2DIEA

Alkaline alpha-amylase amyk from bacillus sp. ksm-1378
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
481
structure length
481
Chain Sequence
TNGTMMQYFEWHLPNDGNHWNRLRDDAANLKSKGITAVWIPPAWKGTSQNDVGYGAYDLYDLGEFNQKGTVRTKYGTRSQLQGAVTSLKNNGIQVYGDVVMNHKGGADGTEMVNAVEVNRSNRNQEISGEYTIEAWTKFDFPGRGNTHSNFKWRWYHFDGTDWDQSRQLQNKIYKFRGTGKAWDWEVDIENGNYDYLMYADIDMDHPEVINELRNWGVWYTNTLNLDGFRIDAVKHIKYSYTRDWLTHVRNTTGKPMFAVAEFWKNDLAAIENYLNKTSWNHSVFDVPLHYNLYNASNSGGYFDMRNILNGSVVQKHPIHAVTFVDNHDSQPGEALESFVQSWFKPLAYALILTREQGYPSVFYGDYYGIPTHGVPSMKSKIDPLLQARQTYAYGTQHDYFDHHDIIGWTREGDSSHPNSGLATIMSDGPGGNKWMYVGKHKAGQVWRDITGNRSGTVTINADGWGNFTVNGGAVSVWVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ancestral sequence evolutionary trace and crystal structure analyses of alkaline alpha-amylase from Bacillus sp. KSM-1378 to clarify the alkaline adaptation process of proteins
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords amylase
total genus 177
structure length 481
sequence length 481
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2dieA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2dieA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dieA01
2O9OA 1QI2A 3MS8A 1CYGA 4AEFA 3RILA 5A6AA 4UQBA 3B8SA 8A3HA 4PTWA 2PBOA 2GK1B 1EQPA 2VZUA 3HG5A 3SCPA 3WH8A 1UASA 1JZ2A 4OIFA 3VD7A 2X0HA 4X0NA 2W66A 3BXWA 1W1PA 4CD4A 3POCA 3RJYA 1UR4A 2XG9A 1Z32X 1UD5A 2BY0A 3EMZA 1Q4NX 3AS1A 5GNZA 4GQRA 5EMYA 5AY7A 1V3MA 5A2BA 3N04A 3GBEA 3AIUA 3W4RA 3K8MA 4DM1A 4AC1X 4AZ5A 3VKKA 2VX5A 5ABFB 1R34A 1UWQA 1UD6A 3GXTA 4MTVA 4IPNB 3PZGA 1JI2A 5CGMA 5A8NA 3W38A 1HJXA 1X1NA 1O6IA 4AISA 3SEPA 3KL5A 1K6AA 2XVLA 3BVTA 2YKKA 3AXXA 1KGWA 4U5KA 1BSIA 2IXVA 3HN3A 3F4VA 2V3FA 3MV01 1QNQA 2BV9A 1ISWA 1NOWA 2W62A 2J77A 1E6PA 4MAZA 3CMGA 3ZSTA 1GOIA 3WSUA 4HMEA 4CN4A 4E4PA 1HJSA 2VCBA 2D73A 2RGMA 1G0CA 2VZOA 3VIGA 5D9PA 3VGBA 1EHAA 3KL3A 1G5AA 1SFSA 2A3AA 4B15A 4N0RA 3WBAA 3W27A 1VFMA 1W9XA 1R47A 2G3MA 1H4PA 4ACZA 2OYKA 2EXOA 3U57A 2FHCA 2J7EA 3RPMA 3W28A 3DHPA 2DT2A 4LPCA 4QDMA 3D4YA 4H8UA 4W85A 2WSKA 3TP4A 1UR8A 3CUHA 4NZJA 1I1WA 3VIPA 1OGGA 3PTMA 1HVXA 5JIWA 4M29A 3A22A 4BCEA 4CD7A 4JKLA 1NH6A 2E40A 5BXTA 4S3KA 1VFFA 4CCDA 4AZCB 1ZBCA 1W2VA 3EDEA 5HXMA 4AYGA 1BFNA 4CU7A 4AD2A 2J62A 4YN5A 4V27A 2F18A 3FAXA 3W82A 2W91A 2O9RA 4LX4A 6TAAA 3VVGA 2WB5A 1EA9C 4JHZA 4D6IA 1QBAA 3S5YA 3W26A 1JFHA 3EJUA 1G94A 1VF8A 1FH7A 5AC5A 2WBGA 4DWSB 1OIFA 3WQ5A 2YBTA 3RM4A 3GM8A 1V0LA 4W5ZA 3ARYA 1JAKA 1B3ZA 4HOZA 2FGLA 1RP9A 4UZSA 3KEHA 4H7VA 2CITA 2DSZA 2ZX9A 1E4LA 1JF5A 1FA2A 2J7HA 3S6TA 4TVCA 1GCYA 4F9DA 3W37A 2B31A 1DWGM 4TX8A 1MW3A 1GHRA 2GJXB 3H53A 4BA0A 1CGTA 2D2OA 2GVYA 1JL8A 1BLIA 1PIFA 2ZXQA 1NM9A 1TG7A 1UWTA 1G9HA 6A3HA 4TUFA 1NOFA 3BLBA 1DWAM 3HG4A 3II1A 5A8PA 3G6MA 1O7AA 1C92A 3LPFA 1UHVA 2VVNA 1K9TA 3AIWA 2X1IA 1JZ7A 1CTNA 3WENA 1E6QM 1L8NA 4WLCA 2BVDA 2ZX6A 1B2YA 1KFWA 1MFUA 2ZUUA 4FNTA 1NWTA 4AMWA 1XC6A 1NP0A 3W53A 1GOWA 3OLEA 1D3CA 3VTRA 2X2HA 1PIGA 5FL0A 3ZJ6A 3TTOA 3MI6A 2VR4A 4LYPA 4ZEPA 4UFIA 2WNWA 3BAYA 5A69A 3ZMRA 4AZ6A 3KLKA 2VQTA 2E3ZA 1UD8A 2W61A 4U2ZA 1VB9A 1FH8A 2D23A 1MW1A 5CGTA 2WWDA 5A6MA 4GI9A 1H49A 1MW2A 3GBDA 2J25A 3UR8A 4A3YA 2PWGA 1X6LA 2WMKA 2YLLA 4EAMA 5D8ZA 4OJYA 1KWGA 3UERA 1OWQA 5BCAA 1JDCA 2VR5A 1HVQA 2GSJA 1UD4A 2O9TA 4TOQA 7A3HA 1JYXA 4J3SA 1MYRA 3AHZA 1IZKA 1TQTA 1JI1A 2BHYA 4GQQA 2WK2A 4QP0A 4CD8A 5A8OA 2V38A 3EDFA 1J18A 3AYRA 1TQUA 1UWUA 1CDGA 1HIZA 3UCQA 1QHPA 2XN2A 4DO5A 3AIVA 4E2OA 3SCQA 1LLOA 2Y8VA 4HPGA 3CHCA 2Z1KA 1KQYA 2GJPA 2A3HA 2O9PA 2BY3A 1C93A 3CHDA 3ARXA 3VGEA 1TVPA 4OKDA 5ABGA 1XH1A 1TA3B 4AZIA 2A3BA 4GZJA 2WCSA 4NXSA 3SCOA 3JUGA 1GUVA 1AQ0A 4RE4A 4DWSA 1B3XA 3WKZA 1CLVA 4B3LA 1ZBVA 5M5DA 4WK9A 1M03A 5AYBA 3N15A 4R5EA 5BRQA 1E43A 1ITXA 2EPKX 3SIMA 1JXJA 1ZL1A 1KWKA 3K1DA 4J3TA 2JF6A 4NSBA 1TFVA 2XWEA 5A6LA 1BG9A 3AHVA 2FHFA 1J0YA 2GFTA 4DWSD 2XIBA 2VL4A 1GQJA 3WMBA 4ZFMA 3WNOA 3VM5A 3WF4A 2AMGA 2OYMA 1C91A 2XSBA 2XGBA 3B9AA 1HXKA 3CV5A 2F7PA 1Q6CA 3N1AA 3VX0A 3VIFA 4NI3A 3WL1A 1VFUA 2CBIA 4H04A 4ZXOA 5IDIA 4FK9A 2WC4A 5FD0A 2WMIB 1BVNP 4XB3A 4PMOA 1US3A 2AOSA 3IJ9A 4PSRA 2XGIA 2WVSA 4UOJA 2VCAA 4NRRA 1U33A 2JF7A 5FKYA 1E4IA 3T2QA 3RM8A 5I3DA 1EOMA 3G6LA 5I79A 3A47A 3ALGA 1JD9A 5I6SA 4J27A 4HOXA 3VPLA 1XV8A 2WKGA 3L4XA 4EK7A 4CD5A 1KCLA 5EFDA 3UG3A 1ZS2A 3AI0A 5HPOA 3CUGA 2EEXA 1ESWA 1W1TA 3ZQ9A 1NP2A 2EBNA 1E1FA 1A47A 1HT6A 2VCCA 3WUGA 3BCFA 3W6MA 4UCFA 4BF7A 2FE0A 1PEZA 1CLXA 4JKMA 4L4OA 3UETA 1JZ3A 2Y4SA 3LMYA 3O6AA 4PCTA 1UD3A 5IHRA 1CWYA 4GZIA 1OD0A 1PZ3A 5CLTA 1NQ6A 3FN9A 1PZ2A 2G3NA 2WVUA 4AD5A 4B9ZA 3PZVA 4HU8A 1EH9A 1LL6A 4AD3A 4P7NA 4WF7A 3AHYA 1CEOA 3TTSA 5A6BA 3W25A 1OBAA 5JBFA 4Z2JA 2F8QA 2JEQA 4TTGA 2V3EA 1KGXA 1W3JA 1CPUA 3SCRA 4URIA 1BAGA 2ZXDA 3WDHA 3CHEA 5D8WA 2PBGA 4LYRA 1VBUA 2WW5A 1QW8A 3ZT6A 3WD4A 1XYZA 3DECA 3WD1A 3APGA 3UG4A 1UWRA 4AY1A 1B30A 3WD0A 3ZSSA 2G3JA 2JFEX 4BS0A 4HZ6A 2WSPA 1LL4A 1J01A 5A2AA 4FNSA 5A1AA 1HP5A 2J8FA 4V2XA 1ISXA 3BVVA 3AMGA 1VFOA 2XJ7A 1L0PA 5ABHA 3BVXA 2PI6A 1XYFA 4AZ7A 5BYWA 1J0JA 5ECUA 1HXJA 2ALWA 4D6GA 2OWXA 4OOZA 1QWUA 4AIUA 1WPCA 4Y7EA 4Z2HA 4CU6A 4LGXA 3PZMA 1WCGA 2W4XA 3WDJA 1ISVA 2WPGA 4C7GA 4QLKA 3GXMA 4PMXA 1UA7A 4HTYA 5JBEA 4MADA 1QNPA 4OZOA 1B9ZA 2ZX7A 2XN1A 1VEPA 2WAGA 3VMNA 4UQAA 2E8YA 3WN6A 4KH2A 1B3VA 1AQMA 1HJQA 1JIBA 4N42A 2XN0A 4M82A 5TD4A 1W3HA 3PZTA 5CQ1A 1OGSA 2F1AA 1GOKA 2X09A 1WDPA 3MUY1 1GOQA 2WHMA 4PCSA 3MMDA 2VX7A 1ITCA 1CECA 1E9LA 2WCAA 5IFPA 1J0KA 1KR0A 3WMCA 4QCFA 1XSIA 2FHBA 1B3YA 3WIJA 3A4AA 1R85A 2JALA 1LF1A 5IXEA 2VRQA 4LXFA 4U3CA 5I23A 3FHQA 2E9BA 3WY4A 2W63A 1MXDA 1ZJBA 1E3XA 4H2CA 1R7OA 4FLSA 5DEZA 4XV0A 2YLAA 3WNMA 1U30A 4PMZA 2CNCA 1KBBA 1OB0A 1J0ZA 2WM0A 3HZ3A 1FOBA 5I0DA 3WNKA 1BG4A 1V0MA 3K8LA 1BGAA 5AC4A 3FAWA 3ZOAA 5A3HA 2VX6A 2XYLA 1DP0A 4PUDA 2WANA 1E72M 2DSWA 1NARA 3LRMA 2D24A 1H09A 2G41A 1G1YA 1B90A 2NT0A 1V3IA 2J7FA 3CUIA 2UY4A 4W5UA 2WVTA 2JIWA 1V6XA 5M03A 1QI3A 2YFOA 1TQSA 4H8HA 3WY2A 4AW7A 3L4WA 3LXAA 2QHAA 4YPJA 3SUTA 1C7TA 1BF2A 2QV4A 2YDSA 2EPOA 1V3LA 4JIEA 3AZSA 4AZCA 1SR0A 5D9OA 3GNRA 1GJUA 3QGVA 2J7DA 2OW6A 4J3VA 4HMDA 3KLLA 1TZ7A 2ZXBA 1UH2A 1B31A 3GH5A 1BVZA 2QMJA 3RJXA 1TR1A 4CCCA 3ZR6A 4CKQA 1PPIA 3VSVA 1UYQA 4XZWA 1D7FA 1H0GA 2IXUA 1PBGA 1TCMA 4A3HA 5EB8A 2NT1A 4C7DA 1TE1A 1WZKA 3PTKA 5E0CA 2WWCA 4J3XA 4P7QA 4IM4A 5C8BB 3L4ZA 2BVYA 1BYBA 2YL5A 4P8WA 1W3KA 4DWSC 1EIBA 4UFHA 1W9PA 4XUYA 3FHAA 1UKOA 2F1BA 4WSKA 5A8MA 2WLYA 4X0VA 1E6NA 3W29A 3CH9A 1HKIA 3EMQA 1K9EA 1TUXA 2WXDM 1C7SA 3L4UA 2FH8A 2D3NA 5DFAA 2ZWZA 2HVMA 1KXQA 2D22A 2D20A 1M04A 3CTTA 2XHYA 5CSUA 3B9EA 2J75A 4JCMA 3ZO9A 4TVUA 3ARQA 1J0HA 1NWUA 5A2CA 1W9UA 2D3LA 3IJ8A 2DT0A 3A3HA 4Z2KA 2E4TA 2VZVA 1J0IA 5AYIA 2WMIA 1XCXA 3WUEA 2WMFA 2X2YA 3ARPA 4FNRA 3L4VA 3LRKA 2X05A 3WL0A 2CETA 2F2HA 1XGZA 4UNIA 3A5VA 3EJSA 3VD9A 1VIWA 1JXKA 4FLRA 4K68A 4D72A 3LPPA 5JIPA 3CZKA 3VGDA 1MFVA 3GNPA 1UR9A 1Q6DA 3QOKA 4JFTA 3WFLA 2VNCA 4JFUA 1BQCA 2XUCA 2EACA 3L4TA 3AZTA 2YOCA 1P6WA 3PZIA 4W87A 2OW7A 4BQ2A 1XHGA 1MQQA 2DH2A 1ECEA 2X0YA 3HG2A 1MQRA 1UZ4A 1PX8A 3TTQA 1V3JA 4PTVA 9CGTA 3ZIZA 4AMCA 3U7VA 2WMGA 5A95A 3MANA 1GORA 5CZKA 4ATLA 1UA3A 1C8QA 2FH6A 1W9BM 5DT7A 4MAVA 2D0FA 4JHOA 1J9YA 5CPSA 2IGTA 3BMWA 2EADA 3WUFA 2Y5EA 1KTBA 3N17A 1V3HA 3EDKA 4JL2A 3AQUA 3MSDA 3WQ4A 2Q8XA 5A6BD 4ML4A 1W9DM 1YHTA 3ZJ7A 5D4YA 4UFMA 1U2YA 1BPLB 2RGLA 1GZJA 4JZ5A 1W1VA 3MUIA 3ECQA 1E6ZA 3FXYA 4Q7NA 1V0KA 1WZMA 3A24A 4AMXA 3RCNA 3IAQA 1MVYA 1GVIA 5CPTA 5HOSA 3CZLA 3M7SA 1UQYA 1QHOA 3UEQA 3VUPA 3WH6A 3AIQA 4AXNA 1M01A 3HU7A 3VX1A 1CENA 2BVTA 3FY1A 1LWJA 4UFKA 1JYNA 2V5DA 1OT1A 2YDQA 1GHSA 3UG5A 1I1XA 3AIEA 3PHAA 2YL8A 2ZUMA 1WDSA 1WZAA 1GONA 2DSVA 1KXVA 1H2JA 3QHMA 1PAMA 4U31A 4IUGA 3HJEA 1E0VA 4CN6A 2BY2A 1HKJA 1GOOA 1AMYA 1NWSA 2DEPA 5DF0A 3GXPA 4DM2A 1GQIA 2QPSA 1TMQA 3MV11 1EXPA 3NJ3A 3VGGA 1E6RA 1UKPA 2WHLA 1LL7A 2VZSA 2GDUA 5BWFA 1DHKA 1CBGA 3PZQA 5C70A 1K9FA 2QMKA 4J3UA 1E6SM 1CGXA 3DX2A 2CHOA 2DQXA 1NOUA 3GNOA 1E5NA 2VX4A 3VIMA 3L2LA 1XH0A 4J7RA 4UTFA 4HOWA 5GQBA 3D52A 1C90A 1FHLA 2VTFA 4ZE5A 1B0IA 2WKLA 5BROA 2EPLX 1T0OA 4J28A 3GTNA 4C7FA 2ZUNA 4D6FA 3DYMA 2JIEA 4FNPA 1RH9A 4MB1A 3MMUA 2DH3A 3L4YA 4RL3A 3NDYA 4PBGA 1JD7A 1OIMA 4KMQA 4P7RA 5BXRA 5DMYA 1KQZA 3CMJA 3D51A 3TV8A 5JUVA 2WVVA 5EFFA 2GUYA 4M24A 2CESA 2D0HA 2OSYA 3AHXA 4B16A 4HA1A 3SUWA 4AIEA 1MXGA 1UQZA 3E1F1 4UQEA 5I78A 3CZNA 1E4NA 2YA1A 2O92A 2XPKA 1R46A 2GJRA 1QNSA 1E70M 5HBFA 5M3WA 1ZBKA 2W67A 3WQVA 3EJRA 3T0BA 3OB8A 3NDZA 1A3HA 1WO2A 2WYSA 5CLWA 1QOXA 3D50A 2D1ZA 3WBEA 2BY1A 3EDDA 4GKLA 1E5JA 2EPMX 4FLQA 1M7XA 3KE0A 4MNJA 4NX0A 3GXNA 1YQ2A 4AD4A 2VURA 2WCGA 2CKRA 3EDJA 4PMDA 1GVYA 1WDQA 3NYDA 2GK1A 1VBRA 3GH4A 3AS3A 3PZOA 2CPUA 3BVUA 2DIJA 3AYSA 1PX4A 4UZUA 3OLGA 3T0AA 5LA2A 2Z1SA 2VO5A 1IZJA 3BCDA 3O9NA 4PEEA 5E9AA 3DYPA 3PTQA 2CIPA 3WF2A 5E70A 5DT5A 4KWUA 4MDPA 4XX6A 2JEPA 2UY5A 1VJZA 2ZIDA 5ABEA 3BLKA 3ARWA 3BUPA 1OSEA 3TA9A 3BLPX 3KL0A 2YDRA 1UWSA 4JFVA 4OOUA 1ZJAA 1TQWA 4BZYA 1E55A 3VIOA 3WY3A 1XRVA 3K8KA 3CPUA 1KBKA 1OINA 2YIHA 1C3FA 3MKKA 4LQ1A 3SCSA 3GXDA 3CC1A 3VIIA 4M56A 5ABFA 4YHGA 2XM1A 3BUIA 4CUCA 3HG3A 3SUSA 4W8BA 3W6LA 2BFGA 4XZBA 1PJ9A 1ZB5A 1V02E 3OLIA 6CGTA 3LXBA 4MB3A 2ZX8A 4B3KA 3KZSA 1UR2A 1CXEA 1E0XA 2OYLA 5M17A 5KEZA 2C7FA 1VEOA 2AAAA 2PB1A 4MJ4A 1UR1A 1W32A 4DUXA 2JE8A 3F5JA 1I75A 3F5LA 4F9JA 1HTYA 3DX0A 1WKYA 3FW6A 3BAKA 3IANA 1HNYA 2CBJA 1CGYA 3OGRA 1SZNA 8CGTA 2ZUWA 4PMVA 3VMPA 4V28A 4FLOA 2Y8KA 1SMAA 1JZ4A 2QF8A 3VM7A 4MDOA 3T08A 3WELA 3DX1A 1E73M 1OD8A 1E71M 1HJVA 4QCEA 1EDGA 1J10A 1LQ0A 1PS3A 1EGZA 1JNDA 2WHKA 2WZEA 4ACZB 5E6YA 5IHSA 1JYWA 1C8YA 1BTCA 5F7UA 5LYRA 2EJ1A 3B9DA 2DSUA 1WDRA 1QWNA 1US2A 3MMWA 3GZAA 3WDRA 2XVKA 4MNMA 4WKHA 1Q6GA 2XFFA 2XIIA 4CN1A 1HP4A 2VRKA 3OLDA 2XWDA 2C0HA 3J7HA 3WH7A 3WY1A 4BQ3A 1F4HA 3WEZA 3CUJA 1G01A 4PMUA 2J74A 1V6VA 4W84A 3DC0A 3RDKA 1V6UA 3K46A 4CVWA 2EPNA 2QLYA 1GPFA 2Y2WA 1X6NA 1EDTA 2WZIA 2VVSA 4D6HA 2WC7A 3OZOA 1RP8A 4AWEA 4FMVA 4D6CA 5CJ5A 3OGVA 2G4FA 1SYTA 3VDCA 1JZ6A 2XFRA 3D3AA 4EE9A 3QR3A 3OBAA 3NUKA 4AD1A 4PN2A 3A4WA 3VINA 5DO8A 3VO0A 3N12A 1VEMA 1UG6A 4QAWA 3H55A 2YA2A 1EHNA 1CGVA 3WH9A 1QVBA 3A21A 3H54A 3ARSA 2XSAA 5HDRA 3PZUA 4W88A 4D1IA 5A6JA 4S3JA 2CERA 1ZBWA 4NRSA 1R86A 3MU7A 1FH9A 1TVNA 1JF6A 2GJXA 2E9LA 1W91A 4HU0A 1GW1A 1VJSA 1XD0A 2EAEA 3UR7A 1R7AA 3BGAA 3DYOA 4TVDA 1LWHA 3LPGA 2PF0A 3AFBA 2W5FA 1VAHA 4JFWA 4GO8A 2X2IA 3VD3A 3WQ6A 4D6DA 5KZ6A 1EOKA 3D5HA 3F5KA 5BRPA 2VC9A 3I3DA 2DSKA 4BQ4A 4ATWA 4KGLA 1QPKA 4NF7A 3BUQA 4OUEA 3AJ7A 3EMCA 3SURA 2UWFA 4PUEA 3VD5A 1GJWA 4GXPA 1EO5A 5IFTA 1JDAA 3VILA 3WFZA 4UQDA 1WP6A 3BC9A 3GXIA 2ZXAA 1AVAA 7CGTA 4E8CA 3ARZA 2VOTA 4KGJA 1HF6A 3W81A 3GH7A 4WKFA 4UFJA 1OCQA 3VD4A 4AZHA 3LRLA 4UOQA 4WKAA 1E56A 3PZNA 4GPNA 4U5IA 3POHA 1XSKA 3N18A 2PWHA 5D9MA 4NZFA 3SCUA 5FIPA 2IUZA 3AS0A 5HPCA 1UH4A 3FNDA 1QI0A 3CBWA 3K4DA 1W9VA 2WBKA 2ZE0A 3BH4A 2J7CA 2V5CA 2BXYA 4D6EA 5CSYA 2PWEA 4TXEA 1DEDA 1VENA 2VRJA 3NSNA 3AZRA 3NSMA 3S5ZA 3VDAA 1HWWA 1TA3A 2F7RA 4YHEA 3BMVA 1KCKA 3ZT5A 3LXCA 5C71A 5D9NA 1KXHA 5JBDA 2DDXA 1JYVA 1FHDA 4HA3A 4KRUA 1W2PA 4PYSA 5FCZA 3BVWA 1BYCA 3I3EA 1PX3A 1J12A 1RPKA 3CGTA 2A3EA 1BGGA 1V6WA 2GDVA 1GQLA 2CBUA 4M80A 3QOMA 3CZJA 5GNYA 4HA4A 4PTXA 2XVPA 3WF0A 1WNOA 1BPLA 4Q22A 2CEQA 2V3DA 3AIRA 4JL1A 2F61A 3AIBA 4CU8A 1QNOA 2MANA 4H41A 1E3ZA 2FGZA 1DWIM 4RE2A 5BXPA 1CXHA 1V0NA 1QI4A 2DPEA 4J3WA 1OM0A 4DUVA 3L2MA 1UR0A 3VIHA 1BYDA 2CBVA 4U3AA 1MW0A 4P8UA 2ZWYA 4LYQA 1SMDA 4GIAA 1OT2A 1MQPA 1CXKA 5A8QA 1W1YA 3AMCA 1H3GA 3HMCA 2NSXA 1B3WA 4NZCA 4QFUA 1IV8A 2XM2A 4P7OA 1JDDA 3T09A 3SCTA 1V08A 2BXZA 4JFSA 3EJPA 2YBUA 1C8XA 4FNQA 4F8XA 1Q6FA 2UY2A 4U33A 1GQKA 3CIVA 3I3BA 1HJWA 3GXFA 4PMRA 2OWWA 3ZJ8A 4ATDA 2BHUA 1HJUA 1FP8A 2ZICA 1QX1A 1QI5A 1R33A 2W92A 4MPKA 3MUAA 3BAIA 1ISZA 3BUBA 1Y7VA 2V3GA 4PSPA 4GINA 2DT1A 2QPUA 1O7DC 2YA0A 2UY3A 3WNPA 4H8VA 1CXFA 5FOOA 4PMYA 3NIYA 3AXIA 1OGBA 2CCRA 2EO7A 3AS2A 3A23A 4F66A 2PWFA 3BUDA 3QHOA 1E6XM 4AEEA 4TX6A 3WF1A 3W0KA 1R87A 1HKMA 3EJTA 5E1QA 4QLJA 1HL8A 5I77A 1JG9A 2E0PA 4WIWA 2BHZA 3VDHA 4AYSA 2YL9A 1HL9A 1EDQA 4QLLA 3N9KA 3CZEA 1H11A 3SUUA 1GOMA 2CXGA 3AMKA 2BNJA 4W89A 4ACYA 4DO6A 2VQUA 3S2CA 3OGSA 3THCA 3OG2A 2WVVB 3PBGA 4W8LA 4WJXA 4MNKA 4AD0A 3AROA 1H41A 3DDGA 2ZUTA 1CNVA 3U7BA 4Z2LA 1E40A 3BAJA 4GO9A 4MJ2A 4UQ9A 3CZGA 1HX0A 1N82A 4AZBA 2J4GA 4CD6A 4E8DA 4MB4A 3SCWA 3ARUA 3WQWA 3DHUA 2YJQA 4HMCA 4U2YA 1FP9A 1JGIA 3DX3A 4FNUA 3RO8A 4TTUA 1EQCA 2J7GA 1DTUA 3WF3A 4CVUA 4W7UA 1E1EA 5A94A 2WHJA 2OSWA 2WMHA 1CGUA 3ALFA 4Z2IA 3NSXA 4IISA 1H1NA 3U5YA 2YFNA 5EBAA 5I24A 3A4XA 4MNLA 2CKSA 1HKKA 2F7OA 1FFRA 3M6DA 2Y24A 1VRXA 3WDQA 1BYAA 1ZU8A 1DWFM 5GNXA 2J79A 3VIJA 4CGTA 2OLHA 1AQHA 4EANA 1WB0A 4FF5A 5E0FA 3VU2A 3VIKA 4F79A 2FDMA 3K4AA 5FL1A 2VZTA 2PC8A 3WD3A 5CXPA 3CZ8A 2E9MA 3A6OA 1K9DA 1E0WA 1QW9A 3ZT7A 4PMNA 4HZ7A 1NWRA 3N11A 3O2LA 2DIEA 5I5RA 3U5UA 3PZ9A 3AMLA 3DDFA 1FFQA 2ZX5A 4DUWA 3VNZA 3WDIA 1CGWA 5A6KA 2A3CA 1B1YA 4P8XA 3CZSA 3SCNA 2CYGA 3BSHA 1KGUA 1WAWA 2VI0A 3CHFA 2BS9A 3AOFA 4M1RA 1F4AA 3GDBA 1XD1A 1XCWA 1JZ8A 2XTKA 4MB5A 4OBRA 1BHGA 3WEMA 2ZUVA 4P7LA 2E8ZA 4M8UA 3W24A 1H5VA 4B9YA 4X9YA 4HZ8A 1H0IA 2DT3A 4IPLA 2VMFA 3M07A 3M46A 1UOKA 2XVNA 1KB3A 2YL6A 3WH5A 2J47A 1UKQA 2VJXA 4W7VA 1J11A 1DWJM 1CZ1A 3RIKA 3OIHA 1R8LA 2D0GA 2EQDA 3MUZ1 3T2OA 3CUFA 1IT0A 4ZENA 4AZGA 2XVGA 1DWHM 1D2KA 3AMDA 1KR1A 3VSUA 1Q6EA 4UQCA 4R27A 4W7WA 4WSJA 1W3LA 4D6JA 1ODUA 3SUVA 3WMSA 2XFYA 2HISA 1UD2A 2X8RA 3RMEA 3SCVA 2ZOXA 3T2PA 4L4PA 3DX4A 4P8VA 3VNYA 4PRWA 3LX9A 2DGAA 4W86A 1QBBA 3ARVA 3QHNA 4OBSA 3D4ZA 1XSJA 3KWXA 3THDA 3T0DA 1R75A 2FYVA 3ZR5A 2C8NA 1JZ5A 4GI6A 3AICA 3IAPA 1CIUA 5CPQA 1EO7A 1RD6A 4D1JA 3WNNA 1UUQA 2CHNA 7TAAA 1KXTA 2NW0A 2VT0A 4PMQA 1V3KA 4HP5A 2WZHA 3ARTA 3AXHA 1UZ1A 3EYPA 4UR9A 1ISYA 3NCOA 3TOPA 1UKSA 1CXIA 5E6ZA 4ZXLA 4GI8A 4OGZA 2WC3A 3WUBA 3TTYA 5CG0A 4CCEA 3VGHA 3N13A 4BQ5A 3AHTA 2ESCA 5BXSA 3CO4A 2G3IA 2WLZA 3OA5A 2EABA 4UOZA 4DO4A 1CXLA 1S46A 5E09A 1JAEA 1JNEA 4NXKA 4JCLA 1V02A 1QNRA 5A6SA 1V6YA 3TONA 3PN8A 2OSXA 3WD2A 3IK2A 4HPHA 3OZPA 3ZJKA 5HNNA 1E15A 3LPOA 4RE3A 1LG2A 4JKKA 1UWIA 1UH3A 1MWOA 2TAAA 3WDPP 3RM9A 1UKTA 3IJ7A 1HN1A 2F7QA 3BAXA 3VGFA 3VMOA 5I2UA 2OWCA 3VDBA 4ZE4A 3ARRA 4A4AA 4AIOA 5LA1A 2WMJA 3ZM8A 1GNXA 5LA0A 1QHZA 2J8GA 4Z2GA 2VUYA 4W93A 1WZLA 3GYCA 2J7BA 2ZUSA 1WE5A 3WEOA 4PTMA 4D71A 1KTCA 5GPRA 2J78A 4W8AA 1TQVA 4UFLA 3AISA 3BSGA 3EBVA 3VSTA 1XH2A 3CLWA 3MSGA 3WQ8A 2X2JA 3IGUA 2G8ZA 1ODZA 3UESA 1V03A 1LJYA 3MO4A 3VOCA 2PWDA 3EJQA 4M81A 4JAWA 4GZEA 4EKJA 1LG1A 1M53A 4KRTA 1E4MM 1JFXA 3WNLA 3BAWA
chains in the Genus database with same CATH superfamily
5AYYA 2DIBA 3HPJB 2O55A 6PTDA 5AZUA 2IH3A 1KLFA 4IKKA 4HU4A 5KSWA 1CD8A 1CYGA 2OMZB 4F0SA 2OLSA 1X7TA 2GT9B 3NL3A 3P73B 5DRWA 2I5GA 4JO3L 5ACLA 4N8UA 2PBOA 3QSKB 1F73A 4N9CA 1EQPA 3HG5A 3SCPA 2P28B 3PABB 4NAQA 2OSLA 4TSFA 1IXPA 5T3XD 2R1PA 1JZ2A 5EOTA 4PZVA 1EP1B 1KIRB 3T0EB 4MCZA 1RIVL 5GHWL 4TLUA 3MFFB 1HZKA 4EAEA 1YE4A 1W1PA 2BLEA 2XQ0A 4OUUB 1LO3H 4D9QE 3RJYA 3VXSB 1IC7H 1UR4A 2XG9A 5GS2H 2DICA 1Z32X 2BY0A 4LRSA 2J6EH 4I89A 3C6LB 1XF3A 4X4MA 4KUCF 5C9JA 4G8FA 2X8KA 4PJ8D 1I3UA 5EOQL 3SBQA 4GQRA 3US1A 1FDLL 1JNLH 3LSOB 4WZLA 4FCHA 2D7TL 4IRZH 4TMTA 1INEH 1HNGA 3N04A 2RA1A 1JZFA 5A2BA 1NBCA 1UW9A 3W4RA 4QT5B 4LP8A 4DM1A 3TWYA 2OK0L 3JZUA 4AZ5A 3P2TA 3DURA 5BUGA 3VKKA 3LZOA 2VXNA 5DFVD 3UAJC 5ITBH 4G8GE 3HZKB 4NM8H 1S7XA 2BZCA 2VDNB 2GPZA 1T83A 4GSUA 2JKNA 1ZD6A 3GI8L 3IF1A 3K0WA 4ETQB 5BUAA 1BMWA 4K39A 2Z35A 4ASTA 3GXTA 2P7TA 3A3GA 2NQHA 2NY3D 1ZV9A 2VM3A 2KHAA 5AYQA 4JZJC 1O6SB 3M0VA 3MRRB 3LQAL 3TO2A 1NCUA 1NWPA 4I5BA 2H32H 3F7YB 3L9EA 5MEND 1M57B 3IIXA 4JZOA 2ZTGA 4OFYD 1EFXD 2XSXA 3LTYA 4AISA 4P9HH 1PDKB 3L3IB 4Y7MA 2XVLA 5C0NC 1NY1A 2GQ3A 3EG9B 2DWEB 1PJ6A 4LF3A 3BVTA 2YKKA 1GHFL 5DI8A 5C09E 4N2BA 3RWHA 5CC6A 1AHWC 4A2FA 3WY9A 4M03A 4U5KA 2C7UA 2QA4B 3BD3A 3ISRA 4WFEE 1YNTA 2FL5A 3HN3A 3KW8A 2A3TA 1WTLA 3F4VA 3O3EB 2V3FA 1MDLA 1F3EA 3C56A 4ZFQA 1NSJA 3I7QA 4IFOA 3ZIYA 4EI6A 3UWUA 3HPXA 4KCUA 3S36H 1NOWA 4HPYH 2OCJA 4XOTA 3SDXF 43CAA 4AQAB 3R0DA 1GJRA 2FUTA 5ICYB 3NPVA 5CDFA 1FC1A 1ZDSA 2AAVA 4KDVA 3BT0A 4RGNC 3F4NA 2QLVB 4OZIE 3E9TA 3L45A 5IHBA 3KJ6L 4LLMB 4B0MB 4CN4A 4Q8BA 4EWND 4FB7A 5LNRA 1RIUL 4UDUA 1TTBA 1EAQA 1P5UB 3BXNB 3LQZB 4GQ9L 1DLHB 2VZOA 4M61B 1G0CA 3FDKA 3HB3B 3HBPA 1ZLEA 4ZUTA 5HJ3B 4EDXB 1PIIA 5CEZL 3U4BH 1EHAA 2FPVA 4JTKA 2ZXEB 3CH8A 3AU6A 4AG4L 5IQ7H 4N0RA 3WBAA 4HXAL 5JW4R 3S0PA 5HYJB 4JM2A 1W9XA 4X8GA 4FTDA 4QYOA 5EEVA 4JTHA 3LS4H 3NZHH 4FFVD 5B39A 1W16A 1TLKA 3IBEA 3F7PC 5I16A 3BW4A 2OODA 2EVJA 4MYTA 1OQXA 3D30A 5A6TC 4GW5A 5D1XD 5KSAA 4GABA 4OLVL 5FYKU 3CVBA 2BSRA 4DQOL 1U22A 2VJ0A 5FCUH 5DJCB 4OBTA 2FHCA 4TL4A 2GYSA 3WHXA 4TX9A 3RPMA 2E1DA 1MF2H 2OA9A 3N3MA 4Q8PA 2N01B 4FHJA 1TJIL 5TQ0H 4LPCA 4QDMA 3GLEA 2A83A 4LCWE 3N50A 4KZ0A 5B4MD 5E93A 4D6GA 2DEUA 1F9CA 4W85A 4E9QA 3LKRB 2VW7A 3TP4A 4KZEH 3ITOA 4LVFA 5F2IA 4NZJA 4PJ9A 3ZR4A 2NR6A 3K4ZA 1JPTL 4M6VA 1OGGA 3BKML 4OFPA 1Z6JT 1QQDB 2I85A 3JVGA 3S2JA 1P48A 2EFGA 3UNDA 1HVXA 1NUFA 2Y1ZA 4WHCA 3MRJA 2AITA 3DMMB 1XYMA 4BCEA 1P2CA 4JKLA 3UU0A 3NIDB 3DG3A 1IKNC 2CCWA 5IBXC 2E40A 4MD5B 5DJZA 1LTDA 4OD2A 2YSSA 4XAGA 3P82A 4MMZB 3AVUA 3QEUB 1G9NH 4H8WC 5IYPA 2PXYC 4EF3A 4AZCB 2YK1L 1E27A 4L8CB 1AYRA 1W15A 5HXMA 1UJQA 1XUUA 3GMMB 2AK1H 1BFNA 2YR1A 1LEGB 1WYJA 2H26B 1T21B 3H8NA 3NK3A 4Q8UA 1O5KA 1AW1A 5BZAA 4RD0A 2BMWA 2J62A 2OKOA 4V27A 3FAXA 3W82A 1L6SA 2W91A 1SJDA 3CDGA 1BAFL 1NIAA 4LX4A 1N08A 6TAAA 1RSCA 3U9UA 3H23A 3GSWB 2WUBL 1MUWA 1EA9C 1D5BB 1X5YA 2AJVL 3WK1A 4ZB5A 4YAFA 3KM2A 3S5YA 2DZUA 2VSKB 4QRRB 2XA8L 3GQFA 3FN0H 3WX7A 2HTLC 5EZIH 3ISIX 1U91A 2KDGA 1CQXA 4OD1H 3MO1B 3EJUA 4IYKA 1GYUA 1G94A 1YRRA 4KZCA 3IUDA 4J4KA 5F44A 5HMSA 3QRLA 4AU0A 2B4CC 3MDWA 1FH7A 1ML0A 1BG1A 4B53A 1WAAF 3S5OA 5AC5A 5D9SA 3L5MA 3MNVB 4QNPE 3QUXC 4REQB 4Z7NB 2AJXL 4TL5A 1RIVH 3TLLA 5EWIL 1CLYL 3ZMEA 3RM4A 3TVMD 3OO2A 3GM8A 3T04D 1GTNA 1BXUA 2QEXB 1GW6A 1FL6A 4WO4D 2AEIT 3EWZA 3GDKA 3W07A 4ZL1A 4AGLA 1K85A 3DX7A 4MS8D 4GG9A 1BOYA 4MFHA 1KPRB 2W3ZA 3OAUH 5K33A 1MNZA 1Q9OB 4F2MA 5ESQB 1I4FB 4OV6F 1N59A 4RAUB 1K8XA 1E4LA 2J7HA 5D6DC 3IKKA 3WLMA 4F9DA 3P3RA 4HT1L 5FM5O 1DBKL 4DFIA 4JX5A 4LS1A 5HGBA 1SPDA 5HATA 2H8PB 4EIBA 1BFVH 1UA6H 5ADPL 5TQ2H 2FR4A 4Y8EA 3ZK0A 4YVXA 4RZ6A 2BNQE 5I0ZA 1KGCE 2N4IA 4L4TB 4P57A 1F0LA 1QGAA 2H6PA 1PIFA 5D4IA 1MLBB 1NM9A 2XRAH 1UENA 1G9HA 1ZM2A 3MR9A 1C08A 4K5PA 1TG7A 4F0LA 4HALA 4R85A 5A2IH 4E9LA 6A3HA 1IC7L 2ICEA 2LU7A 2C9VA 3DA0A 3GMRA 3QJOA 3A67H 4G6JH 4XO8A 4Z7NF 2QF7A 3OYZA 4RV8A 3HG4A 5FYKL 4YTRA 1S8DA 5GSRB 3PXJA 3QV8A 4DJDC 3NJKA 5JNYA 2D7TH 1MPAH 4E0RB 4UOW1 4YU1A 2HPOA 3P80A 1A21A 4UM9B 3NFUA 4IIHA 5GJSH 1UHVA 3KJ4C 3ZQXA 1JZ7A 2J4WH 1FCBA 1CTNA 2CIIB 4CNIA 1NPUA 3A4FA 4LDOB 3VI3A 1Z5HA 4XCCH 2JIZA 4MZ1A 1O75A 1X39A 4J8QA 2ZX6A 4G1BA 3L1GA 1K4DA 4OCSH 3F1QA 4OZHE 4N4PA 3SLNA 1ED3A 3RK8A 4DQKA 3HPAA 3H24A 4C5ZA 3H9NA 4O4YH 4P5MA 2PNDA 4KKNA 3UTPD 4JFYB 4ENEC 3T4WA 4B27A 5D7IE 1LE9A 4MJIA 2R7EB 4NN7C 1NWTA 8XIAA 4XOBA 1ZEAH 1GAWA 3PJSA 1OP5H 3DG6A 5H4YA 4XO5A 4FQHA 1XLHA 4PUNA 1NBYA 4UTJA 1NWOA 3QV6A 3W53A 2Q20A 3L3HB 1D3CA 5F1UA 4OCYL 4L6DA 2VLJE 3ZKSD 3F04A 3MLUH 1M2VB 1S3RA 1ROWA 4OR1A 1AI1H 1AO7B 1JPSL 2HT2D 1E9OA 1I7TB 4M93B 4XO9A 5C0AB 2Q87A 3T5WA 3NZUA 4GUOA 2QCLA 4UMGA 4LYPA 3ZMRA 1JGEA 2R1XB 3MCKA 3SZKC 3FJ6A 3WFBL 4J1UA 5JPNB 4XVTL 4Q4SA 2XU9A 4U2ZA 3V4VB 1A6ZB 4P3CL 5JYMA 4XBPA 4S3EA 1AS8A 1MW1A 4FI6A 3QEQD 2MOVA 3UC0L 4ERSH 1MCIA 3D8MA 4L8BA 5CGTA 2WWDA 2LVCA 4K5OA 4RPQA 3QAZC 2HXTA 1AD0A 3P54A 3MRKB 4L8DA 5FCSH 2AFNA 3K7UA 3KCPB 1ICTA 5A7BA 4P3IA 3TCXA 4EUPG 5KUKA 1XZ0B 4NG3A 1KTDA 1X98A 3W1XA 4A3YA 4XCNB 3GEFA 4QTFA 3EKZA 3LGEA 5I74C 4BH7B 2P24B 3WTSA 2EECA 1UBSA 4M4PA 3TASA 1CT8B 5IB3A 3G18A 5D8ZA 1MZHA 3ARGB 1QO5A 2VBTA 4XLCA 4FQXD 5KSVA 4NI6A 1RZKC 3U7YL 2ICWB 4XAFA 3V10A 1JDCA 1II4E 1G6CA 3PS7A 2GSJA 4C59B 1FCGA 2PMQA 1UD4A 4TOQA 3UBGA 1RJYA 1FPTH 4XMYA 5H59A 4AIBA 3GY1A 3RY4A 3C08L 4HV8A 4L23A 1SFLA 3E38A 3WBKA 3EPOA 4XPAH 2A4CA 1JVKA 3NCYP 3I1FA 4HBKA 4HIPA 1WOSA 3V9FA 2V38A 1E2WA 4IU3A 5EMUA 3W86A 4IGBB 4D8AA 2QFPA 3DIDA 3LOWA 4PODA 2NWSA 3AWGA 3UCQA 3AALA 1G7JB 1OTSC 2XN2A 1Q0YH 2WPDA 5FECB 3X3FH 1OSZB 3KWSA 5IEKA 4H8WH 2WYHA 5FI8A 1EVTC 4LY4A 1YECH 3SBWA 3QDHA 3X3GH 3GU1A 1QDSA 1W6TA 3LHPL 1JV5A 3LQAH 4PRHE 4XN4A 5IQLA 3ZZSA 2ED8A 3V6FB 4IBQA 5IP4A 5IB4A 1AQDB 3CHCA 1BQKA 3C09B 3WSQL 5CG7A 2GJPA 2A3HA 1QLEL 2O9PA 2DUZA 2VMEA 3R94A 1AD4A 1C93A 3CHDA 3ARXA 1KCZA 1EJWC 3EF7A 3PGFL 3VGEA 3PA2A 1TVPA 2WWMC 1R3QA 1LYXA 5CSZA 5DMIL 5DQ9A 3T71A 5EOCH 2JDIA 2F74B 3F8UB 3GS7A 5F7WC 1TA3B 3TX9A 4U6XB 3QGAC 3SFWA 1GUVA 3KWWB 1JULA 1K72A 3SDAA 3V4PL 2ZZ2A 3S3SA 3FKRA 1D5XB 3ECBA 1L0YA 1XX1A 4NQVA 5J12B 3MBED 4NO3B 1O6VA 4ZUUB 5HNTA 4DVBA 1M03A 4ODSH 1XGYH 4B96A 4A55A 2DORA 3CASA 1RHHA 4R5EA 5C9KA 5F6HI 2F58L 2HT4C 3BQVA 3KPSE 5DUPH 3DOSA 4XHJC 5FYJU 3QHFL 3JSSA 5JHMA 2WLIB 1CURA 1ZCRA 1KT2A 5E6TA 3CK5A 2WB1A 2CHXA 1ZL1A 1K5NB 3QFJD 2VAAB 3FBKA 2X44D 2X7LA 4J3TA 5KN5B 1N7ML 4UTAH 1DJNA 4HDIB 5A6LA 1BG9A 2V7XA 2F1EA 4YVNA 4G5ZH 1QA9B 2XQYA 1XF2A 3CFDA 4JZNA 3F4DA 1XBYA 3V0HA 1MHHB 2VL4A 2XIBA 3QIWB 3MLXH 5LGHH 3E2QA 3HQ1A 1WIUA 5L4IA 5HI5D 1LUCB 1U1UA 5D2WA 4X6DE 5E1HB 5TE4H 4RZBA 1BX2B 3VGAB 2E6FA 2X2UA 3PDOB 3MVTA 1REIA 2EKSA 4FQXC 4WV1A 5IV2B 3REQA 2OEMA 5C09D 3X1EA 3V5FA 2Q7YB 4HLZG 3HTWA 1IJ9A 3MSYA 2MHAB 3K6NA 1XKJA 2XSBA 1BEXA 1P1VA 3EGXB 1TV5A 4IMLB 2XGBA 3ARDD 1MHEA 4GISA 4R90H 1XBXA 3CXDL 2YPVL 2BP1A 3GZPA 1KPVB 2IQ9H 2NXZB 4YHZL 2QCGA 4DYKA 1TTQA 3QZWA 1CFMA 3S48A 2GBAA 3OC8A 1FLRH 4CSTA 2VGGA 3FO1B 4RNFA 5E7BA 3H56A 4ZXOA 5ALCH 3IE4A 4FABL 5IDIA 1H8LA 1OSPL 2XZLA 2A6IB 2W6IA 2OI9B 1Z8AA 3N6JA 1KG0B 4O00A 3GD1C 4D8PA 3CFEA 3VXOA 1Y6MR 3QARA 2VEFA 1A7PL 3GIPA 3QGKC 3QA3A 1WOBA 4JUTA 4L8SA 1U58A 4KZEL 4PMOA 1YVLA 4F7TB 3GSMA 3ARDB 3ES8A 5K69A 1R5BA 5H8PA 3IJ9A 2JKTM 4OCYH 2FZ9A 1EFQA 4PULA 1SU5A 5T9BG 2HS6A 1A6TB 4YC2B 5DMKB 2G95A 2APBA 5E4AA 3N14A 4WAFA 5EC2B 4YSTA 5H1WA 4DRSA 5G4OA 1U33A 5T1DH 4GBXD 4Y2DA 3KHJA 3DTXB 4MHBA 2IQAA 1XJBA 3KLHD 5CCHE 1E51A 3RM8A 5TRDA 4JMXA 3FA4A 1S5IL 3U1QA 2WBJC 1HQRA 3OAYK 1BZ8A 3G6LA 3BL3A 1IO4C 3ALGA 2HLFD 4LVGA 3OKLB 4R7NB 3VH8A 3BT2H 3CVIH 1D6EA 3VPLA 2A21A 4H8QA 1Q8MA 2CSPA 4M7JH 1YKWA 3GHTA 5M1TA 1QVGB 5KBLA 2G9KA 4ZNEE 4E9YA 3S46A 1KCLA 4HWZA 4NHUB 2APXA 1A65A 2AJYL 1RZQA 1RIUH 4IHOA 1ZS2A 1B2WL 4XNUL 3UG3A 3HV8A 2BVPB 5TK2A 5DRCA 1ESWA 4JVUA 1T99A 3QG6A 5FO8A 3WCYA 3H2FA 3UAJA 4O58H 5I66A 1KLGA 1IEVA 4ZAKC 2C15A 3B8UA 4RNIA 2IO5A 3J27A 4AG4H 1PAZA 5IQ7L 1Q9KA 2VCCA 2CBXA 2XOTA 3ME3A 2BFVL 5MHSE 2DZWA 3PG9A 5D02A 1KD0A 3OODA 3BCFA 1YRKA 1MCWM 4YFLI 5IJKC 2CF4A 2L04A 3UJEA 3NQDA 3BG9A 1T20A 2QVNA 1F4WL 3BPCB 3AAZA 1LJMA 2DQHL 5DS0A 3VFGL 3US0A 1EWYA 1U3HC 4U28A 2FE0A 3E1YE 1X7QB 2Z2UA 4E2VA 2HG5B 3LIZH 3M47A 3GXUB 2VLKE 4EN2A 1O5QA 2WXFA 4U0QB 5LNSA 3L23A 2J21A 3SY0A 3UETA 2XZQH 4Y9UA 5LBGA 3KYKH 3RQ3A 3Q45A 1UG9A 1WKEA 3UA3A 3QUGA 3UMTA 1AJ7H 3OL2A 4X8CA 1ZM9A 5FR3A 2DRUA 3IS1X 4I3RL 1UD3A 4QRTA 5F8QC 2ETWA 4K23H 2QSCL 2R1WA 3N41B 2FD6H 1U1HA 1KC7A 4JGMA 3SD2A 4Q9CA 4POYA 4WUUB 1PZ2A 1TXKA 2G3NA 5ICXB 4DKTA 4G6MH 3MKCA 1CLOL 5BZDB 2Z1BA 2YUVA 1TF4A 4JE0A 3ABXA 4L7ZA 4K5MA 2CZDA 2I25N 3ROOA 4OD1L 5JQIB 2X4TA 4JQIL 4AZ8A 2CLIA 3LM7A 4P5TD 5SWZA 5GJTH 4S1FA 4R34A 4XZUB 4EN3C 1DIOA 1POJA 4XKWA 2BXVA 4WF7A 5IJVA 2VMJA 1CEOA 1BBDH 3BGFC 3M4HA 3SQSA 3W25A 4MQ7B 1P5BA 4W9DC 3VO1A 3WIFB 4ZSTA 4N2GA 3GQYA 4FIRA 2O93L 4Z78B 3WEXA 5CZVH 3AXLA 3Q2NA 3SJVA 3SY8A 3WXWH 1KGXA 2XWJB 2JXMB 4NCC1 4B97A 1JUKA 1W3JA 3CFBB 3QJFB 4LAKA 4RM0A 4ELMA 4R7OA 4IDJH 5LWYH 1BAGA 3NCYS 3CHEA 5D8WA 3BNWA 2PBGA 3CQFA 2Q8LA 3I6GB 2DPKA 3GJFB 4XPHH 1G7HA 5EZJA 1VBUA 2RB8A 4MTMA 2WW5A 4Z1DA 2QQQA 4IIDA 2H45A 5KW9L 3O3BB 3MJ9H 2DWDB 3DECA 3O06A 1PKQA 4IW3B 2BP3A 2A5UA 1OFOA 2RFXB 2FWOA 3VFSA 3ZTEA 3C9NB 2Q71A 3WD0A 2H9GB 2P8MB 4M53A 2EDRA 2JFEX 1T5KA 2YPKA 4FS0A 4QEGA 3VTMA 1G7LB 3LQEA 2YWHA 5L0QB 2XSKA 2WKOA 5E24E 4A21A 3BG5A 4S39A 3U46B 4OFVA 1YEDA 2WSDA 1D5ZA 4G1KA 5A1AA 2J8FA 1G7IB 3KPNB 1OEZW 4V2XA 2WN3A 3R7QA 1EAOA 3BVVA 3AMGA 4WR3A 2IIJA 3VYOA 3DDMA 1U8NA 2BJML 3V5DA 2GQFA 1PD0A 2HJKB 5KS9B 3GRBA 4Z76A 3NQMA 1DFBL 2YMXL 4TOYL 2YWZA 4ICCX 4KUZH 1G1CA 2GK7A 1PZAA 2JJTA 5F7KC 1XSOA 3GSUB 2V8LA 1DQKA 3PWPD 1JWUA 5DXWA 3VAEA 1XL6A 4QROA 3EFFA 2VQ1A 5MERA 4QXTB 4ILDA 3EEZA 2RAGA 3MX0A 3SFKA 3OJXA 2ALWA 4HIEA 2Z6JA 4QITA 5HR7A 1FRQA 1M42A 1WPCA 3LCIA 4XCEB 4LMQI 3RDTB 3GD6A 1PYWB 4HC1H 2XKUA 4B7LA 4BCZA 1RK5A 2MNWA 1UYWL 3NFSL 4QRPB 4NZ1A 1AZNA 3QFTA 1ISVA 5EOTB 2ZOLB 3HI1A 4C7GA 2Y7NA 3V8CA 4OPVA 4HT3A 2ERJB 4BINA 3EJYD 1H7NA 1UA7A 2DWXA 2OR9L 1IU1A 1LNUA 2QBWA 1CL7H 4ZTPL 1B9ZA 2LR4A 5IT2H 3P14A 2ZX7A 1OAZL 4HU2A 1KGIA 3KGUA 4Y4FD 5SWQA 3V7MA 2AKZA 4P46A 2WAGA 3QQ0A 2XWXA 5FJIA 1MCDA 4X0KA 1F76A 3VWKA 4AUBA 4HZLA 2OMTB 3QDJD 5FJRA 1K2DA 2E86A 2PP9A 1P4BH 1YPZA 2Z7UA 1RK0B 3GBMH 3SDYL 1S38A 2F5BH 3SCQA 5E6UB 1N7MH 1HJQA 1S5IH 2BW4A 2ZNWA 4B5TA 5MENA 1JIBA 4E5TA 4ZG1A 2ZA3A 4H8WL 2R15A 1T1ZB 4XWGH 3GB6A 4LCCC 3TN4A 4PJAE 4JHAL 2B7NA 4PA8A 1TCRB 1EIXA 1C9WA 2BP8B 1KYAA 2P8CA 4CQAA 3ITVA 4JQXC 3NBNA 3SGEI 1J5OH 2ZXGA 1W3HA 1ZTVA 2GGEA 4L4LA 1OGSA 1BMFA 3QSYA 2F1AA 2X09A 4RXFA 1ZJHA 1WDPA 1ACCA 4XX1G 1EJOL 4X98A 2HVBA 3MUY1 4WENB 5ELIA 2DQEL 4IIZA 1GOQA 4R88A 4ZE4A 4LNYA 1CTOA 4LKXB 4WWVA 3TO2B 2DL2A 1ITCA 4LOFA 1E9LA 1PKYA 4KFOA 1V0FA 4Q8NA 1IC4L 5DMMA 4Z5RB 5IFPA 2R0WH 3EAUA 3CN4A 5CCKL 1OGAB 1LK2B 4ICXA 1S7TB 1WU8A 1ID2A 3WIJA 3A4AA 5HYQA 2JCCB 1LF1A 3EG9A 2VRQA 1R85A 2HBVA 5T3XH 2JALA 2WZTA 3QNYA 4ENED 4UC5A 1M6OB 2WXHA 3FHQA 4LPUA 4U6YA 1H6EA 4R7VA 3VW3L 3SKNB 5C1MB 2NX5D 3V79C 1UWEH 3BVJA 5C07E 3NAAL 2QJNA 1JGUL 1JGLH 1EZVY 1U2RA 5G5DA 4PABA 3IDMB 3LPWA 4EVNA 5GRJH 4BR1A 4R26L 4FLSA 1PDZA 2WHVA 4K55A 2YLAA 3FQNB 4NO0D 4ZVJA 1U30A 1MEXL 3TCLB 2NY0B 3ATYA 3BWAB 4P2RE 5IIEB 4IFKA 4RDVA 4C6PA 1KBBA 1PYMA 4UILH 3JYBA 1NPJA 5EFIB 4J3OC 3U1SH 4XPAL 3BWSA 3VWJD 4BK9A 5ILTL 4IQHA 3R8RA 1OWWA 1CU4L 4UQ2A 4YSDA 5C7XH 1E7UA 3O45A 5GGVY 5DZJA 3FN3A 4NAJA 2HH0H 3QHZL 3M1CA 3ZOAA 5G5IA 4EPKA 2R9VA 4WTZG 1JZDC 1XUZA 4NYYA 4H8PA 1UM5H 4YWSA 2GSGA 5KVDE 1DP0A 5E95B 4OCLC 3VI3F 4BH8B 3G4SB 4HWNA 2GOKA 3IXAA 4HSOA 3UJRA 3TYUA 5DK3A 3FTSA 1E72M 1UZGA 3F2LA 4NZRH 2XG4B 2EO9A 1LEIB 1AXTH 3QFSA 2P4AB 4FI7A 2E27L 2ZBTA 1NARA 1D7CA 2D24A 4PCNA 3IWPA 4HJGB 5GJSL 4HIBA 1A4KB 3OF6A 4Z7UA 3HZMA 4TQHA 4ZO6A 3X1BA 4XORA 1IGSA 2QZ5A 4H13C 1MCKA 1AHWB 2NT0A 2XTJD 4AH2A 4U3HA 4PJGE 1IMHC 3HQNA 5EUKB 3H9ZA 4W5UA 2WVTA 1V6XA 3RWFB 1C9DA 2XQYK 5L4JA 3BFQG 3V5HB 4HKJA 4XH2B 3A13A 3LXAA 3S35L 4L05A 3UBXA 4YPJA 3UDWA 3BPNC 3MQIA 3QH3A 1E2VA 1OCZB 4NC1E 4IOSA 4H6QA 1OB1B 1UOVA 3W75A 1SUJA 1KGCD 2EE0A 3QRGL 2IGFL 4FKKA 4U6VL 4AENA 3OGCA 1RPXA 4WVRA 1WKFA 2ISWA 3RGBA 5TNVA 5BS0B 1JZEA 3T42A 1SXCA 2WUCH 1YPXA 3UP8A 4HQVA 1SR0A 4AZCA 1FBIH 4JHMA 5GIRA 1GJUA 2H7WA 5KVGE 2J7DA 2CHWA 5F9OL 1UVQA 2OKMA 2JTYA 3OPSA 3RGHA 2C19A 2ZTBA 1PD6A 3AUVA 2W80C 3AT0A 2QQLL 3KLLA 5AQ0A 1OABA 1NGZA 1TZ7A 4LOCA 3CM4A 4YL2A 2QMJA 3MV9A 3FQTA 1SOXA 5A2FA 1TR1A 4FG2A 1XGEA 3ZR6A 1T7XA 2DZTA 4MPQA 5DSZA 1D5BA 4Z7VE 1TJRA 4HOMA 4ONFH 4LEOB 3O3AA 4U1LB 4X6EB 5FAGA 1PPIA 4YLCA 4QRRA 2E67A 4XZWA 2UY7B 3U6WA 4DELA 4AT6A 1S2VA 5AZ1A 2WWMD 4FZEH 4NKIL 4HSQA 3WIHL 3FO0H 5AWNL 3ITCA 5JA9A 1TCMA 3GJEA 4DGVL 1TMHA 3L95B 4LIQE 2EO1A 1AQKH 4JDEA 3SDXE 4Z7OB 3WIIH 3V1HA 4X99B 2EDJA 2J1ZA 2PGEA 3NTYA 3LH2L 5EB8A 1QO3A 5HGAA 3EJYC 1TE1A 3BLFA 2WWCA 3QY7A 4IMGA 4P7QA 5CIPH 1A3QA 1S9XA 3INUH 3L4ZA 3TO4B 4H1ZA 4LHUG 3ZBUA 3DVNB 4LVOB 5JHLH 3AVYA 4H3DA 1W3KA 4P9ML 4JY6A 5FWQA 1BQ5A 1EIBA 4TYUA 3SDDB 2X0SA 1UT9A 3G5ZA 5D5MB 3KUMA 4UFHA 4XUYA 3FHAA 1CD0A 4IG2B 4IICA 4GGBA 2WJ7A 3CFKA 3LGDA 5LGJA 2VABB 2YQ3A 4MQXC 3CH9A 4E0CA 3LXUX 2PDIA 4AVFA 4BK4A 2ED9A 5H35A 2V67A 3D87B 5DC0A 3DK2A 3ZE0F 5FKAA 3SDCD 3PPCA 2D3NA 4W9TA 4ERIA 3R1GH 5F8RC 4AF7A 2WBJA 3NDZE 1XR9A 2OBGA 4BFJA 4Y9FA 1R3TA 2R56H 1QH0A 3G0XA 4XD4A 3MRQA 2HFGH 4ZSOE 2ABAA 5F1VA 2AV7A 1FRGL 2J1YA 5D70L 1ICPA 3VACA 4F15C 1L9OA 1XR8A 2GY5A 4MX7A 3HOJA 3T0ED 4TPRH 5KYNA 1GS7A 3ZU8A 1JF1B 4EACA 4MMXA 1OGJA 2EDQA 3GBML 4AQOA 4FX6M 3VNJA 4D9RD 1XAKA 5D30A 2CZFA 3O4OC 3I75A 3IB4A 3KOFA 5I3IA 3A3HA 4Z2KA 1QFWL 5DJ8B 3SJ3A 1G7MA 1ZS8A 1Y65A 5AYIA 1Z69A 5DRIA 1SY6A 5HJBA 1FVDA 3L7RA 3F83A 5AECA 1JRHI 3L4VA 1RAMA 1NCAL 2H41A 5JIQA 3UXDA 4WHDA 4U3SB 5KBNC 3T05A 2YO3A 4OLUH 4D0DB 1XGZA 1TPDA 4DGYL 1JUFA 4L1TA 1SOSA 3TVMB 4JVWA 4LSQH 5I1DB 4OH2A 2YAMA 1TIUA 2BFVH 1M7IB 3R8QA 2YW4A 2EDKA 5CEZH 2GQHA 1H3PL 3TOYA 4K0OA 3GNPA 2G2NA 7FABH 3TYBA 6ENLA 2AQNA 4YDVA 5AKTA 3O41B 2ENPA 2Q86B 1I82A 2QS8A 2CJUL 3MGAA 4WI8A 3DESA 4S3BA 4MD4B 4JFUA 1BQCA 4PRTA 3V0WH 4J1UB 1QATA 5JPNA 5FF6A 5JUEH 5IYRA 3HJ0A 3RAJH 2CGZA 3GHUA 3OZLA 5B38B 1MFCH 4L6OA 3O6FD 3FT4A 4L29B 4ZUVB 2X7WA 1Q6OA 2P0OA 1EK3A 3TNNB 4HIJA 3SHSA 4O4VA 1NDYA 3MLTB 1J9ZA 2PD5A 4FWTA 1DSFH 1KTDB 1K3ZA 4UTCA 1U3ZA 5JQ6H 3UQNA 4GVIA 3SGJA 5HHQA 3BJFA 1PX8A 3EB4A 4HIHA 2BSCA 1V3JA 4F57H 1TYRA 1GTEA 3TZVD 5HJLA 2C5DC 1I18A 3CHQA 4HH9A 4HS3A 4JTSA 4DP5X 3S4SB 3QYQA 5LIWX 5AKQA 4O1DA 5C09B 2KKQA 3P40A 3VRJB 4NM8L 1HNFA 4M1GL 3BUVA 3VFVB 3QDME 1AR1B 4YJZL 3AWNA 5C5YA 5E4EB 1CNFA 4MYUA 5I5JA 1S5TA 5A95A 4FE9A 3KLAA 2OYPA 2GEQA 3EH2A 3L8QA 1U9KA 4MAUL 5H6HA 1YDPA 2IDSA 3N73A 3NQFA 4I6KA 3BQ5A 2FBRA 3WS3B 2FH6A 2COVD 3NZ1A 5E94B 1DANU 4MAVA 1TNMA 4XOAA 5T3ZE 5E0QA 2D0FA 2L7UA 5EO0A 3VYPA 1FJ1B 1MRDH 4MA8L 3MJMA 3MNZB 4NYUA 1MJ8H 5E8NB 1D5IL 1DBML 1JZIA 4M7LL 4O9HH 2WXIA 5E8OA 3R7MA 5CCGE 1OSZA 3HVDA 1T2QH 2EIJB 2Y5EA 3DXIA 5T1KA 1OCWL 1KTBA 4LCIL 4AJYV 4IOTA 5H8DA 3N17A 1KEGH 3ULUF 4Q7BA 2KX9A 3F4CA 1T5EA 1AQDA 1YY9D 3ULVL 4GS7C 1TT6A 1A1OB 4QHKJ 4AUJA 4QE5A 3QEHB 2NX9A 5A6BD 5FV2A 4ML4A 3ZZLA 4HYTB 1YPZE 4R5TA 5I6NA 3C5JB 4PJCB 5D96B 5FDWB 3U0WL 4WDIB 4RLIA 4JYEA 3V0DA 2ZZUT 1L0XA 3CFJB 5KETA 3KVLA 2ID5A 3MUIA 1QCWA 4M0XA 3QIUA 4P5KB 3ECBB 3GSNH 3HZYA 1Z5LA 1KB5H 3ZHNA 4F3FA 1F1DA 2DP3A 4YXHL 5FOBA 1FI8C 1GGCL 2XWBB 4LCWB 4AYFB 1OAZH 4I5XA 4JTDA 2OO0A 1XBDA 2ZRXA 4HF5H 3BIBX 1EHLH 1JZJA 4O54A 2VITB 4EF8A 3JQPA 5HOSA 1AS6A 1UQYA 1L6GA 3UEQA 3VFGH 4O57A 1KT2B 3WUWA 2DWYA 4AXNA 1K5NA 2OK0H 3NOEA 1E1RA 3HU7A 3QC0A 3L3DA 1SJHA 4PJ8A 1CENA 4NZ8A 3CPRA 5I3HA 2R29H 1XB2A 6FABH 1OX4B 2E7FA 1IR1A 2JQAA 1KNOA 4ISVA 2RC5A 4DNHA 1IAOA 3MXWL 4PRHD 4DP1X 2O26U 1G4TA 4KRMB 1YYML 1UUSA 5TH2A 2BOLA 2FIKA 2O6EA 2BM1A 5IGXL 5A16A 2YZ5A 1MUCA 3EOUA 4LAOA 4P2VA 3W7QA 3F12B 3LH2H 3P9WB 1S7RA 1OF6A 3MNMA 3UG5A 5FF2A 2DYRB 4WI6A 2P5EB 2PDFA 4JQ2A 2I7GA 3QZLA 5KZEA 2MHAA 2ZSWB 4KRNA 3HR6A 1WZAA 1GSMA 3VFRA 1JGVL 4P2RA 3MXVL 1ADQL 1BZ7B 1KBLA 5AL8A 4NKQB 2J3SA 3FRUB 3QHMA 1U8OA 3SQBA 1C12B 1Q6QA 2A5HA 3MJWA 4TVPL 3P4MB 4HK0B 2DEWX 1IM3B 2E9WA 5JA8B 3Q3GB 4GG6F 2BS71 3N2OA 4P4KA 1G4RA 2P46B 1UQSA 1HKJA 1J5OL 1SEBA 1AMYA 1S5NA 2DEPA 5EOCJ 4QQUA 7REQA 4CVXB 1PLCA 2CM5A 2KQNA 4P12A 1XGRA 4H9GA 4Z7NE 2VM9A 4M1DH 4LAZA 1UKPA 5HMFA 2LE9A 3PWJA 2EDHA 1TPC1 3MMPA 1HKLL 2VXSH 3RA7L 1UWGL 1W6LA 1YSOA 2BPOA 5EB9A 3SDYH 3W9EA 3ABZA 1AHKA 4YPGA 3N6QA 2AJVH 3JT2A 5C0CE 3RJQB 5FYJD 5C70A 4BWLC 3TUUA 4B9PA 3O6LH 4JPIA 1J05A 1BD2E 3TESA 3GTFA 3ZTJH 1A6TA 5DMKA 2NWRA 2D9RA 4MDIA 2CHOA 4JO4H 3QULB 2X3UA 1O94A 1XI3A 2Y7MA 4MA3A 1RK7A 4ROPA 3QIBA 1BEYL 1NGXB 4FFZL 4YWGL 1P4IH 3U6XA 2W0LA 2ACUA 2HT4D 2YXXA 3VIMA 4GLEA 1UUNA 2X3BA 2E7BA 1LWIA 3M0LA 1BZDA 4J7RA 2MCPL 5GQBA 4OPSA 1PBYA 2DQEH 1N6VA 3N2JA 3LYRA 4GK8A 3ZPNA 3CPWB 1NC4D 1RXLA 4QEEA 3QZWG 1D5MA 1ZK9A 3OKXA 1T1YA 4ZE5A 1MCRA 3AQXA 4HEPG 1U1JA 2QMUA 2EPLX 3BP7A 1T0OA 1B4EA 1X44A 2A85A 1UWFA 1N8ZA 3RJDA 4HWEH 2WNZA 4YAWA 4P5RA 4AYID 3CAWA 4C7FA 1RUML 2G75B 3KRSA 2X41A 3CQPA 4D6FA 4H01A 4IHOB 4RRPG 4RFNC 4TUUA 4FNPA 1NFKA 1RH9A 4MB1A 3MMUA 3TROA 2EDWA 2FVMA 3CYVA 5D09A 1I2OA 1P0EA 1H15B 2AK4E 3T4AA 5DO2D 1IM9D 3URNA 1KPUB 1NKGA 1TVHA 1LT8A 1NCDH 4HPOL 3LV3A 4Y9EA 1JD7A 4KKPA 5A3ID 2OX5B 1FXQA 5DMNA 4UMSA 1NVMA 2IQ0A 4ZCMA 2D4FA 3TJEH 4TRPL 4QE1A 4Z0XB 1A4AA 5IB2A 1C5DB 1GYLA 2H0JA 2IMMA 3F7VA 3OR7B 4LASH 4O4YL 3TPUB 1FWGC 4HK5A 2WVVA 2MWCA 2LU5A 1HQ4B 4UTHA 4G6JL 4Z23A 2YZ8A 3CX2A 1NMAH 4XMPH 4DJMA 3NM3A 4Z1MA 1KJ2B 2B4GA 1Y0LB 1S2UA 4R9HA 4I77L 2D0HA 2OSYA 1AO7E 1PTAA 4Y1AA 1PZ5A 1Q94B 2YQ2A 1JRCA 4DHGA 4HA1A 5LXEA 2EKCA 1NFAA 3N1MC 2FQDA 2IV9A 1NOAA 4AVIA 4BV1A 2X6CA 4U7SA 4GYBA 5DMIH 5I30L 1H63A 4UQEA 5JW4M 1A9BA 3DPBB 3FQXB 2H9AA 3C6CA 1M9WA 4Q8TA 5I78A 1Q9LA 5JOPD 4S1RH 3HE6A 5BU6A 3RLVA 2YA1A 3CSYB 2J2ZA 1R46A 1WK0A 2NV1A 1UZDA 1E63A 3G7TA 2B7QA 2EXWC 4I9AA 4RXGA 4HZAA 4IJ3B 2MSPA 1VYRA 3MNWB 4XMVA 3ATZA 4ZW7A 3R0UA 5I1AA 5M3WA 3MACH 1HHHB 4NWUL 4NQEA 3FCSB 5E6IA 2NNAA 4UT9L 1ZANH 1EFCA 3B2XA 1VGAA 4YHOL 4PLKD 4DPRA 1O4UA 5F3FA 1E4WL 2DTMH 4MDRA 4NQED 3K6DA 1EX1A 4G1NA 4A6YL 2Z34A 4LQFL 4NT6B 3SB3A 2CGRH 5EEYA 4TVSa 2WYSA 3PG8A 1TENA 1ONRA 5HJXA 2XZOA 4D0CB 1JV2B 2VR2A 4X22A 4QRRD 2PABA 2XXMB 3H94A 1E5JA 2QULA 3SY6A 3CUPB 4AG0A 2DY3A 3ZVHA 3FIGA 3BE7A 4MNJA 4B43A 1T7ZA 1EZLA 3GRWL 4Z0BL 1XGQB 1FWFC 4M43L 3D0LB 4P8QA 4UT6H 1CBVH 3QQDA 1YEYA 4H6EA 1SZEA 1KYOJ 2FAUA 5D72L 1F02I 1VADB 4RLZA 3RAJL 1BYNA 4NBXB 4IOFC 5F88A 4A22A 1OAKH 2P8MA 1RZJC 4WRHA 1XGUB 3BVUA 5EZLA 5I1KH 1KV8A 3AYSA 1PX4A 2DQUL 2VQ4A 3JXAA 2IANA 3OLGA 3T0AA 2LW3A 3WN5A 3TYGH 3D39E 1BWLA 2HB0A 1YPFA 4G5GA 4A6YA 3QKZA 1NGPL 4Y7OC 2XFXB 1GKQA 4CQ8A 1G7IA 3VFUB 1RZ7H 1W5QA 3FTYA 1OC7A 5E9AA 3Q1SL 1JTOA 2J5LB 3A0OA 4G8FB 2CUMA 5C0JA 3Q3AA 2VLJB 3N5AA 1XB3A 3EBIA 5E70A 4EI5B 4BPRA 2HVJB 4WUUD 3WF2A 2FX8L 1QVFB 5F89B 3IACA 3V0AC 3EA2A 1GYAA 4ZCIA 1S3KH 1RCOB 4XX6A 5G4WA 4MAYD 1BFSA 4QT5A 5EZPA 4YAQA 3BLKA 4OI7A 2WLNA 3QTGA 5LGYA 3QEGH 2XJKA 1XDLA 4P4RA 4UINL 1DKWA 3TA3A 2F7FA 2R69H 3KL0A 2OMXB 2RH9A 1HL5A 1S7XB 2FBJH 2VWEC 3N3EA 1MFEL 4HIQA 5J1SC 1V79A 2GDQA 2CLZB 2BDQA 3QI9C 4CQDA 3UPWA 3JT0A 1TQCC 5F9AC 1J9QA 1N64L 4MMXC 3VWKD 4JR9H 4BZYA 3VRIA 5D2XA 1CFQA 5HVHC 4IQLA 2FVKA 3GKWH 4OUUA 5B80A 4UI2A 1CLZL 2GAZB 2HCZX 4L0ZA 1KYFA 3KGSA 2E1RA 1QUFA 3PQYB 4PLNC 3H6OA 4G1MA 3NQ2A 5U7SA 1BJ1H 1NAMH 3IJYA 3B2DC 2ZZGA 2P5NA 2CXEA 3GWQA 1LRNA 1Q9SA 1NQKA 4Z0SA 2G4EA 3PWVB 3ICJA 4R84A 3OTTA 2LGNA 4WI7A 1NLDL 5KVGH 1XLIA 2Y0SA 3RITA 3CC1A 3BPLB 2E09A 2G37A 1EJFA 2XM1A 3BUIA 3TWBA 3LN4A 1R3RA 2JKIS 4FTVA 2OLDA 3APCA 5JW3L 4AVHA 1SY6L 4KEZA 1H3XA 2P7TB 4FL4B 5HPMA 2BFGA 4Y19A 1VQ6B 3KPLA 3RZWA 2P0IA 5A2KH 2PTZA 3BGGA 5XIMA 4IBYA 4Y2OA 1B2WH 3QCVL 4HAKA 2A77L 2ZCLL 3R4IA 4TQPA 4GT7A 4AQAA 4LF2A 1ZB5A 2Q1EA 2X1UA 3OLIA 3TA3D 3L5WA 5KBMA 3G5XA 3EWBX 1NJJA 3OBKA 4X83A 3LXBA 5C0AD 2NQ3A 3C87A 1PQZB 3BI9X 1VYSX 4IMEA 1OO2A 5FSDC 3CCUB 1T7YA 3AWFA 3D5OF 4HJEA 3OVQA 3L0GA 4HKZB 2X1PA 4K71C 4X50A 3ZVIA 5AB3A 3FCBA 1QFHA 1ASPA 2ZX8A 3MRBB 4MB3A 1MNUL 4MJID 2AL1A 1NANH 1PSKL 4YAUA 3PQYD 1CXEA 3BN3B 5KG9B 1E0XA 1UR2A 1KIQA 5C0RL 2TYSA 3B5HA 2EDDA 2IBZX 4AQZA 1PGRB 3T4YA 5FHAL 4U1SA 3WUZA 3GHRA 5AWNH 1SQ2N 4DUXA 1DO6A 4F9PC 1BD2D 1KB5L 3HC4H 1W0JA 2OEJA 3S8FB 1AY1L 2QKIC 2XXGA 3ZX1A 1E4HA 4AM0Q 2GLKA 3BZ4B 1HTYA 4XCFH 4XOCA 4A66A 5I8CB 3DX0A 5FS5A 3I6KB 1EXUA 1WKYA 4L4TD 2YARA 3ILPB 3PSVA 2CBJA 3MOQA 1CGYA 1F18A 3O81A 3Q7JA 5IW1A 1RJZB 4IBLT 3ES6A 1SZNA 3GSXB 5DHXB 1A5LC 2RFGA 3BXNA 3LQZA 4LVHC 1AGEB 4ONGH 4QRPD 4WQOA 3VMPA 4HVBA 2TSAA 2PDXA 5EEWA 4C56D 2R2EA 5JUEL 2CJ3A 1CFVL 3EOTL 5I0YA 3B8TA 4WXZA 3CVDA 1GC1C 2NNCA 3THML 4MDOA 4JS7A 1W8NA 2P49B 4JTTA 4U4IA 4X05A 4QCEA 4I0KA 1J10A 1S2CA 2ATMA 1PS3A 3CWNA 1ZHNA 3RI5K 2WHKA 3N44F 3FJ4A 5DANA 2EXTA 2IH3B 3B0YA 5HHNA 3D69B 3OGOE 4JBSA 1WAAA 4IHBA 3LMZA 5JR1L 2E9JA 4NUQA 4OCWL 1IGML 2CALA 4OD2B 2KZBA 3ARBD 4UIKH 2OTPA 2R0KL 3JTBA 5T33H 1BTCA 4D9LH 4RPPA 1GZPA 3C60B 1RMFH 4OCNC 2PCFB 3OSVA 1QKZL 1P84J 1CL7I 3ELQA 2OSLB 1X3DA 2AV1A 2IJ0C 4HUCA 5SV4A 2AF2A 5J35A 4B5ZA 4N86A 4LOUD 1SM9A 2A4AA 4OAWB 1NFBA 2RBLA 4CN1A 3P7YA 2PSNA 5BW7C 4YELA 5AYUH 2F15A 3OLDA 3SE8L 3ENLA 4YGVA 1QQDA 4FAMA 3L5AA 1YA5A 4ALDA 1J2BA 2XWDA 3N0PB 5AD0B 2C0HA 3WH7A 3HZMB 5CEZE 3OJGA 1FH2A 4O14A 4Z4RA 2ZSVB 1XF3B 3LHPH 3WY1A 5J0BA 1EXBA 4AH2B 4KPHH 5BS0D 4QJ5B 3CSBA 3ANVA 1WSST 2IDCA 3WFHA 1G9MH 5IQ9B 1JJ2B 3QHFH 2DTSA 3RDJA 2VKWA 3K46A 3TA3C 4XH2A 4Z77B 3W9ZA 3WJMA 4CVWA 4LSTH 3UBXB 3WK0A 3DURB 3QH3B 4K8HA 1MHCB 2WZIA 4WJKB 4OQTH 1XBRA 1R3IH 1LEGA 3GX9A 2QFRA 2DJLA 1EZSA 5J6GB 2WC7A 3OZYA 3P3YA 3V0VA 3IRZA 4LLVA 2FGWH 1FPTL 2BK8A 3HTLX 3LBOA 1XEDA 2X70B 1G7QA 3NXLA 3U9UB 1Z42A 2X12A 4OT7A 3HI6L 3W76A 1T83C 1E4XI 4KHTH 1L6YA 5EZOH 4HS8H 4JDVA 2WCPA 5EBGA 5L9DL 2G4FA 2IQTA 2PTTB 4AJVA 1SYTA 2LTQB 3NT0A 3VI2A 4RGNE 4IRSB 3Q38A 5FO9A 2JKAA 2VEIA 3D3AA 3LEVL 2XTJC 5SWSD 2YKLH 2AKMA 1VQMB 5EUOB 3MV9B 3SJPA 1RI8A 1IXNA 4FEZA 1CE1H 5DI8B 4LRTA 5FYLE 1EGMA 5H94A 4O1CA 2B5IB 2ZT9C 4GIPD 5GSVB 2QGBA 2WJZA 1VEMA 2VDOL 1P7QA 2BZ7A 4M1DL 1UG6A 2FL5B 1URLA 3QAQA 3BRDA 2H6PB 3PAOA 3NABH 1CGVA 4LS2A 4MDJB 3WH9A 3UYIA 4F27A 5HVWA 1XGPA 3ARSA 1AW2A 5IWLC 2QV5A 4KK6C 3W2HA 5LN4A 4W88A 3B7RL 3QUYD 3HF3A 5TE4L 4PE8A 4E41A 5LG6A 2IFGA 4TVPH 1BSLA 1DVFC 1WUZA 5E8DL 5CZJA 1ZDQA 3SDCA 2PDPA 4PLJC 4ZYKA 2UV8G 1F6PA 1ZLVK 2EGZA 3HE7D 2CERA 1KCRH 4OLZH 5EU7C 4XN2A 1TFHA 2F19H 1Z3GH 3GSQB 4XD3A 1X38A 1OF2B 1KFAH 3OQ3B 3SKOB 4O0QA 4UUIA 2E9LA 4HU0A 3RCMA 1XQKA 4U0RB 3ZTNH 5I0WA 3FSZA 3SM0A 4OIIH 1ZHAA 4RE0A 3QXUA 1DBBH 1I9IL 4BUGA 5I1CL 1WV7T 1XD0A 2EAEA 4M1CC 1IM9A 4JDZB 1R7AA 1TIMA 1ZUNB 2ENYA 1NBYB 2IAMC 4NNXB 3RHWK 4GW5B 1TJXA 5BZXA 5IJCC 3G1VA 5D9OA 5BXFB 1CB7B 4XVOA 5J6HA 3KOXA 3P9LB 1AO7A 1MWAA 2BIHA 3BAEH 3HJZA 1ZA6B 1UXSA 1F41A 4KXCA 4ZQRA 4J6RH 3VD3A 1YPIA 3ASTA 3WLSA 5FFOA 1I1CA 2CIIA 2R1XA 1JGEB 4N1EA 1EFTA 4TKWA 3TIEA 4EJ1C 2DV6A 3M5XA 1YN7A 2FCBA 1KSRA 2NLYA 3OX8B 4XMUA 4JREB 4G6AD 5EBMB 1UWEL 3UYRL 4MMXB 1LCOA 5FYLD 2ITCB 3Q48A 2DSKA 1K4CA 1BX1A 5LIUX 1VQ5B 2IDTA 4G8IA 3BFOA 4NF7A 1ZHLA 4GX8A 4OUEA 3DMMA 3NQCA 2X6MA 4RNRA 4LCUA 4UTBL 1S9WA 1XQBA 3NTCH 4NQSB 2VDKL 4CMMA 2IDUA 1TKWA 3TJHC 3CFMA 3VD5A 1JPKA 4R0LA 3ULUE 5IFTA 2W27A 3BUTA 3QDAA 1FVCB 3W7LA 1JUFB 2AJUL 4FMKA 5C6TH 4LVOC 4AI7A 3BC9A 2O6PA 3LCXA 5BSYA 2NYKA 3TQPA 2VNJA 4PS7A 1PG7L 4M5SA 1R6VA 1QFOA 3K2IA 4GMTL 1S0UA 1NMCB 2E59A 4H9MA 4TULH 3U9PL 3JW7A 4AZUA 1NC4A 1A4CA 2DY2A 4HV8B 4U1HA 3M8OL 1D7DA 1HE7A 3W81A 4DVRH 1F4XH 1HF6A 2RJGA 4OT1L 1AXSB 2YD0A 5K9QI 5IRPA 4FP1A 5E6RB 1RUMH 5GRZA 2GY7B 3GRWA 5FF6B 1KELH 1QYGL 2X4SA 3THAA 2OJZH 5B7YA 3VGAC 3VFWA 4GPNA 1RUPH 2VFGA 2J5WA 3AO0A 4NZFA 3GNNA 2J56A 4XKVA 3PAYA 5IEKB 3N9RA 3AS0A 2JJWA 4R3SA 1DCLA 4PJ7E 1I1YA 4WI5A 5JXED 1GZGA 2KVOA 3WZ0E 1QI0A 4HNVA 1PMYA 4NC2B 3Q65A 4WGWB 2ZUQC 2OO6A 1JPST 1RIHL 1MI5A 4RETB 5AHNA 2ZKXA 1UIPA 2Y7SA 5KVFL 3MBDA 4RPDA 5KSUA 4JPVH 3K1GA 5CSYA 5F3HB 4GKTA 3RVTC 1ETZA 4JANA 1VFTA 2VRJA 4TXEA 4PPTA 1G0YR 4LLDB 5CZVL 2I60L 3S4SA 5B3JE 1T0NA 3S5ZA 3PAUA 5DQ9B 1TA3A 2V2CA 3AAMA 3GK8H 3NOYA 1N70A 3EX4A 3H7BB 3QXDA 3LXCA 5DUBB 1S9VB 1DQIA 4PY7A 4XXDA 3KLHC 1YNYA 4J2QA 1PNCA 1YDPB 4NS0A 3BPNB 1KXHA 3FU5A 3HNTH 4MXWH 3WTXA 4KUZL 1J9RA 1UZ6E 4Y16C 5DHVA 5E94A 1T8XA 3W11D 2BWQA 4DVBB 1OLZA 5F7EH 2QTEA 4KJWD 2OZ4L 3BZFA 5HDQL 1FHDA 1W2PA 4FOKA 3QPQC 2YD4A 1AGDB 2QR0A 4OZGB 5IESH 1QPOA 5IWLA 4PYSA 4II2A 1JXGA 1BYCA 3FGCA 4IIFA 5TR9A 3ONYA 4K9JA 4AX3A 3LH8A 3MBWB 1C08B 2X53A 3CD6B 2ZVRA 1QFUH 1EBGA 5ILTH 4BZ2A 6XIAA 1CFSA 1MKFA 4K2UH 1TV4A 1RPKA 4AWUA 1DBJH 2R9HD 4TTDD 2O4MA 3UPAA 1Q45A 3NM1A 3THQA 3ZE0B 3CGTA 1V6WA 2JQMA 2GDVA 3GZ3A 3H9HA 3SCMA 4M80A 4JPWH 4AHOA 5KITA 5F2MA 3CZJA 1CGSL 5HHXL 5K1JA 4XD6A 4WY7H 3UGUA 3QJVB 5E1GA 4B3XA 1OP9A 4WWKB 4MVBD 5KW9H 1GKRA 4CADA 2NVCA 2W0UA 4TNVK 4YSAA 4G83A 4UYQA 4ZR8A 4GRWB 3IUIA 2WNNA 4JPGA 3W71A 1DSWA 1ADSA 2PTDA 4JO2H 4HXAH 4JL1A 1Z1WA 3CIXA 1WDWA 2BHFA 1LE9B 4IMLA 2C14A 3HZYB 1LVEA 5ESVA 1VR6A 2MANA 3LQGA 4FZIA 3KAAA 5DCEA 3T0WA 3CHSA 3OFNA 5IFAL 2EUZA 4MY8A 4APXB 3UJFA 5HHOD 2YQBA 3KOWA 3BP5A 4YGAB 3MGOB 1V0NA 4GAYB 4OGQC 1BVKB 2JTDA 1QI4A 1QBML 4D2NA 3EJCA 5JW3H 4EEEA 1OM0A 1LLZA 2DPEA 3GVJA 1DBAH 1BQHA 5C0DA 1EFXB 2YMXH 5K39A 4TOYH 4KXAA 4NUWA 3VIHA 4JTUA 4DLMA 1DVQA 4FXLA 3PVDA 3T3ME 1MH5B 1MW0A 4PRRA 1NC2D 4C1NB 3Q2CA 3KD4A 1CXKA 5I8EA 3HGSA 3PNWA 3REWA 4HD5A 1LK3H 3AMCA 2FECI 2X88A 4B95C 1H3GA 1KIPA 4F7TA 5B8CA 1NU5A 1ZVSA 3I6LD 4LUYA 5KMYA 2Y2YA 2GIMA 3VE7A 2E6PA 1XZ0A 4OVUA 3G1SA 1SXBA 5CJ8A 4XCNA 4F7MA 4GMSL 4GVFA 2N3JA 2Z92A 1FZKB 3T09A 5IXEA 4AE0A 2NDGA 3E74A 3O6YX 2OT1A 4H44C 1XMEB 4PJDA 2Q3OA 3MKGA 3HM7A 3SCTA 4C6NA 3PXHA 3PM6A 2WB7A 5DD0L 4FNQA 2NY4B 2WQSA 4V11A 2ZRZA 1Q6FA 2J6WA 4L9LC 1IBGH 1FZOB 2FJHB 2AQQA 1TREA 3F5WA 5D7SL 5FSEC 3I3BA 1BAFH 3TX4A 1H9VA 1WAAE 3GXFA 4NN7B 1SM3H 1SBSL 4WQMA 1YY9C 4H9TA 1TFPA 4Z7VF 2ORBL 2V31A 5KVEE 3B8DA 1Q38A 4JM4H 1DVFB 3H7UA 2ZICA 3LNIA 2O5NA 1KBPA 5FW7A 3ETTA 2K45A 4A39A 5F6IB 2W92A 2BOBB 2CZ5A 1ELOA 4MPKA 4M5PA 2LLLA 1DBKH 1WA2X 3LCWA 4O50A 3D25B 3T8LA 3KMDA 3MUAA 4OW6A 4JFOA 5G55A 5HHMB 3WXVH 2WIIA 2XN9D 4LCWD 4XVSL 1FDYA 1GGBH 3I9GH 4E41D 1P7TB 3BUBA 4OLWH 1LDSA 1J05B 3HS0B 4WEUD 3PWUA 5GRUL 4GG6B 4GINA 2DCUA 2VCBA 3NWRA 3ZYJA 2QPUA 4YTQA 1KN2L 3QULA 1MIML 1O7DC 3RPBA 5C3LD 3X1NA 5H8MA 4YK4B 3ZWSA 3KFTA 1C5BH 3W85A 4EP8C 4WEMB 1WBZB 4BUHA 3EWYA 2CBQA 4XN8A 5DRZA 5HDBB 3BUDA 1ECZA 4C56A 2DJ4A 1DQMH 4CC4A 4IMKA 1SFDA 2EDXA 2X4RA 3QUMH 4NOBA 4JOMA 3P11H 3KWWA 3EH4B 4HEMA 1PL3A 3AC0A 4HKXB 2DWSA 1EXHA 5EII