA 4UNQA 1KIAA 3GLQA 4JSTA 4E3WA 5JFTA 1EB8A 4K9DA 1RABA 2X6WA 3ZHSA 2GM4A 1J7JA 2KI5A 1OREA 3GK3A 4NXNB 1OB2A 1FX1A 4UZUA 1F6DA 1C7QA 5AI8A 1N2BA 4HNRA 3IL2A 2PH7A 3MFQA 4URYR 3SXJA 4ZA2A 4I50F 1PNTA 2XZPA 3PHIA 1JJFA 4UBOA 1I3MA 1TM4E 1XRMA 3C14C 1JKJB 1GKLA 1UT8A 5T4BA 5IXJA 4I1OA 1NWCA 2XIQA 4HRAA 1VBMA 2L69A 5JD6A 4XW2A 1PL6A 1YR9A 4LE0A 1QBGA 2HWUA 2YS6A 3ML1A 3AGQA 2P9BA 3FTNA 3TSAA 3QKIA 1Q1GA 2DWQA 1OAOC 2O0HA 4OXYA 1SC4A 3LOQA 3VU3A 5L9AA 3HUEA 4O2LA 5AVOA 2D5LA 2WKQA 1XI2A 1W5FA 3FMVA 2JJ8A 4KMSA 3UMCA 3L8FA 121PA 2Y77A 3S8MA 2X58A 1CEXA 2J31A 2CNDA 1LPMA 3WMFA 3ZV3A 1KJIA 5KWVA 4YRKA 2M9MA 3W2GA 1UKYA 1ZIXA 4HQKA 4I19A 1L4NA 4CFYA 5IDXA 1AZTA 1XZKA 5FPQA 5FR1A 2J85A 2GN4A 4B33A 4M8NE 2FTKE 1KOFA 5FOTA 2WD8A 3GIWA 5B36A 3GT4A 3WS7A 1G4HA 2TS1A 1LGYA 1AQUA 3QOYA 5A1JA 2RI0A 1I9GA 1KEPA 1F3OA 3GLIB 2LZ0A 2EARA 4Z9AA 2PGNA 1S1CA 5EPOA 3SCZA 4NZYA 3TZEA 3RSFA 1VDMA 2ZZEA 4I8DA 1BKDR 1MB3A 2OUIA 4Q6BA 1WV1A 5AIAA 3MM4A 1A77A 3VR6H 5LIPA 1NXVA 5CA1B 4MV7A 1GRVA 1EK2A 3BKWA 3D4PA 2NTJA 3M4XA 4D44A 5J3OA 1SUDA 2E5FA 3TZCA 2BKAA 2DY0A 3A6FA 5LQCA 1Z62A 3E9QA 4LC9A 3SD7A 1MX3A 4DDHA 3TLEA 5B4UA 5ITZA 4FHZA 3JTEA 4PEVA 4WZAE 4RLFA 3GPCA 4R98A 3I2KA 2XH8A 3TXXA 4NULA 2HU8A 1H9AA 5HJ2A 2X6XA 1FTGA 1KBZA 3L1JA 1B41A 2OXEA 4LYEA 4KFTA 5FV7A 3ZYZA 2CMHA 3BH6A 3OM1A 5LQKA 3PCXA 2X2EA 3MT8A 2DKNA 2VSNA 4LSWA 4OKSA 5AUPB 5JATA 2IUTA 4YAEA 4F1WA 1VPTA 1GWNA 2QSYA 2GVZC 4RBNA 3VH2A 2B5VA 4ALJA 4M9UA 3V1LA 3QVUA 4XYMA 1J22A 2VBIA 5DVZA 3EZYA 4CIDA 1E77A 5JHHB 1QB7A 3T54A 1RCTE 4HPXB 4CG1A 2YVAA 2R68A 4MP3A 2O8CA 2GVNA 3PVSA 4AJJA 3R1IA 5JD5A 4L74A 5FNVB 1TKCA 2Q5CA 1C41A 2PLAA 4Z0NA 2OBRA 3RC2A 4DSOA 4IH9A 4LYYA 5C80A 4WKPA 3EOAI 2RHJA 3PQ3A 1Q7RA 3O84A 3VPAA 2Q7DA 3KCQA 5DBHX 3PFBA 1RLUA 3UWOA 1ZQ1A 3PLRA 2B1GA 3CMEB 2RHBA 5CDFA 3HJBA 5BOVA 4B3HA 5HOQA 3AX6A 1DDOA 1JN0A 4RFSA 4DA8A 1D1TA 4LNUA 1ISSA 3QELA 3LX6A 1FJHA 3LQRA 2B6HA 4I1SA 3BMNB 1GUFA 4D0RA 1DIGA 1ZMBA 5HMLA 3OX1A 1SHZA 3RS7A 3OO0A 2CWWA 3UF0A 5JSHA 2NG1A 1D5WA 5K8IA 3C3AA 1V9CA 3LPDA 4FFDA 4AYTA 4DR1B 4MO9A 4UU1A 3E8MA 2AZTA 2NZWA 5JS6A 3LHSA 3HXKA 1YZYA 2JATA 3DSRA 4EI9A 1P73A 1QHEA 1H42A 2CXOA 1G64A 2NXNA 2ECFA 4NYIR 4YDSA 3HBFA 1BWPA 5KNDH 1QZ3A 3D9QX 5D7NA 3OIDA 1T6BY 3OOSA 1XD9A 4KFSA 4MP8A 1OX4A 3W9UA 4P0TA 3DZJA 4XWTA 3HUTA 3ZVMA 1TUEA 1AX9A 4IV8A 4ZZ1A 1XMQB 2G1PA 2V7BA 2NUPB 4RTSA 5ER6A 4UPDA 2ZT5A 1BHSA 1D6NA 1GV1A 4QGGA 1WUJS 2FSFA 4A03A 3LKVA 3HKCB 4TWRA 3EJ6A 4FHEA 1X94A 1PGNA 3N0WA 3QJGA 3BB3A 3OPMA 1SK8A 1VJCA 2HBZA 3UG6A 4TVKA 3FR7A 1I6WA 2KYRA 3O92A 4JVOA 4X61A 3CRRA 2VO1A 4I3GA 1ZCFA 2XOKD 3BJIC 4UC0A 1TQHA 4DCNA 3AUXA 2VTBB 3H2GA 1J1IA 2R1TA 5EMMA 1U2GA 3G49A 1XPOA 3B3GA 2XPCA 1S01A 2PD3A 4MKFA 1U2EA 2BOVA 3F7NA 5DWQA 3IEKA 3G0BA 1MH9A 4TKZA 5K01A 3QHAA 4FPXA 4AECA 1TF7A 3KT6A 3EW7A 2CLCX 5TPWA 1QQBA 2BD0A 3E58A 4Y98A 1ZA2A 3G0CA 3IDZA 3LUFA 4Y2QA 5JT1A 1WCIB 1S2NA 4K6KA 3T61A 2P2NA 3V7YA 1I6LA 2JANA 1TA0A 4ARSA 3HI6A 4WJKB 4E4RA 3DOUA 4EPVA 5FPKA 4E0FA 2I2CA 1JGTA 1E5VA 2O8VA 2VPQA 3E1GA 4L3WA 2A0FA 5LLTA 3KO8A 4DK1A 1G98A 5EMHA 2FOIA 3HTXA 2CXNA 1DUSA 2GD0A 2WD7B 2ZSIA 3P9KA 5LLDA 3QOFA 4YCSA 4WXPA 3O4VA 4BE7B 2QMZA 4H18A 4DBVO 1XTPA 4GPIB 4PYLA 2R6HA 1G3QA 3K0AB 5KHOC 3ER8A 4IJKA 1ULSA 3A3OA 3TIIA 2CSXA 5IBPA 3PEUA 5L3ZA 1HXHA 4HVTA 3QXSA 1JEJA 2Y6UA 3L41A 5C8YB 2Y71A 1N2JA 3LV8A 2JGIA 1PV1A 2QBYA 1WBDA 4NONA 3C3DA 4ND2A 4TV9A 3V00A 1GUDA 3P32A 4XLCA 5FPSA 1GDTA 4RA9B 2FVGA 1GG8A 1BEEA 3K5WA 3N5KA 7ADHA 5K8LA 2TRSB 4Z4EA 1Z37A 3IVAA 1KNXA 3MK31 2XB9A 2OBBA 4EYKA 1E1NA 2VYQA 1U1EA 4X0EA 1TF2A 2AJBA 3IAM1 3BSSA 1UKEA 1XF9A 1NVMB 2WJJA 2GZ3A 4ZOEA 4S3MA 4WWHA 1ZWKA 5I45A 4CTMA 4FYVA 4YCJA 2WWRA 3IT2A 3STHA 3WYBA 1A4RA 3TZBA 2V7EA 1E1CA 4JLMA 2QLTA 3DEYX 3QX8A 2GZAA 4GC5A 5E6RA 3SZMA 3VSDA 3JASB 4ERXA 1Q9SA 2XCSB 1KI6A 4PHFA 4LGYA 4L0CA 4G1MB 1AKWA 1PFQA 5B58T 1UCFA 5LP6C 3B70A 5BN3A 1FDOA 1SCBA 1KH1A 2CLFB 3ICWA 1S9DA 1QTRA 3KDAA 4ZCLA 4GFDA 4Y6QA 3U4GA 4MQ6A 3BHJA 1T8RA 3WKAA 4ZKDA 4ZHQB 3CSDA 3HN7A 5E6UB 4CIYA 1EKXA 4L3OA 4X20B 5BQPA 2X0EA 4UNPA 2PRIA 4LOLA 1QH9A 4GL2A 2ETXA 1RRGA 4UNSA 2ZRGA 3SJ7A 3BMCA 5AW0A 1XU9A 1US8A 2R6AA 5FOQA 1W0KA 2ZYHA 4Q9KA 1W93A 3ICOA 3TOCA 2ZL7A 3V5NA 4DA0A 5IDWA 3SS8A 1B3RA 3C48A 3ITNA 2FZGA 3PYMA 3L93A 2RKWA 5KIAA 2QD4A 4LYHA 2PD4A 3ANTA 2E1RA 5EOVA 3ZCTA 3OZTA 1Y80A 2PA0A 3OWOA 4D9BA 4O0MA 5JSZA 1WTHD 3EZ6A 1E7YA 4MKXA 4OHOA 3TRHA 1LQTA 3IXLA 4OKNA 3BRQA 3B6MA 5C5EA 5JNRA 4ZGNB 3P9ZA 4NHEA 2ZG6A 2RJNA 4N76A 2X0IA 2J0VA 5KTYA 4JI3B 3Q3CA 5CTAA 3KHTA 3RREA 2JLBA 1YDFA 2ZCUA 1I94B 5CHEA 2WSBA 2XE7A 3FUWA 4ETNA 1R27A 1BGXT 2ZT8A 4O2AF 4EPYA 1XQWA 1TYZA 3L6EA 2A8YA 3NDIA 5JEDA 3ZVRA 2G67A 2PEYA 3EE6A 3TX2A 3V3KA 4BGVA 1UMKA 4LWOA 4FS3A 3SC6A 2JL1A 1V71A 4R8MA 2C5FA 1T1JA 5LQUA 4RZ2A 5K3BA 2GREA 3KWFA 4MLDA 3MNFA 3WBFA 1T5IA 3ELYA 3RFXA 1ZVQA 2C5LA 4DK0A 3LBHA 2DCUA 3W5JA 1THTA 4V0KA 4RADA 3PIIA 4FGWA 4YROA 3OWXA 2H08A 3RSGA 2YNMD 1OGIA 2WYOA 1P6UA 3C5CA 1QNLA 1SBHA 4RQUA 4A9AA 2A92A 5INTA 2F1JA 2FVXA 3KTAA 1C30A 1GNQA 1U4OA 2R6GA 4HZGA 3PFNA 3ZS8A 1RACA 5FB3A 4E7PA 1QFXA 1NYTA 1OU4A 1G17A 2HQOA 1E5TA 2LDXA 3ASQA 2PL5A 2QMEA 3GRVA 3H2YA 4MCIA 4X93A 1KQNA 4R54A 5BVHB 5HNKA 1J00A 2O3TA 3CF2A 3EOZA 2I71A 3PHCA 4LDQA 5FYDA 4CQLA 2VAMA 1OVMA 5AKEA 3GPDG 1QPGA 3QPWA 3PA6A 1IUPA 1PS0A 2L2QA 1K08A 3G8BA 2GPSA 4HDSA 3BHNA 3B85A 4N0PA 1XQ9A 3A4NA 3X2EA 3EQ7A 4Z7QB 2OZVA 4W9MC 4YWHA 1KYWA 1DJLA 4K0KB 1C9MA 4BIIA 3W5VA 3FPKA 2QAJA 5ALTA 2QF7A 5EE9A 5FD8A 4B8ZA 2VYVA 3W5SA 2V6GA 1KJWA 1XJWA 3D4NA 3GLHE 1MV8A 3OMXA 1L5VA 3PCTA 2G9RA 3TQTA 3RVPA 5G2OA 4MLZA 3WFJA 1NFRA 4MWZA 3V1TC 4ZJUA 1LVUA 2NM0A 2WU3A 5TEVA 4X7MA 1RXSA 5B1EA 3Q5GA 2G0TA 1JIKA 5D6NA 5DS0A 2AA3A 3NWBA 1SIUA 1BCRB 3QFCA 4KX3A 5LD2C 1YGYA 3Q4GA 5E95A 3AJEA 4EHLA 1MT0A 1I18A 1NFQA 3M7IA 1OGYA 3QBTA 3GFFA 5LKAA 1P4SA 3HUFA 3IPRA 2GPAA 3LCVB 4EA8A 1K4KA 4UTVA 4KR6A 1IMJA 2X19A 1ESEA 1EI9A 4MV9A 4M8LA 5F3RA 3UHOA 3O93A 3FRJA 4E1VA 2OYSA 1EVQA 3CZAA 3MWKA 3OLYA 1SBCA 1BXGA 2AN9A 1UP6A 2EJVA 2XIJA 3ABSB 4QYXA 5EGSA 4EATA 1DC8A 1UK7A 3NDRA 1X6VA 3GT3A 1FVHA 4UUPA 4E2WA 5LQRA 3V9PA 4YMUA 2VJMA 3K2IA 3O8OB 3K1TA 3TI7A 3LMKA 1BPLA 2W0SA 4O8ZA 3SMVA 1WCV1 5DYGA 3QLJA 4FFWA 3ULKA 2IA5A 1R9MA 1S2MA 5AM4A 5H9WA 3OD1A 2W6JA 1GPLA 1L7XA 1SUPA 2JF0A 1WOSA 1TVKA 2IGTA 2P9GA 4MUIA 2IXGA 4M49A 1WZEA 3U3JA 1RHRA 2XCUA 3WXMA 2YW9A 3I9V1 3LWDA 3S99A 3ZBQA 4YRMA 1UXIA 5AHRA 5J35A 1RAGA 3V8EA 3I9FA 1XD2A 4QO8A 3OPYA 5HYVA 5IC4A 1KHHA 3A9WA 3AF1A 2VAXA 5AW1A 3N0XA 5JECA 1QKJA 2PNFA 4Q4CA 5TR9A 1K9MD 2RB4A 2X4IA 1M72A 4E22A 2KQUA 4G1UC 5LZ4A 1LD3A 1YRYE 2ZWIA 3G2LA 4IZIA 3H65A 5C7YA 4HUQA 1DPFA 3D7RA 2OZLA 2BGUA 4EX7A 2UXCB 1RKUA 4DJFC 4CEIB 4X8HA 3FCOA 3HZRA 4IIYA 5JCZA 5I48A 2FXIA 1KSHA 1AURA 1CJCA 1OY1A 1SPBS 2YBEA 1EXWA 3PF9A 4KQFA 3W5DA 4QBKA 1NMEA 3EEBA 4NC9A 1U2GC 1M6VA 2AR9A 3C0KA 1AE1A 1PR5A 1YC2A 1M90D 1Z75A 2JJMA 4Q3EA 5E8RA 3ZU4A 3LNCA 1N7IA 4AM8A 4AWXA 1QSGA 3Q1LA 4H4CA 4L07A 4ZC1A 2QQEA 4C7XA 5EERA 4CMKA 4GECA 3CEPB 3U26A 2AK2A 3KLOA 2P5SA 1JP7A 1QZUA 5IVIA 3SEFA 3PX7A 5DU2A 4JGBA 2PZ8A 2V96A 2DWOA 5CG1A 4G2NA 1TCVA 2Q3MA 1VQMB 1WTCA 4XPZA 2JAQA 4GUDA 3JQ6A 3LYUA 4LZLA 1EYZA 5DI3B 5TQ0A 3BUSA 1N6LA 2HIHA 3K09A 3WGQA 3MS7A 1I4OA 3EVFA 4MZDA 1XJCA 5TPZA 4RKRA 1E2GA 3WGYA 1Q50A 1Y3BE 4X6YA 1PT7A 3RV3A 4D2IA 2FYTA 5J4KA 3BTSA 4HSEA 1GAXA 4RSRA 3M6FA 1IULA 2IELA 4R68A 1ZGHA 4JC5A 4PPFA 1NMZA 2Q2QA 4K9PA 4F6CA 2V7TA 3K9CA 4JA0A 3GFSA 4I4CA 4NENA 3NASA 3Q5EA 1YQGA 3ABRB 3AW9A 1FQJA 1UODA 3AI3A 2XVMA 3EBPA 3L9XA 1YIOA 4RDLA 2VL7A 1I5RA 1JPVA 2IPLA 3ELDA 2WHRA 3EVGA 1NUHA 4GR5A 4N9WA 1REQB 3RWBA 5D87A 4UM5A 1XOIA 4PYRA 4XM0A 2NVUB 4LVNA 1IK6A 1M74A 3EN0A 3CPWB 2O8BA 5J9FA 1G55A 5LA6B 4UM8B 3ZJYA 3HH8A 2QP9X 3H9NA 4MPJA 3TW8B 4QTYA 1J97A 1FP4B 1TD9A 1VKZA 1G6Q1 2DBYA 4H7FA 1D0SA 4QRHA 3OF2A 8ABPA 3N0RA 1FDSA 1MA3A 4R41A 2W43A 4E08A 3C6XA 1O9HA 2GCIA 1OLUB 3IQWA 5AFSA 2RKBA 4YMSA 4BUZA 5JAOA 4H1UA 1JIVA 4PHTA 1EFVA 5PGMA 1E3WB 2ZYRA 3EVEA 5E6SB 4KGZA 4X5OA 2JGRA 2X76A 2PWAA 3FGPA 5H7XA 3QU9A 2XTNA 1BGWA 4B6OA 2PUAA 3ID6C 3DNMA 2ZROA 3ONDA 3W7AA 4CF6A 1B15A 1HFKA 2VWPA 4CKYA 2Z04A 4YP6A 1ZH0A 1QTQA 1YC5A 3I9V6 1SUFA 1JHDA 4HDNA 5EQDA 1QIGA 1RVV1 1AVTA 3SKXA 2GJ8A 4B6EA 1PD0A 3VYSB 1WZCA 1CW2B 3CG0A 1YTUA 1YCFA 3EULA 2BELA 3K15A 4NQZA 1MO5A 1NOJA 4J3NA 1X1CA 1L6IA 1WKVA 2P2YA 3HSYA 3K31A 4RZIA 4PFQA 4OU5A 4W8GA 3LBIA 3RVBA 1Y63A 4IIFA 3RS0A 3TMAA 4E4TA 4Z51A 2C03A 4DN6A 3OW2B 4YRQA 4IIBA 1O96A 4OAPA 4J94A 5JLAA 3FYUA 5KNLA 4GICA 5DW0A 1OASA 3ZHYA 1NX6A 3HBAA 4LHXA 3IR5A 1J8VA 3IURA 1QG0A 3I76A 4JLJA 1LBTA 1VCNA 5DTJA 4JI4B 3A6DA 1OAAA 2J07A 3GLTA 4QG7A 1V1MA 1KJ8A 5EPEA 1JHQA 2FW8A 2X0JA 4HEA1 3JZIA 4DW8A 2PTHA 2E4ZA 4PXAA 1NN3A 1KZ9A 2CVHA 3VHLB 4R8SA 1QOZA 8OHMA 3WYDA 1UPBA 2HC9A 1DADA 4IAOA 3V8BA 5IYWA 2Y05A 3AR9A 2WM2A 3KZOA 2IS1A 4JBWA 5JBIA 3NETA 2DU8A 1YKFA 2XA2A 3B9RA 3R44A 1VSVA 4FYHA 4WZBE 4BB9A 3KR2A 3Q3EA 2WP0A 4FDVA 3FCXA 4H1VA 4YQFA 4IPTA 4U3JB 1SXPA 3ZW7A 1YWGO 3HPRA 1OPXA 4H3SA 3AETB 2RGCA 1EFPA 1F6BA 4MW2A 5CK5A 2O59A 2FY8A 3M70A 4I3HA 4DY4A 3A0RB 2H1VA 4QM7A 3PPWA 3DTVA 3N75A 4LJKA 2I67A 2BFCB 2BGNA 1BRMA 1TB4A 2Y0DA 4F46A 1DKLA 3HXMA 3EXIA 2X8LA 3SVLA 2VHEA 2A14A 2ZZNA 2BZ0A 3B7WA 3UVEA 1KFJB 5IKMA 1Z2DA 1D2AA 2EWWA 3G2KA 4DNQA 4QYWA 5U1PA 3JATA 3RIGA 2H1SA 1ULUA 1E20A 1EVLA 1L4YA 4YV1A 4EGSA 2A6PA 1JNXX 3C3CA 3D2LA 4QVKA 4I50A 5GPBA 3VR2A 1RAEA 2V9CA 2I4LA 3GL9A 4GNRA 2EW8A 4II3A 1S3SA 3PQ8A 2VOEA 3RLFA 2DPLA 3PYLA 3P9IA 3CB4A 2XHZA 3RUAA 3TLCA 3ZZ1A 4EM6A 1ISJA 1PZNA 3HN2A 5BYAA 3ZDBA 1Z0UA 2AN1A 4DWVA 1GFWA 1IVYA 2I9KA 4IUDS 3ZNQA 3H05A 4N7MA 3JD0A 1HTWA 4DARA 1QYIA 4BEVA 3ITEA 4QDUA 1H2BA 3MCTA 1XQBA 4AZ0B 4EY6A 5LSAA 1Z33A 3KP1A 3DPUA 3NBXX 1CS0A 3OP1A 2HJWA 4LDAA 4NDNE 2PFSA 1LY1A 3X1XA 1WD5A 4I4LA 3ROTA 2K7FA 1E9EA 4OQZA 2P91A 1JHOA 4Y9UA 1W2BB 3NRBA 5DM4A 3G1TA 4C30A 1FYDA 1MA0A 3PC6A 3R0QA 5DFAA 4NFHA 3GVLA 2V03A 3ND9A 5KQLA 4HYYA 2A9PA 4KXXA 4GRDA 5JJIA 1Y33E 1XL1A 1HA3A 2D13A 2VQSA 1SRQA 4TKVB 3CYFA 2ORVA 2OBLA 2V1XA 3M3HA 4PHGA 3AKEA 3DMFA 1ZINA 3Q3AA 2EHJA 3IBTA 5FI1B 1W4BA 3EEYA 4MQEB 3X2FA 3F6SA 4C7VA 4DCVA 1JAHA 2XCQA 1E9SA 4RTJA 3IFSA 2PUTA 3R3JA 4W1SA 4K2AA 4KC0A 4BY9E 4NCNA 1YVDA 2QEQA 5F3WB 3SG0A 2VZ8A 3T12A 3AT1A 3DOEA 3L7IA 4B46A 2ZIXB 1HO3A 3PIRA 5E6TA 2C9DA 4MULA 1JKXA 2KHZA 3K1ZA 3F73A 4CKBB 4DLYA 3DZIA 5LIRA 1SMKA 3OAAA 1H94A 1JDVA 1A0OA 1NVWQ 4M7WA 3V4VB 4RY0A 3ZE1B 1M0SA 1VMAA 1G42A 4M6WA 4PQEA 4BEJA 3DMPA 1FTQA 2QRJA 4DYHA 3L6OO 3W2IA 1A2OA 1GGEA 4BU0A 4PLZA 1WMFA 5SZJA 3GH3A 4BMOB 2XZOA 1D4AA 2ANBA 3QX9A 4R6WA 2IPAB 4WZAB 4QNMA 5I9IA 2OMEA 3GP8A 4Q6WA 4RHFA 2HQ1A 4E88A 1NNEA 3GFGA 3GVHA 3ED5A 3QYPA 4WLOA 4XGQA 1KAMA 3GWZA 2GWHA 3P9QA 4Q39A 4ABTA 3CVYA 4LHSA 1M7BA 1P2UA 4J0EA 4HS4A 5EWJA 4H4DA 3RVSA 5BOSB 2H6EA 2YIDA 4K9LA 4ENVA 5KTRA 5A6SA 1E59A 2FETA 2QDKA 1GHTA 2BE7A 2P5UA 2VCYA 4RMIA 2X0DA 1Y1LA 3EMVA 4W7IA 4N5MA 4BKPA 4EQ6B 4LZPA 4U6SA 3V2GA 1T5DX 1H0SA 2C2WA 3HUUA 3KTDA 5HP4A 4V38A 4UEJA 1M83A 1GPBA 1Q16A 2ENWA 1QWSA 2WUDA 2AOXA 3JVDA 3O75A 4WFQA 1J8QA 1Y0BA 5EWMA 3RHFA 3UMJA 3KR0A 2PQ6A 1P1RA 5KDDA 1EBBA 2ZRNA 4P2BA 4PQRA 5FUYA 2PX3A 1TUBB 3K09C 3NFRA 3DLPX 3LUCA 3VOSA 3BB1A 4I5FA 2JKZA 3L7CA 5C32A 5EMNA 2FZKA 2Y1CA 4Z4RA 3EIEA 5IARA 1HTTA 2H5EA 3VNVA 3S2GA 4BXOA 3WNZA 2GSDA 3CZMA 1XEFA 2IOFK 4HJXA 3ZCXA 3B7PA 2GZDA 5HKOA 4BFTA 2M6RA 1QQTA 2V5UA 2PJDA 5G4LA 2FCAA 2ZJBA 3H13A 4HWRA 4AL4A 3C3JA 4DXAA 2CNKA 2W6ID 3PLAE 3QU4A 1GUYA 5BN4A 5FTNA 1H2WA 1JXOA 4G0PA 1TIKA 2QG9A 2G8NA 5HRAA 1K7YA 2BEUA 2H00A 4XORA 3C3MA 5FULA 4NK4A 4AIRA 1NC3A 4KXUA 1J0XO 2OV3A 2PSDA 1Z2NX 2XDAA 4LJ9A 3HFSA 2ZBDA 3ZIDA 1R66A 2X15A 3QPCA 2X53S 2NWQA 4GVXA 4KDCA 3EUAA 3I9NA 4MUEA 4I6EA 1NR1A 1RDFA 2AI3A 4X7FA 3HDHA 4GI5A 3E1KA 5FTKA 5AXDA 3B8EA 3SWWA 4ZVNA 4MUJA 2BUBA 2PKXA 4Z86A 3A31A 1STOA 3S55A 3R5FA 4BZZA 4X8MA 2FHSA 3OZCA 3UW3A 3ZWVA 4CL3A 3BVPA 5GJCA 4J7XA 2KJQA 3DOJA 3WLTA 3EUEA 4H3VA 4KQGA 1EMDA 4KQ2A 4PIVA 2VTEA 2AC2A 1CQWA 3RYIB 1KOGA 5F4ZA 5ARBA 4A10A 4YA6A 1RQRA 1OYYA 2A3RA 3CRVA 3KQSA 5I7FA 4QDOA 1SD2A 2HT6A 3QKUA 6AT1A 4KPEC 4RTQA 3KFLA 4S04A 4RDCA 4AP6A 1XP5A 2CVOA 2IE0A 3IIEA 3R0JA 4B8YA 4EKEA 2HBQA 2WMDA 4Z99A 5JVDB 1AF4A 4OA5A 4E4YA 1MVNA 1XJQA 4ZJPA 5BSMA 1S1MA 4GLFA 4PIMA 3X1DA 3PVZA 1J7KA 1CYDA 1ENZA 3NG1A 5JOQA 2NPIA 1LWNA 3NXSA 2QD3A 3VAZA 1LV8A 1RC1A 4FMCF 2G5TA 1FNDA 4UVGA 4EG6A 5LWHA 2O0KA 1N8TA 3IUMA 4JROA 1ZUD1 2Q5JA 4ROXA 2HF2A 2RGBA 4PGGA 2C8LA 5KSOA 1IAVA 1WUIS 2ZVJA 1F2UB 4HN2A 1BQEA 1E1QA 4WMLA 2WIBA 4P6VF 1OXKB 5FADA 1Z8HA 3FYUC 1F8UA 3JVEA 3NVMB 3ZVKA 2XVAA 4B9AA 3FKQA 4OHKA 1KP9A 1WY5A 1JJ7A 3ND8A 4OJYA 4QUZA 1XHFA 2I33A 3RCBA 3FF4A 5JNLA 4ZVUA 3TSOA 1U04A 1TADA 4BLTA 3B38A 4EBFA 1JMKC 4OTZA 1M3SA 2ZT6A 1CY2A 1L5YA 3EVAA 2XI4A 1FUKA 3G5TA 4NBKA 1KJYA 1QIFA 4AY6A 3UWKA 1MZPA 3ZWYA 4ESEA 1E7MA 2EL9A 5F4JA 2KS6A 1NN0A 5IJ9B 3UA4A 3C7TA 3LNTA 3WK9A 2WKRA 5CVTA 3VNUA 4RPKA 1SPXA 4FHDA 3NI2A 3IT3A 4DIEA 3RT7A 3F5FA 3HB0A 3IKJA 4LBZA 5ALXA 4RDJA 4KRFA 3I9JA 1I5EA 3QIVA 3TZ6A 1UC8A 1IM2A 3U7HB 1ZMRA 3F5MA 5LKRA 2DYIA 3RVRA 5HKAA 4D9GA 3RQIA 1XCJA 2FDRA 3OEEA 5G4KB 4CDMA 2WG0A 2E1BA 1XCBA 4I5EA 1FYWA 3D8UA 3DAPA 1E5DA 1G7RA 1Z6TA 2RJOA 1QHXA 3ILXA 5EE1A 1HDXA 1LK5A 2QU7A 3GF4A 3Q9UA 4IIJB 3W8DA 1G2PA 4DM3A 4DUGA 2R47A 1YK1A 5CU7A 2BZSA 4HTFA 1S4QA 3HI4A 3NHWA 1D2CA 4MVWA 1FLDA 5B3AA 3QGMA 5D3ZA 2IPXA 3U31A 1KVSA 1VQ5B 3O03A 2XMZA 1RXYA 2PSJA 2YYSA 2OPHA 1SHKA 2WRZA 4E30A 4E14A 3RWMB 3K32A 4RSMA 1B93A 1L3BA 3QPUA 5K2MA 4G5QA 1TT5A 2NXJA 3TE7A 1BN6A 3RS5A 3WI7A 4OOVA 2JRCA 1P9WA 4URFA 1NJGA 3CNBA 4EHBA 3TNDA 2ZDQA 3ELUA 1E5QA 4Q9JA 2AD1A 5HILA 3ZKWA 2I6XA 3OD5A 4HG2A 3BXEA 3CLUD 4ZAFA 5B6IA 2QUHA 3GUHA 1XC7A 5KYWA 4Q3AA 3R5KA 2PX2A 5JAZA 2YZNA 4P4SB 3K9HA 3CINA 1VQKB 1W88B 2QVCA 1B8VA 3M3DA 3EFEA 4QFMA 1QGUA 2JBAB 3GZJA 3MQ2A 3O31A 1IPFA 5DNWA 5GJWC 2QN9A 4OXRA 1KDPA 1R6UA 4YX9A 5KNBD 2OV1A 1Z07A 3K0FA 3ZK8A 2IIBA 2IU0A 3ZR4B 1U3FA 3VR6A 4PNEA 5ISMA 3BS4A 2XMDA 3P19A 4X05A 4IWXA 1YOBA 2G9UA 2EEZA 2Z95A 1V6AA 3DDYA 1XCOA 2XMRA 4S2UA 5ETJA 2R4TA 4LUCA 1P45A 2AEMA 2J7PA 3H2KA 4X1OA 5BPFA 3OEHA 1Q82D 1ZD4A 2CXPA 3U16A 2D3LA 2KW5A 4PG8A 2J3IA 3ABQB 3CZ9A 2GARA 3O83A 4TKLA 5LR6A 3N2KB 3EEQA 1RSZA 4RHUA 4AWBA 4JL8A 3LQ6A 2I8CA 3E2MA 1D1NA 3E84A 1ISIA 2QYSA 4GMXA 4IR7A 4AF6A 3MCZA 3CZPA 4QT0A 4JI5B 4G0UA 3ORHA 2OYNA 1N08A 4W9RA 4MUHA 3PWKA 2A0XA 2ZIZA 3EFBA 4H4EA 5EQTA 1PX2A 3F4LA 5KU1A 2EGUA 3JARA 4Q7LA 5E2AA 2IEAA 1AG9A 3VNQA 3SZLA 3FETA 2A30A 3DVAB 4G67A 4P53A 3KC2A 2AG6A 5DGXA 3HRKA 3BWCA 4AF7A 2VXBA 3OOCA 1WSRA 3YASA 1IBKB 1Q3HA 3C24A 2F1MA 1BWSA 4HATA 5FLKA 1INLA 4DLRA 2A86A 4S1VA 1GKUB 2FUG6 3GELA 4OAQA 3WXBA 3VDQA 4B8WA 3GLHB 4B3JA 4E03A 3A4VA 4B4UA 3MXOA 4KQ9A 2I1LA 3B5EA 1U2SA 5AJYA 3NLLA 3LT4A 2SBTA 3MTIA 4KE7A 4CTOA 4ZHSA 1O4WA 1I30A 1XPRA 1MJNA 1W5EA 4J91A 2YHIB 1K6JA 2B21A 1OR8A 1U0JA 1V0JA 2JFYA 2NQTA 3O73A 4FCWA 2PMFA 5B7GA 4TLDA 1CKEA 3U80A 1G4AE 5ICMA 4CNBA 4CN9A 3CNNA 4CLOB 4EAAA 1RWBA 5A2GA 3P45A 3MGBA 4FGUA 1U0EA 4CKWB 1GITA 2EFHB 3R5XA 3ONUA 3RIXA 2V97A 3S1LA 1PWEA 1LTKA 3HNRA 3TQIA 1W36D 3DOOA 3NGMA 3BY1A 3EGXA 2CD7A 1N2CB 3ACDA 4P83A 2WV9A 4IDQA 4JCCA 3IDFA 2DUJA 3OLQA 4NQRA 1PZFA 1GPMA 4H7DA 1BD3A 3JR7A 4R4JA 1NONA 4EEZA 1N9ZA 2Q0XA 2VBGA 3H5OA 3PI7A 2PT9A 4JFRA 1BMQA 3KYDB 3P9RA 3TOSA 1N9GA 1A9XB 1C5KA 1PZEA 2O4CA 3EEFA 1MG0A 2LR0A 4FX5A 4XR9A 2GJKA 5IAKA 1YO6A 1DL5A 1X1EA 2BCGY 4R0VA 1I1QB 3D4IA 5FBQB 1E99A 2QJRA 2C07A 3U56A 4BQEA 2H4ZA 5IVKA 2A3NA 3T4PA 1RW4A 2CNWD 4JX8A 1KQFA 1AJEA 3HG7A 4KX5A 3MSCA 1T43A 3KELA 4QOFA 3RKRA 3TLMA 1IXKA 2R1VB 3VI3B 3QK7A 3EARA 3BEOA 1ACMA 1XVTA 3CISA 3FPLA 1P5ZB 4YXFA 5ITVA 2JHFA 1GOTA 1EESA 3OPQA 5IUJC 3BAFA 3HR7A 5E0KB 1G7SA 2N3ZA 1PJCA 4HE6A 4QOJA 5A04A 1OTXA 3NAGA 3G7UA 1KO1A 4ECEA 2AW5A 2JIZA 2OV6A 1DBRA 3B82A 2FRVA 4JP2A 4DNFA 4RJ2A 2H8GA 3BD8A 3CEAA 4L9WA 3EGVA 2H4JA 3WHKA 4Z54A 1TVEA 1UPCA 1ODTC 2ZSDA 2J0EA 1RCUA 4I08A 4OPMA 4BWFB 4LTMA 2B4YA 1GN8A 3GZNA 2B20A 3RC3A 4CQMB 1SELA 2I6QA 4XRRA 1XTBA 5CB4F 2QL6A 3TR6A 5JJKA 3N7TA 3HU1A 5ALWA 1T1RA 1UADA 2WAYA 3KOYA 5HE8A 3GRUA 3E9ZA 3JQ7B 1DT5A 1L1QA 2ZPUA 2FEXA 1KK0A 1N6HA 1RTTA 4KKTA 1QG6A 2FE1A 3JQAA 3ZY6A 2HCRA 3MIZA 3MBIA 2GO1A 5F9FA 3HJGA 5CDFE 1QVVA 3SVTA 4MW0A 1KMNA 1PAUA 1QHSA 2GN9A 4PBTA 4ER6A 1NI4A 4OP1A 2OV4A 2VA8A 1U7PA 2CHFA 4GSKA 1LLDA 1PVVA 2PS3A 3Q41A 4LI3X 1X42A 1EK0A 2ZI5A 3ISXA 4QDXA 1Z47A 2G28A 5UKDA 4DV7B 2ZR7A 3WL4A 5F98A 1PK8A 1T0HB 2GA8A 4P26A 2B94A 2X3FA 3B2NA 3HKBA 1EH5A 3LQ1A 4LECA 4NFSA 4FFBA 4PR3A 4X85A 4C78A 5A3RA 4IHJF 1C29B 1DJPA 2ASEA 3VYRB 1N5IA 1ZK1A 1UC4B 4HLNA 5JPIA 3KQLA 4ZRMA 2I3AA 2ZBQA 4V1CA 2RH9B 2ZAMA 3I5MA 4WL0A 1TLLA 1MB0A 3WGIA 4P54A 1CFZA 3G88A 5I5EA 4GL4A 4IYRA 1D09A 1G8FA 1J2TA 3G2QA 3HSKA 3EXAA 1W25A 2KLBA 5FJJA 2BEKA 2ZR9A 1ADCA 1KP3A 4GBMA 4EP1A 1QH1B 2XHEA 4J1SA 4LPKA 3D6TB 1CY7A 1EE9A 3ORFA 2M5SA 1VQPB 2IOFA 4GXRA 4P86A 3RTCA 3SNKA 4F84A 3RAJA 1VFNA 5B58C 1HYQA 2QV0A 3MWGA 3E1SA 4KK3A 4ZP1A 4NNPA 1PR3A 2XAUA 5TNXA 4L0MA 5L4SA 4QHTA 3QWBA 2OZEA 4MXDA 4R2WA 4OYRA 3UPDA 3PA8A 2A2ZA 3V97A 4XNFA 3DC2A 1YVPA 5LB2A 4CT4B 3D7NA 3DHYA 1E62A 3NVDA 4BFYA 4HN9A 1TLTA 2C29D 3TGLA 2N1BA 2GYYA 4RVGA 1A5AB 5HCIA 1R5JA 2Y2VA 2H2AA 1RADA 3ITDA 1VE3A 1WY7A 3QY0A 4L4SA 4O4HA 5KSYA 4OI0A 2WJ4A 1L5QA 5JASA 4BLRA 1EVZA 1ZD9A 2O1WA 2VSQA 4YT4A 1BOOA 3HR4A 5KJEA 4BVAA 1QQAA 1TVCA 3T3EA 2WT4A 5BSKA 5DK4A 4I0WB 1YL6A 1IY8A 2BW0A 3FBGA 5CHYA 2MSDB 4MMZB 4Q7MB 1V16B 2PJUA 1RFGE 1T2AA 1W85A 2F17A 4GD3Q 3MMNA 4BB5A 1KIFA 4A91A 5MN5A 5DNAA 3AB7A 2FI1A 2X5JO 4P12A 1JL3A 4ITVA 1VHTA 1VBKA 2IYTA 4CM7A 4ENQA 1BJTA 3AVWA 1UDRA 5CUQA 4AY5A 2EOAA 3SYNA 5JH7F 5FLEX 1NAIA 3EZ7A 1PVDA 1WSDA 4QOHA 3URKA 3PDIB 3GMDA 2QTVB 1QLJA 3IAXA 3JD1A 4LZZA 4Y2UA 2I91A 4G1FA 3H83A 4HDKA 5KYYB 1ZZEA 3T9AA 3HBNA 1LS1A 4TT3D 3HXOA 4QNNA 3ADCA 5CT4A 2QUKA 5AVJA 3BZWA 5EY5B 4MUKA 3RG8A 3U4IA 4LMBA 2Q1XA 1XKXA 2ZRDA 3G2JA 3L1IA 3NC4A 1GLNA 3G9UA 5ELXA 3HCNA 3LA8A 4FGZA 4HDMB 4MV5A 2BVNA 2DCMA 4BNTA 4DVJA 821PA 4FUTA 5LUAA 4EKDA 1M2OA 1KFKB 3UMFA 1ZU4A 5EFOA 1Z2OX 5EKUA 2NGRA 3ZQJA 2EL7A 2HJSA 4RIGA 3TBFA 4P8RA 1G5PA 4M9SA 4YRTA 3B12A 3FCYA 4ALIA 4CF7A 4ARIA 2YWCA 1JG6A 1L3CA 2B7BA 3H9EO 3IA7A 3JYNA 4A73A 4F85A 2PRZA 2QMQA 3ZE6A 1OD6A 3PC2A 3W4KA 3ZHQA 3DE7X 3OQIA 4REMA 2V6JA 1FP7A 4TLBA 1E2MA 1MJHA 1X7XB 3CPEA 3L77A 2BWJA 4AULA 2J08A 2AOUA 4EB0A 2ZTSA 1KXJA 3LX5A 5B7QA 2PD6A 3I61A 3FDJA 4TQAA 1ZK3A 1LDNA 1NSYA 2XXJA 3B78A 4YAFA 4LTDA 4JBYA 4YRGA 4JNCA 1PT8A 2R85A 4F12A 5LQMA 3PE3A 3VKGA 1PSDA 1DJOA 3EVTA 1XHEA 3CZ4A 3JQEA 4PPGA 4XWGA 4XUEA 3ZE0B 4F92B 1CQXA 1BKYA 2P3QA 3R77A 5E2BA 3H9QA 2C4WA 3X3HA 2ZJ8A 3Q88A 4FYKA 4N5IX 5KKNB 1TCAA 1NBHA 4UKDA 2P1DA 2Z56A 5CJ2A 4FSXA 5AHOA 1VKHA 4DTCA 2CB9A 2BGIA 1POXA 4G0ZA 4V3CA 3T34A 2QD2A 4MUAA 3QKSA 4M99A 1MW9X 2AG1A 2E6KA 4KPUA 3ROQA 1NXSA 4UTZA 4G1EB 4RKEA 1DLIA 1IBRA 2Q3BA 1FNSA 2ECQA 4Q47A 2Z6QA 2LBPA 1G291 2DH5A 3DOFA 4M0MA 4NR0A 3TTYA 1QH8B 4WXMA 5H68A 1YB6A 1PNVA 4FN4A 2H1WA 3OE7D 4F6LA 5C37A 1GCGA 4UZSA 5HBRA 3MJSA 2A1UA 4FWIB 1ADYA 1R5NA 4IVNA 2WMYA 5MGBA 4CLDA 3FHJA 2XKJE 1RXIA 4FXPA 2OM6A 3L49A 5JAHA 1F38A 4O4JB 4TZKA 3L79A 1R16A 1SXIA 2P9HA 2XYRA 2LKCA 3CMMA 3SEJA 1L1EA 4JT4A 2OGZA 4M0PA 3L0YA 3UWDA 1EU1A 1K3TA 2C95A 5LOVF 3AC0A 2GN0A 4K46A 1BQ3A 3ZC3A 1CNEA 1ZOLA 2VP3A 3FD8A 5GVSA 3VMFA 3LP6A 4RPHA 4B4KA 4B5LA 1H4SA 1R6DA 4LYGA 5BXYA 3O2SB 1Y7IA 4E6PA 1BX1A 2JGEA 5JYDA 4QM6A 1N33B 1OCEA 1DO8A 3VTAA 4R7GA 2DQZA 3O3NB 1DTSA 1CXZA 3E82A 3EXG2 1Q5PA 4IMRA 4BLWA 4Z7JA 3LUJA 1NP3A 2ISQA 4CUJA 5DN9A 1YT5A 3IR6A 5DHAA 4EUKA 3T5AA 4F3RA 1ZLYA 3CR8A 2R8YA 1GL9B 2JIBA 2XWQA 3HS3A 3P2IA 3QEOA 3Q98A 4J4BA 4JENA 5F1OA 4AU1A 4HAYA 1KEWA 4YPVA 4Q1FA 2QSJA 2Y0EA 3FAZA 3LK6A 2FN3A 3DMHA 1Q91A 4BO0A 3SLKA 1F9AA 1Y8RB 3EGIA 4MVJI 5TVKA 2O0MA 2V98A 3N74A 4LF4B 1SAYA 4U2FA 1NWHA 3AVTA 2B8JA 4MKRA 3H5NA 4NJMB 5F73A 1KAGA 1O9GA 3KDPA 3ZWPA 4WECA 4Z1OA 1SCQA 5EJMA 1PR1A 2FMFA 2VDLB 3U19A 3CCCA 4M4SA 4LGVA 4A27A 1IFXA 5EXTA 3M89A 2AYYA 3C6ZA 3HWX1 2NU8A 1G8PA 1ZRNA 3AFHA 1H2EA 4DLZA 2VP0A 2ET6A 4U8GA 3NDJA 5KJ1A 3ZLTA 5DLQC 2QMHA 4XA8A 1P72A 3TPFA 5JROA 1QHIA 3B1FA 1KOLA 5B53A 1ZW6A 3OIUA 4NH0A 4M55A 2WTXA 5AM1A 4WNAB 3ZGLA 1ABFA 1DC3A 1SCUA 4BNKA 4L16A 1J99A 5DX8A 1N92A 1JZTA 1U3GA 4FDTA 5KX5B 3KEOA 1TZ2A 4US0R 4DWWA 3LLMA 1RHMA 1WSBA 1R4NB 3TN7A 3I42A 1OZAA 4BMZA 1NYQA 3IQXA 1BE0A 1GXSA 3ICQB 2JN9A 3L7YA 3UQYS 4RWEA 1JIIA 3LZ6A 2PVCA 4ZU6X 1JYSA 4Y2RA 1N5JA 5DOZA 3OSUA 1PW7A 1TQ8A 2NX2A 1F51E 2VXOA 4E1AA 4DMRA 4M60A 1V0EA 1UBHS 4R2IA 4D8UA 3K70C 1UPAA 3L84A 1JA1A 4X92A 3WMEA 1GDDA 2OLEA 1PJ4A 1DEAA 2NVBA 2GN6A 2K6GA 3O2QB 5EESA 3HXLA 3ZHUA 1T9HA 2XB6A 4OQQA 1KSGA 4X1KA 5IZCA 1MIHA 3W5CA 3M5CA 5FBLB 3UMBA 1CUWA 3AVVA 4F2DA 4DLNA 2VYND 2ZXEA 5ALGA 5A9RA 4BNDA 2YZ7A 2W2QA 2GETA 1MXFA 1IJKA 1PQ4A 2VJBA 3BK1A 3L7LA 4KUHA 4Q3KA 4N47A 1RC8A 1RKQA 1P4MA 2VBTA 4PO9A 1N8RD 2Y1EA 4BMPB 3UFXA 1SRRA 2ZYTX 4IIVA 3ZV6A 2ZRFA 4W1QA 3OG9A 3E2PA 4IXDA 3MERA 2R25B 1IE3A 2QTAA 4RX1A 3NDBB 1H3FA 3QEMA 2CXHA 1NBEA 4IJ6A 4YJFB 2NOAA 2IPNA 2VUHB 3HUDA 4RD1A 3G1WA 3V1KA 4ND8B 3AM1A 3DWEX 3FOWA 2BAGA 4DNPA 4TMYA 1PQYA 1DRKA 3FSGA 1R88A 1UQTA 1URPA 2IF0A 1IMOA 1ITZA 2NZJA 4MS1A 4JX9A 4M53A 4BC1A 3G0DA 4GC9A 4IQ0A 4MKHA 3PUKA 2JI4A 1FFSA 2FPLA 2IKQA 2WM3A 4Q3CA 3ZDYB 4F2PA 3JSAA 1XK6A 1QRAA 1Z7YA 2D00A 4L02A 4RIIA 4WX2B 4ZOCA 4DXHA 5HA5A 5CR9A 3AO0B 5HFJA 2ZJ3A 3TMKA 3DKKA 1PN3A 4FI3F 1XZ8A 2G4LA 5LP1A 2JH9A 5BVGA 4OHMA 3N59A 5AW7A 3O91A 3FDXA 3UMSA 3JZDA 4DT1B 1ZN8A 3QOWA 1CSEE 2OZPA 3N8NA 4NOKA 2C2KA 4NY1A 2HCFA 5LZ8A 1PJ8A 2DPGA 2JJ1D 3IHLA 2EU8A 4F6RB 2FUKA 1PQPA 2YRXA 5CVVA 3QBVA 2I3ZA 1RWKA 4MYTA 2C1ZA 2P67A 5EC8A 5IRCD 3U44A 1R0ZA 3SQLA 1W8IA 4AZ3A 5IYZB 1RJWA 4HSGA 4R69A 4HNUA 3IJPA 2VHQA 4G0MA 4G5FA 1OFTA 4TXMA 5KNCD 2JLZA 4TWZA 5K3FA 2ZXIA 4L8LA 2FJ0A 2V9PA 3MLEA 1IN8A 2I7TA 2NAPA 4COKA 421PA 4ZVLA 2YYAA 1DCMA 2G06A 3QVJA 2XF2A 4KVZA 3UJAA 3QHQA 3ZHCA 4AXBA 4KR3A 4IY1A 4LWZA 5JG7A 2DLDA 4JI2B 1EM8A 1RRPA 3TUJC 2IYWA 1O87A 3GYBA 4L57A 1JBEA 2J5XA 1NMYA 4XRGA 2C3OA 3IH5A 2O2GA 2BEVA 4JZKA 3H2BA 4BJHB 1LPSA 1M34A 1Y9AA 4GM4A 4LCEA 3TB6A 1JS1X 3CEMA 1SXGA 1CJKC 2PHZA 2X0RA 4UU7A 4C08A 5IMBA 1FTYA 4N3NA 2FOLA 5IF3A 3QVSA 5HJ5A 6GPBA 2TMYA 2WUEA 4JOSA 3PGXA 2C7RA 1C3OB 3IXQA 4C7OB 2O14A 2VTDA 3CZRA 1P0FA 1PCXA 2DR2A 2BFDB 4JL5A 2I5PO 3UHJA 1IN4A 3IE1A 4GKJB 2D8MA 2DEUA 3SVZA 4F9FA 2JPDA 4AC9A 3JAWB 2IY7A 2ZB2A 4G86A 8ADHA 4L27A 1S8AA 1P4AA 1UEJA 1N6IA 4MYCA 4F4IA 1II8A 1U0NA 4HGRA 3UWSA 2AXNA 4AMGA 2XQGA 1TF5A 4MGKR 4MI3A 1NDUA 1ZDMA 2BR5A 4MUXA 1DAPA 2WJ3A 4O2BF 2UXBB 3GGGA 2B8TA 2EZ8A 1XEXA 1LEHA 3NZEA 4M0KA 5JSYA 3MWLA 1CQIA 3HYCA 5AKGA 4B9EA 4P2NA 4NP6A 2CXRA 2CY0A 2YY5A 1Y4SA 3AHGA 3EY4A 4PSAA 1WORA 2X2FA 3F47A 2NU7B 4CG2A 5CD1A 2PZBA 4G1CA 2QRKA 4GPD1 4IMIB 4NRDA 4X3PA 1V95A 1SBTA 3AF2A 1F1JA 2LCIA 2R6FA 2WHEA 3MILA 3RH0A 3UB4A 1Y42X 5B4VA 4YIHA 1Z63A 3WMGA 1XEAA 2WYVA 3AUFA 3JRXA 2Z58A 2JGKA 3LC1O 2HRQA 1DIAA 3OWHA 1GT6A 3PNKA 3F7OA 4HDOB 4HGYA 2QL5A 3WLPA 4F3KA 1Q74A 3E5MA 1Q1ZA 1P4HA 2BBSA 5FCDA 1PLLA 1WLSA 4JEMA 2VP6A 4U00A 4EHDA 4I9FA 2WYWA 1EXMA 5GVRA 5ICEA 1UOEA 4L5YA 4B7XA 1SK9A 1CUYA 3AERB 3FWHA 4FMDB 3RVDA 4AICA 5JHGB 3UK0A 1A8PA 5ALNA 4ONEA 1WXHA 1WMSA 3UJ7A 3FB1A 4IIUA 4QRDA 2I4RA 3M2TA 3V1YA 1TYDE 4C3OB 3QX3A 3RTEA 1M76A 2JBHA 1O6ZA 4GKVA 4Y6LA 5GIPE 4DG9A 3D7MA 1I2MA 4ALMA 3NP9A 4YI3A 1QZZA 2XRFA 2HJVA 3CVOA 4Q7QA 2XMCA 1X9HA 2WOJA 2FKNA 3PD0A 4OVKA 3RUPA 3IPXA 3I4CA 4JJFA 4XLZA 2EZ4A 3IEIA 2OGWA 2O2EA 3NBFA 4D45A 1Y4UA 1NBWB 3HL4A 3RF7A 4Y1FA 5FPTA 5THXA 3C6MA 3T4EA 3VUEA 3W6ZA 4B4OA 4QO7A 1RJ9B 5AIBA 3HFJA 2FMTA 3S29A 3H2IA 1N2OA 3BWBA 1OHHD 1YI0A 3HKEA 3R3HA 1XVLA 2DHRA 3WZMA 1I6MA 4BNIA 4M0CA 4XGNA 2BZ1A 5T64A 1LPPA 5COQA 4FBGA 5LUBA 3H0CA 1A8SA 1XA4A 4Y3UA 5LZ5A 3UJ9A 4D56A 1J2YA 2AN4A 3KAKA 3QW4B 2MSEB 3OM0A 4K6OA 4OUDB 3ZXIA 2ZGVA 1ZPDA 3U4CA 2X7XA 4HH3C 2VPYA 4J4HA 3ZTWA 3MJHA 1RHQA 4F86A 1F3LA 2WJ6A 3R7WB 2XX3A 3SSNA 4AI6A 1C80A 3ELWA 3A1UA 3UC9A 2HDNB 1PJAA 5C1OA 1QFYA 3IVCA 3OHMA 4XARA 2QMUA 1JT9A 3E81A 3IPAA 4EH1A 1KORA 2VJKA 3BSWA 3LKBA 3N86A 4KSCA 5J5CA 2VRCD 4TMZA 1WDLA 5A5FA 4C7MA 4AKEA 4A8JC 2C4MA 1L4GA 1E0KA 1T1EA 3KU4A 4XN0A 3QKRA 1ZMOA 4IIHA 3ADDA 1H4TA 1QB8A 3ZXYA 4CW7A 3KJHA 2EBWA 4DLPA 4JK3A 5LXTF 1H1DA 2CDBA 1WNFA 2D3NA 1IUNA 1CUEA 2G82A 2C04A 2JBWA 2OHJA 4RDKA 2IUEA 2NT4A 3DPIA 1GAWA 3FDZA 1DQPA 2CRVA 4GEGA 5EKSA 4OHUA 2OQIA 2ZE7A 3TM5A 1HOTA 1V1JA 2VEOA 5HVNA 1FFEA 1GU7A 1Q22A 1VKNA 2XYVA 3K5IA 3LGXA 1P9NA 2B0JA 3CWQA 4KH0A 3VOAA 4EYQA 1HWYA 5LNK1 2RG1A 3MRSA 2JFOA 1OB0A 3I9LA 2DBVO 1SVSA 5TRTA 4BBZA 2CT8A 5BWNA 621PA 2H0QA 1ESMA 1ZSYA 1U1GA 3OZFA 5KAPA 1HZZC 4AKTA 1SIOA 2AC7A 2QW1A 1S0UA 3IESA 3GAFA 5J2TB 3EAFA 3UJHA 2J0SA 2Q8QA 5BSFA 5HZMA 3CX4A 2AQHA 2RDMA 4J9UE 4BMCA 5C1BA 3GGJA 1CJUC 3GFQA 4CL2A 4PG7A 3A14A 4C3VA 3D6NB 1R74A 3JWEA 4IINA 1HE1C 2QRLA 3QPAA 1MOSA 1AM4D 3ASUA 3V7WA 1YJCA 4EHJA 5C52B 2AL7A 2ATEA 1MEEA 4MYRA 4ALKA 3TS1A 1PR9A 5IZCC 4D4GA 1QGZA 2N42A 3AQ4A 3B3JA 4IMPA 4PQYA 4PG5A 4UMDA 4X90A 3TPZA 4ZI7B 1XTSA 1QDEA 4UXHA 2QN1A 1FNCA 2G09A 3LOUA 1XX6A 4ZI3A 3UB2A 4AUMA 1PFWA 3CCRB 1D4FA 3I9MA 3HVIA 3OHPA 5I9SA 1L5OA 1VE9A 1Y8QA 3AEQB 2BFWA 3ESCA 3GEHA 3UAOA 2G80A 4BZPA 2XLCA 5DSZA 2Z98A 2CLEB 3AI7A 1N5MA 3IO5A 3OT1A 1XLTC 5FKJA 2CDRA 3AYZB 1W4ZA 3W05A 4PN3A 1Y8AA 4JWTA 3JVVA 4XKJA 2RK6A 3S2UA 1PNRA 1SHTX 3WIBA 3IKTA 3AKDA 4UCWA 1Y48E 1GTZA 2P9ZA 1EUZA 1X8XA 3AHJA 1VHOA 1WXWA 3GGDA 3UH1A 2A0UA 2G4VA 1SWVA 4URWR 1NV8A 1C1DA 1Y9DA 2HLDA 3JQRA 1E2FA 1CE8A 2WNIA 4MUYA 3C39A 4RLSA 2EHDA 2O6LA 1N0VC 3FDFA 4JODA 3TNYA 4DRZA 1DUVG 2IHJA 3IOCA 4QLBA 4F4DA 1HEUA 4M7RA 4XCVA 1QYCA 4ZGBA 1EJBA 1F0NA 2IIQA 2GYVA 2H9AA 4GMFA 4V39A 4R3UC 1Q77A 4XDHA 4JJIA 4C5CA 2EBFX 4B3FX 5IK2A 1MAVA 1GY8A 1SJ9A 2ADMA 5BN5B 3B48A 3GBPA 4V0OA 4JJ7A 3FPHA 2JJ1A 4KYIB 1E2KA 2X8JB 4RXTA 2F4VB 2Q8PA 1DV1A 3DUFB 5FL3A 3DR5A 3OETA 5CDUA 5JYEA 1LSJA 3LW7A 3GNQA 4IHJA 1XRRA 1Q57A 4U7TB 1C3XA 3IPCA 4QAQA 1DZ3A 4QVGA 1D9ZA 1QO7A 4QOGA 4TLEA 3JXEA 3KHKA 1M0EA 5KNCA 2EFEB 4X3OA 1B8UA 3U1VA 1I7DA 4RFSB 1USVA 1QIKA 4LNUB 2QENA 3M4YA 3HJAA 4Z9BA 3LH5A 1WP9A 3R0ZA 3ZIAD 1JDZA 3V1MA 3RRYA 2FCRA 2R79A 2QTZA 2BN4A 1BOFA 2Q46A 1UBKS 2OO7A 3IBYA 3I2JA 3H6GA 3LY8A 4NCHA 2B2XA 2HX1A 4Q9AA 4LK3A 4QPJC 2AWOA 5DT2A 1GTRA 4BO1A 1ST2A 4GO1A 1DG3A 3K0BA 4CM3A 5IDQA 4TS3A 5ELMA 1G6OA 2WI8A 1NF8A 3HBJA 3UH0A 3TI9A 1IY1A 2BHNA 2VQFB 4UBLA 5ALJA 3V42A 5JIBA 1P0IA 1UBCA 4CMAA 3SF8A 3RSZA 4HTAA 3FOZA 2HA0A 2OOSA 3NTVA 1LQUA 1PNQA 3L8GA 5D3KA 3A6HA 3BQMB 1G8KA 5T6MA 5EHIA 4H3KB 5CG2A 4IDPA 3FFTA 4Q0MA 1CZRA 1IH8A 5EIHA 5B1DA 4QU5A 2M98A 3RIEA 4CF5A 4P0PB 1JTVA 4HZUB 3HV0A 1D6SA 2O48X 2VT6A 1K73D 1K3FA 1HR0B 3DXYA 1EFUA 2P2LA 3CKMA 5D1HA 5DT9A 4OHXA 4DDWA 4XD7A 4CKCB 5AVQA 1PD1A 3GJ5A 4J6EA 1RYEA 1U5BA 1Z38A 1Z9BA 2VK2A 1O5OA 1E3EA 2I80A 4U0JA 2XLBA 5DHTA 3AHFA 1TPYA 3PUZA 1ZJZA 3OQOA 2GLTA 3WJ2A 4EW1A 4XAQA 4EGCB 4BQPA 3Q8MA 4WXRA 5FWXA 1SIBE 2GDJA 1DQNA 4BL5A 1F17A 2A59A 3CONA 5KQGA 3N2GB 4RTOA 2R1TB 2ISSD 2VDJA 5HZGA 2H57A 1QXSA 1B74A 2P79A 4C06A 1A8HA 2PUWA 2YXDA 3VKHA 1LSSA 1DBWA 4N7RA 3AINA 4NICA 1TYEB 2A4KA 1TM1E 1Y5LA 5CLLA 5JCOA 1O7JA 2I7VA 1HORA 2V54A 2I4OA 2OVFA 1U9JA 1GTVA 1JNYA 4GNKA 5JH7A 5J2UF 1CR1A 3NIFB 4V0SA 3ZY4A 2CLHB 1OIXA 2YQZA 4I5IA 4RELA 5FOSA 2Q9BA 3VR4H 4AXXA 2HCTA 4ZPXA 3I5YA 2NTVA 4G25A 2X0KA 1HSZA 2IODA 1B14A 2VXCA 1XZNA 2YUIA 3KEQA 3F9CA 3OZ7A 1HNXB 3DT6A 3GJ8A 4BKRA 3GZ4A 1KWGA 4RD3A 1P2SA 4S1WA 3G8YA 5CLIA 3WBBA 3A2KA 2GK4A 1AUXA 3TUIC 2B8NA 5A8AA 1BG6A 3FLBA 3FUVA 3P2JA 3M5DA 3QNMA 1B1AA 4KTVE 4MR9B 4OY3A 1F14A 4YRDA 4C3ZA 3LDUA 1IU9A 1P33A 2Y68A 3LKZA 3NV9A 1IHMA 2UZIR 3BMQB 4DJAA 2IOYA 3DMGA 4V0ME 3R9XB 4LEIA 3RANA 3B89A 1ZCZA 2HZ7A 3D7KA 4MAFA 5E7MA 1OYOA 5JSKA 2D1RA 1RM5A 2E1PA 2DFLA 2H07A 1KMCA 4V03A 3WE7A 4ZCTA 1EFLA 3HGTA 4HHEA 1DAIA 2G63A 2H9IA 4JVLA 2HI0A 3D81A 1T1GA 2AT1A 4YJ2B 3G7SA 3COWA 4P1ZA 4L8FA 2JS7A 3PP8A 3TOXA 4C4TA 5CLHA 5LWQA 4JQYA 4LZOA 1WP4A 4BO3A 1P9OA 1BFDA 2QVLA 2WNHA 2GBGA 3NAQA 2G04A 2DQ4A 1GPAA 2Q5EA 2XUZA 3PCRB 1QE0A 4CL8A 3WL7A 1NE2A 2RH5A 1JEDA 5JQGF 4JITA 5C81A 1RXUA 2F55A 4L5BA 2NZYA 4ME6A 3EVCA 3KJFA 4XEHA 5J5VA 2BGWA 2BLLA 2QTWB 1KZHA 3FLAA 2VZ9A 3TLAA 5AOAA 1C2TA 4N40A 3A8IA 3Q5DA 4EGAA 5JZ9A 3PJRA 2VG8A 4AS1A 5DCLA 5EP4A 1BCSB 3G59A 2P7HA 1NUUA 1NOIA 3M6XA 1PL0A 3WDMA 3FW1A 3HB4X 3NHZA 1ZD1A 1PTKA 4FXUA 5HJ7A 1RLIA 4MIEA 2VRCA 5BNTA 2AFHE 5G1NA 3KQHA 4DSZA 2WYHA 2EGGA 2J3HA 3LDAA 4TZTA 5ADVA 2ZANA 2F67A 4TMVA 3OIGA 2ZL6A 4H7HA 2GTIA 2UZ0A 5B30A 1CR4A 3VX3A 3EIHA 3NM6B 1US8B 2VI5A 2YYYA 3K0EA 3GA5A 1DQRA 4C2UA 1G2IA 4JC8A 1PVOA 2MMCA 5AHWA 1G7CA 4WN9B 1JQ5A 1M1NB 4G89A 1HG1A 1Y1PA 4WVFA 5DLDA 1EWVA 3H17A 2PA3A 2H9YA 3R6GA 3P2MA 5LZ2A 3SQOA 3PTAA 4CG0A 1TC1A 3O2JA 2BC9A 5LOVA 4D98A 3SHQA 4AUEA 3G3EA 3GHHA 3H4IA 5FAKA 5SV2A 2FB9A 1OH8A 1N3YA 3M9WA 1QGED 4IH1A 1APBA 4EYEA 4U4AA 3P9YA 2POQX 3OEWA 4M37A 5AKZA 3HVJA 3NJ8A 5IDYA 3E05A 2WWWA 4OP7A 1B43A 1TO2E 4BJ3A 5L95A 3AKZA 3MMXA 3KEFA 3S5JA 1U81A 4JVMA 4C04A 1KFBB 1VQNB 3ETGA 2R87A 3K53A 2CFRA 5HDQA 4B7CA 4DFDA 4OK5A 3FYHA 4IQFA 4TRJA 3EIOA 2O1SA 2PQ2A 3CIOA 2FVYA 2IDMA 3W1WA 2QUIA 3H9JA 4MDFA 2AI2A 1O5TA 1ZOIA 4J1NA 3WSVA 4D6XA 3GRRA 1Z7WA 1BEZA 4R9NA 2HCBA 1I4LD 1TOAA 5AW9A 1RZUA 4RPCA 3PXAA 4LOIA 1AUOA 3MMSA 2ANCA 3W6OA 1RAIA 5P21A 3BN3A 4Y2VA 3F5QA 3LC0A 3KQWA 1XRSB 5JBQA 3MCUA 3NKVA 1Y1QA 1W34A 1A4XA 3OM8A 4FWBA 3PWZA 4TTAA 4UJ3A 4YAGA 3MC1A 1YVRA 1F06A 1YCGA 4H6WA 3HP7A 4P0QB 5DEIA 2GI4A 2Z2ZA 1C7ZA 4XDYA 5TMDA 2QN6A 2X1VA 4R71A 1W1IA 3P27A 3QFFA 3DWIA 2D0DA 4ZMSA 3KQNA 1IB0A 1XKQA 4ZV7A 3TIVA 1P80A 3NPMA 3WWOA 3UKOA 1X87A 2BZGA 4OJNA 1QQ7A 4UREA 1ELOA 2J0UA 4RHXA 2C0CA 1XR3A 3GCDA 2CFTA 1Z0KA 5COAA 4Q4JB 1XLUA 1NLFA 3N2ZB 5FPYA 5BT8A 2O8DA 1V2HE 4B3CA 2ZZKA 1BMTA 1W8DA 3L7JA 4GEKA 2I03A 4WCFB 3Q7RA 3WVNA 4B45A 3M4ZA 4D9HA 2DHQA 1X3SA 3V34A 4NH4A 1C1XB 1G8MA 1UZLA 3N6VA 4IDAA 3JU4A 3P71T 4KVGA 4NV0A 4OQ4A 4QICA 2XNJA 4D9FA 1HKHA 4R1SA 2YVQA 1MC5A 4MA4A 4FLMA 1RZ3A 1UT6A 1Z0SA 1GGNA 2W2KA 1S8FA 3DVLA 1ICEA 2JAUA 3K2QA 3OPNA 3PQ7A 1XT6A 2XMSA 3H16A 3QYAA 3T3OA 4QTTB 2Y1GA 1OFUA 1PK7A 2ETVA 3A36A 1ZH4A 1SBQA 4J0FA 3UJPA 5U9CA 2J0QA 3HVUA 2RAVA 4QFCA 4RMNA 5C4MA 5CFQA 3UGKA 4KIUA 4CN8A 2MINB 2E55A 2Y0BA 5B12A 1KQGA 1T5SA 1V5WA 2C5BA 1U2QA 2JI7A 3T5TA 5F9MA 5BUZA 2PMDA 2CDCA 4KAFA 2XQFA 1OWMA 3PGLA 3WGGA 1E0JA 3PQEA 1J07A 4M7PA 3GLGA 2FWMX 1K8AD 1YKSA 2NO4A 3FMGA 5CNJA 4BZXA 1R4MB 1J70A 4ZCQA 1EBUA 3SYTA 3UV3A 2H29A 5EWLA 3T94A 4ARZB 4EZEA 4YV0A 3QEBZ 1X74A 3FY4A 4DCPA 1FSFA 3O47A 5DM2A 1TVKB 4QASA 1K2WA 2ZB8A 4HADA 3R6WA 4V02A 2HW8A 5IBQA 3MRTA 3SXUB 1EJ2A 2XOEA 1RU3A 3AEKB 4RZUA 1AQYA 3U0BA 3KZVA 2PWPA 4NOMA 3A9RA 2ZRIA 3NP7A 2HCJB 4RIFA 2IZ5A 3I6BA 4G4SP 4O4IF 4TROA 1PEDA 4ZVTA 3VTZA 2PO7A 2BMVA 3IV7A 4BVLA 4EBBA 2GERA 4UVEA 2VP9A 4GSYA 4B6GA 4O5OA 4MWGA 4N6GA 1P60A 3WRXA 5WRFA 2PU7A 1ZGBA 4UZEA 3JZFA