2X53S

Structure of the phage p2 baseplate in its activated conformation with sr
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
298
structure length
298
Chain Sequence
GVRQYKIHTNLDGTDDKVWDVTNGKVRFYQPSNLGLQSTNNIWQSNGIGVMGTRSITQPQIEFKLETFGESLEENYQLMKDFVNDILSKKFVTLEYQTEIFQVYADLALADVTKTEGYGKNGTFSEKITFDIITKWYTYENLTFDKIQNGKVIAGMSKIYGGTAPGNYKYIKGTSYTYYGESDIDRLSRWDIKEEIFSFMGILYPKLPKTPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQGWKGTTALNLFPVMDFERYRTRIIEKGQMELINLSKAEFKIKRKADFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF16
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
total genus 53
structure length 298
sequence length 298
chains with identical sequence T, U, V, W, X
ec nomenclature
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.210 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x53S01
2.60.120.880 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2x53S02
2X53S 2WZPP
chains in the Genus database with same CATH superfamily
2VCBA 1GZTA 3KCXA 3CC4B 1I8DA 4QPGC 4CCJA 4CEYC 2F17A 1KK1A 4EZ4A 5ISLA 4E4HA 4L2NA 4K1ZA 1YRZA 5KHKA 3THPA 5F6KA 2HEVF 4LHLA 4M3CE 2WZR1 2OUHA 2BNNA 2UU8A 1BK1A 4X0CA 1Q8OA 2CWMA 4NHKA 1AR91 4J6GA 4P6VF 3B8HA 4B43A 1A8PA 2DUQA 3I2JA 3POFA 4AEDB 2VBPA 1KTVA 3KEWA 4Q1PA 3T3YA 1J9ZA 3H8UA 4CPBD 2GH8A 4AE2A 3CO2A 1BZWA 4WQMA 1GYKA 3W2EA 1F8VA 3VL9A 5CISA 4OQ8A 2CAVA 3I8TA 2F1LA 2OBRA 4CCKA 1Y0YA 1S4MA 5F3CA 2WQ4A 2KD7A 4YM3A 1FI2A 2WNVC 4AQTA 1G6NA 1O3QA 4NROA 1XB2A 2J1VA 3PVEA 3LCPA 3RMXA 3AX4A 4Z1VA 4R4XA 4JHTA 1H2KA 3VMFA 3T30A 2WPDA 4ES9A 1V6JA 1CQXA 1T6BX 2XVGA 4J25A 2FZ1A 5JDBA 4PBPA 1H42A 2VMEA 3V0AB 3ASPA 5IHRA 4HK9A 2F4LA 2UWBA 4RCZA 3MPBA 5TSWA 1JTZX 4P3IA 2O8QA 1FV3A 1ENXA 4MXWB 5KSWB 2XHKA 4N7IA 2PHFA 1OOPA 4FOVA 1QQP1 1CESA 1V6LA 1HW5A 1V9U3 3B93A 5IW0A 2CV6A 5L7OC 4XQDA 3T09A 4B3GA 2P3KA 4ZU5A 3ZN6B 5DUUA 2WO3A 1V0FA 5IVYA 4IE7A 3WXMA 3RZJA 4NIIA 4XEZA 2WJYA 1EAH1 2V7TA 1DHKB 2OK7A 1H6XA 2Q0AA 3T08A 5GJ6A 3ES4A 1KQSB 2NP0A 2DCTA 5FZEA 2PHDA 1AZDA 3NKGA 4B4PA 2AH2A 3WDTA 1D8TA 4CQJA 5JZGB 2P6CA 3BOPA 4RS5C 4TMTA 3ZIAA 1W6NA 3W21A 2BBAA 3MYXA 4Q0UA 4K1XA 5E8AA 4LORA 2WBKA 4RR3C 1BJQA 3CQOA 3SCFA 2HWE2 5E6TA 2EAAA 3ASSA 2BQPA 5FZGA 1W2BB 5LY1A 1LCLA 3VBSA 2BRTA 3ECQA 2QQOA 5CFCC 3AC0A 1STMA 3VDAA 2X0KA 2R9VA 4DS0A 3OD4A 3WW4A 3ELNA 2LTNA 4CVUA 4IL7A 1PGSA 3TWIA 4IQPA 4MYTA 5F4MA 3H7JA 1CIWA 3ZSLA 4QU2A 1E5SA 3ZYIB 3HOBA 4NIAA 4CDQC 1PMHX 2ZBUA 1QOTA 1QJY1 1OURA 1W99A 3JXSA 4QXKA 4S2DA 3I2OA 3V7AA 4FFHA 1Y0RA 1KMHA 4E8CA 3KGLA 1KK3A 2D97A 1GO2A 1QUFA 5K0UC 2A75A 2JE8A 1W9TA 2ZTGA 2VBVA 1RUJ1 2W6JA 4XAAA 1VQ7B 3K51A 2GJKA 3H50A 3I97A 5T5JA 3H8OA 2HJIA 3ZVXA 4AW7A 2JDKA 4XILA 4QPIB 2JDZA 2VMDA 2AYHA 1N1YA 3IIAA 2BUKA 2Q6OA 1OGJA 1PO12 2FDHA 2QN6A 3UGHA 2WNUB 5HV4A 2XWJB 4I0AA 2V4VA 5IAVA 3K4ZA 3ZYGA 2XQRA 4IV1A 3E5XA 1E5HA 3WNPA 1IS5A 3THDA 4M4RA 1V6IA 2WS91 1VALA 5CAZA 3J4UH 2BBVA 2XGJA 4NWWA 1W34A 4NE9A 5FXWA 4B4DA 2V4DA 2FCTA 3E6CC 1AR83 1TME2 1XNTA 3MF6A 1V5VA 3GVLA 1S55A 4AVAA 3ZZUA 1NT0A 4QB2A 1CAUA 3BNWA 1SCSA 2W95A 1NQJA 2ZX3A 2FDKA 5FP3A 3HEIA 3SCHA 3KLSA 1RUG1 3OTFA 4MHRA 4MX3A 1H2LA 3AYDA 4AI2A 2JN9A 4P9WA 5A3TA 3WUDA 3OUJA 1YJKA 1ZBA1 1SZBA 3ZN4A 3TRSB 4HXCA 3GIRA 3POJA 1QXPA 3LFIA 2GN7A 5IAXA 1ODMA 4ATEA 4Q0QA 4UBHA 1DG6A 1ZZBA 2Q4SA 3UKNA 3RZGA 3IB3A 4B7KA 3BIEA 1X7NA 1LU2A 2J1RA 1VQMB 2QDNA 2OYNA 3JQXA 4RHV3 4AVTA 3K48A 5HCFA 2IXLA 5IVVA 4G5GA 1VBE1 3KB5A 5E16A 5DSZA 1FV2A 3WNLA 1PVC3 3AZYA 1UZVA 2KVOA 4AF7A 4TKOB 1K28D 4ZS2A 2BFUS 3A21A 1AYM3 2TNFA 1YJNB 5FYSA 4DK1A 3O1SA 5DDJ3 1PIV3 4MLOA 3WBJA 4FAHA 2IXIA 5EHDA 5LWBA 1C8M3 4FP3A 2P37A 1R082 4XQ4A 3IMNA 4V1PA 1BXHA 4JCKA 2Q30A 1AXYA 2TBVA 3AGQA 4MGYE 2FCVA 4HBNA 1W39A 3PVBB 1LESA 5FREA 2B5HA 5A6XA 2HMAA 3HN1A 1DU3D 1JJ2B 4M1KA 1RTVA 3U4XA 3P1IA 3RJRA 4LBNA 5AN9A 2IXCA 4DEVA 1RUD3 4HVRA 3MIFA 4DNYA 4FXGB 4OHZA 4ORFA 4DQAA 3AP7A 5J98B 4COYA 4UW4A 4GH4A 4HSLA 3AP4A 4HONA 3ZR6A 1U2RA 1FMD2 1OPOA 1PGL1 2ZZFA 1EY2A 3WW2A 2ZBVA 5C9AA 5CZKA 5D21A 3W5NA 4XBLA 5LZ6A 2X5IB 5J48A 2EIEA 1HB3A 3EQEA 2X53S 1VHOA 4ROXA 1F5JA 3WV6A 1V9U1 1QX4A 1K45A 2Q1MA 4Q4V1 4LBMA 3NJYA 5FUPA 1RUC3 4WV8A 1GSLA 4IEVA 2XB6C 3AMMA 3OGJA 3ZSJA 3ZN5A 1R5NA 3APBA 2WUHA 4JRLA 5H5JA 1BLIA 4C1WA 2UWCA 3NNFA 4KWUA 3OD0A 1D4VB 4GA9A 3T2OA 4C91A 1BVVA 3MV01 3POYA 4AEMA 2JG9C 2JDHA 1SM4A 1UYPA 1WCUA 5JMCA 1QF3A 2HCJB 3OFNA 5DS0A 1BBT2 3Q8BA 1PX4A 5CNAA 2XG3A 1L7QA 1J3QA 2JG8B 2VG9A 3QFCA 1O4ZA 5IYQA 4QDRA 4P3YA 1YJLA 1RJ8A 1PMJX 3E6DA 4AF6A 3C7GA 1GZ9A 5JPNB 2WZ8A 4AQSA 4MHUA 3LPFA 2VZ1A 1QH6A 5FYMA 1M06G 2I2SA 1MEC1 1YFYA 1SBFA 1AL0G 3E5QA 4N3GA 3PMSA 4FOWA 1G9BA 3WF4A 3NV3A 1HV0A 4DZGA 3VHPA 2X85A 3G4SB 4XHXA 5FPXA 2VMGA 1AJKA 2BGIA 3VO2A 2ZEYA 3WCSA 5FO0A 4F8AA 1W35A 4DXTA 1DGRN 2QDRA 2DCZA 1OKQA 4C90A 1YHQB 2E6VA 5FYZA 3J7LA 2D93A 5BSXA 2ZGMA 3W59A 5FP7A 2XMLA 1UMKA 1S0JA 1RUF3 5L9BA 2BGCA 1CQ9A 1OVPA 2XNJA 3KM5A 3HPNA 4ZV4A 5F3EA 3GCWA 2WYRA 3SHRA 1CAXB 4URTA 2Y6GA 3WP4A 1MQTB 3Q3AA 1COV2 1ASJ1 2P4EA 4TLFA 1TNFA 2AREA 1OLQA 3D4KA 1VLOA 4YVSA 5EYXA 5IJRA 4XLAA 1D2EA 4ISQA 3FFZA 1VQKB 4CCMA 1PJ5A 5A8AA 5EXOA 3AVUA 2D6MA 1VBA1 2OYZA 1SDDB 2WL1A 4WWVA 4YGEA 3I3DA 2G9ZA 5T5LA 5DUWA 3ZYRA 3MLKA 4OZOA 2QMUA 4XJWA 3TNPB 5ERLA 2WSSA 5FWEA 1JYCA 1W6OB 5FYIA 3USUB 1HIXA 3T0AA 1ND3B 3T2TA 2C78A 4WZFA 1KJZA 5I0RA 1OB2A 4CEWA 1O3RA 2ORXA 4UFIA 3CDZB 4OUMA 2P3MA 1NCQC 1Q5OA 4OQ9A 4P12A 2ZTNA 1XNBA 2VH9A 4IV3B 1JB9A 3H42B 3BVCA 3DN7A 4K8FA 1QH7A 1SPPB 1UYYA 4PBOA 1A34A 3FHQA 3WP5A 4I0WB 2FHRA 1ZRCA 1Q56A 3ZXGA 4A3ZA 5FR3A 3NRUA 1JYIA 5ABJC 3PDQA 3OPZA 2ZGOA 4QPGA 4CEYA 1JBCA 1BCXA 2HWD2 4P9GA 4RHV1 5LBBA 1OLME 2ZX4A 3V65A 4N43B 4JTNA 1JU3A 1GOHA 4CU6A 2D3SA 1ST8A 2Y38A 4IERA 3FLTA 1PVC1 2GMMA 1SLAA 3NV4A 1UW8A 5JI9A 1J3RA 4LBLA 4OZXA 4LBKA 2FDFA 4XONA 4KNCA 1XU2A 4N53C 1F4HA 1HXS2 1QMJA 1YJWB 4ATFA 3ETPA 5DDJ1 4BXFA 4A7KA 1PIV1 1ND2C 2DCKA 2CWSA 5EJ3A 1C8M1 2W1UA 2WNVA 4GAZA 3MPPG 4CA9A 3GZTB 4M3CF 4TMZA 4TYSA 1RQRA 4PIZA 4OHVA 4UAJA 2ZKLA 4XOGA 1ULGA 3Q8EA 1PGW2 4JDMA 1AX1A 1VAMA 1DG1G 3VBOB 4BK4A 3J8F3 4QXCA 1QJX3 2QVSB 1YIFA 3CIHA 1IG3A 4FN5A 5IYYA 2O8OA 2J42A 1UD1A 4GXLA 1RUD1 4LHSA 5F1RA 2VTXJ 2VXJA 3CMEB 5L7OA 1CPMA 2QE7A 1U5ZA 2V09A 3OY8A 5ACA2 1LULA 3BU7A 4WM7B 2K9ZA 5DAXA 2IZWA 4YAFA 5A70A 4QQPA 5LBFA 2I1LA 4RDJA 4Q1RA 2N7GA 3KCYA 1S0GA 4P02B 3VR6A 3AXEA 3UJQA 4D3WA 1H9WA 4XJZA 5EWSA 2IWGB 2E9QA 2B45X 2WZR2 2BZDA 3KT7A 2QCSB 2YC0A 4XCBA 1AR92 1RUC1 4W65A 2Y64A 4RS5A 5FBZA 5FY5A 3HAGA 3GSIA 4K8RB 5H9SA 4EE2A 4PAAA 3ZFGC 4RR3A 1X8EA 2W6IA 3ZDSA 2XJTA 1UY0A 3SCGA 1T6YA 4KKSA 1AUYA 5FV3A 1FT9A 2ZZJA 3FWEA 1GNYA 4NRQA 3V56A 1MZ5A 5CFCA 3IMMA 3LEKA 1VR3A 3CNAA 1Q7YD 4XJAA 3O1PA 1VQOB 2EA7A 1YIJB 2ZZGA 2HKXA 4B1LA 3BB6A 2WWSA 3RZLA 2VXRA 1QJEA 3UL2A 1JHJA 1V0EA 1UY3A 4LIVA 4HOOA 2W52A 4CDQA 4LBJA 5LRRA 1W3XA 3M70A 3LOBA 2ZEWA 2Y0IA 1W0PA 4LOSA 5JMOA 2VTFA 3ZZ0A 4PC1A 3FJSA 4CCDA 5J09A 1JZ6A 2ARCA 3OBZA 3H9AA 3RY8A 4IEYA 4FBFA 3L9JT 3P6BA 4NIDA 2CBXA 1J84A 5C6CA 5K0UA 1QQP2 5LEKA 1W9SA 2D3PA 1F5FA 1XE8A 2ADEA 4W8JA 5ANQA 1BPLA 2HWE3 1NLQA 2JJ6A 3CPWB 3Q8CA 1EAH2 4LXLA 3UV9A 2XNCA 3S7IA 1H8TC 4RSUA 5FYCA 2RJ2A 1UO9A 4Q7JB 4WVWA 4YRDA 2WLQA 1JZ8A 3N9QA 5BYNA 4YXWA 2E31A 1UX7A 4YAWA 1SLCA 4JHZA 4E27A 4TSFA 2ZACA 4A7ZA 5BNNC 2DUOA 3ZKYA 4P6YA 5JLVA 4CP2A 1CIYA 5FZBA 2DVAA 4M4SA 1MS3A 1W6QA 5IFPA 1COWA 1OUXA 3W5UA 4ZU4A 3QFTA 1L7RA 3PU8A 3ZBUA 5IK2A 2JKXA 3ZLIA 4DXSA 2IXJA 1N3OA 3VHRA 1UY4A 1W6NB 3ZXAC 4H3WA 1OGIA 3IT8A 1F31A 3EB7A 2Q8EA 3U6KA 3WQ1A 2SBAA 3IIIA 5C8CC 3CJIB 4NHMA 4ZS3A 2ZPXA 2BVNA 2AC1A 1SLBA 2JJ2A 4MYEA 3VBSB 3MICA 4RD7A 3MI8A 4ZGQB 2FBEA 1U5YA 4Z4UA 5FOJB 4EZHA 1YIPA 1QJY2 4P2NA 3DYOA 5IYPA 1CNFA 1MS0A 5SV8A 5A3WA 2CW5A 4XFBA 3W2HA 5HI0A 5KC6A 1DZQA 1PZ9A 3W9AA 4LK6A 1NX9A 1EFUA 5JSRA 4BLJA 3PURA 2RVAA 1RUJ2 3DF0A 1S0EA 3I59A 4PC6A 1PX3A 5C4WB 3ONUA 3IZOA 4NPLA 2OW4A 1WLCA 4HANA 1YC61 3LA7A 5D2AA 1HRV3 3N7LA 1UKRA 4BQ4A 3I2DA 2FDIA 3ZXFA 1UD8A 1YO8A 1QJFA 4BJ0A 4DNRB 5C3OA 1Q8QA 4A6OA 1EXMA 4X7DA 3WNDA 4QXHA 3VNVA 4PDWB 5FP8A 4QKDA 3H3ZA 5KXCA 1GU3A 4X06A 1UZZA 3ZZTA 4IV1B 1WW7A 4AFDA 4BIFA 2C6SA 4XVHA 1OUSA 4AC9A 3B82A 2PAEA 5JXHA 1RL3A 3PUAA 3UYJA 1ZM4A 4G1VA 3W5MA 2ZGKA 1QJZA 1N05A 2VZUA 1RUG2 3GXUA 3A8JA 3OZVA 4YW2A 1YYNA 1OH4A 4HSJA 4TMXA 2QE3A 1GAQA 1ZBA2 2BP6A 2IVJA 3FL7A 3J8F1 4TXWA 4P25A 1VLYA 2YDEA 4DNTB 2H0VA 4NPMA 1ONAA 1HQNA 3WLUA 1WLTA 3JU4A 4K21A 3BCFA 5KR7A 3UGFA 2GALA 1SKQA 2YXSA 3H1WA 3O1VA 4R9CA 2MEV3 1CAVA 1UMIA 2ERFA 5KHIA 4ZZ5A 1VBE2 1UKGA 1SBEA 4XFAA 5I91A 4GZ9A 2DY1A 1LKNA 5F32A 3EMRA 2SLIA 4XLEA 4Y5SA 5BNPC 3GHNA 2W1SA 2E32A 4FAGA 1LNSA 4GJYA 5FZLA 1ALYA 4YELA 3I2FA 2JG9A 4R8HA 2Y6JA 1OSGA 3GM8A 5B6IA 5CB7A 5IK4A 2B8MA 2CGPA 4K20A 1Y9MA 3WY9A 4QB6A 5FO1A 2WYFA 2ARBA 3WDVA 2OA2A 3WQ7A 4AYUA 1OHFA 5F2SA 4HN0A 1H1MA 3I4IA 1U5IA 1E62A 1I7PA 2CRVA 4QQOA 3SH3A 3B9IA 4Z8BA 4HE5A 2F4NA 1JUIA 1HV1A 5FRAA 3HNMA 1FOD3 3OYWA 3BN6A 4P22A 4EN7B 2ZXIA 4YW5A 4HT1T 1GWMA 4MGQA 1UU4A 5D1IA 4XUOA 1I3HA 1NA1B 4HPKA 5H59A 3O14A 1VQ5B 4Y33A 2O0OA 1PGL2 3B3QE 3RJ2X 1BQPA 1PM4A 2GPJA 1ZBE3 1G7CA 4YNIA 3TOJA 1XQBA 3KHBA 4IW3A 1BX1A 2FMDA 4GH4B 3AXDA 1UOFA 3PJQA 4HKOA 5HZAA 1FX5A 5FYYA 3D26A 1UIJA 1V9U2 3QH6A 4AI1A 4Q4V2 2BNMA 3OAAA 2XJUA 2GP5A 4UF0A 5C9AB 3GBWA 3ISXA 2IXHA 2Y0OA 1DQ6A 5IK7A 3FX3A 4B3XA 4DIQA 3E5UA 2RDNA 1MZFA 2Q8DA 5LA2A 1AHSA 4NHLA 1VBC3 4XF4A 2BGPA 4UFMA 1D7PM 4LITA 4EQVA 3H8XA 4FK8A 1IHMA 4F3JA 4ONUA 5JZGC 2PHXA 4OYUA 3GHMA 5APAA 2WO1A 3EJKA 4Q4X3 5I8YA 2WQ8A 2VZPA 1AMOA 5A33B 4URAA 1RINA 4JKKA 4OHWA 1N1TA 2UURA 4M00A 5A3UA 4FTEA 1CGPA 2E1RA 3ROUA 4JGYC 4CCOA 4RM0A 2OQ7A 3WNOA 5TV2A 2ZX1A 3TEXA 5IVEA 3W5VA 2A73B 1UMZA 3RRDA 4CXWA 1MEC2 4CXXA 1E64A 3N9PA 1NCQA 4M4PA 4FVVA 3HNYM 4TZDA 2VBSA 5EMNA 4P9YA 1K42A 2QA4B 1BEV3 5A89A 2VY0A 3CP8A 4LKDA 4QPWA 4JVAA 3PVDA 4DB5A 3FJOA 4GULA 4DFSA 5ABJA 1DP0A 4XLHA 3MFAA 3ZFEB 4L8QA 2VZLA 1ZREA 5DZGA 4LLOA 4QPYA 2C2WA 4XIKA 2B5OA 2ZAAA 2YG0A 1ULDA 1T6XA 4Y5Z0 4QX7A 3QACA 2TUNA 4HN1A 5F3GA 2NZ9A 4Y1VA 1WBFA 1W9FA 1NLSA 4FOYA 3UETA 1ZRRA 1REFA 3SKBA 5FKBA 2J1AA 4NRPA 1CX1A 1E1RA 4YW6A 3ZO0B 1E1QA 5H9RA 1WSVA 3WSOA 5LMZA 1VE0A 1NCRC 2OPWA 4K3UA 4WZCA 3KF5A 1HRV1 3NO8A 4XBQA 5JI7A 3RVHA 4N53A 1SLTA 1ASJ2 4B29A 2WNUC 4XF1A 4JMQA 1E5RA 4M3CA 2VMHA 3OZWA 3HD8B 1XYOA 1ND2A 4RL7A 3GGLA 3PUQA 4Y4YA 1XXNA 3MIBA 3PL0A 3N7JA 3R05A 1TG7A 4AI8A 3D3AA 2YROA 3R6SA 1OH3A 1VBA2 1W06A 1D0GA 3IDAA 4I30A 4YVSB 1O91A 1HB4A 4Z4TA 2R0HA 1D4M3 2R32A 1HN1A 1W0OA 4BZ4A 1URXA 2OK8A 2EXHA 4FP2A 5TRDA 4MSVA 4PLNA 3JB4C 4TMWA 5J36A 4YG6A 2XEXA 2D6LX 3CCUB 1JNYA 3HT2A 3PVOA 4MADA 4RA0A 2JIJA 4FO9A 1KDMA 2Y6LA 4CEWB 5L46A 5J96B 1JA1A 4P9IA 1SACA 2PHWA 3RGBA 2HWF3 3MHZA 2AGSA 4RQPC 2V7UA 2PLV3 4CSWA 3WNCA 3UKVA 3MW4A 2ILMA 4XMAA 2RR13 1CWPA 3C7OA 4CTEA 4SBVA 5JR2A 5GM0A 1YNAA 2F4PA 3ZXKA 1CVNA 3K4DA 4RHV2 4E2GA 5F37A 1GQHA 4QPGB 1ZZ6A 2MEV1 2VZVA 2QTZA 3VBFB 2RS11 1LOBA 4P26A 3ZFGA 1ULFA 1OT5A 1GANA 4YSFA 1PVC2 3WOGA 2OBSA 5BUVA 2XJRA 1LOFC 5CA6A 1ENSA 4DO0A 2JKBA 5DDJ2 3IBMA 1PIV2 2X6XA 4UZFA 2DBIA 5DQ0A 4JAAA 1F2NA 1C8M2 4AAXA 1I6XA 2VNRA 3EYPA 4BLIA 5GZGA 4KBBA 4NOTA 3T4HB 4RD1A 4M0HA 2VCCA 4L99A 3ENRA 2AEZA 1KK0A 5TY0A 4XFHA 2CAUA 4UW6A 3H1YA 3HT1A 1Q81D 1LOGA 3NQHA 4IDZA 4J1XA 2JX9A 5FIUA 2RG4A 2DTWA 4ASLA 1GAWA 1FOD1 2DVGA 1RUD2 2CDOA 2VUCA 1OA3A 4ZKTB 3OSDA 2C5BA 3ASQA 2WC2A 2BVBA 3LEMA 5F7UA 4AL9A 3TBDA 3D0SA 1RVF1 2X6YA 1S0BA 4ZXEA 1QXJA 4KWJA 1WCQA 2DU0A 4YFWA 1K12A 1ZBE1 1H8TA 1FAYA 2VUDA 1R5OA 5AVPA 2OKXA 4KKTA 2A71A 2X5IC 3BTYA 3OY8B 1K5MC 4YGBA 3VZMA 4Y26A 1WOOA 1GKBA 3AZWA 4LBWA 2I74A 4E4SA 5BNNA 4MG2A 3K46A 1DARA 1RUC2 4WVMA 2YGLA 2JB8A 5DMYA 3T2PA 3A0NA 2YU2A 4AVVA 2BGOA 2YY1A 2WNEA 2DEUA 4Z82A 3IPVB 4B44A 1YFXA 3NV1A 1XB9A 3J7NA 1T5EA 4IGPA 3D5OA 1VBC1 3PIJA 5M0TA 3Q38A 5LBEA 4RS5B 2VGDA 2FQPA 2KR2A 3TN93 3MCAA 2KXLA 5FUIA 1OKOA 2QQMA 4K7JA 1QGLA 3DEMA 4Q4X1 4YM0A 3KSCA 2K46A 2E63A 1V6KA 5GLWA 5C8CA 4ISRA 4QHZA 1MS9A 2JG8C 5CFCB 1E3ZA 1JOPA 1WBLA 4PT6A 2YB7A 4G7XA 2UYBA 3LGRA 2XR4A 3LSEA 4BMBA 2HBTA 2OPKA 1BMFA 1KDKA 4CP0A 3WDWA 1DQ0A 4LULA 3RWNA 2Q8OA 2X09A 1JUHA 2DCJA 5C7GA 5KXDA 3AZZA 4MGKE 3W2IA 4Z4VA 2ZMKA 3QFRA 3DL3A 1BEV1 5FZ7A 3OUIA 3FE5A 2JEMA 1W2UA 4R9BA 2EXKA 2JDYA 4Y1UA 2IFWA 1ZX5A 5K0UB 1HX6A 1O8PA 3L2YA 4AHXA 3AMNA 4AEKA 3IWZA 3CESA 5L73A 2LW8A 4PCRA 1Y4WA 4NO4A 2B4KA 2JDNA 4UW5A 4ZCIA 1DCSA 4K1YA 1G86A 1EFRA 3GALA 3QSYA 1QUEA 5A3PA 3QOPA 4BA6A 2R1BA 4OP7A 4DQKA 1RUH3 1ZYBA 5BV6A 2B7BA 4QHBA 2YBPA 3SEJA 2BWCA 3CZUA 2FZ2A 3AJYA 1HLCA 2PLFA 2E53A 3TYJA 4XF3A 4R9AA 2ZL6A 1PJ7A 4YM2A 1JZ5A 2VQ0A 2QQVA 4JX0A 2C77A 5I8SA 2PFWA 4H14A 4AR2A 4HL0A 1WD4A 2ZGUA 2CGOA 5A7OA 4LT5A 2ZHMA 1RGSA 3ACFA 5FO7B 5JXJA 1MS4A 1D4M1 5A7SA 5FZCA 2ZEZA 3EHKA 3DPRC 3H3UA 3AJZA 2LS6A 4Z2AA 4JDOA 2WS93 1SLIA 2HBUA 2W92A 5J35A 2VZ3A 1CNEA 2ZL7A 1HKDA 4FPCA 1PM7A 4XC9A 1ULPA 4BM8A 1QFZA 2NMOA 2HLDA 4CDXC 1KFUL 1VF7A 2A3WA 1BJKA 4FPEA 2HWF1 4XN0A 4GB33 3AZXA 1EYBA 1H4HA 2PLV1 1ZZ7A 3VDDC 3UNPA 4EN0A 3BIWE 1KRIA 2D6PA 2RR11 5BNPA 3I59B 3T51B 3VD4A 3ITQA 3SKVA 1I1EA 2PAKA 4AFCA 5TR9A 1EP1B 1QFJA 5DPNA 4TTGA 3SLDA 3ZSEA 1YFUA 4QD2A 5IYNA 2VUAA 1KD7A 3T56B 2O1QA 1QU0A 1JA0A 1DDIA 4UFKA 2J1TA 2CU5A 2LZJA 1TLLA 3BCWA 3R6KA 3ME2A 5IATA 4K6BA 1H0BA 2YZ4A 2QQUA 4MUVA 5FZ1A 3V0BB 1VB4A 4LHNA 4X7CA 4RJLA 5FZFA 4CP1A 4HKLA 4Q26A 3VD3A 3UT0A 3LDKA 3AVYA 2P5BA 3KVAA 1VP6A 3OGVA 2QQPA 4PQ9A 5T50A 4C0HA 1OB5A 5KHJA 3JU9A 1OA4A 3OJWA 2DVFA 2A1XA 3LDBA 3N7KA 1OF3A 1RHI3 2C9AA 4MYUA 1KD1D 4X07A 3VBRC 1IPSA 1VRH3 1EP3B 1CAWB 1ULEA 2GK6A 2OT7A 4P9LA 4HVQA 3CCVB 4Y4RA 4Y9UA 3J8F2 5FIXA 4BK5A 1QJX2 3GQBA 2GMPA 4GWMA 4RFT0 3WP6A 2DURA 1S2KA 2VBTA 3BY2A 3OP1A 4QKFA 4LK7A 5DN6A 1Q82D 4Y5TA 3DYPA 4MXWA 4LKFA 4DOUA 4RD3A 2C26A 2X05A 2PMDA 5HCBA 5A7NA 5FUNA 4UFLA 3U14A 4LUMA 2DERA 2ZHNA 4OPOA 4I3GA 2YMZA 1H8HA 3LZZA 3N36A 3GJBA 4NR1A 4WM7C 5KWRA 3Q8AA 2E7QA 1NDHA 3ZFFC 1UF2C 4FQZA 2VULA 3B5LB 3OJBA 2D9RA 2ZGLA 4PC2A 2CGNA 4IEOA 2V73A 3CHXA 1QKQA 3N9NA 3VHNA 3VN4A 4HKWA 5BNQA 1CAVB 2Y60A 4TLGA 4FSJA 2RS33 3P3PA 2YWHA 2AACA 3ILNA 3U37A 5JZGA 5GLUA 2MPFA 1LGCA 5DG2A 1EV13 4YW1A 5L36A 1S0UA 1HDKA 5FZOA 2WT2A 1RMU3 4XUPA 4M01A 3KT1A 1PK6C 3FN9A 1W9XA 3EO6A 4OCTA 1A78A 4Z4ZA 1LEMA 2D5FA 1SLLA 4KL1A 1GZWA 2WJSA 3GJAA 5IT6A 2JG9B 2LROA 3LPGA 5GZCA 4ZONA 4WM8B 4JGYA 3TN91 2XKPA 4KI5M 1S2BA 2VR4A 4Q4V3 3VUOA 3OW7A 3A8IA 4RD6A 2NQYA 4G4FA 1N0VC 4HVOA 5CFDB 2J7MA 3UESA 4ZXKA 4M0NA 2BFUL 1XE1A 4OOVA 3GCXA 1JZ4A 4LIUA 3WP3A 4P14A 1SEFA 3AKTA 5JOYA 3M8LA 4PJYA 2ZITA 1UOJA 1CJPA 3I3QA 4XACA 3WUCA 1IOAA 4JRAA 1MS5A 3DECA 5AVAA 1ZUNB 3B02A 1ZA4A 5CEHA 1H1AA 4XKVA 1XFOA 3LF7A 3MIEA 5CADA 4B4RA 1KXGA 1M90D 5H9QA 5EJ1B 4HPKB 4BIOA 5I0SA 3I56B 2J1EA 3BTZA 3VBUB 1QWRA 3MEPA 1VBB3 1OA2A 3AMHA 1VQ6B 1W8TA 4Q29A 3ZXLA 2JDUA 1UY2A 1YI7A 5JBQA 3WDUA 3JD71 3BGAA 3JQRA 4IW3B 2VTXA 2OVUA 4OHYA 2VNKA 1QDCA 2J1UA 2FX3A 1NCRA 4R9DA 2W91A 1DBNA 4OMDA 2NN8A 4UF0B 2WNUA 1MEC3 2BDRA 3D6EA 2BPA2 2XJSA 1WW4A 4P00B 3ES1A 4C1XA 4BQ5A 2AEYA 2DCUA 4QQHA 1OLMA 2JWPA 3LO8A 4ZZ8A 2RDSA 3T1MA 1RUH1 3I2HA 4XFIA 1W2OA 1OLRA 4P9XA 4R71A 2RJLA 4NRMA 3JBG3 3VKOA 1NY71 3C7HA 3O12A 2A5ZA 3V76A 5GZEA 4BQYA 3R4DB 5E88A 4DXZA 5FLJA 4AHZA 4X7FA 4ZPIA 5CDFA 3CJIC 5A7PA 2X29A 2FCUA 2W9XA 1O4YA 5HBAA 1HRI1 5F2WA 1QJU3 2WR8A 2XUEA 2XUMA 4EN8B 4FOQA 4TN7A 3O1UA 3CCSB 5FY7A 4A44A 3N9OA 3HR9A 3AMQA 1ASJ3 2VJIA 4QV2A 3I2GA 3NJXA 3S6PA 1NCQB 1NXD1 1CPNA 1E3XA 1QGAA 4RQPA 4XJ8A 3QE2A 4OPVA 3MLJA 5CKQA 1W8FA 4L8JA 4YGDA 2GN3A 4P08A 4BCUA 5LK7B 1VBA3 1TQ5A 1W8UA 2YYOA 3NNLA 4I2OA 1ENQA 2GP3A 3M4FA 1LOEA 3RZHA 2WO7A 5FZMA 1W8WA 3HVDA 1ELOA 2VJJA 1LEDA 3LKJA 1MPXA 2BW8A 4Y1YA 2D6OX 5DAQA 3NAPB 1T6ZA 3WXPA 1PKVA 2ID4A 4RLZA 1QIQA 5LASA 5C4WC 1V00A 3TNQA 4GB31 2JD4A 2QNKA 4LNVA 2DYIA 1HRV2 3C2UA 3K4AA 4LBQA 1CD3G 4H7LA 4RYDA 1LOFA 3U75A 2W1QA 1ULCA 1RUI3 1O5UA 5J7MA 3A8KA 1VAKA 2RMU3 4BDVB 1DLLA 1WP6A 4V2VA 2WKKA 4BPZA 2LALA 4EWDA 5FLIA 1QH0A 4N53B 3DXTA 2G19A 3OOCA 4PDWC 5FMOS 2K0GA 1ND2B 1HJGA 2OTJB 1REDA 3MO4A 1Z0HA 4DQLA 3ES9A 5JWPA 1LU1A 1R081 3DCQA 4DPNA 3MMPA 4LBOA 2W46A 3QCWA 5D8AB 3OUHA 5F5AA 3NNGA 1X8MA 3OBTA 1J83A 2VUJA 2H0BA 3PUSA 1ZRIA 4NHXA 4IEWA 4IESA 1RHI1 1OI6A 1R1A3 1PJ6A 2W5FA 1VRH1 4AEJA 1JYVA 4QQ2A 1JYXA 3VV1A 1V70A 4XJ9A 2W87A 3ZDVA 2PELA 3QBQA 3OPTA 3NVCA 1DIWA 4Q27A 3VBHB 2VBUA 4LTAA 4MGIE 3ZIXA 2GC1A 3SKJE 4CCCA 3WBKA 5F5IA 2X5IA 1BHGA 3DDYA 1SBDA 1K5MA 4QU1A 1OC1A 2EXJA 4META 5HCHA 1F9KA 1BK0A 4RD0A 4M2LA 4X05A 5K9YA 1XPWA 3N35A 4BHPA 3UK9A 1GVHA 4XJUA 1LENA 1J1TA 2MEV2 3ST7A 1SCRA 4PF5A 3EBRA 1Z7S3 2EIXA 2RS12 2HYKA 5A3NA 2Y6HA 2DTYA 3AYEA 3PU3A 1UD3A 1IJFA 3AMPA 3U78A 4P1VA 2WT1A 2RS31 3A3BA 5DZEA 4S2FA 4XDQA 4YW7A 4Q5OA 4Q0SA 3OEAA 2V5DA 3K3OA 1IQDC 1EV11 3HNBM 4UT5A 1RMU1 3I7DA 3CW2A 1PZ8A 2YU1A 3A4UA 5F5CA 2JG8A 4D69A 3AP9A 4SLIA 5A3MA 2LM3A 2AENA 3AKRA 3CU7A 1OQ1A 2ZCWA 4CRQA 5FPUA 4UXAA 3OBAA 3W2FA 1ZA7A 4XHBA 2ZMLA 2E1BA 4WVVA 4Q0VA 4NAMA 3ORJA 5GALA 3J7HA 3VDCA 4LUKA 2ETEA 1J59A 5FYHA 2B9UA 1NAEA 3BPZA 2D43A 4OHXA 2ZBJA 3WG3A 4LE3A 1FOD2 4H55A 4IE5A 1NLRA 5C5TA 1WZXA 3ZOIA 2Z42A 4LEJA 4V2WA 4E2QA 1K8AD 1JN2P 1NA1C 4NUBA 3BY1A 1DDGA 4OLLA 2Q5TA 4XDOA 5FMBA 2PHUA 3VD5A 4COWA 1ZBE2 1GWLA 2V72A 1CN1A 5BPXA 1UWWA 1OD5A 2GQFA 1XNCA 1FNBA 2ZHKA 2JE7A 5FFOC 1VBB1 2BERA 2VNIA 5J1XA 1H8TB 4FTSA 5F5QA 5C9AC 3HQRA 3NNJA 2ARAA 1VQ4B 2V5YA 1QNYA 1PZ7A 5BNOC 3D0JA 2QBXA 3AKSA 2PHTA 4Y7CA 1MR5A 2LRPA 3WQZA 3MIGA 1VBC2 3B9CA 4WVMB 3VZOA 2XGXA 3ZPNA 2D3NA 1J3PA 4ES8A 2W68A 4OULA 1JOBA 4CDUC 3CCRB 3RYPA 4L0PA 3URFA 1AYN3 4PHZA 1PO23 3ZYFA 2J1SA 1VQPB 2B7CA 1NKGA 2BU9A 1KFXL 4Q4X2 3B7MA 1Q43A 1GOGA 1NE6A 2ZA9A 1WD3A 1VRBA 2Y6FA 1B09A 1X33A 2ZZEA 3LSDA 2EF6A 2FMYA 5T3NA 2QTWB 3PUIA 4FPHA 2YPDA 3JBG1 4RCYA 5K8SA 4L9BA 2D5HA 2ET1A 5C8CB 1VMFA 4Z4WA 4LOTA 1VLNA 3DPRA 1R64A 4OFGA 1JZ3A 4XABA 1G7YA 2GNBA 3DUIA 1GOFA 3R0RA 2DDUA 4AFBA 4LQRA 5LEJA 1JYTA 3FZ3A 4QM9A 1QJU1 1VJSA 1BEV2 1TUIA 4I09A 4AGGA 4CDXA 1LR5A 4H7MA 3U6BA 4JKMA 2OIIA 2CC2A 2QZ3A 1GR3A 3OEBA 2D44A 5HKKA 2BF4A 3HWJA 1APNA 2WDBA 1AR63 3VDDA 3IM0A 3RYKA 3ZFEC 2Z5WA 1W04A 3GDBA 5KW9A 2C1FA 2YWFA 3QFSA 4AHYA 2E7AA 2RC6A 3FUOA 2CSGA 1NUKA 2DV9A 4XD7A 3CCMB 2WRAA 1Q9SA 3VDBA 1QDOA 2ZX2A 3FC0A 4X7EA 3K3NA 5A32A 3OF1A 2VOTA 5DAPA 2R073 3O5SA 3BCDA 5EPAA 2GREA 4LJHA 2P34A 1RUE3 4YVWC 3AYAA 1H6YA 1RUI1 2XKOA 4UBGA 3M2MA 4QWNA 2RMU1 4UOJA 3WDYA 1REEA 4XN3A 3HQXA 1VBD3 2FVGA 1IS4A 4LO7A 3LQ6A 1H30A 1FXZA 1NB9A 2Z79A 4DY3A 4NCNA 3M3QA 1UD2A 3VBRA 2C9KA 1G7TA 3RS6A 4YG0A 4KH9A 3KZ4C 4KU7A 3K75B 3VZLA 1D4M2 5FBJA 3WD5A 2OTLB 3ATGA 4AVCA 3U4SA 4RPBA 2R49A 1HB2A 4RGAA 1B35B 2GAUA 3WVJA 1DGWX 2XOKA 1WPCA 5FZ3A 3LA2A 5JPMB 4PC3A 5FDBA 4BXSV 1AJOA 3DKWA 1R1A1 4IE6A 2EALA 5JAXA 4F7ZA 1NQDA 4B4QA 2VYQA 3NMBA 3BYWA 2R6HA 4Q4Y1 1AX0A 3JUUA 4RFRB 4WM7A 1D2QA 3ZFFA 2A6WA 3DYMA 1WCSA 1KRHA 2HWF2 3C7EA 2QQIA 5ANNA 2ZGPA 1LHOA 4D6RA 1XC6A 2PLV2 4LO5B 2VNJA 2RR12 1DQ2A 4XUQA 4JGZC 3VD9A 3PENA 2RV9A 5DAWA 5ACA1 1UAIA 2W39A 4B3FX 1RUOA 1C5HA 4OPSA 1J1LA 3WNBA 4B3NA 1W03A 1JODA 4M0LA 2VAUA 4PABA 2VM9A 3AZVA 3USSA 4UZUA 5BNPB 1WMDA 2V7XA 1Z7S1 4A45A 1PK6A 3VBFC 4BYYA 1WW6A 3B69A 5CG9A 3AKQA 3RSJA 4QVJA 1JS9A 2QTLA 1IS3A 5FYVA 3OGGA 1MACA 4GKXA 3WG2A 4Y9RA 5FA6A 1G9FA 3UJOA 1W8OA 1YHFA 3WF2A 1WMEA 2Z4FA 2ZMNA 2BV4A 2KM2A 4YARA 5T54A 5F39A 2WR9A 2VJXA 1CZTA 5LBCA 3T0DA 3AM2A 4NVPA 1N08A 3TAYA 2HWB3 3WY6A 4Z1MA 5JIAA 4DINB 4BWOA 1NJID 2WFF3 3RFRA 4J0QA 1R093 5F8PA 3RDIA 2GH2A 2EVXA 2CNAA 4UFJA 2XONA 2VBDA 2RHPA 1UMHA 5FZKA 4FCAA 4Z4SA 1W9YA 4XOTA 4TT3A 5DN2A 5HXVA 4BQ2A 4AQ2A 3SC7X 4ARYA 4A41A 4PGOA 5FYTA 3SISA 5FL7A 1F35A 2D7FA 4ZGNB 1MVEA 2JJ1A 2WWJA 3CF6E 2ZX0A 1W0JA 3OW2B 1F20A 3OZUA 5F4OA 1MVQA 5FKCA 1C28A 2VC9A 2WA3A 3LDRA 5FPAA 4UYBA 4YALA 4IEZA 3RZMA 2JICA 3S57A 3PTYA 1QXRA 1SFPA 5FY0A 4FPFA 3KMHA 5FY8A 2BOIA 5A6QA 1O3SA 1Q86D 5JSOA 3I54A 1US2A 4PF1A 2QKDA 4K9SA 2RS53 1VHEA 3LOIA 4A42A 3VZNA 5FMCA 4QX1A 3LVBA 4U2AA 5C3QA 3TN92 3OBRA 5FZOB 3AGPA 1AYN1 1XNDA 1PO21 4Z07A 4NPRA 4AFMA 3E20A 1T6GC 1GZWB 4UWDA 3FHIB 4JGYB 3ZPYA 1XRUA 4NWVA 3CJIA 1H4GA 3WINE 1OOPB 3PA1A 2MHFA 1X50A 3FKSA 2R043 3GZUC 1GBGA 3GVJA 1GP6A 2VL4A 4PLOA 1KEXA 3SJPA 3IKWA 5F3IA 1YWKA 2XBO3 2Y34A 1DQ1A 2W3JA 3OB8A 1H9PA 4WBBA 2VZRA 4AHWA 5FMDA 4O7XA 3ZYPA 2YC4A 2ZXHA 4OI2A 1WA6X 5BSYA 1QVFB 1VQLB 3MFCA 1UOGA 1ZM2A 3B00A 4DEQA 3JD72 3LQCA 5CKNA 4JZRA 3ZSKA 1ZZCA 5C4WA 4HE6A 3BODA 4FTBA 1AR61 2AR6A 3IN9A 2VPVA 3BALA 2BGJA 3VNUA 2XL7A 4G6IA 2HH9A 3O0WA 1OMIA 1RYYA 3CD6B 3WW1A 3QH7A 2EIBA 2J22A 5JVVA 3AKPA 1UY1A 2YC2A 1BLZA 1M4WA 1UZ0A 1NCRB 3CBNA 3WF3A 2A3YA 2NPIA 4IGOA 2IFRA 1WCDJ 3K2OA 1RUH2 4PDWA 2J7KA 4XLCA 1YFWA 1YUDA 2JDIA 4CU8A 3CMMA 1GUIA 3U11A 3B01A 2R071 1OVSA 4I0BA 2VQAA 4FFIA 2CTVA 2VMCA 1RUE1 1WGPA 4Q4W3 1NY72 4LMFA 1AVBA 3O0VA 4B48A 4XFCA 1TMF3 4RDLA 1VBD1 1KGYA 5JSPA 2Q6KA 1WU8A 3CPXA 1PVXA 4CDWC 4BMEA 4A6SA 4Q0PA 1N1SA 4CP9A 3VGIA 3ACIA 4IGQA 1XBFA 5JCTA 4HMZA 1HRI2 1OBNA 5BXXA 3GZAA 4FFFA 3VLBB 4DK0A 3O0XA 1K3IA 3CJXA 4O9GA 3KD4A 3RMYA 4Y20A 5HXBA 4Q8LA 2F43A 2UY8A 2VZOA 1UD5A 4II3A 2WS92 2GC2A 3ZXDA 5C33A 4DMIA 2XVLA 3VKFC 2NYYA 3VZKA 3KV4A 3G6JB 5EFUA 1JYNA 3HBKA 4Y1XA 3JQPA 3MGUA 4RQPB 4QMAA 1DYOA 1LTEA 1CZSA 1NRKA 5FPLA 4GB32 5E1RA 3J26N 4XFGA 1O3TA 4QB1A 4JV4A 4QX5A 3KGZA 4L92A 1PMIA 3WT3A 2XJVA 4PI2A 4ZCLA 4EROA 1ZRFA 3FPPA 3WZ1A 1G9AA 4S2GA 1UN1A 5HZBA 2QUOA 1KJRA 2Q8CA 2NLRA 1XSRA 5KXBA 3AVRA 2XNDA 4EWEA 2CYFA 2G4IA 1G7RA 1CAUB 4LBQB 3DGTA 3LIGA 3X29B 3KT4A 1S1AA 2GU9A 3U1XA 2YBKA 1FNCA 3TEYA 3CCLB 2L9LA 2R6QA 5IYWA 1RB8G 5A88A 3CTAA 2QDXA 4LC0A 5E6HA 5LCWL 1CR7A 1S72B 2WABA 2C4XA 1FPN3 3S30A 2GC0A 4IEXA 1DGRA 1UZYA 3I1FA 4COUA 4R52A 4E4ZA 3INAA 3GNEA 4D94A 4OMCA 3I2KA 4MH0E 1JHNA 1ZVFA 4ZHNA 2RS13 3BOWA 1RHI2 5FCCA 3POSA 3AVTA 2XPJA 4XORA 3L2HA 2HWB1 1VRH2 4NMIA 4XAEA 1UNBA 5EIYB 1NA1A 2WFF1 2ZGQA 2P3JA 1R091 1XU1A 3U07A 2I45A 3VL8A 5FOBB 5A80A 4G3YC 1EFCA 1W2TA 4E8DA 2WQZC 1WUVA 2R1DA 1ZNPA 4AEDC 5FQ0A 4L97A 5FJHA 3KV6A 1KC8D 1W8NA 1SFYA 3LD8A 3BU0A 4UI9L 1UIKA 4YG3A 3O1TA 4D7SA 2OZ6A 3A0KA 1W2AX 5EV7A 3RNSA 3OE7A 4FPYA 5BNOA 1K5MB 1QY4A 4XUNA 4MO3M 3JZVA 5HV0A 3CP2A 1EPWA 3BC9A 4E4DX 3ASTA 3WF0A 5IYRA 3E1F1 5FZDA 5G04L 4CDUA 4GIQA 5IVJA 2RS32 1ZZ9A 3M3OA 3FHAA 4M53A 1TVCA 2VW0A 4KBZA 1NG0A 2G9FA 1HA3A 1EV12 3GF6A 5A7WA 2R16A 2ZEXA 2VOWA 2JENA 5A33A 1RMU2 4BQ1A 2ZJCA 1RVF3 5FY9A 2DBNA 1CONA 2RS51 3POIA 4EJRA 4HFSA 5G05L 4YZ5A 1UX6A 1NZCA 1W6MA 1HVXA 3I3MA 3SNMA 3LE0A 4WM8C 4FI9A 3I55B 2AZ5A 4LPLA 1TZOA 2A3XA 1QG0A 3ONYA 1N07A 2D74A 3GBGA 4XNFA 3AVVA 2RM23 3T1LA 3KVBA 5CFDC 2ZXQA 2VMFA 3BTXA 1V6NA 3MW2A 2R041 3C3VA 1LHWA 4P9SA 4YYOA 5L9VA 4Y22A 5AC93 1GP5A 3WHTA 5JOZA 1E43A 4Z92B 4XDPA 2WN2A 2XBO1 1QOOA 2C5DA 3ZFEA 2JB4A 3AVXA 2D40A 2X10A 1AR73 4QX3A 1VQ9B 5A3LA 3UGGA 3FMGA 4AQ6A 1UD4A 4GWNA 2GNMA 4W4ZA 2TEPA 1VBB2 2Y6KA 3VBUC 5L19A 3ZM8A 1B23P 3PHMA 5THXA 1BYHA 3E97A 3B94A 1XNKA 4JDNA 2ORZA 1W6PA 5FP4A 5A6ZA 3A3GA 5K7PA 1AL23 1I5ZA 2W2IA 1HJFA 5CBLA 5JOXA 4FXUA 4YM1A 2WAAA 4CU7A 1FYUA 1KK2A 4DUVA 2DYCA 3H1MA 5EJZB 1H8VA 4MV2A 2D6KA 2NM1A 4YVWA 2EIDA 1IGOA 1QGYA 1Q8PA 1MABA 4P5HA 5JXIA 1RUNA 1KJLA 2P17A 4CCLA 3IDEA 1EP2B 4DY5A 4AOCA 5KHGA 4B7EA 1QGZA 4FXKB 2WLPA 3PJYA 5KC5A 4OUEA 1YEWA 1UQXA 4CUCA 3ABZA 2WO2A 1MS1A 1FRQA 1ODNA 2QQNA 5C5UA 4R4ZA 3AP5A 3W5HA 4QVAA 4LBZA 3JBG2 4Q4W1 4KGGA 4AAPA 2VCAA 5FK7A 1WLDA 3CKHA 1FNYA 1CX4A 4CPBA 4XZUG 4AI0A 3KQ4B 4XQWA 1TMF1 4YZ2A 4BQWA 2ADDA 1BX0A 5T5OA 4MGTA 1U12A 3H94A 2EFGA 3CC7B 1WLWA 3QD6A 3PTRB 4E0FA 2WIIB 4ASUA 1FNZA 2F1MA 4DRVA 1AR81 2YWGA 3SLIA 3Q9OA 3Q39A 1GNHA 1E57A 4OUSA 2CK3A 4QPIC 1I5PA 1QJU2 1JU4A 3DPRB 1GLHA 4XCAA 4D6QA 3WQ0A 3SEEA 1SQ4A 2BM0A 1TTTA 4NN0A 1C8NA 2WNOA 3HIFA 1LOAA 1UXXX 3VKNA 2QJVA 4LBVA 1GFF2 4CUGA 2R063 2ZZQA 3OG2A 3NV2A 3PIGA 5FZIA 1UPSA 1XYPA 4CDXB 4JGZA 2OUJA 4LKSA 1LECA 1OD3A 4HLTA 3SH4A 5CU1A 1W05A 2XWBB 2ZHLA 4YGCA 3N4MA 1CJDA 4ACBA 3VDDB 5C71A 1WW5A 3NAPC 3VBFA 2WZPP 2VW1A 5IWFA 4AWDA 3M3IA 2NPFA 1DQ4A 1DGWA 1KZLA 2FD8A 2KA3A 5EQUA 1W8ZA 1ZM1A 3SQOA 2RJKA 1RUI2 2CNDA 3FLPA 3CXCB 3WYAA 2RMU2 3MBWA 4H9GA 2YFZA 4UFHA 1JZ2A 5A32B 5KNLA 2OS2A 5F6LB 4EN6B 1DF0A 4ACAA 1PNGA 4MXVA 4A7YA 3AFGA 3JQWA 5FYUA 2ZKNA 1AYM1 1OPMA 4HETA 5CG8A 5IFTA 3ZKUA 1C1LA 5FPVA 2QFEA 4LLFA 2HWC3 1S0CA 2Q1FA 5FJKA 4BQXA 2G1MA 1FPN1 1JMUB 1S4CA 2BWAA 2XOMA 3IDCB 1VB2A 1Q8SA 1W3VA 3QLQA 1LJ7A 1LRHA 3VBRB 2IXKA 5DXDA 5D8AC 4PIXA 4NIHA 4CEYB 4EV0A 2K2SA 1V6OA 2VO5A 5IK5A 3PUHA 2IUWA 4KG0A 1NZIA 4XMIA 5FNZA 1R1A2 4FPKA 4WZLA 1W90A 2VOXA 2H6BA 4N9IA 1TNRA 2YPJA 2HDNB 2X3UA 4Q4Y2 2Z2SB 4GKYA 3ACGA 2WN3A 4CE8A 1O5LA 5LRSA 3VBHC 4GQ7A 3OPOA 5JXGA 2GZWA 5JUVA 2GNTA 1YX2A 3ZMNA 1JOJA 3T4VA 2DF7A 2PQSA 3ZFFB 4FPLA 1SG3A 1UOBA 1H2NA 3WF1A 2ZABA 2VOVA 3O1OA 2WNVB 4YZ1A 4XOPA 1Z7S2 3EXUA 3IPVA 4OI0A 3PMEA 3ZPOA 1RQPA 2W47A 4D6SA 2YUEA 5FTTC 4WVZA 1JW6A 4PQQA 1S2EA 4BU2A 3S7EA 4QT6A 1PK6B 5HCAA 4HK8A 4X8PA 3W58A 4UW3A 3VKLA 4IEPA 3O7OA 1RIRA 2CY6A 4L11A 1RXGA 5FZHA 1GICA 3ZYJB 1L7LA 3ZR5A 2E26A 5L7OB 3CEWA 2WWUA 4GMP3 5FZ4A 3OJXA 4D8MA 2VNHA 4TSVA 4LBQD 2V31A 1UU6A 3ASIA 2WJVA 2Q6LA 2RM21 4XETA 5GLZA 1HZEA 3NWKA 3DKQA 2BNOA 3OCPA 1LHUA 4Z2WA 1W0KA 5K4LA 5DABA 5AFEA 3M3CA 1WDTA 5AC91 2A6VA 3HJRA 1NOVA 4IEUA 2GC3A 4LO8A 1NB0A 4O9EA 1XJAA 4RR3B 2ATFA 1AR71 4O65A 2VZQA 2XJQA 2DWRA 3JQQA 4UAPA 5FLHA 5AFBA 3RI8A 1P4MA 2A6XA 3NW4A 4QHYA 3OEHA 2ENRA 1SMVA 3RG0A 2Y26A 2G9GA 5C70A 2WSVA 2WZNA 1C1FA 2Q1ZB 3POWA 1N06A 3H9NA 1K73D 1AL21 1YXWA 1OQEA 4NBSA 2JIGA 2CDPA 3R6JA 2VMIA 2ZS6B 4QX8A 2VCMA 1KITA 3MZHA 3OGRA 2R0FA 5A7QA 4CDQB 4AXOA 1RUF1 4GJZA 1AYN2 1PO22 4IXLA 3M7AA 3VHOA 2PIAA 3VZJA 3MUZ1 1QNWA 1AIPA 1DFQA 1D1NA 4CDWA 4Y1ZA 2XDVA 3JD73 4DRRA 1JZ7A 3J7MA 2C5HA 1A8DA 4A3XA 4D0QA 4NAOA 4Y3OA 3H8RA 2D6NA 3RPQA 2WYSA 4W6YA 4GWJA 4N9HA 2IVIB 3N7MA 3PUNA 2PHRA 1H8EA 4LE4A 3KS7A 4ASKA 5GLVA 4Q8KA 1YQ5A 1W8HA 1US3A 3A1PA 2NV4A 1PO13 1HN0A 4QUZA 3GVKA 4EYUA 1TEIA 3RZZA 2P2KA 3C7FA 3I2IA 5KHHA 4OOSA 1MQTC 3G71B 3ZYHA 4GQNA 1XQNA 1W6QB 4RD2A 5H9PA 4XXPA 2R061 2IC1A 4RGKA 3WG4A 1AR62 2ES3A 1UU5A 3BKZA 1NXMA 3MIHA 3WNXA 2ZL5A 2ZGNA 4YW3A 1D2SA 2W1WA 1E63A 1I18A 1EPZA 3BUCA 3LFMA 1TME3 1O4TA 2D3LA 3MV11 1HRI3 2XLAA 5DAVA 2DUPA 3G05A 1C3HA 2ZAHA 5GKAC 2WA4A 2ZGTA 3U0ZA 5FYBA 2XHNA 3D8CA 4QGNA 1F15A 2Q6IA 3SITA 5CVRA 3MIDA 5FXVA 3A22A 3N3HA 5J37A 3Q6QA 2QZ2A 5LATA 2A6YA 1ZZ8A 1ND3C 2R072 4PLMA 2GMEA 4COZA 1RUE2 3V0BA 3S5AA 3NE5B 1G7SA 1QOSA 1N1VA 3MF9A 3BQJA 1BMV1 2YWEA 1QHDA 2DCYA 4IV3C 4IETA 1UYXA 1VBD2 1NBMA 2E33A 3N9LA 4ZCMA 3ZXEA 1PNFA 4ASMB 3KV5A 5CYYA 1NYWA 3PNAA 1GMMA 4C43A 2HWC1 1WA4A 2VQUA 1CAWA 1IG0A 1QFYA 4EN9B 3A7QA 3RI9A 2EICA 2PE3A 2PA7A 2VBBA 2A7AA 4CP9B 3ZC3A 5J3OA 1XE0A 4ITCA 4B8EA 5CIRA 2B42B 4X6QB 1BQEA 1B35C 5FO8B 5B2GB 4C0SA 4P9JA 1VIWB 5FZ8A 1WOPA 4XW3A 4AEDA 1S0IA 5HPOA 3AYCA 4N43C 3LQEA 1IZ3A 4N8MA 1QJX1 4GMP0 3S0MA 4Y20B 5GV8A 2EAKA 4I01A 2GNDA 1Q3EA 4BISA 1C5IA 2B46X 4XLFA 5FAXA 1R083 2JDPA 2XXZA 3MUY1 4CCEA 3GYDA 3W20A 5FZ9A 3WW3A 1WCKA 1IKPA 4CYDA 4EH1A 2V7VA 3MW3A 3RQ0A 2VU9A 2VQTA 4XMYA 1IPJA 2RDRA 3WR0A 3CMAB 4AVZA 1C4RA 3M3EA 3I3EA 4BOWA 2BSAA 2XLGA 4QM8A 3LEIA 1BKZA 5A3OA 3WX5A 4C8DA 3IAPA 1Y9GA 3CCQB 3VBOC 3V0AA 2VOKA 2OQ6A 1DQ5A 4WM8A 4G7WA 2VVEA 2NMNA 4X6RB 2BTVC 4KU8A 3ACHA 1FMD3 1DZTA 2P3IA 3ON7A 1ULOA 2JE9A 2VD7A 4N3NA 3OEEA 5EP9A 5JIUA 5GZDA 5CFDA 3ZMOA 4BB3A 3ZN6A 1GV9A 1N47A 5DZFA 1UYZA 4AF9A 1YLLA 2Y33A 4QKBA 3KCCA 4QDSA 2HWB2 4GMP1 5FO9B 1FNDA 3KHCA 2DETA 2WFF2 4XL9A 2PHLA 1R092 5FMOL 3RYRA 5FXZA 4EWAA 4QDQA 4AVBA 3IDBB 2DU1A 3CZJA 4MVTA 1L3JA 4KWLA 5FP9A 4D7YA 3DV8A 5LK5A 3CCJB 4QQLA 5LB6A 3VBUA 1O59A 4QXBA 3LEGA 1I9RA 2XJPA 1RXFA 1WMFA 4E2SA 4A2UA 4RDKA 1X9PA 1OF4A 1Y7BA 3S5QA 4QGLA 4DUWA 2C4UA 5FQ0B 5FZ6A 3O1MA 1LB2A 1BBT3 1N3PA 5DG1A 4X8NA 2YGMA 1PHMA 4IUGA 3KWVA 2XVKA 2HLEA 1GP4A 5I0DA 2VW2A 1YQCA 5J3UA 4WZKA 2YBSA 2JXAA 1VQNB 2HWE1 4JQRA 4KWKA 5C3RA 1SKYB 3FBMA 3WCRA 1UD6A 1YQ8A 5BNOB 3CCEB 1A6CA 3OGSA 4ARXA 4JKLA 3AP6A 4FPOB 3JB8A 2WINB 5LA9A 1HB1A 2VE1A 3H7YA 4AVSA 1UZWA 2Z6BD 4GALA 2HEYF 4W6WA 4CDUB 4YEJA 1IPKA 1ZRDA 2AHOA 2RS52 1Y43B 5FK8A 3LB9A 3OYWB 3BI3A 4U9UA 5C8WA 1WMXA 5FY4A 1VMJA 5A7WB 4AI9A 4KG8A 2BJSA 4LBYA 5IK8A 3SH5A 2XQXA 3SXWA 3Q6RA 1IS6A 1O7FA 5LA0A 3P26A 2ET7A 5EYYA 1IJEA 3ALQA 4HG6B 5DUVA 4X8IA 1W6MB 4YHBA 2DIEA 2OZJA 3I49A 2P3YA 3ILFA 3VO1A 5CKMA 3B78A 1T2XA 4QPIA 3NL1A 2H6CA 1GJRA 5A1LA 1OOPC 2R042 3HBZA 3BTAA 5F4JA 4LKEA 2VZTA 1SHWB 2W08A 3FLRA 4C0BA 4XPVA 2D98A 1FRNA 2XH6A 4I02A 1G8WA 2BYVE 4MOAA 1DZRA 4NJ4A 2XBO2 4FQ4A 4ET7A 2JDAA 1PO11 3R4SA 3PVNA 4Y22B 1IQAA 1COV3 4MZUA 3THTA 1DYPA 3LAGA 3WDXA 4JQTA 3LWCA 4TWTA 5L9RA 2OX0A 5T5PA 4CUAA 3KV9A 3FUQA 1H1IA 2QQLA 1UPIA 4KKUA 3NAPA 1YCIA 1GR1A 3ZBTA 1FNMA 3WHUA 3AVSA 4RD4A 1WWYA 2D3RA 3JCIA 4XQFA 4XFFA 4GD4A 3TB0A 2ZOEB 3M1HA 2WAOA 4XE9A 1W6PB 3CRZA 1TME1 4K40A 2P1BA 1DDLA 1VQ8B 5JOWA 2E7TA 3VBSC 1C57A 3ASRA 3T0BA 3POEA 3P3NA 4YVWB 4AI3A 1OFNA 4O61A 3P27A 3OKXA 3TEZA 3NJZA 1E79A 4JC1A 2V7WA 5E89A 2V7QA 3SLNA 2V4AA 3K77A 1V6MA 2JDMA 2B39A 4RN5A 5FY1A 1GNZA 4Q4W2 4QFMA 2ZGSA 4INDA 2GJPA 5GV7A 4LA3A 4YWAA 1EP0A 1TMF2 4OVEA 1POV3 4XTMA 2C24A 1ENRA 3GZEA 4FT8A 2BVVA 5ABJB 5D8AA 3WNKA 5IVBA 5C3PA 2M5SA 1AR82 2HEWF 1YLOA 4PI0A 1WTHD 2HWD3 5T55A 4BQ3A 1MRZA 1A8MA 4AGRA 3AK0A 2R7EB 3PLQA 2DVBA 3NKTA 1ACCA 3AB0A 1P8JA 4XZPA 2GDFA 5FPBA 2EXIA 4QX0A 2YHJA 2GJRA 3VBHA 3H3LA 1LGNA 1GZCA 2QQWA 4UZEA 1Q8VA 1X36A 3FBYA 5FWJA 3MLLA 2XZPA 1OHHA 4W6XA 1YQ6A 3E6BA 4AZZA 2VECA 4QX2A 1AX2A 1HXS3 5BY5A 4P5YA 3POBA 1JXNA 2UWAA 4M3CB 3U10A 2XL9A 1LGBA 1WSRA 2XLFA 4YW4A 4QKNA 1Z78A 3N9MA 4IV1C 3ETQA 5C3SA 2DFCA 1WOSA 4JGZB 3UKTA 3FFQA 1AXKA 1M1KD 5GLTA 5JR7B 4H2AA 3IAQA 1ZM9A 3O1RA 1W0NA 4QHOA 3D82A 1BVP1 1JI6A 3T2QA 4YFZA 2RC5A 2FDGA 3ZYBA 1YITB 4BH9A 4A4AA 4Q4Y3 4YZ3A 2BM1A 3BH4A 1AYM2 5FXXA 4BE3A 4HZFA 4F7DA 1RC6A 4CCNA 1W2NA 1SFNA 3PA2A 1QEXA 1U5XA 4OOXA 3WQBA 4DXRA 2WSUA 4B47A 2DFBA 1FPN2 5ACA3 2A70A 1W9WA 1FMD1 4W50A 2W0XA 1HQWA 4IE0A 3KF3A 2QQKA 1X9TA 1QVGB 4LR4A 2PMWB 1YQ2A 3WNMA 1EUTA 4YAOA 4I3PA 1XOYA 3FPKA 1F60A 3CC2B 1YJ9B 2WZR3 3PUMA 3NNMA 1AR93 3WG1A 4NNJA 2MNGA 4U36A 3I3BA 4GWIA 1MS8A 2PYTA 3ZFGB 2Z69A 1G9DA 2VNGA 4Z4YA 3TEWA 1TE1B 1IB0A 3R4UA 4QAWA 3WNNA 2B9VA 4XR6A 3AFKA 3ZIWA 4S2HA 3VD7A 2O14A 4MGZE 3KQRA 5T52A 4XUTA 4AK3A 2XZLA 1GQGA 3SEPA 5DUXA 4XURA 1POQA 2RDQA 4XF0A 1BBT1 4ZY9A 3VKMA 1AXZA 3DXUA 4E9KA 4PC7A 4II2A 3C8XA 4TMVA 2AUYA 5B4NA 4AGVA 1O8SA 5FPZA 4FWTA 2VVFA 2QGGA 3ZUGA 2QQJA 2VZSA 2R30A 2LUWA 2YV8A 1RVF2 2BOJA 1VMHA 1G9CA 1EWYA 1UL9A 1QQP3 3A23A 1B2RA 4XTPA 4YZ4A 3AL6A 3F2ZA 4GH4C 3CB4A 1VJ2A 4PIYA 1A3KA 3CL1A 1N0UA 1MZEA 2PN5A 4DUXA 3F95A 1EAH3 2RM22 1Y9QA 3E1YE 1HQLA 5KBFA 1CZVA 1XE7A 4NIGA 1AF9A 4ZU7A 2X6WA 4KQ7A 2XZOA 3GBFA 5BNNB 1CAXA 2YFUA 4XXAA 1S0DA 1MQTA 5AC92 1POV0 4Q2FA 5IUQA 2A6ZA 1IKQA 3WEZA 1FDRA 2B7YA 3HMYA 3ACLA 4F83A 3ILRA 1AR72 1WKYA 3AVWA 1COV1 4NHYA 5B4XA 4HIZA 1E5IA 5SV5A 3THCA 4B1MA 3OPWA 1ZM3A 4Z4RA 4CZSA 4CU9A 3CLPA 1OFSA 4Y24A 4OI1A 3A35A 3G7DA 1LOCA 4TN1A 1VAVA 5A6YA 1SDWA 1W6OA 5LY2A 1AL22 3USUA 1OB0A 4QGMA 4KGQA 2FDJA 1KS4A 1ND3A 1JYWA 2UYAA 1K9MD 5GZFA 2I07B 3U2QA 4JTOA 2DOGA 4XBNA 4LO4B 5HXMA 2P6HA 4IE4A 3RWKX 3AL5A 2BEOA 1RUF2 3KL9A 2PXJA 4IV3A 1QJY3 1UXZA 3HN3A 2ZGRA 1YI2B 2OXBA 2JIZA 1H2MA 1SPPA 5IVCA 4XYXA 4WZEA 1J58A 1FATA 3T53B 1TVGA 1U0AA 3G6EB 2BMWA 2W94A 1WORA 2WT0A 2RE9A 4XIOA 3SMHA 1XYNA 3V64A 3MDPA 3BPSA 2VNOA 2E51A 1RUJ3 5IVFA 4CXYA 4FPGA 4CDWB 4N7UA 4XF9A 3W2GA 1LODA 3H0OA 1POV1 1R1ZA 1O6UA 1KQRA 5F9TA 1B35A 3J81k 5LA1A 2UY9A 3ZX7A 3POGA 4YPJA 4OI4A 4LHKA 4N43A 1K5JA 1W28A 3ZXJA 3P5BA 4KMQA 1XNAA 2HWD1 3CMGA 4IEQA 1JH5A 1NE4A 2CL2A 3OOXA 2BN4A 4D7TA 3J9SA 2OBTA 3LNNA 2CF4A 2CHHA 5I0TA 1H85A 2C0ZA 4COVA 4YAUA 2R062 2PQQA 4WZTA 2F6BA 3NSTA 2VVDA 2QEXB 4N90A 1LHVA 2BPOA 2ARXA 2JECA 3LIHA 1UCXA 4XM3A 1HXS1 4BPRA 3HQUA 5KXEA 1RJ7A 4LO6B 4CUBA 1LAJA 3MHPA 1OXCA 4YVSC 2BV3A 4FPJA 1RITA 1DLCA 1EFTA 4G1BA 2DVDA 5A1FA 1S0FA 2X8KA 1DGLA 1OQDA 3VB9A 5LW9A 3VBOA 4YLZA 2WFPA 2JD9A 1GQPA 2Y8KA 1EUUA 4FFGA 4G9SB 4AFAA 2HYXA 1RUG3 1GWKA 1X82A 1DYKA 3RZKA 1R5BA 4J1WA 1V0AA 5EZWA 4MGSA 5A1AA 1PGW1 1XSQA 1ZBA3 1BMV2 3ZSMA 2EIGA 2WZEA 1Y3TA 3LA3A 1N3QA 5FZAA 4RGGA 1LHNA 5I93A 4RPDA 1MZ6A 1N8RD 1W87A 3SJZA 2VNVA 1KS5A 3NJVA 4CEWC 1D0HA 5I0UA 4LA2A 5I8TA 5FZ0A 2C4TA 2HWC2 4AG4A 2GK7A 1VPHA 2PTMA 2PAMA 1F4AA 3Q8FA 4XKWA 1VBE3 1YI9A 2GSYA 1FX0A
chains in the Genus database with same CATH topology
3KCXA 2YXSA 2VOXA 3H1WA 2H6BA 4N9IA 1I8DA 1TNRA 2X5IA 2YPJA 4QPGC 4CEYC 4R9CA 2MEV3 4Q4Y2 1CAVA 3DDYA 1SBDA 1K5MA 2Z2SB 4L2NA 4K1ZA 2ERFA 1YRZA 4GKYA 5KHIA 5KHKA 1VBE2 3THPA 1UKGA 5F6KA 1O5LA 2EXJA 3VBHC 2HEVF 1SBEA 4GQ7A 1F9KA 4LHLA 4M3CE 3OPOA 4META 2WZR1 2OUHA 2BNNA 2UU8A 4XFAA 1BK1A 5I91A 1Q8OA 5K9YA 2GZWA 1LKNA 3N35A 2CWMA 4NHKA 4BHPA 3UK9A 1AR91 4J6GA 2GNTA 4XJUA 1LENA 1J1TA 2MEV2 3ST7A 2SLIA 4XLEA 2DUQA 1SCRA 5BNPC 3ZMNA 4AEDB 3GHNA 1JOJA 2DF7A 3EBRA 4PF5A 1Z7S3 2RS12 3KEWA 4Q1PA 4FAGA 3ZFFB 3H8UA 2HYKA 2GH8A 1ALYA 4FPLA 4YELA 4AE2A 3CO2A 1H2NA 1BZWA 2JG9A 1GYKA 2DTYA 3AYEA 4R8HA 1OSGA 2ZABA 1F8VA 1UD3A 3VL9A 2VOVA 2WNVB 5CB7A 3AMPA 4XOPA 1Z7S2 4YZ1A 3EXUA 2WT1A 5IK4A 3IPVA 2CAVA 4OI0A 2B8MA 2CGPA 3PMEA 2RS31 3A3BA 3I8TA 5DZEA 4K20A 4S2FA 4XDQA 4Q0SA 2YUEA 5FTTC 4WVZA 2ARBA 3WDVA 2OA2A 1EV11 2WQ4A 3WQ7A 4YM3A 4AYUA 1JW6A 1FI2A 1OHFA 1RMU1 2WNVC 4AQTA 1G6NA 4HN0A 1O3QA 3S7EA 4QT6A 1PK6B 5HCAA 4HK8A 1H1MA 3I4IA 1U5IA 4X8PA 3PVEA 3LCPA 3W58A 3RMXA 3AX4A 4Z1VA 3I7DA 1PZ8A 4QQOA 4R4XA 3SH3A 1H2KA 2WPDA 3B9IA 4UW3A 4ES9A 3VKLA 4IEPA 3O7OA 1V6JA 3A4UA 4Z8BA 1RIRA 2JG8A 4D69A 2CY6A 3AP9A 4SLIA 5A3MA 4L11A 1JUIA 2LM3A 2AENA 3AKRA 3CU7A 1HV1A 1OQ1A 2XVGA 2ZCWA 5FRAA 4CRQA 2FZ1A 4UXAA 1FOD3 5JDBA 4PBPA 3OYWA 1GICA 4XHBA 4P22A 4EN7B 3V0AB 3ZYJB 2ZXIA 2ZMLA 2E1BA 4HK9A 4YW5A 4WVVA 2UWBA 4Q0VA 4HT1T 3MPBA 1UU4A 5GALA 5TSWA 4LUKA 2ETEA 5L7OB 3CEWA 5D1IA 1J59A 4GMP3 1JTZX 2B9UA 2O8QA 3BPZA 4TSVA 1I3HA 4LBQD 1NA1B 1FV3A 2D43A 4HPKA 4OHXA 2V31A 1ENXA 1UU6A 2ZBJA 3WG3A 3O14A 4LE3A 3ASIA 1FOD2 2WJVA 4MXWB 4H55A 2O0OA 1PGL2 3B3QE 2XHKA 4N7IA 2PHFA 3RJ2X 1BQPA 1OOPA 4FOVA 1QQP1 1CESA 1V6LA 1HW5A 1V9U3 3B93A 1NLRA 2RM21 4XETA 1ZBE3 2CV6A 2Z42A 4LEJA 5GLZA 4YNIA 5L7OC 1HZEA 4E2QA 4XQDA 3TOJA 3NWKA 4B3GA 2FMDA 2P3KA 4GH4B 3AXDA 4ZU5A 3ZN6B 1JN2P 3PJQA 4HKOA 1NA1C 1FX5A 4OLLA 2BNOA 5DUUA 3OCPA 1V0FA 1LHUA 2Q5TA 4Z2WA 1W0KA 1UIJA 1V9U2 3QH6A 2PHUA 4XEZA 2WJYA 1EAH1 4Q4V2 4AI1A 2BNMA 4COWA 5AFEA 3M3CA 1DHKB 1ZBE2 3OAAA 2XJUA 2Q0AA 5GJ6A 3ES4A 5C9AB 5AC91 3GBWA 2A6VA 2DCTA 2NP0A 1NOVA 4IEUA 2IXHA 1CN1A 2PHDA 1AZDA 2Y0OA 5BPXA 1DQ6A 1OD5A 3NKGA 5IK7A 1XNCA 4B4PA 2ZHKA 3FX3A 2AH2A 2GC3A 2JE7A 5FFOC 3E5UA 3WDTA 1VBB1 4LO8A 1MZFA 4O9EA 5JZGB 4RR3B 2ATFA 1AR71 1H8TB 1AHSA 4NHLA 4FTSA 2XJQA 5F5QA 1VBC3 4XF4A 5C9AC 2DWRA 3BOPA 4RS5C 2V5YA 1QNYA 5FLHA 5AFBA 3RI8A 3ZIAA 1W6NA 2A6XA 1PZ7A 3NW4A 5BNOC 3D0JA 3MYXA 3OEHA 4Q0UA 2ENRA 1IHMA 1SMVA 3RG0A 4F3JA 3AKSA 2PHTA 2Y26A 4ONUA 1MR5A 5E8AA 5JZGC 2G9GA 2PHXA 3WQZA 3GHMA 3MIGA 4RR3C 1VBC2 3B9CA 2WSVA 1BJQA 3EJKA 4WVMB 1C1FA 3VZOA 4Q4X3 2Q1ZB 2XGXA 5I8YA 3ZPNA 3POWA 3SCFA 2D3NA 1J3PA 2HWE2 4ES8A 5A33B 2EAAA 2W68A 4OULA 4CDUC 1AL21 1YXWA 3RYPA 1OQEA 2BQPA 3URFA 1AYN3 1RINA 4OHWA 1PO23 1LCLA 2VMIA 1N1TA 2UURA 3VBSA 4M00A 2ZS6B 1KFXL 3ECQA 4Q4X2 5CFCC 1KITA 4FTEA 3B7MA 3MZHA 1CGPA 1Q43A 1NE6A 2ZA9A 3ROUA 4JGYC 2R0FA 2R9VA 1WD3A 4CDQB 4DS0A 3OD4A 3WW4A 1B09A 1X33A 2ZZEA 1RUF1 2LTNA 1AYN2 3ELNA 3LSDA 4AXOA 2EF6A 2FMYA 4IL7A 1PGSA 1PO22 5T3NA 4IXLA 3M7AA 3VHOA 3TWIA 4FPHA 3VZJA 4IQPA 2ZX1A 3H7JA 1QNWA 1CIWA 3JBG1 1DFQA 4CDWA 4Y1ZA 3ZSLA 5K8SA 2A73B 4L9BA 3JD73 2D5HA 1UMZA 4DRRA 4QU2A 3RRDA 2ET1A 1MEC2 3ZYIB 4CDQC 1QOTA 5C8CB 1NCQA 1A8DA 4A3XA 1QJY1 1VLNA 2D6NA 4FVVA 3DPRA 3RPQA 4TZDA 4W6YA 4P9YA 1BEV3 4QXKA 2VY0A 4N9HA 4S2DA 4OFGA 1KMHA 1G7YA 3N7MA 2PHRA 2GNBA 1H8EA 3CP8A 3DUIA 3R0RA 3KGLA 4AFBA 4JVAA 2D97A 4LE4A 5LEJA 4DB5A 3FZ3A 3KS7A 4GULA 4DFSA 4QM9A 5K0UC 5GLVA 1QJU1 5ABJA 4Q8KA 2A75A 1VJSA 4XLHA 3MFAA 2ZTGA 3ZFEB 1BEV2 1RUJ1 4I09A 2W6JA 4AGGA 4L8QA 4CDXA 1ZREA 5DZGA 4LLOA 4QPYA 1LR5A 1PO13 4H7MA 3K51A 2GJKA 3GVKA 3H50A 2OIIA 5T5JA 1TEIA 2HJIA 4XIKA 3ZVXA 2QZ3A 3RZZA 2ZAAA 4AW7A 2P2KA 1ULDA 4Y5Z0 4XILA 1GR3A 4QPIB 2D44A 5HKKA 2JDZA 3QACA 2AYHA 2TUNA 3HWJA 1APNA 4HN1A 1N1YA 2NZ9A 4Y1VA 1AR63 1WBFA 3VDDA 3IM0A 3RYKA 3ZFEC 2Z5WA 1NLSA 3IIAA 4FOYA 1ZRRA 1REFA 2BUKA 5KHHA 1PO12 1MQTC 1E1RA 2WNUB 3ZO0B 1E1QA 2C1FA 5H9RA 4GQNA 1XQNA 1W6QB 5H9PA 4AHYA 4XXPA 2R061 2XWJB 1NCRC 2IC1A 4I0AA 4K3UA 4WZCA 3WG4A 3ZYGA 1AR62 4IV1A 2ES3A 3E5XA 1HRV1 1UU5A 1IS5A 3NO8A 4XBQA 1V6IA 5JI7A 2E7AA 1NXMA 3FUOA 4N53A 1SLTA 2WS91 3MIHA 1ASJ2 2DV9A 4XD7A 1VALA 2WNUC 3WNXA 4B29A 4XF1A 4JMQA 2ZGNA 3J4UH 5CAZA 4YW3A 1D2SA 4M3CA 1I18A 1EPZA 2VMHA 2BBVA 1QDOA 2ZX2A 3HD8B 1TME3 1O4TA 1XYOA 2XGJA 2D3LA 3FC0A 1ND2A 4RL7A 5A32A 1HRI3 3OF1A 2XLAA 4NWWA 2DUPA 3G05A 1XXNA 4Y4YA 1C3HA 2ZAHA 2R073 5GKAC 3MIBA 2WA4A 3O5SA 3BCDA 3N7JA 3R05A 2ZGTA 3U0ZA 2P34A 4AI8A 1RUE3 2YROA 2V4DA 3R6SA 4YVWC 3D8CA 3E6CC 4QGNA 1VBA2 3AYAA 1D0GA 1RUI1 2XKOA 3SITA 4UBGA 1AR83 5CVRA 1TME2 3M2MA 3MIDA 3MF6A 3N3HA 5J37A 2RMU1 2QZ2A 3WDYA 4I30A 4YVSB 1REEA 3GVLA 2A6YA 4XN3A 1ZZ8A 1ND3C 1O91A 3HQXA 1S55A 2R072 4PLMA 1VBD3 2GMEA 4AVAA 4COZA 1CAUA 1IS4A 1RUE2 3V0BA 1SCSA 4LO7A 3NE5B 2R0HA 1NQJA 1QOSA 1N1VA 2ZX3A 3MF9A 1H30A 1BMV1 1D4M3 1FXZA 2R32A 1W0OA 4BZ4A 1URXA 2Z79A 1QHDA 2EXHA 4FP2A 3SCHA 2DCYA 4DY3A 3M3QA 1UD2A 1RUG1 3KLSA 3OTFA 4IETA 4IV3C 4MX3A 3VBRA 1H2LA 1VBD2 1NBMA 3AYDA 4MSVA 3RS6A 4PLNA 4AI2A 4YG0A 3JB4C 4P9WA 4KH9A 3WUDA 3KZ4C 4KU7A 1YJKA 1ZBA1 3ZXEA 1PNFA 3VZLA 1D4M2 4ASMB 5J36A 3ZN4A 3WD5A 3ATGA 4AVCA 3TRSB 4YG6A 1QXPA 2R49A 1NYWA 3PNAA 2D6LX 4RGAA 1B35B 3HT2A 2GN7A 3PVOA 4RA0A 2GAUA 2HWC1 1WA4A 3WVJA 1CAWA 4EN9B 1DGWX 2XOKA 4FO9A 4ATEA 3RI9A 2PA7A 1WPCA 4Q0QA 3LA2A 4UBHA 1KDMA 1DG6A 4CEWB 1ZZBA 5JPMB 5FDBA 2A7AA 1AJOA 2Q4SA 3UKNA 5J96B 3DKWA 4P9IA 1R1A1 4ITCA 1SACA 2PHWA 4B8EA 5CIRA 4B7KA 2B42B 4X6QB 2HWF3 1B35C 5FO8B 5B2GB 2AGSA 2EALA 1X7NA 5JAXA 4RQPC 4P9JA 4F7ZA 1LU2A 1NQDA 1VIWB 2PLV3 2QDNA 4XW3A 3UKVA 3JQXA 4RHV3 4B4QA 4AVTA 3MW4A 2ILMA 4XMAA 4AEDA 3K48A 1S0IA 4Q4Y1 2RR13 3AYCA 1AX0A 3JUUA 4N43C 4WM7A 5HCFA 2IXLA 1D2QA 3ZFFA 1VBE1 3KB5A 5E16A 1IZ3A 4CTEA 2A6WA 1QJX1 4GMP0 1WCSA 4SBVA 2HWF2 3S0MA 4Y20B 1FV2A 2ZGPA 1LHOA 5GM0A 1YNAA 1PVC3 2F4PA 3AZYA 2EAKA 1CVNA 2PLV2 2KVOA 3ZXKA 4RHV2 4E2GA 4LO5B 1GQHA 4QPGB 1ZZ6A 2MEV1 4TKOB 2GNDA 2RR12 4I01A 1K28D 1DQ2A 1Q3EA 1C5IA 4JGZC 2B46X 2BFUS 5ACA1 1UAIA 2W39A 4XLFA 3VBFB 4B3FX 5FAXA 1AYM3 1R083 2RS11 2TNFA 1RUOA 1C5HA 1LOBA 3ZFGA 4DK1A 1ULFA 1J1LA 3GYDA 5DDJ3 4B3NA 3WW3A 1PIV3 1GANA 4MLOA 1PVC2 4YSFA 4FAHA 3WOGA 2IXIA 1WCKA 3AZVA 1IKPA 3USSA 4CYDA 4UZUA 5BUVA 2XJRA 1C8M3 3MW3A 1LOFC 3RQ0A 2VU9A 4FP3A 1WMDA 5BNPB 1Z7S1 2P37A 1R082 4XQ4A 1PK6A 5CA6A 1ENSA 3VBFC 4BYYA 1WW6A 3B69A 4XMYA 5CG9A 1IPJA 3IMNA 3WR0A 2JKBA 4V1PA 1BXHA 5DDJ2 3AKQA 3IBMA 3RSJA 1PIV2 4AVZA 2X6XA 1C4RA 4JCKA 3M3EA 2Q30A 1AXYA 4BOWA 4JAAA 2TBVA 2XLGA 1F2NA 1C8M2 4QM8A 1IS3A 1BKZA 3OGGA 1MACA 1I6XA 2VNRA 4MGYE 3WX5A 4HBNA 1W39A 4GKXA 3WG2A 3PVBB 4BLIA 5GZGA 3VBOC 3V0AA 2VOKA 4KBBA 4NOTA 1LESA 5FREA 2B5HA 1G9FA 3UJOA 3HN1A 1DU3D 1YHFA 4M0HA 1WMEA 2ZMNA 4L99A 1DQ5A 2KM2A 4WM8A 3ENRA 4YARA 5T54A 4G7WA 2VVEA 2NMNA 4X6RB 1RTVA 3U4XA 4XFHA 2CAUA 3RJRA 4LBNA 4UW6A 2BTVC 4KU8A 2IXCA 1FMD3 1RUD3 3AM2A 3H1YA 3MIFA 4HVRA 4FXGB 4DNYA 4NVPA 1DZTA 2P3IA 2JE9A 3HT1A 4OHZA 1LOGA 3TAYA 2HWB3 3OEEA 4ORFA 3WY6A 4DQAA 4Z1MA 4J1XA 3AP7A 2JX9A 5JIUA 5GZDA 5J98B 5CFDA 3ZMOA 4COYA 5JIAA 4DINB 4UW4A 2DTWA 4GH4A 3ZN6A 4HSLA 4ASLA 4BWOA 1GV9A 1N47A 5DZFA 2WFF3 4AF9A 3AP4A 1FOD1 2DVGA 1YLLA 1FMD2 1OPOA 1R093 1RUD2 1PGL1 3KCCA 1OA3A 2ZZFA 3RDIA 1EY2A 2GH2A 2HWB2 2EVXA 2CNAA 3WW2A 2RHPA 5C9AA 4ZKTB 4GMP1 2WC2A 2BVBA 4FCAA 4XBLA 5FO9B 2X5IB 2WFF2 4XL9A 5J48A 4XOTA 4TT3A 2PHLA 5HXVA 3TBDA 3EQEA 3D0SA 2X53S 1R092 2X6YA 1RVF1 1S0BA 5FMOL 3RYRA 4AQ2A 4EWAA 1F5JA 3WV6A 1V9U1 2Q1MA 4Q4V1 1QXJA 4LBMA 4KWJA 3SISA 5FL7A 2DU0A 4YFWA 4AVBA 1ZBE1 1H8TA 2DU1A 3IDBB 1FAYA 4MVTA 2D7FA 5AVPA 4KKTA 1L3JA 1MVEA 2A71A 1RUC3 2JJ1A 4KWLA 4WV8A 1GSLA 4IEVA 2XB6C 2X5IC 4D7YA 3DV8A 3OY8B 5LK5A 3AMMA 3OGJA 3CF6E 1K5MC 3ZSJA 4YGBA 2ZX0A 1W0JA 4QQLA 3VZMA 3VBUA 4Y26A 3ZN5A 1GKBA 3AZWA 2I74A 4E4SA 1MVQA 1I9RA 2XJPA 5BNNA 1C28A 3APBA 1WMFA 2WA3A 4E2SA 1RUC2 4WVMA 4JRLA 4A2UA 2YGLA 3A0NA 4IEZA 4AVVA 2JICA 1BLIA 2YY1A 4C1WA 1Y7BA 2WNEA 2UWCA 4QGLA 3OD0A 3PTYA 1D4VB 4Z82A 5FQ0B 3IPVB 4GA9A 1LB2A 1YFXA 1BBT3 1QXRA 1N3PA 5DG1A 4C91A 1BVVA 3NV1A 4X8NA 2YGMA 4FPFA 1PHMA 3KMHA 2XVKA 1T5EA 3POYA 4AEMA 1O3SA 5JSOA 3I54A 3D5OA 2VW2A 1VBC1 2JG9C 5J3UA 5JMCA 2JXAA 4RS5B 2VGDA 1QF3A 2FQPA 2HWE1 4JQRA 3TN93 4KWKA 3OFNA 1SKYB 3FBMA 3WCRA 1UD6A 2KXLA 2QKDA 5BNOB 4K9SA 1BBT2 2RS53 4K7JA 1A6CA 3AP6A 5CNAA 4FPOB 1QGLA 3LOIA 3JB8A 2WINB 3VZNA 2XG3A 1J3QA 2JG8B 4Q4X1 2VG9A 4YM0A 3H7YA 3KSCA 4AVSA 4U2AA 2E63A 1O4ZA 2Z6BD 4GALA 1V6KA 3TN92 5GLWA 2HEYF 4W6WA 1YJLA 5C8CA 4ISRA 4CDUB 4YEJA 1IPKA 1RJ8A 3OBRA 1ZRDA 2RS52 1Y43B