2QDXA

P.aeruginosa fpr with fad
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
257
structure length
257
Chain Sequence
b'SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLVTREPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDDRAMICGSPSMLEETSAVLDSFGLKISPRMGEPGDYLIERAFVEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin reductase
molecule tags Oxidoreductase
source organism Pseudomonas aeruginosa
publication title Biochemical and Structural Characterization of Pseudomonas aeruginosa Bfd and FPR: Ferredoxin NADP(+) Reductase and Not Ferredoxin Is the Redox Partner of Heme Oxygenase under Iron-Starvation Conditions
pubmed doi rcsb
total genus 82
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qdxA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2qdxA02
5GV8A 1ELOA 4HE6A 4B3XA 4ZGNB 2PIAA 4RD6A 1DG1G 2BF4A 4M1KA 3WXMA 1XB2A 2OTJB 3LVBA 4AF6A 3G4SB 2FX3A 1KQSB 2QTZA 4G1BA 4R71A 1IJEA 1QX4A 3VO2A 4TMWA 5AN9A 3FJOA 4LBVA 4NCNA 1YIJB 3OZUA 2CRVA 3JQPA 3CB4A 1QFZA 1QH0A 4YAFA 1GJRA 3CC7B 1OB2A 1BJKA 1G7SA 2EIXA 1TUIA 4Y9UA 4RCZA 4G5GA 2VNKA 2RC5A 3AGQA 4M53A 4LBYA 3WNCA 2QN6A 1EXMA 1GAQA 3CCRB 3I56B 2VZLA 1Q82D 1TTTA 4FWTA 2R6HA 1SKQA 3OJXA 1VQOB 3CCLB 1GAWA 1S72B 3MHPA 4EH1A 1Q86D 4PC7A 2BGIA 2BV3A 1J9ZA 5KSWB 5H59A 4AC9A 1N0UA 4B43A 1VQ5B 3VO1A 2XEXA 2YWGA 4Q7JB 1OGJA 1YJNB 4YHBA 1YHQB 1EFUA 3E20A 1WDTA 4RD1A 1G7CA 1TVCA 2YWFA 1GO2A 1KD1D 4RJLA 1U2RA 1FRNA 3WY9A 3W2HA 2X3UA 1SM4A 3LO8A 1KK1A 3CXCB 3B82A 2DEUA 1QFYA 1H85A 3CC4B 1S0UA 1FDRA 1JA0A 1F60A 4K1XA 3AGPA 1N0VC 3CCVB 4P3YA 3CCEB 3CCSB 4LBZA 4MYUA 4TMXA 4RD4A 2DCUA 3QFCA 4TN1A 1W2BB 3CPWB 1KK3A 4LBWA 1ZM4A 3W5UA 3SJZA 3FPKA 4J0QA 1EFTA 4TMTA 4Y7CA 3W2IA 2VNJA 1FNMA 1BX0A 4LC0A 2J7KA 2C77A 2YWEA 4ZCMA 4DQLA 1B23P 1A8PA 4M4SA 3OZVA 3WYAA 1JA1A 4ZCIA 4M0LA 3P26A 3ZZ0A 1ZM3A 1KRHA 1VQ6B 3QE2A 4U9UA 1K73D 2OTLB 4YAUA 3VNUA 5EMNA 3VNVA 1IB0A 4ZV4A 1VQMB 4G1VA 4RD2A 1FNCA 4PC3A 1YITB 3W2EA 3CD6B 2BMWA 1EWYA 3AVTA 1KJZA 4TMZA 3ZZUA 1JJ2B 1TLLA 5TR9A 3CC2B 1D1NA 4ZCLA 1JNYA 2GQFA 3U2QA 1D2EA 4RCYA 1D8TA 1W87A 1YJWB 4WQMA 1ZM2A 1VQNB 2HDNB 2VNIA 2XNJA 4HE5A 2BSAA 1BQEA 4B44A 3E1YE 1VQ8B 1KC8D 3QSYA 3QFSA 2AHOA 2QTLA 1KK2A 3W5VA 4AF7A 3J81k 1QVFB 1QVGB 1IJFA 3CCQB 4FK8A 1QFJA 2HMAA 4QFMA 4MYTA 3VMFA 1G7RA 2QMUA 1VQLB 3P27A 1QG0A 1QGYA 2YWHA 1CQXA 1E62A 2RC6A 2DERA 3AVVA 3PENA 2QEXB 5TY0A 1CNFA 3ZC3A 3CCJB 5FA6A 1K8AD 2E1RA 1YI2B 3MMPA 2NPFA 1NDHA 1M90D 3WBKA 4PC1A 2XNCA 3CCMB 2BN4A 3LYUA 3ZBUA 3I1FA 4IW3B 2C78A 1NJID 3B8HA 1R5BA 1FNBA 1H42A 1FNDA 2BPOA 4YAOA 4YAWA 1K9MD 5GV7A 5TV2A 3WBJA 4P6VF 3QFTA 3B78A 2B7BA 3OW2B 1BX1A 1ZM9A 1YJ9B 2VNHA 1G7TA 2VYQA 3CMEB 1CNEA 4Y9RA 2DY1A 1VQ9B 4QHYA 3WNBA 5JBQA 3I55B 1QGZA 3WNDA 4UAJA 3LRXA 5H5JA 3G6EB 4F7DA 1R5OA 4YALA 1EP3B 3AVXA 4ACBA 3CW2A 2D74A 4H9GA 1DARA 3JQRA 4TMVA 4PC2A 1QGAA 4NBSA 2PMDA 1VQKB 1OB5A 2QDXA 1Q81D 2GPJA 1KK0A 4N3GA 1VQ7B 4FN5A 1AIPA 1F20A 2ZITA 3OZWA 5THXA 4ACAA 4B48A 1EP2B 4BPRA 1QUEA 2PLFA 1QUFA 2EFGA 3QFRA 1JB9A 1VQPB 3CRZA 3CMAB 1UMKA 1FRQA 2BM0A 2B5OA 3V76A 4PC6A 4DQKA 3W5HA 4ZGQB 1OGIA 4PGOA 1Q7YD 3W2FA 3JQQA 5HXBA 4C0SA 4B47A 1DDIA 1HA3A 2BGJA 4C43A 1GR1A 4RD3A 1W34A 4M2LA 2BVNA 3AVWA 5DSZA 1KTVA 3W2GA 3MCAA 2OK7A 3AVUA 2B7CA 1I7PA 3ES9A 2CNDA 3U6BA 4RD0A 1W35A 3OJWA 1AMOA 2BM1A 1M1KD 1EFCA 1E63A 2DETA 3ZZTA 1GVHA 2OK8A 4N3NA 3CCUB 3AVYA 1E64A 4B4DA 1VQ4B 1B2RA 1EP1B 1DDGA 1R5NA 3U6KA 3G71B 1N8RD 1XE1A 3A1FA 3ZBTA 2QA4B 2HCJB 1ZUNB
chains in the Genus database with same CATH superfamily
2ZRJA 1LBQA 2ZKLA 1CRQA 2ZSKA 3O9ZA 4KGZA 2NXNA 4PYOA 2J9FB 3MJ4A 3MTEA 5GOZA 1BE6A 2EYUA 4P7JA 5IH7A 4QXAA 3UQZA 1DG1G 4J0FA 3RVJA 5CDYA 5LUAA 1U31A 2D13A 2G72A 3IR6A 4DUYB 3FHJA 1QIJA 1VCIA 4TV9A 3AETB 3CF4G 1KQFA 4Z3DA 1NVUQ 3BEOA 3OPVA 1GTJ1 1HK7A 3DGEC 3QA3E 1F4LA 2EIHA 4JXJA 4TKZA 3V8VA 2DJIA 4P4GA 4FFVA 5BPFA 3TXXA 1CE8A 1J2RA 1D2GA 4BX8A 1NVKA 3RSCA 4N8DA 4ADSG 4D98A 1YL7A 2IVFA 4RU1A 1ZK1A 1U8UA 3AHEA 2CXQA 3BG5A 4MV5A 3DHYA 2WWRA 2QENA 1N92A 3T51B 2PGAA 3DBHA 2NG1A 3DPSA 4W6QA 4TL7A 1ZOOA 4EG3A 4W9MC 4DMMA 1I8TA 1IQUA 1OWNA 3JRWA 4HGQA 2WPNA 3W5SA 1AH2A 1V8BA 2XWJI 3QENA 3V7FA 5F9FA 1R0XA 1O0SA 1Q7GA 1Z0FA 4R8RA 3VYUB 1Q7TA 4GIBA 4Q4DA 2Z98A 1NBME 4RDCA 1NVFA 3O8DA 4MR8A 3D64A 3ZI4A 1SEVA 4G25A 2B82A 4IY1A 3IVXA 2FDRA 4JC0A 4S1PA 3CB4A 5B7QA 2GM5A 4BWGA 3SNKA 4NBLA 4RQBA 1FDUA 2JAUA 5L3QB 1EWQA 2OT3B 1BJKA 1ZUHA 3BD8A 3CRVA 3C6MA 3KB1A 3OLCX 2BFPA 2XOXA 2JFHA 2M9MA 2RHRA 2XZLA 3A7EA 3G3EA 1VCNA 4NBWA 4MKIA 1GU0A 5EIHA 4L16A 5BW6B 1BTOA 1TUIA 2KM1A 4C0LA 4BFCA 3T7IA 3TVYA 3VH3A 2R1TA 4B2IA 4DG9A 4RTJA 1LPOA 2F3QA 1VYVA 1KR2A 1ONBA 1B73A 4WX2B 2J48A 2C5HA 1JX6A 2YKGA 3NV7A 1WMAA 3AY3A 5FBLB 2XA2A 2I2BA 3QUQA 1CK4A 1T8UA 2Y99A 1L4EA 1P3Y1 3I2KA 5F5LA 1S8OA 5EP1A 2FQ1A 2A6PA 3UKDA 1YRWA 1SA0A 3BSWA 3WLFA 1U2QA 2J85A 3LS2A 3PYXA 3ICVA 4B2PA 1Q3KA 2FMHA 3T9CA 4C1BA 2GEBA 3H17A 3V7UA 1W73A 3RRMA 4BNTA 3SZ3A 1TRHA 2BLLA 3EGXB 3OSZA 9ATCA 1U7PA 1PFUA 1YR1A 2XYQA 5TVGA 4DPMA 5GZ1A 1L4BA 5BQFA 2QX4A 3Q9LA 3GJTA 1A5SB 4CODB 5T4HA 4JVMA 4RX1A 3VC7A 1VJTA 3STTA 5KYXA 2POCA 4GDFA 4KQCA 3AFHA 1TT7A 3KKOA 1AVTA 1U9JA 2ZS8A 3SXPA 5D01A 4DIMA 4JQSA 1AV6A 1GZHB 4V3CA 2P9GA 2ZT5A 2P8SA 4XUCA 3HCBA 2Z2IA 1V7CA 5DP2A 3R8CA 3S55A 1EK6A 1KP3A 1O77A 3ABOB 3KTOA 4WKPA 5TQVA 2DQYA 2HRBA 3M1AA 4ROSA 3ESZA 4AMBA 5IDWA 2CZCA 1RCFA 2FPIA 1WY7A 2X8JA 3K9FC 3BCHA 3MA0A 1RC8A 2GDJA 3ZDQA 4O2AA 3LO8A 4R0NA 3B7GA 3RM3A 1J0CA 2CJWB 5CFQA 4U7DA 1O94A 3NHZA 4P7BA 3IIMA 2I8LA 3T34A 1NKVA 3T56B 1TJ5A 5AJXA 3AKYA 2AFRA 3FWYA 2FEMA 4QZVA 1E0KA 2F1RA 3RWMB 4CR6A 3H4TA 4EGQA 3CC4B 3IHWA 4Y2PA 1FDRA 3RHFA 3SI7A 1ODSA 4LCJA 2DKFA 2IOQA 1J99A 3AHJA 3HKBB 5TARA 1PDOA 2W6QA 3AHGA 3WO1A 4C7OA 4LYEA 4N76A 4PHFA 1T3SA 2KJQA 3KPJA 3M5CA 3GR6A 5EQTA 2O8NA 4E4YA 5IJWA 1H22A 4OOFA 2PKWA 2RGEA 4MYUA 3LTEA 1OX4B 4A10A 1R0WA 4ZALA 2E82A 3WLJA 1VFPA 2CLIB 4GOLD 4X8MA 3U49A 1J7KA 1ENZA 1ZC4A 4ZAVA 4ZMBA 5I01A 2X1LA 4MB6A 5IYZF 5EIEA 1JEYA 1HE4A 4DADA 4O1IA 3UJ9A 3I8XA 1URPA 4L8YA 2Q1TA 2X8BA 1F0KA 2X1VA 2E85A 3IH5A 2PQMA 1SXJD 2AE1A 2WIDA 1GG9A 1XMPA 4G01B 1A9OA 1TTPB 4OA5A 5TEVA 4BS9A 3AFMA 3DWIA 1NB9A 1C7FA 4R98A 4RMNA 4BASA 2QTHA 4Y9SA 4IIBA 4BRZA 5E7JA 3H0CA 3ZTYA 2XPCA 2VNJA 1T8RA 2CD9A 2OE2A 1RVDA 2ZIXB 4OXKA 5E2IA 4LC0A 3RSGA 3GLIB 4Y8VA 3LBFA 1V6CA 1USUA 4JDUA 1JHOA 4OOVA 2OZPA 2FWPA 4RTPA 1A4XA 1RZVA 1D2NA 3OZVA 3PNVA 4CMCA 2V31A 1N06A 3M6AA 4NOKA 1LS1A 3IP7A 5CEEA 1ZM3A 5JPIA 3UOWA 3QUSA 1VSQA 2ZSDA 3KO8A 3DT6A 4YRSA 4BE7B 1SKMA 2JBAB 4EO7A 4IOLA 3U16A 3V4ZA 3MN1A 1K7CA 4BNMA 5I7UA 2P91A 1QQTA 3DV9A 1RD4A 1LVUA 5E2BA 3KWMA 4ZV4A 2GHTA 1WW8A 3W7BA 2VT3A 3CB2A 3GI1A 4OB7A 1PJ5A 4V38A 3KQQA 1FB5A 3CX7A 1PDVA 5B1DA 1OVGA 5C52B 1II9A 5JJCA 5A6SB 4X1OA 3WGVA 4YCSA 3NG1A 3QE9Y 1MD9A 1YU6A 2GLXA 3PS9A 3L0IB 4CIBA 2HM7A 4N47A 1NVDA 3GBVA 4O4IF 4DIUA 3PTAA 3PGVA 4FINA 4BB6A 3FCYA 4GC5A 2I3BA 4HJRA 3RS0A 4GE3A 2DBQA 1T36A 2ZRPA 3ROZA 3GJRA 1WXGA 4L78A 4EQ6A 2OVBA 2IBTA 3GWGA 2W37A 1WY5A 1I0LA 1ND5A 3G7UA 3HG7A 3VSEA 5J1SB 4MW0A 1Z45A 4MP8A 4DA4A 3HDGA 1GSHA 2YHIB 1WVMA 2C4WA 4HNQA 3AM4A 3MTDA 4B3RB 3KQKA 1IJBA 2QI9C 4YX9A 5IX8A 5IYPA 3ISVA 2IXBA 1YLOA 2XXAB 3TAUA 4YJ2A 2PUTA 4Y6PA 4RWZA 4S1VA 4B44A 5BNWA 3PDHA 1E1LA 4CEIA 5TMBA 2ONZA 2J4CA 2O0JA 3K4HA 1SXJE 1MC8A 2PPVA 2GF2A 2DFDA 3O47A 5E4FA 1ZU4A 2OLJA 2XSZD 5WRFA 1EESA 3D3EA 1K66A 4UCXA 1BWPA 2RHBA 5AXCA 4L1KA 4LWZA 1UP7A 1KI6A 4XJVA 4XDHA 3SIRA 5KQLA 2V59A 3DHEA 5IEJA 5JNTA 1GILA 3WLOA 2WKRA 3P94A 4X1IB 3WIUA 5JNWA 2V9ZA 3IPYA 2HMAA 3KL2A 3GUHA 1M33A 4XASA 5EUCA 5G4LA 1XDWA 4G0PA 1N3IA 1YB2A 4PWZA 5IARA 1CUIA 1SHUX 1YA4A 4R3NA 3CNLA 2QMUA 1RJ9B 3PYLA 5B3KA 4J49A 1QE5A 4EAAA 1OOEA 2I1WA 3HEAA 4LSMA 4OAQA 4LISA 1JE0A 4DV1B 1ZK0A 1NLUA 1SBYA 2A8YA 2HSEA 2XMDA 4IJMA 2HX1A 4JUFA 2TMYA 4MV4A 4QOHA 2JK1A 4WZBA 5JFGA 2O8BB 4N41A 1R50A 3EQ6A 4DIBA 3GLUA 4EUNA 1UC8A 1CUJA 2RH5A 2WHRA 1R0KA 3HJCA 2J87A 2QUBA 4RNDB 1LLQA 3FYCA 4DRZA 3A1TA 1X8LA 1EK2A 2IGBA 3M70A 1YTUA 1D09A 1T9GS 2PZLA 3HVHA 3TD6A 4IRXA 5DWVA 2IUEA 3LECA 4MB0A 1MB2A 5DOVA 4EUEA 4EHFA 1HBJA 1BKSB 1BA3A 1CW2B 1TM7E 3VU8A 1E58A 1YGPA 2QIOA 4RY0A 4Y67A 1W36D 3GIWA 3ZDFA 4LXXA 3TH5A 4CKEB 4L15A 1R6TA 1B6RA 1W4LA 1XNJA 3HJHA 4JT2A 4UTXA 3H1EA 5IPFA 1ABBA 4UHKA 1AKVA 1LX6A 1XA4A 2ZT6A 4QSMA 4AJ4A 1A4RA 4DABA 4EHAA 1M90D 4EI2A 1EJBA 4X95A 2WAXA 4QQRA 3OQ6A 1EWTA 1VJGA 5H3LA 4IH4A 3EUFA 1G3IA 1A77A 1QYCA 2JK0A 3H1PA 4M8NE 1M1YA 1QR2A 4Z0NA 3LUKA 4JI8B 3V9PA 2CDAA 3M34A 5HK9A 2EJWA 1LU9A 3BMNA 3U7HB 1P6UA 3VBEA 2EDAA 3ETDA 2IXFA 1COWD 1HLPA 4M83A 3JAKA 3PDCA 4FX2A 3RCBA 4B3CA 1YIOA 3F6YA 3OFKA 1NATA 4MSUA 4WOJA 1S8NA 3EGCA 2EG5A 4GKBA 3HVUA 3TBHA 1UD8A 4KXLA 4NKRA 3UMSA 4UJ3A 2VCEA 3C98A 3ZU4A 4UKDA 1NRKA 1X86B 5BSRA 5EGNA 5HPYB 1TK9A 3K9LA 3LBNA 2DR2A 3D4PA 2CKDA 2EKZA 4R9NA 4ER6A 1KQ3A 2LBPA 4L4XA 3MFQA 2VNHA 1A2OA 3LDUA 3N0XA 1E6KA 3TLKA 2R9VA 2O7NA 2QPLA 4HYEA 5DN9A 1JLLA 3JWJA 2I6XA 2FETA 2O3JA 3HPRA 4GPEA 1M2GA 3R7DA 1V1JA 4GHWA 1M8GA 3LP8A 3ICQB 4HXGA 2QL9A 5IUNC 1YRLA 2O3SA 1UD4A 4NATA 5EJ2A 4CMIA 1CJKC 1D3AA 4KV9A 1U1EA 1TFRA 2XQVA 1FRZA 4FJ1A 2XYHA 1JDNA 3ZHZA 1XTIA 2JBHA 2VTKA 3AQIA 4YK7A 3SXUA 3K0AA 3C0KA 3UMJA 2IX3A 2H9IA 4GKKB 4IM7A 1ZEJA 3HS3A 1NJ1A 3FYDA 1I0ZA 5KWVA 1U1GA 4OY3A 4MUBA 1CZUA 1WOPA 2ZQZA 4HWSA 3A06A 4Q3LA 3PC3A 2X7XA 3DEAA 4HWTA 3W6PA 2E4ZA 3RIEA 3LA6A 5FB3A 3C87A 1YL5A 1MIOA 1NG9A 2OGSA 2BKEA 2HMUA 3ND8A 4DNQA 4JLBA 2G83A 5C1IA 1OJ7A 5EZYF 2VTBA 1KJJA 1XCPA 3G1WA 4RJJA 1W4ZA 2CMFA 3NLLA 3OZ7A 4PVDA 1CUDA 3WS7A 1Q81D 2Q4RA 5EE0A 3RTDA 4MI9A 1DTSA 2DFVA 4BRUA 1R9JA 1UOPA 4IRMA 5GZ3A 1YR7A 1ONNA 1ZJ4A 1NI5A 2FZVA 3PC4A 4ZC8A 1DFHA 2Y1DA 4QFBA 5KNCA 3A8KA 2PNJA 1FFHA 3V46A 4INPA 1R0CA 2VP9A 4ACAA 3LYAA 4CKXA 4RL4A 3IXMA 2FXIA 1SBNE 3TB4A 3VGJA 2AMYA 4Z4SA 1MRSA 1Y5RA 4I6JA 4Z0PA 5JYDA 1BMFD 1F38A 4FYHA 1RC0A 2O2SA 4Q4JB 2O3QA 3F7TA 3JQ9A 4LDRA 2AXQA 2FQXA 1DBIA 3GL9A 2GASA 1JB9A 1H8HA 4PXYA 3ONDA 4DQ0A 4U7TB 3U60B 3B3QA 3SR0A 1FRQA 2V9PA 4WN3A 5A5VA 4G5YA 1E5LA 4CKBB 5ALRA 4MV8A 1I3NA 3TGLA 1U8TA 2C92A 2WOOA 2PTHA 2P7IA 3N8HA 4ZOBA 4ENUA 1L7DA 4PC6A 2QTFA 4YJ3F 3SOPA 4B4UA 1MO4A 2VDWB 2ODAA 2YFQA 4MMXB 4D9IA 4RVOA 1E3XA 1LK5A 3GGDA 3V4PB 3ITNA 1GAXA 1PJSA 1V11B 3NTLA 2UYCA 1TXGA 3JQ8B 5E9WA 1YA6A 3D6TB 2ZYGA 4C0WA 4OYLA 2VPYA 5BOVA 3T9DA 3MPOA 3I62A 4JY7A 2HGZA 5I8PA 2FK8A 3WHIA 1JVBA 1W34A 4M2LA 1ZD1A 3F6CA 3IP8A 3B3GA 3EGDA 2IYNA 3KWJA 3PXEA 5AJYA 3RNLA 3EN0A 1DTEA 3KUXA 1VHTA 5AJZA 2NUBA 4HGYA 2MSEB 4LPKA 1MPXA 4OQQA 2JDIA 2B8JA 1OV4A 4RYLA 4XDZA 1HFJA 2B7CA 4CR7A 2D54A 3LUHA 1P9OA 4MVJF 4YREA 4JUCA 1FXUA 3VZQA 5JR3A 5LNK6 1QTRA 3T7AA 2CB9A 3OJWA 2IZ6A 1KZLA 3JPWA 3STUA 1V4VA 3G0OA 1E6CA 1JLRA 2ZTUA 2OLKA 3RADC 1GSAA 4KRGA 1NW8A 3MCUA 1E4EA 3RRZA 1E63A 4LXHA 1ADCA 2A0WA 2W9XA 3RVOA 5EJ5A 2GAOA 4JQOA 2FJUA 2PLNA 3H5NA 3DMFA 2XYRA 3NALA 3EVEA 3HR8A 1W85A 1E64A 4PQFA 1DRVA 3QRWA 3UJ6A 2WV9A 2YBEA 1FP4A 1E20A 1L7EA 3GCGA 4HH4A 4Q05A 5TGTA 4C5BA 4GMFA 1INLA 3SLGA 5JJBA 3F2IA 1H3FA 2WD7B 1KRXA 1MABB 2DECA 5JE8A 4X7RA 3LQEA 2IYAA 3ZU2A 3P2KA 1QO0D 3G5LA 1L2TA 2V7XA 2XDAA 3N53A 1W581 2Q1YA 2HJ9A 1E9DA 3I73A 2C61A 3IAM1 3I2GA 3PQCA 4OGKA 2CJPA 1E3ZA 3UKOA 1T4CB 4E2YA 2V3CC 3N05A 3ETCA 1FYDA 1YOVB 4EYGA 4G86A 4YUXA 2W2KB 4D9KA 2HPZA 3OOSA 1PW7A 1SBCA 3WGKA 4MVJE 1ISJA 3VNBA 5JDIC 2XXBA 5EUBA 1NURA 4TQGA 1OIXA 3GVIA 4WLNA 2PIDA 4YUZA 5HP4A 4KLZA 3AY6A 4C3OB 4YXWA 4W8GA 2CVZA 4UU0A 1FSGA 2OTCA 3EF0A 5JQGF 1T1EA 4JP1A 4HTFB 2PL5A 1DMRA 4C4TA 1J21A 3ORYA 4LJRA 2HQSA 2IBMA 2VP0A 1AV7A 4EJ2A 3IEVA 3KV3O 1XJQA 2ZYRA 1I2CA 4AN4A 3GIDA 4Q1EA 3KYDA 1K5GA 2QE7D 3TZLA 4B83A 4F8EA 1BW9A 4AF6A 3EZNA 2GA8A 4JLAA 4P5PA 5EIOA 4CM1A 5JD6A 5DM70 3WB2A 1SKYB 1AOXA 2SKCA 5HKKA 4D42A 4EP1A 3B12A 2ZUSA 1CY7A 4C0AC 4G1BA 1BFDA 4EZBA 4PSKA 4NCJA 3EFHA 1RIFA 3VDQA 1E9RA 4XORA 5FUQA 5DM2A 4TMWA 4BMYA 1DC4A 2O8CA 4HPWA 2A0XA 2P2LA 3T1OA 3K9BA 2D2FA 3DBHB 1VPWA 5T6MA 5IP5A 2VT2A 3WA7A 5EE5B 3BC1A 1D1SA 1G60A 1C7RA 4LDJA 1AGYA 2Q9AA 3RUAA 4BUZA 3NBMA 2BEKA 3LZ6A 5JAIA 4PZAA 2DF8A 3A27A 1M6YA 1O94C 3UICA 3CCFA 1LTKA 1ND6A 4RPBA 4EDHA 4WK4B 3PNMA 2VKTA 2XVYA 1VI2A 3QVKA 3JR7A 4B3TB 4YRFA 3SBXA 1AK1A 4PM4A 5BV2P 3PXGA 1J8YF 3DMHA 5CPBA 1HYEA 1TMOA 2NP7A 3ZHBA 2NUPB 2IZZA 5DNEA 3OF3A 3CUSA 2FZKA 4PHGA 4EY4A 2UVPA 5F2OA 4K9OA 1OI7A 2F67A 1MX9A 1FVHA 5FO0A 3IOYA 1Z0DA 2E4YA 2WKWA 3O73A 2DUWA 3NNNA 2WVAA 3I6BA 4Y98A 2O5EA 2OGZA 2VDQB 1T26A 2UYQA 4L08A 5B1YA 4QEKA 2EC5A 2P6OA 3L8EA 2EZTA 5ALNA 2BR5A 4LTDA 5H4GA 4JXZA 2PWYA 3EWSA 2B8EA 2BFCA 1XKXA 3EAFA 3AF0A 1NJ6A 1KPIA 1NUPA 1YCFA 2WLSA 3CSSA 1Y1PA 4AJKA 1AGXA 1IRXA 1NYQA 4J0KA 4MUIA 4RQUA 2VZLA 5ER9A 1YS6A 4N3BA 3TJMA 1LLDA 5EHQA 1VKNA 4Z9YA 5P21A 1SVOA 3VR3A 5AJWA 3VDMA 3MWKA 1ZJ6A 4Q4AB 4KVAA 3RHZA 3ITKA 1GAWA 3WGZA 1U9YA 2LWIA 3K1TA 1A7AA 5LBTA 4BO3A 2J09A 1YDEA 4CM9A 4U8HA 4S1WA 4ZN6A 4U1RA 1KI8A 3H5IA 5ESXA 3BXOA 1UBHS 3EEBA 3G0IA 3ZCRA 2H4HA 1X1AA 2LCFA 4BNWA 5CT4A 5I9LA 1W9MA 1VQ5B 1XKTA 2I22A 4LYDA 4F71A 5FI1B 3LCVB 4BATA 3I2HA 2V4DA 4FMCB 2KYRA 4RC9A 2VSOA 1KEEB 1H8HD 2CFCA 3HZHA 4YPVA 4I1OA 4IIYA 4PGGA 5AKZA 5DHQA 2HRCA 3QWHA 3LH5A 1P9LA 5D87A 5K3FB 3Q8LA 2DQKA 3W05A 2Q6VA 1Q0SA 4CXMA 4FC7A 2EP7A 1L5RA 5IU6A 2HA0A 5FEMA 3IAM6 5EQFA 1E3TA 3KT6A 1NULA 2PBFA 4IQ8A 4JP5A 5DCUA 4C30A 3G0HA 1PEAA 1QK5A 3TR0A 3RLFA 3I76A 4BNGA 2GN2A 2C7OA 5ADUS 4CL0A 3LKDA 1QFYA 5KKAA 1M1YE 3GRUA 5IJ0A 4IHJB 1H85A 1Z74A 2AYXA 4HMQA 4PZ0A 221PA 4QBTA 4C29A 1TIBA 2R8PA 2C99A 2C5EA 5CT5A 2JARA 2J08A 4H1TA 5IXJA 4K1XA 3R6TA 4KH0A 3MB8A 1JHVA 3QU9A 1GKLA 1CUFA 4O5AA 1DEHA 1WXFA 3CCVB 2C9YA 4QARA 4EJSB 3DNMA 2C0CA 1PR5A 1QJCA 2GLTA 4LGMA 5C46F 1U28A 4Z53A 4G6ZA 4H31A 3Q1KA 3U1VA 5J23A 1RLOA 5TE9A 5BR4A 4NXNB 3TFQA 3UK7A 3V4OA 3SYNA 4C3VA 1VJ5A 3I53A 3TCKA 3BH6A 1ZD8A 2PL1A 4Q1FA 4ZZ3A 1X80B 2IYRA 4MULA 4L5CA 2PV7A 3C6XA 3PQ5A 4MUEA 3UPTA 4BAUA 1OLXB 1Q7CA 2V98A 4I5EA 1BIFA 4PX9A 1LPNA 1NWCA 4BHTA 2H11A 2MMCA 4Q9AA 1V3VA 1JWLA 1Y6JA 4LFCB 2BRUC 2YXDA 2H4YA 1HG0A 1WZCA 1I4TD 2PAAA 1K97A 4INOA 4BMOB 1K7FB 2XCRB 4D9CA 4ZCMA 3ZE6A 1E0DA 1FTSA 4GKAA 1A8PA 1I4WA 3OFVA 4MR9A 3KKPA 3WE7A 2RGYA 4V1CI 2XWBF 2UZ0A 1JEJA 1S89A 1X9IA 1NVBA 2WWWA 3GG2A 1VXRA 4UBKA 3ZE9A 3DZCA 1M5TA 3EZFA 4BECA 3ZZ0A 3M8KA 4YQFA 1UP4A 1V7PC 2FPRA 1Y3IA 4Z4HA 3N3AC 3N0WA 1U0OC 5GJCA 1N2JA 1JR6A 1Q1NA 2AR0A 3IAUA 3ACCA 1Z63A 3IT0A 3RYIA 4BNHA 2I29A 3OE5A 2PT5A 4M88A 2QG6A 3WBBA 4WKOA 4D8YA 2NU6B 1U1FA 3HCWA 3S0JA 3QKRB 4G1VA 3GMSA 2VZ8A 3MXOA 4F7WA 3MJTA 2LCQA 3IP1A 5FPQA 3AQ4A 3ZYCA 4C6TB 2Z4SA 3INNA 5JS6A 3VPSA 3OOWA 4DVJA 4DWOA 2AMVA 1G8FA 4L8JA 4A8TA 3PDUA 3K1JA 1BDJA 3EIOA 4RUKA 1UADA 1M2VA 4OQMA 5C8ZA 1B74A 3D8UA 2Q4EA 3LA8A 4I3FA 4KFUA 4OMDA 4ENVA 3LU1A 3WV4A 4CFSA 5H3HA 1TEHA 1HYQA 2HSJA 1HQDA 4GX2A 1YKSA 1CY8A 4MTCA 4OL9A 1PHPA 2OAQ1 3JALB 1A72A 4GOKA 4QIHA 4DCGA 3AJDA 2I2DA 1TAQA 5JLAA 3OP1A 3WLTA 3U2QA 4GECA 3RF7A 3P19A 4TV9F 1RRGA 3AFOA 4G97A 1SXIA 5SY4A 5ITWA 2R25B 2JI8A 3QU7A 3JATA 1R6VA 5JO9A 2ZYAA 1GQQA 2NXEA 2Q4DA 4I7EA 3ZLTA 1EIWA 1YONA 1VJ1A 1RP7A 1UXKA 2XNJA 2ZIFA 1T4DA 2ZB3A 2BSAA 3MILA 3O74A 4XVRA 1BQEA 4G1FA 4MZXA 4CDMA 2AR9A 2QVXX 2GJ9A 3CLSC 1KC8D 1WLSA 4RKEA 3WLKX 4D3YA 2AHOA 2FLKA 3FUVA 2CHGA 3CP8A 4CKWB 4OHCA 3COYA 5JYEA 1YE8A 4LN1A 1SXPA 2CXOA 3C6YA 3NM4A 4HFRA 4OU4A 4AN0A 5DNDA 1S5PA 1AMUA 1RWNA 5AVKA 1LWOA 1XDSA 1JTVA 4Q3AA 4PBTA 4H0NA 4FK8A 1N5JA 3GLVA 4B4OA 3Q8MA 2O1SA 4L3OA 3VU9B 4AUNA 3HZZA 5BN1A 4H1VA 4FFRA 1L7BA 5FX2A 5ED0A 4OFXA 3S6JA 2OXIA 5JRDS 3D7MA 2WZNA 1KJIA 2XKAA 3OTIA 4R2HA 4BNNA 1DL5A 1OI3A 2ZJ1A 1AY0A 5IJAA 1CRZA 1L7NA 3HV2A 4FI3C 4I5GA 4DJFC 4D9NA 1Z37A 2PRZA 3OLQA 1KI2A 3KR2A 1NE7A 3IFSA 1VE1A 3NHLA 1QV6A 1F1BA 3A3NA 1N5LA 4GUDA 3F8SA 4IUCS 3TQSA 1SC4A 2Y0CA 1IHDA 3WZ2A 1ZDMA 5G0UA 3KQLA 1E61A 1L9XA 3ZGXA 1WSVA 4P25A 2QNIA 3A6ZA 4O1HA 3IUNA 4NEHB 5K2OA 5JG7A 1J8QA 1WU7A 3U62A 4LNUB 4WXYB 4OQ4A 1Z6YA 4C4AA 1V43A 2R8RA 4S35A 1T9HA 1S4QA 4OCZA 4BO9A 3EVDA 3AFGA 3DM5A 4M54A 4DCNA 3BFVA 2ZTNA 1T2UA 2ZL7A 2OFPA 5CBKA 1KFBB 5EP4A 1ODCA 5EMHA 2GHRA 4BLSA 4QVGA 4J16A 1MEOA 4BO1A 4EIWA 3CCJB 1IPFA 4HTFA 3M82A 4QL3A 4PX5A 5E3IA 3M3DA 2Q7XA 2H51A 4A1FA 3Q10A 2CK3D 3T06B 4F84A 1P7PA 3SU8A 2ZXEA 4ZT3A 1UD6A 3GNQA 4MJ7A 1CR0A 2G09A 4RPJA 4YPOA 3ZE8A 3LNTA 1CUSA 3K96A 5HKOA 4I55F 6ADHA 1HETA 1ZR4A 2VBSA 2ZJ6A 1EM6A 2QRKA 2XNCA 3L6DA 3QWAA 4JBGA 1T43A 1JDTA 3ILYA 2O7QA 3M0EA 4JROA 4ZK2A 1TL7C 1BD3A 2FRXA 3N2IA 3Q6IA 4E1VA 4FDLA 2BZGA 3NC0C 2GS9A 3I2IA 4NULA 4E7OA 1PUJA 4C7KA 1X8XA 2NN3C 2OBLA 1U2ZA 3NB0A 2VAPA 3LGSA 3BMXA 3COPA 3M6LA 2BTQB 3SVZA 3ZKWB 5A9SA 1SWWA 4MCHA 1I1HA 2BPOA 4LY3A 1TQ6A 3A0UA 5TF0A 1NXPA 5BURA 2RJOA 5HF9A 4DA0A 4YBZA 4YP6A 4PHTA 1PR6A 3I04A 3L9WA 1YRBA 1OXBB 2NAFA 3NVKI 1WXWA 2YC2C 5KTNA 1N2CA 3EZ2A 4H15A 1ZVJA 3LKZA 5DHAA 3RUFA 1XNQB 1W5BA 3OW2B 4E4TA 5HZMA 3ZPNA 3KT3A 1R2QA 3J7TA 5E8RA 1LY1A 2FWAA 2YWRA 4KPUA 1QC5A 3VSBA 2QGGA 3JPYA 3EVFA 6LDHA 3DYVA 2IEAA 5KOYA 5AH0A 3H3JA 2H1LA 1T4CA 2QTAA 5FPYA 4AMVA 4N5DA 1BXZA 4GQBA 3S2GA 4DSOA 4QLBA 3O75A 1BA2A 1IMJA 1WQ1R 4NZMA 3PEEA 5TT1A 5K20A 3NBUA 3Q11A 4YY3B 3ADCA 3LOUA 4CF7A 1DAKA 2AQ8A 2R7MA 1E0AA 1V16A 4XYMA 5LMUB 2O8DB 2FDCA 2N3ZA 5JSUA 4B84A 2GI4A 1VLHA 3AH8A 4QBFA 5LOVF 1EQAA 1JSRA 1KRWA 5G4KB 4HL6A 3RVKA 1RRVA 2D2EA 1KIFA 4ACBA 1CY1A 1RWVA 2HU5A 4IXDA 3EG5A 1NONA 1EG7A 3JQ7A 4LNAA 1N1MA 5KMGA 1S3SA 5LB2A 4B40A 1YE5A 1E4EB 2WAOA 5HA5A 3JQAB 3JU4A 1L4KA 4G85A 1KQNA 2QOEA 3QKSB 4EW1A 5I8ZA 1IDN1 2L69A 4LXQA 1PGPA 4DSNA 2XITA 4C0HA 1PZXA 1G3QA 1GNQA 1Z2OX 2W2LD 4EQZA 3EPLA 3D2AA 1N5RA 1RHUA 2EERA 2QX7A 2EU8A 2Z3ZA 3PJFA 3ZEAA 1YUMA 3DUFB 3E3LA 4NWIA 2HD4A 3V4VB 5K01A 3H2YA 4IBOA 1I18A 2C7GA 4ZVPA 4C2BA 2I3ZA 2A1UB 2WIFA 2YNMD 3E1KA 2ZPUA 4ZVUA 2I8CA 5CITA 1QZUA 2IVZA 2Y1XA 1QRTA 3OLWA 2F1IA 4D25A 1Y9JA 2OCGA 1QRDA 3INGA 4OP1A 2ZJ8A 3GZNB 5HFJA 3WGGA 4A5SA 3UMYA 4DB4A 1NBMD 2GCPA 1OYOA 5IDQA 2FPPA 2VJDA 3FNFA 1BO6A 3I05A 3DB2A 5DW0A 5EI5A 4UUBA 1E1QA 1RACA 2B2XA 2VP5A 3JQ6A 2PU5A 3H8WA 3V42A 1SCJA 1UPCA 3L8GA 1D6MA 1M74A 1UDRA 1MJGA 1GPMA 3AUKA 3BZUA 3OOEA 4JJ8A 3LJKA 2ZWOA 1MTZA 4KQFA 3I72A 3DE0X 2AKAB 1JKMA 2PUHA 4LXYA 2F2TA 4WI1A 3VVLA 1RI3A 1ZCZA 2XR1A 3U19A 4QNMA 3UC5A 2JLRA 5AP9A 1CFZA 1H1LA 1RPZA 2PH3A 3MOIA 1S7CA 3JQQA 1UBGA 2XF2A 4KX5A 1PR4A 3UATA 2YV3A 3UK0A 3OEED 1LBIA 1RZRA 2W43A 4AY4A 1AF4A 1MIHA 4G81A 1GV1A 3RWBA 3WFIA 1W4CA 2P2YA 1XVVA 5D2CA 2WYVA 5ERYA 2F8LA 4HDAA 3A4TA 2P65A 2P62A 2W71A 7REQA 2HNKA 2UXCB 4LVNA 2ZZNA 5A0VA 1ZVKA 1IM5A 2RKBA 3A6KA 4Q4HA 4RTRA 4UBJA 4UNPA 3AIMA 2JRCA 3EEFA 4D4IA 4DMRA 4LF6B 2XGJA 5AK0A 3RYCA 1YBVA 2H2DA 1IL0A 2BEVB 2I7DA 3CNQS 5FD8A 5KZMB 1EXNA 4B2LA 3U56A 4K0RA 4UTZA 3AZOA 5H9VA 1IZ9A 4MS1B 4G4SO 5TVKA 4BGUA 2C8VA 2DVMA 2KS6A 2PXXA 5AHRA 5DGXA 5IVIA 4B9AA 5JSFA 5JW6A 2ZT8A 4JJKA 1Y9ZA 1KXJA 4G6IA 5LBIA 1XRSB 4RPKA 2XBMA 1CC1S 2XWSA 3C4QA 2O0HA 4MGHA 1S2OA 4BWYA 3D6FA 1M73E 2YBDA 2ZYIA 2HK6A 2ZYUX 4KE8A 3NETA 4TX1A 4URHA 2F3TA 1E2PA 2HT1A 1K68A 1D5WA 2ATIA 1MH9A 1YS9A 1U7OA 1XC7A 4XFJA 3S1SA 1PTJA 3NH9A 3G7NA 4TKVB 4JP2A 1FXWA 2XMBA 2HCJB 2CHEA 4BVJA 2BD0A 4J2HA 1NRWA 2CD7A 1K7YA 3RIYA 3IAS1 4XRGA 3DVAA 2D1TA 4RE6A 4MHTA 2A9PA 3D3KA 1T8TA 5LOVA 4DJTA 2WP8J 5KWSA 4ZODA 5I48A 4YMVA 1AGRA 1PL6A 2F43B 3IQWA 2OFXA 2V4MA 3G9TA 4E0FA 2R4TA 3RIXA 1LC3A 1MH1A 4DLUA 1XB2A 3UGTA 1RQPA 1QO9A 3BMOB 4OAPA 3BEDA 3DR5A 4IGEA 1DWUA 5I7AA 3X1ZA 5KU7A 5I3ZA 2XQIA 2Z56A 2IYQA 3IKLA 4FHFA 2Q5OA 1IJEA 1A7JA 1ITZA 4O0LA 1IWOA 3RNOA 5KQSA 3T7EA 1XBTA 4LUCA 1GQ2A 3ROGA 5AK6A 2BFBB 2WFMA 2WKSA 3ADDA 4V0SA 3RAEC 1EFLA 2IS4A 4MRMA 1V3QE 2XSZA 3A9VA 2PBRA 5E95A 4PSCA 1CZLA 4DBLE 3NU1A 3SX2A 3KP1A 1P1KA 1AQUA 2ZI4A 3NJ8A 4BKOA 3ONFA 2JANA 1DRKA 1SBHA 2SKEA 1QB7A 1ES9A 5HMLA 1JDUA 1R1DA 2WM9B 1DEKA 3WIBA 1P9RA 1ZIPA 3O2QB 3WLHA 4CF5A 4U00A 2LR0A 4Z4EA 1KI6B 4LRYA 3SY8A 3NO4A 5CA0F 1NI3A 3IP5A 4L6IA 2FZCA 2I4TA 2J3LA 1X1BA 3N5CA 4EW6A 1JHYA 3ICEA 1KJWA 4BQQA 3U7QB 2FQYA 2C9ZA 2V74B 3UUWA 1KMQA 2IEIA 3FDIA 5IWAB 4GPZA 2W8ZA 1WETA 3IL2A 3EEQA 3H65A 2OO3A 2CJXA 4J90A 3BJRA 3L4EA 4Y2YA 4M38A 4BN4A 4GW3A 2WTNA 2CF6A 1G18A 2CLHB 1CR2A 2G71A 2DJ5A 3JQBA 1UPUA 4BQRA 4KQ6A 3NIDB 1IULA 3A1WA 4IWYA 4RPHA 5TNXA 2EBUA 1N6IA 4ZOLB 3SHTA 3UMVA 3OCWA 4BNUA 5IKPA 4MV6A 4ZXPA 3RRBA 1N8TA 4LI3X 4BMXA 3DHNA 5ICMA 4MI6A 2J30A 2YS6A 3E9EA 2HA7A 2Q8PA 3MT9A 3KJEA 3P1JA 4N5LA 2HQ1A 4AROA 5HJ7A 4OFBA 5G4KA 1DQRA 2GPTA 1XDZA 2DPYA 4EH1A 1P39A 2ECQA 1E9CA 3H5WA 5T41A 4CMAA 1XD2B 2IW3A 1CUHA 2N46A 4QOFA 4G5OA 2BGIA 2BV3A 3D5TA 1IY1A 1YCDA 1OVMA 4H3SA 5FUVA 3T1VA 4DR3B 1N6PA 3WMFA 3AINA 4DYVA 1QIDA 2K87A 5BNZA 1RRCA 3SJCA 2NV0A 1DUSA 4XGKA 4EHIA 2ZWAA 4FS3A 1SXGA 1OIVA 1R88A 1WDTA 1I4LD 1SR8A 2AJ8A 3DTVB 4AWBA 5IFKA 5ARDA 3HP4A 4PE5B 1GO2A 1BVRA 2WJ4A 4RFSB 4RQAA 2N42A 4RJLA 1Z33A 1KYVA 1R4MB 2FW1A 2J9ZB 1TPZA 3L1UA 2EFDB 1SVNA 2BR3A 3EQ7A 3BMCB 3KYBA 4MYDA 1UBEA 3AHFA 4R0VA 5FL7D 3DAPA 3ZEIA 1XXLA 5B64A 3OSUA 3GA5A 1W75A 1MV8A 2ZJ7A 3QPAA 4FBMA 4EI9A 5JMOA 3GPIA 5BRAA 4B3MB 3Q3HA 3OJ0A 4JLKA 4O4HF 1Q7RA 5FADA 3VGPA 1W44A 1NPDA 4YDQA 1SQGA 2OYNA 3QJYA 4YT5A 1V5VA 4WZEA 3K5IA 4REOA 3EXIA 5EJ8A 3GXOA 1B6SA 4IIEA 4CMBA 2FXVA 5CB6A 1RJFA 4ZMRA 3LK7A 1GLGA 1HO3A 1P2FA 1Z07A 1M67A 1YS7A 2JFZA 3HKEB 1REQA 3AR9A 3OZBA 4IVPA 3T5AA 1BHSA 1ZQ1A 4ZVVA 1WX1A 5EHNA 4DLSA 1KZ7B 2FVYA 2DCUA 3NC1C 1NYTA 4RK7A 2GBPA 3LX5A 3FE2A 4H18A 5IM5A 2DUJA 5KOHA 4FR5A 5HZKA 3NDBB 4O25A 5CW2A 5F3RA 3C45A 3ZHVA 4B3GA 3ZHQA 4DV4B 1FNSA 3DAFA 4OHXA 4WUVA 2IYPA 2HLDA 3GEBA 4TKUB 3RYHA 4B6PA 4C14A 1L0BA 4TT3D 3KVYA 1MG0A 3DZBA 3PHIA 1OU4A 1U5BB 5JI2E 2OBYA 2X2OA 5TIIA 3L7KA 1VKOA 5FWNA 3EA4A 1FSPA 2Z8YM 1CDZA 2ZIXA 5AM4A 1OH8A 3LX4A 2HXSA 4V24A 3CHYA 1AZWA 2XMCA 1Y4AE 1XCLA 1BX0A 1QVVA 3KHSA 4RULA 4B4VA 3TKAA 2MWMA 2C9MA 3AF3A 3NYWA 3EQ8A 3JD3A 3O8QA 3FPAA 1GKUB 5CG2A 1QKIA 2C7VA 5G53C 1BHQ1 5JALA 5JV5A 3S8EA 4CETA 3SQOA 1DWOA 4MGZR 3ORHA 4UEQA 3KUKA 2ZM6B 4BIMA 1SQ6A 3NDJA 4YFVA 4QM7A 3ZWXA 3R76A 3AM1A 2CLKB 4JV5B 1Z6AA 1UMCB 2BBOA 2WU1A 4AY6A 4BEJA 1EEHA 1KBOA 1P5HA 1ZGCA 5AVJA 1WM1A 3QIVA 3G9QA 4BDSA 5JTUA 4JCOA 3ZCQA 1FS6A 3E7DA 1I7SB 3H9QA 5AHXA 1PF7E 2CWWA 3SEQA 2P5YA 5CK4A 5BV1A 1E3WB 4DV6B 4IDFA 1J5EB 4MDHA 2F17A 5GONA 4WKBA 5K3EA 4XW2A 4ZU6X 3R5FA 4BN5A 1ECFA 2NV4A 5ELXA 3CJQA 4I1UA 2WRZA 5I7OA 4BXOA 4EMBA 1IQRA 2DYKA 2Z0MA 1NW9B 3EE6A 4PZDA 3PP8A 3DFZA 2XX3A 1HT2E 2GXUA 5JJLA 2P77A 4ESVA 1AKNA 3W5AA 4DNRB 5ADWA 2JFNA 3REQB 5IHXA 2VCYA 1D1NA 2CNKA 3AOEC 3S27A 3ZU5A 4Q82A 3I9NA 3LHFA 4TGLA 5BR1A 3ZV3A 4BO8A 1IWPB 2FG7C 3TUZC 1RXIA 2I9PA 1OHHA 1V25A 4PHHA 4WQMA 1Q6ZA 1MUUA 2Z2XA 3I5UA 3L5KA 1YDFA 2Q4BA 1CNMA 4M49A 3N1UA 3EVCA 1ULAA 3HRHA 4DV3B 3BL5A 5C5DA 1O6BA 2CMDA 3A3KA 1DRUA 3O6VA 3ME5A 1VQ8B 5B7NA 4LE1A 4TYWA 1EXVA 2G76A 2FMXA 2JLCA 1V37A 3GBPA 5A4DA 3VVMA 1OXSC 1GDDA 1WP6A 2ECPA 2PUVA 3QLVC 3LBIA 4GG1A 3TAXA 1TZBA 2EWVA 2ZUVA 1IJFA 1G5RA 3BJMA 3L1IA 4LZAA 2FOIA 4IHQA 1OXXK 1T2NA 1Y34E 4P3NA 4UEWA 3QEBZ 1BKYA 2ATCA 2PM8A 3BTUA 1NZDA 1MPTA 1OXTA 3FCUB 4MVXA 1SK8A 3FHLA 1ULBA 4IGFA 5ISMA 2VHUA 3BCUA 2W4IA 4NG5A 4Y1FA 3VR5D 4ESOA 3VPHA 1IBRA 3HZOA 4HK4A 3LQ6A 1AZSC 2BTQA 2ODQA 2YHUA 3N5KA 4UOQA 1R8SA 5A9SB 5JAZA 2F6RA 4FYWA 3WYFA 5A9RA 4WESA 5KJEA 3SKVA 1RAEA 1LB1B 3MLBA 5CVCA 1F8XA 4ZTZB 1XG5A 3H5TA 4OBEA 1G17A 2QHXA 2ZR9A 1L5WA 2WSIA 3FMIA 1FLVA 1QCZA 1RQ7A 1RTTA 2FX2A 4QOGA 2UZ4A 3IMGA 4BO6A 3VSDA 3EWNA 3L93A 3M4XA 5KYVA 1KYIA 2XUPA 4TXLA 4EPYA 5CXUA 5H02A 2BKXA 4MUXA 3F5SA 4P0QB 2IHBA 5JSQA 2ZYDA 3PVCA 2X0JA 2H7CA 3UHFA 4W7HA 1D6JA 2FFHA 1TEZA 2PUEA 1VHQA 3G2HA 1FFEA 2NGRA 1N3LA 3ZC3A 2OG1A 4QDZA 3AUSA 5EESA 3E9MA 3SLDA 1ZRMA 4K86A 5CVUA 3UAYA 3AOEA 1ZVMA 1HZJA 3ACDA 3MWDA 4D45A 2JCSA 3U5ZB 4DCOA 4HYQA 3U3OA 3NR2A 3AVQA 4Z4GA 2LNDA 1C1DB 1LSSA 4PYQA 1Z5NA 2PX5A 1K8YB 3R8XA 3VYTB 5BYKA 4C21A 4RY9A 2KWIA 1ACJA 1CEQA 1RP1A 3DG9A 1G6Q1 2FV8A 3I0NA 1T2FA 4Y2XA 4YRPA 1GOTA 4PG8A 1H8EA 1ISHA 3ECSA 4OEHA 5BN3A 3CYFA 1LRLA 3O03A 1E60A 3FMGA 4JL6A 1DKRA 1K92A 1NJID 2IHVA 1OB0A 3CTAA 1UKAA 2H57A 2Q62A 3BHNA 2G5TA 4KGDA 1ORRA 1R5BA 1CVLA 2VHEA 4XARA 3RS9A 4AMYA 4F0JA 2EWWA 1SKUA 4OMCA 3KAPA 4LF7B 4ZEXA 3IBFA 5ALTA 1O4VA 1CFJA 2EVWX 2I87A 3GDWA 5JEEA 4JVLA 5B7PA 5CFLA 4IMIB 1JR3A 4P2GA 3QFTA 1J20A 1KBQA 1TM2A 2GBLC 4Y2UA 3U1TA 3C8DA 4QUGA 2SICE 3PU6A 1N75A 3U4IA 2QYHA 3B78A 3HN6A 5DHUA 3WGIA 5LYJA 1JR3D 3LC1O 4NRDA 3U39A 5CEJA 3P9SA 1QZTA 3BWCA 1XL0A 3NHJA 3FAZA 3NOVA 3VPAA 2J9XB 2H4ZA 3Q88A 5K3OA 4EA9A 4B6RA 1ZM9A 3O2JA 4XR4A 1XZPA 1NXWA 4BMDA 1IVNA 2YXBA 1IN6A 2IEBA 2VP4A 3PXUA 3DV0B 4RESA 5DN6A 4ASUD 1XZAA 2YXLA 4LMRA 2NP6A 2HRZA 1T2VA 2G6TA 1YB1A 5LVAA 3L07A 3LP6A 3MRTA 4LYAA 3TOSA 4P0PB 2XVAA 4J75A 1RXEA 4PEVA 2W58A 2Q5EA 2VP3A 4PABA 1SUDA 3TOVA 2XB2A 2ID4A 3KETA 1G6KA 3A4MA 2QN1A 4L4SA 1IQ0A 3PD7A 2A14A 3OAAA 4AO8A 1W48A 4QFDA 3TRFA 1MT0A 4MVJD 4YALA 1O58A 5BNTA 2ZLBA 4C87A 1UJBA 3SFTA 2AI1A 4A23A 2BT4A 1CJMA 1E8MA 3NV9A 1A0OA 1N8NA 3PCXA 1VL1A 1X7ZB 2QZZA 3DE1X 1U04A 2PH5A 1FTYA 2V3VA 1PJ2A 4FFBA 4KXMA 2UYOA 4BP8A 3QSGA 3OLZA 5HDQA 3NFRA 5IG2A 4ER3A 2R8YA 2O2GA 1VECA 1GPKA 4FWBA 3FOAA 3PQ8A 1AQ6A 4KXFB 4AP6A 1LFDB 1DKLA 4I99A 2I54A 3C3KA 4RXUA 5ITZA 3H4MA 2P6UA 2YH2A 4G8BA 1NBEA 1E5DA 1RYHA 3L7AA 5HIKA 4K5QA 4WXPA 2L19A 2M1ZA 4QUBA 5C3MA 1ILEA 1E2NA 5GAJA 1BC5A 2DY0A 4KBGA 4RF2A 5FHRA 3B6MA 3HY4A 5HF5A 1F20A 5CFMA 1CYDA 4TRJA 3SHWA 2YYYA 3G0GA 3W9YA 4HS9A 2A7QA 3JD0A 1QDUA 4ND8B 4NECA 3TIFA 3PNOA 3OPXA 3UB2A 4XYGA 1Y82A 2XZPA 3M1LA 5GIOE 1XYGA 5AESA 3ZQJA 4YO7A 2E5WA 3HKCA 4BVHA 4D5GA 2PQ0A 2X2PA 1Y1SA 1IZYA 1NRJB 4TS3A 4BNFA 3PJRA 1QBKC 2YJZA 4ZT2A 1PK9A 4JOQA 4L4UA 1IATA 3VDXA 4NICA 4IICA 2AMJA 1H4VB 2Y93A 2DOGA 3D6UA 3H2BA 1KZGB 3ZGLA 4ERNA 1CR4A 3ZWKA 2W2NA 3IE2A 3U9LA 3A2NA 4P4UA 4ZT6A 2WYUA 5C9ZA 4DUGA 3KPWA 4U2FA 2HV8A 1B8VA 4QUKA 4BQOA 1PX2A 1RRMA 2P6MA 1BCSB 1XQ9A 3QA9A 5J2UA 2AS0A 2GJ8A 1LRKA 3L18A 4KQWA 1UIMA 3REGA 4B34A 5AO9A 5BYAA 2BYTA 1DDIA 2CHUA 4TYNA 3EX7C 5LN1A 5BSHA 2GPYA 1QG6A 2XWPA 4BFSA 4PS1A 4TWJA 4TLMB 2N0SA 2PGXA 2D1FA 2O7SA 4HRVA 4NBTA 1NKSA 4NCXA 3OQVA 2JEZA 4K03A 1KKLA 4LWOA 3BF8A 2ACWA 2OFWA 4TSRA 4B6SA 2WB2A 2B35A 3WGYA 3AIOA 3O4GA 1M8FA 4WN9A 4N7RA 4ENTA 1I5OA 5A0FA 3S2FA 4JXKA 1KDRA 3DTVA 2PH7A 4P86A 1LPPA 3GLQA 2G6BA 4M1YA 1ZW1A 4GYYA 3KZCA 3MT8A 3SDZA 3UUEA 3AVYA 2C4NA 5AM5A 4HLUC 3F3MA 2WHYA 3FGZA 4L9RA 4F1JA 2DAPA 1R3UA 3SMVA 4UAVA 2I1QA 4KXXA 1Z5UA 4KMRA 2FE1A 4QPPA 2ENWA 4Y18A 4A2CA 1F17A 3DFMA 4Z49A 4JH0A 3MT0A 2ZPAA 3SICE 4I55A 1E0SA 2JH9A 5GVRA 1C81A 4RADA 3L8ZA 5JS7A 2K2QB 1QGED 2OGTA 5A8AA 3LT2A 2W6NA 1BH6A 4J9UE 4Z8YA 1MORA 4YUAA 4E30A 4IF6A 4ISBA 1C9KA 1MFZA 1KI1A 3GZ4A 5FNVF 4LC9A 2R8OA 4TRNA 4UUPA 5ALOA 4AY3A 4MUJA 3VH1A 3IDFA 3NIWA 3NAQA 3CGWA 2RI6A 1KMHA 4F5ZA 2ZSJA 1F1JA 1JJAA 1J7JA 4D3DA 4HXYA 1XRMA 3DHVA 3ENVA 4YCMA 1MB3A 3TSYA 4IV0A 5LNK1 5LIPA 4HX9A 3R3JA 4IIUA 2ZJ2A 4EK9A 3WJ1A 1DQSA 4JYPA 1XQVA 5JU6A 3OMWA 3PFFA 3RBZA 3DMTC 4JB8A 5CXXA 1MF7A 1NW7A 3CN9A 3CEAA 1ATIA 4UEOA 3LWBA 4U6SA 4MQFA 3C3EA 2GBIA 2CFIA 3FW1A 3PNSA 2XY4A 2JLQA 5IC4A 3IXLA 1E2UA 2XGSA 3ANXA 3X1JA 4QYSA 3KT0A 2JLSA 4LYJA 2WMYA 4JI4B 4NENB 3W4IA 3G49A 3GRVA 3OKAA 4TM8A 2GM3A 1CCWA 1M0WA 5DRTA 2WTAA 2JATA 1E3IA 3STVA 2ZJFA 3AERA 1D2RA 1M2OA 5E6SA 4DLYA 2CXTA 2KBFA 3P9RA 4O5OA 3Q41A 4G9BA 2YICA 1I0IA 4ZO7A 4YMIA 1IUKA 3U7JA 3W78A 5E3HA 3R7AA 2O6LA 1C9DB 4I36A 5LM3A 1P6QA 2G17A 1PYOA 3D81A 4HAYA 1TM1E 4ZYLA 1V9LA 2Q4TA 2OYSA 4NOJA 2NQ8A 3O93A 4FCCA 4Y1EA 2JC3A 4YV0A 5CH5A 2AG1A 2KE5A 2ZANA 1ZCFA 2D62A 3KR0A 4TV8A 5DSXA 1N34B 3MINA 3DL4A 3MSCA 4O4HA 4TMYA 1PS9A 4LZOA 1HRDA 1FJXA 3AILA 4EITA 1SPXA 1N5OX 4ZT4A 2VEDA 2YN4A 2QYOA 4E6PA 5ES4B 4HKTA 2HFKA 1NNEA 5JECA 4J6FA 3UJNA 4ZU1X 1N6NA 2QSYA 1K89A 3NBXX 3KBBA 4G89A 2I03A 4BFYA 1K06A 1NVEA 3ESYA 4U2GA 2OV1A 3LQRA 5EQDA 2Z3VA 3DKVA 4LG1A 4X90A 3GLGA 4PY2A 3FUTA 2FW0A 5DNWA 1JAXA 1KO5A 2ZR7A 4YRIA 2Y92A 3U1BA 2RBKA 4AX8A 3NZEA 3EGIA 4FWTA 2R6DA 2AXNA 4B3JA 2IYUA 2V7GA 4GX5A 4UULA 2J4DA 2IXAA 4JAVC 1AGPA 1ZPDA 3AY7A 1MFPA 5FTKA 4LJ8A 3B9BA 3HWWA 2O4CA 3KTDA 2P4SA 1N07A 2EP8A 3IDOA 4MARA 4N1AA 4L02A 2X0FA 4CIWA 4TYPA 1VE3A 4HGZA 2XMPA 1HKUA 5DIFA 5KSWB 3WMGA 4C01A 4BNDA 5BMVA 4BKPA 1Q20A 5L95A 2FSGA 5LWQA 1UH5A 2Q0QA 4H3KB 1NMSA 4LYYA 2PMCA 2VIIA 2XAUA 2FZLA 3K9CA 1GQYA 4P2BA 2SCUA 3W7VA 4K9MA 4JJAA 3CLRC 1YKGA 1QOPB 1OCEA 2PRYA 2KPOA 1FQKA 3ND5A 4C4SA 1GAEO 4EHHA 4YAGA 1U2RA 4DSZA 3RGWS 4O02B 2ORVA 3NAMA 2REQA 3VOBA 3WKEA 5HRAA 1B0PA 3N75A 1U3VA 4RVCA 7REQB 1BMTA 2E89A 3FJ1A 4MROA 3RUPA 1E96A 3IJ5A 4D44A 2F9MA 2P2GA 1RRFA 1SPBS 3KM0A 4BFVA 2H59A 5EVCA 3U7RA 2HIGA 5CB4A 3EUWA 4CVNA 4CM4B 1X38A 3HV0A 4KRXA 4GWGA 4IPTA 1O8BA 1Z7EA 2VWHA 1XKQA 2IX9A 3M6UA 2Z6QA 3RYIB 2Z1NA 4ME6A 5EJMA 4MTLA 1BWQA 4MI1A 3QQ5A 4E0BA 3DWGA 1E1CA 5H80A 3ED1A 2O14A 4IEEA 4ALNA 2WZQA 5JBNA 2X0DA 4BN0A 3DZKA 3WI7A 2C58A 4KU4A 4IQGA 1GUFA 1E4VA 1B1AA 4W8OA 4G3XA 1WCV1 2FGKA 2UZAA 4MKHA 1YOBA 1AGNA 3Q5EA 3RRXA 3SEFA 2VG8A 4IIJF 3TIIA 1Y80A 1T8WA 5T7BA 1BDBA 4RV5A 3LP5A 3GCWA 3GA0A 3W6NA 5BW8A 4M0PA 2IYSA 2VJBA 1EK1A 5LL6P 2WMOB 3K0HA 3OETA 3DUWA 4OXNA 4KWEA 3GHHA 2AC7A 1FOEB 4NBVA 3SPXA 1WUTA 3GUYA 1A8IA 1P4HA 4L75A 3NJRA 4QPNA 4NEQA 3ZGVA 3KZMA 4R69A 4DA8A 2QD5A 1H9AA 1O9BA 1QF6A 1K3TA 3HBJA 4YDSA 3BB1A 2WWGA 3GJ4A 4G0ZA 1T0BA 5KYUA 1XHLA 3GCDA 5H8WA 2Z5FA 3I42A 2QMQA 2BIFA 5AVVA 4UDOA 2GK7A 4MX8A 4BLVA 4ZHQA 2CZQA 3WYAA 2C94A 2J9RA 4Z86A 5JSZB 2ISSD 1ZGZA 4NVRA 2RB4A 1UK9A 1X92A 2EV9A 4FN4A 1CZHA 1Q95A 1TEXA 3KVOA 1ENYA 3UW1A 4E21A 1E89A 1E4YA 3H13A 4KZKA 1G5HA 1A9PA 2FSHA 3PWKA 2B69A 1VIVA 2WUFA 4A82A 1ZBDA 3DFFA 2OBMA 3B3FA 3OP4A 2WWFA 2GSDA 1P1JA 3D6MA 2ZROA 3WYDA 1IWBB 1QKJA 3A35A 1XRPA 1NPYA 1LBHA 3FCCA 1X77A 1OFHA 3KEFA 4I1VA 3RAPR 3LM8A 1YITB 1IEVA 4WV3A 4YRGA 3FCOA 1LH0A 1R4NB 2NSYA 3ICCA 4YROA 1T2CA 5DTQA 4ZVSA 3N3BC 3INYA 2B30A 1Z6PA 2AE2A 3JTEA 1QTQA 2IF2A 1NR7A 5KTPA 2VK8A 4RL6A 2XF8A 5U1PA 3U3RA 4KPUB 3NRJA 2ZBFA 1GVNB 4NK5A 3ZH2A 5D5HA 1RJDA 5C7YA 4Q48A 1JI3A 1QORA 2PRSA 4UHJA 4TKVA 2PG3A 2TMGA 4F91B 3V2UA 2EFJA 1VMDA 1CUEA 1OBFO 4RAQA 2QSZA 4NYJQ 4US0R 3ZV7A 1TGYA 1GWNA 3SSAA 1NV8A 4HOYA 1F8YA 5IT0A 1OW3B 1T3TA 3MWEB 1C8KA 1HFEL 1C2TA 4J1NA 3CKLA 1TUGA 5DRYA 1KYQA 2BFFA 3UYLA 3PC7A 3KX2A 4ALLA 3S28A 1H5QA 2V6BA 2SHKA 4PZPA 2GZSA 3WO0A 2E0IA 2FRDA 2WFLA 5HOQA 5IYZB 2WQZA 1PV4A 2DLCX 3V1UA 2QPAA 2XCUA 4XOTA 2KLHA 2RK3A 3LY5A 4MHSA 1YACA 2H5IA 2HI0A 2JLBA 3F8TA 3UHJA 5JUWA 1HL7A 1KAGA 3W6OA 4X71A 2YJGA 5HJ2A 4AURA 2YW9A 1ZXBA 5JQGA 1U5AA 3QLUA 1PZMA 5ALLA 2JHPA 5FWYB 2PE3A 2R3SA 5TQJA 4CRWB 3FTNA 2PT9A 3AEKA 1VLMA 2H0RA 4QFMA 2CBZA 1L7RA 4BLRA 1EP9A 4XPIB 2GT1A 3BRWD 4MW1A 3AP1A 1ADFA 2DPGA 3V34A 3QX3A 3ZWYA 1KZHA 1P1FA 1FDOA 1Y4SA 1K4MA 3DMDA 1ZUWA 1VQ1A 1M1YB 3I4LA 5AKHA 2CL5A 2WIGA 3K3PA 4QDTA 3CT6A 4L3WA 1ONOA 3UXHA 5BUSA 3MINB 4O4HB 4Q5IA 3ZWAA 3KIPA 3J81A 3CY6A 3PNBA 3TZ6A 2ASEA 1KZ4A 3W77A 4E1BA 2CNWD 1TKCA 1E9SA 2X6RA 3RTBA 4Q7KA 3EXEA 1VBFA 3F5DA 4FILA 4KI0A 4KMSA 4HYTA 3RKUA 3Q6NA 4JB3A 2IBSA 1NU6A 4IVRA 4HRYA 3SQNA 4EHNA 2YZGA 3TJRA 5KYTA 1AKYA 5TPZD 2CCKA 5DU2A 3UKJA 1N5IA 4WT7A 3VPGA 4AS2A 5CX4A 1A2BA 3GU3A 2V96A 2NAPA 3SF8A 1GCIA 4K1LA 3S7ZA 5I7RA 1XEWX 4CEJB 2QEXB 3GUCA 5I4IA 3MELA 3RT1A 3SDSA 3CLTC 4D81A 1G9TA 2WA2A 4ED9A 1ARZA 3ZV6A 5IAEA 2HDWA 3AXTA 1XV5A 4FONA 4LCBA 4FS8A 1CVRA 4X7MA 2BI4A 3HO6A 1S2LA 1YI2B 1EWVA 3BXFA 2NPFA 3PCRB 3A3GA 5KAPA 1UDAA 1TD9A 4I9NA 4K28A 4N40A 1RXUA 4BGVA 3W9SA 1U7DA 2I6TA 3NBQA 2HJWA 3ANTA 3LYUA 3UM9A 3C3PA 4W5NA 1SGWA 3ONWA 3KKQA 3D1LA 5B2FA 2BKAA 4EYKA 3GGGA 3KS9A 1G64A 3FXAA 4IV5A 4KMMA 1K0UA 1MJHA 5KIAA 2OWEA 4RSHA 5BOSA 3KDSE 1FNDA 1K9MD 4A5OA 1HYGA 4L3VA 3K72B 3B5JA 3GWZA 5K1ZA 4UUMA 2QORA 4LS3A 1XZNA 1ESDA 4BGDA 4GWKA 1A9TA 5LLTA 1YTLA 1NY5A 1IY2A 2EJCA 2RAFA 4WERA 3ASPA 3C1AA 2B7BA 2NPOA 4O2BA 4QA9A 1FXWF 1UC5B 2HHAA 2WU4A 3U7FB 3IAEA 5AVSA 1R66A 4V0OA 5CD1A 3CWZA 4OP3A 2WJGA 4Q9JA 2QTMA 4Q3BA 1L7AA 4CGZA 1K4YA 3O38A 1NUTA 2VN8A 3R3XA 1C14A 1CHDA 4Q03A 5E1DA 2X9QA 3RDPA 4DCVA 2GXAA 3T3GA 3SWWA 4KP7A 1A5BB 3K92A 1VF7A 4UBLA 2RAVA 3HYRA 2R2GA 3V1MA 4AXXA 1P5FA 4FB5A 1MXHA 4ZOLA 5AVXA 5LDHA 4J16C 4UTOA 2ZB2A 3RTAA 1ODJA 4MO9A 2ZI5A 5GM1A 3WQQA 2VK2A 4ZEVA 1L9KA 2LXNA 3U44B 1Q1AA 3Q6RA 2IHUA 4KR0A 4NE2A 3HB4X 5ICSA 4ZJYA 1T5OA 1KSFX 3P2IA 2ODTX 4G0QA 3KQHA 4K88A 1PR2A 2BKVA 2H1WA 5EMMA 4G56A 2Q5HA 1MQAA 3K9HA 1HGXA 4Q00A 4S1TA 4Y2TA 1AJEA 3TTVA 3R5HA 4KWHA 2RE8A 2XRMA 3G05A 3WIOA 2EDCA 3K6KA 3STHA 1PT9A 2H0QA 1ZSNA 1QRSA 5FULA 1YASA 4PYRA 3USZA 2GPJA 2ZJOA 3GLGB 4Q9KA 2QL7A 4YYEA 3NWJA 4AT1A 3HXMA 3MCVA 3SHVA 4I66A 1T9GR 1PHRA 2OC4A 2PKEA 1GV0A 1U2DC 1K3UB 2WTBA 3NOXA 4KIUA 4YJGA 3MHTA 4KKSA 3TDNA 4XH9B 1SVIA 3PEWA 1PJAA 1E99A 1E92A 2V7VA 5DF1A 1IN4A 1B1CA 1ZNQO 2PLFA 1QGUA 4XA8A 1JBEA 1CQPA 3ASYA 2ZAYA 4TV8B 5EC8A 3OT5A 1LPAB 2ZUWA 3P9PA 4JYCA 1Y1RA 3U4CA 1B2LA 2GNOA 2HHLA 2B8WA 2H63A 4Q4JA 4QV2A 4S2UA 1UK6A 4KFRA 3V76A 4UBNA 5F4OA 1RZ3A 3AHIA 4XOIA 2C5GA 4XWTA 2GXQA 2R6ZA 4D74A 2GTIA 5K03A 3TRHA 4DWVA 3UCXA 4IHJF 2AQIA 4TTTS 3CMMA 3E3OA 4J7AA 4AJEA 5HX7A 1JFFA 2XVXA 5AVUA 2NO0A 3JVVA 4YTEA 3BT7A 2WVHA 4M9RA 2CUTA 4GMGA 1TC1A 1BS1A 4K6GA 4ATNA 5LP6F 8MHTA 2XNSA 4WXHA 3FFTA 3ITEA 3TI7A 5KPJA 1NGSA 4B47A 4PR0A 4ZJUA 3D7NA 3VZPA 4EG1A 4HDMB 2ES4A 1EGMB 3LHIA 5LOVB 2CHVA 1OQAA 3KE9A 1TVKB 1II8A 1MGPA 4BKQA 3P20A 2JGEA 4D96A 1JEDA 4CWAA 3AVUA 3DWFA 4YACA 1I7PA 1UIRA 2NUAB 2CXUA 3G2QA 4JBXA 4DTCA 1R6AA 5DIZA 4ZFNA 3PDJA 4UM9B 1TNDA 1QE0A 3QEOA 4EEXA 4R1LA 1NL3A 1QIGA 3AWDA 1H2YA 2R62A 4REMA 3H19A 4IIFA 3KDPA 3TTTA 1K88A 4KKVA 1A04A 3VU0A 4R0MA 2NVUA 3THSA 3QUBA 2BSXA 2Y1CA 2YMLA 4RFSA 3P97A 4F3YA 1RVV1 4L4ZA 4MW7A 4BJHB 2GOYA 1H1DA 5LKRA 1L4MA 4ETWA 1XLWA 2SBTA 3AF4A 2ATXA 4B82A 3KZ1E 1U1IA 1U99A 4FJ0A 1AF7A 1E1MA 1GN8A 1VLJA 3OLVA 4NR0A 4WW0A 3SBEA 2R48A 2XJ4A 4DCMA 3BK1A 4YV2A 4TMKA 3ET4A 2QW1A 1NW6A 2RHMA 3TLJA 3OCYA 3Q7IA 2Q45A 1H6BA 2EGUA 1B41A 4PNPA 1DAIA 1VL0A 2EEZA 2QAGB 3FFAA 3LD9A 2QVGA 3E84A 4ILKA 2AX3A 4IIDA 2DZDA 3HGQA 2YIVX 3SJUA 2WF6A 2O57A 5LSAA 3O4IA 4PGHA 2LIPA 3KJNA 2EJBA 3JYQA 5G1OA 5IDVA 3E9CA 2XWQA 3E1SA 4B7ZA 1AU9A 1DSSG 2F3RA 1YDWA 3EZGA 5CAEB 3TINA 4RH3A 5BSVA 2JI9A 1RLUA 4X05A 3AF6A 1U7TA 1MXFA 4HDQB 1FFBA 4M55A 4F6CA 3ZGZA 3THYB 1GPWB 3FSGA 4FUQA 5AIAA 3JZFA 2GEUA 1QVRA 4HPJB 4Z3OA 4BVAA 3I1YA 4GL4A 5EHZA 2J4FA 4RF4A 4I1SA 1EMDA 2EKBA 3JZIA 2R1ZA 1NNLA 3TOCA 3QKRA 3DC7A 4U9HS 4OOEA 3BK7A 4FXUA 4MINA 8OHMA 2FX3A 3HB7A 5IAGA 3EA5A 1M2OB 1X1CA 1KJYA 2WF7A 4OKSA 4NYMQ 3IQXA 3FKJA 4LHWA 5B1HA 5DW3A 3W9UA 2PRJA 1LBTA 2IOHA 3SQXA 3S70A 5CNJA 1EWKA 3GFOA 4ESEA 3T0FA 4UW9A 4TVKA 2E7ZA 2YIJA 4UU8A 2AOXA 1RIIA 4F2GA 1UBCA 5HE8A 5BSKA 2K7FA 1H94A 1D07A 3CUTA 1GR0A 4ZCQA 1YHNA 4AIRA 2BMVA 4ITRC 5FJIA 5BN5B 5ADVA 4LMAA 4YFYA 1YIJB 4JQZA 4LYFA 3CUYA 2P69A 4ZYZA 5LP1A 1P4AA 2XYVA 5I47A 3W5DA 1VBKA 2TYSB 2AJDA 2UUPA 3PUKA 5J5AA 1WSBA 4IYRA 1E1RA 2JJQA 4FM9A 4FFDA 1V2GA 5KEIA 1QFZA 2L0XA 2XOKD 1OFUA 4YAFA 2C5BA 3DO5A 1GJRA 3N07A 4PRLA 2RHGB 1G7SA 2UZIR 2DC1A 4G9GA 4ETMA 5FH9A 3VKWA 3BULA 5SV2A 1XZIA 1G291 5EJ7A 3E3MA 1XWIA 3HSKA 3BRSA 5HF6A 2GZ2A 3Q9SA 4TKOB 4LJKA 3OBIA 4FFMA 2X5JO 1R12A 2P1RA 5ALPA 4TRMA 1ISPA 1N6KA 3KHKA 1Q1EA 1QONA 1G2QA 4L6AA 5CW1A 1C7JA 2GRJA 3QVLA 3FPCA 4RTOA 3JWGA 1UJCA 1JHUA 3B6EA 2C3YA 3C4JA 1JIIA 2CN1A 1C9JA 4J03A 1T5DX 5FWDA 1HORA 3DVAB 3KTFA 1UBKS 3B6IA 1TIKA 1Y37A 4HNSA 1JMKC 5JADA 2QJRA 1GPH1 1X74A 3RU2A 2OFFA 5ALJA 3M2TA 3CRQA 3ZJYA 3AP2A 3LWNA 3RVDA 3TPFA 4GH5A 1MB4A 2CK3A 3ZZNA 3JWHA 4L22A 2IH5A 1JGTA 1E2DA 2ALJA 3CUVA 1W2HA 4AC9A 3ASQA 1Y9EA 2CLOB 2QQFA 5CDUA 4TWBA 1TYCA 3K0CC 2OB2A 1UJMA 1X14A 1E79D 3I28A 4NJOA 1BS2A 4QPZA 1XWFA 3PFNA 1YHQB 4ZQGA 4UFNA 5C34B 5JCZA 3BE5A 1EVZA 2OGUA 1J33A 4JJ4A 4J1TC 4UHBA 2YWFA 1EQUA 1QYRA 1V9SA 3Q7EA 4RHEA 2VH2A 4IG4A 4FZRA 1YUNA 3TQHA 2GWRA 3A9UA 3ASUA 3O4FA 2JLYA 2Y77A 1M72A 4UMDA 1BX3A 5JLJA 3HCRA 5DCLA 1O9HA 3FOCA 3WFZA 1XVIA 4BYMA 1Z18A 1GZSA 3DAGA 4KUHA 1IOLA 4LVCA 4ZVMA 2Z5VA 4YJFA 1TADA 1KR5A 2R8BA 4RYDA 1USWA 1B00A 3FUCA 1EBUA 2QN3A 1ISGA 3O4HA 5LQMA 2PS3A 2ZB4A 1BYUA 3WISA 4KHZA 2PKQO 3HCCA 4JK3A 4X6YA 1JAZA 3B52X 1KY5A 2V0NA 4JVOA 1U7WA 4F2DA 1HEYA 3DLAA 3E81A 4M7WA 4ML3A 1NOIA 4A7PA 4BMPB 1JA0A 5D3KA 4BTLA 1KPHA 3IV6A 5BR8B 4ON9A 3DCIA 1W30A 3HNRA 5H9WA 3IT3A 1XQWA 4C7BA 1B8OA 1W19A 1S01A 1U9IA 4DT1A 1GQSA 1F9EA 1ZGAA 4RM2A 3SF8B 4I1RA 4REQB 2BM8A 1D0VA 3P4UA 3V7AA 1TZCA 2QJOA 3E23A 4M60A 1ATZA 3TNJA 1HDCA 3ELDA 3EBLA 2P30A 3FPPA 2VYFA 3ZPXA 3RYHB 1FS4A 4R68A 1OWMA 4G4JA 4J0QA 2XUDA 2DHEA 1GQFA 1BFKA 3PR1A 4L8GA 4RV4A 4XNFA 2JFVA 4DCTA 5B5SA 4GEKA 3UUGA 1PNVA 4JI3B 4WZLA 5ALMA 4UCWA 4E7PA 1SIOA 2I4MA 5IT9A 4BO2A 3LZCA 1LDGA 5IKOA 2XRZA 4OMFG 3QBTA 3I83A 3EC7A 3NJ4A 4M0KA 4B3SB 3U48A 3KOYA 3AEKB 5FP0A 2OB1A 4I1PA 1T15A 1Z4LA 2WFLB 4NSNA 1AX9A 4PN3A 2FP3A 2L42A 2VA9A 2B99A 3SQLA 4D8VA 4RTLA 1VHOA 3D6HA 4ZT5A 5ULLA 5FPTA 3PVZA 4FFBB 4I9HA 2CJFA 2BJHA 2MR6A 1OT5A 2ZOSA 3D1VA 1DLIA 3L05A 4Z4YA 1E3SA 1X94A 3LZDA 4GPIB 4LOIA 4Q9NA 2BMFA 3ZXSA 2ZM5A 3R9WA 2GSWA 3IAXA 1A9QA 1TRKA 2XKBA 3HSYA 4PCVA 5E7MA 4BGEA 3R7FA 4RD2A 3W34A 3NCHA 1G38A 1Z4PX 2BMWA 2C7BA 4IJKA 4QRIA 3W1VA 4NZOA 3TG8A 1IBLB 3BCSA 3OE7A 2H65A 4FGSA 1YNOA 1SY7A 4X8LA 5F1PA 4BNKA 3BK2A 2BTEA 4GM0A 3Q3VA 4MW2A 1E7SA 2J3DA 2YQ4A 1W93A 2DR0A 1UM9B 4M8SA 5CHEA 1Y5NA 3D2CA 4R3WA 3RC8A 5TR9A 5CLQA 1TQ8A 5L6LB 4XMYA 4Q4LA 3ROFA 4XRRA 4ND5A 1BVUA 4WK2B 4WZBB 2GQFA 3QK7A 4Z51A 5KNLA 1YZFA 1PTJC 2BKUA 5JI3E 3MWJA 3OZRA 2VLBA 1CZKA 1EYZA 3FKSA 3ETJA 1IN1A 3HMQA 1SMKA 3KQTA 4JUDX 3I4CA 4RKFA 521PA 3KVNA 3AR8A 1C0PA 3ER6A 2VBTA 1LZKA 1MAVA 1ZI8A 2J1LA 4TTJA 4ARZB 4C20A 3F46A 1XD2A 3OEHA 3PKIA 4R1MA 2GVDC 2CMGA 1F2DA 1VM6A 3IO5A 1TYAE 4XLAA 3HCNA 3H2SA 3Q38A 3BM5A 4WKNA 5GJVC 5TS3A 3RJMA 1C30B 1UPBA 4RF3A 3K0FA 1HFKA 3EMDA 4GYJA 4U5XA 1EK0A 2WNIA 2Z58A 3R09A 1WXQA 4FYKA 4X1YA 3TVDA 4EATA 4DR7B 4EA7A 1DWQA 1GTZA 1KO1A 4FGZA 1BRTA 4GOMD 4NONA 4W7IA 1N1GA 1L5QA 4LOAA 1LFAA 1BD4A 3T7TA 4DLXA 1O87A 1R8QA 3I9V1 2YWDA 4X20B 2AKEA 3OLXA 4LTNA 3WYBA 2PKXA 1QLHA 5KAMA 5CA1A 4Q66C 1YR3A 1LNZA 4MR9B 1KVRA 5GONB 3UT0A 1HNZB 3GDFA 5AM1A 2GN4A 4C3UA 5JMWA 3AIKA 2G06A 4IUBS 2P75A 4KYTA 1I7NA 4H1WA 5KVAA 3WKBA 4TTAA 4JKOA 4QXPA 3S1AB 4AI6A 3DDNA 2Q6OA 3GGCA 3R7NA 3P27A 2M6KA 2AFIE 2G5GX 1XI2A 1QGYA 1NBAA 5AKIA 4NS4A 1GXSA 2Y2VA 3FG9A 3BDAA 2ACEA 2X8LA 3FOWA 3H97A 2C7QA 1N2OA 3L46A 1RBYA 3HKCB 2QM0A 1P60A 4Q1BA 1WUIS 2RHDA 3G8YA 2GK3A 4CR8A 5BWNA 3IV9A 4XFKA 2O2DA 4HD8A 5J5CA 2DFTA 4QUIA 2F1OA 3LQYA 2DUUA 2GZAA 1UP6A 2Q8NA 1E79A 5CT8A 1U0EA 3N76A 4GOXA 1FU8A 2H2AA 2V8BA 4PONA 5IJZA 4CG3A 5TY0A 1DO0A 1N9KA 4CCAA 5FA6A 5CCXA 5K8JB 3BE8A 3HI6A 3T4PA 1DT3A 5AHWA 3T3DA 3QEAZ 4DARA 1RXCA 3C14C 4PRZA 4B2YA 1J2JA 2E1RA 1B43A 2Q7OE 4XONA 2OSBA 3SQMA 3SCZA 1G8PA 2C31A 2D06A 5K4HA 3OIVA 4HEHA 2JHCA 2A59A 3S5JA 4B17A 3WBKA 1VG9B 3BCRA 2AOVA 1U0NA 4ZVNA 2E4WA 3E48A 2RD2A 1LF0A 1NXQA 3GT0A 4K6MA 4HTAA 4ZVLA 5GWXA 5I7HA 3L4JA 3OKFA 1Z2DA 2PY6A 2R00A 5MF6A 1GLNA 5KHLB 1O1YA 2C4MA 1UOOA 3GD5A 2ZSFA 4UE6A 1DQPA 4ZD6A 2XCTB 3AK4A 2VJOA 4MEAA 1OF1A 1Q57A 2NZ2A 1XTRA 4R8MA 3WG9A 3EVAA 4E5NA 2RGBA 5BN4A 5CDFE 3FHCB 1GGFA 2B1GA 1GDTA 4AF8A 2QMYA 2PAFA 1Z83A 1ICIA 1YQGA 3H83A 3VR1A 4I0WB 3MNFA 4Z99A 1QVAA 5EZ6B 1IEWA 1L5GB 3U3JA 3R0JA 2UYGA 5AUOB 2XXAA 1TU0A 5TV2A 2Q50A 1HSOA 1PJ8A 1ZUNA 4B5LA 3G0CA 4DC9A 3Q9NA 5JNSA 4NMWA 4KO4S 2HSGA 3LQ1A 1VOTA 1YZQA 2B4TO 3WK4A 1MJ5A 2HDHA 4P22A 2OQ2A 5JVDF 1OFTA 1NHGA 4YMUA 2RGCA 4U3JA 3ZWBA 4B31A 5IT5A 1NI4A 1DIHA 1UKCA 1C3VA 3NP9A 4FWIB 2YHSA 5G02A 4DV5B 3ND7A 3WA6A 4JYMA 3PQEA 5DE3A 1KVUA 3NTUA 5HE9A 4EBFA 1K2WA 2LPMA 2ROQA 2PMEA 4EJSC 1NJFA 1PGNA 1SCKA 1G21E 3U26A 3TQOA 2C2MA 1YDGA 2FH5B 1KETA 2J45A 3VC1A 1AA6A 2WPDD 3WNBA 4B80A 4UC0A 3H18A 3O95A 1XLTC 5L45A 1P0MA 1DC5A 4WKGA 1OFUX 3O8LA 1J70A 3L41A 1CZRA 2Z08A 3U31A 5E9JA 4O8ZA 3NDRA 3X2FA 1TA0A 3AKCA 1CQIB 2FY8A 2DBVO 4DNPA 2JD2A 1MRNA 3UOGA 3OPOA 4P3PA 4UQOA 1YX2A 3PL1A 3SN6A 3GLKA 1XN1A 4HJXA 4CDGA 1RM5A 2Q5QA 2R1VB 4MIOA 4OATA 5KNBD 5BWOA 5TF4A 2A86A 5JT1A 3E22A 2FW6A 4URFA 4MJLA 3TMKA 2X4DA 1P2VA 1YT5A 1U6JA 4Q9LA 2AOUA 5G3YA 1P19A 4BDTA 4PNZA 5FI5A 2Y6VA 1O96B 2BGUA 3K70B 5F64A 3GNSA 2X6XA 3QFFA 4LJ7A 1CF4A 4FXPA 1I6KA 1EZ4A 3DVLA 5AM3A 2C1XA 2Z5GA 1JPNA 2D3LA 3AG5A 4BBJA 2VDPB 4R8SA 3I9V6 2FP4A 4TMFA 4Z4ZA 4F45A 4JU8A 4QGBA 2V1UA 2RGXA 3LCRA 4ZQCB 4IIXA 5G40A 3DKPA 4LNHA 4FC6A 2C00A 4RHCA 3KL9A 1ECBA 3AERB 3BXZA 4RPGA 3V8RA 4CNQA 4CZ2A 2TMKA 1R6BX 1OBCA 1CP2A 2WE8A 3BXXA 3QFRA 4G1MB 5EIFA 2ZSIA 3EQ9A 1ORVA 4J3JA 1L8AA 1TKBA 1XQXA 2QEQA 1EX6A 4QE3A 3OU2A 3L49A 1V9CA 2HSZA 1GNVA 4Q0MA 4YYZA 1G66A 1VSUA 3IVCA 1CRPA 4R81A 3QUCA 3D0KA 4HDCA 1E1YA 2VAWA 2P79A 2X1MA 5ESRA 2VBGA 4L6CA 2Y8EA 4DQKA 4LJ4A 1Y8RA 3MMZA 5C7LO 3DA8A 4BX2A 1SVWA 1XYVA 1EFKA 1Q0ZA 1FFDA 3NM6B 2AEEA 4KRYA 3D1JA 1QHFA 4JJFA 1I9CA 3N8DA 2WJHA 3KHUA 1R3DA 5MN4A 1NVVR 4QYTA 4DWWA 2PUWA 1HZEA 4HN4B 2QZPA 3WFJA 5EMKA 6Q21A 4NPHA 1N2GA 3LWZA 3A2KA 4ZU3A 1WSDA