4ACBA

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
469
structure length
448
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEITIDIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSLATION ELONGATION FACTOR SELB
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
total genus 97
structure length 448
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acbA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acbA01
3ADDA 3PEUA 3SOPA 3ADBA 4QHYA 3IKJA 3TVDA 1FX0A 4KFTA 1M6NA 3L0SA 1JB9A 1YRAA 4GOJA 4OI2A 1KSFX 1QGZA 1Y63A 4PHHA 2ZROA 3ZVRA 2GVDC 1JR3E 3ICQB 2YOGA 5JSZA 2FGKA 4BZPA 5HCIA 1TQ2A 1Z2AA 2QPOA 4HB2A 4WXPA 4B48A 1KI4A 2DHRA 3CZQA 4BFUA 1W7AA 2QEQA 2B21A 4FMCB 3D8BA 1HH4A 3L8YA 2DB3A 1CTQA 1DARA 5E95A 5C4MA 2WJGA 1PLJA 1W36D 3ICEA 1CRPA 5FUXA 3LVRE 3P1JA 4ACBA 2IYZA 1KDRA 4BEBA 2BMJA 1FL9A 4LV6A 4B71A 2EWVA 1UBEA 4QL3A 3QFTA 3U3OA 4W7SA 2CE2X 5E7JA 4C0JA 2VBCA 2PEZA 4KFSA 3MSXA 4F4IA 3KKOA 4URWR 4D4KA 2C8VA 4HUTA 3BK7A 3GLFA 4ESVA 4ZKEA 1F20A 2O0HA 4PFSA 5HZHA 2F55A 1NLFA 1QHNA 3PEVA 4UXIA 5AUQA 1VYUA 2PT5A 3MFYA 4LYFA 4C3ZA 3CF2A 3SI7A 2BBWA 2ZVQX 4B47A 5FI1B 1ODFA 2QPTA 3JVUA 4CYMA 1IAQA 2ZI7A 3E1SA 3NBXX 3WHKA 2QL6A 2F9MA 3F8TA 2IA5A 2VLIA 3GQBA 4Q01A 2A7QA 2XJ4A 1GM5A 1G4UR 3P32A 3HU3A 3RANA 2RGNA 1NJFA 2H8KA 1AMOA 4NCNA 4DSUA 4B2PA 2JJ2A 5CDFE 1Z6XA 3SJCA 1JBKA 2ASEA 4DHEA 1AKEA 4HUQB 4NCIA 2IWHA 2OHFA 2ZRKA 3WP0A 2HT1A 4OL0A 1E9AA 1OHHD 1F2UB 4GI7A 4PSAA 3THWB 5JEEA 1D9ZA 1RJ9A 3VMFA 2ZRJA 2ZRIA 4ZV4A 2WJVA 2BVNA 4U5XA 4DEXA 1NVVR 4QM7A 2A78A 3GJ7A 5P21A 2OSBA 4KVAA 1MR3F 4KAXA 1E96A 1Q22A 3I5XA 1IN8A 3CPHA 2GESA 3EA5A 3ZQJA 2BGJA 1GRQA 2CVFA 5H8WA 1RIFA 2P67A 4U9UA 5B58C 3EASA 3HR7A 2DCUA 1KGDA 1Z0IA 2QA4B 1CP2A 3QNUA 4LBVA 4XD7D 2C03A 3HWSA 1N5LA 4PC3A 4A4DA 4Q1CA 2PL3A 2IUSA 4LYHA 4B35A 5K8TA 1W35A 3EG5A 5LPNA 1GKYA 1ONBA 2QPAA 1FTNA 2OG2A 3KXLA 1QHHA 3T1QA 2ZYWX 1E2MA 1WB9A 4CEHB 3QF7A 5KDLA 4MUAA 4D80A 4K81B 4BUJA 3P27A 2J45A 4M9QA 5L3SB 2CMKA 3QFSA 3C8UA 4RD0A 2FEMA 3QEOA 3K0AB 2BHRA 3CMEB 2ZJOA 1KK3A 3FPAA 4ON9A 4B6FA 5DHFA 3H1TA 3AEZA 3BOSA 2VSOA 4LHXA 5FOUA 1WE2A 2O5VA 4EFMA 1TVCA 1W4CA 4JZKA 5LDDC 4ABYA 2W00A 2HCJB 2VNJA 3EIQA 4ITRC 5KPJA 4BZXA 1YZKA 3SDZA 1E9FA 2GBLA 4LGMA 4DRZA 1BX1A 2FG5A 2I1QA 3WMFA 3KUCA 2OBMA 3FMFA 5EJEA 4DCTA 2G6BA 1N8RD 1VMAA 1K9MD 3LH5A 4X8OA 2W2TA 1E4YA 1QHYA 3KQHA 2IYLD 4B2LA 1YZNA 1MABB 2OAQ1 3BB4A 5FL7A 2VNKA 1OT3A 2N42A 3IPXA 3W5JA 2ZRNA 4A8JA 4V0OA 1SM4A 2CK3A 1VQ4B 1KOFA 1QF9A 3NXSA 4Q21A 4RFVA 2GJ8A 2GRJA 3BH7A 4RZUA 2BEJA 1PZNA 1QG0A 2XOKD 4TLBA 5A4JA 2GZAA 3IO3A 3U2QA 1H8ED 4O0MA 3SEAA 2HYDA 5EXXA 2AFHE 1G9XA 3QPWA 3AP3A 4NYJR 1XCMA 2O8DA 2IK8A 2Q9CA 2AHOA 2AX4A 3TQCA 1EX7A 1S0UA 2H17A 4L9SA 1AJEA 4AKHA 2BPOA 2W0SA 3QXJA 1CR1A 4IVQA 2OK7A 2GXAA 4C4PA 2XSZD 4N1AA 5BN5A 2NPFA 3JZMA 3GLGB 3CRQA 4B4DA 1Z29A 1GL7A 2C9OA 4ZKDA 4R2HA 3CWZA 4S2EA 2EFEB 2OO7A 5IK2D 1PLKA 3O47A 4KSBA 2FOLA 2RHMA 2FU5C 2O8EA 3QKTA 1TQ4A 4PAMA 1VCMA 1E69A 3GLIB 1Q86D 3ZVNA 1YR8A 3MWJA 1XZPA 2W6IA 2CL0X 3PUWA 2VF7A 2YWHA 3NC0C 3RS2A 1TU4A 3C7KA 3QXXA 5DN6D 2YZ2A 1L7VC 2BC9A 4NYIR 4TT3D 1G17A 3W6PA 1KO5A 1N6LA 2YNMA 2QI9C 1P3JA 4CEJB 3U6KA 4ZDIA 2WKPA 2ZAMA 3CPWB 1OYYA 4NKRA 3NC1C 1NKTA 4AF6A 2R9VA 4TTPA 1S2MA 3LW7A 3DVLA 3AVUA 4C0SA 4Q4AB 2QBYA 3CCMB 4MYCA 3AP2A 1L4UA 1BMFA 2GEUA 2D7DA 3FYHA 3EX7C 5SZJA 2EYUA 1KJWA 2CRVA 1SXJD 1UFQA 3OIUA 3WYFA 2QN6A 1K8AD 1ESMA 2C77A 1G16A 3HR8A 2OBLA 1YJ9B 3K0FB 3CCUB 2RGEA 3E1YE 1WDTA 4BGDA 2ZTSA 2BCGY 1QH0A 2EVWX 4C0LA 1NNEA 4W5JA 4JLOA 4LJAA 4BQSA 3SE0A 5DHAA 3CCRB 1KKLA 2NIPA 5J47A 4Q19A 1N6KA 3CX6A 1NKSA 3GFOA 2FV8A 4P3YA 2UZIR 3K9NA 3ZIAD 5KO2A 4RKFA 3GD7A 2MSEB 3I5YA 2PCJA 3KKNA 3W3AA 2J0VA 2IS2A 3BFXA 1KTVA 1XP8A 3F0TA 1YZGA 1JECA 3CRMA 4LDJA 1T0JB 1TEVA 1EFRD 4Q5IA 1PVOA 1WA5A 5KTYA 2BGIA 1P2TA 3L0OA 4KJZA 4YXWA 5FTNA 4HLUC 3ZLJA 3KJIA 4M9XA 4G5GA 3C16C 4HAZA 2YV5A 4JBWA 4P33A 1RRFA 4D0LB 1BJKA 2WWXA 3OEHA 4JL8A 2Z4SA 1PUIA 2ZE5A 4DIDA 2BDTA 4L16A 1N5JA 2ZSEA 3GJ0A 2VYFA 2X77A 4KV9A 2PCLA 4BRWA 2Z0MA 5JCZA 2VO1A 1F48A 4IDQA 4AD8A 3I73A 3EPKA 2WWYA 4NP6A 4EFNA 1KDTA 3LBHA 1FTSA 2QTFA 1J8YF 4Q18A 1NSTA 2DYKA 4QBGB 2BMFA 4AKEA 1E64A 3MWLA 1E2LA 3CRRA 1ZVQA 4XSGA 1T3SA 1W36B 4II7A 1E2GA 4AK9A 2X3UA 4OQLA 1GVHA 2Q9AA 4LJ9A 1AS2A 1MRSA 3QXSA 1GNQA 1EXMA 3CO5A 4ZGQB 3UWKA 3RC3A 2IYXA 3F5FA 4XVQA 2XXAA 4D4JA 5L3VA 3KQLA 1RYHA 1KNQA 5EXTA 2PMDA 1ESNA 1SKYE 3LW8A 5HZKA 4R9UC 2BF4A 2ODBA 1AZSC 4B3BA 1FQJA 5IRCD 1XXHE 2MMGA 3VKWA 2OTJB 1N6PA 2VNHA 2CL6X 1G8GA 2HXSA 6Q21A 1BS1A 3VR3A 3AKEA 4IDPA 2NO7A 2OEPA 4WZAE 4D0NA 4ZCLA 4I99A 3PEYA 1KO1A 4O2RA 5AUNB 2Y8EA 1W0JA 2D2EA 1QUEA 3VAAA 2J0UB 3TBKA 2JGNA 2IBMA 1Z06A 4YALA 1EWRA 2ZE8A 3OAAA 4TSFA 1IY1A 2VP0A 4NYJQ 3VU9B 3X1WA 1D5CA 1V5WA 4DLXA 3NTUA 5JHHB 2REOA 2F1HA 4D0GA 1P75A 4PXAA 2WPDD 1J90A 3Q5DA 2RB4A 1CR2A 4BZQA 1HYQA 3QJYA 4GOXA 3FKQA 3FPKA 1NBMA 1ZBDA 2NG1A 2IS1A 2W83A 2YJTD 4Q1FA 1GVNB 4JKYA 1RC8A 3TR5A 2WAXA 1ZM7A 4M1MA 4DBLC 2XTMA 3SHWA 2GXUA 3OF5A 2GPJA 3B1XA 4KBFA 1U2RA 4A6XA 4KYUA 4R2IA 1PJRA 1EWYA 2QT1A 2CLDX 3ZH9B 1W0KD 2D06A 4NYIQ 4RD3A 1NY6A 4LJ5A 1VQ5B 1KSGA 2ONJA 2PZEA 1T3HA 4TLEA 3RS3A 2VSXA 3EARA 2HMAA 3IQXA 3ADKA 3W34A 1FNBA 1DBSA 2XB2A 4K1XA 1HT1E 1C9KA 5DYIA 5JWHA 2LP6A 4CZ2A 3ZQ6A 1P72A 1AGRA 1YZQA 4RY2A 5BWMA 1XD2B 4B32A 3RRMA 2KBEA 1LB1B 2JLWA 1JR6A 3CW2A 2WOOA 2I1VB 4KI0A 1XPRA 4HAVA 2JEOA 3OEEA 5FOVA 1QG4A 4V0LA 1IJEA 3MAAC 1QVGB 4MRSA 2A9KA 3DKVA 1GTVA 1SVIA 3PXGA 2HEIA 4Y9RA 4GDFA 1A4RA 3MGCA 3SQXA 2XZLA 2IYRA 2GHIA 4FMDF 3OESA 4LJ8A 4YMTA 3MRSA 3IBGA 4QBFA 4KHZA 3BXZA 2BJVA 4UJ3A 4CGZA 1YIJB 4XWAA 5LB2A 4B33A 4F93B 3WNCA 3MD0A 4M22A 2QE7A 3BS4A 3AVPA 4UJ5A 1AIPA 2P6RA 1MKYA 3TVTA 2ZSDA 2QQEA 2W0MA 2R2AA 1UAAA 1AM4D 2JATA 2LKDA 3OZXA 3QIAA 4Q7LA 2OCAA 3AM1A 4URUR 1O87A 2ZRPA 2EFGA 5DISB 1JXMA 5DLQC 1QFJA 3ZJYA 3QVUA 4RZXA 1R0XA 2RHDA 3GJ6A 4CDGA 5JBQA 3U7FB 4DZZA 1ZD8A 4HE6A 2QMUA 4UKDA 1G7CA 4DQKA 3IILA 4LPSA 4Q66C 1GNRA 2NO9A 2C78A 1M7BA 2AK2A 2NO1A 3EWAA 4WZ6A 3EZ9A 3QF4A 1T5LA 1DAKA 2ZSBA 4R98A 4PQYA 1FP7A 2Q3MA 2WHXA 1KRHA 1YITB 3WNDA 4E09A 2O8FB 4KFUA 1DPFA 1ZRHA 5H1YA 1XPUA 1JR3D 3BC1A 3MWKA 4QHTA 5SZKB 5F98A 3DHWC 5EUQB 4O2LA 1OB2A 1Z5ZA 1X3SA 1VQOB 1E62A 3CBQA 1ANKA 3SFZA 1G3RA 2H92A 4FMBB 2Q3FA 4L5BA 2WSMA 1WRBA 721PA 2ZIAA 2CCJA 2DWQA 3VR6A 1W4RA 2A5YB 4B34A 2EWWA 5DNYB 4WVFA 3SS8A 4CT4B 4YONB 3M0EA 4LBWA 1Z3IX 2JJ1A 4QNRA 2VNIA 1IY0A 3ECCA 2WICA 3K0SA 1CKEA 3PITA 1KMQA 3TJZA 1JXOA 4IW3B 3KTAB 4YQFA 3U3MA 3V00A 3T61A 4G5OA 2OE2A 3EZFA 4Q47A 4P4SB 1E79D 5AUOB 2ZR7A 1F5NA 1SXJB 1Q3TA 1N0UA 3B1WA 3EZ6A 4OQFA 2FF7A 3ASZA 5J5CA 4BLTA 4TT3A 3T1TA 3GFPA 4U7DA 2FFAA 1SVWA 1JPJA 3W2EA 3DOEA 4PO1A 4AF7A 4BLOA 3V4FA 3K9HA 4YMVA 1A2BA 1W49A 1ZNWA 2GTPA 4TQUS 3K0CC 2YWFA 4QC2A 4AYTA 3LBNA 5JS8A 1G291 2VF8A 1W87A 4ZPXA 4Y7CA 4ASUD 5KNCA 3BFKA 1J2JA 4D25A 3EWSA 1YZUA 2W2XA 3DMNA 4OJQA 2FN4A 4J0QA 1AK2A 2IL1A 2OM2A 1VQNB 3T15A 3QE2A 2QDXA 1R6BX 4RD2A 1EP1B 3FKSA 3W2IA 4OHZA 1I4LD 2ZJ2A 2BBSA 4Q4HA 2P3SA 4IXMA 2FWRA 4N0EA 1Q1ZA 1KI7A 1IJFA 1H85A 1E2QA 2FGJA 1W48A 4MRVA 5BQ5A 1TPZA 2PZFA 1Q21A 4TLAA 3DO6A 4KO8A 1P60A 2EW1A 4V03A 5JEDA 1XMIA 1DOAA 3SBEA 4DCSA 1IN4A 3QG5A 4Q9LA 4Z1MA 4F7WA 1YHNA 5CK5A 5FR2A 3K9GA 2BCJQ 3B60A 5AJWA 4LHYA 2QTHA 3CX8A 4ERNA 4XWKA 1OGJA 2GCPA 3DEFA 4OI4A 1SKQA 4I1UA 2D2FA 3W5VA 4MGIR 3UIEA 2BV3A 1XFAA 5JMTA 1S9DA 1UM8A 5J4VA 2ZI4A 1YQTA 1Q1EA 2WBLC 5KDDA 4TYPA 5G41A 1E98A 1II9A 3CNOA 4QGHA 1S3GA 1D2NA 1OPXA 3KKQA 3T5GA 2ZEJA 1CQXA 2IT1A 3BAFA 4PX9A 4LWZA 1GITA 2IF2A 4V02A 5BYJA 4MDFA 2FPMA 3J81k 3OE7D 3ZBTA 3NG1A 3PENA 2DR3A 5C4GB 1XTKA 2QG6A 3UKDA 2FFBA 5G53C 1UBCA 3KFVA 2VPPA 2ZYTX 4URXR 3AKDA 2GNOA 1NF3A 4LYJA 4MRRA 4AY2A 1TL7C 3ZS9A 3W5IA 5FTMA 2PEYA 3ZDQA 3I62A 1FFHA 2P0EA 3FDIA 4V0NA 1W36C 4OHYA 4KSCA 2VTKA 1IXSB 3OIWA 4FMCF 1AA9A 2F43B 1UDWA 3NHAA 4A0RA 4IEIA 4IFEA 1RW4A 4HB0A 3SJAA 1IONA 3BJIC 1OXSC 1IXRC 3MJHA 1EFTA 1VQLB 2WJIA 2FH5B 1XCGB 4K46A 4C2TA 5E3HA 2HYIC 2QUZA 1G3UA 1E4VA 1ZC4A 2Q21A 3KXKA 5BN4A 1NG9A 2XNSA 2FSGA 5HXBA 1Z08A 3GLFE 5E7IA 1DTSA 4JVMA 2CJWB 2ZUDA 1II8B 4UNNA 4DUGD 4IXNA 1A5TA 2G3YA 4WA7A 3FOZA 1H8HD 1Q57A 1R7RA 4P6VF 3TW4A 4TMZA 2A5DA 4RVCA 3C15C 621PA 2V9PA 1Q20A 2WWGA 4XTCS 1DELA 2ZANA 3K53A 1CIPA 4DLVA 2H57A 4NL4H 5KSPA 3RAPR 4DC9A 5B30A 1K73D 5L3RA 2ZREA 4Q9IA 5EMNA 3AF0A 4HLUA 1CXZA 3QXHA 1D1NA 2CXXA 4NTZA 5CB8A 1D8TA 2GJ9A 1HURA 1E2FA 5SZIA 4B73A 4FCVA 2IUTA 5JSZB 2MMCA 3TAUA 2CNWA 4HZUB 4E03A 3EA0A 2KSQA 3CCQB 1J70A 4B44A 2CDNA 1QVRA 1S1CA 5UKDA 1S1MA 3FJOA 2QENA 3GJ3A 4Q7KA 2Z6VA 2JIZD 5DIFA 4EFLA 1H65A 1ZAKA 5JI2E 3QKSB 4EUNA 2WV9A 2N1BA 1KK0A 3OJWA 2BM1A 5E7MA 4BFXA 1G7SA 2AWNA 4M9ZA 3U4QB 1JPNA 1E94E 2CLSA 2JLZA 1W2BB 3VKGA 2OESA 2GXSA 4RZ3A 2JA1A 3QSYA 3GFTA 1M7GA 1DAIA 3R9XA 1MO3A 2WJHA 3CMAB 1C4OA 1LV7A 4DLZA 3IO5A 1FUKA 1VG0B 1E2IA 3BWDD 4HATA 2HV8A 5CJPA 3THYB 1ZUHA 1TAGA 1HEIA 1IBRA 1LTQA 2JLUA 4B74A 3AVOA 4PO9A 1SQ5A 3F3YA 1Z47A 1FDRA 3I55B 1NVUQ 2R44A 4PZLA 1AQYA 4JLBA 5FPYA 4TZ6A 4JKIA 2IX3A 1COWD 2GCOB 1ZM2A 3CPEA 3U7HB 4QNMA 1GZSA 1X8JA 2JLYA 4F38A 1DEKA 1RJ9B 1ZD1A 3I32A 1G20E 5KSWB 1EFCA 3T1OA 3UG6A 5HTKA 3OIVA 3KQKA 3T06B 2V7QD 4BLSA 2XTZA 1KSHA 1UKZA 1XZQA 1ZUIA 3SHFA 1IHUA 3CIOA 3LXXA 2IUUA 1X1RA 1VHTA 5DE3A 5J4KA 1QBKC 2CLCX 4JLAA 4JIMA 1IB0A 2ZUBA 3IIMA 4OHVA 4ILEA 1W46A 4TLCA 1G5TA 1U0JA 2F7SA 1N6RA 2J41A 2O0KA 2Z5FA 3M6AA 4M1OA 1JB1A 2VZLA 4RZ2A 2QA5A 4HUQA 1G8FA 1Z0AA 1Z8FA 4ARZB 3E20A 1YRBA 3ZVLA 2W6JA 1X86B 1AS0A 1Q82D 2HLDA 1F2UA 3BBPA 1E9CA 3TKLA 3THWA 3KJEA 1SVMA 4GNKA 1BIFA 1JJ7A 1ZD9A 5HPYB 3AF3A 4DSTA 4EJSB 3SNHA 2P6NA 1OXVA 4RJLA 2ZR9A 1G8HA 4DLRA 4GMDA 2EFDB 2DETA 1P2SA 1P4SA 2EYQA 3HP1A 3W8NA 1J99A 2ANBA 1M34E 1XEWY 4EPWA 5HKKD 1OLOA 1HQCA 4EKDA 1E2PA 2WJJA 4EAQA 3CXCB 5CB6A 8OHMA 2REBA 3B1VA 1OIVA 4ACAA 1G5PA 1UADA 1W5SA 4C43A 3HU1A 1F2TB 3OFND 3QPVA 2GCNA 3MUFA 4HAYA 4HLCA 4M1TA 1G41A 1X6VA 4RKEA 3K1JA 3R9WA 1D6JA 2QSYA 3BFVA 4P4UA 1I4TD 3UATA 2H7VA 4RCYA 4CEHA 3KUDA 4DKXA 5F9FA 1KMHB 3QBVA 5JJLA 1SXJC 1KQSB 1P5ZB 4ZO4A 5L3SA 4PANA 1P62B 5EZ5A 1VDZA 2W58A 3PCRB 4GZLA 4IVRA 5IHPA 2AXNA 4HDCA 4JLPA 4GP7A 1TMKA 2V4ZA 2Z83A 1ZM3A 1P2UA 1OE0A 2IEYA 2ODEA 3K0AA 4IOMA 4AURA 5KSZA 4TMXA 4B43A 1F6BA 3KZ1E 4UAJA 4IRUB 3D31A 3DL0A 2OK8A 2QP3A 4I1VA 2GQFA 4Q03A 4EPTA 3RSOA 4PHGA 2ZU6A 1E1RA 4DLTA 3WRYC 3TSZA 2ZS8A 5DI9A 3KFXA 1WXQA 3W5UA 4DLSA 4PC7A 2RC5A 2QNRA 3CCVB 4MKHA 2N46A 2YWEA 3AVWA 2ZPTX 4GRAA 3P26A 1HA3A 2OCPA 4QOSA 1NSFA 4C7OB 4GFDA 5C1BA 2ZRDA 3TE6A 1XE1A 1ETUA 4LK2A 4ZDJA 3CX7A 2PIAA 1A7JA 2RGAA 2GEDA 2ZJAA 4G5QA 5FBRB 4QGAA 3RRZA 2D3WA 2BMWA 2J59A 1E1QA 2XB4A 3BRWD 5DI3B 5F9HA 3U61B 2RH5A 1S72B 3SC3A 5CIWA 3RRNA 2QTVB 2ZRCA 2NMVA 1R2QA 4QGGA 2BJWA 3ZVMA 4MH0R 2GILA 3S1AB 2HF8A 2QAJA 4M53A 4QFMA 2XNDD 1EP3B 4PC6A 1OB5A 3B78A 1GILA 1ZIOA 2WWFA 3LX8A 5JWRA 4C9BA 1ZU5A 4MDEA 2RGDA 3GLGA 2WSSD 2F1JA 4G5SA 2GEVA 2FA9A 3FMIA 3TUJC 1Z22A 3FMPB 2QQ0A 4M1WA 5H5JA 1GP2A 1AZTA 4M2LA 1XTSA 4LX0A 4WXRA 4BECA 4Q1EA 3AF1A 4NONA 3GLIA 2YC4C 3VNVA 3DDCA 4GL2A 1DS6A 1M90D 2J3EA 1GG2A 1E0JA 5JHGB 3AVYA 2FZ4A 3G71B 2I4IA 1PLLA 3JVVA 4TQ9A 2ZSAA 3OW2B 4QBIA 4FI3C 4CEJA 1XD9A 2QMOA 5DYGA 3X1ZA 1M8PA 1XCPA 2JLQA 2R65A 1U9IC 1QZXA 1P6XA 3IGFA 4HE5A 4URYR 1FRQA 1Z0DA 5EP3A 4WQMA 3K09C 3K0CA 4Q4AA 4JSYA 1KZ7B 1Z6TA 4XH9B 4ZI3A 4NE2A 4BFYA 1FZQA 2YVUA 3G82C 1UBFA 3CH5A 5BXQC 4YAWA 2WWHA 1KI9A 4ZGNB 1ZCBA 4PR0A 1U99A 1XTQA 2JLSA 4D4MA 1FMJA 3K0FA 3EAQA 1EFUA 1FNDA 5H59A 1RKBA 4A2QA 3SJZA 1G3IA 1LY1A 1XNJA 1WBBA 3C5HA 4HI0E 1VQ6B 5EXPA 1NI3A 2GDJA 2J46A 3MHPA 3FWYA 2XX3A 1NMXA 4GT1A 4M1SA 4LJ4A 2O8CB 4AC9A 2H5EA 3VHLB 3CC7B 1R0WA 1XTJA 2GF9A 2K5UA 5D3QA 2V1UA 1EX6A 5KUTA 4IOKA 5AN9A 4W5HA 1OKKA 1G64A 3REGA 4TMVA 2FFQA 2GETA 3ZZ0A 1XEXB 2O0JA 4US1R 4PHTA 4H1UA 1NBME 2GWHA 3K9LA 4FCWA 5D3MB 1TU3A 3RHFA 3N2IA 4CRWB 1VQKB 2BBOA 1GNPA 1W4BA 2JDID 3LQRA 1JA1A 3BGWA 4Q48A 1KK2A 1B23P 1XWIA 2G1JA 1YI2B 5GV7A 4WIAA 3DM5A 1TQ6A 2F3TA 3AUYA 3G6EB 1P9RA 1SGWA 1FNCA 5HE8A 4BLQA 3SN6A 1GKIA 2PX3A 4YAFA 1N3BA 3R8CA 5EUMA 1XF9A 2CL7X 3DZ8A 4OHWA 3PUVA 3PFIA 4DB2A 1W44A 1JJ2B 2GJSA 4BWYA 1AS3A 3QY0A 3HU2A 1R4AA 2BM0A 2YKGA 1E9DA 5G40A 5CM8B 4C0HA 1N25A 4YDSA 3GLHE 3ETLA 1LW7A 4KBGA 1CJTC 2O8BA 2J5XA 1EK0A 4JSTA 1RRCA 1BX0A 2GKSA 1OIXA 1V43A 2GVZC 2OFWA 2QGNA 5HR5A 1U8AA 2J7PD 5FOXA 4B75A 3EPJA 4JVLA 2WKRA 1G7TA 3I4LA 3W2FA 4AIIA 1KK1A 2E9SA 3GP8A 2QSZA 3LFUA 4DIEA 4OK3A 1RFLA 1GWNA 4KODA 1YR6A 4QJ5A 2VEDA 2QT0A 3MG9A 4JT4A 2GZDA 2RGNC 4RD1A 1Z6GA 4OK5A 5GJBA 1FUUA 2PJZA 4I4LA 4MKFA 2HJVA 3CKLA 5K8UA 3OIYA 4V0MA 3B9PA 2IYTA 1QX4A 4Z8XA 2G0TA 3LVQE 2IYSA 5BW8A 2J0UA 2AL7A 1T9HA 2WIBA 1TNDA 2YWGA 5C2JB 3VU9A 1UEJA 2QEXB 3SYNA 3NKVA 1B0UA 3SBDA 1MT0A 4URVR 4US2R 4R71A 4JL5A 2P65A 4M0LA 1VTKA 4BLPA 4D4LA 5SZHB 2I3BA 1OHHA 1VQMB 1SKYB 4F91B 2F1IA 3FVQA 5FOTA 1WF3A 5JFGA 1ZINA 2WAYA 4YC7A 2ZRMA 1VYVA 5EXSA 1BH2A 1XXHB 2DWPA 2GZHA 1TF7A 1NVWQ 4XVUA 3GLHA 1F60A 4DCNA 1ZUNB 3MMPA 1JAHA 3BE4A 4I1OA 1IXZA 1LF5A 4QG7A 2A5FA 3FB4A 2VL7A 2KJQA 3ASYA 3CRW1 4P4TA 5HE9A 1UF9A 4RFSB 1D2EA 3VR2A 3FHOA 3RWOA 2CCKA 1JQJC 3AKCA 3GJXC 5CM9C 5FL3A 5JJIA 1UDXA 1KZGB 4XD7A 521PA 2ZR0A 1UPTA 4L8GA 4EJSC 3CH4B 1XB2A 2OTLB 2P5TB 5H68A 3LV8A 4KCGA 1VQ7B 4CVNA 2YYZA 5JI3E 1FOEB 3CF6R 3Q85A 2IXEA 4URZR 3L82B 3IEVA 2RGGA 3IEUA 2C95A 4I1SA 4W9MC 2ZJZA 3NWJA 1XD2A 4IEEA 1CU1A 1LS1A 1Q3HA 2ODNA 3TW8B 5L3QB 1W2GA 2ZM5A 4MKGA 4CEIB 1N5IA 1HV8A 3FFAA 3U3JA 2G0NA 2NPIA 2ZRAA 4TMKA 2ZRGA 5EP1A 3Q7QA 2GBLC 2D74A 1OJLA 1SVOA 3CF0A 4FWIB 2WZQA 1CR0A 2OBNA 2JJ2D 2BBTA 2ZXUA 3C14C 2FMXA 3BB3A 3JQPA 1BYIA 1M74A 4JLNA 5AJVB 3U3KA 3OZVA 1S8FA 1U81A 3LVBA 5FTKA 5JLJA 1RVDA 5FTJA 1M1YE 4PC2A 121PA 4DDVA 2IWRA 3ZYCA 2EU8A 1RZ3A 3KXIA 4UXHA 1FNNA 4B3CA 1E6CA 2QAGB 1BQEA 1N0WA 1E9RA 3QQ5A 4Q1AA 4A0FA 4TL9A 4MITA 3Q5EA 5KOYA 2NO6A 4Q00A 1LNZA 2G9NA 3EPHA 3CNLA 3MLEA 3X2SA 3NBFA 3FFBA 1NVXQ 4XOIA 3AVTA 1YZLA 1AKYA 3LDAA 2BIFA 5CK4A 3FTQA 4Q7MB 4JYBA 2EQBA 2XOKA 1FW6A 2ZAOA 4LC0A 1H8EA 1MOZA 4PPFA 1YJNB 3GEHA 3ZC3A 1OSNA 3BD9A 2OUKA 3VO1A 5CITA 1R0ZA 4DT1B 2O8FA 3BH0A 4JS0A 4DB4A 3UMSA 3H0KA 5FPTA 1DDIA 2AK3A 2XSZA 3VO2A 3QXCA 1N2CE 2OFXA 1GJRA 2IW3A 3IIJA 1T8UA 3U3RA 3V9PA 4X8LA 1VQ9B 2IXFA 5IK2A 1T8TA 1W2HA 1Z2CA 3Q8XB 5CLQA 4HEJA 4A92A 5LB4A 4D26A 2IYYA 2IHYA 2OXRA 1NRJB 5DN6A 5G3YA 2R6HA 1Z0JA 1CJKC 3PG5A 4LRWA 2CE7A 4Q4JB 3RYTC 4TL6A 3W8RA 5FA6A 4BLRA 1DG3A 3K70B 5GJVC 3KX2A 4MYTA 1DAHA 2HF9A 3H2YA 4LSGA 1VCIA 4G01B 5KNDA 2EFCB 2ZE7A 1DADA 1EWQA 4KXFB 3GJ5A 2DBYA 3O8RA 3ZD6A 2UVQA 3U44B 2QRZA 1E9SA 5DO9A 3VNUA 2G88A 5FL7D 2AKAB 2BKEA 3CNNA 3LLMA 4P4SA 4B3FX 2XGJA 2C2HA 1SXJA 1VCOA 4B3XA 3FMOB 4GOKA 4PTLA 5GVRA 5FPKA 3THXB 1Q0UA 4AKGA 1S3SA 3I3SR 5JRZA 3GEEA 4CW7A 2ZRBA 1Z0KA 1K5DA 2VP5A 3KB1A 3SFVA 3CD6B 1KO8A 3U60B 2IEZA 4GZMA 2XNJA 2NZJA 1JJVA 1H42A 3RS5A 3ZD7A 2DEUA 3DM9B 4MYUA 1S4QA 2OXCA 4PHFA 221PA 3CRZA 1CLUA 3ZIAA 1ZW6A 3BORA 3HJNA 4A2WA 5GJWC 4ZIRB 2D62A 3HYTA 1GUAA 4TYNA 1OW3B 1X8KA 1XEWX 3B2EA 4DQLA 4S35A 1E2JA 1MV5A 4HAXA 2IHBA 1YU9A 4TL8A 3UXMA 1EFRA 3IHWA 1YJWB 1QG2A 4LHVA 5FFMA 3I8XA 1US8B 4LZZA 3A37A 1VYTA 2Q6TA 1G6HA 1UKYA 2W6ID 1ZCAA 4IDHA 5H70A 5GADl 4B3GA 4C0QC 4DLYA 2HCBA 1E9BA 4M4SA 2WIAA 1JI0A 1F3OA 3I61A 2IC5A 2QROA 1YHQB 1XMSA 2W2VA 1SVKA 2HXYA 4RD6A 4LBYA 2BN4A 3C5CA 3GJ8A 1XEFA 2ZJYA 3UMFA 4B6EA 1W47A 1EESA 1IN7A 1TUEA 3U5ZB 3AVVA 4JLVA 4PSVA 3LBIA 1S9HA 4QGFA 4Q9KA 5ANRB 4IOLA 4LC1A 4HDQB 3RS7A 1AQUA 1BMFD 1VECA 3H84A 4YAUA 1Z83A 5AWFC 4EQ6A 4YMUA 2WWIA 1GKUB 3PJRA 4G1BA 2AXPA 4E22A 4ZCMA 1RE0A 3CRVA 3EXAA 1KDOA 4UNQA 1N6IA 4EPXA 1CRQA 2DFKB 4NCJA 1R0YA 1KJZA 1E2EA 2B7CA 1SHKA 3W2GA 1OH6A 1ZYUA 2VHQA 3B1ZA 5FBVB 2ZQ5A 4C0AC 3LD9A 2JASA 3LO8A 3B7GA 1BOFA 4JYCA 1P9WA 3QKRA 1X1SA 4GP6A 4TTQA 3SJBA 1W4AA 1K8RA 1TQDA 3R7WB 3W3ZB 5CJ2A 3L0IB 1SZPA 1CBUA 4NYMQ 2PX0A 1CJMA 1LF0A 4HLQB 1XBTA 4Q02A 4OK6A 5DH9A 2IYWA 2ZJBA 3QUSA 3CCLB 3W9YA 2NQ2C 2F43A 3G0HA 3CC2B 2VHCA 1M7HA 3K09A 4GPTA 3IDQA 1TUIA 1T5IA 4YXWD 3MJRA 4JJKA 1VG1A 3IHLA 2QZ4A 2FDCA 1XMVA 1JAIA 5LD2B 2Q9BA 2VSFA 4M1YA 2QRNA 5FUYA 2FJUA 3V76A 4X8MA 2A5GA 1OXUA 3N2EA 3SYLA 4LJYA 5EP4A 3UWOA 3LWNA 1KAOA 4ZI2A 1FX0B 1Q12A 2V8OA 1G4AE 3TUZC 5B64A 1II8A 1HE8B 5CIQA 3CR8A 3A1WA 4IOJA 1DG1G 2WPDA 4LJ7A 3SYKA 2CCGA 2X2EA 2QP9X 4N3GA 4YLGA 4TMWA 1TLLA 5FBLB 1YR7A 3N5CA 4A36A 1CNEA 4X8HA 1N6OA 1S96A 5JECA 2ORWA 3PUYA 1SHZA 1RRGA 2PH1A 4FN5A 1TEXA 3QE0A 4YDHB 5B2ZA 1KI6A 1XX6A 3U6BA 2OT3B 3AGPA 1AGPA 1VKJA 3PIRA 1W0KA 4TTRA 1R5NA 4U00A 4NHOA 1UMKA 3RWMB 2QM7A 2OLKA 3IPYA 4ZCIA 2NO0A 3THOA 3BIFA 2CNDA 2OZEA 4WW0A 4AWXA 4BFSA 1GAQA 3A6PC 3CR7A 1WQ1R 3RS4A 5KSYA 1Z6YA 3O8DA 4PAQA 2REXB 3GLFB 3UMRA 2BOVA 2RAPA 4HZUA 1KDPA 2XJ9A 3VHXA 2AN9A 4JT2A 2KE5A 2ZJ5A 1XPOA 3TNFA 2HDNB 2XZPA 2RC6A 3AUXA 4JMPA 4NDZA 1N6HA 1OFIA 4FINA 4TLDA 3X1XA 4LHZA 4V0KA 1U0LA 3R20A 1E0KA 1TF5A 1OFTA 3QFRA 2BWJA 2IYQA 2RGXA 4P0TA 3ZZUA 2XNCA 1OH5A 1Z0FA 1W0JD 4FW9A 2XEXA 1OXXK 4LHWA 1TTTA 3QKSA 5KYKA 3SU8A 4E5UA 4TQAA 3OAAD 4TSFD 3WYGA 4B76A 2OILA 5J4LA 1GO2A 1TX4B 1YR9A 4LV8B 2J1LA 4JVNA 4XSHA 3TAHA 1NLYA 2E87A 3Q7PA 3WMEA 3B82A 3U4QA 2WKQA 3LRPA 2ZS9A 3PQCA 2P2LA 4ZDWA 4DXAA 2AR7A 1X8LA 1KY3A 2QGZA 2WMNB 4A15A 4TYWA 1NBMD 2BEKA 3DPUA 3BB1A 4GBMA 2C99A 2B8WA 2F3RA 1I4DD 2H1LA 2ZU0C 1G18A 4XIGS 5KDOA 4I81A 3DOFA 3THYA 2AWOA 4HYYA 2V6IA 1L8QA 1G7RA 4FWTA 1E99A 4TWZA 4JLJA 1KJYA 3A4LA 2C96A 3P4XA 5JZVA 3CUEF 4M8NE 3ONWA 2QTZA 4Y9UA 5IDVA 1PUJA 2ZI9A 2WWWA 2QAGC 4IFBA 1ZJ6A 3A1UA 2ZVPX 3D3QA 4JLMA 1RPZA 2VQSA 3LQQA 1IOZA 2R6GA 4FIDA 1NDHA 1UKEA 821PA 1NJID 1L2TA 2GCOA 2C98A 4C30A 1T3LA 2H18A 4DVGA 4BFWA 1K5GA 2ZITA 2J87A 3LXRA 1VPLA 4FCTA 1QHHB 2PZGA 3EIEA 5FPSA 1D2MA 1JR3A 3QBTA 2V55B 2YOHA 4PZYA 4A6PA 3CCEB 2WVJA 5THXA 2LWIA 3ZGXA 4A0GA 2RMKA 3KDSE 2IYVA 1HT2E 1JEEA 2JAQA 1YJ5A 3ND8A 4OQXA 3TIFA 1KKMA 1RRPA 3LY5A 4OHXA 4UNRA 4OKSA 4NBSA 2ERXA 3VX3A 4BFTA 4C0KA 2JLRA 3OEED 4AKIA 3DMDA 4A1FA 5DGXA 4DEYA 1E2KA 1G5RA 5TVKA 4DCVA 4P31A 3EZ7A 4IKEA 4ARZA 3FHCB 3I92A 3NBZC 5FBWB 4D2IA 1QDEA 4BRUA 2CEAA 2ZJ8A 4HB3A 4POAA 1VCNA 3QOFA 4BE7B 3GLGE 1FPMA 1VIAA 2C9YA 2QE7D 3W5HA 1DAFA 2J9RA 4EJSA 5J40A 2XITA 5JS7A 2X1VA 2DERA 5FUVA 2BMDA 3HYRA 4A8JB 3AP1A 4TL7A 4PO8A 3EPLA 1OH8A 3GLIE 3OZWA 2RGBA 1E79A 1C1YA 1NG1A 1W5TA 2Q0HA 1HE1C 3K70C 3JQRA 4F7DA 4LPKA 3T34A 3AF2A 4MRNA 2QY9A 1GAJA 1F2TA 1QGYA 4QXAA 3W90A 5CDFA 2OFOA 1ZNYA 5K8IA 3UK6A 3A4MA 1XTRA 1P61B 1B2RA 2XAUA 4HB4A 2O8DB 4IJMA 4ASUA 2D4HA 3JQQA 2O52A 3AB3A 1NN3A 3TLXA 1KMHA 3AVQA 4F4JA 2GJAA 4KVGA 2JLVA 3WYAA 1EGAA 1GOTA 3AH8A 2YOFA 1MABA 4UQOA 5EE1A 1NN1A 2QORA 3GJ4A 4EDHA 1KSJA 3FHTA 3WY9A 4AG5A 2O8EB 1NL3A 1FMLA 3TUIC 4QJ3A 2ZSFA 5FUWA 1VQPB 2FFHA 2XTNA 1G21E 1Z63A 3CCSB 2NGRA 1CS4C 1WMSA 3RC8A 1YKSA 4DSNA 3Q3JB 1QHIA 3C4JA 3RVBA 1G3QA 2LCFA 2FX3A 3KJGA 4LY6A 1KI8A 4US0R 3KKPA 2JJ1D 1NJGA 1XJCA 1P73A 1XTIA 4XVRA 5K8LA 1U98A 3E5HA 3R8FA 1KNXA 1E2HA 5JJKA 1O3YA 2E1RA 2DWOA 2HJGA 2P6UA 4NCKA 4OYHA 2ECKA 2A2ZA 4C7OA 1MO6A 3VX4A 2QBYB 1QVAA 1ZIPA 2ZRFA 1KYIA 1MO5A 3A8TA 4W5WA 1GRRA 2AKYA 4XWOA 4LOAA 5DI3A 5AUPB 3GPLA 4K8OA 3I56B 4HLDA 2J0QA 4Q7JB 1XJQA 3V4RA 3WBJA 2VP4A 4NU0A 3OE7A 3LLUA 1HUQA 5TARA 3S1AA 4RCZA 1YZTA 4PPQA 3TQFA 5IT5A 3K70D 1IQPA 2ZYUX 2ZS7A 2VIIA 3EZ2A 3L2OB 4RD4A 1KIMA 5C46F 4LBZA 1E0AA 3UPUA 2FPKA 3FGNA 2RKOA 4PQFA 4MKIA 3SR0A 3FKSD 4G3XA 4NZYA 4L4UA 4Q9HA 3TGPA 2ZI5A 3WP1B 3RS0A 2X2FA 2ZRLA 1Q7YD 3ZZTA 2X19A 3NIBA 1JEDA 4YAOA 1R5OA 3B8HA 1NP6A 2KI5A 3O8CA 2ZI6A 2AD5A 2VHTA 3P4YA 4MGZR 1N6NA 2R8RA 2DPXA 5A0FA 4CT5A 3QEJA 3KJHA 1E2NA 3M4YA 4PPNA 4P32A 4AYWA 4Z1MD 4UXJA 1T4GA 1J9ZA 1KI3A 1GIAA 1QRAA 1N0VC 4TMTA 2BKUA 3A1VA 2GF0A 1CJUC 5BYKA 4IHQA 1FP6A 1QHXA 4YMSA 4DUGA 3M1IA 5LD2C 2PJRA 2BSAA 1DAMA 3WNBA 1T6NA 4DLUA 3RLFA 1H8HA 1NVVQ 3W6OA 3MCAA 4TN1A 2ZETA 3QPUA 3W6NA 4TYYA 3ADCA 3NH6A 2VP2A 4QM6A 1E2DA 3VTKA 2V1XA 3E70C 4V0ME 1ZM9A 2L0XA 5AK0A 3H4MA 3AVXA 3T12A 4WBSA 5ELXA 4Z8YA 3A4NA 3VR1A 3CC4B 1K6MA 3TK1A 1MRNA 5HCNA 4NH0A 4D6PA 4Q1DA 1NMZA 1VG8A 1KD1D 1E63A 1VQ8B 2OAP1 2QP4A 1GDDA 2Z43A 4HAWA 3RNLA 2ZI3A 2O8CA 3T5DA 2ERYA 1XD8A 1T91A 4IDOA 2RCNA 2XXAB 4QJ4A 2V6JA 1OFUX 1P2VA 5F2EA 3Q9LA 5E4FA 4PAOA 4OBEA 1JQLB 1XEXA 4KITB 2R6AA 2ANCA 3B13B 1SVSA 4BPRA 1M2OB 2AFIE 5D3MA 2F1RA 3GCGA 4EH1A 2DFNA 2DFLA 3TMKA 1SULA 2PLFA 421PA 2O8BB 1DDGA 3CM0A 1BKDR 5FOWA 1GR1A 1MH1A 1ZNXA 2A30A 2JIZA 2KWIA 3CPJB 4G0NA 4G1UC 4OI1A 5TMPA 1G1MA 4UNPA 3IUYA 4WAUA 1Q1BA 5A5GA 4UNSA 4YMWA 1QFYA 1YVDA 2A3RA 4KLNA 3LX5A 4MGKR 2ONKA 1OV4A 3A36A 2TMKA 4ESHA 3L8ZA 3NDPA 4M21A 1LVGA 3TRFA 5GVSA 2B92A 3CZPA 3TSWA 5BN3A 1QHGA 2QU8A 1SVLA 2Z4RA 2B6HA 4QKQA 4FK8A 3IQWA 1ZU4A 1OH7A 2DFTA 4Q1BA 2OCYC 4BPBA 4O25A 3QG1A 3ES9A 1NIPA 2IS6A 1WCV1 2VHJA 4QRHA 1SQRA 1W34A 4IDNA 2DY1A 4M9SA 5TV2A 3U7GA 1GAWA 5M04A 3NEYA 1COWA 2UKDA 1KO7A 2EFHB 2IF0A 4DWJA 2R6FA 2FSIA 4DDUA 4GSYA 3RDPA 2CNWD 1VG9B 1OGIA 3D7MA 1JA0A 2FZLA 4KYIB 2C9CA 2GAOA 1TADA 2V7QA 2ODWA 3E2IA 3O8BA 5AJXA 2G77B 3GLHB 3G4SB 2CBZA 3GMTA 1W1WA 5TR9A 2PT7A 2ZE6A 4PGOA 1CEEA 1U0HC 4D82A 1I2MA 2ORVA 3SZRA 3CONA 1LFDB 1QHSA 5AR1A 4QBHA 3WBKA 4Q9JA 5JWOA 4BEJA 2G1KA 4DJTA 3PUXA 1KY2A 4DSOA 5IF9A 1J8MF 5J4HA 2V54A 3VR5A 2F6RA 5KHOC 5KPDA 2ATVA 5TXGA 3L0PA 3B9QA 1J7KA 4D81A 2G83A 2YHSA 2JLXA 3AV0B 1XXHA 1CF4A 1DO2A 5FPHA 1A2KC 2C04A 3G5UA 5EZ6B 1Z6AA 4RSGA 3TR0A 5HKKA 5FH9A 4A9AA 3RABA 3GEIA 4JLDA 4RFSA 4EPRA 3OFNA 4WZBE 3D6TB 4Q4LA 1WBDA 2CHVA 4KFRA 1E0SA 1L4YA 1WP9A 2CHGA 4XJXA 2NZ8A 1JALA 2KB0A 5TB5A 1U94A 1DAEA 1U90A 3QF4B 4ZDKA 2J0SA 1HY3A 4A8JC 4U02A 4DDWA 3A1SA 1U8YA 3I8SA 4NPHA 3U7EB 1KAGA 4MGYR 1GSIA 3MWYW 4H9GA 4HSEA 3KKMA 4NYMR 5L3QA 1QVFB 3PEWA 1XRJA 4CEIA 4LI0A 2ZUCA 1OF1A 1OFHA 4AYXA 4TYQA 2MSDB 1A1VA 3QENA 1ELOA 3OZUA 3NEJA 1SXJE 1UBGA 2HUPA 1CULC 4LUCA 5FI0B 4EPVA 5FR1A 3KQNA 2FSHA 4M1KA 5KU1A 1CJVC 1NIJA 5B57C 1GRNA 5GJCA 1KC8D 5EE0A 4CF7A 4N0DA 1DO0A 5G3ZA 2FNAA 5J4YA 1JNYA 4PC1A 1G3MA 3HDTA 1XU4A 1G19A 1KO4A 2AD1A 2W6JD 1NMYA 1CNFA 1QGAA 1DE0A 1GL9B 2HLDD 2WMOB 2QAGA 3K0EA 4Y0AA 3HPRA 5FBQB 4AG6A 3HPQA 5L8VA 5AJZA 5GV8A 2ATXA 2WJYA 2J7KA 5EQTA 4G1VA 4JVSB 2P5SA 3WXMA 3PR1A 1FQKA 4Z51A 2NOAA 1Q81D 1N5KA 2JJ8A 3RRYA 4OJKA 4DCUA 1OIWA 4N3NA 3A58B 3BERA 3DKPA 3JZAA 1T0HB 1R5BA 1VHLA 3C41J 2QTLA 2VYQA 1P7CA 1P9NA 1ZC3A 3PV0A 1A82A 4PQRA 5CYOA 4DDTA 5F3WB 2FPLA 3CWQA 4LV5B 4B3DA 1D9XA 3LNCA 5TDHA 4JLKA 2VP9A 2V3CC 2SHKA 3UG7A 1GL6A 4DT1A 2XNDA 1FNMA 1R10A 2VA8A 4FMDB 4IVPA 1XMJA 3OHMA 3QI2A 3QVVA 4EIWA 1IN5A 3QKUA 5CYPA 1HQYE 3LAWA 5KSOA 1DVRA 4L15A 3T1VA 3AQ4A 4WOPA 2QM8A 2WSSA 3CB4A 4EPYA 4XTRA 2KBFA 3KTAA 5KNBA 3B5JA 5TY0A 1E9EA 1OYWA 3X1DA 4B2IA 4CIDA 2H16A 2IXGA 4Q4HB 2B7BA 2CK3D 3NH9A 4QHSA 1E32A 3AKYA 3TSOA 3UANA 2R6DA 4E07A 3W2HA 1UJ2A 2R6CA 1A8PA 4TZ0A 1M1KD 4Q4JA 4HDOB 1E1RD 3EC1A 4C0BA 4MA4A 2NTYC 2GAAA 2Q3HA 4MRPA 1R8QA 3EC2A 4LYAA 5FOSA 3OJXA 1BO6A 3KB2A 2GXQA 3U44A 3N70A 1Q44A 2VRWA 5EP2A 2WOJA 2BMEA 3AF4A 2B8TA 4PSKA 1FRNA 4G5RA 1G6OA 3RSLA 2YINC 2EIXA 3NBYC 3FE2A 5JCPA 4LCBA 3THXA 1KI1A 5CLLA 1NY5A 1E1QD 2ZRHA 1I7PA 4PPGA 4OI0A 2QMHA 1ZNZA 1XDBA 4JL6A 2PBRA 3I1FA 2VH5R 3DZDA 1IN6A 3K8YA 3T35A 1EP2B 2X8AA 4OQMA 3R9IA 2LKCA 4LJ6A 4NMMA 4A0HA 2GJKA 3ZBUA 3PUZA 3QFCA 1NLZA 4OQNA 3LO5A 4ZIRA 3REFA 2OLJA 3WHLA 4BFVA 1I2DA 4FD2A 3X1YA 1VIYA 1KI2A 4A2PA 3AGQA 1YE8A 2IYUA 3KQUA 1ZM4A 1U8ZA 4EQ6B 1OXTA 2B5OA 5DSZA 3KL4A 1UEIA 1MO4A 1R8SA 1US8A 3I72A 4GMXA 2FSFA 5EE3A 2RGCA 5FTLA 1DAGA 1Q1QA 2JDIA 3ND9A 1HTWA 3IIKA 2R62A 4NCHA 4H1VA 2ORIA 3NVAA 4KLZA 5C18A 1KHTA 3A1TA 5EE5B 3IBYA 3QKRB 1G8YA 4PZZA 2HT6A 1NN0A 3CLVA 4FXPA 2GK6A 2FE4A 1BYUA 1EFHA 4BASA 1AN0A 2PMKA 3CCJB 2GA8A 2OCBA 4DLWA 3EIHA 1E3MA 2CVHA 3ZS8A 5JRJA 1U9IA 3H86A 1RYFA 2QMEA 3B85A 1Z28A 1IY2A 3L43A 4MQBA 1IM2A 1TF2A 1CR4A 2GK7A 5AJYA 1Z07A 1GFIA 1EG7A 3SQWA 3NDBB 2PLRA 1UKVY 1ZP6A 3WRXC 4C2UA 1NN5A 4HAUA 2JCSA 3VFDA 4BFZA 4F4CA 4F92B 2VHUA 3B1YA 4Y0VA 2F9LA 2WM9B 3VKHA 4MUBA 3Q72A 2C5LA 2J7PA 1LS6A 3P20A 3VQTA 1QUFA 2VP6A 3OEHD 1PV4A 2CHQA 2ZYVX 4YHBA 3R7WA 4JBYA 3LA6A 1ZMXA 2YC2C 4HZIA 4L9WA 1G8PA 3TH5A 2CJWA 1OKKD 2MSCB 4MYHA 4R7ZA 4JBXA 2FEOA 3EW9A 3NHBA 3VR4A 2WTUA 4O3MA 1Y3AA 4A82A 2D7CA 4AI6A 4JJZA 2XZOA 2UZ3A 1QFZA 3BH6A 5LBIA 1XJ0A 3WMGA 2A5JA 5EE9A 1II0A 4KU4A 3PVSA 4Z54A 2IS4A 2OV2A 1KI6B 3B6EA
chains in the Genus database with same CATH superfamily
3AR6A 1DEXA 4QHYA 3T54A 1PZFA 2EI8A 1M6NA 3L0SA 4KFTA 1YL5A 2WYOA 4PRLA 4PVDA 5JSZA 1NQTA 4F9GA 2FW9A 1ZTLA 3H5CB 3A06A 2QAIA 1WX1A 4DGJA 2C8WB 2IYZA 4QUGA 4IV8A 4LV6A 2ZSUA 1SBYA 3SF0A 1NPMA 2CE2X 2BI4A 4EAAA 3E5MA 3KKOA 5IKEA 2A7HA 1WV1A 1ABIH 2RB5A 2O0HA 4LTDA 2Z9KA 2FK7A 4AJJA 1IRXA 2O1XA 4KR7A 2IJOB 4Q01A 2XRZA 3BEUA 3P32A 3ZHXA 1NJFA 2Q3DA 3BTKE 4I8IA 2HA4A 3RE1A 3C1TA 3K65B 1WXIA 3ZWVA 4YASA 1N7HA 3EA5A 4UHBA 2R84A 4U9UA 3KB6A 2HRBA 3L4JA 1KYTA 4XD7D 4RVFA 2ZWAA 5BXYA 5ALHA 3QF7A 4A0SA 2H1CA 3C7CB 5AM0A 5AOCA 4ND2A 2WPMS 2AOVA 5FOUA 1YPHE 4GO1A 3SF8A 1IC6A 1RQ2A 2O8TA 5KPJA 1TC2A 2NYRA 1G2QA 1BX1A 4G0XA 1CY2A 2OBMA 4QPZA 5EJEA 2V03A 2FW1A 1CNMA 1I01A 2IYLD 2O23A 3OKFA 2XGSA 3BB4A 2ZUEA 2CVQA 2KYRA 2Q0SA 1JHYA 1H8ED 1UFRA 3SYTA 2Y1EA 2AFHE 3IAFA 3B8EA 2Q9CA 3OOHA 1Z0UA 2EAUA 3BCSA 4ZT3A 2OK7A 3A14A 4C4PA 4MWTA 3CRQA 4RTQA 2CL0X 2Q2WA 2B1GA 2YWHA 4JT8A 4ZGWA 1HT0A 2QF3A 2ZYAA 2FTKE 4GCHF 1C5RA 3LONA 3TEFA 4KPUA 1QAOA 1F0YA 2PHZA 1GBCA 2CMHA 4NQRA 4Q4AB 2IHTA 1EJNA 2AMDA 2VRBA 3OIUA 1DC6A 1U3UA 1G16A 3DFJA 3MZ0A 1V5VA 4ZJZA 2JN9A 1R15A 3USCS 4MWDA 2QJTA 5IG2A 2P79A 4LXYA 2J0VA 1O3KA 1UFKA 1WCWA 1YZGA 1XKXA 1T0UA 3MERA 2W2KB 1GWAA 1GZ4A 3T3OA 5FTNA 4M9XA 4XPIA 1QVWA 2LXNA 3ORRA 3VC2A 3EQZA 2GJRA 1MQ8B 1C7EA 2JLBA 3Q11A 1BWRA 2Q6VA 3BEIB 2PCLA 3QZUA 4K6KA 3QWCH 1XI2A 2BB4A 1XTBA 3EPKA 4U8HA 3FPEA 3IOEA 4P1VA 3E7FA 5LPFA 5D3ZA 1IOWA 4H27A 2OBXA 1GVHA 2IYOA 2Q9AA 3VB4A 2YIMA 3VYTB 4OQYA 2V31A 1O32A 1GV1A 1F7VA 1QDUA 3RC3A 4NG4A 2D8WA 2UDPA 4K9RA 2X23A 3K3PA 4E13A 2ODBA 5F33A 1XXHE 2MMGA 2NO7A 2WF6A 3Q87B 5HXAA 3LBAA 4P2NA 1RKUA 5C5IA 3DDYA 1EWRA 3M4XA 1DDOA 1BTHH 1STOA 4AROA 2LV8A 2NU0E 5JHHB 4MV5A 4OAQA 1N9GB 1J90A 2AYXA 1P2IA 2HU8A 3BQNB 5BUQA 5DWVA 3CENA 2GPJA 1GQYA 4KYUA 4B1TA 2FPXA 1K1NA 2GB4A 3EZNA 3DXXA 2WJ6A 3EARA 2HMAA 1JMYA 4OL9A 2Q4DA 1DBSA 1AGRA 3HCRA 3RRMA 1JR6A 4WSOA 4ROXA 3HCDA 1S2DA 4CM1A 1K6JA 1TO2E 4EJ6A 2V6BA 3WKEA 1E7QA 5D8DA 1ZSVA 4XM3A 4BVGA 1MKYA 1KEEA 3UMJA 3MK31 1GR0A 3DTYA 3DNMA 5JBQA 3KALA 1IAUA 1C1QA 2AK2A 1V0FA 4WZ6A 1BHXF 3SU2A 1ZWLA 3P2YA 1DKMA 5CYFA 4KKSA 1WDIA 2WT8A 1NBWB 1P7ZA 2FQYA 1UDBA 4FS3A 2B6NA 4H3SA 2C9MA 1DRVA 5DNYB 2II6A 2H1UA 1NFUA 2ZDQA 3BIWA 3E22B 3K0SA 3WDKA 2JETC 1EEXB 3PGVA 1NB9A 4ZVTA 3AFOA 1GBBA 2WHQA 1Z4IA 3PGXA 3VOBA 4OQFA 4ZMBA 1JPJA 3DOEA 4P12A 4XB2A 2AT1A 3LBNA 4O5OA 1JT9A 3EWSA 1KZ4A 4D3FA 5A4MS 4KPGA 4FYKA 1ECFA 1SO8A 1VZ3A 2FWRA 3H6HA 4S12A 1DOAA 3V46A 4EB6B 1K9OE 3FCEA 5CK5A 2D54A 4U0JA 3RVKA 1P3DA 1N75A 4ODIA 2NUAA 4CL2A 1JPVA 4F5YA 1DU4A 4FFBA 4CDRA 2AXEA 4ER5A 1LQDB 1Q15A 1L7AA 1E5DA 3MXTA 4BOYA 2FPMA 4IZ6A 2WQ6A 3AKDA 1CS0A 1O2ZA 5KYTA 1L4DA 4KDRA 4II2A 4RJJA 2QM0A 3QHPA 3BF6H 1MUEB 1RIWC 4GWLA 1J0AA 2R8ZA 1FUYB 3PA6A 3U31A 3ZDCA 2Q21A 3O2NA 4YGXB 4JVMA 1A77A 2CJWB 4L50A 4R01A 4UCQA 2K2QB 2A5DA 1WY7A 4GR5A 3CZ4A 2P4SA 3PPVA 3GJZA 1W6RA 5EIFA 3T9DA 1J16A 1JG3A 3A80A 1K75A 4X92A 3Q3EA 1NU8A 3KT8A 1E2FA 4G4SP 2RBKA 2HK6A 3LM8A 4Q82A 3IAS6 4HZUB 4CM3A 2Y1CA 3CR3C 3U4MA 4BNDA 2PS0A 1QVRA 4YP9A 5AW2A 2PX4A 1AUVA 1GPNA 1VE7A 2QENA 2I4MA 3TGWA 2GCTC 1L1RA 3O95A 4BFXA 4I1PA 3UHFA 1E94E 1ORTA 2QJFA 2OB1A 1JF8A 1AB5A 2ZOSA 3ICVA 4J2YB 5LYJF 1C4OA 3PFNA 4BX8A 3EMKA 1FUKA 3I77A 3THYB 4NA7A 5C9ZA 4A1TA 5IASA 2QTAA 1AC5A 3FKJA 4WDQA 1JILA 1DIHA 4IBLH 2FG6C 4DIMA 4K69A 4QNMA 4HS9A 3I32A 1KYZA 4WLOA 3EXHC 4HX5A 1VITG 2XTZA 1XU7A 1IHUA 3CIOA 1UPFA 4AMZA 2YZKA 2ZUBA 5A5EA 5JXGA 3MNBA 5HW0A 3EH2A 3A3NA 3JSXA 3SXUA 1YRYE 1SIBE 1YRBA 4RGYA 2IH4A 2HLDA 4X45A 5DCWA 4DSTA 1A9SA 1KSNA 1BWQA 3RJTA 3ZOZA 1LWNA 1P1RA 4YRFA 2OPBA 1Z34A 3EBOA 3UR6A 1FAXA 4CEHA 1PWXA 1YBMA 2PTGA 3Q3KA 4HDCA 2Q4BA 2YNBA 2GF2A 4Q2KA 4YM9A 1U3CA 1YPMH 3WWFA 4UC0A 3CCVB 3AI2A 4OVKA 1AK1A 3U4CA 4FGZA 1Q1GA 3CX7A 1A7JA 4C6TB 4F1WA 9MHTA 4WKCA 4ZAFA 3BRWD 4TQGA 5CG2A 4OG2A 3AY6A 4YQEA 2ZIGA 3ZZ8A 1RQ7A 4LCJA 4HGQA 4C05A 1K4YA 1ZIOA 4HTCH 2CJPA 5F76A 1OZ0A 1I24A 3FNRA 4KMSA 3GLIA 4Y2RA 3UPTA 1DS6A 2J3EA 5TQ0B 3ZY4A 2ZGVA 4DGQA 2QMOA 2BGLA 1M0WA 4HXEB 2QYOA 1FMJA 4BHTA 4H1TA 4I1RA 1OAOC 4IJ5A 2Q41A 5ITVA 2ZG6A 1PZEA 5K45A 1TNKA 2H5EA 1CX9B 2Q1TA 2K5UA 4J1TA 1CVWH 2FFQA 4UD2A 4K2AA 4PHTA 1NT1A 4DJZB 2FI4E 1C1RA 2C2KA 4MV8A 5EHXA 1Z5VA 1Y42X 1VA4A 4Q48A 1YI2B 4RA9A 5ARBA 1UBUS 1AUJA 2F3TA 2D9RA 1GZDA 4XOUA 3HVUA 4MNYA 1AS3A 3MPUA 1H6BA 3ILYA 3PHHA 5IBQA 3DG9A 2AA3A 1ZLYA 3BD6A 1GI8B 1FIZA 3SDSA 4DVAU 2J6CA 1DQSA 3R3JA 2ZJ7A 4WACA 1KZ9A 4JK5A 3D59A 1WR8A 2ZP0H 5EJLA 1C9NA 3TD9A 2A1DB 1FUUA 1K1OA 4RXUA 1OOKB 2JFNA 4XX0B 3B9PA 3MGBA 4XCVA 2W37A 1PRYA 3AEYA 3AI1A 4M0LA 4ZZIA 5HOEA 5KVVA 4BC0A 2G9VA 1YHYA 4DPLA 2HCTA 5JC8A 5KJCA 4GXRA 3RSCA 1TDJA 3A89A 3ENKA 3A6HA 3KTFA 4CM8B 5E1BA 3T4UA 1LHFH 3IESA 2QRVB 4TPKA 1H2BA 1TYEB 1MW9X 4EECA 2CXVA 1EB8A 2ZR0A 4L8GA 1SY7A 1TIKA 3GVPA 3IH5A 2BF7A 6GCHG 5CMLA 4ISNA 1Z9BA 3RK4A 5C37A 1RZVA 5ARDA 1T5OA 3EJ6A 5COQA 2W4MA 3Q7QA 2GBLC 2D74A 2OBNA 2XIJA 1UMBB 3JQPA 1BYIA 3BQJA 4OJNA 4P22A 4FUGA 1ZN8A 1NYQA 4JELA 1NFYA 1T1GA 3Q5EA 4Q00A 1LVUA 3X2SA 3L04A 3H11A 1EG2A 1KTIA 1NS3A 2ZAOA 4EUFA 4Y6GB 2IRWA 2W11A 4KXQA 5JJBA 2AHME 1USIA 1D2GA 4QRIA 3DOHA 3LHIA 1DY8A 2D1TA 3HEAA 5FPPA 4L27A 3CJTA 5LB4A 2IHYA 2OXRA 2YIJA 4CRGA 2SNVA 3GYMA 1TB4A 4DRXB 4MHSA 5EGMA 3A4IA 2B1RA 4E2ZA 1RQPA 3CZRA 2CFOA 7AT1A 5GVRA 2IIQA 4O0LA 2SGAA 4JQZA 1NM5A 1KO8A 4GZMA 2IUEA 2NXNA 1VL1A 5BWBA 4I8LA 4YNBA 4N6NA 4ZJPA 4IQ8A 1U0RA 4PLFA 1H0RA 3UXMA 1EFRA 1HX7A 4YP1A 3LUHA 3UWDA 3F67A 5GOTA 1HUTH 1DEOA 1JI0A 3DBHA 3EVBA 2GD6A 2WMDA 2IC5A 2QROA 2BN4A 4XBCA 1W47A 4FFSA 1J0EA 2YJNA 4UTZA 2ZTXA 3RS7A 4LXIA 3TOCA 1LNSA 3H84A 1SQOA 3PJRA 4G1BA 3EXAA 4RHTA 2QVZX 2ZDNA 2C57A 4EO4A 3UB4A 4C6SA 3EIFA 3KDAA 3WB9A 4D3ZA 4JYCA 2CW5A 4GP6A 1SNYA 2GJ4A 4X3OA 3BZWA 2X9GA 2CYAA 3QUSA 2NQ2C 3G0HA 5MDHA 2JVKA 2VSFA 1P1BA 1Q12A 3GCWA 3U1BA 3S28A 2VF2A 3BULA 4LJ7A 3CE9A 4EA7A 2QP9X 4N3GA 1CNEA 1CA0C 1IQHA 1FB5A 1HBTH 1K3TA 1TEXA 1MFZA 2HHLA 4TTRA 3PIRA 4U00A 5JZSA 1YJCA 3FO8D 3KP1A 4R0IA 2NO0A 1OI2A 3DOCA 4D5EA 4DMLA 5EYPA 2AN9A 2KE5A 1XPOA 3FUCA 3M6UA 2OGSA 4M1QA 1HLDA 5EY5B 3E5NA 4OM9A 2BEWB 2HPAA 4ZDWA 5ALOA 1KFBB 4ENTA 5AI6A 2GBPA 2VP3A 1V9CA 2F3RA 1QIDA 1G5QA 3PX2A 1JDPA 2QW1A 2IQ5A 4UHEA 1KJYA 3P4XA 3GRUA 3LQQA 3UB3A 1V2JT 5I4IA 1NDHA 5TF0A 2BZ1A 2PR2A 3OLQA 4A6PA 4D9JA 1XVIA 2JAQA 2HQSA 1SZJG 4MMZB 1T2AA 5J3OA 3F4LA 2JLRA 4JP3A 3TFOA 3BMCB 3EUWA 3U39A 5DGXA 4DEYA 1WXFA 3G3EA 3OEWA 4P31A 3HCAA 4IKEA 4ARZA 1H1TA 5LSAA 1M9NA 4BRUA 3E0PB 3D4PA 4L85A 3DS8A 2BMDA 1QRZA 1JDZA 2WSLA 4UOQA 3RC1A 4D7AA 1E5VA 3R5HA 2GT1A 2KCOA 1MQAA 4AZ3A 3K70C 1NJ6A 1Y8QB 1EI9A 4WOKA 1O2MA 3UWIA 4L9AA 2G9ZA 2PMBA 1CF2O 1EXWA 2O8DB 5IAOA 5G4LA 3S2GA 2CWDA 5JD4A 5C8YB 1EGAA 4ARSA 4EY6A 2HQBA 3FTFA 1THSH 4COOA 3EGDB 3EVTA 3O5AA 2ZUSA 3E9YA 1JG2A 3FN8A 1GG6B 2FX3A 3KJGA 3KKPA 2Z3CA 1Q3XA 3RARA 5SGAE 1K68A 1KNXA 4OYHA 4Z4RA 4BNGA 1MU0A 3I37X 2NXWA 1XVOA 1GRRA 1YP9A 2X8WA 5AUPB 4F6RB 4K8OA 1S0RA 2ZBUA 2JH9A 2QTVA 1PJ4A 4F84A 2VP4A 3CEPB 2DZDA 1HUQA 4BFCA 1W10U 3FANA 1KC1A 5HZAA 1CUEA 2AFRA 2R6ZA 1WZIA 3NGXA 4QUBA 1NP6A 5EMMA 1HE2A 4UHJA 4MLDA 3KJHA 2RHBA 3SYRA 2ASVA 4UXJA 5EJFA 5YASA 2Z8ZA 2LZ0A 2BFWA 3AJDA 5AW4A 3W6OA 5LP6F 4DYHA 2FEQH 3STYA 2G4CA 2IEIA 2WIGA 4Q0MA 4HYTA 4HD8A 3HZRA 3O8OB 1KVSA 4X7MA 4X5OA 1KQPA 4YJFB 4MI3A 2ZWIA 3TTWA 1VHOA 3O4RA 1P2VA 1DCKA 4YI3A 1XEXA 2VT2A 3OTQA 4BPRA 4XUEA 1FY8E 2CF4A 1YR2A 1XU9A 2X86A 3SM9A 5SYNA 3AX6A 1LMWB 2HJSA 3NDPA 3AIKA 5GVSA 1QHGA 2MYTA 4LYDA 3ZY2A 3GBSA 1U11A 4QRHA 4IDNA 3EBLA 1PR9A 1U04A 4EI8A 3WIEA 5AKXA 3F2FA 4CBOA 2A59A 3G17A 4X94A 3RDPA 3F9IA 4PGMA 5J2UA 3EFOA 4O02B 2GAOA 4TXLA 3TI9A 2WYGA 5A03A 4WE3A 3Q98A 1RRKA 2VAPA 3X43A 4BP1A 4JLWA 1GL3A 3WBKA 4FEAA 5ICSA 4U3JB 2X0FA 4D81A 2PSEA 3DBOB 3RB8A 3D1VA 2FUNB 4FR0A 2IU0A 2ZYGA 3QTVH 5L45A 5TJXA 3PMHB 3MHTA 1L4YA 1WQSA 2NZ8A 1GCTC 3MWYW 3EZGA 3MPOA 3CV3A 3LNTA 3NEJA 5IH3A 3RVMA 2A67A 4JR0A 1IPFA 1GARA 2VHZA 3O3CA 3FDZA 1TM1E 4JNCA 1R1DA 3FRIA 1I4EB 1NMYA 4G1EB 3DL4A 3PHLA 1L5OA 4F96A 2ATXA 3SZEA 3ZVKA 3LJOA 3V48A 1FQKA 3H2SA 1TJ3A 2XWAA 3RVRA 4DCUA 1PJ8A 2PAAA 1BTZA 3WRXA 4ZCNA 2QTLA 2FOHA 2R00C 4LV5B 2VA8A 5DT2A 1XMJA 3QI2A 2XBLA 1RKXA 3QKUA 2NU8A 1B1AA 1HQYE 2OMKA 4I7YH 2WSSA 4HVTA 1SRRA 2CMDA 2GLXA 2FOAA 2WHEA 1J56A 4U6SA 1GYPA 1CVIA 1DKOA 1BOQA 2LBPA 3O0DA 3EQ0H 2OM6A 1M1KD 4HDOB 1E1RD 4CLRA 1H2ZA 1UJ4A 4MYSA 4R2XA 3KIDU 3OJXA 3ANXA 2N1MA 4AS3A 3R3YA 2EIXA 2RHCA 3H3FA 1I6WA 4OI0A 1J6UA 4RDKA 4QYIA 3TE7A 3ZBUA 2B9VA 3C3XA 4Z9XA 4NE9A 5FO1A 3AOGA 1JWTA 2XCIA 1YCPH 2BE7A 2H00A 1UEIA 1US8A 5JJCA 8LPRA 5FTLA 3SSOA 2B0FA 4G1MB 3IPRA 3EGKH 2O7RA 5LQRA 5I45A 2XHZA 4FJ1A 1QC5A 1OA1A 3UB2A 1KJNA 1MH9A 1ELGA 2VNSA 1NDQA 2C2MA 4EM6A 1PL6A 1IQLA 2BXTH 4RM3A 3GJTA 1W93A 2PX8A 1JA9A 1QUFA 3TXXA 4LDPA 4L9WA 3TH5A 4Y6OA 3L8DA 1E3ZA 3EW9A 1IYZA 3A1FA 7ADHA 4Y6DA 5JANA 5E6SB 5LBIA 1XJ0A 2FEXA 2QL7A 4TKMA 3PVDA 2XB6A 1DXYA 5I9BA 3SOPA 1Z73A 1W6UA 1C5SA 2G5TA 2WYUA 1T4UH 3A3OA 2G67A 2O0MA 1MEJA 2PV0A 5E7JA 1IWOA 4NA8A 2KAIA 4P25A 2OINA 5C2ZA 1QL9A 2Z1DA 2J3KA 3F73A 3F8TA 2WUFA 1U2PA 1HKUA 4B2PA 1X9IA 4M7GA 3SJCA 4XUCA 3BIUH 5MGNA 4X97A 4OHUA 4XRGA 1TCAA 4PSAA 3LUCA 3FRJA 5E2BA 3DEHA 2B4RO 1GBHA 1RM4A 4KVAA 5DK4A 2YV4A 4ZCTA 4I8GA 5H8WA 1OFVA 1AKVA 3LIIA 1XGKA 2ZDLA 1N5LA 4B35A 2QC2A 3L92A 2V5UA 3LQ2A 2WVHA 4CR6A 4PVCA 1NN6A 3KSBC 4UVHA 2VSOA 4EFMA 4MTLA 2SGQE 3DAPA 2NSJA 5GQSA 1EK2A 1K6EA 4ND5A 4W4TA 4BU1A 2ETXA 2FQ1A 4B2LA 4ZQHA 4UW9A 1HDZA 1GBKA 1VQ4B 1QF9A 3RXOA 4RFVA 5AVJA 3BA1A 1R9JA 4HEHA 3P0RA 1QIXB 1PZNA 3N86A 1NQOA 2WWVD 1ONOA 1QH9A 3TQCA 3ZXSA 1NRXA 3OQJA 5G4BA 1AJEA 1IOLA 1PSZA 5C35A 1KOGA 3BMOB 1GBFA 1Z29A 3QKTA 1PGOA 1E69A 1VCMA 3RQIA 4ZQFA 2QI9C 3GA5A 5H7XA 3BWVA 4NKRA 1PR0A 1O3HA 3P9IA 4C0SA 2WZBA 5D84A 3AP2A 1B1CA 5HF9A 4WKBA 5A0BA 1HMYA 1ZJJA 1C4XA 5HDBB 4RYDA 4KPFC 3Q3AA 3LPLA 4JU9A 4FZJA 1GZ7A 2FV8A 3ZIAD 1UBHS 1N7JA 2MSEB 3GUVA 1ADJA 1P7WA 1KTVA 2TGDA 3OWHA 2G51A 1W8IA 2Z56A 2E4XA 4ZARA 1V8DA 3KR1A 3B53X 1U8FO 5AKKA 4GQIA 4OREX 2WM3A 3PRKE 1SAYA 3JVIA 2C7OA 3HBJA 1ESBA 2P2GA 4B9AA 2GYWA 5AIAA 1PFXC 4FTWA 1OT5A 1M2GA 3UW1A 3L5OA 4CKEB 4II7A 2ZVJA 4LJ9A 1TMOA 3WLHA 2JFYA 3AF5A 3F5FA 3OE5A 2FS8A 5EXTA 4M7OA 4H6XA 1XVMA 1CZHA 1BS1A 5CA1F 3AKEA 3S5JA 4R9NA 4O8CA 2IIBA 4RESA 3CH7A 5EXLA 2VJNA 2ZE8A 3ZCQA 2FVXA 2P90A 2QXIA 3VJKA 4DLXA 3LYHA 4AN4A 4WKOA 1TYZA 3S9BA 4HWGA 4I9FA 3RU2A 1I1NA 4UTVA 2AFIB 2QVYX 1RI4A 1ELFA 4LCEA 4N7BA 1YIAA 5DNAA 4N7RA 4XSVA 1LQTA 3E18A 3PKZA 1V1RB 2VSXA 2CMGA 2P5UA 4E7OA 2XB2A 1ENOA 5I8PA 5TPWA 2C97A 4IHJF 5BQ3A 3KKZA 1K1EA 3OEEA 1VPTA 1ZUNA 3HO6A 1YDGA 1QVGB 2XADA 1T4VH 3T7IA 4XCQA 4IIJA 3IBGA 1AU9A 1UT6A 4CGZA 1JHOA 1XKLA 4Q7LA 2A1IA 4CRDA 3TB4A 2Y66A 4GRDA 1O87A 4L75A 3DTVA 3E15A 3JV7A 1M1NB 5K3SA 4Z4YA 1EZ1A 1C1XB 2DJ5A 1FP7A 4GE0A 3RIEA 1Y5BT 2XCQA 2BX4A 4MS1B 5A62A 2PUFA 2JLAA 1W5FA 3T9AA 4AJKA 3H6KA 4K60A 4ARAA 3SFZA 1SL3A 2Q3FA 3H2BA 3WK9A 1TMUH 3KQVA 4ZOAA 3AYZB 3VR6A 3MXOA 1W4RA 4PO3X 4EO7A 3HXQA 3SS8A 3KPVA 1DEHA 3DFIA 2JAPA 4IDEA 5EIXA 2PGDA 2WYJA 1RCTE 1CKEA 1TYNA 3TJZA 3PLPA 1EQ9A 3WADA 4M9CA 3HY6A 4Q47A 4UVGA 5FUBA 5K0NA 5CCEA 4TY7A 3Q2OA 3SEZA 3LWZA 3GH3A 4FOUC 2BYAX 3N0RA 3F1KA 4IWYA 1M1YA 2H5DA 1Z35A 1J2JA 3OZGA 3DMNA 3ESBA 1AK2A 2ZO3H 4R69A 4FUCA 4GD3Q 2ZJ2A 3TMYA 3A3BA 4V0RA 1KI7A 1HOTA 4AM8A 1JTEA 2BDIA 1T4CB 3CXUA 5JEDA 1E3XA 1UMCA 1OZAA 1YHNA 2C8LA 2DHEA 2B1QA 4KKUA 2PGNA 4E33A 4XWKA 2J95A 3MJVA 1AIXH 5JMTA 3UCFA 2OV8A 5H80A 4FLMA 4Y2UA 1E98A 4E2WA 3V0XA 2AX3A 4M7RA 4L8VA 4TXHA 4PBTA 5C4GB 5CM2Z 3UKDA 3KFVA 4P6YA 1ZDMA 2PRZA 3UAYA 5K0SA 4OMUA 1KL7A 1O33A 1SBNE 1IXSB 4KK4A 4EK9A 4UTXA 2A57A 1V2UT 3F9RA 1VQLB 5BN4A 4N41A 5HXBA 1PJ5A 4L3WA 4IXNA 2G4UA 1UJ5A 4HEQA 4C2AA 3TM4A 4RVCA 1O57A 1PT9A 2ZANA 1ZJ5A 5KSPA 4DC9A 5IJZA 5L3RA 3AG6A 5H0IA 1D1NA 1ZNQO 1TUGA 2WK1A 5I9SA 1VLMA 3VVBA 4FCVA 4MDHA 1SC4A 4ND6A 3WWZA 2O3UA 1NGSA 2FETA 2ZIFA 1VKHA 5JI2E 1DCFA 1I0ZA 2YXNA 3HC7A 4L5IA 3Q6RA 5CVJA 4IMPA 2E5FA 1F1BA 1IUOA 1W2BB 1FRZA 3H0EA 2CVOA 1DAIA 1P02A 4XBDA 3GQBB 4A23A 1TAGA 3VZCA 4JLBA 1YTUA 1XVVA 1LXCA 3RNOA 3L93A 2JLYA 2H9HA 3HXOA 4NV3A 3ZZ5A 1M1UA 2AOTA 5ALYA 4F4HA 3JQ7A 3R0XA 5D6OA 3CMMA 4MR7B 2EKZA 1JB1A 3GWZA 1EFPA 3DBRB 1BCSA 4X1OA 4EYKA 1AS0A 1Q82D 3D23A 4EJSB 1UTLM 3BF7A 1N5MA 1J49A 2YTZA 3KM0A 1M34E 4BUZA 2WJJA 3QIVA 1BFKA 3CXCB 4P81A 4GPZA 4JA2A 1T43A 3TOSA 4ZJYA 3SC2A 3CP2A 3FOFC 3P2OA 3FRHA 4Y3UA 1OZHA 3RV3A 5I51A 1MC5A 1WKVA 1XRPA 4P54A 4E7RG 1YZFA 3SBKA 4MW7A 4IOMA 3UK7A 3GV0A 1C1MA 5C94A 3DDSA 3TSZA 3KFXA 1YH3A 3U37A 1H3EA 5I9IA 1L7DA 3AVWA 4GFDA 2G5PA 1A5HA 4EFKA 5F9HA 1A4WH 2J97A 1VSQA 3U61B 1S72B 3RRNA 2FEAA 1XDSA 3KVRA 5HTOA 5I4BA 2WWFA 1NAIA 1Z5OA 1ZU5A 5HHTA 1F7UA 2F9UA 3KQBA 3PHBE 4IV0A 1Z22A 1YPJH 5DM60 4JUCA 4BECA 5AW8A 3MT8A 3SK0A 3JQ6A 3UOGA 1M90D 1YRHA 5JQGA 5U9CA 4TTTS 1M8PA 3AUJB 4HE5A 1Z0DA 1Z39A 3IDAA 2M5SA 1TPOA 4XH9B 4M6WA 2YVKA 3NHJA 1FZQA 1JLRA 1CEQA 5KYWB 5ABWA 5LL6P 1KI9A 4ZGNB 4XYGA 2V97A 4LTMA 3F46A 2QD3A 2XMRA 3UA4A 2TBSA 2X4LA 1NLUA 1Y8RB 1TTHA 2G8NA 4X91A 1MTWA 4CLEA 4BBJA 1DDJA 2Y1GA 1CQJB 4UFGH 2FZKA 4HDSA 1UJCA 1F6DA 2Y1WA 2XCRB 1ZR2A 1SFRA 2W6ZA 3DP9A 1P9RA 5DZSA 3TTSA 1SCDA 4HS4A 1GKIA 1Z0ZA 1TVKA 1EDDA 3SJUA 4E7PA 4ABDA 1HLTH 1W44A 4FYJA 1P0QA 4MINA 5CM8B 3TRJA 4ZXFA 4YDSA 4FFPA 4HAIA 5JQWA 5AI0A 5IT9A 2B5VA 1UHBB 5IZ4A 2Q6DA 1FDSA 4MVNA 3AB8A 1GGDC 3I5AA 2FPSA 1RFLA 1YJBA 3WIUA 1WLYA 4OK5A 2ALJA 4Q1VA 4IQ0A 2BD5A 3HSKA 4FQ8A 4KK3A 4YJKA 3DHKH 2RI1A 3KT6A 5IVDA 4I4CA 5C2JB 1WQ4A 4G6ZA 4ZAGA 1NJ5A 5DM0A 5A9SA 4Y8XA 3LH1A 1H2AS 4TV9B 4LE1A 3AU8A 1LF5A 3FB4A 3R6TA 3E8XA 5JJIA 1W2WB 4OBXA 5EERA 1UPTA 3WL7A 2QJWA 1T5HX 3KE9A 3CF6R 4XARA 5DXAA 1UMDA 1D3TB 2X3FA 3IEVA 1SCUB 3SGLA 1C1HA 3TG8A 3MIIA 4CEIB 2QUKA 4XIIA 3WFZA 2CWWA 4OFBA 3OZVA 5JLJA 4DDVA 5T5QA 2IWRA 1L5MA 1GHBF 1YQUA 3AM5A 4MKZA 3VZBA 3FFBA 4JP5A 4NU5A 3ANNA 4X95A 5SICE 3Q6IA 5FI3A 2EJTA 4D9GA 5L4NA 2YJ6A 2OUKA 4JS0A 1M72A 1CQIA 3A84A 1C8VB 3N39C 1BNCA 4ZVNA 3TL2A 1QQ5A 1OR8A 3IR5A 4QLBA 4IHJB 1YTLA 4C6RA 2BFBA 1G2MA 2FQWA 1CDOA 1S2GA 3JWPA 3WNQA 4G5FA 1KXAA 1N36B 1BRMA 5I47A 4FVDA 2W4IA 5C81A 2G76A 2BFFA 4WLEA 1NZDA 5DO9A 2BKEA 1K1MA 4MAFA 2C2HA 4XA8A 3PTLA 1VBKA 2P3TB 3B36A 4CW7A 1QOPB 2GN6A 1U1FA 1UXJA 1DP4A 5K3FA 2OP1A 2D62A 4OP7A 3FDXA 3I8OA 2WPKS 1XXFA 3BSSA 5A5DA 4CL0A 2WZNA 2FOBA 4KX5A 5ICGA 2HCBA 4M1EA 1FTYA 1CFZA 4OHMA 3RYCA 5GMOA 4B6EA 2BTOA 4ZK2A 3OMLA 3F4BA 2WU1A 3LGVA 2OHHA 3FR7A 1E92A 4DJAA 2HB6A 3OQMA 1VECA 3UUFA 4YAUA 1CJBA 2VBSA 4EPXA 1EWKA 1OH6A 2HLPA 1BG6A 3ZCUA 4KDFA 2PT9A 1CGJE 2ORED 2WPNA 1BMDA 4IH4A 4TTQA 5IANA 2PO7A 1MDBA 4XRNA 3TNTA 5C17A 4ASHA 4B79A 4NNPA 5KWEA 4EYEA 2QZ4A 3EDYA 2OVFA 2Q9BA 2HSGA 4M1YA 2BVXH 2R85A 4DNOA 3CNRA 1WABA 2N0SA 3RBVA 4IOJA 3GPCA 1BUIA 4X8HA 2YRWA 3RTBA 1IQJA 5JO9A 4HDKA 3BDVA 3KEMA 3U6BA 3PB1E 1BHO1 3WMWA 3W79A 2OLKA 2J9FA 4X8VH 1MC1A 2REXB 2R48A 4AJHA 2PGXA 5MHTA 2W6PA 3AUXA 3X1XA 4TLDA 4LHZA 1RHUA 2VF5X 2TRSB 1ZJZA 1OXXK 2JIQA 3QKSA 5FBKA 3RXGA 3MU5A 3COZA 2OILA 1YR9A 2HOBA 4ISOA 1FFBA 4YTAA 3PWBA 1J2YA 4Z4CA 3MWDB 4BLVA 5BSRA 4LGYA 4O4IF 5CXXA 1W13U 3W1VA 1ZJ6A 1NJID 2ZZQA 5SY9A 1JMVA 2PYZA 1HLGA 2ZITA 3PDJA 2I34A 4IXWA 3U3XA 3DAOA 1V2LT 3A83A 3RODA 3QUAA 1YX2A 2D0DA 4ZYXA 2CKDA 4K05A 1Y9EA 3LPDA 1IZ7A 3EZ7A 3MD9A 3NBZC 5ESDA 1N2ZA 3IDFA 5PTPA 1FPMA 1J1UA 2J9RA 1MX5A 4G65A 4L5AA 1QB7A 1EFKA 3OZWA 2ZR8A 2ZIXB 5JAOA 4MRNA 3QLTA 5J59A 2H9YA 4CGYA 4U7GA 1J2EA 4B0PA 4XYBA 4KRXA 1QCZA 2GJAA 1TPYA 3PA1A 3F3KA 3AH8A 4IJWA 4B6JA 2JCBA 3F6BX 2AG0A 3U1JB 2F9PA 1Z63A 3KSDO 4YO9A 3DT8A 4MI1A 1WVIA 5K0BA 1K8YB 1KRXA 3STIA 2DWOA 4MR8A 5CFZA 2GCGA 2Q99A 5DI3A 3AHCA 4XFJA 1Z7EA 3TMAA 3S1AA 1PV1A 5KNCD 1WEHA 4IIBA 2BFCB 3SZUA 1I4OA 3T7DA 1ICIA 1GGNA 5KOHA 3EIUA 1A9YA 4B82A 3NGLA 3B8HA 1O3DA 2DPXA 5A0FA 5M7EA 2KW5A 4X6YA 1T4GA 4XDHA 1KI3A 2OHVA 2AG1A 3A8CA 3F8WA 4CQMB 1PZGA 1H0KA 2NAPA 1AKUA 2PUTA 4KTSA 3RLFA 3NM6B 1AXRA 3ADCA 3NH6A 2F9FA 4QM6A 5GPBA 3TSYA 1AU8A 5AW1A 2WT9A 4JI6B 3GCHC 1JU4A 3VR0A 5LU9A 3CC4B 1MRNA 1ITZA 2R25B 1TQ8A 1T9AA 4JENA 3MOCA 1CEXA 2QD1A 3QMMA 1K22H 4FB5A 1B5GH 4W8GA 2PLFA 3VPCA 2A30A 3CPJB 2C2OA 3GRKA 3NNSA 3DSPA 3N8GA 4NVRA