4ACBA

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
469
structure length
448
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEITIDIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
molecule keywords TRANSLATION ELONGATION FACTOR SELB
total genus 97
structure length 448
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acbA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acbA01
3CC2B 4KHZA 1ZNXA 3KQKA 2P5SA 3ZD7A 1AM4D 2R6GA 4V0KA 4MGIR 2XB4A 3K53A 4BEJA 3VX3A 1W87A 1LVGA 2J5XA 1H8HD 1BMFD 3B78A 2RGGA 1XXHE 4QRHA 1VQMB 1FX0A 4OHYA 4KLZA 3ZLJA 3FTQA 4ZCMA 1BQEA 1VDZA 4U7DA 3B60A 1NIJA 2QM8A 1Q0UA 3IILA 2OZEA 3OAAA 4MUBA 4OKSA 4RFVA 4TL6A 3U3KA 1ZRHA 5AUNB 1SVLA 1FOEB 2MSCB 3V4RA 1FMJA 2QM7A 5DN6A 4JSTA 2X19A 4HUQB 3R20A 1Q1BA 2QI9C 4JLVA 1YJNB 1HY3A 1JALA 4Q03A 1WBDA 2DPXA 4ARZB 3ZZ0A 3EC1A 2ZRPA 3U44B 1W0JA 4TZ0A 3BJIC 5J40A 1OXXK 3X1WA 3SOPA 2PMDA 3LNCA 3V00A 2G88A 5B64A 1WB9A 2GBLA 3EPHA 4HAXA 5J4YA 5JEEA 2IYVA 2IYUA 4QGAA 1SXJB 2F55A 5LB2A 1FP6A 3CW2A 2J0SA 3RC3A 4LC0A 1OH8A 1XEFA 2ZR7A 3K0AA 4V0LA 2B21A 4M21A 3T35A 4JLOA 1AJEA 4TLBA 3SE0A 2RAPA 1ZC3A 5E7JA 1XZPA 4YAOA 2QGZA 4L15A 5ANRB 3THWB 1GP2A 4PX9A 1VIYA 3SNHA 1ZINA 1CJMA 1Q12A 3CWZA 1VQ9B 1XEXB 5UKDA 1E0AA 2IYYA 4ZDWA 3VTKA 3TK1A 1G3UA 1OHHD 4P33A 621PA 1E1QD 3PV0A 1KDPA 3N2EA 3CCRB 4IDHA 3R8CA 2IX3A 5H1YA 2ODNA 4BFSA 1UMKA 2IC5A 5JFGA 1P2TA 2VP6A 1SVOA 2FWRA 2OFWA 2QP3A 4M2LA 1K5DA 3W2GA 2PMKA 3L0IB 4HDOB 3SYNA 721PA 1IN6A 1BYUA 3LXXA 3X2SA 5JS7A 4AG6A 3IPXA 3K70D 3BFKA 1WDTA 1YRAA 3OJXA 1VG8A 2G6BA 3OESA 5DNYB 1M7BA 5K8IA 3C41J 3TLXA 1N6LA 4HAWA 1CNFA 2OCAA 2YOFA 3OIVA 4V0ME 3W34A 2GVDC 4HYYA 5G41A 1XCMA 2ZYVX 2QQEA 2WJJA 4YAWA 4EUNA 1G4UR 3SHFA 4BLOA 1KY3A 3M6AA 4JVNA 2ZVQX 3K09A 3TSZA 1AKYA 3DMDA 2Q9AA 1B0UA 4HLDA 3UMRA 1NSFA 4HEJA 4LJAA 1XPUA 4YHBA 3U3JA 2BMJA 2C2HA 4BECA 1CQXA 1X8LA 4JLAA 3U7GA 2REXB 4WZ6A 1QRAA 3I56B 2O8FA 5FOUA 1DTSA 1ZD8A 3RRYA 1VQNB 1B23P 2Q6TA 2ZSDA 3KQUA 1ESMA 3QG5A 5IHPA 3W9YA 4DSNA 3KTAB 2QTFA 3FFAA 3MWLA 4GP7A 1IOZA 1VQ5B 4IKEA 3HDTA 1KK2A 3PENA 2CVHA 2HXSA 3LX5A 1KO7A 1S2MA 2PJZA 1CXZA 4YDSA 4PC3A 1HA3A 1I2DA 2J46A 3I8SA 5FOXA 3ZIAA 4DXAA 1U9IC 2QRNA 4M8NE 2QUZA 3TR0A 4HE6A 4KYIB 1FTNA 1HTWA 5DH9A 5JSZB 1N5IA 1OLOA 2GHIA 1RYFA 2ORVA 4AYTA 2GDJA 1JB9A 2RCNA 2AKAB 3S1AB 1E2DA 4DDVA 2ZJ2A 5J4VA 3Q3JB 5EXPA 1GVNB 1Z0AA 4MA4A 4YLGA 4KYUA 2W0SA 4QOSA 3SFZA 4EQ6B 4GFDA 2ZRLA 4C0SA 2VIIA 4B34A 4URXR 1N0VC 3KKOA 3K9HA 1SGWA 2QTZA 4NYIQ 1J99A 3LV8A 2QGNA 3ZC3A 3HR8A 3K0AB 2GZDA 3NIBA 1G3RA 2ZRKA 2HV8A 4TSFA 1JAHA 1G20E 3HP1A 4LJ6A 2R6FA 1KZGB 4A92A 2RH5A 1W36D 2MMGA 3TQCA 1DARA 4EAQA 2EU8A 3B2EA 3VNVA 3T12A 4LHWA 3SDZA 4M1MA 4KBGA 1GWNA 3V76A 4AF6A 4OK3A 4ACAA 5FBLB 3SYLA 1L4UA 3UXMA 3HPRA 1QGAA 1N6PA 1W5SA 4IDQA 2X2FA 3IQWA 3VKHA 3NH9A 4JL5A 2JLYA 1QGYA 1KD1D 2BMDA 1TQ2A 5FUXA 2ZYWX 4B3XA 2DFKB 1VHTA 2FDCA 1KI2A 1QH0A 3F0TA 3JZMA 4URUR 2H57A 2HYIC 1XMVA 4MKFA 1CR2A 3E1SA 3OZXA 4D4JA 3KKMA 1LV7A 3B7GA 2V7QD 1NN0A 4O25A 3VHXA 1NDHA 2ZRMA 2N1BA 3PQCA 4JLKA 5HZHA 2GQFA 2H17A 1ZU4A 1MOZA 2WWYA 4F92B 2Q21A 1VQLB 2EFHB 2CL6X 3CCJB 1NI3A 4NCNA 4I4LA 3A37A 4Q4JA 1SXJD 5G3ZA 1KI3A 2Z4SA 4M4SA 2HXYA 3L0PA 3W8RA 4BFUA 5B57C 1V5WA 1GR1A 3OEEA 3TSWA 3C8UA 4XVRA 3LBIA 3H0KA 2F9LA 5IK2A 2CK3D 2A2ZA 1W2BB 1Q82D 4I1SA 5G40A 1LF5A 2ZETA 4CEIA 2IS6A 4ZIRB 4Z1MD 1NG9A 5EMNA 1F2TA 4FD2A 1QHNA 1VCIA 1ODFA 2IEZA 1G6OA 1W35A 1E4VA 2A5JA 3LDAA 3P4XA 5P21A 5IRCD 2J7KA 1UKVY 2RC5A 2ODWA 2QNRA 2G77B 2FFHA 2WWXA 3ND9A 2P0EA 2OUKA 5H5JA 2OTLB 1RRCA 5AUOB 4LYFA 1AIPA 1KI6A 2DYKA 1Z83A 3VHLB 2QT0A 5FUYA 3WRXC 3T06B 4BPBA 2BVNA 4QHSA 3B6EA 1E96A 5BXQC 4JBXA 4D81A 1VYUA 3BFXA 2HF8A 3BRWD 3TMKA 2B8WA 1OYWA 5H8WA 4A2PA 3A4LA 3F8TA 4K81B 1II8A 5CB6A 4DDUA 5FL7A 3QE2A 3JZAA 4OQXA 2F9MA 2KE5A 2ZTSA 4D4MA 4EPXA 3JQQA 1U8ZA 4LJ4A 2CJWB 1KDTA 3VO2A 1KKMA 2OFXA 2W2XA 4IDNA 4I1UA 4ABYA 5FR2A 4BFZA 4L8GA 3K9LA 2NG1A 4FCTA 4IHQA 2GF9A 4MYUA 1EX6A 2GCPA 4PQYA 3BH0A 4HUQA 3THOA 5B58C 5EE5B 1EFHA 3W2EA 2ZR9A 2WWFA 4QG7A 3TVDA 2PLRA 1G5TA 4Q01A 2N42A 1YKSA 2VEDA 1GM5A 2WSSD 3AQ4A 3CMAB 4TN1A 2SHKA 2GAOA 3NH6A 4K8OA 5DO9A 2V4ZA 1NVVQ 1YHQB 1J90A 3IO5A 4PPNA 2P5TB 3G4SB 1L2TA 2BEKA 3U2QA 1E99A 3WXMA 3WNBA 1CRQA 3VR1A 2BBOA 1S1CA 2UZIR 5FL3A 2YWHA 2WJYA 2V6IA 5AUQA 3WY9A 2AXPA 2CHGA 2GJSA 2V54A 2FOLA 2IS1A 4JKIA 1UAAA 3CUEF 4YQFA 2GA8A 1WA5A 4P4SA 1MO4A 1ZNZA 1KI4A 3CBQA 4TLEA 3ADCA 2O8EA 2A5YB 2YOHA 2ZPTX 4JZKA 2WKQA 1DAIA 2AK2A 2BIFA 3AP3A 2ERXA 2ZJYA 2ORWA 1Q57A 4C3ZA 1IXSB 1IJFA 3K0FB 2R6HA 5DISB 1S9HA 3RS0A 3GFTA 4A6XA 1WCV1 2FSHA 2W58A 4KFSA 1GAWA 5C2JB 1IB0A 2JIZD 2ZJ8A 5AJXA 5LBIA 5HZKA 4D26A 4ACBA 2H1LA 4JL8A 2I3BA 4KVGA 2VZLA 5HE8A 1JPJA 3QPUA 1NMZA 2VF8A 4JKYA 2FPMA 3IKJA 2V55B 1I4DD 4PC2A 4JLMA 4JSYA 2ZRCA 3LY5A 2VNKA 3CCQB 1Z22A 2VYQA 3HWSA 2A3RA 4GI7A 3T1OA 2GVZC 1UBCA 2UZ3A 8OHMA 3ZD6A 4A36A 1F2UA 2YOGA 1W7AA 3CB4A 2BKUA 3CF2A 1HE8B 2O8DA 2BJVA 2ASEA 1P6XA 3PUVA 3BFVA 1JR3A 1R0WA 5JCZA 3P4YA 1J70A 5LD2C 1GFIA 1W0KA 2FSGA 2ZU6A 4Q1AA 4NH0A 4OQNA 1ZP6A 1M2OB 2WJHA 4DUGD 1KHTA 2D7CA 2J41A 4Z51A 5L3QB 1R5OA 3NBYC 2OHFA 1VQ7B 1JI0A 2J0UB 1Z6XA 3DO6A 3QF4A 3WYFA 4EPYA 5K8LA 1E3MA 5FOSA 1G5PA 1QDEA 3IDQA 2OSBA 2IW3A 1QFJA 3N70A 4DCVA 1AN0A 1VECA 2IXFA 1CNEA 4DLVA 1G18A 1HT1E 1NLFA 3EZ9A 1KMHB 3ONWA 3RS4A 2ZJ5A 4C9BA 3ND8A 2GZHA 4DLRA 2VP9A 4QNRA 3KL4A 4P4TA 3VAAA 3IHLA 2W6IA 2XSZD 3ZVMA 2GJ8A 2OILA 1Z06A 3GJ0A 4LC1A 4B33A 4DSOA 1AQUA 1SXJE 4KU4A 1N6IA 2P2LA 3PJRA 3NBXX 4HDQB 4RD4A 4D82A 5JWRA 5DLQC 3RRNA 1HV8A 5G53C 3AH8A 5KDLA 4HE5A 2HLDA 1OIXA 2NO0A 4LGMA 4PSKA 2C98A 1Z0KA 3JQRA 1VQ6B 4DRZA 1W4AA 3MWJA 4KXFB 1QG4A 5HTKA 4MRNA 5FBVB 2DETA 1G1MA 1Z2CA 2QMOA 2J7PD 4Q7LA 1FNCA 1AMOA 1MR3F 4G1BA 3UMSA 3QFTA 4KITB 1CJTC 1A7JA 3AF4A 3MUFA 3THWA 3KX2A 3SU8A 3HJNA 4MGKR 5C18A 4F93B 1E2QA 1ZAKA 3QEJA 4G5OA 2GEUA 2AWOA 1U0LA 3GLGB 1Q1ZA 1LS6A 3BH7A 1TU4A 1M6NA 2KJQA 4OHVA 1EESA 1XMIA 1ZUHA 1XPOA 3Q72A 5CDFA 1JECA 4JYBA 3LH5A 4Q66C 5KNDA 1YI2B 2VLIA 1QBKC 4QL3A 2JGNA 4F38A 1QFYA 2Q3FA 3CRZA 1FX0B 1NJFA 1ZIPA 2Y8EA 4JLPA 1IN7A 1U0HC 4LK2A 3LW8A 3X1ZA 2JJ2D 4TMVA 1S4QA 4NHOA 1DG1G 1FTSA 2P3SA 4KAXA 4LHVA 4OI4A 3K70C 1X1SA 2WAYA 1T5LA 4X8LA 5FPHA 2X3UA 4DVGA 1SHKA 5TV2A 4AD8A 2C99A 5JHHB 3LWNA 5GVRA 5C4GB 5CLQA 2D06A 3AF3A 1QX4A 1IY0A 5FL7D 3B1ZA 3KUDA 2PBRA 1SVIA 3ASZA 3NG1A 4Y0VA 1VHLA 3K0EA 4W9MC 1CP2A 2CLCX 3DOFA 4DEXA 2VSFA 1ZD1A 2BV3A 2BCJQ 1E9DA 4DCTA 2YYZA 3EZ2A 4QC2A 2J0UA 1E9RA 2WJIA 4ON9A 1AGRA 4C0KA 1N2CE 2Z0MA 4Q21A 2KBEA 4Y0AA 1D2MA 2ERYA 1JA1A 3WBJA 2MSDB 3I92A 1W1WA 2RGNA 2OM2A 1UADA 3FYHA 3EA0A 4KSBA 3CX7A 5FTMA 1U9IA 3HU1A 4FIDA 2IUTA 3TH5A 4CDGA 3W5IA 3UATA 2PCLA 2XTMA 1QGZA 4JLBA 4AIIA 1R10A 2ATVA 1JXMA 4TTQA 3HR7A 1DS6A 2BM0A 4BFXA 3PCRB 4UNSA 1CR1A 2OFOA 1MABA 4YXWA 2RGEA 4G1UC 2OG2A 3CRRA 5AJYA 1ZM3A 1Z8FA 1CJVC 4TLCA 2IS2A 2ZR0A 4EPTA 3AF1A 4RKFA 1KAGA 2XEXA 2GEDA 5KNBA 3GEEA 3RDPA 3TJZA 3AKYA 3DVLA 5AWFC 4UXIA 4BRWA 3PEWA 4GDFA 2XOKD 4M1OA 4V02A 4JL6A 5C4MA 4G1VA 4E07A 4YAUA 1H65A 2FGKA 2G0TA 3R7WA 5FOWA 3P1JA 2KI5A 1XJ0A 2QU8A 4BLRA 4HAYA 1O3YA 3A1VA 5CM9C 5HE9A 1CBUA 3I5XA 4PXAA 1JAIA 1NN3A 1YZNA 3GEHA 4Z54A 4URZR 1C1YA 3AUXA 1N5LA 1G8FA 3Q5DA 3G6EB 2BPOA 1ZCBA 3UG6A 4DC9A 1GO2A 2IF2A 3HU3A 4U00A 1ZYUA 3A1WA 3VU9B 1GKIA 1R0ZA 3O8CA 3IEVA 5KPJA 3FMOB 5BYJA 2JIZA 4OQMA 1E9EA 1LTQA 1N6OA 1PLLA 2ZI3A 5CLLA 5KDDA 1KGDA 3M1IA 4G5QA 1UFQA 3QENA 3ZVNA 2ZRGA 3KKPA 2Q3MA 2BCGY 5IF9A 2C8VA 3IHWA 1VG9B 2AD5A 2YINC 4QJ3A 4B3BA 2ZRIA 2BBSA 1T6NA 3CONA 1AZSC 3MWKA 4QHTA 3FKQA 4EH1A 2LKCA 2CNWD 2PZGA 3KTAA 3AVQA 1W4RA 1GUAA 4XWAA 4PZLA 2QDXA 2O8EB 3BAFA 2VNHA 1N6NA 1KAOA 1F5NA 4QHYA 2W0MA 3OF5A 4PC7A 4GMDA 2A5DA 1NBMA 3ZDQA 4QM6A 1RVDA 1KO8A 1ZBDA 3P27A 4P32A 1BMFA 4HAZA 5DSZA 4XVQA 1Y3AA 4YMSA 1YR8A 4EPVA 3DZ8A 5JMTA 1PJRA 4QFMA 4LV5B 3OZVA 3GJ4A 3AF2A 1SM4A 1PZNA 5FTKA 3CCLB 4MH0R 2FPLA 3MJRA 1M74A 3NC0C 2OK8A 4C7OB 3ZZTA 1KI6B 2WWGA 4UJ5A 1P60A 3W6NA 1W36B 1WF3A 5JJKA 2Q9CA 1VG1A 5FPKA 3L43A 2BN4A 1Z47A 2GK7A 3RHFA 4LI0A 4TMKA 4A2WA 2P6NA 4NCKA 4RD1A 2BOVA 3B9QA 3NEYA 2BHRA 2XSZA 4Q1DA 2XNJA 1EWRA 5TARA 1F2UB 2GILA 3IBYA 3IIMA 1P3JA 1W5TA 2KB0A 4HAUA 1CTQA 4PHGA 5DYGA 2O8DB 1GILA 1E2MA 1G6HA 4V0MA 4A8JC 5K8UA 1U98A 2ATXA 4WZBE 2R62A 3CRW1 4FMDF 3PXGA 5FH9A 2AD1A 3FB4A 2FZ4A 1CJUC 2A9KA 1JNYA 3WMEA 4RZXA 4P4UA 1JXOA 1DDGA 2OK7A 1JJ2B 1TQ4A 2ONJA 2O0KA 1GNRA 3KQNA 3QXHA 2ODEA 4PPGA 3DHWC 1E2PA 1E63A 4TL7A 4WQMA 3RABA 1E1QA 4W5JA 5KO2A 2RGCA 1DAFA 1T91A 2GRJA 3PIRA 5LB4A 3CCSB 1VYTA 4UNRA 2LWIA 2D3WA 4BLPA 4N0EA 1XP8A 2BEJA 3RRMA 1RE0A 4Q1CA 2QBYB 1EFRA 3GJ5A 3LX8A 2X1VA 1UBGA 3GLIE 3REFA 3I55B 3GLFA 5JEDA 4YMVA 1TQ6A 5JCPA 5M04A 4N0DA 1G7CA 1M8PA 3UG7A 1JQLB 2FU5C 3WNCA 1VPLA 1R0XA 2FN4A 3PEVA 3K0SA 1QFZA 3CF6R 2QA5A 4C0JA 4Q5IA 4BLQA 2X8AA 3BK7A 2VHCA 2Z83A 1W2HA 4KCGA 4EPRA 4B35A 1OYYA 2ZSFA 2EVWX 3LXRA 3MFYA 4AYWA 3LA6A 4PZZA 1AQYA 3T34A 1YHNA 2D7DA 2JDIA 3ECCA 2XTZA 2XNDD 1R8QA 4DCSA 1AS0A 2Q9BA 3U3MA 4BZXA 3T1QA 2BGJA 3AM1A 2ZQ5A 4J0QA 4XJXA 1RJ9B 1Z0JA 3NEJA 4JVMA 3EA5A 3B13B 5H70A 3PUXA 5KHOC 2X77A 1Z3IX 2RGXA 2VP4A 5CIQA 3IEUA 1XMSA 2DCUA 3A4NA 4BFTA 2ZUCA 2FG5A 1GAQA 1SVSA 4L4UA 4PAQA 1J7KA 2GCOA 1P9NA 1Z28A 2FA9A 4PQFA 4RFSA 4PZYA 5GV8A 2QPAA 3RLFA 1E2HA 1RPZA 1Q20A 1NP6A 4HZIA 5A0FA 1TX4B 4NKRA 3UIEA 4B75A 5CITA 4JT2A 4IVQA 3CCEB 2BMFA 3EAQA 2O0HA 4GBMA 1Q3TA 3OEHA 1NVVR 1JQJC 1G8YA 3PVSA 4BLTA 1OE0A 4KJZA 2QSYA 2ZJZA 1EP3B 4LJYA 4LPKA 1Y63A 4Q7JB 4CEJA 4JJKA 4O0MA 4TYPA 4NCJA 2ZITA 2DWPA 2YJTD 4FMDB 3VR2A 1I7PA 2GF0A 2CHQA 4RVCA 2ORIA 4EFLA 1LF0A 1R0YA 4P3YA 1FP7A 1K5GA 2WJVA 2PX0A 3R9IA 5L3SA 4FMBB 3O8RA 2F6RA 2MSEB 2C03A 2HJVA 4V0OA 1P2UA 1VCOA 3W2IA 1X86B 2AX4A 4RCYA 3LVBA 2ZREA 4TSFD 1KSGA 2REBA 1AKEA 2DWOA 2VSXA 2O52A 1HQCA 4DQKA 3LRPA 4L9WA 5JRZA 3CO5A 4OHXA 4JIMA 2FE4A 4FCVA 4LV8B 2V9PA 1E0SA 2WPDA 3LBHA 3GQBA 1A82A 2V1XA 4MDFA 3FHTA 5B30A 4OK6A 3RRZA 1P75A 3MD0A 4NYMQ 1ZCAA 2OLJA 1IAQA 4QJ4A 1J2JA 1H8ED 4AY2A 4Q4HB 2O8BB 1KJYA 2GEVA 5SZJA 4NCIA 1Z08A 2V8OA 2HMAA 1IY1A 1KO4A 5FUWA 1OFUX 2QBYA 4O3MA 5FI0B 3FVQA 1OKKA 3KUCA 1PUIA 1BOFA 2KBFA 1T9HA 2V7QA 4XD7D 3TVTA 2HEIA 3I1FA 1XDBA 2NPFA 3HYTA 5JI3E 3B1VA 1M1KD 3CX8A 3TQFA 4TL8A 4A1FA 2OBLA 2YZ2A 1PVOA 1OB5A 1E2JA 2WWWA 4M1KA 2F43B 2WWHA 6Q21A 3EPJA 2PZFA 3B5JA 3W6PA 4TYWA 4GOKA 3X1YA 2XB2A 3PITA 4A0GA 2CNWA 4KV9A 3S1AA 1W44A 4TL9A 2GWHA 1P7CA 1Q21A 1RFLA 2EW1A 4II7A 1US8A 1SXJA 2A5GA 2QEQA 1A4RA 4GOJA 2TMKA 3NWJA 2EWWA 3JVVA 3RS3A 3QSYA 1N0WA 5TXGA 4G0NA 4XSGA 1NBMD 1RJ9A 1UBFA 5EXSA 4I99A 4BPRA 3I73A 4K1XA 2C9YA 3QFRA 1L8QA 1QZXA 2A7QA 1E9BA 2HT6A 1KTVA 1XEXA 4OQLA 1DE0A 4LPSA 2F1IA 3KQHA 3VU9A 3U60B 1HE1C 1R5NA 4FN5A 3LQRA 1KSFX 1L7VC 4JLJA 1SKYE 4GRAA 4Q9HA 2O8CB 2XX3A 2FH5B 5GVSA 3A1UA 3ADKA 2QN6A 1OFIA 2OEPA 4UXJA 4QBIA 1E1RD 4LUCA 5FTLA 3L8ZA 1S96A 3C14C 1OGIA 1DG3A 1TUIA 4HLQB 3Q5EA 2ZJAA 3VKGA 2J45A 2ZI5A 1ZNYA 1GJRA 1BS1A 1S9DA 3K9GA 4NTZA 2ZYUX 5GADl 2UKDA 4M9XA 2CE2X 2ZIAA 1DOAA 2FFBA 3VX4A 4JJZA 3AVTA 4ZKEA 4B32A 2G3YA 1E9AA 3QF4B 1LW7A 1TF5A 4M9ZA 5CDFE 3QBVA 2PEZA 1DAMA 2NQ2C 2VO1A 3LW7A 2F1HA 4EFMA 1IJEA 3JVUA 4L5BA 4ASUD 4M0LA 5L3RA 5D3MB 1FNBA 1QVRA 2QE7A 4PHTA 1T0HB 1ZW6A 1I4TD 1S8FA 1KC8D 1U8AA 2ZROA 4KBFA 4D0NA 3U61B 4MYTA 2DR3A 2RGNC 1IHUA 3LO8A 5TY0A 2HCJB 4R7ZA 3U7EB 3QNUA 3IPYA 5DI9A 4DLTA 3V9PA 4OK5A 4OI1A 4TYNA 1FNMA 1YITB 4WZAE 5AJVB 4LBWA 4QGGA 4OJQA 2QP4A 3MWYW 2CDNA 1CRPA 3E1YE 3RWOA 4HI0E 1E2NA 2GAAA 4Y7CA 2F1RA 3KKQA 4LV6A 1ETUA 4ZI2A 4RZ2A 2QAGC 4A0RA 3IQXA 3UK6A 1IXZA 4W5WA 1Z6AA 4I1OA 4PC6A 1FQJA 3ZVLA 2WM9B 4B2PA 4HB2A 5FI1B 3CD6B 4Q9LA 3WP0A 4CW7A 1OGJA 4AYXA 1EWQA 1NVXQ 3WMGA 5DI3A 2GPJA 2IUSA 3NVAA 1JJ7A 1KSJA 1NL3A 1ZD9A 3M0EA 3OIYA 4JMPA 2JCSA 1J8YF 1G4AE 4LBVA 5JRJA 2XXAA 1UKZA 1E79A 1ZM9A 1YR9A 4QBHA 2ZS9A 4X8MA 1ZM2A 2G83A 4PQRA 2ZSEA 1KDOA 2O5VA 4K46A 2YV5A 1Z6TA 3PFIA 2WAXA 3CZQA 1RKBA 2C96A 2ZSBA 4HB0A 5BWMA 5F9FA 1KK0A 2QG6A 3AF0A 1NKSA 4JYCA 3TE6A 4A0FA 1E9FA 2CCJA 2FPKA 1D9ZA 1YR6A 2XAUA 1GL7A 4MRPA 4AKIA 1M1YE 2OXRA 4TQ9A 1E69A 4HB3A 3W6OA 5EP1A 2ZI4A 3OFNA 2VNJA 4Q19A 3U4QA 2EYUA 3HPQA 2AL7A 3VR6A 1OH5A 1JR3E 4N3NA 3W5UA 4OHWA 5E7MA 1G8GA 5DHFA 5EUMA 2VA8A 1H42A 1D8TA 1VIAA 2YHSA 5CYPA 4H1UA 4H9GA 1NRJB 2JASA 2BSAA 3OE7A 3TAHA 5KSOA 1KSHA 3X1DA 1X8JA 4W7SA 4KFUA 2CCKA 3BGWA 2D2FA 3ZS8A 1JR3D 3ZQJA 3JQPA 5LDDC 4B3FX 1XXHA 5F2EA 5FPYA 1WRBA 1QHXA 4IEIA 1K73D 2VP5A 1BX1A 3PUYA 4BWYA 4XTRA 1XD9A 3EG5A 3VKWA 2V1UA 4LCBA 1JEDA 2GK6A 1I4LD 2DFLA 3RS5A 2PJRA 4RFSB 3Q9LA 4ZGQB 1GTVA 3SJAA 2BGIA 4DIEA 3AVOA 3QKUA 1E94E 1UF9A 3BB4A 3CPHA 1PUJA 3SJZA 3A58B 3B1YA 3A4MA 3QXSA 1P4SA 1PLKA 1YZTA 2R6CA 2CLDX 3CXCB 2L0XA 2R6DA 3NDPA 3OIWA 4DWJA 5KPDA 1Z0DA 1GRRA 3E70C 4IOKA 1NMXA 4O2LA 4KLNA 2WTUA 4BZPA 3RC8A 1NF3A 5JECA 2H92A 3CPEA 4I81A 2WV9A 1BYIA 2PIAA 1OKKD 4XIGS 3A6PC 1R2QA 5E4FA 5JLJA 2XITA 4M53A 3BOSA 2W6JD 4KODA 3DM9B 1L4YA 5E7IA 3ICQB 4MKGA 1G3QA 4HB4A 4DBLC 2C78A 3BB3A 2DY1A 3OEED 2JJ1D 2JLSA 3U7FB 3VQTA 1P72A 4RSGA 1T8UA 4XOIA 4A8JA 3QPWA 3H84A 4IVPA 1K6MA 2NPIA 4QBFA 3OZUA 2Z43A 5FBQB 1T3HA 1SVWA 2RGBA 1E62A 4I1VA 4QXAA 3RYTC 3BORA 1MT0A 2OXCA 1COWA 3W5VA 3L82B 2J7PA 3K1JA 2VQSA 1EK0A 2XZOA 1G5RA 1GZSA 2XNSA 4G5RA 2C77A 4IW3B 2R8RA 5SZHB 3VR5A 2ECKA 5FFMA 4OHZA 1RYHA 3GFOA 3QOFA 4US1R 3QBTA 2DB3A 1E98A 3QQ5A 1FQKA 2VHUA 2J3EA 4DLXA 5D3QA 2DERA 1VQPB 3TBKA 1XZQA 2J87A 4CVNA 4E09A 1M7HA 5IK2D 1Q22A 3CCUB 1G19A 1ZNWA 2E9SA 3BIFA 1TF2A 2GJ9A 1XPRA 2ZVPX 4B74A 4PFSA 2XJ4A 2DHRA 1KMQA 2IHYA 1OXUA 1KO5A 3EIEA 3EARA 5K8TA 1TL7C 3EIQA 1G17A 2FFAA 2ZE5A 1QHHB 3FE2A 4RCZA 4TYQA 1TTTA 4C2UA 1F2TB 4ZGNB 3DOEA 4BRUA 2O8FB 1U81A 1YU9A 1TPZA 1A1VA 3TAUA 4Q9IA 3VMFA 1GITA 1T3LA 2HJGA 2WSSA 4NPHA 3ZQ6A 1GKUB 1P2VA 3I72A 3QKRA 5CK5A 2IYSA 3GLFE 4PAOA 3GLIA 3SC3A 3EC2A 4UXHA 2ZJBA 4Q7MB 5EZ6B 1E6CA 3RS2A 2D62A 3I32A 3VR4A 3C15C 3UMFA 1E9CA 2FFQA 2QQ0A 2A5FA 1Z6GA 1E2EA 2KWIA 2DFTA 2YWEA 5TDHA 1G64A 3KFVA 1P5ZB 1N6RA 4UNNA 3PG5A 5A5GA 1BJKA 2WMNB 4A82A 1GKYA 1KO1A 2IF0A 3EIHA 4AG5A 2ZXUA 3C5CA 2AK3A 3MMPA 3UWOA 1YJWB 2EYQA 3AUYA 3AGPA 4S35A 4ZV4A 3F5FA 3SJCA 1NLYA 2LP6A 4AURA 5EQTA 2CCGA 2OE2A 1UJ2A 5EXTA 2B6HA 3GJ8A 4DT1A 3SS8A 1G7SA 1SKQA 4Q1BA 1OXSC 2BC9A 4Q9KA 4UQOA 4YMTA 1EG7A 1XE1A 4YMWA 2F3TA 2IYRA 1E79D 2AHOA 2CLSA 2GXQA 3L2OB 2X2EA 3SFVA 3DKVA 2OESA 4NE2A 1U2RA 2NO9A 3BWDD 2FV8A 3LLMA 2OCBA 1KKLA 4IDPA 2GCNA 1D2NA 1OH7A 1B2RA 1T5IA 1WBBA 4QNMA 2ZJOA 3FMIA 521PA 1FMLA 4FI3C 4LBZA 3SHWA 1N3BA 4E22A 2IYQA 4MYHA 4PGOA 2WJGA 2WMOB 1WMSA 2VL7A 2ZRAA 3G82C 1W34A 2YVUA 3ZJYA 2B92A 4NL4H 2BDTA 2ZI6A 1FUKA 3PR1A 5TMPA 1E64A 1S72B 1DAHA 3CIOA 3CH4B 4AKEA 3W90A 3CX6A 4V03A 1CLUA 2NMVA 2GCOB 3ZVRA 1SQ5A 1IQPA 3AVPA 1QVFB 3OE7D 1VCMA 1S3GA 1LB1B 1YJ5A 2VH5R 1QHHA 3B9PA 1DAGA 2IYZA 4YMUA 1J8MF 3OAAD 2QMUA 3EW9A 4B6EA 2FSIA 5KDOA 3GLGE 4B44A 1ZM4A 1TF7A 2G1JA 5FTNA 2C5LA 4XTCS 1QG2A 2ZE7A 4LJ8A 4AKHA 3IGFA 2DWQA 1US8B 1KY2A 4NYJR 2E1RA 1FPMA 1GDDA 5KTYA 1VMAA 3PUZA 2YWGA 5GJVC 3FHCB 1NY6A 2WIAA 1KDRA 1NVWQ 4AKGA 3THYB 2WHXA 1N0UA 2QTHA 1MO5A 3KKNA 1U94A 3CR7A 4R2HA 4IFBA 4RY2A 5JS8A 3ZS9A 1W0KD 4PAMA 1SULA 1GL6A 1YRBA 3WHLA 1D6JA 3EZ6A 4A15A 4JBWA 4DUGA 4OQFA 2QAGB 4OI0A 2OCPA 1CEEA 2CMKA 4FXPA 2W6JA 4LHZA 4C0QC 1KK1A 1DO2A 1Z6YA 2PH1A 4CEHA 2AXNA 2IA5A 2REOA 1UKEA 2OCYC 4TQAA 4D80A 2I1VB 4UJ3A 1KJZA 2ZAOA 4B2LA 1ZUNB 3NKVA 1QHSA 4FMCF 4IOLA 2H8KA 3K8YA 4DSTA 3IUYA 3CKLA 3LD9A 1GNQA 4YALA 1W0JD 2ZRJA 1QHYA 4Q1FA 2EQBA 3O8BA 1T8TA 2W2VA 1DADA 1VKJA 1KMHA 2VHTA 2GXUA 1K9MD 2VTKA 3VFDA 5KU1A 1TEVA 4JVSB 2I1QA 4D0LB 2EFCB 4Q4AA 2CXXA 1F48A 3QKSB 1R5BA 2F1JA 1COWD 1RZ3A 1TQDA 4N1AA 1KYIA 3SYKA 4DLSA 3QIAA 3H1TA 1LS1A 5JHGB 3B8HA 1E2GA 3NDBB 1KK3A 1OW3B 4TLAA 4TMTA 4KFRA 3NXSA 2D4HA 2WSMA 1TEXA 2EWVA 1EP1B 1Z63A 4BFVA 2GTPA 2WKPA 4C0HA 2JLQA 3L8YA 1OHHA 5EXXA 2NZ8A 4DLUA 4X8OA 5BN4A 4US2R 5LPNA 1AS3A 2BMWA 4NZYA 2PT7A 4P0TA 4B76A 3T1TA 3A8TA 2R65A 4BQSA 4KFTA 2EFGA 3U3RA 3G0HA 4PSVA 4TWZA 3CC7B 2IYLD 4KI0A 1UPTA 4TT3A 4A8JB 5HPYB 4F4CA 4DJTA 2ZAMA 3QVVA 4TTPA 1G7RA 5EP4A 5BN5A 4QM7A 3UPUA 3D8BA 1XB2A 4MDEA 1NN1A 4B3DA 4Z8YA 3D3QA 3O8DA 3P32A 5JSZA 3TUZC 1Z07A 1W2GA 4B3CA 2UVQA 3ZIAD 2GJKA 3AB3A 2D2EA 2QRZA 4D25A 3SN6A 4Q48A 1NIPA 1SVMA 2HF9A 3PEYA 3DL0A 2C04A 3MLEA 3R7WB 5GJWC 4NONA 1D2EA 4YDHB 4PR0A 4PO9A 3AVUA 4RD6A 4IDOA 3CNLA 4RKEA 4Q02A 4DB4A 3EX7C 2VPPA 3FGNA 3KJGA 4R98A 3CF0A 4CT4B 4AF7A 4QJ5A 5DIFA 3NHBA 4PO8A 1DEKA 1G7TA 1P9WA 1ONBA 2BKEA 3G71B 2B8TA 3AVVA 1J9ZA 1R4AA 2IK8A 2QY9A 2WOJA 3H86A 3I3SR 3QY0A 4FMCB 1T0JB 1QHGA 3TUIC 1QUFA 3TKLA 1N6KA 3T1VA 3GLFB 5C46F 1MV5A 1QF9A 3CCMB 2AFIE 2IYTA 1N6HA 1FUUA 3OIUA 3Q7PA 3AKDA 1YZKA 1G41A 1R7RA 3GLHB 4TTRA 1OXTA 3SQWA 3W5HA 1U8YA 4RJLA 1IY2A 1GSIA 1W49A 2WWIA 5L3QA 3CCVB 1GIAA 4BZQA 4LJ7A 4TZ6A 2VNIA 3KB1A 4NU0A 1OB2A 4WBSA 2J0VA 3QUSA 3KZ1E 3GLIB 2JLWA 1XTQA 4BE7B 1BO6A 1I2MA 1TVCA 2GXSA 3KJHA 1EWYA 1TLLA 1RIFA 4YONB 1VCNA 1NNEA 4RD3A 2ZI7A 2Q3HA 2R6AA 3KDSE 1AK2A 2ZRBA 2BF4A 3B82A 3FPKA 4OL0A 4D2IA 1N5JA 1SZPA 3H4MA 1ESNA 2J59A 4NDZA 3QVUA 1A8PA 4AI6A 1ANKA 4NP6A 4DB2A 2B5OA 3I4LA 4WXPA 3C5HA 4BUJA 1VG0B 3QG1A 1ZMXA 2WVJA 1NBME 1RW4A 1HURA 1IONA 1HT2E 1G291 1EP2B 3FMPB 4Q00A 1ZIOA 4URYR 3U7HB 2YC4C 1M34E 2E87A 2IYXA 2Q0HA 3CLVA 4F4JA 3GD7A 2VRWA 3RANA 4WVFA 1XD2A 2P65A 4ZO4A 2A30A 4Q47A 4OI2A 4CF7A 1ELOA 4B47A 1RC8A 1JR6A 2CK3A 1FZQA 4E03A 2IL1A 2ZRHA 2HYDA 2CE7A 1XJQA 1F6BA 3U6KA 1CF4A 1GAJA 3TIFA 1QUEA 1KOFA 4DSUA 3AVWA 2P6RA 1VQ8B 1OSNA 2VBCA 2CRVA 4DIDA 1IXRC 3IO3A 3W8NA 4EKDA 1GVHA 3FPAA 1TADA 1XMJA 3CM0A 1F3OA 1NJID 1HUQA 4MUAA 1QG0A 1QHIA 1AA9A 3C4JA 3FHOA 3VO1A 1RRFA 4PHHA 421PA 5FR1A 2EFDB 2WIBA 3QKTA 1UDXA 4AC9A 2JEOA 5F98A 2OAQ1 2QMHA 4M9QA 2XJ9A 3W3ZB 3CRMA 3LVRE 2ZEJA 1XFAA 4NYIR 5DN6D 3EPLA 2JLVA 1E2KA 2AWNA 1ZUIA 3OW2B 3FWYA 1JJVA 2MMCA 1XEWX 4LZZA 3BH6A 2NTYC 2QORA 2LCFA 4LY6A 3SQXA 4HDCA 2QSZA 1Q7YD 3A36A 4JVLA 1FRNA 1Z29A 4JS0A 1W47A 2R44A 2WBLC 3KJEA 4G5GA 4UNQA 2QTLA 3B1XA 3MG9A 1CJKC 1OH6A 3CMEB 3NBFA 3LVQE 4FK8A 1F20A 5AJWA 3GMTA 3DPUA 3NHAA 1SKYB 3E5HA 5AJZA 1WQ1R 5JBQA 3NC1C 3THXB 2QT1A 3Q8XB 1XJCA 2OAP1 3GCGA 5TB5A 3LO5A 4Y9UA 4EIWA 1OIVA 2R9VA 3K09C 1JBKA 1P9RA 1MRSA 3D6TB 3EWAA 4B2IA 4PTLA 4ZKDA 4D6PA 4ZIRA 4TMWA 5HCNA 3X1XA 3T5GA 4M1YA 5FOVA 5IT5A 3FJOA 5KNCA 3U6BA 1N5KA 1YR7A 1JA0A 2QAGA 1MH1A 1Q86D 2EFEB 4P4SB 1D5CA 2ZE8A 1KIMA 3BD9A 3DZDA 1YVDA 1KNXA 1F60A 2ZE6A 4HZUA 2QTVB 1O87A 3REGA 1EFRD 3KXIA 4NYMR 1MO6A 4TT3D 5FTJA 2ZUDA 5EE1A 3ZGXA 4DCUA 5KYKA 3W3AA 3FDIA 1P61B 1AGPA 2CEAA 5L3SB 2OBNA 3L0SA 4Q4AB 2J9RA 3MHPA 4FW9A 4UAJA 5KSYA 3I8XA 4E5UA 4MKIA 2HUPA 5HKKA 1DDIA 5KSPA 1UKYA 2NOAA 2CJWA 1CS4C 4TLDA 3FOZA 4IVRA 4R71A 3QXJA 3MCAA 2OTJB 1CIPA 1II0A 1Z0FA 2IT1A 3EZFA 3KQLA 1G21E 3J81k 4U9UA 2JDID 2RGAA 2H7VA 4IEEA 1KI8A 4NYJQ 3LBNA 4WAUA 4Z8XA 3A1SA 1WE2A 4ZPXA 4YC7A 2JATA 4GOXA 4XVUA 5BYKA 4RD0A 3IIJA 1C9KA 1Z5ZA 4URWR 5EJEA 4LRWA 3Q7QA 3I61A 3KJIA 3OFND 1MRNA 1JPNA 2WKRA 1G8PA 1IN8A 1SVKA 3MGCA 3QF7A 1IBRA 2BWJA 3W2FA 1XF9A 4ZI3A 1UBEA 1XWIA 2N46A 1M90D 2ZUBA 4DLYA 3E20A 4C4PA 1YIJB 1U0JA 3QPVA 4HUTA 3ZZUA 3QKRB 1KJWA 2F43A 2XZPA 5EE0A 3R9WA 4LWZA 1LNZA 3TRFA 4JLNA 3WMFA 1S3SA 3AVYA 1W46A 4US0R 1MABB 3DEFA 4LHXA 1IN4A 3K0CC 4L16A 4X8HA 1H8EA 3BE4A 3EPKA 1EFCA 5CJPA 1SQRA 1A5TA 2QAJA 2GESA 4MGZR 4A6PA 4BASA 3RVBA 4CT5A 2GZAA 1KRHA 1Q3HA 2GKSA 3K0FA 4HLCA 1DBSA 1KNQA 2FF7A 5SZIA 4FINA 3E2IA 2D74A 4BGDA 2PT5A 4RZ3A 1QVAA 2ZI9A 2IYWA 1EFTA 4R2IA 4HLUA 1C4OA 2QZ4A 5IDVA 2VSOA 2LKDA 4LYAA 1Z2AA 4IOJA 1E0KA 5KOYA 3THYA 3ICEA 3RNLA 3ADBA 3PUWA 3Q85A 1FNDA 3CC4B 1YE8A 3KB2A 4OBEA 1RRGA 5JI2E 4PPQA 2NZJA 3SR0A 2O8CA 5DYIA 4DLWA 5F9HA 4NCHA 4CYMA 1T4GA 3WYGA 2RGDA 1SHZA 4MYCA 1D1NA 3BXZA 3CPJB 2DFNA 2NO7A 4HLUC 4P31A 2FGJA 4O2RA 2QEXB 5E3HA 5A4JA 3U4QB 4F7WA 4LBYA 5J4KA 3GLHE 5JJLA 4BEBA 2O0JA 2P6UA 1K8RA 4TMZA 5CB8A 1W36C 5GJBA 4B43A 2F7SA 4MQBA 4XD7A 2IWHA 2W6ID 1BIFA 2KSQA 4XWOA 5FBRB 3QFSA 4DDTA 3U5ZB 2V3CC 1CKEA 4BFYA 4YAFA 1G8HA 1NN5A 2OV2A 4S2EA 5HXBA 1E2IA 2OLKA 3SEAA 5FPTA 1KQSB 3RAPR 2XZLA 4QBGB 5EE3A 1N8RD 4MRSA 1XXHB 2ODBA 2ZM5A 1FW6A 2HLDD 4B3GA 4D4KA 4Q1EA 5L3VA 1W4BA 1DPFA 4M1SA 4Q4LA 4GMXA 3N5CA 1OV4A 4QGFA 1Q44A 3ETLA 1S1MA 5FOTA 4Z1MA 4CRWB 4UKDA 3P26A 1OF1A 2I4IA 1JEEA 1XRJA 3FFBA 4C7OA 4B4DA 3BERA 2ANBA 4DKXA 3AVXA 3CH5A 3M4YA 1G9XA 1VTKA 3EWSA 4JT4A 1LY1A 2JLXA 1DO0A 5GJCA 3CNOA 3QEOA 2FX3A 2H5EA 2NIPA 1DAKA 1X6VA 3H2YA 3T5DA 3DM5A 3TGPA 2EIXA 3T61A 2NGRA 1S0UA 1XTRA 1XNJA 1N25A 4LSGA 2ANCA 3PEUA 2WICA 4IFEA 1UEIA 2QE7D 2J1LA 4KSCA 3GJXC 4IXMA 3AGQA 3MJHA 2IHBA 1E1RA 2QL6A 2IS4A 2FMXA 4LOAA 4U5XA 4DDWA 3AEZA 1CR4A 1H85A 1D9XA 4IXNA 4MRVA 5DI3B 1IM2A 4Y9RA 5EP3A 5B2ZA 3SI7A 3O47A 3HU2A 1X8KA 5HCIA 3VR3A 4CGZA 4FWIB 3WNDA 3RSLA 4C43A 2XXAB 2JJ2A 1BKDR 4WOPA 1EFUA 4C0LA 5FPSA 3EXAA 4EFNA 5BQ5A 1OXVA 4A0HA 2AR7A 2NO1A 1W4CA 3OHMA 3ZBUA 1DELA 2AFHE 5DE3A 5CJ2A 4EJSA 5J47A 5SZKB 1GRNA 5CYOA 2VHJA 1TAGA 4N3GA 4XWKA 2CVFA 4ASUA 5GV7A 4DQLA 3CPWB 3WRYC 4BLSA 5HKKD 4A4DA 4GNKA 3MSXA 3ZYCA 821PA 4M9SA 5D3MA 3TSOA 4GSYA 2JJ8A 4DZZA 5BW8A 4CIDA 1FDRA 1KI7A 3QXCA 4H1VA 3GJ7A 5AUPB 3P20A 1VQ4B 1P73A 1CULC 3QI2A 4Q18A 1BH2A 2VHQA 3B85A 4POAA 1LFDB 1OFHA 2B7CA 1FRQA 3FKSD 4M1TA 2Z6VA 1HEIA 1II9A 3UKDA 2B7BA 5J4HA 4IRUB 1KI1A 1OIWA 3LQQA 4ERNA 4YXWD 1G3IA 1ZM7A 4DHEA 4ZDIA 5LD2B 4CZ2A 1HYQA 4JLDA 5H59A 2W00A 5AR1A 4Q4HA 2IEYA 4R9UC 3WP1B 2R2AA 2ZANA 1KI9A 3TUJC 2ZU0C 4XH9B 4G5SA 1Q1QA 4UNPA 2C9OA 2AN9A 5H68A 4A9AA 3K70B 2VF7A 3MRSA 1ZJ6A 2ZRNA 4ZDJA 4DEYA 2BJWA 1E0JA 3NBZC 3ADDA 2RHMA 5G3YA 2PCJA 1IN5A 3WYAA 4EQ6A 3TW8B 1M7GA 4NMMA 3AP1A 4GPTA 2Z5FA 1K8AD 4CEJB 4L9SA 4JBYA 4CEIB 4A2QA 2J0QA 1YZQA 221PA 4B73A 4PO1A 2QPTA 4DLZA 4F7DA 2GETA 5JWOA 2BMEA 3D31A 4HAVA 1GL9B 1A2KC 3EZ7A 3SBEA 2W2TA 4Q9JA 2YKGA 1EGAA 3CRVA 2PLFA 2A78A 1AZTA 4PANA 3UANA 1NLZA 2IXGA 1YZLA 2CL0X 2JLRA 4V0NA 3TW4A 2GJAA 1CU1A 3OZWA 2QA4B 3KXKA 1H8HA 2JA1A 3QE0A 4G01B 1XBTA 4WA7A 3GLGA 2XTNA 5FBWB 2CL7X 5CK4A 1NG1A 3LAWA 3SBDA 1NY5A 4GP6A 1VQKB 1HQYE 5TR9A 2QENA 5L8VA 1OJLA 1YJ9B 4F4IA 2HT1A 2QPOA 1VQOB 3HYRA 2OBMA 5EE9A 2RB4A 1FFHA 4LJ5A 2QMEA 2OT3B 4URVR 1U99A 3IBGA 3GLHA 3GPLA 2CHVA 2BM1A 4XSHA 1G16A 1GNPA 2BBWA 1MKYA 5KSZA 1P62B 4TYYA 5J5CA 1EX7A 3WBKA 1FNNA 3I62A 1KZ7B 1XTJA 4Q4JB 3RS7A 3W2HA 4B6FA 4ZCIA 5DHAA 5EUQB 1ZU5A 4M1WA 1XCGB 1NMYA 5AK0A 4B48A 5EP2A 5BN3A 1NVUQ 1XTKA 4MGYR 1YZUA 3GJ3A 5KUTA 121PA 4ZDKA 4ILEA 5ELXA 4OYHA 2ZS7A 3TR5A 2G0NA 4P6VF 3AKCA 2ZRFA 2JLUA 5TVKA 3TNFA 3GP8A 4D4LA 3W5JA 2VYFA 4IJMA 2FJUA 2G9NA 2BBTA 3DMNA 2P67A 2QROA 3B1WA 4BFWA 1R6BX 2IUUA 1BX0A 2HDNB 3R9XA 1Q81D 1XD8A 3THXA 2JJ1A 2YC2C 1RRPA 3CNNA 4HATA 1E4YA 1DAEA 2GNOA 3GEIA 2K5UA 3BBPA 2JLZA 2FEMA 2PX3A 1PLJA 2PL3A 3CZPA 3LFUA 4ESHA 4ESVA 5EZ5A 1XD2B 1Q1EA 4EDHA 1EXMA 3EASA 1MO3A 1P2SA 3SJBA 1ZC4A 5F3WB 2XNDA 3BB1A 2RMKA 2DBYA 1XU4A 3MAAC 3AP2A 2RC6A 1WXQA 2FNAA 1GOTA 1UDWA 3C16C 3DDCA 3F3YA 5J4LA 5JWHA 2FZLA 3LLUA 2QP9X 2ZYTX 4WW0A 1TUEA 4LJ9A 2PEYA 1HH4A 1U90A 2ZS8A 3BS4A 4PC1A 1E9SA 1SXJC 1E2LA 2PZEA 4PSAA 3R8FA 3SZRA 1W48A 1II8B 1OFTA 4C0BA 4WIAA 3QFCA 2ZSAA 4DCNA 3V4FA 1Z0IA 3DKPA 1YZGA 2RHDA 2IXEA 3GFPA 3KFXA 1X3SA 4M22A 1E32A 1T3SA 1V43A 1R8SA 1OPXA 2WOOA 4RD2A 4TMXA 1VYVA 4IOMA 3C7KA 3ES9A 2XNCA 2ONKA 1GRQA 2FEOA 2YWFA 5THXA 1UM8A 3CRQA 3L0OA 4GZLA 3CWQA 5AN9A 3VNUA 3QJYA 1AS2A 3ZH9B 2JAQA 2ZRDA 3GJ6A 2C9CA 3QKSA 2IWRA 3U3OA 5HR5A 3AKEA 3ASYA 4ZCLA 3AV0B 1DVRA 5FUVA 4F91B 5JZVA 1XX6A 4QGHA 1TU3A 2IBMA 4ARZA 2W83A 1FL9A 4HSEA 4PHFA 3U44A 2WZQA 2YNMA 2F3RA 2HCBA 1G3MA 1X1RA 3IIKA 1WP9A 4RZUA 1ZVQA 4LX0A 2XGJA 3N2IA 5FA6A 3K9NA 4LDJA 4G3XA 3OEHD 1NKTA 2G1KA 5E95A 3K0CA 4GZMA 5DGXA 2VP2A 2CNDA 2WPDD 4MRRA 4AWXA 2O8BA 3I5YA 1UEJA 4LYJA 4LYHA 1E2FA 4TQUS 2H16A 4C30A 5KSWB 4C2TA 2OO7A 3FKSA 1JB1A 1XCPA 4U02A 2AKYA 5CM8B 3WHKA 4MKHA 1YQTA 1QVGB 2XOKA 4GL2A 4EJSB 1PV4A 1CR0A 2NO6A 1TMKA 3CR8A 5CIWA 4PPFA 4HZUB 4C0AC 3OJWA 4Q7KA 3RWMB 1XTIA 2DEUA 4W5HA 2RKOA 2Z4RA 3QXXA 2GBLC 3G5UA 4WXRA 4DT1B 4EPWA 4EJSC 3RSOA 1GG2A 3FMFA 1XEWY 4GT1A 3UWKA 1NJGA 5JJIA 4FCWA 4QKQA 3T15A 3KXLA 4ITRC 4LHYA 4D0GA 1NSTA 1TNDA 1A2BA 3BC1A 4FWTA 1XTSA 3NTUA 5C1BA 2V6JA 4NBSA 4AK9A 4CEHB 3D7MA 2GXAA 2H18A 4MITA 3A1TA 1OT3A 4KO8A 4KVAA 4OJKA 4B71A 2FSFA 3ZBTA 2VP0A 2C95A 2CBZA
chains in the Genus database with same CATH superfamily
4QO8A 4GXTA 2IZZA 1ZFNA 1OX5A 4IAOA 4QUBA 2GCEA 3VR0A 3IMGA 3PWZA 4WCFC 1R66A 1SGNE 1H1BA 5CPFA 1F0TA 1FOEB 1I2AA 3F6YA 1PR5A 5K8VA 4FXGH 1TIOA 5EWJA 3D6FA 2XI4A 2ZJ6A 1SVNA 2PMFA 3LNCA 1Y8QA 4N82A 4KN5A 4LC0A 1OH8A 3NONA 3FTNA 3SJ7A 4MW6A 1EIZA 3CJRA 3BSYA 1CJMA 4IBOA 3CLKA 3WAKA 5AI0A 1E1QD 3WQBA 4IDFA 3CCRB 4B87A 1HDOA 5KNCD 1UMKA 4UVDA 4OFBA 2VP6A 3NBMA 1RTKA 2QZ9A 2JJYA 4PQEA 3MXTA 4MLCA 4QTZA 3NNDA 2PKQP 4LK4A 3T3MB 4IO0A 2I1LA 1U8XX 2B83A 4MYSA 2GUWA 4UM9D 3DE4X 3UAIC 4BRZA 2VPTA 2REXB 2H4WA 3C6BA 5FOUA 2WTMA 1WSDA 2ZSUA 5DTJA 2HA5A 3GZTB 5IYRA 4LFCB 4RKRA 4LOHA 3SIPA 5C5CA 4LRSB 4BTVA 1JQBA 4QQKA 3I8SA 1MB4A 2ORVA 2H2HA 4E2ZA 1NFRA 1C1VH 3O7MA 2H2DA 1TNLA 3KT0A 2W70A 2HNKA 2J4IA 3K9HA 3FO8D 4PPYA 1JRTA 2STBE 3N7DA 3HB9A 5DW3A 3TXYA 1ABBA 2BTCE 2HV9A 3SYLA 1LHCH 3IVGA 1G0NA 3WL7A 2BMDA 3F3KA 1SPXA 5D8DA 4ZKNU 1KI2A 1UFVA 3F0TA 1EUCA 3ZXIA 3JZMA 5D86A 1QTNA 3ITNA 5C31A 1I36A 3M1YA 3K6RA 1VQLB 3CCJB 1NI3A 4NCNA 4TXJA 1KF0A 2QJWA 2JGFA 3R0IA 1SXJD 3CSSA 4WLVA 2BFMA 4UM7A 3W4IA 1D6WA 5L6LB 5IK2A 1J20A 2XLBA 3FX2A 1Z4KA 2CK3D 3T3NA 4QT4A 4I1SA 4ZIRB 1NZDA 3VDNB 4ISNA 2QG4A 4LISA 2ODWA 5B2EA 2P0EA 2C8XB 2QVXX 4V2UA 5CVCA 1K3TA 2DBVO 5ELMA 2XC4A 1Y33E 1SCIA 4H2DA 3GZNA 3TF5A 3A4LA 2H59A 1II8A 2DAPA 3A84A 4HX9A 4LX8A 5BRRE 4NU6A 1K7XB 1ODLA 3NOXA 4Q01A 1G5TA 4CLRA 4YUAA 3PNPA 1P0SH 2PGNA 3VAZA 4B17A 4X85A 1Y8QB 4JUIA 4O29A 2VJ1A 4ZTZB 3KCGH 1BHXF 3KN2A 3W8EA 4CFZA 1AKMA 2XBXA 1B43A 4OO3A 3WL4A 3C24A 4Z3KA 2BHGA 2IS1A 5GXPA 2G00A 4KUHA 1YONA 3JQBA 3ADCA 4JZKA 2WKQA 3T28A 3AUUA 5LC1A 4OXNA 3BMNA 2UXCB 2RK6A 3T5MA 5LCXA 4P0QB 2R6HA 2QRPA 2P9EA 5JVDA 2IPXA 5JCJD 2XBUA 2A8YA 2ZT6A 1WM1A 4PC2A 3GWZA 1DXPA 1Z22A 2WQ7A 2WA1A 2UZ3A 4ZT6A 3U5TA 4XARA 1P6XA 1JR3A 2FSGA 2PRYA 4BUCA 3ZWXA 2VBVA 4REOA 1QPGA 3SI3H 4DANA 3D0RA 4OEHA 3QTBA 1P5FA 1E3MA 4ETMA 1NOIA 2OSBA 1SOVA 3TNDA 1W10U 3COVA 3HA5A 2AMJA 4P4TA 2CGEA 4ZZ2A 3IVAA 2J3MA 5EKDA 1CWUA 5BSMA 4KWCA 1BDMA 1N6IA 2OKGA 4MUYA 5DLQC 5CHBA 4Z0NA 4BS9A 2BGMA 2J9GA 1T26A 3EEBA 1P10A 3QVGA 5EQFA 1V2OT 3CLSD 2WV7A 4AFNA 1NTPA 3BH7A 4ZTUB 1Z71A 2I78A 1XPOA 4OM7A 1YVRA 3R5FA 3K35A 1RTFB 2I7VA 4LDPA 1UC4B 4EB6A 3R5JA 3OFJA 3CRZA 1ILWA 1UTKA 3T0GA 2P3SA 1X1SA 3O9ZA 1DQRA 2C99A 1YMUA 1YF3A 4XUDA 4M83A 3QU4A 3CLUC 1ZD1A 4AN1A 2Y80A 1XAIA 1ECBA 2NVBA 1UCYE 1GL0E 1P2GA 2RGNA 4FIDA 4OP1A 4AIIA 3OHPA 4OSOA 4JLBA 1GVKB 1DS6A 1JIRA 2P93A 2YXBA 5L51A 4F46A 4G1UC 2CJFA 3JWPA 4HDRA 2Z7FE 6YASA 5T5QA 3LUJA 4MS3B 2LPMA 4CLEA 4QUJA 3GFFA 3VV3A 3TB4A 3R7WA 1F51E 5HE9A 4J07A 3UZUA 2FPOA 3R0FA 1LI5A 1AU8A 4L6IA 3TXXA 1C1OA 2HC9A 4OGKA 5EIXA 2YQZA 1N6OA 5E1DA 2ZRGA 4R2MA 3IHWA 4ZXPA 3V8EA 5ADHA 1V6AA 2BBSA 4QHTA 2R6R1 4YBZA 5AHXA 3DJFA 1V2KT 1B3BA 3WDKA 5DNVA 2WV5A 1ZH6A 3Q3HA 1LLCA 1GQFA 2ECPA 2PA0A 1Q6YA 4Z4ZA 4QFMA 4LXBH 4J1YA 3NC0C 3H5VA 3W6NA 3BQMB 5ETJA 1I5RA 2F8MA 4RD1A 3VYUB 4UU1A 3OQJA 1T8WA 4A8JC 4E5PA 4UDWH 3G8AA 1RYYA 1PWEA 3J7AC 3CU5A 2FZ4A 4YP5A 2QN1A 3WMEA 3CH6A 1CV2A 3PP8A 2OK7A 3HRKA 1O2HA 3DHWC 3DA9B 4JYZA 2RGCA 1UPAA 1OFGA 2YCBA 4CMKA 1E92A 1T10A 3AHGA 3SXJA 3DE6X 4Z3DA 3BG5A 1UZNA 1QCYA 1FN8A 1RAEA 2FU5C 3KPYA 5JS6A 5DP7A 3MCZA 1XDDA 3OX2A 3I9V6 1QH9A 4LXYA 3AIOA 4KCGA 2FS8A 2ROQA 3H83A 1IZ0A 4AY6A 2X8JB 1CZNA 3PUXA 1ESZA 5JTUA 5CIQA 2XCUA 2VWGA 5HWSA 2JD1A 3FWZA 5GV8A 5KYVA 5FV7A 1BHQ1 1N2ZA 1BA2A 1G98A 2GTBA 2FI4E 5CDGA 1EEHA 5KOHB 2RHRA 1MW8X 3EXHA 3ODDA 2ZITA 2NUTB 2IHVA 4N5LA 4DZRA 2ORIA 4OBXA 1XTPA 1O3HA 4X1KA 3MOIA 2MSEB 3ZWNA 4RMGA 2FKAA 4RCYA 3HY6A 2JD0A 1AKEA 3FRHA 4H3HB 3DAPA 2AMFA 3DLHA 1FLNA 1Y3BE 3FHTA 4E1AA 1J2JA 5C8VA 4FILA 1ZL0A 1FUJA 5FUWA 3OM0A 1CUEA 4UREA 3R1IA 2DPLA 3AUAA 1C41A 4QOJA 3ZQKA 2NN3C 3CPXA 1PVOA 1OU4A 3PPVA 1WMAA 4Z0PA 3VU1A 2PZFA 4TZKA 1SRQA 5TRDA 5DBHX 3RSFA 1US8A 1E5QA 5E2BA 3MB8A 1UBFA 4K9PA 5KC9A 2O1EA 2QS9A 1D0VA 3MMSA 4RORA 2O8CB 1DTWA 3WGYA 3SAJA 2VWOA 5CCDA 1BS1A 5EEGA 1DWPA 4YCLA 1LW7A 4NX2A 1BG6A 4KQEA 2RFLA 5EJ4A 4M0LA 3ESRA 3ASQA 1XDGA 3G7UA 3ZVAA 1P39A 2DR3A 2XODA 5ALEA 1CDDA 1AB9C 1CUSA 2I62A 4YRAA 2VJMA 3CMCO 1YITB 4TM7A 3I9MA 2N1MA 5JATA 3KF2A 1ETUA 4L78A 5KHAA 2F9PA 1FP4B 1UTOA 3KLPX 4B2PA 1FBTA 1QZ8A 5FI1B 4AYXA 3PS9A 5HIYA 2GPJA 2IUSA 3QWIA 3L8DA 2OFFA 2FF5A 3PFIA 4Z4CA 3UJPA 4JYCA 3WV5A 1GI4A 3SVTA 1UD5A 1NFXA 4QEZA 2NT3A 2XF2A 2ILVA 3H8SA 3T7SA 2P78A 5EUMA 2BLVA 1PTJA 4IRXA 1V25A 4I9NA 2D2FA 4AY4A 1PS8A 3MAJA 3FWPA 2GK6A 2JZNA 3CKYA 4X7RA 1HNXB 4B2CA 3AVOA 1AKTA 4IG4A 1YRWA 5KX5B 4DNOA 3BMXA 3JALA 3UY4A 4CMAA 2LD4A 1Y48E 4FB5A 5DYNA 1NLUA 4RM0A 3O0TA 3M3SA 2SCUA 1USWA 1TYZA 4MYRA 1MT0A 4YMHA 2ZYRA 3DDHA 1ENPA 3L82B 5A4IS 5DJ7A 3IEXA 3E1XB 3I30X 1VRVA 4EHJA 4MV9A 2XVMA 5E0JA 3W04A 1KEVA 4H35A 2BD5A 5H4GA 1FONA 2BE7A 4BVBA 3LRTA 4F49A 1PR1A 3CP7A 4NESA 3QBDA 2GFHA 1L6IA 2OTVA 2R00C 4O4IF 3E58A 4GVUA 4Y2UA 5HJ2A 4ZVLA 1CQIB 2CNNA 3DL2A 4LJKA 1A8IA 4BNHA 1E2EA 4NLLA 4NA8A 1YY3A 4L02A 1ZJKA 4LNUB 4YMLA 4ZV4A 4AMUA 4Q3BA 1PYDA 3GRRA 1KAEA 2QIOA 1DUIA 1O2KA 4GC9A 5HS6A 1JLLA 2F3CE 4POOA 4BAOB 1C2MA 1NFWA 4ZZ3A 3Q3GE 4MMZB 3FSRA 3L8GA 4XLLA 1RWNA 4PYLA 2WJGA 2G8NA 1WMSA 2VL7A 5ECWA 4F3CA 1NXVA 3DTVD 2BDTA 3D3EA 3N8IA 3P2KA 3B9PA 4YMUA 3EW9A 2C5LA 4QYTA 2H29A 5AH0A 1YLOA 1ZSNA 3RUDA 2YWGA 2BONA 4UUPA 1C0EA 2EDCA 5AVVA 2FETA 4UHDA 4RY2A 3UJDA 2DOGA 1G38A 3FSGD 4PAMA 2JHAA 3EZ6A 5EJ2A 1RXVA 4BTTB 4PE5B 3CS3A 4JOQA 3SJUA 5LR6A 2PH1A 3KAJA 2CJYA 3VU0A 3I6IA 4KELA 1A8UA 3I9OA 1Z15A 4OS7A 3JU3A 2JFHA 1VKJA 5FA5A 3R6WA 2AG5A 2OHOA 4MB0A 4RS4A 3V2IA 4D99A 2I76A 3DPIA 4JU9A 2RIPA 1SUEA 1M76A 2R3SA 1SC6A 4B3MB 1KVSA 4X1PU 3RBZA 3B3FA 4DLUA 4DM7A 1AS3A 1PZGA 3PQ5A 3VNSA 2DBQA 1I80A 5KJFA 1PNOA 1HXFH 1A9QA 3QVVA 1JSRA 2J3IA 3DMGA 4FYJA 1TMYA 5K03A 4P5EA 1EBBA 3FUVA 2P9HA 1ZH2A 3WIVA 4AF7A 2IU6A 3PLPA 3OHMA 3G71B 3D64A 1X2EA 3GLFB 1QGUA 4UONA 2VF5X 4HLNA 3MI4A 3BEOA 3PA8A 1J1IA 5BSVA 3BTHE 1UP4A 3T3OA 1GIAA 1TK3A 3GJRA 4EG1A 1EZUC 2JLWA 1V2NT 1TA4A 2WILA 2ZI7A 2XRZA 4FOTA 2JL1A 4FFWA 3B82A 4BP9A 2J59A 1HZJA 1UQTA 3QVSA 3R3WA 1JZSA 1ADBA 5EC8A 5DGCA 7REQB 3RGWS 4G4SP 4OH1A 3N0TA 4I9UA 3PDIB 3EUFA 4ZO4A 2A30A 4OI2A 4Q12A 2H9IA 1O5OA 1OSNA 2PX8A 4W1SA 4H4FA 4GUXA 4UZSA 4PIVA 1A5IA 2EFDB 2H5LA 1UK4A 1O96A 3KFLA 2FOBA 1Y6QA 1W1UA 1U0EA 1L7BA 3SV2H 4LY6A 3TINA 3RBXA 4E32A 4AUEA 4DLKA 1UDCA 2QXUA 1JWBB 3CRNA 1U8UA 3B23B 4TMYA 1A5GH 2DF8A 4ABHA 3WIEA 3SJOA 4OX9Y 1D2HA 2B1GA 4D6PA 3PPYA 4L5YA 3JYLA 4O3UA 3DUFB 3PHCA 4U6NA 4P4SB 3AERA 3ZWCA 3DZDA 2TYSB 3VTZA 1U4OA 2X9QA 4LDNA 2GREA 1FRFS 3GY7A 1AGPA 1BUIA 1R6VA 4GM4A 5HKKA 2YS6A 5J2TF 1DBPA 3GA0A 4KGVA 3W8DA 1WP4A 4QPZA 4IWNA 4MPVA 4GPEA 2ZWPA 1MRNA 1G8PA 2NNWB 5G4BA 1X7XA 3KQYA 3MT9A 1V2HE 3CT4A 1D5WA 1RHKA 1C7ZA 3V80A 1YIJB 4JBHA 1UANA 1CZHA 2PUQH 5T57A 3K0CC 4L16A 2OD7A 3U31A 3RVBA 3C6XA 2A86A 2QIQA 4XBCA 4FOSA 2QZ4A 3HA7A 3Q85A 2QWXA 1AHIA 4IKOA 5ALLA 3TG2A 1X39A 3ZN2A 3WK8A 2NO7A 3M5PA 2FEQH 1K8RA 4JV5B 3EY9A 2IWHA 4MVJF 1E1YA 3JQEA 4C3OB 3VR5D 3PL1A 4ODIA 2I4IA 2P8OC 5IJ0A 2OSVA 3A1NA 3HQ4O 2BTQB 4YHHB 3PC2A 3LS2A 4BBAA 1E1RA 3GP3A 1W12U 4ZYTA 4QVIA 1JE0A 1LFAA 3SI7A 3PC4A 3ENNA 2IODA 1BB0B 3VUEA 4ZYUA 1FY2A 5BQ5A 1YXMA 1P12E 3PC3A 2C93B 4QPNA 2JLCA 3QHPA 5KOJA 3L7DA 3QTLA 5F4JA 2RKWA 1FE8A 4E14A 1Z5NA 1MCTA 3OZAA 3G2LA 3F0PA 2QN5T 1NTRA 1OFHA 4HJXA 1FSSA 1RM3A 3LGYA 3CG0A 3LJKA 1KI9A 1Q3KA 3TUJC 3FUWA 4TPYA 3FHLA 1K6JA 5H68A 4DEYA 2Z2KA 3NBZC 5CM2Z 3ADDA 2VINA 1IN5A 1T8PA 3KNZA 3E9CA 2YX1A 4ZYZA 1IXYA 3I04A 1X1DA 3KOMA 4BIIA 3AFIA 4CEJB 4P1VA 4CEIB 2JZOA 3OEYA 1AHHA 4PO1A 3D31A 2R96A 4R1TA 3HGPA 3V42A 1HSZA 2W2TA 2AQKA 1MTWA 4L0MA 1LPNA 4KRXA 1V1RB 5FYQA 2FR1A 1WZNA 2WG2A 3SX4A 2Z3VA 1XBTA 3HCDA 1EVKA 2CL7X 2ENUA 3AM5A 1XWFA 4AO7A 3K1YA 3V2UA 1NZFA 1F4PA 2P6MA 1BJRE 2AFVA 1MP0A 4BNFA 1Y9JA 4XSHA 4ABFA 3GDSA 4ALMA 5J5CA 4PBRA 4R1UA 4CT0A 5GOTA 3EDMA 1IYZA 2GNPA 4ILEA 2C3MA 4BMVA 2OBSA 1T2EA 3NHJA 1Y4AE 1SXQA 2E4WA 3E22A 2P67A 2KS6A 3B1WA 2HRQA 3ME5A 4O2BF 1SUAA 2BMAA 1AB9B 3LFUA 1ZICA 3OWOA 4ROSA 1XD2B 3AESB 4KPEC 2OK5A 3QPCA 3JR3A 4LRYA 4RK0A 3LNNA 1SCUA 1O3IA 1TUEA 4B2YA 2EBFX 2C4UA 1EOLA 8LDHA 3ZHBA 1OFTA 2RI0A 2XWBF 3AG5A 5EJ1A 2WOOA 2ZUVA 3IERA 3H8WA 3M6XA 2EI7A 3KL6A 1X80B 3P9RA 1Z5PA 2G4UA 1K9SA 1KTSB 3C1OA 3QY9A 4ZQBA 4U32A 2IPQX 1UD3A 2CDAA 1PJQA 4NCBA 2XGJA 1FUEA 2X5NA 5EOVA 4RVDA 4OQ4A 3K9CA 3UAXA 4P5PA 4QQFA 2B36A 1Z2OX 3TJNA 1S2LA 1E2FA 3TL2A 4DPMA 5I01A 1GBTA 4DV3B 1KJQA 1YQTA 3OICA 1RYMA 1O2DA 4K3UA 3OJWA 2DEUA 3AW9A 3I2JA 1VJRA 4RTKA 3FMFA 4L1KA 5JJIA 1CZUA 4CFYA 3ZHCA 4X7EA 4IPTA 1NMSA 3O8OA 5IS2A 3L7IA 4A23A 3E5MA 1V0EA 3E9EA 3HG7A 3WGTA 5EZYF 3A3KA 2P9ZA 2FPGB 4GYYA 4JEIA 4FSDA 4DJAA 4HQNA 2VUTA 1M6EX 2J5XA 3ANNA 4IDGA 4QRHA 1VQMB 1P19A 1AKRA 4RCVA 5AUNB 3EIUA 3MFQA 1E1CA 3AJ9A 1E1KA 2OHXA 2ZRPA 2VJIA 1WB9A 4HAXA 2ZEBA 2IYUA 3CW2A 3DW1X 4WV3A 2I7CA 3IV7A 3D62A 2GCTC 4ZDWA 4KFCA 3WRYA 1NXWA 2D1YA 5BR7A 4FVDA 4BFSA 3IPCA 3SYNA 4M2LA 1K5DA 1HL7A 5DNEA 2RA3A 4KTTE 5K8IA 4OHKA 3SF8B 3VZPA 4OPOA 2X0JA 5G41A 3C98A 3EIXA 1KY3A 1PBNA 3OETA 1QYCA 2C2HA 2JGMA 1F6DA 4JLAA 2O5EA 1POXA 4XN3A 2O8FA 3DR3A 4YH1A 4YLYA 2FUG6 4XDEA 3UUFA 1Y8AA 5C35A 1KFBB 3MH4A 4IKEA 4GECA 3HDTA 1S2MA 1CXZA 5FOXA 4LFAB 3WLMA 4F86A 2NU3E 4HE6A 4JMYA 3F5MA 5JSZB 3JQ9A 2AKAB 3JARA 1Z0AA 3QVJA 4EQ6B 3EB9A 1HXHA 4FB4A 3KKOA 5DOZA 4X20A 1ABIH 3HSYA 2GZDA 4GGPA 1G20E 3NPAA 3V1MA 5LVAA 1QSGA 1HQKA 4Q3CA 4A92A 3VM6A 2HKIA 3UMGA 1UQUA 4KBGA 4C5CA 2A58A 5EHGA 3C1KA 2OQVA 3TCXB 3VXEH 1YBAA 2E7ZA 4AQYB 1QRRA 4D4JA 3W1EA 5ARCA 4X1QU 3B7GA 4XUEA 1I94B 3B5EA 2VXCA 1Z17A 2HRDA 2VYND 4N4AA 1M9NA 1NULA 1QP0A 4EY7A 4KPUB 3S2FA 3BMQB 1PPFE 4M1EA 1Q82D 3L4EA 3ZGZA 4J7UA 1F2TA 2ZFQH 4NE9A 3QZRA 4EI7A 2C5AA 3WJ2A 2R7KA 2P4HX 2WM3A 5AUOB 4I0WB 4XM2A 4B6SA 4BPBA 1FSZA 1P1RA 1TYDE 3KTOA 2NWQA 3F8TA 2OO5A 3BSWA 2ZTSA 2H2AA 2PD3A 4PBTA 1KDTA 4HGNA 2NG1A 4LJSA 5IC6A 4M7WA 1DIBA 4QG7A 2PLRA 1DWQA 3HJUA 2Y05A 2XT6A 1UWLA 1K2VN 1H3EA 1V4VA 3CZ9A 3RRFA 4KW7A 2OQ2A 3OT1A 2D1QA 3VR4D 1S1CA 4BMZA 5BPHA 1SU8A 4OG2A 2MYNA 2AXPA 2JFWA 1UAAA 3PB1E 2G63A 1EQUA 1XKXA 3CBQA 2VOEA 2ZPTX 3NU1A 4OYRA 1G9TA 1Z5WA 3DQQA 1BVRA 1ZY2A 1IHDA 1WCV1 2AZXA 2J3QA 4JL8A 1BGWA 2I3BA 1JPJA 2A1UA 4RLFA 3VR6D 4FETA 4QG3A 1E3SA 3O3MB 4QPJC 4L85A 2OHJA 3JQCA 5E38A 1W7AA 1TC2A 3GAZA 4BGUA 1I51A 3G89A 1FTWA 3DWIA 3GZNB 1USVA 2ZIZA 1RYBA 3WJ1A 2G04A 2OHFA 2D4AA 5FPQA 1VKNA 4UC0A 3T9CA 3N70A 1FK8A 4PS0A 4BYGA 3HP4A 3L6BA 4IUCS 1WV0A 4YRGA 1P5RA 1Z06A 4E5SA 2C3YA 2P9JA 5CHEA 3I1YA 4AS2A 2A5AA 3WGUA 3CZ5A 4D82A 1K7FB 2QF4A 1ZEJA 1TZBA 2IHKA 3MWJA 1L5LA 1X94A 1HBTH 3NRLA 2FK7A 4OGGA 5DT2A 5C18A 4BKRA 2DTXA 4M76B 4Z4SA 4YV2A 2GEUA 3AL0C 3U9SA 4WOKA 1JEYA 1TU4A 1LK0A 4OHVA 4ZAGA 5CDFA 3STVA 4BTLA 3MBIA 2G70A 1W25A 1EB2A 4HH4A 5C7IO 4CRBA 2YJZA 4G0YA 2A2QH 1FTSA 5TEWA 2C00A 3OPQA 4DXHA 5ES3A 5GVRA 2Y68A 2QVGA 2WPLS 1F9AA 5HM2A 1SUCA 3PNSA 4YTAA 4U8GA 1RTLA 3OA0A 3PIDA 3V8VA 1L7QA 1XMXA 4FFBB 1REQA 1AQ7A 2ERYA 5EW2H 3MYRA 3FYHA 1FYEA 3DE7X 3HU1A 3GVPA 3TH5A 1RKVA 1Y9ZA 1Q11A 3TYXA 3TRJA 2O54A 3LQYA 2OHGA 2OQIA 2OG2A 1C4U2 5IABA 1CJVC 1YD7A 2P5YA 1ZTJA 3TJZA 3G2NA 2XOKD 4M1OA 1KQFA 3AHJA 4YAUA 3HABA 3PWCA 1APBA 4GW3A 3RYCB 1T8LA 6PFKA 1ZYUA 3VU9B 4INZA 2H52A 3S8MA 3BF7A 1LTQA 1KGDA 5IYZB 1CA0C 2W2MA 4HVCA 4C06A 1NURA 3D6MA 1HAYB 4EH1A 3SHVA 3ZVDA 5K2OA 2EARA 1GARA 2VJKA 5DSZA 5JMTA 2DLCX 1MQ8B 4CCSA 4MRAA 2QSUA 1QOZA 1EWVA 3AWIA 4FMPA 3RKSA 3VJMA 2VTEA 5K3CA 5AHWA 3R7BA 2HVXA 2J9XB 3B36A 1XHEA 1N2CB 1TVKB 2XNJA 3DFJA 3NETA 2YHAA 2FE1A 4WZBE 3MOSA 3PXGA 4XGRA 2FDRA 1MA0A 5U4XA 3TRDA 2R11A 4N5NA 1I6LA 1JJ2B 5GZ6A 5DG6A 3KQNA 2KCOA 1KQGA 4K6CA 4LY3A 2VDLB 1PSZA 3U3ZA 3ZX5A 4PR3A 1MQSA 1Y6ZA 3Q3AA 1UPBA 5BT8A 1DGQA 4A5TS 5JEDA 4N0DA 1B1AA 1M8PA 1V8PA 3WNCA 1R0XA 1EASA 1T2VA 2VVTA 3BXFA 2ZBPA 3WTCA 1BS9A 3JTMA 4I8GA 1NA5A 2QX8A 4H7FA 4L8YA 4CM1A 1AS0A 2PLAA 1JMOH 3NJ8A 1NF8A 4IKPA 3MRXA 5LBTA 4EGQA 2VP4A 2O5CA 1QVWA 1NP6A 5HKKD 1J5PA 4B80A 5M34A 3A14A 1MJGA 5IW8A 4YESB 2HLCA 1UVTH 2PX0A 4C6HA 4FMBB 1U5CA 4WVLA 3A6HA 1A5BB 4DWOA 3BGIA 2FE4A 4P7BA 4JT8A 2WTBA 2I3GA 1DHRA 2DU8A 4QJ4A 1IY1A 3KUCA 3E0XA 3ZWBA 5LIRA 3NHSA 3L06A 4A1FA 4M1KA 4WLUA 4TYWA 2W2OA 1K1OA 3HKBA 3TQQA 2HCTA 1DY9A 2XB2A 3I2FA 2VXYA 2GWHA 4MZDA 1MBZA 5CA0F 4K9DA 1S6FA 5TXGA 5AKHA 3I73A 2VDMB 2D1SA 4OQLA 2NU1E 1QYXA 5JMOA 3KYDB 4KPGA 1SZCA 2XMQA 4RS3A 4RQBA 3WGJA 2A9JA 1QVVA 5KZMB 2ZJAA 3H16A 1WPRA 3SE7A 2VQFB 3EFEA 2O8WA 1TX8A 2G3YA 5KWSA 5TQ0A 3PYXA 5CDFE 1EG2A 1V2LT 2VO1A 4QUHA 4M6WA 1VJSA 4L5BA 4YCSA 3Q6IA 2PN1A 3JYPA 2RBKA 1XVUA 3I04M 1S8FA 2O7VA 1V8ZA 4TVOA 1V9CA 3QH4A 1ECPA 1BSVA 4LBWA 4RZQA 2FX2A 3CW8X 5IP5A 1BEEA 3JU4A 5DTQA 4RZ2A 2H0QA 3WWCA 3KQQA 3ZZ1A 3UK2A 1BHSA 1DEHA 5EMMA 4PC6A 1O3NA 2YV1A 4R9SA 2MSKA 2C2KA 2E48A 5AXDA 3ZQ4A 2AN1A 2JCSA 4Y6PA 4BATA 1G4AE 3GRZA 4PQRA 4REQB 5GY7A 2P11A 5THKA 1NESE 2CCJA 2OXRA 4G25A 1N6XA 5B1YA 1RZRD 2VNJA 1OH5A 2RSLA 4C1NA 1TNKA 7YASA 1MB0A 1U3UA 4O2AA 3C5WP 3Q6MA 3BG4B 5TGZA 3OIDA 4M0PA 1JT2A 5D7NA 2FEWB 3RYFA 4IDDA 3BCRA 1JEDA 1I4LD 2ZOSA 3G9QA 1WOYA 3H75A 2CLDX 3OIWA 1MG0A 1Z0DA 1SU7A 1CUDA 5ECYA 1WXFA 2GX6A 1OUMA 2FSVA 2EKQA 1XQBA 2WD9A 5E4JA 2AA3A 5B6OA 2JLSA 3N1UA 3TLKA 1XRMA 3QWFA 3PFWO 1BVUA 3H84A 3JX9A 1W19A 2QTRA 1L7XA 2O06A 3W5VA 3INYA 2GD6A 2CXTA 2W3IA 4M0KA 1OBOA 5IYPA 5AD1A 1CUGA 1E60A 3RK1A 4LF7B 1ZOPA 2DHRA 3V33A 4B82A 4BNGA 2O8LA 4PVDA 3G5TA 4L5IA 2O8FB 3N8HA 3EVFA 4G0MA 4G36A 4D9HA 1GKUB 1WTHD 3FSEA 2VYVD 3OCCA 3RVQA 1B93A 4D5GA 4OFWA 2AXEA 4UNNA 5A5GA 2ZGVA 2B2XA 2A0KA 3RRBA 3V1TC 3EODA 1YJWB 3AUYA 3GCDA 1G9SA 4Z9FA 1I33A 4XDGA 3PWSA 3DSPA 4QDTA 3DEYX 2ZJFA 2R8XA 3BCUA 1O34A 1AKWA 2VJBA 2PUHA 4A16A 5LA6A 1LVUA 2NO9A 2OCBA 1CQJB 3WE7A 2QYOA 4LK3A 3GU3A 4M0DA 3JD2A 4ZRNA 3G82C 1Q14A 2YVUA 3ZWPA 1NNLA 4BQQA 2OZLB 1S72B 4ZO6A 3MJEA 3ZVRA 5A5DA 2Q6GA 1SUDA 3MHTA 1VI6A 4MA5A 2HREA 5FTNA 4MMYB 4DBZA 1SD5A 2E1RA 1FPMA 1RIWC 2WIAA 1VE5A 3DVAB 2XUIA 2FI3E 4HFPB 5C7LO 1QYIA 1JEYB 4RHFA 3HEMA 4FXPA 1KRWA 4ZCPA 1TGBA 4YCAA 3GOVB 3IDZA 5J5VA 4KGZA 1K1EA 3UF0A 1P29A 2M98A 4D9FA 2JHPA 1DIRA 3G5AA 3L1VA 4PRLA 4KREA 4DLSA 3QIAA 4R8LA 1YOVB 2V6MA 2Q28A 2BDYA 5HM6A 1X9HA 2PFEA 4HH1A 1GYPA 4NZYA 4U3JA 4LDZA 2QL9A 2GFQA 4M87A 1UPTA 1U9JA 3CLUD 5CVDA 4QM7A 1G3EA 3D8BA 2OV3A 3WOVA 1GNVA 4B3DA 4HAIA 5KNCH 4YY3B 2I2AA 3ZIAD 3U1JB 1XRRA 4RC9A 5A4FS 2O05A 1O94C 3LC3A 4BAUA 3BTME 3IXLA 1SUFA 4PO9A 1F8UA 1JI3A 3D3KA 3AEYA 1R4AA 2B8TA 3DFLA 1L5SA 3H86A 2P90A 3ZHUA 4QDJA 1SVUA 4ZT7A 2WKWA 1VGRA 4ZZ0A 1YDGA 5AM1A 1GN9A 1G41A 3GLHB 1YJQA 3DC7A 4U7TB 1ZLRA 1CIVA 4BX2A 3R6JA 4IGFA 3PUNA 1TLLA 1FDPA 4QXPA 5ALDA 3BPSA 1SZPA 3ATMA 4NARA 1JIUA 5JBTA 3BTTE 1FV9A 3P9KA 1M34E 1MH0A 2ATCA 1ELOA 2FPXA 1C9NA 1PE0A 2I3ZA 4S1PA 3CISA 3ZUGA 1ETTH 3ACDA 2CRVA 1JG1A 3ZHXA 2VCYA 3FPAA 2G06A 1NJID 1PJAA 4L74A 4J6EA 1AIXH 4NSVA 3U62A 2BQ6B 5JU6A 4Z4IA 3CRMA 1T2AA 4AECA 1Q1AA 1TJ5A 1NT4A 2P6PA 2DECA 4NWIA 1W9HA 2WYIA 1UMCB 3P0IA 2MMCA 1JEAA 4XKJA 3LGWA 4FP9A 1ZRNA 4O2BB 4XWYA 5DTRA 2TGPZ 2WBLC 3G2OA 1QQ5A 2FUCA 3RVJA 3CMEB 3AF5A 1QGED 3Q8XB 1XJCA 2HWKA 4DSAA 1KOLA 1VHEA 4Y9UA 5ITZA 3RXEA 1P9RA 3EWAA 3W79A 1V6CA 1REQB 3D4BA 3T5GA 1T6XA 2PV7A 1WSVA 3D4OA 2LXNA 4GE3A 1J5XA 4FONA 5HF6A 1KXZA 5F7OA 4KE9A 4U2DA 1F60A 4MPJA 4ABAA 2ZE6A 3REGA 4IRMA 5EE1A 3FSJX 1A7UA 5JZBA 4I4IA 1EI9A 3L0SA 3C85A 5IT0A 4MQLA 3I8XA 1HMYA 2HUPA 4MUJA 3P5BA 3HAGA 1RRVA 3UPTA 4P9NA 3LBYA 4OQEA 5T41A 4URWR 5ENDA 4LRWA 1XCLA 1IN8A 2BWJA 2Y1DA 3L0YA 5J43A 4D7AA 1WU8A 4UFDH 3HK3B 1GXSA 3QDZB 1DLEA 4LHXA 5C5DA 1QGDA 4IIGA 2BFWA 3O0DA 5BNFA 3EXEB 1R3DA 4HN2A 2J9FB 4FINA 1P18A 3DVQX 5HK9A 2ZI9A 4R2IA 3MJCA 5LLSA 2LKDA 1ZGVA 3L5KA 5KOYA 1KOGA 3RNLA 3ADBA 1PYOA 3NE5B 2Q2WA 1YS9A 2W93A 4RMNA 5DYIA 1T4GA 2DFNA 3FPFA 3ONFA 3U4QB 4HQFA 2OP1A 2O0JA 2F7SA 2JH6D 3EOAI 3L6UA 2B1JA 4PRKA 5L9AA 3SEAA 2DM6A 1T3TA 2XZLA 2J3HA 5EE3A 3WL8A 5KC8A 2VPIA 3TH4H 3H5NA 1QF7A 1E1CB 3ZWDA 1OF1A 4R31A 4DKXA 2LNDA 1M8GA 1MFPA 3CNOA 3QEOA 3KEWA 4KLAA 1MAXA 1RZVA 3C6KA 3NWEA 2ZC9H 1H85A 3AO0B 1DTWB 3MF4A 3WNDA 1COZA 2PT6A 1CRZA 5K6RA 1KP2A 3N2LA 1QB8A 4N3GA 4BLSA 1VR1H 1IULA 4GNKA 2M5TA 1ILEA 4HFRA 4GSYA 3U13A 2CN0H 2JFPA 1V1MA 4L7QA 3BGDA 2CWDA 2EHDA 1LNQA 3IQZA