4ACBA

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
469
structure length
448
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEITIDIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
molecule keywords TRANSLATION ELONGATION FACTOR SELB
total genus 97
structure length 448
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acbA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acbA01
2YWHA 1P9NA 1XTQA 2BSAA 2FPLA 2GZHA 1W36D 2JJ8A 4RSGA 3GCGA 3TR0A 3G71B 3HWSA 3Q5EA 2O8BB 5DE3A 5EUMA 4ARZB 4LJYA 3QENA 4M9ZA 4URWR 5AN9A 1W0JD 4JL6A 2JA1A 1Q1BA 4W5WA 2BDTA 4A0GA 4LPKA 3EPLA 2Q9BA 5AUNB 4MA4A 2O8CB 1XD8A 5JJKA 4BFYA 4MRSA 3FMPB 4CT4B 3IQXA 1GAJA 5C2JB 4URXR 3ADBA 4C7OA 5FA6A 2JJ1D 4B6EA 2QMHA 3I32A 2ZAOA 2O0HA 3U44A 2BMDA 4P33A 1AK2A 2KE5A 1EX6A 1HURA 3W2FA 1XMVA 2HT1A 3TUJC 2ZI4A 2RC5A 3GLGA 5LD2B 1LV7A 3OJXA 1KMQA 2W00A 1Z29A 3OE7D 1KAOA 4GP7A 2ZR7A 3R9WA 5KDOA 1SHZA 1UAAA 2PLRA 4EJSA 4DBLC 5K8UA 4AKEA 3TUIC 4RD3A 2OXRA 1OH5A 1UMKA 2W6JA 2QMOA 3T12A 3T06B 1E2PA 4OJKA 3OIUA 1GRQA 3ZZTA 1U9IC 1RVDA 3U7EB 3C5CA 3FMOB 2X77A 3SOPA 1E1RA 3FOZA 4IOMA 2IWHA 3KX2A 1FRNA 2ANCA 2F3TA 2JDID 3EZFA 1YRAA 2GEUA 2QUZA 2OLJA 1E69A 3A36A 1AM4D 4YMWA 1ZVQA 4KO8A 1DAFA 3U7GA 4NYJQ 2OAP1 2P3SA 1M7BA 2DFTA 2ZITA 2DFKB 2XOKA 1O87A 4TT3A 1ZNXA 1J8MF 1N2CE 1YHNA 1NLZA 5FTNA 2LP6A 1QGYA 4I1UA 2Z4RA 4CW7A 1NIJA 3TIFA 3E1YE 1JR3D 4M1KA 3A4NA 5EP1A 5B58C 1G3MA 2QL6A 4XWAA 5C18A 1AS0A 4Q9JA 3CCSB 2QN6A 1FNMA 4WW0A 2Q3MA 3NWJA 4E07A 3N2EA 3EPHA 5KTYA 2Q9CA 3BORA 3HYRA 1OPXA 4BQSA 1FZQA 3Q8XB 3NHAA 1G7SA 1GL9B 2DWPA 3T15A 1H8HD 2GEVA 3FE2A 1GKIA 5HZKA 3VKWA 2GBLA 2QQEA 3E5HA 5EQTA 3OW2B 4Q9IA 1DO0A 4WZ6A 5FUXA 1YQTA 4GOKA 4HAUA 2FU5C 1F20A 2JGNA 1VIYA 4Y0AA 3B2EA 1OT3A 1Z83A 3FPAA 2ZSDA 4LHZA 1CJVC 4DVGA 1KSJA 1E1RD 1FMJA 1KO1A 1JAHA 1N6LA 1SKYB 1JJ2B 4IDHA 3TNFA 4DCTA 3K09A 4BWYA 1XCPA 1XE1A 1GSIA 5EP3A 1Q20A 3AF3A 4E22A 3QKSB 1XPRA 4DCUA 2D2FA 1NRJB 4Q4JB 2ZI5A 3EA0A 1Z2AA 1EXMA 4EPXA 2JLZA 1GZSA 1TEVA 3MJRA 3X1ZA 2ZRAA 3REFA 2CRVA 4XTRA 1JA0A 2MSDB 3WHLA 4OL0A 5FBQB 2DFNA 4LHWA 4N0DA 1AGRA 4Q7LA 2WOJA 3S1AA 4HUQA 5AJYA 2F1RA 4Q4HB 2DYKA 1WE2A 5C4GB 1U9IA 2BHRA 3TH5A 1DAMA 1XXHB 2VQSA 5KSPA 3L43A 2VYQA 1GWNA 1MR3F 3I5XA 1R0YA 5KSYA 1RRCA 2CE2X 3JQQA 2CHGA 1KY2A 4NYIR 4OHYA 2ODWA 1FNBA 1BH2A 1E2GA 1G7TA 1P9WA 2H5EA 2HF9A 2QP9X 4KVGA 4M22A 5F9FA 2ZRGA 3BRWD 2J0UB 4M1MA 3GLGB 3LLUA 1IXSB 3O8RA 4AYWA 1YRBA 1L4UA 2GCOA 1NKSA 1P2SA 3WYFA 2FWRA 721PA 3CCMB 4AY2A 1CLUA 1MKYA 5CLLA 3AKCA 4I1SA 1EFRD 2ZRPA 3GEEA 2FX3A 4O25A 4D0GA 1EWQA 1A2BA 4J0QA 1GKUB 4QM6A 1TADA 3QF7A 4JSYA 2AD1A 4LYJA 5FH9A 1MRSA 2DWOA 1ZM9A 4M0LA 5FTLA 3MHPA 3AKEA 1U0HC 3FVQA 3QQ5A 3UMFA 1L7VC 1WBBA 1WCV1 3IILA 4POAA 1UKZA 4A2QA 4DHEA 2IYYA 2B21A 5BN5A 1XMIA 4LUCA 3QBTA 2HCBA 3QNUA 3KFXA 4GP6A 4EPYA 1E98A 4YALA 1DBSA 1VHTA 4FD2A 4IDOA 4NCHA 2ZI6A 1G18A 1XF9A 1L8QA 2OSBA 4Q7KA 5EZ6B 2DB3A 4D25A 1G8HA 4FMDF 1O3YA 2ZYWX 4DQKA 1Q21A 1BYUA 1AQUA 1GNQA 2RGDA 3DMNA 3PITA 2ZE6A 4D6PA 1N3BA 1VG9B 4D4MA 2H1LA 4MGYR 1QHGA 2GPJA 2VNIA 1XU4A 4Q9LA 2H17A 1W0KD 1KOFA 4V0LA 4F4IA 4PC7A 1Z0IA 1QFJA 4P4SB 1GL6A 4US0R 1KO5A 4ZDJA 3G6EB 2WJVA 1Q86D 1F3OA 5FPHA 4Q1CA 2B8TA 3R8FA 3UPUA 3V4FA 221PA 1Z28A 1NN0A 3ZS8A 3KQNA 3CB4A 2IL1A 5JSZB 2V1UA 4JVLA 1EK0A 4U00A 4QC2A 5AK0A 2PJRA 5E7JA 2X1VA 5L3SA 1J7KA 1F2TB 1E2EA 3MGCA 3WMEA 2VBCA 2LKDA 3CPWB 3T5GA 3R7WA 2R6HA 1Z0FA 4IDNA 4YDHB 1Z06A 2YINC 3LA6A 4U5XA 1IJEA 3CH5A 3ZBUA 5GJCA 1E9DA 5L8VA 4EFLA 2ZIAA 5G3ZA 3TSWA 2CHVA 1KMHB 1N5JA 2CHQA 2RC6A 1CTQA 3PENA 5B57C 4TQAA 1LW7A 2J9RA 2ZUDA 2OTJB 1CNFA 5HXBA 4G5GA 1C9KA 2I4IA 2R6AA 4IHQA 4PQYA 2RH5A 1P61B 1OH6A 2CDNA 3I56B 3SU8A 3UATA 1G21E 3IIJA 2W2VA 2QNRA 2I1VB 3NC1C 3T1TA 4G5RA 1ZIOA 3CCLB 1F5NA 3VX4A 1G64A 2FSHA 4YC7A 5AR1A 4KITB 2OBLA 2EYQA 1MABB 4PFSA 1NY6A 4ESHA 3FFBA 4JLVA 3Q5DA 1K8RA 3RS4A 3FHTA 3MAAC 1YR9A 1CU1A 2V55B 3VU9B 1QG4A 4B43A 2MSEB 1NDHA 3CZQA 2BM0A 4CEIB 1M90D 4TYWA 2QI9C 1XFAA 1NG9A 1W5TA 3UK6A 3WP0A 5KO2A 1CNEA 1DDIA 5H70A 1D6JA 2DPXA 2Q9AA 4QG7A 3T34A 1KIMA 1FL9A 5HKKD 4TYYA 3TUZC 4JL5A 2JIZA 4YLGA 2ORWA 5D3MA 3F8TA 2G0NA 3BFKA 1IN4A 1D2MA 2R6FA 2WWIA 2JJ2D 2UKDA 4JVSB 1XEXA 2WIBA 4Q03A 4QNRA 1OW3B 4TZ0A 1U99A 4M1TA 4PC1A 2HXYA 2R9VA 4BFUA 1IXZA 4Q18A 4YHBA 2GWHA 3B13B 2X2FA 2IK8A 3SQWA 3SJBA 1ZRHA 4HLUC 4HDOB 3NBZC 2AX4A 4NKRA 1TVCA 1H8ED 1MO3A 4ASUA 1QFYA 3ZIAD 3TAUA 2AD5A 5HCIA 1TX4B 3SHWA 3FYHA 4AURA 1GP2A 1LFDB 5P21A 5CJPA 2DCUA 1BKDR 2RGGA 2WJGA 3RRYA 3Q85A 2FDCA 1PLJA 5SZIA 1XD2B 1G8YA 3CWQA 5B2ZA 4LYAA 5E7IA 5IK2A 2PEZA 4PPQA 4I4LA 1R0WA 1TLLA 1KO4A 2CLCX 2KBFA 2F9LA 2ZS8A 1E4VA 1RIFA 5DH9A 4TZ6A 3C5HA 2BWJA 3BERA 3B8HA 4FI3C 4M9XA 2GXUA 3EA5A 1T8UA 1RRPA 4KI0A 4L16A 4Q01A 1D2NA 3GJ0A 1VDZA 2ZRKA 4DCNA 4XVRA 1OYYA 2BKEA 2WSMA 1UBFA 2VO1A 5AUOB 2ANBA 5GJWC 3BH7A 4C0HA 4V0MA 4DUGA 2J3EA 1I2MA 5G40A 3U61B 1JJVA 2C96A 1XPOA 2GHIA 5FUWA 4TMZA 5GVRA 1ZUNB 3SDZA 3EARA 4AF6A 2OO7A 1KK1A 4GOXA 2GJ8A 3DKVA 3GJ8A 2HJGA 1NNEA 2CL6X 1X8KA 3K9LA 4W7SA 4DDUA 2BOVA 3EASA 4B3BA 5DNYB 3LVBA 3VKGA 2ZUBA 4XVUA 4FMDB 5CM8B 2ZYUX 3DVLA 1IHUA 5H5JA 3VO1A 3BXZA 3MMPA 1U0LA 4KHZA 2G6BA 2UVQA 1K73D 4MKFA 1XEWY 1YITB 121PA 3K0CC 3K09C 3P4XA 4B3CA 2ZSAA 1T0HB 3KTAA 3QF4B 5FOSA 2QE7A 4KFRA 3VR1A 4GPTA 2EYUA 1VYVA 2O8DB 2GVZC 3WNBA 2KBEA 1GTVA 1Z08A 2UZIR 2LWIA 4P4SA 3U6KA 1KI2A 4QL3A 4N3NA 1YIJB 4LJ7A 4C0KA 5E95A 2GNOA 2BEJA 5CDFA 3A1UA 2IS2A 1UADA 4A9AA 4HLCA 5JS8A 3L2OB 2NPIA 1KI1A 4IOJA 1E9RA 5J47A 2WWHA 4PHGA 5KUTA 2G88A 3CCJB 4UNSA 2DEUA 2LCFA 2Q6TA 2CXXA 4AF7A 3QY0A 3C8UA 3K70D 2QT1A 4YAFA 3D31A 3SN6A 3CLVA 2RHMA 2O8FA 2ZRBA 1EGAA 1GIAA 4LJ9A 3FFAA 2ZRCA 4G1VA 2V54A 3QIAA 4Q1DA 1WXQA 3MFYA 1NJID 1FTSA 2XNJA 2XTMA 2I3BA 3HDTA 4R7ZA 4PXAA 5EXSA 1XRJA 3UG7A 3A1VA 1ONBA 3ZVLA 2DERA 2OXCA 3GJ6A 3W5HA 1W49A 4HLDA 3VTKA 4Q48A 3ETLA 5D3MB 3HJNA 4F91B 4KU4A 2YC2C 3RANA 3FMIA 3AVTA 1W7AA 3NBXX 2VHCA 4NHOA 2W83A 3SJAA 1RPZA 1E9SA 1NSTA 4URYR 3GLIB 1OKKA 3HPRA 5BWMA 3VKHA 1CR4A 3AF4A 3B1VA 4LY6A 2JEOA 4IFBA 1KI7A 5J4YA 2FSGA 3N2IA 3EX7C 1IAQA 2IW3A 1S0UA 4JS0A 3CZPA 1HT2E 2ZJ5A 3O47A 1W0JA 2ZRLA 2NO0A 1CULC 3IIKA 3ZVRA 2XSZD 3B82A 4IJMA 2NO9A 3NH9A 4U02A 1UJ2A 1X3SA 3KKPA 3Q72A 4OQNA 1R8SA 1J2JA 3TKLA 3CCEB 2WTUA 1YZQA 4O0MA 2GESA 2WOOA 3NG1A 2F1IA 1W4CA 2GDJA 2HT6A 4OI4A 3MJHA 1Z0JA 5GJBA 5FPYA 1G8GA 5J4HA 2ZTSA 3ZJYA 3B6EA 3A6PC 4IVQA 1C4OA 1G5PA 1E2QA 3UWOA 2PIAA 3AF2A 3L8YA 5EXXA 2IYXA 4B44A 3W5IA 2H16A 2WJYA 2VTKA 4B35A 1S4QA 2XB4A 1IY1A 1WQ1R 5JJLA 1E4YA 1ZNWA 2PMKA 1VQ8B 2ZRHA 3IUYA 4BLSA 1E1QD 2B7CA 2A78A 5TMPA 4ESVA 2OESA 3P20A 1FQKA 1W4AA 3JVVA 4UQOA 2QBYA 5AUQA 1QH0A 5JRZA 2FA9A 1ZM3A 3IPYA 1KY3A 4V0OA 2QG6A 2BIFA 4L9WA 2W0MA 1KJYA 2PT7A 2FFBA 1TQ2A 4P32A 2IUUA 3AVQA 4ZGNB 4OI2A 3OZWA 1II8B 3AVUA 3A8TA 1LTQA 2NG1A 3PUVA 3RS3A 1WA5A 3LW8A 2A5JA 3TJZA 4CVNA 3CX8A 4HZIA 4US2R 5JWOA 2J0SA 3DZDA 3OHMA 1Z0AA 5BN4A 4D4KA 4KCGA 2NMVA 2ZREA 1OXTA 1K6MA 1JJ7A 1ZD1A 3C14C 1YVDA 4JBWA 4A0FA 1Z6GA 4BLTA 1JB1A 3UANA 5EJEA 2HYIC 2CNWD 3UXMA 1IQPA 5D3QA 3QG5A 3U6BA 1AJEA 2W2XA 4YQFA 4TMVA 4BEJA 1GJRA 2G1KA 3RWOA 1OLOA 2VRWA 2WPDA 1UBEA 3L0PA 2A5YB 2ATXA 5JECA 3QFSA 1DS6A 1OIVA 3AB3A 3GFTA 3LQQA 2F43A 4XWKA 4FCVA 5L3QA 1W47A 4JBYA 2EFCB 1NG1A 3K0AB 4JKIA 3VHLB 1N6RA 1RYHA 8OHMA 4RFSB 2EIXA 3QPVA 1P6XA 4B3XA 2GRJA 1RYFA 4H1UA 3CKLA 1XP8A 3PCRB 5B30A 2RKOA 2WKPA 1KI6B 1RJ9A 2V8OA 4NMMA 2VSXA 3I1FA 4GMDA 1S8FA 4OQFA 1FMLA 5EXTA 2IS1A 4XSHA 2SHKA 3LRPA 2ORVA 1E64A 2KI5A 2OE2A 1T3LA 2OT3B 4LJ5A 4P3YA 4MUBA 4PR0A 3SEAA 4BFWA 1ZM7A 1NI3A 4NE2A 1OSNA 2D3WA 3GJ3A 3O8DA 2QA5A 1PV4A 3FPKA 1KDRA 3IO3A 1DARA 4P31A 5TVKA 1F6BA 3F0TA 3WBJA 2AFIE 821PA 3KUDA 4UNQA 1CRQA 3QEJA 1E2FA 2JDIA 3RSLA 3RS7A 1HTWA 5DSZA 4OK6A 3FKSD 1ZMXA 2XTZA 2YZ2A 3PXGA 3VQTA 1EFUA 4Z8YA 2RGNA 3FGNA 2REOA 1IM2A 1KI9A 4ZCMA 4LPSA 3TSZA 2PL3A 2FPKA 2AFHE 1FUKA 2DBYA 3WMFA 2G77B 4C0JA 1J8YF 2VP0A 4PQRA 1ZU4A 4IXMA 4N0EA 3VHXA 1YJ9B 3LY5A 2XAUA 2QQ0A 1EWYA 1JXMA 1QFZA 3A4LA 4QRHA 3SJCA 5TXGA 2CVHA 3KXKA 4WQMA 3NBFA 1N0WA 4MQBA 4TQ9A 1TF5A 4ZKEA 2Z0MA 3BJIC 3I5YA 1XTRA 1E3MA 4NPHA 1ZIPA 1MH1A 2HEIA 3B1ZA 1WDTA 4Q02A 1P5ZB 2VA8A 1GR1A 1AN0A 1G291 4Q4LA 1W2BB 2N1BA 3HP1A 5A0FA 2BBSA 3ZZUA 1J90A 2NO7A 2Z83A 1G19A 1AIPA 4H9GA 3V9PA 4RVCA 4WXPA 3OFND 4OQXA 4PX9A 1M6NA 4NCKA 2JLXA 4ZO4A 5JHHB 4E03A 3CPHA 1GG2A 1ZW6A 2OEPA 4LV5B 2IYUA 5LDDC 1TUIA 4Y9UA 4Z1MA 3NHBA 5DIFA 2QORA 5JS7A 5AJVB 4Z51A 4ZCLA 1NVVQ 1KHTA 1R8QA 3PV0A 3RRMA 4CEJB 3WNCA 3OAAD 4BRUA 2MMCA 3NC0C 3D8BA 4JZKA 5KNBA 4NU0A 1T3SA 4DZZA 4QKQA 2HF8A 3ADCA 1SXJC 4PAMA 3H1TA 3V00A 2ZR9A 2YVUA 1H65A 3P4YA 4TMTA 4TLEA 4A4DA 1HQYE 1P2VA 2Y8EA 3CNNA 4XH9B 1EFTA 1YJWB 2D74A 1YU9A 3AVPA 4QNMA 1DVRA 2QP3A 2FEMA 3MWKA 5JI2E 5EUQB 3AF0A 1X8JA 4PO9A 5KSZA 4GDFA 3U60B 2W0SA 1IN7A 2IYTA 3LFUA 4M9QA 1X1SA 3W5VA 2EVWX 1OB5A 1FTNA 1NLFA 3Q7PA 4Q1BA 5FOXA 1MABA 4ZDKA 1II8A 2FNAA 4UJ3A 4XD7D 3W90A 1UKVY 4ZPXA 2B6HA 1W36C 4HZUA 4DEYA 4NYIQ 4R98A 1TPZA 1W2GA 3LXXA 2ZJAA 3JVUA 4OHXA 1FFHA 1M2OB 5HZHA 1E9BA 5GV7A 1E99A 4GMXA 4C3ZA 1XMJA 3NBYC 1G5RA 5AWFC 4A36A 2BKUA 3H4MA 1G4UR 3OF5A 4LYHA 4C2TA 1EWRA 4MGZR 1E9EA 4B3FX 2OCAA 4RCYA 1IB0A 3KJIA 2C2HA 3QXJA 3SJZA 3PEWA 1NVVR 4HB2A 4HZUB 3LDAA 1S96A 3Q9LA 1HE1C 1T3HA 3CX7A 4NCNA 3RAPR 1F2UB 1XJ0A 4H1VA 5E3HA 4ACBA 2VLIA 1JPJA 1CP2A 1KKLA 2IF2A 4WIAA 2PX0A 2KWIA 1UM8A 2IX3A 2OM2A 1AQYA 3R9IA 2GJAA 2WWGA 2Z5FA 4X8LA 3THWB 1OXXK 3MG9A 4Q4AB 5KDLA 2QDXA 3U4QB 3I62A 4O2LA 2GETA 4F93B 2KB0A 2ODBA 3AF1A 1R6BX 2QSZA 1SXJB 4DB2A 4YXWD 2IS6A 1U8ZA 5JWRA 3WRYC 4LX0A 2ZE7A 1P9RA 2RAPA 5JEDA 4D2IA 1QGZA 4TMXA 4JLAA 1JEEA 2BN4A 2VP5A 1FP7A 2VP4A 4OYHA 5DYIA 1D1NA 4HAYA 4KVAA 1KZGB 4R2HA 3AGQA 1VQ4B 1CJUC 1Q0UA 4UJ5A 4DLRA 1N5KA 3EIEA 4RZUA 2XNDD 4N1AA 2J0VA 2OFXA 4C7OB 1S1MA 3JZMA 2IYSA 4M53A 3EZ2A 3PEVA 1G41A 3I72A 3UKDA 1VQKB 5A4JA 3QE2A 4LSGA 4V03A 3LD9A 4DUGD 4A0HA 4M1WA 2YYZA 4IFEA 3CMAB 4MYCA 6Q21A 1FNNA 2OLKA 1QBKC 3ZD7A 4DT1B 1YJ5A 2D4HA 3ZC3A 4JLDA 3ZZ0A 1RFLA 3GLGE 1IXRC 4OK3A 3X2SA 3DZ8A 3MUFA 2AL7A 1SULA 2F3RA 2PH1A 1XCMA 1NVUQ 2FN4A 4PQFA 4YMSA 1NMYA 3PUWA 4PC2A 3C41J 4IEIA 3GLHA 4JKYA 3DOFA 2HCJB 4B76A 5IK2D 2OCBA 4DDVA 1GOTA 4W5JA 4HATA 2OV2A 5LB2A 1G3RA 2AR7A 1NMZA 1NL3A 1TL7C 3K9GA 1X86B 3PUYA 4PTLA 1E2JA 5FPTA 5G3YA 2ONJA 1ELOA 1SXJD 2O8DA 3CBQA 3AP1A 2CCKA 3W6OA 3GLHE 4ASUD 1PZNA 2QY9A 3T1VA 3GLHB 5THXA 3FDIA 2G9NA 3BFVA 2BPOA 1KKMA 3LW7A 3W34A 4AG6A 1RW4A 4CYMA 4DCSA 2PJZA 1GILA 1UF9A 4B3DA 5DHAA 5KNDA 1HV8A 1ZAKA 2P67A 3I8SA 1U8YA 2QMEA 4TLDA 4DLXA 5H68A 1E2HA 1CQXA 3PJRA 4PPGA 1BIFA 1Z07A 2JIZD 3KKNA 4B2LA 1R5NA 2Z43A 3B1WA 3LX8A 5FL3A 1BMFD 2C78A 1IN5A 1U8AA 2RB4A 4GNKA 3D7MA 2QP4A 4G5QA 1KSGA 2R6GA 3CCQB 1W4BA 3FKSA 4IVRA 2L0XA 3OZXA 3TLXA 1K9MD 2PCJA 1QDEA 1MO4A 3CMEB 1XJQA 2R44A 4QGHA 1PLKA 1W2HA 2XXAA 4UNRA 4TSFD 3WNDA 5F98A 2A2ZA 4BFTA 3PEYA 1X1RA 2GA8A 1QG2A 4Q4HA 1YZLA 4DLUA 1OV4A 1C1YA 2QBYB 4PHHA 4G1BA 4QJ4A 4RD4A 1JQJC 2W6IA 4HAXA 4Q4AA 4WBSA 4EH1A 4Q9HA 4AD8A 3U4QA 2W2TA 4HE6A 2V9PA 2ZI3A 2W58A 1JEDA 4A6PA 4Q4JA 5FOUA 3QXSA 2AXNA 5K8TA 5BYJA 2WVJA 4YXWA 4EAQA 1FX0A 2JASA 4KFTA 1N6NA 2GJ9A 2ZYTX 1SXJE 1MRNA 2AHOA 1JR3E 1CF4A 1W34A 1SZPA 2XX3A 4NCIA 2O8FB 4N3GA 1DPFA 3DHWC 4JLMA 2E87A 2YJTD 3EW9A 4MKGA 2CJWB 4V0NA 1PLLA 2BGJA 2ZQ5A 1T91A 3QVVA 1GO2A 3OIYA 4BPRA 1OXUA 5KOYA 2DFLA 1YR8A 3MSXA 1TF2A 4HI0E 2QMUA 4B33A 2ZPTX 2IHBA 1JQLB 2ECKA 3W6PA 3CCVB 1P2UA 1XXHA 1XDBA 2CCGA 3C15C 4TL7A 1QHHA 2JLUA 3PVSA 4DLVA 1KO7A 3T1QA 4BASA 4C4PA 3PG5A 3LVQE 4Q47A 2CMKA 1CEEA 2R6DA 1QF9A 4BLRA 3QFRA 5TDHA 2BCGY 1KRHA 5JCZA 2C77A 2FFQA 5FOWA 2GF9A 3AGPA 1W0KA 3FHCB 4NYMQ 4HAVA 4IW3B 1Q44A 2WJHA 2X8AA 3AM1A 5KNCA 2ZETA 4BE7B 3U44B 3OE7A 3VO2A 4X8HA 2VHJA 5FTJA 2ZM5A 1HQCA 3CR8A 2P2LA 5FBLB 2XZLA 1KNXA 1XTSA 2J7PA 3LBIA 2P0EA 4PO1A 2D7DA 3KL4A 1YZNA 1ODFA 1VPLA 4MYHA 1DDGA 4M4SA 1A2KC 2CVFA 2RGXA 2WKQA 1E1QA 2FEOA 1PUJA 3EXAA 2A30A 4EJSB 1U0JA 1COWD 3ICEA 3IDQA 4ZDIA 2JLYA 3SI7A 4AWXA 1NBMA 4MDFA 4PPNA 5JSZA 3LO8A 3M4YA 4GOJA 3A58B 1ZU5A 2IYLD 4LOAA 4TLBA 5CK5A 2ONKA 3HR8A 3T5DA 2F55A 5AJZA 3AVXA 1KTVA 2WICA 3CRVA 4L4UA 4XJXA 2G0TA 1N6OA 1EFHA 2GKSA 2VSFA 3GEIA 1XPUA 3QBVA 5DN6A 3EWSA 3WBKA 1QHXA 2IUTA 2XNSA 5L3QB 1U90A 4B47A 1NIPA 4JLJA 4C0QC 4WVFA 2XSZA 4UXHA 3SQXA 5GJVC 5KSWB 1IONA 1YR6A 1LS1A 4AC9A 3W2GA 2J46A 3QVUA 1YKSA 1NBMD 1XEFA 1CJKC 2CK3D 3D6TB 5M04A 1IN6A 2J41A 4LHVA 3KXIA 4Z54A 2JLWA 1IBRA 3T1OA 2JLQA 1GVNB 1AGPA 1HH4A 3EIHA 1E0SA 1G3QA 4Q1EA 2NO1A 4ON9A 4PC3A 4B3GA 3LWNA 2FJUA 4D82A 3VFDA 4Q7MB 1G4AE 3B60A 3P27A 1US8A 3CF0A 4FMCF 5LB4A 3OIVA 2VYFA 3THOA 1BQEA 2PZGA 4DDWA 3CR7A 2CLDX 1UFQA 1KDTA 2CL0X 5J4LA 4I1OA 4EQ6A 4B73A 3R8CA 1ZP6A 3KFVA 4NL4H 5FPKA 4U9UA 4LDJA 1OHHA 4EKDA 1T9HA 3ICQB 1D9ZA 2P6UA 3WYAA 2GZDA 5JRJA 1JAIA 2PX3A 5TY0A 2GEDA 1E0AA 1ZC4A 1T5IA 2P65A 1E2KA 2H8KA 1GAWA 2RMKA 4DSTA 5CYOA 4G1UC 2A5DA 4LK2A 2OFOA 2R2AA 3BB4A 2VPPA 4CEHB 3SYNA 1KJZA 4P4TA 4G3XA 2CJWA 5CK4A 3A1SA 1KI8A 4FINA 4OKSA 2XEXA 2WWYA 1HEIA 2J0UA 4DCVA 2C03A 4TMWA 2ZJ8A 4TTQA 3I55B 1KI4A 2EFDB 2IA5A 3QFCA 1JI0A 5JHGB 4U7DA 2ZSFA 5FR1A 3OEED 1I4LD 1BYIA 1E63A 1TU4A 4MITA 3CW2A 1K5DA 3LAWA 5IHPA 2EFHB 4B74A 4ZI2A 3CIOA 1ZC3A 4HUQB 2CEAA 2REXB 4KBGA 2Q3HA 3VR4A 1B2RA 4KSBA 2QE7D 4PC6A 2QTHA 1DG3A 2GK7A 3CH4B 4BGDA 3ZLJA 4RCZA 2A3RA 1DO2A 3SR0A 2EFEB 4PSVA 1W48A 2WSSD 1R0XA 3C16C 4NBSA 5FUVA 5KDDA 2WKRA 2WSSA 5HE9A 1H85A 3OEHA 4Q7JB 5J4VA 5KSOA 2BJVA 3HU2A 1OFUX 2C9CA 4F4JA 2W6ID 4OHVA 2Q0HA 2LKCA 1VCMA 5KYKA 3I92A 4DLZA 1A8PA 2AWNA 2BEKA 4A82A 1ZD9A 3CRZA 2VL7A 4TT3D 3OEEA 3DM5A 3QG1A 4G5SA 4PHFA 1N6PA 2WPDD 4YDSA 5DLQC 4C9BA 3LBNA 1D8TA 4CRWB 3MLEA 2GILA 3GFPA 4TTPA 5C1BA 4A6XA 1YZTA 4JL8A 1Q3TA 1XD2A 4FMBB 5AJXA 3I73A 1W35A 3K8YA 4QGFA 1JR6A 2G3YA 3D3QA 2ZRJA 2XJ9A 4M1SA 4B32A 1V5WA 1ZCBA 3LV8A 2VH5R 1I2DA 2CE7A 1SHKA 2OBMA 2WHXA 4XVQA 1UKYA 2QZ4A 4K1XA 4V0KA 5CM9C 1AZTA 1KDOA 1PUIA 2OAQ1 3BAFA 2ZRIA 1E94E 4ZGQB 3GPLA 5E7MA 4FCWA 1FPMA 3AVYA 1UDXA 5A5GA 1KNQA 2ZRDA 4L5BA 5L3RA 3W9YA 1OHHD 2BCJQ 1X6VA 2GJSA 2A7QA 2ZR0A 2ZSEA 1P73A 4JYBA 3W2EA 5JI3E 5FI1B 5CJ2A 5TB5A 3O8BA 4LCBA 4LJ6A 4QHSA 1M1YE 4QBFA 1VG0B 1Z8FA 4IRUB 2QEXB 4AG5A 4XOIA 3CRMA 1AKEA 5LD2C 1E0KA 2HMAA 1R4AA 3UIEA 1N5IA 3TVDA 2GZAA 2JAQA 5H59A 1JECA 2ZVPX 2ZE8A 5BW8A 2QA4B 1M1KD 4D0LB 1VG1A 1M8PA 1SVLA 2HXSA 1WMSA 4ILEA 4JJKA 1HY3A 4BLQA 1SVSA 4CEJA 1M74A 5TR9A 2ZJZA 4EQ6B 4KFSA 1RRGA 2GAOA 5H1YA 4Q5IA 2QAGB 1G8PA 3RLFA 2FFAA 2MMGA 2V1XA 4GZLA 1D2EA 1OFIA 3IO5A 2XZOA 4O3MA 2XTNA 3GMTA 3ZD6A 1ZNYA 4X8OA 4DB4A 5F3WB 2WWFA 3QXHA 3CRW1 2WMNB 4G01B 4Y0VA 4B75A 2VNHA 2VHUA 4PAOA 3CD6B 5HR5A 4MGKR 2GQFA 3W8RA 2ZU0C 4CF7A 1Z6AA 1XMSA 3ASYA 2WIAA 1KK3A 4S35A 2ZYVX 4B6FA 4R71A 1G16A 1XNJA 5JLJA 3QPUA 5EP2A 1ESNA 4BECA 4F38A 1E2MA 3C7KA 1ZUIA 2RGCA 3ZVMA 5SZKB 3GJXC 3F3YA 4B71A 1F48A 3QEOA 3QI2A 3RNLA 1CBUA 2HDNB 4FWTA 2XZPA 4M1OA 1OKKD 3NTUA 3CNOA 1Y3AA 3QFTA 1M34E 4DEXA 3GLIE 3U3JA 1IJFA 2GCNA 2P5TB 4NTZA 3X1WA 2FE4A 5FPSA 3ZQJA 3BIFA 4TL6A 1LF5A 2GK6A 4K8OA 3DO6A 5EE0A 3CO5A 2FSIA 1E32A 3LH5A 1Q82D 2PZFA 4A8JB 3PUZA 3QKRB 1XTKA 4OI0A 3WXMA 4LBYA 3K53A 4B34A 4ZI3A 2QPTA 1LF0A 1ANKA 3KB1A 1FUUA 1Z5ZA 1BX1A 1B23P 4A92A 2VP6A 3IHWA 3G0HA 2YHSA 4IEEA 1A5TA 1QHIA 2MSCB 3QXXA 4A0RA 5FBVB 3RDPA 4A8JA 1FRQA 3IQWA 3N70A 1EESA 3U3RA 3H0KA 1DTSA 2IYZA 5C46F 3AQ4A 2Q21A 4BFVA 2NZ8A 3ADDA 4M2LA 2J1LA 2ZUCA 2R6CA 1N6IA 3THXA 4TYNA 1Q1EA 5DGXA 1NVXQ 3TGPA 1Q57A 3BWDD 3UMSA 1MT0A 5KU1A 2IS4A 1FQJA 2F1JA 2VNJA 3W6NA 3VNUA 2ZJYA 4M21A 2ORIA 4ITRC 3KJEA 1KI6A 1OH8A 3IGFA 4UKDA 2ZROA 4LWZA 3WRXC 1U2RA 3FMFA 1N25A 3GLFB 1TTTA 3A37A 1XB2A 1Z22A 2ODEA 1SVOA 1BO6A 4TWZA 4XIGS 2JATA 1FDRA 2P6NA 1N5LA 3SFVA 1HYQA 2C9OA 4DLSA 1SKQA 1GL7A 2BC9A 2FPMA 1Z6XA 4JSTA 2IT1A 3NEJA 4Q19A 2QGNA 1RRFA 2EWWA 1N0VC 1R10A 2QTZA 2BBWA 2HJVA 2QEQA 1XZPA 2IEZA 4NDZA 3RABA 4RKFA 5C4MA 5JCPA 4C0AC 1W4RA 3ZDQA 2V3CC 1YZGA 4EPWA 1E96A 1P62B 2ZS7A 4TSFA 4AKHA 3DM9B 2FH5B 1QVRA 4LV8B 2GXSA 1G3UA 1VECA 3SYKA 2QTLA 2QRZA 1VKJA 2BMJA 3EPJA 1Z2CA 2C9YA 1OXVA 2H57A 2A5FA 3CRRA 4FN5A 4KXFB 4QBGB 3K0AA 5FUYA 3H84A 1BJKA 2ZS9A 4ACAA 2V7QA 4BZXA 1SVIA 5TV2A 4D0NA 3RS0A 3ES9A 2X3UA 1GUAA 1DAIA 1OF1A 2IC5A 2H18A 4URVR 1YI2B 3K0FB 1CXZA 2EW1A 4IKEA 4IOLA 3RS2A 1ZINA 1DAHA 1Q3HA 2QT0A 2ZRFA 2J0QA 3G82C 1F2TA 4WAUA 4AKIA 3O8CA 2BBTA 2E1RA 4QGAA 3X1YA 1EFCA 3BB1A 3IPXA 3X1DA 1OGJA 1OYWA 1ESMA 4NYMR 3J81k 3UG6A 4E5UA 3LO5A 4RZ2A 3BBPA 3U2QA 3LLMA 3VR2A 1AS3A 3TQFA 1DAEA 2B92A 1TF7A 2WWXA 1VG8A 4XSGA 4IXNA 3G4SB 3CWZA 2FOLA 4HDCA 2ODNA 1Q22A 4FXPA 4YAOA 2PT5A 4JLBA 4ERNA 1WP9A 4F7WA 3EWAA 4MKIA 4UNPA 521PA 3IEVA 3RHFA 3GLIA 2XJ4A 1VMAA 2R62A 5LBIA 5BYKA 4DXAA 5HKKA 3A4MA 2V7QD 1G17A 1FNCA 1N6KA 1Z6YA 1FNDA 2FSFA 2AWOA 4W5HA 1I4TD 4MH0R 1XWIA 3KDSE 1AMOA 1EG7A 2DWQA 5EE9A 2C98A 1NJFA 3CCRB 3H2YA 1P3JA 3ZH9B 1TMKA 3MCAA 4QFMA 2A5GA 2QENA 3WYGA 4B48A 4K46A 3NH6A 3M6AA 3W5JA 4YMUA 4HDQB 1TQDA 3AKDA 3ND8A 1NN1A 1W5SA 4O2RA 3EZ6A 3HU3A 1LVGA 1G1MA 2ZI7A 1NKTA 3AUXA 5FOTA 2N46A 4FK8A 1CKEA 2YNMA 3BH0A 2XNDA 1J70A 5EP4A 4KSCA 1DG1G 1GNRA 3AP2A 5CB8A 3QKRA 3UMRA 3OESA 4Y9RA 4A2WA 2OBNA 4OQLA 1RC8A 4NCJA 3ZS9A 3X1XA 1K8AD 4D80A 5JFGA 4QBHA 2EWVA 1TEXA 1JR3A 2GTPA 1SVWA 4MRRA 5K8LA 2YWGA 4D4JA 1YHQB 2BV3A 3CC4B 1A4RA 3CF6R 3RWMB 5FFMA 3UWKA 3GLFE 3KQHA 1Z6TA 2XGJA 4EUNA 2XOKD 3K70B 2IYQA 2VEDA 4DT1A 3T61A 1E0JA 3TQCA 1ETUA 4RZ3A 1SQRA 4B4DA 2BBOA 3SHFA 4PANA 3P1JA 3K0EA 4TL8A 5JBQA 3U7HB 3VR5A 2BGIA 4URZR 1M7GA 4RD2A 3CM0A 2REBA 4NZYA 5DO9A 1I4DD 3B9QA 3LBHA 1QUEA 2GBLC 1ZCAA 3EG5A 2PEYA 3KJHA 4F7DA 1KK2A 1E62A 2ATVA 2CBZA 2J59A 4HB4A 4MRNA 3BB3A 1PVOA 3JQPA 1PJRA 2O8EB 2BMFA 4KLZA 1E79A 3VX3A 4D81A 3TW8B 3LVRE 3ECCA 2NTYC 4I99A 5JWHA 4DC9A 4L8GA 1NP6A 3AV0B 5FI0B 1KGDA 4DLWA 1KSHA 1OJLA 3ZBTA 1P7CA 5G41A 2YWEA 2N42A 5DI3B 1LB1B 2QROA 4AIIA 2O8EA 1HE8B 4BEBA 3PQCA 1L2TA 4PSAA 4BFSA 4DKXA 1QGAA 1VCOA 3ASZA 1L4YA 1E6CA 2IUSA 1RKBA 5CYPA 4M1YA 2QAJA 3GEHA 4RD1A 4B2IA 1IOZA 3TK1A 3CF2A 4MKHA 3S1AB 1B0UA 2AK2A 3K70C 4NH0A 1EP3B 1QVGB 4DIDA 2X2EA 2RCNA 3A1TA 1P75A 1BOFA 1QRAA 2NPFA 1UDWA 3EC2A 1Q81D 3OAAA 1UEJA 4DLTA 1S1CA 1NLYA 1JBKA 2F7SA 3RC3A 3KQKA 4JJZA 1ZNZA 2F1HA 2BJWA 4CIDA 3LX5A 1AZSC 4OK5A 1SVMA 2ZEJA 4UXIA 2RGNC 4AK9A 2D06A 4MRVA 5F9HA 3TR5A 2C99A 2BMWA 1IY0A 1WBDA 2IF0A 2ZXUA 3CONA 4TMKA 4YMVA 4LGMA 4BLPA 5CITA 3NEYA 2R65A 4WA7A 2QSYA 3BH6A 1JXOA 3SNHA 4C0SA 4D4LA 4Q1AA 4QM7A 4GZMA 3HPQA 1WF3A 1EP2B 1MO6A 1Q1QA 3B85A 3QKTA 4QGGA 1P4SA 4TQUS 3SE0A 4ABYA 4EPTA 3EZ9A 1U81A 3DPUA 5AUPB 2YWFA 4PAQA 3VR3A 1JNYA 1BX0A 3Q7QA 1VQMB 2FGJA 4OHZA 4JLKA 5FBRB 1VQ6B 1YR7A 4ZIRA 2WMOB 3KQLA 3PR1A 3WY9A 2GJKA 1E79D 3K0CA 1G5TA 2J7PD 1QX4A 3QKUA 4TYPA 1G6HA 2VF7A 4JVNA 1R2QA 3IEUA 3IBGA 4CEIA 1OFTA 2ZJ2A 5ELXA 1ZUHA 3CC2B 1X8LA 4X8MA 5SZJA 1UEIA 1GKYA 3L8ZA 1J99A 1LS6A 1VIAA 1Z0KA 3E2IA 3FTQA 2XXAB 3U7FB 1CR2A 1S3SA 1A1VA 1QUFA 2WJIA 1ZM4A 4LZZA 1XEXB 4C43A 1N0UA 1SKYE 4OQMA 1II9A 4WZAE 1KD1D 1UBGA 2GAAA 3CPJB 3QOFA 4PSKA 2VZLA 1TUEA 4DSNA 2YOHA 1MOZA 4L9SA 5EE3A 3W8NA 5J40A 2WM9B 4RY2A 1T4GA 4BPBA 2FZ4A 2OTLB 1MO5A 4DDTA 1H8HA 2QM8A 3A1WA 2JLSA 1XCGB 3B7GA 4QJ3A 1NJGA 5EE5B 4RFVA 2O8BA 1FW6A 4ZCIA 1KQSB 1QHSA 3MWJA 3V76A 3I3SR 4PZZA 2IWRA 4A15A 3KXLA 1QHYA 2VP9A 1OB2A 4JVMA 2FFHA 1KC8D 4YONB 2I1QA 1E9FA 2Z6VA 3R7WB 3SC3A 3AEZA 3GLFA 3K1JA 2C5LA 4EFMA 1R5OA 5KPJA 1XX6A 5DISB 1S9DA 5LPNA 4FCTA 1VQNB 4IDQA 4KODA 4BFZA 1XEWX 2B8WA 4HLUA 3NIBA 2QU8A 2AKAB 2QRNA 1VYTA 2FF7A 1F60A 2QPAA 4KYIB 2PLFA 3RSOA 3EZ7A 2RGBA 3THXB 1S72B 2VIIA 2WJJA 2NO6A 3AP3A 2WV9A 1II0A 2KJQA 5CB6A 3EIQA 1G3IA 4A1FA 1KK0A 1NY5A 1XJCA 4FIDA 3I4LA 3MWLA 2H7VA 2YKGA 4G5OA 3SFZA 3QUSA 2HUPA 5HTKA 3DKPA 4XWOA 4MGIR 1BMFA 3BFXA 1Z63A 1D5CA 1KJWA 3K0SA 2IYRA 1VTKA 4NP6A 3ADKA 2IXGA 1OIXA 4QHTA 4EDHA 1VQPB 1W46A 1GITA 4JT4A 4US1R 3B9PA 1JA1A 1G9XA 1A82A 4YAWA 3P26A 2JLVA 2WBLC 1CRPA 4AYTA 3U3MA 3JQRA 1YZKA 1VHLA 4ZKDA 4II7A 4ARZA 5H8WA 4R2IA 5CDFE 4QXAA 1Z0DA 2J87A 2RGAA 2F6RA 3T35A 4TLCA 1KDPA 2OCPA 2IEYA 2AXPA 3ZIAA 3BGWA 2JJ1A 1M7HA 3CX6A 1H8EA 4TLAA 1SXJA 5GADl 1OGIA 3RRNA 4MYTA 3RRZA 2V6IA 2ZU6A 4JYCA 4Y7CA 3HU1A 1KMHA 1XZQA 4RFSA 4GRAA 4KV9A 2D62A 4L15A 5IDVA 1IY2A 1U94A 2K5UA 4M8NE 2VSOA 5JEEA 1DAGA 2CK3A 4ZDWA 5FL7A 5TARA 4LHXA 1KI3A 3THYB 1JPNA 2WAXA 3ZVNA 1EX7A 1NVWQ 3CPEA 3M1IA 4C30A 1YJNB 4BLOA 4C2UA 2ZVQX 1S3GA 5L3SB 3W2IA 4TYQA 3PEUA 2BMEA 2NOAA 4HE5A 2B5OA 1K5GA 2OHFA 3EAQA 1FX0B 4Z1MD 3E1SA 3FKQA 3HYTA 4MRPA 1WB9A 2G83A 1P2TA 2AKYA 4BUJA 1GAQA 1VQOB 4NONA 3K0FA 3Q3JB 4GSYA 2P5SA 3FJOA 4G0NA 3ZGXA 4LBVA 621PA 3VR6A 1CJMA 3QJYA 4Q9KA 5DI9A 3DDCA 1Z47A 4WZBE 1T0JB 3LQRA 4DSOA 2BF4A 1SM4A 4C0BA 1YZUA 2TMKA 2YOGA 4RZXA 1QHHB 3CCUB 4ZIRB 3AVWA 2C04A 4P0TA 2IBMA 3L0OA 5EZ5A 3C4JA 4BRWA 4CZ2A 5F2EA 3PIRA 1ZM2A 1COWA 3MRSA 4IOKA 4MYUA 1TAGA 4DQLA 2QAGC 3BOSA 1NN5A 4UNNA 3QKSA 2VNKA 5E4FA 3ZQ6A 1D9XA 3AKYA 4JLPA 5IT5A 3B5JA 3GQBA 2J7KA 2JCSA 2GXQA 3E20A 5HCNA 1CS4C 3GJ5A 3L82B 5DHFA 4LBZA 2OK8A 2QTVB 2C8VA 5KPDA 3TBKA 2HYDA 2AK3A 4I1VA 5G53C 2ERYA 2YV5A 1TNDA 2O0KA 3OIWA 3B1YA 4EIWA 2H92A 4V0ME 4DLYA 5CIQA 2ZE5A 2O52A 3DOEA 5FTKA 2ZRMA 3RYTC 4OI1A 4LC1A 3BE4A 3B78A 2F9MA 2FG5A 3DEFA 4HAZA 4R9UC 4S2EA 3KKOA 3DL0A 4QOSA 4UXJA 3SZRA 3EPKA 2XB2A 1KYIA 1VCNA 2ZJOA 4RJLA 3G5UA 5EXPA 1UPTA 2ASEA 3RC8A 3P32A 3AVVA 3L0IB 4ZV4A 4JLNA 4LI0A 4LV6A 2OZEA 4LJAA 4PGOA 1XBTA 2NQ2C 4CGZA 3KUCA 2EFGA 1ZD8A 2D7CA 4HSEA 3U3KA 1US8B 2GXAA 1ZYUA 1Z3IX 5UKDA 4PZYA 3TE6A 4QJ5A 4GBMA 1JB9A 4V02A 3REGA 3R9XA 4RD0A 1OFHA 1RE0A 1E2IA 3GJ4A 4F4CA 3R20A 4XD7A 2IXEA 3U3OA 4FMCB 1R5BA 1U98A 2IXFA 3M0EA 4LC0A 3NDBB 1V43A 3EC1A 4LJ4A 1TQ6A 2PBRA 2XITA 4MDEA 3WHKA 3NVAA 4PZLA 5HE8A 3KKQA 3NDPA 3GP8A 1JALA 2VHQA 1DADA 3H86A 3GFOA 2WWWA 5EE1A 1OH7A 4IVPA 2GVDC 3LXRA 3PFIA 4CEHA 1E2LA 2OG2A 1AA9A 3SBDA 3WMGA 4AYXA 1EP1B 1CIPA 4PO8A 3SS8A 5JMTA 1G6OA 1G7CA 1T6NA 3W3ZB 5ANRB 4JMPA 421PA 1LY1A 5J4KA 2FGKA 2OUKA 2WAYA 1GDDA 1S9HA 3CNLA 2ZANA 4URUR 3VNVA 5SZHB 4DSUA 2Q3FA 1RZ3A 1W36B 1LNZA 3IKJA 4M9SA 4RKEA 4LYFA 4BZPA 2NIPA 5HPYB 1SVKA 3QSYA 2D2EA 2A9KA 4HUTA 1NF3A 4F92B 2OFWA 4Q66C 4DWJA 1A7JA 2ZRNA 1CR1A 5K8IA 3OFNA 3ONWA 5FL7D 4EPVA 2PMDA 4E09A 1HT1E 4IDPA 1XXHE 3KTAB 4P6VF 3L0SA 1AKYA 1P72A 1VCIA 3QF4A 4MUAA 3QXCA 4OHWA 4WOPA 1F2UA 4GL2A 1QVAA 1QZXA 4TL9A 2HLDD 3PUXA 1KZ7B 5BQ5A 5JJIA 1TQ4A 3N5CA 1HA3A 1W1WA 1OE0A 3TRFA 4KFUA 3THYA 4D26A 3CXCB 1DEKA 1Q1ZA 2GF0A 3FB4A 2ZAMA 1G8FA 4WXRA 2CL7X 3OJWA 1NBME 2DR3A 1OXSC 4Q1FA 3ZYCA 2QAGA 4Z8XA 1XTJA 3W5UA 3BS4A 4HB3A 4JLOA 2F43B 2HLDA 1FOEB 3W3AA 4GT1A 2O8CA 4JT2A 5FBWB 1R7RA 4HYYA 1E9CA 4HAWA 3DMDA 3JZAA 1VQ5B 3FHOA 2PCLA 4W9MC 2GCOB 2JJ2A 3U5ZB 4FW9A 1N6HA 1IN8A 3TAHA 5JZVA 4OBEA 2IYVA 1SQ5A 4YMTA 3KQUA 1RJ9B 2YOFA 2VP2A 2BM1A 2OILA 1FP6A 2HV8A 1GVHA 2NGRA 3BD9A 3IBYA 4LJ8A 2OCYC 5IF9A 2RGEA 1GRNA 1HUQA 1ZJ6A 3THWA 1NSFA 1DAKA 3IHLA 2FMXA 5FTMA 2E9SA 5DYGA 3BK7A 1E2DA 4JBXA 4NYJR 1I7PA 1GFIA 5EMNA 2GCPA 1ZBDA 4RD6A 3RVBA 4CT5A 2FV8A 2BVNA 2WZQA 2V6JA 3IIMA 3TSOA 3FWYA 2OK7A 1CJTC 1QVFB 2J5XA 5CIWA 2QPOA 2CLSA 3KB2A 2ZSBA 3CRQA 3KZ1E 4Q00A 5DI3A 1QG0A 1E9AA 3W2HA 1T5LA 3OEHD 2IHYA 4JIMA 3MD0A 2DHRA 5J5CA 4PPFA 3K9HA 4K81B 3OZUA 4AKGA 4FWIB 4CDGA 4DIEA 5IRCD 5BN3A 3V4RA 4EJSC 4B2PA 5FR2A 1G7RA 4HEJA 3B1XA 3QE0A 1XTIA 4EPRA 3I61A 5GVSA 2DETA 4DRZA 4KLNA 2O5VA 5FOVA 2P6RA 4TTRA 1KAGA 3K9NA 3NKVA 1TU3A 3OZVA 1UBCA 3AUYA 1MV5A 1P60A 2FZLA 2UZ3A 3E70C 3SBEA 5BXQC 1Q12A 1T8TA 1W87A 1UKEA 2CNWA 2YC4C 3TW4A 2IYWA 3RS5A 3HR7A 5GV8A 4C0LA 1R0ZA 2C95A 2QM7A 4LHYA 1VQ7B 2CNDA 1G20E 5L3VA 5AJWA 1YE8A 4HB0A 3AVOA 2DY1A 4YAUA 4OJQA 4EFNA 4P4UA 3VU9A 1DE0A 3QPWA 2W6JD 2VHTA 4HLQB 4LBWA 3F5FA 1E2NA 1S2MA 1VYUA 4LRWA 4QHYA 1GRRA 5CLQA 2G1JA 4DJTA 1CR0A 3ND9A 3CC7B 1OIWA 3LNCA 4GI7A 1AS2A 3TMKA 2ZJBA 3WP1B 4BZQA 2XNCA 4KYUA 3KKMA 2V4ZA 3SYLA 1XD9A 1KO8A 1QHNA 2JLRA 2RHDA 1GM5A 3GJ7A 3CUEF 2VF8A 4A2PA 1GNPA 1NN3A 4QBIA 1NMXA 2EU8A 1W44A 2QGZA 2ERXA 3GD7A 1VQ9B 3AH8A 1H42A 2AN9A 1J9ZA 4UAJA 2NZJA 5KHOC 1Q7YD 4GFDA 2QTFA 1N8RD 1Y63A 4XTCS 4AI6A 1DOAA 2X19A 2PZEA 1VQLB 2CCJA 3MWYW 4BFXA 2J45A 4KJZA 5B64A 1DELA 3NXSA 4A8JC 1SGWA 1EFRA 5DN6D 2EQBA 1KSFX 4I81A 4KBFA 4Q21A 2KSQA 4PHTA 2O0JA 1BS1A 4TN1A 2Z4SA 2B7BA 3VMFA 2R8RA 2ZI9A 1WRBA 3I8XA 3TVTA 4KAXA 3BC1A 3VAAA 3KJGA
chains in the Genus database with same CATH superfamily
2EERA 4K2HA 4RSGA 2PS9A 2HO5A 4YRPA 3UTCA 3PQ3A 3HHEA 7GCHF 4QUEA 1XD8A 3PC8C 3IQXA 2FFJA 4XGRA 6PFKA 3VSBA 1VZ2A 4BMSA 1B8PA 5J63A 2QMHA 4A10A 2VH2A 3I32A 4MP3A 4AMGA 5DRYA 1HURA 1B76A 2HT1A 3TUJC 2BL4A 3BTGE 1SEPA 3AINA 2VF2A 1K3TA 3T52A 4L85A 3FPJA 2QMOA 4E5KA 4AUKA 3OIUA 4GLJA 5L51A 3ZQ4A 1SFIA 2HQ1A 3BEFB 1YRAA 2KCAA 1L4HA 2OAP1 2XHEA 2ZJ0A 3BHJA 4I55A 3ZJ4A 5B1IA 2EHJA 3WSVA 1NNUA 1PS9A 2LP6A 3FCSB 3NCLA 5EPUA 5C18A 5EWJB 3A7DA 1LQTA 1U0BB 2A2QH 5KS2A 1NURA 5J59A 1MH0A 3TOCA 3TXXA 2QQEA 4MR8B 3DMTC 2GX6A 2FU5C 3VMMA 5IVKA 6CHAB 1TC2A 1C4WA 1KO1A 2VJJA 5AVVA 1YL7A 1GVZA 5CHEA 3LYHA 4E22A 1CT9A 3U4GA 4K88A 4L7QA 4UCFA 1A4WH 5J35A 2RHRA 4KGVA 2PGLA 1KXZA 5ICCA 4LHWA 2R4QA 3OO1A 5LPRA 2CN1A 5T5QA 3FANA 1WWKA 3A84A 1TYEB 3M7QA 5KSPA 4ZCTA 1GWNA 4QPZA 4IDAA 3NRCA 1KY2A 4L9RA 2C3UA 2DBVO 4M1MA 2XTTB 3PB3A 3ISXA 1DJLA 1MAWA 3G3EA 4MWZA 2AF3C 3SC6A 3LQFA 4J16C 2I3ZA 4IRMA 4M0LA 4WH6A 2V45A 2FOAA 4POAA 2CNBA 1PFXC 2IYYA 2WVHA 4FM9A 1DUSA 1XMIA 2JGDA 3U48A 3KFXA 5D2CA 1E98A 1BBRE 2ZI6A 4MLPA 2DB3A 4UBIA 5JB8S 4K3JA 4D8XA 4NEHB 2RGDA 3PITA 3F5MA 2ZZQA 2Z3CA 4EF5A 1QB1A 1QCCA 4EMSA 5M2QA 1N4DA 2WJPA 2AN5A 4PRLA 4YO8A 1O96B 4RLFA 5L3SA 3VJKA 3HBAA 4CIYA 4C2AA 2GTBA 1KMHB 2CHQA 1LW7A 3TZKA 2RH5A 3T3OA 3A81A 2J9FA 1R00A 4Z4WA 1KJ8A 4PFSA 4K0KB 4XDYA 3EZNA 3A87A 3Q5DA 3HM9A 3MAAC 2YMQA 5BWNA 1G36A 3T9BA 4ALLA 3Q3VA 5JAHA 4RKOB 2X6WA 4I9UA 4AY4A 3RAGA 3V1UA 2WIBA 1NRNH 4QNRA 3CZ5A 5IC4A 1JN0A 4O0LA 1INLA 4B9AA 3EFOA 1ZRHA 5T4BA 4QV2A 2O2HA 4DVAU 4N65A 3ED5A 3T0IA 3PSAA 3REQB 4GHWA 4ZI7F 5B2ZA 1SIUA 1SBHA 2KBFA 2D5AA 3IQFA 1UBJS 3QPCA 5G4KA 1GARA 4S1NA 3VAZA 2M6KA 2I29A 2CNKA 3ZV6A 1TT7A 1T6XA 1KK1A 3SZLA 1WB4A 3M5WA 1Z4MA 2QNIA 3EASA 3LVBA 1CE8B 3CLRD 3DVLA 1IHUA 1EPUA 1ZOMA 3H94A 1QIHA 4NCBA 4GYJA 5TCAA 4JUAA 4YRDA 4KFRA 5L7WA 1TGVA 5BN4B 5KREA 3KUXA 4DMRA 5E95A 2DPMA 5AF9H 1TJPB 1GN8A 1HG0A 4CPDA 2QT1A 2OXIA 3LOPA 1EGAA 3DB1A 1EOLA 1J0AA 3WO0A 2I80A 3FBWA 3HDYA 4LQDA 1W49A 3GNQA 3FB1A 3WQZA 3MNBA 3AF4A 2K8IA 3OHPA 4JS0A 2ZSJA 2ZJ5A 4AW9A 3WLMA 3JD2A 4PZDA 1JG3A 4LNAA 4IC5A 1WCIB 5E1OA 4O0MA 2GESA 1HE4A 4MR9A 3KQEA 1VA4A 1Z0JA 4WWHA 1KYNA 4LF9B 4G5YA 4EHDA 2PUBA 1A8UA 1YBFA 4B44A 1FB5A 3L7BA 3VO9A 3E61A 1ZI9A 1MB2A 2X8BA 2VUIB 3CEJA 4TKVA 1QP4A 3P20A 4NENB 3OF2A 4BMPB 4V0OA 1L5NA 4NSYA 2BIFA 3NUQA 1V8ZA 4NA9H 1K1LA 1SXPA 3AHJA 1OOEA 2NG1A 3RS3A 3TJZA 4BLWA 4GX1A 4CVNA 4OB8A 2PUJA 1OWIA 1SLVB 1CHOF 2NMVA 5A5DA 1AH2A 1IQPA 2PYDA 2ZZEA 2G1KA 2A5YB 3UPEA 5EOVA 5JECA 3LQQA 4RQBA 4GVUA 4FCVA 3HO1A 3UF0A 3VHLB 3PYLA 4B3XA 1V2UT 4GOND 3LY8A 4AULA 3OH8A 4Y71A 1S8FA 3N8DA 4FOOA 3AHFA 4R2KA 2ZQ1A 1ZSNA 1T3LA 1W88A 4P3YA 1VA5A 1RJEA 1ZM7A 3I83A 4PZUA 1L4BA 3SQMA 2QA5A 5ILOA 1LPMA 2AFIE 3QU4A 2WAMA 4RETA 1Y98A 1T31A 5K4HA 1X7YA 3KWLA 1FRFS 7REQB 4XR9A 4LPSA 4QGSA 2FPKA 4IW4E 2VWLA 1EWYA 4QRHA 1PQ4A 1XOIA 1TF5A 4WCFB 2P9QA 1ZOPA 1MH1A 3IP7A 2B69A 2CUTA 2D5IA 3VAYA 1V35A 2OCXA 3R2JA 1LWNA 2J4CA 4OQXA 1TGBA 2XWPA 3WIVA 1TUIA 2E4UA 3PP8A 3CUYA 4OSEA 4BRUA 3D8BA 3INTA 3H1TA 1NO9H 1J15A 3A2MA 2CEKA 1P2VA 2ZPUA 3IEIA 5CFPA 2JAPA 1V48A 1SCKA 2TGPZ 1QHEA 5CH5A 1W36C 4DEYA 1TPZA 1DOZA 2HIGA 4C3ZA 2QGGA 1NQAO 4RCYA 1VXRA 5KWEA 3QXJA 4X1YB 1NFUA 3R4VA 4BVAA 1XJ0A 2XLBA 4DNFA 3P2KA 4MJLA 1W36B 3BTOA 2QSZA 4YXWD 2O8VA 5SYMA 2X86A 4DCPA 5BNZA 3BG5A 1H8DH 1JEEA 4OYHA 1KXJA 3WK9A 2CKMA 4DLRA 5FX2A 2V6NA 3V8QA 4RA6B 1DIGA 1S8NA 2R87A 3ZUGA 4EJMA 3CCFA 5CGQB 2R7LA 1PJ5A 3D5TA 1NLUA 1RQ7A 1L0ZA 2J3DA 1A69A 4YMSA 1TGTA 3I0NA 3ZJTA 3GLHA 2BW0A 1GOTA 3K30A 1A98A 2Z2XA 1UXIA 4WDRA 1MTOA 3BFVA 4HYTA 4WNAA 3W34A 2WEKA 2F3CE 5T3HA 1G2IA 4JSRA 5JO9A 1WLYA 1DFPA 2R8XA 4WL0A 1W12U 4AZWA 1DWBH 1N05A 2PU5A 2R6GA 2VCEA 2V7PA 3L6PA 4R3WA 1K9MD 1MO4A 1Z4PX 2ZU2A 1XLWA 1KY5A 3T5BA 4TWAA 3NTQA 1QB9A 1UTMA 1V4VA 3X2FA 5L4NA 3DE0X 1A7KA 1JQBA 1O3CA 3S27A 2D3LA 2W2TA 1DRWA 3FAKA 3TJNA 3W5SA 3ORFA 3O8QA 3QXSA 2P3FH 1NVGA 3A7XA 1GTG1 5LYJF 2PHZA 1PL6A 5IP5A 4N3GA 5HMLA 4JITA 1U4SA 3TTTA 1B74A 1XDBA 3K65B 1JTEA 1O5FH 3N8NA 4C4PA 3PG5A 4BO5A 1NFQA 2R6DA 3CF4A 1DCKA 1QF9A 2H00A 1FN8A 5C0OE 2ONCA 3U17A 2PBZA 3VO2A 3LQ1A 4X8HA 3KHTA 2XRFA 4LF8B 2GM3A 3IERA 1YUBA 4E0BA 3WLRA 2P0EA 3Q7IA 1ZHOA 3DTTA 4FFDA 1MBMA 1N5RA 1ZZGA 3NORA 5DK6A 3IV7A 3NIGB 4AGJA 3CGGA 3QITA 1XUFA 5CK5A 5K6RA 1CEQA 1H2ZA 1KTVA 4YP5A 5HRAA 1EFHA 2Q7XA 3DVSX 4XGIA 1K7CA 1I1HA 1SN7A 3AWDA 2WAAA 2DXIA 5D01A 4ZO7A 2ZIVB 1U2TA 1BBRK 1FY3A 1HH4A 4RS4A 4JBLA 5EIWA 4Z0NA 3MU4A 2E5FA 4ZAZA 3MTJA 2B30A 3OF3A 3DVAB 5LQDA 5DCUA 3WFIA 1BCRA 1O0SA 4DSTA 1WDKA 1ZHFA 1M1ZA 3K9CA 4AU1A 4G3XA 1K68A 3TNTA 5J58A 3AXSA 4JZ1A 3NHYA 2PPVA 2EFDB 2AG6A 2GI4A 4MITA 3LAWA 1RWPA 2OXEA 3PT5A 1A50B 4I6JA 2OQVA 5DLEA 2YRWA 1JT2A 3JQ6A 2WKRA 2FX6A 1JBQA 1WUNH 2J5UA 3Q76A 3NI2A 2OCVB 3E9CA 2OGSA 5C1BA 1FP1D 1EA7A 1AUOA 5BV7A 4NY1A 4Y8XA 1PPGE 3UB0A 1V5WA 2VH5R 2WHXA 1UBHS 2ZRIA 4GAWA 2PP6A 4U5QA 3ROMA 5A5GA 8LPRA 3V1YA 5L3RA 1GI6A 3NJ8A 4LCBA 3B3AA 3HI6A 3WGUA 4TKOB 2CHFA 3SG0A 3QTLA 4X6LA 4AG5A 3W5AA 1WUHS 2RHBA 4EHLA 5T67A 1IUPA 4IC6A 2JN9A 3K9QO 1JECA 2QA4B 5KX5F 3HXMA 1OWPA 4JUIA 2VJPA 1T2EA 5ALOA 2ZDQA 2FFAA 5AP9A 3SKYA 1OFIA 2V3WA 2DECA 3QXHA 3SNAA 1BMLA 4CF7A 2ZGXH 1Z88A 4BKMA 3W0LB 4ZT6A 2AH4X 2GV6A 3OZTA 4BECA 3C7KA 2YXNA 3ZVMA 1SGNE 1CUZA 4I33A 1OKKD 3V42A 5M29A 4E14A 4LTDA 1VGRA 4JODA 5EPEA 3BIJA 4NIVA 2H2HA 2VP6A 4ZZ3A 4GPZA 2BE9A 4B6RA 4FVBA 2A94A 4RIHA 4HJRA 1MT0A 4M21A 4AUEA 1WPGA 5CNKA 4HNSA 4K9NA 3L0CA 3SU1A 1JW9B 2V6BA 4PYOA 2JATA 1XXDA 1HYQA 2C9OA 3OQ6A 2EARA 5BVHB 3LL7A 2Q5IA 5C4MA 1C0KA 3JZIA 1UM9B 3DM9B 2NM0A 4IZHA 4Z86A 1CQQA 3NR2A 2ZBQA 2AXEA 2O57A 4J43A 2JW5A 1JHDA 4CL0A 5TV2A 1E3XA 4B79A 1FTGA 4I1RA 2WT8A 3AL2A 1F2TA 2XWAA 1Z82A 1K9VF 2E1RA 1YHYA 3UA4A 2O5CA 3J81k 4AJEA 3E0XA 1AS3A 3TQFA 1C3LA 3F6BX 2IDMA 4ZTZB 4CMBA 2P9JA 4WZKA 1J6UA 4YAOA 3MMGA 1RWXA 2BYTA 4JWTA 5ES3A 1VMAA 3UCEA 3D6VA 2R62A 1L8AA 3QSGA 2HJSA 1H3EA 3P0FA 1AMOA 3T5MA 1BCRB 1YI8A 1TRMA 2AMJA 1HJAB 3KWFA 3LHSA 5ALQA 2RDEA 3SLNA 5LYJB 5JH7F 1HYGA 1YBMA 3AUXA 4MZDA 4RF3A 1LJLA 4J1TC 1EFVA 3OPXA 4HWOA 2LIPA 1ECJA 5JNRA 4O9VA 3KUUA 3QFHA 2CWDA 3OQVA 3W05A 1E6LA 4UUQA 2VZ0A 1TWXB 1OAOA 5EKUA 2BELA 3T61A 3V46A 1V16A 4DLLA 3VR5A 4URZR 4F5WA 3OCUA 2VBIA 2I62A 3LBHA 1NBIA 3K1YA 2Y5GA 2PV7A 1XHFA 1KIGH 2I2BA 2P4EA 1NONA 5C4IA 1RWOA 3PHJA 5ALMA 2EG9A 1DG9A 3N2YA 3DCJA 4E4YA 3QK1A 4AIIA 1A5SB 3NNDA 3R5JA 4BEBA 3AMVA 5JBCS 4RD1A 3PNQA 4YAEA 1BVHA 4I3HA 1E59A 2A0KA 4HPWA 1O6CA 2PFEA 2FI1A 1NXWA 3PC7A 3MT7A 1CUFA 3F3KA 2RGNC 4DCDA 3UUGA 2AKEA 1Q9SA 2BMWA 1IY0A 4QXQA 1U7OA 3L7KA 2ZXUA 4QDZA 5CFOA 4NEGA 1MC8A 4RVGA 4QM7A 2FS9A 3IUQA 2QB5A 4PAQA 4W6QA 3CMCO 5SYAA 4HH4A 1P1HA 1WY5A 1DLKB 3MHTA 3VR5H 4K6FA 1NC6A 1KOJA 3R3YA 3G9UA 1ZSVA 1R2QA 2IHKA 3DWEX 4BP9A 1SD5A 4FFBB 2XXAB 3ZTYA 4K87A 2GKVE 2JI9A 1KD1D 3CPJB 3CP8A 2MTBA 3UT6A 4KPYA 3UWPA 5K03A 2I4TA 2H2WA 4YUAA 2PXHA 1KBQA 4RK5A 4AJJA 2E1BA 3MWJA 4A15A 1WSWA 2K6GA 1BJRE 4LZ1H 3TDMA 4OB7A 3SICE 4I32A 1QGUB 3WGTA 3BZBA 1LI7A 1SQFA 1XZLA 5K9ZA 3RXIA 2VIIA 3U4IA 1AB9B 2KJQA 2F2TA 4FU0A 5ECYA 1WPXA 1UTKA 2EZUA 2G8LA 1Z63A 3ZDAA 3R6KA 1BXGA 3DVRX 5FWXA 1ETHA 1PR3A 3HKBB 2RGAA 5LQNA 1GPMA 3T35A 3ZIAA 3BGWA 2I9PA 4E4TA 1HOTA 1QOPB 4CF4A 1FFCA 4QVKA 3BTEE 3GLKA 1JIIA 3THYB 1C4V2 3OHSX 1DIBA 1M72A 3P9SA 5EODA 3EF0A 3SX2A 4OL9A 5LWHA 3AV3A 2QRUA 5DI9A 2BHSA 1NQWA 4RXMA 2TMKA 2WE7A 3WGYA 4ZIRB 3CEAA 3TIIA 5EZ5A 1NUAA 1WU8A 3PIRA 4IOKA 4MMXB 1LCIA 3LFTA 4XDGA 2GXQA 3AUJB 2BFOA 1YK1A 5HKLA 1B93A 1YRLA 3QTBA 3DSOA 4JD5A 5HJ5A 4AN7A 4Q7YA 4R9UC 2WVGA 5BT9A 3OLYA 1VL0A 1N8KA 2COKA 3FIJA 1VLOA 1R9NA 2HI0A 2ZTXA 2CVPA 4MICA 3E9QA 1Y34E 1OFHA 1W9XA 1THPB 3ZHTA 4L8LA 3M0EA 4FI3F 3KVVA 1V43A 1PBTA 2IOQA 4X8VH 2I2XB 3HB9A 4ND8A 1QP7A 3IAFA 1YRHA 4K6HA 4HQLA 4FDUA 2WFLB 1KIFA 1H1LB 2F9FA 2FGKA 2O3RA 3GJQA 4ZVPA 2WAYA 1S9HA 1CIJA 3L5KA 5KNBD 4ND7A 1RZ3A 3IKJA 4RO0A 1BN7A 1KR2A 1F51E 1V3VA 4KO4S 4I8XA 1SVKA 1V8OA 3FZDA 4YP9A 4LDPA 3LLSA 3KOXA 5LXTF 1W29A 2I7DA 4EOGA 1D3AA 1HT1E 1QH9A 3L0SA 3KSAC 2NUTA 4I8IA 2M6RA 3NQ41 2QL7A 1KAMA 3H11A 4JUDX 1BHQ1 4ZVRA 2RDLA 1D6NA 3C5WP 2VWMA 1YA4A 4IF4A 3DQZA 1XE3A 3TQQA 2H65A 2YHIB 1CUJA 2W37A 1VQ5B 2RFLA 1OI3A 1MJNA 5T8KA 1TJ3A 2IYVA 3KQUA 5C1IA 2OILA 3OJCA 3LXUX 4IWYA 1GRNA 1DANH 3E82A 4QREA 1O2YA 1GADO 1XRPA 4PX2A 3RVBA 5BMVF 1TEHA 2J5XA 2RH4A 2FM2A 4MUFA 1E9AA 3FNHA 2RBEA 3R9XB 4MUKA 1CUVA 4IIXA 4CKBB 3L4EA 2EDCA 3NVMB 2AOVA 5EYPA 4PZCA 1KAGA 2YC4C 1I80A 1O94D 3ZHXA 5GIPE 2J08A 4C7JA 2XRYA 4MA0A 1GCTC 5DT2A 4MWOA 5IZCC 2JANA 4K9MA 4XM1A 1IBLB 3SEQA 1QORA 4GPBA 1V8BA 1PR0A 4QBIA 2ZYDA 1M2JA 1H42A 3CXRA 1N2GA 2ZT6A 2HRBA 2QTFA 3EVAA 4UEKA 4DLBA 4XTCS 2W2KA 4X00A 4B0PA 2J45A 4K0RA 3PTBA 4CMKA 1QHRB 1DGQA 2EQBA 4U7GA 4YV1A 4NLLA 3I8XA 3NAGA 1WRBA 4RIEA 1W36D 4P1ZA 3HWSA 1J0BA 5KJEA 4M9ZA 4UUOA 4HAIA 3CV3A 1ZH6A 2I78A 4FNAA 1TOAA 3H7OA 4E08A 1WTHD 3OW7A 5FAXA 4URXR 3VH3A 1ZPCA 5H4GA 1XMVA 1Z38A 1U5BB 2PLRA 3H1FA 4NIYA 1UMKA 1GJBB 3ZZTA 5CVDA 4IV8A 3C5CA 3GY8A 1N2ZA 3KX2A 2PUWA 1ZVQA 4WJKB 3N7DA 1Y0YA 5TVGA 1O87A 1JG2A 3PGMA 3TLBA 2YNBA 1LTOA 3WB2A 2I2FA 3UJBA 5ALEA 4YJFB 4CW7A 3TIFA 1BXZA 1SQAA 4UTXA 5B58C 2RFKC 2B8JA 4ND2A 1J0DA 2QWXA 4UE7H 3AM4A 3WZMA 1RYBA 3DT6A 5DWDA 4RVFA 4EMBA 3M3DA 2XB8A 1Z83A 2CGEA 3PKZA 4YPVA 3D5EA 3GZNB 3TW8A 1BKYA 1Q20A 3AF3A 3D0KA 2ZI5A 1Z2AA 3NHPA 4EPXA 1KMIY 3MJRA 2V3OH 3O3CA 4MXDA 3SOSA 1LSSA 3N87A 4ZJZA 1GPYA 4CL2A 1XKTA 2BHRA 1DAMA 4N5LA 4OQQA 1RJFA 5KSYA 3RKRA 1MU8B 4BJ6A 1CVLA 4HDSA 1JTVA 1NKSA 1QIDA 3VC2A 1MQ8B 2BF7A 1C41A 1MKYA 1EZ4A 3L06A 4DR4B 3B12A 2ZRPA 3HRIA 5KYWA 4D0GA 2DBZA 3HZZA 5HIJA 1CP3A 1ZM9A 1UKZA 3I42A 5FCKA 3FUCA 1DX6A 2WYUA 3Q8LA 3ZWDA 4IDOA 4YWHA 4GPEA 3NIWA 2H4XA 3KYJB 4G1FA 1BYUA 5D8DA 3C3DA 4UE2A 3HDVA 5HMAA 3ZCXA 1N2EA 4UM8B 3RT9A 2OOKA 3AM5A 1KEEA 2G5NA 3SZNA 4CMHA 3G6EB 4ARSA 5C67A 3PKIA 2A0YA 2VIVA 5DM0A 3Q9NA 2PPLA 4KK3A 4ABJA 3VZDA 3WRVA 3S1LA 4IDNA 3Q38A 3TSWA 4FE7A 3PENA 5B57C 2O2XA 1E6MA 2CVZA 4FN4A 3UAIC 4GKVA 4G5GA 2HSEA 2I4IA 2JFHA 2WC1A 4NV1A 1LVYA 3ESRA 4ER6A 5IKXA 1EU1A 3FPCA 1G21E 2C2ZA 4TM8A 5LPEA 5FXMA 4G5RA 1QRUA 1P29A 2BLNA 4YVFA 3ISJA 3ID6C 4KPUA 2G4TA 1NY6A 4IG4A 4XR6A 5A03A 1JSXA 5T6DA 3BXPA 3CZQA 3E8XA 4J0EA 3D81A 3WP0A 2IVZA 2EGUA 3PWSA 3KELA 4JL5A 4CU5A 3BFKA 2WWIA 1OWMA 1EFPA 1OW3B 1A9YA 1C9YA 3E1GA 3RVKA 3UAYA 1L5WA 2WTNA 2QV7A 1O89A 4AURA 3L18A 3LNTA 1JDBC 1EIZA 1WXWA 4Y18A 2QF0A 1RTKA 3MJTA 5K3CA 4KI0A 4L16A 3OA2A 4YRAA 2VO1A 5BUSA 2C88A 1P2IA 5FUWA 2A9QA 1K6EA 3H7IA 3L6DA 1Q3XA 4HQOA 3KU1A 2HJGA 2BOVA 4XVUA 3VO1A 3KM0A 5E1DA 4QTZA 1Q7TA 1THSH 1T0HB 3W7AA 1IMJA 4BAMB 4BNKA 2PH7A 2BH9A 4C0KA 1NI4B 4EHFA 4WUVA 3HSSA 4IOJA 2O06A 4YAFA 3SN6A 2JS7A 2X9GA 4G1VA 4UPDA 5HYOA 3DE1X 1NNI1 1NJID 3ILSA 4TV8F 3HDTA 2CMYA 1KQOA 4ND6A 2WMDA 2VUTA 3RVLA 4XW2A 1RTLA 5JVDB 5LNK6 1N2HA 3PLPA 2W83A 3SJAA 2JH6D 1OKKA 2RAUA 5FT9A 4QLBA 4XUGB 2H9AA 1JLSA 3B82A 3M7UA 3QTVH 4U02A 5GXPA 3OC6A 1O2TA 4B7CA 1R8SA 1W30A 2PMBA 2GDJA 2HT6A 3O3OB 1T6ZA 2JVIA 5FPYA 3HVHA 1U5CA 3C48A 2G1UA 1WJGA 3GK3A 3ZE7A 2RSLA 1YJQA 1Z4JA 1OAOC 3PE4A 2HCRA 2A78A 1NYQA 4UQOA 2BDEA 2CJPA 2C4KA 2QG6A 4XA8A 3OIFA 1MH9A 1M76A 3FSGD 4HFMA 3UUWA 3I4CA 3BD8A 2P4UA 4WERA 1E66A 3FZEA 1CNMA 3UXMA 1Y1LA 5JE8A 1NBEA 3ZVCA 3AU9A 4GKKB 4YWJA 1V41E 2WPMS 4WGFA 5E6RA 4AICA 4L0CA 3GLRA 4M1EA 4UHBA 4DY4A 1TKCA 1XP8A 3GW8A 5B30A 5CGZA 2BZGA 1QJCA 2CNLA 5LFAA 3SUDA 3PZBA 1UJ1A 2OE2A 1F6BA 3F0TA 4Q1VA 2YZ2A 2JARA 3LUFA 1HDXA 1HMPA 1CW2B 4IXMA 1N3IA 2XAUA 3R7LA 3OQNA 2IFTA 1DVAH 4C22A 4QPJC 1KEUA 1VHOA 1A46H 1QR3E 1E3MA 2Y9PB 4Q02A 1WDTA 1GHBG 3RR2A 1Z15A 4JJ4A 1D3TB 5A0FA 2ZYAA 4UVHA 2JLBA 4RVCA 5FA5A 5AOVA 3U16A 3IUEA 4KDFA 4OGKA 2UVPB 1A9RA 1RBZA 1CQWA 2WG0A 5DP9A 3G9ZA 1UM9A 1JDVA 3AR3A 5G1NA 2QVYX 4QKQA 4QDXA 3ADCA 2YVUA 1MV8A 1CY1A 1SRQA 4TMTA 3NT5A 3PHCA 1EFTA 1VE3A 3SFTA 5JI2E 3DQPA 3SSMA 4BVKA 1PNRA 5F78A 3U7QA 5C37A 4Q1BA 1CF9A 2ZHDA 1A3BH 2WABA 1OC4A 4UC0A 3ENKA 4KKDA 4A7PA 1R5JA 4FZ5A 3JWEA 4J6FA 3ZTWA 2GJRA 3FO8D 4PLYA 4GBED 1EG2A 3OF5A 2EXXA 1H0HA 5IN4A 2OM2A 3THWB 4LDQA 1R4NA 5IAJA 1XRNA 2XKKA 1FSZA 2IOFA 1HPGA 5IVHA 4I1PA 1SIOA 1L5LA 1M2EA 4HAYA 2BY5X 4P38A 4EEZA 4E5DA 2OC0A 5E8EH 4X1RU 4N1AA 4C7OB 3WJ1A 2G07A 2WNHA 1G41A 4RHUA 4DUGD 4RBNA 4DLNA 3L8DA 2CZQA 4OK3A 3DZ8A 3PA8A 3PUWA 3TH4H 1X1QA 3USES 4LI3X 2HCJB 1HLGA 2GX4A 3AQIA 4EKNB 3T1VA 5HZMA 4L8VA 5LJLA 3GF4A 1Z0ZA 2J48A 1YD7A 3I8SA 2W6ZA 4D8VA 4YR7A 1GJDB 1DXQA 3KKNA 2ZTVA 2OUAA 1NPTO 4HXYA 1PZGA 5K3FA 3TLXA 2PCJA 2R2WU 1XJQA 1LMWB 2IODA 1L5VA 2IPHA 2J6CA 1E9VA 2A2ZA 1IATA 1GTMA 1PS0A 1T34A 4AN4A 4Q9HA 1ZOOA 5EQSA 5C8YA 3QHQA 3JV7A 3DP9A 1C50A 4CKEB 1J7JA 4YXWA 1SG6A 2AHOA 1W34A 3CCBA 4UBNA 2D0IA 3F5SA 3OIYA 1OXMA 1TF2A 4EKGA 2IHBA 3BDVA 5CCEA 2C5FA 2DJ5A 5AVDA 1F8XA 5H82A 1QPZA 5KYUA 2HBRA 3AGPA 1QTNA 4YJHB 5AW2A 2ZQZA 5FTJA 1V4BA 2F91A 3E9ZA 4BHTA 1KXEA 3KL4A 4XBBA 1TGSZ 1F8FA 4C01A 1PUJA 4RSHA 4KI7A 2JLYA 4KO2S 3SI7A 4PYQA 5FULA 7ESTE 4MPPA 3Q6MA 2ECQA 4UMDA 2CB0A 3CSSA 3HDQA 3I9FA 3VU8A 5L45A 3DD2H 1TZ2A 2Z9CA 1ZOLA 5P8WA 3KCNA 5EIHA 4WFQA 4AC9A 3S2EA 1WSRA 1U6QA 2VWHA 4GOLD 1HAYB 4L5AA 5IBPA 1AGPA 1WX1A 3VSAA 4ON9A 4P82A 1G4AE 3CF0A 2AZXA 3D8NA 1WHTA 1HBJA 2CLDX 4ZVLA 1UMDA 3BH4A 2G9QA 3NK8A 2FIRH 4P3PA 3IAS1 1GAWA 3ENWA 1C29B 3E6AA 4FINA 2WWYA 1P31A 3VNRA 3QX3A 5IBCA 1TTQB 5H83A 3STVA 3FUWA 1NZJA 1ZGGA 3HCAA 1IOLA 2GVNA 4PC6A 3IEKA 5FUVA 3LPMA 1Z37A 4NVRA 2GB4A 1C5PA 2P69A 3USZA 4D79A 3EXIB 1EWKA 3LCJA 5J1TB 1SUCA 2WHYA 4EW6A 3FWKA 1VB5A 1L5YA 4Q24A 4A6XA 4D45A 1V11A 2PX2A 1V2OT 2Z56A 4NA7A 5E7MA 3R0FA 4J1TA 1TRKA 2CY0A 5DGCA 2EP8A 5A4MS 3TWOA 1ISMA 1OREA 1VG0B 2WF8A 3FVRA 5TMEA 1HC7A 1NUUA 2FN7A 3QVLA 2GZAA 1CG6A 3WVNA 1P1FA 1IUNA 4MIKA 2H11A 2HK8A 3ZWCA 2XZOA 2OZKA 3F2HA 2DE8A 4B75A 4QYMA 1EK2A 2ZAIA 3AEYA 2AFHA 2ZYVX 1ZUIA 4F86A 2ZT5A 4WNYA 4A8PA 1VF7A 3GLIE 5K0ZA 4TL6A 3WKAA 2F4LA 2UU9B 3QKRB 3UMMA 1UFVA 1ANKA 5KNCD 4F21A 3ZYDA 3CG4A 4GM1A 1IPHA 1L7OA 5JSUA 3OY6U 5C46F 4BFVA 2RB5A 2NZ8A 1KYZA 4UD9H 1N6IA 3DVQX 2HIMA 4D74A 4CN8A 2ZJYA 5BQXA 4ENWA 4EJ0A 1NOKA 4RJTA 1SVOA 2XGGA 4G26A 2C5AA 4RQUA 2AQHA 4MW6A 3TPCA 1Y4UA 3C6XA 1TCCA 2IT1A 3P45A 4XKWA 1M2VA 2B4AA 5ALFA 3RABA 2Z98A 3R41A 3EEYA 1MT3A 2TRMA 7MDHA 3HJHA 1SK9A 2DQ4A 4X2VA 1VKJA 5BSMA 4OLHA 5GWXA 3CRRA 1Y8ZA 1WB5A 4ACAA 1KZHA 2X3FA 4FXGH 4CGYA 2PGQB 2R8ZA 3ES9A 1OF1A 4GMFA 2FETA 4P93A 1HNXB 4WAUA 1OGJA 4P6YA 4Y6GB 3W9UA 3GGCA 3EVEA 4YT4A 4CM4B 1Y33E 1S85A 1ZQ1A 2XJ4A 4R8KA 3CW9A 2AWOA 4FYYA 3NM5A 2C98A 5F76A 5EFOA 3IAAA 4AZ3A 1PRYA 1QGDA 1UVSH 3VB6A 1ULZA 1CEYA 4MUJA 5DXAA 4NCJA 1XL1A 4F6RB 1TEXA 4Z7OB 2DBQA 2HSWA 3CNEA 1Z6TA 1LX6A 1XU9A 3QM1A 5ITZA 4UFNA 3HO8A 4IS2A 2DQYA 1SQRA 3V1LA 4DIIH 3NWPA 3ATLA 5CG1A 5ER9A 2ZYRA 4KKUA 2QE6A 1PNVA 2EIHA 3L4BA 2XBUA 2XMCA 3VX3A 4D81A 3ZK7A 1KEPA 1X80B 5H0IA 3KJXA 2QL9A 4RPBA 2PX6A 2QK4A 2BHNA 1NNSA 2QAJA 4KGDA 4JENA 3TK1A 1AKWA 1FQWA 1BOFA 2OG1A 1R4MB 1TZJA 1ZNZA 3ZBQA 1LPPA 5JFTA 3FSEA 5DHRA 1B16A 3BN9A 5FIUA 1M0WA 2AMQA 1ODTC 1UVOA 1WP6A 5IJ9A 2VJMA 3OQBA 5AUPB 4G8BA 3P6ZB 5FBRB 1LWOA 5NULA 3CURA 1A9PA 5KVVA 5LQSA 1SG9A 1WY7A 3ND5A 3ZVBA 3GVLA 4KQEA 1P8JA 4OQMA 5C80A 1II9A 2VPZA 3K6YA 2WIDA 2AZ4A 2GN0A 3S99A 1T4GA 1YE5A 2BCEA 4ARIA 2AVDA 1XLUA 3T28A 3EDOA 3R3XA 4NPAA 2YNAA 1GZDA 1V8FA 1QZ8A 1AU9A 1QF7A 1DBVO 3I04A 4LWOA 4PZZA 4XLTA 3K6JA 3OOCA 5FWNA 1B0ZA 2WYHA 1XX6A 4JB0A 5KTMA 2GT7A 2NZYA 2AKAB 3C5VA 3KSDO 3OPNA 4OJTA 1KK0A 2H7CA 1XJCA 2C3MA 4RV5A 1UXGA 2HUPA 4XWOA 2QUIA 4G85A 3SJPA 1VQPB 1JYEA 4O4JB 4B4OA 4NU5A 5JD5A 4R81A 2NTJA 4RM3A 3G6KA 1FQ3A 1SA0B 3PL1A 4RFSA 4KV9A 1ELTA 3M36A 4NMHA 1K89A 3NWBA 2CSXA 5EXEA 5JEEA 3ODPA 2H6EA 3PVZA 1YZ3A 2ZWPA 2EJVA 3W2IA 2BMEA 3HYTA 2IE0A 3QYJA 5IFKA 1GAQA 4I2VA 5C1DA 4G0NA 4LBVA 2LTAA 1CJMA 2NVUA 3QJYA 2QMZA 4WZBE 1SM4A 3Q0EA 3WIOA 3KYDB 5BN1A 4RZXA 2LUOA 4NX2A 3K72B 4DG5A 3ITEA 1E0FD 1Z4KA 1O77A 4ETNA 1NRIA 3AXTA 4IGAA 1V2JT 3HZOA 1HAVA 3DEZA 1E4OA 3GXOA 1PQ7A 2IN2A 2ZE5A 1BRMA 3HB1A 3S68A 1IHXA 3IFSA 3H3XA 4PZAA 1DFIA 3M9WA 4RJLA 5EYPB 4HK4A 3IAM6 1HSZA 4GLFA 3TE6A 1EJAA 4IR7A 2PX5A 4B46A 4JI8B 4R68A 1NF9A 5LA6A 4FMCB 1Y82A 1HTBA 2IXFA 1ZCFA 1H0RA