2DIEA

Alkaline alpha-amylase amyk from bacillus sp. ksm-1378
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
481
structure length
481
Chain Sequence
b'TNGTMMQYFEWHLPNDGNHWNRLRDDAANLKSKGITAVWIPPAWKGTSQNDVGYGAYDLYDLGEFNQKGTVRTKYGTRSQLQGAVTSLKNNGIQVYGDVVMNHKGGADGTEMVNAVEVNRSNRNQEISGEYTIEAWTKFDFPGRGNTHSNFKWRWYHFDGTDWDQSRQLQNKIYKFRGTGKAWDWEVDIENGNYDYLMYADIDMDHPEVINELRNWGVWYTNTLNLDGFRIDAVKHIKYSYTRDWLTHVRNTTGKPMFAVAEFWKNDLAAIENYLNKTSWNHSVFDVPLHYNLYNASNSGGYFDMRNILNGSVVQKHPIHAVTFVDNHDSQPGEALESFVQSWFKPLAYALILTREQGYPSVFYGDYYGIPTHGVPSMKSKIDPLLQARQTYAYGTQHDYFDHHDIIGWTREGDSSHPNSGLATIMSDGPGGNKWMYVGKHKAGQVWRDITGNRSGTVTINADGWGNFTVNGGAVSVWVKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords amylase
publication title Ancestral sequence evolutionary trace and crystal structure analyses of alkaline alpha-amylase from Bacillus sp. KSM-1378 to clarify the alkaline adaptation process of proteins
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 177
structure length 481
sequence length 481
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2dieA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2dieA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dieA01
5A6BA 4KRTA 7CGTA 4MAVA 2WZEA 4GQRA 1R46A 3B8SA 4HOWA 3DX0A 5KZ6A 3VD7A 2WPGA 1C92A 3WQVA 1UQZA 3ZT5A 4BQ2A 4J7RA 4MB4A 1TMQA 1UKSA 3LMYA 2OSWA 3SUWA 2YA2A 2ZX6A 3A22A 4CCEA 3EDDA 3IAPA 3AYRA 3WQ5A 1M7XA 2VRJA 3RM8A 2WZHA 5E09A 1GQIA 1ZBCA 3B9EA 3QHNA 2E8YA 1BYAA 3WY3A 3OGSA 3A47A 3BAYA 4P8VA 2BY3A 3GXFA 4DWSC 1JI2A 1NOWA 2Y24A 4NZJA 1HL9A 1QNRA 3K1DA 3W38A 4AZ6A 4DWSD 2W62A 4W5ZA 1JXKA 2WWCA 1UR8A 2DDXA 1OT1A 5A6MA 1V02A 2O9RA 3OB8A 3AICA 3AS2A 1ZU8A 3PZIA 1QPKA 3WD3A 5AC4A 1KXHA 1C8XA 3CZEA 3AIEA 4ZE5A 3IK2A 3CGTA 3WKZA 4J3UA 1KCLA 2AOSA 3GXMA 2PC8A 3GBDA 1HVXA 4D6HA 3A24A 2CEQA 3ZR6A 1PZ3A 1NWUA 1E6RA 5D9PA 1IT0A 3TTYA 3SCSA 5F7UA 5A8PA 1UKOA 1OD8A 1BLIA 1E55A 5A2AA 3AIUA 2DSUA 4GI9A 1V08A 3WD4A 5GPRA 3VMPA 3WF0A 1XD1A 3SCWA 1HJXA 2ALWA 4AZBA 4KGLA 3S5ZA 4UZSA 1EXPA 3FN9A 4E2OA 4QFUA 1MQRA 3VUPA 1ODUA 2WCSA 2WVUA 2QMKA 3F5JA 4GO9A 3ARZA 3WMSA 4LQ1A 1JZ7A 3RMEA 3GXPA 2V3GA 5CSUA 2VRKA 3O9NA 4L4OA 4UOJA 2XGIA 3M46A 4U33A 1KQYA 2DT1A 1W3HA 2CCRA 2DSKA 3DHUA 5GNXA 1C8YA 3MMUA 3BLBA 1W1TA 2DSWA 3DECA 1LLOA 1V02E 5CPTA 1CXKA 1TVNA 3RILA 2DT3A 1E40A 2VVNA 3ARWA 2BY0A 3ZJ6A 1UKQA 1E4LA 3EDEA 1EH9A 1QOXA 2F2HA 1R87A 1TR1A 1W91A 2FHCA 2ZUUA 1XSIA 1GOKA 3WDJA 2CETA 3BUDA 4FLSA 1SFSA 2OSXA 1TE1A 2QPSA 3KL0A 5E0FA 2UY3A 5ECUA 1UWRA 1MW0A 4PN2A 3W82A 3PTMA 1XD0A 1XCWA 2A3HA 3VKKA 4W7UA 1BVZA 1UZ1A 3MUY1 3D51A 1QI5A 4PMRA 1QW9A 4EE9A 4B3KA 1P6WA 4QLJA 3LRMA 1XC6A 3T2QA 3BAKA 4UR9A 4CD4A 1XSJA 2W66A 4AC1X 5JIWA 1JYVA 1CGXA 5A69A 1V0KA 2FH6A 2YDSA 4V28A 5E6YA 4XZWA 2FE0A 1QW8A 4HPHA 2Y8VA 4FNRA 3HZ3A 5A8NA 3T2PA 1GVIA 3WD1A 2J7CA 4W8BA 5GNZA 2DGAA 3ARPA 2XHYA 2A3EA 1WZLA 4H8HA 4LPCA 4X0VA 2XN1A 2YIHA 3PN8A 1NP2A 1VENA 3QOKA 2CBUA 3ARRA 1JGIA 2NT0A 3WEZA 1LWHA 3O2LA 4JAWA 2CYGA 4PCTA 5BWFA 4W5UA 5GQBA 3UCQA 1QHZA 2RGLA 3EDJA 1CXHA 5CGTA 1OGGA 2EO7A 3ZJKA 4U5IA 5D8WA 1BFNA 2V3EA 4WLCA 2WHMA 3EJUA 4OBRA 1E6SM 2PWHA 1HJVA 1H09A 1UG6A 2W67A 3VIOA 1T0OA 3APGA 1XYZA 4KRUA 2VCCA 3WQ4A 3LXCA 5JBEA 5DT7A 1KXQA 1U33A 2B31A 1US2A 1K9DA 2W61A 4UQEA 4IM4A 1L0PA 1MYRA 4HU8A 8CGTA 2UY4A 2VQUA 4BQ4A 3SUTA 3AIQA 3CUIA 4EANA 2GDVA 3CHEA 2V3DA 3RO8A 2XG9A 2YL9A 2Y2WA 1CXLA 1AQHA 2VC9A 3ZT6A 4WK9A 1PEZA 1PIFA 1WO2A 3VGHA 2AMGA 3AHYA 1WNOA 2ZWZA 3GZAA 2D3NA 4H2CA 3NSMA 2WNWA 3NYDA 3QHOA 2O92A 1UWIA 1QNSA 3WL0A 2XWEA 1O7AA 4GQQA 1EHNA 2O9OA 3AROA 1C90A 1J0IA 1D3CA 3GBEA 4F8XA 3VGBA 1C91A 1UWTA 3S2CA 2VZSA 4A4AA 3W4RA 2D23A 3W24A 3OLEA 4JKMA 1JF5A 5CPQA 1EOKA 1WCGA 5CPSA 4YHEA 2J25A 2WKGA 3CZSA 3WBAA 4CN4A 1UA7A 2WMGA 1UUQA 4D6JA 3EJTA 2BHZA 4ACZA 1EA9C 2XVLA 2OWCA 1W9XA 2QPUA 4UQDA 2WSPA 4AD0A 5C8BB 3BUBA 2ZX9A 1BGAA 4GZIA 4F66A 3GH4A 1CTNA 5DT5A 4ZEPA 5M3WA 1EO5A 4UFMA 5FCZA 3CZKA 2XGBA 1KWKA 2JEQA 1TQUA 2BXYA 4WSKA 5E0CA 4MNLA 3UERA 3DYPA 3IANA 4W7VA 1HT6A 1BTCA 3FHAA 1J12A 1K9TA 1PJ9A 1UOKA 1V6XA 2A3AA 1G0CA 3PZUA 3A21A 4GXPA 1SMAA 4NX0A 4HMDA 1UA3A 1NWTA 2FHFA 3EDKA 4PTMA 3TP4A 2X2YA 2OYKA 3TOPA 2WMIB 3W6LA 4DO5A 1JAKA 1J0YA 3TTQA 3BUPA 1GQKA 2QV4A 4MTVA 2OW6A 2J75A 3AJ7A 4HZ6A 1EQCA 5I2UA 1C8QA 3CHFA 3N1AA 3PZTA 1NQ6A 1E15A 1KGUA 1MW2A 2XVPA 1E0WA 4QP0A 1B90A 5HPOA 4H04A 3AZSA 1B9ZA 1XGZA 3AXXA 4BA0A 4LYPA 1VIWA 3ARXA 3BCDA 1XCXA 2XPKA 4IISA 3OLIA 2O9PA 2WK2A 1E72M 2YL6A 3POCA 3ARYA 2QF8A 3A3HA 1TQSA 3L4ZA 3N12A 4PMXA 4ACZB 3POHA 3JUGA 1GQJA 3CUJA 4S3JA 3GXIA 3A23A 3SCUA 2YA0A 1W9PA 3PZQA 1DWJM 1A3HA 4A3HA 5ABHA 5IHRA 1CIUA 2XSBA 4TX6A 3BVTA 1ESWA 3SCPA 1HWWA 2PBGA 4C7GA 1RP8A 2WVVA 5BXPA 3NDZA 4N42A 5DMYA 3ARUA 3FNDA 2PBOA 4P7NA 2ZUNA 1E5NA 3WMCA 4JZ5A 5A3HA 3WNPA 4D1IA 3L4TA 3QR3A 3VNZA 4D6IA 1ZJBA 5DF0A 4CD6A 1KWGA 2BS9A 3WF3A 4W87A 5C70A 1ZB5A 3BC9A 1KTBA 2ZOXA 3ZT7A 1W9BM 2WZIA 4J3WA 4A3YA 4FNQA 3UR8A 2W63A 1VEMA 1G9HA 1JFXA 1GOOA 5I24A 3LPGA 5IFTA 1CLXA 3A4AA 2BHYA 4PCSA 2Z1SA 2OYMA 3IJ9A 4X0NA 1OIFA 1OINA 1A47A 3THDA 2OWXA 4OGZA 1B3YA 4N0RA 1ISZA 3AS1A 2EABA 1MW1A 4NZCA 1PX3A 4FK9A 1QHOA 1W2PA 4PTWA 1JZ4A 3K8MA 1VFFA 3VSUA 4NI3A 1Q6CA 3ARVA 2EAEA 1NARA 2EPOA 1JZ5A 4CKQA 2V3FA 3LPOA 2CIPA 1NWSA 3OZPA 4CU7A 2CHNA 1WZMA 3N04A 3AMDA 1HX0A 2DPEA 2UWFA 1W9UA 3BSGA 1RPKA 3IJ8A 5ABFB 4MNKA 3PZ9A 1V6VA 5CGMA 4HA3A 1HN1A 4WF7A 4AIUA 5AY7A 1B3XA 3RJYA 4KH2A 4HP5A 3DYMA 4HU0A 1JFHA 1R86A 3HG2A 2Q8XA 1WDPA 2WVVB 5ABGA 4GPNA 1VJSA 1K9EA 3RM4A 2HVMA 5AYBA 4Z2HA 4PRWA 2GVYA 3OA5A 2VR4A 2ZUTA 1F4HA 2XM2A 5D9NA 1XHGA 2Y5EA 1E56A 5E70A 4PTXA 3GTNA 3BUIA 4HOXA 4WSJA 5D4YA 5I79A 4WKFA 3TONA 3M7SA 2YFNA 2ZXQA 1TQWA 1WB0A 1UD2A 1LG1A 1FP8A 2FDMA 3K46A 2ZUVA 3WH8A 2MANA 5E9AA 3EJPA 2YJQA 3WN6A 1WKYA 2WBKA 1C7SA 4GI6A 1ISXA 4AISA 4AZCA 3IGUA 4AEEA 1B1YA 4R5EA 3VINA 1K6AA 3WH5A 2IGTA 2VX5A 5HPCA 1X1NA 3LX9A 2UY2A 3W27A 4J27A 4TOQA 2PF0A 1J0JA 2EBNA 1FOBA 4PMNA 5CZKA 1FH7A 3G6LA 3WNLA 3CZNA 2J79A 2XVKA 1E9LA 2IUZA 2X2JA 4DO4A 2WMHA 2XFRA 1LWJA 1QI2A 1FH9A 4OIFA 4FMVA 1XH0A 1I75A 5HOSA 2F8QA 2ZUWA 5E1QA 3VMOA 1JDAA 5A8MA 1KBBA 4FLRA 3WQ8A 3OGVA 3VX1A 2X0HA 1EDGA 1V3LA 4WJXA 4HA1A 4AZIA 4GZEA 4ZXOA 4J3VA 2JE8A 4W88A 3L2MA 2ZICA 3PZOA 3RDKA 3AIWA 3VDAA 1CECA 1ZL1A 4XB3A 3BUQA 2FHBA 3MI6A 4OKDA 1QI0A 1E3XA 3AISA 2WLZA 2A3BA 1JZ3A 1FP9A 1O7DC 2WVSA 1WE5A 2D0GA 4V27A 3LXAA 1FFRA 3L4UA 1C7TA 1WPCA 3WDPP 1LQ0A 3AS0A 2JALA 1LG2A 1UWUA 4PMDA 2WMJA 1UD3A 4FNUA 1E6PA 1R47A 4P8XA 5JUVA 2YFOA 5A94A 3PZVA 3WY2A 2PWDA 3L4XA 3WFLA 4MB1A 3VM7A 2GFTA 4HOZA 4KGJA 5ABEA 1CENA 4TVUA 1UYQA 2XM1A 2JF6A 3G6MA 3S6TA 1LL7A 3KL3A 5I23A 1J01A 2J77A 4DWSA 1MW3A 2WWDA 4AZCB 3DDGA 3AHVA 1G5AA 2FGZA 1W9VA 2D1ZA 3WENA 2J7GA 3WUBA 3A4XA 4PMZA 2VZTA 3GH7A 4QLKA 4CD7A 1HIZA 5CG0A 2X1IA 5JBDA 3H54A 3VDHA 4W84A 5LA2A 1DWAM 1CGTA 1GJUA 4BF7A 1J9YA 3M07A 2XFYA 5DO8A 1EDQA 3SCTA 3D52A 4P7RA 4BZYA 3MUAA 1HXJA 1HJUA 3O6AA 3T08A 3WH9A 4KMQA 1AVAA 4EKJA 1ITXA 3CMGA 3UR7A 3DX1A 1UKPA 1E70M 4Q7NA 2EEXA 5TD4A 1R85A 1BGGA 4CCDA 5FL1A 2CNCA 2W5FA 3VO0A 1GPFA 1E4IA 4PMOA 4JFUA 3K4AA 4W7WA 2ZXBA 3VIGA 4Q22A 5EB8A 4QCFA 4AD2A 1RP9A 5M03A 1TVPA 4H7VA 1ISYA 4ATLA 1N82A 1YQ2A 3MO4A 2W91A 1KBKA 1GJWA 3WELA 4F9JA 1EGZA 1UH4A 3GXTA 4D6GA 4PUEA 3BVUA 4EAMA 1US3A 1E1FA 3NDYA 3HG3A 1OB0A 4ML4A 1GUVA 3ZR5A 2WMFA 4TXEA 1EOMA 5I78A 4P7QA 1KR0A 3NUKA 1QBAA 2BVYA 2YA1A 1MFUA 2F7OA 5M5DA 3AXIA 4AD4A 4DWSB 3VDCA 3WF2A 4B9YA 4J3XA 1E4MM 1WDQA 1W1VA 4CUCA 3DX2A 4PEEA 4JFVA 5A8QA 2NSXA 1PS3A 1Y7VA 3VGDA 3L2LA 3ALGA 6CGTA 2BY1A 3MMDA 1GW1A 3ZJ8A 1SR0A 4U2YA 2VNCA 3DC0A 3IJ7A 2E4TA 3HG5A 3L4VA 4CU8A 3W26A 3ZOAA 2V5DA 2VCBA 1R33A 3CZJA 3VX0A 2G8ZA 1JYNA 4GKLA 3GM8A 1NH6A 4AMCA 4U31A 1TQTA 1JXJA 2VI0A 1UR4A 1BPLA 2VZOA 1JYWA 4W93A 2QLYA 2G3MA 3VD5A 1Q6FA 2YDQA 3WDHA 1UD8A 4OBSA 4L4PA 1MVYA 1BG4A 2WHLA 1WZKA 1B3WA 2QMJA 1GQLA 1RH9A 4BQ5A 3VIMA 4S3KA 5HBFA 3BXWA 1W3LA 2YKKA 1G01A 3MV11 1V0NA 2EPKX 2OWWA 2WC7A 2WC3A 1YHTA 2VTFA 1ZS2A 3W6MA 1R75A 3SCQA 1J18A 1B2YA 3ZSSA 1E43A 3GNOA 3OLGA 4H8VA 3BAWA 5CLWA 1MWOA 3I3EA 3VIKA 2W92A 4HPGA 1VAHA 1BQCA 4LXFA 2VZVA 1XSKA 1H11A 1CZ1A 1CXIA 4C7FA 4AZGA 3KWXA 1J10A 4FNPA 2PWGA 1QI3A 2V38A 5BXSA 3AIVA 1BF2A 4QAWA 1I1WA 4JIEA 4QLLA 4MB5A 1U2YA 2WVTA 3WFZA 4M8UA 2DEPA 2JIWA 1GVYA 3CTTA 2AAAA 4AXNA 3EMCA 4OZOA 4E4PA 4IPLA 4DUXA 4TVCA 3PZGA 3VGFA 3VGEA 5D9MA 4PMVA 1MQQA 2IXUA 1KXTA 5BXTA 3PBGA 1DHKA 3U57A 4JHOA 4NSBA 3HU7A 1SMDA 3AFBA 3AYSA 2WHKA 3L4YA 3OLDA 5DFAA 3VNYA 1M53A 1XH1A 3EJRA 2W4XA 2E9MA 3OG2A 1CPUA 3VVGA 3II1A 2WM0A 3QOMA 3OBAA 2X2HA 1E5JA 2DQXA 2VVSA 3CV5A 4ZXLA 2D0HA 4MADA 2A3CA 4MB3A 1S46A 4R27A 3TTOA 2J4GA 1VFUA 3ZQ9A 4H8UA 2CPUA 2DT2A 4NXSA 3VSVA 4UQBA 2GDUA 4TTUA 5BXRA 5GNYA 2BV9A 2EXOA 1FA2A 3D4ZA 2EPMX 1W1YA 2BFGA 2PI6A 4D6CA 2CKSA 4UQCA 3EMZA 1IZJA 2C8NA 3VOCA 6A3HA 2WSKA 3UEQA 2ZX7A 1OIMA 1UR9A 4AZ5A 1PBGA 2WHJA 3DX4A 1W9DM 3RM9A 1E6XM 1C3FA 3N18A 1L8NA 5HDRA 2CHOA 3BGAA 4F9DA 1MXGA 4UFHA 1R34A 1W3JA 3VU2A 4U3AA 4M80A 4MNMA 1KXVA 4K68A 3CMJA 2FGLA 2J74A 1V3IA 3OIHA 3CC1A 1XV8A 3T0BA 4PYSA 4AIEA 2XVNA 3MV01 1NWRA 2CKRA 1OBAA 2HISA 2GJXA 1EO7A 3W28A 3AHZA 3IAQA 3MSGA 1ODZA 2DH3A 5A8OA 3AOFA 1W32A 4HMEA 2IXVA 3AMCA 3WSUA 1HJQA 4OOZA 1KCKA 2GK1A 1WP6A 3DYOA 5CXPA 1JI1A 2VX4A 2YBUA 1GCYA 5IFPA 5I77A 3LRKA 3FXYA 5A6SA 4CU6A 3CUHA 2F61A 3N11A 3OGRA 5HNNA 3DDFA 5A6BD 5A6JA 2DT0A 4WKHA 3D5HA 3SCVA 4D71A 1BSIA 2X0YA 1H0GA 5FOOA 1UH3A 4D6EA 4MDPA 3T09A 3THCA 1G94A 4E8CA 2J7EA 3AMKA 1VEOA 1V3KA 2XN0A 5FD0A 1JYXA 3QHMA 2XUCA 4UOZA 3D3AA 2D3LA 3T0DA 3BLPX 1NM9A 1RD6A 3HMCA 2CBJA 3AMGA 1H1NA 1BHGA 2YLLA 2VO5A 2WW5A 1UR2A 4WKAA 5IDIA 3AZTA 1ZBVA 4ZFMA 2PWEA 1GHRA 1OWQA 4C7DA 1JZ2A 4CVWA 1JZ6A 1HNYA 1HKMA 2WMKA 1HKKA 3WH6A 4AZHA 3AIRA 1TUXA 1V0LA 2ZXAA 1AQ0A 3CHCA 2EADA 1JIBA 2X2IA 4B15A 1H2JA 4Z2KA 3LXBA 2OSYA 5BROA 4NRRA 1DWIM 5D9OA 5C71A 2DSVA 3KL5A 3AI0A 3K8KA 1U30A 3FHQA 3MUZ1 3U5YA 1GONA 3NIYA 4H41A 4RE2A 2D2OA 3WF1A 2GJXB 4AMWA 4D6FA 1X6NA 1M04A 1QX1A 2JF7A 5BRPA 4PMQA 4DO6A 1OCQA 1QNPA 1H3GA 4AYSA 2E9BA 1HXKA 1X6LA 4URIA 2ESCA 2YL5A 1JF6A 3WDRA 4AEFA 1PX8A 3BAIA 5FIPA 1UQYA 1ITCA 2BXZA 3BVWA 2VCAA 4HTYA 3WDQA 1KQZA 1VRXA 2Z1KA 1TG7A 3W37A 1B3VA 3CHDA 1XH2A 4CN6A 1VJZA 1FFQA 2WYSA 1PZ2A 1B3ZA 3ALFA 1XRVA 1J0ZA 3AIBA 1QBBA 3SURA 2VT0A 3PHAA 3LPFA 3FAWA 3WMBA 4KWUA 2E3ZA 1OD0A 3H55A 3D50A 1IZKA 1VFOA 3N15A 1ISWA 2ZIDA 1PX4A 2JFEX 2WANA 3GNPA 1GOQA 3SUSA 1CXEA 1BYBA 1QWUA 4OUEA 3WNMA 3F5KA 3UG3A 4AWEA 2F18A 1V0MA 2XIBA 4FLOA 2ZUMA 1E73M 2CESA 1JDCA 3EYPA 1FHLA 4QCEA 4J3TA 1UD5A 1KGXA 4GZJA 2WBGA 1EHAA 2YLAA 1K9FA 2EPNA 3RJXA 3WF4A 3FW6A 4UFLA 3K4DA 4PBGA 4YN5A 1Q6EA 2ZX5A 2WKLA 4UQAA 1B0IA 4U3CA 3AS3A 4FNSA 1CBGA 2VOTA 4LYRA 4MDOA 4JL1A 3GYCA 3ZJ7A 1ZBKA 4Z2JA 3A5VA 1DWFM 2J7BA 3CZLA 4PMYA 4RE3A 3I3BA 1WDRA 2YOCA 4GI8A 2WCGA 3WNOA 5E6ZA 1KGWA 3N17A 3GDBA 4NZFA 4B9ZA 5DEZA 3BMWA 2J7FA 4DUVA 5CJ5A 3KZSA 3VMNA 3NJ3A 5EFFA 3NSXA 4RE4A 4FLQA 3BH4A 2J7DA 4U5KA 3W0KA 2CXGA 1UD4A 1H0IA 4M29A 1E0XA 3LRLA 1D2KA 1H4PA 3S5YA 4HA4A 4B16A 3NCOA 1HF6A 1CEOA 2VX6A 4TTGA 1WZAA 2VMFA 1QNQA 2V5CA 3TA9A 4AIOA 4CVUA 1MQPA 1HP5A 3MS8A 4GIAA 4M82A 1JL8A 3BVXA 3W29A 1V6UA 3VDBA 3UG4A 2WXDM 5KEZA 3MANA 4CD8A 5A95A 3KE0A 3AZRA 1SYTA 1DWGM 2C0HA 1E71M 4M81A 1ZJAA 2F7QA 5FKYA 3VD9A 3RCNA 3AQUA 1E1EA 2E40A 3N9KA 1E6QM 1LF1A 1QI4A 4ACYA 2FH8A 2J78A 2EACA 4M24A 1MFVA 1ECEA 1V3MA 1FH8A 3CUFA 1VFMA 2CBIA 2VL4A 1R8LA 3VTRA 1E3ZA 1PIGA 1LL6A 3GXDA 1UR0A 2F1AA 1GORA 4OOUA 5LYRA 1JG9A 2XWDA 2VR5A 4UNIA 2D20A 1B30A 3VGGA 4D6DA 1TQVA 3PZMA 3T0AA 3LPPA 2X09A 5A6AA 4PSRA 4IPNB 3N13A 4YPJA 3WD2A 2RGMA 4UCFA 1UHVA 3H53A 3U7VA 3BAJA 2PB1A 4WIWA 5AYIA 3WUGA 3MKKA 1C93A 3WNKA 3ZIZA 4AMXA 3RPMA 4W85A 4QDMA 1E4NA 3SEPA 3TTSA 1W2VA 1MXDA 3CH9A 3EBVA 4E8DA 1EDTA 4PSPA 2E8ZA 4AYGA 1EQPA 1TFVA 2ZXDA 1GZJA 4FF5A 1UD6A 1BVNP 3A4WA 1M03A 2VX7A 4BS0A 4XZBA 3E1F1 2WCAA 5HXMA 1QNOA 4IUGA 4AY1A 5I6SA 2WAGA 2VZUA 3AHXA 1UZ4A 1HJWA 1CGWA 4ZE4A 4F79A 2J8GA 4DUWA 3F4VA 2YDRA 3K8LA 1E6ZA 3FAXA 4DM2A 1AMYA 2XYLA 4JCLA 4U2ZA 5CSYA 3VIJA 1UWQA 4HMCA 1KFWA 4ATWA 4AD1A 5A6KA 4D72A 2G41A 1KB3A 4W8AA 2EQDA 2ZE0A 1JD9A 3W25A 4HZ7A 1UKTA 1OGSA 2YL8A 5I5RA 4JKKA 5A6LA 2BY2A 5D8ZA 2XVGA 4J28A 5EBAA 4JFSA 5JIPA 3VILA 1CDGA 1W3KA 4W89A 3KEHA 3CPUA 1VBRA 2TAAA 3VIHA 4TUFA 1JNEA 5CQ1A 1JDDA 4JFWA 5A1AA 4MPKA 5I3DA 1VF8A 2DIJA 5BYWA 3BLKA 1HKJA 4XV0A 3WUFA 2D0FA 7TAAA 4Y7EA 3VIIA 3WEMA 1VBUA 2BHUA 9CGTA 1GOMA 2BVDA 2G3IA 4W8LA 2EPLX 4GO8A 4V2XA 4X9YA 3WIJA 4XX6A 2JEPA 1GNXA 3CBWA 1CGVA 1O6IA 3SCRA 1PAMA 3CLWA 2OYLA 1CXFA 4UZUA 3VSTA 4PTVA 1GOWA 3TV8A 4OJYA 1R7OA 2X8RA 4P8WA 4RL3A 1Z32X 4Z2IA 1E6NA 1PPIA 3B9DA 3FY1A 5FL0A 4Z2GA 4CN1A 2BNJA 2D73A 2WMIA 1QWNA 3CUGA 2D22A 2PWFA 4M1RA 3WY1A 3RIKA 4HZ8A 4CGTA 1J0KA 2WB5A 3NSNA 2X05A 2O9TA 1Q6DA 5JBFA 1BYCA 2ZWYA 4JKLA 1J0HA 1IV8A 2DH2A 3EJSA 3BCFA 1H5VA 1W1PA 1V3HA 5EFDA 3U5UA 2J47A 2ZX8A 3U7BA 2G3NA 1DP0A 4MNJA 1KTCA 1V3JA 2XJ7A 2GJRA 4UFJA 2F1BA 4BCEA 3L4WA 1KR1A 1HJSA 1LJYA 2D24A 2VUYA 3WEOA 3WY4A 3EJQA 1DTUA 4CCCA 3WH7A 4BQ3A 3DX3A 2Y4SA 4CD5A 2F7RA 5A2CA 1NP0A 1VB9A 1V6YA 4YHGA 1BPLB 1E0VA 1QVBA 3ARSA 3KLKA 4PUDA 1NOFA 1V6WA 3VD3A 1UH2A 4EK7A 1AQMA 3CO4A 3VPLA 5BRQA 1BYDA 1HL8A 2NT1A 1NOUA 4MAZA 4DM1A 2DSZA 4MJ4A 1CLVA 4B3LA 4AD3A 1TZ7A 3VIFA 1ISVA 2Y8KA 1QHPA 2VJXA 4UFKA 5I0DA 2BVTA 4UFIA 1HP4A 2F7PA 3VIPA 3D4YA 4JFTA 5EMYA 2GSJA 2E0PA 1CGUA 5BCAA 1OT2A 8A3HA 1CYGA 3QGVA 3MMWA 3ZM8A 2OLHA 3PTKA 3AMLA 4NF7A 3WL1A 2J62A 4TVDA 3HJEA 3SIMA 2XIIA 3HG4A 1SZNA 2YBTA 3EMQA 3MSDA 4JHZA 3SUUA 1DEDA 2J7HA 2WC4A 3ARQA 2GJPA 3EDFA 4TX8A 2XN2A 1CNVA 1J11A 5AC5A 3DHPA 3BAXA 3GXNA 3BSHA 3W81A 3MUIA 1JZ8A 1JNDA 1H49A 3BMVA 1Q6GA 4M56A 2CERA 1WDSA 3UESA 1OSEA 3GNRA 4LYQA 3SUVA 1CWYA 2NW0A 1H41A 1UR1A 1TCMA 2VURA 2E9LA 7A3HA 2J8FA 3ARTA 2G3JA 3CZ8A 1TA3A 5LA0A 4NXKA 3PTQA 5ABFA 1VEPA 1UASA 1LL4A 1CGYA 4P8UA 4NRSA 2ZUSA 4ZENA 3KLLA 4P7LA 1DWHM 5M17A 1FHDA 3WUEA 2DIEA 2EJ1A 1F4AA 4JCMA 2VQTA 2CBVA 5A2BA 3SCOA 1XYFA 1JAEA 3A6OA 4JL2A 3WQWA 3ZSTA 1D7FA 1G1YA 4AD5A 2OW7A 2WLYA 1HVQA 3J7HA 3WBEA 4XUYA 2C7FA 4UTFA 3CZGA 1BAGA 1V03A 2XSAA 4P7OA 1OM0A 1ZBWA 2XTKA 2GUYA 4LGXA 4PMUA 3UETA 2VRQA 4AW7A 1WAWA 3BVVA 3VD4A 1Q4NX 3ECQA 2FYVA 2CITA 6TAAA 3ZO9A 1EIBA 3WDIA 3WNNA 1OGBA 2JIEA 3PZNA 1GOIA 4AZ7A 5LA1A 3MU7A 1GHSA 3AHTA 4FNTA 3GH5A 3B9AA 3T2OA 2XFFA 4Z2LA 1M01A 2UY5A 4GINA 4J3SA 3CIVA 1JD7A 4UOQA 5CLTA 4MJ2A 2G4FA 1UWSA 4D1JA 1BG9A 1B31A 3UG5A 2QHAA 3HN3A 4ATDA 3I3DA 4W86A 1R7AA 4LX4A 3WQ6A 3SCNA 1HKIA 3WD0A 5IHSA 4UQ9A 3VM5A 1HTYA 3AXHA 1TA3B 2GK1B 3W53A 3ZMRA 1I1XA 3F5LA 3OZOA 3M6DA 5IXEA
chains in the Genus database with same CATH superfamily
3TLRA 3FLUA 2P8PA 1T04A 3FONB 5KZCD 1P0DA 4LBSA 4JLRB 4GSDH 3VD7A 4F9PA 4BQ2A 4WWNA 4CCEA 5KS9F 1KLUB 1L9PA 1QPXA 3B37A 1VFLA 1JNYA 4QBXA 5DRXA 2Z93A 1QWGA 3V0FA 1XUUA 4M61B 4I3SH 1ZUNB 3GSMA 3DTXB 4PYGA 5DJDB 1PYWB 4GRWF 4FTDA 1UEYA 4X60A 2DDXA 2JJ1A 2APVA 2B1AL 4PJCB 4HQQL 4AM0Q 3KEDA 5T3ZL 5TBOA 4TS6A 4HMNA 4IUOA 4Z7IA 3LKQA 3FFDB 3FYOA 2FWLB 3CN1A 5AZ2H 4ZUVA 1FNSH 3WTVA 1YDNA 4A7SA 4FR6A 2A77L 3BIAX 3ZHNA 1T03L 4ODTH 1TFPA 4LS0A 4E2OA 4ZXBC 1ME9A 5EUKB 4HUWB 1HNGA 1MELA 1LK3L 4U10A 5EBGA 1JERA 2Y1HA 1INQA 1KQYA 3GF8A 5FKPA 2GEEA 1ZD6A 4OV5A 4I7VA 4WCJA 5FYJH 5E6TA 3MXVL 3HA0A 3NQFA 2V2XB 3ASRA 3U0PB 2VYQA 3ZJ6A 3UTQA 1MSPA 1QOXA 1JPGB 1XSIA 3C5ZC 3HBLA 2Y5QA 5EIIG 2A9AA 3MRPB 4FLSA 3N14A 2A74C 4XQFA 2AV7A 2R82A 4Z7QE 4HGKC 4Y4KA 1OSYA 4A8NA 2TRSA 1MHHA 3I2CH 3V7AA 1Y0YA 2F19H 2X4NA 4OLVH 4CD4A 3QI9D 5BMFL 1D9KB 4HUCA 4G8GE 2VLRE 1OPGH 1T1WB 4LNVA 5BMXA 2J1XA 2NY2D 3FU9A 1FNBA 3HRZB 5H8PA 1H5BC 3DXAB 3ARPA 3PP7A 3QOKA 2OBGA 1M6UA 4TOYH 5C8JA 4HC1L 4N4QA 1HILB 4WFFE 1M3JA 1BD2E 1J48A 4ZFFB 1BZ7B 4OF3A 4XN1A 1IFRA 4AYFB 5D4QA 2PDKA 1J93A 1BFNA 3KCJA 1HIML 2Z9TA 3LZFL 4DXKA 2CMRH 4AJVA 1R1CA 5LBVA 4MNQA 5HJYA 2Z8SA 1WFUA 3WD5L 1NPJA 3BFQG 4H8WL 5AOZA 3AGQA 5AVRB 3SPJA 2XACC 1MUWA 4YWGH 3AIQA 1BEYH 1YNTF 3LTVA 4J4KA 3LN3A 1EEYA 2B5OA 4TMVA 1KIQB 2Y36L 3K1KC 3U0WL 2LTQC 3EX1A 1OGIA 1AQHA 5DJ2A 3ZT6A 1GY2A 4WK9A 1FO0B 2IAND 3TF7C 4TMTA 4PBXA 4ODWB 1VGKB 2QGBA 1S9YA 5I1KH 3QHOA 3CX5J 4PJDA 1W34A 3LHWA 2DUZA 2ESVA 5AVQB 1BMWA 4NYUA 3G6DH 2Q87A 3W2IA 3VGBA 4PFMA 2PSNA 1X44A 1DVFC 1GL4B 3GMRA 1VC4A 3SJPA 2KYIA 3FMGL 3SGJA 1WCGA 5IBXA 3ABMB 4FI7A 4UMBA 1PSKL 3T65A 3MV9B 3OAZH 1EA9C 4YQXH 2ROYA 1WGOA 1KDIA 2OWCA 5KJRH 2Z0UA 1DG1G 4UQDA 5C8BB 2E86A 4F66A 3TNMB 5DT5A 4YK4B 1EKOA 4IBQA 2EE6A 2JEQA 1WRFA 3FB8A 4UU9A 3Q4DA 3SDCC 5E0CA 2VKXA 3QH3A 2QCMA 1DANT 1LO3L 4ZB2A 5DJ6B 3OTRA 3VOGA 5FYLD 1CD8A 5EO1B 1UC6A 5IB4A 4L64A 5G1YA 2R2BA 2NY0B 1XGQA 3T4AC 3NQ7A 2XYBA 3S0PA 2PTXA 3G7TA 3Q5YA 1J0YA 4XCEA 4ANVA 1EMTH 2QV4A 1I85A 1ZIAA 4JFHE 5CZXD 4XPBH 5T5FA 3H0TB 2O61A 2OLDA 4QP0A 1RZKC 4IJ3B 4MA8L 1B90A 3V1HA 3AZSA 3NRQA 4LMQI 1QUNB 2YQ2A 4DTGL 1SEBB 4NO0A 4XQ6A 3UTSE 4U1MB 4O14A 3ARYA 1QFEA 4YC2C 1DJWA 3EOBA 4NENB 5EOCL 3BZGA 1GQJA 1LYQA 3SDXB 4LCWA 3AVYA 2Y5TA 4XMLL 3UBHA 3QJOA 3WN5C 1P43A 1T96A 4XZ4A 3MP3A 3GBML 2PBOA 2ZUNA 4JZ5A 4QDPA 4D1IA 5CKGA 2C9QA 3M6YA 1D1NA 5HHMD 3BGFC 2ZCHL 3CD6B 1AI1H 3M7WA 4W9FC 1IHMA 5JNYA 1GZGA 4IBVA 1Z7JA 4R71A 1A6AB 2I7GA 1NDMA 1PCWA 5ACZA 4HA0A 4IJCA 4IU3A 1XLJA 2H3NB 4R5TA 3TYDA 3KWTA 2W9MA 4U1SA 4K71B 1I7RA 3I55B 1Y18B 1S7UA 3L4CA 4KCVA 3IDMB 2E7DA 4KY2A 1US0A 3NDZE 2VDGA 5CGMA 4WNQB 4PW9A 3RWGB 3TO4B 1Q9KA 4QXGL 2R6HA 3RM4A 1OCJA 2GGHA 4Z7NE 2ZQKA 2GVYA 3PG8A 5D9NA 1XHGA 5B3SB 3OKKA 4LB4A 2O4MA 2WUBH 5E24E 3GTNA 3VO2A 3T55A 2YFNA 5JXEC 4DELA 2EZ0D 4JXCA 3QUZD 5E9AA 4AQ1A 5B22A 4WO4D 4HN8A 4L5ZA 4N3NA 1AGDB 4DP2X 3NG3A 4ZMQA 2YRBA 2R29A 4FXSA 1MJUL 2QVMA 4L6DA 2EH7H 1QO3B 4G1EB 1ADSA 4I0KA 3MA9H 4TQIA 1HDMB 3C2AH 5IV2A 2R14A 2FB4H 1H3PL 1BJ8A 1E9LA 2C77A 1JGLL 1FH9A 4FMVA 1JCVA 1BBDH 1IC5L 4GGBA 1Q9OA 2BWGA 4HLZH 3EGJA 4FLRA 1KEMH 4ZMLA 2W07A 5I8KH 4W88A 1ZL1A 2ARJA 3BW9B 4JZNA 3O9WA 4K7VA 4QCIB 3HUJE 5HYEA 5T1DL 1WE5A 1AD0A 3SJVB 5KTEL 3O63A 3FT2B 2JALA 1NBVL 4PMDA 3UTOA 1ZT7A 1R47A 3MLVH 3H6OA 5IHZB 3INOA 4HOZA 3PBWA 3WS6A 1VZIA 2UZXA 2FZ3B 5MHSE 5CBAB 4LVBA 2G75B 3LN5B 2OZ4L 3U4KA 2BIHA 2Y7EA 3W9EA 3IGSA 3SQMA 4HCDA 2PDJA 3CUPA 5JO5B 3B0XA 1LE5A 3AQDA 2H0PA 3GUWA 3FUIA 2ZWLT 3SY8A 4DP9X 4RDYA 1DJQA 6FABL 4Z7QB 2OXHB 1KB9K 3BLEA 1P53A 5GRUH 5IB1B 4Y9MA 3IJYA 2ZXEB 2F8OA 2P8BA 5D71L 1AQKL 3FT4A 4MMYB 4X2UA 2R0ZH 4QEGA 5FUCC 3BZ4A 3FTXA 1WA3A 4G8GB 1KELL 2VLRB 4GUHA 3FQUB 3UG8A 1P9MA 4NI8A 1UQSB 3HG3A 2DLHA 1UROA 4Z7OE 1BQSA 2DZVA 3IDUA 5I78A 3A3BA 3NJVA 4KHXH 5F1IA 2V7QA 5FUOH 4M4PA 6REQB 4OZFB 4HGWB 5EF3A 4FXGA 4L29B 4MJID 2NSXA 3L9RA 4MD5B 4NQCE 3U3HA 4YFEA 1YXYA 1BD2B 4I1NB 3NA4A 1GC1L 3GSNH 1UXMA 2UX6A 4AJ0A 3BY2A 4D9RE 4CU8A 2V69A 4NKDA 1XE1A 3VI3F 4PQXA 5ADOL 4A2HA 4QLRA 3WLMA 2O5YH 1VQ5B 5LCVL 1VZGA 4X80H 1A50A 1KT2A 1UT1A 4L8JA 4XPTH 4OBSA 4NUGL 4WI4A 2WUCL 1L6XA 4MFEA 3VFUB 1GQLA 4FEIA 3LCHA 1AANA 1W3LA 1G01A 3RX4A 2VLLB 2OWWA 2AQRA 5T3XL 3MLRL 4D9QD 1N9PA 3SJ3A 4LGSB 4K7PH 3F83A 4FQ1H 4ONHB 2CLVB 4RIRB 3G5VB 2VEPA 1CZ1A 2ALRA 3ZTEA 3KWXA 1J10A 3QPXL 1SSDA 1ITQA 1QFPA 1JPSL 3T6XA 4PJGE 3FPPA 4EX4A 3O1NA 2XWCA 3IF1B 4MGGA 4ZVJA 4E4PA 2R9HC 5DI8A 4RZKA 1NIAA 2PLKA 1DBML 5E23A 3KWWB 4QHKI 4I9JA 1DHKA 3O2VL 3U57A 1Z42A 2HLFD 3U48A 3RL1A 1RZ7H 1K70A 4MJ5B 3EJRA 1EGJH 2Y6SD 2FVLA 4Q33A 1FV1A 1JWUB 1V7AA 2X2HA 2K6YA 4RFNC 2D0HA 3Q94A 2Y7OA 3UU0A 2A3CA 2WGNB 2CXEA 1H6UA 4H8UA 1V77A 1K03A 5BXRA 4EQ3A 5IREA 4JFFA 4XVTL 3T04D 1LQAA 4FI6A 2DQMA 2CKSA 2JKTM 2VN4A 1NOLA 3PWJA 1XBXA 3BE1L 2B4CC 4F7PA 1M05A 3EGDA 3ARBD 3FU3A 4ODUA 3AITA 4XWGH 3VG0L 5KNLA 4PC6A 3FULA 1V7NH 4JIQA 5D4JA 4H9MA 1OJXA 1Q7QA 3DBXB 4LIQE 4ZAKC 1XAUA 2I5GA 3WSUA 1HJQA 5AKSA 3DYOA 1QNZH 5D2LF 4QD2E 1JI1A 2E7LC 1D5BB 4YLWA 2YAQA 5IVXF 3T0WA 1P4MA 4U1IA 2J7KA 4MA3B 2DT0A 1C16A 4QDGA 3QFDA 3S1WA 3D4CA 3EWDA 5IBUB 4F2TA 1JWSA 3AREA 2IJ0C 3ZRCC 4UOZA 2MJWA 3CAKA 1K8CA 3JU2A 1J5SA 1L6ZA 2Z8WC 4AZUA 3R0UA 2PEVA 1U36A 4HJSA 3MLWH 4P4KB 4L48A 2PWEA 3RY6A 3IK4A 3QWOB 1TPXC 1CFVH 1RVFL 5AYQA 1BZEA 3QIWB 3NE5B 3CCMB 4IBUA 1BM7A 4KROB 2WXNA 4NQEE 3SOBL 2NWRA 2XSXA 1QX1A 2JF7A 4RDJA 1MRFH 2YW4A 2E9BA 1OCBA 3BAIA 1C08B 1G4TA 3ZX1A 3IEAA 4RZCA 2VAJA 3U9UB 4UTLA 1MHEA 4MYPA 1L9QA 1ORQA 4Y9FA 3F01A 1MVUB 3A67L 4U1NA 3F5WA 1YY8B 2Z1WA 4IMEA 3VH8A 3F5KA 3FOLA 1U22A 1FHNA 3V6BR 5KVFH 2CESA 4K94H 3EYPA 4MLJA 1FLRL 4AVNA 1NEZG 2WBGA 1EHAA 2FYMA 3AACA 1K9FA 3RJXA 4PBGA 4PJFF 4AIXA 1KJ2L 2YMXH 2CJUH 4EF8A 4U3CA 3CLFL 4JEJA 4MQXC 4U3HA 1N8IA 4FOUA 4S11A 5AVVB 1T7XA 4FHBD 1I3GH 3CZLA 2CDFB 3G6JA 3R1GH 3PWNB 3LKSA 4QG6A 4M5SA 1P4IL 1WDAA 2ADIA 1F4XL 5CZVH 1FWHC 4RFOH 3UPMA 5FLUA 1UP3A 2R0WH 1Y5WA 3EWCA 4RD2A 2O4EA 2CRZA 4B5NA 1KKOA 4KWWA 3C5JA 1AG0A 4GW5B 4Y4KD 3VXSD 1BM3H 3HUJB 4C6OA 3VI4E 4Q9BA 3ELAT 1NMCB 3SPHA 1WZAA 3XINA 4Z7AA 3ITLA 2ZA1A 4FQJH 4U6VL 4CD8A 4Q8NA 5EORH 1NFBA 1RSFA 4L8CB 2NY3D 1E1EA 4NQTA 4MY9A 2ZOKA 4UB9A 2FH8A 1TVLA 1Y6MR 3MZGB 4G6AC 5HMDA 4M1GL 1ZTXH 3PWUB 3MBWB 4ZTEA 4WKXA 3UAJA 1UR0A 1CFNA 1H42A 2BZDA 2FWUA 5EU6B 2BGJA 3TBSA 3CFJA 4JO3L 1JA1A 4LLYB 1PU0A 4UINL 2VIRB 4NAJA 3IDGB 3PREA 4PR5A 4ONGH 3ZIZA 3RPMA 3ZZQA 3M64A 5I19L 1WAAF 3HE7C 2OPJA 4JFXA 1VFAA 5CIPB 3BRGC 5HMEA 4P6VF 2YCLA 4R3SA 1GZJA 4UNLA 4LCYB 2VX7A 2ICSA 4HKBB 4W1TA 3N91A 4N2OA 3GPSA 1CGWA 2DKMA 4ODVL 3VNJA 4YJZL 2GTZB 4WU5A 4Z7OB 1K4CA 3A3WA 3D0LA 4LEFA 4AF0A 5A2KH 5FA5A 1BZDA 2ZE0A 4K5NA 4PC8A 1OGSA 4QXUH 5I5RA 1TYJA 4BM7A 5D8ZA 3FB7A 4NQCB 5JIPA 3B2VH 5FGBC 3KFTA 4JY9A 4QE1A 3CPUA 5LMZA 1VBRA 1ONEA 3VIHA 4GT0A 1Q0XL 3FSZA 3QPEA 4ASTA 5B38G 2YZ8A 3TYCA 5DEFB 2XZ7A 1O7DE 3O6FA 4LRNL 3A0OA 3PFQA 2IPWA 5GZOC 3O2DA 4ZPTB 4EPDC 3X3GH 4HSAC 2B3IA 3MNVA 4LLVB 4DH2A 4BK5C 2YWFA 4L3EE 5E1IA 3LD8C 2HLEB 3FQTA 3BT2L 1GTFA 1GZPB 5HGDB 2PUZA 1J0HA 2PCFA 4P05A 4O1DA 2AGTA 3DOIA 2XT1B 3WMQA 3HCVB 4UOW1 3RGTA 4ZO7A 1BQLL 4PJGB 2X6WA 3EAKA 1V3JA 2ISSA 2I07B 5HJBA 2YRPA 1K73D 1A4JB 4PTUB 2OX5A 4W9GC 3CN0A 1BMFA 4NO0D 2VUYA 4TSFA 4AV0A 5DRIA 2DZEA 4DF0A 1EBAA 2VXUL 5C9JB 2QAPA 4FA7B 1VB9A 4LSUL 5K9QG 3NN8A 3P54A 3VD3A 3LRSB 2HPIA 3CO4A 3SPVB 1B4JH 5D9SB 3AGPA 1WWWX 3TW9A 2FZ9A 2RJMA 2ZZGA 2JTDA 2VJXA 2BVTA 4HPYL 5C08A 2GQHA 2ACQA 1SYSB 3VIPA 3AADB 3W1LA 3NVDA 3TH2T 8A3HA 1IL1B 1DLFH 7FABL 5F21B 2VD8A 4OCRH 4GY4A 2HPTA 1OAJA 4AZ8B 5E51A 3BV7A 5K4XA 1O7SA 4GB9A 4N5ED 2CA3A 1EGJA 1V55B 1FBIH 1GTHA 5HULA 2NQHA 2DQFA 3BSHA 4R7NA 1W72B 2BJML 3GR7A 2HSIA 4H0GA 4KJQC 1AIFB 3ZVIA 3LQAH 4YUEL 1TCMA 4OBTA 3VC6A 4KQNA 4N4PA 1SJHB 2P47B 1D7DA 1KY6A 2DQCL 4M03A 3KBEA 4BF9A 1OF0A 4BH8B 1TVCA 3S37X 1ED3A 1KBLA 3WUEA 1B0RB 4JTGA 1QEXA 1QUFA 1EXUA 4QO1A 3QULB 4OJFL 4H1LG 1G7CA 2OW7A 4ZTYA 1BJKA 3IYLW 3MOBH 2CIIA 4RRPA 3CC5B 4P7OA 1LJMA 2VRQA 1WAWA 3U9PL 1MJ7L 1Q4NX 3JWNC 2FYVA 3F2LA 4HE6A 3CMEB 1U58A 5LIXX 5LA1A 2PW1A 2D31B 2R15A 4I87A 4HWZB 5KSAA 2PDIA 4ZUSB 1UOVA 4XM3A 4UOQA 3I9IA 1XT5A 4N2IA 4DP6X 4F2UA 3C3UA 4Q7IA 4LOVA 2FDBP 1PKQB 4PWJA 4XWOC 4NQEB 3OKXA 1BJ1H 3JT2A 5K9KA 2C9XA 4ODSL 4YDMA 1BQRA 4BI5A 4YYFA 4GQRA 3ZMEA 2YQGA 3EJZC 2QDWA 4GW4A 1YEFL 5GS0C 1OZUA 4UZFA 5E94B 2HLDA 3O9WD 1AMKA 2ORBH 5AKRA 2P46B 3LMYA 3ECVA 5C9RA 1DCEA 2ZSVB 1KIPB 1P7KB 2E8YA 1YA5A 5E6SB 3DIFA 2OBRA 1P6AB 4ZX6A 2RUSA 2XH2A 1E27A 5E93A 4DP4X 1DVQA 5ID0B 1X7IA 1OQXA 3OIXA 4IS6A 2XKSA 2WWCA 5H37H 1OYCA 1QTWA 3ZDXE 3ZTJH 5DDHA 4B3EA 3QZLA 4HHAB 4N0UA 4LPTA 3AIEA 1IAOA 2PC8A 1GSKA 2QTLA 3SDYL 4GW1B 4ZQNA 4FQLH 3GMQA 3EWXA 2YEZB 1H8NA 2ZDSA 4XBPB 2E47A 1KPUB 3VMPA 1XD1A 1DJZA 4R9OA 4NNPH 1QH0A 4QRUA 1TG8A 1PE1A 4KTDH 4L0ZA 3FN9A 4NAEB 5A7EA 5FYJD 4WRHA 4EE2A 1F76A 4Z3FA 3O45A 1NIBA 3MLXL 5KSVA 3VE7A 5A2IH 1P5VB 1NBYA 3DSNA 4XBGA 2WQVA 4XP6L 4OT7A 3CJJA 2I56A 4BZ2A 1KBGL 4Z7VA 3VWJB 3H12A 2WLKA 4U1JB 2R69L 2V5KA 1XBVA 4YHIB 2OXNA 2R8SH 5C0ND 4HKZA 1UPMB 4Y7OC 5I7GA 4LVOB 3VB8A 1YIJB 4Z0JA 3U36A 1OAYH 2FO4A 3D51A 2KMWA 5T1MB 3VFNB 3TXVA 1TEFA 3SIKA 3R0MA 1XC6A 5C3LD 5B8CC 3EXTA 3HMXL 3HE7D 1W1B1 3HC0B 3BO8B 3RI5F 1F3WA 2BVEA 3LNFA 3TA4D 3H9SE 5DTFA 1W2BB 3F85A 4L4TE 4P2YA 5IQ9A 5AD0B 2GTWB 4HIJA 1F90H 2E9JA 1DV7A 3STPA 3LQ6A 3UTPD 3DVIA 4ZMVA 3KOWA 4NC0B 1RUAH 3VI4F 3TIEB 2FVGA 5FXCH 3B9VA 3RWEB 4XNYL 2RGLA 1RK0B 3WLSA 4F8OA 4OECA 1DBKH 3EWYA 2V4DA 4A8IA 2WBJA 2LLLA 2DDQL 2WHMA 2QDDA 4NS0A 43C9A 2XA8H 5KVEE 4QUZA 2C26A 4WUUD 3BP4B 4Z3JA 4OD3L 1NUFA 4KRUA 5HINA 3MRGB 4AHPA 1HINL 2G0KA 3BKJH 2E9WA 4OAWA 2W61A 1J9ZA 5HGHB 2BSBA 3B4UA 4H6EA 3OGCA 3NPSB 5IW1B 4EUPA 5E08L 1AZNA 4KFPA 4X9SA 1PDKA 4C6DA 3WXWL 3KR3L 3FDKA 3SD5A 3IWPA 4L1DA 4LKXA 4IMKA 1EBGA 4YHBA 3SE4C 4EZLA 5D37A 4Z4RA 3D4GA 2Z1BA 4I4WB 4YHNB 4EWND 4DSYA 4JFFD 4GK8A 3SE8L 4RZ5A 2JIXD 5BVPL 4P5TC 2HV5A 1YTEA 5IB2B 5EOTB 2ATKA 5CPSA 2WQWA 2W6RA 2F5AL 2VM4A 2WKGA 4CN4A 4FG0A 1UXSA 2BHZA 5BRBA 4U9UA 2AQNA 2HWZL 3QO1A 4PULA 4P04A 1NICA 3LV3B 4AMKL 3LTYA 3GSQB 5EF1A 4UFMA 4J8RB 3BKML 3Q45A 1KWKA 4WSKA 4M7KL 4MMZB 2ZSWA 1DL7L 1PJ9A 3EKCA 3P77B 1U8NB 3QA3A 2IANA 4HMDA 1TJHH 2DY3A 3FYYA 2X2YA 3TN0B 3AXMA 1A5MC 2Z8RA 5I76B 4PV9A 1VQ4B 2CZEA 4F8QA 4M4SA 1I60A 1E9OB 3ARED 3UJFA 2NNAA 3F7VB 5B1AB 1IWBA 2NV4A 4DW2H 3POCA 2I69A 4G9DB 4PJAF 4KJQD 2ZXWB 5K9CA 4ZTPL 2CWRA 3H85A 4FYRA 3FQYA 5BPPA 2XSBA 2CRIA 1RZKH 3NZ8A 3T07A 1R5WB 1BJ1J 4KVNH 4N8CL 5KS9E 4C7GA 4O2EB 4IHOA 4MGXA 3BFOA 4FFZH 2MEJB 1W6WA 4GXVL 3VNZA 4LCCC 3TWBA 3OL2A 4NUMA 2QIIA 3DOSB 1Q1JH 2WZIA 4J3WA 1BG1A 4GRWE 2XTSA 2ILLA 1O94A 2DQHH 1RY0A 3P80A 4JDBA 3P2DA 1XWVA 4MBRA 3MLYH 4DBWA 2GSIB 1A47A 4XHJD 2LT9A 4IRZL 4E5XB 3BSZL 4US6A 1FFOA 4CDHA 2R1YB 5C0AE 4Q4KA 4OZIA 1FZJA 5IJDC 1N4XL 3ARVA 2EAEA 3OVRA 4O54A 2X0VA 2DQ6A 5E2WH 1ZPLA 3N04A 3P3UA 4JFYB 3BSGA 1ONQB 1DVUA 2VJ8A 3GRWL 5ABFB 1W16A 5IMLA 2CDEB 3N50A 3F4CA 3KXFE 1I1CA 4HP5A 5FA3B 5T5NF 2NUPA 1PLGL 4LEOB 5E2UH 1T2QL 1VJSA 1U93A 5GRVL 5HK4A 2Q76A 1ZV5A 4MUPA 3TFXA 3TL5A 5L46A 2VDQB 5AB9A 2IG2L 4GUFA 4K94C 2PCYA 4NKCA 1QSEE 3CIWA 2P8MA 3QZNA 1F2JA 4OGAD 3BG3A 3M0YA 4DN4H 4AISA 3EOAA 3IGUA 2A4EA 4ZNEE 3AAZA 4P59L 1Q9LA 4KKBD 5IJKC 5I16B 3IBOA 2ZBVA 2NY4C 2ZYHA 3ENLA 1RAMA 1V0EA 3CZUB 3EWZA 3L3DB 3RCMA 2YUWA 1RLWA 4WD0A 2XICA 1DFBL 3B0PA 1GGUA 5FYKL 5SX5H 3V4UL 4DO4A 3QNFA 4K3ZA 4CNIA 3G08A 1LWJA 1ZRUA 2QJJA 1UOLA 2MNJB 1N68A 3UAJD 5I2IB 1I45A 3KBSA 2YPLA 2YPVH 4G7VH 3WQ8A 3BKCH 2XQBL 2N7AA 4ZX5A 5E5RB 1WSVA 3L2MA 3RDKA 3EFFA 1M9HA 5CILL 5T1KB 3WK0A 1FP9A 2E6FA 1NDTA 3LVTA 2BP3A 1JFQH 4WY0A 4HDIB 1SUJA 1UWUA 3LG3A 1E6PA 5AB3A 2HFEA 3TZVB 3D9AH 4YHMH 2EKGA 5K5YA 1RCYA 1ZANH 5AN9A 1L9TA 4DFHA 4CQDA 5GJTL 3UNDA 1OCWL 2CLHA 3N42F 1HYRC 2OCJA 4XP9H 3WUBA 3BLOA 1MIEL 5F4JA 1UPPA 5JBDA 2C3GA 1OK0A 5C0RL 3W75A 1T7VA 1T99A 2XFYA 4NJAL 5DZLA 3R0KA 3UX9B 2WSYA 2YYTA 4LPXA 5CBEB 4AYID 4EKJA 5GJSL 2XGJA 3B8TA 2EEXA 5TD4A 4JDEA 1CD1A 1ETA1 1JK8A 3WTTA 4ZO8A 4B44A 2J8TA 2E9GA 4KRPB 1I9IL 3ZDXF 3Q6GL 1BZOA 4GY0A 2NX5E 2QYGA 3O6FD 1Q63A 3RTLA 4K3DH 4D6GA 1KFLA 2GLKA 3BVUA 5FJUA 3H9SB 1N26A 4L4TB 3EO9L 3NDYA 1U8IA 3FQ2A 1XJBA 4RZ6A 1ADQH 1WDWA 5IJCC 1CYWA 3BZFB 5LWYL 5E8NA 1OTTD 3E6FA 1YXCA 4UNVA 1H9DA 4PIBA 4S3DA 1HKFA 3H4FA 1OFDA 1SQ2N 4QSFA 5EMLA 2F54B 1D2PA 5JH1A 2HJKA 3LRGA 3C5ZA 3VCRA 1TZIA 4NYLA 4Y1TA 2BY1A 3ZJ8A 2A74A 3H6JA 4U2YA 1OLZA 2JQAA 1WEJL 5C5YA 5D8JL 2Q3ZA 4J39A 2V7NA 4L6OA 1JYNA 4GAJH 5D70H 3SGZA 1OF8A 3BYYA 1Q6FA 5DCCA 3WDHA 2Y61A 2Z31C 3QNXB 3VIMA 1O6SA 3RI5K 1OGAA 1UURA 2WC7A 4AV4A 3SQBA 3BPCA 3SCQA 4RX0A 5D2VA 4FX6M 4H8VA 1NB9A 3OAYK 4I0CC 1Q8JA 4LCUB 5D09A 1NRKA 3LCFA 1CXIA 1I1AC 5BXSA 1K1DA 1CCZA 3SBFA 4F57L 2DEPA 1IJFA 4L0YA 1O0VA 2BX7A 4OZOA 4X83A 1BF8A 1JPIA 1G9EA 5ABAA 1ZMYA 4JTDA 2C3HA 1WKDA 2LFGA 3FKKA 3GHRA 4C1NA 3CP2A 1BGXL 4DZ8B 4IHCA 2C9VA 2XV2A 4BZ1H 5AYXA 3UO1L 3EBAA 1CPUA 4RX4D 5TDPA 3QUXB 1E3FA 1ESOA 3IVSA 1I2PA 4R27A 1MN4A 2I9LB 4ZS6C 2XWJA 3TNNB 1A7RL 4OLZH 4PRHB 3SQRA 5FEWA 1ZCCA 1FFTB 3H1ZA 2COVD 1G6CA 5CGQA 5JXQA 1Q6RA 5GGRA 2Z6FA 3T77A 2IMRA 4D6CA 1WKFA 4WI8A 5J4MA 1DVFA 2WYHA 3EBHA 2Y6ZA 3DX4A 1EHLH 3M0LA 3FFCE 4DY1A 4GAGH 3SYAA 4UFHA 3VU2A 3D18A 5G55A 2IV9A 4JHUA 4WV1C 3I9GL 5KSAD 3TAKA 2XCMC 3G04A 1OVZA 3PAJA 5GGQL 3SSJA 5FJOA 2L4OA 4LUSB 2IAMD 3IAQA 5F7DA 3MPCA 3RU8H 1W32A 3ATDA 4PY8J 3SDCA 1I8KB 4RWYH 2XTJE 4B90A 3ULVC 5LBSH 5KS9B 1RMFH 4R97C 2AK1L 4FAAB 1NCNA 4GJ1A 3CUHA 5HNNA 5L88H 1FPTL 3K2MC 1MUMA 4Z7UA 2X0YA 4RAHA 4XAPA 1F60A 4GRWB 5IUCA 1EBHA 5BW7C 5HMSA 1XF1A 3A6BL 4ELMF 3D3AA 3D06A 4X7DC 3AGVA 3ITXA 1FF5A 3AFLA 5I71B 4WKAA 3GINA 4QHMB 5ADPH 2ZG2A 4JPVL 1SXBA 2CK3A 2QMUA 1IQ8A 4XPHH 2Q8AL 4PGEA 4QLWA 1QPQA 4RBPH 4PWIA 2QEZA 3WN5A 2ZZEA 1A5FH 4I3GA 4QXVA 1B6UA 4O5LL 4MQ7B 3KCPB 2H3KA 5ESAB 2YL5A 2GI7A 5DEJA 5FEZA 2VE6B 5DC9B 3GSWB 3DROB 3V7AG 4MJHA 4PMFA 1B3VA 1EP1B 1M2VB 1QOKA 4XMPL 2DEYX 2RH9A 1SFLA 4XGZA 1XGPA 4Q8TA 3LNGA 1J0ZA 3QQ4B 1I3RA 2FL5B 1WIOA 4GNKB 3OP2A 3FPYA 4D9LL 1DUZA 1QSEB 3S1VA 2ATPB 2WANA 2VZ3A 3WNMA 3D3FA 3WQEA 2XIBA 4LRSA 1CGSL 3N55A 3IV8A 4NAFB 1YY9C 4Q6XA 2X1UA 4QCEA 1DANU 1AQDA 5HDLA 1U8CA 3IRSA 2FKPA 4PJBF 3Q6FA 4NZTH 2CH8A 4AM0B 4UTUA 3WJJA 3FO2A 4BELD 2MMXA 4UUIA 3GDBA 3LQGA 3FSVA 3EO1B 2E6AA 4R26H 3VGAB 1RK6A 4TXVB 2MQGA 3HHMA 4PL1A 2BXVA 1T5XA 1A80A 2YWZA 5D1QC 4AY7A 4EF3A 1XGDA 2ED7A 5DVOA 1YSOA 3VOHA 1JV5B 2VMFA 1UT9A 2V5CA 2QDXA 1FUYA 1HP5A 1QG3A 3KWVA 4TVPH 3F12A 4JTIA 2MH4A 4DLFA 2FEEL 3V0VB 1CT5A 2V8MA 4FHKA 2OMXB 2YRZA 8FABA 3KOZA 1AFVL 1EDYA 2FUQA 1JCLA 3VI3E 2NYZA 3QCTL 3R8RA 4Y88A 4RRPM 1G7LB 2CBIA 1U8MA 1UB5A 1RFDL 2EYTB 4TUUA 2Q6OA 3CHPA 3S5OA 4M6OH 3CMOH 3BDBA 4N8VB 4L2LA 1MCWM 3MYOA 4EXQA 4ALAC 2E1WA 2WBJD 5IYPA 3H2WA 1YNTB 5DVLA 4BKNA 4XMYA 4YPJA 5H8MA 4F8LA 4ZOBA 2DIKA 3O0KA 3TASA 1OWWA 3VXSA 1MG2C 3LV5A 3TTSA 3D87B 1W2VA 1S5HB 3MCNA 2C1OB 2VDOB 2NX5B 1L5GA 1CE1H 1BVNP 3E1F1 2DF3A 1BYPA 1BXBA 4M6PA 5GHWH 4YSQA 3HI6L 2G9HA 2GITA 4HHWA 1KTRL 5M7QA 3ET9F 2BN4A 4WDWA 2R1XB 5C7ZA 5IESL 4PJXA 1DQDH 1OP3H 1UKTA 5AYUH 3I85A 1MCHA 4HUVB 2HLAA 4LPWA 3D0VB 3OKEB 3KEHA 2NW2A 3IIPA 3QMSA 2ZA2A 3NL2A 2HVBA 1S7SA 1K9MD 2DWEB 1IBGL 3C6SB 1NJJA 3RU6A 3VZXA 1QBMH 5CJNA 7TAAA 1ADQA 5IQMA 2BMWA 1S3KH 3P74A 4I9TA 3RNQB 4XP1H 4GO8A 5CD3B 5FECB 4C5YA 4UT7H 1YBQA 2K70A 2QJGA 5DVNA 2UXFA 3RGBA 4J1UB 3CU7A 4WK4B 2LFEA 1Z32X 3CFMA 3LS5L 5I75B 1SGJA 2J7LA 4G9FD 2D22A 4ABUA 3S36H 3RIKA 1K77A 1X5AA 1AGFB 4P5KB 4W9IC 3Q9QA 3VG9B 3I9PA 2J47A 5J1SC 2O5ZH 3ULSB 4E8GA 3HV8A 3BDYL 3V4VL 1OZQA 4FIRA 2OI9C 1CVRA 5D2LE 3WUWB 5D2NE 1XSOA 1VBHA 5IVXE 3K5RA 3HB3D 4RGOL 2RDWA 3B2UD 1ULVA 3S9IA 5CZ0A 3WY4A 1CDIA 3EJQA 1K4DA 3FB5A 2G4GA 5FEXA 3LZQA 5J12B 4RV3A 4GQZA 4ZFZA 5BOPA 1EAQA 1FP5A 5HANA 1GVRA 1V6YA 3UFYA 1TLKA 3LN4A 4DVBA 3F7YA 3IPWA 2V5BA 2CDGB 4LNCA 4HKJB 1J8HB 2VELA 3WKYA 2FZ8A 4XI5C 1J8RA 4R84A 4YX2H 4HK0B 5ACMA 1PCSA 4E9TA 1ANUA 4PRNA 3MROB 3TVAA 5E2JA 5TPWH 5FF7A 3KAAA 5DJAA 1FORL 1PTDA 4L3CB 1ZTVA 2YWHA 2X7VA 4XTDA 4UT9L 3VFMA 3VXTA 2JSFA 4BZ1A 2RACA 2C5HA 3FFCB 5I6XC 4G5AA 5AC5A 5KOMC 2Q7YB 1JNDA 1ZWIB 5DSCA 4JJ5B 1T89C 5IEKA 2BRQA 2J8FA 2G3JA 1YQVL 3C2RA 3GIVA 5HJ3B 4Z0XA 5HPMB 3KLLA 3GHSA 2H32B 1UMKA 3MO1B 4HU4A 3QIUC 5KBPA 3C0QA 3O3AA 4N2YA 4QTHB 4D8OA 4N26A 1GQNA 3WBEA 4BJLA 1NFGA 2FGWH 3HGSA 3BAEH 1YEJL 4CAGA 4PJFE 3SCMD 4OFVA 3ECQA 3E3QC 4QY8A 1WA0X 5GGVL 1OGBA 4LTSA 5SWSD 3O4LE 4FWTA 1SJCA 2NSOA 5J5EA 4UM8B 2ZOTA 4Z1AA 5FDWB 2J44A 3UWQA 2OMUA 4F7CA 3JTTB 4AYBA 4F7KA 1T1YB 5DSZA 4XOCA 3CQHA 4ATDA 5FO2A 3WQ6A 2FIKB 4ZUTA 3JWNH 1U8KA 2XIMA 5HD8C 1AHKA 4ZAKA 4KMTH 2EC9U 3ZPNA 2E7LA 3EA3A 1QO2A 2YPLD 2QPEB 2GGEA 1KK3A 4YDVB 3KP1A 1R5VA 1X5GA 1GGOA 4HSOA 3FUJA 4OV9A 3PPGA 3WQVA 4GUQA 3CH8A 2VL5B 5DWUH 3EDDA 3IAPA 3TS8A 1AD9A 5E09A 1ZBCA 4S3EA 3OXSB 4OF7A 3CIXA 2B81A 5DR5L 1UIPA 3ROOA 43CAB 1PQZA 3U2SB 3U0TA 5GS0H 4Q8QA 3W87A 4LSDA 4TSCL 3HN5A 1LILA 3K1DA 4MKMA 3W38A 2QJDA 3BVNB 3THQA 2CJ3A 1JRBA 4DWDA 1U9KA 1IARB 3MGTB 1DXIA 1WAAE 1N0XH 5KYYB 2EKSB 4ZQCA 3IK2A 1M7IA 1A6VL 4ROQA 3TEVA 1BP3B 3FUEA 2XC8A 1U91A 3SKMA 3QUYC 4P06A 2BVOA 1S7VA 3JYBA 2PLJA 4AZBA 4F8PA 4YXLL 5DYOB 1KFKA 4HNVA 4HHMA 2I7SA 5G2HA 2VDPL 3QV7A 1P1ZB 3UY7A 3GXPA 4ZXBD 4U05A 4ZMNA 3VK5A 4P46C 5FCUL 2OOGA 4GJIA 4HJIA 3B5HA 3APNA 2DT1A 1JZEA 4HJUA 5C86A 2HRLA 3PXJA 3DECA 4E2DA 1QKZL 3VI3B 4YHKL 5EC1B 1E4LA 1SDDB 3W7KA 1R87A 1N5YH 2OFJA 3H2EA 1CYXA 3ZWTA 1S2UA 3LEYH 1RUPL 3LEVL 1CB2A 1XEUA 3C5ZD 5IM7A 4PGLA 1S7TA 3KHQA 1VRDA 4U0RC 5IBLC 1XCWA 4Y9GA 2A3HA 2UXGA 1QEWB 5CF3A 3CU2A 3SB3A 4FP8L 2FTAA 1EJRC 1ZLSH 5JQ9A 3BAKA 1XSJA 2AQQA 1G9NL 2YDSA 4V28A 5J11C 4NGHH 3CV1A 4U0QB 1CFBA 4MS8C 1IGFH 1UWYA 4AVOA 4WW2F 5B39G 1OX4A 4N8UA 5LGJB 3KPLB 1MPAL 3GTHA 5K9OB 1OGAD 3V5DA 1XIWB 4X0VA 1OK4A 3DVGA 2ROXA 1UUNA 2DICA 1BQUA 3UQNA 2G95A 1IB5A 5LKNA 4H6KA 1YX2A 1V79A 1UCBL 4L3AA 2WAQA 1SSGA 1YEWA 3Q1SH 5ANMA 9PCYA 2KERA 1J1OL 2A6LA 4P3YA 1JZFA 2MCAA 2W67A 2DFAA 1T0OA 3NEXA 4NI6A 3S5LA 1O60A 1QFUL 4JNZA 3JXAA 4GG8B 1U0QA 1U92B 1MZRA 5E1HB 2CO7B 4JQ3A 4Z95L 1MYRA 3VC5A 3MO7A 1JVNA 2OJZL 3HE7A 4Z08A 4AW4A 4M6UA 3H3PL 4PW3A 1XCTA 2ERJB 3ISWA 2WQSA 3V8CA 1N05A 4NOBA 2C4TA 2OSLA 2PAJA 4N2DA 3WKNA 4IIQA 3MVIA 3C6LC 5FO7B 2NQ3A 3QJQB 4Y2OB 1C90A 5F9DC 1J0IA 1BFOB 2ZZ1A 2NZ9C 1UWTA 5EPDA 4P2OC 1M41A 2EC9T 1J1XL 2ZOWA 1ZNNA 1DVFD 4KBXA 2YUZA 2WMGA 1CE6A 5FGBA 4PB5A 2A73B 4WUUA 1TT6A 5D2NB 5C9XA 2BWDA 4GABA 1W9XA 2D2GA 2XZCH 3GD1C 1NFAA 2FNBA 3BUBA 2X0SA 3OKNB 9XIMA 1ME7A 2H5UA 1LLZA 5SWZE 1XF5B 3CZKA 4IOFC 2CBPA 2PR4H 1N07A 2HH0L 4UNUA 5GZOA 4W7VA 3NCYS 1HOCA 3SDCD 4WJ5A 2GJKA 1UA3A 2C1IA 3UA3A 5BUGA 4YFLF 2OYKA 2BSSB 2V5MA 3SQOL 5B39A 4XNQA 5L6YH 4AC9A 1OEPA 2BVNA 3S0CA 2JIXA 3PZTA 2BINA 1NQ6A 2DZXA 3L2NA 4CILA 2XZPA 5I1LA 5K9QI 3F7QA 3VH8G 1VIWA 1TQJA 5KUMA 2GVEA 1E72M 5C0DA 1P7HL 4I1RA 3JWDH 4DIXA 4NNCA 3P4OA 3TW7A 1G4MA 4KWSA 3BDKA 3LH2H 2P5WE 3MCKA 3UTSB 4Z4VA 2X41A 1XR9A 4C6PA 5LHDA 1EP2A 1X4ZA 1R4XA 3BVTA 3SCPA 1UUSA 3M1ZA 3UXFA 1OZMA 1OEZW 2WVVA 3UDWC 1YPXA 2QVIA 1I7TA 4YDZA 2V7VA 3VQ2C 4B5EA 4IMLA 4JRXA 2FBRA 1XCQB 4GKNB 4PS7A 5GGSY 3IMRA 1T83C 4YXWA 4MSWB 3Q43A 2XH4A 3A4AA 2BHYA 2WJZA 5KYXB 1H63A 3QJFB 2YQBA 4GNJA 4PRID 2IFFH 2VC6A 2EYSA 1EJOL 4HLZG 2GDQA 1BWLA 3CT2A 4CMHC 4G7YH 1E4HA 1A65A 2AW2A 3O4LB 3RIFF 3D48R 2XJKA 4HIHB 1FL6A 3RG1C 4ZZFA 4MZ2A 2EPOA 2CM6A 2VNHA 3VYNA 4E9LA 1JPFB 3S2AA 2FD6L 4NP7A 2WCPA 4HU0A 4ZB5A 4KTGA 2VZ1A 5JIQA 4FI8A 5BV7B 3AVVA 3KWUA 3QUKA 1QRQA 4H8QA 1QFJA 4EIZC 3DFHA 3MI2A 1DXEA 4Z7NB 4HOXA 3NABH 3TIMA 2ZXQA 4NL1A 1O1HA 1N12A 2V2CA 2H9GB 1A9BA 4QJ1A 4GI6A 5JXED 2QIWA 4I8DA 5HR6A 4PUNA 2CF4A 5KAQG 4IIGA 4A7QA 4J27A 3LY0A 4HIXL 3LS4L 2XVKA 4LU5L 2WXIA 2X2JA 1EPVA 3DVNB 4JO2H 5F6HI 1IGSA 1NLDL 2V67A 4W4OC 3PFMA 3NYZA 1BKSA 3RR4A 4B96A 3E8UL 3WFEH 1AW2A 4NUQA 4L9YA 2A6IB 3ESUF 3IETB 2W0FA 1F74A 3BWUC 2WO2B 3D46A 1WPCA 1JXFA 3N6HA 1TZGH 3APYA 4WUIA 2MCPL 3LQZB 4BUGA 3L5MA 1H6TA 5KG9A 2CIKA 3NQ2A 2YD4A 3PGCA 4LSTL 4IBWA 2H8PA 5HHPB 4HHPA 5DCBA 5L9FA 1NBZA 4F0KA 1OAUH 3RY4A 1PY9A 3G4SB 2QADC 4C0SA 4EBQH 2DZSA 4B97A 4NDMA 5AENA 3LCGA 5DS8B 4RFEB 2X53A 3OBKA 1VFBB 3MNMA 4L5FL 3WH9A 1ACZA 4WTZG 3UR7A 1IAIH 1U1HA 4JUSA 4XMWA 3F58L 5I03A 1GPFA 3TFKC 4JQVC 3K4AA 4YGVA 2R0LL 4KFMA 3MKGA 4MAUH 4DF9A 4L65A 1F86A 3GJEA 3VNVA 1F6LL 4MRCA 1TYRA 5EBWA 1MWAL 1DJIA 4PUEA 4D0CB 2XIOA 3BISA 2DY2A 3GBLA 3TCTA 1TPDA 4BUQA 3QBUA 4DWSB 4BKLB 4OTXH 2H8ZA 5BMWA 4GSUA 2YBVA 2OJEA 1HQTA 2VN3A 1Q86D 2PF8A 4JZJB 2I85A 2X53S 5EO9B 1SVBA 5TGBB 3MMDA 2IO5A 4N0YH 2EIZB 2TMDA 4G7FA 1B6DA 3E6HA 4X99A 3QJXA 2QJMA 1CB7B 1TQTA 4Q4RA 2C78A 2PLCA 4YVUA 3GLDA 4XAWH 2E76C 2JMRA 3UJ2A 1FZMA 2BM0A 3QR0A 3L0GA 2DN7A 1QRNA 1G7JA 4O2CA 5FX3A 5I82A 2YK1H 1IBYA 2YKKA 3H24A 3RAJH 3HPAA 5T8GA 1BXAA 3AXLA 4PJEA 4JN1L 4RRPG 3OLGA 2NMSA 1L0XA 2J6WA 3GSNA 4PJAE 4FABH 3SN1A 2OZ0A 1PTAA 4LRTA 4BKSC 4LSPL 3WFZA 5JORB 5T1LB 1TPB1 3LYRA 2EFGA 4NQUA 1TJ1A 3M86A 1JCJA 1GVYA 4OFPA 3GVQA 1UZHA 1VERA 4JFDE 3U6XA 3QG6B 3EWBX 4Y2DB 5IT2L 4Y4HB 2R9HD 1ZHKB 4WTZA 1EP3B 3TF4A 3VRJB 1WWCA 3MGOB 4ZMYA 3IDXH 5IUSA 4IOIA 5SWZB 1EA0A 1RSCA 3VVGA 1ZT4A 4C60A 1TVDA 1NY1A 3W76A 1A5SA 4KT2A 3GS6A 5FI8A 2ICWA 2HX8A 5I15L 3TTOA 4AH2A 2FQDA 1XGRA 4CADB 3SDAC 3MUJA 5GGTH 1FA2A 3D4ZA 5CC6A 4XKVA 2HT2C 2OX4A 5HHVH 1FH5L 1WBXB 2PDWA 1OXYA 3Q05A 3AY4A 1PBGA 4I88A 3N18A 3TCEA 4L7ZA 2J4WH 4Y5VB 5L0QB 4HD9A 4AEIL 1I1FB 3U6XS 5JR1L 3RFZC 4WDIA 4L1HA 4C4UA 3U6RB 2WN2A 2TSBA 3OE7A 2AL2B 2P5WB 2HISA 2AQ3A 4RX4A 1JGMA 3ZZTA 4Q2ZB 1THCA 4ILDA 1U95B 3KPQB 3PAUA 2CC0A 4ZAKD 1TJIH 1E6JH 4H9VA 4I0PB 1J9QA 1P2CB 3CV7A 2WWOA 2MHAB 4IQEA 1FWGC 1NAML 1UH3A 3UYPB 4CRPA 3OZ9H 4N4YB 2EVIA 3AMKA 5FO0A 2CZVA 4M3HA 3ULVH 3AMGA 4KJYB 4OFIA 4PGBB 1BHGA 3WYAA 4JPSA 2VO5A 3HAGA 4KU1A 5IDIA 1S7QA 3L3JB 1GHRA 1OWQA 4C7DA 4NZ4A 1JZ6A 1KCVL 4N6RA 1L9OA 2ZXAA 3CHCA 4A1RA 1DQTA 4G11A 1H3TA 2IAMA 4TUJA 1GONA 2AANA 3R10A 3U4AA 3L3GB 3W7LA 5JHLH 2RJGA 1KRCC 1S2CA 2HKFH 3IJEB 2ESCA 5EIQA 1AZRA 4AEFA 2NLIA 1ZV2A 3BVWA 4C4KT 3O41A 2VWSA 4FCHA 4M00A 1PZ2A 3A8IA 1PLAA 3QW4B 1MKFA 3MFFB 2YGNA 3HRZC 4ZFOA 1OFPA 2Y88A 1IX2A 1JJUA 1VPXA 3N15A 3VTAA 2DQJL 1U5VA 2I14A 1KFGA 4HXBH 2D9RA 3BH8B 5KW9H 4ODBD 3ZDYF 1T7YA 1MH5B 1ZXKA 3RIFK 2Q6IA 2XU2A 1MMFA 3C08L 4HAKA 5IBTH 5DS2A 5C0BA 5TQ2L 1WDRA 1RVKA 4MQXD 3MRLA 4MS6A 5IYQA 2Y3AA 4XNZB 4D0BB 2XWZA 5EFFA 3NSXA 3US0A 4TVPD 3QDJD 4EUPG 1OARL 4P12A 3W85A 5KSUA 2FJGA 4S2BA 3P02A 3E2HB 3RITA 4L8BA 4B16A 4X4KA 1T66C 3NCOA 1QNQA 3TA9A 3VI4B 4JY6B 3LB6C 3ZRSA 1MFBH 4CQ8A 3IACA 1LRTA 2Y89A 2YCEA 1E71M 4XN4A 3QISA 5FKYA 1WK0A 5IJKA 3U2JA 3MMEB 5JZ7C 4WWKC 1R9YA 3PSVA 2NQJA 4X05A 4JG9A 1D8WA 2VL4A 2JJ2A 2H47C 3NCXA 4G6AD 3KJ6L 2Y70A 4HNUA 4DHGA 3WD2A 4YK4C 1X98A 4JIIX 2Z8VC 3H53A 2DJLA 1P0SE 2GIYA 5AYIA 3K0WA 4BYHA 4KRMB 5KUKA 1RZGA 2EDBA 3TKFA 5DJCA 5F7EH 1TFVA 2NY0C 4ALAH 2ZCLL 3NJFA 4RGMB 2DZBA 1KIRA 5MENA 1DARA 1AK5A 1CLZL 1K2DA 5EGRA 3TH4T 4EP8C 2R1PA 1FXPA 3IRZA 1GJRA 3G3DA 3HPXA 3JVAA 3LKNA 3P61A 3MU3A 2VC2L 1G7QB 3NZPA 4IJ3C 4XD7A 3MZNA 4DNLA 5I18H 1Q72H 4AGLA 3GSUA 1GS7A 1J9SA 3SAZA 2PU1A 3KW7A 5B3JF 4V1DA 2NY1B 1JRHL 4ANXA 1K4HA 1C5DA 2AHOA 1F1AA 4YDJA 1BLNA 1P4CA 4XTIA 4CMMB 2N59A 1EGMA 3MTRA 4HBCL 4Q4QA 4DCQB 5ITFA 1SU5A 2BVDA 3W72A 5CEZE 3FRUA 1LLWA 2X1OA 3DI3B 1KCBA 4NBZB 5T3ZE 2OZ8A 3CPGA 3EFDL 4F7MB 5GZOD 4MA7L 4UBDC 1PPIA 2D73A 4L3EB 1JBJA 2BTMA 1BAFH 1JGUL 1UZ8A 2ZWYA 3OAUL 2JJWA 4JKLA 4N2KA 1T7LA 2GAZB 2G30A 3VNLA 4NNJA 1ZRQA 4IG2A 3V6OC 4EAEA 3UWEA 5DC2A 1NKRA 3GSXA 4XPGL 4TV6A 4S1RL 1XHHA 2F1BA 1KR1A 3WEOA 1Q85A 3CWOX 4HXAH 4GOSA 4PR4A 3T4WA 5M94B 4K2SA 5HYQA 2HAZA 5A16B 4JM4L 1S9XA 5DUPL 3ARSA 3TO4C 4JAMA 5HXBA 1EO8L 3K0YA 4ELME 2E1BA 2Z31A 3HEIB 2WTRA 4MJ4A 1CLVA 2YD8A 1TZ7A 4G9FA 1T1XA 3SE9L 3D4YA 4JRXD 3GDTA 1CGUA 1JRCA 1BJMA 1UFUA 3QGVA 3JWDC 4X5WB 5H35B 3ZM8A 1SHXA 3USZA 1SYVA 4M48H 5LLIC 2E6DA 4A2LA 2B7PA 1I1AA 3MRKB 4I2XA 2GC4C 2VWTA 3RPIB 3DHPA 2J88H 1H49A 2IBZX 2A2IA 3OOQA 3TV3L 3FCUB 1QSFA 2XIQA 3BEWB 5D93C 3TOYA 3TJEL 3EXLA 2EDTA 3CESA 3D34A 5LA0A 1X5YA 1WBJA 1EFUA 3UC0H 1TWSA 4RE0A 1OGJA 1I82A 3RWDB 2EJ1A 2XQYG 2CBVA 1T5WA 3RGVB 4P2QA 4AD5A 3B3BA 2K9UA 4B47A 1EVUA 2WLIB 2A4CA 1ZBWA 3ZTJG 3UETA 1I8MB 4KUCF 3BVVA 3VD4A 1POKA 3FTGA 2P0OA 5DANA 2I25N 3I50L 4PJBE 2YEQA 4H0HB 4PB3A 5J8OA 1FNGB 3ZO9A 5K1NA 5DY2A 1OD9A 1GPOH 3B9AA 2QLVB 4FFYH 2QR6A 4WV1A 1TX2A 1SDYA 3MC5A 4MJ2A 3ANUA 3W73A 1BYOA 4DERA 3JQQA 1IXNA 1E6OH 3GC3A 3MRJA 1KCUH 3CQKA 2IIJA 1QLFA 4S1QL 1LO4L 4E5TA 5GSRA 3JYCA 5I3KA 4XWOD 4XD3A 3APFA 3MV7E 5LQBH 2P88A 1XEDA 1QTYT 3RA7L 1S2WA 3N42B 4J7RA 1CFMA 3EJZD 2LOEA 1IBFA 1UM6L 5GS0D 1R0MA 1GSMA 2ZF9A 3SCMA 5KVGE 4X7DA 3QHNA 2VXVH 3OP1A 4K7YA 3BIKA 4G42A 4B5VA 1FNAA 5CP3H 5SWSA 4ZMAT 5JHLA 3HKFA 3MLZH 1O66A 4HYTB 1DTNA 2PGWA 3IVKA 3PHSA 1EJXC 3BH9B 3ZDXB 4ONFH 3CVHL 3JU4A 1CFSA 3KPOA 2NX1A 2PPEA 3KVQA 1IT0A 3BPNB 2BC4B 3SFKA 4MHBA 1S7RA 1IXOA 5E4EB 5J6GA 2XQYA 1MCOL 1M42A 3CNKA 3EYQC 4FAMA 4OW6A 3V6ZA 1AH4A 4PRDB 1KF9B 4QGCA 3MOAL 5H37A 2FLBT 3RMEA 4X63A 4N22A 3LB6D 1PJ5A 3QRHA 1P0EA 1NGZA 3KDMB 4LUYA 3QVAA 3HN8A 4KO9A 1HSBB 3UTZA 1OE3A 1VR6A 3ERXA 4LYKA 1V02E 4J8QA 1ZHBA 1UKQA 4JN6A 4GRMA 1TR1A 1AGEA 4PRPE 4ZL1A 2CETA 1DBJL 2BVQA 2V2WB 3HMWH 1CICB 1QLEB 1TZOA 2LU4A 4G2AA 4FQIL 3W2FA 3PTMA 1F45A 1XD0A 1RJCA 3MVSA 3H4GA 4KXDA 5CN3A 1FL3A 4WSGA 3TC6A 5A69A 3JZEA 1W56A 4QYOA 2W38A 2F15A 4DJFC 5D1QA 2F5BL 4FNRA 4NBSA 4HB7A 4ZXBA 4GP8B 3W1PA 5CINH 3G5YB 1QRND 1TU2A 3PNWA 1HK6A 5GNZA 2EH8L 3ZMNA 4GAYB 1RHCA 3VFVB 4E41E 3U4EA 3O2LA 1AXTH 3RWIB 5H59A 5GQBA 4X6BB 1CXHA 2A83A 2R7EB 1SRDA 1M71B 3EJUA 4OZGE 1H09A 4ICMA 1VF7A 3ULUL 3KPSD 3HG0A 4CVXA 1A7PH 1L0PA 5LNEA 4KKNA 2FX7L 3VCCA 2Y0FA 1W5PA 3T0TA 5CUSL 2V33A 1HWHB 1Q0YH 3V5HB 1FFNA 3Q44A 1CC3A 4A6YL 1J9TA 1RQRA 2CZNA 1WNOA 2ZWZA 5K7JA 3X2QB 1S8DA 1QNSA 1UWXK 1XLKA 3JTBA 3T3PF 1H5BA 2EEBA 1D3CA 4TN9A 4A4AA 4P4KC 1JNLL 3GYRA 4XLFA 4FERA 4JPIA 5ICUA 3LIZL 4P5TD 2XXMB 3QH2A 4ACZA 3Q6RA 5BXFB 1E28A 2R1WB 2F7IA 1UWEL 3K2KA 3IJSA 4KROC 1HCFX 5INCB 2BSCA 1FIGL 1V5JA 2PKDA 5REQA 4ZEPA 5LGHH 5FCZA 2PP1A 1CQYA 4XCFL 1HT6A 1K6WA 3TBWA 4ELMB 1WUEA 1HSAB 1OZTG 2IS7A 1SN5A 4HWBH 1RZ8B 5FF0A 1TVHA 2VCOA 1M57B 1GYWA 4DO5A 4UM9A 1YN7B 3DHDA 1OG0A 4WXZA 3CCUB 3JV6B 4HZ6A 1EQCA 4QHUA 3GHBL 2JI3A 2VDML 1KGUA 1MW2A 1QPNA 2AK4E 2CLIA 4LHUA 1ND0A 2QFPA 3BKYH 3WOVA 5CJ8A 5DQ9B 1FWSA 4WY7H 4OQTH 3F05A 1I4FA 4L9ZA 2R4SL 3S37H 5J5RA 1GW6A 3JUGA 3GSIA 2C6QA 3B9OA 1V7YA 3B3IA 2Q01A 4GFXA 1CIUA 1CT8A 2XSKA 3W39B 3P62A 5JOPD 2FT8A 1Z0MA 2YN5A 4R96B 3WMCA 5G2NA 1TZHA 4GPVA 2NLJB 5DVMA 5DZJA 5JVLA 3RY8A 1NMCC 1IGIH 4RH4A 2J88A 4Z5RA 3T4AA 3A64A