3OW7A

Crystal structure of the membrane fusion protein cusb from escherichia coli.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
296
structure length
296
Chain Sequence
QNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein cusB
total genus 32
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ow7A02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ow7A03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3ow7A01
3T56B 2NN6H 1Q90A 3PUXA 2E74C 3IKJA 1GUTA 3FMCA 4PV1C 3I4LA 1GUSA 1VF5C 3BG3A 2QF7A 3MXUA 1V8QA 4G7OC 4KKTA 1VF7A 3ND8A 1Q1EA 3ND9A 2PCFB 3I72A 1H9MA 4DNTB 3QJYA 3A8IE 3LNNA 3PV0A 1LACA 2A6EC 3OOCA 1O78A 1ZYRC 2B8FA 2PNRC 2NN6G 3I73A 4KN4C 4TKOB 1IW7D 4DK1A 4OO1H 1OXTA 1LABA 2E76C 2IT1A 4JK1C 1H9SB 1Z7TA 2JEBI 2BA0A 1Y8NB 2D2CC 3H94A 1GJXA 2A6HC 3T53B 1FYCA 4LK1C 1K8OA 4OO1G 3FPPA 1CI3M 1HTPA 1TU2B 2K7VA 3LWUA 1HQMC 1YNJC 3VR5A 4KHZA 4H44C 4KI0A 4KMUC 4RCNA 1E2ZA 3N6RA 1DD2A 1GHJA 2EJGC 4GZYC 2A68C 4DK0A 3MFYA 1OXVA 1GUNA 3M85A 4G7ZC 5KNDA 4IFDG 2BDOA 1H9SA 1DXMA 1V43A 2JE6I 4KN7C 1VDZA 1B9MA 3OW7A 3AB9A 1H9RA 3CRLC 4BA2I 1OXSC 1EWHA 3A7LA 3M4YA 3GQBA 3W3AA 3A7AB 3PUWA 3TZUA 4IFDH 2Q8IB 3KLRA 5BN4A 3QG1A 4IQZA 2O5JC 2NN6I 4LJZC 1ONLA 2K32A 1I6VC 5KNCA 3PUVA 3PUZA 1IYVA 2A69C 2DN8A 1T5EA 3SE0A 2O5IC 1QJOA 5KNBA 2KA7A 1O7LA 5BN5A 3D31A 5A35A 5C0XG 2JXMB 1Q12A 3EQLC 2K33A 3IFTA 4XTCS 3PUYA 5JEAH 1Z6HA 3M7NA 2BE5C 1B9NA 1H9JA 3BDOA 4OGQC 2AUKA 1CTMA 2DNEA 1Y69U 2EVBA 3RLFA 3OPOA 2D62A 3GD7A 3D4RA 3U9SA 4DNRB 4HR7B 2ZT9C 3VR4A 4KKSA 2D5DA 4H0LC 3WDNA 1GHKA 2F1MA 1E2WA 2JEAI 2A6HD 1DCZA 3QIAA 1E2VA 3T51B 1FR3A 3HGBA 3P20A 3A8JE 5K36G 2EDGA 1YNNC 2AUJD 4JBWA 3CRKC 1OXUA 2A68D 2EJFC 3VR3A 2A69D 3SDZA 4BA1I 1Q1BA 1VCIA 2E75C 1A6XA 3NE5B 5JEAG 5C0XH 4H13C 2EJMA 4I7ZC 4G7HC 2AWOA 1HCZA 1H9KA 2YYZA 4L8JA 1CFMA 1SMYC 2BA1A 2BE5D 1GUGA 2KCCA 5K36H 3VA7A 4XIGS 3L7ZC 1Y8PB 1PMRA 2LMCB 3VR6A 1IYUA 1ZKOA 2V4DA 3A8KE 2PPBC 1OXXK 1BDOA 4TQUS 1GUOA 1IW7C 1G291 2DNCA 2B8GA 1HPCA 2R6GA 2CW0C 2A6ED 5BN3A 4KKUA 1Y8OB 3DXJC 1TKWB 2L5TA 3VR2A 1K8MA
chains in the Genus database with same CATH superfamily
4B47A 5G3LF 1Y0RA 1N36Q 1GUTA 2KCTA 3KJOA 4ALPA 1VF5C 3H91A 1ZM9A 5KEEA 4RDKA 4JV5L 2OQ0A 3RLNA 3W2EA 4ME3A 2OEOA 4DR3L 2RDGA 4P2CB 1O78A 4MYTA 3S9WA 3SEJA 1A8VA 2SDFA 1JORA 4ZQ3A 3MXNB 4HCEA 3OHXC 5D65A 1RHPA 1Y1WB 4DR6Q 1QZHA 4DR5L 1H8EA 2PZTA 3ZYYX 3M4OH 1K8OA 1S72A 1VQ6B 1MKHA 2K6AA 3CCRA 5J39A 3LWUA 1BJKA 1HQMC 2K5VA 1B8AA 1PFNA 1G7RA 4P6YA 1ENCA 2B63B 1HA6A 2N49A 3MA2B 1SKQA 2HQLA 3G7LA 4C56C 1MI2A 1Q86C 1E64A 4JI3Q 4Y7NH 4DV6Q 4QCLA 1VQOB 4ROXA 2F0VA 3DUZA 3RNUA 2GVBA 2R7ZG 1DXMA 3ICEA 4U9UA 5HY6A 4APVA 2JP1A 1PFMA 3QFSA 1VQMA 4NMZA 2ZTEA 3HG9A 2VJJA 1R4PB 3CCJB 3R3OA 2FJ2A 1QE6A 3Q23A 1YJWA 4KLKA 4LFAQ 4CJ1B 1A3VA 1EIGA 4A3FG 2W6IA 1GR1A 4K8JA 1EQVA 2RVLA 1QUQA 2K28A 5A35A 3CTAA 2WSSA 1Y1VG 3C46A 3ZZUA 4JG2A 2PLFA 1QX4A 4FO2A 4LBVA 1E62A 3GTLH 2DYIA 1N36L 2QGGA 3CMEA 2EY2A 2JA8B 1LLRD 2SNMA 1X3QA 1CA6A 2ZXIA 2ZL6A 1I94Q 3GSIA 4RFBA 1X54A 3WDNA 1AMOA 2F1MA 3G6EB 1NR2A 2A6HD 2EIXA 4M0LA 2F0MA 1I7PA 2BH2A 1F9SA 2I46A 2KHSA 3BVMA 1PRTB 1LTBD 4YHBA 1E1TA 3ZBTA 2NTSA 1C4QA 4UP9A 2XWJB 1VQIA 5FLXE 1K83H 3AVWA 2BA1A 1TLLA 5A88A 3VA7A 2KOLA 2PE3A 4HEDA 1Y8PB 4JOIC 2PPBC 3NPPA 3MXNA 1EFCA 1Q7YC 1IW7C 5GV8A 2LZJA 3DM3A 2JN4A 1KK3A 3BZDB 4WJ3M 2HUGA 3TS2A 2KECA 1E0BA 3T1YL 3I7FA 1COWA 3QFCA 5IP7G 4ILWA 4M2LA 1PH6A 3U50C 1XMOL 3KYHC 3Q0AA 3N52A 4X06A 1X3GA 2IY5B 4JI5L 1VLYA 3D4DA 4EH1A 4K2LA 4CHTB 1RD9D 4Y7CA 3ITPA 4ZLTF 5CBEE 2P3MA 2DY8A 5C44H 4AQYL 1GOZA 1PYSB 3I56B 4AH6A 5C5LA 1F20A 2IL8A 2Q2UA 2BA0A 2K01A 3H94A 3CCSA 3E20A 2JDIA 2C9OA 4X65L 4TMTA 4OO1G 5C4XH 1II3A 3VYRA 4Y9RA 4C3HB 1WP6A 5GAHC 2ZZFA 4I65A 3VO2A 1L2FA 1UD6A 4PZ7A 3S2HH 2LFNA 1T5XD 1QUQB 2DY7A 2F0EA 1O7YA 4P2NA 4ID6A 1D8TA 4DK0A 5DAUA 3HS0C 4IFDG 5JOBA 1W6JA 4LF6Q 2YU9H 1VDZA 1H8HA 4DV5Q 3M4YA 3NEMA 4YWLA 4A3BB 1ELOA 1DOMA 4JI2L 1H95A 4QIWB 1I3QB 1TUIA 2QA4B 2O5JC 5TV2A 5J35A 1STNA 1MD2D 1PH3A 1ENAA 4CDEC 2CC2A 1QVGA 1SYGA 3A5ZB 3R6JA 1WCMH 4LUOA 5IODA 4A3IG 2NVYB 4E0FA 3ER0A 3HOYG 4QL5A 4MIUA 1RL2A 2JA9A 1PJ6A 1TS3A 3D31A 1FD7D 1PH8A 1JE4A 3B8HA 4X3UA 3TQYA 1PRTD 3NENA 4XTCS 4GKKQ 4BPRA 3EFXD 5FNZA 3E1YE 3PGZA 3RLFA 4TVAB 1VLOA 2JA5B 2XNDA 3RZDH 2V31A 1E24A 3HOVH 1YIJA 3CU7A 4LBZA 2IPKD 4TN1A 4ZGNB 3A74A 5T1GA 3JAMc 1PYBA 5E1FA 4KHVA 4LUZA 5JBQA 3CCSB 3ERSX 2Q2IA 5CV9A 1KDCA 4X66Q 2R92B 1C9OA 1MSHA 5C0XI 4OX9L 3EJIA 4FNFA 1PLFA 4BA1I 2ZM6L 1F77A 4ZCKA 2R6HA 4I7ZC 4XONA 2DETA 2F0IA 4AVZA 1TVCA 4EVOA 4XDXA 1S5FD 1WTHA 3E9IA 4A3IH 5M9OA 3L7ZC 2LMCB 3MEFA 3JAMi 2YU9B 1PVOA 2I0QA 3RMHA 5HGQA 4X64L 5C4JH 4R4OA 4K1XA 1G291 2OBTA 2X6GA 4A3LH 1E1QA 3UDGA 1PFBA 4P3YA 1PDQA 1KIXA 2M9VA 1VQJA 4JC0A 4JI7L 4FF3A 1R5BA 1TWHB 2GK7A 4L6TB 5IGFA 3S17H 1EEID 4GLAC 2EIFA 2OXPA 4DAPA 4RCYA 1AN8A 1FNVA 4X65Q 3CRZA 2PNRC 5A89A 1SM4A 1ZYRC 1IYJB 2N3SA 3R93A 4OO1H 4LF4L 2ES2A 3GV6A 4OXPA 4ZCLA 4JW0A 2F1LA 1FNBA 1Y1VH 5C3XA 1HTPA 3H0GB 5CV6A 2QTZA 2EYOA 2KCMA 1YNJC 1DARA 1B53A 1KTVA 5LMUL 4RA8A 5FLXc 1QVCA 1TS4A 3ASRA 4LC0A 1L1OB 3CQZH 2CW0D 3VYSA 2PMZB 2QKIC 1K9MD 4C2MH 4YCWA 2JA5H 5DLQE 3J81k 1ZUNB 1VQEA 4B3TL 3E0EA 1KRTA 1WSVA 4PMBA 2X8KA 1D1IA 3BVGA 4G7WA 2JA7H 1SNPA 2K14A 1P16A 2Q8IB 5FLXL 2F03A 1UE6A 1IKLA 5D3DA 1HNWL 4RPBA 1IYVA 5I4DA 4X05A 3NTIA 3OW2B 4DR3Q 3ZPNA 4B4DA 1YI2B 2ZXHA 2KA7A 1X9NA 2J7ZA 1ASYA 4HCSA 3B82A 3BQJA 1Q12A 3AU7A 1M90C 3FKIB 1UD3A 4M1UB 1YEZA 4CKEA 2E2JB 3GIRA 3FVQA 1SYEA 2F0HA 3OPOA 1SMXA 4XLAA 2BVNA 4L5TA 1PH1A 2BH8A 2ZXOA 1AIPA 4OX9Q 2PQAA 4RHSA 1GHKA 3CHBD 1KK1A 5FJ8G 1LTGD 4CKCA 3UE1A 1E2VA 3HGBA 4A3MH 2CH4W 3HOUH 2R93G 1V9PA 2Z8LA 1BLIA 2WZPP 3PO2H 5CV4A 4OONA 1GAWA 4HMJA 1NMGA 3KF8B 4EQOA 4JBKA 2AWNA 2KENA 5C3WA 2D3LA 2DY1A 3AEVA 2B5OA 3W5VA 1JJGA 2NPFA 2RDFA 1VQ5B 1EUJA 4UZFA 3RZOB 2L4NA 3NP8A 4DXGA 1VQ7A 2CWPA 1O7IA 1SRUA 4NKLA 1G91A 4B3XA 3QR8A 2C35B 5BN3A 4X8IA 2Y0SB 1WTOA 2RHSB 1VQFA 3BY1A 3ISXA 4KD4A 2NN6H 4JI1Q 3IKJA 3EROA 3R8BA 1NMFA 1GUSA 3CQZB 3MXUA 2C5BA 4KJOA 4A75A 1XPRA 1B3QA 1LT6D 3MAQA 1HNWQ 2IX3A 1VQKA 2PIAA 3DWQA 1EY6A 2QDBA 2ZZQA 3QJYA 2XGTA 2X53S 1VQPA 1W2BB 1LACA 4KY7A 1C7YA 2F4VL 4DK1A 1UEAB 5HZAA 4A4IA 4K0KL 3MZ5A 2IT1A 4CDCC 1K8AC 1F2YA 2PMZE 3E3XA 2WYRA 4QMGA 1IHMA 4DUYQ 2HLDA 1OB5A 1SE2A 1LYLA 3MC0B 1SE3A 1E7ZA 5EKLA 1KC8C 1NB9A 3W2HA 3NBIA 5L46A 2EE1A 3WY9A 3M4QA 2RC5A 1LV9A 5BR8Q 2PNHA 3I4NB 4IALA 4G57A 3E5SA 1GO3E 4C3IG 1JB7A 1GHJA 4Z4UA 2NYZD 3GTJB 3QWNA 1WPCA 4DR2Q 2F0WA 3M85A 1EEFD 1CA5A 4UP7A 2NZHA 5IYCG 5M3MB 2Q8TA 4DQKA 1J8IA 2EYJA 3BYTB 2Q6OA 4P71A 4EQPA 2PQAB 3QO2A 4RD0A 3M3YH 1HR0W 4GKJQ 3J80L 4IQZA 3GTKH 3SGIA 1PYWD 2MQHA 1NE3A 5IYWA 3JQRA 3K0XA 4A3MB 4LF6L 2ICEC 5KYLA 4JI5Q 1ENFA 1W0KA 1KHIA 3G71A 5EPKA 4AF7A 1KNEA 2EQSA 1S0UA 2C2WA 1IL8A 1TWGB 4F8MA 1AW7A 3HOWG 4C1NI 1Z6HA 2V7WA 4Y9UA 1BBWA 2F0DA 5IYPA 1STAA 1XJVA 3S24A 2CQAA 5LHY1 1G6PA 1HHVA 2D62A 1TTTA 3HFZB 3VR4A 2L12A 1KK2A 1WD0A 4DR4Q 2BGJA 3KUPA 2VBVA 4B08A 4GNXA 2QW7A 1AZQA 4FF4A 3A35A 4L5SA 1C8CA 1BCPC 2BM1A 2EJFC 2MGSA 1KDBA 2XZPA 4Z4WA 2UUCL 1K28A 4MYUA 5IYDH 1OHHA 5K36H 1V0FA 2YWEA 2GJRA 3HOXG 1MABA 1G7CA 3A8KE 3KOJA 4RGMA 5FK9C 4XMYA 2JSOA 4ZCMA 1K28D 1AEXA 4DNIA 1LTAD 1SROA 1SFOB 1N32L 1TKWB 1YHBA 4LWCA 1I5FA 3VR2A 3OZUA 3I4MB 2E74C 2OCEA 3BG3A 4X64Q 1BPLA 3H0GH 4XORA 1WJJA 3BCDA 3H09A 4CJ2C 2PW7A 4Z4SA 3I4OA 1EY7A 1EOTA 1G2TA 4XQNA 5M3MH 4QIWE 1J6QA 2Z0SA 4DUYL 1T6ZA 5IYDG 2UXDL 3WQZA 4RDLA 1JC7A 1WI5A 1IW7D 4U673 1PH7A 1G7SA 1G2SA 3SHLA 4O2DA 1WTVA 4RD4A 3CP0A 5EKIA 3U4ZA 4OELB 1DOLA 1HJPA 2R9VA 2M2LA 2OQKA 3QB3A 3VR5A 1EFTA 3AVYA 1IJFA 1N07A 1VQCA 4HJAA 2J4XA 1VQ8B 1KQSB 4WZKA 1BCPF 4JI3L 4II2A 4DV6L 4A3EG 4Y52H 1ICWA 3ASQA 1BR9A 1ZYRD 2JE6I 2F0GA 3K8AA 4A3DG 5LMUQ 4RLZA 3OW7A 3AB9A 1VQ4B 3TP8A 2I07B 1TXYA 1KRHA 5ELEA 5J22A 2X3UA 4N9PA 2D9UA 1JCKB 4KJNA 2D9RA 1HVXA 1VQ9A 4RD3A 4R8NA 4POGA 4RGOS 3UDFA 1S5CD 1KD1C 5KNCA 3HOVG 5C6AA 4WZTA 5BSYA 4XLHA 4GNXB 1CNFA 1GM5A 2NVQB 3CP2A 5LL6X 3K7UC 3ONUA 2XNAC 4P74A 1Q8IA 2XSCA 5IE8A 3MHPA 3JAME 2BOSA 3EQLC 2DJGC 1YLOA 1B7YB 3HKZG 1UMKA 4BXXH 2L11A 1H9JA 1VMPA 4BBRB 2UXBQ 2C78A 4MTNA 3U9SA 1K73C 1XXGA 3K5OA 1FGUA 1I94L 1C0AA 4IW3B 4H0LC 4FXKC 5H5JA 2B2WC 2JEAI 3CCEA 3MFGA 4K6LA 1ZEQX 1AP0A 2QDLA 3SLNA 2X69A 5CC4A 2V7XA 4CKBA 4AYBB 1VQ9B 2XNCA 4PC2A 1JQYD 3NK9A 2B63G 4WWVA 1MHWC 1J9ZA 4TMVA 1JB9A 5A8AA 1WTWA 3K5MA 4XLEA 1X6OA 4IURA 1M8AA 1JNYA 2DJFC 3NUCA 2KCCA 1PTOC 1WD1A 2RHQB 4PC7A 3VR6A 1VQOA 3NQTA 3W2DA 4CGYB 1I4GA 4LF5Q 4A76A 3AFQA 5IT9c 2F0QA 1TWFH 4TRDA 1DDGA 1HPCA 4V0BA 2NZOA 3G6JB 4F7XA 3U6BA 4E6IA 2RSNA 4EX5A 4DXFA 3CCJA 3S2DB 5H59A 2OWOA 4LF9L 3PIO3 1SE8A 2ATWA 1OGIA 1SYBA 4UZUA 3W2FA 5C3EH 3J81c 5EMNA 4LFCQ 2NVTB 1HTLD 2HDNB 2XIWA 1A15A 1BQQT 4ZV4A 3PV0A 4IUPA 4LK1C 1CM9A 1D2BA 1HFNA 1SYCA 4AQYQ 2WR8A 2IHEA 2I5MX 1RQPA 1G6ZA 1JWUD 4A3KH 4A3JB 1B44D 2PW5A 4X3KA 2NZ1D 2FFKB 3J81L 4R4IA 1K83B 2UXBL 1NR4A 2OF1A 3J7A5 1T6YA 3GP7A 1FRQA 3NHHA 2JJ1A 1RIPA 2L1BA 1LO5D 2HHHQ 3WWVA 3CC4B 3CCMA 1N8RD 2E2IB 3IL8A 3KDFA 1VJSA 3J80i 3P27A 1EZ6A 4CDDC 1O80A 1FNWA 1RODA 2ZBVA 3W3AA 2F0OA 1QNKA 4XR6A 1K0RA 2J0TD 4JI2Q 5JEAJ 4G5GA 1HR0L 1QGYA 4LF7L 1K8GA 4GOPC 5J3BA 5KSWB 4H7BA 3IFDA 1IB0A 1T5EA 3H9NA 1YZ6A 4JI1L 5C4XG 1RF2D 1X3FA 2JXMB 3G71B 1JMCA 3H3VC 1EQRA 2BN4A 2Q2HA 3ONYA 3M7NA 4GQNA 2AUKA 4P9SA 3VMFA 5C44G 1VQLB 4DK3C 3CAMA 4A3FH 1VQMB 4X7CA 2B39A 4XOTA 3ASSA 4DNRB 1NTGA 4K0KQ 1JB3A 5EBDA 4NP5A 1F2MA 1Y14B 4A3GB 4A3KB 1MIUA 2KBNA 1JJCB 3T51B 3E9HA 5A2QL 4BBSB 4HIKA 3A8JE 1N8RC 3QFTA 3I3CA 4A3BH 5JVH3 2F3IA 2H5XA 3CXCA 4NXNL 4DR4L 3BDCA 2OTJB 3QSYA 2RQXA 1YJ9A 2ZZGA 1PH4A 4OHJA 3C1EA 1BMFA 3K81C 3C3LA 3NELA 1BNZA 1GUGA 1HNXL 2E1RA 4BY7H 3D4WA 3J7ZC 2ZJPA 2Q8RE 4ZAIA 3L9AX 4YAOA 4FXDA 4OOXA 4XQQA 4FYDA 1O7ZA 4LF9Q 2L0CA 4Q7JB 4Z1MA 4GNXC 1J5EL 4KKUA 2RCFA 2K5NA 3SEBA 2N55A 2JJ2A 1Q90A 1GJRA 1TT2A 4GS3A 4A93B 3CF5A 2K52A 4KHPQ 1KLGD 1VF7A 3W1BA 5M5WB 3DWAA 3TREA 3GTOH 1PKVA 3PO3G 3PVDA 4O42A 1STYA 2RBMA 1NAPA 3GO5A 3P75A 2ICIA 4UY8C 4P3IA 3BU2A 2MO1A 4XT1B 1WVLA 4S3SA 5ELNA 1CUKA 2VY3A 3WOFA 2VNUD 4R4TA 1C48A 2XN9C 1WTPA 4XN3A 3KFUA 2WB1B 1NRKA 2ZITA 1YIJB 2NBFA 3QOJA 5TR9A 3GTLB 4XYQA 3A8KA 3WNDA 2UXCQ 2IHFA 4AC9A 2K5HA 2F3WA 3T13A 2KCNA 4QUCA 4DR7Q 1ZM4A 2UUCQ 4LF7Q 5JVG3 1V43A 1B23P 1MGSA 4YEJA 1QG7A 1PJ7A 2UUBL 4HIDA 4PZ6A 1DYQA 3S17B 3A7AB 1HZEA 5E7NA 5FO9B 1K73D 3EIVA 2DOGA 2QTLA 3D8GA 3W1GA 1D2EA 2F52A 3ZBUA 2ZXPA 4A3GH 2GN5A 2JA6G 3L0OA 1BX1A 3LQ6A 5CMDA 3PUVA 3SJZA 1HNXQ 4CDFC 1RDPD 1QVFB 2DN8A 3HEJA 1Z47A 4RD6A 1QJOA 3I1FA 2DERA 5KNBA 2OBSA 2E5LQ 1BCPD 3Q22A 3TRZA 4K14A 1OGJA 1CKNB 1PFSA 3AGPA 1Y1VB 1M1KD 1EY9A 3UDIA 2WINB 1SKYB 1CK1A 1B9NA 1RCVD 1KD1D 3S1RB 5FO1A 2VNHA 2PI2A 4IJLA 1IL2A 2JA8G 1YHQB 4DA2A 4DAYB 5A2QE 2G5DA 3M9BA 2E2HH 2M5SA 1YNND 4RD1A 4EQ5A 2AUJD 4R9WA 2CBXA 3KLWA 2VUMG 1E3XA 1N06A 3HOZB 1Q46A 1HUNA 3GTOB 1F2LA 1FJGL 2F0KA 5G3LD 3W2IA 5EBCA 4JCVE 3R2TA 1G7TA 4L8JA 3OP1A 2G9DA 4C3HH 1KRSA 1T6XA 1A62A 1PMRA 4LAAA 1ILPA 2BDNA 4EQNA 3BCFA 1BDOA 1PTOF 1YBYA 1GUOA 2VYQA 2PYKA 2NTTA 2B8GA 3K80C 3OE7A 5M5XB 2TSSA 1UUPA 2D0PA 1WOSA 3Q6SA 4B44A 3FMCA 2JK8A 2H4OA 1CSPA 4RH6A 4Y7NB 1YITB 1PHJA 3S16H 1SR3A 3GTGB 2RA4A 4OO1I 1QFZA 4YHHL 1K8AD 1N08A 3RD4A 2NN6G 4JPBW 2FX3A 2PMDA 3CCMB 1JE5A 1UD2A 5IGDA 3BVZA 3OWEB 4O1NA 3X3NA 4DAYA 1IZ6A 1LTID 1U4PA 4DR7L 3KJPA 1NDHA 1YJWB 1CI3M 1D5XC 1VQKB 5GV7A 3AVTA 4X66L 3Q8DA 4X62Q 2ASBA 4C3HG 3S1QB 5ELFA 3M3YB 5IYRA 2VB3X 4DV3Q 1JICA 2O4XA 1UD5A 4HJ8A 3GTMH 3PA2A 2YWHA 2A68C 2MO0A 4TSSA 2Z4IA 3MFYA 1OXVA 4IPHA 1QB5D 3HOZH 3Q6QA 4F7DA 1GD7A 4KN7C 2VUMH 2JA8H 5M3FG 1IKMA 4GN4B 1HFGA 4XD7A 3CRLC 3A7LA 3G48A 3HOUG 1F9RA 4JMQA 1VQBA 2E5LL 4XYOA 4A3LG 4AYBE 3K7AH 1R9TH 4LF8L 2R7FA 3E6ZX 1I4HA 4A3FB 4Z4YA 4UZEA 1AE3A 2ZBUA 4NW2A 3PF5A 2WPDA 3QOLA 4JI7Q 2XNJA 4TMXA 5C4ZA 4A3IB 4UDUC 1EP2B 2IW3A 1L1OA 3Q3AA 3GTPH 2NVXH 4WQMA 1G51A 5C4JB 3X3MA 2L15A 4UAIA 4R4QA 1CTMA 1SBBB 3I4NH 3S16B 1CQXA 1YJ9B 2OT2A 2JA5G 2ZXRA 1PZJD 5J1ZA 3BH4A 2AMCB 2EYPA 2ZTGA 2EYLA 3J7YW 4IZ8A 4HJ9A 2I5HA 2CH4A 5F4JA 4YHHQ 1CHPD 4WZLA 3QIAA 4BY7B 2GK6A 5HURA 4B3SQ 2EDGA 1XYIA 1N34Q 1OB2A 4JI4Q 3GTQB 3KF6B 3RY8A 2K05A 4KD3A 3Q38A 4RG1A 1N05A 4C2MB 3QE2A 1A6XA 2K5WA 1VHEA 4P25A 1V1OA 3I8ZA 3JAML 4NXML 1HCZA 1CQVA 2YYZA 4Z4RA 4QVJA 4B3TQ 2R93H 5M3MG 3CC7B 3STBC 3NWTA 1OXXK 1GAQA 2CNDA 1K9MC 1KABA 2Z6KA 3W5HA 2R6GA 2CW0C 2FMMA 4R1JA 1BVSA 4EGVA 4GOPA 1PV4A 5CR3A 4R71A 3K7AB 2HD3A 3OYYA 2AHOB 3T56B 2MNAA 5IYCH 4LFBL 2DUDA 3PUNA 4RDJA 4KKTA 1PA6A 4K8IA 1X3EA 4DQLA 1S40A 3FKSA 4DNTB 3KF6A 3HOXH 3GTPB 4DU9A 5KRUA 3T1HL 5IP9G 4CJ0B 3MEHA 3ZC3A 5GADC 4DV1L 1K3BC 1PTOH 4NXNQ 4XKVA 2K04A 4DV3L 2GQFA 3I55B 4C0SA 2JA7G 4FF1A 4R4CA 1JWSD 2HDMA 1MSGA 5T1IA 1YHAA 4JYAQ 5LMNL 4XLCA 1W3SA 3NTHA 1SNQA 1V1PA 4KY6A 1I8DA 3C2QA 3N6RA 2AQ3B 4NB3A 4JI0L 2I1LA 2EJGC 4L63B 2VNKA 4GZYC 1DM0B 2DEUA 5C3EG 1DD2A 4G7ZC 2IJ0A 2N78A 1VQ7B 3TBIB 2GREA 3RZDB 5JJLA 4A3BG 2Q6KA 1QVGB 2VZAA 4BA2I 3K58A 2B2TC 3PUWA 1SSOA 2IX1A 1H42A 1WDTA 2W6JA 1ONLA 1S4MA 4B3ML 2C77A 5KYIA 1HA5A 1X32A 4J8QA 1TWAB 5ELOA 2HDLA 4KTAA 1O7LA 3S1MB 5L37A 1PH5A 4OOSA 4X7DA 1B70B 3RZOH 4ULLA 3J81E 3G4SA 3U4VA 4ZK9B 1P4MA 3WXMA 3AVUA 4ZUIA 2BE5C 3PO2G 1V0EA 4OPSA 3WNCA 3S1NH 1IJEA 3CC7A 2F4VQ 2YWFA 1L0YB 1Z9FA 4XOPA 1WCMG 2UXCL 4X07A 2LXKA 5IIFA 1IBLL 1N33Q 1Q3LA 4QV2A 1DCZA 1PRTC 3CCVA 4DV2Q 3VNVA 3L3OC 4DV0L 1TWHH 5COYA 5FA6A 1SJHD 3CKIB 1OXUA 1TR5A 4P75A 2SEBD 2UUBQ 1A63A 4FP5D 1V1PB 1QCBD 1Q1BA 4U68A 3WYAA 5FLMG 2QEJC 4PG3A 2VBSA 4G7HC 4DR2L 4C3JG 5HZBA 3W5UA 5TY0A 2BF4A 5JJZA 2UU9L 2FMCA 1ESRA 3ULPA 2OTJA 3G4SB 4G6IA 4JOIA 4FWTA 1ZKOA 3KK7A 2V7QA 4M53A 4JI0Q 1PJ5A 3HP3A 1LM0A 1XPOA 1FJGQ 1F9QA 3I55A 3NSWA 3GTJH 2G9HD 1VHOA 1UE1A 1U9RA 2PI2E 4BBRH 1FNDA 1HXYD 4DUZQ 1K8MA 1JOQA 3HOYB 4A3DH 3I4LA 3T1HQ 3A8JA 1V8QA 2B2VC 3ND8A 3ND9A 3FJOA 2PZUA 3SK4A 3W5OA 5LL6S 1M4VA 2AKWB 1HNZL 3A54A 1FRNA 1KDAA 1I50H 4PZ8A 2WB1E 2BCOA 5KGUA 2OK8A 2NUCA 2WKCA 4ZKCB 2BV3A 1EXMA 5JPMC 1HQRD 3C2PA 4JYAL 5FO7B 5M5YB 4BBRG 1D5MC 3I56A 4LF4Q 1LUZA 1EY4A 2LY7A 3V7AA 2D2CC 5I9PA 3MTSA 4LBYA 3T16A 4JBJA 1UE7A 3BY2A 3TS0A 3L2PA 3NTKA 5KNLA 1TU2B 2K7VA 2MHVA 2FHTA 4RWSC 4LMQD 3RN2A 2JJQA 1T9HA 2C4UA 4AYBG 1S72B 1K0SA 1WTQA 1JA1A 2CHBD 3O13A 2BMWA 2H1EA 5KNDA 3S14B 3BYYB 5JJKA 4X62L 3CCUB 5C4HA 3KLSA 3SK6A 1EIYB 1CSQA 1D7QA 4LUVA 3S2DH 3NBHB 3SKBA 2EZVA 1U0LA 4IFDH 4PQXA 1SFOH 1EY5A 3KLRA 2B2WA 4N3NA 4II3A 2WJVA 2B2YA 1SNDA 2CFMA 2YV5A 4B48A 1HZAA 4IUVA 4A3CH 5E6TA 2Z6BD 1CQFA 5KIXA 1JOKA 3SE0A 1EFWA 2O5IC 5EPJA 1LTLA 1HA3A 2A73B 3CW2C 1KQSA 4QJFA 3FKIG 4JI6L 3OKXA 5DN6A 3A55A 1E22A 3AGQA 4P72A 2Q2TA 2QN6A 2Z6BA 1ZM2A 2GA4B 1LT3D 4UHVA 4POFA 2LXJA 3IRBA 1QGZA 5HGTA 2N88A 1N0UA 3HAGA 4DV4L 3ZJYC 4XQFA 1KJZA 3CPWB 3CMEB 1E2WA 1EIFA 4MHEA 5AFWA 2E2IH 5I9OA 1GXDC 3JU4A 2R93B 2DGYA 1FGBD 1M1KC 4XN0A 2CRVA 3P20A 2QCPX 3OZVA 1YJNB 1VQGA 3CRKC 2UU9Q 3S15H 3LO8A 2YTYA 2V7TA 2Z4HA 1W0JA 2WAQB 3H3VI 3S2HB 2A74C 4A3EH 3V2TA 4OPVA 4XXEA 2ZL7A 1QH0A 3A5UA 1WOPA 3MCAA 1TIID 4XQJA 4LF8Q 4QVAA 2RKSA 3D0FA 4QF4A 3P1HA 3V76A 3NBHA 2IWHA 3HOXB 3J81i 3OJXA 3KDFB 3CD6A 1I4QA 1BUVT 2PO4A 2Y0SG 3UDXA 4Z4TA 5DM63 4Q5VA 4NXMQ 1WORA 2BGIA 3C1FA 3DXJC 4X6AH 1Q86D 1S5BD 4HMIA 1QNUA 5IP9H 3T1YQ 1QGAA 2XRSD 1TVXA 4O0AA 2N8NA 4JBMA 1VQPB 4OOVA 2B2TA 1SNMA 4XM3A 2HQEA 3SK8A 1BXTA 1NCVA 4C3IH 3A8IE 1X56A 1MRZA 4JI8Q 1FDRA 3OOCA 2B8FA 3E0JA 3I73A 4KN4C 3P7JA 2RDHA 1Y1WG 4DAVA 4JK1C 3GTKB 1Y8NB 2V1CC 5IT9E 2AQ1B 4XKWA 2D74A 5IP7H 1JWMD 4N8X1 4MN3A 2X0KA 5KW9A 2ZTNA 4YY3Q 2EY1A 3RUZA 1KAWA 4IOAA 1TWGH 1HRJA 3QFRA 4IUNA 3DWPA 3WBJA 2F0SA 1SXTA 4M4SA 1GUNA 1ET9A 1XTCD 1GKHA 1WSRA 3SK5A 4A3EB 4N8FA 4B3RQ 2X6WA 2WZNA 2HT1A 1CT1D 2CVRA 3GQBA 1HUMA 5BN4A 3QG1A 4GKJL 2Z9HA 3OWFA 5HXBA 3J7AF 3GV3A 4HSPA 3RN5A 2K32A 3PENA 1FNMA 3EVQA 3F2DA 3FHWA 1SE4A 3S15B 3OFNA 2V7VA 1D1NA 1XTDA 3OMCA 1G8ZD 4LFBQ 1W9XA 2EFGA 2MJ8A 4GN3B 5CGKA 4K5XA 4JV5Q 2QEXB 4ZKBB 4DV1Q 3LGJA 1D6EC 3EA6A 1MJCA 1XNQL 1SYFA 1NUCA 2EY5A 1NBMA 4LBWA 1I4RA 1WFQA 4HIOA 4A3JH 4RGNA 3GDEA 2BM0A 2P5ZX 2WP8J 3OIQA 4KKSA 2D5DA 2YTVA 4K5WA 1UNSA 3B78A 3H0GG 2F0LA 1JR0D 4RGTA 3CESA 3I4MH 4OWWB 1E3PA 2EOTA 2NVYH 5LMNQ 2XEXA 5GAGC 3SDZA 1VCIA 1XNRL 5FO8B 4C3IB 2O2LD 3J80c 5DSZA 2AWOA 3PSIA 3DMUA 3WOEA 3VDYA 1VQLA 3D6CA 2K1BA 3MXPA 2E2HB 2QEXA 1EU3A 2XRQD 1IYUA 1VQ4A 2V4DA 4RJLA 2OBRA 1I50B 3I91A 3CC2A 4OWTB 1F60A 4I7AA 3CC4A 1VQNA 2VB2X 4RCOA 4JI8L 1U5KA 3V96A 4QQBX 1VQAA 2ID0A 2R92H 4PV1C 4P6VF 1XFOA 4IUUA 2QF7A 4OEMB 3FPUB 1Q82C 1I6HH 2WKDA 4DGZA 5NUCA 1N33L 2VJIA 3ZIAA 1SJED 3UI2A 2A6EC 3M7GA 1STHA 3J81j 3DHQA 1UWVA 1OXTA 3DM1A 3AYHB 1LABA 3EN2A 3T4AC 4BBSH 1TY0A 1E1OA 4B3GA 3T53B 1ICFB 4CQJA 3CCEB 3VYUA 1EY0A 1ZM3A 2QGQA 2XOKA 5DM73 4DV2L 1YITA 5JPNC 4B3FX 3MVVA 2NVQH 3TP5A 1DG1G 3GTGH 4F88A 5IOCA 1DGSA 4NPSA 1B4OA 3U6KA 4DFAA 1AFPA 5I6WA 4KK7A 1EFRA 2X6XA 1MBYA 1SNOA 2JN9A 2CF4A 1LTSD 3LX0A 1STBA 1U2RA 3SLDA 1JT8A 4BY1G 3F2BA 1IBML 1NBWA 5CV7A 3TZUA 3K57A 1Q82D 1XNRQ 1BX0A 1GO2A 3TSSA 2B2UA 2ENBA 2LKVA 5GROA 3G6EA 4IFDI 3OIPA 3ONAB 1A2UA 4G4KA 1BKBA 2R61A 3PA1A 5IYBG 3GVLA 1TWCB 2KVMA 3IFTA 1I4XA 4F87A 3PMFA 1SN8A 4RHRA 1CNEA 1PTOD 3KBGA 4X3TA 4ODGA 4DV7L 2DNEA 4V190 1F2ZA 3AMUA 2F0UA 2NV4A 3PQIA 4IFDJ 4YALA 4DN4M 1Q8KA 5C44B 2V7UA 4HR7B 1SAPA 1EQQA 1EYGA 1KC8D 4FDBA 1RTOA 4A93H 1RQRA 1B50A 4OPOA 4X3SA 4YAUA 4C1NK 4IJHA 1QFJA 3AFPA 2NVXB 3CC2B 2R92G 1EIHA 1S4ZA 3I4NG 2ALYB 1N34L 4JI4L 2CWAA 1CZGA 2HMAA 1YI2A 4XL9A 2NVTH 1D5ZC 4HN7A 1R9TB 2R7ZB 1XX8A 3FKIH 4G1BA 2UUAL 4DKAC 1EYCA 5F4OA 1IXRA 4K2KA 4GLVB 5M3FB 2C5CA 1S5ED 3PIPA 3OJWA 3CW2A 2M00A 2NWGA 3URYA 4ASUA 1CKOA 2MP1A 1HZCA 1W35A 1OO9B 3RLOA 5AJ3Q 1I3QH 4YWMA 1EOVA 1Y8OB 1SEBD 4TT3A 4AF6A 3A3BA 1Y1WH 3Q39A 3HOVB 4YIJA 2VNIA 5B6IA 3CCLA 3KL9A 1E43A 5EPLA 3NWSA 5C0XJ 3M4OB 4FVMA 3S1RH 1PZID 1NY4A 4DPGA 3I72A 1B3AA 1WOCA 3HKZB 1A3UA 1L0XB 4P22A 4C43A 1W34A 1D1KA 5DNFA 4DV4Q 4J1MA 5E3FA 3GVJA 1A8PA 1SNCA 1QVFA 5TSSA 4DR5Q 1LTRD 1A3TA 1W2BA 3CCQA 4DV7Q 3FDTA 1STGA 3I90A 3OMGA 3FPPA 1A2TA 1UAPA 5BR8L 4IO9A 4BY7G 4IUQA 1BBXC 2WB1G 3MHBA 1TWCH 5E4WC 3TP6A 4L5RC 3CB4A 2HCJB 1RTNA 2A19A 3BJUA 2HHHL 3ZUGA 1ASZA 1KNAA 4UP8A 4M8AA 4PABA 5EKKA 4PGOA 4Z9CB 5CDFA 1B9MA 3K6OA 3MXGA 4YAWA 4UAJA 4B9XA 1EY8A 3CMAA 4NBSA 2B2VA 1WTXA 5IGEA 3PUMA 2OTLA 3H6MA 1H85A 2GPJA 2WAQE 4LFAL 1XQBA 4BWGB 4ZCIA 2A1AA 3I4MG 4A3MG 2A69C 4WORA 4YELA 1VMCA 2R7DA 2B29A 3PO3H 4ABNA 5ELBA 5C0XG 2B7BA 2D3NA 3SJPA 1DOKA 1E1RA 4J0QA 1QILA 2AQ2B 3I2ZA 3ZZ0A 2X6YA 3TZDA 1OB0A 3HOWB 2E1BA 3BDOA 4GN5A 2ZZEA 3HZXA 1V1QA 2HCIA 5FIUA 3VNUA 4MNOA 5M3FH 2F3VA 1YNJD 3D4RA 1QG0A 1SYDA 2ZT9C 3BZKA 5C5MA 2LS01 4J15A 3DLLA 3K59A 1KZLA 1W87A 1B1ZA 4ZGQB 3CCQB 1NSNS 4A3JG 1I18A 1EYDA 1R4QB 2CCZA 1UEBA 2SOBA 3MWYW 2F0JA 3ULLA 4ZRZA 5IYQA 2DCUA 2OTLB 1X55A 1HH2P 4X7EA 1NJID 3M4PA 3OEEA 3CCLB 2VUMB 1PXUA 2VQFQ 4B43A 4XLFA 4XT3B 3F2CA 1BOSA 4P26A 1TWAH 2OYNA 3H3VH 2KJXA 3G05A 4Q0FA 1YVCA 5D3IB 1IBKQ 3A0JA 2WIIB 3CPFA 1PRTF 4GLXA 3J80E 2EY6A 3VO1A 3KLSX 4TQUS 1STEA 2JIZA 3GTMB 3TDQA 1GUWA 5CORA 2L5TA 3STBD 4QB4A 3OZWA 1CKMA 4ME5A 3DDYA 3K5NA 5ISRA 4J6HA 1VQDA 3B6YA 4HTHA 1GVPA 4RMFA 5C4XB 1N0VC 4KHPL 3PO3B 1EP1B 3FEWX 2PCFB 4Z4VA 2PQEA 3PCOB 5EGTA 1QUFA 2UXDQ 1HNZQ 3K0YA 1VS0A 3ES9A 2EYFA 3KF8A 3PO2B 1QFYA 1QOHA 4TKOB 4QGUA 1EWIA 1TS2A 2E76C 2XVSA 5EJWA 1XMQQ 5E4XA 1FYCA 3F8TA 3BS1A 1EZ8A 2X6LA 3R2IA 1XPUA 5DS0A 2A5HA 4B3SL 2QA4A 4TMZA 4KHZA 2EYHA 3D3RA 3CPXA 4RCNA 2CK3A 2KVOA 1CKNA 3A8IA 1LTTD 5FLMH 5CV5A 2E2DC 1H9SA 4C3JB 4HJ7A 1YX2A 1EYAA 4HIZA 1IHZA 1ML0D 3WBKA 2WFWA 3KBXA 4A3DB 4QHYA 2F0TA 2LSSA 4UPAA 2HIVA 5ELDA 1JA0A 3CMMA 3K5LA 1BO0A 4KV6A 4B9WA 1E3ZA 4WZEA 2GJPA 1TY2A 3PUZA 3LWEA 2EXZA 3BC9A 5J3OA 4FXGC 4HE5A 1NJIC 1IBKL 3S14H 2RF4A 3NXWA 1KXLA 3U58A 4G7XA 5IWAQ 5IT9L 5BN5A 1PZKD 4OP7A 1WOOA 3MMPA 4IPGA 1EWCA 2KEEA 3TP7A 1YHQA 1A0IA 4PC6A 3I70A 4OGQC 2D0OA 3HRZC 1Y69U 1KTKA 1X3PA 2F0FA 2R7ZH 2KUMA 1XE1A 5GAEC 4NCNA 1KAAA 2AHOA 2B2UC 5M5XH 4ACAA 5TRDA 4K5VA 3BDLA 1DONA 4RKLA 2VQFL 4XNFA 5HKKA 2MFIA 2YWGA 2A68D 1UD4A 2K5QA 3A3GA 2A69D 2ZJRA 2HIXA 1VQ8A 2KHIA 1EU4A 4KY5A 2ZM6Q 2NB0A 1XMQL 4HSVA 1PTOB 3U9OA 2PZWA 1E79A 4H13C 4FK8A 2GJKA 4PNYA 1QWYA 3CPWA 1MJEA 1CZWA 2QE7A 4H9GA 3OTOQ 2BE5D 1QZGA 3V05A 4XIGS 3SXHA 1P8LA 2EPBA 3LQEA 3P26A 1M90D 1J9OA 2B3GA 1KLUD 4C3JH 5CBAE 4LF5L 1YJNA 4FXUA 3CCUA 4TSFA 3CCVB 1FNCA 2FXQA 3JC66 3KEWA 4JVZA 2L55A 2ZTCA 4NDXA 5F4MA 1JJ2B 2FINB 5IGGA 3S1MH 3NQIA 2CQOA 3S1QH 4X0CA 4IPDA 4IOCA 3PUXA 3FRPB 4G7OC 3D26A 4NNJA 2VNJA 2K4KA 4LFCL 4PAAA 4FN5A 1Q1EA 4DR1Q 1VQNB 1H9MA 2ZTDA 4Z4ZA 1EQTA 1XB2A 3LNNA 5AN9A 5I2XA 1U4LA 3HKSA 4P73A 1K3RA 1F9PA 1U4RA 2JQOA 4PC3A 1N9WA 2F43A 2B7CA 4P1VA 4A3KG 1GJXA 2A6HC 4BBSG 2F0PA 1TWFB 1EP3B 5IYNA 2JA7B 3OAAA 4OIKA 3JQPA 4YCVA 4DV0Q 3CMAB 2RCNA 2FVGA 4OWXB 3S1NB 5JJIA 4KI0A 1ZXTA 2Y0SE 5I6YA 2I5LX 1JJ2A 2ZL5A 4P12A 2CW5A 2XWBB 3OW2A 3AQQA 5C3EB 2BDOA 2UUAQ 5H1SE 2VL6A 2Z1CA 1PH9A 3HOUB 2A8VA 2C4TA 1OXSC 3AVVA 4PC1A 4QFMA 2XGJA 1S5DD 2WV6D 1UE5A 4ZYSA 4HJ5A 2E2JH 1R5OA 4OIJA 5IWAL 3HOWH 1HR0Q 2B63H 4PMWA 5ELCA 1TQOA 1N32Q 1ET6A 1WU8A 2WACA 5AJ3L 2X85A 3HOYH 3GTQH 3F2UA 4DF7A 5CV8A 3PIP3 4DUZL 2GVAA 2R3ZA 3CD6B 1CHQD 4DK6C 4A3CG 1D8LA 4HE6A 1OTCA 1EFID 2F4NA 2K33A 4LW1A 5JEAH 3ZZTA 2EXDA 1VQHA 5M5YH 1XNQQ 2EVBA 1DDIA 3RR5A 3W2GA 1BQEA 1TS5A 4DAMA 4DR1L 3ASTA 2CKZB 5DEHA 3SR1A 4QY7A 3BZCA 4GOPB 3D6WA 1FR3A 5K36G 1LT4D 4H02A 2VQEL 3UE0A 4JBWA 3OSOA 3ERQA 1Q9SA 1Y0YA 3ULJA 3OTOL 3R6KA 4BXXG 3H15A 3JQQA 4WJ4A 2K03A 3U2QA 1EL0A 2Q6LA 3NE5B 4IUTA 5JEAG 4HIMA 4HAEA 5C0XH 2E8GA 2Q6IA 4QUZA 2EJMA 2J7KA 2QILA 1H9KA 1AE2A 4RKBA 1CFMA 5IY0A 1R5NA 3J7AV 1ESFA 2VW9A 2JA6H 1XMOQ 2KEDA 1E63A 4K6DA 2XZOA 4IPCA 1U4MA 1J5EQ 4LNQA 2XZLA 3SVMA 4DV5L 2QDXA 1FVIA 3FP9A 1GVHA 1DJRD 1NB0A 5GQOA 4ACBA 1SMYD 4N3GA 2HCCA 2IX0A 1HZBA 1XWEA 2KQ3A 3CXCB 1WTRA 1I4PA 5EAYA 4R8IA 4JI6Q 4A93G 2DIEA 4IN3A 3VA5A 1SDFA 4AIMA 4N9TA 1Q81D 4WFN3 5FOBB 3F1ZA 2VXWA 1HZ9A 1L1OC 4MTKA 1H9SB 1Z7TA 3FPKA 2JEBI 4GKKL 2K50A 4YAFA 2JYOA 4TMWA 2F4IA 3TMEA 2VBUA 1I6HB 3CP8A 1FNUA 4M1KA 1B2RA 4H44C 3HOZG 3VYTA 4KMUC 1BBUA 3A1PA 4RPDA 5BSXA 1E2ZA 5IGBA 5JAVA 1PH2A 5FJ8H 2VBTA 2ZJQA 1WYDA 5M5WH 5I2YA 4CBVA 2SNSA 4WJWA 3PIOA 2WJYA 1WTHD 2TMPA 3GVKA 4BY1H 5CYUA 3Q24A 3TEHB 1H9RA 1W6KA 4MZ9A 1EWHA 4QUFA 4RM0A 3TN2A 1BCPB 5THXA 2K5DA 3HKZE 1IBMQ 4FF2A 5IK2A 5IGCA 2NN6I 2VS1A 3BNWA 3DEOA 4LJZC 1VQ6A 1NNXA 1KL9A 1FX0A 1I6VC 1AZPA 5FKAC 2JA6B 4B3MQ 2QMUA 2MPMA 1YNXA 2RSOA 4OL7A 5D14A 1KMHA 2L9HA 1L0WA 1Q7YD 1JOOA 3PUYA 3EBEA 4DR6L 3WNBA 1UD8A 5K5PA 3A56A 2BSAA 1RKNA 1LT5D 2OK7A 4PMCA 2VQEQ 3GD7A 1V5VA 1WCMB 4BS9A 1EFUA 1RJTA 2C5HA 2YTXA 2VZLA 4YWKA 2KHJA 3IAYA 4A3GG 1IBLQ 2BPOA 5LMZA 4RAUC 1QUEA 2B2YC 1EWYA 3ASPA 2XTIA 1BF4A 1YNNC 1SLJA 4YXWA 5LMNW 1ILQA 3LVBA 3VR3A 1Q81C 5FL7A 4YY3L 2EYMA 3AVXA 1S3OA 5FO0A 5F2DA 1VQ5A 2E75C 2WAQG 4WRDA 4ZUJA 4RD2A 5IYBH 3DEPA 4L5QA 4YCUA 4G1VA 1KK0A 2RC6A 2F0NA 1SMYC 4B3RL 3PF4A 2MUYA 3CCRB 4BY1B 2K75A 1AH9A 5EQ0A 1B2TA 2Z6KC 2DNCA 1DZ1A 4X7FA 3Q6RA 1X65A 1FL0A 2A6ED 4RCZA 3OEHA
chains in the Genus database with same CATH topology
5G3LF 1GUTA 1VF5C 3H91A 5KEEA 2OEOA 2RDGA 4P2CB 1O78A 3S9WA 2SDFA 1JORA 4ZQ3A 4HCEA 3OHXC 5D65A 1RHPA 1Y1WB 1H8EA 2PZTA 3ZYYX 1K8OA 2K6AA 5J39A 3LWUA 1HQMC 1PFNA 1ENCA 2B63B 1HA6A 3MA2B 3G7LA 4C56C 1MI2A 4QCLA 2F0VA 3DUZA 1DXMA 2JP1A 1PFMA 4NMZA 3HG9A 2VJJA 1R4PB 3R3OA 2FJ2A 1QE6A 3Q23A 4CJ1B 1A3VA 1EIGA 2W6IA 4K8JA 1EQVA 2RVLA 2K28A 5A35A 2WSSA 3C46A 4FO2A 2EY2A 2JA8B 1LLRD 2SNMA 1X3QA 1CA6A 2ZXIA 4RFBA 3WDNA 2F1MA 1NR2A 2A6HD 2F0MA 1F9SA 2I46A 2KHSA 3BVMA 1PRTB 1LTBD 2NTSA 1C4QA 2XWJB 5FLXE 2BA1A 3VA7A 2KOLA 4HEDA 1Y8PB 2PPBC 3NPPA 3MXNA 1IW7C 2LZJA 3BZDB 2HUGA 2KECA 1E0BA 1COWA 4ILWA 3Q0AA 3N52A 1VLYA 3D4DA 4K2LA 4CHTB 1RD9D 4ZLTF 3ITPA 5CBEE 2DY8A 1GOZA 5C5LA 2IL8A 2BA0A 2K01A 3H94A 2JDIA 2C9OA 4OO1G 1II3A 3VYRA 4C3HB 1WP6A 2ZZFA 4I65A 1UD6A 2LFNA 1T5XD 2DY7A 2F0EA 4ID6A 1O7YA 4DK0A 5DAUA 3HS0C 4IFDG 5JOBA 1W6JA 1VDZA 1H8HA 3M4YA 4A3BB 1DOMA 4QIWB 1I3QB 2O5JC 1MD2D 1STNA 1ENAA 1SYGA 5IODA 2NVYB 4E0FA 4MIUA 1TS3A 3D31A 1FD7D 1JE4A 4X3UA 1PRTD 4XTCS 3EFXD 3RLFA 2JA5B 2XNDA 2V31A 3CU7A 2IPKD 5T1GA 5E1FA 4KHVA 5CV9A 1KDCA 2R92B 1MSHA 5C0XI 3EJIA 4FNFA 1PLFA 4BA1I 1F77A 4I7ZC 4XONA 2F0IA 4AVZA 4EVOA 4XDXA 1S5FD 5M9OA 3L7ZC 2LMCB 2YU9B 3RMHA 1G291 2X6GA 1E1QA 1PFBA 1PDQA 2M9VA 4FF3A 1TWHB 2GK7A 4L6TB 5IGFA 1EEID 4DAPA 2OXPA 1AN8A 1FNVA 2PNRC 1ZYRC 3R93A 4OO1H 3GV6A 5C3XA 1HTPA 3H0GB 5CV6A 2EYOA 1YNJC 1B53A 4RA8A 1TS4A 2CW0D 3VYSA 2PMZB 2QKIC 4PMBA 2X8KA 1D1IA 3BVGA 4G7WA 1SNPA 2F03A 2Q8IB 5FLXL 1IKLA 5D3DA 1IYVA 5I4DA 3NTIA 3ZPNA 2ZXHA 2KA7A 2J7ZA 4HCSA 1Q12A 3AU7A 3FKIB 1UD3A 4M1UB 4CKEA 2E2JB 3FVQA 1SYEA 2F0HA 3OPOA 4XLAA 2ZXOA 4RHSA 1GHKA 3CHBD 1LTGD 4CKCA 1E2VA 3HGBA 2Z8LA 1BLIA 2WZPP 5CV4A 4HMJA 4EQOA 2AWNA 5C3WA 2D3LA 2RDFA 3RZOB 2L4NA 3NP8A 4DXGA 4NKLA 1G91A 5BN3A 2Y0SB 1WTOA 4KD4A 2NN6H 3R8BA 3EROA 3IKJA 1GUSA 3CQZB 3MXUA 4KJOA 1LT6D 3MAQA 2IX3A 3DWQA 1EY6A 2QDBA 2ZZQA 3QJYA 2X53S 1LACA 4KY7A 4DK1A 1UEAB 3MZ5A 2IT1A 1F2YA 4QMGA 2HLDA 1SE2A 3MC0B 1SE3A 5EKLA 3NBIA 2EE1A 1LV9A 3I4NB 4IALA 4G57A 3E5SA 4C3IG 1GHJA 2NYZD 3GTJB 3QWNA 1WPCA 2F0WA 3M85A 1EEFD 1CA5A 5M3MB 2Q8TA 1J8IA 2EYJA 3BYTB 4EQPA 3QO2A 3J80L 4IQZA 1PYWD 4A3MB 2ICEC 5KYLA 1ENFA 1W0KA 5EPKA 1KNEA 1IL8A 1TWGB 4F8MA 1AW7A 4C1NI 1Z6HA 2F0DA 1STAA 2CQAA 5LHY1 1HHVA 2D62A 3VR4A 2L12A 1WD0A 3KUPA 4B08A 1AZQA 4FF4A 3A35A 1C8CA 1BCPC 2EJFC 2MGSA 1KDBA 2XZPA 1OHHA 5K36H 1V0FA 2GJRA 1MABA 3A8KE 4RGMA 5FK9C 4XMYA 2JSOA 1K28D 1AEXA 1LTAD 1SFOB 1TKWB 3VR2A 3I4MB 2E74C 3BG3A 1BPLA 4XORA 3BCDA 3H09A 4CJ2C 2PW7A 1EY7A 1EOTA 1G2TA 4XQNA 3WQZA 1JC7A 1IW7D 4U673 1G2SA 3SHLA 1WTVA 5EKIA 1DOLA 2R9VA 2M2LA 3QB3A 3VR5A 2J4XA 1BCPF 4II2A 1ICWA 1BR9A 1ZYRD 2JE6I 2F0GA 3OW7A 3AB9A 3TP8A 2I07B 5ELEA 5J22A 4N9PA 2D9UA 1JCKB 4KJNA 1HVXA 4R8NA 4RGOS 1S5CD 5KNCA 5C6AA 4XLHA 2NVQB 3CP2A 5LL6X 2XNAC 1Q8IA 2XSCA 3JAME 2BOSA 3EQLC 2L11A 1H9JA 1VMPA 4BBRB 3U9SA 1XXGA 3K5OA 4H0LC 4FXKC 2B2WC 2JEAI 3MFGA 4K6LA 1ZEQX 1AP0A 5CC4A 2X69A 4CKBA 4AYBB 1JQYD 3NK9A 1WTWA 3K5MA 4XLEA 4IURA 1M8AA 3NUCA 2KCCA 1PTOC 1WD1A 3VR6A 3NQTA 3W2DA 4CGYB 1I4GA 2F0QA 4TRDA 1HPCA 4V0BA 3G6JB 4F7XA 4E6IA 2RSNA 4DXFA 3S2DB 3PIO3 1SYBA 2NVTB 4UZUA 1HTLD 2XIWA 1A15A 1BQQT 4LK1C 3PV0A 4IUPA 1CM9A 1D2BA 1HFNA 1SYCA 1G6ZA 1JWUD 4A3JB 1B44D 2PW5A 4X3KA 2NZ1D 2FFKB 3J81L 1K83B 1NR4A 2OF1A 3GP7A 3NHHA 2JJ1A 2L1BA 1LO5D 2E2IB 3IL8A 1VJSA 1EZ6A 1O80A 1FNWA 1RODA 3W3AA 2F0OA 1QNKA 4XR6A 2J0TD 5JEAJ 4H7BA 3IFDA 1T5EA 1RF2D 2JXMB 3H3VC 3M7NA 4GQNA 2AUKA 2B39A 4XOTA 4DNRB 1JB3A 5EBDA 4NP5A 1F2MA 4A3GB 4A3KB 5A2QL 3T51B 4BBSB 3A8JE 3I3CA 5JVH3 3BDCA 2RQXA 2ZZGA 4OHJA 3C1EA 1BMFA 3C3LA 1BNZA 1GUGA 3D4WA 2Q8RE 4ZAIA 3L9AX 4FXDA 4XQQA 4FYDA 1O7ZA 2L0CA 4Z1MA 4KKUA 3SEBA 2N55A 2JJ2A 1Q90A 1TT2A 4A93B 1KLGD 1VF7A 5M5WB 3DWAA 1PKVA 4O42A 1STYA 2RBMA 1NAPA 3GO5A 3P75A 2ICIA 1WVLA 4XT1B 4S3SA 3WOFA 2VNUD 1C48A 2XN9C 1WTPA 4XN3A 2WB1B 1NRKA 3GTLB 2NBFA 3QOJA 4XYQA 2F3WA 3T13A 2KCNA 4QUCA 5JVG3 1V43A 1MGSA 4YEJA 1QG7A 1DYQA 3S17B 3A7AB 1HZEA 5FO9B 3D8GA 2ZXPA 5CMDA 3PUVA 1RDPD 2DN8A 3HEJA 1Z47A 1QJOA 5KNBA 1BCPD 3Q22A 4K14A 1Y1VB 1EY9A 2WINB 1SKYB 1CK1A 1B9NA 1RCVD 3S1RB 4DA2A 5A2QE 2M5SA 1YNND 2AUJD 4R9WA 1E3XA 3HOZB 1HUNA 3GTOB 1F2LA 2F0KA 5G3LD 5EBCA 3R2TA 4L8JA 2G9DA 1PMRA 4LAAA 1ILPA 2BDNA 4EQNA 3BCFA 1BDOA 1PTOF 1GUOA 2PYKA 2NTTA 2B8GA 5M5XB 3OE7A 2TSSA 1UUPA 3Q6SA 3FMCA 2H4OA 4RH6A 4Y7NB 3GTGB 4OO1I 2RA4A 3RD4A 2NN6G 1UD2A 5IGDA 3BVZA 3OWEB 4O1NA 3X3NA 4DAYA 1LTID 1U4PA 1CI3M 1D5XC 3S1QB 4C3HG 5ELFA 2VB3X 1JICA 2O4XA 1UD5A 4TSSA 2A68C 2Z4IA 3MFYA 1OXVA 1QB5D 4KN7C 1IKMA 1HFGA 4XD7A 3CRLC 3A7LA 1F9RA 4JMQA 4XYOA 3E6ZX 1I4HA 4A3FB 4NW2A 2WPDA 3QOLA 5C4ZA 4A3IB 4UDUC 2IW3A 5C4JB 3X3MA 4UAIA 1CTMA 1SBBB 3S16B 2OT2A 2ZXRA 1PZJD 5J1ZA 3BH4A 2EYPA 2ZTGA 2EYLA 3J7YW 4IZ8A 1CHPD 3QIAA 4BY7B 2GK6A 5HURA 2EDGA 1XYIA 3GTQB 2K05A 4KD3A 4C2MB 1A6XA 2K5WA 1V1OA 3I8ZA 3JAML 1HCZA 1CQVA 2YYZA 3NWTA 1OXXK 1KABA 2R6GA 2CW0C 2FMMA 4EGVA 5CR3A 3K7AB 3T56B 4KKTA 4K8IA 3FKSA 4DNTB 3GTPB 4DU9A 5KRUA 4CJ0B 3MEHA 1PTOH 4XKVA 2K04A 4FF1A 1JWSD 2HDMA 1MSGA 5T1IA 4XLCA 3NTHA 1SNQA 1V1PA 4KY6A 1I8DA 3N6RA 2AQ3B 1DD2A 4L63B 2EJGC 4GZYC 1DM0B 4G7ZC 2IJ0A 3TBIB 3RZDB 4BA2I 3K58A 2B2TC 3PUWA 1SSOA 2IX1A 2W6JA 1ONLA 5KYIA 1HA5A 1X32A 4J8QA 1TWAB 2HDLA 4KTAA 1O7LA 3S1MB 4ULLA 3J81E 4ZK9B 4ZUIA 2BE5C 1V0EA 1L0YB 4XOPA 5IIFA 1Q3LA 1DCZA 1PRTC 3L3OC 5COYA 1SJHD 3CKIB 1OXUA 1TR5A 2SEBD 4FP5D 1V1PB 1QCBD 1Q1BA 4U68A 2QEJC 4G7HC 4C3JG 5JJZA 2FMCA 1ESRA 4G6IA 1ZKOA 3KK7A 2V7QA 3HP3A 1F9QA 3NSWA 2G9HD 1U9RA 1HXYD 1K8MA 1JOQA 3HOYB 3I4LA 1V8QA 2B2VC 3ND8A 3ND9A 2PZUA 3SK4A 5LL6S 1M4VA 3A54A 1KDAA 2BCOA 5KGUA 2NUCA 2WKCA 4ZKCB 5JPMC 1HQRD 3C2PA 5FO7B 5M5YB 1D5MC 1EY4A 2LY7A 2D2CC 5I9PA 3MTSA 3T16A 3NTKA 5KNLA 1TU2B 2K7VA 4RWSC 2FHTA 2MHVA 4LMQD 1WTQA 2CHBD 3O13A 2H1EA 3S14B 5KNDA 3BYYB 5C4HA 3KLSA 3SK6A 2EZVA 4IFDH 4PQXA 1EY5A 3KLRA 2B2WA 4II3A 2WJVA 2B2YA 1SNDA 4IUVA 2Z6BD 1CQFA 5KIXA 1JOKA 3SE0A 2O5IC 5EPJA 2A73B 5DN6A 3A55A 2GA4B 1LT3D 5HGTA 2N88A 3HAGA 4XQFA 1E2WA 4MHEA 5AFWA 5I9OA 1GXDC 3JU4A 2R93B 1FGBD 4XN0A 3P20A 2QCPX 3CRKC 2Z4HA 1W0JA 2WAQB 3S2HB 2A74C 3V2TA 4XXEA 1TIID 4XQJA 2RKSA 4QF4A 3P1HA 2IWHA 3NBHA 3HOXB 1I4QA 1BUVT 2PO4A 5DM63 4Q5VA 3C1FA 3DXJC 4HMIA 1S5BD 1QNUA 2XRSD 1TVXA 2B2TA 1SNMA 4XM3A 2HQEA 3SK8A 1BXTA 1NCVA 3A8IE 3OOCA 2B8FA 3E0JA 3I73A 4KN4C 3P7JA 2RDHA 4DAVA 4JK1C 3GTKB 1Y8NB 5IT9E 2AQ1B 4XKWA 1JWMD 4MN3A 2ZTNA 2EY1A 3RUZA 1HRJA 4IUNA 3DWPA 2F0SA 1SXTA 1GUNA 1XTCD 1ET9A 3SK5A 4A3EB 2X6WA 1CT1D 2CVRA 3GQBA 1HUMA 5BN4A 3QG1A 3OWFA 3J7AF 3GV3A 4HSPA 2K32A 3EVQA 1SE4A 3S15B 3OFNA 3OMCA 1G8ZD 1W9XA 2MJ8A 5CGKA 4K5XA 4ZKBB 1D6EC 3EA6A 1SYFA 1NUCA 2EY5A 1NBMA 1I4RA 4RGNA 2WP8J 3OIQA 4KKSA 2D5DA 4K5WA 1UNSA 2F0LA 1JR0D 4RGTA 3CESA 2EOTA 3SDZA 1VCIA 5FO8B 4C3IB 2O2LD 2AWOA 3DMUA 3WOEA 3D6CA 2K1BA 3MXPA 2E2HB 1EU3A 2XRQD 1IYUA 2V4DA 3I91A 1I50B 2VB2X 4RCOA 3V96A 2ID0A 4PV1C 4IUUA 2QF7A 3FPUB 2WKDA 4DGZA 5NUCA 2VJIA 3ZIAA 1SJED 3UI2A 2A6EC 3M7GA 1STHA 3DHQA 1OXTA 3DM1A 3T4AC 1LABA 1TY0A 4B3GA 3T53B 3VYUA 5DM73 1EY0A 2XOKA 5JPNC 4B3FX 3MVVA 3TP5A 4F88A 5IOCA 1B4OA 4DFAA 1AFPA 5I6WA 4KK7A 1EFRA 2X6XA 1MBYA 1SNOA 1LTSD 3LX0A 1STBA 3TZUA 5CV7A 3K57A 3TSSA 2B2UA 2ENBA 2LKVA 4IFDI 3OIPA 3ONAB 1A2UA 4G4KA 2R61A 3GVLA 1TWCB 2KVMA 4F87A 3IFTA 1I4XA 3PMFA 4RHRA 1PTOD 3KBGA 4X3TA 4ODGA 2DNEA 4V190 1F2ZA 3AMUA 2F0UA 4IFDJ 4DN4M 5C44B 4HR7B 1SAPA 1RTOA 1B50A 4X3SA 4C1NK 2NVXB 1EIHA 1S4ZA 1CZGA 4XL9A 1D5ZC 4HN7A 1R9TB 2R7ZB 1XX8A 1EYCA 4K2KA 5M3FB 2C5CA 1S5ED 2M00A 2NWGA 3URYA 4ASUA 2MP1A 1OO9B 1Y8OB 1SEBD 4TT3A 3A3BA 3HOVB 4YIJA 3M4OB 1E43A 5EPLA 3NWSA 5C0XJ 4FVMA 1PZID 3I72A 1B3AA 3HKZB 1A3UA 1L0XB 4P22A 1D1KA 5DNFA 4J1MA 5E3FA 3GVJA 1SNCA 5TSSA 1LTRD 1A3TA 3FDTA 1STGA 3I90A 3OMGA 3FPPA 1A2TA 1UAPA 4IUQA 1BBXC 3MHBA 5E4WC 3TP6A 1RTNA 1KNAA 4M8AA 5EKKA 4Z9CB 5CDFA 1B9MA 3K6OA 3MXGA 4B9XA 1EY8A 2B2VA 1WTXA 5IGEA 3H6MA 4BWGB 2A69C 4WORA 4YELA 1VMCA 4ABNA 5ELBA 5C0XG 2D3NA 1DOKA 2AQ2B 1E1RA 1QILA 2X6YA 3TZDA 1OB0A 3HOWB 2E1BA 3BDOA 2ZZEA 3HZXA 2HCIA 2F3VA 1YNJD 3D4RA 1SYDA 2ZT9C 5C5MA 2LS01 3K59A 1KZLA 1B1ZA 1NSNS 1I18A 1EYDA 1R4QB 2SOBA 3MWYW 2F0JA 4ZRZA 3OEEA 2VUMB 1PXUA 4XT3B 4XLFA 1BOSA 2KJXA 3G05A 4Q0FA 5D3IB 2WIIB 1PRTF 3J80E 2EY6A 3KLSX 4TQUS 1STEA 2JIZA 3GTMB 3TDQA 1GUWA 5CORA 2L5TA 4QB4A 4ME5A 3DDYA 3K5NA 5ISRA 4J6HA 4HTHA 5C4XB 3PO3B 3FEWX 2PCFB 2PQEA 5EGTA 3K0YA 2EYFA 3KF8A 3PO2B 1QOHA 4TKOB 1TS2A 2E76C 2XVSA 5EJWA 5E4XA 1FYCA 3BS1A 1EZ8A 2X6LA 3R2IA 2A5HA 4KHZA 2EYHA 3D3RA 4RCNA 2CK3A 2KVOA 1LTTD 5CV5A 2E2DC 1H9SA 4C3JB 1EYAA 4HIZA 1IHZA 1ML0D 3KBXA 4A3DB 2F0TA 5ELDA 3CMMA 3K5LA 1BO0A 4KV6A 4B9WA 1E3ZA 2GJPA 1TY2A 3PUZA 3LWEA 2EXZA 3BC9A 4FXGC 3NXWA 4G7XA 5IT9L 5BN5A 1PZKD 1EWCA 2KEEA 3TP7A 3I70A 4OGQC 3HRZC 1Y69U 1KTKA 1X3PA 2F0FA 2KUMA 1KAAA 2B2UC 4K5VA 3BDLA 1DONA 4RKLA 4XNFA 5HKKA 2A68D 1UD4A 2K5QA 3A3GA 2A69D 1EU4A 4KY5A 2NB0A 4HSVA 1PTOB 3U9OA 2PZWA 1E79A 4H13C 2GJKA 4PNYA 1QWYA 1CZWA 2QE7A 2BE5D 3V05A 4XIGS 3SXHA 2EPBA 1J9OA 5CBAE 1KLUD 4FXUA 4TSFA 3M3YB 4NDXA 3KEWA 2L55A 5IGGA 2FINB 3NQIA 3PUXA 3FRPB 4G7OC 4NNJA 1Q1EA 1H9MA 1EQTA 3LNNA 5I2XA 1U4LA 1F9PA 1U4RA 2F43A 1GJXA 2A6HC 2F0PA 1TWFB 2JA7B 3OAAA 4OIKA 3S1NB 4KI0A 1ZXTA 5I6YA 2XWBB 5C3EB 2BDOA 2Z1CA 3HOUB 1OXSC 2XGJA 4ZYSA 1S5DD 2WV6D 4OIJA 4PMWA 5ELCA 1TQOA 1ET6A 2WACA 2X85A 3F2UA 4DF7A 5CV8A 3PIP3 2R3ZA 1CHQD 1EFID 2K33A 5JEAH 2EVBA 1TS5A 5DEHA 3SR1A 3D6WA 1FR3A 5K36G 1LT4D 4JBWA 3OSOA 3ERQA 2K03A 1EL0A 3NE5B 4IUTA 5JEAG 4HAEA 5C0XH 2EJMA 2QILA 1H9KA 4RKBA 1CFMA 3J7AV 1ESFA 2KEDA 4K6DA 2XZOA 1U4MA 2XZLA 3SVMA 1DJRD 1SMYD 2HCCA 2IX0A 1XWEA 2KQ3A 1WTRA 1I4PA 4R8IA 2DIEA 4IN3A 3VA5A 1SDFA 4N9TA 4WFN3 5FOBB 2VXWA 1H9SB 1Z7TA 2JEBI 2JYOA 2F4IA 3TMEA 1I6HB 3CP8A 1FNUA 4H44C 3VYTA 4KMUC 1E2ZA 5JAVA 5IGBA 5I2YA 4CBVA 2SNSA 4WJWA 2WJYA 1WTHD 2TMPA 3GVKA 5CYUA 3Q24A 1H9RA 1W6KA 1EWHA 4QUFA 3TN2A 1BCPB 2K5DA 4FF2A 5IK2A 5IGCA 2NN6I 3DEOA 4LJZC 1FX0A 1I6VC 1AZPA 5FKAC 2JA6B 2MPMA 2RSOA 4OL7A 5D14A 1KMHA 2L9HA 1JOOA 3PUYA 1UD8A 5K5PA 3A56A 1RKNA 1LT5D 4PMCA 3GD7A 1WCMB 4BS9A 1RJTA 3IAYA 4RAUC 2B2YC 1BF4A 1YNNC 4YXWA 1ILQA 3VR3A 5FL7A 2EYMA 5F2DA 2E75C 4WRDA 4ZUJA 3DEPA 2F0NA 1SMYC 2MUYA 4BY1B 5EQ0A 1B2TA 2DNCA 1DZ1A 2A6ED 3OEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T56 B;  2NN6 H;  1Q90 A;  3PUX A;  2E74 C;  3IKJ A;  1GUT A;  3FMC A;  4PV1 C;  3I4L A;  1GUS A;  1VF5 C;  3BG3 A;  2QF7 A;  3MXU A;  1V8Q A;  4G7O C;  4KKT A;  1VF7 A;  3ND8 A;  1Q1E A;  3ND9 A;  2PCF B;  3I72 A;  1H9M A;  4DNT B;  3QJY A;  3A8I E;  3LNN A;  3PV0 A;  1LAC A;  2A6E C;  3OOC A;  1O78 A;  1ZYR C;  2B8F A;  2PNR C;  2NN6 G;  3I73 A;  4KN4 C;  4TKO B;  1IW7 D;  4DK1 A;  4OO1 H;  1OXT A;  1LAB A;  2E76 C;  2IT1 A;  4JK1 C;  1H9S B;  1Z7T A;  2JEB I;  2BA0 A;  1Y8N B;  2D2C C;  3H94 A;  1GJX A;  2A6H C;  3T53 B;  1FYC A;  4LK1 C;  1K8O A;  4OO1 G;  3FPP A;  1CI3 M;  1HTP A;  1TU2 B;  2K7V A;  3LWU A;  1HQM C;  1YNJ C;  3VR5 A;  4KHZ A;  4H44 C;  4KI0 A;  4KMU C;  4RCN A;  1E2Z A;  3N6R A;  1DD2 A;  1GHJ A;  2EJG C;  4GZY C;  2A68 C;  4DK0 A;  3MFY A;  1OXV A;  1GUN A;  3M85 A;  4G7Z C;  5KND A;  4IFD G;  2BDO A;  1H9S A;  1DXM A;  1V43 A;  2JE6 I;  4KN7 C;  1VDZ A;  1B9M A;  3OW7 A;  3AB9 A;  1H9R A;  3CRL C;  4BA2 I;  1OXS C;  1EWH A;  3A7L A;  3M4Y A;  3GQB A;  3W3A A;  3A7A B;  3PUW A;  3TZU A;  4IFD H;  2Q8I B;  3KLR A;  5BN4 A;  3QG1 A;  4IQZ A;  2O5J C;  2NN6 I;  4LJZ C;  1ONL A;  2K32 A;  1I6V C;  5KNC A;  3PUV A;  3PUZ A;  1IYV A;  2A69 C;  2DN8 A;  1T5E A;  3SE0 A;  2O5I C;  1QJO A;  5KNB A;  2KA7 A;  1O7L A;  5BN5 A;  3D31 A;  5A35 A;  5C0X G;  2JXM B;  1Q12 A;  3EQL C;  2K33 A;  3IFT A;  4XTC S;  3PUY A;  5JEA H;  1Z6H A;  3M7N A;  2BE5 C;  1B9N A;  1H9J A;  3BDO A;  4OGQ C;  2AUK A;  1CTM A;  2DNE A;  1Y69 U;  2EVB A;  3RLF A;  3OPO A;  2D62 A;  3GD7 A;  3D4R A;  3U9S A;  4DNR B;  4HR7 B;  2ZT9 C;  3VR4 A;  4KKS A;  2D5D A;  4H0L C;  3WDN A;  1GHK A;  2F1M A;  1E2W A;  2JEA I;  2A6H D;  1DCZ A;  3QIA A;  1E2V A;  3T51 B;  1FR3 A;  3HGB A;  3P20 A;  3A8J E;  5K36 G;  2EDG A;  1YNN C;  2AUJ D;  4JBW A;  3CRK C;  1OXU A;  2A68 D;  2EJF C;  3VR3 A;  2A69 D;  3SDZ A;  4BA1 I;  1Q1B A;  1VCI A;  2E75 C;  1A6X A;  3NE5 B;  5JEA G;  5C0X H;  4H13 C;  2EJM A;  4I7Z C;  4G7H C;  2AWO A;  1HCZ A;  1H9K A;  2YYZ A;  4L8J A;  1CFM A;  1SMY C;  2BA1 A;  2BE5 D;  1GUG A;  2KCC A;  5K36 H;  3VA7 A;  4XIG S;  3L7Z C;  1Y8P B;  1PMR A;  2LMC B;  3VR6 A;  1IYU A;  1ZKO A;  2V4D A;  3A8K E;  2PPB C;  1OXX K;  1BDO A;  4TQU S;  1GUO A;  1IW7 C;  1G29 1;  2DNC A;  2B8G A;  1HPC A;  2R6G A;  2CW0 C;  2A6E D;  5BN3 A;  4KKU A;  1Y8O B;  3DXJ C;  1TKW B;  2L5T A;  3VR2 A;  1K8M A; 
#chains in the Genus database with same CATH topology
 4B47 A;  5G3L F;  1Y0R A;  1N36 Q;  1GUT A;  2KCT A;  3KJO A;  4ALP A;  1VF5 C;  3H91 A;  1ZM9 A;  5KEE A;  4RDK A;  4JV5 L;  2OQ0 A;  3RLN A;  3W2E A;  4ME3 A;  2OEO A;  4DR3 L;  2RDG A;  4P2C B;  1O78 A;  4MYT A;  3S9W A;  3SEJ A;  1A8V A;  2SDF A;  1JOR A;  4ZQ3 A;  3MXN B;  4HCE A;  3OHX C;  5D65 A;  1RHP A;  1Y1W B;  4DR6 Q;  1QZH A;  4DR5 L;  1H8E A;  2PZT A;  3ZYY X;  3M4O H;  1K8O A;  1S72 A;  1VQ6 B;  1MKH A;  2K6A A;  3CCR A;  5J39 A;  3LWU A;  1BJK A;  1HQM C;  2K5V A;  1B8A A;  1PFN A;  1G7R A;  4P6Y A;  1ENC A;  2B63 B;  1HA6 A;  2N49 A;  3MA2 B;  1SKQ A;  2HQL A;  3G7L A;  4C56 C;  1MI2 A;  1Q86 C;  1E64 A;  4JI3 Q;  4Y7N H;  4DV6 Q;  4QCL A;  1VQO B;  4ROX A;  2F0V A;  3DUZ A;  3RNU A;  2GVB A;  2R7Z G;  1DXM A;  3ICE A;  4U9U A;  5HY6 A;  4APV A;  2JP1 A;  1PFM A;  3QFS A;  1VQM A;  4NMZ A;  2ZTE A;  3HG9 A;  2VJJ A;  1R4P B;  3CCJ B;  3R3O A;  2FJ2 A;  1QE6 A;  3Q23 A;  1YJW A;  4KLK A;  4LFA Q;  4CJ1 B;  1A3V A;  1EIG A;  4A3F G;  2W6I A;  1GR1 A;  4K8J A;  1EQV A;  2RVL A;  1QUQ A;  2K28 A;  5A35 A;  3CTA A;  2WSS A;  1Y1V G;  3C46 A;  3ZZU A;  4JG2 A;  2PLF A;  1QX4 A;  4FO2 A;  4LBV A;  1E62 A;  3GTL H;  2DYI A;  1N36 L;  2QGG A;  3CME A;  2EY2 A;  2JA8 B;  1LLR D;  2SNM A;  1X3Q A;  1CA6 A;  2ZXI A;  2ZL6 A;  1I94 Q;  3GSI A;  4RFB A;  1X54 A;  3WDN A;  1AMO A;  2F1M A;  3G6E B;  1NR2 A;  2A6H D;  2EIX A;  4M0L A;  2F0M A;  1I7P A;  2BH2 A;  1F9S A;  2I46 A;  2KHS A;  3BVM A;  1PRT B;  1LTB D;  4YHB A;  1E1T A;  3ZBT A;  2NTS A;  1C4Q A;  4UP9 A;  2XWJ B;  1VQI A;  5FLX E;  1K83 H;  3AVW A;  2BA1 A;  1TLL A;  5A88 A;  3VA7 A;  2KOL A;  2PE3 A;  4HED A;  1Y8P B;  4JOI C;  2PPB C;  3NPP A;  3MXN A;  1EFC A;  1Q7Y C;  1IW7 C;  5GV8 A;  2LZJ A;  3DM3 A;  2JN4 A;  1KK3 A;  3BZD B;  4WJ3 M;  2HUG A;  3TS2 A;  2KEC A;  1E0B A;  3T1Y L;  3I7F A;  1COW A;  3QFC A;  5IP7 G;  4ILW A;  4M2L A;  1PH6 A;  3U50 C;  1XMO L;  3KYH C;  3Q0A A;  3N52 A;  4X06 A;  1X3G A;  2IY5 B;  4JI5 L;  1VLY A;  3D4D A;  4EH1 A;  4K2L A;  4CHT B;  1RD9 D;  4Y7C A;  3ITP A;  4ZLT F;  5CBE E;  2P3M A;  2DY8 A;  5C44 H;  4AQY L;  1GOZ A;  1PYS B;  3I56 B;  4AH6 A;  5C5L A;  1F20 A;  2IL8 A;  2Q2U A;  2BA0 A;  2K01 A;  3H94 A;  3CCS A;  3E20 A;  2JDI A;  2C9O A;  4X65 L;  4TMT A;  4OO1 G;  5C4X H;  1II3 A;  3VYR A;  4Y9R A;  4C3H B;  1WP6 A;  5GAH C;  2ZZF A;  4I65 A;  3VO2 A;  1L2F A;  1UD6 A;  4PZ7 A;  3S2H H;  2LFN A;  1T5X D;  1QUQ B;  2DY7 A;  2F0E A;  1O7Y A;  4P2N A;  4ID6 A;  1D8T A;  4DK0 A;  5DAU A;  3HS0 C;  4IFD G;  5JOB A;  1W6J A;  4LF6 Q;  2YU9 H;  1VDZ A;  1H8H A;  4DV5 Q;  3M4Y A;  3NEM A;  4YWL A;  4A3B B;  1ELO A;  1DOM A;  4JI2 L;  1H95 A;  4QIW B;  1I3Q B;  1TUI A;  2QA4 B;  2O5J C;  5TV2 A;  5J35 A;  1STN A;  1MD2 D;  1PH3 A;  1ENA A;  4CDE C;  2CC2 A;  1QVG A;  1SYG A;  3A5Z B;  3R6J A;  1WCM H;  4LUO A;  5IOD A;  4A3I G;  2NVY B;  4E0F A;  3ER0 A;  3HOY G;  4QL5 A;  4MIU A;  1RL2 A;  2JA9 A;  1PJ6 A;  1TS3 A;  3D31 A;  1FD7 D;  1PH8 A;  1JE4 A;  3B8H A;  4X3U A;  3TQY A;  1PRT D;  3NEN A;  4XTC S;  4GKK Q;  4BPR A;  3EFX D;  5FNZ A;  3E1Y E;  3PGZ A;  3RLF A;  4TVA B;  1VLO A;  2JA5 B;  2XND A;  3RZD H;  2V31 A;  1E24 A;  3HOV H;  1YIJ A;  3CU7 A;  4LBZ A;  2IPK D;  4TN1 A;  4ZGN B;  3A74 A;  5T1G A;  3JAM c;  1PYB A;  5E1F A;  4KHV A;  4LUZ A;  5JBQ A;  3CCS B;  3ERS X;  2Q2I A;  5CV9 A;  1KDC A;  4X66 Q;  2R92 B;  1C9O A;  1MSH A;  5C0X I;  4OX9 L;  3EJI A;  4FNF A;  1PLF A;  4BA1 I;  2ZM6 L;  1F77 A;  4ZCK A;  2R6H A;  4I7Z C;  4XON A;  2DET A;  2F0I A;  4AVZ A;  1TVC A;  4EVO A;  4XDX A;  1S5F D;  1WTH A;  3E9I A;  4A3I H;  5M9O A;  3L7Z C;  2LMC B;  3MEF A;  3JAM i;  2YU9 B;  1PVO A;  2I0Q A;  3RMH A;  5HGQ A;  4X64 L;  5C4J H;  4R4O A;  4K1X A;  1G29 1;  2OBT A;  2X6G A;  4A3L H;  1E1Q A;  3UDG A;  1PFB A;  4P3Y A;  1PDQ A;  1KIX A;  2M9V A;  1VQJ A;  4JC0 A;  4JI7 L;  4FF3 A;  1R5B A;  1TWH B;  2GK7 A;  4L6T B;  5IGF A;  3S17 H;  1EEI D;  4GLA C;  2EIF A;  2OXP A;  4DAP A;  4RCY A;  1AN8 A;  1FNV A;  4X65 Q;  3CRZ A;  2PNR C;  5A89 A;  1SM4 A;  1ZYR C;  1IYJ B;  2N3S A;  3R93 A;  4OO1 H;  4LF4 L;  2ES2 A;  3GV6 A;  4OXP A;  4ZCL A;  4JW0 A;  2F1L A;  1FNB A;  1Y1V H;  5C3X A;  1HTP A;  3H0G B;  5CV6 A;  2QTZ A;  2EYO A;  2KCM A;  1YNJ C;  1DAR A;  1B53 A;  1KTV A;  5LMU L;  4RA8 A;  5FLX c;  1QVC A;  1TS4 A;  3ASR A;  4LC0 A;  1L1O B;  3CQZ H;  2CW0 D;  3VYS A;  2PMZ B;  2QKI C;  1K9M D;  4C2M H;  4YCW A;  2JA5 H;  5DLQ E;  3J81 k;  1ZUN B;  1VQE A;  4B3T L;  3E0E A;  1KRT A;  1WSV A;  4PMB A;  2X8K A;  1D1I A;  3BVG A;  4G7W A;  2JA7 H;  1SNP A;  2K14 A;  1P16 A;  2Q8I B;  5FLX L;  2F03 A;  1UE6 A;  1IKL A;  5D3D A;  1HNW L;  4RPB A;  1IYV A;  5I4D A;  4X05 A;  3NTI A;  3OW2 B;  4DR3 Q;  3ZPN A;  4B4D A;  1YI2 B;  2ZXH A;  2KA7 A;  1X9N A;  2J7Z A;  1ASY A;  4HCS A;  3B82 A;  3BQJ A;  1Q12 A;  3AU7 A;  1M90 C;  3FKI B;  1UD3 A;  4M1U B;  1YEZ A;  4CKE A;  2E2J B;  3GIR A;  3FVQ A;  1SYE A;  2F0H A;  3OPO A;  1SMX A;  4XLA A;  2BVN A;  4L5T A;  1PH1 A;  2BH8 A;  2ZXO A;  1AIP A;  4OX9 Q;  2PQA A;  4RHS A;  1GHK A;  3CHB D;  1KK1 A;  5FJ8 G;  1LTG D;  4CKC A;  3UE1 A;  1E2V A;  3HGB A;  4A3M H;  2CH4 W;  3HOU H;  2R93 G;  1V9P A;  2Z8L A;  1BLI A;  2WZP P;  3PO2 H;  5CV4 A;  4OON A;  1GAW A;  4HMJ A;  1NMG A;  3KF8 B;  4EQO A;  4JBK A;  2AWN A;  2KEN A;  5C3W A;  2D3L A;  2DY1 A;  3AEV A;  2B5O A;  3W5V A;  1JJG A;  2NPF A;  2RDF A;  1VQ5 B;  1EUJ A;  4UZF A;  3RZO B;  2L4N A;  3NP8 A;  4DXG A;  1VQ7 A;  2CWP A;  1O7I A;  1SRU A;  4NKL A;  1G91 A;  4B3X A;  3QR8 A;  2C35 B;  5BN3 A;  4X8I A;  2Y0S B;  1WTO A;  2RHS B;  1VQF A;  3BY1 A;  3ISX A;  4KD4 A;  2NN6 H;  4JI1 Q;  3IKJ A;  3ERO A;  3R8B A;  1NMF A;  1GUS A;  3CQZ B;  3MXU A;  2C5B A;  4KJO A;  4A75 A;  1XPR A;  1B3Q A;  1LT6 D;  3MAQ A;  1HNW Q;  2IX3 A;  1VQK A;  2PIA A;  3DWQ A;  1EY6 A;  2QDB A;  2ZZQ A;  3QJY A;  2XGT A;  2X53 S;  1VQP A;  1W2B B;  1LAC A;  4KY7 A;  1C7Y A;  2F4V L;  4DK1 A;  1UEA B;  5HZA A;  4A4I A;  4K0K L;  3MZ5 A;  2IT1 A;  4CDC C;  1K8A C;  1F2Y A;  2PMZ E;  3E3X A;  2WYR A;  4QMG A;  1IHM A;  4DUY Q;  2HLD A;  1OB5 A;  1SE2 A;  1LYL A;  3MC0 B;  1SE3 A;  1E7Z A;  5EKL A;  1KC8 C;  1NB9 A;  3W2H A;  3NBI A;  5L46 A;  2EE1 A;  3WY9 A;  3M4Q A;  2RC5 A;  1LV9 A;  5BR8 Q;  2PNH A;  3I4N B;  4IAL A;  4G57 A;  3E5S A;  1GO3 E;  4C3I G;  1JB7 A;  1GHJ A;  4Z4U A;  2NYZ D;  3GTJ B;  3QWN A;  1WPC A;  4DR2 Q;  2F0W A;  3M85 A;  1EEF D;  1CA5 A;  4UP7 A;  2NZH A;  5IYC G;  5M3M B;  2Q8T A;  4DQK A;  1J8I A;  2EYJ A;  3BYT B;  2Q6O A;  4P71 A;  4EQP A;  2PQA B;  3QO2 A;  4RD0 A;  3M3Y H;  1HR0 W;  4GKJ Q;  3J80 L;  4IQZ A;  3GTK H;  3SGI A;  1PYW D;  2MQH A;  1NE3 A;  5IYW A;  3JQR A;  3K0X A;  4A3M B;  4LF6 L;  2ICE C;  5KYL A;  4JI5 Q;  1ENF A;  1W0K A;  1KHI A;  3G71 A;  5EPK A;  4AF7 A;  1KNE A;  2EQS A;  1S0U A;  2C2W A;  1IL8 A;  1TWG B;  4F8M A;  1AW7 A;  3HOW G;  4C1N I;  1Z6H A;  2V7W A;  4Y9U A;  1BBW A;  2F0D A;  5IYP A;  1STA A;  1XJV A;  3S24 A;  2CQA A;  5LHY 1;  1G6P A;  1HHV A;  2D62 A;  1TTT A;  3HFZ B;  3VR4 A;  2L12 A;  1KK2 A;  1WD0 A;  4DR4 Q;  2BGJ A;  3KUP A;  2VBV A;  4B08 A;  4GNX A;  2QW7 A;  1AZQ A;  4FF4 A;  3A35 A;  4L5S A;  1C8C A;  1BCP C;  2BM1 A;  2EJF C;  2MGS A;  1KDB A;  2XZP A;  4Z4W A;  2UUC L;  1K28 A;  4MYU A;  5IYD H;  1OHH A;  5K36 H;  1V0F A;  2YWE A;  2GJR A;  3HOX G;  1MAB A;  1G7C A;  3A8K E;  3KOJ A;  4RGM A;  5FK9 C;  4XMY A;  2JSO A;  4ZCM A;  1K28 D;  1AEX A;  4DNI A;  1LTA D;  1SRO A;  1SFO B;  1N32 L;  1TKW B;  1YHB A;  4LWC A;  1I5F A;  3VR2 A;  3OZU A;  3I4M B;  2E74 C;  2OCE A;  3BG3 A;  4X64 Q;  1BPL A;  3H0G H;  4XOR A;  1WJJ A;  3BCD A;  3H09 A;  4CJ2 C;  2PW7 A;  4Z4S A;  3I4O A;  1EY7 A;  1EOT A;  1G2T A;  4XQN A;  5M3M H;  4QIW E;  1J6Q A;  2Z0S A;  4DUY L;  1T6Z A;  5IYD G;  2UXD L;  3WQZ A;  4RDL A;  1JC7 A;  1WI5 A;  1IW7 D;  4U67 3;  1PH7 A;  1G7S A;  1G2S A;  3SHL A;  4O2D A;  1WTV A;  4RD4 A;  3CP0 A;  5EKI A;  3U4Z A;  4OEL B;  1DOL A;  1HJP A;  2R9V A;  2M2L A;  2OQK A;  3QB3 A;  3VR5 A;  1EFT A;  3AVY A;  1IJF A;  1N07 A;  1VQC A;  4HJA A;  2J4X A;  1VQ8 B;  1KQS B;  4WZK A;  1BCP F;  4JI3 L;  4II2 A;  4DV6 L;  4A3E G;  4Y52 H;  1ICW A;  3ASQ A;  1BR9 A;  1ZYR D;  2JE6 I;  2F0G A;  3K8A A;  4A3D G;  5LMU Q;  4RLZ A;  3OW7 A;  3AB9 A;  1VQ4 B;  3TP8 A;  2I07 B;  1TXY A;  1KRH A;  5ELE A;  5J22 A;  2X3U A;  4N9P A;  2D9U A;  1JCK B;  4KJN A;  2D9R A;  1HVX A;  1VQ9 A;  4RD3 A;  4R8N A;  4POG A;  4RGO S;  3UDF A;  1S5C D;  1KD1 C;  5KNC A;  3HOV G;  5C6A A;  4WZT A;  5BSY A;  4XLH A;  4GNX B;  1CNF A;  1GM5 A;  2NVQ B;  3CP2 A;  5LL6 X;  3K7U C;  3ONU A;  2XNA C;  4P74 A;  1Q8I A;  2XSC A;  5IE8 A;  3MHP A;  3JAM E;  2BOS A;  3EQL C;  2DJG C;  1YLO A;  1B7Y B;  3HKZ G;  1UMK A;  4BXX H;  2L11 A;  1H9J A;  1VMP A;  4BBR B;  2UXB Q;  2C78 A;  4MTN A;  3U9S A;  1K73 C;  1XXG A;  3K5O A;  1FGU A;  1I94 L;  1C0A A;  4IW3 B;  4H0L C;  4FXK C;  5H5J A;  2B2W C;  2JEA I;  3CCE A;  3MFG A;  4K6L A;  1ZEQ X;  1AP0 A;  2QDL A;  3SLN A;  2X69 A;  5CC4 A;  2V7X A;  4CKB A;  4AYB B;  1VQ9 B;  2XNC A;  4PC2 A;  1JQY D;  3NK9 A;  2B63 G;  4WWV A;  1MHW C;  1J9Z A;  4TMV A;  1JB9 A;  5A8A A;  1WTW A;  3K5M A;  4XLE A;  1X6O A;  4IUR A;  1M8A A;  1JNY A;  2DJF C;  3NUC A;  2KCC A;  1PTO C;  1WD1 A;  2RHQ B;  4PC7 A;  3VR6 A;  1VQO A;  3NQT A;  3W2D A;  4CGY B;  1I4G A;  4LF5 Q;  4A76 A;  3AFQ A;  5IT9 c;  2F0Q A;  1TWF H;  4TRD A;  1DDG A;  1HPC A;  4V0B A;  2NZO A;  3G6J B;  4F7X A;  3U6B A;  4E6I A;  2RSN A;  4EX5 A;  4DXF A;  3CCJ A;  3S2D B;  5H59 A;  2OWO A;  4LF9 L;  3PIO 3;  1SE8 A;  2ATW A;  1OGI A;  1SYB A;  4UZU A;  3W2F A;  5C3E H;  3J81 c;  5EMN A;  4LFC Q;  2NVT B;  1HTL D;  2HDN B;  2XIW A;  1A15 A;  1BQQ T;  4ZV4 A;  3PV0 A;  4IUP A;  4LK1 C;  1CM9 A;  1D2B A;  1HFN A;  1SYC A;  4AQY Q;  2WR8 A;  2IHE A;  2I5M X;  1RQP A;  1G6Z A;  1JWU D;  4A3K H;  4A3J B;  1B44 D;  2PW5 A;  4X3K A;  2NZ1 D;  2FFK B;  3J81 L;  4R4I A;  1K83 B;  2UXB L;  1NR4 A;  2OF1 A;  3J7A 5;  1T6Y A;  3GP7 A;  1FRQ A;  3NHH A;  2JJ1 A;  1RIP A;  2L1B A;  1LO5 D;  2HHH Q;  3WWV A;  3CC4 B;  3CCM A;  1N8R D;  2E2I B;  3IL8 A;  3KDF A;  1VJS A;  3J80 i;  3P27 A;  1EZ6 A;  4CDD C;  1O80 A;  1FNW A;  1ROD A;  2ZBV A;  3W3A A;  2F0O A;  1QNK A;  4XR6 A;  1K0R A;  2J0T D;  4JI2 Q;  5JEA J;  4G5G A;  1HR0 L;  1QGY A;  4LF7 L;  1K8G A;  4GOP C;  5J3B A;  5KSW B;  4H7B A;  3IFD A;  1IB0 A;  1T5E A;  3H9N A;  1YZ6 A;  4JI1 L;  5C4X G;  1RF2 D;  1X3F A;  2JXM B;  3G71 B;  1JMC A;  3H3V C;  1EQR A;  2BN4 A;  2Q2H A;  3ONY A;  3M7N A;  4GQN A;  2AUK A;  4P9S A;  3VMF A;  5C44 G;  1VQL B;  4DK3 C;  3CAM A;  4A3F H;  1VQM B;  4X7C A;  2B39 A;  4XOT A;  3ASS A;  4DNR B;  1NTG A;  4K0K Q;  1JB3 A;  5EBD A;  4NP5 A;  1F2M A;  1Y14 B;  4A3G B;  4A3K B;  1MIU A;  2KBN A;  1JJC B;  3T51 B;  3E9H A;  5A2Q L;  4BBS B;  4HIK A;  3A8J E;  1N8R C;  3QFT A;  3I3C A;  4A3B H;  5JVH 3;  2F3I A;  2H5X A;  3CXC A;  4NXN L;  4DR4 L;  3BDC A;  2OTJ B;  3QSY A;  2RQX A;  1YJ9 A;  2ZZG A;  1PH4 A;  4OHJ A;  3C1E A;  1BMF A;  3K81 C;  3C3L A;  3NEL A;  1BNZ A;  1GUG A;  1HNX L;  2E1R A;  4BY7 H;  3D4W A;  3J7Z C;  2ZJP A;  2Q8R E;  4ZAI A;  3L9A X;  4YAO A;  4FXD A;  4OOX A;  4XQQ A;  4FYD A;  1O7Z A;  4LF9 Q;  2L0C A;  4Q7J B;  4Z1M A;  4GNX C;  1J5E L;  4KKU A;  2RCF A;  2K5N A;  3SEB A;  2N55 A;  2JJ2 A;  1Q90 A;  1GJR A;  1TT2 A;  4GS3 A;  4A93 B;  3CF5 A;  2K52 A;  4KHP Q;  1KLG D;  1VF7 A;  3W1B A;  5M5W B;  3DWA A;  3TRE A;  3GTO H;  1PKV A;  3PO3 G;  3PVD A;  4O42 A;  1STY A;  2RBM A;  1NAP A;  3GO5 A;  3P75 A;  2ICI A;  4UY8 C;  4P3I A;  3BU2 A;  2MO1 A;  4XT1 B;  1WVL A;  4S3S A;  5ELN A;  1CUK A;  2VY3 A;  3WOF A;  2VNU D;  4R4T A;  1C48 A;  2XN9 C;  1WTP A;  4XN3 A;  3KFU A;  2WB1 B;  1NRK A;  2ZIT A;  1YIJ B;  2NBF A;  3QOJ A;  5TR9 A;  3GTL B;  4XYQ A;  3A8K A;  3WND A;  2UXC Q;  2IHF A;  4AC9 A;  2K5H A;  2F3W A;  3T13 A;  2KCN A;  4QUC A;  4DR7 Q;  1ZM4 A;  2UUC Q;  4LF7 Q;  5JVG 3;  1V43 A;  1B23 P;  1MGS A;  4YEJ A;  1QG7 A;  1PJ7 A;  2UUB L;  4HID A;  4PZ6 A;  1DYQ A;  3S17 B;  3A7A B;  1HZE A;  5E7N A;  5FO9 B;  1K73 D;  3EIV A;  2DOG A;  2QTL A;  3D8G A;  3W1G A;  1D2E A;  2F52 A;  3ZBU A;  2ZXP A;  4A3G H;  2GN5 A;  2JA6 G;  3L0O A;  1BX1 A;  3LQ6 A;  5CMD A;  3PUV A;  3SJZ A;  1HNX Q;  4CDF C;  1RDP D;  1QVF B;  2DN8 A;  3HEJ A;  1Z47 A;  4RD6 A;  1QJO A;  3I1F A;  2DER A;  5KNB A;  2OBS A;  2E5L Q;  1BCP D;  3Q22 A;  3TRZ A;  4K14 A;  1OGJ A;  1CKN B;  1PFS A;  3AGP A;  1Y1V B;  1M1K D;  1EY9 A;  3UDI A;  2WIN B;  1SKY B;  1CK1 A;  1B9N A;  1RCV D;  1KD1 D;  3S1R B;  5FO1 A;  2VNH A;  2PI2 A;  4IJL A;  1IL2 A;  2JA8 G;  1YHQ B;  4DA2 A;  4DAY B;  5A2Q E;  2G5D A;  3M9B A;  2E2H H;  2M5S A;  1YNN D;  4RD1 A;  4EQ5 A;  2AUJ D;  4R9W A;  2CBX A;  3KLW A;  2VUM G;  1E3X A;  1N06 A;  3HOZ B;  1Q46 A;  1HUN A;  3GTO B;  1F2L A;  1FJG L;  2F0K A;  5G3L D;  3W2I A;  5EBC A;  4JCV E;  3R2T A;  1G7T A;  4L8J A;  3OP1 A;  2G9D A;  4C3H H;  1KRS A;  1T6X A;  1A62 A;  1PMR A;  4LAA A;  1ILP A;  2BDN A;  4EQN A;  3BCF A;  1BDO A;  1PTO F;  1YBY A;  1GUO A;  2VYQ A;  2PYK A;  2NTT A;  2B8G A;  3K80 C;  3OE7 A;  5M5X B;  2TSS A;  1UUP A;  2D0P A;  1WOS A;  3Q6S A;  4B44 A;  3FMC A;  2JK8 A;  2H4O A;  1CSP A;  4RH6 A;  4Y7N B;  1YIT B;  1PHJ A;  3S16 H;  1SR3 A;  3GTG B;  2RA4 A;  4OO1 I;  1QFZ A;  4YHH L;  1K8A D;  1N08 A;  3RD4 A;  2NN6 G;  4JPB W;  2FX3 A;  2PMD A;  3CCM B;  1JE5 A;  1UD2 A;  5IGD A;  3BVZ A;  3OWE B;  4O1N A;  3X3N A;  4DAY A;  1IZ6 A;  1LTI D;  1U4P A;  4DR7 L;  3KJP A;  1NDH A;  1YJW B;  1CI3 M;  1D5X C;  1VQK B;  5GV7 A;  3AVT A;  4X66 L;  3Q8D A;  4X62 Q;  2ASB A;  4C3H G;  3S1Q B;  5ELF A;  3M3Y B;  5IYR A;  2VB3 X;  4DV3 Q;  1JIC A;  2O4X A;  1UD5 A;  4HJ8 A;  3GTM H;  3PA2 A;  2YWH A;  2A68 C;  2MO0 A;  4TSS A;  2Z4I A;  3MFY A;  1OXV A;  4IPH A;  1QB5 D;  3HOZ H;  3Q6Q A;  4F7D A;  1GD7 A;  4KN7 C;  2VUM H;  2JA8 H;  5M3F G;  1IKM A;  4GN4 B;  1HFG A;  4XD7 A;  3CRL C;  3A7L A;  3G48 A;  3HOU G;  1F9R A;  4JMQ A;  1VQB A;  2E5L L;  4XYO A;  4A3L G;  4AYB E;  3K7A H;  1R9T H;  4LF8 L;  2R7F A;  3E6Z X;  1I4H A;  4A3F B;  4Z4Y A;  4UZE A;  1AE3 A;  2ZBU A;  4NW2 A;  3PF5 A;  2WPD A;  3QOL A;  4JI7 Q;  2XNJ A;  4TMX A;  5C4Z A;  4A3I B;  4UDU C;  1EP2 B;  2IW3 A;  1L1O A;  3Q3A A;  3GTP H;  2NVX H;  4WQM A;  1G51 A;  5C4J B;  3X3M A;  2L15 A;  4UAI A;  4R4Q A;  1CTM A;  1SBB B;  3I4N H;  3S16 B;  1CQX A;  1YJ9 B;  2OT2 A;  2JA5 G;  2ZXR A;  1PZJ D;  5J1Z A;  3BH4 A;  2AMC B;  2EYP A;  2ZTG A;  2EYL A;  3J7Y W;  4IZ8 A;  4HJ9 A;  2I5H A;  2CH4 A;  5F4J A;  4YHH Q;  1CHP D;  4WZL A;  3QIA A;  4BY7 B;  2GK6 A;  5HUR A;  4B3S Q;  2EDG A;  1XYI A;  1N34 Q;  1OB2 A;  4JI4 Q;  3GTQ B;  3KF6 B;  3RY8 A;  2K05 A;  4KD3 A;  3Q38 A;  4RG1 A;  1N05 A;  4C2M B;  3QE2 A;  1A6X A;  2K5W A;  1VHE A;  4P25 A;  1V1O A;  3I8Z A;  3JAM L;  4NXM L;  1HCZ A;  1CQV A;  2YYZ A;  4Z4R A;  4QVJ A;  4B3T Q;  2R93 H;  5M3M G;  3CC7 B;  3STB C;  3NWT A;  1OXX K;  1GAQ A;  2CND A;  1K9M C;  1KAB A;  2Z6K A;  3W5H A;  2R6G A;  2CW0 C;  2FMM A;  4R1J A;  1BVS A;  4EGV A;  4GOP A;  1PV4 A;  5CR3 A;  4R71 A;  3K7A B;  2HD3 A;  3OYY A;  2AHO B;  3T56 B;  2MNA A;  5IYC H;  4LFB L;  2DUD A;  3PUN A;  4RDJ A;  4KKT A;  1PA6 A;  4K8I A;  1X3E A;  4DQL A;  1S40 A;  3FKS A;  4DNT B;  3KF6 A;  3HOX H;  3GTP B;  4DU9 A;  5KRU A;  3T1H L;  5IP9 G;  4CJ0 B;  3MEH A;  3ZC3 A;  5GAD C;  4DV1 L;  1K3B C;  1PTO H;  4NXN Q;  4XKV A;  2K04 A;  4DV3 L;  2GQF A;  3I55 B;  4C0S A;  2JA7 G;  4FF1 A;  4R4C A;  1JWS D;  2HDM A;  1MSG A;  5T1I A;  1YHA A;  4JYA Q;  5LMN L;  4XLC A;  1W3S A;  3NTH A;  1SNQ A;  1V1P A;  4KY6 A;  1I8D A;  3C2Q A;  3N6R A;  2AQ3 B;  4NB3 A;  4JI0 L;  2I1L A;  2EJG C;  4L63 B;  2VNK A;  4GZY C;  1DM0 B;  2DEU A;  5C3E G;  1DD2 A;  4G7Z C;  2IJ0 A;  2N78 A;  1VQ7 B;  3TBI B;  2GRE A;  3RZD B;  5JJL A;  4A3B G;  2Q6K A;  1QVG B;  2VZA A;  4BA2 I;  3K58 A;  2B2T C;  3PUW A;  1SSO A;  2IX1 A;  1H42 A;  1WDT A;  2W6J A;  1ONL A;  1S4M A;  4B3M L;  2C77 A;  5KYI A;  1HA5 A;  1X32 A;  4J8Q A;  1TWA B;  5ELO A;  2HDL A;  4KTA A;  1O7L A;  3S1M B;  5L37 A;  1PH5 A;  4OOS A;  4X7D A;  1B70 B;  3RZO H;  4ULL A;  3J81 E;  3G4S A;  3U4V A;  4ZK9 B;  1P4M A;  3WXM A;  3AVU A;  4ZUI A;  2BE5 C;  3PO2 G;  1V0E A;  4OPS A;  3WNC A;  3S1N H;  1IJE A;  3CC7 A;  2F4V Q;  2YWF A;  1L0Y B;  1Z9F A;  4XOP A;  1WCM G;  2UXC L;  4X07 A;  2LXK A;  5IIF A;  1IBL L;  1N33 Q;  1Q3L A;  4QV2 A;  1DCZ A;  1PRT C;  3CCV A;  4DV2 Q;  3VNV A;  3L3O C;  4DV0 L;  1TWH H;  5COY A;  5FA6 A;  1SJH D;  3CKI B;  1OXU A;  1TR5 A;  4P75 A;  2SEB D;  2UUB Q;  1A63 A;  4FP5 D;  1V1P B;  1QCB D;  1Q1B A;  4U68 A;  3WYA A;  5FLM G;  2QEJ C;  4PG3 A;  2VBS A;  4G7H C;  4DR2 L;  4C3J G;  5HZB A;  3W5U A;  5TY0 A;  2BF4 A;  5JJZ A;  2UU9 L;  2FMC A;  1ESR A;  3ULP A;  2OTJ A;  3G4S B;  4G6I A;  4JOI A;  4FWT A;  1ZKO A;  3KK7 A;  2V7Q A;  4M53 A;  4JI0 Q;  1PJ5 A;  3HP3 A;  1LM0 A;  1XPO A;  1FJG Q;  1F9Q A;  3I55 A;  3NSW A;  3GTJ H;  2G9H D;  1VHO A;  1UE1 A;  1U9R A;  2PI2 E;  4BBR H;  1FND A;  1HXY D;  4DUZ Q;  1K8M A;  1JOQ A;  3HOY B;  4A3D H;  3I4L A;  3T1H Q;  3A8J A;  1V8Q A;  2B2V C;  3ND8 A;  3ND9 A;  3FJO A;  2PZU A;  3SK4 A;  3W5O A;  5LL6 S;  1M4V A;  2AKW B;  1HNZ L;  3A54 A;  1FRN A;  1KDA A;  1I50 H;  4PZ8 A;  2WB1 E;  2BCO A;  5KGU A;  2OK8 A;  2NUC A;  2WKC A;  4ZKC B;  2BV3 A;  1EXM A;  5JPM C;  1HQR D;  3C2P A;  4JYA L;  5FO7 B;  5M5Y B;  4BBR G;  1D5M C;  3I56 A;  4LF4 Q;  1LUZ A;  1EY4 A;  2LY7 A;  3V7A A;  2D2C C;  5I9P A;  3MTS A;  4LBY A;  3T16 A;  4JBJ A;  1UE7 A;  3BY2 A;  3TS0 A;  3L2P A;  3NTK A;  5KNL A;  1TU2 B;  2K7V A;  2MHV A;  2FHT A;  4RWS C;  4LMQ D;  3RN2 A;  2JJQ A;  1T9H A;  2C4U A;  4AYB G;  1S72 B;  1K0S A;  1WTQ A;  1JA1 A;  2CHB D;  3O13 A;  2BMW A;  2H1E A;  5KND A;  3S14 B;  3BYY B;  5JJK A;  4X62 L;  3CCU B;  5C4H A;  3KLS A;  3SK6 A;  1EIY B;  1CSQ A;  1D7Q A;  4LUV A;  3S2D H;  3NBH B;  3SKB A;  2EZV A;  1U0L A;  4IFD H;  4PQX A;  1SFO H;  1EY5 A;  3KLR A;  2B2W A;  4N3N A;  4II3 A;  2WJV A;  2B2Y A;  1SND A;  2CFM A;  2YV5 A;  4B48 A;  1HZA A;  4IUV A;  4A3C H;  5E6T A;  2Z6B D;  1CQF A;  5KIX A;  1JOK A;  3SE0 A;  1EFW A;  2O5I C;  5EPJ A;  1LTL A;  1HA3 A;  2A73 B;  3CW2 C;  1KQS A;  4QJF A;  3FKI G;  4JI6 L;  3OKX A;  5DN6 A;  3A55 A;  1E22 A;  3AGQ A;  4P72 A;  2Q2T A;  2QN6 A;  2Z6B A;  1ZM2 A;  2GA4 B;  1LT3 D;  4UHV A;  4POF A;  2LXJ A;  3IRB A;  1QGZ A;  5HGT A;  2N88 A;  1N0U A;  3HAG A;  4DV4 L;  3ZJY C;  4XQF A;  1KJZ A;  3CPW B;  3CME B;  1E2W A;  1EIF A;  4MHE A;  5AFW A;  2E2I H;  5I9O A;  1GXD C;  3JU4 A;  2R93 B;  2DGY A;  1FGB D;  1M1K C;  4XN0 A;  2CRV A;  3P20 A;  2QCP X;  3OZV A;  1YJN B;  1VQG A;  3CRK C;  2UU9 Q;  3S15 H;  3LO8 A;  2YTY A;  2V7T A;  2Z4H A;  1W0J A;  2WAQ B;  3H3V I;  3S2H B;  2A74 C;  4A3E H;  3V2T A;  4OPV A;  4XXE A;  2ZL7 A;  1QH0 A;  3A5U A;  1WOP A;  3MCA A;  1TII D;  4XQJ A;  4LF8 Q;  4QVA A;  2RKS A;  3D0F A;  4QF4 A;  3P1H A;  3V76 A;  3NBH A;  2IWH A;  3HOX B;  3J81 i;  3OJX A;  3KDF B;  3CD6 A;  1I4Q A;  1BUV T;  2PO4 A;  2Y0S G;  3UDX A;  4Z4T A;  5DM6 3;  4Q5V A;  4NXM Q;  1WOR A;  2BGI A;  3C1F A;  3DXJ C;  4X6A H;  1Q86 D;  1S5B D;  4HMI A;  1QNU A;  5IP9 H;  3T1Y Q;  1QGA A;  2XRS D;  1TVX A;  4O0A A;  2N8N A;  4JBM A;  1VQP B;  4OOV A;  2B2T A;  1SNM A;  4XM3 A;  2HQE A;  3SK8 A;  1BXT A;  1NCV A;  4C3I H;  3A8I E;  1X56 A;  1MRZ A;  4JI8 Q;  1FDR A;  3OOC A;  2B8F A;  3E0J A;  3I73 A;  4KN4 C;  3P7J A;  2RDH A;  1Y1W G;  4DAV A;  4JK1 C;  3GTK B;  1Y8N B;  2V1C C;  5IT9 E;  2AQ1 B;  4XKW A;  2D74 A;  5IP7 H;  1JWM D;  4N8X 1;  4MN3 A;  2X0K A;  5KW9 A;  2ZTN A;  4YY3 Q;  2EY1 A;  3RUZ A;  1KAW A;  4IOA A;  1TWG H;  1HRJ A;  3QFR A;  4IUN A;  3DWP A;  3WBJ A;  2F0S A;  1SXT A;  4M4S A;  1GUN A;  1ET9 A;  1XTC D;  1GKH A;  1WSR A;  3SK5 A;  4A3E B;  4N8F A;  4B3R Q;  2X6W A;  2WZN A;  2HT1 A;  1CT1 D;  2CVR A;  3GQB A;  1HUM A;  5BN4 A;  3QG1 A;  4GKJ L;  2Z9H A;  3OWF A;  5HXB A;  3J7A F;  3GV3 A;  4HSP A;  3RN5 A;  2K32 A;  3PEN A;  1FNM A;  3EVQ A;  3F2D A;  3FHW A;  1SE4 A;  3S15 B;  3OFN A;  2V7V A;  1D1N A;  1XTD A;  3OMC A;  1G8Z D;  4LFB Q;  1W9X A;  2EFG A;  2MJ8 A;  4GN3 B;  5CGK A;  4K5X A;  4JV5 Q;  2QEX B;  4ZKB B;  4DV1 Q;  3LGJ A;  1D6E C;  3EA6 A;  1MJC A;  1XNQ L;  1SYF A;  1NUC A;  2EY5 A;  1NBM A;  4LBW A;  1I4R A;  1WFQ A;  4HIO A;  4A3J H;  4RGN A;  3GDE A;  2BM0 A;  2P5Z X;  2WP8 J;  3OIQ A;  4KKS A;  2D5D A;  2YTV A;  4K5W A;  1UNS A;  3B78 A;  3H0G G;  2F0L A;  1JR0 D;  4RGT A;  3CES A;  3I4M H;  4OWW B;  1E3P A;  2EOT A;  2NVY H;  5LMN Q;  2XEX A;  5GAG C;  3SDZ A;  1VCI A;  1XNR L;  5FO8 B;  4C3I B;  2O2L D;  3J80 c;  5DSZ A;  2AWO A;  3PSI A;  3DMU A;  3WOE A;  3VDY A;  1VQL A;  3D6C A;  2K1B A;  3MXP A;  2E2H B;  2QEX A;  1EU3 A;  2XRQ D;  1IYU A;  1VQ4 A;  2V4D A;  4RJL A;  2OBR A;  1I50 B;  3I91 A;  3CC2 A;  4OWT B;  1F60 A;  4I7A A;  3CC4 A;  1VQN A;  2VB2 X;  4RCO A;  4JI8 L;  1U5K A;  3V96 A;  4QQB X;  1VQA A;  2ID0 A;  2R92 H;  4PV1 C;  4P6V F;  1XFO A;  4IUU A;  2QF7 A;  4OEM B;  3FPU B;  1Q82 C;  1I6H H;  2WKD A;  4DGZ A;  5NUC A;  1N33 L;  2VJI A;  3ZIA A;  1SJE D;  3UI2 A;  2A6E C;  3M7G A;  1STH A;  3J81 j;  3DHQ A;  1UWV A;  1OXT A;  3DM1 A;  3AYH B;  1LAB A;  3EN2 A;  3T4A C;  4BBS H;  1TY0 A;  1E1O A;  4B3G A;  3T53 B;  1ICF B;  4CQJ A;  3CCE B;  3VYU A;  1EY0 A;  1ZM3 A;  2QGQ A;  2XOK A;  5DM7 3;  4DV2 L;  1YIT A;  5JPN C;  4B3F X;  3MVV A;  2NVQ H;  3TP5 A;  1DG1 G;  3GTG H;  4F88 A;  5IOC A;  1DGS A;  4NPS A;  1B4O A;  3U6K A;  4DFA A;  1AFP A;  5I6W A;  4KK7 A;  1EFR A;  2X6X A;  1MBY A;  1SNO A;  2JN9 A;  2CF4 A;  1LTS D;  3LX0 A;  1STB A;  1U2R A;  3SLD A;  1JT8 A;  4BY1 G;  3F2B A;  1IBM L;  1NBW A;  5CV7 A;  3TZU A;  3K57 A;  1Q82 D;  1XNR Q;  1BX0 A;  1GO2 A;  3TSS A;  2B2U A;  2ENB A;  2LKV A;  5GRO A;  3G6E A;  4IFD I;  3OIP A;  3ONA B;  1A2U A;  4G4K A;  1BKB A;  2R61 A;  3PA1 A;  5IYB G;  3GVL A;  1TWC B;  2KVM A;  3IFT A;  1I4X A;  4F87 A;  3PMF A;  1SN8 A;  4RHR A;  1CNE A;  1PTO D;  3KBG A;  4X3T A;  4ODG A;  4DV7 L;  2DNE A;  4V19 0;  1F2Z A;  3AMU A;  2F0U A;  2NV4 A;  3PQI A;  4IFD J;  4YAL A;  4DN4 M;  1Q8K A;  5C44 B;  2V7U A;  4HR7 B;  1SAP A;  1EQQ A;  1EYG A;  1KC8 D;  4FDB A;  1RTO A;  4A93 H;  1RQR A;  1B50 A;  4OPO A;  4X3S A;  4YAU A;  4C1N K;  4IJH A;  1QFJ A;  3AFP A;  2NVX B;  3CC2 B;  2R92 G;  1EIH A;  1S4Z A;  3I4N G;  2ALY B;  1N34 L;  4JI4 L;  2CWA A;  1CZG A;  2HMA A;  1YI2 A;  4XL9 A;  2NVT H;  1D5Z C;  4HN7 A;  1R9T B;  2R7Z B;  1XX8 A;  3FKI H;  4G1B A;  2UUA L;  4DKA C;  1EYC A;  5F4O A;  1IXR A;  4K2K A;  4GLV B;  5M3F B;  2C5C A;  1S5E D;  3PIP A;  3OJW A;  3CW2 A;  2M00 A;  2NWG A;  3URY A;  4ASU A;  1CKO A;  2MP1 A;  1HZC A;  1W35 A;  1OO9 B;  3RLO A;  5AJ3 Q;  1I3Q H;  4YWM A;  1EOV A;  1Y8O B;  1SEB D;  4TT3 A;  4AF6 A;  3A3B A;  1Y1W H;  3Q39 A;  3HOV B;  4YIJ A;  2VNI A;  5B6I A;  3CCL A;  3KL9 A;  1E43 A;  5EPL A;  3NWS A;  5C0X J;  3M4O B;  4FVM A;  3S1R H;  1PZI D;  1NY4 A;  4DPG A;  3I72 A;  1B3A A;  1WOC A;  3HKZ B;  1A3U A;  1L0X B;  4P22 A;  4C43 A;  1W34 A;  1D1K A;  5DNF A;  4DV4 Q;  4J1M A;  5E3F A;  3GVJ A;  1A8P A;  1SNC A;  1QVF A;  5TSS A;  4DR5 Q;  1LTR D;  1A3T A;  1W2B A;  3CCQ A;  4DV7 Q;  3FDT A;  1STG A;  3I90 A;  3OMG A;  3FPP A;  1A2T A;  1UAP A;  5BR8 L;  4IO9 A;  4BY7 G;  4IUQ A;  1BBX C;  2WB1 G;  3MHB A;  1TWC H;  5E4W C;  3TP6 A;  4L5R C;  3CB4 A;  2HCJ B;  1RTN A;  2A19 A;  3BJU A;  2HHH L;  3ZUG A;  1ASZ A;  1KNA A;  4UP8 A;  4M8A A;  4PAB A;  5EKK A;  4PGO A;  4Z9C B;  5CDF A;  1B9M A;  3K6O A;  3MXG A;  4YAW A;  4UAJ A;  4B9X A;  1EY8 A;  3CMA A;  4NBS A;  2B2V A;  1WTX A;  5IGE A;  3PUM A;  2OTL A;  3H6M A;  1H85 A;  2GPJ A;  2WAQ E;  4LFA L;  1XQB A;  4BWG B;  4ZCI A;  2A1A A;  3I4M G;  4A3M G;  2A69 C;  4WOR A;  4YEL A;  1VMC A;  2R7D A;  2B29 A;  3PO3 H;  4ABN A;  5ELB A;  5C0X G;  2B7B A;  2D3N A;  3SJP A;  1DOK A;  1E1R A;  4J0Q A;  1QIL A;  2AQ2 B;  3I2Z A;  3ZZ0 A;  2X6Y A;  3TZD A;  1OB0 A;  3HOW B;  2E1B A;  3BDO A;  4GN5 A;  2ZZE A;  3HZX A;  1V1Q A;  2HCI A;  5FIU A;  3VNU A;  4MNO A;  5M3F H;  2F3V A;  1YNJ D;  3D4R A;  1QG0 A;  1SYD A;  2ZT9 C;  3BZK A;  5C5M A;  2LS0 1;  4J15 A;  3DLL A;  3K59 A;  1KZL A;  1W87 A;  1B1Z A;  4ZGQ B;  3CCQ B;  1NSN S;  4A3J G;  1I18 A;  1EYD A;  1R4Q B;  2CCZ A;  1UEB A;  2SOB A;  3MWY W;  2F0J A;  3ULL A;  4ZRZ A;  5IYQ A;  2DCU A;  2OTL B;  1X55 A;  1HH2 P;  4X7E A;  1NJI D;  3M4P A;  3OEE A;  3CCL B;  2VUM B;  1PXU A;  2VQF Q;  4B43 A;  4XLF A;  4XT3 B;  3F2C A;  1BOS A;  4P26 A;  1TWA H;  2OYN A;  3H3V H;  2KJX A;  3G05 A;  4Q0F A;  1YVC A;  5D3I B;  1IBK Q;  3A0J A;  2WII B;  3CPF A;  1PRT F;  4GLX A;  3J80 E;  2EY6 A;  3VO1 A;  3KLS X;  4TQU S;  1STE A;  2JIZ A;  3GTM B;  3TDQ A;  1GUW A;  5COR A;  2L5T A;  3STB D;  4QB4 A;  3OZW A;  1CKM A;  4ME5 A;  3DDY A;  3K5N A;  5ISR A;  4J6H A;  1VQD A;  3B6Y A;  4HTH A;  1GVP A;  4RMF A;  5C4X B;  1N0V C;  4KHP L;  3PO3 B;  1EP1 B;  3FEW X;  2PCF B;  4Z4V A;  2PQE A;  3PCO B;  5EGT A;  1QUF A;  2UXD Q;  1HNZ Q;  3K0Y A;  1VS0 A;  3ES9 A;  2EYF A;  3KF8 A;  3PO2 B;  1QFY A;  1QOH A;  4TKO B;  4QGU A;  1EWI A;  1TS2 A;  2E76 C;  2XVS A;  5EJW A;  1XMQ Q;  5E4X A;  1FYC A;  3F8T A;  3BS1 A;  1EZ8 A;  2X6L A;  3R2I A;  1XPU A;  5DS0 A;  2A5H A;  4B3S L;  2QA4 A;  4TMZ A;  4KHZ A;  2EYH A;  3D3R A;  3CPX A;  4RCN A;  2CK3 A;  2KVO A;  1CKN A;  3A8I A;  1LTT D;  5FLM H;  5CV5 A;  2E2D C;  1H9S A;  4C3J B;  4HJ7 A;  1YX2 A;  1EYA A;  4HIZ A;  1IHZ A;  1ML0 D;  3WBK A;  2WFW A;  3KBX A;  4A3D B;  4QHY A;  2F0T A;  2LSS A;  4UPA A;  2HIV A;  5ELD A;  1JA0 A;  3CMM A;  3K5L A;  1BO0 A;  4KV6 A;  4B9W A;  1E3Z A;  4WZE A;  2GJP A;  1TY2 A;  3PUZ A;  3LWE A;  2EXZ A;  3BC9 A;  5J3O A;  4FXG C;  4HE5 A;  1NJI C;  1IBK L;  3S14 H;  2RF4 A;  3NXW A;  1KXL A;  3U58 A;  4G7X A;  5IWA Q;  5IT9 L;  5BN5 A;  1PZK D;  4OP7 A;  1WOO A;  3MMP A;  4IPG A;  1EWC A;  2KEE A;  3TP7 A;  1YHQ A;  1A0I A;  4PC6 A;  3I70 A;  4OGQ C;  2D0O A;  3HRZ C;  1Y69 U;  1KTK A;  1X3P A;  2F0F A;  2R7Z H;  2KUM A;  1XE1 A;  5GAE C;  4NCN A;  1KAA A;  2AHO A;  2B2U C;  5M5X H;  4ACA A;  5TRD A;  4K5V A;  3BDL A;  1DON A;  4RKL A;  2VQF L;  4XNF A;  5HKK A;  2MFI A;  2YWG A;  2A68 D;  1UD4 A;  2K5Q A;  3A3G A;  2A69 D;  2ZJR A;  2HIX A;  1VQ8 A;  2KHI A;  1EU4 A;  4KY5 A;  2ZM6 Q;  2NB0 A;  1XMQ L;  4HSV A;  1PTO B;  3U9O A;  2PZW A;  1E79 A;  4H13 C;  4FK8 A;  2GJK A;  4PNY A;  1QWY A;  3CPW A;  1MJE A;  1CZW A;  2QE7 A;  4H9G A;  3OTO Q;  2BE5 D;  1QZG A;  3V05 A;  4XIG S;  3SXH A;  1P8L A;  2EPB A;  3LQE A;  3P26 A;  1M90 D;  1J9O A;  2B3G A;  1KLU D;  4C3J H;  5CBA E;  4LF5 L;  1YJN A;  4FXU A;  3CCU A;  4TSF A;  3CCV B;  1FNC A;  2FXQ A;  3JC6 6;  3KEW A;  4JVZ A;  2L55 A;  2ZTC A;  4NDX A;  5F4M A;  1JJ2 B;  2FIN B;  5IGG A;  3S1M H;  3NQI A;  2CQO A;  3S1Q H;  4X0C A;  4IPD A;  4IOC A;  3PUX A;  3FRP B;  4G7O C;  3D26 A;  4NNJ A;  2VNJ A;  2K4K A;  4LFC L;  4PAA A;  4FN5 A;  1Q1E A;  4DR1 Q;  1VQN B;  1H9M A;  2ZTD A;  4Z4Z A;  1EQT A;  1XB2 A;  3LNN A;  5AN9 A;  5I2X A;  1U4L A;  3HKS A;  4P73 A;  1K3R A;  1F9P A;  1U4R A;  2JQO A;  4PC3 A;  1N9W A;  2F43 A;  2B7C A;  4P1V A;  4A3K G;  1GJX A;  2A6H C;  4BBS G;  2F0P A;  1TWF B;  1EP3 B;  5IYN A;  2JA7 B;  3OAA A;  4OIK A;  3JQP A;  4YCV A;  4DV0 Q;  3CMA B;  2RCN A;  2FVG A;  4OWX B;  3S1N B;  5JJI A;  4KI0 A;  1ZXT A;  2Y0S E;  5I6Y A;  2I5L X;  1JJ2 A;  2ZL5 A;  4P12 A;  2CW5 A;  2XWB B;  3OW2 A;  3AQQ A;  5C3E B;  2BDO A;  2UUA Q;  5H1S E;  2VL6 A;  2Z1C A;  1PH9 A;  3HOU B;  2A8V A;  2C4T A;  1OXS C;  3AVV A;  4PC1 A;  4QFM A;  2XGJ A;  1S5D D;  2WV6 D;  1UE5 A;  4ZYS A;  4HJ5 A;  2E2J H;  1R5O A;  4OIJ A;  5IWA L;  3HOW H;  1HR0 Q;  2B63 H;  4PMW A;  5ELC A;  1TQO A;  1N32 Q;  1ET6 A;  1WU8 A;  2WAC A;  5AJ3 L;  2X85 A;  3HOY H;  3GTQ H;  3F2U A;  4DF7 A;  5CV8 A;  3PIP 3;  4DUZ L;  2GVA A;  2R3Z A;  3CD6 B;  1CHQ D;  4DK6 C;  4A3C G;  1D8L A;  4HE6 A;  1OTC A;  1EFI D;  2F4N A;  2K33 A;  4LW1 A;  5JEA H;  3ZZT A;  2EXD A;  1VQH A;  5M5Y H;  1XNQ Q;  2EVB A;  1DDI A;  3RR5 A;  3W2G A;  1BQE A;  1TS5 A;  4DAM A;  4DR1 L;  3AST A;  2CKZ B;  5DEH A;  3SR1 A;  4QY7 A;  3BZC A;  4GOP B;  3D6W A;  1FR3 A;  5K36 G;  1LT4 D;  4H02 A;  2VQE L;  3UE0 A;  4JBW A;  3OSO A;  3ERQ A;  1Q9S A;  1Y0Y A;  3ULJ A;  3OTO L;  3R6K A;  4BXX G;  3H15 A;  3JQQ A;  4WJ4 A;  2K03 A;  3U2Q A;  1EL0 A;  2Q6L A;  3NE5 B;  4IUT A;  5JEA G;  4HIM A;  4HAE A;  5C0X H;  2E8G A;  2Q6I A;  4QUZ A;  2EJM A;  2J7K A;  2QIL A;  1H9K A;  1AE2 A;  4RKB A;  1CFM A;  5IY0 A;  1R5N A;  3J7A V;  1ESF A;  2VW9 A;  2JA6 H;  1XMO Q;  2KED A;  1E63 A;  4K6D A;  2XZO A;  4IPC A;  1U4M A;  1J5E Q;  4LNQ A;  2XZL A;  3SVM A;  4DV5 L;  2QDX A;  1FVI A;  3FP9 A;  1GVH A;  1DJR D;  1NB0 A;  5GQO A;  4ACB A;  1SMY D;  4N3G A;  2HCC A;  2IX0 A;  1HZB A;  1XWE A;  2KQ3 A;  3CXC B;  1WTR A;  1I4P A;  5EAY A;  4R8I A;  4JI6 Q;  4A93 G;  2DIE A;  4IN3 A;  3VA5 A;  1SDF A;  4AIM A;  4N9T A;  1Q81 D;  4WFN 3;  5FOB B;  3F1Z A;  2VXW A;  1HZ9 A;  1L1O C;  4MTK A;  1H9S B;  1Z7T A;  3FPK A;  2JEB I;  4GKK L;  2K50 A;  4YAF A;  2JYO A;  4TMW A;  2F4I A;  3TME A;  2VBU A;  1I6H B;  3CP8 A;  1FNU A;  4M1K A;  1B2R A;  4H44 C;  3HOZ G;  3VYT A;  4KMU C;  1BBU A;  3A1P A;  4RPD A;  5BSX A;  1E2Z A;  5IGB A;  5JAV A;  1PH2 A;  5FJ8 H;  2VBT A;  2ZJQ A;  1WYD A;  5M5W H;  5I2Y A;  4CBV A;  2SNS A;  4WJW A;  3PIO A;  2WJY A;  1WTH D;  2TMP A;  3GVK A;  4BY1 H;  5CYU A;  3Q24 A;  3TEH B;  1H9R A;  1W6K A;  4MZ9 A;  1EWH A;  4QUF A;  4RM0 A;  3TN2 A;  1BCP B;  5THX A;  2K5D A;  3HKZ E;  1IBM Q;  4FF2 A;  5IK2 A;  5IGC A;  2NN6 I;  2VS1 A;  3BNW A;  3DEO A;  4LJZ C;  1VQ6 A;  1NNX A;  1KL9 A;  1FX0 A;  1I6V C;  1AZP A;  5FKA C;  2JA6 B;  4B3M Q;  2QMU A;  2MPM A;  1YNX A;  2RSO A;  4OL7 A;  5D14 A;  1KMH A;  2L9H A;  1L0W A;  1Q7Y D;  1JOO A;  3PUY A;  3EBE A;  4DR6 L;  3WNB A;  1UD8 A;  5K5P A;  3A56 A;  2BSA A;  1RKN A;  1LT5 D;  2OK7 A;  4PMC A;  2VQE Q;  3GD7 A;  1V5V A;  1WCM B;  4BS9 A;  1EFU A;  1RJT A;  2C5H A;  2YTX A;  2VZL A;  4YWK A;  2KHJ A;  3IAY A;  4A3G G;  1IBL Q;  2BPO A;  5LMZ A;  4RAU C;  1QUE A;  2B2Y C;  1EWY A;  3ASP A;  2XTI A;  1BF4 A;  1YNN C;  1SLJ A;  4YXW A;  5LMN W;  1ILQ A;  3LVB A;  3VR3 A;  1Q81 C;  5FL7 A;  4YY3 L;  2EYM A;  3AVX A;  1S3O A;  5FO0 A;  5F2D A;  1VQ5 A;  2E75 C;  2WAQ G;  4WRD A;  4ZUJ A;  4RD2 A;  5IYB H;  3DEP A;  4L5Q A;  4YCU A;  4G1V A;  1KK0 A;  2RC6 A;  2F0N A;  1SMY C;  4B3R L;  3PF4 A;  2MUY A;  3CCR B;  4BY1 B;  2K75 A;  1AH9 A;  5EQ0 A;  1B2T A;  2Z6K C;  2DNC A;  1DZ1 A;  4X7F A;  3Q6R A;  1X65 A;  1FL0 A;  2A6E D;  4RCZ A;  3OEH A; 
#chains in the Genus database with same CATH homology
 5G3L F;  1GUT A;  1VF5 C;  3H91 A;  5KEE A;  2OEO A;  2RDG A;  4P2C B;  1O78 A;  3S9W A;  2SDF A;  1JOR A;  4ZQ3 A;  4HCE A;  3OHX C;  5D65 A;  1RHP A;  1Y1W B;  1H8E A;  2PZT A;  3ZYY X;  1K8O A;  2K6A A;  5J39 A;  3LWU A;  1HQM C;  1PFN A;  1ENC A;  2B63 B;  1HA6 A;  3MA2 B;  3G7L A;  4C56 C;  1MI2 A;  4QCL A;  2F0V A;  3DUZ A;  1DXM A;  2JP1 A;  1PFM A;  4NMZ A;  3HG9 A;  2VJJ A;  1R4P B;  3R3O A;  2FJ2 A;  1QE6 A;  3Q23 A;  4CJ1 B;  1A3V A;  1EIG A;  2W6I A;  4K8J A;  1EQV A;  2RVL A;  2K28 A;  5A35 A;  2WSS A;  3C46 A;  4FO2 A;  2EY2 A;  2JA8 B;  1LLR D;  2SNM A;  1X3Q A;  1CA6 A;  2ZXI A;  4RFB A;  3WDN A;  2F1M A;  1NR2 A;  2A6H D;  2F0M A;  1F9S A;  2I46 A;  2KHS A;  3BVM A;  1PRT B;  1LTB D;  2NTS A;  1C4Q A;  2XWJ B;  5FLX E;  2BA1 A;  3VA7 A;  2KOL A;  4HED A;  1Y8P B;  2PPB C;  3NPP A;  3MXN A;  1IW7 C;  2LZJ A;  3BZD B;  2HUG A;  2KEC A;  1E0B A;  1COW A;  4ILW A;  3Q0A A;  3N52 A;  1VLY A;  3D4D A;  4K2L A;  4CHT B;  1RD9 D;  4ZLT F;  3ITP A;  5CBE E;  2DY8 A;  1GOZ A;  5C5L A;  2IL8 A;  2BA0 A;  2K01 A;  3H94 A;  2JDI A;  2C9O A;  4OO1 G;  1II3 A;  3VYR A;  4C3H B;  1WP6 A;  2ZZF A;  4I65 A;  1UD6 A;  2LFN A;  1T5X D;  2DY7 A;  2F0E A;  4ID6 A;  1O7Y A;  4DK0 A;  5DAU A;  3HS0 C;  4IFD G;  5JOB A;  1W6J A;  1VDZ A;  1H8H A;  3M4Y A;  4A3B B;  1DOM A;  4QIW B;  1I3Q B;  2O5J C;  1MD2 D;  1STN A;  1ENA A;  1SYG A;  5IOD A;  2NVY B;  4E0F A;  4MIU A;  1TS3 A;  3D31 A;  1FD7 D;  1JE4 A;  4X3U A;  1PRT D;  4XTC S;  3EFX D;  3RLF A;  2JA5 B;  2XND A;  2V31 A;  3CU7 A;  2IPK D;  5T1G A;  5E1F A;  4KHV A;  5CV9 A;  1KDC A;  2R92 B;  1MSH A;  5C0X I;  3EJI A;  4FNF A;  1PLF A;  4BA1 I;  1F77 A;  4I7Z C;  4XON A;  2F0I A;  4AVZ A;  4EVO A;  4XDX A;  1S5F D;  5M9O A;  3L7Z C;  2LMC B;  2YU9 B;  3RMH A;  1G29 1;  2X6G A;  1E1Q A;  1PFB A;  1PDQ A;  2M9V A;  4FF3 A;  1TWH B;  2GK7 A;  4L6T B;  5IGF A;  1EEI D;  4DAP A;  2OXP A;  1AN8 A;  1FNV A;  2PNR C;  1ZYR C;  3R93 A;  4OO1 H;  3GV6 A;  5C3X A;  1HTP A;  3H0G B;  5CV6 A;  2EYO A;  1YNJ C;  1B53 A;  4RA8 A;  1TS4 A;  2CW0 D;  3VYS A;  2PMZ B;  2QKI C;  4PMB A;  2X8K A;  1D1I A;  3BVG A;  4G7W A;  1SNP A;  2F03 A;  2Q8I B;  5FLX L;  1IKL A;  5D3D A;  1IYV A;  5I4D A;  3NTI A;  3ZPN A;  2ZXH A;  2KA7 A;  2J7Z A;  4HCS A;  1Q12 A;  3AU7 A;  3FKI B;  1UD3 A;  4M1U B;  4CKE A;  2E2J B;  3FVQ A;  1SYE A;  2F0H A;  3OPO A;  4XLA A;  2ZXO A;  4RHS A;  1GHK A;  3CHB D;  1LTG D;  4CKC A;  1E2V A;  3HGB A;  2Z8L A;  1BLI A;  2WZP P;  5CV4 A;  4HMJ A;  4EQO A;  2AWN A;  5C3W A;  2D3L A;  2RDF A;  3RZO B;  2L4N A;  3NP8 A;  4DXG A;  4NKL A;  1G91 A;  5BN3 A;  2Y0S B;  1WTO A;  4KD4 A;  2NN6 H;  3R8B A;  3ERO A;  3IKJ A;  1GUS A;  3CQZ B;  3MXU A;  4KJO A;  1LT6 D;  3MAQ A;  2IX3 A;  3DWQ A;  1EY6 A;  2QDB A;  2ZZQ A;  3QJY A;  2X53 S;  1LAC A;  4KY7 A;  4DK1 A;  1UEA B;  3MZ5 A;  2IT1 A;  1F2Y A;  4QMG A;  2HLD A;  1SE2 A;  3MC0 B;  1SE3 A;  5EKL A;  3NBI A;  2EE1 A;  1LV9 A;  3I4N B;  4IAL A;  4G57 A;  3E5S A;  4C3I G;  1GHJ A;  2NYZ D;  3GTJ B;  3QWN A;  1WPC A;  2F0W A;  3M85 A;  1EEF D;  1CA5 A;  5M3M B;  2Q8T A;  1J8I A;  2EYJ A;  3BYT B;  4EQP A;  3QO2 A;  3J80 L;  4IQZ A;  1PYW D;  4A3M B;  2ICE C;  5KYL A;  1ENF A;  1W0K A;  5EPK A;  1KNE A;  1IL8 A;  1TWG B;  4F8M A;  1AW7 A;  4C1N I;  1Z6H A;  2F0D A;  1STA A;  2CQA A;  5LHY 1;  1HHV A;  2D62 A;  3VR4 A;  2L12 A;  1WD0 A;  3KUP A;  4B08 A;  1AZQ A;  4FF4 A;  3A35 A;  1C8C A;  1BCP C;  2EJF C;  2MGS A;  1KDB A;  2XZP A;  1OHH A;  5K36 H;  1V0F A;  2GJR A;  1MAB A;  3A8K E;  4RGM A;  5FK9 C;  4XMY A;  2JSO A;  1K28 D;  1AEX A;  1LTA D;  1SFO B;  1TKW B;  3VR2 A;  3I4M B;  2E74 C;  3BG3 A;  1BPL A;  4XOR A;  3BCD A;  3H09 A;  4CJ2 C;  2PW7 A;  1EY7 A;  1EOT A;  1G2T A;  4XQN A;  3WQZ A;  1JC7 A;  1IW7 D;  4U67 3;  1G2S A;  3SHL A;  1WTV A;  5EKI A;  1DOL A;  2R9V A;  2M2L A;  3QB3 A;  3VR5 A;  2J4X A;  1BCP F;  4II2 A;  1ICW A;  1BR9 A;  1ZYR D;  2JE6 I;  2F0G A;  3OW7 A;  3AB9 A;  3TP8 A;  2I07 B;  5ELE A;  5J22 A;  4N9P A;  2D9U A;  1JCK B;  4KJN A;  1HVX A;  4R8N A;  4RGO S;  1S5C D;  5KNC A;  5C6A A;  4XLH A;  2NVQ B;  3CP2 A;  5LL6 X;  2XNA C;  1Q8I A;  2XSC A;  3JAM E;  2BOS A;  3EQL C;  2L11 A;  1H9J A;  1VMP A;  4BBR B;  3U9S A;  1XXG A;  3K5O A;  4H0L C;  4FXK C;  2B2W C;  2JEA I;  3MFG A;  4K6L A;  1ZEQ X;  1AP0 A;  5CC4 A;  2X69 A;  4CKB A;  4AYB B;  1JQY D;  3NK9 A;  1WTW A;  3K5M A;  4XLE A;  4IUR A;  1M8A A;  3NUC A;  2KCC A;  1PTO C;  1WD1 A;  3VR6 A;  3NQT A;  3W2D A;  4CGY B;  1I4G A;  2F0Q A;  4TRD A;  1HPC A;  4V0B A;  3G6J B;  4F7X A;  4E6I A;  2RSN A;  4DXF A;  3S2D B;  3PIO 3;  1SYB A;  2NVT B;  4UZU A;  1HTL D;  2XIW A;  1A15 A;  1BQQ T;  4LK1 C;  3PV0 A;  4IUP A;  1CM9 A;  1D2B A;  1HFN A;  1SYC A;  1G6Z A;  1JWU D;  4A3J B;  1B44 D;  2PW5 A;  4X3K A;  2NZ1 D;  2FFK B;  3J81 L;  1K83 B;  1NR4 A;  2OF1 A;  3GP7 A;  3NHH A;  2JJ1 A;  2L1B A;  1LO5 D;  2E2I B;  3IL8 A;  1VJS A;  1EZ6 A;  1O80 A;  1FNW A;  1ROD A;  3W3A A;  2F0O A;  1QNK A;  4XR6 A;  2J0T D;  5JEA J;  4H7B A;  3IFD A;  1T5E A;  1RF2 D;  2JXM B;  3H3V C;  3M7N A;  4GQN A;  2AUK A;  2B39 A;  4XOT A;  4DNR B;  1JB3 A;  5EBD A;  4NP5 A;  1F2M A;  4A3G B;  4A3K B;  5A2Q L;  3T51 B;  4BBS B;  3A8J E;  3I3C A;  5JVH 3;  3BDC A;  2RQX A;  2ZZG A;  4OHJ A;  3C1E A;  1BMF A;  3C3L A;  1BNZ A;  1GUG A;  3D4W A;  2Q8R E;  4ZAI A;  3L9A X;  4FXD A;  4XQQ A;  4FYD A;  1O7Z A;  2L0C A;  4Z1M A;  4KKU A;  3SEB A;  2N55 A;  2JJ2 A;  1Q90 A;  1TT2 A;  4A93 B;  1KLG D;  1VF7 A;  5M5W B;  3DWA A;  1PKV A;  4O42 A;  1STY A;  2RBM A;  1NAP A;  3GO5 A;  3P75 A;  2ICI A;  1WVL A;  4XT1 B;  4S3S A;  3WOF A;  2VNU D;  1C48 A;  2XN9 C;  1WTP A;  4XN3 A;  2WB1 B;  1NRK A;  3GTL B;  2NBF A;  3QOJ A;  4XYQ A;  2F3W A;  3T13 A;  2KCN A;  4QUC A;  5JVG 3;  1V43 A;  1MGS A;  4YEJ A;  1QG7 A;  1DYQ A;  3S17 B;  3A7A B;  1HZE A;  5FO9 B;  3D8G A;  2ZXP A;  5CMD A;  3PUV A;  1RDP D;  2DN8 A;  3HEJ A;  1Z47 A;  1QJO A;  5KNB A;  1BCP D;  3Q22 A;  4K14 A;  1Y1V B;  1EY9 A;  2WIN B;  1SKY B;  1CK1 A;  1B9N A;  1RCV D;  3S1R B;  4DA2 A;  5A2Q E;  2M5S A;  1YNN D;  2AUJ D;  4R9W A;  1E3X A;  3HOZ B;  1HUN A;  3GTO B;  1F2L A;  2F0K A;  5G3L D;  5EBC A;  3R2T A;  4L8J A;  2G9D A;  1PMR A;  4LAA A;  1ILP A;  2BDN A;  4EQN A;  3BCF A;  1BDO A;  1PTO F;  1GUO A;  2PYK A;  2NTT A;  2B8G A;  5M5X B;  3OE7 A;  2TSS A;  1UUP A;  3Q6S A;  3FMC A;  2H4O A;  4RH6 A;  4Y7N B;  3GTG B;  4OO1 I;  2RA4 A;  3RD4 A;  2NN6 G;  1UD2 A;  5IGD A;  3BVZ A;  3OWE B;  4O1N A;  3X3N A;  4DAY A;  1LTI D;  1U4P A;  1CI3 M;  1D5X C;  3S1Q B;  4C3H G;  5ELF A;  2VB3 X;  1JIC A;  2O4X A;  1UD5 A;  4TSS A;  2A68 C;  2Z4I A;  3MFY A;  1OXV A;  1QB5 D;  4KN7 C;  1IKM A;  1HFG A;  4XD7 A;  3CRL C;  3A7L A;  1F9R A;  4JMQ A;  4XYO A;  3E6Z X;  1I4H A;  4A3F B;  4NW2 A;  2WPD A;  3QOL A;  5C4Z A;  4A3I B;  4UDU C;  2IW3 A;  5C4J B;  3X3M A;  4UAI A;  1CTM A;  1SBB B;  3S16 B;  2OT2 A;  2ZXR A;  1PZJ D;  5J1Z A;  3BH4 A;  2EYP A;  2ZTG A;  2EYL A;  3J7Y W;  4IZ8 A;  1CHP D;  3QIA A;  4BY7 B;  2GK6 A;  5HUR A;  2EDG A;  1XYI A;  3GTQ B;  2K05 A;  4KD3 A;  4C2M B;  1A6X A;  2K5W A;  1V1O A;  3I8Z A;  3JAM L;  1HCZ A;  1CQV A;  2YYZ A;  3NWT A;  1OXX K;  1KAB A;  2R6G A;  2CW0 C;  2FMM A;  4EGV A;  5CR3 A;  3K7A B;  3T56 B;  4KKT A;  4K8I A;  3FKS A;  4DNT B;  3GTP B;  4DU9 A;  5KRU A;  4CJ0 B;  3MEH A;  1PTO H;  4XKV A;  2K04 A;  4FF1 A;  1JWS D;  2HDM A;  1MSG A;  5T1I A;  4XLC A;  3NTH A;  1SNQ A;  1V1P A;  4KY6 A;  1I8D A;  3N6R A;  2AQ3 B;  1DD2 A;  4L63 B;  2EJG C;  4GZY C;  1DM0 B;  4G7Z C;  2IJ0 A;  3TBI B;  3RZD B;  4BA2 I;  3K58 A;  2B2T C;  3PUW A;  1SSO A;  2IX1 A;  2W6J A;  1ONL A;  5KYI A;  1HA5 A;  1X32 A;  4J8Q A;  1TWA B;  2HDL A;  4KTA A;  1O7L A;  3S1M B;  4ULL A;  3J81 E;  4ZK9 B;  4ZUI A;  2BE5 C;  1V0E A;  1L0Y B;  4XOP A;  5IIF A;  1Q3L A;  1DCZ A;  1PRT C;  3L3O C;  5COY A;  1SJH D;  3CKI B;  1OXU A;  1TR5 A;  2SEB D;  4FP5 D;  1V1P B;  1QCB D;  1Q1B A;  4U68 A;  2QEJ C;  4G7H C;  4C3J G;  5JJZ A;  2FMC A;  1ESR A;  4G6I A;  1ZKO A;  3KK7 A;  2V7Q A;  3HP3 A;  1F9Q A;  3NSW A;  2G9H D;  1U9R A;  1HXY D;  1K8M A;  1JOQ A;  3HOY B;  3I4L A;  1V8Q A;  2B2V C;  3ND8 A;  3ND9 A;  2PZU A;  3SK4 A;  5LL6 S;  1M4V A;  3A54 A;  1KDA A;  2BCO A;  5KGU A;  2NUC A;  2WKC A;  4ZKC B;  5JPM C;  1HQR D;  3C2P A;  5FO7 B;  5M5Y B;  1D5M C;  1EY4 A;  2LY7 A;  2D2C C;  5I9P A;  3MTS A;  3T16 A;  3NTK A;  5KNL A;  1TU2 B;  2K7V A;  4RWS C;  2FHT A;  2MHV A;  4LMQ D;  1WTQ A;  2CHB D;  3O13 A;  2H1E A;  3S14 B;  5KND A;  3BYY B;  5C4H A;  3KLS A;  3SK6 A;  2EZV A;  4IFD H;  4PQX A;  1EY5 A;  3KLR A;  2B2W A;  4II3 A;  2WJV A;  2B2Y A;  1SND A;  4IUV A;  2Z6B D;  1CQF A;  5KIX A;  1JOK A;  3SE0 A;  2O5I C;  5EPJ A;  2A73 B;  5DN6 A;  3A55 A;  2GA4 B;  1LT3 D;  5HGT A;  2N88 A;  3HAG A;  4XQF A;  1E2W A;  4MHE A;  5AFW A;  5I9O A;  1GXD C;  3JU4 A;  2R93 B;  1FGB D;  4XN0 A;  3P20 A;  2QCP X;  3CRK C;  2Z4H A;  1W0J A;  2WAQ B;  3S2H B;  2A74 C;  3V2T A;  4XXE A;  1TII D;  4XQJ A;  2RKS A;  4QF4 A;  3P1H A;  2IWH A;  3NBH A;  3HOX B;  1I4Q A;  1BUV T;  2PO4 A;  5DM6 3;  4Q5V A;  3C1F A;  3DXJ C;  4HMI A;  1S5B D;  1QNU A;  2XRS D;  1TVX A;  2B2T A;  1SNM A;  4XM3 A;  2HQE A;  3SK8 A;  1BXT A;  1NCV A;  3A8I E;  3OOC A;  2B8F A;  3E0J A;  3I73 A;  4KN4 C;  3P7J A;  2RDH A;  4DAV A;  4JK1 C;  3GTK B;  1Y8N B;  5IT9 E;  2AQ1 B;  4XKW A;  1JWM D;  4MN3 A;  2ZTN A;  2EY1 A;  3RUZ A;  1HRJ A;  4IUN A;  3DWP A;  2F0S A;  1SXT A;  1GUN A;  1XTC D;  1ET9 A;  3SK5 A;  4A3E B;  2X6W A;  1CT1 D;  2CVR A;  3GQB A;  1HUM A;  5BN4 A;  3QG1 A;  3OWF A;  3J7A F;  3GV3 A;  4HSP A;  2K32 A;  3EVQ A;  1SE4 A;  3S15 B;  3OFN A;  3OMC A;  1G8Z D;  1W9X A;  2MJ8 A;  5CGK A;  4K5X A;  4ZKB B;  1D6E C;  3EA6 A;  1SYF A;  1NUC A;  2EY5 A;  1NBM A;  1I4R A;  4RGN A;  2WP8 J;  3OIQ A;  4KKS A;  2D5D A;  4K5W A;  1UNS A;  2F0L A;  1JR0 D;  4RGT A;  3CES A;  2EOT A;  3SDZ A;  1VCI A;  5FO8 B;  4C3I B;  2O2L D;  2AWO A;  3DMU A;  3WOE A;  3D6C A;  2K1B A;  3MXP A;  2E2H B;  1EU3 A;  2XRQ D;  1IYU A;  2V4D A;  3I91 A;  1I50 B;  2VB2 X;  4RCO A;  3V96 A;  2ID0 A;  4PV1 C;  4IUU A;  2QF7 A;  3FPU B;  2WKD A;  4DGZ A;  5NUC A;  2VJI A;  3ZIA A;  1SJE D;  3UI2 A;  2A6E C;  3M7G A;  1STH A;  3DHQ A;  1OXT A;  3DM1 A;  3T4A C;  1LAB A;  1TY0 A;  4B3G A;  3T53 B;  3VYU A;  5DM7 3;  1EY0 A;  2XOK A;  5JPN C;  4B3F X;  3MVV A;  3TP5 A;  4F88 A;  5IOC A;  1B4O A;  4DFA A;  1AFP A;  5I6W A;  4KK7 A;  1EFR A;  2X6X A;  1MBY A;  1SNO A;  1LTS D;  3LX0 A;  1STB A;  3TZU A;  5CV7 A;  3K57 A;  3TSS A;  2B2U A;  2ENB A;  2LKV A;  4IFD I;  3OIP A;  3ONA B;  1A2U A;  4G4K A;  2R61 A;  3GVL A;  1TWC B;  2KVM A;  4F87 A;  3IFT A;  1I4X A;  3PMF A;  4RHR A;  1PTO D;  3KBG A;  4X3T A;  4ODG A;  2DNE A;  4V19 0;  1F2Z A;  3AMU A;  2F0U A;  4IFD J;  4DN4 M;  5C44 B;  4HR7 B;  1SAP A;  1RTO A;  1B50 A;  4X3S A;  4C1N K;  2NVX B;  1EIH A;  1S4Z A;  1CZG A;  4XL9 A;  1D5Z C;  4HN7 A;  1R9T B;  2R7Z B;  1XX8 A;  1EYC A;  4K2K A;  5M3F B;  2C5C A;  1S5E D;  2M00 A;  2NWG A;  3URY A;  4ASU A;  2MP1 A;  1OO9 B;  1Y8O B;  1SEB D;  4TT3 A;  3A3B A;  3HOV B;  4YIJ A;  3M4O B;  1E43 A;  5EPL A;  3NWS A;  5C0X J;  4FVM A;  1PZI D;  3I72 A;  1B3A A;  3HKZ B;  1A3U A;  1L0X B;  4P22 A;  1D1K A;  5DNF A;  4J1M A;  5E3F A;  3GVJ A;  1SNC A;  5TSS A;  1LTR D;  1A3T A;  3FDT A;  1STG A;  3I90 A;  3OMG A;  3FPP A;  1A2T A;  1UAP A;  4IUQ A;  1BBX C;  3MHB A;  5E4W C;  3TP6 A;  1RTN A;  1KNA A;  4M8A A;  5EKK A;  4Z9C B;  5CDF A;  1B9M A;  3K6O A;  3MXG A;  4B9X A;  1EY8 A;  2B2V A;  1WTX A;  5IGE A;  3H6M A;  4BWG B;  2A69 C;  4WOR A;  4YEL A;  1VMC A;  4ABN A;  5ELB A;  5C0X G;  2D3N A;  1DOK A;  2AQ2 B;  1E1R A;  1QIL A;  2X6Y A;  3TZD A;  1OB0 A;  3HOW B;  2E1B A;  3BDO A;  2ZZE A;  3HZX A;  2HCI A;  2F3V A;  1YNJ D;  3D4R A;  1SYD A;  2ZT9 C;  5C5M A;  2LS0 1;  3K59 A;  1KZL A;  1B1Z A;  1NSN S;  1I18 A;  1EYD A;  1R4Q B;  2SOB A;  3MWY W;  2F0J A;  4ZRZ A;  3OEE A;  2VUM B;  1PXU A;  4XT3 B;  4XLF A;  1BOS A;  2KJX A;  3G05 A;  4Q0F A;  5D3I B;  2WII B;  1PRT F;  3J80 E;  2EY6 A;  3KLS X;  4TQU S;  1STE A;  2JIZ A;  3GTM B;  3TDQ A;  1GUW A;  5COR A;  2L5T A;  4QB4 A;  4ME5 A;  3DDY A;  3K5N A;  5ISR A;  4J6H A;  4HTH A;  5C4X B;  3PO3 B;  3FEW X;  2PCF B;  2PQE A;  5EGT A;  3K0Y A;  2EYF A;  3KF8 A;  3PO2 B;  1QOH A;  4TKO B;  1TS2 A;  2E76 C;  2XVS A;  5EJW A;  5E4X A;  1FYC A;  3BS1 A;  1EZ8 A;  2X6L A;  3R2I A;  2A5H A;  4KHZ A;  2EYH A;  3D3R A;  4RCN A;  2CK3 A;  2KVO A;  1LTT D;  5CV5 A;  2E2D C;  1H9S A;  4C3J B;  1EYA A;  4HIZ A;  1IHZ A;  1ML0 D;  3KBX A;  4A3D B;  2F0T A;  5ELD A;  3CMM A;  3K5L A;  1BO0 A;  4KV6 A;  4B9W A;  1E3Z A;  2GJP A;  1TY2 A;  3PUZ A;  3LWE A;  2EXZ A;  3BC9 A;  4FXG C;  3NXW A;  4G7X A;  5IT9 L;  5BN5 A;  1PZK D;  1EWC A;  2KEE A;  3TP7 A;  3I70 A;  4OGQ C;  3HRZ C;  1Y69 U;  1KTK A;  1X3P A;  2F0F A;  2KUM A;  1KAA A;  2B2U C;  4K5V A;  3BDL A;  1DON A;  4RKL A;  4XNF A;  5HKK A;  2A68 D;  1UD4 A;  2K5Q A;  3A3G A;  2A69 D;  1EU4 A;  4KY5 A;  2NB0 A;  4HSV A;  1PTO B;  3U9O A;  2PZW A;  1E79 A;  4H13 C;  2GJK A;  4PNY A;  1QWY A;  1CZW A;  2QE7 A;  2BE5 D;  3V05 A;  4XIG S;  3SXH A;  2EPB A;  1J9O A;  5CBA E;  1KLU D;  4FXU A;  4TSF A;  3M3Y B;  4NDX A;  3KEW A;  2L55 A;  5IGG A;  2FIN B;  3NQI A;  3PUX A;  3FRP B;  4G7O C;  4NNJ A;  1Q1E A;  1H9M A;  1EQT A;  3LNN A;  5I2X A;  1U4L A;  1F9P A;  1U4R A;  2F43 A;  1GJX A;  2A6H C;  2F0P A;  1TWF B;  2JA7 B;  3OAA A;  4OIK A;  3S1N B;  4KI0 A;  1ZXT A;  5I6Y A;  2XWB B;  5C3E B;  2BDO A;  2Z1C A;  3HOU B;  1OXS C;  2XGJ A;  4ZYS A;  1S5D D;  2WV6 D;  4OIJ A;  4PMW A;  5ELC A;  1TQO A;  1ET6 A;  2WAC A;  2X85 A;  3F2U A;  4DF7 A;  5CV8 A;  3PIP 3;  2R3Z A;  1CHQ D;  1EFI D;  2K33 A;  5JEA H;  2EVB A;  1TS5 A;  5DEH A;  3SR1 A;  3D6W A;  1FR3 A;  5K36 G;  1LT4 D;  4JBW A;  3OSO A;  3ERQ A;  2K03 A;  1EL0 A;  3NE5 B;  4IUT A;  5JEA G;  4HAE A;  5C0X H;  2EJM A;  2QIL A;  1H9K A;  4RKB A;  1CFM A;  3J7A V;  1ESF A;  2KED A;  4K6D A;  2XZO A;  1U4M A;  2XZL A;  3SVM A;  1DJR D;  1SMY D;  2HCC A;  2IX0 A;  1XWE A;  2KQ3 A;  1WTR A;  1I4P A;  4R8I A;  2DIE A;  4IN3 A;  3VA5 A;  1SDF A;  4N9T A;  4WFN 3;  5FOB B;  2VXW A;  1H9S B;  1Z7T A;  2JEB I;  2JYO A;  2F4I A;  3TME A;  1I6H B;  3CP8 A;  1FNU A;  4H44 C;  3VYT A;  4KMU C;  1E2Z A;  5JAV A;  5IGB A;  5I2Y A;  4CBV A;  2SNS A;  4WJW A;  2WJY A;  1WTH D;  2TMP A;  3GVK A;  5CYU A;  3Q24 A;  1H9R A;  1W6K A;  1EWH A;  4QUF A;  3TN2 A;  1BCP B;  2K5D A;  4FF2 A;  5IK2 A;  5IGC A;  2NN6 I;  3DEO A;  4LJZ C;  1FX0 A;  1I6V C;  1AZP A;  5FKA C;  2JA6 B;  2MPM A;  2RSO A;  4OL7 A;  5D14 A;  1KMH A;  2L9H A;  1JOO A;  3PUY A;  1UD8 A;  5K5P A;  3A56 A;  1RKN A;  1LT5 D;  4PMC A;  3GD7 A;  1WCM B;  4BS9 A;  1RJT A;  3IAY A;  4RAU C;  2B2Y C;  1BF4 A;  1YNN C;  4YXW A;  1ILQ A;  3VR3 A;  5FL7 A;  2EYM A;  5F2D A;  2E75 C;  4WRD A;  4ZUJ A;  3DEP A;  2F0N A;  1SMY C;  2MUY A;  4BY1 B;  5EQ0 A;  1B2T A;  2DNC A;  1DZ1 A;  2A6E D;  3OEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...