2DIEA

Alkaline alpha-amylase amyk from bacillus sp. ksm-1378
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
481
structure length
481
Chain Sequence
b'TNGTMMQYFEWHLPNDGNHWNRLRDDAANLKSKGITAVWIPPAWKGTSQNDVGYGAYDLYDLGEFNQKGTVRTKYGTRSQLQGAVTSLKNNGIQVYGDVVMNHKGGADGTEMVNAVEVNRSNRNQEISGEYTIEAWTKFDFPGRGNTHSNFKWRWYHFDGTDWDQSRQLQNKIYKFRGTGKAWDWEVDIENGNYDYLMYADIDMDHPEVINELRNWGVWYTNTLNLDGFRIDAVKHIKYSYTRDWLTHVRNTTGKPMFAVAEFWKNDLAAIENYLNKTSWNHSVFDVPLHYNLYNASNSGGYFDMRNILNGSVVQKHPIHAVTFVDNHDSQPGEALESFVQSWFKPLAYALILTREQGYPSVFYGDYYGIPTHGVPSMKSKIDPLLQARQTYAYGTQHDYFDHHDIIGWTREGDSSHPNSGLATIMSDGPGGNKWMYVGKHKAGQVWRDITGNRSGTVTINADGWGNFTVNGGAVSVWVKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords amylase
molecule tags Hydrolase
source organism Bacillus sp.
publication title Ancestral sequence evolutionary trace and crystal structure analyses of alkaline alpha-amylase from Bacillus sp. KSM-1378 to clarify the alkaline adaptation process of proteins
pubmed doi rcsb
total genus 177
structure length 481
sequence length 481
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2dieA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2dieA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dieA01
5A8OA 3WQ6A 1QPKA 3CZKA 1E6ZA 1E6SM 3KEHA 2WMIA 2D2OA 2GK1B 4H04A 3HZ3A 2WZHA 1M01A 1W2VA 3SUVA 1PX4A 2YFNA 3WEMA 3ZOAA 1W1PA 1SZNA 3AYSA 5FIPA 1BGGA 1BYAA 5IDIA 5D8WA 1Q6CA 1E0WA 3M7SA 4CCEA 1JDDA 1MWOA 4K68A 3HG3A 2PWFA 3VNYA 4M24A 5BRPA 1KR0A 3LRMA 3GXNA 4FNUA 1VEMA 1CWYA 3DYPA 4S3KA 1CTNA 3DX1A 1TVNA 2ZUVA 2DT1A 3OLGA 1EO5A 1OGBA 3ARRA 3IJ9A 1V02E 1TCMA 3GH4A 2PI6A 1H3GA 4PMVA 1M7XA 4J3XA 2WBKA 1W3KA 3W29A 1JAEA 3A47A 5CXPA 4DWSB 1B9ZA 1XCWA 3QHOA 1XV8A 1LG2A 4D6HA 1E40A 5GQBA 4TUFA 2QLYA 2WLYA 5ECUA 2WMKA 4BA0A 3THDA 4W8LA 3FAWA 1MW1A 2VURA 1UUQA 4GO8A 3L4WA 5A8QA 1QHZA 1UASA 1X6NA 3TTOA 2TAAA 3VMOA 3RPMA 2YJQA 3WNMA 4P7RA 5DT5A 1QW9A 5I78A 1KGXA 1UR8A 1LG1A 3L4VA 1H2JA 3VD9A 3AOFA 1V03A 4PEEA 3CMJA 1JNEA 3L4TA 5CPTA 4J27A 3HU7A 3ECQA 1G1YA 2WCGA 3T2PA 4BS0A 1HJQA 2Z1SA 1FH9A 4NZCA 3O9NA 4OJYA 4W8BA 2WYSA 4MNKA 3VD7A 3DYOA 4JFVA 2J77A 2WVUA 1CXFA 2DSWA 4F9JA 1V3HA 1R7AA 3EJPA 3K8KA 1SMAA 1MFVA 3LRKA 2WK2A 2WMHA 2VOTA 1FHDA 2EBNA 5I77A 3WQVA 1EDTA 1HP4A 3L2MA 1HJWA 1OGSA 4HOZA 4QFUA 3OGRA 5DEZA 4Z2KA 4BCEA 2J8FA 1O7DC 1HXKA 4NXKA 4PTVA 1VRXA 4S3JA 3BUIA 2BY1A 7TAAA 1VFOA 2WLZA 4CGTA 2RGLA 1CLVA 3AMCA 2ZXAA 3F4VA 4BQ5A 1PS3A 3MMDA 1J9YA 1IV8A 3T08A 3EJTA 3VTRA 3FY1A 4UOQA 2JIWA 5A95A 1JDAA 3EDFA 5A6JA 1NOUA 2FH6A 5EMYA 3T0AA 5DFAA 5I0DA 2JEPA 1E1EA 3VUPA 3IK2A 1GOKA 1J11A 1JI1A 4DO4A 4CU8A 2O9RA 3PTMA 2C0HA 4CU6A 4FMVA 1ISXA 3NDYA 5I79A 2CHNA 3A24A 1JYWA 1DWAM 1BVNP 1ODZA 2A3AA 2EEXA 1BYDA 1AQ0A 1UD5A 2D3LA 3KL3A 1S46A 4P8UA 2VR5A 3LX9A 2ZX5A 2WW5A 4ACZA 1HVQA 1B3YA 1E4NA 3A6OA 1SFSA 4AZ5A 3UR8A 3WUFA 3W4RA 1E6NA 3W6MA 3NSNA 3SCQA 4JL1A 2DQXA 3ZJ8A 2UY5A 5F7UA 4L4PA 2QMJA 1C3FA 1Q6DA 3NJ3A 4UQBA 1C92A 4H8HA 3PZNA 2GJPA 3BSGA 1C93A 4OGZA 4DWSD 3WQ8A 5IHSA 4OIFA 2XVLA 3AS3A 3B8SA 4GZJA 4NSBA 5A2CA 1XHGA 1RH9A 5D4YA 2D1ZA 1TUXA 1BGAA 1UKOA 4RE3A 5DO8A 3KE0A 3BMWA 2YA1A 3O6AA 1KXTA 4OUEA 3EMQA 4OZOA 3QR3A 4HOWA 3BVWA 3S5ZA 1UOKA 1V6XA 1GOQA 1CYGA 1V0NA 3SCUA 1B3ZA 1L8NA 2CBVA 4J3TA 1EHNA 4BZYA 1PIGA 4CUCA 2FYVA 3UG4A 1ISZA 2E4TA 3WNOA 1JZ2A 3CGTA 1MVYA 4LYQA 3ZT6A 3O2LA 1NP2A 3RILA 2CCRA 1H5VA 2JF6A 4E4PA 3EJRA 4W8AA 1HXJA 4Z2LA 3DHUA 3WBAA 4F9DA 4FNQA 4JFUA 4W85A 2CBJA 2VI0A 3N15A 1EA9C 4DM1A 2WZIA 2ZUTA 1W1VA 4LPCA 2ZIDA 2WSPA 2X2YA 2GJRA 3VO0A 2MANA 1BF2A 1W32A 2W4XA 3ZR5A 3NUKA 4FLQA 1FP8A 4ML4A 2J75A 2ZXQA 2EQDA 3VOCA 4U33A 3EYPA 1LF1A 4J7RA 3PN8A 3POCA 4A3YA 3W25A 1JAKA 1LL7A 6CGTA 3TP4A 4D6IA 5E0FA 4NZJA 3W37A 1NQ6A 2ALWA 1E0VA 4GI9A 5I5RA 5JIPA 1KQZA 1VJSA 2UWFA 4AD4A 5D9MA 1D7FA 4WSJA 1LLOA 4W84A 5AYIA 3VGEA 1U2YA 1TA3A 1D3CA 2JIEA 4AD3A 2VJXA 1HJVA 2W92A 1IZJA 2ESCA 2EPOA 3FXYA 1BTCA 3MV01 3DDGA 3WDRA 1UWQA 2NT1A 1OINA 5FOOA 4U31A 5M17A 4P8VA 4GQRA 6TAAA 3OGSA 4D1JA 4URIA 3NYDA 1C90A 3WY2A 3AHTA 3W27A 1ZJBA 2JF7A 3L4UA 4C7FA 5GNYA 4PRWA 2BNJA 5CQ1A 1OGGA 3VM5A 5A6SA 1H1NA 2CHOA 3T0BA 4A4AA 2CERA 3PTKA 1UKPA 3NDZA 1EOMA 5A8PA 3AZSA 2XSAA 1TA3B 2E40A 2O92A 3E1F1 3IANA 5D9PA 1JZ6A 3WIJA 5CGTA 1ITCA 2DEPA 4OKDA 2X2IA 2YL9A 1WDSA 2G8ZA 1V3MA 4KMQA 1BPLA 1DHKA 1E1FA 3MS8A 1KB3A 2WVTA 3AMGA 1WP6A 4GZEA 4WJXA 4BQ4A 2CNCA 4AIEA 3CZ8A 3A4AA 1N82A 3MMWA 4AD5A 2EXOA 3ARTA 2YFOA 2CPUA 3VGDA 1E4IA 5BXTA 2D3NA 1ZBKA 1HP5A 2YDSA 5AYBA 3BGAA 3MSDA 1MQQA 3WF3A 2WWCA 3VSUA 3PZIA 1BAGA 4J3UA 3A3HA 3ARQA 3VDAA 4NRSA 1E56A 1PZ3A 1XH0A 2ZWZA 1W9BM 3VIHA 5ABEA 2GUYA 3ZJ7A 4CD6A 2W63A 3WELA 1JZ5A 1DWFM 3RM4A 1UH2A 3I3BA 1ZL1A 3HG5A 5AC5A 2FGZA 3H54A 4UFIA 3CZLA 2AMGA 5A8NA 3AFBA 4P7QA 1YHTA 1O7AA 2WKLA 1HN1A 3SUTA 1V3JA 1T0OA 2EPLX 3WENA 1FH7A 2CESA 4XV0A 2FH8A 3OB8A 1MQPA 5JBFA 2G3NA 2J25A 4QLKA 4IM4A 2F7QA 1QHPA 4LYRA 3A21A 4W87A 4IISA 3OLDA 2VX7A 4FNTA 3OLEA 1B1YA 1J0YA 1BVZA 5E6ZA 4ZFMA 1E3XA 1UR9A 1PZ2A 1KXVA 3SCPA 1HX0A 4AC1X 4CN6A 4XX6A 2C8NA 2W67A 1ECEA 2E0PA 3SIMA 4HZ8A 3AHVA 1OCQA 1EGZA 4CD4A 8CGTA 3VDBA 3WD1A 1QNRA 4JAWA 1R47A 1KBKA 5HPOA 1VAHA 3UR7A 5EFFA 4BQ2A 3VGGA 4PMUA 3AIEA 3A5VA 3VDHA 2ZWYA 3AYRA 1F4HA 4ZE4A 3G6LA 3GXDA 2ZXDA 4AD2A 3CZEA 4MB1A 3W0KA 1J0KA 4QLJA 2A3EA 1TFVA 4W7VA 2BXYA 3ARSA 4UR9A 2BVTA 1QNOA 4Z2IA 4B16A 3CPUA 5E0CA 1J0IA 5BXRA 4PSPA 1LJYA 2PWDA 4CN4A 1KCKA 2VVSA 3MI6A 1JF6A 4CCCA 1CGWA 3WF0A 1V6WA 3VILA 4UZUA 2VRJA 3BVUA 2WC7A 4FNSA 4PUEA 1AVAA 4CVUA 2YL8A 3EMCA 4FNRA 4EE9A 4DM2A 3ALGA 1VENA 1WPCA 1UH3A 3GXTA 3SCRA 2DSKA 1M04A 3M6DA 3PZGA 2D0GA 3WQWA 1DWHM 1HKIA 3WFZA 5A8MA 3D4ZA 1VBRA 1WDRA 2NW0A 1TQSA 2YBTA 1PEZA 1UYQA 3KLLA 1CIUA 2CYGA 4AYGA 1B30A 3LMYA 1CDGA 3KL0A 3OBAA 3ZT5A 4RE4A 4MNLA 3WN6A 1ZBCA 5JBDA 1ODUA 2WM0A 1UQZA 3ZSTA 2F2HA 1K9EA 3EJUA 2GK1A 3T2QA 3WH9A 1UR4A 5BXPA 1KFWA 4AIUA 2W62A 3II1A 1QNSA 1V3IA 2YBUA 1ZS2A 4D6CA 1LL6A 3QHNA 3BLBA 2DIEA 1XRVA 4AZCA 3ZSSA 2X1IA 4PYSA 3RMEA 5C8BB 1QOXA 1BQCA 4CCDA 4UFHA 1GOMA 5CGMA 2XFFA 4Q22A 5CSUA 1V0MA 3U7VA 2OSYA 4GI6A 5FCZA 1B3VA 3VGFA 1W3HA 2DPEA 5E70A 3AROA 2X8RA 1V02A 3MKKA 5A6BD 2W61A 1GVIA 4AD0A 3GXMA 3EDEA 4X9YA 3RM9A 4AZHA 1JG9A 3N13A 1C7TA 3U57A 2ZUNA 2OYMA 3CHDA 4HU8A 5LA1A 4UZSA 1CGVA 3GNPA 2V38A 1UD4A 3CZNA 4AD1A 4AZ6A 4UCFA 2XGBA 3SUWA 2O9OA 3AHZA 1GQIA 5ABGA 1PJ9A 3D52A 1NWTA 2CXGA 2VMFA 4JFWA 4J3SA 2BVDA 1EQPA 1X1NA 4HPGA 4AWEA 4AEEA 3AZRA 5A6AA 3UEQA 3ARWA 3VD3A 2DDXA 2ZICA 3L4YA 3DX0A 5FKYA 2XIBA 4J3VA 2GDVA 1E6RA 2ZXBA 3BVXA 1LL4A 3WD4A 3CHCA 3CZGA 4N42A 2BHZA 1M03A 3ARYA 2ZUMA 4GI8A 2OLHA 4UQEA 4ATWA 3QOMA 3BC9A 2VQTA 1X6LA 3VSTA 1W1YA 3VGHA 3WFLA 2VX5A 1W1TA 2GJXA 3AMDA 1TQTA 3VIJA 2VZSA 1QI4A 1PPIA 4UFKA 1AQMA 4MJ2A 4LX4A 3I3DA 4PMNA 5HDRA 1GHRA 1C8XA 1JI2A 3AIVA 3CC1A 3B9AA 1ESWA 2Y8VA 4TOQA 1JXKA 1R7OA 1KCLA 3AIQA 4H8UA 3AIUA 4MTVA 1CGXA 5CLWA 2DT0A 3N17A 3FHAA 4AMCA 2B31A 4ZE5A 3OA5A 2VR4A 3CV5A 1GHSA 3WY3A 3CLWA 4AZGA 2G4FA 2ZUSA 1E73M 4M82A 2YKKA 2WBGA 3ARUA 4FK9A 3BSHA 2DIJA 3NSMA 3F5KA 2YA0A 3VINA 4OOUA 1K9FA 4AMXA 4IPNB 4CVWA 2J7EA 1JNDA 3VU2A 1E4MM 4NF7A 5GNZA 2F61A 3N18A 1R8LA 2BY0A 4UOZA 2XTKA 2G3IA 5BXSA 1Q6GA 3DYMA 1JZ8A 3WF1A 5CPQA 1QBBA 2BV9A 2VVNA 3BUDA 3EBVA 2F1AA 1QW8A 5DT7A 2VZUA 1HTYA 3DC0A 5AC4A 1ZU8A 4W7UA 3FNDA 4D6FA 2ZOXA 3AI0A 3GXFA 3A4WA 3BLKA 1XCXA 4NXSA 3GBDA 3PZ9A 4H8VA 1J18A 2PF0A 1W9PA 2VRKA 4PTWA 3VIFA 4D6JA 2YOCA 2JEQA 3ZM8A 4PN2A 4GKLA 4HMEA 1RP9A 2DT2A 1OIFA 1VFFA 2E3ZA 3D5HA 4A3HA 1R85A 2WCSA 4UTFA 3DHPA 5A3HA 2X0YA 3SCVA 1C91A 3WNNA 2J8GA 2G3JA 2J7GA 2XVGA 2WC4A 5A6LA 2J7BA 1UD6A 2DSUA 1NOFA 4UQDA 1UD2A 1HIZA 1FOBA 1GORA 3AHXA 2XGIA 4D6EA 2X0HA 5BYWA 3CUGA 2D0FA 4HTYA 3WEOA 3HG2A 3D51A 2WCAA 4CD7A 3VMPA 1UD8A 4YHGA 4EK7A 3W53A 1E15A 1FFRA 4PCTA 3FW6A 4D71A 3W82A 4Z2HA 4JKMA 2EPNA 2E9LA 2VCBA 2XFYA 1UA7A 2D73A 1OM0A 1DWGM 1W2PA 5JUVA 5FD0A 3DX3A 3LPOA 1J0HA 4PMOA 1W9UA 3A4XA 2HVMA 4AZCB 3KLKA 3IJ8A 4B9YA 4QCEA 1ISWA 1G9HA 5E09A 2D0HA 5IHRA 3TONA 3B9DA 2VC9A 3S6TA 2W66A 4GXPA 3BAWA 1BYCA 4NRRA 2WANA 1CPUA 3VIOA 3S5YA 2XJ7A 1R86A 3APGA 3ZO9A 1V08A 2CETA 3AJ7A 1UR1A 7CGTA 1FA2A 1B3WA 3PZOA 3TTSA 2D23A 3CO4A 3D50A 1FH8A 3TTYA 3W81A 1NM9A 1VB9A 5LA0A 4Y7EA 5M03A 1G0CA 4GO9A 5ABFB 5TD4A 3PZVA 3BUBA 2BY2A 3EMZA 4JHOA 5C70A 1HWWA 1A3HA 5DF0A 1OSEA 2PC8A 5ABHA 1DEDA 3S2CA 4MDPA 1V3KA 1JYNA 1WZAA 1H0IA 3RO8A 2XM2A 1QI3A 2XWDA 1MW0A 3A23A 2WB5A 3JUGA 1ZJAA 4EAMA 3SCWA 1H0GA 3ARZA 1V3LA 4B9ZA 2WAGA 2D20A 1UKTA 4KH2A 4GIAA 4UQCA 1WNOA 3WF2A 2F7RA 3DDFA 1EOKA 1XSIA 1FFQA 1C7SA 1E71M 4HOXA 2XWEA 2VO5A 2J62A 2FHBA 2WVVB 7A3HA 4KRUA 1KQYA 4NX0A 3VM7A 3OZPA 5JIWA 4M80A 2EPMX 4J3WA 3UG5A 4Q7NA 3VDCA 1XSKA 4M56A 2DSZA 3K46A 4GPNA 1EH9A 4CU7A 2D22A 1JD9A 1TQWA 3WEZA 4DUVA 4TX6A 2RGMA 5D9NA 3AICA 3AZTA 2BY3A 1G01A 3N11A 4R27A 4FLRA 5A6BA 4PSRA 3RM8A 3WDQA 3AHYA 4JL2A 2VUYA 1GUVA 4ACZB 4XZBA 3EDJA 3GNRA 3VGBA 3BAIA 4MAZA 4QP0A 4QLLA 3EDKA 1KTBA 4E8DA 4M29A 3H55A 1JDCA 4DUXA 3WUEA 1OT2A 1BG4A 1JF5A 1A47A 3BAYA 1EHAA 5A69A 4WF7A 2GDUA 4WK9A 1E9LA 1PBGA 1W3LA 3ARVA 3WDHA 5M5DA 4QDMA 4HZ7A 2XG9A 4WSKA 2J74A 3BLPX 4PMDA 5FL0A 1MFUA 1OB0A 3KL5A 1QNQA 2XFRA 5IFPA 4JIEA 1HKKA 1BYBA 1EQCA 1U30A 4M8UA 3HG4A 1CZ1A 2PWGA 1ITXA 3RJYA 1HJXA 1QI2A 1PAMA 1IT0A 1WAWA 3L2LA 4GZIA 3HN3A 4IPLA 1J0JA 3BXWA 1JGIA 3PZQA 2EPKX 2J79A 2XPKA 1QWNA 4H7VA 1DP0A 3MU7A 1HT6A 1C8YA 2ZX9A 4UFMA 1E5NA 3U7BA 2J47A 4LYPA 2O9PA 2V5CA 3CH9A 1NARA 1GQKA 5I2UA 3EJSA 5BRQA 1LQ0A 2CKRA 4M1RA 4YPJA 3WH5A 3ARPA 3WD2A 2C7FA 1UKSA 5A6MA 1RPKA 2OYLA 3PZTA 4MB5A 1HVXA 4U5KA 4CD8A 3LRLA 2GFTA 4W89A 2F7OA 1NWSA 4TX8A 3T2OA 4FF5A 1SMDA 3PBGA 4UQAA 1GOWA 2X2JA 3CBWA 1IZKA 2PWEA 1SYTA 3CZJA 1DTUA 3RJXA 2UY4A 1B0IA 4W7WA 1WB0A 3SEPA 3MANA 1OBAA 2J4GA 5I23A 1V6UA 4DO5A 4DWSC 8A3HA 1CXLA 3NCOA 2XHYA 4HU0A 2GSJA 5CJ5A 3U5YA 3BCFA 1Q6EA 1XYFA 1GJUA 2NSXA 4MAVA 5KZ6A 2V3FA 3VX0A 1E3ZA 4AEFA 1UWSA 2WVVA 3AXIA 4R5EA 1QVBA 3OIHA 3F5JA 1QBAA 3GBEA 4CN1A 1OT1A 1K6AA 3L4XA 4WKHA 4OBRA 4TXEA 4UOJA 4D6DA 1HNYA 3NSXA 2FE0A 2QHAA 3AIWA 4D1IA 3AS1A 3OGVA 3AMKA 3WMCA 1UWRA 2G41A 1TQVA 1EXPA 1KXQA 3MSGA 1B31A 3WL1A 3PZUA 1AMYA 2A3HA 2AAAA 1GJWA 3UG3A 3WY1A 2F1BA 4CD5A 2VL4A 1CGTA 3K1DA 1TR1A 4V2XA 1WO2A 2BVYA 2PWHA 2VX4A 3MV11 4OBSA 1E6QM 2BS9A 2VZVA 4WKAA 4FLOA 5D9OA 1Q6FA 3WDPP 2F18A 3GTNA 2ZUUA 1CLXA 3EJQA 1RD6A 3PTQA 1XD0A 3G6MA 3LPFA 2VT0A 4DO6A 3RDKA 1EDGA 1V6YA 1UZ1A 1V6VA 2O9TA 4Z2JA 4P7NA 1PX8A 2WVSA 4PMRA 4JFTA 3MUAA 4EKJA 3SUSA 1H11A 3W6LA 3VX1A 3WNLA 1NWRA 1PIFA 4P8WA 3WQ5A 1WKYA 1UZ4A 3BAXA 4X0NA 5HOSA 3WH7A 4AISA 3UETA 4HPHA 3ARXA 4PMYA 5HBFA 3CIVA 4IUGA 3HJEA 1GPFA 1QWUA 3WBEA 2DH3A 3VIGA 4B15A 1J01A 3POHA 4BF7A 4X0VA 4JHZA 5HNNA 2YDRA 4ZEPA 3CUHA 3MMUA 4D72A 3ZJKA 2J7CA 2J7FA 3VSVA 3KZSA 1TQUA 4AZIA 4UNIA 1KR1A 2X05A 1OWQA 1AQHA 1O6IA 3PZMA 3WH6A 2FHCA 4HP5A 2EAEA 3BAJA 1W91A 2WKGA 1WZMA 2E9BA 1GCYA 1SR0A 4DWSA 4LQ1A 1VFMA 3LXCA 4LXFA 4U5IA 1UWUA 4PTMA 1GNXA 3MUIA 3AQUA 1H49A 4MNMA 1WZKA 4P7OA 4FLSA 2BHYA 3DECA 4NI3A 4W88A 4ZENA 2EADA 4ZXLA 2WHJA 1K9DA 5CSYA 2OWCA 2X2HA 4MADA 4EANA 4ATDA 1JZ3A 3K8MA 4HA4A 1MQRA 1VF8A 3IJ7A 4C7DA 2PBGA 2EACA 4W5ZA 1J0ZA 1UA3A 3M07A 2XVPA 4ACYA 2QF8A 1RP8A 3HMCA 3TTQA 2WWDA 3GXPA 1FHLA 1ISVA 5JBEA 2OWXA 3UCQA 1E6PA 3QOKA 2A3BA 5LA2A 1TZ7A 2VQUA 3A22A 4F79A 1I1WA 1R33A 3VIIA 4WIWA 4U3CA 1XH2A 2XIIA 2XN0A 5I24A 4W5UA 4ATLA 5EBAA 2GVYA 1GONA 1GQJA 2J78A 2J7DA 2V3DA 3ZMRA 3WDIA 1VIWA 1CNVA 2CITA 3M46A 4D6GA 4MB3A 1C8QA 2EABA 2QPSA 2VNCA 3GH7A 2DT3A 3IAPA 1V0KA 4HMDA 3LXBA 2OW7A 3B9EA 2PBOA 4MNJA 1QX1A 4KRTA 4AZ7A 4JCMA 2YA2A 1TG7A 1WCGA 6A3HA 2BHUA 2OSXA 4H41A 1K9TA 3UESA 5GNXA 4P7LA 1QNPA 3AS0A 1W9XA 2IXUA 4F8XA 1JZ4A 3AIBA 3GNOA 4RL3A 3MUZ1 1J12A 1D2KA 2JALA 1DWIM 5A6KA 3ZIZA 2WHMA 4AXNA 4V28A 2YL5A 4GQQA 5A1AA 3VMNA 4HMCA 1Y7VA 3WY4A 5M3WA 1OIMA 2VZOA 2CBIA 3CUIA 1E0XA 4YN5A 2BFGA 2OYKA 1E70M 3OZOA 2CEQA 3AXHA 1CECA 2CKSA 4TVCA 1GOIA 3LPGA 1HL9A 1CXHA 3VKKA 3N1AA 2AOSA 3BUQA 3AS2A 1BFNA 2XVNA 1NOWA 4XB3A 2WXDM 3MUY1 1H09A 2VZTA 4KGJA 1JZ7A 3BVTA 3GH5A 4JKLA 2YL6A 3ZQ9A 1GZJA 5CG0A 4PMXA 3VIMA 1XSJA 1MXGA 2A3CA 3WMSA 2WHLA 1EO7A 4AYSA 2DGAA 3BAKA 3MO4A 4OOZA 3NIYA 3WUBA 1E6XM 1DWJM 3VD4A 3W26A 1CXIA 1P6WA 2YLLA 4W93A 1TMQA 1Z32X 2JE8A 4TTUA 3H53A 4L4OA 2ZX7A 4WLCA 1L0PA 4QCFA 2XN1A 2Y4SA 4P8XA 1TE1A 4MJ4A 3N9KA 4WKFA 2BXZA 2V3EA 2WMIB 3SCSA 3OLIA 1WDPA 4KGLA 1WZLA 2IUZA 3W28A 1QHOA 4V27A 2QPUA 2OSWA 1KBBA 1ISYA 4AZBA 2IGTA 3UERA 1H41A 1VFUA 2ZX8A 2XYLA 1HKMA 1MYRA 1US3A 1MW2A 1HJUA 3I3EA 5IXEA 3QGVA 2UY3A 3AIRA 1XGZA 3ZT7A 2OWWA 3VIPA 1W9DM 2XVKA 3U5UA 1UR0A 4XUYA 3ZJ6A 3T0DA 2EJ1A 3FHQA 3BH4A 1ZBVA 3CUFA 1KTCA 2VTFA 3N12A 3VD5A 2F7PA 1EIBA 3N04A 4BQ3A 3RIKA 5EB8A 1G5AA 2XUCA 1UWTA 2E9MA 1UHVA 1HL8A 5HXMA 1UKQA 2W91A 5AY7A 4U2ZA 1UQYA 3CHFA 3WD3A 1UD3A 2CIPA 1E72M 1Q4NX 2YIHA 3GM8A 3WNPA 2Y8KA 3GDBA 2IXVA 3WKZA 2PB1A 4M81A 1WE5A 4C7GA 1R87A 1MW3A 1JD7A 1GVYA 3WH8A 3WF4A 1FP9A 2Y24A 3RCNA 2FDMA 3WMBA 3OG2A 2W5FA 2WHKA 3CZSA 2E8ZA 3ZR6A 4NZFA 1JXJA 5FL1A 5CZKA 4HZ6A 3D4YA 1GOOA 1CGYA 4UQ9A 3EDDA 1JFXA 1XYZA 1XD1A 1VEOA 5HPCA 1NWUA 1GW1A 1JL8A 1UH4A 3WNKA 1US2A 1OD0A 2HISA 3LPPA 1JYXA 1VJZA 3F5LA 1MXDA 2EO7A 2WMJA 5BCAA 4U2YA 1CBGA 4B3LA 1NP0A 1YQ2A 2YLAA 3DX2A 3L4ZA 1BSIA 3WD0A 1OD8A 2FGLA 1I75A 1B3XA 2DSVA 5GPRA 1CEOA 1CGUA 2WC3A 4YHEA 4UFLA 1CENA 1F4AA 2UY2A 1LWHA 2VCCA 2Q8XA 3J7HA 4KWUA 2QMKA 4U3AA 2X09A 1VBUA 1KWKA 1BHGA 3TV8A 4ZXOA 5BWFA 3K4DA 1HKJA 1KXHA 4TVDA 1E5JA 1R46A 2XSBA 1CXEA 1KWGA 5CLTA 4UFJA 4AW7A 3D3AA 2F8QA 3GZAA 4QAWA 1TVPA 1U33A 2NT0A 3LXAA 1VEPA 4E8CA 3IAQA 1E55A 1XC6A 4HA3A 2QV4A 3W38A 3AMLA 1H4PA 3K4AA 2G3MA 3VPLA 5LYRA 3WDJA 4LGXA 1NH6A 4TTGA 4PUDA 3VNZA 2YDQA 2Y2WA 2ZX6A 2XM1A 2Y5EA 4XZWA 4AIOA 2Z1KA 2ZUWA 4W86A 5E1QA 3SCOA 4PTXA 3TA9A 1WDQA 3FN9A 2ZE0A 5DMYA 3TOPA 3AISA 3WL0A 3PHAA 1W9VA 1J10A 5C71A 3FAXA 1B90A 4TVUA 3SCNA 5A2BA 4RE2A 3T09A 1ZBWA 3CTTA 1PX3A 2WZEA 4Z2GA 4N0RA 1I1XA 1HJSA 1R34A 1UWIA 3DX4A 3SCTA 3WSUA 3K8LA 1GQLA 4AY1A 4MDOA 4HA1A 1XH1A 4PCSA 2V3GA 4F66A 1G94A 1QI5A 1EDQA 1V0LA 1B2YA 4AMWA 2JFEX 4PMQA 4PMZA 3CUJA 4JCLA 4H2CA 5E6YA 4PBGA 3AXXA 3VVGA 4DUWA 2WSKA 3GXIA 1KGWA 1BG9A 4MB4A 1BPLB 3GYCA 4JZ5A 5CPSA 2WMGA 5A2AA 3W24A 3SUUA 3THCA 1KGUA 4J28A 1BLIA 4CKQA 3SURA 3BCDA 3QHMA 5IFTA 2E8YA 2DH2A 4E2OA 1QI0A 3BMVA 5A94A 3ALFA 5D8ZA 1E43A 2J7HA 4JKKA 5I3DA 2WPGA 5EFDA 1JYVA 1JFHA 3BUPA 3CMGA 5ABFA 4FNPA 2FHFA 4GINA 1CXKA 2VRQA 4MPKA 2V5DA 2D24A 5BROA 2OW6A 5E9AA 4B3KA 1HF6A 2VX6A 1W3JA 3WUGA 1LWJA 3KWXA 2XN2A 1ZB5A 3WQ4A 1M53A 2VCAA 3BVVA 2WNWA 3IGUA 1JIBA 1E4LA 2WMFA 1UR2A 5KEZA 9CGTA 3VIKA 1R75A 3CHEA 5I6SA 1UG6A 4JFSA 2CBUA 2GJXB
chains in the Genus database with same CATH superfamily
5E5CA 4X8JB 1CMOA 1T1WA 5GRWA 3LS4H 1QPKA 4DQKA 5DCDA 5BZDB 1E6ZA 1SDYA 5D4HA 5HJ3A 4OZHF 3SCMA 4CVXA 5CWSB 3R4DA 1P4LB 2DICA 3R89A 2ZZUT 4GCXA 1BZOA 4H04A 3LLDA 5IR1A 4Y96A 3GMQA 4FP8H 2BDNH 4UF7C 1M01A 1XIFA 4GSRA 2V5LA 3P80A 3SUVA 1BVNT 2A9NL 1KDJA 1ZJIA 2VOMA 1I7ZB 3A3BA 2AV1A 2I9LA 2FSEA 2APBA 4MHHG 1ZZMA 3AYSA 3O4LD 4R7LA 2EUWA 1BGGA 1BYAA 5FIPA 4EDWL 4KKLD 2IANA 1T8QA 1YY8B 5IDIA 3BQUC 1IU1A 3IRZA 1JGVL 3FT0A 2HN7A 1ZHBB 3NZUA 2ICEA 3GSVB 4L4TA 4N85A 1Z8AA 1G4EA 1JDDA 1QLEL 3MLUL 4AW4A 4K68A 1SYSB 3HG3A 2VAJA 4WCYL 2VM8A 5L88H 1F76A 1FYTD 1UWXK 2PWFA 2X7LB 1TV8A 4JFOB 4JTKA 4IIDA 1ADSA 2Y85A 4N87A 4XBEL 5DZVA 3MP5A 3UO1L 3X13B 1JDEA 4DPQA 2VC5A 4UV4L 4EJ1C 4NRZB 3GXNA 2P5WB 4JFZL 1V05A 4B6ZA 3B43A 3S83A 3TC7A 4YYCA 4YHML 1I8KB 3UJEA 3BVDB 1NGWA 2VISA 4Z4YA 2OL3B 5BZZA 1QLRB 1UA6H 4E0RA 1EO5A 3EKCA 2OR9L 1KK3A 4LRNH 4XBPA 4XWGH 1YNKH 5LWYH 3F7KA 1NCCH 5KBLA 4HKPA 5J13C 4FI7A 1V02E 5E5UB 3BRDA 2R82A 3QPQD 4PMVA 2VJ0A 1AMOA 4L65A 3V35A 3W29A 3CDGA 3W7GA 3F4CA 3S8WA 3A47A 1V8EA 4WEBL 2E5CA 3WMQA 4DWSB 1K4CA 1YEDA 3KPOB 3OG4B 2CGYA 2B16A 4LAKA 3GG1A 2BODX 1Y0LB 5B1CA 1E40A 5EF1A 4GMSL 2QVKA 1XUUA 3ZE1F 3SBRA 3GNDA 1SFJA 4TUFA 2QLYA 2CK0H 2QKIA 5GRUL 3CCEB 1MCEA 1A49A 1XZWA 3WS6C 4BA0A 3CQIA 1KLUA 3NYKA 3EYQC 3NPVA 3THDA 1R0AH 5T3ZE 5EPMB 3WS3A 4C43A 2EIXA 2GGIA 1S9XA 5C55A 5CC5A 1NIAA 3OYZA 4XISA 4M1CC 4P5MA 3HG0A 3FCGA 2VMCA 4AAJA 5F9WB 4WK2B 2ENSA 4O1BA 3BKCL 2J6WA 4HJTA 4P9MH 5A8QA 2DQIL 3SI9A 2VDOL 1KXTB 3BPCB 4CNIB 3TTOA 2TAAA 2RDUA 3N4FA 5AHLA 4OTXL 3J81k 2FFIA 2VHLA 1QW9A 4XMYA 3EOTL 4IRSB 4KKBC 5I78A 3BPLB 3IDMA 3MOBL 3ORJA 1SBSL 5EU6A 1UR8A 1LG1A 4H7CA 3L4VA 4TR9A 4GAFB 4AVOA 2XFGB 3AOFA 1V03A 3DIFB 1IEBA 5E0QA 2GC4C 1G0YR 3WU1A 3CMJA 3S8HA 1IGIL 4WO4A 1JNEA 1HQ4A 3U6WA 1LO5A 1Y0YA 2GI7A 4L8SC 1XQ4A 4KQ4H 1W0VB 5EZOH 1FRBA 2Z34A 2OU4A 2P5ED 3T6VA 1X4YA 5IV2A 1IAKB 2Y2YA 1Y0LA 2O55A 5CAHA 5E1HB 1B88A 1DYZA 4NO0D 2WCGA 1HCYA 1KIQA 4RETB 3T2PA 5C0CA 1HJQA 4BS0A 1K8CA 2N7AA 3GSNH 4NO5B 1FH9A 1AYRA 4NZCA 3RX2A 3MRRA 2O7SA 3D18B 4AENA 3NTCH 4YHPA 5HDLA 4R2GB 5DHEA 5H2ZA 3H9YA 5E8DL 4LE8A 2C2WA 4NYLB 2WYSA 4PTVA 1ADDA 1U21A 4PH6A 2CIKA 4GG9A 3UZQA 3B8DA 1NGZB 1T4KB 4JGUA 4I9WE 3NPZB 3W9EB 1N55A 2M8XA 5F6HI 5KSAD 5THXA 1I8KA 1BQHG 1LILA 3F83A 1FNSL 1TQCC 3VR6A 4DK6A 4Z8FH 1PFCA 1QSFA 3D1MC 4H9ZA 4IOSA 1SMAA 2VITA 3BGFB 2SFPA 3LRKA 4HCRA 1AOZA 3S8FB 2WMHA 4IKKA 4TMBA 2VOTA 1UYWL 5LCVA 2XTJC 3C9NA 2AQOA 2VLRA 1Q81D 2X42A 4CADA 1TJ0A 3GDMA 1K6QL 4QD2E 3PJUA 3MRFB 2UBPC 4Y16C 3DVGA 1EDTA 2F0CA 1HP4A 1I1AB 5FJIA 4NAEA 2YAEA 3RKDD 1OC7A 1YY8A 1MWAL 4X50A 3OGRA 4MZYA 4P9HH 2NV2A 4HHGA 4IP4A 3HB9A 4HV8B 4Z2KA 3IPFA 4NCDA 4GKOA 1KRMA 5FK9B 5I8CB 2Y07L 1A0CA 2ZZ6A 4YXGA 1JJKA 3ZL4H 4PB9H 1JWMB 3HC4L 3BZFB 2PDCA 2GC7C 4JQIL 5AZUA 4PB5A 1QSFB 4A1RA 3H7LA 1RHFA 3GSWB 4DAGL 1WOOA 4NO2A 4X4YB 3VI4A 4CGTA 4NQCB 1RY7B 3QRLA 2NQ9A 2YD9A 1NGZA 1T4KA 2XTJE 5CSBA 3S3SA 1V51A 1OARL 1Z9OA 3APYA 1TVLA 3ZHFA 2DJ4A 1ORSB 4E3VA 1T1WB 1KN2L 3QIWB 4ZNEA 5KVFH 4UINH 3G6EB 1Z6KA 4GQNA 4PY7B 3MACL 5ESVB 3MMDA 4ZTOH 1IXPA 3MRRB 1QO5A 2C5HA 1ULVA 2E86A 3GMOA 2A6KB 4KDVA 3WLBB 2Y1ZA 2MCMA 2R1WB 3OX8A 4UOQA 5C0DB 2JIWA 3FY1A 2ANUA 4AM0A 5CUSL 1EZVY 2INZA 5A6JA 2ILLA 1UXWA 3HMWL 5ISZE 1TX0A 2BO0A 5GISH 1NOUA 4QHNB 2J7LA 4YL2A 4ORGA 5SWQA 4WO4B 2UZ9A 3WXMA 4HH9B 4LUSB 1E1EA 4M6UA 3JV0A 3KPPA 3O3BB 3O8XA 2DZBA 1V93A 2B3IA 1TU2A 2CHDA 5F0PB 4AMCA 3CV7A 2Q76A 4CU6A 1QATA 2VFGA 2CHNA 5KSAA 4RFOH 4NKOA 1DWAM 4BM7A 4MADA 4WV1B 1SN5A 1KENL 2CBOA 1XQBA 2P44B 1IIHA 3NM1A 1MCIA 1RUPL 4GC3A 3TR2A 4XNAA 2A3AA 4LDLB 3Q9PA 2JB6A 4YDIH 5DDHA 1BYDA 1AQ0A 4I77L 4M9PA 4CW1A 3APDA 1TDQA 3LX9A 4TN9A 5D5MF 4Z5RB 4IG2A 5M95B 2I5IA 3UBFA 1UM5L 3TEUA 3E8VA 4E68A 3MV9E 1HVQA 4NPYA 2O6CA 4NN6C 1KCZA 1AZVA 1PD1A 3OHXA 1ZGDA 2PDXA 3IK4A 4AZ5A 1YNLL 3WUFA 3W4RA 1E6NA 1P1ZB 3AUVA 2C1IA 4HUKB 1M7IA 1OAYL 3QORC 2G9HB 2YBRA 4X8IA 3EWUA 1OF6A 3BH8B 2ERJB 2NDGA 3B1UA 3NIFE 2DQDL 2NQ3A 4JB9H 4LBZA 5DXWA 4ZFZB 2G37A 3M16A 4OFCA 4ZW6A 1C3FA 4XO6A 1Q6DA 2FQIA 2F19L 5TAOA 1AQDA 3CCHB 3DGGB 4KHTH 3ABMB 4HUUA 3NJ3A 2PIAA 1DBKL 4JE0A 3V0FA 5J11B 3ARBC 4OLZH 5FYLD 3RMJA 2DQHL 5D1QC 5JXEC 2AGKA 2R1LA 1WAUA 3TO2B 3WQ8A 3MJ8B 2I9TA 5EF0A 4F7PA 1RUSA 1XG3A 5DMJB 4Z0SA 4EIVA 1U3HA 5IB4A 1XHGA 3F2LA 5HHOD 2O4EA 3FRPG 1A7RL 1RZKC 1PQZB 3DV6B 3NDYE 4YGVA 5TFSL 1IWAA 2DUAA 1BGAA 4MAUH 1T5WA 3IN2A 5LB1A 3L9YA 2OEMA 4CNNA 4Z7WA 2AK1L 3STLA 3BV4A 3AREA 4JW3A 3GSVA 4JPVH 3F2DA 2HJFA 5EUOB 4L4TB 5C6WH 5DJXA 1TJHL 3VFVA 3L3OA 2PF8A 5F4OA 2FVMA 3NJFA 4F7TA 4PCNA 4FZEL 3AVWA 3BPNB 3V52L 3FNKA 3HZMB 4GEJA 2CUMA 4RMBA 4J35A 4G80A 5FACA 5I5JA 2HK0A 2VC2L 5HI3D 3BVWA 3D3VB 3N0PB 4HEME 4L5FH 4GP5B 3GMQB 4MS8D 4R4BB 4WFGE 3S5ZA 2VXUL 1MCPL 5LQBH 2VZ3A 4LHJB 3UADA 1EHXA 2O1AA 1GOQA 1V6XA 5CWSA 4YZWA 5B22A 4YE4H 1B4JL 3BKCH 4FTVA 4M0LA 3QXAA 3C5JB 2IGFH 4BWUA 5IFHH 3OZVA 3X2QB 1BA9A 3HPLA 1QX4A 3H24A 1E6JH 1EHNA 4QRSA 5KG9B 3U4EB 2R4RL 4PI0A 2V6HA 3UH8A 1A02N 4KCVA 2FYVA 2X28A 4V1DA 2TSAA 3UG4A 4F91B 1T1ZA 3CGTA 3SDOA 1T3FA 2NNXA 3P27A 1WCQA 3H2AA 2VN6A 2WSDA 1H6EA 3RILA 2JF6A 1RZJC 4L8DA 2X4OA 1A14H 1TSRA 1AS7A 2GITA 2PGRA 5GZOC 3CCRB 2WV3A 3ZTNH 1HXJA 4DQAA 5HMEA 3CC5A 2BG5A 2D31A 1FVDA 5FW8A 5BU6A 2XIQA 3HFTA 4MD4A 4RMVA 2V5DA 3HFML 2ZRXA 1OPGL 1J5TA 2AXWA 1S7SA 4LP8A 4ZS7L 2Q6WA 4W85A 3S2MA 4B53A 1EJUC 1ZRUA 3N15A 1EA9C 2R91A 2WZIA 2ZUTA 4LPCA 1JRCA 1A7PL 1ONRA 1A5AA 1AS6A 2GJRA 3ATEA 4OZHB 4Z7WE 3PC0A 4MMZB 2XWBA 3FB7B 2B8OT 3GMPA 1WBYA 3K6NA 4HQQL 4KAQH 4LPYA 3NUKA 1D5BA 4Y5XA 1HKLL 4NQDA 5HD8D 3ZZSA 3FT9A 3NGBB 3GUTA 4O1FA 4UTWA 4G9FE 4PREB 4JG0L 2ZOKA 2ZOWA 3VMFA 2IF7A 2EQDA 3GQBA 2VXSH 5G4OA 5CBAA 2GVGA 1PKQA 3PJSA 2C3XA 5BXFA 3T78A 4GQ9H 3PN8A 2NYYC 5K93A 1F4XL 3SOBH 5F4SA 2WLIA 3MCKA 4PP1D 1FO0L 5L9DL 3K13A 4PUNA 4BZ2L 5H37A 1LL7A 6CGTA 3F7VA 1FNEA 4W9CC 3TYGH 3ZE0E 4XODA 3DK2A 1AE6L 1S4IA 4LIQH 4PJ7E 3QEQE 1G7QB 3ULSB 4FJ6A 4NZJA 3O2WH 1EBHA 2WPBA 2NY5C 1NBZB 3AT9A 1EEUA 1R3LA 3GJFB 1FNFA 2OMWA 3OPUA 4GUCA 4LCCA 4LVHB 1DFBL 5JIPA 1AG1O 3G5XB 3PABB 2PP9A 4YBQD 4DXKA 1KV5A 3TGXA 1D7FA 4PJHB 4LKXA 4ODXA 1O60A 1U2YA 4J3ZA 4RD4A 3WLKX 4Q58C 3CLEL 1N67A 1G0XA 3DI3B 1UT2A 3A67H 3EGDB 3IF1B 5DJCB 5FM8A 2XV3A 4GRLD 3VFUB 2IBBA 3LS9A 4BSJA 3GR4A 4AD3A 4DAGH 1DLFL 3FUNA 4YHYC 3E12A 2W07A 4FP8L 4K9EH 1XGUB 3JTTA 4L4VE 1WOSA 4HUNB 5DHVA 3ZYOA 3O0LA 1ES0A 2VDRH 3MV01 4KPHL 4XHQA 3UZEA 1W17A 5ICZB 3ITXA 3MA8A 4UZFA 1OFBA 2NT1A 1E64A 4XP9H 1L9RA 1SPQA 3PUUA 4LY4A 3PWNB 1BJMA 1FKXA 4N1EA 2QUMA 1AI1H 4GQRA 4LPVA 4ZGNB 2JFCA 2NRDA 1FWFC 3INOA 4GAJL 4ZMWA 5JIMA 4F8LA 4AKQA 1C90A 3EPOA 4Y8EA 2CMRH 1MCWM 4Y4HD 5I3FA 2AKRB 4CQAA 5DFTA 1WK0A 1ZJBA 3URAA 3QUZD 1CI3M 1IBBA 2IBZY 5SX4H 1I2OA 4GLRI 3FV9A 3GJFH 1NPUA 4I89A 2ATKB 3UAJD 2I5GA 3G1RA 4G1EB 1L7TH 3QNXB 3CMOH 4NNYB 3KPRD 2VDGA 5IB5B 3BRGC 3B3DA 1OGGA 5A6SA 1Q1JL 1H1NA 4CCZA 3VA6A 5U7SA 2IAMD 1U91A 4Z23A 3BLOA 4PJBA 4XWGL 3TJPA 3WBKA 1YNKL 1JHKH 2H2SD 3F3HA 5E00B 3NO1A 3O41A 4ILDA 1HILA 4XGZB 4LSUH 3RVVD 3O9WA 5I1LB 4Z7QF 2VDIA 2XNJA 3LZQA 3W7JA 4OLUH 1TLMA 1BBJA 2F7FA 3NDZA 2F8OA 1EOMA 4MA3A 5I5MA 2XSAA 3GTIA 4HPXA 1TA3B 4ZA0A 4F4RA 4QXVA 2OMZB 1JZ6A 1K2DA 3W01A 4XXDA 1CB4A 4YDIL 2PGWA 4FD0A 4A38A 1CF1A 4J2XA 4ZBJA 3KCPA 3GIRA 4FG6C 3G08A 1DHKA 1E1FA 2WVTA 3R94A 2FQGA 4G56A 2XWTB 3EJZC 5FEWA 1YYCA 2PXYB 3A4AA 4Y5VB 5TE7H 1YW1A 3QHZH 4JFFA 1I0BA 1HEZB 4LLMB 1I8UA 5F93C 1EHLH 4HS8H 2YFOA 4FABL 3KRZA 3MMWA 3VGDA 4OZFH 5L2JB 2UWEB 5BXTA 3BVJA 4NNXA 1HYRC 3EFDL 3KPSD 1QFOA 3VXRB 4F7CB 1ZBKA 2WGNB 2Z4QB 2EHHA 1H50A 3E6EA 3A3HA 3G6JA 1C5BL 3HBLA 3QWRA 3QG6A 4AU0A 3NRFA 4WY7H 3TNOA 1L6ZA 2ZWZA 1HI6A 3KH3A 5CBEA 1F3JB 1TO4A 1OG0A 2DQFB 2GWGA 2ZAGA 3AGWA 3GHUA 4M1KA 3ONYA 5EH1A 4W9EC 4L4TE 4MTMA 4XNFA 3UABA 5KYUB 4ODHH 4Z3FA 3KS0J 3DKHA 3DTUB 4PCFA 3L3IB 2WAQA 1UQSB 2VLRE 2OZ0A 3CEUA 5AC5A 2MQGA 2GJ6D 2Y6SD 3P77B 1YEWA 2R23A 3QJTB 4NUGH 2Z31D 3LQZB 1A66A 4B3GA 4PD4J 1W5MA 2YXOA 4UFIA 3MFGB 2X4NA 3B37A 4KXDA 3CLMA 2HVNA 2AXHA 2XWCA 3H42H 3CCQB 3ILPA 4KZ0A 4OCSH 5A89A 1HKWA 2PDHA 1OIFA 2QQ6A 4N8UA 1XIWB 5I73C 4NERA 4PTNA 5DLLA 2AJUL 4NAJA 1YHTA 4P7QA 3WE1A 2NY2B 1R3IL 4XPGH 3HIJA 1OK4A 2H26B 2WKLA 1HN1A 2KI6A 1BZ8A 3TKFA 3O4LB 5AVRB 4QQ3A 2EPLX 3SUTA 2Y22A 1OXYA 2CJUL 3D07A 3RB5A 4G7RB 1XLIA 4Q4PA 4HVXA 4OCWL 5KSVA 2DZAA 1XAUA 1FAKT 1FYHB 3WE6A 4AYMC 5HUOA 3CU1A 4ODSL 1QFHA 5JBFA 3ALWA 4OB5H 3EGJA 1PSCA 1FPTL 5TK2A 1KN4L 2XBDA 4WUUA 3UTSB 5GV8A 3L81A 4NHCL 1ROWA 2UV3A 2OZ8A 4DGUA 3RYMA 2F7QA 1QHPA 1KACB 2DWDB 4YSDA 4AQ8A 4DP5X 4ZAKB 1U3NA 2BW5A 1J9TA 4FNTA 1XR2A 1HFBA 3KPMA 3PXLA 5C0FB 3GU9A 3G6JF 3RVVC 3KYNB 1OF2B 4KKCC 4FFYA 5DYFA 1DTNA 4MKNA 1Y5XA 5JIQA 4X5WA 5E6ZA 5I1HL 4ZFMA 1KD0A 4X0CA 2Y07H 3EA1A 5DUBA 1PZ2A 4H4NA 3ZBTA 1L6FA 2GYSA 5I0YA 2HLFD 1R5IA 5T5NG 4YAQA 1HZYA 2WIIB 2M5SA 2Z7WA 5GJTH 1TPDA 3BLDA 4V1YA 2WSYA 3GEWB 3C2RA 3WLTA 2EH8L 2Z7KA 3S2LA 1YJWB 1XH3A 5D6DA 3ZQXA 1JCNA 3B8HA 3CH1B 3QO1A 5DMNA 4F20A 3AU0A 1EBGA 2W67A 2E0PA 1WHOA 4NJKA 2CR3A 5I09A 3AHVA 4TNEA 1P7QD 3MV8A 1YNTA 1IXNA 2WZPD 3TJIA 3UXKA 3EYUH 4JY4A 1QNRA 3C86A 4AVHA 1NFDE 1R47A 1KBKA 4JQVA 3TYFA 1KZQA 3GKFA 1MHPH 2XN9B 2Z35A 2VM9A 5T33L 2PKDA 1UZDA 2C3VA 4TVPD 4MSSA 4ES9A 3OPSA 3BD5A 1IM3D 5CN1A 3P3TA 5HHVH 1G6RL 3MC0A 4IEFA 2ADJA 1CZ8L 3A5VA 1RERA 4N9OB 4Y2WA 1NJID 2OVLA 4KFMA 3H9NA 4RISL 3CFJA 5BOOA 3V16A 5TV2A 4GVFA 1O75A 2EH7H 2PW1B 3WFEL 3WUWA 1GQNA 3AYRA 2YMTA 2OGYA 3OKXA 2Y7LA 1CD1B 3PNRB 1HESA 2ITDB 4MNQA 4NZTL 4AL8C 2QGEA 1MXSA 3G6LA 3WBWA 4QTIL 3GXDA 2Q7YA 4OP7A 2ZXDA 1UJ3C 1YG9A 4IJCA 3CZEA 4JTQA 1MCNA 4DNRB 4HB7A 1UBSA 3UR8A 4X98B 2A3EA 2H8ZA 5G2WA 2OJZH 4TUJB 3FU7A 4Z2IA 3S48A 4G82A 1JQVA 3WFHB 1DVFD 1IC7L 1I8IB 4PS4H 1G7HB 5BXRA 3LCLA 4O02H 2VXTL 3QUMH 2YSTA 4QOKA 4NDMB 3TC9A 2JKPA 3WJWA 3WLJA 4XX1G 3BUTA 4W6XB 1KCKA 4M6PA 3IV3A 4RFEA 3V55A 2IPUG 4WHTB 1CGWA 4MZRA 1VDGA 3NN8A 3O9WC 5CP7B 1XF0A 2CLFA 4MG4A 1V6WA 1W1IE 3VH8G 3C2EA 3FK4A 2HG0A 2BM3A 5DELA 4LB3A 2FL5B 1OCOB 3NIDB 5CHNB 3BVUA 4FNSA 1XCQA 5B80A 1R3HB 3RWHA 2WW8A 3N2CA 2V9RA 3W7IA 4CQBA 4DKEL 3QE5A 2OSLB 3ECVA 4LSDA 4AHOA 5H8MA 1S3HA 1KYUA 1TQBB 4KKSA 2BIOA 3G4SB 4YEJA 2BSSA 1PD0A 4RCXA 2YXVA 5FF4A 4QFMA 3HZVA 2WNKA 3MHZA 4BFIA 3QIBD 4EI6B 1UH3A 2EIMB 3REQA 3HR5A 4OCXH 1NFDF 5B1KA 4FHBD 2DSKA 1M04A 1NIEA 3U48A 1WS7A 5F7BA 1CO1A 3EYQD 4WU5B 4GRWF 4ZD3L 3PZGA 4GXMA 4X8CA 4U6XB 4TV3A 4I3RL 1VLYA 3EZJB 2VW7A 4LSUL 1M1SA 1YNPA 1YRRA 1PKMA 4D8AA 3P9LB 3EOTH 4E41E 1HKIA 4LIQE 4PJFB 1ADQH 1WDRA 3ISRA 2XNCA 3U2SB 1PEZA 4JTLA 4NJ9H 1SOKA 3TVMA 2QA4B 4IJ3C 4IS6A 5BMFH 1XYCA 4N0FA 3F03K 4RW5A 3H2EA 4YS1A 5KN5A 1T6YA 3GI8H 4K94C 4HUCA 1U3ZA 3KLLA 1QOQA 5AC8A 2ZE3A 4L0PB 2KPNA 2C1PA 3BKYL 4G3YL 4PGCB 4AQAA 4LFYA 2BS71 4JPWH 3G04B 1B30A 3KL0A 4F40A 3HC2A 4P23D 3MFFB 3VWJC 1JHTA 3CVIL 4GHRA 1RHHB 2MNJB 2OGJA 2JKTM 5EOCJ 5EN2A 1DVUA 3ZK0A 3LA4A 4MNLA 3W2NA 2YO3A 3WN6A 1ETJA 4C56E 2W0LA 3R5EA 4PUUA 4Q8BA 4IPJA 5IFHL 4KNUA 2P28B 2CK3A 2W38A 4PS3A 1ZGLA 1RMFH 1UQZA 2GK1A 4L3AA 1SUHA 4OFVA 2F54A 3CFIC 1OP5K 1ZNNA 4U1GB 5BXPA 5KANI 3KXFA 1QO3B 4DHLA 3FPPA 4DP6X 3BZEB 3OQ3B 2GIMA 3QH3B 1KFWA 4F2ME 1NKRA 1XDLA 2Z0IA 3C8NA 5LJYH 4HNOA 1U95A 1QNSA 1TJIH 2YBUA 4UM8A 2B1HH 4JVUA 1H6FA 2AJ3B 4X7CC 5DWPA 1ZS2A 4XHJC 3G0SA 4Y90A 1J1OH 2WOQA 1SO3A 4OGXL 5F0MB 4D6CA 1HJCA 2YD8A 3ULVD 4HJFA 4NZDA 2A6JA 5FUOL 2GTZB 4OHQA 3BLBA 5HATA 4ODTH 1F41A 3BZEA 4YL4A 4QS6A 3CHQA 2X1OA 3REWB 1TTGA 2X1IA 1XQLA 4A8NA 1INEL 4QHUA 4U1HB 5L4FA 3RMEA 3CVHA 3MODH 3HPSA 2RR3A 4RWYH 1OP3H 2YR3A 4O02B 3TJLA 1BX1A 3SADA 1F11B 1H0DA 1GOMA 2KZBA 2K6WA 2XFFA 2XTSA 4Q22A 3M88A 4BFOA 2CJUH 1NEZB 1V0MA 4C6OA 4NQVB 4Y7CA 3DMMC 4RSVA 1Z3NA 1AIFB 1UZ8A 4ZCWA 2M83A 4ONGL 4MNGB 5D7IA 1BOGB 1JHTB 1W72B 5L4IA 2VXSL 4UWMA 3P62A 1UCBH 4GI6A 3SDCD 3CNKA 4L4VA 4IRZL 1B3VA 4OW6A 3A4JA 2A79A 4MAYA 2O5YL 4Y8DC 2PMZA 5I1CH 1NFIB 2X6YA 2X53A 3NMEA 2YD2A 3T77B 1G1CA 1INDL 3MMEA 3TYGL 3C5XA 5HVHC 1UWAA 1XUZA 3QS3A 2UZXB 1V02A 3UZWA 4DZ8B 4M6MH 2YUVA 2ZD0A 2W61A 3TO4D 3OPOA 4PV8A 4K2UH 4US6A 3U2SA 5I9QC 3WTYA 1FWDC 3MRQA 3M0ZA 2DW5A 2HT2D 2PP8A 3RM9A 4AZHA 3GHSA 4ZMGA 5KZEA 4CILA 4ENEC 5E6ID 5LGKA 4YR6A 2EVJA 2EXYC 5GISL 5HGDA 4YK4C 4TNVK 1K3IA 3ARDD 1RALA 2DM3A 3P4NA 2OYMA 4G8GB 4G8IA 5EZIH 3R13A 5CJXA 3F7RA 3OKMB 1AC6A 1CGVA 3P5YA 5A6TC 4ODVL 4POCA 1GZQB 3RNKB 1XEDA 4FQHB 4JQVC 1FFNB 4PTUA 2V38A 5AVNA 2QEZA 4P3YA 3PAVA 1D5IL 4K9EL 3AHZA 3L4CA 3WHE0 4BFIB 4FHAA 3CV6A 3OMAB 5HGGS 1VFAB 2V5TA 3N50A 3KVMA 1DQJB 3MP4A 5E5MB 4G8EA 4RFOL 3OYXA 4MYPA 2VDLB 4KNQA 1EQPA 3MU3A 5D6DC 4WEBH 3E6FA 4AWEA 3FTSA 2BMKA 4N0CC 3WN5C 4QOKE 1VR6A 1UW9A 5ESAB 5I0ZA 3RGVD 3DA0A 3UEQA 1JCVA 5ID0B 1VKXB 2AMXA 1RZ8A 4OF0A 2ZICA 4XH2A 2VEKA 4KITB 3GSUB 4JNZA 1U58B 1WUNT 4YQXL 4D8LA 5FYKH 4LAOA 4BXVA 3TJEL 3IUIA 1UP0A 3ME3A 3OMNB 4XLAA 3NL2A 1I8IA 4AV5A 1W5OA 5F6IC 3THAA 5D2XA 2DYPB 3PGDA 5CSSA 3ZN6A 2ZXBA 1NCIA 3PPGA 3CZGA 3WLIA 1JHKL 2A4EA 5IROC 3FO2B 1UPMB 1KOAA 1S9VA 4RA3A 3W7KA 2ZUMA 1A6VH 1PKQE 3A9BA 3PWJA 1EXMA 2FB3A 4LCRA 4LEXL 4LVFA 3EWXA 3OL2A 3DARA 4L29B 2BVUA 4GH7B 3PAOA 2N4IA 1X6LA 2DQHH 4WNQA 5MEND 3CJPA 1GYLA 1W1YA 2AAVA 5KVEE 2WO5A 3Q6QA 3IS1X 1ACYL 2A83B 2YB4A 1TIMA 2C1OB 4Y9OA 2W80C 1RZKH 1TWZA 3IVKB 2VX5A 3WFLA 4B5WA 3AMDA 1ELSA 3ARBD 4MJJA 1XGQB 5KSAC 5FL7A 3CS2A 4QI3A 2C3VB 3FFDB 1C16B 5EO1A 4MXWH 3LEXA 1I7TA 5JXAH 2ZP8A 1BG1A 1FLTX 4PMNA 1KQSB 4RAHA 3BSMA 2ZTNA 3GMNB 5IQ7H 4M7JH 1N8IA 2OO6A 5HDRA 2XA3A 4KO9A 1GHRA 4UAHA 4GP8B 5JPMB 3FTYA 4O17A 1HAUA 1NBCA 4OSUH 1PLGL 1Z7AA 3AIVA 3R1ZA 4UTMA 2LLGA 5CG7A 2QV5A 2YC1A 3SJPA 5A88A 1EK3A 2QMUA 2FBOJ 2QKFA 5E1GA 3WD5L 1E9YB 4U1KB 3SO5A 3FQNA 3AIUA 1R17A 1G7LA 2E7BA 4OJFL 1ZVHA 2X9YA 3FH5A 3QDMA 5C9JB 4MTVA 5DBTA 1FRGH 2WIIA 4KZEH 4QNWA 3T8XB 1G9NH 4L05A 4F2EA 2HKAA 3CXCB 3FHAA 4WTXA 1IEAA 3CBKB 4WU7B 5CILL 4XN8A 1Q3NA 3ECBB 5EC2B 4US5D 2VR4A 4HUXB 3WNCA 3ARDB 1YC7A 5JQHC 1XIJA 3A9IA 1AH3A 1CLOL 4ZODA 3OQ8A 3WY3A 1S2CA 1BZ9B 3CLWA 1BPVA 1F6AA 4HEMA 2Y88A 4MA1C 1U6AL 5L2KB 2YXXA 4WOZA 2Y3NA 2P3EA 2ZUSA 3BFOA 3T71A 3KUMA 4I5BB 5EA0H 1DIDA 3SPIA 5A8GA 3ARUA 2D2GA 5AL0A 2HK1A 2BJMH 4ZO6A 2OMBA 3TBYB 3A8JA 1NSJA 1EEYA 3BSHA 2X8KA 1DLHB 3PUMA 2IS7A 3ZL4L 3F5KA 2OAAA 2YA0A 1YLOA 4DP1X 1S7UA 4KZDL 4A63A 2CLRA 4JPWL 4PGOA 5JTWA 3NA9H 4YDVA 4IPNB 4R88A 5FECB 2J7EA 4Z1BA 1TETL 1E4MM 4NF7A 2XWRA 1NFAA 4I4WB 1YMMD 2XFWA 3AVEA 2ZDRA 3K5XA 4PLKC 4X5XA 3QY7A 4Y16A 3MUGA 4C6JA 2VN5A 5E8EB 4BCXA 1Q6GA 4DBUA 1A9BA 2ZCKH 4NHCH 1TPVA 3QE2A 4HIEB 3VXMB 1XFBA 3ZTEA 5G2IA 3IJYB 4JE4B 3V7PA 4NQDD 5CPQA 1QBBA 5E2UL 1MUWA 2VVNA 3BUDA 1US0A 2YRBA 1AL8A 4R8WL 1TELA 1QEWA 3QDGA 1QW8A 3TPUA 1F4XH 2XI9A 2VZUA 3SOBL 1P4IH 3DC0A 5CF3A 4B9GA 5L2KE 5DD3H 3QP3A 1Y8BA 4O57A 2G4EA 4W7UA 4MAYC 3AM8C 5MI0C 3DDMA 4D6FA 3N85H 3AI0A 3GXFA 3ASTA 5AYTA 4Z3HA 3EAUA 3ULUD 4Z95L 1KBIA 3GBDA 4YFLF 3ANVA 3QZMA 3C5SB 5K9JH 2I1OA 5GVJA 1SKYB 1RULH 4XNYL 2LABA 4WCJA 3VI3E 1WORA 5CEYB 4I18C 4IIEA 4P2NA 4AEOA 5JPNC 4JRYA 2NCEA 5TF1L 4LAQL 3JWDL 3HKZA 3A4EA 2XG4B 4N6RB 5DGRA 1RP9A 1JCTA 1F58H 3ARFB 3EHBD 3BGMA 3DFPA 4ONGH 2JNZA 4JFFB 3FSUA 1MHPL 1FFOB 1R85A 4JM2B 2ZZGA 4IK7A 3HGOA 4A7UA 4IL2A 4HCRL 4K0OA 2OMXA 2X0YA 5FDYA 2VBUA 3RHWF 4ZMAT 3MRGA 3LH8A 3LZOA 1GZGA 2J6EA 3QF0A 2VUOA 3EX1A 2FIKA 2BW4A 2WXLA 1KJVA 3MRDA 4RISH 1A80A 4PUJA 3U1QA 1CVRA 1TUIA 1AI1L 1G5GA 3CJJA 3LKNA 4M7KL 3UIYA 2R83A 3CPLB 3ZDYF 2J7BA 3CV2A 1OTSC 4PMUA 1NOFA 3ABLB 3OKNB 4NZTH 4UQDA 1K4GA 4LBEA 2GGEA 3AWFA 2XH2A 1FOBA 5IHWA 2OQJA 2WB7A 3BDXA 2LLLA 1X7SA 4MS6A 3AHXA 4XQFA 3O9WB 3RLGA 2W9EL 2G5WA 1HHKB 2R56H 4Z3IA 3EGSB 1EXGA 3ITYA 1GGCH 2R8WA 2X0HA 5BYWA 2QKIC 4PJBB 1MLBA 4GKZA 4L6HA 3G5VB 3MUCA 4WEVX 4JFEE 4JZJA 5KBKA 1S5VA 5D2VA 4X9HA 3D51A 1JPFB 2WCAA 3C5ZB 1I3UA 3W1XA 2Z31A 2NY4C 4Q9QL 5C08A 4WZKA 1U93A 5DVMA 2NXGA 4K55A 4EK7A 3MA9L 1YBQB 4XBSA 3W87A 3GINA 3TT3L 1VJIA 2J55A 3LNGA 3AUOA 3MYZA 3FW6A 3I74A 5DZLA 1U83A 3RLHA 4WI0B 1FWGC 5E24E 4FQIL 2NY5L 2BSBA 1OAUL 2DKSA 3QJFA 4TSBH 5AZ1A 4PLKD 1QAWA 2E9LA 2VCBA 1AIFA 1UZ8B 2WUBH 5A16B 5AZEL 3ZRFC 3QZBA 5DQ9A 5EU9A 3BQ6A 5AYXA 3GY1A 3RLVA 3HVDA 2HG5A 3ZJAA 1DWGM 4QJ3B 1RZGA 4D0BB 3NFSH 4WNJA 4OZGA 1IGTA 1IIIA 4XMXA 1F11A 1H0DB 4P2QD 4PYHA 4WW2F 5CS7A 5D7LA 1TJGL 3DX3A 4JO3H 5L2KD 4O1CA 4QRAA 4PMOA 6REQA 5I3GA 5D7JC 1SJXA 3WKQA 5E2VH 5EOCL 3E3HA 1DVFB 12E8H 1I9JL 3KLKA 2A9ML 3QIWC 1HC1A 5T1KA 2A6JB 1ISWA 2BNQA 5KZCD 1IBFA 1M57B 5E09A 2P3ZA 2YWEA 1TPB1 3BQUB 3QRBA 4ZD3H 3TONA 4HTBA 3VCRA 3NCFB 4XP1H 1WKEA 4NS0A 3B0PA 4CQ8A 1W5PA 2JGYA 2WQAA 5E2WL 5H37G 3S6TA 3NIFF 2GWNA 3UXDA 3BAWA 4UM9A 3KXFE 3WQOA 2N0KA 4LGSB 1BYCA 3PUDA 3A6CH 4WZLA 4NRRA 4UMAA 5T8GA 4AZ8B 3CIXA 4O4WA 2XJ7A 2WBJD 1FCGA 3DG6A 1FNEB 4PJDB 3APGA 4MUZA 1JV2A 4QUZA 4DGWC 4B4DA 3NG5A 4PV9B 3SE3C 5IOBA 3M1BA 3OVPA 3MX0A 3LSBA 2Y5TA 7CGTA 4NUGL 5DI8A 3PCYA 3V0SA 4C1NB 5GGSY 3D50A 5FM4A 3RFRA 5EA9A 1C9WA 3BEVA 3UVIA 5AAWC 3X3FL 3G04A 3TU9A 1N26A 1TLKA 3KYAA 4P59L 1EF3A 3C5QA 1KM3A 2JJWA 3CDCA 3KYOA 4I9WD 4FHKA 4Y7EA 2QF7A 1U2CA 4YWSA 3U7WL 5JHLL 1RMFL 2YJLA 2B5IC 4LCVA 3PZVA 3WD5H 3C5ZA 3IFPA 1TJ1A 3CU2A 2CUAA 1IQWH 3PXJA 2X4RB 1VQ9B 4AEHL 5JO5A 4YHLL 4OB5L 1A3HA 2OR2A 4DNHA 6XIAA 1QVOA 3S88L 5IMOA 4MWAE 3DFHA 5ABHA 4TMZA 5D1XB 1E67A 1HCZA 3QARA 4N2OA 2VENA 1EWYA 1DANT 5DRNA 5C8JB 5DVKA 1JYNA 4R6UA 2X4OB 2XM2A 3R6JA 1W6LA 4ECLA 1QI3A 4Q9BA 1GZPA 4EXKA 4MCZB 2WB5A 3JUGA 1T3FB 4DQLA 2OR7A 2ZYSA 1KJVB 4RDBA 2E75C 4QMEA 4UT7L 5GRJL 4F2MB 1E51A 4PJBF 3QHTC 3LTSA 3MA7A 1AMXA 2V82A 4MKSA 4DP0X 3CT7A 1YE4A 4HQVA 4KS0A 4MMWA 1BAWA 2OMUA 4KTYA 2GPJA 2NY3D 2QNEA 4GIAA 4PJCE 3TBTA 2IOMA 2ZZ4A 3LSCA 4U1SA 3WF2A 2YK1H 3ML8A 1RA5A 4MXVF 4WWVA 3NPXA 2YAQA 5DUJA 1EOKA 2LOEA 4ISVA 4DETA 3GVGA 4K8EA 4WHTA 4RJLA 1Z9LA 1FFQA 4QYOA 5DJ6B 1E71M 1WV7T 2XWEA 2DZVA 1PCWA 4AF0B 2QULA 1RFDL 2FHBA 3R18A 3RWDA 4DF9A 2PDQA 1KQYA 4R2GC 3VM7A 2PC4A 2NTFA 5RUBA 3KLAA 4K2UL 2JCCE 4O4YL 1UMLA 5FA4B 3GB7B 5DS8B 4ZMZA 4Q6JA 4BD4A 3QXUA 1OSZA 3GHEL 4KK8D 4JQ3A 4Q7NA 1WEJL 4M56A 4GPNA 4F7PB 3FQXB 3QDGB 4FA7B 2D22A 2Z1BA 1CCZA 1TQWA 3WEZA 3S9ZA 4H7ZA 2P8MB 4DUVA 2J5LB 4XLHA 3CLFH 3JZ7A 4XB7A 1PZDA 1YHPA 3HE6B 3JU2A 4H3DA 2JCWA 1BMWA 4F57L 3OE7A 3AICA 1O95A 3LZ5A 3FC8A 2EJAA 1M7DA 4X8XA 4CBZA 5IJVA 1F86A 1G01A 4IEFB 1CWVA 2NLIA 2PU0A 3N11A 4LLWA 1XLDA 1CS6A 2ZL6A 5JHBA 1V77A 3MHPA 4QNPF 2V7TA 2A6IB 3TO4B 5EF2A 1X8FA 1ZFJA 3CC2B 2WWKT 2BOEX 3H7VA 3KHJA 1XIGA 3TQKA 5F9WC 3ZUGA 1T0MB 3HLAA 1NLBL 2A9NH 4WRLA 3TR9A 3MUUA 3P73B 3FKUS 5DJYB 2YYUA 4AIZB 3EKGA 3GNRA 4JIHA 4RDZA 4JKWA 3B8VA 3OKYA 4EIGB 4EDWH 4Z5RA 4S38A 1AH1A 4QGYA 2NY4B 1GTEA 1JGVH 5CPMA 4JRLA 1MJ8H 1S7TA 4DLMA 1I8LC 2BNRD 4QLLA 1ZT7A 4UT9L 3KJ4C 4HBQA 1BQHA 3CQFA 5FA6A 5I6NA 3V79C 5MHBA 1C29A 3EZ8A 1Y18B 1DQQB 3ETSA 3B4UA 2DLTA 4XP6H 2HRPL 4DUXA 2O6EA 2Z64C 4NM4L 2OBSA 5KSAB 1T99A 3W3OA 2ZC1A 1DDTA 2B15A 1KCRL 1O7DE 3G6AA 3UC0L 3PNZA 4GFIA 2ADIA 3S3BB 4YVVA 5TDOA 1E9LA 4XN4A 2DIAA 4KKXA 3BZGA 3ARVA 5M5DA 3OGOE 3FB6A 5G2HA 1XGTB 1UP2A 2YCIX 5AW4B 1ACYH 4HZ7A 1KCXA 1LQ2A 4QDMA 2PZ0A 2XG9A 3CP2A 4MQSB 2CM6A 5CJNA 3BLPX 3GD6A 3KL5A 2XFRA 2BOLA 2FJHA 3N4EA 1ZHKA 4B27A 1HKKA 3Q44A 4I0PB 4I5UA 3KAOA 3UYRH 2FJFA 4XPAH 2PR4L 4N2CA 2EDYA 3QH2A 4FCHA 2A6LA 1PLGH 1PS9A 1K02A 2HWGA 1QI2A 2VR6A 2C1OA 3L2LA 3O6DA 3LKQB 1TKWB 1IILE 1J0JA 1KGIA 2HS8A 2PS2A 5IQNA 2DAVA 4WW1B 4A6GA 4H7VA 1DP0A 5IW1B 3MYJA 1HT6A 3O1NA 2ZX9A 4WZEA 4ODSH 4PLOB 3U7BA 3R0NA 4LYPA 1JWMA 2IBGA 2IG2H 1NBQA 3L3IA 3IGAA 5L8LB 1NARA 1GQKA 4Q56A 2CLPA 1B57A 1ZLUK 5C0JB 2MKWA 4FQJL 1ITBB 2R1PA 5CH9A 2F15A 2KPWA 2YWGA 4XL9A 2VCOA 3D87B 1I9CB 3HJZA 1HA3A 2QV2A 3NFNA 3KYMB 4EPKA 3AAZB 3SDXA 1G4PA 5GHWL 1D6VH 2NV9A 2Q8AH 3WH5A 4FA3A 3Q8FA 5DY3A 3CCSB 1IKFH 5GRYA 4A2HA 3PREA 2O61A 1IBDA 3TJXA 3L1OL 3LRSA 3ZKND 5J11C 3U9UA 2BNRA 1N05A 3LRLA 1A1MB 5TQ0H 3N6YA 1L5GA 3B7UX 5SV4A 5ID0A 1KFJA 2GFTA 3VA8A 3R6KA 1Q8AA 1MFCH 3E6FB 3UFIA 3GSNL 3WTWA 4PRPD 4DBSA 2MJWA 3BSZA 2BDQA 2X2JA 5DS2A 5JW4R 3T6QC 2PWEA 3CBWA 1E9QA 2EUZA 1WHPA 1NAKL 1SY6L 1G0DA 3LQAC 1CB2A 2JIXB 2RCSL 4GGHA 3G08B 2UY4A 1X3DA 4PLNC 3VI2A 4YXWA 1CDCA 3WXWL 2GCYA 2WXFA 2ZKHH 4PG9A 5KVGL 5CMAA 2HVKA 5EOTB 4Y4FA 2DEXX 3LV3B 4R5XA 5F72S 3SEPA 3U0HA 3MANA 1OBAA 4NO5A 5A7EA 2CWXA 2V5JA 2DMGA 4GQZA 1B23P 4DO5A 4IRZH 1NB9A 2QDGA 4N90E 5TQ2L 2UZIH 3QFSA 4EF9A 3L1FA 3QXDB 4BQ8A 4F9PA 5I1CL 4PFHA 3ECUA 3WQCA 1HHJA 1FYTE 3NCOA 3BKMH 3F58L 5FIEA 2NX1A 4N2GA 4AQEA 2GSJA 3FH7A 3MRQB 5L7XL 4HU0A 3U5YA 3UT0A 4JFYA 2BVOB 3SDCC 1UZ6E 1MDRA 1Q6EA 4G1MA 1EZSA 4TUOA 1KRBC 3KM8A 2EDKA 2NSXA 3B8YA 4AX3A 4K3DL 4JHWL 2V3FA 2R69L 3NABH 5K7JA 4Z7UA 4AEFA 5BW6A 4EEEA 3LS4L 2FR4B 4MNQD 4Y4FC 4L1XA 4NAFA 1CT8B 3BMXA 2PRHA 2AKRA 1G9MC 2WVVA 3UTTB 1M5WA 2VYQA 4RIRB 1IKNA 4LCUA 3RDTA 2GBUA 2P1YA 2HT2C 2LGNA 1COBA 2IDQA 4QWWD 1PYMA 4D0CB 1Y0EA 3MBXH 1DBJL 3L7RA 1OOAA 3WG6A 4FXGC 1WDAA 3HZYB 3F5JA 4C91A 1A3QA 5C0NC 3C6LB 2AK4B 2E4FA 3KWWA 1EGVA 1K7FA 2Z6IA 4RNFA 4CN1A 2OOGA 3RN6A 3ESPA 4FQQB 3UJIL 4B2DA 1NCDH 3CK5A 4UINL 3ZE0F 4UOJA 5AW0B 1M71B 5IBLD 3G9VA 4RDQG 5HP5A 5D1ZD 4NFCA 1SFHA 2AJXL 3W3BA 3JWNH 2FB4H 2XIDA 3RGTA 5K69A 3W2KA 4D1IA 2L0DA 4Q0XL 3V6ZA 5IY5B 1WOPA 3AMKA 1J6PA 3HLKA 4BPRA 1L6YA 4FQXC 2G41A 4L1BA 1IQDB 1PE1A 1YMHA 4M1DH 4PJHA 4PVLA 4ECNA 4JPGA 4UV4H 4MWFA 4W9HC 5F7YC 3RGVA 4HH8A 4NAQA 3IBEA 1MUCA 3F7PC 4GP4B 4RNRB 4GCAA 3N5AA 2CLLA 2OL3A 4NQUA 2XFXA 5F71A 2BSLA 4NIKB 4Z7WF 1QSVA 3IIVA 3D05A 4K7VA 2WO3B 3BEWA 3OSVA 2X2GA 1AMYA 2A3HA 3FVMA 2AP2A 1GJWA 2P5WA 1R3KB 2JQXA 4HCHA 1U8CA 1U8IB 2VL4A 4PJCF 4U1NA 3GMRB 1A6VL 4RVBA 4Y88A 3D39D 3QMSA 3UWEA 1T66D 3KEDA 3UCCA 1X5YA 1FGNH 1X44A 5FKAA 5BXFB 4GIOA 2YGYA 2V7WA 2FX9H 2PWHA 3VXSA 4DEFA 3FFCE 2EAWA 4OBSA 3ULUF 1HZKA 3T0EC 4PC3A 1I8MB 4JHMA 3WEXA 5TPWL 4JGDA 3LHYA 3NSCA 1FIGH 4Y4KA 4RZCB 6XIMA 4WKAA 4X07A 1PIIA 4RM0A 4FLOA 2VMDA 1Q6FA 3LMZA 3WDPP 2Y61A 4QDWA 1MWAB 2ZUUA 3FB7A 1I7UB 2HRGA 3RX5A 4GSDL 1OJXA 5EMNA 1QRND 3EJQA 2EYRB 1F9CA 3PTQA 1FRQA 4OZFA 3UP8A 3X17A 3BLLA 3AVXA 3ARBA 4PJGB 4Y19E 4LCQA 3TASA 4JKPL 1YI2B 2YBGA 3CFDB 3RDKA 3UJFA 4OY9A 4NNBA 1BCIA 3C12A 1DE6A 3QIUD 3DO4A 4OUUB 1KFCA 2O9TA 2H5UA 8XIAA 1DYSA 2WMPB 3C4UA 5HANA 8TIMA 3T8VA 3NIDE 2BSEA 1Z0MA 4JFTA 3TZVA 3HV8A 2BRRL 2J7CA 3W7EA 4K07A 1NPNA 1U3YA 4YEFA 3SUSA 1H11A 4Y1AE 3VX1A 5U4NA 3MRCB 1GYNA 1ME9A 3HQNA 3W1RA 3L5IA 3FUJA 5DEFA 2FATL 3DLQR 5MEPA 2DW6A 2VXQH 5KS9E 3WQ5A 4DYKA 1NCBH 1T80A 1UZ4A 4G6CA 3DX9A 4GPVA 4B9CA 2Z7YA 2V2TA 1L9WA 2LLEA 1KG0B 1W15A 3I7SA 2PPEA 4KMTH 4PWJA 4JG1L 5CHNA 2VDMH 1AGFA 5HBFA 2FFCA 5ILTL 3CIVA 2UZPA 4ES4A 2DKUA 5CP7A 1EIXA 3VKJA 5DTFB 1GCFA 2HTKC 3HJEA 4LOCA 1A2YA 1QWUA 1AKJD 2MKLC 1LEIB 4K7PH 4JN6A 4YSOA 5GS0H 4HYRA 2R2CA 4UMSA 3CCUB 3V7MA 1F2JA 1JTPA 3RWFB 4BF7A 4JHZA 2YDRA 3CN4A 5BQDA 4BI7A 2O72A 3QW9A 2FZ9A 5I16B 3ZJKA 4LRSA 4DY1A 2R1NA 1WBZA 1IFHL 3D39A 4AZIA 4UNIA 2MUCA 4JHBA 4GRMB 1KK2A 2DOGA 2BWDA 3BWAA 4RRPM 3RG1C 3U0PB 1KR1A 3WJYA 1D9EA 3NRQA 5K1JA 2YSSA 1UWFA 2CA3A 4PU2A 4JS3A 3ATFA 2Q7YB 1OWQA 4HULB 3BP7B 3DO7B 2JALA 4RW3A 4HD5A 5GSVB 4O51B 5DD5H 4D9QD 2HZGA 3CYVA 4OZGE 4WHYH 3SKNA 4UTJA 5T1DL 4OFYA 5KSBB 4XMUA 2QUNA 4P46C 1Q9WA 1AMKA 1VGAA 3CN0A 2V31A 2EEBA 2EAEA 2XZCL 2MOGA 3B7SA 3CCHA 1F00I 3EBAA 1W0YT 3QEUA 4HKJB 5CGYD 3SPVA 4ZBCA 1A7QL 1IKFL 3O4LE 4GS7C 2GY7B 3IWVA 1KJ2H 1T2QL 3QORA 4P4KB 3KGRA 4J3OF 4XNXL 5DK2B 5D72H 4P61A 3LXCA 2E56A 5E03A 4JGNA 4RLIA 4U5IA 1EMTH 1P1ZA 4MGGA 3N40F 4K7FA 4UQ3B 4NNJA 3O63A 2B9AA 4LMQI 3MLXL 3NVQA 1LUCA 1TNMA 1D5ZA 1AXTL 1D5IH 1BFOB 2WB1A 5CJ8A 2Z24A 5PCYA 5PAZA 4NPYB 5E7BA 2OPCA 4U0QB 2J66A 1OARH 4IRJD 5GSVA 1RQBA 4GNVA 1IC4L 1R3JB 2ITCA 3AY2A 2PO6D 4KHXL 1JPDX 3QO1B 4PY8I 1RIUH 4MY9A 4ZENA 2EADA 5ABTA 1JK8A 4AWJC 3U0PA 4K37A 1NDZA 4P2QA 4WHDA 5DDHB 1AO7A 2W81C 3FCUB 3PL6B 4XORA 3VOGA 2WHJA 1R5IB 2BDNL 1S8DB 1QACA 5AW9B 1CT5A 1VGEL 3M1CA 1FFPB 1EL3A 2I5QA 2X2HA 4PJCB 4B0MM 4EANA 2R4SL 4G7VH 5CUSH 1GJPA 3HNTL 4HA4A 4JQ2A 4ZQNA 4X5WB 5BV7H 3SAZA 1PDZA 2H3NB 2WXQA 2DWSA 1PBYA 4YHZL 1R3SA 2G3FA 1NICA 3A3XA 1LGVA 3MHFA 4RV3A 4OF6A 2CC0A 3SGZA 1UUNA 5DTFA 1HUVA 2MOQA 3L6FA 1MUJA 4KDTC 1FH5H 5ES4B 4LSRH 2QZRA 2QSCH 5EIQA 5EO0A 1IC5L 35C8L 1KB5A 3H3PH 1N8ZA 2R56L 4P23A 1IGJA 3QZOA 1PZ0A 1UXWB 4FULA 2QFPA 4F1SA 5HDOA 1MO0A 4NIYE 5EWIH 3GXPA 2W60A 1FHLA 2WWDA 1ISVA 3VI3F 1H3PL 3UPAA 2OWXA 3UCQA 5JBEA 3E6HA 4RAVB 1S3TC 3ABRA 4U0RC 1SLVA 3RG6A 3ZZTA 4E4FA 1JNLL 2OK8A 4LRNL 4PMFA 4JUSA 1AD1A 2A3BA 5LA2A 3EOOA 3A22A 3P67A 3PAJA 3LNNA 3NQIA 1HCFX 3P3RA 4FEIA 4TMPA 3QDME 3UPCA 2X70B 3UJSA 4WIWA 5BUPA 4W70A 3BOFA 4XP9L 2E6JA 3TBVA 1HIMH 3ILPB 1W3IA 5TRDA 3NFUA 4ZUTA 1KLGB 4E8GA 4R33A 4ABVA 3DTXB 1TMHA 2FECI 3X3GL 3ATYA 4POZC 4XCCL 3G1YA 1WYJA 4IHOB 2VDPH 2V37A 3F6IA 1MNSA 2VNJA 2IPKB 4L1GA 2XIOA 1IBYA 2V3DA 3IDIA 3V6OA 2X6MA 5AVUB 1FAIH 4DELA 1SLXA 4ACPA 4FA8A 3HBQA 1KEGH 4LBUA 4BEUA 1PB0A 1OEPA 1I9RH 4BJLA 4ZQCA 1U8MA 1WWCA 3QEQA 5CGYC 1CNVA 3HOJA 3WEXB 4Z42C 2QQKH 3FQ4A 1S78C 3MRFA 1I85A 3CSFA 3F7YB 2VNCA 2NDFA 1RZJL 2DQIH 5K59E 1R9FA 4YLWA 3S2NA 2GEQA 3QVQA 2M2DA 4ZUSB 3LXBA 4S23A 3SGEI 2QDXA 1QUFA 1P7KB 3MNWA 4FKHA 3JQRA 5AVVB 3V5HB 4QTHB 2Q09A 2HYMA 4P2YA 5FO2A 1KFLA 4OLUL 1OOWA 4D9LL 2NLJA 5LNGA 1W5NA 2JELH 2NQZA 1E4WL 2YCLB 3CWHA 3S5NA 1PZ1A 2K9FB 4AZ7A 1EXHA 1G7MB 5HULA 4BEQA 3N43F 4Y7OC 1Z44A 1EP3A 1TG7A 5FM5M 5A2IH 4PLJD 3KBPA 1CNFA 1IGIH 4AC9A 2YD7A 2IGLA 2OELA 6A3HA 1V7AA 4NLHA 4H41A 4LBSA 2NUYA 3EYOB 4PBFA 2DF3A 4AENB 2TMDA 1HSBA 1YNQA 4XR6A 1YEHH 3OAWA 3THUA 1T22B 3OIXA 3TCSA 4TL5A 2HKFH 4MA3B 3M0KA 3V5OA 9XIAA 4K3ZA 3KBEA 2I7OA 1K6WA 3SN6N 2IXUA 4P59H 3CFBA 4RJEA 4S1FA 3S1UA 4H0IA 3REVB 2BVPA 4JYEA 5J35A 4N9EA 3LKPA 2E6FA 6FABH 4MLRA 3MUZ1 4KI5E 3MBFA 4FQJH 1HEJC 5FW6A 5I75B 3D48R 2XZAL 3JVFC 4P57A 1U91B 4IGBC 4Q89A 1TZAA 2AK4A 1G7IA 3RR4A 1IQWL 3T42A 4KKNA 3VNJA 4R8WH 2PPCA 1A14L 4N68A 5F9OL 4LCWD 2CZFA 2CCLA 4JYFA 3BPCA 3WY4A 4KQ3L 2F08A 5E2TL 1OIMA 3UGVA 1AZ1A 3O6KL 4KVCH 1ZLDA 3MGTB 5EZLB 2OV0A 4J23A 3BJ91 1DQVA 2AJSH 3H42L 4W1TA 1SM3L 2NUTA 5K9JL 2OK0H 4XO7A 4YN5A 3SRDA 2NCMA 3KPSA 1KLUB 1I2NA 1IBGL 2BASA 3CCMB 3QYQA 1JGUL 2PN5A 4CJ0A 1YZZA 2L5HA 5DK3A 1I9IH 1FZOA 5LAXB 2PTVA 3HNSL 5TF1H 3GRWA 2CKSA 3TAOA 1VYRA 4Z7VB 2X85A 4H88L 2MQ0A 2DV0A 3N9RA 3ULAB 3FUEA 3Q2WA 2G4GA 1UTDA 4LT9A 1ACXA 5D2NB 1F56A 4PB0H 2IQAA 2RBLA 5E4AA 1T22A 3NIGF 1IAOB 2NSQA 5FAAA 4XZHA 4D9RE 3PGFL 3W2UA 3WYRA 4ZCIA 5I3IA 1MG3C 3PF2A 4Y4FB 3HI1A 1SW3A 1KGYE 3TVMC 1F0LA 1AR1D 2QGGA 3AS2A 4MX7B 4R3SB 4DFIA 1FO0H 4UNUA 3CP8A 4QHMA 2BINA 5HJXA 1R5VA 4KGJA 2DZUA 3E1YE 4WQMA 1KYOJ 2VZTA 3MACH 4XWOC 4A66A 5FFLA 4TV6A 4XCEA 4M3PA 4WDWA 5D38A 1DQKA 2ENYA 1R3LB 2A1YA 4HKZA 1GZJA 1GW9A 4L1WA 1HW6A 4PMXA 3GVVA 4CNUA 4ERSH 4ONHB 2NLJB 3QQ9D 3N06B