4ACBA

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
469
structure length
448
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEITIDIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
molecule keywords TRANSLATION ELONGATION FACTOR SELB
total genus 97
structure length 448
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acbA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acbA01
4ACBA 1RVDA 2HJGA 1E62A 2FSHA 4Q19A 4YAOA 1WXQA 4DC9A 3HR7A 3H0KA 5CYOA 3LLMA 3AQ4A 4AK9A 4IRUB 2ZRPA 3R9IA 3AB3A 3K09C 2ZJOA 3B82A 4G1BA 3AVXA 1SXJD 3GEIA 4Q4AB 4PZLA 3M0EA 5A4JA 1H8ED 2MMGA 3IIKA 4P0TA 4R71A 1E0JA 1P2UA 4YMSA 4MUBA 3GLIB 2XZLA 1UM8A 2PMKA 2PT5A 2WSSD 4JS0A 1R8QA 1YZQA 3RWMB 4IEEA 3KXKA 5EE3A 3X1ZA 4CEIB 1CF4A 3OJWA 5EXXA 5CJPA 3JVUA 2FFBA 4EPRA 2JLQA 2O0KA 4AD8A 3Q7QA 4LJAA 2QE7A 4OHYA 1FPMA 1FMJA 4I4LA 4DB4A 3F3YA 4IXMA 3AF0A 2F43B 4HDCA 4YMWA 1GNPA 4TMZA 1ZINA 2O0HA 3VU9A 1R0YA 3G82C 4NL4H 3CWZA 4G3XA 4PQFA 4BFYA 1BOFA 3PEWA 1XMIA 2PZEA 2BM0A 2H18A 1TPZA 3OFND 1KO1A 1XB2A 2OK8A 1Q81D 2FZ4A 2I1QA 4Y7CA 3E70C 2QMHA 2EWWA 4C3ZA 4MGYR 2OM2A 3LXRA 4LC0A 2QP3A 4V02A 2YYZA 2VNIA 5GV8A 1E2DA 4ZKEA 2CNDA 1HQCA 5AN9A 2BBSA 4B44A 3NEYA 4LZZA 5EUMA 2RHDA 1KDOA 3BJIC 4Z51A 4UXHA 4HYYA 3BRWD 3T12A 1W44A 1OH5A 4B71A 4ZDJA 4ARZA 4AYWA 2RGNC 2AR7A 5TXGA 4URVR 4ON9A 2O8DB 1HH4A 4M1SA 2IEYA 1XXHE 2IS1A 3A58B 5CM8B 4ZI3A 2FSGA 2J46A 4PTLA 1ELOA 1H42A 2GHIA 2GZAA 3IBYA 4PGOA 2UVQA 3LQQA 4Z8YA 4BRWA 1CNFA 3B1YA 3G5UA 1GL6A 4LPKA 3PCRB 2XEXA 3M6AA 4JVNA 2ZRLA 3AV0B 2J87A 4KJZA 1S2MA 1PVOA 1VCMA 1OGIA 3L82B 3SEAA 5F3WB 1ZM9A 2CLCX 4YALA 3AGQA 2WVJA 3LD9A 4V0MA 3BD9A 4F92B 1N5LA 3RS3A 4DZZA 2HCJB 2WJJA 3U2QA 2C5LA 2J0UA 1CS4C 1QHSA 2WWGA 3T15A 2NQ2C 4CT5A 5IT5A 5LPNA 1IN7A 3D8BA 2GCOB 2QM8A 1Q86D 3CF2A 3VO2A 5KNCA 2JLVA 3GLFE 2CCJA 2R6GA 4YAWA 1ZD1A 4JLOA 1EGAA 3AVTA 4Q9IA 1U0HC 3LFUA 3FHCB 4UNNA 5AR1A 5BN5A 2Q3FA 4QHTA 1TQ6A 1W4BA 4GSYA 4AIIA 3K0EA 2CL6X 3GEHA 1E9BA 2Z4RA 1ZM4A 4FN5A 3ZYCA 1M7HA 2BMFA 4EPVA 5FH9A 5FOXA 2G77B 1IJEA 3TMKA 2GF0A 4W9MC 3MCAA 3NDBB 1CP2A 2OFOA 1P6XA 2JJ2A 1TTTA 1G8YA 1R0XA 3CONA 3SHWA 2GEUA 4BLOA 3ADDA 2IYZA 4QM6A 4BFZA 3L8ZA 3UG6A 2RGBA 3CNNA 3A37A 2CLSA 3KKQA 5AUNB 2O5VA 4Q03A 2ZSEA 3A1VA 1II9A 3FYHA 5GVRA 3W6PA 1SXJA 2WBLC 5TV2A 5JJIA 2BWJA 2OXCA 2ZROA 3CR8A 2VSXA 1M2OB 4YONB 2IXGA 3MWJA 4HB2A 1TLLA 1E9RA 1GFIA 1H65A 4YHBA 3MWLA 3ZS9A 2ZPTX 3BH7A 4F4JA 4QC2A 4RD1A 1NJGA 4LYAA 1FZQA 4C0SA 1HA3A 1JAIA 4M9SA 3U3MA 1Q3HA 2FU5C 3UXMA 3ZH9B 4A9AA 4B75A 5K8TA 5H8WA 1GKUB 3NDPA 5GADl 2RC5A 4KXFB 3KKMA 2RGAA 5FBWB 2WMOB 3TSWA 1QVGB 1V43A 5HKKD 3K9LA 1FX0B 2CK3A 2GCNA 3FE2A 4FXPA 4TT3D 2VPPA 1Z63A 4A8JB 4BFTA 5DGXA 1KK1A 3ASZA 2JEOA 3LX8A 3GJ6A 2JLSA 5FTNA 2BCJQ 2PLRA 4WZAE 5HTKA 4URYR 5EXPA 1NY5A 5F9HA 2R6CA 1GAQA 3A1UA 2WJGA 4A82A 4DDUA 2XNSA 4Q21A 5JI3E 3I5XA 1IN6A 3BAFA 4LYJA 2QTHA 4CRWB 2GEDA 2ZQ5A 2NIPA 1VQOB 4G5RA 1E1RA 2DYKA 2J59A 5EXTA 3ASYA 1COWA 4IVPA 3RC8A 3X1YA 1EG7A 3AP3A 2AKAB 3P27A 3QEOA 1W46A 5K8LA 5JHGB 2C9YA 4RZUA 3C41J 1R8SA 4KYUA 1HY3A 1KO5A 1E0SA 3X2SA 4NE2A 4RD2A 2YVUA 3CPHA 4LDJA 5LB4A 4LWZA 4JYBA 5P21A 2BHRA 5CM9C 3ADKA 3VR6A 5DYGA 1ZIOA 1FTSA 4TQAA 4O2LA 4DQLA 1P73A 2WKRA 1Z6YA 1CIPA 2VZLA 1P60A 2OV2A 4JLPA 2DEUA 3VNVA 3VO1A 1A82A 3AUYA 2NZJA 4G01B 2Q3MA 4FIDA 4L16A 2VEDA 2GBLC 1U99A 1YZNA 2R6HA 3FB4A 4LBWA 3LY5A 1Z29A 2YINC 2ZI9A 3QBTA 1U8AA 1N2CE 3QF4B 4IOMA 3W90A 1E9AA 2ZE8A 5JWRA 1AK2A 4IDQA 5FTKA 3HPQA 4HB4A 3TUIC 2QQ0A 1A2KC 2RGDA 3Q5EA 1K8AD 4IDPA 1W48A 5EP2A 5JS8A 2KSQA 1D2MA 2CHGA 1ZU4A 3FMIA 4CGZA 4WZ6A 4YDHB 1QVRA 2QL6A 2QUZA 3W5IA 4HATA 3V00A 1OW3B 1M74A 1SXJB 4D4MA 4W5JA 3C8UA 1US8B 5CIWA 3AF3A 2G0NA 2X1VA 2D4HA 3B1VA 4XWKA 2J3EA 1LF5A 4EJSB 2XGJA 1JR3A 3E1YE 4NBSA 1ESMA 4LJ6A 5M04A 3QFCA 3PJRA 1OYWA 4MKHA 2CHVA 2EYQA 3DOEA 1B2RA 4IDHA 4BFXA 1XPRA 4Q9KA 1GUAA 2P5TB 5BYKA 1U9IA 1D2NA 2ZJZA 3OIUA 4KITB 3KKOA 1I4TD 3W5UA 5FOSA 4OHZA 1W0KD 3VR1A 5JWOA 1KO4A 4DB2A 5KSWB 2GXQA 3OHMA 4LJ5A 1OYYA 4Q9LA 3EWAA 4X8LA 5DLQC 1OKKD 5B58C 4GNKA 5CYPA 4NMMA 2F7SA 3B9PA 2IUUA 3RLFA 1CBUA 1XZPA 4BGDA 3U7FB 4M9ZA 1VG8A 1N0WA 3BK7A 5FTJA 4BFVA 1SQRA 3B78A 1L7VC 1G3IA 5TDHA 3U4QA 3ADCA 1F3OA 2NO0A 3KTAB 2WSMA 4TN1A 2VIIA 4ZKDA 1DELA 3ND9A 1FOEB 1BO6A 1QG0A 1N0VC 2PMDA 4IJMA 3SJZA 1S9DA 2VHTA 4C0QC 1OXTA 4EPTA 3CF6R 2RCNA 4AC9A 2AFHE 2D2EA 4K81B 5AUOB 4F4CA 3SR0A 1XFAA 3QEJA 1K9MD 1FW6A 2PJRA 3EC1A 2ASEA 5EP3A 4Q1CA 3DMNA 3EW9A 1OB5A 4C0BA 1X6VA 2ZJAA 5KU1A 3EASA 1EX6A 1L2TA 1G7SA 2Q0HA 2AWOA 3ZQJA 3JVVA 4EFLA 2JLRA 3PUYA 1IOZA 1VCOA 4IKEA 3LO5A 4TZ0A 3QY0A 3VHLB 5CITA 2QBYB 1AKYA 3A4MA 2AL7A 1W34A 2DETA 2AD1A 4D4LA 3OZXA 2C9OA 1G20E 4PC6A 5LD2C 1M1KD 1RKBA 1F20A 1R5BA 1XPUA 1JECA 1NSFA 4TL6A 5G3ZA 2NG1A 1Z6AA 2GETA 1CR1A 3BIFA 3ND8A 5E7IA 2C9CA 2RH5A 2ZUCA 2CNWD 2J0SA 4HZUA 4JLAA 1OV4A 2UZIR 4A2PA 2W83A 3W2GA 1XTJA 4FMBB 4L4UA 4CT4B 2VYQA 4JVSB 3LX5A 3WNBA 2WIAA 3DVLA 1OH8A 3SBEA 1I2MA 1ZNWA 2ZVPX 1ZU5A 3AKCA 2WPDD 2YNMA 5CLQA 3WHKA 1YQTA 2C8VA 3NTUA 4IDNA 1VQ5B 2FNAA 4TSFA 1ZBDA 1Z0IA 3K0CA 2GCOA 1NG9A 4TSFD 4PSVA 5FL3A 1BIFA 3TRFA 1NNEA 1E2LA 2IEZA 2QMEA 4MKIA 4MGKR 4NU0A 3GFTA 2V6JA 1KI2A 1KJZA 1R7RA 2F6RA 2QEXB 1RRCA 3C16C 3U3OA 1O3YA 3NC1C 1GKIA 3BWDD 1GL7A 4TL9A 1EWQA 2HF8A 1VQ7B 1DPFA 1F2TA 3EPHA 4OBEA 3H1TA 4WXPA 5AJWA 3GLFB 1U90A 3PFIA 4RFVA 1Z06A 4NCJA 1CJKC 4JBWA 1LF0A 3GJ3A 3QKSB 4UAJA 1VQ9B 2P65A 3QUSA 4WZBE 1F6BA 4L5BA 1S8FA 3I32A 3TNFA 5JJKA 4DHEA 2XXAB 2AHOA 1AGRA 2OT3B 3I73A 4D0GA 4DIEA 4ASUA 2V7QA 3TK1A 3LH5A 2O8BB 3R8FA 1Q21A 2ZI7A 3R7WA 4N0EA 1R5OA 3P4YA 4HAYA 1RW4A 3DO6A 4LI0A 4P33A 3EARA 2CMKA 3MUFA 4IFBA 4FWTA 2G88A 2IT1A 1QGAA 5KHOC 4JSTA 4Q01A 3KTAA 1TF5A 2OBLA 5AJZA 1Q57A 1QFJA 3LBHA 1XEWY 5J40A 1DO0A 1PJRA 3I5YA 4RD3A 2VF7A 2VF8A 1WQ1R 1UBCA 2YJTD 4BECA 1W36B 3AF4A 2NO6A 3QVVA 4PAMA 4PHTA 2P0EA 4EDHA 5DNYB 1HURA 1G8PA 4GP6A 4W5WA 5HE8A 3W5JA 3SU8A 1T8TA 3T61A 3BH6A 4QBHA 1NVVR 2YHSA 4DT1A 4HE6A 4B33A 3O8RA 3TUJC 2ODEA 1E63A 2ZE5A 4QBFA 2ZS9A 3UIEA 3GLFA 2OTLB 1ZM2A 1NL3A 1M8PA 2DCUA 3TGPA 3D6TB 5FI1B 3QXJA 4WXRA 4EKDA 4GMXA 1DDIA 4JLJA 1IXRC 3P4XA 4Q4JB 5BXQC 4CEIA 2H92A 3W3ZB 3U7EB 3AEZA 3IHLA 1Q1QA 2Q9CA 4N3GA 2F1JA 2V6IA 4QBGB 4KBGA 1E1QD 2BM1A 2JA1A 2HV8A 4LBZA 3O8DA 1ZM7A 4U5XA 3RRNA 1KK2A 1G17A 1X3SA 3BH0A 4LPSA 2WWYA 4MRRA 1SVSA 5FA6A 2IA5A 1FRNA 2CVHA 4G1VA 4C0LA 1XU4A 2E87A 1FL9A 4PC2A 2ORVA 4OQNA 2J41A 4QGFA 5IK2D 5JRJA 4NHOA 2FG5A 1QVFB 3A4NA 1GVHA 3F5FA 3SBDA 2OTJB 3T1TA 2B8WA 4X8HA 5FOVA 3QXCA 1TL7C 2YOGA 2CBZA 2F55A 1XXHA 2ZREA 3CCUB 1ZMXA 3M1IA 1K6MA 2ODNA 4LJ9A 4B3GA 3VKHA 4G1UC 5JWHA 1XCPA 2VNKA 2VHJA 4M53A 3U7HB 4NYJQ 2YWHA 4O25A 4B2PA 5KO2A 1KMHB 2IUTA 3E1SA 1EFRD 1XMJA 2IYRA 2CE7A 3N5CA 1FNNA 2C98A 3V4FA 1BMFD 2VRWA 1RRFA 4P3YA 1AIPA 3CRVA 1X8LA 4V0ME 2GJ8A 3TSZA 3IIMA 1IY0A 1G7RA 1GZSA 5FPYA 4OI1A 2CK3D 2ZAMA 1JR6A 3I1FA 1G5TA 1XTQA 2BBWA 4TL7A 4C0JA 2IF2A 3NC0C 5LD2B 4PFSA 1AA9A 1Z22A 1S96A 5H68A 5LDDC 4A2WA 1CXZA 1CKEA 3B1WA 1R4AA 3EA0A 3HU1A 4QL3A 3B5JA 2F3RA 3QFRA 3MGCA 4BLQA 2A3RA 4TYQA 4NDZA 1P72A 1YE8A 2ATXA 2X19A 1AGPA 3MMPA 3DKPA 4JLBA 4PPQA 3AVVA 3VR2A 1UADA 4CEHB 1KJWA 4U7DA 2FH5B 3QPUA 3K70C 3U44A 3IEVA 1GKYA 4M1MA 2QGZA 1SZPA 3OJXA 1OSNA 1K5GA 1W0JA 3TVTA 2VP5A 1QX4A 5BYJA 3QIAA 1AKEA 4B4DA 4LSGA 1I2DA 4QBIA 2IWHA 4A4DA 1QG4A 1WCV1 1UDWA 2G9NA 1E2PA 3LAWA 1ZD8A 1W5TA 5KNDA 3MHPA 4IFEA 4LJ8A 1Y3AA 1A4RA 4LV6A 2ZANA 1XXHB 4OK3A 2GJ9A 4B34A 5K8IA 2XZPA 4ZIRB 4DUGD 3VR3A 4M9QA 2ODWA 1QDEA 4DSOA 4TL8A 1WB9A 3NBYC 1N6PA 2GILA 3C5HA 1X8JA 6Q21A 2XJ9A 4AI6A 1S72B 4LV8B 3KX2A 4MGIR 3RRMA 1XX6A 2OFWA 4F93B 1II0A 2R8RA 1HE1C 4MYTA 2JJ2D 1VG9B 1W0JD 2JJ8A 1P2VA 2R9VA 4TYNA 5FUXA 4PZZA 4FWIB 4Z1MA 4A0GA 2JIZD 1UKZA 4DSNA 4EPYA 2DBYA 4G5SA 2ZYTX 5LB2A 4DLTA 2NPIA 3IEUA 1WMSA 5GJBA 4M2LA 1SHZA 2RGEA 5H1YA 4LJ7A 3EC2A 3T35A 1A8PA 2OCBA 3OEHD 2QRNA 2H17A 1QZXA 1KRHA 1YR8A 2CXXA 4GZMA 4CIDA 2HT1A 3RRZA 2J0QA 2ZYUX 4OK6A 4F7WA 1NI3A 1UKVY 2V1XA 4JLMA 4LC1A 3SN6A 3LDAA 1SM4A 1EFCA 1T91A 4PO1A 1VKJA 1DBSA 2VLIA 4A0RA 4AKEA 4OQXA 4TLEA 3TUZC 4CEHA 1EFHA 5TY0A 4FI3C 5CB8A 1OGJA 1MO4A 1JXMA 3CUEF 2GQFA 3WBKA 4MYCA 1NMZA 3ZVRA 1YZTA 8OHMA 2KI5A 2ZTSA 2PJZA 3TE6A 1YR7A 2BKUA 3EZ9A 2GJKA 1TMKA 1S1CA 5C4GB 3PXGA 4MRNA 3THWB 1B0UA 4YAFA 3E2IA 1PUJA 2BCGY 4C7OB 1I7PA 1LNZA 4M1OA 3FKQA 5L3SB 4QRHA 2ZS8A 4L15A 4OHWA 2WAXA 4R98A 3B2EA 3VQTA 4B2LA 1L8QA 1E32A 2BIFA 4WW0A 3KQKA 5DSZA 2I3BA 1P61B 1SVIA 2J0VA 2V8OA 4LHWA 4MA4A 2WWFA 3VR4A 4DJTA 2JASA 3HWSA 4W5HA 3J81k 3T1OA 2DWOA 4G0NA 4DLZA 4TMKA 4BLRA 1W2BB 2P6UA 3WNCA 5KNBA 2EQBA 4L8GA 4QNMA 5A5GA 3R9XA 1NBMA 1W4AA 2J5XA 2GJSA 1Z0AA 3GLGA 3RABA 1X86B 1ZNZA 1SKQA 4FMDF 2A5JA 1E9CA 1QG2A 4A1FA 4D4JA 5KTYA 2V4ZA 5IDVA 2EWVA 3LV8A 3QJYA 4CEJB 2OBNA 2BDTA 1ZIPA 4PO9A 2W6IA 4NONA 4BZXA 5FPHA 2YOFA 4PSKA 1JJ7A 3PUZA 2KBFA 2C95A 1DG1G 2RGCA 2ZI3A 2ZJ5A 3S1AB 4EPXA 2YC2C 1DTSA 2JATA 1G6HA 4TTRA 4RZ2A 2J1LA 621PA 3I62A 3PEYA 1VCIA 4FK8A 2HLDA 2B7CA 1XEWX 2B6HA 4Y0AA 3LBNA 3NKVA 4CZ2A 4PSAA 4MRPA 1GILA 3VX3A 1BH2A 2WPDA 5HZHA 1QHHA 4US1R 2HUPA 2J7KA 3L0IB 4GT1A 2VSFA 2R2AA 4WBSA 2W0MA 2XJ4A 4CDGA 5E7MA 1SVMA 4FCTA 3B85A 1CJUC 5DISB 2CHQA 2CJWB 3LQRA 1YJWB 3FPKA 3LO8A 1R5NA 2ZU0C 3CCQB 3MWYW 2O52A 4DUGA 4Q4HB 2VP2A 3SJBA 3N2IA 3K70B 2MSEB 3EZFA 4B6EA 1QGZA 1XTKA 2O8CB 2QE7D 4KCGA 1XMSA 2J45A 2J7PA 2JJ1A 3LVBA 4ZGNB 2OAP1 2LWIA 2P2LA 1N5JA 3A1SA 4PO8A 4PPGA 5KSOA 1CJTC 1DAKA 3DMDA 1KI3A 1CRQA 1OFIA 4XOIA 5DE3A 2JIZA 4RCZA 2F1RA 1RRPA 3GP8A 2HEIA 1DAFA 1CR2A 4PHHA 3AF1A 2PZFA 1NIPA 2C77A 1GTVA 3TW8B 5FBVB 4QXAA 5DI3B 1V5WA 1T3HA 3THXA 1H8EA 4QJ5A 5DN6D 4XWAA 4GZLA 5D3MA 3AH8A 4YXWD 5FTMA 4BEJA 4E03A 1U8ZA 1XJQA 1TQ4A 2R44A 3A36A 2GXAA 2BF4A 4IOLA 1DO2A 3R9WA 1P4SA 2BJWA 2QI9C 2R65A 1VQ6B 421PA 3JQRA 2B7BA 1E0KA 2ZRDA 4I1VA 1RFLA 4HLCA 2CDNA 3ZD6A 5FL7A 4OHXA 221PA 2PBRA 2H57A 1DAEA 5FBLB 3W34A 3THYB 2CCGA 5A0FA 4ZPXA 4Q7KA 1GR1A 1JB1A 1E2GA 2CL7X 2CLDX 3K09A 4HSEA 2VP9A 1YZKA 3EZ7A 1TQDA 1P75A 1KDRA 3LWNA 5SZIA 3CLVA 2QEQA 4NKRA 4KAXA 1CQXA 5FPSA 1GVNB 4ITRC 4AF7A 4B35A 3RYTC 3L0PA 2NTYC 4WIAA 4DSTA 2EU8A 3AKDA 3JZMA 1E2IA 1F2UA 3CH5A 3FMOB 4JLVA 2MSCB 1YRBA 2HLDD 5EQTA 5B64A 3AP1A 5IHPA 4D25A 4C43A 3ZZ0A 1Z0JA 5FOTA 1XE1A 2FGJA 3GPLA 4GRAA 2Q6TA 3GLIA 3EPLA 2JDIA 2R62A 4I1SA 3QXXA 1KSJA 4QJ4A 5FOUA 4O2RA 2QPTA 1PUIA 4GOJA 2WWXA 4RZXA 5JSZA 1GITA 2G1JA 5B57C 1GSIA 5C2JB 1YHNA 2OAQ1 2QM7A 1VHTA 4JLKA 2VH5R 4B3CA 2OESA 4OJQA 3TH5A 4PAQA 1D8TA 1WBDA 1GNQA 3AVWA 4XVRA 3QFSA 5IK2A 1NBME 3R8CA 3CZPA 4TYPA 4EJSC 3RAPR 4AY2A 4JT2A 1QHYA 2C96A 2QROA 1Z0FA 4YAUA 3CNOA 1XCGB 2XNDD 4R2IA 4A8JA 4QGGA 1ANKA 1UEJA 3CRRA 5G53C 2WWIA 3TQCA 1GJRA 3FGNA 3QSYA 1KNXA 3WYFA 2QENA 3FDIA 5J4KA 1VECA 4CYMA 4HLQB 1PLJA 4DEXA 2ZUDA 4US2R 1GWNA 2BOVA 1YKSA 1ONBA 3L2OB 3GJ4A 2GDJA 2OXRA 3B9QA 3U60B 4KI0A 4JL6A 4PC3A 2E1RA 2P3SA 3F0TA 3PUXA 3H2YA 4NCKA 1TF7A 4RFSB 4AYTA 5EE5B 1OFHA 2JLWA 3BE4A 2VP4A 4DCSA 1OH7A 4D26A 1KTVA 2OCAA 3C7KA 3TSOA 3H84A 3B8HA 1HUQA 1UMKA 2ZYVX 2F43A 3RRYA 3X1WA 4B73A 2RAPA 1ZCBA 2D3WA 4RD6A 1VG0B 4XD7A 1JR3D 3IQWA 3WMFA 3Q5DA 2C99A 2ODBA 4PX9A 4NCIA 4B3XA 3W6OA 1P5ZB 2FV8A 1QHIA 3NEJA 3E20A 4K8OA 4YMTA 1T0HB 2VL7A 4FCWA 4Q1DA 4NP6A 2JCSA 2ZRIA 4I99A 1AM4D 2D2FA 2ATVA 1N5KA 2QTLA 2H1LA 4S35A 4DBLC 3THYA 4CW7A 4YC7A 2AWNA 2OG2A 4DLWA 3DKVA 5EXSA 4QNRA 5DIFA 3L8YA 3SYKA 1TU3A 4ARZB 4D80A 2GPJA 2ZETA 4ZI2A 3CC7B 4PHFA 1T0JB 1COWD 1OFUX 1IY2A 1SVKA 4N0DA 2VHUA 5AJYA 2XSZA 3ZDQA 4XJXA 5THXA 5BN3A 1TU4A 4JLNA 4A36A 5ELXA 4AG5A 3K0FA 4BWYA 1T5LA 1RYFA 4EUNA 2NO7A 4ZCMA 4HUQA 3UG7A 1NKTA 3VAAA 821PA 2W58A 5KSZA 4Q1AA 3D7MA 4F7DA 3IGFA 1Z83A 2AK3A 1FNMA 4CVNA 4Q1FA 3ICEA 2ZUBA 2XOKD 3AVQA 4TZ6A 5J4LA 2FOLA 3IIJA 3KQHA 1KKLA 1Z07A 2ZRJA 4A2QA 4B3FX 1U81A 2WIBA 2WZQA 1QF9A 1R0WA 4HZUB 4BFUA 2ZRGA 4JVMA 4RKEA 4A6PA 1T8UA 3DHWC 4KFTA 1JQJC 1UJ2A 4M4SA 4LHVA 3D31A 5EP1A 1W4CA 1RE0A 4HB0A 3UKDA 3CNLA 3SOPA 1US8A 2PH1A 3TIFA 4EPWA 4TMXA 3IBGA 4A0FA 1SGWA 1NIJA 4RVCA 5JI2E 4OQFA 2QTVB 4Q7LA 5BWMA 1J99A 1KKMA 1HQYE 4Q5IA 3LBIA 1IN4A 1KDPA 3SYNA 4LY6A 2ERXA 3W9YA 1RYHA 2XSZD 4JBYA 5DI9A 1KDTA 3BB3A 1VTKA 1TVCA 4H1UA 5HKKA 1F2TB 2W2TA 3Q9LA 1G8HA 4L9SA 1ZAKA 3WY9A 2XNCA 1GM5A 1FNDA 4H9GA 5ANRB 4ZO4A 1S3SA 4P32A 2YOHA 3M4YA 5CIQA 1J2JA 2QORA 3KKPA 2XOKA 1FQKA 3IO5A 4KBFA 1D6JA 2A78A 1AMOA 2BMJA 1PZNA 1SVLA 3QQ5A 2WKPA 1G21E 3PVSA 3FMPB 1S4QA 4MGZR 4URWR 3DM5A 4JT4A 3CPWB 1IJFA 2IK8A 3IDQA 4B3DA 1YIJB 2BMEA 4XIGS 1Q3TA 2FSFA 1A1VA 1Q12A 1CR4A 3BFVA 3CRMA 3G4SB 2ORWA 4KU4A 3E5HA 3C5CA 1P62B 3W2HA 4B43A 2CVFA 3O47A 5EP4A 4B3BA 1E0AA 2N42A 3I55B 5FR2A 2ZIAA 1EK0A 4D4KA 4D81A 4TMWA 1OHHA 4J0QA 1AZSC 3NH9A 2GA8A 3CPEA 1I4LD 4WOPA 3ZZTA 1HT2E 5FI0B 1M6NA 1IB0A 1II8A 1ZP6A 3R20A 2XXAA 2DHRA 1VYUA 2G0TA 5KDDA 1RC8A 5L3QA 1KZ7B 5HXBA 2H5EA 1KGDA 1XDBA 4IXNA 4LX0A 4E22A 3U6KA 2DWQA 1L4UA 1M90D 1BX1A 1MRSA 1VQLB 2QA5A 4EFNA 1WDTA 1VYVA 1Q44A 1MV5A 3UMSA 1AQUA 2XZOA 2OILA 4LUCA 1Z3IX 4M8NE 4URZR 2ZRCA 3VU9B 2QTZA 2ZXUA 3PEUA 4R7ZA 3U61B 3KQUA 1NKSA 3ZS8A 5KSPA 2XTMA 4ESHA 3VKWA 2VA8A 4B74A 3ZVLA 4AURA 3NG1A 4Z8XA 1DG3A 1PLKA 1EFUA 2G3YA 3B6EA 2WMNB 4OKSA 4GBMA 2QMUA 2XAUA 2YV5A 4EQ6B 4TTQA 3A6PC 4DRZA 1N6IA 4L9WA 3SDZA 5HR5A 4BLPA 4UXJA 1E94E 4DLRA 2FN4A 2WJIA 3TQFA 4MRSA 2GAOA 1FQJA 4CF7A 1KJYA 2IF0A 3W8NA 3K53A 5TVKA 2P5SA 2QRZA 3GMTA 4YLGA 3KXIA 3QXSA 1J70A 2XX3A 2IS2A 3W2FA 3CCJB 5DHFA 3WHLA 1ZUIA 2O8FB 1IM2A 2RC6A 1MABA 4GL2A 1O87A 1XRJA 4M1TA 1EWRA 2ZYWX 2RGXA 1J9ZA 1KMQA 1OXVA 5L3SA 3RHFA 2FZLA 3ES9A 4C2UA 2OUKA 4IVQA 4DWJA 5L3RA 2CRVA 3QF7A 5GJWC 3PR1A 3TAHA 2OSBA 3TAUA 2FPLA 2RGGA 3KDSE 4Q7JB 1Z0DA 2D74A 2ZSDA 3PG5A 4KVGA 1E2JA 2BBTA 4ESVA 4PC1A 4YMUA 2GK6A 4OJKA 4I1UA 1GOTA 1FUKA 1IAQA 4U9UA 4XH9B 4KFSA 5DN6A 1GIAA 1N6OA 1J90A 2AKYA 4M0LA 5D3QA 1MO3A 1MH1A 1KAGA 4QGAA 4M1WA 2YWEA 2IYLD 3LW8A 3QKUA 2ANCA 2ZSFA 4LGMA 5J4HA 1C1YA 2OLJA 2V54A 4MITA 3Q72A 1KIMA 2A9KA 2EVWX 4DCTA 3DZDA 1Z6XA 2JJ1D 1XTSA 3U5ZB 4UNQA 1E1RD 2FPKA 1MOZA 3GLIE 3CW2A 3RS4A 1DS6A 1SHKA 1MKYA 1KHTA 1RIFA 1TX4B 2QG6A 2W6JA 1AJEA 1X1RA 1YJ9B 5J5CA 3MJHA 1M34E 4JJKA 4C4PA 1MO6A 2DFKB 1U2RA 4JJZA 1DVRA 1Q22A 3GLHB 1GP2A 4NCNA 1EP2B 2VHQA 3GJXC 3CRZA 4DXAA 4DSUA 4E07A 4KVAA 2ZRKA 3VKGA 1NVXQ 3EZ6A 2AK2A 2W2XA 1VPLA 4TYWA 1T9HA 1G19A 3Q8XB 2WHXA 2BPOA 1Z2AA 1KO7A 3SS8A 3CMEB 1YJ5A 1YI2B 1NN3A 3U6BA 5FL7D 1QHGA 5CK4A 4IVRA 3OZWA 1LW7A 1T3LA 4OI2A 4HAWA 5FOWA 3CWQA 3RS0A 2OBMA 3EXAA 5SZHB 3IPXA 1WP9A 3QVUA 1E99A 1MR3F 2A5DA 1CU1A 3N70A 3CBQA 3KJEA 4HLUC 2JLXA 1DDGA 3UANA 1HTWA 1J7KA 4MDFA 4MKFA 1XEXA 4NYMQ 4KLNA 3D3QA 1KI6B 2ZAOA 1XTRA 5KDLA 1YZLA 4KV9A 2F9MA 2GTPA 2ZS7A 1W47A 2V9PA 5JEEA 3THOA 1NMYA 2H8KA 2RHMA 2ZVQX 3B7GA 4YDSA 5F9FA 2FSIA 5GJVC 1NVWQ 1E79D 4A15A 3IPYA 1UKEA 5B2ZA 3EG5A 2AFIE 1W2GA 1N5IA 4PANA 3TR0A 3HJNA 5D3MB 4D2IA 5JMTA 3DM9B 2ZSAA 3MD0A 4IDOA 4AKHA 5FUVA 3CKLA 3JZAA 4Y9RA 5G40A 2NO9A 3P20A 4XSGA 3B60A 1TNDA 1GO2A 1ZW6A 4XSHA 1GAWA 1S1MA 1P9WA 3BBPA 4JKYA 3KZ1E 3AUXA 4HUTA 1JAHA 1IHUA 4DEYA 4TMTA 1XNJA 4NPHA 1XD2A 1Y63A 2QTFA 2W6ID 1KO8A 3KJGA 4C30A 4OI0A 1GG2A 2WJHA 1GRNA 2GXSA 4DCNA 3BB4A 2D62A 3GLHA 1QH0A 2EFHB 3GEEA 4QHSA 3JQPA 1SULA 2GZHA 3PITA 4M22A 4NYJR 3RVBA 3ZVNA 2FGKA 1S0UA 3ZBUA 1SVWA 3W8RA 1XD9A 2AXNA 2WJYA 4LRWA 1ESNA 4QOSA 4YQFA 1G7CA 3CCRB 5JZVA 1QUFA 4I81A 3K0SA 2V1UA 1E1QA 4U02A 1N6KA 1ZCAA 2XB4A 5E4FA 3FKSD 1FTNA 1YVDA 1TUIA 2QAJA 3CZQA 1ODFA 1YU9A 4KYIB 3P26A 4V0OA 1D5CA 4QGHA 4A0HA 2EIXA 1VQPB 2JGNA 4D82A 4Q1EA 3B1ZA 2B5OA 2ZEJA 3W5VA 2B92A 2J0UB 3I92A 3EPJA 1A7JA 3UWOA 5JECA 3QKRB 1XD8A 5GVSA 2OCYC 1TUEA 2QT1A 2QA4B 3G0HA 5EJEA 2HYIC 2JLZA 3Q3JB 3OZVA 3DZ8A 2OK7A 1BX0A 1E9EA 2V55B 1KNQA 1N0UA 3G71B 1FRQA 1U0JA 1QHXA 3AVOA 3EZ2A 4Q4JA 3FHTA 1W35A 1JEEA 1NSTA 2ZM5A 3U4QB 1QBKC 2OZEA 1W49A 4TLCA 2GNOA 2TMKA 2ZRNA 2IUSA 2G6BA 3C15C 4F4IA 4Y9UA 1AS3A 2PT7A 3K9NA 3K9GA 3OIVA 5EUQB 4EFMA 1JXOA 2W0SA 3MLEA 3B1XA 3NBFA 4JSYA 3LRPA 3H86A 2AN9A 1E2QA 1JA0A 2X77A 1BS1A 1E64A 4QKQA 1U0LA 3BFXA 1KYIA 3OE7D 2GKSA 4GOKA 3KKNA 1KQSB 5JJLA 1Z47A 4Q66C 3NBXX 4OL0A 4RFSA 1KI4A 2VP6A 4AKIA 3I4LA 2Z6VA 2J9RA 4UQOA 5E3HA 4AG6A 3KFVA 2FEMA 1EP3B 1R6BX 2OFXA 2WSSA 1IN8A 2IBMA 2QPOA 5KSYA 3CRW1 2EFGA 4HLUA 5FBQB 5C18A 4DCVA 3JQQA 1KZGB 1VCNA 3UK6A 4JBXA 1S9HA 4DQKA 2NZ8A 4ZGQB 3HR8A 4M1KA 3FPAA 3EA5A 4UXIA 3RS5A 3K8YA 5JEDA 3GLGE 4V0KA 1RPZA 1YZGA 3MJRA 4JKIA 2BGJA 3OF5A 3AF2A 4OI4A 4X8MA 1C9KA 2PX0A 2RB4A 1EESA 3I3SR 3KL4A 1RRGA 1CR0A 3SJCA 4IOKA 2CE2X 3TVDA 1E2FA 4LV5B 4PQRA 2FPMA 4LCBA 1VYTA 1D1NA 4B47A 4G5QA 1G7TA 1OT3A 3CR7A 3I61A 1N3BA 2FFHA 3QKRA 3W5HA 1Q1ZA 3CCSB 4DDTA 2BMDA 2WAYA 4IOJA 2LCFA 2HXSA 2VO1A 3WP1B 1QHNA 4V0LA 3VNUA 3GJ5A 4TQ9A 4Q47A 1G3QA 3ZIAD 2QP9X 5AUPB 1B23P 3LLUA 1G3UA 3DDCA 2HYDA 4Q00A 2HCBA 2QAGB 1TAGA 3VTKA 1N6NA 2WWHA 2IYXA 5GV7A 3L0SA 2CEAA 3REGA 1H85A 2Q21A 3AGPA 4QHYA 3BB1A 5H5JA 4BASA 4D0NA 3EPKA 2X2FA 4RCYA 4E09A 1RJ9B 1XF9A 3CIOA 2DB3A 1G3MA 4KFUA 2IXEA 2NGRA 4ZDWA 3L0OA 4EIWA 1WF3A 4C0KA 4ABYA 1VMAA 4JIMA 1ZVQA 1QGYA 3BORA 3NBZC 4PC7A 3WRXC 1E4VA 4U00A 2WTUA 3QOFA 3QKTA 2REBA 2A5GA 1KK0A 3EX7C 2H7VA 1EP1B 1EFTA 4OQLA 1VQMB 4TMVA 1P9RA 4ZCIA 3RDPA 1DE0A 2GEVA 4FMCF 5G41A 2EFDB 1RZ3A 4TQUS 2HDNB 4LHXA 2A5FA 4A6XA 3OZUA 1AZTA 2YZ2A 4IW3B 1JI0A 1BMFA 5CB6A 3FVQA 2O8DA 4C9BA 5J4VA 2Z43A 4ACAA 2O8BA 5JHHB 4JYCA 1OB2A 2IYWA 1U94A 2REOA 2GVZC 3MSXA 5EE0A 5HPYB 1AS2A 4OQMA 4TTPA 1VG1A 1E2HA 1IBRA 2GF9A 5IF9A 4PXAA 4ERNA 1UF9A 1W2HA 4KFRA 1GDDA 3AVUA 3OAAD 5JS7A 4GDFA 4KLZA 1OHHD 1ZNYA 3RNLA 1G9XA 4Q4LA 4BE7B 1W0KA 2DY1A 1BYUA 1VQNB 4HEJA 5CK5A 3SFVA 3KUDA 1G291 1HT1E 3QPVA 1Z6TA 2PL3A 3QF4A 5E95A 1X8KA 3X1XA 1Q82D 1HV8A 1KK3A 4D0LB 1GNRA 1NJID 2GXUA 5FPTA 3QFTA 3ECCA 1E2NA 3CCVB 4AKGA 4EH1A 2FA9A 2IYSA 5DO9A 3QG5A 4PHGA 1LS6A 1KI8A 1JJ2B 4V0NA 5L3VA 1TF2A 1J8YF 2OO7A 3CM0A 2QDXA 2XITA 5FUYA 1BJKA 1L4YA 4O3MA 4Q1BA 2EFCB 1OPXA 3FKSA 4K46A 1E96A 2ZJBA 2DPXA 2WM9B 1HEIA 4FMDB 4TLAA 2ZSBA 5HZKA 1Z28A 1A5TA 4UNPA 5G3YA 5JSZB 4EJSA 2N46A 1KI1A 4XD7D 1EXMA 3TLXA 1Z5ZA 5EE1A 5EMNA 2ZE6A 4TWZA 3ONWA 4LYHA 5HE9A 3S1AA 3WMEA 1E9FA 4B32A 4XTCS 521PA 1JPNA 2VHCA 3MWKA 1VIYA 2G83A 2D7DA 1II8B 4RZ3A 4UNSA 5JRZA 1YHQB 3GCGA 3N2EA 2O8EA 3CX7A 1IY1A 4TLBA 3OFNA 3ZVMA 5CJ2A 2R6FA 4EAQA 1UEIA 3SFZA 3P32A 2QBYA 3NVAA 3U3KA 4JLDA 1KI7A 4OK5A 3CO5A 3K1JA 2C2HA 1OXUA 1Z2CA 2VP0A 1MT0A 1VIAA 3AKEA 2UZ3A 1KAOA 5DHAA 3UPUA 3OEHA 2JLUA 1VQ8B 3U44B 1NDHA 4LBYA 3GD7A 3A8TA 3EIHA 2FE4A 1VDZA 1TADA 2QP4A 1KI6A 3CX8A 3UMRA 1DARA 2BBOA 2HF9A 4P6VF 3ZBTA 4F91B 3RS7A 1E2KA 3V9PA 3NIBA 4BLTA 1DAGA 3CPJB 4EQ6A 2OLKA 3RANA 5F2EA 3BOSA 1Q20A 3W3AA 2W2VA 2GK7A 4N3NA 2PCLA 1E69A 4MH0R 1AQYA 4II7A 2C03A 2B21A 3B13B 1SKYE 4DLYA 3OAAA 4C0HA 1N6LA 2IHYA 2A7QA 1KI9A 1SKYB 5C1BA 3HU3A 2ZI4A 3PUWA 1ETUA 4BQSA 2IC5A 2C04A 4NTZA 1FNCA 3G6EB 3IUYA 2RMKA 1CNEA 4R9UC 2BKEA 3A1TA 4RJLA 4GFDA 2GAAA 2OE2A 2ZRMA 4MKGA 1G5PA 2IWRA 1G41A 3LVQE 2Q9BA 1OXXK 2GWHA 5HCIA 3CCMB 1MRNA 1XEFA 1DADA 3HP1A 1J8MF 3PEVA 4HAUA 4MYUA 1G18A 1Z6GA 1ZC3A 4ZCLA 1E79A 3V4RA 2GJAA 3K0AB 4Q02A 2KBEA 3REFA 4B76A 2ZR7A 1G8FA 3WXMA 1JNYA 4RY2A 3T1QA 4B48A 3ZJYA 5AWFC 2HT6A 3R7WB 4BLSA 2QSZA 3AVPA 3O8BA 2BV3A 4KO8A 2VNHA 3NHBA 2BJVA 5BN4A 2K5UA 3FFBA 2QZ4A 3ZQ6A 2IS4A 1K5DA 5DH9A 3CH4B 1UDXA 4P4SA 4IHQA 1HE8B 2E9SA 2FFAA 4O0MA 1KD1D 4Z54A 4G5OA 4LYFA 2ZJ2A 4DLXA 3FOZA 1LY1A 2SHKA 3QNUA 3O8CA 2LKCA 3RSLA 4BRUA 4RD4A 4HE5A 2FX3A 4HZIA 4IEIA 1P9NA 1DEKA 3PV0A 3VX4A 1AN0A 5J47A 3KFXA 3QENA 4P31A 2DFTA 2WOOA 3V76A 1Q0UA 3C4JA 3EIQA 3KQNA 1JR3E 3IKJA 4LBVA 3OW2B 1ZJ6A 5TMPA 1W36D 3CF0A 1T4GA 1OIXA 1WBBA 2AD5A 1YRAA 2BN4A 2W6JD 4HDQB 4A8JC 4UNRA 1K8RA 3ZLJA 1NN0A 2Z5FA 2PX3A 2FDCA 4NYIR 3PIRA 2ZU6A 1VHLA 3HDTA 5KUTA 4HLDA 2ZRHA 4DDWA 3IHWA 3KB1A 1QUEA 4G5GA 5JFGA 2ORIA 3QE2A 4X8OA 5FPKA 2FJUA 5L3QB 1OKKA 4RKFA 2OCPA 5JCPA 4LHZA 2ANBA 2ZI6A 3T34A 2ONKA 3AKYA 1JALA 3BS4A 5JLJA 4URUR 1QFZA 4RSGA 4Y0VA 4JMPA 1KOFA 1U9IC 4DLVA 1NJFA 2BMWA 3GQBA 4GMDA 1K73D 5AJXA 2ZRFA 3T5DA 4BUJA 4BPBA 1KSFX 4A92A 4JL8A 1Z8FA 1LTQA 5KYKA 4AYXA 1RJ9A 3WNDA 3IQXA 1KSGA 2IYYA 4CEJA 1ZUHA 3U7GA 4PQYA 4TLDA 4XWOA 2GZDA 3QI2A 2VYFA 1T6NA 1N8RD 1X1SA 4Q48A 1D9ZA 1GL9B 1CTQA 1JQLB 1XZQA 3GLHE 1GRRA 4QJ3A 2KWIA 3CD6B 2FWRA 1I4DD 3PUVA 2IYQA 3T06B 2FEOA 1Z08A 2IYUA 5TR9A 4LOAA 2FF7A 3WYAA 2ZR9A 1UBGA 2JLYA 4ZDIA 2I4IA 1W5SA 4ILEA 3KXLA 3H4MA 121PA 1PV4A 2ZJ8A 1NLFA 3OEED 2NMVA 1CLUA 3DOFA 1G3RA 2F3TA 1H8HA 1D9XA 1LFDB 3EIEA 4C7OA 2XB2A 2NO1A 1NRJB 3GFPA 1ZC4A 2O8CA 3GFOA 2O0JA 5CLLA 4OYHA 4MYHA 3IO3A 3EAQA 2QGNA 4HI0E 2BEJA 1XJ0A 2WWWA 1NMXA 1JA1A 1IXZA 1UFQA 3I8SA 3QG1A 3KQLA 4WA7A 3CRQA 3VMFA 1F60A 3CB4A 2Z0MA 3GJ8A 1NVVQ 4MRVA 5TARA 2QMOA 3ADBA 2KJQA 2HMAA 1M1YE 3NH6A 1FMLA 4DKXA 5BW8A 4P4SB 3GJ7A 1SXJC 1E6CA 2I1VB 3DL0A 4WVFA 3U3RA 2VTKA 1T5IA 4ZDKA 3GLGB 2P6NA 5FBRB 3WRYC 2QQEA 4MUAA 4BZPA 3CX6A 2OHFA 5H70A 1P3JA 2XTZA 4RD0A 1QVAA 2EW1A 2YC4C 1C4OA 1UAAA 2CJWA 1F5NA 1UBFA 1E9SA 3SJAA 1NP6A 4HUQB 5C46F 1HYQA 3Q7PA 3OIYA 1Q1EA 5JCZA 2QPAA 1OH6A 4K1XA 1DAMA 1U8YA 3K0CC 1QHHB 1R0ZA 2L0XA 5SZKB 3SE0A 1BQEA 1IQPA 1DOAA 1M7BA 2XTNA 4LJ4A 2PLFA 3CC2B 5GJCA 4BZQA 4URXR 5EZ5A 3CCEB 3ZZUA 2BEKA 5KDOA 3LA6A 1E9DA 1VQ4B 1MABB 2D06A 2CCKA 3AM1A 2A30A 2Y8EA 1EX7A 3QKSA 1YITB 1IXSB 2FFQA 2MMCA 5KPDA 3AVYA 1DAHA 2ZE7A 3A4LA 3AP2A 2ZI5A 2Q9AA 4XVUA 4QM7A 3WBJA 4UJ5A 3BGWA 3OESA 2VBCA 4BEBA 3SQXA 1P2TA 1NN5A 1MO5A 3ZGXA 4Q7MB 1FNBA 3SQWA 4DCUA 3SC3A 3ICQB 2VQSA 4BFSA 2NOAA 2DR3A 1OF1A 4LK2A 4ASUD 4HAZA 3NWJA 1WE2A 1ZM3A 2ERYA 1FP7A 2JDID 4I1OA 4N1AA 2PIAA 2R6AA 2V3CC 2YWFA 3OE7A 1PLLA 1UBEA 3FJOA 1F48A 3Q85A 4P4UA 1ZNXA 4V03A 4POAA 4GOXA 3CXCB 1E2MA 3UWKA 2DWPA 5EZ6B 3VHXA 3THXB 2KE5A 2IS6A 2EFEB 1TEXA 4JL5A 3SYLA 3I72A 5FUWA 4DVGA 2ZJYA 3K9HA 4FINA 3W2EA 2R6DA 2WJVA 3IILA 3SI7A 2P6RA 2BC9A 4NYMR 3LXXA 4TT3A 1LVGA 4AWXA 3HYRA 2GBLA 1NF3A 1IONA 4HDOB 4M21A 3MAAC 4DLSA 4ZIRA 3K70D 1KY2A 2ECKA 2Z4SA 2NPFA 3FMFA 5TB5A 2IX3A 4XTRA 3ZC3A 1W4RA 4Q9HA 5AK0A 4MDEA 2J7PD 1E3MA 1KY3A 3TBKA 3ETLA 3FTQA 1CJMA 3TKLA 4GI7A 1E2EA 3BC1A 2EYUA 1Z0KA 4W7SA 1LV7A 3KJHA 1SQ5A 3FFAA 2QAGA 1QRAA 4DT1B 2PEYA 1OIWA 3LW7A 4NCHA 4GP7A 5CDFE 1JEDA 1G8GA 2QSYA 4FCVA 2A5YB 4UJ3A 1XPOA 4R2HA 1SVOA 3C14C 3MG9A 2P67A 3WYGA 4B6FA 4NYIQ 4Q9JA 2B8TA 2ZRAA 1CULC 1LB1B 5F98A 3T5GA 2DFNA 1NBMD 3P1JA 2QY9A 1Q7YD 3DPUA 3KJIA 4PR0A 4YMVA 2LP6A 4M1YA 1JBKA 2GVDC 3HYTA 2YKGA 1AS0A 1F2UB 2JAQA 1IN5A 4WAUA 2QN6A 1M7GA 3F8TA 3T1VA 1G5RA 2CL0X 2PCJA 2WICA 2AXPA 4KSCA 3UMFA 4FD2A 4KODA 5DYIA 2WKQA 4M9XA 3THWA 3RSOA 1FDRA 1ZYUA 4QFMA 1YR6A 1EFRA 1FFHA 4JZKA 1YZUA 4OHVA 4NH0A 3QE0A 2GESA 2H16A 3OIWA 4PZYA 1VQKB 3QBVA 3A1WA 1ZRHA 2LKDA 2IW3A 1KMHA 1XJCA 3BERA 1YR9A 1W36C 2VNJA 1H8HD 2DFLA 3FHOA 3GJ0A 3LVRE 4LHYA 5BQ5A 3MFYA 1BYIA 3OEEA 4C2TA 4XVQA 1CJVC 3TR5A 2BGIA 2WV9A 1CEEA 721PA 1S3GA 1WRBA 1GAJA 2IL1A 2GRJA 1G6OA 2IYVA 4AF6A 3FWYA 3K0AA 4S2EA 3VFDA 1FP6A 2UKDA 2C78A 4LJYA 3VR5A 1G64A 1P2SA 1JJVA 3PQCA 4PPNA 3NXSA 2HXYA 2F1HA 1W7AA 1GRQA 2REXB 3QXHA 5J4YA 1XP8A 3HPRA 5H59A 1A2BA 4Q18A 1FUUA 4UKDA 2G1KA 2IHBA 5UKDA 1XEXB 4DDVA 4MQBA 4HB3A 1KC8D 1DAIA 5CDFA 1XMVA 1NN1A 1EWYA 2V7QD 1NY6A 3W6NA 3WP0A 4Z1MD 1OIVA 1R10A 3SHFA 4B2IA 3RC3A 2MSDB 3BXZA 3DEFA 4HAXA 2XNJA 1U98A 3K0FB 1XCMA 5LBIA 1Q1BA 3TW4A 2QNRA 4F38A 4D6PA 2ZITA 1LS1A 1NVUQ 2X2EA 2WOJA 3LNCA 5KPJA 1G1MA 1KSHA 1W87A 3W2IA 2AX4A 5IRCD 5DI3A 3ZD7A 4PPFA 4P4TA 5C4MA 5FR1A 2N1BA 2O8FA 4DLUA 2A2ZA 1TEVA 2KB0A 1XD2B 2Q3HA 3MRSA 4KSBA 4Q4AA 3RWOA 2VSOA 4ZV4A 1ZD9A 1R2QA 1E4YA 2QAGC 5KOYA 4FMCB 4WQMA 2YWGA 2OEPA 3KUCA 2QT0A 2XNDA 5K8UA 1YJNB 1JPJA 1OXSC 1G16A 3KB2A 2D7CA 4Q4HA 3RS2A 3X1DA 3SNHA 4C0AC 2DERA 1JB9A 2W00A 1NLZA 1BKDR 3L43A 2RGNA 3QPWA 5E7JA 1QFYA 2BSAA 1N6HA 1OE0A 4BFWA 1UKYA 3SZRA 1OLOA 1ZUNB 2O8EB 2CNWA 3I56B 2Z83A 1TQ2A 4US0R 3I8XA 5FTLA 1P7CA 1G4AE 5SZJA 2IYTA 4GPTA 1FX0A 3UATA 1T3SA 1XTIA 1UPTA 3BFKA 5FFMA 4JVLA 5JBQA 5AJVB 1OJLA 5HCNA 4E5UA 4H1VA 4NZYA 2PZGA 1D2EA 3WMGA 4FW9A 1N25A 2ZRBA 4PAOA 2ZR0A 4YXWA 4TYYA 2X3UA 2X8AA 4KHZA 3TJZA 1XBTA 2PEZA 2FMXA 1NLYA 1OFTA 3NHAA 2BVNA 1NG1A 3U3JA 1E98A 4BPRA 3CCLB 2IXFA 3ZIAA 5EE9A 1W1WA 1CRPA 5AUQA 3EWSA 2F9LA 3CMAB 1SXJE 4HAVA 2RKOA 4QG7A 2ONJA 1XWIA 1N6RA 1WA5A 5L8VA 3HU2A 5B30A 2QU8A 3CC4B 4DIDA 3PENA 1G4UR 2HJVA 2GCPA 2F1IA
chains in the Genus database with same CATH superfamily
4ACBA 2HJGA 4N40A 1I01A 4YAOA 2CW5A 4FE4A 4EUKA 1TCUA 3X2FA 1GZVA 2JFPA 2XBMA 1FDIA 3IAFA 4G1BA 3M0EA 3O3OB 1P2UA 1IUOA 4B3RB 4MUBA 5F4JA 4TUYB 1XHEA 4B4VA 3ZU3A 4GLLA 3OJWA 4N3CA 2JGIA 1ABBA 2B1GA 4AJIA 5EJZA 4I4LA 1MTUA 3VXEH 4IJWA 3RVQA 3WDSA 3OM9A 4B3JA 1BRMA 2HA6A 2XMQA 1V2KT 3P2IA 1Q81D 3NZEA 4H42U 3BTGE 3NVDA 1SBYA 4ZC1A 1OT5A 5JNUA 1BA2A 5TC4A 3CCFA 1RXEA 4FT4A 5G0VA 5EXDA 1H42A 3L6BA 5TPZD 5LQNA 2C88A 5CMXH 5DOVA 5C2ZA 4LTMA 3A9TA 3PD7A 5DP4A 2WVJA 3AGQA 3P97A 3BD9A 3HP4A 4MIOA 2FMTA 2GD2A 3U2QA 2BDUA 1LBTA 3TOCA 3UR6A 3KRTA 3AVTA 3I1JA 3IKLA 2XUDA 4P54A 3ZJ5A 2G77B 5KCMA 1Q3XA 2GF0A 5JY6A 3D7LA 1IZ7A 3A37A 1M72A 3W6PA 1II9A 2WG2A 4ZT7A 5KJ1A 1OI7A 4KP7A 2EL9A 1V3UA 3ZS9A 4QC2A 4OHMA 4C0SA 4FDLA 4M9SA 3ZZNA 3U3MA 4CN8A 3BMXA 3BTDE 5A1JA 3IHTA 4LRYA 2Z09A 3UC9A 1DQYA 1GGHA 2X3FA 4FXPA 2VPPA 2D3TA 4G86A 4P3XA 2PLRA 1NY5A 5I5GA 3CHYA 3RC8A 5LQAA 4ZHQB 1P2NA 1GCOA 4FP9A 4KYUA 2R87A 5JZBA 1O3KA 4LDJA 1WKCA 1E7MA 5DWQA 3REOA 2DGDA 1NAHA 3ESCA 2ECPA 5DMXA 2WKRA 1CIPA 1WW3A 3OLYA 2UUPA 3TZ6A 2ZPQA 3SKBA 2VTBA 1QB8A 4FJ0A 2PKAA 2PWPA 1I2BA 3AI7A 2QUZA 4HATA 1Y8AA 4E7OA 2Y92A 4MMZB 4Y9DA 4GPEA 2D4HA 4A03A 1W2WB 3DUWA 3RFUA 1N07A 4HWSA 5A3RA 1E3WA 4I5FA 3OPYA 1ADFA 1SUPA 3W79A 1JJBA 1XTBA 3OHMA 4Q9LA 2PFEA 4X8LA 2QRUA 2PLAA 1PJ3A 1FN8A 4JZEH 4J3NA 5C8YA 2F67A 1QIHA 3KQPA 1CT0E 3MQFA 4U7PB 3T9CA 4LJRA 4MEBA 3OCXA 1RKVA 3H97A 4M1QA 3UT6A 3EC1A 2P69A 3U0VA 2Q07A 3C5WP 5EI5A 4MVJD 3QYFA 3HKEA 2C0CA 4JBGA 5C94A 2HQ1A 4UDXX 3D6NB 3ILXA 4JB2A 3W2GA 4D9NA 5FXMA 3FLBA 4RTNA 4TSFD 1M2JA 4JEIA 3RXCA 3CLRC 4KQCA 1HIAA 1Y1PA 4KTTE 7MDHA 4DYDA 4HWRA 1YTLA 1G3EA 4WJLA 4OGYA 4BFCA 2W5EA 1VQ9B 2W93A 3SHTA 5JJKA 2XD9A 3TK1A 2VSYA 5C5OA 1JX6A 4CKBA 4AVYA 1VPEA 1E3IA 3VVLA 1CF9A 2AVNA 4MR9A 3D5EA 2OBLA 4DW2U 1C2HA 1VC2A 1HDEA 3TRKA 4FGWA 4KFCA 3ZWQA 4M86A 3RYIB 3TXXA 4Z7OB 4K6MA 4DDHA 4QBHA 2ET6A 4L3OA 3S27A 5B1IA 4F48B 5EKTA 2XOEA 4UM7A 1GQOA 1GLGA 4ROSA 2GERA 1E7SA 4UQPA 3HACA 4FXGH 3MA0A 4YK7A 4XJTA 4KN8A 2GZ2A 2X9VA 3FD8A 3D8HA 4RPBA 2B8WA 1JMKC 3QFFA 1PGJA 4MB0A 4ZP1A 1K6MA 4RDJA 4UPVA 4MG3A 1DEOA 2EP7A 1XMJA 4VGCC 3N5CA 3S28A 1E1MA 2XC4A 2JH6D 3PO1C 2AJLI 4UDYX 1G5TA 4B1TA 5LDDC 3SNDA 1WZNA 4PZDA 3RSGA 3DGEC 1MGOA 4JEMA 1BD3A 4IW4E 4MVJE 3DH0A 1FVHA 2IDZA 4FEEA 4YEJA 1QG4A 2BTOA 1YWGO 2ZANA 4YRCA 4RKRA 2P2ZA 4NZ9A 4ZIRB 2A67A 4JP5A 1QMPA 5B2FA 3RRMA 1W0JD 3GYGA 5IASA 5DM2A 2OD2A 5AI9A 2IIVA 3DD1A 3VB5A 2WYOA 1T32A 2RGEA 2V35A 3HABA 3PV5A 1A8PA 5DX1A 4C7XA 1E61A 2ACVA 2OGSA 2W5UA 4BC1A 1H4QA 4MMXB 1DBSA 3AEKB 1VL2A 3WADA 3NJ4A 4FI3C 3WBFA 3HUDA 5LUBA 3V1MA 1MO4A 3IP9A 8OHMA 3BXXA 2GJKA 2CHAB 4GI5A 1ZJKA 3F71A 4C7OB 1I7PA 4DNPA 4OHWA 2NUAB 4X0WU 2YW9A 1RD3B 5CHAB 2J0VA 4ND4A 2FDRA 2C4NA 1D1PA 4DLZA 4QD3A 4GL4A 1X86B 3A84A 5TS3A 3QJYA 4GEGA 3A87A 4X7MA 5H80A 4W99A 3DWFA 4JKOA 1CUBA 1PK8A 3HY3A 3PA8A 2HJRA 3A9UA 3E7XA 6NULA 2HPAA 4K0KB 2HLDA 2QMZA 2FWJA 3TGKE 3LT5A 2W48A 4XBBA 2BY8X 3N7TA 4Z6KA 4Z4QA 4GT1A 1FU4A 4DNRB 1J8VA 2VDVE 4JGGA 2ZECA 1YJWB 2XPCA 1TU0A 4DUGA 2RH9B 4WZEA 4DA9A 2VRCA 4XDEA 5AK6A 3TRHA 2JK0A 4ZGNB 2OAP1 4KR9A 2HMUA 3LCUA 3DMDA 4UARA 1EUYA 1OFIA 3C45A 1ZCJA 2NU8A 2ZGBH 1CR2A 3C70A 1NIPA 4PZEA 1KEVA 1N08A 1Y3YA 3PLPA 2HMWA 5C1UA 1A4UA 2P4QA 4PFQA 3FKJA 2IJD1 3D23A 5FB3A 3PXXA 2P2CA 4M8SA 4RORA 3OOEA 1BQ3A 2B36A 3T4UA 1W8DA 3WZLA 3PNPA 3H65A 4FUIA 5EERA 4KAXA 1BDJA 3F73A 1L7OA 4AF7A 3ENWA 1NXWA 3FMOB 1PDOA 2HLDD 1WY5A 1MX5A 2PUHA 3ZZ0A 1Y8QA 3LFHA 5C17A 3SHOA 2C54A 3IAM6 4HLNA 4FX2A 3PRDA 2G1JA 2OAQ1 2QM7A 2OESA 1KZYC 4HIZA 5K09A 3LS2A 3R8CA 4TYPA 4UE6A 4G0QA 4XLLA 3WQHA 4JYAB 1U7DA 1ZW1A 3M1YA 4CL3A 1Z4QA 4ZJYA 1GWNA 5JZSA 3UGTA 4IIXA 4KI0A 4E7NA 4V2UA 1IULA 4D45A 4X8TH 4JI7B 4Y6DA 3RFTA 1E3JA 3GDHA 1G8SA 3R23A 3EZLA 3ZXSA 1XQYA 3NEPX 3UTCA 5G0TA 4YMTA 4LFBB 1LO6A 1K0FA 4S35A 5K3AA 3MGAA 1TU3A 2QRVA 1USWA 4D9JA 5AJYA 2FVYA 5LKRA 4CI0B 4MWEA 1TU4A 3IV9A 3AW8A 1RYFA 4GOOD 1IQFA 3ATKA 5IJ9A 2OBFA 2ZTGA 4G5FA 821PA 3D7MA 3O9MA 4KB5A 3IT0A 1IM5A 4ZA2A 1EVZA 1JZSA 2KLHA 1S6HA 4K3VA 5C52B 3F6RA 2ZHEH 3M1AA 3DHWC 5AFYH 1US8A 1G37A 2GVFA 4DCMA 2FQYA 2QUKA 1XZNA 3QYJA 2ZBDA 3RF7A 1ZIXA 1BTXA 4JBYA 1Y3UA 1VTKA 4X00A 1G8HA 3OQ1A 1PJPA 5ANRB 1X87A 2VI5A 4P32A 2YOHA 3F97A 3KKPA 3DMTA 3QLJA 3N87A 4HX2A 2AMFA 3JALB 3KHVA 4B3DA 1YIJB 1GRCA 1Q3TA 1DIHA 2SICE 1QY6A 1P62B 2CVFA 4NFLA 1E0AA 2JCXA 3I55B 3IPRA 1TCBA 1EK0A 4YA6A 4WERA 4IINA 2R751 2I7TA 1U5AA 1KGDA 5F8TA 2QA5A 4BQOA 2NW6A 4PPYA 3GYLB 2C83A 4RXMA 2R8EA 3SNEA 4JZIA 2XC0A 3QQPA 4UE3S 3F7MA 1A8UA 3N8NA 5ESDA 4M0EA 4EQ6B 4R1QA 4L9WA 4NY1A 3PHHA 4UXJA 3KPYA 3W0LB 1M2VA 5JUWA 3MHTA 3FPEA 3G0BA 4MJ7A 1OP2A 1NN6A 1IB6A 5B4UA 1V0JA 4FDUA 4MYDA 3Q6MA 3T5CA 4IDGA 1DDOA 3ID6C 4NG5A 1GQFA 1JLLA 1MCZA 1VI2A 1HDOA 4LQDA 3ZCVA 5MN6A 1D0IA 3OJFA 3TAHA 1CGHA 2RIRA 5BRNA 2ZSDA 5ARBA 4OJKA 5C1DA 2A2XH 3DOUA 1J90A 4TKUA 3WQRA 5JCXA 5IFLA 2FO9A 4YT4A 5HM6A 4JJAA 5T8KA 4OHBA 4MCAA 2KCPA 2OYSA 2Z6BD 3GLIE 4XLZA 4TS3A 3HQ4O 4M55A 4E15A 1Q3KA 1WKBA 3GLHB 2VHXA 2WMDA 1EP2B 3CRZA 5AW7A 3A1DA 1BOOA 4B6PA 2Y2UA 4WZBB 4X60A 3OJOA 1YJ5A 2BHTA 3L04A 3P2YA 3U6BA 2X6RA 4QQNA 1O2PA 1MR3F 1CU1A 2VJNA 1V2UT 2RJNA 1SU8A 1TPAE 4FGKA 4MKFA 1XEXA 4TKVB 5C5DA 1KI6B 1QRWA 1MAAA 1ZOPA 2PNFA 2ZVQX 3BCRA 3IPYA 3TJUA 2Z04A 1N5IA 3EGDB 1K7YA 2OCIA 5I51A 3SO3A 5BV1A 4X44A 5G40A 4CKEA 5A8XA 4MDHA 1AURA 1GO2A 5LH8A 4GI2A 1EK2A 3LUCA 4EHAA 4G1MB 4MROA 3FDFA 2P9BA 4DCNA 1B15A 4NYJR 4D9BA 1G7CA 2XRCA 5AKJA 2W4IA 2IOYA 1IBKB 1U80A 1YASA 4BRZA 1ODFA 1V2GA 3OJCA 4RNDB 4P3OA 3M35A 2DXIA 4Q4JA 4R0VA 2G6BA 1JXOA 1LPNA 3MOSA 3CS7A 5F52A 3BF8A 1MTOA 2GKSA 5DX0A 1UBOS 1PR9A 2PD3A 2FP4B 2IBMA 4CQMA 1JEOA 1O34A 1QC5B 3AHJA 4JBXA 2H9EH 1RPZA 3DF7A 2BGJA 4R8LA 5HNKA 2GPAA 2ESRA 2NAPA 1HKUA 3K32A 3ZXYA 1UBRS 2WUEA 2H2FA 3ZCSA 1PJCA 4B47A 1IZ0A 2F8MA 1FVXA 5CUQA 3USZA 4BU1A 4Q7YA 3LLUA 1MCTA 3HBJA 3VTKA 1KAEA 1Y3FE 3TTXA 1HNEE 2E6KA 1W29A 3G2JA 3ZD9A 3CIOA 4MVJA 4MPVA 4C0KA 1VMAA 3UOGA 1E4VA 4L4SA 4Y0NA 4HBGA 3JYPA 2YZ2A 5IYZF 4L3VA 2O8DA 4C9BA 3UFXB 1HE3A 1YC0A 4DCCA 3G2LA 2HQRA 2CV3A 1O8BA 1RRVA 2G40A 3IDSA 1WM1A 1NXXA 2C8KA 2NN3C 1POXA 3ROPA 4J0IA 3R44A 2GXUA 5EWJA 4JYUH 3I04A 4U7TB 2IYSA 3HKBA 5HQTA 4DR2B 4FFRA 2OB1A 2EEZA 2R85A 4MYSA 1K0HA 3AU9A 1BN7A 1JSZA 1E96A 1RWXA 4H15A 5HZKA 3LQFA 1QIGA 1KI1A 3VDXA 2W3KA 5AHGH 521PA 3NZIA 2QTBA 4KHPB 5B5SA 2IHNA 4DLNA 7ADHA 3K1JA 1VIAA 1CP3A 1W6RA 1PJAA 1JG4A 3B2NA 2QN8A 5AESA 3EIHA 3CX8A 3UMRA 2IOTA 3EISA 4C4OA 1Q20A 2W2VA 5DLPA 3IC5A 4TV9B 2A7QA 2BFNA 2BR5A 3DBLB 3SUEA 3E1KA 1AVTA 2RMKA 3EIWA 1F8GA 4FS8A 2YFQA 3D4PA 2OE2A 2ZRMA 1V11B 3M5NA 3LVQE 2BZAA 3LOQA 1MRNA 2AMYA 3LC0A 4HAUA 3IP8A 4G56A 1E4EB 2GJAA 2KBEA 1XQ6A 3INYA 3REFA 2PXHA 1IG0A 2ZR7A 4GHWA 4RY2A 4LKOA 2HNTC 1S7GA 3HJBA 1BVHA 1SFIA 4HNUA 1X7ZB 5DP9A 3LOXA 5LIRA 4OOEA 1WQ3A 1E3WB 4DLXA 3RSLA 1XKXA 1DI0A 4QUGA 1M0TA 3QENA 2DH6A 3NONA 3O92A 4FR2A 1T15A 4PYOA 3ZLJA 3FNIA 1AV6A 1B4DA 4Z4VA 2PGAA 5JFGA 4KXWA 3ZH2A 1NTPA 1O94C 1JIIA 2OBBA 4K40A 2F4VB 2W8BB 2ZRFA 3K2IA 1KSFX 1Y9ZA 3LC3A 4F12A 1ZUHA 3F4LA 5B36A 3OBIA 2AFHA 1T6NA 1X1SA 3TRDA 4DV4B 3ZR4B 5FFFA 1U7OA 4YLEA 1JYEA 4FUDA 4WKNA 1VI5A 3SV9A 4ZDIA 4DCGA 3C3MA 1CLUA 1GG8A 3I05A 2FR1A 3KQSA 4UTNA 3O84A 1NM5C 2QGNA 2E1BA 3RRXA 1NU9A 4B87A 3AOEA 4PLPA 3HM9A 1F60A 4JASB 1AQIA 2HMAA 4ZDKA 1B93A 3KYCA 2A1TS 2NVWA 3BTSA 1Y37A 4HUQB 3MI4A 1UFVA 3EY9A 5KYWA 1IQPA 1P5JA 3AB7A 4LJ4A 2HA5A 4KP0A 5DHPA 5A4IS 5DRTA 2VXYA 3QKSA 3FCAA 2DFPA 2QCYA 3WGVA 4U39A 2A4GA 3BGWA 4I3FA 1UHBA 4Y2SA 4Q7MB 2PP6A 1XUJA 4U2BA 4X61A 3RTEA 4UFFH 4QLAA 4UUPA 3PMAB 2BEUB 4XLCA 1F48A 1ZNXA 4V03A 3CXCB 5AM5A 3TITA 1E6MA 4NCAA 2FN3A 2R6DA 2XTJA 1AHTH 1CUDA 4KTSA 4GWGA 5B4TA 3K2BA 1YHZA 2OO5A 3MBOA 5DHQA 3SX2A 5HWSA 1CUIA 3M3TA 2GM5A 2HHHB 2Y5FA 3JZFA 4PTZA 4CQLA 2Z9LA 1UM9B 5CDFE 1YQ9A 5B3JA 2CD9A 2XCOA 4UHBA 3FDZB 3C14C 1TBRH 2CLLB 2PTCE 1MRZA 5KMGA 3GUVA 3GWGA 1DWDH 4Y6PA 3KJIA 4GW3A 4J90A 3M6IA 3F5SA 2G51A 3BIWA 2HTEA 3S7HB 1G5RA 1V7CA 2CL0X 3OCYA 3UMFA 1HRKA 1YL7A 2FDAA 1YJAA 1RABA 4H1TA 1UJ1A 1FFHA 4HR7A 5E0HA 2Z2KA 1KVSA 4QNNA 3LY8A 4N6NA 5JXWA 3EODA 2YWRA 3LVRE 4C2TA 3IMCA 1QQUA 3BF6H 721PA 3BDAA 1Y5AT 3FWYA 2ZXHA 4N12A 3B3QA 1C1TA 3FNEA 3MEQA 1UTPA 3GVKA 5CDFA 3UJ9A 2GTHA 3RASA 4UUQA 2WZBA 1Q1NA 3HCFA 3B3FA 4E32A 1O5GH 3O8QB 4XYGA 2X2EA 4NZQA 3FFWA 3S3TA 1SN7A 5SV2A 4OYRA 4DLUA 2KB0A 2JGDA 4G89A 1E4YA 2OEPA 1JPJA 4QPJC 1G16A 3KB2A 4L7VA 1T9CA 5E7JA 4EFDA 2J09A 2UXBB 4X1PU 4X8VH 4JOQA 3CG4A 4X85A 1TQ2A 3G89A 4MWCA 2C4TA 3UATA 1XTIA 4JVLA 2BTQA 3ABZA 2PZGA 4C22A 2X8AA 1E98A 1J2RA 3U9LA 2G5VA 2DT8A 2RGYA 2ONJA 1KYWA 1N6RA 3HU2A 3LUFA 2YHUA 2ZZQA 4RIHA 2GCPA 2HU5A 5TPZA 1MXHA 3H0KA 5KTOA 4MUIA 1P1BA 2WZNA 3MJDA 1VZ3A 3AVXA 1M1ZA 2AZTA 1EHYA 3GPDG 2DUJA 3IQEA 4YMSA 5B7GA 2WSSD 3NUQA 4JS0A 1Z8JB 3D3JA 3KXKA 3GOVB 1WIWA 1IQMA 1ZD5A 2YQ4A 4ISHH 1ZUNA 4YX9A 5C3NA 4QOEA 4NI5A 1S3FA 3G82C 1P1KA 1K4YA 2BGUA 2H18A 2LP4Y 5KKNB 3OFND 1QFSA 3LJJA 5JVDA 1QVWA 4IF6A 1OFGA 4G25A 2GNPA 4X1OA 4HYYA 2GPNA 4J76A 1P4JA 3R5SA 4ER7A 1NJ1A 1LX6A 1MQ5A 2ZJ0A 4FFWA 5THQA 4EYSA 2X8KA 3RY8A 2XEXA 3L6OO 2J87A 3HI6A 1ACJA 2PA0A 3KJQA 2BONA 4F8JA 1R4ZA 2CLCX 3SIRA 1I80A 2FYRA 4V0MA 4RGBA 3S0NA 4CT5A 1IN7A 5ECYA 2DKOA 1WTCA 3M6VA 3ESXA 1BUIA 4EDFA 3NIWA 2GJPA 4EB0A 1XMXA 4RPLA 5EGSA 2PUFA 4HK4A 1ZK0A 2CLSA 4TPYA 1N9GA 2VYVA 2BWJA 2GLTA 1LQTA 2VSXA 3ENNA 3L7JA 5KCZA 2D0IA 3WK6A 2XEDA 2QLBA 1TLLA 1KMMA 2FQWA 3AJRA 3UJDA 1YI1A 2R8XA 4ZRNA 2C7OA 3HXLA 3ZH9B 4B75A 1GKUB 2XF2A 4KREA 1P05A 1ZI8A 3VPHA 3A9RA 3WLRA 3P95A 4P22A 4U2EA 4QOHA 2JEOA 2FZEA 3TGIE 5HTKA 2XNSA 5JI3E 4Y10E 2FDXA 2O9QA 5EJ7A 3AWIA 2J59A 2B78A 1U1DA 2I6SA 1SGEE 1UPAA 1GU0A 1R8SA 1MMFB 1EBBA 3X2SA 4NE2A 2J6HA 3CPHA 2RCEA 3QKIA 3KB8A 2VZLA 1VIMA 1Z36A 4AZTA 1ZSLA 2CVPA 2V7TA 4F21A 2YHBA 1RKQA 3HPQA 4HB4A 2NVOA 5HSGA 1UC5B 3U4GA 4XIYA 2BDHA 2HL6A 3LBFA 4D92A 2GYUA 3C8UA 1G3BA 1QG6A 1Z8RA 3S6JA 2VR1A 1L3CA 4BFXA 3QP9A 4FZ3A 1ZICA 1T2VA 3F3MA 2GTIA 3VBCA 1DITH 4L5CA 3SMVA 1SUCA 2W2KA 4AZVA 1JF8A 1L7VC 2O8MA 1G3IA 5B1HA 1FOEB 1U8UA 3SJZA 3JCZA 3CF6R 3ZVDA 1GZ4A 1EQ9A 4RPIA 4K81B 5ENDA 5AUOB 2PV9B 1CY6A 1TO1E 3JQFC 3CZAA 5KU1A 1KXJA 5ES3A 1JKMA 2Q0HA 1HJ9A 1TCAA 3OU2A 3AL0C 2QN3A 2DETA 1NUSA 3CLUD 4OAPA 2FTLE 1F0KA 1NSFA 5G3ZA 1S2DA 2GETA 2H1OA 1CT4E 3L7IA 2CNWD 1VCPA 1ULTA 1A3BH 4HN4B 4FMBB 1IQIA 2G9UA 2WU3A 4DM7A 2TS1A 2EEPA 2WZDA 2G4UA 1Q31A 3GAMA 2W2LD 5C81A 2AVDA 1FMTA 4UDNA 3A2KA 4QJBA 1TZMA 3M7IA 2QMYA 1GL7A 2HMSA 1VQ7B 5BSRA 1B2LA 4A1VA 3PFIA 5CYGA 4ENRA 4WZBE 3PPYA 4DHEA 3UY4A 3FR8A 3L5OA 2Z1NA 1RFNA 1DO8A 2H9TH 4YB8A 3MUFA 5HJ5A 1HXEH 5D84A 2JKZA 3EXIB 3N8GA 1EWVA 10MHA 4RD3A 1FLAA 5BQPA 1QV9A 1CBWB 3CH7A 4JVOA 3D6TB 4ZVNA 1RC0A 3BEFB 2J9FB 5IZ4A 1JE1A 3AILA 1DMSA 4YP5A 1TZBA 3E27A 1YHYA 1UD2A 2E6UX 2VOJA 4K60A 4YJ2F 1SBHA 3E9QA 3DOCA 3W8EA 1NESE 5BSHA 3VOBA 4QGFA 2GYYA 2EQ5A 1PJQA 3SBDA 2F3SA 2ODNA 1HSZA 3E3LA 1SAYA 1T5BA 2X4LA 3NOOA 1CT2E 1CFJA 4L07A 2CE7A 3R4VA 4PV7A 4JBIA 1DAOA 2YXNA 1CUYA 1YA8A 4NBUA 1V9SA 2OQ2A 6CHAC 4RFLA 4KQEA 4WOKA 5JNLA 3VC7A 3B1WA 1K68A 3VSDA 4IXTA 3N7OA 3SLKA 4HH3C 3VR2A 3P0IA 5JNRA 3LFTA 4RTSA 1E18A 4XGRA 2BH9A 3QUQA 3NBUA 2CVQA 4WTOA 2R1VB 3V1UA 1SCJA 3S1LA 4U2FA 3H17A 3GEBA 2W6CX 4NJMB 2JARA 5JADA 3AERB 2GKOA 3RSZA 5JXJA 4MYTA 1P2VA 3EGXB 2J08A 4CQJA 5GJBA 4JNKA 1CUGA 1NAIA 2JCBA 4ZAVA 3NLLA 4JI3B 1J5EB 4OF4A 5A71A 4NXMB 1PJLA 3G49A 4P1VA 2IU0A 2AEMA 4RBNA 3ZDYB 2WNHA 1YZTA 2ZTSA 2PK3A 1PUJA 5J23A 3EOAI 4W1QA 1J20A 3TIGA 2XQFA 4MA4A 3T1OA 4IRMA 5KNBA 4L8GA 1V9CA 5HMLA 1Z0AA 1Z4PX 1MD9A 2AUNA 4FMDF 2ATCA 1MDBA 2PT6A 2V4ZA 4RDXA 4R41A 3IEXA 2OBNA 4DKJA 3A28A 3PB3A 4BZXA 2YOFA 1WB4A 1K6JA 2QNIA 2JIQA 4JWKA 1CERA 4IBLH 4PXYA 5DYTA 4CCYB 3HA3A 1E6WA 1BVRA 1GI3A 4FK8A 1F38A 4TX1A 3ZE2B 1R6UA 3B85A 2JFNA 1QJ1B 3MMGA 1MQ6A 1YB1A 3CG0A 3N2IA 4FU7A 1QGDA 2YZ7A 1QGZA 1KOGA 4ALKA 3DMGA 2IV3A 1PEYA 1UPXA 5DP8A 2JKVA 4O1HA 2BJHA 2V6FA 2XNIA 1SGPE 5K0CA 3A36A 2Y4OA 5DTIA 4L6IA 3OTJE 1ZSVA 2KPOA 1K3UB 2MCFA 1LQUA 1IC6A 3GUHA 1CYDA 2V7VA 1EZXC 1J23A 3MLAA 3EZ7A 2QJOA 4Q3AA 3HFJA 2WK1A 1SCKA 3DZHA 4B35A 4KGXA 2ZCKP 3H5AA 4ES6A 2W6ZA 4MCHA 1P0FA 2GSDA 3FTPA 3L4KA 4O2RA 3EDYA 1VHTA 4BANB 4CIVA 3N75A 4O2BB 1QHYA 1ZXLA 2QROA 3IIIA 4HN2A 1NF9A 3IL2A 3FGNA 5G4KA 3FDIA 1Z0SA 3DS8A 2FESH 1SEVA 4CDMA 2BE7A 2R47A 5EE5B 1SURA 1APBA 4EGCB 4UEHH 2XWSA 1TOAA 1QB6A 5IJWA 1HXHA 3H75A 4PLCA 1K63A 4L50A 2IXAA 2QLNA 3EXHB 5FRDA 3EA8A 3K9WA 4RF2A 2QTLA 3RXBA 2H1LA 2QJRA 4TMFA 2OXTA 8MHTA 2VWMA 1LHEH 1X9IA 3BRWA 1DY8A 2JGEA 2EARA 3F6UH 3PTNA 3H6HA 1W5FA 2H31A 1UXIA 4EUNA 3WWPA 4QYIB 2H08A 3Q2KA 4M60A 1LLFA 3NCHA 4F7DA 3U7JA 2GB4A 3QW4B 4OOFA 1QF9A 3OM8A 3EQ8A 5CURA 1P4GA 2CLKB 1W4CA 4HB0A 2HGSA 3EGDA 5CVDA 4A0FA 1GARA 1SGWA 4IQFA 5JI2E 2CXPA 1J99A 3SZUA 1SOMA 4FCCA 4EVQA 1BZYA 1NQXA 2XSZD 4YVFA 2R68A 4RSRA 3IMGA 2XNCA 3MU1A 2QORA 4V0SA 4CHAB 1SVLA 2OFPA 2WKPA 3LQ1A 1S4QA 2C97A 3DE7X 4HRVA 3NYIA 2NU3E 3BHIA 3T7CA 3GISB 5F1PA 4PLTA 2DFDA 1YB4A 2VWQA 1C3XA 3LI2A 1OHHA 1OD6A 1GTSA 3ASQA 2C5FA 4WOPA 4AVZA 3ND5A 4IZHA 3IOMA 4BDTA 1GZ7A 2DHRA 3KOOA 2Q4BA 2H5EA 4LX0A 4RTKA 4EFNA 4KO4S 1Y7HA 1I13A 4HY3A 2YYAA 1BROA 1IAVA 3I77A 8ABPA 2GNAA 1P3DA 4OKSA 3JYQA 2OTVA 1P45A 1Q19A 1WXEA 3ED1A 1XRSB 3VPAA 2BRUC 1DFGA 1WY7A 2AGEX 3W8NA 4WKCA 1YL6A 4I8JA 1EUZA 5JMPA 1LLDA 5LXTF 3DZFA 4I86A 5FBKA 3RADC 1WDLA 2V65A 4LDNA 4TTSA 3I29A 1ZDMA 3E7DA 4JUAA 3DTYA 4FYXA 2BFBB 2FPLA 4RVDA 4Q7JB 1QYDA 2REQB 4TS4A 4I1UA 1GOTA 3HUUA 2LZ0A 3GF4A 4XUEA 1P7VA 1D6WA 2OLJA 1A0LA 4EYKA 2PUJA 3PE3A 1YB7A 2EVWX 1ZQ1A 3STXA 2JS7A 1E1RD 2R1TB 3RS4A 2JH9A 6LDHA 2CNOA 4C4PA 2IP4A 1ZLXA 1GP2A 1KQ3A 4GX2A 4DSUA 3VR0A 3EE6A 2ZCHP 1N9GB 1RU3A 2P9JA 2DWCA 3M34A 4D1YA 3ZE8A 1XTRA 1AKTA 5CHEA 4B8WA 3L02A 3N2KB 1E3SA 4YQYA 1XMNB 1D5WA 4AJJA 4ZRDA 4PYKA 2HTFA 3TR0A 4ZGGA 3HJNA 4ZT2A 3OF3A 4OMCA 5FUVA 4Q39A 3NX4A 2FP7B 4ZVQA 4DEYA 5CVVA 5E0OA 1P3EA 2QTFA 1HVXA 1GG2A 2G00A 4PLZA 2D62A 3HVJA 2P9QA 4TTJA 3ZVNA 4WL0A 3ZBUA 1NZDA 2PSEA 4FDVA 2COUA 4D5GA 2BFOA 4X7BA 5MF6A 1F8XA 2QAJA 2WINI 3RIHA 5K7RA 4ZAXA 2WFMA 1T25A 2BR3A 3N86A 2BF7A 3ZHTA 4PG8A 2FPZA 3EEQA 3MS2A 4A7IB 5JO9A 1NU6A 4FKBA 4FOPA 4TLCA 2TMKA 3WWFA 4O4HA 4HDRA 1AS3A 1V7QA 1KAMA 3DJFA 4EFMA 3NBFA 4R2KA 5EHIA 4JSYA 3LRPA 1E2QA 2X77A 1OWDA 1BS1A 2Q2OA 1CVRA 5FX2A 3O1JC 2DPYA 4INJA 2VP6A 4NMWA 1E6EA 2V3MA 1U7HA 1GZUA 5BV2P 2QR3A 1P8JA 2W2KB 3ABQB 5KEDA 2CF6A 4R5HA 4X8MA 3CESA 4IOKA 2GPSA 5ALKA 3ENVA 3FLAA 3L7YA 3R9XB 4EL0A 4TROA 3ZIAD 1YVPA 3HN6A 4BQEA 3REGA 4OJMX 3EPKA 4RCYA 2O59A 4BTLA 5E1DA 5K8JB 1RFGE 1XF9A 2ZJ4A 4PSCA 2BB4A 1SFRA 3JVEA 3L0OA 2GBPA 2O2DA 3ONNA 2QVYX 4ETMA 3WC4A 2ISQA 1EFTA 1T8NA 2Q99A 2QRMA 3OZUA 4J0HA 5CB6A 2JJYA 4ASHA 4RELA 4JYCA 1V0FA 4MUKA 3FVTA 2IPQX 3BIOA 2QYHA 3O3NB 5DZSA 3ZGOA 1ZNQO 3RXMA 5JS7A 3L4EA 2X40A 4JUDX 1KFJB 2EZ8A 5F4OA 1MJFA 2XBWA 1AZ8A 4JQSA 4DG4A 3W3AH 3RQIA 4EH1A 1XHLA 1BHSA 1K7FB 4M9CA 3AFNA 4NC9A 4JFRA 2ZVDA 3LPLA 1HZJA 4RLQA 3ZZ3A 5ESBA 3M3DA 3M33A 2B2NA 3HO8A 1SB8A 1VIYA 3ANTA 2Q6KA 1CCWA 2VDQB 1EFPA 1C9TA 2M1XA 3CO5A 4C01A 5B3LA 2BVXH 5KAPA 4I9GA 2UZ3A 4FZJA 2QX7A 1HAGE 2DQZA 2J48A 3G2HA 2X0DA 3UHAA 1J33A 3ESTA 4E0BA 3B13B 1N33B 1XTZA 1N6LA 3W6UA 4O03A 1WSBA 4Y18A 3IUYA 4GFDA 5A4DA 5J43A 1ECFA 3OIDA 3RKSA 3N76A 1J8MF 3PEVA 2JFQA 1WHTB 3PWKA 4EHLA 1BA3A 1CDDA 3N3AC 2VF2A 5GJ4B 3EBLA 2K5UA 4E33A 3HJRA 4J2HA 1QU2A 1GMDG 1LA2A 3O8CA 2VDPB 3ZV8A 4PYIA 3OU0A 3SM3A 4KRGA 4MUNA 2FCRA 4DK0A 2ATEA 4ABAA 3MOCA 4RZHA 1Y5BT 1NLMA 3EQ6A 4MQ5A 1LJ8A 4AS1A 4ZI5A 3TECE 4A26A 2VK2A 2HNTE 4Y0VA 5EODA 5JT1A 2OBQA 1KJNA 3TTUA 3WNDA 2A92A 1L4BA 4TLDA 4XWOA 5L30H 2A9VA 1CTQA 2AIQA 5D5HA 3UJ3X 3M70A 4U0KA 5TQ0B 2WJAA 2ZJ8A 2AG6A 4FB5A 2BDGA 2PTNA 1RI4A 1Z2OX 4YMHA 5BSWA 5ITZB 1OR8A 1GI5A 1LC0A 5CXXA 3I52A 1JA1A 2E1PA 5EQQA 2FR0A 4ARAA 4UM5A 3ADBA 1FMLA 1SXJC 1K9VF 4IVNA 4G0XA 2RJOA 2P6NA 3NRJA 3PC6A 1HAIH 4GWKA 1IAUA 5H70A 3CXUA 1PPEE 4V0QA 4FONA 3QA3E 1DAMA 3SE0A 2HIGA 1KC1A 1IK4A 4BX8A 3CCEB 1MOSA 1KDYA 1U5BB 3KALA 2J0EA 3DAYA 1V2PT 3AP2A 4XVUA 4QM7A 3WBJA 3DAOA 1NRKA 2IYAA 1MO5A 1GJ5H 1FNBA 1PS8A 4J1YA 4DCDA 1NQTA 1CQJB 5K0SA 1OF1A 1ZM3A