3T56B

Crystal structure of the pre-extrusion state of the cusba adaptor-transporter complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
322
structure length
322
Chain Sequence
b'ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein CusA
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 57
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t56B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t56B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t56B01
1IYUA 1V8QA 1ONLA 2E75C 2O5IC 4KN4C 3PV0A 1HCZA 4OO1H 2BE5D 3A7LA 3LWUA 2QF7A 2EJMA 3VR4A 1IYVA 1V43A 2A6HD 3M85A 1H9MA 3GQBA 4IQZA 1H9JA 3A8KE 2BA0A 1ZKOA 3FPPA 2L5TA 3VR2A 1DD2A 1E2VA 1GUTA 1T5EA 3BDOA 3U9SA 5BN4A 2ZT9C 4JK1C 1GUGA 2E76C 5K36G 4H13C 4BA1I 2NN6G 4JBWA 1Y69U 4G7ZC 3L7ZC 1QJOA 2AWOA 3PUZA 1TU2B 3OW7A 4DNRB 1GUOA 1Z7TA 2BA1A 1LABA 3NE5B 2D5DA 3MFYA 3PUVA 3VR6A 3PUWA 1OXUA 3IKJA 3P20A 4PV1C 4KHZA 4XTCS 5KNBA 2IT1A 5C0XH 4DK0A 3I4LA 4KKUA 3W3AA 2E74C 4G7HC 2KA7A 2YYZA 1O7LA 3I72A 1VF5C 1FR3A 1VCIA 2LMCB 3MXUA 3T53B 3IFTA 4IFDG 1Q90A 5K36H 5A35A 1B9MA 2EDGA 2A68C 2A6EC 4L8JA 3VR5A 2JXMB 5KNCA 3A8IE 5JEAH 1H9SA 2K7VA 1B9NA 2EJFC 4KMUC 4BA2I 3VA7A 5BN5A 4KKTA 3OPOA 1TKWB 1DXMA 2PCFB 3SDZA 1YNNC 1SMYC 3H94A 1HPCA 3D4RA 3EQLC 3ND9A 1G291 1FYCA 1E2WA 2PNRC 1GHKA 3A8JE 3CRKC 1Y8NB 2F1MA 3GD7A 4HR7B 4DK1A 4OGQC 1CI3M 1HQMC 4IFDH 4LK1C 2BDOA 1HTPA 4OO1G 3TZUA 1Y8PB 2EJGC 3DXJC 2DN8A 3QG1A 3WDNA 2B8FA 1ZYRC 2JE6I 3QIAA 2V4DA 4TKOB 1CFMA 5KNDA 1Q1BA 2NN6H 2JEAI 1LACA 1O78A 2BE5C 1VF7A 1I6VC 2A6HC 3SE0A 3N6RA 2D62A 1CTMA 1OXXK 2DNEA 2KCCA 3CRLC 4I7ZC 3VR3A 3M7NA 1IW7C 2JEBI 3LNNA 2D2CC 4KKSA 3AB9A 3KLRA 4LJZC 2PPBC 2CW0C 1A6XA 1VDZA 1E2ZA 3M4YA 1GUSA 1H9RA 2O5JC 1K8MA 1H9KA 1YNJC 1GHJA 2A68D 2NN6I 2AUJD 2A6ED 4KI0A 4GZYC 2K33A 4DNTB 3QJYA 3FMCA 4H44C 3HGBA 2DNCA 4RCNA 5C0XG 2A69C 2EVBA 2B8GA 1BDOA 2R6GA 3A7AB 2Q8IB 1K8OA 2AUKA 1IW7D 1Z6HA 1DCZA 1EWHA 4KN7C 5BN3A 4G7OC 1GJXA 3T51B 1Q1EA 3PUYA 1H9SB 3OOCA 1GUNA 3RLFA 4H0LC 3I73A 1Q12A 5JEAG 1OXTA 4TQUS 3D31A 3ND8A 2A69D 3BG3A 1OXSC 3PUXA 1PMRA 4XIGS 1Y8OB 1OXVA 3T56B 2K32A
chains in the Genus database with same CATH superfamily
4A3BH 2VJIA 3LWEA 3MVVA 2E75C 2K6AA 3I55A 2XRSD 5TR9A 1I94Q 3VR4A 3WNDA 1V43A 1IYVA 3U50C 1H9MA 3D26A 4IQZA 1NTGA 4P25A 1EP1B 3U6BA 1KNAA 3HOWH 1KABA 3G48A 1IBML 5A2QE 2NZOA 3BNWA 3ZC3A 1U4RA 4Q7JB 1FL0A 3EFXD 4BA1I 3X3MA 1TWAH 2KHJA 4RKLA 4X62L 2XNDA 4YALA 2EY6A 2WZNA 3ZBTA 3NE5B 4OX9Q 2UXDL 2R9VA 2F4VQ 3RMHA 3S1RH 2FINB 2RDHA 1B4OA 4LUZA 1PTOD 1STAA 2N8NA 3ULLA 5C4XH 4Y7CA 3B6YA 3K7AB 4KKUA 2VL6A 1ZUNB 3WBKA 2AWNA 2EQSA 4YCVA 3J81k 2QN6A 2RHQB 2JN9A 2K5DA 2FMMA 1V0EA 1OGJA 1LT5D 3MXUA 3KJOA 3C1EA 2XN9C 2X6WA 4R4IA 4Z4ZA 3GTQB 1E43A 2KEDA 4RM0A 4MN3A 1JA1A 1Q3LA 3A8IE 1WTPA 2ZL5A 4ZCKA 4OWWB 4PMWA 4RGMA 4AF7A 1RQRA 2F1LA 4EVOA 3VA7A 2CWPA 4F87A 3HOVG 4A3GB 4TN1A 4HIMA 4ASUA 5M3MH 1GM5A 1VJSA 5C5LA 1TVCA 1D5MC 2YU9B 4GNXC 1D2EA 3AVWA 4JI6Q 4XT1B 1G6ZA 3G7LA 2NBFA 3OZWA 2R7DA 1EYAA 4F88A 1N36Q 1E1OA 4A3GG 2V7WA 1LUZA 3S17H 2EY5A 3HOXH 4RGOS 1GO3E 2EY1A 1VF7A 2ZL6A 3JAME 2SNMA 4DUYQ 4P12A 1SNQA 3D6WA 1SDFA 3M4OB 4DR4Q 2K14A 1YHQB 1HZEA 1JJ2A 1S5FD 1PA6A 4A4IA 4LF5Q 1MJEA 4OP7A 2JA7H 5KIXA 4WZTA 1JOKA 1YX2A 4QL5A 1VQ8B 2FHTA 1YJ9B 2DNCA 5DN6A 2K5VA 4LUOA 4C2MB 4EQNA 4IO9A 2Q8IB 4A93G 4XDXA 3K7UC 5EMNA 1D1NA 1XMQQ 5IT9c 2Q2HA 2R7ZB 4QGUA 1WOPA 1E64A 3OOCA 4XD7A 2OTJB 2WFWA 3OJXA 1O80A 1ZM2A 1KNEA 4U673 3PO3H 3S15H 2F0HA 1Q12A 3ND8A 4BBSH 2XTIA 1EYCA 1A3UA 1GR1A 5TSSA 4POGA 3ERQA 1JB3A 2R7ZG 2CF4A 4Z1MA 1G8ZD 4NXMQ 2F0VA 2QF7A 3M3YB 2K03A 3NTKA 1RJTA 2KOLA 5J3BA 4JI7L 1KQSB 1PTOF 1SKYB 1Q82D 3ONYA 1LTID 1K73C 1WPCA 1IBLQ 3RNUA 1MSGA 4N9PA 2JP1A 1UD6A 2IY5B 2ZT9C 3TP7A 2XWBB 2DYIA 4MYUA 1AIPA 1YVCA 3D4DA 3L7ZC 1QJOA 3PUZA 3F2CA 1RTOA 1Z7TA 4KK7A 1EY5A 4PNYA 4M1KA 2HD3A 2LSSA 4XLHA 1B7YB 4DNIA 1ZM9A 3CXCA 4H9GA 3DM1A 2VJJA 5DM63 1JT8A 4DK0A 2X0KA 2L55A 3KBGA 2F0WA 4CJ1B 2NTSA 4PG3A 2EYLA 2ZXIA 2AQ1B 4R9WA 4HJ5A 5E7NA 3IFTA 1A8VA 2EYOA 3CPWA 3GTKB 3CF5A 2XOKA 1FGBD 2Y0SB 3OAAA 4L63B 3NENA 3K81C 1DG1G 1PZKD 4P75A 3CRZA 3RY8A 1DARA 1EOTA 1Q81C 1DXMA 4X65Q 5D65A 4DPGA 3AGQA 4OWTB 1VQAA 3WOEA 3HOZH 5EBDA 5G3LD 4YHHQ 2L0CA 3BH4A 1MRZA 5D3IB 2VXWA 2Y0SG 1OB5A 2RF4A 2V7UA 4Y9RA 3NHHA 1E3XA 1D5ZC 1KAWA 3V05A 4JG2A 1AFPA 1HJPA 1CA5A 3GV3A 2EOTA 1WOOA 4YWKA 4A3BB 2EYHA 2F0EA 4QVJA 3OIQA 1SEBD 5M3FH 1KK0A 4IFDI 1QUQA 4IN3A 1V9PA 4XN0A 4DR7Q 4I7ZC 4QIWB 3HP3A 1BVSA 5JJKA 3QOJA 4ZCIA 1A6XA 2WR8A 1TS5A 4HIOA 2BH8A 3OEHA 2UXBL 3S1NB 1K8MA 1YNJC 3HOWB 1STYA 2A6ED 2UUAQ 1WU8A 2K33A 4A3BG 3I56A 1SNDA 1UE7A 5NUCA 4JI5L 1TWAB 4AH6A 3ASRA 3K5OA 4O42A 1EWHA 1ILQA 1F2MA 5T1IA 3HS0C 1TS2A 3H0GH 4RPBA 3S1RB 1E62A 5IIFA 3U2QA 2GN5A 1STEA 5C4XB 1X9NA 3KLSX 4CKEA 3HOWG 3M4QA 3FEWX 1Y14B 4UZEA 2DETA 4DA2A 1HA5A 1KZLA 1I18A 1CQFA 5JJZA 2E1RA 4A3MB 4WJ3M 1J6QA 4BY7H 1OHHA 5JEAJ 4C3JH 1RD9D 3MXNB 1YIJA 1LT3D 4MHEA 3UE1A 5C4XG 3GQBA 2WB1E 1NR4A 3OP1A 1XFOA 1II3A 3U9SA 1PXUA 3CMEB 2E76C 3F8TA 2BF4A 4TT3A 4LF8L 4ZQ3A 2Z6KA 5HY6A 1JMCA 3VO1A 2LXJA 4H02A 4A3MG 1CQVA 4DNRB 1I5FA 1LTAD 2BA1A 1TWGB 3CD6A 3S2HH 2ASBA 4B3RQ 2IT1A 3S17B 4QCLA 1BCPC 4KY5A 3HOXB 1IJFA 5G3LF 2AQ2B 4K2KA 3W5HA 3NBHA 5ELCA 4IPHA 4UAIA 1B3QA 3BDCA 1WTHD 1VQPA 1N06A 4DV3L 2JA5H 2F0IA 1QZHA 1M90D 1OO9B 3NELA 4LWCA 5IYBH 3GTPH 4XQJA 4HJ7A 2VUMB 2F0QA 1VQLA 2K1BA 4Z4UA 2GQFA 3B8HA 2XVSA 1VQOA 1B50A 4IFDJ 3AU7A 3CRKC 5JJLA 2SEBD 4DAPA 1G7SA 1RTNA 1DOKA 3GD7A 4PZ7A 2E2JH 3V76A 3S15B 1DDIA 4FO2A 1PJ5A 3CP0A 1QG7A 3PSIA 5EKLA 1F2ZA 4LF9L 2VUMG 4BBSB 1HZCA 4IJLA 2AHOA 4DV2L 3CCJA 4JI1L 1LACA 1MHWC 2J7KA 3FPKA 4NXML 3C1FA 1COWA 1EY4A 1YZ6A 1N34L 3N6RA 3ULJA 3CCLB 2OQ0A 2JEBI 2UXCL 1SYGA 1J8IA 3AB9A 4LJZC 5ELBA 4CHTB 5BR8Q 2B2UA 1WYDA 4BBSG 3TEHB 3JQRA 5CBEE 5FLXL 2X6YA 3HGBA 1I4XA 3U6KA 2BDNA 5C4JH 4G7OC 1K28D 4DK3C 4V0BA 2P5ZX 3TMEA 4IUPA 4DV5Q 3OTOQ 5LMNL 1K83H 2E1BA 1D8LA 1DJRD 3M4PA 4C43A 1JB7A 4M2LA 4X07A 2IX1A 4ZYSA 4GKKL 4Y52H 5CBAE 4EQPA 4XL9A 4B3FX 4K0KL 1Y8OB 4IPCA 3Q6QA 4CKBA 4XQFA 4P74A 1ONLA 3VNVA 3I2ZA 3QFCA 1EFUA 3GTOH 1TWCH 3LX0A 4QHYA 2GREA 2X85A 2EYFA 2QGQA 1ICFB 4FF2A 4DR6L 2QA4B 1CZGA 3PF5A 4GS3A 1PH8A 1B70B 1E2VA 4C3HB 1XPUA 5FL7A 4JI4Q 2QGGA 1QUEA 3Q8DA 3NPPA 4X7DA 4DQLA 1EY6A 3GTGH 2I1LA 3QFTA 4TMWA 2PMZE 3CU7A 4ODGA 2L11A 1YITA 3CC4B 1HFGA 3FKSA 4LFCL 4PGOA 5IGBA 4RD2A 3OW2B 2NVQH 4GKJQ 1DDGA 1K8GA 4DR2L 5C4ZA 1L0XB 1PHJA 4XMYA 5CYUA 4C3HG 5M3FB 2A73B 1UD5A 2B2YC 2N3SA 3ISXA 3E0EA 4OL7A 4AYBE 5C44H 2QTZA 5TV2A 5C3EB 2EDGA 4XYQA 3R3OA 1SYCA 3OWFA 5C0XI 4IOAA 1F9RA 1QB5D 3A0JA 2RDGA 3KUPA 4BXXH 1FRNA 2IL8A 3VMFA 1EIFA 5M3FG 1VQ6A 3G6EB 2QCPX 4JOIC 3RLNA 1VQKA 1O7YA 2XNJA 2EPBA 3D4WA 3OMCA 2OQKA 2W6IA 2VQEQ 5FIUA 4UHVA 3H0GB 4HR7B 5C3EG 3J80L 3BVMA 5E3FA 4B3SQ 1Q8KA 1Q81D 2DERA 5JAVA 4Z4RA 2JIZA 3GSIA 2BV3A 3DXJC 2LZJA 4NMZA 1KDCA 4ZGNB 3M7GA 1L1OB 1LTTD 1QG0A 2ZTDA 2L1BA 2MHVA 1IBKL 3L9AX 1F2LA 4ID6A 2B2WC 1O78A 2KHSA 3VYTA 1U5KA 5C3XA 1FNVA 4JI2L 3H0GG 4Z9CB 4JBKA 1M4VA 1D6EC 2D62A 3M7NA 4C3JB 3KYHC 4G4KA 1KXLA 1EWYA 4RHRA 3GV6A 2CVRA 1U0LA 1K8AC 3SK5A 2BH2A 1QX4A 4RFBA 1AE2A 4Z4TA 4BWGB 5C0XG 1QE6A 1YHBA 2EYPA 1WTVA 1SSOA 2RDFA 5I6WA 2Q6LA 4TMTA 5I4DA 5JVG3 4LF7Q 4O1NA 1GAQA 3ZBUA 1EEID 2H4OA 3LQ6A 1X6OA 1SNPA 1JJCB 3K7AH 2JYOA 2NV4A 1KTKA 4NW2A 3HOVH 1NDHA 3AYHB 4X05A 2B2TC 4J6HA 4POFA 3ZJYC 1FJGQ 1EFTA 1JE4A 2QDXA 1CSQA 1LLRD 1CNFA 1BR9A 3GTQH 1G6PA 2B2VA 2WINB 2JA5B 4OOVA 4LFBQ 1GAWA 2YV5A 1C4QA 3G4SA 1J5EL 3E3XA 1SNMA 3H3VC 1XXGA 4DXFA 4WZKA 3M85A 2GK7A 2AKWB 2AMCB 4RDJA 4IW3B 1W2BA 4RD0A 1SE4A 1X56A 4RD6A 2C35B 4B3MQ 1BQEA 3QFSA 2XZLA 3MEFA 2K75A 4A3EB 5LMUQ 4N3NA 1ET9A 2HCIA 2YU9H 1Y69U 5LMZA 4JI3Q 3BYTB 4MTKA 2JA5G 3P1HA 1PJ6A 2A74C 2XEXA 4XYOA 4IUNA 2UUCQ 4PC6A 1YHQA 4ACBA 2HMAA 4DR5L 4RDLA 2MP1A 2PZWA 1D8TA 2D9UA 5KGUA 1AMOA 2E74C 2KA7A 4A93H 4HCSA 3V96A 1BX0A 4A3EG 4A3DG 2DIEA 2MFIA 1CQXA 1X3GA 3CW2C 5IOCA 3HZXA 1TLLA 1A3TA 1EYGA 4OXPA 4RD1A 3VYRA 4X06A 3SEJA 1B9MA 1WDTA 4RCZA 1PH7A 4FXKC 1BOSA 2AQ3B 1GVPA 2K7VA 2OTJA 3K8AA 2K50A 4XLEA 3CCMB 1ESFA 4GN4B 4JI0L 2MO0A 4UPAA 2R7ZH 4J0QA 3SLNA 1IHZA 2UU9L 1BBUA 2CQOA 4OGQC 1N0VC 3TP5A 1N32L 5IWAL 1D2BA 1KQSA 4RLZA 1HNZQ 3QB3A 3T1HL 1JQYD 2K05A 2F0UA 4RCOA 3VYSA 4IURA 1A8PA 3E5SA 1Q86C 3ZZUA 3J81i 4YEJA 4JMQA 3MAQA 2KCMA 4R1JA 4DV0Q 2A6HC 3CCUB 1TWCB 3M3YH 2UUBQ 1STHA 2KQ3A 1I6HB 4NXNL 3NBIA 3PIPA 3A8JA 1W35A 1PRTB 4IZ8A 4NPSA 1TS3A 3KDFB 4UDUC 4JV5Q 4DNTB 3PA1A 3GTGB 3MTSA 5CMDA 4GLVB 1NY4A 4K1XA 3BZDB 2Z4IA 3PUYA 2Z8LA 3OIPA 1LV9A 2RC5A 5HXBA 3AVTA 2ZXRA 3CKIB 3Q23A 1JA0A 3GTMB 1F60A 1KDBA 2Y0SE 4OIKA 1QVFB 1ILPA 1B2TA 4MYTA 5KW9A 2ICEC 3NEMA 3NP8A 2ZITA 1V1QA 4WORA 1WP6A 1MGSA 2PMZB 5L37A 2ID0A 5CV9A 3A5ZB 2QMUA 2SOBA 2PQEA 5EKKA 1HNWL 4WZEA 1E3ZA 4DR1Q 4ROXA 1QOHA 4RMFA 4QF4A 1R9TB 3GTLH 1VMCA 4RAUC 4JI8L 1EQTA 4AYBB 1BQQT 4DAVA 1XX8A 1Y0RA 1YEZA 3SLDA 2ZZFA 1EIYB 3ZIAA 1KL9A 2OBRA 5KYLA 1F77A 1T6YA 3LO8A 4RKBA 4C56C 2QKIC 1TS4A 4BXXG 1G91A 4K5VA 5EAYA 4AYBG 3NTHA 1MI2A 4XTCS 4PAAA 1NRKA 1PRTD 4A3JH 3C3LA 3U58A 4KY6A 1FNMA 1NSNS 2YYZA 4GOPC 2BM0A 3C46A 5C5MA 1BXTA 3NWTA 5K36H 5IT9L 1L0WA 3SXHA 1WSRA 1N9WA 1WTHA 3S1NH 4J8QA 4X7CA 1P4MA 2RCNA 3FHWA 2JSOA 1PV4A 2M9VA 5FA6A 2PYKA 4Z4WA 4XKVA 4BA2I 1TKWB 3H3VI 1BKBA 2IHEA 2DJGC 3ND9A 1G291 1H8HA 4JW0A 3TS0A 3QWNA 2CBXA 2EXZA 4DN4M 4X62Q 1B44D 3HOVB 4IFDH 2UXDQ 4TRDA 1C8CA 1HTPA 2VQFL 2NTTA 2CRVA 2ZBVA 3MXNA 4XN3A 2KBNA 4XT3B 3JQQA 2XIWA 2K4KA 5B6IA 2ZBUA 4XNFA 4ZCLA 1A2TA 2Q8RE 4K8JA 4L5QA 3A8IA 3SHLA 1I50H 3JAMi 1SYEA 1K3BC 2ZM6L 3CMEA 4HJAA 4A3MH 2F0GA 1PLFA 4DAYB 2M2LA 1LT4D 2F0FA 3DUZA 3SKBA 2BVNA 1R4PB 2RVLA 4F7DA 1FVIA 1LM0A 1VDZA 1H9RA 3HOUH 1GHJA 2AUJD 2F0LA 1K9MD 3CCEB 2F4NA 5C3WA 2GJKA 4LFAL 1BBXC 3AMUA 1Y0YA 1L0YB 4LBVA 1SJHD 2A69C 4RCNA 1JORA 1KK1A 2R6HA 1VQGA 1I4PA 1TWGH 2F0SA 5JOBA 3FKIG 3TRZA 2C5BA 2NVXB 2ALYB 2Q8TA 1E22A 4RD4A 1K8AD 1P8LA 3F2BA 2RKSA 3T13A 1T6ZA 3PIP3 4JBMA 4A93B 4CQJA 1KC8D 2NVTB 5J3OA 4LF6L 3CHBD 3D0FA 5IYCH 4X64L 1K0SA 1IYUA 2PLFA 4HJ8A 3PV0A 1N36L 2C4TA 4PABA 3O13A 3ER0A 5GAGC 2BE5D 2VS1A 3UDGA 5I2XA 3NUCA 2XRQD 2VUMH 3KF8B 1PRTF 2QEXB 1OB2A 4XKWA 3A8KE 2Q6OA 1N0UA 2O2LD 4A3CH 4DR4L 3KEWA 5DS0A 2HT1A 3IAYA 3CC7B 2ZZEA 1P16A 1ENFA 1X54A 4GN5A 4QJFA 3A56A 3TP8A 1K0RA 1TU2B 1JC7A 1F9QA 3CCLA 1E1RA 5IT9E 3PUWA 3EN2A 3CCQB 1HUMA 4YAWA 3BQJA 3ZUGA 2MO1A 2K28A 2IWHA 3I4LA 5KNBA 2CCZA 1E79A 3CMAB 4QVAA 3DMUA 4B08A 5FO9B 3UI2A 1GD7A 4K14A 1WTXA 1NUCA 2A68C 1Q7YC 5KNCA 4B3TL 3KJPA 3R6KA 2ZL7A 4GLXA 1S72B 1SMYC 1H42A 1SAPA 1PYWD 1BLIA 1E2WA 3OHXC 3E1YE 3Q0AA 2D74A 3NQTA 4ZK9B 1V0FA 2PO4A 3BY1A 3FDTA 1IBLL 1VLYA 1R4QB 2R92B 2FMCA 3AFQA 5CORA 5AJ3Q 1SNCA 2EJGC 4IUUA 2OWOA 1TVXA 4QUZA 2JE6I 2QA4A 2CC2A 1VQ7A 2YTYA 1XWEA 1OGIA 1JCKB 3FPUB 4FVMA 3MEHA 2X3UA 1VQ5B 1M1KC 4LF4L 5HZBA 5GV7A 1WORA 2M00A 3EVQA 3SE0A 3W5OA 1XNRL 1PH9A 4P3YA 2N55A 2F0PA 1Q9SA 4DV6L 1S40A 1G7RA 2R92G 4X3TA 3GTLB 2CW0C 3M4YA 2OXPA 5DAUA 1GUSA 4C3HH 2NN6I 2F3VA 4DQKA 4N8FA 3AGPA 3PVDA 3S2DH 1EFRA 1UEBA 1NBWA 1NNXA 4YY3L 1N33L 1TT2A 1YNND 5M5XB 3MC0B 1H9SB 5HGQA 4A3JB 4GOPB 5JEAG 3K6OA 3J7ZC 1IL2A 2PZTA 1LYLA 4JC0A 1FDRA 1QVGB 2L9HA 3HRZC 2G9HD 2F0MA 5KYIA 5C3EH 1EY9A 3WNBA 3K0XA 3X3NA 5F2DA 2N49A 3I70A 1YJWA 4IUVA 5IGEA 2UXBQ 2WV6D 4A3JG 3KLWA 2LS01 3W2FA 2I46A 1KK3A 1KHIA 1L1OA 3QSYA 3BZCA 4EQ5A 5ELOA 4JI5Q 4HTHA 1S5BD 4FN5A 2E2DC 4X8IA 5K36G 4P6YA 1I7PA 3WQZA 2NN6G 4GN3B 4ILWA 3I8ZA 5KSWB 3DWAA 2F4IA 4OONA 4XQNA 4DV1L 3VNUA 3MFYA 4ZLTF 2NUCA 1O7ZA 2Q6KA 4ZRZA 1YLOA 5C0XH 4G1VA 1OTCA 3B82A 5CV8A 1PJ7A 3W3AA 4RJLA 1YI2B 1V1PA 1I50B 1D1KA 3I91A 3CTAA 4FXUA 2FFKB 4HEDA 1PYBA 2JA8H 4IFDG 3BCFA 2PI2E 2BN4A 3KLSA 1VHEA 2CQAA 2OCEA 4ZKCB 3DLLA 3I7FA 4YWLA 4X7EA 3HOUB 2WPDA 4U9UA 1B9NA 4GNXB 2WJVA 1SXTA 1HZAA 3GVJA 2PCFB 3R2IA 1GXDC 4AF6A 4APVA 1FYCA 1I4RA 1VQJA 2B29A 3BVGA 5EPKA 3I4OA 4UAJA 3H9NA 1HNXL 5DSZA 2NZHA 2RQXA 2IPKD 4A3FG 2WACA 5LL6S 1JICA 1ZEQX 5THXA 2F3IA 4TSFA 1F9SA 1OB0A 3NSWA 3HOUG 2ZXHA 2DEUA 3WDNA 2GA4B 3OYYA 1VQ4A 2B63B 2C2WA 4YAOA 4LUVA 1KMHA 1LTSD 1DOMA 4PC1A 1GKHA 5IGGA 3EBEA 3K5NA 1T6XA 1L2FA 2DY7A 1OXXK 4DV3Q 3RZOB 3LNNA 3ASQA 1TTTA 1SE2A 2WKCA 4BPRA 3EROA 4MIUA 2ZJQA 4ZUJA 4A3EH 2B63G 4JVZA 3URYA 5IYCG 4A3DH 5ISRA 3T1YL 2C77A 1JB9A 3BS1A 2PE3A 4DV7L 2AUKA 4AVZA 1D1IA 1ASZA 1C9OA 3KFUA 1GJXA 1TUIA 2VNKA 1HZ9A 3IL8A 1JWUD 1ELOA 4YWMA 4LF9Q 1KRHA 4B4DA 2I07B 4DV2Q 3J7AF 4P22A 3SJZA 4A3CG 1CK1A 4JI1Q 2A69D 3LVBA 1FD7D 2KCNA 5CV6A 1JJGA 1I8DA 3Q3AA 4CDFC 4Z4VA 1ENCA 3CCMA 1XYIA 4DUZQ 1TWFH 2K32A 1N34Q 2NWGA 2RBMA 4FK8A 4OPSA 3CESA 3ASSA 2OBSA 4BBRB 2ZTNA 5IYDG 5E1FA 2UXCQ 3W5UA 2C78A 3A35A 4CBVA 3PIO3 4LNQA 5A8AA 1S5ED 4PZ6A 1STBA 5J39A 1EWCA 1VQNB 4J1MA 5GAEC 4CJ2C 1DD2A 3EIVA 5BSYA 4DF7A 3KOJA 3L3OC 1T5EA 2ZJRA 1XPRA 2ZXOA 1YBYA 1E24A 1HXYD 3PGZA 2XZPA 1SR3A 4LBWA 2Z1CA 4BBRG 3U9OA 3ERSX 1XMOL 3CCUA 5LMNQ 2GJPA 3OW7A 2XWJB 5CGKA 5JPMC 2GVAA 3HEJA 3AFPA 2PZUA 3G71A 5A89A 4GKKQ 2OYNA 1ICWA 4K0KQ 3KDFA 1N05A 5EBCA 1I6HH 1H95A 2WSSA 3BCDA 1FR3A 1VCIA 2LMCB 4G7WA 3CCSA 2IX3A 1HA6A 2VW9A 3D6CA 2WJYA 1HR0L 2XNAC 2B2UC 4RH6A 2A19A 2ENBA 5E4WC 4DR6Q 1XJVA 4N3GA 3OPOA 3F2UA 1SRUA 3S2DB 3H94A 1HPCA 4NCNA 3KF6A 4CDCC 3CXCB 4A76A 1K73D 3G05A 1HVXA 1ZXTA 3PENA 2NB0A 5M5WH 1UEAB 2ZTCA 4K2LA 2V7XA 2E8GA 3GTMH 1PFMA 4AQYL 1PZID 4LFCQ 1SMXA 1IKMA 1Z9FA 3E0JA 1CKNB 1JWSD 1UD8A 1E7ZA 2DY1A 4M1UB 4JOIA 4FXGC 4TVAB 3ASTA 3P75A 2OTLB 3VO2A 1B3AA 1U4MA 4GLAC 4HE5A 2V1CC 1EQRA 3RZDB 3CQZB 4CGYB 3OZUA 4RHSA 1GJRA 3MZ5A 1XQBA 3I90A 2YWGA 2K5NA 1R9TH 5C4HA 2FX3A 3SK4A 2K5QA 3S16H 4A3IB 3MHBA 4OELB 1B53A 1R5NA 4FDBA 1WOCA 5L46A 4KI0A 1B23P 2BMWA 4L5SA 3A54A 3ASPA 1SJED 2EVBA 2R6GA 1WD1A 3A55A 1ET6A 2RC6A 5LMNW 3T51B 4TMXA 2CW0D 5H1SE 3HKZE 1DGSA 1E3PA 2NVYB 3E20A 1PYSB 4ZKBB 4A3IG 1SFOB 3RLOA 1W0JA 1PFBA 5FLXE 3RD4A 4JYAL 2D3NA 3K0YA 1IBKQ 4P2CB 2BM1A 4M8AA 2JA8B 3T56B 4JI2Q 1EYDA 2B7CA 2VZAA 1HCZA 2VYQA 5IP7H 3IRBA 3Q38A 3QR8A 5I6YA 1RHPA 5F4OA 3V7AA 4RGNA 3GDEA 2QE7A 1KAAA 1WI5A 2BA0A 4XONA 1JNYA 1YNXA 3QO2A 1PDQA 2JA8G 3R93A 5BN4A 5CDFA 1HUNA 1BCPB 1YNJD 2JQOA 1VQMB 5IP9H 3K59A 4G7ZC 2E2HH 4B48A 4UZFA 4DAYA 4KJOA 3F2DA 3OEEA 1OXUA 3HKSA 3IKJA 3P20A 1WTWA 3P27A 1EOVA 4DGZA 4G7HC 4LF7L 2A1AA 1YIJB 1O7LA 1RIPA 3I72A 5IYQA 1ESRA 2C5CA 3OFNA 4P6VF 3H3VH 1LT6D 1EIGA 3FKIH 2C5HA 3SR1A 4KHPL 5CV4A 3OJWA 3P7JA 1EU3A 1X32A 4IUTA 3ONUA 4CKCA 4GQNA 3T4AC 2VY3A 3J80i 1IKLA 4A3DB 5A88A 4KKTA 3S1MH 4HN7A 3TZDA 4LC0A 1DYQA 2R7FA 5JVH3 2B39A 4WJ4A 2NVXH 1I4GA 4WRDA 3DDYA 5EPLA 2F1MA 4NBSA 5GQOA 4DR5Q 4B3ML 1QNKA 4AIMA 1BMFA 2Z6BD 3TBIB 2NVTH 1FNBA 5LMUL 1VQ8A 3KF8A 5FO7B 1WSVA 1YJ9A 2B8FA 2QEXA 1VQPB 3R6JA 5KNDA 1TWFB 1VLOA 1WFQA 1UNSA 2B2VC 5DM73 2UUCL 1Q46A 1C0AA 3J80E 1BCPD 5ELNA 1FRQA 2J7ZA 3CC7A 4TMZA 2FJ2A 4FNFA 4DFAA 3Q39A 1CTMA 4A75A 1Q82C 1RQPA 1LTRD 3UDXA 1IW7C 1D5XC 2D2CC 4R4TA 3A1PA 4L6TB 5EQ0A 2MQHA 3PUNA 3CCQA 1XNQL 4Q0FA 1Y1VB 1VQEA 4Y7NB 2PNHA 4O0AA 5E4XA 3CMAA 1EIHA 3KK7A 3CCJB 4B44A 3BZKA 1AE3A 2NZ1D 1N32Q 2KUMA 3K58A 5IWAQ 1TY0A 1GUNA 2R61A 1IL8A 1W87A 2K01A 3T1HQ 4ZAIA 1G51A 5EKIA 3BYYB 1Y1VG 2ZZGA 1S72A 1PMRA 1U9RA 1RKNA 1EEFD 4QQBX 4DV4L 4KN4C 2PIAA 3CCRB 4NXNQ 2HHHL 4AC9A 2X6GA 4ULLA 5J22A 1H8EA 1ENAA 1MJCA 5IK2A 1UUPA 4OPOA 2Z4HA 5D3DA 2LFNA 4EGVA 2XNCA 3Q6SA 2JJ2A 1ZKOA 2WP8J 4K6DA 5M5WB 4FF4A 4NP5A 1GUGA 1Y1WH 2C9OA 3CP2A 4L5RC 1LTLA 4A3KB 1KRTA 2R92H 2R93G 2AWOA 3PCOB 3SGIA 4X66L 4KY7A 4PMCA 4K5WA 3HOYH 4QV2A 1HH2P 2E5LL 3J81c 1E0BA 4HIZA 1MSHA 3EA6A 1WVLA 3W2DA 2R3ZA 1FNUA 4A3KG 2DOGA 4KTAA 3ULPA 3S9WA 1HNWQ 1Q90A 4RWSC 4ABNA 3S16B 2BGIA 4ACAA 2CNDA 2A6EC 5JEAH 1MD2D 1H9SA 4G6IA 1VQBA 4JI8Q 3W5VA 4EX5A 2IX0A 5BN5A 4B3XA 1PZJD 3I4MG 1QILA 1NE3A 3PO2H 4FWTA 4DR1L 1BCPF 4MNOA 1QVGA 5M5XH 1F9PA 3GO5A 4UY8C 4P73A 4UP8A 4DR3L 4A3LG 5ELDA 4HE6A 1EY8A 1Y8PB 3QG1A 1JOOA 2DN8A 2A8VA 2RSOA 1ZYRC 3D8GA 4Q5VA 4TKOB 2NN6H 3HKZB 2JEAI 3E6ZX 1F20A 2ZXPA 2KENA 2ZJPA 1VQ6B 4KV6A 3Q6RA 1KJZA 3VR3A 1IBMQ 4BS9A 3KLRA 3OKXA 1I94L 3WXMA 1LTGD 2IW3A 4QUFA 4CJ0B 2PPBC 5CC4A 3TQYA 1AP0A 4GZYC 3HKZG 4M4SA 4ME5A 1YI2A 4NNJA 2B8GA 3QOLA 2E2HB 1CM9A 5IP7G 1K8OA 2CFMA 4PQXA 4KN7C 2H1EA 2VNJA 1T9HA 1J9OA 5IGDA 2VQFQ 1FX0A 1GO2A 3AEVA 2W6JA 2MJ8A 4RG1A 5K5PA 5I9PA 2IJ0A 4OX9L 1GUWA 1OXTA 1D7QA 3D31A 4GNXA 4E0FA 4UZUA 2F4VL 1A62A 3FKIB 1XTDA 2YTXA 5IP9G 2KVMA 4N8X1 3UE0A 2ZM6Q 2BCOA 4R71A 3DEPA 3P26A 1N8RC 3RN5A 3M9BA 4A3FH 1M90C 2ZTEA 3RR5A 2XGTA 5FK9C 1G2TA 4KD4A 2HIVA 3K80C 3A7LA 1NMFA 2FVGA 3LWUA 5M9OA 3ICEA 3OMGA 1EP3B 3S1MB 1ASYA 4LFAQ 5IGFA 2EXDA 2L5TA 1K28A 2F03A 3WY9A 4PZ8A 3MCAA 2WYRA 4JK1C 1X3PA 2QEJC 3WWVA 1EZ6A 1I3QH 3TSSA 4OO1I 4P3IA 3OE7A 3MMPA 4X3KA 1O7IA 5IYWA 2OT2A 2B63H 5IYPA 3A3BA 2XGJA 3MXGA 1AZQA 4JI6L 1EXMA 3C2PA 1F2YA 4EQOA 3Q24A 4LF6Q 2EFGA 1S0UA 3G4SB 1VQ9B 2F43A 4R4OA 5FJ8H 4X64Q 3JAMc 4HSPA 2FXQA 4JCVE 1W2BB 3RZOH 1KIXA 3T53B 4B43A 1S5CD 2VBUA 2F0JA 1MIUA 5A35A 4R4CA 3A8KA 4DUYL 1WTRA 2N88A 3VR5A 4L8JA 2OF1A 2G5DA 5JJIA 2CHBD 2EJFC 1LO5D 3ZZTA 1G2SA 3MA2B 3TP6A 4LF5L 1EUJA 3GTJH 3JQPA 2PNRC 5IYDH 1DZ1A 2CKZB 3S1QB 1PVOA 4FXDA 1XMQL 4LK1C 3WOFA 3VYUA 1VQDA 1YHAA 4OO1G 4YCWA 5DEHA 2V4DA 1VQNA 1R5OA 1Q1BA 1W34A 1HHVA 4JI7Q 4BBRH 1KRSA 1CKOA 4K5XA 1PFNA 4EH1A 1UD3A 1X55A 4CDDC 1EQVA 1Z47A 2DNEA 2KCCA 4B3TQ 1SE8A 4P9SA 5CV5A 5I2YA 1QFZA 2DCUA 2OK8A 2VBTA 1E2ZA 3ONAB 2M5SA 1QGZA 3NXWA 4PMBA 3W1GA 5FLMH 5HKKA 1SLJA 1QGYA 1TQOA 3DWQA 4OWXB 1Y1WB 1V1OA 5ELEA 1BDOA 4DKAC 4P2NA 1IW7D 1DCZA 2Z0SA 2KEEA 3E9IA 4G5GA 2H5XA 3RLFA 3CCVB 4YIJA 2BOSA 4IJHA 3HOYB 3ZZ0A 2VNHA 5H59A 1S4MA 3PUXA 1XE1A 2CW5A 1DOLA 5TRDA 4XIGS 1Y1WG 4TSSA 1OXVA 3FMCA 4LF4Q 2D3LA 4J15A 5AJ3L 3PF4A 3CB4A 1CT1D 3CC4A 1XNRQ 4C1NK 2VB3X 4DV6Q 3OW2A 1RL2A 1A63A 1NMGA 3PUMA 1Q86D 1EFCA 4R8NA 5BSXA 1EY0A 5EJWA 1YJNB 5C6AA 3L2PA 3TREA 4RD3A 3HOYG 1CKNA 2A6HD 5E6TA 1IHMA 2HLDA 3PIOA 3PO2B 4O2DA 4HCEA 2DUDA 3FRPB 4X65L 2OTLA 1QUFA 4YY3Q 1N33Q 2RHSB 5F4JA 2N78A 4H13C 4FYDA 4JBJA 2V31A 1KD1C 3KBXA 3C2QA 4YHHL 2OK7A 3W2IA 1SM4A 2D0PA 3VR6A 4R8IA 1LABA 1WOSA 4XLAA 3S14B 3CC2B 2EYMA 3G6EA 2JDIA 1S4ZA 3QE2A 4LW1A 4UP9A 3PO2G 3RZDH 2EY2A 3CQZH 3RUZA 3STBC 3UDFA 2PQAB 2B3GA 5HURA 4HMJA 3T16A 1N07A 1CHPD 1PH6A 1HFNA 4A3IH 5KEEA 2F0TA 4QMGA 4DR7L 4II2A 2F52A 2XZOA 4ALPA 1E1TA 2OEOA 1MABA 3WNCA 4P26A 4LMQD 3D4RA 2UUAL 3J7AV 3LGJA 1IYJB 1X3EA 4QY7A 2GPJA 3I55B 4DV1Q 1BJKA 4YHBA 2NVYH 1SFOH 3NK9A 2K5HA 3FJOA 2WAQE 1CI3M 5IE8A 1HQMC 4XXEA 2TMPA 2CK3A 3J81j 2Z6BA 4NDXA 1JE5A 1UE5A 3BC9A 1IZ6A 4U68A 2KVOA 2X69A 5JBQA 3QIAA 1CFMA 2PI2A 3HG9A 3A74A 1FNWA 4X3SA 4A3FB 3AQQA 1SN8A 3NWSA 2J0TD 1A15A 1PH2A 1VS0A 2VNUD 1EL0A 5T1GA 3WBJA 1VQMA 4WFN3 1EZ8A 1WCMH 1X65A 1RDPD 1L1OC 1ZYRD 2JA6H 2CWAA 4YAUA 2X6XA 1S3OA 1NCVA 1VHOA 1K3RA 4LF8Q 2G9DA 2HQLA 1WJJA 3VA5A 3QJYA 4RGTA 1EQQA 4OHJA 1I3QB 1CNEA 2X8KA 1A3VA 4RA8A 1HNXQ 1RF2D 4KJNA 4L5TA 2V7QA 3QFRA 2KJXA 1VQFA 3MFGA 4OIJA 1Q1EA 1SYBA 5M3MB 4UP7A 5FNZA 2KECA 4R4QA 5AN9A 4X6AH 4TQUS 1QCBD 2RCFA 1QNUA 2EZVA 3BG3A 1UAPA 4B3RL 5JPNC 3WYAA 2V7TA 3GVKA 3I4NH 5EPJA 2O5IC 4N9TA 5COYA 2QILA 2LXKA 1NJIC 5M3MG 2Z6KC 1LTBD 1AEXA 1NB9A 3OWEB 5FJ8G 2YWFA 5H5JA 3GTJB 3FPPA 5FO0A 3T1YQ 1N8RD 2E2IH 1UE1A 2F0DA 4DV7Q 2JA7B 4QFMA 4JBWA 3HOXG 2Q2TA 3DHQA 4OPVA 2RA4A 4C1NI 4HIKA 2F3WA 4NB3A 1B2RA 2VBVA 1IXRA 1CSPA 1VMPA 1JJ2B 1EY7A 1DM0B 4I65A 2XSCA 1R5BA 1X3QA 5J1ZA 1EFID 1U4PA 4CDEC 3DWPA 2VB2X 3PO3B 3BY2A 4PC2A 4IUQA 1VF5C 2JA7G 4XR6A 3K57A 1UMKA 1HTLD 4LBYA 3K5MA 1BPLA 3GVLA 5HZAA 2QDLA 3W2EA 4DUZL 2ES2A 1Y1VH 1QH0A 2K04A 3NTIA 4Y7NH 4S3SA 1PH3A 3D3RA 5BR8L 2EYJA 3PO3G 3EQLC 2HCJB 1E1QA 4FP5D 4C3IH 1AH9A 2SNSA 2HIXA 3OZVA 1XMOQ 3ZPNA 4FF3A 4H7BA 4DK1A 3CCRA 2GK6A 1TWHH 1SE3A 3J7A5 5J35A 5FLMG 1XTCD 3OTOL 4DV5L 2L15A 4F8MA 2YTVA 2O4XA 5IODA 4WWVA 2LKVA 2J4XA 2MPMA 2MUYA 2F0OA 4JPBW 4YCUA 3KL9A 4YELA 3RN2A 2R93H 5GROA 1I4QA 3IFDA 1HR0Q 3TDQA 1W6KA 3DM3A 4P1VA 2B2YA 3CRLC 1G7TA 1QVFA 2Q2UA 4DXGA 4B9WA 1C48A 4KKSA 2K52A 2QDBA 4C0SA 2VBSA 2ZTGA 3I1FA 5FO1A 1H9KA 1UWVA 4OOXA 1Q7YD 2A68D 5LHY1 2VZLA 2JA9A 4A3KH 4H44C 1BF4A 5HGTA 3PA2A 2MGSA 4BY1H 2B7BA 3JC66 1VQHA 4JI4L 4DR2Q 1VQ7B 3CPWB 1SMYD 5BN3A 4AQYQ 3HOZB 1H85A 1W3SA 3CMMA 1PRTC 4WQMA 4LBZA 4P71A 1SBBB 3FVQA 4Z4SA 3I4MH 4K8IA 4GKJL 3CPXA 2I5HA 1OXSC 1TR5A 4PC3A 3JU4A 1W6JA 3AVYA 1TY2A 4NKLA 2WKDA 3I3CA 1IJEA 4A3LH 1HA3A 1V8QA 4DK6C 3HOZG 1KLUD 2D9RA 2B2WA 4HMIA 3ZYYX 1M1KD 3UDIA 4G57A 4HJ9A 2EJMA 3BJUA 3EJIA 1WTOA 1FNCA 1PTOH 1NAPA 1CKMA 1PTOC 3BDOA 4X3UA 1UD2A 3H91A 1WD0A 2C4UA 1QUQB 3GIRA 1U2RA 4WJWA 2VQEL 5FKAC 2CH4W 1GUOA 1AZPA 3TS2A 2L4NA 4JYAQ 1PKVA 4B3SL 1ZM3A 3A3GA 2HDNB 4KHZA 4PV1C 1YJWB 2WZPP 1UE6A 4QB4A 2OBTA 2YWEA 3AVUA 1JR0D 4IPGA 4XQQA 5M5YH 5FLXc 3I56B 5DNFA 2WAQB 2A5HA 5GAHC 1HQRD 1KD1D 1AW7A 2Z9HA 3VDYA 1HR0W 2P3MA 2B2TA 2PW7A 1WCMB 2X53S 3OSOA 2EIFA 2I5LX 3U4ZA 1SYFA 3V2TA 2CH4A 2JA6B 5AFWA 1K9MC 3LQEA 1FNDA 2F0NA 1JOQA 1MKHA 1XPOA 3HAGA 4B3GA 4PC7A 4ZGQB 4M0LA 4X7FA 3HFZB 4BY7B 3STBD 2WAQG 3SDZA 1UD4A 4Z4YA 1S5DD 3Q22A 4X0CA 1WCMG 4M53A 1ML0D 5CV7A 1Y8NB 3PQIA 5CR3A 2HQEA 1V1PB 2WIIB 1EU4A 1HZBA 2JN4A 1BX1A 1EFWA 5DLQE 2JA6G 1KC8C 3CCEA 3SJPA 4HIDA 2LY7A 2DY8A 3B78A 3TZUA 2DGYA 2WB1B 2KCTA 4XM3A 2IHFA 3CPFA 4BY7G 4Y9UA 4C3JG 3K5LA 1SKQA 4KHVA 3S2HB 1CUKA 5I9OA 4KHPQ 3I4NB 1J5EQ 3R2TA 4YAFA 2BE5C 1FJGL 3N52A 2BPOA 1BUVT 2DJFC 5IGCA 1BBWA 5EGTA 4ZUIA 3CD6B 3TN2A 3CW2A 3BU2A 4LFBL 2YWHA 2WB1G 1CZWA 3U4VA 5D14A 1GOZA 1ZM4A 2E2IB 3R8BA 3J81L 3I4NG 3GTPB 4ZCMA 3CP8A 1VQ9A 2GVBA 1QZGA 4A3GH 1KTVA 3NBHB 1WTQA 4HSVA 1VQ4B 2PW5A 1Z6HA 2ICIA 4IOCA 2EIXA 3ES9A 1B1ZA 4KLKA 2PMDA 1SNOA 4MTNA 4JI3L 4I7AA 4E6IA 4H0LC 3G6JB 3I73A 2MNAA 3GP7A 3MXPA 2E2JB 1RODA 1TXYA 2HDLA 2F0KA 4ME3A 1VQLB 1Q8IA 5IYBG 3ITPA 5C0XJ 1IB0A 1VQOB 1T5XD 2L12A 1NBMA 1VQCA 4XLFA 1U4LA 1V5VA 4QUCA 3J80c 3MWYW 4OO1H 2BSAA 4RDKA 1VQIA 4JI0Q 2QW7A 4WZLA 3F1ZA 2D0OA 2JJ1A 1FGUA 1J9ZA 3M4OH 2QTLA 3AVXA 3BVZA 2UU9Q 2X6LA 2EE1A 1XNQQ 2AHOB 2K5WA 2SDFA 4IALA 3A5UA 1H9JA 3VR2A 4C3IB 4HAEA 1KLGD 2RSNA 1GUTA 3H6MA 5IY0A 3S1QH 4KD3A 4F7XA 5GV8A 1NJID 4C2MH 3CAMA 4YXWA 1TWHB 1A2UA 1QFYA 1TIID 2Q2IA 4V190 3PMFA 5KNLA 1N08A 4B47A 1I4HA 2D5DA 3PUVA 1GVHA 4RCYA 5C4JB 2ATWA 2BGJA 3H09A 2B5OA 4RPDA 1CA6A 5IYRA 1K83B 4C3IG 1BNZA 5A2QL 2R93B 4P72A 3SEBA 1HNZL 1A0IA 4DV4Q 5IYNA 3E9HA 4TMVA 5FO8B 5F4MA 1G7CA 1QVCA 3SK8A 2HHHQ 4XORA 2HDMA 4DV0L 2HUGA 1E63A 1QFJA 2JXMB 1CHQD 2UUBL 3W1BA 2NPFA 3S24A 3CCVA 3GTOB 1DONA 1PH5A 4OOSA 4KMUC 1STNA 4BY1B 1VQ5A 1NB0A 1YNNC 3H15A 3G71B 1SROA 4JV5L 3FP9A 3A8JE 1EP2B 3SK6A 1GHKA 3W2HA 3NQIA 2I5MX 2V7VA 4MZ9A 4X66Q 4FF1A 1STGA 5ELFA 1XB2A 1RCVD 2BDOA 3I4MB 3CCSB 2HCCA 4LAAA 3W2GA 1YJNA 4G1BA 1EWIA 2E5LQ 4OEMB 1B8AA 1JWMD 1KK2A 1KDAA 1X3FA 4BY1G 4DU9A 1W0KA 4XOPA 5KRUA 1PH4A 1W9XA 2Q6IA 5LL6X 2NVQB 4DAMA 3L0OA 2I0QA 2JK8A 3J81E 1PH1A 4IPDA 2TSSA 1I6VC 3KF6B 4GOPA 3SVMA 1YITB 2KHIA 3BDLA 2NYZD 3GTKH 5C44B 1QWYA 4XLCA 1MBYA 3CC2A 2O5JC 1AN8A 1PTOB 3J7YW 3JAML 1HRJA 2ZZQA 2GJRA 4G7XA 1PFSA 3A7AB 2PQAA 1SYDA 4XOTA 4DR3Q 5GADC 3S14H 3DEOA 1NR2A 4B9XA 4ZV4A 1QGAA 1BO0A 5C44G 5M5YB 2JJQA 4II3A 5FOBB 4K6LA 4QIWE 1C7YA 3MHPA 1VQKB 1M8AA 2VNIA 5TY0A 3AVVA
chains in the Genus database with same CATH topology
2VJIA 3LWEA 3MVVA 2E75C 2K6AA 2XRSD 3VR4A 1IYVA 1V43A 1H9MA 4IQZA 1KNAA 1KABA 5A2QE 1U4RA 3EFXD 4BA1I 3X3MA 4RKLA 2XNDA 2EY6A 3NE5B 2R9VA 3RMHA 2FINB 2RDHA 1B4OA 1PTOD 1STAA 3K7AB 4KKUA 2AWNA 2K5DA 2FMMA 1V0EA 1LT5D 3MXUA 3C1EA 2XN9C 2X6WA 3GTQB 1E43A 2KEDA 4MN3A 3A8IE 1Q3LA 1WTPA 4PMWA 4RGMA 4EVOA 3VA7A 4F87A 4A3GB 4ASUA 1VJSA 5C5LA 1D5MC 2YU9B 1G6ZA 4XT1B 3G7LA 2NBFA 1EYAA 4F88A 2EY5A 4RGOS 2EY1A 1VF7A 3JAME 2SNMA 1SNQA 3D6WA 1SDFA 3M4OB 1HZEA 1S5FD 5KIXA 1JOKA 2FHTA 4C2MB 2DNCA 5DN6A 4EQNA 2Q8IB 4XDXA 2R7ZB 3OOCA 4XD7A 1O80A 1KNEA 4U673 2F0HA 1Q12A 3ND8A 1EYCA 1A3UA 5TSSA 3ERQA 1JB3A 4Z1MA 1G8ZD 2F0VA 2QF7A 3M3YB 2K03A 3NTKA 1RJTA 2KOLA 1PTOF 1SKYB 1LTID 1WPCA 1MSGA 4N9PA 2JP1A 1UD6A 2ZT9C 3TP7A 2XWBB 3D4DA 3L7ZC 1QJOA 3PUZA 1RTOA 1Z7TA 4KK7A 1EY5A 4PNYA 4XLHA 3DM1A 2VJJA 5DM63 4DK0A 2L55A 3KBGA 2F0WA 4CJ1B 2NTSA 2EYLA 2ZXIA 2AQ1B 4R9WA 3IFTA 2EYOA 3GTKB 2XOKA 1FGBD 2Y0SB 3OAAA 4L63B 1PZKD 1EOTA 1DXMA 5D65A 3WOEA 5EBDA 5G3LD 2L0CA 3BH4A 5D3IB 2VXWA 3NHHA 1E3XA 1D5ZC 1AFPA 3V05A 1CA5A 3GV3A 2EOTA 4A3BB 2EYHA 2F0EA 3OIQA 1SEBD 4IFDI 4IN3A 4XN0A 4I7ZC 4QIWB 3HP3A 3QOJA 1A6XA 1TS5A 3OEHA 3S1NB 1K8MA 1YNJC 3HOWB 1STYA 2A6ED 2K33A 1SNDA 5NUCA 1TWAB 3K5OA 4O42A 1EWHA 1ILQA 1F2MA 5T1IA 3HS0C 1TS2A 3S1RB 5IIFA 1STEA 5C4XB 3KLSX 4CKEA 3FEWX 4DA2A 1HA5A 1KZLA 1I18A 1CQFA 5JJZA 4A3MB 1OHHA 5JEAJ 1RD9D 1LT3D 4MHEA 3GQBA 1NR4A 1II3A 3U9SA 1PXUA 2E76C 4TT3A 4ZQ3A 1CQVA 4DNRB 1LTAD 2BA1A 1TWGB 2IT1A 3S17B 4QCLA 1BCPC 4KY5A 3HOXB 5G3LF 2AQ2B 4K2KA 3NBHA 5ELCA 4UAIA 3BDCA 1WTHD 2F0IA 1OO9B 4XQJA 2VUMB 2F0QA 2K1BA 2XVSA 1B50A 4IFDJ 3AU7A 3CRKC 2SEBD 4DAPA 1RTNA 1DOKA 3GD7A 3S15B 4FO2A 1QG7A 5EKLA 1F2ZA 4BBSB 1LACA 3C1FA 1COWA 1EY4A 3N6RA 2JEBI 1SYGA 1J8IA 3AB9A 4LJZC 5ELBA 4CHTB 2B2UA 5FLXL 5CBEE 2X6YA 3HGBA 1I4XA 2BDNA 4G7OC 1K28D 4V0BA 3TMEA 4IUPA 2E1BA 1DJRD 2IX1A 4ZYSA 5CBAE 4EQPA 4XL9A 4B3FX 1Y8OB 4CKBA 4XQFA 1ONLA 3LX0A 2X85A 2EYFA 4FF2A 1CZGA 1E2VA 4C3HB 5FL7A 3NPPA 1EY6A 3CU7A 4ODGA 2L11A 3FKSA 1HFGA 5IGBA 5C4ZA 1L0XB 4XMYA 5CYUA 4C3HG 5M3FB 2A73B 1UD5A 2B2YC 4OL7A 5C3EB 2EDGA 4XYQA 3R3OA 1SYCA 3OWFA 5C0XI 1F9RA 1QB5D 2RDGA 3KUPA 2IL8A 2QCPX 1O7YA 2EPBA 3D4WA 3OMCA 2W6IA 3H0GB 4HR7B 3J80L 3BVMA 5E3FA 5JAVA 2JIZA 3DXJC 2LZJA 4NMZA 1KDCA 3M7GA 1LTTD 2L1BA 2MHVA 3L9AX 1F2LA 4ID6A 2B2WC 1O78A 2KHSA 3VYTA 5C3XA 1FNVA 4Z9CB 1M4VA 1D6EC 2D62A 3M7NA 4C3JB 4G4KA 4RHRA 3GV6A 2CVRA 3SK5A 4RFBA 4BWGB 5C0XG 1QE6A 2EYPA 1WTVA 1SSOA 2RDFA 5I6WA 5I4DA 5JVG3 4O1NA 2H4OA 1EEID 1SNPA 4NW2A 2JYOA 1KTKA 2B2TC 4J6HA 1JE4A 1LLRD 1BR9A 2B2VA 2WINB 2JA5B 1C4QA 1SNMA 3H3VC 1XXGA 4DXFA 3M85A 2GK7A 1SE4A 2XZLA 4A3EB 1ET9A 2HCIA 1Y69U 3BYTB 3P1HA 2A74C 4XYOA 4IUNA 2MP1A 2PZWA 2D9UA 5KGUA 2E74C 2KA7A 4HCSA 3V96A 2DIEA 5IOCA 3HZXA 1A3TA 3VYRA 1B9MA 4FXKC 1BOSA 2AQ3B 2K7VA 4XLEA 1ESFA 1IHZA 4OGQC 3TP5A 1D2BA 3QB3A 1JQYD 2K05A 2F0UA 4RCOA 3VYSA 4IURA 3E5SA 4YEJA 4JMQA 3MAQA 1I6HB 2A6HC 1TWCB 1STHA 2KQ3A 3NBIA 1PRTB 4IZ8A 1TS3A 4UDUC 4DNTB 3GTGB 3MTSA 5CMDA 3BZDB 2Z4IA 3PUYA 2Z8LA 3OIPA 1LV9A 2ZXRA 3CKIB 3Q23A 3GTMB 1KDBA 4OIKA 1ILPA 1B2TA 3NP8A 2ICEC 4WORA 1WP6A 1MGSA 2PMZB 2ID0A 5CV9A 2SOBA 2PQEA 5EKKA 1E3ZA 1QOHA 4QF4A 1R9TB 1VMCA 4RAUC 1EQTA 4AYBB 1BQQT 4DAVA 1XX8A 2ZZFA 3ZIAA 5KYLA 1F77A 4RKBA 4C56C 2QKIC 1TS4A 1G91A 4K5VA 3NTHA 1MI2A 4XTCS 1NRKA 1PRTD 3C3LA 4KY6A 1NSNS 2YYZA 3C46A 5C5MA 1BXTA 3NWTA 5K36H 5IT9L 3SXHA 4J8QA 2JSOA 2M9VA 2PYKA 4XKVA 4BA2I 1TKWB 3ND9A 1G291 1H8HA 3QWNA 2EXZA 4DN4M 1B44D 3HOVB 4IFDH 4TRDA 1C8CA 1HTPA 2NTTA 3MXNA 4XN3A 4XT3B 2XIWA 4XNFA 2Q8RE 1A2TA 4K8JA 3SHLA 1SYEA 2F0GA 1PLFA 2M2LA 1LT4D 2F0FA 3DUZA 1R4PB 2RVLA 1VDZA 1H9RA 1GHJA 2AUJD 2F0LA 5C3WA 2GJKA 1BBXC 3AMUA 1L0YB 1SJHD 4RCNA 2A69C 1JORA 1I4PA 2F0SA 5JOBA 2NVXB 2Q8TA 2RKSA 3T13A 3PIP3 4A93B 2NVTB 3CHBD 1IYUA 3PV0A 3O13A 2BE5D 5I2XA 3NUCA 2XRQD 1PRTF 4XKWA 3A8KE 2O2LD 3KEWA 3IAYA 2ZZEA 1ENFA 3A56A 3TP8A 1TU2B 1JC7A 1F9QA 1E1RA 5IT9E 3PUWA 1HUMA 5KNBA 2K28A 2IWHA 3I4LA 1E79A 3DMUA 4B08A 5FO9B 3UI2A 4K14A 1WTXA 1NUCA 2A68C 5KNCA 1SMYC 1SAPA 1PYWD 1BLIA 1E2WA 3OHXC 3Q0AA 3NQTA 4ZK9B 1V0FA 2PO4A 3FDTA 1VLYA 1R4QB 2R92B 2FMCA 5CORA 1SNCA 2EJGC 4IUUA 1TVXA 2JE6I 1XWEA 1JCKB 3FPUB 4FVMA 3MEHA 2M00A 3EVQA 3SE0A 2N55A 2F0PA 4X3TA 3GTLB 2CW0C 3M4YA 2OXPA 5DAUA 1GUSA 2NN6I 2F3VA 1EFRA 1TT2A 1YNND 5M5XB 3MC0B 1H9SB 4A3JB 5JEAG 3K6OA 2PZTA 2L9HA 3HRZC 2G9HD 2F0MA 5KYIA 1EY9A 3X3NA 5F2DA 3I70A 4IUVA 5IGEA 2WV6D 2LS01 2I46A 4HTHA 1S5BD 2E2DC 5K36G 3WQZA 2NN6G 4ILWA 3I8ZA 3DWAA 2F4IA 4XQNA 4ZLTF 3MFYA 2NUCA 1O7ZA 4ZRZA 5C0XH 5CV8A 3W3AA 1V1PA 1I50B 1D1KA 3I91A 4FXUA 2FFKB 4HEDA 4IFDG 3BCFA 3KLSA 2CQAA 4ZKCB 3HOUB 2WPDA 1B9NA 2WJVA 1SXTA 3GVJA 2PCFB 3R2IA 1GXDC 1FYCA 1I4RA 3BVGA 5EPKA 2RQXA 2IPKD 2WACA 5LL6S 1JICA 1ZEQX 4TSFA 1F9SA 1OB0A 3NSWA 2ZXHA 3WDNA 2GA4B 2B63B 1KMHA 1LTSD 1DOMA 5IGGA 3K5NA 2DY7A 1OXXK 3RZOB 3LNNA 1SE2A 2WKCA 3EROA 4MIUA 4ZUJA 3URYA 5ISRA 3BS1A 2AUKA 4AVZA 1D1IA 1GJXA 3IL8A 1JWUD 2I07B 3J7AF 4P22A 1CK1A 2A69D 1FD7D 5CV6A 2KCNA 1I8DA 1XYIA 1ENCA 2K32A 2NWGA 2RBMA 3CESA 4BBRB 2ZTNA 5E1FA 3PIO3 3A35A 4CBVA 1S5ED 1STBA 5J39A 1EWCA 4J1MA 4CJ2C 1DD2A 4DF7A 3L3OC 1T5EA 2ZXOA 1HXYD 2XZPA 2Z1CA 3U9OA 2GJPA 3OW7A 2XWJB 5CGKA 5JPMC 3HEJA 2PZUA 1ICWA 5EBCA 2WSSA 3BCDA 1FR3A 1VCIA 2LMCB 4G7WA 2IX3A 1HA6A 3D6CA 2WJYA 2XNAC 2B2UC 4RH6A 2ENBA 5E4WC 3OPOA 3F2UA 3S2DB 3H94A 1HPCA 3G05A 1HVXA 1ZXTA 2NB0A 1UEAB 4K2LA 1PFMA 1PZID 1IKMA 3E0JA 1JWSD 1UD8A 4M1UB 4FXGC 3P75A 1B3AA 1U4MA 3RZDB 3CQZB 4CGYB 4RHSA 3MZ5A 3I90A 5C4HA 3SK4A 2K5QA 4A3IB 3MHBA 1B53A 4KI0A 3A54A 1SJED 2EVBA 2R6GA 1WD1A 3A55A 1ET6A 3T51B 2CW0D 1SFOB 2NVYB 4ZKBB 1W0JA 1PFBA 5FLXE 3RD4A 2D3NA 3K0YA 4P2CB 4M8AA 2JA8B 3T56B 1EYDA 1HCZA 5I6YA 1RHPA 4RGNA 2QE7A 1KAAA 2BA0A 4XONA 3QO2A 1PDQA 1HUNA 3R93A 5BN4A 5CDFA 1BCPB 1YNJD 3K59A 4G7ZC 4DAYA 4KJOA 3OEEA 1OXUA 3IKJA 3P20A 1WTWA 4DGZA 4G7HC 1O7LA 3I72A 2C5CA 1ESRA 3OFNA 1LT6D 1EIGA 3SR1A 5CV4A 3P7JA 1EU3A 1X32A 4IUTA 4CKCA 4GQNA 3T4AC 1IKLA 4A3DB 4KKTA 4HN7A 3TZDA 1DYQA 5JVH3 2B39A 1I4GA 4WRDA 3DDYA 5EPLA 2F1MA 1QNKA 1BMFA 2Z6BD 3TBIB 3KF8A 5FO7B 2B8FA 5KNDA 1TWFB 1UNSA 2B2VC 5DM73 3J80E 1BCPD 2J7ZA 2FJ2A 4FNFA 4DFAA 1CTMA 1LTRD 1IW7C 1D5XC 2D2CC 4L6TB 5EQ0A 4Q0FA 1Y1VB 4Y7NB 5E4XA 1EIHA 3KK7A 2NZ1D 2KUMA 3K58A 1TY0A 1GUNA 2R61A 1IL8A 2K01A 4ZAIA 5EKIA 3BYYB 2ZZGA 1PMRA 1U9RA 1RKNA 1EEFD 4KN4C 2X6GA 4ULLA 5J22A 1H8EA 1ENAA 5IK2A 1UUPA 4EGVA 2Z4HA 5D3DA 2LFNA 3Q6SA 2JJ2A 1ZKOA 2WP8J 4K6DA 5M5WB 4FF4A 4NP5A 1GUGA 2C9OA 3CP2A 4A3KB 2AWOA 4KY7A 4PMCA 4K5WA 1E0BA 4HIZA 1MSHA 3EA6A 1WVLA 3W2DA 2R3ZA 1FNUA 4KTAA 3S9WA 1Q90A 4RWSC 4ABNA 3S16B 2A6EC 5JEAH 1MD2D 1H9SA 4G6IA 2IX0A 5BN5A 1PZJD 1QILA 1BCPF 1F9PA 3GO5A 5ELDA 1EY8A 1Y8PB 3QG1A 1JOOA 2DN8A 2RSOA 1ZYRC 3D8GA 4Q5VA 4TKOB 2NN6H 3HKZB 2JEAI 3E6ZX 2ZXPA 4KV6A 3VR3A 4BS9A 3KLRA 2PPBC 1LTGD 2IW3A 4QUFA 4CJ0B 5CC4A 1AP0A 4GZYC 4ME5A 4NNJA 2B8GA 3QOLA 2E2HB 1CM9A 1K8OA 4PQXA 4KN7C 2H1EA 1J9OA 5IGDA 1FX0A 2W6JA 2MJ8A 5K5PA 5I9PA 2IJ0A 1GUWA 1OXTA 3D31A 4E0FA 4UZUA 3FKIB 2KVMA 2BCOA 3DEPA 1G2TA 5FK9C 4KD4A 3A7LA 3LWUA 5M9OA 3OMGA 3S1MB 5IGFA 2L5TA 2F03A 4JK1C 1X3PA 2QEJC 1EZ6A 3TSSA 4OO1I 3OE7A 4X3KA 2OT2A 1AZQA 3A3BA 2XGJA 3MXGA 3C2PA 1F2YA 4EQOA 3Q24A 2F43A 4HSPA 3T53B 1S5CD 2F0JA 5A35A 1WTRA 2N88A 3VR5A 4L8JA 2OF1A 2CHBD 2EJFC 1LO5D 1G2SA 3MA2B 3TP6A 2PNRC 1DZ1A 3S1QB 4FXDA 4LK1C 3WOFA 3VYUA 4OO1G 5DEHA 2V4DA 1Q1BA 1HHVA 4K5XA 1PFNA 1UD3A 1EQVA 1Z47A 2DNEA 2KCCA 5CV5A 5I2YA 4PMBA 1E2ZA 3ONAB 2M5SA 3NXWA 5HKKA 1TQOA 3DWQA 1Y1WB 1V1OA 5ELEA 1BDOA 1IW7D 1DCZA 2KEEA 3RLFA 4YIJA 2BOSA 3HOYB 3PUXA 1DOLA 4XIGS 4TSSA 3FMCA 1OXVA 2D3LA 1CT1D 4C1NK 2VB3X 4R8NA 5EJWA 5C6AA 1EY0A 2A6HD 2HLDA 3PO2B 4HCEA 3FRPB 4FYDA 4H13C 2V31A 3KBXA 3VR6A 4R8IA 1LABA 4XLAA 3S14B 2EYMA 2JDIA 1S4ZA 2EY2A 3RUZA 5HURA 4HMJA 3T16A 1CHPD 1HFNA 5KEEA 2F0TA 4QMGA 4II2A 2XZOA 2OEOA 1MABA 4LMQD 3D4RA 3J7AV 3NK9A 1CI3M 1HQMC 4XXEA 2TMPA 2CK3A 4NDXA 3BC9A 4U68A 2KVOA 2X69A 3QIAA 1CFMA 3HG9A 1FNWA 4X3SA 4A3FB 2VNUD 3NWSA 2J0TD 1A15A 1EL0A 5T1GA 4WFN3 1EZ8A 1RDPD 1ZYRD 2X6XA 1NCVA 2G9DA 3VA5A 3QJYA 4RGTA 4OHJA 1I3QB 2X8KA 1A3VA 4RA8A 1RF2D 4KJNA 2V7QA 2KJXA 3MFGA 4OIJA 1Q1EA 1SYBA 5M3MB 2KECA 4TQUS 1QCBD 1QNUA 2EZVA 3BG3A 1UAPA 5JPNC 3GVKA 5EPJA 2O5IC 4N9TA 5COYA 2QILA 1LTBD 1AEXA 3OWEB 3GTJB 3FPPA 2F0DA 2JA7B 4JBWA 3DHQA 2RA4A 4C1NI 2F3WA 1VMPA 1EY7A 1DM0B 4I65A 2XSCA 1X3QA 5J1ZA 1EFID 1U4PA 3DWPA 2VB2X 3PO3B 4IUQA 1VF5C 4XR6A 3K57A 1HTLD 3K5MA 1BPLA 3GVLA 3NTIA 2K04A 4S3SA 3D3RA 2EYJA 3EQLC 1E1QA 4FP5D 2SNSA 3ZPNA 4FF3A 4H7BA 4DK1A 2GK6A 1SE3A 1XTCD 4F8MA 2O4XA 5IODA 2LKVA 2J4XA 2MPMA 2MUYA 2F0OA 4YELA 1I4QA 3IFDA 3TDQA 1W6KA 2B2YA 3CRLC 4DXGA 4B9WA 1C48A 4KKSA 2QDBA 2ZTGA 1H9KA 2A68D 5LHY1 1BF4A 4H44C 5HGTA 2MGSA 5BN3A 3HOZB 1SMYD 3CMMA 1PRTC 1SBBB 3FVQA 4K8IA 1OXSC 1TR5A 3JU4A 1W6JA 1TY2A 4NKLA 2WKDA 3I3CA 1V8QA 1KLUD 2B2WA 4HMIA 3ZYYX 4G57A 2EJMA 3EJIA 1WTOA 1PTOH 1NAPA 1PTOC 3BDOA 4X3UA 1UD2A 3H91A 1WD0A 4WJWA 5FKAC 1GUOA 1AZPA 2L4NA 1PKVA 3A3GA 4PV1C 4KHZA 4QB4A 1BNZA 2WZPP 1JR0D 4XQQA 5DNFA 2WAQB 2A5HA 1HQRD 1AW7A 2B2TA 2PW7A 1WCMB 2X53S 3OSOA 1SYFA 3V2TA 2JA6B 5AFWA 1JOQA 2F0NA 3HAGA 4B3GA 4BY7B 3SDZA 1UD4A 1S5DD 3Q22A 1ML0D 5CV7A 1Y8NB 5CR3A 2HQEA 1V1PB 2WIIB 1EU4A 2LY7A 2DY8A 3TZUA 2WB1B 4XM3A 4C3JG 3K5LA 4KHVA 3S2HB 5I9OA 3I4NB 3R2TA 2BE5C 3N52A 1BUVT 5IGCA 5EGTA 4ZUIA 3TN2A 1CZWA 5D14A 1GOZA 2E2IB 3R8BA 3J81L 3GTPB 3CP8A 1WTQA 4HSVA 2PW5A 1Z6HA 2ICIA 1B1ZA 1SNOA 4E6IA 4H0LC 3G6JB 3I73A 3GP7A 3MXPA 2E2JB 1RODA 2HDLA 2F0KA 1Q8IA 3ITPA 5C0XJ 1T5XD 2L12A 1NBMA 4XLFA 1U4LA 4QUCA 3MWYW 4OO1H 2JJ1A 3BVZA 2X6LA 2EE1A 2K5WA 2SDFA 4IALA 1H9JA 3VR2A 4C3IB 4HAEA 1KLGD 2RSNA 1GUTA 3H6MA 4KD3A 4F7XA 4YXWA 1TWHB 1A2UA 1TIID 4V190 3PMFA 5KNLA 1I4HA 2D5DA 5C4JB 3PUVA 3H09A 1CA6A 1K83B 4C3IG 2R93B 5A2QL 3SEBA 5FO8B 3SK8A 4XORA 2HDMA 2HUGA 2JXMB 1CHQD 1DONA 3GTOB 4KMUC 1STNA 4BY1B 1YNNC 1GHKA 3A8JE 3SK6A 3NQIA 4FF1A 1STGA 5ELFA 1RCVD 2BDOA 3I4MB 4LAAA 2HCCA 1KDAA 1JWMD 4DU9A 5KRUA 1W0KA 4XOPA 1W9XA 5LL6X 2NVQB 3J81E 2TSSA 1I6VC 3SVMA 3BDLA 2NYZD 5C44B 1QWYA 4XLCA 1MBYA 2O5JC 1AN8A 1PTOB 3J7YW 3JAML 1HRJA 2ZZQA 2GJRA 4G7XA 3A7AB 1SYDA 4XOTA 3DEOA 1NR2A 4B9XA 1BO0A 5M5YB 4II3A 5FOBB 4K6LA 1M8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYU A;  1V8Q A;  1ONL A;  2E75 C;  2O5I C;  4KN4 C;  3PV0 A;  1HCZ A;  4OO1 H;  2BE5 D;  3A7L A;  3LWU A;  2QF7 A;  2EJM A;  3VR4 A;  1IYV A;  1V43 A;  2A6H D;  3M85 A;  1H9M A;  3GQB A;  4IQZ A;  1H9J A;  3A8K E;  2BA0 A;  1ZKO A;  3FPP A;  2L5T A;  3VR2 A;  1DD2 A;  1E2V A;  1GUT A;  1T5E A;  3BDO A;  3U9S A;  5BN4 A;  2ZT9 C;  4JK1 C;  1GUG A;  2E76 C;  5K36 G;  4H13 C;  4BA1 I;  2NN6 G;  4JBW A;  1Y69 U;  4G7Z C;  3L7Z C;  1QJO A;  2AWO A;  3PUZ A;  1TU2 B;  3OW7 A;  4DNR B;  1GUO A;  1Z7T A;  2BA1 A;  1LAB A;  3NE5 B;  2D5D A;  3MFY A;  3PUV A;  3VR6 A;  3PUW A;  1OXU A;  3IKJ A;  3P20 A;  4PV1 C;  4KHZ A;  4XTC S;  5KNB A;  2IT1 A;  5C0X H;  4DK0 A;  3I4L A;  4KKU A;  3W3A A;  2E74 C;  4G7H C;  2KA7 A;  2YYZ A;  1O7L A;  3I72 A;  1VF5 C;  1FR3 A;  1VCI A;  2LMC B;  3MXU A;  3T53 B;  3IFT A;  4IFD G;  1Q90 A;  5K36 H;  5A35 A;  1B9M A;  2EDG A;  2A68 C;  2A6E C;  4L8J A;  3VR5 A;  2JXM B;  5KNC A;  3A8I E;  5JEA H;  1H9S A;  2K7V A;  1B9N A;  2EJF C;  4KMU C;  4BA2 I;  3VA7 A;  5BN5 A;  4KKT A;  3OPO A;  1TKW B;  1DXM A;  2PCF B;  3SDZ A;  1YNN C;  1SMY C;  3H94 A;  1HPC A;  3D4R A;  3EQL C;  3ND9 A;  1G29 1;  1FYC A;  1E2W A;  2PNR C;  1GHK A;  3A8J E;  3CRK C;  1Y8N B;  2F1M A;  3GD7 A;  4HR7 B;  4DK1 A;  4OGQ C;  1CI3 M;  1HQM C;  4IFD H;  4LK1 C;  2BDO A;  1HTP A;  4OO1 G;  3TZU A;  1Y8P B;  2EJG C;  3DXJ C;  2DN8 A;  3QG1 A;  3WDN A;  2B8F A;  1ZYR C;  2JE6 I;  3QIA A;  2V4D A;  4TKO B;  1CFM A;  5KND A;  1Q1B A;  2NN6 H;  2JEA I;  1LAC A;  1O78 A;  2BE5 C;  1VF7 A;  1I6V C;  2A6H C;  3SE0 A;  3N6R A;  2D62 A;  1CTM A;  1OXX K;  2DNE A;  2KCC A;  3CRL C;  4I7Z C;  3VR3 A;  3M7N A;  1IW7 C;  2JEB I;  3LNN A;  2D2C C;  4KKS A;  3AB9 A;  3KLR A;  4LJZ C;  2PPB C;  2CW0 C;  1A6X A;  1VDZ A;  1E2Z A;  3M4Y A;  1GUS A;  1H9R A;  2O5J C;  1K8M A;  1H9K A;  1YNJ C;  1GHJ A;  2A68 D;  2NN6 I;  2AUJ D;  2A6E D;  4KI0 A;  4GZY C;  2K33 A;  4DNT B;  3QJY A;  3FMC A;  4H44 C;  3HGB A;  2DNC A;  4RCN A;  5C0X G;  2A69 C;  2EVB A;  2B8G A;  1BDO A;  2R6G A;  3A7A B;  2Q8I B;  1K8O A;  2AUK A;  1IW7 D;  1Z6H A;  1DCZ A;  1EWH A;  4KN7 C;  5BN3 A;  4G7O C;  1GJX A;  3T51 B;  1Q1E A;  3PUY A;  1H9S B;  3OOC A;  1GUN A;  3RLF A;  4H0L C;  3I73 A;  1Q12 A;  5JEA G;  1OXT A;  4TQU S;  3D31 A;  3ND8 A;  2A69 D;  3BG3 A;  1OXS C;  3PUX A;  1PMR A;  4XIG S;  1Y8O B;  1OXV A;  3T56 B;  2K32 A; 
#chains in the Genus database with same CATH topology
 4A3B H;  2VJI A;  3LWE A;  3MVV A;  2E75 C;  2K6A A;  3I55 A;  2XRS D;  5TR9 A;  1I94 Q;  3VR4 A;  3WND A;  1V43 A;  1IYV A;  3U50 C;  1H9M A;  3D26 A;  4IQZ A;  1NTG A;  4P25 A;  1EP1 B;  3U6B A;  1KNA A;  3HOW H;  1KAB A;  3G48 A;  1IBM L;  5A2Q E;  2NZO A;  3BNW A;  3ZC3 A;  1U4R A;  4Q7J B;  1FL0 A;  3EFX D;  4BA1 I;  3X3M A;  1TWA H;  2KHJ A;  4RKL A;  4X62 L;  2XND A;  4YAL A;  2EY6 A;  2WZN A;  3ZBT A;  3NE5 B;  4OX9 Q;  2UXD L;  2R9V A;  2F4V Q;  3RMH A;  3S1R H;  2FIN B;  2RDH A;  1B4O A;  4LUZ A;  1PTO D;  1STA A;  2N8N A;  3ULL A;  5C4X H;  4Y7C A;  3B6Y A;  3K7A B;  4KKU A;  2VL6 A;  1ZUN B;  3WBK A;  2AWN A;  2EQS A;  4YCV A;  3J81 k;  2QN6 A;  2RHQ B;  2JN9 A;  2K5D A;  2FMM A;  1V0E A;  1OGJ A;  1LT5 D;  3MXU A;  3KJO A;  3C1E A;  2XN9 C;  2X6W A;  4R4I A;  4Z4Z A;  3GTQ B;  1E43 A;  2KED A;  4RM0 A;  4MN3 A;  1JA1 A;  1Q3L A;  3A8I E;  1WTP A;  2ZL5 A;  4ZCK A;  4OWW B;  4PMW A;  4RGM A;  4AF7 A;  1RQR A;  2F1L A;  4EVO A;  3VA7 A;  2CWP A;  4F87 A;  3HOV G;  4A3G B;  4TN1 A;  4HIM A;  4ASU A;  5M3M H;  1GM5 A;  1VJS A;  5C5L A;  1TVC A;  1D5M C;  2YU9 B;  4GNX C;  1D2E A;  3AVW A;  4JI6 Q;  4XT1 B;  1G6Z A;  3G7L A;  2NBF A;  3OZW A;  2R7D A;  1EYA A;  4F88 A;  1N36 Q;  1E1O A;  4A3G G;  2V7W A;  1LUZ A;  3S17 H;  2EY5 A;  3HOX H;  4RGO S;  1GO3 E;  2EY1 A;  1VF7 A;  2ZL6 A;  3JAM E;  2SNM A;  4DUY Q;  4P12 A;  1SNQ A;  3D6W A;  1SDF A;  3M4O B;  4DR4 Q;  2K14 A;  1YHQ B;  1HZE A;  1JJ2 A;  1S5F D;  1PA6 A;  4A4I A;  4LF5 Q;  1MJE A;  4OP7 A;  2JA7 H;  5KIX A;  4WZT A;  1JOK A;  1YX2 A;  4QL5 A;  1VQ8 B;  2FHT A;  1YJ9 B;  2DNC A;  5DN6 A;  2K5V A;  4LUO A;  4C2M B;  4EQN A;  4IO9 A;  2Q8I B;  4A93 G;  4XDX A;  3K7U C;  5EMN A;  1D1N A;  1XMQ Q;  5IT9 c;  2Q2H A;  2R7Z B;  4QGU A;  1WOP A;  1E64 A;  3OOC A;  4XD7 A;  2OTJ B;  2WFW A;  3OJX A;  1O80 A;  1ZM2 A;  1KNE A;  4U67 3;  3PO3 H;  3S15 H;  2F0H A;  1Q12 A;  3ND8 A;  4BBS H;  2XTI A;  1EYC A;  1A3U A;  1GR1 A;  5TSS A;  4POG A;  3ERQ A;  1JB3 A;  2R7Z G;  2CF4 A;  4Z1M A;  1G8Z D;  4NXM Q;  2F0V A;  2QF7 A;  3M3Y B;  2K03 A;  3NTK A;  1RJT A;  2KOL A;  5J3B A;  4JI7 L;  1KQS B;  1PTO F;  1SKY B;  1Q82 D;  3ONY A;  1LTI D;  1K73 C;  1WPC A;  1IBL Q;  3RNU A;  1MSG A;  4N9P A;  2JP1 A;  1UD6 A;  2IY5 B;  2ZT9 C;  3TP7 A;  2XWB B;  2DYI A;  4MYU A;  1AIP A;  1YVC A;  3D4D A;  3L7Z C;  1QJO A;  3PUZ A;  3F2C A;  1RTO A;  1Z7T A;  4KK7 A;  1EY5 A;  4PNY A;  4M1K A;  2HD3 A;  2LSS A;  4XLH A;  1B7Y B;  4DNI A;  1ZM9 A;  3CXC A;  4H9G A;  3DM1 A;  2VJJ A;  5DM6 3;  1JT8 A;  4DK0 A;  2X0K A;  2L55 A;  3KBG A;  2F0W A;  4CJ1 B;  2NTS A;  4PG3 A;  2EYL A;  2ZXI A;  2AQ1 B;  4R9W A;  4HJ5 A;  5E7N A;  3IFT A;  1A8V A;  2EYO A;  3CPW A;  3GTK B;  3CF5 A;  2XOK A;  1FGB D;  2Y0S B;  3OAA A;  4L63 B;  3NEN A;  3K81 C;  1DG1 G;  1PZK D;  4P75 A;  3CRZ A;  3RY8 A;  1DAR A;  1EOT A;  1Q81 C;  1DXM A;  4X65 Q;  5D65 A;  4DPG A;  3AGQ A;  4OWT B;  1VQA A;  3WOE A;  3HOZ H;  5EBD A;  5G3L D;  4YHH Q;  2L0C A;  3BH4 A;  1MRZ A;  5D3I B;  2VXW A;  2Y0S G;  1OB5 A;  2RF4 A;  2V7U A;  4Y9R A;  3NHH A;  1E3X A;  1D5Z C;  1KAW A;  3V05 A;  4JG2 A;  1AFP A;  1HJP A;  1CA5 A;  3GV3 A;  2EOT A;  1WOO A;  4YWK A;  4A3B B;  2EYH A;  2F0E A;  4QVJ A;  3OIQ A;  1SEB D;  5M3F H;  1KK0 A;  4IFD I;  1QUQ A;  4IN3 A;  1V9P A;  4XN0 A;  4DR7 Q;  4I7Z C;  4QIW B;  3HP3 A;  1BVS A;  5JJK A;  3QOJ A;  4ZCI A;  1A6X A;  2WR8 A;  1TS5 A;  4HIO A;  2BH8 A;  3OEH A;  2UXB L;  3S1N B;  1K8M A;  1YNJ C;  3HOW B;  1STY A;  2A6E D;  2UUA Q;  1WU8 A;  2K33 A;  4A3B G;  3I56 A;  1SND A;  1UE7 A;  5NUC A;  4JI5 L;  1TWA B;  4AH6 A;  3ASR A;  3K5O A;  4O42 A;  1EWH A;  1ILQ A;  1F2M A;  5T1I A;  3HS0 C;  1TS2 A;  3H0G H;  4RPB A;  3S1R B;  1E62 A;  5IIF A;  3U2Q A;  2GN5 A;  1STE A;  5C4X B;  1X9N A;  3KLS X;  4CKE A;  3HOW G;  3M4Q A;  3FEW X;  1Y14 B;  4UZE A;  2DET A;  4DA2 A;  1HA5 A;  1KZL A;  1I18 A;  1CQF A;  5JJZ A;  2E1R A;  4A3M B;  4WJ3 M;  1J6Q A;  4BY7 H;  1OHH A;  5JEA J;  4C3J H;  1RD9 D;  3MXN B;  1YIJ A;  1LT3 D;  4MHE A;  3UE1 A;  5C4X G;  3GQB A;  2WB1 E;  1NR4 A;  3OP1 A;  1XFO A;  1II3 A;  3U9S A;  1PXU A;  3CME B;  2E76 C;  3F8T A;  2BF4 A;  4TT3 A;  4LF8 L;  4ZQ3 A;  2Z6K A;  5HY6 A;  1JMC A;  3VO1 A;  2LXJ A;  4H02 A;  4A3M G;  1CQV A;  4DNR B;  1I5F A;  1LTA D;  2BA1 A;  1TWG B;  3CD6 A;  3S2H H;  2ASB A;  4B3R Q;  2IT1 A;  3S17 B;  4QCL A;  1BCP C;  4KY5 A;  3HOX B;  1IJF A;  5G3L F;  2AQ2 B;  4K2K A;  3W5H A;  3NBH A;  5ELC A;  4IPH A;  4UAI A;  1B3Q A;  3BDC A;  1WTH D;  1VQP A;  1N06 A;  4DV3 L;  2JA5 H;  2F0I A;  1QZH A;  1M90 D;  1OO9 B;  3NEL A;  4LWC A;  5IYB H;  3GTP H;  4XQJ A;  4HJ7 A;  2VUM B;  2F0Q A;  1VQL A;  2K1B A;  4Z4U A;  2GQF A;  3B8H A;  2XVS A;  1VQO A;  1B50 A;  4IFD J;  3AU7 A;  3CRK C;  5JJL A;  2SEB D;  4DAP A;  1G7S A;  1RTN A;  1DOK A;  3GD7 A;  4PZ7 A;  2E2J H;  3V76 A;  3S15 B;  1DDI A;  4FO2 A;  1PJ5 A;  3CP0 A;  1QG7 A;  3PSI A;  5EKL A;  1F2Z A;  4LF9 L;  2VUM G;  4BBS B;  1HZC A;  4IJL A;  2AHO A;  4DV2 L;  3CCJ A;  4JI1 L;  1LAC A;  1MHW C;  2J7K A;  3FPK A;  4NXM L;  3C1F A;  1COW A;  1EY4 A;  1YZ6 A;  1N34 L;  3N6R A;  3ULJ A;  3CCL B;  2OQ0 A;  2JEB I;  2UXC L;  1SYG A;  1J8I A;  3AB9 A;  4LJZ C;  5ELB A;  4CHT B;  5BR8 Q;  2B2U A;  1WYD A;  4BBS G;  3TEH B;  3JQR A;  5CBE E;  5FLX L;  2X6Y A;  3HGB A;  1I4X A;  3U6K A;  2BDN A;  5C4J H;  4G7O C;  1K28 D;  4DK3 C;  4V0B A;  2P5Z X;  3TME A;  4IUP A;  4DV5 Q;  3OTO Q;  5LMN L;  1K83 H;  2E1B A;  1D8L A;  1DJR D;  3M4P A;  4C43 A;  1JB7 A;  4M2L A;  4X07 A;  2IX1 A;  4ZYS A;  4GKK L;  4Y52 H;  5CBA E;  4EQP A;  4XL9 A;  4B3F X;  4K0K L;  1Y8O B;  4IPC A;  3Q6Q A;  4CKB A;  4XQF A;  4P74 A;  1ONL A;  3VNV A;  3I2Z A;  3QFC A;  1EFU A;  3GTO H;  1TWC H;  3LX0 A;  4QHY A;  2GRE A;  2X85 A;  2EYF A;  2QGQ A;  1ICF B;  4FF2 A;  4DR6 L;  2QA4 B;  1CZG A;  3PF5 A;  4GS3 A;  1PH8 A;  1B70 B;  1E2V A;  4C3H B;  1XPU A;  5FL7 A;  4JI4 Q;  2QGG A;  1QUE A;  3Q8D A;  3NPP A;  4X7D A;  4DQL A;  1EY6 A;  3GTG H;  2I1L A;  3QFT A;  4TMW A;  2PMZ E;  3CU7 A;  4ODG A;  2L11 A;  1YIT A;  3CC4 B;  1HFG A;  3FKS A;  4LFC L;  4PGO A;  5IGB A;  4RD2 A;  3OW2 B;  2NVQ H;  4GKJ Q;  1DDG A;  1K8G A;  4DR2 L;  5C4Z A;  1L0X B;  1PHJ A;  4XMY A;  5CYU A;  4C3H G;  5M3F B;  2A73 B;  1UD5 A;  2B2Y C;  2N3S A;  3ISX A;  3E0E A;  4OL7 A;  4AYB E;  5C44 H;  2QTZ A;  5TV2 A;  5C3E B;  2EDG A;  4XYQ A;  3R3O A;  1SYC A;  3OWF A;  5C0X I;  4IOA A;  1F9R A;  1QB5 D;  3A0J A;  2RDG A;  3KUP A;  4BXX H;  1FRN A;  2IL8 A;  3VMF A;  1EIF A;  5M3F G;  1VQ6 A;  3G6E B;  2QCP X;  4JOI C;  3RLN A;  1VQK A;  1O7Y A;  2XNJ A;  2EPB A;  3D4W A;  3OMC A;  2OQK A;  2W6I A;  2VQE Q;  5FIU A;  4UHV A;  3H0G B;  4HR7 B;  5C3E G;  3J80 L;  3BVM A;  5E3F A;  4B3S Q;  1Q8K A;  1Q81 D;  2DER A;  5JAV A;  4Z4R A;  2JIZ A;  3GSI A;  2BV3 A;  3DXJ C;  2LZJ A;  4NMZ A;  1KDC A;  4ZGN B;  3M7G A;  1L1O B;  1LTT D;  1QG0 A;  2ZTD A;  2L1B A;  2MHV A;  1IBK L;  3L9A X;  1F2L A;  4ID6 A;  2B2W C;  1O78 A;  2KHS A;  3VYT A;  1U5K A;  5C3X A;  1FNV A;  4JI2 L;  3H0G G;  4Z9C B;  4JBK A;  1M4V A;  1D6E C;  2D62 A;  3M7N A;  4C3J B;  3KYH C;  4G4K A;  1KXL A;  1EWY A;  4RHR A;  3GV6 A;  2CVR A;  1U0L A;  1K8A C;  3SK5 A;  2BH2 A;  1QX4 A;  4RFB A;  1AE2 A;  4Z4T A;  4BWG B;  5C0X G;  1QE6 A;  1YHB A;  2EYP A;  1WTV A;  1SSO A;  2RDF A;  5I6W A;  2Q6L A;  4TMT A;  5I4D A;  5JVG 3;  4LF7 Q;  4O1N A;  1GAQ A;  3ZBU A;  1EEI D;  2H4O A;  3LQ6 A;  1X6O A;  1SNP A;  1JJC B;  3K7A H;  2JYO A;  2NV4 A;  1KTK A;  4NW2 A;  3HOV H;  1NDH A;  3AYH B;  4X05 A;  2B2T C;  4J6H A;  4POF A;  3ZJY C;  1FJG Q;  1EFT A;  1JE4 A;  2QDX A;  1CSQ A;  1LLR D;  1CNF A;  1BR9 A;  3GTQ H;  1G6P A;  2B2V A;  2WIN B;  2JA5 B;  4OOV A;  4LFB Q;  1GAW A;  2YV5 A;  1C4Q A;  3G4S A;  1J5E L;  3E3X A;  1SNM A;  3H3V C;  1XXG A;  4DXF A;  4WZK A;  3M85 A;  2GK7 A;  2AKW B;  2AMC B;  4RDJ A;  4IW3 B;  1W2B A;  4RD0 A;  1SE4 A;  1X56 A;  4RD6 A;  2C35 B;  4B3M Q;  1BQE A;  3QFS A;  2XZL A;  3MEF A;  2K75 A;  4A3E B;  5LMU Q;  4N3N A;  1ET9 A;  2HCI A;  2YU9 H;  1Y69 U;  5LMZ A;  4JI3 Q;  3BYT B;  4MTK A;  2JA5 G;  3P1H A;  1PJ6 A;  2A74 C;  2XEX A;  4XYO A;  4IUN A;  2UUC Q;  4PC6 A;  1YHQ A;  4ACB A;  2HMA A;  4DR5 L;  4RDL A;  2MP1 A;  2PZW A;  1D8T A;  2D9U A;  5KGU A;  1AMO A;  2E74 C;  2KA7 A;  4A93 H;  4HCS A;  3V96 A;  1BX0 A;  4A3E G;  4A3D G;  2DIE A;  2MFI A;  1CQX A;  1X3G A;  3CW2 C;  5IOC A;  3HZX A;  1TLL A;  1A3T A;  1EYG A;  4OXP A;  4RD1 A;  3VYR A;  4X06 A;  3SEJ A;  1B9M A;  1WDT A;  4RCZ A;  1PH7 A;  4FXK C;  1BOS A;  2AQ3 B;  1GVP A;  2K7V A;  2OTJ A;  3K8A A;  2K50 A;  4XLE A;  3CCM B;  1ESF A;  4GN4 B;  4JI0 L;  2MO0 A;  4UPA A;  2R7Z H;  4J0Q A;  3SLN A;  1IHZ A;  2UU9 L;  1BBU A;  2CQO A;  4OGQ C;  1N0V C;  3TP5 A;  1N32 L;  5IWA L;  1D2B A;  1KQS A;  4RLZ A;  1HNZ Q;  3QB3 A;  3T1H L;  1JQY D;  2K05 A;  2F0U A;  4RCO A;  3VYS A;  4IUR A;  1A8P A;  3E5S A;  1Q86 C;  3ZZU A;  3J81 i;  4YEJ A;  4JMQ A;  3MAQ A;  2KCM A;  4R1J A;  4DV0 Q;  2A6H C;  3CCU B;  1TWC B;  3M3Y H;  2UUB Q;  1STH A;  2KQ3 A;  1I6H B;  4NXN L;  3NBI A;  3PIP A;  3A8J A;  1W35 A;  1PRT B;  4IZ8 A;  4NPS A;  1TS3 A;  3KDF B;  4UDU C;  4JV5 Q;  4DNT B;  3PA1 A;  3GTG B;  3MTS A;  5CMD A;  4GLV B;  1NY4 A;  4K1X A;  3BZD B;  2Z4I A;  3PUY A;  2Z8L A;  3OIP A;  1LV9 A;  2RC5 A;  5HXB A;  3AVT A;  2ZXR A;  3CKI B;  3Q23 A;  1JA0 A;  3GTM B;  1F60 A;  1KDB A;  2Y0S E;  4OIK A;  1QVF B;  1ILP A;  1B2T A;  4MYT A;  5KW9 A;  2ICE C;  3NEM A;  3NP8 A;  2ZIT A;  1V1Q A;  4WOR A;  1WP6 A;  1MGS A;  2PMZ B;  5L37 A;  2ID0 A;  5CV9 A;  3A5Z B;  2QMU A;  2SOB A;  2PQE A;  5EKK A;  1HNW L;  4WZE A;  1E3Z A;  4DR1 Q;  4ROX A;  1QOH A;  4RMF A;  4QF4 A;  1R9T B;  3GTL H;  1VMC A;  4RAU C;  4JI8 L;  1EQT A;  4AYB B;  1BQQ T;  4DAV A;  1XX8 A;  1Y0R A;  1YEZ A;  3SLD A;  2ZZF A;  1EIY B;  3ZIA A;  1KL9 A;  2OBR A;  5KYL A;  1F77 A;  1T6Y A;  3LO8 A;  4RKB A;  4C56 C;  2QKI C;  1TS4 A;  4BXX G;  1G91 A;  4K5V A;  5EAY A;  4AYB G;  3NTH A;  1MI2 A;  4XTC S;  4PAA A;  1NRK A;  1PRT D;  4A3J H;  3C3L A;  3U58 A;  4KY6 A;  1FNM A;  1NSN S;  2YYZ A;  4GOP C;  2BM0 A;  3C46 A;  5C5M A;  1BXT A;  3NWT A;  5K36 H;  5IT9 L;  1L0W A;  3SXH A;  1WSR A;  1N9W A;  1WTH A;  3S1N H;  4J8Q A;  4X7C A;  1P4M A;  2RCN A;  3FHW A;  2JSO A;  1PV4 A;  2M9V A;  5FA6 A;  2PYK A;  4Z4W A;  4XKV A;  4BA2 I;  1TKW B;  3H3V I;  1BKB A;  2IHE A;  2DJG C;  3ND9 A;  1G29 1;  1H8H A;  4JW0 A;  3TS0 A;  3QWN A;  2CBX A;  2EXZ A;  4DN4 M;  4X62 Q;  1B44 D;  3HOV B;  4IFD H;  2UXD Q;  4TRD A;  1C8C A;  1HTP A;  2VQF L;  2NTT A;  2CRV A;  2ZBV A;  3MXN A;  4XN3 A;  2KBN A;  4XT3 B;  3JQQ A;  2XIW A;  2K4K A;  5B6I A;  2ZBU A;  4XNF A;  4ZCL A;  1A2T A;  2Q8R E;  4K8J A;  4L5Q A;  3A8I A;  3SHL A;  1I50 H;  3JAM i;  1SYE A;  1K3B C;  2ZM6 L;  3CME A;  4HJA A;  4A3M H;  2F0G A;  1PLF A;  4DAY B;  2M2L A;  1LT4 D;  2F0F A;  3DUZ A;  3SKB A;  2BVN A;  1R4P B;  2RVL A;  4F7D A;  1FVI A;  1LM0 A;  1VDZ A;  1H9R A;  3HOU H;  1GHJ A;  2AUJ D;  2F0L A;  1K9M D;  3CCE B;  2F4N A;  5C3W A;  2GJK A;  4LFA L;  1BBX C;  3AMU A;  1Y0Y A;  1L0Y B;  4LBV A;  1SJH D;  2A69 C;  4RCN A;  1JOR A;  1KK1 A;  2R6H A;  1VQG A;  1I4P A;  1TWG H;  2F0S A;  5JOB A;  3FKI G;  3TRZ A;  2C5B A;  2NVX B;  2ALY B;  2Q8T A;  1E22 A;  4RD4 A;  1K8A D;  1P8L A;  3F2B A;  2RKS A;  3T13 A;  1T6Z A;  3PIP 3;  4JBM A;  4A93 B;  4CQJ A;  1KC8 D;  2NVT B;  5J3O A;  4LF6 L;  3CHB D;  3D0F A;  5IYC H;  4X64 L;  1K0S A;  1IYU A;  2PLF A;  4HJ8 A;  3PV0 A;  1N36 L;  2C4T A;  4PAB A;  3O13 A;  3ER0 A;  5GAG C;  2BE5 D;  2VS1 A;  3UDG A;  5I2X A;  3NUC A;  2XRQ D;  2VUM H;  3KF8 B;  1PRT F;  2QEX B;  1OB2 A;  4XKW A;  3A8K E;  2Q6O A;  1N0U A;  2O2L D;  4A3C H;  4DR4 L;  3KEW A;  5DS0 A;  2HT1 A;  3IAY A;  3CC7 B;  2ZZE A;  1P16 A;  1ENF A;  1X54 A;  4GN5 A;  4QJF A;  3A56 A;  3TP8 A;  1K0R A;  1TU2 B;  1JC7 A;  1F9Q A;  3CCL A;  1E1R A;  5IT9 E;  3PUW A;  3EN2 A;  3CCQ B;  1HUM A;  4YAW A;  3BQJ A;  3ZUG A;  2MO1 A;  2K28 A;  2IWH A;  3I4L A;  5KNB A;  2CCZ A;  1E79 A;  3CMA B;  4QVA A;  3DMU A;  4B08 A;  5FO9 B;  3UI2 A;  1GD7 A;  4K14 A;  1WTX A;  1NUC A;  2A68 C;  1Q7Y C;  5KNC A;  4B3T L;  3KJP A;  3R6K A;  2ZL7 A;  4GLX A;  1S72 B;  1SMY C;  1H42 A;  1SAP A;  1PYW D;  1BLI A;  1E2W A;  3OHX C;  3E1Y E;  3Q0A A;  2D74 A;  3NQT A;  4ZK9 B;  1V0F A;  2PO4 A;  3BY1 A;  3FDT A;  1IBL L;  1VLY A;  1R4Q B;  2R92 B;  2FMC A;  3AFQ A;  5COR A;  5AJ3 Q;  1SNC A;  2EJG C;  4IUU A;  2OWO A;  1TVX A;  4QUZ A;  2JE6 I;  2QA4 A;  2CC2 A;  1VQ7 A;  2YTY A;  1XWE A;  1OGI A;  1JCK B;  3FPU B;  4FVM A;  3MEH A;  2X3U A;  1VQ5 B;  1M1K C;  4LF4 L;  5HZB A;  5GV7 A;  1WOR A;  2M00 A;  3EVQ A;  3SE0 A;  3W5O A;  1XNR L;  1PH9 A;  4P3Y A;  2N55 A;  2F0P A;  1Q9S A;  4DV6 L;  1S40 A;  1G7R A;  2R92 G;  4X3T A;  3GTL B;  2CW0 C;  3M4Y A;  2OXP A;  5DAU A;  1GUS A;  4C3H H;  2NN6 I;  2F3V A;  4DQK A;  4N8F A;  3AGP A;  3PVD A;  3S2D H;  1EFR A;  1UEB A;  1NBW A;  1NNX A;  4YY3 L;  1N33 L;  1TT2 A;  1YNN D;  5M5X B;  3MC0 B;  1H9S B;  5HGQ A;  4A3J B;  4GOP B;  5JEA G;  3K6O A;  3J7Z C;  1IL2 A;  2PZT A;  1LYL A;  4JC0 A;  1FDR A;  1QVG B;  2L9H A;  3HRZ C;  2G9H D;  2F0M A;  5KYI A;  5C3E H;  1EY9 A;  3WNB A;  3K0X A;  3X3N A;  5F2D A;  2N49 A;  3I70 A;  1YJW A;  4IUV A;  5IGE A;  2UXB Q;  2WV6 D;  4A3J G;  3KLW A;  2LS0 1;  3W2F A;  2I46 A;  1KK3 A;  1KHI A;  1L1O A;  3QSY A;  3BZC A;  4EQ5 A;  5ELO A;  4JI5 Q;  4HTH A;  1S5B D;  4FN5 A;  2E2D C;  4X8I A;  5K36 G;  4P6Y A;  1I7P A;  3WQZ A;  2NN6 G;  4GN3 B;  4ILW A;  3I8Z A;  5KSW B;  3DWA A;  2F4I A;  4OON A;  4XQN A;  4DV1 L;  3VNU A;  3MFY A;  4ZLT F;  2NUC A;  1O7Z A;  2Q6K A;  4ZRZ A;  1YLO A;  5C0X H;  4G1V A;  1OTC A;  3B82 A;  5CV8 A;  1PJ7 A;  3W3A A;  4RJL A;  1YI2 B;  1V1P A;  1I50 B;  1D1K A;  3I91 A;  3CTA A;  4FXU A;  2FFK B;  4HED A;  1PYB A;  2JA8 H;  4IFD G;  3BCF A;  2PI2 E;  2BN4 A;  3KLS A;  1VHE A;  2CQA A;  2OCE A;  4ZKC B;  3DLL A;  3I7F A;  4YWL A;  4X7E A;  3HOU B;  2WPD A;  4U9U A;  1B9N A;  4GNX B;  2WJV A;  1SXT A;  1HZA A;  3GVJ A;  2PCF B;  3R2I A;  1GXD C;  4AF6 A;  4APV A;  1FYC A;  1I4R A;  1VQJ A;  2B29 A;  3BVG A;  5EPK A;  3I4O A;  4UAJ A;  3H9N A;  1HNX L;  5DSZ A;  2NZH A;  2RQX A;  2IPK D;  4A3F G;  2WAC A;  5LL6 S;  1JIC A;  1ZEQ X;  5THX A;  2F3I A;  4TSF A;  1F9S A;  1OB0 A;  3NSW A;  3HOU G;  2ZXH A;  2DEU A;  3WDN A;  2GA4 B;  3OYY A;  1VQ4 A;  2B63 B;  2C2W A;  4YAO A;  4LUV A;  1KMH A;  1LTS D;  1DOM A;  4PC1 A;  1GKH A;  5IGG A;  3EBE A;  3K5N A;  1T6X A;  1L2F A;  2DY7 A;  1OXX K;  4DV3 Q;  3RZO B;  3LNN A;  3ASQ A;  1TTT A;  1SE2 A;  2WKC A;  4BPR A;  3ERO A;  4MIU A;  2ZJQ A;  4ZUJ A;  4A3E H;  2B63 G;  4JVZ A;  3URY A;  5IYC G;  4A3D H;  5ISR A;  3T1Y L;  2C77 A;  1JB9 A;  3BS1 A;  2PE3 A;  4DV7 L;  2AUK A;  4AVZ A;  1D1I A;  1ASZ A;  1C9O A;  3KFU A;  1GJX A;  1TUI A;  2VNK A;  1HZ9 A;  3IL8 A;  1JWU D;  1ELO A;  4YWM A;  4LF9 Q;  1KRH A;  4B4D A;  2I07 B;  4DV2 Q;  3J7A F;  4P22 A;  3SJZ A;  4A3C G;  1CK1 A;  4JI1 Q;  2A69 D;  3LVB A;  1FD7 D;  2KCN A;  5CV6 A;  1JJG A;  1I8D A;  3Q3A A;  4CDF C;  4Z4V A;  1ENC A;  3CCM A;  1XYI A;  4DUZ Q;  1TWF H;  2K32 A;  1N34 Q;  2NWG A;  2RBM A;  4FK8 A;  4OPS A;  3CES A;  3ASS A;  2OBS A;  4BBR B;  2ZTN A;  5IYD G;  5E1F A;  2UXC Q;  3W5U A;  2C78 A;  3A35 A;  4CBV A;  3PIO 3;  4LNQ A;  5A8A A;  1S5E D;  4PZ6 A;  1STB A;  5J39 A;  1EWC A;  1VQN B;  4J1M A;  5GAE C;  4CJ2 C;  1DD2 A;  3EIV A;  5BSY A;  4DF7 A;  3KOJ A;  3L3O C;  1T5E A;  2ZJR A;  1XPR A;  2ZXO A;  1YBY A;  1E24 A;  1HXY D;  3PGZ A;  2XZP A;  1SR3 A;  4LBW A;  2Z1C A;  4BBR G;  3U9O A;  3ERS X;  1XMO L;  3CCU A;  5LMN Q;  2GJP A;  3OW7 A;  2XWJ B;  5CGK A;  5JPM C;  2GVA A;  3HEJ A;  3AFP A;  2PZU A;  3G71 A;  5A89 A;  4GKK Q;  2OYN A;  1ICW A;  4K0K Q;  3KDF A;  1N05 A;  5EBC A;  1I6H H;  1H95 A;  2WSS A;  3BCD A;  1FR3 A;  1VCI A;  2LMC B;  4G7W A;  3CCS A;  2IX3 A;  1HA6 A;  2VW9 A;  3D6C A;  2WJY A;  1HR0 L;  2XNA C;  2B2U C;  4RH6 A;  2A19 A;  2ENB A;  5E4W C;  4DR6 Q;  1XJV A;  4N3G A;  3OPO A;  3F2U A;  1SRU A;  3S2D B;  3H94 A;  1HPC A;  4NCN A;  3KF6 A;  4CDC C;  3CXC B;  4A76 A;  1K73 D;  3G05 A;  1HVX A;  1ZXT A;  3PEN A;  2NB0 A;  5M5W H;  1UEA B;  2ZTC A;  4K2L A;  2V7X A;  2E8G A;  3GTM H;  1PFM A;  4AQY L;  1PZI D;  4LFC Q;  1SMX A;  1IKM A;  1Z9F A;  3E0J A;  1CKN B;  1JWS D;  1UD8 A;  1E7Z A;  2DY1 A;  4M1U B;  4JOI A;  4FXG C;  4TVA B;  3AST A;  3P75 A;  2OTL B;  3VO2 A;  1B3A A;  1U4M A;  4GLA C;  4HE5 A;  2V1C C;  1EQR A;  3RZD B;  3CQZ B;  4CGY B;  3OZU A;  4RHS A;  1GJR A;  3MZ5 A;  1XQB A;  3I90 A;  2YWG A;  2K5N A;  1R9T H;  5C4H A;  2FX3 A;  3SK4 A;  2K5Q A;  3S16 H;  4A3I B;  3MHB A;  4OEL B;  1B53 A;  1R5N A;  4FDB A;  1WOC A;  5L46 A;  4KI0 A;  1B23 P;  2BMW A;  4L5S A;  3A54 A;  3ASP A;  1SJE D;  2EVB A;  2R6G A;  1WD1 A;  3A55 A;  1ET6 A;  2RC6 A;  5LMN W;  3T51 B;  4TMX A;  2CW0 D;  5H1S E;  3HKZ E;  1DGS A;  1E3P A;  2NVY B;  3E20 A;  1PYS B;  4ZKB B;  4A3I G;  1SFO B;  3RLO A;  1W0J A;  1PFB A;  5FLX E;  3RD4 A;  4JYA L;  2D3N A;  3K0Y A;  1IBK Q;  4P2C B;  2BM1 A;  4M8A A;  2JA8 B;  3T56 B;  4JI2 Q;  1EYD A;  2B7C A;  2VZA A;  1HCZ A;  2VYQ A;  5IP7 H;  3IRB A;  3Q38 A;  3QR8 A;  5I6Y A;  1RHP A;  5F4O A;  3V7A A;  4RGN A;  3GDE A;  2QE7 A;  1KAA A;  1WI5 A;  2BA0 A;  4XON A;  1JNY A;  1YNX A;  3QO2 A;  1PDQ A;  2JA8 G;  3R93 A;  5BN4 A;  5CDF A;  1HUN A;  1BCP B;  1YNJ D;  2JQO A;  1VQM B;  5IP9 H;  3K59 A;  4G7Z C;  2E2H H;  4B48 A;  4UZF A;  4DAY A;  4KJO A;  3F2D A;  3OEE A;  1OXU A;  3HKS A;  3IKJ A;  3P20 A;  1WTW A;  3P27 A;  1EOV A;  4DGZ A;  4G7H C;  4LF7 L;  2A1A A;  1YIJ B;  1O7L A;  1RIP A;  3I72 A;  5IYQ A;  1ESR A;  2C5C A;  3OFN A;  4P6V F;  3H3V H;  1LT6 D;  1EIG A;  3FKI H;  2C5H A;  3SR1 A;  4KHP L;  5CV4 A;  3OJW A;  3P7J A;  1EU3 A;  1X32 A;  4IUT A;  3ONU A;  4CKC A;  4GQN A;  3T4A C;  2VY3 A;  3J80 i;  1IKL A;  4A3D B;  5A88 A;  4KKT A;  3S1M H;  4HN7 A;  3TZD A;  4LC0 A;  1DYQ A;  2R7F A;  5JVH 3;  2B39 A;  4WJ4 A;  2NVX H;  1I4G A;  4WRD A;  3DDY A;  5EPL A;  2F1M A;  4NBS A;  5GQO A;  4DR5 Q;  4B3M L;  1QNK A;  4AIM A;  1BMF A;  2Z6B D;  3TBI B;  2NVT H;  1FNB A;  5LMU L;  1VQ8 A;  3KF8 A;  5FO7 B;  1WSV A;  1YJ9 A;  2B8F A;  2QEX A;  1VQP B;  3R6J A;  5KND A;  1TWF B;  1VLO A;  1WFQ A;  1UNS A;  2B2V C;  5DM7 3;  2UUC L;  1Q46 A;  1C0A A;  3J80 E;  1BCP D;  5ELN A;  1FRQ A;  2J7Z A;  3CC7 A;  4TMZ A;  2FJ2 A;  4FNF A;  4DFA A;  3Q39 A;  1CTM A;  4A75 A;  1Q82 C;  1RQP A;  1LTR D;  3UDX A;  1IW7 C;  1D5X C;  2D2C C;  4R4T A;  3A1P A;  4L6T B;  5EQ0 A;  2MQH A;  3PUN A;  3CCQ A;  1XNQ L;  4Q0F A;  1Y1V B;  1VQE A;  4Y7N B;  2PNH A;  4O0A A;  5E4X A;  3CMA A;  1EIH A;  3KK7 A;  3CCJ B;  4B44 A;  3BZK A;  1AE3 A;  2NZ1 D;  1N32 Q;  2KUM A;  3K58 A;  5IWA Q;  1TY0 A;  1GUN A;  2R61 A;  1IL8 A;  1W87 A;  2K01 A;  3T1H Q;  4ZAI A;  1G51 A;  5EKI A;  3BYY B;  1Y1V G;  2ZZG A;  1S72 A;  1PMR A;  1U9R A;  1RKN A;  1EEF D;  4QQB X;  4DV4 L;  4KN4 C;  2PIA A;  3CCR B;  4NXN Q;  2HHH L;  4AC9 A;  2X6G A;  4ULL A;  5J22 A;  1H8E A;  1ENA A;  1MJC A;  5IK2 A;  1UUP A;  4OPO A;  2Z4H A;  5D3D A;  2LFN A;  4EGV A;  2XNC A;  3Q6S A;  2JJ2 A;  1ZKO A;  2WP8 J;  4K6D A;  5M5W B;  4FF4 A;  4NP5 A;  1GUG A;  1Y1W H;  2C9O A;  3CP2 A;  4L5R C;  1LTL A;  4A3K B;  1KRT A;  2R92 H;  2R93 G;  2AWO A;  3PCO B;  3SGI A;  4X66 L;  4KY7 A;  4PMC A;  4K5W A;  3HOY H;  4QV2 A;  1HH2 P;  2E5L L;  3J81 c;  1E0B A;  4HIZ A;  1MSH A;  3EA6 A;  1WVL A;  3W2D A;  2R3Z A;  1FNU A;  4A3K G;  2DOG A;  4KTA A;  3ULP A;  3S9W A;  1HNW Q;  1Q90 A;  4RWS C;  4ABN A;  3S16 B;  2BGI A;  4ACA A;  2CND A;  2A6E C;  5JEA H;  1MD2 D;  1H9S A;  4G6I A;  1VQB A;  4JI8 Q;  3W5V A;  4EX5 A;  2IX0 A;  5BN5 A;  4B3X A;  1PZJ D;  3I4M G;  1QIL A;  1NE3 A;  3PO2 H;  4FWT A;  4DR1 L;  1BCP F;  4MNO A;  1QVG A;  5M5X H;  1F9P A;  3GO5 A;  4UY8 C;  4P73 A;  4UP8 A;  4DR3 L;  4A3L G;  5ELD A;  4HE6 A;  1EY8 A;  1Y8P B;  3QG1 A;  1JOO A;  2DN8 A;  2A8V A;  2RSO A;  1ZYR C;  3D8G A;  4Q5V A;  4TKO B;  2NN6 H;  3HKZ B;  2JEA I;  3E6Z X;  1F20 A;  2ZXP A;  2KEN A;  2ZJP A;  1VQ6 B;  4KV6 A;  3Q6R A;  1KJZ A;  3VR3 A;  1IBM Q;  4BS9 A;  3KLR A;  3OKX A;  1I94 L;  3WXM A;  1LTG D;  2IW3 A;  4QUF A;  4CJ0 B;  2PPB C;  5CC4 A;  3TQY A;  1AP0 A;  4GZY C;  3HKZ G;  4M4S A;  4ME5 A;  1YI2 A;  4NNJ A;  2B8G A;  3QOL A;  2E2H B;  1CM9 A;  5IP7 G;  1K8O A;  2CFM A;  4PQX A;  4KN7 C;  2H1E A;  2VNJ A;  1T9H A;  1J9O A;  5IGD A;  2VQF Q;  1FX0 A;  1GO2 A;  3AEV A;  2W6J A;  2MJ8 A;  4RG1 A;  5K5P A;  5I9P A;  2IJ0 A;  4OX9 L;  1GUW A;  1OXT A;  1D7Q A;  3D31 A;  4GNX A;  4E0F A;  4UZU A;  2F4V L;  1A62 A;  3FKI B;  1XTD A;  2YTX A;  5IP9 G;  2KVM A;  4N8X 1;  3UE0 A;  2ZM6 Q;  2BCO A;  4R71 A;  3DEP A;  3P26 A;  1N8R C;  3RN5 A;  3M9B A;  4A3F H;  1M90 C;  2ZTE A;  3RR5 A;  2XGT A;  5FK9 C;  1G2T A;  4KD4 A;  2HIV A;  3K80 C;  3A7L A;  1NMF A;  2FVG A;  3LWU A;  5M9O A;  3ICE A;  3OMG A;  1EP3 B;  3S1M B;  1ASY A;  4LFA Q;  5IGF A;  2EXD A;  2L5T A;  1K28 A;  2F03 A;  3WY9 A;  4PZ8 A;  3MCA A;  2WYR A;  4JK1 C;  1X3P A;  2QEJ C;  3WWV A;  1EZ6 A;  1I3Q H;  3TSS A;  4OO1 I;  4P3I A;  3OE7 A;  3MMP A;  4X3K A;  1O7I A;  5IYW A;  2OT2 A;  2B63 H;  5IYP A;  3A3B A;  2XGJ A;  3MXG A;  1AZQ A;  4JI6 L;  1EXM A;  3C2P A;  1F2Y A;  4EQO A;  3Q24 A;  4LF6 Q;  2EFG A;  1S0U A;  3G4S B;  1VQ9 B;  2F43 A;  4R4O A;  5FJ8 H;  4X64 Q;  3JAM c;  4HSP A;  2FXQ A;  4JCV E;  1W2B B;  3RZO H;  1KIX A;  3T53 B;  4B43 A;  1S5C D;  2VBU A;  2F0J A;  1MIU A;  5A35 A;  4R4C A;  3A8K A;  4DUY L;  1WTR A;  2N88 A;  3VR5 A;  4L8J A;  2OF1 A;  2G5D A;  5JJI A;  2CHB D;  2EJF C;  1LO5 D;  3ZZT A;  1G2S A;  3MA2 B;  3TP6 A;  4LF5 L;  1EUJ A;  3GTJ H;  3JQP A;  2PNR C;  5IYD H;  1DZ1 A;  2CKZ B;  3S1Q B;  1PVO A;  4FXD A;  1XMQ L;  4LK1 C;  3WOF A;  3VYU A;  1VQD A;  1YHA A;  4OO1 G;  4YCW A;  5DEH A;  2V4D A;  1VQN A;  1R5O A;  1Q1B A;  1W34 A;  1HHV A;  4JI7 Q;  4BBR H;  1KRS A;  1CKO A;  4K5X A;  1PFN A;  4EH1 A;  1UD3 A;  1X55 A;  4CDD C;  1EQV A;  1Z47 A;  2DNE A;  2KCC A;  4B3T Q;  1SE8 A;  4P9S A;  5CV5 A;  5I2Y A;  1QFZ A;  2DCU A;  2OK8 A;  2VBT A;  1E2Z A;  3ONA B;  2M5S A;  1QGZ A;  3NXW A;  4PMB A;  3W1G A;  5FLM H;  5HKK A;  1SLJ A;  1QGY A;  1TQO A;  3DWQ A;  4OWX B;  1Y1W B;  1V1O A;  5ELE A;  1BDO A;  4DKA C;  4P2N A;  1IW7 D;  1DCZ A;  2Z0S A;  2KEE A;  3E9I A;  4G5G A;  2H5X A;  3RLF A;  3CCV B;  4YIJ A;  2BOS A;  4IJH A;  3HOY B;  3ZZ0 A;  2VNH A;  5H59 A;  1S4M A;  3PUX A;  1XE1 A;  2CW5 A;  1DOL A;  5TRD A;  4XIG S;  1Y1W G;  4TSS A;  1OXV A;  3FMC A;  4LF4 Q;  2D3L A;  4J15 A;  5AJ3 L;  3PF4 A;  3CB4 A;  1CT1 D;  3CC4 A;  1XNR Q;  4C1N K;  2VB3 X;  4DV6 Q;  3OW2 A;  1RL2 A;  1A63 A;  1NMG A;  3PUM A;  1Q86 D;  1EFC A;  4R8N A;  5BSX A;  1EY0 A;  5EJW A;  1YJN B;  5C6A A;  3L2P A;  3TRE A;  4RD3 A;  3HOY G;  1CKN A;  2A6H D;  5E6T A;  1IHM A;  2HLD A;  3PIO A;  3PO2 B;  4O2D A;  4HCE A;  2DUD A;  3FRP B;  4X65 L;  2OTL A;  1QUF A;  4YY3 Q;  1N33 Q;  2RHS B;  5F4J A;  2N78 A;  4H13 C;  4FYD A;  4JBJ A;  2V31 A;  1KD1 C;  3KBX A;  3C2Q A;  4YHH L;  2OK7 A;  3W2I A;  1SM4 A;  2D0P A;  3VR6 A;  4R8I A;  1LAB A;  1WOS A;  4XLA A;  3S14 B;  3CC2 B;  2EYM A;  3G6E A;  2JDI A;  1S4Z A;  3QE2 A;  4LW1 A;  4UP9 A;  3PO2 G;  3RZD H;  2EY2 A;  3CQZ H;  3RUZ A;  3STB C;  3UDF A;  2PQA B;  2B3G A;  5HUR A;  4HMJ A;  3T16 A;  1N07 A;  1CHP D;  1PH6 A;  1HFN A;  4A3I H;  5KEE A;  2F0T A;  4QMG A;  4DR7 L;  4II2 A;  2F52 A;  2XZO A;  4ALP A;  1E1T A;  2OEO A;  1MAB A;  3WNC A;  4P26 A;  4LMQ D;  3D4R A;  2UUA L;  3J7A V;  3LGJ A;  1IYJ B;  1X3E A;  4QY7 A;  2GPJ A;  3I55 B;  4DV1 Q;  1BJK A;  4YHB A;  2NVY H;  1SFO H;  3NK9 A;  2K5H A;  3FJO A;  2WAQ E;  1CI3 M;  5IE8 A;  1HQM C;  4XXE A;  2TMP A;  2CK3 A;  3J81 j;  2Z6B A;  4NDX A;  1JE5 A;  1UE5 A;  3BC9 A;  1IZ6 A;  4U68 A;  2KVO A;  2X69 A;  5JBQ A;  3QIA A;  1CFM A;  2PI2 A;  3HG9 A;  3A74 A;  1FNW A;  4X3S A;  4A3F B;  3AQQ A;  1SN8 A;  3NWS A;  2J0T D;  1A15 A;  1PH2 A;  1VS0 A;  2VNU D;  1EL0 A;  5T1G A;  3WBJ A;  1VQM A;  4WFN 3;  1EZ8 A;  1WCM H;  1X65 A;  1RDP D;  1L1O C;  1ZYR D;  2JA6 H;  2CWA A;  4YAU A;  2X6X A;  1S3O A;  1NCV A;  1VHO A;  1K3R A;  4LF8 Q;  2G9D A;  2HQL A;  1WJJ A;  3VA5 A;  3QJY A;  4RGT A;  1EQQ A;  4OHJ A;  1I3Q B;  1CNE A;  2X8K A;  1A3V A;  4RA8 A;  1HNX Q;  1RF2 D;  4KJN A;  4L5T A;  2V7Q A;  3QFR A;  2KJX A;  1VQF A;  3MFG A;  4OIJ A;  1Q1E A;  1SYB A;  5M3M B;  4UP7 A;  5FNZ A;  2KEC A;  4R4Q A;  5AN9 A;  4X6A H;  4TQU S;  1QCB D;  2RCF A;  1QNU A;  2EZV A;  3BG3 A;  1UAP A;  4B3R L;  5JPN C;  3WYA A;  2V7T A;  3GVK A;  3I4N H;  5EPJ A;  2O5I C;  4N9T A;  5COY A;  2QIL A;  2LXK A;  1NJI C;  5M3M G;  2Z6K C;  1LTB D;  1AEX A;  1NB9 A;  3OWE B;  5FJ8 G;  2YWF A;  5H5J A;  3GTJ B;  3FPP A;  5FO0 A;  3T1Y Q;  1N8R D;  2E2I H;  1UE1 A;  2F0D A;  4DV7 Q;  2JA7 B;  4QFM A;  4JBW A;  3HOX G;  2Q2T A;  3DHQ A;  4OPV A;  2RA4 A;  4C1N I;  4HIK A;  2F3W A;  4NB3 A;  1B2R A;  2VBV A;  1IXR A;  1CSP A;  1VMP A;  1JJ2 B;  1EY7 A;  1DM0 B;  4I65 A;  2XSC A;  1R5B A;  1X3Q A;  5J1Z A;  1EFI D;  1U4P A;  4CDE C;  3DWP A;  2VB2 X;  3PO3 B;  3BY2 A;  4PC2 A;  4IUQ A;  1VF5 C;  2JA7 G;  4XR6 A;  3K57 A;  1UMK A;  1HTL D;  4LBY A;  3K5M A;  1BPL A;  3GVL A;  5HZA A;  2QDL A;  3W2E A;  4DUZ L;  2ES2 A;  1Y1V H;  1QH0 A;  2K04 A;  3NTI A;  4Y7N H;  4S3S A;  1PH3 A;  3D3R A;  5BR8 L;  2EYJ A;  3PO3 G;  3EQL C;  2HCJ B;  1E1Q A;  4FP5 D;  4C3I H;  1AH9 A;  2SNS A;  2HIX A;  3OZV A;  1XMO Q;  3ZPN A;  4FF3 A;  4H7B A;  4DK1 A;  3CCR A;  2GK6 A;  1TWH H;  1SE3 A;  3J7A 5;  5J35 A;  5FLM G;  1XTC D;  3OTO L;  4DV5 L;  2L15 A;  4F8M A;  2YTV A;  2O4X A;  5IOD A;  4WWV A;  2LKV A;  2J4X A;  2MPM A;  2MUY A;  2F0O A;  4JPB W;  4YCU A;  3KL9 A;  4YEL A;  3RN2 A;  2R93 H;  5GRO A;  1I4Q A;  3IFD A;  1HR0 Q;  3TDQ A;  1W6K A;  3DM3 A;  4P1V A;  2B2Y A;  3CRL C;  1G7T A;  1QVF A;  2Q2U A;  4DXG A;  4B9W A;  1C48 A;  4KKS A;  2K52 A;  2QDB A;  4C0S A;  2VBS A;  2ZTG A;  3I1F A;  5FO1 A;  1H9K A;  1UWV A;  4OOX A;  1Q7Y D;  2A68 D;  5LHY 1;  2VZL A;  2JA9 A;  4A3K H;  4H44 C;  1BF4 A;  5HGT A;  3PA2 A;  2MGS A;  4BY1 H;  2B7B A;  3JC6 6;  1VQH A;  4JI4 L;  4DR2 Q;  1VQ7 B;  3CPW B;  1SMY D;  5BN3 A;  4AQY Q;  3HOZ B;  1H85 A;  1W3S A;  3CMM A;  1PRT C;  4WQM A;  4LBZ A;  4P71 A;  1SBB B;  3FVQ A;  4Z4S A;  3I4M H;  4K8I A;  4GKJ L;  3CPX A;  2I5H A;  1OXS C;  1TR5 A;  4PC3 A;  3JU4 A;  1W6J A;  3AVY A;  1TY2 A;  4NKL A;  2WKD A;  3I3C A;  1IJE A;  4A3L H;  1HA3 A;  1V8Q A;  4DK6 C;  3HOZ G;  1KLU D;  2D9R A;  2B2W A;  4HMI A;  3ZYY X;  1M1K D;  3UDI A;  4G57 A;  4HJ9 A;  2EJM A;  3BJU A;  3EJI A;  1WTO A;  1FNC A;  1PTO H;  1NAP A;  1CKM A;  1PTO C;  3BDO A;  4X3U A;  1UD2 A;  3H91 A;  1WD0 A;  2C4U A;  1QUQ B;  3GIR A;  1U2R A;  4WJW A;  2VQE L;  5FKA C;  2CH4 W;  1GUO A;  1AZP A;  3TS2 A;  2L4N A;  4JYA Q;  1PKV A;  4B3S L;  1ZM3 A;  3A3G A;  2HDN B;  4KHZ A;  4PV1 C;  1YJW B;  2WZP P;  1UE6 A;  4QB4 A;  2OBT A;  2YWE A;  3AVU A;  1JR0 D;  4IPG A;  4XQQ A;  5M5Y H;  5FLX c;  3I56 B;  5DNF A;  2WAQ B;  2A5H A;  5GAH C;  1HQR D;  1KD1 D;  1AW7 A;  2Z9H A;  3VDY A;  1HR0 W;  2P3M A;  2B2T A;  2PW7 A;  1WCM B;  2X53 S;  3OSO A;  2EIF A;  2I5L X;  3U4Z A;  1SYF A;  3V2T A;  2CH4 A;  2JA6 B;  5AFW A;  1K9M C;  3LQE A;  1FND A;  2F0N A;  1JOQ A;  1MKH A;  1XPO A;  3HAG A;  4B3G A;  4PC7 A;  4ZGQ B;  4M0L A;  4X7F A;  3HFZ B;  4BY7 B;  3STB D;  2WAQ G;  3SDZ A;  1UD4 A;  4Z4Y A;  1S5D D;  3Q22 A;  4X0C A;  1WCM G;  4M53 A;  1ML0 D;  5CV7 A;  1Y8N B;  3PQI A;  5CR3 A;  2HQE A;  1V1P B;  2WII B;  1EU4 A;  1HZB A;  2JN4 A;  1BX1 A;  1EFW A;  5DLQ E;  2JA6 G;  1KC8 C;  3CCE A;  3SJP A;  4HID A;  2LY7 A;  2DY8 A;  3B78 A;  3TZU A;  2DGY A;  2WB1 B;  2KCT A;  4XM3 A;  2IHF A;  3CPF A;  4BY7 G;  4Y9U A;  4C3J G;  3K5L A;  1SKQ A;  4KHV A;  3S2H B;  1CUK A;  5I9O A;  4KHP Q;  3I4N B;  1J5E Q;  3R2T A;  4YAF A;  2BE5 C;  1FJG L;  3N52 A;  2BPO A;  1BUV T;  2DJF C;  5IGC A;  1BBW A;  5EGT A;  4ZUI A;  3CD6 B;  3TN2 A;  3CW2 A;  3BU2 A;  4LFB L;  2YWH A;  2WB1 G;  1CZW A;  3U4V A;  5D14 A;  1GOZ A;  1ZM4 A;  2E2I B;  3R8B A;  3J81 L;  3I4N G;  3GTP B;  4ZCM A;  3CP8 A;  1VQ9 A;  2GVB A;  1QZG A;  4A3G H;  1KTV A;  3NBH B;  1WTQ A;  4HSV A;  1VQ4 B;  2PW5 A;  1Z6H A;  2ICI A;  4IOC A;  2EIX A;  3ES9 A;  1B1Z A;  4KLK A;  2PMD A;  1SNO A;  4MTN A;  4JI3 L;  4I7A A;  4E6I A;  4H0L C;  3G6J B;  3I73 A;  2MNA A;  3GP7 A;  3MXP A;  2E2J B;  1ROD A;  1TXY A;  2HDL A;  2F0K A;  4ME3 A;  1VQL B;  1Q8I A;  5IYB G;  3ITP A;  5C0X J;  1IB0 A;  1VQO B;  1T5X D;  2L12 A;  1NBM A;  1VQC A;  4XLF A;  1U4L A;  1V5V A;  4QUC A;  3J80 c;  3MWY W;  4OO1 H;  2BSA A;  4RDK A;  1VQI A;  4JI0 Q;  2QW7 A;  4WZL A;  3F1Z A;  2D0O A;  2JJ1 A;  1FGU A;  1J9Z A;  3M4O H;  2QTL A;  3AVX A;  3BVZ A;  2UU9 Q;  2X6L A;  2EE1 A;  1XNQ Q;  2AHO B;  2K5W A;  2SDF A;  4IAL A;  3A5U A;  1H9J A;  3VR2 A;  4C3I B;  4HAE A;  1KLG D;  2RSN A;  1GUT A;  3H6M A;  5IY0 A;  3S1Q H;  4KD3 A;  4F7X A;  5GV8 A;  1NJI D;  4C2M H;  3CAM A;  4YXW A;  1TWH B;  1A2U A;  1QFY A;  1TII D;  2Q2I A;  4V19 0;  3PMF A;  5KNL A;  1N08 A;  4B47 A;  1I4H A;  2D5D A;  3PUV A;  1GVH A;  4RCY A;  5C4J B;  2ATW A;  2BGJ A;  3H09 A;  2B5O A;  4RPD A;  1CA6 A;  5IYR A;  1K83 B;  4C3I G;  1BNZ A;  5A2Q L;  2R93 B;  4P72 A;  3SEB A;  1HNZ L;  1A0I A;  4DV4 Q;  5IYN A;  3E9H A;  4TMV A;  5FO8 B;  5F4M A;  1G7C A;  1QVC A;  3SK8 A;  2HHH Q;  4XOR A;  2HDM A;  4DV0 L;  2HUG A;  1E63 A;  1QFJ A;  2JXM B;  1CHQ D;  2UUB L;  3W1B A;  2NPF A;  3S24 A;  3CCV A;  3GTO B;  1DON A;  1PH5 A;  4OOS A;  4KMU C;  1STN A;  4BY1 B;  1VQ5 A;  1NB0 A;  1YNN C;  3H15 A;  3G71 B;  1SRO A;  4JV5 L;  3FP9 A;  3A8J E;  1EP2 B;  3SK6 A;  1GHK A;  3W2H A;  3NQI A;  2I5M X;  2V7V A;  4MZ9 A;  4X66 Q;  4FF1 A;  1STG A;  5ELF A;  1XB2 A;  1RCV D;  2BDO A;  3I4M B;  3CCS B;  2HCC A;  4LAA A;  3W2G A;  1YJN A;  4G1B A;  1EWI A;  2E5L Q;  4OEM B;  1B8A A;  1JWM D;  1KK2 A;  1KDA A;  1X3F A;  4BY1 G;  4DU9 A;  1W0K A;  4XOP A;  5KRU A;  1PH4 A;  1W9X A;  2Q6I A;  5LL6 X;  2NVQ B;  4DAM A;  3L0O A;  2I0Q A;  2JK8 A;  3J81 E;  1PH1 A;  4IPD A;  2TSS A;  1I6V C;  3KF6 B;  4GOP A;  3SVM A;  1YIT B;  2KHI A;  3BDL A;  2NYZ D;  3GTK H;  5C44 B;  1QWY A;  4XLC A;  1MBY A;  3CC2 A;  2O5J C;  1AN8 A;  1PTO B;  3J7Y W;  3JAM L;  1HRJ A;  2ZZQ A;  2GJR A;  4G7X A;  1PFS A;  3A7A B;  2PQA A;  1SYD A;  4XOT A;  4DR3 Q;  5GAD C;  3S14 H;  3DEO A;  1NR2 A;  4B9X A;  4ZV4 A;  1QGA A;  1BO0 A;  5C44 G;  5M5Y B;  2JJQ A;  4II3 A;  5FOB B;  4K6L A;  4QIW E;  1C7Y A;  3MHP A;  1VQK B;  1M8A A;  2VNI A;  5TY0 A;  3AVV A; 
#chains in the Genus database with same CATH homology
 2VJI A;  3LWE A;  3MVV A;  2E75 C;  2K6A A;  2XRS D;  3VR4 A;  1IYV A;  1V43 A;  1H9M A;  4IQZ A;  1KNA A;  1KAB A;  5A2Q E;  1U4R A;  3EFX D;  4BA1 I;  3X3M A;  4RKL A;  2XND A;  2EY6 A;  3NE5 B;  2R9V A;  3RMH A;  2FIN B;  2RDH A;  1B4O A;  1PTO D;  1STA A;  3K7A B;  4KKU A;  2AWN A;  2K5D A;  2FMM A;  1V0E A;  1LT5 D;  3MXU A;  3C1E A;  2XN9 C;  2X6W A;  3GTQ B;  1E43 A;  2KED A;  4MN3 A;  3A8I E;  1Q3L A;  1WTP A;  4PMW A;  4RGM A;  4EVO A;  3VA7 A;  4F87 A;  4A3G B;  4ASU A;  1VJS A;  5C5L A;  1D5M C;  2YU9 B;  1G6Z A;  4XT1 B;  3G7L A;  2NBF A;  1EYA A;  4F88 A;  2EY5 A;  4RGO S;  2EY1 A;  1VF7 A;  3JAM E;  2SNM A;  1SNQ A;  3D6W A;  1SDF A;  3M4O B;  1HZE A;  1S5F D;  5KIX A;  1JOK A;  2FHT A;  4C2M B;  2DNC A;  5DN6 A;  4EQN A;  2Q8I B;  4XDX A;  2R7Z B;  3OOC A;  4XD7 A;  1O80 A;  1KNE A;  4U67 3;  2F0H A;  1Q12 A;  3ND8 A;  1EYC A;  1A3U A;  5TSS A;  3ERQ A;  1JB3 A;  4Z1M A;  1G8Z D;  2F0V A;  2QF7 A;  3M3Y B;  2K03 A;  3NTK A;  1RJT A;  2KOL A;  1PTO F;  1SKY B;  1LTI D;  1WPC A;  1MSG A;  4N9P A;  2JP1 A;  1UD6 A;  2ZT9 C;  3TP7 A;  2XWB B;  3D4D A;  3L7Z C;  1QJO A;  3PUZ A;  1RTO A;  1Z7T A;  4KK7 A;  1EY5 A;  4PNY A;  4XLH A;  3DM1 A;  2VJJ A;  5DM6 3;  4DK0 A;  2L55 A;  3KBG A;  2F0W A;  4CJ1 B;  2NTS A;  2EYL A;  2ZXI A;  2AQ1 B;  4R9W A;  3IFT A;  2EYO A;  3GTK B;  2XOK A;  1FGB D;  2Y0S B;  3OAA A;  4L63 B;  1PZK D;  1EOT A;  1DXM A;  5D65 A;  3WOE A;  5EBD A;  5G3L D;  2L0C A;  3BH4 A;  5D3I B;  2VXW A;  3NHH A;  1E3X A;  1D5Z C;  1AFP A;  3V05 A;  1CA5 A;  3GV3 A;  2EOT A;  4A3B B;  2EYH A;  2F0E A;  3OIQ A;  1SEB D;  4IFD I;  4IN3 A;  4XN0 A;  4I7Z C;  4QIW B;  3HP3 A;  3QOJ A;  1A6X A;  1TS5 A;  3OEH A;  3S1N B;  1K8M A;  1YNJ C;  3HOW B;  1STY A;  2A6E D;  2K33 A;  1SND A;  5NUC A;  1TWA B;  3K5O A;  4O42 A;  1EWH A;  1ILQ A;  1F2M A;  5T1I A;  3HS0 C;  1TS2 A;  3S1R B;  5IIF A;  1STE A;  5C4X B;  3KLS X;  4CKE A;  3FEW X;  4DA2 A;  1HA5 A;  1KZL A;  1I18 A;  1CQF A;  5JJZ A;  4A3M B;  1OHH A;  5JEA J;  1RD9 D;  1LT3 D;  4MHE A;  3GQB A;  1NR4 A;  1II3 A;  3U9S A;  1PXU A;  2E76 C;  4TT3 A;  4ZQ3 A;  1CQV A;  4DNR B;  1LTA D;  2BA1 A;  1TWG B;  2IT1 A;  3S17 B;  4QCL A;  1BCP C;  4KY5 A;  3HOX B;  5G3L F;  2AQ2 B;  4K2K A;  3NBH A;  5ELC A;  4UAI A;  3BDC A;  1WTH D;  2F0I A;  1OO9 B;  4XQJ A;  2VUM B;  2F0Q A;  2K1B A;  2XVS A;  1B50 A;  4IFD J;  3AU7 A;  3CRK C;  2SEB D;  4DAP A;  1RTN A;  1DOK A;  3GD7 A;  3S15 B;  4FO2 A;  1QG7 A;  5EKL A;  1F2Z A;  4BBS B;  1LAC A;  3C1F A;  1COW A;  1EY4 A;  3N6R A;  2JEB I;  1SYG A;  1J8I A;  3AB9 A;  4LJZ C;  5ELB A;  4CHT B;  2B2U A;  5FLX L;  5CBE E;  2X6Y A;  3HGB A;  1I4X A;  2BDN A;  4G7O C;  1K28 D;  4V0B A;  3TME A;  4IUP A;  2E1B A;  1DJR D;  2IX1 A;  4ZYS A;  5CBA E;  4EQP A;  4XL9 A;  4B3F X;  1Y8O B;  4CKB A;  4XQF A;  1ONL A;  3LX0 A;  2X85 A;  2EYF A;  4FF2 A;  1CZG A;  1E2V A;  4C3H B;  5FL7 A;  3NPP A;  1EY6 A;  3CU7 A;  4ODG A;  2L11 A;  3FKS A;  1HFG A;  5IGB A;  5C4Z A;  1L0X B;  4XMY A;  5CYU A;  4C3H G;  5M3F B;  2A73 B;  1UD5 A;  2B2Y C;  4OL7 A;  5C3E B;  2EDG A;  4XYQ A;  3R3O A;  1SYC A;  3OWF A;  5C0X I;  1F9R A;  1QB5 D;  2RDG A;  3KUP A;  2IL8 A;  2QCP X;  1O7Y A;  2EPB A;  3D4W A;  3OMC A;  2W6I A;  3H0G B;  4HR7 B;  3J80 L;  3BVM A;  5E3F A;  5JAV A;  2JIZ A;  3DXJ C;  2LZJ A;  4NMZ A;  1KDC A;  3M7G A;  1LTT D;  2L1B A;  2MHV A;  3L9A X;  1F2L A;  4ID6 A;  2B2W C;  1O78 A;  2KHS A;  3VYT A;  5C3X A;  1FNV A;  4Z9C B;  1M4V A;  1D6E C;  2D62 A;  3M7N A;  4C3J B;  4G4K A;  4RHR A;  3GV6 A;  2CVR A;  3SK5 A;  4RFB A;  4BWG B;  5C0X G;  1QE6 A;  2EYP A;  1WTV A;  1SSO A;  2RDF A;  5I6W A;  5I4D A;  5JVG 3;  4O1N A;  2H4O A;  1EEI D;  1SNP A;  4NW2 A;  2JYO A;  1KTK A;  2B2T C;  4J6H A;  1JE4 A;  1LLR D;  1BR9 A;  2B2V A;  2WIN B;  2JA5 B;  1C4Q A;  1SNM A;  3H3V C;  1XXG A;  4DXF A;  3M85 A;  2GK7 A;  1SE4 A;  2XZL A;  4A3E B;  1ET9 A;  2HCI A;  1Y69 U;  3BYT B;  3P1H A;  2A74 C;  4XYO A;  4IUN A;  2MP1 A;  2PZW A;  2D9U A;  5KGU A;  2E74 C;  2KA7 A;  4HCS A;  3V96 A;  2DIE A;  5IOC A;  3HZX A;  1A3T A;  3VYR A;  1B9M A;  4FXK C;  1BOS A;  2AQ3 B;  2K7V A;  4XLE A;  1ESF A;  1IHZ A;  4OGQ C;  3TP5 A;  1D2B A;  3QB3 A;  1JQY D;  2K05 A;  2F0U A;  4RCO A;  3VYS A;  4IUR A;  3E5S A;  4YEJ A;  4JMQ A;  3MAQ A;  1I6H B;  2A6H C;  1TWC B;  1STH A;  2KQ3 A;  3NBI A;  1PRT B;  4IZ8 A;  1TS3 A;  4UDU C;  4DNT B;  3GTG B;  3MTS A;  5CMD A;  3BZD B;  2Z4I A;  3PUY A;  2Z8L A;  3OIP A;  1LV9 A;  2ZXR A;  3CKI B;  3Q23 A;  3GTM B;  1KDB A;  4OIK A;  1ILP A;  1B2T A;  3NP8 A;  2ICE C;  4WOR A;  1WP6 A;  1MGS A;  2PMZ B;  2ID0 A;  5CV9 A;  2SOB A;  2PQE A;  5EKK A;  1E3Z A;  1QOH A;  4QF4 A;  1R9T B;  1VMC A;  4RAU C;  1EQT A;  4AYB B;  1BQQ T;  4DAV A;  1XX8 A;  2ZZF A;  3ZIA A;  5KYL A;  1F77 A;  4RKB A;  4C56 C;  2QKI C;  1TS4 A;  1G91 A;  4K5V A;  3NTH A;  1MI2 A;  4XTC S;  1NRK A;  1PRT D;  3C3L A;  4KY6 A;  1NSN S;  2YYZ A;  3C46 A;  5C5M A;  1BXT A;  3NWT A;  5K36 H;  5IT9 L;  3SXH A;  4J8Q A;  2JSO A;  2M9V A;  2PYK A;  4XKV A;  4BA2 I;  1TKW B;  3ND9 A;  1G29 1;  1H8H A;  3QWN A;  2EXZ A;  4DN4 M;  1B44 D;  3HOV B;  4IFD H;  4TRD A;  1C8C A;  1HTP A;  2NTT A;  3MXN A;  4XN3 A;  4XT3 B;  2XIW A;  4XNF A;  2Q8R E;  1A2T A;  4K8J A;  3SHL A;  1SYE A;  2F0G A;  1PLF A;  2M2L A;  1LT4 D;  2F0F A;  3DUZ A;  1R4P B;  2RVL A;  1VDZ A;  1H9R A;  1GHJ A;  2AUJ D;  2F0L A;  5C3W A;  2GJK A;  1BBX C;  3AMU A;  1L0Y B;  1SJH D;  4RCN A;  2A69 C;  1JOR A;  1I4P A;  2F0S A;  5JOB A;  2NVX B;  2Q8T A;  2RKS A;  3T13 A;  3PIP 3;  4A93 B;  2NVT B;  3CHB D;  1IYU A;  3PV0 A;  3O13 A;  2BE5 D;  5I2X A;  3NUC A;  2XRQ D;  1PRT F;  4XKW A;  3A8K E;  2O2L D;  3KEW A;  3IAY A;  2ZZE A;  1ENF A;  3A56 A;  3TP8 A;  1TU2 B;  1JC7 A;  1F9Q A;  1E1R A;  5IT9 E;  3PUW A;  1HUM A;  5KNB A;  2K28 A;  2IWH A;  3I4L A;  1E79 A;  3DMU A;  4B08 A;  5FO9 B;  3UI2 A;  4K14 A;  1WTX A;  1NUC A;  2A68 C;  5KNC A;  1SMY C;  1SAP A;  1PYW D;  1BLI A;  1E2W A;  3OHX C;  3Q0A A;  3NQT A;  4ZK9 B;  1V0F A;  2PO4 A;  3FDT A;  1VLY A;  1R4Q B;  2R92 B;  2FMC A;  5COR A;  1SNC A;  2EJG C;  4IUU A;  1TVX A;  2JE6 I;  1XWE A;  1JCK B;  3FPU B;  4FVM A;  3MEH A;  2M00 A;  3EVQ A;  3SE0 A;  2N55 A;  2F0P A;  4X3T A;  3GTL B;  2CW0 C;  3M4Y A;  2OXP A;  5DAU A;  1GUS A;  2NN6 I;  2F3V A;  1EFR A;  1TT2 A;  1YNN D;  5M5X B;  3MC0 B;  1H9S B;  4A3J B;  5JEA G;  3K6O A;  2PZT A;  2L9H A;  3HRZ C;  2G9H D;  2F0M A;  5KYI A;  1EY9 A;  3X3N A;  5F2D A;  3I70 A;  4IUV A;  5IGE A;  2WV6 D;  2LS0 1;  2I46 A;  4HTH A;  1S5B D;  2E2D C;  5K36 G;  3WQZ A;  2NN6 G;  4ILW A;  3I8Z A;  3DWA A;  2F4I A;  4XQN A;  4ZLT F;  3MFY A;  2NUC A;  1O7Z A;  4ZRZ A;  5C0X H;  5CV8 A;  3W3A A;  1V1P A;  1I50 B;  1D1K A;  3I91 A;  4FXU A;  2FFK B;  4HED A;  4IFD G;  3BCF A;  3KLS A;  2CQA A;  4ZKC B;  3HOU B;  2WPD A;  1B9N A;  2WJV A;  1SXT A;  3GVJ A;  2PCF B;  3R2I A;  1GXD C;  1FYC A;  1I4R A;  3BVG A;  5EPK A;  2RQX A;  2IPK D;  2WAC A;  5LL6 S;  1JIC A;  1ZEQ X;  4TSF A;  1F9S A;  1OB0 A;  3NSW A;  2ZXH A;  3WDN A;  2GA4 B;  2B63 B;  1KMH A;  1LTS D;  1DOM A;  5IGG A;  3K5N A;  2DY7 A;  1OXX K;  3RZO B;  3LNN A;  1SE2 A;  2WKC A;  3ERO A;  4MIU A;  4ZUJ A;  3URY A;  5ISR A;  3BS1 A;  2AUK A;  4AVZ A;  1D1I A;  1GJX A;  3IL8 A;  1JWU D;  2I07 B;  3J7A F;  4P22 A;  1CK1 A;  2A69 D;  1FD7 D;  5CV6 A;  2KCN A;  1I8D A;  1XYI A;  1ENC A;  2K32 A;  2NWG A;  2RBM A;  3CES A;  4BBR B;  2ZTN A;  5E1F A;  3PIO 3;  3A35 A;  4CBV A;  1S5E D;  1STB A;  5J39 A;  1EWC A;  4J1M A;  4CJ2 C;  1DD2 A;  4DF7 A;  3L3O C;  1T5E A;  2ZXO A;  1HXY D;  2XZP A;  2Z1C A;  3U9O A;  2GJP A;  3OW7 A;  2XWJ B;  5CGK A;  5JPM C;  3HEJ A;  2PZU A;  1ICW A;  5EBC A;  2WSS A;  3BCD A;  1FR3 A;  1VCI A;  2LMC B;  4G7W A;  2IX3 A;  1HA6 A;  3D6C A;  2WJY A;  2XNA C;  2B2U C;  4RH6 A;  2ENB A;  5E4W C;  3OPO A;  3F2U A;  3S2D B;  3H94 A;  1HPC A;  3G05 A;  1HVX A;  1ZXT A;  2NB0 A;  1UEA B;  4K2L A;  1PFM A;  1PZI D;  1IKM A;  3E0J A;  1JWS D;  1UD8 A;  4M1U B;  4FXG C;  3P75 A;  1B3A A;  1U4M A;  3RZD B;  3CQZ B;  4CGY B;  4RHS A;  3MZ5 A;  3I90 A;  5C4H A;  3SK4 A;  2K5Q A;  4A3I B;  3MHB A;  1B53 A;  4KI0 A;  3A54 A;  1SJE D;  2EVB A;  2R6G A;  1WD1 A;  3A55 A;  1ET6 A;  3T51 B;  2CW0 D;  1SFO B;  2NVY B;  4ZKB B;  1W0J A;  1PFB A;  5FLX E;  3RD4 A;  2D3N A;  3K0Y A;  4P2C B;  4M8A A;  2JA8 B;  3T56 B;  1EYD A;  1HCZ A;  5I6Y A;  1RHP A;  4RGN A;  2QE7 A;  1KAA A;  2BA0 A;  4XON A;  3QO2 A;  1PDQ A;  1HUN A;  3R93 A;  5BN4 A;  5CDF A;  1BCP B;  1YNJ D;  3K59 A;  4G7Z C;  4DAY A;  4KJO A;  3OEE A;  1OXU A;  3IKJ A;  3P20 A;  1WTW A;  4DGZ A;  4G7H C;  1O7L A;  3I72 A;  2C5C A;  1ESR A;  3OFN A;  1LT6 D;  1EIG A;  3SR1 A;  5CV4 A;  3P7J A;  1EU3 A;  1X32 A;  4IUT A;  4CKC A;  4GQN A;  3T4A C;  1IKL A;  4A3D B;  4KKT A;  4HN7 A;  3TZD A;  1DYQ A;  5JVH 3;  2B39 A;  1I4G A;  4WRD A;  3DDY A;  5EPL A;  2F1M A;  1QNK A;  1BMF A;  2Z6B D;  3TBI B;  3KF8 A;  5FO7 B;  2B8F A;  5KND A;  1TWF B;  1UNS A;  2B2V C;  5DM7 3;  3J80 E;  1BCP D;  2J7Z A;  2FJ2 A;  4FNF A;  4DFA A;  1CTM A;  1LTR D;  1IW7 C;  1D5X C;  2D2C C;  4L6T B;  5EQ0 A;  4Q0F A;  1Y1V B;  4Y7N B;  5E4X A;  1EIH A;  3KK7 A;  2NZ1 D;  2KUM A;  3K58 A;  1TY0 A;  1GUN A;  2R61 A;  1IL8 A;  2K01 A;  4ZAI A;  5EKI A;  3BYY B;  2ZZG A;  1PMR A;  1U9R A;  1RKN A;  1EEF D;  4KN4 C;  2X6G A;  4ULL A;  5J22 A;  1H8E A;  1ENA A;  5IK2 A;  1UUP A;  4EGV A;  2Z4H A;  5D3D A;  2LFN A;  3Q6S A;  2JJ2 A;  1ZKO A;  2WP8 J;  4K6D A;  5M5W B;  4FF4 A;  4NP5 A;  1GUG A;  2C9O A;  3CP2 A;  4A3K B;  2AWO A;  4KY7 A;  4PMC A;  4K5W A;  1E0B A;  4HIZ A;  1MSH A;  3EA6 A;  1WVL A;  3W2D A;  2R3Z A;  1FNU A;  4KTA A;  3S9W A;  1Q90 A;  4RWS C;  4ABN A;  3S16 B;  2A6E C;  5JEA H;  1MD2 D;  1H9S A;  4G6I A;  2IX0 A;  5BN5 A;  1PZJ D;  1QIL A;  1BCP F;  1F9P A;  3GO5 A;  5ELD A;  1EY8 A;  1Y8P B;  3QG1 A;  1JOO A;  2DN8 A;  2RSO A;  1ZYR C;  3D8G A;  4Q5V A;  4TKO B;  2NN6 H;  3HKZ B;  2JEA I;  3E6Z X;  2ZXP A;  4KV6 A;  3VR3 A;  4BS9 A;  3KLR A;  2PPB C;  1LTG D;  2IW3 A;  4QUF A;  4CJ0 B;  5CC4 A;  1AP0 A;  4GZY C;  4ME5 A;  4NNJ A;  2B8G A;  3QOL A;  2E2H B;  1CM9 A;  1K8O A;  4PQX A;  4KN7 C;  2H1E A;  1J9O A;  5IGD A;  1FX0 A;  2W6J A;  2MJ8 A;  5K5P A;  5I9P A;  2IJ0 A;  1GUW A;  1OXT A;  3D31 A;  4E0F A;  4UZU A;  3FKI B;  2KVM A;  2BCO A;  3DEP A;  1G2T A;  5FK9 C;  4KD4 A;  3A7L A;  3LWU A;  5M9O A;  3OMG A;  3S1M B;  5IGF A;  2L5T A;  2F03 A;  4JK1 C;  1X3P A;  2QEJ C;  1EZ6 A;  3TSS A;  4OO1 I;  3OE7 A;  4X3K A;  2OT2 A;  1AZQ A;  3A3B A;  2XGJ A;  3MXG A;  3C2P A;  1F2Y A;  4EQO A;  3Q24 A;  2F43 A;  4HSP A;  3T53 B;  1S5C D;  2F0J A;  5A35 A;  1WTR A;  2N88 A;  3VR5 A;  4L8J A;  2OF1 A;  2CHB D;  2EJF C;  1LO5 D;  1G2S A;  3MA2 B;  3TP6 A;  2PNR C;  1DZ1 A;  3S1Q B;  4FXD A;  4LK1 C;  3WOF A;  3VYU A;  4OO1 G;  5DEH A;  2V4D A;  1Q1B A;  1HHV A;  4K5X A;  1PFN A;  1UD3 A;  1EQV A;  1Z47 A;  2DNE A;  2KCC A;  5CV5 A;  5I2Y A;  4PMB A;  1E2Z A;  3ONA B;  2M5S A;  3NXW A;  5HKK A;  1TQO A;  3DWQ A;  1Y1W B;  1V1O A;  5ELE A;  1BDO A;  1IW7 D;  1DCZ A;  2KEE A;  3RLF A;  4YIJ A;  2BOS A;  3HOY B;  3PUX A;  1DOL A;  4XIG S;  4TSS A;  3FMC A;  1OXV A;  2D3L A;  1CT1 D;  4C1N K;  2VB3 X;  4R8N A;  5EJW A;  5C6A A;  1EY0 A;  2A6H D;  2HLD A;  3PO2 B;  4HCE A;  3FRP B;  4FYD A;  4H13 C;  2V31 A;  3KBX A;  3VR6 A;  4R8I A;  1LAB A;  4XLA A;  3S14 B;  2EYM A;  2JDI A;  1S4Z A;  2EY2 A;  3RUZ A;  5HUR A;  4HMJ A;  3T16 A;  1CHP D;  1HFN A;  5KEE A;  2F0T A;  4QMG A;  4II2 A;  2XZO A;  2OEO A;  1MAB A;  4LMQ D;  3D4R A;  3J7A V;  3NK9 A;  1CI3 M;  1HQM C;  4XXE A;  2TMP A;  2CK3 A;  4NDX A;  3BC9 A;  4U68 A;  2KVO A;  2X69 A;  3QIA A;  1CFM A;  3HG9 A;  1FNW A;  4X3S A;  4A3F B;  2VNU D;  3NWS A;  2J0T D;  1A15 A;  1EL0 A;  5T1G A;  4WFN 3;  1EZ8 A;  1RDP D;  1ZYR D;  2X6X A;  1NCV A;  2G9D A;  3VA5 A;  3QJY A;  4RGT A;  4OHJ A;  1I3Q B;  2X8K A;  1A3V A;  4RA8 A;  1RF2 D;  4KJN A;  2V7Q A;  2KJX A;  3MFG A;  4OIJ A;  1Q1E A;  1SYB A;  5M3M B;  2KEC A;  4TQU S;  1QCB D;  1QNU A;  2EZV A;  3BG3 A;  1UAP A;  5JPN C;  3GVK A;  5EPJ A;  2O5I C;  4N9T A;  5COY A;  2QIL A;  1LTB D;  1AEX A;  3OWE B;  3GTJ B;  3FPP A;  2F0D A;  2JA7 B;  4JBW A;  3DHQ A;  2RA4 A;  4C1N I;  2F3W A;  1VMP A;  1EY7 A;  1DM0 B;  4I65 A;  2XSC A;  1X3Q A;  5J1Z A;  1EFI D;  1U4P A;  3DWP A;  2VB2 X;  3PO3 B;  4IUQ A;  1VF5 C;  4XR6 A;  3K57 A;  1HTL D;  3K5M A;  1BPL A;  3GVL A;  3NTI A;  2K04 A;  4S3S A;  3D3R A;  2EYJ A;  3EQL C;  1E1Q A;  4FP5 D;  2SNS A;  3ZPN A;  4FF3 A;  4H7B A;  4DK1 A;  2GK6 A;  1SE3 A;  1XTC D;  4F8M A;  2O4X A;  5IOD A;  2LKV A;  2J4X A;  2MPM A;  2MUY A;  2F0O A;  4YEL A;  1I4Q A;  3IFD A;  3TDQ A;  1W6K A;  2B2Y A;  3CRL C;  4DXG A;  4B9W A;  1C48 A;  4KKS A;  2QDB A;  2ZTG A;  1H9K A;  2A68 D;  5LHY 1;  1BF4 A;  4H44 C;  5HGT A;  2MGS A;  5BN3 A;  3HOZ B;  1SMY D;  3CMM A;  1PRT C;  1SBB B;  3FVQ A;  4K8I A;  1OXS C;  1TR5 A;  3JU4 A;  1W6J A;  1TY2 A;  4NKL A;  2WKD A;  3I3C A;  1V8Q A;  1KLU D;  2B2W A;  4HMI A;  3ZYY X;  4G57 A;  2EJM A;  3EJI A;  1WTO A;  1PTO H;  1NAP A;  1PTO C;  3BDO A;  4X3U A;  1UD2 A;  3H91 A;  1WD0 A;  4WJW A;  5FKA C;  1GUO A;  1AZP A;  2L4N A;  1PKV A;  3A3G A;  4PV1 C;  4KHZ A;  4QB4 A;  1BNZ A;  2WZP P;  1JR0 D;  4XQQ A;  5DNF A;  2WAQ B;  2A5H A;  1HQR D;  1AW7 A;  2B2T A;  2PW7 A;  1WCM B;  2X53 S;  3OSO A;  1SYF A;  3V2T A;  2JA6 B;  5AFW A;  1JOQ A;  2F0N A;  3HAG A;  4B3G A;  4BY7 B;  3SDZ A;  1UD4 A;  1S5D D;  3Q22 A;  1ML0 D;  5CV7 A;  1Y8N B;  5CR3 A;  2HQE A;  1V1P B;  2WII B;  1EU4 A;  2LY7 A;  2DY8 A;  3TZU A;  2WB1 B;  4XM3 A;  4C3J G;  3K5L A;  4KHV A;  3S2H B;  5I9O A;  3I4N B;  3R2T A;  2BE5 C;  3N52 A;  1BUV T;  5IGC A;  5EGT A;  4ZUI A;  3TN2 A;  1CZW A;  5D14 A;  1GOZ A;  2E2I B;  3R8B A;  3J81 L;  3GTP B;  3CP8 A;  1WTQ A;  4HSV A;  2PW5 A;  1Z6H A;  2ICI A;  1B1Z A;  1SNO A;  4E6I A;  4H0L C;  3G6J B;  3I73 A;  3GP7 A;  3MXP A;  2E2J B;  1ROD A;  2HDL A;  2F0K A;  1Q8I A;  3ITP A;  5C0X J;  1T5X D;  2L12 A;  1NBM A;  4XLF A;  1U4L A;  4QUC A;  3MWY W;  4OO1 H;  2JJ1 A;  3BVZ A;  2X6L A;  2EE1 A;  2K5W A;  2SDF A;  4IAL A;  1H9J A;  3VR2 A;  4C3I B;  4HAE A;  1KLG D;  2RSN A;  1GUT A;  3H6M A;  4KD3 A;  4F7X A;  4YXW A;  1TWH B;  1A2U A;  1TII D;  4V19 0;  3PMF A;  5KNL A;  1I4H A;  2D5D A;  5C4J B;  3PUV A;  3H09 A;  1CA6 A;  1K83 B;  4C3I G;  2R93 B;  5A2Q L;  3SEB A;  5FO8 B;  3SK8 A;  4XOR A;  2HDM A;  2HUG A;  2JXM B;  1CHQ D;  1DON A;  3GTO B;  4KMU C;  1STN A;  4BY1 B;  1YNN C;  1GHK A;  3A8J E;  3SK6 A;  3NQI A;  4FF1 A;  1STG A;  5ELF A;  1RCV D;  2BDO A;  3I4M B;  4LAA A;  2HCC A;  1KDA A;  1JWM D;  4DU9 A;  5KRU A;  1W0K A;  4XOP A;  1W9X A;  5LL6 X;  2NVQ B;  3J81 E;  2TSS A;  1I6V C;  3SVM A;  3BDL A;  2NYZ D;  5C44 B;  1QWY A;  4XLC A;  1MBY A;  2O5J C;  1AN8 A;  1PTO B;  3J7Y W;  3JAM L;  1HRJ A;  2ZZQ A;  2GJR A;  4G7X A;  3A7A B;  1SYD A;  4XOT A;  3DEO A;  1NR2 A;  4B9X A;  1BO0 A;  5M5Y B;  4II3 A;  5FOB B;  4K6L A;  1M8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...