3OW7A

Crystal structure of the membrane fusion protein cusb from escherichia coli.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
296
structure length
296
Chain Sequence
QNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusB
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 32
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ow7A02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ow7A03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3ow7A01
4BA1I 2A6HD 3QG1A 2JE6I 3PUXA 2D5DA 3BG3A 3CRLC 4JBWA 3A8KE 5BN5A 3VA7A 2O5IC 2A68D 2DNEA 2F1MA 1GJXA 3P20A 3WDNA 1IYUA 1CI3M 1H9JA 4OO1G 1O7LA 3TZUA 2KCCA 1H9KA 3A8JE 3W3AA 4G7ZC 1O78A 1Q1EA 2AWOA 3U9SA 4IFDG 2AUKA 2NN6H 3ND8A 1FYCA 5BN4A 2K7VA 3AB9A 2V4DA 3T53B 1GUNA 3M85A 1VF5C 2BA0A 3A8IE 1IYVA 5A35A 3QJYA 3PUZA 3D4RA 3L7ZC 1EWHA 4I7ZC 3PUWA 3BDOA 2E75C 4L8JA 3PUYA 4G7HC 4KKTA 2EVBA 4KN4C 1Z7TA 5C0XH 3A7AB 1LACA 1Y8OB 1OXTA 2PCFB 2ZT9C 3LWUA 1IW7C 1Y69U 3OPOA 2E76C 1GUTA 1OXUA 1E2ZA 1OXVA 2K32A 4LK1C 3OOCA 2DN8A 1DCZA 1H9MA 2IT1A 3M7NA 2K33A 1H9RA 2BE5D 2A6ED 2JXMB 3DXJC 1K8OA 2QF7A 3SE0A 1A6XA 1CTMA 3IFTA 2E74C 2NN6G 1Y8PB 3I73A 1BDOA 2EDGA 2L5TA 3RLFA 2EJFC 5K36H 3FMCA 3ND9A 2YYZA 2BA1A 3VR2A 4RCNA 1OXSC 1CFMA 3M4YA 5JEAH 3I4LA 3LNNA 1HQMC 1TKWB 3PUVA 1SMYC 2LMCB 4KMUC 2JEBI 5C0XG 1VDZA 1Q90A 5KNDA 2A6HC 4KN7C 2D62A 1I6VC 1VF7A 3OW7A 1B9MA 2A69D 3MXUA 1GUOA 3N6RA 3I72A 3SDZA 1E2VA 2A68C 2AUJD 1YNJC 4KHZA 3EQLC 1Z6HA 3VR3A 4DK1A 2BDOA 4TKOB 4H0LC 4HR7B 1VCIA 3PV0A 4KI0A 3IKJA 2B8GA 2DNCA 1GHJA 3KLRA 3MFYA 2PNRC 4H13C 3VR6A 2KA7A 3HGBA 4OO1H 1GUGA 3GD7A 1Q1BA 1V43A 2D2CC 1OXXK 2B8FA 3VR4A 3QIAA 2JEAI 1HTPA 3CRKC 4BA2I 2O5JC 1V8QA 4DK0A 1H9SB 1ZYRC 4KKSA 4JK1C 1HCZA 5BN3A 2NN6I 4G7OC 4OGQC 1DD2A 1H9SA 1LABA 1HPCA 1GUSA 1FR3A 1Y8NB 2BE5C 2A6EC 2R6GA 3GQBA 3H94A 4H44C 3FPPA 1G291 1E2WA 1IW7D 1PMRA 2Q8IB 1GHKA 4DNRB 4DNTB 1Q12A 3A7LA 4GZYC 2EJMA 5KNCA 5K36G 1TU2B 5KNBA 1DXMA 1YNNC 1ONLA 4LJZC 3T51B 1K8MA 2EJGC 5JEAG 1B9NA 4XTCS 2PPBC 4IFDH 3NE5B 4XIGS 1ZKOA 4KKUA 1QJOA 2A69C 4IQZA 4PV1C 3VR5A 4TQUS 1T5EA 3D31A 3T56B 2CW0C
chains in the Genus database with same CATH superfamily
1Q8IA 4C2MB 3J81E 1S72B 5IE8A 1YJ9B 4KD4A 4HJ5A 1G7RA 1HR0W 2GPJA 5D14A 4CDDC 1Q81C 2E5LL 1EIGA 2IX0A 2UUBQ 2B7BA 4K5VA 1M4VA 5KRUA 5G3LF 5F4OA 2X69A 1G7TA 3U9SA 4IFDG 2AUKA 4OHJA 1C4QA 3T1HQ 5A88A 2ZTEA 2WPDA 1W2BB 2D3LA 1JA0A 4XONA 3QFCA 2CH4A 4UAJA 2VNUD 3D4RA 5CV8A 2UXBQ 3F1ZA 1G7SA 1BCPD 4I7AA 1ZYRD 3E1YE 3KDFA 2X85A 2PCFB 4C0SA 3CHBD 1BBXC 1U4MA 1EWCA 3S16H 3OAAA 4YY3Q 1PH9A 4A3FH 2VQFL 1EP3B 4EQNA 3A54A 1TWGB 2MPMA 2RC6A 2ZJPA 1IBKQ 2VBVA 2VQEL 5T1IA 4IUQA 1KK2A 4XYQA 1QUEA 4DV2Q 4IN3A 5FLXE 3TS0A 1QGYA 4LNQA 1PLFA 1NNXA 2PQEA 3KLWA 4L5RC 4R8IA 3CQZB 4H0LC 5IYQA 1OGJA 1B3AA 3W5OA 3E0EA 3U58A 1XNQL 2K5HA 3CCJA 4UZFA 3MVVA 3A56A 4JI8Q 4OWXB 1AE2A 4CJ0B 1Q86D 1HNXQ 4XD7A 3H0GB 1V8QA 4LAAA 1N0VC 1RIPA 5EAYA 3HS0C 1EIFA 1H9SA 4GKKQ 1JE4A 1QNKA 4PGOA 4LW1A 4ALPA 1R5NA 1V0EA 3VNUA 1B7YB 2F0LA 1ILPA 3CP2A 3Q3AA 4DV0Q 3RZOH 3G4SB 3FPPA 2F0UA 2KHIA 3ONYA 3I4NG 2I07B 3BJUA 3SR1A 4I65A 3J7AF 2EY1A 3EN2A 5CBAE 1FGUA 2G5DA 3RLOA 2WACA 2UXDQ 1CQXA 1KDBA 3C46A 2K5WA 3MZ5A 3AVUA 2LXJA 1DGSA 2CKZB 4IFDH 2X6YA 4UZUA 1WTRA 3VR5A 3CP8A 1IZ6A 2QGQA 1Y0RA 3E9HA 2K5VA 3J7ZC 2E2DC 3I7FA 4NB3A 2C5HA 2AQ1B 4DAMA 2Q2UA 5IGBA 1KZLA 3QG1A 4QGUA 3TQYA 2VUMH 2EY6A 1H85A 2K04A 4IO9A 1HNWQ 2L0CA 1KAAA 2A68D 3KF6A 4DV1L 1UD2A 5JPMC 1DYQA 3A0JA 4PNYA 1H9KA 2RF4A 3Q0AA 2ZITA 4RGTA 1T9HA 4ULLA 4DF7A 2Y0SB 4ZK9B 5GAGC 4II2A 3CCSB 3HOWG 4RD2A 1W0JA 3KDFB 1EUJA 1PZKD 3OFNA 4L8JA 2OXPA 5J3OA 3WNBA 2ZT9C 4NCNA 2NVXH 4LF5L 1GUTA 2E5LQ 1XQBA 1YHBA 4ZAIA 2EFGA 2BM0A 3A3GA 4OL7A 4JI7L 1T6XA 1R4QB 2F0KA 3S15H 2QF7A 1X3QA 1A6XA 3S16B 3IFTA 1HFGA 2A74C 1HA5A 3FMCA 4A3FB 2XNDA 1BX0A 1QB5D 1VMCA 1N8RD 4DGZA 1LT6D 2X8KA 2RVLA 4IUTA 4RHRA 4PZ8A 3TN2A 1VQOB 1LTRD 2NVYH 3G6EA 2N49A 4MTKA 3CKIB 3U9OA 5JJKA 4BXXG 1VLOA 4TMWA 4GNXA 4RMFA 3KYHC 2Z6BD 3I72A 4GS3A 5GROA 4A3LG 1F2MA 5M5XB 2VQFQ 2HDNB 4EH1A 1Y1WG 1U0LA 4OPSA 2BDOA 4X65L 3TRZA 3CC2A 3AVWA 4OONA 4YEJA 5BSXA 3CCJB 1Y14B 3V96A 2I46A 3OWEB 2VQEQ 4ME3A 5M3FB 2OWOA 4GN5A 2C5BA 3OW2A 2F43A 2JEAI 5I9OA 2RCNA 1QX4A 1LTSD 1FDRA 1H9SB 2QCPX 3EVQA 1D8LA 2ZTDA 1GKHA 2PLFA 2ZL5A 4P75A 2F0PA 1GUSA 2NWGA 1JORA 2BE5C 2BGJA 2JJ1A 4QUZA 3GO5A 1M90C 2JYOA 2YU9B 3S1QH 5D3DA 4M2LA 1RHPA 5NUCA 1TVCA 1RTOA 4GQNA 4QVJA 2JA5H 3C2QA 4A3JB 3RZOB 1PYSB 4AH6A 4L6TB 4DR3L 1DOLA 1YJNA 1V0FA 1DXMA 1K9MC 3PA2A 4IPGA 1XWEA 5IP9H 3S1RH 1H42A 3CPXA 1P16A 2JA9A 2OBSA 4XIGS 1XFOA 2C4TA 1V5VA 3ITPA 1SNOA 1EWYA 5GAEC 3T1YQ 5ELCA 1TIID 3KF8A 3M4OH 3E9IA 3ULPA 3KF6B 2GN5A 5J22A 2VZLA 1KQSA 1QH0A 1BUVT 1HZ9A 1TR5A 2SEBD 2JA6B 2HCJB 3I90A 1I4HA 2N3SA 4QHYA 1Q7YD 3JAMc 1CI3M 1GAWA 2VUMB 2R7DA 4IPDA 3C3LA 3Q39A 1I4RA 1PH2A 1JMCA 2IY5B 2CHBD 4RA8A 3M7GA 3IRBA 1PZJD 2KUMA 1EY6A 1M1KC 5HZBA 2C35B 3B82A 4MHEA 5CYUA 1CHPD 1SYEA 4XLEA 1E1OA 2EVBA 5IIFA 1E24A 1YHQA 4IFDJ 2DETA 1X3PA 4AYBE 2CW0D 3NEMA 5M5YH 4LBYA 3P75A 4RJLA 4FWTA 4KHPQ 2DN8A 3CMEA 4DV1Q 2PNHA 3GP7A 4DV5Q 5JJIA 3BVMA 1Y1WH 4Z4ZA 3E0JA 2NVXB 1SNQA 1WTOA 1S5ED 3CCVA 4X3SA 3WOFA 1TWHH 4IW3B 2VNIA 1Q8KA 1P4MA 4U9UA 3ULJA 3S15B 3ZPNA 3A35A 2HDMA 2SOBA 4IUUA 1YNND 1D6EC 5H5JA 4AYBG 1QUFA 4B9XA 5JEAH 2UUCL 3G6EB 1V1OA 1TKWB 1X32A 5KEEA 1F20A 4GNXB 1EWIA 3E20A 4G7WA 3PUMA 3LO8A 2Z9HA 1CKNA 4Z4WA 4IUNA 3H3VI 4K5XA 1I4XA 3CC2B 3JQQA 2NVYB 1Z6HA 2PIAA 1Q82D 2ZXRA 4M4SA 1XTCD 3PF5A 2L55A 1N36Q 3VO1A 2F3WA 3F2DA 2Z6KC 2DNCA 3K6OA 3I4MG 4Q5VA 1EFTA 4K0KL 2ZZQA 4A3IG 2F0OA 2RHSB 4A93B 1V43A 2L15A 3NBHA 3LQEA 4B3MQ 4OEMB 4OWWB 4ABNA 4ZUIA 2N8NA 2KEDA 2F0JA 1EQVA 3I55A 1UWVA 3A8IA 4LF7L 4UP9A 3S1NH 2Z4HA 1Y8NB 4IALA 5LMUL 2KECA 4B3SQ 4RDKA 5TY0A 3A5ZB 2WJVA 2PMDA 3S14H 1RKNA 4WZTA 1YVCA 2ZZGA 2YWFA 1NR2A 4XYOA 4J15A 1YJNB 4XKVA 4BBSH 1ML0D 3FVQA 4F7DA 4B48A 2C5CA 2FXQA 1QG7A 4CQJA 1WU8A 3OZUA 5J1ZA 3WNCA 4KJNA 2F0FA 1J6QA 1E0BA 2IW3A 4QMGA 1SYCA 1PTOH 2DGYA 3KF8B 2RDGA 5DM73 1WFQA 3HOYB 1A8PA 1KQSB 2BF4A 3CCMA 1UUPA 1MSHA 3BH4A 1B70B 4JV5L 5A2QE 1EYAA 1S5BD 2O5IC 3A8KE 4P6YA 1AEXA 2B63G 5M5WH 4YCWA 2C9OA 4BS9A 2N78A 5E4XA 4DR3Q 3I56B 4YALA 3NTIA 4X7CA 4G7ZC 5EBCA 1VQ8A 2BH8A 3Q6RA 1GM5A 1CSQA 4TN1A 1PH4A 1S4MA 5D3IB 4NBSA 3K7AH 2R93H 4LBVA 4NXNL 1YHQB 3AQQA 1WOPA 3L7ZC 1EWHA 1K3RA 3HG9A 4U68A 3DLLA 4G7HC 1EFCA 2XWBB 3CMEB 2R7FA 4YWKA 4EVOA 4WZLA 5DEHA 1G8ZD 3D4DA 3SGIA 1F2YA 2KVMA 4B44A 3M7NA 2WP8J 4QUCA 4L5SA 3CCVB 3NSWA 5M5YB 1LLRD 3W2DA 2E74C 2XNAC 1IKMA 4LMQD 2I5LX 1KK1A 5FO8B 2J4XA 2D9UA 5KW9A 4ZQ3A 4R4TA 3CMMA 2ZXPA 5CORA 1TWHB 2NTTA 3KJOA 1SMYC 4Z4YA 2I0QA 2ATWA 1TVXA 1CKNB 2A6HC 1SNDA 2D62A 5J35A 3MXUA 5GQOA 4ACBA 2ZZEA 2AUJD 2K4KA 2VJIA 4QVAA 4RDJA 3AVXA 4BY7B 4RLZA 2HCIA 1R9TB 4KI0A 1WJJA 1VQ7B 4RCYA 4RPDA 4JVZA 2QGGA 2XGTA 1GHJA 2BH2A 3HOVH 2OF1A 1B50A 3NBHB 1X55A 5T1GA 3GD7A 2UUCQ 4P26A 3HRZC 1D1IA 1UEAB 3I55B 3L2PA 4OX9L 1J8IA 1EP1B 4R4OA 2V7TA 4B3RQ 1KXLA 1JJCB 4QIWB 5BN3A 1RQRA 3CCLA 5FNZA 4PG3A 1AIPA 3VA5A 3U4ZA 3OIPA 3UI2A 1FNCA 2QTZA 4NW2A 1VS0A 2ZTCA 1PMRA 2L11A 2J7KA 2EXDA 2WINB 2F52A 3M9BA 2ZJRA 3M4PA 4K0KQ 1X3FA 5IT9c 4KHVA 3K5MA 1K73C 3CCRA 3GVJA 2EJGC 1PXUA 3TP5A 2X6XA 3FEWX 1NRKA 1YBYA 1EL0A 4LF7Q 4BBSB 2E2HH 1WSRA 2A69C 2I5MX 4OOSA 5I2XA 3CCMB 3D31A 4YCUA 4P74A 1VQIA 5LMUQ 3ASSA 4P1VA 3K58A 5CGKA 1XNRL 4YHHL 2I1LA 2JN9A 2QEJC 2B7CA 1WTHA 2K6AA 1HHVA 1F9SA 3SK5A 2PZTA 1WVLA 2W6JA 1VQ8B 5F4JA 3H0GG 1G7CA 1D2BA 1HUNA 5ELBA 4XLCA 1U9RA 1Z47A 1AFPA 5M5WB 3KEWA 2UUBL 1DARA 4YXWA 5BN4A 3EROA 4ACAA 5LMZA 1VF5C 1ET9A 4I7ZC 2Z4IA 4UAIA 3BDOA 1VQDA 4C2MH 3F2BA 3K7AB 1HNZL 4JV5Q 3NENA 4JI6Q 2R93B 2C4UA 1EQTA 3HOUB 1GO3E 3J80c 2J7ZA 2EYLA 1WPCA 2DYIA 1A0IA 5CV6A 4A3BH 3P7JA 2OQKA 1HA3A 5IYWA 5FA6A 3Q22A 3NUCA 3LWEA 1KTVA 3AFQA 3IAYA 1HXYD 3WNDA 4MN3A 5EKLA 2Q2IA 3GVKA 5EPLA 4XOPA 4A3KG 3T4AC 4P12A 3MEFA 3BCFA 1PFSA 2Y0SE 4NXNQ 1PJ5A 3NELA 1OXSC 2X3UA 1LTID 1JB3A 1GVHA 1EEFD 2QMUA 1HQMC 1YNXA 3OHXC 3GTPH 1UEBA 4DR4L 3MWYW 3P26A 2DCUA 3DM1A 4DR1L 3LQ6A 1IL2A 4DV2L 3PO2H 4K1XA 3SDZA 1N33Q 4WORA 1TWGH 1BQEA 1YZ6A 3QO2A 1IKLA 4HR7B 2ZJQA 1ZM4A 3AGPA 2Y0SG 4JG2A 2Z6KA 2B8GA 4NMZA 5E3FA 2CH4W 1WTVA 3GVLA 5HZAA 2B2TC 3ULLA 3N52A 1PRTF 4DA2A 4OOXA 4NDXA 4OO1H 2WIIB 1TS4A 4LUOA 2VW9A 1QUQA 1VQ5A 1OXXK 3OSOA 1NR4A 2B29A 5EPKA 3HOVB 1VQLA 4XM3A 1PYBA 2Z6BA 3CAMA 1HNXL 5FKAC 4B3TQ 1UD3A 4QCLA 1CK1A 3CQZH 1VQNA 4N3GA 1IHMA 4CKEA 3H94A 4G4KA 1COWA 2IX3A 3I2ZA 4A3FG 1LM0A 1IW7D 4Z4RA 3H9NA 5JBQA 2JN4A 1B3QA 1U5KA 4RDLA 1DOMA 1QNUA 1X65A 5KNCA 4AQYQ 3WXMA 3CCRB 1SYGA 4JI5Q 1K8MA 1TY0A 3HOZH 3VMFA 4X8IA 3TREA 3HOWH 3CCQA 2UXDL 3QFSA 2AKWB 1SBBB 4AF6A 4IJHA 1VQ9A 4ZCKA 4DXFA 3V2TA 3G71A 1TS5A 4MYUA 5M3FG 2YTXA 1O7YA 3J81L 3W2GA 4X3KA 4YAFA 1KD1D 1XMQL 4AC9A 2WKCA 3GTOH 1HNWL 2MFIA 4OP7A 2FX3A 4QV2A 5BR8Q 2HLDA 3MAQA 2AWOA 4DAYA 3JC66 3Q23A 3CXCA 1E62A 2X6WA 1VQJA 2EPBA 2F0QA 1EIHA 2H4OA 1X3EA 3RZDB 3GV6A 2UU9Q 4RHSA 4TMXA 1E64A 4R1JA 3BDLA 1SXTA 3OEEA 2QA4B 2VNHA 2WAQE 4FN5A 2YTVA 1OXTA 3LWUA 1BJKA 3PIPA 2P3MA 3QR8A 2IT1A 3MEHA 5HURA 1QILA 2A6ED 4QY7A 2L4NA 5FO7B 2MNAA 2XNJA 1HFNA 4A3BB 3JQPA 1PTOD 1VQHA 2B3GA 3KLSX 1JWSD 2R7ZB 1IBLL 1KHIA 4POGA 4UPAA 1MHWC 2YYZA 3U4VA 3K5LA 2K1BA 2WAQG 2K5QA 3J81k 2Z8LA 5IGGA 1I4QA 1HNZQ 3BY1A 1D2EA 2KQ3A 4X66Q 2PMZE 5KNDA 1LV9A 4KN7C 5FLXL 1PVOA 2CVRA 4IFDI 4B4DA 3GTPB 1Q9SA 2NZOA 4P72A 2VUMG 5IYPA 4KHZA 5THXA 4NPSA 4P2NA 3ASQA 1KC8D 1Q46A 3BZKA 4DXGA 3PO2B 3GTLH 5DM63 1S40A 1KJZA 1I50B 2XRSD 5C4ZA 2D0OA 3J81c 4FXKC 1VQLB 1I3QH 3A8JA 1OHHA 3RMHA 4RD1A 3PMFA 2PZWA 5DAUA 4DR4Q 1B2TA 3I3CA 4DR1Q 3CC4A 1DD2A 4ILWA 4X05A 3STBD 5M5XH 2BMWA 4E0FA 2BCOA 1BBUA 1EFUA 3QFRA 1D1NA 4V190 2PQAA 3FP9A 4LF8Q 5ELOA 5IK2A 4H44C 4HE5A 1AMOA 4TT3A 5C5LA 2L1BA 3R2TA 1JA1A 4FXDA 1I4GA 1WSVA 1Q12A 5M3FH 4LBWA 1XTDA 2K05A 4GZYC 4Y52H 3U6BA 2WR8A 1JC7A 1H8EA 1K8GA 2XNCA 2NBFA 1LT5D 5DS0A 3T51B 2A73B 3CCQB 1KK0A 1PH3A 3PQIA 2F0VA 1VQ9B 2XN9C 1QZHA 1O80A 1M8AA 2GK6A 2F3IA 2YU9H 3G71B 1KABA 3HOZB 4HTHA 3DWQA 1UE1A 3T1YL 1LYLA 3GDEA 3ONUA 4RD4A 3QFTA 4A93G 4A3JH 4HIKA 3UDGA 1GJXA 3WDNA 1HR0Q 3B78A 2PI2A 1LTTD 1WTQA 4DAYB 3CXCB 3LVBA 1SKYB 1JJ2A 3GTOB 1FYCA 3T53B 1TWFH 5CV5A 2HIXA 1JCKB 5JJZA 1SM4A 3PUZA 2IWHA 5EKKA 1RD9D 1JOQA 1CNFA 2CW5A 4CJ2C 2JA6H 4X7EA 2TMPA 4HAEA 3H15A 1XMQQ 2D74A 1D8TA 2AQ3B 1LT4D 1ASYA 4R4QA 4TMTA 1DCZA 5COYA 2JA5G 4DKAC 4KHPL 3FPUB 1CTMA 3D6WA 2QEXA 2NN6G 3T16A 2C77A 4DV5L 5IP9G 3PIP3 5CV4A 1IJEA 4FXGC 2NZHA 2E2IH 3HOYG 5A89A 2UUAL 5I6YA 3D26A 4LF9Q 2XIWA 1PH7A 2XRQD 3MMPA 2JEBI 5M3MH 1BBWA 1N06A 3K81C 4A3GB 5FO1A 4F88A 1IL8A 1NAPA 4J1MA 1VQAA 1AZPA 3L0OA 2SDFA 1GOZA 3K5OA 1VJSA 2WYRA 4J0QA 1GVPA 3IKJA 1WORA 1UMKA 1IBLQ 1K8AC 1IBML 1FNUA 2B2TA 1B2RA 2A19A 1N36L 1GUGA 4X0CA 3DWAA 3GTLB 1YITA 3ZUGA 2DJFC 2L9HA 5IGFA 5KNLA 3MC0B 4X62Q 1Y1VH 1ZYRC 3ZC3A 3W2EA 2KVOA 1GJRA 4B3ML 1I3QB 1FNDA 4CJ1B 2PQAB 1CNEA 2N88A 1FJGQ 3SJZA 4RD3A 1A63A 3H3VC 2KHJA 4WZKA 2Q6IA 1E2WA 2ZL6A 1G6PA 1GHKA 5ELDA 3KK7A 1CKOA 2MUYA 4GLVB 5IYNA 4A93H 4B3SL 1GXDC 1J5EL 2DERA 1PH5A 2BPOA 5IYCG 3K7UC 2J0TD 1CQVA 4HSPA 1STHA 2EOTA 5I2YA 1X6OA 5JEAG 2JJ2A 1D5MC 4BPRA 1C48A 4QIWE 1PRTB 3PVDA 4POFA 3EA6A 2AWNA 4MNOA 4XT1B 2GJKA 1G2TA 4RD6A 1AE3A 1QFJA 1G51A 4LWCA 3HAGA 3VA7A 2DNEA 4F7XA 1K83H 4DR6L 1IYUA 3TZUA 1TT2A 2YTYA 2VBSA 4JOIA 1Q86C 1BNZA 2NN6H 5FIUA 1VQEA 4BBRH 1SMXA 2IHEA 4TRDA 3M85A 2H1EA 4A3DB 5IGCA 3HOYH 2XTIA 3EJIA 3QJYA 1E79A 3DMUA 1NCVA 3NP8A 4XQQA 4R8NA 1EXMA 1NY4A 4K2KA 1TWFB 1AH9A 1NSNS 2KHSA 1FL0A 1U4RA 1E1TA 5CC4A 3CMAA 3CW2A 3UDIA 3E6ZX 2DY1A 2UXCQ 3CCEA 2QEXB 1BCPF 3AMUA 3CU7A 3BYTB 3JAMi 4HIZA 3K80C 1ZM3A 2ZBVA 1YHAA 2ZM6L 4BBSG 5DSZA 1F2ZA 2DIEA 1FRQA 2F0NA 3NQTA 5TR9A 3RLFA 2Q8RE 3W5HA 2V7UA 2FJ2A 4LUVA 3U6KA 2KENA 2OEOA 4Z4TA 5L46A 1XYIA 4BY1B 2XSCA 1JR0D 5KSWB 1K28D 2LMCB 4KMUC 1L0XB 4C1NK 3BQJA 1LTGD 4PC7A 2E2IB 1VQ4A 1FRNA 3ISXA 2K75A 5FJ8G 4JI1Q 1SFOB 2A68C 3MXNA 4B47A 5M3MB 2OQ0A 1N0UA 3AVTA 3FJOA 1W0KA 4DK1A 3S24A 3PA1A 1Q3LA 4GN4B 1STGA 1NUCA 4C3JH 1YITB 5J3BA 1RCVD 2UUAQ 1ESRA 1EFWA 2R93G 5IYCH 2B5OA 1MGSA 1SYBA 1O7IA 1ESFA 3AYHB 2N55A 5FOBB 1UE6A 2DJGC 4BWGB 1STNA 4BY7H 4G7XA 3LX0A 4KK7A 4ZKBB 1C7YA 1EFRA 1Y1VB 4P73A 4PZ7A 1R9TH 4B3RL 1I6HH 1W34A 1FR3A 3G7LA 3CESA 2E8GA 2LZJA 2JSOA 3SEJA 2HUGA 1Z9FA 4J8QA 4UP8A 5C5MA 2VB2X 1G291 1ZUNB 2M5SA 4JC0A 5IGDA 1K3BC 1IBMQ 4Z4UA 2GK7A 3UDFA 4LFBQ 3VDYA 2D9RA 5I6WA 3HZXA 2DY7A 1BR9A 1N8RC 1BOSA 3OW2B 1E3ZA 3NTKA 1UE5A 4N9PA 1EU3A 3GTKH 2C2WA 4DR2Q 2QILA 3MCAA 4IQZA 1QGZA 3W2FA 1HH2P 1SE8A 3KBGA 2CF4A 1FNVA 3MHBA 4PMBA 2R92H 3TS2A 1QFYA 4E6IA 3CPFA 4G1BA 2K52A 1RF2D 5GADC 2D5DA 2Q2TA 3NXWA 3BG3A 4WZEA 1J5EQ 5A2QL 3RY8A 4XQNA 1YJWA 4C43A 3BYYB 2F1MA 5I4DA 3HOVG 2F0TA 3CCUA 1SJHD 2F0DA 4YWMA 4TSSA 3TBIB 1LTAD 4LF6Q 4OIKA 3I4OA 2QDXA 1K83B 1N07A 3AB9A 1K73D 5H1SE 3AVYA 5F4MA 2NV4A 4LUZA 3R8BA 4DAVA 3BCDA 1FNMA 2CRVA 5JAVA 3F2CA 3NQIA 4KKTA 4LBZA 3CMAB 4TMVA 4BBRB 3RN2A 4ME5A 4N8X1 1QZGA 2FINB 5FJ8H 3I91A 1Y69U 4FF4A 4JI6L 4DR6Q 3AVVA 1QG0A 4NP5A 3WYAA 2VB3X 1KAWA 3UE0A 1I94Q 4IOCA 1MJEA 2PW5A 1U2RA 1STEA 4ZUJA 1E3XA 1BDOA 2EDGA 4MIUA 4X7DA 3R3OA 5TRDA 1F9RA 1MABA 5GV7A 1EYDA 4RAUC 1STBA 4FYDA 2CK3A 2YWEA 4QFMA 4P25A 1VQ4B 1QGAA 1DG1G 5C0XG 3HOUH 2JIZA 3OW7A 2YWHA 3MXNB 4DV4Q 2F0GA 5CMDA 4Z1MA 1EY5A 1WCMH 4HEDA 1JICA 1VQMA 1Q7YC 1JT8A 4H7BA 1A15A 4P2CB 1VCIA 1RDPD 4II3A 2ZM6Q 4DUZL 2ZL7A 1N33L 3IL8A 1XMOL 1AZQA 1LT3D 5BSYA 2XZOA 4C3IH 3TDQA 1OTCA 4XOTA 3H3VH 4C3JB 5LMNW 1L1OC 3Q24A 1FVIA 5FLMH 4RH6A 2DY8A 3AEVA 4HCEA 4RFBA 1HQRD 4OIJA 4A3BG 2D3NA 3WY9A 2R7ZG 4B3TL 3ERSX 4DK6C 3I70A 4R4IA 2O2LD 3PIOA 1I6HB 1GO2A 1E1RA 3HFZB 2NUCA 4HSVA 1YLOA 3R6JA 2RBMA 4AIMA 4OXPA 5ELEA 3V76A 3BY2A 2F0HA 1YNNC 1ONLA 3QWNA 1NJID 1QE6A 1L2FA 5A8AA 4AQYL 3VNVA 5FO9B 4JI5L 1ZKOA 4NXML 4P9SA 4XNFA 4PV1C 1PFNA 4AVZA 2IHFA 2F0IA 3TZDA 4FNFA 4ZCIA 2XEXA 1UE7A 3PO2G 3GTKB 3WOEA 5JEAJ 1SAPA 5IT9E 1NBWA 1YX2A 3HEJA 1BLIA 5IP7H 5CV7A 1CA6A 2R92B 5BN5A 3RN5A 1AW7A 3CCUB 1YNJD 3JU4A 4PZ6A 2EQSA 3BZCA 1PH8A 1ET6A 4OO1G 3ASTA 1LO5D 4KD3A 4ZLTF 3ZIAA 1O78A 4DV6L 5KYLA 5BR8L 1PA6A 5AJ3L 2R61A 4WRDA 1CKMA 1WD1A 4XLHA 1MIUA 1JOKA 4Z9CB 1A8VA 4M53A 3AGQA 2ID0A 5C0XH 5DLQE 2UU9L 1PRTC 2E76C 2F3VA 4TMZA 5DN6A 3C1FA 1ICFB 3OOCA 5IGEA 4ROXA 3H6MA 5EKIA 3B8HA 3GTJH 1SLJA 4QF4A 1STYA 1WDTA 1QVGA 3O13A 2B2VC 1XPOA 4XLAA 4C3HH 3W5VA 4A3EB 1PHJA 1CA5A 3RZDH 3HOZG 1N9WA 1HUMA 2VL6A 4P71A 1T6YA 1BXTA 1PH6A 1S0UA 4FO2A 3J80E 1LUZA 1ZEQX 3EFXD 1TS2A 2HQLA 5LMNQ 1PYWD 3L3OC 2R9VA 1VDZA 1CHQD 2OK8A 1C9OA 1QVCA 4A76A 3S2HB 1VQMB 4OELB 4X66L 3J80i 1HZEA 4Q7JB 2R7ZH 2VYQA 2OBTA 2VBTA 4TSFA 2E1BA 1JWUD 1R5OA 1WCMB 1Q81D 1ELOA 1B53A 3G48A 2NVQB 3A1PA 1Q1BA 1IXRA 1S5FD 1WOCA 3BZDB 3WWVA 1T6ZA 3S2DH 4C3IB 1X54A 2GJPA 4KKSA 3ERQA 2E2JH 4YAWA 4UHVA 2V7QA 4DQKA 1DDGA 5JVH3 1VHOA 5E6TA 3GTGB 1WTXA 3OZWA 4DUZQ 1R5BA 2RSOA 2VNJA 1VQKA 1I50H 1ILQA 1XMOQ 3LGJA 3NPPA 1WOSA 2Z0SA 5C6AA 4LF8L 5I9PA 2F03A 3RD4A 4ZYSA 1PJ7A 2RDHA 5EPJA 4GOPC 4YELA 5FO0A 1EIYB 3BDCA 4UY8C 2NVTH 5C44B 1FX0A 2KJXA 4A3GG 1TWAB 3PCOB 4NNJA 1NB0A 3PIO3 3NE5B 4KTAA 1QJOA 1W2BA 4GN3B 3CCLB 4FF1A 1B44D 3HOXH 4TQUS 1BO0A 2QKIC 3QOLA 3T56B 3GIRA 4HE6A 3PUNA 4ZGNB 2JE6I 3PUXA 4LFAQ 3ZZUA 4CDCC 3D0FA 1EY9A 5C3EH 4PC3A 4YHBA 5F2DA 2OK7A 5C4XH 1RJTA 5FK9C 1EEID 3P20A 4JBMA 2HQEA 1A2TA 2JA7H 1KNAA 2LKVA 2XWJB 3EBEA 2F4VQ 4HMJA 3BVGA 4RKLA 4O42A 4YIJA 3OTOL 1HR0L 3ND8A 4NXMQ 2V4DA 2CQOA 3MA2B 1EY0A 1IHZA 1F9PA 1QOHA 2KCNA 1XJVA 3FDTA 1S5CD 4JPBW 1ICWA 3K0XA 1II3A 1V1QA 3PUYA 4IPHA 1FNWA 4CKBA 2C78A 3HKZB 3TP8A 4FF3A 1O7ZA 3VYSA 3PENA 1JB9A 2Q8TA 3ICEA 1H9MA 2PI2E 4G6IA 4IJLA 4CHTB 1QVGB 2WFWA 4DNIA 3PO3H 4MYTA 1KLUD 4DV6Q 1VQ6A 3H91A 4PMWA 3GTJB 1EOVA 5AJ3Q 2B2WA 1QVFA 4JOIC 1WTWA 1WI5A 1EY7A 3VR2A 1E22A 2X6LA 2JA8B 4C3HB 5C3WA 1CFMA 3M4YA 2QTLA 2FHTA 1BF4A 3OIQA 3LNNA 5E4WC 5FL7A 5GV8A 3S1MH 1Q90A 3E5SA 4ZV4A 3E3XA 1VF7A 1L0WA 4LF9L 1JJGA 4B3XA 1GUOA 1JOOA 4XT3B 5EBDA 4A3JG 1BQQT 4RGNA 4DV7Q 3ASPA 3CW2C 1HZAA 1SSOA 5C0XJ 4TKOB 1OB2A 3P1HA 1PH1A 4A3DG 2D0PA 1WOOA 3Q38A 3V7AA 3MFYA 2PNRC 2K5NA 2RCFA 1A62A 2H5XA 1OB5A 4FVMA 2O4XA 4HCSA 4APVA 1XXGA 2A8VA 2B2YC 3FKIH 2EXZA 2I5HA 3X3NA 4A3GH 2O5JC 2RKSA 1EYCA 5B6IA 1L1OA 2EIFA 4HIOA 1VQPA 1KTKA 1HCZA 4L5QA 2WSSA 4DAPA 2JA6G 4X62L 3KBXA 1BVSA 3S2DB 1HPCA 3DEOA 1VQKB 4IUVA 1PFMA 2KOLA 2SNMA 2E2JB 3MXPA 1I7PA 3G6JB 1FJGL 2F4NA 3DEPA 3S17B 1MSGA 4GKJQ 4K14A 4BY1G 3CF5A 1K8AD 2CFMA 4N8FA 3J81i 4PC1A 1VQ5B 1QUQB 5KNBA 5EGTA 4PQXA 4RD0A 1NTGA 2GQFA 1A3TA 1SNCA 1K0RA 4ASUA 1IYJB 1ENAA 3OEHA 3SXHA 4XDXA 5M3MG 4YAOA 1E63A 1N05A 2NVTB 1J9ZA 3CCSA 2A5HA 4ODGA 1SYDA 1VQNB 1W3SA 2E1RA 2JQOA 5ELFA 4A3MB 3SLDA 1H8HA 3TP6A 3HOXB 3MHPA 2WJYA 1VQGA 3CRLC 3OJWA 2BVNA 3QE2A 2K01A 3MXGA 1V9PA 1F77A 5AFWA 2EZVA 5C3EB 3T13A 5C4XB 1SYFA 2VBUA 3GV3A 3ZYYX 1TQOA 1Y1VG 4IOAA 1TXYA 2JA7B 1GUNA 1I5FA 2P5ZX 2X0KA 3CC7A 1XE1A 3RUZA 1CM9A 1TWCH 3K8AA 3AU7A 1VQOA 1GR1A 1RTNA 2WKDA 2GREA 5KYIA 4JYAL 1Y8OB 1VQCA 1IW7C 2M00A 4RM0A 2F0EA 2MGSA 4YAUA 1OXVA 4LK1C 2ZTNA 1EOTA 4C1NI 4CDFC 3D3RA 1B1ZA 3VYTA 2K33A 4DPGA 1VQ6B 2BE5D 2JXMB 1M90D 5FLXc 4XKWA 2LXKA 4A3CG 2B2VA 1QVFB 3OTOQ 2UXCL 2CCZA 4M1KA 4A3DH 5K36H 3PO3B 2Q6OA 1IB0A 4FF2A 1K9MD 3NWTA 2AQ2B 2EIXA 2WB1B 2PO4A 2DEUA 5EMNA 2PW7A 4JCVE 4KJOA 3BNWA 5C4JB 3W2IA 4DV3L 3Q8DA 3S1MB 1E2VA 3W1BA 1KD1C 3ER0A 2DOGA 4JI1L 4HJAA 1WTHD 1MI2A 1S5DD 2QN6A 3V05A 3J7YW 3H09A 1G91A 4JBKA 4BY1H 4RCZA 3A5UA 1SN8A 4BBRG 1L1OB 1VQPB 1FGBD 3ONAB 3W5UA 5LL6X 2ZZFA 4DQLA 2EYJA 4A3KB 5HXBA 2NN6I 4B9WA 1SFOH 1N08A 4CKCA 3ZZTA 4B43A 1M1KD 2MO0A 3FKIB 1X3GA 5IWAL 4HN7A 3TSSA 1F9QA 3R93A 2QDLA 2A6EC 4F87A 4MZ9A 3DWPA 2XZPA 3M4QA 3TMEA 1PTOC 3KLSA 4DNTB 4B3FX 1I18A 3WBKA 5CV9A 3W2HA 4GOPA 2X53S 2HHHQ 1CQFA 2V31A 3VYUA 1TU2B 3OP1A 4ZGQB 4LJZC 4LFBL 5CBEE 2KEEA 2ICIA 2CNDA 1B9NA 1Y0YA 4XTCS 3CC4B 2JK8A 1YIJA 1BCPC 4LC0A 1DONA 1JWMD 2VY3A 4DR2L 3MFGA 4Z4SA 5IODA 1EZ6A 2CWPA 4PMCA 1KC8C 4JBWA 3CPWA 2MP1A 4RCOA 4ZRZA 3SK6A 4WWVA 3FPKA 1H9JA 4C3JG 5HY6A 1SNPA 2F0MA 1FNBA 1D1KA 2X6GA 4A3CH 2W6IA 1QWYA 3OZVA 3CC7B 4IZ8A 4MTNA 2EYPA 3STBC 1XX8A 2CWAA 2RDFA 4LF6L 2BA0A 3A8IE 5KGUA 1KRSA 4BY7G 1TUIA 2ZTGA 1SROA 4GLXA 4KN4C 4RG1A 1KL9A 1SEBD 2EYHA 4K6DA 2FFKB 3RR5A 3JAML 4JI2L 1TWCB 3OPOA 2CBXA 4KY7A 1E2ZA 4HMIA 2FMCA 4N3NA 3R2IA 1A3VA 1H9RA 2CQAA 1KRHA 3F8TA 5CR3A 1CSPA 1MJCA 3I4NH 2LFNA 3UE1A 1SE4A 1JJ2B 1I94L 1C0AA 1HVXA 5TSSA 1SDFA 2BA1A 2K14A 3KL9A 4IURA 4JBJA 2XGJA 1PTOF 4EQ5A 2R92G 4Y7CA 4JYAQ 2MHVA 3ZZ0A 2BN4A 2EYMA 3FKSA 1B9MA 3JAME 3U50C 3J7AV 2OTLA 4P3IA 2B2UC 1IJFA 3EQLC 4DV4L 2GVBA 1XNQQ 1CZGA 4HJ7A 4N9TA 1SRUA 4XN0A 1YI2A 2IJ0A 3CB4A 2BSAA 2CC2A 2D2CC 2B8FA 3VR4A 3QIAA 4B08A 2B2YA 2QDBA 4R4CA 4UP7A 2XOKA 4FK8A 4DK0A 1EU4A 4KY5A 1W87A 1E3PA 1XB2A 2HIVA 4Q0FA 1TY2A 1I8DA 2NZ1D 4JK1C 2HMAA 4XR6A 3BS1A 1LABA 4DV3Q 5E7NA 4YWLA 2WAQB 2XVSA 4RGOS 4DFAA 3I1FA 2F0WA 4HJ8A 4A3EG 1NMFA 4M0LA 1NB9A 1P8LA 1G2SA 4G5GA 4GOPB 1PJ6A 4DNRB 2BOSA 4QJFA 3A7LA 3OMCA 4CDEC 2OCEA 1VHEA 5JPNC 1K0SA 4R71A 3I56A 4A75A 4DK3C 3KFUA 3GTMH 4DN4M 1GUWA 4RKBA 5IOCA 5DNFA 1KDCA 3HP3A 2ES2A 1YIJB 1X9NA 3HOUG 3J81j 4WJWA 5IWAQ 3QB3A 5K5PA 1PZID 1MBYA 2RHQB 2PMZB 1UD6A 4XLFA 1ZM2A 1WP6A 1SMYD 4V0BA 1DZ1A 3OMGA 1WCMG 2A6HD 4BXXH 4XMYA 3DDYA 3CPWB 4XXEA 1OO9B 3NK9A 1MRZA 4JI3L 4A3LH 1DM0B 4O1NA 3VO2A 1HRJA 4XORA 5CDFA 1GD7A 1O7LA 2AMCB 4C3IG 2F1LA 4EX5A 1HJPA 1WD0A 3A3BA 2NPFA 3OE7A 1RL2A 4K5WA 2K7VA 2VXWA 5AN9A 3HKSA 1KNEA 5IYBG 2Q6LA 2RSNA 4CGYB 2EY2A 5FLMG 3PUWA 4LF5Q 1RQPA 2E75C 4IPCA 4KLKA 4ZCMA 4JI7Q 4OWTB 3SK4A 4O0AA 4Y9UA 1X56A 1UD5A 5C44G 4LFCL 1GAQA 2WV6D 4K8IA 3SE0A 2FMMA 4X64L 1VQ7A 4WQMA 1R4PB 4H9GA 1VQFA 1JB7A 2L5TA 1E1QA 2BV3A 2ZXOA 4FP5D 3TP7A 2K28A 3ND9A 3I4NB 2G9DA 4WJ3M 4JI0L 4ID6A 3NBIA 2HD3A 4FDBA 3JQRA 1G6ZA 4JI2Q 2ENBA 4FXUA 2OTLB 2A69D 3HKZE 5EJWA 5LMNL 1JNYA 4X65Q 5IP7G 2K03A 2RA4A 3D8GA 1PRTD 2V1CC 5LL6S 2PE3A 4J6HA 3CCEB 3D6CA 1YI2B 3Q6SA 1DOKA 4A3EH 1KLGD 3AFPA 1HZBA 1QCBD 1MKHA 3S1QB 1E43A 1DDIA 1KRTA 3KLRA 1NE3A 4X3UA 2LS01 2JA5B 4PC2A 2B2WC 3HKZG 1B4OA 1V1PA 2EY5A 4QQBX 4DR5L 4OPVA 3S2HH 1TS3A 3I8ZA 4XL9A 4JW0A 3S1RB 2Q2HA 4OGQC 2YV5A 1A2UA 1S4ZA 4H02A 4L63B 3GTQH 1XPUA 4GLAC 4M8AA 3UDXA 3PGZA 3GQBA 3HOWB 1KMHA 2NVQH 4P22A 5C0XI 3M4OB 2JA8G 4DR7L 3X3MA 4C3HG 4UDUC 1UD8A 2GA4B 2MO1A 1ZM9A 1VMPA 4RGMA 2ZXIA 1KK3A 5GAHC 3KUPA 1N32L 2IPKD 2PPBC 4Y7NH 1SNMA 4KKUA 2EYFA 3GTMB 1W6JA 5C3XA 5IYBH 5TV2A 1ZXTA 1OB0A 4HJ9A 3GTGH 4JI4L 1EQRA 2CW0C 1ASZA 4HIMA 2IX1A 1SR3A 2B39A 5J39A 2HT1A 2OT2A 1NDHA 4DUYL 1HTLD 3CTAA 3ASRA 1LTBD 1TTTA 3MTSA 5IT9L 2AHOA 1UAPA 4PABA 4ZCLA 2GVAA 4S3SA 4LFAL 3M3YH 4EQOA 5C44H 1TWAH 2KCCA 4P6VF 3I4MH 3W3AA 2JJQA 1FD7D 4PAAA 2QW7A 1Y1WB 4A3IH 2OTJA 1E7ZA 3OYYA 1EY8A 3B6YA 2F4VL 3CD6A 1VQBA 1IYVA 3WBJA 5A35A 1BX1A 2LY7A 2MJ8A 2F4IA 1D5ZC 4JMQA 2KBNA 2BDNA 1Z7TA 3J7A5 1NMGA 4JI3Q 2QE7A 3SEBA 1BKBA 4K6LA 5G3LD 1Q82C 4Y9RA 2ICEC 2K32A 3SJPA 4LF4L 1YJWB 4KY6A 1N34L 2TSSA 2BM1A 3R6KA 4CBVA 3OKXA 4B3GA 1CUKA 2DUDA 3QOJA 1K8OA 2JP1A 4DU9A 2EYOA 2KCMA 3I73A 3C1EA 2M9VA 1C8CA 4XN3A 2F0SA 3P27A 5IYDG 1RODA 4A3MG 1WTPA 5LHY1 1EYGA 3K5NA 3HOXG 3J80L 2V7VA 1JQYD 3PUVA 1W6KA 3EIVA 2EE1A 4OO1I 3K59A 5L37A 1F2LA 1SE3A 4XQJA 3NTHA 4K2LA 1JE5A 5HKKA 4QUFA 3W1GA 4YCVA 4LFCQ 2V7XA 4U673 5C3EG 2VZAA 2B2UA 5IY0A 4XQFA 5C4XG 2GJRA 4RPBA 2R3ZA 4RWSC 3VR3A 4X64Q 3S1NB 4G1VA 2LSSA 2JA7G 2FVGA 2B63H 4DV7L 1EFID 1AP0A 3S14B 3QSYA 4H13C 2JA8H 3VR6A 3TEHB 2PYKA 3URYA 4EQPA 3KJPA 4JI0Q 1UNSA 5ELNA 3RLNA 1V1PB 2WZPP 1T5XD 3D4WA 1H95A 5ISRA 1SKQA 4PC6A 1S3OA 2HCCA 2WB1E 2XZLA 1SE2A 4F8MA 4G7OC 3ZJYC 3BC9A 1A3UA 2OYNA 1PTOB 2R6GA 1B8AA 4QL5A 5KIXA 3PO3G 1PDQA 2WZNA 2MQHA 3GTQB 1L0YB 2K50A 5E1FA 5JOBA 2OBRA 2ZBUA 3A8KA 5HGTA 2WB1G 3DUZA 1J9OA 4WJ4A 4R9WA 3NWSA 4G57A 2A1AA 4GKJL 3IFDA 1B23P 1KIXA 4DR5Q 1BCPB 4NKLA 1LTLA 1WYDA 3OJXA 3T1HL 4WFN3 3PSIA 4ZKCB 2Z1CA 5C4HA 1OGIA 2NTSA 5HGQA 4Y7NB 3G05A 2RQXA 2QA4A 2UXBL 4BA1I 4P3YA 2AHOB 4O2DA 4AYBB 3S17H 1PV4A 4DR7Q 1U4PA 1TLLA 2YWGA 3DM3A 1S72A 1YJ9A 3K0YA 1W35A 4YY3L 3BVZA 2OTJB 3A74A 2G9HD 2ASBA 5EQ0A 3A8JE 4QB4A 1N32Q 3ZBTA 1CZWA 1Q1EA 1BPLA 4HIDA 3M3YB 2BGIA 3FKIG 1EQQA 1IBKL 3CD6B 1PFBA 3ES9A 3I4MB 5IYDH 3RNUA 4JI4Q 4A3MH 1DJRD 4A3IB 4L5TA 4IUPA 1SJED 4DUYQ 3OWFA 3A7AB 1LACA 1OXUA 1YEZA 1AN8A 2VNKA 2L12A 1F60A 2SNSA 3BU2A 3DXJC 3FHWA 1W9XA 5JJLA 1KDAA 3A55A 3CRZA 1Y8PB 1NJIC 2EJFC 1ENCA 3L9AX 3SLNA 4C56C 2HDLA 2RC5A 3S9WA 1NBMA 2ZXHA 3VYRA 4RCNA 1EZ8A 4JI8L 4X7FA 3SK8A 1MD2D 1HZCA 3I4LA 1D7QA 2ALYB 3N6RA 1I6VC 4Z4VA 1STAA 3C2PA 4LF4Q 4GNXC 4KV6A 1N34Q 4GKKL 3SKBA 1YNJC 3WQZA 3SVMA 1ENFA 3GSIA 1BMFA 2JDIA 1EY4A 1EP2B 3PV0A 4DV0L 3H0GH 2KA7A 3HGBA 4OX9Q 5H59A 2VJJA 1D5XC 1HA6A 2NB0A 1CT1D 3SHLA 2B63B 2Q6KA 1HTPA 1I4PA 2KCTA 3CRKC 3K57A 4BA2I 5M9OA 5C4JH 3U2QA 2V7WA 4AF7A 5D65A 3KOJA 1QFZA 2E2HB 4X3TA 1UD4A 3DHQA 4M1UB 4X6AH 2K5DA 3CP0A 3ZBUA 4A4IA 2R6HA 1PKVA 2M2LA 4OPOA 2Q8IB 4OOVA 5JVG3 4X06A 3G4SA 3Q6QA 1XPRA 4X07A 1VLYA 2EJMA 5K36G 3PF4A 3FRPB 2NYZD 1U4LA 3NHHA 4A3KH 2HHHL 3F2UA 1K28A 4K8JA 4UZEA 2PZUA 1XNRQ 2VS1A 1T5EA 4YHHQ 4EGVA 2IL8A 5IYRA 4TVAB
chains in the Genus database with same CATH topology
1Q8IA 4C2MB 3J81E 4KD4A 5D14A 1EIGA 2IX0A 4K5VA 1M4VA 5KRUA 5G3LF 2X69A 3U9SA 4IFDG 2AUKA 4OHJA 1C4QA 2WPDA 2D3LA 4XONA 2VNUD 3D4RA 5CV8A 1BCPD 1ZYRD 2X85A 2PCFB 3CHBD 1BBXC 1U4MA 1EWCA 3OAAA 4EQNA 3A54A 1TWGB 2MPMA 5T1IA 4IUQA 4XYQA 4IN3A 5FLXE 1PLFA 2PQEA 4R8IA 3CQZB 4H0LC 1B3AA 3MVVA 3A56A 4CJ0B 4XD7A 3H0GB 1V8QA 4LAAA 3HS0C 1H9SA 1JE4A 1QNKA 1V0EA 1ILPA 2F0LA 3CP2A 3FPPA 2F0UA 2I07B 3SR1A 4I65A 3J7AF 2EY1A 5CBAE 2WACA 1KDBA 3C46A 2K5WA 3MZ5A 4IFDH 2X6YA 4UZUA 1WTRA 3VR5A 3CP8A 2E2DC 2AQ1B 5IGBA 1KZLA 3QG1A 2EY6A 2K04A 2L0CA 1KAAA 2A68D 1UD2A 5JPMC 1DYQA 4PNYA 1H9KA 3Q0AA 4RGTA 4ULLA 4DF7A 2Y0SB 4ZK9B 4II2A 1W0JA 1PZKD 3OFNA 4L8JA 2OXPA 2ZT9C 1GUTA 4ZAIA 4OL7A 3A3GA 1R4QB 2F0KA 2QF7A 1X3QA 1A6XA 3S16B 3IFTA 1HFGA 2A74C 1HA5A 3FMCA 4A3FB 2XNDA 1QB5D 1VMCA 4DGZA 1LT6D 2X8KA 2RVLA 4IUTA 3TN2A 1LTRD 3CKIB 3U9OA 2Z6BD 3I72A 1F2MA 5M5XB 2BDOA 4YEJA 3V96A 2I46A 3OWEB 5M3FB 2F43A 2JEAI 5I9OA 1LTSD 1H9SB 2QCPX 3EVQA 2F0PA 1GUSA 2NWGA 1JORA 2BE5C 3GO5A 2JJ1A 2YU9B 2JYOA 5D3DA 1RHPA 5NUCA 1RTOA 4GQNA 4A3JB 3RZOB 4L6TB 1DOLA 1V0FA 1DXMA 1XWEA 4XIGS 3ITPA 1SNOA 5ELCA 1TIID 3KF8A 5J22A 2SEBD 1BUVT 1TR5A 2JA6B 3I90A 1I4HA 1CI3M 2VUMB 3C3LA 1I4RA 2CHBD 4RA8A 3M7GA 1PZJD 2KUMA 1EY6A 4MHEA 5CYUA 1CHPD 1SYEA 4XLEA 2EVBA 5IIFA 4IFDJ 1X3PA 2CW0D 3P75A 2DN8A 3GP7A 3BVMA 2NVXB 3E0JA 1SNQA 1WTOA 1S5ED 4X3SA 3WOFA 3S15B 3ZPNA 3A35A 2HDMA 2SOBA 4IUUA 1YNND 1D6EC 4B9XA 5JEAH 1V1OA 1TKWB 1X32A 5KEEA 4G7WA 4IUNA 4K5XA 1I4XA 2NVYB 1Z6HA 2ZXRA 1XTCD 2L55A 2F3WA 2DNCA 3K6OA 4Q5VA 2ZZQA 2F0OA 4A93B 1V43A 3NBHA 4ABNA 4ZUIA 2KEDA 2F0JA 1EQVA 2Z4HA 1Y8NB 4IALA 2KECA 2WJVA 1RKNA 2ZZGA 1NR2A 4XYOA 4XKVA 1ML0D 3FVQA 2C5CA 1QG7A 5J1ZA 4KJNA 2F0FA 1E0BA 2IW3A 4QMGA 1SYCA 1PTOH 5DM73 2RDGA 3HOYB 1UUPA 1MSHA 3BH4A 5A2QE 1EYAA 1S5BD 2O5IC 3A8KE 1AEXA 4BS9A 2C9OA 5E4XA 3NTIA 4G7ZC 5EBCA 5D3IB 4U68A 3L7ZC 1EWHA 3HG9A 4G7HC 2XWBB 4EVOA 5DEHA 1G8ZD 3D4DA 1F2YA 2KVMA 3M7NA 2WP8J 4QUCA 3NSWA 5M5YB 1LLRD 3W2DA 2E74C 2XNAC 1IKMA 4LMQD 5FO8B 2J4XA 2D9UA 4ZQ3A 3CMMA 2ZXPA 5CORA 1TWHB 2NTTA 1SMYC 1TVXA 2A6HC 1SNDA 2D62A 3MXUA 2ZZEA 2AUJD 4BY7B 2VJIA 2HCIA 1R9TB 4KI0A 1GHJA 1B50A 2OF1A 5T1GA 3GD7A 3HRZC 1D1IA 1UEAB 1J8IA 4QIWB 5BN3A 3VA5A 3OIPA 3UI2A 4NW2A 1PMRA 2L11A 2WINB 4KHVA 3K5MA 3GVJA 2EJGC 1PXUA 3TP5A 2X6XA 3FEWX 1NRKA 1EL0A 4BBSB 2A69C 5I2XA 3D31A 3K58A 5CGKA 2QEJC 2K6AA 1HHVA 1F9SA 3SK5A 2PZTA 1WVLA 2W6JA 1D2BA 1HUNA 5ELBA 4XLCA 1U9RA 1Z47A 1AFPA 5M5WB 3KEWA 4YXWA 5BN4A 3EROA 1VF5C 1ET9A 4I7ZC 2Z4IA 4UAIA 3BDOA 3K7AB 2R93B 1EQTA 3HOUB 2J7ZA 2EYLA 1WPCA 5CV6A 3P7JA 3Q22A 3NUCA 3LWEA 3IAYA 1HXYD 4MN3A 5EKLA 3GVKA 5EPLA 4XOPA 3T4AC 3BCFA 1OXSC 1LTID 1JB3A 1EEFD 1HQMC 3OHXC 3MWYW 3DM1A 3SDZA 4WORA 3QO2A 1IKLA 4HR7B 4NMZA 2B8GA 5E3FA 1WTVA 3GVLA 2B2TC 3N52A 1PRTF 4DA2A 4OO1H 4NDXA 2WIIB 1TS4A 1OXXK 3OSOA 1NR4A 5EPKA 3HOVB 4XM3A 5FKAC 1UD3A 4QCLA 1CK1A 4CKEA 3H94A 4G4KA 1COWA 2IX3A 1IW7D 1QNUA 1DOMA 5KNCA 1SYGA 1K8MA 1TY0A 2IL8A 1SBBB 4DXFA 3V2TA 1TS5A 1O7YA 3J81L 4X3KA 2WKCA 2HLDA 3MAQA 2AWOA 4DAYA 3Q23A 2X6WA 2F0QA 2EPBA 1EIHA 2H4OA 3RZDB 3GV6A 4RHSA 3BDLA 1SXTA 3OEEA 1OXTA 3LWUA 2IT1A 3MEHA 5HURA 1QILA 2A6ED 2L4NA 5FO7B 1HFNA 4A3BB 1PTOD 3KLSX 1JWSD 2R7ZB 2YYZA 3K5LA 2K1BA 2K5QA 2Z8LA 5IGGA 1I4QA 2KQ3A 5KNDA 1LV9A 4KN7C 5FLXL 2CVRA 4IFDI 3GTPB 4KHZA 4DXGA 3PO2B 5DM63 1I50B 2XRSD 5C4ZA 4FXKC 1OHHA 3RMHA 3PMFA 2PZWA 5DAUA 1B2TA 3I3CA 1DD2A 4ILWA 4E0FA 2BCOA 4V190 5IK2A 4H44C 4TT3A 5C5LA 2L1BA 3R2TA 4FXDA 1I4GA 1Q12A 2K05A 4GZYC 1JC7A 1H8EA 2NBFA 1LT5D 3T51B 2A73B 2F0VA 2XN9C 1O80A 1M8AA 2GK6A 3HOZB 1KABA 4HTHA 3DWQA 1GJXA 3WDNA 1LTTD 1WTQA 1SKYB 3GTOB 1FYCA 3T53B 5CV5A 1JCKB 5JJZA 3PUZA 2IWHA 5EKKA 1RD9D 1JOQA 4CJ2C 2TMPA 4HAEA 2AQ3B 1LT4D 5COYA 1DCZA 3FPUB 1CTMA 3D6WA 2NN6G 3T16A 3PIP3 5CV4A 4FXGC 5I6YA 2XIWA 2XRQD 2JEBI 4A3GB 4F88A 1IL8A 1NAPA 4J1MA 1AZPA 2SDFA 1GOZA 3K5OA 1VJSA 3IKJA 1FNUA 2B2TA 1GUGA 3DWAA 3GTLB 2L9HA 5IGFA 5KNLA 3MC0B 1ZYRC 2KVOA 1I3QB 4CJ1B 2N88A 3H3VC 1E2WA 1GHKA 5ELDA 3KK7A 2MUYA 1GXDC 2J0TD 1CQVA 4HSPA 1STHA 2EOTA 5I2YA 5JEAG 2JJ2A 1D5MC 1C48A 1PRTB 3EA6A 2AWNA 4XT1B 2GJKA 1G2TA 3HAGA 3VA7A 2DNEA 4F7XA 1IYUA 3TZUA 1TT2A 1BNZA 2NN6H 4TRDA 3M85A 4A3DB 2H1EA 5IGCA 3EJIA 3QJYA 1E79A 3DMUA 1NCVA 3NP8A 4XQQA 4R8NA 4K2KA 1TWFB 1NSNS 2KHSA 1U4RA 5CC4A 3E6ZX 1BCPF 3AMUA 3CU7A 3BYTB 4HIZA 2F0NA 1F2ZA 2DIEA 3NQTA 3RLFA 2Q8RE 2FJ2A 2OEOA 1XYIA 4BY1B 2XSCA 1JR0D 4KMUC 1K28D 2LMCB 4C1NK 1L0XB 2E2IB 1LTGD 1SFOB 2A68C 3MXNA 5M3MB 1W0KA 4DK1A 1Q3LA 1STGA 1NUCA 1RCVD 1ESRA 1MGSA 1SYBA 1ESFA 2N55A 5FOBB 4BWGB 1STNA 4G7XA 3LX0A 4KK7A 4ZKBB 1EFRA 1Y1VB 1FR3A 3G7LA 3CESA 2LZJA 2JSOA 2HUGA 4J8QA 5C5MA 5IGDA 2VB2X 1G291 2M5SA 2GK7A 5I6WA 3HZXA 2DY7A 1BR9A 1BOSA 1E3ZA 3NTKA 4N9PA 1EU3A 2QILA 4IQZA 3KBGA 1FNVA 4PMBA 3MHBA 4E6IA 1RF2D 2D5DA 3NXWA 3BG3A 5A2QL 4XQNA 3BYYB 2F1MA 5I4DA 2F0TA 1SJHD 2F0DA 3TBIB 4TSSA 1LTAD 4OIKA 1K83B 3AB9A 3R8BA 4DAVA 3BCDA 5JAVA 3NQIA 4KKTA 4BBRB 4ME5A 2FINB 1Y69U 3I91A 4FF4A 4NP5A 2VB3X 2PW5A 1STEA 4ZUJA 1E3XA 1BDOA 2EDGA 4MIUA 3R3OA 1F9RA 1MABA 1EYDA 4RAUC 4FYDA 1STBA 2CK3A 5C0XG 2JIZA 3OW7A 2F0GA 5CMDA 4Z1MA 1EY5A 4HEDA 1JICA 4H7BA 1A15A 4P2CB 1VCIA 1RDPD 4II3A 3IL8A 1AZQA 1LT3D 2XZOA 3TDQA 4XOTA 4C3JB 3Q24A 4RH6A 2DY8A 4HCEA 4RFBA 1HQRD 4OIJA 2D3NA 3I70A 2O2LD 1I6HB 1E1RA 2NUCA 4HSVA 2RBMA 5ELEA 2F0HA 1YNNC 1ONLA 3QWNA 1QE6A 5FO9B 1ZKOA 4XNFA 4PV1C 1PFNA 4AVZA 2F0IA 3TZDA 4FNFA 3GTKB 3WOEA 5JEAJ 1SAPA 5IT9E 3HEJA 1BLIA 5CV7A 1CA6A 2R92B 5BN5A 1AW7A 1YNJD 3JU4A 4OO1G 1ET6A 1LO5D 4KD3A 4ZLTF 3ZIAA 1O78A 5KYLA 2R61A 4WRDA 1WD1A 4XLHA 1JOKA 4Z9CB 2ID0A 5C0XH 1PRTC 2E76C 2F3VA 5DN6A 3C1FA 5IGEA 3OOCA 3H6MA 5EKIA 4QF4A 1STYA 3O13A 2B2VC 4XLAA 4A3EB 1CA5A 1HUMA 1BXTA 4FO2A 3J80E 1ZEQX 3EFXD 1TS2A 1PYWD 3L3OC 2R9VA 1VDZA 1CHQD 3S2HB 1HZEA 1JWUD 4TSFA 2E1BA 1WCMB 2NVQB 1B53A 1Q1BA 1S5FD 3BZDB 4C3IB 2GJPA 4KKSA 3ERQA 5JVH3 2V7QA 3GTGB 1WTXA 2RSOA 1ILQA 3NPPA 5C6AA 5I9PA 2F03A 3RD4A 4ZYSA 2RDHA 5EPJA 4YELA 3BDCA 5C44B 1FX0A 2KJXA 1TWAB 4NNJA 3PIO3 3NE5B 4KTAA 1QJOA 4FF1A 1B44D 4TQUS 1BO0A 2QKIC 3QOLA 3T56B 2JE6I 3PUXA 1EY9A 5F2DA 1RJTA 5FK9C 1EEID 3P20A 2HQEA 1A2TA 1KNAA 2LKVA 2XWJB 4HMJA 3BVGA 4RKLA 4O42A 4YIJA 3ND8A 2V4DA 3MA2B 1EY0A 1IHZA 1F9PA 1QOHA 2KCNA 3FDTA 1S5CD 1ICWA 1II3A 3PUYA 1FNWA 4CKBA 3HKZB 3TP8A 4FF3A 1O7ZA 3VYSA 2Q8TA 1H9MA 4G6IA 4CHTB 1KLUD 3H91A 4PMWA 3GTJB 2B2WA 1WTWA 1EY7A 3VR2A 2JA8B 2X6LA 4C3HB 5C3WA 1CFMA 3M4YA 2FHTA 1BF4A 3OIQA 3LNNA 5E4WC 5FL7A 1Q90A 3E5SA 1VF7A 1GUOA 1JOOA 4XT3B 5EBDA 1BQQT 4RGNA 1SSOA 5C0XJ 4TKOB 3P1HA 3MFYA 2PNRC 4FVMA 2O4XA 4HCSA 1XXGA 2B2YC 2EXZA 2O5JC 3X3NA 2RKSA 1EYCA 1KTKA 1HCZA 2WSSA 4DAPA 3KBXA 3S2DB 1HPCA 3DEOA 4IUVA 1PFMA 2KOLA 2SNMA 2E2JB 3MXPA 3G6JB 3DEPA 3S17B 1MSGA 4K14A 5KNBA 5EGTA 4PQXA 1A3TA 1SNCA 4ASUA 1ENAA 3OEHA 3SXHA 4XDXA 2NVTB 2A5HA 4ODGA 1SYDA 5ELFA 4A3MB 1H8HA 3TP6A 3HOXB 2WJYA 3CRLC 2K01A 3MXGA 1F77A 5AFWA 2EZVA 5C3EB 3T13A 5C4XB 1SYFA 3GV3A 3ZYYX 1TQOA 2JA7B 1GUNA 3RUZA 1CM9A 3AU7A 1RTNA 2WKDA 5KYIA 1Y8OB 1IW7C 2M00A 2F0EA 2MGSA 1OXVA 4LK1C 2ZTNA 1EOTA 4C1NI 3D3RA 1B1ZA 3VYTA 2K33A 2BE5D 2JXMB 4XKWA 2B2VA 5K36H 3PO3B 4FF2A 3NWTA 2AQ2B 2WB1B 2PO4A 2PW7A 4KJOA 5C4JB 3S1MB 1E2VA 1WTHD 1MI2A 1S5DD 3V05A 3J7YW 3H09A 1G91A 1FGBD 3ONAB 5LL6X 2ZZFA 2EYJA 4A3KB 2NN6I 4B9WA 4CKCA 3FKIB 4HN7A 3TSSA 1F9QA 3R93A 2A6EC 4F87A 3DWPA 2XZPA 3TMEA 1PTOC 3KLSA 4DNTB 4B3FX 1I18A 5CV9A 2X53S 1CQFA 2V31A 3VYUA 1TU2B 4LJZC 5CBEE 2KEEA 2ICIA 1B9NA 4XTCS 1BCPC 1DONA 1JWMD 3MFGA 5IODA 1EZ6A 4PMCA 4JBWA 2MP1A 4RCOA 4ZRZA 3SK6A 1H9JA 4C3JG 1SNPA 2F0MA 2X6GA 1D1KA 2W6IA 1QWYA 4IZ8A 2EYPA 1XX8A 2RDFA 2BA0A 3A8IE 5KGUA 2ZTGA 4KN4C 2EYHA 1SEBD 4K6DA 2FFKB 3JAML 1TWCB 3OPOA 4KY7A 1E2ZA 4HMIA 2FMCA 3R2IA 1A3VA 1H9RA 2CQAA 5CR3A 2LFNA 1SE4A 1HVXA 5TSSA 1SDFA 2BA1A 4IURA 2XGJA 1PTOF 2MHVA 2EYMA 3FKSA 1B9MA 3JAME 3J7AV 2B2UC 3EQLC 1CZGA 4N9TA 4XN0A 2IJ0A 2D2CC 4B08A 2B8FA 3VR4A 3QIAA 2B2YA 2QDBA 2XOKA 4DK0A 1EU4A 4KY5A 4Q0FA 1TY2A 1I8DA 2NZ1D 4JK1C 4XR6A 3BS1A 1LABA 2WAQB 2XVSA 4RGOS 4DFAA 2F0WA 1G2SA 4DNRB 2BOSA 3A7LA 3OMCA 5JPNC 1GUWA 4DN4M 4RKBA 5IOCA 5DNFA 1KDCA 3HP3A 4WJWA 3QB3A 5K5PA 1PZID 1MBYA 2PMZB 1UD6A 4XLFA 1WP6A 1SMYD 4V0BA 1DZ1A 3OMGA 2A6HD 4XMYA 3DDYA 4XXEA 1OO9B 3NK9A 1DM0B 4O1NA 1HRJA 4XORA 5CDFA 1O7LA 4C3IG 1WD0A 3A3BA 3OE7A 4K5WA 2K7VA 2VXWA 1KNEA 2RSNA 4CGYB 2EY2A 3PUWA 2E75C 3SK4A 1UD5A 2WV6D 4K8IA 3SE0A 2FMMA 1R4PB 2L5TA 1E1QA 2ZXOA 4FP5D 3TP7A 2K28A 3ND9A 3I4NB 2G9DA 4ID6A 3NBIA 1G6ZA 2ENBA 4FXUA 2A69D 5EJWA 2K03A 2RA4A 3D8GA 1PRTD 5LL6S 4J6HA 3D6CA 3Q6SA 1DOKA 1KLGD 1QCBD 3S1QB 1E43A 3KLRA 4X3UA 2LS01 2JA5B 2B2WC 1B4OA 1V1PA 2EY5A 1TS3A 3I8ZA 4XL9A 3S1RB 4OGQC 1A2UA 1S4ZA 4L63B 4M8AA 3GQBA 3HOWB 1KMHA 4P22A 5C0XI 3M4OB 3X3MA 4C3HG 4UDUC 1UD8A 2GA4B 1VMPA 4RGMA 2ZXIA 3KUPA 2IPKD 2PPBC 1SNMA 4KKUA 2EYFA 3GTMB 1W6JA 5C3XA 1ZXTA 1OB0A 2CW0C 2IX1A 2B39A 5J39A 2OT2A 1HTLD 1LTBD 5IT9L 3MTSA 1UAPA 4S3SA 4EQOA 2KCCA 3W3AA 1FD7D 1Y1WB 1EY8A 1IYVA 5A35A 2LY7A 2MJ8A 2F4IA 1D5ZC 4JMQA 2BDNA 1Z7TA 2QE7A 3SEBA 4K6LA 5G3LD 2ICEC 2K32A 4KY6A 2TSSA 4CBVA 4B3GA 3QOJA 1K8OA 2JP1A 4DU9A 2EYOA 3I73A 3C1EA 2M9VA 1C8CA 4XN3A 2F0SA 1RODA 1WTPA 5LHY1 3K5NA 3J80L 1JQYD 3PUVA 1W6KA 4OO1I 2EE1A 3K59A 1F2LA 1SE3A 4XQJA 3NTHA 4K2LA 4QUFA 5HKKA 4U673 2B2UA 4XQFA 2GJRA 2R3ZA 4RWSC 3VR3A 3S1NB 1EFID 1AP0A 3S14B 4H13C 3VR6A 2PYKA 3URYA 4EQPA 1UNSA 1V1PB 2WZPP 1T5XD 3D4WA 5ISRA 2HCCA 2XZLA 1SE2A 4F8MA 4G7OC 3BC9A 1A3UA 1PTOB 2R6GA 5KIXA 1PDQA 3GTQB 1L0YB 5E1FA 5JOBA 5HGTA 3DUZA 1J9OA 4R9WA 3NWSA 4G57A 3IFDA 1BCPB 4NKLA 4WFN3 4ZKCB 2Z1CA 5C4HA 2NTSA 4Y7NB 3G05A 2RQXA 4BA1I 4AYBB 1U4PA 3K0YA 3BVZA 2G9HD 5EQ0A 3A8JE 4QB4A 1CZWA 1Q1EA 1BPLA 3M3YB 1PFBA 3I4MB 1DJRD 4A3IB 4IUPA 1SJED 3OWFA 3A7AB 1LACA 1OXUA 1AN8A 2L12A 2SNSA 3DXJC 1W9XA 1KDAA 3A55A 1Y8PB 2EJFC 1ENCA 3L9AX 4C56C 2HDLA 3S9WA 1NBMA 2ZXHA 3VYRA 4RCNA 1EZ8A 3SK8A 1MD2D 3I4LA 3N6RA 1I6VC 1STAA 3C2PA 4KV6A 1YNJC 3WQZA 3SVMA 1ENFA 1BMFA 2JDIA 1EY4A 3PV0A 2KA7A 3HGBA 2VJJA 1D5XC 1HA6A 2NB0A 1CT1D 3SHLA 2B63B 1HTPA 1I4PA 3CRKC 3K57A 4BA2I 5M9OA 5D65A 2E2HB 4X3TA 1UD4A 3DHQA 4M1UB 2K5DA 1PKVA 2M2LA 2Q8IB 5JVG3 1VLYA 2EJMA 5K36G 3FRPB 2NYZD 1U4LA 3NHHA 3F2UA 4K8JA 2PZUA 1T5EA 4EGVA 4RHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BA1 I;  2A6H D;  3QG1 A;  2JE6 I;  3PUX A;  2D5D A;  3BG3 A;  3CRL C;  4JBW A;  3A8K E;  5BN5 A;  3VA7 A;  2O5I C;  2A68 D;  2DNE A;  2F1M A;  1GJX A;  3P20 A;  3WDN A;  1IYU A;  1CI3 M;  1H9J A;  4OO1 G;  1O7L A;  3TZU A;  2KCC A;  1H9K A;  3A8J E;  3W3A A;  4G7Z C;  1O78 A;  1Q1E A;  2AWO A;  3U9S A;  4IFD G;  2AUK A;  2NN6 H;  3ND8 A;  1FYC A;  5BN4 A;  2K7V A;  3AB9 A;  2V4D A;  3T53 B;  1GUN A;  3M85 A;  1VF5 C;  2BA0 A;  3A8I E;  1IYV A;  5A35 A;  3QJY A;  3PUZ A;  3D4R A;  3L7Z C;  1EWH A;  4I7Z C;  3PUW A;  3BDO A;  2E75 C;  4L8J A;  3PUY A;  4G7H C;  4KKT A;  2EVB A;  4KN4 C;  1Z7T A;  5C0X H;  3A7A B;  1LAC A;  1Y8O B;  1OXT A;  2PCF B;  2ZT9 C;  3LWU A;  1IW7 C;  1Y69 U;  3OPO A;  2E76 C;  1GUT A;  1OXU A;  1E2Z A;  1OXV A;  2K32 A;  4LK1 C;  3OOC A;  2DN8 A;  1DCZ A;  1H9M A;  2IT1 A;  3M7N A;  2K33 A;  1H9R A;  2BE5 D;  2A6E D;  2JXM B;  3DXJ C;  1K8O A;  2QF7 A;  3SE0 A;  1A6X A;  1CTM A;  3IFT A;  2E74 C;  2NN6 G;  1Y8P B;  3I73 A;  1BDO A;  2EDG A;  2L5T A;  3RLF A;  2EJF C;  5K36 H;  3FMC A;  3ND9 A;  2YYZ A;  2BA1 A;  3VR2 A;  4RCN A;  1OXS C;  1CFM A;  3M4Y A;  5JEA H;  3I4L A;  3LNN A;  1HQM C;  1TKW B;  3PUV A;  1SMY C;  2LMC B;  4KMU C;  2JEB I;  5C0X G;  1VDZ A;  1Q90 A;  5KND A;  2A6H C;  4KN7 C;  2D62 A;  1I6V C;  1VF7 A;  3OW7 A;  1B9M A;  2A69 D;  3MXU A;  1GUO A;  3N6R A;  3I72 A;  3SDZ A;  1E2V A;  2A68 C;  2AUJ D;  1YNJ C;  4KHZ A;  3EQL C;  1Z6H A;  3VR3 A;  4DK1 A;  2BDO A;  4TKO B;  4H0L C;  4HR7 B;  1VCI A;  3PV0 A;  4KI0 A;  3IKJ A;  2B8G A;  2DNC A;  1GHJ A;  3KLR A;  3MFY A;  2PNR C;  4H13 C;  3VR6 A;  2KA7 A;  3HGB A;  4OO1 H;  1GUG A;  3GD7 A;  1Q1B A;  1V43 A;  2D2C C;  1OXX K;  2B8F A;  3VR4 A;  3QIA A;  2JEA I;  1HTP A;  3CRK C;  4BA2 I;  2O5J C;  1V8Q A;  4DK0 A;  1H9S B;  1ZYR C;  4KKS A;  4JK1 C;  1HCZ A;  5BN3 A;  2NN6 I;  4G7O C;  4OGQ C;  1DD2 A;  1H9S A;  1LAB A;  1HPC A;  1GUS A;  1FR3 A;  1Y8N B;  2BE5 C;  2A6E C;  2R6G A;  3GQB A;  3H94 A;  4H44 C;  3FPP A;  1G29 1;  1E2W A;  1IW7 D;  1PMR A;  2Q8I B;  1GHK A;  4DNR B;  4DNT B;  1Q12 A;  3A7L A;  4GZY C;  2EJM A;  5KNC A;  5K36 G;  1TU2 B;  5KNB A;  1DXM A;  1YNN C;  1ONL A;  4LJZ C;  3T51 B;  1K8M A;  2EJG C;  5JEA G;  1B9N A;  4XTC S;  2PPB C;  4IFD H;  3NE5 B;  4XIG S;  1ZKO A;  4KKU A;  1QJO A;  2A69 C;  4IQZ A;  4PV1 C;  3VR5 A;  4TQU S;  1T5E A;  3D31 A;  3T56 B;  2CW0 C; 
#chains in the Genus database with same CATH topology
 1Q8I A;  4C2M B;  3J81 E;  1S72 B;  5IE8 A;  1YJ9 B;  4KD4 A;  4HJ5 A;  1G7R A;  1HR0 W;  2GPJ A;  5D14 A;  4CDD C;  1Q81 C;  2E5L L;  1EIG A;  2IX0 A;  2UUB Q;  2B7B A;  4K5V A;  1M4V A;  5KRU A;  5G3L F;  5F4O A;  2X69 A;  1G7T A;  3U9S A;  4IFD G;  2AUK A;  4OHJ A;  1C4Q A;  3T1H Q;  5A88 A;  2ZTE A;  2WPD A;  1W2B B;  2D3L A;  1JA0 A;  4XON A;  3QFC A;  2CH4 A;  4UAJ A;  2VNU D;  3D4R A;  5CV8 A;  2UXB Q;  3F1Z A;  1G7S A;  1BCP D;  4I7A A;  1ZYR D;  3E1Y E;  3KDF A;  2X85 A;  2PCF B;  4C0S A;  3CHB D;  1BBX C;  1U4M A;  1EWC A;  3S16 H;  3OAA A;  4YY3 Q;  1PH9 A;  4A3F H;  2VQF L;  1EP3 B;  4EQN A;  3A54 A;  1TWG B;  2MPM A;  2RC6 A;  2ZJP A;  1IBK Q;  2VBV A;  2VQE L;  5T1I A;  4IUQ A;  1KK2 A;  4XYQ A;  1QUE A;  4DV2 Q;  4IN3 A;  5FLX E;  3TS0 A;  1QGY A;  4LNQ A;  1PLF A;  1NNX A;  2PQE A;  3KLW A;  4L5R C;  4R8I A;  3CQZ B;  4H0L C;  5IYQ A;  1OGJ A;  1B3A A;  3W5O A;  3E0E A;  3U58 A;  1XNQ L;  2K5H A;  3CCJ A;  4UZF A;  3MVV A;  3A56 A;  4JI8 Q;  4OWX B;  1AE2 A;  4CJ0 B;  1Q86 D;  1HNX Q;  4XD7 A;  3H0G B;  1V8Q A;  4LAA A;  1N0V C;  1RIP A;  5EAY A;  3HS0 C;  1EIF A;  1H9S A;  4GKK Q;  1JE4 A;  1QNK A;  4PGO A;  4LW1 A;  4ALP A;  1R5N A;  1V0E A;  3VNU A;  1B7Y B;  2F0L A;  1ILP A;  3CP2 A;  3Q3A A;  4DV0 Q;  3RZO H;  3G4S B;  3FPP A;  2F0U A;  2KHI A;  3ONY A;  3I4N G;  2I07 B;  3BJU A;  3SR1 A;  4I65 A;  3J7A F;  2EY1 A;  3EN2 A;  5CBA E;  1FGU A;  2G5D A;  3RLO A;  2WAC A;  2UXD Q;  1CQX A;  1KDB A;  3C46 A;  2K5W A;  3MZ5 A;  3AVU A;  2LXJ A;  1DGS A;  2CKZ B;  4IFD H;  2X6Y A;  4UZU A;  1WTR A;  3VR5 A;  3CP8 A;  1IZ6 A;  2QGQ A;  1Y0R A;  3E9H A;  2K5V A;  3J7Z C;  2E2D C;  3I7F A;  4NB3 A;  2C5H A;  2AQ1 B;  4DAM A;  2Q2U A;  5IGB A;  1KZL A;  3QG1 A;  4QGU A;  3TQY A;  2VUM H;  2EY6 A;  1H85 A;  2K04 A;  4IO9 A;  1HNW Q;  2L0C A;  1KAA A;  2A68 D;  3KF6 A;  4DV1 L;  1UD2 A;  5JPM C;  1DYQ A;  3A0J A;  4PNY A;  1H9K A;  2RF4 A;  3Q0A A;  2ZIT A;  4RGT A;  1T9H A;  4ULL A;  4DF7 A;  2Y0S B;  4ZK9 B;  5GAG C;  4II2 A;  3CCS B;  3HOW G;  4RD2 A;  1W0J A;  3KDF B;  1EUJ A;  1PZK D;  3OFN A;  4L8J A;  2OXP A;  5J3O A;  3WNB A;  2ZT9 C;  4NCN A;  2NVX H;  4LF5 L;  1GUT A;  2E5L Q;  1XQB A;  1YHB A;  4ZAI A;  2EFG A;  2BM0 A;  3A3G A;  4OL7 A;  4JI7 L;  1T6X A;  1R4Q B;  2F0K A;  3S15 H;  2QF7 A;  1X3Q A;  1A6X A;  3S16 B;  3IFT A;  1HFG A;  2A74 C;  1HA5 A;  3FMC A;  4A3F B;  2XND A;  1BX0 A;  1QB5 D;  1VMC A;  1N8R D;  4DGZ A;  1LT6 D;  2X8K A;  2RVL A;  4IUT A;  4RHR A;  4PZ8 A;  3TN2 A;  1VQO B;  1LTR D;  2NVY H;  3G6E A;  2N49 A;  4MTK A;  3CKI B;  3U9O A;  5JJK A;  4BXX G;  1VLO A;  4TMW A;  4GNX A;  4RMF A;  3KYH C;  2Z6B D;  3I72 A;  4GS3 A;  5GRO A;  4A3L G;  1F2M A;  5M5X B;  2VQF Q;  2HDN B;  4EH1 A;  1Y1W G;  1U0L A;  4OPS A;  2BDO A;  4X65 L;  3TRZ A;  3CC2 A;  3AVW A;  4OON A;  4YEJ A;  5BSX A;  3CCJ B;  1Y14 B;  3V96 A;  2I46 A;  3OWE B;  2VQE Q;  4ME3 A;  5M3F B;  2OWO A;  4GN5 A;  2C5B A;  3OW2 A;  2F43 A;  2JEA I;  5I9O A;  2RCN A;  1QX4 A;  1LTS D;  1FDR A;  1H9S B;  2QCP X;  3EVQ A;  1D8L A;  2ZTD A;  1GKH A;  2PLF A;  2ZL5 A;  4P75 A;  2F0P A;  1GUS A;  2NWG A;  1JOR A;  2BE5 C;  2BGJ A;  2JJ1 A;  4QUZ A;  3GO5 A;  1M90 C;  2JYO A;  2YU9 B;  3S1Q H;  5D3D A;  4M2L A;  1RHP A;  5NUC A;  1TVC A;  1RTO A;  4GQN A;  4QVJ A;  2JA5 H;  3C2Q A;  4A3J B;  3RZO B;  1PYS B;  4AH6 A;  4L6T B;  4DR3 L;  1DOL A;  1YJN A;  1V0F A;  1DXM A;  1K9M C;  3PA2 A;  4IPG A;  1XWE A;  5IP9 H;  3S1R H;  1H42 A;  3CPX A;  1P16 A;  2JA9 A;  2OBS A;  4XIG S;  1XFO A;  2C4T A;  1V5V A;  3ITP A;  1SNO A;  1EWY A;  5GAE C;  3T1Y Q;  5ELC A;  1TII D;  3KF8 A;  3M4O H;  3E9I A;  3ULP A;  3KF6 B;  2GN5 A;  5J22 A;  2VZL A;  1KQS A;  1QH0 A;  1BUV T;  1HZ9 A;  1TR5 A;  2SEB D;  2JA6 B;  2HCJ B;  3I90 A;  1I4H A;  2N3S A;  4QHY A;  1Q7Y D;  3JAM c;  1CI3 M;  1GAW A;  2VUM B;  2R7D A;  4IPD A;  3C3L A;  3Q39 A;  1I4R A;  1PH2 A;  1JMC A;  2IY5 B;  2CHB D;  4RA8 A;  3M7G A;  3IRB A;  1PZJ D;  2KUM A;  1EY6 A;  1M1K C;  5HZB A;  2C35 B;  3B82 A;  4MHE A;  5CYU A;  1CHP D;  1SYE A;  4XLE A;  1E1O A;  2EVB A;  5IIF A;  1E24 A;  1YHQ A;  4IFD J;  2DET A;  1X3P A;  4AYB E;  2CW0 D;  3NEM A;  5M5Y H;  4LBY A;  3P75 A;  4RJL A;  4FWT A;  4KHP Q;  2DN8 A;  3CME A;  4DV1 Q;  2PNH A;  3GP7 A;  4DV5 Q;  5JJI A;  3BVM A;  1Y1W H;  4Z4Z A;  3E0J A;  2NVX B;  1SNQ A;  1WTO A;  1S5E D;  3CCV A;  4X3S A;  3WOF A;  1TWH H;  4IW3 B;  2VNI A;  1Q8K A;  1P4M A;  4U9U A;  3ULJ A;  3S15 B;  3ZPN A;  3A35 A;  2HDM A;  2SOB A;  4IUU A;  1YNN D;  1D6E C;  5H5J A;  4AYB G;  1QUF A;  4B9X A;  5JEA H;  2UUC L;  3G6E B;  1V1O A;  1TKW B;  1X32 A;  5KEE A;  1F20 A;  4GNX B;  1EWI A;  3E20 A;  4G7W A;  3PUM A;  3LO8 A;  2Z9H A;  1CKN A;  4Z4W A;  4IUN A;  3H3V I;  4K5X A;  1I4X A;  3CC2 B;  3JQQ A;  2NVY B;  1Z6H A;  2PIA A;  1Q82 D;  2ZXR A;  4M4S A;  1XTC D;  3PF5 A;  2L55 A;  1N36 Q;  3VO1 A;  2F3W A;  3F2D A;  2Z6K C;  2DNC A;  3K6O A;  3I4M G;  4Q5V A;  1EFT A;  4K0K L;  2ZZQ A;  4A3I G;  2F0O A;  2RHS B;  4A93 B;  1V43 A;  2L15 A;  3NBH A;  3LQE A;  4B3M Q;  4OEM B;  4OWW B;  4ABN A;  4ZUI A;  2N8N A;  2KED A;  2F0J A;  1EQV A;  3I55 A;  1UWV A;  3A8I A;  4LF7 L;  4UP9 A;  3S1N H;  2Z4H A;  1Y8N B;  4IAL A;  5LMU L;  2KEC A;  4B3S Q;  4RDK A;  5TY0 A;  3A5Z B;  2WJV A;  2PMD A;  3S14 H;  1RKN A;  4WZT A;  1YVC A;  2ZZG A;  2YWF A;  1NR2 A;  4XYO A;  4J15 A;  1YJN B;  4XKV A;  4BBS H;  1ML0 D;  3FVQ A;  4F7D A;  4B48 A;  2C5C A;  2FXQ A;  1QG7 A;  4CQJ A;  1WU8 A;  3OZU A;  5J1Z A;  3WNC A;  4KJN A;  2F0F A;  1J6Q A;  1E0B A;  2IW3 A;  4QMG A;  1SYC A;  1PTO H;  2DGY A;  3KF8 B;  2RDG A;  5DM7 3;  1WFQ A;  3HOY B;  1A8P A;  1KQS B;  2BF4 A;  3CCM A;  1UUP A;  1MSH A;  3BH4 A;  1B70 B;  4JV5 L;  5A2Q E;  1EYA A;  1S5B D;  2O5I C;  3A8K E;  4P6Y A;  1AEX A;  2B63 G;  5M5W H;  4YCW A;  2C9O A;  4BS9 A;  2N78 A;  5E4X A;  4DR3 Q;  3I56 B;  4YAL A;  3NTI A;  4X7C A;  4G7Z C;  5EBC A;  1VQ8 A;  2BH8 A;  3Q6R A;  1GM5 A;  1CSQ A;  4TN1 A;  1PH4 A;  1S4M A;  5D3I B;  4NBS A;  3K7A H;  2R93 H;  4LBV A;  4NXN L;  1YHQ B;  3AQQ A;  1WOP A;  3L7Z C;  1EWH A;  1K3R A;  3HG9 A;  4U68 A;  3DLL A;  4G7H C;  1EFC A;  2XWB B;  3CME B;  2R7F A;  4YWK A;  4EVO A;  4WZL A;  5DEH A;  1G8Z D;  3D4D A;  3SGI A;  1F2Y A;  2KVM A;  4B44 A;  3M7N A;  2WP8 J;  4QUC A;  4L5S A;  3CCV B;  3NSW A;  5M5Y B;  1LLR D;  3W2D A;  2E74 C;  2XNA C;  1IKM A;  4LMQ D;  2I5L X;  1KK1 A;  5FO8 B;  2J4X A;  2D9U A;  5KW9 A;  4ZQ3 A;  4R4T A;  3CMM A;  2ZXP A;  5COR A;  1TWH B;  2NTT A;  3KJO A;  1SMY C;  4Z4Y A;  2I0Q A;  2ATW A;  1TVX A;  1CKN B;  2A6H C;  1SND A;  2D62 A;  5J35 A;  3MXU A;  5GQO A;  4ACB A;  2ZZE A;  2AUJ D;  2K4K A;  2VJI A;  4QVA A;  4RDJ A;  3AVX A;  4BY7 B;  4RLZ A;  2HCI A;  1R9T B;  4KI0 A;  1WJJ A;  1VQ7 B;  4RCY A;  4RPD A;  4JVZ A;  2QGG A;  2XGT A;  1GHJ A;  2BH2 A;  3HOV H;  2OF1 A;  1B50 A;  3NBH B;  1X55 A;  5T1G A;  3GD7 A;  2UUC Q;  4P26 A;  3HRZ C;  1D1I A;  1UEA B;  3I55 B;  3L2P A;  4OX9 L;  1J8I A;  1EP1 B;  4R4O A;  2V7T A;  4B3R Q;  1KXL A;  1JJC B;  4QIW B;  5BN3 A;  1RQR A;  3CCL A;  5FNZ A;  4PG3 A;  1AIP A;  3VA5 A;  3U4Z A;  3OIP A;  3UI2 A;  1FNC A;  2QTZ A;  4NW2 A;  1VS0 A;  2ZTC A;  1PMR A;  2L11 A;  2J7K A;  2EXD A;  2WIN B;  2F52 A;  3M9B A;  2ZJR A;  3M4P A;  4K0K Q;  1X3F A;  5IT9 c;  4KHV A;  3K5M A;  1K73 C;  3CCR A;  3GVJ A;  2EJG C;  1PXU A;  3TP5 A;  2X6X A;  3FEW X;  1NRK A;  1YBY A;  1EL0 A;  4LF7 Q;  4BBS B;  2E2H H;  1WSR A;  2A69 C;  2I5M X;  4OOS A;  5I2X A;  3CCM B;  3D31 A;  4YCU A;  4P74 A;  1VQI A;  5LMU Q;  3ASS A;  4P1V A;  3K58 A;  5CGK A;  1XNR L;  4YHH L;  2I1L A;  2JN9 A;  2QEJ C;  2B7C A;  1WTH A;  2K6A A;  1HHV A;  1F9S A;  3SK5 A;  2PZT A;  1WVL A;  2W6J A;  1VQ8 B;  5F4J A;  3H0G G;  1G7C A;  1D2B A;  1HUN A;  5ELB A;  4XLC A;  1U9R A;  1Z47 A;  1AFP A;  5M5W B;  3KEW A;  2UUB L;  1DAR A;  4YXW A;  5BN4 A;  3ERO A;  4ACA A;  5LMZ A;  1VF5 C;  1ET9 A;  4I7Z C;  2Z4I A;  4UAI A;  3BDO A;  1VQD A;  4C2M H;  3F2B A;  3K7A B;  1HNZ L;  4JV5 Q;  3NEN A;  4JI6 Q;  2R93 B;  2C4U A;  1EQT A;  3HOU B;  1GO3 E;  3J80 c;  2J7Z A;  2EYL A;  1WPC A;  2DYI A;  1A0I A;  5CV6 A;  4A3B H;  3P7J A;  2OQK A;  1HA3 A;  5IYW A;  5FA6 A;  3Q22 A;  3NUC A;  3LWE A;  1KTV A;  3AFQ A;  3IAY A;  1HXY D;  3WND A;  4MN3 A;  5EKL A;  2Q2I A;  3GVK A;  5EPL A;  4XOP A;  4A3K G;  3T4A C;  4P12 A;  3MEF A;  3BCF A;  1PFS A;  2Y0S E;  4NXN Q;  1PJ5 A;  3NEL A;  1OXS C;  2X3U A;  1LTI D;  1JB3 A;  1GVH A;  1EEF D;  2QMU A;  1HQM C;  1YNX A;  3OHX C;  3GTP H;  1UEB A;  4DR4 L;  3MWY W;  3P26 A;  2DCU A;  3DM1 A;  4DR1 L;  3LQ6 A;  1IL2 A;  4DV2 L;  3PO2 H;  4K1X A;  3SDZ A;  1N33 Q;  4WOR A;  1TWG H;  1BQE A;  1YZ6 A;  3QO2 A;  1IKL A;  4HR7 B;  2ZJQ A;  1ZM4 A;  3AGP A;  2Y0S G;  4JG2 A;  2Z6K A;  2B8G A;  4NMZ A;  5E3F A;  2CH4 W;  1WTV A;  3GVL A;  5HZA A;  2B2T C;  3ULL A;  3N52 A;  1PRT F;  4DA2 A;  4OOX A;  4NDX A;  4OO1 H;  2WII B;  1TS4 A;  4LUO A;  2VW9 A;  1QUQ A;  1VQ5 A;  1OXX K;  3OSO A;  1NR4 A;  2B29 A;  5EPK A;  3HOV B;  1VQL A;  4XM3 A;  1PYB A;  2Z6B A;  3CAM A;  1HNX L;  5FKA C;  4B3T Q;  1UD3 A;  4QCL A;  1CK1 A;  3CQZ H;  1VQN A;  4N3G A;  1IHM A;  4CKE A;  3H94 A;  4G4K A;  1COW A;  2IX3 A;  3I2Z A;  4A3F G;  1LM0 A;  1IW7 D;  4Z4R A;  3H9N A;  5JBQ A;  2JN4 A;  1B3Q A;  1U5K A;  4RDL A;  1DOM A;  1QNU A;  1X65 A;  5KNC A;  4AQY Q;  3WXM A;  3CCR B;  1SYG A;  4JI5 Q;  1K8M A;  1TY0 A;  3HOZ H;  3VMF A;  4X8I A;  3TRE A;  3HOW H;  3CCQ A;  2UXD L;  3QFS A;  2AKW B;  1SBB B;  4AF6 A;  4IJH A;  1VQ9 A;  4ZCK A;  4DXF A;  3V2T A;  3G71 A;  1TS5 A;  4MYU A;  5M3F G;  2YTX A;  1O7Y A;  3J81 L;  3W2G A;  4X3K A;  4YAF A;  1KD1 D;  1XMQ L;  4AC9 A;  2WKC A;  3GTO H;  1HNW L;  2MFI A;  4OP7 A;  2FX3 A;  4QV2 A;  5BR8 Q;  2HLD A;  3MAQ A;  2AWO A;  4DAY A;  3JC6 6;  3Q23 A;  3CXC A;  1E62 A;  2X6W A;  1VQJ A;  2EPB A;  2F0Q A;  1EIH A;  2H4O A;  1X3E A;  3RZD B;  3GV6 A;  2UU9 Q;  4RHS A;  4TMX A;  1E64 A;  4R1J A;  3BDL A;  1SXT A;  3OEE A;  2QA4 B;  2VNH A;  2WAQ E;  4FN5 A;  2YTV A;  1OXT A;  3LWU A;  1BJK A;  3PIP A;  2P3M A;  3QR8 A;  2IT1 A;  3MEH A;  5HUR A;  1QIL A;  2A6E D;  4QY7 A;  2L4N A;  5FO7 B;  2MNA A;  2XNJ A;  1HFN A;  4A3B B;  3JQP A;  1PTO D;  1VQH A;  2B3G A;  3KLS X;  1JWS D;  2R7Z B;  1IBL L;  1KHI A;  4POG A;  4UPA A;  1MHW C;  2YYZ A;  3U4V A;  3K5L A;  2K1B A;  2WAQ G;  2K5Q A;  3J81 k;  2Z8L A;  5IGG A;  1I4Q A;  1HNZ Q;  3BY1 A;  1D2E A;  2KQ3 A;  4X66 Q;  2PMZ E;  5KND A;  1LV9 A;  4KN7 C;  5FLX L;  1PVO A;  2CVR A;  4IFD I;  4B4D A;  3GTP B;  1Q9S A;  2NZO A;  4P72 A;  2VUM G;  5IYP A;  4KHZ A;  5THX A;  4NPS A;  4P2N A;  3ASQ A;  1KC8 D;  1Q46 A;  3BZK A;  4DXG A;  3PO2 B;  3GTL H;  5DM6 3;  1S40 A;  1KJZ A;  1I50 B;  2XRS D;  5C4Z A;  2D0O A;  3J81 c;  4FXK C;  1VQL B;  1I3Q H;  3A8J A;  1OHH A;  3RMH A;  4RD1 A;  3PMF A;  2PZW A;  5DAU A;  4DR4 Q;  1B2T A;  3I3C A;  4DR1 Q;  3CC4 A;  1DD2 A;  4ILW A;  4X05 A;  3STB D;  5M5X H;  2BMW A;  4E0F A;  2BCO A;  1BBU A;  1EFU A;  3QFR A;  1D1N A;  4V19 0;  2PQA A;  3FP9 A;  4LF8 Q;  5ELO A;  5IK2 A;  4H44 C;  4HE5 A;  1AMO A;  4TT3 A;  5C5L A;  2L1B A;  3R2T A;  1JA1 A;  4FXD A;  1I4G A;  1WSV A;  1Q12 A;  5M3F H;  4LBW A;  1XTD A;  2K05 A;  4GZY C;  4Y52 H;  3U6B A;  2WR8 A;  1JC7 A;  1H8E A;  1K8G A;  2XNC A;  2NBF A;  1LT5 D;  5DS0 A;  3T51 B;  2A73 B;  3CCQ B;  1KK0 A;  1PH3 A;  3PQI A;  2F0V A;  1VQ9 B;  2XN9 C;  1QZH A;  1O80 A;  1M8A A;  2GK6 A;  2F3I A;  2YU9 H;  3G71 B;  1KAB A;  3HOZ B;  4HTH A;  3DWQ A;  1UE1 A;  3T1Y L;  1LYL A;  3GDE A;  3ONU A;  4RD4 A;  3QFT A;  4A93 G;  4A3J H;  4HIK A;  3UDG A;  1GJX A;  3WDN A;  1HR0 Q;  3B78 A;  2PI2 A;  1LTT D;  1WTQ A;  4DAY B;  3CXC B;  3LVB A;  1SKY B;  1JJ2 A;  3GTO B;  1FYC A;  3T53 B;  1TWF H;  5CV5 A;  2HIX A;  1JCK B;  5JJZ A;  1SM4 A;  3PUZ A;  2IWH A;  5EKK A;  1RD9 D;  1JOQ A;  1CNF A;  2CW5 A;  4CJ2 C;  2JA6 H;  4X7E A;  2TMP A;  4HAE A;  3H15 A;  1XMQ Q;  2D74 A;  1D8T A;  2AQ3 B;  1LT4 D;  1ASY A;  4R4Q A;  4TMT A;  1DCZ A;  5COY A;  2JA5 G;  4DKA C;  4KHP L;  3FPU B;  1CTM A;  3D6W A;  2QEX A;  2NN6 G;  3T16 A;  2C77 A;  4DV5 L;  5IP9 G;  3PIP 3;  5CV4 A;  1IJE A;  4FXG C;  2NZH A;  2E2I H;  3HOY G;  5A89 A;  2UUA L;  5I6Y A;  3D26 A;  4LF9 Q;  2XIW A;  1PH7 A;  2XRQ D;  3MMP A;  2JEB I;  5M3M H;  1BBW A;  1N06 A;  3K81 C;  4A3G B;  5FO1 A;  4F88 A;  1IL8 A;  1NAP A;  4J1M A;  1VQA A;  1AZP A;  3L0O A;  2SDF A;  1GOZ A;  3K5O A;  1VJS A;  2WYR A;  4J0Q A;  1GVP A;  3IKJ A;  1WOR A;  1UMK A;  1IBL Q;  1K8A C;  1IBM L;  1FNU A;  2B2T A;  1B2R A;  2A19 A;  1N36 L;  1GUG A;  4X0C A;  3DWA A;  3GTL B;  1YIT A;  3ZUG A;  2DJF C;  2L9H A;  5IGF A;  5KNL A;  3MC0 B;  4X62 Q;  1Y1V H;  1ZYR C;  3ZC3 A;  3W2E A;  2KVO A;  1GJR A;  4B3M L;  1I3Q B;  1FND A;  4CJ1 B;  2PQA B;  1CNE A;  2N88 A;  1FJG Q;  3SJZ A;  4RD3 A;  1A63 A;  3H3V C;  2KHJ A;  4WZK A;  2Q6I A;  1E2W A;  2ZL6 A;  1G6P A;  1GHK A;  5ELD A;  3KK7 A;  1CKO A;  2MUY A;  4GLV B;  5IYN A;  4A93 H;  4B3S L;  1GXD C;  1J5E L;  2DER A;  1PH5 A;  2BPO A;  5IYC G;  3K7U C;  2J0T D;  1CQV A;  4HSP A;  1STH A;  2EOT A;  5I2Y A;  1X6O A;  5JEA G;  2JJ2 A;  1D5M C;  4BPR A;  1C48 A;  4QIW E;  1PRT B;  3PVD A;  4POF A;  3EA6 A;  2AWN A;  4MNO A;  4XT1 B;  2GJK A;  1G2T A;  4RD6 A;  1AE3 A;  1QFJ A;  1G51 A;  4LWC A;  3HAG A;  3VA7 A;  2DNE A;  4F7X A;  1K83 H;  4DR6 L;  1IYU A;  3TZU A;  1TT2 A;  2YTY A;  2VBS A;  4JOI A;  1Q86 C;  1BNZ A;  2NN6 H;  5FIU A;  1VQE A;  4BBR H;  1SMX A;  2IHE A;  4TRD A;  3M85 A;  2H1E A;  4A3D B;  5IGC A;  3HOY H;  2XTI A;  3EJI A;  3QJY A;  1E79 A;  3DMU A;  1NCV A;  3NP8 A;  4XQQ A;  4R8N A;  1EXM A;  1NY4 A;  4K2K A;  1TWF B;  1AH9 A;  1NSN S;  2KHS A;  1FL0 A;  1U4R A;  1E1T A;  5CC4 A;  3CMA A;  3CW2 A;  3UDI A;  3E6Z X;  2DY1 A;  2UXC Q;  3CCE A;  2QEX B;  1BCP F;  3AMU A;  3CU7 A;  3BYT B;  3JAM i;  4HIZ A;  3K80 C;  1ZM3 A;  2ZBV A;  1YHA A;  2ZM6 L;  4BBS G;  5DSZ A;  1F2Z A;  2DIE A;  1FRQ A;  2F0N A;  3NQT A;  5TR9 A;  3RLF A;  2Q8R E;  3W5H A;  2V7U A;  2FJ2 A;  4LUV A;  3U6K A;  2KEN A;  2OEO A;  4Z4T A;  5L46 A;  1XYI A;  4BY1 B;  2XSC A;  1JR0 D;  5KSW B;  1K28 D;  2LMC B;  4KMU C;  1L0X B;  4C1N K;  3BQJ A;  1LTG D;  4PC7 A;  2E2I B;  1VQ4 A;  1FRN A;  3ISX A;  2K75 A;  5FJ8 G;  4JI1 Q;  1SFO B;  2A68 C;  3MXN A;  4B47 A;  5M3M B;  2OQ0 A;  1N0U A;  3AVT A;  3FJO A;  1W0K A;  4DK1 A;  3S24 A;  3PA1 A;  1Q3L A;  4GN4 B;  1STG A;  1NUC A;  4C3J H;  1YIT B;  5J3B A;  1RCV D;  2UUA Q;  1ESR A;  1EFW A;  2R93 G;  5IYC H;  2B5O A;  1MGS A;  1SYB A;  1O7I A;  1ESF A;  3AYH B;  2N55 A;  5FOB B;  1UE6 A;  2DJG C;  4BWG B;  1STN A;  4BY7 H;  4G7X A;  3LX0 A;  4KK7 A;  4ZKB B;  1C7Y A;  1EFR A;  1Y1V B;  4P73 A;  4PZ7 A;  1R9T H;  4B3R L;  1I6H H;  1W34 A;  1FR3 A;  3G7L A;  3CES A;  2E8G A;  2LZJ A;  2JSO A;  3SEJ A;  2HUG A;  1Z9F A;  4J8Q A;  4UP8 A;  5C5M A;  2VB2 X;  1G29 1;  1ZUN B;  2M5S A;  4JC0 A;  5IGD A;  1K3B C;  1IBM Q;  4Z4U A;  2GK7 A;  3UDF A;  4LFB Q;  3VDY A;  2D9R A;  5I6W A;  3HZX A;  2DY7 A;  1BR9 A;  1N8R C;  1BOS A;  3OW2 B;  1E3Z A;  3NTK A;  1UE5 A;  4N9P A;  1EU3 A;  3GTK H;  2C2W A;  4DR2 Q;  2QIL A;  3MCA A;  4IQZ A;  1QGZ A;  3W2F A;  1HH2 P;  1SE8 A;  3KBG A;  2CF4 A;  1FNV A;  3MHB A;  4PMB A;  2R92 H;  3TS2 A;  1QFY A;  4E6I A;  3CPF A;  4G1B A;  2K52 A;  1RF2 D;  5GAD C;  2D5D A;  2Q2T A;  3NXW A;  3BG3 A;  4WZE A;  1J5E Q;  5A2Q L;  3RY8 A;  4XQN A;  1YJW A;  4C43 A;  3BYY B;  2F1M A;  5I4D A;  3HOV G;  2F0T A;  3CCU A;  1SJH D;  2F0D A;  4YWM A;  4TSS A;  3TBI B;  1LTA D;  4LF6 Q;  4OIK A;  3I4O A;  2QDX A;  1K83 B;  1N07 A;  3AB9 A;  1K73 D;  5H1S E;  3AVY A;  5F4M A;  2NV4 A;  4LUZ A;  3R8B A;  4DAV A;  3BCD A;  1FNM A;  2CRV A;  5JAV A;  3F2C A;  3NQI A;  4KKT A;  4LBZ A;  3CMA B;  4TMV A;  4BBR B;  3RN2 A;  4ME5 A;  4N8X 1;  1QZG A;  2FIN B;  5FJ8 H;  3I91 A;  1Y69 U;  4FF4 A;  4JI6 L;  4DR6 Q;  3AVV A;  1QG0 A;  4NP5 A;  3WYA A;  2VB3 X;  1KAW A;  3UE0 A;  1I94 Q;  4IOC A;  1MJE A;  2PW5 A;  1U2R A;  1STE A;  4ZUJ A;  1E3X A;  1BDO A;  2EDG A;  4MIU A;  4X7D A;  3R3O A;  5TRD A;  1F9R A;  1MAB A;  5GV7 A;  1EYD A;  4RAU C;  1STB A;  4FYD A;  2CK3 A;  2YWE A;  4QFM A;  4P25 A;  1VQ4 B;  1QGA A;  1DG1 G;  5C0X G;  3HOU H;  2JIZ A;  3OW7 A;  2YWH A;  3MXN B;  4DV4 Q;  2F0G A;  5CMD A;  4Z1M A;  1EY5 A;  1WCM H;  4HED A;  1JIC A;  1VQM A;  1Q7Y C;  1JT8 A;  4H7B A;  1A15 A;  4P2C B;  1VCI A;  1RDP D;  4II3 A;  2ZM6 Q;  4DUZ L;  2ZL7 A;  1N33 L;  3IL8 A;  1XMO L;  1AZQ A;  1LT3 D;  5BSY A;  2XZO A;  4C3I H;  3TDQ A;  1OTC A;  4XOT A;  3H3V H;  4C3J B;  5LMN W;  1L1O C;  3Q24 A;  1FVI A;  5FLM H;  4RH6 A;  2DY8 A;  3AEV A;  4HCE A;  4RFB A;  1HQR D;  4OIJ A;  4A3B G;  2D3N A;  3WY9 A;  2R7Z G;  4B3T L;  3ERS X;  4DK6 C;  3I70 A;  4R4I A;  2O2L D;  3PIO A;  1I6H B;  1GO2 A;  1E1R A;  3HFZ B;  2NUC A;  4HSV A;  1YLO A;  3R6J A;  2RBM A;  4AIM A;  4OXP A;  5ELE A;  3V76 A;  3BY2 A;  2F0H A;  1YNN C;  1ONL A;  3QWN A;  1NJI D;  1QE6 A;  1L2F A;  5A8A A;  4AQY L;  3VNV A;  5FO9 B;  4JI5 L;  1ZKO A;  4NXM L;  4P9S A;  4XNF A;  4PV1 C;  1PFN A;  4AVZ A;  2IHF A;  2F0I A;  3TZD A;  4FNF A;  4ZCI A;  2XEX A;  1UE7 A;  3PO2 G;  3GTK B;  3WOE A;  5JEA J;  1SAP A;  5IT9 E;  1NBW A;  1YX2 A;  3HEJ A;  1BLI A;  5IP7 H;  5CV7 A;  1CA6 A;  2R92 B;  5BN5 A;  3RN5 A;  1AW7 A;  3CCU B;  1YNJ D;  3JU4 A;  4PZ6 A;  2EQS A;  3BZC A;  1PH8 A;  1ET6 A;  4OO1 G;  3AST A;  1LO5 D;  4KD3 A;  4ZLT F;  3ZIA A;  1O78 A;  4DV6 L;  5KYL A;  5BR8 L;  1PA6 A;  5AJ3 L;  2R61 A;  4WRD A;  1CKM A;  1WD1 A;  4XLH A;  1MIU A;  1JOK A;  4Z9C B;  1A8V A;  4M53 A;  3AGQ A;  2ID0 A;  5C0X H;  5DLQ E;  2UU9 L;  1PRT C;  2E76 C;  2F3V A;  4TMZ A;  5DN6 A;  3C1F A;  1ICF B;  3OOC A;  5IGE A;  4ROX A;  3H6M A;  5EKI A;  3B8H A;  3GTJ H;  1SLJ A;  4QF4 A;  1STY A;  1WDT A;  1QVG A;  3O13 A;  2B2V C;  1XPO A;  4XLA A;  4C3H H;  3W5V A;  4A3E B;  1PHJ A;  1CA5 A;  3RZD H;  3HOZ G;  1N9W A;  1HUM A;  2VL6 A;  4P71 A;  1T6Y A;  1BXT A;  1PH6 A;  1S0U A;  4FO2 A;  3J80 E;  1LUZ A;  1ZEQ X;  3EFX D;  1TS2 A;  2HQL A;  5LMN Q;  1PYW D;  3L3O C;  2R9V A;  1VDZ A;  1CHQ D;  2OK8 A;  1C9O A;  1QVC A;  4A76 A;  3S2H B;  1VQM B;  4OEL B;  4X66 L;  3J80 i;  1HZE A;  4Q7J B;  2R7Z H;  2VYQ A;  2OBT A;  2VBT A;  4TSF A;  2E1B A;  1JWU D;  1R5O A;  1WCM B;  1Q81 D;  1ELO A;  1B53 A;  3G48 A;  2NVQ B;  3A1P A;  1Q1B A;  1IXR A;  1S5F D;  1WOC A;  3BZD B;  3WWV A;  1T6Z A;  3S2D H;  4C3I B;  1X54 A;  2GJP A;  4KKS A;  3ERQ A;  2E2J H;  4YAW A;  4UHV A;  2V7Q A;  4DQK A;  1DDG A;  5JVH 3;  1VHO A;  5E6T A;  3GTG B;  1WTX A;  3OZW A;  4DUZ Q;  1R5B A;  2RSO A;  2VNJ A;  1VQK A;  1I50 H;  1ILQ A;  1XMO Q;  3LGJ A;  3NPP A;  1WOS A;  2Z0S A;  5C6A A;  4LF8 L;  5I9P A;  2F03 A;  3RD4 A;  4ZYS A;  1PJ7 A;  2RDH A;  5EPJ A;  4GOP C;  4YEL A;  5FO0 A;  1EIY B;  3BDC A;  4UY8 C;  2NVT H;  5C44 B;  1FX0 A;  2KJX A;  4A3G G;  1TWA B;  3PCO B;  4NNJ A;  1NB0 A;  3PIO 3;  3NE5 B;  4KTA A;  1QJO A;  1W2B A;  4GN3 B;  3CCL B;  4FF1 A;  1B44 D;  3HOX H;  4TQU S;  1BO0 A;  2QKI C;  3QOL A;  3T56 B;  3GIR A;  4HE6 A;  3PUN A;  4ZGN B;  2JE6 I;  3PUX A;  4LFA Q;  3ZZU A;  4CDC C;  3D0F A;  1EY9 A;  5C3E H;  4PC3 A;  4YHB A;  5F2D A;  2OK7 A;  5C4X H;  1RJT A;  5FK9 C;  1EEI D;  3P20 A;  4JBM A;  2HQE A;  1A2T A;  2JA7 H;  1KNA A;  2LKV A;  2XWJ B;  3EBE A;  2F4V Q;  4HMJ A;  3BVG A;  4RKL A;  4O42 A;  4YIJ A;  3OTO L;  1HR0 L;  3ND8 A;  4NXM Q;  2V4D A;  2CQO A;  3MA2 B;  1EY0 A;  1IHZ A;  1F9P A;  1QOH A;  2KCN A;  1XJV A;  3FDT A;  1S5C D;  4JPB W;  1ICW A;  3K0X A;  1II3 A;  1V1Q A;  3PUY A;  4IPH A;  1FNW A;  4CKB A;  2C78 A;  3HKZ B;  3TP8 A;  4FF3 A;  1O7Z A;  3VYS A;  3PEN A;  1JB9 A;  2Q8T A;  3ICE A;  1H9M A;  2PI2 E;  4G6I A;  4IJL A;  4CHT B;  1QVG B;  2WFW A;  4DNI A;  3PO3 H;  4MYT A;  1KLU D;  4DV6 Q;  1VQ6 A;  3H91 A;  4PMW A;  3GTJ B;  1EOV A;  5AJ3 Q;  2B2W A;  1QVF A;  4JOI C;  1WTW A;  1WI5 A;  1EY7 A;  3VR2 A;  1E22 A;  2X6L A;  2JA8 B;  4C3H B;  5C3W A;  1CFM A;  3M4Y A;  2QTL A;  2FHT A;  1BF4 A;  3OIQ A;  3LNN A;  5E4W C;  5FL7 A;  5GV8 A;  3S1M H;  1Q90 A;  3E5S A;  4ZV4 A;  3E3X A;  1VF7 A;  1L0W A;  4LF9 L;  1JJG A;  4B3X A;  1GUO A;  1JOO A;  4XT3 B;  5EBD A;  4A3J G;  1BQQ T;  4RGN A;  4DV7 Q;  3ASP A;  3CW2 C;  1HZA A;  1SSO A;  5C0X J;  4TKO B;  1OB2 A;  3P1H A;  1PH1 A;  4A3D G;  2D0P A;  1WOO A;  3Q38 A;  3V7A A;  3MFY A;  2PNR C;  2K5N A;  2RCF A;  1A62 A;  2H5X A;  1OB5 A;  4FVM A;  2O4X A;  4HCS A;  4APV A;  1XXG A;  2A8V A;  2B2Y C;  3FKI H;  2EXZ A;  2I5H A;  3X3N A;  4A3G H;  2O5J C;  2RKS A;  1EYC A;  5B6I A;  1L1O A;  2EIF A;  4HIO A;  1VQP A;  1KTK A;  1HCZ A;  4L5Q A;  2WSS A;  4DAP A;  2JA6 G;  4X62 L;  3KBX A;  1BVS A;  3S2D B;  1HPC A;  3DEO A;  1VQK B;  4IUV A;  1PFM A;  2KOL A;  2SNM A;  2E2J B;  3MXP A;  1I7P A;  3G6J B;  1FJG L;  2F4N A;  3DEP A;  3S17 B;  1MSG A;  4GKJ Q;  4K14 A;  4BY1 G;  3CF5 A;  1K8A D;  2CFM A;  4N8F A;  3J81 i;  4PC1 A;  1VQ5 B;  1QUQ B;  5KNB A;  5EGT A;  4PQX A;  4RD0 A;  1NTG A;  2GQF A;  1A3T A;  1SNC A;  1K0R A;  4ASU A;  1IYJ B;  1ENA A;  3OEH A;  3SXH A;  4XDX A;  5M3M G;  4YAO A;  1E63 A;  1N05 A;  2NVT B;  1J9Z A;  3CCS A;  2A5H A;  4ODG A;  1SYD A;  1VQN B;  1W3S A;  2E1R A;  2JQO A;  5ELF A;  4A3M B;  3SLD A;  1H8H A;  3TP6 A;  3HOX B;  3MHP A;  2WJY A;  1VQG A;  3CRL C;  3OJW A;  2BVN A;  3QE2 A;  2K01 A;  3MXG A;  1V9P A;  1F77 A;  5AFW A;  2EZV A;  5C3E B;  3T13 A;  5C4X B;  1SYF A;  2VBU A;  3GV3 A;  3ZYY X;  1TQO A;  1Y1V G;  4IOA A;  1TXY A;  2JA7 B;  1GUN A;  1I5F A;  2P5Z X;  2X0K A;  3CC7 A;  1XE1 A;  3RUZ A;  1CM9 A;  1TWC H;  3K8A A;  3AU7 A;  1VQO A;  1GR1 A;  1RTN A;  2WKD A;  2GRE A;  5KYI A;  4JYA L;  1Y8O B;  1VQC A;  1IW7 C;  2M00 A;  4RM0 A;  2F0E A;  2MGS A;  4YAU A;  1OXV A;  4LK1 C;  2ZTN A;  1EOT A;  4C1N I;  4CDF C;  3D3R A;  1B1Z A;  3VYT A;  2K33 A;  4DPG A;  1VQ6 B;  2BE5 D;  2JXM B;  1M90 D;  5FLX c;  4XKW A;  2LXK A;  4A3C G;  2B2V A;  1QVF B;  3OTO Q;  2UXC L;  2CCZ A;  4M1K A;  4A3D H;  5K36 H;  3PO3 B;  2Q6O A;  1IB0 A;  4FF2 A;  1K9M D;  3NWT A;  2AQ2 B;  2EIX A;  2WB1 B;  2PO4 A;  2DEU A;  5EMN A;  2PW7 A;  4JCV E;  4KJO A;  3BNW A;  5C4J B;  3W2I A;  4DV3 L;  3Q8D A;  3S1M B;  1E2V A;  3W1B A;  1KD1 C;  3ER0 A;  2DOG A;  4JI1 L;  4HJA A;  1WTH D;  1MI2 A;  1S5D D;  2QN6 A;  3V05 A;  3J7Y W;  3H09 A;  1G91 A;  4JBK A;  4BY1 H;  4RCZ A;  3A5U A;  1SN8 A;  4BBR G;  1L1O B;  1VQP B;  1FGB D;  3ONA B;  3W5U A;  5LL6 X;  2ZZF A;  4DQL A;  2EYJ A;  4A3K B;  5HXB A;  2NN6 I;  4B9W A;  1SFO H;  1N08 A;  4CKC A;  3ZZT A;  4B43 A;  1M1K D;  2MO0 A;  3FKI B;  1X3G A;  5IWA L;  4HN7 A;  3TSS A;  1F9Q A;  3R93 A;  2QDL A;  2A6E C;  4F87 A;  4MZ9 A;  3DWP A;  2XZP A;  3M4Q A;  3TME A;  1PTO C;  3KLS A;  4DNT B;  4B3F X;  1I18 A;  3WBK A;  5CV9 A;  3W2H A;  4GOP A;  2X53 S;  2HHH Q;  1CQF A;  2V31 A;  3VYU A;  1TU2 B;  3OP1 A;  4ZGQ B;  4LJZ C;  4LFB L;  5CBE E;  2KEE A;  2ICI A;  2CND A;  1B9N A;  1Y0Y A;  4XTC S;  3CC4 B;  2JK8 A;  1YIJ A;  1BCP C;  4LC0 A;  1DON A;  1JWM D;  2VY3 A;  4DR2 L;  3MFG A;  4Z4S A;  5IOD A;  1EZ6 A;  2CWP A;  4PMC A;  1KC8 C;  4JBW A;  3CPW A;  2MP1 A;  4RCO A;  4ZRZ A;  3SK6 A;  4WWV A;  3FPK A;  1H9J A;  4C3J G;  5HY6 A;  1SNP A;  2F0M A;  1FNB A;  1D1K A;  2X6G A;  4A3C H;  2W6I A;  1QWY A;  3OZV A;  3CC7 B;  4IZ8 A;  4MTN A;  2EYP A;  3STB C;  1XX8 A;  2CWA A;  2RDF A;  4LF6 L;  2BA0 A;  3A8I E;  5KGU A;  1KRS A;  4BY7 G;  1TUI A;  2ZTG A;  1SRO A;  4GLX A;  4KN4 C;  4RG1 A;  1KL9 A;  1SEB D;  2EYH A;  4K6D A;  2FFK B;  3RR5 A;  3JAM L;  4JI2 L;  1TWC B;  3OPO A;  2CBX A;  4KY7 A;  1E2Z A;  4HMI A;  2FMC A;  4N3N A;  3R2I A;  1A3V A;  1H9R A;  2CQA A;  1KRH A;  3F8T A;  5CR3 A;  1CSP A;  1MJC A;  3I4N H;  2LFN A;  3UE1 A;  1SE4 A;  1JJ2 B;  1I94 L;  1C0A A;  1HVX A;  5TSS A;  1SDF A;  2BA1 A;  2K14 A;  3KL9 A;  4IUR A;  4JBJ A;  2XGJ A;  1PTO F;  4EQ5 A;  2R92 G;  4Y7C A;  4JYA Q;  2MHV A;  3ZZ0 A;  2BN4 A;  2EYM A;  3FKS A;  1B9M A;  3JAM E;  3U50 C;  3J7A V;  2OTL A;  4P3I A;  2B2U C;  1IJF A;  3EQL C;  4DV4 L;  2GVB A;  1XNQ Q;  1CZG A;  4HJ7 A;  4N9T A;  1SRU A;  4XN0 A;  1YI2 A;  2IJ0 A;  3CB4 A;  2BSA A;  2CC2 A;  2D2C C;  2B8F A;  3VR4 A;  3QIA A;  4B08 A;  2B2Y A;  2QDB A;  4R4C A;  4UP7 A;  2XOK A;  4FK8 A;  4DK0 A;  1EU4 A;  4KY5 A;  1W87 A;  1E3P A;  1XB2 A;  2HIV A;  4Q0F A;  1TY2 A;  1I8D A;  2NZ1 D;  4JK1 C;  2HMA A;  4XR6 A;  3BS1 A;  1LAB A;  4DV3 Q;  5E7N A;  4YWL A;  2WAQ B;  2XVS A;  4RGO S;  4DFA A;  3I1F A;  2F0W A;  4HJ8 A;  4A3E G;  1NMF A;  4M0L A;  1NB9 A;  1P8L A;  1G2S A;  4G5G A;  4GOP B;  1PJ6 A;  4DNR B;  2BOS A;  4QJF A;  3A7L A;  3OMC A;  4CDE C;  2OCE A;  1VHE A;  5JPN C;  1K0S A;  4R71 A;  3I56 A;  4A75 A;  4DK3 C;  3KFU A;  3GTM H;  4DN4 M;  1GUW A;  4RKB A;  5IOC A;  5DNF A;  1KDC A;  3HP3 A;  2ES2 A;  1YIJ B;  1X9N A;  3HOU G;  3J81 j;  4WJW A;  5IWA Q;  3QB3 A;  5K5P A;  1PZI D;  1MBY A;  2RHQ B;  2PMZ B;  1UD6 A;  4XLF A;  1ZM2 A;  1WP6 A;  1SMY D;  4V0B A;  1DZ1 A;  3OMG A;  1WCM G;  2A6H D;  4BXX H;  4XMY A;  3DDY A;  3CPW B;  4XXE A;  1OO9 B;  3NK9 A;  1MRZ A;  4JI3 L;  4A3L H;  1DM0 B;  4O1N A;  3VO2 A;  1HRJ A;  4XOR A;  5CDF A;  1GD7 A;  1O7L A;  2AMC B;  4C3I G;  2F1L A;  4EX5 A;  1HJP A;  1WD0 A;  3A3B A;  2NPF A;  3OE7 A;  1RL2 A;  4K5W A;  2K7V A;  2VXW A;  5AN9 A;  3HKS A;  1KNE A;  5IYB G;  2Q6L A;  2RSN A;  4CGY B;  2EY2 A;  5FLM G;  3PUW A;  4LF5 Q;  1RQP A;  2E75 C;  4IPC A;  4KLK A;  4ZCM A;  4JI7 Q;  4OWT B;  3SK4 A;  4O0A A;  4Y9U A;  1X56 A;  1UD5 A;  5C44 G;  4LFC L;  1GAQ A;  2WV6 D;  4K8I A;  3SE0 A;  2FMM A;  4X64 L;  1VQ7 A;  4WQM A;  1R4P B;  4H9G A;  1VQF A;  1JB7 A;  2L5T A;  1E1Q A;  2BV3 A;  2ZXO A;  4FP5 D;  3TP7 A;  2K28 A;  3ND9 A;  3I4N B;  2G9D A;  4WJ3 M;  4JI0 L;  4ID6 A;  3NBI A;  2HD3 A;  4FDB A;  3JQR A;  1G6Z A;  4JI2 Q;  2ENB A;  4FXU A;  2OTL B;  2A69 D;  3HKZ E;  5EJW A;  5LMN L;  1JNY A;  4X65 Q;  5IP7 G;  2K03 A;  2RA4 A;  3D8G A;  1PRT D;  2V1C C;  5LL6 S;  2PE3 A;  4J6H A;  3CCE B;  3D6C A;  1YI2 B;  3Q6S A;  1DOK A;  4A3E H;  1KLG D;  3AFP A;  1HZB A;  1QCB D;  1MKH A;  3S1Q B;  1E43 A;  1DDI A;  1KRT A;  3KLR A;  1NE3 A;  4X3U A;  2LS0 1;  2JA5 B;  4PC2 A;  2B2W C;  3HKZ G;  1B4O A;  1V1P A;  2EY5 A;  4QQB X;  4DR5 L;  4OPV A;  3S2H H;  1TS3 A;  3I8Z A;  4XL9 A;  4JW0 A;  3S1R B;  2Q2H A;  4OGQ C;  2YV5 A;  1A2U A;  1S4Z A;  4H02 A;  4L63 B;  3GTQ H;  1XPU A;  4GLA C;  4M8A A;  3UDX A;  3PGZ A;  3GQB A;  3HOW B;  1KMH A;  2NVQ H;  4P22 A;  5C0X I;  3M4O B;  2JA8 G;  4DR7 L;  3X3M A;  4C3H G;  4UDU C;  1UD8 A;  2GA4 B;  2MO1 A;  1ZM9 A;  1VMP A;  4RGM A;  2ZXI A;  1KK3 A;  5GAH C;  3KUP A;  1N32 L;  2IPK D;  2PPB C;  4Y7N H;  1SNM A;  4KKU A;  2EYF A;  3GTM B;  1W6J A;  5C3X A;  5IYB H;  5TV2 A;  1ZXT A;  1OB0 A;  4HJ9 A;  3GTG H;  4JI4 L;  1EQR A;  2CW0 C;  1ASZ A;  4HIM A;  2IX1 A;  1SR3 A;  2B39 A;  5J39 A;  2HT1 A;  2OT2 A;  1NDH A;  4DUY L;  1HTL D;  3CTA A;  3ASR A;  1LTB D;  1TTT A;  3MTS A;  5IT9 L;  2AHO A;  1UAP A;  4PAB A;  4ZCL A;  2GVA A;  4S3S A;  4LFA L;  3M3Y H;  4EQO A;  5C44 H;  1TWA H;  2KCC A;  4P6V F;  3I4M H;  3W3A A;  2JJQ A;  1FD7 D;  4PAA A;  2QW7 A;  1Y1W B;  4A3I H;  2OTJ A;  1E7Z A;  3OYY A;  1EY8 A;  3B6Y A;  2F4V L;  3CD6 A;  1VQB A;  1IYV A;  3WBJ A;  5A35 A;  1BX1 A;  2LY7 A;  2MJ8 A;  2F4I A;  1D5Z C;  4JMQ A;  2KBN A;  2BDN A;  1Z7T A;  3J7A 5;  1NMG A;  4JI3 Q;  2QE7 A;  3SEB A;  1BKB A;  4K6L A;  5G3L D;  1Q82 C;  4Y9R A;  2ICE C;  2K32 A;  3SJP A;  4LF4 L;  1YJW B;  4KY6 A;  1N34 L;  2TSS A;  2BM1 A;  3R6K A;  4CBV A;  3OKX A;  4B3G A;  1CUK A;  2DUD A;  3QOJ A;  1K8O A;  2JP1 A;  4DU9 A;  2EYO A;  2KCM A;  3I73 A;  3C1E A;  2M9V A;  1C8C A;  4XN3 A;  2F0S A;  3P27 A;  5IYD G;  1ROD A;  4A3M G;  1WTP A;  5LHY 1;  1EYG A;  3K5N A;  3HOX G;  3J80 L;  2V7V A;  1JQY D;  3PUV A;  1W6K A;  3EIV A;  2EE1 A;  4OO1 I;  3K59 A;  5L37 A;  1F2L A;  1SE3 A;  4XQJ A;  3NTH A;  4K2L A;  1JE5 A;  5HKK A;  4QUF A;  3W1G A;  4YCV A;  4LFC Q;  2V7X A;  4U67 3;  5C3E G;  2VZA A;  2B2U A;  5IY0 A;  4XQF A;  5C4X G;  2GJR A;  4RPB A;  2R3Z A;  4RWS C;  3VR3 A;  4X64 Q;  3S1N B;  4G1V A;  2LSS A;  2JA7 G;  2FVG A;  2B63 H;  4DV7 L;  1EFI D;  1AP0 A;  3S14 B;  3QSY A;  4H13 C;  2JA8 H;  3VR6 A;  3TEH B;  2PYK A;  3URY A;  4EQP A;  3KJP A;  4JI0 Q;  1UNS A;  5ELN A;  3RLN A;  1V1P B;  2WZP P;  1T5X D;  3D4W A;  1H95 A;  5ISR A;  1SKQ A;  4PC6 A;  1S3O A;  2HCC A;  2WB1 E;  2XZL A;  1SE2 A;  4F8M A;  4G7O C;  3ZJY C;  3BC9 A;  1A3U A;  2OYN A;  1PTO B;  2R6G A;  1B8A A;  4QL5 A;  5KIX A;  3PO3 G;  1PDQ A;  2WZN A;  2MQH A;  3GTQ B;  1L0Y B;  2K50 A;  5E1F A;  5JOB A;  2OBR A;  2ZBU A;  3A8K A;  5HGT A;  2WB1 G;  3DUZ A;  1J9O A;  4WJ4 A;  4R9W A;  3NWS A;  4G57 A;  2A1A A;  4GKJ L;  3IFD A;  1B23 P;  1KIX A;  4DR5 Q;  1BCP B;  4NKL A;  1LTL A;  1WYD A;  3OJX A;  3T1H L;  4WFN 3;  3PSI A;  4ZKC B;  2Z1C A;  5C4H A;  1OGI A;  2NTS A;  5HGQ A;  4Y7N B;  3G05 A;  2RQX A;  2QA4 A;  2UXB L;  4BA1 I;  4P3Y A;  2AHO B;  4O2D A;  4AYB B;  3S17 H;  1PV4 A;  4DR7 Q;  1U4P A;  1TLL A;  2YWG A;  3DM3 A;  1S72 A;  1YJ9 A;  3K0Y A;  1W35 A;  4YY3 L;  3BVZ A;  2OTJ B;  3A74 A;  2G9H D;  2ASB A;  5EQ0 A;  3A8J E;  4QB4 A;  1N32 Q;  3ZBT A;  1CZW A;  1Q1E A;  1BPL A;  4HID A;  3M3Y B;  2BGI A;  3FKI G;  1EQQ A;  1IBK L;  3CD6 B;  1PFB A;  3ES9 A;  3I4M B;  5IYD H;  3RNU A;  4JI4 Q;  4A3M H;  1DJR D;  4A3I B;  4L5T A;  4IUP A;  1SJE D;  4DUY Q;  3OWF A;  3A7A B;  1LAC A;  1OXU A;  1YEZ A;  1AN8 A;  2VNK A;  2L12 A;  1F60 A;  2SNS A;  3BU2 A;  3DXJ C;  3FHW A;  1W9X A;  5JJL A;  1KDA A;  3A55 A;  3CRZ A;  1Y8P B;  1NJI C;  2EJF C;  1ENC A;  3L9A X;  3SLN A;  4C56 C;  2HDL A;  2RC5 A;  3S9W A;  1NBM A;  2ZXH A;  3VYR A;  4RCN A;  1EZ8 A;  4JI8 L;  4X7F A;  3SK8 A;  1MD2 D;  1HZC A;  3I4L A;  1D7Q A;  2ALY B;  3N6R A;  1I6V C;  4Z4V A;  1STA A;  3C2P A;  4LF4 Q;  4GNX C;  4KV6 A;  1N34 Q;  4GKK L;  3SKB A;  1YNJ C;  3WQZ A;  3SVM A;  1ENF A;  3GSI A;  1BMF A;  2JDI A;  1EY4 A;  1EP2 B;  3PV0 A;  4DV0 L;  3H0G H;  2KA7 A;  3HGB A;  4OX9 Q;  5H59 A;  2VJJ A;  1D5X C;  1HA6 A;  2NB0 A;  1CT1 D;  3SHL A;  2B63 B;  2Q6K A;  1HTP A;  1I4P A;  2KCT A;  3CRK C;  3K57 A;  4BA2 I;  5M9O A;  5C4J H;  3U2Q A;  2V7W A;  4AF7 A;  5D65 A;  3KOJ A;  1QFZ A;  2E2H B;  4X3T A;  1UD4 A;  3DHQ A;  4M1U B;  4X6A H;  2K5D A;  3CP0 A;  3ZBU A;  4A4I A;  2R6H A;  1PKV A;  2M2L A;  4OPO A;  2Q8I B;  4OOV A;  5JVG 3;  4X06 A;  3G4S A;  3Q6Q A;  1XPR A;  4X07 A;  1VLY A;  2EJM A;  5K36 G;  3PF4 A;  3FRP B;  2NYZ D;  1U4L A;  3NHH A;  4A3K H;  2HHH L;  3F2U A;  1K28 A;  4K8J A;  4UZE A;  2PZU A;  1XNR Q;  2VS1 A;  1T5E A;  4YHH Q;  4EGV A;  2IL8 A;  5IYR A;  4TVA B; 
#chains in the Genus database with same CATH homology
 1Q8I A;  4C2M B;  3J81 E;  4KD4 A;  5D14 A;  1EIG A;  2IX0 A;  4K5V A;  1M4V A;  5KRU A;  5G3L F;  2X69 A;  3U9S A;  4IFD G;  2AUK A;  4OHJ A;  1C4Q A;  2WPD A;  2D3L A;  4XON A;  2VNU D;  3D4R A;  5CV8 A;  1BCP D;  1ZYR D;  2X85 A;  2PCF B;  3CHB D;  1BBX C;  1U4M A;  1EWC A;  3OAA A;  4EQN A;  3A54 A;  1TWG B;  2MPM A;  5T1I A;  4IUQ A;  4XYQ A;  4IN3 A;  5FLX E;  1PLF A;  2PQE A;  4R8I A;  3CQZ B;  4H0L C;  1B3A A;  3MVV A;  3A56 A;  4CJ0 B;  4XD7 A;  3H0G B;  1V8Q A;  4LAA A;  3HS0 C;  1H9S A;  1JE4 A;  1QNK A;  1V0E A;  1ILP A;  2F0L A;  3CP2 A;  3FPP A;  2F0U A;  2I07 B;  3SR1 A;  4I65 A;  3J7A F;  2EY1 A;  5CBA E;  2WAC A;  1KDB A;  3C46 A;  2K5W A;  3MZ5 A;  4IFD H;  2X6Y A;  4UZU A;  1WTR A;  3VR5 A;  3CP8 A;  2E2D C;  2AQ1 B;  5IGB A;  1KZL A;  3QG1 A;  2EY6 A;  2K04 A;  2L0C A;  1KAA A;  2A68 D;  1UD2 A;  5JPM C;  1DYQ A;  4PNY A;  1H9K A;  3Q0A A;  4RGT A;  4ULL A;  4DF7 A;  2Y0S B;  4ZK9 B;  4II2 A;  1W0J A;  1PZK D;  3OFN A;  4L8J A;  2OXP A;  2ZT9 C;  1GUT A;  4ZAI A;  4OL7 A;  3A3G A;  1R4Q B;  2F0K A;  2QF7 A;  1X3Q A;  1A6X A;  3S16 B;  3IFT A;  1HFG A;  2A74 C;  1HA5 A;  3FMC A;  4A3F B;  2XND A;  1QB5 D;  1VMC A;  4DGZ A;  1LT6 D;  2X8K A;  2RVL A;  4IUT A;  3TN2 A;  1LTR D;  3CKI B;  3U9O A;  2Z6B D;  3I72 A;  1F2M A;  5M5X B;  2BDO A;  4YEJ A;  3V96 A;  2I46 A;  3OWE B;  5M3F B;  2F43 A;  2JEA I;  5I9O A;  1LTS D;  1H9S B;  2QCP X;  3EVQ A;  2F0P A;  1GUS A;  2NWG A;  1JOR A;  2BE5 C;  3GO5 A;  2JJ1 A;  2YU9 B;  2JYO A;  5D3D A;  1RHP A;  5NUC A;  1RTO A;  4GQN A;  4A3J B;  3RZO B;  4L6T B;  1DOL A;  1V0F A;  1DXM A;  1XWE A;  4XIG S;  3ITP A;  1SNO A;  5ELC A;  1TII D;  3KF8 A;  5J22 A;  2SEB D;  1BUV T;  1TR5 A;  2JA6 B;  3I90 A;  1I4H A;  1CI3 M;  2VUM B;  3C3L A;  1I4R A;  2CHB D;  4RA8 A;  3M7G A;  1PZJ D;  2KUM A;  1EY6 A;  4MHE A;  5CYU A;  1CHP D;  1SYE A;  4XLE A;  2EVB A;  5IIF A;  4IFD J;  1X3P A;  2CW0 D;  3P75 A;  2DN8 A;  3GP7 A;  3BVM A;  2NVX B;  3E0J A;  1SNQ A;  1WTO A;  1S5E D;  4X3S A;  3WOF A;  3S15 B;  3ZPN A;  3A35 A;  2HDM A;  2SOB A;  4IUU A;  1YNN D;  1D6E C;  4B9X A;  5JEA H;  1V1O A;  1TKW B;  1X32 A;  5KEE A;  4G7W A;  4IUN A;  4K5X A;  1I4X A;  2NVY B;  1Z6H A;  2ZXR A;  1XTC D;  2L55 A;  2F3W A;  2DNC A;  3K6O A;  4Q5V A;  2ZZQ A;  2F0O A;  4A93 B;  1V43 A;  3NBH A;  4ABN A;  4ZUI A;  2KED A;  2F0J A;  1EQV A;  2Z4H A;  1Y8N B;  4IAL A;  2KEC A;  2WJV A;  1RKN A;  2ZZG A;  1NR2 A;  4XYO A;  4XKV A;  1ML0 D;  3FVQ A;  2C5C A;  1QG7 A;  5J1Z A;  4KJN A;  2F0F A;  1E0B A;  2IW3 A;  4QMG A;  1SYC A;  1PTO H;  5DM7 3;  2RDG A;  3HOY B;  1UUP A;  1MSH A;  3BH4 A;  5A2Q E;  1EYA A;  1S5B D;  2O5I C;  3A8K E;  1AEX A;  4BS9 A;  2C9O A;  5E4X A;  3NTI A;  4G7Z C;  5EBC A;  5D3I B;  4U68 A;  3L7Z C;  1EWH A;  3HG9 A;  4G7H C;  2XWB B;  4EVO A;  5DEH A;  1G8Z D;  3D4D A;  1F2Y A;  2KVM A;  3M7N A;  2WP8 J;  4QUC A;  3NSW A;  5M5Y B;  1LLR D;  3W2D A;  2E74 C;  2XNA C;  1IKM A;  4LMQ D;  5FO8 B;  2J4X A;  2D9U A;  4ZQ3 A;  3CMM A;  2ZXP A;  5COR A;  1TWH B;  2NTT A;  1SMY C;  1TVX A;  2A6H C;  1SND A;  2D62 A;  3MXU A;  2ZZE A;  2AUJ D;  4BY7 B;  2VJI A;  2HCI A;  1R9T B;  4KI0 A;  1GHJ A;  1B50 A;  2OF1 A;  5T1G A;  3GD7 A;  3HRZ C;  1D1I A;  1UEA B;  1J8I A;  4QIW B;  5BN3 A;  3VA5 A;  3OIP A;  3UI2 A;  4NW2 A;  1PMR A;  2L11 A;  2WIN B;  4KHV A;  3K5M A;  3GVJ A;  2EJG C;  1PXU A;  3TP5 A;  2X6X A;  3FEW X;  1NRK A;  1EL0 A;  4BBS B;  2A69 C;  5I2X A;  3D31 A;  3K58 A;  5CGK A;  2QEJ C;  2K6A A;  1HHV A;  1F9S A;  3SK5 A;  2PZT A;  1WVL A;  2W6J A;  1D2B A;  1HUN A;  5ELB A;  4XLC A;  1U9R A;  1Z47 A;  1AFP A;  5M5W B;  3KEW A;  4YXW A;  5BN4 A;  3ERO A;  1VF5 C;  1ET9 A;  4I7Z C;  2Z4I A;  4UAI A;  3BDO A;  3K7A B;  2R93 B;  1EQT A;  3HOU B;  2J7Z A;  2EYL A;  1WPC A;  5CV6 A;  3P7J A;  3Q22 A;  3NUC A;  3LWE A;  3IAY A;  1HXY D;  4MN3 A;  5EKL A;  3GVK A;  5EPL A;  4XOP A;  3T4A C;  3BCF A;  1OXS C;  1LTI D;  1JB3 A;  1EEF D;  1HQM C;  3OHX C;  3MWY W;  3DM1 A;  3SDZ A;  4WOR A;  3QO2 A;  1IKL A;  4HR7 B;  4NMZ A;  2B8G A;  5E3F A;  1WTV A;  3GVL A;  2B2T C;  3N52 A;  1PRT F;  4DA2 A;  4OO1 H;  4NDX A;  2WII B;  1TS4 A;  1OXX K;  3OSO A;  1NR4 A;  5EPK A;  3HOV B;  4XM3 A;  5FKA C;  1UD3 A;  4QCL A;  1CK1 A;  4CKE A;  3H94 A;  4G4K A;  1COW A;  2IX3 A;  1IW7 D;  1QNU A;  1DOM A;  5KNC A;  1SYG A;  1K8M A;  1TY0 A;  2IL8 A;  1SBB B;  4DXF A;  3V2T A;  1TS5 A;  1O7Y A;  3J81 L;  4X3K A;  2WKC A;  2HLD A;  3MAQ A;  2AWO A;  4DAY A;  3Q23 A;  2X6W A;  2F0Q A;  2EPB A;  1EIH A;  2H4O A;  3RZD B;  3GV6 A;  4RHS A;  3BDL A;  1SXT A;  3OEE A;  1OXT A;  3LWU A;  2IT1 A;  3MEH A;  5HUR A;  1QIL A;  2A6E D;  2L4N A;  5FO7 B;  1HFN A;  4A3B B;  1PTO D;  3KLS X;  1JWS D;  2R7Z B;  2YYZ A;  3K5L A;  2K1B A;  2K5Q A;  2Z8L A;  5IGG A;  1I4Q A;  2KQ3 A;  5KND A;  1LV9 A;  4KN7 C;  5FLX L;  2CVR A;  4IFD I;  3GTP B;  4KHZ A;  4DXG A;  3PO2 B;  5DM6 3;  1I50 B;  2XRS D;  5C4Z A;  4FXK C;  1OHH A;  3RMH A;  3PMF A;  2PZW A;  5DAU A;  1B2T A;  3I3C A;  1DD2 A;  4ILW A;  4E0F A;  2BCO A;  4V19 0;  5IK2 A;  4H44 C;  4TT3 A;  5C5L A;  2L1B A;  3R2T A;  4FXD A;  1I4G A;  1Q12 A;  2K05 A;  4GZY C;  1JC7 A;  1H8E A;  2NBF A;  1LT5 D;  3T51 B;  2A73 B;  2F0V A;  2XN9 C;  1O80 A;  1M8A A;  2GK6 A;  3HOZ B;  1KAB A;  4HTH A;  3DWQ A;  1GJX A;  3WDN A;  1LTT D;  1WTQ A;  1SKY B;  3GTO B;  1FYC A;  3T53 B;  5CV5 A;  1JCK B;  5JJZ A;  3PUZ A;  2IWH A;  5EKK A;  1RD9 D;  1JOQ A;  4CJ2 C;  2TMP A;  4HAE A;  2AQ3 B;  1LT4 D;  5COY A;  1DCZ A;  3FPU B;  1CTM A;  3D6W A;  2NN6 G;  3T16 A;  3PIP 3;  5CV4 A;  4FXG C;  5I6Y A;  2XIW A;  2XRQ D;  2JEB I;  4A3G B;  4F88 A;  1IL8 A;  1NAP A;  4J1M A;  1AZP A;  2SDF A;  1GOZ A;  3K5O A;  1VJS A;  3IKJ A;  1FNU A;  2B2T A;  1GUG A;  3DWA A;  3GTL B;  2L9H A;  5IGF A;  5KNL A;  3MC0 B;  1ZYR C;  2KVO A;  1I3Q B;  4CJ1 B;  2N88 A;  3H3V C;  1E2W A;  1GHK A;  5ELD A;  3KK7 A;  2MUY A;  1GXD C;  2J0T D;  1CQV A;  4HSP A;  1STH A;  2EOT A;  5I2Y A;  5JEA G;  2JJ2 A;  1D5M C;  1C48 A;  1PRT B;  3EA6 A;  2AWN A;  4XT1 B;  2GJK A;  1G2T A;  3HAG A;  3VA7 A;  2DNE A;  4F7X A;  1IYU A;  3TZU A;  1TT2 A;  1BNZ A;  2NN6 H;  4TRD A;  3M85 A;  4A3D B;  2H1E A;  5IGC A;  3EJI A;  3QJY A;  1E79 A;  3DMU A;  1NCV A;  3NP8 A;  4XQQ A;  4R8N A;  4K2K A;  1TWF B;  1NSN S;  2KHS A;  1U4R A;  5CC4 A;  3E6Z X;  1BCP F;  3AMU A;  3CU7 A;  3BYT B;  4HIZ A;  2F0N A;  1F2Z A;  2DIE A;  3NQT A;  3RLF A;  2Q8R E;  2FJ2 A;  2OEO A;  1XYI A;  4BY1 B;  2XSC A;  1JR0 D;  4KMU C;  1K28 D;  2LMC B;  4C1N K;  1L0X B;  2E2I B;  1LTG D;  1SFO B;  2A68 C;  3MXN A;  5M3M B;  1W0K A;  4DK1 A;  1Q3L A;  1STG A;  1NUC A;  1RCV D;  1ESR A;  1MGS A;  1SYB A;  1ESF A;  2N55 A;  5FOB B;  4BWG B;  1STN A;  4G7X A;  3LX0 A;  4KK7 A;  4ZKB B;  1EFR A;  1Y1V B;  1FR3 A;  3G7L A;  3CES A;  2LZJ A;  2JSO A;  2HUG A;  4J8Q A;  5C5M A;  5IGD A;  2VB2 X;  1G29 1;  2M5S A;  2GK7 A;  5I6W A;  3HZX A;  2DY7 A;  1BR9 A;  1BOS A;  1E3Z A;  3NTK A;  4N9P A;  1EU3 A;  2QIL A;  4IQZ A;  3KBG A;  1FNV A;  4PMB A;  3MHB A;  4E6I A;  1RF2 D;  2D5D A;  3NXW A;  3BG3 A;  5A2Q L;  4XQN A;  3BYY B;  2F1M A;  5I4D A;  2F0T A;  1SJH D;  2F0D A;  3TBI B;  4TSS A;  1LTA D;  4OIK A;  1K83 B;  3AB9 A;  3R8B A;  4DAV A;  3BCD A;  5JAV A;  3NQI A;  4KKT A;  4BBR B;  4ME5 A;  2FIN B;  1Y69 U;  3I91 A;  4FF4 A;  4NP5 A;  2VB3 X;  2PW5 A;  1STE A;  4ZUJ A;  1E3X A;  1BDO A;  2EDG A;  4MIU A;  3R3O A;  1F9R A;  1MAB A;  1EYD A;  4RAU C;  4FYD A;  1STB A;  2CK3 A;  5C0X G;  2JIZ A;  3OW7 A;  2F0G A;  5CMD A;  4Z1M A;  1EY5 A;  4HED A;  1JIC A;  4H7B A;  1A15 A;  4P2C B;  1VCI A;  1RDP D;  4II3 A;  3IL8 A;  1AZQ A;  1LT3 D;  2XZO A;  3TDQ A;  4XOT A;  4C3J B;  3Q24 A;  4RH6 A;  2DY8 A;  4HCE A;  4RFB A;  1HQR D;  4OIJ A;  2D3N A;  3I70 A;  2O2L D;  1I6H B;  1E1R A;  2NUC A;  4HSV A;  2RBM A;  5ELE A;  2F0H A;  1YNN C;  1ONL A;  3QWN A;  1QE6 A;  5FO9 B;  1ZKO A;  4XNF A;  4PV1 C;  1PFN A;  4AVZ A;  2F0I A;  3TZD A;  4FNF A;  3GTK B;  3WOE A;  5JEA J;  1SAP A;  5IT9 E;  3HEJ A;  1BLI A;  5CV7 A;  1CA6 A;  2R92 B;  5BN5 A;  1AW7 A;  1YNJ D;  3JU4 A;  4OO1 G;  1ET6 A;  1LO5 D;  4KD3 A;  4ZLT F;  3ZIA A;  1O78 A;  5KYL A;  2R61 A;  4WRD A;  1WD1 A;  4XLH A;  1JOK A;  4Z9C B;  2ID0 A;  5C0X H;  1PRT C;  2E76 C;  2F3V A;  5DN6 A;  3C1F A;  5IGE A;  3OOC A;  3H6M A;  5EKI A;  4QF4 A;  1STY A;  3O13 A;  2B2V C;  4XLA A;  4A3E B;  1CA5 A;  1HUM A;  1BXT A;  4FO2 A;  3J80 E;  1ZEQ X;  3EFX D;  1TS2 A;  1PYW D;  3L3O C;  2R9V A;  1VDZ A;  1CHQ D;  3S2H B;  1HZE A;  1JWU D;  4TSF A;  2E1B A;  1WCM B;  2NVQ B;  1B53 A;  1Q1B A;  1S5F D;  3BZD B;  4C3I B;  2GJP A;  4KKS A;  3ERQ A;  5JVH 3;  2V7Q A;  3GTG B;  1WTX A;  2RSO A;  1ILQ A;  3NPP A;  5C6A A;  5I9P A;  2F03 A;  3RD4 A;  4ZYS A;  2RDH A;  5EPJ A;  4YEL A;  3BDC A;  5C44 B;  1FX0 A;  2KJX A;  1TWA B;  4NNJ A;  3PIO 3;  3NE5 B;  4KTA A;  1QJO A;  4FF1 A;  1B44 D;  4TQU S;  1BO0 A;  2QKI C;  3QOL A;  3T56 B;  2JE6 I;  3PUX A;  1EY9 A;  5F2D A;  1RJT A;  5FK9 C;  1EEI D;  3P20 A;  2HQE A;  1A2T A;  1KNA A;  2LKV A;  2XWJ B;  4HMJ A;  3BVG A;  4RKL A;  4O42 A;  4YIJ A;  3ND8 A;  2V4D A;  3MA2 B;  1EY0 A;  1IHZ A;  1F9P A;  1QOH A;  2KCN A;  3FDT A;  1S5C D;  1ICW A;  1II3 A;  3PUY A;  1FNW A;  4CKB A;  3HKZ B;  3TP8 A;  4FF3 A;  1O7Z A;  3VYS A;  2Q8T A;  1H9M A;  4G6I A;  4CHT B;  1KLU D;  3H91 A;  4PMW A;  3GTJ B;  2B2W A;  1WTW A;  1EY7 A;  3VR2 A;  2JA8 B;  2X6L A;  4C3H B;  5C3W A;  1CFM A;  3M4Y A;  2FHT A;  1BF4 A;  3OIQ A;  3LNN A;  5E4W C;  5FL7 A;  1Q90 A;  3E5S A;  1VF7 A;  1GUO A;  1JOO A;  4XT3 B;  5EBD A;  1BQQ T;  4RGN A;  1SSO A;  5C0X J;  4TKO B;  3P1H A;  3MFY A;  2PNR C;  4FVM A;  2O4X A;  4HCS A;  1XXG A;  2B2Y C;  2EXZ A;  2O5J C;  3X3N A;  2RKS A;  1EYC A;  1KTK A;  1HCZ A;  2WSS A;  4DAP A;  3KBX A;  3S2D B;  1HPC A;  3DEO A;  4IUV A;  1PFM A;  2KOL A;  2SNM A;  2E2J B;  3MXP A;  3G6J B;  3DEP A;  3S17 B;  1MSG A;  4K14 A;  5KNB A;  5EGT A;  4PQX A;  1A3T A;  1SNC A;  4ASU A;  1ENA A;  3OEH A;  3SXH A;  4XDX A;  2NVT B;  2A5H A;  4ODG A;  1SYD A;  5ELF A;  4A3M B;  1H8H A;  3TP6 A;  3HOX B;  2WJY A;  3CRL C;  2K01 A;  3MXG A;  1F77 A;  5AFW A;  2EZV A;  5C3E B;  3T13 A;  5C4X B;  1SYF A;  3GV3 A;  3ZYY X;  1TQO A;  2JA7 B;  1GUN A;  3RUZ A;  1CM9 A;  3AU7 A;  1RTN A;  2WKD A;  5KYI A;  1Y8O B;  1IW7 C;  2M00 A;  2F0E A;  2MGS A;  1OXV A;  4LK1 C;  2ZTN A;  1EOT A;  4C1N I;  3D3R A;  1B1Z A;  3VYT A;  2K33 A;  2BE5 D;  2JXM B;  4XKW A;  2B2V A;  5K36 H;  3PO3 B;  4FF2 A;  3NWT A;  2AQ2 B;  2WB1 B;  2PO4 A;  2PW7 A;  4KJO A;  5C4J B;  3S1M B;  1E2V A;  1WTH D;  1MI2 A;  1S5D D;  3V05 A;  3J7Y W;  3H09 A;  1G91 A;  1FGB D;  3ONA B;  5LL6 X;  2ZZF A;  2EYJ A;  4A3K B;  2NN6 I;  4B9W A;  4CKC A;  3FKI B;  4HN7 A;  3TSS A;  1F9Q A;  3R93 A;  2A6E C;  4F87 A;  3DWP A;  2XZP A;  3TME A;  1PTO C;  3KLS A;  4DNT B;  4B3F X;  1I18 A;  5CV9 A;  2X53 S;  1CQF A;  2V31 A;  3VYU A;  1TU2 B;  4LJZ C;  5CBE E;  2KEE A;  2ICI A;  1B9N A;  4XTC S;  1BCP C;  1DON A;  1JWM D;  3MFG A;  5IOD A;  1EZ6 A;  4PMC A;  4JBW A;  2MP1 A;  4RCO A;  4ZRZ A;  3SK6 A;  1H9J A;  4C3J G;  1SNP A;  2F0M A;  2X6G A;  1D1K A;  2W6I A;  1QWY A;  4IZ8 A;  2EYP A;  1XX8 A;  2RDF A;  2BA0 A;  3A8I E;  5KGU A;  2ZTG A;  4KN4 C;  2EYH A;  1SEB D;  4K6D A;  2FFK B;  3JAM L;  1TWC B;  3OPO A;  4KY7 A;  1E2Z A;  4HMI A;  2FMC A;  3R2I A;  1A3V A;  1H9R A;  2CQA A;  5CR3 A;  2LFN A;  1SE4 A;  1HVX A;  5TSS A;  1SDF A;  2BA1 A;  4IUR A;  2XGJ A;  1PTO F;  2MHV A;  2EYM A;  3FKS A;  1B9M A;  3JAM E;  3J7A V;  2B2U C;  3EQL C;  1CZG A;  4N9T A;  4XN0 A;  2IJ0 A;  2D2C C;  4B08 A;  2B8F A;  3VR4 A;  3QIA A;  2B2Y A;  2QDB A;  2XOK A;  4DK0 A;  1EU4 A;  4KY5 A;  4Q0F A;  1TY2 A;  1I8D A;  2NZ1 D;  4JK1 C;  4XR6 A;  3BS1 A;  1LAB A;  2WAQ B;  2XVS A;  4RGO S;  4DFA A;  2F0W A;  1G2S A;  4DNR B;  2BOS A;  3A7L A;  3OMC A;  5JPN C;  1GUW A;  4DN4 M;  4RKB A;  5IOC A;  5DNF A;  1KDC A;  3HP3 A;  4WJW A;  3QB3 A;  5K5P A;  1PZI D;  1MBY A;  2PMZ B;  1UD6 A;  4XLF A;  1WP6 A;  1SMY D;  4V0B A;  1DZ1 A;  3OMG A;  2A6H D;  4XMY A;  3DDY A;  4XXE A;  1OO9 B;  3NK9 A;  1DM0 B;  4O1N A;  1HRJ A;  4XOR A;  5CDF A;  1O7L A;  4C3I G;  1WD0 A;  3A3B A;  3OE7 A;  4K5W A;  2K7V A;  2VXW A;  1KNE A;  2RSN A;  4CGY B;  2EY2 A;  3PUW A;  2E75 C;  3SK4 A;  1UD5 A;  2WV6 D;  4K8I A;  3SE0 A;  2FMM A;  1R4P B;  2L5T A;  1E1Q A;  2ZXO A;  4FP5 D;  3TP7 A;  2K28 A;  3ND9 A;  3I4N B;  2G9D A;  4ID6 A;  3NBI A;  1G6Z A;  2ENB A;  4FXU A;  2A69 D;  5EJW A;  2K03 A;  2RA4 A;  3D8G A;  1PRT D;  5LL6 S;  4J6H A;  3D6C A;  3Q6S A;  1DOK A;  1KLG D;  1QCB D;  3S1Q B;  1E43 A;  3KLR A;  4X3U A;  2LS0 1;  2JA5 B;  2B2W C;  1B4O A;  1V1P A;  2EY5 A;  1TS3 A;  3I8Z A;  4XL9 A;  3S1R B;  4OGQ C;  1A2U A;  1S4Z A;  4L63 B;  4M8A A;  3GQB A;  3HOW B;  1KMH A;  4P22 A;  5C0X I;  3M4O B;  3X3M A;  4C3H G;  4UDU C;  1UD8 A;  2GA4 B;  1VMP A;  4RGM A;  2ZXI A;  3KUP A;  2IPK D;  2PPB C;  1SNM A;  4KKU A;  2EYF A;  3GTM B;  1W6J A;  5C3X A;  1ZXT A;  1OB0 A;  2CW0 C;  2IX1 A;  2B39 A;  5J39 A;  2OT2 A;  1HTL D;  1LTB D;  5IT9 L;  3MTS A;  1UAP A;  4S3S A;  4EQO A;  2KCC A;  3W3A A;  1FD7 D;  1Y1W B;  1EY8 A;  1IYV A;  5A35 A;  2LY7 A;  2MJ8 A;  2F4I A;  1D5Z C;  4JMQ A;  2BDN A;  1Z7T A;  2QE7 A;  3SEB A;  4K6L A;  5G3L D;  2ICE C;  2K32 A;  4KY6 A;  2TSS A;  4CBV A;  4B3G A;  3QOJ A;  1K8O A;  2JP1 A;  4DU9 A;  2EYO A;  3I73 A;  3C1E A;  2M9V A;  1C8C A;  4XN3 A;  2F0S A;  1ROD A;  1WTP A;  5LHY 1;  3K5N A;  3J80 L;  1JQY D;  3PUV A;  1W6K A;  4OO1 I;  2EE1 A;  3K59 A;  1F2L A;  1SE3 A;  4XQJ A;  3NTH A;  4K2L A;  4QUF A;  5HKK A;  4U67 3;  2B2U A;  4XQF A;  2GJR A;  2R3Z A;  4RWS C;  3VR3 A;  3S1N B;  1EFI D;  1AP0 A;  3S14 B;  4H13 C;  3VR6 A;  2PYK A;  3URY A;  4EQP A;  1UNS A;  1V1P B;  2WZP P;  1T5X D;  3D4W A;  5ISR A;  2HCC A;  2XZL A;  1SE2 A;  4F8M A;  4G7O C;  3BC9 A;  1A3U A;  1PTO B;  2R6G A;  5KIX A;  1PDQ A;  3GTQ B;  1L0Y B;  5E1F A;  5JOB A;  5HGT A;  3DUZ A;  1J9O A;  4R9W A;  3NWS A;  4G57 A;  3IFD A;  1BCP B;  4NKL A;  4WFN 3;  4ZKC B;  2Z1C A;  5C4H A;  2NTS A;  4Y7N B;  3G05 A;  2RQX A;  4BA1 I;  4AYB B;  1U4P A;  3K0Y A;  3BVZ A;  2G9H D;  5EQ0 A;  3A8J E;  4QB4 A;  1CZW A;  1Q1E A;  1BPL A;  3M3Y B;  1PFB A;  3I4M B;  1DJR D;  4A3I B;  4IUP A;  1SJE D;  3OWF A;  3A7A B;  1LAC A;  1OXU A;  1AN8 A;  2L12 A;  2SNS A;  3DXJ C;  1W9X A;  1KDA A;  3A55 A;  1Y8P B;  2EJF C;  1ENC A;  3L9A X;  4C56 C;  2HDL A;  3S9W A;  1NBM A;  2ZXH A;  3VYR A;  4RCN A;  1EZ8 A;  3SK8 A;  1MD2 D;  3I4L A;  3N6R A;  1I6V C;  1STA A;  3C2P A;  4KV6 A;  1YNJ C;  3WQZ A;  3SVM A;  1ENF A;  1BMF A;  2JDI A;  1EY4 A;  3PV0 A;  2KA7 A;  3HGB A;  2VJJ A;  1D5X C;  1HA6 A;  2NB0 A;  1CT1 D;  3SHL A;  2B63 B;  1HTP A;  1I4P A;  3CRK C;  3K57 A;  4BA2 I;  5M9O A;  5D65 A;  2E2H B;  4X3T A;  1UD4 A;  3DHQ A;  4M1U B;  2K5D A;  1PKV A;  2M2L A;  2Q8I B;  5JVG 3;  1VLY A;  2EJM A;  5K36 G;  3FRP B;  2NYZ D;  1U4L A;  3NHH A;  3F2U A;  4K8J A;  2PZU A;  1T5E A;  4EGV A;  4RHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...