3T56B

Crystal structure of the pre-extrusion state of the cusba adaptor-transporter complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein CusA
total genus 57
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t56B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t56B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t56B01
3OPOA 2BE5C 1Z6HA 2R6GA 3DXJC 3QIAA 2PPBC 2L5TA 5K36G 2QF7A 3VR4A 5KNBA 5C0XG 3A8IE 1OXUA 2AUKA 3VA7A 2LMCB 4KN7C 2BA1A 2K7VA 3SE0A 1GUGA 4KKSA 1VCIA 2EJGC 3HGBA 4BA1I 1I6VC 1Z7TA 4HR7B 4LJZC 1TKWB 3QJYA 3LNNA 2Q8IB 1H9RA 4KKUA 1TU2B 3GQBA 1Y8OB 4KHZA 4XTCS 3T51B 2BE5D 2F1MA 3H94A 1B9NA 1H9SB 3P20A 1CI3M 4TQUS 3TZUA 1OXTA 4JBWA 4RCNA 3LWUA 3U9SA 4KKTA 3PV0A 5JEAH 3FMCA 1Q1BA 1OXVA 3VR3A 4G7HC 1FR3A 1HCZA 1OXSC 1V8QA 2BDOA 3CRLC 1FYCA 3A7LA 2E74C 3FPPA 3VR5A 4LK1C 1IYUA 1V43A 1YNNC 1T5EA 2K33A 5BN4A 1O78A 2A69C 3BG3A 1DCZA 1G291 3GD7A 2O5JC 4XIGS 4DNRB 1GUSA 2D5DA 2ZT9C 3RLFA 3VR2A 2EJMA 2AUJD 3MFYA 2NN6G 1OXXK 2YYZA 1HTPA 4GZYC 3OW7A 2EJFC 3IFTA 1GHJA 1IYVA 4OO1G 2JXMB 1Q1EA 3BDOA 3D31A 4PV1C 4DNTB 2A68D 3ND9A 5C0XH 3OOCA 3A7AB 1K8MA 3QG1A 3M4YA 3PUVA 2K32A 3IKJA 4TKOB 2JE6I 1GJXA 3W3AA 3M85A 3D4RA 4L8JA 1SMYC 3PUWA 5BN3A 1ZKOA 4G7OC 2KA7A 1K8OA 4IFDG 3WDNA 1GUNA 1YNJC 3PUXA 4DK0A 1EWHA 2NN6H 3EQLC 1Q90A 2BA0A 2PNRC 4G7ZC 2JEAI 1H9MA 5A35A 3I72A 1B9MA 5KNCA 4IFDH 1LABA 2EVBA 1VF7A 3T53B 1VF5C 1H9JA 2PCFB 3A8KE 3A8JE 2EDGA 3PUYA 1O7LA 2DNEA 2AWOA 1IW7D 2A6ED 1IW7C 1BDOA 1HPCA 2B8FA 4H44C 4IQZA 2V4DA 3NE5B 1E2WA 1E2ZA 2DN8A 1QJOA 1DD2A 3VR6A 1Y8PB 1A6XA 2CW0C 4KN4C 1H9SA 1ZYRC 2D62A 1GUTA 2JEBI 4KMUC 1GUOA 4JK1C 1E2VA 3PUZA 1Y8NB 4KI0A 1GHKA 2B8GA 2IT1A 5KNDA 2A68C 4I7ZC 1LACA 4DK1A 3CRKC 1CFMA 2O5IC 2E76C 4BA2I 1ONLA 3MXUA 2E75C 3KLRA 4H13C 4OGQC 2A6EC 2A69D 2KCCA 5JEAG 2NN6I 3T56B 3SDZA 1HQMC 4H0LC 3M7NA 1DXMA 2D2CC 4OO1H 1Q12A 1VDZA 5BN5A 1PMRA 3L7ZC 1H9KA 3I4LA 2A6HC 5K36H 1CTMA 2A6HD 3I73A 3N6RA 3ND8A 1Y69U 2DNCA 3AB9A
chains in the Genus database with same CATH superfamily
2BE5C 4OOVA 1I4GA 1Y1VB 2K04A 1HR0W 5KSWB 5IOCA 4DQKA 1Q82D 5C0XG 1X55A 4IFDI 3AEVA 4IN3A 2UU9L 2L12A 2VJIA 4Z4TA 1SE4A 2JQOA 1F9SA 1W0JA 3CHBD 1I4XA 3R2IA 3HRZC 5GV8A 2CNDA 3J7AV 1FGBD 5M5XB 1PTOC 2B39A 1B1ZA 5JEAJ 3ONYA 1W2BA 1BX1A 3Q6RA 3CXCB 2UXBL 1L0WA 3RD4A 4BBSH 4CJ0B 2OYNA 1W3SA 3LWUA 2N3SA 1H95A 1E22A 1IJEA 1K83B 3VR3A 4XMYA 3AQQA 2YWFA 1BR9A 4JI3L 3RNUA 5CBAE 3CMMA 1JB9A 2EYJA 3PQIA 5JVG3 5IGDA 5KIXA 3RR5A 1U5KA 1PRTC 3U2QA 2N88A 4UP7A 3RLFA 4YY3L 1EQVA 1MI2A 2YU9H 3WQZA 2K5QA 3PIO3 2GJRA 2L15A 2OQKA 2EIFA 2B2UA 3KF8B 1A2TA 4A3DB 3S16B 1GHJA 4IW3B 3NP8A 3UDFA 2VS1A 3S17B 3PO2G 4GKJQ 3I7FA 1GJXA 1UE6A 1UE5A 4MN3A 2BH2A 1W6JA 5IYDH 3M85A 4AIMA 3ASQA 3MCAA 3CCSB 2KHSA 1F9QA 2L9HA 1RD9D 2ZXOA 4IURA 1ASYA 4KD3A 4YCWA 4O0AA 3ISXA 4P1VA 3PIP3 4RCOA 3CCQA 1FDRA 2IW3A 1KC8D 5IGCA 4O42A 4DR7Q 1ET6A 4L5SA 1SXTA 3GTOH 2CH4A 2RDGA 1MHWC 1Q3LA 1VQAA 2K4KA 3OJWA 1LLRD 4DR7L 2WAQB 1IKMA 3TSSA 4ZYSA 1T6YA 4YAWA 5IWAL 1FRNA 5JPNC 4F87A 4JI7L 1S5BD 2R6HA 1PTOH 2WSSA 4OELB 3PSIA 3PO2B 2PMDA 1TWHB 5C4HA 1F20A 1A6XA 4A3EG 2VJJA 4KN4C 4LFCQ 1BPLA 3URYA 1NTGA 2SNSA 2DY8A 3N52A 4P74A 2HCJB 4IJLA 2F0MA 4LF7Q 4A3BB 3PVDA 4RHSA 1XNRQ 4X6AH 5A2QL 4XLCA 3PIPA 4QQBX 1HQMC 3DEOA 2Z9HA 5BN5A 3D4WA 1H9KA 5C4XG 4PC3A 3N6RA 5C3EB 4V190 2PZWA 2JDIA 2DNCA 2B7CA 4X65Q 3K7AH 2CW0D 2N78A 2RHQB 1JOOA 1KLGD 3K0XA 3UE0A 2O2LD 4M8AA 3MEHA 2Q8RE 4C3HH 5T1GA 5E3FA 5NUCA 5KYLA 4IJHA 4PC1A 3FJOA 1C48A 1JC7A 1VQ5A 2VNIA 3E0EA 3SHLA 1W2BB 1TIID 4TQUS 5JAVA 3QB3A 1N36Q 3MXGA 1K0SA 1RODA 3R6KA 3E9IA 1V5VA 1JE4A 4G7HC 2R7ZB 4PMCA 2K52A 1SYEA 1TS2A 3FPPA 1M90C 1IYUA 4ZQ3A 2SNMA 1QVFA 5C6AA 1UD4A 1HFGA 1ZEQX 2PI2A 3VYUA 1IBLQ 2EJMA 1VQ6A 4CGYB 4WJWA 5M3MH 3W2DA 3S14H 1B44D 2DYIA 1D1IA 1FL0A 1PRTF 3CU7A 1YHQA 1Y1WH 3I4MG 5F2DA 2NVTH 4RDLA 3EFXD 2A73B 3NTKA 2BMWA 1I94Q 4HMJA 4BY1G 1SR3A 2XNAC 1HNXQ 2M00A 1STYA 5LMZA 1BCPD 3I90A 3D4RA 4L8JA 3U6KA 1FX0A 1K8OA 1XYIA 3K8AA 1ELOA 3NBHB 3R3OA 1ENAA 3TREA 3BVGA 2GJPA 4F8MA 1KDBA 4GN5A 5L37A 1EU3A 1XTCD 1A3UA 4DR6L 1E3ZA 3QO2A 5BSYA 5C3EH 5IYCH 2RKSA 1V1QA 4IOAA 2ZBVA 3K7AB 5I6YA 1IHZA 1TT2A 3PUYA 5FLMG 1NMFA 1SLJA 3PMFA 4QL5A 2JIZA 3AFQA 5EPKA 3HOUH 2MHVA 4IQZA 3SK6A 1GAWA 3CCJB 5CV5A 3OMGA 1IL8A 3K5NA 3CP0A 3PA1A 3A5ZB 1YHQB 1WORA 1JWUD 1LO5D 2K05A 2EIXA 1PH9A 1S72A 4JBMA 2JEBI 2DIEA 1E2VA 4AYBE 2YV5A 4EX5A 3JQQA 4FN5A 5FO7B 4DK1A 4E0FA 3A3BA 1RQRA 1HXYD 1QFZA 4LMQD 4WQMA 4A3KB 2X53S 1Q86C 1G2TA 4RGTA 2R93G 3U9OA 1WCMB 2WAQE 3E9HA 3Q24A 3ULJA 1YI2B 2V7QA 1F9RA 2N49A 1SKQA 3NBHA 1B3AA 3OYYA 1EQQA 1Q8KA 3B8HA 2AQ3B 2K5WA 1XPOA 1V1PB 4P2NA 3LO8A 4JOIA 2VBUA 3CD6A 5I9PA 3QFSA 2Z6KA 1UMKA 3Q8DA 5AFWA 4R8IA 4YAUA 5KNBA 3W2IA 5H5JA 5FLXc 3VA7A 5C4ZA 1L2FA 2X6WA 3AVVA 2LMCB 4CKEA 1U4MA 1EU4A 3D4DA 3DLLA 4B3MQ 2QDBA 5C4JH 1VQNB 2FVGA 2A1AA 3NHHA 4TSFA 2P3MA 1X3GA 4DK6C 1VQLB 1VQ8B 1TS4A 1CI3M 1WTQA 5A89A 2ZZFA 1X9NA 1BOSA 2XOKA 1B3QA 2KUMA 3NTIA 5EAYA 1Q1BA 2N55A 3GTKH 1OXSC 2X6LA 3CRLC 1LTRD 1UD2A 3B78A 2F0UA 2D3NA 5CGKA 3ES9A 3NELA 2OCEA 2ZTGA 5EQ0A 1S0UA 5CDFA 4L5TA 4QB4A 2DJGC 1ZM3A 1AZPA 2DOGA 1QH0A 3STBD 3I91A 1KL9A 2YYZA 4JYAQ 5GAHC 2XNDA 4Z1MA 3U6BA 3CCLA 1HA5A 4ZAIA 3PA2A 5FKAC 4GQNA 1WU8A 5IGEA 3ND9A 2GQFA 3S2HH 5KW9A 1EY7A 1HRJA 4GLAC 1KNAA 3JAML 3OAAA 1WTVA 3PUVA 3J81j 4B3RQ 3EA6A 4ME3A 3WWVA 4BBSB 1JA1A 3CP8A 5FO0A 4DAYA 3CMAA 2RQXA 3T4AC 3M4QA 3DEPA 1JE5A 3CCSA 3TRZA 4ZUIA 1CT1D 3K6OA 2GREA 2CQAA 3GSIA 2VQEL 2G9DA 5C44G 2QE7A 3TS0A 5LMNQ 1BO0A 5A35A 1J8IA 4PC7A 1N07A 3GV3A 1S4MA 1E3PA 4GN3B 1EL0A 3K0YA 3SJPA 2HT1A 4TMTA 2OTLA 1SE8A 1V1OA 1A0IA 4DR4Q 3SLDA 2PNHA 3BH4A 2JA8G 3CCJA 1DD2A 3HOWB 4HEDA 4JW0A 2C4TA 4H02A 1GUOA 4CDFC 2RCNA 2L1BA 1WD1A 3PUNA 4X3SA 4Z4YA 1CFMA 1AP0A 2E1RA 1PH4A 1GM5A 3GDEA 4HJAA 1B2TA 3DDYA 2VQFL 3GTKB 2WKCA 1ML0D 1QVGA 4NXNQ 3G6EA 1YNXA 5KEEA 3WBJA 3PO3B 3DWAA 2WPDA 1SYBA 3MXPA 4DR1Q 3J7A5 3Q6QA 1D1NA 2XNJA 1NNXA 1FNCA 1N0UA 3DXJC 4FXGC 1GUWA 2JA7B 4X65L 5G3LD 4YHBA 1A8VA 1BKBA 3SEBA 4BPRA 1HQRD 1PYWD 1O7YA 1RQPA 2EQSA 1NAPA 5A88A 2ZTCA 1HZAA 3BZDB 5EKLA 2Q8IB 1PTOD 2Q2UA 5M5WH 2RC6A 2V7XA 1EY6A 4JBJA 1UAPA 1JQYD 1AE3A 1Y1VG 1Z47A 1ZYRD 2FMCA 2Z1CA 3UDGA 2Q8TA 1FNWA 2UXDQ 3GTJB 2CFMA 1FR3A 4I7AA 4HIZA 2OXPA 4K2KA 2VUMH 1KK3A 3K7UC 2IX3A 3VR5A 1KHIA 3W1GA 1VJSA 1BLIA 3ASRA 4OOSA 2R93H 4A3GG 1Y1WG 3I4MH 4ZV4A 1XPUA 3MAQA 4PG3A 3I4MB 1TS3A 4IUTA 2HD3A 1NR4A 2Q6OA 2NN6G 4UAIA 1OXXK 4TMZA 4U9UA 3HOUB 2K5DA 4MIUA 1TWFH 2F3WA 4LF9Q 4P3IA 3D31A 4PV1C 4DAPA 3GTJH 3GTGH 4LUVA 3HKZE 2GK7A 3MMPA 1QILA 1FNDA 2PIAA 1SN8A 4PQXA 3ZUGA 5IT9E 2OQ0A 5FK9C 2VW9A 3A54A 5DM63 4O2DA 3I55A 2MNAA 3FRPB 5HXBA 3ULLA 4AVZA 1NJID 2TMPA 4CDEC 2WB1G 2BA0A 2PZTA 1F60A 3I72A 2YWEA 4P3YA 2J0TD 5FL7A 3GTPB 2BSAA 1TWGB 4C2MH 2E8GA 3HKZB 3NE5B 4MNOA 4LUOA 1K3BC 3I56A 4NDXA 1LUZA 1CKNA 3S16H 2EYLA 2B2WC 4A3DH 4A3KG 1FD7D 4J0QA 1A3TA 1XJVA 4KJNA 2I0QA 3S15H 1EFRA 1J6QA 1LTTD 5DM73 3V76A 4ZGNB 1S5CD 3MHPA 3OW2B 3I4NH 3R6JA 1KDCA 2A6EC 4OWXB 4XYQA 4DK3C 4N8FA 1KNEA 5FO1A 3FKIH 2L4NA 3STBC 1DOLA 3I4LA 4X3KA 4XQFA 2VZLA 4ULLA 4HIKA 3AB9A 4E6IA 1G6ZA 2KCTA 5FA6A 1Z6HA 4U68A 3CD6B 3OJXA 4C3JG 1B4OA 4NXMQ 3S2DB 2X3UA 4IUPA 1KRTA 4JI1L 5LL6S 3J81E 3H3VH 3CMEB 1VHEA 4X62Q 2JA5G 5M3FB 5LHY1 4KY6A 3V96A 4DF7A 3JAME 5EBCA 1CK1A 2DETA 1TY0A 1U4RA 4KKSA 4UHVA 4MTKA 4L5RC 2Z8LA 1VQNA 1FNVA 4B3ML 1TKWB 2F0FA 4KHZA 1B9NA 4Y7NB 3AVWA 1G7CA 1N33Q 4JBWA 4A3DG 4LF4Q 1VQKA 4HE6A 5C44H 3OWEB 2F03A 1CNEA 1XX8A 5LMUL 2JA5B 4RD3A 2FMMA 3HOXB 1G51A 1PJ6A 5G3LF 5GADC 3MZ5A 1V43A 2Z6BD 1PYSB 4K6DA 2A69C 2QN6A 1VLYA 1GUSA 4RAUC 1MRZA 1UD5A 3KL9A 4RWSC 2W6IA 4F7XA 1HNWL 4LF8L 4N9TA 5F4JA 2L11A 1E3XA 3MFYA 5M3MG 4QFMA 3PENA 1R9TB 1KD1C 2B2TA 1QGZA 1XNRL 4DXFA 4G6IA 2K50A 4V0BA 3B82A 4JI0Q 3ASTA 3A35A 3HOUG 5IYBH 3PCOB 1M90D 4Y7CA 1D6EC 1WTRA 4OEMB 2QA4A 3VYTA 1M1KC 3W3AA 4LFCL 3AFPA 2X69A 3KOJA 4K0KQ 3J81k 1DGSA 3CCUB 2K1BA 5GROA 2KHJA 2NZ1D 2KOLA 4GLVB 2UUCQ 1W35A 1VQBA 2WJYA 1K0RA 1JWSD 1JR0D 2ENBA 5HY6A 2EPBA 4A3EB 4G7ZC 4YHHL 4FXDA 2FX3A 1J9OA 4LF6Q 4JV5Q 4WZTA 1IB0A 5CBEE 4A3FH 1E0BA 1KRSA 1K73C 4DV5L 2LSSA 1PTOF 2WP8J 2M5SA 1TR5A 4JI8L 3MC0B 2R7ZG 4YELA 3U4VA 2A6ED 3CB4A 3E20A 4ZKCB 1WDTA 1XE1A 2GK6A 3PGZA 4LNQA 1D2EA 2V4DA 2M9VA 4DR4L 1D2BA 2ZTNA 3KK7A 1TWFB 2QGGA 5JJLA 1KMHA 1OB2A 3AVUA 4XD7A 2QGQA 1ZYRC 1EY4A 2XEXA 4WFN3 1BBUA 4DR5Q 1EYDA 2F0PA 2R92B 2A68C 2NVXH 1W34A 3U4ZA 1ILQA 1NB0A 1ONLA 2V1CC 4U673 4XOTA 4XLFA 3G6EB 1DXMA 2D2CC 1Q12A 4FDBA 2IY5B 1PRTB 3KBXA 4WRDA 2BPOA 4LFAL 4R4CA 1OB0A 3SGIA 3FEWX 1YJNB 3I73A 1QCBD 4Z4VA 1BQEA 2DCUA 2VNJA 5EBDA 2PMZB 4UZFA 3K57A 1FGUA 3CQZB 5DS0A 1SNMA 1E43A 3BU2A 3I3CA 2JN9A 3ZYYX 4LFBQ 2KHIA 2YWHA 1ZM4A 3SJZA 1VHOA 5J35A 4BWGB 2WZNA 2MO1A 4DFAA 2XNCA 2V7UA 3GVKA 1B7YB 4A3MB 1A63A 1TWCH 1DZ1A 3RMHA 3BY1A 3CCMB 1NJIC 3P20A 1KRHA 3WOFA 4S3SA 2PW5A 2B29A 5AN9A 4DV0L 3M3YB 2CHBD 1PLFA 1YIJB 2EYMA 3GO5A 3P7JA 2OBSA 4P6VF 1R5OA 3TEHB 3H6MA 4FWTA 5IYWA 1E1TA 3PO3H 1LT5D 3CW2A 1A3VA 1SMXA 3GVJA 1I8DA 4LBZA 1C4QA 2NVTB 4MYUA 1EP3B 1S5ED 4QHYA 3HOYB 3R2TA 3J7YW 2H4OA 3PF4A 3VA5A 5AJ3Q 5C0XJ 3GD7A 3S15B 2WFWA 2CH4W 4NP5A 1ZM2A 4J1MA 3VR2A 1NMGA 2QDXA 4RFBA 1K8GA 1QE6A 1VQHA 2C77A 2KCMA 4Z9CB 2A8VA 5THXA 2PZUA 1HTPA 3H3VC 4X05A 3IFTA 4DV6Q 4C2MB 3JAMc 3HOWH 1ESFA 3OP1A 1I18A 2OEOA 4A3MG 3OOCA 4AH6A 3S1RH 3M3YH 2M2LA 2HUGA 1TTTA 2QA4B 3EROA 3PUWA 2BM1A 2KA7A 1B50A 1K28D 4A3MH 3MHBA 2PQAB 3OIPA 1HR0L 1CNFA 4RKLA 1UE7A 4N9PA 3BCDA 4ZRZA 4TMXA 4C3HB 4DK0A 1EWHA 3U58A 1HTLD 2PW7A 4DAVA 1K9MD 4YY3Q 1Q90A 2D9RA 3ONUA 3ZPNA 4HAEA 4KY7A 5JPMC 3LGJA 4IUQA 2MP1A 1BNZA 3PO3G 4FF2A 3RLOA 1CZGA 1F2YA 1BQQT 1Y0YA 3OTOL 2PCFB 1MKHA 2RF4A 1R4PB 1VQEA 2ATWA 1SM4A 4B3XA 4XKWA 2L0CA 2WINB 3HAGA 1TY2A 2DNEA 5D65A 3NENA 1QUQB 1X3PA 2NPFA 3SKBA 5IT9L 5IE8A 3HOYG 1WTHD 1EWCA 4LWCA 3RZDH 2DN8A 2C5BA 1WFQA 5A2QE 1SYFA 3I70A 2ASBA 2NZHA 2VB3X 4J6HA 1EIYB 1WOOA 1KIXA 4M0LA 1EEID 5IYRA 5C3XA 1Q8IA 1C9OA 3BVZA 2CF4A 3W2EA 1HNWQ 1GO2A 3J80c 3Q6SA 5FLXL 1G91A 1E24A 3M7NA 4RA8A 1SNDA 5C4XH 2Q6KA 2OK7A 3KEWA 5K36H 4JI6L 1HA6A 2A6HD 1P16A 3GTOB 3TN2A 2UXDL 4A3FB 3T1YL 1NCVA 1O7ZA 4A3GH 1IBKQ 2R9VA 2B2TC 1WD0A 2PPBC 5TV2A 5K36G 1ICWA 4YAFA 4JC0A 3VR4A 1STGA 5IYBG 1NBMA 1N34Q 1R5BA 4A3EH 1VCIA 1SE3A 2EJGC 1QUQA 1UEAB 2AHOA 1FNBA 3BZKA 4K6LA 1Y8OB 5M9OA 3S1MH 1CQXA 1VQLA 5IT9c 3CCMA 1CQFA 4IPDA 1VQKB 3FKSA 5JEAH 3FMCA 5IP9H 4PZ8A 4ASUA 1IBML 1Y14B 4DUZQ 2E2HH 2K6AA 1U0LA 1BX0A 1EIFA 1VLOA 3ASPA 3T1HL 4YWMA 1N08A 1KK0A 3CPXA 1M8AA 2Q6LA 1V0EA 2HQEA 4K14A 1G291 5IGBA 2JA6H 1NSNS 5LMNW 4G7XA 2Z6KC 2JSOA 1SROA 2ZL6A 4NCNA 3CC2B 1ZM9A 3SK5A 3RZDB 4JI6Q 2A68D 1I4RA 3BQJA 2ID0A 3H3VI 3VNUA 1GJRA 3AMUA 2JA7G 1KJZA 4DV4L 3UDXA 2EY5A 1E62A 1S4ZA 2PQEA 1SDFA 4ZK9B 4IZ8A 1G7TA 2PQAA 1WOPA 4R9WA 5JJZA 4HJ7A 3PUXA 1AMOA 2ZBUA 2NN6H 1NB9A 1L0YB 4UZUA 4XQQA 3EQLC 1IJFA 5ELNA 1Q46A 1Y1VH 1Q81C 2D74A 3C2QA 2JYOA 5M3FH 1BF4A 4TT3A 1UE1A 1LV9A 1B23P 3CMEA 3A8KE 2WR8A 3D0FA 4PZ6A 3FKIB 3VO2A 2FFKB 2EXZA 4RKBA 1BDOA 1VQ9B 4NMZA 4LW1A 4DUYQ 4ZGQB 1AN8A 3ZC3A 4R4TA 4TRDA 1KD1D 4ZCMA 4JK1C 3I4NB 3EVQA 5IGGA 2QTLA 1SJHD 2JN4A 5TSSA 4Z4WA 4B3GA 3SDZA 2A5HA 1I4QA 1UD6A 2ZXHA 2Z0SA 1D8LA 3K5OA 4P72A 2NVQH 5FIUA 5KRUA 4EVOA 3BC9A 4QVAA 2B2VA 4A3CH 4PABA 2EXDA 3CW2C 2XZPA 3OPOA 1LTAD 1JORA 1CA5A 2X85A 2Y0SB 5DNFA 5JJIA 4NW2A 3F8TA 4A93B 3LWEA 4XNFA 3J7ZC 2V31A 4DPGA 3QJYA 3CQZH 4KKUA 2VBTA 1TU2B 3G05A 5FOBB 1ENCA 1JJ2A 2F52A 3TP6A 3H94A 1PFNA 4FNFA 2C5CA 1OXTA 4RM0A 4DV0Q 2F0GA 1CKMA 1JICA 2KBNA 1WSRA 4G7WA 1WOSA 1AH9A 3I4NG 2KEEA 3VYRA 3E3XA 1EXMA 4A3BH 2ZITA 1JJGA 1KDAA 2NWGA 4A3IH 4C1NI 4PGOA 3ITPA 4OPVA 2UUAQ 4JI2L 1L1OB 4GNXB 1X54A 3R93A 1WVLA 1EFWA 3M4OH 1VQOA 4A3LG 1STNA 3H15A 2WACA 2CRVA 2SEBD 2B7BA 5BSXA 1N32Q 4A3IG 1YHBA 2VNUD 1D7QA 3HKSA 3TS2A 3SK4A 5DSZA 3OEEA 4ZKBB 2EOTA 1WCMG 2OT2A 4MTNA 3O13A 1NUCA 2ICIA 5I4DA 1VQPB 1TVCA 5M5YB 3G4SA 1SYDA 1HA3A 1SYGA 1GUNA 1EIHA 3VDYA 3TZDA 3ZJYC 3CPWB 4C3IH 1YHAA 3VO1A 1N34L 1EFCA 4M4SA 3LQEA 3L3OC 3F2BA 1E79A 4RDKA 4AQYQ 3S1QH 4R1JA 1OHHA 4HJ8A 2F4VQ 2BGIA 1LT4D 4RCYA 2OBTA 2JA7H 1FNUA 4JI0L 1VF5C 1H9JA 3BDCA 1AFPA 2B2VC 4LF9L 4UP9A 1XTDA 2NZOA 3ER0A 5HZAA 1BUVT 1DJRD 4G4KA 1I94L 2JA8H 3DHQA 1XMOL 4HIDA 2XRQD 4BBSG 2H1EA 1DDGA 3QE2A 3G71B 5J3OA 4OONA 5J39A 2ALYB 1Y8NB 2D9UA 2F0LA 2ZJPA 2HIXA 3NPPA 4XORA 3C1FA 1SE2A 2HHHQ 5LMNL 4FO2A 3CCEB 4MZ9A 1MSHA 4H13C 2JJ1A 5LL6X 4H0LC 2GPJA 4OX9Q 2XTIA 3NEMA 1CHPD 2D3LA 4EQPA 2RSOA 1CHQD 5DN6A 4N8X1 2QEJC 3BS1A 1F2LA 3UE1A 2QDLA 1ASZA 2L5TA 1PYBA 4IPGA 1HVXA 1YBYA 4XR6A 1Z9FA 5IYQA 4UPAA 3EBEA 3SE0A 3H9NA 4K2LA 3HGBA 4P9SA 1WJJA 1PRTD 2NTSA 1HUNA 4RD0A 5IIFA 1SNQA 1RIPA 1L0XB 3ZZ0A 2KCNA 4QMGA 1VS0A 1QB5D 4TSSA 2F0QA 4BS9A 4AC9A 1E7ZA 4CDCC 1UWVA 4KKTA 4LF4L 1PH2A 3J80E 3Q23A 3S2HB 2CW5A 3QSYA 3W5UA 5KNLA 3S9WA 3CCEA 3TP5A 4RJLA 1O78A 3RZOB 4R4IA 4OHJA 3A8IA 2OTJA 1VQ4B 4DV7L 4K1XA 1XPRA 5FJ8G 4GZYC 4XN3A 2QW7A 4GS3A 3MWYW 3WXMA 1Q1EA 3DM3A 4JYAL 1DYQA 1S5FD 4J15A 4R71A 2GN5A 2HMAA 5FLMH 1BCPF 1CSQA 3BY2A 4G5GA 1KABA 2XN9C 4IALA 3IRBA 1BJKA 3NQIA 3CCUA 1VQ5B 2IHEA 5FNZA 1YJ9B 3G4SB 5C4JB 4OIKA 3D26A 1K9MC 1YZ6A 2G5DA 4ACAA 4B48A 2RDHA 2Z4HA 4JCVE 4RD4A 4A3GB 2RDFA 1HUMA 1PZJD 2K75A 2B5OA 2BM0A 2EVBA 4X66Q 1VF7A 2QTZA 2RSNA 3WNCA 4H7BA 4BY7H 2YTXA 4QGUA 2EDGA 3D3RA 3AGPA 5COYA 5ELDA 3GTGB 4PC6A 1HPCA 3AGQA 4QIWE 4EQNA 2F0SA 1SNPA 3A8JA 1X6OA 1SSOA 2HCCA 2MO0A 2NB0A 3NK9A 2ES2A 2D62A 4WWVA 5EJWA 4XLHA 2FJ2A 3KJPA 3X3MA 1Q81D 2K14A 3P75A 1STAA 2UU9Q 3A74A 4ZUJA 1F9PA 3UDIA 2A19A 1D8TA 4N3GA 4LBVA 3MXUA 2CQOA 1QZHA 4OPOA 4ROXA 1SAPA 3OZUA 2Q6IA 1SBBB 4B3FX 3BDLA 1YJ9A 3L7ZC 5D3IB 1IHMA 2A6HC 2RVLA 4DU9A 2WAQG 1HNXL 4FF3A 2Q2HA 5EGTA 1UD8A 2EY6A 3GTQH 2B2WA 4KN7C 1O80A 5J1ZA 2DGYA 1BBXC 4BY7G 1LTBD 5FO9B 1QOHA 1I6VC 4HR7B 1FJGL 4OPSA 1GO3E 4GOPC 2ZM6L 4II3A 1K3RA 3M4PA 3ONAB 1Q7YD 2BF4A 1MD2D 3NUCA 2BE5D 3S1RB 4M1UB 4DR6Q 1S72B 2UUBL 1ZXTA 1GVPA 1JOKA 2BDNA 3OMCA 4JI5Q 3Q39A 4Y9UA 3CCQB 1X32A 3AU7A 1YIJA 1J5EQ 4B43A 1G2SA 4B9WA 5GQOA 3TP8A 4K8IA 4DV4Q 2NVQB 3MA2B 4RG1A 5T1IA 2ZZQA 3W1BA 3ERQA 2K5VA 1YNNC 4DR5L 3KDFB 3KF6B 5DLQE 4XKVA 4XM3A 3DUZA 1CZWA 2D5DA 3SLNA 1KAWA 5HGTA 1II3A 4CJ2C 4X64Q 2OTJB 1HNZL 3ZZTA 1VQOB 3FP9A 4KHPL 4X64L 1E63A 2B3GA 1CKNB 1RDPD 4PNYA 3PUMA 2I1LA 2JJQA 3SK8A 1GOZA 4P25A 4JI8Q 3QOLA 5LMUQ 1SNCA 3IKJA 5B6IA 4DUZL 1IBMQ 4BBRB 1J5EL 4GN4B 5E6TA 4KHVA 1JMCA 3J7AF 1ZKOA 4JPBW 1WTWA 1JWMD 2C9OA 1VQJA 1IXRA 4PMWA 4BXXG 1N0VC 2DY1A 1FRQA 3M9BA 2BVNA 1MJCA 3H91A 5DAUA 5JJKA 2ZL7A 1XFOA 2J4XA 2E2IH 5KNCA 4OWWB 1LABA 4AYBG 1D5XC 3HG9A 2F4VL 2VZAA 4FXKC 5IP7H 5K5PA 1O7LA 2KQ3A 3CCVA 1TVXA 1WPCA 4QUCA 4YWKA 1WOCA 3ERSX 3KJOA 4X62L 1UUPA 1C7YA 3CC4B 1G6PA 1XNQL 2J7ZA 2X6XA 1MJEA 3HP3A 1A2UA 4X07A 4AYBB 1YX2A 3GP7A 3E0JA 4KI0A 1RCVD 2NVXB 4I7ZC 3FVQA 1TWHH 4HTHA 3E1YE 4IOCA 3PO2H 1XWEA 2ZM6Q 1N32L 1P8LA 1PTOB 2R7FA 4DV2L 5L46A 4DGZA 5IYDG 4FYDA 1IZ6A 1U9RA 3G7LA 2F0VA 1TWAB 2A74C 3ZIAA 1Y69U 3ND8A 3P27A 1RF2D 2GVAA 1EFTA 4HE5A 3AYHB 2EY2A 1AEXA 1PH8A 3QIAA 2MJ8A 3T1YQ 4L5QA 4R4QA 3RLNA 1EFID 1LTLA 1SRUA 3ASSA 3VNVA 2HDNB 3JAMi 2AUKA 2OTLB 1EYCA 1GUGA 5AJ3L 3J81i 1RTOA 1OB5A 2PYKA 1BXTA 4LJZC 1BMFA 3F2CA 4XYOA 2RC5A 5CC4A 4P73A 3CC4A 3T51B 2CCZA 4UDUC 3JQPA 4FF4A 5JVH3 3C3LA 3CRZA 1GKHA 3GTLH 2CBXA 3CPWA 1TWAH 2HDMA 1F2ZA 1FYCA 1BBWA 4RD6A 3K80C 1N05A 4LK1C 4X8IA 1DCZA 3RN5A 4ALPA 4XIGS 2CWPA 3HFZB 4IPHA 3BNWA 4A3JG 4A3KH 1T6ZA 1WI5A 2LFNA 3CTAA 2F3IA 4XL9A 4X66L 2JK8A 2IL8A 3QOJA 4P6YA 4KD4A 3GTMB 4DV2Q 3H0GG 2XWBB 1K83H 5CV7A 1MIUA 2ZZGA 1EYGA 2LXJA 3WYAA 2JXMB 3G71A 1STBA 3NXWA 5C44B 4B3SL 1TLLA 2JA5H 3W2FA 3SXHA 1K8MA 2MQHA 3BYTB 3M4YA 2AQ1B 2K32A 2ZTDA 1D5ZC 3JC66 3NTHA 5GAEC 1JB7A 3FKIG 1QG7A 4AF6A 1EOTA 2B2YA 5BN3A 5M5XH 4HIOA 3HKZG 1YI2A 3UI2A 2MFIA 3HOVH 3S1NB 1M4VA 3DM1A 3T16A 2BN4A 1I4PA 2NTTA 4B08A 2HCIA 2EFGA 4L63B 1SFOH 3B6YA 3OKXA 4P75A 1DARA 2XZLA 4OX9L 2F4NA 1L1OC 4ZCIA 4GNXC 2XSCA 2PI2E 1LTGD 2CK3A 1K8AD 4A4IA 1VQ9A 2KEDA 5JBQA 2DERA 4K5WA 4KK7A 4II2A 3CF5A 2E1BA 3W2HA 2KECA 2E5LL 1X3QA 4XOPA 3NWSA 4MHEA 2F4IA 2B8GA 4GLXA 1W6KA 2UUCL 4X3TA 2ICEC 1YJWA 4J8QA 1LT6D 4OGQC 3KBGA 3CC7B 5JEAG 4OO1H 1A8PA 1I3QB 4XDXA 5D14A 1VDZA 1N33L 4UP8A 3GTPH 1QUFA 1UD3A 3WBKA 2AQ2B 1TWGH 2G9HD 2EYHA 3V2TA 4WZKA 3S1MB 1IKLA 2QCPX 2K5NA 4BXXH 1MSGA 2QEXB 2P5ZX 2R3ZA 2RA4A 2V7TA 4WZEA 1Q86D 1PKVA 1PJ5A 1EWYA 2I5LX 4JBKA 1PH7A 1W87A 1Z7TA 2WYRA 4ME5A 5M5YH 4FXUA 2LZJA 4TMWA 5M3FG 1H9RA 3MFGA 3GQBA 4LBWA 2RCFA 3RY8A 5ELOA 5C5LA 4B3SQ 1QWYA 2F1MA 3SVMA 2VUMG 3CXCA 1JOQA 1R5NA 4Z4UA 4WORA 4G57A 1SYCA 4ACBA 1T5XD 2VB2X 4R4OA 1OXVA 3W2GA 1KQSB 5C3WA 4DV1L 1V8QA 2C5HA 4KJOA 3P26A 2MPMA 2L55A 1XMOQ 5I9OA 4X7EA 1U2RA 5ELEA 1IBKL 3KDFA 3CP2A 1Q9SA 2LXKA 4JOIC 3BG3A 3QFRA 4RD2A 4B3TL 5E7NA 4P22A 2WZPP 3W5OA 4TN1A 1KTKA 3ICEA 2B2YC 1L1OA 4GNXA 4DV3L 4XQNA 4KTAA 1KXLA 2QEXA 4LF6L 4JV5L 2MGSA 2NYZD 2VL6A 4IFDG 1F77A 2F0DA 3BDOA 3CCRA 3OEHA 5H59A 3V7AA 1HJPA 2JE6I 1PVOA 3CESA 4DR3L 1XB2A 1YNND 1M1KD 4ILWA 4BY7B 1VQPA 1SMYC 4YALA 1CSPA 4DUYL 2C2WA 4M2LA 4DXGA 1K8AC 4LBYA 1AIPA 3GVLA 3T13A 2UXCL 1I50B 3I8ZA 4YEJA 4WJ3M 1QNKA 1H8HA 1ILPA 2K01A 1H9MA 4BBRH 1HFNA 3T53B 2Y0SE 3A8JE 2C4UA 2B2UC 2CWAA 2ZJQA 4LFAQ 1CA6A 4H44C 2B63H 1E2WA 1E2ZA 1I3QH 1DM0B 1H8EA 2ZJRA 1R9TH 3P1HA 1G7RA 1XNQQ 1U4LA 1CUKA 1GUTA 5CORA 4KMUC 4MYTA 1N9WA 1BVSA 4IUVA 5GV7A 2YU9B 3HOYH 2BH8A 3CRKC 1DONA 2R61A 4BA2I 5HKKA 4YWLA 5I2XA 3ZBTA 5A8AA 1T9HA 2A69D 2WB1B 4DV6L 4NKLA 4RPDA 1VQ7A 3LX0A 1KK2A 2K5HA 5E4WC 5CV4A 4XONA 1GR1A 4FP5D 3HOXH 3C1EA 4M53A 1N06A 1ICFB 3FPUB 4NXML 4Y7NH 2NUCA 1JJCB 4Z4RA 1EYAA 3D8GA 5C0XI 3DWPA 4B44A 1MGSA 4QY7A 2WJVA 1QGAA 3CPFA 1OXUA 3S1NH 3HOVB 5TRDA 4OL7A 4BA1I 1T6XA 4C43A 4B9XA 1PXUA 4DV3Q 4G1VA 1JJ2B 2HHHL 1AW7A 2WKDA 4H9GA 3TZUA 1NY4A 2JJ2A 4RCNA 4TMVA 3U9SA 4X7DA 1WTOA 4OP7A 1PHJA 2GVBA 3OIQA 4KLKA 4XQJA 3PIOA 3IAYA 4QCLA 1HCZA 4HJ9A 4Z4ZA 1AE2A 1PZKD 3A7LA 3L0OA 2X0KA 2F0JA 3NWTA 1KZLA 2HLDA 1UNSA 2R7DA 2CVRA 1EP2B 4GOPA 1STEA 1EQTA 4LF8Q 1V0FA 1R4QB 2AUJD 2LS01 1VQ6B 5I2YA 2YWGA 3AVYA 4YCVA 2IJ0A 4C3HG 1VQ4A 4F88A 5C5MA 4AQYL 4RGOS 3MTSA 4A93G 3NQTA 4A75A 2UUBQ 5FLXE 1EIGA 3OHXC 1VQCA 2JA8B 2BGJA 1GAQA 1CM9A 1KLUD 2XRSD 1PH6A 4JI4L 1JNYA 2EYPA 3GTLB 3A55A 1K28A 4F7DA 1EY9A 4QV2A 2I5HA 3BYYB 3WDNA 4CDDC 3TBIB 1X65A 1G7SA 1YEZA 1YNJD 4QVJA 4IPCA 2PNRC 4C3IG 4K5VA 2IX1A 4EH1A 4DV5Q 1OGIA 4PC2A 1W9XA 3D6WA 4BY1H 1PH5A 2QILA 5HZBA 1LYLA 4PZ7A 1HHVA 4LF5L 1WP6A 1IYJB 1IW7D 1PFBA 3ZZUA 4ID6A 2X6GA 2ZXRA 3I4OA 5JOBA 3CKIB 3F2DA 2O4XA 2Z6BA 2ZXPA 1PJ7A 3K5MA 1Y8PB 1H9SA 2TSSA 5E4XA 3LVBA 1GVHA 2Q2TA 3RZOH 3M4OB 2E5LQ 4DA2A 3QFTA 4KY5A 1TUIA 2JA6G 1VMCA 1LACA 4A3IB 1WSVA 1U4PA 2DY7A 2EE1A 2ZTEA 4DNIA 2K28A 2VXWA 1RTNA 3J81L 1JCKB 1QVCA 3JQRA 1WYDA 4GKKQ 3OTOQ 1PZID 3C2PA 4O1NA 2F0WA 2DUDA 1X56A 2JP1A 4IUNA 1SEBD 2Q2IA 3SR1A 4RHRA 1ENFA 4ODGA 4QUFA 2F0EA 1KC8C 3QR8A 3OZVA 2QF7A 2E2IB 4UZEA 3X3NA 1D1KA 1RKNA 4RGMA 2C35B 2BA1A 3J80L 1EZ6A 5IYCG 3VYSA 5EPJA 3S2DH 3ZBUA 4ZCKA 1LTSD 4XTCS 1H9SB 4LC0A 4Z4SA 1EP1B 2EYOA 3NBIA 4C3JB 4KV6A 4XXEA 4Y9RA 4GKJL 4RPBA 1XMQL 1KQSA 2WIIB 1KAAA 2NV4A 2KJXA 1RHPA 4C56C 4B3RL 1JT8A 1XMQQ 1HZCA 2PO4A 4JI1Q 2E74C 5CV8A 5CV9A 1WTHA 1EUJA 2K33A 1T5EA 5BN4A 3I2ZA 3KF6A 2E2JB 3M7GA 1SJED 4RDJA 1FNMA 1NDHA 2O5JC 2RHSB 1HZ9A 5J22A 3FPKA 5EMNA 1YLOA 5IYPA 2IPKD 2CC2A 2AWNA 4A3CG 5IY0A 2B63B 4HJ5A 2BOSA 2EJFC 3CCLB 4A3BG 5KGUA 4C3JH 4CHTB 2F43A 2HDLA 3FDTA 2XGJA 3A7AB 4QJFA 3OWFA 4HN7A 1TWCB 3W5HA 5CMDA 1ET9A 2AHOB 4X3UA 4A3JB 5J3BA 1ESRA 5I6WA 4POFA 1QZGA 1EY8A 4NB3A 4NNJA 1B2RA 4QUZA 2LY7A 3WNBA 2FXQA 2HQLA 3GTQB 2WV6D 1YJNA 2VBVA 4B3TQ 2RBMA 4HSPA 3H09A 1HZEA 1EOVA 1HH2P 2SDFA 4HSVA 4CQJA 4NBSA 1MABA 4G1BA 4IFDH 4DQLA 2AMCB 3E5SA 4P2CB 5IK2A 1X3FA 1QFJA 3J81c 2I46A 1W0KA 1NE3A 5IODA 2F1LA 3WY9A 1E1OA 4YIJA 1OO9B 5ELFA 3R8BA 2IHFA 3H0GB 1A62A 1IW7C 3PF5A 4JI4Q 4LAAA 1LM0A 2B8FA 1QFYA 4XLEA 3T1HQ 2F0OA 5BR8L 4YXWA 2X8KA 4DAMA 5EKIA 3G6JB 5TY0A 2PLFA 3FHWA 1HNZQ 2J7KA 2V7VA 2R92H 2I5MX 2O5IC 3GIRA 3A5UA 2E75C 3W5VA 1VQ7B 2F0HA 2NN6I 3A56A 3J80i 1YITA 1MBYA 3D6CA 4RMFA 1N36L 2E2HB 3I55B 1PMRA 4OO1I 3WOEA 3Q38A 5CR3A 4DN4M 2EZVA 4DV1Q 1VQIA 1EQRA 4IUUA 3KUPA 5M5WB 1VQMB 1V1PA 4JI5L 2BV3A 3AVTA 1SNOA 5FO8B 3SEJA 5ISRA 4BY1B 4EGVA 2VNHA 1X3EA 1QNUA 3CCRB 5CV6A 4X0CA 1B8AA 3A8IE 3TQYA 5IGFA 1FVIA 4DR2L 1B70B 4HCEA 2ZXIA 2K7VA 1XXGA 4Y52H 2VQEQ 2VYQA 3A1PA 2AKWB 2EY1A 4RGNA 4QIWB 4ABNA 4HCSA 3LNNA 5IP9G 4EQ5A 1P4MA 5F4OA 2NVYB 3DWQA 1PFSA 3KYHC 1VQ8A 4Q5VA 2ZZEA 3IFDA 1GHKA 4K8JA 3S17H 2N8NA 2XZOA 1CKOA 2F0IA 1KK1A 4TVAB 4B47A 4YAOA 1COWA 2F3VA 2OK8A 2BDOA 1H42A 1N8RC 5C4XB 3I1FA 2VBSA 2XGTA 4Q7JB 1WCMH 4IO9A 1JA0A 1SKYB 5BR8Q 2MUYA 2EYFA 1I7PA 1OGJA 1KTVA 2ZT9C 4BBRG 2XWJB 4P26A 4XLAA 2YTVA 4DR2Q 2OWOA 2IWHA 1PFMA 1FJGQ 3F2UA 3KF8A 3Q0AA 3OE7A 2VQFQ 3U50C 4CKBA 4LF5Q 1IYVA 3TDQA 2DEUA 2B63G 1Q82C 5C0XH 1EWIA 3Q3AA 4UAJA 4TKOB 1DOMA 1BCPC 1SFOB 4DAYB 4JVZA 4K0KL 3DMUA 1C0AA 1DG1G 4G7OC 3KLWA 4OWTB 3A0JA 3TP7A 3EJIA 3IL8A 2UUAL 2H5XA 1WTXA 2Y0SG 4LUZA 1GXDC 3OFNA 3G48A 3BJUA 1E1QA 1C8CA 3CAMA 5IP7G 2CKZB 2LKVA 4HMIA 1QVFB 1EEFD 3V05A 1I6HB 4DR3Q 2AWOA 4X7CA 1OTCA 3GTMH 4C1NK 4EQOA 2OBRA 2E2DC 3VR6A 1Y1WB 1BCPB 4I65A 2DJFC 2CW0C 5ELBA 3NSWA 2KVMA 3KLSX 1DOKA 1CQVA 3MXNB 2JA6B 4IFDJ 5M3MB 3S14B 1RJTA 1STHA 3PUZA 5F4MA 4DV7Q 2IT1A 4JG2A 4JI2Q 3OW2A 4YCUA 4QF4A 4CBVA 1YJWB 1D5MC 3BCFA 1YVCA 2KVOA 4C0SA 1QVGB 2KCCA 3T56B 3CC7A 4JMQA 1ZUNB 2Z4IA 2I07B 4GOPB 1J9ZA 4CKCA 2UXBQ 3AVXA 3HOXG 2ZL5A 1PH1A 2X6YA 1CTMA 2YTYA 3RUZA 5FJ8H 1IL2A 3KFUA 1JB3A 1TQOA 2NVYH 3HOZB 2R6GA 4OOXA 1G8ZD 4ZLTF 4C3IB 4RH6A 4APVA 2W6JA 3CC2A 4XN0A 3S1QB 4ZCLA 4FVMA 1N8RD 4CJ1B 1PV4A 1HR0Q 1HZBA 1I5FA 1QGYA 4AF7A 1I50H 1SMYD 3K59A 5CYUA 1VQGA 4LF7L 3TMEA 4DKAC 3A8KA 3ULPA 2PE3A 3JU4A 1PH3A 1QG0A 1Y0RA 1LT3D 3QWNA 4GKKL 3PV0A 4PMBA 2QKIC 3E6ZX 2FHTA 2QMUA 4P12A 1S3OA 3Q22A 3A3GA 3MEFA 1PA6A 1NRKA 2R92G 2JA9A 5EPLA 2PMZE 3HOZG 1VMPA 1S5DD 3HOWG 4DNRB 2R93B 4WZLA 5HGQA 3CCVB 4NPSA 1IBLL 3QFCA 1Q7YC 4A76A 1RL2A 4RLZA 2VUMB 3RN2A 3VMFA 1QUEA 5TR9A 4YHHQ 3OW7A 3H0GH 2FINB 3S24A 2F0KA 2KENA 4OO1G 4PAAA 1UEBA 3EIVA 4DNTB 2D0PA 4A3LH 2V7WA 3BZCA 1WTPA 1I4HA 3QG1A 2F0NA 1XQBA 4FK8A 1K73D 2GA4B 1DDIA 1PDQA 2GJKA 1NBWA 3C46A 5GAGC 1VQDA 3K5LA 4FF1A 3L9AX 2NBFA 1GD7A 1TS5A 4M1KA 1A15A 4LFBL 3OZWA 4UY8C 2UXCQ 1YNJC 1E64A 3BVMA 4X7FA 4R8NA 5D3DA 5DEHA 1B53A 5KYIA 3L2PA 2HIVA 4A93H 3K58A 2SOBA 4N3NA 2JEAI 1EY5A 1NR2A 1EFUA 3WNDA 4A3JH 3LQ6A 4RCZA 1B9MA 4XT3B 4HIMA 2XVSA 5E1FA 4WJ4A 3GV6A 2C78A 4NXNL 1LTID 4RD1A 3OSOA 3HOZH 4L6TB 5HURA 1EZ8A 2K03A 5IYNA 4OXPA 5H1SE 3I56B 1EY0A 4DR1L 3F1ZA 2WB1E 2VNKA 1QJOA 2VY3A 5C3EG 4JI3Q 1AZQA 4B4DA 2F0TA 1V9PA 3HS0C 1E1RA 3MXNA 2XIWA 4POGA 3K81C 5EKKA 1QX4A 3EN2A 2OF1A 1F2MA 2E2JH 5KNDA 4K5XA 4KHPQ 4XT1B 4X06A 4P71A 2E76C 3HOVG 4Q0FA 3KLRA 3CMAB 2R7ZH 1VQFA 1YITB 1O7IA 2IX0A 3KLSA 3HEJA 1TXYA 1H85A 4OIJA 4A3FG 1I6HH 4JI7Q 5ELCA 3MVVA 3HZXA 5IWAQ 2BCOA 1VQMA 2D0OA 1S40A
chains in the Genus database with same CATH topology
2BE5C 1I4GA 1Y1VB 2K04A 5IOCA 5C0XG 4IFDI 4IN3A 2L12A 2VJIA 1SE4A 1F9SA 1W0JA 3CHBD 1I4XA 3R2IA 3HRZC 3J7AV 1FGBD 5M5XB 1PTOC 2B39A 1B1ZA 5JEAJ 3RD4A 4CJ0B 3LWUA 1K83B 3VR3A 4XMYA 1BR9A 5CBAE 3CMMA 2EYJA 5JVG3 5IGDA 5KIXA 1PRTC 2N88A 3RLFA 1EQVA 1MI2A 3WQZA 2K5QA 3PIO3 2GJRA 2B2UA 1A2TA 4A3DB 3S16B 1GHJA 3NP8A 3S17B 1GJXA 4MN3A 1W6JA 3M85A 2KHSA 1F9QA 2L9HA 1RD9D 2ZXOA 4IURA 4KD3A 3PIP3 4RCOA 2IW3A 5IGCA 4O42A 1ET6A 1SXTA 2RDGA 1Q3LA 1IKMA 1LLRD 2WAQB 3TSSA 4ZYSA 5JPNC 4F87A 1S5BD 1PTOH 2WSSA 3PO2B 5C4HA 1TWHB 1A6XA 2VJJA 4KN4C 1BPLA 3URYA 2SNSA 2DY8A 3N52A 2F0MA 4A3BB 4RHSA 5A2QL 4XLCA 1HQMC 3DEOA 5BN5A 3D4WA 1H9KA 3N6RA 5C3EB 4V190 2PZWA 2JDIA 2DNCA 2CW0D 1JOOA 1KLGD 2O2LD 4M8AA 3MEHA 2Q8RE 5T1GA 5E3FA 5NUCA 5KYLA 1C48A 1JC7A 3SHLA 1TIID 4TQUS 5JAVA 3QB3A 3MXGA 1RODA 1JE4A 4G7HC 2R7ZB 4PMCA 1SYEA 1TS2A 3FPPA 1IYUA 4ZQ3A 2SNMA 5C6AA 1UD4A 1HFGA 1ZEQX 3VYUA 2EJMA 4CGYB 4WJWA 3W2DA 1B44D 1D1IA 1PRTF 3CU7A 5F2DA 3EFXD 2A73B 3NTKA 4HMJA 2XNAC 2M00A 1STYA 1BCPD 3I90A 3D4RA 4L8JA 1K8OA 1FX0A 1XYIA 3R3OA 1ENAA 3BVGA 2GJPA 4F8MA 1KDBA 1EU3A 1XTCD 1A3UA 1E3ZA 3QO2A 2RKSA 3K7AB 5I6YA 3PUYA 1IHZA 1TT2A 3PMFA 2JIZA 5EPKA 2MHVA 4IQZA 3SK6A 5CV5A 3OMGA 1IL8A 3K5NA 2K05A 1JWUD 1LO5D 2JEBI 2DIEA 1E2VA 5FO7B 4DK1A 4E0FA 3A3BA 4LMQD 1HXYD 4A3KB 2X53S 1G2TA 4RGTA 3U9OA 1WCMB 3Q24A 2V7QA 1F9RA 3NBHA 1B3AA 2AQ3B 2K5WA 1V1PB 5I9PA 5AFWA 4R8IA 5KNBA 3VA7A 5C4ZA 2X6WA 2LMCB 4CKEA 1U4MA 1EU4A 3D4DA 2QDBA 3NHHA 4TSFA 1TS4A 1CI3M 1WTQA 2ZZFA 1BOSA 2XOKA 2KUMA 3NTIA 1Q1BA 2N55A 1OXSC 2X6LA 3CRLC 1LTRD 1UD2A 2F0UA 2D3NA 5CGKA 2ZTGA 5EQ0A 5CDFA 4QB4A 1AZPA 3I91A 2YYZA 2XNDA 4Z1MA 1HA5A 4ZAIA 5FKAC 4GQNA 5IGEA 3ND9A 1EY7A 1HRJA 3JAML 1KNAA 1WTVA 3OAAA 3PUVA 3EA6A 4BBSB 3CP8A 4DAYA 2RQXA 3DEPA 4ZUIA 1CT1D 3K6OA 2CQAA 2G9DA 2QE7A 1BO0A 5A35A 1J8IA 3GV3A 1EL0A 3K0YA 1V1OA 3BH4A 1DD2A 3HOWB 4HEDA 1GUOA 2L1BA 1WD1A 4X3SA 1CFMA 1AP0A 1B2TA 3DDYA 3GTKB 2WKCA 1ML0D 5KEEA 3PO3B 3DWAA 2WPDA 1SYBA 3MXPA 3DXJC 4FXGC 1GUWA 2JA7B 5G3LD 3SEBA 1HQRD 1PYWD 1O7YA 1NAPA 3BZDB 5EKLA 2Q8IB 1PTOD 1EY6A 1UAPA 1JQYD 1ZYRD 1Z47A 2FMCA 2Z1CA 2Q8TA 1FNWA 3GTJB 1FR3A 4HIZA 2OXPA 4K2KA 2IX3A 3VR5A 1VJSA 1BLIA 3MAQA 3I4MB 1TS3A 4IUTA 1NR4A 2NN6G 4UAIA 1OXXK 3HOUB 2K5DA 4MIUA 2F3WA 3D31A 4PV1C 4DAPA 2GK7A 1QILA 4PQXA 5IT9E 5FK9C 3A54A 5DM63 3FRPB 4AVZA 2TMPA 2BA0A 2PZTA 3I72A 2J0TD 5FL7A 3GTPB 1TWGB 3HKZB 3NE5B 4NDXA 2EYLA 2B2WC 1FD7D 1A3TA 4KJNA 1EFRA 1LTTD 5DM73 1S5CD 1KDCA 2A6EC 4XYQA 1KNEA 2L4NA 1DOLA 3I4LA 4X3KA 4XQFA 4ULLA 1G6ZA 4E6IA 3AB9A 1Z6HA 4U68A 4C3JG 1B4OA 3S2DB 4IUPA 3J81E 5LL6S 5M3FB 5LHY1 4KY6A 3V96A 4DF7A 3JAME 5EBCA 1CK1A 1TY0A 1U4RA 4KKSA 2Z8LA 1FNVA 1TKWB 2F0FA 4KHZA 1B9NA 4Y7NB 4JBWA 3OWEB 2F03A 1XX8A 2JA5B 2FMMA 3HOXB 5G3LF 3MZ5A 1V43A 2Z6BD 4K6DA 2A69C 1VLYA 1GUSA 4RAUC 1UD5A 4F7XA 4RWSC 2W6IA 4N9TA 2L11A 1E3XA 3MFYA 1R9TB 2B2TA 4DXFA 4G6IA 4V0BA 3A35A 1WTRA 1D6EC 3VYTA 3W3AA 2X69A 2K1BA 2NZ1D 2KOLA 2WJYA 1JWSD 1JR0D 2ENBA 4A3EB 2EPBA 4G7ZC 4FXDA 1J9OA 5CBEE 1E0BA 1PTOF 2WP8J 2M5SA 1TR5A 3MC0B 4YELA 2A6ED 4ZKCB 2GK6A 2V4DA 2M9VA 1D2BA 2ZTNA 3KK7A 1TWFB 1KMHA 4XD7A 1ZYRC 1EY4A 4WFN3 1EYDA 2F0PA 2R92B 2A68C 1ILQA 1ONLA 4U673 4XOTA 4XLFA 1DXMA 2D2CC 1Q12A 1PRTB 3KBXA 4WRDA 1OB0A 3FEWX 3I73A 1QCBD 5EBDA 2PMZB 3K57A 3CQZB 1SNMA 1E43A 3I3CA 3ZYYX 4BWGB 4DFAA 3GVKA 4A3MB 1DZ1A 3RMHA 3P20A 3WOFA 4S3SA 2PW5A 3M3YB 2CHBD 1PLFA 2EYMA 3GO5A 3P7JA 3H6MA 1LT5D 1A3VA 3GVJA 1I8DA 2NVTB 1C4QA 1S5ED 3HOYB 3R2TA 3J7YW 2H4OA 3VA5A 5C0XJ 3GD7A 3S15B 4NP5A 4J1MA 3VR2A 4RFBA 1QE6A 4Z9CB 2PZUA 1HTPA 3H3VC 3IFTA 4C2MB 1ESFA 1I18A 2OEOA 3OOCA 2M2LA 2HUGA 3EROA 3PUWA 2KA7A 1B50A 1K28D 4IFDG 3MHBA 3OIPA 4RKLA 4N9PA 3BCDA 4ZRZA 4C3HB 4DK0A 1EWHA 1HTLD 2PW7A 4DAVA 1Q90A 3ZPNA 4HAEA 4KY7A 5JPMC 4IUQA 2MP1A 1BNZA 4FF2A 1CZGA 1F2YA 1BQQT 2PCFB 1R4PB 4XKWA 2L0CA 2WINB 3HAGA 1TY2A 2DNEA 5D65A 1X3PA 5IT9L 1WTHD 1EWCA 2DN8A 5A2QE 1SYFA 3I70A 2VB3X 4J6HA 1EEID 5C3XA 1Q8IA 3BVZA 3Q6SA 5FLXL 1G91A 3M7NA 4RA8A 1SNDA 3KEWA 5K36H 1HA6A 2A6HD 3GTOB 3TN2A 4A3FB 1NCVA 1O7ZA 2R9VA 2B2TC 1WD0A 2PPBC 5K36G 1ICWA 3VR4A 1STGA 1NBMA 1VCIA 1SE3A 2EJGC 1UEAB 4K6LA 1Y8OB 5M9OA 1CQFA 3FKSA 5JEAH 3FMCA 4ASUA 2K6AA 1M8AA 1V0EA 2HQEA 4K14A 1G291 5IGBA 1NSNS 4G7XA 2JSOA 3SK5A 3RZDB 2A68D 1I4RA 2ID0A 3AMUA 2EY5A 1S4ZA 2PQEA 1SDFA 4ZK9B 4IZ8A 4R9WA 5JJZA 3PUXA 2NN6H 1L0YB 4UZUA 4XQQA 3EQLC 2JYOA 1BF4A 4TT3A 1LV9A 3A8KE 3FKIB 2FFKB 2EXZA 4RKBA 1BDOA 4NMZA 1AN8A 4TRDA 4JK1C 3I4NB 3EVQA 5IGGA 1SJHD 5TSSA 4B3GA 3SDZA 1I4QA 2A5HA 1UD6A 2ZXHA 3K5OA 5KRUA 4EVOA 3BC9A 2B2VA 2XZPA 3OPOA 1LTAD 1JORA 1CA5A 2X85A 2Y0SB 5DNFA 4NW2A 4A93B 3LWEA 4XNFA 2V31A 3QJYA 4KKUA 1TU2B 3G05A 5FOBB 1ENCA 3TP6A 3H94A 1PFNA 4FNFA 2C5CA 1OXTA 2F0GA 1JICA 4G7WA 2KEEA 3VYRA 1KDAA 2NWGA 4C1NI 3ITPA 3R93A 1WVLA 1STNA 2WACA 2SEBD 2VNUD 3SK4A 3OEEA 4ZKBB 2EOTA 2OT2A 3O13A 1NUCA 2ICIA 5I4DA 5M5YB 1SYDA 1SYGA 1GUNA 1EIHA 3TZDA 3L3OC 1E79A 1OHHA 1LT4D 1FNUA 1AFPA 1VF5C 1H9JA 3BDCA 2B2VC 4G4KA 1BUVT 1DJRD 3DHQA 2XRQD 2H1EA 5J39A 1Y8NB 2D9UA 2F0LA 3NPPA 4XORA 3C1FA 1SE2A 4FO2A 1MSHA 4H13C 2JJ1A 5LL6X 4H0LC 1CHPD 2D3LA 4EQPA 2RSOA 5DN6A 1CHQD 2QEJC 3BS1A 1F2LA 2L5TA 1HVXA 4XR6A 3SE0A 4K2LA 3HGBA 1PRTD 2NTSA 1HUNA 5IIFA 1SNQA 1L0XB 2KCNA 4QMGA 1QB5D 4TSSA 2F0QA 4BS9A 4KKTA 3J80E 3Q23A 3S2HB 5KNLA 3S9WA 3TP5A 1O78A 3RZOB 4OHJA 4GZYC 4XN3A 3MWYW 1Q1EA 1DYQA 1S5FD 1BCPF 1KABA 4IALA 2XN9C 3NQIA 5C4JB 4OIKA 2RDHA 2Z4HA 4A3GB 2RDFA 1HUMA 1PZJD 2EVBA 1VF7A 2RSNA 4H7BA 2EDGA 3D3RA 5COYA 5ELDA 3GTGB 1HPCA 4EQNA 2F0SA 1SNPA 3NK9A 2HCCA 1SSOA 2NB0A 2D62A 5EJWA 4XLHA 2FJ2A 3X3MA 3P75A 1STAA 4ZUJA 1F9PA 3MXUA 1SAPA 1SBBB 4B3FX 3BDLA 3L7ZC 5D3IB 2A6HC 2RVLA 4DU9A 4FF3A 5EGTA 1UD8A 2EY6A 2B2WA 4KN7C 1O80A 5J1ZA 1BBXC 1LTBD 5FO9B 1QOHA 1I6VC 4HR7B 4II3A 3ONAB 1MD2D 3NUCA 3S1RB 2BE5D 4M1UB 1ZXTA 1JOKA 2BDNA 3OMCA 1X32A 3AU7A 1G2SA 4B9WA 2NVQB 3TP8A 4K8IA 3MA2B 5T1IA 2ZZQA 3ERQA 1YNNC 4XKVA 4XM3A 3DUZA 1CZWA 2D5DA 5HGTA 1II3A 4CJ2C 1RDPD 4PNYA 3SK8A 1GOZA 3QOLA 1SNCA 3IKJA 4BBRB 4KHVA 3J7AF 1ZKOA 1WTWA 1JWMD 2C9OA 4PMWA 3H91A 5DAUA 2J4XA 5KNCA 1LABA 1D5XC 3HG9A 4FXKC 5K5PA 1O7LA 2KQ3A 1TVXA 1WPCA 4QUCA 1UUPA 2J7ZA 2X6XA 3HP3A 1A2UA 4AYBB 4KI0A 3GP7A 3E0JA 2NVXB 1RCVD 4I7ZC 3FVQA 4HTHA 1XWEA 1PTOB 4DGZA 4FYDA 1U9RA 3G7LA 2F0VA 1TWAB 2A74C 3ZIAA 1Y69U 3ND8A 1RF2D 2EY2A 1AEXA 3QIAA 2MJ8A 1EFID 2AUKA 1EYCA 1GUGA 1RTOA 2PYKA 1BXTA 4LJZC 1BMFA 4XYOA 5CC4A 3T51B 4UDUC 4FF4A 5JVH3 3C3LA 2HDMA 1F2ZA 1FYCA 4LK1C 1DCZA 4XIGS 2LFNA 4XL9A 2IL8A 3QOJA 4KD4A 3GTMB 2XWBB 5CV7A 2ZZGA 2JXMB 1STBA 3NXWA 5C44B 3SXHA 1K8MA 3BYTB 3M4YA 2AQ1B 2K32A 1D5ZC 3NTHA 1QG7A 1EOTA 2B2YA 5BN3A 3UI2A 3S1NB 1M4VA 3DM1A 3T16A 1I4PA 2NTTA 4B08A 2HCIA 4L63B 2XZLA 2XSCA 1LTGD 2CK3A 2KEDA 4K5WA 4KK7A 4II2A 2E1BA 2KECA 1X3QA 4XOPA 3NWSA 4MHEA 2F4IA 2B8GA 1W6KA 4X3TA 2ICEC 4J8QA 1LT6D 4OGQC 3KBGA 5JEAG 4OO1H 1I3QB 4XDXA 5D14A 1VDZA 2AQ2B 1UD3A 2G9HD 2EYHA 3V2TA 3S1MB 1IKLA 2QCPX 1MSGA 2R3ZA 2RA4A 1PKVA 1Z7TA 4ME5A 4FXUA 2LZJA 1H9RA 3MFGA 3GQBA 5C5LA 1QWYA 2F1MA 3SVMA 1JOQA 4WORA 4G57A 1SYCA 1T5XD 2VB2X 1OXVA 5C3WA 1V8QA 4KJOA 2MPMA 2L55A 5I9OA 5ELEA 3CP2A 3BG3A 4P22A 2WZPP 1KTKA 2B2YC 4XQNA 4KTAA 2MGSA 2NYZD 1F77A 2F0DA 3BDOA 3OEHA 2JE6I 3CESA 1YNND 4BY7B 4ILWA 1SMYC 4DXGA 3T13A 3GVLA 1I50B 3I8ZA 4YEJA 1QNKA 1H8HA 1ILPA 2K01A 1H9MA 1HFNA 3T53B 3A8JE 2B2UC 1CA6A 4H44C 1E2WA 1E2ZA 1DM0B 1H8EA 3P1HA 1U4LA 1GUTA 5CORA 4KMUC 4IUVA 2YU9B 3CRKC 1DONA 2R61A 4BA2I 5HKKA 5I2XA 2WB1B 2A69D 4NKLA 3LX0A 5E4WC 5CV4A 4XONA 4FP5D 3C1EA 3FPUB 2NUCA 1EYAA 3D8GA 5C0XI 3DWPA 1MGSA 2WJVA 1OXUA 3HOVB 4OL7A 4BA1I 4B9XA 1PXUA 1AW7A 2WKDA 3TZUA 2JJ2A 4RCNA 3U9SA 1WTOA 3OIQA 4XQJA 3IAYA 4QCLA 1HCZA 1PZKD 3A7LA 2F0JA 3NWTA 1KZLA 2HLDA 1UNSA 2CVRA 1STEA 1EQTA 1V0FA 1R4QB 2AUJD 2LS01 5I2YA 2IJ0A 4C3HG 4F88A 5C5MA 4RGOS 3MTSA 3NQTA 5FLXE 1EIGA 3OHXC 2JA8B 1CM9A 1KLUD 2XRSD 3GTLB 2EYPA 3A55A 1EY9A 3BYYB 3WDNA 3TBIB 1YNJD 2PNRC 4C3IG 4K5VA 2IX1A 1W9XA 3D6WA 2QILA 1HHVA 1WP6A 1IW7D 1PFBA 4ID6A 2X6GA 2ZXRA 5JOBA 3CKIB 2O4XA 2ZXPA 3K5MA 1Y8PB 1H9SA 2TSSA 5E4XA 3M4OB 4DA2A 4KY5A 1VMCA 1LACA 4A3IB 1U4PA 2DY7A 2EE1A 2K28A 2VXWA 1RTNA 3J81L 1JCKB 1PZID 3C2PA 4O1NA 2F0WA 2JP1A 4IUNA 1SEBD 3SR1A 4RHRA 1ENFA 4ODGA 4QUFA 2F0EA 2QF7A 2E2IB 3X3NA 1D1KA 1RKNA 4RGMA 2BA1A 3J80L 1EZ6A 3VYSA 5EPJA 1LTSD 4XTCS 1H9SB 2EYOA 3NBIA 4C3JB 4KV6A 4XXEA 2WIIB 1KAAA 2KJXA 1RHPA 4C56C 2PO4A 2E74C 5CV8A 5CV9A 2K33A 1T5EA 5BN4A 2E2JB 3M7GA 1SJED 2O5JC 5J22A 2IPKD 2AWNA 2B63B 2BOSA 2EJFC 5KGUA 4CHTB 2F43A 2HDLA 3FDTA 2XGJA 3A7AB 3OWFA 4HN7A 1TWCB 5CMDA 1ET9A 4X3UA 4A3JB 1ESRA 5I6WA 1EY8A 4NNJA 2LY7A 3GTQB 2WV6D 2RBMA 4HSPA 3H09A 1HZEA 2SDFA 4HSVA 1MABA 4IFDH 3E5SA 4P2CB 5IK2A 2I46A 1W0KA 5IODA 4YIJA 3T4AC 4ZLTF 5ELFA 3R8BA 1OO9B 3H0GB 1IW7C 4LAAA 2B8FA 4XLEA 2F0OA 4YXWA 2X8KA 5EKIA 3G6JB 2O5IC 2E75C 2F0HA 2NN6I 3A56A 1MBYA 3D6CA 2E2HB 1PMRA 4OO1I 3WOEA 5CR3A 4DN4M 2EZVA 4IUUA 3KUPA 5M5WB 1V1PA 1SNOA 5FO8B 5ISRA 4BY1B 4EGVA 1QNUA 5CV6A 3A8IE 5IGFA 4HCEA 2ZXIA 2K7VA 1XXGA 2EY1A 4RGNA 4QIWB 4ABNA 4HCSA 3LNNA 2NVYB 3DWQA 4Q5VA 2ZZEA 3IFDA 1GHKA 4K8JA 2XZOA 2F0IA 1COWA 2F3VA 2BDOA 5C4XB 1SKYB 2MUYA 2EYFA 2ZT9C 2XWJB 4XLAA 2IWHA 1PFMA 3F2UA 3KF8A 3Q0AA 3OE7A 4CKBA 1IYVA 3TDQA 5C0XH 4TKOB 1DOMA 1BCPC 1SFOB 3DMUA 4G7OC 3TP7A 3EJIA 3IL8A 1WTXA 1GXDC 3OFNA 1E1QA 1C8CA 4HMIA 2LKVA 1EEFD 3V05A 1I6HB 2AWOA 4C1NK 4EQOA 2E2DC 3VR6A 1Y1WB 1BCPB 4I65A 2CW0C 5ELBA 3NSWA 2KVMA 3KLSX 1DOKA 1CQVA 2JA6B 4IFDJ 5M3MB 3S14B 1RJTA 1STHA 3PUZA 2IT1A 4QF4A 4CBVA 1D5MC 3BCFA 2KVOA 2KCCA 3T56B 4JMQA 2Z4IA 2I07B 4CKCA 2X6YA 1CTMA 3RUZA 1JB3A 1TQOA 3HOZB 2R6GA 1G8ZD 4C3IB 4RH6A 2W6JA 4XN0A 3S1QB 4FVMA 4CJ1B 1SMYD 3K59A 5CYUA 3TMEA 3JU4A 1LT3D 3QWNA 3PV0A 4PMBA 2QKIC 3E6ZX 2FHTA 3Q22A 3A3GA 1NRKA 5EPLA 1VMPA 1S5DD 2R93B 4DNRB 2VUMB 3OW7A 2FINB 2F0KA 4OO1G 4DNTB 1WTPA 1I4HA 3QG1A 2F0NA 2GA4B 1PDQA 2GJKA 3C46A 3K5LA 4FF1A 3L9AX 2NBFA 1TS5A 1A15A 1YNJC 3BVMA 4R8NA 5D3DA 5DEHA 1B53A 5KYIA 3K58A 2SOBA 2JEAI 1EY5A 1NR2A 1B9MA 4XT3B 2XVSA 5E1FA 3GV6A 1LTID 3OSOA 4L6TB 5HURA 1EZ8A 2K03A 1EY0A 1QJOA 1AZQA 2F0TA 3HS0C 1E1RA 3MXNA 2XIWA 5EKKA 2OF1A 1F2MA 5KNDA 4K5XA 4XT1B 2E76C 4Q0FA 3KLRA 2IX0A 3KLSA 3HEJA 4OIJA 5ELCA 3MVVA 3HZXA 2BCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPO A;  2BE5 C;  1Z6H A;  2R6G A;  3DXJ C;  3QIA A;  2PPB C;  2L5T A;  5K36 G;  2QF7 A;  3VR4 A;  5KNB A;  5C0X G;  3A8I E;  1OXU A;  2AUK A;  3VA7 A;  2LMC B;  4KN7 C;  2BA1 A;  2K7V A;  3SE0 A;  1GUG A;  4KKS A;  1VCI A;  2EJG C;  3HGB A;  4BA1 I;  1I6V C;  1Z7T A;  4HR7 B;  4LJZ C;  1TKW B;  3QJY A;  3LNN A;  2Q8I B;  1H9R A;  4KKU A;  1TU2 B;  3GQB A;  1Y8O B;  4KHZ A;  4XTC S;  3T51 B;  2BE5 D;  2F1M A;  3H94 A;  1B9N A;  1H9S B;  3P20 A;  1CI3 M;  4TQU S;  3TZU A;  1OXT A;  4JBW A;  4RCN A;  3LWU A;  3U9S A;  4KKT A;  3PV0 A;  5JEA H;  3FMC A;  1Q1B A;  1OXV A;  3VR3 A;  4G7H C;  1FR3 A;  1HCZ A;  1OXS C;  1V8Q A;  2BDO A;  3CRL C;  1FYC A;  3A7L A;  2E74 C;  3FPP A;  3VR5 A;  4LK1 C;  1IYU A;  1V43 A;  1YNN C;  1T5E A;  2K33 A;  5BN4 A;  1O78 A;  2A69 C;  3BG3 A;  1DCZ A;  1G29 1;  3GD7 A;  2O5J C;  4XIG S;  4DNR B;  1GUS A;  2D5D A;  2ZT9 C;  3RLF A;  3VR2 A;  2EJM A;  2AUJ D;  3MFY A;  2NN6 G;  1OXX K;  2YYZ A;  1HTP A;  4GZY C;  3OW7 A;  2EJF C;  3IFT A;  1GHJ A;  1IYV A;  4OO1 G;  2JXM B;  1Q1E A;  3BDO A;  3D31 A;  4PV1 C;  4DNT B;  2A68 D;  3ND9 A;  5C0X H;  3OOC A;  3A7A B;  1K8M A;  3QG1 A;  3M4Y A;  3PUV A;  2K32 A;  3IKJ A;  4TKO B;  2JE6 I;  1GJX A;  3W3A A;  3M85 A;  3D4R A;  4L8J A;  1SMY C;  3PUW A;  5BN3 A;  1ZKO A;  4G7O C;  2KA7 A;  1K8O A;  4IFD G;  3WDN A;  1GUN A;  1YNJ C;  3PUX A;  4DK0 A;  1EWH A;  2NN6 H;  3EQL C;  1Q90 A;  2BA0 A;  2PNR C;  4G7Z C;  2JEA I;  1H9M A;  5A35 A;  3I72 A;  1B9M A;  5KNC A;  4IFD H;  1LAB A;  2EVB A;  1VF7 A;  3T53 B;  1VF5 C;  1H9J A;  2PCF B;  3A8K E;  3A8J E;  2EDG A;  3PUY A;  1O7L A;  2DNE A;  2AWO A;  1IW7 D;  2A6E D;  1IW7 C;  1BDO A;  1HPC A;  2B8F A;  4H44 C;  4IQZ A;  2V4D A;  3NE5 B;  1E2W A;  1E2Z A;  2DN8 A;  1QJO A;  1DD2 A;  3VR6 A;  1Y8P B;  1A6X A;  2CW0 C;  4KN4 C;  1H9S A;  1ZYR C;  2D62 A;  1GUT A;  2JEB I;  4KMU C;  1GUO A;  4JK1 C;  1E2V A;  3PUZ A;  1Y8N B;  4KI0 A;  1GHK A;  2B8G A;  2IT1 A;  5KND A;  2A68 C;  4I7Z C;  1LAC A;  4DK1 A;  3CRK C;  1CFM A;  2O5I C;  2E76 C;  4BA2 I;  1ONL A;  3MXU A;  2E75 C;  3KLR A;  4H13 C;  4OGQ C;  2A6E C;  2A69 D;  2KCC A;  5JEA G;  2NN6 I;  3T56 B;  3SDZ A;  1HQM C;  4H0L C;  3M7N A;  1DXM A;  2D2C C;  4OO1 H;  1Q12 A;  1VDZ A;  5BN5 A;  1PMR A;  3L7Z C;  1H9K A;  3I4L A;  2A6H C;  5K36 H;  1CTM A;  2A6H D;  3I73 A;  3N6R A;  3ND8 A;  1Y69 U;  2DNC A;  3AB9 A; 
#chains in the Genus database with same CATH topology
 2BE5 C;  4OOV A;  1I4G A;  1Y1V B;  2K04 A;  1HR0 W;  5KSW B;  5IOC A;  4DQK A;  1Q82 D;  5C0X G;  1X55 A;  4IFD I;  3AEV A;  4IN3 A;  2UU9 L;  2L12 A;  2VJI A;  4Z4T A;  1SE4 A;  2JQO A;  1F9S A;  1W0J A;  3CHB D;  1I4X A;  3R2I A;  3HRZ C;  5GV8 A;  2CND A;  3J7A V;  1FGB D;  5M5X B;  1PTO C;  2B39 A;  1B1Z A;  5JEA J;  3ONY A;  1W2B A;  1BX1 A;  3Q6R A;  3CXC B;  2UXB L;  1L0W A;  3RD4 A;  4BBS H;  4CJ0 B;  2OYN A;  1W3S A;  3LWU A;  2N3S A;  1H95 A;  1E22 A;  1IJE A;  1K83 B;  3VR3 A;  4XMY A;  3AQQ A;  2YWF A;  1BR9 A;  4JI3 L;  3RNU A;  5CBA E;  3CMM A;  1JB9 A;  2EYJ A;  3PQI A;  5JVG 3;  5IGD A;  5KIX A;  3RR5 A;  1U5K A;  1PRT C;  3U2Q A;  2N88 A;  4UP7 A;  3RLF A;  4YY3 L;  1EQV A;  1MI2 A;  2YU9 H;  3WQZ A;  2K5Q A;  3PIO 3;  2GJR A;  2L15 A;  2OQK A;  2EIF A;  2B2U A;  3KF8 B;  1A2T A;  4A3D B;  3S16 B;  1GHJ A;  4IW3 B;  3NP8 A;  3UDF A;  2VS1 A;  3S17 B;  3PO2 G;  4GKJ Q;  3I7F A;  1GJX A;  1UE6 A;  1UE5 A;  4MN3 A;  2BH2 A;  1W6J A;  5IYD H;  3M85 A;  4AIM A;  3ASQ A;  3MCA A;  3CCS B;  2KHS A;  1F9Q A;  2L9H A;  1RD9 D;  2ZXO A;  4IUR A;  1ASY A;  4KD3 A;  4YCW A;  4O0A A;  3ISX A;  4P1V A;  3PIP 3;  4RCO A;  3CCQ A;  1FDR A;  2IW3 A;  1KC8 D;  5IGC A;  4O42 A;  4DR7 Q;  1ET6 A;  4L5S A;  1SXT A;  3GTO H;  2CH4 A;  2RDG A;  1MHW C;  1Q3L A;  1VQA A;  2K4K A;  3OJW A;  1LLR D;  4DR7 L;  2WAQ B;  1IKM A;  3TSS A;  4ZYS A;  1T6Y A;  4YAW A;  5IWA L;  1FRN A;  5JPN C;  4F87 A;  4JI7 L;  1S5B D;  2R6H A;  1PTO H;  2WSS A;  4OEL B;  3PSI A;  3PO2 B;  2PMD A;  1TWH B;  5C4H A;  1F20 A;  1A6X A;  4A3E G;  2VJJ A;  4KN4 C;  4LFC Q;  1BPL A;  3URY A;  1NTG A;  2SNS A;  2DY8 A;  3N52 A;  4P74 A;  2HCJ B;  4IJL A;  2F0M A;  4LF7 Q;  4A3B B;  3PVD A;  4RHS A;  1XNR Q;  4X6A H;  5A2Q L;  4XLC A;  3PIP A;  4QQB X;  1HQM C;  3DEO A;  2Z9H A;  5BN5 A;  3D4W A;  1H9K A;  5C4X G;  4PC3 A;  3N6R A;  5C3E B;  4V19 0;  2PZW A;  2JDI A;  2DNC A;  2B7C A;  4X65 Q;  3K7A H;  2CW0 D;  2N78 A;  2RHQ B;  1JOO A;  1KLG D;  3K0X A;  3UE0 A;  2O2L D;  4M8A A;  3MEH A;  2Q8R E;  4C3H H;  5T1G A;  5E3F A;  5NUC A;  5KYL A;  4IJH A;  4PC1 A;  3FJO A;  1C48 A;  1JC7 A;  1VQ5 A;  2VNI A;  3E0E A;  3SHL A;  1W2B B;  1TII D;  4TQU S;  5JAV A;  3QB3 A;  1N36 Q;  3MXG A;  1K0S A;  1ROD A;  3R6K A;  3E9I A;  1V5V A;  1JE4 A;  4G7H C;  2R7Z B;  4PMC A;  2K52 A;  1SYE A;  1TS2 A;  3FPP A;  1M90 C;  1IYU A;  4ZQ3 A;  2SNM A;  1QVF A;  5C6A A;  1UD4 A;  1HFG A;  1ZEQ X;  2PI2 A;  3VYU A;  1IBL Q;  2EJM A;  1VQ6 A;  4CGY B;  4WJW A;  5M3M H;  3W2D A;  3S14 H;  1B44 D;  2DYI A;  1D1I A;  1FL0 A;  1PRT F;  3CU7 A;  1YHQ A;  1Y1W H;  3I4M G;  5F2D A;  2NVT H;  4RDL A;  3EFX D;  2A73 B;  3NTK A;  2BMW A;  1I94 Q;  4HMJ A;  4BY1 G;  1SR3 A;  2XNA C;  1HNX Q;  2M00 A;  1STY A;  5LMZ A;  1BCP D;  3I90 A;  3D4R A;  4L8J A;  3U6K A;  1FX0 A;  1K8O A;  1XYI A;  3K8A A;  1ELO A;  3NBH B;  3R3O A;  1ENA A;  3TRE A;  3BVG A;  2GJP A;  4F8M A;  1KDB A;  4GN5 A;  5L37 A;  1EU3 A;  1XTC D;  1A3U A;  4DR6 L;  1E3Z A;  3QO2 A;  5BSY A;  5C3E H;  5IYC H;  2RKS A;  1V1Q A;  4IOA A;  2ZBV A;  3K7A B;  5I6Y A;  1IHZ A;  1TT2 A;  3PUY A;  5FLM G;  1NMF A;  1SLJ A;  3PMF A;  4QL5 A;  2JIZ A;  3AFQ A;  5EPK A;  3HOU H;  2MHV A;  4IQZ A;  3SK6 A;  1GAW A;  3CCJ B;  5CV5 A;  3OMG A;  1IL8 A;  3K5N A;  3CP0 A;  3PA1 A;  3A5Z B;  1YHQ B;  1WOR A;  1JWU D;  1LO5 D;  2K05 A;  2EIX A;  1PH9 A;  1S72 A;  4JBM A;  2JEB I;  2DIE A;  1E2V A;  4AYB E;  2YV5 A;  4EX5 A;  3JQQ A;  4FN5 A;  5FO7 B;  4DK1 A;  4E0F A;  3A3B A;  1RQR A;  1HXY D;  1QFZ A;  4LMQ D;  4WQM A;  4A3K B;  2X53 S;  1Q86 C;  1G2T A;  4RGT A;  2R93 G;  3U9O A;  1WCM B;  2WAQ E;  3E9H A;  3Q24 A;  3ULJ A;  1YI2 B;  2V7Q A;  1F9R A;  2N49 A;  1SKQ A;  3NBH A;  1B3A A;  3OYY A;  1EQQ A;  1Q8K A;  3B8H A;  2AQ3 B;  2K5W A;  1XPO A;  1V1P B;  4P2N A;  3LO8 A;  4JOI A;  2VBU A;  3CD6 A;  5I9P A;  3QFS A;  2Z6K A;  1UMK A;  3Q8D A;  5AFW A;  4R8I A;  4YAU A;  5KNB A;  3W2I A;  5H5J A;  5FLX c;  3VA7 A;  5C4Z A;  1L2F A;  2X6W A;  3AVV A;  2LMC B;  4CKE A;  1U4M A;  1EU4 A;  3D4D A;  3DLL A;  4B3M Q;  2QDB A;  5C4J H;  1VQN B;  2FVG A;  2A1A A;  3NHH A;  4TSF A;  2P3M A;  1X3G A;  4DK6 C;  1VQL B;  1VQ8 B;  1TS4 A;  1CI3 M;  1WTQ A;  5A89 A;  2ZZF A;  1X9N A;  1BOS A;  2XOK A;  1B3Q A;  2KUM A;  3NTI A;  5EAY A;  1Q1B A;  2N55 A;  3GTK H;  1OXS C;  2X6L A;  3CRL C;  1LTR D;  1UD2 A;  3B78 A;  2F0U A;  2D3N A;  5CGK A;  3ES9 A;  3NEL A;  2OCE A;  2ZTG A;  5EQ0 A;  1S0U A;  5CDF A;  4L5T A;  4QB4 A;  2DJG C;  1ZM3 A;  1AZP A;  2DOG A;  1QH0 A;  3STB D;  3I91 A;  1KL9 A;  2YYZ A;  4JYA Q;  5GAH C;  2XND A;  4Z1M A;  3U6B A;  3CCL A;  1HA5 A;  4ZAI A;  3PA2 A;  5FKA C;  4GQN A;  1WU8 A;  5IGE A;  3ND9 A;  2GQF A;  3S2H H;  5KW9 A;  1EY7 A;  1HRJ A;  4GLA C;  1KNA A;  3JAM L;  3OAA A;  1WTV A;  3PUV A;  3J81 j;  4B3R Q;  3EA6 A;  4ME3 A;  3WWV A;  4BBS B;  1JA1 A;  3CP8 A;  5FO0 A;  4DAY A;  3CMA A;  2RQX A;  3T4A C;  3M4Q A;  3DEP A;  1JE5 A;  3CCS A;  3TRZ A;  4ZUI A;  1CT1 D;  3K6O A;  2GRE A;  2CQA A;  3GSI A;  2VQE L;  2G9D A;  5C44 G;  2QE7 A;  3TS0 A;  5LMN Q;  1BO0 A;  5A35 A;  1J8I A;  4PC7 A;  1N07 A;  3GV3 A;  1S4M A;  1E3P A;  4GN3 B;  1EL0 A;  3K0Y A;  3SJP A;  2HT1 A;  4TMT A;  2OTL A;  1SE8 A;  1V1O A;  1A0I A;  4DR4 Q;  3SLD A;  2PNH A;  3BH4 A;  2JA8 G;  3CCJ A;  1DD2 A;  3HOW B;  4HED A;  4JW0 A;  2C4T A;  4H02 A;  1GUO A;  4CDF C;  2RCN A;  2L1B A;  1WD1 A;  3PUN A;  4X3S A;  4Z4Y A;  1CFM A;  1AP0 A;  2E1R A;  1PH4 A;  1GM5 A;  3GDE A;  4HJA A;  1B2T A;  3DDY A;  2VQF L;  3GTK B;  2WKC A;  1ML0 D;  1QVG A;  4NXN Q;  3G6E A;  1YNX A;  5KEE A;  3WBJ A;  3PO3 B;  3DWA A;  2WPD A;  1SYB A;  3MXP A;  4DR1 Q;  3J7A 5;  3Q6Q A;  1D1N A;  2XNJ A;  1NNX A;  1FNC A;  1N0U A;  3DXJ C;  4FXG C;  1GUW A;  2JA7 B;  4X65 L;  5G3L D;  4YHB A;  1A8V A;  1BKB A;  3SEB A;  4BPR A;  1HQR D;  1PYW D;  1O7Y A;  1RQP A;  2EQS A;  1NAP A;  5A88 A;  2ZTC A;  1HZA A;  3BZD B;  5EKL A;  2Q8I B;  1PTO D;  2Q2U A;  5M5W H;  2RC6 A;  2V7X A;  1EY6 A;  4JBJ A;  1UAP A;  1JQY D;  1AE3 A;  1Y1V G;  1Z47 A;  1ZYR D;  2FMC A;  2Z1C A;  3UDG A;  2Q8T A;  1FNW A;  2UXD Q;  3GTJ B;  2CFM A;  1FR3 A;  4I7A A;  4HIZ A;  2OXP A;  4K2K A;  2VUM H;  1KK3 A;  3K7U C;  2IX3 A;  3VR5 A;  1KHI A;  3W1G A;  1VJS A;  1BLI A;  3ASR A;  4OOS A;  2R93 H;  4A3G G;  1Y1W G;  3I4M H;  4ZV4 A;  1XPU A;  3MAQ A;  4PG3 A;  3I4M B;  1TS3 A;  4IUT A;  2HD3 A;  1NR4 A;  2Q6O A;  2NN6 G;  4UAI A;  1OXX K;  4TMZ A;  4U9U A;  3HOU B;  2K5D A;  4MIU A;  1TWF H;  2F3W A;  4LF9 Q;  4P3I A;  3D31 A;  4PV1 C;  4DAP A;  3GTJ H;  3GTG H;  4LUV A;  3HKZ E;  2GK7 A;  3MMP A;  1QIL A;  1FND A;  2PIA A;  1SN8 A;  4PQX A;  3ZUG A;  5IT9 E;  2OQ0 A;  5FK9 C;  2VW9 A;  3A54 A;  5DM6 3;  4O2D A;  3I55 A;  2MNA A;  3FRP B;  5HXB A;  3ULL A;  4AVZ A;  1NJI D;  2TMP A;  4CDE C;  2WB1 G;  2BA0 A;  2PZT A;  1F60 A;  3I72 A;  2YWE A;  4P3Y A;  2J0T D;  5FL7 A;  3GTP B;  2BSA A;  1TWG B;  4C2M H;  2E8G A;  3HKZ B;  3NE5 B;  4MNO A;  4LUO A;  1K3B C;  3I56 A;  4NDX A;  1LUZ A;  1CKN A;  3S16 H;  2EYL A;  2B2W C;  4A3D H;  4A3K G;  1FD7 D;  4J0Q A;  1A3T A;  1XJV A;  4KJN A;  2I0Q A;  3S15 H;  1EFR A;  1J6Q A;  1LTT D;  5DM7 3;  3V76 A;  4ZGN B;  1S5C D;  3MHP A;  3OW2 B;  3I4N H;  3R6J A;  1KDC A;  2A6E C;  4OWX B;  4XYQ A;  4DK3 C;  4N8F A;  1KNE A;  5FO1 A;  3FKI H;  2L4N A;  3STB C;  1DOL A;  3I4L A;  4X3K A;  4XQF A;  2VZL A;  4ULL A;  4HIK A;  3AB9 A;  4E6I A;  1G6Z A;  2KCT A;  5FA6 A;  1Z6H A;  4U68 A;  3CD6 B;  3OJX A;  4C3J G;  1B4O A;  4NXM Q;  3S2D B;  2X3U A;  4IUP A;  1KRT A;  4JI1 L;  5LL6 S;  3J81 E;  3H3V H;  3CME B;  1VHE A;  4X62 Q;  2JA5 G;  5M3F B;  5LHY 1;  4KY6 A;  3V96 A;  4DF7 A;  3JAM E;  5EBC A;  1CK1 A;  2DET A;  1TY0 A;  1U4R A;  4KKS A;  4UHV A;  4MTK A;  4L5R C;  2Z8L A;  1VQN A;  1FNV A;  4B3M L;  1TKW B;  2F0F A;  4KHZ A;  1B9N A;  4Y7N B;  3AVW A;  1G7C A;  1N33 Q;  4JBW A;  4A3D G;  4LF4 Q;  1VQK A;  4HE6 A;  5C44 H;  3OWE B;  2F03 A;  1CNE A;  1XX8 A;  5LMU L;  2JA5 B;  4RD3 A;  2FMM A;  3HOX B;  1G51 A;  1PJ6 A;  5G3L F;  5GAD C;  3MZ5 A;  1V43 A;  2Z6B D;  1PYS B;  4K6D A;  2A69 C;  2QN6 A;  1VLY A;  1GUS A;  4RAU C;  1MRZ A;  1UD5 A;  3KL9 A;  4RWS C;  2W6I A;  4F7X A;  1HNW L;  4LF8 L;  4N9T A;  5F4J A;  2L11 A;  1E3X A;  3MFY A;  5M3M G;  4QFM A;  3PEN A;  1R9T B;  1KD1 C;  2B2T A;  1QGZ A;  1XNR L;  4DXF A;  4G6I A;  2K50 A;  4V0B A;  3B82 A;  4JI0 Q;  3AST A;  3A35 A;  3HOU G;  5IYB H;  3PCO B;  1M90 D;  4Y7C A;  1D6E C;  1WTR A;  4OEM B;  2QA4 A;  3VYT A;  1M1K C;  3W3A A;  4LFC L;  3AFP A;  2X69 A;  3KOJ A;  4K0K Q;  3J81 k;  1DGS A;  3CCU B;  2K1B A;  5GRO A;  2KHJ A;  2NZ1 D;  2KOL A;  4GLV B;  2UUC Q;  1W35 A;  1VQB A;  2WJY A;  1K0R A;  1JWS D;  1JR0 D;  2ENB A;  5HY6 A;  2EPB A;  4A3E B;  4G7Z C;  4YHH L;  4FXD A;  2FX3 A;  1J9O A;  4LF6 Q;  4JV5 Q;  4WZT A;  1IB0 A;  5CBE E;  4A3F H;  1E0B A;  1KRS A;  1K73 C;  4DV5 L;  2LSS A;  1PTO F;  2WP8 J;  2M5S A;  1TR5 A;  4JI8 L;  3MC0 B;  2R7Z G;  4YEL A;  3U4V A;  2A6E D;  3CB4 A;  3E20 A;  4ZKC B;  1WDT A;  1XE1 A;  2GK6 A;  3PGZ A;  4LNQ A;  1D2E A;  2V4D A;  2M9V A;  4DR4 L;  1D2B A;  2ZTN A;  3KK7 A;  1TWF B;  2QGG A;  5JJL A;  1KMH A;  1OB2 A;  3AVU A;  4XD7 A;  2QGQ A;  1ZYR C;  1EY4 A;  2XEX A;  4WFN 3;  1BBU A;  4DR5 Q;  1EYD A;  2F0P A;  2R92 B;  2A68 C;  2NVX H;  1W34 A;  3U4Z A;  1ILQ A;  1NB0 A;  1ONL A;  2V1C C;  4U67 3;  4XOT A;  4XLF A;  3G6E B;  1DXM A;  2D2C C;  1Q12 A;  4FDB A;  2IY5 B;  1PRT B;  3KBX A;  4WRD A;  2BPO A;  4LFA L;  4R4C A;  1OB0 A;  3SGI A;  3FEW X;  1YJN B;  3I73 A;  1QCB D;  4Z4V A;  1BQE A;  2DCU A;  2VNJ A;  5EBD A;  2PMZ B;  4UZF A;  3K57 A;  1FGU A;  3CQZ B;  5DS0 A;  1SNM A;  1E43 A;  3BU2 A;  3I3C A;  2JN9 A;  3ZYY X;  4LFB Q;  2KHI A;  2YWH A;  1ZM4 A;  3SJZ A;  1VHO A;  5J35 A;  4BWG B;  2WZN A;  2MO1 A;  4DFA A;  2XNC A;  2V7U A;  3GVK A;  1B7Y B;  4A3M B;  1A63 A;  1TWC H;  1DZ1 A;  3RMH A;  3BY1 A;  3CCM B;  1NJI C;  3P20 A;  1KRH A;  3WOF A;  4S3S A;  2PW5 A;  2B29 A;  5AN9 A;  4DV0 L;  3M3Y B;  2CHB D;  1PLF A;  1YIJ B;  2EYM A;  3GO5 A;  3P7J A;  2OBS A;  4P6V F;  1R5O A;  3TEH B;  3H6M A;  4FWT A;  5IYW A;  1E1T A;  3PO3 H;  1LT5 D;  3CW2 A;  1A3V A;  1SMX A;  3GVJ A;  1I8D A;  4LBZ A;  1C4Q A;  2NVT B;  4MYU A;  1EP3 B;  1S5E D;  4QHY A;  3HOY B;  3R2T A;  3J7Y W;  2H4O A;  3PF4 A;  3VA5 A;  5AJ3 Q;  5C0X J;  3GD7 A;  3S15 B;  2WFW A;  2CH4 W;  4NP5 A;  1ZM2 A;  4J1M A;  3VR2 A;  1NMG A;  2QDX A;  4RFB A;  1K8G A;  1QE6 A;  1VQH A;  2C77 A;  2KCM A;  4Z9C B;  2A8V A;  5THX A;  2PZU A;  1HTP A;  3H3V C;  4X05 A;  3IFT A;  4DV6 Q;  4C2M B;  3JAM c;  3HOW H;  1ESF A;  3OP1 A;  1I18 A;  2OEO A;  4A3M G;  3OOC A;  4AH6 A;  3S1R H;  3M3Y H;  2M2L A;  2HUG A;  1TTT A;  2QA4 B;  3ERO A;  3PUW A;  2BM1 A;  2KA7 A;  1B50 A;  1K28 D;  4A3M H;  3MHB A;  2PQA B;  3OIP A;  1HR0 L;  1CNF A;  4RKL A;  1UE7 A;  4N9P A;  3BCD A;  4ZRZ A;  4TMX A;  4C3H B;  4DK0 A;  1EWH A;  3U58 A;  1HTL D;  2PW7 A;  4DAV A;  1K9M D;  4YY3 Q;  1Q90 A;  2D9R A;  3ONU A;  3ZPN A;  4HAE A;  4KY7 A;  5JPM C;  3LGJ A;  4IUQ A;  2MP1 A;  1BNZ A;  3PO3 G;  4FF2 A;  3RLO A;  1CZG A;  1F2Y A;  1BQQ T;  1Y0Y A;  3OTO L;  2PCF B;  1MKH A;  2RF4 A;  1R4P B;  1VQE A;  2ATW A;  1SM4 A;  4B3X A;  4XKW A;  2L0C A;  2WIN B;  3HAG A;  1TY2 A;  2DNE A;  5D65 A;  3NEN A;  1QUQ B;  1X3P A;  2NPF A;  3SKB A;  5IT9 L;  5IE8 A;  3HOY G;  1WTH D;  1EWC A;  4LWC A;  3RZD H;  2DN8 A;  2C5B A;  1WFQ A;  5A2Q E;  1SYF A;  3I70 A;  2ASB A;  2NZH A;  2VB3 X;  4J6H A;  1EIY B;  1WOO A;  1KIX A;  4M0L A;  1EEI D;  5IYR A;  5C3X A;  1Q8I A;  1C9O A;  3BVZ A;  2CF4 A;  3W2E A;  1HNW Q;  1GO2 A;  3J80 c;  3Q6S A;  5FLX L;  1G91 A;  1E24 A;  3M7N A;  4RA8 A;  1SND A;  5C4X H;  2Q6K A;  2OK7 A;  3KEW A;  5K36 H;  4JI6 L;  1HA6 A;  2A6H D;  1P16 A;  3GTO B;  3TN2 A;  2UXD L;  4A3F B;  3T1Y L;  1NCV A;  1O7Z A;  4A3G H;  1IBK Q;  2R9V A;  2B2T C;  1WD0 A;  2PPB C;  5TV2 A;  5K36 G;  1ICW A;  4YAF A;  4JC0 A;  3VR4 A;  1STG A;  5IYB G;  1NBM A;  1N34 Q;  1R5B A;  4A3E H;  1VCI A;  1SE3 A;  2EJG C;  1QUQ A;  1UEA B;  2AHO A;  1FNB A;  3BZK A;  4K6L A;  1Y8O B;  5M9O A;  3S1M H;  1CQX A;  1VQL A;  5IT9 c;  3CCM A;  1CQF A;  4IPD A;  1VQK B;  3FKS A;  5JEA H;  3FMC A;  5IP9 H;  4PZ8 A;  4ASU A;  1IBM L;  1Y14 B;  4DUZ Q;  2E2H H;  2K6A A;  1U0L A;  1BX0 A;  1EIF A;  1VLO A;  3ASP A;  3T1H L;  4YWM A;  1N08 A;  1KK0 A;  3CPX A;  1M8A A;  2Q6L A;  1V0E A;  2HQE A;  4K14 A;  1G29 1;  5IGB A;  2JA6 H;  1NSN S;  5LMN W;  4G7X A;  2Z6K C;  2JSO A;  1SRO A;  2ZL6 A;  4NCN A;  3CC2 B;  1ZM9 A;  3SK5 A;  3RZD B;  4JI6 Q;  2A68 D;  1I4R A;  3BQJ A;  2ID0 A;  3H3V I;  3VNU A;  1GJR A;  3AMU A;  2JA7 G;  1KJZ A;  4DV4 L;  3UDX A;  2EY5 A;  1E62 A;  1S4Z A;  2PQE A;  1SDF A;  4ZK9 B;  4IZ8 A;  1G7T A;  2PQA A;  1WOP A;  4R9W A;  5JJZ A;  4HJ7 A;  3PUX A;  1AMO A;  2ZBU A;  2NN6 H;  1NB9 A;  1L0Y B;  4UZU A;  4XQQ A;  3EQL C;  1IJF A;  5ELN A;  1Q46 A;  1Y1V H;  1Q81 C;  2D74 A;  3C2Q A;  2JYO A;  5M3F H;  1BF4 A;  4TT3 A;  1UE1 A;  1LV9 A;  1B23 P;  3CME A;  3A8K E;  2WR8 A;  3D0F A;  4PZ6 A;  3FKI B;  3VO2 A;  2FFK B;  2EXZ A;  4RKB A;  1BDO A;  1VQ9 B;  4NMZ A;  4LW1 A;  4DUY Q;  4ZGQ B;  1AN8 A;  3ZC3 A;  4R4T A;  4TRD A;  1KD1 D;  4ZCM A;  4JK1 C;  3I4N B;  3EVQ A;  5IGG A;  2QTL A;  1SJH D;  2JN4 A;  5TSS A;  4Z4W A;  4B3G A;  3SDZ A;  2A5H A;  1I4Q A;  1UD6 A;  2ZXH A;  2Z0S A;  1D8L A;  3K5O A;  4P72 A;  2NVQ H;  5FIU A;  5KRU A;  4EVO A;  3BC9 A;  4QVA A;  2B2V A;  4A3C H;  4PAB A;  2EXD A;  3CW2 C;  2XZP A;  3OPO A;  1LTA D;  1JOR A;  1CA5 A;  2X85 A;  2Y0S B;  5DNF A;  5JJI A;  4NW2 A;  3F8T A;  4A93 B;  3LWE A;  4XNF A;  3J7Z C;  2V31 A;  4DPG A;  3QJY A;  3CQZ H;  4KKU A;  2VBT A;  1TU2 B;  3G05 A;  5FOB B;  1ENC A;  1JJ2 A;  2F52 A;  3TP6 A;  3H94 A;  1PFN A;  4FNF A;  2C5C A;  1OXT A;  4RM0 A;  4DV0 Q;  2F0G A;  1CKM A;  1JIC A;  2KBN A;  1WSR A;  4G7W A;  1WOS A;  1AH9 A;  3I4N G;  2KEE A;  3VYR A;  3E3X A;  1EXM A;  4A3B H;  2ZIT A;  1JJG A;  1KDA A;  2NWG A;  4A3I H;  4C1N I;  4PGO A;  3ITP A;  4OPV A;  2UUA Q;  4JI2 L;  1L1O B;  4GNX B;  1X54 A;  3R93 A;  1WVL A;  1EFW A;  3M4O H;  1VQO A;  4A3L G;  1STN A;  3H15 A;  2WAC A;  2CRV A;  2SEB D;  2B7B A;  5BSX A;  1N32 Q;  4A3I G;  1YHB A;  2VNU D;  1D7Q A;  3HKS A;  3TS2 A;  3SK4 A;  5DSZ A;  3OEE A;  4ZKB B;  2EOT A;  1WCM G;  2OT2 A;  4MTN A;  3O13 A;  1NUC A;  2ICI A;  5I4D A;  1VQP B;  1TVC A;  5M5Y B;  3G4S A;  1SYD A;  1HA3 A;  1SYG A;  1GUN A;  1EIH A;  3VDY A;  3TZD A;  3ZJY C;  3CPW B;  4C3I H;  1YHA A;  3VO1 A;  1N34 L;  1EFC A;  4M4S A;  3LQE A;  3L3O C;  3F2B A;  1E79 A;  4RDK A;  4AQY Q;  3S1Q H;  4R1J A;  1OHH A;  4HJ8 A;  2F4V Q;  2BGI A;  1LT4 D;  4RCY A;  2OBT A;  2JA7 H;  1FNU A;  4JI0 L;  1VF5 C;  1H9J A;  3BDC A;  1AFP A;  2B2V C;  4LF9 L;  4UP9 A;  1XTD A;  2NZO A;  3ER0 A;  5HZA A;  1BUV T;  1DJR D;  4G4K A;  1I94 L;  2JA8 H;  3DHQ A;  1XMO L;  4HID A;  2XRQ D;  4BBS G;  2H1E A;  1DDG A;  3QE2 A;  3G71 B;  5J3O A;  4OON A;  5J39 A;  2ALY B;  1Y8N B;  2D9U A;  2F0L A;  2ZJP A;  2HIX A;  3NPP A;  4XOR A;  3C1F A;  1SE2 A;  2HHH Q;  5LMN L;  4FO2 A;  3CCE B;  4MZ9 A;  1MSH A;  4H13 C;  2JJ1 A;  5LL6 X;  4H0L C;  2GPJ A;  4OX9 Q;  2XTI A;  3NEM A;  1CHP D;  2D3L A;  4EQP A;  2RSO A;  1CHQ D;  5DN6 A;  4N8X 1;  2QEJ C;  3BS1 A;  1F2L A;  3UE1 A;  2QDL A;  1ASZ A;  2L5T A;  1PYB A;  4IPG A;  1HVX A;  1YBY A;  4XR6 A;  1Z9F A;  5IYQ A;  4UPA A;  3EBE A;  3SE0 A;  3H9N A;  4K2L A;  3HGB A;  4P9S A;  1WJJ A;  1PRT D;  2NTS A;  1HUN A;  4RD0 A;  5IIF A;  1SNQ A;  1RIP A;  1L0X B;  3ZZ0 A;  2KCN A;  4QMG A;  1VS0 A;  1QB5 D;  4TSS A;  2F0Q A;  4BS9 A;  4AC9 A;  1E7Z A;  4CDC C;  1UWV A;  4KKT A;  4LF4 L;  1PH2 A;  3J80 E;  3Q23 A;  3S2H B;  2CW5 A;  3QSY A;  3W5U A;  5KNL A;  3S9W A;  3CCE A;  3TP5 A;  4RJL A;  1O78 A;  3RZO B;  4R4I A;  4OHJ A;  3A8I A;  2OTJ A;  1VQ4 B;  4DV7 L;  4K1X A;  1XPR A;  5FJ8 G;  4GZY C;  4XN3 A;  2QW7 A;  4GS3 A;  3MWY W;  3WXM A;  1Q1E A;  3DM3 A;  4JYA L;  1DYQ A;  1S5F D;  4J15 A;  4R71 A;  2GN5 A;  2HMA A;  5FLM H;  1BCP F;  1CSQ A;  3BY2 A;  4G5G A;  1KAB A;  2XN9 C;  4IAL A;  3IRB A;  1BJK A;  3NQI A;  3CCU A;  1VQ5 B;  2IHE A;  5FNZ A;  1YJ9 B;  3G4S B;  5C4J B;  4OIK A;  3D26 A;  1K9M C;  1YZ6 A;  2G5D A;  4ACA A;  4B48 A;  2RDH A;  2Z4H A;  4JCV E;  4RD4 A;  4A3G B;  2RDF A;  1HUM A;  1PZJ D;  2K75 A;  2B5O A;  2BM0 A;  2EVB A;  4X66 Q;  1VF7 A;  2QTZ A;  2RSN A;  3WNC A;  4H7B A;  4BY7 H;  2YTX A;  4QGU A;  2EDG A;  3D3R A;  3AGP A;  5COY A;  5ELD A;  3GTG B;  4PC6 A;  1HPC A;  3AGQ A;  4QIW E;  4EQN A;  2F0S A;  1SNP A;  3A8J A;  1X6O A;  1SSO A;  2HCC A;  2MO0 A;  2NB0 A;  3NK9 A;  2ES2 A;  2D62 A;  4WWV A;  5EJW A;  4XLH A;  2FJ2 A;  3KJP A;  3X3M A;  1Q81 D;  2K14 A;  3P75 A;  1STA A;  2UU9 Q;  3A74 A;  4ZUJ A;  1F9P A;  3UDI A;  2A19 A;  1D8T A;  4N3G A;  4LBV A;  3MXU A;  2CQO A;  1QZH A;  4OPO A;  4ROX A;  1SAP A;  3OZU A;  2Q6I A;  1SBB B;  4B3F X;  3BDL A;  1YJ9 A;  3L7Z C;  5D3I B;  1IHM A;  2A6H C;  2RVL A;  4DU9 A;  2WAQ G;  1HNX L;  4FF3 A;  2Q2H A;  5EGT A;  1UD8 A;  2EY6 A;  3GTQ H;  2B2W A;  4KN7 C;  1O80 A;  5J1Z A;  2DGY A;  1BBX C;  4BY7 G;  1LTB D;  5FO9 B;  1QOH A;  1I6V C;  4HR7 B;  1FJG L;  4OPS A;  1GO3 E;  4GOP C;  2ZM6 L;  4II3 A;  1K3R A;  3M4P A;  3ONA B;  1Q7Y D;  2BF4 A;  1MD2 D;  3NUC A;  2BE5 D;  3S1R B;  4M1U B;  4DR6 Q;  1S72 B;  2UUB L;  1ZXT A;  1GVP A;  1JOK A;  2BDN A;  3OMC A;  4JI5 Q;  3Q39 A;  4Y9U A;  3CCQ B;  1X32 A;  3AU7 A;  1YIJ A;  1J5E Q;  4B43 A;  1G2S A;  4B9W A;  5GQO A;  3TP8 A;  4K8I A;  4DV4 Q;  2NVQ B;  3MA2 B;  4RG1 A;  5T1I A;  2ZZQ A;  3W1B A;  3ERQ A;  2K5V A;  1YNN C;  4DR5 L;  3KDF B;  3KF6 B;  5DLQ E;  4XKV A;  4XM3 A;  3DUZ A;  1CZW A;  2D5D A;  3SLN A;  1KAW A;  5HGT A;  1II3 A;  4CJ2 C;  4X64 Q;  2OTJ B;  1HNZ L;  3ZZT A;  1VQO B;  3FP9 A;  4KHP L;  4X64 L;  1E63 A;  2B3G A;  1CKN B;  1RDP D;  4PNY A;  3PUM A;  2I1L A;  2JJQ A;  3SK8 A;  1GOZ A;  4P25 A;  4JI8 Q;  3QOL A;  5LMU Q;  1SNC A;  3IKJ A;  5B6I A;  4DUZ L;  1IBM Q;  4BBR B;  1J5E L;  4GN4 B;  5E6T A;  4KHV A;  1JMC A;  3J7A F;  1ZKO A;  4JPB W;  1WTW A;  1JWM D;  2C9O A;  1VQJ A;  1IXR A;  4PMW A;  4BXX G;  1N0V C;  2DY1 A;  1FRQ A;  3M9B A;  2BVN A;  1MJC A;  3H91 A;  5DAU A;  5JJK A;  2ZL7 A;  1XFO A;  2J4X A;  2E2I H;  5KNC A;  4OWW B;  1LAB A;  4AYB G;  1D5X C;  3HG9 A;  2F4V L;  2VZA A;  4FXK C;  5IP7 H;  5K5P A;  1O7L A;  2KQ3 A;  3CCV A;  1TVX A;  1WPC A;  4QUC A;  4YWK A;  1WOC A;  3ERS X;  3KJO A;  4X62 L;  1UUP A;  1C7Y A;  3CC4 B;  1G6P A;  1XNQ L;  2J7Z A;  2X6X A;  1MJE A;  3HP3 A;  1A2U A;  4X07 A;  4AYB B;  1YX2 A;  3GP7 A;  3E0J A;  4KI0 A;  1RCV D;  2NVX B;  4I7Z C;  3FVQ A;  1TWH H;  4HTH A;  3E1Y E;  4IOC A;  3PO2 H;  1XWE A;  2ZM6 Q;  1N32 L;  1P8L A;  1PTO B;  2R7F A;  4DV2 L;  5L46 A;  4DGZ A;  5IYD G;  4FYD A;  1IZ6 A;  1U9R A;  3G7L A;  2F0V A;  1TWA B;  2A74 C;  3ZIA A;  1Y69 U;  3ND8 A;  3P27 A;  1RF2 D;  2GVA A;  1EFT A;  4HE5 A;  3AYH B;  2EY2 A;  1AEX A;  1PH8 A;  3QIA A;  2MJ8 A;  3T1Y Q;  4L5Q A;  4R4Q A;  3RLN A;  1EFI D;  1LTL A;  1SRU A;  3ASS A;  3VNV A;  2HDN B;  3JAM i;  2AUK A;  2OTL B;  1EYC A;  1GUG A;  5AJ3 L;  3J81 i;  1RTO A;  1OB5 A;  2PYK A;  1BXT A;  4LJZ C;  1BMF A;  3F2C A;  4XYO A;  2RC5 A;  5CC4 A;  4P73 A;  3CC4 A;  3T51 B;  2CCZ A;  4UDU C;  3JQP A;  4FF4 A;  5JVH 3;  3C3L A;  3CRZ A;  1GKH A;  3GTL H;  2CBX A;  3CPW A;  1TWA H;  2HDM A;  1F2Z A;  1FYC A;  1BBW A;  4RD6 A;  3K80 C;  1N05 A;  4LK1 C;  4X8I A;  1DCZ A;  3RN5 A;  4ALP A;  4XIG S;  2CWP A;  3HFZ B;  4IPH A;  3BNW A;  4A3J G;  4A3K H;  1T6Z A;  1WI5 A;  2LFN A;  3CTA A;  2F3I A;  4XL9 A;  4X66 L;  2JK8 A;  2IL8 A;  3QOJ A;  4P6Y A;  4KD4 A;  3GTM B;  4DV2 Q;  3H0G G;  2XWB B;  1K83 H;  5CV7 A;  1MIU A;  2ZZG A;  1EYG A;  2LXJ A;  3WYA A;  2JXM B;  3G71 A;  1STB A;  3NXW A;  5C44 B;  4B3S L;  1TLL A;  2JA5 H;  3W2F A;  3SXH A;  1K8M A;  2MQH A;  3BYT B;  3M4Y A;  2AQ1 B;  2K32 A;  2ZTD A;  1D5Z C;  3JC6 6;  3NTH A;  5GAE C;  1JB7 A;  3FKI G;  1QG7 A;  4AF6 A;  1EOT A;  2B2Y A;  5BN3 A;  5M5X H;  4HIO A;  3HKZ G;  1YI2 A;  3UI2 A;  2MFI A;  3HOV H;  3S1N B;  1M4V A;  3DM1 A;  3T16 A;  2BN4 A;  1I4P A;  2NTT A;  4B08 A;  2HCI A;  2EFG A;  4L63 B;  1SFO H;  3B6Y A;  3OKX A;  4P75 A;  1DAR A;  2XZL A;  4OX9 L;  2F4N A;  1L1O C;  4ZCI A;  4GNX C;  2XSC A;  2PI2 E;  1LTG D;  2CK3 A;  1K8A D;  4A4I A;  1VQ9 A;  2KED A;  5JBQ A;  2DER A;  4K5W A;  4KK7 A;  4II2 A;  3CF5 A;  2E1B A;  3W2H A;  2KEC A;  2E5L L;  1X3Q A;  4XOP A;  3NWS A;  4MHE A;  2F4I A;  2B8G A;  4GLX A;  1W6K A;  2UUC L;  4X3T A;  2ICE C;  1YJW A;  4J8Q A;  1LT6 D;  4OGQ C;  3KBG A;  3CC7 B;  5JEA G;  4OO1 H;  1A8P A;  1I3Q B;  4XDX A;  5D14 A;  1VDZ A;  1N33 L;  4UP8 A;  3GTP H;  1QUF A;  1UD3 A;  3WBK A;  2AQ2 B;  1TWG H;  2G9H D;  2EYH A;  3V2T A;  4WZK A;  3S1M B;  1IKL A;  2QCP X;  2K5N A;  4BXX H;  1MSG A;  2QEX B;  2P5Z X;  2R3Z A;  2RA4 A;  2V7T A;  4WZE A;  1Q86 D;  1PKV A;  1PJ5 A;  1EWY A;  2I5L X;  4JBK A;  1PH7 A;  1W87 A;  1Z7T A;  2WYR A;  4ME5 A;  5M5Y H;  4FXU A;  2LZJ A;  4TMW A;  5M3F G;  1H9R A;  3MFG A;  3GQB A;  4LBW A;  2RCF A;  3RY8 A;  5ELO A;  5C5L A;  4B3S Q;  1QWY A;  2F1M A;  3SVM A;  2VUM G;  3CXC A;  1JOQ A;  1R5N A;  4Z4U A;  4WOR A;  4G57 A;  1SYC A;  4ACB A;  1T5X D;  2VB2 X;  4R4O A;  1OXV A;  3W2G A;  1KQS B;  5C3W A;  4DV1 L;  1V8Q A;  2C5H A;  4KJO A;  3P26 A;  2MPM A;  2L55 A;  1XMO Q;  5I9O A;  4X7E A;  1U2R A;  5ELE A;  1IBK L;  3KDF A;  3CP2 A;  1Q9S A;  2LXK A;  4JOI C;  3BG3 A;  3QFR A;  4RD2 A;  4B3T L;  5E7N A;  4P22 A;  2WZP P;  3W5O A;  4TN1 A;  1KTK A;  3ICE A;  2B2Y C;  1L1O A;  4GNX A;  4DV3 L;  4XQN A;  4KTA A;  1KXL A;  2QEX A;  4LF6 L;  4JV5 L;  2MGS A;  2NYZ D;  2VL6 A;  4IFD G;  1F77 A;  2F0D A;  3BDO A;  3CCR A;  3OEH A;  5H59 A;  3V7A A;  1HJP A;  2JE6 I;  1PVO A;  3CES A;  4DR3 L;  1XB2 A;  1YNN D;  1M1K D;  4ILW A;  4BY7 B;  1VQP A;  1SMY C;  4YAL A;  1CSP A;  4DUY L;  2C2W A;  4M2L A;  4DXG A;  1K8A C;  4LBY A;  1AIP A;  3GVL A;  3T13 A;  2UXC L;  1I50 B;  3I8Z A;  4YEJ A;  4WJ3 M;  1QNK A;  1H8H A;  1ILP A;  2K01 A;  1H9M A;  4BBR H;  1HFN A;  3T53 B;  2Y0S E;  3A8J E;  2C4U A;  2B2U C;  2CWA A;  2ZJQ A;  4LFA Q;  1CA6 A;  4H44 C;  2B63 H;  1E2W A;  1E2Z A;  1I3Q H;  1DM0 B;  1H8E A;  2ZJR A;  1R9T H;  3P1H A;  1G7R A;  1XNQ Q;  1U4L A;  1CUK A;  1GUT A;  5COR A;  4KMU C;  4MYT A;  1N9W A;  1BVS A;  4IUV A;  5GV7 A;  2YU9 B;  3HOY H;  2BH8 A;  3CRK C;  1DON A;  2R61 A;  4BA2 I;  5HKK A;  4YWL A;  5I2X A;  3ZBT A;  5A8A A;  1T9H A;  2A69 D;  2WB1 B;  4DV6 L;  4NKL A;  4RPD A;  1VQ7 A;  3LX0 A;  1KK2 A;  2K5H A;  5E4W C;  5CV4 A;  4XON A;  1GR1 A;  4FP5 D;  3HOX H;  3C1E A;  4M53 A;  1N06 A;  1ICF B;  3FPU B;  4NXM L;  4Y7N H;  2NUC A;  1JJC B;  4Z4R A;  1EYA A;  3D8G A;  5C0X I;  3DWP A;  4B44 A;  1MGS A;  4QY7 A;  2WJV A;  1QGA A;  3CPF A;  1OXU A;  3S1N H;  3HOV B;  5TRD A;  4OL7 A;  4BA1 I;  1T6X A;  4C43 A;  4B9X A;  1PXU A;  4DV3 Q;  4G1V A;  1JJ2 B;  2HHH L;  1AW7 A;  2WKD A;  4H9G A;  3TZU A;  1NY4 A;  2JJ2 A;  4RCN A;  4TMV A;  3U9S A;  4X7D A;  1WTO A;  4OP7 A;  1PHJ A;  2GVB A;  3OIQ A;  4KLK A;  4XQJ A;  3PIO A;  3IAY A;  4QCL A;  1HCZ A;  4HJ9 A;  4Z4Z A;  1AE2 A;  1PZK D;  3A7L A;  3L0O A;  2X0K A;  2F0J A;  3NWT A;  1KZL A;  2HLD A;  1UNS A;  2R7D A;  2CVR A;  1EP2 B;  4GOP A;  1STE A;  1EQT A;  4LF8 Q;  1V0F A;  1R4Q B;  2AUJ D;  2LS0 1;  1VQ6 B;  5I2Y A;  2YWG A;  3AVY A;  4YCV A;  2IJ0 A;  4C3H G;  1VQ4 A;  4F88 A;  5C5M A;  4AQY L;  4RGO S;  3MTS A;  4A93 G;  3NQT A;  4A75 A;  2UUB Q;  5FLX E;  1EIG A;  3OHX C;  1VQC A;  2JA8 B;  2BGJ A;  1GAQ A;  1CM9 A;  1KLU D;  2XRS D;  1PH6 A;  4JI4 L;  1JNY A;  2EYP A;  3GTL B;  3A55 A;  1K28 A;  4F7D A;  1EY9 A;  4QV2 A;  2I5H A;  3BYY B;  3WDN A;  4CDD C;  3TBI B;  1X65 A;  1G7S A;  1YEZ A;  1YNJ D;  4QVJ A;  4IPC A;  2PNR C;  4C3I G;  4K5V A;  2IX1 A;  4EH1 A;  4DV5 Q;  1OGI A;  4PC2 A;  1W9X A;  3D6W A;  4BY1 H;  1PH5 A;  2QIL A;  5HZB A;  1LYL A;  4PZ7 A;  1HHV A;  4LF5 L;  1WP6 A;  1IYJ B;  1IW7 D;  1PFB A;  3ZZU A;  4ID6 A;  2X6G A;  2ZXR A;  3I4O A;  5JOB A;  3CKI B;  3F2D A;  2O4X A;  2Z6B A;  2ZXP A;  1PJ7 A;  3K5M A;  1Y8P B;  1H9S A;  2TSS A;  5E4X A;  3LVB A;  1GVH A;  2Q2T A;  3RZO H;  3M4O B;  2E5L Q;  4DA2 A;  3QFT A;  4KY5 A;  1TUI A;  2JA6 G;  1VMC A;  1LAC A;  4A3I B;  1WSV A;  1U4P A;  2DY7 A;  2EE1 A;  2ZTE A;  4DNI A;  2K28 A;  2VXW A;  1RTN A;  3J81 L;  1JCK B;  1QVC A;  3JQR A;  1WYD A;  4GKK Q;  3OTO Q;  1PZI D;  3C2P A;  4O1N A;  2F0W A;  2DUD A;  1X56 A;  2JP1 A;  4IUN A;  1SEB D;  2Q2I A;  3SR1 A;  4RHR A;  1ENF A;  4ODG A;  4QUF A;  2F0E A;  1KC8 C;  3QR8 A;  3OZV A;  2QF7 A;  2E2I B;  4UZE A;  3X3N A;  1D1K A;  1RKN A;  4RGM A;  2C35 B;  2BA1 A;  3J80 L;  1EZ6 A;  5IYC G;  3VYS A;  5EPJ A;  3S2D H;  3ZBU A;  4ZCK A;  1LTS D;  4XTC S;  1H9S B;  4LC0 A;  4Z4S A;  1EP1 B;  2EYO A;  3NBI A;  4C3J B;  4KV6 A;  4XXE A;  4Y9R A;  4GKJ L;  4RPB A;  1XMQ L;  1KQS A;  2WII B;  1KAA A;  2NV4 A;  2KJX A;  1RHP A;  4C56 C;  4B3R L;  1JT8 A;  1XMQ Q;  1HZC A;  2PO4 A;  4JI1 Q;  2E74 C;  5CV8 A;  5CV9 A;  1WTH A;  1EUJ A;  2K33 A;  1T5E A;  5BN4 A;  3I2Z A;  3KF6 A;  2E2J B;  3M7G A;  1SJE D;  4RDJ A;  1FNM A;  1NDH A;  2O5J C;  2RHS B;  1HZ9 A;  5J22 A;  3FPK A;  5EMN A;  1YLO A;  5IYP A;  2IPK D;  2CC2 A;  2AWN A;  4A3C G;  5IY0 A;  2B63 B;  4HJ5 A;  2BOS A;  2EJF C;  3CCL B;  4A3B G;  5KGU A;  4C3J H;  4CHT B;  2F43 A;  2HDL A;  3FDT A;  2XGJ A;  3A7A B;  4QJF A;  3OWF A;  4HN7 A;  1TWC B;  3W5H A;  5CMD A;  1ET9 A;  2AHO B;  4X3U A;  4A3J B;  5J3B A;  1ESR A;  5I6W A;  4POF A;  1QZG A;  1EY8 A;  4NB3 A;  4NNJ A;  1B2R A;  4QUZ A;  2LY7 A;  3WNB A;  2FXQ A;  2HQL A;  3GTQ B;  2WV6 D;  1YJN A;  2VBV A;  4B3T Q;  2RBM A;  4HSP A;  3H09 A;  1HZE A;  1EOV A;  1HH2 P;  2SDF A;  4HSV A;  4CQJ A;  4NBS A;  1MAB A;  4G1B A;  4IFD H;  4DQL A;  2AMC B;  3E5S A;  4P2C B;  5IK2 A;  1X3F A;  1QFJ A;  3J81 c;  2I46 A;  1W0K A;  1NE3 A;  5IOD A;  2F1L A;  3WY9 A;  1E1O A;  4YIJ A;  1OO9 B;  5ELF A;  3R8B A;  2IHF A;  3H0G B;  1A62 A;  1IW7 C;  3PF5 A;  4JI4 Q;  4LAA A;  1LM0 A;  2B8F A;  1QFY A;  4XLE A;  3T1H Q;  2F0O A;  5BR8 L;  4YXW A;  2X8K A;  4DAM A;  5EKI A;  3G6J B;  5TY0 A;  2PLF A;  3FHW A;  1HNZ Q;  2J7K A;  2V7V A;  2R92 H;  2I5M X;  2O5I C;  3GIR A;  3A5U A;  2E75 C;  3W5V A;  1VQ7 B;  2F0H A;  2NN6 I;  3A56 A;  3J80 i;  1YIT A;  1MBY A;  3D6C A;  4RMF A;  1N36 L;  2E2H B;  3I55 B;  1PMR A;  4OO1 I;  3WOE A;  3Q38 A;  5CR3 A;  4DN4 M;  2EZV A;  4DV1 Q;  1VQI A;  1EQR A;  4IUU A;  3KUP A;  5M5W B;  1VQM B;  1V1P A;  4JI5 L;  2BV3 A;  3AVT A;  1SNO A;  5FO8 B;  3SEJ A;  5ISR A;  4BY1 B;  4EGV A;  2VNH A;  1X3E A;  1QNU A;  3CCR B;  5CV6 A;  4X0C A;  1B8A A;  3A8I E;  3TQY A;  5IGF A;  1FVI A;  4DR2 L;  1B70 B;  4HCE A;  2ZXI A;  2K7V A;  1XXG A;  4Y52 H;  2VQE Q;  2VYQ A;  3A1P A;  2AKW B;  2EY1 A;  4RGN A;  4QIW B;  4ABN A;  4HCS A;  3LNN A;  5IP9 G;  4EQ5 A;  1P4M A;  5F4O A;  2NVY B;  3DWQ A;  1PFS A;  3KYH C;  1VQ8 A;  4Q5V A;  2ZZE A;  3IFD A;  1GHK A;  4K8J A;  3S17 H;  2N8N A;  2XZO A;  1CKO A;  2F0I A;  1KK1 A;  4TVA B;  4B47 A;  4YAO A;  1COW A;  2F3V A;  2OK8 A;  2BDO A;  1H42 A;  1N8R C;  5C4X B;  3I1F A;  2VBS A;  2XGT A;  4Q7J B;  1WCM H;  4IO9 A;  1JA0 A;  1SKY B;  5BR8 Q;  2MUY A;  2EYF A;  1I7P A;  1OGJ A;  1KTV A;  2ZT9 C;  4BBR G;  2XWJ B;  4P26 A;  4XLA A;  2YTV A;  4DR2 Q;  2OWO A;  2IWH A;  1PFM A;  1FJG Q;  3F2U A;  3KF8 A;  3Q0A A;  3OE7 A;  2VQF Q;  3U50 C;  4CKB A;  4LF5 Q;  1IYV A;  3TDQ A;  2DEU A;  2B63 G;  1Q82 C;  5C0X H;  1EWI A;  3Q3A A;  4UAJ A;  4TKO B;  1DOM A;  1BCP C;  1SFO B;  4DAY B;  4JVZ A;  4K0K L;  3DMU A;  1C0A A;  1DG1 G;  4G7O C;  3KLW A;  4OWT B;  3A0J A;  3TP7 A;  3EJI A;  3IL8 A;  2UUA L;  2H5X A;  1WTX A;  2Y0S G;  4LUZ A;  1GXD C;  3OFN A;  3G48 A;  3BJU A;  1E1Q A;  1C8C A;  3CAM A;  5IP7 G;  2CKZ B;  2LKV A;  4HMI A;  1QVF B;  1EEF D;  3V05 A;  1I6H B;  4DR3 Q;  2AWO A;  4X7C A;  1OTC A;  3GTM H;  4C1N K;  4EQO A;  2OBR A;  2E2D C;  3VR6 A;  1Y1W B;  1BCP B;  4I65 A;  2DJF C;  2CW0 C;  5ELB A;  3NSW A;  2KVM A;  3KLS X;  1DOK A;  1CQV A;  3MXN B;  2JA6 B;  4IFD J;  5M3M B;  3S14 B;  1RJT A;  1STH A;  3PUZ A;  5F4M A;  4DV7 Q;  2IT1 A;  4JG2 A;  4JI2 Q;  3OW2 A;  4YCU A;  4QF4 A;  4CBV A;  1YJW B;  1D5M C;  3BCF A;  1YVC A;  2KVO A;  4C0S A;  1QVG B;  2KCC A;  3T56 B;  3CC7 A;  4JMQ A;  1ZUN B;  2Z4I A;  2I07 B;  4GOP B;  1J9Z A;  4CKC A;  2UXB Q;  3AVX A;  3HOX G;  2ZL5 A;  1PH1 A;  2X6Y A;  1CTM A;  2YTY A;  3RUZ A;  5FJ8 H;  1IL2 A;  3KFU A;  1JB3 A;  1TQO A;  2NVY H;  3HOZ B;  2R6G A;  4OOX A;  1G8Z D;  4ZLT F;  4C3I B;  4RH6 A;  4APV A;  2W6J A;  3CC2 A;  4XN0 A;  3S1Q B;  4ZCL A;  4FVM A;  1N8R D;  4CJ1 B;  1PV4 A;  1HR0 Q;  1HZB A;  1I5F A;  1QGY A;  4AF7 A;  1I50 H;  1SMY D;  3K59 A;  5CYU A;  1VQG A;  4LF7 L;  3TME A;  4DKA C;  3A8K A;  3ULP A;  2PE3 A;  3JU4 A;  1PH3 A;  1QG0 A;  1Y0R A;  1LT3 D;  3QWN A;  4GKK L;  3PV0 A;  4PMB A;  2QKI C;  3E6Z X;  2FHT A;  2QMU A;  4P12 A;  1S3O A;  3Q22 A;  3A3G A;  3MEF A;  1PA6 A;  1NRK A;  2R92 G;  2JA9 A;  5EPL A;  2PMZ E;  3HOZ G;  1VMP A;  1S5D D;  3HOW G;  4DNR B;  2R93 B;  4WZL A;  5HGQ A;  3CCV B;  4NPS A;  1IBL L;  3QFC A;  1Q7Y C;  4A76 A;  1RL2 A;  4RLZ A;  2VUM B;  3RN2 A;  3VMF A;  1QUE A;  5TR9 A;  4YHH Q;  3OW7 A;  3H0G H;  2FIN B;  3S24 A;  2F0K A;  2KEN A;  4OO1 G;  4PAA A;  1UEB A;  3EIV A;  4DNT B;  2D0P A;  4A3L H;  2V7W A;  3BZC A;  1WTP A;  1I4H A;  3QG1 A;  2F0N A;  1XQB A;  4FK8 A;  1K73 D;  2GA4 B;  1DDI A;  1PDQ A;  2GJK A;  1NBW A;  3C46 A;  5GAG C;  1VQD A;  3K5L A;  4FF1 A;  3L9A X;  2NBF A;  1GD7 A;  1TS5 A;  4M1K A;  1A15 A;  4LFB L;  3OZW A;  4UY8 C;  2UXC Q;  1YNJ C;  1E64 A;  3BVM A;  4X7F A;  4R8N A;  5D3D A;  5DEH A;  1B53 A;  5KYI A;  3L2P A;  2HIV A;  4A93 H;  3K58 A;  2SOB A;  4N3N A;  2JEA I;  1EY5 A;  1NR2 A;  1EFU A;  3WND A;  4A3J H;  3LQ6 A;  4RCZ A;  1B9M A;  4XT3 B;  4HIM A;  2XVS A;  5E1F A;  4WJ4 A;  3GV6 A;  2C78 A;  4NXN L;  1LTI D;  4RD1 A;  3OSO A;  3HOZ H;  4L6T B;  5HUR A;  1EZ8 A;  2K03 A;  5IYN A;  4OXP A;  5H1S E;  3I56 B;  1EY0 A;  4DR1 L;  3F1Z A;  2WB1 E;  2VNK A;  1QJO A;  2VY3 A;  5C3E G;  4JI3 Q;  1AZQ A;  4B4D A;  2F0T A;  1V9P A;  3HS0 C;  1E1R A;  3MXN A;  2XIW A;  4POG A;  3K81 C;  5EKK A;  1QX4 A;  3EN2 A;  2OF1 A;  1F2M A;  2E2J H;  5KND A;  4K5X A;  4KHP Q;  4XT1 B;  4X06 A;  4P71 A;  2E76 C;  3HOV G;  4Q0F A;  3KLR A;  3CMA B;  2R7Z H;  1VQF A;  1YIT B;  1O7I A;  2IX0 A;  3KLS A;  3HEJ A;  1TXY A;  1H85 A;  4OIJ A;  4A3F G;  1I6H H;  4JI7 Q;  5ELC A;  3MVV A;  3HZX A;  5IWA Q;  2BCO A;  1VQM A;  2D0O A;  1S40 A; 
#chains in the Genus database with same CATH homology
 2BE5 C;  1I4G A;  1Y1V B;  2K04 A;  5IOC A;  5C0X G;  4IFD I;  4IN3 A;  2L12 A;  2VJI A;  1SE4 A;  1F9S A;  1W0J A;  3CHB D;  1I4X A;  3R2I A;  3HRZ C;  3J7A V;  1FGB D;  5M5X B;  1PTO C;  2B39 A;  1B1Z A;  5JEA J;  3RD4 A;  4CJ0 B;  3LWU A;  1K83 B;  3VR3 A;  4XMY A;  1BR9 A;  5CBA E;  3CMM A;  2EYJ A;  5JVG 3;  5IGD A;  5KIX A;  1PRT C;  2N88 A;  3RLF A;  1EQV A;  1MI2 A;  3WQZ A;  2K5Q A;  3PIO 3;  2GJR A;  2B2U A;  1A2T A;  4A3D B;  3S16 B;  1GHJ A;  3NP8 A;  3S17 B;  1GJX A;  4MN3 A;  1W6J A;  3M85 A;  2KHS A;  1F9Q A;  2L9H A;  1RD9 D;  2ZXO A;  4IUR A;  4KD3 A;  3PIP 3;  4RCO A;  2IW3 A;  5IGC A;  4O42 A;  1ET6 A;  1SXT A;  2RDG A;  1Q3L A;  1IKM A;  1LLR D;  2WAQ B;  3TSS A;  4ZYS A;  5JPN C;  4F87 A;  1S5B D;  1PTO H;  2WSS A;  3PO2 B;  5C4H A;  1TWH B;  1A6X A;  2VJJ A;  4KN4 C;  1BPL A;  3URY A;  2SNS A;  2DY8 A;  3N52 A;  2F0M A;  4A3B B;  4RHS A;  5A2Q L;  4XLC A;  1HQM C;  3DEO A;  5BN5 A;  3D4W A;  1H9K A;  3N6R A;  5C3E B;  4V19 0;  2PZW A;  2JDI A;  2DNC A;  2CW0 D;  1JOO A;  1KLG D;  2O2L D;  4M8A A;  3MEH A;  2Q8R E;  5T1G A;  5E3F A;  5NUC A;  5KYL A;  1C48 A;  1JC7 A;  3SHL A;  1TII D;  4TQU S;  5JAV A;  3QB3 A;  3MXG A;  1ROD A;  1JE4 A;  4G7H C;  2R7Z B;  4PMC A;  1SYE A;  1TS2 A;  3FPP A;  1IYU A;  4ZQ3 A;  2SNM A;  5C6A A;  1UD4 A;  1HFG A;  1ZEQ X;  3VYU A;  2EJM A;  4CGY B;  4WJW A;  3W2D A;  1B44 D;  1D1I A;  1PRT F;  3CU7 A;  5F2D A;  3EFX D;  2A73 B;  3NTK A;  4HMJ A;  2XNA C;  2M00 A;  1STY A;  1BCP D;  3I90 A;  3D4R A;  4L8J A;  1K8O A;  1FX0 A;  1XYI A;  3R3O A;  1ENA A;  3BVG A;  2GJP A;  4F8M A;  1KDB A;  1EU3 A;  1XTC D;  1A3U A;  1E3Z A;  3QO2 A;  2RKS A;  3K7A B;  5I6Y A;  3PUY A;  1IHZ A;  1TT2 A;  3PMF A;  2JIZ A;  5EPK A;  2MHV A;  4IQZ A;  3SK6 A;  5CV5 A;  3OMG A;  1IL8 A;  3K5N A;  2K05 A;  1JWU D;  1LO5 D;  2JEB I;  2DIE A;  1E2V A;  5FO7 B;  4DK1 A;  4E0F A;  3A3B A;  4LMQ D;  1HXY D;  4A3K B;  2X53 S;  1G2T A;  4RGT A;  3U9O A;  1WCM B;  3Q24 A;  2V7Q A;  1F9R A;  3NBH A;  1B3A A;  2AQ3 B;  2K5W A;  1V1P B;  5I9P A;  5AFW A;  4R8I A;  5KNB A;  3VA7 A;  5C4Z A;  2X6W A;  2LMC B;  4CKE A;  1U4M A;  1EU4 A;  3D4D A;  2QDB A;  3NHH A;  4TSF A;  1TS4 A;  1CI3 M;  1WTQ A;  2ZZF A;  1BOS A;  2XOK A;  2KUM A;  3NTI A;  1Q1B A;  2N55 A;  1OXS C;  2X6L A;  3CRL C;  1LTR D;  1UD2 A;  2F0U A;  2D3N A;  5CGK A;  2ZTG A;  5EQ0 A;  5CDF A;  4QB4 A;  1AZP A;  3I91 A;  2YYZ A;  2XND A;  4Z1M A;  1HA5 A;  4ZAI A;  5FKA C;  4GQN A;  5IGE A;  3ND9 A;  1EY7 A;  1HRJ A;  3JAM L;  1KNA A;  1WTV A;  3OAA A;  3PUV A;  3EA6 A;  4BBS B;  3CP8 A;  4DAY A;  2RQX A;  3DEP A;  4ZUI A;  1CT1 D;  3K6O A;  2CQA A;  2G9D A;  2QE7 A;  1BO0 A;  5A35 A;  1J8I A;  3GV3 A;  1EL0 A;  3K0Y A;  1V1O A;  3BH4 A;  1DD2 A;  3HOW B;  4HED A;  1GUO A;  2L1B A;  1WD1 A;  4X3S A;  1CFM A;  1AP0 A;  1B2T A;  3DDY A;  3GTK B;  2WKC A;  1ML0 D;  5KEE A;  3PO3 B;  3DWA A;  2WPD A;  1SYB A;  3MXP A;  3DXJ C;  4FXG C;  1GUW A;  2JA7 B;  5G3L D;  3SEB A;  1HQR D;  1PYW D;  1O7Y A;  1NAP A;  3BZD B;  5EKL A;  2Q8I B;  1PTO D;  1EY6 A;  1UAP A;  1JQY D;  1ZYR D;  1Z47 A;  2FMC A;  2Z1C A;  2Q8T A;  1FNW A;  3GTJ B;  1FR3 A;  4HIZ A;  2OXP A;  4K2K A;  2IX3 A;  3VR5 A;  1VJS A;  1BLI A;  3MAQ A;  3I4M B;  1TS3 A;  4IUT A;  1NR4 A;  2NN6 G;  4UAI A;  1OXX K;  3HOU B;  2K5D A;  4MIU A;  2F3W A;  3D31 A;  4PV1 C;  4DAP A;  2GK7 A;  1QIL A;  4PQX A;  5IT9 E;  5FK9 C;  3A54 A;  5DM6 3;  3FRP B;  4AVZ A;  2TMP A;  2BA0 A;  2PZT A;  3I72 A;  2J0T D;  5FL7 A;  3GTP B;  1TWG B;  3HKZ B;  3NE5 B;  4NDX A;  2EYL A;  2B2W C;  1FD7 D;  1A3T A;  4KJN A;  1EFR A;  1LTT D;  5DM7 3;  1S5C D;  1KDC A;  2A6E C;  4XYQ A;  1KNE A;  2L4N A;  1DOL A;  3I4L A;  4X3K A;  4XQF A;  4ULL A;  1G6Z A;  4E6I A;  3AB9 A;  1Z6H A;  4U68 A;  4C3J G;  1B4O A;  3S2D B;  4IUP A;  3J81 E;  5LL6 S;  5M3F B;  5LHY 1;  4KY6 A;  3V96 A;  4DF7 A;  3JAM E;  5EBC A;  1CK1 A;  1TY0 A;  1U4R A;  4KKS A;  2Z8L A;  1FNV A;  1TKW B;  2F0F A;  4KHZ A;  1B9N A;  4Y7N B;  4JBW A;  3OWE B;  2F03 A;  1XX8 A;  2JA5 B;  2FMM A;  3HOX B;  5G3L F;  3MZ5 A;  1V43 A;  2Z6B D;  4K6D A;  2A69 C;  1VLY A;  1GUS A;  4RAU C;  1UD5 A;  4F7X A;  4RWS C;  2W6I A;  4N9T A;  2L11 A;  1E3X A;  3MFY A;  1R9T B;  2B2T A;  4DXF A;  4G6I A;  4V0B A;  3A35 A;  1WTR A;  1D6E C;  3VYT A;  3W3A A;  2X69 A;  2K1B A;  2NZ1 D;  2KOL A;  2WJY A;  1JWS D;  1JR0 D;  2ENB A;  4A3E B;  2EPB A;  4G7Z C;  4FXD A;  1J9O A;  5CBE E;  1E0B A;  1PTO F;  2WP8 J;  2M5S A;  1TR5 A;  3MC0 B;  4YEL A;  2A6E D;  4ZKC B;  2GK6 A;  2V4D A;  2M9V A;  1D2B A;  2ZTN A;  3KK7 A;  1TWF B;  1KMH A;  4XD7 A;  1ZYR C;  1EY4 A;  4WFN 3;  1EYD A;  2F0P A;  2R92 B;  2A68 C;  1ILQ A;  1ONL A;  4U67 3;  4XOT A;  4XLF A;  1DXM A;  2D2C C;  1Q12 A;  1PRT B;  3KBX A;  4WRD A;  1OB0 A;  3FEW X;  3I73 A;  1QCB D;  5EBD A;  2PMZ B;  3K57 A;  3CQZ B;  1SNM A;  1E43 A;  3I3C A;  3ZYY X;  4BWG B;  4DFA A;  3GVK A;  4A3M B;  1DZ1 A;  3RMH A;  3P20 A;  3WOF A;  4S3S A;  2PW5 A;  3M3Y B;  2CHB D;  1PLF A;  2EYM A;  3GO5 A;  3P7J A;  3H6M A;  1LT5 D;  1A3V A;  3GVJ A;  1I8D A;  2NVT B;  1C4Q A;  1S5E D;  3HOY B;  3R2T A;  3J7Y W;  2H4O A;  3VA5 A;  5C0X J;  3GD7 A;  3S15 B;  4NP5 A;  4J1M A;  3VR2 A;  4RFB A;  1QE6 A;  4Z9C B;  2PZU A;  1HTP A;  3H3V C;  3IFT A;  4C2M B;  1ESF A;  1I18 A;  2OEO A;  3OOC A;  2M2L A;  2HUG A;  3ERO A;  3PUW A;  2KA7 A;  1B50 A;  1K28 D;  4IFD G;  3MHB A;  3OIP A;  4RKL A;  4N9P A;  3BCD A;  4ZRZ A;  4C3H B;  4DK0 A;  1EWH A;  1HTL D;  2PW7 A;  4DAV A;  1Q90 A;  3ZPN A;  4HAE A;  4KY7 A;  5JPM C;  4IUQ A;  2MP1 A;  1BNZ A;  4FF2 A;  1CZG A;  1F2Y A;  1BQQ T;  2PCF B;  1R4P B;  4XKW A;  2L0C A;  2WIN B;  3HAG A;  1TY2 A;  2DNE A;  5D65 A;  1X3P A;  5IT9 L;  1WTH D;  1EWC A;  2DN8 A;  5A2Q E;  1SYF A;  3I70 A;  2VB3 X;  4J6H A;  1EEI D;  5C3X A;  1Q8I A;  3BVZ A;  3Q6S A;  5FLX L;  1G91 A;  3M7N A;  4RA8 A;  1SND A;  3KEW A;  5K36 H;  1HA6 A;  2A6H D;  3GTO B;  3TN2 A;  4A3F B;  1NCV A;  1O7Z A;  2R9V A;  2B2T C;  1WD0 A;  2PPB C;  5K36 G;  1ICW A;  3VR4 A;  1STG A;  1NBM A;  1VCI A;  1SE3 A;  2EJG C;  1UEA B;  4K6L A;  1Y8O B;  5M9O A;  1CQF A;  3FKS A;  5JEA H;  3FMC A;  4ASU A;  2K6A A;  1M8A A;  1V0E A;  2HQE A;  4K14 A;  1G29 1;  5IGB A;  1NSN S;  4G7X A;  2JSO A;  3SK5 A;  3RZD B;  2A68 D;  1I4R A;  2ID0 A;  3AMU A;  2EY5 A;  1S4Z A;  2PQE A;  1SDF A;  4ZK9 B;  4IZ8 A;  4R9W A;  5JJZ A;  3PUX A;  2NN6 H;  1L0Y B;  4UZU A;  4XQQ A;  3EQL C;  2JYO A;  1BF4 A;  4TT3 A;  1LV9 A;  3A8K E;  3FKI B;  2FFK B;  2EXZ A;  4RKB A;  1BDO A;  4NMZ A;  1AN8 A;  4TRD A;  4JK1 C;  3I4N B;  3EVQ A;  5IGG A;  1SJH D;  5TSS A;  4B3G A;  3SDZ A;  1I4Q A;  2A5H A;  1UD6 A;  2ZXH A;  3K5O A;  5KRU A;  4EVO A;  3BC9 A;  2B2V A;  2XZP A;  3OPO A;  1LTA D;  1JOR A;  1CA5 A;  2X85 A;  2Y0S B;  5DNF A;  4NW2 A;  4A93 B;  3LWE A;  4XNF A;  2V31 A;  3QJY A;  4KKU A;  1TU2 B;  3G05 A;  5FOB B;  1ENC A;  3TP6 A;  3H94 A;  1PFN A;  4FNF A;  2C5C A;  1OXT A;  2F0G A;  1JIC A;  4G7W A;  2KEE A;  3VYR A;  1KDA A;  2NWG A;  4C1N I;  3ITP A;  3R93 A;  1WVL A;  1STN A;  2WAC A;  2SEB D;  2VNU D;  3SK4 A;  3OEE A;  4ZKB B;  2EOT A;  2OT2 A;  3O13 A;  1NUC A;  2ICI A;  5I4D A;  5M5Y B;  1SYD A;  1SYG A;  1GUN A;  1EIH A;  3TZD A;  3L3O C;  1E79 A;  1OHH A;  1LT4 D;  1FNU A;  1AFP A;  1VF5 C;  1H9J A;  3BDC A;  2B2V C;  4G4K A;  1BUV T;  1DJR D;  3DHQ A;  2XRQ D;  2H1E A;  5J39 A;  1Y8N B;  2D9U A;  2F0L A;  3NPP A;  4XOR A;  3C1F A;  1SE2 A;  4FO2 A;  1MSH A;  4H13 C;  2JJ1 A;  5LL6 X;  4H0L C;  1CHP D;  2D3L A;  4EQP A;  2RSO A;  5DN6 A;  1CHQ D;  2QEJ C;  3BS1 A;  1F2L A;  2L5T A;  1HVX A;  4XR6 A;  3SE0 A;  4K2L A;  3HGB A;  1PRT D;  2NTS A;  1HUN A;  5IIF A;  1SNQ A;  1L0X B;  2KCN A;  4QMG A;  1QB5 D;  4TSS A;  2F0Q A;  4BS9 A;  4KKT A;  3J80 E;  3Q23 A;  3S2H B;  5KNL A;  3S9W A;  3TP5 A;  1O78 A;  3RZO B;  4OHJ A;  4GZY C;  4XN3 A;  3MWY W;  1Q1E A;  1DYQ A;  1S5F D;  1BCP F;  1KAB A;  4IAL A;  2XN9 C;  3NQI A;  5C4J B;  4OIK A;  2RDH A;  2Z4H A;  4A3G B;  2RDF A;  1HUM A;  1PZJ D;  2EVB A;  1VF7 A;  2RSN A;  4H7B A;  2EDG A;  3D3R A;  5COY A;  5ELD A;  3GTG B;  1HPC A;  4EQN A;  2F0S A;  1SNP A;  3NK9 A;  2HCC A;  1SSO A;  2NB0 A;  2D62 A;  5EJW A;  4XLH A;  2FJ2 A;  3X3M A;  3P75 A;  1STA A;  4ZUJ A;  1F9P A;  3MXU A;  1SAP A;  1SBB B;  4B3F X;  3BDL A;  3L7Z C;  5D3I B;  2A6H C;  2RVL A;  4DU9 A;  4FF3 A;  5EGT A;  1UD8 A;  2EY6 A;  2B2W A;  4KN7 C;  1O80 A;  5J1Z A;  1BBX C;  1LTB D;  5FO9 B;  1QOH A;  1I6V C;  4HR7 B;  4II3 A;  3ONA B;  1MD2 D;  3NUC A;  3S1R B;  2BE5 D;  4M1U B;  1ZXT A;  1JOK A;  2BDN A;  3OMC A;  1X32 A;  3AU7 A;  1G2S A;  4B9W A;  2NVQ B;  3TP8 A;  4K8I A;  3MA2 B;  5T1I A;  2ZZQ A;  3ERQ A;  1YNN C;  4XKV A;  4XM3 A;  3DUZ A;  1CZW A;  2D5D A;  5HGT A;  1II3 A;  4CJ2 C;  1RDP D;  4PNY A;  3SK8 A;  1GOZ A;  3QOL A;  1SNC A;  3IKJ A;  4BBR B;  4KHV A;  3J7A F;  1ZKO A;  1WTW A;  1JWM D;  2C9O A;  4PMW A;  3H91 A;  5DAU A;  2J4X A;  5KNC A;  1LAB A;  1D5X C;  3HG9 A;  4FXK C;  5K5P A;  1O7L A;  2KQ3 A;  1TVX A;  1WPC A;  4QUC A;  1UUP A;  2J7Z A;  2X6X A;  3HP3 A;  1A2U A;  4AYB B;  4KI0 A;  3GP7 A;  3E0J A;  2NVX B;  1RCV D;  4I7Z C;  3FVQ A;  4HTH A;  1XWE A;  1PTO B;  4DGZ A;  4FYD A;  1U9R A;  3G7L A;  2F0V A;  1TWA B;  2A74 C;  3ZIA A;  1Y69 U;  3ND8 A;  1RF2 D;  2EY2 A;  1AEX A;  3QIA A;  2MJ8 A;  1EFI D;  2AUK A;  1EYC A;  1GUG A;  1RTO A;  2PYK A;  1BXT A;  4LJZ C;  1BMF A;  4XYO A;  5CC4 A;  3T51 B;  4UDU C;  4FF4 A;  5JVH 3;  3C3L A;  2HDM A;  1F2Z A;  1FYC A;  4LK1 C;  1DCZ A;  4XIG S;  2LFN A;  4XL9 A;  2IL8 A;  3QOJ A;  4KD4 A;  3GTM B;  2XWB B;  5CV7 A;  2ZZG A;  2JXM B;  1STB A;  3NXW A;  5C44 B;  3SXH A;  1K8M A;  3BYT B;  3M4Y A;  2AQ1 B;  2K32 A;  1D5Z C;  3NTH A;  1QG7 A;  1EOT A;  2B2Y A;  5BN3 A;  3UI2 A;  3S1N B;  1M4V A;  3DM1 A;  3T16 A;  1I4P A;  2NTT A;  4B08 A;  2HCI A;  4L63 B;  2XZL A;  2XSC A;  1LTG D;  2CK3 A;  2KED A;  4K5W A;  4KK7 A;  4II2 A;  2E1B A;  2KEC A;  1X3Q A;  4XOP A;  3NWS A;  4MHE A;  2F4I A;  2B8G A;  1W6K A;  4X3T A;  2ICE C;  4J8Q A;  1LT6 D;  4OGQ C;  3KBG A;  5JEA G;  4OO1 H;  1I3Q B;  4XDX A;  5D14 A;  1VDZ A;  2AQ2 B;  1UD3 A;  2G9H D;  2EYH A;  3V2T A;  3S1M B;  1IKL A;  2QCP X;  1MSG A;  2R3Z A;  2RA4 A;  1PKV A;  1Z7T A;  4ME5 A;  4FXU A;  2LZJ A;  1H9R A;  3MFG A;  3GQB A;  5C5L A;  1QWY A;  2F1M A;  3SVM A;  1JOQ A;  4WOR A;  4G57 A;  1SYC A;  1T5X D;  2VB2 X;  1OXV A;  5C3W A;  1V8Q A;  4KJO A;  2MPM A;  2L55 A;  5I9O A;  5ELE A;  3CP2 A;  3BG3 A;  4P22 A;  2WZP P;  1KTK A;  2B2Y C;  4XQN A;  4KTA A;  2MGS A;  2NYZ D;  1F77 A;  2F0D A;  3BDO A;  3OEH A;  2JE6 I;  3CES A;  1YNN D;  4BY7 B;  4ILW A;  1SMY C;  4DXG A;  3T13 A;  3GVL A;  1I50 B;  3I8Z A;  4YEJ A;  1QNK A;  1H8H A;  1ILP A;  2K01 A;  1H9M A;  1HFN A;  3T53 B;  3A8J E;  2B2U C;  1CA6 A;  4H44 C;  1E2W A;  1E2Z A;  1DM0 B;  1H8E A;  3P1H A;  1U4L A;  1GUT A;  5COR A;  4KMU C;  4IUV A;  2YU9 B;  3CRK C;  1DON A;  2R61 A;  4BA2 I;  5HKK A;  5I2X A;  2WB1 B;  2A69 D;  4NKL A;  3LX0 A;  5E4W C;  5CV4 A;  4XON A;  4FP5 D;  3C1E A;  3FPU B;  2NUC A;  1EYA A;  3D8G A;  5C0X I;  3DWP A;  1MGS A;  2WJV A;  1OXU A;  3HOV B;  4OL7 A;  4BA1 I;  4B9X A;  1PXU A;  1AW7 A;  2WKD A;  3TZU A;  2JJ2 A;  4RCN A;  3U9S A;  1WTO A;  3OIQ A;  4XQJ A;  3IAY A;  4QCL A;  1HCZ A;  1PZK D;  3A7L A;  2F0J A;  3NWT A;  1KZL A;  2HLD A;  1UNS A;  2CVR A;  1STE A;  1EQT A;  1V0F A;  1R4Q B;  2AUJ D;  2LS0 1;  5I2Y A;  2IJ0 A;  4C3H G;  4F88 A;  5C5M A;  4RGO S;  3MTS A;  3NQT A;  5FLX E;  1EIG A;  3OHX C;  2JA8 B;  1CM9 A;  1KLU D;  2XRS D;  3GTL B;  2EYP A;  3A55 A;  1EY9 A;  3BYY B;  3WDN A;  3TBI B;  1YNJ D;  2PNR C;  4C3I G;  4K5V A;  2IX1 A;  1W9X A;  3D6W A;  2QIL A;  1HHV A;  1WP6 A;  1IW7 D;  1PFB A;  4ID6 A;  2X6G A;  2ZXR A;  5JOB A;  3CKI B;  2O4X A;  2ZXP A;  3K5M A;  1Y8P B;  1H9S A;  2TSS A;  5E4X A;  3M4O B;  4DA2 A;  4KY5 A;  1VMC A;  1LAC A;  4A3I B;  1U4P A;  2DY7 A;  2EE1 A;  2K28 A;  2VXW A;  1RTN A;  3J81 L;  1JCK B;  1PZI D;  3C2P A;  4O1N A;  2F0W A;  2JP1 A;  4IUN A;  1SEB D;  3SR1 A;  4RHR A;  1ENF A;  4ODG A;  4QUF A;  2F0E A;  2QF7 A;  2E2I B;  3X3N A;  1D1K A;  1RKN A;  4RGM A;  2BA1 A;  3J80 L;  1EZ6 A;  3VYS A;  5EPJ A;  1LTS D;  4XTC S;  1H9S B;  2EYO A;  3NBI A;  4C3J B;  4KV6 A;  4XXE A;  2WII B;  1KAA A;  2KJX A;  1RHP A;  4C56 C;  2PO4 A;  2E74 C;  5CV8 A;  5CV9 A;  2K33 A;  1T5E A;  5BN4 A;  2E2J B;  3M7G A;  1SJE D;  2O5J C;  5J22 A;  2IPK D;  2AWN A;  2B63 B;  2BOS A;  2EJF C;  5KGU A;  4CHT B;  2F43 A;  2HDL A;  3FDT A;  2XGJ A;  3A7A B;  3OWF A;  4HN7 A;  1TWC B;  5CMD A;  1ET9 A;  4X3U A;  4A3J B;  1ESR A;  5I6W A;  1EY8 A;  4NNJ A;  2LY7 A;  3GTQ B;  2WV6 D;  2RBM A;  4HSP A;  3H09 A;  1HZE A;  2SDF A;  4HSV A;  1MAB A;  4IFD H;  3E5S A;  4P2C B;  5IK2 A;  2I46 A;  1W0K A;  5IOD A;  4YIJ A;  3T4A C;  4ZLT F;  5ELF A;  3R8B A;  1OO9 B;  3H0G B;  1IW7 C;  4LAA A;  2B8F A;  4XLE A;  2F0O A;  4YXW A;  2X8K A;  5EKI A;  3G6J B;  2O5I C;  2E75 C;  2F0H A;  2NN6 I;  3A56 A;  1MBY A;  3D6C A;  2E2H B;  1PMR A;  4OO1 I;  3WOE A;  5CR3 A;  4DN4 M;  2EZV A;  4IUU A;  3KUP A;  5M5W B;  1V1P A;  1SNO A;  5FO8 B;  5ISR A;  4BY1 B;  4EGV A;  1QNU A;  5CV6 A;  3A8I E;  5IGF A;  4HCE A;  2ZXI A;  2K7V A;  1XXG A;  2EY1 A;  4RGN A;  4QIW B;  4ABN A;  4HCS A;  3LNN A;  2NVY B;  3DWQ A;  4Q5V A;  2ZZE A;  3IFD A;  1GHK A;  4K8J A;  2XZO A;  2F0I A;  1COW A;  2F3V A;  2BDO A;  5C4X B;  1SKY B;  2MUY A;  2EYF A;  2ZT9 C;  2XWJ B;  4XLA A;  2IWH A;  1PFM A;  3F2U A;  3KF8 A;  3Q0A A;  3OE7 A;  4CKB A;  1IYV A;  3TDQ A;  5C0X H;  4TKO B;  1DOM A;  1BCP C;  1SFO B;  3DMU A;  4G7O C;  3TP7 A;  3EJI A;  3IL8 A;  1WTX A;  1GXD C;  3OFN A;  1E1Q A;  1C8C A;  4HMI A;  2LKV A;  1EEF D;  3V05 A;  1I6H B;  2AWO A;  4C1N K;  4EQO A;  2E2D C;  3VR6 A;  1Y1W B;  1BCP B;  4I65 A;  2CW0 C;  5ELB A;  3NSW A;  2KVM A;  3KLS X;  1DOK A;  1CQV A;  2JA6 B;  4IFD J;  5M3M B;  3S14 B;  1RJT A;  1STH A;  3PUZ A;  2IT1 A;  4QF4 A;  4CBV A;  1D5M C;  3BCF A;  2KVO A;  2KCC A;  3T56 B;  4JMQ A;  2Z4I A;  2I07 B;  4CKC A;  2X6Y A;  1CTM A;  3RUZ A;  1JB3 A;  1TQO A;  3HOZ B;  2R6G A;  1G8Z D;  4C3I B;  4RH6 A;  2W6J A;  4XN0 A;  3S1Q B;  4FVM A;  4CJ1 B;  1SMY D;  3K59 A;  5CYU A;  3TME A;  3JU4 A;  1LT3 D;  3QWN A;  3PV0 A;  4PMB A;  2QKI C;  3E6Z X;  2FHT A;  3Q22 A;  3A3G A;  1NRK A;  5EPL A;  1VMP A;  1S5D D;  2R93 B;  4DNR B;  2VUM B;  3OW7 A;  2FIN B;  2F0K A;  4OO1 G;  4DNT B;  1WTP A;  1I4H A;  3QG1 A;  2F0N A;  2GA4 B;  1PDQ A;  2GJK A;  3C46 A;  3K5L A;  4FF1 A;  3L9A X;  2NBF A;  1TS5 A;  1A15 A;  1YNJ C;  3BVM A;  4R8N A;  5D3D A;  5DEH A;  1B53 A;  5KYI A;  3K58 A;  2SOB A;  2JEA I;  1EY5 A;  1NR2 A;  1B9M A;  4XT3 B;  2XVS A;  5E1F A;  3GV6 A;  1LTI D;  3OSO A;  4L6T B;  5HUR A;  1EZ8 A;  2K03 A;  1EY0 A;  1QJO A;  1AZQ A;  2F0T A;  3HS0 C;  1E1R A;  3MXN A;  2XIW A;  5EKK A;  2OF1 A;  1F2M A;  5KND A;  4K5X A;  4XT1 B;  2E76 C;  4Q0F A;  3KLR A;  2IX0 A;  3KLS A;  3HEJ A;  4OIJ A;  5ELC A;  3MVV A;  3HZX A;  2BCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...