3T56B

Crystal structure of the pre-extrusion state of the cusba adaptor-transporter complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein CusA
total genus 57
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t56B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t56B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t56B01
4KKSA 1A6XA 3DXJC 4H0LC 2A6ED 4XTCS 1GHKA 5K36H 2DNCA 1PMRA 1YNNC 1H9SB 1FR3A 2R6GA 2NN6H 1OXSC 3A7AB 1K8MA 3QJYA 4KN7C 3D4RA 2EJMA 4G7HC 5JEAH 3I72A 3PUZA 3D31A 3VR4A 1Q12A 3W3AA 3U9SA 3PUWA 3A8IE 3PUYA 4H13C 1GUTA 2PPBC 3FMCA 3I4LA 4OO1G 1H9JA 4DNTB 4H44C 1O78A 3LNNA 2AWOA 4IFDG 3IKJA 1Q1BA 1Q1EA 3TZUA 2A68C 3T51B 1H9MA 3H94A 3M4YA 3M7NA 5KNCA 1Q90A 3SE0A 3ND8A 3RLFA 1Y8OB 3VR5A 3VR6A 3AB9A 4RCNA 4KI0A 4HR7B 2EDGA 1LABA 1T5EA 1ZYRC 3CRKC 4KKUA 3VR3A 1TKWB 4DK1A 2A6EC 1DD2A 4JK1C 3SDZA 1IW7D 2A69D 4KHZA 3LWUA 3A8KE 1H9SA 1LACA 1OXTA 2D5DA 2O5JC 3I73A 2BA0A 2JE6I 3FPPA 5BN5A 5JEAG 1V43A 2BA1A 4KKTA 2AUJD 4PV1C 5BN4A 1HTPA 2E74C 1G291 2CW0C 3HGBA 1DCZA 1Y69U 4DNRB 2Q8IB 1Y8PB 2F1MA 3P20A 3T56B 3N6RA 5KNBA 4L8JA 1QJOA 2D62A 4KMUC 3PUVA 3GD7A 1ONLA 2A69C 3QIAA 1GUSA 3VA7A 1YNJC 3OPOA 5A35A 2PNRC 1H9RA 3VR2A 5K36G 1E2ZA 3PV0A 2JEAI 3T53B 2D2CC 1IW7C 3BG3A 5KNDA 1K8OA 1FYCA 1OXVA 2BDOA 2BE5C 2DNEA 2JEBI 4IQZA 4XIGS 1VF5C 2K7VA 2A6HD 3MXUA 3NE5B 1SMYC 2ZT9C 1CTMA 4JBWA 3BDOA 4TKOB 2B8FA 1GHJA 1HCZA 2LMCB 4G7ZC 2E76C 1OXUA 1OXXK 2EJFC 3KLRA 4BA2I 1VF7A 1GUOA 3GQBA 4DK0A 4G7OC 1E2WA 1V8QA 2KCCA 1E2VA 3MFYA 1VDZA 1CFMA 3OW7A 1EWHA 2EJGC 1GUGA 1IYUA 3A8JE 3ND9A 4LJZC 1O7LA 1B9NA 5BN3A 4GZYC 2KA7A 1HPCA 2PCFB 4LK1C 2YYZA 1HQMC 2IT1A 2QF7A 3L7ZC 4TQUS 3QG1A 2AUKA 4IFDH 1H9KA 2NN6I 3PUXA 2BE5D 1GJXA 2E75C 3M85A 4OO1H 2JXMB 4KN4C 1Y8NB 1Z6HA 1ZKOA 2DN8A 2EVBA 3A7LA 1TU2B 3OOCA 1B9MA 3CRLC 2K32A 3EQLC 2NN6G 2O5IC 2A68D 1VCIA 1DXMA 2V4DA 2L5TA 2K33A 2A6HC 4BA1I 1GUNA 4I7ZC 5C0XG 3WDNA 1Z7TA 2B8GA 3IFTA 1I6VC 4OGQC 1BDOA 5C0XH 1IYVA 1CI3M
chains in the Genus database with same CATH superfamily
4XKWA 1OGIA 2L55A 4DU9A 2WB1E 3T1YQ 3SKBA 1JB3A 3VYTA 2QKIC 3QJYA 5IYQA 3QWNA 1QGYA 1WOOA 3OTOL 3CCRA 1IZ6A 1VQGA 2IWHA 1TTTA 3AVUA 1BPLA 1I50B 2Q2HA 1S4ZA 3SK4A 4B9XA 1WPCA 1N8RD 3J7ZC 1TWCH 2AWOA 4L63B 2ES2A 4JI2Q 1VQLB 2JA8B 1NMGA 4IFDG 2BH2A 3SEBA 3ND8A 4HIDA 3VR6A 2V7UA 5IYDG 4DGZA 5GQOA 1CT1D 4QY7A 2A6EC 4FF3A 2ENBA 1EOVA 3Q38A 2ZTCA 4LAAA 5EPKA 1IKMA 4F8MA 3BCDA 4KD4A 3NELA 1HTLD 3A5UA 2VNJA 2KECA 4FF2A 4RPDA 5CV6A 2Z1CA 1GJRA 2ZJPA 3CW2A 4IOCA 5EBCA 5LMNW 3CMAB 4XM3A 4LMQD 1STBA 4AC9A 4JI4Q 2JYOA 2P3MA 3MMPA 4RD2A 1TWFH 1UD5A 1EP2B 3W5VA 1PFMA 3HFZB 1EEFD 1W0JA 5D3DA 1TWGB 2N78A 4P71A 4DV2L 4XD7A 5EQ0A 4RPBA 4WZEA 1YNJC 5M3MH 2F0DA 4LF6L 3CESA 1QVFA 2HD3A 5A35A 1IBML 3NQIA 4RGNA 1QVFB 3PV0A 2JP1A 5EBDA 3CC4A 5KNDA 1GKHA 1A3UA 2BDNA 2PZUA 4MN3A 5G3LD 2JA7G 1PH6A 4JI7Q 3SJZA 1LYLA 4MYUA 3B78A 1NUCA 2XNAC 2ZT9C 2R7ZB 5D14A 4C0SA 1DZ1A 5LMZA 1X3QA 2IW3A 1GHJA 4FXGC 1W6JA 4QB4A 2PLFA 5C44H 5M3FH 1JE4A 1SE2A 4YWMA 1E2WA 1V8QA 3ERSX 3PA1A 5TRDA 1JJGA 3M4OB 1CFMA 2KVOA 3GSIA 4DV2Q 2NVXH 3W2FA 4IUUA 1SE8A 1IYUA 3ND9A 4NDXA 2ZTGA 2QF7A 4XR6A 3KUPA 3QG1A 3EVQA 2UUCL 1XNQL 2NN6I 2PW7A 1SKQA 3P26A 4OPOA 3CXCB 2FVGA 3PMFA 2ZTDA 4X7CA 1M8AA 4UAIA 3J81c 3H3VC 5D65A 1PTOC 2DN8A 3A7LA 2IX0A 2JA8G 2GQFA 3FRPB 2NN6G 3JAML 1N0UA 3K0YA 3CP2A 5JBQA 2L5TA 3H0GH 3HOUB 1D7QA 1N36L 4I7ZC 3AU7A 1I18A 3I8ZA 3M7GA 4N8X1 2IHEA 3ZIAA 1KC8D 1J9ZA 2UUBQ 4LNQA 2KQ3A 3U58A 2GREA 1U5KA 2K52A 4POGA 3CCEB 1K83B 2L0CA 1E1RA 2C4UA 2VYQA 1AE3A 1EY9A 2MJ8A 1LTLA 1E3PA 5C44G 4ZCLA 4R9WA 3VYSA 4Z1MA 2F0TA 4OHJA 3BZCA 3NBHA 1WYDA 5KNLA 1I3QH 3SE0A 2ZXHA 2F0LA 3AVXA 4A3LH 1FGUA 1U4RA 5IWAQ 2F4NA 3K8AA 1EYGA 1WOSA 2EDGA 1IBLL 3S16B 3ICEA 3G6JB 1E0BA 3CCVA 4UAJA 3EBEA 2NVQB 4IN3A 3STBD 3U4VA 3OAAA 4TMWA 2FXQA 2UXDL 1HZCA 4K2KA 3K5MA 2B3GA 2RBMA 3P75A 1PH3A 2BGJA 2M2LA 4ZUJA 2BA1A 2EYOA 4PV1C 4A93G 4CKEA 1FDRA 2K50A 1TR5A 2FINB 3O13A 4DR4Q 4JI0Q 1O7IA 3HKZE 2EZVA 3J7A5 1PZID 3MC0B 4DUYQ 3FJOA 1HNZQ 4JI8Q 1U9RA 1S72A 3IAYA 1PYBA 1X55A 4F88A 2KJXA 2HQLA 2WSSA 1HR0L 1J8IA 4NXML 3HG9A 3HKZG 1VHEA 4IUVA 3STBC 5KIXA 1A8PA 2X6LA 1EFUA 3SLDA 4G7XA 1T6ZA 4QHYA 1B44D 2K01A 1KNEA 3NQTA 3MXGA 1HR0W 1KK2A 1HNXL 1UD6A 2LXKA 3TRZA 4G7OC 1JNYA 2B2UA 1PJ6A 1PZJD 1V5VA 3BH4A 1OB5A 3DWAA 4PMWA 5KYIA 3KF6B 1VQBA 3HS0C 3ULJA 1L2FA 1QG7A 4YY3L 3Q0AA 2F4VQ 1U4LA 1S3OA 1VMCA 1KK3A 1B70B 4HCEA 3GTGH 2NTTA 1HXYD 4X66L 1R4PB 1MKHA 2KHSA 4ME3A 2NVQH 2OTLA 2IPKD 2OBTA 4Z4TA 5KSWB 3OIPA 3CMEB 1AW7A 1X56A 4A75A 4FNFA 3GTGB 3U4ZA 1FD7D 4B3XA 4K5XA 2FFKB 4QL5A 4A3EB 4LFAL 4A3CH 3WDNA 1Z7TA 2DJGC 3MHPA 4PC6A 1ET6A 1J6QA 2WP8J 1S72B 3G71A 4LF8Q 2C9OA 4FXDA 3RLNA 1WORA 3W2HA 2QA4B 1BKBA 4HE6A 1NTGA 4IALA 3CC7A 4XL9A 3VR4A 1NR4A 2DY7A 3LX0A 3FKSA 1PRTB 3QOLA 4LF9L 3DWPA 3PO2H 3I4LA 1I50H 4DNTB 3GTQB 1O78A 3C1FA 4LFAQ 3S1NB 1SNPA 3RLFA 2AMCB 3ULPA 2X53S 3CCRB 2KHIA 1WTWA 3BY1A 3CCLB 2F0FA 2OF1A 4DKAC 3CRKC 2AHOA 5FO9B 1HA3A 4C3IG 3I1FA 2A69D 5JOBA 5KYLA 1IBKQ 4XQNA 3CCQA 1H9SA 4ODGA 4M2LA 1BBXC 1BF4A 4IJHA 1LM0A 1DG1G 4O42A 3A1PA 4XONA 1PJ5A 2F0SA 1HTPA 2ZL7A 2R92B 4LBWA 4OWTB 3RLOA 2VUMG 3HOYG 3KL9A 1RKNA 1F2YA 1KNAA 4DNRB 3S1QH 4FP5D 1EY7A 1VQFA 3E9HA 2XNJA 1Y1VH 4DV7L 3MEHA 1AEXA 3QIAA 1D5ZC 2VBTA 3S16H 3X3NA 1L1OC 4DAYB 2B63G 4ZYSA 2DCUA 4IUTA 3VR2A 2ZL6A 1FNWA 3MXPA 4PAAA 4XXEA 4R1JA 2QN6A 1RIPA 4X62Q 4DR7Q 4DPGA 2EQSA 2X6GA 1TWAB 2NVYB 5LMUQ 4GLVB 2VS1A 5E4WC 1XPUA 1SYEA 3A56A 2PI2E 4YEJA 3M4QA 1UD3A 5IYCG 2DOGA 1YBYA 2F3IA 5BSXA 3WQZA 2O2LD 1E1QA 3CPXA 1JB7A 2D3LA 3K0XA 5FOBB 4KY6A 2MNAA 4A3IB 1EWHA 4WFN3 3W5HA 1W6KA 1P8LA 1EIGA 4G7WA 1KK0A 1X3FA 3H0GB 4CDFC 1TWHH 3Q3AA 3PF5A 3DM3A 4F87A 1HVXA 1PHJA 1QG0A 1NB9A 2OEOA 4X05A 4RAUC 3AGQA 1PYWD 2GN5A 4OO1I 1E62A 3GO5A 4F7DA 1STHA 4M1KA 1Y8NB 4NBSA 4PZ8A 5M5WH 4DAPA 1N8RC 1XE1A 3TS2A 5ELNA 4A3GB 3HP3A 1NJID 4XQJA 5CGKA 1YI2B 4A3JH 1CQXA 3GTLH 5JVG3 4M53A 3Q6RA 3A8IA 4TT3A 2Q8TA 2R9VA 1YITA 3BG3A 1F2ZA 3TS0A 2GK6A 2A6ED 1B50A 4XTCS 4PGOA 3J80c 1HRJA 1KRTA 4GLXA 1G7CA 2JIZA 4P25A 1CQVA 4X3UA 4N8FA 1ILQA 4K8JA 3PUYA 3BZDB 5EAYA 5H1SE 4YHHQ 4N9PA 4K0KL 4RJLA 5DLQE 2H1EA 3M4YA 2XZOA 1SFOH 1J5EL 3IRBA 4QUFA 3CTAA 1S5FD 3GVJA 3AB9A 4G4KA 5LMUL 3F2BA 5A2QE 3VR3A 1GUWA 3Q6SA 4C3HB 1DD2A 2YWGA 4OPSA 1SYDA 3SDZA 4LUVA 1FNBA 1NJIC 4DV5L 3E5SA 3NWSA 2Y0SB 1GOZA 1XPRA 4WZLA 2WV6D 3S15B 4Z9CB 4JOIC 4OIJA 2X6XA 3RNUA 2AUJD 1V9PA 5BN4A 3ASPA 4Q0FA 5C4JB 1ZEQX 5M5YH 3LVBA 4ZRZA 4FVMA 1Y8PB 2OBRA 2YWEA 1FVIA 1HA6A 1RTNA 3L9AX 3D6WA 4LF4L 3MXNB 4O1NA 3PUVA 1YZ6A 1ONLA 1OO9B 4A3IG 4AYBB 3FEWX 4E0FA 2PI2A 1PH1A 5K36G 3OWEB 3TMEA 3W5OA 3V05A 2NB0A 1R5OA 4M0LA 4K6LA 4A3MG 4K5VA 1BCPC 3Q24A 1KIXA 4XIGS 4JBJA 3I4NH 5FNZA 3M9BA 3OWFA 3HOZB 5EGTA 1HCZA 1XXGA 4DN4M 5JPNC 4P1VA 1NBWA 3KLRA 1DDIA 2UXCQ 3TREA 5ELCA 4GOPC 4X7EA 1ML0D 2GVAA 1VQPB 3GVLA 4DUZQ 4BBSH 3OZUA 4X7FA 1EEID 4GNXB 3KFUA 4GKKL 4Y7NH 1EY8A 1AP0A 4LJZC 1IJFA 2UU9Q 4GZYC 2CW5A 2B2YC 2EXZA 3FPUB 4RCZA 2L12A 1UD2A 4YCWA 2A8VA 4A3DB 2OCEA 2KCMA 4WWVA 1RTOA 3Q22A 1AIPA 2RSOA 1VQOB 2JA9A 1IBMQ 5CV8A 3AFQA 3OOCA 1A0IA 1RQRA 3EQLC 3G4SB 4B47A 1VQAA 4RD4A 3S1MH 1G6PA 2JA5H 1QH0A 2F43A 1C0AA 4J0QA 4JI2L 2W6IA 1BDOA 2EY2A 1CI3M 4OELB 3BNWA 4K8IA 1K8AD 1KLGD 4EQOA 5IYWA 2DERA 1LTRD 4A93H 3R6KA 1TWHB 3K7AB 5CYUA 3D4RA 2EJMA 3GTQH 3HRZC 2Q8RE 4R4CA 4DR2L 1GO3E 5EPJA 4YY3Q 1SNQA 2F4VL 1DM0B 3D31A 3S2HH 3NTIA 1FNDA 4JBKA 5IGBA 2RDGA 2OTJB 1D2EA 4BY7B 3EIVA 1Q1EA 5I2XA 4YAWA 1C4QA 3KDFB 2OQ0A 5DNFA 1W3SA 3AVYA 1RDPD 1XWEA 3EJIA 4GQNA 2ZTNA 1WP6A 1XNRL 4NCNA 1WTHA 1XYIA 1LTGD 4P12A 2LZJA 3K5LA 1IHMA 1G7RA 3W2DA 2NZOA 1N08A 1U2RA 3HOXH 3CP0A 3LWUA 1SR3A 2GA4B 4J1MA 2ZXIA 2F0IA 2R93B 5FL7A 1YHQB 2O5JC 1QUQA 1SMYD 1WSRA 1R9TB 2QTLA 2RVLA 1BUVT 2YU9B 1PKVA 4A3MH 4QFMA 1Y1VB 1K9MD 1F20A 3GVKA 3V76A 1JA1A 1F9SA 4B3GA 1D2BA 3NBIA 3BDCA 3H9NA 3CCQB 3FDTA 4JI0L 1LT4D 2X6WA 2L4NA 5FJ8G 1B8AA 2QEJC 3KF6A 1L0WA 1CA5A 3AVVA 5C3EG 4ACAA 1I4PA 2JA6B 4BBRB 1YIJB 1QWYA 4WJ3M 3KK7A 3CCMB 1I8DA 1STGA 4C3JG 1B53A 4B9WA 5GADC 1UMKA 3GTOH 2HT1A 2NWGA 2B2WA 4RDJA 4UZEA 5LL6X 3TP5A 3IFDA 2A6HD 2WZNA 3QR8A 1PV4A 1SMYC 4JBWA 4DK6C 4RHRA 3A0JA 4QVJA 1E22A 5M5XB 1VQMB 1BCPB 4NB3A 2MUYA 5ELEA 4G7ZC 1YEZA 1OXUA 2F0GA 4C3JB 1I4QA 1YVCA 4HIZA 5GAGC 3TP7A 4XQFA 2KUMA 3T4AC 5IODA 3UE1A 4OPVA 1VHOA 2HLDA 4NXNQ 2I0QA 4NP5A 4A3JB 4R4TA 3GTLB 4HIOA 4QQBX 2JA7H 1XNRQ 2WZPP 2VB2X 1BX0A 1QILA 1FNCA 2PMDA 3M85A 3TDQA 1JB9A 1WFQA 1VLYA 2O4XA 2C78A 2RA4A 2Q6KA 4RDLA 4HSVA 2OXPA 5M3MG 1ENAA 3A8JA 2O5IC 3CXCA 3I91A 1F60A 4FF1A 3S2HB 1WTHD 3BS1A 1N32Q 1K0SA 3HOYB 3DMUA 5T1IA 3RN5A 2GJKA 1KHIA 4HMJA 3CCVB 1I4RA 5C4XH 1ZYRD 3JAMi 1EP3B 3HOVG 1OB2A 1K28A 2UUCQ 4ID6A 1XNQQ 1GJXA 4K6DA 1FR3A 4DXGA 1F9RA 4KN7C 2FMCA 3WWVA 3AVTA 5JEAH 3I72A 1YIJA 1EIYB 3VYUA 1CSQA 3W3AA 5JJLA 4ZLTF 1KQSB 1G8ZD 2A19A 3A8IE 1DARA 4H13C 4TRDA 4UDUC 4TVAB 5C3XA 1KXLA 4P6VF 4R71A 5DM73 5CV9A 1XJVA 2A68C 2I07B 4KHPL 2C2WA 1ZM2A 3OIQA 4C2MB 5IYDH 1QUQB 1SBBB 4OEMB 4ME5A 2PQEA 2Z0SA 2HDNB 3I55B 1FJGQ 1HUMA 1FRNA 3A8KE 4FN5A 1DJRD 1EFTA 1KL9A 2SNSA 2F3VA 4JMQA 1STEA 4Y52H 2YWFA 2QEXA 4QJFA 1E43A 3FP9A 4BWGB 1WCMB 1D8TA 3S2DH 1A8VA 1EWCA 1NBMA 2ZBVA 2KOLA 4JI4L 2XZLA 4LF7L 2M5SA 4XLHA 4X65Q 3TZDA 2VBSA 1QJOA 5KNBA 2XVSA 4GKJQ 4WZTA 1R4QB 2ALYB 4WRDA 1VQ7B 2B7BA 2CNDA 3A3GA 4JC0A 4X07A 1BCPF 3E0JA 4IUPA 1WOPA 1Q8KA 4DR6L 3GTJB 4LBVA 1BQEA 3V96A 5CV5A 4GKKQ 2TSSA 3HOYH 3C2PA 2ZM6Q 2R7ZH 5ELFA 1BO0A 2NUCA 2MHVA 3SK5A 4IFDI 3A54A 1ESRA 2VJJA 4DK3C 4GNXA 3PO2B 2XEXA 2BSAA 3TEHB 2ZJRA 2B2YA 1JCKB 1N06A 5IP7H 1JA0A 1BR9A 2VNHA 2L9HA 4DV4Q 1OXXK 1SYBA 4ZCMA 3GP7A 3ZYYX 2GJPA 3ONAB 1YI2A 3S15H 1EIHA 4B3RL 1KTVA 3K57A 2GPJA 1E2VA 5IYBG 4IPGA 1VDZA 1F9QA 1YNJD 2C77A 4JI6L 3J81L 5I6YA 1UD8A 1TWFB 4LK1C 1XTCD 2IT1A 1E3XA 3WNBA 2PW5A 3D3RA 2AUKA 4JOIA 3T1HL 3T1YL 1NAPA 2F0KA 2BE5D 1GO2A 2DIEA 4Y7CA 1F9PA 2M00A 2N3SA 4IJLA 5M5XH 5IYBH 1J5EQ 4P22A 4KN4C 2ASBA 5FO1A 2YTVA 4S3SA 4QVAA 1IBLQ 3FVQA 2JJ2A 1MIUA 3BU2A 1K3BC 4XT1B 2VJIA 5IP7G 1YJWA 1X32A 4TSFA 3ZZ0A 2AQ1B 2ATWA 4DUYL 2NVTH 1IYVA 3Q39A 1EYCA 4CQJA 1FNUA 1KAWA 1HFNA 3GIRA 2DNCA 2RQXA 2VL6A 4YWKA 1H85A 1H9SB 4DR5Q 2B63B 2W6JA 5FO8B 4XNFA 4OOVA 1ILPA 4RGMA 5AJ3Q 2N88A 4B3MQ 1UD4A 2DY8A 2IL8A 4IUNA 1WTPA 5EJWA 1PTOD 5GROA 3PIPA 4DR3L 1YJ9B 4FYDA 1K0RA 5CDFA 5A8AA 1DOKA 4KV6A 4EX5A 4HN7A 1OGJA 3A8KA 4LFCL 3G48A 1D5MC 1EU3A 3ITPA 3D4DA 1QFJA 4ZKCB 1LABA 1NCVA 2CH4A 4L5TA 1UE5A 4JK1C 5J22A 3FHWA 4A3IH 2A74C 1E7ZA 2CFMA 2EY6A 4A3KH 1MJCA 3CC2B 1PH7A 1ICFB 4TMXA 3W1GA 3K58A 3AEVA 4NW2A 1RD9D 4BBRH 3CAMA 2PE3A 4FWTA 2V31A 4DAVA 3MTSA 2ZBUA 2F0WA 1CM9A 4KJNA 1UUPA 4PC1A 3LGJA 5F4OA 2Q8IB 4X62L 4I65A 1LTAD 5FKAC 3K80C 4P72A 3PO3H 3GD7A 1EWIA 2VQFQ 5HGTA 1SYGA 2QDLA 3PVDA 1SROA 1VQ4B 3G6EB 2XRSD 4GN3B 2QGGA 2K6AA 1SYCA 2BMWA 2SEBD 1WTOA 3HKSA 4CJ0B 2VY3A 1K28D 3ZBUA 3S1QB 5C4XG 4YALA 1EIFA 4LF6Q 1UEBA 4ZGQB 2PO4A 3J81E 5J35A 2K7VA 4DV4L 3NE5B 2R92H 4RGOS 5AN9A 1JORA 1NSNS 3UDIA 2F0EA 5A2QL 1VQ8A 3TSSA 2R92G 4Z4UA 3P27A 1JJ2A 1FJGL 1B9NA 2BVNA 4YHBA 3WXMA 1V1OA 1OTCA 2HCJB 4TQUS 4LFBQ 1G91A 2YTYA 1YNND 3R93A 4GN5A 2QILA 3GTPH 1SAPA 3OW2B 1I4HA 3CCEA 2K14A 3BYYB 1M4VA 2VUMB 3C2QA 4DAYA 2EYJA 3I56A 1E1OA 3CRLC 5HXBA 3VO2A 1H8HA 2EYLA 4EVOA 3F8TA 4YXWA 2CCZA 2B2VA 5C5MA 3HAGA 3AYHB 2ZXOA 5CR3A 3CCMA 4C3IB 3S14B 4LF8L 1QE6A 4KI0A 2LXJA 3S17H 1GVPA 3CC7B 2NPFA 5B6IA 2MPMA 5IYRA 1TQOA 3VYRA 5HZAA 4N9TA 4DF7A 3CCSB 5M3FB 5C6AA 4BBRG 1D1NA 1YHAA 2C35B 3G7LA 2F0MA 3R8BA 5FLMG 5M5YB 5C4JH 2V7WA 1QVGB 2JJ1A 5FJ8H 4PC3A 3PSIA 3T51B 4B43A 4DNIA 1Q7YC 1I6HH 4CJ1B 3SEJA 1Q90A 3PQIA 4R4OA 4X66Q 1WTXA 4B3SQ 1I5FA 5IT9L 1GXDC 4HR7B 4IUQA 4RDKA 1E3ZA 4Z4WA 4HIKA 2FMMA 4PNYA 1GVHA 1IW7D 4U673 2UXBQ 5CV7A 1Q86C 1EFWA 3OZWA 3HOXG 3CC4B 4ACBA 5HZBA 1HFGA 1N33Q 3UDGA 2E74C 1G291 3E9IA 1PTOB 3U9OA 1WD1A 4WORA 3JC66 3I4MB 3B6YA 4A3GG 2RCFA 4XDXA 1A15A 4BY1H 3F1ZA 1E1TA 4HJ9A 1W87A 3T56B 3NWTA 2VQFL 3GTJH 4A3BG 4L8JA 1E79A 3AFPA 4X3TA 2A69C 4ZCIA 1MABA 2C5CA 1K73D 5H5JA 4C3IH 2V7QA 2RC5A 2GVBA 3SHLA 2KBNA 4JI8L 4II2A 3U6KA 1NY4A 2HUGA 3ZJYC 2KEDA 1IW7C 4PZ7A 3QO2A 1HNZL 2NVXB 3QFRA 2Y0SE 1WJJA 4DR4L 3J81k 1EFID 3UDFA 2LMCB 3HEJA 2E2IB 4A3FH 4B48A 4MTNA 2HQEA 3MFYA 1SNCA 3M4PA 3F2CA 4HAEA 2Y0SG 5C3EB 2DEUA 2K5DA 2Q6IA 3ES9A 4AIMA 4RM0A 3BVZA 4NXMQ 4WQMA 1DYQA 2P5ZX 3L7ZC 1VQJA 4HEDA 1D6EC 4IFDH 1PH2A 1Y1WH 5JVH3 2E75C 1EUJA 4RCOA 4QGUA 2R7FA 3WOFA 1HZAA 5FLXE 1XQBA 1TIID 5CV4A 2VQEQ 4ULLA 2VBUA 4MTKA 2EVBA 1VQOA 1TU2B 1JOQA 2PMZB 3JQPA 3LO8A 3QB3A 3NBHB 3C46A 2K33A 1XFOA 2JN9A 4TMVA 1Q82D 4NPSA 1QGAA 1MSHA 3IFTA 4A3MB 5C0XH 1S40A 2E1RA 3V2TA 1KD1D 2E2JB 5ISRA 1Z47A 4BXXG 3PA2A 3FPKA 5K36H 3OYYA 3PENA 4P9SA 1K8GA 3VNVA 1SXTA 1LTID 5IGCA 3F2UA 3T1HQ 1M1KD 4P3YA 2RHQB 3LNNA 1MGSA 4X64Q 4LUZA 1Q1BA 5L37A 2LS01 1KDBA 1UEAB 3ZZUA 3M7NA 1FL0A 1TS5A 3J7AF 1VQLA 1TLLA 4RCNA 4BY7H 1VQ5B 1TWCB 2K75A 1XMQQ 4A3FG 5IYNA 3Q23A 4XYQA 3GTPB 5GAHC 1JWUD 4GN4B 2MO1A 4DV0L 5JEAG 2UUBL 4O0AA 4KKTA 3WNDA 3TN2A 2J7ZA 1W0KA 5IYPA 3HOVH 4DXFA 2BF4A 2R7DA 2WAQG 3OZVA 4RD6A 2QEXB 4J15A 3RMHA 4UHVA 3S1MB 3GTOB 4LC0A 2E1BA 4B44A 2K5VA 2F1MA 3TBIB 2VXWA 1M1KC 2IX3A 1GR1A 1G2SA 1F2MA 2QDBA 3J80E 3JAME 5I9OA 4KD3A 1IYJB 5C4ZA 3VA7A 1EL0A 3OE7A 4WZKA 2K5WA 1A2TA 2PNHA 4PC2A 2PNRC 2M9VA 2EE1A 4XYOA 2KENA 5HY6A 4JV5Q 2V1CC 4G1BA 1E2ZA 5E3FA 1L0XB 4YCVA 1Q81C 4F7XA 4JPBW 5CBEE 2D2CC 2ZITA 2BDOA 2BE5C 3J80i 1JJ2B 4XOTA 3ZZTA 1PRTF 4I7AA 2HHHQ 5C4XB 1SDFA 3W2GA 3G05A 2F0JA 2B2TC 2AWNA 1R9TH 2ZZGA 3R6JA 4XLCA 1IL8A 4JI7L 1P4MA 1N9WA 2DYIA 2EYMA 1CNFA 3L0OA 4CJ2C 1CKNB 4KY7A 2EPBA 2JSOA 4V0BA 2K5HA 4OWWB 1PXUA 5BN3A 5CBAE 4LF7Q 2KA7A 3OJXA 1VQKA 1TT2A 2DETA 3BQJA 1N0VC 2FX3A 2DY1A 4QV2A 1PLFA 3NTKA 4L5SA 3PUXA 4KY5A 5EKLA 4B3FX 3H91A 3CCUB 1AN8A 2JA8H 3P1HA 1Q81D 5TV2A 1T6YA 1ICWA 4DV0Q 4YHHL 4XLAA 2MO0A 1KK1A 4YAUA 1DXMA 1V1QA 4XKVA 2V4DA 2WYRA 4A93B 1CZGA 1I6VC 4HJAA 4OXPA 2OT2A 1Q3LA 4B3TL 1A6XA 1GHKA 2J7KA 1YNXA 1OXSC 1VQKB 1B1ZA 4IPCA 4K2LA 2CW0D 2B63H 3MA2B 4KHPQ 4OP7A 3DEOA 5A89A 4TMZA 3OMCA 3I4MG 1Y1VG 1II3A 1M90C 4RH6A 3KF8A 1FNVA 2Z9HA 1YX2A 1PRTC 4XOPA 4QUCA 5KNCA 1SFOB 1PFSA 2ZXPA 2RC6A 3T13A 4RA8A 2Z6KA 2B7CA 1BMFA 1YLOA 4MZ9A 1JWMD 2WJYA 2K1BA 4AF6A 4ILWA 2WIIB 1K8AC 2GJRA 2YU9H 4J6HA 1S5CD 1RHPA 1CSPA 1G7TA 3UE0A 1WTRA 1S5DD 3ONUA 5E7NA 1B2RA 4C56C 1KC8C 1SEBD 3I56B 1Y14B 4U68A 5LL6S 1PZKD 2JQOA 1PH5A 2OWOA 1HQRD 2B2TA 2CW0C 4LF5L 4P73A 4DV1L 3X3MA 5BSYA 3U50C 3CCUA 1Y69U 4IOAA 5AJ3L 4B3ML 4QCLA 4OX9L 2CQAA 4AQYL 3I3CA 2JA5G 4Y9UA 4ZUIA 4NXNL 4KJOA 5IGGA 1VQ8B 2VZLA 4DR5L 3PO3G 5J39A 3ASSA 1PRTD 3PIO3 4OOXA 3OEHA 3S1RH 4G1VA 4L5RC 2WPDA 2PQAB 3KLSA 5FLXL 2AQ2B 2JA6G 1ELOA 2F0PA 3CCLA 1WSVA 1A63A 1HNWL 1MRZA 3IL8A 2L11A 2PMZE 3HOWB 5J1ZA 4IPDA 1K9MC 2XNCA 3S1RB 1KABA 5IIFA 2B29A 5J3BA 4A3CG 3OKXA 3WY9A 1G2TA 4Z4RA 3KJPA 5IT9c 1SSOA 3TQYA 2JN4A 1QCBD 4GS3A 1VJSA 2WKDA 2XOKA 4BA2I 4P2CB 1L1OA 1CNEA 4C1NK 3GQBA 1VQ6B 2WKCA 1CHQD 3BVMA 1WU8A 1WCMH 1HJPA 1U4MA 1IBKL 4BXXH 3QE2A 2Z6BA 4X8IA 3S9WA 2E5LL 4A3DH 3A74A 5I9PA 1JJCB 1STAA 4IW3B 4II3A 1H9KA 2V7VA 4AF7A 4LBZA 1WCMG 2CHBD 3NEMA 1DOMA 3GV3A 4Y7NB 3HOVB 2H4OA 3MFGA 3B8HA 1ZUNB 3GTKB 1ZM3A 2IJ0A 1P16A 1Q7YD 1YJNA 1QUFA 2OK7A 4BA1I 1KZLA 3OJWA 1YJWB 2B8GA 4JW0A 1HZBA 1AMOA 3CCJB 2X3UA 5M3MB 4RD3A 2YWHA 4NNJA 2EIXA 1PDQA 2SDFA 4JI5Q 4ROXA 3OHXC 2F0VA 2WAQE 2E2DC 3KBXA 2JA6H 1BNZA 1VQ5A 2I46A 4JCVE 4X65L 4CGYB 1CUKA 4AVZA 3DEPA 4G57A 5IGDA 1EWYA 2R3ZA 3PUWA 1U0LA 3M4OH 5DS0A 1H9JA 2F3WA 3UI2A 4LFBL 3HOWH 4JI3Q 3H94A 1NNXA 4DR2Q 1STNA 1A2UA 4RFBA 1CHPD 2B2VC 3VR5A 5IT9E 1YJ9A 5DM63 2CWAA 4PABA 3C3LA 1ZYRC 3MZ5A 4H9GA 1PH4A 3FKIH 1HH2P 1EFRA 2Q2TA 4N3NA 1VQCA 4EQNA 2ZZEA 1PJ7A 4R4IA 3CPWB 4QUZA 1A3TA 2JK8A 4A3BH 1ASYA 3I73A 2BA0A 2JE6I 4LBYA 5JJIA 4RHSA 1BX1A 4BY1G 1HNXQ 2RDFA 1GD7A 2R7ZG 4A3LG 5BR8Q 3HGBA 4Z4SA 1D5XC 3KLSX 1COWA 1TUIA 3P20A 4A3JG 2UU9L 2XWJB 3E20A 1X3GA 2EYHA 2X6YA 3NSWA 3S24A 1VQPA 1N34Q 1WDTA 3MHBA 1A3VA 2AKWB 2B2UC 2EYPA 1H9RA 1BVSA 1G6ZA 1EYDA 1L1OB 5KGUA 1VQ4A 3T53B 2DGYA 3KEWA 1PFBA 4H7BA 2DNEA 2JEBI 5DSZA 1DOLA 3BYTB 3VNUA 3NK9A 2VBVA 4Q5VA 2HCCA 1SYFA 3ISXA 1KMHA 3K7UC 1C7YA 1S4MA 3G71B 2C5BA 4B4DA 1VF7A 2NBFA 1TS4A 5JJKA 1LO5D 1EFCA 1XTDA 1Q82C 2UXDQ 1LT6D 4RMFA 4FO2A 3F2DA 3CHBD 4X06A 3E1YE 3AVWA 4DAMA 4X0CA 1QOHA 4LFCQ 1LTTD 4PMCA 2HDLA 4C3HG 5IGEA 1N05A 1HPCA 3VA5A 5IY0A 1UAPA 1GAQA 4UZFA 1G7SA 4Z4ZA 3BY2A 4K1XA 2OTLB 1ASZA 4OO1H 5M9OA 1IXRA 3KOJA 2RDHA 3G6EA 2CF4A 4IFDJ 3ASRA 4TN1A 4FDBA 2HIXA 1B4OA 5LMNQ 4HE5A 4Q7JB 4Z4VA 2XGJA 4XN0A 1J9OA 3A35A 4UP7A 4DV3L 3R2IA 4L6TB 1KRSA 4A3EH 5KW9A 1HHVA 1QUEA 5GAEC 4A76A 1B7YB 3Q6QA 4CKCA 1I6HB 1Q12A 3BCFA 3BVGA 4H44C 2YV5A 3NXWA 5C4HA 1EY4A 3CCJA 2QCPX 3E3XA 3TP6A 2F0UA 3TP8A 1MJEA 1LTBD 4HSPA 4JI6Q 1I3QB 1SRUA 2N55A 5DEHA 2XZPA 2HDMA 3NENA 3NUCA 2MP1A 4RLZA 2WFWA 3CP8A 2G9DA 1TKWB 3N52A 1Q8IA 4UP9A 4IO9A 1EQQA 3S14H 3I2ZA 4ZCKA 5TR9A 3A3BA 5C3WA 1ET9A 1UWVA 1BCPD 4ABNA 3HOUG 4HMIA 1RODA 4C1NI 1SKYB 1RF2D 1LV9A 3GDEA 3E0EA 1HZ9A 4AYBG 1EXMA 3QFSA 2FHTA 3J81i 4XT3B 4HJ5A 1NRKA 2Z6BD 1RQPA 4KLKA 1QGZA 2E2IH 2K04A 4EH1A 1ENFA 2ID0A 5BR8L 3S1NH 1VQHA 2OTJA 1VQNA 4YWLA 1N33L 4ZKBB 4RD0A 3D26A 1BQQT 1EU4A 1JMCA 2LFNA 4PMBA 2UXBL 4ZGNB 2CWPA 3ZC3A 2IY5B 4JV5L 2B2WC 1WD0A 4U9UA 4IQZA 1SNOA 2QGQA 2NVTB 5TSSA 2LY7A 1W2BA 4X3SA 2WR8A 2R6HA 4AH6A 4RKLA 4PQXA 2XWBB 3W5UA 1EY5A 1JOKA 5T1GA 1FRQA 2D0OA 2ZZQA 3H3VI 1ZXTA 2KEEA 4OL7A 2E2JH 3K59A 5FO0A 3OW7A 1PTOH 2EJGC 4GKJL 3K5OA 3H6MA 1D1IA 3ZBTA 3BC9A 2X8KA 1HQMC 4IURA 2UXCL 3ULLA 1UE7A 1YJNB 3GTMH 1ESFA 2Z4HA 4JI5L 2QA4A 2YTXA 2JXMB 2K03A 4FXUA 3ASQA 1PVOA 1X54A 3KF8B 3RN2A 1QNUA 1VQ9A 1M90D 4PC7A 1B3QA 2ICIA 4CDEC 5IE8A 1B9MA 4XORA 3GTMB 2F0HA 1WI5A 1IJEA 1O80A 3J80L 2ZZFA 4A3KB 2CBXA 1I94Q 1Y0RA 3WNCA 3G4SA 2R61A 4R8NA 4KKSA 1N32L 3K81C 4H0LC 1E63A 3V7AA 3NTHA 3A55A 5C0XI 3L2PA 1YNNC 2KVMA 2RSNA 3CPFA 3QOJA 4UZUA 4XMYA 3CQZB 5CC4A 4DFAA 4DV3Q 1S5ED 1SLJA 1QFYA 2B5OA 2CH4W 5IOCA 4X6AH 2V7XA 3D0FA 2G9HD 3TZUA 2ICEC 1R5NA 4DV6L 4OIKA 2MFIA 1B3AA 2RCNA 2VZAA 1RJTA 4M1UB 4A3GH 1Y8OB 2LKVA 3VDYA 1OHHA 5EKKA 1AFPA 3S2DB 4FXKC 5TY0A 4DK1A 1VMPA 2VB3X 4JYAQ 1HA5A 1HNWQ 3JU4A 4FF4A 2HIVA 3CQZH 2RHSB 4X64L 2JJQA 1WOCA 1X9NA 2D5DA 3J7AV 5BN5A 4K14A 3GTKH 2XRQD 3DLLA 2CQOA 2QTZA 4MYTA 2WB1B 4RD1A 4X3KA 2AQ3B 2RKSA 1O7YA 4UP8A 3NHHA 1MD2D 5THXA 3R2TA 2EY1A 1KLUD 2EIFA 2XGTA 4PZ6A 3RZDB 3ONYA 1B2TA 3MXNA 1DGSA 1AZPA 3J81j 1MSGA 4LW1A 5LMNL 2ZL5A 1LUZA 3H0GG 1WTQA 1AZQA 4DV1Q 1NB0A 3HKZB 4KMUC 1PFNA 1X3PA 4OONA 2Z4IA 1EZ8A 1BOSA 1Q86D 1D8LA 1PYSB 1QFZA 2VQEL 2I1LA 2F0OA 4GOPB 2F4IA 1EQRA 2JEAI 1H42A 3KJOA 1BBUA 3SGIA 3VO1A 3FKIB 4NKLA 4B08A 1KDAA 3W1BA 2QDXA 1V0EA 1N34L 4DQKA 3QFTA 1SNDA 1L0YB 4TKOB 1I7PA 4R4QA 3HOUH 3KBGA 2E76C 5HURA 4TMTA 3LWEA 2QMUA 4MNOA 1GUOA 4DR3Q 1PH9A 5M3FG 2H5XA 3E6ZX 1JT8A 3MWYW 4LWCA 3RZOH 3LQEA 4N3GA 1EQTA 1KQSA 4EQ5A 1GUGA 1SNMA 2WB1G 1S5BD 2K4KA 3URYA 1C8CA 3OP1A 4KHVA 4CDCC 4JYAL 5L46A 1UE1A 1BLIA 2ZXRA 3EROA 5F4MA 4DV6Q 1ZM9A 1ZKOA 2NZ1D 2PIAA 4A3EG 5E6TA 1ZM4A 3WBJA 1VCIA 2C4TA 2ZM6L 3PF4A 5C44B 2A6HC 4E6IA 1Q46A 4DR6Q 4MIUA 2EFGA 4OGQC 4WJWA 3DXJC 1DDGA 1UE6A 4QIWB 5IWAL 3A7AB 2RF4A 3MAQA 1W35A 4XLFA 1EYAA 4HTHA 2JDIA 3U2QA 3PUZA 3U9SA 3SK8A 2XNDA 3UDXA 1T6XA 2PPBC 2HCIA 4OO1G 3RUZA 4RG1A 2F52A 2PZWA 1F2LA 4B3RQ 5HGQA 1H9MA 5KEEA 2PYKA 4BY7G 3I70A 3RY8A 4Z4YA 2BCOA 2EYFA 3CRZA 3L3OC 1YITB 5C0XJ 1PA6A 1E64A 1AH9A 2GK7A 4KKUA 1LT3D 3CMEA 1A62A 1N36Q 1QZGA 1V0FA 1TS3A 2F1LA 2A73B 1YHQA 4DQLA 1JQYD 2ZTEA 4KK7A 4P74A 5IYCH 3JQQA 1SM4A 1JOOA 3SVMA 1SN8A 4H02A 3FPPA 3WYAA 1V1PB 3PCOB 1IHZA 2UUAQ 2AHOB 1DONA 1I94L 5IK2A 4XQQA 4X7DA 3EA6A 2QW7A 2WINB 4A3BB 2A1AA 4HCSA 4M8AA 3KDFA 3PIP3 2JA7B 4IZ8A 1K83H 3N6RA 3RR5A 5AFWA 1W2BB 3J7YW 2D62A 1WVLA 3OEEA 3WBKA 1AE2A 3Q8DA 4JBMA 1Q9SA 4P6YA 1JWSD 2NYZD 5D3IB 5FLXc 4JI1Q 2Q2UA 3SLNA 4G5GA 1QX4A 3NPPA 4A4IA 1H8EA 1Y1WG 3WOEA 1FYCA 3SR1A 1VQMA 1VQNB 5JJZA 4HIMA 5A88A 2E5LQ 2BH8A 5ELOA 2IHFA 1CTMA 4CDDC 1MI2A 3CC2A 2B8FA 2Z8LA 2F0NA 4P2NA 3R3OA 2F03A 2EJFC 1EY0A 5I2YA 4OX9Q 3CD6B 1F77A 1BXTA 5F4JA 4GOPA 2BV3A 3K6OA 1MHWC 2HHHL 2J0TD 2I5MX 2C5HA 3D4WA 1QB5D 4OWXB 1JICA 1LLRD 2I5HA 3HZXA 1CKOA 2VNUD 4V190 1D1KA 2D9UA 2K5QA 2KHJA 5F2DA 3PO2G 3T16A 3M3YB 4KTAA 3OW2A 3EN2A 2K32A 1VQEA 3H3VH 3HOZG 2R93H 3AGPA 3ZUGA 2L1BA 3BDLA 1X3EA 4L5QA 1GUNA 2X69A 4CHTB 4YIJA 2X0KA 1X65A 1K3RA 2D0PA 1QZHA 4BBSG 3I90A 1PMRA 2R6GA 4OOSA 3OFNA 5NUCA 3MCAA 3CPWA 4LF5Q 4JVZA 3D6CA 1CA6A 5IP9H 1JE5A 2CC2A 1W9XA 2NTSA 2OK8A 3RZOB 2N49A 2DUDA 2CRVA 1TY0A 3JAMc 4J8QA 3IKJA 2BGIA 4UPAA 3OTOQ 4R8IA 2SOBA 2D3NA 1TVCA 1KRHA 1T5EA 2XIWA 1PTOF 2PZTA 3BZKA 4HJ8A 3CKIB 2A5HA 2CKZB 3CD6A 2V7TA 5E4XA 5DN6A 5FLMH 1QVCA 4RWSC 4APVA 5EKIA 3EFXD 1BBWA 2VW9A 3DUZA 5CMDA 5J3OA 4DR7L 2G5DA 3DM1A 2L15A 4YAFA 2WACA 3P7JA 5FIUA 1MBYA 3VMFA 2OBSA 2OYNA 3JQRA 4CKBA 1H95A 2K05A 2OQKA 2FJ2A 3CCSA 4JG2A 1C9OA 4B3TQ 2X85A 3ZPNA 4POFA 1XMOL 2LSSA 4YCUA 1CQFA 1JR0D 3SXHA 5JAVA 3A5ZB 1VQ7A 4ZK9B 4DR1Q 5I6WA 1PH8A 4XN3A 3SJPA 3I55A 4A3FB 1U4PA 4JI1L 1WTVA 4C2MH 2D74A 3DDYA 1HZEA 1NDHA 1OXVA 4IPHA 2Q2IA 4RGTA 3I4NB 1HUNA 1FX0A 2BN4A 2VNKA 3MXUA 3OMGA 5K5PA 1VQ6A 2MQHA 1KAAA 4B3SL 1EY6A 1TWGH 1IKLA 2EY5A 3H15A 1O7ZA 2UUAL 1EZ6A 4EQPA 4TSSA 4DK0A 1EQVA 1VQDA 4UY8C 5M5WB 2EOTA 1KJZA 4ZQ3A 4CBVA 2BPOA 1I4GA 2HMAA 1N07A 3I4OA 4DV7Q 2E2HB 1QVGA 3K5NA 4DUZL 1EOTA 1O7LA 2B39A 2PCFB 4NMZA 4ALPA 2YYZA 1OB0A 5IGFA 4EGVA 4YAOA 1R5BA 2Q6LA 2K5NA 2N8NA 3HOXB 1TS2A 3SK6A 4LUOA 3I4MH 2E2HH 3CB4A 4BPRA 1G51A 1SMXA 1KDCA 2XTIA 4WJ4A 2WJVA 1XMQL 1NE3A 2VNIA 2WAQB 3CW2C 5DAUA 1W34A 1SJED 4GLAC 3ER0A 1TWAH 2NVYH 4C3HH 3I7FA 2XN9C 3PUNA 1Y0YA 2Z6KC 1SE4A 1T5XD 4C3JH 3B82A 2NN6H 1K8MA 2BM0A 2DJFC 3BJUA 3KLWA 4G7HC 2ZJQA 5JEAJ 5CORA 1NR2A 1GM5A 1UNSA 2Q6OA 4PG3A 4A3KG 5C3EH 1GUTA 1YHBA 3FMCA 5FO7B 4LF9Q 3M3YH 5E1FA 1STYA 3ASTA 2I5LX 3RD4A 3PGZA 2F0QA 4JI3L 5GV8A 5HKKA 1SJHD 1VQIA 1GAWA 1NMFA 4M4SA 1Z9FA 3AMUA 1CKMA 1RCVD 4QMGA 3W2EA 1LT5D 4KHZA 1QNKA 1LACA 1TY2A 4K5WA 4HJ7A 2QE7A 4P3IA 1OXTA 3PIOA 5IP9G 1B23P 1V43A 3DHQA 1C48A 1TXYA 2EXDA 5C5LA 4QIWE 4LF4Q 4P75A 4AYBE 5ELDA 2VUMH 1DCZA 3ERQA 4BY1B 4C43A 3W2IA 1I4XA 2CVRA 4ASUA 4DR1L 4QF4A 3HOZH 2R93G 1BJKA 5EMNA 1CKNA 3CF5A 1XMOQ 1GUSA 4GNXC 3CMMA 5H59A 2D9RA 4G6IA 3FKIG 3OPOA 3NP8A 1S0UA 5I4DA 2IX1A 1CK1A 1LTSD 4DV5Q 2TMPA 3H09A 3C1EA 4RCYA 3D8GA 2KCTA 3GV6A 4O2DA 4AQYQ 1K8OA 4XLEA 2J4XA 4RKBA 1VQ9B 1VF5C 2XSCA 1XB2A 1FNMA 2CK3A 3HOWG 2BOSA 4DA2A 4FK8A 3AQQA 5FA6A 3BDOA 2K28A 1FGBD 4MHEA 3K7AH 3QSYA 1KD1C 5COYA 1HR0Q 2NV4A 1SE3A 1XX8A 2KCCA 3U6BA 4YELA 4K0KQ 1KTKA 4Y9RA 2MGSA 5FK9C 5JPMC 3PO3B 5LHY1 1IB0A 3A8JE 1CZWA 2JA5B 1V1PA 2NZHA 4P26A 1RL2A 2SNMA 1T9HA 1TVXA 3CMAA 2KCNA 1K73C 1X6OA 3S17B 3LQ6A 3PUMA 5GV7A 1VS0A 4BS9A 4ZAIA 1ENCA 1Z6HA 3QFCA 1IL2A 1Y1WB 1VLOA 2E8GA 3MEFA 2A68D 2BM1A 3CU7A 4ZV4A 5KRUA 3RZDH 3OSOA 1EP1B 1E24A 5G3LF 3KYHC 3I4NG 4A3DG 5C0XG 1XPOA 1JC7A 5ELBA 2PQAA 5EPLA 3MVVA 4BBSB 3DWQA
chains in the Genus database with same CATH topology
4XKWA 2L55A 4DU9A 3VYTA 1JB3A 2QKIC 3QJYA 3QWNA 2IWHA 1BPLA 1I50B 3SK4A 1S4ZA 4B9XA 1WPCA 4L63B 2AWOA 2JA8B 4IFDG 3SEBA 3ND8A 3VR6A 4DGZA 1CT1D 2A6EC 4FF3A 2ENBA 4LAAA 5EPKA 1IKMA 4F8MA 3BCDA 4KD4A 1HTLD 2KECA 4FF2A 5CV6A 2Z1CA 5EBCA 4XM3A 4LMQD 1STBA 2JYOA 1UD5A 1PFMA 1EEFD 1W0JA 5D3DA 1TWGB 4XD7A 5EQ0A 1YNJC 2F0DA 3CESA 5A35A 3NQIA 4RGNA 3PV0A 2JP1A 5EBDA 5KNDA 1A3UA 2BDNA 2PZUA 4MN3A 5G3LD 2ZT9C 1NUCA 2XNAC 1DZ1A 2R7ZB 5D14A 1X3QA 2IW3A 1GHJA 4FXGC 1W6JA 4QB4A 1JE4A 1SE2A 1E2WA 1V8QA 3M4OB 1CFMA 2KVOA 4IUUA 1IYUA 3ND9A 4NDXA 2ZTGA 2QF7A 4XR6A 3KUPA 3QG1A 3EVQA 2NN6I 2PW7A 3PMFA 1M8AA 4UAIA 3H3VC 5D65A 1PTOC 2DN8A 3A7LA 2IX0A 3FRPB 2NN6G 3JAML 3K0YA 3CP2A 2L5TA 3HOUB 4I7ZC 3AU7A 1I18A 3I8ZA 3M7GA 3ZIAA 2KQ3A 1K83B 2L0CA 1E1RA 1EY9A 2MJ8A 4R9WA 3VYSA 4Z1MA 2F0TA 4OHJA 3NBHA 5KNLA 3SE0A 2ZXHA 2F0LA 1U4RA 2EDGA 3S16B 3G6JB 1E0BA 2NVQB 4IN3A 3OAAA 4K2KA 3K5MA 2RBMA 3P75A 4ZUJA 2M2LA 2BA1A 2EYOA 4PV1C 4CKEA 1TR5A 2FINB 3O13A 2EZVA 1PZID 3MC0B 1U9RA 3IAYA 4F88A 2KJXA 2WSSA 1J8IA 3HG9A 4IUVA 5KIXA 2X6LA 4G7XA 1B44D 2K01A 1KNEA 3NQTA 3MXGA 1UD6A 4G7OC 2B2UA 1PZJD 3BH4A 3DWAA 4PMWA 5KYIA 3HS0C 1QG7A 3Q0AA 1U4LA 1VMCA 4HCEA 2NTTA 1HXYD 1R4PB 2KHSA 2IPKD 3OIPA 1AW7A 4FNFA 3GTGB 1FD7D 4K5XA 2FFKB 4A3EB 3WDNA 1Z7TA 1ET6A 2WP8J 2C9OA 4FXDA 4IALA 4XL9A 3VR4A 1NR4A 2DY7A 3LX0A 3FKSA 1PRTB 3QOLA 3DWPA 3I4LA 3GTQB 4DNTB 1O78A 3C1FA 3S1NB 1SNPA 3RLFA 1WTWA 2X53S 2F0FA 2OF1A 3CRKC 5FO9B 4C3IG 2A69D 5JOBA 5KYLA 4XQNA 1H9SA 4ODGA 1BBXC 1BF4A 4O42A 4XONA 2F0SA 1HTPA 2R92B 1RKNA 1F2YA 1KNAA 4DNRB 4FP5D 1EY7A 3MEHA 1AEXA 3QIAA 1D5ZC 3X3NA 4ZYSA 4IUTA 3VR2A 1FNWA 3MXPA 4XXEA 2X6GA 1TWAB 2NVYB 5E4WC 1SYEA 3A56A 4YEJA 1UD3A 2O2LD 3WQZA 1E1QA 2D3LA 5FOBB 4KY6A 4A3IB 1EWHA 4WFN3 1W6KA 1EIGA 4G7WA 3H0GB 4F87A 1HVXA 2OEOA 4RAUC 1PYWD 4OO1I 3GO5A 1STHA 1Y8NB 4DAPA 4A3GB 3HP3A 4XQJA 5CGKA 5JVG3 4TT3A 2Q8TA 2R9VA 3BG3A 1F2ZA 2GK6A 2A6ED 1B50A 4XTCS 1HRJA 2JIZA 1CQVA 4X3UA 1ILQA 4K8JA 3PUYA 3BZDB 4N9PA 2H1EA 3M4YA 2XZOA 4QUFA 1S5FD 3GVJA 3AB9A 4G4KA 5A2QE 3VR3A 1GUWA 3Q6SA 4C3HB 1DD2A 1SYDA 3SDZA 3E5SA 3NWSA 2Y0SB 1GOZA 2WV6D 3S15B 4Z9CB 4OIJA 2X6XA 2AUJD 5BN4A 4Q0FA 5C4JB 1ZEQX 4ZRZA 4FVMA 1Y8PB 1HA6A 1RTNA 3L9AX 3D6WA 4O1NA 3PUVA 1ONLA 1OO9B 4AYBB 3FEWX 4E0FA 5K36G 3OWEB 3TMEA 3V05A 2NB0A 4K6LA 4K5VA 1BCPC 3Q24A 4XIGS 3OWFA 3HOZB 5EGTA 1HCZA 4DN4M 1XXGA 5JPNC 3KLRA 5ELCA 1ML0D 3GVLA 1EEID 1AP0A 1EY8A 4LJZC 4GZYC 2B2YC 2EXZA 3FPUB 2L12A 1UD2A 4A3DB 1RTOA 3Q22A 2RSOA 5CV8A 3OOCA 3EQLC 2F43A 2EY2A 2W6IA 1BDOA 1CI3M 4K8IA 1KLGD 4EQOA 1LTRD 3K7AB 1TWHB 5CYUA 3D4RA 2EJMA 3HRZC 2Q8RE 5EPJA 1SNQA 1DM0B 3D31A 3NTIA 5IGBA 2RDGA 4BY7B 1Q1EA 5I2XA 1C4QA 5DNFA 1RDPD 1XWEA 3EJIA 4GQNA 2ZTNA 1WP6A 1XYIA 1LTGD 2LZJA 3K5LA 3W2DA 3LWUA 2GA4B 4J1MA 2ZXIA 2F0IA 2R93B 5FL7A 2O5JC 1SMYD 1R9TB 2RVLA 1BUVT 2YU9B 1PKVA 1Y1VB 3GVKA 1F9SA 4B3GA 1D2BA 3NBIA 3BDCA 3FDTA 1LT4D 2X6WA 2L4NA 2QEJC 2JA6B 1CA5A 1I4PA 4BBRB 1QWYA 3KK7A 1I8DA 1STGA 4C3JG 1B53A 4B9WA 2NWGA 2B2WA 5LL6X 3TP5A 3IFDA 2A6HD 1SMYC 4JBWA 4RHRA 5M5XB 1BCPB 2MUYA 5ELEA 4G7ZC 1OXUA 2F0GA 4C3JB 1I4QA 4HIZA 3TP7A 4XQFA 2KUMA 3T4AC 5IODA 2HLDA 4NP5A 4A3JB 3GTLB 2WZPP 2VB2X 1QILA 3M85A 3TDQA 1VLYA 2O4XA 2RA4A 4HSVA 2OXPA 1ENAA 2O5IC 3I91A 4FF1A 3S2HB 1WTHD 3BS1A 3HOYB 3DMUA 5T1IA 2GJKA 4HMJA 1I4RA 1ZYRD 4ID6A 1GJXA 4K6DA 1FR3A 4DXGA 4KN7C 1F9RA 2FMCA 5JEAH 3I72A 3VYUA 3W3AA 4ZLTF 1G8ZD 3A8IE 4H13C 4TRDA 4UDUC 5C3XA 5DM73 5CV9A 2A68C 2I07B 3OIQA 4C2MB 1SBBB 4ME5A 2PQEA 1HUMA 3A8KE 1DJRD 2SNSA 2F3VA 4JMQA 1STEA 1E43A 4BWGB 1WCMB 1EWCA 1NBMA 2KOLA 2XZLA 2M5SA 4XLHA 3TZDA 5KNBA 1QJOA 2XVSA 1R4QB 4WRDA 3A3GA 3E0JA 1BCPF 4IUPA 3GTJB 3V96A 5CV5A 2TSSA 3C2PA 5ELFA 1BO0A 2NUCA 2MHVA 3SK5A 4IFDI 3A54A 1ESRA 2VJJA 3PO2B 2B2YA 1JCKB 1BR9A 2L9HA 1OXXK 1SYBA 3GP7A 1EIHA 3ZYYX 2GJPA 3ONAB 3K57A 1E2VA 1VDZA 1F9QA 1YNJD 3J81L 5I6YA 1UD8A 1TWFB 4LK1C 1XTCD 2IT1A 1E3XA 2PW5A 3D3RA 2AUKA 1NAPA 2F0KA 2BE5D 2M00A 2DIEA 1F9PA 4P22A 4KN4C 4S3SA 3FVQA 2JJ2A 4XT1B 2VJIA 1X32A 4TSFA 2AQ1B 1IYVA 1EYCA 1FNUA 1HFNA 2DNCA 2RQXA 1H9SB 2B63B 2W6JA 5FO8B 4XNFA 1ILPA 4RGMA 2N88A 1UD4A 2DY8A 2IL8A 4IUNA 1WTPA 5EJWA 1PTOD 4FYDA 5CDFA 1DOKA 4KV6A 4HN7A 1D5MC 1EU3A 3ITPA 3D4DA 4ZKCB 1LABA 1NCVA 4JK1C 5J22A 2A74C 2EY6A 3K58A 4NW2A 1RD9D 2V31A 4DAVA 3MTSA 2F0WA 1CM9A 4KJNA 1UUPA 2Q8IB 4I65A 1LTAD 5FKAC 3GD7A 5HGTA 1SYGA 2XRSD 2K6AA 1SYCA 2SEBD 1WTOA 4CJ0B 1K28D 3S1QB 2PO4A 3J81E 2K7VA 3NE5B 4RGOS 1JORA 1NSNS 2F0EA 5A2QL 3TSSA 1B9NA 1V1OA 1G91A 4TQUS 1YNND 3R93A 2QILA 1SAPA 1I4HA 2VUMB 3BYYB 1M4VA 4DAYA 2EYJA 3CRLC 1H8HA 2EYLA 4EVOA 4YXWA 2B2VA 5C5MA 3HAGA 2ZXOA 5CR3A 4C3IB 3S14B 1QE6A 4KI0A 2MPMA 3VYRA 1TQOA 4N9TA 4DF7A 5M3FB 5C6AA 3G7LA 2F0MA 3R8BA 5M5YB 2JJ1A 3T51B 4CJ1B 1Q90A 1WTXA 5IT9L 1GXDC 4HR7B 4IUQA 1E3ZA 2FMMA 4PNYA 1IW7D 4U673 5CV7A 1HFGA 2E74C 1G291 1WD1A 1PTOB 3U9OA 3I4MB 4WORA 4XDXA 1A15A 3T56B 3NWTA 4L8JA 1E79A 4X3TA 2A69C 1MABA 2C5CA 2V7QA 3SHLA 4II2A 2HUGA 2KEDA 1IW7C 3QO2A 2NVXB 1EFID 2LMCB 3HEJA 2E2IB 2HQEA 3MFYA 1SNCA 4HAEA 5C3EB 2K5DA 3BVZA 1DYQA 3L7ZC 4HEDA 1D6EC 4IFDH 5JVH3 2E75C 4RCOA 3WOFA 5FLXE 1TIID 5CV4A 4ULLA 2EVBA 1TU2B 1JOQA 2PMZB 3QB3A 3C46A 2K33A 1MSHA 3IFTA 4A3MB 5C0XH 3V2TA 2E2JB 5ISRA 1Z47A 5K36H 1SXTA 1LTID 5IGCA 3F2UA 3LNNA 1MGSA 1Q1BA 2LS01 1KDBA 1UEAB 3M7NA 1TS5A 3J7AF 4RCNA 1TWCB 3Q23A 4XYQA 3GTPB 1JWUD 5JEAG 4KKTA 3TN2A 2J7ZA 1W0KA 4DXFA 3RMHA 3S1MB 3GTOB 2E1BA 2F1MA 3TBIB 2VXWA 2IX3A 1G2SA 1F2MA 2QDBA 3J80E 3JAME 5I9OA 4KD3A 5C4ZA 3VA7A 1EL0A 3OE7A 2K5WA 1A2TA 2PNRC 2M9VA 2EE1A 4XYOA 1E2ZA 5E3FA 1L0XB 4F7XA 5CBEE 2D2CC 2BDOA 2BE5C 4XOTA 1PRTF 5C4XB 1SDFA 3G05A 2F0JA 2B2TC 2AWNA 2ZZGA 4XLCA 1IL8A 2EYMA 4CJ2C 4KY7A 2EPBA 2JSOA 4V0BA 1PXUA 5BN3A 5CBAE 2KA7A 1TT2A 1PLFA 3NTKA 3PUXA 4KY5A 5EKLA 4B3FX 3H91A 1AN8A 3P1HA 1ICWA 4XLAA 1DXMA 4XKVA 2V4DA 4A93B 1CZGA 1I6VC 2OT2A 1Q3LA 1A6XA 1GHKA 1OXSC 1B1ZA 4K2LA 2CW0D 3MA2B 3DEOA 3OMCA 1II3A 4RH6A 3KF8A 1FNVA 1SFOB 1PRTC 4XOPA 4QUCA 5KNCA 2ZXPA 3T13A 4RA8A 1BMFA 1JWMD 2WJYA 2K1BA 4ILWA 2WIIB 2GJRA 4J6HA 1S5CD 1RHPA 1WTRA 1S5DD 4C56C 1SEBD 4U68A 5LL6S 1PZKD 1HQRD 2B2TA 2CW0C 3X3MA 1Y69U 4QCLA 2CQAA 3I3CA 4ZUIA 4KJOA 5IGGA 5J39A 1PRTD 3PIO3 3OEHA 2WPDA 3KLSA 5FLXL 2AQ2B 2F0PA 3IL8A 2L11A 3HOWB 5J1ZA 3S1RB 1KABA 5IIFA 1G2TA 1SSOA 1QCBD 1VJSA 2WKDA 2XOKA 4BA2I 4P2CB 4C1NK 3GQBA 2WKCA 1CHQD 3BVMA 1U4MA 3S9WA 5I9PA 1STAA 4II3A 1H9KA 2CHBD 1DOMA 3GV3A 4Y7NB 3HOVB 2H4OA 3MFGA 3GTKB 2IJ0A 4BA1I 1KZLA 2B8GA 5M3MB 4NNJA 1PDQA 2SDFA 3OHXC 2F0VA 2E2DC 3KBXA 1BNZA 2I46A 4CGYB 4AVZA 3DEPA 4G57A 5IGDA 2R3ZA 3PUWA 1H9JA 2F3WA 3UI2A 3H94A 1STNA 1A2UA 4RFBA 1CHPD 2B2VC 3VR5A 5IT9E 5DM63 3C3LA 1ZYRC 3MZ5A 1EFRA 4EQNA 2ZZEA 1A3TA 3I73A 2BA0A 2JE6I 4RHSA 2RDFA 3HGBA 1D5XC 3KLSX 1COWA 3P20A 2XWJB 2EYHA 2X6YA 3NSWA 3MHBA 1A3VA 2B2UC 2EYPA 1H9RA 1G6ZA 1EYDA 5KGUA 3T53B 3KEWA 1PFBA 4H7BA 2DNEA 2JEBI 1DOLA 3BYTB 3NK9A 4Q5VA 2HCCA 1SYFA 1KMHA 2NBFA 1VF7A 1TS4A 1LO5D 1LT6D 4FO2A 3CHBD 1QOHA 1LTTD 4PMCA 4C3HG 2HDLA 5IGEA 1HPCA 3VA5A 1UAPA 4OO1H 5M9OA 2RDHA 4IFDJ 1B4OA 2XGJA 4XN0A 1J9OA 3A35A 3R2IA 4L6TB 1HHVA 4CKCA 1I6HB 1Q12A 3BCFA 3BVGA 4H44C 3NXWA 5C4HA 1EY4A 2QCPX 3TP6A 2F0UA 3TP8A 1LTBD 4HSPA 1I3QB 2N55A 5DEHA 2XZPA 2HDMA 3NUCA 2MP1A 3CP8A 2G9DA 1TKWB 3N52A 1Q8IA 3A3BA 5C3WA 1ET9A 1BCPD 4ABNA 4HMIA 1RODA 4C1NI 1SKYB 1RF2D 1LV9A 2FHTA 4XT3B 1NRKA 2Z6BD 2K04A 1ENFA 2ID0A 4ZKBB 1EU4A 1BQQT 2LFNA 4PMBA 2B2WC 1WD0A 4IQZA 1SNOA 2NVTB 5TSSA 2LY7A 4X3SA 4RKLA 4PQXA 2XWBB 1JOKA 1EY5A 5T1GA 2ZZQA 1ZXTA 2KEEA 4OL7A 3K59A 3OW7A 1PTOH 2EJGC 3K5OA 3H6MA 1D1IA 3BC9A 2X8KA 1HQMC 4IURA 1ESFA 2Z4HA 2JXMB 2K03A 4FXUA 1QNUA 2ICIA 1B9MA 4XORA 3GTMB 2F0HA 1O80A 3J80L 2ZZFA 4A3KB 2R61A 4R8NA 4KKSA 4H0LC 3NTHA 3A55A 5C0XI 1YNNC 2KVMA 2RSNA 3QOJA 4UZUA 4XMYA 3CQZB 5CC4A 4DFAA 1S5ED 5IOCA 2G9HD 3TZUA 2ICEC 4OIKA 4M1UB 1B3AA 1RJTA 1Y8OB 2LKVA 1OHHA 5EKKA 1AFPA 3S2DB 4FXKC 4DK1A 1VMPA 2VB3X 1HA5A 3JU4A 4FF4A 2D5DA 3J7AV 5BN5A 4K14A 2XRQD 2WB1B 4X3KA 2AQ3B 2RKSA 1O7YA 3NHHA 1MD2D 3R2TA 2EY1A 1KLUD 3RZDB 1B2TA 3MXNA 1AZPA 1MSGA 1WTQA 1AZQA 3HKZB 4KMUC 1PFNA 1X3PA 2Z4IA 1EZ8A 1BOSA 2F0OA 2F4IA 2JEAI 3FKIB 4NKLA 4B08A 1KDAA 1V0EA 1L0YB 1SNDA 4TKOB 3KBGA 2E76C 5HURA 3LWEA 1GUOA 3E6ZX 3MWYW 1EQTA 1GUGA 1SNMA 1S5BD 3URYA 1C8CA 4KHVA 1BLIA 2ZXRA 3EROA 1ZKOA 2NZ1D 1VCIA 5C44B 2A6HC 4E6IA 4MIUA 4OGQC 4WJWA 3DXJC 4QIWB 3A7AB 3MAQA 4XLFA 1EYAA 4HTHA 2JDIA 3PUZA 3U9SA 3SK8A 2XNDA 2PPBC 2HCIA 4OO1G 3RUZA 2PZWA 1F2LA 1H9MA 5KEEA 2PYKA 3I70A 2EYFA 2BCOA 3L3OC 5C0XJ 2GK7A 4KKUA 1LT3D 1V0FA 1TS3A 2A73B 1JQYD 4KK7A 3SVMA 1JOOA 3FPPA 1V1PB 1IHZA 1DONA 5IK2A 4XQQA 3EA6A 2WINB 4A3BB 4HCSA 4M8AA 3PIP3 2JA7B 4IZ8A 3N6RA 5AFWA 3J7YW 2D62A 1WVLA 3OEEA 1JWSD 2NYZD 5D3IB 3NPPA 1H8EA 3WOEA 1FYCA 3SR1A 5JJZA 1CTMA 1MI2A 2B8FA 2Z8LA 2F0NA 3R3OA 2F03A 2EJFC 1EY0A 5I2YA 1F77A 1BXTA 3K6OA 2J0TD 3D4WA 1QB5D 1JICA 1LLRD 3HZXA 2VNUD 4V190 1D1KA 2D9UA 2K5QA 5F2DA 3T16A 3M3YB 4KTAA 2K32A 2L1BA 3BDLA 1GUNA 2X69A 4CHTB 4YIJA 3I90A 1PMRA 2R6GA 3OFNA 5NUCA 3D6CA 1CA6A 1W9XA 2NTSA 3RZOB 1TY0A 4J8QA 3IKJA 4R8IA 2SOBA 2D3NA 1T5EA 2XIWA 1PTOF 2PZTA 3CKIB 2A5HA 5E4XA 5DN6A 4RWSC 5EKIA 3EFXD 3DUZA 5CMDA 3DM1A 2WACA 3P7JA 1MBYA 4CKBA 2K05A 2FJ2A 2X85A 3ZPNA 1CQFA 1JR0D 3SXHA 5JAVA 4ZK9B 5I6WA 4XN3A 4A3FB 1U4PA 1WTVA 3DDYA 1HZEA 1OXVA 4RGTA 3I4NB 1HUNA 1FX0A 3OMGA 3MXUA 5K5PA 1KAAA 1EY6A 2EY5A 1IKLA 1O7ZA 1EZ6A 4EQPA 4TSSA 4DK0A 1EQVA 5M5WB 2EOTA 4CBVA 4ZQ3A 1I4GA 2E2HB 3K5NA 1EOTA 1O7LA 2B39A 2PCFB 4NMZA 2YYZA 1OB0A 5IGFA 4EGVA 3HOXB 1TS2A 3SK6A 1KDCA 2WJVA 2WAQB 5DAUA 1SJED 2XN9C 1SE4A 1T5XD 2NN6H 1K8MA 4G7HC 5JEAJ 5CORA 1NR2A 1UNSA 1GUTA 3FMCA 5FO7B 5E1FA 1STYA 3RD4A 2F0QA 5HKKA 1SJHD 3AMUA 1RCVD 4QMGA 1LT5D 4KHZA 1QNKA 1LACA 1TY2A 4K5WA 2QE7A 1OXTA 1V43A 3DHQA 1C48A 5C5LA 5ELDA 1DCZA 3ERQA 4BY1B 1I4XA 2CVRA 4ASUA 4QF4A 1GUSA 3CMMA 4G6IA 3OPOA 3NP8A 5I4DA 2IX1A 1CK1A 1LTSD 2TMPA 3H09A 3C1EA 1K8OA 3D8GA 3GV6A 4XLEA 2J4XA 4RKBA 2XSCA 1VF5C 2CK3A 2BOSA 4DA2A 3BDOA 2K28A 1FGBD 4MHEA 5COYA 1SE3A 1XX8A 2KCCA 4YELA 1KTKA 2MGSA 5FK9C 5JPMC 3PO3B 5LHY1 3A8JE 1CZWA 2JA5B 1V1PA 2SNMA 1TVXA 2KCNA 3S17B 4BS9A 4ZAIA 1ENCA 1Z6HA 1Y1WB 2A68D 3CU7A 5KRUA 3OSOA 5G3LF 5C0XG 1JC7A 5ELBA 5EPLA 3MVVA 4BBSB 3DWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KKS A;  1A6X A;  3DXJ C;  4H0L C;  2A6E D;  4XTC S;  1GHK A;  5K36 H;  2DNC A;  1PMR A;  1YNN C;  1H9S B;  1FR3 A;  2R6G A;  2NN6 H;  1OXS C;  3A7A B;  1K8M A;  3QJY A;  4KN7 C;  3D4R A;  2EJM A;  4G7H C;  5JEA H;  3I72 A;  3PUZ A;  3D31 A;  3VR4 A;  1Q12 A;  3W3A A;  3U9S A;  3PUW A;  3A8I E;  3PUY A;  4H13 C;  1GUT A;  2PPB C;  3FMC A;  3I4L A;  4OO1 G;  1H9J A;  4DNT B;  4H44 C;  1O78 A;  3LNN A;  2AWO A;  4IFD G;  3IKJ A;  1Q1B A;  1Q1E A;  3TZU A;  2A68 C;  3T51 B;  1H9M A;  3H94 A;  3M4Y A;  3M7N A;  5KNC A;  1Q90 A;  3SE0 A;  3ND8 A;  3RLF A;  1Y8O B;  3VR5 A;  3VR6 A;  3AB9 A;  4RCN A;  4KI0 A;  4HR7 B;  2EDG A;  1LAB A;  1T5E A;  1ZYR C;  3CRK C;  4KKU A;  3VR3 A;  1TKW B;  4DK1 A;  2A6E C;  1DD2 A;  4JK1 C;  3SDZ A;  1IW7 D;  2A69 D;  4KHZ A;  3LWU A;  3A8K E;  1H9S A;  1LAC A;  1OXT A;  2D5D A;  2O5J C;  3I73 A;  2BA0 A;  2JE6 I;  3FPP A;  5BN5 A;  5JEA G;  1V43 A;  2BA1 A;  4KKT A;  2AUJ D;  4PV1 C;  5BN4 A;  1HTP A;  2E74 C;  1G29 1;  2CW0 C;  3HGB A;  1DCZ A;  1Y69 U;  4DNR B;  2Q8I B;  1Y8P B;  2F1M A;  3P20 A;  3T56 B;  3N6R A;  5KNB A;  4L8J A;  1QJO A;  2D62 A;  4KMU C;  3PUV A;  3GD7 A;  1ONL A;  2A69 C;  3QIA A;  1GUS A;  3VA7 A;  1YNJ C;  3OPO A;  5A35 A;  2PNR C;  1H9R A;  3VR2 A;  5K36 G;  1E2Z A;  3PV0 A;  2JEA I;  3T53 B;  2D2C C;  1IW7 C;  3BG3 A;  5KND A;  1K8O A;  1FYC A;  1OXV A;  2BDO A;  2BE5 C;  2DNE A;  2JEB I;  4IQZ A;  4XIG S;  1VF5 C;  2K7V A;  2A6H D;  3MXU A;  3NE5 B;  1SMY C;  2ZT9 C;  1CTM A;  4JBW A;  3BDO A;  4TKO B;  2B8F A;  1GHJ A;  1HCZ A;  2LMC B;  4G7Z C;  2E76 C;  1OXU A;  1OXX K;  2EJF C;  3KLR A;  4BA2 I;  1VF7 A;  1GUO A;  3GQB A;  4DK0 A;  4G7O C;  1E2W A;  1V8Q A;  2KCC A;  1E2V A;  3MFY A;  1VDZ A;  1CFM A;  3OW7 A;  1EWH A;  2EJG C;  1GUG A;  1IYU A;  3A8J E;  3ND9 A;  4LJZ C;  1O7L A;  1B9N A;  5BN3 A;  4GZY C;  2KA7 A;  1HPC A;  2PCF B;  4LK1 C;  2YYZ A;  1HQM C;  2IT1 A;  2QF7 A;  3L7Z C;  4TQU S;  3QG1 A;  2AUK A;  4IFD H;  1H9K A;  2NN6 I;  3PUX A;  2BE5 D;  1GJX A;  2E75 C;  3M85 A;  4OO1 H;  2JXM B;  4KN4 C;  1Y8N B;  1Z6H A;  1ZKO A;  2DN8 A;  2EVB A;  3A7L A;  1TU2 B;  3OOC A;  1B9M A;  3CRL C;  2K32 A;  3EQL C;  2NN6 G;  2O5I C;  2A68 D;  1VCI A;  1DXM A;  2V4D A;  2L5T A;  2K33 A;  2A6H C;  4BA1 I;  1GUN A;  4I7Z C;  5C0X G;  3WDN A;  1Z7T A;  2B8G A;  3IFT A;  1I6V C;  4OGQ C;  1BDO A;  5C0X H;  1IYV A;  1CI3 M; 
#chains in the Genus database with same CATH topology
 4XKW A;  1OGI A;  2L55 A;  4DU9 A;  2WB1 E;  3T1Y Q;  3SKB A;  1JB3 A;  3VYT A;  2QKI C;  3QJY A;  5IYQ A;  3QWN A;  1QGY A;  1WOO A;  3OTO L;  3CCR A;  1IZ6 A;  1VQG A;  2IWH A;  1TTT A;  3AVU A;  1BPL A;  1I50 B;  2Q2H A;  1S4Z A;  3SK4 A;  4B9X A;  1WPC A;  1N8R D;  3J7Z C;  1TWC H;  2AWO A;  4L63 B;  2ES2 A;  4JI2 Q;  1VQL B;  2JA8 B;  1NMG A;  4IFD G;  2BH2 A;  3SEB A;  3ND8 A;  4HID A;  3VR6 A;  2V7U A;  5IYD G;  4DGZ A;  5GQO A;  1CT1 D;  4QY7 A;  2A6E C;  4FF3 A;  2ENB A;  1EOV A;  3Q38 A;  2ZTC A;  4LAA A;  5EPK A;  1IKM A;  4F8M A;  3BCD A;  4KD4 A;  3NEL A;  1HTL D;  3A5U A;  2VNJ A;  2KEC A;  4FF2 A;  4RPD A;  5CV6 A;  2Z1C A;  1GJR A;  2ZJP A;  3CW2 A;  4IOC A;  5EBC A;  5LMN W;  3CMA B;  4XM3 A;  4LMQ D;  1STB A;  4AC9 A;  4JI4 Q;  2JYO A;  2P3M A;  3MMP A;  4RD2 A;  1TWF H;  1UD5 A;  1EP2 B;  3W5V A;  1PFM A;  3HFZ B;  1EEF D;  1W0J A;  5D3D A;  1TWG B;  2N78 A;  4P71 A;  4DV2 L;  4XD7 A;  5EQ0 A;  4RPB A;  4WZE A;  1YNJ C;  5M3M H;  2F0D A;  4LF6 L;  3CES A;  1QVF A;  2HD3 A;  5A35 A;  1IBM L;  3NQI A;  4RGN A;  1QVF B;  3PV0 A;  2JP1 A;  5EBD A;  3CC4 A;  5KND A;  1GKH A;  1A3U A;  2BDN A;  2PZU A;  4MN3 A;  5G3L D;  2JA7 G;  1PH6 A;  4JI7 Q;  3SJZ A;  1LYL A;  4MYU A;  3B78 A;  1NUC A;  2XNA C;  2ZT9 C;  2R7Z B;  5D14 A;  4C0S A;  1DZ1 A;  5LMZ A;  1X3Q A;  2IW3 A;  1GHJ A;  4FXG C;  1W6J A;  4QB4 A;  2PLF A;  5C44 H;  5M3F H;  1JE4 A;  1SE2 A;  4YWM A;  1E2W A;  1V8Q A;  3ERS X;  3PA1 A;  5TRD A;  1JJG A;  3M4O B;  1CFM A;  2KVO A;  3GSI A;  4DV2 Q;  2NVX H;  3W2F A;  4IUU A;  1SE8 A;  1IYU A;  3ND9 A;  4NDX A;  2ZTG A;  2QF7 A;  4XR6 A;  3KUP A;  3QG1 A;  3EVQ A;  2UUC L;  1XNQ L;  2NN6 I;  2PW7 A;  1SKQ A;  3P26 A;  4OPO A;  3CXC B;  2FVG A;  3PMF A;  2ZTD A;  4X7C A;  1M8A A;  4UAI A;  3J81 c;  3H3V C;  5D65 A;  1PTO C;  2DN8 A;  3A7L A;  2IX0 A;  2JA8 G;  2GQF A;  3FRP B;  2NN6 G;  3JAM L;  1N0U A;  3K0Y A;  3CP2 A;  5JBQ A;  2L5T A;  3H0G H;  3HOU B;  1D7Q A;  1N36 L;  4I7Z C;  3AU7 A;  1I18 A;  3I8Z A;  3M7G A;  4N8X 1;  2IHE A;  3ZIA A;  1KC8 D;  1J9Z A;  2UUB Q;  4LNQ A;  2KQ3 A;  3U58 A;  2GRE A;  1U5K A;  2K52 A;  4POG A;  3CCE B;  1K83 B;  2L0C A;  1E1R A;  2C4U A;  2VYQ A;  1AE3 A;  1EY9 A;  2MJ8 A;  1LTL A;  1E3P A;  5C44 G;  4ZCL A;  4R9W A;  3VYS A;  4Z1M A;  2F0T A;  4OHJ A;  3BZC A;  3NBH A;  1WYD A;  5KNL A;  1I3Q H;  3SE0 A;  2ZXH A;  2F0L A;  3AVX A;  4A3L H;  1FGU A;  1U4R A;  5IWA Q;  2F4N A;  3K8A A;  1EYG A;  1WOS A;  2EDG A;  1IBL L;  3S16 B;  3ICE A;  3G6J B;  1E0B A;  3CCV A;  4UAJ A;  3EBE A;  2NVQ B;  4IN3 A;  3STB D;  3U4V A;  3OAA A;  4TMW A;  2FXQ A;  2UXD L;  1HZC A;  4K2K A;  3K5M A;  2B3G A;  2RBM A;  3P75 A;  1PH3 A;  2BGJ A;  2M2L A;  4ZUJ A;  2BA1 A;  2EYO A;  4PV1 C;  4A93 G;  4CKE A;  1FDR A;  2K50 A;  1TR5 A;  2FIN B;  3O13 A;  4DR4 Q;  4JI0 Q;  1O7I A;  3HKZ E;  2EZV A;  3J7A 5;  1PZI D;  3MC0 B;  4DUY Q;  3FJO A;  1HNZ Q;  4JI8 Q;  1U9R A;  1S72 A;  3IAY A;  1PYB A;  1X55 A;  4F88 A;  2KJX A;  2HQL A;  2WSS A;  1HR0 L;  1J8I A;  4NXM L;  3HG9 A;  3HKZ G;  1VHE A;  4IUV A;  3STB C;  5KIX A;  1A8P A;  2X6L A;  1EFU A;  3SLD A;  4G7X A;  1T6Z A;  4QHY A;  1B44 D;  2K01 A;  1KNE A;  3NQT A;  3MXG A;  1HR0 W;  1KK2 A;  1HNX L;  1UD6 A;  2LXK A;  3TRZ A;  4G7O C;  1JNY A;  2B2U A;  1PJ6 A;  1PZJ D;  1V5V A;  3BH4 A;  1OB5 A;  3DWA A;  4PMW A;  5KYI A;  3KF6 B;  1VQB A;  3HS0 C;  3ULJ A;  1L2F A;  1QG7 A;  4YY3 L;  3Q0A A;  2F4V Q;  1U4L A;  1S3O A;  1VMC A;  1KK3 A;  1B70 B;  4HCE A;  3GTG H;  2NTT A;  1HXY D;  4X66 L;  1R4P B;  1MKH A;  2KHS A;  4ME3 A;  2NVQ H;  2OTL A;  2IPK D;  2OBT A;  4Z4T A;  5KSW B;  3OIP A;  3CME B;  1AW7 A;  1X56 A;  4A75 A;  4FNF A;  3GTG B;  3U4Z A;  1FD7 D;  4B3X A;  4K5X A;  2FFK B;  4QL5 A;  4A3E B;  4LFA L;  4A3C H;  3WDN A;  1Z7T A;  2DJG C;  3MHP A;  4PC6 A;  1ET6 A;  1J6Q A;  2WP8 J;  1S72 B;  3G71 A;  4LF8 Q;  2C9O A;  4FXD A;  3RLN A;  1WOR A;  3W2H A;  2QA4 B;  1BKB A;  4HE6 A;  1NTG A;  4IAL A;  3CC7 A;  4XL9 A;  3VR4 A;  1NR4 A;  2DY7 A;  3LX0 A;  3FKS A;  1PRT B;  3QOL A;  4LF9 L;  3DWP A;  3PO2 H;  3I4L A;  1I50 H;  4DNT B;  3GTQ B;  1O78 A;  3C1F A;  4LFA Q;  3S1N B;  1SNP A;  3RLF A;  2AMC B;  3ULP A;  2X53 S;  3CCR B;  2KHI A;  1WTW A;  3BY1 A;  3CCL B;  2F0F A;  2OF1 A;  4DKA C;  3CRK C;  2AHO A;  5FO9 B;  1HA3 A;  4C3I G;  3I1F A;  2A69 D;  5JOB A;  5KYL A;  1IBK Q;  4XQN A;  3CCQ A;  1H9S A;  4ODG A;  4M2L A;  1BBX C;  1BF4 A;  4IJH A;  1LM0 A;  1DG1 G;  4O42 A;  3A1P A;  4XON A;  1PJ5 A;  2F0S A;  1HTP A;  2ZL7 A;  2R92 B;  4LBW A;  4OWT B;  3RLO A;  2VUM G;  3HOY G;  3KL9 A;  1RKN A;  1F2Y A;  1KNA A;  4DNR B;  3S1Q H;  4FP5 D;  1EY7 A;  1VQF A;  3E9H A;  2XNJ A;  1Y1V H;  4DV7 L;  3MEH A;  1AEX A;  3QIA A;  1D5Z C;  2VBT A;  3S16 H;  3X3N A;  1L1O C;  4DAY B;  2B63 G;  4ZYS A;  2DCU A;  4IUT A;  3VR2 A;  2ZL6 A;  1FNW A;  3MXP A;  4PAA A;  4XXE A;  4R1J A;  2QN6 A;  1RIP A;  4X62 Q;  4DR7 Q;  4DPG A;  2EQS A;  2X6G A;  1TWA B;  2NVY B;  5LMU Q;  4GLV B;  2VS1 A;  5E4W C;  1XPU A;  1SYE A;  3A56 A;  2PI2 E;  4YEJ A;  3M4Q A;  1UD3 A;  5IYC G;  2DOG A;  1YBY A;  2F3I A;  5BSX A;  3WQZ A;  2O2L D;  1E1Q A;  3CPX A;  1JB7 A;  2D3L A;  3K0X A;  5FOB B;  4KY6 A;  2MNA A;  4A3I B;  1EWH A;  4WFN 3;  3W5H A;  1W6K A;  1P8L A;  1EIG A;  4G7W A;  1KK0 A;  1X3F A;  3H0G B;  4CDF C;  1TWH H;  3Q3A A;  3PF5 A;  3DM3 A;  4F87 A;  1HVX A;  1PHJ A;  1QG0 A;  1NB9 A;  2OEO A;  4X05 A;  4RAU C;  3AGQ A;  1PYW D;  2GN5 A;  4OO1 I;  1E62 A;  3GO5 A;  4F7D A;  1STH A;  4M1K A;  1Y8N B;  4NBS A;  4PZ8 A;  5M5W H;  4DAP A;  1N8R C;  1XE1 A;  3TS2 A;  5ELN A;  4A3G B;  3HP3 A;  1NJI D;  4XQJ A;  5CGK A;  1YI2 B;  4A3J H;  1CQX A;  3GTL H;  5JVG 3;  4M53 A;  3Q6R A;  3A8I A;  4TT3 A;  2Q8T A;  2R9V A;  1YIT A;  3BG3 A;  1F2Z A;  3TS0 A;  2GK6 A;  2A6E D;  1B50 A;  4XTC S;  4PGO A;  3J80 c;  1HRJ A;  1KRT A;  4GLX A;  1G7C A;  2JIZ A;  4P25 A;  1CQV A;  4X3U A;  4N8F A;  1ILQ A;  4K8J A;  3PUY A;  3BZD B;  5EAY A;  5H1S E;  4YHH Q;  4N9P A;  4K0K L;  4RJL A;  5DLQ E;  2H1E A;  3M4Y A;  2XZO A;  1SFO H;  1J5E L;  3IRB A;  4QUF A;  3CTA A;  1S5F D;  3GVJ A;  3AB9 A;  4G4K A;  5LMU L;  3F2B A;  5A2Q E;  3VR3 A;  1GUW A;  3Q6S A;  4C3H B;  1DD2 A;  2YWG A;  4OPS A;  1SYD A;  3SDZ A;  4LUV A;  1FNB A;  1NJI C;  4DV5 L;  3E5S A;  3NWS A;  2Y0S B;  1GOZ A;  1XPR A;  4WZL A;  2WV6 D;  3S15 B;  4Z9C B;  4JOI C;  4OIJ A;  2X6X A;  3RNU A;  2AUJ D;  1V9P A;  5BN4 A;  3ASP A;  4Q0F A;  5C4J B;  1ZEQ X;  5M5Y H;  3LVB A;  4ZRZ A;  4FVM A;  1Y8P B;  2OBR A;  2YWE A;  1FVI A;  1HA6 A;  1RTN A;  3L9A X;  3D6W A;  4LF4 L;  3MXN B;  4O1N A;  3PUV A;  1YZ6 A;  1ONL A;  1OO9 B;  4A3I G;  4AYB B;  3FEW X;  4E0F A;  2PI2 A;  1PH1 A;  5K36 G;  3OWE B;  3TME A;  3W5O A;  3V05 A;  2NB0 A;  1R5O A;  4M0L A;  4K6L A;  4A3M G;  4K5V A;  1BCP C;  3Q24 A;  1KIX A;  4XIG S;  4JBJ A;  3I4N H;  5FNZ A;  3M9B A;  3OWF A;  3HOZ B;  5EGT A;  1HCZ A;  1XXG A;  4DN4 M;  5JPN C;  4P1V A;  1NBW A;  3KLR A;  1DDI A;  2UXC Q;  3TRE A;  5ELC A;  4GOP C;  4X7E A;  1ML0 D;  2GVA A;  1VQP B;  3GVL A;  4DUZ Q;  4BBS H;  3OZU A;  4X7F A;  1EEI D;  4GNX B;  3KFU A;  4GKK L;  4Y7N H;  1EY8 A;  1AP0 A;  4LJZ C;  1IJF A;  2UU9 Q;  4GZY C;  2CW5 A;  2B2Y C;  2EXZ A;  3FPU B;  4RCZ A;  2L12 A;  1UD2 A;  4YCW A;  2A8V A;  4A3D B;  2OCE A;  2KCM A;  4WWV A;  1RTO A;  3Q22 A;  1AIP A;  2RSO A;  1VQO B;  2JA9 A;  1IBM Q;  5CV8 A;  3AFQ A;  3OOC A;  1A0I A;  1RQR A;  3EQL C;  3G4S B;  4B47 A;  1VQA A;  4RD4 A;  3S1M H;  1G6P A;  2JA5 H;  1QH0 A;  2F43 A;  1C0A A;  4J0Q A;  4JI2 L;  2W6I A;  1BDO A;  2EY2 A;  1CI3 M;  4OEL B;  3BNW A;  4K8I A;  1K8A D;  1KLG D;  4EQO A;  5IYW A;  2DER A;  1LTR D;  4A93 H;  3R6K A;  1TWH B;  3K7A B;  5CYU A;  3D4R A;  2EJM A;  3GTQ H;  3HRZ C;  2Q8R E;  4R4C A;  4DR2 L;  1GO3 E;  5EPJ A;  4YY3 Q;  1SNQ A;  2F4V L;  1DM0 B;  3D31 A;  3S2H H;  3NTI A;  1FND A;  4JBK A;  5IGB A;  2RDG A;  2OTJ B;  1D2E A;  4BY7 B;  3EIV A;  1Q1E A;  5I2X A;  4YAW A;  1C4Q A;  3KDF B;  2OQ0 A;  5DNF A;  1W3S A;  3AVY A;  1RDP D;  1XWE A;  3EJI A;  4GQN A;  2ZTN A;  1WP6 A;  1XNR L;  4NCN A;  1WTH A;  1XYI A;  1LTG D;  4P12 A;  2LZJ A;  3K5L A;  1IHM A;  1G7R A;  3W2D A;  2NZO A;  1N08 A;  1U2R A;  3HOX H;  3CP0 A;  3LWU A;  1SR3 A;  2GA4 B;  4J1M A;  2ZXI A;  2F0I A;  2R93 B;  5FL7 A;  1YHQ B;  2O5J C;  1QUQ A;  1SMY D;  1WSR A;  1R9T B;  2QTL A;  2RVL A;  1BUV T;  2YU9 B;  1PKV A;  4A3M H;  4QFM A;  1Y1V B;  1K9M D;  1F20 A;  3GVK A;  3V76 A;  1JA1 A;  1F9S A;  4B3G A;  1D2B A;  3NBI A;  3BDC A;  3H9N A;  3CCQ B;  3FDT A;  4JI0 L;  1LT4 D;  2X6W A;  2L4N A;  5FJ8 G;  1B8A A;  2QEJ C;  3KF6 A;  1L0W A;  1CA5 A;  3AVV A;  5C3E G;  4ACA A;  1I4P A;  2JA6 B;  4BBR B;  1YIJ B;  1QWY A;  4WJ3 M;  3KK7 A;  3CCM B;  1I8D A;  1STG A;  4C3J G;  1B53 A;  4B9W A;  5GAD C;  1UMK A;  3GTO H;  2HT1 A;  2NWG A;  2B2W A;  4RDJ A;  4UZE A;  5LL6 X;  3TP5 A;  3IFD A;  2A6H D;  2WZN A;  3QR8 A;  1PV4 A;  1SMY C;  4JBW A;  4DK6 C;  4RHR A;  3A0J A;  4QVJ A;  1E22 A;  5M5X B;  1VQM B;  1BCP B;  4NB3 A;  2MUY A;  5ELE A;  4G7Z C;  1YEZ A;  1OXU A;  2F0G A;  4C3J B;  1I4Q A;  1YVC A;  4HIZ A;  5GAG C;  3TP7 A;  4XQF A;  2KUM A;  3T4A C;  5IOD A;  3UE1 A;  4OPV A;  1VHO A;  2HLD A;  4NXN Q;  2I0Q A;  4NP5 A;  4A3J B;  4R4T A;  3GTL B;  4HIO A;  4QQB X;  2JA7 H;  1XNR Q;  2WZP P;  2VB2 X;  1BX0 A;  1QIL A;  1FNC A;  2PMD A;  3M85 A;  3TDQ A;  1JB9 A;  1WFQ A;  1VLY A;  2O4X A;  2C78 A;  2RA4 A;  2Q6K A;  4RDL A;  4HSV A;  2OXP A;  5M3M G;  1ENA A;  3A8J A;  2O5I C;  3CXC A;  3I91 A;  1F60 A;  4FF1 A;  3S2H B;  1WTH D;  3BS1 A;  1N32 Q;  1K0S A;  3HOY B;  3DMU A;  5T1I A;  3RN5 A;  2GJK A;  1KHI A;  4HMJ A;  3CCV B;  1I4R A;  5C4X H;  1ZYR D;  3JAM i;  1EP3 B;  3HOV G;  1OB2 A;  1K28 A;  2UUC Q;  4ID6 A;  1XNQ Q;  1GJX A;  4K6D A;  1FR3 A;  4DXG A;  1F9R A;  4KN7 C;  2FMC A;  3WWV A;  3AVT A;  5JEA H;  3I72 A;  1YIJ A;  1EIY B;  3VYU A;  1CSQ A;  3W3A A;  5JJL A;  4ZLT F;  1KQS B;  1G8Z D;  2A19 A;  3A8I E;  1DAR A;  4H13 C;  4TRD A;  4UDU C;  4TVA B;  5C3X A;  1KXL A;  4P6V F;  4R71 A;  5DM7 3;  5CV9 A;  1XJV A;  2A68 C;  2I07 B;  4KHP L;  2C2W A;  1ZM2 A;  3OIQ A;  4C2M B;  5IYD H;  1QUQ B;  1SBB B;  4OEM B;  4ME5 A;  2PQE A;  2Z0S A;  2HDN B;  3I55 B;  1FJG Q;  1HUM A;  1FRN A;  3A8K E;  4FN5 A;  1DJR D;  1EFT A;  1KL9 A;  2SNS A;  2F3V A;  4JMQ A;  1STE A;  4Y52 H;  2YWF A;  2QEX A;  4QJF A;  1E43 A;  3FP9 A;  4BWG B;  1WCM B;  1D8T A;  3S2D H;  1A8V A;  1EWC A;  1NBM A;  2ZBV A;  2KOL A;  4JI4 L;  2XZL A;  4LF7 L;  2M5S A;  4XLH A;  4X65 Q;  3TZD A;  2VBS A;  1QJO A;  5KNB A;  2XVS A;  4GKJ Q;  4WZT A;  1R4Q B;  2ALY B;  4WRD A;  1VQ7 B;  2B7B A;  2CND A;  3A3G A;  4JC0 A;  4X07 A;  1BCP F;  3E0J A;  4IUP A;  1WOP A;  1Q8K A;  4DR6 L;  3GTJ B;  4LBV A;  1BQE A;  3V96 A;  5CV5 A;  4GKK Q;  2TSS A;  3HOY H;  3C2P A;  2ZM6 Q;  2R7Z H;  5ELF A;  1BO0 A;  2NUC A;  2MHV A;  3SK5 A;  4IFD I;  3A54 A;  1ESR A;  2VJJ A;  4DK3 C;  4GNX A;  3PO2 B;  2XEX A;  2BSA A;  3TEH B;  2ZJR A;  2B2Y A;  1JCK B;  1N06 A;  5IP7 H;  1JA0 A;  1BR9 A;  2VNH A;  2L9H A;  4DV4 Q;  1OXX K;  1SYB A;  4ZCM A;  3GP7 A;  3ZYY X;  2GJP A;  3ONA B;  1YI2 A;  3S15 H;  1EIH A;  4B3R L;  1KTV A;  3K57 A;  2GPJ A;  1E2V A;  5IYB G;  4IPG A;  1VDZ A;  1F9Q A;  1YNJ D;  2C77 A;  4JI6 L;  3J81 L;  5I6Y A;  1UD8 A;  1TWF B;  4LK1 C;  1XTC D;  2IT1 A;  1E3X A;  3WNB A;  2PW5 A;  3D3R A;  2AUK A;  4JOI A;  3T1H L;  3T1Y L;  1NAP A;  2F0K A;  2BE5 D;  1GO2 A;  2DIE A;  4Y7C A;  1F9P A;  2M00 A;  2N3S A;  4IJL A;  5M5X H;  5IYB H;  1J5E Q;  4P22 A;  4KN4 C;  2ASB A;  5FO1 A;  2YTV A;  4S3S A;  4QVA A;  1IBL Q;  3FVQ A;  2JJ2 A;  1MIU A;  3BU2 A;  1K3B C;  4XT1 B;  2VJI A;  5IP7 G;  1YJW A;  1X32 A;  4TSF A;  3ZZ0 A;  2AQ1 B;  2ATW A;  4DUY L;  2NVT H;  1IYV A;  3Q39 A;  1EYC A;  4CQJ A;  1FNU A;  1KAW A;  1HFN A;  3GIR A;  2DNC A;  2RQX A;  2VL6 A;  4YWK A;  1H85 A;  1H9S B;  4DR5 Q;  2B63 B;  2W6J A;  5FO8 B;  4XNF A;  4OOV A;  1ILP A;  4RGM A;  5AJ3 Q;  2N88 A;  4B3M Q;  1UD4 A;  2DY8 A;  2IL8 A;  4IUN A;  1WTP A;  5EJW A;  1PTO D;  5GRO A;  3PIP A;  4DR3 L;  1YJ9 B;  4FYD A;  1K0R A;  5CDF A;  5A8A A;  1DOK A;  4KV6 A;  4EX5 A;  4HN7 A;  1OGJ A;  3A8K A;  4LFC L;  3G48 A;  1D5M C;  1EU3 A;  3ITP A;  3D4D A;  1QFJ A;  4ZKC B;  1LAB A;  1NCV A;  2CH4 A;  4L5T A;  1UE5 A;  4JK1 C;  5J22 A;  3FHW A;  4A3I H;  2A74 C;  1E7Z A;  2CFM A;  2EY6 A;  4A3K H;  1MJC A;  3CC2 B;  1PH7 A;  1ICF B;  4TMX A;  3W1G A;  3K58 A;  3AEV A;  4NW2 A;  1RD9 D;  4BBR H;  3CAM A;  2PE3 A;  4FWT A;  2V31 A;  4DAV A;  3MTS A;  2ZBU A;  2F0W A;  1CM9 A;  4KJN A;  1UUP A;  4PC1 A;  3LGJ A;  5F4O A;  2Q8I B;  4X62 L;  4I65 A;  1LTA D;  5FKA C;  3K80 C;  4P72 A;  3PO3 H;  3GD7 A;  1EWI A;  2VQF Q;  5HGT A;  1SYG A;  2QDL A;  3PVD A;  1SRO A;  1VQ4 B;  3G6E B;  2XRS D;  4GN3 B;  2QGG A;  2K6A A;  1SYC A;  2BMW A;  2SEB D;  1WTO A;  3HKS A;  4CJ0 B;  2VY3 A;  1K28 D;  3ZBU A;  3S1Q B;  5C4X G;  4YAL A;  1EIF A;  4LF6 Q;  1UEB A;  4ZGQ B;  2PO4 A;  3J81 E;  5J35 A;  2K7V A;  4DV4 L;  3NE5 B;  2R92 H;  4RGO S;  5AN9 A;  1JOR A;  1NSN S;  3UDI A;  2F0E A;  5A2Q L;  1VQ8 A;  3TSS A;  2R92 G;  4Z4U A;  3P27 A;  1JJ2 A;  1FJG L;  1B9N A;  2BVN A;  4YHB A;  3WXM A;  1V1O A;  1OTC A;  2HCJ B;  4TQU S;  4LFB Q;  1G91 A;  2YTY A;  1YNN D;  3R93 A;  4GN5 A;  2QIL A;  3GTP H;  1SAP A;  3OW2 B;  1I4H A;  3CCE A;  2K14 A;  3BYY B;  1M4V A;  2VUM B;  3C2Q A;  4DAY A;  2EYJ A;  3I56 A;  1E1O A;  3CRL C;  5HXB A;  3VO2 A;  1H8H A;  2EYL A;  4EVO A;  3F8T A;  4YXW A;  2CCZ A;  2B2V A;  5C5M A;  3HAG A;  3AYH B;  2ZXO A;  5CR3 A;  3CCM A;  4C3I B;  3S14 B;  4LF8 L;  1QE6 A;  4KI0 A;  2LXJ A;  3S17 H;  1GVP A;  3CC7 B;  2NPF A;  5B6I A;  2MPM A;  5IYR A;  1TQO A;  3VYR A;  5HZA A;  4N9T A;  4DF7 A;  3CCS B;  5M3F B;  5C6A A;  4BBR G;  1D1N A;  1YHA A;  2C35 B;  3G7L A;  2F0M A;  3R8B A;  5FLM G;  5M5Y B;  5C4J H;  2V7W A;  1QVG B;  2JJ1 A;  5FJ8 H;  4PC3 A;  3PSI A;  3T51 B;  4B43 A;  4DNI A;  1Q7Y C;  1I6H H;  4CJ1 B;  3SEJ A;  1Q90 A;  3PQI A;  4R4O A;  4X66 Q;  1WTX A;  4B3S Q;  1I5F A;  5IT9 L;  1GXD C;  4HR7 B;  4IUQ A;  4RDK A;  1E3Z A;  4Z4W A;  4HIK A;  2FMM A;  4PNY A;  1GVH A;  1IW7 D;  4U67 3;  2UXB Q;  5CV7 A;  1Q86 C;  1EFW A;  3OZW A;  3HOX G;  3CC4 B;  4ACB A;  5HZB A;  1HFG A;  1N33 Q;  3UDG A;  2E74 C;  1G29 1;  3E9I A;  1PTO B;  3U9O A;  1WD1 A;  4WOR A;  3JC6 6;  3I4M B;  3B6Y A;  4A3G G;  2RCF A;  4XDX A;  1A15 A;  4BY1 H;  3F1Z A;  1E1T A;  4HJ9 A;  1W87 A;  3T56 B;  3NWT A;  2VQF L;  3GTJ H;  4A3B G;  4L8J A;  1E79 A;  3AFP A;  4X3T A;  2A69 C;  4ZCI A;  1MAB A;  2C5C A;  1K73 D;  5H5J A;  4C3I H;  2V7Q A;  2RC5 A;  2GVB A;  3SHL A;  2KBN A;  4JI8 L;  4II2 A;  3U6K A;  1NY4 A;  2HUG A;  3ZJY C;  2KED A;  1IW7 C;  4PZ7 A;  3QO2 A;  1HNZ L;  2NVX B;  3QFR A;  2Y0S E;  1WJJ A;  4DR4 L;  3J81 k;  1EFI D;  3UDF A;  2LMC B;  3HEJ A;  2E2I B;  4A3F H;  4B48 A;  4MTN A;  2HQE A;  3MFY A;  1SNC A;  3M4P A;  3F2C A;  4HAE A;  2Y0S G;  5C3E B;  2DEU A;  2K5D A;  2Q6I A;  3ES9 A;  4AIM A;  4RM0 A;  3BVZ A;  4NXM Q;  4WQM A;  1DYQ A;  2P5Z X;  3L7Z C;  1VQJ A;  4HED A;  1D6E C;  4IFD H;  1PH2 A;  1Y1W H;  5JVH 3;  2E75 C;  1EUJ A;  4RCO A;  4QGU A;  2R7F A;  3WOF A;  1HZA A;  5FLX E;  1XQB A;  1TII D;  5CV4 A;  2VQE Q;  4ULL A;  2VBU A;  4MTK A;  2EVB A;  1VQO A;  1TU2 B;  1JOQ A;  2PMZ B;  3JQP A;  3LO8 A;  3QB3 A;  3NBH B;  3C46 A;  2K33 A;  1XFO A;  2JN9 A;  4TMV A;  1Q82 D;  4NPS A;  1QGA A;  1MSH A;  3IFT A;  4A3M B;  5C0X H;  1S40 A;  2E1R A;  3V2T A;  1KD1 D;  2E2J B;  5ISR A;  1Z47 A;  4BXX G;  3PA2 A;  3FPK A;  5K36 H;  3OYY A;  3PEN A;  4P9S A;  1K8G A;  3VNV A;  1SXT A;  1LTI D;  5IGC A;  3F2U A;  3T1H Q;  1M1K D;  4P3Y A;  2RHQ B;  3LNN A;  1MGS A;  4X64 Q;  4LUZ A;  1Q1B A;  5L37 A;  2LS0 1;  1KDB A;  1UEA B;  3ZZU A;  3M7N A;  1FL0 A;  1TS5 A;  3J7A F;  1VQL A;  1TLL A;  4RCN A;  4BY7 H;  1VQ5 B;  1TWC B;  2K75 A;  1XMQ Q;  4A3F G;  5IYN A;  3Q23 A;  4XYQ A;  3GTP B;  5GAH C;  1JWU D;  4GN4 B;  2MO1 A;  4DV0 L;  5JEA G;  2UUB L;  4O0A A;  4KKT A;  3WND A;  3TN2 A;  2J7Z A;  1W0K A;  5IYP A;  3HOV H;  4DXF A;  2BF4 A;  2R7D A;  2WAQ G;  3OZV A;  4RD6 A;  2QEX B;  4J15 A;  3RMH A;  4UHV A;  3S1M B;  3GTO B;  4LC0 A;  2E1B A;  4B44 A;  2K5V A;  2F1M A;  3TBI B;  2VXW A;  1M1K C;  2IX3 A;  1GR1 A;  1G2S A;  1F2M A;  2QDB A;  3J80 E;  3JAM E;  5I9O A;  4KD3 A;  1IYJ B;  5C4Z A;  3VA7 A;  1EL0 A;  3OE7 A;  4WZK A;  2K5W A;  1A2T A;  2PNH A;  4PC2 A;  2PNR C;  2M9V A;  2EE1 A;  4XYO A;  2KEN A;  5HY6 A;  4JV5 Q;  2V1C C;  4G1B A;  1E2Z A;  5E3F A;  1L0X B;  4YCV A;  1Q81 C;  4F7X A;  4JPB W;  5CBE E;  2D2C C;  2ZIT A;  2BDO A;  2BE5 C;  3J80 i;  1JJ2 B;  4XOT A;  3ZZT A;  1PRT F;  4I7A A;  2HHH Q;  5C4X B;  1SDF A;  3W2G A;  3G05 A;  2F0J A;  2B2T C;  2AWN A;  1R9T H;  2ZZG A;  3R6J A;  4XLC A;  1IL8 A;  4JI7 L;  1P4M A;  1N9W A;  2DYI A;  2EYM A;  1CNF A;  3L0O A;  4CJ2 C;  1CKN B;  4KY7 A;  2EPB A;  2JSO A;  4V0B A;  2K5H A;  4OWW B;  1PXU A;  5BN3 A;  5CBA E;  4LF7 Q;  2KA7 A;  3OJX A;  1VQK A;  1TT2 A;  2DET A;  3BQJ A;  1N0V C;  2FX3 A;  2DY1 A;  4QV2 A;  1PLF A;  3NTK A;  4L5S A;  3PUX A;  4KY5 A;  5EKL A;  4B3F X;  3H91 A;  3CCU B;  1AN8 A;  2JA8 H;  3P1H A;  1Q81 D;  5TV2 A;  1T6Y A;  1ICW A;  4DV0 Q;  4YHH L;  4XLA A;  2MO0 A;  1KK1 A;  4YAU A;  1DXM A;  1V1Q A;  4XKV A;  2V4D A;  2WYR A;  4A93 B;  1CZG A;  1I6V C;  4HJA A;  4OXP A;  2OT2 A;  1Q3L A;  4B3T L;  1A6X A;  1GHK A;  2J7K A;  1YNX A;  1OXS C;  1VQK B;  1B1Z A;  4IPC A;  4K2L A;  2CW0 D;  2B63 H;  3MA2 B;  4KHP Q;  4OP7 A;  3DEO A;  5A89 A;  4TMZ A;  3OMC A;  3I4M G;  1Y1V G;  1II3 A;  1M90 C;  4RH6 A;  3KF8 A;  1FNV A;  2Z9H A;  1YX2 A;  1PRT C;  4XOP A;  4QUC A;  5KNC A;  1SFO B;  1PFS A;  2ZXP A;  2RC6 A;  3T13 A;  4RA8 A;  2Z6K A;  2B7C A;  1BMF A;  1YLO A;  4MZ9 A;  1JWM D;  2WJY A;  2K1B A;  4AF6 A;  4ILW A;  2WII B;  1K8A C;  2GJR A;  2YU9 H;  4J6H A;  1S5C D;  1RHP A;  1CSP A;  1G7T A;  3UE0 A;  1WTR A;  1S5D D;  3ONU A;  5E7N A;  1B2R A;  4C56 C;  1KC8 C;  1SEB D;  3I56 B;  1Y14 B;  4U68 A;  5LL6 S;  1PZK D;  2JQO A;  1PH5 A;  2OWO A;  1HQR D;  2B2T A;  2CW0 C;  4LF5 L;  4P73 A;  4DV1 L;  3X3M A;  5BSY A;  3U50 C;  3CCU A;  1Y69 U;  4IOA A;  5AJ3 L;  4B3M L;  4QCL A;  4OX9 L;  2CQA A;  4AQY L;  3I3C A;  2JA5 G;  4Y9U A;  4ZUI A;  4NXN L;  4KJO A;  5IGG A;  1VQ8 B;  2VZL A;  4DR5 L;  3PO3 G;  5J39 A;  3ASS A;  1PRT D;  3PIO 3;  4OOX A;  3OEH A;  3S1R H;  4G1V A;  4L5R C;  2WPD A;  2PQA B;  3KLS A;  5FLX L;  2AQ2 B;  2JA6 G;  1ELO A;  2F0P A;  3CCL A;  1WSV A;  1A63 A;  1HNW L;  1MRZ A;  3IL8 A;  2L11 A;  2PMZ E;  3HOW B;  5J1Z A;  4IPD A;  1K9M C;  2XNC A;  3S1R B;  1KAB A;  5IIF A;  2B29 A;  5J3B A;  4A3C G;  3OKX A;  3WY9 A;  1G2T A;  4Z4R A;  3KJP A;  5IT9 c;  1SSO A;  3TQY A;  2JN4 A;  1QCB D;  4GS3 A;  1VJS A;  2WKD A;  2XOK A;  4BA2 I;  4P2C B;  1L1O A;  1CNE A;  4C1N K;  3GQB A;  1VQ6 B;  2WKC A;  1CHQ D;  3BVM A;  1WU8 A;  1WCM H;  1HJP A;  1U4M A;  1IBK L;  4BXX H;  3QE2 A;  2Z6B A;  4X8I A;  3S9W A;  2E5L L;  4A3D H;  3A74 A;  5I9P A;  1JJC B;  1STA A;  4IW3 B;  4II3 A;  1H9K A;  2V7V A;  4AF7 A;  4LBZ A;  1WCM G;  2CHB D;  3NEM A;  1DOM A;  3GV3 A;  4Y7N B;  3HOV B;  2H4O A;  3MFG A;  3B8H A;  1ZUN B;  3GTK B;  1ZM3 A;  2IJ0 A;  1P16 A;  1Q7Y D;  1YJN A;  1QUF A;  2OK7 A;  4BA1 I;  1KZL A;  3OJW A;  1YJW B;  2B8G A;  4JW0 A;  1HZB A;  1AMO A;  3CCJ B;  2X3U A;  5M3M B;  4RD3 A;  2YWH A;  4NNJ A;  2EIX A;  1PDQ A;  2SDF A;  4JI5 Q;  4ROX A;  3OHX C;  2F0V A;  2WAQ E;  2E2D C;  3KBX A;  2JA6 H;  1BNZ A;  1VQ5 A;  2I46 A;  4JCV E;  4X65 L;  4CGY B;  1CUK A;  4AVZ A;  3DEP A;  4G57 A;  5IGD A;  1EWY A;  2R3Z A;  3PUW A;  1U0L A;  3M4O H;  5DS0 A;  1H9J A;  2F3W A;  3UI2 A;  4LFB L;  3HOW H;  4JI3 Q;  3H94 A;  1NNX A;  4DR2 Q;  1STN A;  1A2U A;  4RFB A;  1CHP D;  2B2V C;  3VR5 A;  5IT9 E;  1YJ9 A;  5DM6 3;  2CWA A;  4PAB A;  3C3L A;  1ZYR C;  3MZ5 A;  4H9G A;  1PH4 A;  3FKI H;  1HH2 P;  1EFR A;  2Q2T A;  4N3N A;  1VQC A;  4EQN A;  2ZZE A;  1PJ7 A;  4R4I A;  3CPW B;  4QUZ A;  1A3T A;  2JK8 A;  4A3B H;  1ASY A;  3I73 A;  2BA0 A;  2JE6 I;  4LBY A;  5JJI A;  4RHS A;  1BX1 A;  4BY1 G;  1HNX Q;  2RDF A;  1GD7 A;  2R7Z G;  4A3L G;  5BR8 Q;  3HGB A;  4Z4S A;  1D5X C;  3KLS X;  1COW A;  1TUI A;  3P20 A;  4A3J G;  2UU9 L;  2XWJ B;  3E20 A;  1X3G A;  2EYH A;  2X6Y A;  3NSW A;  3S24 A;  1VQP A;  1N34 Q;  1WDT A;  3MHB A;  1A3V A;  2AKW B;  2B2U C;  2EYP A;  1H9R A;  1BVS A;  1G6Z A;  1EYD A;  1L1O B;  5KGU A;  1VQ4 A;  3T53 B;  2DGY A;  3KEW A;  1PFB A;  4H7B A;  2DNE A;  2JEB I;  5DSZ A;  1DOL A;  3BYT B;  3VNU A;  3NK9 A;  2VBV A;  4Q5V A;  2HCC A;  1SYF A;  3ISX A;  1KMH A;  3K7U C;  1C7Y A;  1S4M A;  3G71 B;  2C5B A;  4B4D A;  1VF7 A;  2NBF A;  1TS4 A;  5JJK A;  1LO5 D;  1EFC A;  1XTD A;  1Q82 C;  2UXD Q;  1LT6 D;  4RMF A;  4FO2 A;  3F2D A;  3CHB D;  4X06 A;  3E1Y E;  3AVW A;  4DAM A;  4X0C A;  1QOH A;  4LFC Q;  1LTT D;  4PMC A;  2HDL A;  4C3H G;  5IGE A;  1N05 A;  1HPC A;  3VA5 A;  5IY0 A;  1UAP A;  1GAQ A;  4UZF A;  1G7S A;  4Z4Z A;  3BY2 A;  4K1X A;  2OTL B;  1ASZ A;  4OO1 H;  5M9O A;  1IXR A;  3KOJ A;  2RDH A;  3G6E A;  2CF4 A;  4IFD J;  3ASR A;  4TN1 A;  4FDB A;  2HIX A;  1B4O A;  5LMN Q;  4HE5 A;  4Q7J B;  4Z4V A;  2XGJ A;  4XN0 A;  1J9O A;  3A35 A;  4UP7 A;  4DV3 L;  3R2I A;  4L6T B;  1KRS A;  4A3E H;  5KW9 A;  1HHV A;  1QUE A;  5GAE C;  4A76 A;  1B7Y B;  3Q6Q A;  4CKC A;  1I6H B;  1Q12 A;  3BCF A;  3BVG A;  4H44 C;  2YV5 A;  3NXW A;  5C4H A;  1EY4 A;  3CCJ A;  2QCP X;  3E3X A;  3TP6 A;  2F0U A;  3TP8 A;  1MJE A;  1LTB D;  4HSP A;  4JI6 Q;  1I3Q B;  1SRU A;  2N55 A;  5DEH A;  2XZP A;  2HDM A;  3NEN A;  3NUC A;  2MP1 A;  4RLZ A;  2WFW A;  3CP8 A;  2G9D A;  1TKW B;  3N52 A;  1Q8I A;  4UP9 A;  4IO9 A;  1EQQ A;  3S14 H;  3I2Z A;  4ZCK A;  5TR9 A;  3A3B A;  5C3W A;  1ET9 A;  1UWV A;  1BCP D;  4ABN A;  3HOU G;  4HMI A;  1ROD A;  4C1N I;  1SKY B;  1RF2 D;  1LV9 A;  3GDE A;  3E0E A;  1HZ9 A;  4AYB G;  1EXM A;  3QFS A;  2FHT A;  3J81 i;  4XT3 B;  4HJ5 A;  1NRK A;  2Z6B D;  1RQP A;  4KLK A;  1QGZ A;  2E2I H;  2K04 A;  4EH1 A;  1ENF A;  2ID0 A;  5BR8 L;  3S1N H;  1VQH A;  2OTJ A;  1VQN A;  4YWL A;  1N33 L;  4ZKB B;  4RD0 A;  3D26 A;  1BQQ T;  1EU4 A;  1JMC A;  2LFN A;  4PMB A;  2UXB L;  4ZGN B;  2CWP A;  3ZC3 A;  2IY5 B;  4JV5 L;  2B2W C;  1WD0 A;  4U9U A;  4IQZ A;  1SNO A;  2QGQ A;  2NVT B;  5TSS A;  2LY7 A;  1W2B A;  4X3S A;  2WR8 A;  2R6H A;  4AH6 A;  4RKL A;  4PQX A;  2XWB B;  3W5U A;  1EY5 A;  1JOK A;  5T1G A;  1FRQ A;  2D0O A;  2ZZQ A;  3H3V I;  1ZXT A;  2KEE A;  4OL7 A;  2E2J H;  3K59 A;  5FO0 A;  3OW7 A;  1PTO H;  2EJG C;  4GKJ L;  3K5O A;  3H6M A;  1D1I A;  3ZBT A;  3BC9 A;  2X8K A;  1HQM C;  4IUR A;  2UXC L;  3ULL A;  1UE7 A;  1YJN B;  3GTM H;  1ESF A;  2Z4H A;  4JI5 L;  2QA4 A;  2YTX A;  2JXM B;  2K03 A;  4FXU A;  3ASQ A;  1PVO A;  1X54 A;  3KF8 B;  3RN2 A;  1QNU A;  1VQ9 A;  1M90 D;  4PC7 A;  1B3Q A;  2ICI A;  4CDE C;  5IE8 A;  1B9M A;  4XOR A;  3GTM B;  2F0H A;  1WI5 A;  1IJE A;  1O80 A;  3J80 L;  2ZZF A;  4A3K B;  2CBX A;  1I94 Q;  1Y0R A;  3WNC A;  3G4S A;  2R61 A;  4R8N A;  4KKS A;  1N32 L;  3K81 C;  4H0L C;  1E63 A;  3V7A A;  3NTH A;  3A55 A;  5C0X I;  3L2P A;  1YNN C;  2KVM A;  2RSN A;  3CPF A;  3QOJ A;  4UZU A;  4XMY A;  3CQZ B;  5CC4 A;  4DFA A;  4DV3 Q;  1S5E D;  1SLJ A;  1QFY A;  2B5O A;  2CH4 W;  5IOC A;  4X6A H;  2V7X A;  3D0F A;  2G9H D;  3TZU A;  2ICE C;  1R5N A;  4DV6 L;  4OIK A;  2MFI A;  1B3A A;  2RCN A;  2VZA A;  1RJT A;  4M1U B;  4A3G H;  1Y8O B;  2LKV A;  3VDY A;  1OHH A;  5EKK A;  1AFP A;  3S2D B;  4FXK C;  5TY0 A;  4DK1 A;  1VMP A;  2VB3 X;  4JYA Q;  1HA5 A;  1HNW Q;  3JU4 A;  4FF4 A;  2HIV A;  3CQZ H;  2RHS B;  4X64 L;  2JJQ A;  1WOC A;  1X9N A;  2D5D A;  3J7A V;  5BN5 A;  4K14 A;  3GTK H;  2XRQ D;  3DLL A;  2CQO A;  2QTZ A;  4MYT A;  2WB1 B;  4RD1 A;  4X3K A;  2AQ3 B;  2RKS A;  1O7Y A;  4UP8 A;  3NHH A;  1MD2 D;  5THX A;  3R2T A;  2EY1 A;  1KLU D;  2EIF A;  2XGT A;  4PZ6 A;  3RZD B;  3ONY A;  1B2T A;  3MXN A;  1DGS A;  1AZP A;  3J81 j;  1MSG A;  4LW1 A;  5LMN L;  2ZL5 A;  1LUZ A;  3H0G G;  1WTQ A;  1AZQ A;  4DV1 Q;  1NB0 A;  3HKZ B;  4KMU C;  1PFN A;  1X3P A;  4OON A;  2Z4I A;  1EZ8 A;  1BOS A;  1Q86 D;  1D8L A;  1PYS B;  1QFZ A;  2VQE L;  2I1L A;  2F0O A;  4GOP B;  2F4I A;  1EQR A;  2JEA I;  1H42 A;  3KJO A;  1BBU A;  3SGI A;  3VO1 A;  3FKI B;  4NKL A;  4B08 A;  1KDA A;  3W1B A;  2QDX A;  1V0E A;  1N34 L;  4DQK A;  3QFT A;  1SND A;  1L0Y B;  4TKO B;  1I7P A;  4R4Q A;  3HOU H;  3KBG A;  2E76 C;  5HUR A;  4TMT A;  3LWE A;  2QMU A;  4MNO A;  1GUO A;  4DR3 Q;  1PH9 A;  5M3F G;  2H5X A;  3E6Z X;  1JT8 A;  3MWY W;  4LWC A;  3RZO H;  3LQE A;  4N3G A;  1EQT A;  1KQS A;  4EQ5 A;  1GUG A;  1SNM A;  2WB1 G;  1S5B D;  2K4K A;  3URY A;  1C8C A;  3OP1 A;  4KHV A;  4CDC C;  4JYA L;  5L46 A;  1UE1 A;  1BLI A;  2ZXR A;  3ERO A;  5F4M A;  4DV6 Q;  1ZM9 A;  1ZKO A;  2NZ1 D;  2PIA A;  4A3E G;  5E6T A;  1ZM4 A;  3WBJ A;  1VCI A;  2C4T A;  2ZM6 L;  3PF4 A;  5C44 B;  2A6H C;  4E6I A;  1Q46 A;  4DR6 Q;  4MIU A;  2EFG A;  4OGQ C;  4WJW A;  3DXJ C;  1DDG A;  1UE6 A;  4QIW B;  5IWA L;  3A7A B;  2RF4 A;  3MAQ A;  1W35 A;  4XLF A;  1EYA A;  4HTH A;  2JDI A;  3U2Q A;  3PUZ A;  3U9S A;  3SK8 A;  2XND A;  3UDX A;  1T6X A;  2PPB C;  2HCI A;  4OO1 G;  3RUZ A;  4RG1 A;  2F52 A;  2PZW A;  1F2L A;  4B3R Q;  5HGQ A;  1H9M A;  5KEE A;  2PYK A;  4BY7 G;  3I70 A;  3RY8 A;  4Z4Y A;  2BCO A;  2EYF A;  3CRZ A;  3L3O C;  1YIT B;  5C0X J;  1PA6 A;  1E64 A;  1AH9 A;  2GK7 A;  4KKU A;  1LT3 D;  3CME A;  1A62 A;  1N36 Q;  1QZG A;  1V0F A;  1TS3 A;  2F1L A;  2A73 B;  1YHQ A;  4DQL A;  1JQY D;  2ZTE A;  4KK7 A;  4P74 A;  5IYC H;  3JQQ A;  1SM4 A;  1JOO A;  3SVM A;  1SN8 A;  4H02 A;  3FPP A;  3WYA A;  1V1P B;  3PCO B;  1IHZ A;  2UUA Q;  2AHO B;  1DON A;  1I94 L;  5IK2 A;  4XQQ A;  4X7D A;  3EA6 A;  2QW7 A;  2WIN B;  4A3B B;  2A1A A;  4HCS A;  4M8A A;  3KDF A;  3PIP 3;  2JA7 B;  4IZ8 A;  1K83 H;  3N6R A;  3RR5 A;  5AFW A;  1W2B B;  3J7Y W;  2D62 A;  1WVL A;  3OEE A;  3WBK A;  1AE2 A;  3Q8D A;  4JBM A;  1Q9S A;  4P6Y A;  1JWS D;  2NYZ D;  5D3I B;  5FLX c;  4JI1 Q;  2Q2U A;  3SLN A;  4G5G A;  1QX4 A;  3NPP A;  4A4I A;  1H8E A;  1Y1W G;  3WOE A;  1FYC A;  3SR1 A;  1VQM A;  1VQN B;  5JJZ A;  4HIM A;  5A88 A;  2E5L Q;  2BH8 A;  5ELO A;  2IHF A;  1CTM A;  4CDD C;  1MI2 A;  3CC2 A;  2B8F A;  2Z8L A;  2F0N A;  4P2N A;  3R3O A;  2F03 A;  2EJF C;  1EY0 A;  5I2Y A;  4OX9 Q;  3CD6 B;  1F77 A;  1BXT A;  5F4J A;  4GOP A;  2BV3 A;  3K6O A;  1MHW C;  2HHH L;  2J0T D;  2I5M X;  2C5H A;  3D4W A;  1QB5 D;  4OWX B;  1JIC A;  1LLR D;  2I5H A;  3HZX A;  1CKO A;  2VNU D;  4V19 0;  1D1K A;  2D9U A;  2K5Q A;  2KHJ A;  5F2D A;  3PO2 G;  3T16 A;  3M3Y B;  4KTA A;  3OW2 A;  3EN2 A;  2K32 A;  1VQE A;  3H3V H;  3HOZ G;  2R93 H;  3AGP A;  3ZUG A;  2L1B A;  3BDL A;  1X3E A;  4L5Q A;  1GUN A;  2X69 A;  4CHT B;  4YIJ A;  2X0K A;  1X65 A;  1K3R A;  2D0P A;  1QZH A;  4BBS G;  3I90 A;  1PMR A;  2R6G A;  4OOS A;  3OFN A;  5NUC A;  3MCA A;  3CPW A;  4LF5 Q;  4JVZ A;  3D6C A;  1CA6 A;  5IP9 H;  1JE5 A;  2CC2 A;  1W9X A;  2NTS A;  2OK8 A;  3RZO B;  2N49 A;  2DUD A;  2CRV A;  1TY0 A;  3JAM c;  4J8Q A;  3IKJ A;  2BGI A;  4UPA A;  3OTO Q;  4R8I A;  2SOB A;  2D3N A;  1TVC A;  1KRH A;  1T5E A;  2XIW A;  1PTO F;  2PZT A;  3BZK A;  4HJ8 A;  3CKI B;  2A5H A;  2CKZ B;  3CD6 A;  2V7T A;  5E4X A;  5DN6 A;  5FLM H;  1QVC A;  4RWS C;  4APV A;  5EKI A;  3EFX D;  1BBW A;  2VW9 A;  3DUZ A;  5CMD A;  5J3O A;  4DR7 L;  2G5D A;  3DM1 A;  2L15 A;  4YAF A;  2WAC A;  3P7J A;  5FIU A;  1MBY A;  3VMF A;  2OBS A;  2OYN A;  3JQR A;  4CKB A;  1H95 A;  2K05 A;  2OQK A;  2FJ2 A;  3CCS A;  4JG2 A;  1C9O A;  4B3T Q;  2X85 A;  3ZPN A;  4POF A;  1XMO L;  2LSS A;  4YCU A;  1CQF A;  1JR0 D;  3SXH A;  5JAV A;  3A5Z B;  1VQ7 A;  4ZK9 B;  4DR1 Q;  5I6W A;  1PH8 A;  4XN3 A;  3SJP A;  3I55 A;  4A3F B;  1U4P A;  4JI1 L;  1WTV A;  4C2M H;  2D74 A;  3DDY A;  1HZE A;  1NDH A;  1OXV A;  4IPH A;  2Q2I A;  4RGT A;  3I4N B;  1HUN A;  1FX0 A;  2BN4 A;  2VNK A;  3MXU A;  3OMG A;  5K5P A;  1VQ6 A;  2MQH A;  1KAA A;  4B3S L;  1EY6 A;  1TWG H;  1IKL A;  2EY5 A;  3H15 A;  1O7Z A;  2UUA L;  1EZ6 A;  4EQP A;  4TSS A;  4DK0 A;  1EQV A;  1VQD A;  4UY8 C;  5M5W B;  2EOT A;  1KJZ A;  4ZQ3 A;  4CBV A;  2BPO A;  1I4G A;  2HMA A;  1N07 A;  3I4O A;  4DV7 Q;  2E2H B;  1QVG A;  3K5N A;  4DUZ L;  1EOT A;  1O7L A;  2B39 A;  2PCF B;  4NMZ A;  4ALP A;  2YYZ A;  1OB0 A;  5IGF A;  4EGV A;  4YAO A;  1R5B A;  2Q6L A;  2K5N A;  2N8N A;  3HOX B;  1TS2 A;  3SK6 A;  4LUO A;  3I4M H;  2E2H H;  3CB4 A;  4BPR A;  1G51 A;  1SMX A;  1KDC A;  2XTI A;  4WJ4 A;  2WJV A;  1XMQ L;  1NE3 A;  2VNI A;  2WAQ B;  3CW2 C;  5DAU A;  1W34 A;  1SJE D;  4GLA C;  3ER0 A;  1TWA H;  2NVY H;  4C3H H;  3I7F A;  2XN9 C;  3PUN A;  1Y0Y A;  2Z6K C;  1SE4 A;  1T5X D;  4C3J H;  3B82 A;  2NN6 H;  1K8M A;  2BM0 A;  2DJF C;  3BJU A;  3KLW A;  4G7H C;  2ZJQ A;  5JEA J;  5COR A;  1NR2 A;  1GM5 A;  1UNS A;  2Q6O A;  4PG3 A;  4A3K G;  5C3E H;  1GUT A;  1YHB A;  3FMC A;  5FO7 B;  4LF9 Q;  3M3Y H;  5E1F A;  1STY A;  3AST A;  2I5L X;  3RD4 A;  3PGZ A;  2F0Q A;  4JI3 L;  5GV8 A;  5HKK A;  1SJH D;  1VQI A;  1GAW A;  1NMF A;  4M4S A;  1Z9F A;  3AMU A;  1CKM A;  1RCV D;  4QMG A;  3W2E A;  1LT5 D;  4KHZ A;  1QNK A;  1LAC A;  1TY2 A;  4K5W A;  4HJ7 A;  2QE7 A;  4P3I A;  1OXT A;  3PIO A;  5IP9 G;  1B23 P;  1V43 A;  3DHQ A;  1C48 A;  1TXY A;  2EXD A;  5C5L A;  4QIW E;  4LF4 Q;  4P75 A;  4AYB E;  5ELD A;  2VUM H;  1DCZ A;  3ERQ A;  4BY1 B;  4C43 A;  3W2I A;  1I4X A;  2CVR A;  4ASU A;  4DR1 L;  4QF4 A;  3HOZ H;  2R93 G;  1BJK A;  5EMN A;  1CKN A;  3CF5 A;  1XMO Q;  1GUS A;  4GNX C;  3CMM A;  5H59 A;  2D9R A;  4G6I A;  3FKI G;  3OPO A;  3NP8 A;  1S0U A;  5I4D A;  2IX1 A;  1CK1 A;  1LTS D;  4DV5 Q;  2TMP A;  3H09 A;  3C1E A;  4RCY A;  3D8G A;  2KCT A;  3GV6 A;  4O2D A;  4AQY Q;  1K8O A;  4XLE A;  2J4X A;  4RKB A;  1VQ9 B;  1VF5 C;  2XSC A;  1XB2 A;  1FNM A;  2CK3 A;  3HOW G;  2BOS A;  4DA2 A;  4FK8 A;  3AQQ A;  5FA6 A;  3BDO A;  2K28 A;  1FGB D;  4MHE A;  3K7A H;  3QSY A;  1KD1 C;  5COY A;  1HR0 Q;  2NV4 A;  1SE3 A;  1XX8 A;  2KCC A;  3U6B A;  4YEL A;  4K0K Q;  1KTK A;  4Y9R A;  2MGS A;  5FK9 C;  5JPM C;  3PO3 B;  5LHY 1;  1IB0 A;  3A8J E;  1CZW A;  2JA5 B;  1V1P A;  2NZH A;  4P26 A;  1RL2 A;  2SNM A;  1T9H A;  1TVX A;  3CMA A;  2KCN A;  1K73 C;  1X6O A;  3S17 B;  3LQ6 A;  3PUM A;  5GV7 A;  1VS0 A;  4BS9 A;  4ZAI A;  1ENC A;  1Z6H A;  3QFC A;  1IL2 A;  1Y1W B;  1VLO A;  2E8G A;  3MEF A;  2A68 D;  2BM1 A;  3CU7 A;  4ZV4 A;  5KRU A;  3RZD H;  3OSO A;  1EP1 B;  1E24 A;  5G3L F;  3KYH C;  3I4N G;  4A3D G;  5C0X G;  1XPO A;  1JC7 A;  5ELB A;  2PQA A;  5EPL A;  3MVV A;  4BBS B;  3DWQ A; 
#chains in the Genus database with same CATH homology
 4XKW A;  2L55 A;  4DU9 A;  3VYT A;  1JB3 A;  2QKI C;  3QJY A;  3QWN A;  2IWH A;  1BPL A;  1I50 B;  3SK4 A;  1S4Z A;  4B9X A;  1WPC A;  4L63 B;  2AWO A;  2JA8 B;  4IFD G;  3SEB A;  3ND8 A;  3VR6 A;  4DGZ A;  1CT1 D;  2A6E C;  4FF3 A;  2ENB A;  4LAA A;  5EPK A;  1IKM A;  4F8M A;  3BCD A;  4KD4 A;  1HTL D;  2KEC A;  4FF2 A;  5CV6 A;  2Z1C A;  5EBC A;  4XM3 A;  4LMQ D;  1STB A;  2JYO A;  1UD5 A;  1PFM A;  1EEF D;  1W0J A;  5D3D A;  1TWG B;  4XD7 A;  5EQ0 A;  1YNJ C;  2F0D A;  3CES A;  5A35 A;  3NQI A;  4RGN A;  3PV0 A;  2JP1 A;  5EBD A;  5KND A;  1A3U A;  2BDN A;  2PZU A;  4MN3 A;  5G3L D;  2ZT9 C;  1NUC A;  2XNA C;  1DZ1 A;  2R7Z B;  5D14 A;  1X3Q A;  2IW3 A;  1GHJ A;  4FXG C;  1W6J A;  4QB4 A;  1JE4 A;  1SE2 A;  1E2W A;  1V8Q A;  3M4O B;  1CFM A;  2KVO A;  4IUU A;  1IYU A;  3ND9 A;  4NDX A;  2ZTG A;  2QF7 A;  4XR6 A;  3KUP A;  3QG1 A;  3EVQ A;  2NN6 I;  2PW7 A;  3PMF A;  1M8A A;  4UAI A;  3H3V C;  5D65 A;  1PTO C;  2DN8 A;  3A7L A;  2IX0 A;  3FRP B;  2NN6 G;  3JAM L;  3K0Y A;  3CP2 A;  2L5T A;  3HOU B;  4I7Z C;  3AU7 A;  1I18 A;  3I8Z A;  3M7G A;  3ZIA A;  2KQ3 A;  1K83 B;  2L0C A;  1E1R A;  1EY9 A;  2MJ8 A;  4R9W A;  3VYS A;  4Z1M A;  2F0T A;  4OHJ A;  3NBH A;  5KNL A;  3SE0 A;  2ZXH A;  2F0L A;  1U4R A;  2EDG A;  3S16 B;  3G6J B;  1E0B A;  2NVQ B;  4IN3 A;  3OAA A;  4K2K A;  3K5M A;  2RBM A;  3P75 A;  4ZUJ A;  2M2L A;  2BA1 A;  2EYO A;  4PV1 C;  4CKE A;  1TR5 A;  2FIN B;  3O13 A;  2EZV A;  1PZI D;  3MC0 B;  1U9R A;  3IAY A;  4F88 A;  2KJX A;  2WSS A;  1J8I A;  3HG9 A;  4IUV A;  5KIX A;  2X6L A;  4G7X A;  1B44 D;  2K01 A;  1KNE A;  3NQT A;  3MXG A;  1UD6 A;  4G7O C;  2B2U A;  1PZJ D;  3BH4 A;  3DWA A;  4PMW A;  5KYI A;  3HS0 C;  1QG7 A;  3Q0A A;  1U4L A;  1VMC A;  4HCE A;  2NTT A;  1HXY D;  1R4P B;  2KHS A;  2IPK D;  3OIP A;  1AW7 A;  4FNF A;  3GTG B;  1FD7 D;  4K5X A;  2FFK B;  4A3E B;  3WDN A;  1Z7T A;  1ET6 A;  2WP8 J;  2C9O A;  4FXD A;  4IAL A;  4XL9 A;  3VR4 A;  1NR4 A;  2DY7 A;  3LX0 A;  3FKS A;  1PRT B;  3QOL A;  3DWP A;  3I4L A;  3GTQ B;  4DNT B;  1O78 A;  3C1F A;  3S1N B;  1SNP A;  3RLF A;  1WTW A;  2X53 S;  2F0F A;  2OF1 A;  3CRK C;  5FO9 B;  4C3I G;  2A69 D;  5JOB A;  5KYL A;  4XQN A;  1H9S A;  4ODG A;  1BBX C;  1BF4 A;  4O42 A;  4XON A;  2F0S A;  1HTP A;  2R92 B;  1RKN A;  1F2Y A;  1KNA A;  4DNR B;  4FP5 D;  1EY7 A;  3MEH A;  1AEX A;  3QIA A;  1D5Z C;  3X3N A;  4ZYS A;  4IUT A;  3VR2 A;  1FNW A;  3MXP A;  4XXE A;  2X6G A;  1TWA B;  2NVY B;  5E4W C;  1SYE A;  3A56 A;  4YEJ A;  1UD3 A;  2O2L D;  3WQZ A;  1E1Q A;  2D3L A;  5FOB B;  4KY6 A;  4A3I B;  1EWH A;  4WFN 3;  1W6K A;  1EIG A;  4G7W A;  3H0G B;  4F87 A;  1HVX A;  2OEO A;  4RAU C;  1PYW D;  4OO1 I;  3GO5 A;  1STH A;  1Y8N B;  4DAP A;  4A3G B;  3HP3 A;  4XQJ A;  5CGK A;  5JVG 3;  4TT3 A;  2Q8T A;  2R9V A;  3BG3 A;  1F2Z A;  2GK6 A;  2A6E D;  1B50 A;  4XTC S;  1HRJ A;  2JIZ A;  1CQV A;  4X3U A;  1ILQ A;  4K8J A;  3PUY A;  3BZD B;  4N9P A;  2H1E A;  3M4Y A;  2XZO A;  4QUF A;  1S5F D;  3GVJ A;  3AB9 A;  4G4K A;  5A2Q E;  3VR3 A;  1GUW A;  3Q6S A;  4C3H B;  1DD2 A;  1SYD A;  3SDZ A;  3E5S A;  3NWS A;  2Y0S B;  1GOZ A;  2WV6 D;  3S15 B;  4Z9C B;  4OIJ A;  2X6X A;  2AUJ D;  5BN4 A;  4Q0F A;  5C4J B;  1ZEQ X;  4ZRZ A;  4FVM A;  1Y8P B;  1HA6 A;  1RTN A;  3L9A X;  3D6W A;  4O1N A;  3PUV A;  1ONL A;  1OO9 B;  4AYB B;  3FEW X;  4E0F A;  5K36 G;  3OWE B;  3TME A;  3V05 A;  2NB0 A;  4K6L A;  4K5V A;  1BCP C;  3Q24 A;  4XIG S;  3OWF A;  3HOZ B;  5EGT A;  1HCZ A;  4DN4 M;  1XXG A;  5JPN C;  3KLR A;  5ELC A;  1ML0 D;  3GVL A;  1EEI D;  1AP0 A;  1EY8 A;  4LJZ C;  4GZY C;  2B2Y C;  2EXZ A;  3FPU B;  2L12 A;  1UD2 A;  4A3D B;  1RTO A;  3Q22 A;  2RSO A;  5CV8 A;  3OOC A;  3EQL C;  2F43 A;  2EY2 A;  2W6I A;  1BDO A;  1CI3 M;  4K8I A;  1KLG D;  4EQO A;  1LTR D;  3K7A B;  1TWH B;  5CYU A;  3D4R A;  2EJM A;  3HRZ C;  2Q8R E;  5EPJ A;  1SNQ A;  1DM0 B;  3D31 A;  3NTI A;  5IGB A;  2RDG A;  4BY7 B;  1Q1E A;  5I2X A;  1C4Q A;  5DNF A;  1RDP D;  1XWE A;  3EJI A;  4GQN A;  2ZTN A;  1WP6 A;  1XYI A;  1LTG D;  2LZJ A;  3K5L A;  3W2D A;  3LWU A;  2GA4 B;  4J1M A;  2ZXI A;  2F0I A;  2R93 B;  5FL7 A;  2O5J C;  1SMY D;  1R9T B;  2RVL A;  1BUV T;  2YU9 B;  1PKV A;  1Y1V B;  3GVK A;  1F9S A;  4B3G A;  1D2B A;  3NBI A;  3BDC A;  3FDT A;  1LT4 D;  2X6W A;  2L4N A;  2QEJ C;  2JA6 B;  1CA5 A;  1I4P A;  4BBR B;  1QWY A;  3KK7 A;  1I8D A;  1STG A;  4C3J G;  1B53 A;  4B9W A;  2NWG A;  2B2W A;  5LL6 X;  3TP5 A;  3IFD A;  2A6H D;  1SMY C;  4JBW A;  4RHR A;  5M5X B;  1BCP B;  2MUY A;  5ELE A;  4G7Z C;  1OXU A;  2F0G A;  4C3J B;  1I4Q A;  4HIZ A;  3TP7 A;  4XQF A;  2KUM A;  3T4A C;  5IOD A;  2HLD A;  4NP5 A;  4A3J B;  3GTL B;  2WZP P;  2VB2 X;  1QIL A;  3M85 A;  3TDQ A;  1VLY A;  2O4X A;  2RA4 A;  4HSV A;  2OXP A;  1ENA A;  2O5I C;  3I91 A;  4FF1 A;  3S2H B;  1WTH D;  3BS1 A;  3HOY B;  3DMU A;  5T1I A;  2GJK A;  4HMJ A;  1I4R A;  1ZYR D;  4ID6 A;  1GJX A;  4K6D A;  1FR3 A;  4DXG A;  4KN7 C;  1F9R A;  2FMC A;  5JEA H;  3I72 A;  3VYU A;  3W3A A;  4ZLT F;  1G8Z D;  3A8I E;  4H13 C;  4TRD A;  4UDU C;  5C3X A;  5DM7 3;  5CV9 A;  2A68 C;  2I07 B;  3OIQ A;  4C2M B;  1SBB B;  4ME5 A;  2PQE A;  1HUM A;  3A8K E;  1DJR D;  2SNS A;  2F3V A;  4JMQ A;  1STE A;  1E43 A;  4BWG B;  1WCM B;  1EWC A;  1NBM A;  2KOL A;  2XZL A;  2M5S A;  4XLH A;  3TZD A;  5KNB A;  1QJO A;  2XVS A;  1R4Q B;  4WRD A;  3A3G A;  3E0J A;  1BCP F;  4IUP A;  3GTJ B;  3V96 A;  5CV5 A;  2TSS A;  3C2P A;  5ELF A;  1BO0 A;  2NUC A;  2MHV A;  3SK5 A;  4IFD I;  3A54 A;  1ESR A;  2VJJ A;  3PO2 B;  2B2Y A;  1JCK B;  1BR9 A;  2L9H A;  1OXX K;  1SYB A;  3GP7 A;  1EIH A;  3ZYY X;  2GJP A;  3ONA B;  3K57 A;  1E2V A;  1VDZ A;  1F9Q A;  1YNJ D;  3J81 L;  5I6Y A;  1UD8 A;  1TWF B;  4LK1 C;  1XTC D;  2IT1 A;  1E3X A;  2PW5 A;  3D3R A;  2AUK A;  1NAP A;  2F0K A;  2BE5 D;  2M00 A;  2DIE A;  1F9P A;  4P22 A;  4KN4 C;  4S3S A;  3FVQ A;  2JJ2 A;  4XT1 B;  2VJI A;  1X32 A;  4TSF A;  2AQ1 B;  1IYV A;  1EYC A;  1FNU A;  1HFN A;  2DNC A;  2RQX A;  1H9S B;  2B63 B;  2W6J A;  5FO8 B;  4XNF A;  1ILP A;  4RGM A;  2N88 A;  1UD4 A;  2DY8 A;  2IL8 A;  4IUN A;  1WTP A;  5EJW A;  1PTO D;  4FYD A;  5CDF A;  1DOK A;  4KV6 A;  4HN7 A;  1D5M C;  1EU3 A;  3ITP A;  3D4D A;  4ZKC B;  1LAB A;  1NCV A;  4JK1 C;  5J22 A;  2A74 C;  2EY6 A;  3K58 A;  4NW2 A;  1RD9 D;  2V31 A;  4DAV A;  3MTS A;  2F0W A;  1CM9 A;  4KJN A;  1UUP A;  2Q8I B;  4I65 A;  1LTA D;  5FKA C;  3GD7 A;  5HGT A;  1SYG A;  2XRS D;  2K6A A;  1SYC A;  2SEB D;  1WTO A;  4CJ0 B;  1K28 D;  3S1Q B;  2PO4 A;  3J81 E;  2K7V A;  3NE5 B;  4RGO S;  1JOR A;  1NSN S;  2F0E A;  5A2Q L;  3TSS A;  1B9N A;  1V1O A;  1G91 A;  4TQU S;  1YNN D;  3R93 A;  2QIL A;  1SAP A;  1I4H A;  2VUM B;  3BYY B;  1M4V A;  4DAY A;  2EYJ A;  3CRL C;  1H8H A;  2EYL A;  4EVO A;  4YXW A;  2B2V A;  5C5M A;  3HAG A;  2ZXO A;  5CR3 A;  4C3I B;  3S14 B;  1QE6 A;  4KI0 A;  2MPM A;  3VYR A;  1TQO A;  4N9T A;  4DF7 A;  5M3F B;  5C6A A;  3G7L A;  2F0M A;  3R8B A;  5M5Y B;  2JJ1 A;  3T51 B;  4CJ1 B;  1Q90 A;  1WTX A;  5IT9 L;  1GXD C;  4HR7 B;  4IUQ A;  1E3Z A;  2FMM A;  4PNY A;  1IW7 D;  4U67 3;  5CV7 A;  1HFG A;  2E74 C;  1G29 1;  1WD1 A;  1PTO B;  3U9O A;  3I4M B;  4WOR A;  4XDX A;  1A15 A;  3T56 B;  3NWT A;  4L8J A;  1E79 A;  4X3T A;  2A69 C;  1MAB A;  2C5C A;  2V7Q A;  3SHL A;  4II2 A;  2HUG A;  2KED A;  1IW7 C;  3QO2 A;  2NVX B;  1EFI D;  2LMC B;  3HEJ A;  2E2I B;  2HQE A;  3MFY A;  1SNC A;  4HAE A;  5C3E B;  2K5D A;  3BVZ A;  1DYQ A;  3L7Z C;  4HED A;  1D6E C;  4IFD H;  5JVH 3;  2E75 C;  4RCO A;  3WOF A;  5FLX E;  1TII D;  5CV4 A;  4ULL A;  2EVB A;  1TU2 B;  1JOQ A;  2PMZ B;  3QB3 A;  3C46 A;  2K33 A;  1MSH A;  3IFT A;  4A3M B;  5C0X H;  3V2T A;  2E2J B;  5ISR A;  1Z47 A;  5K36 H;  1SXT A;  1LTI D;  5IGC A;  3F2U A;  3LNN A;  1MGS A;  1Q1B A;  2LS0 1;  1KDB A;  1UEA B;  3M7N A;  1TS5 A;  3J7A F;  4RCN A;  1TWC B;  3Q23 A;  4XYQ A;  3GTP B;  1JWU D;  5JEA G;  4KKT A;  3TN2 A;  2J7Z A;  1W0K A;  4DXF A;  3RMH A;  3S1M B;  3GTO B;  2E1B A;  2F1M A;  3TBI B;  2VXW A;  2IX3 A;  1G2S A;  1F2M A;  2QDB A;  3J80 E;  3JAM E;  5I9O A;  4KD3 A;  5C4Z A;  3VA7 A;  1EL0 A;  3OE7 A;  2K5W A;  1A2T A;  2PNR C;  2M9V A;  2EE1 A;  4XYO A;  1E2Z A;  5E3F A;  1L0X B;  4F7X A;  5CBE E;  2D2C C;  2BDO A;  2BE5 C;  4XOT A;  1PRT F;  5C4X B;  1SDF A;  3G05 A;  2F0J A;  2B2T C;  2AWN A;  2ZZG A;  4XLC A;  1IL8 A;  2EYM A;  4CJ2 C;  4KY7 A;  2EPB A;  2JSO A;  4V0B A;  1PXU A;  5BN3 A;  5CBA E;  2KA7 A;  1TT2 A;  1PLF A;  3NTK A;  3PUX A;  4KY5 A;  5EKL A;  4B3F X;  3H91 A;  1AN8 A;  3P1H A;  1ICW A;  4XLA A;  1DXM A;  4XKV A;  2V4D A;  4A93 B;  1CZG A;  1I6V C;  2OT2 A;  1Q3L A;  1A6X A;  1GHK A;  1OXS C;  1B1Z A;  4K2L A;  2CW0 D;  3MA2 B;  3DEO A;  3OMC A;  1II3 A;  4RH6 A;  3KF8 A;  1FNV A;  1SFO B;  1PRT C;  4XOP A;  4QUC A;  5KNC A;  2ZXP A;  3T13 A;  4RA8 A;  1BMF A;  1JWM D;  2WJY A;  2K1B A;  4ILW A;  2WII B;  2GJR A;  4J6H A;  1S5C D;  1RHP A;  1WTR A;  1S5D D;  4C56 C;  1SEB D;  4U68 A;  5LL6 S;  1PZK D;  1HQR D;  2B2T A;  2CW0 C;  3X3M A;  1Y69 U;  4QCL A;  2CQA A;  3I3C A;  4ZUI A;  4KJO A;  5IGG A;  5J39 A;  1PRT D;  3PIO 3;  3OEH A;  2WPD A;  3KLS A;  5FLX L;  2AQ2 B;  2F0P A;  3IL8 A;  2L11 A;  3HOW B;  5J1Z A;  3S1R B;  1KAB A;  5IIF A;  1G2T A;  1SSO A;  1QCB D;  1VJS A;  2WKD A;  2XOK A;  4BA2 I;  4P2C B;  4C1N K;  3GQB A;  2WKC A;  1CHQ D;  3BVM A;  1U4M A;  3S9W A;  5I9P A;  1STA A;  4II3 A;  1H9K A;  2CHB D;  1DOM A;  3GV3 A;  4Y7N B;  3HOV B;  2H4O A;  3MFG A;  3GTK B;  2IJ0 A;  4BA1 I;  1KZL A;  2B8G A;  5M3M B;  4NNJ A;  1PDQ A;  2SDF A;  3OHX C;  2F0V A;  2E2D C;  3KBX A;  1BNZ A;  2I46 A;  4CGY B;  4AVZ A;  3DEP A;  4G57 A;  5IGD A;  2R3Z A;  3PUW A;  1H9J A;  2F3W A;  3UI2 A;  3H94 A;  1STN A;  1A2U A;  4RFB A;  1CHP D;  2B2V C;  3VR5 A;  5IT9 E;  5DM6 3;  3C3L A;  1ZYR C;  3MZ5 A;  1EFR A;  4EQN A;  2ZZE A;  1A3T A;  3I73 A;  2BA0 A;  2JE6 I;  4RHS A;  2RDF A;  3HGB A;  1D5X C;  3KLS X;  1COW A;  3P20 A;  2XWJ B;  2EYH A;  2X6Y A;  3NSW A;  3MHB A;  1A3V A;  2B2U C;  2EYP A;  1H9R A;  1G6Z A;  1EYD A;  5KGU A;  3T53 B;  3KEW A;  1PFB A;  4H7B A;  2DNE A;  2JEB I;  1DOL A;  3BYT B;  3NK9 A;  4Q5V A;  2HCC A;  1SYF A;  1KMH A;  2NBF A;  1VF7 A;  1TS4 A;  1LO5 D;  1LT6 D;  4FO2 A;  3CHB D;  1QOH A;  1LTT D;  4PMC A;  4C3H G;  2HDL A;  5IGE A;  1HPC A;  3VA5 A;  1UAP A;  4OO1 H;  5M9O A;  2RDH A;  4IFD J;  1B4O A;  2XGJ A;  4XN0 A;  1J9O A;  3A35 A;  3R2I A;  4L6T B;  1HHV A;  4CKC A;  1I6H B;  1Q12 A;  3BCF A;  3BVG A;  4H44 C;  3NXW A;  5C4H A;  1EY4 A;  2QCP X;  3TP6 A;  2F0U A;  3TP8 A;  1LTB D;  4HSP A;  1I3Q B;  2N55 A;  5DEH A;  2XZP A;  2HDM A;  3NUC A;  2MP1 A;  3CP8 A;  2G9D A;  1TKW B;  3N52 A;  1Q8I A;  3A3B A;  5C3W A;  1ET9 A;  1BCP D;  4ABN A;  4HMI A;  1ROD A;  4C1N I;  1SKY B;  1RF2 D;  1LV9 A;  2FHT A;  4XT3 B;  1NRK A;  2Z6B D;  2K04 A;  1ENF A;  2ID0 A;  4ZKB B;  1EU4 A;  1BQQ T;  2LFN A;  4PMB A;  2B2W C;  1WD0 A;  4IQZ A;  1SNO A;  2NVT B;  5TSS A;  2LY7 A;  4X3S A;  4RKL A;  4PQX A;  2XWB B;  1JOK A;  1EY5 A;  5T1G A;  2ZZQ A;  1ZXT A;  2KEE A;  4OL7 A;  3K59 A;  3OW7 A;  1PTO H;  2EJG C;  3K5O A;  3H6M A;  1D1I A;  3BC9 A;  2X8K A;  1HQM C;  4IUR A;  1ESF A;  2Z4H A;  2JXM B;  2K03 A;  4FXU A;  1QNU A;  2ICI A;  1B9M A;  4XOR A;  3GTM B;  2F0H A;  1O80 A;  3J80 L;  2ZZF A;  4A3K B;  2R61 A;  4R8N A;  4KKS A;  4H0L C;  3NTH A;  3A55 A;  5C0X I;  1YNN C;  2KVM A;  2RSN A;  3QOJ A;  4UZU A;  4XMY A;  3CQZ B;  5CC4 A;  4DFA A;  1S5E D;  5IOC A;  2G9H D;  3TZU A;  2ICE C;  4OIK A;  4M1U B;  1B3A A;  1RJT A;  1Y8O B;  2LKV A;  1OHH A;  5EKK A;  1AFP A;  3S2D B;  4FXK C;  4DK1 A;  1VMP A;  2VB3 X;  1HA5 A;  3JU4 A;  4FF4 A;  2D5D A;  3J7A V;  5BN5 A;  4K14 A;  2XRQ D;  2WB1 B;  4X3K A;  2AQ3 B;  2RKS A;  1O7Y A;  3NHH A;  1MD2 D;  3R2T A;  2EY1 A;  1KLU D;  3RZD B;  1B2T A;  3MXN A;  1AZP A;  1MSG A;  1WTQ A;  1AZQ A;  3HKZ B;  4KMU C;  1PFN A;  1X3P A;  2Z4I A;  1EZ8 A;  1BOS A;  2F0O A;  2F4I A;  2JEA I;  3FKI B;  4NKL A;  4B08 A;  1KDA A;  1V0E A;  1L0Y B;  1SND A;  4TKO B;  3KBG A;  2E76 C;  5HUR A;  3LWE A;  1GUO A;  3E6Z X;  3MWY W;  1EQT A;  1GUG A;  1SNM A;  1S5B D;  3URY A;  1C8C A;  4KHV A;  1BLI A;  2ZXR A;  3ERO A;  1ZKO A;  2NZ1 D;  1VCI A;  5C44 B;  2A6H C;  4E6I A;  4MIU A;  4OGQ C;  4WJW A;  3DXJ C;  4QIW B;  3A7A B;  3MAQ A;  4XLF A;  1EYA A;  4HTH A;  2JDI A;  3PUZ A;  3U9S A;  3SK8 A;  2XND A;  2PPB C;  2HCI A;  4OO1 G;  3RUZ A;  2PZW A;  1F2L A;  1H9M A;  5KEE A;  2PYK A;  3I70 A;  2EYF A;  2BCO A;  3L3O C;  5C0X J;  2GK7 A;  4KKU A;  1LT3 D;  1V0F A;  1TS3 A;  2A73 B;  1JQY D;  4KK7 A;  3SVM A;  1JOO A;  3FPP A;  1V1P B;  1IHZ A;  1DON A;  5IK2 A;  4XQQ A;  3EA6 A;  2WIN B;  4A3B B;  4HCS A;  4M8A A;  3PIP 3;  2JA7 B;  4IZ8 A;  3N6R A;  5AFW A;  3J7Y W;  2D62 A;  1WVL A;  3OEE A;  1JWS D;  2NYZ D;  5D3I B;  3NPP A;  1H8E A;  3WOE A;  1FYC A;  3SR1 A;  5JJZ A;  1CTM A;  1MI2 A;  2B8F A;  2Z8L A;  2F0N A;  3R3O A;  2F03 A;  2EJF C;  1EY0 A;  5I2Y A;  1F77 A;  1BXT A;  3K6O A;  2J0T D;  3D4W A;  1QB5 D;  1JIC A;  1LLR D;  3HZX A;  2VNU D;  4V19 0;  1D1K A;  2D9U A;  2K5Q A;  5F2D A;  3T16 A;  3M3Y B;  4KTA A;  2K32 A;  2L1B A;  3BDL A;  1GUN A;  2X69 A;  4CHT B;  4YIJ A;  3I90 A;  1PMR A;  2R6G A;  3OFN A;  5NUC A;  3D6C A;  1CA6 A;  1W9X A;  2NTS A;  3RZO B;  1TY0 A;  4J8Q A;  3IKJ A;  4R8I A;  2SOB A;  2D3N A;  1T5E A;  2XIW A;  1PTO F;  2PZT A;  3CKI B;  2A5H A;  5E4X A;  5DN6 A;  4RWS C;  5EKI A;  3EFX D;  3DUZ A;  5CMD A;  3DM1 A;  2WAC A;  3P7J A;  1MBY A;  4CKB A;  2K05 A;  2FJ2 A;  2X85 A;  3ZPN A;  1CQF A;  1JR0 D;  3SXH A;  5JAV A;  4ZK9 B;  5I6W A;  4XN3 A;  4A3F B;  1U4P A;  1WTV A;  3DDY A;  1HZE A;  1OXV A;  4RGT A;  3I4N B;  1HUN A;  1FX0 A;  3OMG A;  3MXU A;  5K5P A;  1KAA A;  1EY6 A;  2EY5 A;  1IKL A;  1O7Z A;  1EZ6 A;  4EQP A;  4TSS A;  4DK0 A;  1EQV A;  5M5W B;  2EOT A;  4CBV A;  4ZQ3 A;  1I4G A;  2E2H B;  3K5N A;  1EOT A;  1O7L A;  2B39 A;  2PCF B;  4NMZ A;  2YYZ A;  1OB0 A;  5IGF A;  4EGV A;  3HOX B;  1TS2 A;  3SK6 A;  1KDC A;  2WJV A;  2WAQ B;  5DAU A;  1SJE D;  2XN9 C;  1SE4 A;  1T5X D;  2NN6 H;  1K8M A;  4G7H C;  5JEA J;  5COR A;  1NR2 A;  1UNS A;  1GUT A;  3FMC A;  5FO7 B;  5E1F A;  1STY A;  3RD4 A;  2F0Q A;  5HKK A;  1SJH D;  3AMU A;  1RCV D;  4QMG A;  1LT5 D;  4KHZ A;  1QNK A;  1LAC A;  1TY2 A;  4K5W A;  2QE7 A;  1OXT A;  1V43 A;  3DHQ A;  1C48 A;  5C5L A;  5ELD A;  1DCZ A;  3ERQ A;  4BY1 B;  1I4X A;  2CVR A;  4ASU A;  4QF4 A;  1GUS A;  3CMM A;  4G6I A;  3OPO A;  3NP8 A;  5I4D A;  2IX1 A;  1CK1 A;  1LTS D;  2TMP A;  3H09 A;  3C1E A;  1K8O A;  3D8G A;  3GV6 A;  4XLE A;  2J4X A;  4RKB A;  2XSC A;  1VF5 C;  2CK3 A;  2BOS A;  4DA2 A;  3BDO A;  2K28 A;  1FGB D;  4MHE A;  5COY A;  1SE3 A;  1XX8 A;  2KCC A;  4YEL A;  1KTK A;  2MGS A;  5FK9 C;  5JPM C;  3PO3 B;  5LHY 1;  3A8J E;  1CZW A;  2JA5 B;  1V1P A;  2SNM A;  1TVX A;  2KCN A;  3S17 B;  4BS9 A;  4ZAI A;  1ENC A;  1Z6H A;  1Y1W B;  2A68 D;  3CU7 A;  5KRU A;  3OSO A;  5G3L F;  5C0X G;  1JC7 A;  5ELB A;  5EPL A;  3MVV A;  4BBS B;  3DWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...