2X53S

Structure of the phage p2 baseplate in its activated conformation with sr
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
298
structure length
298
Chain Sequence
GVRQYKIHTNLDGTDDKVWDVTNGKVRFYQPSNLGLQSTNNIWQSNGIGVMGTRSITQPQIEFKLETFGESLEENYQLMKDFVNDILSKKFVTLEYQTEIFQVYADLALADVTKTEGYGKNGTFSEKITFDIITKWYTYENLTFDKIQNGKVIAGMSKIYGGTAPGNYKYIKGTSYTYYGESDIDRLSRWDIKEEIFSFMGILYPKLPKTPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQGWKGTTALNLFPVMDFERYRTRIIEKGQMELINLSKAEFKIKRKADFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
molecule keywords ORF16
total genus 53
structure length 298
sequence length 298
chains with identical sequence T, U, V, W, X
ec nomenclature
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.210 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x53S01
2.60.120.880 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2x53S02
2X53S 2WZPP
chains in the Genus database with same CATH superfamily
1T6YA 2H0VA 1HRV3 4COWA 4QGLA 3AMMA 3H1MA 5FO0A 3K46A 2XOMA 2V09A 2WFPA 3A0NA 3B5LB 2ZX3A 4OI2A 3PTYA 4G5GA 1W9TA 4C0HA 4LIUA 1LOGA 4X0CA 5FJKA 1VRH3 2BEOA 2XQRA 4MYEA 1QGZA 2VM9A 3ONUA 1W8FA 2D43A 1QFYA 2YC2A 3L2HA 2WNEA 3FHAA 4WWVA 4YW4A 3E20A 4AF7A 2GDFA 3URFA 1DYPA 4AFDA 3BTXA 1BK0A 3RDIA 1HXS2 1HQWA 3VN4A 5IAVA 1ZBA1 2P17A 1PMJX 2B9UA 2JDHA 4FT8A 4J25A 3OAAA 2AGSA 4AF9A 2W0XA 3U0ZA 1GUIA 4XDOA 4BQ4A 4FP3A 3W2EA 5FBZA 5A6YA 3ASTA 2BU9A 2R073 1YQ5A 2DYCA 1XYOA 2HLEA 4KGGA 2NM1A 2AH2A 1E63A 4IEUA 4AEDB 1OPMA 2ZGUA 2B7BA 5EYXA 3SXWA 5A80A 2QQVA 4QX8A 4GB31 4QV2A 3S7IA 4RD6A 3GYDA 4CPBA 3AFGA 1E5RA 3ALQA 4DB5A 1RUH2 3J7HA 2B46X 4N9HA 2KXLA 3S57A 3KCCA 4C1XA 3T2PA 5FYBA 4LC0A 4RQPC 3J8F2 3WNNA 1HRV2 3LIHA 2EA7A 4P00B 1ELOA 1PVC3 5FYHA 2IFRA 3VBRA 3B3QE 1M90D 4QX7A 1REEA 1JYTA 4JGZA 1S2EA 4IXLA 4ACAA 4XFGA 3VGIA 2QFEA 1Q56A 1JI6A 1Y7BA 2XONA 2BN4A 5FP7A 1DLLA 2QZ2A 1ZRIA 4BU2A 3O1PA 5JOZA 4TLFA 5C5TA 1QQP2 2JG8B 2DFCA 3OGJA 2BYVE 1XE0A 4AHZA 2F4PA 1VQPB 5IK2A 1POV3 5B2GB 1LKNA 2PHWA 1WW4A 2IVJA 2I1LA 1QG0A 2VOXA 2ZHNA 2D3LA 4TXWA 1CQXA 1GVHA 1EPWA 1OXCA 2ZKNA 4CDUA 5GZCA 4YRDA 3WZ1A 4SBVA 2VZVA 2XG3A 2YBPA 2DBIA 4CDQB 3I56B 3WNOA 4CDWB 3OUHA 3ZXDA 4LBKA 1BQPA 3RG0A 1OVSA 1QJU2 4CCJA 4R71A 1PM7A 3WG1A 4CZSA 1BEV3 2VUAA 4OUEA 4QHZA 5FZHA 3BODA 5I0RA 2XPJA 2DTYA 5FO9B 1WUVA 2GP5A 5LMZA 4YLZA 3VKMA 1WW7A 1JXNA 2GJPA 2Y6KA 4H55A 1L7RA 3HNYM 4CA9A 1OMIA 4RR3B 3L2YA 4BMEA 1VPHA 5GV8A 1H0BA 1K3IA 2B8MA 2VZTA 4Q0VA 4ASKA 2M5SA 1GAWA 4D69A 4LKSA 5JXIA 1WKYA 1QVFB 3E5UA 1MVQA 1WU8A 5C5UA 3W5MA 1FX0A 1RHI1 2JKBA 4UFHA 3IWZA 1ZX5A 1XBFA 2P3IA 2VTFA 5B4XA 2CBXA 5A8AA 4N43A 4Z07A 5FBJA 1RJ7A 1HB3A 1YQ8A 3OBAA 4XQ4A 2QTZA 4I3GA 4QPIA 4ARYA 2SBAA 3LQEA 4XURA 2VXRA 3J9SA 5A7WB 4NN0A 3CQOA 1UKGA 4PT6A 3H8XA 1RMU2 3IDAA 3JCIA 1UW8A 5JSRA 4D7YA 4Z4ZA 2PQQA 2Z79A 4UW4A 5LEKA 2WZEA 4NHLA 5GZDA 1OFSA 2DCYA 4XL9A 1FOD2 1UD3A 5BSYA 5BNPB 5EPAA 4TTGA 1AL21 2D5FA 2W6JA 1VAVA 4E4HA 4XFCA 2PMDA 3WNDA 3LEMA 1PNGA 2QQIA 4QQPA 5FJHA 3NNGA 2RMU3 4Q4W1 4ZKTB 4NBSA 1VBB3 4FPJA 4RL7A 2VU9A 5IK8A 5FP9A 4RLZA 1JA1A 2CL2A 5SV5A 5AC93 3VO1A 4D6SA 1BMFA 4IEPA 4HZFA 4ACBA 1POV1 2YB7A 4MGSA 5IVFA 1MS0A 3H50A 5FPBA 1XC6A 3WW1A 4YW5A 3T30A 1O7FA 4L92A 3AVSA 5GZFA 2E7QA 3QFSA 1SBEA 3VBUB 5IT6A 1JZ4A 1ND3C 5FA6A 1W8HA 5FY1A 1UD2A 3NAPA 1KK2A 2XLGA 4IV1C 2QTWB 5FR3A 2X0KA 2QE3A 5LY1A 2W1WA 4MH0E 2Z69A 3CXCB 2WFF2 3E5XA 1TQ5A 1W0KA 4IERA 2OYZA 5K9YA 3BUCA 1DGLA 5DMYA 2VCAA 2WO3A 4DNTB 4Y4YA 4CDXB 1W3XA 4N43B 1KZLA 1SMVA 3NV1A 3RZZA 2WINB 3PVBB 3ZDVA 4BOWA 1N8RD 1XRUA 4IETA 2HBUA 5I8TA 1QXRA 2A7AA 1C4RA 5E6HA 2D6OX 2RDSA 3H42B 1WCSA 1B35B 4JQRA 4M00A 5A1LA 2XBO1 1T5EA 5A3LA 2DFBA 4JGZC 4CYDA 1I8DA 1RVF1 4FPCA 4HSLA 1VQNB 1QQP1 1YHFA 1FAYA 1Q8SA 3FC0A 4ZZ5A 3HQUA 3BTYA 3JQPA 5FYTA 1DF0A 3I97A 2ZL5A 3GF6A 3F2ZA 4Q4X1 5FYUA 2ZBVA 4HIZA 1IQDC 5JBQA 4QX1A 4IDZA 5A7WA 3WX5A 4CUGA 2FDFA 1O4ZA 1VB2A 3K77A 4WM7B 1UL9A 2DCZA 3HT1A 1RUI3 5CYYA 1UIJA 4I0WB 1J59A 1R1A2 1ZZCA 3LEKA 4M01A 1URXA 4OOXA 4RPBA 3BVCA 1LGCA 4FFFA 3AYEA 1HRV1 1AR63 1Q8OA 1LENA 3ZO0B 2NV4A 1AR81 2ZZJA 3ITQA 1I7PA 1LJ7A 3OYWA 5F6LB 2GNBA 1I3HA 3CC4B 2RJLA 4LQRA 1FNDA 2V7WA 4KBBA 5DDJ1 1JHNA 5FZDA 1QDOA 4YVSB 1LHWA 3HQRA 1UD4A 1BEV1 1UNBA 2JD4A 4BIFA 1V6MA 4XMIA 3PUAA 4P12A 2V4VA 2J1VA 4AI1A 1QU0A 1VQ4B 1QWRA 4CCNA 2D6LX 4EWAA 3OBTA 1V5VA 1AX2A 3A21A 3BQJA 3OEBA 3O5SA 1NCRA 2OQ7A 5LRSA 4Y4RA 3HOBA 1OURA 3OPZA 1VBC3 2EFGA 2QUOA 5DN2A 4PF1A 4HFSA 3NAPB 1RMU3 3ILNA 3LVBA 3KS7A 1WDTA 2GJRA 4XF4A 3I2OA 3CESA 3PUNA 2YXSA 3KGZA 3MZHA 5AN9A 1BLIA 2XLFA 2VG9A 5FPVA 5TRDA 3F95A 5AVPA 2CGOA 2XMLA 4LUKA 4ZZ8A 4LHLA 1VHOA 1B35A 1NAEA 1VJ2A 2EICA 2F4LA 2DERA 1GQHA 2GMPA 3BCWA 1C3HA 4RCZA 3AVWA 1SQ4A 4KNCA 5DDJ3 1W06A 5FO1A 1PIV3 1S2KA 4JV4A 4HPKB 3VBHC 5C71A 2FD8A 1F8VA 4CEWC 5H9QA 4QPYA 2VCBA 4LBJA 2Y34A 4MLOA 3AYAA 2MPFA 1AXZA 3OW7A 4X7DA 4YFWA 3Q6QA 2JG9C 2C4TA 1C57A 1DYKA 3BY2A 5CU1A 3AKTA 4XJUA 3VDCA 1RXGA 5SV8A 4UFLA 1WW5A 1PZ7A 1RUC1 3KL9A 3GZUC 5J7MA 4XACA 3OBZA 2HBTA 1HRI2 2QNKA 3R0RA 1S0BA 3MCAA 2ARAA 3B94A 4RM0A 3JD73 3O1TA 1GANA 2MEV2 4Q0QA 3T1LA 3OZVA 2NN8A 1ZM3A 3WG2A 5A32B 1CAVA 4CDXC 3WW4A 1W8NA 1GWMA 1YITB 1GZTA 5EQUA 5FYCA 5CIRA 3MPPG 4QX5A 5EYYA 2ZL7A 3RYPA 1VQKB 1AYM2 3VKNA 5FZ7A 4AI3A 3VZNA 3MV01 4M4SA 4PABA 3N3HA 3CW2A 2UY9A 1XU1A 2AACA 4GJZA 4LBVA 5FQ0B 2VZOA 5I8SA 2ZZGA 4A45A 2W87A 1DGWA 1FPN1 2MHFA 2UWAA 3OEAA 1IQAA 2VNRA 1ZM4A 2R9VA 3I3BA 4K20A 1XNCA 4PIZA 4MXWB 1RHI2 4XIKA 2VMGA 1AR72 2O8OA 2Y6LA 5FAXA 1CIWA 1DZQA 2XVGA 2QQLA 4PIYA 4RS5C 2GC2A 2WKKA 2G19A 1EP2B 4EROA 1R081 4IEQA 4FVVA 4XLCA 2LRPA 4FXKB 4NMIA 5FIUA 2QQNA 3AXDA 4DUVA 4B3XA 5BNPC 4W8JA 4OI1A 4AVVA 4HSJA 1TME3 1UD6A 3ILRA 3NSTA 4OVEA 5F39A 4Q8KA 3ACIA 3ACFA 5J3OA 5FY8A 4DRRA 2F6BA 1WW6A 1LESA 3VDDC 4XLFA 4IV1B 4LBNA 3ZM8A 3TEYA 1MRZA 2ID4A 2BGCA 2XBO2 2XHKA 3PTRB 1SLCA 2R063 2JDUA 1N3OA 3NW4A 1RUG1 1M4WA 2Z42A 2LALA 1IB0A 4HANA 4IEVA 2D44A 3SKVA 2CSGA 1TMF3 3P1IA 3QH7A 4KH9A 1DARA 2OTJB 2ERFA 5BUVA 5BY5A 4II3A 3W5NA 2WS91 4LO8A 1RXFA 3A4UA 4GWMA 4RFRB 5DN6A 4H7LA 2JECA 1S55A 4KKSA 1Q3EA 2W94A 3IBMA 3WW3A 5K0UB 5APAA 4HXCA 2OK8A 5BV6A 2EAKA 1E3ZA 2H6CA 1ZBE3 4HK8A 3T0AA 1SCRA 1ZBA3 5D2AA 3W9AA 5B4NA 1LEMA 5C4WC 1QH6A 1QJY2 5C3QA 4EYUA 4UZEA 4B44A 2Y60A 3THPA 1LAJA 2VNHA 1UD5A 3OZUA 1IKQA 4AGGA 1QGLA 2BUKA 3RSJA 1E5SA 2EAAA 4GD4A 4CDQC 2ZTNA 2CV6A 1D2EA 3AP6A 3NO8A 4IE6A 3U1XA 1H8HA 5FPLA 3N9PA 1O3RA 3GALA 1UYYA 4Y33A 3VDAA 1LGBA 5IWFA 2BV3A 4CCOA 3SISA 2YWFA 1UKRA 2ILMA 1PIV1 4QM8A 4Y1ZA 1MS5A 4LEJA 4N53B 4UFIA 3KGLA 4ASLA 4XDPA 4P6YA 4GA9A 2BWCA 3LIGA 4NR1A 2R7EB 5KHGA 4CU9A 5JAXA 5CG8A 3ZKUA 3N9QA 1G9AA 4TLGA 2WSVA 5T55A 5BNNA 2D3SA 1U5YA 1WGPA 1A8MA 2CYFA 3KF5A 3J7MA 1PK6A 2NPFA 3OPTA 2B7YA 3RY8A 1JYWA 2HWF2 4DQAA 2JIJA 2XJQA 5EP9A 4AI9A 1UU5A 1VHEA 4B47A 2VOKA 2WO2A 2ZGTA 3EJKA 3MIBA 2OK7A 2VZRA 3ETPA 4ISRA 4Q4Y3 3OKXA 1R091 4A6OA 5KW9A 2N7GA 4K1YA 2A71A 4IEWA 4OUSA 4Q5OA 1NXD1 2EIDA 2BVNA 2GSYA 1ZRFA 2B42B 4Z92B 4XR6A 3PUQA 4JHZA 2JDIA 4RHV2 4XBQA 2FDIA 4E0FA 4M4PA 2ZZFA 2NYYA 5C8CA 1F31A 2ZS6B 1JOBA 4RR3A 5FZLA 3W2GA 2ORXA 1WBLA 3I3EA 1WCKA 3KHBA 5CFDA 1ODMA 3HVDA 3U37A 1UPSA 3MV11 5C9AB 4XMAA 3WG4A 2GPJA 3W5VA 4OLLA 1U5ZA 4P9GA 4XHBA 5C9AA 1P8JA 1OUXA 3OD4A 4WBBA 2BRTA 5KC6A 4LBZA 4Z1MA 4DXRA 3WDYA 1ULPA 3Q3AA 3VL9A 1VMHA 1W6PB 2AR6A 3PL0A 5EJZB 4CDUC 4AQSA 1Z7S1 3OJBA 4XOGA 3ZN5A 5GV7A 1EPZA 1U5XA 4WQMA 3MLKA 3CZJA 4CPBD 1SLBA 3CCQB 2JWPA 1M1KD 2DY1A 1JU4A 1NT0A 3T2TA 4WVMB 4AFAA 4Q2FA 4UT5A 1CAXA 3VD7A 1W8UA 1NA1C 4PDWA 3U75A 2ET1A 2ZBJA 2R041 1FNBA 1LOFA 4PBPA 5JI9A 4MOAA 1TMF2 2E6VA 3V64A 1KC8D 4AFMA 1V6OA 4NE9A 4NHYA 4UW3A 3PMSA 5FOJB 1UZWA 5FLIA 3DCQA 1JZ2A 1E64A 1EUTA 1N1SA 3GHNA 4QKFA 3VHOA 4QKDA 5FIXA 4AQ6A 4YM0A 4WZKA 1HQNA 2PE3A 3T53B 1E5HA 3DPRB 4GALA 1N1VA 2DWRA 5F5AA 3JBG1 4B8EA 3H8RA 2VZQA 4YG6A 1HN1A 1XNBA 4FK8A 3O1UA 2ETEA 2GK6A 4GQNA 1Z7S3 2Q1FA 2IXCA 5A32A 4Z2AA 4F7ZA 4RYDA 2VGDA 4YVSA 1QXJA 4JC1A 4JTNA 5K0UA 5JUVA 3VL8A 3ZFEA 1ULOA 2ZGNA 1BJKA 4YELA 3I4IA 1IJEA 3ST7A 2QDRA 4P5HA 4X05A 3GQBA 3K3OA 3POIA 4Q26A 4BH9A 4ZY9A 2WNOA 3LNNA 2HYKA 1QJEA 5LBEA 4E2GA 1E5IA 2C5DA 5D8AA 2Q1MA 2VCMA 3SJZA 1RUJ2 1SACA 1VAKA 4P9YA 3UGGA 5FMCA 5KHJA 4NIGA 1CZSA 3I3DA 4QX2A 4NROA 2AUYA 3B8HA 3HT2A 5E88A 4GWNA 4LHKA 1F5JA 3VDDB 4ITCA 2R062 1AXYA 4QDSA 1DIWA 1JOPA 2JX9A 2WUHA 4KQ7A 1S4MA 1DFQA 2ZX2A 1O59A 4RD1A 4XLHA 3PHMA 3PUIA 3AGPA 1RUJ1 3Q8EA 3S6PA 1W9XA 1HQLA 1W05A 3VBRB 4IGOA 3B69A 1TNRA 4G7WA 3V76A 5A7OA 3V56A 4BM8A 5HCAA 4QB1A 1IJFA 1C8M3 2B39A 1POV0 4Q4Y2 1QNYA 1LHNA 1S0DA 3OF1A 1HB2A 3RNSA 1LTEA 5BNPA 4OQ8A 3THTA 2VL4A 3GZAA 4D6QA 5LBFA 2YC4A 3VD5A 1MEC2 1W8WA 3M7AA 5T5JA 2ZHLA 2YDEA 5J96B 3VD4A 1ZBA2 1Q8QA 4IEOA 2WJVA 1RUD2 2YFZA 1K5MB 4IV1A 4GH4A 4NAOA 2QKDA 4A3ZA 1UMIA 4DY3A 4DNRB 3G6JB 1Q81D 2D6KA 2D97A 2W1QA 2PN5A 1RUE3 2GU9A 2YBKA 3D0SA 4HT1T 5FZFA 3T1MA 2YU1A 5FKCA 4CUAA 1BX0A 4CXXA 5L7OB 1NB9A 3N35A 1VMFA 1A8PA 2DYIA 3QLQA 1J1TA 4B43A 1K12A 2A6YA 2VMHA 3USSA 3TBDA 3HNMA 4FAHA 1JBCA 3MI8A 3ENRA 4QQOA 2VNOA 3AP7A 1YQ6A 1D4M1 2XGXA 3J8F1 1E1QA 2Q6KA 1ULGA 1F15A 5C8CC 2PHRA 3D82A 1QJX3 3OGSA 3DL3A 3ES9A 2BZDA 4D8MA 2GMEA 5ISLA 1WOOA 2DVDA 2HWB1 2WZNA 4BISA 4CDXA 2WN3A 3BIWE 5DAPA 1YEWA 4DPNA 2B5OA 4HE5A 1CPMA 5J3UA 4ZGQB 3OEEA 4NPMA 2JN9A 4PAAA 4BLJA 5FY5A 2WQ4A 3WUDA 4M0NA 4QT6A 4XAEA 1FMD3 1TVGA 5FZMA 4JRAA 3WF1A 1UO9A 1VBB1 4YPJA 1JN2P 4GAZA 3CHXA 3WQBA 1G9BA 2YPJA 3N9OA 2DOGA 5FDBA 4PI0A 2VCCA 4JGYA 2DURA 3WF3A 1CAXB 2P6HA 2Q6LA 2XUMA 4YVWB 1H6YA 1TNFA 1HB1A 1HZEA 2W91A 2V7TA 3JBG3 2BMWA 2GNMA 3OJXA 3FLRA 2RC5A 4KU7A 5LCWL 4KKTA 1FI2A 3RMXA 4H3WA 3U6BA 1AR91 1UY4A 2WIIB 3M3EA 3USUA 2CK3A 4O7XA 5J35A 1T6ZA 3MF6A 5K7PA 1UMKA 1W6MA 3IB3A 3GVJA 4L97A 3POWA 2RM22 1AJOA 4XCBA 1MR5A 1D2SA 1GICA 2ZX1A 5IK4A 2IUWA 3LKJA 1HKDA 1R64A 1MACA 2BJSA 1ULFA 2GC3A 2RR12 3G7DA 4XYXA 2WYRA 2UY8A 5DUVA 2AHOA 1AX1A 3I59B 2YU2A 4JVAA 3VBUA 1AL22 5HV0A 1ZM1A 3OW2B 1AUYA 4LO7A 4S2GA 1Y4WA 4XE9A 1VF7A 2WWJA 1KD1D 4X7EA 4XF9A 3WCRA 3ZFEB 4HVRA 1XB2A 4Z4TA 3ZXGA 4E4SA 5L36A 5LA1A 3J7NA 1I6XA 1QUFA 3OSDA 4ZXKA 2PHXA 4P9IA 3TAYA 3W58A 3ZFFC 1RUE1 3FJOA 2R072 1QQP3 2R30A 2W46A 4DK0A 1VBA1 2G4IA 5FZAA 5FZKA 5FZEA 1LODA 4HBNA 3W2FA 1V6NA 3CCRB 3KV4A 3JBG2 1PX3A 4C0BA 1TZOA 4ASUA 3CMAB 3CCUB 1NCQA 2JG9A 2YC0A 4JKMA 5G05L 4NHKA 2GH2A 4WM7C 4Z4WA 4YW7A 4NNJA 1YLLA 1VB4A 1UMHA 2UU8A 1LOCA 2ZEWA 3JD71 3H7YA 4AL9A 5FMBA 1W39A 2WZR1 4XORA 1DQ1A 2OBRA 1U0AA 2H6BA 1PGW1 3PUMA 1ST8A 2XL7A 1NOVA 1NB0A 2VNVA 1PGSA 3JD72 2CGPA 2VW0A 4Z8BA 1GR1A 5HI0A 5E6TA 4B4PA 1R1A1 3ZC3A 1RUH1 2BNNA 1WSVA 3VV1A 1XB9A 1H2MA 4N90A 3OCPA 1JZ3A 5JR7B 4ZS2A 1BPLA 3ES4A 1IGOA 1K8AD 4QXCA 3SH3A 5FMOS 3A3BA 2ET7A 4Z4SA 4OMDA 4L2NA 5FREA 2WAAA 3SCFA 2V7XA 1KFXL 5FCCA 2CAUA 2ZMNA 3HBZA 4RHV3 4LBOA 3CPWB 1X82A 4UW6A 2XZOA 4NRMA 2EXHA 2VZ3A 2C4UA 3DYMA 3ZXAC 4DXSA 2FDGA 1Q5OA 4LBLA 2V4DA 3K75B 1XE7A 5FRAA 2WNUA 4CP1A 4XLAA 2JDPA 3WCSA 4AVTA 1YC61 5JSPA 2XZPA 1WD4A 2OTLB 1NLSA 3WHUA 1CAUB 4QHBA 3SH4A 5BNQA 4Q7JB 1KS4A 1PVC2 3O14A 5F5CA 4AOCA 2JIGA 1AIPA 2C6SA 4QKNA 1H8VA 2ZXHA 1ODNA 2E51A 4MUVA 3QFTA 1ZBE2 3EB7A 1IPKA 3IT8A 1VE0A 3PVEA 2E9QA 4JKKA 4QPGB 2C9KA 5F3IA 5IAXA 4XJZA 1CAWA 4S2DA 1H8TC 1S0IA 4FWTA 2E53A 2VQUA 3NWKA 3PIGA 4MX3A 3VLBB 3AKQA 3ZYHA 5DPNA 4EN8B 5FPUA 3JXSA 3AP9A 4KI5M 4NIAA 1YJKA 4YM2A 3WF0A 5HCFA 4C90A 3AP4A 3IMNA 3I2IA 3KWVA 3JQQA 1JYVA 5LK5A 2A1XA 2WS93 5A1AA 3K3NA 3GVLA 4XUNA 1OVPA 3LSDA 4N53A 5FO7B 5FZBA 1IHMA 2HEVF 2Q8DA 2HDNB 4JGZB 1LRHA 3LPFA 2WSUA 3ZUGA 2J1RA 3J7LA 3VKFC 3BU0A 3FZ3A 2VW2A 4P2NA 1W6MB 1V9U3 4DMIA 4X7CA 1VLNA 4NCNA 2B7CA 4JKLA 4BJ0A 5CISA 3ON7A 4URAA 3PVDA 2TUNA 2XWBB 3I55B 1MS4A 2DVBA 1B2RA 2HWD1 2RE9A 4K1XA 4JZRA 1HRI3 3G71B 3UV9A 3MIEA 3W2IA 1W8TA 5JLVA 2Q6IA 3CDZB 2JXAA 3WEZA 3ZXEA 4GMP0 1WTHD 3BTZA 1XNDA 4A7KA 1K28D 3CB4A 2HWF1 3VB9A 1W6QA 5ABJA 1CVNA 1E3XA 4QDRA 1B09A 4Y1VA 3ZSJA 2WSSA 4Z4VA 2XR4A 3GXUA 1R092 4V2VA 1JZ6A 3RWKX 3BALA 4B4RA 1DZRA 1POQA 4DZGA 5FYIA 2V31A 4QVAA 3PENA 1CAVB 1QOOA 1UZVA 4LKFA 3R4UA 5F2SA 3ZR5A 2WABA 1XYPA 3MUZ1 1W2AX 5GJ6A 4W65A 4AAXA 4DEQA 3M8LA 4J0QA 1LHOA 5HXBA 2WFF3 5F32A 5FYMA 4X8IA 2CTVA 5E8AA 3G4SB 3DN7A 4ASMB 1FDRA 4TT3A 3K2OA 1AYM1 3J8F3 4FFGA 2VH9A 2JIZA 3FN9A 4LORA 1O8PA 4MVTA 3CCMB 1WMEA 2RR13 2BFUL 3D5OA 2IVIB 4GKXA 2DEUA 4LKEA 1XQNA 3ZYRA 4JCKA 3WNPA 3BPZA 2YY1A 5G04L 5GLWA 3KEWA 1PNFA 2VTXA 4HPKA 3ZPYA 1IG0A 3C8XA 4CCMA 1Q86D 2ZHKA 2VE1A 2P3JA 3NKTA 4BZ4A 3GVKA 2X3UA 1FRNA 3A23A 3U78A 3WP3A 4Q4V2 4CU7A 1VJSA 3Q38A 4ZS3A 3KV6A 4QQ2A 3FX3A 3LFMA 1NA1B 1EFCA 3RVHA 5JZGA 4AEMA 1W2NA 2RM21 2R1DA 4JDMA 4QX0A 1RUOA 4PI2A 3CIHA 1I5ZA 1R082 1J3QA 2E7AA 3H1YA 3SQOA 4A7YA 4CDQA 5JMOA 1ALYA 1JMUB 3ZFFA 3H3ZA 4X06A 4A42A 3B02A 2HWE2 1YQCA 2LROA 3ZZUA 4FP2A 3WVJA 1O3QA 3JUUA 2R043 5FZ3A 4Y3OA 2G1MA 2EALA 2WZR2 4RD0A 4FPEA 2O14A 5KXDA 4CE8A 1EFUA 3LEIA 1EAH1 4Q4Y1 2WT0A 5CKQA 3ZYGA 4ES9A 1PJ5A 4LO5B 2HWE1 1NLQA 1MS9A 1SPPB 1COWA 5FZ9A 5CFDB 4AR2A 3VBSC 3AMPA 4YW2A 4AGVA 2ZZEA 4FAGA 1KGYA 1HN0A 4G1BA 1IG3A 1NZIA 4GKYA 3VBFB 4YGDA 4CUBA 1G7SA 4TWTA 4MXWA 3I2GA 4ZU5A 4XJ8A 5L73A 1UZ0A 1G7TA 4LBYA 3THCA 1WD3A 1AYN3 1UD8A 3RI9A 1CNEA 4HKOA 4UXAA 4E2QA 2CDOA 4XUOA 3DV8A 2VMIA 4TSVA 4XN3A 1TG7A 3SITA 5HV4A 5BNOA 1MZ6A 1BEV2 1P4MA 4QD2A 5FZ1A 3ZMNA 4N9IA 3FWEA 3C2UA 3TRSB 1D4VB 3RMYA 4XF3A 4DINB 1COV2 1OF4A 5A6QA 2GNDA 3N9NA 1CR7A 1R1A3 4FCAA 4R4ZA 1HXS1 2PYTA 4CCDA 1QXPA 4OQ9A 3LGRA 3E6CC 5C9AC 4AE2A 5FYSA 4AHYA 4LBQB 1E62A 2OS2A 3WDXA 4LT5A 1FMD1 4ROXA 2F1MA 3I8TA 2DBNA 1ASJ3 3C3VA 3ZX7A 2YG0A 4CSWA 1QUEA 2XXZA 4I0AA 1ZA7A 4QM9A 3ZYIB 4AK3A 2V7VA 3O1SA 3BB6A 3PA2A 2YV8A 3ZLIA 1QKQA 1C8NA 3VBSB 1D0GA 2VXJA 5IVJA 3M3IA 3I59A 1QX4A 1NUKA 3B00A 5F2WA 4G9SB 1FYUA 2RS13 2BERA 2F17A 2JB8A 4AFCA 1VQOB 1YFYA 1DGRA 3WOGA 1S4CA 4C91A 2O0OA 4G4FA 1PVC1 3QFCA 2XJRA 3GZTB 4I2OA 3PJYA 1G7CA 3VBFA 5IVVA 2ZGSA 1UOJA 4CCKA 1LHVA 3IDBB 4MADA 1KJZA 1RYYA 2BGJA 4QVJA 5CBLA 4I02A 1W9FA 1US2A 2QQWA 2Z5WA 4QHOA 2LM3A 1L7QA 1EFRA 1W6NB 3UKNA 2JICA 3VZKA 2AREA 1Z7S2 3V7AA 4AGRA 2HWE3 1EP0A 3ZMOA 3M4FA 1YJNB 4IV3A 3THDA 5DS0A 5FY4A 1W2UA 5FY0A 1W35A 4HN0A 3ZXKA 2HEYF 4AC9A 3WUCA 4WZLA 2NP0A 1LOFC 2ZL6A 1W03A 2BVVA 2Y6HA 3CBNA 1UOBA 3W5HA 4XETA 4YM1A 4QUZA 1MS1A 1VBE3 5CFCB 2YWGA 1Y43B 1NE4A 4PGOA 1OC1A 3ZFGC 3LQ6A 1VBB2 3AMHA 3H0OA 3LDRA 4P14A 3RS6A 1H1IA 4YGCA 3T08A 4AVBA 5JMCA 3W5UA 3MF9A 4AG4A 4NIHA 3OTFA 1EXMA 4TSFA 1V6KA 2WDBA 4HONA 5DUUA 5LBBA 4WVMA 4YYOA 4IE0A 4AI0A 3RZKA 1GP5A 4KGQA 4CXYA 2WT2A 1SG3A 4F83A 2XVKA 1RUG3 1V00A 5GLZA 5KC5A 1TTTA 1IS6A 4GMP3 3G05A 4LBQA 1UPIA 1IKPA 1YRZA 3I54A 4Z82A 3ZFEC 1PO23 4XW3A 4OI0A 4M0LA 1HVXA 4B1MA 1CONA 2NQYA 5FLJA 3WW2A 1BJQA 2Y38A 2VUDA 4DIQA 4XTMA 1J9ZA 1G9CA 1MABA 5E16A 2LS6A 4FXGB 3H3LA 5F4OA 1W9SA 3T09A 4A41A 4CU6A 2YFUA 3V0AB 2Z6BD 1NBMA 3MIHA 2BWAA 5FZ0A 3TN93 4HMZA 2RMU2 3AL6A 3AMNA 2WWUA 3NJZA 3WP6A 1D4M3 3ETQA 2VOWA 2FVGA 2C77A 4DOUA 2JJ6A 2GREA 1WBFA 4GWIA 3SHRA 4JDNA 1UYXA 2AZ5A 3VD3A 4YALA 4CEYC 4AQ2A 3D8CA 5CKNA 2BSAA 2ZEZA 4B3NA 4NWVA 4F3JA 3OP1A 5KBFA 1AYM3 2XL9A 1VBA2 3GIRA 3JB4C 5LA2A 5IVBA 2ZPXA 4BYYA 3O1RA 5A88A 4QXHA 2LUWA 2D6MA 3ISXA 3WINE 2V5DA 4DUWA 3JU4A 2IXHA 3ACLA 4R52A 5M0TA 3HEIA 3N9LA 1BMV2 3AYDA 4LHNA 5FFOC 3SCGA 1N08A 3AZWA 1UCXA 5FP8A 1V9U2 2C5HA 2VNJA 2R042 1XE8A 4DXZA 2E7TA 4LK7A 4FBFA 2PELA 5IHRA 1BCXA 5IYNA 3ZXFA 1XNAA 1LU1A 1VBD1 4QPIB 1PMHX 4OYUA 1PJ6A 4CEWB 2YZ4A 2VOTA 4WVZA 1UY1A 1ZM2A 4CP0A 2P3MA 1D8TA 3QE2A 4N3NA 1WWYA 4QQHA 3SC7X 2QTLA 1GP4A 2A3YA 3MHPA 3HQXA 3QSYA 5K8SA 4XFFA 2HWC1 2BOJA 3P5BA 1AVBA 3DPRA 4HK9A 4A6SA 3RI8A 5CZKA 4CDWA 3MDPA 4BQ5A 1ZUNB 2VBSA 4ZCLA 1JHJA 1CZTA 1H8TA 5DAXA 2Q6OA 2OIIA 1YO8A 4M1KA 1UU6A 1K45A 3GHMA 3NAPC 1VQ8B 1IOAA 1LOEA 1F2NA 3ZFGA 1OT5A 1QJY3 4IEZA 4XQFA 5JVVA 1DDGA 4OZXA 3VBOC 1COV3 1KDMA 1QJX2 1H85A 1Y9GA 1HW5A 1YNAA 2BVBA 4FPLA 3UKTA 3OOXA 1D7PM 2R6QA 2RVAA 4I09A 3VR6A 5DG2A 4AEJA 5FQ0A 1UXZA 2D9RA 4YM3A 2ZAHA 4WVWA 2WNUC 1OHHA 4FPKA 1W6NA 5FXZA 3VZLA 1T6XA 3WY6A 5IATA 1IPJA 1N07A 1VBC1 1NYWA 4Y9UA 2GJKA 5FZGA 3SNMA 2I2SA 4UZUA 3ZYPA 3H9NA 3MBWA 3AKPA 4E8DA 1MS3A 5DZFA 2BPA2 1SFNA 2D6PA 4LR4A 1OA2A 1EV12 1A8DA 1WOSA 4W6WA 5DG1A 1UZYA 2VZLA 5EZWA 2QVSB 4P02B 2A70A 2LZJA 3WV6A 2FCTA 3ZVXA 3W2HA 2OZJA 4AZZA 3M3OA 2PLFA 1UD1A 3DXTA 5FUIA 1AR92 4ZV4A 4FPGA 1N05A 4XM3A 3UJQA 3WF2A 4K6BA 4PDWC 4XF1A 2JDNA 1I5PA 3SJPA 3I2JA 4IESA 3U10A 1H9PA 3PA1A 4ZCIA 5E89A 3P27A 1W6OB 2XGJA 2GH8A 3ZXLA 4RPDA 1TME2 3EO6A 3VHRA 5T5LA 3WBKA 4WVVA 1VIWB 2E33A 1CX4A 2P4EA 1YX2A 4XC9A 3RWNA 5J1XA 2ZMLA 2VQAA 4XBNA 1KTVA 1C5IA 2WJYA 2BGPA 2B9VA 2HLDA 2KA3A 2VVDA 3I2HA 5I93A 4EZ4A 4CQJA 2ARCA 3FLTA 2X6XA 4XJWA 1R5NA 2P3YA 4XN0A 5FP3A 4CXWA 3A7QA 4MGZE 1R5OA 5L7OA 1E57A 1FNCA 3Q6RA 3Q8CA 1CPNA 4XAAA 3GZEA 3MW3A 1BXHA 3CMGA 1CD3G 1ASJ1 3IMMA 5HCBA 5FWEA 1QH0A 1OSGA 2VUCA 5GALA 4FTBA 1W90A 4M53A 4XFAA 3QCWA 1O5UA 5T54A 2YPDA 5J09A 5EMNA 1T6GC 2Q8CA 2D74A 2E1RA 4EQVA 4BHPA 3LB9A 1OB2A 3RYRA 2FDHA 3CMMA 5FYVA 1ND3B 1TMF1 1ASJ2 4ONUA 3CLPA 1S0GA 1XSQA 4Q29A 4BE3A 1GNZA 1AJKA 4EZHA 3POYA 5EFUA 1D0HA 2WA3A 1UOGA 1Z0HA 2WA4A 2XNDA 4R9AA 3W59A 4EV0A 3ABZA 3P6BA 2QMUA 2D3PA 1WCQA 2ATFA 2OZ6A 3WY9A 2QQMA 1WPCA 3D6EA 3MIDA 1STMA 5F7UA 3LOIA 3N7JA 3OPOA 1W9YA 1XFOA 1QF3A 3QACA 5IFTA 2C24A 4B3GA 5CB7A 5A1FA 4XOPA 4YVWA 3CD6B 4NJ4A 1M06G 1S0EA 2IWGB 1WMDA 4COVA 1WLDA 1VP6A 1S1AA 1G9FA 4AHXA 4XKVA 1PJ7A 1QOTA 2CDPA 1OBNA 4G6IA 1MQTA 3HN3A 3OUJA 5L19A 4KBZA 2OX0A 2QQUA 4YZ5A 3WF4A 3D4KA 1GQPA 3J4UH 4XABA 3AL5A 3KSCA 5KHHA 1JYIA 2GC1A 1PGW2 3O7OA 3V0BB 4GH4B 3QD6A 3LQCA 3VBSA 1NKGA 1AL23 4XFBA 3T3YA 3U4XA 3KD4A 5I0UA 1QMJA 1V6IA 2R061 1WCUA 4XZPA 1H42A 4FOWA 5EV7A 2TEPA 4CRQA 3DKWA 3MIFA 1X36A 1B23P 3ZSKA 3ZYBA 3AVYA 2PLV1 4FXUA 2D6NA 3BTAA 1A78A 3WQ1A 2WYFA 4DQLA 4UW5A 5A7PA 4HOOA 4AHWA 5AC91 3KT4A 4B29A 1DHKB 2FHRA 1OOPA 3ASPA 3ZIWA 1NCRB 4G1VA 3BCDA 1ACCA 2VZSA 4BQ1A 1NQJA 2GK7A 2UYBA 3PURA 1AR71 3GDBA 1AYN1 1QJX1 4HG6B 4AQTA 4Q8LA 5FMOL 2P34A 1S2BA 2ZX4A 5H9SA 4UAPA 3OY8B 2Q8OA 1A6CA 2WS92 2X5IC 3BGAA 3UK9A 5IVCA 1GZWB 5DAVA 4BQXA 3CCLB 4LE4A 5AVAA 1XNKA 2R32A 1YFXA 2NPIA 1NE6A 2X09A 1H30A 3JB8A 4YAOA 1U12A 1GJRA 4XXAA 2DCTA 2V5YA 1BKZA 2OKXA 5LWBA 1EV11 4I3PA 1J58A 5LATA 4BK5A 4OCTA 4R9BA 4O9GA 1GR3A 5FYZA 4QXBA 4DY5A 5ERLA 2DDUA 5IYWA 1OH4A 1KRHA 3VNVA 2HWF3 2JDAA 1PGL1 4IW3A 3C7EA 2JEMA 1PMIA 4XJAA 2X6YA 4OOSA 1PM4A 3OJWA 1VBD2 4JGYB 4JRLA 1BBT2 4KWJA 4O9EA 4RFT0 3WQ0A 4MO3M 1E1RA 2WO7A 1RUG2 1W6OA 1HV0A 5FPAA 4BMBA 2J7MA 4M2LA 4P9JA 4EWDA 5IYPA 3HMYA 5H9PA 4H9GA 4YW3A 3VKLA 1UAIA 1JZ8A 2RM23 2I07B 3DECA 1MPXA 3KT7A 3JQRA 1WMFA 3GJAA 1H2NA 4MGQA 5JDBA 2C4XA 2RS33 1EWYA 1ZZ7A 4LA2A 2E31A 1RL3A 2ENRA 1VAMA 2R16A 1H4HA 2VD7A 4EN6B 5LASA 1XE1A 4Q4V3 1DG1G 3E97A 3FFZA 1OGJA 3Q9OA 5H59A 1VQMB 1UYZA 2DVAA 2EXIA 5D8AC 1TUIA 1N0VC 3POFA 4RDLA 2YGLA 3TOJA 5I8YA 1AR62 4XFHA 1QJY1 3J26N 4Z4UA 3MUY1 4FSJA 1AL0G 1GU3A 1KJLA 1N47A 2F43A 1SPPA 2PMWB 3MICA 2W95A 2WR8A 3ASSA 5A6ZA 4ES8A 3V0AA 1R5BA 4TYSA 2XUEA 1OHFA 4GH4C 3UESA 3VBOA 3T0DA 5LA0A 1RUC2 1C5HA 1H2KA 1OGIA 1HDKA 1PO21 1UX7A 4ZXEA 1WMXA 4AEDC 2VZUA 3AMQA 1RJ8A 2XDVA 4YZ4A 5I0TA 1GZWA 4DS0A 5TR9A 4YZ1A 4LMFA 2MEV1 4DXTA 4ZGNB 4YSFA 2YBSA 4JMQA 1KFUL 3RZJA 1OKOA 4IE4A 1JU3A 2C1FA 2GAUA 3C7GA 3FFQA 1K73D 1BZWA 2Y26A 4IGPA 3CC2B 2PTMA 4PC6A 1JW6A 1UY3A 4MXVA 2G9GA 3O0XA 3OGGA 2E26A 3CF6E 3LA2A 5FUPA 2ZGRA 3ASQA 4P9WA 4SLIA 3VHNA 3VZJA 3B82A 3AK0A 1U2RA 1NA1A 5A3OA 1QH7A 5JPMB 1Y9MA 4PLMA 3MW2A 3WT3A 3LZZA 4WZEA 3J81k 1RUE2 2R071 2D98A 3FLPA 3UYJA 4F7DA 5DABA 4FOYA 1ZREA 4FI9A 5ACA3 1NQDA 4LO6B 2VTXJ 4OPOA 3FBMA 2WZR3 3O12A 5EJ1B 1HX6A 5GKAC 5I0DA 1DQ0A 1GNYA 2OPWA 4PDWB 1RUD3 4XCAA 3CJIC 4R8HA 3X29B 2HMAA 1AR83 3EHKA 4XUQA 3WLUA 4R4XA 4E4ZA 3AKSA 3SH5A 4XNFA 3POEA 3B9IA 3RJRA 4RD3A 2MEV3 5BNNB 4PF5A 3BU7A 1FNYA 5KHKA 4TMVA 4QWNA 2R0FA 4QB2A 4PLNA 3T51B 5AC92 3DF0A 1MZEA 2DCUA 4PLOA 3U2QA 4D3WA 2P1BA 2QZ3A 5EXOA 2RS11 1A3KA 1ULCA 4COZA 5JWPA 3ZZ0A 3DEMA 1NLRA 1T6BX 2EIEA 1PO11 4HE6A 3ZN4A 3KMHA 2Y6JA 4DQKA 1WLCA 3ZYFA 1PKVA 4GJYA 1G9DA 4EN0A 3PUSA 1VQ9B 1PZ9A 3BPSA 2BP6A 4LUMA 3AGQA 2JG9B 3ZFGB 1ENRA 1OA4A 3AVVA 1V0AA 1XJAA 1UY0A 2L9LA 2J7KA 4RD4A 2CRVA 2RV9A 3APBA 1BQEA 3NJYA 1QJU3 3ONYA 2G9FA 2FZ1A 2Y0OA 4OI4A 4PJYA 4MGTA 1REFA 3UJOA 3D3AA 5EHDA 3DDYA 2CWSA 5JIAA 4BPZA 2UURA 2IXKA 4K7JA 1IS5A 2QCSB 2CWMA 3CMEB 1BVVA 3BOWA 1VQLB 4OPSA 1W9WA 1UX6A 3CKHA 2C9AA 4XHXA 5H9RA 2Y0IA 5T5PA 4N53C 2WC2A 1MEC1 3PNAA 1BK1A 2DTWA 4CVUA 2DVGA 1JYXA 2CAVA 3JQXA 3C7FA 5FOBB 4P22A 4AW7A 1GAQA 2VMEA 3FHQA 1CIYA 1Q7YD 2KR2A 2CW5A 5FPZA 1W0OA 1LOBA 4Q4X3 4A3XA 1PK6B 3KLSA 5JOWA 1RVF2 2KVOA 4FFIA 1MQTB 1D1NA 5T3NA 5FXVA 3W21A 1E43A 1CN1A 2IXIA 1Q9SA 1Y0RA 2QQKA 5GM0A 1NZCA 3ATGA 3NJVA 1NXMA 1NY72 1S0CA 3GCXA 1ND2B 2D93A 1XYNA 2WJSA 4DFSA 3VDBA 4X6RB 3UKVA 3I3MA 3BCFA 1A34A 1F4AA 1N06A 1Q43A 4YVSC 5ACA1 1OD5A 2DUPA 2FMDA 1H1MA 4IEYA 4Q1RA 3ZFFB 1RUD1 2JDKA 3LO8A 2SLIA 3R6SA 4L9BA 4P3IA 2A6XA 5IUQA 5K0UC 3GM8A 3BIEA 5LY2A 5FZCA 3OB8A 4BIOA 4BB3A 1AZDA 3LA3A 4QMAA 2RDNA 3M2MA 2BV4A 1ND3A 1CGPA 3E6BA 1HA3A 2ZAAA 4CEYB 3IPVA 1VBA3 2CY6A 4P5YA 3WDUA 3OZWA 3R6KA 2V7UA 3A8KA 2XHNA 2ZEYA 1KQSB 3KZ4C 4XOTA 2X05A 4AVCA 2WT1A 1GZCA 1O8SA 2WNVC 5IFPA 1OFNA 2FCVA 1ZBE1 2ZZQA 5KXBA 4IL7A 4META 4OHVA 3PU3A 2VVFA 1WORA 5DSZA 1WA6X 1KK0A 2RS51 5A3PA 2X85A 4QXKA 1COV1 3LOBA 2Q8EA 3U14A 3CCVB 4E2SA 3CEWA 1QFZA 3L9JT 5HKKA 2JB4A 1HXS3 4Z4RA 4CUCA 2W6IA 1B35C 1FPN3 2J1SA 3WSOA 2OVUA 1LNSA 4XEZA 3KV9A 2BNOA 4GWJA 5JI7A 3U4SA 3ZXJA 1PO22 1YIJB 1DQ6A 1V6LA 4QKBA 5FZ4A 5L9VA 1AR82 4N43C 4CP9B 5C3OA 2OYNA 1RUF3 3B93A 4LBMA 4RDKA 3RRDA 4R9DA 1JH5A 1C8M2 1W04A 4L8QA 1GOHA 3JQWA 4UBGA 1O3TA 1YFWA 2Q0AA 1UXXX 2VPVA 5D1IA 4BWOA 3NV4A 3O1MA 3A3GA 4NAMA 1QOSA 2X29A 1QJFA 3HN1A 4H7MA 2PFWA 2VBDA 5BSXA 1SLAA 3AZYA 5TY0A 4EJRA 2TBVA 5CA6A 5LRRA 1NCQC 1IS3A 2ZBUA 1C8M1 1QIQA 2B45X 5B6IA 2A6ZA 2WNVB 3R05A 2W5FA 4LXLA 1RHI3 4LNVA 4XQDA 4OULA 1X7NA 1YI7A 3I3QA 4RD7A 4DUXA 4GB33 1UN1A 2FDJA 1QGAA 3C7HA 4Y26A 5IVYA 1RUJ3 4CEYA 3VD9A 4P9SA 1EAH3 2HWB2 3DXUA 5FMDA 1CNFA 2LW8A 1E79A 3ACGA 3PMEA 2CF4A 5CDFA 4YW1A 2X6WA 4B4QA 2WZPP 1KEXA 1REDA 4AEKA 3GNEA 4ATEA 3IAQA 4QAWA 1YWKA 3OOCA 1BX1A 1RUF2 3I2KA 3PIJA 4V2WA 4KWUA 3BI3A 4JAAA 5I0SA 2EIXA 4ZHNA 5BPXA 4CU8A 2V4AA 5L9BA 4P6VF 2XJSA 1ZZ8A 4EWEA 5LZ6A 3LA7A 1BMV1 5IW0A 3SLDA 3AVUA 1PHMA 2K9ZA 4JQTA 5CFCC 4IW3B 3IIIA 1RGSA 1VALA 2GC0A 4KG8A 4RD2A 3RPQA 1AR73 4BDVB 4BQ3A 5D21A 2ADEA 1YJWB 2YMZA 4XILA 5EJ3A 2PHUA 2P3KA 3I2DA 2ZX0A 3WR0A 5CNAA 4A2UA 4XZUG 4CEWA 4XBLA 4D6RA 5LW9A 1WZXA 1XOYA 3MFAA 4PIXA 4MGKE 4LLOA 2RR11 2HEWF 4ZONA 5DAWA 3WXPA 1HJGA 2K46A 2FDKA 1SEFA 1AHSA 4KWKA 5FZOB 3WQ7A 4D7SA 2GZWA 4FTSA 2HWC2 2JE9A 2KM2A 2E1BA 2R6HA 4Y1XA 4I0BA 1NY71 1QEXA 5DUXA 5C4WA 2TNFA 2VNKA 1N0UA 3FJSA 5CVRA 4FOQA 3ECQA 5DQ0A 3PJQA 5K4LA 5T5OA 4COUA 1ENXA 5IYYA 3BY1A 1CESA 1YIFA 5F5IA 5J98B 4X7FA 3CCEB 3JU9A 4LOSA 1R1ZA 1DQ4A 2A6VA 2WQ8A 3EXUA 1OOPB 3IDCB 2JJ1A 1UZZA 4QPWA 2XVLA 3P3NA 4U36A 3CTAA 3KM5A 4K8FA 3UL2A 2AENA 2ZJCA 3TN91 1K5JA 1EUUA 3OEHA 3VNUA 3IPVB 4LE3A 4WZCA 3GJBA 4TZDA 5HCHA 3PUHA 3KVAA 2OPKA 2PLV2 2GP3A 3NJXA 3VBFC 1S0FA 2GN7A 3IDEA 4PBOA 4YEJA 4INDA 3S5AA 1F20A 2W08A 3M3QA 3D26A 2W68A 2ES3A 4E27A 5THXA 2WN2A 3IN9A 4G3YC 2VR4A 3N7KA 2F4NA 1X9PA 1OLME 3O1OA 1Y3TA 4E8CA 1US3A 5IJRA 1OOPC 1UWWA 4IGQA 4P9LA 5DDJ2 5FZIA 1CWPA 2JG8C 1YLOA 1GKBA 3LD8A 4B7KA 4I01A 5JXGA 4P1VA 1PVXA 4QX3A 5FY9A 3OE7A 4PC3A 2RS52 4XQWA 3ZDSA 2QE7A 4H14A 4LBQD 1GOFA 2IXJA 1FNZA 3E6DA 1W34A 2XOKA 3INAA 5BYNA 1OI6A 4CP9A 3WNKA 1ONAA 3IM0A 3ORJA 4NIDA 5TV2A 4PQ9A 3SCHA 5FZOA 1VRH1 3QBQA 2EVXA 1RTVA 1GNHA 5IVEA 5C3RA 1GO2A 4IQPA 4RQPB 3RZMA 4K40A 3LSEA 3SEPA 5JZGB 2VQTA 4TMXA 1ZZBA 2PAMA 3U6KA 1G86A 1IPSA 1GBGA 3OGRA 5BNOC 2X5IA 4GB32 4KL1A 1HIXA 2BNMA 1W8ZA 2JG8A 5CFDC 2WO1A 4S2FA 5E1RA 3VZMA 3I49A 3MMPA 1C28A 5DAQA 1OPOA 3BYWA 1R093 4DNYA 4EN7B 1K5MA 5HZBA 3N4MA 2VC9A 3K51A 4AVSA 3TEZA 1MVEA 2DCKA 2RJ2A 2PXJA 3PDQA 3T56B 1X33A 2C26A 1WOPA 2WR9A 5L46A 5A3TA 4W4ZA 1QJU1 5DUWA 3WHTA 3VBUC 4BCUA 5JPNB 1JYNA 1OLMA 4JTOA 3SEEA 3A1PA 5A89A 3HJRA 4JDOA 1SHWB 1YFUA 1N1YA 2O8QA 4A44A 1VLYA 3CZUA 1BVP1 2XJTA 3LPGA 5A33B 4QB6A 5FKBA 2VMDA 4UYBA 2PQSA 3OG2A 1W3VA 4IEXA 4MHRA 2VNGA 1ENSA 3WD5A 2HH9A 3TB0A 3POGA 4M4RA 1NCQB 4YAUA 1X8MA 4NOTA 5BNOB 4OHZA 2C78A 1TE1B 4YAWA 2JE7A 2Y6GA 4RJLA 4TMZA 5FL7A 2X53S 2XB6C 4GXLA 4M0HA 4Q4V1 3TEWA 2RJKA 3TWIA 2F1LA 2QQJA 4YHBA 4XMYA 1OQEA 2FX3A 1GLHA 1SBFA 3GGLA 3H9AA 3O0VA 4Y5SA 3ZBTA 4LJHA 4F8AA 4RGAA 3Q8FA 3T2QA 3S7EA 1KK3A 4JGYC 1RUF1 1Q8VA 4NWWA 1O4YA 1RC6A 2XJVA 3LE0A 4C1WA 5F3GA 1JUHA 1W0JA 2VBTA 2W52A 3MW4A 2PHTA 2JDZA 3PVOA 1LR5A 4RA0A 4J1XA 5L9RA 1W0NA 2J42A 4Y24A 3FPPA 1X8EA 3WQZA 3KVBA 4YWAA 1KXGA 3IAPA 3S5QA 2YUEA 5F3CA 4XLEA 3NL1A 5FO8B 2ZCWA 1AR93 3FMGA 4NHXA 1O6UA 3KQRA 4NHMA 4O61A 5F37A 4WM7A 1JNYA 1YI9A 2HYXA 2NMNA 3OGVA 5FK7A 5HBAA 1LU2A 4LITA 2BM1A 3FPKA 2JDMA 2K2SA 3A0KA 2B5HA 2X5IB 1NRKA 4FQZA 2BW8A 4NO4A 1V0EA 4YAFA 4RN5A 1EV13 4AVAA 2EXJA 2WL1A 1JZ7A 4OPVA 2ZGOA 1V9U1 3HD8B 2ZKLA 1YJ9B 2XZLA 2YWEA 1H8TB 3KF3A 3LCPA 4RDJA 3MLLA 4I30A 3OFNA 3NV2A 4YGBA 5IK5A 4OHYA 4UOJA 2OBTA 1DDLA 3HBKA 1HRI1 3OPWA 1QJZA 3B01A 3OYWB 3NQHA 3AZXA 4XPVA 4AI8A 4E9KA 5JCTA 2VBUA 3CCSB 2VY0A 2Y8KA 1SKQA 2BFUS 3ZN6B 4Y9RA 1XSRA 4FPHA 4LA3A 4Z1VA 1H4GA 5ABJC 1IZ3A 4GIQA 3ES1A 3DUIA 3FHIB 5KHIA 3ZOIA 1FOD1 1MEC3 1SFYA 1NJID 2P37A 4X07A 4N7UA 3AM2A 1G8WA 1TLLA 2VBPA 4KU8A 3ZSLA 2VBBA 4LBWA 2ARBA 1RQRA 2PHDA 4MHUA 4OP7A 2YWHA 4J6GA 1ZRCA 3TNQA 4B48A 2FQPA 5HXMA 3AXEA 3ZYJB 4BQYA 1PK6C 3K4DA 2VAUA 4L99A 3UGHA 3S30A 2P5BA 4KKUA 4TMTA 3FBYA 1APNA 4J1WA 1G7RA 2IZWA 4Q0PA 3I7DA 3WNLA 1IS4A 5FV3A 3CP8A 2ZABA 1GV9A 4S2HA 4UFKA 5CAZA 2ZOEB 5FP4A 2BF4A 2VJXA 3UETA 4AWDA 1EYBA 1I18A 4FQ4A 2O1QA 4PCRA 2OXBA 2WFF1 1XXNA 2WYSA 4HETA 5LB6A 3AX4A 3TEXA 1JS9A 3Q8BA 2W9XA 4LLFA 5F6KA 4W50A 3N9MA 5JOXA 1YUDA 2QEXB 4AEDA 4UI9L 2CC2A 4AF6A 2R1BA 4BXSV 4E4DX 4YZ3A 4ET7A 5ANNA 1J3RA 1W2TA 1DLCA 2A5ZA 2OW4A 4XFIA 3EMRA 4RGKA 3KCXA 4JX0A 4X8PA 1J1LA 1UYPA 2DUOA 2HWD2 4XUTA 5C3PA 1D2QA 2FZ2A 2E32A 4MSVA 3CNAA 1ZA4A 4V1PA 3DYOA 2WLPA 3O1VA 2CNAA 5C8WA 1AR61 2ZGKA 2EIBA 2OA2A 3KB5A 3H8UA 3P3PA 3ZBUA 3DKQA 4MGYE 2D5HA 4PC7A 1BYHA 2OUHA 4Y22B 4YG0A 4OHWA 3LAGA 1WSRA 3I1FA 1RVF3 4YARA 1DP0A 3A22A 5KR7A 3GBFA 1PIV2 3DYPA 4LIVA 2P6CA 2DETA 5JSOA 5F9TA 5FWJA 3HWJA 1VRH2 2OUJA 1S72B 1FMD2 4YZ2A 1RUNA 1OH3A 1S0JA 4LPLA 1VRBA 3CJIA 4ZU4A 2ZGMA 5F4JA 1C1LA 3AVRA 3WNCA 4W6XA 3WNBA 1JJ2B 1QNWA 2A6WA 2XEXA 3AC0A 4H2AA 1Z78A 1PO13 1GOGA 3LDBA 4N8MA 2BDRA 4CDUB 3JZVA 2VOVA 2ORZA 4RS5A 1W99A 2WQZC 2BQPA 1VMJA 2I45A 3CJXA 4XTPA 3RYKA 4Y20B 3SMHA 3UT0A 3V0BA 2WNVA 5AFBA 1VBE2 3W20A 2WAOA 5KXCA 4X8NA 5A7NA 4LULA 1DGRN 3PVNA 4L0PA 4II2A 4IE7A 4CCLA 2V72A 3O0WA 2BGOA 4WZTA 2ZHMA 3RZLA 3POSA 4IUGA 3NNFA 4UAJA 3ASRA 1ZM9A 3ELNA 1V0FA 3QFRA 1JYCA 2W3JA 2RC6A 2J1UA 2D3RA 2VZPA 1BLZA 3VKOA 5KXEA 3MPBA 4W6YA 3SKJE 1VBD3 2JKXA 3ACHA 3ZN6A 3PU8A 2YGMA 5JR2A 2GNTA 1RIRA 1RUI2 2BTVC 2PAEA 3WP5A 1XPWA 4BPRA 5BNNC 1KDKA 5IK7A 1LGNA 4ZU7A 3CP2A 3OUIA 1NDHA 1ENQA 1WA4A 1F9KA 3ZPOA 4AYUA 5A3NA 3AVXA 4CTEA 5A3WA 3ASIA 4B3FX 1J3PA 1ZRDA 1YIPA 4XF0A 3VO2A 4EE2A 2QQOA 2VQ0A 4LOTA 4XDQA 1EAH2 2HWB3 3ZSEA 1WLTA 4NPRA 4YFZA 4YW6A 2WRAA 5C3SA 3LF7A 1QFJA 3RFRA 4HKLA 4IV3B 1ZYBA 5EIYB 4OHXA 4RSUA 1XQBA 4PC1A 3FUOA 2BM0A 2CU5A 4NUBA 4Y1UA 1YCIA 2JENA 3DGTA 1VR3A 2R49A 3H94A 1J84A 2YYOA 4OZOA 5A3MA 2XBO3 3VHPA 1PX4A 2UWCA 1HV1A 2J1AA 4K9SA 2EIGA 4QQLA 1O91A 4RCYA 2NLRA 3PLQA 4B1LA 1F60A 1WLWA 1YQ2A 3NNLA 4RQPA 1MZ5A 2DU0A 4XUPA 2I74A 2D40A 3CO2A 3NRUA 3EBRA 1LEDA 1LCLA 2V7QA 3VBRC 1SBDA 2W2IA 5FUNA 1CQ9A 1VQ5B 2FCUA 1W2OA 3POBA 4GZ9A 3C7OA 1GWKA 1L3JA 1ZZ9A 3RJ2X 4BA6A 1FV3A 2ZGPA 3QOPA 3FE5A 2VVEA 4EH1A 4Y1YA 1QY4A 3ZIXA 3OBRA 4WV8A 3MGUA 1PGL2 1UOFA 4LHSA 5IYRA 3AZVA 3OY8A 3Q39A 5FYYA 4QU1A 1LECA 2XWJB 4YXWA 1NCRC 2B4KA 4Q27A 3POJA 5A33A 1K5MC 4NIIA 3E1F1 3WNXA 5GZEA 4COYA 1ZNPA 1W87A 4WM8C 3D0JA 2VYQA 1CZVA 1OQDA 1U5IA 1CJDA 5FY7A 4QPGA 2OT7A 4MZUA 3T2OA 5A6XA 4XXPA 4AI2A 4Y5Z0 3VBHA 4XD7A 4HKWA 2UYAA 3AB0A 1BHGA 3CU7A 4ISQA 4B4DA 1KMHA 2AEYA 4NRPA 4P08A 1XNTA 1RB8G 1YI2B 5HXVA 2R0HA 1DQ5A 5JXHA 1BBT3 3SLNA 3U11A 5J37A 1VBC2 2V73A 3B9CA 3H1WA 5GLVA 4ARXA 2W47A 3M1HA 5FTTC 3AJZA 4XJ9A 5F8PA 1KD7A 1OB5A 3BH4A 3ZPNA 1QDCA 3T0BA 4L11A 4Z4YA 3USUB 2K0GA 2DVFA 1FATA 1R083 3SKBA 1TEIA 3UGFA 3WDVA 3N7MA 4FFHA 1CJPA 1JZ5A 1OD3A 5GZGA 4UFMA 2BBVA 3N7LA 4Y20A 4TN7A 1KITA 1O3SA 2RHPA 1SDDB 2Y6FA 3HAGA 4RS5B 4BQ2A 2VMFA 4MYTA 2XKOA 4OFGA 2HWD3 3VZOA 3RZHA 3R4DB 2EXKA 3CRZA 2FMYA 4M3CB 4URTA 4WM8B 5A3UA 5JOYA 3KHCA 4M3CF 4IV3C 4C43A 3RQ0A 4Q4X2 1JTZX 2H0BA 2Q4SA 4RR3C 4YNIA 4A7ZA 2PLV3 2YROA 3ZZTA 1ZZ6A 4DO0A 1G7YA 3SEJA 2NZ9A 2QGGA 3Q8AA 5FXWA 1FXZA 5A7QA 2WPDA 1H8EA 1QVGB 2DF7A 1YJLA 2PHLA 2W92A 4K8RB 4CP2A 1H2LA 4M3CE 4DK1A 2RDQA 4X6QB 2VJIA 1H6XA 2LTNA 1ZRRA 3E5QA 4DRVA 1G6NA 2J22A 4UZFA 4C0SA 4NRQA 2A75A 4QPGC 2D7FA 1N3QA 4Y5TA 1N1TA 4MGIE 4K3UA 3H3UA 4UF0B 2Z2SB 1AX0A 3WP4A 4U2AA 1DZTA 3FUQA 4CDWC 2E63A 3B78A 2VO5A 3RGBA 2CGNA 4LO4B 1FT9A 2HJIA 1JB9A 5FZ6A 5C70A 1RITA 4LKDA 5J36A 1W2BB 1SKYB 2X8KA 5JZGC 4GQ7A 2ZTGA 1EP3B 1F5FA 1LB2A 1SM4A 1ND2C 1Q82D 1DGWX 1D4M2 1I1EA 2PIAA 1O4TA 2JE8A 5LA9A 5FLHA 3LFIA 3NNMA 5C7GA 3AVTA 3NNJA 3AFKA 5HPOA 5KWRA 1O5LA 1W8OA 5FXXA 2XNJA 3IIAA 1L7LA 3V65A 4FPOB 2XKPA 1NG0A 1FRQA 2A3WA 2PAKA 5CG9A 4UFJA 2C2WA 3M3CA 3TYJA 4FN5A 4UBHA 5CFCA 2X10A 3QH6A 1LOAA 1ULDA 2W1SA 2J1EA 2ZXIA 2OQ6A 2DCJA 4P9XA 3TNPB 4RHV1 2ZEXA 2WWSA 3CCJB 2GQFA 3M70A 3NVCA 4RGGA 4R9CA 5IYQA 2QQPA 3WDTA 1EFTA 1V6JA 1C1FA 1X50A 4BXFA 2VBVA 2ZITA 5KNLA 1HLCA 5A70A 1RUI1 3BN6A 1UY2A 1GSLA 4UWDA 4TKOB 4BQWA 4WM8A 5CKMA 1RINA 1ND2A 5DZEA 3H8OA 1Q8PA 1QGYA 3A35A 4FO9A 2RS32 1MZFA 2DV9A 4PQQA 1AYN2 2WNUB 3MHZA 2QA4B 2VZ1A 3KV5A 4D0QA 1LULA 3ZIAA 5ANQA 5F5QA 2EF6A 1MS8A 1OKQA 4TN1A 3WXMA 2WZ8A 4QHYA 4HLTA 3VBOB 3WNMA 1JA0A 1HJFA 2GMMA 3KCYA 2BOIA 2VECA 4ZPIA 1W0PA 2RMU1 5J48A 2RS31 2ZACA 3NMBA 1GWLA 1SLTA 1PO12 2AEZA 2VNIA 4K1ZA 3I2FA 1AXKA 4ATFA 2IFWA 1J83A 1SZBA 1UU4A 4Q0SA 5LBCA 3WYAA 1RUC3 3GBWA 3H7JA 3CPXA 1UQXA 3LWCA 1K42A 1JODA 1GQGA 1KS5A 5JXJA 5ACA2 3G6EB 2OBSA 1DU3D 3K4AA 4U9UA 4Y7CA 1BBT1 4L8JA 3CC7B 3R6JA 3EQEA 3CJIB 2JDYA 1FPN2 4AVZA 2D3NA 1DBNA 3P26A 2IXLA 1KK1A 4Q1PA 4OUMA 2Y33A 3MEPA 4N7IA 2J1TA 5T52A 2P2KA 4QU2A 2VJJA 5LEJA 1UMZA 2VUJA 3VUOA 1YHQB 2Q30A 4AAPA 2A3XA 3GSIA 4D94A 1WCDJ 5I91A 1JOJA 3NV3A 3KQ4B 4A4AA 4Q0UA 2NMOA 2BPOA 2XNCA 1AMOA 2Q5TA 3U07A 1H1AA 5C4WB 5A7SA 1FX5A 3RZGA 4C8DA 4HN1A 2XQXA 4BLIA 1FNMA 3AP5A 4NPLA 4YVWC 5GLTA 4MYUA 4B7EA 2QN6A 4TMWA 2GALA 4CCCA 4QDQA 2DU1A 2AYHA 1RQPA 2MNGA 4Z2WA 4P26A 2ZGQA 4YGEA 1T2XA 2VULA 1VQ7B 1DYOA 3R4SA 3E1YE 1DCSA 2DIEA 2ZXQA 2XJUA 2CNDA 1DG6A 3IZOA 4UF0A 4D7TA 2BBAA 1YYNA 2FBEA 4HVOA 3BKZA 3B7MA 3LDKA 1TME1 3GBGA 1ULEA 1EP1B 1W6QB 5ABJB 3EYPA 2JD9A 4FTEA 4XKWA 1OF3A 4FPFA 4Y22A 2QDNA 1EY2A 4O65A 5C8CB 1KRIA 4HVQA 1GMMA 1DQ2A 1QHDA 4PHZA 5D8AB 4CCEA 4WZFA 3MFCA 2W1UA 1VQ6B 4AFBA 3K48A 5H5JA 1CAWB 4KWLA 5HZAA 1FOD3 3VMFA 3WDWA 1KJRA 1UF2C 3ZSMA 2ZA9A 3ILFA 1F4HA 3BOPA 5L7OC 1WP6A 5LK7B 2BGIA 1KQRA 3HIFA 4K21A 3IKWA 1GYKA 1RUH3 3LEGA 3A8IA 2WBKA 4QPIC 5GLUA 3MYXA 1F35A 2A73B 1NX9A 2Y64A 4GULA 1SFPA 4ZCMA 1TVCA 1X9TA 2RS53 4IE5A 1W6PA 3T4VA 5C33A 2CHHA 2RDRA 1I9RA 5AFEA 4YG3A 1FV2A 4EN9B 4P3YA 1OLRA 1DDIA 2DUQA 4Q4W3 1GZ9A 2GN3A 3ME2A 1H9WA 2HWC3 2PA7A 1MQTC 1N3PA 1LHUA 1SLIA 4FOVA 4NVPA 5FK8A 4JHTA 4XONA 2ZMKA 5F1RA 1VLOA 1OUSA 3ZR6A 2IC1A 1SCSA 1SDWA 1HB4A 4AXOA 2PHFA 4PC2A 4G7XA 3N36A 4M3CA 3HPNA 2Z4FA 5F3EA 1S0UA 5C6CA 3BNWA 1ZVFA 4MG2A 4Q4W2 3HR9A 5CEHA 1VBE1 5EWSA 5FZ8A 5KSWB 2ZGLA 3OD0A 3MLJA 3NKGA 3UNPA 3WBJA 5TSWA 3SLIA 1OLQA 1V70A 3HNBM 3K4ZA 3WG3A 4QFMA 4BK4A 3CL1A 1UIKA 1YXWA 2Q1ZB 4OOVA 5JIUA 4DEVA 2JJ2A 5DXDA 2QDXA 1OB0A 1GP6A 3MO4A 4OMCA 2XH6A 3TN92 4MV2A 1Y9QA 2KD7A 1GFF2 5DZGA 2XJPA 5CADA 2AC1A 4ORFA 2HKXA 1PZ8A 2RS12 4P25A 2VW1A 3BC9A 1W28A 5FPXA 2ADDA 4GMP1 3T4HB 1CAUA 2WLQA 1CX1A 3VBHB 2YHJA 2VMCA 3ZKYA 5FNZA 3GCWA 4LTAA 3AYCA 3FL7A 5F4MA 4FPYA 4XIOA 4XVHA 3FKSA 2RG4A 1OQ1A 1K9MD 2C5BA 3AKRA 1Y0YA 3NE5B 4HL0A 3ROUA 3DPRC 2XLAA 1JUIA 2C0ZA 1SLLA 4QGMA 3AZZA 3MIGA 3A8JA 2UWBA 2G9ZA 3KT1A 4KG0A 3AJYA 5BXXA 4KMQA 2W39A 1AF9A 4QGNA 2ARXA 3VDDA 2HCJB 1XU2A 3S0MA 2QJVA 4LK6A 4N3GA 2QBXA 1OA3A 5T50A 1RMU1
chains in the Genus database with same CATH topology
2H0VA 1HRV3 4COWA 4QGLA 3AMMA 3H1MA 3B5LB 2V09A 2WFPA 3A0NA 2ZX3A 4OI2A 3PTYA 4C0HA 1LOGA 1VRH3 2BEOA 4MYEA 2D43A 3L2HA 2WNEA 4AFDA 4YW4A 3URFA 2GDFA 1DYPA 3RDIA 1HXS2 1HQWA 3VN4A 1ZBA1 2P17A 2B9UA 4FT8A 3U0ZA 3OAAA 2AGSA 4AF9A 2W0XA 4FP3A 5FBZA 2R073 2DYCA 4KGGA 1XYOA 4AEDB 2NM1A 2AH2A 4IEUA 1OPMA 2ZGUA 5EYXA 3SXWA 4GB31 3S7IA 3GYDA 3AFGA 3ALQA 4DB5A 1RUH2 2B46X 4N9HA 2KXLA 3KCCA 4C1XA 4RQPC 3J8F2 1HRV2 2EA7A 1PVC3 2IFRA 3VBRA 3B3QE 1REEA 4JGZA 4IXLA 3VGIA 4XFGA 2QFEA 1Q56A 1Y7BA 1DLLA 2QZ2A 5JOZA 4TLFA 1QQP2 2JG8B 2DFCA 3OGJA 2BYVE 4AHZA 2F4PA 1POV3 5IK2A 5B2GB 1LKNA 2PHWA 1WW4A 2VOXA 2ZHNA 2D3LA 2ZKNA 1EPWA 4CDUA 5GZCA 4YRDA 3WZ1A 4SBVA 2XG3A 4CDQB 4CDWB 3ZXDA 4LBKA 1BQPA 3RG0A 1QJU2 1PM7A 3WG1A 4CZSA 1BEV3 2VUAA 2XPJA 5I0RA 3BODA 2DTYA 5FO9B 1WUVA 4YLZA 3VKMA 1WW7A 1JXNA 2GJPA 4H55A 1OMIA 4RR3B 3L2YA 4BMEA 1H0BA 2B8MA 4Q0VA 2M5SA 4D69A 3E5UA 1MVQA 1FX0A 1RHI1 2JKBA 3IWZA 1ZX5A 2P3IA 4N43A 4Z07A 1RJ7A 4XQ4A 4I3GA 4QPIA 2SBAA 2VXRA 3J9SA 4NN0A 1UKGA 1RMU2 3JCIA 1UW8A 5JSRA 4D7YA 2Z79A 2PQQA 4UW4A 5LEKA 4NHLA 5GZDA 1OFSA 2DCYA 4XL9A 1FOD2 1UD3A 5BNPB 1AL21 2D5FA 2W6JA 1VAVA 4XFCA 1PNGA 4QQPA 2RMU3 4Q4W1 4ZKTB 1VBB3 4FPJA 4RL7A 2VU9A 5IK8A 5SV5A 2CL2A 5AC93 1BMFA 4IEPA 4HZFA 1POV1 1MS0A 3H50A 3WW1A 4YW5A 1O7FA 4L92A 5GZFA 2E7QA 1SBEA 3VBUB 1ND3C 1UD2A 3NAPA 2XLGA 4IV1C 2QE3A 4MH0E 2Z69A 2WFF2 3E5XA 1TQ5A 1W0KA 4IERA 2OYZA 5K9YA 1DGLA 4DNTB 4Y4YA 4CDXB 4N43B 1KZLA 1SMVA 3NV1A 3RZZA 2WINB 3PVBB 4BOWA 4IETA 1XRUA 5I8TA 1QXRA 2A7AA 1C4RA 2D6OX 4JQRA 1WCSA 1B35B 4M00A 2XBO1 1T5EA 5A3LA 2DFBA 4JGZC 4CYDA 1I8DA 1RVF1 4FPCA 4HSLA 1QQP1 1YHFA 1FAYA 1Q8SA 3FC0A 1DF0A 3GF6A 4Q4X1 4HIZA 3WX5A 1O4ZA 1VB2A 4WM7B 1UL9A 2DCZA 3HT1A 1RUI3 1UIJA 4I0WB 1J59A 1R1A2 1ZZCA 4M01A 1URXA 1LGCA 3AYEA 1HRV1 1AR63 1Q8OA 1LENA 3ZO0B 1AR81 2ZZJA 5F6LB 1LJ7A 3OYWA 2GNBA 1I3HA 2RJLA 5DDJ1 4KBBA 1JHNA 1QDOA 4YVSB 1LHWA 1UD4A 1BEV1 2JD4A 4BIFA 1V6MA 4XMIA 4AI1A 1QU0A 1QWRA 2D6LX 4EWAA 3OBTA 1AX2A 3O5SA 1NCRA 5LRSA 3OPZA 1VBC3 2QUOA 4HFSA 3NAPB 1RMU3 3ILNA 3KS7A 2GJRA 4XF4A 3MZHA 3CESA 2YXSA 3KGZA 1BLIA 2XLFA 2VG9A 5AVPA 2CGOA 4LUKA 4LHLA 1B35A 1VJ2A 1GQHA 2GMPA 3BCWA 1C3HA 1SQ4A 4KNCA 5DDJ3 1PIV3 1S2KA 4JV4A 4HPKB 3VBHC 1F8VA 4CEWC 5H9QA 4QPYA 4LBJA 4MLOA 3AYAA 2MPFA 1AXZA 3OW7A 4YFWA 2JG9C 1C57A 1DYKA 5CU1A 3AKTA 4XJUA 5SV8A 1WW5A 1PZ7A 1RUC1 3GZUC 5J7MA 1HRI2 2QNKA 3R0RA 1S0BA 3B94A 3JD73 1GANA 2MEV2 4Q0QA 3T1LA 2NN8A 3WG2A 5A32B 1CAVA 4CDXC 3WW4A 5CIRA 3MPPG 4QX5A 5EYYA 3RYPA 1AYM2 3VKNA 4AI3A 3VZNA 3N3HA 2UY9A 1XU1A 5FQ0B 5I8SA 2ZZGA 1DGWA 1FPN1 2MHFA 2UWAA 3TN92 1IQAA 2VNRA 2R9VA 4PIZA 4K20A 1XNCA 4MXWB 1RHI2 4XIKA 2VMGA 1AR72 2O8OA 5FAXA 1CIWA 1DZQA 2XVGA 4PIYA 4RS5C 2GC2A 2WKKA 4EROA 1R081 4IEQA 4FVVA 4XLCA 4FXKB 3AXDA 5BNPC 4OI1A 4AVVA 4HSJA 1TME3 1UD6A 3ILRA 3NSTA 4OVEA 4Q8KA 4DRRA 2F6BA 1WW6A 1LESA 3VDDC 4XLFA 4IV1B 4LBNA 2BGCA 2XBO2 2XHKA 1SLCA 2R063 1N3OA 3NW4A 1RUG1 1M4WA 2Z42A 2LALA 4IEVA 4HANA 2D44A 1TMF3 3QH7A 4KH9A 2ERFA 5BUVA 5BY5A 4II3A 2WS91 4LO8A 3A4UA 4GWMA 5DN6A 4H7LA 2JECA 1S55A 4KKSA 1Q3EA 3IBMA 5K0UB 5BV6A 2EAKA 1E3ZA 2H6CA 1ZBE3 4HK8A 5C4WC 1SCRA 1ZBA3 3W9AA 1LEMA 1QH6A 1QJY2 3THPA 1UD5A 1IKQA 4AGGA 1QGLA 2BUKA 3RSJA 2EAAA 4CDQC 2ZTNA 2CV6A 3NO8A 3AP6A 1H8HA 1O3RA 3GALA 1LGBA 3SISA 1UKRA 2ILMA 1PIV1 4QM8A 4Y1ZA 1MS5A 4LEJA 4N53B 4ASLA 3KGLA 4GA9A 2BWCA 4NR1A 5KHGA 5CG8A 5JAXA 5T55A 2WSVA 5BNNA 2D3SA 1U5YA 1WGPA 1A8MA 2CYFA 1PK6A 2B7YA 2HWF2 4DQAA 2XJQA 1UU5A 2ZGTA 3OBRA 2VOKA 3EJKA 3MIBA 4ISRA 4Q4Y3 1R091 4K1YA 2N7GA 2A71A 4IEWA 4OUSA 1NXD1 2GSYA 1ZRFA 2B42B 4XR6A 4RHV2 2JDIA 4XBQA 4E0FA 5C8CA 2ZZFA 2NYYA 1F31A 2ZS6B 4RR3A 5CFDA 1WBLA 1WCKA 1UPSA 5C9AB 4XMAA 3WG4A 4OLLA 4P9GA 1U5ZA 4XHBA 5C9AA 3OD4A 4WBBA 5KC6A 4Z1MA 3WDYA 3VL9A 1W6PB 2AR6A 4CDUC 4AQSA 1Z7S1 3OJBA 4XOGA 3ZN5A 3MLKA 1EPZA 1U5XA 4Z92B 1SLBA 3T2TA 4WVMB 4AFAA 4Q2FA 1CAXA 1NA1C 4PDWA 2ET1A 2ZBJA 2R041 1LOFA 4PBPA 5JI9A 4AFMA 1TMF2 2E6VA 3V64A 1V6OA 4UW3A 3PMSA 5FOJB 5FLIA 1N1SA 3GHNA 3VHOA 4AQ6A 4YM0A 4GALA 1HQNA 3T53B 3DPRB 1N1VA 2DWRA 3JBG1 4B8EA 4YG6A 1XNBA 2ETEA 2GK6A 4GQNA 1Z7S3 2IXCA 5A32A 4F7ZA 2VGDA 4YVSA 1QXJA 4JC1A 4JTNA 5K0UA 3VL8A 3ZFEA 2ZGNA 4YELA 3I4IA 3ST7A 2QDRA 4P5HA 4Q26A 3GQBA 4BH9A 3LNNA 2HYKA 4E2GA 5D8AA 2C5DA 2Q1MA 1VAKA 1RUJ2 1SACA 4P9YA 5KHJA 2AUYA 3HT2A 5E88A 4GWNA 4LHKA 1F5JA 3VDDB 4ITCA 2R062 1AXYA 1DIWA 2JX9A 4KQ7A 3PHMA 1DFQA 2ZX2A 4L9BA 4XLHA 4WV8A 3WOGA 1RUJ1 3S6PA 1W9XA 1HQLA 3VBRB 3B69A 1TNRA 4G7WA 3V56A 4BM8A 5HCAA 1C8M3 2B39A 1POV0 4Q4Y2 1QNYA 1LHNA 1S0DA 3OF1A 3RNSA 1LTEA 5BNPA 3THTA 3GZAA 1MEC2 5T5JA 3M7AA 2ZHLA 2YDEA 5J96B 1ZBA2 1Q8QA 4IEOA 2WJVA 1RUD2 4IV1A 1K5MB 4GH4A 2QKDA 4DY3A 4DNRB 3G6JB 2D6KA 2D97A 2PN5A 1RUE3 2GU9A 3D0SA 4HT1T 3T1MA 5L7OB 3N35A 3QLQA 1J1TA 2A6YA 2VMHA 3USSA 3TBDA 4FAHA 1JBCA 3MI8A 3ENRA 4QQOA 2VNOA 3AP7A 1D4M1 2XGXA 3J8F1 1E1QA 5C8CC 1ULGA 2PHRA 3D82A 1QJX3 3DL3A 2GMEA 2DVDA 2HWB1 4CDXA 3BIWE 4DPNA 1CPMA 3OEEA 4BLJA 2WQ4A 3WUDA 4M0NA 4QT6A 1FMD3 4JRAA 1VBB1 1JN2P 1G9BA 2YPJA 5FDBA 4JGYA 2DURA 1CAXB 2XUMA 4YVWB 1TNFA 1HZEA 3JBG3 2GNMA 3FLRA 4KU7A 4KKTA 1FI2A 3RMXA 4H3WA 1AR91 3M3EA 2WIIB 3USUA 2CK3A 3MF6A 5K7PA 1W6MA 3GVJA 4L97A 3POWA 2RM22 1AJOA 1MR5A 1D2SA 1GICA 2ZX1A 5IK4A 3LKJA 1HKDA 2RR12 1MACA 2GC3A 1ULFA 3G7DA 4XYXA 5DUVA 2UY8A 1AX1A 3I59B 4JVAA 3VBUA 1AL22 1ZM1A 1AUYA 4LO7A 4S2GA 4XE9A 1VF7A 4XF9A 3ZXGA 3WCRA 5L36A 3ZFEB 4HVRA 4E4SA 1I6XA 4ZXKA 2PHXA 4P9IA 3TAYA 3W58A 3ZFFC 1RUE1 2R072 2R30A 1QQP3 4DK0A 1VBA1 2G4IA 1LODA 4HBNA 1V6NA 3JBG2 4C0BA 4ASUA 2JG9A 1NCQA 2YC0A 4NHKA 2GH2A 4WM7C 4NNJA 1YLLA 1VB4A 2UU8A 3JD71 1LOCA 3H7YA 1W39A 2WZR1 4XORA 1DQ1A 1U0AA 2H6BA 1PGW1 2XL7A 1NOVA 1PGSA 3JD72 2CGPA 2VW0A 4Z8BA 5HI0A 4B4PA 1R1A1 2BNNA 1RUH1 3VV1A 1H2MA 4N90A 3OCPA 5JR7B 1BPLA 3ES4A 1IGOA 3SH3A 5FMOS 3A3BA 2ET7A 4L2NA 5FREA 3SCFA 1KFXL 5FCCA 2CAUA 2ZMNA 3HBZA 4RHV3 4LBOA 1X82A 4UW6A 2XZOA 2EXHA 3ZXAC 1Q5OA 4LBLA 2V4DA 5FRAA 1XE7A 2WNUA 4CP1A 4XLAA 4AVTA 5JSPA 2XZPA 1WD4A 3WHUA 1NLSA 1CAUB 4QHBA 3SH4A 5BNQA 1KS4A 1PVC2 3O14A 1H8VA 2ZXHA 2E51A 4MUVA 1ZBE2 3PVEA 4QPGB 1IPKA 3IT8A 2E9QA 4XJZA 1CAWA 4S2DA 1H8TC 1S0IA 2E53A 3VLBB 4E2SA 3NWKA 4MX3A 4EN8B 3AKQA 3AP9A 1YJKA 4YM2A 5HCFA 4C90A 3AP4A 3IMNA 5LK5A 2WS93 3GVLA 3LSDA 4N53A 5FO7B 1IHMA 2HEVF 4JGZB 1LRHA 2WSUA 3VKFC 3FZ3A 2VW2A 1W6MB 1V9U3 4DMIA 1VLNA 2TUNA 2XWBB 1MS4A 2DVBA 2RE9A 2HWD1 1HRI3 3UV9A 3MIEA 5JLVA 2JXAA 3ZXEA 4GMP0 1WTHD 1XNDA 4A7KA 1K28D 2HWF1 1W6QA 5ABJA 1CVNA 1E3XA 4Y1VA 1B09A 3ZSJA 2WSSA 1R092 3BALA 4B4RA 1DZRA 4DZGA 2V31A 1CAVB 1QOOA 3R4UA 1XYPA 5GJ6A 4W65A 3M8LA 2WFF3 1LHOA 2CTVA 5E8AA 4ASMB 3DN7A 4TT3A 1AYM1 3J8F3 2VH9A 2JIZA 4MVTA 1WMEA 2RR13 3D5OA 2BFUL 4GKXA 3WW3A 3ZYRA 1XQNA 4JCKA 3BPZA 2YY1A 5GLWA 3ZPYA 3KEWA 1PNFA 4HPKA 2ZHKA 3NKTA 2P3JA 4BZ4A 5BNOC 3GVKA 3WP3A 1G9AA 4Q4V2 1VJSA 4QQ2A 3FX3A 1NA1B 5JZGA 4AEMA 2RM21 2R1DA 4JDMA 1RUOA 1I5ZA 1R082 1J3QA 2E7AA 3H1YA 4A7YA 4CDQA 1ALYA 3H3ZA 3B02A 2HWE2 4FP2A 3WVJA 1O3QA 3JUUA 2R043 2WZR2 2EALA 4FPEA 5KXDA 1EAH1 2WT0A 3ZYGA 4ES9A 4LO5B 2HWE1 1MS9A 5CFDB 1COWA 3VBSC 3AMPA 4YW2A 4AGVA 2ZZEA 4FAGA 4GKYA 3VBFB 4YGDA 4TWTA 4MXWA 4ZU5A 5L73A 4XJ8A 1WD3A 1AYN3 1UD8A 3RI9A 4UXAA 4HKOA 4E2QA 3DV8A 2VMIA 4TSVA 4XN3A 3SITA 5BNOA 1MZ6A 1BEV2 4QD2A 3ZMNA 4N9IA 3FWEA 3C2UA 3TRSB 1D4VB 3RMYA 4XF3A 4DINB 1COV2 2GNDA 4FCAA 1CR7A 1R1A3 4R4ZA 1HXS1 2PYTA 1QXPA 3LGRA 3E6CC 5C9AC 4AE2A 4AHYA 4LBQB 3WDXA 4LT5A 1FMD1 3I8TA 2F1MA 1ASJ3 3C3VA 3ZX7A 4I0AA 4QM9A 3ZYIB 4AK3A 3BB6A 2YV8A 1QKQA 1C8NA 3VBSB 1D0GA 3M3IA 3I59A 3B00A 4G9SB 1FYUA 2RS13 4AFCA 1YFYA 1DGRA 4C91A 2O0OA 4G4FA 1PVC1 3GZTB 2XJRA 4I2OA 3PJYA 3VBFA 2ZGSA 1LHVA 3IDBB 5CBLA 4I02A 2Z5WA 2LM3A 1EFRA 1W6NB 3UKNA 2JICA 3VZKA 2AREA 1Z7S2 4AGRA 2HWE3 1EP0A 3ZMOA 3M4FA 4IV3A 1W2UA 4HN0A 3ZXKA 2HEYF 2NP0A 3WUCA 1LOFC 2BVVA 4XETA 4YM1A 1MS1A 1VBE3 5CFCB 1Y43B 1NE4A 1VBB2 3AMHA 3H0OA 4P14A 3RS6A 4AVBA 1H1IA 4YGCA 5JMCA 3MF9A 4AG4A 3OTFA 1V6KA 4TSFA 5DUUA 4YYOA 4AI0A 4WVMA 4KGQA 2WT2A 4F83A 2XVKA 1RUG3 1V00A 5GLZA 5KC5A 1IS6A 4GMP3 3G05A 4LBQA 1UPIA 1IKPA 1YRZA 3I54A 4Z82A 3ZFEC 1PO23 4XW3A 4OI0A 1HVXA 1CONA 2NQYA 5FLJA 3WW2A 1BJQA 2Y38A 4XTMA 1G9CA 1MABA 5E16A 4FXGB 3V0AB 2Z6BD 1NBMA 3MIHA 2BWAA 3TN93 4HMZA 2RMU2 3AMNA 3WP6A 3NJZA 4DOUA 1D4M3 3ETQA 2VOWA 2JJ6A 1WBFA 3SHRA 4JDNA 2AZ5A 4CEYC 4AQ2A 3D8CA 4B3NA 4NWVA 4F3JA 5KBFA 1AYM3 2XL9A 1VBA2 3JB4C 2ZPXA 4BYYA 2LUWA 2D6MA 3WINE 3JU4A 2IXHA 3ACLA 4R52A 1BMV2 3AYDA 4LHNA 5FFOC 3SCGA 3AZWA 1UCXA 1V9U2 2R042 1XE8A 4DXZA 2E7TA 4FBFA 2PELA 1BCXA 3ZXFA 1LU1A 1VBD1 4QPIB 4CEWB 2YZ4A 4WVZA 4CP0A 4QQHA 2A3YA