2X53S

Structure of the phage p2 baseplate in its activated conformation with sr
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
298
structure length
298
Chain Sequence
b'GVRQYKIHTNLDGTDDKVWDVTNGKVRFYQPSNLGLQSTNNIWQSNGIGVMGTRSITQPQIEFKLETFGESLEENYQLMKDFVNDILSKKFVTLEYQTEIFQVYADLALADVTKTEGYGKNGTFSEKITFDIITKWYTYENLTFDKIQNGKVIAGMSKIYGGTAPGNYKYIKGTSYTYYGESDIDRLSRWDIKEEIFSFMGILYPKLPKTPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQGWKGTTALNLFPVMDFERYRTRIIEKGQMELINLSKAEFKIKRKADFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF16
molecule tags Viral protein
source organism Lactococcus phage p2
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
total genus 53
structure length 298
sequence length 298
chains with identical sequence T, U, V, W, X
ec nomenclature
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.210 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x53S01
2.60.120.880 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2x53S02
2X53S 2WZPP
chains in the Genus database with same CATH superfamily
5A6YA 4R9CA 1UPIA 2EIGA 1OFNA 1CZTA 2A71A 3BNWA 4PGOA 2G1MA 4N53A 3IPVB 4IERA 1RMU2 2W39A 3IIAA 4ZZ5A 5A33B 2VNOA 1A8DA 2PHDA 4TKOB 4GZ9A 4IXLA 4PIYA 4W50A 3W2IA 5CIRA 4YGDA 4RSUA 4H3WA 1V5VA 1QWRA 5T52A 1J9ZA 5F5QA 4AEDA 2R1BA 1WOSA 2JG9C 3CCLB 4Q4V1 4QXHA 4AHYA 1Y3TA 3DYPA 4RHV1 2XBO1 2KVOA 1JA0A 5EP9A 2ZJCA 1CJDA 4Q4V3 5FDBA 4YZ5A 4BQ1A 3ASSA 1VRH2 1ZM2A 3MFCA 4DY5A 3H3UA 3ASQA 1F2NA 1BEV2 1NT0A 1DDGA 4HK8A 4Q0UA 4CVUA 2CWSA 5CKMA 4B3GA 4LOSA 2ERFA 4D3WA 4ACAA 3ZSJA 2JD9A 2RS51 4X06A 2NP0A 3ST7A 1BLIA 2VNIA 4YZ3A 2BWAA 4WV8A 3I3MA 4MYUA 4YM3A 3VHPA 3PENA 2D43A 2ZGRA 1XE0A 3FFZA 3LB9A 2DU1A 3PVOA 3POYA 3POEA 1ULOA 1O8SA 1RUC1 5FYMA 4DRRA 2QN6A 3OGJA 4Z4TA 2VYQA 2FHRA 5GZFA 2IXLA 1VBD3 4KU7A 3WCSA 3ZYPA 4Q4Y2 2YMZA 3ZFGC 4AVAA 3OW2B 1E5RA 2XZPA 1FMD3 4UXAA 3DPRB 2ADEA 4MOAA 2VZTA 5FK8A 3JQPA 4Q4W3 2RC5A 2MHFA 3ALQA 4FPKA 1VBE2 3MUY1 4BMEA 1MS4A 4YG0A 3UT0A 5LRSA 3K77A 5LEKA 3H94A 2YBPA 3CQOA 4XF1A 3D26A 5I0UA 2F43A 5GZCA 5JSOA 3OE7A 1CJPA 4RLZA 1C8M2 1UMHA 2FCUA 2OPWA 1NE4A 1V70A 2RMU3 3K48A 3AZVA 3KT4A 2HWE2 3OPTA 1BVP1 1GU3A 3OD0A 4IE7A 1S1AA 4KWLA 1VBA2 2E31A 2WT2A 5T5LA 1J83A 1AJKA 1J1TA 3IT8A 4AF9A 2R1DA 2ZL6A 1JUHA 3JBG2 3WINE 1QGAA 5EMNA 3WSOA 3LDKA 3CRZA 3Q6QA 1ULEA 2Q8EA 4BLJA 4IUGA 4LC0A 1JOJA 1DHKB 1YQ2A 2FVGA 2JDUA 2BBAA 1QY4A 3CJIC 2YC0A 3LA7A 3OBTA 5HCBA 4OI1A 3MIDA 1QH0A 3AVVA 1RMU1 5FY4A 4BK4A 2VNHA 4P22A 1GNHA 1YIPA 4XOGA 4BJ0A 3U1XA 1JHNA 4DFSA 5CDFA 4QX3A 5DAWA 4DS0A 2Q1FA 1FXZA 4YW3A 4Z4VA 2JG9A 4A7ZA 1D2EA 3I97A 1PX3A 1DLLA 2QKDA 3MF6A 4ZU7A 2PMDA 2OVUA 2XR4A 5FZAA 1AX1A 1ND2C 1ODMA 2JB8A 3W5VA 2UYAA 1HRV1 2DCTA 3PVEA 3U4SA 4BCUA 4ZXKA 1FV2A 4GULA 2XGXA 5FYYA 3WDWA 5J37A 3WD5A 4CZSA 4F7DA 4IE0A 1DFQA 3FWEA 1W0NA 3UETA 5G05L 2JXAA 2WABA 4Y20B 1OHFA 1Q8QA 1S2BA 2AEYA 4AVZA 3AMQA 4Z4WA 4L0PA 2YUEA 2J1RA 4TWTA 2GC2A 2V7QA 1Y0YA 2ZGPA 3PMEA 5C3RA 1CVNA 1I7PA 1S4MA 1K28D 2VZLA 4TN7A 2CSGA 2W1QA 1V9U1 1H4HA 3ES9A 5FPBA 5KSWB 2GNTA 3BPZA 4GB33 3VBFA 2VJIA 5F32A 2W5FA 1RJ8A 1WW7A 4IEUA 3WZ1A 1VQ5B 3OUJA 5CG9A 4EWEA 2BM1A 3M2MA 4WZKA 4XQFA 1UZVA 1KDKA 4P3YA 1GLHA 1NG0A 4Z07A 3VBUB 2XG3A 4DPNA 3GM8A 2CHHA 2NN8A 3BGAA 1VQMB 2UY8A 2X29A 3M3EA 2XWBB 1UMKA 4GH4C 2HWD3 4V2WA 2OBSA 4AHWA 1RUNA 3WG4A 3OZUA 1QVGB 1WMXA 2XUMA 3DL3A 1VP6A 3THDA 2EF6A 5JMCA 3AX4A 4LPLA 3OBRA 4LKDA 2R061 3ILNA 1YUDA 5L46A 1HXS2 3JUUA 3CP2A 5BPXA 3UK9A 1W06A 2BVBA 1LOFA 3NSTA 2X0KA 3ZKUA 4NIGA 3PJQA 3HD8B 2JENA 2R0FA 3IN9A 1T6XA 1QXRA 2AREA 1BBT1 2C5HA 2W9XA 2Y6JA 1ZA4A 2BFUS 4YM0A 3TBDA 3U0ZA 3O1MA 3QBQA 2E6VA 1UZYA 1OC1A 1K42A 5F1RA 2VJXA 1OURA 1RGSA 2BSAA 1GZWA 1YJLA 2VECA 3HQRA 4NAOA 4WVMA 5DXDA 2BQPA 4GWNA 3WF0A 1DZTA 1JZ6A 1D4M1 4CU9A 3LPFA 3BCFA 2XQRA 3BTZA 2YC4A 5A88A 3QCWA 3E1F1 2J7KA 1LENA 3MLLA 4Y33A 2KR2A 2XNJA 1DGRA 4WVMB 2JG8B 2A73B 2XL7A 3VKOA 2VVEA 1J84A 2F1LA 3TN91 1PNFA 2D44A 3MEPA 2WL1A 1RUH3 3WXMA 3GZTB 3KZ4C 3BTYA 1H8HA 1YLOA 1W6NB 5CFCA 3SITA 5JAXA 5AVPA 1QMJA 4ATEA 1KFXL 2HWF2 3GHNA 3VL8A 1RINA 2A3WA 2CWMA 3SXWA 5JSPA 3E20A 4N7IA 2EXHA 3JQWA 4LITA 1FOD2 2DEUA 4Y9RA 1ZM9A 5FZCA 5HV4A 4G3YC 4B29A 1MVEA 3ABZA 1WWYA 4FN5A 2OKXA 3R6KA 1H1MA 4P12A 5L19A 3GJAA 4LO6B 1ZBA3 3H1MA 1YYNA 4I3GA 5LWBA 2WPDA 4WWVA 3OW7A 2GC1A 2C9AA 3VBFC 4BH9A 4Z1MA 4CDQA 3KHCA 2V4DA 1TMF1 1BQEA 2ZXHA 1DZRA 1E5SA 4FPJA 1KMHA 1M4WA 4EN0A 3ES4A 5IFPA 3GNEA 3KSCA 1EAH3 5FY9A 3S7IA 1ZZ8A 2NPIA 3VBSB 4XAAA 5FMOS 4XM3A 3E1YE 4LJHA 3ZFEB 3WW4A 1DYOA 4RDJA 4JGZA 2V7TA 3AFGA 1VMJA 2R062 3LEKA 2ZGSA 2UY9A 1GR3A 3MLJA 5H9SA 1UMIA 1V6NA 3THCA 1MS5A 1OH3A 3KV9A 3H7JA 2C78A 3D3AA 4ZU5A 5C7GA 4HKOA 4CU6A 1CX4A 3MIFA 1IZ3A 2W0XA 3PUSA 2GK6A 1V6LA 2C1FA 3ZSKA 3BC9A 4AI2A 4RDKA 2E33A 4UBHA 2VZPA 1LHWA 1IHMA 5HPOA 4Y22B 3W59A 2RM21 2OZ6A 4N7UA 4C1WA 5FMOL 4FPLA 1GP4A 1ZUNB 2V5DA 5LBEA 3OYWB 2Y34A 2E26A 4XXPA 3WW3A 2BOIA 4JX0A 3NE5B 4HPKB 1QJX1 1AR93 2NM1A 4XF9A 3WLUA 5FLJA 5KWRA 4FPHA 1RITA 1TMF3 2OK8A 1G6NA 1AR82 4CCJA 2R9VA 1W2NA 4RPBA 2ETEA 2WAOA 1BK0A 1OXCA 4GD4A 4K8RB 3OGGA 4OMCA 1CAWB 4WM7C 1OUSA 2ZBUA 1EFTA 4AEMA 1RTVA 1N08A 4GB32 4QXCA 4DINB 1BZWA 2XZOA 3BTAA 1ZRCA 3T53B 5CFCC 1XYPA 3NNGA 4GQ7A 4LO7A 2DTYA 4D94A 1JMUB 2X53S 1CESA 3K75B 1TVCA 3SH3A 4CDWC 1F31A 4LBZA 3WP6A 4WVVA 2VXJA 1FNCA 3J9SA 2PIAA 3WQ1A 3OGVA 2VULA 4NRMA 1PMHX 3KL9A 1Y7BA 3OUHA 3ZBUA 1PGSA 3OGSA 1TZOA 2W91A 5L36A 1UD1A 3DECA 1BLZA 1NB0A 4B4DA 4FOQA 4KH9A 1UD2A 4TSVA 3IDCB 5CU1A 5AFEA 2WWJA 1QJY1 3BB6A 1G8WA 5CEHA 2OXBA 3ZFFA 2GC3A 1FNMA 1MQTB 2VZOA 3Q8EA 4ISRA 4KWKA 1ZZ7A 4PABA 3BUCA 2F17A 2E53A 2VPVA 3FHIB 1VQLB 3CDZB 4R71A 2QQUA 5JXGA 1F5FA 5CKQA 5A6ZA 1QGLA 2EIXA 4CE8A 3U07A 2AC1A 4JGZC 2K46A 3VZLA 2BBVA 2PQSA 3LFIA 3LQEA 1AZDA 4CEWC 4Q0SA 2QTZA 3AL6A 4LK6A 4XJ8A 4I2OA 3URFA 4LUMA 4P2NA 1JU4A 2DBNA 3FLTA 3HMYA 4QHOA 2P3IA 4U36A 4Z82A 5IATA 5TSWA 5T5PA 2UURA 2VBUA 1ASJ1 1VBA1 2AR6A 2VL4A 1FPN1 2Z2SB 1W04A 3LSDA 3POSA 5JR7B 3VZKA 2ZTGA 3MCAA 1H4GA 5DSZA 4UFJA 1DYKA 2EIEA 1Y9MA 4OI4A 3UKVA 1PO23 1XYOA 3LD8A 2VOTA 4YVSB 3T08A 4Q4X1 3BY2A 4GH4B 2QA4B 1GP6A 1NCRA 3H3LA 3ZXLA 5EIYB 2XJUA 2D9RA 4NCNA 3MICA 4PC6A 4OZXA 1HB1A 3N7KA 1T2XA 2DUPA 1FDRA 3ZR6A 5FUNA 3CC2B 5SV8A 3DDYA 4AFCA 4N43C 4GB31 3VBFB 3ZIXA 1WU8A 2BGIA 3BYWA 3ILFA 4TZDA 4FAGA 2X6XA 4HXCA 4NIDA 4UFMA 2H6BA 4A7YA 5BXXA 2P3MA 3H1WA 5GM0A 3LZZA 1ZRRA 1PM4A 5C9AA 1JBCA 1C4RA 4RQPC 4CCDA 2VZSA 3KT7A 1Q43A 4XVHA 3JQQA 1UXXX 2O14A 3K4DA 4AEDB 4INDA 4O65A 2IZWA 3GZEA 4P9XA 1UN1A 2YU1A 1ENSA 3WUCA 5DAVA 1VQNB 1LHVA 3WNDA 1W6PA 1SCRA 1S0BA 1JW6A 2NMNA 2ZMLA 3AJZA 1UPSA 3AXDA 3MIBA 3POJA 4H14A 3ZN5A 5KW9A 2QJVA 4ZHNA 5KHHA 4IV1C 4AFMA 5B2GB 1XU1A 4QV2A 3IMMA 1NE6A 1OGJA 3WBJA 4YHBA 1W9YA 2JG8C 4KMQA 4JDOA 5DDJ2 1DQ2A 1O4YA 3ZFFC 1VBB1 3EB7A 4LHKA 2B4KA 5J09A 1JYXA 5CYYA 4H7LA 5J35A 2CAUA 4Q4Y3 4XACA 4IGPA 5F8PA 3ZYIB 1X9TA 4J1XA 3RMXA 4YRDA 4P1VA 2KM2A 5J96B 4TLGA 4LE3A 2IFRA 5DUWA 3WNBA 1UWWA 3G6JB 1EFRA 5F7UA 1LAJA 3THTA 3FUQA 4DQAA 3TEZA 4QQHA 4OPOA 3O0VA 4AHZA 1Y4WA 2XVLA 3E5XA 3FUOA 5IYRA 3AKRA 2LALA 5FZOB 3AGPA 1UOJA 2Z4FA 3C3VA 3IZOA 5EJ1B 5K9YA 3V0BB 3RDIA 1HN0A 4XN0A 1FAYA 2ZXQA 2WN3A 1UD8A 2ES3A 3AL5A 4LE4A 3CF6E 3WBKA 5FZOA 1VRH3 1W99A 2I45A 4FFFA 4TXWA 5ERLA 5FIXA 1IS3A 2OUJA 2YGLA 1AR63 5CNAA 4Q4X2 1ZBA2 2QQJA 2VU9A 1OMIA 4JKMA 5C8CA 3RZKA 1C5HA 3GDBA 3AGQA 1NCRC 3A1PA 1G7SA 2ZEXA 3KVBA 2VAUA 3HT1A 5LY2A 4TMXA 2BDRA 2DFCA 5EPAA 5A7PA 1NCQA 3KF3A 4URAA 2RS33 4HE5A 4NHMA 5LZ6A 1OGIA 4RD2A 3MHZA 3C8XA 1YJKA 3S6PA 4CDQC 5C8CB 2P2KA 4V1PA 2VGDA 1AL22 3FN9A 1E57A 5FAXA 5FKCA 2R6HA 3BCDA 1K8AD 1C5IA 1NCQB 3SKVA 1NYWA 2BWCA 3AVUA 5C9AC 4LHNA 1S2EA 2IXCA 3C7EA 2BFUL 2OT7A 3KHBA 3LOBA 2MEV2 2YXSA 2D97A 5FPZA 4MZUA 1MPXA 2DWRA 2AUYA 5A7QA 2XHKA 3KV6A 3VBRB 4EROA 1SDDB 3WXPA 3FE5A 4C0BA 5AC91 3A3GA 3O7OA 2Q8DA 4LT5A 3C7GA 1X8MA 3A8KA 1FOD1 1GP5A 5F3GA 4YW4A 1LGBA 3M3QA 2XEXA 2GNBA 1K45A 2BM0A 2P3YA 2UWBA 3APBA 2ZEZA 4GXLA 4P9IA 4JHTA 1N1TA 1W9XA 3BH4A 2CF4A 2VOVA 2VO5A 3NV1A 1VJ2A 4M00A 4QPGA 4C8DA 2C5DA 2D93A 4Z4ZA 2VBBA 5HKKA 3HQXA 2OUHA 2C5BA 1TMF2 5FP4A 2HH9A 5FXVA 5CVRA 2VZRA 4HSJA 4FPYA 4EZHA 2WO1A 2ZX0A 5JPMB 5A1LA 1R082 5A3PA 4TSFA 4NHKA 3VZNA 1VB2A 2QDNA 3HPNA 4U9UA 3KGLA 3R05A 1W8OA 5A70A 1BHGA 2F4LA 2JE8A 2RR12 1HW5A 2VC9A 5KHIA 3NWKA 3VKNA 1NLQA 2BGPA 2VOWA 2D74A 2O1QA 4JHZA 4L97A 4LBLA 1R64A 4QX8A 1GOGA 1SG3A 1GZCA 5FZGA 3ZXEA 4DIQA 2AYHA 2VZVA 4HBNA 1H85A 2HWB2 1RJ7A 3U6KA 1MEC1 1BJQA 1T5EA 1TQ5A 3Q38A 3HNBM 4LA2A 4BM8A 5IK7A 1VAKA 5LASA 2X85A 3RZHA 1BBT3 2HCJB 1UU5A 2ZS6B 1LOAA 4JRLA 1YC61 1QGZA 1WMDA 4QPIC 5IVEA 3ZDVA 1A8PA 1L7QA 2VBPA 3GALA 1W35A 3CEWA 3K4ZA 3WP4A 1RQRA 1NCQC 3WR0A 3O1OA 1QNYA 1AR91 1Q3EA 4YVWC 1EXMA 1QH7A 3U78A 1GICA 3RGBA 2AENA 4UZUA 4XORA 2JJ6A 1BXHA 3VLBB 5A3MA 5FYHA 3RYRA 4FOYA 3NJXA 3ZPOA 1FNDA 4LBVA 4GAZA 4IW3A 3VZOA 3W20A 3ZYFA 3J7MA 1I8DA 1SM4A 4NN0A 5DN2A 4YWAA 1CQXA 3RSJA 4AI1A 1R093 2J1SA 3ZXGA 1GV9A 1ND3C 2PLFA 3LVBA 3OFNA 5TY0A 3B5LB 4P9YA 2X5IB 5FLHA 4GJYA 1F8VA 3DCQA 5JOZA 3O12A 4QT6A 4GWJA 5IK8A 3WY9A 3OEHA 3Q8FA 5I91A 3ACLA 5GZDA 4YARA 1PGW2 4BQ2A 4LA3A 5FZLA 1QNWA 3WDYA 1NX9A 2ZGKA 5IHRA 4E2SA 1SQ4A 1W8HA 4BIOA 3VD3A 1O3RA 1N1SA 1OVSA 4AEJA 1J3RA 1NAEA 1OSGA 2ZAHA 4XDOA 4A6SA 2K9ZA 1ND2B 1HA3A 1ULGA 2IXHA 2QQNA 2XJPA 4D7SA 2JDAA 3ISXA 3BI3A 1QFJA 5FIUA 2R042 5I8YA 3THPA 1E3XA 4OI2A 4YGBA 4CP1A 1FI2A 2V7WA 4P3IA 2YV8A 2DBIA 4S2DA 5FLIA 2JN9A 1ENQA 5C3QA 5T55A 5DAQA 4QM9A 5T54A 1RHI3 2QQMA 1WA6X 3B69A 1WZXA 4IE6A 2Z6BD 2HYKA 2AH2A 4MHRA 4IV1B 3I56B 1D7PM 1YRZA 2BJSA 3I3QA 2XL9A 4P26A 2N7GA 3FMGA 3EMRA 1WBLA 1XE1A 1WLWA 2A6XA 2PHUA 2VE1A 1ALYA 1FPN2 4XBLA 4CCNA 4CDUB 1RXFA 4J1WA 4Y3OA 1IS5A 5HI0A 1RUH1 1PMJX 2A3YA 3EJKA 1DQ5A 1PO22 4AWDA 3K46A 3ZFFB 1PHMA 4K1XA 3SEJA 5DAXA 1Z7S2 3LE0A 3POWA 2JKXA 3VZMA 4IETA 4PC7A 1K9MD 1WW4A 4NE9A 3KLSA 3RI9A 3UL2A 1YHFA 1ZZBA 2B7BA 2JECA 3MF9A 3T0AA 5SV5A 1B35C 1HV1A 4XEZA 5FMBA 2Q1MA 1N0VC 1XB2A 2YG0A 4YZ4A 4PDWA 3AVWA 4BK5A 1H6YA 2V7XA 3HOBA 4EZ4A 1SEFA 2JDYA 4Q4V2 4E4DX 1W9FA 4NIHA 4MX3A 1FV3A 1S55A 4NPLA 1XNCA 4ATFA 2WKKA 4LLFA 1LOCA 4QX7A 1REEA 3ME2A 2TUNA 2E32A 3SCFA 1YQ6A 1GQHA 3N9NA 3OPZA 4ASKA 2V7UA 1BQPA 2PQQA 4P9JA 5FR3A 4CSWA 2G9FA 1OOPC 1NDHA 2QVSB 3IDEA 5IVBA 1RXGA 2W3JA 4UWDA 5K0UA 5ACA3 3CCSB 3AMPA 4X7DA 4XLFA 3PDQA 1G9AA 1XYNA 2CU5A 2QEXB 2BV3A 4QDQA 4M0NA 5IAXA 3OPOA 2OPKA 2BVVA 2PHLA 1PVXA 3OKXA 3EQEA 3FPKA 4YG3A 2X6WA 3S57A 2B42B 3AB0A 4MO3M 3JD72 4PBOA 5DDJ1 3WDXA 4DNYA 4FPCA 4JZRA 4XZPA 5FBJA 3GQBA 3WF2A 5TRDA 4QQ2A 1I1EA 3IKWA 1Z0HA 2XLGA 2R041 1UW8A 4NRQA 4IESA 1PIV2 4Q0PA 3WG3A 1VQ9B 1K5MC 3WDVA 3O1RA 1ZVFA 4XKWA 2HBTA 3PTRB 4OZOA 3VBOA 4BLIA 4XCBA 4IQPA 1DLCA 3MBWA 3C2UA 1SFNA 2QNKA 2JKBA 3K4AA 3EBRA 3LA2A 5LW9A 3WNNA 3WHTA 3ZC3A 1UOGA 1MQTA 2VOXA 4XIKA 1DZQA 3JCIA 2A1XA 4RJLA 2HWE1 2XJTA 4XDQA 3V64A 3VUOA 3CW2A 2PLV2 4TMVA 2QQVA 4LBYA 3USSA 4AFBA 3WY6A 3FL7A 4PQ9A 1I5ZA 5FZMA 2GNDA 1A78A 1GNYA 2A5ZA 4OHYA 1ODNA 4GWIA 2ZABA 3QOPA 4PIXA 1OH4A 1H30A 2CGOA 4B1LA 1LU1A 2G19A 3NAPC 5E6HA 1JYCA 2RHPA 4QFMA 2ZAAA 1H8TA 3AYEA 1SFYA 3ASIA 4XW3A 5C3PA 2YC2A 5C4WA 1HZEA 4XJZA 1CZVA 2W94A 1SBEA 3P3PA 5K7PA 4EYUA 2C0ZA 4GIQA 1PIV3 2HEVF 2WSUA 4ORFA 4YYOA 2HBUA 4PCRA 5A3NA 2DURA 3CHXA 3ZZTA 3O0XA 4YVSA 2BMWA 1HLCA 5FYSA 2A7AA 4GMP1 5F9TA 4ZZ8A 1QGYA 1UQXA 2C77A 4XABA 5HV0A 2YWEA 4NWVA 5BY5A 1NLSA 3OBAA 1DQ0A 2X8KA 1G7TA 1VHEA 3SJZA 1W6PB 4Y1ZA 4Y24A 4AQ2A 4E27A 3O1UA 5IVFA 1E1RA 2XOMA 3HN3A 2YBKA 1WW6A 1OA3A 4LUKA 1J3QA 3MW2A 1US2A 2GH8A 4RM0A 4NHYA 3UYJA 4F8AA 1K3IA 5FPLA 3JU9A 1MZFA 4QMAA 1ZM4A 3FPPA 3WDTA 1D4M3 3VV1A 4ES8A 1KS4A 1Y9GA 1QJU3 4WVWA 3VKMA 4RD4A 3ZN6A 3V0AB 1KITA 2W6JA 2YWGA 2CTVA 1EUUA 3R4UA 3RWKX 2WT0A 4D8MA 3DXTA 3H8XA 5FZDA 1QG0A 1KRIA 1F60A 1H1AA 1S0CA 4S2FA 2W2IA 1AL0G 4COWA 5KHGA 2Y6LA 3MW3A 2OX0A 3A22A 3CLPA 2HLDA 1HDKA 1OLME 1ENRA 4O9EA 4HK9A 4BPRA 1RUC3 4P9WA 2A6VA 5I8SA 2UWAA 1G9CA 2W6IA 5A3OA 2ZX3A 1QX4A 3DYOA 1ZBE1 3V76A 2ZMNA 4RA0A 4XC9A 4YGCA 3KQRA 3V0BA 1B35B 4XETA 4QPWA 4BYYA 4F83A 3LDBA 1W3VA 4A3XA 2XHNA 3T2TA 3O1VA 5A7OA 2VY0A 3LF7A 4O9GA 5HCHA 4B1MA 1AXZA 1HXS1 1VMFA 5FUPA 4RFT0 1GOHA 1L3JA 4OI0A 3EHKA 2FD8A 2D3NA 3ZXAC 2L9LA 2ZKNA 2ZXIA 1VQ8B 1UL9A 1W6MB 2EAKA 2PMWB 3ZSLA 4GALA 4E8DA 3FJSA 5FOBB 2X09A 5L9BA 4Q1RA 2EICA 1SHWB 4OHZA 2HWB1 1DF0A 2WINB 1CPNA 2ZEYA 3NAPA 5FJKA 4JGYB 2W95A 3L2YA 3ZFEA 3NNJA 1H8TC 4FPEA 1SCSA 4L8JA 4XXAA 3RYKA 2R043 4B4PA 1EPZA 5LA9A 4WZEA 4O7XA 3SMHA 2ZTNA 2FMDA 2ARCA 4TMWA 3IM0A 2RR13 1Y0RA 1TUIA 1OB5A 4LOTA 3QFCA 4K20A 1UCXA 4GJZA 3TN92 1FYUA 4Q2FA 5KXEA 2XDVA 4J6GA 3PJYA 5L9VA 4GKYA 1E5HA 2B5HA 5BUVA 3S7EA 2VTFA 3T2PA 1MR5A 3WF3A 4KGGA 5BNNA 4AGGA 3VR6A 1AR73 5T5OA 1W39A 4BQ5A 2GPJA 4M4SA 2FCTA 1I3HA 4E4SA 2D3LA 1IGOA 3FHAA 4I0AA 4HVQA 5A89A 5IJRA 4CTEA 1O3SA 3OD4A 2B46X 3CP8A 4COZA 4JQRA 4MGYE 3ZXDA 4N3NA 4AQ6A 4DQKA 4EN8B 1O4TA 4LBWA 4XR6A 2Q30A 4CU8A 1QJU2 1W9SA 3CJIB 4Q8LA 4IEZA 4B48A 3ECQA 5H5JA 2F6BA 1AIPA 1LESA 2IXIA 1K5MB 1AR83 1AR71 3OY8A 1OLRA 4ZCIA 1X33A 4YW7A 3UJOA 3WG2A 2WZR3 1SPPB 4X7EA 2GJRA 2OS2A 3E97A 1DGWA 4YAFA 1YHQB 3ZXJA 4UI9L 3RZMA 1U5IA 1REFA 3MIEA 4P6VF 1N3PA 1N06A 4BZ4A 2FX3A 3ENRA 1AYM1 3AVSA 1T6BX 4OMDA 4PI0A 4BOWA 1OUXA 3NV3A 5J98B 5DN6A 1MEC3 1O91A 3SH4A 1U2RA 3JB8A 4Q4W1 4QGNA 5J1XA 1I18A 3WNKA 1WLDA 5FZFA 1V0AA 5F3IA 2XPJA 2QGGA 1SMVA 3JXSA 5FY5A 1VBD1 2VMHA 4LMFA 3IPVA 5A33A 5CFDC 4FTEA 3GBWA 3IDAA 2RM22 1CNFA 3QH7A 2Y26A 3VDCA 4OHWA 2PAEA 3WP5A 4R4XA 1RUJ2 1RUH2 2IVIB 3B94A 3VBOB 1SLLA 5LBCA 3WUDA 3BPSA 3IAQA 4ZXEA 3RG0A 2NPFA 5BNOA 2PHXA 4YW6A 1HRI3 1EWYA 1M90D 3AMMA 2BF4A 1Z7S1 4NHLA 4WZCA 5E16A 1QQP1 3RNSA 4AVTA 1PNGA 5C9AB 5HXVA 2PLV3 1TEIA 2CY6A 2DVBA 3J7LA 4B4RA 4HZFA 1SFPA 2VUCA 1BPLA 2ZZFA 1ULPA 1YEWA 1ZRIA 2J1TA 3CIHA 4O61A 4A7KA 3TEYA 2SLIA 1RUF1 2GP3A 2RJKA 2NQYA 2BUKA 3MZHA 1CZSA 2X05A 3WCRA 2FDFA 4OOXA 2ILMA 4XUQA 1HB3A 3E6CC 4OLLA 4XMIA 3DPRC 4ZGNB 2B5OA 5BNNC 2RC6A 3CPWB 1KTVA 1S0GA 4YAWA 2HKXA 2WBKA 4FXUA 1VLYA 1I6XA 4ASUA 4QGLA 1DDLA 4BHPA 3WQBA 1RUI1 1LRHA 4EV0A 4XFGA 1YJ9B 2PFWA 1XQBA 1QJU1 1V6IA 2V7VA 2YDEA 4EN6B 4NRPA 4AYUA 2BYVE 4IE5A 2AGSA 1JODA 3WW1A 3PUNA 1AL23 1AXKA 4QU2A 5FZ9A 4B4QA 2HWD2 1SLAA 3WNMA 1QJY2 3L9JT 4PLNA 4Y26A 4UBGA 1G7CA 3JD71 5A3WA 2YZ4A 5THXA 5DZGA 2VNKA 3RYPA 3NVCA 2XJSA 2WA3A 4XHXA 2XVGA 2ZHLA 1C8M3 5BNNB 5FYIA 2QDXA 3A4UA 4W4ZA 5FP8A 2I74A 3W2GA 1OKOA 1JI6A 3ZFGB 4C90A 3VDAA 1Z78A 3ZYRA 4H9GA 3CXCB 3G7DA 4FBFA 2WAAA 3LEIA 4Q4W2 1QUEA 2JG9B 4BA6A 4PC1A 1G9BA 5FZKA 3AC0A 2ZL5A 2OTLB 2NZ9A 5E6TA 1AXYA 1VBB3 3BODA 3HR9A 2BTVC 1PGL2 1FNBA 5FO1A 2A70A 1W9WA 1W0JA 2D6KA 2PTMA 1ND3B 1POV3 4L2NA 4XF4A 4AK3A 4HFSA 4NNJA 3O1TA 4AQTA 4FP2A 1UIJA 1RYYA 1ZZ6A 4HONA 3POFA 3CC4B 2JD4A 3B01A 4AVCA 2VMGA 5F4MA 3KVAA 5A7SA 5BNOC 2QE7A 4HVRA 2QTWB 5JUVA 4K1YA 4ZY9A 5H59A 1VQ7B 2DVFA 4OULA 4XPVA 4AI3A 3VD9A 3S5AA 4LBJA 1XRUA 1CR7A 3GBFA 4Y1UA 1WW5A 4QAWA 4E8CA 1VE0A 3T1MA 4CCOA 4BXSV 5FPXA 2JJ2A 4K7JA 2WQ8A 1WCKA 1GMMA 1HQNA 4I0BA 5I0RA 1JYWA 3WNLA 1RUF2 3HWJA 5M0TA 3QSYA 4LKEA 3I2OA 1ZNPA 1JUIA 2BNOA 2YY1A 3A7QA 2DERA 1IPKA 4XFCA 1MABA 4CUBA 5K0UB 3GSIA 2XONA 4G4FA 2FDGA 4AEKA 1POV0 1M1KD 4P14A 4PIZA 4G1BA 1FATA 3NAPB 1K12A 3LQ6A 2OTJB 4UF0A 5CZKA 4LNVA 1ELOA 4OQ9A 3VBHA 1PZ8A 3AYDA 2BNNA 3DEMA 3I59B 2Q0AA 5GLVA 3MW4A 4QX2A 3CCJB 3TYJA 4QDSA 2HWE3 4L11A 5KXBA 2VTXA 4JCKA 4LIUA 2BPA2 5FYZA 3ACFA 1NRKA 1ZRDA 1R1ZA 3CCUB 1UF2C 4UAJA 1ZZCA 1CONA 2ZGLA 5IUQA 1FPN3 1RUC2 4QXKA 5ACA1 1QDOA 4JTOA 3I59A 1WGPA 2DUQA 4QVJA 1IG3A 2JICA 2Y0IA 4UAPA 2DF7A 2WS93 2OW4A 1LGNA 1H2NA 1N1YA 4AVSA 5DDJ3 1YITB 1UY1A 4OHXA 2XMLA 2YPJA 2CW5A 5DUXA 4BU2A 2VCAA 3QACA 4HLTA 2GDFA 1RUE2 4XE9A 4FXGB 1MS3A 2ZX4A 5FBZA 1SBFA 4AG4A 3W5MA 3ORJA 4BIFA 4XAEA 4M3CF 4BMBA 1PGL1 4NPRA 3MMPA 1HJFA 3PA1A 1YI7A 3CCQB 5IYYA 4RDLA 4PBPA 5IAVA 1Q56A 2YGMA 3RMYA 2CC2A 4YNIA 1QXPA 2PAMA 3A0KA 5D8AC 4XUTA 3BQJA 3ZYGA 4IV3A 3POIA 1BYHA 4MXVA 4ZU4A 3CNAA 5FY0A 4LBQA 5LEJA 3LKJA 1X36A 4A2UA 4ET7A 4K9SA 4IV3B 4EN9B 2UU8A 1D2SA 4N53C 4P5HA 3R6SA 4CPBD 4LKFA 1LJ7A 2PHRA 4COUA 2B8MA 2WQ4A 5CFCB 1GQPA 4LLOA 4ZONA 1UMZA 4QPGB 4RS5A 1C3HA 2E63A 2GH2A 1VQOB 3NNLA 2I07B 5EHDA 3UJQA 5HCAA 1HX6A 3LSEA 3RFRA 1EFUA 4M3CB 2EVXA 2PHWA 4N90A 1XFOA 2VW1A 1JOBA 3LWCA 5JIUA 5KHJA 2DDUA 2QQOA 4YAOA 2ZCWA 3TOJA 5GLZA 5IYQA 2Y6KA 4XILA 3VHNA 2HDNB 3CCRB 2GAUA 4RS5B 4ASLA 1IOAA 1YFWA 3V56A 4YFZA 3H0OA 1IJFA 3ZVXA 3TRSB 1MRZA 1WP6A 4ARYA 2W87A 2BN4A 5JOWA 4N8MA 5HXBA 3I1FA 3SKBA 3ZX7A 4CDQB 1C1LA 4A6OA 4AR2A 2Q6OA 3N9PA 4C1XA 2QTLA 1R1A3 1WMFA 5TR9A 2I2SA 4IDZA 4AW7A 2ZITA 1EP0A 4OVEA 2VZUA 1KGYA 3ZOIA 3G6EB 2WFPA 1JZ2A 4AVBA 1LKNA 1UYYA 2FCVA 2GALA 1V0FA 4YLZA 1Q7YD 4FWTA 5JSRA 1D0HA 3EXUA 4CCCA 4RD0A 4B47A 1UY0A 2P1BA 3FHQA 3KEWA 3LEMA 3GZAA 4YVWB 4XCAA 2VBSA 3C7HA 1R5BA 2ZZGA 3DV8A 5A32A 4G1VA 3I49A 1KXGA 3AK0A 4PF1A 4BQ3A 2V72A 1L7RA 2FDJA 3L2HA 1OBNA 4WM8A 5GKAC 1EAH1 4X7CA 4YAUA 1YJNB 1O7FA 2OA2A 2VR4A 2XB6C 1V6KA 4LO8A 4W8JA 3Q8CA 5DG2A 2QQPA 1LOEA 1W8FA 1PK6C 4JGYA 3WVJA 4CCMA 2DCZA 3AP6A 4RGKA 4XFBA 3X29B 4KL1A 4CUCA 2WSVA 2JDHA 2VCMA 3P6BA 2Q6IA 3H42B 1BBT2 5KHKA 3PA2A 3LO8A 1R1A2 2CNAA 3CJIA 3JZVA 2CRVA 1UO9A 4MH0E 1BMFA 4X8NA 1COWA 1UIKA 2V4VA 2Z5WA 4W65A 3OGRA 2GJKA 4HIZA 1KQRA 1Q8SA 1W6MA 4HANA 5D21A 1N47A 4BXFA 1U0AA 1IKQA 1W90A 2EXIA 2J22A 2V09A 3SLNA 3ACIA 3Q8BA 4BQXA 5H9QA 2JEMA 3RJRA 1CAXA 1QDCA 3CCMB 4UFHA 3WQ7A 5LK7B 4DEQA 3VBSC 1VQ4B 5BNPA 1D1NA 3CB4A 1PZ7A 3TN93 5A6XA 1RL3A 1ND2A 5TV2A 3N9MA 5FPVA 5F4OA 2WN2A 3H8RA 5FP9A 2IFWA 2X6YA 1H2MA 4XQWA 1EYBA 4E2GA 4Y7CA 1VQPB 4FFHA 2EXJA 4ZV4A 4JQTA 3W5UA 5FYTA 1S72B 2VQUA 2VQ0A 5A6QA 4II2A 5IYWA 1CIWA 2JDZA 2F4PA 1EP3B 1U12A 4WZFA 5JIAA 3GGLA 1M06G 2E9QA 1PGW1 3W5HA 4FTSA 1N07A 2G9GA 5B6IA 1JOPA 3CZJA 1FNZA 4Q5OA 2WRAA 3R6JA 3T30A 1RQPA 3TNPB 3O0WA 1CPMA 1D4VB 2W47A 3ZXFA 4CEYA 1V00A 4X05A 3H3ZA 2Y38A 2VNRA 2WZR2 3PTYA 3D5OA 3AJYA 2BOJA 3OZWA 5EWSA 4F7ZA 1HRI2 5FNZA 4GH4A 1O5LA 1BX1A 2GU9A 4DNRB 5FOJB 4BQWA 2KA3A 2IXJA 4Z4SA 4CP0A 3PVBB 1CNEA 1OPMA 4HVOA 3AP9A 1KJLA 3NO8A 1T6YA 1ST8A 4RCYA 5LB6A 3SQOA 3LQCA 2WIIB 3HAGA 3O14A 2GQFA 1LOFC 3F2ZA 1HIXA 2ZHKA 3T0BA 3TWIA 1WCDJ 2RE9A 5DUUA 1GJRA 3NQHA 2QQLA 4RR3A 1KJRA 1I9RA 1GNZA 4Q29A 3VKFC 1EPWA 2EFGA 4CDWB 1UYZA 2P3KA 1R1A1 3BALA 5C4WB 3KCCA 2R063 4J0QA 2DU0A 4PI2A 4V2VA 5CBLA 2ET7A 1PO21 4BWOA 3IIIA 4C91A 4B3XA 2VUJA 3I3DA 3ROUA 4AAXA 1K5JA 2DCKA 3I2DA 1YCIA 1QJX2 4I0WB 1H8VA 2WO2A 2Y6GA 3AKPA 5GJ6A 2K0GA 3UKNA 2Q8OA 3VHOA 2XKOA 2WJSA 1RUG2 1NZIA 2NMOA 1DQ6A 3PUMA 4AEDC 1TME1 2ZL7A 2ZKLA 3B9CA 3VB9A 5E88A 5BNOB 1GBGA 2J7MA 4IEYA 1XE7A 5DZFA 4DXSA 5LATA 2XLFA 4OPVA 4CP2A 1Y43B 3VBUC 4D6RA 2IXKA 1OLQA 2H6CA 3AFKA 4DXRA 5C5UA 1G9DA 3OEAA 1BMV1 1U5XA 1TG7A 1H8TB 1GWKA 5LY1A 3I55B 3Q3AA 4N9HA 3VD5A 3USUB 1ENXA 1QF3A 3A23A 4JRAA 4ZGQB 4P9LA 3POGA 1UOBA 1LU2A 5ANNA 5C8WA 1JZ7A 4FCAA 3BIEA 2BGJA 3B78A 1AHSA 1JH5A 3N7JA 4HOOA 4LQRA 4S2HA 1DYPA 4SBVA 3P27A 3ZZUA 4LHLA 1HRV3 4UFIA 4DZGA 4FQZA 1YWKA 3FBYA 3PU8A 3VNVA 1CAUA 2Q5TA 1JZ5A 1JZ3A 5IWFA 1X9PA 1TNFA 2C4XA 2VMCA 1H0BA 1WOPA 3KT1A 3KD4A 1VLOA 3QFRA 2XH6A 1W8NA 3ZFGA 2WLPA 1C28A 2XLAA 4N9IA 5FXZA 2P4EA 5FXXA 2D6PA 4MADA 4MV2A 2DYIA 1WUVA 1PO12 2BGCA 3WV6A 3OCPA 3RJ2X 1O6UA 4DRVA 2C2WA 3WG1A 1PVC2 1SLIA 5FY8A 4Q1PA 1YFXA 4YGEA 2TNFA 3S0MA 4AVVA 1D8TA 4JAAA 4A41A 2DY1A 5FO0A 3T0DA 2VZ1A 4FQ4A 4KGQA 4QB6A 5BNQA 1UZWA 2XNCA 2R32A 2NYYA 3QE2A 2WO7A 1ASJ2 3ZUGA 3VO2A 5IFTA 3PNAA 3D0SA 1OI6A 2DTWA 5H9PA 2RMU2 3OOXA 2ZGMA 1DQ4A 3Q6RA 1DGWX 3N35A 1VBC2 5JZGA 3J81k 4PC2A 2Y0OA 1F15A 4RGGA 4IE4A 1KS5A 4XJUA 2D6OX 1MS0A 5FREA 1YQ8A 1SACA 3HT2A 3RZJA 1GYKA 1S0EA 3T4VA 4NROA 1OHHA 2QQKA 3FBMA 2LTNA 1YJWB 4OUSA 1DBNA 1QH6A 1P4MA 1YI9A 2P3JA 4MXWA 4UYBA 1ZA7A 5H9RA 5FO8B 1Q9SA 3OZVA 4N3GA 4B43A 3UNPA 5FYUA 4XTPA 1LTEA 2Y6HA 3CMGA 3VBUA 3VBHB 2R073 5JOYA 5FYVA 3DN7A 5DQ0A 1NXD1 2WZNA 4NBSA 1POQA 1QOSA 2RS11 1B2RA 1EUTA 4OYUA 4QXBA 2XGJA 3K3NA 4OFGA 3SCGA 5DAPA 3RZZA 5A8AA 1AMOA 4R9AA 4DMIA 5KR7A 2BPOA 4KU8A 2WJVA 4LK7A 4UW3A 1QJY3 4QQPA 1QFZA 3AMNA 3AYCA 1Z7S3 1COV2 4Q27A 3VO1A 3V7AA 2XXZA 3W2HA 4D69A 2FDKA 2OQ6A 4KKSA 4IL7A 4FAHA 2XNDA 2LZJA 5FWJA 2ZMKA 4XLAA 4QKFA 3M70A 4M1KA 2J1VA 2OQ7A 4YELA 2B9UA 5GLTA 3LGRA 1VBB2 1DARA 3AP4A 1CAVB 2VTXJ 4D0QA 4GMP0 3FFQA 2WT1A 3O1SA 1Q81D 2XZLA 4XJAA 1QKQA 1BX0A 2DYCA 4M3CE 1GZWB 1QU0A 4QVAA 2RG4A 5JBQA 1DIWA 2WO3A 3BVCA 5I93A 5FZ7A 3ASRA 2YFUA 1AJOA 1DP0A 4QQOA 2GP5A 5AN9A 5BSXA 1ZBE2 5JR2A 3AVYA 1Q8VA 1C8M1 4CEWA 2GMEA 1H2KA 3GHMA 4NIIA 4HT1T 2C9KA 4NWWA 2VCCA 5FZ3A 4QDRA 1RUD3 1S4CA 3VD7A 4I09A 1TLLA 3ATGA 2Q1ZB 3PIJA 1GVHA 3M7AA 4NHXA 4X0CA 1VBC1 4P08A 1WBFA 4FSJA 4EJRA 5JZGC 1E64A 3HIFA 1N3QA 1VBE3 3LIHA 3W9AA 3ZYJB 1EP1B 2V4AA 4MVTA 3KV5A 1DDIA 4TTGA 4GQNA 4KQ7A 3UGFA 4OHVA 3MIHA 2D3SA 4IW3B 2DVGA 3E6BA 3NJVA 1WDTA 1D0GA 3U14A 4N43A 5JVVA 3MDPA 1AL21 5IT6A 1AX2A 1NZCA 1W34A 4R4ZA 4AI0A 1ZX5A 1HRV2 5E1RA 4QHYA 4XOPA 1N1VA 1XB9A 1OFSA 4RQPA 2Z42A 4I30A 2C4UA 5EQUA 2SBAA 4AFAA 3BY1A 3BKZA 1LCLA 3M3CA 1COV1 3HEIA 3LFMA 2RS13 4XN3A 5KC6A 5FP3A 2XJVA 5KXCA 3CZUA 2QZ3A 2VMEA 3G4SB 2H0BA 3ETQA 1RUJ3 1YQ5A 2OYNA 2CGNA 2EXKA 2WNVC 3AKQA 3AXEA 3BU7A 3IAPA 2XBO3 1V9U3 2R0HA 4ISQA 4IV1A 4AZZA 4Y9UA 3N4MA 2D3RA 5DG1A 1VF7A 1MZ6A 1WCUA 4LBOA 1PJ7A 4Q7JB 2HWB3 2VVDA 4JDMA 1PO13 2BV4A 1GWLA 2JB4A 4LBKA 4QPYA 4DEVA 3H7YA 1RUG3 2FDIA 2Z79A 4QWNA 4WZTA 1VLNA 2HWC3 3DYMA 2A75A 5FZBA 1AYM3 3ZLIA 2P6HA 3LPGA 1HRI1 5BV6A 4PF5A 1LECA 4OP7A 1SZBA 2PAKA 3PU3A 4FO9A 1SLBA 3KMHA 1EV12 4HKLA 4BPZA 3AKTA 1RC6A 3BCWA 4P5YA 5FPAA 1IG0A 3VHRA 4H7MA 1VAMA 5FK7A 2UYBA 1Q82D 4Z2AA 2RS32 4RL7A 2FZ2A 3ZYBA 4HE6A 1W2UA 3P26A 4II3A 2OZJA 5FQ0B 1ZYBA 2WR8A 2VZQA 2VJJA 2E7AA 1R092 4AAPA 5A3TA 2BVNA 1JB9A 3ZO0B 4D7TA 3U4XA 4YW1A 4S2GA 5J7MA 4XDPA 1CAXB 1SLTA 5LBBA 2OBRA 3CCVB 1QIQA 1A34A 2ZGOA 3BOWA 2HJIA 2ZX2A 4UZEA 4L9BA 4M4PA 5GV7A 4XLHA 4MGKE 1LOGA 4Y1YA 1DCSA 1XU2A 3N9LA 1E43A 1XBFA 1AR92 1UD4A 4META 3OF1A 4WM7A 3E5UA 5F37A 2CDPA 5FUIA 2HYXA 1C57A 4NUBA 2ARBA 3J8F2 2D3PA 5LA2A 3T3YA 3D8CA 3WNPA 4TMZA 1IPJA 1V6MA 3PUHA 5C3SA 4AL9A 2VNGA 2HWF1 3H1YA 5L73A 4RR3B 4CDWA 3JU4A 3MI8A 2DFBA 4TYSA 4YZ1A 1JNYA 1DGLA 3ITQA 4WBBA 5FZHA 3RS6A 3T56B 5AFBA 3VNUA 5T50A 3SLDA 4X6RB 2DCYA 1JS9A 1UU4A 2WNVA 1STMA 4PJYA 2D5HA 1RUI2 3BOPA 3D6EA 4L92A 3N3HA 1SBDA 1CD3G 5GZEA 4J25A 4XTMA 1PM7A 2VW2A 2ORXA 1YIJB 4CUGA 5C6CA 4RD3A 4KWJA 1H42A 4X07A 2HWD1 5DUVA 1CX1A 2RS53 1BCXA 4MG2A 1W87A 3AMHA 1SDWA 3TNQA 2Y8KA 3B02A 4XF0A 4XFIA 3T51B 3PUIA 4UW4A 5HZAA 3LAGA 5GALA 2BW8A 5FYCA 1C8NA 1PO11 4UZFA 3HJRA 4K1ZA 2YB7A 2R072 1NY72 1KK0A 1EFCA 2DIEA 1JU3A 3PUQA 4RFRB 5IVCA 4XLCA 2VCBA 3RRDA 3OJXA 1KQSB 4MGSA 1W2TA 3CO2A 4A4AA 5FCCA 2WR9A 1AYN3 3AYAA 1FMD2 3MYXA 4W6XA 3VDDC 3RZGA 1ZRFA 2DCUA 1R091 1ZM1A 1HQLA 5F5AA 1BKZA 2XUEA 1XSQA 1OD3A 4COVA 4QHBA 1KDMA 1OF4A 1UY3A 4DXZA 2GSYA 4LO5B 1XC6A 3AVTA 1UOFA 3EO6A 3CMMA 3NW4A 3GBGA 2JWPA 1R083 4QPIA 5ANQA 1WCQA 3C7OA 3M1HA 3ZMNA 5CFDB 2JDIA 2X3UA 1B23P 2VG9A 4M2LA 4P02B 2F1MA 4PAAA 5CAZA 1BEV3 4QPIB 3DF0A 3MFAA 2A6WA 5CISA 3H9NA 3IDBB 3I3EA 2W1SA 5JXIA 2WWSA 4Z1VA 4AF7A 3U2QA 3AKSA 5F2WA 4XONA 2F4NA 3PVDA 2CL2A 3TAYA 1W28A 4XJ9A 2D40A 1ND3A 2WUHA 3SLIA 3CCEB 2JE7A 2YU2A 3CTAA 4HL0A 2GJPA 1KEXA 1W3XA 4EWDA 1YO8A 4FVVA 4K3UA 1WD3A 4IGQA 1IS6A 3P1IA 5EFUA 5FXWA 3PL0A 3ZPNA 3AP5A 4MSVA 4JMQA 1G7YA 4JKKA 2DVAA 3GXUA 3ZMOA 3J7NA 2CDOA 3VL9A 2QBXA 1XQNA 2JG8A 3EYPA 2PA7A 5GZGA 1UYXA 3NL1A 5APAA 4MGTA 4HN1A 4NIAA 5ACA2 5IYNA 4OPSA 2RDSA 2GC0A 2G9ZA 2JDKA 2RJ2A 4LBQB 3M4FA 1WCSA 2LRPA 1PIV1 3PMSA 3FJOA 2ZX1A 1AYN1 3DGTA 4WM8B 3VDDB 4Z2WA 4Z4YA 4E9KA 4KKTA 5CA6A 2R071 1W2BB 3WT3A 3J7HA 5BSYA 2D98A 4GWMA 3FLRA 1RUF3 4UF0B 1RUE1 1O5UA 1MACA 3GCWA 4C0HA 5HBAA 1AVBA 3S30A 1SLCA 4XBNA 3KM5A 3OEBA 1VQKB 4FPGA 1COV3 4XHBA 5L9RA 4YZ2A 1UZZA 3VDDA 3KB5A 1YFYA 2PLV1 4Y5SA 1DG6A 2PYTA 3BN6A 3CJXA 4BQYA 5FL7A 3WQZA 1L7LA 2WNEA 3DXUA 1GR1A 2VBTA 2LROA 4MUVA 2G4IA 3NKGA 4RGAA 4IEXA 3FC0A 3SHRA 2WFF1 1GFF2 1S0JA 1UYPA 1OD5A 1QVFB 1W05A 3ONYA 5C8CC 1APNA 4Y5TA 3ACHA 3W21A 4AXOA 2WSSA 1PZ9A 4XFAA 1PX4A 2JJ1A 2BRTA 4XLEA 4LXLA 4Y22A 2WYRA 2HEWF 5F39A 2WYSA 2XQXA 1WPCA 1YI2B 5KNLA 5K4LA 4RN5A 3GJBA 5FMDA 1Q8OA 2AHOA 1GWMA 4XBQA 4XURA 1DQ1A 5F6LB 2C26A 1HB2A 2WNUB 2GMPA 3MPBA 4XUPA 1VQ6B 2VZ3A 3U11A 2ZGQA 4FK8A 3VDBA 2EAAA 5JI7A 2DV9A 3T1LA 4BE3A 4CDXA 3CMAB 1F4HA 1UZ0A 2ORZA 2WZ8A 3HBZA 1BK1A 1KK3A 2AEZA 1VRH1 1FRQA 4MYTA 2W92A 3GF6A 2ZACA 3LEGA 4YALA 4AQSA 4DOUA 4E4HA 4DK1A 3MHPA 5FTTC 1OOPA 5A32B 5A3LA 1RUD1 3K51A 3ON7A 4IEQA 4E2QA 5K0UC 2RS52 5FZEA 3W2FA 2J42A 3MGUA 3WOGA 3AZXA 3SEPA 1TTTA 4KBBA 1V6JA 4PC3A 1JYVA 3G05A 5FA6A 4YM2A 1RVF1 1H6XA 3KWVA 4HKWA 4QGMA 3N9OA 4IEWA 4XF3A 4CRQA 1W6QA 1G7RA 1UD6A 2HMAA 4A3ZA 1NA1C 4XZUG 4OUMA 4QPGC 1CAWA 5DZEA 1E63A 4PLOA 4KG8A 3OTFA 2GMMA 3PUAA 4Q4Y1 5F5IA 3HN1A 4ACBA 4NVPA 5A7NA 3KV4A 3UV9A 4XUOA 5C70A 1AYN2 5JOXA 2HLEA 3AVXA 3NJZA 5AVAA 1QFYA 5EZWA 3OB8A 4CXXA 2LW8A 5FPUA 2LUWA 1DGRN 5LA0A 1BVVA 2YROA 3T2OA 2HEYF 1YIFA 5IVVA 1MQTC 1OVPA 1QOOA 3LNNA 2W1WA 4Q0QA 3M3OA 3U37A 3T4HB 4Q0VA 4FP3A 3NNMA 4CDUC 1QJEA 3OJWA 2XVKA 3JBG1 4QB1A 4CCLA 4QUZA 2BNMA 2IUWA 1UX7A 1UKRA 4CEWB 4C0SA 1XNKA 2P37A 3N9QA 4ITCA 1Q86D 4WVZA 2DCJA 5T5JA 4E0FA 1Y9QA 2B39A 3B7MA 3B9IA 3MV11 5FZIA 3WP3A 5FO9B 1UX6A 4E4ZA 1GZ9A 4N43B 2JDNA 1EP2B 1WORA 2PE3A 2VD7A 1VALA 1SKYB 1GO2A 2UWCA 3HVDA 4W6YA 1XNDA 1OLMA 2V73A 2M5SA 4YVWA 1N05A 4ZPIA 1GOFA 1F35A 2PN5A 1NCRB 3I54A 4YVSC 1S0IA 1NQDA 2ZZJA 2VOKA 1TE1B 2Y6FA 4KG0A 4CDXC 4TN1A 3WYAA 2VBDA 3J8F1 3HNYM 3AZWA 1BJKA 3A35A 2JIJA 1ULFA 3CL1A 1ASJ3 4YEJA 1UD3A 3ZYHA 2PELA 4EE2A 5AC92 3UGHA 4G6IA 1LEMA 4WZLA 2RDNA 1E5IA 4DY3A 1NXMA 2E1RA 2ID4A 1NJID 5JLVA 4YPJA 2VMFA 2MNGA 4I02A 1URXA 1IKPA 1Q8PA 2WWUA 3FX3A 5I0SA 1QUFA 2ZBJA 3ZSMA 1V9U2 1PJ5A 5IK4A 1NA1A 3PURA 4K40A 2CNDA 2ENRA 1JTZX 4UW6A 3ZN6B 4PT6A 2WC2A 2AZ5A 4LHSA 3M3IA 1AR72 4UFLA 1GZTA 1P8JA 4MLOA 3ELNA 2R7EB 4XD7A 2ZGTA 5FO7B 4D6QA 2JDPA 5FZ1A 1W2OA 5EJ3A 4FI9A 3H8OA 2MEV3 3OAAA 2W46A 3LOIA 1B09A 1LB2A 1KFUL 2O0OA 2QQWA 2OYZA 3SC7X 2P17A 4YW5A 4X8IA 3FKSA 2JE9A 4NJ4A 1AYM2 1UU6A 2R30A 5F2SA 4GMP3 4KBZA 4LTAA 4NR1A 3OOCA 3C7FA 4CDUA 1YX2A 4P9GA 2WNVB 4IEVA 3W2EA 4LR4A 3WW2A 3I2JA 2JX9A 1G86A 1JA1A 1MEC2 1WKYA 2ZGUA 4QM8A 3GVJA 3LCPA 5A7WB 1PKVA 3ZPYA 2EIDA 4H55A 4EQVA 2EIBA 2D6NA 2C24A 5FMCA 3PLQA 3FLPA 5A1FA 1O3TA 1PK6B 3ZFEC 4TT3A 4WM7B 4JKLA 1TME3 2VVFA 3SJPA 1A8MA 2YPDA 4ZCMA 1NUKA 5LK5A 2RDQA 1WLCA 3OJBA 5CADA 1QQP2 2CK3A 1W03A 3MPPG 4BQ4A 1B35A 4D6SA 1IQAA 1QJX3 5A7WA 1VB4A 2GNMA 2IWGB 4PDWC 4YW2A 2K2SA 1LGCA 3BTXA 2BEOA 4CCEA 4QKBA 1IJEA 3ASPA 5HXMA 3RY8A 2YWFA 4L8QA 4QX1A 3ZR5A 2J1UA 3VD4A 3OEEA 1G9FA 4HN0A 3GCXA 2R6QA 5C5TA 2ZA9A 4XNFA 5FRAA 3ASTA 2AACA 4XOTA 1FNYA 4MHUA 1N8RD 4OUEA 3D0JA 4K21A 4B44A 5J48A 4RYDA 1NQJA 3CU7A 2W52A 4Y1VA 5AC93 1H9WA 1XPWA 2X10A 1QJZA 1J1LA 4AI9A 3LDRA 4XMAA 1JN2P 3O5SA 2TEPA 1EV13 1AR61 3HBKA 4Q4X3 1GAWA 1SKQA 2QUOA 4QX5A 1HVXA 4URTA 3I3BA 4M0HA 1TNRA 5G04L 1H2LA 1E62A 3U75A 4XL9A 3G71B 2D6LX 2BP6A 3JBG3 3OG2A 1UNBA 3SH5A 1E79A 2W68A 5JZGB 1CQ9A 4GA9A 1VBA3 1OPOA 4Z4RA 4UT5A 3RWNA 4JDNA 3TEWA 4G7WA 2JIZA 1K5MA 1LEDA 3OY8B 1RIRA 4MYEA 4MGZE 1OOPB 3OUIA 1D2QA 1I5PA 5A80A 3UESA 1AF9A 3J26N 1ZM3A 1SPPA 4ZS2A 1F9KA 3VBOC 5JXHA 5KXDA 3I2IA 1NLRA 3IB3A 2OK7A 1PVC1 3RQ0A 2WQZC 4ONUA 2BGOA 3Q39A 1DG1G 2WZPP 2IC1A 3USUA 3DKQA 2VXRA 2VNJA 2H0VA 3QLQA 5FP7A 4L99A 4CP9A 2DOGA 1WSVA 5IK5A 2GZWA 3ZZ0A 5I0TA 2I1LA 1WOOA 2WDBA 1JZ4A 1S0FA 1CAVA 3VN4A 2ET1A 4JV4A 4B3FX 1IPSA 5GV8A 1F4AA 1VRBA 3A0NA 1W6NA 3N7MA 3NNFA 1CAUB 5LRRA 5CFDA 1R5OA 5IVJA 1FT9A 2VW0A 5B4XA 2MPFA 1YLLA 3WDUA 3POBA 2B7YA 1FX0A 2R49A 3ONUA 2VNVA 5T3NA 4X8PA 1CIYA 2TBVA 1VHOA 3D4KA 4YM1A 4Z8BA 2ZOEB 5C4WC 2ARAA 2HWC2 2QE3A 3OSDA 3DKWA 3WNCA 2ZGNA 1AR81 1X50A 1W6QB 2ZHMA 4HG6B 4AOCA 2E51A 3ACGA 3I8TA 5FKBA 4Z4UA 3QD6A 4DUVA 1S0UA 4IGOA 4EWAA 3MV01 3A3BA 3BU0A 4LBNA 4P00B 1JYNA 1KD7A 2Y60A 3JQRA 1E1QA 5JMOA 3AM2A 1PVC3 2J1EA 4ZS3A 2VBVA 3CESA 1XNAA 4KI5M 2ZZQA 4OCTA 2RS12 2ATFA 5F4JA 2BZDA 1VIWB 2J1AA 4R8HA 1XNTA 4XYXA 5FZ8A 1YQCA 4TLFA 2ZEWA 5BYNA 3SKJE 3FZ3A 4FTBA 1RUD2 3T09A 1BMV2 3S5QA 2P5BA 1KK2A 2LS6A 2IVJA 2BU9A 4YSFA 2B7CA 2ADDA 3I7DA 4JC1A 2WFF3 4YXWA 1RVF2 3A21A 4XMYA 4QU1A 4AE2A 4DXTA 2W08A 3NV2A 3KF5A 4W6WA 4QX0A 5LCWL 2FBEA 2NV4A 1O59A 4LORA 2A6YA 2WJYA 1FRNA 2GK7A 5IVYA 4CPBA 5DABA 2WYFA 5B4NA 1LHNA 3I4IA 4FPOB 4B3NA 2WS91 1W8UA 1OQDA 3TEXA 1LODA 2E7TA 3ZKYA 4RD6A 3DUIA 3PHMA 1W0KA 1J58A 3OYWA 2X5IA 1ONAA 4LBMA 4DK0A 3HNMA 4Y4YA 1KJZA 5IYPA 4HPKA 1W8TA 3NMBA 1W8ZA 3NRUA 3K3OA 4FXKB 3ZN4A 2Z69A 1ACCA 3PIGA 2O8QA 5IW0A 1RB8G 2D6MA 4XKVA 5K8SA 2QZ2A 4QKNA 2Y33A 4KKUA 5GLUA 1QEXA 3W58A 2Q6KA 1HB4A 3I2FA 3SISA 4A45A 2BERA 4FPFA 1REDA 4HETA 4ES9A 5LBFA 1RUE3 2LM3A 1XSRA 4AF6A 2DUOA 1PMIA 3U10A 1H9PA 1QXJA 2DETA 3VMFA 2WA4A 2WNUA 2VMDA 3OPWA 4BISA 4LIVA 2O8OA 2FQPA 2ZHNA 1OQ1A 4LBQD 5E8AA 2Q4SA 5CG8A 1HKDA 5EJZB 4FFGA 1CWPA 1H8EA 1N3OA 1RMU3 3ZM8A 4BDVB 2VUDA 4QD2A 2RVAA 4KWUA 3GYDA 4CXWA 1O4ZA 3ILRA 3CMEB 4I01A 3CC7B 2QQIA 2XJQA 4EN7B 2B9VA 1BEV1 2QFEA 1N0UA 4PDWB 1VJSA 3IWZA 3B82A 3NJYA 4P6YA 3VKLA 1GKBA 3AP7A 3CPXA 3VBHC 3R4SA 2ARXA 2CBXA 4C43A 3Q8AA 1W0PA 4G7XA 4M01A 5F5CA 4CA9A 1WD4A 2YHJA 1DU3D 3WNOA 4N53B 1NB9A 1WA4A 4YFWA 3WF1A 3ZDSA 5I0DA 4IEPA 4FFIA 1UKGA 3B8HA 1W6OB 4U2AA 3RI8A 1XOYA 5J3OA 2FMYA 4HMZA 3TB0A 5FZ6A 4CUAA 4M53A 5ABJC 1RUI3 5FQ0A 1XNBA 2RM23 4K6BA 4NMIA 1XE8A 2WNOA 4CEYB 3H8UA 4WQMA 1IQDC 1YXWA 5DPNA 2WS92 3CBNA 1FOD3 5JDBA 1S0DA 5D8AB 3AZYA 3OBZA 1X8EA 2CYFA 5KBFA 1MS1A 4RD7A 1W6OA 3IMNA 3N36A 4QHZA 2XWJB 5BNPB 2VQTA 4Q26A 4NPMA 1W0OA 3VBRC 3H50A 2ZBVA 4RQPB 3RZLA 2X5IC 1IB0A 1J3PA 5J36A 3GVKA 3ZSEA 3BIWE 3MO4A 1S2KA 1EV11 1HQWA 3KCYA 4AFDA 5JXJA 1EAH2 5JWPA 1JYIA 5EXOA 4PQQA 1KRHA 3QFTA 1MS8A 1TVGA 1YNAA 2OIIA 2RS31 3AVRA 1US3A 4BB3A 5F3CA 4OOSA 4YG6A 4LULA 1RHI2 3B93A 1VAVA 3MLKA 4IV3C 4UFKA 4Y20A 1NA1B 3SNMA 1ZBA1 2JIGA 4Y1XA 1X82A 2Y64A 4RHV3 5FZ4A 5F3EA 5FY7A 3JB4C 4AGVA 1UAIA 2PXJA 3MIGA 2WNUC 4DUXA 4EH1A 1C1FA 1KK1A 4FOVA 4ASMB 3CD6B 1VR3A 4R52A 1HN1A 4QQLA 1NOVA 2YWHA 5IK2A 1OB2A 1JJ2B 2GN3A 1GAQA 3M8LA 1W2AX 3V65A 1F20A 3NKTA 2VMIA 1UD5A 4RS5C 4AI8A 2GN7A 3ETPA 3R0RA 1FX5A 2CAVA 4M4RA 1GUIA 4QKDA 1VMHA 4CQJA 1YFUA 4XQDA 4FOWA 3I2HA 4Q8KA 1ZZ9A 5FFOC 2MEV1 2W1UA 3INAA 4M3CA 1KZLA 2QDRA 2PHTA 1MZEA 3U6BA 5GLWA 1LULA 3B00A 3DPRA 2FDHA 1MZ5A 4ZKTB 2PHFA 3MUZ1 3UGGA 1UXZA 1O3QA 4COYA 1NKGA 1F5JA 2P34A 2QMUA 3RVHA 4TMTA 5FV3A 5FYBA 5BNPC 2EALA 5FWEA 4CP9B 4DUWA 5J3UA 5ABJA 2CGPA 4RD1A 3J4UH 3JQXA 1AR62 1XJAA 5D1IA 2V5YA 4XIOA 3ZBTA 5EV7A 1UY2A 4D7YA 1HJGA 2V31A 3I2KA 2YFZA 3ZIWA 2QCSB 3K2OA 4IEOA 4CCKA 5ABJB 5DMYA 1WLTA 1JZ8A 3F95A 5ISLA 2WZR1 5CKNA 3LIGA 4NOTA 1R081 1O8PA 1LR5A 2KD7A 2VH9A 3VBRA 3WNXA 2KXLA 2E7QA 2ZZEA 1AX0A 1X7NA 4JVAA 4Z92B 4X6QB 4G5GA 1ZREA 2RR11 1NY71 1QJFA 3ES1A 1PJ6A 3E6DA 3B3QE 3N7LA 4DO0A 4WM8C 2RJLA 3I2GA 1J59A 1WTHD 4LEJA 5E89A 3ZIAA 1JXNA 4KNCA 4LO4B 1QHDA 4MGIE 1OKQA 4MXWB 5C71A 3V0AA 4Y5Z0 3GIRA 4P9SA 1FMD1 1RHI1 1PK6A 1K73D 4JGYC 2D5FA 5C3OA 2WZEA 1VBD2 4UOJA 3OP1A 1WMEA 5L7OC 4DQLA 2C6SA 1CGPA 1OA2A 1JHJA 4XJWA 1OF3A 3ZXKA 1A3KA 1EY2A 1RUOA 1RUJ1 3J8F3 1U5ZA 1ULDA 4B7KA 1LOBA 2RDRA 3D82A 3RPQA 3CKHA 3R4DB 1D4M2 4DB5A 2YYOA 5C33A 3E5QA 4QB2A 3WF4A 3W5NA 5LMZA 2JDMA 3SEEA 3SCHA 4B8EA 4M0LA 4CDXB 3A8JA 1NBMA 4ROXA 1QQP3 2HWC1 4DNTB 2VUAA 4XFHA 1LHOA 1RUG1 2DVDA 4ARXA 1GQGA 1W9TA 5HZBA 4B7EA 4CYDA 1TME2 2P6CA 5A3UA 5FY1A 2Q8CA 5I8TA 3QH6A 2XOKA 4CXYA 1E3ZA 2D7FA 3VBSA 1VPHA 1OT5A 1ZBE3 2VM9A 3P5BA 4LKSA 4H2AA 5D2AA 3KQ4B 3NV4A 1LHUA 1V6OA 2XBO2 4G9SB 4RHV2 5FZ0A 3UKTA 3WQ0A 4JGZB 1T6GC 3WHUA 4OQ8A 4P25A 5DS0A 4AC9A 4A44A 4UW5A 4XFFA 5LA1A 4AGRA 5EYYA 4ZCLA 1IS4A 1KD1D 2HWF3 4MGQA 1A6CA 1HXS3 5F6KA 3GZUC 5HCFA 4X7FA 4PHZA 4RCZA 1V0EA 3QFSA 3WEZA 3KCXA 2E1BA 1RVF3 1W8WA 1LNSA 1VBC3 2FZ1A 4GKXA 4I3PA 1QOTA 4K8FA 2R16A 4A42A 5JI9A 3P3NA 5FJHA 1UY4A 2VQAA 2Q6LA 5KC5A 4JTNA 1POV1 4CEYC 3O1PA 5EYXA 2EA7A 2GREA 1GSLA 2RV9A 3KGZA 1H1IA 3IBMA 1CN1A 1R5NA 4FT8A 4XUNA 5JPNB 1JYTA 3H9AA 4CU7A 1HV0A 5CB7A 1AUYA 4OOVA 2A6ZA 2B45X 1VBE1 4AHXA 3A8IA 2XJRA 3VZJA 4RPDA 2CV6A 5A1AA 3WX5A 2C4TA 4R9BA 3LA3A 2YBSA 5L7OB 3Q9OA 1T6ZA 1OA4A 1WSRA 1ULCA 1Q5OA 3HQUA 3T2QA 1MS9A 1XXNA 1MVQA 4HSLA 3VGIA 3PVNA 4PLMA 4XQ4A 4F3JA 2OBTA 2WLQA 1GANA 1OB0A 2A3XA 3JD73 4NO4A 1OQEA 4RR3C 2NLRA 5D8AA 4NAMA 5L7OA 4R9DA 2XKPA 2ZPXA 4Y4RA 2RMU1 3KS7A 3AZZA 3GVLA 2WFF2 1KC8D 4SLIA 1U5YA 5JCTA
chains in the Genus database with same CATH topology
4R9CA 1UPIA 2EIGA 1OFNA 2A71A 4N53A 3IPVB 4IERA 1RMU2 2W39A 3IIAA 5A33B 2VNOA 1A8DA 2PHDA 4TKOB 4IXLA 5CIRA 4PIYA 4YGDA 5T52A 4EV0A 4RSUA 4H3WA 1QWRA 4AEDA 5F5QA 2R1BA 2JG9C 4Q4V1 4AHYA 1Y3TA 4RHV1 2XBO1 2KVOA 2ZJCA 1CJDA 4Q4V3 5FDBA 4YZ5A 4BQ1A 1VRH2 3MFCA 4DY5A 3H3UA 1F2NA 1BEV2 4Q0UA 4HK8A 2CWSA 4B3GA 2ERFA 4D3WA 3ZSJA 2RS51 3ST7A 1BLIA 4YZ3A 2BWAA 4WV8A 4YM3A 3VHPA 2ZGRA 2D43A 3FFZA 3LB9A 3PVOA 3POYA 2DU1A 4DPNA 1RUC1 4DRRA 3OGJA 2FHRA 5GZFA 2IXLA 1VBD3 4KU7A 3WCSA 3ZYPA 4Q4Y2 2YMZA 3ZFGC 4AVAA 2XZPA 1FMD3 4UXAA 3DPRB 4Q4W3 2MHFA 3ALQA 4FPKA 1VBE2 4BMEA 1MS4A 4YG0A 5LEKA 3H94A 4XF1A 5I0UA 5JSOA 2F43A 5GZCA 3OE7A 1CJPA 1C8M2 3K48A 4XFCA 2RMU3 1NE4A 1V70A 3AZVA 3KT4A 2HWE2 4KWLA 1BVP1 3OD0A 1S1AA 1VBA2 2WT2A 5T5LA 1AJKA 1J1TA 3IT8A 4AF9A 2R1DA 3JBG2 1JUHA 3WINE 1ULEA 4BLJA 3CJIC 1JOJA 1DHKB 3LA7A 3OBTA 4AHWA 5HCBA 1QY4A 4OI1A 2YC0A 3MIDA 1RMU1 4P22A 1GNHA 1YIPA 4XOGA 1JHNA 4DFSA 5CDFA 4DS0A 1FXZA 4YW3A 4A7ZA 2JG9A 1DLLA 2QKDA 3MF6A 4ZU7A 2OVUA 1G9CA 1AX1A 1ND2C 2UYAA 4BCUA 1HRV1 2DCTA 3PVEA 4ZXKA 1FV2A 4GULA 2XGXA 3WDWA 5J37A 3WD5A 4CZSA 1DFQA 3FWEA 2JXAA 4Y20B 1OHFA 1Q8QA 1S2BA 4AVZA 3AMQA 2YUEA 4TWTA 2GC2A 2V7QA 2ZGPA 3PMEA 1CVNA 1K28D 1V9U1 1H4HA 2GNTA 3BPZA 4GB33 3VBFA 2VJIA 1RJ8A 1WW7A 4IEUA 3WZ1A 5CG9A 4EWEA 3M2MA 4XQFA 1KDKA 1GLHA 1NG0A 4Z07A 3VBUB 2XG3A 3M3EA 2NN8A 2UY8A 2X29A 4GH4C 1RUNA 2XWBB 2HWD3 3WG4A 2XUMA 3DL3A 1VP6A 2EF6A 5JMCA 3AX4A 3OBRA 2R061 3ILNA 1YUDA 1HXS2 3JUUA 5BPXA 3CP2A 3UK9A 2BVBA 1LOFA 3NSTA 3PJQA 3HD8B 2JENA 2R0FA 3IN9A 1QXRA 2AREA 1BBT1 1ZA4A 2BFUS 4YM0A 3TBDA 3U0ZA 3QBQA 2E6VA 1UZYA 5F1RA 1RGSA 1GZWA 1YJLA 2VECA 5DXDA 4I2OA 4WVMA 2BQPA 4GWNA 1DZTA 1D4M1 3BCFA 3QCWA 1LENA 3MLLA 1DGRA 4WVMB 2JG8B 2A73B 2XL7A 3VKOA 2VVEA 3TN91 1PNFA 2D44A 3MEPA 2WL1A 1RUH3 3KZ4C 3GZTB 1H8HA 5JAXA 1W6NB 5CFCA 3SITA 5AVPA 1QMJA 4ATEA 1KFXL 2HWF2 3GHNA 3VL8A 1RINA 2A3WA 2CWMA 3SXWA 5JSPA 4N7IA 2EXHA 3JQWA 1FOD2 4G3YC 4B29A 1MVEA 1H1MA 5L19A 4LO6B 1ZBA3 3H1MA 1YYNA 4I3GA 2WPDA 2GC1A 3OW7A 4BH9A 2C9AA 3VBFC 4CDQA 4Z1MA 2V4DA 1TMF1 2ZXHA 1DZRA 4FPJA 1KMHA 1M4WA 4EN0A 3ES4A 3GNEA 3KSCA 1EAH3 3S7IA 1ZZ8A 2NPIA 3VBSB 5FMOS 4XM3A 3ZFEB 3WW4A 4JGZA 3AFGA 2R062 2ZGSA 2UY9A 1GR3A 3MLJA 5H9SA 1V6NA 1MS5A 3H7JA 4ZU5A 4HKOA 1CX4A 3MIFA 1IZ3A 2W0XA 3ZSKA 2GK6A 1V6LA 2C1FA 3BC9A 4AI2A 4UBHA 1LHWA 1IHMA 4Y22B 3W59A 2RM21 2OZ6A 4N7UA 4C1WA 5FMOL 4FPLA 3OYWB 4XXPA 3WW3A 3NE5B 4HPKB 1QJX1 1AR93 2NM1A 4XF9A 3WLUA 5FLJA 5KWRA 4FPHA 1RITA 1TMF3 1G6NA 1AR82 2R9VA 2ETEA 4WM7C 3OGGA 1CAWB 4AEMA 1RTVA 4GB32 4DINB 1BZWA 2XZOA 3BTAA 1ZRCA 3T53B 5CFCC 1XYPA 4LO7A 4GQ7A 2DTYA 4D94A 2X53S 1CESA 3SH3A 4CDWC 1F31A 3WP6A 4WVVA 3J9SA 3WQ1A 2VULA 1Y7BA 1PGSA 5L36A 1UD1A 4FOQA 4KH9A 4TSVA 1UD2A 5CU1A 3IDCB 5AFEA 1QJY1 3BB6A 1G8WA 3ZFFA 2GC3A 1MQTB 4ISRA 4KWKA 1ZZ7A 2E53A 2VPVA 3FHIB 1F5FA 1QGLA 3U07A 4JGZC 3VZLA 2BBVA 1AZDA 4CEWC 4Q0SA 4XJ8A 3URFA 4LUMA 3HMYA 4U36A 3FLTA 4Z82A 2P3IA 5TSWA 5T5PA 2UURA 1ASJ1 1VBA1 3LSDA 2AR6A 2Z2SB 1FPN1 3POSA 5JR7B 1G9AA 3VZKA 2ZTGA 1H4GA 1DYKA 3UKVA 4OI4A 1PO23 1XYOA 4YVSB 4Q4X1 4GH4B 1NCRA 3ZXLA 2XJUA 3MICA 4OZXA 3N7KA 2DUPA 5SV8A 3DDYA 4AFCA 4N43C 4GB31 3VBFB 3ZIXA 3ILFA 4TZDA 4FAGA 2X6XA 2H6BA 4A7YA 5BXXA 3H1WA 5GM0A 3LZZA 1ZRRA 5C9AA 1JBCA 1C4RA 4RQPC 3KT7A 1Q43A 4AEDB 4INDA 2IZWA 4P9XA 1UN1A 1ENSA 3WUCA 1LHVA 1W6PA 3AXDA 1SCRA 1S0BA 2NMNA 1JW6A 2ZMLA 3AJZA 1UPSA 3MIBA 3ZN5A 4H14A 2QJVA 5KHHA 4IV1C 4AFMA 5B2GB 1XU1A 1NE6A 4B4QA 5DDJ2 2JG8C 4JDOA 1DQ2A 1O4YA 3ZFFC 1VBB1 4LHKA 5J09A 4H7LA 2CAUA 4Q4Y3 3ZYIB 4J1XA 3RMXA 4YRDA 2KM2A 5J96B 4LE3A 2IFRA 5DUWA 3G6JB 1EFRA 3THTA 3FUQA 4DQAA 4QQHA 3O0VA 4AHZA 3E5XA 2XVLA 3FUOA 3AKRA 2LALA 3C3VA 5K9YA 3V0BB 3RDIA 4XN0A 1FAYA 4LE4A 1UD8A 2ES3A 3CF6E 1VRH3 2I45A 1IS3A 2OUJA 2YGLA 1AR63 5CNAA 4Q4X2 1ZBA2 2VU9A 1OMIA 5C8CA 1C5HA 1NCRC 3HT1A 2DFCA 1NCQA 2RS33 4NHMA 1YJKA 3S6PA 5C8CB 2P2KA 4V1PA 2VGDA 1AL22 1E57A 5FAXA 3BCDA 1C5IA 1NCQB 1NYWA 2BWCA 5C9AC 4LHNA 2IXCA 2BFUL 3LOBA 2MEV2 2YXSA 2D97A 5FPZA 4MZUA 3VBRB 2DWRA 2AUYA 4EROA 2XHKA 3WXPA 5AC91 3FE5A 4C0BA 3A3GA 3O7OA 4LT5A 1X8MA 1FOD1 4YW4A 1LGBA 3M3QA 2UWBA 2GNBA 3APBA 4GXLA 4P9IA 1N1TA 1W9XA 3BH4A 2VOVA 3NV1A 4M00A 1VJ2A 4QPGA 2C5DA 2D93A 5HKKA 3HQXA 2OUHA 1TMF2 5CVRA 4HSJA 4FPYA 2ZX0A 5JPMB 1R082 4TSFA 4NHKA 3VZNA 1VB2A 2QDNA 3R05A 3KGLA 2RR12 5KHIA 1HW5A 3NWKA 3VKNA 2VOWA 2O1QA 4LBLA 4L97A 1GZCA 3ZXEA 2AYHA 4HBNA 2HWB2 1RJ7A 1MEC1 1BJQA 1T5EA 1TQ5A 4LA2A 4BM8A 5IK7A 1VAKA 2X85A 1BBT3 1UU5A 2ZS6B 1LOAA 4JRLA 1WMDA 4QPIC 3GALA 3CEWA 3WP4A 1NCQC 3WR0A 1QNYA 1AR91 1Q3EA 4YVWC 1QH7A 1GICA 2AENA 4UZUA 4XORA 2JJ6A 1BXHA 3VLBB 5A3MA 3RYRA 4FOYA 3VZOA 1I8DA 4NN0A 3RSJA 4AI1A 1R093 3ZXGA 1GV9A 1ND3C 3OFNA 3B5LB 4P9YA 5FLHA 2X5IB 1F8VA 5JOZA 3O12A 4QT6A 5IK8A 3OEHA 5I91A 3ACLA 5GZDA 4YARA 1PGW2 4LA3A 3WDYA 1QNWA 2ZGKA 4E2SA 1SQ4A 4BIOA 1O3RA 1N1SA 4AEJA 1J3RA 1OSGA 2ZAHA 2K9ZA 1ND2B 2IXHA 1ULGA 2XJPA 4D7SA 2R042 5I8YA 3THPA 1E3XA 4OI2A 4YGBA 4CP1A 1FI2A 2YV8A 4S2DA 5FLIA 1ENQA 5T55A 3VKFC 4QM9A 5T54A 1RHI3 3W58A 3B69A 2Z6BD 2HYKA 2AH2A 4IV1B 1YRZA 4LTAA 2XL9A 2N7GA 3FMGA 4XBLA 1WBLA 1WLWA 2A6XA 2PHUA 1ALYA 1FPN2 4CDUB 4J1WA 1IS5A 5HI0A 1RUH1 2A3YA 3EJKA 1DQ5A 1PO22 4AWDA 3ZFFB 1PHMA 1Z7S2 3POWA 3VZMA 4IETA 3RI9A 1WW4A 3UL2A 3KLSA 1YHFA 1ZZBA 2JECA 3MF9A 5SV5A 1B35C 1HV1A 4XEZA 2Q1MA 4YZ4A 4PDWA 2NP0A 1SEFA 4E4DX 4Q4V2 4MX3A 1FV3A 1S55A 4ATFA 1XNCA 2WKKA 4LLFA 1LOCA 1REEA 3ME2A 2TUNA 3SCFA 1GQHA 3OPZA 2PQQA 1BQPA 4P9JA 2G9FA 1OOPC 2QVSB 3IDEA 5K0UA 5ACA3 3AMPA 4XLFA 1XYNA 4M0NA 3OPOA 2OPKA 2BVVA 2PHLA 1PVXA 3EQEA 4YG3A 2X6WA 2B42B 3AB0A 5DDJ1 3JD72 4PBOA 3WDXA 4DNYA 4FPCA 4XZPA 3GQBA 1I1EA 4QQ2A 3IKWA 1Z0HA 2XLGA 2R041 1UW8A 4Q0PA 4IESA 1PIV2 3WG3A 3WDVA 1K5MC 1ZVFA 4XKWA 3VBOA 4BLIA 4IQPA 3C2UA 1SFNA 2QNKA 2JKBA 3LA2A 3EBRA 3WHTA 2VOXA 1MQTA 4XIKA 1DZQA 3JCIA 2HWE1 2XJTA 4XDQA 3V64A 3VUOA 3USSA 2PLV2 4AFBA 3WY6A 4PQ9A 1I5ZA 4OHYA 2GNDA 1A78A 2A5ZA 2ZABA 3QOPA 4PIXA 1H30A 2CGOA 1LU1A 3NAPC 1JYCA 2RHPA 2ZAAA 3AYEA 1H8TA 1SFYA 3ASIA 4XW3A 5C4WA 1HZEA 4XJZA 1SBEA 3P3PA 5K7PA 2C0ZA 4GIQA 2HEVF 1PIV3 2WSUA 4ORFA 4YYOA 4PCRA 2DURA 3O0XA 4YVSA 1HLCA 2A7AA 4GMP1 5F9TA 4NWVA 5BY5A 1NLSA 1DQ0A 2X8KA 4AQ2A 1W6PB 4Y1ZA 4Y24A 4E27A 1E1RA 1WW6A 1OA3A 4LUKA 1J3QA 3MW2A 2GH8A 4F8AA 3JU9A 1MZFA 4QMAA 3FPPA 3WDTA 1D4M3 3VV1A 4ES8A 1KS4A 4WVWA 1QJU3 3ZN6A 3VKMA 3V0AB 1KITA 2W6JA 2CTVA 3R4UA 2WT0A 1KRIA 1S0CA 1H1AA 4S2FA 4COWA 1AL0G 5KHGA 3MW3A 3CLPA 2HLDA 1HDKA 1ENRA 4O9EA 4HK9A 4P9WA 1RUC3 5I8SA 2A6VA 2UWAA 2W6IA 2ZX3A 4RA0A 1ZBE1 4YGCA 2ZMNA 3V0BA 3KQRA 1B35B 4XETA 4BYYA 4F83A 4A3XA 3T2TA 2VY0A 4O9GA 1AXZA 1HXS1 4OI0A 4RFT0 1L3JA 3EHKA 2D3NA 3ZXAC 2ZKNA 2ZXIA 1UL9A 1W6MB 2EAKA 3ZSLA 4GALA 3FJSA 5FOBB 4Q1RA 4OHZA 2HWB1 1DF0A 2WINB 1CPNA 3NAPA 4JGYB 3ZFEA 3L2YA 1H8TC 4FPEA 1SCSA 4L8JA 4XXAA 3RYKA 2R043 4B4PA 1EPZA 3SMHA 2ZTNA 2FMDA 3IM0A 2RR13 4K20A 1UCXA 3TN92 1FYUA 4Q2FA 5KXEA 4J6GA 3PJYA 4GKYA 2B5HA 5BUVA 3S7EA 1MR5A 4KGGA 5BNNA 3VR6A 1AR73 5T5OA 1W39A 1I3HA 4E4SA 2D3LA 1IGOA 4I0AA 4HVQA 4CTEA 1O3SA 3OD4A 2B46X 3CP8A 4COZA 4JQRA 4MGYE 3ZXDA 4AQ6A 4EN8B 1O4TA 4XR6A 2Q30A 1QJU2 3CJIB 4Q8LA 4IEZA 3ECQA 2F6BA 1LESA 2IXIA 1K5MB 1AR83 1AR71 3OY8A 1OLRA 3WG2A 1X33A 2WZR3 2GJRA 3E97A 1DGWA 3ZXJA 1U5IA 1REFA 3MIEA 1N3PA 4BZ4A 3ENRA 1AYM1 4BOWA 3NV3A 5J98B 5DN6A 1MEC3 1O91A 3SH4A 3JB8A 4Q4W1 4QGNA 1I18A 1WLDA 2XPJA 1SMVA 1VBD1 2VMHA 3IPVA 5A33A 5CFDC 4FTEA 3GBWA 2RM22 3QH7A 2Y26A 4OHWA 2PAEA 3WP5A 4R4XA 1RUJ2 1RUH2 3B94A 3VBOB 5IK5A 1SLLA 3WUDA 5BNOA 3RG0A 2PHXA 1HRI3 3AMMA 1Z7S1 4NHLA 4WZCA 5E16A 3RNSA 1QQP1 4AVTA 1PNGA 5C9AB 5HXVA 2PLV3 1TEIA 2CY6A 2DVBA 4B4RA 4HZFA 1BPLA 2ZZFA 4A7KA 2SLIA 1RUF1 2RJKA 2NQYA 2BUKA 3MZHA 3WCRA 2ILMA 3E6CC 4OLLA 4XMIA 3DPRC 5BNNC 1S0GA 2HKXA 4FXUA 1VLYA 4ASUA 1I6XA 4QGLA 1DDLA 4BHPA 1RUI1 1LRHA 4XFGA 2YDEA 2PFWA 1QJU1 1V6IA 4EN6B 4AYUA 2BYVE 2AGSA 3WW1A 1AL23 1AXKA 4QU2A 2HWD2 1SLAA 1QJY2 3L9JT 4PLNA 4Y26A 4UBGA 3JD71 2YZ4A 5DZGA 3RYPA 3NVCA 2XJSA 2WA3A 4XHXA 2XVGA 2ZHLA 1C8M3 3A4UA 2I74A 3ZFGB 4C90A 1Z78A 3ZYRA 3G7DA 4FBFA 4Q4W2 2JG9B 4BA6A 1G9BA 2NZ9A 3HR9A 1AXYA 1VBB3 3BODA 1PGL2 2BTVC 2A70A 2PTMA 2D6KA 1W0JA 1ND3B 1POV3 4L2NA 4XF4A 4AK3A 4HFSA 4NNJA 4AQTA 4FP2A 1UIJA 1ZZ6A 4AVCA 2JD4A 3B01A 2VMGA 5BNOC 2QE7A 4HVRA 4K1YA 4AI3A 4OULA 2DVFA 4XPVA 4LBJA 1XRUA 1CR7A 3GBFA 4Y1UA 1WW5A 3T1MA 5FPXA 2JJ2A 4K7JA 1WCKA 1HQNA 4I0BA 5I0RA 1RUF2 3HWJA 1ZNPA 1JUIA 2BNOA 2YY1A 5K0UB 1IPKA 1MABA 4G4FA 4AEKA 1POV0 4P14A 4PIZA 1FATA 3NAPB 4LNVA 3VBHA 1PZ8A 3AYDA 2BNNA 5GLVA 3I59B 2Q0AA 4AVBA 3MW4A 3TYJA 5KXBA 2HWE3 4L11A 2BPA2 4JCKA