2X53S

Structure of the phage p2 baseplate in its activated conformation with sr
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
298
structure length
298
Chain Sequence
GVRQYKIHTNLDGTDDKVWDVTNGKVRFYQPSNLGLQSTNNIWQSNGIGVMGTRSITQPQIEFKLETFGESLEENYQLMKDFVNDILSKKFVTLEYQTEIFQVYADLALADVTKTEGYGKNGTFSEKITFDIITKWYTYENLTFDKIQNGKVIAGMSKIYGGTAPGNYKYIKGTSYTYYGESDIDRLSRWDIKEEIFSFMGILYPKLPKTPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQGWKGTTALNLFPVMDFERYRTRIIEKGQMELINLSKAEFKIKRKADFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF16
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
total genus 53
structure length 298
sequence length 298
chains with identical sequence T, U, V, W, X
ec nomenclature
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.210 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x53S01
2.60.120.880 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2x53S02
2WZPP 2X53S
chains in the Genus database with same CATH superfamily
4B1LA 1TZOA 1C1LA 2CL2A 5FZDA 3AC0A 1UY2A 3W5HA 5FPVA 1LOEA 3KHCA 3K4AA 3CCEB 3E97A 4HN1A 2RS33 1POV3 5FP3A 5LRRA 4X8NA 1CAXB 3ACFA 1DBNA 3BC9A 4LBNA 1MZFA 4GH4B 1K5MC 2IXLA 4DRRA 4B7KA 3ZXAC 2WLPA 2OK8A 3VBOA 1WWYA 1XYPA 4AFAA 2D44A 4LBMA 2C0ZA 5T50A 3O1UA 4RDLA 4FFFA 2NN8A 2F17A 4RFT0 1AYN3 5FPBA 4QMAA 3FHQA 3D8CA 2VNKA 3FX3A 1ST8A 3JBG3 5ACA1 2OBTA 5F5AA 2PHUA 2RS11 5DABA 1JA1A 4P9IA 4P26A 3BCDA 4JDMA 2JDZA 3LQCA 1TNRA 3NRUA 1EYBA 4QGMA 4YAWA 2KVOA 2W08A 3POYA 1W99A 4FOYA 1XQNA 4JGYB 3T4VA 1ELOA 1QXJA 2PLV3 2YBSA 2WJSA 2JKXA 2JIJA 2XZOA 5FY1A 2OPKA 2GC0A 2AR6A 3OCPA 3ILRA 5F9TA 3B01A 3VL9A 4Y7CA 5LMZA 4WZCA 2J42A 3VBFB 3ECQA 3GYDA 2ZXIA 4I3GA 1PO11 4LIUA 3WP6A 1BMV2 1X50A 4QQ2A 1JU4A 5A7SA 4I02A 4JRAA 1US3A 1YNAA 4FPEA 1NKGA 4ZCIA 1LHWA 1GV9A 3S57A 4A6OA 4C1XA 3I59A 1DYKA 1M90D 4AEMA 4FTEA 2R041 2V5DA 3DXTA 1OVPA 3B02A 3RZHA 2V31A 1ASJ1 2WLQA 1ZZ7A 3WD5A 3CJIB 2A73B 4BQ4A 4ITCA 3TN92 1DGRA 3RYRA 4E4ZA 3WR0A 3SISA 4ONUA 3MF6A 4QQPA 3U6KA 4RPDA 4HBNA 4BLJA 5FZ0A 4P3YA 4N43B 3O12A 4XQDA 1DYOA 4IEUA 2DCYA 1A34A 4Q4Y2 1CAVA 3H3LA 4HMZA 1QJU1 3BCWA 2Q30A 2W6JA 4D7YA 2EVXA 2VQAA 3I54A 4NIGA 1T2XA 1F2NA 5BY5A 2ZGKA 5LEJA 2IFRA 5FO7B 2QDRA 3ZYFA 3VD7A 3AFKA 1PGW2 2EF6A 4NWVA 4MGSA 4H7LA 4WWVA 4D8MA 2WO2A 3I2KA 5I0UA 4XJZA 5CKQA 4K3UA 1VBA2 2HEYF 1ZBA3 1LGNA 4CDUB 5FYYA 4Z4WA 4N9HA 5LK5A 3LPFA 3WNKA 1H2KA 1PX3A 1UYYA 3LDKA 2ZAAA 3W5MA 4AQTA 3QCWA 3S30A 5A80A 3VGIA 4LBQA 4GAZA 2XR4A 2V5YA 3U4SA 1ZM3A 2YC0A 3T2TA 1J1TA 4AOCA 4GKXA 3MYXA 2RMU1 3N9PA 5C3SA 2I1LA 5JXJA 3RSJA 2JKBA 4PBOA 3GZUC 1SLLA 4PDWC 3BU0A 3AZWA 4XUOA 5CG9A 2VNHA 3MHPA 1VBD2 5KHJA 1NB9A 4JGZA 2ZHMA 5A8AA 3ASPA 1LESA 3FBMA 4ES8A 4TTGA 3TEYA 2H6CA 4IGQA 2J1SA 5BXXA 4JV4A 2X8KA 4R71A 4CP9B 3HD8B 3CU7A 3JU9A 3TEZA 1EV12 1NAEA 1PMJX 1QFZA 4W65A 2D5HA 3ZSKA 2HKXA 3WP3A 3CIHA 1COWA 2YC4A 1VBC2 3MUZ1 1WMFA 1W9FA 1ULFA 3LGRA 1GOHA 1AR91 1W6PA 4Q4Y3 1W6MB 2QQNA 3U75A 1RB8G 2PHRA 1SLTA 3VZKA 2VC9A 3RJRA 4XJAA 2FX3A 4GWMA 1UY4A 4A45A 1VQ4B 2CRVA 2UY9A 2VCCA 3IAPA 2RS52 3ES4A 4H2AA 3GZTB 2D3NA 3ILNA 3EXUA 1DDIA 1W8OA 2ILMA 1VBA3 1U5YA 5CFCC 4B4RA 1N3OA 2IXIA 1EFTA 4OHVA 3MGUA 4LNVA 1F20A 5FFOC 2QQJA 1ENXA 3NKGA 4QHYA 4XXPA 2XPJA 2C5HA 2XKOA 4QDSA 5IUQA 4IE4A 4XHBA 3PTRB 3AVRA 3R6SA 3ZPOA 5CAZA 3VBUA 4KWKA 1PNFA 2GC2A 2P6CA 4CEWA 3U4XA 4INDA 1JOPA 1CZTA 5ABJB 2XUMA 2WQ4A 3D26A 3Q3AA 3D82A 1VBD3 2VZ1A 5CYYA 1YJLA 1WD4A 3KT4A 2KXLA 1RL3A 2VL4A 3U1XA 5FK8A 3OEEA 4CPBD 4AQ6A 1H8TC 4DUXA 4LMFA 1WLWA 1C57A 4MHRA 4OOVA 4BJ0A 1FOD3 4Y22B 3OZWA 4IW3B 1EV13 2WQZC 2UWCA 1I5ZA 2BZDA 2GNDA 4FOVA 3CMEB 2KM2A 4YAOA 1N07A 4OZOA 3WUDA 5FZOA 2NMNA 1VBC3 5L9VA 2DVFA 1WP6A 2CNAA 1CQ9A 2JDNA 2DCJA 1NA1A 5FDBA 3ROUA 5JZGB 3CMGA 4G5GA 4KWUA 4AVAA 2EA7A 1PJ5A 5DZEA 2VJIA 1ODNA 2VBTA 4Q5OA 5IVEA 4PC6A 2WA4A 1UY3A 3TOJA 1XE7A 5TY0A 3HPNA 2PXJA 2WN3A 2ARXA 5KXDA 2YWHA 4NMIA 4QPGC 4MUVA 3OGJA 3ON7A 1QVFB 2A3YA 2R1BA 2RS53 1OUSA 1WU8A 1C4RA 3A3GA 3ZFGB 1FAYA 4NRPA 1JHJA 1RUC1 5FMCA 2BRTA 3PURA 1J59A 1YUDA 2OZJA 5A1AA 3PUMA 3KT1A 4YLZA 2DERA 2YFZA 4CQJA 3K4DA 2XWBB 4Q0VA 5HCAA 5DAPA 4YNIA 4ZU4A 5J98B 3F95A 4RGKA 5T5LA 3UGFA 1AX1A 3K2OA 5FJKA 1CWPA 2VMIA 2Z5WA 1QGAA 3IB3A 1NE6A 3VBSA 5I0DA 1H9PA 2PQQA 1LOBA 3HJRA 3RZKA 2NM1A 1BX1A 2WZPP 2GZWA 1AR82 4XOGA 1R092 4JRLA 2F6BA 1KZLA 1K5MA 1DARA 3CCSB 4W6XA 2ZL5A 2W68A 3VKOA 5GV8A 1VQNB 4FXGB 4LUKA 2FDFA 2UYBA 5L73A 4GA9A 4NWWA 3N7JA 2DCZA 4LLFA 1GZCA 3SH3A 1JYNA 4RYDA 1LECA 1VMJA 2DURA 2V73A 4LO6B 1MEC3 3ZN4A 4KI5M 4GIQA 2Y6LA 3SXWA 2QQUA 4XJ8A 5FZAA 2ADDA 4LTAA 1F31A 1PO21 4EV0A 4M3CB 4QKNA 3W2IA 2ZAHA 4LO4B 5L7OA 1Y7BA 2FD8A 1H2LA 1R5BA 1NRKA 3R4SA 3INAA 4TT3A 2WO7A 4BQWA 3WOGA 5M0TA 1DDLA 5A1FA 3N9OA 2GDFA 2MEV2 1PM4A 2GMPA 2PA7A 4Y26A 3TNQA 3GGLA 3QFRA 4IEWA 3K3OA 4HE6A 1GBGA 1ZBA1 5HV4A 3Q8BA 1V6NA 3UGGA 3VHNA 4IV3A 1UOGA 3B5LB 3TWIA 4B47A 4Z4SA 4FFHA 5EP9A 4P00B 4LHNA 4OHZA 3WQZA 4UZFA 1AR71 1OT5A 2QZ3A 4O9GA 3OYWA 1VQ5B 1AR83 2BV4A 4QPIB 3NAPB 4UAPA 5C4WB 3N7LA 1XRUA 4LK6A 4AEDB 4MADA 3PVBB 3MIHA 5FLJA 1DQ6A 3P3PA 4UBHA 4XMYA 3WNNA 5F2SA 3VDBA 3RPQA 3K51A 4F7ZA 1UY0A 5KXCA 3VHPA 4XVHA 1YLLA 2DCUA 2G9ZA 3HQXA 1OB0A 3OBTA 4I0WB 4DUWA 3HNBM 2JG9A 4EZ4A 2Z6BD 2QQPA 1T6ZA 4R52A 1U2RA 5CIRA 5DUVA 4Q8LA 4A42A 2YPJA 4HN0A 4UFLA 4XTMA 4DQLA 4BISA 5FY4A 2EIGA 4CCEA 3BALA 1A8DA 3T0DA 2Y60A 2DBNA 3KV9A 2OVUA 1S0IA 3S0MA 1OMIA 3M1HA 4WZKA 4M01A 5JWPA 2QCSB 4AF6A 5E6HA 3LVBA 5F37A 3HNYM 1QOTA 2VNJA 2ZITA 1VAMA 1XNDA 2RHPA 2VH9A 4YRDA 2F1MA 1SEFA 2WRAA 2Y64A 3AM2A 4N53B 3SEJA 2ZKLA 5D8AC 2MEV3 4RQPB 3AL6A 1DG6A 3T1MA 3A21A 2X6YA 1NCRB 2DFBA 5A6QA 2XG3A 1KD7A 5FXXA 4AFBA 2V72A 2XWJB 1EFUA 1YI2B 5FBZA 2GH8A 1H2NA 4O7XA 1FMD1 4IEOA 1H6YA 4XLEA 5FYUA 3LE0A 1S0FA 4LO8A 4YG6A 4TMTA 1KJLA 4P3IA 1T6GC 1S0GA 4CZSA 3NNJA 2F4NA 3BTYA 4RD4A 2W9XA 2FZ1A 1O59A 3EBRA 4AEJA 2V7QA 3BPSA 3T08A 3OOXA 1QQP2 2XOMA 3KS7A 1HVXA 4PLMA 2OK7A 1W9XA 4CDXC 3WF3A 1E5HA 2RV9A 1WZXA 1ZUNB 4MZUA 2B5HA 1RGSA 4G9SB 4FPFA 3ABZA 2P6HA 5J1XA 2WS92 4EJRA 4XJWA 1FOD1 3CL1A 5I0RA 4MG2A 1UD1A 4C0SA 4Z92B 4Y24A 1SDDB 2VG9A 2VW2A 1J3QA 1WUVA 3OJXA 1KJZA 4X7FA 3WF2A 4NR1A 2ZKNA 1BEV1 5FJHA 2WAAA 1W2NA 2YB7A 2D97A 1LODA 4XFIA 4AQ2A 1Q8VA 5JUVA 4Z4RA 2VMGA 2JD4A 3ASIA 1F5FA 1DQ1A 5FY0A 5LY2A 3WP4A 4OULA 5C33A 1UPIA 2M5SA 3T0BA 1FNBA 1LGBA 2BM1A 3MIBA 1A8PA 4DNYA 3C7HA 3WDWA 2XVKA 4B8EA 3OEHA 4ZONA 4P9GA 5DAVA 2UURA 2BBVA 3UJOA 5E1RA 5DS0A 4PC7A 2BPA2 4P5HA 4OQ8A 5GALA 1GNZA 2CV6A 1OOPB 2X5IB 2X3UA 1JYCA 4X0CA 5C7GA 4Q0SA 2ZZQA 3RY8A 4QKDA 3FJOA 3I97A 5JZGC 1H8HA 1YEWA 1QQP3 2YGMA 2JDUA 2XONA 2QN6A 2P3KA 1XYNA 1VBE2 2ZX0A 2Q8OA 3AP6A 1QDOA 4Q0QA 5FQ0B 1WGPA 1YITB 1AIPA 1BCXA 1RHI1 3UL2A 3PUSA 2VQTA 2UY8A 1KS5A 3IT8A 1HN1A 3P6BA 1TUIA 1E5RA 4E2GA 4IE7A 4CCDA 2WS93 4QPGA 5A6YA 3AZYA 2NLRA 1QWRA 4IV1B 2PHTA 2R0FA 1RUH2 4Z1VA 4BH9A 5HZAA 3QE2A 2HEWF 1MEC1 5IYWA 4Y1UA 1VRH2 5KSWB 5HZBA 1GNHA 1JXNA 3DPRB 5FYBA 3VNUA 2WT1A 4EWDA 1MQTA 2WNUB 3I3BA 1R5NA 4PABA 2I45A 3AMPA 3N9NA 1YWKA 5GZGA 4KKUA 1W8NA 4AAPA 4UFMA 4DNTB 1DZRA 1S2EA 1AHSA 5EYXA 2MHFA 4PC2A 4LKFA 2A1XA 2E51A 4TMVA 3ZIXA 2GN7A 2GN3A 2DU1A 4FTSA 3SLDA 4QXBA 5K7PA 3WQ1A 4GH4A 1JOBA 1N3PA 2BPOA 1UYXA 4UFHA 2QDNA 4IEPA 3BY2A 4G4FA 1UF2C 4ZXKA 1RUG1 3FPKA 4UWDA 1Q5OA 1PZ7A 2Y6FA 2NZ9A 5JOZA 1QH7A 2W2IA 1BVP1 3NKTA 4ISQA 3ZXJA 1OVSA 3ZYJB 4KG8A 1ZZCA 5LBEA 5BNOB 5JSPA 3FZ3A 3RDIA 1NE4A 5FZKA 1MS0A 3M3EA 4V2WA 4A3XA 2YY1A 1YYNA 4XUQA 4JGYA 3ZDVA 4XHXA 2OT7A 5T54A 1GP4A 1VBE3 3MW4A 4B4PA 1RIRA 3AXEA 3N3HA 4QM8A 3NE5B 5H9SA 1CNEA 2ZHLA 2VOWA 3LA2A 1N1VA 5IVYA 5DDJ1 4ASUA 4XJUA 2SLIA 3VBFA 1WLCA 3ZZUA 1YI7A 3A35A 4WQMA 3C7EA 1A8MA 1DGLA 1RUH3 2VZLA 1SLIA 2FMDA 3P1IA 4JTOA 1AXKA 1VRH3 3QH6A 1DF0A 1GP6A 2J7MA 3D3AA 1BKZA 3DEMA 2GNMA 1TME2 1R1A2 3VZNA 5T3NA 4QGNA 1UD3A 1D8TA 1YIFA 1IJEA 1KMHA 1WSVA 2GJPA 2JXAA 3VDCA 5IVCA 1LKNA 1S2BA 3CJIA 3CC7B 4H3WA 3ZKUA 3OUHA 3KHBA 1O6UA 2G19A 5HI0A 1EP3B 1KXGA 5FYMA 2C9KA 4N43A 4RGAA 3NAPC 5C4WC 4UFIA 5DAXA 1YJKA 1UXZA 2VY0A 4BPZA 4C8DA 1DCSA 1NOVA 1VP6A 3LSDA 2Y6KA 2BGJA 1PX4A 4CCOA 2VBDA 1JA0A 1FV3A 1RUD2 1WMEA 2R062 5FPUA 3VR6A 5DUUA 2Q8EA 1BJQA 2FDHA 2C4XA 1XB2A 1KDMA 3WNMA 3MI8A 4FWTA 2OTLB 3O1RA 4Q4X1 1O3TA 4Y1VA 2HBTA 2VZPA 1D4M2 1AL22 2VW1A 3IPVB 2WO3A 3ZXGA 1EXMA 2YC2A 5I8SA 2IXCA 2DIEA 4NIIA 3W2EA 2XEXA 3KT7A 1UO9A 4CDUA 1J9ZA 2J1UA 5EXOA 1E5IA 1E63A 1D1NA 5GKAC 3JB8A 2CTVA 4OZXA 1VAKA 4ZHNA 3VB9A 2XJRA 5FKBA 5FYVA 4AVVA 1PNGA 5I8YA 5EIYB 3FFQA 2IZWA 4DRVA 1AXYA 3CLPA 3ZIAA 4ROXA 2EXIA 2XL7A 1UD6A 2VNRA 1HQLA 2WJVA 2ZGMA 1QX4A 4LE4A 5F5IA 4XILA 4ORFA 4JKMA 4YXWA 2CK3A 4Y5Z0 2WO1A 2W47A 1NCRC 2BV3A 1KEXA 3BU7A 1RUE1 1TME3 4AGGA 4Y20B 1AYM1 1R1A3 1REEA 2DUOA 4ATEA 2JDMA 4XLCA 3LDBA 3GJAA 3ZLIA 1SLAA 2LUWA 1T6XA 4Q8KA 1VQ7B 3JQQA 2JX9A 5FYCA 4YFWA 3LA3A 2BU9A 1IQAA 2G9GA 1BK1A 2WZ8A 3T53B 2VYQA 4XM3A 4CA9A 3P3NA 1OPMA 1GJRA 4QU2A 3BODA 4CVUA 4BA6A 5FPXA 1EPWA 1DZTA 2RE9A 4TXWA 5K0UB 5IYNA 4QAWA 5GV7A 2ORXA 2D6MA 3VLBB 5BNNB 2RVAA 5JXGA 3BIWE 2I07B 1R081 4PIYA 4N3NA 4B48A 5IYPA 5FP4A 3RG0A 4D6QA 4S2GA 3PENA 1RUD3 3V56A 2D98A 2HBUA 4HSLA 2R063 4UAJA 1S55A 3KVBA 2CGNA 1APNA 2WZR1 4ZV4A 3ELNA 4PCRA 5FRAA 1PVC2 2WR9A 3OJBA 1SZBA 4E27A 5DN2A 4DQAA 1SKYB 4XF9A 4S2FA 1O8PA 2YPDA 3QFCA 1ZVFA 3G6JB 1LHOA 4AHZA 1BQPA 1RINA 5IJRA 4HANA 1OB2A 2JE7A 2WSSA 1BLIA 5HXVA 5A70A 1M1KD 2ZHNA 4GULA 2WNVA 2HWC3 4OUMA 1UMZA 1OI6A 1C1FA 3AGQA 2B7YA 4XC9A 5JI7A 2OTJB 2VNVA 2JDKA 1WBLA 4FXUA 5ABJA 3H8XA 4D3WA 3GJBA 4Y9RA 1B35A 2FDJA 1CD3G 5IW0A 4M4PA 3AZZA 4B4QA 5HBAA 1ULPA 1ND3A 2BMWA 4XPVA 4P14A 2GH2A 3J7HA 4AQSA 2Z69A 4CDQB 3CPXA 4Q26A 5JPMB 3ZOIA 4OI2A 3Q8AA 2IVIB 4Y22A 1OOPC 2AUYA 2ZA9A 4IW3A 2X5IC 1L7LA 1EFRA 1QKQA 3RRDA 3A22A 4Z82A 3E5UA 1RUI2 1NLSA 4QHBA 5THXA 4XQ4A 3L9JT 4BQ1A 2C24A 3V0BB 2JG8A 4W6WA 3H9AA 3BVCA 2GQFA 2DCKA 2VAUA 3CMMA 1NLQA 3CW2A 1WOOA 5FZCA 1QGYA 3ZVXA 3Q6QA 1S4CA 4BMEA 4JVAA 4Y1ZA 4RLZA 1C5IA 1QGZA 4JAAA 5FZFA 3WHTA 1ACCA 4UYBA 1HXS3 1DGRN 4A7ZA 2EIDA 3NJXA 5FREA 4MH0E 2NV4A 3ZYPA 3WW2A 4J1WA 4IV1C 3KCXA 3H8RA 5DQ0A 4ZXEA 4BM8A 4DMIA 4DFSA 1PMHX 2CAVA 1NCQC 4HVRA 2ARBA 5T5PA 5AC92 3VMFA 3ZFGA 3VNVA 5KC5A 3ZN6B 1PVC3 4RN5A 4R9AA 4YGEA 1OLME 2HWD2 4NHKA 1WCUA 4GMP0 4YFZA 1AVBA 1L7RA 1N0UA 3RI8A 3KWVA 5CKMA 1W6NB 1W8WA 1YCIA 2WNOA 1IJFA 2W6IA 4YW1A 4GB32 4CP1A 4YVWB 4AI9A 4FPYA 1YIPA 5J3UA 1LEMA 4MX3A 2JJ6A 1UD2A 4P6VF 2BOIA 3VDDB 1AR62 2JD9A 5JI9A 2D6PA 1EP2B 3J26N 4FPGA 1WSRA 2BOJA 1UN1A 1D0GA 4X6QB 4Q0PA 4RDJA 2XZLA 1RUF1 4XD7A 2XVGA 2VTXJ 2WT0A 3BI3A 1FXZA 3PU3A 2FDGA 5HV0A 3W5UA 4YZ2A 5IVFA 2JN9A 5BNOC 3KEWA 3WYAA 4WM8C 3GVKA 5AVAA 2GPJA 3PMSA 4QX1A 1RUI3 1GNYA 2D6LX 1LCLA 1K9MD 2BGPA 2PELA 3NO8A 3WNBA 1NY72 2YU1A 4CEYC 4M3CA 3G4SB 1HRV1 1SKQA 3WW4A 3SKJE 4E8DA 2PHXA 1GUIA 5FZ8A 4AL9A 1IOAA 3B00A 3O0WA 3T4HB 1UX6A 4YW2A 1EFCA 2D6KA 1IS3A 3FJSA 5A7NA 2ET1A 5FXZA 2QGGA 4GMP3 2GJKA 5LBFA 3SH5A 2CYFA 4PI0A 1CZVA 2X10A 1IS4A 1GANA 2Y33A 5AC93 2P34A 2ADEA 3ZR5A 1SHWB 2X53S 4PIZA 4LKDA 4F7DA 2BBAA 3A0KA 3ZYIB 4HK9A 1SBFA 4QX8A 2PYTA 3BQJA 2HWD3 4CCLA 2HEVF 4YPJA 1U5ZA 3VBHB 3ZFFC 4TWTA 4RHV1 2E7QA 2E9QA 2EALA 4OFGA 1OFNA 2VUCA 4GB33 4R9DA 3CHXA 1VBB1 2W1WA 1KK3A 4XR6A 2CU5A 1K73D 4R9CA 2LW8A 3U0ZA 4DEVA 1AR63 1CIWA 3SITA 3GDBA 3N9QA 4WVMB 1SM4A 2V7XA 4QPIA 3NAPA 5C4WA 2B9VA 1IGOA 3EB7A 4XACA 4AEDA 4FO9A 4K8FA 2BVBA 1X82A 2Z79A 5KW9A 4MXWB 2R7EB 2GU9A 4ASKA 5ACA2 2RS12 1IB0A 4D0QA 4J1XA 3AYDA 5C3OA 2BGCA 3AP7A 1ZZ6A 2BF4A 4P9LA 2VZUA 2VVDA 3TRSB 4J25A 1UMKA 2RJLA 3LB9A 4YARA 3HAGA 3WNDA 4C91A 4BE3A 4AHWA 1XE1A 2VUDA 3H8OA 3OBRA 3VZOA 1N08A 4ZCLA 1W04A 1OKQA 3CF6E 4NROA 1WCQA 5DZFA 4C0HA 4AI0A 3FKSA 3U6BA 4C0BA 3I2OA 1R5OA 1PO12 4JQRA 1JYVA 3GBWA 4XUNA 4RD1A 2V7UA 2ZMLA 3DDYA 2ZCWA 4YVSB 3NNGA 4N53A 1GKBA 2VZ3A 3DV8A 2ZMKA 4AGRA 1MS1A 2PMDA 4RQPA 3MCAA 3HN1A 3VBRC 4CCCA 1CNFA 3VD4A 4UW5A 3B8HA 4XOPA 4IUGA 4BB3A 2R042 5KHGA 1LR5A 1PVXA 4YAUA 2Y34A 1ASJ2 3SHRA 2R49A 4NE9A 3LQ6A 3JQRA 2QDXA 3WW3A 2YGLA 4B3NA 4E2QA 3NL1A 2WJYA 3R6JA 1NB0A 5FYHA 2HWC1 5A33B 4DNRB 4XDPA 1L3JA 1W9TA 5DG1A 3WCRA 4B3XA 1W0JA 4E4SA 4YGBA 3KL9A 4CTEA 1I1EA 4I3PA 1QJU2 2WSVA 4N7IA 4IGOA 1RUOA 1BHGA 3EYPA 4LO5B 5K0UC 5LA0A 4Z1MA 3KD4A 2WFF1 4GWIA 3I3QA 2VCMA 5CVRA 2CAUA 3K46A 1VR3A 3BKZA 3R4UA 5ACA3 2CWSA 1DQ4A 1MS4A 1QXRA 2FMYA 3LAGA 1XSRA 3TBDA 2OZ6A 3ZXLA 4BIOA 1GU3A 4LBVA 4E9KA 4LKEA 3USUB 1K12A 1WBFA 3A23A 3UT0A 2YBPA 1AXZA 2XNCA 5FYZA 2JDIA 5F6KA 4Q29A 2AEZA 5BNQA 2C9AA 4JQTA 5LB6A 1PO13 4ISRA 3TEXA 1WCSA 3VKNA 2RDSA 2RMU2 4IEVA 3HWJA 5ISLA 1HXS1 3BIEA 5A7PA 3M3QA 2DDUA 5LZ6A 3O14A 3MV01 3WZ1A 2XXZA 1TLLA 1YFWA 4FFGA 4LBKA 1E79A 2P3MA 4O65A 3UKVA 1QUFA 2XZPA 1QG0A 3BN6A 1GZ9A 2D3PA 4AF7A 2D93A 3IM0A 4YSFA 1OQEA 2A3XA 1IKQA 1UMIA 4AVCA 1ASJ3 1KS4A 3ETPA 5J96B 1HIXA 2ARAA 3HMYA 3RZGA 4G7WA 3AL5A 1TEIA 3O1VA 5D1IA 3PIGA 3B82A 4XQWA 1RUJ1 1NZIA 1OOPA 1N1SA 2X5IA 3T09A 4AVTA 1UD8A 2A75A 3TB0A 4LPLA 1VF7A 4PDWB 1AR92 1C8NA 1QJU3 1Y43B 3OP1A 3OGSA 4YGCA 1GICA 3LEMA 4P9JA 4E0FA 2C1FA 1V6OA 3S7IA 4J6GA 1RXFA 2VOXA 3EQEA 3PUIA 4X05A 5FQ0A 1NDHA 1HDKA 5JIAA 1IZ3A 1OA4A 1BJKA 2TUNA 3AGPA 4LBYA 5HXBA 1CVNA 2YU2A 4YWAA 3ZKYA 4ZY9A 1EUUA 4XZUG 5EYYA 1B09A 5DMYA 5E89A 1W0KA 1NYWA 4IV1A 4LXLA 3RFRA 1A3KA 1W8FA 4Q0UA 3A8JA 3Q8EA 1VQOB 4LHLA 4UF0B 3MLKA 4EN9B 1H2MA 3LCPA 1KK2A 1KGYA 1VRBA 3DPRA 4UZEA 1A6CA 5FZBA 4LE3A 3MF9A 1Q56A 1CIYA 3MPBA 1F4HA 2WNUA 2X09A 4NJ4A 4A3ZA 2VUJA 2DEUA 1YFYA 5C9AB 3KVAA 3SQOA 5J3OA 2QQLA 3AKTA 4YVWC 1L7QA 2RMU3 4A6SA 2VOVA 1PHMA 1Y4WA 3WINE 3OBZA 1QDCA 3DL3A 1WCKA 3R4DB 3VDDC 4NPLA 2NP0A 3MHZA 1JHNA 1ZRIA 2JE8A 1JH5A 5FXWA 1RITA 2OIIA 3DKWA 3KSCA 1G9DA 2ES3A 4XF0A 4ZS3A 3M70A 1FNDA 4G3YC 1NLRA 4OP7A 3WV6A 3RZLA 5A7QA 5FZLA 2DYCA 4DY5A 2L9LA 4LUMA 3ZSMA 2HWB1 4U2AA 3SCHA 2TNFA 2CC2A 3T51B 4XF3A 1XB9A 3LPGA 4PJYA 5JMCA 2OXBA 3LSEA 4RD3A 5IFTA 5F4MA 2CGPA 1UU6A 2C26A 2IWGB 2DV9A 3E1YE 1AR93 4KWJA 1GSLA 3THDA 2PAEA 1CONA 1TG7A 2WZNA 3N9MA 2V7TA 5T55A 4IEXA 1E43A 5C3PA 3OPOA 4WZLA 4QDRA 4NHXA 1STMA 1CQXA 1AJKA 2QQVA 3C8XA 2IFWA 4YAFA 3S6PA 4B3GA 5GJ6A 5G05L 2VBBA 3POJA 4Q27A 4L8QA 1OKOA 3HBKA 1JZ8A 2QFEA 3VKMA 4Q7JB 1H42A 2RC6A 1RUC2 2DUPA 2HYXA 1UNBA 1UZZA 4O61A 3CMAB 3U10A 2BWAA 3O1PA 4RD2A 1YFXA 2XHKA 4P22A 2ZZFA 2FHRA 1UCXA 2RDRA 4RS5C 1W90A 5A32B 1CX1A 1PZ9A 3LEKA 3F2ZA 3G05A 3DCQA 3RZMA 1FX5A 4EH1A 4OOXA 2V7WA 4FPJA 3LIHA 4YELA 3WW1A 3GQBA 2HCJB 4XONA 5FMOS 3RGBA 3ZYRA 2GP5A 3MBWA 4COZA 1UU5A 3OUIA 3CCRB 1Z0HA 5FYSA 4TYSA 5GLWA 3VUOA 3I2JA 5F39A 2LROA 4H7MA 4I0BA 3FPPA 5I0SA 5IK8A 1BK0A 2K9ZA 4I01A 1G7YA 1UYZA 2C77A 5A6ZA 1S0EA 4BWOA 4QU1A 1W8TA 4H9GA 4YYOA 5FWEA 1W8UA 2OYNA 4MLOA 2WQ8A 3WBJA 2XNDA 1PIV3 3IDEA 4WBBA 1PO22 3M2MA 2ZGUA 2YWFA 5SV5A 1WW4A 1JTZX 1S2KA 2XOKA 3MW3A 1D2EA 4RCYA 2A7AA 1GQPA 4Z2AA 1KQSB 3D4KA 1SCRA 5GLUA 1ENSA 3AVXA 1QJFA 3GVJA 4YVSC 2QQOA 5CNAA 1RUC3 4YZ5A 4ARYA 5FLIA 4NOTA 2CWMA 4YZ3A 1Y9GA 5FO8B 4D94A 3PNAA 5TRDA 2VMFA 1ZBA2 4PLOA 5C71A 4HG6B 4XFBA 4P12A 2EAAA 2R16A 3AYEA 2NMOA 4Z4TA 2DUQA 2VE1A 4MGIE 1VLOA 4BCUA 4ZPIA 4Y20A 3CPWB 5J36A 1YX2A 2GK6A 1QVGB 4XETA 1K42A 2DCTA 4Z4VA 3WNOA 1BZWA 1JI6A 3Q9OA 1WA6X 1O8SA 1AR72 3KF5A 3H7YA 3AP5A 1C8M1 2QVSB 5KXEA 4BHPA 2WYRA 4P25A 1E57A 4Q1PA 1UZVA 1DHKB 5D2AA 3V0AB 2G1MA 1MRZA 3ASQA 4PC1A 2JB4A 4AAXA 4XN0A 5FY8A 1OSGA 4JTNA 1DLCA 2QJVA 3H1YA 5BNNA 1R64A 2HWF3 3ATGA 2VBSA 5A3TA 1JYIA 4AC9A 1W9SA 1VQLB 4HT1T 1BBT1 2BEOA 5FUNA 2DVAA 4XXAA 4B43A 3SC7X 1ND2C 1NXD1 1ZM4A 1VAVA 2DVDA 1LOFC 5IYQA 2VO5A 1PO23 4IE0A 5GZFA 1W6PB 1REDA 3N7MA 3ZR6A 1IS5A 3A7QA 1V00A 2BYVE 4FSJA 2D3SA 1QJY1 2ARCA 2ZX2A 4CUAA 1BMFA 1QNWA 5FR3A 5A7OA 4XE9A 2R071 3T3YA 3U07A 1S0JA 2Y6GA 1CPMA 1VQPB 1S72B 3IDAA 1ULGA 5EMNA 1W2UA 1NQJA 5F3EA 2VXJA 4BXFA 1D2QA 2J22A 2IVJA 4IETA 3I2DA 4RD0A 3ST7A 1PK6A 1VB2A 4XDQA 2ZEWA 5G04L 1V9U1 5LBBA 1J84A 1S0BA 4M0HA 5FKCA 1X9TA 3ORJA 4ZZ5A 2VZVA 1EPZA 1FMD2 1SCSA 5DG2A 4CDQA 4CYDA 5CG8A 4MYUA 4A4AA 3SNMA 1YQ2A 4BK5A 1JUIA 1AR73 3M4FA 3ZMNA 5D8AB 2Z42A 2WWUA 3I2FA 5FO9B 2D74A 2G4IA 4GZ9A 4HKWA 1SPPB 1RXGA 4XBNA 3V0BA 1WTHD 3ETQA 2ZEYA 4OCTA 3O5SA 5B6IA 5FY5A 2R30A 1W87A 2B42B 1W28A 2LS6A 2A6YA 5A7WB 5BSXA 4CDWC 3BYWA 2XLAA 1FOD2 2JB8A 3NMBA 1BYHA 1VPHA 1VMFA 3ZPYA 1JZ5A 3MEPA 4H14A 1NA1B 2NPIA 4CRQA 4Y9UA 1HN0A 4GKYA 5F32A 2W0XA 3ZN6A 1BEV2 1H1IA 1QFYA 4KGGA 3MIDA 4PAAA 4CDXB 1IHMA 1XC6A 1ZM2A 2XGJA 2VU9A 5H9RA 4EROA 2JE9A 5FP9A 1YQ5A 3MIFA 1BVVA 5C9AC 1W6NA 3T2OA 1IS6A 3BY1A 1VJSA 4OI4A 1CJDA 2VQUA 5J48A 2Q8DA 3HR9A 3MW2A 4HETA 4LHSA 4OPSA 3PUNA 4D7SA 3VDDA 3I4IA 2A6WA 5KC6A 4RR3C 1UMHA 2ZGOA 1WA4A 2OS2A 3J4UH 1FATA 2DWRA 2GK7A 1OB5A 1HA3A 5JOYA 3KCYA 1TMF1 4XNFA 4DK0A 4N8MA 1FMD3 1YXWA 4JX0A 2AHOA 3E6BA 3ME2A 3AP9A 2WUHA 1FV2A 2XUEA 3MUY1 3UV9A 1RJ7A 4N90A 3OY8B 5IVVA 1S1AA 3ACHA 3UYJA 2BFUL 4P5YA 3VBOC 4ZU7A 4HXCA 1C28A 2E63A 4AK3A 2VNIA 3B78A 3BTXA 1PM7A 4PC3A 5FO1A 3IDCB 1K5JA 1RHI2 4DIQA 1EY2A 4HIZA 4I2OA 3GCXA 1JYXA 3IWZA 4MGYE 1OC1A 1WORA 3MIGA 2FDKA 2GC1A 3AVWA 2RM21 2PHFA 1MEC2 1F60A 3DKQA 1HB2A 4BQYA 2EIXA 2OBRA 4JKLA 4MO3M 1UW8A 1PIV1 1N06A 2YUEA 3ZM8A 3JB4C 1BEV3 4YW4A 1N3QA 1ONAA 3JZVA 5LK7B 4RA0A 4BOWA 3GSIA 2K2SA 3PUAA 3VBHA 5H9PA 5JXIA 4K9SA 3JQWA 4G1BA 1DDGA 1LHUA 2FBEA 1QOOA 1URXA 1LULA 2VBPA 4RL7A 1OD5A 5EZWA 4DXZA 5CFDB 1OHHA 3I3EA 4WVVA 4GD4A 3J81k 1RUG2 4Y4YA 4X06A 4WVMA 1HV0A 1V6KA 4MYTA 1Z7S1 1XOYA 1AUYA 4MXWA 3VDAA 4OI1A 1I8DA 1ULEA 3PUHA 1WPCA 2YMZA 5ANQA 4G6IA 3WLUA 2W1QA 4YW3A 5JPNB 4Q2FA 3WQBA 2ID4A 4H55A 3OYWB 4XABA 3H0OA 4UT5A 4X7DA 2F1LA 2J1AA 2CNDA 5FZ9A 1H4GA 3FHAA 4RGGA 4DEQA 3OZVA 1KC8D 3VZLA 4XDOA 5C5TA 1TE1B 2ENRA 2F43A 1M06G 2V4AA 1RHI3 3OBAA 4TMWA 2WYFA 5DDJ2 5FPLA 5GLZA 2A6VA 2WIIB 4AGVA 1W6QB 2HWF1 3PMEA 1TTTA 3AK0A 4P9WA 1PZ8A 2DTWA 5TR9A 5F3IA 1FX0A 3IMMA 2AZ5A 4XLHA 2R1DA 1QNYA 4CXWA 5F6LB 2VZRA 3FMGA 2VD7A 1W8HA 1Q8PA 5KHIA 2E6VA 1COV1 3E5QA 2HWE3 2LM3A 2XVLA 3A0NA 1EAH1 4JDNA 4QT6A 4DUVA 2VCBA 4MGTA 4Q1RA 4FOWA 4K1YA 3QFTA 2BWCA 1VALA 3NNFA 4II2A 5LASA 3GZEA 2XJVA 1SBDA 4YHBA 2PLFA 4HFSA 5FZIA 2X6WA 3OAAA 2Q6OA 4J0QA 2ZL7A 1H9WA 3ZXEA 1YJWB 2EAKA 5A33A 4C1WA 4PIXA 3TAYA 2LZJA 2C78A 4OOSA 2GNTA 2WABA 4K1ZA 4U9UA 1UIKA 4JGZC 4LBWA 5I91A 1RUG3 1LAJA 4UW3A 1MZ6A 3FN9A 3MDPA 1B2RA 1YI9A 4FI9A 3IMNA 4L92A 5BNPB 1H85A 1DGWA 4MGKE 1XE0A 3MLJA 5FMBA 4ZU5A 4Q4X2 2Y26A 3OF1A 1B23P 4IEZA 3ZDSA 4ARXA 5H59A 4YM0A 1R1ZA 3CXCB 1AJOA 2P3IA 3K48A 1H1MA 4KH9A 2DOGA 1OQ1A 5F8PA 5FP7A 2ZS6B 1F9KA 4AVSA 1MVEA 1SFNA 1ZA4A 2WZEA 4AEKA 2OQ7A 5DDJ3 5LA2A 1QOSA 1Q3EA 3CC2B 1QH6A 3VD5A 3SEPA 1U12A 3AKSA 2W5FA 4MSVA 3ZXFA 3FHIB 5TSWA 2FQPA 3KQRA 1YIJB 1LHVA 1YC61 2KA3A 1KTVA 3WEZA 1QGLA 4UI9L 2ZMNA 2I2SA 4AYUA 1RUE2 2ATFA 3FUOA 3SCFA 3PVNA 3THTA 1AYM2 2VXRA 5KHKA 2OW4A 2VBUA 4Z4ZA 4XMIA 1FYUA 4YZ1A 5C8CB 1SQ4A 3UESA 3PL0A 1O3RA 3FFZA 3B9IA 3VBUC 3A1PA 4WZEA 1DYPA 1NQDA 4XKVA 4CEWC 1UL9A 1CX4A 1PGL1 3QACA 1QUEA 2VTXA 1FDRA 2CHHA 1XFOA 2QQWA 2H0VA 1NUKA 4BYYA 2BW8A 4PDWA 4A41A 1KK0A 4M00A 4M53A 2LALA 5F5CA 1ZZ8A 1UZ0A 1YQCA 1R082 5HKKA 1GWMA 1JZ4A 3MFCA 4XLAA 4XF1A 1QIQA 4FOQA 4M4SA 1QU0A 5HXMA 4NPMA 5B4NA 2VOKA 3ACIA 1IQDC 2BP6A 5FWJA 1KRIA 5FPZA 2K46A 1G7TA 2WZR2 2YG0A 2ZEXA 4Q4X3 1PKVA 1YFUA 1HJFA 1K28D 1NA1C 4ES9A 1W6OB 3BPZA 3OFNA 3FLRA 4XFHA 4ZS2A 3RQ0A 4N3GA 1DG1G 4UF0A 2HJIA 4RD7A 4S2HA 1XU1A 2SBAA 4FAGA 1RQPA 5KNLA 5JSOA 3QH7A 5C9AA 3ES1A 2Y0OA 1GWLA 1HQWA 3O7OA 5IAXA 4LA3A 1O3QA 2E1BA 1QXPA 3C7FA 4V2VA 3JXSA 4Y5SA 5CFCA 1G7RA 1RUE3 4BPRA 4XJ9A 1AYM3 4JKKA 1J1LA 3TNPB 1IG3A 3K75B 2NYYA 1V5VA 1ZRFA 1JOJA 4OMCA 3CCLB 2D40A 3LOIA 2BTVC 1RYYA 3MO4A 4OYUA 3VBSC 2Q5TA 1W8ZA 2H0BA 4Y33A 1IPJA 4LR4A 1D2SA 3OD4A 4C90A 2ZX4A 3I3DA 3POSA 2B7BA 2BM0A 3VHRA 1O4TA 1NBMA 4XMAA 1V0FA 3CEWA 2P1BA 4GXLA 2Q1FA 3HOBA 2ZGQA 1R083 4PGOA 2IUWA 2JDAA 3ZZ0A 5JVVA 1RMU1 1UY1A 4FP2A 3WDVA 4CXXA 5SV8A 2O8OA 1GFF2 4W4ZA 1H8TA 3IAQA 1HJGA 3ZFEB 1H8VA 2ZBUA 5FOBB 4XIKA 3S5QA 2WZR3 2K0GA 3RVHA 4IL7A 5KHHA 3CDZB 5L7OC 3KCCA 2R0HA 1XYOA 1FNZA 2ZL6A 4SBVA 3U11A 5F4JA 3CCMB 5A32A 5F3GA 2O1QA 5L36A 4QPWA 1WMDA 3D0JA 3WNLA 5LY1A 3I8TA 3IIAA 5EFUA 4XLFA 5CISA 1WW6A 4XEZA 3ONUA 1M4WA 1NCQB 1O5LA 3H1MA 1T5EA 1TNFA 5CFDC 2OBSA 2W91A 4AZZA 5GZEA 3ZUGA 3QSYA 4NAMA 2YHJA 1RUF2 4E8CA 4XFGA 4SLIA 3RYPA 2UWBA 5E16A 1YJNB 2X6XA 4CCJA 2HWE1 3BNWA 1S4MA 1ZA7A 4IV3C 4OQ9A 2PQSA 4KMQA 4LIVA 2WPDA 5HCFA 1G9AA 3H1WA 3I2GA 4FPKA 3NV2A 3EJKA 3H7JA 1Q81D 5C8WA 1RVF1 2JDYA 4RD6A 3W58A 1CAXA 3J8F1 4TSFA 1HRV2 2ZBJA 4EE2A 3P5BA 2AH2A 3KV6A 4TN7A 3M8LA 2RC5A 2GC3A 3I49A 1K45A 1QH0A 3DN7A 1G8WA 4WV8A 2JG9C 4PBPA 3H9NA 2HH9A 3SCGA 2D3LA 2VBVA 1QJX1 1X8EA 1D0HA 3WHUA 2CF4A 1XJAA 3GBFA 4WM8B 3GF6A 2XHNA 2QA4B 3BUCA 1DQ0A 5FYTA 1ZM1A 4OHWA 2ORZA 1MR5A 2XBO1 3ZSLA 4F8AA 4CEYB 4RHV2 3HVDA 4OHYA 3I7DA 2BVNA 4FN5A 4XIOA 3O1MA 4MGQA 3GIRA 3BOWA 2HYKA 1VBB2 2W1SA 3PIJA 4ET7A 4Q4V1 5J37A 4IDZA 2Q1ZB 5A3PA 1JMUB 2WNEA 4M1KA 4HKLA 4B7EA 2LTNA 1ZRCA 1W2AX 1W2TA 3SJPA 2RR11 5FPAA 1KFXL 1WOSA 4Y1YA 4CU8A 5FNZA 3GNEA 5LBCA 1NX9A 4NAOA 1WOPA 5CDFA 3V0AA 5EPAA 1YHFA 2YZ4A 5JLVA 5T52A 1RUF3 4WVWA 5B4XA 1TVGA 1I18A 1SG3A 5FXVA 4XFCA 3KV4A 3ZFFB 5ANNA 3MIEA 2ZZGA 1HX6A 4B3FX 2DBIA 2JDHA 3Q8FA 4PF5A 5BNPC 3TN93 3T30A 2XDVA 4HONA 1FRNA 4ASMB 2AGSA 2R6QA 5EJ1B 4B29A 2YWGA 1J3RA 3HT2A 4R4XA 2Y6JA 4Q4W1 1ZBE1 1UOBA 4OLLA 4NRMA 4NVPA 2KD7A 2DYIA 1HRV3 1QJEA 2WDBA 4Z4YA 4PLNA 5ERLA 4XURA 2HDNB 1FT9A 4AF9A 3PHMA 3ILFA 5FL7A 4CU7A 4GALA 4K8RB 3POIA 3ZN5A 2Q8CA 1OA3A 1D4VB 1ODMA 3W5VA 4QHZA 2NQYA 1WDTA 3AZXA 1PJ6A 1HRI1 3JD71 5IAVA 5FA6A 5AVPA 1WLDA 3N35A 5JIUA 2VMHA 1JUHA 2V4VA 4AFDA 2ZGPA 2VZOA 1MVQA 1JZ2A 2VZSA 4LC0A 3WG1A 5A6XA 3DYMA 1E3XA 4Y1XA 1HZEA 2B8MA 4RHV3 2JENA 5KR7A 4NNJA 4TMXA 3OB8A 5C8CC 2WNVB 4OMDA 2W92A 3MZHA 1VBB3 3ASTA 4NCNA 4Z4UA 3JQPA 2HWC2 2PMWB 2ZEZA 4CUGA 3OEBA 4DY3A 5J09A 5J35A 4QB2A 4FQZA 1W2OA 4XYXA 1YO8A 1NG0A 5D8AA 4CE8A 1SACA 1B35B 5FLHA 5FK7A 3VBRB 2GALA 1LTEA 1G9BA 2XQRA 1ND3B 2VMDA 1XNTA 2WFF2 4X6RB 2JECA 3KM5A 3IZOA 1SPPA 3VZMA 2C4UA 4QX7A 4CU6A 1V6MA 2XJTA 4CU9A 3LIGA 1MACA 5KWRA 2DVGA 3OW7A 5CKNA 1UXXX 3NV4A 4FAHA 4R8HA 3T0AA 2BQPA 5A7WA 4CP9A 3D5OA 4RM0A 2VECA 2DY1A 1NJID 2RS31 3ASSA 2JG8B 5FUPA 3AMNA 1POV1 3ZSEA 4BDVB 5A1LA 3ZPNA 1HB4A 4Y4RA 4QX5A 5JOXA 3OD0A 3POEA 2E1RA 2CGOA 2X85A 1D7PM 1DZQA 2UU8A 5A3UA 5FZGA 2WKKA 4HLTA 4CDXA 1W6MA 4HK8A 2E32A 2VCAA 3WG2A 1WCDJ 1HXS2 2RDQA 1AYN1 2W39A 4P1VA 3JBG1 3M3IA 3GALA 4P08A 3M7AA 1QEXA 4WZFA 1WLTA 1FPN2 2VZQA 1KDKA 3FLPA 1WD3A 3POWA 1MQTC 3PVDA 4II3A 2WWSA 3LNNA 3SKVA 2E26A 3V65A 5CADA 1OPOA 2PLV1 3CP8A 4YALA 4GWNA 3OSDA 2BDRA 3JQXA 1RUJ2 2WL1A 2QQMA 4I30A 3KQ4B 2QNKA 4BQ3A 1W2BB 3L2HA 2JEMA 4NRQA 4B4DA 3OY8A 2JJ1A 4CUBA 4GH4C 3GM8A 5A3NA 1XQBA 1OQDA 2JIGA 2WC2A 5L9RA 4Z2WA 3LDRA 4QXCA 1IKPA 1LOGA 2WFF3 1GVHA 1GO2A 3CP2A 1XNKA 3HQUA 4UZUA 3VD9A 3QBQA 1YQ6A 2ZGNA 1RQRA 1JN2P 3NJZA 4LOTA 1K8AD 2WWJA 3ZFEC 3T2PA 2ZHKA 1JBCA 2EXHA 2GMEA 3CZJA 4ZZ8A 3DGTA 3A4UA 4WZTA 1HB3A 1Y0RA 3LKJA 4JGYC 5FZ4A 1ULDA 1BXHA 5H5JA 5JZGA 4HKOA 5FTTC 1AMOA 3WVJA 4TSVA 4BQXA 4OI0A 3OKXA 4N7UA 5CZKA 4K1XA 1X36A 3WDYA 5LCWL 4CXYA 4QB1A 3VBFC 4KKSA 3OGGA 1W0NA 2CDOA 1IPKA 4ZGQB 1JYWA 3NNMA 4EN0A 4BXSV 1PMIA 4FBFA 3R6KA 2Z2SB 1FPN3 2ZACA 3I3MA 4S2DA 5CFDA 3WDTA 4R9BA 2AREA 2WYSA 4CSWA 5EWSA 3OPTA 1UX7A 3SMHA 1YQ8A 4AXOA 3ACLA 3I56B 4QXKA 3J7LA 2HWB2 1I7PA 3Q39A 4FXKB 3CJIC 3EMRA 1GQHA 1RUJ3 3ZBUA 3AYCA 2BJSA 4M0NA 4QHOA 2EXJA 4RDKA 4DB5A 1BMV1 1JZ3A 4WVZA 2A3WA 4N43C 3H8UA 1R093 1WMXA 2QKDA 3NJYA 2VNGA 4B44A 3AVSA 2ZTNA 2N7GA 3JCIA 4I09A 3E6DA 2YWEA 5FZ6A 3CBNA 3NJVA 1VLNA 3DECA 3T56B 1DIWA 2XJQA 1W9WA 3LD8A 3LWCA 4EYUA 4EQVA 5BSYA 4HPKB 1W6QA 5DUXA 4Z8BA 3TN91 1UKRA 4YEJA 3AJZA 3B94A 4X7EA 3RYKA 3H3ZA 2AEYA 2JWPA 4CDUC 5DAQA 4LBZA 1X9PA 3ASRA 3WNCA 1W0PA 4Q4Y1 4AHYA 3LEIA 3ISXA 3K77A 2ZTGA 3AMQA 3W20A 2R9VA 3M3OA 1PGW1 5JCTA 4HVOA 3ZYHA 3LO8A 5FUIA 2VQ0A 1LU1A 2ZX1A 3D0SA 1YHQB 4P9XA 5A3MA 4L9BA 1KK1A 1VBA1 3GCWA 2J1EA 4RS5B 5LATA 4XFFA 1MS5A 1LOAA 3NWKA 4QVAA 3RJ2X 2HWB3 2QTZA 2IXHA 2B4KA 1W0OA 2W1UA 2P2KA 5K9YA 1XXNA 4AI8A 3CKHA 3LA7A 5IWFA 5JR2A 3MPPG 5BNPA 2HLEA 4HL0A 1ZREA 4CP0A 3CO2A 4YW5A 3NNLA 1W39A 4M4RA 3PVOA 1E5SA 4CPBA 3RMYA 4FVVA 2PE3A 4W6YA 2OX0A 3WCSA 4DK1A 3Q38A 3OZUA 1VBD1 1MS9A 2X0KA 4EWAA 4OVEA 3PLQA 3PTYA 1G86A 4FFIA 1G9CA 3IIIA 3ZC3A 1EUTA 3M3CA 4P9SA 3VL8A 1EV11 2J1TA 4XBLA 1UKGA 1VLYA 1G7SA 1NXMA 1O4YA 1CAUB 3WXPA 1VBC1 1G6NA 4IEYA 1N0VC 1SLBA 4IESA 4TLFA 2ZZEA 5CEHA 4CP2A 4UW4A 1VMHA 2B9UA 2FDIA 1GZWB 1I3HA 2EIBA 4BMBA 1FNMA 2YDEA 3V7AA 3NV1A 2WNVC 3I2IA 5C8CA 4LBLA 1ENRA 3H42B 2BGOA 1OF4A 1C8M2 1AL0G 3AMHA 4R4ZA 1XNBA 1G9FA 2RS51 5ABJC 3P26A 1RJ8A 3JU4A 3CB4A 3W2FA 1B35C 2B39A 1TVCA 3HNMA 3NSTA 4JDOA 1H1AA 1MZEA 1ND3C 3C2UA 3KGLA 1S0DA 1Z78A 3WXMA 5E88A 3WF1A 1NCRA 4EN8B 4IXLA 3RMXA 1UYPA 1P8JA 5A88A 5DXDA 3O1OA 4FT8A 3DUIA 3SEEA 1BBT2 3CTAA 1GAQA 4EWEA 5FZMA 2ET7A 3UNPA 4FQ4A 5CU1A 4QX3A 2YBKA 2JG8C 3U14A 1JJ2B 2QTLA 4LKSA 4P2NA 4QVJA 1W6OA 3ZYBA 2RG4A 4BQ2A 1QJY2 3ZMOA 5JAXA 1VJ2A 3WX5A 5I93A 1LJ7A 3BTZA 3FLTA 3WQ7A 4MV2A 2R072 3AMMA 4D6RA 3A8IA 2VGDA 1SFPA 2BGIA 4G7XA 3B3QE 2B46X 1RUNA 5JR7B 1VHEA 4COVA 4RPBA 4OPOA 1WW7A 1ND2B 4NHLA 3ZFGC 1HLCA 1PGSA 1DQ5A 1UPSA 1V9U2 3CC4B 2CSGA 3B9CA 3ZO0B 5GZDA 3OPZA 2A6ZA 3IBMA 1OA2A 2WINB 2XH6A 3POGA 4WM7B 4ACBA 5AFBA 5JBQA 4NUBA 4K6BA 1EWYA 2J1VA 4LORA 4LOSA 3PVEA 1CAWB 2JIZA 4FPHA 2J1RA 1C8M3 2C5BA 5DZGA 2VMEA 2B45X 5F7UA 2ZXQA 1N05A 3AVVA 1QHDA 4QQLA 5LA9A 3NW4A 2YROA 3OE7A 2D5FA 1FPN1 3ZIWA 3O0VA 4URAA 3AX4A 4FPOB 3VO2A 4QB6A 3OW2B 3NVCA 2GJRA 3WNXA 1SBEA 2W94A 3W9AA 2OKXA 2O8QA 4DOUA 1BBT3 2PAKA 4XAAA 3RWNA 3DXUA 3OOCA 3MMPA 3QOPA 1ZNPA 4OPVA 3ZFEA 4I0AA 4IE5A 1OLMA 2ZGSA 1I9RA 3PJYA 3BB6A 4COYA 1JU3A 1MABA 3FBYA 4BLIA 1LB2A 2J7KA 4GWJA 1JYTA 5EHDA 3OUJA 4XAEA 3TYJA 1AF9A 1OHFA 1AR81 1OFSA 1QJY3 1R091 1UD4A 3ZXDA 5LEKA 2R6HA 5EJZB 5C5UA 1UQXA 1AZDA 1GOGA 2R073 3HEIA 5GZCA 2PFWA 5BUVA 5IVBA 4CDWB 2F4PA 4AVBA 3LQEA 3GZAA 5LA1A 3LFMA 4NIDA 4IERA 1IPSA 4ZKTB 3FL7A 1HQNA 1GMMA 3AP4A 1QF3A 1NCQA 1V9U3 4HZFA 4PQ9A 3RNSA 1T6YA 3W5NA 5IT6A 3AVTA 2ZJCA 3WF4A 5HPOA 3N4MA 1TMF2 1OLRA 5GLVA 3RZZA 1VQKB 2E31A 1J83A 1U5IA 1Y9QA 4LBOA 4DS0A 3FE5A 1N1TA 3G71B 3JUUA 4M3CE 1F5JA 5JSRA 4LITA 4W8JA 1XNCA 2EICA 2DF7A 4M3CF 1WW5A 2H6BA 3DF0A 4LBQD 1O7FA 2MEV1 5FMDA 4NHYA 4K21A 4QPIC 3IDBB 4RR3B 4AEDC 3AKPA 1OLQA 5IYRA 2O14A 1OD3A 4QDQA 4X8IA 3AZVA 4RJLA 1HKDA 2XJUA 1DFQA 5BYNA 4QM9A 1UZYA 3MV11 4KQ7A 2VULA 3J7NA 2RM22 5KXBA 3WY6A 3D6EA 3ZX7A 1JW6A 4V1PA 1MS3A 4HSJA 3V76A 3I2HA 1PIV2 2RJ2A 2X05A 5BNOA 2VOTA 2QBXA 4WM8A 3VBOB 2PIAA 1JZ6A 4NO4A 4YGDA 1H30A 2Y38A 3GVLA 2X29A 4CEYA 3CQOA 1F8VA 3WDUA 2HLDA 4KG0A 1JODA 1K3IA 1C3HA 5FP8A 4QPYA 1GYKA 3DYOA 4N53C 4COWA 4HVQA 3A8KA 2VJXA 2XNJA 1YRZA 1JS9A 2W3JA 4RQPC 1IG0A 3RWKX 1CGPA 3QLQA 2C5DA 4GJYA 2BVVA 4KBBA 1ENQA 1Q86D 2R32A 4BK4A 4IEQA 3G6EB 2XKPA 2V09A 3THPA 3CJXA 3LOBA 2QE3A 3KF3A 3AJYA 1TMF3 2P5BA 1F15A 1Z7S2 4RCZA 3L2YA 1A78A 2P3YA 4UW6A 5EJ3A 3ZFFA 2BNNA 1AX2A 1FRQA 2A70A 1OH3A 5L46A 2GP3A 4NIHA 2GNBA 2FCVA 2D6NA 3WG4A 5KBFA 3SJZA 1QJZA 4UFKA 2ZOEB 4PQQA 1V0AA 2QMUA 5FOJB 4IE6A 3H50A 3I59B 3WUCA 4CCNA 3OGRA 5T5JA 1ZZBA 2E7TA 1XE8A 5F4OA 1FNCA 1LGCA 2HWF2 4XUPA 3GBGA 1J58A 2RM23 3R05A 2XJSA 1CPNA 1ZM9A 2I74A 4P6YA 3UK9A 4D6SA 1KQRA 3W2GA 3BH4A 3WQ0A 1SDWA 1D4M3 1AL23 2VVEA 1CAVB 1COV2 1W35A 1EAH2 2UYAA 3IPVA 1E1QA 1G7CA 2PHLA 2VMCA 4EN6B 1QQP1 1DU3D 4N9IA 2PN5A 3APBA 4LT5A 2C2WA 4RSUA 4X07A 1REFA 3USSA 5FY9A 1GZTA 3KLSA 3ACGA 1MPXA 4QKFA 3PA1A 4LA2A 3CZUA 3K4ZA 1VHOA 4ZCMA 2YXSA 2RJKA 4AW7A 2WS91 1XBFA 2D7FA 4A44A 1PK6B 5LW9A 3Q8CA 3SLIA 3VBRA 3OTFA 3U37A 5JXHA 5L19A 1UOJA 1ZX5A 4OUEA 1Z7S3 3R0RA 4LBQB 4NPRA 2AYHA 2GMMA 1T6BX 4TZDA 2WA3A 4XW3A 1POQA 1YJ9B 4JHTA 4BZ4A 2YV8A 4FCAA 1VQMB 2DU0A 2ZGRA 3VKFC 1EP1B 2EIEA 4XTPA 4KL1A 1EP0A 1E1RA 2AACA 1I5PA 1GWKA 2IXJA 5LRSA 2DVBA 3CRZA 3UKNA 1Q8SA 4FPLA 4E4DX 4JGZB 1W3XA 5DAWA 4YZ4A 2YFUA 5FZ3A 3VV1A 1V70A 2BNMA 4XBQA 3LEGA 1H0BA 3E1F1 2VTFA 4TN1A 5K0UA 1BPLA 2BERA 2DFCA 2Y6HA 1LU2A 2BNOA 4X7CA 2VUAA 1F4AA 5FCCA 4LQRA 1TQ5A 4QKBA 2UWAA 1S0CA 1QFJA 2RDNA 3N7KA 2JICA 4M0LA 3WF0A 1COV3 3DPRC 4F3JA 1EAH3 2WNUC 1SLCA 5L9BA 4A7KA 4QX0A 1VBE1 2VW0A 4WM7C 3VKLA 2VJJA 3KV5A 3C7GA 3PU8A 4QXHA 2HMAA 5A89A 1XSQA 4XF4A 3B93A 2D9RA 3PUQA 4KU8A 3WT3A 3P27A 1PGL2 2FZ2A 1W05A 1Q8QA 1CJPA 4QQOA 3ES9A 3WDXA 1RUH1 1Q82D 1GP5A 5D21A 4QX2A 4YM1A 4LK7A 2XB6C 2P37A 2YYOA 1VRH1 1GR1A 4OHXA 2Q6LA 4NBSA 2EXKA 3HT1A 1OGJA 1ZYBA 4P02B 3LZZA 3AB0A 2Y8KA 2BSAA 4MXVA 2EFGA 1HB1A 3VBUB 1O5UA 2XMLA 4CEWB 3C3VA 4K20A 4DXRA 2BN4A 4MGZE 4HE5A 3QD6A 2Q6KA 4AI2A 4BQ5A 5CA6A 1UOFA 1H4HA 4Y3OA 4O9EA 2PAMA 2VPVA 2ZX3A 4LEJA 3HBZA 3OPWA 3HN3A 2QQIA 4YW7A 1GR3A 1NZCA 3O0XA 4W50A 4FTBA 3SH4A 5FZOB 2AENA 3DYPA 3B69A 4LULA 3T1LA 4ASLA 1N1YA 1O91A 3KZ4C 2TEPA 4M2LA 2TBVA 1HW5A 2CBXA 3AFGA 4UXAA 1KRHA 1YLOA 3O1TA 1BX0A 3VN4A 2P17A 1ZRRA 5F3CA 2CW5A 1CR7A 2B5OA 5FZHA 4K7JA 1LNSA 3W21A 3CCVB 1VQ6B 1O3SA 1GQGA 1Y3TA 4KNCA 2QQKA 1DLLA 4KU7A 5HCHA 4KBZA 4YVWA 2P4EA 2A71A 2IC1A 2QTWB 3A3BA 4KKTA 2Z4FA 1GLHA 5BV6A 2PHWA 5EQUA 3GHMA 2VZTA 4DO0A 1F35A 2KR2A 1VE0A 5IK5A 3GXUA 5C6CA 1OBNA 4TLGA 1RMU2 2WSUA 4QFMA 1TME1 5B2GB 5IATA 1R1A1 4QQHA 4L0PA 4DZGA 4DXSA 1V6JA 3VBSB 5A3LA 4AI3A 3EO6A 2GREA 2MNGA 4AFMA 4HPKA 1OH4A 1H6XA 2C6SA 1OF3A 4CCKA 1K5MB 1OGIA 4QGLA 3AKRA 4XUTA 3RS6A 4NN0A 4XKWA 2WFPA 1FNYA 3TEWA 3RI9A 3PJQA 2ERFA 3BOPA 4HOOA 1US2A 4LO7A 3IKWA 4L2NA 2JJ2A 3WBKA 1XPWA 3THCA 4Z07A 4L8JA 4C43A 2WAOA 3OGVA 2WR8A 2QEXB 4F83A 5C70A 1XU2A 1VQ9B 1W34A 4GQNA 2XLGA 1RUD1 1Y9MA 2R061 4URTA 4LHKA 2W95A 4NIAA 4IGPA 3WY9A 5FZEA 4GJZA 1HV1A 1JB9A 3OG2A 1MZ5A 1D4M1 4JC1A 1AL21 5L7OB 3OJWA 4XL9A 1GAWA 4L99A 2WBKA 2HWE2 5FIXA 1Y0YA 4TMZA 3ZZTA 1NT0A 3CCUB 5AN9A 4RS5A 5A3OA 4YM3A 3VZJA 2GAUA 3H94A 1W03A 3E5XA 2OUHA 3ITQA 5GLTA 2XJPA 3BGAA 3WP5A 3U2QA 4KWLA 3I55B 3V64A 2XLFA 4X8PA 4XCBA 2W46A 1LENA 5E8AA 4XQFA 1KJRA 1RVF2 3PA2A 1V6IA 3J8F2 2FCTA 3MFAA 1VB4A 1AX0A 4LBJA 5F1RA 3ENRA 4XOTA 5FZ7A 5FZ1A 3PDQA 5FIUA 5BNNC 3KGZA 5LWBA 3HIFA 1RMU3 5E6TA 3ZXKA 2FVGA 1LEDA 2WN2A 4IV3B 3POBA 4DQKA 2RS13 5I8TA 1QJX2 2IXKA 5IHRA 5F5QA 3S7EA 3CCJB 3G7DA 4DINB 2Q1MA 4K40A 4YG3A 2OYZA 1Q7YD 1Q8OA 5K4LA 1RTVA 2XGXA 1DP0A 2BFUS 2XBO2 4EZHA 1CAUA 4META 1CESA 4OUSA 3T2QA 2JDPA 4AR2A 2Q4SA 1E3ZA 4PI2A 4UFJA 4U36A 1E64A 3WG3A 4Q4V2 3AKQA 1GZWA 3O1SA 4COUA 1FI2A 2JG9B 3E20A 1E62A 1Q43A 3LF7A 4GQ7A 5BPXA 3ZSJA 2RR12 3K3NA 1ZZ9A 3X29B 3RZJA 2XL9A 1UAIA 2QE7A 4AFCA 1N8RD 4YVSA 1PK6C 2ZABA 2AC1A 5JDBA 3FUQA 2GSYA 2VNOA 1PJ7A 4PF1A 4A2UA 3KB5A 5FBJA 2A6XA 1PVC1 5C3QA 2QUOA 1W9YA 2R043 2VM9A 5IVJA 4AWDA 5IK7A 1N47A 3W59A 4CDQC 2P3JA 3UETA 4E4HA 5K8SA 3J7MA 4XFAA 1SFYA 5IK4A 3SKBA 4YG0A 4P9YA 1JZ7A 3N9LA 3VHOA 4DPNA 4UBGA 4LLOA 4Q4W2 1ZBE2 1LOCA 1OXCA 1RVF3 3EHKA 3J8F3 3URFA 2D3RA 5JMOA 3J9SA 2O0OA 3N36A 3CNAA 2MPFA 1ULOA 4BIFA 2ZGTA 4YM2A 3POFA 3H3UA 1SMVA 1W3VA 4XN3A 1OURA 2E53A 1CN1A 3AVUA 1MS8A 3GHNA 5J7MA 4CCMA 3S5AA 3NQHA 4QV2A 1UD5A 3CD6B 1QJX3 1HRI2 3JD72 4MYEA 2ZPXA 4FK8A 1KD1D 4PT6A 2PHDA 2WT2A 5CBLA 3UGHA 4YW6A 1S0UA 5FV3A 4FP3A 1ND2A 3C7OA 3BTAA 4XCAA 4D7TA 1LOFA 2XBO3 1RUI1 4JMQA 1KFUL 2Y0IA 3USUA 2ZZJA 5IFPA 5FAXA 4QD2A 4DXTA 2A5ZA 3HQRA 4A7YA 1P4MA 3FC0A 4JZRA 4Q4V3 2CY6A 4WM7A 2VR4A 5FMOL 3OEAA 5DN6A 5HCBA 4RFRB 4XORA 2RR13 1CAWA 1V0EA 4AE2A 5DPNA 1UIJA 3LFIA 1BQEA 4G1VA 4GMP1 2Q6IA 5CFCB 1WKYA 1UZWA 1X8MA 5DSZA 1V6LA 4ZGNB 5AC91 5IK2A 5GM0A 3AYAA 3AVYA 1U5XA 4ACAA 2VVFA 4XZPA 5I0TA 2FCUA 3MLLA 4JHZA 4AI1A 1H8EA 2HWD1 4UOJA 4TKOB 1W06A 5FY7A 5A3WA 2CDPA 3NV3A 2E7AA 3QFSA 4AHXA 4GB31 1O4ZA 3AXDA 3VD3A 2RS32 4JCKA 3WSOA 4Q4W3 1ZBE3 2ZXHA 3MICA 1I6XA 3CESA 2LRPA 1U0AA 2XQXA 1AR61 4EN7B 3UJQA 2ZBVA 3Q6RA 1ZRDA 4CUCA 1QMJA 4D69A 2OUJA 5F2WA 3CCQB 1KITA 2DETA 1POV0 4L11A 4QUZA 5JOWA 5APAA 3W2HA 1QY4A 5T5OA 1UU4A 1UWWA 1DGWX 1H8TB 1AYN2 1LHNA 3ALQA 2W87A 3JBG2 4Y5TA 3UKTA 2W52A 1HRI3 4AVZA 5FO0A 3JD73 1CZSA 2DTYA 4L97A 4CDWA 5CB7A 1VIWB 4AG4A 5IYYA 4BU2A 1VQ8B 3WNPA 2D6OX 3IN9A 2NPFA 5C3RA 2F4LA 2QZ2A 1X7NA 3BCFA 1J3PA 3SLNA 4PHZA 1BLZA 2BUKA 2PLV2 1LRHA 4MVTA 1XNAA 2PTMA 1NY71 2C4TA 3VO1A 1GOFA 2OPWA 3VBHC 1Q9SA 4ATFA 3E6CC 4B1MA 3I1FA 4E2SA 3ZYGA 4MHUA 4QWNA 5AFEA 4QPGB 2E33A 5FYIA 1DQ2A 2G9FA 1X33A 2ETEA 1ALYA 2V7VA 4IQPA 4NHMA 2OA2A 3ZBTA 2D43A 1JNYA 1OUXA 2V4DA 2Q0AA 4MOAA 1ULCA 3FWEA 5H9QA 3U78A 1MQTB 2OQ6A 5DUWA 4RR3A 3ONYA 2ZGLA 3B7MA 4LJHA 4FPCA 5EV7A 4KGQA 1RC6A 1C5HA 2B7CA 5TV2A 3KMHA
chains in the Genus database with same CATH topology
5K0UB 1C1LA 4R4ZA 1XNBA 2D6MA 2CL2A 3VLBB 1UW8A 5BNNB 1PIV1 1G9FA 2RS51 5ABJC 3BIWE 2I07B 1R081 2YUEA 3JB4C 1BEV3 1RJ8A 4PIYA 1LOEA 1N3QA 1ONAA 4YW4A 3JU4A 3JZVA 3E97A 5LK7B 4RA0A 1B35C 2B39A 4HN1A 2RS33 3RG0A 4BOWA 1POV3 2K2SA 3NSTA 4S2GA 1RUD3 3V56A 4JDOA 5LRRA 1H1AA 1MZEA 2D98A 1ND3C 3C2UA 4X8NA 1CAXB 3KGLA 4HSLA 2R063 1DBNA 3BC9A 4LBNA 1S55A 1MZFA 1S0DA 1Z78A 4GH4B 1K5MC 3VBHA 5E88A 2IXLA 2CGNA 1NCRA 4DRRA 4B7KA 4EN8B 4IXLA 3RMXA 3ZXAC 1APNA 2WLPA 5H9PA 3VBOA 1XYPA 4K9SA 5DXDA 4AFAA 2D44A 2WZR1 4LBMA 2C0ZA 3ELNA 4PCRA 4FT8A 5FRAA 1PVC2 3JQWA 5T50A 3OJBA 3DUIA 4E27A 1BBT2 1LHUA 2FBEA 1QOOA 1URXA 4DQAA 1LULA 4RL7A 2NN8A 1OD5A 1SKYB 5EZWA 4EWEA 4RFT0 4XF9A 4DXZA 5CFDB 4S2FA 1AYN3 1OHHA 4QMAA 1ZVFA 3G6JB 2ET7A 1LHOA 3D8CA 1BQPA 1RINA 4FQ4A 4HANA 4WVVA 4AHZA 3FX3A 5CU1A 1RUG2 3JBG3 5ACA1 2JE7A 4Y4YA 4WVMA 2JG8C 2PHUA 2RS11 2WSSA 1BLIA 5HXVA 1W6OA 1HV0A 4P9IA 2ZHNA 4GULA 1V6KA 3BCDA 2WNVA 2JDZA 2HWC3 4JDMA 1QJY2 3ZMOA 4OUMA 5JAXA 1VJ2A 1TNRA 3WX5A 5I93A 1Z7S1 1LJ7A 1AUYA 1EYBA 1UMZA 4QGMA 1OI6A 1C1FA 2KVOA 4MXWA 2W08A 2B7YA 3POYA 5JI7A 4FOYA 4OI1A 1I8DA 1XQNA 3FLTA 4JGYB 3WQ7A 4MV2A 1WBLA 2R072 3AMMA 4FXUA 1QXJA 1ULEA 1WPCA 2YMZA 2PLV3 2VGDA 4G6IA 5ABJA 2WJSA 3WLUA 4YW3A 2XZOA 5JPNB 4Q2FA 4D3WA 2OPKA 2GC0A 3OYWB 2AR6A 4H55A 3OCPA 4G7XA 3B3QE 2B46X 3H0OA 3ILRA 1RUNA 1B35A 5JR7B 1CD3G 5F9TA 3B01A 3VL9A 3AZZA 4B4QA 4COVA 5HBAA 1ND3A 1H4GA 4WZCA 3VBFB 1WW7A 4RGGA 3ECQA 3GYDA 2ZXIA 4I3GA 2GH2A 4P14A 4XPVA 4AQSA 1ND2B 1PO11 2Z69A 4NHLA 3ZFGC 1HLCA 1PGSA 3WP6A 4CDQB 4Q26A 1DQ5A 5JPMB 4OI2A 1BMV2 3VZLA 1UPSA 1X50A 4QQ2A 1TE1B 1V9U2 3B9CA 2ENRA 2F43A 3ZO0B 5GZDA 1M06G 1RHI3 4I02A 4JRAA 5DDJ2 3OPZA 4Y22A 1OOPC 2AUYA 1YNAA 2ZA9A 5GLZA 4FPEA 2X5IC 2A6VA 2WIIB 2A6ZA 3IBMA 4AGVA 1OA2A 2WINB 2XH6A 1EFRA 1QKQA 3RRDA 1W6QB 1LHWA 1GV9A 2HWF1 3PMEA 4Z82A 4WM7B 3E5UA 1RUI2 3AK0A 1NLSA 4P9WA 4QHBA 5AFBA 4C1XA 1PZ8A 2DTWA 3I59A 4XQ4A 3L9JT 1DYKA 4K6BA 4BQ1A 1FX0A 3V0BB 2JG8A 4AEMA 4W6WA 3H9AA 4FTEA 2R041 3PVEA 1CAWB 2DCKA 3B02A 2JIZA 2AZ5A 4FPHA 4XLHA 2R1DA 1C8M3 1QNYA 3CMMA 5F6LB 2V31A 1ASJ1 2WLQA 5DZGA 1ZZ7A 3FMGA 3WD5A 3ZVXA 3CJIB 1Q8PA 2A73B 2B45X 4ITCA 3TN92 5KHIA 1DGRA 2E6VA 4JVAA 4BMEA 4Y1ZA 3RYRA 1COV1 4E4ZA 3E5QA 1C5IA 1QHDA 3WR0A 2HWE3 2LM3A 4QQLA 2XVLA 3A0NA 4JAAA 3NW4A 3SISA 3WHTA 1EAH1 4JDNA 4QT6A 1HXS3 2YROA 4ONUA 1DGRN 4A7ZA 3MF6A 3OE7A 4Q1RA 4FOWA 4QQPA 2D5FA 4K1YA 2BWCA 5FREA 1FPN1 4HBNA 1VALA 4MH0E 4BLJA 3ZIWA 3ZYPA 4N43B 3WW2A 4II2A 4J1WA 3O12A 3O0VA 4XQDA 3AX4A 4FPOB 4IV1C 3KCXA 4BM8A 4IEUA 2DCYA 4DFSA 4DMIA 2XJVA 3NVCA 1SBDA 2GJRA 2CAVA 1NCQC 4HVRA 1CAVA 4Q4Y2 2ARBA 3WNXA 5T5PA 4HFSA 5AC92 2X6WA 3OAAA 1SBEA 1QJU1 4HMZA 3BCWA 3ZFGA 5KC5A 2Q30A 3W9AA 3ZN6B 1PVC3 2O8QA 2W6JA 4DOUA 1BBT3 1H9WA 2PAKA 4D7YA 3RWNA 3OOCA 3ZXEA 5A33A 2EAKA 2EVXA 2VQAA 3I54A 4R9AA 4C1WA 4PIXA 4YGEA 3QOPA 3TAYA 2LZJA 1F2NA 5BY5A 2HWD2 2GNTA 1ZNPA 2ZGKA 4K1ZA 4NHKA 4GMP0 5LEJA 3ZFEA 4I0AA 2IFRA 5FO7B 1UIKA 4YFZA 2QDRA 2ZGSA 1AVBA 1I9RA 3AFKA 3PJYA 4JGZC 5I91A 1PGW2 1RUG3 3BB6A 2EF6A 4NWVA 4COYA 3RI8A 4H7LA 4UW3A 1MABA 3FBYA 1W6NB 4BLIA 1YCIA 1LB2A 1MZ6A 2W6IA 4YW1A 3MDPA 4GB32 5I0UA 4CP1A 4YVWB 1YI9A 3TYJA 1AF9A 4XJZA 1OHFA 1AR81 1OFSA 1QJY3 4K3UA 1R091 1UD4A 4FPYA 3ZXDA 3IMNA 1VBA2 1YIPA 4L92A 5J3UA 5LEKA 1LEMA 2HEYF 2JJ6A 4MX3A 1UD2A 1ZBA3 5BNPB 1LGNA 1DGWA 4CDUB 1AZDA 2R073 3VDDB 5GZCA 1AR62 4N9HA 5LK5A 4MGKE 5JI9A 2PFWA 3MLJA 1H2KA 2D6PA 4ZU5A 5BUVA 2ZAAA 3J26N 4AQTA 4Q4X2 2Y26A 4CDWB 3OF1A 3QCWA 4FPGA 3S30A 4IEZA 2F4PA 4AVBA 3VGIA 3GZAA 1UN1A 1D0GA 4LBQA 2V5YA 4X6QB 3ZDSA 4Q0PA 4YM0A 2XZLA 1R1ZA 1RUF1 4IERA 4ZKTB 1AJOA 2YC0A 4XD7A 2XVGA 2P3IA 3K48A 3T2TA 1H1MA 1J1TA 4KH9A 1HQNA 1OQ1A 4GKXA 3AP4A 3MYXA 2ZS6B 1F9KA 1QF3A 2RMU1 1NCQA 4AVSA 1MVEA 1SFNA 1V9U3 4HZFA 4PQ9A 2WT0A 3RSJA 3RNSA 1ZA4A 2JKBA 4PBOA 5IT6A 3GZUC 4AEKA 1FXZA 2ZJCA 5DDJ3 1SLLA 4PDWC 1QOSA 1Q3EA 1QH6A 3N4MA 1TMF2 3AZWA 1OLRA 4YZ2A 5CG9A 5GLVA 3RZZA 1U12A 1VBD2 3AKSA 5BNOC 5KHJA 3KEWA 4WM8C 4MSVA 3GVKA 5AVAA 3ZXFA 3PMSA 3FHIB 1U5IA 1Y9QA 5TSWA 1RUI3 2FQPA 2ZHMA 4JGZA 4LBOA 4DS0A 3FE5A 1N1TA 3KQRA 2D6LX 1LHVA 1LCLA 2KA3A 2PELA 1LESA 3JUUA 3FBMA 4ES8A 3NO8A 1NY72 4M3CE 1F5JA 2H6CA 5JSRA 4CEYC 1XNCA 4JV4A 5BXXA 4M3CA 1HRV1 2X8KA 1QGLA 3WW4A 2ZMNA 2I2SA 2PHXA 3HD8B 3CU7A 2DF7A 3JU9A 4AYUA 1RUE2 2ATFA 3FUOA 4M3CF 1EV12 3SCFA 1AL0G 3PVNA 1WW5A 4W65A 2D5HA 2H6BA 1IOAA 3THTA 3DF0A 3B00A 3O0WA 1AYM2 4LBQD 1O7FA 3ZSKA 2VXRA 5KHKA 2HKXA 2MEV1 3WP3A 2OW4A 4K21A 1UX6A 4QPIC 3IDBB 4RR3B 1COWA 4YW2A 4XMIA 1VBC2 4AEDC 2D6KA 1IS3A 3FJSA 3AKPA 2ET1A 1FYUA 4YZ1A 1WMFA 5C8CB 1SQ4A 1OLQA 4GMP3 1O3RA 3FFZA 1ULFA 2GJKA 3B9IA 3LGRA 3VBUC 3SH5A 2CYFA 1DYPA 1NQDA 3AZVA 1AR91 1W6PA 4Q4Y3 4XKVA 1HKDA 1IS4A 4CEWC 1GANA 5AC93 1UL9A 2P34A 1CX4A 1W6MB 2XJUA 1DFQA 5BYNA 4QM9A 1UZYA 4KQ7A 2X53S 2VULA 1RB8G 2RM22 5KXBA 1PGL1 3WY6A 3QACA 4PIZA 2PHRA 3D6EA 3ZX7A 3A0KA 3ZYIB 4HK9A 1SBFA 1JW6A 1SLTA 4V1PA 3VZKA 2PYTA 2HWD3 2H0VA 3RJRA 1MS3A 4XJAA 2HEVF 1U5ZA 4GWMA 4BYYA 2BW8A 4HSJA 4PDWA 4M00A 2LALA 3VBHB 3ZFFC 4TWTA 4RHV1 2E7QA 1PIV2 1ZZ8A 2UY9A 2E9QA 2EALA 4OFGA 2RS52 5BNOA 4WM8A 1OFNA 3ES4A 3GZTB 1R082 2D3NA 3VBOB 5HKKA 4GB33 3ILNA 4NO4A 4YGDA 3EXUA 4R9DA 1VBB1 2ILMA 3MFCA 4XLAA 4XF1A 1VBA3 4FOQA 1U5YA 5CFCC 1H30A 1QU0A 4B4RA 1N3OA 2Y38A 4XR6A 3GVLA 2IXIA 2X29A 4R9CA 4CEYA 4OHVA 2VOKA 3MGUA 4LNVA 1F8VA 5FFOC 3U0ZA 3WDUA 1AR63 2HLDA 4KG0A 1KRIA 1ENXA 5FPZA 1CIWA 3NKGA 4XXPA 3SITA 1C3HA 2XPJA 2WZR2 4WVMB 4Q4X3 1PKVA 4QPYA 1YFUA 2XKOA 1K28D 1NA1C 5IUQA 4ES9A 4QPIA 1W6OB 3NAPA 5C4WA 1GYKA 4N53C 1IGOA 4XHBA 4COWA 3BPZA 4AEDA 4HVQA 4FO9A 3OFNA 3FLRA 3R6SA 1YRZA 4K8FA 4XFHA 3RQ0A 5CAZA 2BVBA 1X82A 4RQPC 1CGPA 2Z79A 4MXWB 2HJIA 3QLQA 4RD7A 2GU9A 2C5DA 4S2HA 3VBUA 1XU1A 2BVVA 4KWKA 1PNFA 5ACA2 4KBBA 1ENQA 2GC2A 2RS12 2SBAA 2R32A 4CEWA 3U4XA 4IEQA 4INDA 4J1XA 3AYDA 4FAGA 2XKPA 2V09A 3THPA 5ABJB 2XUMA 3CJXA 2BGCA 3AP7A 2WQ4A 3LOBA 1ZZ6A 2QE3A 3D82A 3AJYA 4P9LA 5KNLA 1TMF3 5JSOA 1Z7S2 2VVDA 3QH7A 3TRSB 1VBD3 5C9AA 3L2YA 3ES1A 1A78A 1YJLA 2RJLA 3LB9A 4UW6A 4YARA 3HAGA 1WD4A 3KT4A 2KXLA 2Y0OA 5EJ3A 3ZFFA 4C91A 4BE3A 1RL3A 1HQWA 3O7OA 4AHWA 2BNNA 1AX2A 4LA3A 3OBRA 2A70A 3VZOA 3OEEA 1O3QA 2E1BA 1H8TC 4AQ6A 1QXPA 1OKQA 1WLWA 1C57A 3CF6E 5CFCA 1FOD3 4Y22B 1RUE3 5DZFA 1EV13 2WQZC 4C0HA 2GNBA 2D6NA 2UWCA 4AI0A 1I5ZA 3WG4A 3FKSA 5KBFA 4C0BA 4XJ9A 1AYM3 2GNDA 1PO12 4FOVA 1J1LA 4JQRA 2KM2A 1QJZA 2ZOEB 3TNPB 5FOJB 3WUDA 2NYYA 3GBWA 3H50A 1ZRFA 2NMNA 1VBC3 3I59B 1JOJA 3WUCA 2DVFA 1WP6A 2CNAA 2D40A 1CQ9A 3LOIA 2BTVC 2ZMLA 3DDYA 2DCJA 2ZCWA 4YVSB 1NA1A 5T5JA 1ZZBA 3ROUA 5FDBA 2E7TA 5JZGB 3VBSC 2Q5TA 4N53A 2H0BA 1XE8A 1GKBA 1LGCA 3DV8A 1IPJA 2ZMKA 4LR4A 4AGRA 1MS1A 1D2SA 2HWF2 4AVAA 2EA7A 4RQPA 5DZEA 3OD4A 3HN1A 2VJIA 3GBGA 3VBRC 4C90A 2ZX4A 1J58A 3POSA 2RM23 3R05A 2XJSA 1CPNA 4UW5A 2I74A 3UK9A 4XOPA 2WA4A 3TOJA 3VHRA 1O4TA 2R042 5KHGA 1LR5A 1KQRA 1PVXA 1NBMA 1XE7A 4XMAA 1V0FA 3CEWA 2ARXA 5KXDA 3BH4A 1ASJ2 3SHRA 2R49A 3WQ0A 4QPGC 4MUVA 3OGJA 4GXLA 1SDWA 1D4M3 2A3YA 1AL23 2R1BA 2RS53 2ZGQA 1R083 2VVEA 3WW3A 1CAVB 1COV2 1C4RA 2YGLA 3A3GA 4B3NA 4E2QA 3NL1A 1FAYA 3ZFGB 1EAH2 2UYAA 3IPVA 1E1QA 2WJYA 5JVVA 2PHLA 1RMU1 1RUC1 4FP2A 4EN6B 3WDVA 1QQP1 1DU3D 5SV8A 4N9IA 2HWC1 2O8OA 2PN5A 1J59A 1GFF2 5A33B 4DNRB 1L3JA 3APBA 1YUDA 5DG1A 4LT5A 3WCRA 1H8TA 4RSUA 2OZJA 1REFA 3USSA 3ZFEB 1H8VA 3KT1A 4YLZA 1W0JA 4E4SA 3KLSA 5FOBB 4YGBA 4XIKA 4CTEA 1I1EA 4I3PA 2WZR3 2XWBB 1QJU2 2K0GA 2WSVA 4N7IA 4Q0VA 5HCAA 4YNIA 4ZU4A 5J98B 1RUOA 4LA2A 4LO5B 4IL7A 5T5LA 5K0UC 4Z1MA 3KD4A 1AX1A 2WFF1 2YXSA 5KHHA 2RJKA 4AW7A 2WS91 2VMIA 5CVRA 2Z5WA 5L7OC 2CAUA 2D7FA 1VR3A 1PK6B 1NE6A 3VBSA 3KCCA 1H9PA 3R4UA 2PQQA 5ACA3 2R0HA 2CWSA 1LOBA 1FNZA 1XYOA 2NM1A 1DQ4A 4SBVA 3SLIA 1MS4A 3U11A 1QXRA 2FMYA 3OTFA 2WZPP 3VBRA 3LAGA 5A32A 3TBDA 2OZ6A 2GZWA 5L19A 1AR82 3ZXLA 4XOGA 1ZX5A 1R092 4JRLA 4BIOA 2F6BA 1KZLA 1K5MA 2O1QA 4W6XA 5L36A 1Z7S3 1WMDA 3R0RA 4LBQB 3D0JA 4NPRA 2AYHA 2GMMA 3I8TA 4TZDA 2WA3A 2W68A 3VKOA 4E9KA 3IIAA 4XW3A 5EFUA 4FXGB 4XLFA 4LUKA 3USUB 4BZ4A 2UYBA 1WBFA 1WW6A 5L73A 2YV8A 4FCAA 2DU0A 4GA9A 4XEZA 2ZGRA 1M4WA 4NWWA 1AXZA 3VKFC 3N7JA 1NCQB 1O5LA 4XTPA 3H1MA 4KL1A 1T5EA 1TNFA 5CFDC 1EP0A 2DCZA 4LLFA 1E1RA 1GZCA 5GZEA 2JDIA 5F6KA 3SH3A 4Q29A 2IXJA 1LECA 5BNQA 2DVBA 5LRSA 2C9AA 2DURA 2YHJA 3UKNA 1RUF2 1PO13 2V73A 4LO6B 1MEC3 4XFGA 1Q8SA 4ISRA 4FPLA 4SLIA 3ZN4A 3RYPA 2UWBA 4E4DX 1WCSA 4GIQA 5E16A 3VKNA 2X6XA 4JGZB 2RMU2 4IEVA 3SXWA 3HWJA 2HWE1 4YZ4A 4XJ8A 4IV3C 1HXS1 3VV1A 1V70A 2BNMA 4XBQA 1H0BA 3M3QA 3O14A 4LTAA 1F31A 1PO21 4EV0A 4M3CB 5K0UA 1BPLA 2DFCA 1LU2A 3WZ1A 2ZAHA