4ACBA

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
469
structure length
448
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEITIDIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSLATION ELONGATION FACTOR SELB
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
total genus 97
structure length 448
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acbA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acbA01
4X8HA 3QE0A 4JVNA 2X3UA 1Y3AA 5JBQA 3W2EA 1IXRC 2D7CA 4M22A 6Q21A 2OK7A 3AGQA 1D2NA 1AK2A 4KBGA 2AXPA 3LWNA 1GM5A 3HYTA 1KJWA 2FF7A 4M21A 3AF0A 3KJIA 2RC6A 5H1YA 4KITB 3R9XA 4HEJA 5FBLB 2GBLA 4LUCA 1SQRA 1GAQA 5FOTA 2MSEB 2WWHA 2XZLA 3NEYA 1K9MD 2ZYWX 2A5GA 2PJRA 1RPZA 3W8NA 5KDOA 3CX7A 4NDZA 1KJYA 2NO1A 2ZR7A 2F9LA 2GPJA 4EPWA 2BMWA 1M90D 2IWHA 2RGEA 1SVIA 1TF7A 1OXUA 1TX4B 4OK6A 2QDXA 4HB0A 3UK6A 1Z0IA 3HU2A 5D3MB 3IEUA 4MYTA 1CRQA 1TQ2A 1XD2B 1Z22A 1Z28A 2GWHA 3E5HA 1E64A 1UMKA 1M7HA 3N2EA 4PPNA 1OIVA 2ZSAA 4LBZA 1EFTA 5TVKA 5AK0A 3I8XA 3BIFA 4QG7A 4TLAA 4YMTA 3ND9A 3PUXA 4C0LA 3W2GA 2BSAA 1JJ7A 1R5NA 3B13B 4DLUA 2E9SA 1RVDA 2ODEA 2WPDA 2YOHA 1UAAA 4C0JA 1E2NA 3DO6A 3IBGA 4MRNA 1N6OA 3CM0A 4ON9A 1U81A 1HE1C 3IPXA 1Z83A 3BERA 2PJZA 1IN4A 1L8QA 1NBME 1W5SA 1XU4A 2RGXA 5FUXA 5FR2A 2X77A 2QORA 2XNCA 5JWOA 3FTQA 4DDVA 2GJAA 2H7VA 4Q18A 3DOEA 1XF9A 2Z4RA 5EZ6B 2JJ2D 4RD1A 3U60B 1Z6XA 4OYHA 1G41A 3UMSA 4F4IA 3NC1C 4U5XA 1JAIA 4RZ2A 1EFUA 3W5VA 4FWTA 3KXKA 3VMFA 2SHKA 1OHHD 3OZXA 3QG5A 4PO1A 4YMSA 1BJKA 1U99A 4TLCA 3W2IA 4B74A 4YXWD 1GKYA 2J0VA 1U2RA 3O47A 3Q72A 1DAKA 3U7HB 1W46A 3IO5A 1ZRHA 4KO8A 1BMFA 4V02A 4Z8YA 3CCRB 4EPXA 1J90A 3TBKA 1E2JA 1S4QA 4HAUA 3LRPA 2EFCB 4PPFA 2O8FB 4UAJA 2V9PA 4LK2A 4V0MA 1QZXA 1BOFA 4PZLA 2OLJA 1XD8A 3NBZC 3CX6A 4PC2A 3F5FA 1KI9A 2QMUA 1ZIOA 1FPMA 3KXLA 4HAZA 4Q4JA 2ZSDA 3KQHA 5FL3A 4D4LA 4HYYA 4B2LA 1A4RA 2QSZA 4A15A 3DZ8A 5E7IA 4D6PA 1CR2A 2QTFA 2J7KA 3IIMA 1QFJA 2AR7A 4KBFA 5KOYA 1KDOA 3ADBA 1G9XA 1RJ9A 1ZCBA 4QGAA 4XH9B 3W6NA 3RS4A 4FXPA 4CIDA 4EFNA 1CR1A 1TL7C 2LP6A 1TADA 4LJ5A 3RRNA 4C3ZA 3B1ZA 5F3WB 2JLVA 1LF0A 4IVPA 1ESMA 2J0UA 1CTQA 1Q1BA 1EP3B 1NKSA 4NCHA 1JXMA 4WAUA 2VNJA 5ANRB 3EPHA 3W6OA 2W6ID 4NBSA 1N6KA 3AKYA 1UKZA 3V00A 3LXXA 1TPZA 2B8WA 3K70D 1E4VA 4QBGB 2CK3A 2AL7A 3JVUA 1XTQA 4JLOA 4Q00A 3A37A 2BMJA 3U3JA 8OHMA 1KQSB 1OFUX 3EZFA 4HDQB 2CBZA 5FUYA 1XTRA 1GITA 3OIYA 3U7GA 1WXQA 1L4YA 3EC1A 3VR4A 2IYLD 2QL6A 4WA7A 2FSHA 1R7RA 1H8HA 4PANA 4YDHB 4Z51A 1XTKA 2EFGA 3BD9A 2GK6A 1NF3A 2IL1A 1N5JA 1ZM3A 3TSZA 4KSCA 2OO7A 3E1YE 3NHAA 5FL7A 4BEBA 1W5TA 2OK8A 2NG1A 2X8AA 1UBEA 2J1LA 1SKYB 4O25A 1T3SA 3G82C 3KKPA 5TDHA 1Z08A 2IT1A 2YWGA 2FH5B 2YINC 5KHOC 1RE0A 3TUIC 4MKIA 3ZVMA 5FPYA 4JVMA 4C2UA 2BBOA 2JJ1A 5CK5A 1IOZA 2C98A 3KKMA 2XX3A 3I61A 4PAOA 2IA5A 4UXIA 3OHMA 3W2HA 4C0SA 3CF6R 4QJ4A 5J4LA 4GMDA 4M9XA 1CIPA 4K8OA 4LBYA 2J45A 1G3IA 4OQLA 4IVQA 3P4XA 1ZNZA 3IGFA 1EK0A 3OW2B 2X2EA 3Q5DA 4EFMA 1B0UA 2EFHB 3RSOA 4PQYA 1Z0AA 1PUJA 4XVQA 2CNWA 3FMOB 4D80A 5GVRA 5C4MA 2OEPA 1AM4D 3T35A 3H4MA 4Q7LA 1Z0FA 4OK5A 2Z0MA 4AK9A 2I1QA 2IS1A 3GCGA 4TMXA 4O2LA 2G88A 3E70C 4PHFA 4LJ9A 2RGDA 4Q1AA 1W48A 3C4JA 3QIAA 3LX5A 3MWYW 3QPUA 4QGHA 2BF4A 2YOFA 4BFSA 3MCAA 2CLDX 4CF7A 1I7PA 2OCPA 5C4GB 3DKPA 4LCBA 4HAVA 1VQNB 3CF2A 3ASYA 4AD8A 2QENA 4DLWA 1UBCA 4DSNA 1PUIA 2VP4A 3KQUA 1KOFA 1E62A 1GSIA 1U0HC 2BVNA 1IAQA 3X2SA 3IIJA 3EIEA 5L3QA 2QQEA 4RZ3A 4NTZA 2QQ0A 3WBJA 3GLFA 1M74A 4B75A 3P20A 4B3XA 2CE7A 4G5QA 1YHNA 4KYIB 1FRNA 1UKYA 4FWIB 4C0BA 3KDSE 2ODBA 3AP1A 4TYWA 1KI2A 2KB0A 2Z6VA 5JWHA 1O3YA 3HU3A 3KQLA 4W5JA 3A1WA 4DKXA 4QGFA 3WRXC 2FA9A 2VP2A 3VR1A 1P73A 1GNQA 1E0JA 4B4DA 1Z3IX 2FJUA 2MMCA 4O0MA 2ASEA 2BBTA 1US8B 2CHVA 3WBKA 1RFLA 3AV0B 3C7KA 2WIBA 2KBFA 3K0AB 3K0FB 4OHXA 3CW2A 3I8SA 1Q21A 1ZM9A 1JJ2B 2CJWB 2VF8A 5SZIA 2GA8A 3QVUA 1JEEA 4R9UC 3VX3A 4AYWA 4BZPA 1E9SA 4WBSA 1IN8A 3CD6B 4HB4A 3U3OA 4ZIRB 3ZH9B 5JS8A 1OH5A 1EG7A 1DAFA 1K5DA 2WOJA 3OF5A 2ZRNA 5DH9A 1ZD8A 1ODFA 3T1TA 1U98A 5JEEA 3RS7A 3RC8A 3SDZA 4R2HA 2QT0A 3RRMA 4LC1A 3WMFA 4XD7D 1R8SA 4PQRA 3AH8A 4Y9RA 3GJ6A 3ONWA 2NPFA 5LBIA 4G1VA 3REGA 3TMKA 4GSYA 3ADCA 4TYNA 1QG4A 2PT5A 3AF3A 1HUQA 2GJ9A 2ZJ2A 3CRRA 4JYBA 3O8RA 2CEAA 2JLWA 4Q66C 1SVLA 4GT1A 3LQRA 4DDTA 1II8A 1KAGA 4IXNA 2ZJ5A 2VQSA 5C46F 2ZE6A 4U7DA 3GJ0A 5KNCA 2HXSA 1Q82D 3E20A 4MITA 1VECA 4G5SA 2FSIA 4OI4A 3SHWA 1VHLA 2GF9A 2B8TA 5JECA 4CEIA 1Q57A 1YZGA 1UKEA 2F43A 4QOSA 4C4PA 2ZITA 3K70C 3U6KA 2H57A 1T91A 1FNNA 1UF9A 2AWNA 4DLYA 1FNMA 4PC3A 1AQYA 1G3QA 2NPIA 4JZKA 2RGBA 2V7QD 3WXMA 3P1JA 4GOJA 5EE9A 3MD0A 1J70A 4LJ7A 2QA4B 5UKDA 2ZYUX 4LHYA 2HJGA 1D1NA 5E7MA 2PBRA 2ZRLA 4ARZB 1E69A 1SVSA 3VHXA 1W47A 4BZXA 2BKEA 3FFBA 4PZYA 1QX4A 3AVVA 3CH4B 4PC7A 1KDPA 4NYIQ 2IX3A 3ZD6A 1T5IA 2WPDD 2XTZA 3GQBA 3CCQB 2B6HA 2IWRA 4Q4HB 1HQYE 3CPHA 1DG3A 2JLZA 5B57C 4PFSA 4PQFA 2F1RA 2RHDA 2HMAA 4JLJA 3CIOA 1DBSA 3SE0A 2PIAA 3B8HA 1JNYA 2CLSA 2FFBA 3RANA 2J0QA 1NVUQ 3KFXA 4D0LB 4W9MC 1IM2A 4CEJB 1OGJA 2UZ3A 1XMIA 4QNMA 3CX8A 2FFAA 2ZSEA 4JJZA 5AWFC 1EP1B 4L16A 3WP0A 2QMOA 5JCPA 3EARA 621PA 4JLDA 1KAOA 5JS7A 2ZU6A 4PSVA 2BJVA 2IS2A 4HLCA 5TY0A 3K70B 1BO6A 1D2EA 1NL3A 3R20A 2VBCA 4LJ6A 3OESA 2G1KA 3AUXA 1KI7A 3LXRA 1E2LA 1BMFD 2ZM5A 1L4UA 2R44A 4ZDKA 3VFDA 3T61A 1P2VA 2DBYA 3K0AA 4TMKA 1J8MF 5DSZA 1S2MA 5TXGA 1G3MA 3UKDA 4AYTA 1T5LA 4TL6A 1DS6A 3KTAA 4NYMQ 821PA 1W36D 4DLXA 3IBYA 3CPJB 1ETUA 2P6UA 1UEJA 1YRBA 1W4AA 3RS3A 1W2HA 3C41J 3SYLA 2WAYA 3CCMB 1W0KA 3QEJA 3BFXA 2YWFA 4D4KA 3OFND 1A2KC 1GKIA 1XBTA 4BEJA 3VKGA 4OI2A 2F1HA 1YZKA 5J4HA 2ZRDA 2Q9CA 3ZJYA 2QT1A 2JLRA 3TRFA 2JEOA 1KMHA 1FX0B 1P9WA 2YV5A 2ZI5A 4WXRA 5CLLA 3I72A 4FW9A 1ZM7A 4A6XA 1KIMA 2KBEA 3ZQJA 1BQEA 3LLUA 4MA4A 3T12A 1F5NA 1CKEA 4KLZA 4CYMA 1OYWA 4FMCB 1F2TA 4JMPA 4EIWA 2GXAA 3B60A 2B92A 1E2IA 4BFUA 121PA 1U0LA 2GRJA 3CCUB 4FCWA 4TYQA 4M9SA 2A30A 1WE2A 5K8IA 1OIWA 1ZCAA 5J4VA 4C2TA 3LD9A 3J81k 4CRWB 3LO8A 1VCOA 1NMYA 1S72B 5HE9A 3AKDA 4PHGA 2IS6A 3PUVA 4JLBA 1GIAA 3T5DA 4BFXA 3WNBA 1OHHA 4CT4B 2OLKA 1HE8B 1KJZA 4ITRC 2VNIA 4UJ5A 5AJWA 5FL7D 3CRVA 4YXWA 4FMCF 3S1AB 2E1RA 2CHGA 2V4ZA 5IRCD 4AF7A 3HP1A 1KI3A 4P32A 1XTIA 2N42A 3CCLB 4OK3A 2F6RA 3GLHB 4F4JA 2MSCB 4F91B 2FSGA 2I3BA 2JDID 4Z54A 4IDHA 4PHHA 5KDDA 4DCVA 2FEMA 1CJVC 2WJIA 2VNHA 5B58C 4MQBA 2KE5A 3ETLA 5G3YA 1F3OA 1VIYA 1OB2A 1G5PA 2ZETA 1NJGA 4QBFA 1Z29A 1DAMA 1TMKA 3B1XA 1KK2A 1Z07A 2H1LA 4Q4HA 5EZ5A 3GLIB 2XTMA 4UKDA 2BMDA 3UG7A 2QM7A 4CT5A 2GJ8A 4JSTA 3DMDA 3KUDA 3B82A 3C15C 3LAWA 5JHGB 5J5CA 1E99A 1D9XA 4PX9A 4B32A 2IUUA 5FPTA 4JL8A 4CEJA 1I4DD 3AEZA 1YKSA 1JXOA 5HKKD 4Q7KA 5JI2E 2C2HA 3Q85A 5TV2A 1E0KA 1OH7A 4HLDA 1VDZA 1VG9B 4R2IA 1G1MA 4Q9JA 2W6IA 3K9GA 4PR0A 2ZJZA 4NMMA 4ERNA 2IYRA 4Q47A 4AG5A 4D82A 2G0NA 2GZHA 2VF7A 3CC7B 2QGNA 5AJVB 1X86B 1T3HA 4TYPA 3UWKA 1YZQA 3KX2A 2G6BA 3PENA 3NDPA 4JLNA 3LVRE 3WYGA 2HT6A 1QHSA 4OI0A 2XXAB 3EX7C 4AF6A 4PZZA 3RVBA 1D8TA 1A7JA 1YU9A 2GKSA 5HXBA 4Q02A 3FHOA 4W7SA 2P6RA 5JRZA 1U0JA 4YC7A 1R10A 4TWZA 1HTWA 4B34A 1E1QD 1OFTA 1SXJA 4M1OA 2P65A 1SVKA 5SZJA 5B30A 1W49A 3KZ1E 2ZAOA 4JT4A 3RWMB 4I1OA 5FBVB 3DMNA 1VG8A 2EVWX 2PCLA 3NKVA 1KD1D 3OJWA 4LI0A 1W34A 1TTTA 2ZJYA 1D6JA 4NP6A 4Q1EA 3AKCA 2ZRBA 1YIJB 2DWPA 2I4IA 3BORA 2EWWA 1AKEA 5ELXA 1XPOA 4AI6A 1UKVY 1ZNYA 4IXMA 3SI7A 2ZJ8A 2R65A 3UIEA 1W2GA 3CMAB 1CQXA 3GJ4A 2D74A 2UKDA 2WJVA 4OQNA 4KVAA 1G3RA 2EWVA 1TF5A 4US2R 2V1XA 1KK1A 4MDEA 2YZ2A 4RD0A 3K09C 4QBIA 5FBQB 3VQTA 4GP6A 4Q48A 5FTNA 4PPQA 1MO3A 3RAPR 2IYQA 3U6BA 1MKYA 5KSZA 1BX1A 1YE8A 4LHXA 2R6HA 1W36C 2HF8A 1VCMA 3W5UA 1XPRA 3BFKA 2RH5A 4AURA 1NDHA 4D4MA 5F9FA 4P6VF 1AS0A 1NVWQ 4JLAA 1UADA 4MDFA 5DNYB 2ZRHA 5DHAA 1HH4A 1RYFA 1I2DA 4P4SB 3QKRB 4P33A 4M1TA 1DARA 2HLDD 1GNRA 1P9RA 4GMXA 4II7A 4MKFA 3ICQB 3T1VA 2DETA 4OJQA 1JJVA 2BMFA 1AN0A 2BEKA 5FOWA 3U3KA 3RSLA 1GJRA 4DXAA 4R71A 1OW3B 2FOLA 2NO9A 3EA0A 4EPTA 1UJ2A 4NHOA 2VHUA 3A8TA 2ZROA 3PJRA 3X1ZA 5EP2A 1YRAA 1FMLA 1W2BB 1OF1A 2A5DA 4Q1DA 2R8RA 1JECA 1IHUA 3RLFA 4IJMA 5CB8A 2GTPA 3TSOA 2GCNA 5FTKA 4BFWA 2ZRMA 1YQTA 1G4UR 3O8CA 1X3SA 4LX0A 3AB3A 4DCTA 2H17A 1N0VC 4UNNA 3RDPA 2ANCA 2WTUA 1KKMA 2VZLA 4UNRA 1CU1A 3UPUA 3LBIA 2BOVA 5HPYB 1MT0A 3QJYA 4HAWA 1A82A 2CE2X 1YVDA 1CJTC 4DLZA 1I2MA 3IIKA 2ZRCA 3KFVA 4EFLA 4WXPA 2VEDA 3CWZA 2N1BA 3GFTA 3SYKA 2ZRIA 1YHQB 1U9IC 1FFHA 3GLGE 2XOKD 2FSFA 1M7GA 5B2ZA 4BE7B 2AD1A 1DADA 4HATA 1G8GA 1UDWA 2PT7A 1RJ9B 4DB4A 3IDQA 4BLTA 1WMSA 3QG1A 4XD7A 1FRQA 3A6PC 2VP6A 4PAMA 1OFIA 5K8UA 3AVWA 4TMWA 1CBUA 1GP2A 1M1YE 1SZPA 4V0KA 3TIFA 3CLVA 2IS4A 4FN5A 1DO0A 2OXCA 5EXSA 3THWA 1VTKA 2RAPA 4MRRA 1GZSA 2GXUA 4XTCS 1VQKB 4AKEA 3EPKA 1XDBA 2YWEA 3OZWA 2WKQA 5HTKA 4YLGA 5BN4A 2ECKA 3A4LA 3B2EA 4TTRA 1N6RA 3EWAA 1JPNA 4A36A 4DHEA 2FU5C 1VCIA 4LDJA 4DUGD 1QGYA 1FTNA 4YONB 4RSGA 1G8YA 2Y8EA 4DIDA 4L9SA 2NTYC 4LYFA 1VQOB 1R4AA 1W0KD 4GRAA 4A9AA 3PV0A 2V7QA 4F7WA 2OSBA 1LTQA 4B6EA 2JA1A 3CNNA 4B6FA 2FE4A 4KAXA 3K9LA 4G5OA 4DWJA 1P7CA 3V76A 2AKAB 4D4JA 4XWAA 1UEIA 5BXQC 4M2LA 5DYIA 5L3SB 5JSZA 1F20A 1K8RA 4B33A 2ATXA 3LVBA 4LJ4A 4UQOA 4P4SA 4BPBA 3QKRA 3BRWD 4MGKR 3JQRA 4UJ3A 4D26A 1TEVA 2ZJBA 4HLQB 4URVR 3FHTA 2A7QA 2IEZA 3UMRA 1IY1A 5JJKA 1HT1E 1AZSC 2V6JA 2AKYA 2QZ4A 4JKIA 1E2KA 3QKSA 3U44A 1AIPA 1KC8D 4Q1FA 2AHOA 3TKLA 4ZDIA 5A0FA 5JCZA 2FGJA 3GEHA 5H70A 1NRJB 3MWKA 2RGAA 2CCGA 1XMJA 1ZNWA 2OCAA 4EJSC 4OQXA 3RC3A 2OAQ1 1NIPA 2DFTA 1G7SA 2EFEB 4ZKEA 4AKIA 4IDPA 5B64A 1EWRA 5GVSA 4LPKA 4Z8XA 1ZJ6A 4DQKA 4L4UA 4DCNA 3QXXA 2CVFA 3DOFA 3L82B 2X2FA 1BX0A 1E2GA 5EP3A 5GV8A 2LCFA 3U2QA 3LBHA 5FOXA 4CW7A 1NBMA 3K09A 3DDCA 2ZS9A 4NCKA 4ZO4A 1KRHA 2JAQA 2VHJA 1O87A 4IEEA 4X8MA 5CM8B 4JJKA 3TUJC 5LD2C 2FPMA 1KZ7B 4R7ZA 3ZGXA 5L3QB 3WY9A 3PUYA 1YJ5A 4H9GA 4TTQA 1PVOA 3EASA 4NU0A 5TMPA 2ERXA 3GLFB 2H5EA 2QGZA 4YQFA 4OHYA 2YHSA 1KSFX 1VQ6B 3OAAD 1JALA 2ORWA 3OFNA 5L3VA 1N0WA 1IB0A 4RFSA 1N6PA 3PR1A 1JB1A 3OE7D 2A78A 3PG5A 4HAYA 5IF9A 1AA9A 2WBLC 1S1MA 2GCOB 3DKVA 5F2EA 1K6MA 4IFEA 1XFAA 1N6NA 2WJYA 2ZI9A 4LY6A 4Q1BA 1GR1A 4L15A 2A2ZA 4GL2A 5H59A 1KGDA 3FE2A 4DBLC 3I1FA 4XIGS 4HZIA 3R8FA 1Q0UA 4V03A 2PL3A 1TLLA 3X1WA 5CK4A 4ZGQB 1RYHA 2VHTA 3CCSB 2GJKA 2CL0X 2P67A 3OEHA 3TJZA 1CS4C 4DQLA 4TLBA 2PZEA 1XCGB 2VIIA 1ANKA 1XXHB 4JBYA 4X8OA 2QTVB 2RCNA 2REBA 1NLZA 5DYGA 1EFRD 2OG2A 3FHCB 5KNBA 3JVVA 2NIPA 5KSWB 4HAXA 2OFOA 5FPKA 2IXEA 3AVPA 1ZC3A 1G8HA 2P3SA 4BUJA 4LRWA 1OE0A 5LD2B 4RKFA 3I73A 1YR6A 3LH5A 5L8VA 2XGJA 1SXJD 5KSOA 4A8JC 1EFCA 1P62B 2DFKB 2QE7D 1J2JA 4H1VA 2R6CA 5E95A 1Z6AA 1EGAA 3SYNA 3T15A 5JJIA 4JKYA 1T0HB 2D2FA 5FI0B 1II8B 5FH9A 5CB6A 1U9IA 1IXSB 3TNFA 2JDIA 2DWQA 5M04A 2CL6X 2WKRA 3WMGA 1VQ9B 2VSOA 1WRBA 1W87A 4KODA 1G17A 1NMXA 3O8DA 1GFIA 1KO1A 5L3SA 2F43B 2H18A 4CEIB 4BPRA 1QHIA 2BCGY 1FUKA 3HPRA 3PVSA 3T1QA 4DCUA 5FI1B 3PCRB 1E9RA 1YITB 3EWSA 1W0JD 4J0QA 1UFQA 4TMTA 5KU1A 3KQNA 4FINA 1IN5A 3TR0A 1G18A 4IEIA 3EXAA 3L43A 3W6PA 2A3RA 2ODNA 4U00A 4EPYA 3TW8B 1RRFA 3FGNA 4P3YA 1WF3A 1AGPA 2BJWA 2DYKA 3W5HA 3MJRA 4QRHA 5HKKA 4C9BA 3CNOA 1JQLB 1A8PA 1R0XA 4PC6A 3AVTA 2A9KA 1Q20A 4N3NA 1G5RA 2ZQ5A 2ZSBA 4GZLA 1E79D 1QG2A 2PMKA 5AJYA 5DI9A 3MFYA 5E4FA 2J3EA 4JT2A 1YZLA 1CR0A 5HCIA 2B5OA 4Z1MD 1Z6GA 1GL7A 3G4SB 3BK7A 1XJCA 2QUZA 4FI3C 1CEEA 2J0SA 2ZI7A 3SQWA 1E9EA 1E1QA 4LJYA 3PEVA 4TMVA 5EXXA 2JCSA 3BBPA 4BFYA 1P72A 1VQMB 4LZZA 1DE0A 1XZPA 1XEXA 4M1SA 1C9KA 4B43A 4RJLA 3ZYCA 4GI7A 3HYRA 1QVGB 1MRSA 1WCV1 3KJGA 1W7AA 1DVRA 2WMOB 1GILA 4KXFB 1VQ8B 2QPOA 2GCOA 3NG1A 2O8CB 1WBDA 1KDRA 3CUEF 2R6FA 4WZAE 1QGAA 4BECA 1TVCA 3B6EA 1BYUA 1VG0B 1X1SA 3BWDD 3D31A 3KTAB 3QFSA 1VIAA 2KWIA 3O8BA 4I1SA 2ATVA 2W2XA 2DY1A 3AF1A 3PFIA 3GJ5A 4NL4H 4XWOA 5CM9C 5EJEA 4EJSA 2BPOA 4URZR 5KPDA 2ZVPX 2QPAA 1QH0A 3AF4A 3JQPA 1EFHA 1XXHA 1N25A 2C9OA 4B48A 3CMEB 2EQBA 1KSJA 1QDEA 2AXNA 1CNFA 3CCJB 2NO7A 4FMDB 4BLOA 5AN9A 1JPJA 2C8VA 2G83A 3CWQA 1BH2A 4JL5A 3QI2A 4PAQA 4QKQA 1KMHB 1VCNA 1Q44A 2J7PD 2BBWA 3P27A 2ZUDA 4UNPA 3FFAA 4U9UA 2W2VA 1G6OA 3G5UA 4LYHA 5G40A 1WBBA 1FP7A 2HLDA 3FPAA 1SHKA 3AVOA 2GXSA 1F2TB 1SKYE 1FMJA 4WOPA 5AUOB 1CJUC 1NKTA 3A1SA 2QP4A 3WRYC 1X8KA 3A1VA 2ZRPA 3MG9A 2ZU0C 1HYQA 1KDTA 5D3QA 1FNDA 4FIDA 4FMDF 3QFCA 5GJVC 4ZDJA 3RS0A 3THYA 3I3SR 1JA1A 4MH0R 2B21A 2OBMA 5LB2A 4LBVA 5JFGA 2C96A 4TTPA 3B78A 4RCZA 1WA5A 1ZC4A 4HUQA 4KSBA 1NVVQ 4AIIA 4A82A 1XNJA 2RGNC 3M1IA 2QTZA 1QG0A 2A5JA 3ZIAD 2OCBA 2W6JD 1SM4A 4WVFA 3T1OA 4OHVA 4TLDA 2O8EB 2ZEJA 2HT1A 3SEAA 1C1YA 5LPNA 5JMTA 2XNDA 1XP8A 1KI8A 1ZNXA 2VH5R 4ZCIA 1QFYA 2IYZA 1H85A 3MMPA 1AGRA 1XTSA 3CRW1 4ESHA 3KQKA 3ES9A 1QBKC 1GRRA 4M9ZA 4E07A 1R6BX 1SXJC 3AGPA 4PPGA 4B71A 4BRWA 3Q5EA 4LHVA 3L8YA 1E0SA 4GPTA 4TQAA 2VSFA 3RS2A 2K5UA 4BFVA 2GZDA 3CRMA 4E22A 3OZVA 4DEYA 1LB1B 1IJEA 1KZGB 3L2OB 4KCGA 4A0RA 2XOKA 4Y9UA 4BLPA 1ZP6A 5LB4A 1XJ0A 4M8NE 2ZS8A 3K9HA 3GFOA 2BWJA 3EZ2A 4A8JA 3NXSA 3ZBUA 1IY0A 1NIJA 1G64A 2R9VA 2QNRA 2FX3A 1G3UA 4XWKA 2VA8A 4HLUC 1JB9A 1YI2B 2FPKA 5BN3A 1XTJA 3H86A 2Q9AA 3U61B 3KXIA 4A0HA 2ZJOA 4RZXA 1R5BA 3KKQA 1LS6A 4QHYA 3CC4B 1WDTA 1CRPA 1EP2B 1OT3A 1ONBA 4EPRA 2FMXA 5E3HA 1A1VA 1KMQA 2LWIA 4PSKA 4BLSA 3QPWA 4YAUA 2FZ4A 1HURA 3I32A 4C30A 3SJCA 1NBMD 3UWOA 2O8CA 2GHIA 3GMTA 3P4YA 221PA 1RRCA 3DM9B 1DELA 5JJLA 2HJVA 4DUGA 1N5IA 4JVLA 1U94A 4MGIR 2ORIA 5TB5A 4M4SA 3EZ7A 3LX8A 3QF4A 2HCBA 3CO5A 2JASA 5EUQB 1W4RA 1E2EA 3G6EB 1G16A 3FYHA 2ONKA 4M9QA 1SXJB 3ASZA 2GETA 5FBWB 4DEXA 2JLQA 2WWWA 1QHHB 4LJAA 4AC9A 5KPJA 2J46A 4DIEA 4E03A 1NN5A 3AVYA 1G21E 2OTJB 2ZI6A 2EIXA 2ZUCA 1T9HA 4X8LA 4PC1A 1N6LA 1X8JA 3QENA 3GJ8A 1C4OA 5E7JA 3SC3A 4B2PA 1KK3A 1E1RA 4XJXA 4CGZA 2OE2A 3DZDA 4XSHA 3VU9B 4JBXA 3THOA 3HDTA 4Q5IA 4HE5A 2IBMA 4ILEA 4RD3A 1ZD1A 2QSYA 3RYTC 2Q3HA 3ZQ6A 3KL4A 4NZYA 3WYAA 3LNCA 3GD7A 3OEHD 5J4KA 1VQ5B 1XCPA 2Z5FA 3BB1A 3REFA 3CKLA 1JR6A 4JVSB 4ZKDA 2F3TA 3LV8A 1YR8A 3MUFA 4LSGA 4NCJA 2FV8A 3K0EA 3FMPB 3PQCA 4KI0A 3RRZA 2O52A 4LYJA 2QA5A 1U8AA 5GADl 2C9YA 4KFTA 4A2PA 2WMNB 1Z8FA 2REXB 2DB3A 5A4JA 1Q3TA 4EPVA 1CP2A 1GL6A 3WNDA 3FJOA 2OM2A 1DG1G 4JLKA 1E96A 4M53A 2AD5A 2JGNA 3FWYA 5CDFA 1T6NA 4IOJA 4DT1A 3FOZA 2O8EA 2J41A 4V0LA 2Q6TA 1P5ZB 1U8ZA 2VYFA 4C43A 2QMHA 4QBHA 1OH6A 1QHGA 1VHTA 2ZRGA 3KUCA 1NN1A 5AJZA 5CYPA 1XRJA 1T8UA 4DSUA 3DEFA 1NP6A 2O0KA 4C7OA 3RHFA 1E98A 1KI6B 1U8YA 2ZUBA 3IO3A 5DN6A 4B3DA 3QKUA 3LW7A 3ND8A 4F38A 1OPXA 3OAAA 4JBWA 3E1SA 2WAXA 2WICA 4N0DA 4D0NA 5A5GA 2QAJA 2DWOA 1NN0A 5FTJA 3OE7A 1PLLA 4GOKA 2VP0A 2H8KA 1HQCA 2ORVA 1H42A 3A4MA 4D81A 1NY6A 5DI3A 3M0EA 3SQXA 3EZ6A 1UPTA 1N3BA 3U7FB 4F92B 2V8OA 3QE2A 3QEOA 1BS1A 4BLQA 1BYIA 2HXYA 2OT3B 5EE0A 1VYTA 3Q3JB 1IJFA 4KYUA 1J7KA 1ELOA 1S8FA 1RRGA 4EKDA 1NJFA 3TW4A 1ZVQA 1E9CA 4YAFA 1GKUB 2RGNA 1VYVA 3SU8A 1E0AA 1QVRA 2G1JA 1KSHA 3VNVA 3CNLA 4LBWA 1NN3A 2QU8A 3C14C 1A2BA 1EFRA 4F4CA 1II9A 3KKNA 3EAQA 3ZS8A 2YKGA 1E94E 2QY9A 3HR8A 1ZU5A 3BGWA 1JR3E 1G7RA 2OFXA 1Q22A 4IKEA 4DZZA 3DVLA 1YR9A 3VO2A 2JJ8A 3G0HA 2HEIA 3CRQA 1FNCA 1CULC 1QHHA 2QE7A 1E2HA 5CITA 3THWB 3BFVA 3VHLB 5HCNA 2PEZA 4Q01A 2IUSA 4RFVA 1KNXA 3UXMA 4WZBE 3CXCB 2UZIR 2PX0A 2XAUA 4LHWA 4DRZA 4DSOA 2XEXA 1WP9A 2NQ2C 4UNQA 2YC2C 4F93B 3NBXX 1JI0A 3GJ3A 2OILA 1YZNA 1ZYUA 4QHTA 4LJ8A 2C04A 3IQXA 1W0JA 1SKQA 2BKUA 3UATA 2CDNA 3IILA 3VU9A 2P5SA 1Q1QA 2QG6A 4QC2A 1H8EA 1QVAA 4HLUA 5JRJA 1TU3A 4FK8A 1KY3A 1XEFA 3SJZA 4L8GA 3W9YA 1COWA 1Z2AA 1II0A 4Q4AA 1B23P 3M6AA 1ZD9A 3K1JA 4I4LA 5JZVA 3ZZ0A 2QM8A 1DPFA 5EXPA 4AWXA 2IHYA 2RGGA 3NWJA 5AR1A 4EQ6B 1E32A 1MH1A 4RD6A 1IN7A 5JSZB 3ZVLA 1V43A 2XNJA 1PZNA 2OBNA 3C8UA 3H1TA 4D0GA 4ASUD 1G20E 1E79A 1YR7A 5AUNB 3B1YA 4B44A 3SOPA 4TL9A 2WWYA 2Z43A 1OH8A 4MUBA 1FUUA 2OCYC 4Z1MA 1Z6TA 2F55A 4BRUA 3GLHE 2WWIA 3QKSB 3U44B 3RWOA 3SZRA 2Q21A 4ZPXA 4HZUA 1ZAKA 3CCEB 4TL8A 1KI6A 5EMNA 2HCJB 1Z0DA 1A5TA 2H16A 1K73D 1GVNB 2BC9A 2BIFA 5SZKB 2ZI4A 4R98A 5EUMA 4C0HA 2FG5A 4QFMA 3GLIE 4Y7CA 3RS5A 2BGJA 4POAA 3OEED 1RZ3A 2GAOA 2OV2A 3T5GA 1FDRA 4TSFD 4NPHA 2QAGC 4KVGA 4QJ5A 3ZZTA 2I1VB 2XNDD 1FQKA 2GEUA 2CCKA 4KFUA 4Q7MB 5BWMA 3EIHA 1N6IA 2QEXB 1YJWB 4LGMA 2VLIA 4G5RA 2O8DB 1EESA 1DTSA 1W36B 2QN6A 4LOAA 3FKSD 3BH7A 3N5CA 2WZQA 4IOLA 3GEEA 2ZXUA 1SGWA 4G1BA 4PHTA 4TZ0A 5DO9A 1Z6YA 3AVQA 1HT2E 2DEUA 2IYXA 4KV9A 2G3YA 4C0QC 2QP9X 1Q1ZA 3CR8A 2D3WA 1JAHA 1KK0A 2OTLB 1MABB 2Q3FA 2VP5A 1M34E 4LV6A 4RFSB 4Q03A 2GEVA 2P0EA 1OYYA 3AKEA 1OXXK 5KUTA 3ECCA 5EE1A 4CDGA 1YZTA 4NCIA 2WWGA 2J7PA 1R5OA 1KTVA 2R2AA 4IFBA 4ZDWA 3OIWA 4IRUB 4OBEA 4YMUA 4TLEA 3TSWA 2ZTSA 5FBRB 3SHFA 3IHWA 3U3MA 5H5JA 1GL9B 2H92A 3OIVA 4P0TA 1FTSA 4DLRA 1VG1A 3JQQA 3BC1A 3GLGA 3K8YA 2V6IA 2PH1A 2LKDA 1ZBDA 4FD2A 4CEHB 1W1WA 4A1FA 3CB4A 1KSGA 3I5YA 3IKJA 2EYUA 2IYYA 3VKHA 5DISB 4URUR 1MV5A 1JEDA 1MR3F 3LDAA 4B76A 1W4BA 3CONA 3ZIAA 1Z63A 2W6JA 4PSAA 4QNRA 4RVCA 2GVDC 3MAAC 1GAWA 1IONA 3PITA 3GP8A 3L0IB 1AJEA 4LC0A 3BAFA 2QTLA 2J5XA 2ZRKA 3X1YA 3HJNA 2JLXA 2QBYA 2IF0A 4JL6A 4FMBB 3I5XA 3QVVA 4NYJR 4OKSA 2Q3MA 2HDNB 3MWLA 3B1WA 4L5BA 2W00A 2QTHA 1D9ZA 4DB2A 1G6HA 2BN4A 5DE3A 2BDTA 2GILA 1K8AD 4FCVA 2WSSA 4YMVA 5CJPA 5FPHA 2D06A 4MGYR 4EQ6A 1NSFA 4C0AC 3ZLJA 2XJ9A 4IVRA 1H65A 1P2SA 1SQ5A 4URYR 3NBYC 2A5YB 1TUIA 4G5GA 1LW7A 1E1RD 4Q9IA 5AJXA 1TQ4A 2VRWA 4Y0AA 2CNDA 1S1CA 2GXQA 4B3FX 3SJBA 3SBDA 5IK2D 1NVXQ 4YDSA 1N5KA 3TVTA 4BZQA 4Q4LA 2XSZA 4DC9A 2ZRJA 1E2FA 4ZCMA 1ZUHA 2GCPA 2IYTA 5IDVA 4LWZA 5CJ2A 4XOIA 2O0JA 3QQ5A 4JSYA 2AN9A 2HYIC 4E5UA 5IT5A 3AP2A 3U7EB 1P60A 3KJHA 3Q8XB 1R0WA 2VHCA 2D7DA 1SVOA 3IHLA 4KHZA 4MRSA 4URWR 3F0TA 2HUPA 3U5ZB 2ZVQX 2HV8A 4JS0A 4TL7A 3K0SA 4AY2A 2FGKA 2ZREA 2IHBA 3UANA 1Z0KA 3VR3A 4DCSA 2NZ8A 3U4QB 5EP4A 1M7BA 4WW0A 3HU1A 4DLVA 4A2WA 1F2UA 1E3MA 1L2TA 1Z5ZA 2O8DA 2AWOA 4V0ME 2PEYA 5BN5A 4KLNA 3CR7A 3IQWA 4LYAA 1E9FA 4URXR 1BKDR 1NLYA 4QL3A 4FCTA 5DN6D 3EA5A 3AQ4A 4GZMA 2ZR0A 1SVWA 1Z0JA 3DM5A 4IOMA 1XEXB 1W4CA 1G291 1LF5A 4QGGA 5AUQA 1MABA 1OGIA 3GJ7A 3CZQA 4YAOA 2C99A 2OAP1 1QUEA 3EIQA 3QXJA 3IEVA 1Y63A 2GJSA 1TQ6A 2QI9C 2CCJA 2AK3A 3C5HA 5TARA 1N8RD 2EU8A 3BE4A 1GNPA 2NO0A 2BV3A 2FWRA 3CZPA 2YOGA 1RC8A 3CPWB 1XMSA 2GQFA 1XX6A 2IK8A 3MRSA 5TR9A 2GK7A 1Q12A 4BLRA 2C03A 2GEDA 1DOAA 4UXJA 3VR5A 3PEYA 3RABA 3BXZA 3PUZA 3LLMA 4EJSB 1W35A 1G4AE 4ACBA 3OIUA 2IYUA 5FTMA 5JI3E 4TQUS 2RKOA 1UM8A 3QOFA 3UG6A 5AUPB 4CEHA 1Q1EA 5GV7A 2BM0A 3QSYA 2DERA 1E2DA 5BW8A 3HPQA 1AZTA 3NEJA 5DHFA 2QAGA 4GNKA 3AP3A 2GNOA 3L0PA 4QHSA 2ZR9A 2IEYA 2J59A 3VO1A 3OJXA 4Q9KA 1E2MA 3CPEA 3MJHA 3TH5A 1D2MA 1T4GA 2JLUA 3PIRA 2OUKA 1CJMA 2REOA 4WIAA 4A6PA 1IQPA 4IDNA 5JHHB 3GEIA 1Q7YD 3L8ZA 3Q7PA 1TAGA 5EXTA 2EFDB 4M1MA 4A92A 1CNEA 1KO4A 1OSNA 5FTLA 4W5HA 3THYB 1E2PA 1FOEB 2KSQA 4XTRA 5C1BA 2IYVA 3A58B 3KB1A 3ZVNA 1VYUA 1GUAA 1E9BA 4HUQB 1DDIA 4OQMA 2PZFA 4MKHA 4B35A 4ZI2A 1JR3D 1YZUA 3AUYA 2J9RA 1OKKA 2DCUA 3A4NA 1FP6A 1KKLA 2IXGA 3B1VA 5D3MA 3SR0A 3TGPA 1LVGA 1XD2A 3H84A 1H8ED 4TYYA 1P4SA 2GZAA 2IC5A 5BQ5A 4NE2A 4S35A 1COWD 5JEDA 1HEIA 2ZYVX 4DDUA 3P32A 1FL9A 1N5LA 2W0SA 3W90A 1MOZA 1XJQA 3FVQA 1VQPB 3FB4A 1DAIA 2ERYA 4A0FA 4PO8A 1ZIPA 4IDQA 3DL0A 3BB4A 5GJBA 2GAAA 5KDLA 4ZCLA 4RCYA 2JATA 2YWHA 5DIFA 1GVHA 2C77A 2XB2A 2ZE7A 5FPSA 3LO5A 5CIWA 1Z2CA 3SN6A 4AKGA 4D25A 3QNUA 1J99A 3CCVB 2WSMA 3U4QA 4NONA 3TQCA 3T06B 1AS3A 2WJGA 4I1VA 4I99A 1SHZA 2NGRA 4A8JB 4AKHA 1Q86D 3QKTA 3IPYA 5KSPA 2V54A 2RMKA 3F3YA 3GLFE 4C0KA 3PUWA 5H68A 3BJIC 2OBLA 2WIAA 3CF0A 2VO1A 3LW8A 1NG9A 4N3GA 3BOSA 2IYWA 4XVRA 1LFDB 2OFWA 2NO6A 1MO6A 2C9CA 2XNSA 2ZI3A 3EPJA 3QF7A 2PLFA 3GJXC 4IHQA 1FZQA 3WNCA 4I1UA 1RKBA 1LNZA 5GJCA 5L3RA 2DR3A 1KHTA 1GTVA 2VTKA 2BBSA 5SZHB 1IY2A 5FR1A 1P6XA 4DJTA 2R6AA 4CVNA 3TLXA 2V1UA 4ACAA 4B73A 2O8FA 2HF9A 1DEKA 2RHMA 1QGZA 4BFZA 4JIMA 2W2TA 3ZDQA 3EG5A 3ICEA 2TMKA 2ONJA 3QF4B 2OHFA 3D6TB 3H0KA 4GOXA 2JIZD 4EDHA 1E63A 2FFQA 1E9DA 1D5CA 2X19A 1QUFA 1P3JA 3NTUA 3WYFA 1S9DA 4W5WA 5FUWA 2JLSA 1XXHE 3SBEA 4TN1A 4XSGA 1TNDA 1N0UA 3THXB 3BH6A 2B7CA 4LV8B 2WWXA 1N2CE 3A1TA 3MWJA 2O0HA 3BH0A 2PLRA 3W8RA 3D7MA 3TE6A 4DLSA 3ZC3A 5FOUA 3G71B 5J47A 5J40A 2O8BB 2Q9BA 4TQ9A 4US0R 1KI4A 1ZUNB 4ASUA 1PV4A 3VNUA 3QXSA 1JQJC 1KI1A 2YNMA 4B3GA 2R6DA 3LFUA 4CZ2A 2B7BA 1X6VA 3N2IA 3QPVA 4NCNA 2RC5A 2QEQA 4ZI3A 2BGIA 4MKGA 3KJEA 4Q21A 3VKWA 2F9MA 4IW3B 4N0EA 1OXSC 3QY0A 4K46A 1P9NA 2RGCA 2WJJA 4US1R 1NJID 3QBVA 2MMGA 3QFTA 3SNHA 2FDCA 3ZZUA 2XZOA 4TT3D 1EX6A 3NH9A 4P4TA 2C78A 1T0JB 3OEEA 5BYJA 4B3BA 1RW4A 4DT1B 4TSFA 1FNBA 1XZQA 1YJNB 1JBKA 1VKJA 5FOVA 4JLMA 4Q9LA 1RIFA 2VPPA 4HUTA 3C5CA 2BCJQ 1VQ7B 5THXA 4ZV4A 4ESVA 5F9HA 2VL7A 4C7OB 3FKSA 2Z83A 1LS1A 2WSSD 4OJKA 2VYQA 3TK1A 3W3ZB 4HE6A 1P75A 2C5LA 4AG6A 1P2TA 4AYXA 4WZ6A 2QROA 4L9WA 4BQSA 3K0CC 5K8TA 1CF4A 3NIBA 1TU4A 4QM7A 1NSTA 2XB4A 2YC4C 2AX4A 2BEJA 2G9NA 1SULA 4RKEA 2WM9B 2IF2A 2KJQA 4OHWA 2XSZD 1OXVA 1OIXA 5DI3B 2NOAA 2G77B 4JYCA 4OI1A 1GDDA 3MSXA 1LV7A 1XPUA 3U3RA 4NKRA 2OESA 2PZGA 4Q19A 3DPUA 3I55B 2XITA 1G8FA 2YYZA 3CC2B 5LDDC 5KO2A 3A1UA 5KYKA 2A5FA 1ZUIA 3MHPA 521PA 2LKCA 2WOOA 3B5JA 1AKYA 1W44A 1EWQA 2D2EA 1OLOA 3X1XA 4PO9A 1GAJA 5BYKA 4HSEA 2EW1A 2VSXA 2V3CC 3OZUA 3CRZA 2KI5A 1TEXA 1E4YA 5DGXA 3CH5A 4MYUA 1BIFA 4DDWA 1KYIA 2RB4A 1AMOA 1VQLB 1S96A 1Z47A 3X1DA 2AFHE 1GOTA 5JWRA 3P26A 1RRPA 4B2IA 4P4UA 4D2IA 3R7WB 1S3SA 3QUSA 4DVGA 3TUZC 1OB5A 2D62A 1MO5A 3THXA 2IXFA 3KKOA 1HV8A 3EC2A 1IBRA 3D8BA 2ZRFA 2VNKA 2CL7X 1K5GA 3AVUA 1US8A 2F3RA 3R9WA 1ESNA 2GF0A 3K0FA 4LPSA 4RD2A 2CJWA 2WHXA 4U02A 4ZGNB 3SFVA 1R0YA 1CLUA 2ZYTX 3FKQA 3IUYA 3K53A 4HI0E 2O8BA 2VHQA 4UXHA 1IN6A 4ZIRA 3WP1B 1SVMA 4EAQA 1R8QA 2QRNA 5IK2A 2WJHA 2XTNA 1J8YF 1HA3A 4S2EA 4E09A 2P5TB 2AFIE 4M1WA 1QHNA 4Q4AB 4BWYA 3ZD7A 3I56B 2ZRAA 1PLKA 3JZAA 3LBNA 1U90A 2R62A 2CLCX 4PXAA 2V55B 4KFRA 2R6GA 1WB9A 2DFNA 5KNDA 3DHWC 4QJ3A 1HY3A 1DAHA 3H2YA 1G7CA 1E6CA 4BFTA 5CDFE 5KTYA 2N46A 3TQFA 4MYHA 4OQFA 3BS4A 3ZS9A 3ADDA 1TQDA 1XE1A 5FFMA 3VX4A 1ZU4A 2HYDA 1S3GA 2CK3D 2ANBA 3GFPA 3TAHA 3WHLA 2G0TA 1X8LA 5EQTA 3PEWA 2ZIAA 3RRYA 2JJ2A 3ADKA 3N70A 4MYCA 1KNQA 4HZUB 2O5VA 1KO8A 3CBQA 4TMZA 1Q3HA 4P31A 1R2QA 3WMEA 4IDOA 3R8CA 1S0UA 3L0OA 5K8LA 1H8HD 3FPKA 4OL0A 1UBGA 1DDGA 2BHRA 4MRPA 4I81A 4K81B 4MUAA 1OKKD 1T8TA 3K9NA 4PTLA 3ZVRA 1QVFB 1P2UA 2UVQA 4NYJQ 4MGZR 1CJKC 3A36A 2IYSA 5G41A 2ZPTX 1NNEA 3SS8A 1OJLA 4WQMA 1DAGA 1GRQA 4ARZA 4EUNA 3VTKA 2X1VA 2D4HA 2F7SA 4V0NA 3QFRA 3M4YA 1XEWX 1ZM2A 2JJ1D 5CLQA 5J4YA 3T34A 3TVDA 4G0NA 3NDBB 1G7TA 2ZE8A 1MRNA 1XD9A 4ABYA 1QHXA 4GDFA 2QRZA 2NMVA 2GBLC 2DFLA 4H1UA 1NG1A 3W34A 1XB2A 4A0GA 2Q0HA 2GESA 4B47A 5HZKA 1XMVA 4IOKA 4PGOA 4HB3A 1F6BA 3VR2A 2FFHA 5GJWC 1M2OB 4DLTA 3EW9A 5CYOA 421PA 2QMEA 3V4RA 1WQ1R 4KJZA 2CNWD 2XZPA 1I4TD 3NHBA 1PLJA 1VMAA 1T3LA 5FA6A 2FNAA 2NZJA 3B9PA 2WV9A 4B3CA 1SXJE 1QHYA 1B2RA 1YJ9B 3MLEA 3AF2A 5G3ZA 4JLVA 5EE5B 3R7WA 1F60A 3V9PA 1OXTA 3GLGB 4LHZA 4O2RA 1F48A 2CHQA 5HZHA 3K0CA 5CIQA 2JLYA 1KO5A 2QP3A 3HWSA 3MGCA 1ZW6A 4M0LA 5DLQC 3E2IA 5H8WA 1VQ4B 1JR3A 1TF2A 2MSDB 1NVVR 2F1IA 2ODWA 2BM1A 4TZ6A 1GG2A 1Q81D 3B7GA 3AM1A 1AQUA 1NI3A 4LV5B 5G53C 4G01B 5C18A 2QBYB 4K1XA 2XJ4A 4NH0A 5JLJA 3W3AA 3FDIA 1S9HA 3BB3A 2P2LA 2C95A 2FN4A 2CVHA 2ZE5A 1FX0A 3VAAA 5P21A 4YALA 3SJAA 3ZBTA 1MO4A 1Z06A 1FQJA 4O3MA 1GRNA 3W5JA 2W58A 4GBMA 1R0ZA 1QFZA 4NYIR 1M8PA 1L7VC 2FZLA 1CR4A 1V5WA 2F1JA 3UMFA 1JA0A 1PJRA 1EXMA 4YMWA 4F7DA 2CXXA 2PMDA 4V0OA 2WKPA 1N6HA 2YJTD 2ZANA 4N1AA 3PXGA 2GDJA 3R9IA 2FEOA 3AVXA 1QRAA 3V4FA 2GVZC 4QM6A 2OXRA 2P6NA 4KFSA 2IUTA 3I4LA 1J9ZA 1XCMA 5IHPA 2YVUA 4RY2A 3S1AA 4M1KA 3RNLA 1LY1A 2L0XA 2QPTA 2WVJA 4A4DA 3Q7QA 1AS2A 4RD4A 2Z4SA 5HE8A 721PA 1GO2A 1OV4A 3NBFA 3B85A 3FMFA 3GLHA 3QXHA 5KSYA 1FW6A 1KY2A 1DAEA 1E9AA 1F2UB 3GPLA 3C16C 1XWIA 4HDOB 5C2JB 1G19A 3I92A 4DSTA 2FPLA 2ZAMA 1E2QA 2CRVA 1IXZA 1OFHA 2ZJAA 4Q1CA 4XVUA 1ZMXA 4NYMR 3HR7A 2JIZA 3Q9LA 3TR5A 4HB2A 3W5IA 1ZINA 4Q7JB 1KO7A 4BASA 3GLIA 2IW3A 2PCJA 3F8TA 4GFDA 3B9QA 5FOSA 1M6NA 4BGDA 2EYQA 3TAUA 2ZS7A 4Y0VA 4G3XA 1UBFA 3QBTA 3EZ9A 4JLPA 3LQQA 1NMZA 5EE3A 5FUVA 1GWNA 1X1RA 5F98A 3VR6A 1ZM4A 3PEUA 3WHKA 1M1KD 1G8PA 2OZEA 4QXAA 2DPXA 3W2FA 1VPLA 3LY5A 3FMIA 4HDCA 2AK2A 3SFZA 4RZUA 4A2QA 2WWFA 2ZSFA 3EPLA 2VP9A 4Q4JB 3LVQE 4KU4A 1NY5A 1UDXA 1NLFA 4GP7A 2PX3A 3LA6A 1CXZA 1G5TA 2BMEA 4MRVA 2DHRA 3I62A 2W83A 1EX7A 4OHZA 1XEWY 4Q9HA 2XXAA 5HR5A 2CMKA 3JZMA 4YHBA 1I4LD 1QF9A 3L0SA 4M1YA 2QAGB 2J87A 3NH6A 4TT3A 4EH1A 5EP1A 2J0UB 1DO2A 1EWYA 4YAWA 3D3QA 3NVAA 3QXCA 1TUEA 3KB2A 1P61B 4G1UC 2E87A 2W0MA 3NC0C 4UNSA
chains in the Genus database with same CATH superfamily
4JVNA 2X3UA 4OFZA 2OK7A 3EFHA 1IRIA 2AA3A 1GM5A 3HYTA 4ABEA 2KCPA 5FOTA 3KXPA 3AZPA 1ELFA 4EPWA 1RCTE 2FTMA 1KYZA 3EGXA 3AQIA 2XYGA 4CIYA 1Z0IA 1KQOA 5HQTA 1GYQA 3ZZDA 1MAHA 1SCBA 2OCKA 4CRAA 2XW6A 1R5NA 4BNTA 1GRCA 3B9BA 2BD0A 1XWWA 4RHYA 2WV4A 4LMRA 4PSDA 5SGAE 3ZK8A 2FPSA 1HG0A 3OQMA 1E38B 3IV7A 2XNCA 4X71A 3CHYA 4WINA 1P1CA 4RD1A 4OYHA 4U5XA 3STYA 2RCEA 1O6ZA 3O47A 3U7HB 4BYGA 3FGPA 1ECFA 3NHWA 4EGFA 5JH7A 3HGPA 4EGAA 2O8FB 4UAJA 4V0MA 3ESCA 4AJ9A 1MHPA 4JJ6A 4BY9E 4RLHA 1TFXA 4UHKA 3IQIX 3GWZA 3IQHX 1GT6A 1PZMA 1P05A 3S9CA 3GXBA 3T3HA 1LF0A 3RU3A 1Q1BA 4EF6A 4EB6B 4NBSA 3LXXA 3TBHA 4X7PA 1OFUX 4HDQB 4E2YA 4QSMA 3EC1A 2VKTA 4PANA 2YNAA 1R9GA 2YRWA 5TVGA 1N5JA 2VI5A 2YINC 5DHSA 4C4XA 2C93B 2WU4A 1EIWA 3BMOB 4MR7B 4OSOA 5JNWA 1S84A 3W2HA 4W82A 2CWDA 2J45A 4MR8A 1N5MA 1ZN7A 4E08A 1W5BA 1AUTC 5H9WA 1L9KA 4OV6B 1W48A 3D5TA 1O39A 2BSXA 4A16A 3H5OA 1QVWA 1P1HA 3HA3A 4B80A 4EA7A 3ZQUA 4N5MA 1CZRA 3G9QA 4YT8A 2A9PA 4REQB 4NTZA 4FP9A 2JGRA 4BQEA 1OWMA 3EMKA 3EHDA 1CZOA 5IYRA 3Q6MA 3QUQA 1GNQA 2BBTA 2GERA 5BQ3A 1B8OA 3CW2A 1CZNA 3HZOA 2XV1A 2X8LA 1UFVA 1K5DA 4Z9XA 1YWGO 2FPRA 1XYYA 3SDZA 1B0ZA 4INHA 3P2JA 1R8SA 4U01A 3GS9A 5C37A 1GFWA 3DPSA 5B3AA 2XVZA 1B7GO 5BN1A 1KAGA 4IXNA 1WSBA 1HL7A 1Z71A 1WPRA 3SHOA 3UAVA 1Q57A 4Y1FA 1TE2A 1T91A 4PYMA 5DX1A 3WK6A 1G3QA 1QB6A 2NPIA 2B1GA 4DURA 2V7QD 1PJ4A 1TT5A 1J5XA 4C5CA 1E8MA 2BKEA 1U3TA 4RI0A 3H04A 3K96A 3A7ZA 2WPDD 1TTPB 3WX0A 3K9FC 3TL6A 3CPHA 3OZ7A 1HYHA 2G81E 4BFCA 3ABOB 5ERYA 4NMWA 2J0QA 1C3XA 4NWIA 3WLEA 4RSRA 5AI9A 4HQLA 2XBLA 2OBQA 4ZV7A 1NDUA 3E6PH 2BEWB 1JHPA 1L4UA 1V5FA 4BN5A 3OM8A 2JFXA 3HRKA 1UINA 3TLKA 3RTDA 3C41J 5F1YA 1SGYE 2QGGA 3GIRA 1PKEA 3BFXA 1KZ1A 1XBTA 3VKGA 4ENRA 4ZHLU 2CMDA 3BZUA 2QT1A 1O35A 2NU2E 3QRWA 1GGDC 1E1YA 1BQEA 3EXHB 3JYHA 4IGEA 2Z8XA 2V7XA 2PV7A 4XVCA 4BFUA 4C4TA 4FCWA 4QQKA 1WE2A 1XI2A 1DBPA 4Q9DA 2HFKA 3HKDA 2A88A 4BVHA 1Q0SA 3LO8A 2DE0X 2V3VA 3WYDA 1KWKA 4JLBA 4AZ3B 3D3WB 1LTHR 2VNIA 3DLCA 2CHGA 3S7KB 4D9RA 1R37A 1MQAA 3LT0A 1S5PA 2AJ8A 2F6RA 3GLHB 3V5NA 1UP4A 1O89A 3EN0A 4PHHA 1H05A 4D9JA 1HAPH 1EXNA 1BEEA 1OI3A 1F3OA 1K27A 5L6MB 5F2OA 3RMNH 3RLIA 1HJAB 2BMDA 1QPBA 2ET6A 5F33A 4RX1A 3B82A 4F21A 1JLSA 2GTBA 1TIBA 5G4KA 2K4MA 2BGGA 1Z13A 1QH8A 2ZXHA 3KGPA 4PR0A 4XBCA 3LCVB 4NMMA 3IELA 2QGNA 3SV2H 1BCRB 4JLNA 3O9ZA 3EEBA 4AF6A 2DBZA 3GYMA 1YU9A 4QPNA 1QYWA 4LF4B 3KZOA 3VV2A 3EXIA 3EODA 5BR8B 4Y2JA 2PCLA 2ZCLP 2DWPA 4FNGA 2EWWA 4MVJG 2AI3A 2I8CA 3E91A 5KKAA 3DAYA 1V3VA 2ZTVA 2WJVA 1IBCA 5NLLA 4FUGA 1MQSA 4CN9A 4PPQA 3U4CA 4MX8A 4X84A 5CXSA 2QX7A 1ZIXA 3KKKA 5F3RA 5AM3A 3NNDA 4KZPA 3V1UA 5A7HA 4UUQA 1J4AA 3QKRB 2F91A 4II7A 4RHEA 1IQGA 3VYUB 2BEKA 4DIUA 4AJOA 1MF7A 4FB4A 1QRXA 3N3BC 3PJRA 1OP0A 4CHTA 1W2BB 3L06A 1Z4JA 5F23A 1D09A 4D56A 4BBPA 1PFWA 1V96A 1UEXC 2PZMA 4LNAA 1JQ3A 4ZUHA 1KEEA 3A4TA 1I2MA 4AJ2A 3SXPA 4TS9A 1GBTA 4R7GA 4RZHA 3G68A 2FPUA 1CEYA 5A09A 4PAMA 4CMBA 3V80A 5JXIA 3A86A 1PP4A 2G1AA 5EXMA 2Z95A 3SU4A 3F2FA 5F64A 3BD7A 1Z18A 3EPKA 1YPHE 1Y8TA 2WF5A 4GP9A 3HXTA 1NA5A 4DUGD 3G3EA 2OYRA 3A14A 2NTYC 4MG3A 4MQ6A 2NT3A 4UDYX 1KPIA 3EY4A 3LT5A 3JSXA 2C1EA 4ZI7B 3ZKAA 4V24A 4I8GA 5IT4A 1P7CA 5CE1A 1OFUA 3HRHA 1HT3A 4ARAA 1Y7IA 3UOAB 2ZB3A 3FHTA 2IU6A 4F2PA 3F3BA 2R1ZA 4RWZA 4OJNA 1GL0E 2UYHA 4WLFA 2AGGX 3GFVA 3B6MA 4EMSA 4B09A 3FRIA 2OGZA 3LOQA 4GECA 2HAEA 3UJNA 5CW1A 2EFEB 3D02A 4PRYA 4NEQA 5B55A 4WD3A 2ANMH 4UM9B 3BUSA 5LD2C 4TKUA 2HK6A 1ZS9A 1T32A 3GLFB 3MXOA 1P1RA 2ORWA 4BVKA 1Z7YA 3L7KA 4DUPA 1V0JA 3FCCA 4AXBA 5GDSH 1N6NA 4Q1BA 1GR1A 3FE2A 3FCSB 4RLQA 3X1WA 4DT4A 3GY3A 3TJZA 2VIIA 3SR4A 4A5OA 2RCNA 1Y6QA 1FU8A 2OP1A 4H4CA 3FM9A 5KSWB 2BFFB 4L4YA 3P9XA 4MUNA 5LP6A 4HP8A 1LJUA 4LXIA 2CKMA 5JYDA 2DR0A 5FIUA 3ZJUA 2YJGA 3ZVAA 5M04A 2R66A 4XDGA 3L4SO 4X94A 2KVOA 3QUCA 1E1MA 5HG0A 3EBPA 2ODNA 1RWOA 3U19A 1MFZA 5F8ZA 4E15A 1K7CA 1YR1A 1RC0A 3PC4A 1A8PA 4BNDB 1R66A 4GZLA 1E79D 3O8OA 3A81A 3YASA 4Z1MD 3G4SB 4EY4A 2BHNA 1IFXA 4GBGA 3PEVA 4TMVA 1VQMB 2XRCA 1G38A 4UBJA 3AHFA 3JPWA 3HYRA 1QP7A 5JJCA 3ZWOA 1LFAA 2WMOB 1JH9A 2QPOA 4TYMA 4KQWA 5DHTA 4G67A 3CUEF 1TVCA 4F3NA 3SJ7A 2C7PA 4I1SA 1DINA 4NS1A 1A8QA 1XROA 2FSVC 2ZJ4A 4DMUB 4EJSA 1UTQA 4WXIA 4URZR 1PWZA 2C9OA 4FMDB 4ZVQA 3BD6A 1TA4A 1T8SA 4LYHA 4L8JA 2NACA 2J94A 1BVYF 1O4WA 3OLXA 4YLEA 3A1VA 2OV6A 2ZU0C 1HYQA 1KDTA 5GZ1A 1NFFA 4HGCA 5K0HA 4G97A 3F7NA 2IELA 4QU0A 1SM4A 1EB8A 1XP8A 3SHQA 2IYZA 4IAOA 2HIHA 4NIYA 4E07A 2LNDA 5EPOA 1S85A 3W1WA 1EVLA 2GZDA 3HY4A 1O5FH 1J09A 1MCTA 4J0KA 1ZJJA 3VPXA 3AHIA 3QE4A 1PYOA 3H86A 1BX3A 4KFCA 2PLAA 3VYWA 5JSKA 1M0EA 1Q2XA 3I32A 2MINB 3TLEA 3PE4A 4ZVUA 4OG2A 5E9AA 3DC2A 3N0WA 3PT9A 1EHYA 2WT4A 5EUQB 5BVHB 5B3JC 5EOVA 4P93A 4J0EA 4G24A 3TR6A 4E03A 2E7ZA 1N6LA 5EIOA 5AIBA 1QFKH 1GN8A 3I9KA 7GPBA 1FAKH 1V39A 2CKDA 5CFPA 1XGKA 4H17A 4V2UA 3LNCA 1YGYA 4MCHA 4LSGA 1G63A 3FPBA 4I86A 3PQCA 4PNPA 3VYVA 4LXQA 1UJMA 2VU8E 3CP8A 1OV6A 1GGFA 3DKIA 1M1ZA 3F5MA 1MX3A 4XIYA 1U8ZA 2QMHA 3K4QA 1SXQA 4FYXA 2QNIA 4NFYA 4KZKA 1NF8A 1GLGA 5A7GA 3LW7A 4OQZA 3AERB 4AY3A 5DSFA 1K1JA 1YGCH 5A5GA 2G72A 3A4MA 5DK6A 3WKDA 1GL3A 5BR7A 2QTBA 2Y81A 3A1PA 1GCUA 5HYOA 2Q0SA 5EE0A 3OKAA 4M7PA 1KC3A 5F4ZA 4I9GA 3SU8A 1J0BA 3DFIA 1J25A 4N5IX 1XNHA 3HACA 4DZZA 2QL9A 3DVLA 5CHAB 3AUJB 5AHRA 1CULC 1ZVJA 2PRZA 3UXMA 5LZ2A 1E3DA 1WP9A 3MILA 3S1SA 4X6PA 1ZI8A 2AN4A 1FFWA 5CM2Z 5HNKA 4AF8A 1GMDF 3ANSA 3SKYA 3SJZA 1Z2AA 2VWNA 1ZA1A 2ORYA 1P3CA 1RAFA 1J1IA 2A0YA 4DARA 3P92A 4NMXB 5EZYF 1S2LA 5K9ZA 2O5EA 1DBWA 2C97A 5EUMA 1TX6A 5GY7A 3RS5A 1N2JA 4JSRA 2A9RA 1GI3A 4QJ5A 3BHMA 4PWYA 1IYZA 1ESBA 4GQNA 2NUTB 3GEEA 3EF3A 3OTWA 3EWNA 2DEUA 3EYAA 4C0QC 3E3AA 4EI7A 4JQYA 2GYVA 3GPBA 2D3WA 1N8OB 4JITA 2HK9A 3U3XA 4CMGA 1JDTA 3RV4A 1OYYA 2PA3A 5EE1A 1P77A 2A0KA 1ZITA 3ZZ6A 5FWDA 5ALHA 3A4YA 5EIYA 4BP1A 4E4RA 3ZWQA 1QU3A 1K1OA 2FB9A 3ZHXA 1VE3A 3KJFA 4WZZA 2PH1A 2ZU4A 4PG6A 4BAKB 2NX2A 3VKHA 2K1QA 1VI2A 1NC3A 4YP6A 1ZRNA 3TLYA 2HSJA 3T5CA 5JCXA 4ABJA 4GOLD 3L4EA 1PK9A 3MJSA 2JLXA 3UREA 3QVVA 3ZCRA 3E8XA 3SIPA 4X6YA 1K8AD 1SD5A 2H54A 3PV2A 4IMIB 5HUQA 1YF3A 3CT6A 3MT0A 4HYTA 3E2MA 1JJAA 2HA2A 3T1YB 3NDRA 4ZCMA 4GOMD 1DICA 3ZGNA 3K1AA 4XOIA 5EHZA 3R5SA 4HAOA 3ZHBA 4DQDA 3U7EB 3GR6A 2SNWA 3QU9A 3WK7A 3S2EA 2ZREA 1OS8A 5EP4A 2QIPA 1YULA 4YCAA 1SLVB 1E9FA 2ZDKA 2YNMC 2IY7A 1Z0JA 3P2OA 1EHCA 3JQ8B 2GCIA 1N8RD 2BE9A 3ZE0B 2CXSA 2HBZA 2GQFA 4DLPA 2ECPA 2GK7A 2H9EH 1KXDA 1W35A 2KX4A 4XDEA 4KG7A 3RU4D 1WTHD 4JHLA 3OEYA 4OHKA 5AUPB 2JFOA 2BM0A 3M34A 2HA5A 1TDJA 1Z68A 3JU3A 4Z4ZA 1OAOA 2J9ZB 3QWIA 5IPFA 5BMVF 4IDNA 2UWOA 4OH1A 4HGRA 4XVHA 1E2PA 2BE7A 2J3DA 3D8UA 3OCUA 1N5OX 5IMBA 4O59O 2W3IA 5DNUA 3AR8A 3STUA 3K2UA 1C5UA 2ZZFA 5IDYA 1SUCA 4KRFA 4MR9B 3WNZA 5GJBA 3OU2A 5EXDA 1NKVA 4QXOA 5KEIA 1AE5A 1J00A 4D25A 1V2ST 3ER8A 1FW8A 2FI3E 1UVUH 1YE3A 3FUTA 2WIAA 4PNHA 5CDHA 3BTVA 2J9NA 3LW8A 1LFDB 2OFWA 2C9CA 2YQ4A 2R1VB 4EARA 1X77A 2VINA 2BBSA 1IY2A 3EG9B 2ANWA 2O8FA 5BV7A 3U39A 3ESTA 5B12A 4AKSA 2V96A 4MS1B 2CHAC 1QQ6A 3NTUA 4FKBA 2JLSA 3SBEA 5IP5A 1GHWH 3OCCA 1TE0A 3J7TA 1SCIA 3BH0A 3FIUA 3N59A 4RDXA 3D7MA 4JCNA 5J40A 3WNQA 4EB6A 1NPYA 2J5KA 1ISGA 3QXSA 4A1OA 3OLVA 4A7IB 2RC5A 5LPEA 3MU4A 3OZTA 4IW3B 3JTMA 1QIDA 1P9NA 3IKTA 5LYJA 3EXEB 2C78A 5I7AA 1JQBA 3L92A 3LNTA 1FNBA 1PZEA 2HSEA 3FJYA 3BMOA 4MR7A 1KYVA 1BRBE 4JOQA 2ZULA 3V1MA 3IA2A 5HYVA 4AG6A 1CT9A 1BA8B 1KMNA 4I31A 2I62A 3DZJA 5BWNA 2BEJA 1WOOA 3JQ9C 1X80B 2W2KA 2KJQA 2PRJA 1VDMA 1GDDA 1VGCC 1PTJA 2OESA 3DCYA 1WG8A 4HN9A 3EMVA 2ZU3A 4DXHA 3A1UA 3A32A 3HMKA 1AKYA 1EAIA 2IPQX 3L07A 2VSXA 3GVXA 1J21A 2VAPA 4JJEA 4Z5XA 3WLRA 2FX4A 5F1OA 1L1RA 3W7AA 5DK1A 1CUJA 3ZZMA 2VDNB 3IUYA 1CLUA 2Z6AA 1YBWA 1UBHS 3WE7A 1A5IA 4UXHA 4AS1A 3WP1B 3VZRA 1J8YF 3GYLB 5JYEA 2IOTA 3K2IA 3R8XA 4CCAA 1NN6A 3B89A 4Z4FA 1IN1A 2V55B 4AUKA 5KTYA 3TQFA 3MQ2A 5K03A 2OC1A 3GFPA 2R8XA 2ZIAA 1CUXA 4AG2A 3WQSB 3RRYA 4G65A 4CDNA 5I7EA 4HZUB 4CLRA 1S0UA 3L0OA 4LRSB 4ZCPA 1RMTA 2BHGA 1AKWA 3SS8A 1GGJA 4GG1A 1IPEA 4J7CA 1T5OA 1QO0A 1G7TA 2FEWB 2I0FA 2PKRA 2FR8C 3IP3A 1AKNA 2ULLA 1XB2A 3P97A 5T6BA 5HZKA 4JX8A 1FTYA 1PZXA 3RTGA 4QFCA 4MCJA 3OOSA 2B9VA 1VMAA 4C87A 2HO5A 4EOGA 1VKNA 1SXJE 5AVWA 1YJ9B 3A9UA 3V9PA 3E3MA 2LZJA 4M0DA 5HZHA 1UC5B 2BEWA 4BUCA 3QE3A 1YB7A 3HFJA 1Q3XA 2NQ8A 3HY6A 3L7NA 4DCGA 3HVIA 4U2KA 4HX5A 4UEJA 1QKJA 3QX3A 3K9WA 2UYYA 3ATWA 4RKYA 3EXHA 1ESTA 3W5JA 3VB7A 3EGXB 3TDKA 4ATNA 3NKKA 5EPYA 4CDRA 2EJUA 2IGBA 3UMFA 5B7GA 4QICA 2OHGA 2GDJA 3VGJA 1QRAA 2RAVA 2NVOA 1NJ8A 3OFSA 4AZ3A 1JYSA 3I4LA 3S2IA 5BNTA 2IOYA 2WYOA 2C54A 3ZIDA 3GLHA 3HFGA 5IWAB 2YW2A 1MG5A 1KJIA 3QQPA 1KL7A 2ZDAH 2GPWA 1GJCB 4H0CA 4ZVRA 3P2KA 1ACLA 5KKCA 3EZ9A 1NMZA 5FF9A 5E8RA 1ZOPA 1VPLA 4A2QA 3SFZA 4RMGA 3OCZA 2YOLA 1DNPA 1BCRA 2AJLI 1KOJA 1MV8A 3JZMA 1HZEA 4P08A 5KTNA 2D4AA 1XVLA 2R97A 5LQRA 3NVAA 1UTKA 5BW6B 1K8XB 3OT4A 2D7CA 2CBXA 2OGUA 3ZBQA 2O3UA 1S83A 2QL5A 3QNWA 5FBLB 2PH7A 2PJRA 1PJ6A 2FLKA 3W78A 4NG4A 3TJUA 3L1IA 3FZYA 4Q37A 5AW4A 4L3OA 5D3MB 1XD2B 3IODA 3KB8A 4PPNA 1OBFO 2ZDQA 1T8OA 1VJAU 4OS6A 4UE7H 2R7KA 3FCUB 5PTPA 4PAAA 4PG7A 2YOHA 1IE3A 1N6OA 1WXDA 1EZSC 4N12A 1DWOA 1WBGB 3QVGA 4MR8B 3S9BA 3HM2A 1PPGE 2GJAA 2H7VA 1I4EB 4Q18A 3BFJA 5JXGA 1NQTA 4JP1A 3IAS6 2SHKA 1BJKA 2W6NA 1GKYA 3RGWS 1P12E 1DAKA 3IO5A 2EQAA 1YPLH 4W5QA 4IQ8A 4DLKA 4MVJM 4X8UH 2BLVA 1XD8A 4PC2A 4HAZA 3UMYA 2PBZA 4D6PA 3EAGA 2J7KA 1QFJA 4FUEA 5T7BA 4EFNA 4U0JA 2AQKA 2RDLA 3AOGA 1QE0A 4YI5A 3QU4A 4DGSA 2C3YA 4IVPA 4WZAB 1L1EA 4J3FA 3MHWU 4N39A 1WCXA 2GAIA 1C8KA 3QWAA 1UKZA 1L5FA 4QBGB 4Q00A 3A37A 1Q0LA 4II2A 4JMLA 3IVMA 2BOKA 3DT6A 4XR6A 1C8LA 4BKRA 1XTKA 3TSZA 4D8WA 5FL7A 3E1YE 1A95A 1O94A 5A2MH 3FVFB 3KKPA 2VZEA 1CT0E 1VGVA 4ZI7A 1XNQB 3NM5A 1GPDG 3ZVMA 5FPYA 4C2UA 3TCNA 1HDCA 4AJJA 3WKEA 2NTEA 3I61A 4YV2A 3PD0A 2UXDB 1HV7A 3CF6R 1GI8B 1F1BA 3BEIB 2HMWA 1ELVA 3A3BA 2JIRA 4FHZA 1FYXA 1PZFA 1TT5B 3ORYA 4MB6A 2R1UA 1RXSA 3FMOB 4ZXPA 3C6KA 4J7AA 3RXJA 2V35A 4AK9A 3W5CA 4JXZA 3PFHA 1JHQA 2C4WA 2EZ8A 3EBLA 3WL7A 1EE1A 1IHOA 3L8HA 3GK3A 1KOFA 1JDBB 4DL9A 5CB4F 3Q6RA 1FVOA 3VO9A 2QQ0A 3DEYX 3GLFA 3P9PA 1SBCA 3HU3A 3PUHA 2E6KA 1E0JA 4B4DA 2FJUA 2MMCA 2FZCA 2DQYA 4OHXA 1HXHA 2O50A 2Q5EA 4JB3A 3T27A 2R4QA 4HB4A 5BVGB 2O3TA 2Q1TA 4INZA 1U98A 1LDEA 3RC7A 3LNNA 3WMFA 4PQRA 2BFFA 3R0VA 5EOKA 4I55F 3CRRA 3L7YA 5IULC 4XDZA 4TTIA 8ABPA 4AIRA 3KTOA 5DP2A 1Q82D 1NBIA 1DS2E 4OSEA 1HDRA 4L51A 3T5AA 3T3GA 5CGQB 2ZUEA 1AQYA 2GPNA 4OHRA 3QOXA 4JZKA 1T5TA 3CLRD 4GOJA 1X1QA 2ZLBA 1ZGZA 2ZYUX 4ZZ0A 3PJDA 3KTFA 2IX3A 1O3CA 1PR1A 2EQNA 1JIXA 2PT9A 4O8CA 4M0MA 4HVCA 2Y1DA 5M3BA 3RSSA 1QP0A 4FYYA 2CLSA 1ISSA 3K8ZA 3RUOA 1QMPA 3B8EA 3D7LA 4PSVA 2CMGA 1RXYA 4U4AA 1JQKA 3R20A 2VBCA 3OESA 2Z9LA 4KMSA 1SFRA 4TL6A 821PA 2CWWA 1OQAA 3A7EA 5A0VA 2XA1A 1W2HA 3EXIB 4KVFA 1JHMA 3HEMA 3OFND 4G5FA 1I4OA 3T53B 3OLZA 2WSBA 4OGGA 2P69A 3TRFA 3JZ1B 3AJRA 1I6KA 3I72A 2KBEA 3LQ4A 1OYWA 1Q16A 1QF6A 3TTXA 2B92A 3GELA 1C5TA 4XX1A 4TTVA 4Q80A 3FPGA 3TTWA 3O7MA 4G1CA 5DBOA 4FIZA 2FETA 5CUQA 4ITRC 1HORA 2FW0A 3HBFA 3SZUA 3DDYA 1YFLA 3OD1A 4B87A 3RFTA 2VH2A 3T26A 2AMYA 2I3BA 4IDHA 3M83A 4QPZA 2WNHA 3L8DA 4QBFA 3UTDA 4Q4HA 1KK2A 1DC4A 4OHPA 3FWPA 3F9RA 5HKLA 5FB3A 4YUAA 1KEEB 1E0KA 2OHIA 2I7TA 3OCXA 4Q47A 5FLKA 3ZTYA 3UT5B 3CC7B 2MINA 2PFKA 4QUEA 2QVLA 4RZSA 2XXAB 1UQUA 3FPPA 3F1LA 1MCVA 3E9CA 1ZSNA 2ZJYA 1TNKA 4M0FA 1IBKB 4IXMA 4US2R 2H0QA 4RD0A 3PMHB 1MO3A 4AWBA 5CNIA 5IC5A 2HF8A 4DOMA 3WWYA 1LNSA 4IHAA 4D4MA 4NECA 2QF5A 2CF6A 1EH5A 4J29A 1GG9A 1HH4A 2XKAA 1Y5MA 3EGWA 1P9RA 2AS9A 1G5HA 3EA0A 1UJ2A 4PE5B 5DNAA 3TGKE 3AYXB 5LA6A 1DC8A 1T8PA 2FWMX 2HPZA 2O2IA 1YRAA 2A5DA 3HBNA 3AERA 4KAJA 4BTUB 3TSOA 4HNVA 3OURA 2FWWA 4KQ6A 2Z6QA 4LX0A 4DCTA 1LK7A 3RDPA 2BEVB 3LBIA 4WXMA 5HPYB 1U7OA 5E9WA 3GFQA 4X8SH 5IJ9A 3PNKA 1Y7HA 4DRXA 1RJ9B 5K4GA 1YP9A 4R1LA 3V3KA 4IRXA 3ENKA 4X9XA 4B6QA 5AVZA 1Z4NA 1CO7E 1BD4A 1Z2PX 2G51A 2D1QA 1G3CA 3S44A 4FN5A 4L5JA 2YY7A 3RXMA 4QATA 1A0LA 2PNFA 3IL2A 4NFFA 3Q4GA 4JR0A 5T41A 4QDTA 2VRBA 1MVLA 3GYBA 1G8YA 1VP9A 1KXJA 3NO4A 4LYFA 5BSYA 2H3HA 2PYDA 4BGVA 2HDWA 1QL9A 4EZEA 2FSSA 1JU9A 2O8MA 4AX9H 3OHPA 2QXTA 2NYRA 2OHXA 4LOYH 4U2CA 3E8MA 4LJ4A 3IRUA 4NPCA 3GG9A 3A6DA 5I9TA 1E2KA 3IOYA 1M2KA 5CT6A 1NR5A 2FUKA 1T1GA 1GFSA 5EINA 4XKWA 2HBYA 5KYYB 2A14A 3RC3A 2C7OA 2A94A 1XTZA 1XKXA 3AFOA 3KJXA 3LDUA 1EWRA 1X13A 2A9FA 4J2YB 1Y7PA 5C1PA 2R85A 3DZBA 3MSCA 1W85A 3O4HA 5EPUA 3ELUA 2YZ7A 3AHGA 1XALA 5IXYA 1WXWA 3ZGXA 2NUTA 1GWAA 4CETA 5D5PA 3GBPA 2GVFA 2TMDA 4W1PA 3AM3A 2LD4A 4RV9A 3PG5A 1ZESA 4KLAA 5IF9A 3H5NA 5JTTA 1R12A 1XFAA 1KERA 3S1LA 1A0JA 2OUAA 4I4CA 5JJ5A 2IJOB 2GJKA 2RIRA 1K0FA 4TLBA 1PEYA 3KQWA 4X7RA 2ZT5A 3KV3O 4WERA 2REBA 1SGIB 3MNXA 2P9TA 2NM0A 2DQSA 5KTSA 4YQEA 1G8HA 4LRWA 3T5PA 4YP9A 5KSOA 3HJGA 4H1VA 1J2JA 1NOIA 5E95A 4Y2QA 4WBNA 3VOSA 4NJOA 3DQPA 3UJDA 3WGYA 3SQHE 3GP3A 3MYYA 3WHIA 3W6PA 3RVRA 2O5CA 3TYXA 1SUEA 3HWRA 2JLAA 3DZFA 3MI4A 2RHOA 5IAJA 1G5RA 3ZZAA 3RP2A 1O4VA 1O0CA 4R1QA 4D5EA 1L1QA 2A35A 1GMCF 5FPQA 3FPJA 2Y1EA 2KM0A 3LZ6A 5EXXA 1JSCA 3GLKA 4B43A 1JHOA 1EWTA 4FUIA 4BB5A 1VQ8B 1RCUA 5AFYH 2FPGA 3JWIA 3LOUA 1KDRA 5E6SB 2ZIZA 3RREA 4L3VA 4RPHA 2O57A 3TVJB 2LGJA 2J98B 5DWQA 3BIXA 5CCXA 2AFHB 4E5KA 5FYDA 3MERA 4RYDA 1WKBA 1AKRA 3ATKA 4ROTA 4YO8A 3G2IA 4HN4B 5C5IA 3ZOZA 3INGA 2R0KA 4WOKA 1LVBA 1L2EA 4DGJA 4MQ5A 2AV6A 3WDSA 3EXG1 1DJLA 5I9MA 2C96A 4B2YA 1DQPA 2RGNC 2FP3A 2VJIA 2W6JD 4GM0A 1C1YA 1EAWA 2FPIA 1C4V2 3BDAA 2Y5HA 1AGRA 4MR9A 1GRRA 4DGQA 1ZR4A 3M5WA 4E22A 1P80A 2XOKA 2PA0A 4BLPA 5GNDA 2Z8ZA 1JXAA 1YBVA 4C1NA 2CFIA 1I9CA 3H9BA 1A8SA 1K68A 2G52A 5MN4A 3O4FA 1THSH 1S0QA 3E48A 2O8UA 2XVAA 3HJHA 1T2AA 3EG9A 4GE0A 1WTCA 5TB5A 1KGSA 4QDUA 1QOQB 2OLEA 3P2IA 4MS1A 1W4RA 3EPPA 1W5EA 3V7NA 3P9YA 4OREX 1SXHA 1TKBA 4EB3A 1FY5A 1TJ5A 4XSHA 5ECYA 2K7FA 4K8BA 2XWJI 3WYAA 3QLVC 2PE5A 1A5GH 3PK0A 3NX4A 3E1XB 1VHQA 4FX2A 3K1YA 2O8EA 2J41A 2VYFA 4MTBA 2BB4A 3UAYA 2PUDA 1TD1A 1NN1A 4EHKA 1MXHA 2O0KA 4R9SA 3IO3A 1H66A 2WK1A 3OAAA 3C3JA 4ZU1X 3LOPA 5EHXA 1GGDB 2WJ4A 5JMPA 4XBBA 1X80A 3N9IA 1W19A 3WRYA 4QD3A 2FMKA 1O3EA 3KF2A 5E1MA 1FN6A 1RFGE 1DCFA 3UIRA 4IZHA 2A33A 2YKGA 4YRZA 4Q3LA 2OFXA 5KYNA 3K4HA 1C1HA 2ECOA 3DP9A 4YPVA 5HCNA 4FJ2A 5HIZA 4RFVA 3PE3A 1SC6A 1G8KA 1LEHA 2GBGA 3PWCA 3ZX5A 2ASVA 1Q1QA 4HLUA 4FK8A 1KY3A 1U7PA 1DLEA 3ZYEA 2Z5GA 1AFEH 2OB1A 1WOFA 5ITSA 1E32A 1MH1A 2J9YB 3UHFA 1XE3A 4D0GA 5CMLA 3F9GA 2W7SA 1QJCA 4DZTA 5C53B 1AIXH 3KWLA 2WWIA 3U44B 1UJ1A 4PTZA 4HZUA 3CCEB 4RLSA 2AVDA 1KI6A 1TYBE 1EQ2A 2VUSA 3ABSB 1VB5A 3M5CA 2AW3A 3RE1A 1C7QA 3ZZTA 4IGDA 2XNDD 2I1VB 3UENA 4Q7MB 2QEXB 1XFOA 4G1BA 1D8AA 1QGED 1I3MA 3T9EA 3ZW9A 2VP5A 2FR0A 4LV6A 2B61A 1HBJA 3IG6B 2FEKA 1D6WA 1NXVA 3CTAA 4YHHB 4CCYB 1A2CH 1GYPA 5KTPA 3SHFA 3OIVA 3QITA 4TY6A 2VWMA 3CA8A 4DAEA 2R3SA 1ZBDA 4FD2A 1TLDA 2I2CA 5CXUA 4NBRA 2Z4TA 1HDYA 2JA2A 2I22A 2NUAB 1Y9AA 2QLLA 1W7GH 1NBWB 1P81A 1C1TA 1WB4A 2V5UA 4KX3A 4FCVA 5CBKA 3DSPA 1K22H 4GC5A 1P2SA 2GAJA 3QPAA 3SHCH 3UR9A 2PJDA 1M3SA 1FEZA 3I01A 3TIXB 4YDSA 2VDVE 1U8FO 4L85A 2Y4OA 1GA4A 2JIQA 5HZAA 2Y1XA 1XYGA 3WK4A 3QQ5A 3QVLA 1YACA 5IT5A 3KJHA 3UHOA 4QWMA 3SC2B 3OD5A 3WJ7A 1W6RA 1EXVA 1BXRB 3K6SB 4Q2KA 2D5AA 1EB9A 5C5EA 2TPIZ 4HEHA 4GMFA 2I7DA 5JAPA 3TFOA 4PNEA 2CLOB 4ZA2A 4HRVA 4WCFC 2FZWA 3G49A 1SWWA 3SZEA 5EQJB 4H31A 1C7JA 2WMDA 3OIUA 1QTQA 1E7RA 3VU1A 3A6LA 2Y80A 5AF9H 1ZMOA 2A4MA 3NEJA 4GNKA 4IDGA 3L0PA 5DM70 4JGBA 1SCDA 4JODA 3BE5A 3OJXA 5EJ5A 1T4GA 1X9IA 2OUKA 3IHKA 1CJMA 3KL6A 3ZOKA 4YDQA 3QMMA 5JNTA 1VLQA 2PD3A 1JR3D 5LYJB 2J48A 2YXBA 1KKLA 5D3MA 5EIBD 1XD2A 2RHTA 1GDUA 2JETC 3SF8B 2X0DA 3W3AD 1AQ7A 1CW2B 1N5LA 4FC6A 4CG0A 1C29B 1ZIPA 4CI0B 1XZ8A 3DL0A 5KDLA 2XB2A 1I51A 1L7RA 4BP3A 1Z2CA 5C0TA 2W2KB 1Y3FE 3AILA 3CVWA 2ZCJA 2ZJ0A 3Q87B 2NWQA 5IBPA 5BORA 4KKSA 3KQPA 1MO6A 1WXHA 1F0KA 4Y0ZE 2P27A 1P6XA 1JJIA 1QE3A 1MN6A 4EWLA 3ELWA 2O23A 1GVZA 4FUJA 1I7DA 1XP5A 4PX3A 1CUUA 1EA5A 5TSDA 3AUTA 1N0UA 1T9GS 3LUAA 2H5CA 2C2ZA 4JC5A 4EGCB 4WZAA 2EX1A 2P16A 3VR6D 1FDSA 3G71B 1RQXA 1J9GA 3RO7A 1OVMA 3CXUA 1KI4A 1TZ2A 3O2QB 4U30A 1N32B 3G1UA 4YXFA 4PX5A 4M3NA 4US1R 1NJID 3SPXA 3QBVA 3SNHA 2NXCA 1H2AS 1GMDG 5DASA 2GGVB 2UYGA 4NFSA