3T56B

Crystal structure of the pre-extrusion state of the cusba adaptor-transporter complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein CusA
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 57
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t56B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t56B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t56B01
2A6EC 2O5IC 4OO1H 3PUYA 1EWHA 1HTPA 1I6VC 1Q12A 4GZYC 2D2CC 2AUKA 5KNBA 2A68C 1T5EA 4KI0A 3FPPA 4PV1C 3QJYA 1H9JA 1TKWB 2NN6H 2K7VA 3VR5A 5C0XH 3CRKC 3M4YA 3QG1A 5BN3A 2A6HC 2JXMB 1OXSC 3PUZA 3I72A 1YNNC 1BDOA 3EQLC 1TU2B 3GQBA 4JBWA 5BN4A 2BE5D 3N6RA 1GJXA 1LABA 2LMCB 5K36G 2A6ED 3I4LA 4KN7C 1GUNA 3WDNA 4IFDH 3IKJA 2Q8IB 5JEAH 1GHJA 1ZYRC 4DK1A 3VR2A 2A68D 3L7ZC 2AWOA 3MXUA 4BA2I 3P20A 3LNNA 3OOCA 5A35A 2EJFC 3VA7A 1CTMA 3VR4A 3TZUA 3D4RA 3OPOA 3LWUA 4XIGS 1FYCA 4BA1I 3I73A 1VF5C 4IQZA 1H9SB 2A6HD 4KKSA 2V4DA 4KHZA 3VR6A 1PMRA 2B8FA 2NN6G 1YNJC 2R6GA 1IW7D 3PUXA 3H94A 2A69C 1Y8PB 5KNDA 4G7ZC 4I7ZC 1FR3A 1OXVA 2DNCA 2E75C 2NN6I 4LJZC 4H13C 1E2ZA 1CFMA 3ND9A 1GHKA 2K32A 2EDGA 3W3AA 1HQMC 2D62A 1V43A 3SDZA 3T53B 3CRLC 2AUJD 4DK0A 4L8JA 2EVBA 4IFDG 4KMUC 1HCZA 1DD2A 3DXJC 2BA1A 1Z6HA 4TQUS 2F1MA 1B9MA 1Q90A 3SE0A 4OO1G 1Y8NB 1DXMA 1GUGA 4G7HC 2O5JC 3NE5B 2A69D 2JEAI 1OXXK 1OXTA 2PNRC 3VR3A 1LACA 4JK1C 3RLFA 1SMYC 1A6XA 5C0XG 3BG3A 3A8KE 1H9SA 3AB9A 2EJGC 2B8GA 1Q1EA 4KKTA 3BDOA 1GUOA 2D5DA 2K33A 4TKOB 1HPCA 3A7LA 3PV0A 1Q1BA 1IYUA 5K36H 1H9MA 2IT1A 2ZT9C 3FMCA 1K8OA 1G291 2E74C 3T51B 3T56B 4RCNA 3MFYA 1DCZA 3M85A 1Y8OB 2PCFB 3D31A 1E2WA 2CW0C 4H44C 2BDOA 3A8IE 2DN8A 5KNCA 3PUVA 2QF7A 5JEAG 1H9RA 3A8JE 2PPBC 4H0LC 3IFTA 4G7OC 4HR7B 1GUTA 4OGQC 3HGBA 1VF7A 1O78A 1H9KA 1ONLA 4XTCS 3U9SA 3A7AB 2DNEA 2EJMA 4DNTB 1B9NA 1Z7TA 3ND8A 1O7LA 1V8QA 1IW7C 2KCCA 1QJOA 1K8MA 2E76C 1VCIA 2BA0A 4LK1C 1GUSA 2L5TA 3KLRA 3QIAA 1OXUA 1VDZA 2JEBI 3M7NA 1Y69U 1CI3M 2JE6I 3PUWA 1IYVA 4DNRB 1E2VA 2BE5C 4KKUA 1ZKOA 5BN5A 3OW7A 4KN4C 3GD7A 2KA7A 2YYZA
chains in the Genus database with same CATH superfamily
5B6IA 1HTPA 4C1NK 1WSVA 5IY0A 2DGYA 3CKIB 1GO2A 1S4MA 1ASYA 4ZUJA 2GPJA 1JJ2B 1F2ZA 3BCDA 4QB4A 1I8DA 4RD0A 1KK0A 1OGIA 1TVCA 3I72A 3ULPA 1S5ED 3KF6B 3GQBA 4GOPB 1B2TA 2BE5D 3CC7B 2OK8A 3R6JA 3IL8A 3H0GG 5K36G 2HCJB 2YWHA 4A3FH 4DU9A 4A93B 3BS1A 1WTRA 5LMNQ 2JIZA 1IZ6A 4KHVA 2A68D 1X65A 5FO7B 2MO0A 4GLVB 4LF5L 4ZKBB 4RKLA 2PW5A 3LWEA 3UI2A 3PO2H 1LT4D 4IQZA 1U4PA 3H9NA 1QFZA 1W6JA 4POFA 1VQMA 1Y1VH 2VNJA 2ZXRA 1T5XD 4M0LA 1B1ZA 2VNKA 1MKHA 2DNCA 2Q6OA 1XPRA 5I6WA 5DN6A 1QVFA 3HOYB 5KNLA 4JMQA 1WSRA 2A73B 3A0JA 3VO1A 1V43A 2D62A 4IALA 4X7CA 1TS4A 1CKMA 4WORA 3SLNA 1HCZA 4QFMA 2N3SA 2BA1A 1X3GA 4JOIA 1HUNA 5J3OA 5IGBA 3PO3B 1NE3A 1E3XA 5HZBA 2K6AA 4JI7L 3L3OC 4B43A 2EIFA 3FHWA 1B4OA 5A89A 2JEAI 1L1OB 1OXXK 2AQ3B 2E2IH 1RF2D 2R3ZA 5FKAC 4P25A 4Z4YA 1E3PA 1ZUNB 2RVLA 4PMBA 3CP2A 1VQPB 2B8GA 1W3SA 2Y0SG 3D26A 1ICFB 3PQIA 4X3SA 2CK3A 5FLXL 1LTRD 1F20A 3CC4B 1F60A 1YHBA 3TS0A 2C35B 5EQ0A 5K36H 4XMYA 3HOWH 2V1CC 1SDFA 4KLKA 3MFYA 4DV0Q 3CAMA 2WINB 2M9VA 3K0XA 5T1GA 1YHQA 4UZFA 1ZXTA 2DN8A 1TWAH 4RD2A 4JI2Q 1G6PA 3CCSA 4O0AA 1K9MD 1SJHD 2B2YA 3FKSA 1QVCA 2L1BA 4XNFA 4DNIA 5BSYA 4B3MQ 4A3KB 4NPSA 2ZITA 1M1KD 4IUUA 3ASTA 3E9HA 3J81i 4OEMB 4OX9Q 3C2QA 3CMMA 3TREA 3QB3A 3GP7A 4HMJA 3I4MB 5JVH3 4HIZA 3GO5A 2RDFA 1N9WA 3DWPA 2BH2A 5G3LF 1JMCA 5CMDA 1B3AA 1N34Q 2XNJA 1SAPA 1EY7A 3BYTB 1PJ7A 4XLEA 3Q23A 2K04A 3AVUA 4X64Q 1SYCA 3JQRA 2K5VA 3ASQA 3BU2A 4NXNQ 5JAVA 2NVYH 3OFNA 3EBEA 4GQNA 3NBHA 3HS0C 1W9XA 2BN4A 5D3IB 1FVIA 2JA6B 4CKEA 3S1QH 3S1RB 3KDFB 2EYPA 1KDCA 2VJJA 2EYHA 1LABA 1UE7A 2ZJRA 2J4XA 1STGA 3VNVA 5FJ8G 3OTOL 1OO9B 4ACBA 2MPMA 1MSGA 3BJUA 1QUEA 5E1FA 3VR4A 5CGKA 3KBGA 2NV4A 1ENFA 2V7WA 1BBUA 1D5XC 2V4DA 4A3JG 1I3QH 2R6GA 2ATWA 3PUXA 3GDEA 4QF4A 3G7LA 4CDDC 1LYLA 4G5GA 2E75C 2NN6I 3FKIB 3AGPA 1H8HA 4PC1A 1EOVA 4ZCIA 3CCUB 2D0OA 4X8IA 3I70A 4X0CA 1HQMC 3CCVA 2WB1G 3GV3A 4XDXA 5M5XH 4DK0A 5GROA 4JI0Q 2MP1A 3BC9A 5E6TA 4XYQA 5HKKA 4FWTA 1KTKA 1I4HA 5NUCA 4ZK9B 1D6EC 3PO3G 1B9MA 1Q90A 4HIOA 1VS0A 3A1PA 4KY6A 3VA5A 1F9RA 1SFOH 1NB0A 4OOXA 2RHSB 1YJ9A 1D5MC 1A6XA 2NTTA 3GTMB 2UXCQ 4RDLA 4ULLA 1X32A 5C3EB 2K33A 4TKOB 4IUQA 2ZTEA 1N36L 1EFCA 3SJZA 2EXZA 2A74C 5FJ8H 3K5MA 3D31A 4YXWA 2VY3A 1C9OA 2X6XA 1B50A 1HNWQ 1H95A 3TZDA 3I4OA 4M4SA 5ELNA 3C1EA 3IFTA 4Z4RA 3EFXD 4ZYSA 2JSOA 1TWGH 2NBFA 4YIJA 2PZUA 4A3JH 5EKKA 2VQEL 3HOUB 3MC0B 4TMXA 4XLFA 1TT2A 1TIID 5CV4A 1C0AA 4A3KG 1TXYA 2GK6A 1SXTA 4JC0A 4F7XA 4XR6A 1IW7C 2QN6A 1CKNA 1K8MA 3CQZB 4DAMA 1AN8A 1IXRA 2A19A 2PMZB 3M7NA 3S1MB 1UD6A 2F4IA 1YIJB 1SYGA 1DARA 3A55A 2F0TA 5F4MA 3HKZE 2W6JA 3VYRA 3PO3H 1CQXA 4JV5Q 2O5IC 4XYOA 3PUYA 5DS0A 3CRZA 5GAGC 1HQRD 1O7ZA 1RJTA 4LAAA 5IYBG 3GTQB 3MAQA 4XQJA 2L9HA 3D4WA 3RMHA 1A8PA 2R92G 5FL7A 4BBRG 3CMAA 4LFBQ 1PFBA 2WIIB 1TWCB 3WOFA 4JBWA 1X6OA 4XOPA 1EWYA 1KXLA 4H02A 1AE2A 5IE8A 1PKVA 5H59A 2K28A 1N32L 4OIKA 2B63G 5K5PA 4P1VA 4HE5A 4ID6A 2C77A 3ZPNA 3KF8B 1J9OA 3J7AV 3S2DB 3JQQA 2E5LL 5IP7G 3B6YA 1CNEA 3PA1A 2NB0A 3T1YL 4A3IG 5FK9C 1NCVA 1L0YB 1WOOA 4AC9A 1E22A 1H9SB 2IWHA 2YTVA 4A3KH 3D4DA 2EYJA 2F0OA 3FP9A 3PGZA 4DUYL 2A69C 4AYBE 3FKIG 3G6EA 2PW7A 1VQOA 1VQGA 4S3SA 3G71A 3K57A 4A76A 1OB2A 1U0LA 1VHOA 3CCMB 1DJRD 4B47A 3BZDB 3W3AA 3SDZA 1E7ZA 4P6YA 2KUMA 1S72B 1K28D 3K80C 1KLUD 4RA8A 5GAHC 5IYBH 1F9QA 1SYFA 1Z6HA 4P2CB 3T13A 1EFTA 1L0WA 3I91A 1XMQL 3D0FA 3MEFA 5CR3A 1X56A 1S4ZA 2I0QA 4F87A 2R93B 1G7CA 3ZJYC 5A88A 1Q86D 2R92H 3DM3A 4F7DA 4BBRH 1HTLD 1QNUA 3E1YE 1HNXQ 1CSQA 1SMYC 5FO1A 2JA6H 1IBLQ 4FXDA 1B70B 3CMEA 3S1RH 1EY5A 1QZHA 2I1LA 1U4MA 1UEBA 4FXKC 4X65L 4QQBX 1Q1BA 2OCEA 3FRPB 3HOXB 3H3VC 4TMVA 1CZGA 3V2TA 1TVXA 4GNXA 3J81c 3T56B 1VQJA 4LW1A 1KRTA 2F0GA 3RD4A 3ZZ0A 1B44D 3H09A 3I4NB 5KNCA 2KENA 3NWTA 3STBC 2IPKD 4XORA 2RF4A 1BMFA 2B2UC 2UUBQ 4A3IH 1RKNA 4F8MA 3NUCA 1VQ9B 2ZXPA 4KY7A 3CCLA 2QILA 2XTIA 3PUMA 1ZM9A 1JB3A 1EQRA 3OYYA 4OGQC 5I6YA 2F4VQ 3MHPA 5G3LD 3KK7A 3T1HQ 1EU4A 1SRUA 3FKIH 1CZWA 1WD0A 4J6HA 2I5MX 2JA7G 2KCCA 4DUZQ 2UUCQ 2N8NA 3CESA 4ME3A 1NBWA 3L0OA 1MBYA 2JEBI 4B48A 5IP9G 1X9NA 2WJYA 2WZPP 1TQOA 2JE6I 4QUCA 4YWMA 1X3QA 2E2HB 1QX4A 4B3FX 1ZKOA 1YBYA 1SYEA 2WAQB 5C3XA 4DV2Q 2JJ2A 3GD7A 3SHLA 3R6KA 1CHQD 2F0QA 1I6VC 5KNBA 1AP0A 2QEXB 3QO2A 3QJYA 1TWHB 3GTMH 4A3DG 1KMHA 4LBVA 1SE2A 2EY2A 5C3EH 1DOLA 2J0TD 3ZC3A 2PYKA 1J5EQ 4A3BG 3CC2A 1TU2B 1JJGA 1WOPA 2OWOA 2PZWA 3BZKA 4JOIC 4RPBA 3CD6B 4LMQD 5CV9A 4EQNA 3J80c 1E62A 4CDCC 1VQHA 3FDTA 2XNDA 1WYDA 2F0WA 3HOUH 4IZ8A 4RWSC 2EIXA 2V7UA 3I73A 4YAUA 1RQRA 2DJFC 2DCUA 1V5VA 4RCOA 2RCNA 5M9OA 1RHPA 4KHPL 1UD4A 4U9UA 2XEXA 2CF4A 3CQZH 4JI6Q 1KQSA 2QDLA 1LTAD 2B29A 3D8GA 5IP9H 1O7IA 1JOQA 1OHHA 1K3BC 3J7ZC 1L2FA 3IFDA 4Q5VA 3VDYA 2HDLA 2D74A 3S15B 2B2YC 2G9HD 3OEHA 1N08A 1K0RA 1UUPA 4OWXB 5J35A 1WJJA 1R5OA 2XZLA 1IYJB 2F1LA 3Q0AA 1D8TA 4RAUC 1GKHA 3QFCA 1UEAB 2RSNA 5CORA 4B9XA 5IWAQ 5C4JB 2A8VA 4HCEA 2A69D 4QMGA 1NAPA 1ML0D 2XGTA 5IT9c 1WD1A 3CF5A 2GJKA 2VJIA 1BXTA 2A1AA 2ALYB 2KHIA 1EFRA 4MTKA 4A3BH 4IUPA 4O42A 1NB9A 3I2ZA 1XFOA 2F0EA 1STBA 1HPCA 3A7LA 1EU3A 4DV5L 1QVGB 3A3BA 1S5FD 1SE4A 4ZGQB 2Z9HA 1PDQA 1HFNA 1PTOF 4P72A 2UUAQ 1YZ6A 4IUVA 2NVTB 2QGGA 1KAWA 3I4NG 2MQHA 3S2DH 1SKQA 1JWMD 3I56A 2YU9B 3NEMA 5JEAG 3TP5A 1EY6A 1NSNS 4NXMQ 4ASUA 1R4QB 4DAYB 4LUVA 1JORA 1SMYD 2AQ1B 4KD4A 2ZJQA 3PIPA 1XE1A 2CW5A 1IKLA 2EJMA 4O2DA 4Y9UA 4EQ5A 1W0JA 2PQAB 3VNUA 4P26A 2HHHQ 3BNWA 2FMCA 4FNFA 4MN3A 3PIP3 1Y1WG 2YWGA 3NENA 4IJLA 3W2DA 3EJIA 5JBQA 4JG2A 3H15A 2L55A 3STBD 4DGZA 4DV7L 2QTLA 3CCRB 1QG7A 2ZTDA 4JPBW 3OW7A 2JJ1A 3CRKC 4A3FB 4GN5A 5LMNL 2R61A 3M7GA 2YWFA 2B2TA 3PENA 2L15A 4K8IA 1EQQA 1LT5D 1M4VA 5ISRA 3PO2B 5ELCA 1BLIA 2DYIA 4M53A 2JN9A 4B4DA 2A6HC 3A35A 2I5LX 4OPSA 2JXMB 3SK4A 1WI5A 1Y1VB 1SJED 4TRDA 2PIAA 2C4UA 1TY0A 1YNNC 4DK6C 1SR3A 1HRJA 2WYRA 4FDBA 3CCJA 4DV6L 3PMFA 1EZ6A 2FINB 4R1JA 4UP8A 4WJWA 4AVZA 3I4NH 3VO2A 4KN7C 1WTVA 5IYQA 2NZOA 5JEAH 2OTJB 2QW7A 3VR2A 3MXUA 1NMFA 2IW3A 3P20A 3U58A 4MYTA 1HHVA 1WU8A 1VQEA 1PH3A 3SK8A 3K0YA 1XNRL 5T1IA 1E1QA 1VQBA 3AU7A 5AJ3L 2G9DA 4YAWA 4PG3A 4ZCKA 3PF5A 1Y1WH 3OEEA 4IPDA 3V05A 2FHTA 1W0KA 1VQ8B 4ALPA 4JW0A 1EEFD 1QH0A 1PFSA 3WBKA 2KECA 1STHA 3PF4A 1NRKA 2AUJD 2ICIA 3H0GB 4AQYQ 4P6VF 2F0KA 1VQNA 1HZAA 1ENAA 3WNCA 3W5HA 2GREA 3RN5A 1GUGA 1TWHH 1TWAB 3BQJA 2M2LA 4JI2L 4Q7JB 2K14A 3CCQB 4IURA 4K2LA 2VNHA 3X3NA 1G2TA 3NTKA 2CWPA 3SK5A 3SXHA 2VQFQ 3MZ5A 4KV6A 3G05A 1GVPA 1EWCA 5C0XG 1KDAA 4EVOA 2EJGC 1VQ4A 4WJ4A 2GA4B 3ZIAA 4BXXG 2PQEA 3EROA 3MTSA 3PV0A 3AVXA 4OX9L 1IYUA 1N06A 2WKDA 4HJ9A 1G291 1FNDA 2L0CA 1ASZA 4Q0FA 1DCZA 2OXPA 3HRZC 2KOLA 1WOSA 4WRDA 1R9TB 1DM0B 1G6ZA 3D3RA 4ME5A 1EFID 2PLFA 4Z4SA 3WQZA 2QCPX 3U6KA 4RGOS 3W2HA 2C5BA 1H9KA 1O78A 1ONLA 4QY7A 4RFBA 2L4NA 4XTCS 3R8BA 2XWJB 1XQBA 4YCVA 2NVYB 4R71A 1N33Q 4RD3A 4DV4Q 1TS5A 4OOSA 4JYAL 1VQ7A 2Y0SB 4M8AA 3J7AF 3OMCA 3S1QB 2QDXA 4FXUA 3ONYA 1CA6A 1N05A 3TP7A 3RY8A 4PZ7A 5BN5A 1Z47A 5CC4A 3Q6QA 2XOKA 4GZYC 2QA4A 5IYNA 1VQMB 2HMAA 2K4KA 3TN2A 3TRZA 4J15A 3CU7A 1ZEQX 2XGJA 4TSSA 3KOJA 1PH8A 1JT8A 4WFN3 1J6QA 5C0XH 1C7YA 4G7WA 1AMOA 2WZNA 1KJZA 1EOTA 4WQMA 2RA4A 1FGBD 4K5VA 3GVLA 2MO1A 1I3QB 1GVHA 1SYBA 5JOBA 3VYTA 2IX3A 4GLXA 2FMMA 1KABA 3FVQA 4X3KA 1DGSA 5IGGA 2NVTH 4WZLA 1W2BA 2A5HA 2YU9H 3GSIA 4BA2I 4DQKA 3J81L 2WFWA 3K7AB 2HDMA 1J8IA 1NUCA 1FYCA 3RZOB 1YNXA 2AHOA 3KJPA 4RM0A 4ACAA 2A6HD 1RODA 4KHZA 2Z4IA 1Q81C 1YNJC 1YNND 4GNXC 3QFSA 1UE6A 1SFOB 2UXCL 3NPPA 1NDHA 1RD9D 4A4IA 3OHXC 3TP6A 1V1QA 1FRNA 3A56A 3K5NA 1VMPA 2XNAC 2SNSA 3C2PA 4A3LG 1SBBB 1HR0Q 1DD2A 2CNDA 5CV6A 1EYCA 3WBJA 3ASRA 3QFTA 3BY2A 1F9PA 4QIWB 4RDJA 1NBMA 1DXMA 2D0PA 3ASPA 1HNWL 4G7HC 1A63A 2F0DA 2PNRC 2IJ0A 2DJGC 3RLFA 1TWGB 3NSWA 4A3JB 2R7FA 3BG3A 3I8ZA 5LHY1 2JJQA 2B7BA 3QWNA 4LFAQ 1Q3LA 1QZGA 5DNFA 1STEA 3U6BA 2R7DA 2E2DC 1Q46A 2E74C 4B3TQ 5H1SE 1D1IA 4R4CA 1I6HH 4DR6L 4CKCA 3M85A 5LMUQ 2WB1B 1LV9A 1ESFA 3CCEA 3U50C 4LBYA 3J80L 3PSIA 3ZZTA 1UAPA 3QSYA 1S40A 4JV5L 2VBUA 2ASBA 2EYFA 2VNIA 1HZ9A 2HQEA 3HGBA 4LF4L 2OEOA 4JI4Q 4UP9A 1NTGA 3A8JA 4X3TA 3QOJA 1B9NA 1EY0A 1LTTD 1VQ5A 2F0MA 4LFBL 3JC66 3S14H 2F3IA 3E3XA 4ZUIA 4HEDA 2OF1A 3H0GH 2XRQD 4A3LH 4UPAA 1R5NA 1YHAA 1HNZQ 4KKUA 2HCIA 5HGTA 4YAFA 5L37A 1CHPD 2KA7A 1Y0YA 4B3GA 1MABA 2YYZA 2BH8A 3F2CA 4GKJL 1VQIA 5CBEE 4K14A 3NTIA 3ZBUA 5C4HA 1WORA 1E24A 5TV2A 2RDHA 1PA6A 1FL0A 1CQFA 3J7A5 4RLZA 2BDNA 3RLOA 1U4LA 1HZBA 4L5QA 1ESRA 2FX3A 4ZLTF 5IT9L 1JJ2A 2VZAA 1BOSA 2PMZE 4K5WA 2Z4HA 5BN4A 4Y7CA 3H3VH 3SEJA 3KF6A 4GOPA 1GUNA 3CC7A 3SGIA 1R9TH 4LBWA 3IKJA 3ONAB 5FNZA 2EZVA 3HKSA 1PFMA 1LT3D 1MD2D 1V1PA 2AWOA 4JI1L 1FX0A 1SKYB 2X3UA 1E43A 1PRTF 4P73A 2LS01 3OPOA 1YJ9B 4UHVA 1KC8C 2JK8A 4X62Q 1B3QA 1RQPA 3CP8A 2Q2UA 2R92B 4BBRB 1IKMA 4DR2Q 1WTHD 2ZZEA 1IBLL 1FD7D 1FNUA 2P5ZX 5J3BA 1NNXA 3UE0A 4Y52H 2JA8G 3T53B 4IFDG 2NTSA 2BV3A 1EP2B 1D2EA 1EY4A 4A3MG 2GJRA 2ZM6Q 2B63B 1LM0A 5J22A 1TLLA 2Q6IA 4RD4A 4K1XA 3M4PA 4XN0A 5C3WA 1Q81D 4DR3L 1YNJD 3AFPA 2XN9C 2N55A 3QE2A 4A3IB 4TMZA 2KCTA 2Q8TA 3GTJH 2D9UA 4G1VA 5KYIA 3T1HL 3ZUGA 2F43A 2Z6BA 5IGCA 4WZTA 2I5HA 1GUOA 3P27A 5ELOA 3J80i 3E0EA 1PH5A 4OL7A 1JWUD 3IRBA 5GQOA 5IGFA 5C5MA 2X53S 2Q6LA 2EFGA 2B2TC 3K7AH 2VBVA 2CW0C 1X3EA 3A8IE 2GQFA 1QUFA 3D6CA 1RTNA 1IL8A 4WZEA 4OPVA 4L5RC 3RZOH 4H0LC 4IO9A 2Q2TA 4HR7B 1OB0A 3AQQA 2RCFA 3A3GA 3MWYW 4JI5Q 2K5DA 4DR7L 2D3NA 5C44B 1XNQQ 1JOOA 3ND8A 1RTOA 4RCZA 3BYYB 4JBJA 3MXNA 1FNVA 1XYIA 3A54A 2JA8H 3PVDA 2V31A 4RJLA 1CI3M 3PUWA 2LXKA 1PRTC 2Z6KC 4DR1L 1HZCA 1U9RA 3Q6RA 1JB7A 3F2UA 2Z1CA 4DR4L 4A3MH 1AH9A 1P16A 2YTYA 1BCPF 1Q12A 2AUKA 2X6YA 3HEJA 4FF4A 3FPPA 5JJKA 2OBTA 1TY2A 3G6EB 2Z0SA 1VLYA 1I4RA 3OZWA 1VQOB 5ELDA 1YITB 3E0JA 4MTNA 2ID0A 5I2YA 1OXSC 1X3FA 1KNAA 3MMPA 4JI6L 3EQLC 2JA7B 3OMGA 1OB5A 2OTLB 4QHYA 1CNFA 3SVMA 2VS1A 3B82A 2AQ2B 2WAQE 5F4OA 4PAAA 4HE6A 2MHVA 4CJ0B 1W6KA 3DM1A 4PC2A 1SMXA 1HA6A 2HQLA 3C46A 5TRDA 4FK8A 3WY9A 3VA7A 3HZXA 1EQTA 4EQPA 1K83B 4LF6Q 4NW2A 5IWAL 4BY7G 3MA2B 2B8FA 4TT3A 1I94L 4ZV4A 1IJEA 3H94A 5EJWA 1Y8PB 1D7QA 4M1KA 5C6AA 4A3DB 2LKVA 1N07A 1ZM4A 2OYNA 4GNXB 2NWGA 3G4SB 2WACA 2F0FA 4C1NI 4A3BB 2LSSA 1TS2A 2K32A 2K5WA 2WR8A 1KZLA 3K5OA 4OWTB 1BF4A 5I9OA 3CCUA 1PJ5A 2X6WA 4JI7Q 2ENBA 3VYSA 5M5WH 2F1MA 5A2QL 4Y7NH 1KC8D 3F2BA 1H42A 4TMWA 4UAJA 1Y8NB 2LXJA 1JJCB 4L6TB 4XT1B 5F2DA 4EQOA 1DDIA 1QNKA 3M4OH 4XKWA 1B53A 2TSSA 4FXGC 4NXML 3TSSA 3Q39A 2UXDL 1KRHA 4YHBA 1QGYA 1S0UA 4RCYA 3CPXA 1Q1EA 4QCLA 5DM63 1YEZA 4NP5A 4R4IA 1PH7A 2V7TA 1BCPC 4HAEA 4FVMA 3SR1A 1RL2A 3MHBA 2LY7A 5L46A 1V0EA 4H44C 2BDOA 4RDKA 2F0UA 1LUZA 3JAME 2EE1A 3EN2A 1EIGA 3H6MA 5EPJA 2PPBC 1ET6A 1HJPA 3RR5A 1EWIA 4BY7H 1S5BD 2CRVA 4Z4WA 3CPWB 2I46A 4A3EG 3NTHA 5C44G 3SKBA 4P22A 3CC2B 4DNTB 4HMIA 4I65A 1PTOH 5D65A 4OOVA 1UD5A 2CVRA 1CT1D 4MZ9A 1GAQA 3ES9A 1HVXA 1JB9A 3AVTA 3ULLA 5KEEA 4DV3Q 1OXUA 3M4QA 1A2TA 4X05A 1VQDA 2CW0D 1V1OA 4C56C 3ERQA 2B63H 3ASSA 4NDXA 3KJOA 5CV7A 1LT6D 3CXCB 3W1BA 4EGVA 5IP7H 4V190 4PC3A 2FFKB 1HR0W 4KI0A 5LMNW 2WPDA 5H5JA 4ZKCB 1KQSB 3VR5A 1DYQA 1O7YA 3K59A 5HXBA 2RC5A 3I7FA 4IUTA 4GKKQ 1FDRA 3S2HH 4QGUA 3PUZA 1SN8A 4CDFC 1EIFA 1KLGD 2C9OA 2DETA 1Y1WB 2KBNA 2EY6A 3BZCA 1L0XB 1GJXA 3BVMA 2F4NA 2YV5A 4MIUA 3WDNA 2UXBL 1EL0A 5IYCG 4R8NA 1F77A 4ZAIA 2CCZA 1T9HA 2EJFC 2V7VA 4RH6A 3KF8A 4QL5A 4A3EH 2ZL5A 2HIVA 5C44H 1YJNB 4YY3Q 4PNYA 4LF9Q 1PMRA 2NN6G 4UY8C 4K0KQ 1IW7D 1OGJA 1SLJA 3OE7A 2IX0A 5KNDA 4G7ZC 1FR3A 4LJZC 5GAEC 2MJ8A 3WXMA 1KL9A 1UD2A 1SNDA 3BVGA 1C4QA 4A3CG 1XPOA 1V9PA 4E0FA 3RLNA 4OXPA 3R2TA 1PZKD 2PNHA 4POGA 3CCMA 5TR9A 1B23P 2K1BA 1VJSA 3DXJC 4ABNA 1A15A 4GN4B 1QB5D 3ULJA 1S72A 2V7XA 3A8IA 3NQIA 2ZL6A 3NK9A 2B2VA 3OIPA 1LACA 4DR5Q 2K5QA 3A8KE 3E6ZX 2JA7H 1GXDC 2NVQH 3LQEA 2RKSA 5J1ZA 4APVA 5JJLA 1N33L 4P9SA 2VL6A 4DV4L 1IHMA 5JJIA 4HCSA 2JA5G 1IHZA 4RGTA 5M5YB 1ET9A 5IYCH 3RUZA 4TN1A 2B7CA 1YVCA 3NBIA 4H7BA 3I55B 4NNJA 3MFGA 2ZXIA 3OWEB 1H9RA 1K83H 3DEOA 5AFWA 5KYLA 1LTLA 1SE8A 2VQEQ 3NWSA 3ICEA 2RHQB 3K81C 4G6IA 4ILWA 3R93A 4HJAA 4FP5D 4LWCA 2GK7A 3MXPA 4YWLA 1VQ9A 4A3DH 1ICWA 4NBSA 1ZM2A 1B7YB 4KY5A 1BCPD 2VB2X 1ELOA 4R9WA 5BR8Q 1BPLA 1P8LA 2F0LA 3OWFA 1PRTB 1SNOA 1VMCA 1P4MA 1Y0RA 1YJWB 5KIXA 1VQ6A 5IK2A 5HURA 1EP3B 3SLDA 3UDXA 5E4WC 1SEBD 2K52A 2HT1A 2D2CC 1T5EA 1D5ZC 4P2NA 3CW2A 1YX2A 1G51A 3DEPA 1D2BA 3TBIB 3M4YA 1KK3A 2QEXA 5BN3A 1VQCA 2NUCA 3IAYA 3GVJA 3KYHC 1I18A 2Y0SE 4BY1B 3BDLA 1W35A 1EEID 4UZEA 4KD3A 3J7YW 2JA5H 2F03A 3BCFA 1DG1G 2EY1A 4MNOA 4HN7A 3F2DA 1K73C 1AZQA 1LTGD 4EX5A 3F8TA 5EKIA 2E5LQ 4PC7A 1E79A 4XQFA 3CD6A 4LFCQ 3T1YQ 2BPOA 1GAWA 1HR0L 5A35A 4DK3C 4H9GA 4GN3B 3QR8A 2M00A 3LWUA 1CK1A 1PH1A 1PV4A 1IB0A 1M90C 5M3FG 1XMOQ 3OW2B 4KKSA 2VYQA 1VQ4B 1GD7A 1K28A 1F2MA 3TDQA 3LQ6A 4ODGA 2H5XA 1CFMA 3P75A 4RG1A 4OIJA 1RIPA 2ZZGA 1EYGA 2ZZQA 2F0IA 4NCNA 1BQQT 1J9ZA 5IYDG 4LFAL 2XWBB 2QE7A 1XMQQ 3H3VI 4OELB 3HKZG 4B3TL 1A3VA 2H4OA 2AWNA 1I6HB 3I90A 5LMUL 1VQLA 4ZCMA 2WJVA 4CJ2C 4JI3Q 3JQPA 1EIHA 4R4TA 4ROXA 1PH2A 4OWWB 3W5VA 4C0SA 1VQ7B 4X65Q 1PZJD 3AB9A 1PTOC 1KIXA 2GJPA 1QILA 2PMDA 1VQKB 4KKTA 1R4PB 2RC6A 1SSOA 4XLCA 3QFRA 2D5DA 3BDOA 4U68A 1BX1A 4RD1A 1RCVD 1HA5A 1KAAA 5EMNA 2ZT9C 3S14B 4L5TA 4C3IG 1BCPB 3P26A 1QWYA 4QIWE 3KFUA 2B2WA 2SDFA 1UWVA 1HNZL 4C3HG 2VUMG 1IBKQ 4DV0L 4IPGA 5M3FH 1VLOA 1EQVA 1O80A 2B39A 1IL2A 1TUIA 4DAYA 1F2LA 4JVZA 1U2RA 1WFQA 3W5OA 1O7LA 2DY8A 4AYBG 5FO8B 2F0HA 1I50B 4B3ML 1DONA 2E76C 1VCIA 1LTID 2PQAA 1C48A 2YTXA 5IYDH 4B3SQ 3E9IA 3J81E 2WB1E 4DNRB 4PGOA 1A0IA 1E1RA 3OZVA 4KK7A 2AHOB 1WTQA 2ZL7A 2E2JH 4BBSG 4B3RQ 3CCRA 2XSCA 1N34L 5TSSA 4GS3A 2ZXHA 4LF8Q 1D1KA 3V7AA 3DWAA 1JWSD 4X64L 4X06A 1TWFH 4NXNL 3S1NB 1W87A 4X07A 1LTSD 5LMZA 3CP0A 4BY1G 1I4QA 4JBMA 3S9WA 4DF7A 4Z9CB 5FOBB 1X54A 4LF7Q 5M5YH 5EPLA 1BJKA 4C3IH 3LX0A 3U2QA 3AGQA 3CHBD 2VUMH 5KSWB 2Q8IB 2MUYA 4G1BA 2WP8J 1A2UA 1CTMA 3MXGA 1BKBA 1GO3E 3TZUA 4BA1I 2JP1A 4KHPQ 4IUNA 1PYSB 2K5HA 4OPOA 4X66Q 2MNAA 1KDBA 1QVFB 3OZUA 1EIYB 5EAYA 3JU4A 2H1EA 2CKZB 4H13C 1K73D 4BXXH 3GTJB 1HA3A 4OHJA 2EDGA 3AVWA 3A8KA 3CCEB 1YI2A 3T16A 5A8AA 2LZJA 3J80E 2VW9A 2EVBA 1EUJA 1WPCA 2ZZFA 1NJIC 5M3MB 4X7EA 3WYAA 4K2KA 1M90D 4JI0L 3TQYA 2BVNA 1EYAA 5E7NA 1FNCA 2C5HA 3LVBA 3W5UA 4K6LA 4PMCA 1VQ5B 2DY7A 1AZPA 4A3GB 2UU9Q 4DV1Q 3KUPA 1WTOA 4JK1C 3CCQA 5FLXE 1PH6A 4BY1H 4JI5L 3OIQA 1XNQL 2VBSA 4YCWA 1MSHA 1FNBA 3HG9A 1SNQA 2EOTA 4JI8Q 2KVOA 2DERA 4LC0A 2CFMA 2QTZA 3W2EA 1YHQB 3OSOA 4C43A 3T51B 2CWAA 2JA8B 4QV2A 1X3PA 3CCSB 1DZ1A 1F9SA 3ISXA 4PC6A 1E0BA 4M1UB 4A3MB 4YAOA 3DDYA 4WWVA 5IT9E 2B2UA 1PTOD 3A7AB 2DNEA 2J7ZA 1Z7TA 2IL8A 5IOCA 1TR5A 3UDFA 4LNQA 3EIVA 3M3YB 2YWEA 3GIRA 2L5TA 4QJFA 4DV7Q 3GTOB 1IYVA 1V1PB 1ENCA 3HOWG 5COYA 5JEAJ 1E2VA 5C5LA 3J81k 1I4PA 4HJ8A 3FEWX 1NY4A 4FN5A 2A6EC 3CPFA 4XM3A 3SJPA 3ZBTA 5LL6X 1PYBA 1QUQA 4IPCA 1YLOA 3NBHB 1S5DD 3UE1A 4LF6L 4YHHQ 4NKLA 3BDCA 1UD8A 4RKBA 4E6IA 1CSPA 4DV6Q 1X55A 1PH4A 2PI2E 2PZTA 3EVQA 2QMUA 3KLWA 3N6RA 2D3LA 3V96A 1WDTA 2F52A 2X6LA 1T6ZA 3I3CA 3ERSX 1KHIA 3K5LA 2B2VC 3L7ZC 3JAMc 2XVSA 4PQXA 3LNNA 2PO4A 4Y9RA 2HUGA 3BY1A 5D14A 1DOKA 1XNRQ 4XIGS 1E64A 5M5WB 2HIXA 4Y7NB 5AJ3Q 1VF5C 2RSOA 3HOZG 3M4OB 1PLFA 1XB2A 3KBXA 3U4ZA 1QCBD 2BM1A 5IYPA 1I50H 1AW7A 4PZ6A 2Q2IA 3Q24A 1STAA 1LLRD 1NR2A 3CCVB 1Q8IA 1I4XA 2GVAA 1STNA 2KCNA 2SEBD 3KL9A 3NP8A 3Q3AA 2MFIA 2R9VA 2WKCA 1TS3A 5DM73 4FYDA 1RDPD 5M3MG 3PA2A 1DOMA 2Z8LA 4OO1G 4RGNA 1Q9SA 1II3A 2DIEA 4BPRA 4A3GG 3TS2A 2BF4A 4XL9A 3MXNB 3S1NH 1QOHA 4BY7B 2OQ0A 4O1NA 2VZLA 2RDGA 4EH1A 3E20A 1HNXL 3DWQA 4UP7A 4P75A 1PTOB 1BO0A 2KCMA 1WCMB 1NJID 3CTAA 4DV3L 1BX0A 4RCNA 5FO0A 1Y8OB 2PCFB 3CW2C 1E2WA 4U673 3MCAA 5IGEA 1OTCA 4LUOA 2K03A 3PUVA 4AH6A 2I07B 1ILPA 4LBZA 1IBMQ 1M8AA 2QGQA 2ICEC 4G7OC 3HOZH 1GUTA 5C0XJ 2UUBL 3F1ZA 2GN5A 5FA6A 1GUWA 2X69A 2F4VL 2BGIA 1CKNB 4RGMA 4JYAQ 5J39A 1L1OA 1V8QA 4G4KA 4B08A 4GKKL 3HOVB 1BBXC 3L2PA 1GUSA 3S2HB 2FJ2A 1BQEA 2L12A 4A93G 4DUZL 4CKBA 1D8LA 3BH4A 1VQPA 5EGTA 2UUCL 1UE5A 4RPDA 1N8RC 5M3MH 1PH9A 3CC4A 4XN3A 4XQNA 1EP1B 1FJGQ 1ZM3A 2BM0A 5D3DA 1CKOA 3U9SA 5FLMG 3AVVA 4OO1H 2B5OA 3U4VA 4DV2L 2RQXA 1MIUA 4A3GH 1I7PA 2RBMA 3CMAB 2HLDA 1H9JA 2FXQA 1TKWB 3UDIA 5IGDA 4TSFA 4QVAA 1NR4A 3VYUA 4A3EB 1Q86C 4YY3L 3HP3A 4LF9L 3HOYG 2K5NA 3S17H 2XRSD 4K0KL 4YELA 4X7DA 5CV8A 4CHTB 1KRSA 5I9PA 2CQOA 1J5EL 5AN9A 1LTBD 3KLSX 2LFNA 5E4XA 2PE3A 1BBWA 2A6ED 5A2QE 4IFDH 1PJ6A 2XIWA 1ZYRC 3OJXA 5C4XB 4JCVE 4C2MB 4ZGNB 1H85A 2F3WA 1A3UA 3GTLB 3VR6A 5DAUA 3TMEA 1K8AC 1IJFA 4P3YA 3G71B 2F3VA 4I7ZC 3M3YH 1PXUA 2EXDA 4DR5L 2B2WC 3GTOH 4FF3A 3E5SA 4A93H 3DMUA 2NVQB 1A3TA 2EYMA 4GLAC 2OQKA 3CRLC 3KDFA 3RZDB 2D9RA 4LF5Q 4DPGA 5FLMH 4KMUC 2SNMA 4B3XA 2KQ3A 3K8AA 3UDGA 3HAGA 3OKXA 2X85A 3EA6A 1JCKB 1EYDA 4FO2A 2O5JC 1GM5A 1EFUA 3CMEB 1OXTA 4P3IA 3HOYH 3GTPB 3G6JB 2JA9A 5C4ZA 4DAVA 3I4MG 1WCMG 4YCUA 4DR6Q 3TEHB 3A5UA 3FMCA 2WV6D 2KEEA 5BR8L 3LO8A 5DSZA 3DLLA 1Y14B 2JYOA 2ZTCA 3CCLB 5IIFA 2UUAL 1JNYA 1KTVA 4IJHA 4IW3B 2ZBVA 4LF4Q 2B3GA 3URYA 2CH4A 4L63B 4OP7A 2M5SA 2AMCB 2VB3X 1WOCA 4G57A 4HJ5A 2JA6G 2EY5A 4II3A 3HOVG 2HCCA 1V0FA 4LK1C 2BA0A 4II2A 4MYUA 1VDZA 1JR0D 2HHHL 4GKJQ 4N3NA 3B8HA 2JA5B 4F88A 3SK6A 2PI2A 5HY6A 4AIMA 4DN4M 1UD3A 4LFCL 1MHWC 3FJOA 5CYUA 2XZPA 1XWEA 3T4AC 2K7VA 1T6XA 1FGUA 2GVBA 1XMOL 5KGUA 1FRQA 3QG1A 1W34A 1WVLA 2F0SA 1N0VC 2ZBUA 4UZUA 1PFNA 3I4MH 1COWA 1WCMH 1YITA 4N9TA 2VXWA 2F0PA 1N8RD 4DQLA 1G8ZD 3AFQA 2LMCB 4HIDA 4AF7A 4JI1Q 2OTLA 1Q7YC 3GTGB 1GOZA 3GVKA 3WNDA 5C4XG 1AIPA 1WTHA 1K0SA 1YIJA 1VHEA 1EXMA 4CQJA 3D4RA 3Q6SA 4FF2A 1JE4A 3U9OA 4JI3L 2JDIA 1SNMA 2C78A 4CGYB 1PZID 3ITPA 5C3EG 3AEVA 3HOVH 2OBSA 3PUNA 2DY1A 1WTWA 2N78A 4J0QA 1PVOA 1PRTD 5GV7A 2KEDA 1AFPA 1CM9A 4IOAA 1LO5D 3G4SA 1ZYRD 2K01A 3PCOB 2BGJA 3OTOQ 4L8JA 3KLSA 3OJWA 2NYZD 4DR3Q 4HSVA 2O2LD 3SE0A 2E1BA 4AQYL 1C8CA 4P71A 3HOUG 1IBKL 1K8AD 4C3JB 1PHJA 3NE5B 5M3FB 4R4QA 1N0UA 4NB3A 2BMWA 3WNBA 1H9SA 1EY8A 2VQFL 2NZHA 5C0XI 5EPKA 3ER0A 3HFZB 3GV6A 1VQ6B 3OAAA 5KW9A 4IFDJ 1H9MA 5GV8A 4KTAA 1SYDA 3I56B 4X7FA 4B3SL 5C4XH 4ZRZA 3PIOA 4G7XA 4C2MH 3HKZB 1QGAA 1CQVA 3SEBA 5GADC 2ZJPA 3W2IA 4DR7Q 4B3RL 1FNWA 3VMFA 3JAML 3GTLH 2W6IA 2E2JB 1UNSA 4KJOA 3PIO3 2EQSA 4MHEA 4LF8L 2XZOA 3CPWA 1D1NA 2R7ZB 2EYLA 1HXYD 1TWFB 1N36Q 4QVJA 1MI2A 4DR1Q 2DEUA 3O13A 2K05A 1SROA 3RZDH 1MGSA 1Y69U 4DR4Q 4DKAC 3FPUB 4LF7L 4C3IB 4BS9A 1SNCA 4KN4C 4HJ7A 1QG0A 2X8KA 4PABA 4Z4VA 3N52A 1EWHA 1R5BA 4RD6A 4C3HB 2VUMB 1KD1C 4Z1MA 1ILQA 2X6GA 3CXCA 2N49A 3GTPH 1F2YA 2NN6H 3R2IA 5TY0A 1XX8A 2N88A 4X66L 5FLXc 1CA5A 1A62A 3CCJB 5FIUA 3S1MH 4GOPC 4AYBB 5CV5A 3RN2A 2IX1A 1HH2P 3V76A 1BDOA 3M9BA 3AVYA 4CDEC 4A3CH 5FO9B 3QOLA 5CDFA 2ES2A 3R3OA 1VQLB 1AE3A 3I4LA 5JPNC 5EBDA 3GTQH 1JC7A 3S16B 3C3LA 1KNEA 4WJ3M 4DK1A 2ZXOA 3GTKB 2AKWB 2NVXB 3OOCA 1XXGA 2R93G 4XOTA 4BBSB 1BR9A 3TP8A 4UAIA 1I94Q 1I4GA 4RHSA 2J7KA 4IN3A 2EYOA 4XLAA 1JA0A 1G2SA 2QEJC 3NHHA 4N9PA 4TVAB 1Z9FA 1TWCH 3ZYYX 1YJNA 2UU9L 4DV1L 5ELEA 2C2WA 2K75A 1E2ZA 3ND9A 4K6DA 3HOXG 1GHKA 1BVSA 5EBCA 1QE6A 5HGQA 4FF1A 2V7QA 4Z4UA 3ZZUA 1Q7YD 1VQNB 1VQAA 4HSPA 4JI8L 1N32Q 1E1OA 1K8GA 2Q2HA 4DAPA 2CHBD 2G5DA 4DXGA 4TQUS 3K58A 3LGJA 5THXA 2UXDQ 5JVG3 4C3JG 1L1OC 1DDGA 2F0JA 3H91A 4HIMA 4X6AH 4IPHA 4CBVA 4P12A 4DUYQ 4IOCA 1KK1A 1Q82C 3VR3A 4R4OA 1JA1A 3Q38A 3DUZA 2NPFA 4X3UA 5IYRA 2OBRA 2IT1A 5EKLA 5CBAE 3JAMi 3GTGH 2WAQG 5I2XA 4CJ1B 5E3FA 4AF6A 2R93H 3A8JE 1Q8KA 4B44A 3I55A 1MJCA 2KHJA 4M2LA 2Q8RE 2Q6KA 1VF7A 4B9WA 4NMZA 4R8IA 2R7ZG 4N8X1 1NMGA 4JI4L 2QDBA 4XQQA 3WWVA 4YHHL 1QJOA 3HOXH 1S5CD 2IHEA 1B2RA 2JN4A 1MJEA 3B78A 5IODA 3MVVA 2F0NA 2QA4B 2BE5C 2P3MA 3ONUA 1QVGA 3L9AX 1K3RA 2NZ1D 4DFAA 2IHFA 4ZQ3A 3Q22A 2K50A 4A75A 1EFWA 3A5ZB 4UDUC 2TMPA 1KK2A 2Z6KA 4XONA 1YJWA 1SM4A 4C3JH 2JQOA 2MGSA 3NQTA 4P74A 2A68C 4PV1C 1VQFA 2ZTGA 1H8EA 2XNCA 4I7AA 2SOBA 1SNPA 3D6WA 2E2IB 1G7RA 1WP6A 1GR1A 1QGZA 1YI2B 4YEJA 4YWKA 1W2BB 4XKVA 2E2HH 2CQAA 2UXBQ 1MRZA 1BNZA 4QUFA 1XTDA 3HOWB 3KEWA 1T6YA 1JICA 1KD1D 2KHSA 1GHJA 4XXEA 5LL6S 1CUKA 1QFJA 3C1FA 2C5CA 4PZ8A 3K6OA 1SE3A 2E8GA 2VNUD 4OO1I 3J81j 5BSXA 3I1FA 1G91A 1HUMA 4PMWA 3S24A 4XT3B 2OK7A 1UMKA 1WTPA 2R7ZH 3OW2A 3NELA 1I5FA 1OXVA 4X62L 4HIKA 1S3OA 3P7JA 1XPUA 5ELBA 4ZCLA 3AYHB 2CBXA 2HDNB 4RMFA 5I4DA 1WTXA 1XJVA 4K8JA 1E63A 1G7TA 5JJZA 4DR2L 2O4XA 1HFGA 2CC2A 4V0BA 2QKIC 3WOEA 1HZEA 4OONA 1GJRA 2F0VA 4JBKA 1BUVT 4TMTA 2HD3A 1EY9A 1U4RA 4KJNA 3A74A 4XD7A 4C3HH 2E1RA 5DEHA 4YALA 4QUZA 4IFDI 2VBTA 2L11A 3NXWA 1IBML 2OTJA 2OT2A 2ZM6L 1UE1A 2DOGA 5JPMC 2R6HA 3HOZB 2IY5B 1K9MC 4Z4TA 3P1HA 4N8FA 3DHQA 3BVZA 5F4JA 1AEXA 4LUZA 3X3MA 1M1KC 1E1TA 2KJXA 5IYWA 2X0KA 3K7UC 1VQKA 1JOKA 4XLHA 3G48A 3S15H 3S16H 1FNMA 4HTHA 1K8OA 3W2GA 3OP1A 1TTTA 4A3FG 1VQ8A 1QUQB 4J8QA 3GTKH 3MEHA 2NVXH 4J1MA 3W2FA 1JQYD 5C4JH 1B8AA 4BBSH 2QF7A 1FJGL 4DXFA 2Z6BD 3Q8DA 1XTCD 3RNUA 1Q82D 1PYWD 4RHRA 5DLQE 3W1GA 1JE5A 5KRUA 3PO2G 2CH4W 3FPKA 1QFYA 2BOSA 3AMUA 1E3ZA 5HZAA 2WSSA 4WZKA 1Y1VG 1EZ8A 4K5XA 2ZTNA 2BSAA 2EPBA 4DV5Q 2FVGA 1G7SA 1STYA 4Z4ZA 4BWGB 3S17B 5ELFA 3KLRA 3QIAA 2C4TA 2DUDA 4L5SA 3CB4A 2KVMA 1U5KA 4N3GA 4DA2A 2BCOA 5M5XB 1A8VA
chains in the Genus database with same CATH topology
1HTPA 4C1NK 3CKIB 4ZUJA 1F2ZA 3BCDA 4QB4A 1I8DA 3I72A 1S5ED 3GQBA 1B2TA 2BE5D 3IL8A 5K36G 4DU9A 4A93B 3BS1A 1WTRA 2JIZA 4KHVA 2A68D 5FO7B 4ZKBB 4RKLA 2PW5A 3LWEA 3UI2A 1LT4D 4IQZA 1U4PA 1W6JA 2ZXRA 1T5XD 1B1ZA 2DNCA 5I6WA 5DN6A 3HOYB 5KNLA 4JMQA 2A73B 2D62A 1V43A 4IALA 1TS4A 4WORA 1HCZA 2BA1A 1HUNA 5IGBA 3PO3B 1E3XA 2K6AA 3L3OC 1B4OA 2JEAI 1OXXK 2AQ3B 1RF2D 2R3ZA 5FKAC 2RVLA 4PMBA 3CP2A 2B8GA 5FLXL 4X3SA 2CK3A 1LTRD 5EQ0A 5K36H 4XMYA 1SDFA 3MFYA 2WINB 2M9VA 5T1GA 1ZXTA 2DN8A 2B2YA 1SJHD 3FKSA 2L1BA 4XNFA 4A3KB 4IUUA 3CMMA 3QB3A 3GP7A 4HMJA 3I4MB 5JVH3 4HIZA 3GO5A 2BCOA 2RDFA 3DWPA 5G3LF 5CMDA 1B3AA 1SAPA 1EY7A 3BYTB 4XLEA 3Q23A 2K04A 1SYCA 5JAVA 3OFNA 4GQNA 3NBHA 3HS0C 1W9XA 5D3IB 2JA6B 4CKEA 3S1RB 2EYPA 1KDCA 2VJJA 2EYHA 1LABA 2J4XA 1STGA 1OO9B 2MPMA 1MSGA 5E1FA 3VR4A 5CGKA 3KBGA 1ENFA 1D5XC 2V4DA 2R6GA 3PUXA 4QF4A 3G7LA 2E75C 2NN6I 3FKIB 1H8HA 3I70A 1HQMC 3GV3A 4XDXA 4DK0A 2MP1A 3BC9A 4XYQA 5HKKA 5NUCA 1KTKA 1I4HA 4ZK9B 1D6EC 1B9MA 1Q90A 4KY6A 3VA5A 1F9RA 1D5MC 1A6XA 2NTTA 3GTMB 4ULLA 1X32A 5C3EB 2K33A 4TKOB 4IUQA 2EXZA 2A74C 3K5MA 3D31A 4YXWA 2X6XA 1B50A 3TZDA 3C1EA 3IFTA 3EFXD 4ZYSA 2JSOA 2NBFA 4YIJA 2PZUA 3HOUB 5EKKA 3MC0B 4XLFA 1TT2A 1TIID 5CV4A 2GK6A 1SXTA 4F7XA 4XR6A 1IW7C 3CQZB 1K8MA 1AN8A 2PMZB 3M7NA 3S1MB 1UD6A 2F4IA 1SYGA 3A55A 2F0TA 2W6JA 3VYRA 2O5IC 4XYOA 3PUYA 3GTQB 1HQRD 1O7ZA 1RJTA 4LAAA 3MAQA 4XQJA 2L9HA 3D4WA 3RMHA 5FL7A 1PFBA 2WIIB 1TWCB 3WOFA 4JBWA 4XOPA 1PKVA 2K28A 4OIKA 5K5PA 4ID6A 3ZPNA 3J7AV 1J9OA 3S2DB 2NB0A 5FK9C 1NCVA 1L0YB 1H9SB 2IWHA 3D4DA 2EYJA 2F0OA 2A69C 2PW7A 4S3SA 3K57A 1DJRD 3BZDB 3W3AA 3SDZA 2KUMA 1K28D 1KLUD 4RA8A 1F9QA 1SYFA 1Z6HA 4P2CB 3T13A 3I91A 5CR3A 1S4ZA 4F87A 2R93B 1HTLD 1QNUA 1SMYC 4FXDA 1EY5A 1U4MA 4FXKC 1Q1BA 3FRPB 3HOXB 3H3VC 1CZGA 3V2TA 1TVXA 3T56B 3RD4A 2F0GA 3H09A 1B44D 3I4NB 5KNCA 3NWTA 2IPKD 4XORA 1BMFA 2B2UC 1RKNA 4F8MA 3NUCA 2ZXPA 4KY7A 2QILA 1JB3A 5I6YA 4OGQC 5G3LD 3KK7A 1EU4A 1CZWA 1WD0A 4J6HA 2KCCA 3CESA 1MBYA 2JEBI 2WJYA 2WZPP 1TQOA 2JE6I 4QUCA 1X3QA 2E2HB 4B3FX 1ZKOA 2WAQB 1SYEA 5C3XA 2JJ2A 3GD7A 3SHLA 1CHQD 2F0QA 1I6VC 5KNBA 1AP0A 3QO2A 3QJYA 1TWHB 1KMHA 2EY2A 1SE2A 1DOLA 2J0TD 2PYKA 1TU2B 2PZWA 4LMQD 5CV9A 4EQNA 3FDTA 2XNDA 2F0WA 4IZ8A 4RWSC 3I73A 4RCOA 5M9OA 1RHPA 1UD4A 1LTAD 3D8GA 1JOQA 1OHHA 3IFDA 4Q5VA 2HDLA 3S15B 2B2YC 2G9HD 3OEHA 1UUPA 3Q0AA 2XZLA 4RAUC 5CORA 1UEAB 2RSNA 4B9XA 5C4JB 4HCEA 2A69D 4QMGA 1NAPA 1ML0D 1WD1A 2GJKA 2VJIA 1BXTA 1EFRA 4IUPA 4O42A 2F0EA 1STBA 1HPCA 3A7LA 1EU3A 3A3BA 1S5FD 1SE4A 1PDQA 1HFNA 1PTOF 4IUVA 2NVTB 1JWMD 2YU9B 5JEAG 3TP5A 1EY6A 1NSNS 4ASUA 1R4QB 1JORA 1SMYD 2AQ1B 4KD4A 1IKLA 2EJMA 1W0JA 4MN3A 2FMCA 4FNFA 3PIP3 3W2DA 3EJIA 2L55A 4DGZA 1QG7A 2JJ1A 3OW7A 3CRKC 4A3FB 2R61A 3M7GA 2B2TA 4K8IA 1LT5D 1M4VA 5ISRA 3PO2B 5ELCA 1BLIA 2A6HC 3SK4A 3A35A 2JXMB 1Y1VB 1SJED 4TRDA 1YNNC 1TY0A 1HRJA 3PMFA 1EZ6A 2FINB 4WJWA 4AVZA 4KN7C 1WTVA 5JEAH 3VR2A 3MXUA 2IW3A 3P20A 1HHVA 3SK8A 3K0YA 5T1IA 1E1QA 3AU7A 2G9DA 3OEEA 3V05A 2FHTA 1W0KA 1EEFD 2KECA 1STHA 1NRKA 2AUJD 2ICIA 3H0GB 2F0KA 1ENAA 1GUGA 1TWAB 2M2LA 3X3NA 4IURA 4K2LA 1G2TA 3NTKA 3SK5A 3SXHA 3MZ5A 4KV6A 3G05A 1EWCA 5C0XG 1KDAA 4EVOA 2EJGC 2GA4B 3ZIAA 2PQEA 3EROA 3MTSA 3PV0A 1IYUA 2WKDA 1G291 2L0CA 4Q0FA 1DCZA 2OXPA 3HRZC 2KOLA 4WRDA 1R9TB 1DM0B 1G6ZA 3D3RA 4ME5A 1EFID 3WQZA 2QCPX 4RGOS 1O78A 4XTCS 1H9KA 1ONLA 4RFBA 3R8BA 2L4NA 2XWJB 2NVYB 1TS5A 2Y0SB 4M8AA 3J7AF 3OMCA 3S1QB 4FXUA 1CA6A 3TP7A 5BN5A 1Z47A 5CC4A 2XOKA 4GZYC 3TN2A 3CU7A 1ZEQX 2XGJA 4TSSA 4WFN3 5C0XH 4G7WA 1EOTA 2RA4A 1FGBD 4K5VA 3GVLA 1I3QB 2IX3A 1SYBA 5JOBA 3VYTA 2FMMA 1KABA 3FVQA 4X3KA 5IGGA 2A5HA 4BA2I 3J81L 3K7AB 2HDMA 1J8IA 1NUCA 1FYCA 3RZOB 2A6HD 1RODA 4KHZA 2Z4IA 1YNJC 1YNND 1SFOB 3NPPA 1RD9D 3OHXC 3TP6A 3A56A 3K5NA 1VMPA 2XNAC 2SNSA 3C2PA 1SBBB 1DD2A 5CV6A 1EYCA 1F9PA 4QIWB 1NBMA 1DXMA 4G7HC 2F0DA 2PNRC 2IJ0A 3RLFA 1TWGB 3NSWA 4A3JB 3BG3A 3I8ZA 5LHY1 3QWNA 1Q3LA 5DNFA 1STEA 2E2DC 2E74C 1D1IA 4CKCA 3M85A 2WB1B 1LV9A 1ESFA 3J80L 1UAPA 2EYFA 2HQEA 3HGBA 2OEOA 4X3TA 3QOJA 1B9NA 1EY0A 1LTTD 2F0MA 4ZUIA 4HEDA 2XRQD 4KKUA 2HCIA 5HGTA 1CHPD 2KA7A 4B3GA 2YYZA 1MABA 5CBEE 4K14A 3NTIA 5C4HA 2RDHA 1CQFA 2BDNA 1U4LA 1ESRA 4ZLTF 5IT9L 1BOSA 4K5WA 2Z4HA 5BN4A 1GUNA 3IKJA 3ONAB 2EZVA 1PFMA 1LT3D 1MD2D 1V1PA 2AWOA 1FX0A 1SKYB 1E43A 1PRTF 2LS01 3OPOA 3CP8A 2R92B 4BBRB 1IKMA 1WTHD 2ZZEA 1FD7D 1FNUA 3T53B 4IFDG 2NTSA 1EY4A 2GJRA 2B63B 5J22A 5C3WA 4XN0A 1YNJD 2XN9C 2N55A 4A3IB 2Q8TA 2D9UA 5KYIA 5IGCA 2F43A 1GUOA 4OL7A 1JWUD 5IGFA 5C5MA 2X53S 2B2TC 2CW0C 3A8IE 3D6CA 1IL8A 1RTNA 4H0LC 4HR7B 1OB0A 3A3GA 3MWYW 2K5DA 2D3NA 5C44B 1JOOA 3ND8A 1RTOA 3BYYB 3MXNA 1FNVA 1XYIA 3A54A 1WTWA 2V31A 3PUWA 1CI3M 1PRTC 1U9RA 3F2UA 2Z1CA 1BCPF 1Q12A 2AUKA 2X6YA 3HEJA 4FF4A 3FPPA 1TY2A 1VLYA 1I4RA 5ELDA 3E0JA 2ID0A 5I2YA 1OXSC 1KNAA 3EQLC 2JA7B 3OMGA 3SVMA 2AQ2B 2MHVA 4CJ0B 1W6KA 3DM1A 1HA6A 3C46A 3VA7A 3HZXA 1EQTA 4EQPA 1K83B 4NW2A 3MA2B 2B8FA 4TT3A 5EJWA 3H94A 1Y8PB 5C6AA 4A3DB 2LKVA 2NWGA 2WACA 2F0FA 4C1NI 4A3BB 1TS2A 2K32A 2K5WA 3K5OA 1KZLA 1BF4A 5I9OA 2X6WA 2ENBA 3VYSA 2F1MA 5A2QL 5F2DA 1Y8NB 4L6TB 4XT1B 4EQOA 1QNKA 4XKWA 1B53A 2TSSA 4FXGC 3TSSA 1Q1EA 4QCLA 5DM63 4NP5A 1BCPC 4HAEA 4FVMA 3SR1A 3MHBA 2LY7A 1V0EA 4H44C 2BDOA 2F0UA 3JAME 2EE1A 1EIGA 3H6MA 5EPJA 2PPBC 1ET6A 1S5BD 2I46A 3NTHA 4P22A 4DNTB 4HMIA 4I65A 1PTOH 5D65A 2CVRA 1UD5A 1CT1D 1HVXA 5KEEA 1OXUA 1A2TA 2CW0D 1V1OA 4C56C 3ERQA 4NDXA 5CV7A 1LT6D 4EGVA 4V190 2FFKB 4KI0A 2WPDA 4ZKCB 3VR5A 1DYQA 1O7YA 3K59A 4IUTA 3PUZA 1KLGD 2C9OA 1Y1WB 2EY6A 1L0XB 1GJXA 3BVMA 4MIUA 3WDNA 1EL0A 4R8NA 1F77A 4ZAIA 2EJFC 4RH6A 3KF8A 4PNYA 1PMRA 2NN6G 1IW7D 3OE7A 2IX0A 5KNDA 4G7ZC 1FR3A 4LJZC 2MJ8A 1UD2A 1SNDA 3BVGA 1C4QA 4E0FA 3R2TA 1PZKD 2K1BA 1VJSA 3DXJC 4ABNA 1A15A 1QB5D 3NQIA 3NK9A 2B2VA 3OIPA 1LACA 2K5QA 3A8KE 3E6ZX 1GXDC 2RKSA 5J1ZA 4HCSA 1IHZA 4RGTA 5M5YB 1ET9A 3RUZA 3NBIA 4H7BA 4NNJA 3MFGA 2ZXIA 3OWEB 1H9RA 3DEOA 5AFWA 5KYLA 3NWSA 4G6IA 4ILWA 3R93A 4FP5D 2GK7A 3MXPA 1ICWA 4KY5A 1BCPD 2VB2X 4R9WA 1BPLA 2F0LA 3OWFA 1PRTB 1SNOA 1VMCA 5KIXA 5IK2A 5HURA 5E4WC 1SEBD 2D2CC 1T5EA 1D5ZC 3DEPA 1D2BA 3TBIB 3M4YA 5BN3A 2NUCA 3IAYA 3GVJA 1I18A 4BY1B 3BDLA 1EEID 3J7YW 4KD3A 2F03A 3BCFA 2EY1A 1AZQA 4HN7A 1LTGD 5EKIA 1E79A 4XQFA 5A35A 2M00A 3LWUA 1CK1A 4KKSA 1F2MA 3TDQA 4ODGA 1CFMA 3P75A 4OIJA 2ZZGA 2ZZQA 2F0IA 1BQQT 2XWBB 2QE7A 1A3VA 2H4OA 2AWNA 1I6HB 3I90A 2WJVA 4CJ2C 1EIHA 1PZJD 3AB9A 1PTOC 2GJPA 1QILA 1R4PB 1SSOA 4KKTA 4U68A 3BDOA 4XLCA 2D5DA 1RCVD 1HA5A 1KAAA 2ZT9C 3S14B 4C3IG 1BCPB 1QWYA 2B2WA 2SDFA 4C3HG 1EQVA 1O80A 2B39A 4DAYA 1F2LA 1O7LA 2DY8A 5FO8B 2F0HA 1I50B 1DONA 2E76C 1VCIA 1LTID 1C48A 3J81E 4DNRB 1E1RA 4KK7A 1WTQA 2XSCA 5TSSA 2ZXHA 1D1KA 3DWAA 1JWSD 3S1NB 1LTSD 1I4QA 3S9WA 4DF7A 4Z9CB 5FOBB 5EPLA 3LX0A 3CHBD 2Q8IB 2MUYA 2WP8J 1A2UA 1CTMA 3MXGA 3TZUA 4BA1I 2JP1A 4IUNA 1KDBA 3JU4A 2H1EA 4H13C 3GTJB 4OHJA 2EDGA 3T16A 3J80E 2LZJA 2EVBA 1WPCA 2ZZFA 5M3MB 4K2KA 1EYAA 4K6LA 4PMCA 2DY7A 1AZPA 4A3GB 3KUPA 1WTOA 4JK1C 5FLXE 3OIQA 1MSHA 3HG9A 1SNQA 2EOTA 2KVOA 3OSOA 3T51B 2JA8B 1X3PA 1DZ1A 1F9SA 1E0BA 4M1UB 4A3MB 3DDYA 5IT9E 2B2UA 1PTOD 3A7AB 2DNEA 2J7ZA 1Z7TA 2IL8A 5IOCA 1TR5A 3M3YB 2L5TA 3GTOB 1IYVA 1V1PB 1ENCA 5COYA 5JEAJ 1E2VA 5C5LA 1I4PA 3FEWX 2A6EC 4XM3A 5LL6X 1S5DD 4NKLA 3BDCA 1UD8A 4RKBA 4E6IA 2PZTA 3EVQA 3N6RA 2D3LA 3V96A 2X6LA 3I3CA 3K5LA 2B2VC 3L7ZC 2XVSA 4PQXA 3LNNA 2PO4A 2HUGA 5D14A 1DOKA 4XIGS 5M5WB 4Y7NB 1VF5C 2RSOA 3M4OB 1PLFA 3KBXA 1QCBD 1AW7A 3Q24A 1STAA 1LLRD 1NR2A 1Q8IA 1I4XA 1STNA 2KCNA 2SEBD 3NP8A 2R9VA 2WKCA 1TS3A 5DM73 4FYDA 1RDPD 1DOMA 2Z8LA 4OO1G 4RGNA 1II3A 2DIEA 4XL9A 1QOHA 4BY7B 4O1NA 2RDGA 3DWQA 1PTOB 1BO0A 1WCMB 4RCNA 1Y8OB 2PCFB 1E2WA 4U673 5IGEA 2K03A 3PUVA 2I07B 1ILPA 1M8AA 2ICEC 4G7OC 1GUTA 5C0XJ 1GUWA 2X69A 4RGMA 5J39A 1V8QA 4G4KA 4B08A 3HOVB 1BBXC 3S2HB 1GUSA 2FJ2A 2L12A 4CKBA 3BH4A 5EGTA 4XN3A 4XQNA 5D3DA 3U9SA 4OO1H 2RQXA 2RBMA 2HLDA 1H9JA 1TKWB 5IGDA 4TSFA 1NR4A 3VYUA 4A3EB 3HP3A 2XRSD 4YELA 5CV8A 4CHTB 5I9PA 1LTBD 3KLSX 2LFNA 5E4XA 2A6ED 5A2QE 4IFDH 2XIWA 1ZYRC 5C4XB 4C2MB 2F3WA 1A3UA 3GTLB 3VR6A 5DAUA 3TMEA 2F3VA 4I7ZC 1PXUA 2B2WC 4FF3A 3E5SA 3DMUA 2NVQB 1A3TA 2EYMA 3CRLC 3RZDB 4KMUC 2SNMA 2KQ3A 3HAGA 2X85A 3EA6A 1JCKB 1EYDA 4FO2A 2O5JC 1OXTA 3GTPB 3G6JB 5C4ZA 4DAVA 3FMCA 2WV6D 2KEEA 2JYOA 5IIFA 3URYA 4L63B 2M5SA 2VB3X 4G57A 2EY5A 4II3A 2HCCA 1V0FA 4LK1C 2BA0A 4II2A 1VDZA 1JR0D 2JA5B 4F88A 3SK6A 4DN4M 1UD3A 5CYUA 2XZPA 1XWEA 3T4AC 2K7VA 5KGUA 3QG1A 1WVLA 2F0SA 4UZUA 1PFNA 1COWA 4N9TA 2VXWA 2F0PA 1G8ZD 2LMCB 3GTGB 1GOZA 3GVKA 3D4RA 3Q6SA 4FF2A 1JE4A 3U9OA 2JDIA 1SNMA 4CGYB 1PZID 3ITPA 1PRTD 1AFPA 2KEDA 1CM9A 1LO5D 1ZYRD 2K01A 4L8JA 3KLSA 2NYZD 4HSVA 2O2LD 3SE0A 2E1BA 1C8CA 4C3JB 3NE5B 5M3FB 1H9SA 1EY8A 5C0XI 5EPKA 3GV6A 3OAAA 4IFDJ 1H9MA 4KTAA 1SYDA 4ZRZA 4G7XA 3HKZB 1CQVA 3SEBA 1FNWA 3JAML 2E2JB 2W6IA 1UNSA 4KJOA 3PIO3 4MHEA 2XZOA 2R7ZB 2EYLA 1HXYD 1TWFB 1MI2A 3O13A 2K05A 1MGSA 1Y69U 3FPUB 4C3IB 4BS9A 1SNCA 4KN4C 2X8KA 3N52A 1EWHA 4C3HB 2VUMB 4Z1MA 1ILQA 2X6GA 1F2YA 2NN6H 3R2IA 1XX8A 2N88A 1CA5A 4AYBB 5CV5A 2IX1A 1BDOA 5FO9B 3QOLA 5CDFA 3R3OA 3I4LA 5JPNC 5EBDA 3S16B 1JC7A 3C3LA 1KNEA 4DK1A 2ZXOA 3GTKB 2NVXB 3OOCA 1XXGA 4XOTA 4BBSB 1BR9A 3TP8A 4UAIA 1I4GA 4RHSA 4IN3A 2EYOA 4XLAA 1G2SA 2QEJC 3NHHA 4N9PA 3ZYYX 5ELEA 1E2ZA 3ND9A 4K6DA 1GHKA 5EBCA 1QE6A 4FF1A 2V7QA 4HSPA 4DAPA 2CHBD 4DXGA 4TQUS 3K58A 5JVG3 4C3JG 2F0JA 3H91A 4CBVA 3VR3A 3DUZA 4X3UA 5CBAE 2IT1A 5EKLA 5I2XA 4CJ1B 5E3FA 3A8JE 2Q8RE 1VF7A 4B9WA 4NMZA 4R8IA 2QDBA 4XQQA 1QJOA 1S5CD 5IODA 3MVVA 2F0NA 2BE5C 3L9AX 2NZ1D 4DFAA 3Q22A 4ZQ3A 4UDUC 2TMPA 4XONA 2MGSA 3NQTA 2A68C 4PV1C 2ZTGA 1H8EA 2SOBA 1SNPA 3D6WA 2E2IB 1WP6A 4YEJA 4XKVA 2CQAA 1BNZA 4QUFA 3HOWB 3KEWA 2KHSA 1JICA 1GHJA 4XXEA 5LL6S 3C1FA 2C5CA 3K6OA 1SE3A 2VNUD 4OO1I 1G91A 1HUMA 4PMWA 4XT3B 1WTPA 1OXVA 3P7JA 5ELBA 5I4DA 1WTXA 4K8JA 5JJZA 2O4XA 1HFGA 4V0BA 2QKIC 3WOEA 1HZEA 2F0VA 1BUVT 4KJNA 1EY9A 1U4RA 4XD7A 5DEHA 4IFDI 2L11A 3NXWA 2OT2A 5JPMC 3HOZB 3P1HA 3DHQA 3BVZA 1AEXA 3X3MA 2KJXA 1JOKA 4XLHA 1K8OA 4HTHA 4J8QA 3MEHA 4J1MA 1JQYD 2QF7A 4DXFA 2Z6BD 1XTCD 1PYWD 4RHRA 5KRUA 2BOSA 3AMUA 1E3ZA 4K5XA 2WSSA 1EZ8A 2ZTNA 2EPBA 1STYA 4BWGB 3S17B 5ELFA 3KLRA 3QIAA 2KVMA 4DA2A 2OF1A 5M5XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6E C;  2O5I C;  4OO1 H;  3PUY A;  1EWH A;  1HTP A;  1I6V C;  1Q12 A;  4GZY C;  2D2C C;  2AUK A;  5KNB A;  2A68 C;  1T5E A;  4KI0 A;  3FPP A;  4PV1 C;  3QJY A;  1H9J A;  1TKW B;  2NN6 H;  2K7V A;  3VR5 A;  5C0X H;  3CRK C;  3M4Y A;  3QG1 A;  5BN3 A;  2A6H C;  2JXM B;  1OXS C;  3PUZ A;  3I72 A;  1YNN C;  1BDO A;  3EQL C;  1TU2 B;  3GQB A;  4JBW A;  5BN4 A;  2BE5 D;  3N6R A;  1GJX A;  1LAB A;  2LMC B;  5K36 G;  2A6E D;  3I4L A;  4KN7 C;  1GUN A;  3WDN A;  4IFD H;  3IKJ A;  2Q8I B;  5JEA H;  1GHJ A;  1ZYR C;  4DK1 A;  3VR2 A;  2A68 D;  3L7Z C;  2AWO A;  3MXU A;  4BA2 I;  3P20 A;  3LNN A;  3OOC A;  5A35 A;  2EJF C;  3VA7 A;  1CTM A;  3VR4 A;  3TZU A;  3D4R A;  3OPO A;  3LWU A;  4XIG S;  1FYC A;  4BA1 I;  3I73 A;  1VF5 C;  4IQZ A;  1H9S B;  2A6H D;  4KKS A;  2V4D A;  4KHZ A;  3VR6 A;  1PMR A;  2B8F A;  2NN6 G;  1YNJ C;  2R6G A;  1IW7 D;  3PUX A;  3H94 A;  2A69 C;  1Y8P B;  5KND A;  4G7Z C;  4I7Z C;  1FR3 A;  1OXV A;  2DNC A;  2E75 C;  2NN6 I;  4LJZ C;  4H13 C;  1E2Z A;  1CFM A;  3ND9 A;  1GHK A;  2K32 A;  2EDG A;  3W3A A;  1HQM C;  2D62 A;  1V43 A;  3SDZ A;  3T53 B;  3CRL C;  2AUJ D;  4DK0 A;  4L8J A;  2EVB A;  4IFD G;  4KMU C;  1HCZ A;  1DD2 A;  3DXJ C;  2BA1 A;  1Z6H A;  4TQU S;  2F1M A;  1B9M A;  1Q90 A;  3SE0 A;  4OO1 G;  1Y8N B;  1DXM A;  1GUG A;  4G7H C;  2O5J C;  3NE5 B;  2A69 D;  2JEA I;  1OXX K;  1OXT A;  2PNR C;  3VR3 A;  1LAC A;  4JK1 C;  3RLF A;  1SMY C;  1A6X A;  5C0X G;  3BG3 A;  3A8K E;  1H9S A;  3AB9 A;  2EJG C;  2B8G A;  1Q1E A;  4KKT A;  3BDO A;  1GUO A;  2D5D A;  2K33 A;  4TKO B;  1HPC A;  3A7L A;  3PV0 A;  1Q1B A;  1IYU A;  5K36 H;  1H9M A;  2IT1 A;  2ZT9 C;  3FMC A;  1K8O A;  1G29 1;  2E74 C;  3T51 B;  3T56 B;  4RCN A;  3MFY A;  1DCZ A;  3M85 A;  1Y8O B;  2PCF B;  3D31 A;  1E2W A;  2CW0 C;  4H44 C;  2BDO A;  3A8I E;  2DN8 A;  5KNC A;  3PUV A;  2QF7 A;  5JEA G;  1H9R A;  3A8J E;  2PPB C;  4H0L C;  3IFT A;  4G7O C;  4HR7 B;  1GUT A;  4OGQ C;  3HGB A;  1VF7 A;  1O78 A;  1H9K A;  1ONL A;  4XTC S;  3U9S A;  3A7A B;  2DNE A;  2EJM A;  4DNT B;  1B9N A;  1Z7T A;  3ND8 A;  1O7L A;  1V8Q A;  1IW7 C;  2KCC A;  1QJO A;  1K8M A;  2E76 C;  1VCI A;  2BA0 A;  4LK1 C;  1GUS A;  2L5T A;  3KLR A;  3QIA A;  1OXU A;  1VDZ A;  2JEB I;  3M7N A;  1Y69 U;  1CI3 M;  2JE6 I;  3PUW A;  1IYV A;  4DNR B;  1E2V A;  2BE5 C;  4KKU A;  1ZKO A;  5BN5 A;  3OW7 A;  4KN4 C;  3GD7 A;  2KA7 A;  2YYZ A; 
#chains in the Genus database with same CATH topology
 5B6I A;  1HTP A;  4C1N K;  1WSV A;  5IY0 A;  2DGY A;  3CKI B;  1GO2 A;  1S4M A;  1ASY A;  4ZUJ A;  2GPJ A;  1JJ2 B;  1F2Z A;  3BCD A;  4QB4 A;  1I8D A;  4RD0 A;  1KK0 A;  1OGI A;  1TVC A;  3I72 A;  3ULP A;  1S5E D;  3KF6 B;  3GQB A;  4GOP B;  1B2T A;  2BE5 D;  3CC7 B;  2OK8 A;  3R6J A;  3IL8 A;  3H0G G;  5K36 G;  2HCJ B;  2YWH A;  4A3F H;  4DU9 A;  4A93 B;  3BS1 A;  1WTR A;  5LMN Q;  2JIZ A;  1IZ6 A;  4KHV A;  2A68 D;  1X65 A;  5FO7 B;  2MO0 A;  4GLV B;  4LF5 L;  4ZKB B;  4RKL A;  2PW5 A;  3LWE A;  3UI2 A;  3PO2 H;  1LT4 D;  4IQZ A;  1U4P A;  3H9N A;  1QFZ A;  1W6J A;  4POF A;  1VQM A;  1Y1V H;  2VNJ A;  2ZXR A;  1T5X D;  4M0L A;  1B1Z A;  2VNK A;  1MKH A;  2DNC A;  2Q6O A;  1XPR A;  5I6W A;  5DN6 A;  1QVF A;  3HOY B;  5KNL A;  4JMQ A;  1WSR A;  2A73 B;  3A0J A;  3VO1 A;  1V43 A;  2D62 A;  4IAL A;  4X7C A;  1TS4 A;  1CKM A;  4WOR A;  3SLN A;  1HCZ A;  4QFM A;  2N3S A;  2BA1 A;  1X3G A;  4JOI A;  1HUN A;  5J3O A;  5IGB A;  3PO3 B;  1NE3 A;  1E3X A;  5HZB A;  2K6A A;  4JI7 L;  3L3O C;  4B43 A;  2EIF A;  3FHW A;  1B4O A;  5A89 A;  2JEA I;  1L1O B;  1OXX K;  2AQ3 B;  2E2I H;  1RF2 D;  2R3Z A;  5FKA C;  4P25 A;  4Z4Y A;  1E3P A;  1ZUN B;  2RVL A;  4PMB A;  3CP2 A;  1VQP B;  2B8G A;  1W3S A;  2Y0S G;  3D26 A;  1ICF B;  3PQI A;  4X3S A;  2CK3 A;  5FLX L;  1LTR D;  1F20 A;  3CC4 B;  1F60 A;  1YHB A;  3TS0 A;  2C35 B;  5EQ0 A;  5K36 H;  4XMY A;  3HOW H;  2V1C C;  1SDF A;  4KLK A;  3MFY A;  4DV0 Q;  3CAM A;  2WIN B;  2M9V A;  3K0X A;  5T1G A;  1YHQ A;  4UZF A;  1ZXT A;  2DN8 A;  1TWA H;  4RD2 A;  4JI2 Q;  1G6P A;  3CCS A;  4O0A A;  1K9M D;  1SJH D;  2B2Y A;  3FKS A;  1QVC A;  2L1B A;  4XNF A;  4DNI A;  5BSY A;  4B3M Q;  4A3K B;  4NPS A;  2ZIT A;  1M1K D;  4IUU A;  3AST A;  3E9H A;  3J81 i;  4OEM B;  4OX9 Q;  3C2Q A;  3CMM A;  3TRE A;  3QB3 A;  3GP7 A;  4HMJ A;  3I4M B;  5JVH 3;  4HIZ A;  3GO5 A;  2RDF A;  1N9W A;  3DWP A;  2BH2 A;  5G3L F;  1JMC A;  5CMD A;  1B3A A;  1N34 Q;  2XNJ A;  1SAP A;  1EY7 A;  3BYT B;  1PJ7 A;  4XLE A;  3Q23 A;  2K04 A;  3AVU A;  4X64 Q;  1SYC A;  3JQR A;  2K5V A;  3ASQ A;  3BU2 A;  4NXN Q;  5JAV A;  2NVY H;  3OFN A;  3EBE A;  4GQN A;  3NBH A;  3HS0 C;  1W9X A;  2BN4 A;  5D3I B;  1FVI A;  2JA6 B;  4CKE A;  3S1Q H;  3S1R B;  3KDF B;  2EYP A;  1KDC A;  2VJJ A;  2EYH A;  1LAB A;  1UE7 A;  2ZJR A;  2J4X A;  1STG A;  3VNV A;  5FJ8 G;  3OTO L;  1OO9 B;  4ACB A;  2MPM A;  1MSG A;  3BJU A;  1QUE A;  5E1F A;  3VR4 A;  5CGK A;  3KBG A;  2NV4 A;  1ENF A;  2V7W A;  1BBU A;  1D5X C;  2V4D A;  4A3J G;  1I3Q H;  2R6G A;  2ATW A;  3PUX A;  3GDE A;  4QF4 A;  3G7L A;  4CDD C;  1LYL A;  4G5G A;  2E75 C;  2NN6 I;  3FKI B;  3AGP A;  1H8H A;  4PC1 A;  1EOV A;  4ZCI A;  3CCU B;  2D0O A;  4X8I A;  3I70 A;  4X0C A;  1HQM C;  3CCV A;  2WB1 G;  3GV3 A;  4XDX A;  5M5X H;  4DK0 A;  5GRO A;  4JI0 Q;  2MP1 A;  3BC9 A;  5E6T A;  4XYQ A;  5HKK A;  4FWT A;  1KTK A;  1I4H A;  5NUC A;  4ZK9 B;  1D6E C;  3PO3 G;  1B9M A;  1Q90 A;  4HIO A;  1VS0 A;  3A1P A;  4KY6 A;  3VA5 A;  1F9R A;  1SFO H;  1NB0 A;  4OOX A;  2RHS B;  1YJ9 A;  1D5M C;  1A6X A;  2NTT A;  3GTM B;  2UXC Q;  4RDL A;  4ULL A;  1X32 A;  5C3E B;  2K33 A;  4TKO B;  4IUQ A;  2ZTE A;  1N36 L;  1EFC A;  3SJZ A;  2EXZ A;  2A74 C;  5FJ8 H;  3K5M A;  3D31 A;  4YXW A;  2VY3 A;  1C9O A;  2X6X A;  1B50 A;  1HNW Q;  1H95 A;  3TZD A;  3I4O A;  4M4S A;  5ELN A;  3C1E A;  3IFT A;  4Z4R A;  3EFX D;  4ZYS A;  2JSO A;  1TWG H;  2NBF A;  4YIJ A;  2PZU A;  4A3J H;  5EKK A;  2VQE L;  3HOU B;  3MC0 B;  4TMX A;  4XLF A;  1TT2 A;  1TII D;  5CV4 A;  1C0A A;  4A3K G;  1TXY A;  2GK6 A;  1SXT A;  4JC0 A;  4F7X A;  4XR6 A;  1IW7 C;  2QN6 A;  1CKN A;  1K8M A;  3CQZ B;  4DAM A;  1AN8 A;  1IXR A;  2A19 A;  2PMZ B;  3M7N A;  3S1M B;  1UD6 A;  2F4I A;  1YIJ B;  1SYG A;  1DAR A;  3A55 A;  2F0T A;  5F4M A;  3HKZ E;  2W6J A;  3VYR A;  3PO3 H;  1CQX A;  4JV5 Q;  2O5I C;  4XYO A;  3PUY A;  5DS0 A;  3CRZ A;  5GAG C;  1HQR D;  1O7Z A;  1RJT A;  4LAA A;  5IYB G;  3GTQ B;  3MAQ A;  4XQJ A;  2L9H A;  3D4W A;  3RMH A;  1A8P A;  2R92 G;  5FL7 A;  4BBR G;  3CMA A;  4LFB Q;  1PFB A;  2WII B;  1TWC B;  3WOF A;  4JBW A;  1X6O A;  4XOP A;  1EWY A;  1KXL A;  4H02 A;  1AE2 A;  5IE8 A;  1PKV A;  5H59 A;  2K28 A;  1N32 L;  4OIK A;  2B63 G;  5K5P A;  4P1V A;  4HE5 A;  4ID6 A;  2C77 A;  3ZPN A;  3KF8 B;  1J9O A;  3J7A V;  3S2D B;  3JQQ A;  2E5L L;  5IP7 G;  3B6Y A;  1CNE A;  3PA1 A;  2NB0 A;  3T1Y L;  4A3I G;  5FK9 C;  1NCV A;  1L0Y B;  1WOO A;  4AC9 A;  1E22 A;  1H9S B;  2IWH A;  2YTV A;  4A3K H;  3D4D A;  2EYJ A;  2F0O A;  3FP9 A;  3PGZ A;  4DUY L;  2A69 C;  4AYB E;  3FKI G;  3G6E A;  2PW7 A;  1VQO A;  1VQG A;  4S3S A;  3G71 A;  3K57 A;  4A76 A;  1OB2 A;  1U0L A;  1VHO A;  3CCM B;  1DJR D;  4B47 A;  3BZD B;  3W3A A;  3SDZ A;  1E7Z A;  4P6Y A;  2KUM A;  1S72 B;  1K28 D;  3K80 C;  1KLU D;  4RA8 A;  5GAH C;  5IYB H;  1F9Q A;  1SYF A;  1Z6H A;  4P2C B;  3T13 A;  1EFT A;  1L0W A;  3I91 A;  1XMQ L;  3D0F A;  3MEF A;  5CR3 A;  1X56 A;  1S4Z A;  2I0Q A;  4F87 A;  2R93 B;  1G7C A;  3ZJY C;  5A88 A;  1Q86 D;  2R92 H;  3DM3 A;  4F7D A;  4BBR H;  1HTL D;  1QNU A;  3E1Y E;  1HNX Q;  1CSQ A;  1SMY C;  5FO1 A;  2JA6 H;  1IBL Q;  4FXD A;  1B70 B;  3CME A;  3S1R H;  1EY5 A;  1QZH A;  2I1L A;  1U4M A;  1UEB A;  4FXK C;  4X65 L;  4QQB X;  1Q1B A;  2OCE A;  3FRP B;  3HOX B;  3H3V C;  4TMV A;  1CZG A;  3V2T A;  1TVX A;  4GNX A;  3J81 c;  3T56 B;  1VQJ A;  4LW1 A;  1KRT A;  2F0G A;  3RD4 A;  3ZZ0 A;  1B44 D;  3H09 A;  3I4N B;  5KNC A;  2KEN A;  3NWT A;  3STB C;  2IPK D;  4XOR A;  2RF4 A;  1BMF A;  2B2U C;  2UUB Q;  4A3I H;  1RKN A;  4F8M A;  3NUC A;  1VQ9 B;  2ZXP A;  4KY7 A;  3CCL A;  2QIL A;  2XTI A;  3PUM A;  1ZM9 A;  1JB3 A;  1EQR A;  3OYY A;  4OGQ C;  5I6Y A;  2F4V Q;  3MHP A;  5G3L D;  3KK7 A;  3T1H Q;  1EU4 A;  1SRU A;  3FKI H;  1CZW A;  1WD0 A;  4J6H A;  2I5M X;  2JA7 G;  2KCC A;  4DUZ Q;  2UUC Q;  2N8N A;  3CES A;  4ME3 A;  1NBW A;  3L0O A;  1MBY A;  2JEB I;  4B48 A;  5IP9 G;  1X9N A;  2WJY A;  2WZP P;  1TQO A;  2JE6 I;  4QUC A;  4YWM A;  1X3Q A;  2E2H B;  1QX4 A;  4B3F X;  1ZKO A;  1YBY A;  1SYE A;  2WAQ B;  5C3X A;  4DV2 Q;  2JJ2 A;  3GD7 A;  3SHL A;  3R6K A;  1CHQ D;  2F0Q A;  1I6V C;  5KNB A;  1AP0 A;  2QEX B;  3QO2 A;  3QJY A;  1TWH B;  3GTM H;  4A3D G;  1KMH A;  4LBV A;  1SE2 A;  2EY2 A;  5C3E H;  1DOL A;  2J0T D;  3ZC3 A;  2PYK A;  1J5E Q;  4A3B G;  3CC2 A;  1TU2 B;  1JJG A;  1WOP A;  2OWO A;  2PZW A;  3BZK A;  4JOI C;  4RPB A;  3CD6 B;  4LMQ D;  5CV9 A;  4EQN A;  3J80 c;  1E62 A;  4CDC C;  1VQH A;  3FDT A;  2XND A;  1WYD A;  2F0W A;  3HOU H;  4IZ8 A;  4RWS C;  2EIX A;  2V7U A;  3I73 A;  4YAU A;  1RQR A;  2DJF C;  2DCU A;  1V5V A;  4RCO A;  2RCN A;  5M9O A;  1RHP A;  4KHP L;  1UD4 A;  4U9U A;  2XEX A;  2CF4 A;  3CQZ H;  4JI6 Q;  1KQS A;  2QDL A;  1LTA D;  2B29 A;  3D8G A;  5IP9 H;  1O7I A;  1JOQ A;  1OHH A;  1K3B C;  3J7Z C;  1L2F A;  3IFD A;  4Q5V A;  3VDY A;  2HDL A;  2D74 A;  3S15 B;  2B2Y C;  2G9H D;  3OEH A;  1N08 A;  1K0R A;  1UUP A;  4OWX B;  5J35 A;  1WJJ A;  1R5O A;  2XZL A;  1IYJ B;  2F1L A;  3Q0A A;  1D8T A;  4RAU C;  1GKH A;  3QFC A;  1UEA B;  2RSN A;  5COR A;  4B9X A;  5IWA Q;  5C4J B;  2A8V A;  4HCE A;  2A69 D;  4QMG A;  1NAP A;  1ML0 D;  2XGT A;  5IT9 c;  1WD1 A;  3CF5 A;  2GJK A;  2VJI A;  1BXT A;  2A1A A;  2ALY B;  2KHI A;  1EFR A;  4MTK A;  4A3B H;  4IUP A;  4O42 A;  1NB9 A;  3I2Z A;  1XFO A;  2F0E A;  1STB A;  1HPC A;  3A7L A;  1EU3 A;  4DV5 L;  1QVG B;  3A3B A;  1S5F D;  1SE4 A;  4ZGQ B;  2Z9H A;  1PDQ A;  1HFN A;  1PTO F;  4P72 A;  2UUA Q;  1YZ6 A;  4IUV A;  2NVT B;  2QGG A;  1KAW A;  3I4N G;  2MQH A;  3S2D H;  1SKQ A;  1JWM D;  3I56 A;  2YU9 B;  3NEM A;  5JEA G;  3TP5 A;  1EY6 A;  1NSN S;  4NXM Q;  4ASU A;  1R4Q B;  4DAY B;  4LUV A;  1JOR A;  1SMY D;  2AQ1 B;  4KD4 A;  2ZJQ A;  3PIP A;  1XE1 A;  2CW5 A;  1IKL A;  2EJM A;  4O2D A;  4Y9U A;  4EQ5 A;  1W0J A;  2PQA B;  3VNU A;  4P26 A;  2HHH Q;  3BNW A;  2FMC A;  4FNF A;  4MN3 A;  3PIP 3;  1Y1W G;  2YWG A;  3NEN A;  4IJL A;  3W2D A;  3EJI A;  5JBQ A;  4JG2 A;  3H15 A;  2L55 A;  3STB D;  4DGZ A;  4DV7 L;  2QTL A;  3CCR B;  1QG7 A;  2ZTD A;  4JPB W;  3OW7 A;  2JJ1 A;  3CRK C;  4A3F B;  4GN5 A;  5LMN L;  2R61 A;  3M7G A;  2YWF A;  2B2T A;  3PEN A;  2L15 A;  4K8I A;  1EQQ A;  1LT5 D;  1M4V A;  5ISR A;  3PO2 B;  5ELC A;  1BLI A;  2DYI A;  4M53 A;  2JN9 A;  4B4D A;  2A6H C;  3A35 A;  2I5L X;  4OPS A;  2JXM B;  3SK4 A;  1WI5 A;  1Y1V B;  1SJE D;  4TRD A;  2PIA A;  2C4U A;  1TY0 A;  1YNN C;  4DK6 C;  1SR3 A;  1HRJ A;  2WYR A;  4FDB A;  3CCJ A;  4DV6 L;  3PMF A;  1EZ6 A;  2FIN B;  4R1J A;  4UP8 A;  4WJW A;  4AVZ A;  3I4N H;  3VO2 A;  4KN7 C;  1WTV A;  5IYQ A;  2NZO A;  5JEA H;  2OTJ B;  2QW7 A;  3VR2 A;  3MXU A;  1NMF A;  2IW3 A;  3P20 A;  3U58 A;  4MYT A;  1HHV A;  1WU8 A;  1VQE A;  1PH3 A;  3SK8 A;  3K0Y A;  1XNR L;  5T1I A;  1E1Q A;  1VQB A;  3AU7 A;  5AJ3 L;  2G9D A;  4YAW A;  4PG3 A;  4ZCK A;  3PF5 A;  1Y1W H;  3OEE A;  4IPD A;  3V05 A;  2FHT A;  1W0K A;  1VQ8 B;  4ALP A;  4JW0 A;  1EEF D;  1QH0 A;  1PFS A;  3WBK A;  2KEC A;  1STH A;  3PF4 A;  1NRK A;  2AUJ D;  2ICI A;  3H0G B;  4AQY Q;  4P6V F;  2F0K A;  1VQN A;  1HZA A;  1ENA A;  3WNC A;  3W5H A;  2GRE A;  3RN5 A;  1GUG A;  1TWH H;  1TWA B;  3BQJ A;  2M2L A;  4JI2 L;  4Q7J B;  2K14 A;  3CCQ B;  4IUR A;  4K2L A;  2VNH A;  3X3N A;  1G2T A;  3NTK A;  2CWP A;  3SK5 A;  3SXH A;  2VQF Q;  3MZ5 A;  4KV6 A;  3G05 A;  1GVP A;  1EWC A;  5C0X G;  1KDA A;  4EVO A;  2EJG C;  1VQ4 A;  4WJ4 A;  2GA4 B;  3ZIA A;  4BXX G;  2PQE A;  3ERO A;  3MTS A;  3PV0 A;  3AVX A;  4OX9 L;  1IYU A;  1N06 A;  2WKD A;  4HJ9 A;  1G29 1;  1FND A;  2L0C A;  1ASZ A;  4Q0F A;  1DCZ A;  2OXP A;  3HRZ C;  2KOL A;  1WOS A;  4WRD A;  1R9T B;  1DM0 B;  1G6Z A;  3D3R A;  4ME5 A;  1EFI D;  2PLF A;  4Z4S A;  3WQZ A;  2QCP X;  3U6K A;  4RGO S;  3W2H A;  2C5B A;  1H9K A;  1O78 A;  1ONL A;  4QY7 A;  4RFB A;  2L4N A;  4XTC S;  3R8B A;  2XWJ B;  1XQB A;  4YCV A;  2NVY B;  4R71 A;  1N33 Q;  4RD3 A;  4DV4 Q;  1TS5 A;  4OOS A;  4JYA L;  1VQ7 A;  2Y0S B;  4M8A A;  3J7A F;  3OMC A;  3S1Q B;  2QDX A;  4FXU A;  3ONY A;  1CA6 A;  1N05 A;  3TP7 A;  3RY8 A;  4PZ7 A;  5BN5 A;  1Z47 A;  5CC4 A;  3Q6Q A;  2XOK A;  4GZY C;  2QA4 A;  5IYN A;  1VQM B;  2HMA A;  2K4K A;  3TN2 A;  3TRZ A;  4J15 A;  3CU7 A;  1ZEQ X;  2XGJ A;  4TSS A;  3KOJ A;  1PH8 A;  1JT8 A;  4WFN 3;  1J6Q A;  5C0X H;  1C7Y A;  4G7W A;  1AMO A;  2WZN A;  1KJZ A;  1EOT A;  4WQM A;  2RA4 A;  1FGB D;  4K5V A;  3GVL A;  2MO1 A;  1I3Q B;  1GVH A;  1SYB A;  5JOB A;  3VYT A;  2IX3 A;  4GLX A;  2FMM A;  1KAB A;  3FVQ A;  4X3K A;  1DGS A;  5IGG A;  2NVT H;  4WZL A;  1W2B A;  2A5H A;  2YU9 H;  3GSI A;  4BA2 I;  4DQK A;  3J81 L;  2WFW A;  3K7A B;  2HDM A;  1J8I A;  1NUC A;  1FYC A;  3RZO B;  1YNX A;  2AHO A;  3KJP A;  4RM0 A;  4ACA A;  2A6H D;  1ROD A;  4KHZ A;  2Z4I A;  1Q81 C;  1YNJ C;  1YNN D;  4GNX C;  3QFS A;  1UE6 A;  1SFO B;  2UXC L;  3NPP A;  1NDH A;  1RD9 D;  4A4I A;  3OHX C;  3TP6 A;  1V1Q A;  1FRN A;  3A56 A;  3K5N A;  1VMP A;  2XNA C;  2SNS A;  3C2P A;  4A3L G;  1SBB B;  1HR0 Q;  1DD2 A;  2CND A;  5CV6 A;  1EYC A;  3WBJ A;  3ASR A;  3QFT A;  3BY2 A;  1F9P A;  4QIW B;  4RDJ A;  1NBM A;  1DXM A;  2D0P A;  3ASP A;  1HNW L;  4G7H C;  1A63 A;  2F0D A;  2PNR C;  2IJ0 A;  2DJG C;  3RLF A;  1TWG B;  3NSW A;  4A3J B;  2R7F A;  3BG3 A;  3I8Z A;  5LHY 1;  2JJQ A;  2B7B A;  3QWN A;  4LFA Q;  1Q3L A;  1QZG A;  5DNF A;  1STE A;  3U6B A;  2R7D A;  2E2D C;  1Q46 A;  2E74 C;  4B3T Q;  5H1S E;  1D1I A;  4R4C A;  1I6H H;  4DR6 L;  4CKC A;  3M85 A;  5LMU Q;  2WB1 B;  1LV9 A;  1ESF A;  3CCE A;  3U50 C;  4LBY A;  3J80 L;  3PSI A;  3ZZT A;  1UAP A;  3QSY A;  1S40 A;  4JV5 L;  2VBU A;  2ASB A;  2EYF A;  2VNI A;  1HZ9 A;  2HQE A;  3HGB A;  4LF4 L;  2OEO A;  4JI4 Q;  4UP9 A;  1NTG A;  3A8J A;  4X3T A;  3QOJ A;  1B9N A;  1EY0 A;  1LTT D;  1VQ5 A;  2F0M A;  4LFB L;  3JC6 6;  3S14 H;  2F3I A;  3E3X A;  4ZUI A;  4HED A;  2OF1 A;  3H0G H;  2XRQ D;  4A3L H;  4UPA A;  1R5N A;  1YHA A;  1HNZ Q;  4KKU A;  2HCI A;  5HGT A;  4YAF A;  5L37 A;  1CHP D;  2KA7 A;  1Y0Y A;  4B3G A;  1MAB A;  2YYZ A;  2BH8 A;  3F2C A;  4GKJ L;  1VQI A;  5CBE E;  4K14 A;  3NTI A;  3ZBU A;  5C4H A;  1WOR A;  1E24 A;  5TV2 A;  2RDH A;  1PA6 A;  1FL0 A;  1CQF A;  3J7A 5;  4RLZ A;  2BDN A;  3RLO A;  1U4L A;  1HZB A;  4L5Q A;  1ESR A;  2FX3 A;  4ZLT F;  5IT9 L;  1JJ2 A;  2VZA A;  1BOS A;  2PMZ E;  4K5W A;  2Z4H A;  5BN4 A;  4Y7C A;  3H3V H;  3SEJ A;  3KF6 A;  4GOP A;  1GUN A;  3CC7 A;  3SGI A;  1R9T H;  4LBW A;  3IKJ A;  3ONA B;  5FNZ A;  2EZV A;  3HKS A;  1PFM A;  1LT3 D;  1MD2 D;  1V1P A;  2AWO A;  4JI1 L;  1FX0 A;  1SKY B;  2X3U A;  1E43 A;  1PRT F;  4P73 A;  2LS0 1;  3OPO A;  1YJ9 B;  4UHV A;  1KC8 C;  2JK8 A;  4X62 Q;  1B3Q A;  1RQP A;  3CP8 A;  2Q2U A;  2R92 B;  4BBR B;  1IKM A;  4DR2 Q;  1WTH D;  2ZZE A;  1IBL L;  1FD7 D;  1FNU A;  2P5Z X;  5J3B A;  1NNX A;  3UE0 A;  4Y52 H;  2JA8 G;  3T53 B;  4IFD G;  2NTS A;  2BV3 A;  1EP2 B;  1D2E A;  1EY4 A;  4A3M G;  2GJR A;  2ZM6 Q;  2B63 B;  1LM0 A;  5J22 A;  1TLL A;  2Q6I A;  4RD4 A;  4K1X A;  3M4P A;  4XN0 A;  5C3W A;  1Q81 D;  4DR3 L;  1YNJ D;  3AFP A;  2XN9 C;  2N55 A;  3QE2 A;  4A3I B;  4TMZ A;  2KCT A;  2Q8T A;  3GTJ H;  2D9U A;  4G1V A;  5KYI A;  3T1H L;  3ZUG A;  2F43 A;  2Z6B A;  5IGC A;  4WZT A;  2I5H A;  1GUO A;  3P27 A;  5ELO A;  3J80 i;  3E0E A;  1PH5 A;  4OL7 A;  1JWU D;  3IRB A;  5GQO A;  5IGF A;  5C5M A;  2X53 S;  2Q6L A;  2EFG A;  2B2T C;  3K7A H;  2VBV A;  2CW0 C;  1X3E A;  3A8I E;  2GQF A;  1QUF A;  3D6C A;  1RTN A;  1IL8 A;  4WZE A;  4OPV A;  4L5R C;  3RZO H;  4H0L C;  4IO9 A;  2Q2T A;  4HR7 B;  1OB0 A;  3AQQ A;  2RCF A;  3A3G A;  3MWY W;  4JI5 Q;  2K5D A;  4DR7 L;  2D3N A;  5C44 B;  1XNQ Q;  1JOO A;  3ND8 A;  1RTO A;  4RCZ A;  3BYY B;  4JBJ A;  3MXN A;  1FNV A;  1XYI A;  3A54 A;  2JA8 H;  3PVD A;  2V31 A;  4RJL A;  1CI3 M;  3PUW A;  2LXK A;  1PRT C;  2Z6K C;  4DR1 L;  1HZC A;  1U9R A;  3Q6R A;  1JB7 A;  3F2U A;  2Z1C A;  4DR4 L;  4A3M H;  1AH9 A;  1P16 A;  2YTY A;  1BCP F;  1Q12 A;  2AUK A;  2X6Y A;  3HEJ A;  4FF4 A;  3FPP A;  5JJK A;  2OBT A;  1TY2 A;  3G6E B;  2Z0S A;  1VLY A;  1I4R A;  3OZW A;  1VQO B;  5ELD A;  1YIT B;  3E0J A;  4MTN A;  2ID0 A;  5I2Y A;  1OXS C;  1X3F A;  1KNA A;  3MMP A;  4JI6 L;  3EQL C;  2JA7 B;  3OMG A;  1OB5 A;  2OTL B;  4QHY A;  1CNF A;  3SVM A;  2VS1 A;  3B82 A;  2AQ2 B;  2WAQ E;  5F4O A;  4PAA A;  4HE6 A;  2MHV A;  4CJ0 B;  1W6K A;  3DM1 A;  4PC2 A;  1SMX A;  1HA6 A;  2HQL A;  3C46 A;  5TRD A;  4FK8 A;  3WY9 A;  3VA7 A;  3HZX A;  1EQT A;  4EQP A;  1K83 B;  4LF6 Q;  4NW2 A;  5IWA L;  4BY7 G;  3MA2 B;  2B8F A;  4TT3 A;  1I94 L;  4ZV4 A;  1IJE A;  3H94 A;  5EJW A;  1Y8P B;  1D7Q A;  4M1K A;  5C6A A;  4A3D B;  2LKV A;  1N07 A;  1ZM4 A;  2OYN A;  4GNX B;  2NWG A;  3G4S B;  2WAC A;  2F0F A;  4C1N I;  4A3B B;  2LSS A;  1TS2 A;  2K32 A;  2K5W A;  2WR8 A;  1KZL A;  3K5O A;  4OWT B;  1BF4 A;  5I9O A;  3CCU A;  1PJ5 A;  2X6W A;  4JI7 Q;  2ENB A;  3VYS A;  5M5W H;  2F1M A;  5A2Q L;  4Y7N H;  1KC8 D;  3F2B A;  1H42 A;  4TMW A;  4UAJ A;  1Y8N B;  2LXJ A;  1JJC B;  4L6T B;  4XT1 B;  5F2D A;  4EQO A;  1DDI A;  1QNK A;  3M4O H;  4XKW A;  1B53 A;  2TSS A;  4FXG C;  4NXM L;  3TSS A;  3Q39 A;  2UXD L;  1KRH A;  4YHB A;  1QGY A;  1S0U A;  4RCY A;  3CPX A;  1Q1E A;  4QCL A;  5DM6 3;  1YEZ A;  4NP5 A;  4R4I A;  1PH7 A;  2V7T A;  1BCP C;  4HAE A;  4FVM A;  3SR1 A;  1RL2 A;  3MHB A;  2LY7 A;  5L46 A;  1V0E A;  4H44 C;  2BDO A;  4RDK A;  2F0U A;  1LUZ A;  3JAM E;  2EE1 A;  3EN2 A;  1EIG A;  3H6M A;  5EPJ A;  2PPB C;  1ET6 A;  1HJP A;  3RR5 A;  1EWI A;  4BY7 H;  1S5B D;  2CRV A;  4Z4W A;  3CPW B;  2I46 A;  4A3E G;  3NTH A;  5C44 G;  3SKB A;  4P22 A;  3CC2 B;  4DNT B;  4HMI A;  4I65 A;  1PTO H;  5D65 A;  4OOV A;  1UD5 A;  2CVR A;  1CT1 D;  4MZ9 A;  1GAQ A;  3ES9 A;  1HVX A;  1JB9 A;  3AVT A;  3ULL A;  5KEE A;  4DV3 Q;  1OXU A;  3M4Q A;  1A2T A;  4X05 A;  1VQD A;  2CW0 D;  1V1O A;  4C56 C;  3ERQ A;  2B63 H;  3ASS A;  4NDX A;  3KJO A;  5CV7 A;  1LT6 D;  3CXC B;  3W1B A;  4EGV A;  5IP7 H;  4V19 0;  4PC3 A;  2FFK B;  1HR0 W;  4KI0 A;  5LMN W;  2WPD A;  5H5J A;  4ZKC B;  1KQS B;  3VR5 A;  1DYQ A;  1O7Y A;  3K59 A;  5HXB A;  2RC5 A;  3I7F A;  4IUT A;  4GKK Q;  1FDR A;  3S2H H;  4QGU A;  3PUZ A;  1SN8 A;  4CDF C;  1EIF A;  1KLG D;  2C9O A;  2DET A;  1Y1W B;  2KBN A;  2EY6 A;  3BZC A;  1L0X B;  1GJX A;  3BVM A;  2F4N A;  2YV5 A;  4MIU A;  3WDN A;  2UXB L;  1EL0 A;  5IYC G;  4R8N A;  1F77 A;  4ZAI A;  2CCZ A;  1T9H A;  2EJF C;  2V7V A;  4RH6 A;  3KF8 A;  4QL5 A;  4A3E H;  2ZL5 A;  2HIV A;  5C44 H;  1YJN B;  4YY3 Q;  4PNY A;  4LF9 Q;  1PMR A;  2NN6 G;  4UY8 C;  4K0K Q;  1IW7 D;  1OGJ A;  1SLJ A;  3OE7 A;  2IX0 A;  5KND A;  4G7Z C;  1FR3 A;  4LJZ C;  5GAE C;  2MJ8 A;  3WXM A;  1KL9 A;  1UD2 A;  1SND A;  3BVG A;  1C4Q A;  4A3C G;  1XPO A;  1V9P A;  4E0F A;  3RLN A;  4OXP A;  3R2T A;  1PZK D;  2PNH A;  4POG A;  3CCM A;  5TR9 A;  1B23 P;  2K1B A;  1VJS A;  3DXJ C;  4ABN A;  1A15 A;  4GN4 B;  1QB5 D;  3ULJ A;  1S72 A;  2V7X A;  3A8I A;  3NQI A;  2ZL6 A;  3NK9 A;  2B2V A;  3OIP A;  1LAC A;  4DR5 Q;  2K5Q A;  3A8K E;  3E6Z X;  2JA7 H;  1GXD C;  2NVQ H;  3LQE A;  2RKS A;  5J1Z A;  4APV A;  5JJL A;  1N33 L;  4P9S A;  2VL6 A;  4DV4 L;  1IHM A;  5JJI A;  4HCS A;  2JA5 G;  1IHZ A;  4RGT A;  5M5Y B;  1ET9 A;  5IYC H;  3RUZ A;  4TN1 A;  2B7C A;  1YVC A;  3NBI A;  4H7B A;  3I55 B;  4NNJ A;  3MFG A;  2ZXI A;  3OWE B;  1H9R A;  1K83 H;  3DEO A;  5AFW A;  5KYL A;  1LTL A;  1SE8 A;  2VQE Q;  3NWS A;  3ICE A;  2RHQ B;  3K81 C;  4G6I A;  4ILW A;  3R93 A;  4HJA A;  4FP5 D;  4LWC A;  2GK7 A;  3MXP A;  4YWL A;  1VQ9 A;  4A3D H;  1ICW A;  4NBS A;  1ZM2 A;  1B7Y B;  4KY5 A;  1BCP D;  2VB2 X;  1ELO A;  4R9W A;  5BR8 Q;  1BPL A;  1P8L A;  2F0L A;  3OWF A;  1PRT B;  1SNO A;  1VMC A;  1P4M A;  1Y0R A;  1YJW B;  5KIX A;  1VQ6 A;  5IK2 A;  5HUR A;  1EP3 B;  3SLD A;  3UDX A;  5E4W C;  1SEB D;  2K52 A;  2HT1 A;  2D2C C;  1T5E A;  1D5Z C;  4P2N A;  3CW2 A;  1YX2 A;  1G51 A;  3DEP A;  1D2B A;  3TBI B;  3M4Y A;  1KK3 A;  2QEX A;  5BN3 A;  1VQC A;  2NUC A;  3IAY A;  3GVJ A;  3KYH C;  1I18 A;  2Y0S E;  4BY1 B;  3BDL A;  1W35 A;  1EEI D;  4UZE A;  4KD3 A;  3J7Y W;  2JA5 H;  2F03 A;  3BCF A;  1DG1 G;  2EY1 A;  4MNO A;  4HN7 A;  3F2D A;  1K73 C;  1AZQ A;  1LTG D;  4EX5 A;  3F8T A;  5EKI A;  2E5L Q;  4PC7 A;  1E79 A;  4XQF A;  3CD6 A;  4LFC Q;  3T1Y Q;  2BPO A;  1GAW A;  1HR0 L;  5A35 A;  4DK3 C;  4H9G A;  4GN3 B;  3QR8 A;  2M00 A;  3LWU A;  1CK1 A;  1PH1 A;  1PV4 A;  1IB0 A;  1M90 C;  5M3F G;  1XMO Q;  3OW2 B;  4KKS A;  2VYQ A;  1VQ4 B;  1GD7 A;  1K28 A;  1F2M A;  3TDQ A;  3LQ6 A;  4ODG A;  2H5X A;  1CFM A;  3P75 A;  4RG1 A;  4OIJ A;  1RIP A;  2ZZG A;  1EYG A;  2ZZQ A;  2F0I A;  4NCN A;  1BQQ T;  1J9Z A;  5IYD G;  4LFA L;  2XWB B;  2QE7 A;  1XMQ Q;  3H3V I;  4OEL B;  3HKZ G;  4B3T L;  1A3V A;  2H4O A;  2AWN A;  1I6H B;  3I90 A;  5LMU L;  1VQL A;  4ZCM A;  2WJV A;  4CJ2 C;  4JI3 Q;  3JQP A;  1EIH A;  4R4T A;  4ROX A;  1PH2 A;  4OWW B;  3W5V A;  4C0S A;  1VQ7 B;  4X65 Q;  1PZJ D;  3AB9 A;  1PTO C;  1KIX A;  2GJP A;  1QIL A;  2PMD A;  1VQK B;  4KKT A;  1R4P B;  2RC6 A;  1SSO A;  4XLC A;  3QFR A;  2D5D A;  3BDO A;  4U68 A;  1BX1 A;  4RD1 A;  1RCV D;  1HA5 A;  1KAA A;  5EMN A;  2ZT9 C;  3S14 B;  4L5T A;  4C3I G;  1BCP B;  3P26 A;  1QWY A;  4QIW E;  3KFU A;  2B2W A;  2SDF A;  1UWV A;  1HNZ L;  4C3H G;  2VUM G;  1IBK Q;  4DV0 L;  4IPG A;  5M3F H;  1VLO A;  1EQV A;  1O80 A;  2B39 A;  1IL2 A;  1TUI A;  4DAY A;  1F2L A;  4JVZ A;  1U2R A;  1WFQ A;  3W5O A;  1O7L A;  2DY8 A;  4AYB G;  5FO8 B;  2F0H A;  1I50 B;  4B3M L;  1DON A;  2E76 C;  1VCI A;  1LTI D;  2PQA A;  1C48 A;  2YTX A;  5IYD H;  4B3S Q;  3E9I A;  3J81 E;  2WB1 E;  4DNR B;  4PGO A;  1A0I A;  1E1R A;  3OZV A;  4KK7 A;  2AHO B;  1WTQ A;  2ZL7 A;  2E2J H;  4BBS G;  4B3R Q;  3CCR A;  2XSC A;  1N34 L;  5TSS A;  4GS3 A;  2ZXH A;  4LF8 Q;  1D1K A;  3V7A A;  3DWA A;  1JWS D;  4X64 L;  4X06 A;  1TWF H;  4NXN L;  3S1N B;  1W87 A;  4X07 A;  1LTS D;  5LMZ A;  3CP0 A;  4BY1 G;  1I4Q A;  4JBM A;  3S9W A;  4DF7 A;  4Z9C B;  5FOB B;  1X54 A;  4LF7 Q;  5M5Y H;  5EPL A;  1BJK A;  4C3I H;  3LX0 A;  3U2Q A;  3AGQ A;  3CHB D;  2VUM H;  5KSW B;  2Q8I B;  2MUY A;  4G1B A;  2WP8 J;  1A2U A;  1CTM A;  3MXG A;  1BKB A;  1GO3 E;  3TZU A;  4BA1 I;  2JP1 A;  4KHP Q;  4IUN A;  1PYS B;  2K5H A;  4OPO A;  4X66 Q;  2MNA A;  1KDB A;  1QVF B;  3OZU A;  1EIY B;  5EAY A;  3JU4 A;  2H1E A;  2CKZ B;  4H13 C;  1K73 D;  4BXX H;  3GTJ B;  1HA3 A;  4OHJ A;  2EDG A;  3AVW A;  3A8K A;  3CCE B;  1YI2 A;  3T16 A;  5A8A A;  2LZJ A;  3J80 E;  2VW9 A;  2EVB A;  1EUJ A;  1WPC A;  2ZZF A;  1NJI C;  5M3M B;  4X7E A;  3WYA A;  4K2K A;  1M90 D;  4JI0 L;  3TQY A;  2BVN A;  1EYA A;  5E7N A;  1FNC A;  2C5H A;  3LVB A;  3W5U A;  4K6L A;  4PMC A;  1VQ5 B;  2DY7 A;  1AZP A;  4A3G B;  2UU9 Q;  4DV1 Q;  3KUP A;  1WTO A;  4JK1 C;  3CCQ A;  5FLX E;  1PH6 A;  4BY1 H;  4JI5 L;  3OIQ A;  1XNQ L;  2VBS A;  4YCW A;  1MSH A;  1FNB A;  3HG9 A;  1SNQ A;  2EOT A;  4JI8 Q;  2KVO A;  2DER A;  4LC0 A;  2CFM A;  2QTZ A;  3W2E A;  1YHQ B;  3OSO A;  4C43 A;  3T51 B;  2CWA A;  2JA8 B;  4QV2 A;  1X3P A;  3CCS B;  1DZ1 A;  1F9S A;  3ISX A;  4PC6 A;  1E0B A;  4M1U B;  4A3M B;  4YAO A;  3DDY A;  4WWV A;  5IT9 E;  2B2U A;  1PTO D;  3A7A B;  2DNE A;  2J7Z A;  1Z7T A;  2IL8 A;  5IOC A;  1TR5 A;  3UDF A;  4LNQ A;  3EIV A;  3M3Y B;  2YWE A;  3GIR A;  2L5T A;  4QJF A;  4DV7 Q;  3GTO B;  1IYV A;  1V1P B;  1ENC A;  3HOW G;  5COY A;  5JEA J;  1E2V A;  5C5L A;  3J81 k;  1I4P A;  4HJ8 A;  3FEW X;  1NY4 A;  4FN5 A;  2A6E C;  3CPF A;  4XM3 A;  3SJP A;  3ZBT A;  5LL6 X;  1PYB A;  1QUQ A;  4IPC A;  1YLO A;  3NBH B;  1S5D D;  3UE1 A;  4LF6 L;  4YHH Q;  4NKL A;  3BDC A;  1UD8 A;  4RKB A;  4E6I A;  1CSP A;  4DV6 Q;  1X55 A;  1PH4 A;  2PI2 E;  2PZT A;  3EVQ A;  2QMU A;  3KLW A;  3N6R A;  2D3L A;  3V96 A;  1WDT A;  2F52 A;  2X6L A;  1T6Z A;  3I3C A;  3ERS X;  1KHI A;  3K5L A;  2B2V C;  3L7Z C;  3JAM c;  2XVS A;  4PQX A;  3LNN A;  2PO4 A;  4Y9R A;  2HUG A;  3BY1 A;  5D14 A;  1DOK A;  1XNR Q;  4XIG S;  1E64 A;  5M5W B;  2HIX A;  4Y7N B;  5AJ3 Q;  1VF5 C;  2RSO A;  3HOZ G;  3M4O B;  1PLF A;  1XB2 A;  3KBX A;  3U4Z A;  1QCB D;  2BM1 A;  5IYP A;  1I50 H;  1AW7 A;  4PZ6 A;  2Q2I A;  3Q24 A;  1STA A;  1LLR D;  1NR2 A;  3CCV B;  1Q8I A;  1I4X A;  2GVA A;  1STN A;  2KCN A;  2SEB D;  3KL9 A;  3NP8 A;  3Q3A A;  2MFI A;  2R9V A;  2WKC A;  1TS3 A;  5DM7 3;  4FYD A;  1RDP D;  5M3M G;  3PA2 A;  1DOM A;  2Z8L A;  4OO1 G;  4RGN A;  1Q9S A;  1II3 A;  2DIE A;  4BPR A;  4A3G G;  3TS2 A;  2BF4 A;  4XL9 A;  3MXN B;  3S1N H;  1QOH A;  4BY7 B;  2OQ0 A;  4O1N A;  2VZL A;  2RDG A;  4EH1 A;  3E20 A;  1HNX L;  3DWQ A;  4UP7 A;  4P75 A;  1PTO B;  1BO0 A;  2KCM A;  1WCM B;  1NJI D;  3CTA A;  4DV3 L;  1BX0 A;  4RCN A;  5FO0 A;  1Y8O B;  2PCF B;  3CW2 C;  1E2W A;  4U67 3;  3MCA A;  5IGE A;  1OTC A;  4LUO A;  2K03 A;  3PUV A;  4AH6 A;  2I07 B;  1ILP A;  4LBZ A;  1IBM Q;  1M8A A;  2QGQ A;  2ICE C;  4G7O C;  3HOZ H;  1GUT A;  5C0X J;  2UUB L;  3F1Z A;  2GN5 A;  5FA6 A;  1GUW A;  2X69 A;  2F4V L;  2BGI A;  1CKN B;  4RGM A;  4JYA Q;  5J39 A;  1L1O A;  1V8Q A;  4G4K A;  4B08 A;  4GKK L;  3HOV B;  1BBX C;  3L2P A;  1GUS A;  3S2H B;  2FJ2 A;  1BQE A;  2L12 A;  4A93 G;  4DUZ L;  4CKB A;  1D8L A;  3BH4 A;  1VQP A;  5EGT A;  2UUC L;  1UE5 A;  4RPD A;  1N8R C;  5M3M H;  1PH9 A;  3CC4 A;  4XN3 A;  4XQN A;  1EP1 B;  1FJG Q;  1ZM3 A;  2BM0 A;  5D3D A;  1CKO A;  3U9S A;  5FLM G;  3AVV A;  4OO1 H;  2B5O A;  3U4V A;  4DV2 L;  2RQX A;  1MIU A;  4A3G H;  1I7P A;  2RBM A;  3CMA B;  2HLD A;  1H9J A;  2FXQ A;  1TKW B;  3UDI A;  5IGD A;  4TSF A;  4QVA A;  1NR4 A;  3VYU A;  4A3E B;  1Q86 C;  4YY3 L;  3HP3 A;  4LF9 L;  3HOY G;  2K5N A;  3S17 H;  2XRS D;  4K0K L;  4YEL A;  4X7D A;  5CV8 A;  4CHT B;  1KRS A;  5I9P A;  2CQO A;  1J5E L;  5AN9 A;  1LTB D;  3KLS X;  2LFN A;  5E4X A;  2PE3 A;  1BBW A;  2A6E D;  5A2Q E;  4IFD H;  1PJ6 A;  2XIW A;  1ZYR C;  3OJX A;  5C4X B;  4JCV E;  4C2M B;  4ZGN B;  1H85 A;  2F3W A;  1A3U A;  3GTL B;  3VR6 A;  5DAU A;  3TME A;  1K8A C;  1IJF A;  4P3Y A;  3G71 B;  2F3V A;  4I7Z C;  3M3Y H;  1PXU A;  2EXD A;  4DR5 L;  2B2W C;  3GTO H;  4FF3 A;  3E5S A;  4A93 H;  3DMU A;  2NVQ B;  1A3T A;  2EYM A;  4GLA C;  2OQK A;  3CRL C;  3KDF A;  3RZD B;  2D9R A;  4LF5 Q;  4DPG A;  5FLM H;  4KMU C;  2SNM A;  4B3X A;  2KQ3 A;  3K8A A;  3UDG A;  3HAG A;  3OKX A;  2X85 A;  3EA6 A;  1JCK B;  1EYD A;  4FO2 A;  2O5J C;  1GM5 A;  1EFU A;  3CME B;  1OXT A;  4P3I A;  3HOY H;  3GTP B;  3G6J B;  2JA9 A;  5C4Z A;  4DAV A;  3I4M G;  1WCM G;  4YCU A;  4DR6 Q;  3TEH B;  3A5U A;  3FMC A;  2WV6 D;  2KEE A;  5BR8 L;  3LO8 A;  5DSZ A;  3DLL A;  1Y14 B;  2JYO A;  2ZTC A;  3CCL B;  5IIF A;  2UUA L;  1JNY A;  1KTV A;  4IJH A;  4IW3 B;  2ZBV A;  4LF4 Q;  2B3G A;  3URY A;  2CH4 A;  4L63 B;  4OP7 A;  2M5S A;  2AMC B;  2VB3 X;  1WOC A;  4G57 A;  4HJ5 A;  2JA6 G;  2EY5 A;  4II3 A;  3HOV G;  2HCC A;  1V0F A;  4LK1 C;  2BA0 A;  4II2 A;  4MYU A;  1VDZ A;  1JR0 D;  2HHH L;  4GKJ Q;  4N3N A;  3B8H A;  2JA5 B;  4F88 A;  3SK6 A;  2PI2 A;  5HY6 A;  4AIM A;  4DN4 M;  1UD3 A;  4LFC L;  1MHW C;  3FJO A;  5CYU A;  2XZP A;  1XWE A;  3T4A C;  2K7V A;  1T6X A;  1FGU A;  2GVB A;  1XMO L;  5KGU A;  1FRQ A;  3QG1 A;  1W34 A;  1WVL A;  2F0S A;  1N0V C;  2ZBU A;  4UZU A;  1PFN A;  3I4M H;  1COW A;  1WCM H;  1YIT A;  4N9T A;  2VXW A;  2F0P A;  1N8R D;  4DQL A;  1G8Z D;  3AFQ A;  2LMC B;  4HID A;  4AF7 A;  4JI1 Q;  2OTL A;  1Q7Y C;  3GTG B;  1GOZ A;  3GVK A;  3WND A;  5C4X G;  1AIP A;  1WTH A;  1K0S A;  1YIJ A;  1VHE A;  1EXM A;  4CQJ A;  3D4R A;  3Q6S A;  4FF2 A;  1JE4 A;  3U9O A;  4JI3 L;  2JDI A;  1SNM A;  2C78 A;  4CGY B;  1PZI D;  3ITP A;  5C3E G;  3AEV A;  3HOV H;  2OBS A;  3PUN A;  2DY1 A;  1WTW A;  2N78 A;  4J0Q A;  1PVO A;  1PRT D;  5GV7 A;  2KED A;  1AFP A;  1CM9 A;  4IOA A;  1LO5 D;  3G4S A;  1ZYR D;  2K01 A;  3PCO B;  2BGJ A;  3OTO Q;  4L8J A;  3KLS A;  3OJW A;  2NYZ D;  4DR3 Q;  4HSV A;  2O2L D;  3SE0 A;  2E1B A;  4AQY L;  1C8C A;  4P71 A;  3HOU G;  1IBK L;  1K8A D;  4C3J B;  1PHJ A;  3NE5 B;  5M3F B;  4R4Q A;  1N0U A;  4NB3 A;  2BMW A;  3WNB A;  1H9S A;  1EY8 A;  2VQF L;  2NZH A;  5C0X I;  5EPK A;  3ER0 A;  3HFZ B;  3GV6 A;  1VQ6 B;  3OAA A;  5KW9 A;  4IFD J;  1H9M A;  5GV8 A;  4KTA A;  1SYD A;  3I56 B;  4X7F A;  4B3S L;  5C4X H;  4ZRZ A;  3PIO A;  4G7X A;  4C2M H;  3HKZ B;  1QGA A;  1CQV A;  3SEB A;  5GAD C;  2ZJP A;  3W2I A;  4DR7 Q;  4B3R L;  1FNW A;  3VMF A;  3JAM L;  3GTL H;  2W6I A;  2E2J B;  1UNS A;  4KJO A;  3PIO 3;  2EQS A;  4MHE A;  4LF8 L;  2XZO A;  3CPW A;  1D1N A;  2R7Z B;  2EYL A;  1HXY D;  1TWF B;  1N36 Q;  4QVJ A;  1MI2 A;  4DR1 Q;  2DEU A;  3O13 A;  2K05 A;  1SRO A;  3RZD H;  1MGS A;  1Y69 U;  4DR4 Q;  4DKA C;  3FPU B;  4LF7 L;  4C3I B;  4BS9 A;  1SNC A;  4KN4 C;  4HJ7 A;  1QG0 A;  2X8K A;  4PAB A;  4Z4V A;  3N52 A;  1EWH A;  1R5B A;  4RD6 A;  4C3H B;  2VUM B;  1KD1 C;  4Z1M A;  1ILQ A;  2X6G A;  3CXC A;  2N49 A;  3GTP H;  1F2Y A;  2NN6 H;  3R2I A;  5TY0 A;  1XX8 A;  2N88 A;  4X66 L;  5FLX c;  1CA5 A;  1A62 A;  3CCJ B;  5FIU A;  3S1M H;  4GOP C;  4AYB B;  5CV5 A;  3RN2 A;  2IX1 A;  1HH2 P;  3V76 A;  1BDO A;  3M9B A;  3AVY A;  4CDE C;  4A3C H;  5FO9 B;  3QOL A;  5CDF A;  2ES2 A;  3R3O A;  1VQL B;  1AE3 A;  3I4L A;  5JPN C;  5EBD A;  3GTQ H;  1JC7 A;  3S16 B;  3C3L A;  1KNE A;  4WJ3 M;  4DK1 A;  2ZXO A;  3GTK B;  2AKW B;  2NVX B;  3OOC A;  1XXG A;  2R93 G;  4XOT A;  4BBS B;  1BR9 A;  3TP8 A;  4UAI A;  1I94 Q;  1I4G A;  4RHS A;  2J7K A;  4IN3 A;  2EYO A;  4XLA A;  1JA0 A;  1G2S A;  2QEJ C;  3NHH A;  4N9P A;  4TVA B;  1Z9F A;  1TWC H;  3ZYY X;  1YJN A;  2UU9 L;  4DV1 L;  5ELE A;  2C2W A;  2K75 A;  1E2Z A;  3ND9 A;  4K6D A;  3HOX G;  1GHK A;  1BVS A;  5EBC A;  1QE6 A;  5HGQ A;  4FF1 A;  2V7Q A;  4Z4U A;  3ZZU A;  1Q7Y D;  1VQN B;  1VQA A;  4HSP A;  4JI8 L;  1N32 Q;  1E1O A;  1K8G A;  2Q2H A;  4DAP A;  2CHB D;  2G5D A;  4DXG A;  4TQU S;  3K58 A;  3LGJ A;  5THX A;  2UXD Q;  5JVG 3;  4C3J G;  1L1O C;  1DDG A;  2F0J A;  3H91 A;  4HIM A;  4X6A H;  4IPH A;  4CBV A;  4P12 A;  4DUY Q;  4IOC A;  1KK1 A;  1Q82 C;  3VR3 A;  4R4O A;  1JA1 A;  3Q38 A;  3DUZ A;  2NPF A;  4X3U A;  5IYR A;  2OBR A;  2IT1 A;  5EKL A;  5CBA E;  3JAM i;  3GTG H;  2WAQ G;  5I2X A;  4CJ1 B;  5E3F A;  4AF6 A;  2R93 H;  3A8J E;  1Q8K A;  4B44 A;  3I55 A;  1MJC A;  2KHJ A;  4M2L A;  2Q8R E;  2Q6K A;  1VF7 A;  4B9W A;  4NMZ A;  4R8I A;  2R7Z G;  4N8X 1;  1NMG A;  4JI4 L;  2QDB A;  4XQQ A;  3WWV A;  4YHH L;  1QJO A;  3HOX H;  1S5C D;  2IHE A;  1B2R A;  2JN4 A;  1MJE A;  3B78 A;  5IOD A;  3MVV A;  2F0N A;  2QA4 B;  2BE5 C;  2P3M A;  3ONU A;  1QVG A;  3L9A X;  1K3R A;  2NZ1 D;  4DFA A;  2IHF A;  4ZQ3 A;  3Q22 A;  2K50 A;  4A75 A;  1EFW A;  3A5Z B;  4UDU C;  2TMP A;  1KK2 A;  2Z6K A;  4XON A;  1YJW A;  1SM4 A;  4C3J H;  2JQO A;  2MGS A;  3NQT A;  4P74 A;  2A68 C;  4PV1 C;  1VQF A;  2ZTG A;  1H8E A;  2XNC A;  4I7A A;  2SOB A;  1SNP A;  3D6W A;  2E2I B;  1G7R A;  1WP6 A;  1GR1 A;  1QGZ A;  1YI2 B;  4YEJ A;  4YWK A;  1W2B B;  4XKV A;  2E2H H;  2CQA A;  2UXB Q;  1MRZ A;  1BNZ A;  4QUF A;  1XTD A;  3HOW B;  3KEW A;  1T6Y A;  1JIC A;  1KD1 D;  2KHS A;  1GHJ A;  4XXE A;  5LL6 S;  1CUK A;  1QFJ A;  3C1F A;  2C5C A;  4PZ8 A;  3K6O A;  1SE3 A;  2E8G A;  2VNU D;  4OO1 I;  3J81 j;  5BSX A;  3I1F A;  1G91 A;  1HUM A;  4PMW A;  3S24 A;  4XT3 B;  2OK7 A;  1UMK A;  1WTP A;  2R7Z H;  3OW2 A;  3NEL A;  1I5F A;  1OXV A;  4X62 L;  4HIK A;  1S3O A;  3P7J A;  1XPU A;  5ELB A;  4ZCL A;  3AYH B;  2CBX A;  2HDN B;  4RMF A;  5I4D A;  1WTX A;  1XJV A;  4K8J A;  1E63 A;  1G7T A;  5JJZ A;  4DR2 L;  2O4X A;  1HFG A;  2CC2 A;  4V0B A;  2QKI C;  3WOE A;  1HZE A;  4OON A;  1GJR A;  2F0V A;  4JBK A;  1BUV T;  4TMT A;  2HD3 A;  1EY9 A;  1U4R A;  4KJN A;  3A74 A;  4XD7 A;  4C3H H;  2E1R A;  5DEH A;  4YAL A;  4QUZ A;  4IFD I;  2VBT A;  2L11 A;  3NXW A;  1IBM L;  2OTJ A;  2OT2 A;  2ZM6 L;  1UE1 A;  2DOG A;  5JPM C;  2R6H A;  3HOZ B;  2IY5 B;  1K9M C;  4Z4T A;  3P1H A;  4N8F A;  3DHQ A;  3BVZ A;  5F4J A;  1AEX A;  4LUZ A;  3X3M A;  1M1K C;  1E1T A;  2KJX A;  5IYW A;  2X0K A;  3K7U C;  1VQK A;  1JOK A;  4XLH A;  3G48 A;  3S15 H;  3S16 H;  1FNM A;  4HTH A;  1K8O A;  3W2G A;  3OP1 A;  1TTT A;  4A3F G;  1VQ8 A;  1QUQ B;  4J8Q A;  3GTK H;  3MEH A;  2NVX H;  4J1M A;  3W2F A;  1JQY D;  5C4J H;  1B8A A;  4BBS H;  2QF7 A;  1FJG L;  4DXF A;  2Z6B D;  3Q8D A;  1XTC D;  3RNU A;  1Q82 D;  1PYW D;  4RHR A;  5DLQ E;  3W1G A;  1JE5 A;  5KRU A;  3PO2 G;  2CH4 W;  3FPK A;  1QFY A;  2BOS A;  3AMU A;  1E3Z A;  5HZA A;  2WSS A;  4WZK A;  1Y1V G;  1EZ8 A;  4K5X A;  2ZTN A;  2BSA A;  2EPB A;  4DV5 Q;  2FVG A;  1G7S A;  1STY A;  4Z4Z A;  4BWG B;  3S17 B;  5ELF A;  3KLR A;  3QIA A;  2C4T A;  2DUD A;  4L5S A;  3CB4 A;  2KVM A;  1U5K A;  4N3G A;  4DA2 A;  2BCO A;  5M5X B;  1A8V A; 
#chains in the Genus database with same CATH homology
 1HTP A;  4C1N K;  3CKI B;  4ZUJ A;  1F2Z A;  3BCD A;  4QB4 A;  1I8D A;  3I72 A;  1S5E D;  3GQB A;  1B2T A;  2BE5 D;  3IL8 A;  5K36 G;  4DU9 A;  4A93 B;  3BS1 A;  1WTR A;  2JIZ A;  4KHV A;  2A68 D;  5FO7 B;  4ZKB B;  4RKL A;  2PW5 A;  3LWE A;  3UI2 A;  1LT4 D;  4IQZ A;  1U4P A;  1W6J A;  2ZXR A;  1T5X D;  1B1Z A;  2DNC A;  5I6W A;  5DN6 A;  3HOY B;  5KNL A;  4JMQ A;  2A73 B;  2D62 A;  1V43 A;  4IAL A;  1TS4 A;  4WOR A;  1HCZ A;  2BA1 A;  1HUN A;  5IGB A;  3PO3 B;  1E3X A;  2K6A A;  3L3O C;  1B4O A;  2JEA I;  1OXX K;  2AQ3 B;  1RF2 D;  2R3Z A;  5FKA C;  2RVL A;  4PMB A;  3CP2 A;  2B8G A;  5FLX L;  4X3S A;  2CK3 A;  1LTR D;  5EQ0 A;  5K36 H;  4XMY A;  1SDF A;  3MFY A;  2WIN B;  2M9V A;  5T1G A;  1ZXT A;  2DN8 A;  2B2Y A;  1SJH D;  3FKS A;  2L1B A;  4XNF A;  4A3K B;  4IUU A;  3CMM A;  3QB3 A;  3GP7 A;  4HMJ A;  3I4M B;  5JVH 3;  4HIZ A;  3GO5 A;  2BCO A;  2RDF A;  3DWP A;  5G3L F;  5CMD A;  1B3A A;  1SAP A;  1EY7 A;  3BYT B;  4XLE A;  3Q23 A;  2K04 A;  1SYC A;  5JAV A;  3OFN A;  4GQN A;  3NBH A;  3HS0 C;  1W9X A;  5D3I B;  2JA6 B;  4CKE A;  3S1R B;  2EYP A;  1KDC A;  2VJJ A;  2EYH A;  1LAB A;  2J4X A;  1STG A;  1OO9 B;  2MPM A;  1MSG A;  5E1F A;  3VR4 A;  5CGK A;  3KBG A;  1ENF A;  1D5X C;  2V4D A;  2R6G A;  3PUX A;  4QF4 A;  3G7L A;  2E75 C;  2NN6 I;  3FKI B;  1H8H A;  3I70 A;  1HQM C;  3GV3 A;  4XDX A;  4DK0 A;  2MP1 A;  3BC9 A;  4XYQ A;  5HKK A;  5NUC A;  1KTK A;  1I4H A;  4ZK9 B;  1D6E C;  1B9M A;  1Q90 A;  4KY6 A;  3VA5 A;  1F9R A;  1D5M C;  1A6X A;  2NTT A;  3GTM B;  4ULL A;  1X32 A;  5C3E B;  2K33 A;  4TKO B;  4IUQ A;  2EXZ A;  2A74 C;  3K5M A;  3D31 A;  4YXW A;  2X6X A;  1B50 A;  3TZD A;  3C1E A;  3IFT A;  3EFX D;  4ZYS A;  2JSO A;  2NBF A;  4YIJ A;  2PZU A;  3HOU B;  5EKK A;  3MC0 B;  4XLF A;  1TT2 A;  1TII D;  5CV4 A;  2GK6 A;  1SXT A;  4F7X A;  4XR6 A;  1IW7 C;  3CQZ B;  1K8M A;  1AN8 A;  2PMZ B;  3M7N A;  3S1M B;  1UD6 A;  2F4I A;  1SYG A;  3A55 A;  2F0T A;  2W6J A;  3VYR A;  2O5I C;  4XYO A;  3PUY A;  3GTQ B;  1HQR D;  1O7Z A;  1RJT A;  4LAA A;  3MAQ A;  4XQJ A;  2L9H A;  3D4W A;  3RMH A;  5FL7 A;  1PFB A;  2WII B;  1TWC B;  3WOF A;  4JBW A;  4XOP A;  1PKV A;  2K28 A;  4OIK A;  5K5P A;  4ID6 A;  3ZPN A;  3J7A V;  1J9O A;  3S2D B;  2NB0 A;  5FK9 C;  1NCV A;  1L0Y B;  1H9S B;  2IWH A;  3D4D A;  2EYJ A;  2F0O A;  2A69 C;  2PW7 A;  4S3S A;  3K57 A;  1DJR D;  3BZD B;  3W3A A;  3SDZ A;  2KUM A;  1K28 D;  1KLU D;  4RA8 A;  1F9Q A;  1SYF A;  1Z6H A;  4P2C B;  3T13 A;  3I91 A;  5CR3 A;  1S4Z A;  4F87 A;  2R93 B;  1HTL D;  1QNU A;  1SMY C;  4FXD A;  1EY5 A;  1U4M A;  4FXK C;  1Q1B A;  3FRP B;  3HOX B;  3H3V C;  1CZG A;  3V2T A;  1TVX A;  3T56 B;  3RD4 A;  2F0G A;  3H09 A;  1B44 D;  3I4N B;  5KNC A;  3NWT A;  2IPK D;  4XOR A;  1BMF A;  2B2U C;  1RKN A;  4F8M A;  3NUC A;  2ZXP A;  4KY7 A;  2QIL A;  1JB3 A;  5I6Y A;  4OGQ C;  5G3L D;  3KK7 A;  1EU4 A;  1CZW A;  1WD0 A;  4J6H A;  2KCC A;  3CES A;  1MBY A;  2JEB I;  2WJY A;  2WZP P;  1TQO A;  2JE6 I;  4QUC A;  1X3Q A;  2E2H B;  4B3F X;  1ZKO A;  2WAQ B;  1SYE A;  5C3X A;  2JJ2 A;  3GD7 A;  3SHL A;  1CHQ D;  2F0Q A;  1I6V C;  5KNB A;  1AP0 A;  3QO2 A;  3QJY A;  1TWH B;  1KMH A;  2EY2 A;  1SE2 A;  1DOL A;  2J0T D;  2PYK A;  1TU2 B;  2PZW A;  4LMQ D;  5CV9 A;  4EQN A;  3FDT A;  2XND A;  2F0W A;  4IZ8 A;  4RWS C;  3I73 A;  4RCO A;  5M9O A;  1RHP A;  1UD4 A;  1LTA D;  3D8G A;  1JOQ A;  1OHH A;  3IFD A;  4Q5V A;  2HDL A;  3S15 B;  2B2Y C;  2G9H D;  3OEH A;  1UUP A;  3Q0A A;  2XZL A;  4RAU C;  5COR A;  1UEA B;  2RSN A;  4B9X A;  5C4J B;  4HCE A;  2A69 D;  4QMG A;  1NAP A;  1ML0 D;  1WD1 A;  2GJK A;  2VJI A;  1BXT A;  1EFR A;  4IUP A;  4O42 A;  2F0E A;  1STB A;  1HPC A;  3A7L A;  1EU3 A;  3A3B A;  1S5F D;  1SE4 A;  1PDQ A;  1HFN A;  1PTO F;  4IUV A;  2NVT B;  1JWM D;  2YU9 B;  5JEA G;  3TP5 A;  1EY6 A;  1NSN S;  4ASU A;  1R4Q B;  1JOR A;  1SMY D;  2AQ1 B;  4KD4 A;  1IKL A;  2EJM A;  1W0J A;  4MN3 A;  2FMC A;  4FNF A;  3PIP 3;  3W2D A;  3EJI A;  2L55 A;  4DGZ A;  1QG7 A;  2JJ1 A;  3OW7 A;  3CRK C;  4A3F B;  2R61 A;  3M7G A;  2B2T A;  4K8I A;  1LT5 D;  1M4V A;  5ISR A;  3PO2 B;  5ELC A;  1BLI A;  2A6H C;  3SK4 A;  3A35 A;  2JXM B;  1Y1V B;  1SJE D;  4TRD A;  1YNN C;  1TY0 A;  1HRJ A;  3PMF A;  1EZ6 A;  2FIN B;  4WJW A;  4AVZ A;  4KN7 C;  1WTV A;  5JEA H;  3VR2 A;  3MXU A;  2IW3 A;  3P20 A;  1HHV A;  3SK8 A;  3K0Y A;  5T1I A;  1E1Q A;  3AU7 A;  2G9D A;  3OEE A;  3V05 A;  2FHT A;  1W0K A;  1EEF D;  2KEC A;  1STH A;  1NRK A;  2AUJ D;  2ICI A;  3H0G B;  2F0K A;  1ENA A;  1GUG A;  1TWA B;  2M2L A;  3X3N A;  4IUR A;  4K2L A;  1G2T A;  3NTK A;  3SK5 A;  3SXH A;  3MZ5 A;  4KV6 A;  3G05 A;  1EWC A;  5C0X G;  1KDA A;  4EVO A;  2EJG C;  2GA4 B;  3ZIA A;  2PQE A;  3ERO A;  3MTS A;  3PV0 A;  1IYU A;  2WKD A;  1G29 1;  2L0C A;  4Q0F A;  1DCZ A;  2OXP A;  3HRZ C;  2KOL A;  4WRD A;  1R9T B;  1DM0 B;  1G6Z A;  3D3R A;  4ME5 A;  1EFI D;  3WQZ A;  2QCP X;  4RGO S;  1O78 A;  4XTC S;  1H9K A;  1ONL A;  4RFB A;  3R8B A;  2L4N A;  2XWJ B;  2NVY B;  1TS5 A;  2Y0S B;  4M8A A;  3J7A F;  3OMC A;  3S1Q B;  4FXU A;  1CA6 A;  3TP7 A;  5BN5 A;  1Z47 A;  5CC4 A;  2XOK A;  4GZY C;  3TN2 A;  3CU7 A;  1ZEQ X;  2XGJ A;  4TSS A;  4WFN 3;  5C0X H;  4G7W A;  1EOT A;  2RA4 A;  1FGB D;  4K5V A;  3GVL A;  1I3Q B;  2IX3 A;  1SYB A;  5JOB A;  3VYT A;  2FMM A;  1KAB A;  3FVQ A;  4X3K A;  5IGG A;  2A5H A;  4BA2 I;  3J81 L;  3K7A B;  2HDM A;  1J8I A;  1NUC A;  1FYC A;  3RZO B;  2A6H D;  1ROD A;  4KHZ A;  2Z4I A;  1YNJ C;  1YNN D;  1SFO B;  3NPP A;  1RD9 D;  3OHX C;  3TP6 A;  3A56 A;  3K5N A;  1VMP A;  2XNA C;  2SNS A;  3C2P A;  1SBB B;  1DD2 A;  5CV6 A;  1EYC A;  1F9P A;  4QIW B;  1NBM A;  1DXM A;  4G7H C;  2F0D A;  2PNR C;  2IJ0 A;  3RLF A;  1TWG B;  3NSW A;  4A3J B;  3BG3 A;  3I8Z A;  5LHY 1;  3QWN A;  1Q3L A;  5DNF A;  1STE A;  2E2D C;  2E74 C;  1D1I A;  4CKC A;  3M85 A;  2WB1 B;  1LV9 A;  1ESF A;  3J80 L;  1UAP A;  2EYF A;  2HQE A;  3HGB A;  2OEO A;  4X3T A;  3QOJ A;  1B9N A;  1EY0 A;  1LTT D;  2F0M A;  4ZUI A;  4HED A;  2XRQ D;  4KKU A;  2HCI A;  5HGT A;  1CHP D;  2KA7 A;  4B3G A;  2YYZ A;  1MAB A;  5CBE E;  4K14 A;  3NTI A;  5C4H A;  2RDH A;  1CQF A;  2BDN A;  1U4L A;  1ESR A;  4ZLT F;  5IT9 L;  1BOS A;  4K5W A;  2Z4H A;  5BN4 A;  1GUN A;  3IKJ A;  3ONA B;  2EZV A;  1PFM A;  1LT3 D;  1MD2 D;  1V1P A;  2AWO A;  1FX0 A;  1SKY B;  1E43 A;  1PRT F;  2LS0 1;  3OPO A;  3CP8 A;  2R92 B;  4BBR B;  1IKM A;  1WTH D;  2ZZE A;  1FD7 D;  1FNU A;  3T53 B;  4IFD G;  2NTS A;  1EY4 A;  2GJR A;  2B63 B;  5J22 A;  5C3W A;  4XN0 A;  1YNJ D;  2XN9 C;  2N55 A;  4A3I B;  2Q8T A;  2D9U A;  5KYI A;  5IGC A;  2F43 A;  1GUO A;  4OL7 A;  1JWU D;  5IGF A;  5C5M A;  2X53 S;  2B2T C;  2CW0 C;  3A8I E;  3D6C A;  1IL8 A;  1RTN A;  4H0L C;  4HR7 B;  1OB0 A;  3A3G A;  3MWY W;  2K5D A;  2D3N A;  5C44 B;  1JOO A;  3ND8 A;  1RTO A;  3BYY B;  3MXN A;  1FNV A;  1XYI A;  3A54 A;  1WTW A;  2V31 A;  3PUW A;  1CI3 M;  1PRT C;  1U9R A;  3F2U A;  2Z1C A;  1BCP F;  1Q12 A;  2AUK A;  2X6Y A;  3HEJ A;  4FF4 A;  3FPP A;  1TY2 A;  1VLY A;  1I4R A;  5ELD A;  3E0J A;  2ID0 A;  5I2Y A;  1OXS C;  1KNA A;  3EQL C;  2JA7 B;  3OMG A;  3SVM A;  2AQ2 B;  2MHV A;  4CJ0 B;  1W6K A;  3DM1 A;  1HA6 A;  3C46 A;  3VA7 A;  3HZX A;  1EQT A;  4EQP A;  1K83 B;  4NW2 A;  3MA2 B;  2B8F A;  4TT3 A;  5EJW A;  3H94 A;  1Y8P B;  5C6A A;  4A3D B;  2LKV A;  2NWG A;  2WAC A;  2F0F A;  4C1N I;  4A3B B;  1TS2 A;  2K32 A;  2K5W A;  3K5O A;  1KZL A;  1BF4 A;  5I9O A;  2X6W A;  2ENB A;  3VYS A;  2F1M A;  5A2Q L;  5F2D A;  1Y8N B;  4L6T B;  4XT1 B;  4EQO A;  1QNK A;  4XKW A;  1B53 A;  2TSS A;  4FXG C;  3TSS A;  1Q1E A;  4QCL A;  5DM6 3;  4NP5 A;  1BCP C;  4HAE A;  4FVM A;  3SR1 A;  3MHB A;  2LY7 A;  1V0E A;  4H44 C;  2BDO A;  2F0U A;  3JAM E;  2EE1 A;  1EIG A;  3H6M A;  5EPJ A;  2PPB C;  1ET6 A;  1S5B D;  2I46 A;  3NTH A;  4P22 A;  4DNT B;  4HMI A;  4I65 A;  1PTO H;  5D65 A;  2CVR A;  1UD5 A;  1CT1 D;  1HVX A;  5KEE A;  1OXU A;  1A2T A;  2CW0 D;  1V1O A;  4C56 C;  3ERQ A;  4NDX A;  5CV7 A;  1LT6 D;  4EGV A;  4V19 0;  2FFK B;  4KI0 A;  2WPD A;  4ZKC B;  3VR5 A;  1DYQ A;  1O7Y A;  3K59 A;  4IUT A;  3PUZ A;  1KLG D;  2C9O A;  1Y1W B;  2EY6 A;  1L0X B;  1GJX A;  3BVM A;  4MIU A;  3WDN A;  1EL0 A;  4R8N A;  1F77 A;  4ZAI A;  2EJF C;  4RH6 A;  3KF8 A;  4PNY A;  1PMR A;  2NN6 G;  1IW7 D;  3OE7 A;  2IX0 A;  5KND A;  4G7Z C;  1FR3 A;  4LJZ C;  2MJ8 A;  1UD2 A;  1SND A;  3BVG A;  1C4Q A;  4E0F A;  3R2T A;  1PZK D;  2K1B A;  1VJS A;  3DXJ C;  4ABN A;  1A15 A;  1QB5 D;  3NQI A;  3NK9 A;  2B2V A;  3OIP A;  1LAC A;  2K5Q A;  3A8K E;  3E6Z X;  1GXD C;  2RKS A;  5J1Z A;  4HCS A;  1IHZ A;  4RGT A;  5M5Y B;  1ET9 A;  3RUZ A;  3NBI A;  4H7B A;  4NNJ A;  3MFG A;  2ZXI A;  3OWE B;  1H9R A;  3DEO A;  5AFW A;  5KYL A;  3NWS A;  4G6I A;  4ILW A;  3R93 A;  4FP5 D;  2GK7 A;  3MXP A;  1ICW A;  4KY5 A;  1BCP D;  2VB2 X;  4R9W A;  1BPL A;  2F0L A;  3OWF A;  1PRT B;  1SNO A;  1VMC A;  5KIX A;  5IK2 A;  5HUR A;  5E4W C;  1SEB D;  2D2C C;  1T5E A;  1D5Z C;  3DEP A;  1D2B A;  3TBI B;  3M4Y A;  5BN3 A;  2NUC A;  3IAY A;  3GVJ A;  1I18 A;  4BY1 B;  3BDL A;  1EEI D;  3J7Y W;  4KD3 A;  2F03 A;  3BCF A;  2EY1 A;  1AZQ A;  4HN7 A;  1LTG D;  5EKI A;  1E79 A;  4XQF A;  5A35 A;  2M00 A;  3LWU A;  1CK1 A;  4KKS A;  1F2M A;  3TDQ A;  4ODG A;  1CFM A;  3P75 A;  4OIJ A;  2ZZG A;  2ZZQ A;  2F0I A;  1BQQ T;  2XWB B;  2QE7 A;  1A3V A;  2H4O A;  2AWN A;  1I6H B;  3I90 A;  2WJV A;  4CJ2 C;  1EIH A;  1PZJ D;  3AB9 A;  1PTO C;  2GJP A;  1QIL A;  1R4P B;  1SSO A;  4KKT A;  4U68 A;  3BDO A;  4XLC A;  2D5D A;  1RCV D;  1HA5 A;  1KAA A;  2ZT9 C;  3S14 B;  4C3I G;  1BCP B;  1QWY A;  2B2W A;  2SDF A;  4C3H G;  1EQV A;  1O80 A;  2B39 A;  4DAY A;  1F2L A;  1O7L A;  2DY8 A;  5FO8 B;  2F0H A;  1I50 B;  1DON A;  2E76 C;  1VCI A;  1LTI D;  1C48 A;  3J81 E;  4DNR B;  1E1R A;  4KK7 A;  1WTQ A;  2XSC A;  5TSS A;  2ZXH A;  1D1K A;  3DWA A;  1JWS D;  3S1N B;  1LTS D;  1I4Q A;  3S9W A;  4DF7 A;  4Z9C B;  5FOB B;  5EPL A;  3LX0 A;  3CHB D;  2Q8I B;  2MUY A;  2WP8 J;  1A2U A;  1CTM A;  3MXG A;  3TZU A;  4BA1 I;  2JP1 A;  4IUN A;  1KDB A;  3JU4 A;  2H1E A;  4H13 C;  3GTJ B;  4OHJ A;  2EDG A;  3T16 A;  3J80 E;  2LZJ A;  2EVB A;  1WPC A;  2ZZF A;  5M3M B;  4K2K A;  1EYA A;  4K6L A;  4PMC A;  2DY7 A;  1AZP A;  4A3G B;  3KUP A;  1WTO A;  4JK1 C;  5FLX E;  3OIQ A;  1MSH A;  3HG9 A;  1SNQ A;  2EOT A;  2KVO A;  3OSO A;  3T51 B;  2JA8 B;  1X3P A;  1DZ1 A;  1F9S A;  1E0B A;  4M1U B;  4A3M B;  3DDY A;  5IT9 E;  2B2U A;  1PTO D;  3A7A B;  2DNE A;  2J7Z A;  1Z7T A;  2IL8 A;  5IOC A;  1TR5 A;  3M3Y B;  2L5T A;  3GTO B;  1IYV A;  1V1P B;  1ENC A;  5COY A;  5JEA J;  1E2V A;  5C5L A;  1I4P A;  3FEW X;  2A6E C;  4XM3 A;  5LL6 X;  1S5D D;  4NKL A;  3BDC A;  1UD8 A;  4RKB A;  4E6I A;  2PZT A;  3EVQ A;  3N6R A;  2D3L A;  3V96 A;  2X6L A;  3I3C A;  3K5L A;  2B2V C;  3L7Z C;  2XVS A;  4PQX A;  3LNN A;  2PO4 A;  2HUG A;  5D14 A;  1DOK A;  4XIG S;  5M5W B;  4Y7N B;  1VF5 C;  2RSO A;  3M4O B;  1PLF A;  3KBX A;  1QCB D;  1AW7 A;  3Q24 A;  1STA A;  1LLR D;  1NR2 A;  1Q8I A;  1I4X A;  1STN A;  2KCN A;  2SEB D;  3NP8 A;  2R9V A;  2WKC A;  1TS3 A;  5DM7 3;  4FYD A;  1RDP D;  1DOM A;  2Z8L A;  4OO1 G;  4RGN A;  1II3 A;  2DIE A;  4XL9 A;  1QOH A;  4BY7 B;  4O1N A;  2RDG A;  3DWQ A;  1PTO B;  1BO0 A;  1WCM B;  4RCN A;  1Y8O B;  2PCF B;  1E2W A;  4U67 3;  5IGE A;  2K03 A;  3PUV A;  2I07 B;  1ILP A;  1M8A A;  2ICE C;  4G7O C;  1GUT A;  5C0X J;  1GUW A;  2X69 A;  4RGM A;  5J39 A;  1V8Q A;  4G4K A;  4B08 A;  3HOV B;  1BBX C;  3S2H B;  1GUS A;  2FJ2 A;  2L12 A;  4CKB A;  3BH4 A;  5EGT A;  4XN3 A;  4XQN A;  5D3D A;  3U9S A;  4OO1 H;  2RQX A;  2RBM A;  2HLD A;  1H9J A;  1TKW B;  5IGD A;  4TSF A;  1NR4 A;  3VYU A;  4A3E B;  3HP3 A;  2XRS D;  4YEL A;  5CV8 A;  4CHT B;  5I9P A;  1LTB D;  3KLS X;  2LFN A;  5E4X A;  2A6E D;  5A2Q E;  4IFD H;  2XIW A;  1ZYR C;  5C4X B;  4C2M B;  2F3W A;  1A3U A;  3GTL B;  3VR6 A;  5DAU A;  3TME A;  2F3V A;  4I7Z C;  1PXU A;  2B2W C;  4FF3 A;  3E5S A;  3DMU A;  2NVQ B;  1A3T A;  2EYM A;  3CRL C;  3RZD B;  4KMU C;  2SNM A;  2KQ3 A;  3HAG A;  2X85 A;  3EA6 A;  1JCK B;  1EYD A;  4FO2 A;  2O5J C;  1OXT A;  3GTP B;  3G6J B;  5C4Z A;  4DAV A;  3FMC A;  2WV6 D;  2KEE A;  2JYO A;  5IIF A;  3URY A;  4L63 B;  2M5S A;  2VB3 X;  4G57 A;  2EY5 A;  4II3 A;  2HCC A;  1V0F A;  4LK1 C;  2BA0 A;  4II2 A;  1VDZ A;  1JR0 D;  2JA5 B;  4F88 A;  3SK6 A;  4DN4 M;  1UD3 A;  5CYU A;  2XZP A;  1XWE A;  3T4A C;  2K7V A;  5KGU A;  3QG1 A;  1WVL A;  2F0S A;  4UZU A;  1PFN A;  1COW A;  4N9T A;  2VXW A;  2F0P A;  1G8Z D;  2LMC B;  3GTG B;  1GOZ A;  3GVK A;  3D4R A;  3Q6S A;  4FF2 A;  1JE4 A;  3U9O A;  2JDI A;  1SNM A;  4CGY B;  1PZI D;  3ITP A;  1PRT D;  1AFP A;  2KED A;  1CM9 A;  1LO5 D;  1ZYR D;  2K01 A;  4L8J A;  3KLS A;  2NYZ D;  4HSV A;  2O2L D;  3SE0 A;  2E1B A;  1C8C A;  4C3J B;  3NE5 B;  5M3F B;  1H9S A;  1EY8 A;  5C0X I;  5EPK A;  3GV6 A;  3OAA A;  4IFD J;  1H9M A;  4KTA A;  1SYD A;  4ZRZ A;  4G7X A;  3HKZ B;  1CQV A;  3SEB A;  1FNW A;  3JAM L;  2E2J B;  2W6I A;  1UNS A;  4KJO A;  3PIO 3;  4MHE A;  2XZO A;  2R7Z B;  2EYL A;  1HXY D;  1TWF B;  1MI2 A;  3O13 A;  2K05 A;  1MGS A;  1Y69 U;  3FPU B;  4C3I B;  4BS9 A;  1SNC A;  4KN4 C;  2X8K A;  3N52 A;  1EWH A;  4C3H B;  2VUM B;  4Z1M A;  1ILQ A;  2X6G A;  1F2Y A;  2NN6 H;  3R2I A;  1XX8 A;  2N88 A;  1CA5 A;  4AYB B;  5CV5 A;  2IX1 A;  1BDO A;  5FO9 B;  3QOL A;  5CDF A;  3R3O A;  3I4L A;  5JPN C;  5EBD A;  3S16 B;  1JC7 A;  3C3L A;  1KNE A;  4DK1 A;  2ZXO A;  3GTK B;  2NVX B;  3OOC A;  1XXG A;  4XOT A;  4BBS B;  1BR9 A;  3TP8 A;  4UAI A;  1I4G A;  4RHS A;  4IN3 A;  2EYO A;  4XLA A;  1G2S A;  2QEJ C;  3NHH A;  4N9P A;  3ZYY X;  5ELE A;  1E2Z A;  3ND9 A;  4K6D A;  1GHK A;  5EBC A;  1QE6 A;  4FF1 A;  2V7Q A;  4HSP A;  4DAP A;  2CHB D;  4DXG A;  4TQU S;  3K58 A;  5JVG 3;  4C3J G;  2F0J A;  3H91 A;  4CBV A;  3VR3 A;  3DUZ A;  4X3U A;  5CBA E;  2IT1 A;  5EKL A;  5I2X A;  4CJ1 B;  5E3F A;  3A8J E;  2Q8R E;  1VF7 A;  4B9W A;  4NMZ A;  4R8I A;  2QDB A;  4XQQ A;  1QJO A;  1S5C D;  5IOD A;  3MVV A;  2F0N A;  2BE5 C;  3L9A X;  2NZ1 D;  4DFA A;  3Q22 A;  4ZQ3 A;  4UDU C;  2TMP A;  4XON A;  2MGS A;  3NQT A;  2A68 C;  4PV1 C;  2ZTG A;  1H8E A;  2SOB A;  1SNP A;  3D6W A;  2E2I B;  1WP6 A;  4YEJ A;  4XKV A;  2CQA A;  1BNZ A;  4QUF A;  3HOW B;  3KEW A;  2KHS A;  1JIC A;  1GHJ A;  4XXE A;  5LL6 S;  3C1F A;  2C5C A;  3K6O A;  1SE3 A;  2VNU D;  4OO1 I;  1G91 A;  1HUM A;  4PMW A;  4XT3 B;  1WTP A;  1OXV A;  3P7J A;  5ELB A;  5I4D A;  1WTX A;  4K8J A;  5JJZ A;  2O4X A;  1HFG A;  4V0B A;  2QKI C;  3WOE A;  1HZE A;  2F0V A;  1BUV T;  4KJN A;  1EY9 A;  1U4R A;  4XD7 A;  5DEH A;  4IFD I;  2L11 A;  3NXW A;  2OT2 A;  5JPM C;  3HOZ B;  3P1H A;  3DHQ A;  3BVZ A;  1AEX A;  3X3M A;  2KJX A;  1JOK A;  4XLH A;  1K8O A;  4HTH A;  4J8Q A;  3MEH A;  4J1M A;  1JQY D;  2QF7 A;  4DXF A;  2Z6B D;  1XTC D;  1PYW D;  4RHR A;  5KRU A;  2BOS A;  3AMU A;  1E3Z A;  4K5X A;  2WSS A;  1EZ8 A;  2ZTN A;  2EPB A;  1STY A;  4BWG B;  3S17 B;  5ELF A;  3KLR A;  3QIA A;  2KVM A;  4DA2 A;  2OF1 A;  5M5X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...