2DIEA

Alkaline alpha-amylase amyk from bacillus sp. ksm-1378
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
481
structure length
481
Chain Sequence
TNGTMMQYFEWHLPNDGNHWNRLRDDAANLKSKGITAVWIPPAWKGTSQNDVGYGAYDLYDLGEFNQKGTVRTKYGTRSQLQGAVTSLKNNGIQVYGDVVMNHKGGADGTEMVNAVEVNRSNRNQEISGEYTIEAWTKFDFPGRGNTHSNFKWRWYHFDGTDWDQSRQLQNKIYKFRGTGKAWDWEVDIENGNYDYLMYADIDMDHPEVINELRNWGVWYTNTLNLDGFRIDAVKHIKYSYTRDWLTHVRNTTGKPMFAVAEFWKNDLAAIENYLNKTSWNHSVFDVPLHYNLYNASNSGGYFDMRNILNGSVVQKHPIHAVTFVDNHDSQPGEALESFVQSWFKPLAYALILTREQGYPSVFYGDYYGIPTHGVPSMKSKIDPLLQARQTYAYGTQHDYFDHHDIIGWTREGDSSHPNSGLATIMSDGPGGNKWMYVGKHKAGQVWRDITGNRSGTVTINADGWGNFTVNGGAVSVWVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords amylase
publication title Ancestral sequence evolutionary trace and crystal structure analyses of alkaline alpha-amylase from Bacillus sp. KSM-1378 to clarify the alkaline adaptation process of proteins
pubmed doi rcsb
source organism Bacillus sp.
total genus 177
structure length 481
sequence length 481
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2dieA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2dieA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dieA01
3ZO9A 2CERA 3W6LA 1CZ1A 3B9EA 3GXDA 4PMVA 5AY7A 3ZJ7A 3DX3A 5LA1A 4UNIA 5EFDA 1JF5A 1ZL1A 4JKMA 3AYRA 3T0BA 3J7HA 3WBAA 3WUFA 2BHYA 3CH9A 3PZIA 1TCMA 2VX7A 4Z2LA 4WJXA 2XFRA 4MPKA 3GXNA 5AC4A 4M82A 3GH4A 1U33A 5D9NA 1CWYA 3VGGA 2WZIA 3LXBA 4HU0A 1MQPA 3NUKA 2YA2A 1V6UA 3ARRA 4LX4A 1UD2A 2D3LA 1KXHA 1GOQA 1W2VA 3WD2A 1VEMA 1UD4A 1ITXA 5GQBA 4LGXA 5M5DA 4AD3A 1OB0A 1JDAA 3WDQA 1KQYA 4CKQA 3GTNA 3MV11 5IFTA 5AC5A 3AHZA 4DUVA 1B31A 2CBVA 2DSKA 2W66A 3HG2A 2QLYA 4BCEA 3IJ8A 3WD1A 1J12A 2J62A 1JFXA 1Q6CA 5IDIA 2ZUWA 2WB5A 3F4VA 1EOKA 3AZRA 1OD8A 2A3BA 2WWCA 1PJ9A 1CGWA 2Y5EA 3BGAA 3MKKA 3A21A 3SCVA 4PYSA 3WY2A 1CPUA 2B31A 2J7BA 5ABGA 5A3HA 5DFAA 4OZOA 1KBBA 3HG4A 3BUPA 3AXXA 1NP2A 1M7XA 5A6SA 5A8QA 4AW7A 1W1YA 2VCCA 1VRXA 1I1XA 1E1FA 1XRVA 1Q6DA 1QX1A 2WVTA 4W85A 3VM5A 3KL5A 3DX0A 2NSXA 3NDZA 4TVUA 5E70A 3RMEA 3EMCA 2XVLA 2J8GA 2X09A 3SUSA 1PZ3A 2VTFA 1H4PA 2VZTA 3D51A 3VIPA 3CMJA 5EMYA 1YHTA 4WK9A 3WNPA 1NOFA 4M8UA 1J10A 2Z1KA 2WLYA 2O92A 4IISA 1CXKA 2FH6A 1H5VA 3WF1A 4UCFA 3WL0A 2WMHA 2DT2A 4F8XA 4FLRA 5HPCA 5A6JA 2G3NA 3N12A 1CLVA 1UYQA 4B16A 1FHDA 1C8YA 3SCQA 2EXOA 2CEQA 1HP5A 1E0XA 3WEOA 2CYGA 5GNXA 1QI0A 3I3BA 1UKOA 2DT1A 4PEEA 3CHFA 4Z2JA 3W24A 3WIJA 1E6ZA 1CIUA 1VIWA 1R34A 3K8LA 1OGSA 1MXDA 1B90A 3CLWA 4FLQA 1PAMA 1AVAA 2AOSA 4P7RA 1KGXA 3OZOA 4WKHA 5HXMA 1UR9A 3W81A 3EMQA 1GORA 1B3VA 1TA3A 3WF0A 3ZT7A 4UQDA 2OYKA 3ZSTA 4A4AA 1XD0A 3EYPA 4MADA 5ABFB 3G6MA 2ZXQA 2XN2A 2WXDM 3I3DA 3K4DA 1Q6EA 1UD3A 4PCTA 1PS3A 3MI6A 1XV8A 3WY1A 3MU7A 2CXGA 1GVIA 1QNRA 2EQDA 3WMBA 2DPEA 1B3XA 2XM2A 2AMGA 1DP0A 1OGGA 2WKLA 5LA2A 1JYXA 1NWRA 4EAMA 1VB9A 1QBAA 3PZNA 3LXAA 5CXPA 2VC9A 1HIZA 3VIIA 1TG7A 5KZ6A 2F2HA 3WDPP 1VBRA 2VZSA 4W87A 5IFPA 4D6JA 1O7AA 4KGJA 2BXYA 3QGVA 4OBSA 1AQHA 2FGZA 2YJQA 1FH8A 1WDPA 3VINA 4PMZA 3SCTA 3BAKA 1E71M 4AZ6A 1QNPA 4UFHA 4PMQA 5I77A 3HN3A 7CGTA 3AHXA 1BPLB 1J0JA 2Y2WA 3BCDA 5CSYA 2PC8A 4J3VA 1CBGA 1E3ZA 4JFVA 4UOQA 4Z2HA 1D7FA 1WO2A 5A8PA 1PZ2A 2CHNA 1CXIA 1ISZA 4W5UA 5A2AA 3WF2A 1JYVA 3ARPA 3RJYA 2VQUA 1XGZA 4PBGA 1E1EA 4IPLA 2O9PA 3A4WA 4P8UA 1C90A 3GM8A 3K4AA 2YBUA 1EH9A 1V6XA 3WKZA 5I3DA 1JYWA 5FD0A 5A6BA 1JAKA 3N17A 2W61A 3CZGA 1LG1A 3AJ7A 4JAWA 4OBRA 2HISA 1W9BM 3VMNA 4CVWA 1SYTA 1MW0A 4PSRA 4NI3A 4GQRA 1UD5A 3K8MA 2ZX6A 2QHAA 3WFZA 4DWSB 4HA3A 4ZFMA 4ATDA 2VR4A 1ZS2A 2WC7A 3RPMA 3UCQA 1D2KA 3D4YA 2F8QA 3RILA 1E6QM 4JL1A 4LYPA 3RO8A 2Y8VA 1BYBA 4W89A 4BA0A 1J0ZA 1V0KA 2F7QA 4IUGA 2QPSA 1UWIA 4GI8A 3WY4A 4PRWA 4W86A 4LQ1A 1SMDA 3T09A 1KGWA 2VUYA 1BVNP 3K1DA 1R46A 1UWSA 3WUBA 2JF6A 1NH6A 3MUZ1 3BH4A 1M53A 2D0FA 4B3LA 2XFYA 1O6IA 4J3XA 1UR8A 3VIHA 3BAIA 1V6WA 1JZ8A 1GPFA 5CPSA 4UQAA 1ZBVA 1VFFA 2Z1SA 1GONA 1JI1A 1GOIA 3AOFA 3MANA 4WKFA 3CGTA 2W91A 2FE0A 1ISVA 5JUVA 1PBGA 3II1A 5A95A 1EDTA 4AZ5A 1BFNA 1UWRA 5E0FA 3NDYA 3E1F1 2PWGA 3VIKA 4UTFA 2EPKX 5C70A 1QI4A 3BC9A 3AZTA 3O9NA 1QWNA 1TQVA 3LX9A 2ALWA 1DWGM 2RGMA 2WHJA 5ABEA 1M04A 1LL7A 2VR5A 5CQ1A 3UETA 3AIRA 1ZJAA 4M56A 4P7NA 4HP5A 3WNKA 2UY3A 1DWFM 2OWXA 4AD5A 5JBFA 1QW8A 3U7VA 3A47A 2WVUA 2CBUA 2JF7A 3BLKA 3PZUA 4WIWA 3VD7A 1JF6A 3RCNA 3KLLA 3HG3A 2ZUTA 4DM2A 5BRQA 3UG4A 2EPNA 5CPQA 3LPPA 4AC1X 1V6YA 3LPFA 5DMYA 1JL8A 3ZIZA 3CTTA 1WPCA 4KGLA 5D9OA 2GVYA 4H04A 4X9YA 1H3GA 4D6EA 2ZUVA 1UD8A 4DO6A 1GQKA 1OINA 2ZXDA 4GIAA 4FLSA 3EJRA 4UFJA 2F61A 3GNRA 4GINA 1W9XA 4PMNA 3CZKA 5IXEA 5FIPA 4UQEA 1QBBA 3GNOA 4U3AA 3AHYA 1NOWA 1HP4A 3T2OA 1JDCA 2J7GA 4TUFA 4UQCA 5FL0A 1KQZA 3OLGA 4GO8A 1VEPA 3WELA 3EMZA 3VGBA 1CENA 4F79A 2WCGA 1TZ7A 2F7OA 4HTYA 2OW6A 3PZ9A 2O9OA 5HOSA 1HJXA 1PPIA 1V02A 2PWHA 3AMKA 2BVDA 1G5AA 3S5YA 1LJYA 2UY4A 1J0IA 1WCGA 3MO4A 2Y4SA 2CNCA 4B9ZA 4R5EA 3HU7A 4A3HA 1CGXA 2ESCA 2X05A 4TVCA 3N9KA 3H55A 1OT2A 4HZ6A 4M80A 1QI3A 3PTKA 1V3MA 5I23A 4J3TA 4U33A 3MSDA 3NSMA 5D8WA 3UG5A 2FHFA 3N18A 3NSNA 1Q6GA 3BVTA 1HXKA 1E43A 4W8AA 2X2IA 1TFVA 2IUZA 2EADA 3U57A 1B1YA 2CETA 2JE8A 4FNQA 3WMSA 1C7TA 3UG3A 3CUFA 4QLLA 4UR9A 4E2OA 3W26A 1EOMA 4BQ3A 3PN8A 2VT0A 2O9RA 1E70M 1ECEA 2XVNA 2GDVA 5A2BA 1RD6A 3W38A 2VURA 6TAAA 3L2LA 4PMUA 1W91A 1H41A 2DSZA 1AQ0A 1SFSA 1HXJA 4MB5A 3AZSA 3AYSA 1M01A 2WVVA 4E8CA 3DYPA 5I2UA 4NSBA 3CZSA 1HVQA 4AIUA 1FOBA 1TE1A 3WQ4A 4JFSA 3QR3A 4UFLA 2RGLA 2OWCA 1BQCA 1PIGA 3AIVA 2W62A 1EGZA 2VZVA 2DQXA 3FXYA 2QF8A 4H8VA 4WSJA 3OBAA 3TTOA 2VL4A 2D3NA 2XUCA 4U5KA 3ARYA 3ARTA 1QPKA 4J28A 2PI6A 4X0NA 3CHCA 1BSIA 2J78A 3BUDA 2YA1A 1UD6A 4JCLA 3VIOA 3DDFA 4W93A 3WNNA 3I3EA 2G41A 2WCAA 2C8NA 2ZWYA 8A3HA 1QI5A 2F18A 1CECA 4DO5A 1E56A 1UZ1A 3B9DA 1IZJA 3PZVA 3O6AA 1UH3A 3K46A 3EBVA 4KH2A 3WNOA 2VCBA 4GZJA 3ZJKA 2VZOA 1B3YA 1JZ7A 1CXLA 4D1IA 4JL2A 3WH7A 1HF6A 2DGAA 1JZ2A 2Y8KA 5BXRA 1J01A 5CPTA 1J18A 2V3FA 1QHZA 4AXNA 4NZCA 1QW9A 2DT3A 2QMKA 1KWGA 4CU8A 2CHOA 3LRMA 4FNTA 1NOUA 4MB3A 1FH7A 3CZ8A 2GSJA 3ZT5A 1UWUA 1CNVA 2BVYA 4QFUA 1XHGA 5DF0A 2CIPA 5HDRA 4HMEA 3ECQA 1QOXA 4FNSA 1E40A 1GHRA 4CCCA 2MANA 3WQ8A 1QHPA 1S46A 1R75A 4HMCA 3WF4A 4Q7NA 3A22A 4WKAA 4BQ4A 5IHSA 4QAWA 1G01A 3WUGA 3F5JA 1FP9A 4KMQA 4W84A 1V02E 3PTQA 3AIWA 4AY1A 2WMKA 1W3LA 1AMYA 1E15A 1K9FA 3QHNA 2VVSA 4D1JA 1CTNA 1UASA 3A23A 1W3KA 4XV0A 4J3WA 3BXWA 2PWFA 5A69A 2DSVA 1ODUA 4W7UA 8CGTA 4PMDA 4C7DA 2ZUUA 5BXSA 4MNJA 3K8KA 1HL9A 1BAGA 2YFOA 1JNDA 1UKPA 2EPOA 2QMJA 2VVNA 4HMDA 1KCKA 3IAPA 2QPUA 2EO7A 1CXEA 2WHKA 2V38A 2XYLA 1JNEA 1RPKA 1PIFA 4AZBA 1HJVA 4F9JA 2GUYA 5BXPA 4CN6A 3RM4A 1CXFA 5DT7A 4QLKA 3EJSA 3WEZA 1W32A 2VI0A 1WZMA 4EE9A 4W8LA 4GO9A 3KWXA 4FF5A 3WDJA 1E55A 2F1BA 3VSVA 2YOCA 2EAEA 2YFNA 2BNJA 3SUWA 4Z2KA 3BAYA 2ZX7A 2VRKA 4J3UA 3LPOA 2A3HA 2YBTA 2VX4A 5E09A 2YDSA 4E4PA 1NWUA 5TD4A 3ZMRA 2V3GA 3DC0A 3ARXA 3MMUA 5E1QA 1T0OA 4PTVA 3POHA 3SUTA 1RH9A 2EBNA 2X0HA 3SEPA 4P7LA 3H54A 1ZBKA 3AHVA 3M07A 2BS9A 1H1NA 3ZJ8A 2CBIA 1UG6A 1GOOA 2YKKA 1G9HA 4OGZA 4MNMA 1NWSA 1C8QA 1CXHA 1BG9A 1BHGA 1P6WA 4CUCA 4FMVA 1C91A 1XYFA 1UH2A 4Q22A 1MW3A 3BAWA 3WMCA 1JZ6A 3GDBA 4JFUA 1UKTA 3VIMA 3ZM8A 3EJQA 2EPLX 4JKKA 9CGTA 1MVYA 3CUGA 1OM0A 4CN4A 1JGIA 1KBKA 4CD7A 4CU7A 4MB4A 2E8YA 1WE5A 2D0GA 2DH3A 1DEDA 3NJ3A 4KRUA 3N11A 1MW2A 2E3ZA 2NW0A 3MS8A 2E4TA 4GI9A 2PWEA 1R85A 5IHRA 1JXJA 5ABFA 4CD5A 3WEMA 1J0YA 4AD2A 1HX0A 1MWOA 1W9UA 2GJXB 2UY5A 2D1ZA 2W92A 3OLEA 1OCQA 1EDQA 3ARWA 3N1AA 2XHYA 2E40A 3S2CA 1JIBA 3MUIA 2A3CA 2V3EA 4ATWA 1C7SA 1ISYA 5CG0A 3AIEA 1WZKA 1HKJA 4UQ9A 3BAXA 2OLHA 2WVSA 4AEEA 2BY0A 3W28A 1E6XM 3VSTA 5A6MA 3VPLA 3SCNA 5CSUA 4NXKA 3BAJA 2YDQA 4RE3A 1LWHA 3KLKA 3EDDA 2BV9A 1X1NA 4TX6A 2XVPA 1KTCA 3VD4A 2XVGA 4XB3A 2J75A 4D6GA 1HKKA 4GXPA 3SCRA 2A3EA 4AZHA 5C8BB 3QHOA 5JIPA 5KEZA 3DHUA 1XC6A 3QOKA 1BGGA 1H2JA 3A4AA 3VNYA 3VOCA 4PMRA 3IJ9A 2GJXA 1BPLA 1DTUA 4DO4A 1XSKA 4NRSA 3AFBA 5A6KA 2WC3A 1ISWA 5I6SA 1NP0A 3AXIA 3WY3A 1B2YA 1XH1A 1US2A 3GH7A 2V3DA 2IXUA 3WQ6A 1LWJA 1J9YA 5CLWA 2VX5A 5JBDA 4ZEPA 3W37A 1H0GA 3HMCA 2X2JA 1PX8A 5HBFA 1K6AA 1V03A 2WMFA 1R47A 3M7SA 1JZ5A 4H8HA 3ZT6A 1H11A 1BG4A 3O2LA 2BXZA 1FP8A 2J7DA 4C7FA 1ISXA 1UQZA 3ZJ6A 3VGDA 3RDKA 2J74A 3AIQA 5BWFA 4U3CA 3CIVA 1MYRA 3EJTA 3U7BA 2G3JA 3LMYA 3G6LA 2CPUA 5F7UA 3WFLA 4S3JA 4URIA 3ARZA 4TX8A 3AIBA 4DWSA 1BGAA 3AROA 4V28A 3RM8A 2XJ7A 1XD1A 3DX1A 1KB3A 3KL3A 4AWEA 4JIEA 3L4XA 1QWUA 3D5HA 2FDMA 2FHBA 2GJPA 2ZIDA 2J7CA 2ZX9A 2VOTA 3OGSA 4Y7EA 3EJPA 1LG2A 2F1AA 2FH8A 1U30A 3GXIA 1KR1A 3D3AA 1QNOA 3FNDA 5C71A 1PEZA 5A1AA 3WNLA 3QOMA 1IZKA 1LF1A 1HJUA 3A24A 4CVUA 1HT6A 3WENA 3PZOA 3SCUA 4KWUA 1E4LA 2VMFA 3AS2A 3EJUA 4E8DA 2WHMA 3M6DA 1CLXA 3SURA 1GVYA 4PMYA 1HVXA 1VJZA 1D3CA 3AISA 2BY1A 2CESA 4D6FA 4AZIA 4N0RA 4OOUA 2CKSA 1NARA 2C7FA 1VFUA 1CDGA 4LYRA 2ZXBA 2XGBA 1E0VA 2FGLA 2CITA 1BLIA 3VKKA 4JKLA 4UOZA 2G4FA 3ZR6A 6A3HA 3GXPA 3MSGA 2BHUA 3BUBA 1XCXA 3DX2A 3OGVA 1XH0A 4B3KA 1QNSA 5I0DA 4AZCB 2GJRA 2ZUMA 4PCSA 3VDHA 1M03A 3WH6A 1NWTA 3DYOA 1UR1A 4A3YA 1V3JA 1ZJBA 1XH2A 2ZX5A 4HOZA 3OIHA 1PX4A 4HOXA 3WD3A 4JFWA 3APGA 3W0KA 3CZNA 3HJEA 3IK2A 3CV5A 1OBAA 3VGFA 3VTRA 3WH9A 1XYZA 1HL8A 4HPHA 3PZTA 2EPMX 1EQPA 1G94A 1VEOA 1XCWA 3RIKA 3VIFA 3BVWA 2CKRA 3GXMA 3BLBA 1F4AA 1OSEA 3TONA 3VNZA 2OSXA 4QLJA 4XUYA 3BLPX 4GQQA 2OYLA 2PBGA 1MQQA 4HZ8A 3N04A 1DWAM 2ZE0A 3GXFA 1G0CA 2WCSA 3F5KA 5HPOA 5I79A 4DM1A 3WDHA 3CUIA 4XX6A 3PTMA 3W53A 4PSPA 3MMDA 1DWHM 4U2ZA 1OIMA 4ZXOA 2WMJA 1CEOA 4P8XA 3VGEA 3KE0A 1FHLA 3VX0A 5A6LA 1W9VA 1W3HA 1BF2A 1VAHA 1B9ZA 5A2CA 2VZUA 1V3KA 2UY2A 3FHAA 4TOQA 2IGTA 5BRPA 3CHDA 3IANA 2J47A 5DEZA 1ITCA 3W29A 3B8SA 4JCMA 4AD0A 2W67A 3GZAA 4IPNB 4ZXLA 1LL6A 4AMXA 4NX0A 3WD4A 4DWSC 4TXEA 1UHVA 1KFWA 1Y7VA 4AMCA 1B0IA 3ARQA 1HJQA 2YL8A 1TR1A 4NXSA 3WQ5A 1VENA 1WZLA 3TP4A 1WP6A 2E9MA 4UZUA 3ARVA 3POCA 3RJXA 1U2YA 1K9DA 3CO4A 2VRQA 1OD0A 4X0VA 5E6ZA 3LRLA 5CLTA 2IXVA 1HN1A 1KXQA 1E6RA 4JZ5A 4UZSA 3EDKA 3D52A 1B3ZA 4Z2GA 1KCLA 4AD1A 2X0YA 2VRJA 1VFMA 1J11A 2VO5A 3CHEA 1R7OA 4C7GA 4U31A 1E4NA 4AD4A 5D4YA 2D73A 1MXGA 5M17A 3AICA 4YN5A 1GJWA 1LL4A 3VDCA 2FYVA 4B15A 3FW6A 4HOWA 1X6NA 3THDA 5BROA 2J8FA 1KXTA 4MB1A 1QNQA 2YL5A 1H49A 1ODZA 2F7PA 1UR2A 1V3LA 4F9DA 2WKGA 7A3HA 5E9AA 5A94A 3FY1A 2A3AA 2F7RA 2WMGA 1JFHA 3OA5A 2XTKA 1IT0A 4IM4A 4UFKA 1JI2A 4N42A 3CPUA 1EHAA 1GUVA 1FFRA 3WSUA 3BUQA 4EANA 2WANA 1JD7A 4M81A 1H0IA 3WNMA 4GKLA 1EHNA 3GBEA 3ZSSA 4W8BA 4P7OA 2JEQA 4JHZA 4OJYA 2D0HA 3HZ3A 1UR0A 4PMXA 4PTXA 5EBAA 4OKDA 5D9MA 3TA9A 3WF3A 3TTYA 3WH8A 3CBWA 1JZ3A 3L4YA 2EABA 6CGTA 4FNPA 2YL6A 2WLZA 2J77A 4H8UA 4M29A 3KZSA 2WAGA 2WW5A 4HZ7A 1R8LA 1UUQA 4J3SA 3VMPA 3KEHA 3PHAA 4NF7A 1OGBA 3VDAA 3WDIA 3WQVA 3VSUA 3AS3A 1US3A 2XWDA 4PMOA 3AMCA 4LPCA 5CGTA 3OZPA 1L0PA 2X2YA 5AYBA 3ARUA 4M1RA 3W6MA 1I75A 4UFIA 4HU8A 5BCAA 1KXVA 1W1TA 2JIEA 3FAXA 3T2PA 1UOKA 5A8MA 1J0HA 1EXPA 2PF0A 1GOWA 1GQJA 3GH5A 3VMOA 1W9DM 4L4PA 1HTYA 2GFTA 2BY2A 1HJSA 4GZIA 4D6CA 2V5CA 3BUIA 1TQTA 1VBUA 4WLCA 5D8ZA 2ZICA 1V08A 3ALGA 3OGRA 1E73M 3BVVA 3DECA 1NM9A 4NZFA 4U5IA 3A4XA 4AZGA 1UWTA 2GK1B 3BVXA 1ZB5A 2J25A 3IJ7A 4WF7A 5E0CA 2JIWA 3WD0A 3NIYA 3KL0A 2D20A 2OSWA 1CYGA 4TVDA 3TV8A 4NZJA 1V0NA 2XIBA 3CC1A 3TTQA 3VIJA 5EFFA 3UERA 3VU2A 1EIBA 1UA7A 4UFMA 2E9BA 3W25A 3PZMA 1CGVA 1W1PA 3DX4A 3WN6A 4V2XA 1R87A 5A8NA 3B9AA 1O7DC 1KTBA 3AS1A 4ZE5A 1W2PA 2FHCA 5DT5A 1Z32X 4QDMA 5ECUA 1BYDA 1TA3B 2PB1A 1SZNA 1E0WA 1TQSA 2ZWZA 2J79A 3SUVA 2E0PA 1FH9A 2WMIB 4D72A 3AQUA 4MTVA 1B30A 1PX3A 3BSHA 3VVGA 4MAZA 2WBGA 4YPJA 1EO7A 1SR0A 1V6VA 2WZHA 1BVZA 1LQ0A 4OIFA 5I5RA 2HVMA 2GK1A 1WB0A 3PZGA 4L4OA 1EA9C 4RL3A 4AISA 1UR4A 3GBDA 5ABHA 3SCSA 2J7HA 4S3KA 4CD4A 4AYGA 3T2QA 1E6NA 4ACZB 2WC4A 1TVPA 1GQLA 1WZAA 4ZENA 3EDEA 5GNZA 4AYSA 1IV8A 1C93A 1CGYA 4J27A 1W9PA 5HNNA 4B9YA 2VQTA 3BSGA 2VCAA 4ACYA 3BMVA 4HPGA 4XZWA 1I1WA 5M03A 2YL9A 2XIIA 1ZBWA 1R86A 1V3HA 1N82A 1HKMA 3VUPA 2D22A 2WMIA 3U5YA 2W5FA 1HWWA 5A8OA 2C0HA 1ZU8A 1R33A 4UOJA 1DWJM 5BXTA 2ZUNA 3THCA 1GCYA 1EDGA 2XG9A 3CUJA 4PUEA 2ZUSA 2Q8XA 4R27A 2YIHA 1E4MM 1K9EA 3AMDA 1BTCA 1QI2A 1UH4A 2G8ZA 4TTGA 7TAAA 1EQCA 4ACZA 3NCOA 1UWQA 2J7FA 3ARSA 1JYNA 1WDQA 2WYSA 3L4ZA 5FKYA 2V5DA 3EDJA 3ZOAA 2X1IA 2XFFA 3VD3A 4LXFA 3GYCA 1TVNA 4BQ2A 1E6SM 2WSPA 4PTMA 2DT0A 3S5ZA 2X2HA 1V0LA 2JFEX 4AMWA 2WK2A 5I24A 2QV4A 3ZQ9A 5BYWA 5GPRA 1BYCA 3AI0A 3A3HA 4Z2IA 2PWDA 1MFUA 3ALFA 1X6LA 4M24A 2EEXA 3SCOA 5I78A 4EKJA 1JD9A 3PZQA 5A6BD 1BYAA 1VFOA 2GDUA 1QHOA 2WHLA 4RE2A 3IAQA 3CZJA 3LXCA 3QHMA 1V3IA 2DSWA 4YHEA 1RP9A 3T0AA 1JG9A 1MQRA 1TUXA 1XSIA 2Y24A 3L4TA 2AAAA 1UQYA 3U5UA 1OT1A 4PN2A 2NT1A 4CN1A 1Q6FA 2XSBA 2DIEA 2ZX8A 3BMWA 1E72M 1KR0A 1C3FA 4P8WA 1QVBA 4EK7A 2DH2A 2CCRA 2J4GA 3L4VA 2JEPA 4MJ2A 3NSXA 5CJ5A 3AXHA 5FCZA 1G1YA 3OB8A 2YDRA 3AMLA 1ZBCA 3GXTA 3UR8A 2WNWA 1E6PA 1FFQA 1KGUA 1GZJA 1OIFA 3UESA 3W4RA 4P8VA 1E5NA 3SCWA 1L8NA 4FLOA 4MDPA 4P7QA 5EB8A 1H09A 1HNYA 2E9LA 1WKYA 3VM7A 4MAVA 4AEFA 2X8RA 5CZKA 5FL1A 1W3JA 2D23A 4H41A 3SCPA 3GNPA 4DWSD 1V0MA 4QCEA 2WM0A 2XVKA 3VD5A 3WUEA 2VX6A 4MJ4A 2DEPA 1OWQA 3AMGA 4H2CA 2WSKA 2EACA 1GJUA 1FA2A 3S6TA 3WBEA 3F5LA 3OLDA 1LLOA 4JHOA 2WPGA 4ML4A 1MFVA 3HG5A 4OUEA 4AZ7A 1AQMA 3L2MA 3WL1A 3LRKA 3DYMA 3A6OA 1R7AA 3T08A 4UQBA 3VDBA 1E3XA 4D6IA 2XGIA 3MV01 5LA0A 4BS0A 3N15A 4XZBA 4MNLA 5E6YA 1B3WA 4D6HA 4AIEA 4QCFA 1GW1A 4GPNA 4QP0A 2YLAA 5JIWA 2XSAA 4AIOA 3PBGA 2DIJA 1E9LA 1W1VA 3OG2A 4J7RA 3MMWA 3FN9A 1GOMA 2G3IA 3BVUA 3W82A 2BHZA 3L4UA 3OLIA 4W7VA 3CUHA 4PUDA 3MUAA 3H53A 3L4WA 4YHGA 1JDDA 4U2YA 1JZ4A 4LYQA 3CZLA 1TMQA 1UKQA 4CGTA 3TOPA 2CBJA 4CD6A 1GNXA 2DDXA 4MNKA 5AYIA 3DHPA 1A47A 4ATLA 3VGHA 4D71A 2XWEA 1F4HA 5FOOA 3D50A 4TTUA 1UA3A 5DO8A 3LPGA 2W63A 3WDRA 2WWDA 2ZOXA 1EO5A 2XM1A 3IGUA 4HA1A 3CMGA 3AS0A 3MUY1 1WDRA 3A5VA 2XPKA 3N13A 1VF8A 4BZYA 4CU6A 3D4ZA 1UKSA 4F66A 1J0KA 2OWWA 4FNUA 4WSKA 3DDGA 2OW7A 1NQ6A 2D24A 4GZEA 4AZCA 4FK9A 4KRTA 4NRRA 3SUUA 1HJWA 3AIUA 2G3MA 4RE4A 3WQWA 3NYDA 4PTWA 1GOKA 1TQUA 4CCDA 1K9TA 2WZEA 1YQ2A 1MW1A 2PBOA 4ZE4A 2ZXAA 2NT0A 1VJSA 2VNCA 4V27A 3FHQA 2WBKA 1TQWA 2TAAA 2YA0A 1JXKA 2YLLA 1CGTA 1RP8A 4BQ5A 4H7VA 3VILA 2OSYA 1XSJA 4JFTA 2XN0A 3AHTA 5M3WA 2WVVB 3BCFA 1E4IA 4FNRA 3FAWA 2JALA 5GNYA 3JUGA 5A6AA 5D9PA 1DWIM 2O9TA 3T0DA 1DHKA 3VO0A 1HKIA 3UEQA 2UWFA 2VJXA 4K68A 4D6DA 3WH5A 4W7WA 4W5ZA 2DSUA 1WDSA 4DUWA 3VX1A 3SIMA 2D2OA 1KWKA 3M46A 1C8XA 1ESWA 4MDOA 1UZ4A 2E8ZA 2OYMA 2EJ1A 1C92A 4W88A 2W4XA 3VIGA 3CZEA 1JAEA 5LYRA 3RM9A 4DUXA 1Q4NX 2BY3A 1A3HA 5JBEA 4CCEA 1WNOA 3TTSA 3VD9A 4GI6A 5CGMA 3EDFA 2J7EA 4HA4A 4BF7A 1WAWA 1GHSA 1GQIA 2XN1A 2BVTA 1E5JA 4CD8A 1SMAA 2BFGA 4OOZA 3W27A 3ZR5A 3UR7A 1CGUA
chains in the Genus database with same CATH superfamily
2AKMA 4P4RB 4XLHA 2O30A 1FWTA 3DBXB 3GHPA 2WLLB 3WEAA 2AV1B 2Z6IA 3PZIA 1TCMA 4Z2LA 3HE6C 4JIIX 4ONVA 1NCWL 4B48A 3LVEA 1IGTB 2OVLA 2OX1A 2KLRA 3T8XA 2YYTA 1FIGH 4HJJH 4IIQC 2PR4H 1RV8A 3M17A 4IHCA 1IKOP 4Y4FA 1WTGT 4N0UA 4WGVB 2F9BT 1ITXA 4GG8A 3LS5L 3ZKXC 3EWBX 1KUMA 5ESVA 3TURA 5CBBA 1LO4H 1HE8A 2ATKB 3UPMA 5TR9A 3ZWSA 3FH7A 3C52A 3QIUD 3HRPA 3JYBA 4EIZC 2WHVA 5KW9H 3KS0J 2WBJA 3H56A 3BLIA 4U1JA 2ZUWA 5HNUA 3H12A 4BKLB 4IPPA 3AZRA 4JM2B 2IGFL 3PAJA 4BEUA 1NFDB 1MWAH 3QUMH 4YSTA 2YGVA 3BQUA 3S36L 4YBQD 5A8QA 4XNUL 3H8NA 1N18A 2DKUA 5CSGA 4FX6M 3LDBC 3S8WA 2Y69B 3HGOA 4ADGA 4KRMB 1EYWA 4ZAKA 3EX3A 1P1XA 4K0OA 3HPLB 4AEHH 3VFTB 4BINA 2PR9A 1PZ3A 1XRFA 3D51A 3WGVB 2C9QA 3CMJA 4WK9A 4UDTA 3U46B 1E9QA 3WK1A 2GKIA 4DBDA 5F88B 4BK5A 4HQQL 2VR6A 5TFSL 4S0SD 1Q90A 4BZ2L 4NJ9H 1AZCA 5LMZA 4S1SH 4ODXB 3MRGB 3W24A 4OV4A 4LT7A 1XLAA 3HA1A 4JX0A 3H9SB 1ONQA 3RPIB 4GYFA 3NURA 2AOSA 4N02A 4XIAA 3SKMB 2ESVD 4XNXH 1PW3A 2OOGA 1DIEA 3JV0A 1C29A 4N1HB 3EOAA 3KPLB 3M0ZA 2P10A 3T3MF 4Q8MA 1GORA 1B3VA 1G43A 4WJ5B 1F3JA 1BBDH 4PJBA 1JPIA 4ANXA 3RIAF 4PMJA 3JZ7A 4H5SA 4PEKA 3APCA 3KLSA 5ICYA 3TBSB 5TV2A 1EJ8A 1XV8A 5ERWA 1I3RB 3S48A 3RNDA 2X4UA 3OP2A 1AH4A 2AVGA 2Q8ZA 5LO7A 3LXAA 5FNZA 3TCXA 4NN5C 2F58L 5JA8B 3U25A 5IFPA 4EXQA 4HPNA 1M2OA 2CLEA 1OV8A 1N05A 4KGJA 4LPXA 5C3TA 3QTPA 3LBCA 2W6JA 3L6FA 4LL4A 4CC4A 3R4IA 3RWJA 2F1EA 3ROOB 4JFVA 2H7WA 5F7BA 1CXIA 2ED7A 2YB1A 2WJFA 3NL5A 1H15A 3ILDA 2IBGA 1FYTE 3E3HA 3N34A 1S7TA 2A73A 3FU3A 1E0OB 2VYQA 4GAYA 5D38A 4ZW6A 2V63A 1MLCB 4JIHA 4A2GA 4CVWA 4P6VF 4B27A 3P0VH 4JM2C 2PCQA 1TTPA 4Z4SA 1EP2A 4ODTH 3AVWA 4OJCA 3D3FA 2XWZA 4RAVA 4BA0A 4K3DH 4C56E 5TPWH 5AAPA 3WY4A 3MRMB 4PRWA 4WD0A 3KZ8A 3GI8H 1NFKA 3AAZA 1PZSA 1OSYA 3IU3A 3I6SA 3WLMA 3LPWA 2INZA 3V10A 3S4SA 1GOIA 2FBJH 1NFIB 4BV1A 3W56A 4W4QA 4RMBA 2CHDA 5FYJE 1DCEA 2I17A 1CT8A 1EDTA 3RTQC 4ZB5A 3NO5A 1MLBB 1AD9A 5D4QA 3BO8B 1LE9A 2IF7A 4FHAA 4MJHA 1TQVA 2QADB 4E2BA 5KAQF 2BWQA 3MQTA 1JZJA 3MUGB 3WQPA 1AIPA 2DWDB 1U58B 3HC3L 5EO0A 3UFIA 4DVBA 1E4WL 3CPWB 4X4YA 5JBFA 1KN2H 3IACA 1QK0A 4PJFB 5JW4Q 3U36A 3KLLA 3BE1H 1N2VA 1PCSA 4DM2A 5B7FA 3LPPA 3D30A 5ELIA 4LRNH 4X9YA 3AWFA 5DS0A 2Q6LA 3B8TA 4R9HA 4QRBA 2DV0A 2WM1A 4IIFA 1S9WB 4Q4OA 1UPMB 3BP7B 5FIPA 1GZQB 2Z27A 3GRWH 1Q2RA 3L68A 1NOWA 2V7NA 4IL0A 4WU5B 5DSCB 3HVDA 3CB4A 4ETQA 3OLGA 1VEPA 4K6AA 1KJVB 1R3QA 2VDKB 5DMNA 3CN4A 1UWEH 1K3ZA 3IETB 4UU9B 4V1DE 3BH9A 3BVJA 1II4E 3W7GA 1WZ1L 3LS4L 3FCSA 2JJ2A 2JWYA 2W3ZA 3BK0A 1GYUA 4DT2A 2J8HA 3U57A 3EYUH 3DBPA 3GTXA 4UT9A 4MZ3A 3KPSB 3M7FB 2ENSA 4PLOB 1ZCOA 2PKDA 3W9EA 1MI5E 3L21A 4PVBA 4MSWB 1I1YB 3CQPA 5FDWA 1DIDA 2IADA 1W91A 4ABWA 3K6SB 1WA0X 3VRJB 3GG8A 3RNQB 4RW5A 4EX4A 3O6FD 2EUXA 3RX3A 5EMLA 1GR7A 3BGMB 3D08A 2OJZH 4AMAA 3BUTA 3KYNB 1HO1A 5D2NE 2O4MA 3M7WA 3NO1A 4LOEA 3SRDA 1K5NB 2APSA 4H8PA 1QOKA 2PI6A 4HIHA 4Z0SA 5EO9A 1E4KC 1YE6A 2QADC 3VNMA 1P6BA 3N9GH 8A3HA 1KMHA 3QVAA 2DMBA 3OWEA 4L8CB 3AVYA 5SX5K 2VZOA 1WCQA 5JH1A 2Z1BA 4W68A 2ZG2A 2V7XA 3OU8A 2NVAA 1BZ7B 2UY7A 3QE5A 5SWSB 5CGYD 3FIGA 4FNTA 4FXKC 4O12A 3ZK0A 4KJPD 1JNYA 4YGAB 1CNVA 1J2WA 4WNQA 1E30A 2LAAA 1P0EA 3PSWA 4WO4A 5FYJH 4Y2OB 4XORA 4E9RA 1YJWB 8FABB 4HMCA 3P14A 3RCYA 4P5KB 1XMEB 4XT1C 2DQ6A 2J88H 5JHDE 3QSRA 4ZCIA 1SEQL 3RDTB 2XU9A 3PNRB 2QGGA 1HYRC 3L9YA 2HK1A 1VLIA 2X12A 8CGTA 1PQZB 2WN3A 3QUMB 2QMJA 2OPJA 3H2WA 5KS9A 3LO8A 1XGUB 4LARH 2ZZ7A 4NQ1A 1P5BA 4BXSV 2C15A 3ABMB 1RZ8B 4XBGA 3IIXA 1F5WA 3FQXB 1BQGA 3TLLA 2HJKB 4AENA 3WDJA 2YOCA 1TRIA 4E4PA 1EFRA 3FYYA 4PTVA 4JKWA 5C07B 3HG1D 1RH9A 2XWBA 3KR3L 5DJCA 3F58H 1ZBKA 3AHVA 4KFOA 3GC5A 1JUEA 1A4KB 1YNLH 4FX7A 3W5NA 1C8QA 1BG9A 4ZUSA 2VM3A 3UH8A 4UTWA 4NRYA 3WSQH 4AVHA 4DQOL 2CO7B 3EADA 5GGRA 5C0AB 5BMXA 3FOMA 4IKJA 4BSVB 2R7EB 3ORWA 2E25A 3FB6B 3JW7A 1RMFL 1WS7A 2ZCKL 2UZXB 2YD2A 4Z7VB 2ZP8A 2GJXB 3CDGA 1OCQA 5A8AA 3TWCL 5IP4A 5CSZA 3MUIA 5EHFA 1MPAL 5C0BB 2BGNE 2UY6B 5D2WA 4AX3A 5FW8A 1T4KA 2GK2A 4MWFB 3VSTA 4N9CA 4KUCF 3U7WH 2YDQA 4P5TA 2Y3NA 4LB4A 5FCSH 3E6FA 1IC4H 3P27A 4TX6A 5AB1A 1GC1C 4CQBA 5D7SH 5G4MA 4NBYB 1HKKA 2BMKB 1LTXA 4HH8A 1YEGL 3DHUA 1LD9B 1LHZA 2NYKA 1DTUA 1RFDL 1L7TL 3Q1EA 1M1XB 1RZGB 5EC2A 3ASSA 5JBDA 4XN1A 1I1AB 1YMME 5GZOA 1RPUA 4AMKL 4XCCL 4APXB 1FP8A 1ISXA 5TDPA 1E28B 3MRPA 3QHTC 4BRJA 3S3SA 2HLAB 1RL1A 4OIIL 4EPEC 1YUHA 1QTSA 4I87A 5HR6A 3PJSB 1KTKE 4URIA 5DD3L 2XDHA 1BGAA 1ZHLA 4V28A 2ZOKB 2YS4A 4NILA 3LN5A 4WWNA 2Y62A 3D5HA 2EJAA 4G43B 3TH3T 1CK0H 2ZIDA 3KOWA 4JTAA 4MA8L 3D2UA 4O02A 2Z26A 3ZLFA 2R9HD 1EK3A 2W0UA 3UTQA 1IZKA 1KD1D 3ZE2F 5EPMB 4MKSA 1G7QA 1OCZB 5IY5B 3ESVF 1F1GA 1GVYA 1DE5A 1H60A 5AYUH 1CTMA 1A0DA 2XGBA 4WUUE 2CITA 4N8CL 1K7FA 5E6IC 5FW7A 2QKIA 2PP9A 1N0LA 2CBXA 4R4BA 2QR0A 3C6SB 3GC3A 4FN0A 2A83B 4B3KA 3LKQA 3ANVA 1V3JA 1ZJBA 1BKSA 1N2RA 1RK6A 4NZRL 4HU3A 2DTML 2IQ9L 4GH1A 3WH9A 5CD3A 4PRTA 2ZC1A 3GG1A 2P0OA 1QQDA 2FK9A 1CZ8L 1H3PL 2VXSL 4NAMA 4CJ0A 5DR5H 4B3FX 2PBGA 1CFQB 1SDDB 3TH2T 4PVNA 3TYFA 4EVZA 3AXMA 1KT2A 1FA4A 2EE2A 4IGBD 3C2FA 3W7LA 2Z7UA 4DN1A 3KXFD 1I9JH 4EAEA 1NBZA 1TTCA 2I26N 4ZO9A 3GMOB 3SDXA 1C12A 2J71A 4PS3A 3FHAA 3D47A 2DYPA 2NY3D 4EQ3A 5M7QA 4MKMA 2CLRB 1TPEA 4XD7A 3CPLA 2J27A 1XR9B 4KCVA 4AMXA 3QEGH 4DWSC 1F1AA 1L2UA 3SKJL 5HJGA 1A5FH 3KMDA 3KP1A 1WZLA 4QXVA 3RJXA 1I1AC 2A6DA 3UPBA 4I3RL 5E6ZA 3CCSB 1DBMH 4ZTOH 5FA3B 1PZ1A 1KXQA 1L9TA 4ANKA 5IJVB 4I89A 4PJGF 1HAUA 4Z2GA 3L3JB 5T9BG 1WORA 2MKLC 4MCNA 1RLDA 5FEWA 2ZWNA 4FR1A 4AD4A 1YY8A 1E9ZB 5AAWC 4LEQA 2VMJA 7PTDA 3VW3H 4B15A 1JE6A 2XZ9A 3QEUA 5FHAL 4RCAA 3PUMA 1ZLWH 2B7BA 1AXSA 3NPVA 2FZBA 2VIRB 2WANA 5I02A 4W9FC 4PP2B 4X4ME 4MAYB 4U1LB 2QVMA 4UTUA 1XT5A 3UTSD 4HS6B 4LCYB 4C6FA 3WF3A 1LK3H 2WD0A 1RUPL 1G9EA 4FNPA 5I3FA 2YL6A 1VA9A 1S39A 3LHWA 4HJGA 3VYOA 1AGBA 1EMTH 3WLBA 4GJ1A 4M6VA 3V76A 4P22A 3KVMA 5PTDA 2HMAA 2XWDA 1TJ0A 4BJLA 4PJ7A 1HS6A 1FE8H 4ZXBB 2HVNA 2WBXA 3GS0A 4B91A 1GSMA 4Y9OA 4C56B 3K6OA 5C08A 1R3SA 3ARDD 4B3XA 2HCJB 4L4PA 2GFTA 1AJ0A 4JQ1A 4GZIA 3I75B 3WNCA 1AGFB 1NC2D 4N2YA 1KJZA 1EJ6A 3G8EA 1TWWA 4KTDL 5CP3A 4YS4A 5AVTB 3T6VA 4HUNB 3A4XA 1N4XH 4PG2A 1CYWA 3NIYA 1HNFA 1CYGA 4MQ7B 3SGKC 5F9DC 1J9TA 1LP9A 5J57B 3UYIA 1B4KA 3B9AA 4MQXD 4ZE5A 3OZ9H 2ITDB 5HHNA 4OH2A 1JV5B 2AI0L 3RF9A 1YNKL 5F7FA 5ABAA 1OAYH 2ZZ3A 1Y65A 4JY8A 2HFFA 4RL3A 4G5ZL 3HE7A 1ZCRA 3EDEA 3SZ6A 4ACYA 3JWNG 3QQXA 2ZAIA 3E2SA 3VUPA 3QUYA 1VSCA 3LAFA 1IXPA 4O0QA 4H2HA 2X38A 4GXUN 3SJVA 4AQZA 3CHVA 5I1JL 3CUJA 3GZOA 1BEUA 3CXHJ 5BVPL 4B5XA 2V68A 3VNJA 1UH4A 3EYOB 4KCTA 1EHXA 4YDLC 5DUML 5L88L 2JQMA 5D72L 1XF3A 1IGYA 4ZQRA 4WO4C 4MAYC 4TV3A 1F42A 3LCFA 3QUHA 4AMWA 3QJTB 1LDCA 4UTTC 1TV3A 1QUNA 4F8PA 3RU8H 3TWYA 2ZUXA 3WLKX 1E2VA 4LEOB 3PZQA 4GUFA 1NCBH 4ZTPL 4GFXA 1V3IA 4YHEA 3WKPA 1MI5B 1XSIA 2FCBA 2Y24A 1RJZA 4NYYA 3TBVA 5E5UB 5LNGA 3LIZA 3UBPC 4JS3A 3GMNA 2R0ZL 5IMKA 1Q6QA 3DX6A 1CDIA 4QXTB 3NG3A 3UESA 1U8HB 1DKWA 1NIUA 2BSSA 3UZYA 3B1UA 3FH8A 1TSRA 5FL1A 1A53A 1A3QA 2HLFD 2VKWA 3NCWA 4MWAA 2O5YH 4XSLA 2BCKB 1KFAH 2ZAHA 3GTIA 3IKKA 2F08A 6REQB 4QOKD 5FPIA 1U1JA 3N4AA 4NP9A 2WKJA 3ULVD 3HG5A 1FWWA 2CZ5A 4IP5A 3DYMA 3MOAH 3U2SB 5LA0A 4P4KB 4KFMA 5K2ZA 2ZRXA 3GSVA 3NPWA 4GPNA 3VI4E 1XIWA 1OF6A 1AS8A 2XFXA 3CC2B 3D7PA 3TQVA 2VB5A 3HBGA 2BGIA 3OG4B 5ALBL 3CUHA 2W9DH 1I2PA 2QCDB 4NZUH 1WXZA 3JTTB 1TKKA 1AFSA 3W3OA 3PS7A 4PABA 5TE7L 3CZLA 3G24A 5JOPD 4F8LA 3E9AA 2H9AA 3DERA 5DS2A 2PDPA 4QDGA 1S8DB 1D7KA 5LNDA 5HYQB 1MCOL 2CWXA 3LPGA 4JFQA 1D2PA 2JCCF 3IGUA 2FO4A 3ENEA 4TL4A 5BW6A 4DJFA 2PDHA 4J3OF 1OG6A 1UKSA 3FSAA 2HUEA 2WZ0A 4IU3B 1UG9A 1TZIB 3QT2A 1LWIA 4LASH 3P80A 3QO1B 3FOKA 2X7VA 5FYLE 4BFJA 1ASPA 1MQKH 1K9TA 3I9IA 3OKEB 3BLFA 1FNSH 2WXLA 3GVLA 4L8DB 3MZ2A 5FA5A 3QFJE 4W4NA 3UWVA 4QXGL 1VJSA 3STFA 5ICUA 3PJUA 4PL1A 1YTKA 4AQOA 1B4LA 4KZEH 3QNZB 3W71A 4EI5B 5E6TA 2WVVB 5DRXA 1E4IA 4FNRA 3FAWA 2MTPA 4QKTA 1R5VB 3I2CL 3QZWB 4D6DA 3UEQA 4YWSA 2QUMA 5L4MA 4NCDA 4WW2B 1WF5A 1JN6B 1IYXA 3MNVA 3APMA 2XZCH 4ZZKA 4FFYA 2BPBA 2F19L 1MIEL 4I48A 4IMDA 3O45A 2NX3A 2JQXA 5LYRA 1BV8A 5T5FH 3FNKA 3QNYB 2WKOF 5BU9A 3HV9A 1ML1A 5D2NC 2XZQH 1E5JA 3E02A 4GVHA 4G71B 3H7LA 2KLSA 1YNTF 3M8OH 3WFDL 4AM0Q 3F5WB 3PPCA 4IUOA 2FJHA 4Y5VB 4GX9A 3DX3A 4KEUA 1JF5A 5DJXB 3AYRA 1XXFC 5LGHL 2PXYB 1TUPA 2D03L 3WBAA 2DYIA 3FA4A 3MFFB 4MA3A 3O4LA 3V0VB 1HU8A 5FO0A 3GH4A 3FN3A 4R7XA 2CNYA 4OZFB 4HWEH 5IEHB 4B9KC 3ARRA 1VADA 4LX4A 4UMBA 4MZ2A 2XXGA 4AV0A 4HBCL 2AEOA 4PJ8B 4IJCA 4EN3A 1AFVH 4YDVB 3AFLA 4AH2A 1W5PA 4I85A 4I3SH 3U9UA 4RMRA 1ECZA 2PZNA 3MA9L 2PRLA 2BV3A 3HOGA 4PQXA 1YMMB 2J62A 4J3ZA 1HZLA 4UT6H 2F5AH 3OJXA 4NQVB 1PJ9A 3W9DB 4EIVA 2IFFL 2ZDSA 3P4OB 2EIZB 3KLAA 3TCTA 4E9YA 1MIML 2AV7A 2FQGA 2J43A 4PJ9A 5A6SA 1ADQH 2AABH 5AOUA 3OKOB 3T0VA 4KO5A 4OZGB 1KYOK 3II2A 3UEZA 1TWZA 2Z1KA 3VZZA 1CXKA 3PGFH 4ODSL 3IWUA 3N12A 3CVDA 4K3JL 3A9BA 1HZHH 1EJOH 2I9TA 1KGCE 3QJHA 5DUJA 2ALRA 1YRKA 1BJ8A 4WUUB 3PNWB 1K4CA 3WIJA 5DWUL 4IHBA 5D7IF 1F58H 1YDOA 4FLQA 2GT9B 5DZNA 5HXMA 4TNVF 1X39A 3X13A 3W81A 5AZ2H 1L5GA 2A2IA 5IVXE 3IJHA 4BM7A 5E2WH 5FYLH 2V7QA 4RQQB 2EYTA 4KO6A 4K8RL 4HSOA 2B7NA 5ABFB 1F18A 1DHPA 3KYKH 3KW3A 2F54D 3K4DA 1FCCA 1MCHA 2D7MA 4TVPD 4MCMA 4I18B 4K3ZA 4H19A 4IK6A 3DJSA 1YLBB 1NWRA 1P4IH 1VB9A 2PXYC 4F7EB 1A4JB 2A1WH 3X1NA 1HHGA 1TG7A 4XQFA 4XRCA 5IEKA 4WTZA 5EDXA 4D6JA 3QKEA 4L1WA 2MUCA 3D87B 3OJVC 5JVLA 3FN0L 2UZYB 3MXVH 2COVD 2AP2A 2BASA 4FP8H 3EG9B 1VCGA 3A4JA 3IF1A 3O06A 1J9ZA 1W37A 4BF5A 1BFSA 3G3LA 4PE8A 4PJ8C 2KZWA 4AY8A 1BVKB 3L48A 4PG9B 2VQUA 1RZIA 2NQHA 1QPXA 25C8L 1U3HB 2XI9A 5EMJA 3ABSA 1EH9A 4YDKH 3RU6A 1KLGB 3FTGB 1N3NA 4XMXA 2B15A 4FCHA 3FO9B 3V4LA 1JWMB 5F96L 4UQ2B 2H41A 4ODHH 3LEYL 4WGXA 3ZY7A 5A88A 3VFUA 1A9BB 3PENA 4LRIA 3LOTA 4E9WA 4YSQA 3EHBB 1BF8A 1A50A 3PQYB 3GVQA 1VPXA 3RWFB 2VBTA 1QRKA 1A6AB 1MO0A 4A04A 4WKZB 5IMOA 3LB6D 1J9QA 3FZUC 3OE7A 4XN8A 3RYSA 2IWKA 1T1ZA 2I32A 3UAAA 4NJKA 3H4WA 3KPOA 2DBJA 5IJBC 1UR8A 3VIHA 1OTTD 5I30H 4ELME 1G1KA 4PJHE 2AJXL 1VHNA 1TLLA 2A7NA 4L0YA 4WKFA 3F2DA 4XVSH 5DHYA 1Z41A 5INDA 4KKXA 3QUYC 4A7QA 3OEHA 3EWZA 3G6AB 5IFHL 4Q8NA 1H51A 3FT4A 4G8IB 3PV6B 3O9NA 2RGMA 4F93B 2YWEA 5EUOA 3SN0A 5ABEA 4PR5A 3N73A 1CFMA 5F1UA 4S1DD 2BSCA 4QT5A 1MJUL 3UYRH 4JRYA 4UILH 4AD5A 3AREB 3BZJA 2WVUA 5I75C 1AD0A 4LVNC 5E8PB 4NUWA 3G5ZB 1KGYE 4RZ4A 2KQNA 4Y9FA 4HJWA 4AC1X 4G9DA 3K74B 4KGLA 2F74A 1WICA 4I18C 5AKRA 3MRDB 1SUHA 4G5DA 4HJFA 3CVCA 4GRMA 1BOYA 2QQLL 2UZIH 4Y9PA 2AZAA 2WXIA 3KPMB 4UQEA 4MS8D 1FDRA 5T1JA 3WBXA 3WFAA 3GMMA 1H5BB 3LEVL 4TUFA 3RVWC 4NNYB 1XIMA 1NGZB 3U4BH 1SF5A 5J12B 3VGBA 2D7TL 1ZS8A 1A7PH 1Z5YD 1HJXA 5GGVH 3MW7A 4B9ZA 4EQ2A 1GY1A 5DELA 3CC4B 4LSRL 4L4TE 5TE6L 5KZMA 5I23A 3MSDA 2BRRH 1W6WA 2NCEA 2FX8H 4LU5H 4ORGB 4Y0GA 1ELOA 1JSYA 1ZLEA 1KC7A 4N8VA 4GBXB 4WFEE 1WEJL 2X1QA 4GGBA 2WXKA 3MA8A 2OT0A 1ZXKA 1CE6B 1UGKA 4UR9A 2XNDA 3Q58A 2PD9A 3MXWL 5LNVA 5E99H 2PABA 3LZRA 3L3GA 5FUZH 2NUWA 3C2EA 3FV9A 5B8CA 2ZOLB 3Q9PA 1G4EA 4PMUA 3QI9B 3FRPA 4NSBA 4DKEL 1XUUA 2YB4A 1ZLDA 3GHBH 1NKOA 1OC7A 3EZ8A 1HHIA 3SYCA 1D5XA 2RCSL 2W62A 3V0EA 2FUQA 2QJIA 3TTOA 5JO5B 4XNYL 3ID7A 5CILH 1PFCA 1I7RA 3GINA 2D7OA 4HIBA 2B1HL 1G1CA 4JCLA 1OE3A 1A7NH 1XISA 2G41A 1SHMA 4WK0B 1QJWA 4K37A 3QR1A 4LSTL 3OW2B 5FUOH 1FN4A 2Z93B 4KJYA 2YUXA 1B3YA 2OSLA 2DGAA 4MYUA 3LRHA 4DB7A 2VLJD 3E2VA 5TJWK 1KWGA 4DUOA 4F48A 4MYPA 3NM3A 4DJEC 2MMXA 1B0RB 2ISWA 3ELFA 1U3JA 4KPLA 4R85A 1QBML 5XIAA 1TCRA 5D71H 5B22A 4FNSA 1YEYA 3WF4A 1XTMA 5ITFB 4Q7NA 4FXGB 1C8PA 2DICA 3W2HA 1H5BC 2P5EE 5EOQL 2WIMA 3DO3A 3AIWA 3UJEA 4QXUH 3WTWA 4K5NA 5J12C 2NX1A 2DWSA 1UB6A 2X4PB 2XY1A 1WV2A 5I6PA 5KTEH 1A6TB 1BFVH 3AACA 4FJYA 3K8KA 4F37F 1Q0YH 4A7SA 4NQTA 4HMDA 1KCKA 1IFHH 3T3PF 3DAQA 3VDGA 5K9KB 3SB3A 4L5FE 4I5BA 4L4JA 5DT1L 3S47A 5L4JA 1BZDA 2VDKL 1VKXA 4F9JA 1DXEA 1I2NA 5KBPA 1AODA 4XAWL 4PB3A 1N5AA 5E8OA 3LBOA 4GO9A 1IKFL 1I8IA 5BUPA 4YGVB 4RV3A 3BAYA 4BQ8A 2XA3A 2IAND 5GZNA 4L9LA 4C6QA 4ZB2A 2VC7A 1QFUH 2NUPA 2NNFA 5CPNA 4XNZB 1DOSA 1LEIA 1UWXH 3QI9C 4Z7QE 3CUXA 3PIQA 4R4NC 4EN3C 1PG7H 5CZJA 3WMCA 3CMEB 1GTHA 3O41B 2EPLX 5JLZB 1SFDA 5CO1A 1MVYA 2D0GA 1KA9F 1EHLL 1W34A 2F53D 2XIQA 2AJVH 4N0UE 3MI3A 2TYSA 3UYPB 2HX7A 4UIMA 4K8HA 4C47A 4F2TA 2FB3A 4ONGH 2C9UA 5KVGE 3QJXA 3FUKA 2RD0A 2E40A 1I53A 32C2B 1DVFD 4PJXA 1XDLA 5MERB 4ZQMA 2H0PA 3C61A 1I7PA 4RAHA 4ZUWA 4CNUA 3FFCD 3QVQA 1DUYA 3G0SA 4F3FA 2XVGA 4XB3A 3W2FA 5CZXD 4AZHA 3UJTH 2Y1AA 1O7VA 3CRZA 5FGCE 1L6PA 3BJLA 4J4KA 4L1BA 1QWGA 1FVDA 5K4XA 1US2A 1XQLA 1CLYH 1H0GA 4ZMPA 1PX8A 2PR4L 1AHMA 4ONFH 3J8F7 4EPSA 3CNKA 1DTNA 1VCFA 1T1XB 4PTUA 3GKZA 4XN9A 3W2NA 4XZ4A 3AIQA 1MYRA 5B3NA 2HYMA 4M4PA 5AOZA 2Y1VA 4YSUA 1LO4L 4X98B 4IEFB 4IBSA 5J9PA 2WQXA 4WNSA 2RR3A 1DANT 2R1YA 4AWEA 3DARA 5KW9L 4M6NH 4B5ZA 1LQ2A 1R3HB 5FGRA 4D8LA 2W9MA 5EZIH 2COQA 1WCBB 3W1ZA 2WNXA 2XRAH 3QUML 3HE6B 5AYYA 3LTPA 1Y0LB 1FFNA 1IVLA 4F33B 4PJBE 2FIQA 3H2OA 3AISA 3FTVA 1NA8A 4M7JH 3OKYA 4UOZA 3STPA 4AEHL 3ZKXB 1ORSB 3DX2A 4AVJA 1WOBA 3VDHA 3APGA 3HJEA 4HS3A 1UVQA 4Z3JA 2ZOWA 1YMHB 3ES7A 4L5FH 4HPHA 1G94A 2K9UA 2ZG3A 4HEPG 5AAMA 3K13A 5EA0H 4FQHA 4ZGQB 4POUB 4S1SL 2XQYG 3SY0A 3BLPX 3HC0B 3N04A 4YL2A 5IGXH 3BJSA 2Z35A 4LRIC 3MJWA 4ACAA 1CLZL 1XEDA 1M1KD 2NY6D 4L29B 1PJ7A 3MYOA 3LDBB 4WHBA 5I1DB 1BBDL 2VAJA 3E49A 1OP5H 1OC5A 7PCYA 2PIAA 4NLAA 3CHDA 2PPCA 4OLEA 4MNQD 3LRSB 5DEZA 2C3VA 4WNJA 3UBXG 4CADA 4AD0A 3OGCA 3KCOA 1T41A 2ADYA 3QPQC 4TXEA 1XBDA 1J1XH 1YLOA 2NX5D 1LBLA 4XPGH 3KFTA 3POCA 2C5HA 1S1RA 1FYHB 1C9SA 1DL7H 1PGRB 1E6RA 4K3HA 1A6VL 4NUGL 4S3AA 5JPNA 4PGLA 5KVGH 1JTOA 3EDKA 1EUUA 1B3ZA 4AD1A 2X0YA 3IXAA 4P2OD 1VLWA 4UBDD 3HZKB 4JFED 4MB1A 4K8EA 5AC8A 2DEYX 1XB3A 2IC2A 1QFWL 4YDJB 3P0VL 4HCLA 2XTKA 3I02A 1DL3A 1GUVA 4NN5B 3DIFB 2BVQA 5HJ3A 4ODTL 3MMEA 2WXFA 4YXLH 2J2ZA 4K3DL 4B4HA 5TPWL 1GC1H 4NJAH 4H01A 1IQDA 3OO2A 1PHWA 4F9PC 5T1KD 3W2DH 3TMQA 1CE1L 1ET7A 3VMPA 2XPYA 4ADUA 3SPIA 4JE0A 3VZYA 1WU8A 3M86A 2FBJL 4G6CA 4DPBX 4HU8A 5F0LB 1SFHA 2HE5A 4RMUA 5A8MA 2C5BA 2OLDA 1MDRA 3ITOA 4XG1A 2J8OA 4JO4H 3RZCD 1KC8D 3BD4A 3GSXB 2R0WH 1MCNA 1HJSA 4AQAB 3UTTD 2MQCA 1NEZB 1P7KA 1T5XB 5C0DB 3FQNB 3ALGA 1D8CA 4EF9A 2AJ3A 2ZOTA 1MRQA 3H9HA 2BOLA 1TVBA 4PS7A 1WSVA 3I9AA 3BVXA 4UDUA 1KN2L 1XQKA 2GGEA 4NZJA 3BE1L 3DVGB 4RZ5A 1LK2A 4LRNL 1ZHNB 3OJMB 4Y88A 3PPFA 2PMDA 3SGJC 5E9NA 2PB1A 2E0PA 1FH9A 2WMIB 1OWRM 4FYQA 3ULAB 5CWSB 3RTQB 4KVNL 3RWEB 3WIFA 3PYCA 3GRWL 1BVZA 3DTXA 2DW6A 4C4BA 1S9YA 2CBTA 1EXUA 4M6PA 5HI3D 3GBDA 1GQLA 4YQXH 1DVZA 1JDFA 2XX1A 3B1TA 1UWEL 4N9GA 4GSDH 2C16A 2JKAA 1S7XA 3CESA 2AEIT 4APQB 3UZEC 3U5YA 4QS6A 1ET5A 1LGVA 3V6BR 2Q0ZX 1J5OH 3HMXL 3GIQA 1AHWA 3GM0A 2YIHA 1E4MM 3NPZB 3HFTA 3UP6A 2J7FA 1L0XA 2CU0A 4YHPB 1MH5A 5EWIH 4NWUH 4D9RE 4KERA 1WG3A 1KO0A 4L4TB 4AGOA 3ZQ9A 3A8JA 4PJEA 3DBSA 1BYCA 2PWDA 1OABA 3ALFA 2Z6FA 1HCYA 4RGOL 1Y0EA 1ERNA 3Q5YA 5HHQB 4TUKL 1D6EB 4F4RA 2OJZL 4PLJD 3RCMA 5TBOA 2AAAA 5IJKA 1FZMB 3WEXB 4QJ3B 3QDME 1B9BA 1QVBA 4MHBA 3N44B 4NQSA 5C86A 2R6OA 3BMXA 3C5SA 1DQMH 3ZE0B 5CJ5A 2VM9A 4OF7A 2VJJA 3N9GL 4JANB 3EGDA 1U2CA 1FFQA 1GZJA 1MRDH 3W4RA 4XISA 2EDXA 1E5NA 5KS9E 1Q1JH 4L9LC 3OKMB 4DZ8A 1ZPTA 4G72B 2HPTA 5CLYA 3H2PA 2F7FA 1G7PA 4OTKA 4H41A 3QW4B 1KB5H 4LS2A 4XOBA 2IALA 2Z7ZA 4H2CA 3FH5A 1JGEB 2QLVB 4A1RA 1X7IA 1E8YA 3EO0A 3NTCH 1ITBB 1E2ZA 2WPGA 3EFOA 3LRKA 3Q8BA 4JRFA 1MJJB 2VELA 5GJTH 1R7AA 3WQDA 1E3XA 1J5DA 2ZTNA 3ABKB 3W7MA 5DUBA 4PTDA 4IRJA 3CCLB 1NF7A 4BS0A 4D8PA 1WDWA 2J88L 3PWPD 2XWJA 3C0JA 1QU4A 5JIWA 4A7GA 1I2OA 4D9QE 1R5WB 3JTSB 4HWBL 1GOMA 4GKZB 3KDPB 1OGAD 3QZNA 4W7VA 3GLCA 4YVUA 4APQC 4NRZB 4WDXA 2HDNB 2WLIA 5AKTA 3BKYH 3IFPA 4LARL 5BS0A 4MAUH 3CH1B 3TPUA 3D0LB 2P5EB 5AOMA 1OQFA 4UT9H 4F8OA 4FXKB 3VH8G 3LIUA 4R3SA 1B4JH 2OZ4L 4ZMYA 2EICA 4K7FA 3MUY1 4JMNA 4PB4A 1FX0A 4BZYA 1AA1B 2BNRD 4OV9A 4HSHA 4OD2A 3DRTB 4GX8A 3AIUA 4RZCB 3DGDA 4ANWA 3F58L 2GJZA 3WQWA 5BSXA 5AN7A 2BP8B 3PPGA 2XN9D 3PL6A 4HAKA 2DZEA 1EZVY 1YNLL 2ZXAA 5I1KH 3ME0A 1U8OB 2WWMD 1XF5A 4RMWA 2WBKA 4QGTA 3WSQL 1TZ8A 4DN3H 2CZFA 2XN0A 1MHPL 3P9WB 3R58A 2YAHA 2IH1A 4Q14A 4KQNA 4IFRA 3LKNA 3VX1A 3CQIA 2GQAA 4H88H 4Z7QB 1P9MA 3CXCB 1ZA3B 3SPHA 1F1DA 4JPIB 4P2QD 1F90H 3T6ZA 3MCYA 3BJFA 4GT0A 1FRNA 2ZYIA 1H62A 2BVTA 4RA0C 1M90D 3U7WL 2I9LA 3O6FA 2QCGA 1E9OB 1IC4L 3O9WD 4N0UB 1VQ8B 1VHCA 5D7SL 4MXVF 3JVFC 5ESVB 3SRHA 3GHUA 4GKTA 1VBJA 3T0BA 3QZAA 3GXNA 2WBJB 2PPAA 4U1JB 1X5KA 3NVTA 4F8TA 2WZIA 4YAWA 3NAAL 3ETBJ 1VCAA 3MRBB 3RDJA 3PS6A 2Y7QA 3V7AA 1NGQH 1LM8V 2IGLA 3ITXA 1OSPH 4B5WA 5LG6A 1WBZA 5KTLA 4WW1B 4HB7A 5FGCB 3GTNA 5HK4A 5HDWA 1IBHA 2JTYA 3U0HA 5CU5A 4GRLD 3WJJA 1CK0L 4HCHA 2TSBA 2QAPA 2OGJA 2WWCA 2QUVA 4UDTB 4ERSH 3SE9H 1E9QB 4Q8VA 4OPVA 3SCVA 1MNUH 1S9XA 3WY2A 1WAUA 1T96A 2A3LA 2BPOA 3SDXE 2ZXCA 2VLLA 1PTZA 4F7DA 5AYUL 3IM1A 1XYMA 5IW3A 1PE1A 1XRVA 3D3VD 3OMIB 1ONQB 1VLXA 2FNWA 3P9MA 5IOKA 5TRDA 4J1UA 4A7UA 3EOAB 1LRQA 3F1QA 4MA7H 1MWAB 3VXOA 2V4LA 3DX8A 1H5VA 4UCFA 5BU6A 5E9DA 5LDUA 5HPCA 4EIGB 3U0WL 3H85A 4H5SB 3N1GC 1KXQE 3RVUC 3ULUD 1BXXA 3NN8A 2X4UB 5DR5L 1O7DE 2BN4A 1VIWA 4UYQA 1B90A 4N6EA 4ORIA 4OGAD 4I2XA 1KK1A 1JXDA 1X98A 4ZOCA 4ZFFA 3UA3A 2JDIA 4Q6XA 4S2SA 4W9EC 1I7TA 4Y4FC 5E6IB 1TKWB 2QCNA 3RWJB 5C0QA 5KOMC 1UD3A 2JGYA 1KW1A 4L1TA 2N1KA 1H15B 2DPEA 3FQTB 4KXAA 4IBWA 3STBA 3QEGL 3TU6A 4KRZA 3H24A 1NEPA 1S7TB 2A73B 3PZNA 3UJIH 1EPXA 1HIZA 4GAYB 1FG9C 1P0DA 3GXUB 2WBJC 4PJ5D 4PMZA 1V8HA 1NBQA 1DBML 2FGWL 3FBKA 7CGTA 4PJ7E 2QEJA 2Q8AH 1EP2B 3TA6A 4O2FA 5D8JH 1S7UA 1PZ2A 5TF1H 4W5UA 3BQUC 5D96C 2BVUA 1LORA 4RAVB 3ARPA 5C08E 2IMRA 2AAVA 3GM8A 4O02H 4YE4L 3RYMA 5ACZA 1EF3A 5I6OA 3AAZB 4ZAKC 2W61A 4A2HA 1LG1A 1F6LL 2ABAA 3LQZA 1X5FA 3VWKD 1N8FA 5JR1H 3R18A 3K8MA 3TT1H 4J8QA 4DWSB 2OZ8A 1NLBH 1CIDA 4MJIB 2VR8A 4ATDA 2VR4A 4KK6C 4BK5C 3TAOA 4O1AA 5LXEA 4FXSA 1CT8B 4OOXA 3BLDA 4YHZH 1AD9B 1LUCB 4Q8OA 1LE9B 1LK3L 1W8SA 3L3IA 5ABZA 4NU7A 1K70A 3NQGA 4ABQA 1ACZA 1SFTA 4LH8A 1NH6A 5JORB 4Q4RA 4DNLA 5JIQA 3HR5A 3TVAA 2VFHA 3O0RH 1GPFA 3W74A 1OE1A 5EO0B 5IB3A 3TJXA 4X4YB 4G7VL 3USBA 1HGWA 5DS8A 2XWTB 1FE8L 3NTYA 2ID5A 3U36B 4OAWA 3FUMA 4XTIA 3IRPX 3SCMD 3QDGD 1U8IA 4TSBH 5E8DH 4FX8A 4KKQA 1FH2A 5M1TA 3U0TB 1UB3A 2PWGA 3U2OA 2OJEB 3LX9A 1DWGM 1KB5B 4KKLC 4YIWA 4FF9A 1I0BA 3L66A 2DEUA 3ZZ1A 3UETA 3AIRA 4MXWH 1J1OL 5FYJU 1ZJAA 2UY3A 3QIWA 2WSSA 3SJVE 1N4XL 3WK3A 2CC0A 1RUKH 5F1IA 3B34A 5IT2H 4FQCH 5IB5A 4ETQB 4BH7B 4MYTA 3G1VA 5JDSB 3I85A 4CC4C 5KANI 5TQ2H 4CILA 1EGMA 3OZ9L 1KTVA 3ITCA 3I7QA 1UC4A 3B7TA 1H6FA 2ZXDA 3Q6QA 3NPUA 3BH9B 3HAGA 4UFJA 1OAYL 2GDQA 1E9PA 3DU0A 5IJKC 1QBBA 1U8LB 1GY2A 1ZNNA 3WY9A 3FRUB 4K1GA 4F5CA 5LKNA 3UTPE 1ZPUA 2D3JA 2WCGA 3D85D 2FWSA 2O5ZH 3UWZA 3GY1A 2O9OA 3W9EB 3AMKA 3KXFA 1HAWA 3VRIA 4R5EA 4K1WA 3THAA 4ODUA 4REQB 2C9XA 4ZBJA 1Q8MA 1DSYA 1YI2B 1RK1A 2IADB 1QI3A 1V3MA 3FSOA 3NSMA 1W0JA 2P8MA 2FHFA 2CO2A 4QEEA 4PFHA 2Y1YA 1I7UA 4OLZL 2CA4A 1K8XA 4IOIA 1G4SA 2DCUA 5E0KA 2LV4A 1EEZA 4TTDC 3CSGA 1I8KA 5IKCA 4MWAE 5IVZA 4IRJC 2D7PA 4HIHB 5BNXD 2PURA 3PWNA 2YXVA 4URKA 3RU8L 5EO9B 4Q4IA 3O3BA 1ZHBA 2Z2UA 5J5DA 1SOKA 3IRSA 1BF6A 1NCBL 3QO0A 4POCA 1UM6H 4DN4H 1DQJA 5IR1B 1HDMB 1WAAF 4YHMH 3PBYA 2UY7B 1I8MA 3N1MC 4B60A 2YZ5A 1Y18A 4YDLB 4JD4A 3LNGA 4WNQB 5DK0B 3VRLE 3WNNA 3L95B 4QHNA 4O0KA 4WO4B 4KTYA 4MTMA 4D0CA 5FSDC 1E56A 1FYTB 1IZJA 5IB4B 1M7DA 1UH3A 1IJNA 3EBVA 1HF6A 4OLVH 3GBML 1J01A 3KH4A 2GBVA 3QDMB 4Z7NF 3N91A 3GJEA 1FH7A 4NP4H 2PWUA 2ZXEB 4CAGA 2E6AA 3MRFB 4RNIA 3ECQA 1JA1A 2BIOA 1MFDH 3E1YE 3MOAL 3B8UA 2BVPA 1SNRA 3ARDA 1X9LA 4LCRA 4GB9A 2O6DA 2WP3O 1NC2A 3T8QA 1MNSA 3FT2B 4XBGB 5GS0D 1PLAA 4JVWA 3VXRD 2VLKE 4DPQA 3ES8A 1MFCH 1KK0A 1MCFA 5BXSA 2W9DL 2AGKA 4JYDA 2VVNA 5DJCB 3GC2A 3QMSA 1T21A 1E9IA 5LIXX 5ENLA 1ZDQA 5LNUA 2WXOA 3GSNA 1MCCA 3GE7A 1DQQA 3D2TA 4GY1A 1S7SA 5HJDA 1AQKH 5MEND 2B77A 3VC6A 1QYGH 4OCYH 3X14A 3FDKA 4FF5A 1E55A 2EAEA 5GGRB 4BH8A 3V0IA 5EBMA 3F12A 1N6VA 4XNMB 1EP1A 3R0NA 3G5YA 1MQKL 2AJSH 5E2JA 1F9CA 1ONRA 1FNSL 4PUNA 1TSIA 1BECA 3VU1A 3SLDA 4KZ0A 1P6WA 5GJPA 5A16B 3VQLA 3GWQA 1MZHA 2ZQKA 5CSZB 3O4LE 2QTVA 4N2AA 4JFUA 2Y8UA 3LCWA 1OCNA 3LIZH 2K4AA 3QRHA 1T4KB 1OM0A 4CD7A 3NQVA 4LAMA 3HB3C 4P5TB 5E2UH 1OO2A 4J8RA 3ILPA 4XR6A 1QFPA 3E6FB 1K8IB 2RHGA 5D7HA 1MW2A 1F05A 2E3ZA 2OMVB 3CTLA 4AHPA 3GF8A 1UP0A 4CD5A 1M9SA 4FFZL 1F3DH 1F3TA 4DY1A 3B3BA 5T5FL 3LZFL 3OEXA 4OP7A 2NXZD 2KBGA 4QHLA 1PKMA 4V1DB 3CN0A 3EOOA 1IQWL 3AIEA 4GH7B 3P4MB 2XZQL 4UQ9A 1W5QA 3DKLA 2IOIA 1XQ4A 4HK6A 1W3NA 4LOCA 1DLHA 5A6MA 4BSJA 2GEQA 3LRGA 3M8OL 4GXMA 3EDDA 3MRPB 1BM7A 1KTCA 4C55A 2AL1A 4UWQB 3KGUA 2XH0A 3P74A 3ZDWA 1PO9A 3CN2A 4OJFH 1SKQA 1ND0B 2IJ0C 3A13A 2EC9U 2O7QA 4NBZB 1YSOA 3NRPA 1S4MA 3AFBA 3LN5B 1TJGL 4U3XA 4YDZA 4XCYB 4HWEL 4AGLA 4O02B 5HHPA 3B5GA 1BG4A 2E3VA 1AFVL 5EORH 1KQSB 2CUHA 4I3SL 4MVAA 3WUZA 4ZCWA 5D2NB 3ARZA 2HTLD 3F6LA 4JIEA 1QWUA 2QKIB 3MJYA 2VOTA 4OTXL 1I31A 2DEWX 3GXIA 3FNDA 5IYPA 5I1EH 4QSFA 3LKQB 1N2RB 4UTWC 4B5UA 1HJUA 5KINA 4XP5H 3DDYA 4KWUA 1X5AA 1TJXA 1MCKA 3BRFA 4GABA 1QQDB 3RLHA 2AABL 1AZUA 4XVUD 2ZXBA 2Z65C 3VXSA 2FGLA 3FQ2A 3C5ZA 3MKGA 3HTWA 1VGAA 3TYFB 3Q43A 1KT2B 3GXPA 2WNZA 5AHFA 3D9AL 3BDYH 4LSPH 4PCSA 3PGFL 4JFWA 4PVMA 1NBZB 4UCGA 2BCMA 5JMRA 2EPMX 4P5TC 1SRDA 1LXMA 4XQ6A 5JHDB 1XPYA 4FFYH 2P7TB 4ZS7H 4HZ8A 2PF8A 3CPLB 4AITA 4YTSA 4RK8A 1C08A 1IEQA 5H2BB 5HGDA 5B3JE 4DHLA 5AZ2L 3OMZA 4IGSA 3VI2A 5C9XA 5FYLL 4L9XA 5GZOC 1FHLA 2AQ2A 4YHNB 3KYKL 3H3BC 1FWHC 3G1HA 2OG9A 2PPDA 2Z0IA 4ZMQA 1KFCA 2Q9OA 3R0DA 1P4IL 1YY8B 3A5FA 3MODH 2A1WL 5E5LA 3CCEB 2PW2B 3MYJB 3A6CH 3N06B 4M1GL 3QJFB 1HE7A 4UZUA 3CO4A 1AXSB 1ES0A 3OB0K 1OAQL 4P2NA 4FP8L 4IX2A 4BPRA 4TF4A 5B38B 1GYNA 3NJGA 5CR1A 3DMMA 1ZEAH 4PRIA 2J3SA 4XVOA 1OYAA 5F3HA 3VA6A 2FDSA 3O2DL 1SO3A 2NW2A 4JTGA 4M8QA 4EH1A 4YDKL 4ACTA 1X6NA 6FABH 3P0WA 3O6KH 3THDA 4K7VA 1HILA 3B40A 1PYWA 2QKIC 4HJGB 3MC5A 1G6RA 1AGBB 1V3LA 3WLBB 2WKGA 4KO7A 1OEPA 4ODHL 4PJ7B 2Z4TA 2XTLA 4JRYE 4EANA 1TEFA 4LHUG 1H0IA 3KWWB 2CLMA 4LTSA 4WU7A 1QMLA 4AYMC 3EOBA 5C08B 1A14L 4A6YA 5LCVA 2J8UF 3ARGA 5I15L 1KM5A 2X89A 2O7SA 1NCDH 3JUYA 2DBLH 4HZ7A 1XP3A 1F56A 1T66D 2ISFA 3FYOA 4NF7A 3DOSA 2QSTA 3ZKQD 3GVVA 1IT9H 3GU1A 2B5OA 2ROYA 4DWHA 4H9TA 5D5MF 5E9XA 4YAUA 4XVSL 1X9UA 1W1TA 2N0MA 2XA8L 3QWRA 5LGJA 1RR2A 3BWAA 2OPCA 2Y88A 5HAOA 5EBGA 4BF9A 3U4EA 1PSKL 1DVJA 4RX4D 1G7HA 5HQEA 3K6DA 3R4DA 4LVHC 1W1B1 4UILL 5K9CA 1UWTA 4BI7A 4GBDA 3HE7B 3KL0A 1OHLA 4B9JA 3OQEA 1KYAA 1V0NA 3PA1A 2PDIA 4RWYH 4UFMA 3L9RA 1RIUH 2REQA 2OP4L 1O7DC 4YAFA 3AS1A 2FFIA 3MZGB 2ZWZA 3SUVA 3HPZA 4MTVA 1G7TA 3QUYB 3L7EA 2WBGA 3HNSH 1XL4A 3IRZA 3BGGA 2D2HA 4L56A 4A7VA 3MJGX 3U4BL 2N1TE 3UJJL 1YN7A 1TPXC 5GNZA 1XF3B 1Z3NA 3TFBA 3C4UA 4B9YA 4OT1H 5GGVL 4XZWA 5I75B 5F4OA 4NPYA 2YL9A 3ULSB 1K73D 3QKZA 4B9GA 4LVNB 3CCMB 4N2LA 2F54A 1QUNB 1OK4A 4XPTH 1CTOA 2BRRL 4CMMA 2ZUNA 2QJJA 5FM8A 1Z5LA 1JZGA 2GHZA 3WE1A 4LNVA 2ADJB 1X5YA 1U5JA 1ZVNA 1TR7A 4K7YA 2VJ0A 3L4ZA 3VD3A 2XFFA 4NJJA 3TQ0A 1BQUA 4OSUH 1BVNT 1HW6A 4BQ2A 3TBVB 4OHQA 4EP8C 5EUKB 5KYYA 3U83A 1MJ8L 1QATA 3HS8A 2Z1VA 4XBPB 3GMNB 3STLA 2R9RA 4JFPA 4Z1BA 1GTEA 4XP4H 2AQRA 5TH2A 5F8QC 3GHBL 1T7ZA 1GT8A 3HUJF 4FTDA 4U1GB 3W02A 3CZJA 3LXCA 4PG2C 3O8XA 5EB9A 2BVEA 2X6CA 5HHMD 3BPCB 3IJYB 4Y19A 1U42A 5CILL 4MWAB 3PXJA 1NGWA 1N55A 3V52L 1IBZA 4NYLA 4KK9D 4ZD3L 5HVHB 1OCJA 2K45A 1A7NL 1BZ9A 4KETA 3ARFA 3VXUD 3QZPA 4HLZH 2H8ZA 5FUOL 3ICJA 5IQLA 3NQEA 1AKJB 3W7HA 3GSVB 3HE7C 2FKPA 2APFA 3BUVA 4OJAA 4UNKA 1BQHA 2R1LA 1XIWB 3UGXA 3WLNA 3F3HA 2YMOA 3MBDA 4QHUA 5D71L 5DHXB 5KYXA 4KKUA 3ECBA 4N0YH 2JK5A 1QTPA 1IARB 2H9AB 2XGIA 1HCZA 3LKRA 1DQTA 3JTBA 3MNZB 1RCOB 4RRPG 3A8KA 1XF4A 1N64H 1GQNA 2IDTA 3MDUA 4II3A 4QXUL 2BGQA 4JFQB 3IVKB 2FO4B 4AIOA 1OALA 3ERXA 4CL7A 2F0CA 5KTEL 4G9FA 1Q0YL 4WI6A 4NZ3A 5FWRA 3PHOB 3MUAA 2CDFA 3GZ3A 1IFHL 4Q6IA 2WLNA 1OHHA 1P84J 3W1NA 5DZOA 3S2NA 3OEEA 5DO8A 3NZHH 4GO6B 2YCEA 1EO5A 3ATDA 4LLUA 2VLKB 4KHXH 5C9WA 3AS0A 2CBPA 1F86A 1RUSA 4PJXE 2GSMB 1IJ9A 4GQGA 5DRXB 4B50A 1HH6B 1QFUL 4AZCA 4NRRA 1BYPA 1GHFH 4GWEA 3UDWA 1TU2B 5F9JA 4HIXH 2R9VA 1PD1A 1RZQA 3MNVB 1RLWA 1GW0A 2PBOA 2SODB 3ZN6A 3O45B 2OOFA 4I1PA 1DJHA 1PG7L 1UOWA 4BFBD 2J6VA 1E5BA 2ZBTA 1W35A 2NQCA 4U1GC 4B7IA 2BSRA 1OFDA 3W5VA 3RX5A 1WOSA 3H9NA 3TM6A 1XBRA 1OE2A 1XSJA 4HH9A 1WRFA 4QKXB 4MWAC 5GRJH 4TSAH 4S3CA 5D30A 1DWIM 3R89A 2GOKA 3T0DA 2AJVL 2UWFA 2YXFA 2DSUA 1DO5A 3HLKA 5BZDB 5HVHC 3S34H 2Y0FA 5L2KD 2OYMA 4ONGL 1RY7B 3AY4A 4MA3B 1M9HA 4A2RA 3O4LB 3QDJA 4KI5D 2Y89A 1WNOA 3KPRD 3F05A 5BO0D 3CH8A 3PAZA 3T8MA 3IDJA 1SMAA 2BFGA 1AANA 4OOZA 1E5AA 5CFAA 1XIWC 4EN3B 4F0HA 4YNYA 5F70A 4JQ4A 4YSPA 4NWTH 3UJTL 2VQ1B 1UEMA 4LLAA 3O6MH 3J7HA 4X60A 3EOLA 5EA9A 3UABA 1BWKA 5AW0B 4Y2WA 5D9NA 4ONFL 3LXBA 4WGWB 1E8XA 4HU0A 1MQPA 3JYCA 4DAGH 1GOQA 4R97C 4DJFC 4PU2A 5B21A 5CH9A 3SDYL 4WAFA 5ADOH 2BMBA 2HX9A 2AV7B 1VPOL 4LLVA 2RKXA 2PPFA 4PJ9B 4FI7A 1Q63A 1NPJA 3HA0A 1B31A 2WYRA 4DP5X 4AQ1A 3BQJA 5DMLA 4C1NA 3EYSH 2FX7H 4H1LA 1WC7B 3RWIA 3ZZQA 5IDIA 5EZIL 2WYHA 2NMSA 3CLFL 2ZOUA 4NUMA 1OD8A 2A3BA 3QQDB 4ROXA 2XRAL 2Y5EA 3ZDXE 4NUJA 2Y70A 2ZITA 3MLTA 5I66A 1I6NA 4ZX4A 3BUPA 4M1DH 4Y4KA 5TGBA 4AW7A 5F0MB 1I1XA 1CNEA 3QBUA 3HBQA 4XMPH 4M7JL 4FERA 3TIMA 5HJXA 3EKGA 3T0ED 3NDZA 3PRZA 3RWCB 3WOVA 2Q1EA 3HMJG 2PU1A 2WLYA 2FH6A 2X0VA 1HXYA 4L5FL 5B4MD 4DVOA 3VI4B 3NAVA 1LEKA 4X6DF 4J39A 4P61A 3EYQC 5IGXL 1TJHH 1N19A 3CLWA 1MREH 2OQLA 1KF9B 1KPUB 2HX8A 5E51A 3BQVA 1TA3A 1TVHA 3EYPA 3IF1B 4PGEA 2PLMA 3D4CA 3MHGA 4QFMA 5D7JD 4PCTA 4JQXA 3KPTA 2CXGA 2CPCA 3H0TB 4UIOA 3CW2A 1F97A 3SY5A 4NKMA 3L1OH 2Z25A 4KRPD 3OBKA 4FDWA 4AYEC 2FSDA 5DLMH 5L8JB 4XPGL 4DKTA 3G0XA 4X7EA 6XIMA 3BAEH 1MDLA 1ZGLA 4Z5RA 3VFUB 4ZMWA 2X3CA 2DERA 3QFJB 4LCIL 3BCDA 3S5OA 4WVXA 4Z2HA 3GBLA 2X85A 3CC7B 1CU4L 1SY6A 4PJ9C 5IMOB 4KDWA 1I8UA 7XIMA 5BUAA 4HKJA 2H3XC 3S5NA 5FD0A 4ZUUB 4C0SA 2YRPA 1TJ2A 4TT3A 3BH8A 3SJPA 4UNVA 5A6IA 3TO4A 1XIDA 5KBMA 1EFUA 4CW1B 4HNTA 1LROA 3LTVA 5INDB 3OM3B 4YDMA 3FO1A 2AKRA 2Y8VA 4OU3A 1FIGL 4HJJL 1JHKH 1GC1L 4NJAL 3FT4B 3GYEA 1BVNP 2E1WA 4OFQA 1PL3A 3W2DL 4LF3B 4GG6A 3MPCA 4PC3A 1M53A 2YD7A 4PR5B 4EJ1C 4KFPA 4QT5B 4RDZA 2YPVA 4C6NA 3AOFA 1DJSA 4LBEA 1AD0B 4DIAA 4KQ0A 2B7CA 3BSZA 3E38A 2WV8A 3E2QA 4JDZB 4ES4A 1WT5A 4PWIA 2HPIA 4G9DB 5DZPA 5G2HA 1WD8A 2X16A 2R0WL 5GJMA 2F74B 1IWPA 1FBAA 5K59E 2V2XA 2DWXA 2ALWA 2WUBH 3UZQB 2WHJA 1MWAL 1SJHB 2ZJSH 2YOAA 5IQ9A 3BG5A 3CAFA 3SPVB 3UP8A 2W07A 2PUZA 3X2QB 2GY7B 3WNKA 4QYAA 3CHSA 4GMTH 3QH3A 4W9GC 3TFKD 2WO2B 5K9OA 2E6FA 1RJYB 2EPNA 5T5NF 1L6WA 4LVEA 4FXUA 4OE7A 1XCTA 4DO6A 1U92A 2ZWLT 2YR3A 3TSBA 3CIXA 4PJEE 2FTAA 5F3BA 2VCOA 2CW6A 1IBFA 1OTUC 3AHYA 4X99A 4NJ9L 3UPRB 1IE4A 5ID0A 4GO8A 3W5MA 3EMZA 3GEWB 4YQXL 1DYSA 1EJSC 4L3CB 1ANUA 3L67A 3N2OA 3BKCH 4XNXL 3OR7B 4GSDL 4N0CD 4RGMC 4KNSA 2CLHA 4YEJA 4KTEH 1XLFA 1H9VA 2CNCA