2DIEA

Alkaline alpha-amylase amyk from bacillus sp. ksm-1378
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
481
structure length
481
Chain Sequence
TNGTMMQYFEWHLPNDGNHWNRLRDDAANLKSKGITAVWIPPAWKGTSQNDVGYGAYDLYDLGEFNQKGTVRTKYGTRSQLQGAVTSLKNNGIQVYGDVVMNHKGGADGTEMVNAVEVNRSNRNQEISGEYTIEAWTKFDFPGRGNTHSNFKWRWYHFDGTDWDQSRQLQNKIYKFRGTGKAWDWEVDIENGNYDYLMYADIDMDHPEVINELRNWGVWYTNTLNLDGFRIDAVKHIKYSYTRDWLTHVRNTTGKPMFAVAEFWKNDLAAIENYLNKTSWNHSVFDVPLHYNLYNASNSGGYFDMRNILNGSVVQKHPIHAVTFVDNHDSQPGEALESFVQSWFKPLAYALILTREQGYPSVFYGDYYGIPTHGVPSMKSKIDPLLQARQTYAYGTQHDYFDHHDIIGWTREGDSSHPNSGLATIMSDGPGGNKWMYVGKHKAGQVWRDITGNRSGTVTINADGWGNFTVNGGAVSVWVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords amylase
publication title Ancestral sequence evolutionary trace and crystal structure analyses of alkaline alpha-amylase from Bacillus sp. KSM-1378 to clarify the alkaline adaptation process of proteins
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 177
structure length 481
sequence length 481
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2dieA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2dieA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dieA01
2OSWA 1GVIA 2E9BA 1KCKA 4BQ5A 2XVPA 2GK1B 5A69A 1IZJA 1ISVA 4AXNA 3MUAA 3WQVA 3ARQA 1B3ZA 2XIIA 1JNEA 2WHJA 3U5YA 2WCAA 4P8WA 2QV4A 3UCQA 2DT0A 5C70A 3BVTA 3AS0A 3TV8A 3FN9A 4J3SA 1RD6A 3BUBA 1DP0A 2WNWA 1O6IA 4U2ZA 1UA7A 3FHAA 1XH0A 3L4YA 1RP8A 1XCWA 4AZIA 3GBEA 1G1YA 2BXYA 1JL8A 4L4OA 3RPMA 1FFRA 3U57A 4OKDA 1OBAA 3WH5A 3PTMA 3MUZ1 2ZXDA 3EMCA 4D6GA 4UR9A 4JZ5A 5C71A 1NP2A 4PMUA 5C8BB 2J79A 1UWTA 1JYXA 5I5RA 4RL3A 5FKYA 2D23A 3UESA 3MMWA 3K1DA 3WDHA 2CHNA 3A6OA 1E6QM 2PF0A 4AYSA 5E1QA 1AQHA 4M8UA 4FNSA 2FHBA 4ZENA 5DFAA 1TQSA 2NT1A 1HJQA 3GYCA 4ACZB 3MANA 3W4RA 1DWFM 4DO6A 5A8PA 1BYBA 3WBAA 3KL0A 3UEQA 3VOCA 4U31A 4UQEA 1DWJM 3A24A 4QCFA 5CGTA 5A8NA 3N18A 1E3XA 2XN2A 3AMLA 5CLTA 3PZVA 3CUGA 5EB8A 3AICA 2YIHA 3GZAA 2VCBA 2DPEA 1YQ2A 4AZ7A 2VR5A 4UOQA 1EGZA 1AVAA 2J62A 3EBVA 1UASA 2GJXA 1KR0A 4UQAA 5BROA 1CXFA 3A21A 3N04A 4Y7EA 1EOMA 5KZ6A 1V6WA 4S3JA 2WMKA 1CXLA 2WCSA 3WMSA 1QI4A 2WMHA 1NWTA 3THDA 3GH4A 4DUVA 3VX0A 4AC1X 2E3ZA 2F18A 3CGTA 3IAPA 3MUY1 4JHZA 3VIHA 1ISXA 3SUUA 3OG2A 2YDQA 1J0YA 1UWSA 3BXWA 1ZJAA 2D2OA 4FLSA 3KL5A 2UWFA 1Q6EA 5FIPA 3GTNA 1OGGA 3WF1A 4A3HA 2CITA 1BHGA 2BY1A 3QHNA 2G3IA 3ZMRA 1TFVA 3CIVA 3ARWA 5HDRA 1Z32X 3WDRA 4GXPA 4M82A 5CXPA 3VMPA 4AIOA 2XPKA 4ZXLA 5IXEA 3WQ8A 4C7GA 3OLDA 1B1YA 2ZUVA 3B8SA 2IXVA 4PTVA 4CU8A 1U30A 1BG9A 4D6JA 3JUGA 2CYGA 2J7GA 2X09A 3NJ3A 3GXTA 3ARYA 3RO8A 4UCFA 1FA2A 1OWQA 3A4AA 3F5LA 1H11A 4W5UA 1HXKA 3SCQA 3VVGA 3VU2A 1PS3A 4KH2A 1E71M 1BQCA 1V3JA 3ARTA 5A6AA 4TTUA 4PMYA 2XVLA 2AAAA 3BUQA 2XYLA 4AD2A 5A2CA 4AIEA 3PZTA 3MI6A 4OIFA 2WXDM 2WZEA 3LPGA 1NARA 1H0IA 4UOZA 1V6VA 1GHRA 1XYZA 2FYVA 1A47A 3CMJA 4KWUA 1EH9A 2J7DA 3WKZA 3OIHA 3L4ZA 2QHAA 3HZ3A 2VRKA 2GUYA 4JCLA 3WDIA 3QHOA 1NWUA 5CSYA 5GPRA 2WMFA 3AIQA 3EMQA 4AZ6A 2NT0A 5BXSA 3VIKA 3PTQA 1C8XA 1XSIA 3D4ZA 3VNYA 5A8OA 3BLKA 1W32A 3GNOA 1KBKA 1ZBKA 2DSZA 4P7QA 4CVUA 3SCRA 3LRMA 5A6JA 4J3WA 1VF8A 2GFTA 3AZRA 4PMXA 5ECUA 3VDCA 3TTYA 1O7AA 4PMZA 1QNPA 3ARVA 2F7OA 3UG5A 2C8NA 5D8ZA 4WSKA 3TTSA 1DHKA 5AYBA 1NH6A 3NSXA 2F61A 4GZJA 4FLQA 3VIFA 4QLLA 1UG6A 3PZGA 3T09A 1K9DA 5I24A 3CZSA 3WD0A 1CLXA 2CERA 1G0CA 1DWGM 1RP9A 2X2IA 3IJ8A 5BYWA 2VVNA 1MVYA 1E4LA 5D9NA 4DM2A 3QOMA 2V3FA 4H8UA 1GPFA 2EADA 2VTFA 2OSXA 1XCXA 2WC4A 1PJ9A 2XSBA 2CNCA 3VD4A 3EYPA 3MO4A 1JD9A 1G01A 2O9TA 4J3TA 3KEHA 4X9YA 2VX7A 1E40A 3ARXA 4JFUA 1GW1A 2C7FA 3WN6A 2CKSA 2VVSA 2D0GA 1CTNA 1R85A 2VQUA 3VTRA 5IFTA 3TP4A 4MB5A 4GI8A 4M81A 5I6SA 1M04A 2ZICA 1UZ4A 4TUFA 6TAAA 1BVNP 1PX4A 2DQXA 4MPKA 5AY7A 2V5CA 1TZ7A 2D20A 1VFFA 3AHVA 5IHSA 1SMDA 1GJUA 3L2LA 1CGWA 3S5ZA 1E0XA 1CENA 1B3XA 1NOFA 1B3YA 1XD0A 1BFNA 2ZUNA 3CHFA 2CIPA 3K8KA 1E6ZA 1ZJBA 1VENA 1BF2A 1J0JA 3BH4A 4OOUA 3QOKA 3ZR6A 4ATWA 3HMCA 3WQ6A 1HN1A 1C7TA 4FNTA 1MW1A 2FH8A 2CETA 4HOWA 3GNRA 2ZX8A 3HG5A 1BVZA 1TQTA 1MQQA 2X2HA 1IT0A 3F5JA 1HKJA 1R87A 2TAAA 1E1FA 4J3UA 3VGBA 1E0VA 2XM1A 3MMDA 3BAWA 2O9OA 2DSKA 3VGFA 3EDFA 1ODZA 1B3VA 2JF7A 3NUKA 3OLGA 1ISWA 2XTKA 4JHOA 1D2KA 4BQ3A 1W1TA 1W1VA 4GI6A 1W1YA 2ZXAA 4NZFA 1HT6A 3WELA 3ZSSA 3RCNA 3T2PA 3U7BA 4CD7A 3IJ7A 4S3KA 4F9DA 2F7QA 4AZBA 3BUDA 2ZX5A 3AROA 2X2JA 3AXXA 1PZ2A 4HP5A 2BFGA 2EJ1A 3B9EA 4ZE5A 1B3WA 2F1AA 5LA1A 4HZ6A 1G94A 3EJSA 3FAWA 5FCZA 4JFVA 3W26A 3A5VA 2ZIDA 2GK1A 1TMQA 4BA0A 1VJZA 5DF0A 1RPKA 3D4YA 3AMDA 4J3XA 4PTWA 2WMJA 4ATDA 3TOPA 4QDMA 3N9KA 4D6FA 1X6NA 2G3JA 2YJQA 3CZEA 4DWSA 4TXEA 3GXFA 1NOWA 3B9DA 3OLEA 3SCNA 3WSUA 3AHTA 5EBAA 3VIGA 1WDRA 2EPLX 4H2CA 3DHPA 3O9NA 1CWYA 2F7RA 3IGUA 2WMIA 3AMGA 2QPUA 1UD5A 3WY2A 2PBOA 4H8VA 5A8MA 1JYWA 1PZ3A 1E0WA 4FNQA 4HOZA 1JFXA 6CGTA 3VIPA 3WUEA 2QPSA 3WH6A 1E5JA 1D7FA 4KGJA 4JKMA 1V08A 4UNIA 1WE5A 3BGAA 1SFSA 4FK9A 3HN3A 3I3EA 5GNZA 4LYQA 1DWIM 4AMXA 3IAQA 1KTCA 4QAWA 2YL5A 4UQ9A 3T08A 1JNDA 3WY1A 1V3IA 3AIRA 1W1PA 4CU6A 4XV0A 1TR1A 5DMYA 3BUIA 4W93A 4LYRA 1XC6A 3BC9A 1HJXA 3WF2A 1J0IA 4CN1A 1C3FA 3MSGA 4AW7A 5EFDA 1HNYA 3WD2A 1CNVA 3AHZA 3WEMA 5FOOA 2W4XA 2YA1A 1HWWA 2G3MA 2JF6A 2X8RA 1JI2A 2J7HA 4HPHA 3WF0A 4ZE4A 5A6SA 3FY1A 1JF5A 3BMWA 4IPNB 1HJSA 2JIEA 5JIPA 5A3HA 4PYSA 3WUBA 3ZM8A 2DSVA 1CGTA 2WK2A 5DEZA 2J8GA 3U5UA 2AMGA 1WB0A 4MNLA 4MADA 1H1NA 4HU0A 1BPLB 1V02E 3PZMA 1OGSA 3DDFA 3AMCA 1BG4A 1UWQA 2FH6A 3M6DA 4GIAA 4WKAA 3UERA 3L4XA 1V3KA 3ARUA 1UD6A 5CZKA 3AISA 1PAMA 1KB3A 1ITXA 5CPTA 2F2HA 2A3CA 1W9VA 1QBAA 3UG4A 5BXRA 3RJXA 1UKSA 4NZJA 2J8FA 1MW0A 2BHZA 4RE4A 1UKPA 1QWUA 3RDKA 2WLYA 2XFYA 3KLLA 1FHLA 1GORA 1U33A 1HVQA 1B30A 1M03A 1R46A 4UZSA 3UR7A 3W25A 1CGYA 4N0RA 1EO5A 4UFKA 2WC3A 4W8LA 2D3LA 3GXPA 4UQBA 2UY2A 1EDTA 5BWFA 3WL0A 2VX5A 3CZJA 3F5KA 5A1AA 4DO5A 5A2BA 3EDJA 5HPCA 1HP4A 3VD5A 1IV8A 4QFUA 1VB9A 4PBGA 3PZNA 3WFLA 3CBWA 2CHOA 3WDPP 1EDQA 4OZOA 5ABGA 7A3HA 3AOFA 4EK7A 2D22A 1JDAA 1KXTA 3VKKA 7CGTA 2YFNA 1HJWA 3DECA 1W2PA 4FNRA 1YHTA 4UQCA 1G5AA 5D4YA 2YA0A 1OT2A 1W9BM 1GCYA 3EDKA 1LQ0A 3VDBA 5E6YA 1J0KA 3GXDA 2X0HA 2OWWA 4HA3A 5E6ZA 2YBUA 3CH9A 1Q6FA 2DT2A 4HMCA 2WZHA 3M46A 3SEPA 4C7DA 8CGTA 1VEMA 1JDDA 3K8LA 1JAEA 5M3WA 1W91A 2JALA 1CXKA 2BVYA 2WW5A 2BY2A 2OLHA 1UWRA 1GHSA 1BYDA 3VD9A 3OGRA 3DX1A 1J18A 2E8YA 3DC0A 4XZBA 3AS2A 1HL8A 3T2OA 4B3LA 2O92A 1GUVA 3KL3A 2DH2A 4J28A 5AC5A 2ZUWA 3G6LA 3WUFA 1C7SA 1JZ6A 4QLJA 1QHPA 1VAHA 3W6LA 4PUEA 3WQWA 1R47A 1EIBA 5JUVA 1BYCA 3EJPA 5E70A 5CPSA 3NDYA 3LX9A 2XUCA 3VIMA 4P7RA 3VMNA 4IM4A 1BYAA 2BVTA 4WLCA 1LLOA 1WKYA 5A6BD 4H7VA 4Z2IA 2AOSA 1MYRA 2V38A 1UD3A 1MW3A 1SZNA 3W29A 3KZSA 1QVBA 1KXVA 4YHEA 4MNKA 1GOKA 3A22A 4NSBA 2J77A 4C7FA 1NOUA 1LWHA 4MTVA 2A3BA 4U2YA 1TQUA 3D51A 5BRPA 3T0AA 3HU7A 2CBVA 3KE0A 1ZB5A 1G9HA 2WVVA 3BUPA 1M01A 2WHKA 4PSRA 1V3HA 4U5KA 4WKFA 4BQ4A 4MB3A 1K6AA 3NSNA 2XVNA 4CN4A 3KLKA 2C0HA 4AZHA 4W7UA 4BS0A 2OYKA 3LPPA 3SCTA 1C8QA 2VX4A 1W9DM 1V3MA 1JYNA 2XWEA 2V5DA 1PX8A 3VINA 1FP9A 2GVYA 1LWJA 4PCSA 1E6NA 1CIUA 2WZIA 3SUWA 5M03A 3ZOAA 1V02A 1O7DC 4CVWA 4CD5A 1WPCA 4W85A 4XZWA 2VOTA 1CGXA 3WMCA 2IUZA 3BAYA 2F8QA 5I79A 4JFSA 1KXHA 5BXTA 1WP6A 1SMAA 2YBTA 4H8HA 3L4VA 1CPUA 1C91A 1L8NA 3BLPX 3WY4A 3MU7A 4AZGA 2G4FA 1M7XA 1QW9A 2W62A 3CV5A 1OIMA 3BCDA 2W61A 1JZ3A 3A4WA 3EDEA 2VO5A 2Y2WA 2BVDA 1A3HA 4AZCA 3W0KA 5A6KA 1UR1A 1LL7A 2YLAA 3SUTA 2HISA 3W24A 4W7WA 1X6LA 3SCSA 3A23A 1JZ7A 1EXPA 1VFOA 1SR0A 4KRTA 2OSYA 4JL2A 1B0IA 3AXIA 3AYRA 2WMGA 3N1AA 2J7BA 3AZTA 3M07A 2WCGA 4HOXA 2PWHA 2EPMX 1K9TA 3AS3A 1Q6GA 3TA9A 1NWRA 3OZOA 1QNQA 1E70M 2D0HA 1W9PA 1UKOA 3TTQA 2E0PA 4IUGA 1JZ4A 3WDJA 4MDPA 4D6DA 4ML4A 2W91A 5I2UA 3IJ9A 4CU7A 2XJ7A 3ARZA 3BSGA 3VIOA 3CUIA 4Z2HA 4M24A 3QR3A 2UY4A 1XD1A 1HP5A 5DO8A 2O9PA 3VUPA 4AZ5A 4FMVA 3AI0A 4Z2JA 3DYMA 4JFTA 2EXOA 1JZ2A 1TA3B 1UR0A 5IHRA 1QI3A 5E0CA 3WNPA 1E1EA 4JFWA 3PBGA 2BHUA 2G41A 4AEEA 4CKQA 2J47A 1E5NA 1M53A 5FD0A 2EPKX 3POCA 1T0OA 4XUYA 6A3HA 2BS9A 5E9AA 3DX0A 3H54A 4QP0A 2ZUMA 2BHYA 5LYRA 5CQ1A 3CLWA 4U3AA 3ZR5A 4PN2A 2B31A 1QI2A 2Z1SA 2WWCA 1US2A 1W3KA 3RIKA 1UH4A 4L4PA 4HZ8A 3H55A 1PBGA 4WIWA 4AMCA 1ZS2A 2X0YA 4CCDA 1V0KA 1VEPA 1HIZA 2WWDA 1E55A 3WDQA 3LXCA 3D52A 2NW0A 1AQMA 1JG9A 3RM9A 1LG1A 3CUHA 4GPNA 4FLOA 4MNJA 2G8ZA 1XV8A 1UWUA 2X05A 3RJYA 2WPGA 1XGZA 1WAWA 4A3YA 1UR8A 3CTTA 3QHMA 5CGMA 1HJVA 2J74A 3WQ4A 1F4AA 4NXSA 3CZKA 5CSUA 1D3CA 3W6MA 3CO4A 3BSHA 2PBGA 4CD6A 2PWFA 3MKKA 1W3LA 4Z2KA 1ITCA 4F79A 1KGUA 2J25A 1H41A 1HKIA 3PZOA 2D0FA 2ZUSA 1BPLA 4NXKA 2WBGA 2OYLA 4JKKA 3MV01 5HNNA 1WZKA 2YL9A 2YDRA 1BAGA 1GZJA 3AIBA 4NI3A 1EHNA 3D5HA 4CN6A 3OLIA 1OINA 4KMQA 2YL8A 2X2YA 3AS1A 1V3LA 2WAGA 1Q4NX 1UQZA 1AQ0A 5ABFA 1KTBA 4PSPA 3D3AA 4NRSA 3N17A 3PTKA 5D9PA 4OBRA 4KGLA 2D73A 2WVSA 2WVUA 5I0DA 3BVVA 3WIJA 2CBUA 1XSKA 1UKTA 1GOMA 2ALWA 3H53A 2ZXQA 1LL6A 1E15A 3APGA 4UFMA 1W3HA 4OBSA 1ZBWA 3B9AA 1R7OA 1HX0A 1I1XA 5GNYA 3ALFA 1KGXA 4HA1A 4YPJA 2W92A 1GOIA 4D72A 3PZQA 2E4TA 4MJ2A 4E4PA 4IISA 2W67A 4E2OA 2FGLA 1UR2A 3WFZA 1XH1A 3A47A 4NRRA 1E6XM 1HXJA 1WNOA 1JYVA 3AFBA 3FXYA 3CC1A 4M1RA 4D71A 1FP8A 1E4IA 1FHDA 2VC9A 2Y4SA 3T2QA 4NX0A 3VSVA 3VM7A 1EOKA 3L4UA 4HMEA 3DX3A 4CD4A 1C8YA 3SUSA 2CBJA 4V28A 4AD3A 1CXHA 3VDAA 2Y24A 5F7UA 1GONA 3SCUA 1PEZA 1KCLA 2ZWYA 3WEOA 4Q7NA 4NZCA 2VT0A 4E8DA 4MAZA 1OGBA 1UR9A 4PCTA 1J9YA 3CZGA 2WBKA 2WC7A 1V03A 3MUIA 2XGBA 5EMYA 1ODUA 4UZUA 2BNJA 3FW6A 1V6UA 2VL4A 4ACZA 2EAEA 1QBBA 4F8XA 1OB0A 2Y5EA 2EPOA 4LYPA 5CJ5A 1ZL1A 1PX3A 5JBDA 2WSPA 2VZVA 3WH7A 3THCA 1TVPA 4D6HA 1GJWA 2WKLA 1UWIA 3VPLA 2ZUUA 1WDQA 3FNDA 1EO7A 4ACYA 2QMKA 5E09A 1UUQA 3LPFA 1C93A 1XH2A 5A8QA 3CZ8A 2XG9A 2XWDA 3VM5A 3ZT6A 2VCCA 3VX1A 2YLLA 3OA5A 2GJRA 1QI5A 3ZT5A 4LPCA 1DWHM 1HKMA 4DWSC 3BVWA 1SYTA 4RE2A 1BLIA 1CXIA 1JD7A 1I1WA 4F66A 4D6IA 2FGZA 1EHAA 1UOKA 2EBNA 2J7CA 2VURA 2OWXA 1JGIA 3ZJ6A 1E43A 1JI1A 2CCRA 3PZ9A 1R34A 1P6WA 1J0ZA 1KFWA 2D1ZA 1GQKA 2YFOA 5M5DA 2JIWA 2DIEA 5DT7A 3DYOA 3J7HA 2J7FA 1W3JA 4PMNA 4EKJA 3GH7A 1KBBA 3UETA 1CXEA 2ZX7A 4HZ7A 3WENA 2WM0A 4DO4A 3W27A 4J3VA 3WF3A 5BCAA 4QCEA 4GKLA 4EE9A 5LA0A 4WKHA 1JXKA 1VBUA 7TAAA 1FOBA 1PIGA 1UD4A 2XN1A 4DM1A 2XFFA 1IZKA 4UFHA 1S46A 1HKKA 2VCAA 3WMBA 3ARSA 1FH7A 2WB5A 1MXGA 3VNZA 3WD3A 1GVYA 1MQRA 1WCGA 4GO8A 1H09A 1ISYA 4BZYA 3EDDA 2A3HA 2FHFA 2VRQA 4W8BA 2ESCA 1Y7VA 3VGGA 1DEDA 3BAXA 2VUYA 4WF7A 1K9FA 4V27A 1FH9A 4HPGA 3BLBA 2WANA 2PC8A 2BV9A 4W87A 1MWOA 3K4DA 5I3DA 4KRUA 3AYSA 5M17A 1CECA 3N12A 4V2XA 2VX6A 4CCCA 4BCEA 2E8ZA 4W89A 3AIVA 5A6LA 4DWSB 3D50A 5JBFA 3POHA 2V3DA 4TOQA 3NIYA 4HMDA 3GXMA 4E8CA 4DUWA 4BF7A 2WMIB 4CD8A 2WSKA 3WNLA 2VNCA 3VD3A 2J75A 3I3BA 3NYDA 3DDGA 1QHOA 1HL9A 1B90A 5BRQA 2F7PA 4QLKA 1OSEA 1WZAA 2RGLA 4HA4A 2XIBA 3RM4A 4YN5A 4B9ZA 5AC4A 2J4GA 4M56A 1ESWA 1V0MA 1ECEA 3N15A 2A3EA 3CZNA 2WHMA 5ABEA 4GZEA 2GJPA 1V0LA 4AWEA 1E56A 1J0HA 4TX6A 1Q6CA 3WF4A 1XRVA 4UFIA 1TQWA 1QPKA 2CPUA 4UOJA 2FDMA 5D9MA 4W5ZA 4CCEA 3CUJA 3EJRA 3VIJA 2IXUA 1X1NA 3CHEA 3N13A 1PPIA 4ZEPA 2V3GA 3AIWA 5KEZA 1CLVA 3SURA 4W8AA 2UY5A 1H49A 4AD4A 1BGGA 3DYPA 1LJYA 3AXHA 3VSUA 5A6BA 3LRLA 1ZBCA 1TA3A 3UG3A 2BY3A 3VD7A 3CHCA 1DTUA 4AMWA 1H2JA 1BTCA 4D6CA 4JL1A 5A2AA 4IPLA 1LL4A 1JAKA 1GOWA 2ZXBA 5GNXA 2WVTA 3NCOA 1B9ZA 1XSJA 1LF1A 5IFPA 3K46A 1UH3A 4B3KA 5LA2A 4PEEA 4TVUA 4EANA 3L4WA 3ZJ7A 3A3HA 4N42A 3ZIZA 2D24A 3LPOA 3E1F1 4XB3A 1UD2A 1QNOA 5GQBA 2DT3A 5A6MA 4OJYA 1KGWA 5ABHA 4P8UA 2OW6A 1V0NA 4U33A 5HXMA 1EQCA 1WZMA 4Q22A 3DX2A 3VILA 1ZU8A 3WH8A 3VO0A 2Y8VA 5DT5A 1EDGA 2YL6A 3UR8A 3PHAA 1W2VA 3T0BA 3W28A 2EPNA 3CMGA 2PWGA 2JFEX 1I75A 3GNPA 4GINA 3BAKA 5CG0A 1CYGA 1QNSA 2CBIA 2VZOA 4W84A 4GQQA 4JAWA 1VRXA 1NP0A 2DT1A 8A3HA 1UH2A 3GM8A 3II1A 4MB1A 3GH5A 1GQIA 3FAXA 1RH9A 2YA2A 1ZBVA 3PZIA 2YOCA 3ZJ8A 2XGIA 1FFQA 1VFUA 1H0GA 3VGHA 4R5EA 2Q8XA 2FHCA 1K9EA 5FL1A 1OM0A 1VIWA 4ATLA 3SIMA 3W53A 2ZE0A 4NF7A 5HBFA 4UQDA 2DIJA 3I3DA 4TX8A 2DEPA 2ZX6A 4MDOA 4P7LA 2WKGA 1J10A 2VR4A 3U7VA 4W86A 1UZ1A 2EEXA 3HJEA 2NSXA 3QGVA 2DGAA 2W5FA 3AQUA 4HU8A 4OOZA 2ZUTA 2F1BA 1KQYA 3LXBA 2Z1KA 1BGAA 4GZIA 2EO7A 1NWSA 3TONA 3LXAA 1TCMA 2CXGA 3EJQA 2XN0A 1MW2A 4D1IA 4FNPA 3SUVA 3SCWA 4FF5A 3HG4A 5A95A 4DUXA 3PN8A 4LGXA 4J27A 3CHDA 1JXJA 3SCVA 2JE8A 3AIEA 1AMYA 3OGSA 1JZ5A 1C92A 4JCMA 2VMFA 2DSWA 2VI0A 4OGZA 5IDIA 3ZT7A 3RILA 4M80A 2XVKA 1DWAM 1CGUA 1NM9A 1WDPA 4PUDA 2GJXB 1CBGA 1E6PA 4AD0A 4CGTA 5BXPA 2DH3A 3WNNA 2XHYA 3S5YA 1Q6DA 1GOOA 3AZSA 1QWNA 2VZSA 4D6EA 1KWKA 1TVNA 4W88A 3GXNA 3ZJKA 2JEPA 3K4AA 1UR4A 3BMVA 4MB4A 4PRWA 2J7EA 1R33A 3SCPA 3OZPA 2X1IA 3W38A 1E3ZA 1C90A 2PB1A 4WJXA 1E6RA 4URIA 1B2YA 3AIUA 1XHGA 4P8VA 3AHXA 1CDGA 5I23A 2MANA 2WVVB 1TG7A 3NDZA 2QF8A 4J7RA 2VRJA 4K68A 2CKRA 4HTYA 9CGTA 4MJ4A 4H04A 1H3GA 1WZLA 2EQDA 1CEOA 1GNXA 4WSJA 3W81A 1V6XA 2A3AA 4X0NA 3CZLA 4ZXOA 3WD1A 1QI0A 3CUFA 4B16A 4U5IA 1VBRA 4TVCA 3BAIA 3ARRA 4EAMA 2QLYA 2Y8KA 4PMQA 3WY3A 2E9LA 3GBDA 1GQLA 3M7SA 1H4PA 5CPQA 3K8MA 2E40A 5I77A 3DHUA 2XVGA 3O6AA 3VGDA 4RE3A 2RGMA 4PMDA 1J01A 5I78A 1CGVA 1VFMA 1JDCA 1N82A 4A4AA 3EJUA 1BSIA 2OYMA 4FNUA 4ZFMA 3VGEA 2ZX9A 1H5VA 2VZUA 3WL1A 1MQPA 1US3A 2J78A 1XYFA 3ALGA 2D3NA 4AEFA 3W37A 1QW8A 5D9OA 2QMJA 3L2MA 1E9LA 4AZCB 4R27A 1WO2A 4B15A 4AISA 5CLWA 2CEQA 3SCOA 2JEQA 5JBEA 2HVMA 4P8XA 4UFLA 4GQRA 1QOXA 1EA9C 3IK2A 1HF6A 5A94A 3DX4A 1W9UA 2XM2A 3MSDA 3A4XA 2PWEA 3VMOA 2XFRA 3G6MA 3CPUA 3GDBA 1KR1A 3GXIA 4P7OA 1KWGA 3BAJA 1UQYA 3WQ5A 2G3NA 4DWSD 1HVXA 2BY0A 3WNOA 1B31A 4X0VA 3BCFA 2E9MA 1NQ6A 1JIBA 4Z2GA 3OGVA 1F4HA 1EQPA 3ECQA 2XSAA 3EMZA 1TUXA 4MNMA 2ZOXA 4P7NA 4AIUA 4BQ2A 2OW7A 5EFFA 2GDUA 4H41A 4TVDA 1WDSA 1GOQA 1KXQA 1OT1A 2PWDA 3IANA 1VEOA 1U2YA 5HPOA 2DSUA 4GO9A 2W66A 2IGTA 2WHLA 4AYGA 1R8LA 1OIFA 1ISZA 4U3CA 1UD8A 1TE1A 3ARPA 3KWXA 3WH9A 4WK9A 2DDXA 2YKKA 4LQ1A 4JIEA 1UKQA 5AYIA 1QNRA 4XX6A 4GI9A 5E0FA 3RMEA 1E6SM 1TQVA 3PZUA 4AY1A 1LG2A 3F4VA 3AJ7A 4PMOA 3ZO9A 2V3EA 4PTMA 3O2LA 3OBAA 2EABA 1PIFA 1UYQA 4OUEA 4PTXA 2FE0A 2YDSA 4UFJA 4D1JA 1JFHA 3LMYA 1JF6A 5JIWA 2CESA 1UHVA 3RM8A 4AD5A 3AHYA 3W82A 1E73M 1OD8A 1UA3A 3ZSTA 1OD0A 4PMRA 1KQZA 3T0DA 1MFUA 4FLRA 1E72M 4CUCA 3BVUA 4LXFA 3NSMA 1R75A 4LX4A 3HG2A 1VJSA 3WBEA 1R7AA 3WUGA 4Z2LA 3LRKA 4M29A 5D8WA 1MXDA 4AD1A 1L0PA 1R86A 4PMVA 2ZWZA 2UY3A 2O9RA 2W63A 2VJXA 3AMKA 4JKLA 2PI6A 2VZTA 2BXZA 1W9XA 4W7VA 4YHGA 2WYSA 4TTGA 3MMUA 1HJUA 3ZQ9A 1E4NA 2OWCA 3MV11 4F9JA 3S2CA 3FHQA 3BVXA 4B9YA 1OCQA 3WEZA 1J12A 3HG3A 2WLZA 3N11A 5ABFB 2VQTA 3OB8A 1QHZA 3TTOA 5TD4A 1CZ1A 3WNKA 3MS8A 1E4MM 3VDHA 1MFVA 3WNMA 3VIIA 4UTFA 1J11A 3WD4A 1V6YA 2GSJA 2EACA 3L4TA 1HTYA 1JZ8A 4MAVA 5HOSA 3VSTA 1FH8A 2GDVA 3S6TA 3EJTA 5FL0A 1GQJA 1QX1A
chains in the Genus database with same CATH superfamily
2XINA 2E9BA 4WTZG 1UB6B 2OFQA 4F7KA 1KN2L 2N1TE 1LO4L 1FNHA 1FAKT 1XICA 3UCQA 2J6EL 2I9LB 2EIXA 1IKOP 3B5HA 4N8CH 3AW5A 3E0GA 3KBWA 3RITA 1M71B 3I6KA 5GRZA 3SY8A 1HW6A 1ASPA 1CCWB 4OE7A 1SW7A 2VN5A 1JL8A 3QGKC 4TMZA 1JVLA 1XCFA 3QXWA 3CSGA 3I50H 4KVCL 4AX6A 3T8MA 3VRIB 3RVXC 4X42A 3UP1A 2QW5A 2ADAA 4P25A 3B5GA 2WZ0A 4ONGL 3LHTA 4O5LL 4O2EA 2Y7NA 4ZX3A 3HUJE 2VN3A 2PF0A 4WUKL 3VCLA 1RJLB 2FHBA 5I71C 5MEND 4DP0X 3WUWA 2NT1A 4YWGL 3KW3A 4ANXA 3TGXA 3U4EA 1W1IE 3W5UA 3W4RA 1FCGA 2FQEA 3STZA 3KL0A 5CGTA 3N18A 2XN2A 3KM8A 2LLLA 2HFTA 4GXVL 1RPQA 1WBXA 2H7WA 1UWEH 3DI1A 1A6AA 4LIQL 4ZAKD 2OMUA 1CXFA 2ZXHA 3WBWA 3T0EC 4Q9QL 2WMKA 4LRIC 2Z27A 4ACPA 2WMHA 2R0LL 4M5YL 3GH4A 4RPBA 1W72A 5DURB 2QPXA 4Z1AA 1MI5A 2J43A 1TRIA 5HJYA 3GTVA 2GGHA 4KKRA 1BKSA 1S9YB 4ZX6A 3EOTH 1KCRL 4CQJA 1TU2B 1UT9A 2R1PA 1XCQA 3PAZA 2FIQA 3CXOA 5DZVA 3CLFH 1J86A 5CZVH 4DP5X 2VIRB 1S4MA 5T1LA 2MRYA 3VFVA 1HAUA 8FABB 3ARYA 3LH2L 4FA7B 4A3QA 1KZLA 3SCQA 2XXFA 5LNEA 4LF3A 3D1MC 1I9RH 1RAMA 2NSMA 4GGBA 4ZQOA 1EAQA 4I5UA 1HI6B 3E1YE 4W4QA 1LILA 5A2CA 5CBBA 4OPVA 5HUPA 3WS6A 4E36A 4UZGA 3VFSA 2R15A 3CXHJ 1N19A 5GZOA 3RWEB 3L4ZA 4YXLL 5D7LA 4KQ0A 1YQVH 1XR8B 1WC7B 3P9LA 3LS4H 2QDDA 5A8OA 5DJCB 2DKMA 3LQAH 1FTXA 2VC2L 4M7JL 2Y7OA 1OGJA 1CICD 3IFNL 3FFDA 5F7EH 4UV4H 2VSDA 3CSFA 2HVJA 5SWQA 5K1JA 4MLSA 1UZ8A 4DJDD 2N4IA 3WLQA 2VEIA 4RFEA 2NR6D 2CERA 3K6DA 4YHNB 1ZAJA 1T7VA 2CBQA 3QOMA 2EDNA 1NGZB 4HHAB 3O6LH 2R2HA 3IXTB 4FXGA 2CKBL 4J3TA 1D5ZB 1XGUA 4N2CA 1NICA 4D7BA 4FQ1H 2MFNA 3TASA 2ID5A 3QBUA 4WK4B 1M04A 3NVTA 1XLCA 3SYQA 2YSSB 5J57B 3IGLA 4KZEH 1P4IL 1CGWA 3HLAB 1HESA 3W84A 1DORA 5EU5A 1B3XA 3QJQB 5LAPA 2PW1B 1MH5B 4TULH 1ZMYA 1TTUA 5AAWA 1LO0H 5EUOF 2OKMA 4WNQB 1HN1A 1R3WA 3KJ4C 3TA3A 3H94A 3TH2T 5D93B 1BVLB 2JGQA 2IG2H 4K7PH 4YC2B 1IAOA 3QYNA 4O58L 1DVTA 3G5EA 4M43H 4BQ3A 2QN6A 1FVDB 2MOVA 4CADA 4GI6A 4QHUB 2CLHA 4ANKA 1RR2A 4M3PA 4X83A 1KPUA 2IBZX 4F9DA 4X6BB 1NFDB 2C9UA 4YFEA 2X2JA 3KLSA 2G0LA 4A1RA 4ZE5A 3JTSB 2F1AA 3T0CA 4OD2A 3IS4A 2OP4H 5D4HA 4TRPL 2ZRVA 3AMDA 5E7BA 4X4XA 1D5IL 4UDTB 4LBRA 1FA4A 2DI7A 2OQHA 2CUIA 3WO3B 4OFVA 2DMGA 3QIWC 1JRBA 2ZAIA 1WDRA 4RMRA 5IQOA 4QDPA 3SCMA 3IJLA 5I9QC 4XLAA 3C2OA 1FX6A 4HOZA 1I3RA 3OJMB 1WCBA 2X41A 3EJYD 4NQ1A 4DPPA 4PUUA 1REQB 5CEZD 1WE5A 2HX7A 4N5UA 4R85A 5H8MA 1X7IA 1AIFA 4IX2A 2DQCL 2YAOA 1CI5A 2R56H 3QXDB 3MSGA 1AJ7H 3A3BA 4MQXC 3UWEA 5C07E 3M1OA 1R0AL 3B8VA 4QRFA 1F2XK 4FXKA 2ISDA 3EXTA 3BXNA 3FY1A 4ZX4A 4MXWH 5JIPA 1H7XA 4TL4A 2NY5C 3S5OA 1XGQB 5FF2A 3ARFD 4UINL 1F4WL 5DFTA 2YQGA 2V82A 4BELD 3V9CA 3RFZA 3CCSB 2MKWA 4X6CB 3L4XA 1V3KA 4ISVB 3GNXA 4D8PB 3CMFA 4AUUA 3PWUA 2HLDA 4QTGA 3WXMA 2JJUA 5HGGS 5L9DH 1W9VA 5FF4A 3UG4A 2HT3D 5IBLC 2ZP9A 4MKNA 1UKSA 1M1KD 3RDKA 3AQYA 2FK9A 4TS6A 3GIQA 2YXWA 2H8ZA 5LBGA 2V2XB 3KGTA 5HJ3B 5C9JA 2BHFA 2QCCA 5A1AA 1FZJB 3L5XL 4PBGA 1OGAD 3FFCA 1R3HA 4L1BA 2BVQB 4XPFL 4LVNC 4WRLA 4PD4K 3KYMB 5D7JA 3WX7A 3UWQA 5CGBA 7CGTA 2WN3A 1HJWA 4Z7WE 5LQBH 3QQ3A 1IGJA 1OT2A 2YPLE 1OLZA 4E9TA 1VQ4B 4L9LB 5AW9B 4N1CA 3PP3H 4HAKA 1N2RA 3LM3A 3MUGA 5M3WA 4Y2LA 3KJ6L 5L0QB 5EOQH 2CE6A 3AG2B 4PJCF 2XG4A 4XG1A 3VD9A 4AW4A 3QEUA 4XZBA 3OQ3B 3VO1A 4LV4A 1GIGH 4HPOH 2I7GA 5IFAL 1CF8L 2A9ML 2BVOB 5K9OB 4U1MA 4TMWA 1PHWA 3MCAA 1HL4A 4P7RA 5L4IA 5C0CA 4LV9A 3JVGA 3ECBA 4MA8H 2OTDA 4AJ0A 1U3HD 4PTTB 3S34H 1KXVA 1U5HA 2NQZA 4KKAD 1OFOA 4DGWC 2X40A 3OEEA 2X44D 4XT1C 4YNGA 5HGHB 3QFJD 1HXMA 1CFQB 2GT9B 4DGUA 4YHBA 4AV0A 2NY0C 4Y5YC 1WBYB 1ML0A 2OR9H 1E0UA 2XWEA 4FABL 3NPXA 3BDBA 3LM7A 2GSIB 3IDUA 1N67A 4A6YH 4P2OD 3MUUA 3SDCD 1RJPA 1MLBA 4NO5B 2GGEA 1EP2A 1LMKA 3RE0A 1D3HA 1BWVA 1MIML 4JFSA 2D31B 2QDHA 5HHXH 3SGUA 2VERN 1TITA 2XT1B 2HZHA 1FQ0A 3X1EA 1QW9A 4MNGE 4H1LG 5HI4D 2DQGH 4F2EA 5AHNA 3SIKA 3W24A 3CBRA 1JZ7A 2X0UA 4HGXA 2Y8UA 3DUSA 5T1MA 4PJ8A 3EF4A 1QPQA 3VFNA 1K9TA 1MF2L 4XZ9A 4A7SA 4CKVX 3GDMA 3MACH 2PTVA 4WUUD 1NEZB 1NMBL 5I2UA 3IJ9A 3BSGA 4Q0XH 4V2CB 3IU4L 2K0RA 2PLTA 1XF4A 4RZ5A 4X5WB 4JFED 3GEFA 1UR0A 5E0CA 4X8JA 3B8HA 3PBGA 1YY8B 3MC5A 2J47A 3R06A 2AXJA 1A1OB 3ZZ0A 3R0MA 3ZR5A 2Z1SA 5H6HA 3N40F 4L4PA 4L56A 3H7BB 4HYVA 2D9RA 5C0JB 3WAKA 1QR1A 3WJJA 3IJIA 1J9CT 5BUGA 5KVFH 4TIMA 3U2ZA 3MLTB 4NWTL 3GJFK 4MYXA 5DMKB 1UCWA 3LMZA 1HOCA 3QCTH 2BM1A 4WCJA 4GLRI 2PBGA 1ITCA 1E9PB 2G2RB 3W87A 3SDCB 4NXKA 2VCOA 1OGAE 2PLKA 3MV01 4F1SA 4UAOB 2G60L 1A5NC 4DOHB 4OQ1A 1MCRA 4JFFB 2PZNA 4HJWA 3TT3H 1ZA6A 4Z8FH 1T03H 3F2CA 4I3SH 4Y9GA 4KZDH 4FP1A 4A35A 2BWIA 5FCUH 4KGLA 5FYKL 4RLZA 3O6KH 3DMMA 5C09B 5DGQA 4JFQB 3V6FB 1KB5A 1SXSA 2FNBA 3DHFA 1T04A 4X60A 3LQGA 4R8WH 2QL1A 5BQ7A 3UA4A 2ZZFA 5I3FA 3KBSA 4MQ7B 3FRPG 4NKDB 4WTXA 4NZ3A 2XHNA 1KTDB 2GPJA 5HR7A 1PKLA 4RGNE 1TKWA 3CXHK 1D2PA 4O16A 4X5XA 5B1BB 4DJED 1BQSA 4M1RA 4WO4D 4MGGA 5IK2A 3SADA 3VSVA 3VM7A 3MJ9A 3UZ5A 3ZN6A 1LGVA 4XB8A 3SKJH 3SSJA 4KETA 4YDNA 4EVNA 1SJVA 2J9ZA 3L6FA 2BIQA 3HC2A 2UUDK 1Q90A 2DLFH 5E51A 5E4AA 1F05A 3G0SA 4NENB 3FTYA 4UMAA 4ZZ9A 4R26H 4YTRA 3UABA 2WSPA 1O1HA 2VZVA 3LY0A 4UTAA 3JW7A 3TJIA 2XN9A 3BK0A 1XGEA 2AQNA 1YUHA 2Q6WA 1QI5A 1N7ML 3QRGH 1F7BA 1XDTT 1BYOA 2F5BL 2PS2A 1RQBA 4NZRL 1JD7A 1MAKA 4XO8A 3ZJ6A 3L12A 3OKYA 1B4RA 3C8DA 2ZPKH 3KVQA 4U05A 4UTWA 4ZS6C 4E0FA 4L05A 2HKHH 2O5XL 2WWNA 4J3VA 5AW2B 1DCEA 4EE9A 4JVPA 1E8XA 1IC7H 1U58A 3VXUB 4WKHA 4ZR8A 4AWTA 4XP4L 2FD6H 4W9EC 1UD4A 1U8MB 4LT7A 3REWB 4ELMF 1BQLH 3FU5A 4G6MH 4Z7AA 3WD3A 3OFNA 1MQRA 4FAAB 5IR1A 5HANA 1JGEA 4UAJA 4G6JL 3MRMB 4O0QA 3TIDA 4M61B 2OEKA 3BLBA 4IIHA 3LRGA 1EWDA 1UACH 5KN5B 1U8OA 2NQJA 1UJ3C 3OE7A 3NTCL 5BVJA 4V2XA 4DNRB 2C9QA 2HJLB 4GX8A 4DWSB 5HJGA 2F6KA 3S8FB 5JBFA 1QRQA 4OLUH 4WWPA 5D8JH 4XOTA 2BZCA 2WTOA 5TDOB 3ZKXB 3E38A 1XKJA 4K1WA 3M8OL 1JPDX 3QIBD 3W9EA 4N2YA 1WH0A 1AKJB 4I5BA 1JNHB 3V8CA 5SWSB 3FNKA 5LWYH 2YZ1A 3EO0B 1Y6NR 2HKFL 4QDGA 2DB8A 1DVJA 3RBGA 5HVFB 3AACA 1J1PL 1V5VA 2FX8H 5LCVL 4BXVA 1XI3A 4R88A 4UOJA 4RQQB 1QFWM 1Q7MA 5IMMB 2VD8A 4NY2A 3SM0A 1PPIA 3BPLB 4PREB 4LBZA 2WLKA 2DLIA 1AXSA 4JZOB 3H70A 1LBLA 2K4WA 1DCLA 1VCGA 4F15B 5EIVA 1WBHA 3BAEH 3LRLA 3T6ZA 1BQHA 2NNXA 1T0NB 3UG3A 5AVHA 1ZLWH 2HVKA 1AHWC 1H7OA 2HRGA 1A53A 5D37A 1T0MB 4X3ZA 4ICMA 3IAGC 2QADB 1FE8L 1XE1A 3FUNA 4LVAA 3OF6D 1EXGA 3EWYA 5JHDD 4ZSOA 3DX8B 4WWNA 2OU4A 2V7TA 4GJTB 2HFFA 1DN0A 2O5YH 4PJAF 3AVUA 2YW4A 1K85A 5JPMB 1CFTA 3KVLA 5T8GA 2HRLA 3UJJH 3WQFA 3NQDA 2WQUA 4CQAA 3T0BA 1UQSA 1F3XA 3WKML 1S5IH 5F9JA 1PKQE 1JWUA 1S2VA 1K4DA 2VDQH 2XWJB 2O61A 1UH2A 4DLMA 1EZVY 3GR4A 1KCXA 1P7KB 3VGHA 2I5YH 3UZXA 1PNDA 1OK4A 3RTQB 3R6IA 4APQC 1L3WA 4U1HA 1BX1A 4DN4L 4NPYA 2ZE0A 5HHVL 2A6IA 1ILUA 1BZ9B 3Q8BA 4NJ9L 1CR9L 3FPPA 4M7LL 1DARA 4NHUA 3ZE0B 1CJYA 4G1VA 2E1BA 3QGVA 3W1MA 5IHBA 1KIQB 1XBXA 4OCWH 1P84K 1JV5B 2VL5A 1NWSA 4B2DD 3LXAA 4CMHB 3R11A 1MW2A 3NRFA 4ZUTB 1TFHA 1F1GA 5KS9F 4DXXA 4LVDA 1FFNA 3C5QA 5GGRA 4GISA 1RXLA 2I14A 2EEAA 1YEDB 3A3YB 1E9ZB 2QZQA 4YE4L 4R84A 4YX2L 2VDPL 4NJGA 5DUPH 4XX1E 5DUBA 4QKXB 2Z8SA 1CBGA 3O45A 1T5KA 4XXDA 3EO9L 1SW0A 4PUBH 5GJTL 1G7IA 3WIHL 2NOYA 4EI5D 1KT2B 3CZFA 5C0RL 4MUPA 4HXBL 3BMVA 3L23A 2WQXA 4NNAA 1I9JH 1VGKB 4C4BA 5I0VA 2FX9H 1ZE3C 2AJZA 2CZDA 5REQB 1ZXKA 3FO1A 4NM8H 3AHXA 3C2YA 2AXGB 5HHNB 3CZLA 1GW9A 3T8QA 4LL4A 4Z0JA 5LHFA 4RETB 3EW3B 2AJVH 4KCUA 3OZKA 4HETA 4NBXB 3VXTA 4YBQD 1P0SE 3SKMB 5L2KE 4I0PA 3QZOA 1SN2A 1XGYH 2XZLA 4OH2A 5BNKA 2FEEL 4TLTA 2QCDA 2DYPB 5I78A 3O4LA 1QAWA 4MAYC 3B2VL 4JZNA 1DVXA 4ZX5A 4JDZA 2VKWA 5D2VA 4IOIA 1EFXB 4Q4IA 3IGFA 4NQDB 3CDGA 4NHVA 4Y1AE 4Y16A 3NL2A 3GO1H 3MLVH 3PJXA 2QGBA 2VLKD 2N56A 2Z91A 2EDEA 1F3WA 5BW7C 4G1NA 4U3SB 3M6YA 2XFRA 4H9UA 4P7OA 3UAJD 2CO3A 4OT7A 1R5VA 4X8CA 3VWKD 3M5YA 4BQ2A 5FF7A 4DJFD 4QHNA 4I2XE 3WOVA 3X11B 3HMXH 1L9MA 3GSVB 4HIZA 4X7SH 3JZ7A 3B7TA 3GJEB 3L3OA 2YZRA 3DVGA 4LBUA 3THAA 3FB6A 1G5GA 1XEDA 5BNXD 1JPIA 2ISVA 5JHDE 3WN5C 1I0BA 3QYMA 4XX6A 4JRXE 4QRUA 1KCVH 3SE4C 2CZNA 2GTZB 2JIXB 4PABA 3D0AA 3EGDA 1UYQA 1NIEA 4TQEH 4EN3B 5C0GB 4LVEA 3GMOA 2EE0A 3AHYA 3UVIA 2MQGA 3IFOA 5KZEA 3GHEH 5CC3A 3WLOA 3BDYH 5ANMA 5I66A 1JUFB 2QUTA 4FTDA 4WI9A 2WNGA 4RA3A 4PMVA 4KHXH 5B21A 1G87A 1XGPA 2VZTA 2BXZA 2HK0A 2YKLL 1EXUA 3MRHA 2YYTA 5ELIA 3BVXA 3L16A 3GFUA 3L3JA 2OTWA 3W1LA 2ZCHH 3W5MA 2GAZB 3D25A 1ACZA 5KJRL 4UTFA 1EEZA 3PNWA 3EWZA 4JTUA 1DDHB 3G08A 3LV3B 3UNTA 4KKNA 4G43A 5I5IA 1CGSH 2YGYA 2J7LA 1OFAA 4L4VA 4G8IB 1Q7ZA 1Q3NA 1ISVA 1CVSC 3P3TA 3NZGA 3QWQB 4NN6C 4R96B 2GJ6A 1I2RA 4LF2A 4K3ZA 1RD6A 2PXYD 3GIRA 4HLZH 1DQTA 4H20L 3TVMA 3CPXA 2ZL6A 4KQ4L 4RIRA 1U8CA 2ALRA 1AFVH 3S36L 1JDEA 4OKDA 5HWMA 4Q4QA 3BV7A 4OF8A 3WH5A 1T4KB 5FO8B 1GPWA 5F9OH 2GB2A 5IROD 1H3XA 1PZ0A 4YHYC 2DFAA 5IMLB 1NIAA 5HYIA 3BJ91 2G9HB 1LE5B 1E6QM 4WR3A 3FO9A 5E1QA 2XNDA 3HI6L 3VXME 1XVSA 4ZNCD 5SWUA 4DZBA 5J1TC 4YDJB 1HJQA 3UTZA 3LCHA 1P53A 3QCVH 1A49A 3G3DA 1LT8A 1XR9A 3A24A 2H6UA 1Z9SA 1YEKH 3HZYB 1A6UL 2VC6A 1ZT1B 1YQ2A 2FZ9A 5KNLA 4DVOA 4AZ7A 5DRZA 4ADSA 3EBVA 1TMCB 1YECH 1KR0A 2EIJB 3E2VA 4JM0A 3GI8L 1EOMA 2NY5L 3GD6A 4FQJL 3WMSA 4AM0A 3E3QC 4LSPH 3OKDA 1USZA 2E3ZA 1X7SA 3V5KA 2MCMA 3ID7A 2E86A 3RX2A 2FFCA 2WQVA 3G6JA 4U4IA 1WGVA 2VE6B 1OGGA 1T89C 1IAMA 4A3HA 4NWUH 1A4AA 1NCDL 2PGRA 1QSEA 4AIOA 4IBSA 3P54A 3FF7A 5IXEA 3AGWA 1EUTA 4GKNA 3PK7A 5IESH 1EJFA 2VLKE 1S6NA 1FA2A 1FGVL 3B9KC 1BAWA 3A4AA 4NU7A 2H0PA 4KEMA 4POYA 5ID1B 1E71M 4CNOA 1V3JA 3MCLH 4I13B 5A6AA 1QRKA 5JDSB 1OFBA 2E9WA 2PTWA 2Y22A 4IFKA 3PZTA 3GIZL 1BQEA 1K9MD 3D39D 1KV7A 1IE5A 1OX4B 3L7FA 2QHAA 1VQ8B 4GRLD 4HXAH 1EPFA 3KLAB 4L8SB 1TEFA 4XBEH 5E2TH 4NO0D 1ET8A 5AYUH 4IRZL 1INQB 3TTYA 1KPRB 4IG2B 4ZOAA 1MCLA 2BSRB 4X7DA 1T66D 3L48A 4OCXL 4O11A 1F3RB 4BH8A 3UC2A 1GAWA 3B56A 3JV6B 4GP4B 5CD3A 3ASOB 3QQWA 1GPFA 2N1KA 3D3FA 2OI9B 3WNCA 3GZQA 5TE6L 2WPDA 3D2UB 4JFUA 4ERSH 2GITB 5LNVA 2QKIA 5C6TH 3WN6A 1R3VA 3ILQD 3FO0L 1E27B 5T3XL 3YPIA 4ZUUA 1AG6A 4MPKA 4C6LA 5CINL 1HDMB 4ASTA 2CLKA 1MQKH 2XG5B 3JTTB 2GUOA 9PCYA 1CURA 1EJTC 3CHFA 5LIXX 2AJXL 2EE6A 4U6HA 4FB7A 5IY5B 2EDOA 4OIIL 1AJ0A 3VWJA 2DLEA 4PJEA 5BVPH 3OJDB 4JHOA 3MOQA 4H25B 5F93C 4OCNC 3ILEA 4IIGA 2V7VA 1RZIA 2X3BA 3GW3A 3G18A 4MKVA 4YTTA 2CLZA 1E1CA 3ILPA 3MTRA 1TJ2A 5F9WB 1PIIA 3C08H 4IHOB 4ZXBA 2GBVA 4JFVA 4PJ5A 3A5VA 2WXRA 4F9LC 4BA0A 4F58H 1N5AA 4OIAA 3RGBA 2FZMA 3BT0A 1US0A 3N9KA 1ZS8B 3B9DA 3HZKA 3AHTA 4JNYA 3HR5B 1GJIA 2X7LA 2OFJA 4MFEA 1TIWA 1QQDB 4I9MA 1VPQA 1JFXA 3N6HA 2OPJA 4OD3L 3SDAC 4MMWA 4TNEA 2LFGA 1DWIM 4FI7A 7PTDA 3LKRA 2YAPA 2YUZA 4XV0A 3UPRA 4PGLA 4RBPK 2DY2A 4O51A 1GYWA 2HG5B 4R71A 1T99A 3V4PB 5EO0B 3NCYS 3KPRB 4A6YB 5K33A 2A9AA 3VTMA 4FP8H 4PJCB 4ZE4A 4XCFL 4G9FD 1OZQA 4NJAL 1QYGH 1QNIA 3UX9B 5E5LA 1IQWH 3FSOA 4NQEA 7FABL 4Q4MA 4IU3B 3TYFA 3RPBA 3JQPA 3PZMA 3QG7L 3R0DA 5BMXA 1O0VA 1YEJL 3GUFA 1XX1A 2XQBH 1LO5A 3QTPA 1J8HE 3VXSA 3BQVA 1NMCC 5M2FX 5JW4M 2IW0A 4DZHA 3EOSA 3D39E 4Y4FD 3OGOE 4XP5H 1JN6B 5DQPA 4WJ5B 3B0XA 3NEEA 4AQ1B 1UP3A 2JXMA 3BZ4A 3GVWA 5FJOA 1A7NL 2OX5A 2WC3A 4UM9D 5FCSH 1AS8A 3V0SA 3VD5A 3NQIA 5I74C 1JVOA 2PC4A 2NYKA 2HLFC 4FQHA 4QPEA 3WUWG 1VESA 4LPUA 5IW1B 3FUJA 1UWGH 1MEXH 1IGCH 2JKIS 4ATTA 3NIGE 3N25A 3K6IA 1NCIA 4OI7A 4I9AA 1A3QA 3HQPA 3RNQA 1ZCRA 1CK0L 4FCAA 3VKBA 3IVKB 2ZCKH 1ZPTA 2B7NA 3OGRA 4BBWA 1XH3A 4ZQTA 3KXQA 4UT9H 2PPAA 4Y4KD 1T41A 2TSBA 1C7SA 4HCRA 4LNRB 3W6LA 4K8RH 2VNHA 1TX2A 1JK8B 3EJPA 2ZRXA 5F3HA 2J56A 3BMXA 1P7QA 3WGUB 2O0TA 3V36A 3BPNC 4OJFL 2FTAA 2WJDA 4JMXA 1OP9A 4YHEA 3ULSB 1QVFB 1L6SA 1NDHA 3C5ZB 3WEBA 2R1WB 3FCGA 1U1UA 5ISZA 5KW9H 5DK0A 1M01A 1FG2A 2NY7H 2VR3A 1MVUB 3LHUA 1FZMA 2CSPA 2FKPA 4D2NA 2C3WA 3M7OA 4N2IA 3CAQA 1HQRB 2TYSA 3VJ6B 3QIUD 4BCYA 1MHCA 2BGJA 1ONRA 1NFIA 1NCNA 3KR3L 5G4WA 5H94B 1ENUA 4ADTA 3EADA 1OYAA 3G8RA 3URBA 3ASPA 5A16B 3L4VA 1IJ9A 3IGHX 5DVPA 2ZDSA 1JRCA 4TVPL 2HH0L 5IJVA 2VFHA 4RMVA 3KHDA 5GS1B 4JM4L 1QPOA 2AF2A 2I7SA 3S4SB 2KC0A 1FYTD 1H6UA 3OKNA 3VRLE 5FKAB 3V0FA 4L2LA 2WIIA 2DMKA 4HOXA 5ANHA 5FECB 1FFOB 1Q6GA 4AT6A 4B0MB 1COBA 1SJHA 2D0HA 5FV2A 2XFWA 5E8PB 4CU7A 4YC2C 3BG3A 4Z2HA 2P10A 2YCJA 1MCJA 5LB1A 1GTFA 3SQOL 3MNVA 5KG9A 4YELA 2VDLH 3DYMA 3T4AA 2ATKB 2I07B 4Z1DA 2B0MA 4OCLC 5IHRA 1Q63A 1M53A 5JHLA 1RV8A 6A3HA 3OW7A 1F4XL 3ISWA 3G1VA 4JD4A 3NWRA 1ZLUH 1EA0A 2HCZX 3P73B 2JKTM 4M1DL 2XQYA 4CW1A 2CLRB 1AQMA 4RNRB 1KBGH 1OCBA 5AKQA 3AAZA 4FLOA 3Q3GA 2FYMA 5EF3A 4HX1A 4R0LC 1F4AA 2A74A 5F9AC 5ABAA 4FFVD 5C0QA 1NAKL 5BZDA 1MNNA 2IPUG 1SXAA 1DJYA 2OYLA 1ZALA 1UA6L 4FQXB 2OR8A 5C0AA 4Z77B 3KPQA 1G7HB 4UAHA 1GZJA 1HNFA 2G9KA 3QZWA 3G1RA 4A39A 3BVJA 4LLMB 1SXNA 3C2RA 2ERJB 3U36A 4JPVH 4D3CL 1UYWL 3BOXA 3ZE0F 1M2OA 2XPYA 3R94A 1PFCA 5MHBA 4EIBA 3DGRA 4FG2A 1JZEA 1ZP3A 4Y9CA 5LXXA 1GZHC 1SFHA 4G5AA 1ED3A 4ELMB 2ATSA 1ZKAA 1MN4A 4N2EA 3CJPA 4K5LA 5CN1A 3WFZA 4U4MA 4LKCA 1R5WB 4OSUH 2YPVL 1A6WL 4W9DC 3KBJA 2V5KA 3AUWB 3TWYA 1T1YA 2Y4SA 2VC9A 1FLRH 1HZEA 1V79A 4RCAA 5GZNA 3NCBB 1NEPA 1PNCA 5JUEH 4LSSL 4U3HA 2Z3FA 3VDAA 2ZWYA 3MRLB 3D3VE 1E8YA 1A6ZA 1ZENA 2NV1A 2OEJA 3F6IA 5HYQB 5EO9B 1G7PA 4H8WC 4B9PA 2D7TL 2ITCA 3O8XB 3ITLA 3F7LA 4WUIA 5DZNA 3PS6A 1EHXA 2AZAA 3VA6A 3HPLB 3JWNG 1MDLA 1Y5VA 1A0EA 5K9QI 1XB6A 4MMXB 5J5EA 5JBDA 1PKVA 4D9LL 1EPXA 1KC5H 2ZUUA 1RK0A 3TU6A 3IJYB 1CLYL 3US9A 1JTTA 2OLDA 2GEEA 2XKNB 2V9QA 1U93B 1L3NA 3CFUA 1CT8B 5JTWA 3CIQA 5CGQA 2XIMA 4KXCA 3PB0A 4FEZA 3PJSA 2DQ6A 2F1MA 4FRWA 3NJXA 4XLEA 4L1TA 4CQCA 1UENA 3DURA 5DT7A 3QDMB 4XMPH 3W2DH 4L9LC 4Y5VA 4EKJA 4PRHB 2EEFA 4BQ6A 3NFPA 3DKLA 3RLUA 1H61A 3HC0B 4IIQA 4HUNB 4HWBL 3W39A 5T3ZD 3WMPA 7TAAA 4M48L 4IK6A 3HGRA 1N5YL 2NLJA 2XN1A 1YMHB 2H6PB 2XZ7A 1BZQK 1FYTE 5I8KL 1CD1B 5MI0B 1UROA 4FQ2H 3IKCB 4HQVA 2QCHA 4R4FH 1MFBL 3KM2A 4W4OC 4PFMA 4EEEA 3UROR 4HK5A 2ZG1A 4IRSB 2QGEA 4DELA 1KNOA 5LJYH 3AG1B 3VD1A 4J5NA 3FT9A 1E2WA 3EZ8A 3UP8A 5C5YA 1TEGA 2L7JA 2MNRA 3BLIA 1OOAA 4Z18A 5BRQA 2OR2A 4HA4A 5K39B 3ABGA 5AD0B 4MNQA 3NEXA 1M57B 2F5AL 5LNSA 1IJFA 4M3HA 3PS7A 4Q8NA 2G5RA 2B81A 1FUNA 1M6OB 3BQUB 3MRIB 1I18A 4BHUA 4LB3A 1H6TA 1BZDA 4EF9A 1I53A 4UFIA 2ZXCA 3MDWA 2XTJD 3F2BA 4APXB 3PRZA 1ZTXL 1MJ7H 1EP3A 4GSQA 4JQAA 3DX7B 4Q6JA 4Z7VF 3SDDC 4C6CA 2W60B 5KS9B 2UY5A 4MWAB 3CVCA 3GZ3A 3DYPA 3R0NA 1OSZB 4JY5H 1MRDL 3F2DA 5EO1B 2R94A 3L9RA 1BTCA 3CFEB 2CA3A 2CM6A 4XBGB 1XSJA 1T5XB 3K46A 5GGTH 4WVRA 4WWVA 3C6CA 3EZ4A 3O2WH 3UG8A 1Z0NA 4AL8H 2FBRA 3K81A 4OJYA 3NQBA 3CFJB 1XP3A 4NSKA 1OSYA 2PP7A 1AP2B 4XN1A 5C07D 4Z5RA 4RDVA 3NABL 5J12C 4UQ2A 3MO1B 3HE6D 4IXXA 3B4NA 4GINA 3KPOB 3GKWH 2JJWA 1ICPA 1L2UA 1SO3A 3TQ0A 1UMYA 3L45A 3GPEA 4NNBA 2VDIA 2ICWB 4C6DA 4MB1A 4PJGE 2OKTA 3OKKA 3PZIA 3NCJH 2RJHA 1WWCA 3CHVA 5D70H 4H1ZA 3RR4A 1HHIA 5T33L 1I1AA 3W53A 3HB3C 3B8IA 4DX3A 1VACB 2F53A 2P28B 4UQDA 4IS6B 4JLRB 3O7UA 5CSGA 4HSQA 5LBSH 2DEPA 1IEXA 4X7FC 4OVXA 5DJZB 1U8JB 2H26A 4FA6A 4K37A 1E9QA 3C0JA 5HHQA 3QUXA 3DHDA 4LDOB 4XCCH 3QPQC 4I3GA 1XLDA 4HU2A 5DT1L 3W1AA 2Q0ZX 5MENB 2OCFD 3SCWA 2YK1H 4JR5A 1RQPA 2GIYA 5IHZA 2A99A 1AANA 1Q9SA 1E8WA 2HUEA 4LLQA 3UMTA 2HB0A 1T3FB 3BUVA 5IDIA 1VD6A 4HJFA 4Y0GA 4AQEB 2NXHA 1JF1B 4AD0A 2VFDA 4OB5L 4ZAKB 2DH3A 3EKCA 1WTLA 5KWYC 1MCOH 3HNTL 5HPMB 2ICWI 2YPLD 1RJYB 4WW2F 3CHRA 4N0FB 4W88A 5IV2A 3K4AA 2QQKL 3PSWA 5T3ZE 3OZPA 5I2IA 5EB9A 1C9DA 1B3OA 4P8VA 5I23A 1LE9A 1YYLL 2EQDA 2TSYA 4G8TA 1FWAC 3QF0A 4LBVA 4M3JA 3PWAA 2C1IA 2XU9A 1RAKA 2PRLA 1R3IH 5E1HB 3ZMNA 3K71B 5I26A 3KRZA 5DCDA 2FIRT 4HVBA 4GH3A 4C56E 4JHAH 2ADJA 3S2MA 1CE6B 2E40A 3NXFA 3FYPA 1FV1A 4A2EA 4A7QA 1QFUL 3EHBD 3C8FA 1O68A 3KLHD 1K8IA 2OAAA 1M7PA 2BOBA 1GGBH 4HHGA 4HK7A 4KJQC 3FJLA 2R1XA 2GOKA 4PBXA 2ITDA 4HD9A 3BZFA 3CL6A 4H9VA 4MA3A 4AEFA 2BNRA 4Y9FA 1W5PA 1XZWA 2ZUYA 4Y4HD 1OCZB 4FNLH 4K3EL 3OTTA 1VBJA 2VDKH 3R2GA 2XTJE 3KPPA 2HPOA 1CICB 4DH2A 1Q6OA 3A4XA 3UEZA 2E7HA 5L46A 3NZHL 4JN6A 2E9MA 4L1DA 4YBLB 3BG9A 1PD0A 3L9EA 5IB4B 1HHJA 1WDSA 2XXGA 3F83A 3DV6B 4N9OB 2PGFA 3BY1A 3ATBA 1K4CB 3FHEA 5JXAL 3FLUA 1OK8A 3SLNA 4HIHA 5E0FA 3GIVA 4GT0A 4GW1B 1TO3A 3O8AA 2E67A 4XVSH 4OCSH 3Q5TA 4OUEA 2HX8A 4GRMA 5CPMA 2HRPH 2X0VA 1T20B 1RUML 4BZ2L 1Q94B 4LSQH 1NEYA 1O7SA 2VXQH 1ZHBA 4P3DA 2IPUK 1OANA 1KEMH 2VXSH 5HHMD 5INDB 1KTLA 2CZFA 4WI0B 4K71B 4KO9A 2QCFA 5D96C 4W7VA 3WI9A 4MOZA 2OWCA 1LRNA 4TUUA 5CMAB 3FT2B 3DUUB 5TQ0L 5HI3C 1VZHA 2I32A 3THUA 4DXKA 2IH9A 2WLZA 4NT0A 3APDA 4F2MB 5ITBL 2BSCA 3WNMA 4XTIA 1N9PA 3IRCA 1A5OC 3L4TA 5E00A 2GSJA 4JO1L 2O72A 2Q8BL 1FF5A 4P46D 2AV7B 1H63A 2HTLD 4WZEA 3CMEB 4FFZL 1PW3A 2YQ2A 5EU6A 1ZSHA 2HSIA 3UJTH 2J20A 5D71H 1JWMA 3RI5F 4RZCA 2DERA 3WJLA 3UTSA 4QD2E 1XCWA 2P8PA 2BMKB 2JKLA 3DDMA 3LOWA 4F2UA 4BRVA 3GU2A 4KNSA 3MUZ1 3PM6A 1VHNA 1BQHG 3LNEA 3WIFB 2IOOA 2LV4A 1F8TL 5I1IL 3HMWL 1OVZA 5FO7A 2WIMA 4E0CA 3H8NA 5IRPA 1MAMH 4MYWB 4TOYH 3QEHA 2X89A 4GLEA 3A8IA 1XBZA 3HZVA 3ABMB 4PTUB 4WO0A 4NUJB 3Q2DA 3NRQA 4RGND 4HPYH 3RO6A 1SEBA 4KIEA 3GC4A 3O0KA 1GY1A 1YXCA 4F0MA 3ARFB 4X5PA 5J6HB 4QXUL 4B5EA 5BROA 3MBEC 5K9DA 3WQCA 4HS6B 1CXLA 1FWFC 5F1UA 3RU8X 3WFBH 2ZKMX 5F1IA 1QFHA 4UANA 5BMFH 3TT1L 1XEUA 2J2ZB 3W0WA 1VJIA 4MDRA 3UFYA 3PPSA 1MEWA 2BB0A 2PAJA 1LDPH 1VFSA 4KEZA 5IVXE 1TDQA 3LN4B 3IETA 1BJ1J 3B8SA 3LRHA 2DQDH 1U8IB 5H2ZA 2WQDA 2BV3A 2AK4A 5JQ6L 5HZAA 3B40A 1AXTL 5C54A 4R9HA 4W5UA 3CTAA 2X4PA 5E0QA 4V1YA 2Y1YA 5C2CA 1OGAB 1TETL 3Q43A 3U48A 5E23A 2AAAA 3MFFB 2VP8A 3P5YA 2QE7A 3O4OB 1JRHL 4II3A 2CDFA 3LPGA 3M5ZA 1V6VA 1CTMA 1YPFA 3V0UA 4NRZA 3TW7A 3QW9A 2DTSA 1RZKH 5FOJA 5DMNA 3O1NA 3T1GA 1GC1H 4RMQA 4NI8A 3ZDWA 5GPRA 4RGMC 1HKFA 3Q94A 2BDNL 5G2IA 3KCOA 2F0CA 4F5CA 3GO2A 3DO7A 4KTDL 1OQFA 4EWND 1MNSA 3OIXA 4K8RD 1VF8A 5B8CA 3K91A 3VDCA 1V7NL 1TUPA 4AAJA 4HIIA 1NH6A 2ZF8A 1AR1D 4GG8A 3QNYA 5AC7A 2YRBA 5B4MD 3CN0A 4PJHA 5F7BA 3S3JA 1SQMA 3T2LA 5EPMA 4TV3A 5I8EB 1MSSA 1YBQA 3LV5A 1MFAL 3AU1A 3FK4A 5HHME 1PJ9A 3U0WH 1U3HB 3DSFL 2VGBA 1D6EA 3X3GH 2KI6A 4L9DA 1G6RH 1GZPB 3NSDA 1S0UA 4WX2A 1AJ2A 4M81A 1P48A 4K9EC 3MA9H 3R8QA 3NOEA 2BNUA 1TZ7A 5KYUB 1VFFA 3QFJB 2B0SH 4FG6D 1QUFA 1WUEA 5IB5B 2AEOA 2JJ1A 1Q7YD 1QKZL 1HG3A 4NBSA 2CU9A 3DLQR 1MREL 3ZYJA 5BZAA 1Q65A 4KBPA 4DSYA 2OMWB 3RY8A 1HSBA 4P2OB 4YTSA 4P61A 1F8IA 1T22B 3UTOA 2H0FA 3MGOA 4PV8A 3D48R 4KKQA 3LCXA 1LNUA 5E1AB 1E9OB 4NO2B 4JTEA 2R29L 5JU6A 3Q1EA 7ODCA 5CU5A 1W0VA 3AQXA 5D1ZA 3DXAD 1JXGA 3UPAA 4LAJH 5C0BA 3SAZA 4GP5B 3NQKA 3F58H 1RJQA 3MZGB 4LMQI 4OJDH 4DBUA 2RD0A 2JI1A 1IQ8A 1F3EA 2AK1H 1HSAA 5ESVA 2R9HD 2ABBA 4O50A 3PNRB 1JGDA 1PCWA 3VE9A 3DBPA 2Q7NA 4JGNA 4WUUB 5DJAA 2R4RL 4FERA 2NX5E 1OAZL 1RUAL 2JKNA 5G5DA 4H8VA 1MHHB 3UO1L 1GVQA 3VIPA 5EU3B 3OPOA 2QPSA 3O9WA 4JFEB 1D7FA 5F21B 1ZV2A 3OX8A 1I2OA 5DZLA 1XBDA 3MV9A 4CJ0A 3HN3A 5GNZA 4OQTH 5ETUB 3R7QA 1MHEA 4G3YL 5AAMC 8TIMA 1JCVA 1VQ7B 3SZKC 3MLWL 1QEXA 2YCKX 4R90H 2W4XA 4Y7OC 4GAYB 2G75A 3NZUA 1JI2A 3LBOA 5CM1A 3I74A 5MEPA 1C1EH 4UTBA 3OVQA 4N3NA 5E9DD 5BS0A 4S2SB 1FRNA 2AXFA 4DIAA 1H5BA 1YTKA 4FQLH 4GIAA 2XH2A 4ZTPL 1G1KA 1UD6A 4ZCIA 2Q7YA 4QT5B 1S5VA 4RR4A 5DO2C 1LOSA 5FJPA 4ANWA 1A4LA 3T6CA 1S9WB 1AY1L 3NPWA 5FGRA 1PDYA 2ADFH 1LLZA 4PRBA 3L1EA 3CUZA 3QQXA 3PF3A 2AEQL 4GOSA 1U33A 2VLJD 3QH2A 4QRBA 3MHPA 4XMWA 4ZUSB 4YDMA 2GGGA 5F89A 4S1SL 2PCPA 4PGEB 2VDLB 1S72B 2X12A 3VXNA 2G37A 3PZNA 2OK7A 3P82A 4M1KA 5IBXA 1H50A 4QJ1A 3DDYA 2FX7L 5L2KD 4WO4B 4Z78B 2BJMH 2IH3A 4ODXB 2X6UA 1TEYA 3OKLB 5FEZA 3FO2B 5DJ0A 1ADSA 3TNNA 5DQDL 4YDLB 3TEWA 5E5RB 1ZHLB 2H0JA 4DGVL 3N34A 1YRKA 2ZKHL 3O3AA 2JALA 3HUJF 2AS5M 2G5UA 2QCGA 1VLYA 3QUKB 5IYWA 3W7QA 4Y1AD 3JQQA 2W95A 1BVOA 3UIZA 4H8WL 1FNDA 3HPSA 4PGBB 4E9WA 2NUYA 1NPUA 3RWJA 5FJRA 3O11A 43C9B 1FO0H 5EBWB 4WY7H 4XN8A 4E5XB 1NGXB 5HNUA 1X98A 3BT2H 3MRQA 4JNMA 4M5ZH 3Q01A 1IAKB 5HBBA 1HQ4B 3H21A 2CNYA 1KCSL 5AKTA 1EVTC 2EG7A 4IGBC 1Q86D 4C6BA 4J4PD 3SOBL 1QMLA 2J77A 2P53A 1NOUA 3H1ZA 1LWHA 4MTVA 5GGVY 2REQA 1UW9A 1FVCA 1PSKL 5EEUA 2FMOA 1TV5A 3DXAE 2XXMB 4JRXD 1OM3H 2XY1A 1NCHA 3PULA 2B7BA 4X6EB 4Z0SA 3QJOA 4P5MB 2A6JB 3QAQA 1R3RA 2W0LA 4ZPVA 2XIDA 2HT4C 3REQA 3SUWA 4BY3A 5I6MA 5IM7A 1KBWA 4OKVA 3ZTNH 3UTTA 3NRPA 3MODL 2JF1A 5TAOA 4DVBA 4UB9A 5I79A 2PYED 3KYNA 4KTEL 2X1RA 1P7BA 5F44A 3U0PA 2N59A 4U1NA 3WY4A 4GYKA 4M6NL 2W61A 4W1TA 3QIBB 2VO5A 2CNZA 3MP3A 3OAYK 4AH2B 2YEVB 4QLRA 3QQ1A 3RHWF 3QORC 5AN7A 5FEPA 4JK0D 1F00I 2WUCH 3OXRB 1N2VA 4KVNH 3ISRA 2NUWA 1N70A 3L9CA 2XIOA 1LROA 5IFJA 4BWWA 4PB0L 1KFBA 4IMLB 3FQYA 3EYOA 4D6DA 1RK6A 5E9DE 3CUIA 1R5NA 3L7RA 3FQUA 5DJ8A 2ZXIA 5MERA 4KK8D 3CS2A 1WTHD 3ARBD 2DJ4A 3WHXB 3SY1A 2BC4B 4CVZA 4I2XB 3RIFF 2EPKX 2BS9A 3DX0A 1Q82D 2BHYA 5GRYA 2ODIA 3NTYA 3S2LA 3SIZA 1PZSA 1F8MA 1OQOA 1U91B 2HWGA 1ZS2A 3PUDA 5F9WC 2PTYA 1JUKA 2X4UB 5AZEH 2JIZA 2VLLB 5JHDB 1A2YB 2E09A 1N07A 3VXMD 2W9DH 2LR4A 2VLJE 1G7SA 1S9KC 3SE8L 2QCEA 3B7UX 2OJEA 3ITOA 1RSFA 1H41A 1HKIA 1N6VA 3AUVA 4UUJA 4UV7H 5CP7A 2H1PL 1AH3A 5I1EL 3EJZD 5GS2H 2V8LA 2UZ9A 5FGBA 2VC5A 4CCZA 1WZKA 2YL9A 2YDRA 1IM3D 4JHBA 4QNPE 4CN6A 1KB9J 1FKXA 4WTQA 5CJOL 2ARJB 4N2HA 3RVTC 3AWEA 4WY0F 3AS1A 1YZZA 1J87A 1BAFH 1UCTA 3PWNB 1WIOA 4JB9L 1LEKB 1H7RA 4DNLA 4LAOA 3K5SA 4H9TA 4DI9A 3NR0A 4GY4A 2ZKXA 4LS0A 3GT6A 4HBCL 4Y5XB 1EEPA 2PPCA 1X6UA 5I8OH 1LL6A 3VACA 4DK6A 2QVMA 1M7UA 3HNVH 4PJ9A 4TNVK 3MYOA 3ALFA 1GKRA 4D72A 3SGDH 1TJPA 5T3ZH 4OD1H 2KPWA 1AG0A 4KKCC 2C1OA 4NNPL 5C0NC 5MP6H 2DJMA 3IWVA 3QCUL 4US5A 2WLIA 1RMFH 2ZP8A 2A4AA 3S42A 4L7ZA 3T2QA 3LZ3A 4IM8A 5K3VA 2UX6A 3NQMA 4EXAA 3A6BL 4LANA 3MRPB 3ZIAA 4JY6B 4XC3H 1QG3A 3IGKA 1R3JB 1RZQA 5D72H 4EI5B 4EOWL 4NIRA 3QFTA 5EMYA 3G6EB 2XNAA 4L4JA 1XIBA 3VFTB 1ZL1A 1IWAA 1AZCA 1XG4A 3RUBL 4ICNA 2A83A 5CZRA 4JN2A 2EYTB 4TLUA 4TQ8A 1WDQA 2YD2A 1EZSA 1PZ5B 3SJVA 4AIZB 2BGSA 2VCCA 1IXPA 2YLLA 3OPZL 4YAQA 3M0YA 3TJHC 1EV2E 3ARDD 2ZCLH 4AGMA 4TNWK 3DPBB 2VURA 4Z7VB 3V7AA 1P6WA 1DL7H 5KVDL 2ZQ0A 1VQ6B 1FGNH 2PYEE 1UADC 1F6PA 1S7VB 3CCRB 1DL3A 1TTGA 1GEHA 4XD6A 4DO4A 3AB0C 5JMUA 4PP2A 1R38A 4Z4YA 4GKLA 3TBSA 2EUXA 1TZHB 4NNXB 2YMTA 1VLXA 2EE3A 4JG0H 1MXGA 3TOYA 1RHHB 5IMOA 4HPXA 3IJEA 2SODB 4YQXH 3I55B 1PHQA 3ELAT 3BWAA 4L3EE 2RJMA 4WF7A 4N20A 3MKCA 3NGFA 2VLKB 5FJJA 4OOSA 2JMRA 3IYLW 4Y19A 2GIMA 3ZL4H 3NL5A 4LCWD 3EFFA 5MEQA 4O1DA 1S9XB 3HKFA 4Z7WF 3RZCD 4HMDA 3TBBA 3VWKB 4XE5B 1KLFB 1C8PA 3C5ZC 1V5XA 3E9AA 4ZCWA 1CLZH 3V0VA 4RDKA 3CMMA 4D0CA 3WGVB 2QGGA 3CXDH 1HHGA 3QV6A 4YN5A 2YD8A 3HS0A 1M9SA 2A3EA 3PLYA 3GJFH 1M3IA 4A3RA 1VKXA 2E6FA 4LSVH 5AOKA 2PP9A 1XHHA 1X96A 4P5TC 5C7VA 1FNMA 5CEWA 2RALA 2NZ1A 2C79A 4IL2A 3I6RA 2B3RA 2YBRA 4N4YB 5LXGH 1H49A 5HD8C 4ORGA 4F80A 1XS2A 1ACXA 4G7WA 3BV4A 5FUCC 1S7SA 1U8HB 1FDJA 3DRTB 5GNXA 4JPGA 2QNEA 5D2NA 5IFPA 4JO4H 4B6ZA 1T8QA 1E4XH 1NZRA 4MWFB 5DELA 3ZJ7A 2D24A 4JANB 4MD0A 3PL6C 3H2MA 3QUZA 4WW2B 5IVXF 2VYQA 3FS2A 4CNTA 1FPTL 3OZMA 2JVUA 4Q74A 2Y8VA 3L1OH 4MIMA 1GW6A 2GFBB 3ZBUA 3CN3A 4KI1A 2QVFB 4LCCC 8A3HA 3PGCA 1RH9A 1WKFA 4JY8A 3ZJ8A 4LCVA 3O06A 2PXYB 3I6TA 4XWGL 4AGQA 3WYAA 4PRIA 4ONHB 1AGDA 4NUQA 4Y9BA 2GVJA 4LU5H 1J8HD 3GB6A 1MEHA 1KM0A 1OF8A 3FCBA 2IDQA 2VBUA 2A2QT 2YEQA 2Y61A 2X4RB 5BZXA 3H3KA 1VPOL 2VAAA 3PV6B 3AYVA 4U6XB 3RWCA 3NM1A 3B8DA 4ACBA 3CCQB 3DI0A 1R3LB 3OGCA 4UM8A 1AH4A 3HNSH 4LCYA 1ZOXA 2XQYG 5DFVC 3EH1A 2X1PA 4D1IA 3SUVA 4M4SA 5LXEA 4XBPB 1ZXQA 2QZRA 4FQXC 2O4QA 3TROA 4UT6L 4B9KC 4N0YH 1AMYA 3QDAA 3FQWA 4P22A 1CGUA 1WDPA 1IC4L 2J4WH 5F9DC 1B6UA 1FNGA 3WNNA 1GT8A 3TJEH 3N3EA 4N7QA 5FA4B 1R24A 4H2AA 5AYQA 3MTXA 1VFAB 1BXBA 2J7EA 1NANH 3QZWG 4HFUH 5FLUA 9XIAA 2WO4A 3OQ8A 4XO9A 3QMSA 3K4ZA 2WP3O 3ABKB 3PDOA 2W6RA 1WWAX 4IOSD 5FJIA 2QF8A 3S3BB 3KH3A 2W0KA 3PIQA 2BGIA 4JUTA 1W8GA 1EUUA 1FDLH 1CEOA 4XH2A 4XZLX 2JQZA 3BWSA 1L8PA 2PTZA 1KA9F 2B4CC 4U5IA 3I4KA 1MCNA 5E6ID 1I7ZA 4P4RB 4EAMA 4XNUH 2X4OB 5LNGA 3HQNA 4E4UA 4BK5C 4LCWE 2R2EA 2XZAL 3M7SA 4I3RH 1EDYA 4MZIA 4G5ZL 2OZ4L 4NN5C 3HG1A 4PLJC 4CC0A 4PMDA 3NACH 4G5GA 4ZSUA 2ZX9A 3D39B 3KTCA 5CBEA 1MQ8A 4EPDC 1PU0A 1O5QA 4N86A 1X8FA 1XYFA 4GRLB 2D3NA 1NPNA 3STFA 2IGFL 4ZMWA 3SGKA 1JDFA 2PD5A 1YEFL 2IAMD 1H60A 3B04A 2B59B 3DVNB 1L9TA 1KY7A 4HIPA 3PVFA 4NO0B 5A94A 1O5RA 3DX4A 5F7YC 4DF0A 3VFWB 3GXIA 1FAIL 1M7DA 3AU6A 1CQYA 4PB5A 1NQ6A 1I8LA 2L7QA 1F4HA 1KBIA 5KAQG 1TUXA 4LLDB 3RX5A 3BGFC 4KKSA 2A7PA 2FTYA 5DSZA 1YDOA 4N8UA 3MO7A 1R8LA 4Z7UE 2E27H 3E8UL 3EOAB 3VZZA 3OXSA 3UBPC 4BHYA 5FS5A 4BSWB 4WK9A 4P5UA 3CMOL 3MOBL 1O12A 3IDNA 1U95B 1IBFA 3IT8D 5E24E 1IL1B 1UVQB 4AG4L 4Q9RL 3PZUA 4AY1A 1BZ8A 2VDNL 4H2HA 4GNJA 5JO5B 5ICZA 32C2B 3HA1A 3M17B 4UFJA 3LLDA 4B91A 3FU0A 2Q8ZA 1LO2H 4X5RA 4F0KA 1MFCH 1NIBA 4U1IB 1YPZA 1SYVB 2XPGA 4DIXA 4RJEA 2B7OA 4LX4A 2WSRA 4GVGA 3H9NA 2W8CA 3JWDC 2CXKA 2WYZA 4PR5A 1JE6A 4YAWA 1A5FH 5FSEC 2OGJA 4W9LC 2W63A 4JKLA 4P9HH 4JZJB 2Z4QA 3CO8A 4OZFA 3NL6A 5IQ9A 4NQTA 3RDTD 1KJ3L 5KTLA 1F76A 3X12B 1IAIH 4S23A 3OD3A 4JYEA 3L54A 1EANA 3VB9A 1YTEA 2R91A 1E6OH 4P2QA 3VCRA 2FJFB 4S1FA 5FL7A 2VM4A 3T1FA 2GK1B 2DLGA 2OSLA 1DBJL 4HIEB 4QHMB 2CGRH 3OVUB 4JIQA 3KEWA 5ES4B 1TJGH 2EICA 2PU0A 4NKOB 4FN0A 4XVTH 1PY0A 1O6IA 5AZUA 2A3TA 4U2ZA 1S8DA 5IUCA 1RP8A 2IQ9H 1G1YA 4KTGA 2IKHA 1G6RB 2XWRA 2X85A 3V6ZB 5AECA 2V7XA 3LEXA 4P6VF 5K9JH 2DQMA 3NQVA 3LKNA 2JGYA 1ETJA 1L6XA 5AB0A 2BX5A 3QUMA 3KCLA 3X14A 4XNYH 1YITB 3EYUL 1D5RA 2JDIA 5LMZA 2UWEA 3CFIC 4YL2A 4ZENA 3GYCA 4MDIB 1LWIA 3TIMA 4XK2A 3W88A 5I1KH 5DQ9B 1DWJM 2ZRYA 4G9FB 1K2DA 2BIHA 4X6DA 2DPEA 3C52A 3GC2A 1AVAA 4QF1B 4S1RL 3WUZA 3WS3A 4TUKH 1XLIA 1KJ2A 4Y7EA 3U83A 1GYVA 2J44A 3IGXA 3KDNA 4AC1X 4FI6A 5E8NA 2F4NA 3D3VD 5EBMA 3WXVL 3OG2A 4O4WA 3TWCL 2VISB 5EZLA 2WWKO 1A1MA 1ZJAA 2D2OA 4KFMA 4H1LH 5FIPA 4OF6A 4Y4FB 4HHWA 2Q10A 3QHNA 3VVWA 3STBA 4UNVA 4EUPA 1F6YA 1GPOL 1BG9A 4X7TB 1ZM2A 4UM9B 2VR8A 1L7IH 4S3AA 3C5SB 3U4AA 2C1PA 2BMBA 5ECJE 5IMKA 1S5TA 5TQ2H 3F8UB 4ZAKC 1EC9A 4NEHB 4PMYA 1RPXA 5F2MA 1U8QB 4OF7A 4FN5A 4KWUA 5FYLL 5D7LD 1Y6MR 1D9KD 4JCLA 1VC4A 4YDIH 4RD2A 4G7YL 2YC1B 4XGZA 2I5GA 1I3UA 5AZ2H 3T3ME 1XSIA 2AEIT 3D4ZA 1KCZA 3W9DA 4WWKA 3DJ9A 3B3IA 4GXWA 1NCOA 4MY1A 2R8WA 3AZRA 4WV1A 3FU7A 1HC1A 1URZA 2F19L 1QATA 4Y4KB 4XMLH 3TTSA 4NAEB 4XVUD 3P0GB 4PJDE 3M0LA 5D93C 1RHFA 2FLBT 2Z9TA 3BFWA 4YL9A 3P14A 4G9PA 1WYIA 3IVTA 1BP3B 4YDKH 2RCSH 4I18B 3VNIA 3OPUA 3BEWB 4K7FA 4L3AA 2FYYA 2R2CA 4WW1A 2QHRL 1VBGA 4X9YA 2QSCH 3UJRA 2C7FA 1S5HA 4S0TD 3SPIA 3ITXA 1CI3M 5EU4A 5CAKA 4QTFA 2K8QA 2PEVA 4LSTH 3LIZA 2HFEA 3KDPB 2NY1D 4KJWD 3M0JA 1CENA 4LY8A 4G1BA 5HY9A 4UTUA 1N0XL 3HE7A 3FOMB 4X98B 3GS7A 1H3VA 4OUIA 3T3PE 3HG5A 3I65A 1TQTA 4KWOA 5D5MA 3QI9D 3ISXA 3QIUB 2B4GA 3CSYB 2CZ5A 3IS1X 5IJCC 3ASWA 5L88L 1N68A 1ODZA 3L08A 5AVZB 5A40E 2QUVA 5IVZA 3MZTA 3M41A 1Q72H 4XQ6A 4CMMB 4MZ2A 1C5DB 1N59A 1WUFA 2F7QA 4YS1A 3QH3A 1PZ2A 3B9EA 4MJZA 3FEMA 2AJSH 4AXWA 5F6HI 2RB8A 3QQ9C 5HDQL 4BH7B 1TWDA 3MLUH 5FCZA 1FYTB 1FO0B 3SPCA 3UPWA 3ZVHA 1A9EA 3GRWA 3FT3B 2XQYK 3CZEA 2EXYD 3QJHA 4Q6XA 4A2SA 3Q13A 3E6HA 5ERWA 3BP5A 1ADQA 2WMIA 1DJSA 4PS8A 3SCMD 1RZMA 4OJCA 3W72A 1PZ3A 2NUTA 3KYKL 2EVJA 1KIRA 2ICEA 1KFGA 3ZTDC