3OW7A

Crystal structure of the membrane fusion protein cusb from escherichia coli.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
296
structure length
296
Chain Sequence
b'QNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusB
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 32
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ow7A02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ow7A03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3ow7A01
2A6EC 2L5TA 4JBWA 1K8MA 2Q8IB 1IYUA 2O5IC 1V8QA 3AB9A 1B9NA 2BDOA 3HGBA 1VCIA 3A7AB 1PMRA 1Z7TA 5JEAG 4G7ZC 4KKTA 3T51B 1HCZA 3VA7A 4JK1C 3M85A 1O78A 2IT1A 2EDGA 5K36G 4TKOB 4IFDH 3ND8A 4RCNA 3NE5B 3LWUA 5C0XH 4DNRB 3FMCA 4OO1H 2K32A 3CRKC 3LNNA 1B9MA 1VDZA 2KCCA 3N6RA 5BN3A 1IW7C 3PUXA 4DK1A 3D4RA 1HQMC 1V43A 1YNJC 2JE6I 4XIGS 5JEAH 2BE5C 2R6GA 4OGQC 4KKUA 2DNCA 1Q12A 1IYVA 2E76C 3OW7A 2E74C 4KHZA 3MFYA 1HPCA 3P20A 1GHJA 2F1MA 1LACA 2A69C 3D31A 3IFTA 3QG1A 4KI0A 4PV1C 2KA7A 1VF5C 4G7HC 2PPBC 2A68C 4L8JA 4HR7B 1A6XA 3MXUA 1EWHA 4H13C 1OXUA 3EQLC 4BA2I 2JEBI 1GJXA 1GUOA 2D62A 4IQZA 3W3AA 3VR5A 2A6HC 1Y8OB 4BA1I 3IKJA 2LMCB 3PUWA 2D2CC 3ND9A 3VR3A 3A8IE 2A6ED 1LABA 4H0LC 2EJMA 1GUSA 1TU2B 3BDOA 1VF7A 4LK1C 1ZKOA 4TQUS 3I4LA 2K33A 4I7ZC 2PCFB 2JEAI 3SE0A 3QIAA 1GUTA 2B8GA 1HTPA 1SMYC 1GHKA 1ZYRC 3PV0A 1BDOA 5KNDA 3PUZA 2BA1A 1GUNA 3DXJC 2QF7A 1O7LA 1YNNC 2NN6G 3OPOA 1Y8NB 2DN8A 3L7ZC 3PUVA 1GUGA 2AWOA 1FR3A 3U9SA 1DXMA 3WDNA 2K7VA 1Q1EA 2D5DA 2E75C 3VR4A 1IW7D 1CFMA 2CW0C 5K36H 3SDZA 1H9RA 1ONLA 1H9SB 2BE5D 3A8JE 4H44C 3I72A 2B8FA 2V4DA 4DK0A 2O5JC 3M4YA 2A69D 5BN4A 4IFDG 2AUJD 1Z6HA 5KNCA 1H9KA 4XTCS 5KNBA 2A68D 4OO1G 1DD2A 3FPPA 1Q90A 3GD7A 3PUYA 3BG3A 1OXSC 2PNRC 2JXMB 1E2VA 1Y69U 1G291 1E2ZA 1Y8PB 1I6VC 3TZUA 1Q1BA 2A6HD 1FYCA 1OXXK 2DNEA 4KMUC 1H9SA 1H9MA 1TKWB 2YYZA 2EJFC 3CRLC 4LJZC 2BA0A 4KN4C 3RLFA 3VR6A 1OXTA 2EJGC 1H9JA 2NN6I 2ZT9C 3T53B 3GQBA 4GZYC 2AUKA 1CI3M 3M7NA 3T56B 3A7LA 4DNTB 3KLRA 5A35A 3A8KE 2EVBA 4G7OC 4KN7C 1E2WA 1OXVA 1QJOA 3OOCA 5BN5A 3I73A 4KKSA 3H94A 1CTMA 1K8OA 5C0XG 2NN6H 1T5EA 3QJYA 3VR2A 1DCZA
chains in the Genus database with same CATH superfamily
3BZDB 5F4OA 2I5MX 4A3LH 3QO2A 3MTSA 4XT1B 3KUPA 4P74A 5KNLA 2F4NA 1PH3A 1YNXA 2WINB 4LF9Q 1UMKA 1CSPA 1IYJB 2IT1A 3U6KA 1SFOB 1XWEA 1KTKA 2OBSA 3TSSA 5M3MH 2LSSA 5GV8A 1W35A 4XLCA 2B2TC 4MYTA 1AEXA 2BV3A 2L0CA 1QFJA 5H5JA 3CF5A 1N36Q 1I94Q 5M5XB 4ABNA 4A76A 3KBGA 5LHY1 2VUMH 2QGQA 4XR6A 1F9SA 1GXDC 1VQCA 3PO3B 4YAUA 3D31A 3T1YQ 1ZM9A 3ZC3A 3P27A 4JI8L 4V0BA 2BDNA 4H02A 4XYQA 3G05A 2XRQD 5EKKA 1EWCA 1XMQL 1QZGA 3U4VA 3S1MH 4HJ8A 3J81E 4IQZA 4LBVA 1EEID 2XWJB 4JVZA 2E2DC 3TZDA 3QFSA 4BY1B 4DV5L 4OPSA 1S40A 4X7EA 3OAAA 2PYKA 3ERSX 1BJKA 1KZLA 2N55A 1EZ6A 1W3SA 1HZ9A 2F0QA 1FNBA 2CWAA 3MVVA 1VQPB 3MFGA 3B78A 4KTAA 3HOUG 2R7FA 1J9ZA 3W2DA 2JA6G 2CNDA 2VNUD 2BOSA 2LY7A 2Q6KA 2R92G 1KRSA 3ZBUA 4PC3A 3PUVA 1MIUA 2YU9B 2FVGA 1IJFA 5C3XA 1PFSA 1WSVA 3VYTA 2NYZD 3HOVB 5BN4A 5I9OA 2A1AA 3HRZC 1YHBA 2VBSA 5FO7B 1Y14B 2FFKB 2B2UA 3MMPA 2JXMB 3F2CA 3RLNA 1RIPA 4QGUA 3A74A 4WFN3 2Q8RE 4IALA 4XM3A 2HUGA 4A3BB 4DUYL 2BA0A 2XOKA 1CKNA 5J22A 4DAYA 2UXDQ 4PABA 3GQBA 4LF6L 1RQPA 1R4PB 4GN3B 1G91A 4LBWA 1QB5D 3NQIA 3CMAA 1ELOA 2RCFA 1SROA 5JAVA 3CC7A 4Z4ZA 4A3FH 2F03A 1ET9A 1R9TB 2CFMA 3R2TA 3QOLA 4A3CH 1PH6A 3HKSA 3H94A 1Q81C 3FEWX 4DV1Q 2DETA 2K4KA 1HNXQ 2L5TA 2Q6OA 1NAPA 4ZYSA 1O7YA 1V8QA 4HIMA 1N34L 3I4MH 3KYHC 2MJ8A 3JQRA 3A55A 3V05A 3RLOA 1FNMA 1Q82D 1QUQB 1STBA 4YY3Q 2E2JB 1A3VA 3AVUA 4BY7H 2VBVA 2DY8A 4R4QA 4DV0Q 2X6WA 4K8JA 2ENBA 4J0QA 1YI2B 3FMCA 3RNUA 1AZQA 4N3GA 2BH8A 4NCNA 4R8NA 3C2QA 4XLEA 1I4RA 1C4QA 3WQZA 3N6RA 3M4QA 4RH6A 3CCRB 2CF4A 2CQOA 2CWPA 3OE7A 4MZ9A 1CSQA 4QUFA 1J5EL 1YIJA 2I5HA 2D0OA 1K0RA 1VQNA 1EU3A 1G6ZA 4EX5A 5CV5A 5CV9A 2F1MA 1JT8A 4G7HC 1WTHA 3CESA 1BNZA 3EROA 3BCDA 3UDFA 2B2YA 4C3JG 2QTLA 4DNIA 1T6YA 3EVQA 1BCPC 3VMFA 2KCNA 4ACAA 1EYGA 1EFWA 3IL8A 3A54A 5ELBA 4BA1I 2R93G 3P7JA 1EUJA 4R4CA 5FNZA 1E1QA 1DM0B 1ENCA 2K5DA 5M3FG 5IYQA 1TU2B 3NTKA 3NP8A 1VLYA 5IT9L 3S2HH 1UE7A 1B3AA 1GKHA 5AFWA 4QHYA 1SDFA 2B8GA 4AYBB 1TWCB 1TWHH 2L4NA 5FIUA 3S17H 4RG1A 2N49A 3K7AB 1E7ZA 5EKLA 4DV7Q 1EIHA 5FLXc 2OCEA 3CKIB 1MD2D 2PNHA 1PVOA 3EN2A 1RCVD 2CW0C 5IYBH 2HCJB 3D8GA 1QILA 2LXKA 4RGNA 1I18A 3A5UA 2EYFA 1H9SB 1ILPA 1Y1VG 3CCQA 2NZOA 3PGZA 2MFIA 2O5JC 1CQFA 1H85A 3D4WA 1QG0A 1F2MA 4OELB 4X7DA 5J39A 5IP9H 1DD2A 4DR2L 1KJZA 1N32Q 1OHHA 3CCEA 5M3MB 5IGBA 1NJIC 4Q5VA 1I6VC 4XQJA 4L5QA 4C2MH 5A2QE 1H9MA 1QNKA 5IP7H 2Q8TA 4JI3Q 1I4XA 4A3EG 1VQMA 2VUMB 2TMPA 1JWMD 1CI3M 2MQHA 4KLKA 3DLLA 1HA5A 3HOYG 3C2PA 4DU9A 2DJFC 5M5WH 4YAFA 4B48A 1QJOA 1FNWA 1LM0A 3DDYA 1IHMA 3IRBA 1LTSD 2CK3A 5DM63 4FF2A 3S1MB 3KLWA 4POGA 2HMAA 3JQPA 2UUCQ 5HGTA 1LT5D 3MC0B 4N8X1 3K7UC 3RR5A 2VW9A 4RWSC 1M90D 4GLVB 4K6LA 4LF7L 1N07A 2ZJRA 4FVMA 1D5ZC 5D14A 4RCNA 2B2WC 3B6YA 4P1VA 2V7XA 1JJGA 5DLQE 1IJEA 1XX8A 5CV4A 2V31A 1IBMQ 4A3DB 1LTLA 1YITA 1DOLA 3CD6B 1Q9SA 3M9BA 3KDFB 4Q0FA 4JYAL 3OIPA 1K0SA 1STAA 2R7DA 3NBHB 4UP7A 1JC7A 1KRHA 3CAMA 5FL7A 1SR3A 4IFDJ 3MFYA 1KAWA 3OZVA 5THXA 1GHJA 2A69C 3CCJB 4OX9Q 4BBSG 1VQLB 1BKBA 1X54A 3CMEA 2Q2IA 4B3FX 1XTCD 3H15A 5COYA 1N33Q 4DAMA 4NXNL 3S15B 1EYDA 2Q2HA 1VQ7B 4BBRB 1A3TA 1DG1G 1DARA 2PMDA 2UUAQ 1SMXA 4AQYL 2NZ1D 1LABA 4ID6A 2QEXA 3VO1A 2EY1A 5G3LF 1NBMA 1PRTF 4IUPA 1BBXC 1W0JA 5H59A 1E79A 1GR1A 1BCPB 3BQJA 1WCMH 4DV3L 1B2TA 2C78A 4ME3A 4JOIC 3MZ5A 4ZKBB 1Y1WH 1WTPA 5IYCG 3DXJC 3HOZG 4Y9UA 3K0YA 1A8PA 3NEMA 1RTOA 1SE2A 2E2IB 3E20A 1EWYA 3MEFA 2QDXA 3HAGA 4N8FA 1GAQA 5KGUA 2YWFA 1GUGA 1FR3A 4RMFA 1SYEA 1F2YA 4OOVA 2Q6LA 2VB3X 4HJ7A 1J8IA 3JAML 2EIFA 2Q6IA 4FXGC 1VQ5A 1DDGA 5EKIA 4M4SA 3K8AA 2EYPA 1KC8D 4PMBA 1Y0YA 5KNCA 2ZJPA 5TV2A 5KW9A 2K75A 2E2HH 1SNCA 5JJKA 4BY7B 3BG3A 2PNRC 1C0AA 4G5GA 1PYBA 3ULLA 3FKIG 2GJRA 2AWNA 2A6HD 1E22A 1FYCA 1TKWB 1PKVA 1NMGA 4WJ4A 3K5MA 1NCVA 2JA6B 1PH8A 1QVCA 3ZPNA 1S4ZA 2PO4A 4TMWA 4DGZA 3ZZ0A 5C4ZA 2GVBA 2R92B 1EWIA 1QE6A 3E0EA 2WJVA 2FHTA 5A35A 3J7YW 2VNKA 2B29A 1VS0A 3I1FA 4TSFA 3ZJYC 3Q6RA 2X85A 5DAUA 3AU7A 3J7A5 1E1TA 1A2TA 1VQEA 1EIYB 3E3XA 3I91A 1K3RA 1IYUA 4FF4A 1EFRA 5L46A 3RN5A 1B9NA 2BM0A 2PQEA 1VQJA 2KJXA 5C3EB 1FRNA 4CGYB 2HCIA 1YX2A 3T51B 1HJPA 3CCMB 2B2VA 3HKZE 3NBIA 3M85A 4DUZL 2F0SA 2DCUA 5FO8B 1EY4A 3MHPA 3ND8A 4XLFA 2KEDA 1P8LA 1TWHB 3T4AC 1S5BD 5C0XH 3S17B 4ACBA 3ONAB 4B3ML 1X9NA 3U6BA 2OTJB 2I5LX 1SNMA 4XL9A 3D4RA 3PO3G 2KHSA 1D1NA 1U2RA 2JA5G 3W5HA 4X64L 3GTOB 3MXNA 3V96A 1XJVA 2ZL7A 1Z9FA 1UE5A 1H8EA 1LYLA 1NDHA 4BY1G 1YBYA 1FX0A 1WSRA 3GIRA 4OOXA 4QVAA 4DK3C 5G3LD 4XKWA 3F2UA 1GAWA 1X3PA 4RD2A 1JB3A 1BR9A 4X6AH 1ZKOA 4MIUA 4UAJA 4JI8Q 1YZ6A 1WP6A 2B2UC 5I9PA 1VQBA 3WNBA 1XMQQ 5C4JH 3QIAA 4V190 2ICEC 1K8GA 4A3IH 2HCCA 3S1RB 3OMCA 1R5NA 1K28D 1PHJA 5M9OA 4DV5Q 1YNNC 3PQIA 2HIVA 1BBUA 2VXWA 1PFBA 2Z9HA 2F0TA 3A35A 2A74C 1QFZA 1G8ZD 1FNDA 3J7AF 3KFUA 4KHPL 1GD7A 5HXBA 1YLOA 2Z6BA 3HOVG 1RJTA 1LO5D 2MPMA 4DPGA 4XORA 3VYRA 2EXZA 2KHIA 4XXEA 3BNWA 5A8AA 4DK0A 4OL7A 1VQGA 4F87A 2W6JA 1Q86C 2ES2A 3AGQA 2Q2UA 1KD1C 2R93B 4OWWB 3KBXA 1M4VA 2D0PA 1QCBD 5C44B 2F0KA 2XIWA 3GD7A 1AFPA 1OXSC 3FP9A 1MSHA 4A3BG 3NQTA 2CHBD 5ELFA 1TR5A 4OHJA 1X3EA 3M4OH 2B5OA 4CJ2C 1JQYD 2EJFC 4EQOA 2YTYA 2EJGC 1O7IA 4AYBE 4JBJA 2WR8A 3CMMA 3M7NA 3E6ZX 3W2EA 4DNTB 3GP7A 3V76A 1EXMA 5IGEA 1EYCA 3F1ZA 4WZTA 2GPJA 4KKSA 5ELCA 4DUYQ 1UWVA 4AIMA 1SKQA 1PTOF 5CR3A 4LF6Q 4XKVA 2CW5A 3JU4A 2BDOA 2B2YC 1VCIA 1O7ZA 2XNDA 2F1LA 4K2LA 4WRDA 1AE2A 5J3BA 1STNA 4G7XA 2O2LD 1S3OA 5E7NA 4G1BA 3ONUA 3HP3A 1VQ6A 3JAME 4C0SA 1N34Q 2L55A 3ASPA 4A3EB 1S72A 3K57A 4R1JA 2WB1B 5I4DA 5HGQA 2EIXA 2JE6I 2BF4A 1KK0A 3E9HA 1JWUD 3SK5A 5FJ8G 5JEAH 3G7LA 1LTID 4Z4VA 3D0FA 4KKUA 2WP8J 1SSOA 2MUYA 4QMGA 3LQEA 4XNFA 2A68C 5IT9c 3EFXD 1I4GA 4HR7B 2R3ZA 2HIXA 2RKSA 1J5EQ 1BQEA 1SNQA 5HURA 3W3AA 5C5LA 2B63H 1SYCA 5E4WC 1PJ7A 2XWBB 5FLMH 1HVXA 2ZZFA 3VR3A 4QV2A 1B3QA 1I3QB 4NBSA 1NE3A 4NW2A 4Z4RA 4AYBG 1STYA 2X6XA 4C3IH 1EY8A 4A3KB 1L0WA 1PV4A 4B44A 5LL6S 3I4LA 4NDXA 5A88A 1I8DA 1F2LA 1CHPD 2BGIA 1SMYC 3CPWA 3QSYA 4LC0A 1Q7YD 2UU9L 2OQKA 1SJED 5FO0A 4G4KA 3CP0A 2F0OA 1EY7A 5GAGC 3U9SA 3SK8A 4A3LG 2SOBA 2Z4HA 4BBSB 1S5DD 1D1IA 5AN9A 1YNJD 4J6HA 2ZXPA 2V4DA 4DAYB 2NBFA 3S24A 2IX3A 4ME5A 4YALA 3KOJA 4FN5A 5M3MG 2WYRA 1EY9A 1K73C 3Q39A 3CC7B 4DK6C 2RHSB 1WYDA 4FF1A 1BMFA 4HMJA 1ENAA 2VUMG 2A8VA 1EP3B 2HT1A 4HIOA 3CCUA 5IGFA 2VJJA 3FRPB 2BN4A 1WORA 2ZTDA 2R9VA 1TWAB 4ZUIA 1S5CD 1U4RA 4LF4L 4DR2Q 1UD3A 1EY0A 4C3HB 5EBDA 1WPCA 5TRDA 3GSIA 4KN7C 2E1RA 1PTOD 1KK2A 5CC4A 4H9GA 3TS2A 1K9MD 3J7ZC 3PVDA 4YXWA 1VQAA 2JA7H 5C4XB 1EFCA 1SYFA 4N3NA 3H09A 3GVLA 1JJ2A 5E4XA 4E6IA 4JBMA 4DR4L 1KMHA 1YIJB 1VQNB 2D74A 2DY7A 2NVXH 1PZID 1UUPA 1C9OA 3LWEA 4JK1C 5ELNA 5C4JB 1YHAA 4DV4L 4A3DG 4IFDH 4DXFA 3BZCA 4DAVA 2B7CA 1T6ZA 1HR0W 2NPFA 2WZNA 3HG9A 4Y9RA 4ZKCB 1K83B 3OZUA 1OB0A 4FWTA 2WV6D 3IAYA 1KQSA 4DK1A 4RGTA 4LF7Q 1V43A 2KCTA 3R6KA 2X0KA 3PIO3 2RBMA 5IYNA 3K58A 4H7BA 4HJAA 1KDAA 5K36H 1DDIA 1CM9A 1VF5C 4AF6A 4RJLA 4BBRG 2RSOA 4YAOA 1XQBA 1B7YB 5D3IB 5I2XA 1KIXA 3HOXB 4XYOA 1TS4A 4JYAQ 1CKMA 4HJ9A 3DEOA 1HRJA 3NUCA 1IBLL 4WORA 1GM5A 1K28A 3ND9A 4OONA 2F3IA 2X8KA 3FDTA 3TS0A 5J1ZA 1KDBA 1TS2A 4A93H 3M4OB 2F4IA 1PDQA 2EY5A 4IUTA 4LK1C 2NVYB 2XNAC 2VNJA 1FJGL 3HFZB 3BC9A 1XFOA 3CCQB 1WVLA 4NXNQ 5BR8L 1EZ8A 4FNFA 2EOTA 3G71A 2B7BA 3Q38A 4DR7L 4A3CG 2QKIC 1IKLA 3QFTA 1A15A 3PO2H 4AQYQ 3OP1A 5C0XJ 3G6EA 2JA5B 3I4OA 3GTLB 5A2QL 5CV7A 3J80L 3J81j 2DN8A 1ZM3A 1JNYA 2ZBUA 4UZFA 3CCEB 3WNCA 2E75C 2KECA 3I2ZA 4LW1A 3RUZA 1HZAA 4DV3Q 1IZ6A 2M9VA 2L15A 3A8JE 2JP1A 4KK7A 4H44C 3PF5A 1Q82C 2VNIA 3GV3A 4UZUA 1T5XD 4XDXA 1VQMB 4BY7G 1SNDA 1S5FD 3S2DH 1SBBB 4UAIA 3OWEB 5IODA 4IUUA 1I4HA 1NR2A 3FPUB 1BPLA 4B3TL 4A3GH 1VQ4A 3GTQB 1HNZL 1EP1B 2PE3A 1WFQA 3E1YE 2B2VC 5IYRA 2EYHA 4A3JB 2NVTH 2OK8A 1FNVA 4KD3A 1OXTA 2QA4A 1W9XA 3UI2A 1X3GA 1SE3A 3ONYA 4HE5A 2HDLA 4CJ1B 5I2YA 1ICFB 3A7LA 3LX0A 1VQKA 4X62L 1TWGB 2JK8A 1IL2A 1GO3E 4U673 3WXMA 4G57A 1CTMA 2F0MA 3W1BA 5C3EG 2HHHL 2K05A 3HKZB 1JICA 4DR1L 2B63B 1IXRA 2VY3A 1N08A 4JBWA 2Q8IB 1QGYA 1YITB 4BXXH 4FF3A 4JPBW 4QY7A 4G7ZC 4C3IB 4PZ8A 4EQ5A 3H0GB 3TMEA 4ZUJA 2M5SA 4IFDI 1KDCA 3CMEB 3K59A 3UDIA 3Q24A 1PYWD 3J81i 4TRDA 3BY2A 5IYBG 3V7AA 1EU4A 1U9RA 2SDFA 2H4OA 1RQRA 3A8IA 3CHBD 1YJNA 2F52A 3WYAA 3BDLA 4DUZQ 1HNWL 2QEXB 3QG1A 1K3BC 2XRSD 3F2BA 3AVVA 1JWSD 4OWTB 4B3MQ 1SN8A 3GTKB 1QH0A 3MXUA 5DN6A 1EQTA 2XGTA 3NSWA 3M7GA 2IL8A 4YWKA 1PFMA 1XNRL 3C46A 1H8HA 4DA2A 4X64Q 5ELDA 5IP7G 2PW5A 2VYQA 5HKKA 1RODA 4K8IA 3KLSX 4HMIA 1Q3LA 4L5RC 1WOOA 2F3VA 2JIZA 5T1IA 3N52A 2K52A 2PCFB 2ZTGA 2M00A 2FMCA 4JC0A 3OEEA 1VQ5B 4HSPA 2R7ZH 1BDOA 3D6CA 1OGIA 2F0FA 3W2FA 1BCPF 2WB1E 1W87A 3PSIA 4XLAA 1CNEA 3A0JA 2K01A 5LMUL 1EY6A 5JEAJ 4J1MA 1M90C 3BYTB 4DN4M 3LGJA 2VQFL 5C44G 2PQAA 2AUJD 4R9WA 2NVXB 4A3MH 4KHPQ 3CQZH 3ZZTA 2CKZB 1MJEA 1HA3A 3VA5A 2JJ1A 1E2VA 2OK7A 3QFCA 1MABA 4OIJA 1VHOA 1D6EC 1FGUA 3JC66 4IOCA 1JJCB 1E3XA 1P16A 2XNJA 3E0JA 4KN4C 4II2A 3W5VA 2J4XA 1D8TA 4O0AA 3S16H 1PFNA 1TQOA 2K5QA 1OB2A 4XMYA 5IYPA 2GA4B 2X69A 3I55A 2J7KA 3UE1A 1DOKA 4CDDC 1ZXTA 3D4DA 4P2NA 2KCMA 4HIDA 1IBKL 3OW2A 4IO9A 3I70A 3J81c 1PJ6A 2K5WA 3VR2A 5BN3A 5EPLA 4YWMA 1UE6A 2C4TA 1YVCA 1EYAA 1W6KA 2WJYA 1WCMG 4P75A 2LKVA 3NHHA 4C1NI 3J80E 1L2FA 3MXNB 1Y1WG 2OWOA 3ISXA 1Q8KA 5GAEC 5CMDA 3MEHA 1RD9D 1B50A 2Z6KA 2WB1G 2MO1A 2F0PA 4QIWB 3Q6QA 4IPGA 2F43A 3C1EA 3PO2B 4OO1H 2V7TA 2F3WA 1VDZA 1PXUA 4JW0A 2PLFA 4OPVA 5GQOA 3BDCA 2QN6A 1XMOL 3SK4A 5EAYA 1KHIA 4JI2L 1EOVA 1IYVA 4P12A 2LXJA 1VQ9A 1SYDA 1GOZA 1FNCA 3AYHB 1KC8C 3TDQA 4RDLA 4YHHL 4RGMA 3B8HA 3E5SA 4PMWA 1AW7A 2OQ0A 2ZM6L 4JI4L 2D62A 1F60A 4QUCA 3DEPA 5FK9C 1HZBA 4IPCA 2A6HC 4B3XA 1BX1A 3MAQA 4IJLA 3TN2A 4POFA 4A3KG 3KEWA 5IIFA 1TWFH 1JOKA 1UEBA 2X6LA 2NVTB 3SEBA 4Z4YA 1CKOA 3TBIB 2YWGA 1KABA 4RDJA 2F0DA 2FMMA 4M1UB 1CA6A 4QJFA 1NTGA 4CKEA 4CDCC 4DF7A 1KLUD 1I6HH 4XD7A 2BA1A 1EQRA 1GUNA 5E6TA 1O7LA 2UUBL 4WJ3M 2WSSA 3O13A 4RFBA 1BO0A 2C35B 3ZYYX 3TP6A 1Q1EA 1C8CA 2JN9A 1LT4D 3VYUA 1F20A 4RD4A 4BS9A 1ZM2A 3Q22A 2DEUA 2UU9Q 3PF4A 4HEDA 4DR6L 4DR3L 4HCSA 3OSOA 2J7ZA 1D2BA 2PIAA 1COWA 1VQIA 3CPXA 2ZXIA 4TMZA 2PMZE 2F0NA 2RDGA 1OXXK 1Y1VH 4A3FB 4C3HG 2JQOA 1ASYA 3OYYA 5B6IA 1FVIA 4YCVA 3PIOA 2QDBA 4X7CA 2BVNA 4KY7A 5EMNA 3SGIA 1PZJD 3U50C 2RA4A 1PLFA 3I4MB 2E8GA 3H3VH 2V7VA 4LF5L 2KHJA 3ZZUA 5C4XG 1CT1D 1XNQL 4HCEA 4ODGA 1JR0D 1VQ6B 1T5EA 3A5ZB 3MA2B 3P75A 3BY1A 4LF4Q 1S72B 1PH5A 4GQNA 1XPUA 1QGZA 1JB9A 2K04A 4IOAA 3I8ZA 4DV2L 1X3QA 4A4IA 2KBNA 5E3FA 3QR8A 1I5FA 3ULPA 3WY9A 1E0BA 3I90A 4WZEA 1DONA 3I4NH 1F9PA 1UAPA 3S1NH 1O78A 2V7UA 1UD4A 1VQDA 1W34A 3FPKA 2R7ZB 2QGGA 3I3CA 4R4TA 2HDMA 3KLSA 4OO1I 3LNNA 4UPAA 4DR4Q 2AHOA 2F0UA 2F4VL 4ULLA 3I7FA 4GNXA 3M3YH 1T9HA 1HQMC 3KL9A 4ROXA 5FA6A 3U58A 2LS01 3OJWA 1B70B 2VB2X 1OB5A 4DV4Q 2DYIA 1E24A 4PMCA 4X3TA 3OW7A 1SE4A 3HOXG 1EQQA 4EQPA 5JOBA 5T1GA 4FYDA 4KY6A 4IW3B 1XB2A 1EP2B 2RCNA 5LMNW 2C9OA 3S1QH 5LMZA 3CPWB 4X3UA 3S2HB 1MBYA 3CQZB 4JI0Q 3GVKA 3K5NA 1U4PA 3HZXA 3SHLA 5IWAL 3G6JB 2PW7A 3J80c 2EJMA 2WPDA 3BDOA 1VF7A 4K0KL 1JORA 1D5MC 3GTJH 2ZZQA 3S16B 5CBAE 1IL8A 1EFTA 2R6HA 4PC2A 5BSXA 1IBLQ 1WOCA 4YEJA 4EQNA 3AEVA 4CKCA 5EGTA 1V5VA 2OTLA 1L1OA 2V1CC 3L7ZC 1AIPA 1E43A 4OOSA 5GV7A 4MTKA 1JA1A 1FJGQ 4P72A 2JDIA 1H9RA 5BR8Q 3PMFA 5CGKA 3CCUB 4DR7Q 4R71A 2MP1A 4HIZA 1PRTD 4M8AA 4C2MB 3HOZH 5C5MA 1U4LA 1D2EA 4B9WA 1H9KA 1GVHA 2C77A 4KY5A 2RC5A 1PJ5A 4NNJA 4EH1A 4CDFC 2X3UA 4A3JG 3SLNA 3VDYA 3ITPA 3TZUA 4LFBL 5M5WB 3KF8A 4M2LA 2DNEA 4N9TA 4KMUC 1M1KC 1KAAA 1J9OA 5C4HA 2PZTA 3X3MA 4X8IA 1FD7D 3BS1A 1JJ2B 2OT2A 4GZYC 2E5LL 2KENA 4PG3A 3I56A 1UNSA 5J3OA 1KTVA 4DFAA 1PA6A 4TVAB 1NSNS 1RL2A 4B3TQ 3TRZA 3BH4A 5DEHA 2F0WA 3ER0A 1E64A 3HKZG 4X3SA 1HNZQ 3K5OA 2B63G 4YWLA 3ASQA 3ASSA 1LV9A 4HN7A 5FLMG 3GTPH 1WTRA 2OF1A 1BBWA 2K50A 1E62A 1PTOH 4C3IG 1VMPA 4FP5D 4ZK9B 4TSSA 1KQSB 2QCPX 4X62Q 1Z7TA 3H0GG 2ZXOA 2DERA 1WTOA 1MJCA 3W2HA 3EIVA 3ULJA 2UXBL 2IJ0A 4IPHA 1ENFA 2WKDA 1Q7YC 2HHHQ 2WAQB 4X66L 1IHZA 1HH2P 2YTVA 2A19A 4DR1Q 1LTRD 3DWQA 3Q6SA 2K32A 4DXGA 3CRKC 1B9MA 4C56C 1WTXA 1N8RD 1TLLA 4LMQD 1U5KA 3EA6A 1N0UA 3PUXA 2MO0A 1W2BB 3R93A 1YNJC 1SFOH 1Y0RA 3SR1A 1KK1A 2C5HA 1Q12A 4FXKC 4JBKA 1XPOA 2ZJQA 1HHVA 2EY6A 4GKKL 4Q7JB 2HDNB 4WQMA 5AJ3L 2PPBC 2YTXA 1VMCA 4GN4B 2ZZEA 2EYMA 1CQVA 4L8JA 1EOTA 3G71B 1JCKB 1OXUA 3EQLC 4BA2I 3AVXA 5JJZA 2JJ2A 1WCMB 3G6EB 3Q8DA 4FDBA 1Y8OB 4ZAIA 1A0IA 2ZTCA 1HNWQ 1I7PA 1WDTA 1Y1WB 4PC1A 2A6ED 5C0XI 4Z1MA 5TSSA 4X65L 2C4UA 1Q8IA 2VBTA 4GLAC 2CBXA 2JEAI 4RCYA 1V0EA 2Y0SE 1HFGA 4YAWA 4QIWE 1XNRQ 3PV0A 1V0FA 1PTOC 1V1OA 3VYSA 2QDLA 4Z4TA 1UEAB 1LUZA 4LF8L 4GS3A 1K9MC 4IUNA 5F2DA 3LO8A 2RDHA 1DXMA 4OXPA 4AF7A 1VQ4B 4PC7A 3F8TA 4MNOA 2ZL5A 1LT6D 4II3A 2XGJA 2AMCB 5CDFA 2E2HB 1AE3A 2I0QA 4FXUA 3RN2A 2Z1CA 1GUWA 4ZGNB 4UP9A 2B8FA 2QA4B 1QOHA 4KJOA 1X65A 4IFDG 4NXML 1LLRD 3STBD 4PZ6A 3I4NB 3S1NB 1B44D 1TIID 2DOGA 1VQKB 4G1VA 1WJJA 1MHWC 4NPSA 3MXPA 4O42A 2NTSA 4RHRA 3CC4A 5LMUQ 4BPRA 1VJSA 4KD4A 3CXCA 4QUZA 2K03A 4YCWA 4J8QA 3HOWH 5LL6X 1QVGA 1E1OA 2VQFQ 3MHBA 4B3SL 4IJHA 3R3OA 3CB4A 3W2IA 4UZEA 2PI2A 3KJOA 4HSVA 4X05A 1X55A 3NPPA 2Z6KC 4IN3A 2JSOA 3CCLA 2CH4W 2AUKA 3GV6A 2BM1A 3CPFA 3MWYW 1VQFA 5LMNL 4O2DA 4YELA 3KK7A 2NV4A 5CV6A 1XYIA 1E2WA 3OOCA 5HZBA 4X0CA 3JAMi 4IZ8A 2OYNA 1YHQA 2CCZA 2XZPA 1W0KA 3A8KA 1WTVA 1B23P 4NKLA 4UY8C 4EVOA 1A63A 2O5IC 2JA9A 3H91A 4IUVA 3AB9A 3AVYA 1A62A 1YJNB 5A89A 1ESFA 3L9AX 2ZITA 1V1PA 2Y0SG 5ELEA 2P5ZX 1IBKQ 2XEXA 4LNQA 1HCZA 4GKJL 1E63A 1LTGD 3PO2G 2W6IA 1NBWA 1W6JA 3JQQA 1SNOA 4B3GA 2A5HA 2V7QA 5I6WA 3P26A 3ASRA 2K14A 4TMXA 5GADC 5FOBB 4KHVA 4R4OA 4O1NA 3SKBA 3WWVA 2AQ1B 1HPCA 4N9PA 1EY5A 1QNUA 1KNAA 1XMOQ 4A3GG 1U4MA 5F4MA 2JA8H 1TTTA 3L3OC 4JI2Q 2AQ2B 4B08A 3AGPA 1WU8A 1DOMA 5CYUA 4ZLTF 4L6TB 1G2SA 2VNHA 4A3IB 2NZHA 1LTBD 2KUMA 5IGCA 4R4IA 4U9UA 1VQOA 1UD6A 4YHHQ 2GK6A 1DYQA 2QILA 3CC2A 2HQEA 2ZM6Q 4JI4Q 3Q0AA 4JI0L 1GUTA 3WOFA 1NRKA 2LFNA 3IFDA 3OFNA 5TR9A 2PQAB 4QL5A 4B9XA 1C7YA 3NXWA 1QVFA 3BVMA 1MKHA 1VLOA 1Y8NB 4I7AA 1FNUA 2EPBA 2D5DA 5KYLA 1IW7D 3CCSA 3H6MA 1II3A 1W2BA 2QE7A 4ZGQB 1CQXA 2BE5D 2YV5A 1SXTA 2NVQH 2UUBQ 2PMZB 2QTZA 2EYOA 4RD1A 3FKSA 3I55B 4DV6L 2SEBD 4JI7L 5IGDA 3CCVA 2PI2E 4GOPA 3OIQA 4A3FG 3JAMc 4WZLA 3OW2B 1G291 1E2ZA 1WD1A 4YHBA 4P3IA 4TMTA 1JA0A 3CRLC 4JMQA 3T16A 4DR6Q 2VQEQ 4I65A 1K8AD 3BZKA 2ZT9C 1I4QA 4DR3Q 3P1HA 4P73A 1K73D 3I4MG 3BVZA 2K6AA 3F2DA 2SNSA 2RQXA 3KF6B 3QOJA 4GNXC 1M8AA 5JBQA 3CW2A 1ZYRD 3A8KE 2ZXHA 3ERQA 2P3MA 4X06A 4JI6L 2BMWA 1B53A 5FLXE 3LVBA 4P71A 2ZZGA 1K8OA 3RZDH 1JB7A 2QMUA 2NN6H 3W2GA 4YCUA 4CKBA 2ZBVA 1K8MA 2MHVA 5IYDH 5KIXA 3T13A 1ESRA 2E1BA 1D5XC 2RC6A 3J81k 4Y7CA 2RVLA 2WIIB 1BF4A 4LF5Q 2R7ZG 1F2ZA 1VQ9B 1VQ8A 3OTOL 1XNQQ 4LFAL 2FINB 1R5BA 4KJNA 1JE4A 2TSSA 3TP5A 3WBKA 3AMUA 2AKWB 2IW3A 1AZPA 3QE2A 4DV2Q 4GN5A 3ZUGA 2DUDA 2G9DA 1HXYD 3OKXA 1D7QA 4U68A 4PNYA 5KSWB 1L1OC 4A3MG 3PUMA 4A3DH 5D65A 3UDGA 1QGAA 5M5YH 1EQVA 1LT3D 4RA8A 2F4VQ 4GLXA 2F0LA 4DAPA 1EWHA 2JN4A 4LUZA 1SLJA 2L9HA 1YJWA 2DIEA 4XN3A 3A56A 3UDXA 3VR5A 1F77A 1TS5A 2LMCB 1N06A 4HTHA 4K6DA 3KJPA 4X7FA 3HOWB 3BVGA 4OEMB 4TQUS 3OHXC 3S15H 2WAQE 2QEJC 4BBRH 1G6PA 4JV5L 2Z8LA 4K2KA 1TY0A 4QCLA 4JI1L 4Y52H 2OXPA 2RSNA 5IWAQ 5IP9G 4P3YA 2AQ3B 1I50H 4K0KQ 2KOLA 4LUVA 1TY2A 4P9SA 4RGOS 2O4XA 4RHSA 1Q46A 1BVSA 5KRUA 4MTNA 2E2IH 4QFMA 2GVAA 3SVMA 4AC9A 2HQLA 2XTIA 2XNCA 5H1SE 1WTQA 2ID0A 4PZ7A 5ISRA 3BU2A 2EFGA 4XTCS 4OO1G 3T1HL 2EY2A 5E1FA 4E0FA 1E3PA 2UXCL 1Q1BA 3OEHA 2F0JA 3S14H 4LJZC 2VL6A 4Z9CB 4XQNA 3WOEA 5GAHC 1DZ1A 5IGGA 1SEBD 2JJQA 2JA7B 3G4SA 1ZEQX 4ZV4A 4LWCA 4LFBQ 3AFQA 3HOUH 4G7OC 4P22A 1OXVA 2EQSA 2JA6H 1B4OA 2JA8B 5JJLA 2NN6I 1HR0L 1H95A 2R92H 4HAEA 2E5LQ 2YWEA 1SAPA 2AHOB 1KL9A 2CH4A 4GNXB 2B3GA 2WAQG 1FGBD 3CRZA 1RDPD 1YJ9A 2ZTNA 2K28A 1WOSA 4TT3A 1QZHA 2EDGA 3AVTA 2NB0A 4LUOA 4FXDA 3NTHA 4JI5L 4TMVA 1B1ZA 2I46A 5C3EH 3Q3AA 4ASUA 4OIKA 4CBVA 1SRUA 3R8BA 3FJOA 4OP7A 3FHWA 1JOQA 1QWYA 2UXBQ 3BJUA 1G7RA 3DWPA 3R2IA 2KQ3A 1NB9A 1ICWA 4X66Q 2E74C 2G5DA 4KHZA 4PV1C 1EFUA 2KA7A 2NVQB 4XOTA 3A3BA 1BLIA 1GO2A 4A93B 3KF6A 2NWGA 3TP8A 1GJXA 3GTOH 1GUOA 1STGA 1PH1A 1Q81D 1NY4A 3TQYA 2OTLB 2Y0SB 3PUWA 1QFYA 1L1OB 3X3NA 1VQHA 3A8IE 4GKKQ 5AJ3Q 5IK2A 1WTWA 1XPRA 3PIP3 2IY5B 2K33A 2Z6BD 1PZKD 2BCOA 1U0LA 1HTPA 4PAAA 4DQKA 3PA1A 2SNMA 5CV8A 2A73B 1BOSA 3CU7A 1LTTD 3TP7A 5ELOA 4X65Q 4MN3A 4DR5L 1UD2A 3S2DB 1DGSA 1E1RA 2K7VA 3RZDB 3ES9A 1DJRD 1NB0A 4RD3A 1CFMA 4LFCL 3S1RH 1TVCA 1D8LA 1TS3A 2BSAA 3ZBTA 4HE6A 3KF8B 1IKMA 1VQPA 1MRZA 2FXQA 4A3GB 3I4NG 2OBRA 1O80A 2GK7A 4LF8Q 3I56B 2K5VA 2DJGC 1G7SA 2ALYB 1RKNA 2RF4A 3U9OA 1Y69U 4B3RL 5IY0A 4C3JH 1BCPD 2M2LA 2I07B 2IX1A 4A75A 2C5CA 4OWXB 3B82A 3VNUA 2R93H 3PA2A 3S9WA 5M3FH 4NXMQ 1KRTA 3OZWA 5C44H 3QFRA 3J80i 2CC2A 1A3UA 1J6QA 2IHEA 4XT3B 1L0XB 2R61A 1QX4A 1B2RA 3SJZA 2N3SA 1WD0A 4LF9L 5M5YB 4B3SQ 3I73A 4IPDA 2I1LA 2F0EA 2VQEL 2VBUA 5JPNC 5C0XG 1NUCA 1UE1A 3OWFA 1CUKA 3QWNA 2KEEA 2CW0D 4WJWA 5LMNQ 1X6OA 3HGBA 1X3FA 1N36L 1I94L 2WACA 3GVJA 1HFNA 4P6VF 3VA7A 1ET6A 3A3GA 1RHPA 4P6YA 3DMUA 5CORA 4PQXA 1S4MA 3E9IA 4ZRZA 1GJRA 2MNAA 5DSZA 5F4JA 3T1YL 2K5NA 3G48A 3W1GA 4NP5A 2H1EA 1NJID 1BX0A 4DQLA 2XZLA 3ICEA 1NNXA 3HS0C 2Q2TA 1I50B 4XIGS 1WOPA 4GKJQ 2ASBA 1HUNA 4M0LA 1PH7A 1PRTC 1QUQA 2EYLA 4A3EH 2HD3A 2EXDA 2DY1A 4K5XA 1EIFA 1CZGA 1YI2A 1ASZA 3HOYH 4A3IG 4H13C 1RTNA 2JEBI 1G7TA 2CRVA 5NUCA 3CCRA 4B47A 1PYSB 5EJWA 4RM0A 3NWTA 1SYBA 1HQRD 4LBYA 3AVWA 4K14A 2MGSA 3ZIAA 3NENA 3S14B 2B2TA 1EIGA 3D3RA 4XN0A 4FO2A 4I7ZC 1V9PA 4GOPC 4J15A 5D3DA 4BWGB 3RZOH 1MI2A 4MHEA 1AMOA 1R5OA 1I3QH 3CP2A 2KVMA 2N78A 4M1KA 3HOUB 1PH2A 4RDKA 4A3KH 2C2WA 3OPOA 1F9RA 3M4PA 2AWOA 3CC4B 5EPJA 4NB3A 3TEHB 3WDNA 5L37A 3WBJA 2VZAA 4A3MB 2X53S 1WI5A 3CXCB 5FO1A 1P4MA 1X56A 2F0HA 1TVXA 4KV6A 3SDZA 1QVGB 3CW2C 3UE0A 1ZM4A 1FRQA 4XQFA 2D9UA 1TXYA 1JE5A 1YEZA 4IURA 2B39A 4QVJA 2A69D 5IT9E 3CP8A 3CCLB 1ILQA 2UXDL 4XOPA 3H3VC 1ZUNB 4BBSH 1D1KA 1MGSA 3FPPA 3VO2A 3PUYA 1AH9A 3GTMH 5IYWA 1N8RC 4XLHA 1YHQB 3DUZA 5DS0A 4L5SA 4C43A 1H9SA 3GTGH 4RAUC 1AP0A 4QB4A 4P26A 4B4DA 4DV1L 2WFWA 1H9JA 3SEJA 1GVPA 5IOCA 4DV6Q 1HNXL 4JI7Q 3EBEA 1C48A 3TREA 3T56B 3GO5A 1V1PB 1HZEA 4ALPA 2XSCA 2Z4IA 1IB0A 5BN5A 1EFID 2EE1A 5IYCH 4YY3L 4CDEC 1BXTA 2K1BA 1TWAH 3R6JA 1LTAD 5C6AA 4AVZA 5HZAA 3QJYA 4Y7NH 4C3HH 4DV0L 2A6EC 2G9HD 4RLZA 1G7CA 1EEFD 2XZOA 3A7AB 1PMRA 3DM1A 4RCZA 5JEAG 4KKTA 2WKCA 5JJIA 4JI6Q 4XONA 2EYJA 4AH6A 1N05A 1R4QB 2F0GA 3V2TA 3W5UA 5C4XH 4TKOB 3NE5B 1G51A 3PUNA 3LWUA 4DNRB 1TT2A 2Z0SA 3C1FA 2GREA 4RPBA 4P2CB 5C3WA 1HUMA 2JYOA 2EZVA 1FDRA 1L0YB 3FKIH 4UHVA 2QW7A 3H3VI 4ILWA 2R6GA 4OGQC 3OTOQ 3K5LA 4LFAQ 1VQOB 2D3LA 3VR6A 1E3ZA 4KI0A 3CC2B 1MSGA 1LACA 1K83H 4ZCIA 3BYYB 3STBC 3MXGA 4B43A 4HIKA 1BQQT 4ZCKA 1QG7A 4RD0A 1TWFB 1CA5A 4RKLA 1A6XA 4ZCLA 1QVFB 3CD6A 2GJKA 3HOWG 3KDFA 1PRTB 4F88A 4M53A 4C3JB 1V1QA 2D2CC 3SXHA 1I6HB 3RMHA 1Z47A 3NBHA 4DV7L 3BCFA 1KNEA 4ZQ3A 3NWSA 3HOXH 3CCSB 3CCJA 5M3FB 1S0UA 1VQLA 3K80C 4UDUC 4LBZA 2RHQB 2OBTA 1B8AA 1A8VA 4NMZA 1VQ7A 1SKYB 2QF7A 3OMGA 4F7DA 2D9RA 2VJIA 3A1PA 1X32A 3CCVB 2NVYH 5M5XH 4PC6A 3EJIA 4GOPB 4LAAA 1CNFA 2NUCA 2YWHA 3C3LA 1RF2D 4XQQA 3W5OA 1N32L 4RCOA 3PO3H 4JV5Q 2JA5H 3I72A 3VNVA 1S5ED 4JI1Q 3GTLH 3M4YA 3J7AV 3NELA 3SJPA 4JI3L 1F9QA 2BH2A 1Y1VB 2N8NA 5FLXL 3K0XA 4JG2A 4G6IA 5DNFA 4F8MA 4L5TA 1NR4A 1Q90A 3PCOB 4BY1H 3RD4A 3D26A 4HJ5A 5GROA 3SK6A 1Y8PB 1AN8A 4APVA 5JVH3 1BUVT 2K5HA 2L12A 3L0OA 3DM3A 4S3SA 4QQBX 2JA7G 4L63B 2WZPP 2ATWA 3J81L 3L2PA 1G2TA 2UUCL 5FKAC 1QUEA 2PZUA 3T1HQ 1KK3A 1SNPA 1SM4A 1XTDA 2ZTEA 3GTQH 3KLRA 4OPOA 2UXCQ 4A3JH 1QUFA 1VQ8B 3K81C 4F7XA 5FO9B 2JA8G 3HOYB 5J35A 1UD8A 1YNND 4X07A 1M1KD 2YU9H 5HY6A 4C1NK 4K5VA 3RY8A 4UP8A 1XE1A 1DCZA 2N88A 2FX3A 4FK8A 4Z4UA 3D6WA 1TWGH 4G7WA 1A2UA 2XVSA 2IWHA 1IBML 5I6YA 2ZXRA 3HOVH 3PIPA 2VS1A 3MCAA 1Q86D 4X3KA 3M3YB 2ZL6A 5EPKA 1SE8A 1KD1D 3AFPA 5IE8A 1PH9A 5K36G 1HR0Q 3RZOB 1ML0D 3CTAA 3PENA 1TUIA 4OX9L 2D3NA 2X6GA 2GJPA 2KCCA 3ASTA 1YJWB 1IW7C 2KVOA 1N33L 4QF4A 4A3BH 4WZKA 1OO9B 3NK9A 3AQQA 2GQFA 3S1QB 4CJ0B 3H0GH 2OEOA 3U2QA 2BE5C 1HZCA 1CHQD 2DNCA 2NTTA 2E76C 2UUAL 4RD6A 3CCMA 1HTLD 4JI5Q 4A93G 3P20A 1VHEA 3IFTA 4K5WA 2F0IA 4IUQA 4P25A 2GN5A 2IPKD 4YIJA 1R9TH 5BSYA 2LZJA 1STHA 2X6YA 2C5BA 1NMFA 2V7WA 3DWAA 3GTJB 2OTJA 3GTMB 1H42A 1T6XA 3IKJA 2H5XA 3K6OA 5KYIA 3OJXA 1CKNB 1FL0A 2B2WA 4H0LC 1WTHD 1GUSA 1K8AC 1JMCA 1JOOA 3GTKH 3GTGB 5KEEA 3WNDA 3A8JA 3CMAB 4MYUA 4DKAC 2E2JH 3SE0A 1GHKA 1ZYRC 2BPOA 5KNDA 3PUZA 2ICIA 4WWVA 1I4PA 1N9WA 1SJHD 1STEA 2NN6G 2CQAA 4R8IA 2DGYA 2FJ2A 5IYDG 3HOZB 4RPDA 2J0TD 5EBCA 3VR4A 2IHFA 5EQ0A 2PZWA 4Y7NB 4PGOA 1ONLA 2L1BA 5FJ8H 5TY0A 5JVG3 1XXGA 1KLGD 1KXLA 1CZWA 4K1XA 2BGJA 4JCVE 1Z6HA 5K5PA 5KNBA 2A68D 3FVQA 4DR5Q 3G4SB 1PH4A 4Z4SA 1SYGA 2VZLA 4LFCQ 5JPMC 4JOIA 3DHQA 3H9NA 3NTIA 3QB3A 4RKBA 3URYA 5CBEE 4Z4WA 2IX0A 4ZCMA 2YYZA 1OGJA 3RLFA 3FKIB 1OTCA 2RDFA 5DM73 1UD5A 3T53B 3GTPB 4BXXG 2XN9C 4EGVA 1TWCH 1CK1A 4B3RQ 3SLDA 1YJ9B 4CHTB 1PTOB 1HA6A 3K7AH 3HEJA 3U4ZA 1SMYD 2EVBA 2F0VA 3GDEA 4CQJA 2L11A 3LQ6A 3Q23A 1N0VC 2CVRA 2HLDA 4TN1A 1EL0A
chains in the Genus database with same CATH topology
3BZDB 3QO2A 3MTSA 4XT1B 3KUPA 5KNLA 2WINB 2IT1A 1SFOB 1XWEA 1KTKA 3TSSA 4XLCA 2B2TC 1AEXA 2L0CA 5M5XB 4ABNA 3KBGA 5LHY1 4XR6A 1F9SA 1GXDC 3PO3B 3D31A 4V0BA 2BDNA 4XYQA 3G05A 2XRQD 5EKKA 1EWCA 3J81E 4IQZA 1EEID 2XWJB 4BY1B 2E2DC 3TZDA 3OAAA 2PYKA 1KZLA 2N55A 1EZ6A 2F0QA 3MVVA 3MFGA 4KTAA 3W2DA 2VNUD 2BOSA 2LY7A 3PUVA 2YU9B 5C3XA 3VYTA 2NYZD 3HOVB 5BN4A 5I9OA 3HRZC 5FO7B 2FFKB 2B2UA 2JXMB 4WFN3 2Q8RE 4IALA 4XM3A 2HUGA 4A3BB 2BA0A 2XOKA 5J22A 4DAYA 3GQBA 1R4PB 1G91A 1QB5D 3NQIA 5JAVA 2F03A 1ET9A 1R9TB 3R2TA 3QOLA 3H94A 3FEWX 2L5TA 1NAPA 4ZYSA 1O7YA 1V8QA 2MJ8A 3A55A 3V05A 1STBA 2E2JB 1A3VA 2DY8A 2X6WA 4K8JA 2ENBA 3FMCA 1AZQA 4R8NA 4XLEA 1C4QA 1I4RA 3WQZA 3N6RA 4RH6A 3OE7A 4QUFA 1G6ZA 1EU3A 5CV5A 5CV9A 2F1MA 4G7HC 3CESA 1BNZA 3EROA 3BCDA 2B2YA 4C3JG 3EVQA 1BCPC 2KCNA 3IL8A 3A54A 5ELBA 4BA1I 3P7JA 1E1QA 1DM0B 1ENCA 2K5DA 1TU2B 3NTKA 3NP8A 1VLYA 5IT9L 1B3AA 5AFWA 1SDFA 2B8GA 4AYBB 1TWCB 2L4NA 3K7AB 5EKLA 1EIHA 3CKIB 1MD2D 1RCVD 2CW0C 3D8GA 1QILA 4RGNA 1I18A 1ILPA 2EYFA 1H9SB 2O5JC 1CQFA 3D4WA 1F2MA 5J39A 1DD2A 1OHHA 5M3MB 5IGBA 4Q5VA 1I6VC 4XQJA 5A2QE 1H9MA 1QNKA 2Q8TA 1I4XA 2VUMB 2TMPA 1JWMD 1CI3M 1HA5A 3C2PA 4DU9A 1QJOA 1FNWA 3DDYA 1LTSD 2CK3A 5DM63 4FF2A 3S1MB 5HGTA 1LT5D 3MC0B 4RWSC 4K6LA 4FVMA 1D5ZC 5D14A 4RCNA 2B2WC 1XX8A 5CV4A 2V31A 4A3DB 1DOLA 4Q0FA 3OIPA 1STAA 1JC7A 5FL7A 4IFDJ 3MFYA 1GHJA 2A69C 4B3FX 1XTCD 5COYA 3S15B 1EYDA 4BBRB 1A3TA 2NZ1D 1LABA 4ID6A 2EY1A 5G3LF 1NBMA 1PRTF 4IUPA 1BBXC 1W0JA 1BCPB 1E79A 1B2TA 3MZ5A 4ZKBB 1WTPA 3DXJC 3K0YA 1RTOA 1SE2A 2E2IB 3HAGA 5KGUA 1GUGA 1FR3A 1SYEA 1F2YA 2VB3X 1J8IA 3JAML 4FXGC 5EKIA 4PMBA 2EYPA 5KNCA 1SNCA 4BY7B 3BG3A 2PNRC 2GJRA 2AWNA 2A6HD 1FYCA 1TKWB 1PKVA 3K5MA 1NCVA 2JA6B 1S4ZA 3ZPNA 2PO4A 4DGZA 5C4ZA 2R92B 1QE6A 2WJVA 2FHTA 5A35A 3J7YW 4TSFA 2X85A 5DAUA 3AU7A 1A2TA 3I91A 4FF4A 1IYUA 1EFRA 1B9NA 2PQEA 5C3EB 2KJXA 4CGYB 2HCIA 3T51B 2B2VA 3NBIA 3M85A 2F0SA 5FO8B 1EY4A 3ND8A 4XLFA 2KEDA 1TWHB 3T4AC 5C0XH 1S5BD 3S17B 3ONAB 1SNMA 4XL9A 3D4RA 2KHSA 3GTOB 3MXNA 3V96A 1H8EA 1FX0A 5G3LD 4XKWA 3F2UA 1X3PA 1JB3A 1BR9A 1ZKOA 4MIUA 1WP6A 2B2UC 5I9PA 3QIAA 4V190 2ICEC 2HCCA 3S1RB 3OMCA 1K28D 5M9OA 1YNNC 2VXWA 1PFBA 2F0TA 3A35A 2A74C 1G8ZD 3J7AF 1RJTA 1LO5D 2MPMA 4XORA 3VYRA 2EXZA 4XXEA 4DK0A 4OL7A 4F87A 2W6JA 2R93B 3KBXA 1M4VA 1QCBD 5C44B 2F0KA 2XIWA 3GD7A 1AFPA 1OXSC 1MSHA 3NQTA 2CHBD 5ELFA 1TR5A 4OHJA 4CJ2C 1JQYD 2EJFC 4EQOA 2EJGC 3CMMA 3M7NA 3E6ZX 4DNTB 3GP7A 5IGEA 1EYCA 4KKSA 5ELCA 1PTOF 5CR3A 4XKVA 3JU4A 2BDOA 2B2YC 1VCIA 1O7ZA 2XNDA 4K2LA 4WRDA 1STNA 4G7XA 2O2LD 3HP3A 3JAME 2L55A 4A3EB 3K57A 2WB1B 5I4DA 2JE6I 1JWUD 3SK5A 5JEAH 3G7LA 1LTID 4KKUA 2WP8J 1SSOA 2MUYA 4QMGA 4XNFA 2A68C 3EFXD 1I4GA 4HR7B 2R3ZA 2RKSA 1SNQA 5HURA 3W3AA 5C5LA 1SYCA 5E4WC 2XWBB 1HVXA 2ZZFA 3VR3A 1I3QB 4NW2A 1STYA 2X6XA 1EY8A 4A3KB 5LL6S 3I4LA 4NDXA 1I8DA 1F2LA 1CHPD 1SMYC 1SJED 4G4KA 2F0OA 1EY7A 3U9SA 3SK8A 2SOBA 2Z4HA 4BBSB 1S5DD 1D1IA 1YNJD 4J6HA 2ZXPA 2V4DA 2NBFA 2IX3A 4ME5A 1EY9A 4FF1A 1BMFA 4HMJA 1ENAA 5IGFA 2VJJA 3FRPB 2R9VA 1TWAB 4ZUIA 1S5CD 1U4RA 1UD3A 1EY0A 4C3HB 5EBDA 1WPCA 4KN7C 1PTOD 5CC4A 4YXWA 5C4XB 1SYFA 3H09A 3GVLA 5E4XA 4E6IA 1KMHA 2DY7A 1PZID 1UUPA 3LWEA 4JK1C 5C4JB 4IFDH 4DXFA 4DAVA 3HG9A 4ZKCB 1K83B 1OB0A 2WV6D 3IAYA 4DK1A 4RGTA 1V43A 3PIO3 2RBMA 3K58A 4H7BA 1KDAA 5K36H 1CM9A 1VF5C 2RSOA 5I2XA 5D3IB 3HOXB 4XYOA 1TS4A 3DEOA 1HRJA 3NUCA 4WORA 3ND9A 2X8KA 3FDTA 5J1ZA 1KDBA 1TS2A 3M4OB 2F4IA 1PDQA 2EY5A 4IUTA 4LK1C 2NVYB 2XNAC 3BC9A 1WVLA 1EZ8A 4FNFA 2EOTA 2QKIC 1IKLA 1A15A 5C0XJ 2JA5B 3GTLB 5A2QL 5CV7A 3J80L 2DN8A 2E75C 2KECA 3RUZA 2M9VA 3A8JE 2JP1A 4KK7A 4H44C 3GV3A 4UZUA 1T5XD 4XDXA 1SNDA 1S5FD 1SBBB 4UAIA 3OWEB 5IODA 4IUUA 1I4HA 1NR2A 3FPUB 1BPLA 3GTQB 2B2VC 2EYHA 4A3JB 1FNVA 4KD3A 1OXTA 1W9XA 3UI2A 1SE3A 2HDLA 4CJ1B 5I2YA 3A7LA 3LX0A 1TWGB 4U673 4G57A 1CTMA 2F0MA 2K05A 3HKZB 1JICA 2B63B 4JBWA 2Q8IB 4FF3A 4G7ZC 4C3IB 3H0GB 3TMEA 4ZUJA 2M5SA 4IFDI 1KDCA 3K59A 3Q24A 1PYWD 4TRDA 1EU4A 1U9RA 2SDFA 2H4OA 3CHBD 3BDLA 3QG1A 2XRSD 1JWSD 3GTKB 3MXUA 5DN6A 1EQTA 3NSWA 3M7GA 2IL8A 1PFMA 3C46A 1H8HA 4DA2A 5ELDA 2PW5A 5HKKA 1RODA 4K8IA 3KLSX 4HMIA 1Q3LA 2F3VA 2JIZA 5T1IA 3N52A 2PCFB 2ZTGA 2M00A 2FMCA 3OEEA 4HSPA 1BDOA 3D6CA 2F0FA 1BCPF 4XLAA 2K01A 1EY6A 5JEAJ 4J1MA 3BYTB 4DN4M 2AUJD 4R9WA 2NVXB 3VA5A 2JJ1A 1E2VA 1MABA 4OIJA 1D6EC 1E3XA 3E0JA 4KN4C 4II2A 2J4XA 1PFNA 1TQOA 2K5QA 4XMYA 2GA4B 2X69A 1DOKA 1ZXTA 3D4DA 3I70A 2K5WA 3VR2A 5BN3A 5EPLA 1EYAA 1W6KA 2WJYA 2LKVA 3NHHA 4C1NI 3J80E 5CMDA 3MEHA 1RD9D 1B50A 4QIWB 2F0PA 4OO1H 2F43A 3C1EA 3PO2B 2F3WA 1VDZA 1PXUA 3BDCA 3SK4A 1IYVA 1SYDA 1GOZA 3TDQA 4RGMA 3E5SA 4PMWA 1AW7A 2D62A 4QUCA 3DEPA 5FK9C 2A6HC 3MAQA 3TN2A 3KEWA 5IIFA 1JOKA 2X6LA 2NVTB 3SEBA 3TBIB 1KABA 2F0DA 2FMMA 4M1UB 1CA6A 4CKEA 4DF7A 1KLUD 4XD7A 2BA1A 1GUNA 1O7LA 2WSSA 3O13A 4RFBA 1BO0A 3ZYYX 3TP6A 1Q1EA 1C8CA 3VYUA 1LT4D 4BS9A 3Q22A 4HEDA 4HCSA 3OSOA 2J7ZA 1D2BA 1COWA 2ZXIA 2F0NA 2RDGA 1OXXK 4A3FB 4C3HG 2QDBA 4KY7A 1PZJD 2RA4A 1PLFA 3I4MB 1CT1D 4HCEA 4ODGA 3MA2B 1T5EA 1JR0D 3P75A 4GQNA 2K04A 3I8ZA 1X3QA 5E3FA 1E0BA 3I90A 1DONA 1F9PA 1UAPA 1O78A 1UD4A 2R7ZB 3I3CA 4OO1I 2HDMA 3KLSA 3LNNA 2F0UA 4ULLA 1HQMC 2LS01 2VB2X 4PMCA 4X3TA 3OW7A 1SE4A 4EQPA 5JOBA 5T1GA 4FYDA 4KY6A 2C9OA 4X3UA 3S2HB 1MBYA 3CQZB 3GVKA 3K5NA 1U4PA 3HZXA 3SHLA 3G6JB 2PW7A 2EJMA 2WPDA 3BDOA 1VF7A 1JORA 1D5MC 2ZZQA 3S16B 5CBAE 1IL8A 4YEJA 4EQNA 4CKCA 5EGTA 3L7ZC 1E43A 2JDIA 1H9RA 3PMFA 5CGKA 2MP1A 4HIZA 1PRTD 4M8AA 4C2MB 5C5MA 1U4LA 4B9WA 1H9KA 4KY5A 4NNJA 3ITPA 3TZUA 5M5WB 3KF8A 2DNEA 4N9TA 4KMUC 1KAAA 1J9OA 5C4HA 2PZTA 3X3MA 1FD7D 3BS1A 2OT2A 4GZYC 1UNSA 4DFAA 1NSNS 3BH4A 5DEHA 2F0WA 4X3SA 3K5OA 1LV9A 4HN7A 1WTRA 2OF1A 1PTOH 4C3IG 1VMPA 4FP5D 4ZK9B 4TSSA 2QCPX 1Z7TA 2ZXOA 1WTOA 2IJ0A 1ENFA 2WKDA 2WAQB 1IHZA 1LTRD 3DWQA 3Q6SA 2K32A 4DXGA 3CRKC 1B9MA 4C56C 1WTXA 4LMQD 3EA6A 3PUXA 3R93A 1YNJC 3SR1A 1Q12A 4FXKC 1HHVA 2EY6A 2PPBC 1VMCA 2ZZEA 2EYMA 1CQVA 4L8JA 1EOTA 1JCKB 1OXUA 3EQLC 4BA2I 5JJZA 2JJ2A 1WCMB 4ZAIA 1Y8OB 1Y1WB 5C0XI 2A6ED 4Z1MA 5TSSA 1Q8IA 2JEAI 1V0EA 1HFGA 3PV0A 1V0FA 1PTOC 1V1OA 3VYSA 1UEAB 4IUNA 5F2DA 2RDHA 1DXMA 2E2HB 1LT6D 4II3A 2XGJA 5CDFA 4FXUA 2Z1CA 1GUWA 2B8FA 1QOHA 4KJOA 4IFDG 1LLRD 3I4NB 3S1NB 1B44D 1TIID 3MXPA 4O42A 2NTSA 4RHRA 1VJSA 4KD4A 2K03A 4J8QA 5LL6X 3MHBA 3R3OA 4HSVA 3NPPA 4IN3A 2JSOA 2AUKA 3GV6A 3MWYW 4YELA 3KK7A 5CV6A 1XYIA 1E2WA 3OOCA 4IZ8A 2XZPA 1W0KA 1WTVA 4NKLA 4EVOA 2O5IC 3H91A 4IUVA 3AB9A 1ESFA 3L9AX 1V1PA 5ELEA 1HCZA 1LTGD 2W6IA 1W6JA 1SNOA 4B3GA 2A5HA 2V7QA 5I6WA 5FOBB 4KHVA 4O1NA 2AQ1B 1HPCA 4N9PA 1EY5A 1QNUA 1KNAA 1U4MA 3L3OC 4B08A 2AQ2B 1DOMA 4ZLTF 5CYUA 4L6TB 1G2SA 4A3IB 1LTBD 2KUMA 5IGCA 1UD6A 2GK6A 1DYQA 2QILA 2HQEA 3Q0AA 1GUTA 3WOFA 1NRKA 2LFNA 3IFDA 3OFNA 4B9XA 3NXWA 3BVMA 1Y8NB 1FNUA 2EPBA 2D5DA 5KYLA 1IW7D 3H6MA 1II3A 2QE7A 2BE5D 1SXTA 2PMZB 2EYOA 3FKSA 2SEBD 5IGDA 3OIQA 1G291 1E2ZA 1WD1A 3CRLC 4JMQA 3T16A 4I65A 2ZT9C 1I4QA 3P1HA 3BVZA 2K6AA 2SNSA 2RQXA 3QOJA 1M8AA 3A8KE 1ZYRD 2ZXHA 3ERQA 1B53A 5FLXE 2ZZGA 1K8OA 2NN6H 4CKBA 1K8MA 2MHVA 5KIXA 3T13A 1ESRA 2E1BA 1D5XC 2RVLA 2WIIB 1BF4A 1F2ZA 2FINB 4KJNA 1JE4A 2TSSA 3TP5A 3AMUA 2IW3A 1AZPA 2G9DA 1HXYD 4U68A 4PNYA 5D65A 1EQVA 1LT3D 4RA8A 2F0LA 4DAPA 1EWHA 2L9HA 2DIEA 4XN3A 3A56A 3VR5A 1F77A 1TS5A 2LMCB 4HTHA 4K6DA 3HOWB 3BVGA 4TQUS 3OHXC 2QEJC 2Z8LA 4K2KA 1TY0A 4QCLA 2OXPA 2RSNA 2AQ3B 2KOLA 1TY2A 4RGOS 2O4XA 4RHSA 5KRUA 3SVMA 1WTQA 2ID0A 5ISRA 4XTCS 4OO1G 2EY2A 5E1FA 4E0FA 1Q1BA 3OEHA 2F0JA 4LJZC 4Z9CB 4XQNA 3WOEA 1DZ1A 5IGGA 1SEBD 2JA7B 1ZEQX 4G7OC 4P22A 1OXVA 1B4OA 2JA8B 2NN6I 4HAEA 1SAPA 1FGBD 1RDPD 2ZTNA 2K28A 4TT3A 2EDGA 2NB0A 4FXDA 3NTHA 2I46A 1B1ZA 4ASUA 4OIKA 4CBVA 3R8BA 1JOQA 1QWYA 3DWPA 3R2IA 2KQ3A 1ICWA 2E74C 4KHZA 4PV1C 2KA7A 2NVQB 4XOTA 3A3BA 1BLIA 4A93B 2NWGA 3TP8A 1GJXA 1GUOA 1STGA 2Y0SB 3PUWA 3X3NA 3A8IE 5IK2A 1WTWA 3PIP3 2K33A 2Z6BD 1PZKD 2BCOA 1HTPA 2SNMA 5CV8A 2A73B 1BOSA 3CU7A 1LTTD 3TP7A 4MN3A 1UD2A 3S2DB 1E1RA 2K7VA 3RZDB 1DJRD 1CFMA 1TS3A 1IKMA 4A3GB 1O80A 2GK7A 1RKNA 3U9OA 1Y69U 1BCPD 2M2LA 2I07B 2IX1A 2C5CA 3S9WA 1A3UA 4XT3B 1L0XB 2R61A 1WD0A 5M5YB 3I73A 2F0EA 5JPNC 5C0XG 1NUCA 3OWFA 3QWNA 2KEEA 2CW0D 4WJWA 3HGBA 2WACA 3GVJA 1HFNA 3VA7A 1ET6A 3A3GA 1RHPA 3DMUA 5CORA 4PQXA 4ZRZA 4NP5A 2H1EA 2XZLA 3HS0C 1I50B 4XIGS 1HUNA 1PRTC 2EYLA 4K5XA 1CZGA 4H13C 1RTNA 2JEBI 5NUCA 5EJWA 3NWTA 1SYBA 1HQRD 4K14A 2MGSA 3ZIAA 3S14B 2B2TA 1EIGA 3D3RA 4XN0A 4FO2A 4I7ZC 5D3DA 4BWGB 1MI2A 4MHEA 3CP2A 2KVMA 3HOUB 3OPOA 1F9RA 2AWOA 5EPJA 3WDNA 4A3MB 2X53S 4KV6A 2F0HA 1TVXA 3SDZA 4XQFA 2D9UA 4IURA 2B39A 2A69D 5IT9E 3CP8A 1ILQA 4XOPA 3H3VC 1D1KA 1MGSA 3FPPA 3PUYA 4XLHA 3DUZA 1H9SA 1AP0A 4RAUC 4QB4A 1H9JA 5IOCA 1C48A 3T56B 3GO5A 1V1PB 1HZEA 2XSCA 2Z4IA 5BN5A 1EFID 2EE1A 1BXTA 2K1BA 1LTAD 5C6AA 4AVZA 3QJYA 2A6EC 2G9HD 1EEFD 2XZOA 3A7AB 1PMRA 3DM1A 5JEAG 4KKTA 2WKCA 4XONA 2EYJA 1R4QB 2F0GA 3V2TA 4TKOB 3NE5B 3LWUA 4DNRB 1TT2A 3C1FA 4P2CB 5C3WA 1HUMA 2JYOA 2EZVA 1L0YB 4ILWA 2R6GA 4OGQC 3K5LA 2D3LA 3VR6A 1E3ZA 4KI0A 1LACA 1MSGA 3BYYB 3MXGA 1BQQT 1QG7A 1CA5A 1TWFB 4RKLA 1A6XA 2GJKA 1PRTB 4F88A 4C3JB 2D2CC 3SXHA 1I6HB 3RMHA 1Z47A 3NBHA 3BCFA 1KNEA 4ZQ3A 3NWSA 5M3FB 4UDUC 4NMZA 1SKYB 2QF7A 3OMGA 1X32A 2VJIA 3EJIA 4LAAA 2NUCA 3C3LA 1RF2D 4XQQA 4RCOA 3I72A 1S5ED 3M4YA 3J7AV 1F9QA 1Y1VB 5FLXL 5DNFA 4G6IA 4F8MA 1NR4A 1Q90A 3RD4A 3SK6A 1Y8PB 1AN8A 5JVH3 1BUVT 2L12A 4S3SA 4L63B 2WZPP 3J81L 1G2TA 5FKAC 2PZUA 1SNPA 3KLRA 5FO9B 4F7XA 3HOYB 1UD8A 1YNND 4C1NK 4K5VA 2N88A 1DCZA 3D6WA 4G7WA 1A2UA 2XVSA 2IWHA 5I6YA 2ZXRA 4X3KA 3M3YB 5EPKA 5K36G 3RZOB 1ML0D 2D3NA 2X6GA 2GJPA 2KCCA 1IW7C 2KVOA 4QF4A 1OO9B 3NK9A 3S1QB 4CJ0B 2OEOA 2BE5C 1CHQD 2DNCA 2NTTA 2E76C 1HTLD 3P20A 4K5WA 3IFTA 2F0IA 4IUQA 2IPKD 4YIJA 2LZJA 1STHA 2X6YA 3GTJB 3DWAA 3GTMB 3IKJA 3K6OA 5KYIA 2B2WA 4H0LC 1WTHD 1GUSA 1JOOA 3GTGB 5KEEA 3SE0A 1GHKA 1ZYRC 5KNDA 3PUZA 2ICIA 1I4PA 1STEA 1SJHD 2NN6G 2CQAA 4R8IA 2FJ2A 3HOZB 2J0TD 5EBCA 3VR4A 5EQ0A 2PZWA 4Y7NB 1ONLA 2L1BA 5JVG3 1XXGA 1KLGD 1CZWA 1Z6HA 5K5PA 5KNBA 2A68D 3FVQA 1SYGA 5JPMC 4RKBA 3DHQA 3NTIA 3QB3A 3URYA 5CBEE 2IX0A 2YYZA 3RLFA 3FKIB 2RDFA 5DM73 1UD5A 3T53B 3GTPB 2XN9C 4EGVA 1CK1A 1HA6A 4CHTB 1PTOB 3HEJA 1SMYD 2EVBA 2F0VA 2L11A 3Q23A 2CVRA 2HLDA 1EL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6E C;  2L5T A;  4JBW A;  1K8M A;  2Q8I B;  1IYU A;  2O5I C;  1V8Q A;  3AB9 A;  1B9N A;  2BDO A;  3HGB A;  1VCI A;  3A7A B;  1PMR A;  1Z7T A;  5JEA G;  4G7Z C;  4KKT A;  3T51 B;  1HCZ A;  3VA7 A;  4JK1 C;  3M85 A;  1O78 A;  2IT1 A;  2EDG A;  5K36 G;  4TKO B;  4IFD H;  3ND8 A;  4RCN A;  3NE5 B;  3LWU A;  5C0X H;  4DNR B;  3FMC A;  4OO1 H;  2K32 A;  3CRK C;  3LNN A;  1B9M A;  1VDZ A;  2KCC A;  3N6R A;  5BN3 A;  1IW7 C;  3PUX A;  4DK1 A;  3D4R A;  1HQM C;  1V43 A;  1YNJ C;  2JE6 I;  4XIG S;  5JEA H;  2BE5 C;  2R6G A;  4OGQ C;  4KKU A;  2DNC A;  1Q12 A;  1IYV A;  2E76 C;  3OW7 A;  2E74 C;  4KHZ A;  3MFY A;  1HPC A;  3P20 A;  1GHJ A;  2F1M A;  1LAC A;  2A69 C;  3D31 A;  3IFT A;  3QG1 A;  4KI0 A;  4PV1 C;  2KA7 A;  1VF5 C;  4G7H C;  2PPB C;  2A68 C;  4L8J A;  4HR7 B;  1A6X A;  3MXU A;  1EWH A;  4H13 C;  1OXU A;  3EQL C;  4BA2 I;  2JEB I;  1GJX A;  1GUO A;  2D62 A;  4IQZ A;  3W3A A;  3VR5 A;  2A6H C;  1Y8O B;  4BA1 I;  3IKJ A;  2LMC B;  3PUW A;  2D2C C;  3ND9 A;  3VR3 A;  3A8I E;  2A6E D;  1LAB A;  4H0L C;  2EJM A;  1GUS A;  1TU2 B;  3BDO A;  1VF7 A;  4LK1 C;  1ZKO A;  4TQU S;  3I4L A;  2K33 A;  4I7Z C;  2PCF B;  2JEA I;  3SE0 A;  3QIA A;  1GUT A;  2B8G A;  1HTP A;  1SMY C;  1GHK A;  1ZYR C;  3PV0 A;  1BDO A;  5KND A;  3PUZ A;  2BA1 A;  1GUN A;  3DXJ C;  2QF7 A;  1O7L A;  1YNN C;  2NN6 G;  3OPO A;  1Y8N B;  2DN8 A;  3L7Z C;  3PUV A;  1GUG A;  2AWO A;  1FR3 A;  3U9S A;  1DXM A;  3WDN A;  2K7V A;  1Q1E A;  2D5D A;  2E75 C;  3VR4 A;  1IW7 D;  1CFM A;  2CW0 C;  5K36 H;  3SDZ A;  1H9R A;  1ONL A;  1H9S B;  2BE5 D;  3A8J E;  4H44 C;  3I72 A;  2B8F A;  2V4D A;  4DK0 A;  2O5J C;  3M4Y A;  2A69 D;  5BN4 A;  4IFD G;  2AUJ D;  1Z6H A;  5KNC A;  1H9K A;  4XTC S;  5KNB A;  2A68 D;  4OO1 G;  1DD2 A;  3FPP A;  1Q90 A;  3GD7 A;  3PUY A;  3BG3 A;  1OXS C;  2PNR C;  2JXM B;  1E2V A;  1Y69 U;  1G29 1;  1E2Z A;  1Y8P B;  1I6V C;  3TZU A;  1Q1B A;  2A6H D;  1FYC A;  1OXX K;  2DNE A;  4KMU C;  1H9S A;  1H9M A;  1TKW B;  2YYZ A;  2EJF C;  3CRL C;  4LJZ C;  2BA0 A;  4KN4 C;  3RLF A;  3VR6 A;  1OXT A;  2EJG C;  1H9J A;  2NN6 I;  2ZT9 C;  3T53 B;  3GQB A;  4GZY C;  2AUK A;  1CI3 M;  3M7N A;  3T56 B;  3A7L A;  4DNT B;  3KLR A;  5A35 A;  3A8K E;  2EVB A;  4G7O C;  4KN7 C;  1E2W A;  1OXV A;  1QJO A;  3OOC A;  5BN5 A;  3I73 A;  4KKS A;  3H94 A;  1CTM A;  1K8O A;  5C0X G;  2NN6 H;  1T5E A;  3QJY A;  3VR2 A;  1DCZ A; 
#chains in the Genus database with same CATH topology
 3BZD B;  5F4O A;  2I5M X;  4A3L H;  3QO2 A;  3MTS A;  4XT1 B;  3KUP A;  4P74 A;  5KNL A;  2F4N A;  1PH3 A;  1YNX A;  2WIN B;  4LF9 Q;  1UMK A;  1CSP A;  1IYJ B;  2IT1 A;  3U6K A;  1SFO B;  1XWE A;  1KTK A;  2OBS A;  3TSS A;  5M3M H;  2LSS A;  5GV8 A;  1W35 A;  4XLC A;  2B2T C;  4MYT A;  1AEX A;  2BV3 A;  2L0C A;  1QFJ A;  5H5J A;  3CF5 A;  1N36 Q;  1I94 Q;  5M5X B;  4ABN A;  4A76 A;  3KBG A;  5LHY 1;  2VUM H;  2QGQ A;  4XR6 A;  1F9S A;  1GXD C;  1VQC A;  3PO3 B;  4YAU A;  3D31 A;  3T1Y Q;  1ZM9 A;  3ZC3 A;  3P27 A;  4JI8 L;  4V0B A;  2BDN A;  4H02 A;  4XYQ A;  3G05 A;  2XRQ D;  5EKK A;  1EWC A;  1XMQ L;  1QZG A;  3U4V A;  3S1M H;  4HJ8 A;  3J81 E;  4IQZ A;  4LBV A;  1EEI D;  2XWJ B;  4JVZ A;  2E2D C;  3TZD A;  3QFS A;  4BY1 B;  4DV5 L;  4OPS A;  1S40 A;  4X7E A;  3OAA A;  2PYK A;  3ERS X;  1BJK A;  1KZL A;  2N55 A;  1EZ6 A;  1W3S A;  1HZ9 A;  2F0Q A;  1FNB A;  2CWA A;  3MVV A;  1VQP B;  3MFG A;  3B78 A;  4KTA A;  3HOU G;  2R7F A;  1J9Z A;  3W2D A;  2JA6 G;  2CND A;  2VNU D;  2BOS A;  2LY7 A;  2Q6K A;  2R92 G;  1KRS A;  3ZBU A;  4PC3 A;  3PUV A;  1MIU A;  2YU9 B;  2FVG A;  1IJF A;  5C3X A;  1PFS A;  1WSV A;  3VYT A;  2NYZ D;  3HOV B;  5BN4 A;  5I9O A;  2A1A A;  3HRZ C;  1YHB A;  2VBS A;  5FO7 B;  1Y14 B;  2FFK B;  2B2U A;  3MMP A;  2JXM B;  3F2C A;  3RLN A;  1RIP A;  4QGU A;  3A74 A;  4WFN 3;  2Q8R E;  4IAL A;  4XM3 A;  2HUG A;  4A3B B;  4DUY L;  2BA0 A;  2XOK A;  1CKN A;  5J22 A;  4DAY A;  2UXD Q;  4PAB A;  3GQB A;  4LF6 L;  1RQP A;  1R4P B;  4GN3 B;  1G91 A;  4LBW A;  1QB5 D;  3NQI A;  3CMA A;  1ELO A;  2RCF A;  1SRO A;  5JAV A;  3CC7 A;  4Z4Z A;  4A3F H;  2F03 A;  1ET9 A;  1R9T B;  2CFM A;  3R2T A;  3QOL A;  4A3C H;  1PH6 A;  3HKS A;  3H94 A;  1Q81 C;  3FEW X;  4DV1 Q;  2DET A;  2K4K A;  1HNX Q;  2L5T A;  2Q6O A;  1NAP A;  4ZYS A;  1O7Y A;  1V8Q A;  4HIM A;  1N34 L;  3I4M H;  3KYH C;  2MJ8 A;  3JQR A;  3A55 A;  3V05 A;  3RLO A;  1FNM A;  1Q82 D;  1QUQ B;  1STB A;  4YY3 Q;  2E2J B;  1A3V A;  3AVU A;  4BY7 H;  2VBV A;  2DY8 A;  4R4Q A;  4DV0 Q;  2X6W A;  4K8J A;  2ENB A;  4J0Q A;  1YI2 B;  3FMC A;  3RNU A;  1AZQ A;  4N3G A;  2BH8 A;  4NCN A;  4R8N A;  3C2Q A;  4XLE A;  1I4R A;  1C4Q A;  3WQZ A;  3N6R A;  3M4Q A;  4RH6 A;  3CCR B;  2CF4 A;  2CQO A;  2CWP A;  3OE7 A;  4MZ9 A;  1CSQ A;  4QUF A;  1J5E L;  1YIJ A;  2I5H A;  2D0O A;  1K0R A;  1VQN A;  1EU3 A;  1G6Z A;  4EX5 A;  5CV5 A;  5CV9 A;  2F1M A;  1JT8 A;  4G7H C;  1WTH A;  3CES A;  1BNZ A;  3ERO A;  3BCD A;  3UDF A;  2B2Y A;  4C3J G;  2QTL A;  4DNI A;  1T6Y A;  3EVQ A;  1BCP C;  3VMF A;  2KCN A;  4ACA A;  1EYG A;  1EFW A;  3IL8 A;  3A54 A;  5ELB A;  4BA1 I;  2R93 G;  3P7J A;  1EUJ A;  4R4C A;  5FNZ A;  1E1Q A;  1DM0 B;  1ENC A;  2K5D A;  5M3F G;  5IYQ A;  1TU2 B;  3NTK A;  3NP8 A;  1VLY A;  5IT9 L;  3S2H H;  1UE7 A;  1B3A A;  1GKH A;  5AFW A;  4QHY A;  1SDF A;  2B8G A;  4AYB B;  1TWC B;  1TWH H;  2L4N A;  5FIU A;  3S17 H;  4RG1 A;  2N49 A;  3K7A B;  1E7Z A;  5EKL A;  4DV7 Q;  1EIH A;  5FLX c;  2OCE A;  3CKI B;  1MD2 D;  2PNH A;  1PVO A;  3EN2 A;  1RCV D;  2CW0 C;  5IYB H;  2HCJ B;  3D8G A;  1QIL A;  2LXK A;  4RGN A;  1I18 A;  3A5U A;  2EYF A;  1H9S B;  1ILP A;  1Y1V G;  3CCQ A;  2NZO A;  3PGZ A;  2MFI A;  2O5J C;  1CQF A;  1H85 A;  3D4W A;  1QG0 A;  1F2M A;  4OEL B;  4X7D A;  5J39 A;  5IP9 H;  1DD2 A;  4DR2 L;  1KJZ A;  1N32 Q;  1OHH A;  3CCE A;  5M3M B;  5IGB A;  1NJI C;  4Q5V A;  1I6V C;  4XQJ A;  4L5Q A;  4C2M H;  5A2Q E;  1H9M A;  1QNK A;  5IP7 H;  2Q8T A;  4JI3 Q;  1I4X A;  4A3E G;  1VQM A;  2VUM B;  2TMP A;  1JWM D;  1CI3 M;  2MQH A;  4KLK A;  3DLL A;  1HA5 A;  3HOY G;  3C2P A;  4DU9 A;  2DJF C;  5M5W H;  4YAF A;  4B48 A;  1QJO A;  1FNW A;  1LM0 A;  3DDY A;  1IHM A;  3IRB A;  1LTS D;  2CK3 A;  5DM6 3;  4FF2 A;  3S1M B;  3KLW A;  4POG A;  2HMA A;  3JQP A;  2UUC Q;  5HGT A;  1LT5 D;  3MC0 B;  4N8X 1;  3K7U C;  3RR5 A;  2VW9 A;  4RWS C;  1M90 D;  4GLV B;  4K6L A;  4LF7 L;  1N07 A;  2ZJR A;  4FVM A;  1D5Z C;  5D14 A;  4RCN A;  2B2W C;  3B6Y A;  4P1V A;  2V7X A;  1JJG A;  5DLQ E;  1IJE A;  1XX8 A;  5CV4 A;  2V31 A;  1IBM Q;  4A3D B;  1LTL A;  1YIT A;  1DOL A;  3CD6 B;  1Q9S A;  3M9B A;  3KDF B;  4Q0F A;  4JYA L;  3OIP A;  1K0S A;  1STA A;  2R7D A;  3NBH B;  4UP7 A;  1JC7 A;  1KRH A;  3CAM A;  5FL7 A;  1SR3 A;  4IFD J;  3MFY A;  1KAW A;  3OZV A;  5THX A;  1GHJ A;  2A69 C;  3CCJ B;  4OX9 Q;  4BBS G;  1VQL B;  1BKB A;  1X54 A;  3CME A;  2Q2I A;  4B3F X;  1XTC D;  3H15 A;  5COY A;  1N33 Q;  4DAM A;  4NXN L;  3S15 B;  1EYD A;  2Q2H A;  1VQ7 B;  4BBR B;  1A3T A;  1DG1 G;  1DAR A;  2PMD A;  2UUA Q;  1SMX A;  4AQY L;  2NZ1 D;  1LAB A;  4ID6 A;  2QEX A;  3VO1 A;  2EY1 A;  5G3L F;  1NBM A;  1PRT F;  4IUP A;  1BBX C;  1W0J A;  5H59 A;  1E79 A;  1GR1 A;  1BCP B;  3BQJ A;  1WCM H;  4DV3 L;  1B2T A;  2C78 A;  4ME3 A;  4JOI C;  3MZ5 A;  4ZKB B;  1Y1W H;  1WTP A;  5IYC G;  3DXJ C;  3HOZ G;  4Y9U A;  3K0Y A;  1A8P A;  3NEM A;  1RTO A;  1SE2 A;  2E2I B;  3E20 A;  1EWY A;  3MEF A;  2QDX A;  3HAG A;  4N8F A;  1GAQ A;  5KGU A;  2YWF A;  1GUG A;  1FR3 A;  4RMF A;  1SYE A;  1F2Y A;  4OOV A;  2Q6L A;  2VB3 X;  4HJ7 A;  1J8I A;  3JAM L;  2EIF A;  2Q6I A;  4FXG C;  1VQ5 A;  1DDG A;  5EKI A;  4M4S A;  3K8A A;  2EYP A;  1KC8 D;  4PMB A;  1Y0Y A;  5KNC A;  2ZJP A;  5TV2 A;  5KW9 A;  2K75 A;  2E2H H;  1SNC A;  5JJK A;  4BY7 B;  3BG3 A;  2PNR C;  1C0A A;  4G5G A;  1PYB A;  3ULL A;  3FKI G;  2GJR A;  2AWN A;  2A6H D;  1E22 A;  1FYC A;  1TKW B;  1PKV A;  1NMG A;  4WJ4 A;  3K5M A;  1NCV A;  2JA6 B;  1PH8 A;  1QVC A;  3ZPN A;  1S4Z A;  2PO4 A;  4TMW A;  4DGZ A;  3ZZ0 A;  5C4Z A;  2GVB A;  2R92 B;  1EWI A;  1QE6 A;  3E0E A;  2WJV A;  2FHT A;  5A35 A;  3J7Y W;  2VNK A;  2B29 A;  1VS0 A;  3I1F A;  4TSF A;  3ZJY C;  3Q6R A;  2X85 A;  5DAU A;  3AU7 A;  3J7A 5;  1E1T A;  1A2T A;  1VQE A;  1EIY B;  3E3X A;  3I91 A;  1K3R A;  1IYU A;  4FF4 A;  1EFR A;  5L46 A;  3RN5 A;  1B9N A;  2BM0 A;  2PQE A;  1VQJ A;  2KJX A;  5C3E B;  1FRN A;  4CGY B;  2HCI A;  1YX2 A;  3T51 B;  1HJP A;  3CCM B;  2B2V A;  3HKZ E;  3NBI A;  3M85 A;  4DUZ L;  2F0S A;  2DCU A;  5FO8 B;  1EY4 A;  3MHP A;  3ND8 A;  4XLF A;  2KED A;  1P8L A;  1TWH B;  3T4A C;  1S5B D;  5C0X H;  3S17 B;  4ACB A;  3ONA B;  4B3M L;  1X9N A;  3U6B A;  2OTJ B;  2I5L X;  1SNM A;  4XL9 A;  3D4R A;  3PO3 G;  2KHS A;  1D1N A;  1U2R A;  2JA5 G;  3W5H A;  4X64 L;  3GTO B;  3MXN A;  3V96 A;  1XJV A;  2ZL7 A;  1Z9F A;  1UE5 A;  1H8E A;  1LYL A;  1NDH A;  4BY1 G;  1YBY A;  1FX0 A;  1WSR A;  3GIR A;  4OOX A;  4QVA A;  4DK3 C;  5G3L D;  4XKW A;  3F2U A;  1GAW A;  1X3P A;  4RD2 A;  1JB3 A;  1BR9 A;  4X6A H;  1ZKO A;  4MIU A;  4UAJ A;  4JI8 Q;  1YZ6 A;  1WP6 A;  2B2U C;  5I9P A;  1VQB A;  3WNB A;  1XMQ Q;  5C4J H;  3QIA A;  4V19 0;  2ICE C;  1K8G A;  4A3I H;  2HCC A;  3S1R B;  3OMC A;  1R5N A;  1K28 D;  1PHJ A;  5M9O A;  4DV5 Q;  1YNN C;  3PQI A;  2HIV A;  1BBU A;  2VXW A;  1PFB A;  2Z9H A;  2F0T A;  3A35 A;  2A74 C;  1QFZ A;  1G8Z D;  1FND A;  3J7A F;  3KFU A;  4KHP L;  1GD7 A;  5HXB A;  1YLO A;  2Z6B A;  3HOV G;  1RJT A;  1LO5 D;  2MPM A;  4DPG A;  4XOR A;  3VYR A;  2EXZ A;  2KHI A;  4XXE A;  3BNW A;  5A8A A;  4DK0 A;  4OL7 A;  1VQG A;  4F87 A;  2W6J A;  1Q86 C;  2ES2 A;  3AGQ A;  2Q2U A;  1KD1 C;  2R93 B;  4OWW B;  3KBX A;  1M4V A;  2D0P A;  1QCB D;  5C44 B;  2F0K A;  2XIW A;  3GD7 A;  1AFP A;  1OXS C;  3FP9 A;  1MSH A;  4A3B G;  3NQT A;  2CHB D;  5ELF A;  1TR5 A;  4OHJ A;  1X3E A;  3M4O H;  2B5O A;  4CJ2 C;  1JQY D;  2EJF C;  4EQO A;  2YTY A;  2EJG C;  1O7I A;  4AYB E;  4JBJ A;  2WR8 A;  3CMM A;  3M7N A;  3E6Z X;  3W2E A;  4DNT B;  3GP7 A;  3V76 A;  1EXM A;  5IGE A;  1EYC A;  3F1Z A;  4WZT A;  2GPJ A;  4KKS A;  5ELC A;  4DUY Q;  1UWV A;  4AIM A;  1SKQ A;  1PTO F;  5CR3 A;  4LF6 Q;  4XKV A;  2CW5 A;  3JU4 A;  2BDO A;  2B2Y C;  1VCI A;  1O7Z A;  2XND A;  2F1L A;  4K2L A;  4WRD A;  1AE2 A;  5J3B A;  1STN A;  4G7X A;  2O2L D;  1S3O A;  5E7N A;  4G1B A;  3ONU A;  3HP3 A;  1VQ6 A;  3JAM E;  4C0S A;  1N34 Q;  2L55 A;  3ASP A;  4A3E B;  1S72 A;  3K57 A;  4R1J A;  2WB1 B;  5I4D A;  5HGQ A;  2EIX A;  2JE6 I;  2BF4 A;  1KK0 A;  3E9H A;  1JWU D;  3SK5 A;  5FJ8 G;  5JEA H;  3G7L A;  1LTI D;  4Z4V A;  3D0F A;  4KKU A;  2WP8 J;  1SSO A;  2MUY A;  4QMG A;  3LQE A;  4XNF A;  2A68 C;  5IT9 c;  3EFX D;  1I4G A;  4HR7 B;  2R3Z A;  2HIX A;  2RKS A;  1J5E Q;  1BQE A;  1SNQ A;  5HUR A;  3W3A A;  5C5L A;  2B63 H;  1SYC A;  5E4W C;  1PJ7 A;  2XWB B;  5FLM H;  1HVX A;  2ZZF A;  3VR3 A;  4QV2 A;  1B3Q A;  1I3Q B;  4NBS A;  1NE3 A;  4NW2 A;  4Z4R A;  4AYB G;  1STY A;  2X6X A;  4C3I H;  1EY8 A;  4A3K B;  1L0W A;  1PV4 A;  4B44 A;  5LL6 S;  3I4L A;  4NDX A;  5A88 A;  1I8D A;  1F2L A;  1CHP D;  2BGI A;  1SMY C;  3CPW A;  3QSY A;  4LC0 A;  1Q7Y D;  2UU9 L;  2OQK A;  1SJE D;  5FO0 A;  4G4K A;  3CP0 A;  2F0O A;  1EY7 A;  5GAG C;  3U9S A;  3SK8 A;  4A3L G;  2SOB A;  2Z4H A;  4BBS B;  1S5D D;  1D1I A;  5AN9 A;  1YNJ D;  4J6H A;  2ZXP A;  2V4D A;  4DAY B;  2NBF A;  3S24 A;  2IX3 A;  4ME5 A;  4YAL A;  3KOJ A;  4FN5 A;  5M3M G;  2WYR A;  1EY9 A;  1K73 C;  3Q39 A;  3CC7 B;  4DK6 C;  2RHS B;  1WYD A;  4FF1 A;  1BMF A;  4HMJ A;  1ENA A;  2VUM G;  2A8V A;  1EP3 B;  2HT1 A;  4HIO A;  3CCU A;  5IGF A;  2VJJ A;  3FRP B;  2BN4 A;  1WOR A;  2ZTD A;  2R9V A;  1TWA B;  4ZUI A;  1S5C D;  1U4R A;  4LF4 L;  4DR2 Q;  1UD3 A;  1EY0 A;  4C3H B;  5EBD A;  1WPC A;  5TRD A;  3GSI A;  4KN7 C;  2E1R A;  1PTO D;  1KK2 A;  5CC4 A;  4H9G A;  3TS2 A;  1K9M D;  3J7Z C;  3PVD A;  4YXW A;  1VQA A;  2JA7 H;  5C4X B;  1EFC A;  1SYF A;  4N3N A;  3H09 A;  3GVL A;  1JJ2 A;  5E4X A;  4E6I A;  4JBM A;  4DR4 L;  1KMH A;  1YIJ B;  1VQN B;  2D74 A;  2DY7 A;  2NVX H;  1PZI D;  1UUP A;  1C9O A;  3LWE A;  4JK1 C;  5ELN A;  5C4J B;  1YHA A;  4DV4 L;  4A3D G;  4IFD H;  4DXF A;  3BZC A;  4DAV A;  2B7C A;  1T6Z A;  1HR0 W;  2NPF A;  2WZN A;  3HG9 A;  4Y9R A;  4ZKC B;  1K83 B;  3OZU A;  1OB0 A;  4FWT A;  2WV6 D;  3IAY A;  1KQS A;  4DK1 A;  4RGT A;  4LF7 Q;  1V43 A;  2KCT A;  3R6K A;  2X0K A;  3PIO 3;  2RBM A;  5IYN A;  3K58 A;  4H7B A;  4HJA A;  1KDA A;  5K36 H;  1DDI A;  1CM9 A;  1VF5 C;  4AF6 A;  4RJL A;  4BBR G;  2RSO A;  4YAO A;  1XQB A;  1B7Y B;  5D3I B;  5I2X A;  1KIX A;  3HOX B;  4XYO A;  1TS4 A;  4JYA Q;  1CKM A;  4HJ9 A;  3DEO A;  1HRJ A;  3NUC A;  1IBL L;  4WOR A;  1GM5 A;  1K28 A;  3ND9 A;  4OON A;  2F3I A;  2X8K A;  3FDT A;  3TS0 A;  5J1Z A;  1KDB A;  1TS2 A;  4A93 H;  3M4O B;  2F4I A;  1PDQ A;  2EY5 A;  4IUT A;  4LK1 C;  2NVY B;  2XNA C;  2VNJ A;  1FJG L;  3HFZ B;  3BC9 A;  1XFO A;  3CCQ B;  1WVL A;  4NXN Q;  5BR8 L;  1EZ8 A;  4FNF A;  2EOT A;  3G71 A;  2B7B A;  3Q38 A;  4DR7 L;  4A3C G;  2QKI C;  1IKL A;  3QFT A;  1A15 A;  3PO2 H;  4AQY Q;  3OP1 A;  5C0X J;  3G6E A;  2JA5 B;  3I4O A;  3GTL B;  5A2Q L;  5CV7 A;  3J80 L;  3J81 j;  2DN8 A;  1ZM3 A;  1JNY A;  2ZBU A;  4UZF A;  3CCE B;  3WNC A;  2E75 C;  2KEC A;  3I2Z A;  4LW1 A;  3RUZ A;  1HZA A;  4DV3 Q;  1IZ6 A;  2M9V A;  2L15 A;  3A8J E;  2JP1 A;  4KK7 A;  4H44 C;  3PF5 A;  1Q82 C;  2VNI A;  3GV3 A;  4UZU A;  1T5X D;  4XDX A;  1VQM B;  4BY7 G;  1SND A;  1S5F D;  3S2D H;  1SBB B;  4UAI A;  3OWE B;  5IOD A;  4IUU A;  1I4H A;  1NR2 A;  3FPU B;  1BPL A;  4B3T L;  4A3G H;  1VQ4 A;  3GTQ B;  1HNZ L;  1EP1 B;  2PE3 A;  1WFQ A;  3E1Y E;  2B2V C;  5IYR A;  2EYH A;  4A3J B;  2NVT H;  2OK8 A;  1FNV A;  4KD3 A;  1OXT A;  2QA4 A;  1W9X A;  3UI2 A;  1X3G A;  1SE3 A;  3ONY A;  4HE5 A;  2HDL A;  4CJ1 B;  5I2Y A;  1ICF B;  3A7L A;  3LX0 A;  1VQK A;  4X62 L;  1TWG B;  2JK8 A;  1IL2 A;  1GO3 E;  4U67 3;  3WXM A;  4G57 A;  1CTM A;  2F0M A;  3W1B A;  5C3E G;  2HHH L;  2K05 A;  3HKZ B;  1JIC A;  4DR1 L;  2B63 B;  1IXR A;  2VY3 A;  1N08 A;  4JBW A;  2Q8I B;  1QGY A;  1YIT B;  4BXX H;  4FF3 A;  4JPB W;  4QY7 A;  4G7Z C;  4C3I B;  4PZ8 A;  4EQ5 A;  3H0G B;  3TME A;  4ZUJ A;  2M5S A;  4IFD I;  1KDC A;  3CME B;  3K59 A;  3UDI A;  3Q24 A;  1PYW D;  3J81 i;  4TRD A;  3BY2 A;  5IYB G;  3V7A A;  1EU4 A;  1U9R A;  2SDF A;  2H4O A;  1RQR A;  3A8I A;  3CHB D;  1YJN A;  2F52 A;  3WYA A;  3BDL A;  4DUZ Q;  1HNW L;  2QEX B;  3QG1 A;  1K3B C;  2XRS D;  3F2B A;  3AVV A;  1JWS D;  4OWT B;  4B3M Q;  1SN8 A;  3GTK B;  1QH0 A;  3MXU A;  5DN6 A;  1EQT A;  2XGT A;  3NSW A;  3M7G A;  2IL8 A;  4YWK A;  1PFM A;  1XNR L;  3C46 A;  1H8H A;  4DA2 A;  4X64 Q;  5ELD A;  5IP7 G;  2PW5 A;  2VYQ A;  5HKK A;  1ROD A;  4K8I A;  3KLS X;  4HMI A;  1Q3L A;  4L5R C;  1WOO A;  2F3V A;  2JIZ A;  5T1I A;  3N52 A;  2K52 A;  2PCF B;  2ZTG A;  2M00 A;  2FMC A;  4JC0 A;  3OEE A;  1VQ5 B;  4HSP A;  2R7Z H;  1BDO A;  3D6C A;  1OGI A;  2F0F A;  3W2F A;  1BCP F;  2WB1 E;  1W87 A;  3PSI A;  4XLA A;  1CNE A;  3A0J A;  2K01 A;  5LMU L;  1EY6 A;  5JEA J;  4J1M A;  1M90 C;  3BYT B;  4DN4 M;  3LGJ A;  2VQF L;  5C44 G;  2PQA A;  2AUJ D;  4R9W A;  2NVX B;  4A3M H;  4KHP Q;  3CQZ H;  3ZZT A;  2CKZ B;  1MJE A;  1HA3 A;  3VA5 A;  2JJ1 A;  1E2V A;  2OK7 A;  3QFC A;  1MAB A;  4OIJ A;  1VHO A;  1D6E C;  1FGU A;  3JC6 6;  4IOC A;  1JJC B;  1E3X A;  1P16 A;  2XNJ A;  3E0J A;  4KN4 C;  4II2 A;  3W5V A;  2J4X A;  1D8T A;  4O0A A;  3S16 H;  1PFN A;  1TQO A;  2K5Q A;  1OB2 A;  4XMY A;  5IYP A;  2GA4 B;  2X69 A;  3I55 A;  2J7K A;  3UE1 A;  1DOK A;  4CDD C;  1ZXT A;  3D4D A;  4P2N A;  2KCM A;  4HID A;  1IBK L;  3OW2 A;  4IO9 A;  3I70 A;  3J81 c;  1PJ6 A;  2K5W A;  3VR2 A;  5BN3 A;  5EPL A;  4YWM A;  1UE6 A;  2C4T A;  1YVC A;  1EYA A;  1W6K A;  2WJY A;  1WCM G;  4P75 A;  2LKV A;  3NHH A;  4C1N I;  3J80 E;  1L2F A;  3MXN B;  1Y1W G;  2OWO A;  3ISX A;  1Q8K A;  5GAE C;  5CMD A;  3MEH A;  1RD9 D;  1B50 A;  2Z6K A;  2WB1 G;  2MO1 A;  2F0P A;  4QIW B;  3Q6Q A;  4IPG A;  2F43 A;  3C1E A;  3PO2 B;  4OO1 H;  2V7T A;  2F3W A;  1VDZ A;  1PXU A;  4JW0 A;  2PLF A;  4OPV A;  5GQO A;  3BDC A;  2QN6 A;  1XMO L;  3SK4 A;  5EAY A;  1KHI A;  4JI2 L;  1EOV A;  1IYV A;  4P12 A;  2LXJ A;  1VQ9 A;  1SYD A;  1GOZ A;  1FNC A;  3AYH B;  1KC8 C;  3TDQ A;  4RDL A;  4YHH L;  4RGM A;  3B8H A;  3E5S A;  4PMW A;  1AW7 A;  2OQ0 A;  2ZM6 L;  4JI4 L;  2D62 A;  1F60 A;  4QUC A;  3DEP A;  5FK9 C;  1HZB A;  4IPC A;  2A6H C;  4B3X A;  1BX1 A;  3MAQ A;  4IJL A;  3TN2 A;  4POF A;  4A3K G;  3KEW A;  5IIF A;  1TWF H;  1JOK A;  1UEB A;  2X6L A;  2NVT B;  3SEB A;  4Z4Y A;  1CKO A;  3TBI B;  2YWG A;  1KAB A;  4RDJ A;  2F0D A;  2FMM A;  4M1U B;  1CA6 A;  4QJF A;  1NTG A;  4CKE A;  4CDC C;  4DF7 A;  1KLU D;  1I6H H;  4XD7 A;  2BA1 A;  1EQR A;  1GUN A;  5E6T A;  1O7L A;  2UUB L;  4WJ3 M;  2WSS A;  3O13 A;  4RFB A;  1BO0 A;  2C35 B;  3ZYY X;  3TP6 A;  1Q1E A;  1C8C A;  2JN9 A;  1LT4 D;  3VYU A;  1F20 A;  4RD4 A;  4BS9 A;  1ZM2 A;  3Q22 A;  2DEU A;  2UU9 Q;  3PF4 A;  4HED A;  4DR6 L;  4DR3 L;  4HCS A;  3OSO A;  2J7Z A;  1D2B A;  2PIA A;  1COW A;  1VQI A;  3CPX A;  2ZXI A;  4TMZ A;  2PMZ E;  2F0N A;  2RDG A;  1OXX K;  1Y1V H;  4A3F B;  4C3H G;  2JQO A;  1ASY A;  3OYY A;  5B6I A;  1FVI A;  4YCV A;  3PIO A;  2QDB A;  4X7C A;  2BVN A;  4KY7 A;  5EMN A;  3SGI A;  1PZJ D;  3U50 C;  2RA4 A;  1PLF A;  3I4M B;  2E8G A;  3H3V H;  2V7V A;  4LF5 L;  2KHJ A;  3ZZU A;  5C4X G;  1CT1 D;  1XNQ L;  4HCE A;  4ODG A;  1JR0 D;  1VQ6 B;  1T5E A;  3A5Z B;  3MA2 B;  3P75 A;  3BY1 A;  4LF4 Q;  1S72 B;  1PH5 A;  4GQN A;  1XPU A;  1QGZ A;  1JB9 A;  2K04 A;  4IOA A;  3I8Z A;  4DV2 L;  1X3Q A;  4A4I A;  2KBN A;  5E3F A;  3QR8 A;  1I5F A;  3ULP A;  3WY9 A;  1E0B A;  3I90 A;  4WZE A;  1DON A;  3I4N H;  1F9P A;  1UAP A;  3S1N H;  1O78 A;  2V7U A;  1UD4 A;  1VQD A;  1W34 A;  3FPK A;  2R7Z B;  2QGG A;  3I3C A;  4R4T A;  2HDM A;  3KLS A;  4OO1 I;  3LNN A;  4UPA A;  4DR4 Q;  2AHO A;  2F0U A;  2F4V L;  4ULL A;  3I7F A;  4GNX A;  3M3Y H;  1T9H A;  1HQM C;  3KL9 A;  4ROX A;  5FA6 A;  3U58 A;  2LS0 1;  3OJW A;  1B70 B;  2VB2 X;  1OB5 A;  4DV4 Q;  2DYI A;  1E24 A;  4PMC A;  4X3T A;  3OW7 A;  1SE4 A;  3HOX G;  1EQQ A;  4EQP A;  5JOB A;  5T1G A;  4FYD A;  4KY6 A;  4IW3 B;  1XB2 A;  1EP2 B;  2RCN A;  5LMN W;  2C9O A;  3S1Q H;  5LMZ A;  3CPW B;  4X3U A;  3S2H B;  1MBY A;  3CQZ B;  4JI0 Q;  3GVK A;  3K5N A;  1U4P A;  3HZX A;  3SHL A;  5IWA L;  3G6J B;  2PW7 A;  3J80 c;  2EJM A;  2WPD A;  3BDO A;  1VF7 A;  4K0K L;  1JOR A;  1D5M C;  3GTJ H;  2ZZQ A;  3S16 B;  5CBA E;  1IL8 A;  1EFT A;  2R6H A;  4PC2 A;  5BSX A;  1IBL Q;  1WOC A;  4YEJ A;  4EQN A;  3AEV A;  4CKC A;  5EGT A;  1V5V A;  2OTL A;  1L1O A;  2V1C C;  3L7Z C;  1AIP A;  1E43 A;  4OOS A;  5GV7 A;  4MTK A;  1JA1 A;  1FJG Q;  4P72 A;  2JDI A;  1H9R A;  5BR8 Q;  3PMF A;  5CGK A;  3CCU B;  4DR7 Q;  4R71 A;  2MP1 A;  4HIZ A;  1PRT D;  4M8A A;  4C2M B;  3HOZ H;  5C5M A;  1U4L A;  1D2E A;  4B9W A;  1H9K A;  1GVH A;  2C77 A;  4KY5 A;  2RC5 A;  1PJ5 A;  4NNJ A;  4EH1 A;  4CDF C;  2X3U A;  4A3J G;  3SLN A;  3VDY A;  3ITP A;  3TZU A;  4LFB L;  5M5W B;  3KF8 A;  4M2L A;  2DNE A;  4N9T A;  4KMU C;  1M1K C;  1KAA A;  1J9O A;  5C4H A;  2PZT A;  3X3M A;  4X8I A;  1FD7 D;  3BS1 A;  1JJ2 B;  2OT2 A;  4GZY C;  2E5L L;  2KEN A;  4PG3 A;  3I56 A;  1UNS A;  5J3O A;  1KTV A;  4DFA A;  1PA6 A;  4TVA B;  1NSN S;  1RL2 A;  4B3T Q;  3TRZ A;  3BH4 A;  5DEH A;  2F0W A;  3ER0 A;  1E64 A;  3HKZ G;  4X3S A;  1HNZ Q;  3K5O A;  2B63 G;  4YWL A;  3ASQ A;  3ASS A;  1LV9 A;  4HN7 A;  5FLM G;  3GTP H;  1WTR A;  2OF1 A;  1BBW A;  2K50 A;  1E62 A;  1PTO H;  4C3I G;  1VMP A;  4FP5 D;  4ZK9 B;  4TSS A;  1KQS B;  2QCP X;  4X62 Q;  1Z7T A;  3H0G G;  2ZXO A;  2DER A;  1WTO A;  1MJC A;  3W2H A;  3EIV A;  3ULJ A;  2UXB L;  2IJ0 A;  4IPH A;  1ENF A;  2WKD A;  1Q7Y C;  2HHH Q;  2WAQ B;  4X66 L;  1IHZ A;  1HH2 P;  2YTV A;  2A19 A;  4DR1 Q;  1LTR D;  3DWQ A;  3Q6S A;  2K32 A;  4DXG A;  3CRK C;  1B9M A;  4C56 C;  1WTX A;  1N8R D;  1TLL A;  4LMQ D;  1U5K A;  3EA6 A;  1N0U A;  3PUX A;  2MO0 A;  1W2B B;  3R93 A;  1YNJ C;  1SFO H;  1Y0R A;  3SR1 A;  1KK1 A;  2C5H A;  1Q12 A;  4FXK C;  4JBK A;  1XPO A;  2ZJQ A;  1HHV A;  2EY6 A;  4GKK L;  4Q7J B;  2HDN B;  4WQM A;  5AJ3 L;  2PPB C;  2YTX A;  1VMC A;  4GN4 B;  2ZZE A;  2EYM A;  1CQV A;  4L8J A;  1EOT A;  3G71 B;  1JCK B;  1OXU A;  3EQL C;  4BA2 I;  3AVX A;  5JJZ A;  2JJ2 A;  1WCM B;  3G6E B;  3Q8D A;  4FDB A;  1Y8O B;  4ZAI A;  1A0I A;  2ZTC A;  1HNW Q;  1I7P A;  1WDT A;  1Y1W B;  4PC1 A;  2A6E D;  5C0X I;  4Z1M A;  5TSS A;  4X65 L;  2C4U A;  1Q8I A;  2VBT A;  4GLA C;  2CBX A;  2JEA I;  4RCY A;  1V0E A;  2Y0S E;  1HFG A;  4YAW A;  4QIW E;  1XNR Q;  3PV0 A;  1V0F A;  1PTO C;  1V1O A;  3VYS A;  2QDL A;  4Z4T A;  1UEA B;  1LUZ A;  4LF8 L;  4GS3 A;  1K9M C;  4IUN A;  5F2D A;  3LO8 A;  2RDH A;  1DXM A;  4OXP A;  4AF7 A;  1VQ4 B;  4PC7 A;  3F8T A;  4MNO A;  2ZL5 A;  1LT6 D;  4II3 A;  2XGJ A;  2AMC B;  5CDF A;  2E2H B;  1AE3 A;  2I0Q A;  4FXU A;  3RN2 A;  2Z1C A;  1GUW A;  4ZGN B;  4UP9 A;  2B8F A;  2QA4 B;  1QOH A;  4KJO A;  1X65 A;  4IFD G;  4NXM L;  1LLR D;  3STB D;  4PZ6 A;  3I4N B;  3S1N B;  1B44 D;  1TII D;  2DOG A;  1VQK B;  4G1V A;  1WJJ A;  1MHW C;  4NPS A;  3MXP A;  4O42 A;  2NTS A;  4RHR A;  3CC4 A;  5LMU Q;  4BPR A;  1VJS A;  4KD4 A;  3CXC A;  4QUZ A;  2K03 A;  4YCW A;  4J8Q A;  3HOW H;  5LL6 X;  1QVG A;  1E1O A;  2VQF Q;  3MHB A;  4B3S L;  4IJH A;  3R3O A;  3CB4 A;  3W2I A;  4UZE A;  2PI2 A;  3KJO A;  4HSV A;  4X05 A;  1X55 A;  3NPP A;  2Z6K C;  4IN3 A;  2JSO A;  3CCL A;  2CH4 W;  2AUK A;  3GV6 A;  2BM1 A;  3CPF A;  3MWY W;  1VQF A;  5LMN L;  4O2D A;  4YEL A;  3KK7 A;  2NV4 A;  5CV6 A;  1XYI A;  1E2W A;  3OOC A;  5HZB A;  4X0C A;  3JAM i;  4IZ8 A;  2OYN A;  1YHQ A;  2CCZ A;  2XZP A;  1W0K A;  3A8K A;  1WTV A;  1B23 P;  4NKL A;  4UY8 C;  4EVO A;  1A63 A;  2O5I C;  2JA9 A;  3H91 A;  4IUV A;  3AB9 A;  3AVY A;  1A62 A;  1YJN B;  5A89 A;  1ESF A;  3L9A X;  2ZIT A;  1V1P A;  2Y0S G;  5ELE A;  2P5Z X;  1IBK Q;  2XEX A;  4LNQ A;  1HCZ A;  4GKJ L;  1E63 A;  1LTG D;  3PO2 G;  2W6I A;  1NBW A;  1W6J A;  3JQQ A;  1SNO A;  4B3G A;  2A5H A;  2V7Q A;  5I6W A;  3P26 A;  3ASR A;  2K14 A;  4TMX A;  5GAD C;  5FOB B;  4KHV A;  4R4O A;  4O1N A;  3SKB A;  3WWV A;  2AQ1 B;  1HPC A;  4N9P A;  1EY5 A;  1QNU A;  1KNA A;  1XMO Q;  4A3G G;  1U4M A;  5F4M A;  2JA8 H;  1TTT A;  3L3O C;  4JI2 Q;  2AQ2 B;  4B08 A;  3AGP A;  1WU8 A;  1DOM A;  5CYU A;  4ZLT F;  4L6T B;  1G2S A;  2VNH A;  4A3I B;  2NZH A;  1LTB D;  2KUM A;  5IGC A;  4R4I A;  4U9U A;  1VQO A;  1UD6 A;  4YHH Q;  2GK6 A;  1DYQ A;  2QIL A;  3CC2 A;  2HQE A;  2ZM6 Q;  4JI4 Q;  3Q0A A;  4JI0 L;  1GUT A;  3WOF A;  1NRK A;  2LFN A;  3IFD A;  3OFN A;  5TR9 A;  2PQA B;  4QL5 A;  4B9X A;  1C7Y A;  3NXW A;  1QVF A;  3BVM A;  1MKH A;  1VLO A;  1Y8N B;  4I7A A;  1FNU A;  2EPB A;  2D5D A;  5KYL A;  1IW7 D;  3CCS A;  3H6M A;  1II3 A;  1W2B A;  2QE7 A;  4ZGQ B;  1CQX A;  2BE5 D;  2YV5 A;  1SXT A;  2NVQ H;  2UUB Q;  2PMZ B;  2QTZ A;  2EYO A;  4RD1 A;  3FKS A;  3I55 B;  4DV6 L;  2SEB D;  4JI7 L;  5IGD A;  3CCV A;  2PI2 E;  4GOP A;  3OIQ A;  4A3F G;  3JAM c;  4WZL A;  3OW2 B;  1G29 1;  1E2Z A;  1WD1 A;  4YHB A;  4P3I A;  4TMT A;  1JA0 A;  3CRL C;  4JMQ A;  3T16 A;  4DR6 Q;  2VQE Q;  4I65 A;  1K8A D;  3BZK A;  2ZT9 C;  1I4Q A;  4DR3 Q;  3P1H A;  4P73 A;  1K73 D;  3I4M G;  3BVZ A;  2K6A A;  3F2D A;  2SNS A;  2RQX A;  3KF6 B;  3QOJ A;  4GNX C;  1M8A A;  5JBQ A;  3CW2 A;  1ZYR D;  3A8K E;  2ZXH A;  3ERQ A;  2P3M A;  4X06 A;  4JI6 L;  2BMW A;  1B53 A;  5FLX E;  3LVB A;  4P71 A;  2ZZG A;  1K8O A;  3RZD H;  1JB7 A;  2QMU A;  2NN6 H;  3W2G A;  4YCU A;  4CKB A;  2ZBV A;  1K8M A;  2MHV A;  5IYD H;  5KIX A;  3T13 A;  1ESR A;  2E1B A;  1D5X C;  2RC6 A;  3J81 k;  4Y7C A;  2RVL A;  2WII B;  1BF4 A;  4LF5 Q;  2R7Z G;  1F2Z A;  1VQ9 B;  1VQ8 A;  3OTO L;  1XNQ Q;  4LFA L;  2FIN B;  1R5B A;  4KJN A;  1JE4 A;  2TSS A;  3TP5 A;  3WBK A;  3AMU A;  2AKW B;  2IW3 A;  1AZP A;  3QE2 A;  4DV2 Q;  4GN5 A;  3ZUG A;  2DUD A;  2G9D A;  1HXY D;  3OKX A;  1D7Q A;  4U68 A;  4PNY A;  5KSW B;  1L1O C;  4A3M G;  3PUM A;  4A3D H;  5D65 A;  3UDG A;  1QGA A;  5M5Y H;  1EQV A;  1LT3 D;  4RA8 A;  2F4V Q;  4GLX A;  2F0L A;  4DAP A;  1EWH A;  2JN4 A;  4LUZ A;  1SLJ A;  2L9H A;  1YJW A;  2DIE A;  4XN3 A;  3A56 A;  3UDX A;  3VR5 A;  1F77 A;  1TS5 A;  2LMC B;  1N06 A;  4HTH A;  4K6D A;  3KJP A;  4X7F A;  3HOW B;  3BVG A;  4OEM B;  4TQU S;  3OHX C;  3S15 H;  2WAQ E;  2QEJ C;  4BBR H;  1G6P A;  4JV5 L;  2Z8L A;  4K2K A;  1TY0 A;  4QCL A;  4JI1 L;  4Y52 H;  2OXP A;  2RSN A;  5IWA Q;  5IP9 G;  4P3Y A;  2AQ3 B;  1I50 H;  4K0K Q;  2KOL A;  4LUV A;  1TY2 A;  4P9S A;  4RGO S;  2O4X A;  4RHS A;  1Q46 A;  1BVS A;  5KRU A;  4MTN A;  2E2I H;  4QFM A;  2GVA A;  3SVM A;  4AC9 A;  2HQL A;  2XTI A;  2XNC A;  5H1S E;  1WTQ A;  2ID0 A;  4PZ7 A;  5ISR A;  3BU2 A;  2EFG A;  4XTC S;  4OO1 G;  3T1H L;  2EY2 A;  5E1F A;  4E0F A;  1E3P A;  2UXC L;  1Q1B A;  3OEH A;  2F0J A;  3S14 H;  4LJZ C;  2VL6 A;  4Z9C B;  4XQN A;  3WOE A;  5GAH C;  1DZ1 A;  5IGG A;  1SEB D;  2JJQ A;  2JA7 B;  3G4S A;  1ZEQ X;  4ZV4 A;  4LWC A;  4LFB Q;  3AFQ A;  3HOU H;  4G7O C;  4P22 A;  1OXV A;  2EQS A;  2JA6 H;  1B4O A;  2JA8 B;  5JJL A;  2NN6 I;  1HR0 L;  1H95 A;  2R92 H;  4HAE A;  2E5L Q;  2YWE A;  1SAP A;  2AHO B;  1KL9 A;  2CH4 A;  4GNX B;  2B3G A;  2WAQ G;  1FGB D;  3CRZ A;  1RDP D;  1YJ9 A;  2ZTN A;  2K28 A;  1WOS A;  4TT3 A;  1QZH A;  2EDG A;  3AVT A;  2NB0 A;  4LUO A;  4FXD A;  3NTH A;  4JI5 L;  4TMV A;  1B1Z A;  2I46 A;  5C3E H;  3Q3A A;  4ASU A;  4OIK A;  4CBV A;  1SRU A;  3R8B A;  3FJO A;  4OP7 A;  3FHW A;  1JOQ A;  1QWY A;  2UXB Q;  3BJU A;  1G7R A;  3DWP A;  3R2I A;  2KQ3 A;  1NB9 A;  1ICW A;  4X66 Q;  2E74 C;  2G5D A;  4KHZ A;  4PV1 C;  1EFU A;  2KA7 A;  2NVQ B;  4XOT A;  3A3B A;  1BLI A;  1GO2 A;  4A93 B;  3KF6 A;  2NWG A;  3TP8 A;  1GJX A;  3GTO H;  1GUO A;  1STG A;  1PH1 A;  1Q81 D;  1NY4 A;  3TQY A;  2OTL B;  2Y0S B;  3PUW A;  1QFY A;  1L1O B;  3X3N A;  1VQH A;  3A8I E;  4GKK Q;  5AJ3 Q;  5IK2 A;  1WTW A;  1XPR A;  3PIP 3;  2IY5 B;  2K33 A;  2Z6B D;  1PZK D;  2BCO A;  1U0L A;  1HTP A;  4PAA A;  4DQK A;  3PA1 A;  2SNM A;  5CV8 A;  2A73 B;  1BOS A;  3CU7 A;  1LTT D;  3TP7 A;  5ELO A;  4X65 Q;  4MN3 A;  4DR5 L;  1UD2 A;  3S2D B;  1DGS A;  1E1R A;  2K7V A;  3RZD B;  3ES9 A;  1DJR D;  1NB0 A;  4RD3 A;  1CFM A;  4LFC L;  3S1R H;  1TVC A;  1D8L A;  1TS3 A;  2BSA A;  3ZBT A;  4HE6 A;  3KF8 B;  1IKM A;  1VQP A;  1MRZ A;  2FXQ A;  4A3G B;  3I4N G;  2OBR A;  1O80 A;  2GK7 A;  4LF8 Q;  3I56 B;  2K5V A;  2DJG C;  1G7S A;  2ALY B;  1RKN A;  2RF4 A;  3U9O A;  1Y69 U;  4B3R L;  5IY0 A;  4C3J H;  1BCP D;  2M2L A;  2I07 B;  2IX1 A;  4A75 A;  2C5C A;  4OWX B;  3B82 A;  3VNU A;  2R93 H;  3PA2 A;  3S9W A;  5M3F H;  4NXM Q;  1KRT A;  3OZW A;  5C44 H;  3QFR A;  3J80 i;  2CC2 A;  1A3U A;  1J6Q A;  2IHE A;  4XT3 B;  1L0X B;  2R61 A;  1QX4 A;  1B2R A;  3SJZ A;  2N3S A;  1WD0 A;  4LF9 L;  5M5Y B;  4B3S Q;  3I73 A;  4IPD A;  2I1L A;  2F0E A;  2VQE L;  2VBU A;  5JPN C;  5C0X G;  1NUC A;  1UE1 A;  3OWF A;  1CUK A;  3QWN A;  2KEE A;  2CW0 D;  4WJW A;  5LMN Q;  1X6O A;  3HGB A;  1X3F A;  1N36 L;  1I94 L;  2WAC A;  3GVJ A;  1HFN A;  4P6V F;  3VA7 A;  1ET6 A;  3A3G A;  1RHP A;  4P6Y A;  3DMU A;  5COR A;  4PQX A;  1S4M A;  3E9I A;  4ZRZ A;  1GJR A;  2MNA A;  5DSZ A;  5F4J A;  3T1Y L;  2K5N A;  3G48 A;  3W1G A;  4NP5 A;  2H1E A;  1NJI D;  1BX0 A;  4DQL A;  2XZL A;  3ICE A;  1NNX A;  3HS0 C;  2Q2T A;  1I50 B;  4XIG S;  1WOP A;  4GKJ Q;  2ASB A;  1HUN A;  4M0L A;  1PH7 A;  1PRT C;  1QUQ A;  2EYL A;  4A3E H;  2HD3 A;  2EXD A;  2DY1 A;  4K5X A;  1EIF A;  1CZG A;  1YI2 A;  1ASZ A;  3HOY H;  4A3I G;  4H13 C;  1RTN A;  2JEB I;  1G7T A;  2CRV A;  5NUC A;  3CCR A;  4B47 A;  1PYS B;  5EJW A;  4RM0 A;  3NWT A;  1SYB A;  1HQR D;  4LBY A;  3AVW A;  4K14 A;  2MGS A;  3ZIA A;  3NEN A;  3S14 B;  2B2T A;  1EIG A;  3D3R A;  4XN0 A;  4FO2 A;  4I7Z C;  1V9P A;  4GOP C;  4J15 A;  5D3D A;  4BWG B;  3RZO H;  1MI2 A;  4MHE A;  1AMO A;  1R5O A;  1I3Q H;  3CP2 A;  2KVM A;  2N78 A;  4M1K A;  3HOU B;  1PH2 A;  4RDK A;  4A3K H;  2C2W A;  3OPO A;  1F9R A;  3M4P A;  2AWO A;  3CC4 B;  5EPJ A;  4NB3 A;  3TEH B;  3WDN A;  5L37 A;  3WBJ A;  2VZA A;  4A3M B;  2X53 S;  1WI5 A;  3CXC B;  5FO1 A;  1P4M A;  1X56 A;  2F0H A;  1TVX A;  4KV6 A;  3SDZ A;  1QVG B;  3CW2 C;  3UE0 A;  1ZM4 A;  1FRQ A;  4XQF A;  2D9U A;  1TXY A;  1JE5 A;  1YEZ A;  4IUR A;  2B39 A;  4QVJ A;  2A69 D;  5IT9 E;  3CP8 A;  3CCL B;  1ILQ A;  2UXD L;  4XOP A;  3H3V C;  1ZUN B;  4BBS H;  1D1K A;  1MGS A;  3FPP A;  3VO2 A;  3PUY A;  1AH9 A;  3GTM H;  5IYW A;  1N8R C;  4XLH A;  1YHQ B;  3DUZ A;  5DS0 A;  4L5S A;  4C43 A;  1H9S A;  3GTG H;  4RAU C;  1AP0 A;  4QB4 A;  4P26 A;  4B4D A;  4DV1 L;  2WFW A;  1H9J A;  3SEJ A;  1GVP A;  5IOC A;  4DV6 Q;  1HNX L;  4JI7 Q;  3EBE A;  1C48 A;  3TRE A;  3T56 B;  3GO5 A;  1V1P B;  1HZE A;  4ALP A;  2XSC A;  2Z4I A;  1IB0 A;  5BN5 A;  1EFI D;  2EE1 A;  5IYC H;  4YY3 L;  4CDE C;  1BXT A;  2K1B A;  1TWA H;  3R6J A;  1LTA D;  5C6A A;  4AVZ A;  5HZA A;  3QJY A;  4Y7N H;  4C3H H;  4DV0 L;  2A6E C;  2G9H D;  4RLZ A;  1G7C A;  1EEF D;  2XZO A;  3A7A B;  1PMR A;  3DM1 A;  4RCZ A;  5JEA G;  4KKT A;  2WKC A;  5JJI A;  4JI6 Q;  4XON A;  2EYJ A;  4AH6 A;  1N05 A;  1R4Q B;  2F0G A;  3V2T A;  3W5U A;  5C4X H;  4TKO B;  3NE5 B;  1G51 A;  3PUN A;  3LWU A;  4DNR B;  1TT2 A;  2Z0S A;  3C1F A;  2GRE A;  4RPB A;  4P2C B;  5C3W A;  1HUM A;  2JYO A;  2EZV A;  1FDR A;  1L0Y B;  3FKI H;  4UHV A;  2QW7 A;  3H3V I;  4ILW A;  2R6G A;  4OGQ C;  3OTO Q;  3K5L A;  4LFA Q;  1VQO B;  2D3L A;  3VR6 A;  1E3Z A;  4KI0 A;  3CC2 B;  1MSG A;  1LAC A;  1K83 H;  4ZCI A;  3BYY B;  3STB C;  3MXG A;  4B43 A;  4HIK A;  1BQQ T;  4ZCK A;  1QG7 A;  4RD0 A;  1TWF B;  1CA5 A;  4RKL A;  1A6X A;  4ZCL A;  1QVF B;  3CD6 A;  2GJK A;  3HOW G;  3KDF A;  1PRT B;  4F88 A;  4M53 A;  4C3J B;  1V1Q A;  2D2C C;  3SXH A;  1I6H B;  3RMH A;  1Z47 A;  3NBH A;  4DV7 L;  3BCF A;  1KNE A;  4ZQ3 A;  3NWS A;  3HOX H;  3CCS B;  3CCJ A;  5M3F B;  1S0U A;  1VQL A;  3K80 C;  4UDU C;  4LBZ A;  2RHQ B;  2OBT A;  1B8A A;  1A8V A;  4NMZ A;  1VQ7 A;  1SKY B;  2QF7 A;  3OMG A;  4F7D A;  2D9R A;  2VJI A;  3A1P A;  1X32 A;  3CCV B;  2NVY H;  5M5X H;  4PC6 A;  3EJI A;  4GOP B;  4LAA A;  1CNF A;  2NUC A;  2YWH A;  3C3L A;  1RF2 D;  4XQQ A;  3W5O A;  1N32 L;  4RCO A;  3PO3 H;  4JV5 Q;  2JA5 H;  3I72 A;  3VNV A;  1S5E D;  4JI1 Q;  3GTL H;  3M4Y A;  3J7A V;  3NEL A;  3SJP A;  4JI3 L;  1F9Q A;  2BH2 A;  1Y1V B;  2N8N A;  5FLX L;  3K0X A;  4JG2 A;  4G6I A;  5DNF A;  4F8M A;  4L5T A;  1NR4 A;  1Q90 A;  3PCO B;  4BY1 H;  3RD4 A;  3D26 A;  4HJ5 A;  5GRO A;  3SK6 A;  1Y8P B;  1AN8 A;  4APV A;  5JVH 3;  1BUV T;  2K5H A;  2L12 A;  3L0O A;  3DM3 A;  4S3S A;  4QQB X;  2JA7 G;  4L63 B;  2WZP P;  2ATW A;  3J81 L;  3L2P A;  1G2T A;  2UUC L;  5FKA C;  1QUE A;  2PZU A;  3T1H Q;  1KK3 A;  1SNP A;  1SM4 A;  1XTD A;  2ZTE A;  3GTQ H;  3KLR A;  4OPO A;  2UXC Q;  4A3J H;  1QUF A;  1VQ8 B;  3K81 C;  4F7X A;  5FO9 B;  2JA8 G;  3HOY B;  5J35 A;  1UD8 A;  1YNN D;  4X07 A;  1M1K D;  2YU9 H;  5HY6 A;  4C1N K;  4K5V A;  3RY8 A;  4UP8 A;  1XE1 A;  1DCZ A;  2N88 A;  2FX3 A;  4FK8 A;  4Z4U A;  3D6W A;  1TWG H;  4G7W A;  1A2U A;  2XVS A;  2IWH A;  1IBM L;  5I6Y A;  2ZXR A;  3HOV H;  3PIP A;  2VS1 A;  3MCA A;  1Q86 D;  4X3K A;  3M3Y B;  2ZL6 A;  5EPK A;  1SE8 A;  1KD1 D;  3AFP A;  5IE8 A;  1PH9 A;  5K36 G;  1HR0 Q;  3RZO B;  1ML0 D;  3CTA A;  3PEN A;  1TUI A;  4OX9 L;  2D3N A;  2X6G A;  2GJP A;  2KCC A;  3AST A;  1YJW B;  1IW7 C;  2KVO A;  1N33 L;  4QF4 A;  4A3B H;  4WZK A;  1OO9 B;  3NK9 A;  3AQQ A;  2GQF A;  3S1Q B;  4CJ0 B;  3H0G H;  2OEO A;  3U2Q A;  2BE5 C;  1HZC A;  1CHQ D;  2DNC A;  2NTT A;  2E76 C;  2UUA L;  4RD6 A;  3CCM A;  1HTL D;  4JI5 Q;  4A93 G;  3P20 A;  1VHE A;  3IFT A;  4K5W A;  2F0I A;  4IUQ A;  4P25 A;  2GN5 A;  2IPK D;  4YIJ A;  1R9T H;  5BSY A;  2LZJ A;  1STH A;  2X6Y A;  2C5B A;  1NMF A;  2V7W A;  3DWA A;  3GTJ B;  2OTJ A;  3GTM B;  1H42 A;  1T6X A;  3IKJ A;  2H5X A;  3K6O A;  5KYI A;  3OJX A;  1CKN B;  1FL0 A;  2B2W A;  4H0L C;  1WTH D;  1GUS A;  1K8A C;  1JMC A;  1JOO A;  3GTK H;  3GTG B;  5KEE A;  3WND A;  3A8J A;  3CMA B;  4MYU A;  4DKA C;  2E2J H;  3SE0 A;  1GHK A;  1ZYR C;  2BPO A;  5KND A;  3PUZ A;  2ICI A;  4WWV A;  1I4P A;  1N9W A;  1SJH D;  1STE A;  2NN6 G;  2CQA A;  4R8I A;  2DGY A;  2FJ2 A;  5IYD G;  3HOZ B;  4RPD A;  2J0T D;  5EBC A;  3VR4 A;  2IHF A;  5EQ0 A;  2PZW A;  4Y7N B;  4PGO A;  1ONL A;  2L1B A;  5FJ8 H;  5TY0 A;  5JVG 3;  1XXG A;  1KLG D;  1KXL A;  1CZW A;  4K1X A;  2BGJ A;  4JCV E;  1Z6H A;  5K5P A;  5KNB A;  2A68 D;  3FVQ A;  4DR5 Q;  3G4S B;  1PH4 A;  4Z4S A;  1SYG A;  2VZL A;  4LFC Q;  5JPM C;  4JOI A;  3DHQ A;  3H9N A;  3NTI A;  3QB3 A;  4RKB A;  3URY A;  5CBE E;  4Z4W A;  2IX0 A;  4ZCM A;  2YYZ A;  1OGJ A;  3RLF A;  3FKI B;  1OTC A;  2RDF A;  5DM7 3;  1UD5 A;  3T53 B;  3GTP B;  4BXX G;  2XN9 C;  4EGV A;  1TWC H;  1CK1 A;  4B3R Q;  3SLD A;  1YJ9 B;  4CHT B;  1PTO B;  1HA6 A;  3K7A H;  3HEJ A;  3U4Z A;  1SMY D;  2EVB A;  2F0V A;  3GDE A;  4CQJ A;  2L11 A;  3LQ6 A;  3Q23 A;  1N0V C;  2CVR A;  2HLD A;  4TN1 A;  1EL0 A; 
#chains in the Genus database with same CATH homology
 3BZD B;  3QO2 A;  3MTS A;  4XT1 B;  3KUP A;  5KNL A;  2WIN B;  2IT1 A;  1SFO B;  1XWE A;  1KTK A;  3TSS A;  4XLC A;  2B2T C;  1AEX A;  2L0C A;  5M5X B;  4ABN A;  3KBG A;  5LHY 1;  4XR6 A;  1F9S A;  1GXD C;  3PO3 B;  3D31 A;  4V0B A;  2BDN A;  4XYQ A;  3G05 A;  2XRQ D;  5EKK A;  1EWC A;  3J81 E;  4IQZ A;  1EEI D;  2XWJ B;  4BY1 B;  2E2D C;  3TZD A;  3OAA A;  2PYK A;  1KZL A;  2N55 A;  1EZ6 A;  2F0Q A;  3MVV A;  3MFG A;  4KTA A;  3W2D A;  2VNU D;  2BOS A;  2LY7 A;  3PUV A;  2YU9 B;  5C3X A;  3VYT A;  2NYZ D;  3HOV B;  5BN4 A;  5I9O A;  3HRZ C;  5FO7 B;  2FFK B;  2B2U A;  2JXM B;  4WFN 3;  2Q8R E;  4IAL A;  4XM3 A;  2HUG A;  4A3B B;  2BA0 A;  2XOK A;  5J22 A;  4DAY A;  3GQB A;  1R4P B;  1G91 A;  1QB5 D;  3NQI A;  5JAV A;  2F03 A;  1ET9 A;  1R9T B;  3R2T A;  3QOL A;  3H94 A;  3FEW X;  2L5T A;  1NAP A;  4ZYS A;  1O7Y A;  1V8Q A;  2MJ8 A;  3A55 A;  3V05 A;  1STB A;  2E2J B;  1A3V A;  2DY8 A;  2X6W A;  4K8J A;  2ENB A;  3FMC A;  1AZQ A;  4R8N A;  4XLE A;  1C4Q A;  1I4R A;  3WQZ A;  3N6R A;  4RH6 A;  3OE7 A;  4QUF A;  1G6Z A;  1EU3 A;  5CV5 A;  5CV9 A;  2F1M A;  4G7H C;  3CES A;  1BNZ A;  3ERO A;  3BCD A;  2B2Y A;  4C3J G;  3EVQ A;  1BCP C;  2KCN A;  3IL8 A;  3A54 A;  5ELB A;  4BA1 I;  3P7J A;  1E1Q A;  1DM0 B;  1ENC A;  2K5D A;  1TU2 B;  3NTK A;  3NP8 A;  1VLY A;  5IT9 L;  1B3A A;  5AFW A;  1SDF A;  2B8G A;  4AYB B;  1TWC B;  2L4N A;  3K7A B;  5EKL A;  1EIH A;  3CKI B;  1MD2 D;  1RCV D;  2CW0 C;  3D8G A;  1QIL A;  4RGN A;  1I18 A;  1ILP A;  2EYF A;  1H9S B;  2O5J C;  1CQF A;  3D4W A;  1F2M A;  5J39 A;  1DD2 A;  1OHH A;  5M3M B;  5IGB A;  4Q5V A;  1I6V C;  4XQJ A;  5A2Q E;  1H9M A;  1QNK A;  2Q8T A;  1I4X A;  2VUM B;  2TMP A;  1JWM D;  1CI3 M;  1HA5 A;  3C2P A;  4DU9 A;  1QJO A;  1FNW A;  3DDY A;  1LTS D;  2CK3 A;  5DM6 3;  4FF2 A;  3S1M B;  5HGT A;  1LT5 D;  3MC0 B;  4RWS C;  4K6L A;  4FVM A;  1D5Z C;  5D14 A;  4RCN A;  2B2W C;  1XX8 A;  5CV4 A;  2V31 A;  4A3D B;  1DOL A;  4Q0F A;  3OIP A;  1STA A;  1JC7 A;  5FL7 A;  4IFD J;  3MFY A;  1GHJ A;  2A69 C;  4B3F X;  1XTC D;  5COY A;  3S15 B;  1EYD A;  4BBR B;  1A3T A;  2NZ1 D;  1LAB A;  4ID6 A;  2EY1 A;  5G3L F;  1NBM A;  1PRT F;  4IUP A;  1BBX C;  1W0J A;  1BCP B;  1E79 A;  1B2T A;  3MZ5 A;  4ZKB B;  1WTP A;  3DXJ C;  3K0Y A;  1RTO A;  1SE2 A;  2E2I B;  3HAG A;  5KGU A;  1GUG A;  1FR3 A;  1SYE A;  1F2Y A;  2VB3 X;  1J8I A;  3JAM L;  4FXG C;  5EKI A;  4PMB A;  2EYP A;  5KNC A;  1SNC A;  4BY7 B;  3BG3 A;  2PNR C;  2GJR A;  2AWN A;  2A6H D;  1FYC A;  1TKW B;  1PKV A;  3K5M A;  1NCV A;  2JA6 B;  1S4Z A;  3ZPN A;  2PO4 A;  4DGZ A;  5C4Z A;  2R92 B;  1QE6 A;  2WJV A;  2FHT A;  5A35 A;  3J7Y W;  4TSF A;  2X85 A;  5DAU A;  3AU7 A;  1A2T A;  3I91 A;  4FF4 A;  1IYU A;  1EFR A;  1B9N A;  2PQE A;  5C3E B;  2KJX A;  4CGY B;  2HCI A;  3T51 B;  2B2V A;  3NBI A;  3M85 A;  2F0S A;  5FO8 B;  1EY4 A;  3ND8 A;  4XLF A;  2KED A;  1TWH B;  3T4A C;  5C0X H;  1S5B D;  3S17 B;  3ONA B;  1SNM A;  4XL9 A;  3D4R A;  2KHS A;  3GTO B;  3MXN A;  3V96 A;  1H8E A;  1FX0 A;  5G3L D;  4XKW A;  3F2U A;  1X3P A;  1JB3 A;  1BR9 A;  1ZKO A;  4MIU A;  1WP6 A;  2B2U C;  5I9P A;  3QIA A;  4V19 0;  2ICE C;  2HCC A;  3S1R B;  3OMC A;  1K28 D;  5M9O A;  1YNN C;  2VXW A;  1PFB A;  2F0T A;  3A35 A;  2A74 C;  1G8Z D;  3J7A F;  1RJT A;  1LO5 D;  2MPM A;  4XOR A;  3VYR A;  2EXZ A;  4XXE A;  4DK0 A;  4OL7 A;  4F87 A;  2W6J A;  2R93 B;  3KBX A;  1M4V A;  1QCB D;  5C44 B;  2F0K A;  2XIW A;  3GD7 A;  1AFP A;  1OXS C;  1MSH A;  3NQT A;  2CHB D;  5ELF A;  1TR5 A;  4OHJ A;  4CJ2 C;  1JQY D;  2EJF C;  4EQO A;  2EJG C;  3CMM A;  3M7N A;  3E6Z X;  4DNT B;  3GP7 A;  5IGE A;  1EYC A;  4KKS A;  5ELC A;  1PTO F;  5CR3 A;  4XKV A;  3JU4 A;  2BDO A;  2B2Y C;  1VCI A;  1O7Z A;  2XND A;  4K2L A;  4WRD A;  1STN A;  4G7X A;  2O2L D;  3HP3 A;  3JAM E;  2L55 A;  4A3E B;  3K57 A;  2WB1 B;  5I4D A;  2JE6 I;  1JWU D;  3SK5 A;  5JEA H;  3G7L A;  1LTI D;  4KKU A;  2WP8 J;  1SSO A;  2MUY A;  4QMG A;  4XNF A;  2A68 C;  3EFX D;  1I4G A;  4HR7 B;  2R3Z A;  2RKS A;  1SNQ A;  5HUR A;  3W3A A;  5C5L A;  1SYC A;  5E4W C;  2XWB B;  1HVX A;  2ZZF A;  3VR3 A;  1I3Q B;  4NW2 A;  1STY A;  2X6X A;  1EY8 A;  4A3K B;  5LL6 S;  3I4L A;  4NDX A;  1I8D A;  1F2L A;  1CHP D;  1SMY C;  1SJE D;  4G4K A;  2F0O A;  1EY7 A;  3U9S A;  3SK8 A;  2SOB A;  2Z4H A;  4BBS B;  1S5D D;  1D1I A;  1YNJ D;  4J6H A;  2ZXP A;  2V4D A;  2NBF A;  2IX3 A;  4ME5 A;  1EY9 A;  4FF1 A;  1BMF A;  4HMJ A;  1ENA A;  5IGF A;  2VJJ A;  3FRP B;  2R9V A;  1TWA B;  4ZUI A;  1S5C D;  1U4R A;  1UD3 A;  1EY0 A;  4C3H B;  5EBD A;  1WPC A;  4KN7 C;  1PTO D;  5CC4 A;  4YXW A;  5C4X B;  1SYF A;  3H09 A;  3GVL A;  5E4X A;  4E6I A;  1KMH A;  2DY7 A;  1PZI D;  1UUP A;  3LWE A;  4JK1 C;  5C4J B;  4IFD H;  4DXF A;  4DAV A;  3HG9 A;  4ZKC B;  1K83 B;  1OB0 A;  2WV6 D;  3IAY A;  4DK1 A;  4RGT A;  1V43 A;  3PIO 3;  2RBM A;  3K58 A;  4H7B A;  1KDA A;  5K36 H;  1CM9 A;  1VF5 C;  2RSO A;  5I2X A;  5D3I B;  3HOX B;  4XYO A;  1TS4 A;  3DEO A;  1HRJ A;  3NUC A;  4WOR A;  3ND9 A;  2X8K A;  3FDT A;  5J1Z A;  1KDB A;  1TS2 A;  3M4O B;  2F4I A;  1PDQ A;  2EY5 A;  4IUT A;  4LK1 C;  2NVY B;  2XNA C;  3BC9 A;  1WVL A;  1EZ8 A;  4FNF A;  2EOT A;  2QKI C;  1IKL A;  1A15 A;  5C0X J;  2JA5 B;  3GTL B;  5A2Q L;  5CV7 A;  3J80 L;  2DN8 A;  2E75 C;  2KEC A;  3RUZ A;  2M9V A;  3A8J E;  2JP1 A;  4KK7 A;  4H44 C;  3GV3 A;  4UZU A;  1T5X D;  4XDX A;  1SND A;  1S5F D;  1SBB B;  4UAI A;  3OWE B;  5IOD A;  4IUU A;  1I4H A;  1NR2 A;  3FPU B;  1BPL A;  3GTQ B;  2B2V C;  2EYH A;  4A3J B;  1FNV A;  4KD3 A;  1OXT A;  1W9X A;  3UI2 A;  1SE3 A;  2HDL A;  4CJ1 B;  5I2Y A;  3A7L A;  3LX0 A;  1TWG B;  4U67 3;  4G57 A;  1CTM A;  2F0M A;  2K05 A;  3HKZ B;  1JIC A;  2B63 B;  4JBW A;  2Q8I B;  4FF3 A;  4G7Z C;  4C3I B;  3H0G B;  3TME A;  4ZUJ A;  2M5S A;  4IFD I;  1KDC A;  3K59 A;  3Q24 A;  1PYW D;  4TRD A;  1EU4 A;  1U9R A;  2SDF A;  2H4O A;  3CHB D;  3BDL A;  3QG1 A;  2XRS D;  1JWS D;  3GTK B;  3MXU A;  5DN6 A;  1EQT A;  3NSW A;  3M7G A;  2IL8 A;  1PFM A;  3C46 A;  1H8H A;  4DA2 A;  5ELD A;  2PW5 A;  5HKK A;  1ROD A;  4K8I A;  3KLS X;  4HMI A;  1Q3L A;  2F3V A;  2JIZ A;  5T1I A;  3N52 A;  2PCF B;  2ZTG A;  2M00 A;  2FMC A;  3OEE A;  4HSP A;  1BDO A;  3D6C A;  2F0F A;  1BCP F;  4XLA A;  2K01 A;  1EY6 A;  5JEA J;  4J1M A;  3BYT B;  4DN4 M;  2AUJ D;  4R9W A;  2NVX B;  3VA5 A;  2JJ1 A;  1E2V A;  1MAB A;  4OIJ A;  1D6E C;  1E3X A;  3E0J A;  4KN4 C;  4II2 A;  2J4X A;  1PFN A;  1TQO A;  2K5Q A;  4XMY A;  2GA4 B;  2X69 A;  1DOK A;  1ZXT A;  3D4D A;  3I70 A;  2K5W A;  3VR2 A;  5BN3 A;  5EPL A;  1EYA A;  1W6K A;  2WJY A;  2LKV A;  3NHH A;  4C1N I;  3J80 E;  5CMD A;  3MEH A;  1RD9 D;  1B50 A;  4QIW B;  2F0P A;  4OO1 H;  2F43 A;  3C1E A;  3PO2 B;  2F3W A;  1VDZ A;  1PXU A;  3BDC A;  3SK4 A;  1IYV A;  1SYD A;  1GOZ A;  3TDQ A;  4RGM A;  3E5S A;  4PMW A;  1AW7 A;  2D62 A;  4QUC A;  3DEP A;  5FK9 C;  2A6H C;  3MAQ A;  3TN2 A;  3KEW A;  5IIF A;  1JOK A;  2X6L A;  2NVT B;  3SEB A;  3TBI B;  1KAB A;  2F0D A;  2FMM A;  4M1U B;  1CA6 A;  4CKE A;  4DF7 A;  1KLU D;  4XD7 A;  2BA1 A;  1GUN A;  1O7L A;  2WSS A;  3O13 A;  4RFB A;  1BO0 A;  3ZYY X;  3TP6 A;  1Q1E A;  1C8C A;  3VYU A;  1LT4 D;  4BS9 A;  3Q22 A;  4HED A;  4HCS A;  3OSO A;  2J7Z A;  1D2B A;  1COW A;  2ZXI A;  2F0N A;  2RDG A;  1OXX K;  4A3F B;  4C3H G;  2QDB A;  4KY7 A;  1PZJ D;  2RA4 A;  1PLF A;  3I4M B;  1CT1 D;  4HCE A;  4ODG A;  3MA2 B;  1T5E A;  1JR0 D;  3P75 A;  4GQN A;  2K04 A;  3I8Z A;  1X3Q A;  5E3F A;  1E0B A;  3I90 A;  1DON A;  1F9P A;  1UAP A;  1O78 A;  1UD4 A;  2R7Z B;  3I3C A;  4OO1 I;  2HDM A;  3KLS A;  3LNN A;  2F0U A;  4ULL A;  1HQM C;  2LS0 1;  2VB2 X;  4PMC A;  4X3T A;  3OW7 A;  1SE4 A;  4EQP A;  5JOB A;  5T1G A;  4FYD A;  4KY6 A;  2C9O A;  4X3U A;  3S2H B;  1MBY A;  3CQZ B;  3GVK A;  3K5N A;  1U4P A;  3HZX A;  3SHL A;  3G6J B;  2PW7 A;  2EJM A;  2WPD A;  3BDO A;  1VF7 A;  1JOR A;  1D5M C;  2ZZQ A;  3S16 B;  5CBA E;  1IL8 A;  4YEJ A;  4EQN A;  4CKC A;  5EGT A;  3L7Z C;  1E43 A;  2JDI A;  1H9R A;  3PMF A;  5CGK A;  2MP1 A;  4HIZ A;  1PRT D;  4M8A A;  4C2M B;  5C5M A;  1U4L A;  4B9W A;  1H9K A;  4KY5 A;  4NNJ A;  3ITP A;  3TZU A;  5M5W B;  3KF8 A;  2DNE A;  4N9T A;  4KMU C;  1KAA A;  1J9O A;  5C4H A;  2PZT A;  3X3M A;  1FD7 D;  3BS1 A;  2OT2 A;  4GZY C;  1UNS A;  4DFA A;  1NSN S;  3BH4 A;  5DEH A;  2F0W A;  4X3S A;  3K5O A;  1LV9 A;  4HN7 A;  1WTR A;  2OF1 A;  1PTO H;  4C3I G;  1VMP A;  4FP5 D;  4ZK9 B;  4TSS A;  2QCP X;  1Z7T A;  2ZXO A;  1WTO A;  2IJ0 A;  1ENF A;  2WKD A;  2WAQ B;  1IHZ A;  1LTR D;  3DWQ A;  3Q6S A;  2K32 A;  4DXG A;  3CRK C;  1B9M A;  4C56 C;  1WTX A;  4LMQ D;  3EA6 A;  3PUX A;  3R93 A;  1YNJ C;  3SR1 A;  1Q12 A;  4FXK C;  1HHV A;  2EY6 A;  2PPB C;  1VMC A;  2ZZE A;  2EYM A;  1CQV A;  4L8J A;  1EOT A;  1JCK B;  1OXU A;  3EQL C;  4BA2 I;  5JJZ A;  2JJ2 A;  1WCM B;  4ZAI A;  1Y8O B;  1Y1W B;  5C0X I;  2A6E D;  4Z1M A;  5TSS A;  1Q8I A;  2JEA I;  1V0E A;  1HFG A;  3PV0 A;  1V0F A;  1PTO C;  1V1O A;  3VYS A;  1UEA B;  4IUN A;  5F2D A;  2RDH A;  1DXM A;  2E2H B;  1LT6 D;  4II3 A;  2XGJ A;  5CDF A;  4FXU A;  2Z1C A;  1GUW A;  2B8F A;  1QOH A;  4KJO A;  4IFD G;  1LLR D;  3I4N B;  3S1N B;  1B44 D;  1TII D;  3MXP A;  4O42 A;  2NTS A;  4RHR A;  1VJS A;  4KD4 A;  2K03 A;  4J8Q A;  5LL6 X;  3MHB A;  3R3O A;  4HSV A;  3NPP A;  4IN3 A;  2JSO A;  2AUK A;  3GV6 A;  3MWY W;  4YEL A;  3KK7 A;  5CV6 A;  1XYI A;  1E2W A;  3OOC A;  4IZ8 A;  2XZP A;  1W0K A;  1WTV A;  4NKL A;  4EVO A;  2O5I C;  3H91 A;  4IUV A;  3AB9 A;  1ESF A;  3L9A X;  1V1P A;  5ELE A;  1HCZ A;  1LTG D;  2W6I A;  1W6J A;  1SNO A;  4B3G A;  2A5H A;  2V7Q A;  5I6W A;  5FOB B;  4KHV A;  4O1N A;  2AQ1 B;  1HPC A;  4N9P A;  1EY5 A;  1QNU A;  1KNA A;  1U4M A;  3L3O C;  4B08 A;  2AQ2 B;  1DOM A;  4ZLT F;  5CYU A;  4L6T B;  1G2S A;  4A3I B;  1LTB D;  2KUM A;  5IGC A;  1UD6 A;  2GK6 A;  1DYQ A;  2QIL A;  2HQE A;  3Q0A A;  1GUT A;  3WOF A;  1NRK A;  2LFN A;  3IFD A;  3OFN A;  4B9X A;  3NXW A;  3BVM A;  1Y8N B;  1FNU A;  2EPB A;  2D5D A;  5KYL A;  1IW7 D;  3H6M A;  1II3 A;  2QE7 A;  2BE5 D;  1SXT A;  2PMZ B;  2EYO A;  3FKS A;  2SEB D;  5IGD A;  3OIQ A;  1G29 1;  1E2Z A;  1WD1 A;  3CRL C;  4JMQ A;  3T16 A;  4I65 A;  2ZT9 C;  1I4Q A;  3P1H A;  3BVZ A;  2K6A A;  2SNS A;  2RQX A;  3QOJ A;  1M8A A;  3A8K E;  1ZYR D;  2ZXH A;  3ERQ A;  1B53 A;  5FLX E;  2ZZG A;  1K8O A;  2NN6 H;  4CKB A;  1K8M A;  2MHV A;  5KIX A;  3T13 A;  1ESR A;  2E1B A;  1D5X C;  2RVL A;  2WII B;  1BF4 A;  1F2Z A;  2FIN B;  4KJN A;  1JE4 A;  2TSS A;  3TP5 A;  3AMU A;  2IW3 A;  1AZP A;  2G9D A;  1HXY D;  4U68 A;  4PNY A;  5D65 A;  1EQV A;  1LT3 D;  4RA8 A;  2F0L A;  4DAP A;  1EWH A;  2L9H A;  2DIE A;  4XN3 A;  3A56 A;  3VR5 A;  1F77 A;  1TS5 A;  2LMC B;  4HTH A;  4K6D A;  3HOW B;  3BVG A;  4TQU S;  3OHX C;  2QEJ C;  2Z8L A;  4K2K A;  1TY0 A;  4QCL A;  2OXP A;  2RSN A;  2AQ3 B;  2KOL A;  1TY2 A;  4RGO S;  2O4X A;  4RHS A;  5KRU A;  3SVM A;  1WTQ A;  2ID0 A;  5ISR A;  4XTC S;  4OO1 G;  2EY2 A;  5E1F A;  4E0F A;  1Q1B A;  3OEH A;  2F0J A;  4LJZ C;  4Z9C B;  4XQN A;  3WOE A;  1DZ1 A;  5IGG A;  1SEB D;  2JA7 B;  1ZEQ X;  4G7O C;  4P22 A;  1OXV A;  1B4O A;  2JA8 B;  2NN6 I;  4HAE A;  1SAP A;  1FGB D;  1RDP D;  2ZTN A;  2K28 A;  4TT3 A;  2EDG A;  2NB0 A;  4FXD A;  3NTH A;  2I46 A;  1B1Z A;  4ASU A;  4OIK A;  4CBV A;  3R8B A;  1JOQ A;  1QWY A;  3DWP A;  3R2I A;  2KQ3 A;  1ICW A;  2E74 C;  4KHZ A;  4PV1 C;  2KA7 A;  2NVQ B;  4XOT A;  3A3B A;  1BLI A;  4A93 B;  2NWG A;  3TP8 A;  1GJX A;  1GUO A;  1STG A;  2Y0S B;  3PUW A;  3X3N A;  3A8I E;  5IK2 A;  1WTW A;  3PIP 3;  2K33 A;  2Z6B D;  1PZK D;  2BCO A;  1HTP A;  2SNM A;  5CV8 A;  2A73 B;  1BOS A;  3CU7 A;  1LTT D;  3TP7 A;  4MN3 A;  1UD2 A;  3S2D B;  1E1R A;  2K7V A;  3RZD B;  1DJR D;  1CFM A;  1TS3 A;  1IKM A;  4A3G B;  1O80 A;  2GK7 A;  1RKN A;  3U9O A;  1Y69 U;  1BCP D;  2M2L A;  2I07 B;  2IX1 A;  2C5C A;  3S9W A;  1A3U A;  4XT3 B;  1L0X B;  2R61 A;  1WD0 A;  5M5Y B;  3I73 A;  2F0E A;  5JPN C;  5C0X G;  1NUC A;  3OWF A;  3QWN A;  2KEE A;  2CW0 D;  4WJW A;  3HGB A;  2WAC A;  3GVJ A;  1HFN A;  3VA7 A;  1ET6 A;  3A3G A;  1RHP A;  3DMU A;  5COR A;  4PQX A;  4ZRZ A;  4NP5 A;  2H1E A;  2XZL A;  3HS0 C;  1I50 B;  4XIG S;  1HUN A;  1PRT C;  2EYL A;  4K5X A;  1CZG A;  4H13 C;  1RTN A;  2JEB I;  5NUC A;  5EJW A;  3NWT A;  1SYB A;  1HQR D;  4K14 A;  2MGS A;  3ZIA A;  3S14 B;  2B2T A;  1EIG A;  3D3R A;  4XN0 A;  4FO2 A;  4I7Z C;  5D3D A;  4BWG B;  1MI2 A;  4MHE A;  3CP2 A;  2KVM A;  3HOU B;  3OPO A;  1F9R A;  2AWO A;  5EPJ A;  3WDN A;  4A3M B;  2X53 S;  4KV6 A;  2F0H A;  1TVX A;  3SDZ A;  4XQF A;  2D9U A;  4IUR A;  2B39 A;  2A69 D;  5IT9 E;  3CP8 A;  1ILQ A;  4XOP A;  3H3V C;  1D1K A;  1MGS A;  3FPP A;  3PUY A;  4XLH A;  3DUZ A;  1H9S A;  1AP0 A;  4RAU C;  4QB4 A;  1H9J A;  5IOC A;  1C48 A;  3T56 B;  3GO5 A;  1V1P B;  1HZE A;  2XSC A;  2Z4I A;  5BN5 A;  1EFI D;  2EE1 A;  1BXT A;  2K1B A;  1LTA D;  5C6A A;  4AVZ A;  3QJY A;  2A6E C;  2G9H D;  1EEF D;  2XZO A;  3A7A B;  1PMR A;  3DM1 A;  5JEA G;  4KKT A;  2WKC A;  4XON A;  2EYJ A;  1R4Q B;  2F0G A;  3V2T A;  4TKO B;  3NE5 B;  3LWU A;  4DNR B;  1TT2 A;  3C1F A;  4P2C B;  5C3W A;  1HUM A;  2JYO A;  2EZV A;  1L0Y B;  4ILW A;  2R6G A;  4OGQ C;  3K5L A;  2D3L A;  3VR6 A;  1E3Z A;  4KI0 A;  1LAC A;  1MSG A;  3BYY B;  3MXG A;  1BQQ T;  1QG7 A;  1CA5 A;  1TWF B;  4RKL A;  1A6X A;  2GJK A;  1PRT B;  4F88 A;  4C3J B;  2D2C C;  3SXH A;  1I6H B;  3RMH A;  1Z47 A;  3NBH A;  3BCF A;  1KNE A;  4ZQ3 A;  3NWS A;  5M3F B;  4UDU C;  4NMZ A;  1SKY B;  2QF7 A;  3OMG A;  1X32 A;  2VJI A;  3EJI A;  4LAA A;  2NUC A;  3C3L A;  1RF2 D;  4XQQ A;  4RCO A;  3I72 A;  1S5E D;  3M4Y A;  3J7A V;  1F9Q A;  1Y1V B;  5FLX L;  5DNF A;  4G6I A;  4F8M A;  1NR4 A;  1Q90 A;  3RD4 A;  3SK6 A;  1Y8P B;  1AN8 A;  5JVH 3;  1BUV T;  2L12 A;  4S3S A;  4L63 B;  2WZP P;  3J81 L;  1G2T A;  5FKA C;  2PZU A;  1SNP A;  3KLR A;  5FO9 B;  4F7X A;  3HOY B;  1UD8 A;  1YNN D;  4C1N K;  4K5V A;  2N88 A;  1DCZ A;  3D6W A;  4G7W A;  1A2U A;  2XVS A;  2IWH A;  5I6Y A;  2ZXR A;  4X3K A;  3M3Y B;  5EPK A;  5K36 G;  3RZO B;  1ML0 D;  2D3N A;  2X6G A;  2GJP A;  2KCC A;  1IW7 C;  2KVO A;  4QF4 A;  1OO9 B;  3NK9 A;  3S1Q B;  4CJ0 B;  2OEO A;  2BE5 C;  1CHQ D;  2DNC A;  2NTT A;  2E76 C;  1HTL D;  3P20 A;  4K5W A;  3IFT A;  2F0I A;  4IUQ A;  2IPK D;  4YIJ A;  2LZJ A;  1STH A;  2X6Y A;  3GTJ B;  3DWA A;  3GTM B;  3IKJ A;  3K6O A;  5KYI A;  2B2W A;  4H0L C;  1WTH D;  1GUS A;  1JOO A;  3GTG B;  5KEE A;  3SE0 A;  1GHK A;  1ZYR C;  5KND A;  3PUZ A;  2ICI A;  1I4P A;  1STE A;  1SJH D;  2NN6 G;  2CQA A;  4R8I A;  2FJ2 A;  3HOZ B;  2J0T D;  5EBC A;  3VR4 A;  5EQ0 A;  2PZW A;  4Y7N B;  1ONL A;  2L1B A;  5JVG 3;  1XXG A;  1KLG D;  1CZW A;  1Z6H A;  5K5P A;  5KNB A;  2A68 D;  3FVQ A;  1SYG A;  5JPM C;  4RKB A;  3DHQ A;  3NTI A;  3QB3 A;  3URY A;  5CBE E;  2IX0 A;  2YYZ A;  3RLF A;  3FKI B;  2RDF A;  5DM7 3;  1UD5 A;  3T53 B;  3GTP B;  2XN9 C;  4EGV A;  1CK1 A;  1HA6 A;  4CHT B;  1PTO B;  3HEJ A;  1SMY D;  2EVB A;  2F0V A;  2L11 A;  3Q23 A;  2CVR A;  2HLD A;  1EL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...