2DIEA

Alkaline alpha-amylase amyk from bacillus sp. ksm-1378
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
481
structure length
481
Chain Sequence
TNGTMMQYFEWHLPNDGNHWNRLRDDAANLKSKGITAVWIPPAWKGTSQNDVGYGAYDLYDLGEFNQKGTVRTKYGTRSQLQGAVTSLKNNGIQVYGDVVMNHKGGADGTEMVNAVEVNRSNRNQEISGEYTIEAWTKFDFPGRGNTHSNFKWRWYHFDGTDWDQSRQLQNKIYKFRGTGKAWDWEVDIENGNYDYLMYADIDMDHPEVINELRNWGVWYTNTLNLDGFRIDAVKHIKYSYTRDWLTHVRNTTGKPMFAVAEFWKNDLAAIENYLNKTSWNHSVFDVPLHYNLYNASNSGGYFDMRNILNGSVVQKHPIHAVTFVDNHDSQPGEALESFVQSWFKPLAYALILTREQGYPSVFYGDYYGIPTHGVPSMKSKIDPLLQARQTYAYGTQHDYFDHHDIIGWTREGDSSHPNSGLATIMSDGPGGNKWMYVGKHKAGQVWRDITGNRSGTVTINADGWGNFTVNGGAVSVWVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ancestral sequence evolutionary trace and crystal structure analyses of alkaline alpha-amylase from Bacillus sp. KSM-1378 to clarify the alkaline adaptation process of proteins
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords amylase
total genus 177
structure length 481
sequence length 481
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2dieA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2dieA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dieA01
2OSWA 1PIGA 2W61A 3RILA 3ZSSA 1W9XA 4OZOA 2WC3A 1E70M 4J27A 4H8HA 5GNZA 3W4RA 2WYSA 3CPUA 4QLLA 1V0MA 3TV8A 3H54A 3U57A 3A24A 3MUAA 1XH2A 4WKAA 2VX4A 1JZ3A 1GVYA 1B0IA 2JEQA 4CD5A 1LLOA 4PMNA 4H8VA 2J7BA 2PB1A 2PWGA 4JFUA 3ZJ7A 1E43A 4PSRA 1H0GA 2VI0A 4HZ8A 4NZJA 2GDUA 3BMWA 1EOMA 2V38A 3F5LA 3PZTA 1K9TA 3WQVA 2VZVA 4P7LA 5BXTA 4X0NA 4JKKA 3AICA 3CZEA 1LQ0A 1OBAA 1CECA 4OKDA 1HIZA 4CCEA 4CU8A 1CGWA 1NH6A 5HPOA 3OGSA 4D6FA 1CDGA 4X9YA 3RO8A 2PBOA 3WDJA 5EFDA 3EDKA 3W37A 1VAHA 1B3ZA 5TD4A 4AY1A 1KGUA 1HJXA 4E8DA 3AFBA 5JBDA 1P6WA 4J3UA 3WH7A 4U33A 3WSUA 4AD2A 4WIWA 4WSJA 1E9LA 4QLKA 3CHFA 3SCNA 1X1NA 3HG2A 3EJQA 1XYFA 1PX8A 2BFGA 3SUTA 3OLDA 5AC4A 1HP5A 1E6NA 1UWRA 1V6YA 1H3GA 3OLIA 1I75A 3W38A 4GXPA 4J3WA 4HOZA 4GIAA 2DGAA 1ISZA 4V27A 2XN0A 5LA0A 3BVTA 2D0GA 3PZQA 1TE1A 3VX0A 3IAPA 3ZQ9A 2WMFA 4AXNA 3N13A 4PMQA 4AMWA 2V3DA 4JCMA 1CPUA 3ALFA 3WUBA 1JI1A 2BXZA 4JHOA 5JIPA 2F7RA 1W3HA 5A94A 3VTRA 3LPGA 2JALA 3TA9A 5A2BA 4M8UA 2UY5A 2VZOA 4WF7A 1OD0A 4YHEA 1PJ9A 3AISA 3SCVA 1G5AA 1E71M 1NP2A 1CXKA 4W5ZA 7A3HA 1D2KA 3VSVA 1C92A 2X2YA 1QNOA 3EJRA 1B3YA 3I3DA 5HXMA 1JNEA 3OB8A 1CZ1A 1TR1A 2DQXA 3MUIA 1ODUA 2V3GA 2MANA 2WANA 1CXFA 1QW8A 4WJXA 5E9AA 1OT2A 1KB3A 5FCZA 3OIHA 3IK2A 5FKYA 3AYSA 1VBUA 4AMCA 5CGTA 2ZXAA 1UHVA 2BS9A 3CUGA 2YA1A 3VMOA 3VMPA 1EDQA 4D6EA 2YL5A 1V6XA 1FOBA 4DUVA 1UD3A 5FL0A 4F9JA 1OIMA 5HPCA 1XCXA 4ATWA 3L4YA 2PF0A 4GPNA 3K8LA 3N18A 5GPRA 3MV11 1PBGA 4AWEA 3VIGA 3WY4A 4BZYA 3AIEA 5KEZA 3FY1A 5I23A 3N11A 3TTYA 5A2AA 3RJYA 3PZVA 1JI2A 5JUVA 3BUDA 5A8NA 3WY1A 1G9HA 2E40A 2XHYA 5A3HA 4AZCB 1D7FA 2WBGA 2Z1SA 4EKJA 2V3EA 2XSAA 2DT2A 1C91A 1H41A 1W1PA 5A8OA 3EDDA 4S3KA 2Y4SA 3WEMA 3L4UA 1LF1A 1LWHA 4EANA 1ZBVA 3VDAA 4YN5A 4PN2A 1XGZA 4B15A 5CZKA 1H2JA 3NSNA 2VVSA 4MDPA 3PTQA 1MVYA 3MMUA 4DWSC 3KLLA 4M80A 1HWWA 4BQ4A 2J7CA 4HU8A 3HZ3A 1V3MA 4W8LA 1FH9A 1UR0A 2WHJA 5I5RA 5CPQA 3W25A 5ABGA 1VEPA 2WW5A 4E4PA 1ZBWA 3WUEA 1TQTA 1W9DM 3BC9A 3BUBA 5BXSA 2VL4A 3WY3A 5F7UA 3CZ8A 4P8XA 4PMZA 2YA2A 2XWDA 1W9BM 2WHKA 4PUDA 2YOCA 2GJXA 2IXUA 1QNSA 3GH4A 4JKLA 3WF1A 4D6CA 3APGA 4WLCA 2AAAA 2E0PA 2JF6A 4MNKA 4ZENA 3VGFA 1KBBA 1E6SM 2WXDM 2XWEA 3VOCA 2WCGA 1E6RA 2W4XA 1R7OA 1CXEA 1XV8A 4MB3A 2DPEA 1HNYA 1QBBA 1ISVA 2F8QA 3BGAA 1HF6A 7CGTA 2CETA 2VZTA 3BAXA 4UCFA 3WD3A 4XB3A 4AZCA 1EDTA 1CEOA 3WDQA 1JYXA 2ESCA 4Y7EA 1VENA 4U2YA 2DT0A 5CSYA 4DUXA 1PZ2A 1FP8A 2XVLA 4YPJA 2VO5A 1W1YA 4OIFA 1R87A 5HNNA 5ABFA 2VZUA 3BVXA 1ZL1A 3AHVA 1LWJA 3RM4A 1GHRA 3AMCA 1ZS2A 2ZOXA 1J12A 5IXEA 4Z2IA 3H55A 2WCSA 1CGUA 3GXIA 4UOQA 1PAMA 1B3WA 2BVYA 1BLIA 1V6VA 1ISXA 2VQTA 1BSIA 3WL1A 5E1QA 5A6LA 4UFJA 1R86A 3S2CA 2Y5EA 2WSPA 2FGZA 1E4MM 3CUJA 3HG5A 4LQ1A 3W24A 3AI0A 2EPKX 3VDCA 2FDMA 1VFMA 3ARTA 2WKLA 4NXSA 3D4YA 2ZIDA 2E8ZA 3A23A 3BSGA 1AMYA 1SMAA 3N12A 4GZEA 2GSJA 1MXGA 1QHOA 1TCMA 3AIQA 3O6AA 3EMCA 1QPKA 1I1WA 4FLSA 1LL6A 1JIBA 3W0KA 1I1XA 3I3EA 3AHTA 3OG2A 3A21A 1QI3A 1VJZA 2Z1KA 1QX1A 3GNRA 1WAWA 2YL6A 3QGVA 4HOXA 2A3CA 3KZSA 5ECUA 4ATDA 3ECQA 3AZTA 5M17A 4MAVA 1HL9A 1KWGA 2WMHA 4HP5A 3VNZA 4IISA 5JBEA 5HDRA 1J9YA 1BPLB 2D3LA 3I3BA 4UFKA 3AS2A 1OD8A 4TUFA 1KCLA 3W6LA 2D73A 3ZJ6A 4OBSA 2W62A 2E4TA 1TA3A 1R34A 1U33A 4LYPA 1UA7A 1BVNP 3AHZA 4M56A 3A47A 3AZRA 2DSUA 2WLZA 4RE2A 2J74A 3BXWA 1E73M 1HXKA 4V28A 4QFUA 1YHTA 3WH9A 2XVGA 1UD6A 4GKLA 4ATLA 3T0DA 3UESA 1AVAA 2D3NA 2CPUA 1E4NA 3CBWA 2WCAA 2EJ1A 1Q6GA 4FMVA 2X2IA 4A4AA 1RPKA 1KXHA 3FW6A 1KFWA 2GDVA 1OM0A 3NCOA 5IHSA 4JFSA 1QNRA 5D8ZA 3CUIA 3UG4A 4GZIA 3GDBA 3M46A 5D9MA 1Q6CA 2J7HA 3CHEA 5FOOA 4Z2GA 2AMGA 2XPKA 4B3LA 3WD2A 3CZLA 5A6BA 2WAGA 2VQUA 4W8AA 1ZBCA 4IM4A 2WVSA 1RP8A 2FYVA 4TVUA 4DO5A 1GW1A 4EAMA 2TAAA 3GBEA 2OWWA 1JF5A 2UY2A 4ZE4A 1UH3A 4CVUA 3PZMA 3F4VA 4XZBA 1UOKA 4FNSA 3WDIA 4UQBA 5IDIA 6TAAA 4IUGA 1KR0A 3VDBA 1TQSA 3W81A 4PCTA 5C70A 1BYDA 3W6MA 2W5FA 3N17A 2JIWA 2XVKA 4J3SA 3DC0A 2VJXA 3UCQA 3S6TA 2OWXA 1FH7A 1GQLA 3W27A 3DHUA 2W91A 3MMDA 4AISA 4ACYA 2DDXA 4D1IA 4MB1A 4JAWA 5AYBA 2G3MA 1FHDA 1V3KA 3LXBA 4U3AA 2NT0A 3WEZA 2ZXQA 2XFRA 3OZOA 3OLGA 3N04A 2CYGA 5A6AA 2VX5A 3MKKA 3GXTA 3SURA 5A6JA 4MJ4A 2GJPA 2ZX6A 3AJ7A 4NRSA 2WSKA 4J7RA 1S46A 3AIUA 1SFSA 4CD4A 2VNCA 3BVWA 5DF0A 1NM9A 5IHRA 3CZSA 3BSHA 4D6HA 3SCPA 1OIFA 1M7XA 1H09A 1JZ2A 3A4AA 4B9YA 2UY3A 4UR9A 4CCDA 2ZXDA 5KZ6A 5C71A 1W2VA 4W87A 1L8NA 2XN1A 4XUYA 2E9LA 1OGGA 1KQZA 1GJUA 2FE0A 1F4AA 2BY2A 2J4GA 4GQRA 2VUYA 1OT1A 3OZPA 1JXJA 1V0NA 2BHZA 3K4AA 2A3AA 4QDMA 3VX1A 5BRPA 4AD4A 4FLQA 4M29A 1E0XA 2VRQA 2BHYA 3EMQA 3WNNA 4ML4A 4M1RA 1OB0A 2XIBA 1E6ZA 1OCQA 3CZJA 3BMVA 1QW9A 3ZIZA 3F5JA 3SCQA 4QP0A 4AD1A 3GH7A 1G01A 1QBAA 3AYRA 1IZKA 4CGTA 3RDKA 3CZGA 5BXRA 3AXXA 5FL1A 3VILA 3POCA 4AYGA 3GBDA 3KEHA 3WFZA 3K4DA 1VB9A 1CENA 2O9PA 1C8QA 5ABHA 5JIWA 1XYZA 4K68A 1WDQA 2DSVA 4TX8A 3FAXA 4AZIA 3VGGA 1QWNA 4WSKA 2A3EA 4HMDA 2WKGA 1O6IA 1Y7VA 3OBAA 5M3WA 1WO2A 1JGIA 4UQ9A 3DYMA 2XYLA 3CTTA 1UD8A 1SR0A 4GI6A 2XM2A 3BAWA 3IJ9A 1WCGA 3NSXA 3QHOA 4UFIA 3BVVA 1CXLA 2CITA 9CGTA 3GXFA 1KBKA 2GUYA 3T09A 4HA4A 2DH3A 4NI3A 2EEXA 1WDRA 3WF2A 2D0FA 3UETA 2IUZA 1FFQA 4LXFA 3S5YA 2WMJA 2BY0A 3L4XA 2XTKA 1XSIA 3GXMA 4GI9A 1UKOA 3AXHA 4D6IA 3DYPA 4PMXA 3OGRA 3CC1A 3WF3A 4FK9A 4DUWA 2XJ7A 1WB0A 2NSXA 5A6KA 5HBFA 4NZCA 3DHPA 3S5ZA 3CH9A 1JZ6A 2WK2A 2QPSA 1GOQA 3CLWA 3THDA 4CD7A 1KGWA 4QAWA 1JFXA 1JD9A 1GCYA 4W88A 3VIIA 3RJXA 1W9VA 5IFPA 1JZ7A 3VIHA 5IFTA 1GOKA 2XUCA 1GJWA 4WKHA 1E4LA 3VKKA 5E70A 3VGBA 3LX9A 2WC4A 3B9EA 3ZJKA 2ZICA 1W2PA 3A4XA 1SZNA 3ARQA 2QV4A 2PWEA 4HA1A 2O92A 4PMDA 4F8XA 1UKPA 1NWSA 1M01A 3L4ZA 2JFEX 1ISYA 4JZ5A 4UNIA 3U7VA 1GPFA 4PMUA 3OLEA 1OGSA 4HU0A 3H53A 2BHUA 4H2CA 3UERA 3RCNA 1NARA 1VRXA 3NDYA 2BXYA 3AIRA 3CUFA 1R8LA 1K9DA 3W26A 4F9DA 2YBTA 2EACA 4UQEA 1BVZA 2WWDA 3LPOA 1CGTA 4Q22A 3UEQA 3ZMRA 1CBGA 2RGMA 1EIBA 3AQUA 1GOWA 1EOKA 3VD7A 2VT0A 4P7NA 4FNRA 2WMIB 1J18A 4Z2KA 5BROA 5C8BB 2VCAA 1JD7A 3BH4A 1DP0A 1E15A 2VRKA 2CBVA 4PSPA 1JDAA 2WBKA 3GZAA 3LMYA 4D6GA 2XFFA 2WHLA 2WZEA 1EDGA 4DM1A 2OYLA 1UWUA 3K8KA 3VD9A 4J3VA 1QNPA 2XFYA 3SCUA 1KXQA 1C3FA 2FHFA 4QLJA 4FLRA 3RM8A 4DM2A 3AOFA 1KXVA 1J0HA 2V5DA 4QCEA 4MNMA 5E09A 1ECEA 1EH9A 1GOMA 2EBNA 1GOOA 3WQWA 1QOXA 3RPMA 5M03A 1LL7A 1G1YA 2QMJA 3PZGA 1VIWA 4UQAA 2BNJA 3GXPA 1VEOA 5I6SA 1CNVA 2CHNA 3BAKA 5E6YA 1M04A 3EDJA 4J3TA 4GO8A 3K1DA 4W7UA 5E0FA 1DWFM 3MU7A 1EA9C 1MXDA 4PMYA 3WH5A 3ARYA 1E5NA 1HL8A 1EQPA 4Z2LA 2VX7A 4L4PA 4RL3A 3KLKA 1BYBA 1WDPA 2DIEA 2GVYA 1QNQA 3D5HA 1N82A 1TUXA 3LRLA 4MTVA 4W89A 1JZ4A 4B9ZA 4QCFA 5DMYA 1BGGA 1XD0A 1UD5A 1PEZA 3SUUA 3DECA 2XG9A 1KXTA 2EADA 3KE0A 5E0CA 1NP0A 4RE3A 3U5UA 4FLOA 1C7SA 1CTNA 2Y8KA 1E6QM 3GNPA 4HPGA 2UWFA 2PI6A 4ZEPA 1GQJA 3AMDA 5A8QA 2WVVA 1MW1A 2W63A 3U5YA 2J7EA 1V08A 3AIWA 1R46A 3VIKA 2RGLA 2CXGA 2QMKA 5BYWA 3BAJA 5A1AA 6CGTA 2YL8A 1EXPA 1Q6DA 5D9NA 4P7OA 4U5IA 3ZT5A 4W85A 1E1FA 1O7AA 1BFNA 2X0HA 3KL0A 2YJQA 2WVTA 1TA3B 4CN6A 5BRQA 4XZWA 5ABFB 2CIPA 1UR2A 2IGTA 3LPPA 5FIPA 1RH9A 1VFOA 5CLWA 4H7VA 1JNDA 3SUSA 3BCFA 3ZT7A 3T2OA 2PBGA 3VIFA 1BTCA 1QVBA 4U3CA 3FXYA 4MAZA 1WZMA 5A6MA 3VD5A 3DDFA 2UY4A 3RIKA 4EK7A 2O9OA 2WHMA 1BHGA 1HT6A 3T2QA 4EE9A 1V0KA 3LXAA 2WLYA 2WB5A 4FNPA 3EJUA 3ZOAA 3L4TA 3BAYA 4AEEA 2DSWA 2G8ZA 2ZWYA 4P7RA 3VIPA 1WKYA 4AZ5A 1NWRA 1E72M 1UQYA 3PZ9A 4NX0A 3IANA 1VFFA 1E1EA 4D72A 4CU7A 1VEMA 2EPMX 3LRMA 4AD5A 1E3XA 3L2LA 3WNPA 4D6DA 1IZJA 2YBUA 3WKZA 2O9TA 1HKMA 4XV0A 4A3YA 5CPSA 2WVUA 1UA3A 1A3HA 2EXOA 2XGIA 4PTMA 1ZJAA 4F66A 4UTFA 5I78A 1B90A 4Z2HA 2WNWA 3MUZ1 4JFTA 4C7FA 1HJUA 3WBEA 1BGAA 5LA1A 3ZR5A 1U30A 3WUFA 2CEQA 1UWQA 1E6PA 2D20A 3K46A 4W7WA 3WL0A 3VIOA 2XVPA 5EB8A 1DWIM 2EPOA 3ARXA 4JCLA 4R5EA 2F1BA 5AYIA 2CBUA 1BQCA 4M24A 5FD0A 3FHAA 4AC1X 2F7QA 3AZSA 1QHZA 3VIJA 1NQ6A 3PZUA 2QPUA 3EYPA 4OOZA 4AEFA 1KCKA 3ARWA 3NUKA 1GQIA 3AMKA 2WM0A 4PTWA 1V3HA 2X8RA 2OW7A 3K8MA 5CG0A 4Z2JA 4BA0A 1C8YA 3PZIA 1E0VA 3VO0A 1FA2A 2PWDA 1PIFA 1X6LA 2X09A 4DWSB 2VCBA 3ZT6A 1JYVA 3VDHA 3U7BA 4W5UA 2X1IA 1OWQA 4GZJA 1TFVA 1JDDA 4UOZA 1ODZA 4LX4A 3W28A 1J0ZA 1UUQA 1UH2A 5I79A 3SUWA 3DX0A 4KGLA 3L2MA 3CV5A 1VFUA 4D6JA 2YDRA 4TTUA 5GNXA 1FP9A 1TMQA 2F2HA 5CJ5A 4ACZA 4C7DA 2YKKA 1JAEA 3ZSTA 2VZSA 1H11A 2WMGA 1JXKA 4NXKA 1UWTA 2BVTA 1HKJA 3PTKA 1JG9A 3VNYA 4UFHA 1JYWA 4IPNB 4TX6A 5D9OA 3DX1A 3OA5A 1QWUA 4PCSA 4DWSA 1T0OA 1UR9A 1R47A 2E9MA 3WIJA 3SCWA 4AD0A 2CBIA 2CKSA 1WDSA 3CZNA 4FNTA 1JZ8A 8CGTA 2EABA 2WVVB 3J7HA 2FHBA 4JHZA 3WQ8A 4J3XA 1B9ZA 3AHXA 4GQQA 1MQRA 5GNYA 4DO4A 2XSBA 3KWXA 2G3IA 2X05A 5I0DA 1V03A 3WDRA 1QI2A 1UASA 2ZE0A 1MFVA 2OYMA 4L4OA 2DSZA 5CLTA 5DO8A 2BV9A 2DSKA 1HJVA 1QI4A 2D22A 5CPTA 1BF2A 4NSBA 3CHDA 4WKFA 3VINA 3VM7A 5E6ZA 1GQKA 4P8UA 1J0IA 1EQCA 1BYAA 4AZHA 4BS0A 3TTSA 3ARSA 4PTVA 1XH1A 2YIHA 1GZJA 3PZOA 4S3JA 1TVNA 4UFLA 3PHAA 5I2UA 1XSKA 3VSUA 5A95A 2ZWZA 2C7FA 2JIEA 5I3DA 4KH2A 4PBGA 2E9BA 1UR1A 5A6SA 2YFOA 1FHLA 3CIVA 1C90A 2YA0A 8A3HA 5JBFA 3SCSA 4GO9A 4B16A 3CHCA 3A6OA 3BUPA 2J75A 3TOPA 4DWSD 1GHSA 4UQCA 2V5CA 2XVNA 3WNLA 3AROA 1UKQA 1K9EA 1J0YA 3PBGA 2WPGA 2GK1B 2VVNA 1LL4A 1K6AA 3HG3A 1OSEA 1R7AA 3FNDA 2VR5A 2D23A 1F4HA 2J7DA 4W93A 4CN1A 1GOIA 3D4ZA 1MQPA 4PYSA 4P7QA 1UD2A 2DT3A 4UZUA 1XSJA 2D24A 1U2YA 5A8PA 2G3JA 1R85A 3BUQA 4OOUA 1AQHA 1NWUA 3QOMA 4AMXA 3TP4A 2G41A 3WENA 1QHPA 3QOKA 1E3ZA 3AXIA 3DYOA 4W86A 2ZUWA 1FFRA 2BY1A 3VVGA 2W92A 1IV8A 4TVCA 3WY2A 5A6BD 2XM1A 2YLAA 3WN6A 2XN2A 3VD3A 1E40A 3VU2A 1WZAA 4LPCA 1J01A 4HA3A 1TQUA 2PC8A 4OJYA 3OGVA 4FF5A 3UG5A 1KWKA 4AYSA 2YL9A 4U5KA 1V3IA 2NW0A 3VGHA 3DX3A 2PWFA 4A3HA 1UD4A 2VX6A 3TONA 1WNOA 5I77A 2YLLA 4W8BA 3GH5A 3G6LA 3TTOA 2Y8VA 4JKMA 4GINA 4AD3A 1B30A 2F18A 1O7DC 3A3HA 3N15A 2CHOA 1Z32X 1DTUA 1HJQA 3ARPA 3WQ6A 3B9AA 3AMGA 4AIUA 4ZE5A 1V6WA 3CO4A 4JL2A 1GUVA 1BG9A 3WBAA 4D71A 2O9RA 5BWFA 1W91A 1RD6A 1B31A 1ZBKA 3N1AA 2EAEA 1J11A 2OW6A 2J62A 3O9NA 1W3KA 1W3JA 1JL8A 2ZX7A 4CD8A 1D3CA 3WQ4A 3WF4A 1HVXA 1W1TA 3MSGA 5CQ1A 1V3JA 2DIJA 4R27A 2C0HA 2WWCA 3GXDA 3ZM8A 4CKQA 3FHQA 1OGBA 1HP4A 4YHGA 2G4FA 4DO6A 2D2OA 1US2A 3B9DA 1CLVA 2VRJA 4F79A 4H41A 4CN4A 2YDSA 3NIYA 1GVIA 1UR8A 1A47A 1TQVA 3CUHA 1UQZA 3VMNA 1E4IA 5A69A 5AC5A 3BCDA 3EJTA 3MV01 1C8XA 5GQBA 2F7OA 3RMEA 3W53A 3G6MA 1H4PA 2ZX8A 4D1JA 4MB5A 1ZB5A 4TOQA 3VIMA 2JF7A 4AIOA 3LRKA 1OINA 3L4WA 2CERA 3KL3A 3WH8A 3W82A 4AZGA 1PX3A 4KRUA 1NOUA 3HJEA 2DEPA 1G0CA 4HOWA 1JAKA 1MQQA 2A3BA 1B3VA 3ZJ8A 1VBRA 1V3LA 3VPLA 4M82A 4CD6A 1UZ1A 1ISWA 2OSXA 1E0WA 2X2JA 4LYQA 1ESWA 1CIUA 4MJ2A 4OGZA 2J79A 5HOSA 3DX4A 4FNUA 1XD1A 1VJSA 3EBVA 2X0YA 3A5VA 3ARRA 1ITCA 2XGBA 4ZFMA 5DEZA 3HN3A 3SCRA 5A2CA 4UOJA 1KR1A 2OLHA 3HMCA 2FHCA 4KMQA 2AOSA 1ZU8A 1CWYA 1EHNA 3E1F1 3RM9A 1Q6EA 2QHAA 2EO7A 3CMJA 5DFAA 3IJ8A 3EMZA 1JF6A 5A8MA 3GXNA 3AHYA 3QHMA 1BPLA 1PX4A 2E3ZA 1H1NA 3WNKA 3M7SA 2GJRA 4GI8A 3M6DA 1JYNA 1CGVA 1DHKA 2PWHA 4LGXA 3W29A 1WZLA 1US3A 3D3AA 3CMGA 3WELA 2BVDA 3A22A 1V0LA 1HXJA 1UYQA 3AS3A 4OBRA 1BG4A 2W66A 2Y2WA 2J78A 3UR8A 4AIEA 1KTBA 1C93A 3HU7A 4TVDA 3MO4A 2G3NA 1EHAA 4W7VA 1JFHA 2FGLA 5EFFA 2YDQA 2J7GA 4U31A 4MNJA 4BCEA 3IAQA 5D9PA 1MYRA 3WUGA 4N0RA 2B31A 4PMVA 1ZJBA 2ZUSA 2OYKA 5M5DA 2D0HA 4AW7A 3T08A 2XIIA 1JZ5A 2EQDA 3WEOA 2IXVA 2GK1A 2Q8XA 1EO7A 3BLPX 1XHGA 2X2HA 3AMLA 1H0IA 3SUVA 4HZ7A 1QI0A 2HVMA 1VF8A 3EDEA 4XX6A 1GNXA 1HJWA 4AZBA 4AZ6A 3AIVA 1XC6A 4NRRA 1DEDA 1XCWA 2E8YA 2GJXB 1E6XM 2J47A 4H04A 3M07A 2Y24A 5BCAA 1WP6A 4BQ3A 1G94A 4UFMA 4CVWA 2CBJA 2ZUVA 4TXEA 1WE5A 3SEPA 2F1AA 4E2OA 2CNCA 2YFNA 3VUPA 1DWAM 1HVQA 2EPNA 1E5JA 3MMWA 3NSMA 1L0PA 1R75A 2NT1A 1SMDA 2FH6A 1J0KA 3BAIA 2A3HA 1HX0A 4JFWA 3D52A 4HPHA 3QR3A 3FN9A 1GORA 3DX2A 1LG2A 4E8CA 2J25A 2WMIA 3MS8A 3WD0A 3GM8A 4HZ6A 3KL5A 3GYCA 1MW2A 5D4YA 1CGXA 1GONA 4LYRA 3II1A 3LXCA 2FH8A 1MW0A 3A4WA 3GTNA 2WZHA 5EMYA 1HJSA 1UG6A 2W67A 4BF7A 1TZ7A 2ZX9A 4MDOA 1H49A 1UWIA 2QF8A 1MFUA 3ARVA 4BQ5A 2CCRA 1WZKA 3AS1A 4ZXOA 3LPFA 3N9KA 2VC9A 4P8VA 4RE4A 3CGTA 4NZFA 3SCOA 5ABEA 4AZ7A 2OSYA 4ACZB 4TTGA 4UQDA 3PZNA 1PZ3A 1W1VA 1TQWA 2VTFA 3SIMA 4KGJA 2HISA 1BYCA 2CESA 2ZUUA 1TVPA 2QLYA 1J0JA 3ARUA 3EJPA 3CZKA 4JFVA 1CXIA 1HKIA 3VSTA 2VURA 2F61A 3WDHA 4HMEA 3MSDA 3WD1A 1YQ2A 1CXHA 2DH2A 3WH6A 3QHNA 3TTQA 2ZUMA 3IGUA 4B3KA 2EPLX 2ZXBA 2ZUTA 1BAGA 4URIA 1NOFA 2D1ZA 1KQYA 4MNLA 3SCTA 2OWCA 4M81A 3T0BA 3MANA 1XH0A 1DWJM 1ITXA 2WZIA 4PEEA 3WFLA 3GNOA 3MI6A 4MB4A 4Q7NA 4UZSA 3T0AA 1W9UA 1B2YA 5LYRA 3DDGA 5EBAA 2J7FA 2VOTA 2BY3A 1TG7A 5I24A 2VR4A 3WMBA 2ZX5A 1KGXA 3D50A 1J10A 1UH4A 3L4VA 7TAAA 1X6NA 4MADA 5CXPA 2J8FA 3EJSA 4PMRA 5DT7A 1V02A 1UWSA 4CUCA 2DT1A 3WDPP 1KTCA 3WNOA 4KRTA 4JL1A 1HTYA 1DWGM 1NOWA 5CGMA 3WF0A 3VM5A 2J77A 3BVUA 3WMSA 5D8WA 1H5VA 3MUY1 3NJ3A 1CGYA 3BLKA 3WMCA 3BLBA 1Q6FA 1EO5A 3FAWA 1NWTA 1QI5A 5LA2A 4W84A 1W3LA 1AQ0A 3D51A 3HG4A 4C7GA 1R33A 2F7PA 5AY7A 4U2ZA 1E55A 4PRWA 1EGZA 1XRVA 2V3FA 6A3HA 1W9PA 1LG1A 1C7TA 3POHA 3O2LA 1CYGA 2ALWA 2C8NA 3AS0A 4BQ2A 3NYDA 3EDFA 4WK9A 3JUGA 2JE8A 1B1YA 4PTXA 4IPLA 4CCCA 1PPIA 3NDZA 3VGDA 2JEPA 1UKSA 4ZXLA 3B8SA 5CSUA 2J8GA 1V02E 4KWUA 1B3XA 1CLXA 3ZR6A 2CKRA 3PN8A 5DT5A 1MW3A 3ALGA 4N42A 1MWOA 3VD4A 1V6UA 4HTYA 1HKKA 1UZ4A 1RP9A 4V2XA 3ZO9A 1PS3A 1HN1A 2GFTA 3T2PA 2ZUNA 1AQMA 1M03A 1M53A 1SYTA 4PUEA 4FNQA 3PTMA 5BXPA 1UKTA 3IJ7A 4J28A 3VGEA 4NF7A 3UR7A 4P8WA 4CU6A 1DWHM 1FH8A 3ARZA 3UG3A 1Q4NX 1WPCA 4X0VA 1LJYA 3WD4A 3WNMA 2VCCA 1IT0A 3AIBA 3WQ5A 1K9FA 3THCA 2VMFA 4HMCA 4PMOA 2WC7A 1E56A 3BUIA 2WMKA 3F5KA 1JDCA 1W32A 4JIEA 4MPKA 4OUEA 1UR4A 4H8UA
chains in the Genus database with same CATH superfamily
4JQ1A 3VNLA 3W1NA 1PIGA 1LXMA 2PR4L 2JJ2A 2JJTC 2QSCL 1A7PL 4OZOA 2R82A 4HS8L 3Q8FA 3KNBA 4HSCX 3MHUA 1IM9B 1EJXC 1NY1A 2WYSA 3M6YA 1HDMA 4L4JA 5CMAA 3ULVD 1I1RA 4C58B 3APTA 3BZ4B 3QIBC 5IYRA 2QEJA 3GS6A 4KUZH 3IJEB 2Z7KA 3E0FA 3GNMH 1TU2B 3DXAE 4KTYA 5BMFL 5HJLA 2JB5L 3ATBA 3TV8A 4QYAA 2CPCA 3OKMA 4BFEA 3BLOA 4N7QA 1TZIA 4PJEB 1G5GA 5K1NA 1EFXB 5G2WA 2NY2C 4OLXL 1IIGA 3TH6A 1OGAA 2VX4A 3ABXA 4I87A 1UXSA 3DERA 1MO0A 4FQHA 3ZDXB 4BINA 1B0IA 4JPIB 5DVLA 1GVYA 2VGIA 2W6JA 4NAJA 4NHUA 1T3FA 4LVHB 1LLOA 2MNRA 3H24A 2PB1A 1J9QA 4PMNA 1TWDA 2PWGA 3VA8A 1FL3A 3TA3B 4GAJH 4UILH 4Z7OE 2PLKA 3BLFA 1I85C 3ZXWA 3NPSB 4OPVA 1F1DA 2J27A 4NZJA 3EWUA 5F4JA 3EWZA 4R2GB 1USZA 4QI3A 2V37A 5F88A 4D8AA 2AV1A 1HH6A 4G6JH 3V0DA 3P69A 4WZHA 3P4MA 5KBKA 2UY6A 3HE6C 1OGAD 5BXTA 2NQCA 4NQDB 3EGXB 4ZD3L 2HLFD 4DF9A 4DKFL 4EZLA 1H1YA 2VM8A 4PUKA 1YHQB 4X0NA 3ILPA 4I8DA 3NPXA 3TEYA 4OLUL 3TYBA 1H8LA 2ZRWA 1YMME 3C6LC 1MRZA 4GG6A 1HNGA 1FWHC 2FEJA 3QJUB 1N8OE 5FL7A 1QEWA 1AHWA 5B39A 4WCYL 3E6EA 1HIZA 4CCEA 4ENED 1NQBA 3NWRA 1CGWA 3STZA 4NQDA 1TYEB 4C56B 1VF5C 1TB3A 3MTWA 3QUMB 4AEHH 4X22A 2K7QA 4ZUVB 3DWTA 5I73B 1EF3A 1Y5VA 4X9YA 5J57B 3VC6A 5ABTA 4L80A 2ZZEA 2PBOA 5DRIA 1P53A 2VDMH 3MLVH 1A9BB 3W7DA 2BSDA 1WCQA 1W5QA 5TD4A 3ZLFA 4JM2D 1Y0LB 3I68A 3RG1C 3QI9C 3QFCA 3L6FA 2CBTA 1HJXA 3EUUA 2RUSA 2NY3C 3LKNB 4C0SA 2Y7QB 4YVXA 3DTXB 1MIEL 4KFMA 5EG6C 4Z7WF 4JZOB 1V5XA 3N2BA 4TLKA 3FPYA 3CP8A 3T9PA 3ARFC 4ADIA 1OZUA 5FUOH 3QTGA 4WIWA 3V4PA 3TYCA 3CHFA 5L2JB 1X1NA 2JTYA 3FT9A 4ZFFB 1DKWA 4HGXA 3PJWA 5F4XA 4FQXC 4KMTL 2D74A 3G05A 4GIPD 3I2CL 2XV3A 1WV7T 5C2UB 4JIRA 1VBHA 1NDWA 3R79A 1E6NA 4FQCH 4WY7H 1EYWA 4YDNA 3QEQB 1H3GA 1JMZA 4QXUH 5F2GA 1AO7E 2EIXA 3KNBB 3OLIA 3CN2A 4HDIB 4KUCD 4BELD 4ORGB 1WYIA 3NCBB 3W38A 2J6WA 3ESPA 3CB3A 3R1ZA 1CZ8L 3HAEB 3S34H 2W60A 3DI2B 5KYYB 2DQUH 3D3VD 1E28A 2DGAA 2Y36H 1FX0A 1TSIA 5F1NA 1QR1B 1INDL 3ENLA 4E42B 3GJFA 3EAUA 2XN0A 3SY8A 2UZPA 3KYOB 1WTHD 2QZQA 3LDBC 3OAUL 4OCXL 2C19A 3GDLA 3UGRA 1KV7A 1HG3A 1TE1A 4DJED 2VSMB 3KLAB 3NDYE 4K71C 4MDJA 1T41A 4H2AA 2F6XA 4BI5A 4Y2NA 2B3IA 2ITFA 3N13A 4AMWA 4JK0D 4O57A 4PMQA 5KETA 4G9FD 4KBXA 1OHHA 1CPUA 3MU3A 1NC2A 1J05A 1DE4A 2BXZA 35C8H 4FQLL 3BLLA 3QDGE 3NL5A 1MCBA 3M88A 3ZQXA 4J2MA 3RZWA 1M65A 2NY0B 1A0DA 4LS1A 3VTRA 3KXFD 3LPGA 1KJMB 2O4EA 2Q6WA 2G5RA 2E5DA 3V0VA 3KPOB 4PGDA 1M7IA 3N4FA 4RFNB 4TKOB 3D7PA 4M8UA 4LNVA 3WJJC 4RD4A 2R6OA 3E5PA 4FPSA 1TYJA 2VZOA 5EU4B 5T91A 5I71C 4Y9FA 4PJ7B 1ZA6A 1A7NH 1UEMA 3OGOE 4A2DA 1OD0A 1E8XA 3WEXB 4GA8A 1ZAJA 5I09A 3DUUB 3MBEB 4BFGA 4XTRD 3RWIB 1ET8A 2X40A 1E71M 3CWGA 1CXKA 1NP2A 2E7CA 4NQDD 2POZA 2YZRA 3FDGA 3M5ZA 3WLOA 3LLXA 2FQFA 4Z7UA 4Y89A 1D2KA 3G6DH 2ZZ2A 2WYRA 3VSVA 4UR7A 1TLLA 2LW3A 4HCRA 2C71A 3UZWA 1GR7A 1WUFA 2AQNA 5C0RH 3M64A 4HW6A 5I6LA 3NL3A 3IJHB 3JWDH 4G71B 3I3DA 5FLUA 3H7UA 5HXMA 1CURA 2NSOA 4P2AA 4NHVA 4C1KA 3VXSE 3OB8A 1YJWB 2LE9A 2WLHA 1CZ1A 4XKYB 1XQ4A 2GUOA 2P50A 4R9XA 4HKJB 3FLUA 3CVIL 1FGNH 1PFCA 2R29H 2LGNA 4H25B 1BM7A 4NERA 3ZX1A 2V3GA 2HEJA 2XZLA 3DVFA 1ND0B 4DHLA 1Q81D 1I4FB 2OJPA 3ZTNL 1KRBC 3TW7A 2CG9X 5FUZH 4HUVB 2ZOKA 1RA0A 3PUDA 5J11B 1JPIA 4O02H 4N2CA 1HOEA 1GG0A 4XNFA 3BE7A 2JB6A 2WMPB 3HBLA 3UXIA 5E2JA 4AMCA 1G7PB 2PLTA 1ME7A 4B3FX 1T83A 2XNAA 5BPPA 1Z9NA 2ZXAA 4MAYA 3QPQD 4GBXC 3STEA 2VQ1A 1ILSA 1KV3A 4BE6A 2Y70A 5KYWB 3MO7A 3I6KB 1E63A 1BIHA 3R0NA 4H20L 25C8L 5DMGC 5FCUH 1U8JA 1XBYA 2VC7A 5FKPA 3JQQA 3BTNA 1V6XA 3M17A 3QISA 3FFDB 4CDHA 2JJWA 5E0KA 4HHPA 3T51B 5FL0A 3LGEA 2EH7H 1XCXA 3ESOA 1I6NA 1C29A 1LBFA 4NIRA 5LGHH 3N18A 3B06A 3MREB 3KYOA 4YR6B 1PBGA 3UY8A 4M9PA 4XIMA 1DBKH 4JX0A 3CSYA 4FI6A 4AMKL 2OX4A 4M1CD 3MZ2A 2PPAA 4R8WH 3P14A 4B5EA 3LZLA 4EDXA 5HHXH 4FKEA 5BQ7A 1TO3A 1TEFA 5TE6H 4XUGA 4OM0L 1DV7A 1MNNA 1ETZA 5FYLE 3U7AA 2DQDL 1UP0A 2J1WA 3RZCC 3RZCB 3TQKA 1DR9A 4XC1L 4Q4MA 1U8QB 5A2AA 4TMZA 3V52L 1FTXA 1LORA 3BIKA 4FEZA 1JI2A 3PGFL 1QFYA 4N85A 4L9XA 3BUDA 1G9HA 5GGRB 3W1TA 2VR6A 4P59H 4KNQA 3ZZTA 1V93A 1RULL 4H1LB 3TE9A 1NGZA 1JUKA 5EU4A 1UWXK 1TMHA 2MCAA 3VB8A 2PDJA 5CH9A 2CO1A 4PV8B 1SOQA 4LF3A 3ZIYA 2LTQC 3J8F7 3T65A 5JTWA 3Q48A 1DJNA 4FYRA 2YEQA 4NZTL 4JNXA 4XZIA 5D5MA 2R2HB 4ODWA 1C91A 1W1PA 3UL4A 3NVQA 2K1MA 3EDDA 3RTQA 2Y4SA 4XCYB 3JXAA 5TGBB 3WEMA 4GACA 2YJLA 1LWHA 4GG6E 4EANA 1TNMA 5DHVA 3N0PB 4PGJA 5D04C 3W9DB 4ZGQB 1XGZA 1PV8A 1S5IL 3NAAH 3N9GL 1ZLVH 3H7BA 4KPLA 2CUMA 2IPTL 1HOCA 1UZ8A 2J88L 3KLLA 2V5JA 4M80A 1MSPA 5DDHA 1N55A 5C97A 2OLSA 1TKKA 1XCFA 2J7CA 2YQGA 3L68A 5BXFA 4M51A 1JQVA 1UCWA 4HU8A 4O17A 4BF9A 1MAKA 3BHBB 1TZOA 1V3MA 3UXDA 3MAWA 5D1XB 1NMBL 1FH9A 2PDUA 4V15A 3PDGA 3S0CA 5I5RA 1XBVA 5CPQA 4LOUC 2PYED 2HG5A 5T5FL 1PTDA 5ABGA 4FFWD 2ZKHH 3PP4L 1SHMA 5I17B 5XIAA 1TZGL 1O95A 3B82A 1PIIA 2XV2A 3GVQA 2F74B 1ZBWA 3RQ3A 1C5BL 3AGVA 3ICJA 2XZQL 3N29A 5LBSL 1JUBA 4XBGB 3GMQA 2VH5H 4W70A 2QUTA 4XCFL 3QEUA 3L9CA 3PWGA 3SD5A 2R29L 3HTLX 3WY3A 2V30A 1KC5H 4P8XA 3LGDA 3SJZA 5D7KD 3QWNA 8FABA 1RUPH 5F0JB 1W9BM 4ZNCD 4PUDA 1TTRA 3TYEA 5D2NB 5FFOA 5G1TA 3WF1A 2Z28A 1CL7L 2Z7GA 5IRPA 1OCCB 1XDTT 3OKNA 5A5WA 2AAAA 2CWRA 1DLFH 3INUL 1GIGL 1HI6B 2JF6A 2I7GA 3L3KB 2A6IB 1UWGL 3THML 3NFPA 4NZRL 5HQLA 3VGFA 3CMEB 3W7HA 1ZA3A 4R26H 2WXDM 4J23A 3TJHD 5C6MA 4DN1A 3WBJA 3ARDA 3G04B 4KT2A 4DAFA 1DZ0A 1E6RA 3QZLA 1S5NA 1JCJA 2FTYA 4HKXB 2YXXA 5DGQA 3CCJB 1EXGA 1YZZA 3PWVA 4F7EB 2YN3A 3FIGA 2AQ1A 4U3HA 3E9UA 2DPEA 1ISVA 5D7SL 3GC2A 1I9EA 1AOHA 2CK0L 3DTXA 4KO7A 3Q45A 1HF6A 2Z31D 4LLUB 2CR3A 1OTTD 2G75B 4PJHB 1VQ6B 1YEFL 1HUVA 3FYOA 3OVGA 3S88H 4XVSH 4DKFH 3RNDA 1VHEA 4G8GB 2XI9A 1U95A 1GSMA 1WCBB 3BAXA 2JK2A 5C0NC 1P7QA 1RMFL 4JHMA 5D7JD 4E5XA 1XRTA 3IS4A 3GWQA 4HIIB 4YYFA 3ECBB 4IEFB 4FG6C 3LHPH 4HZLB 1S7UB 1I1YA 4Y7EA 3NFSL 4X7SL 1D6EA 4QTIL 5F7LB 5HJGA 1OPOA 3MROA 4LP8A 4U2YA 3D39B 2J43A 5ITBL 3S5NA 3RTQD 1D5MA 2QT3A 1VZHA 3STCA 4JHAL 4Z7OF 3TYAA 6PTDA 4QHMA 4A66A 3SPHA 5KYNA 2HJFB 3DSNA 3DX7B 3N41F 3V4UH 1W1YA 4DO7A 4HJTA 5A2FA 4YS1A 3EYQD 2QQNH 1R87A 2VBSA 2QDVA 4LK4A 1HWHB 1P5UA 2HJKB 2YPLA 3GJFB 2R7EA 4ONFL 3MX0B 3BVXA 3FPKA 4G7VH 4HJEA 4IIHA 4PC2A 4WDXA 3WIHH 1LWJA 1FI8C 5T1KD 4ZMVA 5FNZA 5IG7B 4JTLA 4EUPB 3VXOB 3AMCA 1QFWL 1I3VA 1V6YA 2CRVA 1ZS2A 2WSRA 1J1OL 1W1ZA 1AE6L 3Q9PA 1A4BA 1IEWA 1FVEB 2WCSA 4FC3E 5D30A 3HE7B 1CGUA 3GXIA 1LEGB 5FO9A 5I0WA 2NY4C 3WJMA 1AGDA 1ACYH 5E9DD 1LE5A 3FQ1A 1QU4A 2RAGA 4O1CA 3S1UA 4R9OA 3CXFA 1VZGA 1MRCL 4ISVA 5E1QA 2OPJA 4UT6L 5A6LA 4NQ1A 1KPRB 3HZMA 1R86A 2Y5EA 1PHWA 3GQYA 1K8IB 5G2HA 1A6WL 2APWA 4QDWA 1E4MM 4OBTA 4NN5B 5E6RB 3TIDA 2VYQA 4F15C 3CUJA 4Q6IA 2A9NH 2XQYA 3RY5A 5LGYA 5IY5B 1KYAA 4E0RA 1QFHA 1CG9B 2FDMA 3RB5A 1FHGA 4NXSA 3BPNC 2ZIDA 3BSGA 2GC4C 5J56B 4I1RA 5CEXB 2P8MA 3TFKD 2CRIA 4GZEA 4QGTA 2GSJA 1A3ZA 5LGZA 2A77H 1CFSA 3RLHA 1TCMA 5SWZA 3TIDB 3AIQA 1A14L 2H32A 3TX4A 3O6ML 1TITA 4UQ3A 1Q9SA 4P3IA 4O4WA 5KBNC 1K8DA 2NV1A 4ELKA 4G83A 4FLSA 1LL6A 5IFJB 4KJWC 4M6QA 3S3BB 1JNNL 2VBUA 4DN3L 3Q43A 5F93C 1I1XA 4WDWA 5FF7A 1NEUA 1QSFD 3I3EA 3L3OA 3WLBB 1H63A 1S9VA 2JI2A 4LARH 3WS3B 1L2UA 1EEYA 4XPHL 3VOIA 3A21A 1ZLUH 1QI3A 1VJZA 3ZRFC 3OKOB 1QX1A 4JREC 1YIXA 3DFPA 3P9MA 5CCZA 3G71B 4ACBA 1NIBA 1CQXA 2NNFA 2NUPB 3HAEG 4OVUA 1Q1JL 1DBAH 4HKZB 1HZHH 2UWEA 4NZTH 1AD0B 1I82A 4UYQA 3W2DH 1MMFA 4AH7A 1ZXQA 3ECQA 2X44D 5K9JL 1N0XL 3EB3A 4AUBA 5M17A 1DQIA 3VFWB 2JK5A 4FOMA 1IYXA 2ZVRA 1QA9B 1BZQK 4Y1AD 5FKAA 2WMHA 4Y9MA 2IPGA 2MPVA 4HP5A 5TQ0L 3U2IA 3QV7A 2WR8A 3OB0K 2N1KA 3GBML 3PWLA 1U8KA 3EJJX 1KB5B 3SCMB 4FA6A 1JXFA 1XYAA 3PWNB 4AM0Q 1XIEA 4GKOA 3RNQA 1QRND 4BYHA 3A64A 3BW4A 1OD8A 2OZ4H 3MWAA 4L48A 4AXKA 4FFYA 3W6LA 4TVPE 4P46C 4KKAC 5BMFH 2D73A 2RIKA 3BZDA 2BSTB 2G50A 2J71A 2P0OA 2BRRL 4OBSA 3WK1A 4YWSA 2UBPC 5D4QA 2W62A 1UWYA 4OFYD 4AXWB 2OAAA 2RHEA 3MMPA 4QO1B 1EJUC 1UA7A 2YRZA 4V1XA 5LGXA 3MW7A 1SUXA 3U6RA 3A47A 4PJ6A 1H50A 3AZRA 2DSUA 2WLZA 2WWKT 3DMMD 3DV6A 2HKAA 2J74A 4RE2A 4C6JA 3SOBH 2SEBA 5HJYA 1JF1A 1UZGA 1BA9A 1U5HA 1FNSL 3D2UA 4R7DA 1W35A 4UV7H 3BXWA 1SW3A 3PBYA 2A6IA 3ILQD 3L81A 4QRBA 5DUPL 4GNVA 4GYKA 1GPOH 3D18A 1YHTA 2IQTA 2PP0A 3C3UA 3WH9A 5CSZA 1GY2A 2ZYSA 4ATLA 4F9LA 4A7QA 1UEYA 3UESA 2ZWNA 1AA1B 5XINA 3UO1H 3WY9A 5U4NA 3VXRA 4DNLA 2D3NA 5F2LA 4MA8L 3BZFA 3C60B 4Z7VA 1I4NA 4TIMA 3DOSB 3F05A 5T3ZL 1SHSA 3CFTA 5CZXC 4BFNA 4LCVA 5LN8A 1D9EA 5CCHE 4FMVA 4HHAB 3PL6B 2B7QA 2X4SB 4K0OA 4Y9RA 3P0WA 3FW6A 1KFWA 2GDVA 1EK3A 3T8LA 4GYBA 1V0EA 1NUFA 1DBTA 2Z1PA 1YBQB 3MJ7B 1P0EA 2DKMA 1FORH 5I66A 5CP7B 3NJHA 2H8PB 4URKA 1FA4A 3UG4A 2YCJA 3O6KL 1XQBA 4IEFA 4A8NA 1UOVA 4E2VA 4DJMA 3ET9F 4R90L 5F0PB 4AOFA 2BOCB 3ARBB 4O51B 1CF1A 4QEGA 2WJ7A 4R4FL 2O6FA 3NJMA 1XH3B 3EX4A 4LF2A 1KPVB 2W0KA 3QIBA 2XG4A 3TSDA 2AMGA 3KAAA 4GJTB 4KY2A 5FOOA 3U6KA 5D1XA 5C3TA 2GYIA 3RMJA 5A6BA 5TK2A 5TDOB 2QUNA 2VQUA 2IBZX 2TSYA 1S39A 3SY0B 2J9ZA 3DHDA 5IM7B 2WYHA 3QJFB 3ES7A 3K6OA 5AYQA 2WQVA 4YXGA 4H3DA 2X28A 1HKLL 1JV2B 1S9XA 3N0AA 4JM4L 4PS8A 3RNKA 4U1KA 2TAAA 4DO5A 1KM4A 4EBQL 3AZUA 3F7YA 1IX2A 4XPHH 4EN3D 4Y1AA 3GR4A 4TMCA 1YEFH 2CC0A 3PWPD 2OWWA 3S3GA 2IMRA 3FCTB 1EERB 3FCBA 3C2YA 4R33A 1FG9C 1A7OL 1MCEA 2ZT9C 1GKPA 4KIEA 3GB7A 4HWZA 4P0DA 5FDYA 4CVUA 5FJJA 5HK4A 3OKNB 1FCCA 4NIYE 4JIPA 4DELA 3D30A 5CJOH 4RGNC 3WAJA 3QEZA 4ISVB 2RBLA 6TAAA 3TMQA 5AWNL 3HI6H 3QJRB 2FECL 2CDFB 2VDPL 1IILE 4GRLD 1Q6OA 4CEUC 1WAEA 3D4CA 1T03L 4M1CC 3O4LA 4H1LA 5C70A 4PJXA 1BYDA 4OI8A 4OCLC 3KPRD 1U3HC 2W07B 2DPKA 3EO1B 3DIDA 2YMTA 3D26A 2QN6A 5IJVB 2JIWA 2CHRA 1IC4H 2L7EA 3HV8A 5FEPA 2CNYA 3FO9B 4I3RH 1NBYB 1DBML 2ZA3A 1XR8B 3B7TA 3BN9C 1ZDQA 1A6VH 1MI3A 3NRFA 4J3SA 2FEDD 3II2A 5F8RC 4QROA 1YNTF 2APVA 3W7PA 1I7UB 2DI7A 2V7TA 3C8KB 1CICD 3CLEH 2VKWA 3LNHA 3TZVA 3TC6A 2P80A 1KRHA 3EKGA 3EO1A 1EZUA 3GHBH 3KM1A 2Q8AH 3EYSH 4YO0B 1GQLA 4PMFA 1F58H 3T04D 4D3CL 5DT1L 3DRQA 2HCZX 4JFFE 1FZOA 3C5ZC 3VQLA 2EDTA 1BFOB 5GS1A 4RLIA 3MA8A 3WTXA 3IJLA 3MMDA 4ONVA 3LOWA 4YVUA 1U8LB 4AB4A 3RGVD 2DDXA 4NJGA 2JKPA 3P0YH 5F96L 2AV1B 1BJ8A 3C8KA 1ELSA 1YE4A 4S3BA 4ZB5A 4BKNA 2X4PB 4YE4H 2X70A 3O3RA 4MB1A 3B1UA 5HBBA 4OF6A 4JAWA 2EEFA 3SE6A 1NFPA 5E9DE 8TIMA 1V3KA 3UNDA 4L4TD 3SDDA 4LRSA 3CVCA 3LXBA 4U3AA 3M86A 4IHOA 4GT0A 1QLRA 3CXDH 5I2IB 3WEZA 4ENZA 3N25A 3MDJA 2F54B 4PW3A 2AJ3A 3VNIA 3OLGA 3N6HA 3N04A 2OG9A 3JWDL 1JWMA 4H4NA 4Y5YB 5CNHA 3QH2A 5B7FA 3IJIA 4K7YA 2EKGA 2VX5A 5A6AA 4PYHA 2N3JA 2BSSA 3GZOA 4U7SA 4W9KC 1PYWA 3P1VA 4XVTL 7XIMA 4MY1A 1KDIA 2R51A 1AR2A 3PAVA 4GFXA 5TDNB 3U0WH 1R3KA 3PHQA 2GJPA 2FGBA 1UBPC 3MWCA 3SDCD 1A7RL 1XFBA 1AGBA 1URZA 1IAKB 3VFGL 4JDTH 4AQ1A 5HKKA 4YFEA 2ZP0T 2V33A 1P2CA 4UIMB 1S46A 2PCXA 3DJZA 4FJZA 4WW2C 2QQQA 4Z8FH 1KA9F 2ENYA 4RDKA 2C3VA 4JG9A 5IK3B 1SFSA 2IPJA 4F48A 4L3AA 4S1SL 2JKNA 3ULUC 3W76A 2IWEA 3CZSA 5E00B 1OALA 1OK0A 2O5YL 3PHOB 1FBIH 3P2TA 3QCUH 4HH8A 4M3JA 4S1DC 4W6YB 3TEXA 1MI5A 3ALPA 4F7CA 2OTJB 1IT8A 4G1MB 4AAJA 3HN5A 1X5HA 4PB0L 1SF3A 3KYMA 3WFBH 1CG9A 1GZ1A 3CCHB 2EVIA 1MWAB 2QADC 5B4MD 4I1NB 2VJ0A 3JTTB 5GGQH 2PZ0A 4CCDA 1G7MB 3ZUNC 2V5RA 3RAJH 2GK0B 3UA4A 2ZXDA 3MRGA 2W65B 4DX3A 1U5VA 1W2VA 3QUXD 4GE8A 4IICA 2JELH 3V7PA 1EEZA 4HD9A 4IBUA 3CT2A 3LK6A 2QVNA 4UC5A 1SLVA 1JRBA 4EPSA 3INUH 4K9EC 4GW5A 3SB3A 3VFUA 3TBTA 2FE0A 2Z93B 1XWYA 2V2WA 1FRGH 4Q0XL 1IKFH 1UXWA 2XTJD 4FG4A 4Y1AE 4X4YB 2PRMA 4H01A 4Q6JA 2Y3NA 1J48A 1JXJA 3QUZA 4YDVB 5KYYA 4IP4A 4Z7VB 2PDLA 2E7LC 4GY1A 3K4AA 2Q6OA 5DMGD 3QV8A 5GS0H 4YIWA 4C6PA 3PL6A 3SGEI 1ZHKB 4R7VA 2IMNA 4XPAL 4FP1A 1JTTA 3ZVVA 3RVTD 5BRPA 3PGCB 4RAUA 4LS2A 1E0XA 4AF0B 2YBRA 3MRJB 4O5LH 3AAZA 1T7LA 1WOSA 5CD5D 3MKCA 4YO0A 4P1VA 1YMMA 4S3GA 1XLEA 4AGMA 1DN0A 2LU7A 4Z1MA 4ETYA 1XL9A 1RCXB 3W1PA 4N6RA 3FFCB 3PIQA 4JQIA 2VEFA 4LFHD 4YMZA 4ANWA 2HXUA 4WR3A 3C5XA 3I02A 1DVFA 1L5GA 4P07A 1B4JH 1FPTH 3AM8C 4GBXB 4QHNB 1QW9A 4Y4HC 3W01A 2J20A 1A6VL 3FU7B 2VXQH 4S2SB 4W6XB 5FA4A 3SE8L 1YXDA 3QFJA 4Q8OA 1SKYB 5HZAA 3ASNB 2DP3A 3GAKA 2W9MA 5DMKA 1G7SA 3VK5A 1PGRB 3RURA 3DHMA 5KOVC 4HWUA 4KX7A 1A4MA 2EG7A 5J7CC 2YCKX 1M3JA 2ACRA 4NN7C 2PMDA 2MNUA 2PTDA 3G8RA 4KEZA 3VILA 3V5FA 3QGAC 1K4DA 2QELA 4Y1SA 4N1EA 4CJ0A 3WTUA 5FJIA 3UWYA 5DRXB 1MIMH 3N9SA 4DK5A 2E6QA 4IGHA 2OX5A 3DBPA 1RIHH 3MMTA 3Q94A 2Q5BA 2IDUA 5B1BB 3G5XB 4M6PA 1DFBH 1N8ZB 3BDKA 5EF2A 4X98A 2E7FA 4KWSA 5JIWA 4IP5A 4K68A 1XS2A 1WDQA 2DSVA 4TX8A 1DBBH 3SPGA 2NVDA 2Y7LA 3FAXA 4ZXBC 4N02A 2WXFA 1A1NA 2YD9A 5HTSA 3CU7A 4D6HA 1N7ML 5F89B 4NVTA 1FNEA 4N90D 4WHYG 4NP4L 2A3EA 1WXJA 4WI3A 3ZHLA 5KJ7E 2VITA 4DPCX 1MI5B 5FGCE 3EGSB 3ES6B 1O6IA 1DSYA 1ROWA 1Y7VA 5CCJA 1P5UC 3KLHD 3HN8A 4I18C 5LQBL 4PJ5E 4OM0H 2XYLA 1GGOA 1G7VA 3VFGH 4GI6A 3H22A 4LF1A 1OV8A 2QCNA 3H42L 1S9VB 2N0MA 2YPVH 2OI9B 1KGIA 1LLAA 5EF0A 4O02A 2VQ1B 3U0WL 4PRPA 4CC4C 3FDWA 4FGMA 2OEKA 2DZWA 4H9ZA 3IJ9A 4LHQB 1WCGA 1OZTG 3QHOA 2VLRE 2VR9A 5IFAL 4UFIA 1B3IA 1FZJB 1YDPA 3MC0A 1CXLA 32C2B 3IS1X 2CUIA 3MRCA 2CITA 5KSUB 1F6AA 1OGAB 5HVWA 1ZT7B 3B04A 2WTOA 3DRTB 3MJ9A 4ZG1A 9CGTA 2VLKE 3B9VA 3MZGB 3T09A 2ED6A 4G6AC 1ZP4A 2DH3A 3QV6A 1KTLB 1CW2A 1VLOA 2XETA 1WDRA 1A14H 4MCYB 3UETA 3UZYA 4XB8A 5B1CA 3B4YA 5I9QC 4H8NA 1H6EA 1LBLA 3VUPA 2R4SH 3AG1B 1ETB1 2OVLA 4I5UA 4E41A 4GI9A 5KSVA 1UKOA 1P7HL 3QWQB 3UO1L 5HSFA 1VYSX 5AYZA 4M5YH 2NZ1A 2RA1A 1JZEA 3CC1A 4O5LL 2R56L 2FLMA 4DUWA 1M5WA 1NIAA 3KH4A 4OTXH 4Z7WA 2Y5TB 4F20A 4DK0A 3VFVB 2ISSA 3RWJB 1NAL1 1K5NB 1DE5A 3PHQB 1MF2L 1J8KA 1HU8A 3UTZA 1RLWA 5I82A 4HK7A 5LNUA 1YG9A 5E1AA 3WL9A 4XO7A 3CLWA 4PTNA 3B2MA 1V7MH 2I07B 5CUSH 4XMWA 3LEPA 3ZHKA 4CD7A 1IM3A 4QUOA 5J4MA 1U36A 1M05A 5I3IA 3CWHA 1P7BA 1O5QA 5JW4R 3NACL 5BOFA 1REQA 2YWGA 1M7IB 1XGUB 1EP1B 1LM8V 4Q56A 2MEJB 1OAYH 1QBMH 4PJXB 1NB9A 3F6IA 3QPZA 4POZC 3R7RA 1N6QL 3VIHA 4D2NA 5IFTA 5AKSA 1ORQA 4OD2A 3UIYA 4HUUA 3MOBH 4FFZH 5E70A 4EOWH 2DQWA 1WXZA 3R12A 4P9SA 1E6JL 1KBWA 3B9EA 2NQDA 3LX9A 2OQJB 5J11C 3GIZH 2WXLA 3QNZB 5J3HC 2O4QA 1IBGH 2ZICA 3CMAB 1QVGB 2P5WE 2Z93A 3IPFA 2C0AA 3NQ8A 4KESA 4PC3A 4Y2DC 5ILTL 4EKXA 4Y96A 2FFCA 3CD6B 2HT2D 1BFVH 3L1OL 4N8CH 3LH2H 3VMFA 4NI6A 4HIXL 5AOKA 3C0LA 3ARQA 3MCAA 4CW1A 1CLYH 1NGPH 2JCCB 5TFSH 3D9AL 4E2BA 1WTLA 3DGCR 1NVMA 4F8XA 4EPEC 2QFRA 1M01A 1X9QA 3FKSA 1TJRA 3F4NA 4DT2A 1P5BA 4IQLA 4DCQB 5J12C 4Q33A 4FG2A 3S3DB 1ISYA 3LI1A 1ZWIB 1XGYL 4D8ZA 3KDMA 3C6LD 1GPFA 2C9QA 1DQJB 4PMUA 3RUBL 1SXZA 2J44A 1KD1D 3QDMD 4PJFA 5JO5B 3QFEA 4CW1B 3ARGB 1LOQA 4DF0A 3IDGA 4H2CA 2AJ3B 2E6JA 1CE6A 3NQFA 3FTWA 3TZVD 4FJ6A 2C34A 1O6SB 1VRSA 4KRPD 2R9HD 3AIRA 1SGJA 3VR6A 4WRLA 3UBGA 5J0BA 2FBOJ 1J9ZA 5IF0B 3CUFA 3WD5H 2YGVA 3QRFM 4MNGB 4DJEA 1KG0A 3W26A 4X8CA 3T8XB 2YBTA 4HX1B 2ZUYA 4J1UA 4UQEA 5ID1A 1BVZA 4NQEE 4GW4A 4ROXA 5D6CB 4O1BA 2XV0A 2E09A 3ASSA 2OO6A 4QOKD 1CBGA 4DGVH 2RGMA 1NZRA 2QVKA 4GW1A 2Z6IA 2WBWB 3EYSL 4C56A 5I8OL 4GKNB 3CC5B 4KW2A 3AQUA 3OG4B 5E4EB 1NUNB 4L0PB 2OTLB 3VD7A 3PHOA 5JXEC 1OK6A 1O9VA 1OB5A 5E8DL 2MCG1 4FNRA 4B9GA 4DP9X 4UM9B 2Z29A 4MJZA 4C60A 1J18A 3ULUF 4DLFA 1GZQA 2FO8A 1U6AL 4JJ5A 2VCAA 5HNTA 3DUUA 1U2CA 1DP0A 3BH4A 2EINB 1YPZB 4KZEH 2CBVA 5E1AB 3WL9B 3THAA 1NBYA 4EN3B 2GK0A 3P74A 4B27A 4OLVL 4AQEA 1XXDC 4P2OB 6TIMA 3HFFA 2WBKA 3ULUH 2OSLB 3QEQE 2X7LA 2DI9A 5EOTB 3LMYA 4IWWA 3BO9A 3IXTA 1YEGL 3N6YA 5JUEL 4OQTH 4BDVB 4DM1A 4GRLC 3P7YA 3KBSA 5C0AB 2WHVA 4IIQC 4QWWD 3ZYZA 4LB8A 2ZUXA 4OFYA 4YAOA 2YW3A 4Z42C 3KXFA 3QAQA 3RAOA 3GDMA 3Q8AA 4MKNA 4WK2B 1G7LB 3O9WB 2DZUA 2XFYA 1OE2A 3SCUA 1KXQA 2WZPP 1C3FA 2YD7A 2EXWC 2DZXA 2VWEE 2IPWA 2ZRYA 1HINL 4EOUA 4NWTH 3K72B 3N40F 2PURA 3KBJA 5JPNB 4XCYA 3M0YA 1QSFB 4XOCA 4PRIE 3AOFA 4P12A 1R3YA 1J0HA 4DK3A 2EKSA 1SEQL 1SVZA 5A16A 2V5DA 2WBJB 4HNOA 1NSNH 4QCEA 3UTPE 5C6TH 5E09A 4NN5C 4K1WA 1E28B 1EH9A 4CNOA 1GOMA 1ZT7A 1QOXA 1TFHA 1ZTXH 3DFYA 4N2DA 3VFRA 5M03A 1BEYH 1ZTMA 3V36A 1LL7A 1G1YA 2J24A 1TLMA 3H2CA 4Q32A 4GXWA 1OAXH 3LS5L 4FQ2H 2L8AA 3GXPA 2BNJA 5A16B 4GXMA 1WITA 4US5D 1CNVA 3AB0C 3T0EE 4ESKA 3B8UA 2NQ9A 2QR0B 2H9GA 2J21A 3QY7A 1Y6NR 3BAKA 3H7RA 5K9CA 5F4WA 4OLZL 1M04A 4J3TA 4LSUL 2J9YA 1IAII 3ULUE 4WGHA 2OCFD 1F8TL 1UOWA 1RZGA 2K3HA 3QC6X 2AERT 3QSKB 3UTQA 5HDQH 3BUVA 4LSVL 3MU7A 5JVLA 4XL9A 1VPOL 3DKJA 4PMYA 2CRZA 3GMOA 5EU3A 3UTTB 2YCIX 3V0VB 2XQYK 4XR8C 5KJRL 1H8SA 4C4KT 1WOBA 2PZNA 2VX7A 5L4IA 2CIKA 1ZUAX 3JZEA 3QXVA 3KLKA 2C16A 1KYOJ 2Z0BA 4RW3A 2W0PA 3INOA 1RAMA 4US5A 3PAYA 4D0BB 3R5EA 5BW7A 2H32B 1SFHA 3UTQB 2NR6D 3GIYA 5D9SA 2O4MA 2WAHA 4W89A 4PJAF 3THUA 2YPKB 3CBJB 5D7IE 4OSUH 3FRUA 3TJ4A 4YQXL 3T6CA 4GWEA 2Z65C 2FJHB 4JRXD 2FWOA 4MHHI 2ZOOA 1XD0A 2XFGB 4X4MA 1PEZA 4L8CB 3HCVB 4M0XA 3MLSH 2DLFL 3IGFA 4PB9L 2OPCA 1R30A 2VH5L 4AG4L 4PMEA 2PC4A 3SUUA 4HBCL 3DURA 2PCEA 3KE0A 3A4EA 3EYFA 1TWIA 3NEHA 5E0CA 4MLJA 3BYTA 4ZMQA 1G9MC 2O1AA 3PP3K 4DEPC 1CS6A 3T53B 1OWRM 1W8GA 3GMNB 3TIEA 3F5WB 3O81A 3RVUC 1BD0A 3GNPA 4IMDA 2I9LA 3V6FA 1MFCL 2IJ0C 3SPVB 4DGVL 1N2VA 2PI6A 3L23A 3MODH 2B59A 2PIAA 3KWWA 3UGVA 3WZ0E 4DIAA 2R9VA 1MVUB 1NJ9B 4MJIE 1SJDA 2ON3A 4LB4A 2WVVA 2ZTGA 2GWGA 4OZGF 3DFQA 4ZQCA 2ZL6A 4IGSA 3OJDB 2DZSA 4LSBA 4X7CC 1FVDA 2DMHA 4XO6A 2C9VA 5EEXA 1ICPA 2CCVA 1G69A 2CKBH 1WFUA 4JS3A 4O52A 1FNGB 3DROA 4LUIA 3MSYA 4AM0A 4JG5A 1IBZA 2CXGA 4ZYKB 1HQRB 4QXTB 3WIHL 5BRZE 4PJGA 2AI0L 5IBUB 5BYWA 3KXFB 1K6QL 3CU1A 6CGTA 2YL8A 1NICA 2QGCA 1AL7A 4HCIA 5IGXH 1EXPA 1Q6DA 4K3ZA 1C8PA 3T3PE 1DXIA 3PWPA 1I8UA 1EDHA 1QSEE 3LQZB 3WO4B 2BP0A 3ZT5A 5MEQB 3EOOA 3MGOA 3QZEA 5E7BA 1BFNA 3KL0A 5F7KC 3DFSA 3V1HA 1U3YA 4ZPTA 3VI4A 3FUMA 5TRDA 1PG7L 1TA3B 4IBLT 4OGXH 4QO1A 4A7UA 3BMXA 3CW2A 1T5KA 2AJZB 5A3IC 1XFCA 3UX9B 5ABFB 3FC8A 3L2NA 5E5RB 5AW2B 5LLIC 2CIPA 2F74A 4TF4A 3N42B 1RULH 3U46B 1VQOB 4Q8WA 1KB5L 5AD0A 2Y7NA 4OI7A 3MNVA 3U8GA 5DRZA 4ZL1A 1NEZB 2Z31C 3H9SB 5DCBA 5G4EA 4XNXL 5CN1A 1E6JH 1B0WA 2LVEA 3SUSA 3ZT7A 3VIFA 4V1DD 2EDOA 3ISWA 1BLNA 1N4XL 2EVHA 3VFCA 1TUPA 1AHWC 2ZQKA 2HROA 5A6MA 1R0AH 1WHOA 2VC5A 3NH7L 2I85A 2K4AA 4ERSH 4KZ0A 2VOMA 5E2WL 3DX9A 1VQ5B 3WIFB 4ANXA 1QPQA 3UTTA 3GYEA 3DVIA 1B3OA 1REQB 1ZVNA 4LFHG 5T3XH 3TO2A 3BH8A 1PL3A 4O1AA 5CPLA 2WB5A 3ULVF 2DSWA 5EUOA 4LCIL 4OZHB 3ATYA 4GKSB 2ZWYA 3CPXA 4G42A 1EP3B 5B38G 3QUZD 2YCLA 1YQVL 3MRQB 5IB1B 5C8JA 4LB3A 1D5BB 3QCTL 4NX0A 1S72B 2FK9A 4PJBB 4FO4A 4OIBA 1H7XA 3FA3A 3M0XA 3ASPA 2BOEX 4KAQH 4M6MH 2CLZA 3NGBB 4RV8A 3ES9A 1U3JA 3D8MA 1CVSC 2YPLE 3OGCB 1CK0H 5HYQA 2F84A 1F11A 3GDKA 3QIBB 3TV3L 5KVDH 1M4KA 4UZEA 1QNIA 2GTZB 4B3VA 3ECVA 1GXEA 1Q7QA 2A7PA 1BQLH 1L9QA 1GO2A 1UADC 1MJJB 2XWXA 4MHHG 4QYOB 3QHTC 4ICWA 4KOBA 1HKMA 4GXVH 2O9TA 3DRTA 2X3BA 2Y06H 5MHSD 4NYLB 1SQMA 2DM2A 2YLKA 3OPZH 4FXKC 5E6TA 4YHIA 5A7BA 1UCBL 2AHIA 1E4WH 2YAOA 1IR1A 4Z7QF 3LLDA 4HNTA 2FUQA 4U6VL 4XPTH 1W8NA 1KZQA 2OYNA 1A5SA 1VFBB 3F7YB 5H8DA 3ETBJ 1BJ1J 1YECH 1ZJAA 1URLA 2VL5B 4QRTA 5AZ2L 3WJLC 3O4OC 4HS3B 4BJLA 4TOYH 3E2RA 3EB2A 4UTFA 5AOIA 4Z2HA 2AEWA 3GKWL 4F80A 4JFTA 3D0AA 3O7UA 1VQTA 3PS7A 3MRRB 3D3VE 1ZM9A 4GP8B 4KKNA 5CGYD 5EZLA 1NC4A 2EF9A 4JQXA 3P3RA 1AIZA 4E9SA 5DR5H 3V6OC 2RDTA 4G3YH 4LVDA 3ZTEA 4LLWB 2PP9A 4X6BA 1KYUA 2YD3A 3RJQB 4OOSA 2ZL5A 3UJTH 2QZRA 4HK5A 3DGGA 3FO2B 4MAUL 1EJOH 2YQBA 4R4NC 3E2HC 4JPWH 4O2FA 4NOFA 4HIXH 5IJCC 5KSBE 1E6PA 4Z5RB 1WKEA 2D20A 1R5IA 3E0LA 3VIOA 1DWIM 3NJIA 1Z3GL 3ARXA 3WI9A 5FEXA 1QX4A 2XHNA 4JO8A 1BVKB 2KPWA 2WY3B 2OV0A 5DEGB 2F1BA 4A2MA 4Z77B 4J2XA 1BSLA 1AZBA 2DDQL 5MP6H 5K1JA 4A6YL 3FHAA 4FF9A 4JPKH 5HYSG 1EUTA 2F7QA 3KXFE 4OJFH 4BZ1H 3QJOA 4F8OA 1RBLA 2OKTA 5I73C 4YTUA 3GIQA 1KFKA 3BVDB 3MO1A 5EO0A 3R8QA 1JWSA 2B77A 1O7SA 3VXUD 1GYLA 4JN6A 3SAZA 4NCNA 3NUKA 1LYQA 1S7WA 1DEEA 4YBQD 4FOKA 3AMKA 4Y19A 1KLGA 3H3KA 2JJTA 4MSWB 5HHXL 4HIJA 2EIMB 4PRPD 5HDBB 5DY3A 4O4YH 2CH8A 4UMSA 3B0YA 5CG0A 2Z25A 4L1GA 1SM3H 2AQSA 2GTWA 3CFEA 2NXYC 2QGBA 2I7SA 3SN1A 4C91A 1RQBA 3ITGA 5JPMC 4NENB 1ZJHA 3SJVA 1WIUA 3LEYH 4H0GA 1S78C 4WNSA 2R1NA 4NUJA 3UXLA 3UXFA 5CWSA 4OAWB 3KW7A 4TUJA 3VO0A 4X7EA 2W9DH 2R8SH 3GTFA 2X09A 4MZRA 1F4YL 4IJ3B 3WS6C 1DQKA 4X8IA 2PUZA 2XINA 5F4SA 1JYVA 1TT6A 3VDHA 4XCFH 2H1LM 1D5MB 3KRZA 4R96A 4YVPA 1BZ7B 2ZZ5A 1ADDA 3NJFA 4QCIB 4TULL 4H83A 4N2YA 3H2AA 1JDDA 4UOZA 3IRDA 1JNJA 2XSXA 4QG9A 3W28A 3UC0H 2WUBH 1KEML 4RX4A 3UTSB 1BZOA 3LKQB 5GHWH 3L5LA 3GLZA 3NQAA 2YPIA 1L9TA 3TV3H 4JGNA 1EJ8A 3ZUGA 3ROOB 5I79A 1NGWB 4Y4FC 4UT6A 2Q7YA 1W16A 2FECI 3SGKC 3MUGB 1WOAA 2ITCB 2VR2A 4NJJA 1U8HA 1I8KA 3R1GL 1KJVA 4JPGA 4XCCL 4JDEB 4AG4H 1MIEH 4Z08A 2DOGA 4Z7IA 2ZYFA 3A0OA 3EF4A 5LCVA 1CFNA 2X1RA 3OHXC 4P4KD 3P2DA 3T8XA 3RRQA 3RU6A 4M8QA 4NIKB 4AC2A 3NE5B 2F2HA 4Q7BA 1FIGH 3OEEA 2UUDK 1FG2A 2WQSA 1JAEA 1GZPA 3L4CA 4UV4H 5D70H 3RKPA 5FV2A 4HJWA 5DS8B 2QKIA 2WNKA 3ZDXE 3LZFH 5MEOB 1S2TA 1IEBA 4ICXA 3DXIA 4ASTA 1AO7B 2DI8A 1VQNB 5G4MA 2BVTA 2KLRA 1E9ZB 2V4LA 1SDAB 2LU5A 4MA7L 3CH1B 4HHHA 4XMVA 3RRXA 4XD7A 4WFHE 4AWJC 4GFIA 4GP4B 4UXDA 1MELA 1XCTA 1EXBA 3F1QA 4JDBA 1A3RH 3BN3B 1IAIH 3HPFA 1EHLH 2GT9A 3DV6B 5LVEA 1RJPA 5D9OA 1LUCB 3D2UB 1NCIA 1IKNA 1VF7A 4NLHA 4YXLL 1H51A 2DV6A 4MYUA 1KTNA 4P2OC 5D1ZA 1XKJA 3VFMA 1Z7AA 4EH1A 5CLXA 4H6KA 5AC6A 3N40P 2BC4A 2N59A 5HVHB 2E9MA 3NEVA 4MDIA 3N06B 1XCTB 2M1KA 3L95B 3HZYA 4PV9A 4RGMC 2DW7A 1WD9A 4PHXA 3FSUA 3EOAB 1M56B 4Y7MA 5ADPL 3EXJA 1WDSA 3CEUA 4GKZB 4ELMB 5SWUA 2YXFA 4KPHL 4L56A 4FNTA 5CS7A 2WVVB 4KKCD 4L64A 5C92A 1T04A 2B7CA 2FHBA 4JHZA 4XX1G 3S3PA 3EWYA 3QS3A 3K72A 3WQ8A 3CD4A 3OBEA 3HOJA 4C65A 3AHXA 2HVKB 1L7TL 2W0FA 4O8RA 3W7RA 5D2NE 1FRQA 5GNYA 3C87A 3KWXA 5C7ZA 5I0DA 3N3MA 3O0RH 2VD9A 4X6FA 3QQ9C 2CLLA 1QI2A 3W11C 1QLEL 5J3OA 1H3XA 1KF9B 2ZE0A 1WEJL 4UTWA 3OW7A 2WNGA 3VFWA 3PYCA 3LSOB 2V7NA 3ZXAC 3MLXH 4CBZA 4V1DE 2LLEA 3O2VL 3TQPA 2CKNA 3QXUA 5CILH 2AC0A 2MCPH 3MRLB 4YWIA 2DSZA 1LP9E 3H7LA 5LNGA 2BV9A 1NBZB 2FBRA 3O9WD 1A7PH 5D72H 1SNRA 1K02A 2D22A 4JO2H 1E0OB 5CSRA 3DIFA 5C55A 1CCZA 1HZYA 4YFLI 5IEKB 3LSOA 4JE4B 2B8OT 4HCLA 2Q86B 2JKWA 2NW2A 1RZMA 5EU3B 4MZ8A 1ZEAL 3P3YA 3VM7A 2WO2B 4P8UA 4WO4D 5GJMA 4AEOA 5THXA 1I8IA 3UZ5A 4KQ4H 4QRPE 1OW0C 2HDNB 4HPXA 4AZHA 3U0TB 4GUPA 2ICWJ 4G6ML 3TTSA 5KZCB 1ZGLM 4M7SA 3S96A 4JFDA 4XMPH 4MDRA 4E41E 4S3JA 5C0QA 2NV2A 3KFTA 4UFLA 4AQ1B 3LTVA 1I9IH 1X7FA 3F2DA 3SCMD 3GRBA 3P54A 4LT9A 4KKCC 3TSBA 4Y4FA 4W9DC 4EIZC 1R2TA 3BPOC 3TO4C 1ZAHA 2HRLA 3EFFA 5A95A 2ZWZA 3RGVC 4Q9RL 3S98A 5EMKA 2JIEA 4WUKL 3ELQA 3S96B 1WBYB 3T81A 4DYEA 1GAQA 1QVFB 1GMIA 4KH2A 5CSZB 1NCCH 1U58B 3MO1B 5IQMA 1YITB 3O4LD 3CFDB 3ABZA 5F70A 5H2BB 4XP5H 1AYRA 1HC1A 4WI4A 4I13B 1HFBA 1XQLA 8A3HA 1FH5H 32C2A 1RJYA 4G6KL 2FVGA 3EH4B 3L45A 4GO9A 2F6UA 4QOKA 1MVUA 1NJ9A 1G4RA 1OD9A 3DMMB 2J75A 3W2UA 3TOPA 3VWKC 3F65A 4ZQKB 2X1UA 2O5YH 2FTPA 1XXFC 3Q6FB 1AMOA 2ZRZA 3D12B 3FSTA 4Z78B 1EIXA 3I50L 4K7PY 4TQEL 3UBHA 4UQCA 2UZ9A 1JA1A 5I66B 1SZFA 5HPMA 1VBJA 1M6JA 5I3GA 1FZOB 5GS1B 4QXTA 3AROA 3RK8A 5K59E 1KIUA 4E0FA 1UKQA 3KPMB 1K9EA 4F2UA 2DIBA 1WA2X 2HT4C 2VYRE 2BSED 3UPRA 1X96A 1PUDA 4ZCLA 3CVBA 2WPGA 4JDZB 3DOHA 5A2LH 2VVNA 5GGTL 4JZNB 4QR7A 2DM7A 3UYPA 4KHXL 5KSWA 3OKLA 3AT0A 1EFUA 4AZUA 4N28A 2FFIA 2PDMA 5LG1A 3GLEA 4HJGA 2VR5A 1HTIA 3WLRA 3B40A 1VRDA 3DI1A 1IFRA 4L8SB 4HAKA 4TUUA 3BEWA 3D4ZA 1T7XA 1KGCE 5F7BA 3T4AC 4FADA 5HGGS 3SECA 3WUWA 3N91A 3FQUB 3FUHA 4L3ED 2PN5A 2YWHA 1NCCL 3U46A 2VW4A 4WIQA 4P7QA 2DT3A 4JPQA 1KY7A 5DHVH 2DZEA 4P2VA 4X6CF 4PVBA 4TN1A 2VDQL 3DGGB 3FO2A 4FQCL 5FYJE 4OLVH 1OZMA 1ZSXA 5JIQA 4HFWB 3GB7B 4HWZB 4XP1H 2DAVA 2B81A 2BGIA 1XLFA 4P57B 4B5SA 3MR9B 1ACXA 1RCYA 4YJ5A 1FL5B 3VB9A 3WJZA 5JIHA 1G6RH 2CDFA 3WENA 4QKTA 4IT1A 4V1YA 5L7XH 4WHDA 3I7QA 3CH1A 1AK5A 1QHQA 1WWBX 4YDJA 1TTIA 2Y3AA 2XZQH 1TQXA 3O45B 5FO2A 3WXMA 2VDLH 5I1EH 3OG3A 2ZUQB 3S5LA 4V1DB 4EIUA 3PP4H 4JRWA 5JDSA 4XLFA 4LUSB 3A35A 4DJFA 1ZAIA 2UZYA 4Y19B 3TK7A 5A6BD 2OJEA 4PGLA 2AXHA 1MCOH 4PLKC 2YLAA 3WBDA 4I89A 4N3NA 3AY2A 4B6ZA 4KF1A 1E79A 4OZGA 4TSBL 1KFEA 3MMEA 1O5XA 3WTSA 4NBYB 1SXAA 2XN2A 1Q6RA 1RUKL 3VU2A 3PJLA 3G0UA 4RNHA 4M8VA 1CB4A 1TMCB 4Y2DB 5EZOH 1E5BA 2WSYA 3ZWTA 3K74B 3KDMB 3W2JA 1P48A 1K8ZA 1KPUB 4OJYA 3CFBB 3L9BA 2DW5A 4OIAA 2ZRVA 3OGVA 4FF5A 1PDKA 3D05A 2B1AH 2MJWA 1KWKA 3IVSA 4PPTA 4AV5A 1QUNA 1WORA 1U41A 3KDOA 1LO2H 4G43A 2GQ3A 3VGAB 3BT0A 3ZDZF 4OGYL 1TVCA 5TPWH 5IFHL 2ZTJA 4JQ2A 4H9GA 2DQTL 1I4FA 3SDCC 4RNIA 5J1SC 1NPJA 4IDLA 3ZO0A 4U6HA 3S0PA 3TONA 4DAGH 3ROLB 1QLFB 3TAOA 3UJEA 3LQAH 4ZQRA 1H8EA 4W8BA 2ZXGA 1HH6B 3HNSH 1XF4A 4X7DC 4N24A 5E2TH 3MV8E 3R8GA 3TTOA 1Q8AA 2FNBA 3PR2A 1WS8A 2X1WL 3NCJL 1QVOB 1FFPA 4XVSL 2XOKA 3RWDB 4WWVA 3JV4B 2X12A 4JDEA 2J5LB 2J57A 3L9RB 4PP1D 2BWGA 5JQHC 4WFFE 4M1DL 4DQAA 3N15A 4XD4A 4NWTL 3QWOA 3CPLB 3PGFH 5DVMA 3ARPA 4AIUA 3TT3L 4UIMA 4NP7A 3Q1EA 4JJ5B 1SEBA 4DGWC 3XINA 3PNRB 4L8SA 1GUVA 4KNTA 2F1EA 1YJDH 3C60D 3URQA 3MRPB 1JTPA 4P46A 5FUCE 4I4WB 4HF5H 1QO5A 4EUPH 3P3SA 3GSNH 1W91A 5DXWA 4RZCA 4YWGH 4AQOA 4LSTH 5L2KB 5HHOB 1IBBA 3QIBD 4U1GB 4RRPG 1ME9A 1BKHA 2CHDA 4G8FB 5ERWB 3ZK0A 2DQ6A 4O8AA 5EU6D 3RZCA 4KVCH 1RVGA 1W3KA 2CRMA 2P5PA 1CLZH 5GRWA 4K2UH 2XV6B 2ADJB 3DBSA 5I8EA 4HJ0C 3BIKB 3WFHB 2CLFA 1HVXA 1KIPA 1YAZA 2NZ9D 4JFQB 4UM8A 5E8OB 1OC5A 1RY8A 4E9QA 5CBBA 1GJRA 3RVVD 2DWEA 1Y1UA 3KDPB 1TZ8A 2XWBB 4WGVB 3URNA 2HRWA 3HZYB 1ORSA 2CM5A 1U3NA 4JX6A 3OJWA 2DIJA 2F54D 3BUYB 3ULSB 1SXBA 2IKGA 2AQWA 2NY7H 3L3DB 3KR3H 4EDWL 1S0UA 4MA1B 1TX0A 1LO0L 1XX9C 3PU7A 3L3JB 3EFDH 1DSWA 3GZPA 4I88A 4NC0B 4WHTB 3V5DA 5H4ZA 1TO4A 1G4SA 4DO6A 4XZUA 2G4FA 5D72L 2AJSL 3BRFA 2VGGA 3MJ9H 2HRPH 3QK0A 1CD1B 3CAKA 1BIIA 3HZKA 2VDQH 3KG5A 2VAAA 3S4SB 1I7RB 3SN6N 3H94A 1FCUA 2OODA 1ASOA 2KZBA 4GUIA 4H41A 2HLFC 1IEIA 1TQVA 3HAEH 5EU5A 2IS7A 4GBDA 1FZJA 1YDPB 1UQZA 4S3DA 3VMNA 1TCDA 3WCYA 3O6FC 2CLEA 5A69A 3KH3A 2JB6B 4H26B 4LAQH 5DS1A 3EJTA 4DVOA 3MV01 2WP3O 4OZIB 3NCMA 1KN2L 5C08B 1CICB 1S7QB 2HA1A 3RMEA 4PJ9B 4MAYB 1CD1A 1S3KL 2CO4A 1WAAF 2VXVH 3IMSA 2A6NA 4LLVB 1QD0A 3FK3A 2Q71A 4A1RA 4Y5YC 3K4ZA 3QUKA 1RV8A 3OKLB 4ZUTB 4KHTH 5FYJL 1YEEL 1DL7L 3BKJH 3RWHB 3ZKQD 5HUPA 2X4TB 1OQXA 4PBFA 2GI7A 3WLMA 2OKOA 1U92A 4OCYH 4JVUA 4Q6IB 4D9QE 4E0RB 3W82A 4JZJA 3U1SH 4KRUA 4KKRA 4F2FA 1NOUA 3WLWD 2DEPA 3RI5F 5MKGA 4IKJA 4ACPA 4HOWA 4IBZA 3B2VH 4J8RB 4MJID 5JZ7C 1JAKA 1X5JA 5DEFB 3GIZL 1G7TA 4H7CA 1E51A 1B3VA 1SW7A 1H3TA 1V3LA 1G67A 1U22A 3HKZA 1J9CT 4UDUB 2OX5B 3EA1A 5ANHA 5C9XA 2OSXA 1IM9D 2ZPKL 4XNBA 2X16A 4JZJB 4M48H 1WBXA 3QBUA 4N3GA 4OH2A 5DXYA 2ATKB 2BDNH 1BAWA 5EIIG 4FNUA 4FS9A 4OFCA 3GT6A 4E5XG 1I7TB 2FT8A 5DEFA 4PW9A 1F2JA 1XYCA 4I4WA 4XPFH 4P46D 3ARRA 4RWHA 2V31A 3CNYA 3V0TA 1X9RA 3A4FA 5CJBA 5BVJB 5K9DA 4WV1A 3PNWB 3E6FB 5HHOA 3Q6QA 4PG2A 1K4CB 5H2ZA 2CW5A 3HN3A 3BE1L 3MUJA 3AUJA 4XOEA 3P0GB 3WUZA 4GNKB 5EDSA 4PRNA 5A2CA 4CJ1A 4UOJA 4XMYA 4FFYH 3HMCA 2FHCA 1AQKL 3GKWH 4G59C 1BAFL 3LEVL 2EUXA 1IKOP 3DMMC 3HGRA 1DUZA 4B97A 1CWYA 5AZ2H 4L9YA 2GJ6D 3UXKA 2OKMA 2D03H 2ZNWA 1B4JL 1FPTL 2ZDRA 1EO8L 1NB0A 4UT9A 3C3NA 2O93L 1XZ0B 1Q6EA 1ENUA 1RZKL 3M9YA 3MGOB 5EA0L 2VDMB 3Q8E