4ACBA

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
469
structure length
448
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEITIDIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords TRANSLATION ELONGATION FACTOR SELB
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
total genus 97
structure length 448
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acbA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acbA01
1GO2A 3T15A 1XMJA 3TVTA 4BFXA 2ZRFA 1ZJ6A 3IUYA 4RD1A 3D8BA 4KVAA 3O8RA 3K0FA 5KPJA 1A5TA 3Q5EA 1G64A 2A3RA 1W87A 4X8HA 1TF2A 2QN6A 1Q86D 2ZVPX 3HDTA 5AUQA 3RANA 4U5XA 2VHTA 1E64A 2IYTA 1JR3A 1VG0B 2P65A 5FTJA 3N2IA 3BERA 1Z0AA 5FA6A 1HTWA 1S9HA 3K0FB 1U0LA 4G5GA 2E1RA 2GBLC 1B2RA 3KUCA 1EWRA 4A6XA 1Q3TA 1UF9A 4JKIA 3T1OA 4K1XA 3RLFA 4OHZA 2IWRA 1EFTA 1US8A 2IXGA 1RKBA 2Z4RA 2HF9A 4B32A 5C4GB 2YZ2A 1E6CA 1R5OA 2ZI7A 3AP2A 4EPVA 3DPUA 4PFSA 1NVWQ 2C2HA 1GNRA 4E22A 1XD2A 1AQUA 4MRVA 3W6OA 4A2PA 4IVRA 1CXZA 3L2OB 1XXHE 2G83A 4ACBA 4DJTA 2OTLB 3GCGA 1Z0DA 3KB1A 1XNJA 2BKEA 3AVQA 3VR5A 2ZRDA 2C5LA 5J4HA 1IN4A 1U8YA 1XEWX 1GFIA 3QXCA 2C96A 1NBME 3B13B 1OB2A 1XD2B 4LHXA 1Z3IX 2DFNA 4LV5B 2IX3A 2R44A 3FFBA 4IEEA 3PEWA 5K8UA 3I8XA 1W2BB 1VQ6B 1VG9B 1QHNA 3QG1A 1DDIA 2G9NA 4E5UA 4IVPA 1WP9A 3QBVA 2B7BA 1M7HA 2BMFA 3BBPA 5H5JA 3TNFA 1F2TA 5KYKA 3ADCA 2P2LA 4IXMA 2Q3FA 1ZIOA 4A8JA 4OQFA 3SQXA 5E7MA 1TU3A 5DHFA 2ZRNA 1MH1A 2J0QA 2V8OA 3KB2A 1G4AE 3K9NA 2MMCA 1K5GA 3K0SA 2BM1A 2HCJB 3QUSA 5SZKB 1P9RA 4LBVA 4TQ9A 5GVSA 1ZNZA 1F2TB 5SZHB 1T5LA 2LWIA 3RYTC 4A8JB 5IRCD 2LKDA 4M4SA 1JI0A 1GRRA 2HJVA 3SI7A 2H16A 2OCBA 1TF5A 2BBTA 1N6RA 4GMDA 4DZZA 1BS1A 4AYTA 2GXSA 3HU2A 1ETUA 1BIFA 4KVGA 2N1BA 4PQRA 1Q57A 5J4VA 2YC4C 3FKSA 3HR8A 4TTPA 5JBQA 2ECKA 5DGXA 4YLGA 1NN1A 1R8QA 2GA8A 2ZU0C 3PQCA 4AC9A 4FCTA 3A1TA 1XZQA 5JI3E 3CCQB 2XTMA 5DHAA 1Z6GA 1Q7YD 3FMPB 3KKMA 4EFNA 2XEXA 3TE6A 3MGCA 4TL9A 2OBMA 4F38A 1G20E 4GFDA 3VAAA 2DWOA 4Z1MA 1HT2E 3QVVA 3I1FA 3EZ9A 5H68A 2RC6A 4MRPA 2BMWA 2YKGA 1MO5A 2ZRJA 1XEWY 3L43A 5E4FA 4LWZA 2GNOA 1K8RA 1EK0A 1LFDB 1SVLA 2ZUBA 1CULC 3WBJA 3LQRA 2Z5FA 4OK5A 4AYWA 1OXTA 3A6PC 1QGAA 5FUYA 2VTKA 5C1BA 5HKKA 1NSTA 4WQMA 4RKEA 1H8HD 2AX4A 4TYYA 5J47A 4PAMA 1E0JA 1G3RA 1XEXB 3QFCA 3IGFA 2XSZD 4QBIA 5EXTA 2DETA 4EQ6A 1DDGA 3I56B 1IN6A 1S72B 1FL9A 2CXXA 4POAA 5HCNA 2ZJOA 4TQUS 1T5IA 1E2IA 3DKPA 2D62A 3A1UA 2GJ8A 2ZI9A 4XTCS 5JCPA 1D6JA 2ZITA 1N2CE 1T6NA 4KSBA 3SJCA 4TT3D 2GJ9A 3RRNA 5B57C 2O8DA 1E4YA 2IK8A 5C18A 1XFAA 3I92A 4EQ6B 2Z0MA 4LV8B 4TMKA 2ZYUX 4PQFA 4Q1BA 1SXJC 521PA 4V0ME 3SDZA 1SZPA 1XF9A 4UXIA 2QEQA 4D4MA 3EXAA 4KFRA 3D7MA 2CE2X 3AVYA 5FOVA 3ZIAD 1L2TA 1WRBA 4FN5A 2F1JA 5KUTA 2C04A 3R20A 1K6MA 4HB4A 1GITA 3ZVLA 1DEKA 2XOKA 2O8DB 5FI1B 5DI3A 2IYXA 3VHLB 4IOJA 1TQ2A 4Q9JA 2ZSEA 3OE7D 1FW6A 5FBVB 1IHUA 3G71B 1X8LA 3H2YA 1E62A 3OIUA 2Q9CA 1A2KC 3UK6A 3SS8A 3WMFA 4DLSA 1CNFA 3PUWA 4DLUA 1RYHA 3GLHE 4ON9A 3R9WA 5DI3B 1Z2AA 1SVKA 5FH9A 4ESVA 4LC1A 1N3BA 2BV3A 4LBWA 2D3WA 3LV8A 2IS4A 2WICA 3IHWA 2BPOA 5G53C 1KI4A 4HAXA 3TSZA 1SKYE 2VBCA 3QJYA 4P4TA 3ZGXA 1MABA 3BFKA 5J4KA 2WAXA 3ADKA 3D3QA 1ZW6A 2QMOA 1IXZA 1U9IA 4X8LA 1N6IA 3NC0C 1G7TA 2OFWA 1EXMA 1G7CA 1CRQA 3A58B 2JLXA 2ZJ5A 4MUAA 2RKOA 1FNNA 1WDTA 2G1KA 1JJ2B 2NO6A 3LY5A 4EPYA 2C99A 4DRZA 1LS6A 2FA9A 4KFTA 2PJRA 4JYCA 1OYYA 3FFAA 2C95A 1MABB 3IIKA 1EP3B 2WKPA 1WBBA 2ZTSA 3Q7PA 5G41A 2J0UB 4OQLA 1IJEA 1YIJB 1NMXA 1R0XA 2PEYA 2ZSDA 2H1LA 2JGNA 1GNQA 1OXUA 2XITA 1VKJA 2WJHA 4GMXA 4XD7A 3CMEB 1A2BA 1CP2A 4ZGNB 5KU1A 4BLSA 4C0JA 5KDOA 4ZDJA 3RS7A 4HLDA 1KAOA 2P5SA 2YVUA 3ZC3A 3UG6A 3U7GA 1LVGA 2ODNA 5FPKA 4LGMA 3UPUA 1E98A 3HPRA 4C7OA 2PH1A 6Q21A 3EG5A 3U2QA 1J7KA 1J90A 3NKVA 4KI0A 3WRXC 5CK4A 3W2IA 2AFHE 2Z4SA 1OIXA 4DCVA 2REXB 2ZRKA 4A2WA 1GKUB 1ZM9A 5BN4A 4CZ2A 1JB1A 3FWYA 2BCJQ 3NXSA 2J46A 5M04A 2IBMA 4DCTA 4F7DA 1XEFA 4RCZA 3P20A 5ANRB 3WMEA 1YITB 1UBFA 4C7OB 1GAQA 4QFMA 5KSZA 1RW4A 2G3YA 2GILA 3QKSA 1G3UA 2F3RA 1DO2A 4Q4HA 5CK5A 2P6UA 2R6FA 5AJVB 2GXUA 3MFYA 3TSOA 3CW2A 2QM8A 4CT4B 5KSWB 1GJRA 2IUSA 4TTQA 1SHKA 2FNAA 2HUPA 1D9ZA 4I1SA 3WYGA 2WTUA 1JPNA 3TK1A 1TU4A 1ZC3A 1IJFA 1E4VA 3P4YA 4PZZA 4B47A 2QPTA 1L7VC 4PC1A 3QKSB 4U7DA 4Q4HB 2VNJA 1S0UA 3H86A 3QKUA 3VR6A 4OK3A 2BHRA 1KDPA 2NQ2C 2OO7A 4M1TA 2VQSA 3IPYA 1DG3A 721PA 4BRWA 3SQWA 4ZKEA 5ELXA 2FSFA 1N0UA 3WNBA 4CT5A 2BF4A 2CK3D 2QAGA 1UMKA 3CNNA 3NTUA 4OJKA 3OIVA 4UNRA 1HQYE 2JJ8A 2FE4A 1A82A 4JL6A 1XJQA 4A15A 1NJFA 1XRJA 1GUAA 1G6HA 2J7PA 2WM9B 4V0LA 3N2EA 4NH0A 3RSOA 2WIAA 1EWYA 4B74A 4MKHA 5TB5A 1E2HA 2PZEA 2QAGB 3E5HA 2ZS9A 1X8KA 1KD1D 1CQXA 2CNWD 2FFQA 5K8LA 2ATVA 1YJ5A 1E2FA 1U99A 4JJKA 2VIIA 4ZV4A 2I1QA 4G01B 4Z51A 5JHHB 2W83A 2KI5A 4QHYA 1RFLA 3CX6A 1ZC4A 2XB2A 4D4KA 1W0JA 1Q1EA 3QNUA 2F9MA 1G5PA 1Z0KA 3F5FA 4MDEA 1KRHA 4Q9KA 3BB4A 3FKQA 2OK7A 1MR3F 4HSEA 3QFTA 1JXMA 1KSHA 2IYZA 2ZI6A 2CL7X 2O8FA 4HAUA 1E9FA 3W9YA 1OW3B 3VU9A 1TQ4A 2JLUA 3VKGA 1IAQA 4IDOA 1G7SA 1NG1A 2WJJA 4EFMA 1P6XA 1QG0A 2ONJA 2EFGA 2PL3A 3K9LA 1E9EA 5AJYA 1XTSA 3OZUA 2QGNA 4WZ6A 2GEVA 2RGDA 1U0JA 4LBYA 1KI9A 1KZGB 3TSWA 3OZVA 2O8FB 1D9XA 3X1XA 1X6VA 1KK2A 4CEJA 3VU9B 2IUUA 1P2SA 3N70A 2DB3A 1H65A 2V55B 4RZ2A 3K70C 2RC5A 1ZMXA 4HEJA 4ITRC 4NE2A 3EARA 3M4YA 4DLRA 4A2QA 2FOLA 1YZTA 5G3ZA 3B5JA 4KFUA 3RWOA 5A0FA 3T1TA 2DBYA 2R65A 2C8VA 2GXQA 1ZD8A 1KMHB 2W6JA 4Z54A 4CEJB 1G8PA 4KHZA 4DSTA 1Z2CA 2JLSA 2DY1A 2HT1A 3U3MA 4BFYA 2F43A 3IDQA 1P5ZB 1GR1A 1TEXA 2ZYTX 2VNHA 2QTLA 4NP6A 3LO8A 5KNBA 1EGAA 4GBMA 5JLJA 1W44A 4YMTA 1ZNXA 1ONBA 1QVAA 1AS3A 2VF8A 1F60A 3WP1B 1G9XA 2ZROA 2TMKA 4B2PA 2H7VA 2QGZA 4S2EA 4G5SA 4EDHA 1VQOB 2F43B 2FFHA 2RHDA 3SHFA 4WOPA 4US2R 2IHBA 1S1CA 5JJIA 4DIDA 2A7QA 2ZANA 3GP8A 2G0TA 4QRHA 3FB4A 1XXHA 3E1YE 4RD0A 1AM4D 1UEIA 2QTVB 1OH7A 4A92A 1XE1A 4Q9LA 1CLUA 3I72A 2G1JA 1FP7A 3SOPA 2CBZA 4D6PA 2IT1A 4IXNA 2GCPA 1KJZA 4GL2A 1BKDR 1KTVA 1NBMA 3PEUA 4Q1EA 2IC5A 1R4AA 4WBSA 3KJGA 4DC9A 2O52A 3RRZA 3EASA 2R6HA 1N8RD 1VG8A 1A4RA 4A4DA 4CF7A 4LJYA 4Q00A 4W5JA 1XXHB 2KB0A 5F3WB 5DI9A 4MKFA 1MOZA 4URZR 3IBYA 4PANA 1COWA 3LW8A 2DR3A 2IXFA 5EZ6B 1FX0A 5TR9A 3VNUA 2VHJA 2MSCB 3TR0A 1GZSA 3UIEA 4V0OA 4DLTA 1Z0JA 4F92B 2REBA 5FL7A 1SQ5A 4C0LA 1XP8A 1EFUA 1W2GA 2BMJA 3CC2B 3WYAA 4HLCA 1F48A 1AIPA 2QP4A 3ND8A 3RRMA 1E2EA 2ATXA 1VIYA 2ZM5A 5LBIA 2WOJA 3K8YA 3L0OA 5EE3A 3RS0A 5C46F 3LD9A 1QGYA 1FX0B 1CJVC 2J7KA 2Q6TA 1W47A 1NL3A 4L15A 1DTSA 3GJ3A 3B1ZA 1GKYA 3BFVA 2OFXA 1QDEA 3FPAA 5JECA 1KI3A 4GT1A 4C0SA 3KTAA 1NP6A 2F1IA 4IRUB 4KLZA 2H18A 1GVHA 1QBKC 1SGWA 4BLTA 2IYWA 1F20A 4JIMA 3MG9A 1VYUA 2H92A 4K46A 1IQPA 1NY5A 1QHHA 2G0NA 4JLVA 4P0TA 3ZDQA 1GKIA 3MWJA 3REGA 4XVUA 3GEHA 3RWMB 3KQKA 3EX7C 1ZUNB 3BGWA 4GOKA 5BN5A 1KI7A 3GJ7A 5TVKA 3U3KA 3KTAB 2ZAOA 3JZMA 3NEYA 1L8QA 4ACAA 3I3SR 2BC9A 1XTRA 3PIRA 4GOXA 1OH5A 1SVMA 3ECCA 4UXJA 2VSXA 2DFTA 3K09C 1QHHB 1J70A 2LKCA 4JLDA 4UKDA 4TYNA 4V0KA 1JEEA 5FUVA 1ZVQA 1CJMA 3R9XA 2GEUA 3NVAA 3AV0B 2ODWA 2F6RA 2YWGA 3AF0A 4P33A 3ZVMA 4DSNA 4PSKA 1OXVA 2VSOA 1KI2A 3THOA 1S3SA 1XMSA 3LXRA 1CR2A 1T4GA 3LAWA 2H5EA 3KDSE 4JZKA 1FTNA 2IA5A 3IO5A 4LDJA 4EFLA 5TY0A 3IQWA 1WQ1R 3IIMA 4RKFA 1T8TA 3PEVA 4E09A 3EZ2A 4DUGD 1ODFA 4G0NA 2QUZA 3K9HA 2BM0A 4E07A 2CHGA 1TQDA 1YR8A 5B64A 2XNCA 1G16A 4AWXA 4BLOA 1M1YE 1LB1B 2ZE7A 2FH5B 1SVWA 2EU8A 1AA9A 2YYZA 3NWJA 4HAYA 4HDOB 2GPJA 2XJ4A 4IHQA 4DBLC 3RVBA 3PUZA 1T91A 3KQHA 4CEHA 4Q4LA 4X8OA 4V02A 4V0MA 1WE2A 4Q7KA 3UKDA 1T9HA 4B4DA 1IN7A 1CNEA 3BFXA 4YDSA 1EFHA 4DLVA 1JR3D 2GCOB 3CRVA 1FQKA 4OBEA 1N6NA 1E9AA 5B2ZA 3AP3A 2ZQ5A 2ZSFA 4M1SA 3X2SA 4CEHB 3GJXC 3MWLA 3OESA 1AK2A 2PEZA 5FBWB 4DLZA 3WNCA 1Z47A 2FFAA 1E0AA 2QI9C 1U0HC 1TTTA 2ZRBA 5FPSA 4OHXA 2GF0A 2XZLA 1KQSB 1SQRA 3B2EA 3M6AA 4LJ7A 3H4MA 3U6KA 1FUUA 4LPKA 3GLHA 3OEEA 4OI4A 1DARA 2QL6A 3KFVA 3Q7QA 2V1UA 1UFQA 2JIZD 1BQEA 4HB3A 4NCHA 2O8CA 3ETLA 4US0R 3RABA 1KOFA 1N5JA 3UMFA 3DOFA 4UNPA 1G8YA 3A4LA 5FOTA 1A1VA 4PAOA 4HLUC 3GLHB 2ZPTX 4ERNA 3ZD7A 1K9MD 3BOSA 5JS8A 4FCWA 2GZDA 1MO6A 4XWAA 2ERYA 2O8CB 4JVSB 4LJ6A 2VSFA 1XJ0A 1EFRD 3D31A 1Y63A 5E3HA 1ZU4A 2WWXA 3MD0A 2R8RA 1RRFA 1SKYB 4LSGA 3BRWD 1EFCA 1LF5A 3I62A 3E70C 1RRCA 5BYJA 4AI6A 1G8HA 3ZH9B 4QNMA 4Q47A 1DAKA 3CRRA 4JJZA 4XTRA 2BGIA 2RGNC 2VH5R 1G18A 1P2UA 2DFKB 3B82A 3V76A 2FFBA 1UDWA 2PT5A 1PJRA 1P75A 2WBLC 5F2EA 1HYQA 1P61B 1W49A 1YHNA 2NTYC 2HT6A 4II7A 2RB4A 4RZUA 2OFOA 4RZXA 1XTJA 3U44A 1P7CA 1BMFD 4C0AC 4QJ4A 3B1VA 1FNMA 3IHLA 2BDTA 2ZS8A 1X1SA 4P6VF 3ZS8A 2VP9A 3GQBA 1W48A 1JNYA 4L16A 1E1QA 4YONB 4C4PA 4A0GA 2JAQA 3B1XA 3HR7A 5EP3A 5EQTA 1FTSA 5IF9A 4NYIQ 3U44B 3C4JA 1FZQA 1DPFA 2J41A 2YHSA 4JVMA 4NCKA 1N6PA 4BQSA 1FRQA 4Y0VA 3CCSB 1E79D 1VYVA 4DLWA 5JJLA 3G4SB 4EH1A 1XPOA 3GMTA 2DHRA 3L0IB 1FRNA 1RE0A 1M2OB 3NHBA 1E1RD 3FMIA 5HCIA 4E03A 4PR0A 2HLDD 4AYXA 3CB4A 1KC8D 2HXYA 1ZCBA 1F2UA 1UBEA 2FZ4A 3MHPA 1U2RA 3NDPA 1XD9A 2OCPA 4D4LA 2X1VA 3A1WA 2ZI4A 1DAFA 5C2JB 2RAPA 3ICEA 2NOAA 1DAMA 1XMVA 3ES9A 2WSMA 3B9PA 3I8SA 4XIGS 1US8B 3CCEB 1BOFA 2FV8A 3Q9LA 5F9FA 5HKKD 3EC2A 3CCLB 1EX7A 5EZ5A 1O87A 3SYKA 4XWOA 1W36D 2FX3A 1F2UB 2CHVA 3QFRA 1XTKA 1II9A 4RFSA 2VP6A 1AKYA 4OK6A 4OL0A 1NSFA 4I1VA 2GEDA 1Q1BA 1RIFA 4JT4A 1LF0A 2H8KA 2V6JA 4Q1AA 2P6RA 3QXXA 2WHXA 3KZ1E 1Z07A 3CC4B 1VCOA 2DWPA 3TUIC 4CGZA 5SZJA 2WSSA 5CLLA 2QMUA 1Q22A 2EWWA 1ESNA 3ND9A 2A5YB 2DERA 4FMDF 1HE1C 4GP6A 2YINC 1EWQA 5SZIA 1Z29A 4RFSB 2XNJA 3CR8A 3PCRB 2WWYA 3ZYCA 2IEYA 3RS4A 4WW0A 2VL7A 4FINA 4DLYA 2KBFA 1VQ4B 3E2IA 5DN6A 4MKGA 1VMAA 1VPLA 2FEOA 2JDID 3OFNA 4PZYA 2AKAB 2UVQA 5KDLA 1NMYA 4RD3A 2OCAA 2VYFA 1R5BA 1OH6A 5AR1A 4G1BA 4DT1A 1N5IA 1JA0A 4BZXA 4JLPA 2NO9A 4Z8YA 4ZPXA 3P27A 3RS3A 2G88A 1KK0A 5JMTA 4TL6A 2GXAA 3SE0A 2OILA 3SN6A 2J0SA 1G3MA 2F9LA 4JLAA 1YZKA 1O3YA 3AVUA 2RCNA 4NKRA 2Z6VA 2D7CA 2RGEA 1Q1QA 2F7SA 2N46A 2ZETA 3DDCA 2O5VA 2V3CC 1C9KA 3PR1A 2QA4B 1W7AA 3CF0A 1E63A 2IHYA 5KSYA 2GAOA 4DT1B 3CCJB 3GD7A 4KSCA 2IWHA 1QX4A 1E32A 3TUJC 3OIWA 3QKTA 4V03A 4DDWA 1EG7A 2QMEA 4Z8XA 5AJWA 3V4RA 1RC8A 5J4YA 3CC7B 4EPXA 4H1UA 4TZ0A 2AN9A 4LUCA 1ZYUA 3C5HA 1NIPA 3SNHA 2OAQ1 1DBSA 1W0KA 3AEZA 3MRSA 4LV6A 3SEAA 3LW7A 4LPSA 2J9RA 3W5HA 3THWA 3SHWA 1FOEB 1OF1A 4JLKA 421PA 2AXPA 3LNCA 1E3MA 2QPAA 2O8EA 3QEOA 4Q5IA 2IF0A 1NLZA 2GK7A 1C1YA 4G3XA 3BXZA 3L0SA 2CDNA 3EPLA 2EYUA 2BBSA 2WOOA 1GWNA 2B6HA 3THWB 4YXWD 2BMDA 3BAFA 1LTQA 4AKGA 4KITB 3MJRA 3CBQA 5EE1A 4B75A 1YHQB 2QG6A 4TSFD 2CLSA 3PVSA 1E2NA 2VHUA 4IDNA 5BW8A 3U7FB 3K70B 2O8EB 4NONA 1II0A 2G77B 1K8AD 3HWSA 3LVRE 1HA3A 4C43A 2FGKA 4CW7A 4NL4H 1N25A 1P72A 2FPLA 3J81k 4IDPA 2QROA 3FMFA 5HE9A 3OEHD 4FXPA 1NF3A 3JQQA 3UMSA 4JKYA 2HV8A 2R2AA 1OSNA 3B6EA 1E9CA 3K1JA 5CIQA 5IK2A 3U3JA 4D0LB 4N0DA 2HJGA 3T1QA 2RGAA 4M53A 3MWYW 4WVFA 4R2IA 1OH8A 4OHWA 4HB2A 5JI2E 3SJAA 4G5RA 3EPKA 3BB3A 2GZAA 4AURA 2WWFA 3LWNA 4W9MC 3WHLA 3OZXA 1GNPA 2QORA 1DAIA 3BE4A 2XTZA 4RY2A 3NBXX 4Q4AA 1X8JA 2ZE5A 3NIBA 4GI7A 1OIWA 2WMNB 5A4JA 2FSHA 2W2VA 2H57A 1E9SA 5CLQA 2VNIA 2WJIA 4FCVA 1U8AA 1YZGA 3LLMA 4BEJA 4PPQA 1UKYA 2E87A 4OQMA 1QVRA 1G21E 3ONWA 5HZHA 2CRVA 1IONA 2ZE8A 2ZRCA 2PIAA 1W4BA 2QTHA 3O8CA 2GVZC 2NGRA 4Q4AB 5DYGA 3VKHA 4WZAE 2B92A 2A5FA 1NVVQ 2F1RA 1YZLA 5FOUA 5KPDA 1PLKA 2KE5A 1JQLB 4OHVA 4AD8A 1TX4B 3HJNA 4C2UA 4O2RA 1QHYA 1G17A 4JSTA 4B2IA 1AGRA 3MCAA 1OGIA 5JEEA 2YWFA 4WA7A 5TXGA 4I4LA 4Q9IA 3QE0A 2XX3A 1ZBDA 4RCYA 2KBEA 4HYYA 3AF4A 1W4CA 1DAHA 3QY0A 1NVUQ 2XGJA 2YOGA 3TH5A 1LW7A 4ABYA 2J7PD 3BWDD 4TLDA 3IEVA 3T5DA 1C4OA 3TW4A 1JXOA 5BWMA 4B3BA 4BFZA 3QG5A 3NG1A 3ZBUA 3A1SA 4CRWB 5GJBA 3EIQA 3HU3A 1GIAA 2BJVA 1DAEA 4L9WA 4WZBE 3GFTA 4B3GA 4ZI3A 4LZZA 4WXRA 1UKZA 1B23P 3GJ6A 1TAGA 2C98A 4QGFA 4DXAA 3HPQA 3V00A 3G0HA 4L5BA 1H8HA 1W5TA 3LA6A 2ASEA 3K09A 4BRUA 4KV9A 1GAJA 2NPIA 4B3CA 1W34A 4BGDA 4MA4A 1UKEA 3CZPA 4M0LA 1KGDA 4B34A 2VPPA 2ODEA 4QGGA 4TMWA 5GV7A 4HDCA 3SR0A 1QUEA 5AUNB 2QA5A 2I4IA 3AKEA 2AR7A 4PO1A 1E2MA 2OUKA 3VX4A 1Z6XA 1PVOA 5LDDC 1OIVA 3KXKA 4Q01A 1VECA 4KBGA 2XZOA 5KO2A 1YRAA 1G41A 2MMGA 4IOKA 3T61A 2OXCA 2C9CA 1HUQA 1D1NA 1CKEA 4NYJR 4Q7MB 2GZHA 3KL4A 4O0MA 5FR1A 5LB2A 2XNSA 3ZIAA 3AQ4A 1HT1E 3CWZA 3L8YA 2JLVA 5CJPA 1QHIA 4WIAA 3AF3A 4D2IA 4JL5A 4TL7A 1TQ6A 2BN4A 4PTLA 1T0JB 3SBDA 3NBFA 3EZ7A 2N42A 2W6JD 4MYCA 4F4CA 1NJGA 2JEOA 3EAQA 4ZO4A 2LP6A 3EIEA 3OE7A 3U7HB 2IS1A 2WJGA 2WWHA 1JR6A 1OFHA 2FJUA 1I2MA 3SBEA 4BLPA 1G8GA 1UJ2A 3KUDA 3IPXA 3EWSA 1U81A 3B85A 3VR2A 1K73D 4EJSC 2QP9X 2QAJA 1PUJA 2WAYA 3FDIA 2ZVQX 4IOMA 2HXSA 1VQKB 4IFBA 5E7JA 1P9NA 3PXGA 2EFEB 2XNDD 1WBDA 2YC2C 3A1VA 3TQFA 1OFIA 4U9UA 4RZ3A 4F4JA 2IS2A 2ZS7A 1D5CA 4JLNA 2A5GA 3V9PA 1E99A 1YZQA 3OAAD 1HY3A 1II8A 2YJTD 3W3AA 1M34E 3IBGA 3QOFA 1WCV1 3TAUA 3DVLA 3PITA 1YQTA 2FPKA 3P26A 2YWEA 4JBWA 3GJ4A 3F0TA 3VO1A 4JLBA 3PEYA 2CLDX 3D6TB 4OYHA 5GJVC 5P21A 5HR5A 3Q3JB 1E2DA 1GRQA 3GJ8A 4LHYA 3AF2A 1NBMD 1E2LA 4YMWA 1QUFA 3ZZ0A 1U98A 1AS2A 2G6BA 4N3NA 4LYAA 3LO5A 1GP2A 1QFJA 3CXCB 1KO7A 4Q48A 4HLUA 2I1VB 1COWD 1D2NA 3CF2A 1NN3A 3LDAA 2C78A 1Z08A 5JRZA 2PX3A 4ASUD 4GP7A 2RGXA 5CM8B 4RD2A 3TRFA 1SVSA 1QHXA 2AWOA 3KQUA 4CIDA 4FK8A 3A36A 2QTZA 1VHTA 4C30A 5EMNA 2ZR0A 3DMDA 5FL7D 4A0HA 3CRMA 2W6IA 1GTVA 3C14C 4QHTA 1S1MA 3I32A 2CLCX 1XCMA 2Y8EA 2AL7A 4TTRA 5H1YA 1XTIA 2A5JA 4KO8A 4NDZA 2RGNA 1JJ7A 5IHPA 1CEEA 3KX2A 1Q21A 1UBGA 2WWIA 4H1VA 2D74A 1JAIA 4MGKR 5JJKA 4RD4A 5DSZA 3QKRA 1Q81D 1SVOA 3CPHA 4PAQA 1KO5A 4P3YA 4BASA 2BCGY 5KSOA 4ZGQB 2IW3A 3ASZA 4LJ8A 4QHSA 1G6OA 3ZZTA 1JJVA 1J2JA 3LFUA 5HTKA 3DO6A 4DIEA 3GJ0A 4B3DA 3KXLA 5CYPA 2Z83A 3V4FA 3L0PA 3QKRB 5AN9A 1KYIA 2OBLA 5K8IA 2XB4A 5AK0A 5EE5B 1Z8FA 1KJWA 2X8AA 2OLJA 4LHVA 4C2TA 4NBSA 3W90A 1SVIA 3PUXA 1W36C 1UPTA 4HE6A 3TR5A 4MDFA 2HEIA 4MRRA 2FN4A 4AKEA 3NBZC 3IIJA 3ADDA 1KO4A 1UM8A 4ZIRA 3SJBA 3OIYA 1G5TA 2EFCB 2NO1A 2CK3A 1R8SA 1VCMA 4XOIA 2W00A 2ZRAA 2FU5C 3EA0A 3CCVB 1XZPA 2VRWA 4DQKA 4M9ZA 5FOWA 4DB4A 5JWRA 2OE2A 1MT0A 2PLRA 3OZWA 4LX0A 4BFVA 3UMRA 1FP6A 3EZ6A 2B8WA 2QE7D 4NYJQ 4ZIRB 3PV0A 3W5UA 2VP2A 3AVOA 1VQPB 1Q44A 3OHMA 2ZJAA 1VYTA 2B21A 4TMTA 5FOSA 4PPNA 2OESA 1QFYA 5CDFE 2GF9A 2WPDA 3GLIE 1M74A 2YV5A 4XSHA 4KU4A 1KDRA 1K5DA 1CJUC 2ODBA 3DMNA 2IYVA 3NBYC 1GVNB 4TLEA 2ZJBA 3U3RA 4BWYA 1T8UA 1G3QA 3M1IA 2W0MA 5FPHA 4JLJA 2JA1A 2V9PA 4FWIB 4K8OA 1SXJD 4PC2A 1JPJA 2GETA 3QPVA 1NKTA 2JCSA 4GRAA 4AF6A 1U90A 1A7JA 2DCUA 1CTQA 3CNOA 2JATA 2JLWA 1H8EA 1JEDA 1Z5ZA 1UADA 2JJ2D 3FHOA 3LVBA 2A30A 1MRSA 3P32A 1VTKA 3CR7A 5B30A 3NDBB 1G5RA 4CVNA 4GPTA 2FSIA 3Q85A 1J99A 3WY9A 4AF7A 4B2LA 3K0EA 1GG2A 1NRJB 2NIPA 1X3SA 3RRYA 1GM5A 2RGCA 4FMBB 3HU1A 1L4UA 4NYIR 4OKSA 2IXEA 4QGAA 2VO1A 2WV9A 2QM7A 2X2FA 4N3GA 3MUFA 3VNVA 4JMPA 5GADl 1XU4A 2GTPA 3CF6R 4G5OA 4HATA 3KQNA 3DL0A 1VDZA 4BECA 2JJ1D 4LI0A 4PHTA 4TYQA 1KO8A 4OI0A 1H42A 3FJOA 1R0ZA 2D2FA 2HYDA 3FHTA 4HAWA 4MYTA 2R6GA 1MO4A 4LBZA 1GOTA 5DH9A 2DPXA 2YOHA 3DZDA 3K9GA 3GLFE 1E96A 2ZYWX 1RPZA 3CCRB 4HUQA 2VF7A 1ANKA 3ZQJA 2NPFA 3W5VA 5AWFC 3SC3A 2QY9A 4DCSA 5KHOC 4B43A 1W4RA 4W5WA 5DO9A 5GJWC 1P4SA 3SU8A 1EX6A 1ZNYA 1SKQA 4D82A 2VNKA 4ZI2A 2ANCA 3IEUA 3SZRA 4DHEA 5H70A 5KNCA 2I3BA 1GL9B 4DEXA 3IQXA 1D2EA 2WKQA 1TADA 2ZJ2A 4HUQB 3BORA 5UKDA 4ZKDA 3AB3A 3T1VA 3PFIA 4KYUA 4AKHA 5DISB 3Q5DA 5A5GA 5EXXA 5D3QA 4UAJA 1N6LA 1P73A 4NZYA 4DCUA 4C0KA 3CWQA 2RMKA 3H84A 4EPWA 5EJEA 1KZ7B 2VHCA 1T3HA 4DQLA 2HF8A 3GEEA 4TMXA 1XTQA 2IYYA 5GVRA 3BH6A 2AWNA 1ZM7A 1IOZA 4Q9HA 1T0HB 4BZPA 3GLGE 2VP0A 3T06B 2J87A 1Q3HA 2QBYA 4FD2A 2V54A 4MRNA 1M8PA 4BFUA 4BEBA 5JWOA 1Z83A 2ORVA 4IEIA 1J8MF 1JQJC 2KSQA 3G82C 1UEJA 4KCGA 4LYHA 1W35A 5EUMA 1VQ7B 4X8MA 3WNDA 1SM4A 1TUEA 5LB4A 1HURA 1OXXK 3MSXA 3GJ5A 1S96A 2V7QA 5CB8A 1A8PA 3AGPA 2D4HA 2OLKA 4FIDA 4JL8A 1QH0A 3CPWB 1BH2A 2GAAA 1IN5A 4HB0A 4NTZA 2QBYB 4M21A 4P4UA 5FUWA 1F3OA 4MGYR 4U00A 4HZUA 1NNEA 3MLEA 2D2EA 3T35A 3QFSA 5JSZA 5G3YA 5FUXA 4FMCB 4TYWA 3LH5A 1ZUHA 3EZFA 121PA 1KDOA 1KJYA 3CONA 4LJAA 1QG2A 3W2EA 2EFDB 4MYHA 2P67A 4V0NA 4R9UC 4CDGA 1UBCA 1TL7C 1GRNA 2ZR9A 4PSVA 4DB2A 2GKSA 2FF7A 4HLQB 2DEUA 2BGJA 3LRPA 1GL7A 3BB1A 3B1YA 1R2QA 2GESA 2F1HA 3CLVA 5KNDA 3G6EB 1PLJA 3K0CC 4Y9RA 2JLQA 5JSZB 3CZQA 1ZAKA 3CPEA 3GPLA 1CS4C 2EVWX 4I1UA 4DSUA 4M2LA 4KXFB 1BYUA 4LJ9A 4OJQA 1TNDA 1CRPA 4M22A 4YALA 4DSOA 1YU9A 3W2HA 5FFMA 1N0WA 4YHBA 4TL8A 3TBKA 1AMOA 2NMVA 3ZQ6A 2J45A 3O8BA 1OV4A 1DO0A 4QBGB 3AKCA 4URWR 2OHFA 3GEIA 2OXRA 3QXHA 2IYSA 4QM6A 2GJKA 2UKDA 5G40A 1KK1A 3ZLJA 3R7WA 3CCMB 2PBRA 1ZM4A 3VMFA 1NN0A 3UATA 2GVDC 3BJIC 2BEJA 1XWIA 4UNQA 4DUGA 2ZSBA 3I5XA 4YAOA 3BC1A 1AZSC 1Z0IA 1P60A 4B35A 3FKSD 1YR9A 1KKMA 4KYIB 4P31A 1CU1A 1KMQA 1YJWB 4ZCIA 4PHHA 3C8UA 5H8WA 3R7WB 1KKLA 3RSLA 1TLLA 1DS6A 4GSYA 4Q19A 4YMVA 5AUOB 4R71A 1KY2A 5FR2A 4YAUA 3RS5A 2OSBA 3SYLA 1OHHA 4Y9UA 4Z1MD 1W0KD 821PA 3G5UA 2QDXA 5J4LA 4B71A 2O0JA 2Q9AA 1VCNA 4G5QA 1AGPA 2ZXUA 3NH6A 3OJWA 4IW3B 3RS2A 1OKKA 1IY0A 2ORWA 5TDHA 1N6KA 1OT3A 3K70D 3DEFA 2ZRLA 1AS0A 1NVVR 4JBYA 4WAUA 4LYFA 1VQ8B 2PLFA 1E2JA 1U94A 4DKXA 1BX0A 1G3IA 2OV2A 5EXPA 4F93B 2OT3B 2PX0A 1LNZA 3LQQA 2PMDA 1ELOA 5D3MA 3THYA 3UWOA 3CD6B 2CEAA 4EPRA 1S9DA 3DHWC 1AKEA 2JIZA 4URVR 5EUQB 3WP0A 4HAZA 4QJ5A 4TLAA 4EJSA 1ESMA 5KTYA 1GDDA 3AVTA 2Q3HA 2ZRGA 4PX9A 5FL3A 4JYBA 3X1WA 3U7EB 4F7WA 1LV7A 2VEDA 1GAWA 1NG9A 2CJWA 4HUTA 1MV5A 1NLFA 3BD9A 5D3MB 5BYKA 2KWIA 3THYB 3CCUB 5IK2D 2FG5A 1YI2B 4DDUA 1AZTA 2AK3A 4JVLA 2IF2A 1NLYA 3HYTA 1VG1A 4UJ5A 3RC3A 3Q8XB 3TKLA 2XOKD 4EJSB 1EFRA 3QE2A 4C9BA 4NU0A 3U5ZB 3VX3A 2ZSAA 3CRW1 4MRSA 4PPFA 2FPMA 4MGIR 1I2DA 5JHGB 2OG2A 5BQ5A 2CJWB 4O25A 5AJZA 5CITA 5HZKA 3ZVNA 3CKLA 3R8CA 1IB0A 1W46A 1P2VA 1W4AA 2P0EA 4QGHA 1JA1A 5EP2A 2Q3MA 2V6IA 4MH0R 5HPYB 3ZZUA 3QSYA 3ADBA 2IEZA 2VLIA 1KSGA 3U61B 5F9HA 2C9OA 4YAFA 2QU8A 3BH7A 4C0BA 2J5XA 1BMFA 4TZ6A 2HCBA 1MO3A 3KJHA 1KNQA 4A0FA 1OE0A 5JEDA 2NO7A 2KJQA 3IILA 3UG7A 2BOVA 2J0VA 4Y7CA 4JLOA 4IJMA 4TYPA 4FWTA 4US1R 4HDQB 1G7RA 2RH5A 1ZP6A 1BJKA 4C0HA 1P9WA 4D25A 4AK9A 5LD2C 2R6AA 3F8TA 1E79A 1PV4A 4TQAA 1RZ3A 3L8ZA 3QEJA 4URXR 1CJKC 4EIWA 5KSPA 2GRJA 2NG1A 4KAXA 1E1RA 1HQCA 4PQYA 2HLDA 2BIFA 2ZJZA 2FMXA 4XD7D 1XEXA 1N0VC 2ZU6A 3TUZC 4A9AA 3RC8A 2CL6X 5FPTA 2Q9BA 2PT7A 2XAUA 4P4SA 3AVPA 3W8NA 4W5HA 5HE8A 3FMOB 1CR4A 2BBWA 1I4TD 2FWRA 3KKQA 3W8RA 2VP5A 1X1RA 2JLZA 2IS6A 2O0HA 2IYQA 2J3EA 2WWGA 3KQLA 2O8BA 2HMAA 5DE3A 2EQBA 4BZQA 1YKSA 4BE7B 5BXQC 2ZJYA 1Q20A 1TF7A 1FNCA 3W2GA 3AF1A 4P4SB 4D0NA 3L82B 4MGZR 4PHGA 1S8FA 3ASYA 2QSZA 1KHTA 2YNMA 2IL1A 4YC7A 4QL3A 4FMDB 3WXMA 1DADA 2CCKA 3U4QA 1GL6A 3CM0A 1VQMB 1W36B 1J9ZA 4QJ3A 1T3LA 2AD5A 1R0WA 1J8YF 2O8BB 4JT2A 5E7IA 4B76A 1SHZA 1FMJA 1AQYA 4Q66C 5TARA 4R7ZA 2Q0HA 3LXXA 3GFPA 1F5NA 1E0SA 1XMIA 2QPOA 2R9VA 1KSFX 5CDFA 1B0UA 1P3JA 2JDIA 2PZFA 3GLIA 3ZBTA 1SXJE 1QZXA 1N5LA 3U4QB 3REFA 3EIHA 1SULA 5THXA 1KDTA 4GDFA 1UKVY 4PC3A 1NY6A 1ZINA 1NMZA 2GK6A 3GFOA 2UZ3A 2ZEJA 1DG1G 3CRQA 4D81A 4XH9B 2WVJA 1WA5A 1I4LD 2CVHA 3FGNA 3QPWA 4IKEA 3GLIB 3U6BA 2QT1A 3CIOA 3FOZA 3ICQB 2A2ZA 3RHFA 4BFWA 3FYHA 3S1AA 4PC7A 1DAGA 2H17A 4B6EA 4QOSA 5KDDA 4AKIA 1R0YA 4L8GA 1HEIA 5FTMA 4B6FA 1OFTA 4Q4JA 3WMGA 2F55A 4RVCA 1NDHA 1IY1A 3HP1A 1NI3A 3I61A 1Z28A 4KJZA 4DWJA 3MMPA 1HV8A 4QBFA 5IT5A 1XX6A 3KKPA 1TEVA 3S1AB 4PXAA 1IN8A 2OAP1 4N0EA 4ZDIA 1E2KA 1D2MA 2J0UA 2X19A 3QVUA 4OI2A 4ZDKA 3NH9A 2NO0A 3C41J 5JRJA 4M9SA 1RRPA 4Q4JB 3I55B 1AJEA 3B1WA 1OFUX 4RJLA 2EYQA 4M1YA 2E9SA 3CO5A 1W0JD 3T34A 1WXQA 4RSGA 1R10A 4AY2A 1LS1A 1E9DA 1TPZA 1WMSA 2FGJA 2ZIAA 1VHLA 5K8TA 4JBXA 4TLCA 4I81A 4NPHA 4MITA 2XSZA 1JBKA 4YXWA 3VR1A 3CUEF 1M90D 2C9YA 1KO1A 3GLFA 1N5KA 3AKYA 2WIBA 3TMKA 1OJLA 1N6HA 3JQRA 1XDBA 1Z06A 2HDNB 2L0XA 4TSFA 3WHKA 1ZRHA 4O3MA 5FTKA 4Q18A 3U60B 1NJID 1EP2B 3W6PA 2YWHA 3QQ5A 4QC2A 3TAHA 2XTNA 2W6ID 4A1FA 4TT3A 5FBLB 3TJZA 1R6BX 1E94E 1OYWA 3OEHA 5FOXA 4AIIA 4A0RA 5B58C 3GLFB 4F4IA 5FTLA 1Z6YA 3AVWA 3WRYC 1YZNA 1UDXA 4NHOA 4L9SA 2QTFA 3UANA 3CX7A 1G291 4P32A 1X86B 1GSIA 2ZREA 2DWQA 4BUJA 1JR3E 4ESHA 3VR4A 1NN5A 3HYRA 2P6NA 4HE5A 1H85A 3C5CA 4IOLA 4Q03A 4URYR 3CRZA 4A82A 4LHWA 2AK2A 4M1WA 3O47A 3W34A 2B5OA 4ILEA 1KI8A 8OHMA 2QZ4A 2R62A 3UXMA 3T5GA 3GLGA 3M0EA 4QG7A 1KI1A 1CBUA 1QHSA 4AG5A 2CL0X 1JALA 4Q1CA 5C4MA 2LCFA 3JVVA 5CIWA 4TWZA 4H9GA 1KI6A 2X77A 1ZD9A 5EP4A 3B9QA 3LBIA 4MYUA 1ZD1A 5CB6A 3ZJYA 3EWAA 3DZ8A 3PG5A 1DVRA 4JSYA 2QQEA 4UJ3A 1Z22A 2FDCA 2NZJA 5FPYA 3W6NA 3GLGB 3DOEA 4PHFA 2Z43A 3LBHA 3VR3A 4ZCMA 1FMLA 2QNRA 2GDJA 5JZVA 1KI6B 3SFVA 1VCIA 1CJTC 2GHIA 2OM2A 1WF3A 2CE7A 4HAVA 4A8JC 3TVDA 2IYRA 5EP1A 4PGOA 3LVQE 5EE0A 3CPJB 1IY2A 5FTNA 1FNDA 3VKWA 3RNLA 4ARZA 1PZNA 4F91B 4LK2A 2ZUCA 3LX8A 5JWHA 1KAGA 3A4NA 1II8B 3X1ZA 1G1MA 1EP1B 4BLQA 4CYMA 4N1AA 1XB2A 1E2GA 5DIFA 2P3SA 1GILA 1M7GA 4NCIA 3OJXA 4DDVA 2C03A 1FUKA 2QMHA 1R7RA 1CR1A 1BYIA 4ARZB 3CNLA 3C7KA 2WPDD 4WXPA 3TLXA 1JECA 3PJRA 3TQCA 2CCJA 1IBRA 3EW9A 3K0CA 3R8FA 4XVQA 3SYNA 1Q1ZA 2ZRHA 4BLRA 3IKJA 4D0GA 5AUPB 4MKIA 4LJ4A 1VQ5B 5E95A 3TW8B 3QF7A 5FBRB 2D7DA 4LC0A 3QF4A 4IDQA 2DFLA 2NZ8A 2QRZA 3QXJA 1D8TA 3MAAC 3W3ZB 4KBFA 3AVVA 4BFTA 4RD6A 3BH0A 4DCNA 4URUR 5JS7A 1H8ED 1Z0FA 3ZD6A 2IYLD 4TMZA 2A78A 2EFHB 4R98A 4OI1A 4YQFA 2VP4A 4KLNA 1QRAA 1W5SA 3U3OA 1EESA 1NIJA 2W0SA 2Q21A 4B3XA 1XBTA 3CX8A 3T12A 3P4XA 3TGPA 4UXHA 3QF4B 1KMHA 3I5YA 2OEPA 2QRNA 1QFZA 4LJ5A 2A9KA 3VQTA 3O8DA 3B78A 4D80A 3UWKA 3JQPA 3AKDA 3I73A 1VQLB 2EIXA 2ZRPA 2GQFA 3SFZA 1ZM3A 1XCPA 1PLLA 4ZCLA 4TN1A 3FVQA 3H0KA 3Q72A 3AVXA 1E69A 3PUVA 2MSEB 3TIFA 2V4ZA 1FQJA 4OQNA 3X1YA 3WBKA 3OF5A 1ZCAA 3KJIA 2FEMA 3CH5A 2CHQA 1QG4A 1VIAA 2ORIA 3W5JA 2W2TA 2AKYA 3EA5A 4HZIA 4TMVA 1E2QA 4UQOA 1RVDA 2VYQA 4NYMR 1Z63A 5L3RA 1HE8B 1W2HA 1KSJA 4Q1DA 2OCYC 4W7SA 2GBLA 4GZLA 1CIPA 1NKSA 2XZPA 5H59A 4GOJA 2XNDA 3K0AA 4GZMA 1YZUA 3KKOA 4XWKA 3QPUA 5GV8A 2VA8A 1IXSB 1E2PA 2WKRA 3K53A 3OAAA 1BX1A 2GWHA 5DNYB 2CNWA 1ZUIA 4AG6A 5J5CA 4DDTA 1QVGB 221PA 2OTJB 3AUYA 4G1UC 4NCJA 1BO6A 2XXAA 5IDVA 2ZR7A 5AJXA 3K0AB 2F3TA 4M9XA 1KY3A 4QM7A 2JLRA 1KIMA 1QGZA 4DVGA 3WYFA 1G8FA 1S2MA 2P5TB 2PJZA 2RGGA 5FBQB 1IXRC 1P62B 3RAPR 4NMMA 1FNBA 1KNXA 4XVRA 1FDRA 4IFEA 2OBNA 3E20A 4M1OA 3EPHA 3VO2A 3H1TA 3BK7A 2XXAB 1RYFA 4ASUA 2ZI5A 2BEKA 1G19A 2GJAA 2VZLA 4C0QC 3QI2A 1XPRA 3QBTA 4Q1FA 1RJ9A 2ONKA 2RGBA 4A36A 1JAHA 2QEXB 3EC1A 2B7CA 2D06A 4YMUA 1OXSC 5KOYA 1I4DD 1YJNB 1AN0A 2ZYVX 1U9IC 1WB9A 3OEED 1W1WA 3THXA 2YOFA 5F98A 2V7QD 2B8TA 1N6OA 2ZAMA 1YE8A 1Z6TA 4RFVA 3KKNA 1YR6A 2ZI3A 3DM5A 4O2LA 1RJ9B 5DYIA 2MSDB 1ZU5A 3DM9B 4EPTA 2UZIR 2EW1A 4LHZA 5GJCA 5L3QA 3KXIA 4PO9A 1DE0A 3R9IA 2PCJA 3NHAA 2AXNA 2ZUDA 3W2FA 4KODA 1MRNA 2O0KA 2C77A 3THXB 4B33A 2AD1A 1F6BA 4FMCF 1UAAA 2K5UA 4QBHA 4XSGA 5JFGA 3NEJA 5FI0B 3FHCB 3N5CA 3RDPA 4CEIA 1QHGA 1NVXQ 4G1VA 4YAWA 5L3QB 4YMSA 3B60A 3QIAA 1M1KD 1TMKA 1YR7A 1FPMA 4Q02A 3PENA 1M6NA 4S35A 2GJSA 2IUTA 3VFDA 1MKYA 2AHOA 3B7GA 4B3FX 2QENA 4Q21A 1OLOA 4I1OA 4CEIB 1S4QA 3MWKA 4BPBA 2WMOB 2QT0A 4I99A 4TLBA 3X1DA 2BKUA 1Y3AA 2QQ0A 3F3YA 4PSAA 2JLYA 2WJYA 4HI0E 2VHQA 1E9BA 1R5NA 2AFIE 4OHYA 2WJVA 4B48A 4JVNA 3KFXA 4C3ZA 5LD2B 5BN3A 1JB9A 1L4YA 1FFHA 2SHKA 2X3UA 3B8HA 2JASA 1TVCA 1OB5A 1U8ZA 2OK8A 1KK3A 4LCBA 3AH8A 3DKVA 4UNNA 1E0KA 3W5IA 2HYIC 3A4MA 1E1QD 2ERXA 2ZRIA 3E1SA 2QE7A 1V5WA 5TMPA 3FE2A 3FTQA 1VQ9B 3KJEA 2RHMA 2BVNA 2IYUA 1ZNWA 2BSAA 1YVDA 1LY1A 1XJCA 2GCOA 3QENA 2W2XA 2CVFA 2DYKA 2J1LA 5HXBA 3VTKA 1OHHD 2A5DA 1HH4A 1QF9A 3SJZA 3BS4A 4ZDWA 2ZE6A 3CH4B 4PC6A 2PCLA 2XJ9A 4K81B 4LOAA 4M1KA 3ZVRA 4QXAA 3C16C 3BIFA 3IO3A 2W58A 4YDHB 4JLMA 1G4UR 2CNDA 2OZEA 4M8NE 5LPNA 2QAGC 1E9RA 1OKKD 1SXJA 3AM1A 1RRGA 4MQBA 3NC1C 1TUIA 3VHXA 4DEYA 4EAQA 3A8TA 4BFSA 4EKDA 4A6PA 4KFSA 3I4LA 3MJHA 4NYMQ 5JCZA 3EPJA 2PMKA 4PPGA 2JJ2A 5CJ2A 1XPUA 4D26A 2FSGA 1IM2A 3C15C 4LYJA 3AUXA 4QNRA 1ZIPA 2BMEA 4UNSA 2BBOA 4EUNA 4IVQA 1CF4A 2QP3A 2X2EA 5TV2A 2R6CA 1Q82D 3CMAB 1SXJB 1T3SA 3QXSA 2EWVA 3JZAA 4U02A 4B73A 2ZRMA 1YRBA 4LY6A 1Q0UA 2GCNA 4D4JA 1S3GA 2CCGA 5CM9C 1OPXA 4HZUB 4L4UA 1Q12A 3PUYA 4JS0A 4OQXA 4MUBA 2WZQA 4XJXA 2WSSD 1OGJA 1DELA 3LX5A 2WWWA 2JJ1A 2ZJ8A 3OW2B 5EE9A 1QVFB 2V1XA 5L3SA 2BJWA 3A37A 1CR0A 4Q7JB 1P2TA 2CMKA 1DOAA 2BWJA 4GNKA 5DN6D 5CYOA 4LRWA 3OFND 2PZGA 2FZLA 2REOA 4DLXA 1I7PA 3AGQA 3LBNA 1VQNB 2R6DA 4IDHA 2QSYA 4M9QA 4J0QA 1XCGB 4FW9A 4PO8A 1ZM2A 5L3SB 4BPRA 5L3VA 4QKQA 4R2HA 2J59A 1XD8A 3AP1A 5L8VA 4PZLA 1Z6AA 1M7BA 4Y0AA 5EXSA 4NCNA 1PUIA 2ANBA 4FI3C 4M1MA 3P1JA 5J40A 3ZS9A 3LLUA 1YJ9B 4Q7LA 5DLQC 621PA 3FPKA 1V43A 3JVUA 4B44A
chains in the Genus database with same CATH superfamily
3T15A 4BFXA 2HADA 2A0YA 2WTNA 4KBYA 4MW9A 3BCFA 3EA8A 3RANA 1Y6JA 4K28A 2N75A 2P2CA 4M0CA 1EWRA 4QLOA 4I19A 2HA6A 1R5OA 1P2QA 3SNAA 1A1RA 3GGCA 3IP3A 1VPTA 2VBFA 3TGJE 1PWXA 1Z0DA 4BNVA 2VK2A 5J2UA 1U8YA 3SY8A 1YJ8A 5B1EA 2C8YB 2A7XA 4A8PA 2DR0A 4E5UA 4MQUA 1O2XA 3ZVBA 5I6DA 9ATCA 4LNUB 1ZIOA 4A8JA 4E5NA 3BY2A 2CT8A 3UC9A 5EXMA 1NI4B 1J9EA 5DHFA 4CM8A 3SZGA 1SUFA 3QUSA 4M9CA 3H2BA 5B3LA 3KXPA 1UKBA 4P2GA 1OX5A 2B4TO 2N1BA 3TM5A 3LY7A 2GCIA 3ZZ4A 3PQCA 1Q7YD 2EFYA 1F17A 4QASA 1ZTKA 4LZWA 1J6UA 2C3OA 1DJQA 4WKCA 3CO0S 2ZRJA 4S1VA 3O2NA 3S55A 4OK5A 4ZVTA 2PRIA 1NSTA 3AERA 3PC8A 4RH3A 1UUFA 3CCBA 2OBQA 1N1MA 4QPJC 5I4CA 5B57C 2O8DA 4OL9A 3SXUB 5C18A 2GARA 4LV8B 4TMKA 4EA8A 3STYA 3GVLA 4G65A 2ZJFA 4UXIA 4XJTA 3AVYA 2GX4A 4FN5A 3PD1A 5KUTA 1FJGB 3ZVLA 1O32A 1DP4A 1Z71A 2LCIA 4YJ2B 1CNFA 4YT7H 3GJZA 1O5BB 1RYHA 3Q8LA 2O05A 3DBLB 2RI0A 2IS4A 1PT9A 3IXLA 1DBWA 3F6UH 2HWUA 1V2OT 3D3QA 4D0SA 1N6IA 1SNYA 1CRQA 3D7SA 4CMBA 1WDTA 3UK0A 4R8MA 3JQ9A 4K87A 2WAAA 4EEKA 4YAKA 5C51B 4E6PA 2ZSDA 4N18A 1T9GS 2WJHA 1ODLA 2QUJA 4XDZA 5KU1A 2RGUA 4HFPB 3U7GA 2GDZA 4Q3BA 3WRXC 1FZZA 3AETB 3R5XA 2AFIA 1JHXA 2ZTUA 3FGZA 3ST7A 1UBFA 1IHMA 1SQTA 1G3UA 1DO2A 2J67A 5CHBA 3PGJA 4K5ZA 2FNAA 2OFFA 1KHHA 3M9XA 1QYRA 1X9HA 3OY5U 3EGOA 3BF8A 1KDPA 5ALUA 3EGVA 2IKQA 4DGSA 3DAFA 4WKBA 2C29D 4RVOA 4AICA 2WYHA 3ZPNA 4M86A 3OPQA 1IQMA 5A3QA 2YY5A 4D9NA 4BQRA 3KZNA 2ATVA 4DJZB 4JJKA 4Z51A 1SXGA 4EGSA 4ABIA 1W0JA 1Q1EA 4LE2A 4CI9A 1EK1A 3QFTA 1TYAE 3DBRA 1O8BA 4MWGA 3D6JA 1ZXLA 2WJJA 2DT5A 3H97A 3JS5A 2EFGA 4B9AA 4IMPA 2FZEA 1JFFA 4KO2S 1YRHA 1NC6A 1TOCB 4P3KA 4P8RA 1NXQA 5JZBA 4TKVB 1K1JA 3QGJA 3MO6A 1EPTC 5JS1A 4DSTA 2D54A 4L5IA 1Y3HA 1C5YB 5THQA 3LO8A 4XRGA 3YASA 4YMTA 4UZEA 4QDZA 4QUJA 1F60A 1L5VA 5JZOA 4MNYA 4OHBA 3GBPA 4RH0A 3ZEAA 1YDWA 3OTWA 3FB4A 1XXHA 3GIRA 1U0RA 2XRMA 4A92A 3GJYA 1TAWA 3IQHX 3SOPA 5JC8A 2PKQO 4KN9S 2G8LA 4BAZA 3E53A 2XWSA 1TBZH 5J58A 1RPJA 3E0PB 3CC8A 4MVXA 2ZU4A 2PRSA 1CT9A 2EKZA 4HG2A 2P78A 4GM1A 4DR2B 1YUNA 3BFVA 8GCHF 2X86A 3EDOA 3KTAA 1FVFA 4ZT7A 5LU8A 1IAVA 3G6WA 4F3NA 2HCFA 1TD9A 1RM3A 4XE4A 3BMOB 2BC9A 3PIRA 1AZZA 2ECFA 2VSXA 3BA6A 1JEQB 4PY2A 2D3LA 2C5GA 4LJLA 1C7QA 1E7RA 1L1RA 4KXVA 3RIGA 3L1VA 5EODA 4DV0B 4QIHA 3RKRA 1PEYA 1FLAA 5I9IA 2JI8A 3TQHA 3EBPA 4IZHA 2YYZA 3NWJA 1CF9A 2R5NA 3RVBA 4FUIA 4MYDA 1NMQA 3BFJA 3UO8B 1GHVH 2GD4B 1YNSA 5A7GA 2G8NA 4XDYA 3RFUA 3ZWQA 1E9AA 1V8DA 1K7SN 1KDQB 3WNCA 3DHVA 2QI9C 3CY6A 4IQ8A 1E36B 5B7PA 1CZOA 2ZR8A 1MBQA 1Q14A 4QDOA 5EQJB 5ILOA 2HJHA 4IWYA 5MFZA 1P0CA 2EX1A 4P82A 4HMOA 4OB8A 4FCWA 3QE3A 4RGBA 1JFSA 3F74A 1EFCA 1G37A 2WB4A 2BHLA 3DMFA 2RGNC 3AK4A 3BTHE 2R4TA 4LCJA 3RK4A 2CZQA 4GYWA 1EGHA 1BMFD 5ALOA 2NW6A 4YONB 4C4PA 4A0GA 5EP3A 4CF6A 5AKHA 2XCRB 5TF4A 3EYDA 2B20A 5C8YA 5EQRA 1CNMA 4WPGA 3LGVA 3OTIA 1V8PA 4F06A 1ZCBA 1HR0B 1M1ZA 4UAVA 2ZI4A 1X1AA 1THSH 1DAMA 4XIGS 3V6MA 1O87A 4GOMD 1FJXA 1HZEA 5E2PA 4R1PA 2FW0A 4LZLA 1RIFA 3WOHA 1KFEB 3G0DA 1MZAA 2EBWA 2YINC 3EMKA 2R00A 1EX9A 4WV3A 4X95A 2P4SA 4D9RA 4MI1A 5KC9A 3CH7A 4ZYZA 3QWAA 1IZZA 2C7QA 4E2YA 5K0JA 2B8NA 4NBUA 3GDOA 2PRJA 4KSCA 2XGSA 2KCPA 3ESBA 2QMEA 3H4TA 1RWKA 4TZ0A 4FUFA 3SNHA 5FKJA 1XRNA 4AG3A 2Z6QA 5INTA 3BMXA 1QQ4A 1JXPA 4HGNA 5LCXA 3GEGA 2R6JA 1HZZA 3HACA 4KRFA 2VG8A 3FWZA 1P3Y1 4Y6GB 1MC5A 4YXWD 4BNDB 1RJEA 3E81A 3CBQA 1XDZA 1O7JA 3DWGA 4JHLA 5MFPA 1K8AD 5EMKA 4DNQA 2QY0B 3KJFA 1BZYA 2XLCA 3VOBA 2ZTYA 5A0TA 3QWCH 1ZWKA 1U3VA 3TZCA 3NHWA 1IBKB 4HB2A 2CXOA 2P62A 2IW1A 3NIDB 3NBXX 5FHRA 1GN9A 3U5TA 3EVAA 1QHFA 1Y3VA 1KVRA 1PYTC 1ZZGA 3AOEA 5IC5A 4K6HA 3HVUA 1U0BB 1Z8GA 2H1UA 4Y2RA 4UU7A 2WYWA 3MPOA 4EO9A 5DW3A 4HI3A 2B36A 2FXVA 3ANYB 1SEVA 3QE0A 2O2IA 4MCJA 2VDUE 3BXXA 4WH6A 1X80B 2BDIA 1LW7A 1O6CA 4QSMA 2HOBA 2DSTA 4REOA 4LNHA 2VDRB 3N7AA 2A4GA 3IBCA 1PSDA 4ZD6A 4MGEA 3IEPA 3JVIA 1EJNA 1TZMA 3WY8A 3O73A 3G0HA 3LA6A 5IKOA 1T24A 1XDWA 2B5VA 3ESXA 2A0KA 3KOZA 4Q0MA 1IQIA 5HGGA 1X70A 2P94A 4GLOA 3WGIA 5JE8A 4O8ZA 1X0XA 3BRQA 2GZHA 3OKCA 1PWZA 3TQTA 2JLVA 3QGNB 1D07A 4LK4A 4X05A 2P0AA 4D2IA 3AMVA 4MYCA 1VGVA 2H1OA 1M1YB 2Y4NA 1GZ6A 3L93A 4RTPA 3PUIA 1K73D 2AVDA 2WAYA 1SU7A 5LQUA 3HN2A 2JIBA 4HGYA 1YZQA 1QNFA 4AB9A 1OLSB 1BDMA 3NZIA 4WJKB 4EHDA 4F4HA 3BSFA 3VPBA 4F8JA 1MC4A 2IGTA 5EERA 4HLUA 1D2NA 3OVMA 1PNRA 2BEWB 3OT1B 5E6UA 5JCJA 3DMDA 4MQEB 2Y1FA 2ZL7A 5HIYA 3NORA 2I2FA 4RI0A 3CEJA 1YJBA 2GNPA 2GHTA 2SKEA 1RBZA 4RD4A 1TGSZ 1P29A 3CBGA 3KSAC 5LQAA 4U0JA 2AMLA 2IW3A 2QM3A 1G6OA 2PMWB 1G98A 2OOSA 5ARCA 3QHPA 1NBEA 5G2OA 5FHTA 6GCHG 2D8AA 2OSVA 4X8UH 1QAOA 2JFZA 4MDFA 1FRZA 1L7NA 4LOHA 2H6EA 1BJUA 1KO4A 1JNXX 2IJD1 4ZMSA 1VCMA 3EA0A 3VU1A 3D4IA 3Q2IA 4DB4A 4LX0A 3UMRA 3VPCA 4NYJQ 4ZJUA 4TMTA 3IDZA 5FOSA 4PPNA 3GR6A 4F9GA 3G5AA 3IUMA 2WIDA 3NBYC 2BFMA 1ZHFA 4GRAA 4MV8A 4OHFA 4LZPA 1UADA 1UHBB 3LYLA 1MRSA 5E8RA 5B30A 4CVNA 2C1EA 5AKJA 1C7JA 3DXZA 2BXTH 4EMBA 3SKXA 1X1QA 1YBWA 4QATA 5GADl 1XKAC 1SZJG 3ZU3A 5BQXA 1JILA 5BN5B 1RTKA 2HA4A 1GKLA 4LBZA 1GOTA 1VSTA 2GX6A 3LDFA 4KWTA 5JALA 3PO1C 2HIMA 4B8ZA 3E3AA 3BGDA 4EX7A 2O59A 4GW3A 2PUJA 5ISMA 5M5BA 1QHRB 1HLDA 5BW4A 3A7TA 2YQ4A 5A0CA 4WZKA 3J81A 2PUBA 4GC9A 3G7SA 3VA7A 2WTMA 5FCDA 2X9VA 3CNRA 4Y1EA 4MI6A 1T0HB 4H0CA 1RXYA 2H7YA 1NVGA 3EE0B 4BFUA 2Y0EA 5I9TA 3EH1A 2HL6A 5GM2A 3BUSA 4E7RG 1XP5A 2OLKA 3QEMA 5F1PA 1SGTA 1B0PA 4W4TA 5E1OA 5JIBA 4U9HS 1ZH8A 4FMCB 2FK7A 2OZKA 3FWPA 2RH4A 1LVHA 1HE2A 3F90A 4X7RA 4DSUA 4M2LA 1XTZA 4GMHA 3OFJA 2PXCA 3Q7TA 3VV2A 3V5NA 4RTKA 4OP7A 4IO1A 4QM6A 2GJKA 3DAGA 2P40A 3EZNA 2AOWA 3TEFA 3AONB 3SGBE 1QP0A 3OWOA 1ZLXA 3RM2H 2GVDC 2HLHA 1YT5A 1Z0IA 1P2BA 1YJWB 3PEFA 1TLLA 1MZDA 1KY2A 2GHQA 2H1SA 4DR7B 2KVOA 2PS3A 2X8WA 5T5QA 3A2NA 3RC7A 3IP1A 1XKLA 3ZNOA 4YCSA 4JJ4A 1OT3A 1JQBA 5A4AA 4G0YA 1QH1A 5AVUA 2Q6KA 4JASB 5EXPA 4X1NU 2XADA 2Q6DA 2P35A 5A5VA 1ELOA 3BGSA 3CD6B 2CD7A 1ZPCA 4XLAA 5L4NA 4HAZA 3L7CA 4ZOEA 4EJSA 1ZI9A 3U7EB 2Q4TA 1LV7A 2XR1A 2VEDA 4NV0A 5BYKA 3A8CA 1RQLA 3GUHA 5F33A 3GVHA 1GPH1 3EVCA 4PRKA 1UTLM 3I1YA 4MRSA 1I2DA 1XKBC 2NUAA 2CJWB 3AL3A 3LG2A 2GYUA 3K1ZA 1W4AA 3PLRA 4QUBA 2Q1UA 1NQOA 3MZ0A 3VC2A 4W9NA 1HE4A 3EUEA 4JI5B 1S2OA 3H5RA 1S5SA 1W85A 3QW4B 3B9FH 3I6IA 1GPLA 1T9DA 1VRWA 1Y1RA 1WV0A 2CHUA 4J29A 3F7OA 4IJMA 1Y8RB 2PGDA 4RPDA 4AK9A 2Y1WA 3F8TA 4PYQA 3HDJA 1GBBA 5CT8A 2ID8A 4H0NA 2AUTA 3PDUA 5AW0A 4UPEA 1ZLRA 2B94A 4P7FA 1XUJA 4K40A 1GCTB 2WFLB 1S0RA 2PUQH 4FUQA 4D8UA 3KQLA 3H5VA 2EQBA 3OQVA 1T4DA 1CG6A 1BRMA 2OTVA 2H4HA 1LLQA 4XX1A 4DBZA 2ZZQA 1Y98A 4IV8A 5E7IA 4FYHA 1H6AA 2P3LA 4G4JA 1ZPZA 1L5WA 2JDIA 1HAOH 4EHIA 1DIGA 3F4KA 3ENQA 1KIFA 4D9IA 2YY7A 4PC3A 4PLZA 4P9NA 4H1WA 4LWQA 1P57B 3CRQA 4XH9B 3LU1A 3RVQA 4ND8B 4BP1A 1ZVVA 1QJ7B 3FOZA 4JK5A 2QT1A 1V8BA 2IPMA 2W98A 4KNVA 1RAGA 2ZIWB 4YAEA 4B6FA 1X1DA 1CQIA 1QFSA 2AYYA 2D4AA 1NDHA 4HQRA 5KQLA 1WU8A 1HGTH 4AZTA 1MEOA 3SU3A 3TLKA 3DQQA 1ENOA 4LGVA 1BMLA 1E9DA 3RFTA 4MLDA 1Y37A 1CT2E 1I2CA 3CUEF 3FYTA 3GA5A 4I3FA 2WYVA 5LMUB 2FEWB 3QQ5A 4QC2A 1OYVA 1DHRA 1YMUA 4P2BA 1P3EA 5FTLA 4RDHA 2ZAGA 1HDRA 3A7XA 1Z68A 1UDXA 5TMEA 3Q3KA 2VVUA 3VR4A 2P6NA 4Q03A 4MUMA 1ZMOA 3I01M 1BXGB 3O47A 2B5OA 4PZEA 2NSLA 2FW6A 1O2ZA 1DC8A 2R62A 7REQB 1L4HA 3M0EA 1PWHA 3O83A 1MTWA 3QVLA 1JALA 5F3RA 3F6PA 4QUAA 3HI4A 3TJNA 4YMLA 5EHXA 1BDJA 3SEFA 4FEYA 1E4OA 3TVDA 2JKHA 1P01A 1UD6A 2XMCA 5MDHA 3QTVH 4Y2GA 5K6TA 3T26A 3NBKA 5K0CA 4N1AA 1XB2A 1E2GA 4I86A 3GLSA 2RI1A 3SIWA 3VAYA 3J7TA 2VIPA 2WR8A 2CCJA 1WZNA 1Z2NX 3H5AA 1EMDA 2AYZA 3DZGA 2PGLA 3W3ZB 5JS7A 4PGHA 4TTTS 5FD8A 5KVCA 3TH2H 4KTVE 3V6LA 1FRVA 4INKA 4D6XA 5E38A 3TW0A 3T12A 4IDCA 4EYQA 1MXFA 1O6GA 2FTKE 3I9V1 2AF4C 3SFZA 2B30A 3P5SA 4M49A 4RU1A 1BA2A 1AD2A 1CZLA 1CC1S 2VHEA 3BKWA 3OLQA 3H99A 4I8JA 1ZCAA 1WKCA 3W94A 3UHOA 2B6NA 1EXWA 3IQZA 3KQVA 1W2HA 2ZPUA 4GZLA 4UZUA 2JFFA 4UAGA 3H4IA 4M1ZA 3DEZA 1L0BA 1ZHHA 4KRXA 4KXNA 1EGMB 3RXFA 3MOSA 1L5HA 4AAYA 3EHEA 4NBRA 2VQEB 3GEDA 3BEFB 1GXSA 3BK7A 3WLNA 2ACVA 4TXJA 4FB5A 3CP2A 2BZ1A 1PDVA 4LXXA 2ZYVX 2VRBA 2YOFA 2ZAMA 4RFVA 1I30A 2O2ZA 3DM9B 4LHZA 4G81A 2C3MA 1DE0A 4DMFA 3NHAA 3F7NA 3OZIA 3Q39A 4FMCF 1UAAA 1NVXQ 2O48X 1AGYA 4FFBA 1EP5A 3JVEA 3TLZA 4D9QA 2QENA 3NPMA 4D8TA 1SXQA 4R3WA 5AVOA 4I99A 1NT4A 3LHFA 3PV5A 1T9CA 4MV1A 2BX4A 1R3UA 3PQ8A 1N6XA 1PK9A 3AI2A 3A70A 3DKVA 3JASA 4AWAA 1VP9A 2REQA 1QF7A 2EWMA 2BVNA 1HT3A 3MBOA 1B6TA 1EFVB 4J03A 1Y80A 4IC6A 3P0HA 4XNFA 3FDXA 2AZ4A 2A4QA 4YDHB 1UMCA 4B4UA 1OKKD 4DABA 1TUIA 3VHXA 2WA1A 3AY3A 3IAAA 3SEJA 3F9IA 4DPLA 4JA0A 1Q82D 4ZT4A 1QFXA 4YO9A 4E5YA 1UVTH 1D2HA 3EDMA 2UUAB 2WZQA 1QQTA 4LXIA 5CG1A 5A1TA 1WKVA 1CR0A 5JNRA 2CMKA 5DHRA 4H60A 3SUDA 2BEVA 1VQNB 5BSXA 4RKJB 4FW9A 1XHEA 5HJEA 3ASPA 2ABWA 4CRFA 2Q0XA 2WHYA 4IDFA 5JISA 1M2EA 1JBUH 5LSAA 4WESB 1V43A 3V3TA 1YULA 3BTVA 4Z0KA 3L06A 4DV1B 4OXKA 4RD1A 3O8RA 3K0FA 1F5LA 2X0JA 1VJSA 1DU4A 3CV3A 4XLFA 3TAXA 3SV8A 4KKUA 1KDYA 4RTQA 3N2IA 4ILKA 2L69A 2BMGB 5DP5A 4K1XA 5CLGA 3KSMA 2WE8A 2WIGA 2PO7A 4DQUA 1U6IA 3OE4A 3NM5A 3AHDA 3ZY5A 4GXQA 4E22A 3NTOA 2Q5EA 2WTXA 2ZIZA 1A0LA 5DSFA 2ZU3A 4JUBA 2P9HA 2BFNA 2QDKA 2VK1A 3QXCA 4I32A 1U8TA 2C96A 4YDQA 3IITA 2Q5JA 2QW1A 4RV5A 1NDQA 3SQXA 1CB0A 1HAZB 2VJDA 1OTXA 1UXIA 1ZNZA 1ZOLA 1K06A 1A72A 4HYEA 4BV9A 1ZZEA 4R1MA 2EW8A 1ETUA 5TIIA 4EUKA 4UBJA 5JBQA 4OQ4A 3R77A 4QFDA 4AC9A 3CCQB 2XTMA 3ESTA 1LHCH 2XT9A 4J2TA 3FTFA 3UOWA 2EEPA 1UQRA 4Y8XA 3EZ9A 3GNLA 4HQOA 1KDZA 3UYLA 3V4PB 2ZUBA 2RHTA 3TBHA 1UK9A 2H5CA 1QGAA 3CVJA 5HKKA 1V37A 4PAMA 3QQPA 3FA2A 1DDGA 1RWNA 4PG4A 1DMSA 2D62A 1N2CE 2I91A 2NAFA 1SRRA 3CA8A 1O0DH 3EXAA 5A8XA 4OCZA 4AFQA 5T7BA 1SELA 3HNPA 4RULA 4FJ1A 3RY8A 1O3NA 4HDSA 4ZQBA 2R84A 1YZ3A 3G2LA 5CA1A 2XGOA 3SS8A 2VUUA 2BPOA 3CUYA 2PSDA 4ZI5A 3RMLH 3U26A 4OGWA 1T3TA 1TI7A 2LIVA 4GAWA 3UMCA 1CRZA 3M5NA 3GPIA 1NMXA 1R0XA 2PEYA 1KOJA 1QOPB 2A92A 4GMXA 4B8YA 3CMEB 3GB9A 5IEJA 1KFBB 1JQKA 3W2IA 2Z4SA 4J0CA 3RU4E 1PZGA 1TK3A 1CSOE 1TTHA 4PZ9A 5M04A 1MKWH 1SHJA 3NOQA 2F1OA 3EIUA 2VDNB 1GJRA 5BY2A 2TPIZ 4X1QU 3ZWOA 4PC1A 1C0KA 3QKSB 2QRJA 1KLTA 1T4CB 2BHRA 1MDBA 1B42A 4PYRA 1GQFA 5IVKA 4BRWA 3SQWA 4KQFA 3KWFA 2CK3D 2PD4A 2WM9B 4ZT6A 1CP3A 4NG4A 4R40A 2AYXA 5CLIA 2PRKA 2KM1A 1U9ZA 4P3NA 2M1XA 4CNQA 4KXMA 3AR7A 2KI5A 1K9VF 1Z13A 2V3WA 3VR5H 5JAQA 1YB7A 3GUCA 3A2MA 1FIWA 3AF6A 1MAUA 3JARA 4FC6A 5GDSH 4YR7A 4GC5A 4N49A 5FEUA 1FFWA 2ISCA 4BTLA 4EFMA 2ONJA 3F9EA 3U31A 1NRRH 5FQOA 4RK4A 1P8VC 1PPEE 2AG1A 2B8OH 1ECPA 1KZGB 3N7EA 1W581 4GOOD 2R3YA 3EARA 3M4YA 5EOKA 2FN7A 5G1NA 4MMZB 4TRNA 4AQ7A 1ZD8A 3FCOA 5JH7A 3TVYA 2D5IA 5DP8A 2E55A 1Z2CA 2Y7XA 2Y5GA 1P5ZB 3F6YA 1XT6A 2YBEA 3HJBA 2PGNA 1NUHA 2LUOA 5JPCA 2X14A 4BNWA 3SF8B 3E1YE 1LWNA 5SYAA 2Z8YM 4XOTA 2K0QA 4ZXPA 1R4AA 3KJGA 5G4KA 5THKA 4CHAC 1WZ2A 2PV0A 5DI9A 1Q92A 4ALMA 1COWA 2QSUA 2JGIA 5TR9A 4KNYA 1GZSA 1Z0JA 4F92B 5HIZA 5FL7A 4KTTE 4OAOA 5C46F 3L6DA 1QGYA 3LX6A 4MDHA 3U7RA 4DVAU 2DYIA 3JQ9C 4AN0A 3CJRA 3HB5X 2VPYA 1NP6A 3PLNA 5I25A 4WKGA 3E7XA 1KU6A 3KLOA 4JIMA 3K9XB 2AE1A 3P9CA 3MWJA 5EJ9A 1GBTA 2Y5HA 1IZ0A 2DFTA 4BO0A 4TYNA 5CA0B 2GV7A 5EIXA 1JDPA 4LXQA 4MW4A 5FP0A 4PSKA 4H15A 2Y1EA 1T8TA 2ZIXA 1ODFA 3KSUA 3KVVA 2A57A 2CHGA 2H54A 4HH0A 1RRMA 4BLOA 5I7VA 2EU8A 4YLYA 1XLTA 3ICPA 4QUKA 3WK5A 3HZRA 4V02A 4ZHQB 1T9HA 1IN7A 3KKZA 1FQKA 5F53A 2PVPA 2ETXA 4JYUH 2GF0A 1N2SA 3HJCA 3TJUA 1FUUA 1XL1A 4FS8A 3KFVA 4YRCA 1BQEA 4NCHA 4IMQA 5HOQA 2OCVB 3A6FA 3EA7A 5DWVA 4ABBA 1V7QA 4PCVA 5JS8A 2CNOA 3WK6A 2JGFA 3T51B 3BRWD 1N6YA 4ND5A 2V8BA 3K0BA 4AJ9A 4MNTA 3N86A 2VPTA 3U49A 4RZUA 4I8DA 4GBED 3B1VA 2LV8A 4XOJA 2P2DA 2ZS8A 3H65A 2BM8A 2VP9A 3AEQB 1FDTA 2X58A 1FA9A 1TMOA 4I4TB 1ONOA 5EIEA 2C4TA 4NYIQ 4TOIA 1DPFA 2J41A 2H0AA 2O8WA 5AHWA 2DPYA 1E79D 3G4SB 4KTSA 3CN7A 3FGPA 3WGNA 5HCIA 4BVLA 4YN3A 2B7DH 5DRTA 1HKUA 1DAFA 4IFIA 4L0CA 1XMVA 2HU5A 3UT0A 4UU0A 1OP8A 1Y4DE 4M7WA 2ZTVA 4MVJD 4OK6A 5F1YA 1G2QA 1JLLA 3RXPA 3I05A 2OD2A 3CIFA 2B1QA 1I6MA 2PL9A 4CFYA 4BNYA 4R4JA 3PGMA 2FS8A 1Z29A 1D6MA 3IJRA 3ZYCA 4M36A 4DLYA 3VU0A 4TRRA 4UM8B 2VFAA 3HB7A 1XPJA 5AR1A 4BZXA 2H3EA 3ZBQA 4BNTA 3UCEA 3STJA 2Z6VA 2RGEA 3H5LA 4K3UA 4EYGA 2QA4B 4YMGA 3V4RA 5BQPA 2FUEA 1EDBA 1BE6A 2OAQ1 4IYJA 1C9NA 3TD9A 1BN7A 3NKFA 3LYHA 2PVSA 3BTGE 4HBZA 3IVGA 2ZCVA 2HBYA 3SYTA 3ZOZA 2POQX 5A2GA 2A6PA 4HJXA 2F9BH 2I4NA 4P35A 1LDBA 2QUIA 2FGKA 3HJFA 5EKXA 3F7TA 3AUUA 3CZ5A 3JZDA 1BRAA 4JKYA 4G5HA 5GTDA 2RGAA 2FZZA 4AJLA 2FOFA 5HTOA 4V1CA 3DW1X 2I54A 3BE4A 4R9NA 3AR8A 2HDWA 3BAZA 1J1UA 2LTAA 2BY8X 3P6ZB 4OQMA 1NRNH 4UFDH 1W4BA 1XALA 5TRTA 2PW8H 3HHPA 2F1RA 1PLKA 1M66A 1H3NA 1Q84A 2BZGA 5K6AA 1AGRA 1RKQA 2ZXHA 1V1MB 5I4KA 2QLFA 3FYSA 4RS3A 4OUKX 3MNFA 1U3DA 4WFQA 3WL7A 1LQEA 1FP1D 3CVVA 1BFUA 3NG1A 3RLIA 3ZVGA 3ZDXB 5DXJA 3DLCA 3TL6A 3RSGA 1Z7YA 4E5SA 1LPMA 4YOIA 3K72B 4TXHA 4DXAA 1AA6A 1CY0A 4XUDA 4ZALA 2PWXA 2A1UB 5HYOA 2QTAA 1DUEA 4D43A 1ZYOA 3ZG6A 1FS6A 1PFGA 3QWHA 4GHQA 2NQTA 1W2KH 3HWWA 4F4CA 3EAQA 4RXUA 2N47A 5FULA 1WOMA 1CHOF 3K92A 1PNOA 1XELA 4CBVA 2ZVQX 1OTHA 1QH9A 1WBDA 1D5CA 4B4WA 2BOHB 3TOCA 3R5SA 3BHNA 3G2KA 5EQSA 4LHYA 1E2LA 5IYPA 2ZHEH 3ZZ0A 1U98A 3P45A 2C54A 4G36A 2B0CA 1T1IA 4XX0B 3UB0A 4DCPA 1SVNA 5JNTA 3BC9A 1WOYA 3BE5A 2FIRH 4BE4A 3X2EA 1J0AA 5H1YA 4UE7H 4FPXA 4NDZA 3QU7A 3HC7A 4D1YA 3T38A 2WWIA 2LBPA 3X43A 2YTZA 1WQSA 3UAZA 3O21A 3WGVA 4UMDA 2UAGA 4B3DA 2H5JA 5CYPA 5AN9A 3RGWS 3KEGA 4N7MA 1BZXE 3DL2A 2VLBA 4LHEA 1VXRA 3CCVB 4M9ZA 5JWRA 4NFYA 1EJBA 1IVNA 4K6MA 2B8WA 1GAEO 3Q2OA 5F12A 3SOSA 1MP0A 2B21A 3U80A 5ADUS 3LGAA 1DKLA 3U3RA 1ESTA 3BIVH 4DAOA 2C0QA 1XCJA 4ZHQF 3QPVA 1LPPA 2HMWA 4AF6A 4FLFA 1LRKA 2FI1A 3IUEA 4RY9A 3A3NA 4LZAA 2ZUVA 4QOIA 1J99A 3GJRA 4CUZA 5TMDA 1ZGVA 3O9MA 4QOJA 1HJ8A 2WV9A 1IH8A 1WP6A 4N3GA 3VNVA 1OT5A 5KVAA 5BV0A 1H42A 2ZPRA 2XYPA 3TNLA 5JC1A 2HYDA 4JXZA 4MYTA 2DVMA 1NC3A 1YK1A 2DPXA 2CGEA 3GLFE 1ORWA 1CA0B 4V39A 3DEJA 1ANKA 4MRAA 1THZA 1F8GA 3SU8A 4D82A 3K5IA 3IEUA 5F4MA 2WKQA 1MTOA 3PFIA 4EYSA 3R3VA 1O2PA 4AXBA 1XDDA 1PDOA 3FYDA 1P73A 2PYIA 1WUJS 4EHLA 1KZ7B 4KI7A 1H9CA 5IARA 1GG6B 2JAHA 4KEAA 1DPGA 2AMDA 1HAVB 4I4TF 2XWAA 2D13A 2R5WA 4QLAA 4H7HA 2IIVA 3GHHA 5E6TA 4JL8A 3G2MA 4FU0A 3VR4H 3RVKA 5KTMA 3D6VA 2VN8A 4R9UC 1D8AA 4P1ZA 3T5TA 2BY6X 3EEYA 1NR7A 5KNDA 2Z9IA 4HYTA 3UNSA 1A8UA 4M22A 5FFMA 1PJQA 4LJKA 1TFUA 2QMZA 3KP1A 4WZBA 4JI8B 4RTNA 3S69A 1MQSA 2OXRA 2VPQA 2IYSA 3ZLJA 2EI8A 1LX7A 3LQYA 2BGNA 5CLFA 2ZSBA 3G05A 1AZSC 2HRQA 2E4YA 2VNSA 2AXQA 1KZ1A 5DLYA 3RSLA 3ZDBA 2O2EA 3PHBE 3IPLA 5DHQA 3G2PA 1Q6ZA 1IM8A 1W0KD 3IV6A 1O2KA 5ESBA 2Z9JA 1OI3A 1X1CA 2QDXA 2JS7A 3F73A 2O0JA 1BS2A 1ZCJA 3T4XA 4AQYB 1JDJA 2PUVA 2DQYA 3S44A 1QO0A 2C4HA 1EAMA 3THYA 2CEAA 4E30A 3ONYA 1AKEA 4IIYA 3FYUC 2ZZNA 1N9KA 4PX9A 1YJXA 2V5UA 4EGAA 2OGSA 3HYTA 5KOJB 2XOKD 3U5ZB 2MSKA 4GD3Q 3O8NA 5EP2A 2V6IA 1O0CA 4GVUA 1UC8A 3VXEH 1XL0A 3K1AA 4RYLA 3KJHA 5DK1A 1EZUC 4RTOA 1XJ5A 4RSMA 4A0FA 1A7SA 2HRBA 3IILA 2Q9UA 4RHCA 2KR7A 4KE8A 2Y81A 1I0IA 1PU2A 5JARA 4I8XA 4QYTA 4XGQA 5E9QA 2YWCA 2RDMA 5LLDA 1U1EA 3L8ZA 2ZL5A 2PDAA 4YFYA 2HLDA 2GBGA 2BIFA 5L46A 5BQOA 1C0IA 3V3KA 5J4SA 2P9YA 4S1PA 1XCBA 2GN0A 4GOLD 2VAPA 2HMAA 4BO8A 1YKSA 2I55A 1TF7A 3L82B 2ZGVA 3UHFA 4BMOB 5HHTA 1EUZA 1DADA 3JALA 5F2KA 3CM0A 2IYPA 3N76A 3RWBA 2BI8A 1AVWA 1IU9A 1IVSA 1FMJA 3HCFA 1AKNA 3GFPA 3PQ5A 5CDFA 1XMIA 3GLIA 3QO6A 1XX9A 1FYXA 1UKVY 2W2MA 2UUOA 2WD7B 3ZGOA 1DKMA 2QN3A 3FGNA 4W8HA 2RONA 1P33A 5KDDA 2PZJA 5K3FA 5FTMA 4X20B 3SE7A 2FPOA 1HV8A 3ZV8A 4ZDIA 3ANMA 4Q4JB 4J2OA 1JQ3A 4N8SA 2COEA 3NEAA 4F1WA 4JP2A 4H7JA 2A7HA 1PX2A 1YIAA 1TRYA 1Z7KA 2RHJA 2ODTX 1X39A 5GONB 5IDXA 1HE3A 1YBVA 1FQOA 5JSKA 4MS3A 4WMLA 1GCGA 4H6XA 5C2ZA 3A4IA 3CX7A 1X86B 4ESHA 3ZWXA 2Q99A 1AX9A 2XWBF 5GWXA 1L7EA 2HSJA 3KEOA 4G2TA 1CBUA 1ZD1A 1JHPA 4PHFA 2Z43A 3WYCA 1QP7A 3D8SA 2EIHA 3G8CA 5IDQA 3EVNA 2C7VA 4GNRA 2IYRA 5EE0A 5GIBA 2OV4A 4KMMA 4M37A 3HB4X 3SJKA 3LX8A 2BDBA 5JXJA 3MILA 6CHAB 4W9NC 3GICB 1C0EA 3OQPA 4K9SA 3AYZB 5J35A 3KU1A 1R7RA 3O82A 5KCMA 3ODFA 4CLHA 2FPPB 3PJRA 2BFFA 2XD9A 3AR6A 3EQ6A 1Q9SA 5EKDA 1YFJA 5E95A 5TLSA 4YK7A 2D7DA 2QVZX 1M8KA 4XIIA 1AB9C 1QIMA 2A78A 4MO2A 3KLPX 1GBDA 2G6TA 5KYGA 5AW6A 1P4JA 1X7XB 4GO1A 4GI3A 2FOHA 4UDYX 2Q6GA 1SUBA 3RXHA 4OM8A 5BW5A 1SQAA 4XA8A 5A6SA 3JTMA