3OW7A

Crystal structure of the membrane fusion protein cusb from escherichia coli.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
296
structure length
296
Chain Sequence
QNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein cusB
total genus 32
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ow7A02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ow7A03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3ow7A01
4JK1C 2V4DA 2A6EC 3VA7A 3OW7A 3VR2A 3IFTA 1YNNC 3D4RA 2A6HC 3AB9A 2A68C 1Y8NB 2YYZA 2A69C 2JE6I 1E2WA 3PUZA 5KNCA 1ZYRC 2BE5C 2BDOA 3PUXA 2PPBC 4I7ZC 5K36H 2DNEA 4KKSA 1GHJA 1H9RA 3VR3A 3M4YA 2O5IC 4XTCS 4GZYC 1A6XA 1GJXA 5A35A 1OXTA 3L7ZC 4BA2I 1Q1BA 4JBWA 3FPPA 1PMRA 4KN7C 1K8OA 1OXXK 4IQZA 4LJZC 1E2ZA 3SE0A 3QIAA 3A8KE 3I72A 2O5JC 1DD2A 2B8GA 4RCNA 5KNDA 5C0XG 1IW7C 2F1MA 4OGQC 4OO1H 1LABA 3BDOA 2L5TA 1BDOA 4BA1I 1CI3M 2JXMB 1H9SA 1HPCA 1Q90A 1IYVA 2BA1A 1YNJC 2NN6G 3GD7A 3NE5B 1E2VA 1QJOA 2A6HD 1I6VC 2AUKA 2A6ED 2BA0A 2D62A 2K32A 2EVBA 4TQUS 1GUGA 4TKOB 3VR4A 1K8MA 2E75C 2D2CC 3HGBA 3QG1A 2B8FA 2DN8A 1LACA 2PNRC 2R6GA 1O7LA 4KI0A 3ND8A 1Q12A 2D5DA 1T5EA 1ONLA 1V8QA 2DNCA 3T53B 3IKJA 2A69D 1GUOA 1VF7A 3EQLC 2LMCB 3MFYA 4HR7B 3ND9A 4IFDH 1Q1EA 2E74C 1HTPA 2E76C 4IFDG 5BN3A 1V43A 2QF7A 3PUYA 2CW0C 4DNRB 3PV0A 3QJYA 1VDZA 4KKTA 3OOCA 3D31A 2NN6I 5JEAH 1OXUA 3A8IE 3BG3A 3SDZA 5BN4A 1H9KA 3T56B 4L8JA 1GUTA 2KCCA 1GUSA 2K33A 4LK1C 3DXJC 4XIGS 1FR3A 3I73A 3N6RA 5C0XH 2K7VA 1VF5C 3U9SA 1FYCA 4DK1A 1IW7D 2AUJD 2EJMA 2ZT9C 2EJGC 1H9MA 1SMYC 2JEBI 1Y8PB 2BE5D 3P20A 3W3AA 1HCZA 1O78A 1OXVA 2EDGA 3RLFA 4G7HC 4H0LC 1IYUA 1OXSC 3OPOA 4H13C 5JEAG 1CFMA 3MXUA 3CRKC 4KHZA 1DCZA 4PV1C 1CTMA 4KMUC 1HQMC 3TZUA 1DXMA 3GQBA 2JEAI 5KNBA 3LWUA 2KA7A 4H44C 1Y69U 1B9MA 3CRLC 4KN4C 2IT1A 4DNTB 1ZKOA 3PUVA 2EJFC 3LNNA 1G291 1Y8OB 1TU2B 2NN6H 2AWOA 3I4LA 2A68D 3KLRA 3VR6A 3WDNA 2PCFB 3PUWA 5BN5A 2Q8IB 4KKUA 3A7LA 4OO1G 3T51B 1VCIA 3H94A 3A8JE 3M7NA 1H9SB 4DK0A 1TKWB 1Z7TA 3M85A 4G7OC 3A7AB 3FMCA 1B9NA 1H9JA 3VR5A 1GUNA 1Z6HA 1GHKA 5K36G 4G7ZC 1EWHA
chains in the Genus database with same CATH superfamily
2QA4A 4KHPL 3DM1A 4LBZA 2KBNA 3D4RA 3ES9A 1BCPB 4RKBA 3NWTA 5CDFA 2X8KA 1KZLA 3A5UA 3KF6A 4DR4L 1ZM2A 5GV8A 4ID6A 3R93A 5C4XG 1WD0A 1QILA 1ZM9A 2G9HD 1XPUA 3U6KA 1PH4A 4ACBA 1EU4A 1PTOH 5IYNA 3KK7A 2C35B 4GZYC 1Q3LA 4XT1B 5JAVA 1YHAA 3HAGA 4A3MB 1HR0L 1ENAA 4RKLA 5M3MH 2CH4A 4KY5A 3CD6A 3ZIAA 2UXBL 4R4QA 1MHWC 1DDGA 2L9HA 4QMGA 5C4JH 1NDHA 2EYFA 4CJ1B 1SYDA 2QKIC 1XNRL 3A8KE 1YNND 4JYAQ 3EVQA 4XLEA 4LMQD 2ASBA 2QCPX 2JA8G 5EPLA 1KRSA 1E1QA 2M2LA 1QH0A 2XZLA 1NJID 3MTSA 2KVMA 2NN6G 4FXKC 4QUCA 4GOPB 2Q2UA 1E2VA 3C1EA 3GO5A 2BPOA 3EN2A 4IOCA 1HR0W 3A1PA 2E75C 2D2CC 4DV1L 2D3LA 3QG1A 2WB1B 2J4XA 3OYYA 2CW0D 4BXXH 1N05A 4OHJA 2Z4IA 1EFID 1BR9A 4MNOA 2XN9C 1AH9A 3PO2G 1CA5A 1I4HA 1YLOA 1TY0A 3PUYA 4OPVA 1P8LA 4KV6A 4HN7A 5JJZA 4QGUA 3VNUA 3D26A 1EP2B 1OXUA 2DETA 4RH6A 1PH6A 3BY2A 3AVVA 5C0XJ 1YI2B 5FK9C 1U9RA 4HJ9A 1FYCA 3KF6B 2EJGC 1X3EA 3PVDA 1J5EL 4MTKA 2VXWA 4HJ5A 1TWCB 5KNLA 2BE5D 3K58A 4GKKL 5M3MG 3OKXA 1OXSC 1TUIA 1GVPA 1SE3A 1V1PA 2OEOA 3ZYYX 3CC2A 1O80A 3FKIG 2QDLA 2J7ZA 2SEBD 3GVLA 5IT9L 2WB1E 1D5ZC 5FA6A 2QW7A 3HOXG 3K0YA 4L5RC 1SXTA 1KC8C 4A3IH 1WTOA 1XJVA 5KSWB 4P72A 3K80C 2FMMA 4KJNA 3CCSB 3A74A 3HOZG 1VHEA 1KABA 3M7NA 1D5XC 2MPMA 1LTRD 1QB5D 1IBKL 4ZQ3A 4B9WA 1PKVA 1VQLB 5IT9E 1N07A 2H1EA 3OWEB 4LNQA 1DM0B 4B47A 1G6PA 3VA7A 3OW7A 4OWWB 4II3A 2F0EA 3HEJA 4PGOA 3NELA 2OWOA 3H91A 1VQ7B 1V0FA 1I4QA 1UD6A 3QFSA 5J22A 4WQMA 1G7SA 2C2WA 4OIJA 4B3RQ 1L1OA 5HZAA 3F1ZA 4B3FX 4QIWB 1G7RA 1PTOF 1ZEQX 2Z6BA 5M5WB 4DF7A 4LF6Q 2R7DA 4FYDA 1LTID 2VL6A 3W2IA 3I91A 4QCLA 3WYAA 3FPPA 1LT5D 4DXGA 1Y14B 3CPWB 1BBUA 5TY0A 4LJZC 5M5YH 4B43A 1WJJA 4KY7A 2RHQB 5IODA 3J80E 4TMVA 4A3GG 5DS0A 3AFPA 1PV4A 3ZBTA 4DV2Q 2MO1A 2KQ3A 2MJ8A 2EY5A 3KLSA 3NQTA 1CKOA 2E5LL 2NTSA 1YIJB 2N3SA 2EVBA 2XRQD 4RD4A 5M3MB 4N3NA 4ME3A 3SK8A 2WAQE 1HQRD 1SKQA 2ZTNA 3CPFA 2N55A 2A69D 2VJIA 2NZ1D 2MGSA 3CU7A 2E76C 4QB4A 4XT3B 1D2BA 5JVG3 3W1BA 1XX8A 1RTNA 3H9NA 1FNDA 2D9UA 2CFMA 5J3OA 3FKSA 4MYTA 3F2DA 1LTGD 1Q8KA 2IX0A 1EWCA 3SHLA 3ZPNA 1CQFA 5BN4A 1PTOD 5DM63 1Q81C 1IBKQ 2DGYA 1EFTA 4RGOS 2JA7H 4HJ7A 4RD0A 5EMNA 1LTLA 1N36Q 4DK1A 5FO8B 2LS01 3GP7A 1XMOL 2ES2A 4JBJA 1PH7A 1Q9SA 2RKSA 2OTJA 3MCAA 2J7KA 1O78A 3UDGA 5EPKA 5IOCA 1IYUA 2B2TA 3GTPH 1JOQA 2SNMA 3PGZA 3I2ZA 2ZXPA 1EFRA 2R7FA 3J81E 4BS9A 4H44C 2KUMA 1BXTA 2EXZA 2Y0SB 3OAAA 4P12A 4DNTB 1ZKOA 3NTKA 2NN6H 1II3A 5LMNW 1MIUA 4OOVA 2HUGA 2Q6LA 3CMAB 1Q86D 4DK6C 4QF4A 3RZOH 4M0LA 2WIIB 1Q82C 4A3EG 5F4MA 4GS3A 4TSFA 1S5CD 2LKVA 4LF7L 4HCEA 5GAEC 1OGJA 4GOPC 3AFQA 3CCJA 3NWSA 4TMTA 1O7IA 1WTWA 3S16H 4PC6A 4X65Q 3AB9A 2C78A 4QFMA 4E6IA 4G4KA 2PNHA 4OELB 3SJZA 3I4NG 1ZM3A 3HOVH 4Z4VA 5I9PA 4C3JB 3HOUG 2F0MA 2V7TA 2IX3A 3ICEA 4LFCL 4FXGC 4GN3B 5HZBA 1D2EA 1WCMG 1QVCA 5E1FA 4AQYL 4RCOA 4M4SA 3LVBA 1UE6A 2EE1A 4QL5A 1X65A 5D3DA 3M4PA 1HZBA 4WZEA 3FPUB 3NUCA 1QUQB 2BH2A 1JCKB 2E2DC 3CCUA 1XE1A 5JPMC 1ENFA 3SK4A 4C3HB 3TS0A 1N08A 1U2RA 3Q23A 2YWHA 1UEAB 3TBIB 5C3EG 1SYGA 1E79A 3S24A 5DM73 4A3BB 5M5XB 2RC6A 3SGIA 3CCEA 4NMZA 4IALA 3RY8A 4DAYA 2WR8A 2ZL7A 2VQEQ 1JNYA 3FKIB 4EQOA 1Q7YC 4BWGB 2M5SA 3JQPA 5H5JA 3G7LA 1F9SA 1GR1A 4PMBA 4DR1L 2B2YA 1NMFA 3CCVA 1VF7A 1TY2A 2WINB 2L12A 5IGCA 1X55A 1BBXC 2JQOA 4JV5Q 2HDNB 2ZM6Q 5IK2A 3ER0A 3RZDB 2OYNA 3KF8B 4UZEA 3E20A 2CBXA 5EQ0A 3IRBA 3D6CA 3B78A 2K75A 4PZ7A 2B7BA 3I55B 1SYFA 2DIEA 1BCPF 3CC7A 4NXML 3MFGA 3S1QH 3QSYA 1LLRD 1JJ2A 5ELFA 3PUMA 3OE7A 3KL9A 3J81c 4DU9A 4C43A 2VQFQ 3MEFA 1ZUNB 4P2NA 2K14A 4IPGA 2BVNA 2F0PA 2X6YA 2E2JB 2KHSA 4GOPA 1KD1D 1WCMH 2RQXA 1DCZA 1HNWQ 1HFNA 4C3IH 3PIPA 2PW7A 5KNBA 3WWVA 2FVGA 1S3OA 2F0FA 1PZID 1DGSA 3R6JA 3U2QA 4A3KG 3HKZB 1AE3A 4YELA 3ZZ0A 2V7UA 4AYBE 3KDFB 4B9XA 1N34Q 1EIHA 1S4MA 1LUZA 4A76A 2JA6G 1PJ5A 4UDUC 1TS4A 4HAEA 4NPSA 1K9MC 1HHVA 1AE2A 1B9NA 1JMCA 3RLOA 1EIGA 4YY3L 4I7AA 1VQPA 1BCPC 1VQ9A 5JJLA 1DZ1A 1PH9A 2NTTA 3L0OA 2K28A 1XMQL 3X3NA 5TR9A 2HLDA 3VR2A 2F4NA 5EJWA 3EA6A 5CORA 4R4IA 2F0UA 4BY1B 3J80L 4Z4ZA 3KLSX 3KF8A 5EAYA 1B50A 3Q8DA 1PYBA 5LL6S 1JJGA 4CKEA 2K03A 4LF9Q 2KJXA 1IBMQ 3P27A 3VYRA 1DONA 2E2HH 2F0LA 2UU9Q 4BY1H 3MXGA 3CB4A 4B3GA 3S15H 4IQZA 1JWUD 4DPGA 4IOAA 2J0TD 2Z9HA 4C3HG 1DG1G 1EQQA 2F1MA 4OGQC 5F2DA 3TN2A 3BNWA 2DJGC 2AQ3B 4CDEC 1QVFB 4LC0A 1HPCA 2BMWA 1PLFA 1X6OA 1FNUA 3PIOA 1RCVD 4DV1Q 1XXGA 4A93B 5BR8L 1QUQA 5AN9A 1D5MC 3A3GA 1JQYD 1WFQA 1AW7A 4IUVA 1K83H 2K5DA 2VB2X 1IKLA 2XRSD 1C9OA 4DR6Q 1C7YA 3ND9A 3HOWB 1PFMA 2OQKA 1W2BA 3BVGA 5JOBA 1V43A 3MHBA 4BBSG 3QJYA 4DV4L 4YXWA 4XD7A 1UNSA 2WPDA 4FN5A 1OTCA 3QE2A 4X7CA 1GUTA 5CBAE 2Q2IA 4H9GA 3RZDH 1YZ6A 3J7A5 1WOOA 5FIUA 1FNCA 2R7ZG 4GKKQ 2NVXB 3A3BA 4DR2L 1FDRA 4YAUA 2VUMH 3T4AC 4DV0L 3W3AA 3K59A 1PHJA 3DEOA 1CUKA 2EXDA 1HZEA 3VO2A 1UD4A 1N0VC 4PABA 4XLAA 2Q6IA 2DJFC 4KN4C 3KJPA 1KK3A 3V76A 1AMOA 3JQQA 2YWFA 4XQFA 5IYPA 4NXNL 3G4SA 1CQXA 2XWJB 2B2VC 2XSCA 4LWCA 2M9VA 3SVMA 4DK0A 2ICEC 1STEA 1B1ZA 4B3ML 3H3VH 1EIFA 1KLUD 3FHWA 1JB9A 1WCMB 3OJXA 4ACAA 4L5TA 1KK0A 2B2TC 4C3IB 3ONYA 5L37A 2L15A 1S72B 4KHVA 4F87A 5IP9H 4Z4WA 1LT3D 2A68C 3PUZA 4YAOA 5BR8Q 1TWAH 2CWPA 2K1BA 3A0JA 2K5WA 1EYDA 1UEBA 1CHQD 2HHHQ 4AF6A 3MVVA 4B3SL 1P4MA 5K36H 2F0VA 3M4YA 2EIFA 3JC66 1AIPA 1VQPB 3C3LA 3NTHA 3GTJH 3B6YA 1VQ4B 1Q1BA 1EQTA 1G51A 3OHXC 1AEXA 1R5NA 3ASRA 4APVA 1Y1WH 4R4TA 3NENA 2BGIA 4MN3A 5C0XG 3KDFA 4OO1H 1JWSD 5NUCA 4DV2L 4PG3A 4JI0Q 1EQRA 4KTAA 1H9SA 2OTLA 3MA2B 1XPRA 3AEVA 2OXPA 2AQ2B 5HGTA 1SMYD 1RQRA 4JI4L 4P71A 1EEID 5KW9A 3BVMA 4IN3A 4A3JG 4IUTA 4A3FB 4A3MH 1SRUA 3J80c 1SM4A 1IXRA 2OBTA 2BGJA 2DN8A 2R6GA 2E2HB 3ND8A 1GO3E 4K8JA 3HP3A 4JPBW 1K8AC 3PO2H 1CHPD 3SLNA 4HR7B 4OWXB 3VYTA 4G5GA 3TEHB 2X6XA 4CKCA 4ZRZA 1KK2A 5TRDA 3CC7B 5GADC 3GSIA 2XZOA 3KFUA 2PLFA 3A8KA 1QE6A 3D31A 1JC7A 3K7AB 4LBYA 2NB0A 4DGZA 4X62Q 3W5VA 1H9KA 4Z4SA 2KEDA 5IGDA 4HMJA 3V2TA 4LK1C 5I2YA 3CCLA 2YU9B 1FR3A 3CPWA 4UAIA 1I4GA 3CCVB 3DLLA 2L1BA 2JJQA 4DUYQ 3PO3H 1SMYC 1ICWA 4X3SA 5KIXA 2FHTA 3D3RA 4P2CB 2VNKA 4H13C 1YJNA 5IWAL 3U9OA 3MXUA 4CDDC 3SKBA 2HIXA 4X07A 1Y1WG 1CZGA 5EBDA 4XN0A 2X3UA 3GQBA 2QN6A 3CMMA 4P3YA 3I3CA 5C3XA 5M9OA 1IJEA 4GNXA 4HEDA 1X54A 1SE2A 1E1TA 3KLRA 4RCZA 4ZK9B 4DUZL 2DY7A 2JA7B 1N06A 1PZKD 1FX0A 1HUNA 4BBRB 3AVXA 3SEJA 2Q8IB 5CC4A 2X69A 2OK7A 1K8AD 4TSSA 2GQFA 5E4WC 5C44B 3S1NB 3CXCB 2XNJA 2OTLB 4C1NK 3BVZA 1E64A 3HOXB 5EKKA 4AF7A 3K5OA 2BOSA 2RDGA 4G1VA 2HCJB 2AWNA 3I7FA 1N32Q 2ZXIA 3UDFA 1S5FD 3TSSA 4NCNA 3U50C 1T6YA 1STNA 2DNEA 2XWBB 3S15B 2KENA 4X05A 1JWMD 4GN5A 2XGTA 5C44G 1E7ZA 1Y8NB 3STBC 2BDOA 4K2KA 1ENCA 2A19A 2NUCA 4OONA 2C5HA 3M3YB 4JI0L 3GDEA 2NBFA 3GTQB 5CV5A 3OTOL 3ZZUA 3NBIA 1KAAA 2EYLA 2E8GA 5M3FG 1PRTD 5G3LF 3M9BA 1I6HH 1C48A 4DV6L 4XL9A 2B29A 3CMAA 2YWGA 4LFAQ 5LMNL 2V1CC 3FP9A 4FF4A 1V0EA 1SFOB 4IUQA 4A3CH 1KNEA 1K8GA 1HVXA 1EFUA 3HG9A 3A8IA 2EYHA 4FDBA 3CCQA 2VNIA 3WOFA 2EY2A 1NCVA 3K5NA 4FXDA 2R7ZB 1IYVA 2I5MX 3GTJB 4ZUIA 2A6HD 1CM9A 2UXCL 1K0RA 3PUNA 2GN5A 3OW2A 4WZKA 1VQNB 2VY3A 3BZDB 1BKBA 1K8MA 1EP3B 2XIWA 5IGFA 1YJ9B 3H0GH 4PZ8A 4NB3A 1YBYA 1LACA 4X62L 4DR1Q 3RR5A 1Q12A 2EYPA 3CESA 4RD2A 2RDFA 1ONLA 2DNCA 5C5MA 1SSOA 3T13A 1VQIA 2LMCB 5M5YB 3EBEA 1DOKA 3BJUA 4QIWE 2NWGA 1LO5D 5CMDA 1WSVA 1R4QB 1VQKA 4JI6L 4DQLA 3J7ZC 4ABNA 3DWPA 4BY7G 5CV9A 3CAMA 5FOBB 1G2SA 2F0JA 2ICIA 3ULJA 3G6JB 3BY1A 1GUSA 2CRVA 4XIGS 4X7DA 1A3UA 1J6QA 5D14A 2F0KA 1EXMA 2E1RA 2K7VA 1HXYD 3OZWA 1BCPD 1LT4D 4A3LG 3MC0B 4LUOA 4LF4Q 4KLKA 2IW3A 5C4HA 1W35A 3WQZA 3J81k 1A15A 4Y52H 2NPFA 1Y1VB 1FGBD 1SR3A 1EFCA 2NVYB 2WACA 1SYCA 2VNJA 1CFMA 2C9OA 2F52A 4R1JA 3OEHA 1U4LA 1XYIA 4DR7Q 1CT1D 1XNRQ 1IHMA 4Z4UA 4CJ0B 1SNCA 4IPHA 5C5LA 1Y69U 3NEMA 1VMPA 3G6EA 4A3CG 4ZCMA 3K7AH 5B6IA 4GLXA 1QUFA 4RMFA 2ZXHA 2A68D 2FXQA 4WJWA 5FNZA 1GJRA 5IYBH 1LTBD 1WPCA 4JI8Q 2B2UA 4K14A 2B5OA 2PQAA 3JAMc 3G05A 4P74A 5LL6X 2JA8H 2NVTH 1QZGA 1FNVA 1GUNA 1T6ZA 3F2BA 4AH6A 4M1KA 4OP7A 4U68A 1X3GA 4K5WA 1B53A 1STYA 5E3FA 3RNUA 1F77A 3E9IA 3Q24A 5T1IA 1YITA 4EGVA 1B8AA 1STAA 1YNNC 4JI1L 4C3HH 3NBHA 2RA4A 2JA8B 2GJKA 2DEUA 5A89A 2NYZD 3QFCA 1M4VA 4IZ8A 3DDYA 5LMUL 1PA6A 1NAPA 2F0OA 4RGTA 1SNDA 1H9RA 2RBMA 3WNDA 3W2FA 1VQLA 2UXDL 4ROXA 3GTLB 4C3JG 2QEJC 5ISRA 3QOJA 5IYDH 4LF8Q 2GVAA 2IL8A 1K9MD 1UUPA 4F7DA 3G6EB 1IHZA 1X56A 4RD6A 2G5DA 4LFBL 3UE1A 2F1LA 4BPRA 1HZCA 5IGEA 3FJOA 5EBCA 1CI3M 3K5LA 1HNXL 3QFRA 1FNMA 3H09A 3I4NH 3HS0C 4WWVA 4Y9RA 1QJOA 2KEEA 4DK3C 1IKMA 2WKDA 1N8RC 4KD3A 2ZJQA 3AQQA 4X64L 2UUCQ 5FLXL 4TKOB 4DR7L 4ASUA 2PI2E 1FJGL 5IYBG 4BY7H 3DUZA 1TXYA 4PMCA 4LF7Q 1F2ZA 4KI0A 1V8QA 2K5NA 1I7PA 1QGZA 1W0KA 3CHBD 3JAME 3MFYA 1W0JA 1F20A 1I5FA 3ITPA 2N88A 3K81C 3LO8A 1NBMA 3I56A 2XVSA 4UZUA 3BH4A 3I70A 4BY7B 2VW9A 1WTPA 2E2IB 2NN6I 4JI2L 5FLXE 5DSZA 1B70B 3GTOB 2YWEA 4UAJA 3GTMB 2PMDA 4BBSH 1SJHD 3WY9A 1VQNA 1ILPA 2JA5B 1JB3A 1OB0A 2Z8LA 4RDJA 1Y8PB 3P20A 2CHBD 5C6AA 1QUEA 2LFNA 1Q86C 2CQOA 1NJIC 3HOWH 5IYWA 1VQGA 5M3FB 1S72A 1TWHH 3K0XA 1YVCA 2V31A 4AC9A 4TN1A 3I4MG 1D1IA 1PFSA 3CRLC 1W6KA 5IYQA 2IT1A 4YCUA 4HIDA 4DXFA 2QEXA 1G7CA 5FKAC 2XNCA 2JA6B 2RVLA 1VQ6A 3A7LA 3EIVA 5DAUA 1EY8A 4RWSC 3CC4B 4V0BA 1F9RA 3CMEA 5DN6A 2B39A 1UWVA 1TS5A 3HKZG 4QUZA 3FMCA 4A3KB 3HOVB 1GHKA 3X3MA 1LT6D 1BUVT 4Y7NH 1EWHA 1PH5A 1MJEA 2IY5B 4B3TL 5HY6A 2A6EC 3FRPB 1XMOQ 2PZWA 4FF3A 1A8PA 4HIMA 2Z1CA 5IP9G 2UUCL 2XNAC 2HDMA 1P16A 4Q7JB 1YHBA 2RSNA 4XKVA 5E6TA 5KRUA 4PNYA 1HJPA 1BNZA 1ASZA 1GKHA 1YNXA 1EY7A 5H1SE 1EY0A 2F0DA 1JE4A 2X6WA 4YAWA 1FNWA 3AVTA 1VQAA 4O1NA 1DOLA 4DR5Q 3S2HB 2RDHA 1N0UA 1ZYRD 4ZGQB 1PMRA 1E63A 5FO0A 2KCMA 3TQYA 2UUBQ 3SE0A 3CMEB 3QIAA 2O5JC 4RCNA 2NZHA 2CW5A 1S40A 4DAVA 3CQZH 4X0CA 2AKWB 1YJNB 4P26A 5JBQA 1BDOA 4WZLA 3CP0A 1SMXA 3GTLH 2L4NA 5KYLA 1V9PA 4Z1MA 1I4RA 1F60A 1EZ6A 1SAPA 5KGUA 4Z4YA 4PMWA 1KC8D 1EOVA 4RDKA 4TMWA 1EWIA 4RGMA 1XMQQ 5EKLA 2UUAQ 4C1NI 4JI3Q 2E74C 3HOZH 2R92H 2B2WC 3BDCA 4CDCC 2GJPA 1WORA 5HGQA 2W6JA 1QVGB 1RF2D 4A3IG 1L2FA 3I4OA 3QWNA 2AQ1B 1XNQL 1FL0A 2QTLA 1SNMA 4A3IB 2VNUD 1H8EA 2DUDA 3MXNA 2ZL5A 4K2LA 1TWFB 1VF5C 3FEWX 2EY6A 2JIZA 3TZDA 5GQOA 4LUVA 5CBEE 4G7HC 5EKIA 3S1MB 5TSSA 2ZTDA 3U4VA 1IYJB 1ML0D 4PV1C 3V05A 3HOUH 1DXMA 3ONUA 1G8ZD 2WAQG 2ATWA 3PF4A 3PUVA 4JK1C 3WDNA 4JOIA 1VQ4A 1PH3A 2AWOA 4JI5L 1NB0A 1U0LA 3BYYB 4IPDA 1JE5A 4S3SA 1VQOA 1ESFA 2WJYA 3PMFA 2WZPP 1OO9B 2F43A 1E22A 3H3VI 1NUCA 3E0EA 2BM0A 3J81L 3BCDA 2CKZB 2EYJA 1EYAA 1MSHA 4EX5A 3QFTA 3T1YQ 2GJRA 1HZAA 3H15A 1E1RA 2A6HC 2ENBA 1BX1A 2HT1A 4HE6A 2YYZA 2A69C 4NNJA 1PYSB 1VQ5B 4AIMA 4RAUC 1VQJA 5TV2A 4B48A 3MWYW 4YHBA 4MIUA 3VR3A 1WD1A 2O5IC 4CGYB 1KMHA 3SJPA 3TRZA 3S2DH 4LF6L 1L0WA 3T1HL 4LF5L 4A3EB 4XQNA 3EFXD 1K0SA 4HTHA 2VNHA 2R93H 2ALYB 1LTTD 4MZ9A 3E9HA 4A3DH 1XNQQ 4A75A 3S16B 2B8GA 1IW7C 4N8FA 2ZZQA 4PC2A 4O2DA 5CV4A 1JA0A 3BDOA 3G71A 2OT2A 1D7QA 3LQ6A 4OOSA 1L0YB 1QFJA 1JB7A 1KTVA 5I6YA 1XTDA 1WI5A 2EYMA 2RHSB 1IBLL 2AUKA 2F0IA 1VQMA 5ELEA 4IJHA 3GTMH 5AJ3Q 1DDIA 4TQUS 1GUGA 1MSGA 4BBSB 1KXLA 4LUZA 4PZ6A 1B4OA 2E2IH 1NY4A 1EIYB 1EEFD 2D5DA 4GQNA 4ULLA 1J9ZA 1E3XA 2VBVA 5F4OA 2JK8A 1EY6A 1EYGA 4QJFA 5FO9B 4JI5Q 4IFDG 2VBSA 4QY7A 1V1PB 2BV3A 4XYQA 2BM1A 1LV9A 2CW0C 2K5VA 2N8NA 3PV0A 2KHJA 2UU9L 1JA1A 5CR3A 4DNIA 2X53S 3RN5A 1QNKA 4B08A 1Q8IA 2VBUA 1WOCA 3I4MH 1FNBA 2F0GA 2G9DA 3SEBA 4NKLA 4A3FH 3PO3G 1MABA 2V7WA 1VQ5A 3R8BA 2KCNA 1TWGB 1L0XB 1SYBA 2CNDA 3OIPA 3GTGB 1LM0A 1OXVA 1EZ8A 3HFZB 1TTTA 1EFWA 1UE7A 4KHZA 2R93G 5HKKA 4GN4B 2QDBA 2M00A 1PZJD 5IYCH 5ELBA 4ODGA 1K28D 2K5HA 1YHQA 5C4XH 1JOOA 1A63A 2EY1A 1G291 3TP7A 2YU9H 2NVQB 4HJAA 1X3PA 1WTXA 3CCQB 4BY1G 2JA5G 4KKUA 1B2RA 4QVAA 3KJOA 2QGQA 1AP0A 1KRHA 3P7JA 3F8TA 1XPOA 3D8GA 1GVHA 1D8TA 1IB0A 2JN4A 2DYIA 1QGAA 3TP8A 3IAYA 4C3JH 4C0SA 4G7ZC 1Q7YD 4Z4TA 1NR4A 3UDIA 1LTAD 1H85A 2LSSA 5IIFA 1PH2A 4RG1A 2EQSA 4XLCA 2V7XA 5BSXA 5LMUQ 3L9AX 1Q82D 4ZCLA 2IPKD 4KJOA 2QILA 3ASQA 1O7YA 1TVXA 4O0AA 5EGTA 3MAQA 4J8QA 1GJXA 2I5HA 5CV6A 4CDFC 1OXTA 1QFZA 2QMUA 1K3BC 4NW2A 4UY8C 1YX2A 2VYQA 4DR2Q 4NXNQ 4LFBQ 1SBBB 4FO2A 1YJWA 3GTKB 3GVKA 2YTXA 4X8IA 4ILWA 3CXCA 2QGGA 4GLAC 3WXMA 1TLLA 1I3QH 2F03A 3S2DB 1UD3A 3NP8A 5ELDA 1Q90A 1HR0Q 3NE5B 1STHA 2R93B 4L6TB 1FJGQ 4L5QA 4ZCKA 4A3DB 3IFDA 4DN4M 4LAAA 1HA3A 1QX4A 1VQ8A 3F2CA 3NK9A 3TREA 4RCYA 1N9WA 2I0QA 4N8X1 3QOLA 4RPDA 4DAMA 2LXJA 1PH1A 3FVQA 4WFN3 1XQBA 3S1RH 1R9TB 2K5QA 4JI2Q 4KKTA 1L1OC 1K83B 4WZTA 1U5KA 2F0QA 1KK1A 3H3VC 2K33A 5C3EB 1NMGA 2R6HA 3GV6A 1VQBA 5C0XI 2ZTGA 1I8DA 2F0WA 3U9SA 2ZT9C 4JCVE 1QZHA 3S1RB 3I90A 2JEBI 2QE7A 2GK7A 4DV6Q 3UI2A 2IJ0A 2VQFL 2C4TA 2D3NA 1HCZA 4OIKA 2EDGA 5J35A 3NHHA 1DOMA 2R3ZA 5LMNQ 3VNVA 1A2TA 1SJED 2R9VA 1Y0RA 3W2GA 1K28A 3AGQA 5DEHA 4AYBB 4HE5A 4C2MB 1HNWL 2KA7A 3J81j 4XORA 3C2QA 4CQJA 3NTIA 2FX3A 3J7AV 2Z4HA 1FRQA 1X3FA 4DV5Q 3PIO3 3I4LA 4FXUA 3VR6A 1MJCA 4QVJA 1MI2A 2PCFB 4DR3L 1D8LA 2K6AA 3D6WA 2ID0A 3A54A 1ET6A 1TKWB 5IT9c 4RJLA 4C2MH 3GTQH 2WYRA 3OJWA 1H9JA 1VQHA 2FMCA 3HKSA 2EYOA 4X7EA 3JAMi 5M3FH 2V4DA 1N33Q 4JW0A 3OP1A 4XQJA 3M4OH 5ELNA 3MHPA 1Y1VG 1EY4A 1DJRD 2X6LA 1PVOA 3VO1A 3RZOB 4XM3A 4J0QA 4Y9UA 4B3RL 1OGIA 4J15A 2PPBC 1AFPA 4JG2A 2X6GA 4A4IA 4UPAA 2JA6H 4JOIC 3E3XA 1VQKB 2VS1A 1PFNA 5A35A 4XOPA 4MHEA 4HMIA 5A2QL 1K73D 5IYDG 3I56B 1QCBD 1UD2A 1IBML 2UUBL 2LXKA 2CF4A 2Q6KA 4RLZA 2VZAA 4HSVA 3K5MA 1E2ZA 1YHQB 4P9SA 2QDXA 1RDPD 1S5ED 4EQ5A 4A93H 4J6HA 3RN2A 4YALA 1JT8A 1STGA 1SEBD 4BA1I 2Y0SG 2P3MA 4R8NA 3S17B 1YNJC 4JVZA 3S9WA 1XFOA 3GD7A 1SKYB 3J80i 2A5HA 2Q2TA 4XR6A 1M90D 3CTAA 2PIAA 2A73B 4K5VA 2QTZA 2E1BA 1M8AA 3K57A 1WDTA 3VR4A 1KHIA 2K04A 1C0AA 2PNRC 2VBTA 2PYKA 4JBMA 1J8IA 4R8IA 5JJKA 3M7GA 2X0KA 3T53B 1UMKA 3EQLC 1H8HA 1S5DD 1K73C 2ZJPA 3QR8A 2WFWA 3DEPA 4FVMA 1T5XD 1N32L 4O42A 2O4XA 3VYUA 1HA5A 4Q5VA 2QF7A 5L46A 1KRTA 4DNRB 1I4XA 4DV0Q 1COWA 1C8CA 4JBKA 3H0GG 1BQQT 4P1VA 3LGJA 1IZ6A 3MXNB 1DYQA 2R92G 3HZXA 3PQIA 2BDNA 3N6RA 3IL8A 4KD4A 3HOZB 3W2EA 1YIJA 2O2LD 2Q6OA 2ZZGA 4BBRG 4DQKA 5JJIA 4RD3A 1R9TH 3OTOQ 4G7WA 3J7AF 1VQMB 2RF4A 2CVRA 5HXBA 1KQSB 2PI2A 3U6BA 1R5BA 2R92B 2XNDA 1XWEA 3SK6A 1ILQA 3W2HA 4DV7L 2SDFA 2GA4B 2JYOA 1Z47A 4EQPA 1RHPA 1TWAB 1PRTB 4PC1A 1N33L 4A3GB 3PUWA 4YCWA 3EROA 2L55A 4OO1G 1E3PA 1VCIA 4F88A 1JR0D 3A8JE 1Z7TA 4ALPA 1KQSA 5IE8A 1RIPA 2WB1G 3JQRA 3A7AB 3R3OA 2B7CA 1A3TA 2NZOA 2D0PA 2AHOB 1NR2A 5HURA 3BYTB 2C77A 4K5XA 4A3JH 2JN9A 1Q46A 4LF4L 1I50B 1U4RA 2B63G 1KDBA 1A8VA 4YHHQ 4KK7A 2MNAA 3AMUA 3KLWA 2N49A 2BE5C 4HIZA 3Q0AA 3MZ5A 3PUXA 1RKNA 4C56C 4I7ZC 3RMHA 4OEMB 4ZUJA 4TMZA 1G2TA 4V190 4A3JB 3CCSA 2WAQB 1EWYA 3OMGA 4XXEA 1N8RD 3J81i 3HOXH 1R4PB 4YIJA 3S14H 4BA2I 1VMCA 1MRZA 5GAGC 3CF5A 1WTVA 4QQBX 1K8OA 1C4QA 4RDLA 2F3WA 3URYA 1GAWA 1PJ7A 3P1HA 3WOEA 5K5PA 1WSRA 1S4ZA 1WTQA 3M3YH 2ZBUA 4TMXA 1GOZA 5I9OA 3AVYA 1LABA 3V96A 4WRDA 3TS2A 1TQOA 1BF4A 4A3LH 2BA1A 4P75A 4K1XA 1GUWA 4P22A 3RLNA 1VQCA 3E6ZX 3N52A 2X85A 3OW2B 5E7NA 1AZQA 3ASSA 4M8AA 1I6HB 1NRKA 2BA0A 2K32A 1I94Q 4N3GA 2ZZFA 3A56A 3HGBA 1F9QA 1GD7A 2B8FA 2B2VA 4ZAIA 4DV7Q 3Q38A 3R6KA 3Q6SA 4LBVA 4I65A 4FWTA 3IKJA 1HA6A 1KDCA 1NE3A 4L63B 3AYHB 2FFKB 3R2IA 3S1MH 2HCCA 1Y0YA 2B2YC 1TWHB 4DUYL 1QVGA 2I07B 4HCSA 2UXDQ 4WJ4A 2I46A 1BMFA 5FLXc 3FKIH 1BPLA 5DNFA 4NXMQ 1VDZA 3D4WA 1KNAA 3H0GB 1CA6A 5ELOA 2GREA 3L3OC 4NDXA 4NBSA 5M5XH 3I55A 3GTPB 1GO2A 1IL8A 2GVBA 4LBWA 4CJ2C 4HIOA 3STBD 1KJZA 5GV7A 1CSQA 1SROA 3CRZA 4JV5L 3S1NH 2ZBVA 1WYDA 3KOJA 3U58A 2H4OA 2CCZA 4YHHL 1TT2A 2HD3A 3J7YW 3NPPA 1H95A 5JEAG 5CYUA 4H02A 5E4XA 3ZUGA 2BCOA 4U9UA 1CTMA 4KMUC 4GNXC 1F9PA 3TZUA 3UE0A 4JI7L 1PRTC 5D65A 4DAYB 4DFAA 1KTKA 3PCOB 4RGNA 4X3KA 4EQNA 4F8MA 2D9RA 5DLQE 4XLHA 1D1NA 2RCNA 3AVUA 1IJFA 2EJFC 1CK1A 1ICFB 2E5LQ 1IL2A 1Y1VH 2NVYH 1TWFH 2MP1A 3LWEA 1HRJA 1E0BA 2I5LX 3H94A 1BX0A 2K52A 3GV3A 5FO1A 3CCUB 1Q81D 3M4QA 4X64Q 1A3VA 4G7OC 1G6ZA 1NBWA 1W2BB 4HIKA 1WVLA 1EQVA 5IY0A 3GVJA 4YWKA 4AYBG 1M1KC 5ELCA 1QG0A 3NQIA 3OZVA 3P75A 4OXPA 5I2XA 4POGA 2ZXRA 2D74A 3WNBA 2NV4A 3PENA 2JE6I 2Y0SE 5C4XB 2Z0SA 3NSWA 4QV2A 3WBJA 4M1UB 1E3ZA 3JU4A 4XKWA 1B3QA 2F0TA 4KKSA 1N36L 1SE4A 2B3GA 1QVFA 1E1OA 4TRDA 1FD7D 4K0KQ 1STBA 3CCJB 1OHHA 4DV3Q 1ET9A 4ME5A 1S5BD 1RODA 4JBWA 1WU8A 3FPKA 2UXCQ 2IWHA 1BJKA 1PH8A 4A3BH 2JJ1A 5A88A 2CWAA 1U4PA 5KNDA 1K3RA 3CPXA 2CK3A 3G71B 4XOTA 3DMUA 1KAWA 2F4VL 1V1QA 1W9XA 4LF9L 4WORA 1WTRA 1FVIA 3CCLB 1SNPA 2A1AA 1KLGD 1GAQA 1I6VC 1LYLA 1MKHA 1I18A 5M5WH 3SLDA 4JI6Q 5IGGA 3W2DA 3I4MB 2N78A 2HCIA 2OQ0A 2OF1A 2HQEA 1B3AA 3SXHA 1RD9D 4KY6A 4L5SA 1WTHD 3DWQA 2JJ2A 4JI7Q 3HOYH 1AZPA 5G3LD 4FF2A 1CNEA 4IFDH 3MMPA 4UZFA 4X65L 4R71A 2SNSA 3PO3B 1XTCD 3KBGA 3PA1A 2F3VA 3OOCA 3Q3AA 4XONA 4ZGNB 5C3WA 1QNUA 2VZLA 5JEAH 3HOYB 3V7AA 4FNFA 2ZL6A 2HQLA 2BF4A 4AQYQ 4P6VF 2ZITA 2WSSA 3I73A 1S0UA 5FJ8G 3HRZC 4XN3A 3T1HQ 4LF5Q 2AUJD 1X32A 3A55A 1H9MA 4P3IA 1B2TA 3U4ZA 4U673 4CHTB 1G91A 2I1LA 2D0OA 1A62A 3OPOA 4OWTB 1QOHA 4A3DG 2IX1A 1GM5A 1HH2P 2K01A 3I1FA 4G6IA 1HQMC 2VJJA 2FJ2A 4DKAC 3CKIB 1W87A 1EUJA 3A35A 4A3MG 1IBLQ 1CKNA 4RA8A 5I6WA 4DV3L 3F2UA 3WNCA 3PF5A 3LNNA 1Y8OB 1TU2B 3E5SA 5C3EH 2VQEL 3TDQA 1TR5A 2F4IA 4B3MQ 3HKZE 1KIXA 1PDQA 2VB3X 3MXPA 2K4KA 1H42A 2F4VQ 3CCMB 3ASPA 2Z6KC 4TVAB 3Q6QA 3KUPA 2OK8A 3ULPA 1VLYA 1NNXA 3GTKH 3IFTA 4B44A 2UUAL 3OMCA 4KHPQ 1SDFA 4WJ3M 3B8HA 4IURA 2F0HA 1M90C 2V7VA 3S14B 2B63H 3SR1A 1L1OB 1ZYRC 2C5CA 4OL7A 3G4SB 1V1OA 2XEXA 3B82A 1WP6A 5C4JB 2F0NA 2Q2HA 3ASTA 1UAPA 2KHIA 2PO4A 1HNXQ 3L7ZC 4A3KH 1M1KD 4A3EH 2C4UA 2YTYA 2PE3A 3I8ZA 3KBXA 4FF1A 2TMPA 3EJIA 1VQDA 2A74C 2EZVA 2XTIA 4X06A 4XNFA 1E24A 4CKBA 5IP7H 4PC3A 3K6OA 4LF8L 1CSPA 4G7XA 1T9HA 2CC2A 1SLJA 2WP8J 1RL2A 2RC5A 4PAAA 2L5TA 3FDTA 2JXMB 3PIP3 1HUMA 4YCVA 4IPCA 4Z4RA 5J1ZA 3T1YL 2JDIA 5IYRA 1Y1WB 2PMZE 2D62A 4K8IA 4JC0A 4N9PA 3S2HH 3OFNA 1PTOC 4YY3Q 1T5EA 3RD4A 2JA7G 1HTLD 3S17H 3SK5A 1VQ6B 3WBKA 1Q1EA 4XLFA 2V7QA 3CW2A 4OPOA 1NSNS 1N34L 5BN3A 1EY5A 5COYA 4OO1I 2EOTA 2NVXH 1TWGH 1EY9A 4C3IG 3W5UA 2OCEA 3O13A 4G1BA 4TT3A 1B44D 4IUNA 3SDZA 4X7FA 4IJLA 3CCMA 3T56B 4L8JA 2F0SA 1SYEA 1JORA 3AU7A 2HIVA 4G57A 3TMEA 5C0XH 1YEZA 2ZJRA 2WKCA 3W5HA 1VS0A 2EJMA 1LTSD 4F7XA 3MEHA 4UP9A 4YAFA 5CV8A 2A8VA 3K8AA 2WV6D 1J5EQ 5IWAQ 3RLFA 2Z6KA 2XOKA 5AJ3L 3K7UC 4Y7NB 2OTJB 3CRKC 2PMZB 1VQ9B 2W6IA 5GROA 1X9NA 3M4OB 2NVTB 2JEAI 1EL0A 2P5ZX 1T6XA 3LWUA 1FRNA 1CZWA 1B7YB 2K50A 1KDAA 2Q8RE 1CKMA 2WZNA 3ULLA 4OPSA 4OX9Q 2H5XA 2KCTA 1YJWB 1H9SB 4HSPA 3ZZTA 1BOSA 1HFGA 2L11A 4DR6L 2YV5A 4RHRA 1VQOB 1JJCB 1OB2A 3CP2A 2DCUA 1E62A 1PRTF 2CQAA 4MTNA 1PJ6A 4DAPA 1W6JA 4EVOA 1QFYA 1A2UA 1ASYA 3HOUB 2F3IA 1VQEA 4B3TQ 4R4CA 4Q0FA 2ZM6L 1U4MA 4ZKCB 1RQPA 3OWFA 5KNCA 1WOPA 3ZBUA 1I3QB 2PZUA 4X66L 5JEAJ 5D3IB 5I4DA 1UE5A 3W5OA 4MYUA 1GHJA 1RJTA 2MQHA 4J1MA 2EPBA 4XTCS 5C44H 3VMFA 1UD8A 1B23P 3DM3A 2QA4B 1BQEA 2L0CA 4DR5L 4IW3B 1EOTA 3ZJYC 2MFIA 4XYOA 3LX0A 3A8JA 4RD1A 5EPJA 2SOBA 3CW2C 4YWLA 2IHEA 2BSAA 2PZTA 4DV5L 3NBHB 1FGUA 1UE1A 2LY7A 4JI3L 1A0IA 1V5VA 1YITB 5FLMH 2B2UC 4GKJQ 1F2MA 4K6DA 1I94L 4ZYSA 2A6ED 5C4ZA 3S1QB 1TIID 1NB9A 4QHYA 4YWMA 4LFAL 3W1GA 4P73A 1HZ9A 3BQJA 2R7ZH 4RHSA 1X3QA 5JPNC 5FJ8H 3Q6RA 1ZM4A 1TS2A 4K6LA 2WJVA 1JICA 4UP7A 2JA5H 2EIXA 1VLOA 3OIQA 2GPJA 2R61A 3AGPA 2HHHL 3LQEA 3CCEB 3QO2A 3KEWA 3BG3A 2MO0A 4IO9A 1VQ7A 3E1YE 2TSSA 4IUUA 1G7TA 2CH4W 3VYSA 4UP8A 1GXDC 3Q22A 4BBRH 1KD1C 4QUFA 3C46A 1BBWA 3OZUA 1EYCA 4XQQA 3JAML 3GIRA 2LZJA 1I4PA 5AFWA 3OSOA 1UD5A 1HNZQ 4X6AH 3CC2B 4X66Q 4OX9L 4H0LC 4YEJA 3CC4A 5KYIA 3GTOH 4A93G 1ESRA 2DOGA 2Q8TA 5IP7G 1JOKA 4H7BA 2HDLA 1AN8A 2XZPA 2RSOA 1VJSA 2QEXB 3HOVG 2C5BA 3H6MA 1YI2A 5IGBA 1QG7A 4CBVA 1J9OA 3BCFA 4R4OA 5T1GA 3CP8A 4JI8L 4FP5D 1VQFA 5BN5A 4E0FA 3RUZA 2HMAA 3Q39A 1TVCA 4M2LA 1Z9FA 2ZXOA 2B63B 3M85A 4B4DA 1TWCH 3VR5A 4BXXG 1QGYA 4GLVB 4XDXA 2E2JH 5FLMG 2KECA 5K36G 5A2QE 2NVQH 4JI1Q 4NP5A 5FL7A 2EFGA 3L2PA 4GKJL 2K05A 4PQXA 2OBRA 1SFOH 1BVSA 1ELOA 2YTVA 4OOXA 1E2WA 5H59A 1ZXTA 1D6EC 2MUYA 2IHFA 3ONAB 1SE8A 1O7ZA 4RFBA 5J39A 1W34A 1F2LA 4DV4Q 1DARA 4XMYA 3BU2A 4K0KL 1A6XA 1OB5A 2XGJA 3ERSX 1YJ9A 2RCFA 3BZKA 4JMQA 4P6YA 2BN4A 4LFCQ 4HJ8A 4A3BG 4II2A 3BS1A 5CV7A 4DR3Q 4KN7C 4DR4Q 1CKNB 2DY1A 1MBYA 1VHOA 3NXWA 1OXXK 3CD6B 2ZTEA 3I72A 1DD2A 4M53A 1RTOA 3BC9A 2DY8A 3E0JA 2JA9A 4ZKBB 2GK6A 1CNFA 2AMCB 5KEEA 4R9WA 1MGSA 4A3FG 3T16A 1MD2D 1TS3A 5LMZA 1XB2A 4X3TA 4IFDI 4P25A 4AVZA 4JYAL 3BZCA 3TP6A 3D0FA 2VUMG 1O7LA 1F2YA 3CQZB 4ZLTF 1SNQA 3A5ZB 2KOLA 1SNOA 4IUPA 1E43A 4Z9CB 3ISXA 1EP1B 1GUOA 3I4NB 3HOWG 5F4JA 3P26A 1HTPA 5IYCG 4DUZQ 3ZC3A 5LHY1 3C1FA 1HNZL 2JSOA 3HOYG 3GTGH 3KYHC 3AVWA 2UXBQ 4B3XA 1PXUA 2FINB 5GAHC 5JVH3 3A8IE 2KVOA 4X3UA 1CQVA 1JJ2B 2KCCA 2PW5A 3BDLA 4LW1A 1D1KA 4FK8A 3DXJC 4UHVA 3TP5A 5CGKA 3CCRA 3PO2B 3ERQA 4B3SQ 1EU3A 1WOSA 2ZZEA 1IW7D 4ZCIA 1BO0A 4RM0A 1NTGA 3D4DA 3PA2A 1SN8A 4A3GH 3R2TA 1KL9A 4N9TA 2JP1A 1QWYA 2MHVA 4PC7A 4GNXB 2ZTCA 5BSYA 2BH8A 4IFDJ 2AHOA 1WTHA 2OBSA 1B9MA 3DHQA 3PSIA 3OEEA 3CCRB 2DERA 1R5OA 3DWAA 5FO7B 1VQ8B 4POFA 3C2PA 1I50H 3VA5A 4Y7CA 3T51B 3QB3A 4JI4Q 4DA2A 5THXA 5J3BA 1BLIA 3VDYA 5A8AA 2VUMB 3G48A 2Z6BD 4EH1A 1Z6HA 3UDXA 4ZV4A 2PQAB 1YNJD 4RPBA 2PQEA 1W3SA 1PYWD 2B2WA 1PTOB 1PFBA
chains in the Genus database with same CATH topology
3DM1A 3D4RA 1BCPB 4RKBA 3NWTA 5CDFA 2X8KA 1KZLA 3R93A 4ID6A 1WD0A 1QILA 2G9HD 1EU4A 1PTOH 3KK7A 4GZYC 1Q3LA 4XT1B 5JAVA 3HAGA 4A3MB 1ENAA 4RKLA 4KY5A 3ZIAA 2L9HA 4QMGA 2EYFA 4CJ1B 1SYDA 2QKIC 3A8KE 1YNND 3EVQA 4XLEA 4LMQD 2QCPX 5EPLA 1E1QA 2M2LA 2XZLA 3MTSA 2KVMA 2NN6G 4FXKC 4QUCA 1E2VA 3C1EA 3GO5A 2E75C 2D2CC 2D3LA 3QG1A 2WB1B 2J4XA 2CW0D 4OHJA 2Z4IA 1EFID 1BR9A 2XN9C 1CA5A 1I4HA 1TY0A 3PUYA 4KV6A 4HN7A 5JJZA 1OXUA 4RH6A 5C0XJ 5FK9C 1U9RA 1FYCA 2EJGC 2VXWA 1TWCB 5KNLA 2BE5D 3K58A 1OXSC 2OEOA 1SE3A 1V1PA 3ZYYX 1O80A 2J7ZA 2SEBD 3GVLA 5IT9L 1D5ZC 3K0YA 1SXTA 1WTOA 2FMMA 4KJNA 1KABA 3M7NA 1D5XC 2MPMA 1LTRD 1QB5D 4ZQ3A 4B9WA 1PKVA 5IT9E 2H1EA 3OWEB 1DM0B 3VA7A 3OW7A 4II3A 2F0EA 3HEJA 3H91A 1V0FA 1I4QA 1UD6A 5J22A 4OIJA 4B3FX 4QIWB 1PTOF 1ZEQX 5M5WB 4DF7A 4FYDA 1LTID 3I91A 4QCLA 3FPPA 1LT5D 4DXGA 4LJZC 4KY7A 5IODA 3J80E 2KQ3A 2MJ8A 2EY5A 3KLSA 3NQTA 2NTSA 2EVBA 2XRQD 5M3MB 3SK8A 1HQRD 2ZTNA 2N55A 2A69D 2VJIA 2NZ1D 2MGSA 3CU7A 2E76C 4QB4A 4XT3B 1D2BA 5JVG3 1XX8A 1RTNA 2D9UA 3FKSA 1LTGD 2IX0A 3SHLA 1EWCA 3ZPNA 1CQFA 5BN4A 1PTOD 5DM63 4RGOS 4DK1A 5FO8B 2LS01 3GP7A 2RKSA 1O78A 5EPKA 5IOCA 1IYUA 2B2TA 1JOQA 2SNMA 2ZXPA 1EFRA 3J81E 4BS9A 4H44C 2KUMA 1BXTA 2EXZA 2Y0SB 3OAAA 4DNTB 1ZKOA 3NTKA 2NN6H 1II3A 2HUGA 4QF4A 2WIIB 4TSFA 1S5CD 2LKVA 4HCEA 3NWSA 1WTWA 3AB9A 4E6IA 4G4KA 5I9PA 4C3JB 2F0MA 2IX3A 4FXGC 5E1FA 4RCOA 2EE1A 5D3DA 3FPUB 3NUCA 1JCKB 2E2DC 5JPMC 1ENFA 3SK4A 4C3HB 3Q23A 1UEAB 3TBIB 1SYGA 1E79A 5DM73 4A3BB 5M5XB 4NMZA 4IALA 4DAYA 3FKIB 4EQOA 4BWGB 2M5SA 3G7LA 1F9SA 4PMBA 2B2YA 1VF7A 1TY2A 2WINB 2L12A 5IGCA 1BBXC 5IK2A 3RZDB 5EQ0A 3D6CA 1SYFA 2DIEA 1BCPF 3MFGA 1LLRD 5ELFA 3OE7A 4DU9A 2F0PA 2X6YA 2E2JB 2KHSA 2RQXA 1DCZA 1HFNA 2PW7A 5KNBA 2F0FA 1PZID 3HKZB 4YELA 4B9XA 1EIHA 4UDUC 1TS4A 4HAEA 1HHVA 1B9NA 1EIGA 1BCPC 1DZ1A 2NTTA 2K28A 3X3NA 2HLDA 3VR2A 5EJWA 3EA6A 5CORA 2F0UA 4BY1B 3J80L 3KLSX 3KF8A 1B50A 5LL6S 4CKEA 2K03A 2KJXA 3VYRA 1DONA 2F0LA 3MXGA 4B3GA 4IQZA 1JWUD 2J0TD 4C3HG 2F1MA 4OGQC 5F2DA 3TN2A 2AQ3B 1HPCA 1PLFA 1FNUA 1RCVD 1XXGA 4A93B 4A3EB 4IUVA 1D5MC 3A3GA 1JQYD 1AW7A 2K5DA 2VB2X 1IKLA 2XRSD 3ND9A 3HOWB 1PFMA 3BVGA 5JOBA 1V43A 3MHBA 3QJYA 4YXWA 4XD7A 1UNSA 2WPDA 1GUTA 5CBAE 2NVXB 3A3BA 3T4AC 3W3AA 3K59A 3DEOA 1HZEA 1UD4A 4XLAA 4KN4C 4XQFA 2XWJB 2B2VC 2XSCA 2M9VA 3SVMA 4DK0A 2ICEC 1STEA 1B1ZA 1KLUD 1WCMB 2B2TC 4C3IB 4KHVA 4F87A 1LT3D 2A68C 3PUZA 2K1BA 2K5WA 1EYDA 1CHQD 3MVVA 5K36H 2F0VA 3M4YA 3C3LA 3NTHA 1Q1BA 1EQTA 3OHXC 1AEXA 4MN3A 5C0XG 4OO1H 1JWSD 5NUCA 4KTAA 1H9SA 3MA2B 2OXPA 2AQ2B 5HGTA 1SMYD 1EEID 4IN3A 3BVMA 4IUTA 4A3FB 2DN8A 2R6GA 2E2HB 3ND8A 4K8JA 3HP3A 1CHPD 4HR7B 3VYTA 2X6XA 4CKCA 4ZRZA 2XZOA 3D31A 1QE6A 3K7AB 1JC7A 4DGZA 2NB0A 1H9KA 2KEDA 5IGDA 4HMJA 3V2TA 4LK1C 5I2YA 2YU9B 1FR3A 4UAIA 1I4GA 2L1BA 1SMYC 1ICWA 4X3SA 5KIXA 2FHTA 3D3RA 4P2CB 4H13C 3U9OA 3MXUA 1CZGA 5EBDA 4XN0A 3GQBA 3CMMA 3I3CA 5C3XA 5M9OA 4HEDA 1SE2A 2JA7B 3KLRA 4ZK9B 2DY7A 1PZKD 1HUNA 1FX0A 4BBRB 2Q8IB 5CC4A 2X69A 4TSSA 5E4WC 5C44B 3S1NB 4C1NK 3BVZA 3HOXB 5EKKA 3K5OA 2BOSA 2RDGA 2AWNA 2ZXIA 1S5FD 3TSSA 1STNA 2DNEA 2XWBB 3S15B 1JWMD 1Y8NB 2BDOA 4K2KA 1ENCA 2NUCA 3M3YB 2NBFA 3GTQB 5CV5A 3NBIA 1KAAA 2EYLA 1PRTD 5G3LF 1C48A 4XL9A 4FF4A 1V0EA 1SFOB 4IUQA 1KNEA 1HVXA 3HG9A 2EYHA 3WOFA 2EY2A 1NCVA 3K5NA 4FXDA 2R7ZB 1IYVA 3GTJB 4ZUIA 2A6HD 1CM9A 3BZDB 1K8MA 5IGFA 2XIWA 1LACA 1Q12A 2EYPA 3CESA 2RDFA 1ONLA 2DNCA 5C5MA 1SSOA 3T13A 2LMCB 5M5YB 1DOKA 2NWGA 1LO5D 5CMDA 1R4QB 4ABNA 3DWPA 5CV9A 5FOBB 1G2SA 2F0JA 2ICIA 3G6JB 1GUSA 4XIGS 1A3UA 5D14A 2F0KA 2K7VA 1HXYD 1BCPD 1LT4D 3MC0B 2IW3A 5C4HA 3WQZA 1A15A 1FGBD 1Y1VB 2NVYB 2WACA 1SYCA 2C9OA 1CFMA 1XYIA 3OEHA 1U4LA 1CT1D 4CJ0B 1SNCA 5C5LA 1Y69U 1VMPA 2ZXHA 2A68D 4WJWA 1LTBD 1WPCA 2B2UA 4K14A 3G05A 5LL6X 1FNVA 1GUNA 4U68A 4K5WA 1B53A 1STYA 5E3FA 1F77A 3Q24A 5T1IA 4EGVA 1STAA 1YNNC 3NBHA 2RA4A 2JA8B 2GJKA 2NYZD 1M4VA 4IZ8A 3DDYA 1NAPA 2F0OA 4RGTA 1SNDA 1H9RA 2RBMA 3GTLB 4C3JG 2QEJC 5ISRA 3QOJA 2IL8A 1UUPA 1IHZA 5IGEA 5EBCA 1CI3M 3K5LA 3H09A 3HS0C 1QJOA 2KEEA 1IKMA 2WKDA 4KD3A 5FLXL 4TKOB 4ASUA 3DUZA 4PMCA 1F2ZA 4KI0A 1V8QA 1W0KA 3CHBD 3JAME 3MFYA 1W0JA 3ITPA 2N88A 1NBMA 2XVSA 4UZUA 3BH4A 3I70A 4BY7B 1WTPA 2E2IB 2NN6I 5FLXE 3GTOB 3GTMB 1SJHD 1ILPA 2JA5B 1JB3A 1OB0A 2Z8LA 1Y8PB 3P20A 2CHBD 5C6AA 2LFNA 5M3FB 2V31A 1D1IA 3CRLC 1W6KA 2IT1A 4DXFA 5FKAC 2JA6B 2RVLA 3A7LA 5DAUA 1EY8A 4RWSC 4V0BA 1F9RA 5DN6A 2B39A 1TS5A 3FMCA 4A3KB 3HOVB 1GHKA 3X3MA 1LT6D 1BUVT 1EWHA 2A6EC 3FRPB 2PZWA 4FF3A 2Z1CA 2XNAC 2HDMA 2RSNA 4XKVA 5KRUA 4PNYA 1BNZA 1EY7A 1EY0A 2F0DA 1JE4A 2X6WA 1FNWA 4O1NA 1DOLA 3S2HB 2RDHA 1ZYRD 1PMRA 3SE0A 3QIAA 2O5JC 4RCNA 4DAVA 1BDOA 2L4NA 5KYLA 4Z1MA 1I4RA 1EZ6A 1SAPA 5KGUA 4PMWA 4RGMA 5EKLA 4C1NI 2E74C 2B2WC 3BDCA 2GJPA 2W6JA 1RF2D 3QWNA 2AQ1B 1SNMA 4A3IB 2VNUD 1H8EA 3MXNA 4K2LA 1TWFB 1VF5C 3FEWX 2EY6A 2JIZA 3TZDA 5CBEE 4G7HC 5EKIA 3S1MB 5TSSA 4PV1C 1ML0D 3V05A 1DXMA 1G8ZD 3PUVA 4JK1C 3WDNA 2AWOA 3BYYB 4S3SA 1ESFA 2WJYA 3PMFA 2WZPP 1OO9B 2F43A 1NUCA 3J81L 3BCDA 2EYJA 1EYAA 1MSHA 2GJRA 1E1RA 2A6HC 2ENBA 2YYZA 2A69C 4NNJA 4RAUC 3MWYW 4MIUA 3VR3A 1WD1A 2O5IC 4CGYB 1KMHA 4XQNA 3EFXD 4HTHA 1LTTD 3S16B 2B8GA 1IW7C 2ZZQA 5CV4A 3BDOA 2OT2A 1L0YB 5I6YA 2EYMA 2AUKA 2F0IA 5ELEA 4TQUS 1GUGA 1MSGA 4BBSB 1B4OA 1EEFD 2D5DA 4GQNA 4ULLA 1E3XA 1EY6A 4IFDG 5FO9B 4XYQA 1V1PB 1LV9A 2CW0C 3PV0A 5CR3A 2X53S 1QNKA 4B08A 1Q8IA 2F0GA 2G9DA 3SEBA 4NKLA 1MABA 3R8BA 2KCNA 1TWGB 1L0XB 1SYBA 3OIPA 3GTGB 1OXVA 1EZ8A 4KHZA 5HKKA 2QDBA 2M00A 1PZJD 5ELBA 4ODGA 1K28D 1JOOA 2EY1A 1G291 3TP7A 2NVQB 1X3PA 1WTXA 4KKUA 1AP0A 3P7JA 3D8GA 3TP8A 3IAYA 4G7ZC 1NR4A 1LTAD 5IIFA 4XLCA 3L9AX 2IPKD 4KJOA 2QILA 1O7YA 1TVXA 5EGTA 3MAQA 4J8QA 1GJXA 5CV6A 1OXTA 4NW2A 1SBBB 4FO2A 3GTKB 3GVKA 4ILWA 2F03A 3S2DB 1UD3A 3NP8A 5ELDA 1Q90A 3NE5B 1STHA 2R93B 4L6TB 4A3DB 3IFDA 4DN4M 4LAAA 3NK9A 3QOLA 3FVQA 4WFN3 1R9TB 2K5QA 4KKTA 1K83B 2F0QA 3H3VC 2K33A 5C3EB 3GV6A 5C0XI 2ZTGA 1I8DA 2F0WA 3U9SA 2ZT9C 3S1RB 3I90A 2JEBI 2QE7A 2GK7A 3UI2A 2IJ0A 2D3NA 1HCZA 4OIKA 2EDGA 3NHHA 1DOMA 2R3ZA 1A2TA 1SJED 2R9VA 5DEHA 4AYBB 4C2MB 2KA7A 4XORA 3NTIA 3J7AV 2Z4HA 3PIO3 3I4LA 4FXUA 3VR6A 1MI2A 2PCFB 2K6AA 3D6WA 2ID0A 3A54A 1ET6A 1TKWB 1H9JA 2FMCA 2EYOA 2V4DA 4XQJA 1EY4A 1DJRD 2X6LA 3RZOB 4XM3A 2PPBC 1AFPA 2X6GA 1PFNA 5A35A 4XOPA 4MHEA 4HMIA 5A2QL 1QCBD 1UD2A 4HSVA 3K5MA 1E2ZA 1RDPD 1S5ED 4J6HA 1STGA 1SEBD 4BA1I 4R8NA 3S17B 1YNJC 3S9WA 3GD7A 1SKYB 2A5HA 4XR6A 2A73B 4K5VA 2E1BA 1M8AA 3K57A 3VR4A 2K04A 2PNRC 2PYKA 1J8IA 4R8IA 3M7GA 3T53B 3EQLC 1H8HA 1S5DD 3DEPA 4FVMA 1T5XD 4O42A 2O4XA 3VYUA 1HA5A 4Q5VA 2QF7A 4DNRB 1I4XA 1COWA 1C8CA 1BQQT 1DYQA 3HZXA 2BDNA 3N6RA 3IL8A 4KD4A 3HOZB 2O2LD 2ZZGA 4G7WA 3J7AF 2CVRA 2R92B 2XNDA 1XWEA 3SK6A 1ILQA 2SDFA 2GA4B 2JYOA 1Z47A 4EQPA 1RHPA 1TWAB 1PRTB 4A3GB 3PUWA 3EROA 2L55A 4OO1G 4F88A 1VCIA 1JR0D 3A8JE 1Z7TA 3R3OA 3A7AB 1A3TA 5HURA 1NR2A 3BYTB 4K5XA 1I50B 1U4RA 1KDBA 4KK7A 3AMUA 3Q0AA 2BE5C 4HIZA 3MZ5A 3PUXA 1RKNA 4C56C 4I7ZC 3RMHA 4ZUJA 1G2TA 4V190 4A3JB 2WAQB 4XXEA 3OMGA 1R4PB 4YIJA 4BA2I 1VMCA 1WTVA 1K8OA 1C4QA 2F3WA 3URYA 5K5PA 3P1HA 3WOEA 1S4ZA 1WTQA 1GOZA 5I9OA 1LABA 3V96A 4WRDA 1TQOA 1BF4A 2BA1A 1GUWA 4P22A 3E6ZX 3N52A 2X85A 1AZQA 1I6HB 4M8AA 1NRKA 2BA0A 2K32A 2ZZFA 3A56A 3HGBA 1F9QA 2B8FA 2B2VA 4ZAIA 3Q6SA 4I65A 3IKJA 1HA6A 1KDCA 4L63B 2FFKB 3R2IA 2HCCA 2B2YC 1TWHB 2I07B 4HCSA 2I46A 1BMFA 1BPLA 5DNFA 1VDZA 3D4WA 1KNAA 3H0GB 1CA6A 3L3OC 4NDXA 3GTPB 1IL8A 4CJ2C 2H4OA 1TT2A 3J7YW 3NPPA 5JEAG 5CYUA 5E4XA 2BCOA 1CTMA 4KMUC 1F9PA 3TZUA 1PRTC 5D65A 4DFAA 1KTKA 4RGNA 4EQNA 4X3KA 4F8MA 4XLHA 2EJFC 1CK1A 2MP1A 3LWEA 1HRJA 1E0BA 3H94A 3GV3A 4G7OC 1A3VA 1G6ZA 1WVLA 1EQVA 3GVJA 5ELCA 3NQIA 3P75A 5I2XA 2ZXRA 2JE6I 5C4XB 3NSWA 4M1UB 1E3ZA 3JU4A 4XKWA 2F0TA 4KKSA 1SE4A 4TRDA 1FD7D 1STBA 1OHHA 1ET9A 4ME5A 1S5BD 1RODA 4JBWA 2IWHA 2JJ1A 1U4PA 5KNDA 3DMUA 2CK3A 4XOTA 1W9XA 4WORA 1WTRA 1SNPA 1KLGD 1I6VC 1I18A 5IGGA 3W2DA 3I4MB 2HCIA 2OF1A 2HQEA 1B3AA 3SXHA 1RD9D 4KY6A 1WTHD 3DWQA 2JJ2A 1AZPA 5G3LD 4FF2A 4IFDH 2SNSA 3PO3B 1XTCD 3KBGA 2F3VA 3OOCA 4XONA 5C3WA 1QNUA 5JEAH 3HOYB 4FNFA 2WSSA 3I73A 3HRZC 4XN3A 2AUJD 1X32A 3A55A 1H9MA 1B2TA 4U673 4CHTB 1G91A 3OPOA 1QOHA 2IX1A 2K01A 4G6IA 1HQMC 2VJJA 2FJ2A 3CKIB 3A35A 4RA8A 5I6WA 3F2UA 3LNNA 1Y8OB 1TU2B 3E5SA 3TDQA 1TR5A 2F4IA 1PDQA 2VB3X 3MXPA 3KUPA 1VLYA 3IFTA 3OMCA 1SDFA 4IURA 2F0HA 3S14B 3SR1A 2C5CA 1ZYRC 4OL7A 1V1OA 1WP6A 5C4JB 2F0NA 1UAPA 2PO4A 3L7ZC 3I8ZA 3KBXA 4FF1A 2TMPA 3EJIA 2A74C 2EZVA 4XNFA 4CKBA 3K6OA 4G7XA 2WP8J 2L5TA 3FDTA 2JXMB 3PIP3 1HUMA 5J1ZA 2JDIA 1Y1WB 2D62A 4K8IA 4N9PA 3OFNA 1PTOC 1T5EA 3RD4A 1HTLD 3SK5A 1Q1EA 4XLFA 2V7QA 1NSNS 5BN3A 1EY5A 5COYA 4OO1I 2EOTA 1EY9A 4C3IG 3O13A 4TT3A 1B44D 4IUNA 3SDZA 3T56B 4L8JA 2F0SA 1SYEA 1JORA 3AU7A 4G57A 3TMEA 5C0XH 2WKCA 2EJMA 1LTSD 4F7XA 3MEHA 5CV8A 2WV6D 3RLFA 2XOKA 4Y7NB 3CRKC 2PMZB 2W6IA 3M4OB 2NVTB 2JEAI 1EL0A 3LWUA 1CZWA 1KDAA 2Q8RE 1H9SB 4HSPA 1BOSA 1HFGA 2L11A 4RHRA 3CP2A 1PRTF 2CQAA 4DAPA 1W6JA 4EVOA 1A2UA 3HOUB 4Q0FA 1U4MA 4ZKCB 5KNCA 3OWFA 1I3QB 2PZUA 5JEAJ 5D3IB 5I4DA 1RJTA 1GHJA 4J1MA 2EPBA 4XTCS 1UD8A 2L0CA 1EOTA 4XYOA 3LX0A 5EPJA 2SOBA 2PZTA 2LY7A 2B2UC 1F2MA 4K6DA 4ZYSA 2A6ED 5C4ZA 3S1QB 1TIID 4RHSA 1X3QA 5JPNC 1TS2A 4K6LA 2WJVA 1JICA 3OIQA 2R61A 3QO2A 3KEWA 3BG3A 2TSSA 4IUUA 3VYSA 3Q22A 1GXDC 4QUFA 3C46A 1EYCA 4XQQA 3JAML 5AFWA 2LZJA 1I4PA 3OSOA 1UD5A 4H0LC 4YEJA 5KYIA 1ESRA 2Q8TA 1JOKA 4H7BA 2HDLA 1AN8A 2XZPA 2RSOA 1VJSA 3H6MA 5IGBA 1QG7A 4CBVA 1J9OA 3BCFA 5T1GA 3CP8A 4FP5D 5BN5A 4E0FA 3RUZA 2ZXOA 2B63B 3M85A 3VR5A 4XDXA 2KECA 5K36G 5A2QE 4NP5A 5FL7A 2K05A 4PQXA 1E2WA 1ZXTA 1D6EC 2MUYA 3ONAB 1O7ZA 4RFBA 5J39A 1F2LA 4XMYA 1A6XA 2XGJA 4JMQA 4II2A 3BS1A 5CV7A 4KN7C 1MBYA 3NXWA 1OXXK 3I72A 1DD2A 1RTOA 3BC9A 2DY8A 3E0JA 4ZKBB 2GK6A 5KEEA 4R9WA 1MGSA 3T16A 1MD2D 1TS3A 4X3TA 4IFDI 4AVZA 3TP6A 1O7LA 1F2YA 3CQZB 4ZLTF 1SNQA 2KOLA 1SNOA 4IUPA 1E43A 4Z9CB 3I4NB 1GUOA 1HTPA 5LHY1 3C1FA 2JSOA 1PXUA 2FINB 5JVH3 3A8IE 2KVOA 4X3UA 1CQVA 2KCCA 2PW5A 3BDLA 1D1KA 3DXJC 3TP5A 3PO2B 5CGKA 3ERQA 1EU3A 1IW7D 2ZZEA 1BO0A 3D4DA 3R2TA 4N9TA 2JP1A 1QWYA 2MHVA 4IFDJ 1B9MA 3DHQA 3OEEA 3DWAA 5FO7B 3C2PA 3VA5A 3T51B 3QB3A 4DA2A 1BLIA 2VUMB 2Z6BD 1Z6HA 1YNJD 2PQEA 1PYWD 2B2WA 1PTOB 1PFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK1 C;  2V4D A;  2A6E C;  3VA7 A;  3OW7 A;  3VR2 A;  3IFT A;  1YNN C;  3D4R A;  2A6H C;  3AB9 A;  2A68 C;  1Y8N B;  2YYZ A;  2A69 C;  2JE6 I;  1E2W A;  3PUZ A;  5KNC A;  1ZYR C;  2BE5 C;  2BDO A;  3PUX A;  2PPB C;  4I7Z C;  5K36 H;  2DNE A;  4KKS A;  1GHJ A;  1H9R A;  3VR3 A;  3M4Y A;  2O5I C;  4XTC S;  4GZY C;  1A6X A;  1GJX A;  5A35 A;  1OXT A;  3L7Z C;  4BA2 I;  1Q1B A;  4JBW A;  3FPP A;  1PMR A;  4KN7 C;  1K8O A;  1OXX K;  4IQZ A;  4LJZ C;  1E2Z A;  3SE0 A;  3QIA A;  3A8K E;  3I72 A;  2O5J C;  1DD2 A;  2B8G A;  4RCN A;  5KND A;  5C0X G;  1IW7 C;  2F1M A;  4OGQ C;  4OO1 H;  1LAB A;  3BDO A;  2L5T A;  1BDO A;  4BA1 I;  1CI3 M;  2JXM B;  1H9S A;  1HPC A;  1Q90 A;  1IYV A;  2BA1 A;  1YNJ C;  2NN6 G;  3GD7 A;  3NE5 B;  1E2V A;  1QJO A;  2A6H D;  1I6V C;  2AUK A;  2A6E D;  2BA0 A;  2D62 A;  2K32 A;  2EVB A;  4TQU S;  1GUG A;  4TKO B;  3VR4 A;  1K8M A;  2E75 C;  2D2C C;  3HGB A;  3QG1 A;  2B8F A;  2DN8 A;  1LAC A;  2PNR C;  2R6G A;  1O7L A;  4KI0 A;  3ND8 A;  1Q12 A;  2D5D A;  1T5E A;  1ONL A;  1V8Q A;  2DNC A;  3T53 B;  3IKJ A;  2A69 D;  1GUO A;  1VF7 A;  3EQL C;  2LMC B;  3MFY A;  4HR7 B;  3ND9 A;  4IFD H;  1Q1E A;  2E74 C;  1HTP A;  2E76 C;  4IFD G;  5BN3 A;  1V43 A;  2QF7 A;  3PUY A;  2CW0 C;  4DNR B;  3PV0 A;  3QJY A;  1VDZ A;  4KKT A;  3OOC A;  3D31 A;  2NN6 I;  5JEA H;  1OXU A;  3A8I E;  3BG3 A;  3SDZ A;  5BN4 A;  1H9K A;  3T56 B;  4L8J A;  1GUT A;  2KCC A;  1GUS A;  2K33 A;  4LK1 C;  3DXJ C;  4XIG S;  1FR3 A;  3I73 A;  3N6R A;  5C0X H;  2K7V A;  1VF5 C;  3U9S A;  1FYC A;  4DK1 A;  1IW7 D;  2AUJ D;  2EJM A;  2ZT9 C;  2EJG C;  1H9M A;  1SMY C;  2JEB I;  1Y8P B;  2BE5 D;  3P20 A;  3W3A A;  1HCZ A;  1O78 A;  1OXV A;  2EDG A;  3RLF A;  4G7H C;  4H0L C;  1IYU A;  1OXS C;  3OPO A;  4H13 C;  5JEA G;  1CFM A;  3MXU A;  3CRK C;  4KHZ A;  1DCZ A;  4PV1 C;  1CTM A;  4KMU C;  1HQM C;  3TZU A;  1DXM A;  3GQB A;  2JEA I;  5KNB A;  3LWU A;  2KA7 A;  4H44 C;  1Y69 U;  1B9M A;  3CRL C;  4KN4 C;  2IT1 A;  4DNT B;  1ZKO A;  3PUV A;  2EJF C;  3LNN A;  1G29 1;  1Y8O B;  1TU2 B;  2NN6 H;  2AWO A;  3I4L A;  2A68 D;  3KLR A;  3VR6 A;  3WDN A;  2PCF B;  3PUW A;  5BN5 A;  2Q8I B;  4KKU A;  3A7L A;  4OO1 G;  3T51 B;  1VCI A;  3H94 A;  3A8J E;  3M7N A;  1H9S B;  4DK0 A;  1TKW B;  1Z7T A;  3M85 A;  4G7O C;  3A7A B;  3FMC A;  1B9N A;  1H9J A;  3VR5 A;  1GUN A;  1Z6H A;  1GHK A;  5K36 G;  4G7Z C;  1EWH A; 
#chains in the Genus database with same CATH topology
 2QA4 A;  4KHP L;  3DM1 A;  4LBZ A;  2KBN A;  3D4R A;  3ES9 A;  1BCP B;  4RKB A;  3NWT A;  5CDF A;  2X8K A;  1KZL A;  3A5U A;  3KF6 A;  4DR4 L;  1ZM2 A;  5GV8 A;  4ID6 A;  3R93 A;  5C4X G;  1WD0 A;  1QIL A;  1ZM9 A;  2G9H D;  1XPU A;  3U6K A;  1PH4 A;  4ACB A;  1EU4 A;  1PTO H;  5IYN A;  3KK7 A;  2C35 B;  4GZY C;  1Q3L A;  4XT1 B;  5JAV A;  1YHA A;  3HAG A;  4A3M B;  1HR0 L;  1ENA A;  4RKL A;  5M3M H;  2CH4 A;  4KY5 A;  3CD6 A;  3ZIA A;  2UXB L;  4R4Q A;  1MHW C;  1DDG A;  2L9H A;  4QMG A;  5C4J H;  1NDH A;  2EYF A;  4CJ1 B;  1SYD A;  2QKI C;  1XNR L;  3A8K E;  1YNN D;  4JYA Q;  3EVQ A;  4XLE A;  4LMQ D;  2ASB A;  2QCP X;  2JA8 G;  5EPL A;  1KRS A;  1E1Q A;  2M2L A;  1QH0 A;  2XZL A;  1NJI D;  3MTS A;  2KVM A;  2NN6 G;  4FXK C;  4QUC A;  4GOP B;  2Q2U A;  1E2V A;  3C1E A;  3GO5 A;  2BPO A;  3EN2 A;  4IOC A;  1HR0 W;  3A1P A;  2E75 C;  2D2C C;  4DV1 L;  2D3L A;  3QG1 A;  2WB1 B;  2J4X A;  3OYY A;  2CW0 D;  4BXX H;  1N05 A;  4OHJ A;  2Z4I A;  1EFI D;  1BR9 A;  4MNO A;  2XN9 C;  1AH9 A;  3PO2 G;  1CA5 A;  1I4H A;  1YLO A;  1TY0 A;  3PUY A;  4OPV A;  1P8L A;  4KV6 A;  4HN7 A;  5JJZ A;  4QGU A;  3VNU A;  3D26 A;  1EP2 B;  1OXU A;  2DET A;  4RH6 A;  1PH6 A;  3BY2 A;  3AVV A;  5C0X J;  1YI2 B;  5FK9 C;  1U9R A;  4HJ9 A;  1FYC A;  3KF6 B;  2EJG C;  1X3E A;  3PVD A;  1J5E L;  4MTK A;  2VXW A;  4HJ5 A;  1TWC B;  5KNL A;  2BE5 D;  3K58 A;  4GKK L;  5M3M G;  3OKX A;  1OXS C;  1TUI A;  1GVP A;  1SE3 A;  1V1P A;  2OEO A;  3ZYY X;  3CC2 A;  1O80 A;  3FKI G;  2QDL A;  2J7Z A;  2SEB D;  3GVL A;  5IT9 L;  2WB1 E;  1D5Z C;  5FA6 A;  2QW7 A;  3HOX G;  3K0Y A;  4L5R C;  1SXT A;  1KC8 C;  4A3I H;  1WTO A;  1XJV A;  5KSW B;  4P72 A;  3K80 C;  2FMM A;  4KJN A;  3CCS B;  3A74 A;  3HOZ G;  1VHE A;  1KAB A;  3M7N A;  1D5X C;  2MPM A;  1LTR D;  1QB5 D;  1IBK L;  4ZQ3 A;  4B9W A;  1PKV A;  1VQL B;  5IT9 E;  1N07 A;  2H1E A;  3OWE B;  4LNQ A;  1DM0 B;  4B47 A;  1G6P A;  3VA7 A;  3OW7 A;  4OWW B;  4II3 A;  2F0E A;  3HEJ A;  4PGO A;  3NEL A;  2OWO A;  3H91 A;  1VQ7 B;  1V0F A;  1I4Q A;  1UD6 A;  3QFS A;  5J22 A;  4WQM A;  1G7S A;  2C2W A;  4OIJ A;  4B3R Q;  1L1O A;  5HZA A;  3F1Z A;  4B3F X;  4QIW B;  1G7R A;  1PTO F;  1ZEQ X;  2Z6B A;  5M5W B;  4DF7 A;  4LF6 Q;  2R7D A;  4FYD A;  1LTI D;  2VL6 A;  3W2I A;  3I91 A;  4QCL A;  3WYA A;  3FPP A;  1LT5 D;  4DXG A;  1Y14 B;  3CPW B;  1BBU A;  5TY0 A;  4LJZ C;  5M5Y H;  4B43 A;  1WJJ A;  4KY7 A;  2RHQ B;  5IOD A;  3J80 E;  4TMV A;  4A3G G;  5DS0 A;  3AFP A;  1PV4 A;  3ZBT A;  4DV2 Q;  2MO1 A;  2KQ3 A;  2MJ8 A;  2EY5 A;  3KLS A;  3NQT A;  1CKO A;  2E5L L;  2NTS A;  1YIJ B;  2N3S A;  2EVB A;  2XRQ D;  4RD4 A;  5M3M B;  4N3N A;  4ME3 A;  3SK8 A;  2WAQ E;  1HQR D;  1SKQ A;  2ZTN A;  3CPF A;  2N55 A;  2A69 D;  2VJI A;  2NZ1 D;  2MGS A;  3CU7 A;  2E76 C;  4QB4 A;  4XT3 B;  1D2B A;  5JVG 3;  3W1B A;  1XX8 A;  1RTN A;  3H9N A;  1FND A;  2D9U A;  2CFM A;  5J3O A;  3FKS A;  4MYT A;  3F2D A;  1LTG D;  1Q8K A;  2IX0 A;  1EWC A;  3SHL A;  3ZPN A;  1CQF A;  5BN4 A;  1PTO D;  5DM6 3;  1Q81 C;  1IBK Q;  2DGY A;  1EFT A;  4RGO S;  2JA7 H;  4HJ7 A;  4RD0 A;  5EMN A;  1LTL A;  1N36 Q;  4DK1 A;  5FO8 B;  2LS0 1;  3GP7 A;  1XMO L;  2ES2 A;  4JBJ A;  1PH7 A;  1Q9S A;  2RKS A;  2OTJ A;  3MCA A;  2J7K A;  1O78 A;  3UDG A;  5EPK A;  5IOC A;  1IYU A;  2B2T A;  3GTP H;  1JOQ A;  2SNM A;  3PGZ A;  3I2Z A;  2ZXP A;  1EFR A;  2R7F A;  3J81 E;  4BS9 A;  4H44 C;  2KUM A;  1BXT A;  2EXZ A;  2Y0S B;  3OAA A;  4P12 A;  4DNT B;  1ZKO A;  3NTK A;  2NN6 H;  1II3 A;  5LMN W;  1MIU A;  4OOV A;  2HUG A;  2Q6L A;  3CMA B;  1Q86 D;  4DK6 C;  4QF4 A;  3RZO H;  4M0L A;  2WII B;  1Q82 C;  4A3E G;  5F4M A;  4GS3 A;  4TSF A;  1S5C D;  2LKV A;  4LF7 L;  4HCE A;  5GAE C;  1OGJ A;  4GOP C;  3AFQ A;  3CCJ A;  3NWS A;  4TMT A;  1O7I A;  1WTW A;  3S16 H;  4PC6 A;  4X65 Q;  3AB9 A;  2C78 A;  4QFM A;  4E6I A;  4G4K A;  2PNH A;  4OEL B;  3SJZ A;  3I4N G;  1ZM3 A;  3HOV H;  4Z4V A;  5I9P A;  4C3J B;  3HOU G;  2F0M A;  2V7T A;  2IX3 A;  3ICE A;  4LFC L;  4FXG C;  4GN3 B;  5HZB A;  1D2E A;  1WCM G;  1QVC A;  5E1F A;  4AQY L;  4RCO A;  4M4S A;  3LVB A;  1UE6 A;  2EE1 A;  4QL5 A;  1X65 A;  5D3D A;  3M4P A;  1HZB A;  4WZE A;  3FPU B;  3NUC A;  1QUQ B;  2BH2 A;  1JCK B;  2E2D C;  3CCU A;  1XE1 A;  5JPM C;  1ENF A;  3SK4 A;  4C3H B;  3TS0 A;  1N08 A;  1U2R A;  3Q23 A;  2YWH A;  1UEA B;  3TBI B;  5C3E G;  1SYG A;  1E79 A;  3S24 A;  5DM7 3;  4A3B B;  5M5X B;  2RC6 A;  3SGI A;  3CCE A;  4NMZ A;  4IAL A;  3RY8 A;  4DAY A;  2WR8 A;  2ZL7 A;  2VQE Q;  1JNY A;  3FKI B;  4EQO A;  1Q7Y C;  4BWG B;  2M5S A;  3JQP A;  5H5J A;  3G7L A;  1F9S A;  1GR1 A;  4PMB A;  4DR1 L;  2B2Y A;  1NMF A;  3CCV A;  1VF7 A;  1TY2 A;  2WIN B;  2L12 A;  5IGC A;  1X55 A;  1BBX C;  2JQO A;  4JV5 Q;  2HDN B;  2ZM6 Q;  5IK2 A;  3ER0 A;  3RZD B;  2OYN A;  3KF8 B;  4UZE A;  3E20 A;  2CBX A;  5EQ0 A;  3IRB A;  3D6C A;  3B78 A;  2K75 A;  4PZ7 A;  2B7B A;  3I55 B;  1SYF A;  2DIE A;  1BCP F;  3CC7 A;  4NXM L;  3MFG A;  3S1Q H;  3QSY A;  1LLR D;  1JJ2 A;  5ELF A;  3PUM A;  3OE7 A;  3KL9 A;  3J81 c;  4DU9 A;  4C43 A;  2VQF Q;  3MEF A;  1ZUN B;  4P2N A;  2K14 A;  4IPG A;  2BVN A;  2F0P A;  2X6Y A;  2E2J B;  2KHS A;  4GOP A;  1KD1 D;  1WCM H;  2RQX A;  1DCZ A;  1HNW Q;  1HFN A;  4C3I H;  3PIP A;  2PW7 A;  5KNB A;  3WWV A;  2FVG A;  1S3O A;  2F0F A;  1PZI D;  1DGS A;  3R6J A;  3U2Q A;  4A3K G;  3HKZ B;  1AE3 A;  4YEL A;  3ZZ0 A;  2V7U A;  4AYB E;  3KDF B;  4B9X A;  1N34 Q;  1EIH A;  1S4M A;  1LUZ A;  4A76 A;  2JA6 G;  1PJ5 A;  4UDU C;  1TS4 A;  4HAE A;  4NPS A;  1K9M C;  1HHV A;  1AE2 A;  1B9N A;  1JMC A;  3RLO A;  1EIG A;  4YY3 L;  4I7A A;  1VQP A;  1BCP C;  1VQ9 A;  5JJL A;  1DZ1 A;  1PH9 A;  2NTT A;  3L0O A;  2K28 A;  1XMQ L;  3X3N A;  5TR9 A;  2HLD A;  3VR2 A;  2F4N A;  5EJW A;  3EA6 A;  5COR A;  4R4I A;  2F0U A;  4BY1 B;  3J80 L;  4Z4Z A;  3KLS X;  3KF8 A;  5EAY A;  1B50 A;  3Q8D A;  1PYB A;  5LL6 S;  1JJG A;  4CKE A;  2K03 A;  4LF9 Q;  2KJX A;  1IBM Q;  3P27 A;  3VYR A;  1DON A;  2E2H H;  2F0L A;  2UU9 Q;  4BY1 H;  3MXG A;  3CB4 A;  4B3G A;  3S15 H;  4IQZ A;  1JWU D;  4DPG A;  4IOA A;  2J0T D;  2Z9H A;  4C3H G;  1DG1 G;  1EQQ A;  2F1M A;  4OGQ C;  5F2D A;  3TN2 A;  3BNW A;  2DJG C;  2AQ3 B;  4CDE C;  1QVF B;  4LC0 A;  1HPC A;  2BMW A;  1PLF A;  1X6O A;  1FNU A;  3PIO A;  1RCV D;  4DV1 Q;  1XXG A;  4A93 B;  5BR8 L;  1QUQ A;  5AN9 A;  1D5M C;  3A3G A;  1JQY D;  1WFQ A;  1AW7 A;  4IUV A;  1K83 H;  2K5D A;  2VB2 X;  1IKL A;  2XRS D;  1C9O A;  4DR6 Q;  1C7Y A;  3ND9 A;  3HOW B;  1PFM A;  2OQK A;  1W2B A;  3BVG A;  5JOB A;  1V43 A;  3MHB A;  4BBS G;  3QJY A;  4DV4 L;  4YXW A;  4XD7 A;  1UNS A;  2WPD A;  4FN5 A;  1OTC A;  3QE2 A;  4X7C A;  1GUT A;  5CBA E;  2Q2I A;  4H9G A;  3RZD H;  1YZ6 A;  3J7A 5;  1WOO A;  5FIU A;  1FNC A;  2R7Z G;  4GKK Q;  2NVX B;  3A3B A;  4DR2 L;  1FDR A;  4YAU A;  2VUM H;  3T4A C;  4DV0 L;  3W3A A;  3K59 A;  1PHJ A;  3DEO A;  1CUK A;  2EXD A;  1HZE A;  3VO2 A;  1UD4 A;  1N0V C;  4PAB A;  4XLA A;  2Q6I A;  2DJF C;  4KN4 C;  3KJP A;  1KK3 A;  3V76 A;  1AMO A;  3JQQ A;  2YWF A;  4XQF A;  5IYP A;  4NXN L;  3G4S A;  1CQX A;  2XWJ B;  2B2V C;  2XSC A;  4LWC A;  2M9V A;  3SVM A;  4DK0 A;  2ICE C;  1STE A;  1B1Z A;  4B3M L;  3H3V H;  1EIF A;  1KLU D;  3FHW A;  1JB9 A;  1WCM B;  3OJX A;  4ACA A;  4L5T A;  1KK0 A;  2B2T C;  4C3I B;  3ONY A;  5L37 A;  2L15 A;  1S72 B;  4KHV A;  4F87 A;  5IP9 H;  4Z4W A;  1LT3 D;  2A68 C;  3PUZ A;  4YAO A;  5BR8 Q;  1TWA H;  2CWP A;  2K1B A;  3A0J A;  2K5W A;  1EYD A;  1UEB A;  1CHQ D;  2HHH Q;  4AF6 A;  3MVV A;  4B3S L;  1P4M A;  5K36 H;  2F0V A;  3M4Y A;  2EIF A;  3JC6 6;  1AIP A;  1VQP B;  3C3L A;  3NTH A;  3GTJ H;  3B6Y A;  1VQ4 B;  1Q1B A;  1EQT A;  1G51 A;  3OHX C;  1AEX A;  1R5N A;  3ASR A;  4APV A;  1Y1W H;  4R4T A;  3NEN A;  2BGI A;  4MN3 A;  5C0X G;  3KDF A;  4OO1 H;  1JWS D;  5NUC A;  4DV2 L;  4PG3 A;  4JI0 Q;  1EQR A;  4KTA A;  1H9S A;  2OTL A;  3MA2 B;  1XPR A;  3AEV A;  2OXP A;  2AQ2 B;  5HGT A;  1SMY D;  1RQR A;  4JI4 L;  4P71 A;  1EEI D;  5KW9 A;  3BVM A;  4IN3 A;  4A3J G;  4IUT A;  4A3F B;  4A3M H;  1SRU A;  3J80 c;  1SM4 A;  1IXR A;  2OBT A;  2BGJ A;  2DN8 A;  2R6G A;  2E2H B;  3ND8 A;  1GO3 E;  4K8J A;  3HP3 A;  4JPB W;  1K8A C;  3PO2 H;  1CHP D;  3SLN A;  4HR7 B;  4OWX B;  3VYT A;  4G5G A;  3TEH B;  2X6X A;  4CKC A;  4ZRZ A;  1KK2 A;  5TRD A;  3CC7 B;  5GAD C;  3GSI A;  2XZO A;  3KFU A;  2PLF A;  3A8K A;  1QE6 A;  3D31 A;  1JC7 A;  3K7A B;  4LBY A;  2NB0 A;  4DGZ A;  4X62 Q;  3W5V A;  1H9K A;  4Z4S A;  2KED A;  5IGD A;  4HMJ A;  3V2T A;  4LK1 C;  5I2Y A;  3CCL A;  2YU9 B;  1FR3 A;  3CPW A;  4UAI A;  1I4G A;  3CCV B;  3DLL A;  2L1B A;  2JJQ A;  4DUY Q;  3PO3 H;  1SMY C;  1ICW A;  4X3S A;  5KIX A;  2FHT A;  3D3R A;  4P2C B;  2VNK A;  4H13 C;  1YJN A;  5IWA L;  3U9O A;  3MXU A;  4CDD C;  3SKB A;  2HIX A;  4X07 A;  1Y1W G;  1CZG A;  5EBD A;  4XN0 A;  2X3U A;  3GQB A;  2QN6 A;  3CMM A;  4P3Y A;  3I3C A;  5C3X A;  5M9O A;  1IJE A;  4GNX A;  4HED A;  1X54 A;  1SE2 A;  1E1T A;  3KLR A;  4RCZ A;  4ZK9 B;  4DUZ L;  2DY7 A;  2JA7 B;  1N06 A;  1PZK D;  1FX0 A;  1HUN A;  4BBR B;  3AVX A;  3SEJ A;  2Q8I B;  5CC4 A;  2X69 A;  2OK7 A;  1K8A D;  4TSS A;  2GQF A;  5E4W C;  5C44 B;  3S1N B;  3CXC B;  2XNJ A;  2OTL B;  4C1N K;  3BVZ A;  1E64 A;  3HOX B;  5EKK A;  4AF7 A;  3K5O A;  2BOS A;  2RDG A;  4G1V A;  2HCJ B;  2AWN A;  3I7F A;  1N32 Q;  2ZXI A;  3UDF A;  1S5F D;  3TSS A;  4NCN A;  3U50 C;  1T6Y A;  1STN A;  2DNE A;  2XWB B;  3S15 B;  2KEN A;  4X05 A;  1JWM D;  4GN5 A;  2XGT A;  5C44 G;  1E7Z A;  1Y8N B;  3STB C;  2BDO A;  4K2K A;  1ENC A;  2A19 A;  2NUC A;  4OON A;  2C5H A;  3M3Y B;  4JI0 L;  3GDE A;  2NBF A;  3GTQ B;  5CV5 A;  3OTO L;  3ZZU A;  3NBI A;  1KAA A;  2EYL A;  2E8G A;  5M3F G;  1PRT D;  5G3L F;  3M9B A;  1I6H H;  1C48 A;  4DV6 L;  4XL9 A;  2B29 A;  3CMA A;  2YWG A;  4LFA Q;  5LMN L;  2V1C C;  3FP9 A;  4FF4 A;  1V0E A;  1SFO B;  4IUQ A;  4A3C H;  1KNE A;  1K8G A;  1HVX A;  1EFU A;  3HG9 A;  3A8I A;  2EYH A;  4FDB A;  3CCQ A;  2VNI A;  3WOF A;  2EY2 A;  1NCV A;  3K5N A;  4FXD A;  2R7Z B;  1IYV A;  2I5M X;  3GTJ B;  4ZUI A;  2A6H D;  1CM9 A;  2UXC L;  1K0R A;  3PUN A;  2GN5 A;  3OW2 A;  4WZK A;  1VQN B;  2VY3 A;  3BZD B;  1BKB A;  1K8M A;  1EP3 B;  2XIW A;  5IGF A;  1YJ9 B;  3H0G H;  4PZ8 A;  4NB3 A;  1YBY A;  1LAC A;  4X62 L;  4DR1 Q;  3RR5 A;  1Q12 A;  2EYP A;  3CES A;  4RD2 A;  2RDF A;  1ONL A;  2DNC A;  5C5M A;  1SSO A;  3T13 A;  1VQI A;  2LMC B;  5M5Y B;  3EBE A;  1DOK A;  3BJU A;  4QIW E;  2NWG A;  1LO5 D;  5CMD A;  1WSV A;  1R4Q B;  1VQK A;  4JI6 L;  4DQL A;  3J7Z C;  4ABN A;  3DWP A;  4BY7 G;  5CV9 A;  3CAM A;  5FOB B;  1G2S A;  2F0J A;  2ICI A;  3ULJ A;  3G6J B;  3BY1 A;  1GUS A;  2CRV A;  4XIG S;  4X7D A;  1A3U A;  1J6Q A;  5D14 A;  2F0K A;  1EXM A;  2E1R A;  2K7V A;  1HXY D;  3OZW A;  1BCP D;  1LT4 D;  4A3L G;  3MC0 B;  4LUO A;  4LF4 Q;  4KLK A;  2IW3 A;  5C4H A;  1W35 A;  3WQZ A;  3J81 k;  1A15 A;  4Y52 H;  2NPF A;  1Y1V B;  1FGB D;  1SR3 A;  1EFC A;  2NVY B;  2WAC A;  1SYC A;  2VNJ A;  1CFM A;  2C9O A;  2F52 A;  4R1J A;  3OEH A;  1U4L A;  1XYI A;  4DR7 Q;  1CT1 D;  1XNR Q;  1IHM A;  4Z4U A;  4CJ0 B;  1SNC A;  4IPH A;  5C5L A;  1Y69 U;  3NEM A;  1VMP A;  3G6E A;  4A3C G;  4ZCM A;  3K7A H;  5B6I A;  4GLX A;  1QUF A;  4RMF A;  2ZXH A;  2A68 D;  2FXQ A;  4WJW A;  5FNZ A;  1GJR A;  5IYB H;  1LTB D;  1WPC A;  4JI8 Q;  2B2U A;  4K14 A;  2B5O A;  2PQA A;  3JAM c;  3G05 A;  4P74 A;  5LL6 X;  2JA8 H;  2NVT H;  1QZG A;  1FNV A;  1GUN A;  1T6Z A;  3F2B A;  4AH6 A;  4M1K A;  4OP7 A;  4U68 A;  1X3G A;  4K5W A;  1B53 A;  1STY A;  5E3F A;  3RNU A;  1F77 A;  3E9I A;  3Q24 A;  5T1I A;  1YIT A;  4EGV A;  1B8A A;  1STA A;  1YNN C;  4JI1 L;  4C3H H;  3NBH A;  2RA4 A;  2JA8 B;  2GJK A;  2DEU A;  5A89 A;  2NYZ D;  3QFC A;  1M4V A;  4IZ8 A;  3DDY A;  5LMU L;  1PA6 A;  1NAP A;  2F0O A;  4RGT A;  1SND A;  1H9R A;  2RBM A;  3WND A;  3W2F A;  1VQL A;  2UXD L;  4ROX A;  3GTL B;  4C3J G;  2QEJ C;  5ISR A;  3QOJ A;  5IYD H;  4LF8 Q;  2GVA A;  2IL8 A;  1K9M D;  1UUP A;  4F7D A;  3G6E B;  1IHZ A;  1X56 A;  4RD6 A;  2G5D A;  4LFB L;  3UE1 A;  2F1L A;  4BPR A;  1HZC A;  5IGE A;  3FJO A;  5EBC A;  1CI3 M;  3K5L A;  1HNX L;  3QFR A;  1FNM A;  3H09 A;  3I4N H;  3HS0 C;  4WWV A;  4Y9R A;  1QJO A;  2KEE A;  4DK3 C;  1IKM A;  2WKD A;  1N8R C;  4KD3 A;  2ZJQ A;  3AQQ A;  4X64 L;  2UUC Q;  5FLX L;  4TKO B;  4DR7 L;  4ASU A;  2PI2 E;  1FJG L;  5IYB G;  4BY7 H;  3DUZ A;  1TXY A;  4PMC A;  4LF7 Q;  1F2Z A;  4KI0 A;  1V8Q A;  2K5N A;  1I7P A;  1QGZ A;  1W0K A;  3CHB D;  3JAM E;  3MFY A;  1W0J A;  1F20 A;  1I5F A;  3ITP A;  2N88 A;  3K81 C;  3LO8 A;  1NBM A;  3I56 A;  2XVS A;  4UZU A;  3BH4 A;  3I70 A;  4BY7 B;  2VW9 A;  1WTP A;  2E2I B;  2NN6 I;  4JI2 L;  5FLX E;  5DSZ A;  1B70 B;  3GTO B;  2YWE A;  4UAJ A;  3GTM B;  2PMD A;  4BBS H;  1SJH D;  3WY9 A;  1VQN A;  1ILP A;  2JA5 B;  1JB3 A;  1OB0 A;  2Z8L A;  4RDJ A;  1Y8P B;  3P20 A;  2CHB D;  5C6A A;  1QUE A;  2LFN A;  1Q86 C;  2CQO A;  1NJI C;  3HOW H;  5IYW A;  1VQG A;  5M3F B;  1S72 A;  1TWH H;  3K0X A;  1YVC A;  2V31 A;  4AC9 A;  4TN1 A;  3I4M G;  1D1I A;  1PFS A;  3CRL C;  1W6K A;  5IYQ A;  2IT1 A;  4YCU A;  4HID A;  4DXF A;  2QEX A;  1G7C A;  5FKA C;  2XNC A;  2JA6 B;  2RVL A;  1VQ6 A;  3A7L A;  3EIV A;  5DAU A;  1EY8 A;  4RWS C;  3CC4 B;  4V0B A;  1F9R A;  3CME A;  5DN6 A;  2B39 A;  1UWV A;  1TS5 A;  3HKZ G;  4QUZ A;  3FMC A;  4A3K B;  3HOV B;  1GHK A;  3X3M A;  1LT6 D;  1BUV T;  4Y7N H;  1EWH A;  1PH5 A;  1MJE A;  2IY5 B;  4B3T L;  5HY6 A;  2A6E C;  3FRP B;  1XMO Q;  2PZW A;  4FF3 A;  1A8P A;  4HIM A;  2Z1C A;  5IP9 G;  2UUC L;  2XNA C;  2HDM A;  1P16 A;  4Q7J B;  1YHB A;  2RSN A;  4XKV A;  5E6T A;  5KRU A;  4PNY A;  1HJP A;  1BNZ A;  1ASZ A;  1GKH A;  1YNX A;  1EY7 A;  5H1S E;  1EY0 A;  2F0D A;  1JE4 A;  2X6W A;  4YAW A;  1FNW A;  3AVT A;  1VQA A;  4O1N A;  1DOL A;  4DR5 Q;  3S2H B;  2RDH A;  1N0U A;  1ZYR D;  4ZGQ B;  1PMR A;  1E63 A;  5FO0 A;  2KCM A;  3TQY A;  2UUB Q;  3SE0 A;  3CME B;  3QIA A;  2O5J C;  4RCN A;  2NZH A;  2CW5 A;  1S40 A;  4DAV A;  3CQZ H;  4X0C A;  2AKW B;  1YJN B;  4P26 A;  5JBQ A;  1BDO A;  4WZL A;  3CP0 A;  1SMX A;  3GTL H;  2L4N A;  5KYL A;  1V9P A;  4Z1M A;  1I4R A;  1F60 A;  1EZ6 A;  1SAP A;  5KGU A;  4Z4Y A;  4PMW A;  1KC8 D;  1EOV A;  4RDK A;  4TMW A;  1EWI A;  4RGM A;  1XMQ Q;  5EKL A;  2UUA Q;  4C1N I;  4JI3 Q;  2E74 C;  3HOZ H;  2R92 H;  2B2W C;  3BDC A;  4CDC C;  2GJP A;  1WOR A;  5HGQ A;  2W6J A;  1QVG B;  1RF2 D;  4A3I G;  1L2F A;  3I4O A;  3QWN A;  2AQ1 B;  1XNQ L;  1FL0 A;  2QTL A;  1SNM A;  4A3I B;  2VNU D;  1H8E A;  2DUD A;  3MXN A;  2ZL5 A;  4K2L A;  1TWF B;  1VF5 C;  3FEW X;  2EY6 A;  2JIZ A;  3TZD A;  5GQO A;  4LUV A;  5CBE E;  4G7H C;  5EKI A;  3S1M B;  5TSS A;  2ZTD A;  3U4V A;  1IYJ B;  1ML0 D;  4PV1 C;  3V05 A;  3HOU H;  1DXM A;  3ONU A;  1G8Z D;  2WAQ G;  2ATW A;  3PF4 A;  3PUV A;  4JK1 C;  3WDN A;  4JOI A;  1VQ4 A;  1PH3 A;  2AWO A;  4JI5 L;  1NB0 A;  1U0L A;  3BYY B;  4IPD A;  1JE5 A;  4S3S A;  1VQO A;  1ESF A;  2WJY A;  3PMF A;  2WZP P;  1OO9 B;  2F43 A;  1E22 A;  3H3V I;  1NUC A;  3E0E A;  2BM0 A;  3J81 L;  3BCD A;  2CKZ B;  2EYJ A;  1EYA A;  1MSH A;  4EX5 A;  3QFT A;  3T1Y Q;  2GJR A;  1HZA A;  3H15 A;  1E1R A;  2A6H C;  2ENB A;  1BX1 A;  2HT1 A;  4HE6 A;  2YYZ A;  2A69 C;  4NNJ A;  1PYS B;  1VQ5 B;  4AIM A;  4RAU C;  1VQJ A;  5TV2 A;  4B48 A;  3MWY W;  4YHB A;  4MIU A;  3VR3 A;  1WD1 A;  2O5I C;  4CGY B;  1KMH A;  3SJP A;  3TRZ A;  3S2D H;  4LF6 L;  1L0W A;  3T1H L;  4LF5 L;  4A3E B;  4XQN A;  3EFX D;  1K0S A;  4HTH A;  2VNH A;  2R93 H;  2ALY B;  1LTT D;  4MZ9 A;  3E9H A;  4A3D H;  1XNQ Q;  4A75 A;  3S16 B;  2B8G A;  1IW7 C;  4N8F A;  2ZZQ A;  4PC2 A;  4O2D A;  5CV4 A;  1JA0 A;  3BDO A;  3G71 A;  2OT2 A;  1D7Q A;  3LQ6 A;  4OOS A;  1L0Y B;  1QFJ A;  1JB7 A;  1KTV A;  5I6Y A;  1XTD A;  1WI5 A;  2EYM A;  2RHS B;  1IBL L;  2AUK A;  2F0I A;  1VQM A;  5ELE A;  4IJH A;  3GTM H;  5AJ3 Q;  1DDI A;  4TQU S;  1GUG A;  1MSG A;  4BBS B;  1KXL A;  4LUZ A;  4PZ6 A;  1B4O A;  2E2I H;  1NY4 A;  1EIY B;  1EEF D;  2D5D A;  4GQN A;  4ULL A;  1J9Z A;  1E3X A;  2VBV A;  5F4O A;  2JK8 A;  1EY6 A;  1EYG A;  4QJF A;  5FO9 B;  4JI5 Q;  4IFD G;  2VBS A;  4QY7 A;  1V1P B;  2BV3 A;  4XYQ A;  2BM1 A;  1LV9 A;  2CW0 C;  2K5V A;  2N8N A;  3PV0 A;  2KHJ A;  2UU9 L;  1JA1 A;  5CR3 A;  4DNI A;  2X53 S;  3RN5 A;  1QNK A;  4B08 A;  1Q8I A;  2VBU A;  1WOC A;  3I4M H;  1FNB A;  2F0G A;  2G9D A;  3SEB A;  4NKL A;  4A3F H;  3PO3 G;  1MAB A;  2V7W A;  1VQ5 A;  3R8B A;  2KCN A;  1TWG B;  1L0X B;  1SYB A;  2CND A;  3OIP A;  3GTG B;  1LM0 A;  1OXV A;  1EZ8 A;  3HFZ B;  1TTT A;  1EFW A;  1UE7 A;  4KHZ A;  2R93 G;  5HKK A;  4GN4 B;  2QDB A;  2M00 A;  1PZJ D;  5IYC H;  5ELB A;  4ODG A;  1K28 D;  2K5H A;  1YHQ A;  5C4X H;  1JOO A;  1A63 A;  2EY1 A;  1G29 1;  3TP7 A;  2YU9 H;  2NVQ B;  4HJA A;  1X3P A;  1WTX A;  3CCQ B;  4BY1 G;  2JA5 G;  4KKU A;  1B2R A;  4QVA A;  3KJO A;  2QGQ A;  1AP0 A;  1KRH A;  3P7J A;  3F8T A;  1XPO A;  3D8G A;  1GVH A;  1D8T A;  1IB0 A;  2JN4 A;  2DYI A;  1QGA A;  3TP8 A;  3IAY A;  4C3J H;  4C0S A;  4G7Z C;  1Q7Y D;  4Z4T A;  1NR4 A;  3UDI A;  1LTA D;  1H85 A;  2LSS A;  5IIF A;  1PH2 A;  4RG1 A;  2EQS A;  4XLC A;  2V7X A;  5BSX A;  5LMU Q;  3L9A X;  1Q82 D;  4ZCL A;  2IPK D;  4KJO A;  2QIL A;  3ASQ A;  1O7Y A;  1TVX A;  4O0A A;  5EGT A;  3MAQ A;  4J8Q A;  1GJX A;  2I5H A;  5CV6 A;  4CDF C;  1OXT A;  1QFZ A;  2QMU A;  1K3B C;  4NW2 A;  4UY8 C;  1YX2 A;  2VYQ A;  4DR2 Q;  4NXN Q;  4LFB Q;  1SBB B;  4FO2 A;  1YJW A;  3GTK B;  3GVK A;  2YTX A;  4X8I A;  4ILW A;  3CXC A;  2QGG A;  4GLA C;  3WXM A;  1TLL A;  1I3Q H;  2F03 A;  3S2D B;  1UD3 A;  3NP8 A;  5ELD A;  1Q90 A;  1HR0 Q;  3NE5 B;  1STH A;  2R93 B;  4L6T B;  1FJG Q;  4L5Q A;  4ZCK A;  4A3D B;  3IFD A;  4DN4 M;  4LAA A;  1HA3 A;  1QX4 A;  1VQ8 A;  3F2C A;  3NK9 A;  3TRE A;  4RCY A;  1N9W A;  2I0Q A;  4N8X 1;  3QOL A;  4RPD A;  4DAM A;  2LXJ A;  1PH1 A;  3FVQ A;  4WFN 3;  1XQB A;  3S1R H;  1R9T B;  2K5Q A;  4JI2 Q;  4KKT A;  1L1O C;  1K83 B;  4WZT A;  1U5K A;  2F0Q A;  1KK1 A;  3H3V C;  2K33 A;  5C3E B;  1NMG A;  2R6H A;  3GV6 A;  1VQB A;  5C0X I;  2ZTG A;  1I8D A;  2F0W A;  3U9S A;  2ZT9 C;  4JCV E;  1QZH A;  3S1R B;  3I90 A;  2JEB I;  2QE7 A;  2GK7 A;  4DV6 Q;  3UI2 A;  2IJ0 A;  2VQF L;  2C4T A;  2D3N A;  1HCZ A;  4OIK A;  2EDG A;  5J35 A;  3NHH A;  1DOM A;  2R3Z A;  5LMN Q;  3VNV A;  1A2T A;  1SJE D;  2R9V A;  1Y0R A;  3W2G A;  1K28 A;  3AGQ A;  5DEH A;  4AYB B;  4HE5 A;  4C2M B;  1HNW L;  2KA7 A;  3J81 j;  4XOR A;  3C2Q A;  4CQJ A;  3NTI A;  2FX3 A;  3J7A V;  2Z4H A;  1FRQ A;  1X3F A;  4DV5 Q;  3PIO 3;  3I4L A;  4FXU A;  3VR6 A;  1MJC A;  4QVJ A;  1MI2 A;  2PCF B;  4DR3 L;  1D8L A;  2K6A A;  3D6W A;  2ID0 A;  3A54 A;  1ET6 A;  1TKW B;  5IT9 c;  4RJL A;  4C2M H;  3GTQ H;  2WYR A;  3OJW A;  1H9J A;  1VQH A;  2FMC A;  3HKS A;  2EYO A;  4X7E A;  3JAM i;  5M3F H;  2V4D A;  1N33 Q;  4JW0 A;  3OP1 A;  4XQJ A;  3M4O H;  5ELN A;  3MHP A;  1Y1V G;  1EY4 A;  1DJR D;  2X6L A;  1PVO A;  3VO1 A;  3RZO B;  4XM3 A;  4J0Q A;  4Y9U A;  4B3R L;  1OGI A;  4J15 A;  2PPB C;  1AFP A;  4JG2 A;  2X6G A;  4A4I A;  4UPA A;  2JA6 H;  4JOI C;  3E3X A;  1VQK B;  2VS1 A;  1PFN A;  5A35 A;  4XOP A;  4MHE A;  4HMI A;  5A2Q L;  1K73 D;  5IYD G;  3I56 B;  1QCB D;  1UD2 A;  1IBM L;  2UUB L;  2LXK A;  2CF4 A;  2Q6K A;  4RLZ A;  2VZA A;  4HSV A;  3K5M A;  1E2Z A;  1YHQ B;  4P9S A;  2QDX A;  1RDP D;  1S5E D;  4EQ5 A;  4A93 H;  4J6H A;  3RN2 A;  4YAL A;  1JT8 A;  1STG A;  1SEB D;  4BA1 I;  2Y0S G;  2P3M A;  4R8N A;  3S17 B;  1YNJ C;  4JVZ A;  3S9W A;  1XFO A;  3GD7 A;  1SKY B;  3J80 i;  2A5H A;  2Q2T A;  4XR6 A;  1M90 D;  3CTA A;  2PIA A;  2A73 B;  4K5V A;  2QTZ A;  2E1B A;  1M8A A;  3K57 A;  1WDT A;  3VR4 A;  1KHI A;  2K04 A;  1C0A A;  2PNR C;  2VBT A;  2PYK A;  4JBM A;  1J8I A;  4R8I A;  5JJK A;  3M7G A;  2X0K A;  3T53 B;  1UMK A;  3EQL C;  1H8H A;  1S5D D;  1K73 C;  2ZJP A;  3QR8 A;  2WFW A;  3DEP A;  4FVM A;  1T5X D;  1N32 L;  4O42 A;  2O4X A;  3VYU A;  1HA5 A;  4Q5V A;  2QF7 A;  5L46 A;  1KRT A;  4DNR B;  1I4X A;  4DV0 Q;  1COW A;  1C8C A;  4JBK A;  3H0G G;  1BQQ T;  4P1V A;  3LGJ A;  1IZ6 A;  3MXN B;  1DYQ A;  2R92 G;  3HZX A;  3PQI A;  2BDN A;  3N6R A;  3IL8 A;  4KD4 A;  3HOZ B;  3W2E A;  1YIJ A;  2O2L D;  2Q6O A;  2ZZG A;  4BBR G;  4DQK A;  5JJI A;  4RD3 A;  1R9T H;  3OTO Q;  4G7W A;  3J7A F;  1VQM B;  2RF4 A;  2CVR A;  5HXB A;  1KQS B;  2PI2 A;  3U6B A;  1R5B A;  2R92 B;  2XND A;  1XWE A;  3SK6 A;  1ILQ A;  3W2H A;  4DV7 L;  2SDF A;  2GA4 B;  2JYO A;  1Z47 A;  4EQP A;  1RHP A;  1TWA B;  1PRT B;  4PC1 A;  1N33 L;  4A3G B;  3PUW A;  4YCW A;  3ERO A;  2L55 A;  4OO1 G;  1E3P A;  1VCI A;  4F88 A;  1JR0 D;  3A8J E;  1Z7T A;  4ALP A;  1KQS A;  5IE8 A;  1RIP A;  2WB1 G;  3JQR A;  3A7A B;  3R3O A;  2B7C A;  1A3T A;  2NZO A;  2D0P A;  2AHO B;  1NR2 A;  5HUR A;  3BYT B;  2C77 A;  4K5X A;  4A3J H;  2JN9 A;  1Q46 A;  4LF4 L;  1I50 B;  1U4R A;  2B63 G;  1KDB A;  1A8V A;  4YHH Q;  4KK7 A;  2MNA A;  3AMU A;  3KLW A;  2N49 A;  2BE5 C;  4HIZ A;  3Q0A A;  3MZ5 A;  3PUX A;  1RKN A;  4C56 C;  4I7Z C;  3RMH A;  4OEM B;  4ZUJ A;  4TMZ A;  1G2T A;  4V19 0;  4A3J B;  3CCS A;  2WAQ B;  1EWY A;  3OMG A;  4XXE A;  1N8R D;  3J81 i;  3HOX H;  1R4P B;  4YIJ A;  3S14 H;  4BA2 I;  1VMC A;  1MRZ A;  5GAG C;  3CF5 A;  1WTV A;  4QQB X;  1K8O A;  1C4Q A;  4RDL A;  2F3W A;  3URY A;  1GAW A;  1PJ7 A;  3P1H A;  3WOE A;  5K5P A;  1WSR A;  1S4Z A;  1WTQ A;  3M3Y H;  2ZBU A;  4TMX A;  1GOZ A;  5I9O A;  3AVY A;  1LAB A;  3V96 A;  4WRD A;  3TS2 A;  1TQO A;  1BF4 A;  4A3L H;  2BA1 A;  4P75 A;  4K1X A;  1GUW A;  4P22 A;  3RLN A;  1VQC A;  3E6Z X;  3N52 A;  2X85 A;  3OW2 B;  5E7N A;  1AZQ A;  3ASS A;  4M8A A;  1I6H B;  1NRK A;  2BA0 A;  2K32 A;  1I94 Q;  4N3G A;  2ZZF A;  3A56 A;  3HGB A;  1F9Q A;  1GD7 A;  2B8F A;  2B2V A;  4ZAI A;  4DV7 Q;  3Q38 A;  3R6K A;  3Q6S A;  4LBV A;  4I65 A;  4FWT A;  3IKJ A;  1HA6 A;  1KDC A;  1NE3 A;  4L63 B;  3AYH B;  2FFK B;  3R2I A;  3S1M H;  2HCC A;  1Y0Y A;  2B2Y C;  1TWH B;  4DUY L;  1QVG A;  2I07 B;  4HCS A;  2UXD Q;  4WJ4 A;  2I46 A;  1BMF A;  5FLX c;  3FKI H;  1BPL A;  5DNF A;  4NXM Q;  1VDZ A;  3D4W A;  1KNA A;  3H0G B;  1CA6 A;  5ELO A;  2GRE A;  3L3O C;  4NDX A;  4NBS A;  5M5X H;  3I55 A;  3GTP B;  1GO2 A;  1IL8 A;  2GVB A;  4LBW A;  4CJ2 C;  4HIO A;  3STB D;  1KJZ A;  5GV7 A;  1CSQ A;  1SRO A;  3CRZ A;  4JV5 L;  3S1N H;  2ZBV A;  1WYD A;  3KOJ A;  3U58 A;  2H4O A;  2CCZ A;  4YHH L;  1TT2 A;  2HD3 A;  3J7Y W;  3NPP A;  1H95 A;  5JEA G;  5CYU A;  4H02 A;  5E4X A;  3ZUG A;  2BCO A;  4U9U A;  1CTM A;  4KMU C;  4GNX C;  1F9P A;  3TZU A;  3UE0 A;  4JI7 L;  1PRT C;  5D65 A;  4DAY B;  4DFA A;  1KTK A;  3PCO B;  4RGN A;  4X3K A;  4EQN A;  4F8M A;  2D9R A;  5DLQ E;  4XLH A;  1D1N A;  2RCN A;  3AVU A;  1IJF A;  2EJF C;  1CK1 A;  1ICF B;  2E5L Q;  1IL2 A;  1Y1V H;  2NVY H;  1TWF H;  2MP1 A;  3LWE A;  1HRJ A;  1E0B A;  2I5L X;  3H94 A;  1BX0 A;  2K52 A;  3GV3 A;  5FO1 A;  3CCU B;  1Q81 D;  3M4Q A;  4X64 Q;  1A3V A;  4G7O C;  1G6Z A;  1NBW A;  1W2B B;  4HIK A;  1WVL A;  1EQV A;  5IY0 A;  3GVJ A;  4YWK A;  4AYB G;  1M1K C;  5ELC A;  1QG0 A;  3NQI A;  3OZV A;  3P75 A;  4OXP A;  5I2X A;  4POG A;  2ZXR A;  2D74 A;  3WNB A;  2NV4 A;  3PEN A;  2JE6 I;  2Y0S E;  5C4X B;  2Z0S A;  3NSW A;  4QV2 A;  3WBJ A;  4M1U B;  1E3Z A;  3JU4 A;  4XKW A;  1B3Q A;  2F0T A;  4KKS A;  1N36 L;  1SE4 A;  2B3G A;  1QVF A;  1E1O A;  4TRD A;  1FD7 D;  4K0K Q;  1STB A;  3CCJ B;  1OHH A;  4DV3 Q;  1ET9 A;  4ME5 A;  1S5B D;  1ROD A;  4JBW A;  1WU8 A;  3FPK A;  2UXC Q;  2IWH A;  1BJK A;  1PH8 A;  4A3B H;  2JJ1 A;  5A88 A;  2CWA A;  1U4P A;  5KND A;  1K3R A;  3CPX A;  2CK3 A;  3G71 B;  4XOT A;  3DMU A;  1KAW A;  2F4V L;  1V1Q A;  1W9X A;  4LF9 L;  4WOR A;  1WTR A;  1FVI A;  3CCL B;  1SNP A;  2A1A A;  1KLG D;  1GAQ A;  1I6V C;  1LYL A;  1MKH A;  1I18 A;  5M5W H;  3SLD A;  4JI6 Q;  5IGG A;  3W2D A;  3I4M B;  2N78 A;  2HCI A;  2OQ0 A;  2OF1 A;  2HQE A;  1B3A A;  3SXH A;  1RD9 D;  4KY6 A;  4L5S A;  1WTH D;  3DWQ A;  2JJ2 A;  4JI7 Q;  3HOY H;  1AZP A;  5G3L D;  4FF2 A;  1CNE A;  4IFD H;  3MMP A;  4UZF A;  4X65 L;  4R71 A;  2SNS A;  3PO3 B;  1XTC D;  3KBG A;  3PA1 A;  2F3V A;  3OOC A;  3Q3A A;  4XON A;  4ZGN B;  5C3W A;  1QNU A;  2VZL A;  5JEA H;  3HOY B;  3V7A A;  4FNF A;  2ZL6 A;  2HQL A;  2BF4 A;  4AQY Q;  4P6V F;  2ZIT A;  2WSS A;  3I73 A;  1S0U A;  5FJ8 G;  3HRZ C;  4XN3 A;  3T1H Q;  4LF5 Q;  2AUJ D;  1X32 A;  3A55 A;  1H9M A;  4P3I A;  1B2T A;  3U4Z A;  4U67 3;  4CHT B;  1G91 A;  2I1L A;  2D0O A;  1A62 A;  3OPO A;  4OWT B;  1QOH A;  4A3D G;  2IX1 A;  1GM5 A;  1HH2 P;  2K01 A;  3I1F A;  4G6I A;  1HQM C;  2VJJ A;  2FJ2 A;  4DKA C;  3CKI B;  1W87 A;  1EUJ A;  3A35 A;  4A3M G;  1IBL Q;  1CKN A;  4RA8 A;  5I6W A;  4DV3 L;  3F2U A;  3WNC A;  3PF5 A;  3LNN A;  1Y8O B;  1TU2 B;  3E5S A;  5C3E H;  2VQE L;  3TDQ A;  1TR5 A;  2F4I A;  4B3M Q;  3HKZ E;  1KIX A;  1PDQ A;  2VB3 X;  3MXP A;  2K4K A;  1H42 A;  2F4V Q;  3CCM B;  3ASP A;  2Z6K C;  4TVA B;  3Q6Q A;  3KUP A;  2OK8 A;  3ULP A;  1VLY A;  1NNX A;  3GTK H;  3IFT A;  4B44 A;  2UUA L;  3OMC A;  4KHP Q;  1SDF A;  4WJ3 M;  3B8H A;  4IUR A;  2F0H A;  1M90 C;  2V7V A;  3S14 B;  2B63 H;  3SR1 A;  1L1O B;  1ZYR C;  2C5C A;  4OL7 A;  3G4S B;  1V1O A;  2XEX A;  3B82 A;  1WP6 A;  5C4J B;  2F0N A;  2Q2H A;  3AST A;  1UAP A;  2KHI A;  2PO4 A;  1HNX Q;  3L7Z C;  4A3K H;  1M1K D;  4A3E H;  2C4U A;  2YTY A;  2PE3 A;  3I8Z A;  3KBX A;  4FF1 A;  2TMP A;  3EJI A;  1VQD A;  2A74 C;  2EZV A;  2XTI A;  4X06 A;  4XNF A;  1E24 A;  4CKB A;  5IP7 H;  4PC3 A;  3K6O A;  4LF8 L;  1CSP A;  4G7X A;  1T9H A;  2CC2 A;  1SLJ A;  2WP8 J;  1RL2 A;  2RC5 A;  4PAA A;  2L5T A;  3FDT A;  2JXM B;  3PIP 3;  1HUM A;  4YCV A;  4IPC A;  4Z4R A;  5J1Z A;  3T1Y L;  2JDI A;  5IYR A;  1Y1W B;  2PMZ E;  2D62 A;  4K8I A;  4JC0 A;  4N9P A;  3S2H H;  3OFN A;  1PTO C;  4YY3 Q;  1T5E A;  3RD4 A;  2JA7 G;  1HTL D;  3S17 H;  3SK5 A;  1VQ6 B;  3WBK A;  1Q1E A;  4XLF A;  2V7Q A;  3CW2 A;  4OPO A;  1NSN S;  1N34 L;  5BN3 A;  1EY5 A;  5COY A;  4OO1 I;  2EOT A;  2NVX H;  1TWG H;  1EY9 A;  4C3I G;  3W5U A;  2OCE A;  3O13 A;  4G1B A;  4TT3 A;  1B44 D;  4IUN A;  3SDZ A;  4X7F A;  4IJL A;  3CCM A;  3T56 B;  4L8J A;  2F0S A;  1SYE A;  1JOR A;  3AU7 A;  2HIV A;  4G57 A;  3TME A;  5C0X H;  1YEZ A;  2ZJR A;  2WKC A;  3W5H A;  1VS0 A;  2EJM A;  1LTS D;  4F7X A;  3MEH A;  4UP9 A;  4YAF A;  5CV8 A;  2A8V A;  3K8A A;  2WV6 D;  1J5E Q;  5IWA Q;  3RLF A;  2Z6K A;  2XOK A;  5AJ3 L;  3K7U C;  4Y7N B;  2OTJ B;  3CRK C;  2PMZ B;  1VQ9 B;  2W6I A;  5GRO A;  1X9N A;  3M4O B;  2NVT B;  2JEA I;  1EL0 A;  2P5Z X;  1T6X A;  3LWU A;  1FRN A;  1CZW A;  1B7Y B;  2K50 A;  1KDA A;  2Q8R E;  1CKM A;  2WZN A;  3ULL A;  4OPS A;  4OX9 Q;  2H5X A;  2KCT A;  1YJW B;  1H9S B;  4HSP A;  3ZZT A;  1BOS A;  1HFG A;  2L11 A;  4DR6 L;  2YV5 A;  4RHR A;  1VQO B;  1JJC B;  1OB2 A;  3CP2 A;  2DCU A;  1E62 A;  1PRT F;  2CQA A;  4MTN A;  1PJ6 A;  4DAP A;  1W6J A;  4EVO A;  1QFY A;  1A2U A;  1ASY A;  3HOU B;  2F3I A;  1VQE A;  4B3T Q;  4R4C A;  4Q0F A;  2ZM6 L;  1U4M A;  4ZKC B;  1RQP A;  3OWF A;  5KNC A;  1WOP A;  3ZBU A;  1I3Q B;  2PZU A;  4X66 L;  5JEA J;  5D3I B;  5I4D A;  1UE5 A;  3W5O A;  4MYU A;  1GHJ A;  1RJT A;  2MQH A;  4J1M A;  2EPB A;  4XTC S;  5C44 H;  3VMF A;  1UD8 A;  1B23 P;  3DM3 A;  2QA4 B;  1BQE A;  2L0C A;  4DR5 L;  4IW3 B;  1EOT A;  3ZJY C;  2MFI A;  4XYO A;  3LX0 A;  3A8J A;  4RD1 A;  5EPJ A;  2SOB A;  3CW2 C;  4YWL A;  2IHE A;  2BSA A;  2PZT A;  4DV5 L;  3NBH B;  1FGU A;  1UE1 A;  2LY7 A;  4JI3 L;  1A0I A;  1V5V A;  1YIT B;  5FLM H;  2B2U C;  4GKJ Q;  1F2M A;  4K6D A;  1I94 L;  4ZYS A;  2A6E D;  5C4Z A;  3S1Q B;  1TII D;  1NB9 A;  4QHY A;  4YWM A;  4LFA L;  3W1G A;  4P73 A;  1HZ9 A;  3BQJ A;  2R7Z H;  4RHS A;  1X3Q A;  5JPN C;  5FJ8 H;  3Q6R A;  1ZM4 A;  1TS2 A;  4K6L A;  2WJV A;  1JIC A;  4UP7 A;  2JA5 H;  2EIX A;  1VLO A;  3OIQ A;  2GPJ A;  2R61 A;  3AGP A;  2HHH L;  3LQE A;  3CCE B;  3QO2 A;  3KEW A;  3BG3 A;  2MO0 A;  4IO9 A;  1VQ7 A;  3E1Y E;  2TSS A;  4IUU A;  1G7T A;  2CH4 W;  3VYS A;  4UP8 A;  1GXD C;  3Q22 A;  4BBR H;  1KD1 C;  4QUF A;  3C46 A;  1BBW A;  3OZU A;  1EYC A;  4XQQ A;  3JAM L;  3GIR A;  2LZJ A;  1I4P A;  5AFW A;  3OSO A;  1UD5 A;  1HNZ Q;  4X6A H;  3CC2 B;  4X66 Q;  4OX9 L;  4H0L C;  4YEJ A;  3CC4 A;  5KYI A;  3GTO H;  4A93 G;  1ESR A;  2DOG A;  2Q8T A;  5IP7 G;  1JOK A;  4H7B A;  2HDL A;  1AN8 A;  2XZP A;  2RSO A;  1VJS A;  2QEX B;  3HOV G;  2C5B A;  3H6M A;  1YI2 A;  5IGB A;  1QG7 A;  4CBV A;  1J9O A;  3BCF A;  4R4O A;  5T1G A;  3CP8 A;  4JI8 L;  4FP5 D;  1VQF A;  5BN5 A;  4E0F A;  3RUZ A;  2HMA A;  3Q39 A;  1TVC A;  4M2L A;  1Z9F A;  2ZXO A;  2B63 B;  3M85 A;  4B4D A;  1TWC H;  3VR5 A;  4BXX G;  1QGY A;  4GLV B;  4XDX A;  2E2J H;  5FLM G;  2KEC A;  5K36 G;  5A2Q E;  2NVQ H;  4JI1 Q;  4NP5 A;  5FL7 A;  2EFG A;  3L2P A;  4GKJ L;  2K05 A;  4PQX A;  2OBR A;  1SFO H;  1BVS A;  1ELO A;  2YTV A;  4OOX A;  1E2W A;  5H59 A;  1ZXT A;  1D6E C;  2MUY A;  2IHF A;  3ONA B;  1SE8 A;  1O7Z A;  4RFB A;  5J39 A;  1W34 A;  1F2L A;  4DV4 Q;  1DAR A;  4XMY A;  3BU2 A;  4K0K L;  1A6X A;  1OB5 A;  2XGJ A;  3ERS X;  1YJ9 A;  2RCF A;  3BZK A;  4JMQ A;  4P6Y A;  2BN4 A;  4LFC Q;  4HJ8 A;  4A3B G;  4II2 A;  3BS1 A;  5CV7 A;  4DR3 Q;  4KN7 C;  4DR4 Q;  1CKN B;  2DY1 A;  1MBY A;  1VHO A;  3NXW A;  1OXX K;  3CD6 B;  2ZTE A;  3I72 A;  1DD2 A;  4M53 A;  1RTO A;  3BC9 A;  2DY8 A;  3E0J A;  2JA9 A;  4ZKB B;  2GK6 A;  1CNF A;  2AMC B;  5KEE A;  4R9W A;  1MGS A;  4A3F G;  3T16 A;  1MD2 D;  1TS3 A;  5LMZ A;  1XB2 A;  4X3T A;  4IFD I;  4P25 A;  4AVZ A;  4JYA L;  3BZC A;  3TP6 A;  3D0F A;  2VUM G;  1O7L A;  1F2Y A;  3CQZ B;  4ZLT F;  1SNQ A;  3A5Z B;  2KOL A;  1SNO A;  4IUP A;  1E43 A;  4Z9C B;  3ISX A;  1EP1 B;  1GUO A;  3I4N B;  3HOW G;  5F4J A;  3P26 A;  1HTP A;  5IYC G;  4DUZ Q;  3ZC3 A;  5LHY 1;  3C1F A;  1HNZ L;  2JSO A;  3HOY G;  3GTG H;  3KYH C;  3AVW A;  2UXB Q;  4B3X A;  1PXU A;  2FIN B;  5GAH C;  5JVH 3;  3A8I E;  2KVO A;  4X3U A;  1CQV A;  1JJ2 B;  2KCC A;  2PW5 A;  3BDL A;  4LW1 A;  1D1K A;  4FK8 A;  3DXJ C;  4UHV A;  3TP5 A;  5CGK A;  3CCR A;  3PO2 B;  3ERQ A;  4B3S Q;  1EU3 A;  1WOS A;  2ZZE A;  1IW7 D;  4ZCI A;  1BO0 A;  4RM0 A;  1NTG A;  3D4D A;  3PA2 A;  1SN8 A;  4A3G H;  3R2T A;  1KL9 A;  4N9T A;  2JP1 A;  1QWY A;  2MHV A;  4PC7 A;  4GNX B;  2ZTC A;  5BSY A;  2BH8 A;  4IFD J;  2AHO A;  1WTH A;  2OBS A;  1B9M A;  3DHQ A;  3PSI A;  3OEE A;  3CCR B;  2DER A;  1R5O A;  3DWA A;  5FO7 B;  1VQ8 B;  4POF A;  3C2P A;  1I50 H;  3VA5 A;  4Y7C A;  3T51 B;  3QB3 A;  4JI4 Q;  4DA2 A;  5THX A;  5J3B A;  1BLI A;  3VDY A;  5A8A A;  2VUM B;  3G48 A;  2Z6B D;  4EH1 A;  1Z6H A;  3UDX A;  4ZV4 A;  2PQA B;  1YNJ D;  4RPB A;  2PQE A;  1W3S A;  1PYW D;  2B2W A;  1PTO B;  1PFB A; 
#chains in the Genus database with same CATH homology
 3DM1 A;  3D4R A;  1BCP B;  4RKB A;  3NWT A;  5CDF A;  2X8K A;  1KZL A;  3R93 A;  4ID6 A;  1WD0 A;  1QIL A;  2G9H D;  1EU4 A;  1PTO H;  3KK7 A;  4GZY C;  1Q3L A;  4XT1 B;  5JAV A;  3HAG A;  4A3M B;  1ENA A;  4RKL A;  4KY5 A;  3ZIA A;  2L9H A;  4QMG A;  2EYF A;  4CJ1 B;  1SYD A;  2QKI C;  3A8K E;  1YNN D;  3EVQ A;  4XLE A;  4LMQ D;  2QCP X;  5EPL A;  1E1Q A;  2M2L A;  2XZL A;  3MTS A;  2KVM A;  2NN6 G;  4FXK C;  4QUC A;  1E2V A;  3C1E A;  3GO5 A;  2E75 C;  2D2C C;  2D3L A;  3QG1 A;  2WB1 B;  2J4X A;  2CW0 D;  4OHJ A;  2Z4I A;  1EFI D;  1BR9 A;  2XN9 C;  1CA5 A;  1I4H A;  1TY0 A;  3PUY A;  4KV6 A;  4HN7 A;  5JJZ A;  1OXU A;  4RH6 A;  5C0X J;  5FK9 C;  1U9R A;  1FYC A;  2EJG C;  2VXW A;  1TWC B;  5KNL A;  2BE5 D;  3K58 A;  1OXS C;  2OEO A;  1SE3 A;  1V1P A;  3ZYY X;  1O80 A;  2J7Z A;  2SEB D;  3GVL A;  5IT9 L;  1D5Z C;  3K0Y A;  1SXT A;  1WTO A;  2FMM A;  4KJN A;  1KAB A;  3M7N A;  1D5X C;  2MPM A;  1LTR D;  1QB5 D;  4ZQ3 A;  4B9W A;  1PKV A;  5IT9 E;  2H1E A;  3OWE B;  1DM0 B;  3VA7 A;  3OW7 A;  4II3 A;  2F0E A;  3HEJ A;  3H91 A;  1V0F A;  1I4Q A;  1UD6 A;  5J22 A;  4OIJ A;  4B3F X;  4QIW B;  1PTO F;  1ZEQ X;  5M5W B;  4DF7 A;  4FYD A;  1LTI D;  3I91 A;  4QCL A;  3FPP A;  1LT5 D;  4DXG A;  4LJZ C;  4KY7 A;  5IOD A;  3J80 E;  2KQ3 A;  2MJ8 A;  2EY5 A;  3KLS A;  3NQT A;  2NTS A;  2EVB A;  2XRQ D;  5M3M B;  3SK8 A;  1HQR D;  2ZTN A;  2N55 A;  2A69 D;  2VJI A;  2NZ1 D;  2MGS A;  3CU7 A;  2E76 C;  4QB4 A;  4XT3 B;  1D2B A;  5JVG 3;  1XX8 A;  1RTN A;  2D9U A;  3FKS A;  1LTG D;  2IX0 A;  3SHL A;  1EWC A;  3ZPN A;  1CQF A;  5BN4 A;  1PTO D;  5DM6 3;  4RGO S;  4DK1 A;  5FO8 B;  2LS0 1;  3GP7 A;  2RKS A;  1O78 A;  5EPK A;  5IOC A;  1IYU A;  2B2T A;  1JOQ A;  2SNM A;  2ZXP A;  1EFR A;  3J81 E;  4BS9 A;  4H44 C;  2KUM A;  1BXT A;  2EXZ A;  2Y0S B;  3OAA A;  4DNT B;  1ZKO A;  3NTK A;  2NN6 H;  1II3 A;  2HUG A;  4QF4 A;  2WII B;  4TSF A;  1S5C D;  2LKV A;  4HCE A;  3NWS A;  1WTW A;  3AB9 A;  4E6I A;  4G4K A;  5I9P A;  4C3J B;  2F0M A;  2IX3 A;  4FXG C;  5E1F A;  4RCO A;  2EE1 A;  5D3D A;  3FPU B;  3NUC A;  1JCK B;  2E2D C;  5JPM C;  1ENF A;  3SK4 A;  4C3H B;  3Q23 A;  1UEA B;  3TBI B;  1SYG A;  1E79 A;  5DM7 3;  4A3B B;  5M5X B;  4NMZ A;  4IAL A;  4DAY A;  3FKI B;  4EQO A;  4BWG B;  2M5S A;  3G7L A;  1F9S A;  4PMB A;  2B2Y A;  1VF7 A;  1TY2 A;  2WIN B;  2L12 A;  5IGC A;  1BBX C;  5IK2 A;  3RZD B;  5EQ0 A;  3D6C A;  1SYF A;  2DIE A;  1BCP F;  3MFG A;  1LLR D;  5ELF A;  3OE7 A;  4DU9 A;  2F0P A;  2X6Y A;  2E2J B;  2KHS A;  2RQX A;  1DCZ A;  1HFN A;  2PW7 A;  5KNB A;  2F0F A;  1PZI D;  3HKZ B;  4YEL A;  4B9X A;  1EIH A;  4UDU C;  1TS4 A;  4HAE A;  1HHV A;  1B9N A;  1EIG A;  1BCP C;  1DZ1 A;  2NTT A;  2K28 A;  3X3N A;  2HLD A;  3VR2 A;  5EJW A;  3EA6 A;  5COR A;  2F0U A;  4BY1 B;  3J80 L;  3KLS X;  3KF8 A;  1B50 A;  5LL6 S;  4CKE A;  2K03 A;  2KJX A;  3VYR A;  1DON A;  2F0L A;  3MXG A;  4B3G A;  4IQZ A;  1JWU D;  2J0T D;  4C3H G;  2F1M A;  4OGQ C;  5F2D A;  3TN2 A;  2AQ3 B;  1HPC A;  1PLF A;  1FNU A;  1RCV D;  1XXG A;  4A93 B;  4A3E B;  4IUV A;  1D5M C;  3A3G A;  1JQY D;  1AW7 A;  2K5D A;  2VB2 X;  1IKL A;  2XRS D;  3ND9 A;  3HOW B;  1PFM A;  3BVG A;  5JOB A;  1V43 A;  3MHB A;  3QJY A;  4YXW A;  4XD7 A;  1UNS A;  2WPD A;  1GUT A;  5CBA E;  2NVX B;  3A3B A;  3T4A C;  3W3A A;  3K59 A;  3DEO A;  1HZE A;  1UD4 A;  4XLA A;  4KN4 C;  4XQF A;  2XWJ B;  2B2V C;  2XSC A;  2M9V A;  3SVM A;  4DK0 A;  2ICE C;  1STE A;  1B1Z A;  1KLU D;  1WCM B;  2B2T C;  4C3I B;  4KHV A;  4F87 A;  1LT3 D;  2A68 C;  3PUZ A;  2K1B A;  2K5W A;  1EYD A;  1CHQ D;  3MVV A;  5K36 H;  2F0V A;  3M4Y A;  3C3L A;  3NTH A;  1Q1B A;  1EQT A;  3OHX C;  1AEX A;  4MN3 A;  5C0X G;  4OO1 H;  1JWS D;  5NUC A;  4KTA A;  1H9S A;  3MA2 B;  2OXP A;  2AQ2 B;  5HGT A;  1SMY D;  1EEI D;  4IN3 A;  3BVM A;  4IUT A;  4A3F B;  2DN8 A;  2R6G A;  2E2H B;  3ND8 A;  4K8J A;  3HP3 A;  1CHP D;  4HR7 B;  3VYT A;  2X6X A;  4CKC A;  4ZRZ A;  2XZO A;  3D31 A;  1QE6 A;  3K7A B;  1JC7 A;  4DGZ A;  2NB0 A;  1H9K A;  2KED A;  5IGD A;  4HMJ A;  3V2T A;  4LK1 C;  5I2Y A;  2YU9 B;  1FR3 A;  4UAI A;  1I4G A;  2L1B A;  1SMY C;  1ICW A;  4X3S A;  5KIX A;  2FHT A;  3D3R A;  4P2C B;  4H13 C;  3U9O A;  3MXU A;  1CZG A;  5EBD A;  4XN0 A;  3GQB A;  3CMM A;  3I3C A;  5C3X A;  5M9O A;  4HED A;  1SE2 A;  2JA7 B;  3KLR A;  4ZK9 B;  2DY7 A;  1PZK D;  1HUN A;  1FX0 A;  4BBR B;  2Q8I B;  5CC4 A;  2X69 A;  4TSS A;  5E4W C;  5C44 B;  3S1N B;  4C1N K;  3BVZ A;  3HOX B;  5EKK A;  3K5O A;  2BOS A;  2RDG A;  2AWN A;  2ZXI A;  1S5F D;  3TSS A;  1STN A;  2DNE A;  2XWB B;  3S15 B;  1JWM D;  1Y8N B;  2BDO A;  4K2K A;  1ENC A;  2NUC A;  3M3Y B;  2NBF A;  3GTQ B;  5CV5 A;  3NBI A;  1KAA A;  2EYL A;  1PRT D;  5G3L F;  1C48 A;  4XL9 A;  4FF4 A;  1V0E A;  1SFO B;  4IUQ A;  1KNE A;  1HVX A;  3HG9 A;  2EYH A;  3WOF A;  2EY2 A;  1NCV A;  3K5N A;  4FXD A;  2R7Z B;  1IYV A;  3GTJ B;  4ZUI A;  2A6H D;  1CM9 A;  3BZD B;  1K8M A;  5IGF A;  2XIW A;  1LAC A;  1Q12 A;  2EYP A;  3CES A;  2RDF A;  1ONL A;  2DNC A;  5C5M A;  1SSO A;  3T13 A;  2LMC B;  5M5Y B;  1DOK A;  2NWG A;  1LO5 D;  5CMD A;  1R4Q B;  4ABN A;  3DWP A;  5CV9 A;  5FOB B;  1G2S A;  2F0J A;  2ICI A;  3G6J B;  1GUS A;  4XIG S;  1A3U A;  5D14 A;  2F0K A;  2K7V A;  1HXY D;  1BCP D;  1LT4 D;  3MC0 B;  2IW3 A;  5C4H A;  3WQZ A;  1A15 A;  1FGB D;  1Y1V B;  2NVY B;  2WAC A;  1SYC A;  2C9O A;  1CFM A;  1XYI A;  3OEH A;  1U4L A;  1CT1 D;  4CJ0 B;  1SNC A;  5C5L A;  1Y69 U;  1VMP A;  2ZXH A;  2A68 D;  4WJW A;  1LTB D;  1WPC A;  2B2U A;  4K14 A;  3G05 A;  5LL6 X;  1FNV A;  1GUN A;  4U68 A;  4K5W A;  1B53 A;  1STY A;  5E3F A;  1F77 A;  3Q24 A;  5T1I A;  4EGV A;  1STA A;  1YNN C;  3NBH A;  2RA4 A;  2JA8 B;  2GJK A;  2NYZ D;  1M4V A;  4IZ8 A;  3DDY A;  1NAP A;  2F0O A;  4RGT A;  1SND A;  1H9R A;  2RBM A;  3GTL B;  4C3J G;  2QEJ C;  5ISR A;  3QOJ A;  2IL8 A;  1UUP A;  1IHZ A;  5IGE A;  5EBC A;  1CI3 M;  3K5L A;  3H09 A;  3HS0 C;  1QJO A;  2KEE A;  1IKM A;  2WKD A;  4KD3 A;  5FLX L;  4TKO B;  4ASU A;  3DUZ A;  4PMC A;  1F2Z A;  4KI0 A;  1V8Q A;  1W0K A;  3CHB D;  3JAM E;  3MFY A;  1W0J A;  3ITP A;  2N88 A;  1NBM A;  2XVS A;  4UZU A;  3BH4 A;  3I70 A;  4BY7 B;  1WTP A;  2E2I B;  2NN6 I;  5FLX E;  3GTO B;  3GTM B;  1SJH D;  1ILP A;  2JA5 B;  1JB3 A;  1OB0 A;  2Z8L A;  1Y8P B;  3P20 A;  2CHB D;  5C6A A;  2LFN A;  5M3F B;  2V31 A;  1D1I A;  3CRL C;  1W6K A;  2IT1 A;  4DXF A;  5FKA C;  2JA6 B;  2RVL A;  3A7L A;  5DAU A;  1EY8 A;  4RWS C;  4V0B A;  1F9R A;  5DN6 A;  2B39 A;  1TS5 A;  3FMC A;  4A3K B;  3HOV B;  1GHK A;  3X3M A;  1LT6 D;  1BUV T;  1EWH A;  2A6E C;  3FRP B;  2PZW A;  4FF3 A;  2Z1C A;  2XNA C;  2HDM A;  2RSN A;  4XKV A;  5KRU A;  4PNY A;  1BNZ A;  1EY7 A;  1EY0 A;  2F0D A;  1JE4 A;  2X6W A;  1FNW A;  4O1N A;  1DOL A;  3S2H B;  2RDH A;  1ZYR D;  1PMR A;  3SE0 A;  3QIA A;  2O5J C;  4RCN A;  4DAV A;  1BDO A;  2L4N A;  5KYL A;  4Z1M A;  1I4R A;  1EZ6 A;  1SAP A;  5KGU A;  4PMW A;  4RGM A;  5EKL A;  4C1N I;  2E74 C;  2B2W C;  3BDC A;  2GJP A;  2W6J A;  1RF2 D;  3QWN A;  2AQ1 B;  1SNM A;  4A3I B;  2VNU D;  1H8E A;  3MXN A;  4K2L A;  1TWF B;  1VF5 C;  3FEW X;  2EY6 A;  2JIZ A;  3TZD A;  5CBE E;  4G7H C;  5EKI A;  3S1M B;  5TSS A;  4PV1 C;  1ML0 D;  3V05 A;  1DXM A;  1G8Z D;  3PUV A;  4JK1 C;  3WDN A;  2AWO A;  3BYY B;  4S3S A;  1ESF A;  2WJY A;  3PMF A;  2WZP P;  1OO9 B;  2F43 A;  1NUC A;  3J81 L;  3BCD A;  2EYJ A;  1EYA A;  1MSH A;  2GJR A;  1E1R A;  2A6H C;  2ENB A;  2YYZ A;  2A69 C;  4NNJ A;  4RAU C;  3MWY W;  4MIU A;  3VR3 A;  1WD1 A;  2O5I C;  4CGY B;  1KMH A;  4XQN A;  3EFX D;  4HTH A;  1LTT D;  3S16 B;  2B8G A;  1IW7 C;  2ZZQ A;  5CV4 A;  3BDO A;  2OT2 A;  1L0Y B;  5I6Y A;  2EYM A;  2AUK A;  2F0I A;  5ELE A;  4TQU S;  1GUG A;  1MSG A;  4BBS B;  1B4O A;  1EEF D;  2D5D A;  4GQN A;  4ULL A;  1E3X A;  1EY6 A;  4IFD G;  5FO9 B;  4XYQ A;  1V1P B;  1LV9 A;  2CW0 C;  3PV0 A;  5CR3 A;  2X53 S;  1QNK A;  4B08 A;  1Q8I A;  2F0G A;  2G9D A;  3SEB A;  4NKL A;  1MAB A;  3R8B A;  2KCN A;  1TWG B;  1L0X B;  1SYB A;  3OIP A;  3GTG B;  1OXV A;  1EZ8 A;  4KHZ A;  5HKK A;  2QDB A;  2M00 A;  1PZJ D;  5ELB A;  4ODG A;  1K28 D;  1JOO A;  2EY1 A;  1G29 1;  3TP7 A;  2NVQ B;  1X3P A;  1WTX A;  4KKU A;  1AP0 A;  3P7J A;  3D8G A;  3TP8 A;  3IAY A;  4G7Z C;  1NR4 A;  1LTA D;  5IIF A;  4XLC A;  3L9A X;  2IPK D;  4KJO A;  2QIL A;  1O7Y A;  1TVX A;  5EGT A;  3MAQ A;  4J8Q A;  1GJX A;  5CV6 A;  1OXT A;  4NW2 A;  1SBB B;  4FO2 A;  3GTK B;  3GVK A;  4ILW A;  2F03 A;  3S2D B;  1UD3 A;  3NP8 A;  5ELD A;  1Q90 A;  3NE5 B;  1STH A;  2R93 B;  4L6T B;  4A3D B;  3IFD A;  4DN4 M;  4LAA A;  3NK9 A;  3QOL A;  3FVQ A;  4WFN 3;  1R9T B;  2K5Q A;  4KKT A;  1K83 B;  2F0Q A;  3H3V C;  2K33 A;  5C3E B;  3GV6 A;  5C0X I;  2ZTG A;  1I8D A;  2F0W A;  3U9S A;  2ZT9 C;  3S1R B;  3I90 A;  2JEB I;  2QE7 A;  2GK7 A;  3UI2 A;  2IJ0 A;  2D3N A;  1HCZ A;  4OIK A;  2EDG A;  3NHH A;  1DOM A;  2R3Z A;  1A2T A;  1SJE D;  2R9V A;  5DEH A;  4AYB B;  4C2M B;  2KA7 A;  4XOR A;  3NTI A;  3J7A V;  2Z4H A;  3PIO 3;  3I4L A;  4FXU A;  3VR6 A;  1MI2 A;  2PCF B;  2K6A A;  3D6W A;  2ID0 A;  3A54 A;  1ET6 A;  1TKW B;  1H9J A;  2FMC A;  2EYO A;  2V4D A;  4XQJ A;  1EY4 A;  1DJR D;  2X6L A;  3RZO B;  4XM3 A;  2PPB C;  1AFP A;  2X6G A;  1PFN A;  5A35 A;  4XOP A;  4MHE A;  4HMI A;  5A2Q L;  1QCB D;  1UD2 A;  4HSV A;  3K5M A;  1E2Z A;  1RDP D;  1S5E D;  4J6H A;  1STG A;  1SEB D;  4BA1 I;  4R8N A;  3S17 B;  1YNJ C;  3S9W A;  3GD7 A;  1SKY B;  2A5H A;  4XR6 A;  2A73 B;  4K5V A;  2E1B A;  1M8A A;  3K57 A;  3VR4 A;  2K04 A;  2PNR C;  2PYK A;  1J8I A;  4R8I A;  3M7G A;  3T53 B;  3EQL C;  1H8H A;  1S5D D;  3DEP A;  4FVM A;  1T5X D;  4O42 A;  2O4X A;  3VYU A;  1HA5 A;  4Q5V A;  2QF7 A;  4DNR B;  1I4X A;  1COW A;  1C8C A;  1BQQ T;  1DYQ A;  3HZX A;  2BDN A;  3N6R A;  3IL8 A;  4KD4 A;  3HOZ B;  2O2L D;  2ZZG A;  4G7W A;  3J7A F;  2CVR A;  2R92 B;  2XND A;  1XWE A;  3SK6 A;  1ILQ A;  2SDF A;  2GA4 B;  2JYO A;  1Z47 A;  4EQP A;  1RHP A;  1TWA B;  1PRT B;  4A3G B;  3PUW A;  3ERO A;  2L55 A;  4OO1 G;  4F88 A;  1VCI A;  1JR0 D;  3A8J E;  1Z7T A;  3R3O A;  3A7A B;  1A3T A;  5HUR A;  1NR2 A;  3BYT B;  4K5X A;  1I50 B;  1U4R A;  1KDB A;  4KK7 A;  3AMU A;  3Q0A A;  2BE5 C;  4HIZ A;  3MZ5 A;  3PUX A;  1RKN A;  4C56 C;  4I7Z C;  3RMH A;  4ZUJ A;  1G2T A;  4V19 0;  4A3J B;  2WAQ B;  4XXE A;  3OMG A;  1R4P B;  4YIJ A;  4BA2 I;  1VMC A;  1WTV A;  1K8O A;  1C4Q A;  2F3W A;  3URY A;  5K5P A;  3P1H A;  3WOE A;  1S4Z A;  1WTQ A;  1GOZ A;  5I9O A;  1LAB A;  3V96 A;  4WRD A;  1TQO A;  1BF4 A;  2BA1 A;  1GUW A;  4P22 A;  3E6Z X;  3N52 A;  2X85 A;  1AZQ A;  1I6H B;  4M8A A;  1NRK A;  2BA0 A;  2K32 A;  2ZZF A;  3A56 A;  3HGB A;  1F9Q A;  2B8F A;  2B2V A;  4ZAI A;  3Q6S A;  4I65 A;  3IKJ A;  1HA6 A;  1KDC A;  4L63 B;  2FFK B;  3R2I A;  2HCC A;  2B2Y C;  1TWH B;  2I07 B;  4HCS A;  2I46 A;  1BMF A;  1BPL A;  5DNF A;  1VDZ A;  3D4W A;  1KNA A;  3H0G B;  1CA6 A;  3L3O C;  4NDX A;  3GTP B;  1IL8 A;  4CJ2 C;  2H4O A;  1TT2 A;  3J7Y W;  3NPP A;  5JEA G;  5CYU A;  5E4X A;  2BCO A;  1CTM A;  4KMU C;  1F9P A;  3TZU A;  1PRT C;  5D65 A;  4DFA A;  1KTK A;  4RGN A;  4EQN A;  4X3K A;  4F8M A;  4XLH A;  2EJF C;  1CK1 A;  2MP1 A;  3LWE A;  1HRJ A;  1E0B A;  3H94 A;  3GV3 A;  4G7O C;  1A3V A;  1G6Z A;  1WVL A;  1EQV A;  3GVJ A;  5ELC A;  3NQI A;  3P75 A;  5I2X A;  2ZXR A;  2JE6 I;  5C4X B;  3NSW A;  4M1U B;  1E3Z A;  3JU4 A;  4XKW A;  2F0T A;  4KKS A;  1SE4 A;  4TRD A;  1FD7 D;  1STB A;  1OHH A;  1ET9 A;  4ME5 A;  1S5B D;  1ROD A;  4JBW A;  2IWH A;  2JJ1 A;  1U4P A;  5KND A;  3DMU A;  2CK3 A;  4XOT A;  1W9X A;  4WOR A;  1WTR A;  1SNP A;  1KLG D;  1I6V C;  1I18 A;  5IGG A;  3W2D A;  3I4M B;  2HCI A;  2OF1 A;  2HQE A;  1B3A A;  3SXH A;  1RD9 D;  4KY6 A;  1WTH D;  3DWQ A;  2JJ2 A;  1AZP A;  5G3L D;  4FF2 A;  4IFD H;  2SNS A;  3PO3 B;  1XTC D;  3KBG A;  2F3V A;  3OOC A;  4XON A;  5C3W A;  1QNU A;  5JEA H;  3HOY B;  4FNF A;  2WSS A;  3I73 A;  3HRZ C;  4XN3 A;  2AUJ D;  1X32 A;  3A55 A;  1H9M A;  1B2T A;  4U67 3;  4CHT B;  1G91 A;  3OPO A;  1QOH A;  2IX1 A;  2K01 A;  4G6I A;  1HQM C;  2VJJ A;  2FJ2 A;  3CKI B;  3A35 A;  4RA8 A;  5I6W A;  3F2U A;  3LNN A;  1Y8O B;  1TU2 B;  3E5S A;  3TDQ A;  1TR5 A;  2F4I A;  1PDQ A;  2VB3 X;  3MXP A;  3KUP A;  1VLY A;  3IFT A;  3OMC A;  1SDF A;  4IUR A;  2F0H A;  3S14 B;  3SR1 A;  2C5C A;  1ZYR C;  4OL7 A;  1V1O A;  1WP6 A;  5C4J B;  2F0N A;  1UAP A;  2PO4 A;  3L7Z C;  3I8Z A;  3KBX A;  4FF1 A;  2TMP A;  3EJI A;  2A74 C;  2EZV A;  4XNF A;  4CKB A;  3K6O A;  4G7X A;  2WP8 J;  2L5T A;  3FDT A;  2JXM B;  3PIP 3;  1HUM A;  5J1Z A;  2JDI A;  1Y1W B;  2D62 A;  4K8I A;  4N9P A;  3OFN A;  1PTO C;  1T5E A;  3RD4 A;  1HTL D;  3SK5 A;  1Q1E A;  4XLF A;  2V7Q A;  1NSN S;  5BN3 A;  1EY5 A;  5COY A;  4OO1 I;  2EOT A;  1EY9 A;  4C3I G;  3O13 A;  4TT3 A;  1B44 D;  4IUN A;  3SDZ A;  3T56 B;  4L8J A;  2F0S A;  1SYE A;  1JOR A;  3AU7 A;  4G57 A;  3TME A;  5C0X H;  2WKC A;  2EJM A;  1LTS D;  4F7X A;  3MEH A;  5CV8 A;  2WV6 D;  3RLF A;  2XOK A;  4Y7N B;  3CRK C;  2PMZ B;  2W6I A;  3M4O B;  2NVT B;  2JEA I;  1EL0 A;  3LWU A;  1CZW A;  1KDA A;  2Q8R E;  1H9S B;  4HSP A;  1BOS A;  1HFG A;  2L11 A;  4RHR A;  3CP2 A;  1PRT F;  2CQA A;  4DAP A;  1W6J A;  4EVO A;  1A2U A;  3HOU B;  4Q0F A;  1U4M A;  4ZKC B;  5KNC A;  3OWF A;  1I3Q B;  2PZU A;  5JEA J;  5D3I B;  5I4D A;  1RJT A;  1GHJ A;  4J1M A;  2EPB A;  4XTC S;  1UD8 A;  2L0C A;  1EOT A;  4XYO A;  3LX0 A;  5EPJ A;  2SOB A;  2PZT A;  2LY7 A;  2B2U C;  1F2M A;  4K6D A;  4ZYS A;  2A6E D;  5C4Z A;  3S1Q B;  1TII D;  4RHS A;  1X3Q A;  5JPN C;  1TS2 A;  4K6L A;  2WJV A;  1JIC A;  3OIQ A;  2R61 A;  3QO2 A;  3KEW A;  3BG3 A;  2TSS A;  4IUU A;  3VYS A;  3Q22 A;  1GXD C;  4QUF A;  3C46 A;  1EYC A;  4XQQ A;  3JAM L;  5AFW A;  2LZJ A;  1I4P A;  3OSO A;  1UD5 A;  4H0L C;  4YEJ A;  5KYI A;  1ESR A;  2Q8T A;  1JOK A;  4H7B A;  2HDL A;  1AN8 A;  2XZP A;  2RSO A;  1VJS A;  3H6M A;  5IGB A;  1QG7 A;  4CBV A;  1J9O A;  3BCF A;  5T1G A;  3CP8 A;  4FP5 D;  5BN5 A;  4E0F A;  3RUZ A;  2ZXO A;  2B63 B;  3M85 A;  3VR5 A;  4XDX A;  2KEC A;  5K36 G;  5A2Q E;  4NP5 A;  5FL7 A;  2K05 A;  4PQX A;  1E2W A;  1ZXT A;  1D6E C;  2MUY A;  3ONA B;  1O7Z A;  4RFB A;  5J39 A;  1F2L A;  4XMY A;  1A6X A;  2XGJ A;  4JMQ A;  4II2 A;  3BS1 A;  5CV7 A;  4KN7 C;  1MBY A;  3NXW A;  1OXX K;  3I72 A;  1DD2 A;  1RTO A;  3BC9 A;  2DY8 A;  3E0J A;  4ZKB B;  2GK6 A;  5KEE A;  4R9W A;  1MGS A;  3T16 A;  1MD2 D;  1TS3 A;  4X3T A;  4IFD I;  4AVZ A;  3TP6 A;  1O7L A;  1F2Y A;  3CQZ B;  4ZLT F;  1SNQ A;  2KOL A;  1SNO A;  4IUP A;  1E43 A;  4Z9C B;  3I4N B;  1GUO A;  1HTP A;  5LHY 1;  3C1F A;  2JSO A;  1PXU A;  2FIN B;  5JVH 3;  3A8I E;  2KVO A;  4X3U A;  1CQV A;  2KCC A;  2PW5 A;  3BDL A;  1D1K A;  3DXJ C;  3TP5 A;  3PO2 B;  5CGK A;  3ERQ A;  1EU3 A;  1IW7 D;  2ZZE A;  1BO0 A;  3D4D A;  3R2T A;  4N9T A;  2JP1 A;  1QWY A;  2MHV A;  4IFD J;  1B9M A;  3DHQ A;  3OEE A;  3DWA A;  5FO7 B;  3C2P A;  3VA5 A;  3T51 B;  3QB3 A;  4DA2 A;  1BLI A;  2VUM B;  2Z6B D;  1Z6H A;  1YNJ D;  2PQE A;  1PYW D;  2B2W A;  1PTO B;  1PFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...