4ACBA

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
469
structure length
448
Chain Sequence
b'HMDFKNINLGIFGHIDHGKTTLSKVLTEITIDIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSLATION ELONGATION FACTOR SELB
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
total genus 97
structure length 448
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acbA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acbA01
5GVSA 4IEIA 1C1YA 1U0LA 5C46F 1ZM3A 4DLUA 2JDID 1F2TA 1UDXA 4DLSA 3NXSA 1FOEB 3P1JA 1XD9A 3FKQA 1Z6AA 3KFXA 3G82C 3NG1A 5CK4A 3I92A 1VQNB 2Q9AA 3ASZA 2GCOB 1FRQA 3K0FA 4MUAA 3BB4A 1C9KA 3SFZA 1CJVC 1LF0A 2CLDX 5CK5A 1VCIA 1P9RA 2W0SA 3HP1A 4P32A 3VHLB 2YC4C 4FMDF 5D3QA 1BIFA 3GJ7A 4OK6A 1NMYA 1T91A 4I1OA 4PO8A 3THOA 4ZKDA 4MDFA 1TQ6A 1HY3A 3AVVA 3IUYA 1UJ2A 3H84A 1BX0A 1Z3IX 4EDHA 1CP2A 2UZ3A 5FTKA 1OH8A 3LX8A 1SQ5A 4Y7CA 1KKMA 5DLQC 1L8QA 4DT1B 3B9QA 1O3YA 2ZR9A 4LBVA 3EIHA 2NO6A 2ONKA 3GFOA 1YZTA 4QKQA 4ZCLA 4C0SA 1QHGA 2ZE6A 4DLXA 1JB1A 2R6AA 4GSYA 4OI1A 2F43B 1Q44A 1ZM7A 3CC4B 4KXFB 2LKDA 2BVNA 4WXPA 2IF0A 4LHXA 4AIIA 4JKIA 2D62A 4E09A 2QGZA 1G3RA 5CITA 4PZZA 5DO9A 2F1HA 1D2EA 3DM9B 3HU1A 1P3JA 3JQPA 3TQCA 1J8YF 3PVSA 5EE5B 1GAJA 4B3BA 4OI0A 1AA9A 1NLYA 3WYAA 3NIBA 2IYQA 1JALA 2V1UA 4R71A 4KFUA 3VR2A 2IYUA 4NL4H 3ZBUA 3ZZUA 1CJTC 1E9SA 2A5GA 3T5GA 1GAWA 3AVOA 4PQYA 4Q66C 1U98A 5J4LA 3K70B 1BYIA 3K53A 1DDIA 3GLIB 4IDQA 2ZU0C 2O8FB 1Q20A 3C16C 2ODBA 3LBNA 1KY3A 4TWZA 4A0HA 1S96A 2XZPA 4QJ4A 5FI0B 2QTZA 4AF7A 1CJKC 1HE1C 1NN5A 1GZSA 1R0ZA 4YDHB 1US8B 4Q9IA 1S1CA 2CBZA 3A1WA 2Y8EA 4JLBA 4HLDA 2ZSBA 2X1VA 3IDQA 4FW9A 4KAXA 4E07A 1R10A 2BC9A 3QUSA 2Z5FA 4YXWD 4BPBA 4ZO4A 1W36B 1XTQA 3RABA 1S1MA 3QY0A 2ZI4A 4NCIA 4TQ9A 4B3CA 1KO5A 5J5CA 1WE2A 4NPHA 4OHXA 2W2TA 3U3MA 1TTTA 1FX0B 4BFTA 2BEKA 2XTMA 2Z6VA 3RSOA 2VQSA 5GJWC 4BZXA 4A2QA 3FMOB 3WP0A 1NMXA 1TVCA 2XNJA 1VG8A 3CCUB 5G41A 5JJLA 3PUVA 3THWB 3OZWA 2Q9CA 3AF1A 3F3YA 4FD2A 1B0UA 4QFMA 5A0FA 3UWOA 4TMZA 1UADA 4W5WA 1XCMA 2QPTA 2YJTD 4DUGD 3R8CA 2HDNB 2C96A 3C15C 3ZD7A 1FNDA 1P2VA 2Z43A 5DI3B 3WMGA 1F6BA 3DKVA 4C2UA 4CF7A 4F4IA 1NVUQ 2N46A 2BOVA 2V6JA 2WKQA 4OK3A 5L3QA 4IVQA 4MRRA 4R2IA 4QG7A 3BJIC 1LFDB 2XJ9A 2QDXA 1Z6YA 3QF4A 2YOFA 4LYHA 2O8BB 3EWAA 1JAHA 1BQEA 4TQAA 3UKDA 5A4JA 1XTSA 1OB2A 1S4QA 2PCJA 5FOXA 3GQBA 1EP1B 1QHIA 1N5IA 4XD7D 4OBEA 4POAA 2ZRPA 2FZLA 4IHQA 5JCZA 5FR2A 1AMOA 2C99A 3WYFA 1L4YA 1KSGA 3CIOA 5EUMA 4URUR 2ZANA 4QJ5A 3I55B 1KO7A 2ZR7A 3CRZA 1AIPA 2NZJA 3QFRA 4TT3D 4PSVA 2ZETA 3ONWA 3EC2A 1T8UA 1SXJA 4BLPA 1E2JA 5HCNA 1WA5A 4V0LA 3E1SA 5DSZA 3LW8A 1GJRA 1UKEA 2XSZD 4QNRA 5HZHA 3LV8A 2GKSA 4CEHA 4B4DA 3W5JA 1JR6A 1S72B 3CF6R 2W58A 2FN4A 3KDSE 1P62B 1M90D 1VG0B 2RGAA 1ZP6A 4LCBA 2J45A 3THYB 1AS0A 1DOAA 1H85A 5G3YA 4JLAA 1AGRA 1GR1A 3WBKA 1PJRA 4Q9HA 3JVVA 4MYTA 3S1AB 1YRBA 1I4TD 3QXCA 2GXQA 5FUWA 5AJYA 1YR8A 2EQBA 2WM9B 2YC2C 1UAAA 1RFLA 1ZCAA 3DO6A 4II7A 4BE7B 4Q4LA 1R0WA 4O2LA 1TU4A 3L2OB 2OLJA 2JJ2D 2ZYVX 4NYMQ 1QRAA 3W3AA 4DSUA 2WIAA 4GMXA 4IFEA 3SE0A 4LYFA 2AL7A 4EFMA 3G0HA 1AGPA 721PA 1KZ7B 2H5EA 2ZI9A 1YJNB 2WKPA 3R9WA 2DEUA 4MYUA 3PIRA 3DL0A 4AY2A 1J2JA 1G21E 3KJEA 1KNXA 4N1AA 4HAYA 4QM6A 2JATA 3D3QA 3NBYC 3Q5EA 1G8GA 1AQUA 2V9PA 4IDOA 4KSCA 4DCSA 1Z29A 2J0UB 2ZRLA 2W2VA 4HDQB 4B71A 2GXUA 4D4MA 2YWEA 3IO3A 3AGQA 3WMEA 3VNVA 4TMTA 4GZLA 3SJCA 2JLZA 4A8JC 4UJ3A 2D74A 3QPWA 1ZCBA 2BBSA 3ICQB 4TQUS 1G19A 1T3SA 2ZSEA 4HE5A 1Z5ZA 1PZNA 2FWRA 1UFQA 3X1WA 1UKZA 2BGIA 4Z8YA 1KJWA 2HF8A 1N6KA 1OXVA 3T1TA 3LO8A 1Z0IA 2YOHA 3NC1C 1Q57A 1G5TA 1T0JB 2VTKA 4D81A 4DEXA 4EPTA 1TEXA 1UF9A 1R5NA 2F3RA 4BZQA 2YOGA 4AK9A 3U44A 2H17A 1FP6A 4M9XA 1XFAA 1UKYA 2PT5A 1IQPA 4WW0A 5EE0A 1FQJA 2CEAA 4P4SA 1E9RA 1CXZA 2NIPA 1E9AA 2FGKA 1E1RA 3BE4A 2OCYC 2R6DA 5FPTA 3X2SA 4XWKA 2BDTA 3VAAA 4HB4A 2PBRA 2XZLA 1OYWA 3PXGA 2XITA 4ZKEA 1ETUA 4R2HA 1Z28A 3QF7A 4TZ6A 2P0EA 4AYTA 1Q22A 4NHOA 3FMIA 1JR3E 4CT5A 4Q03A 1P6XA 3V76A 2GPJA 4P33A 1G8YA 4UNQA 1OIWA 2VHCA 4B2LA 5K8TA 1N6NA 2IXFA 5AK0A 5L8VA 2LWIA 4PHTA 3MHPA 1CBUA 1VYUA 1KKLA 1Q1EA 1T8TA 2R62A 1W2BB 3HU3A 4GMDA 4QRHA 4YALA 3HDTA 4NONA 3TAUA 3B1VA 2XXAB 2UKDA 4HB3A 3VU9A 4L16A 5EZ6B 4C3ZA 4KODA 4ZI3A 3QPVA 1KIMA 2NTYC 2WWGA 3DOEA 3GFPA 3EAQA 1ZMXA 2VHJA 3PFIA 5KSYA 1D8TA 4H9GA 4GRAA 3UK6A 1YE8A 2UVQA 2R6HA 4P3YA 3FMFA 3IIJA 4YLGA 3QFSA 4K1XA 4Y9RA 4AF6A 3ADBA 2KE5A 1YZUA 2O8EA 2QEQA 1K6MA 1E0SA 1NDHA 1T6NA 3C7KA 4I1VA 4YMSA 1XD2B 1G8PA 1T4GA 2AWOA 1SVSA 4Q4AB 3UG6A 1IB0A 4Q4HA 4DC9A 1S9DA 2RGCA 1DPFA 1LV7A 2ORWA 3LBIA 2GJKA 5FPKA 2GF9A 5TB5A 3V4RA 2GJ9A 3R7WB 5JZVA 3Q7PA 4RCYA 4ARZA 4R7ZA 1Z0DA 4RSGA 1DAEA 2ZRIA 5SZJA 2WZQA 1MH1A 2FDCA 421PA 2HLDA 3F0TA 5LB2A 4KFSA 3B1XA 4TL7A 1W2HA 3W2HA 1TF5A 2ZRCA 3WRXC 3WNCA 1II8A 4YQFA 2OTLB 3R20A 2FG5A 2CJWA 1VHLA 3AVUA 4TMKA 3RWMB 4AYXA 5JS8A 2O8CB 2ASEA 2FV8A 1QVFB 1ZU4A 4YAWA 1CR2A 1E2KA 2IYLD 4A6XA 1S0UA 3K0SA 2ONJA 1Z2AA 3CO5A 4I81A 2RGXA 1HURA 1YZKA 2XTNA 4PC1A 3RNLA 3JQQA 3OE7A 1E9BA 2IT1A 4TLBA 1Y3AA 3U60B 3OESA 5CYOA 1RYHA 1UBCA 2YNMA 4MH0R 3KXLA 4PZYA 2AN9A 1E2GA 1JPJA 4LYJA 1Q0UA 1E94E 5JBQA 2RGEA 2RMKA 4PSAA 1ONBA 4PX9A 4WBSA 2C78A 2F1IA 3M1IA 4Q21A 4Q5IA 4RVCA 5DE3A 1DO0A 2BMFA 2QBYB 1Z06A 2PX3A 3A37A 1N6IA 3RS2A 4C0AC 2YWFA 3UMRA 3THXB 3FYHA 3TE6A 3CONA 3W8NA 2ORVA 2EFGA 2FSFA 4LJ6A 1NKSA 1SVKA 1Q82D 4HEJA 3LO5A 4JSYA 4HLQB 2IYTA 1M6NA 3CRRA 2AK3A 3ASYA 1IONA 1MO3A 1KDTA 1Q1ZA 3T34A 1SVIA 3QKSB 1YIJB 1KOFA 2G1JA 3GCGA 4U5XA 3QNUA 2BSAA 2ZRNA 5UKDA 4LGMA 3HPRA 1R5OA 2VF7A 4F4CA 3ZC3A 5JI3E 1KAGA 3LVBA 2QMHA 5LDDC 4M22A 4ACBA 1CIPA 4DXAA 5G40A 1WRBA 2R8RA 2VLIA 1QHNA 5JRZA 4MGKR 5IDVA 3AEZA 1KO4A 1FW6A 4HSEA 1ZNYA 3DHWC 1TUIA 2HJGA 1NG9A 3HWSA 4D0LB 5J47A 2QA5A 2IEZA 4XVRA 4V02A 1MKYA 1SXJD 2EYQA 1OH5A 1P9NA 2CNWA 5A5GA 1QX4A 1MR3F 5F9FA 2ORIA 5IT5A 2G6BA 2ZE7A 3VO2A 121PA 4JLJA 2F3TA 1ZNWA 2QU8A 3AH8A 4IW3B 1YZLA 4PTLA 1GWNA 2GEDA 3BXZA 5FTNA 3SHWA 4FMCB 4BLOA 5K8LA 5AJXA 5SZKB 5CJ2A 2K5UA 3CKLA 3FWYA 3RVBA 4L8GA 2B7CA 2XX3A 2DB3A 4QM7A 4Q01A 1W4RA 3MD0A 1XTRA 2JEOA 1QDEA 1OFIA 1XU4A 3DMNA 3IBYA 3WRYC 2CL7X 1IOZA 1VCOA 5TARA 1SQRA 3ZVRA 2ZQ5A 2PJRA 3MSXA 2BBOA 4FCTA 4ZDIA 1OFTA 4TL9A 1B23P 1XEFA 1R0YA 1JB9A 4QHSA 3WP1B 4ON9A 4TMVA 5FOTA 4O3MA 1NVWQ 1OXSC 4K8OA 4G1VA 3EZFA 1UBFA 4IDPA 1H8EA 4DB2A 2V4ZA 4TL8A 4C7OB 3AB3A 2ZXUA 1WDTA 4WA7A 1EP3B 1W87A 2HCJB 1RE0A 4QGHA 4Q1BA 2KSQA 5DGXA 2P3SA 2RAPA 1VTKA 4FINA 3A6PC 1MO6A 3U6BA 4X8MA 3KUCA 2XNCA 3ZBTA 2FNAA 2SHKA 4B76A 3AVTA 3Q3JB 1KDRA 4FWTA 5CDFA 2GK6A 4UXIA 2B8WA 4D26A 1ZM4A 1IM2A 1ZNXA 2ANCA 1Q1QA 1UBEA 2IYSA 1R0XA 3NTUA 1QVGB 5LB4A 4A0FA 2JJ1D 1KI9A 4B3GA 2VL7A 3P4XA 3W6NA 5FOUA 5BWMA 2OEPA 4B3XA 3IHWA 2PLRA 2J41A 3MMPA 5JWOA 3SDZA 4EQ6A 4OQLA 1JEDA 4HDCA 3M4YA 4Q1AA 4AWXA 5L3SA 1AZSC 3Q72A 4L5BA 4KSBA 4DLRA 3CCJB 2QY9A 4EPWA 3GJ6A 2OG2A 1E0JA 3X1DA 4PC7A 1SGWA 1UM8A 2CMKA 2WSSA 2YKGA 3QJYA 1G1MA 2ZE5A 2EU8A 4UNSA 221PA 2PEYA 3WY9A 1NBME 3UWKA 4OQNA 2V8OA 2NO7A 2RGNC 3TUJC 5EXXA 4A8JA 2DWQA 3VFDA 1CRPA 3G5UA 2GJSA 4YAFA 4G5RA 2OUKA 3Q5DA 1OHHA 4ZIRB 1R8SA 1IAQA 5FR1A 1EWYA 1RYFA 4IEEA 2OSBA 2VSFA 1J7KA 1BO6A 2GK7A 4W5HA 3QVUA 2GXAA 1IY1A 3AVYA 1DE0A 3CZQA 2HV8A 2GILA 2VPPA 4CDGA 2F7SA 1KY2A 4Q19A 1G8HA 1QGYA 4LPKA 4PQRA 2VNKA 2YZ2A 1U99A 1KI2A 3BD9A 5FA6A 4PPFA 3KTAB 2NO1A 3NBFA 4BRWA 1FPMA 4Q1CA 1GKUB 1ZM9A 2QT0A 1E2MA 2R44A 2CCKA 5C4MA 3EXAA 1VQ5B 2VIIA 3M6AA 4MYHA 3SHFA 3VR1A 3K70C 3TH5A 4M1MA 1IN7A 2J7KA 2ZI3A 1QGZA 1N0VC 3HU2A 3CCRB 4KFTA 3KKPA 4NBSA 2Q0HA 1OJLA 4D4JA 3HPQA 5EXTA 5CJPA 4NE2A 3ZH9B 3ZQJA 2QENA 2JCSA 2VP0A 2EFDB 3JZAA 1R5BA 4M9SA 5DHFA 2GTPA 5FH9A 3I73A 2XB2A 2YINC 1KMHA 4HUQA 1W36C 4UAJA 5H70A 8OHMA 1ZUNB 3REFA 4WZAE 4RJLA 1XD8A 3G4SB 3K0AB 3NHAA 3TVDA 4YMVA 2AHOA 2RC6A 5BW8A 1R2QA 3QKTA 5IK2A 4OKSA 3I3SR 3IBGA 1WMSA 5KNDA 3LWNA 4ASUA 5GADl 2H1LA 2Q21A 4D25A 1GNPA 4D0GA 3ND8A 5CM9C 1JXOA 1EWQA 4Q4JB 4JL8A 1NI3A 1RRPA 3O8CA 3SQWA 4F4JA 2QROA 1YHQB 2XOKA 5FL7D 5CIQA 5E7MA 4JYBA 5AUOB 3EPHA 4PAMA 1PVOA 2DFKB 1J99A 4O0MA 3IEUA 1MABB 4C0HA 1ZRHA 2IBMA 4TL6A 1KI6A 1XCGB 2UZIR 5FBQB 1FTSA 4XWOA 1F48A 3GLHE 3SBEA 2KB0A 1L2TA 1W47A 4A1FA 4IOMA 1NKTA 2VP2A 1DELA 2D2FA 1S8FA 4OJQA 3LXRA 3OIVA 4KFRA 1XEXB 4AD8A 3UXMA 4DHEA 5HCIA 2XNSA 2DY1A 1XF9A 2FFBA 2WJHA 1G64A 3C5CA 4GOKA 1Q3HA 1VYTA 4PAQA 5TR9A 3CF0A 1TADA 4QHYA 2PZEA 5KDDA 5KHOC 5JECA 1QFZA 1E0KA 2V7QD 5LBIA 3SR0A 1Q21A 1IXRC 2OAQ1 3DOFA 5TVKA 4BQSA 1II0A 3G71B 2OBLA 3LLUA 1QHHA 4DIDA 2ODNA 3AUYA 4LV6A 2QSYA 1W0KA 1P9WA 1XMIA 2P2LA 2ZAOA 1OKKD 3TK1A 3MUFA 3N2EA 5G3ZA 2VNHA 3MCAA 4GPTA 1X86B 5GJCA 3RANA 4JT4A 2GVZC 3WNBA 5FTJA 4FXPA 1COWD 1YU9A 2OLKA 2FEMA 4LBZA 4OI2A 2FX3A 3AV0B 1QBKC 1EG7A 1PUJA 1EFUA 2OFOA 1R8QA 4TYYA 1CTQA 2ANBA 2HT6A 4TZ0A 3AF3A 4Q7JB 4X8OA 2JLUA 1A2BA 4MDEA 5DHAA 1OLOA 3PITA 4Q7KA 4URVR 3I8SA 3H2YA 1G7TA 1SHKA 4KJZA 2WWXA 3EPLA 2ZS9A 1ZBDA 3NBZC 4P6VF 1T5IA 2VNIA 4I1SA 4URZR 3U3RA 2BMJA 1JNYA 1U2RA 4ABYA 4KHZA 1I4LD 4CVNA 4DIEA 5JSZA 4TLDA 1E69A 2E1RA 1IN6A 2OV2A 2FPLA 4DZZA 1N6RA 1GIAA 5H59A 2DFTA 4B35A 1Q81D 2VF8A 3BFXA 4LHWA 5IF9A 1VQLB 2REOA 2REBA 3KJHA 4Q9JA 2GXSA 3BRWD 5DN6A 1U8YA 3W5UA 3TVTA 3Q8XB 2FEOA 1F2UA 4LSGA 4RD4A 4JBXA 4CRWB 2VP6A 1KO8A 2CL6X 3U5ZB 4DQKA 1AK2A 5B30A 4XSHA 3RYTC 2NPFA 1KHTA 2O8DB 3VO1A 1XX6A 1K8RA 3B8HA 4CEJA 1KNQA 4TLAA 3GLGA 2EWVA 4XOIA 1KI8A 2J87A 4LJ7A 4B74A 2GQFA 4ZDKA 4D4KA 1H8ED 5HR5A 1KJYA 1T0HB 3CXCB 3U4QA 4BLSA 4PAOA 3PEUA 1F3OA 4IVPA 4D6PA 2WJYA 4NCJA 4QBIA 2OBMA 4LV5B 3SFVA 1O87A 2DWPA 5P21A 2NGRA 3RS0A 3H4MA 2IX3A 1X8KA 1GNRA 3B1ZA 3K9LA 1F20A 1MT0A 4Q00A 1NLFA 3RRYA 3CH4B 1EWRA 3IPXA 1LS6A 2WJVA 1NVVR 4HATA 1EFCA 3FOZA 3WNDA 1UBGA 4BUJA 5D3MA 2ZVQX 3A4NA 1Y63A 1HTWA 3HYTA 4QGGA 1RRGA 1E79A 1QUFA 1RJ9B 2G77B 3QFCA 2JLXA 3VR6A 2W83A 5FFMA 1QHSA 1G3MA 2OCBA 3CZPA 4WVFA 2ZUCA 3L82B 2J0QA 4KCGA 2ZJ2A 3AM1A 4MRNA 4JLNA 1EESA 1JI0A 2OCPA 3W2FA 4UXJA 2A30A 4OHZA 5JCPA 1EX6A 1H8HA 1CNEA 1PLJA 4EKDA 3ETLA 2WJGA 1WQ1R 2VEDA 3GLFB 1AKYA 2NOAA 4BLRA 3AUXA 1Q7YD 5AJWA 1N6PA 1XXHB 4O25A 1J90A 2GCOA 3GFTA 3AQ4A 3FKSA 4MKIA 1ESMA 3I72A 4JLDA 4DRZA 2G0TA 4JL6A 5JFGA 1VQKB 3K8YA 1K9MD 3ZZTA 3LW7A 3BH0A 4GT1A 3ZJYA 3FHTA 4EFLA 1G3QA 4DLTA 5TY0A 4B32A 4PO9A 1M1YE 2KBFA 2FE4A 4YHBA 2QM8A 2XJ4A 3AVQA 3L0PA 3CB4A 4DT1A 3LH5A 1P60A 3LD9A 4BFWA 3DMDA 2JASA 1QHYA 2BWJA 3IO5A 3KFVA 2QE7D 2ATXA 4XJXA 3OAAA 2WPDD 3UMFA 1GG2A 2JLYA 3HR8A 2A7QA 2QORA 3QKRB 3CR8A 4U7DA 4HI0E 2CL0X 4WOPA 2GHIA 3ADDA 3IGFA 2IF2A 2IL1A 4OJKA 1E62A 2F43A 1HQYE 1OIVA 4GI7A 4AC9A 2RGNA 2OM2A 3JVUA 2J0VA 2QP3A 2OO7A 4FMDB 2C03A 2PCLA 1IN4A 1DADA 1X8LA 1EGAA 1W5TA 2FU5C 2WWIA 3GJ4A 1UPTA 2CNDA 1BYUA 2YVUA 5AUQA 2Q3HA 3BH6A 3FPAA 4GP6A 4JBYA 4DLZA 4EIWA 2X8AA 5H8WA 1OE0A 4GFDA 1CEEA 4QJ3A 1JBKA 4KBGA 4C0KA 2C9OA 3KB1A 3ZDQA 1IJFA 3ZGXA 5JEDA 4Q1EA 1G4UR 4ITRC 4Z1MD 2LKCA 3CCVB 1DVRA 1KSHA 2ZRFA 3A1VA 3A36A 3LQRA 4G01B 1XB2A 2AD1A 3EPKA 4LJAA 5IK2D 4ZCMA 1I2MA 1G20E 2BBWA 4TTPA 1KAOA 4H1VA 1TNDA 1AKEA 4EAQA 2JIZA 2BM1A 2O0JA 4JVMA 3ZVNA 2REXB 1E2IA 2WV9A 3BORA 5KO2A 4RD2A 2C5LA 3WXMA 4AKHA 4LV8B 2WWYA 3GLIA 2XOKD 2O8FA 1GUAA 1WF3A 3VQTA 1QF9A 3RRNA 4M21A 4HAUA 1BMFA 4NYJR 3RAPR 1A1VA 2IC5A 1E2FA 4ZPXA 1US8A 1G5RA 3VR3A 1KDPA 4PC6A 4MKHA 3VKGA 1JA0A 1OXXK 4MKFA 2NG1A 1VQ9B 2R9VA 4JS0A 4S35A 3JQRA 1W0JA 2ZYWX 2FOLA 3CC7B 1E98A 2IYZA 4FIDA 3C8UA 4LZZA 3EG5A 4NYIR 4TSFD 5TXGA 3EPJA 1FRNA 4B33A 1FX0A 3AVPA 2QI9C 4KV9A 3K9GA 1KMQA 3PEWA 1U9IC 2C98A 2CVFA 4OK5A 3I61A 2OHFA 4MQBA 1YI2B 1RRCA 1AZTA 2C77A 3RDPA 4UKDA 1E9EA 3THWA 3VNUA 5JRJA 4JLMA 2H92A 4W7SA 3LNCA 4DDVA 3DM5A 4LOAA 3DKPA 5B58C 2JLWA 2CCJA 3KQLA 4A15A 4RD1A 2ODWA 5AN9A 4JJKA 5J4VA 4A6PA 5DI3A 3C4JA 2IHBA 2XNDA 3K9HA 3GLHB 4QHTA 2VO1A 2ZJZA 4EJSB 4W5JA 3ADKA 4CEIB 4AYWA 2W6JA 3TR5A 4C0JA 5E4FA 1ZAKA 1Z6TA 3GJ0A 4KVGA 1P7CA 1MOZA 5SZHB 2ZS8A 4LRWA 2V1XA 3SYLA 1NVXQ 3QXSA 1E3MA 4LC1A 5CIWA 4CW7A 2AR7A 2ZRHA 1GP2A 4YMWA 4BLQA 3EZ9A 3I8XA 1FDRA 2GVDC 2J7PA 4Z8XA 2C95A 2F1RA 4XTCS 1DDGA 4TLEA 4M1OA 4DVGA 2OESA 1CR0A 1GL9B 1XPUA 2HXSA 4EPRA 2WOJA 2Z4RA 2DFLA 4NH0A 2GJAA 2QPOA 3SJBA 1QFYA 4NYJQ 2EW1A 2ZE8A 2KJQA 2VSXA 1V43A 3OEEA 1S2MA 1KO1A 3MG9A 4QNMA 1OB5A 2QTFA 3QI2A 3ND9A 1GKIA 5BQ5A 3WYGA 5HKKA 4PFSA 4KITB 1NBMA 3K0CC 4YDSA 2PL3A 3VKWA 1WXQA 1KK3A 3OJWA 1YJ5A 2MSDB 3FTQA 4P31A 1ZD1A 3E70C 1GVHA 4HLCA 2VZLA 4URYR 5DH9A 3TGPA 1M7HA 1GITA 2YYZA 5DN6D 3ZZ0A 3C5HA 2Z0MA 3D8BA 2ZREA 5FTMA 3THYA 1J70A 2MMGA 5DI9A 1XMJA 4MUBA 4KU4A 4B6EA 5KU1A 3OJXA 2WWHA 1XMSA 3S1AA 3MWJA 3QPUA 2ZPTX 2VNJA 3KJIA 1KK2A 1YZNA 3W3ZB 4B75A 5K8UA 3W5HA 3B78A 2ZUBA 3TIFA 1Q1BA 1CNFA 1SVOA 1KD1D 2JJ8A 4DQLA 2QM7A 2ZIAA 3BAFA 3QG5A 3TRFA 3U3JA 4RD6A 1JQLB 3N2IA 1DBSA 4KYIB 4LYAA 3J81k 4UQOA 2GRJA 4L15A 1VPLA 3PENA 4B48A 3IPYA 1R4AA 4LHZA 3CPWB 4C43A 1W4BA 4LX0A 1IN8A 1JA1A 4JMPA 4TMXA 1N8RD 1CKEA 3QEJA 4FI3C 4ZCIA 1Q3TA 2NQ2C 3QVVA 1D5CA 1P4SA 5TV2A 3SI7A 4NCKA 1OFUX 1PLKA 1CF4A 4EPXA 2J0UA 5AWFC 4WZ6A 1TU3A 2LCFA 3B60A 2VHTA 2D4HA 5JS7A 1Z83A 3EA5A 1GSIA 3PJRA 4RKFA 5DIFA 4F38A 2ATVA 1HH4A 4RD0A 3E5HA 4IVRA 4US1R 4LHVA 3U6KA 3BFKA 1U0HC 2QAGB 1LVGA 4BFVA 4W9MC 4KBFA 2D7DA 4TMWA 3CPJB 3NH6A 3IQXA 4P0TA 1XZPA 2OAP1 2ZRBA 2WWWA 4HAXA 3CPHA 5CM8B 2BMEA 2BIFA 3R8FA 1NY6A 4E5UA 1E2DA 3L0OA 1NP6A 1H8HD 3ZIAA 4G1UC 1VECA 3AKCA 1M74A 3QE0A 2CCGA 3AF0A 4PANA 5SZIA 1XEWX 2QQ0A 2I4IA 4IDHA 4MGYR 4URWR 1SXJE 4QBFA 1YRAA 5L3VA 5JMTA 4JVNA 5C18A 2QGNA 4H1UA 3UANA 4GP7A 1ZYUA 4BFZA 1K8AD 2A5JA 5BXQC 1Z0JA 1OT3A 3RC8A 2OBNA 4TN1A 2ERXA 3DEFA 3FHOA 2QMEA 3KXKA 3C14C 1NF3A 3NC0C 4HZUB 4C30A 1FFHA 1SVWA 1YZGA 2QAJA 3AKDA 4EFNA 5BN4A 3SOPA 4B2IA 3TUIC 1J9ZA 2HXYA 2V6IA 4GOJA 4NDZA 3AP3A 3KKNA 3ZVLA 3AVWA 2XXAA 4JVSB 4B44A 1K5GA 1H65A 4AKGA 3OF5A 2AFIE 2QN6A 1GKYA 4ZGNB 2ZTSA 4WZBE 2FSGA 3UPUA 2XAUA 2QA4B 1IXZA 1X6VA 5CYPA 3ECCA 3QQ5A 3N5CA 1L4UA 2MMCA 2ZEJA 1KZGB 3EARA 1YVDA 4GOXA 1HT1E 2JLQA 2P6NA 1KI1A 1A8PA 5FL3A 3OW2B 2C9CA 1KDOA 2BCGY 4GNKA 1RPZA 2ZM5A 2AK2A 4A36A 1W5SA 2QEXB 4A9AA 1VKJA 1GILA 1N25A 3BIFA 3FJOA 1XD2A 1IXSB 2VRWA 2BMWA 4Q4AA 3NDPA 2JLSA 1G7SA 3U7HB 1TPZA 3VR4A 2PEZA 2GA8A 2H16A 4Q7MB 3CCMB 2V55B 4RKEA 2BKEA 1N5KA 1SKQA 3RWOA 1XJ0A 4FMBB 3R7WA 4ZI2A 2CDNA 2PMKA 4DB4A 3L8ZA 1VQ6B 1CRQA 3L43A 4RFSB 4WQMA 4M9QA 2YWGA 4C0LA 2X2FA 1GOTA 2ZRKA 4LJ5A 3ZYCA 1G8FA 2AFHE 4NTZA 1GNQA 2D06A 4PPGA 4PGOA 2CE7A 1G7RA 1IY0A 5HE9A 1OSNA 1WCV1 2X19A 4E22A 1BMFD 1CU1A 2O8CA 5JWHA 4K46A 3GLFE 4XVQA 2WSMA 1K5DA 1GTVA 4LBYA 3I5YA 1XXHE 2ZYUX 4D82A 4LJYA 3ADCA 5FUVA 1T3HA 4DLWA 2WIBA 4LHYA 1E96A 3RC3A 4OHYA 4DCTA 3TW8B 3CLVA 4PSKA 4DLYA 5E7JA 4YXWA 1XDBA 1N5LA 4BRUA 4IOLA 2P65A 2QRZA 1N6OA 4M53A 1QG0A 1TQDA 2HYIC 4TYQA 4UJ5A 1ESNA 2IHYA 3B2EA 1Z0FA 4G0NA 5LD2B 3T12A 2A78A 1NLZA 3QIAA 4A82A 3OIYA 4FCVA 4DDWA 2FA9A 1Q86D 1N2CE 2H57A 2OXCA 1XPOA 3OZUA 1F2TB 1P75A 1M1KD 1E1RD 5AJZA 4M8NE 3ZS8A 4KYUA 2QBYA 1HT2E 4Q47A 2GAAA 3KUDA 1UEIA 3QENA 3PCRB 5GVRA 1E2LA 3MGCA 3THXA 3KB2A 3ZQ6A 2BN4A 2JGNA 2XNDD 3CM0A 4NZYA 2RB4A 3CNNA 3K0FB 4HAZA 3IHLA 3ZVMA 2I1QA 1JJ7A 1VG9B 2ZJ8A 1SXJC 2KWIA 2IWRA 2W6JD 3D31A 1G17A 3W34A 3VMFA 1BS1A 2B7BA 5EMNA 1D6JA 3BB1A 4MYCA 3QKSA 1EFRA 1VIAA 1U0JA 4XWAA 3K9NA 2RGDA 1DAIA 3QG1A 1U9IA 2BHRA 1VMAA 5FUXA 3K09C 2WAYA 2ZS7A 1OV4A 1V5WA 2WOOA 2YWHA 1UKVY 3KX2A 4QGAA 4QOSA 4RZ2A 5B64A 2J3EA 1T9HA 1U90A 1E9CA 2CLCX 5JJKA 4F92B 1CULC 1TF2A 4G1BA 3L0IB 1BKDR 1X1RA 4U9UA 2OTJB 1E2HA 1FMLA 3T5DA 4TT3A 3CRVA 2EFEB 2A5YB 4A2PA 3EZ7A 2CVHA 4MRPA 4DCNA 2WKRA 1DG3A 4PPQA 3QBVA 4Y0VA 1FUUA 2GBLC 1XP8A 3AVXA 4JT2A 4Y9UA 1MRNA 4BFYA 1UDWA 1F5NA 1P2UA 3GP8A 4N0EA 2DCUA 1NN1A 5J40A 1QHXA 4AKIA 2RHMA 2H7VA 5FBRB 5AUNB 3I32A 3U7EB 2GCPA 4TTRA 1ELOA 3PG5A 4QC2A 5AJVB 5J4YA 2GZHA 2NO9A 3LVRE 1M7BA 2BJVA 2QUZA 2HLDD 2QZ4A 3QXHA 3SU8A 5K8IA 4TTQA 1VCMA 1G3UA 4ZDJA 3FFBA 4B2PA 1IJEA 1UEJA 3VR5A 3E2IA 3X1ZA 5G53C 4NCHA 3MWLA 2VYFA 1G7CA 1DS6A 2L0XA 3IEVA 4K81B 4UNPA 3LDAA 4HB0A 4CYMA 1R7RA 4M4SA 2CK3A 2GF0A 5FPHA 3BH7A 4C7OA 1X8JA 2ERYA 3K0CA 2RCNA 1CQXA 2JJ2A 2QPAA 4RFVA 4Q1FA 1TL7C 3QFTA 4JLVA 6Q21A 3PR1A 2W00A 5GJBA 3OE7D 4FN5A 1QVAA 4IFBA 2R6CA 1GRQA 4LC0A 4JIMA 3KQNA 2JA1A 3GMTA 2GJ8A 2ZU6A 5JHHB 3KKMA 4RZXA 4QGFA 2BF4A 3W9YA 2VP4A 1MRSA 4URXR 1XWIA 2A5FA 1E4YA 3SS8A 3OEHA 2E87A 1RW4A 1YR7A 3SYKA 1XMVA 2YV5A 3FE2A 4BWYA 5HE8A 2RGGA 4M1WA 4PPNA 1E2QA 2WBLC 1NL3A 4O2RA 4Z51A 2J5XA 4CGZA 1BOFA 3Q7QA 4ERNA 3U2QA 2QSZA 4JLKA 3BS4A 3T35A 2FPMA 1E32A 1FNCA 3ZIAD 1S9HA 3UG7A 4BFXA 4EH1A 2G1KA 2IS6A 5ANRB 5L3QB 5KSPA 1XEWY 4B43A 1DAHA 1P72A 3R9XA 3GJ3A 3CX7A 1JJ2B 3DVLA 2O5VA 3QF4B 3EW9A 5AUPB 5GV8A 4LI0A 2BV3A 521PA 2VH5R 4M1YA 1CR4A 5E3HA 1KQSB 3A4MA 1EFHA 1TX4B 4MGZR 4N0DA 1TAGA 5KTYA 4MGIR 2JLRA 1HYQA 3BB3A 3LA6A 4MKGA 1VDZA 3MWYW 3TW4A 4A4DA 3CCSB 2PIAA 4ZIRA 4YAOA 3TR0A 2KBEA 4JYCA 4RD3A 2WTUA 5CB8A 1OXUA 4FCWA 3I4LA 3WMFA 2OK7A 4S2EA 2C8VA 2IK8A 1Z0KA 2BJWA 2CNWD 3LY5A 4M1TA 5KDLA 4XVUA 1NIPA 2ZSDA 5KNBA 1JECA 2VP5A 1E2PA 3EASA 3TBKA 1SXJB 2OT3B 3SEAA 2NZ8A 2J0SA 5FOVA 3KTAA 1OPXA 5DNYB 1E1QA 4CEHB 3I1FA 1EK0A 4OI4A 4BECA 3FGNA 2BCJQ 2NPIA 5KNCA 2DBYA 1R6BX 2WJIA 4V0ME 5CLLA 2D2EA 2CRVA 2RGBA 3P32A 1TQ4A 1Z8FA 2XZOA 4X8LA 4DCUA 3GEEA 4HE6A 4OL0A 1EFTA 1Z22A 3H0KA 4LUCA 4N3GA 1JR3A 3ES9A 2PT7A 3KQHA 3P4YA 3O8DA 4B3FX 2PMDA 5IRCD 4L4UA 3RS7A 1JJVA 4M1KA 4IXMA 1SKYE 2EVWX 1C4OA 3T61A 2FSIA 2ZJYA 5CDFE 2WJJA 2IWHA 5JHGB 2ODEA 3CUEF 4PO1A 1ZIOA 1VQMB 4LK2A 3R9IA 3K0AA 5EZ5A 2G83A 5EP2A 2B5OA 2IA5A 2QTLA 4US0R 5HTKA 3CX8A 3W8RA 2V54A 3REGA 3N70A 3G6EB 2HUPA 4Q4JA 1KI4A 4DDTA 1XNJA 3LQQA 1FP7A 3A1SA 3RS5A 2DHRA 3V00A 1FNBA 2EFHB 3P27A 3X1YA 2EIXA 1KRHA 4B3DA 2ZI5A 2ZROA 3I62A 1MABA 2IXGA 4BLTA 1LNZA 1G6HA 1XTKA 2QT1A 2HMAA 1TUEA 5J4KA 4EJSC 4OQMA 2BPOA 1K73D 1FZQA 3IIKA 1YITB 2HJVA 3QEOA 4M0LA 1XBTA 1S3SA 2B8TA 2R6GA 2D3WA 3RRZA 2Z83A 2IXEA 5F2EA 4C0BA 4PZLA 2PZFA 3A1TA 1B2RA 1U8ZA 1XEXA 2N1BA 3O47A 3P20A 4BEJA 4HDOB 2WSSD 3Q9LA 3OIWA 1WBBA 3U44B 1KC8D 3AF2A 5C2JB 3KXIA 3AF4A 3FB4A 1Z63A 2Q6TA 4P4SB 2WAXA 3CWQA 5EE3A 1NN0A 1CS4C 3I5XA 2IW3A 4YMUA 1BH2A 2LP6A 2QMUA 4RY2A 4G5OA 4G5GA 3H1TA 1OHHD 5DISB 2GZAA 1TMKA 2OFXA 5EUQB 3BGWA 3EX7C 4KI0A 3QOFA 1KI7A 1MO4A 2VP9A 1EFRD 2G3YA 1YKSA 4NYMR 1SVLA 1DTSA 4EPYA 5KDOA 4MRVA 1KI3A 2I3BA 5J4HA 5EP1A 1XPRA 5KUTA 3TSOA 1TEVA 2OCAA 4GZMA 4Z54A 1LW7A 2AXPA 1BJKA 4U02A 5C4GB 3FHCB 1E9DA 3VU9B 2XB4A 2ZSAA 3MAAC 4NCNA 1LY1A 2B21A 4QBGB 3BWDD 4OHWA 4JLOA 4C4PA 1Z6GA 1NVVQ 4HLUC 4V0OA 1M2OB 3GD7A 3B7GA 4PXAA 2GCNA 4X8HA 3UATA 2ZRMA 3TJZA 4BEBA 3TUZC 4IOJA 1Q12A 4WAUA 2XGJA 1ZUIA 3U61B 3C41J 3O8BA 3OFNA 1Z0AA 4YONB 1N0WA 2N42A 2O8EB 1DAMA 1X1SA 4HAWA 1YQTA 4HB2A 1G16A 4A0GA 3Q85A 1E63A 1QZXA 2QTVB 1G9XA 4Q4HB 4WIAA 5CLQA 3K09A 3L0SA 2ECKA 4AG5A 2Q3MA 3QBTA 4DBLC 2IYWA 1L7VC 2FGJA 3FMPB 3D7MA 5DYIA 1PV4A 2GEUA 1SM4A 1RRFA 1OGJA 4KLZA 4XIGS 4ESVA 5EXSA 4A2WA 4DLVA 1W49A 1A5TA 2AXNA 4ASUD 3RLFA 3CF2A 4ARZB 3X1XA 1LF5A 2Q9BA 4HZIA 4HYYA 4OHVA 4PQFA 3SC3A 4P4TA 1CR1A 3EWSA 1KTVA 5TDHA 1ZJ6A 2CHQA 4YMTA 2O8DA 1GFIA 4F7DA 4Q02A 1CJMA 1E0AA 1HA3A 1T3LA 4C9BA 4M9ZA 5EJEA 1U8AA 1W46A 1BX1A 1E99A 1II8B 2QAGC 4JL5A 2GEVA 4TYPA 1NRJB 5AR1A 2CJWB 2CK3D 2E9SA 2ZI7A 2GBLA 2P6UA 4G5SA 1A2KC 1ANKA 3TSZA 2W2XA 1QUEA 1A4RA 3F8TA 1DAFA 1VHTA 4GDFA 3IILA 2C2HA 4QXAA 2FZ4A 1Z47A 2FMXA 3FDIA 2H8KA 3SQXA 1NSFA 5EE1A 1YR6A 3TNFA 2ZRDA 2QNRA 2RHDA 1DAGA 4C2TA 3E1YE 5THXA 3W2GA 5FBVB 4LY6A 3OEHD 2AKYA 2V3CC 2BEJA 4EPVA 5FTLA 2NO0A 2CHVA 1NY5A 1RJ9A 4CT4B 2J46A 4IOKA 1FL9A 2JJ1A 4F93B 1U81A 1Z2CA 3SNHA 3UIEA 1IN5A 5EE9A 1J8MF 4ESHA 1HV8A 4OYHA 1TQ2A 3GJ8A 1VQOB 1W0KD 3LBHA 3DPUA 4BPRA 2PX0A 2VHQA 3NKVA 4GL2A 3B82A 4DDUA 2OZEA 1ZD9A 3M0EA 2J9RA 3AKEA 1SZPA 3D6TB 5B2ZA 5FBLB 1ZIPA 4AURA 1AM4D 3GLFA 3MWKA 4UXHA 4FWIB 2RH5A 1M7GA 1RVDA 5KSZA 1XXHA 4U00A 5ELXA 4ZV4A 4FMCF 2HYDA 2FPKA 3EIEA 2VSOA 2KI5A 2HCBA 1P2TA 3VX3A 1RZ3A 5EP4A 4WXRA 1GDDA 2BBTA 2ZVPX 3SN6A 4TYNA 3CRMA 4R9UC 3WHLA 3EA0A 4FK8A 1D2NA 1QG4A 2CLSA 3T1VA 3QXXA 5FPSA 1KSJA 2B6HA 5F98A 3K0EA 3PQCA 1E1QD 3CR7A 2GESA 4B73A 4NYIQ 4Q9LA 4ACAA 2YHSA 1TF7A 3W90A 3GLGE 4V0KA 4QL3A 4XTRA 1ZD8A 3SJZA 3QKRA 2DERA 4JSTA 4UNNA 5KPJA 3MLEA 4P4UA 1PLLA 5BN5A 2ZSFA 3HR7A 4IRUB 3SYNA 3NDBB 3O8RA 1JR3D 2PJZA 3VTKA 1DAKA 2IUSA 2DPXA 2JAQA 2ZJOA 4Q1DA 3DZ8A 4EUNA 3WBJA 3A58B 4LWZA 2FJUA 4C0QC 5E95A 4CIDA 2FH5B 5F3WB 2EFCB 3GJXC 3CCLB 3T06B 5DYGA 1E6CA 3PEYA 2IS2A 1ZC4A 5FUYA 1G3IA 1VYVA 5HZKA 3CCEB 3W2EA 2DR3A 3P26A 4LPSA 2C9YA 1E2EA 1PUIA 2AWNA 1VCNA 2R2AA 2A3RA 3CWZA 5FOSA 3AGPA 3PEVA 3LRPA 2JLVA 4B6FA 3B5JA 2NMVA 3MJRA 2EYUA 3IKJA 5LD2C 1ZW6A 1QFJA 2QP9X 2WHXA 4LJ8A 2C04A 2QTHA 2QRNA 4XSGA 3BERA 1NG1A 4MITA 3I56B 4D80A 2HT1A 3L8YA 1F60A 4RZ3A 3ZD6A 3T1OA 4V0NA 4OQXA 1YJ9B 1AQYA 2DETA 4RZUA 5F9HA 1W48A 4QBHA 1SKYB 2GETA 1NNEA 1HEIA 3NEYA 3NH9A 4I4LA 1OW3B 5EXPA 3TSWA 1DG1G 3NWJA 5FL7A 3RS3A 1E79D 2J1LA 1OF1A 5B57C 3GEIA 5KOYA 1D1NA 1JXMA 3TMKA 1KYIA 3PUXA 3V4FA 1SULA 5BN3A 3DDCA 4NP6A 5FI1B 1MO5A 4DSNA 1JAIA 3W5VA 1I2DA 4M2LA 1W1WA 5BYKA 2W6IA 4DSOA 4EQ6B 4BZPA 2G88A 3EC1A 3F5FA 5M04A 5L3SB 1G41A 3IIMA 4LJ4A 1P5ZB 1WBDA 1KK0A 1P73A 2IYXA 3VX4A 1P2SA 1Z08A 2H18A 2EWWA 2JDIA 2TMKA 3CBQA 5LPNA 2O8BA 3FPKA 2FSHA 4L9WA 3TAHA 3FKSD 4JKYA 1XJCA 3GJ5A 2WICA 2ZJBA 1NIJA 2X2EA 2OXRA 4AG6A 3B6EA 2Q3FA 1QVRA 2V7QA 1E4VA 3GLHA 2O0HA 1G4AE 3BOSA 2ZRJA 1LB1B 4A8JB 4E03A 1GO2A 4EJSA 1W4AA 4CEIA 1OKKA 1XE1A 5GV7A 1MV5A 3CMEB 2BKUA 4I99A 1FUKA 1KK1A 3WHKA 821PA 1OXTA 4XH9B 1W7AA 1YZQA 2MSEB 1SVMA 3CNLA 5FOWA 3W5IA 4DWJA 1COWA 1ZINA 2VBCA 1D9ZA 4IXNA 2IYRA 1QGAA 2HF9A 4ZDWA 1ZNZA 3GPLA 3OAAD 1T5LA 3U3OA 5L3RA 2ZJ5A 3B85A 1VQPB 3BK7A 1OYYA 4OQFA 1AS2A 1DO2A 2PZGA 3GEHA 1GAQA 1TLLA 3LLMA 3HYRA 1QH0A 2ZAMA 1RC8A 1I4DD 1DEKA 2FFAA 2GWHA 3TLXA 3OHMA 5JWRA 3BBPA 4PHGA 4PR0A 1NSTA 4Q9KA 2OK8A 2OE2A 1SHZA 1YR9A 3KQUA 3FFAA 4B47A 1U94A 3OFND 4IJMA 1HQCA 1ZVQA 2D7CA 4LJ9A 1NMZA 2BM0A 3GLIE 5H5JA 2P5SA 3KJGA 3B1YA 2VHUA 2A5DA 3T1QA 2FFHA 4A0RA 2A9KA 2IYYA 2MSCB 3NBXX 1D9XA 1GL7A 1XTJA 1VQ8B 1KMHB 1KJZA 1DARA 4HUQB 1OGIA 3ZLJA 4Q7LA 2OFWA 3PUWA 4MRSA 5EP3A 3QSYA 3NVAA 2QMOA 4IKEA 1IY2A 2WMOB 621PA 2JIZD 1FNMA 1S3GA 1X3SA 1Z6XA 2IYVA 3K70D 4DCVA 4HLUA 1GL6A 2G0NA 1GVNB 2P5TB 2F55A 3MFYA 4KLNA 3KQKA 3B9PA 4N3NA 2ZI6A 4HAVA 5E7IA 1ZM2A 1EP2B 3QE2A 2QQEA 4D0NA 2AX4A 4G3XA 2BMDA 4V0MA 3H86A 2B92A 1UMKA 1AJEA 1FTNA 1FQKA 2ZR0A 3KKOA 2PLFA 3U3KA 1I7PA 1G5PA 1W35A 2P6RA 1HE8B 1W0JD 3CPEA 1W36D 1KI6B 2R6FA 5FBWB 1LTQA 3IQWA 1ZC3A 4L9SA 5TMPA 1FMJA 1LS1A 4JBWA 4US2R 4ZGQB 3MJHA 5HPYB 1GM5A 1G291 5KSOA 1VQ7B 3LX5A 1KGDA 4M1SA 4YC7A 4DEYA 1W2GA 2F6RA 2IUUA 1ZU5A 2AD5A 3CC2B 1N6LA 4Q18A 3CRW1 2WVJA 1JQJC 5C1BA 2ZITA 4TYWA 4D4LA 2O0KA 3TQFA 2A2ZA 2X3UA 1XTIA 3TKLA 3CNOA 5JJIA 3VKHA 3CCQB 4RCZA 2ZRGA 4UNRA 2QAGA 2WWFA 4Y0AA 2F1JA 2GNOA 3SJAA 4DSTA 3U7GA 1M8PA 5JLJA 2W0MA 4DUGA 1NN3A 1H42A 1QHHB 4MA4A 3RHFA 3ICEA 5KYKA 4DJTA 3BC1A 3A1UA 1RIFA 4G5QA 1OH6A 3NEJA 2IEYA 4PHFA 4PC3A 3CW2A 3AP2A 4JJZA 3QKUA 1VG1A 3U7FB 4J0QA 1N5JA 1P61B 4TLCA 1JEEA 4BGDA 2J7PD 2XEXA 3AP1A 4JVLA 4NMMA 3SBDA 3UMSA 4JLPA 3KZ1E 1WP9A 1GRNA 1KSFX 5JEEA 1E64A 3E20A 3CD6B 4XD7A 1ODFA 2IS4A 2FF7A 1IHUA 3KL4A 3OIUA 2RKOA 3V9PA 3OZXA 3HJNA 4HZUA 1OIXA 4V03A 2F9LA 2AKAB 1ZUHA 3OEED 3PUZA 2X77A 2IUTA 4I1UA 5H68A 3T15A 2QG6A 5HXBA 1A82A 1N0UA 1VQ4B 2GDJA 3CX6A 3KKQA 4PHHA 1GRRA 1CJUC 1EX7A 4ILEA 3FVQA 5HKKD 1CLUA 4KO8A 1NBMD 3W2IA 2ZYTX 3W6OA 2XSZA 2IS1A 1D2MA 2G9NA 4F7WA 1IBRA 4PC2A 3JZMA 5JSZB 4HUTA 1HUQA 2QE7A 1OFHA 2WPDA 1M34E 3CH5A 3EZ6A 2ZRAA 1XRJA 3AKYA 2P67A 2CXXA 5KSWB 5FPYA 3ZS9A 3EIQA 3BFVA 1XJQA 3B13B 4IDNA 5JI2E 1F2UB 1E9FA 3CMAB 2HEIA 2CE2X 2ZUDA 4JZKA 3VHXA 1YHNA 4BFSA 2J59A 4B34A 1G18A 2R65A 4CZ2A 5EQTA 4CEJB 1NJGA 4BFUA 3A8TA 2DFNA 3GLGB 3RS4A 2VA8A 1W44A 1EXMA 4R98A 1QG2A 4Z1MA 1YJWB 2ZJAA 4D2IA 4RFSA 4DKXA 5IHPA 3U4QB 5GJVC 2RC5A 3SZRA 2DWOA 2GAOA 1G6OA 2GZDA 2QP4A 1VIYA 1WB9A 1FNNA 5H1YA 1NJFA 4BASA 2F9MA 1Z07A 3OZVA 3MRSA 1NJID 5BYJA 3RSLA 3NHBA 3RRMA 1AS3A 1A7JA 3LXXA 3K1JA 3LFUA 4GBMA 3B1WA 3CRQA 4NU0A 1E2NA 4F91B 2CHGA 4Q48A 3PV0A 4NKRA 2Z4SA 3EZ2A 3PUYA 2VYQA 5KPDA 1N6HA 2OILA 3QXJA 2QL6A 4LBWA 4A92A 2I1VB 2DYKA 3LAWA 5CB6A 3DZDA 2O52A 1II9A 5D3MB 3LVQE 3W6PA 1XZQA 1N3BA 1JPNA 3A4LA 1W4CA 4LDJA 1AN0A 2PH1A 2FFQA 4AKEA 1RKBA 2BGJA 4YAUA 1W34A 2W6ID 2WMNB 2XTZA 4AI6A 4KVAA 4TSFA 1XCPA 1OH7A
chains in the Genus database with same CATH superfamily
4D6YA 4DLSA 2R8PA 1Z2OX 3WDKA 4ETWA 3UWDA 4LQCA 1TM4E 3EQ2A 1CWUA 4IGKA 4LOLA 3GJ7A 1QK3A 3I37X 2KVOA 4JZEH 1LQTA 3NUMA 4LWQA 1PNTA 4CQJA 6CHAC 4JX9A 1BX0A 4XR9A 5FTKA 1IHDA 3TIGA 3R09A 1X1CA 3PGVA 5BOSA 2IF0A 1TLFA 3N2NA 1PYDA 2Q5FA 1P2MA 3UM9A 2FEWB 4U2DA 4R71A 1M2FA 1C4XA 2NZVG 1WVGA 2RHTA 4ROSA 4LF9B 4DJ5X 1Z5WA 2Q0XA 4MWOA 5HF5A 4WCFA 2I03A 1PNVA 1Z5OA 4Z4TA 3C16C 4XYEA 4AF7A 1US8B 3PNVA 1S1CA 2IHNA 2R8ZA 1BHXF 4FDVA 4JLBA 3TL6A 5HKAA 2BC9A 2Z5FA 1OLUA 4QPJC 2IV7A 3RSOA 1ZOIA 4UFPA 3JAKA 4KG7A 2FP4B 1MFZA 2Q1XA 2XNJA 1QO9A 1HDTH 4TMZA 3ZE7A 2A4MA 4ZOLA 4PGMA 2W3IA 5DI3B 5BV8A 1F6BA 3PJEA 3NBMA 1JLLA 1HBTH 4UDOA 3UMVA 4LYHA 1TECE 2XCOA 4YEJA 2P2SA 4VGCB 3GYMA 4XD7D 2EP5A 3WKCA 1LCIA 4AL4A 2TGTA 3B7WA 3L4SO 3KWLA 2YJ4A 4DA7A 3I55B 2ZR7A 1MP0A 4MI3A 2ZETA 1L9KA 1R3UA 4BLPA 3CG0A 1W1IA 2ADMA 1JRTA 2GKSA 3AUAA 3FSRA 2ZTHA 2W58A 4ER3A 3QWAA 4F2DA 1HYHA 5EHIA 2NN3C 2AOUA 4I2NA 4EUEA 1N5DA 3RVQA 2YC2C 1EVLA 5J5VA 2GEJA 4ISOA 4XVHA 1UXJA 1TGTA 1AOXA 1E6WA 4XM2A 4NQZA 3RXKA 4YI3A 3OJCA 5J2UF 3G0CA 2Z8XA 3O3CA 1TX7A 1V2JT 1AQUA 4IDOA 4GKKB 5AW5A 4YJKA 1DRWA 4GZLA 2JLZA 3HQ4O 1I7LA 5BOVA 3FN4A 4RUKA 5EEHA 1PT6A 3IV9A 1WB6A 3K1ZA 1OXVA 1KYNA 1TT5B 2YOGA 1NQVA 3DUXH 1DC8A 2DFPA 3DUFA 1QSGA 5CHBA 2J9FA 4V2UA 1PVDA 1WB5A 3V7YA 4LMAA 1BHO1 3ZHBA 1DBPA 1XZIA 3IDSA 5FWXB 1VC2A 3MMXA 3VB5A 4DV0B 3ZIUA 3W7VA 5AXDA 2JZNA 4EFKA 1VDMA 4H9GA 1ISIA 1I24A 1ZKMA 5EWLA 4YDRA 1DX6A 3GVHA 1SWVA 2OHOA 1IB0A 3KQYA 4GE0A 1Z8HA 1S84A 4HGPA 5AVQA 3O2QB 3INTA 3NHWA 5GTDA 1JHPA 4JOBA 2V31A 2GCTC 3DDNA 2W4MA 2OTLB 1POWA 2HNTC 2XKKA 3WYEA 2FV8A 5KTKA 1T8NA 3PLNA 1G8KA 3VISA 4HRVA 2P3MA 3CUSA 3OJLA 1RYHA 4AZ3A 5JZSA 3OZTA 1PEDA 3H7IA 1YDWA 4MPDA 2PX3A 3LCVB 3W8NA 1XQWA 1YF4A 2LCIA 3NATA 3WWCA 3V6LA 2AEJA 1IONA 1SVIA 2GGSA 2EGHA 1XNGA 2ZRNA 1O2UA 4WESB 5DNEA 2G25A 2EC5A 4P82A 4DUPA 3ULKA 4JLUA 5E1MA 1KXBA 2QA5A 2SBTA 2BHGA 4RJJA 1N0IA 1M83A 4B5LA 1MR3F 5GDSH 3G7NA 2X14A 4ZP1A 3M7IA 3HFRA 1FYEA 2K5UA 4TUYF 2J3DA 4DJEC 1O8BA 1A9ZA 1MEEA 4IN2A 4WA8A 1XEFA 4RM2A 1PGPA 1T2NA 1WDTA 3EQZA 1W0ZU 4Q1BA 3RM3A 2UYGA 1O3AA 3FW1A 2WVHA 3KS9A 1RWPA 2VJIA 5HM2A 1P11E 2J94A 4UXIA 2A5IA 5ELLA 2BP7B 1ZNXA 1VL0A 1Z6QA 3U19A 1QIXB 1VJTA 1M54A 1O3LA 3Q40A 2P8OC 2PLRA 4CQMA 5I5GA 4MG3A 5KU7A 4OQLA 2VT6A 3IOBA 1WLSA 2ZU5A 3Q72A 3EISA 1XQXA 5TVGA 5SICE 1XWFA 5K0NA 1YFZA 4DIMA 2G81E 3QJYA 3F4LA 3DL7A 4MTCA 2OUKA 2B0CA 1MB3A 1Z0SA 1Q50A 4P2NA 2P59A 2WUEA 5JXJA 1OZGA 1G8HA 3ONYA 1NDUA 3BQNB 1GHAG 2EHJA 4XQ9A 4OGKA 3P9SA 1DEAA 5BQ3A 2Q0HA 3L8MA 3DB1A 2X53S 4UAJA 4JZDH 4WZAE 1XD8A 3NHAA 1A3BH 1G42A 3M33A 2XH8A 4WXHA 2H1LA 5EW2H 4YUVA 2B8NA 2YVKA 4UCXA 2E21A 4F4JA 2F1OA 3QK7A 5E7MA 4PIVA 4FFRA 5GP1A 5B1HA 3BFPA 1J22A 5E0JA 2J98B 5HQJA 3GLHE 5DKFA 1L2TA 4YUAA 2FW7A 4MV0A 3LL7A 5ALXA 1BXZA 3VR6H 1L9XA 4O02B 1PPEE 2PZEA 1QFZA 3TWOA 1PHRA 3COZA 3AUYA 3ABRB 5HM8A 1UEXC 1DJQA 2H6MA 1OKKD 3N9IA 1PJZA 4LJLA 3ASRA 2GVZC 3WGYA 3WNBA 3T5FH 1XK6A 2OLKA 1BA3A 3A04A 5KB3A 4J2HA 2OFOA 4YLQH 4TYYA 5ARDA 4G8BA 3QWIA 2L6OA 1U4SA 3PR3A 5TPWB 4L7VA 3ACDA 2BDAA 4P6VF 4O2AB 4M1EA 2DE8A 3E53A 2D5LA 1L5OA 5EIHA 1E69A 1P1BA 2Q45A 5B55A 3IPLA 1Q81D 3C4VA 1VQLB 2W37A 2HPHA 4DGQA 2ACVA 2R68A 3CZRA 1SK8A 1YLDA 2CL6X 3U5ZB 2VWOA 1AK2A 5B30A 2CLMB 2B1JA 3M5CA 1MOPA 1KI8A 3N2KA 1NPMA 2WUGA 4BLSA 4D6PA 4NCJA 1O87A 4B40A 3ILVA 1UC4B 1J15A 3VOTA 3ZIDA 5BRAA 4LZAA 1QB9A 5JARA 2C3PA 1C30A 1NX6A 2OC4A 5JTTA 4JB0A 2HALA 4ZHQA 4AUKA 5FFMA 1XZ8A 3GY6A 3M4XA 3ZU6A 4Z4CA 2VATA 4FUCA 4RF5A 3EDYA 4BQIA 5AF9H 1N1DA 1F2DA 3LGIA 4QTUB 1TDJA 3TBFA 4QXQA 5IAJA 3OQVA 4B09A 3ZD9A 5DZSA 3AVQA 4HJXA 5EJ4A 2JGRA 3SU6A 3A25A 2QE7D 4U7DA 3CR8A 1YQUA 2CL0X 4NV0A 2XVMA 3AK5A 2XRZA 4QYSA 4DNXA 4FMDB 1VPEA 1CO7E 3H87A 2YVUA 3FLMA 2D1QA 4EIWA 1UC9A 1GBAA 3FVWA 3KB1A 4ZA2A 2VWLA 2ZRFA 1KSHA 1U04A 4DNRB 1G20E 1EB9A 3HCCA 1AKEA 1O6BA 1CA0B 1F0SA 5DTJA 2AI2A 1E2IA 2ZM6B 2EI6A 2WWYA 2CNBA 3SEFA 2VTEA 2D8AA 3RRNA 4HAUA 3RAPR 1A1VA 1US8A 4LOHA 3SHAH 2JBWA 2DKFA 2V9CA 1J23A 2XCTB 1J9EA 3EG5A 3EPJA 3BIOA 3TECE 2FP4A 5JY1A 2C77A 1RTFB 3ZWMA 2XVAA 1PR4A 4W7SA 2RIRA 4F8JA 3THRA 5DI3A 4WXMA 2C9MA 3O4HA 2CLIB 4W5JA 1TNGA 4KVGA 2BD7A 2AR7A 2IQ5A 2EZ4A 1FJ2A 3PE4A 3SHTA 4BNTA 4M1OA 4KKSA 1FLVA 1FP2A 2Z4RA 1I7QB 2IY7A 2PWXA 2NXJA 3MWDB 3OSYA 4FUGA 3ND9A 1GPUA 3JAMA 1ZMRA 5HKKA 1V1RB 3FTQA 1S0QA 4JHXA 1ZGCA 1Y5AT 2HMTA 2WM8A 3UC9A 1J49A 1VE1A 1FSGA 4B75A 3V9AA 1DX9A 3HC7A 4IJQA 1KD1D 3JV7A 2EJWA 1UVSH 1PEAA 1P2OA 1XJ5A 1DBSA 4CMCA 3J81k 2A7JA 4QUEA 1ELBA 1UK3A 1ZIXA 1FBNA 1R4AA 1D2GA 1O2XA 4UFOA 1JFVA 1IN8A 3QVVA 4CJXA 1ONNA 4XWWA 2PU7A 1YA8A 3A7EA 2IIPA 2XQGA 5KAMA 1N78A 4RKFA 1V6SA 3VKFA 2GH1A 2VZEA 2BY8X 1O2TA 4PG8A 2JLCA 2PANA 5F03A 2BIFA 1VGRA 3L0OA 1TT5A 5EXMA 3QWBA 1XEWX 3IOYA 1S0RA 5JMTA 3OM9A 2A5JA 5KMGB 1ODIA 3DEFA 4LECA 1P1HA 4MW5A 5BN4A 1CQPA 5FWXA 1WV1A 1J9ZA 4OD0A 2OXEA 2AJTA 5ESTE 4QD3A 1GEGA 4JUAA 5AQEA 1X7YB 4B2AA 4QXRA 2QA4B 1L4UA 1AURA 4NMWA 3KAQA 3EAFA 3TB6A 1N25A 1AF4A 3NDPA 2G06A 3LQ2A 2PEZA 3QLTA 3FFTA 2Q99A 2HIAA 4LDAA 4FMBB 1JQ3A 3M4ZA 2HY7A 1ZDMA 4HGOA 1NBIA 4BC1A 4BP3A 4C01A 3FWKA 4KELA 3LUFA 5A05A 1I3NA 4BRUA 4IOLA 3UH1A 3SSNA 4KNWA 4PY2A 4RPCA 4TYQA 4IN1A 4BY9E 4HL6A 1KMIY 3OIYA 4DDWA 3ZHUA 1P75A 1AQIA 2GAAA 3KUDA 5IANA 4BUCA 5B6IA 2XI4A 1EPTB 4INJA 3PVCA 5JYBA 3H11B 5LLSA 2SICE 3RFXA 1E1LA 4R83A 6GPBA 3I1JA 2JHPA 2GF2A 4WESA 4XPIB 3E05A 1A96A 3D0RA 1CDDA 3QA9A 4IGDA 2I2CA 1PS8A 3MTIA 2Z8YM 3DFLA 3OOWA 2XR1A 4K9DA 4GX0A 3BWBA 2GBLC 1C4V2 1AQ7A 4LOYH 3E1GA 5J40A 5LYJB 2IFTA 3G2PA 1T2UA 1AGYA 5AJVB 1FFDA 3VGJA 1DRVA 4MGEA 4YOGA 3PDIB 3NGLA 5TMDA 2QTMA 3RIXA 4O1IA 1PG0A 3OPYI 1O3BA 2VYFA 1G7CA 5JXHA 3G23A 1C5VA 4PU0A 1YB6A 2RCNA 4PIMA 1IQNA 3FNBA 1FN6A 4NS1A 4CPDA 2JA1A 2Q3BA 4FCCA 2ZU6A 3D65E 1DAOA 1MHTA 1QA0A 3KQTA 2BP7A 1I5OA 1TQHA 5E2AA 4B5KA 3OQOA 1YR7A 5IDQA 1Z36A 5HE8A 3LHIA 1SPBS 3OCCA 4R0VA 2PGQB 5ED4A 2I2WA 3SF0A 3F6UH 3ZIAD 1EUQA 1DB3A 3UK1A 1T1EA 1DOJA 5AHKA 1BDJA 3CX7A 5TRDA 1RFGE 4LGYA 1U5CA 2JHCA 1NXTA 2SGQE 2VOJA 3J80A 5BSHA 4JYCA 3AZPA 4P4NA 3O91A 3VDXA 1CEQA 5FQNA 1T8WA 3TBKA 1B15A 1RI2A 1PE0A 3C5WP 2HHLA 3JQ9A 4MJ3A 4IIJF 2P9ZA 4DY7B 1KDVA 4AVYA 2EIHA 3KQHA 4MNVA 2PKSB 2CUNA 2FSSA 4IFTA 2JZOA 3EWIA 4P3PA 3LLVA 2BONA 3DKKA 2ZHWH 1LBIA 1Y5BT 1ZIOA 4CXMA 1VSTA 5I46H 2H9EH 4RL4A 3SIPA 1SHUX 5LVAA 1KARA 5I51A 3G6EB 2HN9A 1FP7A 3H97A 3WVNA 5D85A 2VJ1A 4N9QA 4C4OA 3S2ZA 2IXGA 1LNZA 2A0WA 3RYHB 4YO8A 4HXEB 1FZQA 5A7GA 4M0LA 2O8TA 3CB2A 2BDBA 3N2LA 5JH7F 2W6PA 4HDOB 5FPQA 4FHGA 1IHPA 2AZDA 3SZOA 3NS7A 1ABJH 3H8SA 1NO9H 1ID1A 4AY3A 1P7ZA 2Q6TA 1BA8B 5JYDA 3OJ0A 2DUMA 3DHVA 1YS6A 3KVYA 4E11A 1M0EA 4QREA 5AW6A 3VZRA 3RTEA 1ISJA 2HWKA 5J4HA 5KUTA 2I3DA 1YP9A 2GM5A 4CREA 3QYJA 2XB4A 2ZSAA 2B21A 3EGWA 4QASA 5TPWA 2OG1A 3KU4A 3HADA 4B9EA 4O2AA 1QTIA 1DSTA 3PNSA 1ZD2P 5BSTA 4IVNA 1X1SA 3BXEA 4WIAA 1L7VC 1GPKA 4CE6A 1C4U2 4DLVA 3I39X 3T29A 1PFQA 3FYUC 3A87A 1G8MA 4RCVA 3AFHA 4YMTA 3E5RA 4RMJA 4EG6A 1II8B 2GEVA 4RA6B 2VT7A 1WEHA 3GFGA 1ZTLA 4P5DA 2HNTE 3PWSA 4J7XA 1VHTA 4GDFA 2YL2A 2NLOA 1RYNA 1FAKH 1H9AA 3RTDA 2ZRDA 1R9NA 3GRVA 5FBVB 4YH1A 2JD0A 3TSCA 3ZCRA 5K3AA 1TD1A 5IFLA 1U81A 3KCQA 2VB0A 1HV8A 1U0TA 2HSDA 3GJ8A 3T7KA 1EDZA 5KQRA 2VQ3A 3FROA 1ZIPA 2POQX 4BV3A 1DXYA 1KY4A 5DYTA 4U00A 2IBTA 3LNNA 2ACKA 4QG3A 5LZ5A 1IEVA 2I6FA 1CJSA 2PUCA 1R8YA 4HX2A 2F4NA 4XGNA 4RZQA 2VFAA 1KSJA 1QR2A 4XYBA 3SSOA 4NYIQ 5KNCD 2GNAA 3GUHA 3NDBB 4DA9A 3G0OA 4R2LA 5C5IA 1F8YA 4BQEA 4X6LA 1GA4A 4MAAA 5GOZA 3RU2A 1E3DA 2YXNA 1ZL2A 4UHBA 2JLVA 4XIJA 5MF6A 5LD2C 3MT9A 1OV6A 2BEWB 1NVGA 2HGZA 3IMKA 4RZ3A 4OQXA 2DETA 5JNLA 1KJJA 2LPRA 4I8LA 1E79D 3UK2A 1OF1A 3V4FA 1K2VN 3A9RA 5THQA 1O5BB 3EXHC 4XJTA 3LQYA 2AJBA 2FRDA 2I4TA 5L3SB 4PCUA 1G41A 2P2YA 2EWWA 3TXXA 5JXIA 3FPKA 5AI8A 3TAHA 4AG6A 3VXFH 3PJFA 3KZMA 5MGBA 2K2WA 3L9XA 4IDEA 5GV7A 1MV5A 3HH8A 4O29A 1FUKA 5H80A 1PYTD 1TI7A 3TIIA 1N2ZA 1ND5A 4ZAVA 1NFXA 4WEQA 1BGXT 1TLLA 2CMYA 2ZAMA 4BANB 3BBPA 1XELA 1HQCA 3TB4A 2EAUA 3GRUA 3LH3A 1V1RA 4I5DA 2KLBA 3FPGA 2GREA 4KTUA 5T1VA 4NIYA 2LNDA 4Q7LA 1I14A 2Q7OE 4KYVA 3U7RA 3UV6A 1NR1A 3IVGA 4YHHB 1L8LA 5F33A 3EEQA 3N8GA 3LL4A 3AFNA 5E3IA 2Y7ZA 3KT3A 4FKMA 5EG4A 1WKCA 2R6FA 3K73O 1VF7A 2AMLA 1JJBA 4M1SA 3UHOA 1ZU5A 3CC2B 2I87A 4JAVC 5C1BA 5JCJD 4QXMA 3TKLA 1KQOA 2XD4A 1OGYA 3HVJA 2WWFA 1G5FA 4ZI7F 1PW5A 4JU8A 2C58A 3WYNA 2XA1A 1NN3A 3SQEE 2GWRA 3GB9A 4Z7NB 3ICEA 1X9GA 1R0CA 4N82A 1LVBA 2H7YA 2EQNA 2B6NA 3LGSA 4QPNA 3W7AA 5DO4H 4CT0A 4R3WA 4TLCA 3ROTA 4I4IA 3TXYA 4B4WA 4P38A 5KMGA 2HPQH 2ECOA 1KFEB 4N8DA 4OREX 4BNJA 4NEQA 1GPBA 3DVRX 2Q7DA 3TSYA 3T15A 1CDOA 3QNMA 1JWLA 1X7YA 3WYDA 2ECFA 2R4QA 4F7WA 1B00A 1GPWB 1MBQA 1WSWA 4C2BA 5EJFA 4JKOA 1G5HA 3ZEAA 4ZZ3A 1F2UB 1NP7A 5H4GA 2CE2X 4F4FA 4YT2A 4XZ3A 1Z3CA 1C5WB 3GLSA 4X1YB 3L6PA 1GQSA 2VU8E 1JDSA 3JZIA 5JS6A 5BYJA 3NTOA 3NI2A 1KXDA 3EK2A 1A7JA 4UMFA 4YCAA 1M72A 4X6YA 3QXJA 4K3JA 2DYKA 3DZDA 2JH5D 2RGRA 4LDJA 3VC2A 1YL6A 2FFQA 1R8JA 4AI6A 1X94A 4QJIA 4RW0A 3T54A 3P7MA 3H83A 5J4SA 3WQRA 2B36A 3G82C 3TG2A 2QQGA 3EVFA 1EPTA 4MUAA 3H11A 3S2EA 1VJDA 1QTNA 5C8YF 1D9IA 3DCJA 4AGJA 1J24A 1QAOA 3AVVA 3KSZO 4XPIA 1YONA 2V6MA 1I7NA 1GQQA 4N4AA 1C8LA 2ZR9A 4OQEA 2HREA 1UK6A 3T1HB 1L7XA 4D9EA 1YZTA 2F43B 2JGIA 5LQKA 1LKBA 1P1JA 2F9NA 4AIIA 1KQ3A 1SZCA 2QGZA 1MEJA 4JFAA 3LKZA 5LYJA 3WG9A 1J25A 5HXFA 1A4XA 4I8XA 3PDIA 2B9VA 3ZBUA 4QU9A 4PQYA 5C80A 2RARA 2AR9A 1U2TA 1C3VA 2XUZA 4KC0A 1W5FA 5FI0B 2Z8ZA 4RF3A 1UMAH 2HNKA 3QDZB 1UJ4A 4IDBA 3ECSA 5DGHA 5I8ZA 1GA1A 3TZQA 4YV7A 4P22A 5AW2A 5I8PA 4GIBA 4O4IF 2G5CA 4LJRA 3F6PA 2DG2A 3UWOA 2H0QA 4LKOA 3R8CA 1XZJA 2G1UA 4J94A 5I25A 4MVJM 2IHVA 2K87A 3TTXA 1FJGB 3A84A 2FK7A 4GG1A 1HDOA 2RAUA 3ESCA 4MVJF 4IHQA 2PJUA 2C99A 1L4YA 4OMCA 4XWYA 2NZJA 2CLOB 4FXUA 1NYLA 3C1KA 3I76A 3ONWA 4XDEA 3WV5A 2ETVA 1DXQA 4PFJA 1W5BA 2IHTA 1LI7A 5F7OA 3W5JA 2ZPQA 4INZA 5FBHA 5TQ0B 1AH2A 4AOQA 2FN4A 2XMDA 1GG8A 2RGAA 2ATIA 3NRBA 5H0IA 4JLAA 1WOSA 2IU3A 1E8NA 3E4DA 5CDYA 1YR3A 1RKUA 1YD7A 2O07A 2G76A 1UTKA 4O2LA 4TMFA 4FIZA 3SE0A 3HRKA 4MROA 4AY2A 3LS2A 3TOSA 1G21E 4B7CA 2J4CA 3H75A 4GMKA 1G8GA 3U1VA 2ZRLA 2V6BA 4HQFA 1NZQH 4LVCA 3RYHA 1GPMA 3DHNA 3F74A 1GI5A 5KVQA 2HMUA 4JJ8A 1G5TA 4D81A 4UD2A 3O84A 4TVOA 3GN1A 1XFAA 1UKYA 5EE0A 1E1RA 4KN8A 2FFRA 5BSGA 1SGPE 5LPEA 3Q3AA 5KNBD 4UNQA 4BVKA 2VDVE 3V8QA 1DI0A 2FP3A 2AC7A 3R75A 4UDNA 4HB3A 4Q3DA 2PNFA 4GPEA 4DNOA 1LVOA 3ENQA 3EVGA 2WYWA 3EAQA 2PKWA 5C7IO 1KLTA 5F35A 2NTVA 1W6UA 4FHFA 4BQNA 1E4OA 4MWSA 2AKEA 4XFQA 4LMPA 5FNVB 1YT5A 1AVGH 4KR6A 2ZRIA 2EBFX 3M1YA 4NG9H 1II8A 2C3MA 4RA6A 3QMMA 4JUIA 4CCAA 2PYDA 4KQ2A 1T4MA 2ZBFA 3WL4A 4KQKA 4MVWA 1W1UA 2J3KA 1E9BA 1UK2A 4MH0R 2RGEA 1DXWA 4RV9A 5DE3A 1UCYH 2PZJA 1MH0A 1UK9A 3RLIA 5LDGA 2EFGA 2O6HA 3O93A 5CEEA 2EATA 5HOQA 1M6NA 3E27A 2IVFA 3N2YA 5AT1A 1KOFA 1J8QA 3PQ6A 3QNUA 2VF7A 1RBYA 1C9MA 4FYJA 5NULA 3R3GB 5A0AE 1H1LB 2OK5A 3L9WA 3BL8A 3BRCA 2QU8A 1WBJB 3U37A 3K6SB 3IKVA 1IOLA 5IVDA 1PPGE 3KU1A 1HX7A 3QLEA 3KNXA 5EL0A 4Q01A 4XPZA 2J9XB 3IBYA 3WRYC 3MUNA 4MWEA 3GJYA 2J4DA 1U0NA 4FCTA 1OFTA 5IJZA 4NR0A 4FT4A 5FOTA 3WP1B 1NVWQ 4LFAB 3DMFA 4ZEWA 4OAQA 4CV1A 2ZFPH 1PFWA 1ZK4A 1XX9A 1O8CA 1CUHA 2BEWA 2FQYA 4BZZA 5CFPA 3U6BA 1GI8B 2VYND 4A6LA 1KA9H 1DPGA 2FPUA 3H5OA 4RULA 4YVFA 3RLWH 4I31A 1U2GC 1WP4A 1DQRA 4H0CA 2JARA 5L3SA 1AZSC 3L4KA 4TT8A 4BO3A 2JJMA 3R3SA 1EHIA 2HRCA 2FWAA 2ZE5A 3GLQA 4JFRA 2V8OA 4WH8A 3W9BA 4RFLA 1FY5A 2GJSA 4ZIRB 3PFKA 4JMQA 5KS2A 2GK7A 4W5HA 1K0UA 4YRQA 4FQ8A 3CZQA 5BR1A 2F7SA 1P0MA 3L1KA 4QLOA 1U99A 2NO1A 5H81A 3SGQE 4TLLB 1M33A 2JNWA 4FEAA 3SHFA 1JG7A 4KR2A 5DULA 4TX1A 2P27A 2PUBA 5EA2A 2G51A 1YTLA 3RVDA 3Q38A 3DPSA 4D3XA 1AMHA 3REFA 1D3TB 1Q0TA 3CTPA 3G4SB 2ZBEA 1N2EA 5BW8A 1PL6A 2XDAA 2BKVA 4BP8A 1AQJA 1RYMA 1Y1TA 1VM6A 4D0GA 1EWQA 2UWPA 3ONNA 2C92A 3S8EA 2VI5A 5CVDA 4RANA 2DFKB 3CN9A 1UTQA 2KM1A 1ETSH 1MABB 2QRHA 2E5WA 2XBYA 4EYSA 3DDZX 4G41A 1UJ1A 3HJTA 1GTG1 1HO3A 4KIWA 4AYYB 2XNSA 1RJGA 1WU8A 3C5CA 4NZPA 2H2ZA 5CE1A 5FO0A 1R66A 2J07A 1P9WA 5E6UB 5BT9A 2J0EA 3OWXA 5AO9A 2RAVA 3G8DA 3MOIA 2QZJA 3UJPA 2H9HA 4IJUA 4MUEA 2GAIA 1CTQA 1FB5A 1QBOA 2FOCA 2NXNA 1OLOA 3KJZA 2IP1A 5HIJA 2V97A 1IUKA 3RG8A 3MB8A 2OZLB 1M1ZA 3O6VA 4MVJD 2I3GA 4YRNA 2G1AA 2DHQA 4GYKA 1VSVA 2Z56A 1F2UA 5IDKA 4DZRA 5I4CA 5H7XA 3PYMA 4H0NA 3B8HA 5L2YH 2EWVA 4BGVA 1E43A 4LJ7A 1KJYA 1D5WA 1F3OA 2IHKA 1XAGA 3PPWA 4ISHH 4L51A 4QDTA 3A1PA 1UDRA 4IWNA 1Z8RA 4GLBA 2WPHS 4CFZA 1NVVR 1IUNA 1O2MA 1XRLA 4MVCA 3WB0A 4OGWA 2AFHB 4JLNA 3CZ4A 2OC7A 1UBJS 4RGYA 2FS9A 1J42A 3B3QA 1TYZA 1L4KA 4EA7A 3BZUA 4BLRA 4KX5A 2C8LA 4OQDA 1SQSA 3C70A 1DWQA 1Q6YA 1TA6A 1ZWLA 1I4WA 2K8IA 2UZAA 3LJJA 2WA1A 3DEZA 1SGNE 1EDEA 2HA4A 2JA2A 4X6XA 1FV9A 4GDMA 2ZDNA 1Y9EA 2ATXA 2WPDD 2FQXA 3C48A 2O7QA 4B84A 4BAMB 5KWIA 2F43A 4K6CA 2C4HA 8GPBA 2ZXHA 4MVYA 4HPXB 4HTCH 2FEAA 1KDYA 2J08A 3FF1A 1IN4A 3N99A 4XNFA 2EZUA 4GP6A 1W88B 5HIYA 1Z7KA 5C0TA 1VI2A 3G5AA 5JOQA 3BMOB 4H1VA 5EIEA 2OYRA 5E4YA 3KOYA 2REXB 1XQ9A 4AKHA 5JQGF 4E3WA 1YBFA 3F5MA 1O3IA 3VR3A 1SGTA 1P0IA 1ZH8A 2X23A 3W1WA 1F1BA 2H06A 2IYZA 4FIDA 4OS7A 3AVPA 5AOCA 3DFFA 3TQQA 3KHTA 4GSLA 1OXKB 3UICA 5B58C 2JW5A 1SHTX 3JALB 4JJKA 5J4VA 3B36A 3GLHB 4ARUA 1MOZA 3L93A 3QXSA 5DP4A 2AJCA 4DPMA 1HAIH 1HWYA 1FDRA 4RKJB 2BT4A 4ID3A 5DM70 4MMYB 1DDGA 5HJ2A 4TLEA 1CY2A 3SJBA 3TRDA 1GLGA 2QRLA 2ZE8A 4FYYA 1YNOA 2CYAA 3M6VA 4A1TA 5LMCA 1BQ3A 5TQ0A 4YDSA 3VPKA 3WLHA 2MSDB 4YMHA 2VHVA 4URYR 1IQHA 5FTMA 4QUHA 2FLBH 5KU1A 4HN9A 2VPTA 2AN4A 1VKZA 3N39C 3MQKC 3W3ZB 3EIUA 2ZIAA 5FB3A 1PK9A 1Q0HA 1ZTKA 3KJQA 1OS8A 4HRYA 2I54A 2AMPA 1Q3TA 1XN4A 1X70A 1PLKA 2NU7B 3UCEA 4C6TB 3O1HB 4RK5A 4EKYA 1GCDA 5E2OA 3TN7A 1VJRA 5HG0A 1VSUA 2WU4A 4LHVA 4IRMA 4CDMA 1TJ3A 1QQUA 5CFNA 1B8NA 3CPHA 1B73A 3D43A 3PUMA 3NAMA 4F85A 4P86A 1ECLA 1YBMA 1YHZA 1V6CA 4MQMA 1HB0B 1Z0JA 3OE5A 5IWCA 4PINA 3N7UA 4NPCA 5KHLB 4X1PU 1NF3A 1RLMA 5B3JC 2QAJA 1P0CA 3RXVA 2DULA 3SX0A 3F5SA 1G3DA 1N32B 3ECCA 1DY8A 3QQ5A 1ZJWA 2MMCA 4DKJA 2P6NA 5FL3A 2FRXA 1KDOA 3FCUB 3I42A 1FQWA 3KD3A 5FNVA 3VPBA 3GZNB 3G2OA 4N5MA 3EF3A 4BJ6A 3MOSA 3N8KA 1VMIA 3WIDA 1TQ7B 2X2FA 1TK9A 1K6JA 2ASVA 4PPGA 5K51A 1UJNA 1CU1A 3AUKA 1PI3A 3OLVA 4LOIA 1RI3A 2QYIA 1G20B 3DYVA 2NU2E 2AGVA 4DQVA 3E0XA 3INRA 4CG1A 1BEUB 1NT2A 2AG5A 3D3WB 2X1HA 5K99A 4PSUA 4FC7A 1N2CE 1WXGA 3OZUA 4M8NE 1PG5A 1J5XA 2XTAA 3IHLA 4LZNA 5KCZA 3WA7A 1FCJA 1Y3IA 1PSWA 3D31A 2N1MA 5JSHA 4RZSA 5DYYA 2CD9A 1ODLA 3CJRA 4JC5A 3TQRA 5HTOA 2HDWA 4KRYA 1H1LA 4TT3A 4IIBA 2EFEB 3OM8A 1ESBA 4BKUA 4CKWB 3R0VA 1R16A 1XUIA 1XFDA 2YZKA 3K6SA 1DUVG 2BX3A 1ELOA 3PG5A 5J4YA 1O4WA 2OBSA 2FDRA 3D54D 1DSUA 5REQB 4MWBA 3OIFA 1CT9A 1Q1AA 5DTQA 1SC9A 3H13A 5EQRA 1X8JA 3K0CA 1I80A 3TTSA 4Q1FA 2JFZA 4R0NA 3PR1A 2W00A 2DH6A 2R6CA 3O31A 2W4IA 4I1IA 1CUGA 1UAGA 2G9QA 3EA8A 2E85A 4OYRA 4UZSA 4X5OA 1XRPA 2SGFE 4JK5A 1DCKA 2FG7C 1YS2X 1E2QA 1JHMA 2NWQA 4AKTA 2J5XA 5LUBA 3O4VA 2P4EA 2W2LD 4KSYA 4D97A 1I6LA 1UP4A 1Q91A 2MTBA 2C94A 4BIIA 3V13A 3OETA 1PL0A 4M1YA 1Q6ZA 3LA6A 4ZIRA 4RO0A 2Y1DA 2AXQA 2OO5C 4D4HA 1AE8H 2BJWA 3LY5A 2ZSDA 3JQDA 5ESWA 1LHFH 3MWIU 1KLJH 4XARA 5EMJA 1Z8FA 4X8LA 3UUZA 4HE6A 3CSSA 4N3GA 1K8YB 3FBTA 3NRJA 1ZXXA 4AFQA 2X5KO 5CDFE 3I9NA 3LUBA 3GUYA 4JB3A 5JAHA 2GLXA 4G0XA 3QHAA 2HZ7A 1JE1A 4IJWA 4G81A 5JB8S 2B2XA 2YQ4A 2W2KA 2ZA5A 2CDAA 3IC5A 4LJKA 3X1YA 2VJBA 1KRHA 1MABA 4V38A 4A0SA 1NQTA 2B8TA 3RMMH 3RRZA 3AR6A 4I36A 2N1BA 3R7SA 5HZGA 3CTAA 5C2JB 1N4DA 2M2IA 3I5XA 4YMUA 3PMBB 5E6UA 5EUQB 3R7LA 3EX7C 2OV6A 2VP9A 1KI3A 2FMHA 3KRTA 2H7CA 4GZMA 4Z54A 4EUKA 4HDMB 3DO8A 3KOMA 1Z6GA 3RVJA 1ULHA 2GCNA 3CLUD 4BNLA 1DY9A 1LMWB 1OILA 4WAUA 2OORC 4NCYA 4YONB 2OZLA 4C4SA 1J2UA 4MR7B 2A45B 1WQ4A 1ZMNA 6CHAB 3CT6A 2F48A 1JTFA 2CV3A 5THKA 1T5EA 2TBSA 2DGDA 4Q02A 1TD9A 2BHLA 2E9SA 4WY5A 1F0TA 2VWPA 5DK1A 1J2TA 3UXYA 1RC0A 3NBKA 1SURA 3H5TA 3IILA 4QXAA 1EUYA 4B2BA 3WGNA 4UU7A 1Z34A 2QNRA 4CKBB 5B2EA 1S2DA 1RI1A 2ZDMA 1DXOA 3LT2A 2EWMA 3QVKA 4AW9A 5EAIA 2I9PA 4PGHA 2ZVJA 2AFHA 3W6ZA 4DCJA 3DWIA 1PR3A 1QH1B 3M0EA 1SZPA 4M0PA 5AVTA 2PX8A 1WVIA 1ZCJA 3FETA 2F9BH 5KSZA 4LZ4B 3D1JA 4I8DA 3GRFA 2E4ZA 5DBGA 4UFNA 4WACA 3KYIB 5BN4B 3WRVA 4FK8A