3T56B

Crystal structure of the pre-extrusion state of the cusba adaptor-transporter complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
322
structure length
322
Chain Sequence
b'ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein CusA
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 57
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t56B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t56B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t56B01
4DNRB 1E2WA 2PNRC 1V43A 4H0LC 3L7ZC 5BN3A 2JEAI 1GUNA 2EJMA 4IQZA 4XIGS 3H94A 4LK1C 3A7LA 2IT1A 5KNCA 3AB9A 2DNCA 3GD7A 1B9NA 4KKUA 4KKTA 2A69C 2A6HC 1HQMC 1V8QA 3T51B 1O7LA 3T56B 1OXUA 4G7OC 3A8IE 3M7NA 1LABA 3QG1A 1Q12A 2AUJD 3FPPA 2CW0C 4XTCS 1G291 2Q8IB 1K8MA 1OXSC 1HTPA 2BDOA 2EDGA 3FMCA 1E2ZA 3SE0A 3VR3A 2D2CC 3PV0A 1DD2A 4GZYC 4G7HC 1O78A 3D4RA 2NN6H 4KMUC 4DK1A 3PUXA 1Z7TA 1GUSA 1ZYRC 1LACA 1H9SA 2K32A 4KI0A 2KA7A 5K36H 3LNNA 3IFTA 5JEAG 2LMCB 1GHJA 2B8FA 1ZKOA 2K33A 4BA1I 1IW7C 1OXVA 1DCZA 2EJGC 4KHZA 2A68D 4BA2I 3VR2A 3OOCA 1OXTA 1FR3A 1B9MA 3QIAA 2E75C 3EQLC 3P20A 3MXUA 4TKOB 3TZUA 2R6GA 3I72A 3W3AA 1YNJC 2V4DA 5A35A 4H44C 2A68C 1H9JA 1H9SB 2K7VA 4L8JA 1HCZA 3VR4A 3RLFA 3QJYA 1GUGA 2YYZA 3NE5B 3BDOA 1Y8OB 1CFMA 1IYVA 1QJOA 5C0XG 1CI3M 3PUZA 3IKJA 4DNTB 2ZT9C 4HR7B 2B8GA 1VDZA 2NN6I 2KCCA 2E76C 2QF7A 3CRKC 3LWUA 2A6ED 3KLRA 3I4LA 3DXJC 5C0XH 1H9KA 2EJFC 1EWHA 1TU2B 4IFDG 3VR6A 1BDOA 2PCFB 3D31A 1H9MA 1Z6HA 1CTMA 5JEAH 4G7ZC 1Y8PB 1ONLA 3MFYA 3A8JE 4OGQC 1DXMA 2D5DA 2BA0A 4OO1G 1GJXA 1Y69U 2BA1A 2EVBA 2JEBI 1VF7A 4DK0A 1GUTA 1SMYC 3M4YA 3ND9A 4KN4C 3VR5A 3WDNA 2DN8A 2AWOA 2AUKA 1A6XA 1IYUA 4RCNA 3OW7A 3A8KE 4OO1H 1Q1BA 3VA7A 4KN7C 3A7AB 2A69D 2A6HD 5KNDA 2PPBC 3T53B 1PMRA 5KNBA 2F1MA 4PV1C 3HGBA 3I73A 2BE5D 4TQUS 1TKWB 4H13C 3CRLC 4KKSA 5BN5A 4JBWA 1VCIA 3M85A 1Y8NB 2JXMB 2NN6G 2BE5C 1Q90A 3OPOA 2D62A 1FYCA 3ND8A 3SDZA 1YNNC 4I7ZC 1OXXK 2A6EC 3PUVA 3PUWA 2JE6I 1VF5C 1GUOA 2L5TA 1GHKA 3U9SA 2O5IC 1E2VA 5BN4A 5K36G 1T5EA 3BG3A 2O5JC 1K8OA 1Q1EA 3PUYA 4LJZC 4IFDH 3GQBA 1IW7D 2E74C 4JK1C 1I6VC 2DNEA 3N6RA 1H9RA 1HPCA
chains in the Genus database with same CATH superfamily
2NVXH 4AC9A 3FVQA 2CFMA 3URYA 4FXDA 1YJ9B 1SDFA 3QO2A 3GTGH 4HJAA 3PIPA 3TP6A 2UXDL 1JCKB 3I4MB 3HOYH 1W3SA 1I4QA 3CCMB 1F9SA 4RD1A 1BO0A 4G7OC 4QHYA 1LTLA 1HA5A 4LAAA 1KMHA 3DWPA 2AUJD 1ZM9A 4R8IA 1IL2A 5HXBA 2LKVA 2QE7A 3AFQA 1BCPD 4L5QA 2K5HA 5EPLA 5C3EG 3SEJA 3K0XA 4CJ1B 1N8RD 1GUSA 3CCRA 2XRSD 4RCZA 3AVTA 4JI4Q 5GADC 4WZLA 1ZKOA 4A3JH 4ZCKA 2I5LX 1IW7C 1EY0A 3CCEA 3H15A 4BA2I 1L1OB 1KRSA 2WB1E 4FWTA 4B3ML 1FR3A 1UD3A 4MTNA 1Y1VH 5JOBA 5IYBG 4DV0L 2WKDA 1QVFB 3MXUA 3KLSX 2FXQA 1W6JA 2JA8H 1FRQA 3UE1A 4RDJA 1KABA 3CMAB 2NWGA 4QCLA 3BC9A 4YWMA 2GJRA 2VUMH 2Q6KA 1U4LA 4RDKA 1PFMA 1Q7YC 3CPFA 4LFCQ 3JU4A 3S1NB 4ZCIA 3U4ZA 2UXDQ 4XD7A 3NTKA 2B2VC 4RM0A 5COYA 4K2LA 2CK3A 2KCTA 4QB4A 5IIFA 3P26A 4B3SL 1UD8A 3VYSA 5C5MA 3DXJC 1HVXA 2DETA 1LT6D 3VDYA 3CD6A 4IFDG 1F9RA 3H0GH 1EWCA 4IW3B 1FD7D 1XFOA 4ASUA 1ONLA 3CC2B 2E5LQ 2MP1A 2K5DA 2AQ1B 4CGYB 4QVJA 5LHY1 4LF6Q 3ND9A 2E8GA 3I1FA 3DM3A 4QIWE 1BUVT 3V2TA 5FO9B 3WBKA 4GOPA 4QL5A 2ZTDA 1ILPA 4K8IA 1PH2A 3G48A 1II3A 1JOKA 1TWFH 1KD1C 4B3MQ 2JA7H 1MHWC 1B3QA 4H13C 3FP9A 3KL9A 4M0LA 2MQHA 3PCOB 4JOIC 3BS1A 1VS0A 2AQ2B 4OEMB 1G8ZD 1EEID 2EY2A 1JA0A 3CCQB 2CWAA 2DJFC 3U9OA 4G5GA 2EQSA 4JBKA 1JOOA 1M90D 3MTSA 1KIXA 2BDNA 1CA6A 1CKMA 4B3TL 1YZ6A 4A3BB 5K36G 2K5QA 3MA2B 1OO9B 1Y0RA 2V1CC 2VBTA 3HS0C 4ZAIA 4R1JA 2VJJA 5EAYA 1WDTA 4C3IH 5HGQA 4B3SQ 1SAPA 2MJ8A 2KEEA 2PNRC 1JE4A 3HOUH 3A55A 2XN9C 3ZC3A 4XIGS 5CYUA 1N05A 5FLXE 3J7AF 3E20A 5TRDA 2YWHA 3Q6RA 3Q24A 2DY8A 4KKTA 3MXPA 1FNDA 1DM0B 4RH6A 1D5XC 3MVVA 4X07A 3T56B 5C4XG 2HD3A 2SEBD 3K7UC 3M7NA 1ESFA 3NWTA 1EY9A 3KBGA 1HNXL 5HKKA 2ID0A 1E2ZA 2GQFA 4X7DA 4FYDA 1NB9A 1F9QA 3NSWA 4RHRA 4PMBA 4F87A 4A3CG 5H1SE 4Z4UA 4Q5VA 5IWAL 1KQSA 2UUBQ 2J0TD 3ER0A 3PO3H 2BGIA 4IFDI 1KNEA 1LT5D 2GREA 4BY7G 1QZGA 4KHZA 2SNMA 3QB3A 4ZRZA 3NHHA 3AQQA 1Q81C 3FKIB 4B44A 4N3GA 3P20A 2H4OA 5G3LF 5KEEA 1KK1A 3W3AA 4IFDJ 1MBYA 4RGNA 2A68C 1H9JA 1AW7A 2G5DA 3CW2C 4NXMQ 1AIPA 1R9TH 3CCEB 1B7YB 5IYDG 5GROA 5ELFA 1EQTA 3W2HA 1YJNB 3PUZA 2VYQA 4DPGA 3WYAA 2E76C 3PA1A 4U673 4A75A 4ZKCB 1E1TA 4LF8Q 2Z4IA 1QNUA 1PH1A 1CSPA 1ILQA 3L9AX 4OP7A 5C3EH 1HR0L 5DS0A 3K0YA 4IUPA 4HIDA 1WTVA 1FNVA 1VQMA 1HNXQ 1CM9A 2YWGA 4R4QA 1NY4A 1B1ZA 1EXMA 1H9MA 2O4XA 5JJKA 1KNAA 4DUZL 2K50A 4GN5A 3FKSA 2J7ZA 4KN4C 4DKAC 3AFPA 1CQXA 3JAMi 2AWOA 2XIWA 4X8IA 4A3IB 4DAVA 1X32A 2QDXA 4EGVA 3CD6B 1Q8IA 2X3UA 2ASBA 3I73A 3PENA 2NPFA 1NSNS 1SKYB 1OTCA 2R3ZA 4X62Q 4DR2Q 1PDQA 3R3OA 5DLQE 1PXUA 4UY8C 2XZOA 3A5ZB 2XWJB 3VNVA 1MIUA 2EYPA 1QUEA 2KUMA 4Z1MA 1EFTA 2NN6G 1M8AA 4K2KA 1SMXA 4RD4A 3OPOA 1OB5A 1FYCA 5LL6S 3TDQA 4GOPB 1LYLA 2F0NA 5C0XI 1SNPA 4YAFA 1WTRA 1W0JA 1GKHA 2JE6I 2F4VL 2GJPA 3J7YW 1PYWD 1STNA 1LV9A 1AFPA 2YWEA 4FP5D 1W9XA 5JBQA 4IFDH 1L0YB 2B2TC 4LJZC 3V05A 2BN4A 3MHBA 1WTHD 3ZZ0A 1FNCA 1UWVA 3FEWX 4FXKC 3J80i 1CA5A 1HR0Q 1SXTA 1D1NA 1Y14B 1QB5D 3L7ZC 4B48A 3JQQA 4DR3L 3W2EA 2CQAA 1BBWA 3G05A 3GD7A 3MFGA 4DUZQ 2MGSA 1JJGA 2EYFA 1YITA 4CDEC 3QG1A 5HZAA 1QGZA 2KEDA 1HNWL 1HH2P 5KW9A 1J6QA 2B7BA 3E0EA 1B2TA 1EY6A 2WR8A 2RC5A 5JPNC 5IT9c 3R6JA 3IRBA 1DZ1A 1RD9D 1ZUNB 1NBMA 3R2IA 4C2MB 2ES2A 3ZUGA 2SNSA 4E0FA 4DV2Q 5K36H 2UUCQ 4FK8A 1VQJA 2BOSA 2C4TA 4NP5A 1S40A 2WZPP 4A3EB 3HKZG 1VQ8A 2F4VQ 1YX2A 4YHBA 1K9MC 1G7SA 3F2CA 4IJLA 3LVBA 2EY6A 3PF4A 4AVZA 1A3VA 4JBMA 4L5SA 1X54A 1YNJC 3TSSA 5A35A 4H44C 2XSCA 3ASRA 3SLDA 1VQIA 4ILWA 2OK8A 5HY6A 4CDCC 4XLEA 3GP7A 5C44G 4K6LA 1QUQB 3RLFA 1VQOA 4OWXB 5JJIA 1XMOL 4R4OA 2YU9B 3GTJB 1IBLL 2VQEQ 3BY2A 3BNWA 1IKLA 3ZBUA 1TWCH 3CCSA 1PV4A 2NN6I 3FJOA 4RLZA 4GLAC 4PC1A 1O7ZA 5L37A 2B2WA 1HNWQ 5IGGA 5C0XH 4N3NA 1N33L 1EWHA 1GXDC 3NUCA 1ESRA 5LMNL 1KAAA 4UZEA 2B29A 2B3GA 2C5HA 3M7GA 4M4SA 1A3TA 4BY7H 2K14A 2W6IA 2JEBI 4DK0A 1XPUA 4GNXA 2RSOA 2OT2A 4R4IA 5EPJA 2DN8A 2RDFA 4C3JH 3NK9A 2QEXA 1MJEA 3OZUA 3ZJYC 2L0CA 1LTRD 1VQMB 3V96A 1F2YA 2UU9L 4Z4YA 2IL8A 1RCVD 1LTGD 2VY3A 5CV9A 2LZJA 5BN5A 3A35A 5IYDH 1U4PA 4JI1Q 4X64L 1Y8NB 1C9OA 3PIO3 3ZBTA 3QSYA 3PF5A 1PLFA 3NPPA 4NKLA 2D62A 3ND8A 3ZPNA 1DDIA 5KRUA 1HHVA 4PABA 1IBLQ 2OTLA 1FNWA 1QGAA 5C4XB 2FJ2A 4JVZA 5D14A 2HQLA 1KL9A 1T5EA 2PMDA 4XLAA 4H7BA 3WNCA 1K8OA 2ZL7A 3GQBA 1IW7D 3SVMA 1I6VC 3B8HA 1MKHA 1TWAH 4OPSA 5JVG3 3G6EA 2LXJA 1CT1D 5A2QL 4OL7A 2D3NA 2BVNA 4ZV4A 4FXGC 5LMNQ 4LBZA 1D6EC 3H9NA 3HAGA 3SJZA 4NW2A 3GTPB 5ELEA 4ALPA 1K73C 1V8QA 1FGBD 1TT2A 5CBEE 4C1NI 5CC4A 2QGQA 4PZ6A 1N08A 5EBCA 2H1EA 4RGMA 1OXSC 3V7AA 3J81E 2I07B 1PTOB 1BR9A 3OZWA 4R9WA 1MJCA 5M9OA 2G9DA 2NN6H 2OBRA 4P9SA 2VJIA 1Q9SA 2EPBA 4M1UB 5IE8A 1JORA 2MFIA 2D9RA 3P27A 3E0JA 3OHXC 4UP7A 1X55A 5D65A 1HNZL 2WAQG 1A3UA 4FXUA 1YITB 4X3KA 2KENA 2M5SA 2NVYB 1D5MC 1RJTA 1DCZA 4G1VA 1S5DD 3CCVA 3QOLA 1XMQQ 1JJCB 2B7CA 4RD6A 1HR0W 4BBSG 4XOTA 4X3SA 1J9ZA 2X8KA 3CESA 3R8BA 1VHEA 2E75C 1LO5D 4Y7CA 1XPRA 4ROXA 2KOLA 2Z1CA 2OTJA 3S2DH 4QV2A 5IP7H 4O42A 2F0EA 3B82A 3ES9A 3E5SA 1TUIA 2AMCB 4A3GG 4RPBA 2HMAA 5I4DA 1C4QA 5IYRA 4RG1A 4B08A 3WOFA 4OX9L 1HJPA 2KCCA 2D74A 1B53A 2KCNA 3M4OH 3NEMA 4Y52H 4YHHQ 2F03A 4A3LG 1PKVA 1WORA 4B9XA 2EJFC 2JA5B 4JV5Q 3Q6QA 4TMXA 3BU2A 3HOXH 2CH4W 4OGQC 3AVVA 3G7LA 4JI3L 5BR8Q 1L1OC 4QMGA 2QGGA 2XNCA 2P3MA 1K0SA 1VQGA 3GVKA 3ULPA 4CDFC 1YBYA 4Z4SA 3OW7A 1KDCA 2WKCA 4ZLTF 3W2DA 1XJVA 1YNXA 2AKWB 4PV1C 1O80A 1QVCA 2EYOA 1QVGB 3U6BA 3HOZG 1RTOA 5C44H 3I4NB 3KUPA 4KKSA 3DMUA 1E62A 3PUMA 4S3SA 3ONUA 3M85A 4PMCA 3Q23A 4IUQA 4P12A 2BE5C 1V9PA 2QW7A 3GV6A 1EEFD 5EKLA 4IO9A 2A6EC 1VQAA 1SKQA 3HEJA 1ET9A 1WI5A 4OX9Q 5EKKA 5IK2A 2WJYA 4AH6A 2AHOA 4HIMA 4JI7Q 3S17H 2WP8J 4Z4TA 4DR5Q 4A3MB 1D8LA 2GVAA 3MXNA 3D31A 3HOYG 4JPBW 1Q81D 1CQFA 1E0BA 5EKIA 4MYTA 3HOWG 3H94A 1PHJA 4X3UA 2NUCA 3OE7A 4NDXA 1PRTB 4RHSA 3GTQH 1F60A 3CP8A 4OOVA 4JI3Q 1F2MA 2JSOA 1FNMA 3OJWA 2EY5A 3T1HQ 1YJ9A 3BY1A 3HKZB 2IW3A 1G291 4A3FG 4O1NA 3G6EB 2N78A 3QFTA 3CCMA 1BLIA 1E1RA 2UXBL 5IGDA 5C6AA 2DY1A 1CK1A 5NUCA 4A3JG 2Z6KA 4HIOA 4KHPL 4GKKL 1QG0A 3S1QB 1Y1VG 2H5XA 3KYHC 2LMCB 2UUAL 2K33A 2WB1G 5T1GA 1XWEA 5EBDA 1I3QH 4A3KB 3RR5A 1WD1A 4AYBE 1B9MA 1PZJD 3K5NA 2VUMG 5EPKA 1UE7A 3TZUA 4TKOB 5LMNW 1XB2A 2L11A 5LMZA 1EY8A 4N9PA 4P25A 5KYLA 2PMZE 4LF5L 3SHLA 2ZZEA 2F0KA 1Y1WH 3QFCA 1J9OA 1G7TA 2V7VA 3K8AA 1F20A 2PZUA 1FJGL 2HCJB 1U0LA 4M53A 2F0OA 4UZUA 1X3PA 3GTOH 1C48A 2UXCL 2KHIA 4J0QA 5FL7A 2WIIB 2UXBQ 1N36L 1SNCA 4G7ZC 3T1YL 2HDNB 2BA0A 2PI2A 4GKKQ 5BSXA 5FNZA 4DK3C 1Y0YA 4XXEA 2CHBD 3X3NA 4R4TA 2V7UA 3ONYA 2UUAQ 4O2DA 4OIJA 4K5WA 3JQPA 4LF7Q 5K5PA 1I8DA 4B4DA 4A3GH 1UNSA 5LL6X 1SYEA 2F52A 1AP0A 1SBBB 5J3OA 1TY0A 4P6YA 3OTOL 3AGPA 3G4SB 4DXFA 1WTOA 2FINB 1J5EL 4HIZA 4HAEA 3D3RA 1IHMA 5M5WH 2LXKA 1I50H 1Q90A 2Q2HA 3TZDA 1OXXK 4TN1A 4L63B 1DOKA 3U9SA 5HZBA 3I2ZA 3CRZA 1YI2A 2Q6OA 2Q2UA 3T4AC 2PYKA 3CCQA 1BCPB 2NVQH 1SJED 2VBUA 1HPCA 1K9MD 4C0SA 2HQEA 4XLCA 2UXCQ 4XORA 2KECA 1R4PB 1KHIA 1N36Q 3H6MA 1C0AA 2KQ3A 3VO1A 5J3BA 4JI4L 3NQIA 4TMWA 1STEA 2RA4A 1AZPA 3OEEA 4BBSB 4XTCS 1Q12A 1N06A 1EQVA 1TY2A 1K8MA 1YIJB 4K6DA 1VQNA 1JE5A 3PO3G 2ZTEA 1JQYD 1Q46A 4DQLA 1GAQA 4MYUA 2X6GA 4A76A 4RKBA 4GOPC 1JB9A 5AN9A 4DK1A 4NPSA 4DA2A 2OWOA 1LACA 4UZFA 1EWYA 3A8IA 1H9SA 4U68A 1J5EQ 2KA7A 3ITPA 2XZLA 1EYAA 3MXGA 3I56B 4HN7A 3IAYA 4K0KQ 4LFCL 1S5FD 2DEUA 2B5OA 3WY9A 4N9TA 4BS9A 4F8MA 2O2LD 2CCZA 1U2RA 4B3GA 2NZ1D 3K81C 3HOWH 5M3FB 3EQLC 1E7ZA 1IBKQ 2R6GA 1ENFA 2CH4A 2OQKA 2FVGA 3CPXA 1NRKA 2V7QA 3BVZA 3S2HH 1EY7A 1XTCD 4DV6Q 4F88A 4M1KA 3Q22A 1Y8OB 2E5LL 1HA6A 3GVJA 1LTAD 1QJOA 2PQEA 4FO2A 4A3FH 4LF6L 1V0EA 2PI2E 3S1MH 4C56C 2I5MX 1NCVA 2DOGA 1K28D 3KLRA 3EN2A 1Q3LA 1WTHA 1I6HB 1T6ZA 1E1QA 1S3OA 3HOZB 4RGOS 4XYOA 3KJOA 3VR6A 1BDOA 1YJNA 2R92B 1S5ED 4B47A 4IPCA 1VLYA 2HCCA 5F4OA 1D8TA 1YHQA 2NVXB 4CKEA 2XVSA 3GTGB 5KNBA 2F1MA 3L3OC 3SK4A 4P6VF 3HOYB 5C4JH 3E1YE 2FFKB 1MGSA 1QILA 3U6KA 3EBEA 4CKCA 1SYCA 5F4JA 4LBYA 2PQAB 4YCUA 2Q2IA 4XQQA 1XNRL 1XXGA 2L55A 3W2GA 5EJWA 4DGZA 3BYYB 2A74C 1DJRD 4ZUJA 3CB4A 4K5XA 2L1BA 3PUNA 3K5OA 3HKSA 4DNRB 1O7IA 3K59A 4LMQD 2CF4A 4LF9L 2VNKA 4A3JB 4TMTA 3A7LA 2IY5B 4GLVB 5CGKA 2WZNA 1WCMH 2UUBL 1Y1VB 1RTNA 3CHBD 1YI2B 1NJIC 1PH9A 1SSOA 4YXWA 1L0XB 2JA8B 3A8IE 2ZL5A 4HEDA 2HDLA 2JYOA 2BH8A 2QCPX 3I8ZA 1C7YA 2K05A 2BDOA 2RHSB 4DF7A 3VR3A 2K4KA 1DDGA 1VQ5B 4GZYC 1PH7A 1JB3A 5BSYA 1B8AA 1I4GA 4P73A 1UD2A 2JQOA 1K83H 1KLGD 4C1NK 2VW9A 1PFNA 4PNYA 1B44D 4NXML 4BXXG 4TT3A 4BA1I 4JI2L 5M3MG 1ZM3A 1XNRQ 1VQNB 3H0GB 3VR2A 3I55A 4XKVA 5FA6A 1JICA 1W2BA 1KJZA 3C2PA 1BX0A 3HZXA 2E2HH 4LF8L 3BZCA 3G71B 4ZYSA 1Q86C 3Q6SA 1CQVA 2C9OA 3E9HA 5HGTA 5B6IA 2QMUA 4XR6A 1H9SB 3OWEB 1HFGA 1OGJA 4IZ8A 1PYBA 4LF9Q 1WOSA 4XT1B 2R7ZG 2RBMA 3M3YH 1PFSA 1NR4A 3HOVH 1PZKD 1T6XA 1E64A 3NE5B 1PH5A 5GAGC 4Z4VA 2JA7B 1TWFB 4B3RQ 3ERSX 5C0XG 1VJSA 1PTOC 2B2UA 2GPJA 3JAMc 3ISXA 1E63A 3GDEA 1G7CA 2A6ED 1Q8KA 1QUQA 5FLMG 1YLOA 3A8KA 1HTLD 5EQ0A 1K3RA 4C3JG 1VQ6B 5HURA 3U58A 4XONA 1GJXA 2KJXA 4X62L 2VNHA 4DR2L 4X6AH 3D0FA 1AN8A 3AVWA 2QDLA 3M4YA 4E6IA 1KC8D 4C3HG 1N0VC 4DR4Q 3AVXA 4M8AA 4C3IB 3OFNA 4G57A 1TXYA 3HOUB 4JI2Q 4DU9A 3EFXD 3T53B 4A93G 2V7TA 3KBXA 3VNUA 1EP1B 1SFOH 1CSQA 3J80c 2A19A 2C5CA 5IGEA 1K3BC 2CVRA 1YHQB 5M5YH 3CCUA 5CV5A 1PH6A 1QGYA 4FVMA 1YNNC 2VBSA 1VF5C 2NBFA 4XN0A 3TP8A 5BN4A 4NNJA 3U50C 1Q1EA 2Q8RE 3A56A 3BDLA 1SYFA 4B3XA 3PO3B 1DOLA 3BVGA 2F0GA 4KK7A 1IL8A 3BCDA 3PVDA 1EYCA 3HG9A 3AB9A 2B2WC 4EQNA 3ONAB 4YWKA 1EZ8A 1S72A 3HFZB 3T51B 4CDDC 4DV2L 3UDIA 3IFDA 4PZ8A 3S24A 2UUCL 4FN5A 3W1BA 1EOTA 4Z9CB 3FMCA 4GNXC 4GN4B 2EYHA 1X3EA 1R4QB 4UAIA 1R9TB 3JAML 2F3WA 2DIEA 3J7ZC 3BQJA 4A3DH 3E3XA 4ZGQB 1YJWB 1KXLA 3JQRA 1RHPA 5C3EB 1SE8A 2F0LA 2R7FA 5C0XJ 2MO0A 1WTXA 2VQEL 5IP7G 2VL6A 4IUUA 2N3SA 3KK7A 3K5LA 4KHVA 1PJ7A 5GAEC 2V7XA 4ZK9B 1PZID 2OXPA 2Y0SG 4C43A 1G7RA 3OEHA 3GVLA 3P75A 1PTOF 3VR4A 3EROA 2L9HA 5A2QE 3TMEA 1VQKA 3RZOH 1STGA 1QUFA 5DAUA 2K1BA 3I7FA 5GAHC 1HFNA 3J80L 3I55B 4ZCLA 1W2BB 1WTQA 1BMFA 4LFAQ 2B63H 3HOXG 4OPOA 3ZIAA 3U4VA 3K57A 5J39A 3CCJA 4JYAL 5C4ZA 5EMNA 4OWWB 1MSGA 1QX4A 1NMFA 2BMWA 3AMUA 3MZ5A 3MFYA 4RWSC 1LM0A 2X6YA 2DUDA 4BXXH 2CRVA 2PW5A 1B23P 5M3MH 2PW7A 4JI1L 1MI2A 2L12A 3VR5A 2K03A 1TWGH 2VB3X 2VBVA 1KDBA 1TS3A 1F77A 4EH1A 2I46A 1UD4A 2RVLA 3D26A 5C3WA 3FDTA 4QUZA 3WNDA 1B3AA 1W34A 2WYRA 5KNLA 3CQZH 3FPUB 2R7ZH 4TMVA 1NTGA 2VZAA 3C3LA 1PYSB 4XLFA 4YELA 3SR1A 3M4QA 1EUJA 5JAVA 3VYTA 2VZLA 4Y7NH 2ZZQA 4K14A 1SE2A 2QKIC 3A0JA 4OXPA 1QVGA 2D0OA 3K7AH 1VQHA 5AJ3L 1GUOA 5FLMH 1GHKA 1ML0D 1WOPA 1L0WA 3L2PA 4GKJQ 2KVMA 1JB7A 2K75A 2ICEC 5TY0A 4KY7A 4BWGB 1Q82C 4JYAQ 4PC3A 4X7FA 1A62A 2X6XA 1JWMD 1GR1A 4C3HH 4IQZA 3CCUB 1GD7A 1VQCA 1JOQA 3W2FA 1L2FA 4H9GA 2AWNA 4QY7A 3SLNA 3OP1A 4A93H 1LT3D 4HE5A 1UE6A 1JA1A 1UMKA 2IPKD 2ZXOA 2CW0C 2F0PA 1MSHA 1F2ZA 4Y9RA 1XMQL 4LBWA 4QF4A 3SE0A 5IT9L 2R93H 3OMGA 3OYYA 3PSIA 1DD2A 1VQ4A 1B50A 3NWSA 2GK6A 3BCFA 4KMUC 2MNAA 1LTSD 1KDAA 1TWCB 4L5RC 1G2TA 1S72B 4OWTB 5KGUA 3AVUA 1PJ5A 3LNNA 5JEAG 3TQYA 1K8GA 4K5VA 1PRTF 2RCFA 4EQPA 3SK5A 5AJ3Q 4CBVA 4HSPA 3NBHA 4V190 2F43A 1Q7YD 5G3LD 1Y1WG 4BY7B 4Z4ZA 1HUMA 4YIJA 4YHHL 1WSRA 3K80C 2JA6G 4C3JB 5DEHA 1A8VA 2MHVA 4JV5L 2J7KA 3RZDH 4PC6A 3GTKH 4LFBQ 5F4MA 3TBIB 3O13A 3Q0AA 5BR8L 3IKJA 1J8IA 2A5HA 2WINB 3RMHA 4WJWA 4A4IA 2N49A 1VQ7B 3NP8A 2DYIA 5FO8B 4DFAA 1VQKB 2GJKA 1STHA 3U2QA 3PO2G 1GAWA 5FOBB 3B78A 2JN9A 2K04A 1GUTA 1KD1D 3VA5A 3CCJB 1HZ9A 2IX3A 3EIVA 1TWAB 2Z6KC 4X7EA 1S5BD 4Y9UA 1NJID 3SJPA 1STBA 4IALA 1ELOA 2PZTA 3DHQA 4UPAA 2Z6BA 4YEJA 2ZITA 1CHPD 2NZOA 4JI7L 3CMEB 3KFUA 4DR5L 2HDMA 3KF8B 2E2JH 4DR7L 2E2IH 2IWHA 1EWIA 4HE6A 2CKZB 1QFYA 2Z8LA 2R6HA 3KLSA 2ICIA 1DG1G 1WU8A 3OSOA 4WZKA 4MNOA 3VYRA 4YALA 3PUWA 2OQ0A 2TSSA 1S0UA 1EFUA 5A89A 3H3VC 3G4SA 3QWNA 1S4MA 4DQKA 3L0OA 3T1HL 3X3MA 1NAPA 1N34Q 1E22A 1H9RA 5C3XA 1CKOA 2K5WA 4HJ9A 3I4MG 4AIMA 4POFA 1B70B 4X3TA 1VQ9A 1BKBA 1R5OA 4HTHA 1Q86D 2KVOA 2DNCA 3PIP3 2DERA 2V31A 1NBWA 2XNAC 5JEAJ 4II3A 1EFRA 3S1RH 3HKZE 2JIZA 3NXWA 4RCOA 3NBIA 3ZZUA 3S2DB 4XKWA 1LABA 1XE1A 3I4OA 4PG3A 1JR0D 1HTPA 1PTOD 2CNDA 1WP6A 4BY1H 4Z4WA 2D2CC 1M4VA 2Y0SB 4P22A 2WFWA 3S16H 3GTLH 3RD4A 3TS0A 3CTAA 1BCPF 2GK7A 5IP9G 3J81i 4DR1Q 4DR7Q 1CUKA 2K32A 2BV3A 1YIJA 1X9NA 3M4OB 1JWUD 2ZXPA 5M5XH 1VQPB 4G7XA 3TEHB 3F8TA 4BBRH 1OXVA 4JI5Q 4JI0Q 1K0RA 2KHJA 2A68D 3HOXB 4R71A 1VQ4B 2HIVA 1T6YA 2ZXHA 3I56A 1WTWA 3W2IA 3F2BA 2K5NA 1ZEQX 1HCZA 4AQYL 1WD0A 3QJYA 3LX0A 1CKNA 1E3PA 2IHEA 2QILA 3FHWA 1KK3A 3NBHB 4APVA 1IJEA 5C44B 2WPDA 1BXTA 4P75A 3CRKC 2C2WA 1W87A 1YNND 3LWUA 3J7A5 2XGTA 1RL2A 2P5ZX 3CP0A 1GM5A 3ERQA 1TU2B 2ATWA 4IPGA 4LF7L 4LUVA 2M2LA 1Z6HA 3OMCA 1O7YA 5AFWA 5JEAH 1IKMA 4QJFA 4J6HA 3PGZA 2QTLA 3S17B 1OGIA 2OF1A 1V0FA 3WDNA 2K6AA 2CQOA 4XNFA 3RNUA 1GVHA 4RCNA 2VB2X 4ULLA 5I2XA 1Q1BA 2VNJA 5KNDA 2PPBC 3S14H 3WNBA 3D8GA 4J15A 2JA6H 1P16A 4X66Q 3H09A 1OB2A 1CZGA 3GTQB 3W5VA 3LGJA 5IYQA 3UDFA 4ZUIA 2D9UA 3GTMH 5F2DA 3PIOA 1TS4A 3KEWA 1E24A 1HQRD 2JXMB 4DV1L 4AQYQ 3GSIA 1TWHH 4NCNA 5E1FA 2ZJRA 2L5TA 5FJ8G 2KHSA 4Q0FA 2IX1A 3H3VI 2OK7A 4IN3A 5CBAE 1D5ZC 2O5JC 1E79A 2HUGA 2VQFL 1N32Q 4ACBA 2E74C 4XQFA 2PQAA 3KF6B 4XQNA 3PO2H 1WCMG 4FF3A 1TIID 1UD5A 1KRHA 4XLHA 4H0LC 1GUNA 1K8AC 1AZQA 5ELDA 4OO1I 4LK1C 2GVBA 2IT1A 1I3QB 3DWQA 1H8HA 1B9NA 1HZBA 3C1FA 1EIYB 5H59A 2NVTH 1U4MA 1HQMC 1NUCA 2F0QA 5IYCH 1QOHA 3S15H 1COWA 4PC2A 5IGFA 1GVPA 4K0KL 1TS2A 5CR3A 3Q39A 2N88A 4OONA 2EDGA 2JJ1A 4IPHA 4TRDA 1VQ9B 2HLDA 3PV0A 2F0WA 4G4KA 3D4RA 2C4UA 4EVOA 1PA6A 3WQZA 2CW5A 2X69A 1DYQA 3VYUA 2RDGA 1QE6A 4KY6A 1IBKL 2HHHQ 1PH8A 5CORA 4POGA 4DV3L 4CQJA 1E43A 1VQ5A 3FKIG 5ELCA 3GTOB 4DV1Q 1RODA 2ZTGA 1EFID 4DV6L 3NENA 2D0PA 1YNJD 1SNQA 4XDXA 4P26A 2RCNA 3OOCA 3LQ6A 2WAQB 3WWVA 4MN3A 3I4MH 2PNHA 2VQFQ 1EQRA 3HOVG 3NTIA 3TREA 1D1KA 5DSZA 1D2EA 3SK6A 3R6KA 2K7VA 1YHBA 4OIKA 2JJ2A 1Z47A 1I5FA 1B2RA 3MEFA 1LLRD 1FNBA 3I90A 3BVMA 3KOJA 5TSSA 3G71A 4RPDA 1TVXA 4J1MA 1CI3M 1YVCA 2NYZD 4LNQA 4A3GB 1SYBA 1EYDA 2QA4A 4LF4L 2YTXA 1VMPA 4DN4M 2XNJA 1YHAA 4AF6A 1VQDA 5M5WB 5IP9H 1I50B 1HZEA 4N8X1 3BH4A 1Q82D 2EOTA 3H3VH 1P4MA 2DGYA 4QUCA 1CKNB 1FGUA 4UP9A 2JK8A 4A3IG 5JJLA 1BPLA 2ZXIA 2NVQB 5C5LA 3BYTB 4L6TB 2AUKA 4P71A 4DV3Q 1XNQQ 4OO1H 1H8EA 1VQ6A 1PMRA 5I6YA 3S1NH 4IURA 2CW0D 3TP7A 1TLLA 3CRLC 4HCEA 4JCVE 3GV3A 5DN6A 1I94L 2WJVA 2YV5A 2J4XA 3QFSA 3ASQA 4OELB 1EL0A 2ZBUA 3KJPA 1DARA 1CNEA 3CKIB 2QEJC 4P1VA 3CAMA 1E2VA 1XX8A 4JC0A 2RHQB 1VLOA 4MIUA 4LF4Q 2XNDA 2RSNA 4RD3A 2F1LA 3B6YA 3UDGA 4X0CA 1SYGA 1K73D 1N9WA 4UAJA 5CDFA 2B2UC 1VQBA 2JEAI 2OYNA 2Z9HA 4KKUA 5IYNA 3HOWB 5I9PA 1I4XA 5J35A 1X6OA 4ZQ3A 3I3CA 3MAQA 1HA3A 4A3DG 4DAPA 4XMYA 2RF4A 3S2HB 1UAPA 3CU7A 2MO1A 1SM4A 1EZ6A 4OHJA 1WVLA 4A3BH 4A3FB 2PLFA 2TMPA 2L4NA 3EA6A 2VS1A 3J7AV 1Z7TA 4XM3A 4FF4A 4HJ7A 1EP2B 3S1MB 4A3EG 3TS2A 5FJ8H 1I94Q 1H85A 2B8FA 1GOZA 2XWBB 2XGJA 2F0UA 2YTYA 1M1KC 4B3RL 3A54A 1YJWA 3W5HA 2FHTA 4JG2A 1QZHA 2WB1B 3QIAA 1W6KA 2E1BA 4DV5L 2V4DA 1E3XA 4FF1A 1IB0A 1I4PA 2B2YA 5E3FA 2C78A 2VUMB 4FF2A 2A8VA 4Q7JB 1BQQT 2B63G 2PIAA 3BZDB 1NR2A 1X3FA 1FVIA 4RD2A 3STBC 4YCVA 4DV0Q 4DNTB 1HXYD 3AVYA 4DR4L 1TS5A 1WOOA 5C4JB 1R5BA 1EIGA 2R9VA 4UP8A 1PH4A 3MMPA 3DWAA 4I65A 2X85A 1AE3A 1GO3E 2XEXA 4F7DA 3T13A 3KDFA 3JAME 4XYQA 1F9PA 3FKIH 3K5MA 1XTDA 4XT3B 5FO7B 3C2QA 1SN8A 2Q6IA 2QA4B 2DY7A 2WSSA 2BSAA 4KN7C 4B43A 1A2TA 4QIWB 3BDCA 1EIHA 3HGBA 4IOCA 2F0TA 1DGSA 1WCMB 2BE5D 4TSSA 4LUOA 3HRZC 4DV5Q 1VQFA 2ENBA 4HIKA 4U9UA 4DV7L 4LC0A 1FX0A 3EJIA 4ID6A 1T9HA 4WWVA 3OIPA 1I4HA 4J8QA 3N52A 2EFGA 2LS01 3J80E 1I18A 5CV6A 1D2BA 5I2YA 1NDHA 3BG3A 5FLXc 4HJ8A 1ENCA 4X65L 3N6RA 1K83B 2ALYB 1FRNA 4A3IH 1BX1A 4QQBX 1V43A 2PO4A 2B2VA 5BN3A 1PH3A 1FDRA 3D4DA 1NMGA 3K58A 4HMJA 2M00A 1KRTA 1X65A 2FMCA 4IUTA 3A1PA 4JMQA 3TP5A 4B3TQ 1U5KA 2A6HC 1H42A 3CC7A 2CC2A 4DAYA 2R93G 1CHQD 2E2HB 1ZXTA 1HZAA 1X56A 4RFBA 3CCRB 1LTTD 2JA9A 2DJGC 4WZTA 3ULLA 3M3YB 3HOVB 2ZL6A 1N0UA 2F0HA 2ZXRA 1KTKA 1ZYRC 1SNOA 1KZLA 1D1IA 4DV7Q 3C1EA 4LWCA 2DCUA 5FIUA 4PQXA 4JOIA 1V1QA 4V0BA 1WJJA 3OWFA 1QG7A 1TQOA 2A1AA 4LFAL 5E4WC 1E3ZA 3VMFA 1A2UA 3ULJA 4K8JA 2BGJA 4I7AA 4X65Q 2FX3A 5IWAQ 3OZVA 1IZ6A 4DNIA 4WZEA 2FMMA 5IYBH 3ASPA 1A8PA 4II2A 4YWLA 2X53S 4TVAB 3M9BA 5IY0A 1DONA 2EXDA 1UE5A 1UD6A 2OBTA 2K52A 5KIXA 1EY4A 1VDZA 2MPMA 3DEPA 1SFOB 2JA5G 4C2MH 2HCIA 1A63A 3TRZA 3DLLA 5LMUL 1UUPA 5DNFA 5M5YB 1H9KA 1TR5A 3D6WA 3MC0B 1TTTA 5IT9E 1E1OA 4A3EH 1KTVA 5FLXL 4RA8A 4G1BA 1G51A 4X05A 4KD4A 2LSSA 4OPVA 3F2UA 5ISRA 4ZGNB 1PRTC 1BNZA 2EVBA 3RLNA 2NTSA 1VQ7A 1SMYC 1TVCA 2BPOA 1K8AD 3LWEA 4JI8L 2EIFA 1IYUA 1SRUA 1A6XA 2KCMA 2ZTNA 3A8KE 3D6CA 3I4NG 2K5VA 3A7AB 4B9WA 1EOVA 3GTJH 2YU9H 2MUYA 4ME3A 3KDFB 4GKJL 1SJHD 5A88A 1WTPA 2C77A 4X7CA 2OBSA 1X3GA 4WRDA 1V1OA 4RMFA 1EP3B 1VCIA 1PJ6A 3VO2A 5E4XA 4EQ5A 1EQQA 2QN6A 1SEBD 4MZ9A 3TN2A 3CMEA 1UEBA 3PUVA 2BCOA 4A3MG 3KF8A 1RQPA 5FO1A 2ZZFA 4BPRA 1WOCA 4DV4L 2VNUD 4A3DB 3PUYA 3CW2A 4X06A 3PMFA 5L46A 1DOMA 4G7WA 4YAWA 2X6WA 5LMUQ 1E2WA 2NB0A 3FPKA 2WV6D 5CMDA 3A5UA 1EYGA 2F0IA 4RAUC 3QR8A 5KNCA 2I0QA 4ZKBB 3T16A 5IGBA 4EX5A 2LY7A 2EIXA 3AYHB 2A69C 4BY1G 2EYMA 1V5VA 3UE0A 4JI8Q 2HIXA 2Q8TA 4QVAA 1KQSB 2RQXA 4QUFA 5A8AA 1SLJA 2I1LA 3FPPA 3ZZTA 1IHZA 1MABA 4XN3A 1QNKA 3W5UA 2N8NA 1RKNA 3OIQA 1IBML 3RZOB 3WBJA 3LO8A 1WYDA 1S5CD 4RKLA 4DR3Q 1ASYA 4ODGA 1UE1A 5C4XH 4RCYA 4YCWA 2EYJA 3ICEA 3MEHA 4BBRG 1EU4A 1U9RA 3CC7B 2B63B 4DUYL 4DAYB 4A3KG 3CCLA 2OCEA 1ASZA 3DEOA 4A3CH 4LFBL 4AF7A 4WJ4A 1OXTA 5J1ZA 3CF5A 2CWPA 3GTPH 4DV4Q 1EFWA 3GO5A 2F0JA 1BBXC 2F0DA 1SE4A 5M3MB 3AGQA 2BH2A 1VQPA 3S9WA 3ASTA 1TWGB 3SEBA 1ICFB 4L8JA 4PMWA 2D3LA 1PTOH 2B2TA 1QWYA 3IL8A 2E2DC 1IJFA 2YYZA 3CXCA 1AH9A 2K28A 3CQZB 2R7ZB 1YEZA 4ME5A 4DAMA 5I6WA 2R7DA 5DM63 1EY5A 4DR6L 1BCPC 2NVYH 4AYBG 1N8RC 4Y7NB 1IBMQ 1B4OA 1NE3A 3W5OA 3K7AB 1CTMA 1XMOQ 1PFBA 1G6ZA 3LQEA 2I5HA 3MWYW 1Y69U 5ELBA 3F2DA 1XPOA 4DUYQ 4O0AA 4P2CB 2NV4A 1RIPA 4WORA 1C8CA 1CNFA 5JVH3 1D7QA 2W6JA 3M4PA 3QFRA 1VQEA 2G9HD 1XYIA 1HRJA 1BJKA 4C3HB 1N33Q 1VMCA 3R2TA 2ZJQA 3A8JA 1JT8A 1STAA 2IX0A 3SGIA 4A93B 1N34L 3Q38A 4L5TA 4JBWA 3CPWA 3RN5A 2XZPA 2PE3A 5IYPA 5IOCA 3CC4A 2SOBA 2JA5H 5ELOA 5TV2A 3SK8A 2EY1A 1ZM2A 1ICWA 4I7ZC 3SDZA 2R93B 1WFQA 2CBXA 1RF2D 2YWFA 4PC7A 1WPCA 1ENAA 2UU9Q 4LBVA 1KLUD 4CJ2C 4NXNL 2RC6A 1BVSA 4XL9A 4DR6Q 1M1KD 1RQRA 4DXGA 1G2SA 3J81k 2RDHA 2X0KA 4X64Q 1OHHA 5IYCG 1BF4A 4H02A 4GLXA 1VHOA 3J81c 3KF6A 1QCBD 3FRPB 2IJ0A 3I4NH 4GQNA 4DR1L 4G6IA 1SYDA 1OXUA 2EZVA 1KK0A 2SDFA 3KLWA 3H91A 2EYLA 4FDBA 4JI5L 1R5NA 3STBD 4JI0L 2Y0SE 5CV8A 3Q3AA 3RZDB 1STYA 1V1PA 4HCSA 5IGCA 3GTKB 3A3BA 1Z9FA 5D3DA 1HUNA 5I9OA 4G7HC 1O78A 2BM1A 3EVQA 3DUZA 1M90C 5TR9A 1VQ8B 3PUXA 2OEOA 4A3MH 4KI0A 3RY8A 3NQTA 5JJZA 3IFTA 1EFCA 1UEAB 1GHJA 3I70A 4P74A 5M3FG 3MCAA 3J81j 4RGTA 2EJGC 1SROA 5J22A 1QH0A 4K1XA 4WQMA 1OB0A 1GJRA 1VQOB 3QE2A 3F1ZA 4NXNQ 2F0FA 1K28A 3I72A 1EIFA 4KLKA 3CCSB 4NMZA 2PZWA 3CCLB 3ASSA 1HNZQ 4LW1A 3SXHA 2ZJPA 1FL0A 1JJ2A 1SNDA 2JP1A 1CFMA 4RDLA 4JW0A 3CMMA 5IODA 2B8GA 1KK2A 4OOXA 1BOSA 5C4HA 2Q2TA 3S1QH 4N8FA 2E2JB 4PZ7A 2R92G 2E2IB 2EE1A 3NELA 3OKXA 3D4WA 5JPMC 2C35B 2ZZGA 2F0SA 3WXMA 2Z4HA 4GNXB 4X66L 4FNFA 2PCFB 2QEXB 4A3KH 2XTIA 2GA4B 2ZM6L 3A8JE 2Q8IB 1DXMA 2D5DA 3NTHA 4CKBA 3CXCB 4HJ5A 4YY3L 4QFMA 5GV7A 2BA1A 1VF7A 4P3IA 3G6JB 1JMCA 3RUZA 2JN4A 2NTTA 2EXZA 4CJ0B 1AE2A 2N55A 1SNMA 1EU3A 3VA7A 2A6HD 5FKAC 1VQLA 4IUNA 3P7JA 2F0VA 3J81L 2Q6LA 1KC8C 2VXWA 3OW2A 1SR3A 3BJUA 1N32L 1FNUA 1P8LA 3JC66 2OTLB 3UI2A 3S1RB 4PGOA 1W35A 1WSVA 4KY5A 2F4NA 3PQIA 4MTKA 2BF4A 4BY1B 2QDBA 3OJXA 1ZYRD 1JNYA 4TMZA 3ZYYX 1QFZA 3A3GA 1LTBD 3S16B 5E7NA 3GTLB 1N07A 4P72A 3I91A 1LUZA 2WACA 4CHTB 2DNEA 1T5XD 4JI6L 3C46A 3CPWB 4IOAA 4DK6C 4TSFA 5M5XB 2E1RA 4PAAA 4KD3A 3CC4B 4F7XA 4BBRB 1LT4D 2EJMA 4KV6A 1ZM4A 1H95A 2ZM6Q 2JA8G 3WOEA 2HHHL 1IYJB 2F3IA 4UDUC 4YY3Q 2IHFA 2ZTCA 1BQEA 1O7LA 4GS3A 1JWSD 4A3BG 5CV7A 4XQJA 2A73B 4R8NA 4R4CA 4XOPA 1L1OA 2C5BA 1MD2D 1LTID 1G91A 4OO1G 1W0KA 4NBSA 3RN2A 2YTVA 3PA2A 2X6LA 1QVFA 3CCVB 1SE3A 4WFN3 4KJOA 5H5JA 2F3VA 4MHEA 3CP2A 1ET6A 2V7WA 3CMAA 4ACAA 3DM1A 3H0GG 3QOJA 4EQOA 4WJ3M 4UHVA 2OTJB 1PRTD 3W1GA 2WAQE 4B3FX 2BM0A 1A0IA 1SMYD 1V1PB 5FK9C 4IUVA 1S4ZA 2QTZA 4P3YA 4ABNA 4AYBB 4OOSA 4JI6Q 2L15A 2ZBVA 4KHPQ 4BBSH 5GQOA 2JA7G 3AU7A 1CZWA 3AEVA 3RLOA 1Y1WB 2XOKA 3MHPA 3E9IA 4QGUA 3S14B 2PMZB 1GUGA 2R61A 2LFNA 2JA6B 3BZKA 3BDOA 3CC2A 5THXA 3OAAA 2F0MA 5KYIA 1IYVA 3V76A 2F4IA 2ZT9C 4HR7B 2QF7A 1A15A 4LUZA 4IJHA 2K01A 3GTMB 1XNQL 1NNXA 1KAWA 3I4LA 4NB3A 5T1IA 1X3QA 5IYWA 4LF5Q 4RJLA 1TWHB 4ZCMA 1AEXA 5EGTA 4M2LA 1JJ2B 5FO0A 1Y8PB 1HZCA 2XRQD 5E6TA 4C3IG 3GIRA 2JDIA 1AMOA 2GN5A 5M3FH 4A3LH 1PVOA 4GN3B 3HOUG 1G6PA 1BBUA 3A74A 4KTAA 3E6ZX 1I7PA 5DM73 1JC7A 3PO2B 1FJGQ 2KBNA 1I4RA 4KJNA 1RDPD 5GV8A 1QFJA 2A69D 5ELNA 3DDYA 3P1HA 5D3IB 1IXRA 1GO2A 4TQUS 1TKWB 3T1YQ 1U4RA 2NVTB 2HT1A 4IPDA 4RD0A 2AHOB 2VNIA 2B39A 2NZHA 4YAOA 3S15B 4HSVA 1I6HH 4P2NA 2JJQA 2Z0SA 5CV4A 4YAUA 3HOZH 3R93A 1NB0A 3MXNB 4HMIA 2R92H 1VQLB 2B2YC 2Z6BD 1GUWA 2O5IC 3Q8DA 3OW2B 3K6OA 3UDXA 4JBJA 2AQ3B 1F2LA 1XQBA 3HP3A 1MRZA 3SKBA 2RKSA 4JK1C 4Z4RA 5KSWB 2M9VA 3OTOQ
chains in the Genus database with same CATH topology
3FVQA 4FXDA 3URYA 1SDFA 3QO2A 3TP6A 1JCKB 3I4MB 1I4QA 1F9SA 1BO0A 4G7OC 1HA5A 4LAAA 1KMHA 3DWPA 2AUJD 4R8IA 2LKVA 2QE7A 1BCPD 5EPLA 4CJ1B 1GUSA 2XRSD 1ZKOA 1IW7C 1EY0A 4BA2I 1FR3A 1UD3A 5JOBA 2WKDA 3MXUA 3KLSX 1W6JA 1KABA 2NWGA 4QCLA 3BC9A 2GJRA 1U4LA 1PFMA 3JU4A 3S1NB 4XD7A 3NTKA 2B2VC 5COYA 4K2LA 2CK3A 4QB4A 5IIFA 1UD8A 3VYSA 5C5MA 3DXJC 1HVXA 1LT6D 4IFDG 1F9RA 1EWCA 1FD7D 4ASUA 1ONLA 2MP1A 2K5DA 2AQ1B 4CGYB 5LHY1 3ND9A 3V2TA 1BUVT 5FO9B 1ILPA 4K8IA 1II3A 1JOKA 4H13C 3BS1A 2AQ2B 1G8ZD 1EEID 2EY2A 3U9OA 1JOOA 3MTSA 2BDNA 1CA6A 4A3BB 5K36G 2K5QA 3MA2B 1OO9B 3HS0C 4ZAIA 2VJJA 1SAPA 2MJ8A 2KEEA 2PNRC 1JE4A 3A55A 2XN9C 4XIGS 5CYUA 5FLXE 3J7AF 3Q24A 2DY8A 4KKTA 3MXPA 1DM0B 4RH6A 1D5XC 3MVVA 3T56B 2SEBD 3M7NA 1ESFA 3NWTA 1EY9A 3KBGA 5HKKA 2ID0A 1E2ZA 4FYDA 4RHRA 1F9QA 3NSWA 4F87A 4PMBA 4Q5VA 2J0TD 4IFDI 1KNEA 1LT5D 4KHZA 2SNMA 3QB3A 4ZRZA 3NHHA 3FKIB 3P20A 2H4OA 5G3LF 5KEEA 3W3AA 4IFDJ 1MBYA 4RGNA 2A68C 1H9JA 1AW7A 5ELFA 1EQTA 3PUZA 2E76C 4U673 4ZKCB 2Z4IA 1QNUA 1ILQA 3L9AX 3K0YA 4IUPA 1WTVA 1FNVA 1CM9A 1B1ZA 1H9MA 2O4XA 1KNAA 3FKSA 2J7ZA 4KN4C 2AWOA 2XIWA 4A3IB 4DAVA 1X32A 4EGVA 1Q8IA 3I73A 1NSNS 1SKYB 2R3ZA 1PDQA 3R3OA 1PXUA 2XZOA 2XWJB 2EYPA 2KUMA 4Z1MA 2NN6G 4K2KA 1M8AA 3OPOA 3TDQA 1FYCA 5LL6S 2F0NA 5C0XI 1SNPA 1WTRA 1W0JA 2JE6I 2GJPA 3J7YW 1PYWD 1STNA 1LV9A 1AFPA 4FP5D 1W9XA 4IFDH 1L0YB 2B2TC 4LJZC 3V05A 3MHBA 1WTHD 1CA5A 3FEWX 4FXKC 1SXTA 1QB5D 3L7ZC 2CQAA 3G05A 3GD7A 3MFGA 2MGSA 2EYFA 3QG1A 2KEDA 1B2TA 1EY6A 5JPNC 1DZ1A 1RD9D 1NBMA 3R2IA 4C2MB 2SNSA 4E0FA 5K36H 2BOSA 4NP5A 2WZPP 4A3EB 2EY6A 4AVZA 1A3VA 1YNJC 3TSSA 5A35A 4H44C 2XSCA 4ILWA 4XLEA 3GP7A 4K6LA 3RLFA 2YU9B 3GTJB 1IKLA 2NN6I 1O7ZA 2B2WA 5IGGA 5C0XH 1EWHA 1GXDC 3NUCA 1ESRA 1KAAA 3M7GA 1A3TA 2W6IA 2JEBI 4DK0A 2RSOA 2OT2A 5EPJA 2DN8A 2RDFA 3NK9A 2L0CA 1LTRD 3V96A 1F2YA 2IL8A 1RCVD 1LTGD 5CV9A 2LZJA 5BN5A 3A35A 1U4PA 1Y8NB 3PIO3 1PLFA 3NPPA 4NKLA 2D62A 3ND8A 3ZPNA 5KRUA 1HHVA 1FNWA 5C4XB 2FJ2A 5D14A 4H7BA 1T5EA 1K8OA 4XLAA 3GQBA 1IW7D 3SVMA 1I6VC 5JVG3 1CT1D 5A2QL 4OL7A 2D3NA 4FXGC 1D6EC 3HAGA 4NW2A 3GTPB 5ELEA 1V8QA 1FGBD 1TT2A 5CBEE 4C1NI 5CC4A 5EBCA 2H1EA 4RGMA 1OXSC 3J81E 2I07B 1PTOB 1BR9A 4R9WA 5M9OA 2G9DA 2NN6H 2VJIA 2EPBA 4M1UB 1JORA 5D65A 3E0JA 3OHXC 1A3UA 4FXUA 4X3KA 2M5SA 2NVYB 1D5MC 1RJTA 1DCZA 1S5DD 3QOLA 4XOTA 4X3SA 2X8KA 3CESA 3R8BA 2E75C 1LO5D 2KOLA 2Z1CA 4O42A 2F0EA 3E5SA 5I4DA 1C4QA 4B08A 3WOFA 2KCCA 1B53A 2KCNA 2F03A 1PKVA 4B9XA 2EJFC 2JA5B 4OGQC 3G7LA 4QMGA 3GVKA 3OW7A 1KDCA 2WKCA 4ZLTF 3W2DA 4PV1C 1O80A 2EYOA 1RTOA 3I4NB 3KUPA 4KKSA 3DMUA 4S3SA 3M85A 4PMCA 3Q23A 4IUQA 2BE5C 3GV6A 1EEFD 5EKLA 2A6EC 3HEJA 1ET9A 5EKKA 5IK2A 2WJYA 2WP8J 4A3MB 3MXNA 3D31A 1CQFA 1E0BA 5EKIA 3H94A 4X3UA 2NUCA 3OE7A 4NDXA 1PRTB 4RHSA 3CP8A 1F2MA 2JSOA 2EY5A 3HKZB 2IW3A 1G291 4O1NA 1BLIA 1E1RA 5IGDA 5C6AA 1CK1A 5NUCA 3S1QB 2LMCB 2K33A 5T1GA 1XWEA 5EBDA 4A3KB 1WD1A 1B9MA 1PZJD 3K5NA 5EPKA 3TZUA 4TKOB 2L11A 1EY8A 4N9PA 5KYLA 3SHLA 2ZZEA 2F0KA 1J9OA 2PZUA 2F0OA 4UZUA 1X3PA 1C48A 5FL7A 2WIIB 1SNCA 4G7ZC 2BA0A 4XXEA 2CHBD 3X3NA 4OIJA 4K5WA 5K5PA 1I8DA 1UNSA 5LL6X 1SYEA 1AP0A 1SBBB 1WTOA 1TY0A 4DXFA 2FINB 4HIZA 4HAEA 3D3RA 1Q90A 3TZDA 1OXXK 4L63B 1DOKA 3U9SA 3T4AC 2PYKA 1BCPB 1SJED 1HPCA 2HQEA 4XLCA 4XORA 2KECA 1R4PB 3H6MA 2KQ3A 3NQIA 1STEA 2RA4A 1AZPA 3OEEA 4BBSB 4XTCS 1Q12A 1TY2A 1EQVA 1K8MA 4K6DA 1JQYD 2X6GA 4RKBA 4DK1A 4DA2A 1LACA 1H9SA 4U68A 2KA7A 3ITPA 2XZLA 1EYAA 3MXGA 4HN7A 3IAYA 1S5FD 4N9TA 4BS9A 4F8MA 2O2LD 4B3GA 2NZ1D 5M3FB 3EQLC 2R6GA 1ENFA 1NRKA 2V7QA 3BVZA 1EY7A 1XTCD 4F88A 3Q22A 1Y8OB 1HA6A 3GVJA 1LTAD 1QJOA 2PQEA 4FO2A 1V0EA 4C56C 1NCVA 1K28D 3KLRA 1Q3LA 1I6HB 1E1QA 3HOZB 4RGOS 4XYOA 3VR6A 1BDOA 2R92B 1S5ED 1VLYA 2HCCA 2NVXB 4CKEA 2XVSA 3GTGB 5KNBA 2F1MA 3L3OC 3SK4A 3HOYB 2FFKB 1MGSA 1QILA 4CKCA 1SYCA 4XQQA 1XXGA 2L55A 5EJWA 4DGZA 3BYYB 2A74C 1DJRD 4ZUJA 4K5XA 2L1BA 3K5OA 4DNRB 3K59A 4LMQD 4A3JB 3A7LA 5CGKA 1Y1VB 1RTNA 3CHBD 1SSOA 4YXWA 1L0XB 2JA8B 3A8IE 4HEDA 2HDLA 2JYOA 3I8ZA 2QCPX 2K05A 2BDOA 4DF7A 3VR3A 4GZYC 1JB3A 1I4GA 1UD2A 1KLGD 4C1NK 1PFNA 4PNYA 1B44D 4TT3A 4BA1I 3H0GB 3VR2A 4XKVA 1JICA 3C2PA 3HZXA 4ZYSA 3Q6SA 1CQVA 2C9OA 5HGTA 1H9SB 4XR6A 3OWEB 1HFGA 4IZ8A 4XT1B 2RBMA 1NR4A 1PZKD 3NE5B 2JA7B 1TWFB 5C0XG 1VJSA 1PTOC 2B2UA 2A6ED 1HTLD 5EQ0A 4C3JG 5HURA 4XONA 1GJXA 2KJXA 1AN8A 3M4YA 4E6IA 4C3HG 4M8AA 4C3IB 3OFNA 4G57A 3HOUB 4DU9A 3EFXD 3T53B 3KBXA 2C5CA 5IGEA 2CVRA 5CV5A 4FVMA 1YNNC 1VF5C 2NBFA 4XN0A 3TP8A 5BN4A 4NNJA 1Q1EA 2Q8RE 3A56A 3BDLA 1SYFA 3PO3B 1DOLA 3BVGA 2F0GA 4KK7A 1IL8A 3BCDA 1EYCA 3HG9A 3AB9A 2B2WC 4EQNA 3ONAB 1EZ8A 3T51B 3IFDA 1EOTA 4Z9CB 3FMCA 2EYHA 1R9TB 1R4QB 4UAIA 3JAML 2F3WA 2DIEA 1RHPA 5C3EB 2F0LA 5C0XJ 1WTXA 4IUUA 3KK7A 3K5LA 4KHVA 4ZK9B 1PZID 2OXPA 3OEHA 3GVLA 3P75A 1PTOF 3VR4A 3EROA 2L9HA 5A2QE 3TMEA 1STGA 5DAUA 2K1BA 1HFNA 3J80L 1WTQA 1BMFA 3ZIAA 3K57A 5J39A 5C4ZA 1MSGA 3AMUA 3MZ5A 3MFYA 4RWSC 2X6YA 2PW5A 2PW7A 1MI2A 2L12A 3VR5A 2K03A 2VB3X 1KDBA 1TS3A 1F77A 2I46A 1UD4A 2RVLA 5C3WA 3FDTA 1B3AA 5KNLA 3FPUB 3C3LA 4XLFA 4YELA 3SR1A 5JAVA 3VYTA 2ZZQA 4K14A 1SE2A 2QKIC 1GUOA 1GHKA 1ML0D 2KVMA 2ICEC 4KY7A 4BWGB 2X6XA 1JWMD 4IQZA 1JOQA 2AWNA 1LT3D 2IPKD 2ZXOA 2CW0C 2F0PA 1MSHA 1F2ZA 4QF4A 3SE0A 5IT9L 3OMGA 1DD2A 1B50A 3NWSA 2GK6A 3BCFA 4KMUC 1LTSD 1KDAA 1TWCB 1G2TA 5KGUA 3LNNA 5JEAG 4K5VA 1PRTF 4EQPA 3SK5A 4CBVA 4HSPA 3NBHA 4V190 2F43A 5G3LD 4BY7B 1HUMA 4YIJA 4C3JB 5DEHA 2MHVA 3TBIB 3O13A 3Q0AA 3IKJA 1J8IA 2A5HA 2WINB 3RMHA 4WJWA 3NP8A 5FO8B 4DFAA 2GJKA 1STHA 5FOBB 2K04A 1GUTA 3VA5A 2IX3A 1TWAB 1S5BD 1STBA 4IALA 2PZTA 3DHQA 4YEJA 1CHPD 2HDMA 2IWHA 2Z8LA 3KLSA 2ICIA 3OSOA 3VYRA 3PUWA 2TSSA 3H3VC 3QWNA 3X3MA 1NAPA 1H9RA 5C3XA 2K5WA 4X3TA 4HTHA 2KVOA 2DNCA 3PIP3 2V31A 2XNAC 5JEAJ 4II3A 1EFRA 2JIZA 3NXWA 4RCOA 3NBIA 3S2DB 4XKWA 1LABA 1JR0D 1HTPA 1PTOD 1WP6A 2D2CC 1M4VA 2Y0SB 4P22A 3RD4A 1BCPF 2GK7A 2K32A 3M4OB 1JWUD 2ZXPA 4G7XA 1OXVA 2A68D 3HOXB 2ZXHA 1WTWA 1ZEQX 1HCZA 1WD0A 3QJYA 3LX0A 2QILA 5C44B 2WPDA 1BXTA 3CRKC 1YNND 3LWUA 3ERQA 1TU2B 2M2LA 1Z6HA 3OMCA 1O7YA 5AFWA 5JEAH 1IKMA 4J6HA 3S17B 2OF1A 1V0FA 3WDNA 2K6AA 4XNFA 4RCNA 2VB2X 4ULLA 5I2XA 1Q1BA 5KNDA 2PPBC 3D8GA 3H09A 1CZGA 3GTQB 4ZUIA 2D9UA 5F2DA 1TS4A 3KEWA 1HQRD 2JXMB 5E1FA 2L5TA 2KHSA 4Q0FA 2IX1A 5CBAE 4IN3A 2O5JC 1D5ZC 1E79A 2HUGA 2E74C 4XQFA 4XQNA 4FF3A 1TIID 1UD5A 4XLHA 4H0LC 1GUNA 1AZQA 5ELDA 4OO1I 4LK1C 2IT1A 1I3QB 3DWQA 1H8HA 1B9NA 3C1FA 1U4MA 1HQMC 1NUCA 2F0QA 1QOHA 1COWA 5IGFA 1TS2A 5CR3A 2N88A 2EDGA 2JJ1A 4TRDA 2HLDA 3PV0A 2F0WA 4G4KA 3D4RA 4EVOA 3WQZA 2X69A 3VYUA 1DYQA 2RDGA 1QE6A 4KY6A 5CORA 1E43A 5ELCA 3GTOB 1RODA 2ZTGA 1EFID 1YNJD 1SNQA 4XDXA 3OOCA 2WAQB 4MN3A 3NTIA 1D1KA 3SK6A 2K7VA 4OIKA 2JJ2A 1Z47A 1LLRD 3I90A 3BVMA 5TSSA 1TVXA 4J1MA 1CI3M 2NYZD 4A3GB 1SYBA 1EYDA 1VMPA 4DN4M 5M5WB 1I50B 1HZEA 3BH4A 2EOTA 4QUCA 1BPLA 2ZXIA 2NVQB 5C5LA 3BYTB 4L6TB 2AUKA 4OO1H 1H8EA 1PMRA 5I6YA 4IURA 2CW0D 3TP7A 3CRLC 4HCEA 3GV3A 5DN6A 2WJVA 2J4XA 1EL0A 3CKIB 2QEJC 1E2VA 1XX8A 4MIUA 2XNDA 2RSNA 2B2UC 1SYGA 5CDFA 2JEAI 4KKUA 3HOWB 5I9PA 1I4XA 4ZQ3A 3I3CA 3MAQA 4DAPA 4XMYA 3S2HB 1UAPA 3CU7A 1EZ6A 4OHJA 1WVLA 4A3FB 2TMPA 2L4NA 3EA6A 3J7AV 1Z7TA 4XM3A 4FF4A 3S1MB 2B8FA 1GOZA 2XWBB 2XGJA 2F0UA 3A54A 2FHTA 2WB1B 3QIAA 1W6KA 2E1BA 2V4DA 1E3XA 4FF1A 1I4PA 2B2YA 5E3FA 2VUMB 4FF2A 1BQQT 3BZDB 1NR2A 4DNTB 1HXYD 1TS5A 5C4JB 1EIGA 2R9VA 3DWAA 4I65A 2X85A 3T13A 3JAME 4XYQA 1F9PA 3K5MA 4XT3B 5FO7B 2DY7A 2WSSA 4KN7C 1A2TA 4QIWB 3BDCA 1EIHA 3HGBA 2F0TA 4TSSA 1WCMB 2BE5D 3HRZC 2ENBA 1FX0A 3EJIA 4ID6A 3OIPA 1I4HA 4J8QA 3N52A 2LS01 3J80E 1I18A 5CV6A 1D2BA 5I2YA 3BG3A 1ENCA 3N6RA 1K83B 1V43A 2PO4A 2B2VA 5BN3A 3D4DA 3K58A 4HMJA 2M00A 2FMCA 4IUTA 4JMQA 3TP5A 2A6HC 4DAYA 1CHQD 2E2HB 1ZXTA 4RFBA 1LTTD 3M3YB 3HOVB 2F0HA 2ZXRA 1KTKA 1ZYRC 1SNOA 1KZLA 1D1IA 3C1EA 4PQXA 4V0BA 3OWFA 1QG7A 1TQOA 5E4WC 1E3ZA 1A2UA 4K8JA 2FMMA 4II2A 2X53S 1DONA 1UD6A 5KIXA 1EY4A 1VDZA 2MPMA 3DEPA 1SFOB 2HCIA 1UUPA 5DNFA 5M5YB 1H9KA 1TR5A 3D6WA 3MC0B 5IT9E 5FLXL 4RA8A 4KD4A 3F2UA 5ISRA 1PRTC 1BNZA 2EVBA 2NTSA 1SMYC 3LWEA 1A6XA 1IYUA 3A8KE 2ZTNA 3D6CA 3A7AB 4B9WA 2MUYA 1SJHD 1WTPA 4WRDA 1V1OA 1VCIA 5E4XA 1SEBD 3TN2A 3PUVA 2BCOA 3KF8A 2ZZFA 2VNUD 4A3DB 3PUYA 3PMFA 1DOMA 4G7WA 2X6WA 1E2WA 2NB0A 2WV6D 5CMDA 2F0IA 4RAUC 5KNCA 4ZKBB 3T16A 5IGBA 2LY7A 2A69C 2EYMA 2Q8TA 2RQXA 4QUFA 1QNKA 2Q8IB 3FPPA 1IHZA 1MABA 4XN3A 1RKNA 3OIQA 3RZOB 1S5CD 4RKLA 4ODGA 2EYJA 3MEHA 1EU4A 1U9RA 2B63B 3DEOA 1OXTA 5J1ZA 3GO5A 2F0JA 1BBXC 2F0DA 1SE4A 5M3MB 3S9WA 1TWGB 3SEBA 4L8JA 4PMWA 2D3LA 1PTOH 2B2TA 1QWYA 3IL8A 2E2DC 2YYZA 2K28A 3CQZB 2R7ZB 4ME5A 5I6WA 5DM63 1EY5A 1BCPC 4Y7NB 1B4OA 3K7AB 1CTMA 1PFBA 1G6ZA 3MWYW 1Y69U 5ELBA 4P2CB 4WORA 1C8CA 5JVH3 2W6JA 1XYIA 2G9HD 1HRJA 4C3HB 1VMCA 3R2TA 1STAA 2IX0A 4A93B 4JBWA 2XZPA 5IOCA 2SOBA 3SK8A 2EY1A 1ICWA 4I7ZC 3SDZA 2R93B 1RF2D 1WPCA 1ENAA 1KLUD 4CJ2C 4XL9A 4DXGA 1G2SA 2RDHA 1OHHA 1BF4A 1QCBD 3FRPB 2IJ0A 4GQNA 4G6IA 1SYDA 1OXUA 2EZVA 2SDFA 3H91A 2EYLA 5CV8A 3RZDB 1STYA 1V1PA 4HCSA 5IGCA 3GTKB 3A3BA 5D3DA 1HUNA 5I9OA 4G7HC 1O78A 3EVQA 3DUZA 3PUXA 2OEOA 4KI0A 5JJZA 3NQTA 3IFTA 1UEAB 1GHJA 3I70A 4RGTA 2EJGC 5J22A 1OB0A 2F0FA 3I72A 4NMZA 2PZWA 3SXHA 1SNDA 2JP1A 1CFMA 3CMMA 5IODA 2B8GA 5C4HA 1BOSA 2E2JB 2E2IB 2EE1A 3D4WA 5JPMC 2ZZGA 2F0SA 2Z4HA 4FNFA 2PCFB 2GA4B 3A8JE 4CKBA 1DXMA 2D5DA 3NTHA 4OO1G 2BA1A 1VF7A 3G6JB 3RUZA 2NTTA 4CJ0B 2EXZA 2N55A 1SNMA 1EU3A 3VA7A 2A6HD 5FKAC 4IUNA 3P7JA 2F0VA 3J81L 2VXWA 1FNUA 3UI2A 3S1RB 4KY5A 4BY1B 2QDBA 1ZYRD 3ZYYX 3A3GA 3S16B 1LTBD 3GTLB 3I91A 2WACA 4CHTB 2DNEA 1T5XD 3C46A 4TSFA 5M5XB 4F7XA 4KD3A 4BBRB 1LT4D 2EJMA 4KV6A 3WOEA 4UDUC 1O7LA 1JWSD 5CV7A 4XQJA 2A73B 4R8NA 4XOPA 1MD2D 1LTID 1G91A 1W0KA 2X6LA 1SE3A 4WFN3 4KJOA 2F3VA 4MHEA 3CP2A 1ET6A 3DM1A 3QOJA 4EQOA 1PRTD 4B3FX 1SMYD 1V1PB 5FK9C 4IUVA 1S4ZA 4ABNA 4AYBB 3AU7A 1CZWA 1Y1WB 2XOKA 3S14B 2PMZB 1GUGA 2R61A 2LFNA 2JA6B 3BDOA 2F0MA 3OAAA 5KYIA 1IYVA 2F4IA 2ZT9C 4HR7B 2QF7A 1A15A 2K01A 3GTMB 3I4LA 5T1IA 1X3QA 1TWHB 1AEXA 5EGTA 1Y8PB 2XRQD 4C3IG 2JDIA 4KTAA 3E6ZX 5DM73 3PO2B 1JC7A 1I4RA 4KJNA 1RDPD 2A69D 3DDYA 3P1HA 5D3IB 4TQUS 1TKWB 1U4RA 2NVTB 2B39A 3S15B 4HSVA 5CV4A 3R93A 4HMIA 2B2YC 2Z6BD 1GUWA 2O5IC 3K6OA 2AQ3B 1F2LA 3HP3A 4JK1C 2RKSA 2M9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNR B;  1E2W A;  2PNR C;  1V43 A;  4H0L C;  3L7Z C;  5BN3 A;  2JEA I;  1GUN A;  2EJM A;  4IQZ A;  4XIG S;  3H94 A;  4LK1 C;  3A7L A;  2IT1 A;  5KNC A;  3AB9 A;  2DNC A;  3GD7 A;  1B9N A;  4KKU A;  4KKT A;  2A69 C;  2A6H C;  1HQM C;  1V8Q A;  3T51 B;  1O7L A;  3T56 B;  1OXU A;  4G7O C;  3A8I E;  3M7N A;  1LAB A;  3QG1 A;  1Q12 A;  2AUJ D;  3FPP A;  2CW0 C;  4XTC S;  1G29 1;  2Q8I B;  1K8M A;  1OXS C;  1HTP A;  2BDO A;  2EDG A;  3FMC A;  1E2Z A;  3SE0 A;  3VR3 A;  2D2C C;  3PV0 A;  1DD2 A;  4GZY C;  4G7H C;  1O78 A;  3D4R A;  2NN6 H;  4KMU C;  4DK1 A;  3PUX A;  1Z7T A;  1GUS A;  1ZYR C;  1LAC A;  1H9S A;  2K32 A;  4KI0 A;  2KA7 A;  5K36 H;  3LNN A;  3IFT A;  5JEA G;  2LMC B;  1GHJ A;  2B8F A;  1ZKO A;  2K33 A;  4BA1 I;  1IW7 C;  1OXV A;  1DCZ A;  2EJG C;  4KHZ A;  2A68 D;  4BA2 I;  3VR2 A;  3OOC A;  1OXT A;  1FR3 A;  1B9M A;  3QIA A;  2E75 C;  3EQL C;  3P20 A;  3MXU A;  4TKO B;  3TZU A;  2R6G A;  3I72 A;  3W3A A;  1YNJ C;  2V4D A;  5A35 A;  4H44 C;  2A68 C;  1H9J A;  1H9S B;  2K7V A;  4L8J A;  1HCZ A;  3VR4 A;  3RLF A;  3QJY A;  1GUG A;  2YYZ A;  3NE5 B;  3BDO A;  1Y8O B;  1CFM A;  1IYV A;  1QJO A;  5C0X G;  1CI3 M;  3PUZ A;  3IKJ A;  4DNT B;  2ZT9 C;  4HR7 B;  2B8G A;  1VDZ A;  2NN6 I;  2KCC A;  2E76 C;  2QF7 A;  3CRK C;  3LWU A;  2A6E D;  3KLR A;  3I4L A;  3DXJ C;  5C0X H;  1H9K A;  2EJF C;  1EWH A;  1TU2 B;  4IFD G;  3VR6 A;  1BDO A;  2PCF B;  3D31 A;  1H9M A;  1Z6H A;  1CTM A;  5JEA H;  4G7Z C;  1Y8P B;  1ONL A;  3MFY A;  3A8J E;  4OGQ C;  1DXM A;  2D5D A;  2BA0 A;  4OO1 G;  1GJX A;  1Y69 U;  2BA1 A;  2EVB A;  2JEB I;  1VF7 A;  4DK0 A;  1GUT A;  1SMY C;  3M4Y A;  3ND9 A;  4KN4 C;  3VR5 A;  3WDN A;  2DN8 A;  2AWO A;  2AUK A;  1A6X A;  1IYU A;  4RCN A;  3OW7 A;  3A8K E;  4OO1 H;  1Q1B A;  3VA7 A;  4KN7 C;  3A7A B;  2A69 D;  2A6H D;  5KND A;  2PPB C;  3T53 B;  1PMR A;  5KNB A;  2F1M A;  4PV1 C;  3HGB A;  3I73 A;  2BE5 D;  4TQU S;  1TKW B;  4H13 C;  3CRL C;  4KKS A;  5BN5 A;  4JBW A;  1VCI A;  3M85 A;  1Y8N B;  2JXM B;  2NN6 G;  2BE5 C;  1Q90 A;  3OPO A;  2D62 A;  1FYC A;  3ND8 A;  3SDZ A;  1YNN C;  4I7Z C;  1OXX K;  2A6E C;  3PUV A;  3PUW A;  2JE6 I;  1VF5 C;  1GUO A;  2L5T A;  1GHK A;  3U9S A;  2O5I C;  1E2V A;  5BN4 A;  5K36 G;  1T5E A;  3BG3 A;  2O5J C;  1K8O A;  1Q1E A;  3PUY A;  4LJZ C;  4IFD H;  3GQB A;  1IW7 D;  2E74 C;  4JK1 C;  1I6V C;  2DNE A;  3N6R A;  1H9R A;  1HPC A; 
#chains in the Genus database with same CATH topology
 2NVX H;  4AC9 A;  3FVQ A;  2CFM A;  3URY A;  4FXD A;  1YJ9 B;  1SDF A;  3QO2 A;  3GTG H;  4HJA A;  3PIP A;  3TP6 A;  2UXD L;  1JCK B;  3I4M B;  3HOY H;  1W3S A;  1I4Q A;  3CCM B;  1F9S A;  4RD1 A;  1BO0 A;  4G7O C;  4QHY A;  1LTL A;  1HA5 A;  4LAA A;  1KMH A;  3DWP A;  2AUJ D;  1ZM9 A;  4R8I A;  1IL2 A;  5HXB A;  2LKV A;  2QE7 A;  3AFQ A;  1BCP D;  4L5Q A;  2K5H A;  5EPL A;  5C3E G;  3SEJ A;  3K0X A;  4CJ1 B;  1N8R D;  1GUS A;  3CCR A;  2XRS D;  4RCZ A;  3AVT A;  4JI4 Q;  5GAD C;  4WZL A;  1ZKO A;  4A3J H;  4ZCK A;  2I5L X;  1IW7 C;  1EY0 A;  3CCE A;  3H15 A;  4BA2 I;  1L1O B;  1KRS A;  2WB1 E;  4FWT A;  4B3M L;  1FR3 A;  1UD3 A;  4MTN A;  1Y1V H;  5JOB A;  5IYB G;  4DV0 L;  2WKD A;  1QVF B;  3MXU A;  3KLS X;  2FXQ A;  1W6J A;  2JA8 H;  1FRQ A;  3UE1 A;  4RDJ A;  1KAB A;  3CMA B;  2NWG A;  4QCL A;  3BC9 A;  4YWM A;  2GJR A;  2VUM H;  2Q6K A;  1U4L A;  4RDK A;  1PFM A;  1Q7Y C;  3CPF A;  4LFC Q;  3JU4 A;  3S1N B;  4ZCI A;  3U4Z A;  2UXD Q;  4XD7 A;  3NTK A;  2B2V C;  4RM0 A;  5COY A;  4K2L A;  2CK3 A;  2KCT A;  4QB4 A;  5IIF A;  3P26 A;  4B3S L;  1UD8 A;  3VYS A;  5C5M A;  3DXJ C;  1HVX A;  2DET A;  1LT6 D;  3VDY A;  3CD6 A;  4IFD G;  1F9R A;  3H0G H;  1EWC A;  4IW3 B;  1FD7 D;  1XFO A;  4ASU A;  1ONL A;  3CC2 B;  2E5L Q;  2MP1 A;  2K5D A;  2AQ1 B;  4CGY B;  4QVJ A;  5LHY 1;  4LF6 Q;  3ND9 A;  2E8G A;  3I1F A;  3DM3 A;  4QIW E;  1BUV T;  3V2T A;  5FO9 B;  3WBK A;  4GOP A;  4QL5 A;  2ZTD A;  1ILP A;  4K8I A;  1PH2 A;  3G48 A;  1II3 A;  1JOK A;  1TWF H;  1KD1 C;  4B3M Q;  2JA7 H;  1MHW C;  1B3Q A;  4H13 C;  3FP9 A;  3KL9 A;  4M0L A;  2MQH A;  3PCO B;  4JOI C;  3BS1 A;  1VS0 A;  2AQ2 B;  4OEM B;  1G8Z D;  1EEI D;  2EY2 A;  1JA0 A;  3CCQ B;  2CWA A;  2DJF C;  3U9O A;  4G5G A;  2EQS A;  4JBK A;  1JOO A;  1M90 D;  3MTS A;  1KIX A;  2BDN A;  1CA6 A;  1CKM A;  4B3T L;  1YZ6 A;  4A3B B;  5K36 G;  2K5Q A;  3MA2 B;  1OO9 B;  1Y0R A;  2V1C C;  2VBT A;  3HS0 C;  4ZAI A;  4R1J A;  2VJJ A;  5EAY A;  1WDT A;  4C3I H;  5HGQ A;  4B3S Q;  1SAP A;  2MJ8 A;  2KEE A;  2PNR C;  1JE4 A;  3HOU H;  3A55 A;  2XN9 C;  3ZC3 A;  4XIG S;  5CYU A;  1N05 A;  5FLX E;  3J7A F;  3E20 A;  5TRD A;  2YWH A;  3Q6R A;  3Q24 A;  2DY8 A;  4KKT A;  3MXP A;  1FND A;  1DM0 B;  4RH6 A;  1D5X C;  3MVV A;  4X07 A;  3T56 B;  5C4X G;  2HD3 A;  2SEB D;  3K7U C;  3M7N A;  1ESF A;  3NWT A;  1EY9 A;  3KBG A;  1HNX L;  5HKK A;  2ID0 A;  1E2Z A;  2GQF A;  4X7D A;  4FYD A;  1NB9 A;  1F9Q A;  3NSW A;  4RHR A;  4PMB A;  4F87 A;  4A3C G;  5H1S E;  4Z4U A;  4Q5V A;  5IWA L;  1KQS A;  2UUB Q;  2J0T D;  3ER0 A;  3PO3 H;  2BGI A;  4IFD I;  1KNE A;  1LT5 D;  2GRE A;  4BY7 G;  1QZG A;  4KHZ A;  2SNM A;  3QB3 A;  4ZRZ A;  3NHH A;  3AQQ A;  1Q81 C;  3FKI B;  4B44 A;  4N3G A;  3P20 A;  2H4O A;  5G3L F;  5KEE A;  1KK1 A;  3W3A A;  4IFD J;  1MBY A;  4RGN A;  2A68 C;  1H9J A;  1AW7 A;  2G5D A;  3CW2 C;  4NXM Q;  1AIP A;  1R9T H;  3CCE B;  1B7Y B;  5IYD G;  5GRO A;  5ELF A;  1EQT A;  3W2H A;  1YJN B;  3PUZ A;  2VYQ A;  4DPG A;  3WYA A;  2E76 C;  3PA1 A;  4U67 3;  4A75 A;  4ZKC B;  1E1T A;  4LF8 Q;  2Z4I A;  1QNU A;  1PH1 A;  1CSP A;  1ILQ A;  3L9A X;  4OP7 A;  5C3E H;  1HR0 L;  5DS0 A;  3K0Y A;  4IUP A;  4HID A;  1WTV A;  1FNV A;  1VQM A;  1HNX Q;  1CM9 A;  2YWG A;  4R4Q A;  1NY4 A;  1B1Z A;  1EXM A;  1H9M A;  2O4X A;  5JJK A;  1KNA A;  4DUZ L;  2K50 A;  4GN5 A;  3FKS A;  2J7Z A;  4KN4 C;  4DKA C;  3AFP A;  1CQX A;  3JAM i;  2AWO A;  2XIW A;  4X8I A;  4A3I B;  4DAV A;  1X32 A;  2QDX A;  4EGV A;  3CD6 B;  1Q8I A;  2X3U A;  2ASB A;  3I73 A;  3PEN A;  2NPF A;  1NSN S;  1SKY B;  1OTC A;  2R3Z A;  4X62 Q;  4DR2 Q;  1PDQ A;  3R3O A;  5DLQ E;  1PXU A;  4UY8 C;  2XZO A;  3A5Z B;  2XWJ B;  3VNV A;  1MIU A;  2EYP A;  1QUE A;  2KUM A;  4Z1M A;  1EFT A;  2NN6 G;  1M8A A;  4K2K A;  1SMX A;  4RD4 A;  3OPO A;  1OB5 A;  1FYC A;  5LL6 S;  3TDQ A;  4GOP B;  1LYL A;  2F0N A;  5C0X I;  1SNP A;  4YAF A;  1WTR A;  1W0J A;  1GKH A;  2JE6 I;  2F4V L;  2GJP A;  3J7Y W;  1PYW D;  1STN A;  1LV9 A;  1AFP A;  2YWE A;  4FP5 D;  1W9X A;  5JBQ A;  4IFD H;  1L0Y B;  2B2T C;  4LJZ C;  3V05 A;  2BN4 A;  3MHB A;  1WTH D;  3ZZ0 A;  1FNC A;  1UWV A;  3FEW X;  4FXK C;  3J80 i;  1CA5 A;  1HR0 Q;  1SXT A;  1D1N A;  1Y14 B;  1QB5 D;  3L7Z C;  4B48 A;  3JQQ A;  4DR3 L;  3W2E A;  2CQA A;  1BBW A;  3G05 A;  3GD7 A;  3MFG A;  4DUZ Q;  2MGS A;  1JJG A;  2EYF A;  1YIT A;  4CDE C;  3QG1 A;  5HZA A;  1QGZ A;  2KED A;  1HNW L;  1HH2 P;  5KW9 A;  1J6Q A;  2B7B A;  3E0E A;  1B2T A;  1EY6 A;  2WR8 A;  2RC5 A;  5JPN C;  5IT9 c;  3R6J A;  3IRB A;  1DZ1 A;  1RD9 D;  1ZUN B;  1NBM A;  3R2I A;  4C2M B;  2ES2 A;  3ZUG A;  2SNS A;  4E0F A;  4DV2 Q;  5K36 H;  2UUC Q;  4FK8 A;  1VQJ A;  2BOS A;  2C4T A;  4NP5 A;  1S40 A;  2WZP P;  4A3E B;  3HKZ G;  1VQ8 A;  2F4V Q;  1YX2 A;  4YHB A;  1K9M C;  1G7S A;  3F2C A;  4IJL A;  3LVB A;  2EY6 A;  3PF4 A;  4AVZ A;  1A3V A;  4JBM A;  4L5S A;  1X54 A;  1YNJ C;  3TSS A;  5A35 A;  4H44 C;  2XSC A;  3ASR A;  3SLD A;  1VQI A;  4ILW A;  2OK8 A;  5HY6 A;  4CDC C;  4XLE A;  3GP7 A;  5C44 G;  4K6L A;  1QUQ B;  3RLF A;  1VQO A;  4OWX B;  5JJI A;  1XMO L;  4R4O A;  2YU9 B;  3GTJ B;  1IBL L;  2VQE Q;  3BY2 A;  3BNW A;  1IKL A;  3ZBU A;  1TWC H;  3CCS A;  1PV4 A;  2NN6 I;  3FJO A;  4RLZ A;  4GLA C;  4PC1 A;  1O7Z A;  5L37 A;  2B2W A;  1HNW Q;  5IGG A;  5C0X H;  4N3N A;  1N33 L;  1EWH A;  1GXD C;  3NUC A;  1ESR A;  5LMN L;  1KAA A;  4UZE A;  2B29 A;  2B3G A;  2C5H A;  3M7G A;  4M4S A;  1A3T A;  4BY7 H;  2K14 A;  2W6I A;  2JEB I;  4DK0 A;  1XPU A;  4GNX A;  2RSO A;  2OT2 A;  4R4I A;  5EPJ A;  2DN8 A;  2RDF A;  4C3J H;  3NK9 A;  2QEX A;  1MJE A;  3OZU A;  3ZJY C;  2L0C A;  1LTR D;  1VQM B;  3V96 A;  1F2Y A;  2UU9 L;  4Z4Y A;  2IL8 A;  1RCV D;  1LTG D;  2VY3 A;  5CV9 A;  2LZJ A;  5BN5 A;  3A35 A;  5IYD H;  1U4P A;  4JI1 Q;  4X64 L;  1Y8N B;  1C9O A;  3PIO 3;  3ZBT A;  3QSY A;  3PF5 A;  1PLF A;  3NPP A;  4NKL A;  2D62 A;  3ND8 A;  3ZPN A;  1DDI A;  5KRU A;  1HHV A;  4PAB A;  1IBL Q;  2OTL A;  1FNW A;  1QGA A;  5C4X B;  2FJ2 A;  4JVZ A;  5D14 A;  2HQL A;  1KL9 A;  1T5E A;  2PMD A;  4XLA A;  4H7B A;  3WNC A;  1K8O A;  2ZL7 A;  3GQB A;  1IW7 D;  3SVM A;  1I6V C;  3B8H A;  1MKH A;  1TWA H;  4OPS A;  5JVG 3;  3G6E A;  2LXJ A;  1CT1 D;  5A2Q L;  4OL7 A;  2D3N A;  2BVN A;  4ZV4 A;  4FXG C;  5LMN Q;  4LBZ A;  1D6E C;  3H9N A;  3HAG A;  3SJZ A;  4NW2 A;  3GTP B;  5ELE A;  4ALP A;  1K73 C;  1V8Q A;  1FGB D;  1TT2 A;  5CBE E;  4C1N I;  5CC4 A;  2QGQ A;  4PZ6 A;  1N08 A;  5EBC A;  2H1E A;  4RGM A;  1OXS C;  3V7A A;  3J81 E;  2I07 B;  1PTO B;  1BR9 A;  3OZW A;  4R9W A;  1MJC A;  5M9O A;  2G9D A;  2NN6 H;  2OBR A;  4P9S A;  2VJI A;  1Q9S A;  2EPB A;  4M1U B;  5IE8 A;  1JOR A;  2MFI A;  2D9R A;  3P27 A;  3E0J A;  3OHX C;  4UP7 A;  1X55 A;  5D65 A;  1HNZ L;  2WAQ G;  1A3U A;  4FXU A;  1YIT B;  4X3K A;  2KEN A;  2M5S A;  2NVY B;  1D5M C;  1RJT A;  1DCZ A;  4G1V A;  1S5D D;  3CCV A;  3QOL A;  1XMQ Q;  1JJC B;  2B7C A;  4RD6 A;  1HR0 W;  4BBS G;  4XOT A;  4X3S A;  1J9Z A;  2X8K A;  3CES A;  3R8B A;  1VHE A;  2E75 C;  1LO5 D;  4Y7C A;  1XPR A;  4ROX A;  2KOL A;  2Z1C A;  2OTJ A;  3S2D H;  4QV2 A;  5IP7 H;  4O42 A;  2F0E A;  3B82 A;  3ES9 A;  3E5S A;  1TUI A;  2AMC B;  4A3G G;  4RPB A;  2HMA A;  5I4D A;  1C4Q A;  5IYR A;  4RG1 A;  4B08 A;  3WOF A;  4OX9 L;  1HJP A;  2KCC A;  2D74 A;  1B53 A;  2KCN A;  3M4O H;  3NEM A;  4Y52 H;  4YHH Q;  2F03 A;  4A3L G;  1PKV A;  1WOR A;  4B9X A;  2EJF C;  2JA5 B;  4JV5 Q;  3Q6Q A;  4TMX A;  3BU2 A;  3HOX H;  2CH4 W;  4OGQ C;  3AVV A;  3G7L A;  4JI3 L;  5BR8 Q;  1L1O C;  4QMG A;  2QGG A;  2XNC A;  2P3M A;  1K0S A;  1VQG A;  3GVK A;  3ULP A;  4CDF C;  1YBY A;  4Z4S A;  3OW7 A;  1KDC A;  2WKC A;  4ZLT F;  3W2D A;  1XJV A;  1YNX A;  2AKW B;  4PV1 C;  1O80 A;  1QVC A;  2EYO A;  1QVG B;  3U6B A;  3HOZ G;  1RTO A;  5C44 H;  3I4N B;  3KUP A;  4KKS A;  3DMU A;  1E62 A;  3PUM A;  4S3S A;  3ONU A;  3M85 A;  4PMC A;  3Q23 A;  4IUQ A;  4P12 A;  2BE5 C;  1V9P A;  2QW7 A;  3GV6 A;  1EEF D;  5EKL A;  4IO9 A;  2A6E C;  1VQA A;  1SKQ A;  3HEJ A;  1ET9 A;  1WI5 A;  4OX9 Q;  5EKK A;  5IK2 A;  2WJY A;  4AH6 A;  2AHO A;  4HIM A;  4JI7 Q;  3S17 H;  2WP8 J;  4Z4T A;  4DR5 Q;  4A3M B;  1D8L A;  2GVA A;  3MXN A;  3D31 A;  3HOY G;  4JPB W;  1Q81 D;  1CQF A;  1E0B A;  5EKI A;  4MYT A;  3HOW G;  3H94 A;  1PHJ A;  4X3U A;  2NUC A;  3OE7 A;  4NDX A;  1PRT B;  4RHS A;  3GTQ H;  1F60 A;  3CP8 A;  4OOV A;  4JI3 Q;  1F2M A;  2JSO A;  1FNM A;  3OJW A;  2EY5 A;  3T1H Q;  1YJ9 A;  3BY1 A;  3HKZ B;  2IW3 A;  1G29 1;  4A3F G;  4O1N A;  3G6E B;  2N78 A;  3QFT A;  3CCM A;  1BLI A;  1E1R A;  2UXB L;  5IGD A;  5C6A A;  2DY1 A;  1CK1 A;  5NUC A;  4A3J G;  2Z6K A;  4HIO A;  4KHP L;  4GKK L;  1QG0 A;  3S1Q B;  1Y1V G;  2H5X A;  3KYH C;  2LMC B;  2UUA L;  2K33 A;  2WB1 G;  5T1G A;  1XWE A;  5EBD A;  1I3Q H;  4A3K B;  3RR5 A;  1WD1 A;  4AYB E;  1B9M A;  1PZJ D;  3K5N A;  2VUM G;  5EPK A;  1UE7 A;  3TZU A;  4TKO B;  5LMN W;  1XB2 A;  2L11 A;  5LMZ A;  1EY8 A;  4N9P A;  4P25 A;  5KYL A;  2PMZ E;  4LF5 L;  3SHL A;  2ZZE A;  2F0K A;  1Y1W H;  3QFC A;  1J9O A;  1G7T A;  2V7V A;  3K8A A;  1F20 A;  2PZU A;  1FJG L;  2HCJ B;  1U0L A;  4M53 A;  2F0O A;  4UZU A;  1X3P A;  3GTO H;  1C48 A;  2UXC L;  2KHI A;  4J0Q A;  5FL7 A;  2WII B;  2UXB Q;  1N36 L;  1SNC A;  4G7Z C;  3T1Y L;  2HDN B;  2BA0 A;  2PI2 A;  4GKK Q;  5BSX A;  5FNZ A;  4DK3 C;  1Y0Y A;  4XXE A;  2CHB D;  3X3N A;  4R4T A;  2V7U A;  3ONY A;  2UUA Q;  4O2D A;  4OIJ A;  4K5W A;  3JQP A;  4LF7 Q;  5K5P A;  1I8D A;  4B4D A;  4A3G H;  1UNS A;  5LL6 X;  1SYE A;  2F52 A;  1AP0 A;  1SBB B;  5J3O A;  1TY0 A;  4P6Y A;  3OTO L;  3AGP A;  3G4S B;  4DXF A;  1WTO A;  2FIN B;  1J5E L;  4HIZ A;  4HAE A;  3D3R A;  1IHM A;  5M5W H;  2LXK A;  1I50 H;  1Q90 A;  2Q2H A;  3TZD A;  1OXX K;  4TN1 A;  4L63 B;  1DOK A;  3U9S A;  5HZB A;  3I2Z A;  3CRZ A;  1YI2 A;  2Q6O A;  2Q2U A;  3T4A C;  2PYK A;  3CCQ A;  1BCP B;  2NVQ H;  1SJE D;  2VBU A;  1HPC A;  1K9M D;  4C0S A;  2HQE A;  4XLC A;  2UXC Q;  4XOR A;  2KEC A;  1R4P B;  1KHI A;  1N36 Q;  3H6M A;  1C0A A;  2KQ3 A;  3VO1 A;  5J3B A;  4JI4 L;  3NQI A;  4TMW A;  1STE A;  2RA4 A;  1AZP A;  3OEE A;  4BBS B;  4XTC S;  1Q12 A;  1N06 A;  1EQV A;  1TY2 A;  1K8M A;  1YIJ B;  4K6D A;  1VQN A;  1JE5 A;  3PO3 G;  2ZTE A;  1JQY D;  1Q46 A;  4DQL A;  1GAQ A;  4MYU A;  2X6G A;  4A76 A;  4RKB A;  4GOP C;  1JB9 A;  5AN9 A;  4DK1 A;  4NPS A;  4DA2 A;  2OWO A;  1LAC A;  4UZF A;  1EWY A;  3A8I A;  1H9S A;  4U68 A;  1J5E Q;  2KA7 A;  3ITP A;  2XZL A;  1EYA A;  3MXG A;  3I56 B;  4HN7 A;  3IAY A;  4K0K Q;  4LFC L;  1S5F D;  2DEU A;  2B5O A;  3WY9 A;  4N9T A;  4BS9 A;  4F8M A;  2O2L D;  2CCZ A;  1U2R A;  4B3G A;  2NZ1 D;  3K81 C;  3HOW H;  5M3F B;  3EQL C;  1E7Z A;  1IBK Q;  2R6G A;  1ENF A;  2CH4 A;  2OQK A;  2FVG A;  3CPX A;  1NRK A;  2V7Q A;  3BVZ A;  3S2H H;  1EY7 A;  1XTC D;  4DV6 Q;  4F88 A;  4M1K A;  3Q22 A;  1Y8O B;  2E5L L;  1HA6 A;  3GVJ A;  1LTA D;  1QJO A;  2PQE A;  4FO2 A;  4A3F H;  4LF6 L;  1V0E A;  2PI2 E;  3S1M H;  4C56 C;  2I5M X;  1NCV A;  2DOG A;  1K28 D;  3KLR A;  3EN2 A;  1Q3L A;  1WTH A;  1I6H B;  1T6Z A;  1E1Q A;  1S3O A;  3HOZ B;  4RGO S;  4XYO A;  3KJO A;  3VR6 A;  1BDO A;  1YJN A;  2R92 B;  1S5E D;  4B47 A;  4IPC A;  1VLY A;  2HCC A;  5F4O A;  1D8T A;  1YHQ A;  2NVX B;  4CKE A;  2XVS A;  3GTG B;  5KNB A;  2F1M A;  3L3O C;  3SK4 A;  4P6V F;  3HOY B;  5C4J H;  3E1Y E;  2FFK B;  1MGS A;  1QIL A;  3U6K A;  3EBE A;  4CKC A;  1SYC A;  5F4J A;  4LBY A;  2PQA B;  4YCU A;  2Q2I A;  4XQQ A;  1XNR L;  1XXG A;  2L55 A;  3W2G A;  5EJW A;  4DGZ A;  3BYY B;  2A74 C;  1DJR D;  4ZUJ A;  3CB4 A;  4K5X A;  2L1B A;  3PUN A;  3K5O A;  3HKS A;  4DNR B;  1O7I A;  3K59 A;  4LMQ D;  2CF4 A;  4LF9 L;  2VNK A;  4A3J B;  4TMT A;  3A7L A;  2IY5 B;  4GLV B;  5CGK A;  2WZN A;  1WCM H;  2UUB L;  1Y1V B;  1RTN A;  3CHB D;  1YI2 B;  1NJI C;  1PH9 A;  1SSO A;  4YXW A;  1L0X B;  2JA8 B;  3A8I E;  2ZL5 A;  4HED A;  2HDL A;  2JYO A;  2BH8 A;  2QCP X;  3I8Z A;  1C7Y A;  2K05 A;  2BDO A;  2RHS B;  4DF7 A;  3VR3 A;  2K4K A;  1DDG A;  1VQ5 B;  4GZY C;  1PH7 A;  1JB3 A;  5BSY A;  1B8A A;  1I4G A;  4P73 A;  1UD2 A;  2JQO A;  1K83 H;  1KLG D;  4C1N K;  2VW9 A;  1PFN A;  4PNY A;  1B44 D;  4NXM L;  4BXX G;  4TT3 A;  4BA1 I;  4JI2 L;  5M3M G;  1ZM3 A;  1XNR Q;  1VQN B;  3H0G B;  3VR2 A;  3I55 A;  4XKV A;  5FA6 A;  1JIC A;  1W2B A;  1KJZ A;  3C2P A;  1BX0 A;  3HZX A;  2E2H H;  4LF8 L;  3BZC A;  3G71 B;  4ZYS A;  1Q86 C;  3Q6S A;  1CQV A;  2C9O A;  3E9H A;  5HGT A;  5B6I A;  2QMU A;  4XR6 A;  1H9S B;  3OWE B;  1HFG A;  1OGJ A;  4IZ8 A;  1PYB A;  4LF9 Q;  1WOS A;  4XT1 B;  2R7Z G;  2RBM A;  3M3Y H;  1PFS A;  1NR4 A;  3HOV H;  1PZK D;  1T6X A;  1E64 A;  3NE5 B;  1PH5 A;  5GAG C;  4Z4V A;  2JA7 B;  1TWF B;  4B3R Q;  3ERS X;  5C0X G;  1VJS A;  1PTO C;  2B2U A;  2GPJ A;  3JAM c;  3ISX A;  1E63 A;  3GDE A;  1G7C A;  2A6E D;  1Q8K A;  1QUQ A;  5FLM G;  1YLO A;  3A8K A;  1HTL D;  5EQ0 A;  1K3R A;  4C3J G;  1VQ6 B;  5HUR A;  3U58 A;  4XON A;  1GJX A;  2KJX A;  4X62 L;  2VNH A;  4DR2 L;  4X6A H;  3D0F A;  1AN8 A;  3AVW A;  2QDL A;  3M4Y A;  4E6I A;  1KC8 D;  4C3H G;  1N0V C;  4DR4 Q;  3AVX A;  4M8A A;  4C3I B;  3OFN A;  4G57 A;  1TXY A;  3HOU B;  4JI2 Q;  4DU9 A;  3EFX D;  3T53 B;  4A93 G;  2V7T A;  3KBX A;  3VNU A;  1EP1 B;  1SFO H;  1CSQ A;  3J80 c;  2A19 A;  2C5C A;  5IGE A;  1K3B C;  2CVR A;  1YHQ B;  5M5Y H;  3CCU A;  5CV5 A;  1PH6 A;  1QGY A;  4FVM A;  1YNN C;  2VBS A;  1VF5 C;  2NBF A;  4XN0 A;  3TP8 A;  5BN4 A;  4NNJ A;  3U50 C;  1Q1E A;  2Q8R E;  3A56 A;  3BDL A;  1SYF A;  4B3X A;  3PO3 B;  1DOL A;  3BVG A;  2F0G A;  4KK7 A;  1IL8 A;  3BCD A;  3PVD A;  1EYC A;  3HG9 A;  3AB9 A;  2B2W C;  4EQN A;  3ONA B;  4YWK A;  1EZ8 A;  1S72 A;  3HFZ B;  3T51 B;  4CDD C;  4DV2 L;  3UDI A;  3IFD A;  4PZ8 A;  3S24 A;  2UUC L;  4FN5 A;  3W1B A;  1EOT A;  4Z9C B;  3FMC A;  4GNX C;  4GN4 B;  2EYH A;  1X3E A;  1R4Q B;  4UAI A;  1R9T B;  3JAM L;  2F3W A;  2DIE A;  3J7Z C;  3BQJ A;  4A3D H;  3E3X A;  4ZGQ B;  1YJW B;  1KXL A;  3JQR A;  1RHP A;  5C3E B;  1SE8 A;  2F0L A;  2R7F A;  5C0X J;  2MO0 A;  1WTX A;  2VQE L;  5IP7 G;  2VL6 A;  4IUU A;  2N3S A;  3KK7 A;  3K5L A;  4KHV A;  1PJ7 A;  5GAE C;  2V7X A;  4ZK9 B;  1PZI D;  2OXP A;  2Y0S G;  4C43 A;  1G7R A;  3OEH A;  3GVL A;  3P75 A;  1PTO F;  3VR4 A;  3ERO A;  2L9H A;  5A2Q E;  3TME A;  1VQK A;  3RZO H;  1STG A;  1QUF A;  5DAU A;  2K1B A;  3I7F A;  5GAH C;  1HFN A;  3J80 L;  3I55 B;  4ZCL A;  1W2B B;  1WTQ A;  1BMF A;  4LFA Q;  2B63 H;  3HOX G;  4OPO A;  3ZIA A;  3U4V A;  3K57 A;  5J39 A;  3CCJ A;  4JYA L;  5C4Z A;  5EMN A;  4OWW B;  1MSG A;  1QX4 A;  1NMF A;  2BMW A;  3AMU A;  3MZ5 A;  3MFY A;  4RWS C;  1LM0 A;  2X6Y A;  2DUD A;  4BXX H;  2CRV A;  2PW5 A;  1B23 P;  5M3M H;  2PW7 A;  4JI1 L;  1MI2 A;  2L12 A;  3VR5 A;  2K03 A;  1TWG H;  2VB3 X;  2VBV A;  1KDB A;  1TS3 A;  1F77 A;  4EH1 A;  2I46 A;  1UD4 A;  2RVL A;  3D26 A;  5C3W A;  3FDT A;  4QUZ A;  3WND A;  1B3A A;  1W34 A;  2WYR A;  5KNL A;  3CQZ H;  3FPU B;  2R7Z H;  4TMV A;  1NTG A;  2VZA A;  3C3L A;  1PYS B;  4XLF A;  4YEL A;  3SR1 A;  3M4Q A;  1EUJ A;  5JAV A;  3VYT A;  2VZL A;  4Y7N H;  2ZZQ A;  4K14 A;  1SE2 A;  2QKI C;  3A0J A;  4OXP A;  1QVG A;  2D0O A;  3K7A H;  1VQH A;  5AJ3 L;  1GUO A;  5FLM H;  1GHK A;  1ML0 D;  1WOP A;  1L0W A;  3L2P A;  4GKJ Q;  2KVM A;  1JB7 A;  2K75 A;  2ICE C;  5TY0 A;  4KY7 A;  4BWG B;  1Q82 C;  4JYA Q;  4PC3 A;  4X7F A;  1A62 A;  2X6X A;  1JWM D;  1GR1 A;  4C3H H;  4IQZ A;  3CCU B;  1GD7 A;  1VQC A;  1JOQ A;  3W2F A;  1L2F A;  4H9G A;  2AWN A;  4QY7 A;  3SLN A;  3OP1 A;  4A93 H;  1LT3 D;  4HE5 A;  1UE6 A;  1JA1 A;  1UMK A;  2IPK D;  2ZXO A;  2CW0 C;  2F0P A;  1MSH A;  1F2Z A;  4Y9R A;  1XMQ L;  4LBW A;  4QF4 A;  3SE0 A;  5IT9 L;  2R93 H;  3OMG A;  3OYY A;  3PSI A;  1DD2 A;  1VQ4 A;  1B50 A;  3NWS A;  2GK6 A;  3BCF A;  4KMU C;  2MNA A;  1LTS D;  1KDA A;  1TWC B;  4L5R C;  1G2T A;  1S72 B;  4OWT B;  5KGU A;  3AVU A;  1PJ5 A;  3LNN A;  5JEA G;  3TQY A;  1K8G A;  4K5V A;  1PRT F;  2RCF A;  4EQP A;  3SK5 A;  5AJ3 Q;  4CBV A;  4HSP A;  3NBH A;  4V19 0;  2F43 A;  1Q7Y D;  5G3L D;  1Y1W G;  4BY7 B;  4Z4Z A;  1HUM A;  4YIJ A;  4YHH L;  1WSR A;  3K80 C;  2JA6 G;  4C3J B;  5DEH A;  1A8V A;  2MHV A;  4JV5 L;  2J7K A;  3RZD H;  4PC6 A;  3GTK H;  4LFB Q;  5F4M A;  3TBI B;  3O13 A;  3Q0A A;  5BR8 L;  3IKJ A;  1J8I A;  2A5H A;  2WIN B;  3RMH A;  4WJW A;  4A4I A;  2N49 A;  1VQ7 B;  3NP8 A;  2DYI A;  5FO8 B;  4DFA A;  1VQK B;  2GJK A;  1STH A;  3U2Q A;  3PO2 G;  1GAW A;  5FOB B;  3B78 A;  2JN9 A;  2K04 A;  1GUT A;  1KD1 D;  3VA5 A;  3CCJ B;  1HZ9 A;  2IX3 A;  3EIV A;  1TWA B;  2Z6K C;  4X7E A;  1S5B D;  4Y9U A;  1NJI D;  3SJP A;  1STB A;  4IAL A;  1ELO A;  2PZT A;  3DHQ A;  4UPA A;  2Z6B A;  4YEJ A;  2ZIT A;  1CHP D;  2NZO A;  4JI7 L;  3CME B;  3KFU A;  4DR5 L;  2HDM A;  3KF8 B;  2E2J H;  4DR7 L;  2E2I H;  2IWH A;  1EWI A;  4HE6 A;  2CKZ B;  1QFY A;  2Z8L A;  2R6H A;  3KLS A;  2ICI A;  1DG1 G;  1WU8 A;  3OSO A;  4WZK A;  4MNO A;  3VYR A;  4YAL A;  3PUW A;  2OQ0 A;  2TSS A;  1S0U A;  1EFU A;  5A89 A;  3H3V C;  3G4S A;  3QWN A;  1S4M A;  4DQK A;  3L0O A;  3T1H L;  3X3M A;  1NAP A;  1N34 Q;  1E22 A;  1H9R A;  5C3X A;  1CKO A;  2K5W A;  4HJ9 A;  3I4M G;  4AIM A;  4POF A;  1B70 B;  4X3T A;  1VQ9 A;  1BKB A;  1R5O A;  4HTH A;  1Q86 D;  2KVO A;  2DNC A;  3PIP 3;  2DER A;  2V31 A;  1NBW A;  2XNA C;  5JEA J;  4II3 A;  1EFR A;  3S1R H;  3HKZ E;  2JIZ A;  3NXW A;  4RCO A;  3NBI A;  3ZZU A;  3S2D B;  4XKW A;  1LAB A;  1XE1 A;  3I4O A;  4PG3 A;  1JR0 D;  1HTP A;  1PTO D;  2CND A;  1WP6 A;  4BY1 H;  4Z4W A;  2D2C C;  1M4V A;  2Y0S B;  4P22 A;  2WFW A;  3S16 H;  3GTL H;  3RD4 A;  3TS0 A;  3CTA A;  1BCP F;  2GK7 A;  5IP9 G;  3J81 i;  4DR1 Q;  4DR7 Q;  1CUK A;  2K32 A;  2BV3 A;  1YIJ A;  1X9N A;  3M4O B;  1JWU D;  2ZXP A;  5M5X H;  1VQP B;  4G7X A;  3TEH B;  3F8T A;  4BBR H;  1OXV A;  4JI5 Q;  4JI0 Q;  1K0R A;  2KHJ A;  2A68 D;  3HOX B;  4R71 A;  1VQ4 B;  2HIV A;  1T6Y A;  2ZXH A;  3I56 A;  1WTW A;  3W2I A;  3F2B A;  2K5N A;  1ZEQ X;  1HCZ A;  4AQY L;  1WD0 A;  3QJY A;  3LX0 A;  1CKN A;  1E3P A;  2IHE A;  2QIL A;  3FHW A;  1KK3 A;  3NBH B;  4APV A;  1IJE A;  5C44 B;  2WPD A;  1BXT A;  4P75 A;  3CRK C;  2C2W A;  1W87 A;  1YNN D;  3LWU A;  3J7A 5;  2XGT A;  1RL2 A;  2P5Z X;  3CP0 A;  1GM5 A;  3ERQ A;  1TU2 B;  2ATW A;  4IPG A;  4LF7 L;  4LUV A;  2M2L A;  1Z6H A;  3OMC A;  1O7Y A;  5AFW A;  5JEA H;  1IKM A;  4QJF A;  4J6H A;  3PGZ A;  2QTL A;  3S17 B;  1OGI A;  2OF1 A;  1V0F A;  3WDN A;  2K6A A;  2CQO A;  4XNF A;  3RNU A;  1GVH A;  4RCN A;  2VB2 X;  4ULL A;  5I2X A;  1Q1B A;  2VNJ A;  5KND A;  2PPB C;  3S14 H;  3WNB A;  3D8G A;  4J15 A;  2JA6 H;  1P16 A;  4X66 Q;  3H09 A;  1OB2 A;  1CZG A;  3GTQ B;  3W5V A;  3LGJ A;  5IYQ A;  3UDF A;  4ZUI A;  2D9U A;  3GTM H;  5F2D A;  3PIO A;  1TS4 A;  3KEW A;  1E24 A;  1HQR D;  2JXM B;  4DV1 L;  4AQY Q;  3GSI A;  1TWH H;  4NCN A;  5E1F A;  2ZJR A;  2L5T A;  5FJ8 G;  2KHS A;  4Q0F A;  2IX1 A;  3H3V I;  2OK7 A;  4IN3 A;  5CBA E;  1D5Z C;  2O5J C;  1E79 A;  2HUG A;  2VQF L;  1N32 Q;  4ACB A;  2E74 C;  4XQF A;  2PQA A;  3KF6 B;  4XQN A;  3PO2 H;  1WCM G;  4FF3 A;  1TII D;  1UD5 A;  1KRH A;  4XLH A;  4H0L C;  1GUN A;  1K8A C;  1AZQ A;  5ELD A;  4OO1 I;  4LK1 C;  2GVB A;  2IT1 A;  1I3Q B;  3DWQ A;  1H8H A;  1B9N A;  1HZB A;  3C1F A;  1EIY B;  5H59 A;  2NVT H;  1U4M A;  1HQM C;  1NUC A;  2F0Q A;  5IYC H;  1QOH A;  3S15 H;  1COW A;  4PC2 A;  5IGF A;  1GVP A;  4K0K L;  1TS2 A;  5CR3 A;  3Q39 A;  2N88 A;  4OON A;  2EDG A;  2JJ1 A;  4IPH A;  4TRD A;  1VQ9 B;  2HLD A;  3PV0 A;  2F0W A;  4G4K A;  3D4R A;  2C4U A;  4EVO A;  1PA6 A;  3WQZ A;  2CW5 A;  2X69 A;  1DYQ A;  3VYU A;  2RDG A;  1QE6 A;  4KY6 A;  1IBK L;  2HHH Q;  1PH8 A;  5COR A;  4POG A;  4DV3 L;  4CQJ A;  1E43 A;  1VQ5 A;  3FKI G;  5ELC A;  3GTO B;  4DV1 Q;  1ROD A;  2ZTG A;  1EFI D;  4DV6 L;  3NEN A;  2D0P A;  1YNJ D;  1SNQ A;  4XDX A;  4P26 A;  2RCN A;  3OOC A;  3LQ6 A;  2WAQ B;  3WWV A;  4MN3 A;  3I4M H;  2PNH A;  2VQF Q;  1EQR A;  3HOV G;  3NTI A;  3TRE A;  1D1K A;  5DSZ A;  1D2E A;  3SK6 A;  3R6K A;  2K7V A;  1YHB A;  4OIK A;  2JJ2 A;  1Z47 A;  1I5F A;  1B2R A;  3MEF A;  1LLR D;  1FNB A;  3I90 A;  3BVM A;  3KOJ A;  5TSS A;  3G71 A;  4RPD A;  1TVX A;  4J1M A;  1CI3 M;  1YVC A;  2NYZ D;  4LNQ A;  4A3G B;  1SYB A;  1EYD A;  2QA4 A;  4LF4 L;  2YTX A;  1VMP A;  4DN4 M;  2XNJ A;  1YHA A;  4AF6 A;  1VQD A;  5M5W B;  5IP9 H;  1I50 B;  1HZE A;  4N8X 1;  3BH4 A;  1Q82 D;  2EOT A;  3H3V H;  1P4M A;  2DGY A;  4QUC A;  1CKN B;  1FGU A;  4UP9 A;  2JK8 A;  4A3I G;  5JJL A;  1BPL A;  2ZXI A;  2NVQ B;  5C5L A;  3BYT B;  4L6T B;  2AUK A;  4P71 A;  4DV3 Q;  1XNQ Q;  4OO1 H;  1H8E A;  1VQ6 A;  1PMR A;  5I6Y A;  3S1N H;  4IUR A;  2CW0 D;  3TP7 A;  1TLL A;  3CRL C;  4HCE A;  4JCV E;  3GV3 A;  5DN6 A;  1I94 L;  2WJV A;  2YV5 A;  2J4X A;  3QFS A;  3ASQ A;  4OEL B;  1EL0 A;  2ZBU A;  3KJP A;  1DAR A;  1CNE A;  3CKI B;  2QEJ C;  4P1V A;  3CAM A;  1E2V A;  1XX8 A;  4JC0 A;  2RHQ B;  1VLO A;  4MIU A;  4LF4 Q;  2XND A;  2RSN A;  4RD3 A;  2F1L A;  3B6Y A;  3UDG A;  4X0C A;  1SYG A;  1K73 D;  1N9W A;  4UAJ A;  5CDF A;  2B2U C;  1VQB A;  2JEA I;  2OYN A;  2Z9H A;  4KKU A;  5IYN A;  3HOW B;  5I9P A;  1I4X A;  5J35 A;  1X6O A;  4ZQ3 A;  3I3C A;  3MAQ A;  1HA3 A;  4A3D G;  4DAP A;  4XMY A;  2RF4 A;  3S2H B;  1UAP A;  3CU7 A;  2MO1 A;  1SM4 A;  1EZ6 A;  4OHJ A;  1WVL A;  4A3B H;  4A3F B;  2PLF A;  2TMP A;  2L4N A;  3EA6 A;  2VS1 A;  3J7A V;  1Z7T A;  4XM3 A;  4FF4 A;  4HJ7 A;  1EP2 B;  3S1M B;  4A3E G;  3TS2 A;  5FJ8 H;  1I94 Q;  1H85 A;  2B8F A;  1GOZ A;  2XWB B;  2XGJ A;  2F0U A;  2YTY A;  1M1K C;  4B3R L;  3A54 A;  1YJW A;  3W5H A;  2FHT A;  4JG2 A;  1QZH A;  2WB1 B;  3QIA A;  1W6K A;  2E1B A;  4DV5 L;  2V4D A;  1E3X A;  4FF1 A;  1IB0 A;  1I4P A;  2B2Y A;  5E3F A;  2C78 A;  2VUM B;  4FF2 A;  2A8V A;  4Q7J B;  1BQQ T;  2B63 G;  2PIA A;  3BZD B;  1NR2 A;  1X3F A;  1FVI A;  4RD2 A;  3STB C;  4YCV A;  4DV0 Q;  4DNT B;  1HXY D;  3AVY A;  4DR4 L;  1TS5 A;  1WOO A;  5C4J B;  1R5B A;  1EIG A;  2R9V A;  4UP8 A;  1PH4 A;  3MMP A;  3DWA A;  4I65 A;  2X85 A;  1AE3 A;  1GO3 E;  2XEX A;  4F7D A;  3T13 A;  3KDF A;  3JAM E;  4XYQ A;  1F9P A;  3FKI H;  3K5M A;  1XTD A;  4XT3 B;  5FO7 B;  3C2Q A;  1SN8 A;  2Q6I A;  2QA4 B;  2DY7 A;  2WSS A;  2BSA A;  4KN7 C;  4B43 A;  1A2T A;  4QIW B;  3BDC A;  1EIH A;  3HGB A;  4IOC A;  2F0T A;  1DGS A;  1WCM B;  2BE5 D;  4TSS A;  4LUO A;  3HRZ C;  4DV5 Q;  1VQF A;  2ENB A;  4HIK A;  4U9U A;  4DV7 L;  4LC0 A;  1FX0 A;  3EJI A;  4ID6 A;  1T9H A;  4WWV A;  3OIP A;  1I4H A;  4J8Q A;  3N52 A;  2EFG A;  2LS0 1;  3J80 E;  1I18 A;  5CV6 A;  1D2B A;  5I2Y A;  1NDH A;  3BG3 A;  5FLX c;  4HJ8 A;  1ENC A;  4X65 L;  3N6R A;  1K83 B;  2ALY B;  1FRN A;  4A3I H;  1BX1 A;  4QQB X;  1V43 A;  2PO4 A;  2B2V A;  5BN3 A;  1PH3 A;  1FDR A;  3D4D A;  1NMG A;  3K58 A;  4HMJ A;  2M00 A;  1KRT A;  1X65 A;  2FMC A;  4IUT A;  3A1P A;  4JMQ A;  3TP5 A;  4B3T Q;  1U5K A;  2A6H C;  1H42 A;  3CC7 A;  2CC2 A;  4DAY A;  2R93 G;  1CHQ D;  2E2H B;  1ZXT A;  1HZA A;  1X56 A;  4RFB A;  3CCR B;  1LTT D;  2JA9 A;  2DJG C;  4WZT A;  3ULL A;  3M3Y B;  3HOV B;  2ZL6 A;  1N0U A;  2F0H A;  2ZXR A;  1KTK A;  1ZYR C;  1SNO A;  1KZL A;  1D1I A;  4DV7 Q;  3C1E A;  4LWC A;  2DCU A;  5FIU A;  4PQX A;  4JOI A;  1V1Q A;  4V0B A;  1WJJ A;  3OWF A;  1QG7 A;  1TQO A;  2A1A A;  4LFA L;  5E4W C;  1E3Z A;  3VMF A;  1A2U A;  3ULJ A;  4K8J A;  2BGJ A;  4I7A A;  4X65 Q;  2FX3 A;  5IWA Q;  3OZV A;  1IZ6 A;  4DNI A;  4WZE A;  2FMM A;  5IYB H;  3ASP A;  1A8P A;  4II2 A;  4YWL A;  2X53 S;  4TVA B;  3M9B A;  5IY0 A;  1DON A;  2EXD A;  1UE5 A;  1UD6 A;  2OBT A;  2K52 A;  5KIX A;  1EY4 A;  1VDZ A;  2MPM A;  3DEP A;  1SFO B;  2JA5 G;  4C2M H;  2HCI A;  1A63 A;  3TRZ A;  3DLL A;  5LMU L;  1UUP A;  5DNF A;  5M5Y B;  1H9K A;  1TR5 A;  3D6W A;  3MC0 B;  1TTT A;  5IT9 E;  1E1O A;  4A3E H;  1KTV A;  5FLX L;  4RA8 A;  4G1B A;  1G51 A;  4X05 A;  4KD4 A;  2LSS A;  4OPV A;  3F2U A;  5ISR A;  4ZGN B;  1PRT C;  1BNZ A;  2EVB A;  3RLN A;  2NTS A;  1VQ7 A;  1SMY C;  1TVC A;  2BPO A;  1K8A D;  3LWE A;  4JI8 L;  2EIF A;  1IYU A;  1SRU A;  1A6X A;  2KCM A;  2ZTN A;  3A8K E;  3D6C A;  3I4N G;  2K5V A;  3A7A B;  4B9W A;  1EOV A;  3GTJ H;  2YU9 H;  2MUY A;  4ME3 A;  3KDF B;  4GKJ L;  1SJH D;  5A88 A;  1WTP A;  2C77 A;  4X7C A;  2OBS A;  1X3G A;  4WRD A;  1V1O A;  4RMF A;  1EP3 B;  1VCI A;  1PJ6 A;  3VO2 A;  5E4X A;  4EQ5 A;  1EQQ A;  2QN6 A;  1SEB D;  4MZ9 A;  3TN2 A;  3CME A;  1UEB A;  3PUV A;  2BCO A;  4A3M G;  3KF8 A;  1RQP A;  5FO1 A;  2ZZF A;  4BPR A;  1WOC A;  4DV4 L;  2VNU D;  4A3D B;  3PUY A;  3CW2 A;  4X06 A;  3PMF A;  5L46 A;  1DOM A;  4G7W A;  4YAW A;  2X6W A;  5LMU Q;  1E2W A;  2NB0 A;  3FPK A;  2WV6 D;  5CMD A;  3A5U A;  1EYG A;  2F0I A;  4RAU C;  3QR8 A;  5KNC A;  2I0Q A;  4ZKB B;  3T16 A;  5IGB A;  4EX5 A;  2LY7 A;  2EIX A;  3AYH B;  2A69 C;  4BY1 G;  2EYM A;  1V5V A;  3UE0 A;  4JI8 Q;  2HIX A;  2Q8T A;  4QVA A;  1KQS B;  2RQX A;  4QUF A;  5A8A A;  1SLJ A;  2I1L A;  3FPP A;  3ZZT A;  1IHZ A;  1MAB A;  4XN3 A;  1QNK A;  3W5U A;  2N8N A;  1RKN A;  3OIQ A;  1IBM L;  3RZO B;  3WBJ A;  3LO8 A;  1WYD A;  1S5C D;  4RKL A;  4DR3 Q;  1ASY A;  4ODG A;  1UE1 A;  5C4X H;  4RCY A;  4YCW A;  2EYJ A;  3ICE A;  3MEH A;  4BBR G;  1EU4 A;  1U9R A;  3CC7 B;  2B63 B;  4DUY L;  4DAY B;  4A3K G;  3CCL A;  2OCE A;  1ASZ A;  3DEO A;  4A3C H;  4LFB L;  4AF7 A;  4WJ4 A;  1OXT A;  5J1Z A;  3CF5 A;  2CWP A;  3GTP H;  4DV4 Q;  1EFW A;  3GO5 A;  2F0J A;  1BBX C;  2F0D A;  1SE4 A;  5M3M B;  3AGQ A;  2BH2 A;  1VQP A;  3S9W A;  3AST A;  1TWG B;  3SEB A;  1ICF B;  4L8J A;  4PMW A;  2D3L A;  1PTO H;  2B2T A;  1QWY A;  3IL8 A;  2E2D C;  1IJF A;  2YYZ A;  3CXC A;  1AH9 A;  2K28 A;  3CQZ B;  2R7Z B;  1YEZ A;  4ME5 A;  4DAM A;  5I6W A;  2R7D A;  5DM6 3;  1EY5 A;  4DR6 L;  1BCP C;  2NVY H;  4AYB G;  1N8R C;  4Y7N B;  1IBM Q;  1B4O A;  1NE3 A;  3W5O A;  3K7A B;  1CTM A;  1XMO Q;  1PFB A;  1G6Z A;  3LQE A;  2I5H A;  3MWY W;  1Y69 U;  5ELB A;  3F2D A;  1XPO A;  4DUY Q;  4O0A A;  4P2C B;  2NV4 A;  1RIP A;  4WOR A;  1C8C A;  1CNF A;  5JVH 3;  1D7Q A;  2W6J A;  3M4P A;  3QFR A;  1VQE A;  2G9H D;  1XYI A;  1HRJ A;  1BJK A;  4C3H B;  1N33 Q;  1VMC A;  3R2T A;  2ZJQ A;  3A8J A;  1JT8 A;  1STA A;  2IX0 A;  3SGI A;  4A93 B;  1N34 L;  3Q38 A;  4L5T A;  4JBW A;  3CPW A;  3RN5 A;  2XZP A;  2PE3 A;  5IYP A;  5IOC A;  3CC4 A;  2SOB A;  2JA5 H;  5ELO A;  5TV2 A;  3SK8 A;  2EY1 A;  1ZM2 A;  1ICW A;  4I7Z C;  3SDZ A;  2R93 B;  1WFQ A;  2CBX A;  1RF2 D;  2YWF A;  4PC7 A;  1WPC A;  1ENA A;  2UU9 Q;  4LBV A;  1KLU D;  4CJ2 C;  4NXN L;  2RC6 A;  1BVS A;  4XL9 A;  4DR6 Q;  1M1K D;  1RQR A;  4DXG A;  1G2S A;  3J81 k;  2RDH A;  2X0K A;  4X64 Q;  1OHH A;  5IYC G;  1BF4 A;  4H02 A;  4GLX A;  1VHO A;  3J81 c;  3KF6 A;  1QCB D;  3FRP B;  2IJ0 A;  3I4N H;  4GQN A;  4DR1 L;  4G6I A;  1SYD A;  1OXU A;  2EZV A;  1KK0 A;  2SDF A;  3KLW A;  3H91 A;  2EYL A;  4FDB A;  4JI5 L;  1R5N A;  3STB D;  4JI0 L;  2Y0S E;  5CV8 A;  3Q3A A;  3RZD B;  1STY A;  1V1P A;  4HCS A;  5IGC A;  3GTK B;  3A3B A;  1Z9F A;  5D3D A;  1HUN A;  5I9O A;  4G7H C;  1O78 A;  2BM1 A;  3EVQ A;  3DUZ A;  1M90 C;  5TR9 A;  1VQ8 B;  3PUX A;  2OEO A;  4A3M H;  4KI0 A;  3RY8 A;  3NQT A;  5JJZ A;  3IFT A;  1EFC A;  1UEA B;  1GHJ A;  3I70 A;  4P74 A;  5M3F G;  3MCA A;  3J81 j;  4RGT A;  2EJG C;  1SRO A;  5J22 A;  1QH0 A;  4K1X A;  4WQM A;  1OB0 A;  1GJR A;  1VQO B;  3QE2 A;  3F1Z A;  4NXN Q;  2F0F A;  1K28 A;  3I72 A;  1EIF A;  4KLK A;  3CCS B;  4NMZ A;  2PZW A;  3CCL B;  3ASS A;  1HNZ Q;  4LW1 A;  3SXH A;  2ZJP A;  1FL0 A;  1JJ2 A;  1SND A;  2JP1 A;  1CFM A;  4RDL A;  4JW0 A;  3CMM A;  5IOD A;  2B8G A;  1KK2 A;  4OOX A;  1BOS A;  5C4H A;  2Q2T A;  3S1Q H;  4N8F A;  2E2J B;  4PZ7 A;  2R92 G;  2E2I B;  2EE1 A;  3NEL A;  3OKX A;  3D4W A;  5JPM C;  2C35 B;  2ZZG A;  2F0S A;  3WXM A;  2Z4H A;  4GNX B;  4X66 L;  4FNF A;  2PCF B;  2QEX B;  4A3K H;  2XTI A;  2GA4 B;  2ZM6 L;  3A8J E;  2Q8I B;  1DXM A;  2D5D A;  3NTH A;  4CKB A;  3CXC B;  4HJ5 A;  4YY3 L;  4QFM A;  5GV7 A;  2BA1 A;  1VF7 A;  4P3I A;  3G6J B;  1JMC A;  3RUZ A;  2JN4 A;  2NTT A;  2EXZ A;  4CJ0 B;  1AE2 A;  2N55 A;  1SNM A;  1EU3 A;  3VA7 A;  2A6H D;  5FKA C;  1VQL A;  4IUN A;  3P7J A;  2F0V A;  3J81 L;  2Q6L A;  1KC8 C;  2VXW A;  3OW2 A;  1SR3 A;  3BJU A;  1N32 L;  1FNU A;  1P8L A;  3JC6 6;  2OTL B;  3UI2 A;  3S1R B;  4PGO A;  1W35 A;  1WSV A;  4KY5 A;  2F4N A;  3PQI A;  4MTK A;  2BF4 A;  4BY1 B;  2QDB A;  3OJX A;  1ZYR D;  1JNY A;  4TMZ A;  3ZYY X;  1QFZ A;  3A3G A;  1LTB D;  3S16 B;  5E7N A;  3GTL B;  1N07 A;  4P72 A;  3I91 A;  1LUZ A;  2WAC A;  4CHT B;  2DNE A;  1T5X D;  4JI6 L;  3C46 A;  3CPW B;  4IOA A;  4DK6 C;  4TSF A;  5M5X B;  2E1R A;  4PAA A;  4KD3 A;  3CC4 B;  4F7X A;  4BBR B;  1LT4 D;  2EJM A;  4KV6 A;  1ZM4 A;  1H95 A;  2ZM6 Q;  2JA8 G;  3WOE A;  2HHH L;  1IYJ B;  2F3I A;  4UDU C;  4YY3 Q;  2IHF A;  2ZTC A;  1BQE A;  1O7L A;  4GS3 A;  1JWS D;  4A3B G;  5CV7 A;  4XQJ A;  2A73 B;  4R8N A;  4R4C A;  4XOP A;  1L1O A;  2C5B A;  1MD2 D;  1LTI D;  1G91 A;  4OO1 G;  1W0K A;  4NBS A;  3RN2 A;  2YTV A;  3PA2 A;  2X6L A;  1QVF A;  3CCV B;  1SE3 A;  4WFN 3;  4KJO A;  5H5J A;  2F3V A;  4MHE A;  3CP2 A;  1ET6 A;  2V7W A;  3CMA A;  4ACA A;  3DM1 A;  3H0G G;  3QOJ A;  4EQO A;  4WJ3 M;  4UHV A;  2OTJ B;  1PRT D;  3W1G A;  2WAQ E;  4B3F X;  2BM0 A;  1A0I A;  1SMY D;  1V1P B;  5FK9 C;  4IUV A;  1S4Z A;  2QTZ A;  4P3Y A;  4ABN A;  4AYB B;  4OOS A;  4JI6 Q;  2L15 A;  2ZBV A;  4KHP Q;  4BBS H;  5GQO A;  2JA7 G;  3AU7 A;  1CZW A;  3AEV A;  3RLO A;  1Y1W B;  2XOK A;  3MHP A;  3E9I A;  4QGU A;  3S14 B;  2PMZ B;  1GUG A;  2R61 A;  2LFN A;  2JA6 B;  3BZK A;  3BDO A;  3CC2 A;  5THX A;  3OAA A;  2F0M A;  5KYI A;  1IYV A;  3V76 A;  2F4I A;  2ZT9 C;  4HR7 B;  2QF7 A;  1A15 A;  4LUZ A;  4IJH A;  2K01 A;  3GTM B;  1XNQ L;  1NNX A;  1KAW A;  3I4L A;  4NB3 A;  5T1I A;  1X3Q A;  5IYW A;  4LF5 Q;  4RJL A;  1TWH B;  4ZCM A;  1AEX A;  5EGT A;  4M2L A;  1JJ2 B;  5FO0 A;  1Y8P B;  1HZC A;  2XRQ D;  5E6T A;  4C3I G;  3GIR A;  2JDI A;  1AMO A;  2GN5 A;  5M3F H;  4A3L H;  1PVO A;  4GN3 B;  3HOU G;  1G6P A;  1BBU A;  3A74 A;  4KTA A;  3E6Z X;  1I7P A;  5DM7 3;  1JC7 A;  3PO2 B;  1FJG Q;  2KBN A;  1I4R A;  4KJN A;  1RDP D;  5GV8 A;  1QFJ A;  2A69 D;  5ELN A;  3DDY A;  3P1H A;  5D3I B;  1IXR A;  1GO2 A;  4TQU S;  1TKW B;  3T1Y Q;  1U4R A;  2NVT B;  2HT1 A;  4IPD A;  4RD0 A;  2AHO B;  2VNI A;  2B39 A;  2NZH A;  4YAO A;  3S15 B;  4HSV A;  1I6H H;  4P2N A;  2JJQ A;  2Z0S A;  5CV4 A;  4YAU A;  3HOZ H;  3R93 A;  1NB0 A;  3MXN B;  4HMI A;  2R92 H;  1VQL B;  2B2Y C;  2Z6B D;  1GUW A;  2O5I C;  3Q8D A;  3OW2 B;  3K6O A;  3UDX A;  4JBJ A;  2AQ3 B;  1F2L A;  1XQB A;  3HP3 A;  1MRZ A;  3SKB A;  2RKS A;  4JK1 C;  4Z4R A;  5KSW B;  2M9V A;  3OTO Q; 
#chains in the Genus database with same CATH homology
 3FVQ A;  4FXD A;  3URY A;  1SDF A;  3QO2 A;  3TP6 A;  1JCK B;  3I4M B;  1I4Q A;  1F9S A;  1BO0 A;  4G7O C;  1HA5 A;  4LAA A;  1KMH A;  3DWP A;  2AUJ D;  4R8I A;  2LKV A;  2QE7 A;  1BCP D;  5EPL A;  4CJ1 B;  1GUS A;  2XRS D;  1ZKO A;  1IW7 C;  1EY0 A;  4BA2 I;  1FR3 A;  1UD3 A;  5JOB A;  2WKD A;  3MXU A;  3KLS X;  1W6J A;  1KAB A;  2NWG A;  4QCL A;  3BC9 A;  2GJR A;  1U4L A;  1PFM A;  3JU4 A;  3S1N B;  4XD7 A;  3NTK A;  2B2V C;  5COY A;  4K2L A;  2CK3 A;  4QB4 A;  5IIF A;  1UD8 A;  3VYS A;  5C5M A;  3DXJ C;  1HVX A;  1LT6 D;  4IFD G;  1F9R A;  1EWC A;  1FD7 D;  4ASU A;  1ONL A;  2MP1 A;  2K5D A;  2AQ1 B;  4CGY B;  5LHY 1;  3ND9 A;  3V2T A;  1BUV T;  5FO9 B;  1ILP A;  4K8I A;  1II3 A;  1JOK A;  4H13 C;  3BS1 A;  2AQ2 B;  1G8Z D;  1EEI D;  2EY2 A;  3U9O A;  1JOO A;  3MTS A;  2BDN A;  1CA6 A;  4A3B B;  5K36 G;  2K5Q A;  3MA2 B;  1OO9 B;  3HS0 C;  4ZAI A;  2VJJ A;  1SAP A;  2MJ8 A;  2KEE A;  2PNR C;  1JE4 A;  3A55 A;  2XN9 C;  4XIG S;  5CYU A;  5FLX E;  3J7A F;  3Q24 A;  2DY8 A;  4KKT A;  3MXP A;  1DM0 B;  4RH6 A;  1D5X C;  3MVV A;  3T56 B;  2SEB D;  3M7N A;  1ESF A;  3NWT A;  1EY9 A;  3KBG A;  5HKK A;  2ID0 A;  1E2Z A;  4FYD A;  4RHR A;  1F9Q A;  3NSW A;  4F87 A;  4PMB A;  4Q5V A;  2J0T D;  4IFD I;  1KNE A;  1LT5 D;  4KHZ A;  2SNM A;  3QB3 A;  4ZRZ A;  3NHH A;  3FKI B;  3P20 A;  2H4O A;  5G3L F;  5KEE A;  3W3A A;  4IFD J;  1MBY A;  4RGN A;  2A68 C;  1H9J A;  1AW7 A;  5ELF A;  1EQT A;  3PUZ A;  2E76 C;  4U67 3;  4ZKC B;  2Z4I A;  1QNU A;  1ILQ A;  3L9A X;  3K0Y A;  4IUP A;  1WTV A;  1FNV A;  1CM9 A;  1B1Z A;  1H9M A;  2O4X A;  1KNA A;  3FKS A;  2J7Z A;  4KN4 C;  2AWO A;  2XIW A;  4A3I B;  4DAV A;  1X32 A;  4EGV A;  1Q8I A;  3I73 A;  1NSN S;  1SKY B;  2R3Z A;  1PDQ A;  3R3O A;  1PXU A;  2XZO A;  2XWJ B;  2EYP A;  2KUM A;  4Z1M A;  2NN6 G;  4K2K A;  1M8A A;  3OPO A;  3TDQ A;  1FYC A;  5LL6 S;  2F0N A;  5C0X I;  1SNP A;  1WTR A;  1W0J A;  2JE6 I;  2GJP A;  3J7Y W;  1PYW D;  1STN A;  1LV9 A;  1AFP A;  4FP5 D;  1W9X A;  4IFD H;  1L0Y B;  2B2T C;  4LJZ C;  3V05 A;  3MHB A;  1WTH D;  1CA5 A;  3FEW X;  4FXK C;  1SXT A;  1QB5 D;  3L7Z C;  2CQA A;  3G05 A;  3GD7 A;  3MFG A;  2MGS A;  2EYF A;  3QG1 A;  2KED A;  1B2T A;  1EY6 A;  5JPN C;  1DZ1 A;  1RD9 D;  1NBM A;  3R2I A;  4C2M B;  2SNS A;  4E0F A;  5K36 H;  2BOS A;  4NP5 A;  2WZP P;  4A3E B;  2EY6 A;  4AVZ A;  1A3V A;  1YNJ C;  3TSS A;  5A35 A;  4H44 C;  2XSC A;  4ILW A;  4XLE A;  3GP7 A;  4K6L A;  3RLF A;  2YU9 B;  3GTJ B;  1IKL A;  2NN6 I;  1O7Z A;  2B2W A;  5IGG A;  5C0X H;  1EWH A;  1GXD C;  3NUC A;  1ESR A;  1KAA A;  3M7G A;  1A3T A;  2W6I A;  2JEB I;  4DK0 A;  2RSO A;  2OT2 A;  5EPJ A;  2DN8 A;  2RDF A;  3NK9 A;  2L0C A;  1LTR D;  3V96 A;  1F2Y A;  2IL8 A;  1RCV D;  1LTG D;  5CV9 A;  2LZJ A;  5BN5 A;  3A35 A;  1U4P A;  1Y8N B;  3PIO 3;  1PLF A;  3NPP A;  4NKL A;  2D62 A;  3ND8 A;  3ZPN A;  5KRU A;  1HHV A;  1FNW A;  5C4X B;  2FJ2 A;  5D14 A;  4H7B A;  1T5E A;  1K8O A;  4XLA A;  3GQB A;  1IW7 D;  3SVM A;  1I6V C;  5JVG 3;  1CT1 D;  5A2Q L;  4OL7 A;  2D3N A;  4FXG C;  1D6E C;  3HAG A;  4NW2 A;  3GTP B;  5ELE A;  1V8Q A;  1FGB D;  1TT2 A;  5CBE E;  4C1N I;  5CC4 A;  5EBC A;  2H1E A;  4RGM A;  1OXS C;  3J81 E;  2I07 B;  1PTO B;  1BR9 A;  4R9W A;  5M9O A;  2G9D A;  2NN6 H;  2VJI A;  2EPB A;  4M1U B;  1JOR A;  5D65 A;  3E0J A;  3OHX C;  1A3U A;  4FXU A;  4X3K A;  2M5S A;  2NVY B;  1D5M C;  1RJT A;  1DCZ A;  1S5D D;  3QOL A;  4XOT A;  4X3S A;  2X8K A;  3CES A;  3R8B A;  2E75 C;  1LO5 D;  2KOL A;  2Z1C A;  4O42 A;  2F0E A;  3E5S A;  5I4D A;  1C4Q A;  4B08 A;  3WOF A;  2KCC A;  1B53 A;  2KCN A;  2F03 A;  1PKV A;  4B9X A;  2EJF C;  2JA5 B;  4OGQ C;  3G7L A;  4QMG A;  3GVK A;  3OW7 A;  1KDC A;  2WKC A;  4ZLT F;  3W2D A;  4PV1 C;  1O80 A;  2EYO A;  1RTO A;  3I4N B;  3KUP A;  4KKS A;  3DMU A;  4S3S A;  3M85 A;  4PMC A;  3Q23 A;  4IUQ A;  2BE5 C;  3GV6 A;  1EEF D;  5EKL A;  2A6E C;  3HEJ A;  1ET9 A;  5EKK A;  5IK2 A;  2WJY A;  2WP8 J;  4A3M B;  3MXN A;  3D31 A;  1CQF A;  1E0B A;  5EKI A;  3H94 A;  4X3U A;  2NUC A;  3OE7 A;  4NDX A;  1PRT B;  4RHS A;  3CP8 A;  1F2M A;  2JSO A;  2EY5 A;  3HKZ B;  2IW3 A;  1G29 1;  4O1N A;  1BLI A;  1E1R A;  5IGD A;  5C6A A;  1CK1 A;  5NUC A;  3S1Q B;  2LMC B;  2K33 A;  5T1G A;  1XWE A;  5EBD A;  4A3K B;  1WD1 A;  1B9M A;  1PZJ D;  3K5N A;  5EPK A;  3TZU A;  4TKO B;  2L11 A;  1EY8 A;  4N9P A;  5KYL A;  3SHL A;  2ZZE A;  2F0K A;  1J9O A;  2PZU A;  2F0O A;  4UZU A;  1X3P A;  1C48 A;  5FL7 A;  2WII B;  1SNC A;  4G7Z C;  2BA0 A;  4XXE A;  2CHB D;  3X3N A;  4OIJ A;  4K5W A;  5K5P A;  1I8D A;  1UNS A;  5LL6 X;  1SYE A;  1AP0 A;  1SBB B;  1WTO A;  1TY0 A;  4DXF A;  2FIN B;  4HIZ A;  4HAE A;  3D3R A;  1Q90 A;  3TZD A;  1OXX K;  4L63 B;  1DOK A;  3U9S A;  3T4A C;  2PYK A;  1BCP B;  1SJE D;  1HPC A;  2HQE A;  4XLC A;  4XOR A;  2KEC A;  1R4P B;  3H6M A;  2KQ3 A;  3NQI A;  1STE A;  2RA4 A;  1AZP A;  3OEE A;  4BBS B;  4XTC S;  1Q12 A;  1TY2 A;  1EQV A;  1K8M A;  4K6D A;  1JQY D;  2X6G A;  4RKB A;  4DK1 A;  4DA2 A;  1LAC A;  1H9S A;  4U68 A;  2KA7 A;  3ITP A;  2XZL A;  1EYA A;  3MXG A;  4HN7 A;  3IAY A;  1S5F D;  4N9T A;  4BS9 A;  4F8M A;  2O2L D;  4B3G A;  2NZ1 D;  5M3F B;  3EQL C;  2R6G A;  1ENF A;  1NRK A;  2V7Q A;  3BVZ A;  1EY7 A;  1XTC D;  4F88 A;  3Q22 A;  1Y8O B;  1HA6 A;  3GVJ A;  1LTA D;  1QJO A;  2PQE A;  4FO2 A;  1V0E A;  4C56 C;  1NCV A;  1K28 D;  3KLR A;  1Q3L A;  1I6H B;  1E1Q A;  3HOZ B;  4RGO S;  4XYO A;  3VR6 A;  1BDO A;  2R92 B;  1S5E D;  1VLY A;  2HCC A;  2NVX B;  4CKE A;  2XVS A;  3GTG B;  5KNB A;  2F1M A;  3L3O C;  3SK4 A;  3HOY B;  2FFK B;  1MGS A;  1QIL A;  4CKC A;  1SYC A;  4XQQ A;  1XXG A;  2L55 A;  5EJW A;  4DGZ A;  3BYY B;  2A74 C;  1DJR D;  4ZUJ A;  4K5X A;  2L1B A;  3K5O A;  4DNR B;  3K59 A;  4LMQ D;  4A3J B;  3A7L A;  5CGK A;  1Y1V B;  1RTN A;  3CHB D;  1SSO A;  4YXW A;  1L0X B;  2JA8 B;  3A8I E;  4HED A;  2HDL A;  2JYO A;  3I8Z A;  2QCP X;  2K05 A;  2BDO A;  4DF7 A;  3VR3 A;  4GZY C;  1JB3 A;  1I4G A;  1UD2 A;  1KLG D;  4C1N K;  1PFN A;  4PNY A;  1B44 D;  4TT3 A;  4BA1 I;  3H0G B;  3VR2 A;  4XKV A;  1JIC A;  3C2P A;  3HZX A;  4ZYS A;  3Q6S A;  1CQV A;  2C9O A;  5HGT A;  1H9S B;  4XR6 A;  3OWE B;  1HFG A;  4IZ8 A;  4XT1 B;  2RBM A;  1NR4 A;  1PZK D;  3NE5 B;  2JA7 B;  1TWF B;  5C0X G;  1VJS A;  1PTO C;  2B2U A;  2A6E D;  1HTL D;  5EQ0 A;  4C3J G;  5HUR A;  4XON A;  1GJX A;  2KJX A;  1AN8 A;  3M4Y A;  4E6I A;  4C3H G;  4M8A A;  4C3I B;  3OFN A;  4G57 A;  3HOU B;  4DU9 A;  3EFX D;  3T53 B;  3KBX A;  2C5C A;  5IGE A;  2CVR A;  5CV5 A;  4FVM A;  1YNN C;  1VF5 C;  2NBF A;  4XN0 A;  3TP8 A;  5BN4 A;  4NNJ A;  1Q1E A;  2Q8R E;  3A56 A;  3BDL A;  1SYF A;  3PO3 B;  1DOL A;  3BVG A;  2F0G A;  4KK7 A;  1IL8 A;  3BCD A;  1EYC A;  3HG9 A;  3AB9 A;  2B2W C;  4EQN A;  3ONA B;  1EZ8 A;  3T51 B;  3IFD A;  1EOT A;  4Z9C B;  3FMC A;  2EYH A;  1R9T B;  1R4Q B;  4UAI A;  3JAM L;  2F3W A;  2DIE A;  1RHP A;  5C3E B;  2F0L A;  5C0X J;  1WTX A;  4IUU A;  3KK7 A;  3K5L A;  4KHV A;  4ZK9 B;  1PZI D;  2OXP A;  3OEH A;  3GVL A;  3P75 A;  1PTO F;  3VR4 A;  3ERO A;  2L9H A;  5A2Q E;  3TME A;  1STG A;  5DAU A;  2K1B A;  1HFN A;  3J80 L;  1WTQ A;  1BMF A;  3ZIA A;  3K57 A;  5J39 A;  5C4Z A;  1MSG A;  3AMU A;  3MZ5 A;  3MFY A;  4RWS C;  2X6Y A;  2PW5 A;  2PW7 A;  1MI2 A;  2L12 A;  3VR5 A;  2K03 A;  2VB3 X;  1KDB A;  1TS3 A;  1F77 A;  2I46 A;  1UD4 A;  2RVL A;  5C3W A;  3FDT A;  1B3A A;  5KNL A;  3FPU B;  3C3L A;  4XLF A;  4YEL A;  3SR1 A;  5JAV A;  3VYT A;  2ZZQ A;  4K14 A;  1SE2 A;  2QKI C;  1GUO A;  1GHK A;  1ML0 D;  2KVM A;  2ICE C;  4KY7 A;  4BWG B;  2X6X A;  1JWM D;  4IQZ A;  1JOQ A;  2AWN A;  1LT3 D;  2IPK D;  2ZXO A;  2CW0 C;  2F0P A;  1MSH A;  1F2Z A;  4QF4 A;  3SE0 A;  5IT9 L;  3OMG A;  1DD2 A;  1B50 A;  3NWS A;  2GK6 A;  3BCF A;  4KMU C;  1LTS D;  1KDA A;  1TWC B;  1G2T A;  5KGU A;  3LNN A;  5JEA G;  4K5V A;  1PRT F;  4EQP A;  3SK5 A;  4CBV A;  4HSP A;  3NBH A;  4V19 0;  2F43 A;  5G3L D;  4BY7 B;  1HUM A;  4YIJ A;  4C3J B;  5DEH A;  2MHV A;  3TBI B;  3O13 A;  3Q0A A;  3IKJ A;  1J8I A;  2A5H A;  2WIN B;  3RMH A;  4WJW A;  3NP8 A;  5FO8 B;  4DFA A;  2GJK A;  1STH A;  5FOB B;  2K04 A;  1GUT A;  3VA5 A;  2IX3 A;  1TWA B;  1S5B D;  1STB A;  4IAL A;  2PZT A;  3DHQ A;  4YEJ A;  1CHP D;  2HDM A;  2IWH A;  2Z8L A;  3KLS A;  2ICI A;  3OSO A;  3VYR A;  3PUW A;  2TSS A;  3H3V C;  3QWN A;  3X3M A;  1NAP A;  1H9R A;  5C3X A;  2K5W A;  4X3T A;  4HTH A;  2KVO A;  2DNC A;  3PIP 3;  2V31 A;  2XNA C;  5JEA J;  4II3 A;  1EFR A;  2JIZ A;  3NXW A;  4RCO A;  3NBI A;  3S2D B;  4XKW A;  1LAB A;  1JR0 D;  1HTP A;  1PTO D;  1WP6 A;  2D2C C;  1M4V A;  2Y0S B;  4P22 A;  3RD4 A;  1BCP F;  2GK7 A;  2K32 A;  3M4O B;  1JWU D;  2ZXP A;  4G7X A;  1OXV A;  2A68 D;  3HOX B;  2ZXH A;  1WTW A;  1ZEQ X;  1HCZ A;  1WD0 A;  3QJY A;  3LX0 A;  2QIL A;  5C44 B;  2WPD A;  1BXT A;  3CRK C;  1YNN D;  3LWU A;  3ERQ A;  1TU2 B;  2M2L A;  1Z6H A;  3OMC A;  1O7Y A;  5AFW A;  5JEA H;  1IKM A;  4J6H A;  3S17 B;  2OF1 A;  1V0F A;  3WDN A;  2K6A A;  4XNF A;  4RCN A;  2VB2 X;  4ULL A;  5I2X A;  1Q1B A;  5KND A;  2PPB C;  3D8G A;  3H09 A;  1CZG A;  3GTQ B;  4ZUI A;  2D9U A;  5F2D A;  1TS4 A;  3KEW A;  1HQR D;  2JXM B;  5E1F A;  2L5T A;  2KHS A;  4Q0F A;  2IX1 A;  5CBA E;  4IN3 A;  2O5J C;  1D5Z C;  1E79 A;  2HUG A;  2E74 C;  4XQF A;  4XQN A;  4FF3 A;  1TII D;  1UD5 A;  4XLH A;  4H0L C;  1GUN A;  1AZQ A;  5ELD A;  4OO1 I;  4LK1 C;  2IT1 A;  1I3Q B;  3DWQ A;  1H8H A;  1B9N A;  3C1F A;  1U4M A;  1HQM C;  1NUC A;  2F0Q A;  1QOH A;  1COW A;  5IGF A;  1TS2 A;  5CR3 A;  2N88 A;  2EDG A;  2JJ1 A;  4TRD A;  2HLD A;  3PV0 A;  2F0W A;  4G4K A;  3D4R A;  4EVO A;  3WQZ A;  2X69 A;  3VYU A;  1DYQ A;  2RDG A;  1QE6 A;  4KY6 A;  5COR A;  1E43 A;  5ELC A;  3GTO B;  1ROD A;  2ZTG A;  1EFI D;  1YNJ D;  1SNQ A;  4XDX A;  3OOC A;  2WAQ B;  4MN3 A;  3NTI A;  1D1K A;  3SK6 A;  2K7V A;  4OIK A;  2JJ2 A;  1Z47 A;  1LLR D;  3I90 A;  3BVM A;  5TSS A;  1TVX A;  4J1M A;  1CI3 M;  2NYZ D;  4A3G B;  1SYB A;  1EYD A;  1VMP A;  4DN4 M;  5M5W B;  1I50 B;  1HZE A;  3BH4 A;  2EOT A;  4QUC A;  1BPL A;  2ZXI A;  2NVQ B;  5C5L A;  3BYT B;  4L6T B;  2AUK A;  4OO1 H;  1H8E A;  1PMR A;  5I6Y A;  4IUR A;  2CW0 D;  3TP7 A;  3CRL C;  4HCE A;  3GV3 A;  5DN6 A;  2WJV A;  2J4X A;  1EL0 A;  3CKI B;  2QEJ C;  1E2V A;  1XX8 A;  4MIU A;  2XND A;  2RSN A;  2B2U C;  1SYG A;  5CDF A;  2JEA I;  4KKU A;  3HOW B;  5I9P A;  1I4X A;  4ZQ3 A;  3I3C A;  3MAQ A;  4DAP A;  4XMY A;  3S2H B;  1UAP A;  3CU7 A;  1EZ6 A;  4OHJ A;  1WVL A;  4A3F B;  2TMP A;  2L4N A;  3EA6 A;  3J7A V;  1Z7T A;  4XM3 A;  4FF4 A;  3S1M B;  2B8F A;  1GOZ A;  2XWB B;  2XGJ A;  2F0U A;  3A54 A;  2FHT A;  2WB1 B;  3QIA A;  1W6K A;  2E1B A;  2V4D A;  1E3X A;  4FF1 A;  1I4P A;  2B2Y A;  5E3F A;  2VUM B;  4FF2 A;  1BQQ T;  3BZD B;  1NR2 A;  4DNT B;  1HXY D;  1TS5 A;  5C4J B;  1EIG A;  2R9V A;  3DWA A;  4I65 A;  2X85 A;  3T13 A;  3JAM E;  4XYQ A;  1F9P A;  3K5M A;  4XT3 B;  5FO7 B;  2DY7 A;  2WSS A;  4KN7 C;  1A2T A;  4QIW B;  3BDC A;  1EIH A;  3HGB A;  2F0T A;  4TSS A;  1WCM B;  2BE5 D;  3HRZ C;  2ENB A;  1FX0 A;  3EJI A;  4ID6 A;  3OIP A;  1I4H A;  4J8Q A;  3N52 A;  2LS0 1;  3J80 E;  1I18 A;  5CV6 A;  1D2B A;  5I2Y A;  3BG3 A;  1ENC A;  3N6R A;  1K83 B;  1V43 A;  2PO4 A;  2B2V A;  5BN3 A;  3D4D A;  3K58 A;  4HMJ A;  2M00 A;  2FMC A;  4IUT A;  4JMQ A;  3TP5 A;  2A6H C;  4DAY A;  1CHQ D;  2E2H B;  1ZXT A;  4RFB A;  1LTT D;  3M3Y B;  3HOV B;  2F0H A;  2ZXR A;  1KTK A;  1ZYR C;  1SNO A;  1KZL A;  1D1I A;  3C1E A;  4PQX A;  4V0B A;  3OWF A;  1QG7 A;  1TQO A;  5E4W C;  1E3Z A;  1A2U A;  4K8J A;  2FMM A;  4II2 A;  2X53 S;  1DON A;  1UD6 A;  5KIX A;  1EY4 A;  1VDZ A;  2MPM A;  3DEP A;  1SFO B;  2HCI A;  1UUP A;  5DNF A;  5M5Y B;  1H9K A;  1TR5 A;  3D6W A;  3MC0 B;  5IT9 E;  5FLX L;  4RA8 A;  4KD4 A;  3F2U A;  5ISR A;  1PRT C;  1BNZ A;  2EVB A;  2NTS A;  1SMY C;  3LWE A;  1A6X A;  1IYU A;  3A8K E;  2ZTN A;  3D6C A;  3A7A B;  4B9W A;  2MUY A;  1SJH D;  1WTP A;  4WRD A;  1V1O A;  1VCI A;  5E4X A;  1SEB D;  3TN2 A;  3PUV A;  2BCO A;  3KF8 A;  2ZZF A;  2VNU D;  4A3D B;  3PUY A;  3PMF A;  1DOM A;  4G7W A;  2X6W A;  1E2W A;  2NB0 A;  2WV6 D;  5CMD A;  2F0I A;  4RAU C;  5KNC A;  4ZKB B;  3T16 A;  5IGB A;  2LY7 A;  2A69 C;  2EYM A;  2Q8T A;  2RQX A;  4QUF A;  1QNK A;  2Q8I B;  3FPP A;  1IHZ A;  1MAB A;  4XN3 A;  1RKN A;  3OIQ A;  3RZO B;  1S5C D;  4RKL A;  4ODG A;  2EYJ A;  3MEH A;  1EU4 A;  1U9R A;  2B63 B;  3DEO A;  1OXT A;  5J1Z A;  3GO5 A;  2F0J A;  1BBX C;  2F0D A;  1SE4 A;  5M3M B;  3S9W A;  1TWG B;  3SEB A;  4L8J A;  4PMW A;  2D3L A;  1PTO H;  2B2T A;  1QWY A;  3IL8 A;  2E2D C;  2YYZ A;  2K28 A;  3CQZ B;  2R7Z B;  4ME5 A;  5I6W A;  5DM6 3;  1EY5 A;  1BCP C;  4Y7N B;  1B4O A;  3K7A B;  1CTM A;  1PFB A;  1G6Z A;  3MWY W;  1Y69 U;  5ELB A;  4P2C B;  4WOR A;  1C8C A;  5JVH 3;  2W6J A;  1XYI A;  2G9H D;  1HRJ A;  4C3H B;  1VMC A;  3R2T A;  1STA A;  2IX0 A;  4A93 B;  4JBW A;  2XZP A;  5IOC A;  2SOB A;  3SK8 A;  2EY1 A;  1ICW A;  4I7Z C;  3SDZ A;  2R93 B;  1RF2 D;  1WPC A;  1ENA A;  1KLU D;  4CJ2 C;  4XL9 A;  4DXG A;  1G2S A;  2RDH A;  1OHH A;  1BF4 A;  1QCB D;  3FRP B;  2IJ0 A;  4GQN A;  4G6I A;  1SYD A;  1OXU A;  2EZV A;  2SDF A;  3H91 A;  2EYL A;  5CV8 A;  3RZD B;  1STY A;  1V1P A;  4HCS A;  5IGC A;  3GTK B;  3A3B A;  5D3D A;  1HUN A;  5I9O A;  4G7H C;  1O78 A;  3EVQ A;  3DUZ A;  3PUX A;  2OEO A;  4KI0 A;  5JJZ A;  3NQT A;  3IFT A;  1UEA B;  1GHJ A;  3I70 A;  4RGT A;  2EJG C;  5J22 A;  1OB0 A;  2F0F A;  3I72 A;  4NMZ A;  2PZW A;  3SXH A;  1SND A;  2JP1 A;  1CFM A;  3CMM A;  5IOD A;  2B8G A;  5C4H A;  1BOS A;  2E2J B;  2E2I B;  2EE1 A;  3D4W A;  5JPM C;  2ZZG A;  2F0S A;  2Z4H A;  4FNF A;  2PCF B;  2GA4 B;  3A8J E;  4CKB A;  1DXM A;  2D5D A;  3NTH A;  4OO1 G;  2BA1 A;  1VF7 A;  3G6J B;  3RUZ A;  2NTT A;  4CJ0 B;  2EXZ A;  2N55 A;  1SNM A;  1EU3 A;  3VA7 A;  2A6H D;  5FKA C;  4IUN A;  3P7J A;  2F0V A;  3J81 L;  2VXW A;  1FNU A;  3UI2 A;  3S1R B;  4KY5 A;  4BY1 B;  2QDB A;  1ZYR D;  3ZYY X;  3A3G A;  3S16 B;  1LTB D;  3GTL B;  3I91 A;  2WAC A;  4CHT B;  2DNE A;  1T5X D;  3C46 A;  4TSF A;  5M5X B;  4F7X A;  4KD3 A;  4BBR B;  1LT4 D;  2EJM A;  4KV6 A;  3WOE A;  4UDU C;  1O7L A;  1JWS D;  5CV7 A;  4XQJ A;  2A73 B;  4R8N A;  4XOP A;  1MD2 D;  1LTI D;  1G91 A;  1W0K A;  2X6L A;  1SE3 A;  4WFN 3;  4KJO A;  2F3V A;  4MHE A;  3CP2 A;  1ET6 A;  3DM1 A;  3QOJ A;  4EQO A;  1PRT D;  4B3F X;  1SMY D;  1V1P B;  5FK9 C;  4IUV A;  1S4Z A;  4ABN A;  4AYB B;  3AU7 A;  1CZW A;  1Y1W B;  2XOK A;  3S14 B;  2PMZ B;  1GUG A;  2R61 A;  2LFN A;  2JA6 B;  3BDO A;  2F0M A;  3OAA A;  5KYI A;  1IYV A;  2F4I A;  2ZT9 C;  4HR7 B;  2QF7 A;  1A15 A;  2K01 A;  3GTM B;  3I4L A;  5T1I A;  1X3Q A;  1TWH B;  1AEX A;  5EGT A;  1Y8P B;  2XRQ D;  4C3I G;  2JDI A;  4KTA A;  3E6Z X;  5DM7 3;  3PO2 B;  1JC7 A;  1I4R A;  4KJN A;  1RDP D;  2A69 D;  3DDY A;  3P1H A;  5D3I B;  4TQU S;  1TKW B;  1U4R A;  2NVT B;  2B39 A;  3S15 B;  4HSV A;  5CV4 A;  3R93 A;  4HMI A;  2B2Y C;  2Z6B D;  1GUW A;  2O5I C;  3K6O A;  2AQ3 B;  1F2L A;  3HP3 A;  4JK1 C;  2RKS A;  2M9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...