2X53S

Structure of the phage p2 baseplate in its activated conformation with sr
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
298
structure length
298
Chain Sequence
GVRQYKIHTNLDGTDDKVWDVTNGKVRFYQPSNLGLQSTNNIWQSNGIGVMGTRSITQPQIEFKLETFGESLEENYQLMKDFVNDILSKKFVTLEYQTEIFQVYADLALADVTKTEGYGKNGTFSEKITFDIITKWYTYENLTFDKIQNGKVIAGMSKIYGGTAPGNYKYIKGTSYTYYGESDIDRLSRWDIKEEIFSFMGILYPKLPKTPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQGWKGTTALNLFPVMDFERYRTRIIEKGQMELINLSKAEFKIKRKADFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords ORF16
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
total genus 53
structure length 298
sequence length 298
chains with identical sequence T, U, V, W, X
ec nomenclature
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.210 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x53S01
2.60.120.880 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2x53S02
2WZPP 2X53S
chains in the Genus database with same CATH superfamily
4QDRA 1JNYA 1RVF3 3T30A 1AR93 4XMAA 4P9XA 4J1XA 5J96B 4QMAA 2GK6A 1DARA 4AGGA 3HN1A 4Y9RA 2R073 1RVF1 1W9XA 1AR91 1KJLA 4PF1A 3ONYA 1LHUA 1I18A 2WR9A 4J0QA 2IXIA 1NCQC 4RD7A 1RL3A 2D6KA 4G7WA 1CAXA 4RQPA 3B00A 2WFF3 5GLWA 1EAH3 2Q8EA 4QQPA 3Q38A 3KD4A 2Y34A 2WFF1 1E57A 1EAH1 5IYYA 5F4JA 1X36A 3OPTA 2XNCA 1FPN3 4ASUA 2XL9A 1OKQA 4QFMA 1SCRA 4X06A 1FPN1 5EJ1B 1CAUB 1KQRA 1VQNB 4CU7A 1G7YA 2WLQA 3AJYA 4PBOA 5JOZA 1JZ5A 1PMJX 2GZWA 2AREA 4XUOA 3PMSA 4LR4A 2B9UA 4LBNA 5FZKA 2Z69A 1VALA 4QQ2A 3OF1A 3VMFA 3JXSA 2QZ2A 1SBDA 3HNYM 5KR7A 1CX1A 4YW7A 4P9LA 1T6GC 1KD7A 4J25A 5BNOA 1FATA 3K3NA 5DZFA 3K51A 3AX4A 2OUJA 4E9KA 1W04A 1W9FA 5CNAA 3BALA 4I01A 1A8PA 2VQTA 2DBNA 2Z42A 4OVEA 5A3WA 3BY2A 3AP4A 4AFMA 5C33A 1NT0A 3MIHA 2X5IC 2RJLA 1QQP2 1GOGA 3OW7A 3IN9A 2VOKA 2GMMA 2Y8KA 1MZFA 2ZTGA 3THTA 4IE0A 2FCUA 2VQAA 5FYSA 2ZGRA 1S0BA 3ZPYA 1OLQA 1O3TA 1SDWA 3E20A 1UQXA 1SFNA 4OQ9A 3GJBA 2DUOA 2VTFA 4QPIC 4EYUA 4NIDA 4BDVB 4TKOB 1CZVA 2ARCA 2XONA 2OVUA 4M0HA 1VJSA 3CB4A 3VZOA 2SBAA 4ZXEA 3CCEB 1AR82 3VKMA 1V70A 3W2FA 2FZ1A 4BQWA 4YHBA 4QXBA 3R6JA 4K6BA 1SKQA 4HANA 3PVOA 4LEJA 4XOTA 1W2BB 5KHIA 5HZBA 2EVXA 1HZEA 3WW4A 4QB1A 1W9YA 3O1VA 2PQSA 1QOSA 4XFCA 4W6YA 1JOPA 4Z92B 3P3PA 4AFAA 5GZCA 5JZGB 4YW2A 4WZTA 1SHWB 1SBFA 1W0NA 2E26A 2BOJA 4FTEA 4XF9A 1XSRA 4WVVA 1H8TC 4N53B 3R6SA 4OOVA 1A3KA 3MUY1 2ZMKA 2P3IA 3U75A 3W5NA 1NKGA 3O14A 1CR7A 1NZIA 4F7DA 1ZRFA 2ZBUA 3CP8A 3IAQA 1E62A 1COV2 3AZVA 2G9ZA 2X10A 2OUHA 1QHDA 2G19A 3CW2A 3OGVA 3BOWA 5JOXA 2XLAA 1LCLA 5FK8A 1V0FA 2MNGA 3BGAA 5GV7A 3BU7A 3N9LA 4UF0B 1EFUA 2OTJB 5GLVA 1QJZA 5FMOS 4LBJA 4CA9A 3MV11 4URAA 1C57A 1KD1D 4OOXA 2YPDA 3R4DB 2VCBA 4GQNA 4GH4C 3H1WA 1BK1A 1MR5A 3LWCA 2Z6BD 3QACA 2XZOA 4XPVA 4ACBA 1I5ZA 3H8UA 1PGSA 2BEOA 5K9YA 2HEYF 4Y5Z0 4P2NA 2BZDA 4QX5A 3V7AA 1G7TA 4XQFA 5A7SA 4G5GA 4RGKA 4ZS2A 1UN1A 2AUYA 1G9FA 2CNDA 4QPGA 4NPLA 1VBC2 4WM8C 1CQ9A 1YLLA 3U4SA 2DDUA 3WEZA 1S0CA 5FY5A 4BJ0A 3I2FA 3AKTA 2AEYA 3I2GA 2WYRA 4B3NA 2QQUA 3GBFA 1DQ6A 4XDPA 5GJ6A 4HKLA 4HBNA 3ZM8A 1EPZA 3LOBA 3Q8FA 3G6EB 4DXTA 1OI6A 2ZAAA 3MIFA 5CKNA 4OHWA 2RR13 1BLIA 4RLZA 2ZEZA 5KBFA 2WT0A 3K77A 3PVBB 1HRI3 4UYBA 1PVC2 5F8PA 3VBUB 2GSYA 2RR11 3QLQA 5TRDA 2EA7A 2B46X 2ZXQA 1XQBA 3ZOIA 4CCJA 5K0UC 3CCLB 5C8CA 1UY3A 1HB1A 2EAAA 2RC6A 3K75B 2HWB3 2IXKA 1I8DA 3BCFA 1ASJ2 2HWB1 1X9PA 2AACA 4IE7A 5FP4A 1IB0A 2CWMA 1NOVA 2VM9A 3KF5A 4YAFA 4LTAA 1WMDA 5D1IA 2K46A 3CBNA 2Y6HA 3MLLA 4XN3A 4M3CF 4FQ4A 4ZCMA 4Z4SA 3GSIA 1DQ4A 5FUNA 4FFHA 1S72B 1REFA 4DK0A 4ASLA 4LORA 2YWHA 2X6XA 1W87A 5AN9A 3LQCA 1W34A 3UL2A 1RXFA 1R1ZA 4DUVA 3NW4A 5KXCA 1UOFA 3CCQB 1PX3A 4ZCIA 4YG6A 2ZGUA 2YV8A 4QX2A 5TSWA 4AXOA 3POSA 2VL4A 4OHYA 1J58A 4YELA 1ZRCA 1KK3A 1R082 5A7WB 4Q1PA 4G4FA 4LKDA 4C1XA 3ZYJB 5F5AA 1NB0A 1AXZA 5C9AA 2BU9A 4H9GA 2D6MA 4K7JA 2J1TA 2VE1A 4JGYC 2FD8A 1RUH2 5H59A 5ERLA 2JIJA 4AI0A 3SJZA 4A3XA 4R4XA 3ASTA 5FZBA 4NNJA 1GKBA 1FDRA 1XE8A 1HW5A 2PMWB 4E4SA 1ND2A 1B35B 1ULPA 5F32A 2QDXA 4W6XA 1JHJA 4DZGA 4W6WA 2Q6KA 4R9DA 5CG8A 4J6GA 4QM8A 1W8WA 5FP3A 1V0EA 3PJQA 1RJ7A 2O1QA 3N36A 3AKPA 4R9BA 1ULDA 2CK3A 2JDPA 2RDRA 1AXKA 1ZBE3 2BNNA 2OK7A 4XUQA 2D6LX 3VZMA 4X8NA 2PYTA 4YFZA 3JQQA 3DKWA 2F1MA 4DXZA 5FO1A 4Q8LA 3F2ZA 3PA2A 4YZ2A 4K40A 3P27A 2UWBA 3TB0A 1S55A 4C90A 2VGDA 4Y5TA 3WF0A 1W8OA 3MICA 4PQQA 2NPFA 3B93A 4CVUA 2WO2A 2XZPA 4OMDA 1Y43B 5FYVA 4HE6A 5M0TA 2PE3A 5JBQA 3M70A 2XMLA 2ZA9A 3Q39A 1MS1A 2FMDA 2NP0A 5H5JA 5DDJ3 5DS0A 1EP2B 4A44A 1EP1B 2JICA 2LALA 1DF0A 1UU6A 1KK2A 4MYTA 5DDJ1 1S0EA 4M3CA 4CDQA 1CAVB 5I8YA 3BN6A 3ZN4A 3A3GA 2R1BA 5TY0A 2WAOA 1JZ2A 3TRSB 4FCAA 1GNHA 3DEMA 2NZ9A 4DNYA 2EXHA 4W50A 3VD3A 1RUG3 4YVWC 4LBLA 3VBSA 2GN3A 4S2FA 3RJRA 1RUI2 3ZN5A 1W05A 2PLV2 2VBDA 1H42A 4DQAA 3FBMA 3C7EA 2DCJA 1IS4A 3LFMA 3ZYGA 1TVGA 2VTXA 1WP6A 3N9PA 4X7EA 2CYFA 4HXCA 2ZGNA 4XCAA 3P1IA 4LC0A 4AGVA 1BMV2 4C0HA 4ATFA 1JUIA 1EUUA 4Y24A 1CJDA 3WQ0A 4JAAA 4ARYA 1PM4A 1RUC1 5FQ0A 4H3WA 1DQ2A 3BYWA 4YGEA 2ZTNA 2FDFA 1W0PA 3TN92 4YM2A 3UETA 3U1XA 1QJX2 3SEEA 3ZDSA 2ZJCA 3FFZA 2V7WA 1H1AA 1LODA 4L2NA 1GYKA 2W6IA 1S0FA 1ZREA 2ZXHA 1NCQB 2DU0A 1U0AA 2WKKA 1QJY3 1RUF3 5CFCA 4RD6A 2WS91 1NYWA 2JJ2A 4LBYA 2DETA 3W58A 4CP1A 2R1DA 4YVSA 5EXOA 1WLWA 1Z7S3 1ZA4A 1QJY1 5FZGA 1TE1B 2Y6GA 4RSUA 4A7KA 2P2KA 2EXJA 3MIEA 5I0SA 4X0CA 2VOVA 1Z7S1 5CFDA 1BVP1 4IEWA 4EROA 4JQRA 2RDNA 3LIHA 2YWEA 5FZ7A 3WV6A 1LNSA 1J1LA 3EMRA 5CZKA 1XU1A 3IPVB 1OLME 1O4YA 1N1YA 4P9JA 4KI5M 5LMZA 3H8RA 5FY8A 1WCKA 3OUJA 1Q81D 3MHZA 4OUMA 3Q8BA 2DFCA 3HN3A 5ISLA 5EYXA 2MEV2 5FNZA 1NG0A 5SV5A 1AR62 4EN7B 1MZEA 3RI9A 2A6YA 2HWC3 1KK1A 1W6PB 1GAQA 4CDWB 3ZVXA 1DGRA 2WFPA 1FRNA 3CC2B 2CGNA 1O91A 2Z5WA 5CKMA 2VUAA 3JB4C 3R0RA 1F9KA 3M3QA 1YWKA 4Q4X2 5CIRA 3VL9A 1BHGA 1D0GA 4LBQB 4N43A 1STMA 3S6PA 1CWPA 3WW3A 4HONA 1ELOA 4NVPA 5FZAA 1EWYA 1IS5A 4LK7A 4AI3A 2BMWA 1ND3A 2QE3A 3IMMA 5IAXA 3BH4A 1BK0A 4K8RB 1SLIA 1RUD2 3D82A 4N90A 3D5OA 3AMPA 2GP3A 2A75A 4OI4A 4LBZA 2DVBA 4HE5A 1R092 1B2RA 1Y3TA 4IV1B 1YQ2A 1NE6A 2JD9A 3PJYA 5FY0A 3N35A 3H3LA 2ZCWA 1LGBA 1AR73 5BNNB 2ZZEA 5DUUA 3AXEA 2OQ7A 5DUXA 3HQUA 1V6NA 3LNNA 5IK2A 1NCRA 2Q8OA 2D3LA 4DQKA 2ET1A 1BJQA 1G9BA 3A8KA 1GZ9A 5A3LA 2FCVA 4IEZA 3H3UA 3OPOA 4ZGQB 1GP5A 3M3OA 1KGYA 2ZX3A 2V7XA 1EP3B 4FVVA 2WWJA 1OA4A 3OY8B 2DUPA 2E7QA 1IHMA 2VZUA 5IFPA 1X7NA 3GDBA 3CIHA 4FPHA 2Y6FA 5FZFA 1BJKA 5KNLA 2XUEA 3NAPA 2JN9A 2J1AA 2Q4SA 5JMCA 4AVSA 1NQJA 2VNHA 1RQPA 4F3JA 4YLZA 5KSWB 1LOEA 3FL7A 1VBD2 3Q8EA 3L9JT 4YG3A 5AC91 2Y60A 1ZZBA 2WBKA 1VMHA 2YU2A 1HRV2 3VO1A 1H6XA 4AEMA 3AKQA 2JENA 5C5UA 2FMYA 2VNGA 5A3NA 3I2KA 4XF3A 2D7FA 3PA1A 4DMIA 4IV3A 4PLMA 4CCMA 1N0UA 2GU9A 4P00B 1RGSA 3V0BB 1HB3A 3GJAA 1J9ZA 3OGJA 3VBRB 3VDDC 1LENA 4OPSA 1HIXA 3POIA 3KQRA 4COWA 3GXUA 4NIAA 1GLHA 4GH4B 2X3UA 5IJRA 4N3NA 5FMDA 1N8RD 1Q9SA 4D6SA 2YDEA 3RG0A 1UNBA 4D7TA 2PAEA 1FNBA 1XNCA 2JX9A 5FP8A 1JA1A 1I5PA 1OT5A 5IYQA 1JODA 4UFIA 5IK7A 3ZR6A 5BUVA 2ILMA 4RCYA 5FYUA 3IBMA 3T2QA 1PK6C 3H1YA 1O6UA 4Z4RA 5TR9A 3D4KA 5FAXA 3M8LA 4A6SA 1IJEA 4XMIA 3RSJA 3AZYA 5AFBA 1H30A 4DRRA 1GNYA 1PJ5A 1J83A 1ZM4A 2GMPA 3S0MA 4FBFA 1PKVA 3BPZA 4BOWA 2PA7A 3FC0A 2VG9A 1AL22 2E51A 1PHMA 1C5IA 1CAXB 1LHWA 2ZEYA 2PHWA 3CDZB 2YUEA 1RINA 1W0OA 5JSRA 3VDCA 5K0UB 4XCBA 4A6OA 2BGCA 1VQLB 4HG6B 4V1PA 1OMIA 5H9SA 1ENRA 3O1RA 3BPSA 3PUIA 3MW4A 2DV9A 2VBUA 1VQ9B 1WCUA 2VBBA 1YFUA 3NJYA 4JHZA 3G71B 5A89A 2W2IA 2NN8A 4CXXA 1QGZA 3IDBB 5A7PA 3LPFA 3OJXA 3WOGA 2BJSA 1GWKA 2V7TA 4IGPA 3CMEB 2YFZA 4PF5A 1ZZ6A 2GDFA 4AHYA 4LHLA 4PLOA 2LTNA 4L9BA 2W6JA 2Q6IA 3AVUA 4HT1T 1DCSA 3O0VA 2WJVA 3WXMA 2HYKA 4A7ZA 1T6XA 1BEV1 4KH9A 2JG9A 2IUWA 4P25A 1APNA 3MO4A 3FPKA 1BBT2 4W8JA 2VMIA 2R041 4ET7A 1X8MA 1FV2A 2GH8A 3HWJA 4CEWC 2WNUA 3CU7A 1SZBA 2E33A 3KV6A 3KCCA 5A7OA 4HVQA 2VUDA 4ZZ5A 5CAZA 2HCJB 3PTRB 1SG3A 1IKQA 4YNIA 4COYA 1RUJ2 1PZ9A 1S0GA 3ZPOA 2E1RA 3FLPA 2VCCA 4E27A 1VQ4B 4XJWA 2Y26A 4FI9A 2WAAA 2RMU2 2XR4A 4TZDA 3C8XA 3MFCA 1GMMA 4K1ZA 5LBBA 1FT9A 2VNVA 4LNVA 2DCYA 3DXUA 3V0AB 5BYNA 1T5EA 3AYDA 4LUMA 2XWJB 4MGQA 5IUQA 5ABJA 4MHUA 1CAUA 1RMU1 2X09A 1Y0YA 1ZBA3 3NNGA 1HB2A 1PZ8A 3CJIA 2VMFA 3KV4A 4LO8A 3DN7A 1OHFA 1S0JA 4KWJA 3VZLA 1YXWA 1H2KA 5F5IA 4SBVA 1HQNA 1XYPA 4LO5B 4XM3A 2DEUA 1C8M2 1UL9A 2WT2A 3TBDA 5IWFA 4NPRA 3OGSA 4CRQA 4RM0A 3ALQA 4LA3A 2VJXA 4HKWA 3KSCA 1CZTA 4BQ4A 4B7KA 1VBE3 5HCFA 4DY3A 1UMHA 3CRZA 5CYYA 2DWRA 2XVKA 3VBHC 1OC1A 1VBE1 4XFHA 3AK0A 5T3NA 4E8DA 1Q7YD 4FPJA 1TMF3 3CD6B 3KB5A 4LJHA 3ON7A 4WZLA 4YW5A 2PLFA 4MYUA 3WNKA 5LK5A 1F20A 5E6TA 4Z1MA 1PO12 3LZZA 4GQ7A 5DG2A 1D4M3 3MLKA 1TME1 3W5HA 4Y1ZA 4FT8A 5DPNA 3WP6A 4QB6A 1EV13 3C7HA 1Q86D 3E6CC 1NBMA 3JD73 2QTZA 1W6MA 5B2GB 5FYYA 4Q4V2 1BKZA 5FKBA 3JD71 1GQGA 4PC2A 1C1FA 3JCIA 5C3QA 3W5MA 3H42B 2BGIA 1DBNA 5LEKA 4MV2A 1HQLA 3LD8A 2QQWA 4YAWA 4XUNA 4AF9A 1HN0A 1Q5OA 4WV8A 1W0KA 4QU2A 2W9XA 2QQPA 1H2NA 4KG8A 1H6YA 5CVRA 2C1FA 2CTVA 2B42B 1WZXA 2EFGA 4KWUA 2X29A 2HLDA 1W2OA 4DK1A 5F2SA 3PUNA 4KU8A 4IE5A 5EYYA 4L97A 5D2AA 1E5SA 1FNMA 3J7HA 5ACA1 1OGJA 3V56A 4PC6A 1HV0A 1X9TA 3B7MA 3GCXA 1RUE2 4QB2A 5BNPC 4Z4YA 5JPMB 1OPMA 2ARXA 4WM7C 4QPGB 1F8VA 4XABA 4AK3A 2XQRA 1UXXX 2VOTA 1YITB 4HZFA 2R6QA 2QEXB 3H3ZA 4XXPA 2VZRA 2RC5A 4FPGA 2QKDA 4IETA 5B4NA 4EN8B 1WW7A 1POQA 2RM22 2UWCA 2KXLA 5JMOA 2I74A 4TN7A 1J1TA 4HMZA 3O1UA 1W99A 3NL1A 1AF9A 3KZ4C 2YZ4A 3FKSA 5C8CB 1VBB2 5IVBA 2JE8A 2QCSB 5I0DA 2ZGTA 2YROA 3WY9A 2HWD2 4CUAA 3B5LB 1Q82D 4LITA 1ZM9A 2D5FA 4U9UA 1VE0A 2WJYA 4XFBA 4ZY9A 3VNVA 3Q9OA 4HN0A 4QQOA 3Q6RA 1FOD3 3WW1A 3RZJA 2YC2A 1WCQA 5E89A 3J81k 5DN6A 5HCAA 3JB8A 1FOD1 3T2PA 5I8TA 5C4WA 2C5BA 4BQ3A 1N47A 1NRKA 2LRPA 4RHV1 4ZZ8A 1GUIA 1TUIA 3BTZA 4COVA 4F83A 1U5YA 2GALA 4X7DA 4IGQA 1UO9A 2RG4A 4M3CE 4ASKA 1FRQA 1SDDB 1PIV3 3O1TA 5DUVA 4IGOA 2GC2A 1N06A 3MV01 1R1A3 1PIV1 1PNFA 3BTAA 3PUQA 3BU0A 3PHMA 3FMGA 3N9MA 3LQEA 3NNLA 4M53A 5EJZB 1WWYA 4N7IA 3AMQA 4PDWC 1AYM2 4Z4ZA 3OPWA 4XIKA 2W95A 3ETQA 5F2WA 4DOUA 1HJGA 1V6JA 3R4UA 3CCVB 3KMHA 4JV4A 4EV0A 2Y0OA 5C9AB 4OCTA 3AKRA 1NXMA 5H9QA 2AC1A 5GZDA 2BN4A 1CJPA 4YAUA 3LOIA 1BPLA 4OI2A 2W1QA 4EN0A 5FYMA 1OA2A 5E16A 3ZX7A 4Q29A 1JU4A 2V4DA 1H9WA 5T5OA 5GZGA 4HETA 4E8CA 4PLNA 5F9TA 2XVLA 5J09A 1ULFA 2VMDA 1EAH2 1GR3A 4M0LA 4LBKA 2E31A 2ATFA 5IATA 2CC2A 2G9GA 3I56B 3NJXA 1E1RA 3ZFGA 5JXGA 4Y1XA 2WWSA 3N3HA 3ZFFC 1IS3A 1AL0G 3OW2B 4JTOA 3WNLA 5JOWA 1V5VA 2E7TA 4ZCLA 3LB9A 2ZGMA 1ZM3A 3C7GA 3ELNA 5FP7A 4K21A 5A3OA 3UGHA 4RS5A 3SEPA 3KS7A 5DAWA 3WT3A 4GWIA 1GSLA 1HQWA 3RS6A 2XJQA 3OAAA 5E1RA 1ENQA 3ZPNA 2WQ4A 3OBTA 1LB2A 5L9RA 4RL7A 1ZX5A 2ZEWA 2RS51 1JBCA 4AEDC 1QQP3 1GANA 3LE0A 3UJQA 2VCAA 4NPMA 1ULCA 4MH0E 2WYFA 1HLCA 5FFOC 1QQP1 5IK8A 4M3CB 3VHNA 4QAWA 3LDKA 1PGW2 3QFSA 3GZEA 4ZGNB 4AVVA 4B48A 1QFJA 5AFEA 3WQZA 4OOSA 2BUKA 3I55B 1V6IA 1YC61 1GWMA 4AR2A 1SPPA 1VHOA 1MQTC 4CCCA 3FHQA 2V7UA 2HH9A 5FL7A 4A3ZA 1C5HA 1H8HA 2Q6OA 4DNTB 5L36A 4L11A 4E2QA 1DQ5A 4BIFA 5FKCA 1CGPA 1AR83 4HKOA 4FPCA 3VDBA 4XLHA 1JOJA 2JXAA 2JDMA 1LOBA 3C2UA 2PXJA 1W9TA 4KQ7A 1UX6A 2QE7A 4D3WA 2ORZA 2GREA 1SMVA 1M4WA 5FZ6A 3UV9A 3AVVA 5FQ0B 5FXVA 3I59B 4JGZC 4AVCA 3KVBA 3P6BA 5HXMA 1B23P 3URFA 2A6VA 1V9U1 2JE7A 4CU9A 3ITQA 1W2UA 2JG8A 3QBQA 3K4AA 3W21A 3Q6QA 4QKFA 2RS11 2BFUL 4I0WB 4MVTA 4DXRA 3H9NA 3ZIAA 4JX0A 1RUNA 1KFXL 3QH6A 3V65A 1Z78A 5LASA 3ZSKA 3SH3A 3OEHA 4S2GA 3CCUB 3CQOA 5CFCB 5CISA 2DCZA 4H7LA 2ZEXA 3OB8A 2OA2A 3ILNA 4YVSB 3WBJA 4Z07A 4HL0A 1EP0A 3OFNA 4CUBA 2ZGOA 1K42A 4WZFA 3UK9A 4TMZA 4IE4A 2JIZA 1COV3 4BZ4A 1OOPC 4OLLA 4FTSA 4DO0A 1VRH1 1OB2A 2R061 3KCXA 4GXLA 4MGZE 2HMAA 4WVWA 4B3FX 4UFKA 1O7FA 3T2TA 2QDNA 3VKLA 4W65A 2RJKA 2W1WA 1XE0A 2WRAA 3E1F1 4Q2FA 4XONA 1QG0A 1NX9A 3B01A 4RN5A 4AAXA 5DAQA 2J1UA 2DCKA 2XBO3 5KC5A 4XLEA 3WDUA 5IVCA 2XBO1 1DDIA 1WA6X 3TEXA 2GC0A 4XW3A 2XNJA 1ZM2A 3VBOC 3ZSMA 3GIRA 2GN7A 2WYSA 3PDQA 3HT1A 3NV1A 1UZYA 3T1MA 3N4MA 4MHRA 1NA1C 3KF3A 1P8JA 1VBC3 4UBGA 4CSWA 3WW2A 4JDMA 4IL7A 3SQOA 2RHPA 1MS5A 2QQVA 3ZMNA 1VBC1 4AG4A 1NCQA 4QDSA 4BB3A 3WNNA 3ZMOA 4AE2A 1UPSA 3VZJA 1ZM1A 1QKQA 2Q8DA 1GP6A 2QQOA 1PVXA 4AEJA 1VIWB 2AGSA 2PIAA 1PVC3 1VQPB 2VTXJ 1TG7A 2B5OA 3T2OA 2IVIB 2RV9A 1KRIA 1US3A 1KFUL 5JI9A 2RR12 3A23A 5HI0A 3OD4A 3SISA 4BLJA 5C8WA 5DG1A 3ACLA 1OQDA 4D69A 4RDKA 3RJ2X 2W46A 2WN3A 4CCNA 1ASJ3 2OW4A 4N3GA 4TMWA 1IPJA 2HLEA 1DFQA 4BYYA 1T2XA 1A34A 1UW8A 1DG1G 2V31A 3OJBA 3E5UA 1ASJ1 5F3IA 2BBVA 2P4EA 1L3JA 1W6PA 3ONUA 1H85A 1JW6A 3AXDA 2WT1A 2HWB2 3WBKA 1I3HA 1JH5A 3ZIWA 1RHI3 4BLIA 4QHBA 3WG1A 3MZHA 2F4NA 1OHHA 3LEMA 4YYOA 4Q0UA 1RHI1 3LA3A 4OUSA 4OPVA 4YW1A 4PC1A 2WNEA 4FOQA 4MXVA 5GALA 3J7MA 3Q8AA 3NAPB 2IXJA 3ACGA 2XKOA 2X5IA 4IEUA 4RJLA 4DXSA 2W68A 4UOJA 3RWKX 1QDCA 4X6QB 5FZ9A 4EWEA 1ULOA 4UFLA 2IZWA 1WW6A 3PMEA 4MGSA 1NLRA 3DYOA 1R083 1AHSA 3I49A 3SXWA 4D94A 3CC7B 4QPIA 4FP2A 4IV3B 2VNJA 1Q3EA 1H8VA 1DYOA 1OH4A 1DQ0A 5G05L 3KV9A 4ORFA 2WDBA 1RUH3 2PHXA 4IESA 4CDUC 4BPRA 1WCSA 4BISA 1ENSA 4XUPA 1CQXA 3AZWA 3PU8A 3UKNA 2W94A 3JU9A 1W8UA 3CESA 4LIUA 4PBPA 2WNVC 4LKEA 1LTEA 3GHMA 1UU4A 1MEC1 1MABA 3NNJA 2ZKLA 1OFSA 2XHNA 2XHKA 3DYMA 1J84A 5FIXA 1X8EA 4NWVA 5BNPB 1H9PA 2WQZC 5E6HA 3M3IA 4G1BA 2JKXA 1TNRA 5F5QA 3I4IA 3O1MA 5DZGA 3J9SA 4UT5A 1QNYA 2DF7A 1H8TA 3WZ1A 4PHZA 4XOGA 5GZFA 5A7NA 4EZ4A 3HMYA 5FDBA 2M5SA 1UIJA 1PJ6A 3K3OA 2DCTA 1YI9A 2GAUA 3B94A 1I7PA 2VOXA 3VD9A 4YGBA 5BV6A 1UKRA 4CUCA 4QU1A 4EN9B 4Y4YA 3QCWA 3TNQA 1TNFA 4TMTA 3HR9A 5FZDA 3SCFA 2VVEA 5EP9A 4I3GA 2WUHA 3W2EA 4PQ9A 4OHZA 2YWFA 2CHHA 3T09A 2BVNA 4XL9A 4E4DX 3WX5A 3KGLA 3FN9A 4FP3A 1JOBA 2CU5A 4XR6A 1AX1A 1KQSB 4YW3A 3WHUA 2AHOA 3U78A 2WA3A 3VV1A 3MFAA 2VW2A 4FK8A 5HBAA 1S0IA 4LBQD 4BXSV 3ZXEA 2ZGSA 2RS31 4I0BA 5DDJ2 5BSYA 5LZ6A 3OBZA 3BC9A 4XQ4A 4BQ2A 1DGWA 2ZMNA 2A73B 4AI1A 2JD4A 2Y0IA 3QSYA 1VQ7B 2BM0A 4EJRA 4URTA 2WSVA 2JEMA 2YFUA 3K2OA 1RUI3 4LHKA 2MHFA 2PLV3 4L99A 4XKVA 3UT0A 2V4AA 1RUI1 4ES8A 4NRMA 5GKAC 1DP0A 4O9GA 1FX5A 2ZMLA 4Z2AA 2ZL6A 5FYTA 3ZIXA 2JG9B 3HNMA 2FX3A 3OJWA 2D43A 3U6BA 1E3XA 1MRZA 4WM8A 3PU3A 3RPQA 4AVAA 5BXXA 5HV4A 2H0BA 1UIKA 3JBG2 4K9SA 1YJ9B 1HB4A 3I7DA 3LSEA 3ZYRA 4YZ4A 1OF3A 1WBFA 4NHLA 2WNUB 3K4ZA 4AQTA 4BU2A 4XJ8A 3ILFA 1WOOA 3AP7A 2Q0AA 3TN93 4PDWB 1V6MA 4RR3C 3VKOA 5C5TA 1QJX3 1ZRDA 4FQZA 4NRQA 1WW4A 2R071 1RUC2 2QDRA 4LKSA 1H8EA 1RXGA 4LHSA 1BX0A 1JYIA 5FPXA 2GJRA 3Q3AA 1C4RA 4CXWA 4NWWA 2ZBJA 4O9EA 2ZL7A 4K8FA 4E2GA 2WZEA 5K0UA 1BYHA 3NNMA 2EICA 3FFQA 4YGCA 2ZAHA 5FZ3A 5CU1A 3OOCA 3ZYIB 3H8OA 4ZU7A 2X6WA 5ABJB 4OP7A 3AYEA 2WS92 3A4UA 3RFRA 1CPMA 3AL6A 2VYQA 3CJIB 1D7PM 4LO6B 4DNRB 1G7SA 2AH2A 4NIHA 1UY0A 4QXHA 2WSUA 1UD1A 4QDQA 3VHPA 2B7CA 3MCAA 2XJSA 4RD0A 1K5MA 5TV2A 2MEV3 4U36A 3BTYA 4K3UA 5LY1A 5FXXA 2MEV1 2VD7A 1JZ8A 1AR63 2CV6A 5FLJA 3INAA 5DABA 2VNRA 2WC2A 3CMMA 3MBWA 2ZGQA 4FFFA 3NV2A 3RZGA 3E6DA 4MOAA 1CIYA 1XNTA 5FPLA 4UFJA 1H0BA 3SCHA 3VBFC 3WG4A 4LBOA 2X8KA 4L0PA 3ECQA 2YMZA 4Q4X3 4D7YA 3LGRA 4NE9A 5F3EA 2HDNB 5J3UA 4NMIA 1H2LA 3BKZA 1KXGA 4JCKA 1LOFC 4Q4X1 4H55A 2A70A 4CDXC 2ZZQA 1LEDA 2BRTA 4JGYA 4ZS3A 4NIIA 2VH9A 5LRRA 1HXS2 1YFXA 2DURA 1W6MB 3V0AA 4XJAA 4JTNA 2XJTA 1YLOA 5H9PA 4XF4A 1RUD3 4QPYA 3POGA 5K7PA 4LMFA 1NLQA 1R093 1RUD1 5F5CA 4BA6A 5IVVA 3O0XA 4Z4VA 3LIGA 3WCSA 4Y26A 3ZXAC 4ITCA 4FFGA 2EIEA 4OI0A 3UGFA 4AZZA 2JDNA 1LESA 4MYEA 2F4PA 2P3KA 4KGQA 5LK7B 3T56B 4XTMA 3P26A 3IIAA 2PHLA 1HA3A 3W5UA 4NHXA 1VQKB 4ZHNA 3ROUA 2Q5TA 3I8TA 4XURA 4D8MA 3ORJA 4CYDA 5K8SA 4MGIE 2GK7A 2ENRA 2ZGLA 3LEGA 3ZXJA 5GLUA 2C9AA 4P1VA 3RYKA 1QVGB 2VMGA 3OYWA 3CPWB 2I45A 5FLIA 5D8AC 4X05A 4AVZA 2PAKA 4Q27A 1S0UA 2BP6A 4OQ8A 2D6PA 2F6BA 2C4XA 2E32A 4QVJA 3W2IA 1G7RA 4OMCA 2XJVA 3VHOA 1Y0RA 5LRSA 5L73A 4FTBA 4KGGA 3T0AA 4CXYA 5F6LB 3W59A 5J35A 1G86A 3POJA 2LROA 1E79A 5F1RA 1XBFA 4XACA 3KGZA 4XNFA 5A1LA 1VBD3 3KQ4B 2O8OA 2HWE2 1OH3A 3M4FA 1HRV3 4MADA 4NROA 5T5JA 5J3OA 3PIGA 3H94A 2V7VA 1XNAA 1AYN2 1HRV1 2AR6A 5AC92 3ZFEA 1OUSA 2E1BA 3RZKA 1W8FA 4FXKB 4YVWA 4NN0A 1YRZA 3IT8A 3ZSLA 3A0KA 1WTHD 4Q0QA 2WLPA 4UW6A 2YBSA 2ZHLA 4RA0A 4PIYA 1SLBA 3N7JA 1QUFA 3MGUA 1QWRA 1VLNA 3IAPA 3PNAA 1ZZ8A 4QX3A 1EFTA 3ES4A 2HBTA 2WZNA 2BSAA 4CUGA 1WCDJ 4AW7A 5C4WB 4AVTA 2W3JA 2PTMA 4M1KA 3CZUA 3FLTA 4HFSA 5LY2A 5C3PA 4Y22B 4YALA 1CNEA 3FZ3A 3WNBA 2RDSA 4LBVA 3RY8A 1NA1B 2XLGA 2KM2A 2B5HA 4YSFA 2DCUA 2HEVF 5JIUA 3SHRA 4ES9A 3I3QA 3CPXA 2VZ1A 2NMNA 1SLAA 2GNBA 5AVPA 4NHKA 4NUBA 4P5HA 4AL9A 4NBSA 3WF4A 4RFT0 5T5PA 2F43A 2VJJA 3L2YA 5LA2A 1D2QA 2CGPA 3RYPA 1HRI1 2WO1A 1AL23 3HQXA 1XNBA 3JQPA 3WDXA 1CAWA 5F37A 3ES9A 5JZGC 2WPDA 3AM2A 2C0ZA 1QDOA 4OYUA 4XFAA 3AP9A 4XLFA 4YFWA 1VP6A 3T4HB 3AZZA 4LT5A 1FX0A 2DOGA 4P6YA 1QNWA 1W9WA 5FZOA 3U4XA 4N53C 2FDGA 1C1LA 1JXNA 3SITA 3C7OA 4JDNA 2ID4A 1WORA 3KT1A 1XSQA 2EIXA 2VECA 3D0SA 1D2EA 2ZHNA 3HBZA 1HKDA 2BNMA 3ZFGB 4UAPA 3VD5A 5A80A 1YHQB 1K5MC 3G05A 5F7UA 1U5XA 3OUIA 1OGIA 4GD4A 4X8PA 3H0OA 1AZDA 5D21A 3ZYPA 1HDKA 4YRDA 1LR5A 4LBMA 3U14A 2W91A 3MIBA 3PVDA 3HEIA 1BBT3 4RS5B 3DYPA 5F4MA 3KLSA 1BBT1 1BEV2 3LCPA 3MPBA 1MVEA 3GZUC 3LA2A 4XLCA 4RDLA 4L8JA 4AI2A 2R042 2L9LA 5BNQA 3RDIA 4WVMA 2QQKA 5JUVA 3ASSA 1DQ1A 1YHFA 5FV3A 5FUPA 1J3QA 2XH6A 1RUJ3 3QD6A 2QBXA 1MZ6A 3GVLA 4EWDA 3RZMA 1RUJ1 2RMU3 1TTTA 1GOFA 4DQLA 4YM0A 2OZ6A 1SPPB 2W1SA 5HKKA 4PIZA 4QKNA 5GLTA 2OXBA 5LA0A 4QXKA 2VULA 4I02A 4NOTA 3N9QA 2WNVB 3VR6A 4HVRA 5LBCA 4IQPA 2P1BA 3B69A 4I0AA 5FYIA 1UOJA 2VNOA 2C2WA 4YWAA 2D3NA 1RMU2 1VJ2A 5DAVA 4Z4UA 4CP2A 1Q8QA 4A42A 4CEYC 5A7QA 3ZSEA 4TLGA 1ZBE1 4P3YA 3WG3A 1U2RA 1SFYA 3H7JA 1VLYA 1A78A 1C8M3 5EMNA 4LPLA 3AL5A 1UY2A 5EQUA 5KHGA 2C78A 2XL7A 4DIQA 1C8M1 1QX4A 5KXEA 3D8CA 3VO2A 1S4CA 2D74A 1GVHA 1GO2A 4FFIA 4BK4A 2JG8B 3WLUA 1XE7A 2ZBVA 2ZX4A 1CIWA 4OUEA 3S5QA 1CX4A 1I6XA 3A1PA 1OF4A 1DU3D 1V6OA 2WZ8A 1RB8G 2WJSA 5KHKA 4XHBA 2QTWB 2GP5A 3HVDA 1PO13 2LM3A 4KMQA 1NE4A 3WNMA 4DINB 1Q8SA 3VDDA 1PO11 1VMJA 3NE5B 2PQQA 5KXDA 5FO9B 1IZ3A 4P14A 3FWEA 2CNAA 4Q4V3 1N0VC 2CBXA 3ZFEC 3OZWA 2I1LA 3ZYBA 1SCSA 1TME2 1ZVFA 1MACA 1LGNA 3T53B 3C3VA 3B9IA 4C8DA 4CQJA 4WBBA 4TSFA 1G9DA 1RUG1 1GZWA 2QJVA 1T6BX 4DUWA 2D3RA 4JKKA 3KEWA 4I3PA 3DV8A 5A3TA 1WMXA 4XJZA 3AFGA 5DN2A 2RJ2A 3PTYA 1V0AA 4IE6A 1PNGA 1PK6A 5LBEA 1KDMA 4P9SA 2XJPA 2RDQA 2E63A 3I59A 4FPEA 1UWWA 3WDWA 1PMIA 3KWVA 1UD8A 1RUE3 3H1MA 1NQDA 2P3JA 2E9QA 5FO0A 3MW3A 2V73A 3K46A 5I93A 1B35C 1RC6A 2UWAA 2ZPXA 5ACA2 1P4MA 2ORXA 2DVFA 1GU3A 1M90D 2B9VA 4GWMA 3CCJB 2C5DA 3VN4A 1NY72 5DQ0A 2JE9A 4Q4W3 3H9AA 4QPWA 5FXWA 2D97A 4R52A 2BVVA 2NV4A 2C5HA 4Q4W1 5C3RA 4XZUG 2VJIA 4KL1A 1RUF1 4WZCA 3NV3A 3ZC3A 4UW5A 3L2HA 3MLJA 1NAEA 4TT3A 3ZXGA 3WNDA 2RM23 5HCBA 1PX4A 4YW6A 4Y20A 1RUOA 2RM21 4XD7A 2VNIA 3WQBA 4OZXA 2YPJA 4B47A 2J22A 1ENXA 3WDVA 4AF6A 1W6NA 2F1LA 1KDKA 1VBB3 4ATEA 2B39A 1QXPA 3MDPA 3VNUA 5L7OC 2XLFA 4AI8A 2A1XA 5JAXA 2VQUA 2HWD3 4B1MA 3OE7A 1MS9A 4XQDA 4D6QA 3QFRA 2E7AA 4QUZA 2CF4A 2Y33A 3AFKA 3UKVA 1XB9A 1VAVA 4UFMA 1US2A 2HWC1 2CDOA 3EBRA 2TUNA 3VKFC 4Y4RA 4CEWA 2WO7A 4JHTA 1FMD2 3WCRA 4KU7A 4KWLA 1ULEA 4IUGA 1UZ0A 2Z4FA 3R6KA 2HWF2 3DPRC 5KWRA 1DIWA 2CAVA 2O8QA 2Y6KA 3TEYA 2D3SA 5FREA 3HPNA 1UMIA 2X5IB 2GH2A 4RHV2 1LHNA 5FMBA 3MUZ1 5CA6A 3KM5A 5HXVA 3GNEA 1PO22 1DHKB 2AZ5A 5ANNA 4X8IA 4Q8KA 3HNBM 5FZ0A 1IGOA 1MS3A 2CSGA 1ODNA 4CP9A 4HLTA 1G8WA 2XUMA 3W2HA 1EY2A 4OULA 2P17A 1YUDA 4QPIB 2EIDA 4AOCA 1X50A 4AI9A 2DFBA 4G6IA 5F3GA 3EYPA 3O1OA 1K3IA 3IZOA 3I2HA 2HEWF 2VXRA 1AR71 4AQ2A 4ISRA 4DEQA 2Y6LA 1DLCA 2H0VA 1QIQA 1WOSA 5IYNA 3I3BA 2ET7A 4OHXA 4PABA 3O12A 4QGNA 3U2QA 3SH4A 1N05A 1OBNA 3BQJA 3EB7A 1LOCA 2ZKNA 2A5ZA 1N3PA 1ULGA 1TQ5A 2DVGA 4J1WA 4EN6B 1DZQA 1DDLA 4GWNA 1QU0A 1UKGA 4XBNA 3TEZA 2YU1A 5D8AB 1Y4WA 1OQ1A 4H14A 5FJHA 3VBHA 1YJNB 1XXNA 1QJU3 1FNDA 2BERA 4WVZA 3JQRA 3ABZA 4RGAA 1H8TB 1J59A 2ERFA 1TLLA 1QJU1 1WMEA 1JZ6A 1Q8OA 2GJKA 3POEA 3H8XA 3VD4A 1FNZA 1K9MD 4PI2A 3NRUA 3WNOA 4IW3B 3GBWA 4CDWC 3KHCA 4XF0A 2GC1A 5E8AA 4FWTA 4P26A 1DYPA 1XQNA 2LUWA 1IJFA 1F4HA 3BB6A 3CP2A 3IDCB 2RS52 3CCSB 2QQIA 2QFEA 3OOXA 1PGW1 3DXTA 4QX1A 3MIGA 3PENA 1CVNA 3KHBA 1AMOA 5IYPA 2CL2A 2JDKA 3AKSA 3OEAA 3P3NA 4HSLA 4IEXA 1XB2A 1ACCA 5EV7A 3FX3A 3VKNA 4BHPA 3POWA 3I1FA 4MG2A 1UPIA 1IQDC 4FOYA 1HJFA 2YBPA 1PGL2 5I0UA 3MEPA 4A4AA 3J7LA 5FYHA 1S4MA 3IWZA 1W2TA 5IFTA 3CEWA 3WP5A 2DYCA 2GC3A 1DZTA 1YIJB 5BNPA 5DZEA 1REEA 4I2OA 1SKYB 2DTYA 3K48A 4WM7A 4IV1C 3GCWA 2BOIA 3U6KA 3WINE 1ZZ7A 4GKXA 4WM8B 1KTVA 1K45A 2W0XA 3CHXA 3QOPA 5BNNC 4I09A 1BQPA 2VZSA 2VBPA 2J1RA 2C4UA 5FY9A 2R30A 2FZ2A 2D9RA 4C0SA 2VZLA 2D44A 4WQMA 1YIFA 4Q4Y2 1E64A 2IXHA 3G7DA 3RQ0A 4E0FA 4QHOA 1F31A 3ACIA 4R71A 2GMEA 2OX0A 3B9CA 4NHYA 1UD6A 3OG2A 1V9U2 4YZ3A 3NV4A 2D6OX 1DZRA 2YY1A 5IYRA 3WSOA 2RS12 5GZEA 3OP1A 1HV1A 1QXJA 2JJ1A 2EF6A 3LQ6A 1QJEA 4AYUA 5FZEA 1UU5A 3DF0A 5FR3A 3RZHA 3HAGA 3OZUA 1QFYA 3B8HA 2VAUA 2C26A 2CDPA 2TNFA 1YQCA 1H4HA 1XJAA 3NWKA 4QWNA 5CB7A 4PT6A 1GZCA 4MSVA 4MUVA 2DU1A 5A32B 4IERA 3OGRA 1VRH2 2R062 1WBLA 1PZ7A 1HN1A 5IVJA 2OPKA 3RWNA 4MLOA 2F17A 1K5MB 1EFCA 5I0TA 4QX0A 1W9SA 1MS8A 2UYAA 1WKYA 4XDQA 3AJZA 5IYWA 2QVSB 4NAMA 2ADEA 5CADA 2PFWA 3VBRC 3ATGA 2OKXA 2N7GA 2YBKA 1UZVA 1XRUA 1AIPA 5DUWA 4XVHA 3CL1A 4TMVA 2KA3A 4TXWA 3MHPA 4PDWA 2R49A 1ZYBA 2XBO2 3RZLA 2IXCA 3ZYFA 3S57A 3O5SA 5GM0A 1YI2B 4O65A 3NO8A 1RTVA 3AP6A 2VO5A 1E1QA 3GVJA 4I30A 4JGYB 3J8F2 3ZXFA 4DB5A 3VGIA 2QTLA 2WN2A 2JB4A 1JZ7A 3OPZA 3IB3A 1IS6A 2JDUA 4COZA 1V6KA 3RGBA 1G7CA 1QVFB 3DL3A 2BVBA 4LXLA 1K73D 1UYPA 1H2MA 4UAJA 1SFPA 3M1HA 1ZBA1 3BIEA 5DSZA 1AUYA 1MZ5A 2BDRA 1XNDA 5FY1A 3S30A 1XPWA 1OA3A 4GWJA 4C1WA 1C8NA 3J26N 4IEVA 1O3QA 4XORA 1BMFA 4AGRA 2JWPA 3ZFFA 4ACAA 3MIDA 3G4SB 4CEYB 2BYVE 5IVFA 3LVBA 4RQPC 4UZEA 2WINB 1WLCA 1R5BA 4QHYA 3BIWE 4BWOA 3CF6E 3TAYA 3CMGA 1C3HA 4N7UA 1OURA 2DYIA 4NR1A 3OYWB 5FY4A 3SKBA 3QE2A 2ZX0A 3LDBA 4FPOB 1FAYA 2LS6A 3GVKA 3UKTA 4B4DA 1W6OA 2HKXA 5FWEA 4XFFA 5BY5A 2VW1A 1SBEA 2DTWA 3CLPA 2WL1A 2P6CA 3WG2A 3PUHA 1TMF1 5FZLA 4AEDA 3AYAA 1V6LA 2WZR2 4MX3A 4QX8A 1RHI2 1SACA 3JQWA 4G9SB 5FMOL 2BF4A 2X0KA 4Q0VA 1D2SA 3AVWA 3BOPA 4II2A 4CCKA 1D4M1 1N3OA 4TTGA 5FZCA 3GGLA 5FXZA 1EV11 1VBA3 4BMEA 2A3YA 1LHVA 1WA4A 2BGOA 5BNOC 1MQTA 2EXKA 4NAOA 4DRVA 4E2SA 1VBA1 3ZFEB 3I2DA 1U5ZA 4YVWB 3AGQA 1SLCA 2B7YA 3PVNA 3THPA 3GALA 4RD4A 4YW4A 3B3QE 1C28A 1LEMA 2BWCA 4HPKA 3M3EA 1D1NA 5LA9A 3OCPA 1F15A 3HT2A 3AZXA 4RDJA 1WSVA 3UYJA 4XBQA 1W0JA 4B3GA 1W03A 2D6NA 1OVSA 1COWA 4JGZA 3NKGA 1LRHA 2ADDA 4LO7A 4Q26A 2QN6A 2W1UA 4XJUA 3S7EA 1Y9MA 1MEC2 2AEZA 2CAUA 5L9VA 4E4ZA 1BQEA 3WP4A 1IPSA 1S2EA 2KD7A 5JXHA 1BX1A 3G6JB 2VMEA 1F35A 3SKJE 3GYDA 2ZOEB 1QMJA 1W8ZA 1SEFA 4XUTA 4Y9UA 2PAMA 1LECA 1IG3A 1UAIA 4GJYA 3E5QA 4LBWA 2QQLA 4CCDA 4CPBD 2KVOA 1UOGA 2XPJA 1OOPA 1H1IA 5J37A 1BZWA 1ZA7A 1FV3A 3ZSJA 1E63A 5FBJA 2XG3A 1KZLA 4LUKA 3BI3A 3FUQA 1CAWB 3BVCA 1JYWA 1JS9A 3V64A 3DGTA 3CTAA 3GQBA 1L7LA 5L7OB 5FYBA 1KC8D 5FZ4A 4B3XA 5FZOB 1R5NA 2YC4A 5KC6A 4KWKA 2OBTA 2P3MA 5KXBA 2BGPA 2VR4A 5CEHA 4GB32 1VPHA 2VC9A 3ZN6A 2XGXA 1Q8PA 1QOOA 4QVAA 3T1LA 2RS32 5I8SA 2D40A 4PGOA 3F95A 4ZKTB 4RYDA 1LGCA 4Z1VA 1JZ4A 4Y22A 5FWJA 3VBOA 2W47A 5FZ1A 2ZS6B 4Y7CA 4BQXA 3DPRB 4KNCA 1YJKA 3O1SA 1NA1A 2B8MA 3WYAA 4P9IA 3HD8B 3PUSA 3BTXA 3JBG3 3U0ZA 1LAJA 3ZDVA 5FOJB 2KR2A 1R1A1 2JDZA 3D26A 4JKMA 3JBG1 1UYYA 4UWDA 1OD5A 1OPOA 3OUHA 1LHOA 1XE1A 4P9GA 2UURA 3WDTA 2PELA 2JDAA 4B4QA 4B4PA 2Q1MA 4WVMB 1YEWA 3NKTA 1U12A 3RRDA 1RUC3 3AVRA 1IOAA 1O3SA 2VNKA 2XVGA 2R9VA 1GP4A 1RVF2 1AR92 4R9CA 1QH0A 2XB6C 4TMXA 4QPGC 2R072 2W39A 4COUA 2ARAA 1DG6A 1QGYA 1F5FA 2VBTA 4BE3A 2DY1A 3QFTA 1MPXA 3U07A 2CRVA 1URXA 3TEWA 4GJZA 2VPVA 2Z79A 2W92A 3K4DA 2WFF2 4MXWA 2WS93 3VLBB 1D4VB 2XWBB 3DUIA 3WDYA 3EXUA 3P5BA 1XU2A 3N9OA 3FLRA 2C77A 5F6KA 2XGJA 3POBA 4IDZA 2C4TA 5C71A 1FPN2 3FBYA 4PJYA 2BFUS 1GV9A 5FUIA 3BUCA 3AMNA 3USSA 4X7FA 1W6QB 3O7OA 4AFCA 1O3RA 1YX2A 2VUCA 4QGMA 4YM3A 2OZJA 4QQHA 3UGGA 2VOWA 5C8CC 3E5XA 2VMCA 2Y38A 1Q8VA 3FHAA 3HBKA 3IDAA 5FLHA 4XTPA 5FZ8A 1DLLA 2Q1ZB 2UYBA 4A41A 4X6RB 2P34A 5HV0A 1OB0A 2R16A 4A2UA 5FIUA 1YFYA 2EAKA 1TEIA 1PM7A 4X07A 3VDAA 4YAOA 3N7LA 4B29A 5LA1A 4YEJA 2BV3A 1NLSA 4GA9A 3BNWA 1IQAA 4ZU5A 5T52A 3J4UH 4KBZA 4P08A 3RI8A 2QGGA 1QFZA 2BPA2 4BQ5A 3WNXA 2EALA 3N7MA 3UESA 5A33A 5EJ3A 3PVEA 3VDDB 1CONA 2BBAA 1HXS3 4CDUA 4R8HA 2P3YA 1HXS1 2WQ8A 3S5AA 1UMZA 2BTVC 3GF6A 2WNVA 2FDHA 3A7QA 1GZWB 1UY1A 5F39A 2VBSA 3AYCA 4M0NA 3NQHA 2C6SA 5LATA 1XYOA 3LEKA 2JIGA 4XHXA 1AR81 4AHWA 4UZUA 4LLFA 4C0BA 3KT4A 4AFBA 4AHZA 2VUJA 5C9AC 4BQYA 1W3VA 3LDRA 4BMBA 1PK6B 4P02B 1V00A 5JSPA 3USUA 3PLQA 2B45X 1CD3G 1ND2C 1Y7BA 3WR0A 5KW9A 2VU9A 1EXMA 1VAKA 3ASIA 4X7CA 2LW8A 2DUQA 1VRBA 4IXLA 3H50A 2XQXA 1QJFA 2GNMA 4Q1RA 1LOGA 4AC9A 2J1VA 2UY9A 2EIBA 4FAHA 1KJZA 3MI8A 2XZLA 5FZMA 4DS0A 1UF2C 4KBBA 4DY5A 5FA6A 1IPKA 1CPNA 2HWE3 3NNFA 4H2AA 2X53S 3LFIA 4GULA 2DVDA 4Y20B 3W5VA 1KS4A 1COV1 4HIZA 3LF7A 4P12A 2DVAA 4AVBA 3JQXA 2HWE1 1AYN3 3GZTB 3OSDA 5G04L 5AC93 1W6NB 4QD2A 4DEVA 1AYN1 4IEPA 3LPGA 5I91A 4BQ1A 3EO6A 3ST7A 1ST8A 4WWVA 1UZZA 3POFA 2QQMA 4LKFA 1GZTA 3NMBA 5AVAA 1RJ8A 1N1TA 2OK8A 2VCMA 1D0HA 1VAMA 1UD3A 3B78A 2HBUA 2VXJA 2PN5A 2IFWA 2Q6LA 4JMQA 4RFRB 4CDQC 5ANQA 4Y3OA 1EUTA 1EYBA 4ZV4A 5JI7A 4W4ZA 3ZZUA 2WWUA 5THXA 2H6CA 1RYYA 4CEWB 2R32A 2OYNA 3B82A 3SLDA 2NPIA 4QGLA 2K9ZA 4RR3A 5A6XA 3VBSC 2JB8A 2VZOA 4ZONA 1K12A 4QV2A 3A0NA 5A1FA 5IW0A 4XKWA 1H4GA 2Q8CA 1GQHA 3WVJA 2JKBA 2VZPA 1K28D 4CP9B 1Q43A 2YXSA 1UX7A 3UJOA 4JDOA 1UYZA 5BPXA 1XYNA 2TBVA 5B6IA 1E5RA 2PHTA 2MPFA 4Z4TA 1CN1A 2GQFA 4GZ9A 1PVC1 3WQ7A 1AJOA 1JYTA 5F3CA 5FRAA 5A6QA 2ZGKA 1HRI2 5T5LA 2VZ3A 3FUOA 4XC9A 4IEYA 3AMHA 2G1MA 2FBEA 4QKBA 1UY4A 4D0QA 1NUKA 5CFCC 2FHRA 3IM0A 4RQPB 2FDIA 3WXPA 4YVSC 4BIOA 1KS5A 1VHEA 1KMHA 4TWTA 4UBHA 1YJWB 4JC1A 5CFDC 2ARBA 1OLRA 3OKXA 3A21A 3WF2A 3SNMA 3HQRA 4RGGA 1NXD1 4B43A 3VBFA 4RCZA 2R0HA 2LZJA 5JWPA 3VBHB 3N9NA 4OFGA 2GNTA 3TWIA 1UD5A 3ZO0B 2OYZA 3ES1A 2AENA 3CCMB 3BCWA 3EQEA 4HN1A 4FN5A 4OPOA 2NMOA 3LAGA 4YPJA 1LOFA 2BW8A 4Y1UA 4HK9A 1XNKA 4EZHA 4CDXA 1MVQA 4LK6A 1BEV3 2CY6A 2R7EB 1PJ7A 4F8AA 3ZZ0A 1JJ2B 3ZYHA 5LCWL 2BV4A 2EIGA 1AVBA 2TEPA 4LA2A 2R043 3CO2A 4ISQA 2DBIA 2JDIA 1EFRA 3A8JA 4M2LA 4G7XA 3E1YE 2PHDA 1HX6A 1R081 2VZQA 5BNOB 2BNOA 4AAPA 3NSTA 3I2OA 5FMCA 5FP9A 1W8NA 5FYZA 1YFWA 1RUH1 1WD4A 4N43C 2BM1A 4S2DA 1OD3A 4JRAA 1W35A 5CG9A 4L92A 4EE2A 1BLZA 4XFIA 4S2HA 3A22A 5L9BA 2X85A 4NJ4A 1WLTA 2QQNA 1ND3C 1WOPA 3FPPA 2OT7A 5C70A 4UW3A 2NYYA 4P9WA 2XJUA 4D7SA 4F7ZA 3ASPA 3KT7A 3IKWA 2Q30A 5IK4A 4P6VF 2JDYA 3CNAA 4WM7B 1RMU3 3I54A 1UD4A 5D8AA 3D6EA 2XEXA 4QHZA 1LKNA 4FPKA 4FPFA 1DYKA 3ZLIA 3IIIA 3EHKA 3TNPB 5IVYA 5T55A 2XJRA 4SLIA 1NCRC 3CMAB 1O8PA 4N9IA 3X29B 1ZBE2 4P5YA 2UY8A 1W2NA 2V7QA 2B7BA 4Z4WA 3O1PA 2FDKA 2J7MA 3GBGA 2JDHA 2FQPA 2WSSA 4XOPA 5DMYA 3AC0A 3D0JA 4CPBA 4GAZA 2W52A 4IW3A 1BVVA 3HOBA 1XC6A 3WP3A 4XDOA 4RPBA 4JVAA 4UZFA 1G6NA 2ETEA 4Z2WA 1VLOA 2V72A 4V2VA 4B7EA 1WD3A 2X05A 4PI0A 1W3XA 3NAPC 3A3BA 3SMHA 2A7AA 1GR1A 4M4PA 4XAAA 3EJKA 3RVHA 5SV8A 1R5OA 1AX2A 4HVOA 4JKLA 2XNDA 1TME3 3NJVA 3T08A 1SM4A 3AVTA 2PLV1 1XFOA 5BSXA 3CKHA 4IV3C 1WGPA 2NLRA 3D3AA 1KITA 2IXLA 1RUG2 5EPAA 1NZCA 4L8QA 5CDFA 1Z0HA 4E4HA 3JZVA 4XE9A 5T50A 4GALA 1BMV1 5CKQA 1WLDA 4Y33A 2ZZFA 2OS2A 2AYHA 4LE3A 1OFNA 1N1VA 2V4VA 5JDBA 4DPNA 3U10A 3WNCA 1VB2A 3OD0A 5F4OA 4IEOA 4CZSA 3SLIA 4EQVA 4FSJA 5GV8A 3TN91 5CBLA 5ACA3 1QJX1 2E53A 1YI7A 3WUDA 1FNYA 3Q8CA 3O0WA 4LULA 2ZZJA 1OKOA 2RVAA 4JZRA 2CW5A 1NY71 3ZXDA 1W2AX 4QXCA 3B02A 1J3PA 5L19A 2J1EA 2VMHA 3I97A 4N9HA 4Y1YA 5JZGA 1JU3A 1BCXA 1O5LA 1I1EA 2YHJA 4B44A 4YARA 4XN0A 1QY4A 4GMP0 2WR8A 4Q4W2 5DAXA 4N53A 1WUVA 1QJY2 2HJIA 1RUF2 1YQ5A 1JMUB 4UFHA 2ZXIA 4EH1A 1Z7S2 4UI9L 5H9RA 2FDJA 4MZUA 2IVJA 1YNAA 5A32A 2J42A 3U11A 1KJRA 3CCRB 4Z82A 4GKYA 2D98A 4YGDA 1CESA 2V5DA 3ZFFB 2XOKA 2ZX2A 4CTEA 3WQ1A 5JOYA 3RNSA 1FI2A 4UF0A 3DECA 1NDHA 1ONAA 1AR61 5IT6A 5EWSA 4UW4A 4LIVA 2VW0A 2YB7A 5DAPA 4AF7A 3HJRA 1FMD3 4K1YA 1BXHA 1W6OB 1YO8A 5APAA 2HWF3 4M00A 1W39A 1FNCA 1FMD1 4NRPA 2HWC2 1I9RA 1OVPA 2HWF1 4OI1A 1UOBA 3SJPA 1S1AA 4AEDB 1OXCA 3ZXKA 4RHV3 4LO4B 3SKVA 3AGPA 2OBRA 1GJRA 2SLIA 1E5HA 3LEIA 1FYUA 5FPAA 4GMP3 1PO23 1F4AA 1VQ5B 3ZBUA 3W20A 2JG9C 4CU8A 3JU4A 4Q0SA 4K1XA 4GMP1 1PO21 4XF1A 1IKPA 1QF3A 1EPWA 1MQTB 1RIRA 1OB5A 1YJLA 1D8TA 1UXZA 2YYOA 1JN2P 3LSDA 4XLAA 2PMDA 4M4SA 3QFCA 2WNUC 1MS4A 2QMUA 4LQRA 1R091 2ZACA 2P37A 1LU1A 3THCA 2HYXA 3MF6A 1FXZA 2K2SA 4PC3A 2WA4A 1KK0A 4HSJA 5FTTC 4HPKB 3T51B 3ZBTA 2BQPA 2WZPP 5FO7B 3VBUA 2CGOA 4CEYA 5K4LA 3AB0A 5JVVA 3THDA 2D5HA 2D93A 4M4RA 4FPLA 1AR72 3SC7X 5JXIA 1Q56A 1Y9QA 3VZKA 4JGZB 3VUOA 3GHNA 2NM1A 2J1SA 3POYA 3S7IA 5ABJC 5FPZA 5A6YA 1QH6A 2OPWA 1JHNA 1A8MA 1ND2B 1W06A 4XFGA 3CJIC 2OBSA 2K0GA 2VZVA 4RPDA 2A6WA 2Q1FA 1N1SA 2JJ6A 2O0OA 5EIYB 4ZXKA 1W90A 3VL8A 5JPNB 3GZAA 4ZU4A 5C6CA 4CU6A 3M2MA 1WDTA 1VBD1 1QJU2 5LB6A 2F4LA 1OOPB 3OZVA 4LLOA 4XILA 5FCCA 1NB9A 4FO9A 3I3EA 3JUUA 4C43A 1O4TA 5C3SA 2A3WA 2YGMA 3I3MA 2DIEA 3WUCA 3OTFA 2GPJA 2RE9A 2VVDA 3A35A 5FYCA 4M01A 3KVAA 4RD2A 1JTZX 2RS53 1K5JA 3MPPG 2R6HA 5A7WA 3M7AA 4META 1GFF2 1SLLA 4JRLA 2VY0A 2R0FA 4GIQA 1ODMA 1JYVA 3WF1A 5JIAA 1GWLA 2DERA 3ZN6B 3LA7A 3FJOA 4NHMA 1JA0A 5EFUA 3OEEA 4CDQB 4LE4A 4FPYA 3PIJA 4A7YA 5FK7A 2UU8A 5FPUA 5J7MA 1GAWA 4MGKE 5FPVA 5A3MA 1OQEA 1PGL1 1S2BA 3VBOB 1GNZA 3ACFA 1MS0A 2YG0A 5FY7A 3VB9A 4AHXA 1B35A 4XMYA 4XETA 1VR3A 3H7YA 2W08A 2VZTA 3VBSB 1A8DA 3RMXA 3KL9A 4O7XA 2YGLA 3MYXA 1CZSA 3AP5A 2QZ3A 5HPOA 2FCTA 2ZL5A 4ARXA 1A6CA 4Q4Y3 1E3ZA 3ZUGA 1GICA 3N7KA 2QUOA 5FZHA 2QNKA 3PUAA 2XDVA 3M3CA 1SQ4A 4Q4Y1 3DCQA 3FHIB 3OEBA 1AX0A 2OTLB 3MMPA 1U5IA 4DUXA 2ZHKA 1V9U3 4KKTA 4XJ9A 4XIOA 4V2WA 1AL21 4CE8A 1OUXA 2RS13 4NO4A 1REDA 1N3QA 4TSVA 4ASMB 5C3OA 3WD5A 3VZNA 5L7OA 1R64A 4C91A 3DDYA 3MF9A 3APBA 4XQWA 1CNFA 1DGLA 4AWDA 2A3XA 1QXRA 5JLVA 4MXWB 1LJ7A 1SLTA 1F60A 4QM9A 5LW9A 4R9AA 1N08A 4XEZA 4B4RA 1CAVA 4D6RA 2PHFA 4QQLA 3SEJA 1VRH3 2R063 1YYNA 5CFDB 3ASQA 1JI6A 2P6HA 3IMNA 1WU8A 3ILRA 2ZABA 3DPRA 4XXAA 2OQ6A 1E5IA 4QKDA 2E6VA 2WO3A 5IK5A 3TOJA 3ZKYA 1T6ZA 4K20A 3C7FA 2W5FA 1J3RA 4PIXA 3QH7A 4CCOA 2O14A 4HK8A 3WF3A 4NIGA 4Y5SA 1H1MA 4Q7JB 4BH9A 1L7QA 5C4WC 2ZHMA 1O5UA 5FZIA 1L7RA 3SH5A 4AQSA 4CP0A 4EWAA 3AVXA 4UXAA 1ALYA 4ROXA 3ASRA 1UCXA 3NVCA 2GJPA 1Y9GA 1N07A 2D3PA 5A33B 1W8HA 3U37A 3J8F3 2VVFA 2RMU1 1M06G 4CDUB 4FOWA 3OBRA 3ME2A 3SLNA 5B4XA 3OBAA 1VQOB 3J8F1 3NJZA 5GLZA 4N43B 3TYJA 1F2NA 5EZWA 4TYSA 5EHDA 1AXYA 1QH7A 1RQRA 1VB4A 1JYXA 1ND3B 3MW2A 5J48A 4YXWA 3T0BA 1VF7A 4MO3M 2OIIA 4CCLA 4JQTA 1M1KD 3VBUC 5IHRA 4CCEA 1W6QA 1JB9A 3GM8A 1JYNA 1WSRA 2P5BA 3DKQA 1ZBA2 3UNPA 1DGWX 3ZR5A 1JZ3A 4NCNA 4PCRA 5JR7B 4LHNA 3IPVA 3KCYA 2IC1A 5A1AA 2IWGB 2XKPA 3USUB 1JUHA 3I3DA 3OGGA 1NCRB 4AFDA 3E6BA 3V76A 1DGRN 3VD7A 5FBZA 4G1VA 2C9KA 4LOSA 3BCDA 3T4VA 1UD2A 2J7KA 5L46A 1X82A 2G4IA 3LO8A 2A71A 1GBGA 1VMFA 4TN1A 2GNDA 2VQ0A 2ES3A 4ONUA 5LWBA 4QX7A 4YZ5A 1O8SA 3CJXA 1TZOA 4ZPIA 2YWGA 4OZOA 4CDWA 3BODA 3ZFGC 1VBE2 5FPBA 2ZX1A 3RZZA 3AVYA 1QGLA 4R4ZA 2WZR3 3R05A 1ZZ9A 4IEQA 5KHJA 4RD3A 2QQJA 2WZR1 5I0RA 3ETPA 2PHRA 3CC4B 1TMF2 2A6ZA 4BPZA 4LBQA 5HCHA 4U2AA 5A70A 3VHRA 4O61A 4Z8BA 3ACHA 1OSGA 5JCTA 1NJID 5T54A 4RS5C 5A3UA 1WW5A 4Y1VA 1YQ8A 4TLFA 4Q4V1 3FE5A 1POV0 1UZWA 4G3YC 2ZGPA 1D4M2 1T6YA 3KV5A 2Y6JA 2QA4B 1EV12 4P22A 1LULA 3JD72 4FXUA 3WY6A 2YC0A 3AMMA 1QGAA 1AJKA 1X33A 3ENRA 3CXCB 2BGJA 4WZEA 1TVCA 2EXIA 1VBA2 4HOOA 5A3PA 1KEXA 5IAVA 2V09A 4IV1A 4DFSA 1LOAA 1UYXA 4FAGA 1ZRIA 4AQ6A 1W28A 5BNNA 5HZAA 2V5YA 2FVGA 3R4SA 3ZXLA 2Y64A 2G9FA 4WZKA 3W2GA 1RUE1 2WABA 1E43A 4II3A 4P9YA 3I2IA 4RR3B 4BXFA 1QEXA 3I2JA 1MEC3 2B4KA 4PC7A 1LU2A 5J36A 1G9AA 1HVXA 2WIIB 3T3YA 1ZUNB 2CWSA 5FJKA 1S2KA 3OY8A 2JECA 5A88A 4LOTA 4XBLA 1RITA 5JXJA 1B09A 2X6YA 1YIPA 1WMFA 5DXDA 3IDEA 1OLMA 1UMKA 1POV3 4H7MA 1VQMB 2XOMA 4KG0A 1W8TA 4OHVA 4Q0PA 5C7GA 3BY1A 3ISXA 3W9AA 4INDA 1K8AD 5A6ZA 1POV1 4KKUA 1GQPA 1YCIA 1PMHX 1QUEA 4XYXA 1G9CA 2JG8C 4XAEA 3E97A 4BM8A 1IG0A 3LKJA 2BPOA 2XXZA 3ZKUA 4BCUA 1VBB1 1QOTA 2I2SA 3PURA 4Q5OA 1F5JA 3PUMA 4YZ1A 2HWD1 4B8EA 3FJSA 5FO8B 2W87A 3HIFA 4FOVA 1DDGA 3PL0A 1WPCA 1KRHA 4GB33 4BK5A 2Z2SB 2H6BA 3T0DA 3V0BA 2VBVA 4GB31 3VBRA 1XOYA 3J7NA 5FOBB 4FXGB 2RS33 5JSOA 1ZNPA 1O4ZA 1FOD2 2A6XA 3VBFB 3WNPA 4KKSA 4N8MA 4GH4A 3SCGA 2NQYA 1JYCA 5LBFA 4AEKA 5IVEA 1VQ8B 4RD1A 3RMYA 2WNOA 3A8IA 2BWAA 3CZJA 4YG0A 2I07B 1S0DA 5JR2A 4XZPA 2IFRA 5J98B 4MGYE 4CDXB 1ZRRA 5KHHA 2ZZGA 1YQ6A 1AYM3 1PIV2 2C24A 5E88A 5HXBA 5A8AA 5LEJA 1GOHA 1VQ6B 1ZZCA 4MGTA 1R1A2 1AYM1 4QT6A 3WHTA 2ZITA 3ZZTA 4YM1A 4P3IA 4A45A 3AVSA 1O59A 4B1LA 4PAAA 2PHUA 5J1XA 3RYRA
chains in the Genus database with same CATH topology
2VECA 3D0SA 1Y7BA 3WR0A 4Q4V2 1BKZA 2VU9A 1VAKA 2ZHNA 3HBZA 1RVF3 3JD71 1AR93 1GQGA 4XMAA 3ASIA 1C1FA 3JCIA 4P9XA 4J1XA 1HKDA 2BNMA 3ZFGB 5J96B 2DUQA 4QMAA 2GK6A 4AGGA 4IXLA 1DBNA 3H50A 3HN1A 1K5MC 2R073 1RVF1 5LEKA 1W9XA 1AR91 1KJLA 1HQLA 4MV2A 3G05A 2GNMA 4Q1RA 1LOGA 4AF9A 1Q5OA 1U5XA 1LHUA 4WV8A 1I18A 1W0KA 4X8PA 3H0OA 4QU2A 1AZDA 3ZYPA 1HDKA 2UY9A 2QQPA 4FAHA 2IXIA 1H2NA 1NCQC 4KG8A 5CVRA 3MI8A 4RD7A 4YRDA 2C1FA 2XZLA 1LR5A 4LBMA 1UF2C 1RL3A 2CTVA 2D6KA 4DS0A 2B42B 4G7WA 1CAXA 4KBBA 3MIBA 4DY5A 4RQPA 3B00A 1IPKA 2WFF3 5GLWA 1BBT3 1CPNA 4RS5B 1EAH3 2HWE3 4QQPA 3KD4A 2X29A 2HLDA 4DK1A 2X53S 4GULA 2DVDA 4Y20B 4KU8A 1KS4A 2WFF1 3KLSA 1COV1 4HIZA 1BBT1 1BEV2 1E57A 3LCPA 2DVAA 4AVBA 3MPBA 1EAH1 1MVEA 3JQXA 2HWE1 5EYYA 4L97A 3GZUC 3LA2A 4XLCA 4L8JA 1X36A 1FPN3 1AYN3 5ACA1 4ASUA 4AI2A 2R042 2XL9A 3GZTB 3V56A 1OKQA 5AC93 1HV0A 5BNQA 1W6NB 3B7MA 3RDIA 1RUE2 1SCRA 4QD2A 5BNPC 1FPN1 4WVMA 1AYN1 4IEPA 1CAUB 5I91A 4BQ1A 5JPMB 1KQRA 1DQ1A 1OPMA 1YHFA 2ARXA 3EO6A 4WM7C 1J3QA 3ST7A 4QPGB 2XH6A 1G7YA 1RUJ3 1F8VA 2WLQA 3QD6A 1UZZA 4AK3A 3AJYA 4PBOA 5JOZA 1MZ6A 3GVLA 2GZWA 5AVAA 4EWDA 1RUJ1 4HZFA 1RJ8A 2AREA 2RMU3 1N1TA 3PMSA 1D0HA 1VAMA 4LR4A 2B9UA 1UD3A 2R6QA 4LBNA 2PN5A 2IFWA 3H3ZA 4XXPA 4JMQA 4YM0A 4CDQC 2OZ6A 5HKKA 4PIZA 4FPGA 2QKDA 1EYBA 2Z69A 5JI7A 1VALA 4IETA 4QQ2A 5GLTA 3OF1A 4EN8B 1WW7A 4QXKA 2H6CA 2QZ2A 1SBDA 4CEWB 2R32A 2VULA 4I02A 4NOTA 4P9LA 1T6GC 2NPIA 1KD7A 2RM22 5BNOA 2WNVB 3VR6A 1FATA 2UWCA 5DZFA 4HVRA 3K51A 3AX4A 2KXLA 2OUJA 4E9KA 2I74A 4QGLA 4IQPA 2K9ZA 3B69A 1J1TA 3BALA 4HMZA 4I01A 4RR3A 5CNAA 3VBSC 4I0AA 2Z42A 2VNOA 4OVEA 3AP4A 2D3NA 1RMU2 3NL1A 1AF9A 1VJ2A 3KZ4C 3A0NA 2YZ4A 3FKSA 4AFMA 5C33A 5C8CB 3MIHA 4CP2A 1Q8QA 1VBB2 4CEYC 3ZSEA 2QCSB 1ZBE1 2X5IC 4XKWA 1H4GA 2ZGTA 2RJLA 1QQP2 3WG3A 3OW7A 2YROA 1GQHA 1SFYA 2HWD2 3H7JA 3B5LB 1VLYA 1A78A 3IN9A 3WVJA 1C8M3 2JKBA 2VOKA 2GMMA 5KHGA 2D5FA 1K28D 2WJYA 1Q43A 2XL7A 4XFBA 2YXSA 3Q9OA 1C8M1 4HN0A 4QQOA 1MZFA 3UJOA 4JDOA 2ZTGA 5KXEA 5BPXA 1FOD3 3D8CA 3THTA 3WW1A 1XYNA 2TBVA 5E89A 2VQAA 2ZGRA 5DN6A 2PHTA 5HCAA 2MPFA 1S0BA 2JG8B 1OLQA 3WLUA 1XE7A 3ZPYA 1O3TA 3JB8A 1CN1A 1FOD1 1SDWA 1PVC1 1SFNA 2DUOA 3WQ7A 5I8TA 2ZX4A 5C4WA 4QPIC 1CIWA 1AJOA 1N47A 1NRKA 4RHV1 4TKOB 1CX4A 1I6XA 2OVUA 5FRAA 4COVA 4F83A 1DU3D 4M0HA 1U5YA 2GALA 1VJSA 1V6OA 2ZGKA 1HRI2 1RB8G 5T5LA 4M3CE 3VZOA 2WJSA 2SBAA 5KHKA 4XHBA 1PIV3 3FUOA 1AR82 5DUVA 4IEYA 3AMHA 2GC2A 2FBEA 1PO13 2LM3A 1NE4A 1R1A3 3VKMA 1PIV1 1V70A 5CFCC 2FZ1A 2FHRA 4DINB 3IM0A 1PNFA 3BTAA 1Q8SA 4RQPB 3WXPA 3VDDA 1PO11 4YVSC 3NE5B 4BIOA 3PHMA 1KS5A 3FMGA 2PQQA 1KMHA 5KXDA 4K6BA 4TWTA 5FO9B 4HANA 4UBHA 1IZ3A 4P14A 3FWEA 2CNAA 4N7IA 4JC1A 4Q4V3 3PVOA 3AMQA 3ZFEC 5CFDC 4LEJA 4PDWC 4XOTA 1AYM2 2ARBA 1OLRA 1SCSA 1TME2 5KHIA 1ZVFA 3SNMA 1MACA 1LGNA 3T53B 3C3VA 2EVXA 3B9IA 4RGGA 4XIKA 1NXD1 3ETQA 4WBBA 4TSFA 3VBFA 1G9DA 1HZEA 3WW4A 1RUG1 1GZWA 2R0HA 4DOUA 2LZJA 1V6JA 2QJVA 5JWPA 3R4UA 3VBHB 2D3RA 1QOSA 4OFGA 4XFCA 2GNTA 4W6YA 3TWIA 3KEWA 4I3PA 3KMHA 4Z92B 3DV8A 4JV4A 3P3PA 1UD5A 4AFAA 4EV0A 2Y0OA 5C9AB 5GZCA 5JZGB 3ZO0B 2OYZA 3ES1A 2AENA 4XJZA 3AKRA 3BCWA 4YW2A 1NXMA 3EQEA 4HN1A 5H9QA 2NMOA 3LAGA 3AFGA 1SBFA 1LOFA 4FTEA 5GZDA 3PTYA 4XF9A 2BW8A 1CJPA 1PNGA 4WVVA 4Y1UA 3LOIA 4HK9A 1H8TC 1BPLA 1XNKA 4N53B 3R6SA 4CDXA 4OI2A 1PK6A 4EN0A 1A3KA 1MVQA 1OA2A 1BEV3 2CY6A 1KDMA 2ZMKA 4F8AA 2P3IA 2XJPA 5E16A 3ZX7A 4Q29A 2E63A 2EIGA 3I59A 4FPEA 1AVBA 2TEPA 2V4DA 4LA2A 3O14A 2R043 3CO2A 1H9WA 1CR7A 3WDWA 4ISQA 2JDIA 1EFRA 1PMIA 1UD8A 5T5OA 5GZGA 4G7XA 1RUE3 2PHDA 3H1MA 4HETA 4PLNA 1ZRFA 3CP8A 1HX6A 1NQDA 2P3JA 1R081 2E9QA 5F9TA 1COV2 3AZVA 2XVLA 5J09A 1ULFA 3MW3A 5BNOB 2OUHA 1EAH2 2BNOA 1QHDA 1GR3A 2V73A 4LBKA 5I93A 1B35C 3BOWA 1RC6A 2UWAA 2ZPXA 5JOXA 2ATFA 2XLAA 5ACA2 1LCLA 2G9GA 1V0FA 2DVFA 3NSTA 1E1RA 2MNGA 4GWMA 3ZFGA 2C5DA 3VN4A 1NY72 2JE9A 3BU7A 2WWSA 4Y1XA 4Q4W3 3H9AA 3N3HA 1YFWA 3ZFFC 1RUH1 1WD4A 1IS3A 5GLVA 4N43C 4S2DA 2D97A 1AL0G 1QJZA 4R52A 2BVVA 5FMOS 4LBJA 4JRAA 4Q4W1 5CG9A 4L92A 4JTOA 4XFIA 2VJIA 4KL1A 4S2HA 1RUF1 4WZCA 1C57A 5JOWA 3NV3A 2E7TA 3R4DB 4UW5A 2X85A 3LB9A 3L2HA 2ZGMA 3MLJA 4GQNA 4TT3A 1WLTA 4GH4C 1ND3C 3ELNA 3H1WA 3ZXGA 3FPPA 1BK1A 1MR5A 2RM23 4K21A 3LWCA 5HCBA 2Z6BD 4RS5A 4UW3A 3KS7A 2NYYA 3QACA 4P9WA 2XJUA 3WT3A 4D7SA 2XZOA 4Y20A 4F7ZA 1RUOA 3KT7A 3IKWA 2RM21 4XD7A 2Q30A 4XPVA 5IK4A 1GSLA 1HQWA 1I5ZA 3H8UA 1PGSA 3RS6A 2BEOA 5K9YA 2HEYF 2XJQA 4OZXA 3OAAA 4Y5Z0 5E1RA 2YPJA 1ENQA 3ZPNA 2WQ4A 3CNAA 4QX5A 4WM7B 3OBTA 1RMU3 1LB2A 1ENXA 3WDVA 3I54A 1UD4A 5D8AA 3D6EA 1W6NA 1KDKA 1VBB3 1ZX5A 4RL7A 4XQFA 4ATEA 2B39A 2RS51 1QXPA 3MDPA 1JBCA 5L7OC 4AEDC 2XLFA 4AI8A 1LKNA 1QQP3 1GANA 5JAXA 4FPKA 1UN1A 4FPFA 2AUYA 1G9FA 1DYKA 2HWD3 3UJQA 4QPGA 3OE7A 1ULCA 3EHKA 1MS9A 1VBC2 4XQDA 4MH0E 5FFOC 1HLCA 3TNPB 5T55A 1QQP1 5IK8A 2XJRA 4SLIA 4WM8C 4M3CB 3VHNA 2E7AA 1PGW2 1CQ9A 1NCRC 1YLLA 4N9IA 3X29B 1ZBE2 2UY8A 4AVVA 2V7QA 1S0CA 5AFEA 3WQZA 2BUKA 3AFKA 1V6IA 3UKVA 1VAVA 3AKTA 3GBGA 1MQTC 2FQPA 4B3NA 2WSSA 4XOPA 3GBFA 1DQ6A 2HWC1 5GJ6A 4HKLA 3D0JA 4HBNA 1EPZA 3EBRA 3LOBA 5FL7A 2TUNA 3VKFC 4CEWA 2W52A 1FMD2 1OI6A 3WCRA 2ZAAA 1BVVA 4KU7A 4KWLA 1C5HA 1ULEA 3MIFA 4OHWA 1H8HA 1BLIA 2RR13 4DNTB 2HWF2 3WP3A 5KBFA 3DPRC 5KWRA 5L36A 1DIWA 2CAVA 2WT0A 4L11A 4JVAA 3PVBB 4E2QA 1DQ5A 1HRI3 1PVC2 2O8QA 2D3SA 3VBUB 4BIFA 2GSYA 2RR11 5FREA 1G6NA 3QLQA 2ETEA 1CGPA 1AR83 4Z2WA 2EA7A 2X5IB 2GH2A 2B46X 4RHV2 4HKOA 4FPCA 4B7EA 4XLHA 5K0UC 1WD3A 5C8CA 1LHNA 1JOJA 3NAPC 2JXAA 3A3BA 3SMHA 1LOBA 2A7AA 3C2UA 4KQ7A 5CA6A 1UX6A 2QE7A 3KM5A 5HXVA 3GNEA 3EJKA 1PO22 4D3WA 5SV8A 2EAAA 1DHKB 2AZ5A 1AX2A 1SMVA 1M4WA 4HVOA 4Q8KA 2HWB3 1IGOA 1MS3A 2IXKA 3UV9A 1I8DA 3BCFA 1ASJ2 4HLTA 5FQ0B 1G8WA 2XNDA 1TME3 3I59B 2XUMA 2HWB1 4JGZC 4AVCA 1EY2A 4OULA 3URFA 2P17A 1YUDA 4QPIB 1X50A 2A6VA 1V9U1 2DFBA 2JE7A 4G6IA 2CWMA 1W2UA 2JG8A 1NOVA 3QBQA 5D1IA 4LTAA 1WMDA 3MLLA 2PLV1 4XN3A 2RS11 2BFUL 4M3CF 4I0WB 4MVTA 4FQ4A 3ZIAA 1RUNA 2HEWF 1KFXL 4IV3C 1WGPA 3QH6A 2NLRA 2VXRA 3V65A 1KITA 2IXLA 1RUG2 1NZCA 4L8QA 1AR71 5CDFA 1Z78A 1Z0HA 3ZSKA 3JZVA 3SH3A 1DQ4A 3OEHA 4AQ2A 4S2GA 4XE9A 1REFA 4DK0A 4ISRA 4ASLA 5CFCB 2DCZA 5T50A 4H7LA 2X6XA 4GALA 1BMV1 1WLDA 2OA2A 2H0VA 2ZZFA 3UL2A 3ILNA 4YVSB 2AYHA 1R1ZA 4Z07A 4HL0A 1EP0A 3OFNA 4LE3A 2ET7A 4OHXA 2ZGOA 1OFNA 3O12A 1N1VA 4WZFA 4QGNA 3UK9A 5JDBA 3NW4A 5KXCA 4DPNA 3SH4A 3U10A 1VB2A 2JIZA 3OD0A 1COV3 4IEOA 4BZ4A 1OOPC 4OLLA 4CZSA 4FTSA 1LOCA 2ZKNA 2A5ZA 3SLIA 1N3PA 1ULGA 1TQ5A 4FSJA 1VRH1 4YG6A 2ZGUA 2R061 3TN91 5CBLA 2DVGA 2YV8A 5TSWA 4AXOA 4J1WA 3POSA 5ACA3 4EN6B 4OHYA 1QJX1 2E53A 1DZQA 1DDLA 1YI7A 3WUDA 1J58A 4YELA 4GWNA 1ZRCA 1QU0A 3KCXA 4GXLA 4MGZE 1R082 1UKGA 1FNYA 4G4FA 4Q1PA 3O0WA 4XBNA 4LULA 2ZZJA 4WVWA 4B3FX 5D8AB 4C1XA 1O7FA 3T2TA 1OQ1A 2QDNA 4H14A 3VKLA 3ZYJB 3VBHA 4W65A 2RJKA 1NY71 1XXNA 3ZXDA 1QJU3 3B02A 4Q2FA 1J3PA 5L19A 2VMHA 4N9HA 4Y1YA 4WVZA 1AXZA 5C9AA 5JZGA 1BCXA 4RGAA 1O5LA 4XONA 2D6MA 1H8TB 4K7JA 1I1EA 1J59A 2ERFA 3B01A 4JGYC 1QJU1 1WMEA 2YHJA 1RUH2 4YARA 4XN0A 1QY4A 4GMP0 2DCKA 4Q4W2 1Q8OA 2XBO3 4AI0A 2GJKA 4N53A 5KC5A 1WUVA 4A3XA 1QJY2 2HJIA 1RUF2 4XLEA 4R4XA 3WDUA 2XBO1 4NNJA 2ZXIA 1Z7S2 2GC0A 5H9RA 1FNZA 1GKBA 4MZUA 1XE8A 1HW5A 4E4SA 1ND2A 1B35B 4XW3A 1YNAA 5A32A 4W6XA 3U11A 3GBWA 3VBOC 3ZSMA 4XF0A 1KJRA 4CDWC 4DZGA 4W6WA 4R9DA 2GC1A 5CG8A 2GN7A 4Z82A 4J6GA 4GKYA 2D98A 5E8AA 4QM8A 3HT1A 3NV1A 1UZYA 3T1MA 4YGDA 1V0EA 1CESA 3PJQA 3ZFFB 3N4MA 1DYPA 1NA1C 2XOKA 1VBC3 1XQNA 2LUWA 2ZX2A 1RJ7A 4UBGA 4CTEA 3WQ1A 3WW2A 2O1QA 3N36A 4JDMA 3BB6A 3AKPA 4R9BA 5JOYA 3CP2A 1ULDA 3RNSA 4IL7A 2CK3A 2RHPA 3IDCB 2RS52 1MS5A 1AXKA 2QFEA 3ZMNA 1ZBE3 1VBC1 1FI2A 2BNNA 2D6LX 4AG4A 1NCQA 3VZMA 4X8NA 2PYTA 4YFZA 1PGW1 3DKWA 3MIGA 1ONAA 1CVNA 2F1MA 3ZMOA 4DXZA 1AR61 5IT6A 4AE2A 5EWSA 4Q8LA 2CL2A 4YZ2A 1UPSA 4K40A 4UW4A 3VZJA 2VW0A 2UWBA 1ZM1A 3AKSA 3P3NA 3TB0A 1S55A 4C90A 4HSLA 2VGDA 4IEXA 5EV7A 1QKQA 3FX3A 3VKNA 4BHPA 3POWA 1FMD3 1UPIA 4K1YA 3MICA 1BXHA 4FOYA 1PVXA 1W6OB 1PGL2 5I0UA 4AEJA 1YO8A 1VIWB 3MEPA 2HWF3 4M00A 3B93A 1W39A 2AGSA 3IWZA 1FMD1 2HWC2 2XZPA 1PVC3 3CEWA 3WP5A 1I9RA 2DYCA 2GC3A 1DZTA 1Y43B 2HWF1 4OI1A 5BNPA 1S1AA 5DZEA 4AEDB 1REEA 3ZXKA 4I2OA 4RHV3 1SKYB 2DTYA 3K48A 3M70A 4WM7A 4IV1C 4LO4B 2ZA9A 1MS1A 1KRIA 3WINE 2FMDA 2NP0A 1ZZ7A 2SLIA 4GKXA 4WM8B 1KFUL 5DDJ3 2W0XA 5JI9A 2RR12 1FYUA 2JICA 4GMP3 1PO23 2LALA 3QOPA 5BNNC 5HI0A 1DF0A 4I09A 3OD4A 1BQPA 1UU6A 3SISA 4BLJA 5C8WA 2JG9C 3ACLA 5DG1A 5DDJ1 1OQDA 4D69A 3RJ2X 1S0EA 3JU4A 4Q0SA 4GMP1 1PO21 2R30A 2FZ2A 4M3CA 1ASJ3 4CDQA 2OW4A 2D44A 4XF1A 1IKPA 1IPJA 1QF3A 1CAVB 1EPWA 1DFQA 1MQTB 1RIRA 4BYYA 5I8YA