4ACBA

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
469
structure length
448
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEITIDIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
molecule keywords TRANSLATION ELONGATION FACTOR SELB
total genus 97
structure length 448
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acbA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acbA01
3ZDQA 2BIFA 3P4XA 5AK0A 1J8MF 1DTSA 1KDTA 3H4MA 4TTRA 4A6PA 4ZI2A 4W9MC 4QHTA 4PHFA 2G83A 3A1VA 4DCSA 2FEMA 4BFUA 4K46A 4PC3A 5LD2B 3FMPB 1SHKA 2P3SA 2B8WA 3GLHB 4RY2A 3K0AA 2IYLD 1P2SA 1CR4A 2OBLA 3K9GA 1IBRA 3TIFA 4EPVA 1PV4A 1YRBA 2BBOA 3VNVA 5AJYA 4F92B 4AIIA 4DVGA 2QNRA 4WAUA 3I8XA 2N1BA 4NZYA 5EZ6B 1DAMA 1NJFA 4AG6A 4JT4A 1AIPA 1TF2A 4Q1AA 4PSKA 3QNUA 1VCIA 2BMJA 4Q1EA 1YHNA 5AR1A 3G71B 1W0KD 2CRVA 1YHQB 1BOFA 2QMOA 1NF3A 3LY5A 2HV8A 4Q4AB 1VPLA 1B2RA 3KZ1E 2NQ2C 3WHLA 5GVSA 2XZOA 1MT0A 3GEHA 1CXZA 4A9AA 1ZUHA 1WE2A 1FZQA 1VECA 2N46A 3MGCA 4NU0A 3X1DA 2CLSA 4WBSA 1ZU5A 1NLZA 4Z1MD 4BEBA 2Q9CA 2OAQ1 3UPUA 1ZCAA 2O8EA 4WZAE 4TYNA 1JBKA 1FTNA 2WZQA 1F48A 2WAYA 1G8FA 1LS1A 2CBZA 1E2PA 3I55B 5TR9A 4FWIB 4QOSA 3MHPA 4YDHB 2DCUA 5DI3B 3SBEA 2CCGA 3GLFA 3FPKA 2NO6A 2ORIA 4HEJA 4M1YA 4TWZA 5FPYA 3NHBA 3QPWA 2BSAA 1Z6AA 1MO6A 2BKEA 1R6BX 1ZM7A 4Q4AA 1E2IA 1EG7A 4PAOA 2BM0A 4H9GA 1XPRA 3FGNA 2QPAA 3VNUA 2GCOB 3RRNA 2ZRKA 2O8CA 1BH2A 3TR5A 2GZHA 1Z6XA 2UKDA 2C95A 3VO2A 2REBA 3LXRA 3EASA 3OAAA 3PEYA 3FMIA 4LHWA 1NVXQ 1Z0IA 5AUNB 1II8B 3DM5A 4XWAA 2FZ4A 2FNAA 5F9HA 1DAIA 1QVRA 3RVBA 4YMUA 2R6GA 5HTKA 1PUJA 1G16A 3SJBA 4G3XA 2LKCA 1E1RA 3THYA 2JDIA 2ZE6A 3T5GA 5H5JA 1YE8A 2GKSA 4MGKR 4RSGA 2FV8A 1A1VA 3TLXA 1Z29A 3RLFA 4HAWA 5HXBA 1RJ9B 5JLJA 3CZQA 1HY3A 3O8DA 5L3SB 3CCVB 2DERA 3LVBA 1OGIA 1HE8B 2C77A 1NN3A 4OJQA 4P6VF 1HYQA 2QAGA 1NL3A 4DEYA 1JR3A 1P5ZB 3RWMB 2BGIA 4Q4JA 1U98A 1W4CA 3X1ZA 3IHLA 2FSIA 5EMNA 2WWYA 4R2HA 1IHUA 1Y3AA 3R20A 1T3LA 2FG5A 3IO5A 3P1JA 4HAZA 4DDWA 5KPDA 1FP7A 3D6TB 3KJIA 4URVR 3BRWD 1VQKB 2Q9BA 4MKIA 5FOSA 1B0UA 5GJWC 3MWLA 1L8QA 5JJKA 2ZYTX 2XNCA 1Q7YD 2GRJA 3DKPA 4C3ZA 4A36A 2V4ZA 1FQJA 1CTQA 5HR5A 1CLUA 3KFXA 2FPLA 1U90A 4DLYA 4HAUA 2NTYC 2P6NA 1EX7A 3E1YE 1XCGB 3JQRA 4AKEA 4D25A 2QEXB 4DCTA 3TSWA 2J87A 1NLFA 3VMFA 2RGDA 4FCTA 1JPNA 2DWQA 1QFYA 3NBXX 4OHXA 4XVUA 1P9RA 1AS2A 1T8TA 3A37A 4M1OA 1JR3D 1WF3A 4R98A 2ZYWX 1DG1G 2XEXA 4CDGA 1Q81D 1GVHA 3RRZA 2O8DA 3CMEB 2PEZA 2I3BA 3QVUA 4NKRA 2VPPA 1Q57A 2ZU6A 3QFCA 3FVQA 4D0LB 4NHOA 3AP1A 3GCGA 1D5CA 1ESMA 4N0DA 4H1VA 3V4RA 3U44B 3NDBB 2HMAA 5HKKD 1VQ9B 1G20E 3WBKA 2QP3A 4ZIRB 3B1XA 1QHSA 4FMCB 4BFVA 2VYQA 2F1JA 2RB4A 1MABB 1MR3F 2ODNA 3QVVA 4YONB 2RKOA 2VP9A 4B43A 2PL3A 5C1BA 1CRPA 1S1CA 5J4YA 1GAQA 2GF0A 5KDDA 1W0KA 2J1LA 4WVFA 5KSOA 4PO9A 4PHTA 2IEZA 4YXWD 3L0PA 1YITB 3RRYA 4US1R 1NLYA 1TUEA 3W2EA 3S1AB 3TVDA 1XWIA 3VKWA 4UNNA 2QBYA 3ZD7A 4G5RA 4IVPA 4ZIRA 4C2UA 1UAAA 4GP7A 3MWJA 1XDBA 4ZDIA 1JALA 2WV9A 4QL3A 3U44A 1IM2A 2BJWA 2C5LA 1TU3A 5LB4A 4FN5A 3OIYA 2BV3A 5FTLA 4HUTA 4V0LA 1RYFA 1U0JA 3AF1A 4B71A 1HH4A 1F6BA 2HYDA 2IXEA 3LX5A 1FOEB 3RS0A 4TL9A 1PLJA 5DE3A 4MRRA 1XTIA 1UKZA 1QG0A 4OYHA 2RGEA 4TLAA 1LFDB 1OFIA 3M1IA 4IOLA 2F3TA 5TVKA 4KO8A 5EXPA 3TJZA 3GLFB 2ZREA 4HSEA 4LYFA 1YZTA 2Z5FA 4ESVA 1G21E 3B5JA 4HLDA 3SJAA 2E1RA 2F7SA 2IX3A 1AS3A 1GO2A 1F2TB 1A4RA 1CJTC 1R0XA 3CR8A 1U8YA 1XXHA 1XEFA 4TMZA 1VQPB 1KJWA 5BYKA 4XTCS 3KJGA 4S2EA 5DO9A 5L3RA 1U9IC 4A8JB 2JLYA 1WBBA 3U3OA 3TQFA 2W2XA 2VIIA 3K70B 5JI3E 4JSYA 4MYTA 4H1UA 2JGNA 2KBEA 2KB0A 2QTHA 3PUYA 1U8AA 2C2HA 5FA6A 1K8AD 1DBSA 2QT0A 4FCVA 1AK2A 1Q1QA 3EG5A 4C9BA 3W2FA 3DZDA 3RNLA 2OM2A 4MGZR 2DYKA 4TLDA 4PC1A 4AURA 1W48A 2ZANA 4CIDA 4HE6A 3KB1A 4HYYA 1SVIA 2QSZA 521PA 1JNYA 4GNKA 3THXA 3QI2A 2HXSA 5E95A 1P2UA 3CIOA 4QGGA 1VYVA 1ZU4A 3A4MA 5SZKB 5H8WA 3AVXA 1XZPA 1OSNA 2IWHA 3IGFA 1Q86D 1OFUX 1EGAA 4NYMR 3NEYA 3HU3A 2O0HA 3X1YA 1K73D 2Y8EA 3OIVA 2ZS7A 3PFIA 3EPHA 4AYWA 4F4IA 5EP3A 3OE7D 2DEUA 4A92A 4YQFA 5DLQC 3I32A 3KXLA 3JVVA 1E1QD 5C46F 5J47A 1LS6A 3THWB 3BB4A 4DLTA 1J70A 3TUJC 2CVHA 3TSOA 3ADCA 4Q9KA 5B58C 1N0VC 3A1UA 1V5WA 2QMEA 3T1VA 2BDTA 2D06A 3PUZA 3SNHA 4EPYA 2ZR7A 5G40A 1FUKA 3QBVA 1XPOA 4W7SA 3CRZA 2D7DA 2ZRIA 4A82A 3CMAB 1P72A 4DIDA 3CH4B 3ONWA 4CT4B 3DMNA 3M0EA 1XPUA 3IILA 5DIFA 3CONA 1OIWA 5FBWB 4US2R 1ODFA 2QAGC 3QG5A 4E03A 2O8EB 1CR0A 3AKDA 1QH0A 1DOAA 4B34A 2OK8A 1Q3TA 2WWFA 4KBGA 4DCVA 4PGOA 2ZE7A 2GHIA 3GJ7A 5CLQA 1XEXB 2W0SA 1GDDA 2ZI4A 4F4CA 1KI6B 3GLIE 4Q18A 2OG2A 4JLDA 4MYHA 2PIAA 1H8HD 1N6IA 2RC6A 1KNQA 3W2GA 1OYYA 2OAP1 4PR0A 1E96A 2J0SA 2OSBA 3DM9B 2PLFA 1PZNA 1T8UA 2JIZD 3AVPA 3V4FA 2BWJA 3DMDA 3H1TA 2Z43A 3LW8A 2XXAB 1G3QA 4HAYA 1Z2AA 2VP5A 2CLDX 3EA5A 2VNHA 121PA 1N6RA 5LBIA 2DHRA 1N6NA 5FH9A 3TR0A 2J45A 3AVOA 5J4LA 2ONJA 1Z28A 2IYUA 4IJMA 4Q4LA 4WXRA 3LO5A 4JLOA 1US8A 4A2QA 1QHHA 5A4JA 4LGMA 2AFHE 5GADl 3ZLJA 2QDXA 3UMRA 1LVGA 4C43A 4LOAA 3NWJA 3L82B 5GV8A 3PUVA 4I99A 2RGNA 2ZRMA 1E99A 2V1XA 2W6JA 4JT2A 4TMKA 1P60A 3VR4A 4OKSA 2ZETA 3EPKA 2CNDA 1T5LA 1AMOA 3SEAA 4LSGA 1N5LA 1E1RD 3IIJA 1FNBA 4HDCA 2B92A 2MSDB 1MO4A 4WZBE 1QHHB 4B3BA 4DHEA 1QFJA 2QA5A 3K0FB 3GQBA 4V0ME 4JIMA 1ZINA 1AQYA 3A58B 1Z0KA 1TX4B 1NJGA 2Q21A 1NKTA 1P7CA 1VHTA 4TYQA 4A8JC 1LNZA 1D2NA 1F2UA 1CF4A 2ECKA 1W47A 4EPXA 4JL6A 1GRNA 4QNMA 1X3SA 3OZWA 1GKUB 2TMKA 2WAXA 3GEIA 4US0R 2J7KA 2QGZA 4UNQA 2WSSA 3KB2A 4OQFA 1KI6A 5H1YA 2D74A 4RFSA 1S0UA 4ERNA 3WYAA 1EP2B 1MH1A 3FB4A 4A4DA 1TU4A 3PEUA 4URWR 1S72B 3LH5A 4DZZA 1DAHA 3GFOA 1CRQA 2EYUA 2VF7A 4IXMA 5FUVA 2QROA 4I81A 2JLVA 5CJ2A 3W5UA 1S2MA 3CF2A 3OEED 1S8FA 5J4KA 4KODA 1W2BB 4ESHA 2QE7D 2V7QA 3BORA 2ERXA 1L4UA 2CNWA 3NBYC 3GP8A 5THXA 4ASUA 4QG7A 4AF7A 1TTTA 3LAWA 4DT1B 2JLWA 2IHYA 4QGHA 2EVWX 2JJ2D 3IPYA 3LXXA 4A0FA 3MLEA 4C0AC 1Z6GA 3B82A 1JECA 1ETUA 1NRJB 4C0HA 2BMWA 3T1QA 4B73A 2AD5A 2G88A 3Q9LA 4L5BA 4OK6A 1E2EA 2FSGA 4NE2A 4NYJR 1E63A 3AB3A 3OEHD 1FX0B 4B32A 1N5JA 4C7OA 2J41A 4UKDA 2ZJ2A 4Q03A 3CX7A 1FMJA 421PA 2GESA 1R4AA 3RS7A 1HT2E 3C16C 4FWTA 1D8TA 1VCNA 3BH6A 4Q9JA 3MWKA 4JJZA 3K09A 2FFBA 1XMSA 3X1XA 1NSFA 2GJKA 2ZSAA 1TEXA 1GITA 1FP6A 3WRXC 2EIXA 1ESNA 4LHYA 4Q7LA 3HU2A 1E9CA 5GJBA 3AVQA 1C1YA 4TLBA 4YMWA 3BIFA 1TPZA 4PPQA 4DBLC 2QP9X 1YIJB 1OV4A 1X1SA 3L8YA 2ZI9A 1NI3A 2VBCA 3AEZA 2CL7X 4Y9UA 4ZGNB 1YR8A 4FIDA 4MUAA 3OF5A 3SDZA 3KKQA 5FOVA 2XNDD 1WCV1 1G19A 4M2LA 4BPBA 2HCBA 3WMEA 1SKYE 2QMHA 4BLOA 1W34A 1IXRC 2ZRLA 1G5RA 3T34A 5EUMA 1BMFA 2OK7A 1R8QA 5CDFE 1D2EA 1JB9A 2BHRA 3HDTA 4TTQA 3TH5A 2QG6A 4N0EA 2FA9A 4Z8XA 3AGQA 2XSZD 2YJTD 4PO1A 5AUOB 3AF4A 3GFPA 3WNBA 1YR9A 1XX6A 1VIAA 3TAHA 3NDPA 1Z0FA 3BC1A 4JVNA 621PA 3FOZA 1R5OA 3CX6A 3GPLA 2D3WA 3L8ZA 4M8NE 3CM0A 4DJTA 1HTWA 1UDXA 1G4UR 2ZS8A 5DGXA 4U5XA 4A0RA 4Q01A 5FPSA 2YKGA 4UQOA 1G8GA 4YLGA 5BYJA 1QUEA 4NCNA 2ORVA 3EX7C 3KJHA 3EZFA 4DC9A 3FHCB 2QRNA 3K53A 2OCAA 4PSAA 3RS4A 2NPIA 3FKQA 5JRZA 1OPXA 3CWZA 5GJCA 3K0SA 1VQOB 2BMEA 2X1VA 4RKEA 5L3QB 2JLXA 1G9XA 1T9HA 2FSFA 4ZGQB 1MRSA 2ZVQX 2DB3A 3B7GA 3AUXA 721PA 5M04A 4Q4HB 1YZQA 1W36D 1S9DA 1QUFA 3TRFA 2ZUBA 3IBYA 1Q1ZA 3GLGB 4AKGA 1WDTA 3OZUA 2ZU0C 1NBME 3CD6B 3EWSA 4XSHA 4Q5IA 1K5GA 2BEJA 3U4QB 1DAEA 2EFGA 2JEOA 2V55B 3IQXA 2J0VA 3W5VA 2CLCX 2PZFA 4LY6A 4IEIA 1KAOA 4W5WA 4B6EA 1VIYA 2MSCB 3T35A 4QKQA 1W2GA 2Z4SA 1E62A 5P21A 4DUGA 2QM8A 3SQXA 1DVRA 4PZLA 1UMKA 2WKPA 2GILA 4FCWA 3N5CA 4EPRA 2RGCA 2YVUA 1JQJC 3NIBA 4BFXA 1EFTA 3CKLA 3TW4A 1SZPA 4IDOA 3LLUA 2ZJBA 4CT5A 1XJ0A 2ZRGA 2RGBA 4BE7B 1EWRA 1OFHA 3E2IA 1W5TA 3TSZA 3QXSA 3ZBUA 2IS1A 1GL6A 2W2TA 4G5GA 2YV5A 2VRWA 3ZVNA 1TQDA 1US8B 1SXJC 3KL4A 3W6NA 1C9KA 5KO2A 2GTPA 1FPMA 4AKHA 3CCMB 3VTKA 1WP9A 2JCSA 4EKDA 3MFYA 1G4AE 3ZVRA 5EXXA 4EJSB 2WWWA 4LHXA 2P5SA 4OI1A 1GR1A 4TQUS 4JJKA 3F0TA 1FRNA 3EW9A 4B3CA 1P9WA 2QU8A 4NONA 2WHXA 1KO7A 1GTVA 1OT3A 1N25A 2YC2C 1KO5A 3P32A 2VP2A 3QKSA 1G6HA 3T61A 4P31A 3OZXA 4OL0A 3SU8A 3I61A 1SVMA 4FK8A 3LLMA 1U9IA 3L0IB 4C2TA 3EXAA 1M6NA 5JCPA 1MO3A 1DDGA 4AD8A 4PC6A 4DB4A 3AGPA 3O47A 2ASEA 1W36C 2Q3MA 3I1FA 1W4RA 3X2SA 4BWYA 1QHYA 1M2OB 1IN4A 1DO2A 1QHGA 2CMKA 2OILA 3JZMA 4KSBA 1AZTA 3RHFA 3ZQ6A 1GVNB 2H16A 5G3YA 3SFZA 3P26A 1KJYA 4QBFA 1VQ5B 2C99A 2H18A 2R8RA 1ZM4A 2OCYC 1RZ3A 2X3UA 2KI5A 2RC5A 1NJID 3B1WA 2ANCA 3MD0A 4M1WA 1AM4D 4OK5A 5SZJA 3U3MA 1SQ5A 1TQ6A 1UBEA 1VG0B 3IHWA 4EPWA 1UBGA 2RHDA 3WNDA 2H8KA 1UM8A 3WP1B 1E0AA 2ODBA 4DLVA 1I4LD 4O2RA 4EPTA 4URYR 3Q3JB 2GXUA 5LD2C 2LCFA 1KNXA 1YQTA 5UKDA 2GBLC 5LDDC 1RVDA 1KHTA 1ZIPA 1UDWA 1VQ6B 1N3BA 4Y0AA 5CDFA 4JLVA 3U3KA 2K5UA 4LJ5A 2GAAA 1UKEA 2VH5R 1E9DA 1H85A 5GV7A 3R8FA 5FOXA 3V9PA 3A1TA 2RGGA 1G3RA 4WOPA 4DDUA 4HB4A 2ONKA 4JYBA 4HAXA 3TE6A 3MAAC 3CRQA 2GCPA 3WBJA 1E9AA 3U61B 1RYHA 1OW3B 3SOPA 1P9NA 4MRVA 1MOZA 1YVDA 2IYVA 3KKOA 1OE0A 1QVGB 2ZJ8A 4LUCA 1XTKA 1NN0A 2OCBA 1JJ7A 1DARA 1HT1E 4NTZA 1KMQA 4M22A 4B3XA 1B23P 1QDEA 2D2FA 5FBVB 2G77B 2C98A 3AH8A 3W6OA 1X8KA 2G1KA 3BK7A 4QGAA 1OIXA 3KQNA 4ARZB 1XB2A 2XTNA 1KKMA 5K8LA 2Q9AA 2A7QA 2IBMA 2UZ3A 4JBWA 1DO0A 2A78A 1S3SA 1CS4C 1E2JA 3OESA 1G64A 5BW8A 1J99A 1F2TA 1RFLA 2VA8A 3OFND 1KRHA 1JR6A 3HJNA 3GLGE 2RHMA 2F6RA 3CR7A 3JQQA 4XD7D 1ZVQA 3QJYA 2XZLA 2JLQA 2JJ1A 4URZR 5FOUA 1L7VC 4OHVA 4Z1MA 1EESA 1TEVA 2IYSA 3U6KA 2O8FA 1GIAA 1PJRA 1P3JA 5CIQA 3QFRA 1YJ9B 4DLWA 3LDAA 4Z8YA 4PQYA 2Z4RA 3CRVA 1T0JB 3CXCB 4CYMA 1G7RA 3NHAA 1DPFA 2WJVA 3ASZA 4B6FA 2OBNA 3P4YA 3AKCA 2GK7A 4EJSA 3N2IA 4GMXA 5CM9C 3C4JA 1G7CA 5KSYA 3U2QA 3L0OA 1JXOA 3UG7A 4IRUB 3UK6A 2O52A 4DQLA 1FL9A 1G8YA 2X19A 1GILA 3W8RA 3NH9A 4PANA 2AX4A 4EQ6B 1AN0A 1C4OA 1CU1A 3G5UA 4JL8A 5DH9A 1H8EA 3K0FA 1TUIA 5C4MA 2D4HA 2NMVA 2IEYA 3PITA 3GLIA 1RRCA 1XD8A 4XSGA 1DG3A 2ZI6A 1W35A 4YAOA 4YAUA 5JCZA 1GRRA 1AGRA 5IRCD 5KHOC 1DAGA 3TNFA 4OHYA 1Q44A 2H92A 4EIWA 5FR1A 3CNLA 3GFTA 3EZ9A 3EA0A 3EC1A 4X8MA 2HF8A 3EC2A 4MQBA 4DB2A 1A5TA 1MABA 2BJVA 2L0XA 4F4JA 3NBZC 4ZKDA 1E9FA 2IXGA 2BEKA 2O8DB 2JJ2A 5B2ZA 4I1VA 1FDRA 3GLGA 1N8RD 2A30A 4YMTA 1K9MD 1A7JA 4TSFD 4YALA 5F9FA 3RS3A 1KI2A 1BQEA 2IYXA 1TQ4A 4GOJA 4P32A 4A2PA 4KU4A 2UVQA 3KXKA 2RAPA 4MUBA 1E2QA 4KBFA 4TZ0A 4PX9A 1G5PA 1WMSA 3V00A 2RCNA 1E2HA 3B60A 1UF9A 2C04A 4M1SA 5JWHA 3A6PC 2ZYVX 3QXHA 2GWHA 1QGYA 4Z51A 2OO7A 3BOSA 2FX3A 4CEJA 3R8CA 5L3QA 2AFIE 1MV5A 4B33A 1OH7A 3I92A 3CC7B 2WMNB 4HB3A 5G3ZA 1Z47A 3THOA 3CRRA 4U9UA 2ZTSA 4IOMA 4AYXA 4LPSA 3QIAA 2XAUA 1YU9A 3DOFA 3TW8B 5CK5A 3B1ZA 1MKYA 1OB2A 4HLUC 1E9SA 2A9KA 2WOOA 2VSXA 2X2EA 3QKRB 4IDNA 4LV5B 4R71A 4TTPA 2R6DA 4ARZA 1KMHA 2N42A 1ZM9A 2E9SA 2IF2A 3ADBA 3HPQA 2NG1A 1DE0A 2QAGB 4DSUA 1W5SA 2I4IA 2GQFA 4MRPA 3ZS9A 1PLLA 1X86B 4Q7JB 2JJ8A 4ZCMA 2CNWD 3CPWB 5FUWA 4DLUA 3TQCA 2GCNA 2CDNA 4PAQA 3NG1A 4RD0A 4XWKA 2ERYA 2R6AA 4E07A 2YWGA 1K6MA 2ZS9A 3R7WA 1MRNA 2AN9A 2OFWA 1XJQA 4CEIA 1L4YA 1XEWY 4LJAA 3U5ZB 1S3GA 1UEIA 2A3RA 1R10A 1E0SA 4KVGA 4AF6A 1VQLB 1MO5A 5EE9A 2JDID 1KI3A 3AUYA 1SKQA 2QTZA 3QE2A 4KCGA 4LHZA 2ORWA 4BFSA 3PEWA 2I1VB 1LF0A 4HLCA 4NCIA 4GL2A 1E2GA 3LQQA 4Q9HA 2ZJAA 2IWRA 3SBDA 3QFTA 1I2DA 5C2JB 1IN5A 1W44A 2O0JA 2C78A 1XTRA 2NZ8A 5IHPA 4B44A 4QHSA 5HPYB 5H59A 1G41A 2FWRA 2V9PA 2C9YA 1G1MA 3DOEA 3MUFA 2GK6A 2F9MA 2OCPA 2RGNC 4X8HA 5AJVB 4GSYA 4B3DA 3GEEA 3GLHE 4QJ4A 5DHAA 2XJ9A 4MGYR 4FINA 2G1JA 4D81A 1E9EA 5DI3A 4ZKEA 3QSYA 5L8VA 2ZUCA 2PCJA 5JECA 1EP1B 3PIRA 1COWA 1VMAA 1G291 1HV8A 3LBHA 2BMFA 2WWGA 4J0QA 4OHWA 3CRW1 3DEFA 3GJ4A 1ZD8A 4TN1A 1EX6A 3QKRA 4IVQA 3R9IA 1H8ED 3AKYA 5EE3A 4RKFA 1Z0JA 4UNPA 4DWJA 3LW7A 1IQPA 2G0TA 2V54A 4DDVA 2VYFA 1NDHA 4RD1A 2OEPA 3JZAA 4FMCF 2MMCA 4NDZA 4OQLA 3ZVMA 2QTFA 5KYKA 1U99A 3I5XA 2HEIA 3KDSE 2CL0X 3VFDA 3ZIAA 1XEWX 1YKSA 3CWQA 3K8YA 3E5HA 3GJXC 3NXSA 3C8UA 2BC9A 1OXVA 3FFBA 4GI7A 3U7HB 1FNMA 2ZI3A 4UAJA 1QF9A 3HU1A 1G17A 2OESA 1KGDA 2QRZA 3LVRE 5HE8A 1XTQA 1ZIOA 5CM8B 2BCJQ 3Q7QA 3ETLA 4IFBA 4Q48A 5JFGA 2FGJA 4TZ6A 3OE7A 1AJEA 4Q66C 4OQXA 2JA1A 2OTLB 2NO7A 2V8OA 4JLBA 4BQSA 1M7BA 1SXJD 3G4SB 4EFNA 4QBIA 2BVNA 5EXTA 2YINC 3C14C 2FPMA 2XOKA 5FL7D 1F20A 1PVOA 4NBSA 5EE0A 2CHQA 3DKVA 4GFDA 4KFRA 4GOKA 5CYOA 1KK0A 3GLHA 2IUSA 4G5OA 1OLOA 4TSFA 2A5JA 2BPOA 1SHZA 1Z6YA 1E2LA 2FN4A 2ZI7A 4O2LA 1W0JA 5AN9A 3FJOA 1VTKA 2J5XA 1JEEA 1XMVA 3RANA 3BH7A 4DKXA 2ZM5A 1GL7A 4TMTA 1LTQA 3LO8A 2E87A 3DVLA 3GMTA 3LQRA 4MKHA 1XCMA 4LYJA 4POAA 4IOJA 4C30A 4DUGD 1W87A 1JI0A 4GT1A 1S96A 4AC9A 1KI8A 4OI0A 1VG8A 4Q1FA 4JVMA 2V7QD 4XTRA 1ONBA 2VHCA 1HQYE 2YC4C 4TQAA 4A0HA 2D7CA 1Q21A 2WJGA 2XOKD 4QJ3A 1BIFA 4EQ6A 1R7RA 2BN4A 2P67A 2FEOA 2I1QA 2GEDA 5FUYA 4OBEA 4X8OA 3U4QA 1LB1B 3O8RA 3WRYC 2GEVA 4PPFA 3PENA 2F3RA 3FHOA 1TMKA 3ZJYA 2QTVB 1CR2A 3EZ7A 5TARA 5DNYB 1UJ2A 3I72A 1M1KD 1L2TA 2XX3A 3D3QA 3LV8A 4A2WA 1KSGA 4QJ5A 1XU4A 1FNDA 5AJXA 3TGPA 1G3IA 1GWNA 4Z54A 3CCJB 3GJ6A 2H5EA 5CIWA 2DWOA 2F9LA 4UNSA 1I7PA 1W46A 1D9ZA 1EWYA 1JAHA 4OI2A 4AI6A 2QQEA 1T5IA 3U6BA 3PV0A 1KYIA 2WKQA 2J7PA 1ZD9A 3L2OB 3SHFA 2EFEB 2GZAA 3C15C 1YJ5A 4KSCA 3UWKA 1XRJA 4M1KA 5CK4A 1RRGA 1VKJA 3LVQE 4URXR 3QXXA 4G0NA 5FOWA 2HT1A 3B9PA 3F8TA 3L43A 1BO6A 3T06B 1VQ4B 2OTJB 1P2TA 4KV9A 1UFQA 3M4YA 3AQ4A 4KFTA 5KU1A 4JBYA 2VL7A 4A6XA 4MITA 5ANRB 5G53C 5AUPB 4JLAA 3UMSA 2WWIA 3D8BA 1XMIA 2WPDD 2ZVPX 1HQCA 1JA1A 4G5QA 4G1BA 3THWA 3R9XA 4DEXA 3ZZTA 1T6NA 2CVFA 2HT6A 4BUJA 4M9SA 2AHOA 4BRWA 4ZCIA 2VHQA 4MA4A 4FMDF 1OH6A 2ZPTX 1KDRA 2ZRBA 4D80A 1VCMA 2JIZA 5DYIA 3K9NA 4XD7A 5FR2A 3ZBTA 1Z06A 4NCHA 4LBWA 4XIGS 1OYWA 2KBFA 4QRHA 3B85A 1KDPA 1ZJ6A 3NBFA 4ON9A 4WQMA 4HE5A 4A1FA 3THYB 1IB0A 4Q21A 2H7VA 4Q19A 1OKKA 1ZYUA 2JASA 3AVVA 1JB1A 1H42A 4HI0E 4HZUB 2ZRDA 4B2IA 1IXSB 1FX0A 2P6UA 2QPTA 3GJ3A 4IVRA 1TQ2A 3BFVA 4E22A 3FYHA 4E5UA 5KNCA 2WJYA 3QBTA 4ASUD 5DISB 4RFVA 1BX1A 1G8HA 3HPRA 1LY1A 5E4FA 3ZS8A 4LC0A 2BM1A 4JL5A 4UJ5A 5FTNA 2OLKA 2NOAA 3LFUA 1WRBA 1YJNB 3KQKA 1J7KA 4B3FX 4I1OA 4Y7CA 5HZKA 2GXSA 3IIMA 5H70A 3EPLA 4RD4A 4JLPA 1GAJA 2J0UB 4QC2A 4G5SA 3T15A 2ATVA 3TK1A 3NTUA 4PPNA 3KKPA 3TAUA 4UXJA 4YC7A 1QG4A 4KHZA 1UPTA 3TBKA 1P2VA 2W00A 2WJHA 2SHKA 2WSSD 3K0CC 3M6AA 3SJCA 4JMPA 4II7A 1SQRA 4B75A 2WTUA 3RC3A 1NKSA 3SR0A 2ZR9A 4EAQA 3CCUB 2D62A 1OGJA 4AYTA 2CHGA 4IEEA 3BERA 3MMPA 1KQSB 1YZGA 3V76A 2PMKA 2BCGY 2WVJA 2HJVA 1EK0A 1GAWA 5KOYA 1XFAA 3I8SA 3WYGA 4TYYA 3RABA 2OE2A 1K8RA 3U3JA 2AXNA 5KSPA 1A82A 4BGDA 5KPJA 2ZROA 1KI7A 1KZ7B 4LJ8A 3SI7A 3VR1A 4B48A 2YNMA 5AUQA 1VYUA 4N3NA 2Q3HA 2W0MA 2J0QA 2ZRHA 1ZM3A 3RWOA 1ZAKA 4EUNA 1U2RA 4M21A 2BBSA 1ZC3A 3HYTA 4V03A 2ZRJA 5KTYA 4QM7A 3BFKA 3Q5DA 4V0MA 4LJ6A 4JKIA 2P5TB 2NGRA 2EYQA 5FI0B 1CBUA 1JA0A 2HLDD 1GFIA 3VX3A 1FUUA 4UXIA 2F1RA 1KO1A 2J3EA 2DETA 3ZH9B 3W8NA 3RAPR 5TY0A 2DPXA 2QSYA 3QXJA 4GZLA 4BZXA 4B3GA 3I5YA 3BWDD 3EIHA 4QM6A 3AVTA 2GVZC 4X8LA 2IS4A 1RC8A 2GXQA 2VSFA 4EJSC 4B2PA 3EWAA 3QE0A 1YJWB 1G8PA 1T3SA 4BEJA 5LB2A 5JJLA 2IC5A 4O25A 1E6CA 4Q4HA 1X8JA 3W6PA 3O8BA 1CJUC 3CNNA 5BWMA 2A2ZA 2PH1A 1YRAA 2RGAA 4S35A 1ZD1A 2O8FB 3CCRB 2VNKA 1M7HA 2FF7A 1N6LA 4C0LA 1VQMB 1SM4A 4LX0A 4ZV4A 3CCLB 4KI0A 3C7KA 3AKEA 3JVUA 1E2MA 2HUPA 1E0JA 4KAXA 4PSVA 4PZYA 5JRJA 3B2EA 3QQ5A 2H57A 3PVSA 4LRWA 2B7BA 4EDHA 5LPNA 1UKVY 3LBNA 4DDTA 4KFUA 1AKYA 2QZ4A 2QL6A 3A36A 5JWRA 4DCNA 3GJ0A 1P4SA 5FL7A 4JKYA 4HB0A 2R65A 1GNQA 4N1AA 3CLVA 1G6OA 3AP2A 1E4VA 2J9RA 3VU9A 4C0BA 3IKJA 4M9QA 3W5IA 5BN4A 4OK3A 4GZMA 3JQPA 4XVRA 5CYPA 1T0HB 4GRAA 4D0GA 5L3SA 3W34A 2W6IA 3LBIA 3ZZUA 4CF7A 2ZE5A 1S9HA 2IUUA 1N6KA 1TADA 1YZKA 3K9LA 3SHWA 1EFUA 2OBMA 1E94E 1GM5A 1SXJB 3ZIAD 4A15A 5F3WB 1OF1A 4M4SA 1RRFA 1VCOA 1M90D 5J40A 3WHKA 3A1WA 4OQNA 1BYIA 4EH1A 3THXB 4DLZA 1OHHA 4LJ4A 2NO0A 2FSHA 3W2IA 3H0KA 4GPTA 1ZC4A 1NG9A 4C0JA 4YMVA 3DPUA 2QE7A 2GBLA 1BYUA 3VKHA 4LBVA 3QUSA 2ANBA 3P27A 3PJRA 2QM7A 3IIKA 2ZRCA 4RZ3A 2ODEA 4O3MA 2JLSA 4TMWA 1AQUA 1BMFD 3K0CA 2VHTA 3K1JA 5F2EA 4L9WA 1Z63A 3DHWC 2R6HA 3J81k 4PC2A 4GMDA 3OEHA 1IY2A 3I3SR 3GD7A 2Q0HA 4F7DA 3FFAA 4IDQA 4D4KA 1IXZA 2IYZA 1XJCA 1NG1A 4HUQA 5KNBA 4BLTA 3SQWA 3BJIC 3E70C 1W0JD 5JS7A 3ADKA 4C0SA 2Q6TA 4TQ9A 1UEJA 5FBRB 1JEDA 2AWOA 2FGKA 3A4NA 1KSJA 4R2IA 1JPJA 3CB4A 1D2MA 1GNRA 4MYCA 2IK8A 4YAWA 2FDCA 5J4HA 1FFHA 1NSTA 1ZRHA 4HUQB 2QN6A 3FPAA 1CULC 1IOZA 1FQKA 1JQLB 4NYIQ 3U7GA 2UZIR 2IA5A 4MKFA 3CF0A 2WIBA 3WP0A 2BBTA 2PJZA 4QBGB 1YZNA 4RFSB 1IAQA 3QKSB 5E7JA 3ND8A 4DXAA 2AL7A 1NBMA 3CPHA 3CNOA 3Q7PA 5TV2A 2ZJYA 3IPXA 2O0KA 4PHHA 5K8UA 5JWOA 5GJVC 1KIMA 1JJ2B 4TT3A 1R0YA 3QG1A 4U00A 4LV8B 3EARA 3BGWA 3QENA 2W2VA 1W4BA 1BX0A 3KKMA 4RD2A 4Q02A 4NP6A 3FHTA 3FWYA 1WB9A 3GJ8A 3OHMA 4NPHA 1E79A 3S1AA 2W6JD 1XP8A 1ZNXA 3OAAD 5IF9A 3WY9A 2QY9A 1SVLA 2Q3FA 2XNSA 4CRWB 1CEEA 1KO8A 1N2CE 1QFZA 1XE1A 3BH0A 3QPUA 4NH0A 2CEAA 2OV2A 1KD1D 1HURA 2V3CC 3WXMA 5IK2A 2EU8A 3RS2A 3BXZA 2QAJA 4ACAA 1IONA 2Z6VA 1Q12A 2YZ2A 1Z07A 2DFKB 3U7FB 1ZCBA 4I1UA 4KLZA 2IYTA 4MDEA 4BLRA 4IOKA 3B1YA 1EWQA 3KQUA 2WJJA 3FE2A 3ZD6A 3AF2A 1KK3A 3B1VA 4PQFA 3UATA 1W36B 2Z83A 2IYWA 5JSZA 2YWFA 3UG6A 2WIAA 2QEQA 4LCBA 3EIQA 3KKNA 5DI9A 3Q85A 3VHXA 4K1XA 1H65A 3CX8A 2QMUA 1NNEA 4BFWA 4QHYA 3CC4B 3F5FA 1XD2B 1U8ZA 5EJEA 1OJLA 1UBCA 5FPKA 4D4JA 1QX4A 2A5GA 4JVLA 5FTJA 4ZDJA 4PAMA 1WQ1R 2G3YA 4BASA 4L9SA 3T12A 3MWYW 1DS6A 2R6FA 3C5CA 2KSQA 3B8HA 3K70D 2CL6X 4EFMA 4D6PA 3QEOA 2OUKA 3SFVA 2GF9A 1WBDA 2O8BB 2EFDB 2ZI5A 1SGWA 2P6RA 2B8TA 2GJAA 3NKVA 4NMMA 3AM1A 4Q1BA 1Z6TA 1OFTA 2HCJB 4CVNA 2XSZA 3H86A 2P2LA 3QY0A 4BZPA 5HZHA 2OHFA 1XD2A 5TDHA 3QXCA 1HEIA 2DY1A 1J9ZA 1AKEA 2REOA 3OIUA 2CHVA 2W58A 1KSHA 2WOJA 5J4VA 1GG2A 4I1SA 2A5DA 1KY2A 2BKUA 2ZIAA 3FTQA 4F93B 2VP6A 5AJWA 1U94A 3MRSA 2G9NA 4E09A 2R9VA 2LKDA 2AD1A 2QENA 4CW7A 1Q1BA 3IUYA 4Y0VA 3UIEA 1II0A 4YDSA 3IO3A 1RJ9A 2F1HA 3PCRB 4KXFB 3UKDA 3ZQJA 3ZC3A 3LNCA 4LYAA 1NY5A 2CXXA 1ZW6A 1LV7A 1JAIA 1IY1A 1RRPA 3CCSB 4AWXA 1E1QA 2ZRNA 4AKIA 2OZEA 2JATA 3W5HA 3MJRA 1VQ8B 3HYRA 3RS5A 4D4MA 3SJZA 3TKLA 4F38A 5JEDA 5JHGB 4IDHA 3KTAA 4B47A 3RYTC 3BS4A 2GJSA 5CITA 4P3YA 3GLFE 1TF5A 3PXGA 4NYJQ 4HDOB 3VHLB 4KITB 4TL7A 3I56B 1N5KA 5SZHB 2ZQ5A 5KNDA 4UXHA 3VR5A 1II8A 2D2EA 4JZKA 1CP2A 2AWNA 2C9OA 1G7TA 2XB4A 4MGIR 1OH8A 5A0FA 3CUEF 1V43A 5KDOA 3ND9A 4AY2A 1Z83A 1R8SA 5FBQB 1X8LA 3QOFA 1OXUA 1O3YA 8OHMA 4TYWA 3SYKA 1OKKD 1GP2A 3SZRA 4LJ9A 1QVAA 1W7AA 2IYYA 2EFHB 1Q0UA 2ATXA 2QI9C 3FMFA 3SS8A 2J0UA 4QBHA 3OIWA 3PG5A 2X77A 5IDVA 1E98A 1DADA 1HA3A 1Y63A 2GPJA 5HKKA 4DT1A 3RC8A 2DR3A 4A8JA 2PLRA 4Q9LA 4JBXA 4DLSA 3K70C 1XXHB 1BS1A 2IF0A 2BF4A 4BPRA 1BKDR 4RCYA 1E3MA 2HLDA 5CJPA 4JYCA 5FBLB 2XGJA 4GOXA 1PLKA 3B78A 2A5YB 4V0OA 3AP3A 2WPDA 3WMGA 4ZO4A 2IXFA 2B6HA 1ZM2A 5EQTA 1P75A 1N6OA 1Q1EA 2XTMA 4HZUA 1IJFA 3NH6A 1YI2B 2VHUA 5FTMA 2WICA 3EAQA 3K0AB 1UBFA 3FKSA 4UNRA 5JJIA 2CK3A 5EUQB 4IDPA 4DLRA 4MRNA 1Z22A 2IW3A 3ZYCA 1DELA 3CPJB 1G5TA 4KJZA 2FFHA 1CR1A 1NMXA 2QT1A 3TUZC 1YZLA 1CJKC 1A8PA 4M1TA 4ABYA 2HXYA 1F2UB 1SXJA 3HP1A 1T4GA 4JLNA 1J8YF 3CC2B 5DYGA 2VF8A 3K9HA 3MSXA 1SVWA 2P0EA 1I2MA 1GJRA 1E32A 1GUAA 5H68A 1KJZA 3A1SA 1TAGA 3BFXA 2KJQA 4HAVA 1VDZA 4MYUA 1R0WA 4NYIR 4DSNA 4XJXA 1IN7A 1KI9A 5K8IA 3AV0B 4CEIB 2DBYA 2CCKA 3VU9B 3HR8A 3SYLA 2ZSEA 2B21A 3QF4A 3GLIB 4HB2A 1EFRD 2HJGA 1AS0A 3REGA 4PZZA 1SVKA 4IW3B 2XZPA 1ZNZA 3RSOA 5JMTA 4LDJA 3VKGA 3Q5EA 4D82A 2PZEA 4TLEA 4A0GA 1ELOA 3AVWA 2GZDA 4HDQB 2VLIA 2QQ0A 3TVTA 3UXMA 1Z3IX 2Z0MA 4WXPA 4BFYA 2F1IA 1XMJA 2H1LA 5BQ5A 3UMFA 1M34E 2WM9B 4GBMA 3OW2B 2C03A 1LF5A 5JHHB 2ZSFA 5FI1B 3B13B 3BAFA 2ZRPA 4BFTA 1E4YA 4P4SB 5B30A 3MCAA 4U7DA 4CEJB 4WW0A 3CO5A 4AK9A 3VR2A 2CE2X 2ZSBA 3IEVA 1KC8D 2OT3B 3OJXA 4TL6A 4BECA 3DZ8A 4LJ7A 5JSZB 4JSTA 4TT3D 3NC1C 4LWZA 2VEDA 2QP4A 2RH5A 3IBGA 1KKLA 1E9RA 3CW2A 1J90A 1F60A 2GNOA 1XBTA 1QVFB 2G6BA 4LI0A 4LK2A 4QNRA 5FPHA 4C0QC 4Q4JB 3BD9A 2X2FA 2KE5A 1A2BA 1X6VA 4KYIB 4WIAA 5KSZA 4KLNA 2PJRA 2IHBA 3EZ2A 1AA9A 1GNPA 1Z08A 4Q7MB 2VP0A 4TLCA 2W83A 2XNJA 5JS8A 3MJHA 2YOGA 2IS2A 1GKIA 2BGJA 2ZAMA 4R7ZA 3QF4B 1QBKC 4OI4A 4PO8A 4IFEA 1Z2CA 1VHLA 4HZIA 3AVUA 5F98A 2PZGA 1GKYA 4JS0A 5JZVA 3VO1A 1Z8FA 2PT5A 3W3AA 3LX8A 1XNJA 2YYZA 2ZR0A 4JLKA 1P62B 3PUWA 3CPEA 1H8HA 2IYRA 1KO4A 1KZGB 4Q9IA 4BLSA 4G1VA 1UADA 1WA5A 3DL0A 2O8CB 2CCJA 3HWSA 5C4GB 3WNCA 3IQWA 3X1WA 4NL4H 1P6XA 4KVAA 3R9WA 4M0LA 4C7OB 3FKSD 1CIPA 1KK2A 2QUZA 1LW7A 3B9QA 1CNFA 3F3YA 1UKYA 2ZRFA 5EE5B 5GVRA 5B57C 2R6CA 1SVSA 4LZZA 2DFNA 1I4TD 1DAFA 2GCOA 3CH5A 2YOHA 1CNEA 1SKYB 3ADDA 2ZAOA 4LBZA 1NN1A 1TVCA 3AVYA 1G18A 3K0EA 5KSWB 1RW4A 1OIVA 4RZXA 1QZXA 1TLLA 4LYHA 2ZSDA 2JAQA 3KJEA 1G7SA 3CCEB 5FOTA 1QHXA 1E69A 3O8CA 5EE1A 2QGNA 5FPTA 1WXQA 5AJZA 2FFAA 4G1UC 1IJEA 4RD3A 2DWPA 1E64A 2YOFA 3Q8XB 1A2KC 3KUCA 5E3HA 3A8TA 3KQLA 2ZRAA 5JBQA 5JI2E 3ZZ0A 5EZ5A 4B35A 1NVVQ 4ACBA 2FE4A 3FDIA 4FXPA 3G82C 1D6JA 5D3QA 4F7WA 3ASYA 3I73A 2F43B 3U60B 5DN6D 2P65A 4P4UA 4DQKA 3U3RA 4U02A 1KDOA 3B6EA 3KQHA 2FJUA 3E20A 1JR3E 221PA 5FFMA 1NMZA 1R0ZA 2ODWA 3FMOB 3REFA 1N6PA 2B7CA 3CF6R 2C96A 2QPOA 1W4AA 1N0UA 2FOLA 2KWIA 1GL9B 4V0KA 4JLJA 3KTAB 2F55A 5CB8A 3T1TA 1R5NA 3C5HA 1Q20A 3E1SA 4XOIA 4R9UC 2QBYB 2YHSA 1U0HC 1EFHA 3AF0A 4MKGA 2R2AA 2IT1A 2XITA 3BE4A 3ZGXA 1PUIA 3EPJA 1Q3HA 3QPVA 5K8TA 1OHHD 2PT7A 2IYQA 3I4LA 5E7MA 1EP3B 4QXAA 4XWOA 2FPKA 3OFNA 2OLJA 4DSOA 3SC3A 2OFXA 2DFLA 1DEKA 1JXMA 3W9YA 1II9A 3HR7A 2ZITA 1KSFX 1XTJA 5IT5A 1NVUQ 1KMHB 4KYUA 2IL1A 4NCKA 1JJVA 4FMDB 6Q21A 1FTSA 2VHJA 5E7IA 4OHZA 1DDIA 4P33A 4PQRA 1ZNYA 2QORA 4YXWA 4BLQA 3RDPA 2VTKA 1CJMA 4B76A 4L4UA 1S4QA 1KAGA 1HE1C 1ZMXA 4IHQA 3BB1A 5FTKA 2GAOA 4ZPXA 3SE0A 5CB6A 2NO9A 4QFMA 2NIPA 2AK3A 1GSIA 4TYPA 3KUDA 4P4TA 1COWD 2OXRA 5ELXA 1YZUA 2IS6A 2VZLA 1I4DD 2GJ8A 2YWHA 4BRUA 2WJIA 1W49A 2J7PD 4IXNA 2CK3D 2V6IA 2O5VA 4DRZA 3LRPA 2O8BA 3AF3A 4D0NA 4FMBB 4YHBA 1HUQA 1SVOA 5BXQC 5JEEA 1NP6A 1NIPA 1EFCA 4OJKA 3T1OA 2PBRA 4Q00A 3RSLA 1OXTA 1KK1A 1XCPA 5DN6A 2WMOB 4G01B 2GEUA 2HDNB 2WKRA 2PX0A 2XB2A 2FMXA 3DDCA 2VNJA 1VQ7B 1FNNA 1M7GA 1VG1A 3OEEA 4O0MA 4B4DA 1Z5ZA 1QGAA 2VQSA 2ZE8A 1OB5A 1NN5A 1ZNWA 3KFVA 5A5GA 4DSTA 1P73A 2JJ1D 5KDLA 3W90A 2FU5C 4TL8A 1QRAA 3QEJA 3CZPA 3P20A 2XJ4A 2JLZA 3I62A 3LD9A 2PMDA 1U81A 1ZUNB 2VNIA 1RE0A 3VQTA 1ANKA 2AXPA 4HLQB 2AKYA 1AGPA 2IUTA 3CRMA 2RGXA 3TUIC 4MDFA 4C4PA 2VO1A 4Q1CA 1S1MA 5BN5A 4PHGA 3EIEA 2R44A 2EW1A 2ZJOA 2NZJA 1RKBA 2DFTA 2ZYUX 4GDFA 3EZ6A 4JVSB 3WMFA 4RZUA 2F43A 1KI4A 3IDQA 4UJ3A 2WWXA 3D31A 2AKAB 1YR7A 1F3OA 4DIEA 1E0KA 1K5DA 4BFZA 1E79D 1DAKA 2JLRA 3VX4A 5TB5A 4W5JA 1XF9A 4V02A 4M9XA 1M8PA 4DLXA 4F91B 3PEVA 4L16A 3CBQA 1D9XA 1VG9B 2FH5B 1R2QA 4B2LA 2GDJA 1GOTA 3NVAA 2LP6A 1QGZA 1ZP6A 4PFSA 2GJ9A 3TMKA 1XZQA 2HYIC 2WSMA 3OZVA 2CJWB 4PPGA 3L0SA 2ZJZA 5C18A 2HF9A 4CEHB 1Z0DA 3ES9A 4ZI3A 3G0HA 1P61B 3VR6A 2NPFA 3W2HA 5HE9A 5IK2D 5TXGA 1KI1A 1NY6A 1ZBDA 5CLLA 4RD6A 2R62A 2X8AA 3GJ5A 1OXXK 2G0NA 1Q22A 4LV6A 1IN6A 3DO6A 1KY3A 2MMGA 2A5FA 3SYNA 3A4LA 3QFSA 2QA4B 1GZSA 3UWOA 4CEHA 1E2FA 2WWHA 3N2EA 2PCLA 3WYFA 1RPZA 4Y9RA 1OXSC 2CJWA 1E2NA 1NMYA 1SULA 1XTSA 4ZDKA 3LA6A 4HATA 4I4LA 2EQBA 4FI3C 3G6EB 2OXCA 5B64A 2BMDA 1QHIA 3ECCA 4WZ6A 1SXJE 3QKTA 4MRSA 2REXB 2LWIA 1QG2A 3VR3A 1T91A 2CE7A 1KTVA 4LJYA 2AR7A 2YWEA 4M9ZA 1CKEA 3KX2A 4OQMA 4ZDWA 4CZ2A 4FW9A 4RVCA 1OH5A 3BBPA 4IKEA 2FZLA 2EFCB 4DCUA 3Q72A 2EWVA 3QKUA 4XH9B 3NEJA 4NCJA 3ICEA 3T5DA 4YMSA 5L3VA 2ZUDA 2B5OA 2J46A 3K09C 5KUTA 3VAAA 1O87A 4BLPA 4D4LA 4MH0R 4CGZA 2GVDC 1RIFA 2VP4A 3UANA 3OJWA 4BZQA 2H17A 1NVWQ 5AWFC 3R7WB 1G3MA 2J59A 3IEUA 2GA8A 4ITRC 4D2IA 2BOVA 4Q1DA 1XD9A 4P0TA 4URUR 4YAFA 1NBMD 4RJLA 4TMXA 4Q47A 3U7EB 5TMPA 5EP4A 1VYTA 1NVVR 821PA 2NO1A 3RRMA 1FRQA 1XXHE 5D3MA 1G3UA 1N6HA 3KXIA 2C9CA 4Q7KA 3W3ZB 1J2JA 5HCNA 3BB3A 4N3GA 4TMVA 5FL3A 4PTLA 1KOFA 4HLUA 4KFSA 4JLMA 4W5HA 5EP2A 5BN3A 3ZVLA 4L8GA 4PC7A 3PR1A 4LPKA 2ZEJA 4LBYA 5DSZA 3SN6A 1T3HA 2PEYA 1QHNA 2ZJ5A 2XXAA 4GP6A 1IN8A 4P4SA 1CJVC 5HCIA 1N0WA 3ICQB 3H2YA 1M1YE 2AK2A 1YR6A 5G41A 4K81B 4ZCLA 4L15A 2PX3A 4PXAA 1FNCA 1D1NA 1W1WA 4M53A 1TF7A 1XEXA 3NC0C 3W5JA 1U0LA 3H84A 2V1UA 4LC1A 4B74A 3PUXA 3MG9A 3LWNA 4K8OA 4XVQA 1E2DA 2OFOA 4M1MA 4EFLA 1R5BA 2QTLA 3C41J 2BBWA 1GRQA 1ZUIA 2FFQA 4ILEA 4RCZA 4LHVA 1AZSC 5EXSA 1VQNB 1NIJA 1TL7C 2XTZA 5FUXA 2JLUA 1FW6A 5DHFA 4WA7A 1F5NA 4FD2A 1CQXA 4V0NA 4C0KA 2ZXUA 4D26A 2MSEB 1Z0AA 1FMLA 1TNDA 1M74A 2EWWA 3N70A 4RZ2A 5J5CA 2XNDA 2GXAA 1BJKA 4AG5A 1EFRA 5SZIA 1E2KA 2GETA 2WBLC 4QGFA 1IY0A 3CCQB 3D7MA 1Q82D 1E9BA 3PQCA 3QF7A 1X1RA 5D3MB 1N5IA 2C8VA 4NYMQ 5EP1A 1EXMA 1W2HA 2VSOA 2RMKA 2W6ID 2V6JA
chains in the Genus database with same CATH superfamily
2BIFA 5JPDA 3LPDA 5F4MA 2H1RA 3ASQA 3CWCA 5L2ZH 4D8NA 4PC3A 1A9XB 2P3SA 1USWA 4Y71A 5A0AE 5LN1A 4ND2A 2BBOA 4XUGB 4D7AA 4MLDA 3D6MA 5FWXA 4M7OA 4JNCA 1YHQB 1GI6A 1Y82A 2Q3EA 1WTHD 1BWQA 1RP1A 3WHLA 3HV0A 2N46A 3LX6A 1CC1S 3P0RA 3SR3A 1FZTA 3QE4A 3F6UH 2I2DA 3OCJA 1ZCAA 3RARA 4QPCA 5J4HA 2C4NA 3S9BA 2DCUA 1Y3CE 2CCGA 4KRYA 1XPRA 2H5JA 3DTNA 2E48A 1ZMNA 2GCOB 3I1JA 1P1KA 1NVXQ 4CV2A 2BLVA 3D7KA 4LXUA 1EPTC 4KC0A 5HTKA 3V9AA 1G16A 4U3JA 3VM6A 4O4HB 3U1JB 1UANA 1V4NA 4MGKR 1IEXA 3DAGA 4LW8A 1YI1A 3DLTA 1Z8HA 2TYSB 2WFZA 2JGRA 1IHPA 3TG8A 1BHSA 4OATA 4RVSA 2FG5A 4YWHA 2FP3A 3Q8LA 1P33A 3D5TA 1IUOA 1L8QA 5JC1A 3M70A 5CHAC 1USUA 4EY6A 3VR5H 3TZKA 4H7FA 3P2JA 4B31A 3RIGA 1QFYA 3NBXX 1V8ZA 4I55B 1N5DA 4M1OA 4R98A 2XEXA 1JPUA 2GBIA 2QV7A 2VPPA 1T36A 1QTIA 1XTZA 1I7LA 3PRKE 5E9JA 1N2EA 1G20E 2IOYA 3BL8A 4CXMA 1NF8A 1XZEA 3ZGYA 1MABB 4JYUH 3EPPA 4THNH 3O4JA 4B2CA 1V8DA 4QOGA 4UUQA 5CEEA 1S1CA 3ZWVA 1WXRA 4EAAA 1W0KA 4KMRA 1MOPA 2FSSA 1QZ3A 4G5RA 1M0TA 2NU8B 1AZ8A 5ALGA 5KNDH 2NN3C 2BGRA 3ER8A 1F6BA 3R5FA 4MARA 4XX1A 4ZGGA 4NVRA 3PQ4A 3V7UA 2D6FA 4ZCTA 1W9XA 3A7WA 2QRVA 4RYLA 1WVGA 2VEOA 3IAUA 5JMWA 4HMOA 4QOEA 3N7AA 1NJ8A 1Z6EA 4Y8YA 3KJFA 3CLSC 1A4RA 1GI9B 2GB4A 1CYEA 3W4JA 1F8XA 1TM2A 3QUQA 4MEJA 4Z5XA 3PUYA 4UC0A 1OT5A 1ADFA 3IDZA 1WP4A 3DFFA 3SGBE 3K4PA 4AURA 3G05A 2IEIA 4JCOA 2D00A 3HDGA 1N7GA 3WGZA 4AM8A 5EMJA 4QGGA 4Y8XA 2VDJA 3KQWA 3WAJA 1W29A 2HFJA 4ABTA 5DLEA 4Y6SA 5JVDA 1TLFA 2IDJA 4MPXA 2O1SA 1FSGA 4YP6A 3AHGA 4IP0A 1S7CA 5J47A 4M36A 3SF0A 3DAOA 3PDWA 3KYCA 8MHTA 5LNK1 2ZR7A 1X77A 1FUKA 5HDQA 3O8NA 3ZHXA 2H9EH 1NM6A 4B7UA 4H17A 3DULA 5FBWB 1ZD2P 1R00A 2YY7A 1Q3TA 4L3WA 1XEXB 3A3NA 4BVEA 5I7SA 2WSLA 1R6VA 4PR0A 3O1JC 3C97A 4A5OA 4QU9A 4M8KA 3DMDA 2UZAA 4OP7A 2GZMA 4X63A 1M6WA 1C9NA 3R6WA 4B80A 1Y80A 3E91A 1GVZA 5F1OA 2NX2A 1QFMA 1QYCA 3WLHA 1E77A 2C5HA 1ST3A 3CYFA 1POWA 1I3LA 4W1QA 1RP7A 1XQ6A 3S1SA 2XVMA 2MSDB 4J0FA 2PTNA 4DHEA 4YO7A 1MAWA 3K6KA 4M0DA 4TYQA 2ECKA 2K7FA 2WSSA 2D74A 1NVDA 5MN5A 4G1FA 3E1KA 2AUMA 5ILGA 3FB4A 3PEUA 3TGJE 1W52X 2Q2QA 1XRSB 2H7YA 4PRYA 4BMOB 2C5FA 4ZT5A 3BCHA 3WK5A 2IHUA 4A0FA 1W2KH 3MLEA 1X14A 3EWNA 1XU9A 2AJDA 1JECA 4OK6A 3AB3A 1Y1RA 3PDCA 3DKKA 2PWBA 4Y2SA 3T3OA 1DIBA 3ZIDA 5L7TA 4U7JA 5JBNA 2JLBA 3Q3KA 2ZSAA 4WD3A 5KAPA 1YP9A 2OCXA 1GU7A 4ABIA 4FIDA 2RI0A 3OF5A 2XNDD 4M1QA 5JYEA 4K28A 3P4UA 4U2EA 1IXRC 2OK7A 1AUJA 3HVUA 1THGA 3RE1A 4M0CA 1YR9A 5KCZA 1T4UH 2RA0A 1OS8A 3MINA 3BNWA 1UTNA 1NVBA 2YKGA 4J0KA 4YOJA 3EX7C 1B14A 3EZFA 3RS4A 2NPIA 1OPXA 1UBOS 1K8XB 2AQIA 4HEHA 1X94A 1VE7A 1WDTA 1XLTA 2ZU0C 4B4VA 1DBPA 1KERA 1QTNA 1VLQA 1P10A 1UXJA 4HD8A 4MPTA 3G01A 1Z38A 5EUCA 1QB9A 3N5CA 2PT6A 3ZY6A 4BFXA 3AL2A 5F35A 2FWMX 4CT5A 2D5IA 2CHEA 3GRVA 5EQDA 3WO1A 4EZBA 4ZCPA 1MV8A 3IPCA 3WYEA 3L84A 1J00A 1E35B 1GL6A 2DG2A 3K4QA 4DMHA 4UASA 1M2EA 1SEVA 2EX0A 1G2IA 4JJKA 4V39A 4AICA 3I8OA 2QTAA 4G0XA 3SUDA 1PTJC 2ZPRA 5BSRA 4EATA 1KO5A 3T0GA 1XLVA 4R4JA 3U8TH 4MV9A 2D1TA 3R7LA 4QVIA 2PX4A 5IN5A 5DRTA 4FOLA 1GDHA 1WSAA 4WKGA 3RHFA 1BVRA 3GW8A 2ASVA 4QDTA 4B3HA 2IUUA 1O5FH 2ANCA 5KTRA 3E7FA 4DNOA 4NZMA 4DCCA 3FCOA 1E0AA 5BSGA 2C4VA 1HZEA 5B37A 5HIIA 5UKDA 3Q3IA 5E9QA 1MIHA 2VVUA 5CDFA 2Z09A 1AX9A 4ARAA 1G3RA 1W30A 1NBWB 1O2WA 1ZI6A 2JFQA 4ZN6A 1E5TA 3SOPA 1QVWA 1ZPDA 4U0JA 5CD9A 3ORQA 3HZRA 4WJKB 4JB0A 5HZGA 2K1QA 1Z6ZA 4ZARA 1EK6A 5NULA 4RIEA 4X7CA 4E7OA 1DPGA 1CS4C 1USKA 3VSCA 1E20A 3MMZA 3BICA 2F6RA 3C8ZA 1G59A 4P84A 4X07A 1WBGB 4HQ0A 1TEVA 1GIAA 4IGDA 1BCSA 1P2BA 3P7MA 4RGVA 5C67A 1T5DX 3N2IA 4GMXA 3SM3A 3V8BA 3FUUA 5TJ9A 5K0TA 1NQWA 3LLCA 4CRCA 2LP4Y 1C4OA 3A4YA 5AKYA 2D4HA 3DPSA 3PITA 1DTWB 1HJ9A 3U37A 1A5HA 5HXFA 3MH4A 2AFHB 3ZEIA 1EFPA 3F1LA 2GN0A 3EC1A 4XNFA 4HPJB 4QPNA 4ZYVA 2ODAA 4Z2YA 5COBA 1NZFA 2QN8A 3KOYA 1GJAB 1FDRA 3D6UA 2OMEA 1N8RD 4HQRA 2QWXA 3HB0A 3GX1A 5DHRA 3A6PC 3AU9A 4MDHA 1D2GA 1M0EA 2WHQA 2AFIE 3R9KA 3QVLA 1JH8A 1USIA 4M9FA 4NSVA 4EF5A 1VPVA 2PKQP 5I9BA 2VQ3A 1MQ9A 1UWCA 1XDZA 4IIEA 4PG5A 1E7SA 3V33A 1GNSA 1L8OA 4PZ0A 5G1OA 2CDNA 3AK5A 4FVTA 4UUNA 4RD0A 3R7WA 3ZXIA 5JCJD 1S3GA 3DVSX 1MO5A 2BDCA 3QTTA 5EE9A 3T99A 1SKQA 3QLJA 3FNFA 3UAYA 3TM5A 4B44A 4QFDA 3KYFA 2G9VA 4B3DA 3QEKA 3QZUA 5C52B 5H80A 3CNQS 2NU6B 3BMQB 1QBNA 3PL5A 5CFPA 4DIIH 4OHWA 3DEFA 1H8ED 3TK9A 4RKFA 3JZAA 4RD1A 4OQLA 2QTFA 3M5DA 3ZIAA 4DXDA 4XLFA 1YDMA 1KJ8A 2D54A 5KQLA 3HU1A 1QK5A 2LTAA 1ZIOA 3UV6A 5KB3A 5FV4A 1SCIA 2JA1A 1QE0A 1Z82A 1ISHA 2BDIA 4I50B 4Y10E 4AQYB 4KQ1A 4GOKA 1L7DA 2B4YA 3FXAA 4G5OA 5H4GA 3ANTA 3B9BA 4ESOA 2IKQA 4PICA 5JQWA 4E11A 2E87A 4EJ6A 4LYJA 5LA6F 2R60A 1MAUA 3ACBA 2ECOA 3ZUGA 2Z5VA 3JATA 2W37A 3ZJYA 2QTVB 5DNUA 3X2FA 3I1IA 1G3IA 1ID8A 3I5MA 1MKWH 2G7MC 1CUUA 1I7PA 1DOHA 3T1YB 5A8AA 2PSEA 3DGFC 1KYIA 2W5UA 4KSCA 4WWYA 2WUEA 1EE1A 1V1RB 2PSHA 4J91A 5JLAA 3TI9A 2HQBA 2G52A 1VQ4B 1EG2A 4UBNA 3KSRA 1GVLA 5AI8A 3OY5U 3HKEA 4JBYA 3Q40A 1U2EA 4KVZA 4I66A 2NVUA 2CT8A 2VAPA 3ZOZA 1G3BA 4RL4A 2HIHA 1INCA 4X66B 1E9VA 3OQIB 1YS4A 3KV3O 4XIGS 1UTPA 3E7DA 2VDMB 4HE5A 1HLPA 2Y1DA 1ZYUA 2BH2A 4X7EA 4A7IB 3SF8B 4MNYA 3GJ3A 4L2IA 1RLMA 4WOBA 2NZXA 4RFVA 1SOWA 1ECFA 3HPRA 3NZIA 4LC0A 4ERXA 5ALIA 1J7KA 3IAM1 1EJ2A 3GZNA 3M7IA 4JLPA 5ES3A 3ZV3A 4U30A 2FR8A 3ZCUA 5AK5A 2ZWMA 3N39C 2AYXA 2PGNA 2I4LA 4KXNA 2Z8ZA 2HHCA 5GPIB 1WTGH 5KQSA 1P2QA 3RABA 1XVMA 3BXGA 5IUKC 1K8RA 4MTLA 4DSZA 4D9BA 1EVIA 5BN5B 1NM5A 3DCNA 3EFOB 1LU9A 4F9EA 4JT8A 4IGKA 1BXGB 1L4DA 2WUCA 3CUWA 5ARCA 1Y3UA 1ZKMA 4F3YA 3FZDA 1LI4A 2DX7A 5JIBA 3Q7SA 4ZQCB 3PIDA 3SWWA 3B6MA 1DAPA 5SY4A 1XLTC 3NNSA 2C2MA 4ZYXA 1X8JA 3N2ZB 1CJUC 2UWOA 2BGGA 1HE4A 1MH9A 1ZD1A 2C8XB 3N8HA 1N6XA 2CLLB 1BS2A 1A4XA 3ZHOA 2NNLD 4KGAA 1UBSB 3T41A 2X0NA 4OD0A 2FIRH 4I8JA 1O4VA 4XVRA 2AEEA 2X4IA 2IW1A 5L3SA 1Q1NA 1SB9A 1NSYA 2V0NA 4ZPJA 5JPCA 1C5WB 3NPSA 3IR5A 1YZKA 3OQIA 4RY9A 4HN2A 1VCOA 3WHKA 1H0SA 3K5IA 1NC3A 1PSDA 4RABA 2A2XH 1ZC4A 1ZGVA 5D3KA 1QB6A 3QUSA 4KKTA 3V32A 2JLSA 1L4MA 4JA2A 2VHTA 3K35A 1GG6C 3TQTA 1LC0A 3V3TA 2JI9A 3SQWA 4OCZA 1BCRB 4C0SA 1SD2A 2VJYA 3A4NA 1CO7E 3BDAA 2MJLA 2ODTX 2GZ7A 5PNTA 4MYCA 3NAQA 1HRDA 1CULC 1VCWA 1PYTD 1Z4LA 4QBGB 1L5OA 1T8WA 3M1YA 1ZQ1A 1G9TA 5TV2A 1LWOA 1X7XB 3LC1O 4G5FA 4QTZA 1HSOA 4Z4VA 4Q02A 4KQFA 5F5XA 2CLKB 3FWYA 3ROXA 1I3NA 2ABWA 1CEEA 1PG5A 2DF8A 2XF2A 1W19A 3CZ9A 4R3WA 2TBSA 1SC8U 2V3CC 2OXIA 4IIJA 3U7FB 1DUEA 3GWZA 4I1UA 1DKLA 2RAVA 4MI9A 5DTRA 2VDNB 1WHSB 5LWQA 4L4SA 3DUFA 4RTRA 1NNEA 1B8VA 2PQ2A 3BJZA 1X1EA 2L82A 2XTTB 5BPEA 3CEPB 1NRKA 3QUBA 3K70D 4KUGA 1K1EA 2AMVA 4EFMA 3BTDE 2V4DA 1GT6A 2PPLA 4HNUA 4ZVOA 5HBGA 2O59A 3GL9A 1HEIA 3AXTA 2W58A 4QEZA 3PBKA 4ZAFA 4EB6B 3ER9A 2ZIAA 3DQQA 4XUDA 1ANEA 3MRSA 4NCYA 2H0QA 3B6ZA 2QI9F 1HAOH 3BF8A 5KNBD 1IY1A 4PX2A 5AM1A 1TA2A 1E1QA 3K73O 1Z0UA 3PF8A 4S1PA 4MO9A 2QRUA 3KC2A 3BQJA 1PHPA 4IX9A 4MVCA 1SPBS 5KNDA 5BNIA 1LH0A 1GGDC 1KYQA 2ZYRA 1UWLA 4ADSG 2XRFA 2PLAA 3D3KA 3FD8A 5J1SB 1C8KA 1KDVA 3WLRA 1AB9B 3PG5A 3OKAA 4MUIA 3O4FA 2ZVDA 4X44A 5HSGA 1PGJA 1W73A 1SHLA 2WPDA 1SJ9A 1CE5A 4ZI7F 4KBYA 3OZTA 4HZUA 2STBE 1ZLYA 3UENA 3UK1A 4BOYA 5G0WA 3DG9A 4DLRA 5L4SA 3N7DA 1A8PA 2X14A 5FNZA 3WL3A 5DEIA 1SXJA 1EP5A 3FG9A 1J8YF 3EXFB 2ZXHA 2P0EA 2O3TA 3A1SA 1GLGA 3TTSA 5A9SB 2OUAA 4CEIB 2DBYA 1FLEE 3U98H 1SG6A 3AUUA 4NMHA 3NQ41 4ABEA 4H15A 5JMTA 3DFMA 5KI6A 4TLEA 2VLIA 3DAPA 4BMNA 4GC5A 3CQ9A 1T6BY 4R0MA 1IQFA 2SGDE 4Q82A 4DTIA 4I33A 3HCCA 1MC1A 2AG1A 3K9QO 5H4HA 1QBVH 4CEJB 2AI3A 4OQZA 4TL6A 1BPLA 3ELUA 1AY6H 1BCUH 1HYLA 3IBGA 4ENVA 2FF5A 1Q0LA 2I62A 1EM8A 1UK8A 3ZY2A 1JHUA 1D0SA 2J9ZB 2NNWB 3SQOA 1GNPA 4CM9D 3CEJA 2CB0A 2KCYA 4QO7A 4BAQB 1PQ8A 3AVUA 2F83A 1YE5A 2RONA 4NV3A 2ZR0A 2JFHA 4MXDA 2VAXA 4ABAA 4CKZA 1SD5A 1ZK2A 1TA4A 4QNNA 1TFXA 5HKBA 1GUYA 1PJZA 4DV1B 5DX0A 4ZANA 4RXTA 3TF5A 3I9JA 3AVYA 1DWDH 4OQYA 1KH1A 3R0ZA 1QZXA 1TLLA 2ZRQA 3CCEB 1QHXA 4G4IA 4G0PA 1PK7A 3PFWO 4IILA 1X70A 3L7BA 2DR0A 4O3FA 1E64A 2YOFA 2I4MA 2W6NA 1SUFA 5JBQA 4U39A 4A6LA 1Z37A 5CH3A 4DQKA 1RC0A 1TYAE 3UJ6A 2VJJA 3KOZA 4HG6A 1ADYA 3N2KA 2ODWA 3EVTA 3AFMA 3U9LA 3I2JA 2L17A 2KWIA 3RU4E 4IGFA 3KTAB 5GINE 1RXEA 3N3BC 5A3SA 3T4UA 4R9UC 1HDGO 1UD3A 3DLCA 1PW7A 4YBZA 3I4FA 1SHUX 5JJBA 4BVHA 5BW6B 5KKNB 2R96A 4EM6A 3EVNA 3GPIA 3ODGA 4TY6A 1I7NA 3CNBA 3A1CA 5ELMA 4BNHA 1E61A 2ZBDA 5J5VA 4FUGA 3HRHA 4IXNA 4QUIA 5ALVA 1B7GO 1QLHA 3H2ZA 2R8XA 3T1OA 4AVYA 3EULA 3E90B 4JBGA 2VPZA 2JZOA 2FMXA 1YT5A 2WNHA 3IYLW 4RLSA 3RVNA 2GHQA 1MAAA 1E3JA 4UE2A 1L8LA 3HCOA 3ONVA 1BHXB 3EODA 3MB5A 4PRKA 2AXQA 5CMLA 2AKYA 4MROA 1W85A 2HQ1A 4Z4RA 1HQDA 2R44A 4KQ9A 1RKBA 5IM4F 1KI4A 5D7NA 3D31A 3QU5A 3SV9A 2R7NA 1SLWB 4NFSA 4YROA 4W5JA 2ATEA 2FH5B 3MCZA 1QGZA 1PPFE 5EVJA 4A26A 3INNA 3KM0A 1SXIA 5DK4A 5I7EA 3KZVA 2Q6OA 4V0SA 3W2HA 5HE9A 1FFDA 2WHRA 3QNWA 3BJRA 5I4IA 1KY3A 1EHIA 2JCYA 3DMGA 3DA9B 5E6TA 1JU9A 1MD8A 1ZIYA 3LA6A 1N78A 3FUXA 4NESA 1WTCA 4BL5A 3SLRA 3NEJA 5LQCA 3TOXA 1C50A 3PRJA 4LAFA 3QGNB 3DDHA 2PIDA 3ONDA 3JAWA 4RACA 3CP2A 4F9GA 3NJ4A 5BW5A 3VAZA 3C7AA 5A9TA 5ALWA 13PKA 4G09A 3WGIA 1Z4JA 2C8LA 5D87A 1E2DA 3ZHTA 3FCEA 2WLSA 1VQNB 1TJYA 3I4CA 2QL7A 2YVAA 4OPMA 1Z0AA 4ER5A 3N70A 2GETA 4KZKA 1IY0A 3T0FA 1KHHA 1X87A 2LDBA 3G89A 3TNJA 2V3OH 2DULA 3M4NA 1VIDA 4C01A 2ZGBH 3H4MA 3OC6A 2R9PA 1T1SA 1U65A 3T3MB 4FOTA 2VPYA 1SGEE 3K0AA 1HDTH 2IYLD 1G30B 4MV8A 5HIMA 5AJYA 4X45A 2N1BA 3KQTA 4NJEA 2PSSA 4PSKA 3LDHA 1YH3A 1W0KD 5FORA 1O0BA 1FZQA 3NTXA 4HYTA 1O36A 1L7BA 2OAQ1 1JVBA 2PQ6A 1T8PA 3MH7A 3SBEA 1YKFA 2HVYB 8ATCA 1TCVA 2NPOA 1DV2A 1ZM7A 2YQZA 1VPTA 4JXJA 3SQEE 3ESZA 3PR3A 3PUMA 4GCHG 1V2QT 1II8B 1WDWB 4X06A 1C8LA 1O2LA 2Q1YA 2R68A 3LGAA 3T5GA 1C5PA 1F1BA 3MMGA 4JEMA 3OLXA 4BAZA 3RSHA 4KP0A 1M34B 4YO9A 4MVJI 5GMOA 4WZBA 3L8GA 4ECEA 3PA8A 1JR3A 3UFBA 3QX3A 1SGCA 4P7JA 4OG2A 4BNGA 5EGMA 4R2HA 1G3EA 3TZHA 5F78A 4NWIA 3DMYA 1UQRA 3JQ6A 2W4QA 5BR1A 2XNCA 4GGOA 1A3BH 5HNKA 2V4ZA 3U4MA 3GPCA 4H7PA 1V1RA 4HAUA 3RTEA 1JHDA 2BQWB 1NLFA 3A7VA 1WPRA 1J23A 3WKDA 4MS4A 4JP1A 1JR3D 4TMFA 5FPQA 3PA1A 1QV6A 4N0MA 4OUDA 3RASA 4BEWA 2ZSIA 4C6SA 2HQOA 3KAJA 1N2CB 1O0CA 3ENNA 1MXHA 1I2BA 2AFHA 2ODNA 4U7WA 3EAFA 4J1SA 4Z3KA 5JROA 2ZYSA 4UFPA 3H8VA 6PFKA 3M6LA 3G02A 1XWIA 4FGKA 4E4RA 4PZEA 4R3NA 5B2EA 3ENSB 3U26A 4DN6A 1RGQA 5A5FA 5LB4A 2XDYA 2PH7A 1MHTA 2W8BA 3H6KA 3TBHA 1F6DA 4MRRA 2XNKA 1UKZA 1P12E 2GMTB 1Y3BE 3E82A 5KQPA 3IQZA 2QTGA 4IJKA 4MP8A 1B76A 5E9WA 1R0XA 4FFNA 3OJ0A 4S2EA 1V8BA 4I32A 4HRYA 1BGXT 5F64A 2FUEA 1ZSLA 1KLTA 3DZDA 4QGBA 4FQ7A 1ADGA 3HI6A 3M35A 1OAOA 2JKVA 3BRWA 1QP7A 3TX2A 4NGAH 1OBVA 4KIWA 2ZGJA 2IITA 4A92A 4NOJA 4RT1A 3R3ZA 3OPVA 4NSNA 4C4XA 3NRLA 1TYNA 2YS6A 3A1DA 4JYMA 5DM4A 2BDTA 3SNHA 4TLMB 3OM1A 5BYAA 3RDZA 5MHTA 2HSDA 4ZALA 3STVA 2FEAA 2PFEA 3LLVA 3WGNA 1KY4A 3I45A 4L8WB 3TLCA 5TMEA 2JARA 2ZI4A 4D97A 3ZZ7A 2Q3DA 4S2UA 2VZEA 1O2IA 2BDEA 2DHRA 3GNLA 3NBAA 2NLOA 2ONJA 4IS5A 4Y6QA 2CXHA 2AMLA 4WXRA 2PV0A 3T7IA 5A4JA 4JQZA 1Q9SA 2RGNA 3HJHA 4JT2A 4TMKA 3NKKA 3B7PA 2OQVA 3T5BA 4HDCA 5HFNA 1V7QA 2VJMA 2P9FA 1M2HA 1VM6A 1SGRE 3ETEA 2NU9B 3L0YA 3RM3A 1PR2A 3NWBA 3RVDA 1E7WA 5KJCA 2VT6A 1S72B 3R5XA 2YJ6A 1BEUB 2EYUA 1WPQA 4Q9NA 4ZP1A 2C9DA 1LDBA 4QQKA 3IPYA 3LXXA 4R1UA 1NRJB 1QRZA 1LDNA 4LKOA 2QTNA 3QLEA 4L22A 1D8TA 1BN7A 2O2XA 1M76A 1W94A 3VOAA 2ZP1A 2GAJA 3ENZA 4TLBA 3T3GA 2HOBA 2J3KA 2ZAYA 2IP2A 1B0FA 3EK2A 4EA9A 1PJ5A 3EH1A 1P17A 4KKXB 3F2VA 3V3KA 1X2EA 4ZZ2A 3AGQA 4Q80A 2YJTD 3A88A 1A2CH 3H4VA 4CG3A 3FOZA 2V9ZA 3EXG2 1C81A 1Q7GA 5FPSA 4RJKA 4UAGA 1BTXA 1VLMA 3KOOA 5EPEA 4L51A 4PSAA 2XY4A 1M33A 3CTMA 2UAGA 1XR3A 5DHTA 3CD6B 5E0GA 4BP1A 2OHOA 3WBFA 3H6GA 4A10A 1A27A 3F6YA 3T35A 4QREA 5P21A 2PMCA 1WXXA 4A3SA 5K51A 2Z9BA 2QM8A 4PZLA 3L93A 1D1SA 1XQBA 1P19A 5JNRA 4E70A 3TQIA 4FYXA 1EASA 1V45E 4PPYA 1I30A 1N32B 4G5GA 5AI0A 3KHTA 3T4EA 1X0XA 5DBGA 1FPMA 3WYDA 1XCBA 4PVCA 4BNNA 2P5SA 3HKDA 2G1AA 3MBKA 1FFEA 2CUTA 1JT2A 4TYDA 2ECFA 3LLMA 4PGGA 4PCAA 4P35A 5LZ9A 4C2TA 1KTTB 2LIPA 1LBHA 3TYXA 4GKJB 4DDHA 4E51A 1M2OB 3JZMA 4Q3BA 3PTAA 4PZ9A 5HJ2A 2OK5A 2R8BA 3P26A 2WC1A 5BW4A 4M76B 2UUYA 1UBEA 2Z9CA 1E8MA 3V8VA 2C7QA 3F6BX 4FGLA 2XT0A 4PW0A 2HBYA 1UM8A 3ED1A 2GP9B 2XYPA 1NX6A 1GHAG 4IRXA 1PVDA 4B5KA 5GV7A 4KUHA 4PF1A 1OW3B 3DLPX 3EVBA 3BHIA 1NQ5A 1VKZA 3BUSA 2DWCA 3UVEA 5JBCS 1M5RA 1KMQA 4QUDA 4GWLA 3PGJA 1TGBA 2ZQ1A 3L1KA 1GWAA 3JR3A 3N07A 3ICVA 2XXLA 2XUOA 1R4MB 4YMLA 2G4UA 1KKMA 3MWIU 2IBMA 5A3RA 2B4QA 4BJHB 1Z56C 1G64A 3PKZA 1KWGA 3PPVA 2EKPA 4MWZA 2BHGA 3VPXA 3SYJA 2BLOA 4JGGA 3PHIA 3LDAA 3BD6A 2ZDGA 5JPMH 3GUUA 1G7RA 4MIEA 1GZUA 1JR4A 4BAMB 2Z30A 5B6IA 3QK7A 2Q1JA 4KIFA 4P7KA 1ZUWA 3ICWA 3F98A 3GFTA 1I24A 4OFBA 2AUTA 1M66A 2L0XA 4JUFA 2R6R1 5GONF 2DHQA 1KOLA 1KI2A 2UVQA 3LTEA 3M3PA 3VH3A 2IVZA 3IVAA 2X8JB 2C04A 4I19A 3SC2A 3GY7A 1E7RA 2OO7A 3P9RA 4C7MA 1ZRKA 3B53X 4YRNA 3H19A 1HGTH 3MCVA 1UFKA 2B5TB 3HGPA 1YK1A 2I4IA 3IULA 5C1UA 4OREX 1SGNE 2GMWA 2ZK7A 2YVKA 2YWGA 1OTYA 3DONA 4CEIA 2OHXA 2QTZA 2PX6A 4HDSB 4NBUA 3LQQA 2X6YA 2Q6LA 5LH8A 3C43A 1PFQA 5C2JB 1ETTH 2Y5FA 1Z7BA 4QJ4A 4MGYR 2UYCA 1K2I1 1GJ5H 2GA9A 4OFWA 2BMFA 2GX6A 3EVFA 4EFDA 1JHRA 2M5TA 3R9IA 1DXHA 2I6TA 2R86A 4ZVUA 4AY4A 5HS6A 4NDZA 2I71A 2J9NA 1XYVA 2AFQB 1XV5A 5AM2A 2CXPA 1TVKA 1Y89A 4WSOA 3PUHA 1JWLA 2YW9A 3A9SA 3RXLA 3C14C 4AJ9A 5DP6A 1UJ6A 4UEKA 3LIWA 2R1UA 2VCHA 4WLEA 4P22A 1C0LA 3AHCA 4QX6A 2J5XA 2ZM5A 4WZAB 1GL7A 3LUPA 4YEDA 3V13A 1KMMA 1PJCA 2OXSA 2Z58A 4GT1A 2C00A 2KS6A 3ZZ6A 2QQ5A 4LFBB 3RSZA 4X1YA 1VITG 3COSA 1R6TA 3Q6QA 5TCCA 4FFBA 2Y68A 4DM7A 2WP8J 3D3QA 1Y48E 2XE8A 3NJRA 1FLNA 4G6IA 2JI4A 3CCJB 3PLRA 3V1UA 3Q8MA 1GA6A 2XCLA 4JAVC 1GJ9B 1N1EA 1XVUA 1KF0A 1AG9A 4M8SA 1GPAA 2XLBA 2ANWA 3V55A 2YMPA 4DDKA 2X6QA 3ATLA 5IDWA 3VPAA 4OQPA 1PQ4A 1Z5UA 4W7IA 3ETDA 5C37A 3A7TA 1OWHA 2O7RA 5MN4A 4JOQA 3H5TA 5HRUA 4YT6H 1QL9A 3EC7A 4PVDA 4B2IA 4TM8A 2P6UA 4XQGA 4M9CA 3EDRA 5FBHA 4E22A 4DVJA 5B1HA 1J2EA 1JDSA 1TD1A 5CGQB 1TLDA 3LC5A 1O2JA 4XR4A 2GD0A 2PX8A 4YJKA 2Q6GA 3E58A 2O50A 4M54A 5LZ8A 1UPTA 5B3AA 3K0CC 3FDZA 2Q49A 3UXHA 4B2BA 1O2SA 1YZGA 1HNZB 1EK0A 1XFAA 3HPTB 4HHEA 4ZQFA 1DZ3A 3UQZA 1CVIA 2DTXA 3AWIA 3DFUA 5AXDA 1I0ZA 1UPBA 2ZUWA 4JI2B 1CBUA 1JA0A 4IQFA 1H5QA 1AWFH 3D3WA 1PT7A 1O3EA 4NULA 4EZEA 4GZLA 2IP1A 1V6SA 1RBYA 3LECA 5T3UA 2QMQA 2VSFA 5JAOA 4NEHB 5FD8A 3HFGA 4P2BA 4R69A 2MR5A 1HAPH 1FFWA 4DCPA 4PSVA 2YDYA 3IEXA 2ZT5A 2POCA 5KVVA 3JALA 2OD3B 3KWFA 4E6PA 2I4TA 4MWDA 5LR6A 4CRGA 2QR3A 2GVFA 1QQAA 2J32A 3ZNQA 3PTZA 1BBRE 2C59A 1E4EA 2XXJA 2ADOA 3IEMA 4JSRA 3OPXA 1YZVA 1DXYA 2DZDA 2E18A 3H0KA 1HYBA 3EUFA 3IBCA 1LDGA 1IFXA 2ISQA 1QU3A 4RZ3A 4BLWA 4ZZ3A 4TMWA 2AOUA 2VBFA 2BMVA 2ZCVA 3KOMA 4W8OA 3GZNB 3ZGZA 3IBFA 4R2IA 1HT3A 3BTME 4HUQB 1ZRHA 3WVNA 1JQLB 2EKLA 1QTFA 4PYJA 1RSZA 3UZUA 3UC5A 4G9GA 4RFSB 5E7JA 3ND8A 3T1HB 3IPXA 3LGUA 1C5NH 3KKMA 4ZKNU 4JU9A 2ZUTA 4G5YA 5DHUA 1NVAA 2NU8A 2C5GA 1U04A 4REMA 2A0FA 1RJEA 4YY3B 2B83A 4P02A 4YJ2F 3VSBA 2PS1A 4MQMA 1FFAA 4FOSA 1O3LA 1GYPA 1N1DA 2X76A 1O3CA 2C93B 4IOKA 4PABA 2P9HA 5FJIA 3LRXA 4GVXA 3Q85A 2FW1A 3CX8A 2JANA 1TVMA 1CD5A 3KZKA 4IFIA 2E6KA 1QWSA 5TEWA 2QSUA 3GOHA 1C2TA 1Q74A 3EUEA 4RPIA 2HWWA 4PE5B 4I31A 3C3WA 3BL5A 3GY3A 3EG9A 1OX6A 3JQ8B 1O3BA 2OHFA 2CDAA 3BULA 4YOGA 5JBBS 5J4VA 2CLHB 3OETA 4F93B 4KPUB 1Z39A 4IYRA 3A3KA 4ZU3A 4EBFA 3UIEA 4MTBA 3ZC3A 4K6HA 4Q6BA 2QOEA 5E6UB 4Q39A 3HABA 2GD6A 2GJSA 4FHEA 4JZYA 4UM7A 2I7CA 1W25A 5CTJA 1XYYA 4H1HA 4QQRA 1QPBA 3MQKC 1CS0B 1X8LA 3FA2A 1OXUA 1OKKD 3MXTA 2V97A 1PV1A 2J0UA 3S1LA 4JI4B 2PLRA 2V65A 4KH1A 4RCYA 3GFQA 3RUIA 3PLAE 2GDDA 4ZO4A 2OLGA 3RYFA 3R5SA 1HIAB 4UFEH 3EAQA 3OVMA 3DHVA 4WKPA 4LRXA 1VPDA 4K9QA 2QG4A 3ZYCA 1G5TA 2PBLA 4DAOA 3CVJA 1TZJA 4BB9A 4RM3A 4O4JF 5K2MA 1R0WA 3KSUA 2BFFA 1KI9A 2HCRA 1AB6A 4HB2A 4L72A 2BFWA 1QGUA 4LDJA 4S04A 4QVJA 3JWJA 1DRJA 2KX7A 2O06A 2FW8A 3RU7A 2HQSA 3OEYA 5FI1B 2ZZGA 2J4FA 4X1SU 2OHJA 4WBXC 1H94A 4AK9A 1RPTA 1X92A 3EY4A 1P80A 1B0ZA 3VNBA 3FY4A 2CJYA 3RIXA 3EVDA 2XT6A 1VIMA 2HU7A 4BRSA 2PRKA 1QVFB 1M1NB 2VPIA 1A2BA 5BURA 3AU8A 3RTDA 3EZ2A 1EZ4A 2RGUA 1J97A 3DE1X 3SS9X 4HCJA 1R6UA 4E2XA 2B1JA 3U7QA 4OI4A 2C7RA 4X1IB 1Z2CA 4V2IA 4O0LA 1E5VA 3UNQA 3B6KA 2OC4A 3PNQA 4DRXA 2I4RA 5AKLA 4WERA 4I50F 2W7UA 3EXHA 4TXLA 3SJUA