3T56B

Crystal structure of the pre-extrusion state of the cusba adaptor-transporter complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Cation efflux system protein CusA
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
total genus 57
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t56B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t56B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t56B01
2O5JC 4DK0A 1GUTA 2V4DA 2BA1A 2KCCA 2B8GA 4IFDH 2AUKA 3A8JE 3EQLC 1K8OA 4KI0A 3OPOA 3PUZA 1T5EA 3MFYA 1GHJA 1GUSA 3T56B 1HQMC 1O78A 1DCZA 3IKJA 3LWUA 3I73A 3H94A 3OW7A 2D2CC 4IFDG 3A7AB 5JEAG 1Z7TA 1H9SB 3BG3A 3I4LA 1EWHA 1Q12A 1E2WA 2K33A 4KKTA 4KN7C 1GUGA 3KLRA 3PUYA 4KKSA 1V8QA 2IT1A 1I6VC 5KNBA 3BDOA 3N6RA 3NE5B 2LMCB 3WDNA 3FPPA 1H9MA 1IYUA 1K8MA 3QG1A 2K7VA 1H9JA 3PUVA 2A6HD 4KKUA 1G291 2D5DA 1DXMA 1GUOA 1B9NA 1ZKOA 2EVBA 4RCNA 2PNRC 2JEAI 2E74C 1CTMA 3VR3A 3M7NA 1O7LA 3PUXA 2YYZA 4BA1I 1ZYRC 1VCIA 3ND9A 1Y69U 2A68C 3U9SA 3FMCA 1OXUA 1TU2B 5BN5A 3CRKC 2BA0A 4LJZC 2DNCA 1LABA 1HCZA 2A68D 1H9KA 4G7OC 3AB9A 3GD7A 4LK1C 1OXSC 2Q8IB 5KNCA 4XTCS 2O5IC 2A6EC 4OO1H 1A6XA 1BDOA 4DNRB 4DK1A 4H44C 1H9RA 2PCFB 2EJGC 3T51B 1IW7C 2K32A 1VF7A 4L8JA 2A6ED 1ONLA 3HGBA 3L7ZC 3W3AA 5C0XH 2JEBI 1LACA 3A7LA 1E2VA 3OOCA 1Y8NB 2DN8A 1CI3M 2PPBC 3A8KE 1IW7D 1OXVA 1VDZA 2AWOA 3VR5A 4OO1G 4TKOB 2AUJD 3GQBA 4HR7B 3M85A 2ZT9C 1Y8OB 5BN4A 3D4RA 3MXUA 4BA2I 1Q1BA 3QJYA 2JXMB 3IFTA 4DNTB 3M4YA 2B8FA 2R6GA 1CFMA 1QJOA 1B9MA 2CW0C 5KNDA 3CRLC 3VR6A 3P20A 5BN3A 1E2ZA 3QIAA 3A8IE 1YNJC 1Z6HA 2KA7A 2NN6H 3VR4A 5JEAH 5K36H 1VF5C 1Q1EA 1H9SA 3PV0A 2NN6I 4KMUC 2A69C 2F1MA 2DNEA 3PUWA 3TZUA 1IYVA 2EJMA 2L5TA 1SMYC 4KN4C 4XIGS 4G7ZC 1PMRA 3LNNA 4TQUS 2QF7A 2A69D 1DD2A 2BE5C 3SDZA 1FYCA 2NN6G 1FR3A 5K36G 3VA7A 1HPCA 2JE6I 5C0XG 1GHKA 1V43A 4GZYC 3T53B 1OXXK 2BDOA 1Q90A 2EJFC 2EDGA 2BE5D 4OGQC 5A35A 2D62A 3I72A 4G7HC 3ND8A 2E76C 4PV1C 3RLFA 4JBWA 1YNNC 3SE0A 1HTPA 2A6HC 3D31A 4H13C 4I7ZC 1TKWB 1Y8PB 3DXJC 4KHZA 1GJXA 4JK1C 1OXTA 4IQZA 4H0LC 3VR2A 1GUNA 2E75C
chains in the Genus database with same CATH superfamily
1YNND 3KLWA 4Z4TA 1JMCA 2K75A 3FKIH 4FXKC 5IYBH 3ERQA 2V7XA 3HOXG 4K6LA 5FL7A 1W0KA 4LF7L 2B2TA 2RHQB 5D3IB 3WXMA 4DV5L 1YNJD 4YAFA 2Q2TA 4JYAL 3OMCA 3J81c 5B6IA 4PMBA 4RPBA 2R3ZA 2RDGA 1QFJA 3SK5A 4RCYA 1SYBA 1MHWC 3CCUB 4UDUC 2BSAA 2KEEA 2F0WA 2PLFA 2Z6BD 1Q86C 1D8TA 1PZJD 2VBVA 4POGA 4B44A 4ZRZA 1PFBA 2ZBUA 2X53S 4QIWE 1YHAA 1G8ZD 5EAYA 3MTSA 1N9WA 1K83H 1IKLA 1AE3A 1YNXA 2D3LA 1HZ9A 2HMAA 4FWTA 4ALPA 4NKLA 4MTNA 4TMWA 1EZ6A 2WKDA 4APVA 3PIP3 2EYOA 4J8QA 3K7AB 2KCNA 1G2SA 2ZZQA 1LTBD 5IGFA 4BBRH 3R6JA 4B3FX 5TR9A 1K8GA 1HVXA 2SNMA 4A3GH 1V0FA 1EXMA 5A8AA 3GD7A 2J7ZA 2OTJA 2JP1A 3NUCA 4DUZL 3NENA 3PO3B 3T1HQ 1TY2A 3L2PA 3T51B 1JJ2A 1E2VA 3S1NB 3STBD 3WQZA 1CI3M 1XTDA 1OXVA 5FO1A 3AMUA 4EQ5A 4CDEC 3LVBA 3LWEA 3CP2A 4LF8L 2EY6A 1CUKA 4LW1A 4CDFC 3GTPH 2NVQB 4CKBA 4C3HG 2UXBL 3UE0A 4A3MG 1SNCA 4QUFA 4QMGA 1I3QH 1EP2B 2DYIA 1QCBD 4X66Q 2FJ2A 2DEUA 1XYIA 2JK8A 3GDEA 4JCVE 5JPMC 2WAQE 4JG2A 1PDQA 2F1MA 5IT9c 4JBMA 3WNBA 4AVZA 2NZ1D 4HN7A 2OTJB 2OT2A 1I4RA 2PZWA 1EFUA 1DD2A 1ZUNB 3S24A 1VQLA 3SDZA 2Y0SB 4JMQA 4ZCIA 1N8RD 1JJ2B 4XKWA 4GZYC 3OAAA 4KHPL 4WZTA 1JT8A 1II3A 1YI2A 4A76A 5G3LD 1L1OA 4OX9L 4GN5A 3SE0A 1RHPA 1ENAA 4A3EH 4RD1A 5E4WC 3R6KA 2FHTA 3FVQA 1NB0A 1B23P 2V4DA 4DR2Q 5J3OA 2B8GA 1NDHA 1RCVD 5JAVA 1JWMD 4WZEA 4IZ8A 1R4QB 2OF1A 1KD1D 3OZUA 3LWUA 5BR8L 1MSHA 1HZAA 5IYCH 4NBSA 1KNEA 3J80E 4YY3Q 1KTVA 1F20A 1W6JA 3TRZA 1KLUD 2OK8A 1G91A 2ZXRA 1DOKA 3H3VH 1VQLB 4DR7L 5M3MB 5KNBA 5FK9C 1I5FA 1Y1WH 2LMCB 3NBIA 3OW2A 1R5OA 5F4JA 1M1KC 3ER0A 4RLZA 3KJPA 1WU8A 2JA9A 2B3GA 2BVNA 1YI2B 2UXDL 1GUOA 1L1OB 2CH4A 1YJWA 2JEAI 2L55A 2CK3A 4G7XA 5AJ3L 3M7NA 1O7LA 4CGYB 3PUXA 4AYBB 4A3CG 1B2RA 1D5XC 1BUVT 1PH6A 2MO1A 2PNHA 3C2PA 3HOUH 1SLJA 3SK6A 1TWGH 4B48A 3S14H 1DOMA 3G6EA 3HKZE 2AWNA 2N78A 2F0IA 2K04A 5HY6A 3IL8A 1JORA 1O7IA 2KJXA 1U2RA 3JQRA 1HA5A 1SAPA 3DEPA 4KHVA 1Y8NB 3D3RA 3VR5A 1K9MC 2ID0A 4C56C 4LNQA 2C35B 2JA7G 3W5OA 3OW2B 1IBMQ 1FRQA 4XOPA 5BN4A 1EY0A 2ATWA 1A2UA 4JW0A 5DEHA 2F03A 3PIOA 5EPLA 3PO2G 1JJGA 1YJWB 4Z4WA 4LBYA 1V1QA 4R8IA 1X55A 3OEHA 2CW0C 2YWGA 2OYNA 1B1ZA 1LT3D 3HZXA 5DAUA 4XYOA 2Q2UA 1T6YA 5HGTA 1IBLL 5FO0A 4P6YA 4NNJA 1G7SA 4DAYA 5L46A 5C0XI 5KYLA 4A3BG 2TSSA 1N32Q 4G7ZC 4FK8A 4DV1L 5LL6X 2C78A 3G6EB 1QILA 2A69D 2XSCA 1HNWL 5IWAL 4JI2L 1PTOC 2HQEA 4A3IG 2KVOA 3AGQA 3MMPA 4EQOA 4JV5L 2BE5D 3I72A 1PH7A 2HUGA 3HOXH 1BKBA 1GXDC 3QFRA 2PW7A 4FP5D 1TKWB 4F87A 4L5SA 2UXCL 4IN3A 2QILA 1Q82C 1A2TA 2K5NA 2VNUD 3SJZA 1XQBA 2V1CC 2K50A 1U5KA 3AVYA 1QOHA 1WOCA 1LTID 1O78A 4JI7L 4OL7A 3U9OA 2OBTA 4DV3L 2DCUA 4LBWA 2R9VA 1Z7TA 3GVKA 1QE6A 2XRQD 5CYUA 3TBIB 3PUNA 1N36Q 2D3NA 3CCRA 4DAYB 1M8AA 2DY1A 1BBUA 2NZHA 4KN7C 1ILPA 3DLLA 2KQ3A 1DM0B 2K03A 2HQLA 3MEFA 1CQFA 5C4JH 3CCQA 3KDFA 3NK9A 4WFN3 3G6JB 2C2WA 1D5MC 1ILQA 4WJWA 1Q8IA 4I7AA 2O2LD 4L5QA 3V2TA 1JB9A 4IJLA 1W35A 1UEBA 4M0LA 2PNRC 1KC8C 2BGIA 2E74C 5C4XG 1SMXA 4YCWA 4C2MH 4BPRA 1K83B 4BA1I 1JQYD 1TXYA 2Q6OA 1J5EQ 4TMZA 1TVCA 5FJ8G 5M5YH 4B3TL 4DR1L 1UD4A 4BBRB 2X6LA 3S9WA 3GVJA 4DR5Q 2A19A 4Y9RA 2H4OA 3TS2A 4XN3A 3S2DH 1T6ZA 3CU7A 4A3GB 1STYA 3CCRB 4RWSC 2A6ED 3W3AA 3GTQH 2B2UA 1GAWA 1LT6D 2PPBC 2XRSD 1VQPA 4A3MH 1EFWA 1GO3E 2DJFC 3CPWA 2LKVA 3CCQB 3BYTB 5H1SE 3KUPA 1V1PA 1KRTA 1QUEA 1NMFA 3BVMA 2R61A 2ZT9C 3KDFB 4RCOA 2A8VA 2RSNA 2Z9HA 3H9NA 3OZVA 3IFTA 4CQJA 2RF4A 1JA1A 4QB4A 3ZJYC 2E2IH 1IYJB 3W2EA 1AE2A 2ZXIA 4YHHQ 1K73C 3PVDA 1STNA 1B3QA 5KNDA 2F0UA 1I50H 3OWFA 2YU9H 1EYCA 1MKHA 3K6OA 4P2CB 4CJ1B 3GTPB 1B50A 5DNFA 1TY0A 2GJPA 2H5XA 1LYLA 4ZGQB 2ZZGA 3D4WA 1I3QB 2KHSA 2EJMA 1VQNA 3CESA 4G7WA 1PMRA 1SNQA 2E5LQ 2HCJB 2C4TA 3VO1A 1EYDA 4G6IA 3H15A 5JOBA 2XVSA 5LMNL 4EQPA 2UUCL 2V7TA 2B63G 3T53B 3BDCA 4QIWB 2D62A 1VQPB 4OWTB 4IPHA 3CPWB 3S1RH 1AH9A 2V31A 3CC2B 2VUMG 1V1PB 2VY3A 2GVAA 1G6PA 4P6VF 4AF6A 2R92H 2XTIA 1SR3A 1XPRA 2K52A 3DM1A 3NWSA 5A2QE 4IFDI 3HOVG 1A8PA 1XWEA 4A3EB 1D8LA 5D14A 1GUSA 1KJZA 1BX1A 5C3EG 3UI2A 1I94L 2IX1A 1EP3B 3PA1A 1XNQL 1YVCA 4HE5A 1STGA 1H8EA 5C44G 4ILWA 3JU4A 1S5CD 1VQNB 1QVFA 4FO2A 1EFRA 3N6RA 2ES2A 2E8GA 1Q86D 3GTMH 1EWYA 4XLFA 2JYOA 4JI8L 3ICEA 1S72A 1EIYB 1QGYA 4P1VA 1QFYA 1JOKA 1UD8A 3BZKA 1U4RA 4GS3A 3UDGA 1S4ZA 4FN5A 3SLNA 3A5ZB 3J81L 5DM73 1BPLA 4ACBA 3FKIG 4RDLA 1LTLA 4HJAA 2VNKA 2EIFA 1EOTA 2WAQB 4CDCC 4G7OC 4LK1C 2AQ1B 4LFAL 1HFNA 1JOQA 1BCPF 4IPDA 4KV6A 4MZ9A 1XMOL 2JA7H 3CXCA 4EVOA 4OO1I 2EJGC 1IW7C 5THXA 2R93G 1I4XA 3HOUB 4LF7Q 1QVFB 1ESRA 1HR0Q 2F3VA 3J7AF 4X64L 4XDXA 3DMUA 4RGOS 3PO2H 3S14B 1B2TA 2E1RA 2JA5H 4M53A 2VQFQ 1LM0A 2K05A 3T13A 2F0JA 1WTXA 2F0HA 2IHFA 1QNUA 4TMXA 4X65L 4YHBA 1F2LA 4LUZA 1SSOA 4V0BA 3J7ZC 1W9XA 1D2EA 1I4QA 4IUUA 4ZLTF 2SNSA 1B9MA 2K14A 5IODA 3J81i 3D4DA 4DV2L 1VQJA 4A3BH 4CJ2C 3RNUA 2WIIB 3A54A 4PGOA 4A3FG 1KNAA 3AFQA 1A3UA 3OE7A 1EU3A 4RA8A 2VW9A 5FOBB 1WOPA 1W34A 4A3IH 3E0JA 2GK6A 1E63A 2BM1A 2C5CA 3D26A 3M7GA 2XOKA 2KBNA 2ZJRA 1Y0YA 2LZJA 3CXCB 2MGSA 4DA2A 3Q23A 3EBEA 1TT2A 2N49A 1KK2A 4ZUJA 2VNJA 2EYFA 2R7ZG 4CJ0B 1TIID 3W5HA 1YITA 3J81k 4PV1C 4OIJA 3T16A 1PJ5A 2ZL5A 5HKKA 2G9HD 4DR3L 4DUYQ 1Y8PB 3E5SA 2X6GA 4UZUA 1AIPA 3GV3A 3V05A 2DERA 3HOXB 2XGTA 2IPKD 4RM0A 1K8OA 2K5WA 4K0KL 5IT9L 3P7JA 3RR5A 2CWAA 4DXGA 2B2YC 4HMIA 2UUBQ 5FO9B 5FLMG 2V7WA 5M3FG 2UXBQ 1OB0A 1R5NA 3D8GA 1ICFB 4A3KG 2JJ1A 2KHIA 4FF2A 1XPUA 4PG3A 2OQKA 1FGBD 1WCMG 1KQSA 5C4XH 1A3VA 4IUQA 3VYTA 2GK7A 1L0XB 3F2BA 3ISXA 3ZUGA 1H9MA 3WYAA 1X6OA 1KK1A 2K7VA 5LMUL 3G48A 2ZM6L 1PA6A 2A6HD 5FJ8H 1YITB 1VMCA 1PZID 2ZJPA 5C4JB 3K0XA 1SNOA 5IYNA 3PSIA 2Z0SA 2YYZA 1BX0A 2I5LX 4DV6Q 3R2IA 1N0UA 4HIKA 2NTSA 2BOSA 3U9SA 3VNVA 5C6AA 3CHBD 3CB4A 1BR9A 4U9UA 1EQVA 1TS2A 4PZ7A 2M5SA 5ELCA 1WTPA 5JVH3 1I18A 4C2MB 1HNZQ 4X6AH 1H9KA 3P26A 4DV4L 3NEMA 2CH4W 2QN6A 4XTCS 2PMZB 4V190 5M5YB 5IYCG 3M4OH 1S5BD 2CHBD 2QEXA 1RQPA 2WR8A 4X8IA 2JEBI 1QG0A 1JWSD 3B82A 1N06A 1TUIA 3E9IA 4DQLA 4IUTA 1EY8A 2KOLA 4E6IA 3F2CA 3S2DB 1S5DD 3E9HA 1NUCA 1Y1WG 4WRDA 2FVGA 1RDPD 4BY1G 1SE4A 3GTQB 3Q39A 3U50C 4UP7A 4HIDA 2F0QA 4K6DA 5IGCA 4C3HB 4DNTB 2NZOA 4A3MB 4DAVA 1IL2A 1DONA 2W6JA 1MGSA 4X62Q 3RN2A 1QH0A 2P5ZX 4RDJA 3PQIA 4O1NA 1FD7D 4Y7CA 5EBDA 1PH3A 1KXLA 5IYDG 1GR1A 2E2IB 1VQIA 4TT3A 2MUYA 3J7YW 1DDGA 1MBYA 4HCEA 2YU9B 1I50B 4G1BA 1O7ZA 4RD2A 3W5VA 2L5TA 2ZTEA 1C7YA 1NJIC 1PH4A 4PC7A 2L15A 3VNUA 4DF7A 2VUMH 3I8ZA 2NN6G 2QEXB 1A3TA 3TS0A 3SR1A 4QGUA 2VB3X 4OOXA 1FL0A 3S17H 1TWAH 3JAML 3S16H 1STBA 1F60A 5IGEA 1N07A 1SKQA 3LQ6A 3RLFA 4JBWA 1CKMA 1IZ6A 2M2LA 4RKLA 4KHZA 4RHRA 4XOTA 4LFBL 5CDFA 5C3EH 3AVXA 1MIUA 1X54A 2BA1A 4JI0L 2VQEQ 5TSSA 1LTRD 3NTIA 2PI2A 3UDFA 4CHTB 4CKCA 4AC9A 5C44H 4M4SA 4N9PA 5A89A 3BDLA 1T5EA 2UU9Q 1Q82D 4GLXA 3IKJA 2JN9A 3J7AV 1MSGA 2L0CA 4P71A 2X6WA 1IKMA 2MHVA 4ZCLA 3A7AB 2NVYH 5K5PA 4H02A 1HH2P 3ONUA 3HFZB 1BMFA 4RMFA 4X3TA 1WTQA 3PCOB 4GQNA 4DGZA 3JAMi 3EROA 2GN5A 1VQKA 3C1EA 5IYRA 2QGGA 2XNAC 2X85A 3KEWA 1BNZA 1WTOA 3HOWG 2WFWA 4RPDA 4K14A 2K5HA 4YEJA 3GTMB 1CTMA 4Q7JB 4BBSG 1VQEA 3MZ5A 1MJCA 2X69A 3QO2A 1MD2D 4X3KA 5T1GA 3HS0C 4PZ6A 3TQYA 1HNWQ 2UUAL 1KC8D 2F0MA 4P22A 2HIXA 3GP7A 5D3DA 5BN5A 4B9WA 1E22A 4LF6L 2RBMA 2OCEA 2R93H 4JI1Q 5I6YA 1N08A 5EPJA 5F4OA 4XT3B 4GKKL 1J8IA 4AQYQ 2UXCQ 2WSSA 1F9QA 4DK1A 4OONA 3CPFA 4C1NK 4XLAA 3MHPA 1UE7A 5C0XH 4L8JA 2O4XA 4WJ4A 1ONLA 3V7AA 4RAUC 4C43A 2JA7B 5E6TA 4RD6A 1YHBA 1VQKB 3HG9A 1O7YA 5CMDA 4QL5A 1LTGD 5J22A 3MVVA 3MXUA 3PO2B 1TVXA 1Z9FA 2HLDA 3IRBA 3OYYA 4A3FH 4J0QA 4RGMA 2MO0A 2D0PA 1ZYRD 3M3YH 1B4OA 1DARA 1WTRA 4Z1MA 2RC6A 3CRLC 1CZWA 4II2A 5J39A 1SFOH 3DUZA 4IUNA 4N9TA 4RD0A 5M5XH 3S2HH 1CKOA 1C0AA 1P8LA 1WTWA 5BSXA 2C5BA 2HCCA 4N3NA 3U6KA 3EVQA 5EQ0A 3CW2A 1JE4A 2HT1A 4QV2A 1SE3A 3K58A 4A3BB 1I6HH 4X7DA 1YHQA 3Q8DA 2R7ZH 2JDIA 1QG7A 2K1BA 3GTOH 3MFGA 1PJ7A 3QFTA 3TEHB 3K80C 4TQUS 2QF7A 2Z4HA 4II3A 1FYCA 5K36G 3VA7A 4A3IB 4HAEA 1KABA 3HP3A 1WORA 4GKJL 3W2GA 3CCMA 1OO9B 3TP7A 1D7QA 1EY5A 1UE6A 4B3XA 4ULLA 1PLFA 2K6AA 3NXWA 1VMPA 3NTKA 4S3SA 1CM9A 4NP5A 3L0OA 1H42A 3D0FA 4PMWA 5FLMH 4OWXB 1JE5A 5M3FH 3LQEA 1RF2D 3L3OC 4QJFA 3S1MH 1NB9A 5FLXE 5GAGC 5IY0A 4A3KH 2Q8RE 2ZL6A 2VS1A 1WCMH 1DZ1A 1FNDA 2Q6KA 3MXNA 4OPSA 5JJKA 3R3OA 1VQMA 3K8AA 4C0SA 4HMJA 5KSWB 1YHQB 1KIXA 1Q81C 3A0JA 1CK1A 2QDLA 3KF6A 1JOOA 5M5WH 2EFGA 1I6VC 4A3JG 2V7UA 2PIAA 3A5UA 4B3ML 3BU2A 1S4MA 3CCMB 4E0FA 4ASUA 4LUVA 1H9JA 1OGIA 1UNSA 3OWEB 1AN8A 1PTOH 2BGJA 1AEXA 1ZM4A 1SDFA 4ZGNB 2F0VA 3RUZA 5C4XB 4AIMA 3B6YA 3K7UC 5LMNQ 2UUCQ 4RCZA 2R92G 2GJKA 1NR2A 4DN4M 5EPKA 1J9ZA 2A68C 3X3MA 2L9HA 1M4VA 3OJWA 1HA3A 3B8HA 4DAPA 2WV6D 1RQRA 4A3LG 4LJZC 5KIXA 4P12A 1JC7A 1C48A 1CKNA 1V9PA 4JI4L 2Q8IB 2PZUA 2O5IC 2OWOA 3QSYA 2EYJA 5T1IA 2GPJA 3MXNB 3AVUA 4PAAA 4HCSA 2J4XA 4BY1H 1VQMB 3HOZH 1RTOA 3KF6B 3T1YQ 3A8KE 1I94Q 1IW7D 5HZBA 4A75A 3E3XA 4O0AA 3SGIA 1XNQQ 4RDKA 2QEJC 1RKNA 4FF1A 1HJPA 5IYDH 3SLDA 1EUJA 2XEXA 2RCFA 3I91A 4XXEA 3G71A 2YTXA 4JI8Q 1XNRQ 5JBQA 1WYDA 2E2JH 1NSNS 1UAPA 2NN6H 2KA7A 4DR4Q 2D9RA 3GO5A 3I90A 1E1QA 3L9AX 4ME5A 4N8FA 1CKNB 1SMYC 4F88A 2C9OA 3U58A 1SYFA 1XB2A 1FJGQ 3ASQA 3OEEA 3OIQA 1WVLA 2XNDA 1DG1G 1UMKA 1E1TA 2NV4A 3Q38A 1SNDA 3VYRA 1LTTD 3JAMc 3F1ZA 2B63B 1WD0A 2XZLA 2QCPX 2C4UA 3MCAA 4LFAQ 4I65A 5AFWA 1N34Q 1KHIA 2HHHQ 4YELA 4TSSA 2JA5G 3CD6A 3KFUA 2VUMB 1WTHA 1EYAA 5A88A 1R9TH 4I7ZC 4UAJA 3S17B 1TWAB 4NW2A 2A73B 3S16B 4DK0A 2B39A 3HOVB 4LF4Q 1FDRA 2GA4B 4X3SA 1V5VA 5KW9A 2PMZE 5C3EB 3BQJA 1XMQQ 2F1LA 2MFIA 2D2CC 3TP8A 1VQAA 1EFTA 1SN8A 2FFKB 5C44B 2QMUA 4QF4A 3KLSX 4OHJA 1EWHA 4R4OA 2K33A 2LXKA 1GKHA 4RKBA 1KTKA 3HOWH 4B3SL 4B3RL 3PUYA 3BDOA 3RN5A 2NVYB 4BBSH 2W6IA 2ZZEA 4HIMA 1CT1D 5JPNC 1IBKL 4NMZA 1PV4A 2HD3A 2XNJA 2ZXHA 4ZAIA 1VQ9A 3CD6B 4G4KA 4RCNA 1IB0A 1U9RA 5CV5A 3R8BA 4GNXC 3VR3A 3QB3A 1ET6A 3A56A 2JA6G 3J80L 3O13A 3IAYA 3FKIB 4JBJA 5I4DA 1C4QA 2KCMA 3FMCA 1TS5A 2K5DA 3F2DA 4DR3Q 3AB9A 2L12A 2RSOA 3DDYA 3VA5A 3TP5A 3P75A 5CGKA 2R93B 3BC9A 4OOVA 2VNHA 1VF7A 1BCPC 3H91A 1UD3A 1LT5D 1EU4A 2K4KA 2ZTGA 3OOCA 4PC6A 1QVCA 3HAGA 1HXYD 4QQBX 2B2VC 2EY5A 1SKYB 4R71A 1D6EC 3LO8A 1VQ9B 3M4YA 2B8FA 4NXNQ 1HZBA 1TWCH 3Q6QA 4UP8A 3ULPA 3J80i 3H6MA 4RD3A 4QHYA 4YWLA 2DJGC 4A3FB 5F4MA 5LMUQ 1TR5A 1YNJC 1STHA 2NTTA 2YTYA 3HEJA 3NBHA 3T1HL 3M3YB 5K36H 4JOIC 1E1OA 3MEHA 1SFOB 4ME3A 1DYQA 1I4GA 4LMQD 4KN4C 2ZL7A 5M5XB 3BS1A 2XWJB 1CNEA 1IHMA 1NJID 5CV9A 1HPCA 1ASZA 1I6HB 4Z4SA 1U0LA 3GTOB 1G7CA 1YZ6A 4YXWA 2A1AA 2ICIA 2R7ZB 4DV4Q 2Q6LA 3ND8A 4Z4ZA 3BH4A 2SDFA 1YX2A 2BMWA 5COYA 3ZIAA 1OB5A 1WPCA 3CMEA 4X66L 4AH6A 4Q0FA 2PI2E 4IQZA 1CZGA 5J35A 4LF5Q 2JA8G 3P1HA 2AUKA 4QY7A 3EQLC 4KI0A 3OPOA 1FGUA 3F8TA 2NVXH 3FJOA 3GTJH 5IYWA 1QX4A 2F4VL 1MJEA 3I73A 4A3JH 3OW7A 5M3FB 3I4NG 3NBHB 3S1MB 2ZBVA 2Z8LA 4CDDC 2C5HA 1GVHA 4HIOA 3KLSA 1QZGA 2JQOA 1STEA 4OIKA 4A3KB 3EIVA 3S15H 1EFCA 4XLEA 4GNXA 1WCMB 3CP8A 2R7DA 3I70A 1W2BA 3H3VI 4OOSA 1U4MA 3VO2A 1FNCA 1HZCA 4DNIA 1UUPA 3G7LA 4DR2L 3D6CA 2AMCB 5M5WB 2F0EA 4A3LH 1AW7A 4DV7Q 3CMEB 1J9OA 4UAIA 2V7QA 1IJEA 3PMFA 1B3AA 4A93G 1PTOB 4C3IH 1D5ZC 3W5UA 3OIPA 2CRVA 5EKKA 1Q46A 4K8JA 4KLKA 3HKSA 3TDQA 4QFMA 4B08A 2RC5A 2IX3A 3KYHC 1A6XA 2JIZA 3CCVA 4DNRB 5CBAE 3LX0A 4R4QA 2F3IA 4RGTA 3RLNA 4ZKBB 2F0GA 5IYQA 4Y7NH 2V7VA 4OP7A 3A7LA 4GNXB 2VNIA 1XFOA 3EN2A 1PZKD 1VDZA 1Y1WB 2ZXOA 4KY5A 1W2BB 3A3GA 4BY1B 2X0KA 3HOZB 1JWUD 1M90C 3K57A 5HGQA 4XR6A 3GIRA 1VQGA 4RH6A 1PRTC 2Z6KC 5IE8A 1I7PA 3K5OA 2F0PA 4OXPA 5IK2A 4K8IA 1HFGA 4LFCL 1EFID 4UY8C 1A63A 3VR4A 2N3SA 1VF5C 2FINB 1IYVA 4DV5Q 1TWGB 4JYAQ 1I8DA 1PJ6A 3A1PA 1W6KA 2VJIA 2KUMA 2UUAQ 2E2JB 3CCVB 2H1EA 2OTLA 3A8KA 1IBML 2R7FA 1UD5A 5C0XG 3CPXA 4JBKA 1GHKA 5GADC 1PH8A 2IX0A 2X6YA 1S72B 1RIPA 2EJFC 4IOCA 4G7HC 4QUZA 3S1QH 4P9SA 5IP9G 1WDTA 1SNMA 3CC4A 3E20A 4GLAC 4PMCA 4EX5A 1N33L 2OBSA 5FLXc 3WNDA 1GUTA 2KCCA 3AYHB 5KEEA 1PYSB 4XM3A 5HZAA 4B3GA 1JICA 1R9TB 1PFSA 5I9PA 1SBBB 3H0GG 3MFYA 1N32L 1HQMC 5E3FA 4P3IA 2E2HH 1G6ZA 5TY0A 5D65A 1WTHD 3I4LA 1B8AA 5KRUA 2WJVA 1QGZA 3P27A 2CVRA 3CF5A 3S1NH 2OQ0A 1SYCA 3KLRA 1Q8KA 2E1BA 4DUZQ 1B7YB 5HXBA 2OTLB 4C3JG 4FXGC 2JA6H 1PH1A 5A2QL 3QG1A 1WSVA 1XX8A 5C3WA 3HOYG 3CCJA 3HOWB 4KKUA 5I2YA 1QWYA 1FNWA 2RVLA 4YCUA 4BBSB 3CC4B 3G05A 1VQ7A 3ZC3A 3J80c 3ITPA 3SEJA 4KJOA 2PZTA 2JJQA 2M00A 4LF8Q 5F2DA 3ZZUA 3V76A 1EEID 1SYDA 3QOJA 1OXUA 3QWNA 1HUNA 2OK7A 1DOLA 1KRSA 3WOEA 4JI5L 1N36L 4WZLA 5IGGA 1KZLA 4X7FA 2A68D 3KBXA 1TTTA 4X3UA 5FKAC 1SROA 2SEBD 4TMTA 1E1RA 1UEAB 4IPGA 1T9HA 1WJJA 2F0LA 1NCVA 3MA2B 4R4TA 3KJOA 4PC3A 2Z6KA 1VS0A 1HA6A 3SJPA 1KRHA 4DU9A 2CNDA 5E1FA 1VHEA 3AEVA 1M1KD 1K28A 2WZPP 1E0BA 2NBFA 1FNBA 4JVZA 3CCJB 5LMZA 2D0OA 1J5EL 1WD1A 1I4HA 4KHPQ 3FDTA 3NPPA 1SEBD 5CV7A 4F7XA 3M4QA 1VQ7B 5C4ZA 3OTOL 2KECA 4OX9Q 4DFAA 2ZXPA 1JB7A 3P20A 4DR5L 1AP0A 1QZHA 3QIAA 4RG1A 5FO8B 1Y0RA 1Z6HA 5C3XA 4MTKA 3I1FA 5JEAH 1Q1EA 2AQ3B 1VQHA 4ZUIA 3K5LA 2DNEA 1RTNA 4YCVA 2RDFA 1VQBA 1QVGA 1F77A 2PE3A 5G3LF 5BR8Q 2XZPA 1KQSB 3MAQA 4MN3A 5ELOA 5CV6A 1X9NA 3HOZG 1PRTB 4DV0L 4L5TA 1BBXC 1K9MD 3K5NA 1EIHA 5H59A 4DPGA 2JA8H 2DETA 3UDIA 4YAOA 5GV7A 5C4HA 4DR7Q 4XYQA 4KY7A 3A3BA 1VHOA 1QGAA 1Q9SA 4XN0A 4JK1C 2B2WC 3VR2A 2XZOA 4RHSA 3I4NH 2CW0D 1BVSA 4UPAA 3U4VA 1HR0W 2UXDQ 4K2KA 3E6ZX 3VDYA 4GOPC 5AJ3Q 1LT4D 3W2DA 4ACAA 3TSSA 2E5LL 1PH2A 2LSSA 4IFDG 5E4XA 4P74A 2WJYA 2NVXB 1E2WA 2EIXA 2EXZA 2F52A 2BV3A 1QVGB 1KAAA 1V0EA 4A3JB 1PTOD 2IT1A 5DN6A 2MJ8A 5ELFA 2B2YA 4DAMA 3KOJA 1K8MA 2F0SA 1ZM3A 2SOBA 3NSWA 2WYRA 4PC1A 3S15B 4A93H 4AF7A 2AHOA 2D5DA 3S1RB 2XNCA 1DXMA 1PKVA 4WORA 2R92B 2CQOA 1TS4A 3OJXA 2XWBB 3ND9A 4RJLA 1LV9A 2WB1G 3A74A 2PYKA 2KENA 1T5XD 2DNCA 1HCZA 3ZZ0A 1EY7A 5HURA 4F7DA 2NUCA 1G51A 3BVZA 3FHWA 4K5VA 5KNCA 3TREA 1IBLQ 1JCKB 5FIUA 2DIEA 1H9RA 1NNXA 4YAUA 5EBCA 4HEDA 3NTHA 1ML0D 1PFMA 3DWPA 4HJ5A 4P2NA 4PZ8A 2G9DA 2F0TA 3MXPA 4XL9A 3QFSA 3HRZC 4DV1Q 3D6WA 4OO1G 1JR0D 1VQ4A 3UE1A 4JI2Q 5IWAQ 1BXTA 2ZTNA 4Y7NB 1PVOA 5NUCA 4JV5Q 4LAAA 2AHOB 5ISRA 2F0NA 3BZCA 1Q3LA 2R6GA 4FYDA 2VJJA 1BOSA 3SEBA 3SVMA 1R5BA 5TV2A 4HSVA 4CBVA 3J81j 1E2ZA 1IBKQ 4M2LA 1ZEQX 4B47A 3VYUA 3ZZTA 1L2FA 2JN4A 1HR0L 5EKLA 4Z4UA 1L1OC 3F2UA 1FX0A 4JI7Q 2P3MA 1W3SA 2X6XA 1HZEA 5IP9H 2VQFL 4XQNA 2B2WA 2L4NA 4DV3Q 1X3GA 1FR3A 4JI6L 3T4AC 2B7BA 1E24A 1BQQT 1SYGA 3VYSA 1Q7YC 3HKZG 4LF9L 2EDGA 1AZQA 2WP8J 5C0XJ 2HCIA 1YIJA 4GOPA 2NVTH 2JA5B 2FX3A 5KNLA 2BM0A 2CW5A 3RMHA 1HTPA 1VQ4B 3H0GH 1SXTA 3PIPA 2ASBA 1COWA 2HIVA 2K5QA 1TQOA 2E75C 2LY7A 1S5ED 1K73D 4K1XA 5EKIA 4CKEA 1GOZA 3EJIA 2J7KA 3S1QB 3E0EA 1EQQA 1YJNA 2AKWB 1UD6A 2VBSA 1DCZA 2EXDA 3TN2A 3TMEA 3QE2A 1J6QA 3H94A 2X8KA 1LUZA 3U6BA 4NB3A 3SXHA 4C3JH 4A3DG 4G5GA 4B3TQ 1F9PA 1EP1B 4DR1Q 2GJRA 2JJ2A 1JA0A 1JB3A 2I1LA 3EA6A 3HOYH 3MHBA 2E2HB 1TWFH 4FNFA 4MYTA 3R2TA 4WWVA 5KGUA 1EEFD 4DUYL 4PQXA 4UZFA 3FKSA 3NQTA 3KF8A 1HQRD 1CNFA 2R6HA 1Y1VG 3M9BA 2FMCA 3FPUB 4KY6A 5EJWA 1YIJB 1K8AC 2CC2A 4GOPB 2DOGA 1YJ9A 1IXRA 3SK4A 1EL0A 3V96A 1XE1A 5ELEA 4HJ9A 2JA6B 3JQPA 5JVG3 2BH2A 1AFPA 5M9OA 3MC0B 2UUBL 2ALYB 5TRDA 2VXWA 2EY1A 4O2DA 2BH8A 1F9RA 1YJNB 5ELBA 4XLCA 1SJED 2YWFA 4GN3B 1ENCA 2CF4A 1KL9A 4XMYA 1X3FA 4BY7G 3HGBA 3OHXC 4QCLA 1LO5D 4QVAA 3ZBUA 5IIFA 1HUMA 1C8CA 1NBWA 4Z4VA 2VBUA 1XTCD 4TRDA 5I2XA 4L6TB 1LLRD 2F4VQ 2AWOA 4LWCA 3OMGA 3KL9A 1N0VC 3FRPB 4HTHA 5JJIA 2N55A 3KF8B 3X3NA 3AVWA 4ZCKA 5CC4A 3BVGA 4DV6L 4BA2I 5GV8A 2VBTA 1YJ9B 2BN4A 4XLHA 2G5DA 1M90D 3I4MG 4BXXG 5KYIA 2WB1E 2OXPA 1HNZL 4L5RC 1K0SA 2VZLA 3VR6A 4NCNA 3CCLA 1PRTD 1TS3A 2IY5B 3QOLA 4ODGA 2LXJA 3A8IE 4DK3C 1A8VA 1VQCA 4C3IG 3C46A 3ASTA 3Q0AA 3K5MA 3WBJA 4XQJA 1H9SA 1K28D 4OPVA 3IFDA 3GTGH 2PO4A 3ONAB 2BPOA 1A62A 1QUQA 1XXGA 4OELB 3BNWA 3M4OB 2IWHA 1PHJA 3CQZH 3ZYYX 1IL8A 1OXXK 1KDAA 2BDOA 2RA4A 2A74C 5A35A 3DEOA 1UE5A 3KBGA 2E76C 1F2MA 4U68A 4X62L 1D1NA 3I7FA 3NELA 3W1BA 2A6HC 4R1JA 3AGPA 2RQXA 3OP1A 2JA8B 4IFDH 3ASRA 1D1IA 4ZCMA 4F8MA 2XN9C 2WINB 1VJSA 3A8JE 1HTLD 2Z1CA 4DR6L 1GM5A 3PUZA 3CCLB 1UE1A 1FRNA 1G7TA 3T56B 4IALA 5IP7G 1V1OA 3I4NB 2L11A 3CCEA 1SNPA 1EQTA 2NWGA 3TP6A 1H9SB 1RJTA 2QA4A 1WFQA 4IFDJ 4ZQ3A 5CV8A 4RFBA 3AVTA 4LFCQ 1QUQB 4KKTA 5IGBA 3W1GA 4X07A 3URYA 3R93A 4P75A 2WZNA 1EY4A 1XMOQ 2PQEA 3WDNA 2BCOA 1ESFA 3PIO3 2IJ0A 2VQEL 4KTAA 1B70B 3GVLA 4X64Q 5FLXL 1BF4A 3RZDH 1HNXL 1EWCA 2EVBA 3CCSA 3G71B 4O42A 2J0TD 1ZXTA 1CHQD 2EZVA 2UU9L 3VMFA 1X3PA 3PENA 1SE2A 1IHZA 1OTCA 4A93B 4X65Q 4U673 1E43A 1TLLA 1A15A 1TU2B 4JI3L 1X3EA 2ZJQA 2BA0A 2B2UC 3AVVA 4KD4A 1F9SA 3PUMA 2I5MX 4P3YA 4DV2Q 3JC66 1STAA 2EQSA 1OXSC 2EYMA 1N33Q 4FXUA 1FNUA 3CCEB 1A0IA 3WWVA 4QUCA 1BDOA 4OO1H 5C5MA 1PYWD 4ZYSA 4M1KA 1U4PA 4NXML 3CKIB 2QA4B 3PO3G 1EYGA 4K5WA 1BJKA 1KAWA 1KDBA 4XT1B 4Q5VA 3DWAA 2DN8A 1KK0A 2K28A 4H7BA 3RD4A 2RHSB 4MIUA 4KJNA 4C1NI 2VL6A 1Y8OB 3N52A 5LHY1 1PH5A 3CCSB 1QJOA 1X32A 5BSYA 4DXFA 4WJ3M 4JI1L 2WKCA 4ID6A 4AQYL 1SRUA 3KK7A 4KD3A 4K5XA 1X56A 1NE3A 2I46A 5EGTA 1AMOA 2EYHA 1QFZA 3H3VC 4K0KQ 2HDLA 5LMNW 2Q6IA 2IHEA 5GAHC 3PA2A 3GTKH 2F0KA 3U4ZA 5LL6S 4X0CA 3ZBTA 2Y0SG 4X7CA 2B7CA 3BCFA 4JI5Q 2EYPA 5IGDA 2FMMA 2E2DC 2N88A 1C9OA 1YNNC 4WQMA 1RL2A 1GUNA 5I6WA 3WOFA 2ZM6Q 1BBWA 2QE7A 2NVTB 1ELOA 1FNMA 4R4IA 4A3DH 1P4MA 1VQDA 3H0GB 4FXDA 4ROXA 3Q3AA 1B44D 3S2HB 4XD7A 4Y9UA 1NR4A 5JEAG 4DQKA 5DM63 3J81E 2I5HA 3BG3A 1Q12A 4FDBA 3OTOQ 1Y1VH 3FEWX 4BWGB 4J6HA 3E1YE 4J15A 3Q24A 4P73A 1E62A 4C3JB 4H9GA 4OEMB 4XORA 5M3MG 3FPPA 3HOYB 5E7NA 1ZM9A 1L0YB 4XQFA 1CQXA 3PUVA 1TWFB 1G291 3B78A 1GJRA 2K01A 4C3HH 2CQAA 2VYQA 1CSPA 4TSFA 5CR3A 5CBEE 3CC2A 3Q6RA 3ONYA 1TWHH 1NY4A 4X05A 5IYPA 1ZYRC 2I0QA 3GV6A 4DV0Q 4AYBG 1Y69U 2AQ2B 2N8NA 4OWWB 4BY7H 4PABA 3PF4A 1KDCA 4NDXA 1LABA 4XQQA 4LUOA 1VQ6A 1W0JA 1QUFA 2RCNA 4GLVB 3BZDB 4BS9A 2GQFA 3OFNA 3STBC 3I55A 3BCDA 1MI2A 1KK3A 2QTLA 1CA6A 1N05A 2XGJA 1MABA 3I4MH 1VQ8A 4G1VA 4NPSA 2Z4IA 2AUJD 2EE1A 4BXXH 3W2FA 3RZOH 4P26A 3M85A 3GTLH 2CCZA 1Q1BA 4B4DA 4ABNA 2F4IA 2YWHA 4IUVA 4YY3L 2OEOA 4N8X1 1WI5A 5FO7B 1VLOA 1QNKA 4TN1A 4Z9CB 4R9WA 4LFBQ 1Y14B 4JPBW 1UD2A 4ZK9B 2B2VA 3ASSA 3ULJA 4JI0Q 5C5LA 3CRZA 4Z4RA 4X7EA 3K59A 3PV0A 1T6XA 2KVMA 1WOOA 2NN6I 2C77A 2Q2HA 3TZUA 4EGVA 1VQ6B 4XIGS 4UP9A 1N8RC 1AZPA 3T1YL 5H5JA 2B29A 3LNNA 1IJFA 1PTOF 5IT9E 1EZ8A 5CORA 3I55B 3I56A 4XONA 2VZAA 2XIWA 4K2LA 1P16A 2IL8A 3GTGB 1V43A 2GVBA 4JOIA 1K3BC 5CV4A 3FPKA 4OGQC 3K0YA 3WY9A 3MWYW 1VQ8B 2RDHA 1DDIA 4M1UB 1E7ZA 3ULLA 3CMMA 1Q7YD 4H13C 2Q8TA 1YLOA 1GJXA 3CQZB 5J1ZA 3CC7A 2Z6BA 5IP7H 4IO9A 2F3WA 4KK7A 5JJZA 4A3CH 2ZZFA 1XNRL 2O5JC 1BCPB 1NAPA 1KD1C 4DR4L 1LTSD 3C3LA 1H85A 3A8IA 1EY9A 1S5FD 1BLIA 3SKBA 3Q22A 4RD4A 2D74A 1FJGL 3M4PA 2YWEA 4DK6C 5IYBG 4HIZA 4LF6Q 3GSIA 4YWMA 2CFMA 3CMAA 4TVAB 4LBVA 3MXGA 5DSZA 1O80A 1ASYA 4GKKQ 2BDNA 1SJHD 1GUGA 1KLGD 2Y0SE 1EIGA 2PW5A 1N34L 2HHHL 4KKSA 4PC2A 1V8QA 1ZM2A 4J1MA 3I56B 3J7A5 2ZTDA 3BY2A 2F0OA 1WP6A 3NE5B 1W87A 3K7AH 1CSQA 2QDXA 1IYUA 2DGYA 3NQIA 4HSPA 2CBXA 3NHHA 5AN9A 3QFCA 2QGQA 2EYLA 4B43A 4LF4L 1B9NA 1ZKOA 4QVJA 2ZITA 1E79A 3I4OA 3ZPNA 1EIFA 1K8AD 3CP0A 1XMQL 3CC7B 4JI6Q 3A8JA 3LGJA 2WB1B 4UHVA 5JJLA 3PF5A 3RZDB 1K3RA 4LF9Q 3PO3H 4PNYA 3OKXA 3CRKC 2ENBA 1K0RA 1WTVA 5J3BA 2HDMA 3RLOA 1PH9A 4BBRG 5GQOA 1LTAD 4LC0A 1NRKA 2HDNB 4FVMA 4H44C 1Q81D 2F43A 2PCFB 1GO2A 4OPOA 1DGSA 4ZV4A 2K32A 1PFNA 4R4CA 3CMAB 4A3GG 2DUDA 1NBMA 2KCTA 3RY8A 2B5OA 2EOTA 2NVQH 4YAWA 4TKOB 3OZWA 1E3XA 1PXUA 4HJ8A 3OSOA 3K81C 3A55A 3D4RA 1BO0A 4GKJQ 3G4SA 1SYEA 1WOSA 1CFMA 2NPFA 2A5HA 3JAME 3I2ZA 2D9UA 2L1BA 4TMVA 1RD9D 4AYBE 2EPBA 1GUWA 3BJUA 1BQEA 2K5VA 3I3CA 3BY1A 4P72A 1VLYA 5BN3A 1VQ5A 3FP9A 4L63B 3CTAA 4Z4YA 1JJCB 2RKSA 3C2QA 1I4PA 5DLQE 4KMUC 1WSRA 4UZEA 2A69C 4ZKCB 2MNAA 3UDXA 1EY6A 5I9OA 4MYUA 1U4LA 1FVIA 2BE5C 3A35A 4IOAA 1E3ZA 3TZDA 3H09A 4MNOA 1MRZA 3HKZB 3DM3A 1Q90A 2NYZD 2TMPA 2MP1A 3DHQA 4NXNL 3GTKB 2M9VA 4IPCA 4B3MQ 3AU7A 4GN4B 3G4SB 1UWVA 3AFPA 5FA6A 3WBKA 1L0WA 1S0UA 2F4NA 1TWCB 4N3GA 4JC0A 1R4PB 2QKIC 1GVPA 1VQOA 4XKVA 4A3EG 1CA5A 1GHJA 1NMGA 3C1FA 1VQ5B 3EFXD 1XPOA 2MQHA 1H95A 4A3DB 1S3OA 4EQNA 1G2TA 5M3MH 1SMYD 1D1KA 4R8NA 5GAEC 1E64A 1XJVA 5JEAJ 3QR8A 2PQAA 1B53A 4JI4Q 2B2TC 5ELDA 3ASPA 4YHHL 3SK8A 1H8HA 2DY8A 3NWTA 4A4IA 1G7RA 4FF4A 1ENFA 1Y1VB 1KMHA 1CHPD 3U2QA 4B9XA 2WACA 4LF5L 2CKZB 4G57A 2NB0A 4RGNA 2GREA 5GROA 2QW7A 2QTZA 4POFA 2Q2IA 2F0FA 2F0DA 1OB2A 4IUPA 1E3PA 1PRTF 4XNFA 3BYYB 2DY7A 5IOCA 1VCIA 1F2YA 1ET9A 5ELNA 2EY2A 2ZTCA 4M8AA 5FNZA 1YEZA 4Y52H 1VQOB 3GTJB 1TWHB 5L37A 2KHJA 4HE6A 1GD7A 2IW3A 2WAQG 3DWQA 1HHVA 2A6EC 2JSOA 3ERSX 2FXQA 1EOVA 4BY7B 2MPMA 3L7ZC 1SM4A 2B63H 4DR6Q 1D2BA 1RODA 2PQAB 2PMDA 1LACA 1FNVA 3HOUG 1ICWA 2QDBA 3JQQA 1EQRA 3SHLA 4DV7L 3GQBA 3ES9A 2X3UA 1VQFA 2VB2X 4HR7B 4YIJA 3W2HA 1EWIA 3Q6SA 1NTGA 4P25A 3QJYA 3CW2C 2JXMB 2WPDA 4MHEA 3I4MB 3PGZA 2OBRA 5EMNA 3HOVH 4IW3B 3WNCA 1QB5D 3RZOB 1JNYA 3GTLB 4LBZA 1X65A 4X06A 4WZKA 4EH1A 4DKAC 4IURA 3CAMA 4C3IB 1HNXQ 1Z47A 1HRJA 1DJRD 2I07B 3CCUA 2LFNA 3PUWA 2KEDA 3AQQA 1GAQA 1YBYA 1S40A 2CWPA 4IJHA 1BCPD 1CQVA 4YALA 1PYBA 1OHHA 4JI3Q 2JE6I 3NP8A 4FF3A 1F2ZA 2LS01 3W2IA 1OGJA 2YTVA 2YV5A 4B3SQ 4YWKA 4HJ7A 4B3RQ 2BF4A 2ICEC 3D31A 5DS0A 4NXMQ 1X3QA 3DXJC 1OXTA 4H0LC 1SE8A
chains in the Genus database with same CATH topology
1YNND 4FXKC 3ERQA 4K6LA 5FL7A 1W0KA 2B2TA 5D3IB 1YNJD 3OMCA 4PMBA 2R3ZA 2RDGA 3SK5A 1SYBA 4UDUC 2KEEA 2F0WA 2Z6BD 1PZJD 4ZRZA 1PFBA 2X53S 1G8ZD 3MTSA 1IKLA 2D3LA 4NKLA 3PIP3 1EZ6A 2WKDA 2EYOA 4J8QA 3K7AB 2KCNA 1G2SA 2ZZQA 1LTBD 5IGFA 4B3FX 1HVXA 2SNMA 1V0FA 3GD7A 2J7ZA 2JP1A 3NUCA 3PO3B 1TY2A 3T51B 1E2VA 3S1NB 3WQZA 1CI3M 1OXVA 3AMUA 3LWEA 3CP2A 2EY6A 2NVQB 4CKBA 4C3HG 1SNCA 4QUFA 4QMGA 1QCBD 2FJ2A 1XYIA 5JPMC 1PDQA 2F1MA 4AVZA 2NZ1D 4HN7A 2OT2A 1I4RA 2PZWA 1DD2A 3SDZA 2Y0SB 4JMQA 4XKWA 4GZYC 3OAAA 1II3A 5G3LD 3SE0A 1RHPA 1ENAA 5E4WC 2FHTA 3FVQA 2V4DA 2B8GA 1RCVD 5JAVA 1JWMD 4IZ8A 1R4QB 2OF1A 3LWUA 1MSHA 1KNEA 3J80E 1W6JA 1KLUD 1G91A 2ZXRA 1DOKA 5M3MB 5KNBA 5FK9C 2LMCB 3NBIA 1GUOA 2JEAI 2L55A 2CK3A 4G7XA 3M7NA 1O7LA 4CGYB 3PUXA 4AYBB 1D5XC 1BUVT 3C2PA 3SK6A 1DOMA 2AWNA 2F0IA 2K04A 3IL8A 1JORA 2KJXA 1HA5A 1SAPA 3DEPA 4KHVA 1Y8NB 3D3RA 3VR5A 2ID0A 4C56C 4XOPA 5BN4A 1EY0A 1A2UA 5DEHA 2F03A 5EPLA 4R8IA 3OEHA 2CW0C 1B1ZA 1LT3D 3HZXA 5DAUA 4XYOA 5HGTA 4NNJA 4DAYA 5C0XI 5KYLA 2TSSA 4G7ZC 5LL6X 1QILA 2A69D 2XSCA 1PTOC 2HQEA 2KVOA 4EQOA 2BE5D 3I72A 2HUGA 1GXDC 2PW7A 4FP5D 1TKWB 4F87A 4IN3A 2QILA 1A2TA 1QOHA 1LTID 1O78A 4OL7A 3U9OA 2R9VA 1Z7TA 3GVKA 1QE6A 2XRQD 5CYUA 3TBIB 2D3NA 1M8AA 4KN7C 1ILPA 2KQ3A 1DM0B 2K03A 1CQFA 3NK9A 4WFN3 3G6JB 1D5MC 1ILQA 4WJWA 1Q8IA 2O2LD 3V2TA 2PNRC 2E74C 4BA1I 1K83B 1JQYD 1UD4A 4BBRB 2X6LA 3S9WA 3GVJA 2H4OA 4XN3A 3CU7A 4A3GB 1STYA 4RWSC 2A6ED 3W3AA 2B2UA 1LT6D 2PPBC 2XRSD 2LKVA 3BYTB 3KUPA 1V1PA 3BVMA 2R61A 2ZT9C 4RCOA 2RSNA 3IFTA 4QB4A 2ZXIA 1STNA 5KNDA 2F0UA 3OWFA 1EYCA 3K6OA 4P2CB 4CJ1B 3GTPB 1B50A 5DNFA 1TY0A 2GJPA 2ZZGA 3D4WA 1I3QB 2KHSA 2EJMA 3CESA 4G7WA 1PMRA 1SNQA 1EYDA 4G6IA 5JOBA 2XVSA 4EQPA 3T53B 3BDCA 4QIWB 2D62A 2V31A 1V1PB 3DM1A 3NWSA 5A2QE 4IFDI 1XWEA 4A3EB 5D14A 1GUSA 3UI2A 2IX1A 1STGA 1H8EA 4ILWA 3JU4A 1S5CD 4FO2A 1EFRA 3N6RA 4XLFA 2JYOA 1JOKA 1UD8A 1U4RA 1S4ZA 3J81L 5DM73 1BPLA 1EOTA 2WAQB 4G7OC 4LK1C 2AQ1B 1HFNA 1JOQA 1BCPF 4KV6A 4EVOA 4OO1I 2EJGC 1IW7C 1I4XA 3HOUB 1ESRA 2F3VA 3J7AF 4XDXA 3DMUA 4RGOS 3S14B 1B2TA 2K05A 3T13A 2F0JA 1WTXA 2F0HA 1QNUA 1F2LA 1SSOA 4V0BA 1W9XA 1I4QA 4IUUA 4ZLTF 2SNSA 1B9MA 5IODA 3D4DA 4CJ2C 2WIIB 3A54A 1KNAA 4RA8A 1A3UA 3OE7A 1EU3A 5FOBB 3E0JA 2GK6A 2C5CA 3M7GA 2XOKA 2LZJA 2MGSA 4DA2A 3Q23A 1TT2A 4ZUJA 2EYFA 4CJ0B 1TIID 4PV1C 4OIJA 3T16A 2G9HD 5HKKA 1Y8PB 3E5SA 2X6GA 4UZUA 3V05A 3GV3A 3HOXB 2IPKD 1K8OA 2K5WA 5IT9L 3P7JA 4DXGA 2B2YC 4HMIA 5FO9B 1OB0A 3D8GA 4FF2A 2JJ1A 1FGBD 1A3VA 4IUQA 3VYTA 2GK7A 1L0XB 1H9MA 2K7VA 2A6HD 1VMCA 1PZID 5C4JB 1SNOA 2YYZA 3R2IA 2NTSA 2BOSA 3U9SA 5C6AA 3CHBD 1BR9A 1EQVA 1TS2A 2M5SA 5ELCA 1WTPA 5JVH3 1I18A 4C2MB 1H9KA 4XTCS 2PMZB 4V190 5M5YB 1S5BD 2CHBD 2JEBI 1JWSD 4IUTA 1EY8A 2KOLA 4E6IA 3S2DB 1S5DD 1NUCA 4WRDA 1RDPD 1SE4A 3GTQB 2F0QA 4K6DA 5IGCA 4C3HB 4DNTB 4A3MB 4DAVA 1DONA 2W6JA 1MGSA 4O1NA 1FD7D 5EBDA 2E2IB 4TT3A 2MUYA 3J7YW 4HCEA 1MBYA 2YU9B 1I50B 1O7ZA 2L5TA 4DF7A 3I8ZA 2NN6G 1A3TA 3SR1A 2VB3X 3JAML 1STBA 5IGEA 3RLFA 4JBWA 2M2LA 4RKLA 4KHZA 4RHRA 4XOTA 5CDFA 2BA1A 5TSSA 1LTRD 3NTIA 4CHTB 4CKCA 4N9PA 3BDLA 1T5EA 3IKJA 3J7AV 1MSGA 2L0CA 1IKMA 2X6WA 2MHVA 3A7AB 5K5PA 1BMFA 4X3TA 1WTQA 4GQNA 4DGZA 3EROA 3C1EA 2XNAC 2X85A 3KEWA 1BNZA 1WTOA 4K14A 4YEJA 3GTMB 1CTMA 3MZ5A 4X3KA 5T1GA 2X69A 3QO2A 1MD2D 3HS0C 2F0MA 4P22A 3GP7A 5D3DA 5BN5A 4B9WA 2RBMA 5I6YA 5EPJA 4XT3B 1J8IA 2WSSA 1F9QA 4DK1A 4C1NK 4XLAA 5C0XH 4L8JA 2O4XA 1ONLA 4RAUC 2JA7B 3HG9A 5CMDA 1O7YA 1LTGD 5J22A 3MVVA 3MXUA 3PO2B 1TVXA 2HLDA 4RGMA 1ZYRD 1B4OA 1WTRA 4Z1MA 3CRLC 1CZWA 4II2A 5J39A 3DUZA 4IUNA 4N9TA 1WTWA 2HCCA 5EQ0A 3EVQA 1JE4A 1SE3A 3K58A 4A3BB 2JDIA 1QG7A 2K1BA 3MFGA 4TQUS 2QF7A 2Z4HA 4II3A 1FYCA 5K36G 3VA7A 4A3IB 4HAEA 1KABA 3HP3A 1OO9B 3TP7A 1EY5A 4ULLA 1PLFA 2K6AA 3NXWA 1VMPA 3NTKA 4S3SA 1CM9A 4NP5A 4PMWA 1RF2D 3L3OC 5FLXE 2Q8RE 1DZ1A 3MXNA 3R3OA 4HMJA 1CK1A 1JOOA 1I6VC 4E0FA 4ASUA 1H9JA 3OWEB 1UNSA 1AN8A 1PTOH 1AEXA 1SDFA 3RUZA 2F0VA 5C4XB 2GJKA 1NR2A 4DN4M 5EPKA 2A68C 3X3MA 2L9HA 1M4VA 4DAPA 2WV6D 4LJZC 5KIXA 1JC7A 1C48A 2Q8IB 2PZUA 2O5IC 2EYJA 5T1IA 4HCSA 2J4XA 1RTOA 3A8KE 1IW7D 2QEJC 1RKNA 4FF1A 3I91A 4XXEA 1NSNS 1UAPA 2NN6H 2KA7A 3I90A 3GO5A 1E1QA 3L9AX 4ME5A 1SMYC 4F88A 2C9OA 1SYFA 3OEEA 3OIQA 1WVLA 2XNDA 1SNDA 3VYRA 2B63B 1LTTD 1WD0A 2XZLA 2QCPX 4I65A 5AFWA 2VUMB 4YELA 4TSSA 1EYAA 4I7ZC 3S17B 1TWAB 4NW2A 2A73B 3S16B 4DK0A 2B39A 3HOVB 2GA4B 4X3SA 5C3EB 2D2CC 3TP8A 2FFKB 5C44B 4QF4A 3KLSX 4OHJA 1EWHA 2K33A 4RKBA 1KTKA 3PUYA 3BDOA 2NVYB 2W6IA 2ZZEA 1CT1D 5JPNC 4NMZA 2ZXHA 4ZAIA 4G4KA 4RCNA 1U9RA 5CV5A 3R8BA 3VR3A 3QB3A 1ET6A 3A56A 3J80L 3O13A 3IAYA 3FKIB 5I4DA 1C4QA 3FMCA 1TS5A 2K5DA 3AB9A 2L12A 2RSOA 3DDYA 3VA5A 3TP5A 3P75A 5CGKA 2R93B 3BC9A 1VF7A 1BCPC 3H91A 1UD3A 1LT5D 1EU4A 2ZTGA 3OOCA 3HAGA 1HXYD 2B2VC 2EY5A 1SKYB 1D6EC 3M4YA 2B8FA 3H6MA 4A3FB 1TR5A 1YNJC 1STHA 2NTTA 3HEJA 3NBHA 5K36H 3M3YB 3MEHA 1SFOB 1DYQA 1I4GA 4LMQD 4KN4C 5M5XB 3BS1A 2XWJB 5CV9A 1HPCA 1I6HB 3GTOB 2R7ZB 4YXWA 2ICIA 3ND8A 3BH4A 2SDFA 5COYA 3ZIAA 1WPCA 4Q0FA 4IQZA 1CZGA 3P1HA 2AUKA 3EQLC 4KI0A 3OPOA 3I73A 3OW7A 5M3FB 3S1MB 2Z8LA 3KLSA 1STEA 4OIKA 4A3KB 4XLEA 1WCMB 3CP8A 3I70A 1U4MA 1UUPA 3G7LA 3D6CA 5M5WB 2F0EA 1AW7A 1J9OA 4UAIA 2V7QA 3PMFA 1B3AA 1PTOB 1D5ZC 3OIPA 5EKKA 4K8JA 3TDQA 4B08A 2IX3A 1A6XA 2JIZA 4DNRB 5CBAE 3LX0A 4RGTA 4ZKBB 2F0GA 3A7LA 1PZKD 1VDZA 1Y1WB 2ZXOA 4KY5A 3A3GA 4BY1B 3HOZB 1JWUD 3K57A 4XR6A 4RH6A 1PRTC 3K5OA 2F0PA 5IK2A 4K8IA 1HFGA 1EFID 3VR4A 1VF5C 2FINB 1IYVA 1TWGB 1I8DA 1W6KA 2VJIA 2KUMA 2E2JB 2H1EA 1UD5A 5C0XG 1GHKA 2IX0A 2X6YA 2EJFC 4G7HC 1SNMA 4PMCA 1GUTA 2KCCA 5KEEA 4XM3A 4B3GA 1JICA 1R9TB 5I9PA 1SBBB 3MFYA 1HQMC 5E3FA 1G6ZA 5D65A 1WTHD 3I4LA 5KRUA 2WJVA 2CVRA 3KLRA 1SYCA 2E1BA 4C3JG 4FXGC 5A2QL 3QG1A 5C3WA 1XX8A 3HOWB 4KKUA 5I2YA 1QWYA 1FNWA 2RVLA 4BBSB 3G05A 3ITPA 4KJOA 2PZTA 2M00A 5F2DA 1EEID 1SYDA 3QOJA 1OXUA 3QWNA 1HUNA 1DOLA 3WOEA 5IGGA 1KZLA 2A68D 3KBXA 4X3UA 5FKAC 2SEBD 1E1RA 1UEAB 2F0LA 1NCVA 3MA2B 1HA6A 4DU9A 5E1FA 2WZPP 1E0BA 2NBFA 1WD1A 1I4HA 3FDTA 3NPPA 1SEBD 5CV7A 4F7XA 5C4ZA 2KECA 4DFAA 2ZXPA 3P20A 1AP0A 3QIAA 5FO8B 1Z6HA 5C3XA 5JEAH 1Q1EA 2AQ3B 4ZUIA 3K5LA 2DNEA 1RTNA 2RDFA 1F77A 5G3LF 2XZPA 3MAQA 4MN3A 5CV6A 1PRTB 1BBXC 3K5NA 1EIHA 5C4HA 4XYQA 4KY7A 3A3BA 4XN0A 4JK1C 2B2WC 3VR2A 2XZOA 4RHSA 2CW0D 4K2KA 3E6ZX 1LT4D 3W2DA 3TSSA 4IFDG 5E4XA 2WJYA 2NVXB 1E2WA 2EXZA 1KAAA 1V0EA 4A3JB 1PTOD 2IT1A 5DN6A 2MJ8A 5ELFA 2B2YA 1K8MA 2F0SA 3NSWA 2SOBA 3S15B 3S1RB 2D5DA 1DXMA 1PKVA 4WORA 2R92B 1TS4A 2XWBB 3ND9A 1LV9A 2PYKA 1T5XD 2DNCA 1HCZA 5HURA 1EY7A 2NUCA 3BVZA 4K5VA 5KNCA 1JCKB 2DIEA 1H9RA 5EBCA 4HEDA 3NTHA 1ML0D 1PFMA 3DWPA 2G9DA 2F0TA 3MXPA 4XL9A 3HRZC 3D6WA 4OO1G 1JR0D 1BXTA 2ZTNA 4Y7NB 5NUCA 4LAAA 5ISRA 2F0NA 4FYDA 1Q3LA 2R6GA 2VJJA 1BOSA 3SEBA 3SVMA 4HSVA 4CBVA 1E2ZA 1ZEQX 3VYUA 5EKLA 3F2UA 1FX0A 2X6XA 1HZEA 4XQNA 2B2WA 2L4NA 1FR3A 3T4AC 1BQQT 1SYGA 3VYSA 2EDGA 1AZQA 2WP8J 5C0XJ 2HCIA 2JA5B 5KNLA 3RMHA 1HTPA 1SXTA 1COWA 2K5QA 1TQOA 2E75C 2LY7A 1S5ED 4CKEA 5EKIA 1GOZA 3EJIA 3S1QB 1UD6A 3TN2A 1DCZA 3TMEA 3H94A 2X8KA 3SXHA 1F9PA 2GJRA 2JJ2A 1JB3A 3EA6A 3MHBA 2E2HB 4FNFA 3R2TA 5KGUA 1EEFD 4PQXA 3FKSA 3NQTA 3KF8A 1HQRD 4KY6A 2FMCA 3FPUB 5EJWA 3SK4A 1EL0A 3V96A 5ELEA 2JA6B 5JVG3 1AFPA 5M9OA 3MC0B 2VXWA 2EY1A 1F9RA 5ELBA 4XLCA 1SJED 1ENCA 4XMYA 3HGBA 3OHXC 4QCLA 1LO5D 5IIFA 1HUMA 1C8CA 5I2XA 1XTCD 4TRDA 4L6TB 1LLRD 2AWOA 3OMGA 3FRPB 4HTHA 2N55A 3X3NA 5CC4A 3BVGA 4BA2I 4XLHA 5KYIA 2OXPA 3VR6A 1PRTD 1TS3A 3QOLA 4ODGA 3A8IE 3C46A 4C3IG 3Q0AA 3K5MA 4XQJA 1H9SA 1K28D 3IFDA 2PO4A 3ONAB 1XXGA 3M4OB 2IWHA 3ZYYX 1IL8A 1OXXK 1KDAA 2BDOA 2RA4A 2A74C 5A35A 3DEOA 3KBGA 2E76C 1F2MA 4U68A 2A6HC 2RQXA 2JA8B 4IFDH 1D1IA 4F8MA 2XN9C 2WINB 1VJSA 3A8JE 1HTLD 2Z1CA 3PUZA 3T56B 4IALA 1V1OA 3I4NB 2L11A 1SNPA 1EQTA 2NWGA 3TP6A 1H9SB 1RJTA 4IFDJ 4ZQ3A 5CV8A 4RFBA 4KKTA 5IGBA 3URYA 3R93A 1EY4A 2PQEA 3WDNA 2BCOA 1ESFA 3PIO3 2IJ0A 4KTAA 1BF4A 3GVLA 5FLXL 1EWCA 2EVBA 4O42A 2J0TD 1ZXTA 1CHQD 2EZVA 1X3PA 1SE2A 4A93B 1IHZA 4U673 1E43A 1A15A 1TU2B 2BA0A 2B2UC 4KD4A 1F9SA 1STAA 1OXSC 2EYMA 4FXUA 1FNUA 2VNUD 4OO1H 4QUCA 1BDOA 5C5MA 1PYWD 4ZYSA 1U4PA 3CKIB 4K5WA 1KDBA 4XT1B 4Q5VA 3DWAA 2DN8A 2K28A 4H7BA 3RD4A 4MIUA 4KJNA 4C1NI 1Y8OB 3N52A 5LHY1 1QJOA 1X32A 4DXFA 2WKCA 4ID6A 3KK7A 4KD3A 4K5XA 2I46A 5EGTA 2EYHA 3H3VC 2HDLA 2F0KA 5LL6S 3BCFA 2EYPA 5IGDA 2FMMA 2E2DC 2N88A 1YNNC 1GUNA 5I6WA 3WOFA 2QE7A 2NVTB 3H0GB 4FXDA 1B44D 3S2HB 4XD7A 1NR4A 5JEAG 5DM63 3J81E 3BG3A 1Q12A 3FEWX 4BWGB 4J6HA 3Q24A 4C3JB 4XORA 3FPPA 3HOYB 1L0YB 4XQFA 3PUVA 1TWFB 1G291 2K01A 2CQAA 4TSFA 5CR3A 5CBEE 1ZYRC 3GV6A 1Y69U 2AQ2B 1KDCA 4NDXA 1LABA 4XQQA 1W0JA 3BZDB 4BS9A 3OFNA 3BCDA 1MI2A 1CA6A 2XGJA 1MABA 2Z4IA 2AUJD 2EE1A 3M85A 1Q1BA 4ABNA 2F4IA 4IUVA 2OEOA 5FO7B 1QNKA 4Z9CB 4R9WA 1UD2A 4ZK9B 2B2VA 5C5LA 3K59A 3PV0A 2KVMA 2NN6I 3TZUA 4EGVA 4XIGS 1AZPA 3LNNA 1PTOF 5IT9E 1EZ8A 5CORA 4XONA 2XIWA 4K2LA 2IL8A 3GTGB 1V43A 5CV4A 4OGQC 3K0YA 3MWYW 2RDHA 4M1UB 3CMMA 4H13C 2Q8TA 1GJXA 3CQZB 5J1ZA 2F3WA 4KK7A 5JJZA 2ZZFA 2O5JC 1BCPB 1NAPA 1LTSD 3C3LA 1EY9A 1S5FD 1BLIA 3Q22A 4HIZA 3MXGA 1O80A 2BDNA 1SJHD 1GUGA 1KLGD 2PW5A 1EIGA 4KKSA 1V8QA 4J1MA 2F0OA 1WP6A 3NE5B 1IYUA 3NQIA 4HSPA 3NHHA 2EYLA 1B9NA 1ZKOA 1E79A 3ZPNA 2WB1B 3RZDB 4PNYA 3CRKC 2ENBA 1WTVA 2HDMA 1LTAD 1NRKA 4FVMA 4H44C 2F43A 2PCFB 2K32A 1PFNA 1NBMA 2EOTA 4TKOB 1E3XA 1PXUA 3OSOA 3A55A 3D4RA 1BO0A 1SYEA 1CFMA 2A5HA 3JAME 2D9UA 2L1BA 1RD9D 1GUWA 2EPBA 3I3CA 5BN3A 1VLYA 4L63B 2RKSA 1I4PA 4KMUC 2A69C 4ZKCB 1EY6A 5I9OA 1U4LA 2BE5C 3A35A 1E3ZA 3TZDA 3H09A 3HKZB 1Q90A 2NYZD 2TMPA 2MP1A 3DHQA 3GTKB 2M9VA 3AU7A 1TWCB 1R4PB 2QKIC 4XKVA 1CA5A 1GHJA 3C1FA 3EFXD 4A3DB 4EQNA 1G2TA 1SMYD 1D1KA 4R8NA 5JEAJ 1B53A 2B2TC 5ELDA 3SK8A 1H8HA 2DY8A 3NWTA 4FF4A 1ENFA 1Y1VB 1KMHA 1CHPD 4B9XA 2WACA 4G57A 2NB0A 4RGNA 2F0FA 2F0DA 4IUPA 1PRTF 4XNFA 3BYYB 2DY7A 5IOCA 1VCIA 1F2YA 1ET9A 2EY2A 4M8AA 3GTJB 1TWHB 2IW3A 3DWQA 1HHVA 2A6EC 2JSOA 4BY7B 2MPMA 3L7ZC 1D2BA 1RODA 1LACA 1FNVA 1ICWA 2QDBA 3SHLA 3GQBA 4HR7B 2VB2X 4YIJA 3Q6SA 3QJYA 2JXMB 2WPDA 4MHEA 3I4MB 1QB5D 3RZOB 3GTLB 4IURA 4C3IB 1Z47A 1HRJA 1DJRD 2I07B 2LFNA 3PUWA 2KEDA 1BCPD 1CQVA 1OHHA 2JE6I 3NP8A 4FF3A 1F2ZA 2LS01 2ICEC 3D31A 1X3QA 3DXJC 1OXTA 4H0LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O5J C;  4DK0 A;  1GUT A;  2V4D A;  2BA1 A;  2KCC A;  2B8G A;  4IFD H;  2AUK A;  3A8J E;  3EQL C;  1K8O A;  4KI0 A;  3OPO A;  3PUZ A;  1T5E A;  3MFY A;  1GHJ A;  1GUS A;  3T56 B;  1HQM C;  1O78 A;  1DCZ A;  3IKJ A;  3LWU A;  3I73 A;  3H94 A;  3OW7 A;  2D2C C;  4IFD G;  3A7A B;  5JEA G;  1Z7T A;  1H9S B;  3BG3 A;  3I4L A;  1EWH A;  1Q12 A;  1E2W A;  2K33 A;  4KKT A;  4KN7 C;  1GUG A;  3KLR A;  3PUY A;  4KKS A;  1V8Q A;  2IT1 A;  1I6V C;  5KNB A;  3BDO A;  3N6R A;  3NE5 B;  2LMC B;  3WDN A;  3FPP A;  1H9M A;  1IYU A;  1K8M A;  3QG1 A;  2K7V A;  1H9J A;  3PUV A;  2A6H D;  4KKU A;  1G29 1;  2D5D A;  1DXM A;  1GUO A;  1B9N A;  1ZKO A;  2EVB A;  4RCN A;  2PNR C;  2JEA I;  2E74 C;  1CTM A;  3VR3 A;  3M7N A;  1O7L A;  3PUX A;  2YYZ A;  4BA1 I;  1ZYR C;  1VCI A;  3ND9 A;  1Y69 U;  2A68 C;  3U9S A;  3FMC A;  1OXU A;  1TU2 B;  5BN5 A;  3CRK C;  2BA0 A;  4LJZ C;  2DNC A;  1LAB A;  1HCZ A;  2A68 D;  1H9K A;  4G7O C;  3AB9 A;  3GD7 A;  4LK1 C;  1OXS C;  2Q8I B;  5KNC A;  4XTC S;  2O5I C;  2A6E C;  4OO1 H;  1A6X A;  1BDO A;  4DNR B;  4DK1 A;  4H44 C;  1H9R A;  2PCF B;  2EJG C;  3T51 B;  1IW7 C;  2K32 A;  1VF7 A;  4L8J A;  2A6E D;  1ONL A;  3HGB A;  3L7Z C;  3W3A A;  5C0X H;  2JEB I;  1LAC A;  3A7L A;  1E2V A;  3OOC A;  1Y8N B;  2DN8 A;  1CI3 M;  2PPB C;  3A8K E;  1IW7 D;  1OXV A;  1VDZ A;  2AWO A;  3VR5 A;  4OO1 G;  4TKO B;  2AUJ D;  3GQB A;  4HR7 B;  3M85 A;  2ZT9 C;  1Y8O B;  5BN4 A;  3D4R A;  3MXU A;  4BA2 I;  1Q1B A;  3QJY A;  2JXM B;  3IFT A;  4DNT B;  3M4Y A;  2B8F A;  2R6G A;  1CFM A;  1QJO A;  1B9M A;  2CW0 C;  5KND A;  3CRL C;  3VR6 A;  3P20 A;  5BN3 A;  1E2Z A;  3QIA A;  3A8I E;  1YNJ C;  1Z6H A;  2KA7 A;  2NN6 H;  3VR4 A;  5JEA H;  5K36 H;  1VF5 C;  1Q1E A;  1H9S A;  3PV0 A;  2NN6 I;  4KMU C;  2A69 C;  2F1M A;  2DNE A;  3PUW A;  3TZU A;  1IYV A;  2EJM A;  2L5T A;  1SMY C;  4KN4 C;  4XIG S;  4G7Z C;  1PMR A;  3LNN A;  4TQU S;  2QF7 A;  2A69 D;  1DD2 A;  2BE5 C;  3SDZ A;  1FYC A;  2NN6 G;  1FR3 A;  5K36 G;  3VA7 A;  1HPC A;  2JE6 I;  5C0X G;  1GHK A;  1V43 A;  4GZY C;  3T53 B;  1OXX K;  2BDO A;  1Q90 A;  2EJF C;  2EDG A;  2BE5 D;  4OGQ C;  5A35 A;  2D62 A;  3I72 A;  4G7H C;  3ND8 A;  2E76 C;  4PV1 C;  3RLF A;  4JBW A;  1YNN C;  3SE0 A;  1HTP A;  2A6H C;  3D31 A;  4H13 C;  4I7Z C;  1TKW B;  1Y8P B;  3DXJ C;  4KHZ A;  1GJX A;  4JK1 C;  1OXT A;  4IQZ A;  4H0L C;  3VR2 A;  1GUN A;  2E75 C; 
#chains in the Genus database with same CATH topology
 1YNN D;  3KLW A;  4Z4T A;  1JMC A;  2K75 A;  3FKI H;  4FXK C;  5IYB H;  3ERQ A;  2V7X A;  3HOX G;  4K6L A;  5FL7 A;  1W0K A;  4LF7 L;  2B2T A;  2RHQ B;  5D3I B;  3WXM A;  4DV5 L;  1YNJ D;  4YAF A;  2Q2T A;  4JYA L;  3OMC A;  3J81 c;  5B6I A;  4PMB A;  4RPB A;  2R3Z A;  2RDG A;  1QFJ A;  3SK5 A;  4RCY A;  1SYB A;  1MHW C;  3CCU B;  4UDU C;  2BSA A;  2KEE A;  2F0W A;  2PLF A;  2Z6B D;  1Q86 C;  1D8T A;  1PZJ D;  2VBV A;  4POG A;  4B44 A;  4ZRZ A;  1PFB A;  2ZBU A;  2X53 S;  4QIW E;  1YHA A;  1G8Z D;  5EAY A;  3MTS A;  1N9W A;  1K83 H;  1IKL A;  1AE3 A;  1YNX A;  2D3L A;  1HZ9 A;  2HMA A;  4FWT A;  4ALP A;  4NKL A;  4MTN A;  4TMW A;  1EZ6 A;  2WKD A;  4APV A;  3PIP 3;  2EYO A;  4J8Q A;  3K7A B;  2KCN A;  1G2S A;  2ZZQ A;  1LTB D;  5IGF A;  4BBR H;  3R6J A;  4B3F X;  5TR9 A;  1K8G A;  1HVX A;  2SNM A;  4A3G H;  1V0F A;  1EXM A;  5A8A A;  3GD7 A;  2J7Z A;  2OTJ A;  2JP1 A;  3NUC A;  4DUZ L;  3NEN A;  3PO3 B;  3T1H Q;  1TY2 A;  3L2P A;  3T51 B;  1JJ2 A;  1E2V A;  3S1N B;  3STB D;  3WQZ A;  1CI3 M;  1XTD A;  1OXV A;  5FO1 A;  3AMU A;  4EQ5 A;  4CDE C;  3LVB A;  3LWE A;  3CP2 A;  4LF8 L;  2EY6 A;  1CUK A;  4LW1 A;  4CDF C;  3GTP H;  2NVQ B;  4CKB A;  4C3H G;  2UXB L;  3UE0 A;  4A3M G;  1SNC A;  4QUF A;  4QMG A;  1I3Q H;  1EP2 B;  2DYI A;  1QCB D;  4X66 Q;  2FJ2 A;  2DEU A;  1XYI A;  2JK8 A;  3GDE A;  4JCV E;  5JPM C;  2WAQ E;  4JG2 A;  1PDQ A;  2F1M A;  5IT9 c;  4JBM A;  3WNB A;  4AVZ A;  2NZ1 D;  4HN7 A;  2OTJ B;  2OT2 A;  1I4R A;  2PZW A;  1EFU A;  1DD2 A;  1ZUN B;  3S24 A;  1VQL A;  3SDZ A;  2Y0S B;  4JMQ A;  4ZCI A;  1N8R D;  1JJ2 B;  4XKW A;  4GZY C;  3OAA A;  4KHP L;  4WZT A;  1JT8 A;  1II3 A;  1YI2 A;  4A76 A;  5G3L D;  1L1O A;  4OX9 L;  4GN5 A;  3SE0 A;  1RHP A;  1ENA A;  4A3E H;  4RD1 A;  5E4W C;  3R6K A;  2FHT A;  3FVQ A;  1NB0 A;  1B23 P;  2V4D A;  4DR2 Q;  5J3O A;  2B8G A;  1NDH A;  1RCV D;  5JAV A;  1JWM D;  4WZE A;  4IZ8 A;  1R4Q B;  2OF1 A;  1KD1 D;  3OZU A;  3LWU A;  5BR8 L;  1MSH A;  1HZA A;  5IYC H;  4NBS A;  1KNE A;  3J80 E;  4YY3 Q;  1KTV A;  1F20 A;  1W6J A;  3TRZ A;  1KLU D;  2OK8 A;  1G91 A;  2ZXR A;  1DOK A;  3H3V H;  1VQL B;  4DR7 L;  5M3M B;  5KNB A;  5FK9 C;  1I5F A;  1Y1W H;  2LMC B;  3NBI A;  3OW2 A;  1R5O A;  5F4J A;  1M1K C;  3ER0 A;  4RLZ A;  3KJP A;  1WU8 A;  2JA9 A;  2B3G A;  2BVN A;  1YI2 B;  2UXD L;  1GUO A;  1L1O B;  2CH4 A;  1YJW A;  2JEA I;  2L55 A;  2CK3 A;  4G7X A;  5AJ3 L;  3M7N A;  1O7L A;  4CGY B;  3PUX A;  4AYB B;  4A3C G;  1B2R A;  1D5X C;  1BUV T;  1PH6 A;  2MO1 A;  2PNH A;  3C2P A;  3HOU H;  1SLJ A;  3SK6 A;  1TWG H;  4B48 A;  3S14 H;  1DOM A;  3G6E A;  3HKZ E;  2AWN A;  2N78 A;  2F0I A;  2K04 A;  5HY6 A;  3IL8 A;  1JOR A;  1O7I A;  2KJX A;  1U2R A;  3JQR A;  1HA5 A;  1SAP A;  3DEP A;  4KHV A;  1Y8N B;  3D3R A;  3VR5 A;  1K9M C;  2ID0 A;  4C56 C;  4LNQ A;  2C35 B;  2JA7 G;  3W5O A;  3OW2 B;  1IBM Q;  1FRQ A;  4XOP A;  5BN4 A;  1EY0 A;  2ATW A;  1A2U A;  4JW0 A;  5DEH A;  2F03 A;  3PIO A;  5EPL A;  3PO2 G;  1JJG A;  1YJW B;  4Z4W A;  4LBY A;  1V1Q A;  4R8I A;  1X55 A;  3OEH A;  2CW0 C;  2YWG A;  2OYN A;  1B1Z A;  1LT3 D;  3HZX A;  5DAU A;  4XYO A;  2Q2U A;  1T6Y A;  5HGT A;  1IBL L;  5FO0 A;  4P6Y A;  4NNJ A;  1G7S A;  4DAY A;  5L46 A;  5C0X I;  5KYL A;  4A3B G;  2TSS A;  1N32 Q;  4G7Z C;  4FK8 A;  4DV1 L;  5LL6 X;  2C78 A;  3G6E B;  1QIL A;  2A69 D;  2XSC A;  1HNW L;  5IWA L;  4JI2 L;  1PTO C;  2HQE A;  4A3I G;  2KVO A;  3AGQ A;  3MMP A;  4EQO A;  4JV5 L;  2BE5 D;  3I72 A;  1PH7 A;  2HUG A;  3HOX H;  1BKB A;  1GXD C;  3QFR A;  2PW7 A;  4FP5 D;  1TKW B;  4F87 A;  4L5S A;  2UXC L;  4IN3 A;  2QIL A;  1Q82 C;  1A2T A;  2K5N A;  2VNU D;  3SJZ A;  1XQB A;  2V1C C;  2K50 A;  1U5K A;  3AVY A;  1QOH A;  1WOC A;  1LTI D;  1O78 A;  4JI7 L;  4OL7 A;  3U9O A;  2OBT A;  4DV3 L;  2DCU A;  4LBW A;  2R9V A;  1Z7T A;  3GVK A;  1QE6 A;  2XRQ D;  5CYU A;  3TBI B;  3PUN A;  1N36 Q;  2D3N A;  3CCR A;  4DAY B;  1M8A A;  2DY1 A;  1BBU A;  2NZH A;  4KN7 C;  1ILP A;  3DLL A;  2KQ3 A;  1DM0 B;  2K03 A;  2HQL A;  3MEF A;  1CQF A;  5C4J H;  3CCQ A;  3KDF A;  3NK9 A;  4WFN 3;  3G6J B;  2C2W A;  1D5M C;  1ILQ A;  4WJW A;  1Q8I A;  4I7A A;  2O2L D;  4L5Q A;  3V2T A;  1JB9 A;  4IJL A;  1W35 A;  1UEB A;  4M0L A;  2PNR C;  1KC8 C;  2BGI A;  2E74 C;  5C4X G;  1SMX A;  4YCW A;  4C2M H;  4BPR A;  1K83 B;  4BA1 I;  1JQY D;  1TXY A;  2Q6O A;  1J5E Q;  4TMZ A;  1TVC A;  5FJ8 G;  5M5Y H;  4B3T L;  4DR1 L;  1UD4 A;  4BBR B;  2X6L A;  3S9W A;  3GVJ A;  4DR5 Q;  2A19 A;  4Y9R A;  2H4O A;  3TS2 A;  4XN3 A;  3S2D H;  1T6Z A;  3CU7 A;  4A3G B;  1STY A;  3CCR B;  4RWS C;  2A6E D;  3W3A A;  3GTQ H;  2B2U A;  1GAW A;  1LT6 D;  2PPB C;  2XRS D;  1VQP A;  4A3M H;  1EFW A;  1GO3 E;  2DJF C;  3CPW A;  2LKV A;  3CCQ B;  3BYT B;  5H1S E;  3KUP A;  1V1P A;  1KRT A;  1QUE A;  1NMF A;  3BVM A;  2R61 A;  2ZT9 C;  3KDF B;  4RCO A;  2A8V A;  2RSN A;  2Z9H A;  3H9N A;  3OZV A;  3IFT A;  4CQJ A;  2RF4 A;  1JA1 A;  4QB4 A;  3ZJY C;  2E2I H;  1IYJ B;  3W2E A;  1AE2 A;  2ZXI A;  4YHH Q;  1K73 C;  3PVD A;  1STN A;  1B3Q A;  5KND A;  2F0U A;  1I50 H;  3OWF A;  2YU9 H;  1EYC A;  1MKH A;  3K6O A;  4P2C B;  4CJ1 B;  3GTP B;  1B50 A;  5DNF A;  1TY0 A;  2GJP A;  2H5X A;  1LYL A;  4ZGQ B;  2ZZG A;  3D4W A;  1I3Q B;  2KHS A;  2EJM A;  1VQN A;  3CES A;  4G7W A;  1PMR A;  1SNQ A;  2E5L Q;  2HCJ B;  2C4T A;  3VO1 A;  1EYD A;  4G6I A;  3H15 A;  5JOB A;  2XVS A;  5LMN L;  4EQP A;  2UUC L;  2V7T A;  2B63 G;  3T53 B;  3BDC A;  4QIW B;  2D62 A;  1VQP B;  4OWT B;  4IPH A;  3CPW B;  3S1R H;  1AH9 A;  2V31 A;  3CC2 B;  2VUM G;  1V1P B;  2VY3 A;  2GVA A;  1G6P A;  4P6V F;  4AF6 A;  2R92 H;  2XTI A;  1SR3 A;  1XPR A;  2K52 A;  3DM1 A;  3NWS A;  5A2Q E;  4IFD I;  3HOV G;  1A8P A;  1XWE A;  4A3E B;  1D8L A;  5D14 A;  1GUS A;  1KJZ A;  1BX1 A;  5C3E G;  3UI2 A;  1I94 L;  2IX1 A;  1EP3 B;  3PA1 A;  1XNQ L;  1YVC A;  4HE5 A;  1STG A;  1H8E A;  5C44 G;  4ILW A;  3JU4 A;  1S5C D;  1VQN B;  1QVF A;  4FO2 A;  1EFR A;  3N6R A;  2ES2 A;  2E8G A;  1Q86 D;  3GTM H;  1EWY A;  4XLF A;  2JYO A;  4JI8 L;  3ICE A;  1S72 A;  1EIY B;  1QGY A;  4P1V A;  1QFY A;  1JOK A;  1UD8 A;  3BZK A;  1U4R A;  4GS3 A;  3UDG A;  1S4Z A;  4FN5 A;  3SLN A;  3A5Z B;  3J81 L;  5DM7 3;  1BPL A;  4ACB A;  3FKI G;  4RDL A;  1LTL A;  4HJA A;  2VNK A;  2EIF A;  1EOT A;  2WAQ B;  4CDC C;  4G7O C;  4LK1 C;  2AQ1 B;  4LFA L;  1HFN A;  1JOQ A;  1BCP F;  4IPD A;  4KV6 A;  4MZ9 A;  1XMO L;  2JA7 H;  3CXC A;  4EVO A;  4OO1 I;  2EJG C;  1IW7 C;  5THX A;  2R93 G;  1I4X A;  3HOU B;  4LF7 Q;  1QVF B;  1ESR A;  1HR0 Q;  2F3V A;  3J7A F;  4X64 L;  4XDX A;  3DMU A;  4RGO S;  3PO2 H;  3S14 B;  1B2T A;  2E1R A;  2JA5 H;  4M53 A;  2VQF Q;  1LM0 A;  2K05 A;  3T13 A;  2F0J A;  1WTX A;  2F0H A;  2IHF A;  1QNU A;  4TMX A;  4X65 L;  4YHB A;  1F2L A;  4LUZ A;  1SSO A;  4V0B A;  3J7Z C;  1W9X A;  1D2E A;  1I4Q A;  4IUU A;  4ZLT F;  2SNS A;  1B9M A;  2K14 A;  5IOD A;  3J81 i;  3D4D A;  4DV2 L;  1VQJ A;  4A3B H;  4CJ2 C;  3RNU A;  2WII B;  3A54 A;  4PGO A;  4A3F G;  1KNA A;  3AFQ A;  1A3U A;  3OE7 A;  1EU3 A;  4RA8 A;  2VW9 A;  5FOB B;  1WOP A;  1W34 A;  4A3I H;  3E0J A;  2GK6 A;  1E63 A;  2BM1 A;  2C5C A;  3D26 A;  3M7G A;  2XOK A;  2KBN A;  2ZJR A;  1Y0Y A;  2LZJ A;  3CXC B;  2MGS A;  4DA2 A;  3Q23 A;  3EBE A;  1TT2 A;  2N49 A;  1KK2 A;  4ZUJ A;  2VNJ A;  2EYF A;  2R7Z G;  4CJ0 B;  1TII D;  3W5H A;  1YIT A;  3J81 k;  4PV1 C;  4OIJ A;  3T16 A;  1PJ5 A;  2ZL5 A;  5HKK A;  2G9H D;  4DR3 L;  4DUY Q;  1Y8P B;  3E5S A;  2X6G A;  4UZU A;  1AIP A;  3GV3 A;  3V05 A;  2DER A;  3HOX B;  2XGT A;  2IPK D;  4RM0 A;  1K8O A;  2K5W A;  4K0K L;  5IT9 L;  3P7J A;  3RR5 A;  2CWA A;  4DXG A;  2B2Y C;  4HMI A;  2UUB Q;  5FO9 B;  5FLM G;  2V7W A;  5M3F G;  2UXB Q;  1OB0 A;  1R5N A;  3D8G A;  1ICF B;  4A3K G;  2JJ1 A;  2KHI A;  4FF2 A;  1XPU A;  4PG3 A;  2OQK A;  1FGB D;  1WCM G;  1KQS A;  5C4X H;  1A3V A;  4IUQ A;  3VYT A;  2GK7 A;  1L0X B;  3F2B A;  3ISX A;  3ZUG A;  1H9M A;  3WYA A;  1X6O A;  1KK1 A;  2K7V A;  5LMU L;  3G48 A;  2ZM6 L;  1PA6 A;  2A6H D;  5FJ8 H;  1YIT B;  1VMC A;  1PZI D;  2ZJP A;  5C4J B;  3K0X A;  1SNO A;  5IYN A;  3PSI A;  2Z0S A;  2YYZ A;  1BX0 A;  2I5L X;  4DV6 Q;  3R2I A;  1N0U A;  4HIK A;  2NTS A;  2BOS A;  3U9S A;  3VNV A;  5C6A A;  3CHB D;  3CB4 A;  1BR9 A;  4U9U A;  1EQV A;  1TS2 A;  4PZ7 A;  2M5S A;  5ELC A;  1WTP A;  5JVH 3;  1I18 A;  4C2M B;  1HNZ Q;  4X6A H;  1H9K A;  3P26 A;  4DV4 L;  3NEM A;  2CH4 W;  2QN6 A;  4XTC S;  2PMZ B;  4V19 0;  5M5Y B;  5IYC G;  3M4O H;  1S5B D;  2CHB D;  2QEX A;  1RQP A;  2WR8 A;  4X8I A;  2JEB I;  1QG0 A;  1JWS D;  3B82 A;  1N06 A;  1TUI A;  3E9I A;  4DQL A;  4IUT A;  1EY8 A;  2KOL A;  4E6I A;  3F2C A;  3S2D B;  1S5D D;  3E9H A;  1NUC A;  1Y1W G;  4WRD A;  2FVG A;  1RDP D;  4BY1 G;  1SE4 A;  3GTQ B;  3Q39 A;  3U50 C;  4UP7 A;  4HID A;  2F0Q A;  4K6D A;  5IGC A;  4C3H B;  4DNT B;  2NZO A;  4A3M B;  4DAV A;  1IL2 A;  1DON A;  2W6J A;  1MGS A;  4X62 Q;  3RN2 A;  1QH0 A;  2P5Z X;  4RDJ A;  3PQI A;  4O1N A;  1FD7 D;  4Y7C A;  5EBD A;  1PH3 A;  1KXL A;  5IYD G;  1GR1 A;  2E2I B;  1VQI A;  4TT3 A;  2MUY A;  3J7Y W;  1DDG A;  1MBY A;  4HCE A;  2YU9 B;  1I50 B;  4G1B A;  1O7Z A;  4RD2 A;  3W5V A;  2L5T A;  2ZTE A;  1C7Y A;  1NJI C;  1PH4 A;  4PC7 A;  2L15 A;  3VNU A;  4DF7 A;  2VUM H;  3I8Z A;  2NN6 G;  2QEX B;  1A3T A;  3TS0 A;  3SR1 A;  4QGU A;  2VB3 X;  4OOX A;  1FL0 A;  3S17 H;  1TWA H;  3JAM L;  3S16 H;  1STB A;  1F60 A;  5IGE A;  1N07 A;  1SKQ A;  3LQ6 A;  3RLF A;  4JBW A;  1CKM A;  1IZ6 A;  2M2L A;  4RKL A;  4KHZ A;  4RHR A;  4XOT A;  4LFB L;  5CDF A;  5C3E H;  3AVX A;  1MIU A;  1X54 A;  2BA1 A;  4JI0 L;  2VQE Q;  5TSS A;  1LTR D;  3NTI A;  2PI2 A;  3UDF A;  4CHT B;  4CKC A;  4AC9 A;  5C44 H;  4M4S A;  4N9P A;  5A89 A;  3BDL A;  1T5E A;  2UU9 Q;  1Q82 D;  4GLX A;  3IKJ A;  2JN9 A;  3J7A V;  1MSG A;  2L0C A;  4P71 A;  2X6W A;  1IKM A;  2MHV A;  4ZCL A;  3A7A B;  2NVY H;  5K5P A;  4H02 A;  1HH2 P;  3ONU A;  3HFZ B;  1BMF A;  4RMF A;  4X3T A;  1WTQ A;  3PCO B;  4GQN A;  4DGZ A;  3JAM i;  3ERO A;  2GN5 A;  1VQK A;  3C1E A;  5IYR A;  2QGG A;  2XNA C;  2X85 A;  3KEW A;  1BNZ A;  1WTO A;  3HOW G;  2WFW A;  4RPD A;  4K14 A;  2K5H A;  4YEJ A;  3GTM B;  1CTM A;  4Q7J B;  4BBS G;  1VQE A;  3MZ5 A;  1MJC A;  2X69 A;  3QO2 A;  1MD2 D;  4X3K A;  5T1G A;  3HS0 C;  4PZ6 A;  3TQY A;  1HNW Q;  2UUA L;  1KC8 D;  2F0M A;  4P22 A;  2HIX A;  3GP7 A;  5D3D A;  5BN5 A;  4B9W A;  1E22 A;  4LF6 L;  2RBM A;  2OCE A;  2R93 H;  4JI1 Q;  5I6Y A;  1N08 A;  5EPJ A;  5F4O A;  4XT3 B;  4GKK L;  1J8I A;  4AQY Q;  2UXC Q;  2WSS A;  1F9Q A;  4DK1 A;  4OON A;  3CPF A;  4C1N K;  4XLA A;  3MHP A;  1UE7 A;  5C0X H;  4L8J A;  2O4X A;  4WJ4 A;  1ONL A;  3V7A A;  4RAU C;  4C43 A;  2JA7 B;  5E6T A;  4RD6 A;  1YHB A;  1VQK B;  3HG9 A;  1O7Y A;  5CMD A;  4QL5 A;  1LTG D;  5J22 A;  3MVV A;  3MXU A;  3PO2 B;  1TVX A;  1Z9F A;  2HLD A;  3IRB A;  3OYY A;  4A3F H;  4J0Q A;  4RGM A;  2MO0 A;  2D0P A;  1ZYR D;  3M3Y H;  1B4O A;  1DAR A;  1WTR A;  4Z1M A;  2RC6 A;  3CRL C;  1CZW A;  4II2 A;  5J39 A;  1SFO H;  3DUZ A;  4IUN A;  4N9T A;  4RD0 A;  5M5X H;  3S2H H;  1CKO A;  1C0A A;  1P8L A;  1WTW A;  5BSX A;  2C5B A;  2HCC A;  4N3N A;  3U6K A;  3EVQ A;  5EQ0 A;  3CW2 A;  1JE4 A;  2HT1 A;  4QV2 A;  1SE3 A;  3K58 A;  4A3B B;  1I6H H;  4X7D A;  1YHQ A;  3Q8D A;  2R7Z H;  2JDI A;  1QG7 A;  2K1B A;  3GTO H;  3MFG A;  1PJ7 A;  3QFT A;  3TEH B;  3K80 C;  4TQU S;  2QF7 A;  2Z4H A;  4II3 A;  1FYC A;  5K36 G;  3VA7 A;  4A3I B;  4HAE A;  1KAB A;  3HP3 A;  1WOR A;  4GKJ L;  3W2G A;  3CCM A;  1OO9 B;  3TP7 A;  1D7Q A;  1EY5 A;  1UE6 A;  4B3X A;  4ULL A;  1PLF A;  2K6A A;  3NXW A;  1VMP A;  3NTK A;  4S3S A;  1CM9 A;  4NP5 A;  3L0O A;  1H42 A;  3D0F A;  4PMW A;  5FLM H;  4OWX B;  1JE5 A;  5M3F H;  3LQE A;  1RF2 D;  3L3O C;  4QJF A;  3S1M H;  1NB9 A;  5FLX E;  5GAG C;  5IY0 A;  4A3K H;  2Q8R E;  2ZL6 A;  2VS1 A;  1WCM H;  1DZ1 A;  1FND A;  2Q6K A;  3MXN A;  4OPS A;  5JJK A;  3R3O A;  1VQM A;  3K8A A;  4C0S A;  4HMJ A;  5KSW B;  1YHQ B;  1KIX A;  1Q81 C;  3A0J A;  1CK1 A;  2QDL A;  3KF6 A;  1JOO A;  5M5W H;  2EFG A;  1I6V C;  4A3J G;  2V7U A;  2PIA A;  3A5U A;  4B3M L;  3BU2 A;  1S4M A;  3CCM B;  4E0F A;  4ASU A;  4LUV A;  1H9J A;  1OGI A;  1UNS A;  3OWE B;  1AN8 A;  1PTO H;  2BGJ A;  1AEX A;  1ZM4 A;  1SDF A;  4ZGN B;  2F0V A;  3RUZ A;  5C4X B;  4AIM A;  3B6Y A;  3K7U C;  5LMN Q;  2UUC Q;  4RCZ A;  2R92 G;  2GJK A;  1NR2 A;  4DN4 M;  5EPK A;  1J9Z A;  2A68 C;  3X3M A;  2L9H A;  1M4V A;  3OJW A;  1HA3 A;  3B8H A;  4DAP A;  2WV6 D;  1RQR A;  4A3L G;  4LJZ C;  5KIX A;  4P12 A;  1JC7 A;  1C48 A;  1CKN A;  1V9P A;  4JI4 L;  2Q8I B;  2PZU A;  2O5I C;  2OWO A;  3QSY A;  2EYJ A;  5T1I A;  2GPJ A;  3MXN B;  3AVU A;  4PAA A;  4HCS A;  2J4X A;  4BY1 H;  1VQM B;  3HOZ H;  1RTO A;  3KF6 B;  3T1Y Q;  3A8K E;  1I94 Q;  1IW7 D;  5HZB A;  4A75 A;  3E3X A;  4O0A A;  3SGI A;  1XNQ Q;  4RDK A;  2QEJ C;  1RKN A;  4FF1 A;  1HJP A;  5IYD H;  3SLD A;  1EUJ A;  2XEX A;  2RCF A;  3I91 A;  4XXE A;  3G71 A;  2YTX A;  4JI8 Q;  1XNR Q;  5JBQ A;  1WYD A;  2E2J H;  1NSN S;  1UAP A;  2NN6 H;  2KA7 A;  4DR4 Q;  2D9R A;  3GO5 A;  3I90 A;  1E1Q A;  3L9A X;  4ME5 A;  4N8F A;  1CKN B;  1SMY C;  4F88 A;  2C9O A;  3U58 A;  1SYF A;  1XB2 A;  1FJG Q;  3ASQ A;  3OEE A;  3OIQ A;  1WVL A;  2XND A;  1DG1 G;  1UMK A;  1E1T A;  2NV4 A;  3Q38 A;  1SND A;  3VYR A;  1LTT D;  3JAM c;  3F1Z A;  2B63 B;  1WD0 A;  2XZL A;  2QCP X;  2C4U A;  3MCA A;  4LFA Q;  4I65 A;  5AFW A;  1N34 Q;  1KHI A;  2HHH Q;  4YEL A;  4TSS A;  2JA5 G;  3CD6 A;  3KFU A;  2VUM B;  1WTH A;  1EYA A;  5A88 A;  1R9T H;  4I7Z C;  4UAJ A;  3S17 B;  1TWA B;  4NW2 A;  2A73 B;  3S16 B;  4DK0 A;  2B39 A;  3HOV B;  4LF4 Q;  1FDR A;  2GA4 B;  4X3S A;  1V5V A;  5KW9 A;  2PMZ E;  5C3E B;  3BQJ A;  1XMQ Q;  2F1L A;  2MFI A;  2D2C C;  3TP8 A;  1VQA A;  1EFT A;  1SN8 A;  2FFK B;  5C44 B;  2QMU A;  4QF4 A;  3KLS X;  4OHJ A;  1EWH A;  4R4O A;  2K33 A;  2LXK A;  1GKH A;  4RKB A;  1KTK A;  3HOW H;  4B3S L;  4B3R L;  3PUY A;  3BDO A;  3RN5 A;  2NVY B;  4BBS H;  2W6I A;  2ZZE A;  4HIM A;  1CT1 D;  5JPN C;  1IBK L;  4NMZ A;  1PV4 A;  2HD3 A;  2XNJ A;  2ZXH A;  4ZAI A;  1VQ9 A;  3CD6 B;  4G4K A;  4RCN A;  1IB0 A;  1U9R A;  5CV5 A;  3R8B A;  4GNX C;  3VR3 A;  3QB3 A;  1ET6 A;  3A56 A;  2JA6 G;  3J80 L;  3O13 A;  3IAY A;  3FKI B;  4JBJ A;  5I4D A;  1C4Q A;  2KCM A;  3FMC A;  1TS5 A;  2K5D A;  3F2D A;  4DR3 Q;  3AB9 A;  2L12 A;  2RSO A;  3DDY A;  3VA5 A;  3TP5 A;  3P75 A;  5CGK A;  2R93 B;  3BC9 A;  4OOV A;  2VNH A;  1VF7 A;  1BCP C;  3H91 A;  1UD3 A;  1LT5 D;  1EU4 A;  2K4K A;  2ZTG A;  3OOC A;  4PC6 A;  1QVC A;  3HAG A;  1HXY D;  4QQB X;  2B2V C;  2EY5 A;  1SKY B;  4R71 A;  1D6E C;  3LO8 A;  1VQ9 B;  3M4Y A;  2B8F A;  4NXN Q;  1HZB A;  1TWC H;  3Q6Q A;  4UP8 A;  3ULP A;  3J80 i;  3H6M A;  4RD3 A;  4QHY A;  4YWL A;  2DJG C;  4A3F B;  5F4M A;  5LMU Q;  1TR5 A;  1YNJ C;  1STH A;  2NTT A;  2YTY A;  3HEJ A;  3NBH A;  3T1H L;  3M3Y B;  5K36 H;  4JOI C;  1E1O A;  3MEH A;  1SFO B;  4ME3 A;  1DYQ A;  1I4G A;  4LMQ D;  4KN4 C;  2ZL7 A;  5M5X B;  3BS1 A;  2XWJ B;  1CNE A;  1IHM A;  1NJI D;  5CV9 A;  1HPC A;  1ASZ A;  1I6H B;  4Z4S A;  1U0L A;  3GTO B;  1G7C A;  1YZ6 A;  4YXW A;  2A1A A;  2ICI A;  2R7Z B;  4DV4 Q;  2Q6L A;  3ND8 A;  4Z4Z A;  3BH4 A;  2SDF A;  1YX2 A;  2BMW A;  5COY A;  3ZIA A;  1OB5 A;  1WPC A;  3CME A;  4X66 L;  4AH6 A;  4Q0F A;  2PI2 E;  4IQZ A;  1CZG A;  5J35 A;  4LF5 Q;  2JA8 G;  3P1H A;  2AUK A;  4QY7 A;  3EQL C;  4KI0 A;  3OPO A;  1FGU A;  3F8T A;  2NVX H;  3FJO A;  3GTJ H;  5IYW A;  1QX4 A;  2F4V L;  1MJE A;  3I73 A;  4A3J H;  3OW7 A;  5M3F B;  3I4N G;  3NBH B;  3S1M B;  2ZBV A;  2Z8L A;  4CDD C;  2C5H A;  1GVH A;  4HIO A;  3KLS A;  1QZG A;  2JQO A;  1STE A;  4OIK A;  4A3K B;  3EIV A;  3S15 H;  1EFC A;  4XLE A;  4GNX A;  1WCM B;  3CP8 A;  2R7D A;  3I70 A;  1W2B A;  3H3V I;  4OOS A;  1U4M A;  3VO2 A;  1FNC A;  1HZC A;  4DNI A;  1UUP A;  3G7L A;  4DR2 L;  3D6C A;  2AMC B;  5M5W B;  2F0E A;  4A3L H;  1AW7 A;  4DV7 Q;  3CME B;  1J9O A;  4UAI A;  2V7Q A;  1IJE A;  3PMF A;  1B3A A;  4A93 G;  1PTO B;  4C3I H;  1D5Z C;  3W5U A;  3OIP A;  2CRV A;  5EKK A;  1Q46 A;  4K8J A;  4KLK A;  3HKS A;  3TDQ A;  4QFM A;  4B08 A;  2RC5 A;  2IX3 A;  3KYH C;  1A6X A;  2JIZ A;  3CCV A;  4DNR B;  5CBA E;  3LX0 A;  4R4Q A;  2F3I A;  4RGT A;  3RLN A;  4ZKB B;  2F0G A;  5IYQ A;  4Y7N H;  2V7V A;  4OP7 A;  3A7L A;  4GNX B;  2VNI A;  1XFO A;  3EN2 A;  1PZK D;  1VDZ A;  1Y1W B;  2ZXO A;  4KY5 A;  1W2B B;  3A3G A;  4BY1 B;  2X0K A;  3HOZ B;  1JWU D;  1M90 C;  3K57 A;  5HGQ A;  4XR6 A;  3GIR A;  1VQG A;  4RH6 A;  1PRT C;  2Z6K C;  5IE8 A;  1I7P A;  3K5O A;  2F0P A;  4OXP A;  5IK2 A;  4K8I A;  1HFG A;  4LFC L;  1EFI D;  4UY8 C;  1A63 A;  3VR4 A;  2N3S A;  1VF5 C;  2FIN B;  1IYV A;  4DV5 Q;  1TWG B;  4JYA Q;  1I8D A;  1PJ6 A;  3A1P A;  1W6K A;  2VJI A;  2KUM A;  2UUA Q;  2E2J B;  3CCV B;  2H1E A;  2OTL A;  3A8K A;  1IBM L;  2R7F A;  1UD5 A;  5C0X G;  3CPX A;  4JBK A;  1GHK A;  5GAD C;  1PH8 A;  2IX0 A;  2X6Y A;  1S72 B;  1RIP A;  2EJF C;  4IOC A;  4G7H C;  4QUZ A;  3S1Q H;  4P9S A;  5IP9 G;  1WDT A;  1SNM A;  3CC4 A;  3E20 A;  4GLA C;  4PMC A;  4EX5 A;  1N33 L;  2OBS A;  5FLX c;  3WND A;  1GUT A;  2KCC A;  3AYH B;  5KEE A;  1PYS B;  4XM3 A;  5HZA A;  4B3G A;  1JIC A;  1R9T B;  1PFS A;  5I9P A;  1SBB B;  3H0G G;  3MFY A;  1N32 L;  1HQM C;  5E3F A;  4P3I A;  2E2H H;  1G6Z A;  5TY0 A;  5D65 A;  1WTH D;  3I4L A;  1B8A A;  5KRU A;  2WJV A;  1QGZ A;  3P27 A;  2CVR A;  3CF5 A;  3S1N H;  2OQ0 A;  1SYC A;  3KLR A;  1Q8K A;  2E1B A;  4DUZ Q;  1B7Y B;  5HXB A;  2OTL B;  4C3J G;  4FXG C;  2JA6 H;  1PH1 A;  5A2Q L;  3QG1 A;  1WSV A;  1XX8 A;  5C3W A;  3HOY G;  3CCJ A;  3HOW B;  4KKU A;  5I2Y A;  1QWY A;  1FNW A;  2RVL A;  4YCU A;  4BBS B;  3CC4 B;  3G05 A;  1VQ7 A;  3ZC3 A;  3J80 c;  3ITP A;  3SEJ A;  4KJO A;  2PZT A;  2JJQ A;  2M00 A;  4LF8 Q;  5F2D A;  3ZZU A;  3V76 A;  1EEI D;  1SYD A;  3QOJ A;  1OXU A;  3QWN A;  1HUN A;  2OK7 A;  1DOL A;  1KRS A;  3WOE A;  4JI5 L;  1N36 L;  4WZL A;  5IGG A;  1KZL A;  4X7F A;  2A68 D;  3KBX A;  1TTT A;  4X3U A;  5FKA C;  1SRO A;  2SEB D;  4TMT A;  1E1R A;  1UEA B;  4IPG A;  1T9H A;  1WJJ A;  2F0L A;  1NCV A;  3MA2 B;  4R4T A;  3KJO A;  4PC3 A;  2Z6K A;  1VS0 A;  1HA6 A;  3SJP A;  1KRH A;  4DU9 A;  2CND A;  5E1F A;  1VHE A;  3AEV A;  1M1K D;  1K28 A;  2WZP P;  1E0B A;  2NBF A;  1FNB A;  4JVZ A;  3CCJ B;  5LMZ A;  2D0O A;  1J5E L;  1WD1 A;  1I4H A;  4KHP Q;  3FDT A;  3NPP A;  1SEB D;  5CV7 A;  4F7X A;  3M4Q A;  1VQ7 B;  5C4Z A;  3OTO L;  2KEC A;  4OX9 Q;  4DFA A;  2ZXP A;  1JB7 A;  3P20 A;  4DR5 L;  1AP0 A;  1QZH A;  3QIA A;  4RG1 A;  5FO8 B;  1Y0R A;  1Z6H A;  5C3X A;  4MTK A;  3I1F A;  5JEA H;  1Q1E A;  2AQ3 B;  1VQH A;  4ZUI A;  3K5L A;  2DNE A;  1RTN A;  4YCV A;  2RDF A;  1VQB A;  1QVG A;  1F77 A;  2PE3 A;  5G3L F;  5BR8 Q;  2XZP A;  1KQS B;  3MAQ A;  4MN3 A;  5ELO A;  5CV6 A;  1X9N A;  3HOZ G;  1PRT B;  4DV0 L;  4L5T A;  1BBX C;  1K9M D;  3K5N A;  1EIH A;  5H59 A;  4DPG A;  2JA8 H;  2DET A;  3UDI A;  4YAO A;  5GV7 A;  5C4H A;  4DR7 Q;  4XYQ A;  4KY7 A;  3A3B A;  1VHO A;  1QGA A;  1Q9S A;  4XN0 A;  4JK1 C;  2B2W C;  3VR2 A;  2XZO A;  4RHS A;  3I4N H;  2CW0 D;  1BVS A;  4UPA A;  3U4V A;  1HR0 W;  2UXD Q;  4K2K A;  3E6Z X;  3VDY A;  4GOP C;  5AJ3 Q;  1LT4 D;  3W2D A;  4ACA A;  3TSS A;  2E5L L;  1PH2 A;  2LSS A;  4IFD G;  5E4X A;  4P74 A;  2WJY A;  2NVX B;  1E2W A;  2EIX A;  2EXZ A;  2F52 A;  2BV3 A;  1QVG B;  1KAA A;  1V0E A;  4A3J B;  1PTO D;  2IT1 A;  5DN6 A;  2MJ8 A;  5ELF A;  2B2Y A;  4DAM A;  3KOJ A;  1K8M A;  2F0S A;  1ZM3 A;  2SOB A;  3NSW A;  2WYR A;  4PC1 A;  3S15 B;  4A93 H;  4AF7 A;  2AHO A;  2D5D A;  3S1R B;  2XNC A;  1DXM A;  1PKV A;  4WOR A;  2R92 B;  2CQO A;  1TS4 A;  3OJX A;  2XWB B;  3ND9 A;  4RJL A;  1LV9 A;  2WB1 G;  3A74 A;  2PYK A;  2KEN A;  1T5X D;  2DNC A;  1HCZ A;  3ZZ0 A;  1EY7 A;  5HUR A;  4F7D A;  2NUC A;  1G51 A;  3BVZ A;  3FHW A;  4K5V A;  5KNC A;  3TRE A;  1IBL Q;  1JCK B;  5FIU A;  2DIE A;  1H9R A;  1NNX A;  4YAU A;  5EBC A;  4HED A;  3NTH A;  1ML0 D;  1PFM A;  3DWP A;  4HJ5 A;  4P2N A;  4PZ8 A;  2G9D A;  2F0T A;  3MXP A;  4XL9 A;  3QFS A;  3HRZ C;  4DV1 Q;  3D6W A;  4OO1 G;  1JR0 D;  1VQ4 A;  3UE1 A;  4JI2 Q;  5IWA Q;  1BXT A;  2ZTN A;  4Y7N B;  1PVO A;  5NUC A;  4JV5 Q;  4LAA A;  2AHO B;  5ISR A;  2F0N A;  3BZC A;  1Q3L A;  2R6G A;  4FYD A;  2VJJ A;  1BOS A;  3SEB A;  3SVM A;  1R5B A;  5TV2 A;  4HSV A;  4CBV A;  3J81 j;  1E2Z A;  1IBK Q;  4M2L A;  1ZEQ X;  4B47 A;  3VYU A;  3ZZT A;  1L2F A;  2JN4 A;  1HR0 L;  5EKL A;  4Z4U A;  1L1O C;  3F2U A;  1FX0 A;  4JI7 Q;  2P3M A;  1W3S A;  2X6X A;  1HZE A;  5IP9 H;  2VQF L;  4XQN A;  2B2W A;  2L4N A;  4DV3 Q;  1X3G A;  1FR3 A;  4JI6 L;  3T4A C;  2B7B A;  1E24 A;  1BQQ T;  1SYG A;  3VYS A;  1Q7Y C;  3HKZ G;  4LF9 L;  2EDG A;  1AZQ A;  2WP8 J;  5C0X J;  2HCI A;  1YIJ A;  4GOP A;  2NVT H;  2JA5 B;  2FX3 A;  5KNL A;  2BM0 A;  2CW5 A;  3RMH A;  1HTP A;  1VQ4 B;  3H0G H;  1SXT A;  3PIP A;  2ASB A;  1COW A;  2HIV A;  2K5Q A;  1TQO A;  2E75 C;  2LY7 A;  1S5E D;  1K73 D;  4K1X A;  5EKI A;  4CKE A;  1GOZ A;  3EJI A;  2J7K A;  3S1Q B;  3E0E A;  1EQQ A;  1YJN A;  2AKW B;  1UD6 A;  2VBS A;  1DCZ A;  2EXD A;  3TN2 A;  3TME A;  3QE2 A;  1J6Q A;  3H94 A;  2X8K A;  1LUZ A;  3U6B A;  4NB3 A;  3SXH A;  4C3J H;  4A3D G;  4G5G A;  4B3T Q;  1F9P A;  1EP1 B;  4DR1 Q;  2GJR A;  2JJ2 A;  1JA0 A;  1JB3 A;  2I1L A;  3EA6 A;  3HOY H;  3MHB A;  2E2H B;  1TWF H;  4FNF A;  4MYT A;  3R2T A;  4WWV A;  5KGU A;  1EEF D;  4DUY L;  4PQX A;  4UZF A;  3FKS A;  3NQT A;  3KF8 A;  1HQR D;  1CNF A;  2R6H A;  1Y1V G;  3M9B A;  2FMC A;  3FPU B;  4KY6 A;  5EJW A;  1YIJ B;  1K8A C;  2CC2 A;  4GOP B;  2DOG A;  1YJ9 A;  1IXR A;  3SK4 A;  1EL0 A;  3V96 A;  1XE1 A;  5ELE A;  4HJ9 A;  2JA6 B;  3JQP A;  5JVG 3;  2BH2 A;  1AFP A;  5M9O A;  3MC0 B;  2UUB L;  2ALY B;  5TRD A;  2VXW A;  2EY1 A;  4O2D A;  2BH8 A;  1F9R A;  1YJN B;  5ELB A;  4XLC A;  1SJE D;  2YWF A;  4GN3 B;  1ENC A;  2CF4 A;  1KL9 A;  4XMY A;  1X3F A;  4BY7 G;  3HGB A;  3OHX C;  4QCL A;  1LO5 D;  4QVA A;  3ZBU A;  5IIF A;  1HUM A;  1C8C A;  1NBW A;  4Z4V A;  2VBU A;  1XTC D;  4TRD A;  5I2X A;  4L6T B;  1LLR D;  2F4V Q;  2AWO A;  4LWC A;  3OMG A;  3KL9 A;  1N0V C;  3FRP B;  4HTH A;  5JJI A;  2N55 A;  3KF8 B;  3X3N A;  3AVW A;  4ZCK A;  5CC4 A;  3BVG A;  4DV6 L;  4BA2 I;  5GV8 A;  2VBT A;  1YJ9 B;  2BN4 A;  4XLH A;  2G5D A;  1M90 D;  3I4M G;  4BXX G;  5KYI A;  2WB1 E;  2OXP A;  1HNZ L;  4L5R C;  1K0S A;  2VZL A;  3VR6 A;  4NCN A;  3CCL A;  1PRT D;  1TS3 A;  2IY5 B;  3QOL A;  4ODG A;  2LXJ A;  3A8I E;  4DK3 C;  1A8V A;  1VQC A;  4C3I G;  3C46 A;  3AST A;  3Q0A A;  3K5M A;  3WBJ A;  4XQJ A;  1H9S A;  1K28 D;  4OPV A;  3IFD A;  3GTG H;  2PO4 A;  3ONA B;  2BPO A;  1A62 A;  1QUQ A;  1XXG A;  4OEL B;  3BNW A;  3M4O B;  2IWH A;  1PHJ A;  3CQZ H;  3ZYY X;  1IL8 A;  1OXX K;  1KDA A;  2BDO A;  2RA4 A;  2A74 C;  5A35 A;  3DEO A;  1UE5 A;  3KBG A;  2E76 C;  1F2M A;  4U68 A;  4X62 L;  1D1N A;  3I7F A;  3NEL A;  3W1B A;  2A6H C;  4R1J A;  3AGP A;  2RQX A;  3OP1 A;  2JA8 B;  4IFD H;  3ASR A;  1D1I A;  4ZCM A;  4F8M A;  2XN9 C;  2WIN B;  1VJS A;  3A8J E;  1HTL D;  2Z1C A;  4DR6 L;  1GM5 A;  3PUZ A;  3CCL B;  1UE1 A;  1FRN A;  1G7T A;  3T56 B;  4IAL A;  5IP7 G;  1V1O A;  3I4N B;  2L11 A;  3CCE A;  1SNP A;  1EQT A;  2NWG A;  3TP6 A;  1H9S B;  1RJT A;  2QA4 A;  1WFQ A;  4IFD J;  4ZQ3 A;  5CV8 A;  4RFB A;  3AVT A;  4LFC Q;  1QUQ B;  4KKT A;  5IGB A;  3W1G A;  4X07 A;  3URY A;  3R93 A;  4P75 A;  2WZN A;  1EY4 A;  1XMO Q;  2PQE A;  3WDN A;  2BCO A;  1ESF A;  3PIO 3;  2IJ0 A;  2VQE L;  4KTA A;  1B70 B;  3GVL A;  4X64 Q;  5FLX L;  1BF4 A;  3RZD H;  1HNX L;  1EWC A;  2EVB A;  3CCS A;  3G71 B;  4O42 A;  2J0T D;  1ZXT A;  1CHQ D;  2EZV A;  2UU9 L;  3VMF A;  1X3P A;  3PEN A;  1SE2 A;  1IHZ A;  1OTC A;  4A93 B;  4X65 Q;  4U67 3;  1E43 A;  1TLL A;  1A15 A;  1TU2 B;  4JI3 L;  1X3E A;  2ZJQ A;  2BA0 A;  2B2U C;  3AVV A;  4KD4 A;  1F9S A;  3PUM A;  2I5M X;  4P3Y A;  4DV2 Q;  3JC6 6;  1STA A;  2EQS A;  1OXS C;  2EYM A;  1N33 Q;  4FXU A;  1FNU A;  3CCE B;  1A0I A;  3WWV A;  4QUC A;  1BDO A;  4OO1 H;  5C5M A;  1PYW D;  4ZYS A;  4M1K A;  1U4P A;  4NXM L;  3CKI B;  2QA4 B;  3PO3 G;  1EYG A;  4K5W A;  1BJK A;  1KAW A;  1KDB A;  4XT1 B;  4Q5V A;  3DWA A;  2DN8 A;  1KK0 A;  2K28 A;  4H7B A;  3RD4 A;  2RHS B;  4MIU A;  4KJN A;  4C1N I;  2VL6 A;  1Y8O B;  3N52 A;  5LHY 1;  1PH5 A;  3CCS B;  1QJO A;  1X32 A;  5BSY A;  4DXF A;  4WJ3 M;  4JI1 L;  2WKC A;  4ID6 A;  4AQY L;  1SRU A;  3KK7 A;  4KD3 A;  4K5X A;  1X56 A;  1NE3 A;  2I46 A;  5EGT A;  1AMO A;  2EYH A;  1QFZ A;  3H3V C;  4K0K Q;  2HDL A;  5LMN W;  2Q6I A;  2IHE A;  5GAH C;  3PA2 A;  3GTK H;  2F0K A;  3U4Z A;  5LL6 S;  4X0C A;  3ZBT A;  2Y0S G;  4X7C A;  2B7C A;  3BCF A;  4JI5 Q;  2EYP A;  5IGD A;  2FMM A;  2E2D C;  2N88 A;  1C9O A;  1YNN C;  4WQM A;  1RL2 A;  1GUN A;  5I6W A;  3WOF A;  2ZM6 Q;  1BBW A;  2QE7 A;  2NVT B;  1ELO A;  1FNM A;  4R4I A;  4A3D H;  1P4M A;  1VQD A;  3H0G B;  4FXD A;  4ROX A;  3Q3A A;  1B44 D;  3S2H B;  4XD7 A;  4Y9U A;  1NR4 A;  5JEA G;  4DQK A;  5DM6 3;  3J81 E;  2I5H A;  3BG3 A;  1Q12 A;  4FDB A;  3OTO Q;  1Y1V H;  3FEW X;  4BWG B;  4J6H A;  3E1Y E;  4J15 A;  3Q24 A;  4P73 A;  1E62 A;  4C3J B;  4H9G A;  4OEM B;  4XOR A;  5M3M G;  3FPP A;  3HOY B;  5E7N A;  1ZM9 A;  1L0Y B;  4XQF A;  1CQX A;  3PUV A;  1TWF B;  1G29 1;  3B78 A;  1GJR A;  2K01 A;  4C3H H;  2CQA A;  2VYQ A;  1CSP A;  4TSF A;  5CR3 A;  5CBE E;  3CC2 A;  3Q6R A;  3ONY A;  1TWH H;  1NY4 A;  4X05 A;  5IYP A;  1ZYR C;  2I0Q A;  3GV6 A;  4DV0 Q;  4AYB G;  1Y69 U;  2AQ2 B;  2N8N A;  4OWW B;  4BY7 H;  4PAB A;  3PF4 A;  1KDC A;  4NDX A;  1LAB A;  4XQQ A;  4LUO A;  1VQ6 A;  1W0J A;  1QUF A;  2RCN A;  4GLV B;  3BZD B;  4BS9 A;  2GQF A;  3OFN A;  3STB C;  3I55 A;  3BCD A;  1MI2 A;  1KK3 A;  2QTL A;  1CA6 A;  1N05 A;  2XGJ A;  1MAB A;  3I4M H;  1VQ8 A;  4G1V A;  4NPS A;  2Z4I A;  2AUJ D;  2EE1 A;  4BXX H;  3W2F A;  3RZO H;  4P26 A;  3M85 A;  3GTL H;  2CCZ A;  1Q1B A;  4B4D A;  4ABN A;  2F4I A;  2YWH A;  4IUV A;  4YY3 L;  2OEO A;  4N8X 1;  1WI5 A;  5FO7 B;  1VLO A;  1QNK A;  4TN1 A;  4Z9C B;  4R9W A;  4LFB Q;  1Y14 B;  4JPB W;  1UD2 A;  4ZK9 B;  2B2V A;  3ASS A;  3ULJ A;  4JI0 Q;  5C5L A;  3CRZ A;  4Z4R A;  4X7E A;  3K59 A;  3PV0 A;  1T6X A;  2KVM A;  1WOO A;  2NN6 I;  2C77 A;  2Q2H A;  3TZU A;  4EGV A;  1VQ6 B;  4XIG S;  4UP9 A;  1N8R C;  1AZP A;  3T1Y L;  5H5J A;  2B29 A;  3LNN A;  1IJF A;  1PTO F;  5IT9 E;  1EZ8 A;  5COR A;  3I55 B;  3I56 A;  4XON A;  2VZA A;  2XIW A;  4K2L A;  1P16 A;  2IL8 A;  3GTG B;  1V43 A;  2GVB A;  4JOI A;  1K3B C;  5CV4 A;  3FPK A;  4OGQ C;  3K0Y A;  3WY9 A;  3MWY W;  1VQ8 B;  2RDH A;  1DDI A;  4M1U B;  1E7Z A;  3ULL A;  3CMM A;  1Q7Y D;  4H13 C;  2Q8T A;  1YLO A;  1GJX A;  3CQZ B;  5J1Z A;  3CC7 A;  2Z6B A;  5IP7 H;  4IO9 A;  2F3W A;  4KK7 A;  5JJZ A;  4A3C H;  2ZZF A;  1XNR L;  2O5J C;  1BCP B;  1NAP A;  1KD1 C;  4DR4 L;  1LTS D;  3C3L A;  1H85 A;  3A8I A;  1EY9 A;  1S5F D;  1BLI A;  3SKB A;  3Q22 A;  4RD4 A;  2D74 A;  1FJG L;  3M4P A;  2YWE A;  4DK6 C;  5IYB G;  4HIZ A;  4LF6 Q;  3GSI A;  4YWM A;  2CFM A;  3CMA A;  4TVA B;  4LBV A;  3MXG A;  5DSZ A;  1O80 A;  1ASY A;  4GKK Q;  2BDN A;  1SJH D;  1GUG A;  1KLG D;  2Y0S E;  1EIG A;  2PW5 A;  1N34 L;  2HHH L;  4KKS A;  4PC2 A;  1V8Q A;  1ZM2 A;  4J1M A;  3I56 B;  3J7A 5;  2ZTD A;  3BY2 A;  2F0O A;  1WP6 A;  3NE5 B;  1W87 A;  3K7A H;  1CSQ A;  2QDX A;  1IYU A;  2DGY A;  3NQI A;  4HSP A;  2CBX A;  3NHH A;  5AN9 A;  3QFC A;  2QGQ A;  2EYL A;  4B43 A;  4LF4 L;  1B9N A;  1ZKO A;  4QVJ A;  2ZIT A;  1E79 A;  3I4O A;  3ZPN A;  1EIF A;  1K8A D;  3CP0 A;  1XMQ L;  3CC7 B;  4JI6 Q;  3A8J A;  3LGJ A;  2WB1 B;  4UHV A;  5JJL A;  3PF5 A;  3RZD B;  1K3R A;  4LF9 Q;  3PO3 H;  4PNY A;  3OKX A;  3CRK C;  2ENB A;  1K0R A;  1WTV A;  5J3B A;  2HDM A;  3RLO A;  1PH9 A;  4BBR G;  5GQO A;  1LTA D;  4LC0 A;  1NRK A;  2HDN B;  4FVM A;  4H44 C;  1Q81 D;  2F43 A;  2PCF B;  1GO2 A;  4OPO A;  1DGS A;  4ZV4 A;  2K32 A;  1PFN A;  4R4C A;  3CMA B;  4A3G G;  2DUD A;  1NBM A;  2KCT A;  3RY8 A;  2B5O A;  2EOT A;  2NVQ H;  4YAW A;  4TKO B;  3OZW A;  1E3X A;  1PXU A;  4HJ8 A;  3OSO A;  3K81 C;  3A55 A;  3D4R A;  1BO0 A;  4GKJ Q;  3G4S A;  1SYE A;  1WOS A;  1CFM A;  2NPF A;  2A5H A;  3JAM E;  3I2Z A;  2D9U A;  2L1B A;  4TMV A;  1RD9 D;  4AYB E;  2EPB A;  1GUW A;  3BJU A;  1BQE A;  2K5V A;  3I3C A;  3BY1 A;  4P72 A;  1VLY A;  5BN3 A;  1VQ5 A;  3FP9 A;  4L63 B;  3CTA A;  4Z4Y A;  1JJC B;  2RKS A;  3C2Q A;  1I4P A;  5DLQ E;  4KMU C;  1WSR A;  4UZE A;  2A69 C;  4ZKC B;  2MNA A;  3UDX A;  1EY6 A;  5I9O A;  4MYU A;  1U4L A;  1FVI A;  2BE5 C;  3A35 A;  4IOA A;  1E3Z A;  3TZD A;  3H09 A;  4MNO A;  1MRZ A;  3HKZ B;  3DM3 A;  1Q90 A;  2NYZ D;  2TMP A;  2MP1 A;  3DHQ A;  4NXN L;  3GTK B;  2M9V A;  4IPC A;  4B3M Q;  3AU7 A;  4GN4 B;  3G4S B;  1UWV A;  3AFP A;  5FA6 A;  3WBK A;  1L0W A;  1S0U A;  2F4N A;  1TWC B;  4N3G A;  4JC0 A;  1R4P B;  2QKI C;  1GVP A;  1VQO A;  4XKV A;  4A3E G;  1CA5 A;  1GHJ A;  1NMG A;  3C1F A;  1VQ5 B;  3EFX D;  1XPO A;  2MQH A;  1H95 A;  4A3D B;  1S3O A;  4EQN A;  1G2T A;  5M3M H;  1SMY D;  1D1K A;  4R8N A;  5GAE C;  1E64 A;  1XJV A;  5JEA J;  3QR8 A;  2PQA A;  1B53 A;  4JI4 Q;  2B2T C;  5ELD A;  3ASP A;  4YHH L;  3SK8 A;  1H8H A;  2DY8 A;  3NWT A;  4A4I A;  1G7R A;  4FF4 A;  1ENF A;  1Y1V B;  1KMH A;  1CHP D;  3U2Q A;  4B9X A;  2WAC A;  4LF5 L;  2CKZ B;  4G57 A;  2NB0 A;  4RGN A;  2GRE A;  5GRO A;  2QW7 A;  2QTZ A;  4POF A;  2Q2I A;  2F0F A;  2F0D A;  1OB2 A;  4IUP A;  1E3P A;  1PRT F;  4XNF A;  3BYY B;  2DY7 A;  5IOC A;  1VCI A;  1F2Y A;  1ET9 A;  5ELN A;  2EY2 A;  2ZTC A;  4M8A A;  5FNZ A;  1YEZ A;  4Y52 H;  1VQO B;  3GTJ B;  1TWH B;  5L37 A;  2KHJ A;  4HE6 A;  1GD7 A;  2IW3 A;  2WAQ G;  3DWQ A;  1HHV A;  2A6E C;  2JSO A;  3ERS X;  2FXQ A;  1EOV A;  4BY7 B;  2MPM A;  3L7Z C;  1SM4 A;  2B63 H;  4DR6 Q;  1D2B A;  1ROD A;  2PQA B;  2PMD A;  1LAC A;  1FNV A;  3HOU G;  1ICW A;  2QDB A;  3JQQ A;  1EQR A;  3SHL A;  4DV7 L;  3GQB A;  3ES9 A;  2X3U A;  1VQF A;  2VB2 X;  4HR7 B;  4YIJ A;  3W2H A;  1EWI A;  3Q6S A;  1NTG A;  4P25 A;  3QJY A;  3CW2 C;  2JXM B;  2WPD A;  4MHE A;  3I4M B;  3PGZ A;  2OBR A;  5EMN A;  3HOV H;  4IW3 B;  3WNC A;  1QB5 D;  3RZO B;  1JNY A;  3GTL B;  4LBZ A;  1X65 A;  4X06 A;  4WZK A;  4EH1 A;  4DKA C;  4IUR A;  3CAM A;  4C3I B;  1HNX Q;  1Z47 A;  1HRJ A;  1DJR D;  2I07 B;  3CCU A;  2LFN A;  3PUW A;  2KED A;  3AQQ A;  1GAQ A;  1YBY A;  1S40 A;  2CWP A;  4IJH A;  1BCP D;  1CQV A;  4YAL A;  1PYB A;  1OHH A;  4JI3 Q;  2JE6 I;  3NP8 A;  4FF3 A;  1F2Z A;  2LS0 1;  3W2I A;  1OGJ A;  2YTV A;  2YV5 A;  4B3S Q;  4YWK A;  4HJ7 A;  4B3R Q;  2BF4 A;  2ICE C;  3D31 A;  5DS0 A;  4NXM Q;  1X3Q A;  3DXJ C;  1OXT A;  4H0L C;  1SE8 A; 
#chains in the Genus database with same CATH homology
 1YNN D;  4FXK C;  3ERQ A;  4K6L A;  5FL7 A;  1W0K A;  2B2T A;  5D3I B;  1YNJ D;  3OMC A;  4PMB A;  2R3Z A;  2RDG A;  3SK5 A;  1SYB A;  4UDU C;  2KEE A;  2F0W A;  2Z6B D;  1PZJ D;  4ZRZ A;  1PFB A;  2X53 S;  1G8Z D;  3MTS A;  1IKL A;  2D3L A;  4NKL A;  3PIP 3;  1EZ6 A;  2WKD A;  2EYO A;  4J8Q A;  3K7A B;  2KCN A;  1G2S A;  2ZZQ A;  1LTB D;  5IGF A;  4B3F X;  1HVX A;  2SNM A;  1V0F A;  3GD7 A;  2J7Z A;  2JP1 A;  3NUC A;  3PO3 B;  1TY2 A;  3T51 B;  1E2V A;  3S1N B;  3WQZ A;  1CI3 M;  1OXV A;  3AMU A;  3LWE A;  3CP2 A;  2EY6 A;  2NVQ B;  4CKB A;  4C3H G;  1SNC A;  4QUF A;  4QMG A;  1QCB D;  2FJ2 A;  1XYI A;  5JPM C;  1PDQ A;  2F1M A;  4AVZ A;  2NZ1 D;  4HN7 A;  2OT2 A;  1I4R A;  2PZW A;  1DD2 A;  3SDZ A;  2Y0S B;  4JMQ A;  4XKW A;  4GZY C;  3OAA A;  1II3 A;  5G3L D;  3SE0 A;  1RHP A;  1ENA A;  5E4W C;  2FHT A;  3FVQ A;  2V4D A;  2B8G A;  1RCV D;  5JAV A;  1JWM D;  4IZ8 A;  1R4Q B;  2OF1 A;  3LWU A;  1MSH A;  1KNE A;  3J80 E;  1W6J A;  1KLU D;  1G91 A;  2ZXR A;  1DOK A;  5M3M B;  5KNB A;  5FK9 C;  2LMC B;  3NBI A;  1GUO A;  2JEA I;  2L55 A;  2CK3 A;  4G7X A;  3M7N A;  1O7L A;  4CGY B;  3PUX A;  4AYB B;  1D5X C;  1BUV T;  3C2P A;  3SK6 A;  1DOM A;  2AWN A;  2F0I A;  2K04 A;  3IL8 A;  1JOR A;  2KJX A;  1HA5 A;  1SAP A;  3DEP A;  4KHV A;  1Y8N B;  3D3R A;  3VR5 A;  2ID0 A;  4C56 C;  4XOP A;  5BN4 A;  1EY0 A;  1A2U A;  5DEH A;  2F03 A;  5EPL A;  4R8I A;  3OEH A;  2CW0 C;  1B1Z A;  1LT3 D;  3HZX A;  5DAU A;  4XYO A;  5HGT A;  4NNJ A;  4DAY A;  5C0X I;  5KYL A;  2TSS A;  4G7Z C;  5LL6 X;  1QIL A;  2A69 D;  2XSC A;  1PTO C;  2HQE A;  2KVO A;  4EQO A;  2BE5 D;  3I72 A;  2HUG A;  1GXD C;  2PW7 A;  4FP5 D;  1TKW B;  4F87 A;  4IN3 A;  2QIL A;  1A2T A;  1QOH A;  1LTI D;  1O78 A;  4OL7 A;  3U9O A;  2R9V A;  1Z7T A;  3GVK A;  1QE6 A;  2XRQ D;  5CYU A;  3TBI B;  2D3N A;  1M8A A;  4KN7 C;  1ILP A;  2KQ3 A;  1DM0 B;  2K03 A;  1CQF A;  3NK9 A;  4WFN 3;  3G6J B;  1D5M C;  1ILQ A;  4WJW A;  1Q8I A;  2O2L D;  3V2T A;  2PNR C;  2E74 C;  4BA1 I;  1K83 B;  1JQY D;  1UD4 A;  4BBR B;  2X6L A;  3S9W A;  3GVJ A;  2H4O A;  4XN3 A;  3CU7 A;  4A3G B;  1STY A;  4RWS C;  2A6E D;  3W3A A;  2B2U A;  1LT6 D;  2PPB C;  2XRS D;  2LKV A;  3BYT B;  3KUP A;  1V1P A;  3BVM A;  2R61 A;  2ZT9 C;  4RCO A;  2RSN A;  3IFT A;  4QB4 A;  2ZXI A;  1STN A;  5KND A;  2F0U A;  3OWF A;  1EYC A;  3K6O A;  4P2C B;  4CJ1 B;  3GTP B;  1B50 A;  5DNF A;  1TY0 A;  2GJP A;  2ZZG A;  3D4W A;  1I3Q B;  2KHS A;  2EJM A;  3CES A;  4G7W A;  1PMR A;  1SNQ A;  1EYD A;  4G6I A;  5JOB A;  2XVS A;  4EQP A;  3T53 B;  3BDC A;  4QIW B;  2D62 A;  2V31 A;  1V1P B;  3DM1 A;  3NWS A;  5A2Q E;  4IFD I;  1XWE A;  4A3E B;  5D14 A;  1GUS A;  3UI2 A;  2IX1 A;  1STG A;  1H8E A;  4ILW A;  3JU4 A;  1S5C D;  4FO2 A;  1EFR A;  3N6R A;  4XLF A;  2JYO A;  1JOK A;  1UD8 A;  1U4R A;  1S4Z A;  3J81 L;  5DM7 3;  1BPL A;  1EOT A;  2WAQ B;  4G7O C;  4LK1 C;  2AQ1 B;  1HFN A;  1JOQ A;  1BCP F;  4KV6 A;  4EVO A;  4OO1 I;  2EJG C;  1IW7 C;  1I4X A;  3HOU B;  1ESR A;  2F3V A;  3J7A F;  4XDX A;  3DMU A;  4RGO S;  3S14 B;  1B2T A;  2K05 A;  3T13 A;  2F0J A;  1WTX A;  2F0H A;  1QNU A;  1F2L A;  1SSO A;  4V0B A;  1W9X A;  1I4Q A;  4IUU A;  4ZLT F;  2SNS A;  1B9M A;  5IOD A;  3D4D A;  4CJ2 C;  2WII B;  3A54 A;  1KNA A;  4RA8 A;  1A3U A;  3OE7 A;  1EU3 A;  5FOB B;  3E0J A;  2GK6 A;  2C5C A;  3M7G A;  2XOK A;  2LZJ A;  2MGS A;  4DA2 A;  3Q23 A;  1TT2 A;  4ZUJ A;  2EYF A;  4CJ0 B;  1TII D;  4PV1 C;  4OIJ A;  3T16 A;  2G9H D;  5HKK A;  1Y8P B;  3E5S A;  2X6G A;  4UZU A;  3V05 A;  3GV3 A;  3HOX B;  2IPK D;  1K8O A;  2K5W A;  5IT9 L;  3P7J A;  4DXG A;  2B2Y C;  4HMI A;  5FO9 B;  1OB0 A;  3D8G A;  4FF2 A;  2JJ1 A;  1FGB D;  1A3V A;  4IUQ A;  3VYT A;  2GK7 A;  1L0X B;  1H9M A;  2K7V A;  2A6H D;  1VMC A;  1PZI D;  5C4J B;  1SNO A;  2YYZ A;  3R2I A;  2NTS A;  2BOS A;  3U9S A;  5C6A A;  3CHB D;  1BR9 A;  1EQV A;  1TS2 A;  2M5S A;  5ELC A;  1WTP A;  5JVH 3;  1I18 A;  4C2M B;  1H9K A;  4XTC S;  2PMZ B;  4V19 0;  5M5Y B;  1S5B D;  2CHB D;  2JEB I;  1JWS D;  4IUT A;  1EY8 A;  2KOL A;  4E6I A;  3S2D B;  1S5D D;  1NUC A;  4WRD A;  1RDP D;  1SE4 A;  3GTQ B;  2F0Q A;  4K6D A;  5IGC A;  4C3H B;  4DNT B;  4A3M B;  4DAV A;  1DON A;  2W6J A;  1MGS A;  4O1N A;  1FD7 D;  5EBD A;  2E2I B;  4TT3 A;  2MUY A;  3J7Y W;  4HCE A;  1MBY A;  2YU9 B;  1I50 B;  1O7Z A;  2L5T A;  4DF7 A;  3I8Z A;  2NN6 G;  1A3T A;  3SR1 A;  2VB3 X;  3JAM L;  1STB A;  5IGE A;  3RLF A;  4JBW A;  2M2L A;  4RKL A;  4KHZ A;  4RHR A;  4XOT A;  5CDF A;  2BA1 A;  5TSS A;  1LTR D;  3NTI A;  4CHT B;  4CKC A;  4N9P A;  3BDL A;  1T5E A;  3IKJ A;  3J7A V;  1MSG A;  2L0C A;  1IKM A;  2X6W A;  2MHV A;  3A7A B;  5K5P A;  1BMF A;  4X3T A;  1WTQ A;  4GQN A;  4DGZ A;  3ERO A;  3C1E A;  2XNA C;  2X85 A;  3KEW A;  1BNZ A;  1WTO A;  4K14 A;  4YEJ A;  3GTM B;  1CTM A;  3MZ5 A;  4X3K A;  5T1G A;  2X69 A;  3QO2 A;  1MD2 D;  3HS0 C;  2F0M A;  4P22 A;  3GP7 A;  5D3D A;  5BN5 A;  4B9W A;  2RBM A;  5I6Y A;  5EPJ A;  4XT3 B;  1J8I A;  2WSS A;  1F9Q A;  4DK1 A;  4C1N K;  4XLA A;  5C0X H;  4L8J A;  2O4X A;  1ONL A;  4RAU C;  2JA7 B;  3HG9 A;  5CMD A;  1O7Y A;  1LTG D;  5J22 A;  3MVV A;  3MXU A;  3PO2 B;  1TVX A;  2HLD A;  4RGM A;  1ZYR D;  1B4O A;  1WTR A;  4Z1M A;  3CRL C;  1CZW A;  4II2 A;  5J39 A;  3DUZ A;  4IUN A;  4N9T A;  1WTW A;  2HCC A;  5EQ0 A;  3EVQ A;  1JE4 A;  1SE3 A;  3K58 A;  4A3B B;  2JDI A;  1QG7 A;  2K1B A;  3MFG A;  4TQU S;  2QF7 A;  2Z4H A;  4II3 A;  1FYC A;  5K36 G;  3VA7 A;  4A3I B;  4HAE A;  1KAB A;  3HP3 A;  1OO9 B;  3TP7 A;  1EY5 A;  4ULL A;  1PLF A;  2K6A A;  3NXW A;  1VMP A;  3NTK A;  4S3S A;  1CM9 A;  4NP5 A;  4PMW A;  1RF2 D;  3L3O C;  5FLX E;  2Q8R E;  1DZ1 A;  3MXN A;  3R3O A;  4HMJ A;  1CK1 A;  1JOO A;  1I6V C;  4E0F A;  4ASU A;  1H9J A;  3OWE B;  1UNS A;  1AN8 A;  1PTO H;  1AEX A;  1SDF A;  3RUZ A;  2F0V A;  5C4X B;  2GJK A;  1NR2 A;  4DN4 M;  5EPK A;  2A68 C;  3X3M A;  2L9H A;  1M4V A;  4DAP A;  2WV6 D;  4LJZ C;  5KIX A;  1JC7 A;  1C48 A;  2Q8I B;  2PZU A;  2O5I C;  2EYJ A;  5T1I A;  4HCS A;  2J4X A;  1RTO A;  3A8K E;  1IW7 D;  2QEJ C;  1RKN A;  4FF1 A;  3I91 A;  4XXE A;  1NSN S;  1UAP A;  2NN6 H;  2KA7 A;  3I90 A;  3GO5 A;  1E1Q A;  3L9A X;  4ME5 A;  1SMY C;  4F88 A;  2C9O A;  1SYF A;  3OEE A;  3OIQ A;  1WVL A;  2XND A;  1SND A;  3VYR A;  2B63 B;  1LTT D;  1WD0 A;  2XZL A;  2QCP X;  4I65 A;  5AFW A;  2VUM B;  4YEL A;  4TSS A;  1EYA A;  4I7Z C;  3S17 B;  1TWA B;  4NW2 A;  2A73 B;  3S16 B;  4DK0 A;  2B39 A;  3HOV B;  2GA4 B;  4X3S A;  5C3E B;  2D2C C;  3TP8 A;  2FFK B;  5C44 B;  4QF4 A;  3KLS X;  4OHJ A;  1EWH A;  2K33 A;  4RKB A;  1KTK A;  3PUY A;  3BDO A;  2NVY B;  2W6I A;  2ZZE A;  1CT1 D;  5JPN C;  4NMZ A;  2ZXH A;  4ZAI A;  4G4K A;  4RCN A;  1U9R A;  5CV5 A;  3R8B A;  3VR3 A;  3QB3 A;  1ET6 A;  3A56 A;  3J80 L;  3O13 A;  3IAY A;  3FKI B;  5I4D A;  1C4Q A;  3FMC A;  1TS5 A;  2K5D A;  3AB9 A;  2L12 A;  2RSO A;  3DDY A;  3VA5 A;  3TP5 A;  3P75 A;  5CGK A;  2R93 B;  3BC9 A;  1VF7 A;  1BCP C;  3H91 A;  1UD3 A;  1LT5 D;  1EU4 A;  2ZTG A;  3OOC A;  3HAG A;  1HXY D;  2B2V C;  2EY5 A;  1SKY B;  1D6E C;  3M4Y A;  2B8F A;  3H6M A;  4A3F B;  1TR5 A;  1YNJ C;  1STH A;  2NTT A;  3HEJ A;  3NBH A;  5K36 H;  3M3Y B;  3MEH A;  1SFO B;  1DYQ A;  1I4G A;  4LMQ D;  4KN4 C;  5M5X B;  3BS1 A;  2XWJ B;  5CV9 A;  1HPC A;  1I6H B;  3GTO B;  2R7Z B;  4YXW A;  2ICI A;  3ND8 A;  3BH4 A;  2SDF A;  5COY A;  3ZIA A;  1WPC A;  4Q0F A;  4IQZ A;  1CZG A;  3P1H A;  2AUK A;  3EQL C;  4KI0 A;  3OPO A;  3I73 A;  3OW7 A;  5M3F B;  3S1M B;  2Z8L A;  3KLS A;  1STE A;  4OIK A;  4A3K B;  4XLE A;  1WCM B;  3CP8 A;  3I70 A;  1U4M A;  1UUP A;  3G7L A;  3D6C A;  5M5W B;  2F0E A;  1AW7 A;  1J9O A;  4UAI A;  2V7Q A;  3PMF A;  1B3A A;  1PTO B;  1D5Z C;  3OIP A;  5EKK A;  4K8J A;  3TDQ A;  4B08 A;  2IX3 A;  1A6X A;  2JIZ A;  4DNR B;  5CBA E;  3LX0 A;  4RGT A;  4ZKB B;  2F0G A;  3A7L A;  1PZK D;  1VDZ A;  1Y1W B;  2ZXO A;  4KY5 A;  3A3G A;  4BY1 B;  3HOZ B;  1JWU D;  3K57 A;  4XR6 A;  4RH6 A;  1PRT C;  3K5O A;  2F0P A;  5IK2 A;  4K8I A;  1HFG A;  1EFI D;  3VR4 A;  1VF5 C;  2FIN B;  1IYV A;  1TWG B;  1I8D A;  1W6K A;  2VJI A;  2KUM A;  2E2J B;  2H1E A;  1UD5 A;  5C0X G;  1GHK A;  2IX0 A;  2X6Y A;  2EJF C;  4G7H C;  1SNM A;  4PMC A;  1GUT A;  2KCC A;  5KEE A;  4XM3 A;  4B3G A;  1JIC A;  1R9T B;  5I9P A;  1SBB B;  3MFY A;  1HQM C;  5E3F A;  1G6Z A;  5D65 A;  1WTH D;  3I4L A;  5KRU A;  2WJV A;  2CVR A;  3KLR A;  1SYC A;  2E1B A;  4C3J G;  4FXG C;  5A2Q L;  3QG1 A;  5C3W A;  1XX8 A;  3HOW B;  4KKU A;  5I2Y A;  1QWY A;  1FNW A;  2RVL A;  4BBS B;  3G05 A;  3ITP A;  4KJO A;  2PZT A;  2M00 A;  5F2D A;  1EEI D;  1SYD A;  3QOJ A;  1OXU A;  3QWN A;  1HUN A;  1DOL A;  3WOE A;  5IGG A;  1KZL A;  2A68 D;  3KBX A;  4X3U A;  5FKA C;  2SEB D;  1E1R A;  1UEA B;  2F0L A;  1NCV A;  3MA2 B;  1HA6 A;  4DU9 A;  5E1F A;  2WZP P;  1E0B A;  2NBF A;  1WD1 A;  1I4H A;  3FDT A;  3NPP A;  1SEB D;  5CV7 A;  4F7X A;  5C4Z A;  2KEC A;  4DFA A;  2ZXP A;  3P20 A;  1AP0 A;  3QIA A;  5FO8 B;  1Z6H A;  5C3X A;  5JEA H;  1Q1E A;  2AQ3 B;  4ZUI A;  3K5L A;  2DNE A;  1RTN A;  2RDF A;  1F77 A;  5G3L F;  2XZP A;  3MAQ A;  4MN3 A;  5CV6 A;  1PRT B;  1BBX C;  3K5N A;  1EIH A;  5C4H A;  4XYQ A;  4KY7 A;  3A3B A;  4XN0 A;  4JK1 C;  2B2W C;  3VR2 A;  2XZO A;  4RHS A;  2CW0 D;  4K2K A;  3E6Z X;  1LT4 D;  3W2D A;  3TSS A;  4IFD G;  5E4X A;  2WJY A;  2NVX B;  1E2W A;  2EXZ A;  1KAA A;  1V0E A;  4A3J B;  1PTO D;  2IT1 A;  5DN6 A;  2MJ8 A;  5ELF A;  2B2Y A;  1K8M A;  2F0S A;  3NSW A;  2SOB A;  3S15 B;  3S1R B;  2D5D A;  1DXM A;  1PKV A;  4WOR A;  2R92 B;  1TS4 A;  2XWB B;  3ND9 A;  1LV9 A;  2PYK A;  1T5X D;  2DNC A;  1HCZ A;  5HUR A;  1EY7 A;  2NUC A;  3BVZ A;  4K5V A;  5KNC A;  1JCK B;  2DIE A;  1H9R A;  5EBC A;  4HED A;  3NTH A;  1ML0 D;  1PFM A;  3DWP A;  2G9D A;  2F0T A;  3MXP A;  4XL9 A;  3HRZ C;  3D6W A;  4OO1 G;  1JR0 D;  1BXT A;  2ZTN A;  4Y7N B;  5NUC A;  4LAA A;  5ISR A;  2F0N A;  4FYD A;  1Q3L A;  2R6G A;  2VJJ A;  1BOS A;  3SEB A;  3SVM A;  4HSV A;  4CBV A;  1E2Z A;  1ZEQ X;  3VYU A;  5EKL A;  3F2U A;  1FX0 A;  2X6X A;  1HZE A;  4XQN A;  2B2W A;  2L4N A;  1FR3 A;  3T4A C;  1BQQ T;  1SYG A;  3VYS A;  2EDG A;  1AZQ A;  2WP8 J;  5C0X J;  2HCI A;  2JA5 B;  5KNL A;  3RMH A;  1HTP A;  1SXT A;  1COW A;  2K5Q A;  1TQO A;  2E75 C;  2LY7 A;  1S5E D;  4CKE A;  5EKI A;  1GOZ A;  3EJI A;  3S1Q B;  1UD6 A;  3TN2 A;  1DCZ A;  3TME A;  3H94 A;  2X8K A;  3SXH A;  1F9P A;  2GJR A;  2JJ2 A;  1JB3 A;  3EA6 A;  3MHB A;  2E2H B;  4FNF A;  3R2T A;  5KGU A;  1EEF D;  4PQX A;  3FKS A;  3NQT A;  3KF8 A;  1HQR D;  4KY6 A;  2FMC A;  3FPU B;  5EJW A;  3SK4 A;  1EL0 A;  3V96 A;  5ELE A;  2JA6 B;  5JVG 3;  1AFP A;  5M9O A;  3MC0 B;  2VXW A;  2EY1 A;  1F9R A;  5ELB A;  4XLC A;  1SJE D;  1ENC A;  4XMY A;  3HGB A;  3OHX C;  4QCL A;  1LO5 D;  5IIF A;  1HUM A;  1C8C A;  5I2X A;  1XTC D;  4TRD A;  4L6T B;  1LLR D;  2AWO A;  3OMG A;  3FRP B;  4HTH A;  2N55 A;  3X3N A;  5CC4 A;  3BVG A;  4BA2 I;  4XLH A;  5KYI A;  2OXP A;  3VR6 A;  1PRT D;  1TS3 A;  3QOL A;  4ODG A;  3A8I E;  3C46 A;  4C3I G;  3Q0A A;  3K5M A;  4XQJ A;  1H9S A;  1K28 D;  3IFD A;  2PO4 A;  3ONA B;  1XXG A;  3M4O B;  2IWH A;  3ZYY X;  1IL8 A;  1OXX K;  1KDA A;  2BDO A;  2RA4 A;  2A74 C;  5A35 A;  3DEO A;  3KBG A;  2E76 C;  1F2M A;  4U68 A;  2A6H C;  2RQX A;  2JA8 B;  4IFD H;  1D1I A;  4F8M A;  2XN9 C;  2WIN B;  1VJS A;  3A8J E;  1HTL D;  2Z1C A;  3PUZ A;  3T56 B;  4IAL A;  1V1O A;  3I4N B;  2L11 A;  1SNP A;  1EQT A;  2NWG A;  3TP6 A;  1H9S B;  1RJT A;  4IFD J;  4ZQ3 A;  5CV8 A;  4RFB A;  4KKT A;  5IGB A;  3URY A;  3R93 A;  1EY4 A;  2PQE A;  3WDN A;  2BCO A;  1ESF A;  3PIO 3;  2IJ0 A;  4KTA A;  1BF4 A;  3GVL A;  5FLX L;  1EWC A;  2EVB A;  4O42 A;  2J0T D;  1ZXT A;  1CHQ D;  2EZV A;  1X3P A;  1SE2 A;  4A93 B;  1IHZ A;  4U67 3;  1E43 A;  1A15 A;  1TU2 B;  2BA0 A;  2B2U C;  4KD4 A;  1F9S A;  1STA A;  1OXS C;  2EYM A;  4FXU A;  1FNU A;  2VNU D;  4OO1 H;  4QUC A;  1BDO A;  5C5M A;  1PYW D;  4ZYS A;  1U4P A;  3CKI B;  4K5W A;  1KDB A;  4XT1 B;  4Q5V A;  3DWA A;  2DN8 A;  2K28 A;  4H7B A;  3RD4 A;  4MIU A;  4KJN A;  4C1N I;  1Y8O B;  3N52 A;  5LHY 1;  1QJO A;  1X32 A;  4DXF A;  2WKC A;  4ID6 A;  3KK7 A;  4KD3 A;  4K5X A;  2I46 A;  5EGT A;  2EYH A;  3H3V C;  2HDL A;  2F0K A;  5LL6 S;  3BCF A;  2EYP A;  5IGD A;  2FMM A;  2E2D C;  2N88 A;  1YNN C;  1GUN A;  5I6W A;  3WOF A;  2QE7 A;  2NVT B;  3H0G B;  4FXD A;  1B44 D;  3S2H B;  4XD7 A;  1NR4 A;  5JEA G;  5DM6 3;  3J81 E;  3BG3 A;  1Q12 A;  3FEW X;  4BWG B;  4J6H A;  3Q24 A;  4C3J B;  4XOR A;  3FPP A;  3HOY B;  1L0Y B;  4XQF A;  3PUV A;  1TWF B;  1G29 1;  2K01 A;  2CQA A;  4TSF A;  5CR3 A;  5CBE E;  1ZYR C;  3GV6 A;  1Y69 U;  2AQ2 B;  1KDC A;  4NDX A;  1LAB A;  4XQQ A;  1W0J A;  3BZD B;  4BS9 A;  3OFN A;  3BCD A;  1MI2 A;  1CA6 A;  2XGJ A;  1MAB A;  2Z4I A;  2AUJ D;  2EE1 A;  3M85 A;  1Q1B A;  4ABN A;  2F4I A;  4IUV A;  2OEO A;  5FO7 B;  1QNK A;  4Z9C B;  4R9W A;  1UD2 A;  4ZK9 B;  2B2V A;  5C5L A;  3K59 A;  3PV0 A;  2KVM A;  2NN6 I;  3TZU A;  4EGV A;  4XIG S;  1AZP A;  3LNN A;  1PTO F;  5IT9 E;  1EZ8 A;  5COR A;  4XON A;  2XIW A;  4K2L A;  2IL8 A;  3GTG B;  1V43 A;  5CV4 A;  4OGQ C;  3K0Y A;  3MWY W;  2RDH A;  4M1U B;  3CMM A;  4H13 C;  2Q8T A;  1GJX A;  3CQZ B;  5J1Z A;  2F3W A;  4KK7 A;  5JJZ A;  2ZZF A;  2O5J C;  1BCP B;  1NAP A;  1LTS D;  3C3L A;  1EY9 A;  1S5F D;  1BLI A;  3Q22 A;  4HIZ A;  3MXG A;  1O80 A;  2BDN A;  1SJH D;  1GUG A;  1KLG D;  2PW5 A;  1EIG A;  4KKS A;  1V8Q A;  4J1M A;  2F0O A;  1WP6 A;  3NE5 B;  1IYU A;  3NQI A;  4HSP A;  3NHH A;  2EYL A;  1B9N A;  1ZKO A;  1E79 A;  3ZPN A;  2WB1 B;  3RZD B;  4PNY A;  3CRK C;  2ENB A;  1WTV A;  2HDM A;  1LTA D;  1NRK A;  4FVM A;  4H44 C;  2F43 A;  2PCF B;  2K32 A;  1PFN A;  1NBM A;  2EOT A;  4TKO B;  1E3X A;  1PXU A;  3OSO A;  3A55 A;  3D4R A;  1BO0 A;  1SYE A;  1CFM A;  2A5H A;  3JAM E;  2D9U A;  2L1B A;  1RD9 D;  1GUW A;  2EPB A;  3I3C A;  5BN3 A;  1VLY A;  4L63 B;  2RKS A;  1I4P A;  4KMU C;  2A69 C;  4ZKC B;  1EY6 A;  5I9O A;  1U4L A;  2BE5 C;  3A35 A;  1E3Z A;  3TZD A;  3H09 A;  3HKZ B;  1Q90 A;  2NYZ D;  2TMP A;  2MP1 A;  3DHQ A;  3GTK B;  2M9V A;  3AU7 A;  1TWC B;  1R4P B;  2QKI C;  4XKV A;  1CA5 A;  1GHJ A;  3C1F A;  3EFX D;  4A3D B;  4EQN A;  1G2T A;  1SMY D;  1D1K A;  4R8N A;  5JEA J;  1B53 A;  2B2T C;  5ELD A;  3SK8 A;  1H8H A;  2DY8 A;  3NWT A;  4FF4 A;  1ENF A;  1Y1V B;  1KMH A;  1CHP D;  4B9X A;  2WAC A;  4G57 A;  2NB0 A;  4RGN A;  2F0F A;  2F0D A;  4IUP A;  1PRT F;  4XNF A;  3BYY B;  2DY7 A;  5IOC A;  1VCI A;  1F2Y A;  1ET9 A;  2EY2 A;  4M8A A;  3GTJ B;  1TWH B;  2IW3 A;  3DWQ A;  1HHV A;  2A6E C;  2JSO A;  4BY7 B;  2MPM A;  3L7Z C;  1D2B A;  1ROD A;  1LAC A;  1FNV A;  1ICW A;  2QDB A;  3SHL A;  3GQB A;  4HR7 B;  2VB2 X;  4YIJ A;  3Q6S A;  3QJY A;  2JXM B;  2WPD A;  4MHE A;  3I4M B;  1QB5 D;  3RZO B;  3GTL B;  4IUR A;  4C3I B;  1Z47 A;  1HRJ A;  1DJR D;  2I07 B;  2LFN A;  3PUW A;  2KED A;  1BCP D;  1CQV A;  1OHH A;  2JE6 I;  3NP8 A;  4FF3 A;  1F2Z A;  2LS0 1;  2ICE C;  3D31 A;  1X3Q A;  3DXJ C;  1OXT A;  4H0L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...