4NBSA

The structure of aif2gamma subunit h20f from archaeon sulfolobus solfataricus complexed with gdpcp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDFGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title The structure of aIF2gamma subunit H20F from archaeon Sulfolobus solfataricus complexed with GDPCP
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 106
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4nbsA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4nbsA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nbsA01
4AWXA 5JBQA 3UIEA 3CNOA 1E94E 3IGFA 3PVSA 4NYMR 2OLJA 1PLJA 3FYHA 4DLYA 1DAIA 3X2SA 1P73A 2IUTA 3MHPA 5EXXA 3A1SA 1S3SA 1CIPA 4DLXA 3GQBA 2G9NA 1QRAA 4JVMA 2JLVA 1QF9A 2G83A 2OFXA 1EWQA 4HDQB 3QVUA 1KNQA 3RRZA 2ATXA 2FE4A 4FMCF 2JATA 1G5RA 3EZ6A 1E2NA 3V76A 1Z29A 5FR1A 4WIAA 2OTJB 1EFCA 1GL7A 4HATA 4PO8A 3V9PA 2YWGA 4DSUA 1GRQA 1TVCA 2RGBA 3QKTA 5EJEA 4XTCS 2NO9A 2WZQA 3QNUA 2QAGA 1SXJE 2J1LA 2WOOA 1JXMA 3LX8A 2V6JA 4GP7A 5B58C 4TLEA 4X8LA 1Q12A 3EG5A 2HUPA 2WICA 3WRXC 1QVAA 3AUYA 3MJRA 2GK7A 3K0FA 5C46F 1KJYA 1UAAA 1DELA 3QIAA 2VQSA 4MUAA 3K0FB 1NSTA 4GMDA 2XGJA 1W5TA 3OEHD 3PR1A 4B3BA 1CNFA 1DAMA 3QE0A 3CX8A 2ZI5A 2ORWA 5TARA 4B6EA 1KDPA 3C5CA 3UKDA 4A0GA 3Q7PA 3J81k 1G5TA 2VHQA 2IYYA 2G77B 1MRNA 2JEOA 621PA 3SZRA 3MMPA 4X8MA 1K5GA 2QZ4A 4R2HA 1FQJA 3SE0A 1JJ2B 4JLJA 3CRVA 5GADl 2DHRA 2KBFA 2XSZA 2PZFA 4KLZA 1N6LA 5F2EA 3EZ7A 3NIBA 4K81B 4MKGA 5GVRA 2W0MA 1OIVA 4L4UA 4BLTA 1OFIA 4YDSA 3VNUA 2BCJQ 2LWIA 3OE7D 5AJWA 5GJWC 5FPKA 2C99A 2W6JA 2C2HA 1NN3A 3SYLA 1E4VA 3B78A 3C7KA 4V0LA 4EPXA 4ON9A 2ZSFA 1JPNA 1QUFA 2CEAA 4P6VF 1EP3B 3VU9A 2VA8A 2FGKA 4MYHA 1G3QA 3QFCA 4QHTA 3VU9B 3QF4B 3RRNA 5GVSA 2FSIA 2NPIA 1VPLA 3UANA 4DUGA 4HB2A 2NO1A 2QM8A 2IWRA 2G3YA 1IJFA 3GJ6A 4GOKA 5JWRA 2G6BA 2GCPA 5FH9A 3NBYC 3OIUA 1E4YA 1XMJA 3ASYA 5D3MA 1QFJA 2AD5A 4IVRA 1RZ3A 1TAGA 1OIXA 1S1MA 2GF9A 1MKYA 4O2RA 5D3MB 5DN6A 4RFSA 4FWIB 2BBTA 4O2LA 2WJVA 2QGZA 4RFSB 1NRJB 1GDDA 3X1DA 2VP6A 2ZAOA 3TSOA 4DDVA 1GSIA 4A1FA 2OSBA 2AKYA 1GVHA 1VMAA 3FKSA 1ZUHA 3BH0A 4RFVA 2FSFA 1DOAA 4C30A 1W47A 5EUQB 1KMQA 3IIMA 4JLAA 4DCVA 1QHNA 4DCTA 3WNDA 1FRNA 3FGNA 3FVQA 2P6RA 4ZI3A 2JLYA 2RC6A 1KRHA 4G1VA 1E1QA 3GCGA 4BLQA 4JL8A 2IXFA 1VTKA 2WBLC 1QUEA 1N5JA 2ORIA 3QOFA 4EIWA 4MA4A 1NJGA 3BBPA 1JI0A 1E9BA 4TZ0A 3B1XA 3HU3A 2IXEA 1AS0A 1QBKC 4POAA 1JB9A 4G5GA 2C04A 1NIPA 2HXYA 3EWSA 3MCAA 1SVMA 4IEEA 3EZ2A 4P4TA 4P32A 1VQ4B 4TLBA 3RAPR 1E62A 2H18A 4EH1A 4LPKA 1MRSA 2GCNA 2V7QA 1UEJA 4R7ZA 5P21A 1H8HA 1K73D 1NSFA 1Q3TA 2VHUA 1MO6A 2IYWA 3SN6A 1G19A 2IYSA 3KTAA 2O0JA 3HU1A 3CPWB 1KI6A 3SI7A 3KTAB 1N0WA 2HF8A 2Y8EA 1KI6B 5G41A 4EPWA 2GTPA 4KVAA 3O8RA 2JLQA 4E22A 5CB6A 1U2RA 3FHTA 2OE2A 3RVBA 1Z0DA 2JGNA 2R62A 4NCIA 4Q7MB 5LPNA 3SEAA 3WYAA 3K09C 5EP3A 1PUIA 2GZAA 4AG6A 2J0UA 5TMPA 4U00A 1E64A 1KO7A 1B23P 1TEVA 2J0UB 1NJID 1YZTA 1NKTA 1ZAKA 5FL7D 4AIIA 5BN4A 2XX3A 5JLJA 2WKPA 1G7RA 4PPNA 1OH6A 2CBZA 2QY9A 2ZR0A 3M4YA 3EPKA 1QHYA 3ZVLA 2IF0A 1L2TA 1COWA 2FN4A 3Q85A 1FTSA 4XVRA 4YMUA 2IYUA 3TLXA 2J0VA 4RJLA 3N5CA 1QHGA 1OH8A 5DO9A 1TTTA 1E98A 1YR8A 2W83A 1XF9A 2XEXA 5FR2A 3AQ4A 5EP4A 3PUXA 4X8HA 1G64A 2OV2A 2PT5A 2ZSBA 2ZYWX 3AGPA 5JJLA 1KSFX 4KAXA 1Z6TA 2CCKA 2BSAA 1G7TA 1QHSA 4YHBA 1AZTA 1WRBA 3PUWA 4Q01A 5EP1A 5JRZA 4BLOA 2QA4B 3AVPA 1KO8A 3QXJA 1E99A 1P9RA 4MYCA 4F93B 1UKZA 4HZUA 3RABA 3CF0A 2ZXUA 1DARA 4L8GA 3PG5A 4HZUB 3W8NA 2ZPTX 4Y0VA 2ZJZA 4HB4A 3BGWA 1RKBA 4ZGNB 1ZNWA 4IOMA 421PA 2FFAA 4OI0A 1OV4A 4A82A 2X3UA 1LF5A 2DYKA 2Q3MA 3BXZA 3OFND 4NYJR 2ZJ5A 1XPRA 4Q19A 1VDZA 1N6PA 1FDRA 5KHOC 5FOTA 2J5XA 2BF4A 4DLWA 4M0LA 3BIFA 2WWGA 3RC3A 4H1VA 1FMLA 1UEIA 5CLLA 4EQ6A 4Q1CA 2ERXA 1O3YA 2XNSA 4QGGA 4I1OA 1TMKA 5LB2A 3RHFA 3ZDQA 2HDNB 3WXMA 4EQ6B 2XXAA 1S96A 1LV7A 5BN5A 1Y3AA 2QG6A 3W90A 2CLCX 4DKXA 1YHQB 5FBWB 2A9KA 1FNBA 1AGRA 4N0DA 3Q8XB 3EZFA 3AF3A 1Z3IX 2KWIA 3BH7A 2QSZA 1JA1A 4KVGA 3TUZC 3EC1A 4PGOA 1PLKA 2ODWA 4G5OA 4JJZA 4OKSA 4US0R 2OAQ1 3H0KA 1SHKA 4QGAA 4OI2A 3THYA 3E20A 1J9ZA 3NBXX 2RGCA 3BK7A 1ZC4A 1G3MA 3THYB 3KQHA 1GZSA 1T6NA 3ZYCA 5CJ2A 4MGZR 3F5FA 1TQ4A 1SKQA 1LNZA 2O0KA 4LV8B 1QG0A 5J5CA 1YJNB 4F38A 3WNBA 4G1UC 1KHTA 1KOFA 1KSHA 1NMZA 3DMNA 1VCOA 3QXXA 4M1OA 2IA5A 3SQWA 2H57A 2QBYA 1LW7A 3L0OA 5JWOA 1VQ5B 1G5PA 5GJCA 1QHIA 2QBYB 4CEJA 1Z83A 3NTUA 3O8CA 5F3WB 4CEJB 2PX3A 2WSSA 3GLFA 4FD2A 1XJQA 2ZS9A 4C0SA 1I7PA 2Q9BA 1CR4A 2ZEJA 2QRNA 3GLFB 2AXNA 2PBRA 1FW6A 1E2FA 1WXQA 2G0TA 5EXPA 4RZXA 3CCSB 1XTSA 5IK2A 2W2TA 4UXJA 4BFZA 3T06B 1MO4A 5JI2E 2OESA 1E2QA 5E7IA 4EKDA 1US8A 3UMFA 1LF0A 1KI3A 2XITA 1H65A 5B2ZA 1US8B 2IYVA 1FNNA 2YVUA 3IQWA 5EXSA 2OCPA 2BPOA 2PCJA 4Q7JB 4M1KA 1WP9A 3JZAA 1C9KA 2GWHA 1TLLA 1OSNA 3AVUA 5GV8A 1D9XA 2VP2A 3LV8A 4F4IA 1JEDA 3U5ZB 4PZZA 1XXHE 2XB4A 4M8NE 2WV9A 4M1WA 2OBNA 1EFTA 1S72B 1SXJA 3V4RA 1AS2A 2J7PA 1XZQA 3FMOB 1NVVR 3AVVA 1SXJB 2Q6TA 3NBZC 3QBVA 5FPTA 1N2CE 1OF1A 2FEMA 3P32A 3WHLA 1FX0A 3CCVB 2BN4A 4Q9LA 3DOFA 2X8AA 3K0CC 3K70B 1FX0B 1Z0KA 4A36A 5HR5A 1J99A 4OI4A 2QNRA 4G5QA 4AURA 4DLVA 3JQPA 3BWDD 4LOAA 5KNBA 1JNYA 3B1WA 2DY1A 2BMFA 1KIMA 3A37A 3CCRB 2UVQA 4GOXA 2Q21A 1NVWQ 2A5FA 3CLVA 4I81A 6Q21A 3KXIA 3CCJB 4OK5A 3HU2A 3SQXA 4H9GA 3KDSE 3UG7A 2CXXA 1E79D 2IWHA 4OK6A 1OYWA 1W34A 4IOJA 4LX0A 1GRNA 1WCV1 1CULC 2NO7A 3LW7A 3SOPA 2O8BB 1GM5A 3TNFA 2ZUDA 3H86A 1DE0A 1OT3A 3B9QA 4QL3A 3I5YA 3W34A 2OFWA 2J46A 3RLFA 1G8GA 3C5HA 2ZRFA 4ZDKA 4C0KA 1SZPA 4UXHA 2OAP1 1P7CA 1AKEA 2GJAA 5AJZA 4KYIB 2CE2X 5FUXA 3CXCB 1EK0A 1OGJA 3CNNA 1YR7A 3VR5A 2ZI6A 1FP7A 1LFDB 3G5UA 1S9DA 3LNCA 1U8AA 1VG1A 4GNKA 5JWHA 2D62A 2DCUA 1AMOA 3QKRA 4MGKR 1Z47A 1QH0A 3KFVA 1P2VA 4PFSA 2FWRA 3SR0A 4KU4A 3TUIC 4JIMA 1QFZA 4KJZA 4XD7A 3TE6A 5DLQC 4B3XA 5BWMA 1PV4A 2IS4A 4PHTA 1I2MA 3G0HA 2IYLD 2ZYUX 3CR7A 1F20A 3K9NA 2QAGC 3X1ZA 1BMFD 4AKIA 2ZTSA 4NMMA 4FMCB 3BRWD 4JSYA 3U6BA 4TMWA 4LHZA 1E96A 4XJXA 2LCFA 1RRCA 1Z08A 3WYFA 4ZKEA 4LDJA 2CHGA 1II8A 5FI0B 4LBWA 4NZYA 2QPTA 4BPRA 1ZM3A 4UAJA 5THXA 2RGAA 3EASA 3HJNA 1LB1B 1VQ9B 4G5SA 2K5UA 2CCGA 4B47A 4DDTA 5KSWB 2WIBA 3ZGXA 3FJOA 1VECA 2B92A 4C3ZA 2RGGA 4KSBA 5TDHA 4HLQB 4QNMA 3T5DA 3A1UA 4DVGA 3QJYA 2DPXA 5CIWA 1VQLB 1TQ6A 2ZJ2A 3BERA 2EVWX 1G8HA 1BO6A 1UDXA 3IO5A 1GITA 2BEKA 3Q5EA 4BZXA 4WW0A 2Z43A 4Q4LA 4UNQA 4XVUA 5JS8A 2TMKA 2NZ8A 3QQ5A 2BEJA 2XNDA 4HE5A 3MWYW 3CPJB 4BEJA 3ZS8A 2O52A 4NCJA 1D9ZA 1D2MA 3RSLA 3T34A 4Z51A 2QMUA 4V03A 5FOVA 4BFXA 1MABA 3R9XA 2OLKA 4EPYA 2EWWA 2OG2A 3AF0A 3Q3JB 1MABB 2WWXA 2ZI9A 4HB0A 1XTKA 4URWR 1J8YF 4F4JA 4IDNA 5C4MA 2O8EB 1W35A 3OJWA 4EPTA 1QZXA 3H1TA 2MSEB 1DS6A 3VKWA 3NEYA 4Q66C 1VQPB 4GFDA 5L8VA 1I2DA 2RC5A 1OKKD 2RKOA 4R2IA 1T3LA 3U3OA 1Z0AA 2VL7A 1SKYB 1T8TA 2JJ8A 3W6PA 2CNDA 2XNJA 2QEQA 4BFSA 2JLSA 2ERYA 3CH4B 3GFPA 3SYKA 3X1YA 2EW1A 4ZIRB 1ZM4A 1TNDA 1GKIA 1RPZA 2H7VA 4Q1EA 2ZS8A 3T1TA 4NCKA 4PHGA 5SZHB 2VPPA 2WPDD 1G3RA 3Q5DA 2RB4A 3PCRB 4BFYA 1DAGA 3MG9A 4MRSA 5JHGB 3O8BA 3QG5A 3LO8A 1XTQA 1U98A 2P0EA 3P26A 2A5DA 4C4PA 1NI3A 3OEHA 4HLUC 4K8OA 2N1BA 2QGNA 1CS4C 1E2LA 3LAWA 5DGXA 1J70A 2GAOA 3I92A 3W5JA 5AUPB 3FMIA 2VHTA 2Q3HA 4M9QA 1X8KA 3AP1A 4AYWA 4ARZA 3FHOA 5TB5A 4NTZA 1W44A 3QKSB 3RRMA 1ELOA 4ARZB 1ONBA 4C0HA 2REOA 2ZJYA 4PPGA 4V0NA 1MO3A 3KL4A 3QXSA 3VHLB 3AF2A 4RCYA 3KX2A 4AD8A 4DHEA 3DKVA 2A30A 3RYTC 1UBGA 4DLTA 4GZLA 2B8WA 1AJEA 1UADA 3QFRA 1KI9A 4QBFA 4LRWA 4OJQA 3P4YA 1WE2A 4JL6A 3OW2B 2HF9A 4ZGQB 1ZU5A 5BYJA 4V0OA 2R6GA 2X1VA 3QBTA 1TF7A 4C0AC 1BKDR 1QGYA 4IHQA 3AVXA 3L8YA 5FI1B 3QSYA 4LHYA 3DZDA 1YITB 4YLGA 5IRCD 4RD4A 2DWPA 1N6RA 3QXCA 2O0HA 2OO7A 4R9UC 4B71A 4LJ7A 2WMNB 2JA1A 4A9AA 5JMTA 4JT2A 1KI2A 1BX0A 1W2BB 2QMOA 2GHIA 5B64A 1S4QA 1XPUA 2VO1A 2HV8A 2QPAA 2D2EA 1TUEA 1SGWA 2VSOA 4B44A 4UNPA 3ND8A 3RSOA 3A1TA 2IS2A 1E9SA 4LJ6A 4LV5B 5JECA 2JIZA 2QM7A 4PSAA 3TVTA 4B33A 4TTRA 3S1AA 4IDHA 1LS6A 1EGAA 3CPHA 4F91B 1R8QA 1XCPA 2F1JA 3S1AB 5FA6A 2BWJA 1NBMD 2F55A 2X19A 2WAYA 2OT3B 4KCGA 5KPDA 2DFLA 2ONJA 3GJ5A 4LYFA 2OM2A 5JFGA 2W6ID 4BPBA 3LXRA 2VTKA 4N3GA 2ZJOA 2HYIC 2F1RA 3F8TA 4LV6A 1G4UR 1CRPA 3NC1C 4AYXA 4QJ4A 4PAOA 3G82C 3AVQA 3GJXC 2RGNA 1YJ5A 1ZCBA 3LQRA 4TWZA 1F60A 3R8FA 1NG9A 3OIYA 3UWOA 2AR7A 2IYZA 4JMPA 4OQMA 2EYQA 4PPQA 2KSQA 1YKSA 1HQCA 3JZMA 5AJXA 1AZSC 2ODBA 4MKIA 3T1QA 4TT3D 4DB2A 1CJTC 1XXHA 2D2FA 2FU5C 2ZVPX 3E1SA 4M9SA 1M7BA 3OESA 1R7RA 1XXHB 5UKDA 3UATA 1L8QA 1N6NA 3ZJYA 2IL1A 2V3CC 2C78A 2ZE8A 5HZKA 1AQYA 3NXSA 1P3JA 3B1ZA 2V1UA 4TLDA 1Q81D 2W2VA 3EA5A 3FKQA 1KKLA 3VR6A 2FH5B 4S2EA 4D81A 2J0SA 3D6TB 3W6OA 3BB3A 3KKMA 4OJKA 3ZQJA 3VX4A 1E2MA 1W4BA 2V4ZA 2WJGA 4JVSB 5FL7A 2QAGB 3SU8A 3P27A 3IPYA 2ORVA 2I1VB 3I3SR 1R8SA 1GNRA 1KJWA 4MYTA 3B5JA 4JBWA 4DT1A 2A3RA 4F4CA 3L0PA 4DLRA 4DT1B 2CNWD 4Q4HA 3CZPA 4OQLA 2BMDA 4PANA 1W36C 3ND9A 3LLUA 5FOXA 1ZM7A 5KSYA 3ES9A 1XE1A 2VZLA 3AKDA 2GXAA 4Q02A 3U7EB 4Z1MD 4M53A 2O5VA 4A0FA 4TMVA 3KXKA 4Q1FA 2YJTD 1T4GA 3GFTA 2CE7A 1ZM2A 3FFBA 3IQXA 3AKYA 1HE8B 2WJHA 1UKVY 2LKDA 2RCNA 5KTYA 1YQTA 1YI2B 4FMBB 2XJ9A 3KQUA 2ZR7A 4HEJA 5KNDA 2I1QA 4LC0A 1ETUA 1KAGA 4Q1BA 5HTKA 1XEWX 2PEYA 3SYNA 4KBFA 1DG3A 3EAQA 3Q72A 1WA5A 1GKUB 4JZKA 2VSXA 3W2IA 4TZ6A 2AFIE 2C8VA 2IYTA 4O3MA 5JRJA 1N6IA 2ZAMA 1D1NA 3TK1A 2IHYA 4WZ6A 1XEFA 2QRZA 3OFNA 4QRHA 3PUVA 3UK6A 4NYIR 4Q4AA 3N2EA 3A8TA 4ESHA 1TQ2A 1TF5A 3W2HA 2NO6A 2QP9X 4OL0A 1VG8A 3HPRA 3KKPA 1G16A 1W5SA 1XCGB 3FFAA 3HR7A 3OZXA 4EFLA 5KO2A 1Z0IA 2AHOA 4P31A 1SXJC 2JLUA 4RCZA 1CU1A 4Q7KA 4HAXA 5M04A 3U60B 1S0UA 2R6DA 2YNMA 4BEBA 4DXAA 4RD2A 5BYKA 1DBSA 4JT4A 2J0QA 3VKHA 1I4TD 4MUBA 3K70C 4GOJA 3BB4A 1ESNA 5SZKB 2P3SA 1DAHA 5IT5A 2BKEA 1UMKA 4DJTA 2BMWA 4JS0A 5CLQA 3AEZA 3CRW1 3LBNA 4GP6A 2YZ2A 2QQEA 3LXXA 4V0MA 2DETA 4I1SA 4CEHA 2ZRBA 2NIPA 4CZ2A 2IXGA 5KNCA 1CJUC 3TGPA 3OIVA 1JXOA 2J3EA 2NTYC 2NQ2C 2ATVA 2ZIAA 3DDCA 2FSGA 2ZRDA 2N46A 2W0SA 1JPJA 3CM0A 1GKYA 3A36A 4LZZA 3HP1A 3ADCA 1IN5A 4P3YA 1OLOA 2QN6A 3CH5A 4HLUA 4CEIA 3DMDA 4QJ5A 2BV3A 1S2MA 4DWJA 1VKJA 5HKKD 5K8UA 4CEIB 1FL9A 5L3SA 4NYMQ 3PFIA 2BBOA 4L5BA 4TQUS 5L3SB 2ZRLA 3CIOA 5TR9A 3V00A 2FJUA 2EFGA 5KSPA 5H59A 1GP2A 1OW3B 1W46A 2F9MA 4FN5A 3ADKA 3EC2A 4C2UA 3NWJA 4AI6A 2A5JA 4BUJA 4RKFA 4JLKA 1M8PA 1V43A 1E2EA 1EG7A 3LVBA 3TKLA 3I1FA 4GL2A 1IJEA 2CRVA 3L82B 3NBFA 3CW2A 2OCYC 4M1SA 1M1YE 1G20E 4DQKA 4Q48A 2R8RA 1OFUX 4DZZA 1W7AA 1E9DA 3IEUA 4JLOA 3CWQA 1G17A 2IT1A 3OAAA 1HA3A 1II0A 1L4UA 3LWNA 3T5GA 4OHWA 1E9AA 1QHHA 4BFTA 4D26A 1RW4A 3ZIAD 4FW9A 1NL3A 1CJMA 2A78A 1QHHB 3QEOA 5GJVC 1HEIA 2GEDA 1IN8A 2GA8A 1UKYA 2ZRJA 2CMKA 3R9WA 3A4LA 1SKYE 3LA6A 1KO1A 2UZ3A 2R6AA 1ZC3A 2W00A 4JLNA 3QE2A 2VH5R 1P5ZB 3HDTA 2QP3A 4JLVA 3THWA 4B3GA 4K1XA 3JVVA 2GVDC 1IAQA 1GOTA 5G40A 1CLUA 2WKQA 3THWB 4TMTA 2ZVQX 4YMWA 3W5HA 2EWVA 2QROA 1IN7A 4V0KA 5EP2A 2FFBA 2XOKD 1GG2A 1TL7C 2VF8A 1YR9A 2E87A 3AKCA 1JAIA 3ZC3A 2QENA 2CJWA 2ONKA 5DI9A 2ZI4A 3BFVA 3MUFA 4LUCA 1XU4A 4M2LA 5K8TA 2CJWB 1MO5A 3FHCB 1J7KA 1E79A 1XEXA 2J45A 1PLLA 3AVTA 2R44A 3I4LA 4XSGA 1NKSA 1BOFA 1XDBA 1XEXB 2UZIR 4PR0A 4QG7A 2F9LA 1HURA 1D2NA 1TF2A 1NN5A 4IDOA 3B2EA 2ZRCA 2XTZA 5FBRB 4DLSA 3B1VA 3NH9A 1N5IA 2A2ZA 4HUTA 4KO8A 721PA 1CJKC 3VR1A 1CR0A 2ZJAA 1G8FA 1RRFA 2EFEB 1QDEA 1R5BA 3B60A 1ANKA 3AUXA 4NDZA 1Z2AA 3Q7QA 2RGXA 1E0KA 3WYGA 2W58A 3WBJA 5GV7A 2GEUA 3I32A 1E0AA 4RD6A 1KI4A 1U9IA 1E1RD 1CJVC 2A7QA 2R6FA 3LRPA 1K8AD 3RWMB 3NVAA 3I56B 2QT0A 4UJ5A 4CDGA 2C03A 3GLHE 5CITA 4RD1A 1YJ9B 4ZCIA 1XMSA 4IVPA 2ZRGA 4B74A 1EXMA 2KI5A 1EWRA 4TL6A 4B3DA 1R5OA 2REBA 2FZLA 1OXTA 2XTNA 4YAOA 4C0JA 5C2JB 4D0NA 1TQDA 3CX6A 4PO1A 2XXAB 3T1VA 4G3XA 2JDID 4TYPA 4XH9B 3ZS9A 5LBIA 1BMFA 2JJ1D 1GL9B 1IN4A 4ZDWA 1CBUA 4UNSA 5FOWA 3P20A 2QMHA 1OH5A 3MLEA 4CVNA 3ZVMA 2IUUA 1CP2A 2JCSA 1KZ7B 1HV8A 1E3MA 2ODNA 4B34A 4Q47A 1KDRA 4NP6A 5J4LA 4P4UA 2AN9A 1WBBA 1E63A 4AC9A 1YZGA 4ZDJA 2WWIA 1X86B 3LH5A 4BASA 4AF7A 4TTQA 4JBXA 1XJCA 3VO1A 3MRSA 4DDWA 1IN6A 1A8PA 4LJ5A 2OCBA 3U4QA 4KHZA 4G0NA 4Q03A 1GVNB 3IPXA 4FWTA 2DEUA 3BOSA 3HWSA 4RKEA 3ETLA 3T35A 4D0LB 3A6PC 1M2OB 2A5YB 3AF4A 4LBYA 4Z54A 1AGPA 2X2EA 1Q0UA 5KOYA 1TPZA 1ZNXA 4Q9HA 2GAAA 4LC1A 4CT4B 2YKGA 2FZ4A 3M0EA 2VNJA 2CHVA 2GDJA 3H84A 3B7GA 4GBMA 3EIHA 3ZH9B 1G1MA 1ZNZA 3IUYA 4U9UA 1GFIA 521PA 3ZD7A 2H5EA 1TU4A 1W0JD 1W1WA 5A0FA 4AKEA 2B7CA 2QDXA 4C0LA 1E1QD 1U0LA 1HT1E 1XB2A 1P2SA 2IYXA 2QT1A 3VHXA 4C9BA 5HCIA 1VG9B 4B3FX 1A82A 3CPEA 1XMIA 2PJZA 4HAWA 3TAHA 5AUOB 4AYTA 3HYRA 1E2GA 5CK4A 1E2IA 1OE0A 3AVOA 3ZZUA 2ZUCA 4EJSA 5KYKA 1NLFA 1OKKA 4EJSB 3NDBB 2BKUA 4GPTA 2QSYA 4IXNA 4ESVA 4JYBA 3QY0A 2ZJBA 4UNNA 2PT7A 1KD1D 2JLZA 4B32A 1VHTA 2YWHA 5AUNB 3DVLA 2QTFA 1M90D 4MYUA 3E5HA 3F0TA 5FTJA 4YAWA 1T5IA 3IILA 4C7OA 4N3NA 5EE0A 4M21A 1CF4A 2QQ0A 4MRNA 4URZR 2GNOA 2WPDA 4QGHA 4C7OB 1OHHD 3GJ3A 1VQ7B 4Q1DA 2GEVA 4WA7A 3W2EA 3OHMA 1FPMA 4AY2A 2PIAA 1GWNA 4NONA 4OQFA 1HUQA 1P61B 4MITA 4OHXA 2PCLA 1ZD1A 2H17A 1VQKB 1TUIA 4DSOA 4C43A 1Z8FA 1VIAA 1ZP6A 1N25A 2PZGA 4P4SA 4ERNA 2VLIA 4P4SB 3H4MA 1WB9A 3RS4A 2PLRA 2MMGA 4L9SA 3A4NA 2Z5FA 2GCOA 4OQNA 3B85A 4JLPA 3VR3A 4NPHA 4TYNA 4NYJQ 2RGNC 2DWOA 2WHXA 3AV0B 2GCOB 2CVHA 2ZJ8A 4F7DA 2XB2A 1VCMA 4HSEA 3WP0A 2DERA 4NH0A 1HE1C 3TSZA 4CRWB 4DBLC 5J4KA 1QG2A 2BMJA 5J4HA 4YXWA 2IEYA 3AP2A 5E4FA 1EFRD 1XZPA 1F5NA 2RHDA 3L2OB 3GPLA 4M1TA 4YDHB 2ZU0C 4FCVA 4B76A 2FF7A 4NCHA 2SHKA 1X1RA 2CL0X 3LQQA 4IDQA 3W3ZB 2OHFA 3TAUA 1JALA 1S9HA 3THOA 3CNLA 4B35A 3QKRB 3A58B 3TR0A 3OIWA 2QE7D 3LW8A 4W5JA 1SHZA 5EZ5A 2C9OA 1NG1A 4M1YA 1QFYA 1ZM9A 4DB4A 3KUCA 1GAJA 2PX0A 5FUWA 2F1HA 3GLGA 4XSHA 2QUZA 1SVWA 2R6CA 4MRRA 3GLGB 3GMTA 4ACBA 4P33A 2ZSEA 1CEEA 4ZCLA 1GAQA 3KJGA 2KBEA 2AK3A 4F7WA 4DSTA 3CCEB 5JEDA 5G53C 3WBKA 2F3RA 1CXZA 1S1CA 3IHWA 1DG1G 3W5VA 2BHRA 5JHHB 4MRPA 1JR6A 5E7MA 3W5IA 3CRQA 1PZNA 1U0JA 4BE7B 1II8B 3FWYA 4V0ME 4II7A 3EW9A 2OILA 5E7JA 1P60A 4HDCA 4U7DA 4HLCA 3ASZA 2CK3D 4K46A 1T5LA 1NBMA 4DLZA 2FSHA 4I99A 3TJZA 3MGCA 3DKPA 4IW3B 1NVUQ 4X8OA 1EWYA 3AVWA 3K9LA 3OZWA 1EX7A 2D4HA 1XBTA 2VBCA 3AH8A 3K1JA 4BLPA 1H85A 1G3IA 2H8KA 4Q4JA 2W6IA 1XRJA 5CIQA 3QPWA 1AK2A 3RS2A 2DB3A 1W2GA 4BFWA 4Q4JB 2GQFA 3U3KA 4GDFA 2JLRA 1P2TA 3OEEA 2G88A 4QFMA 3TR5A 4MGIR 2Z0MA 1L4YA 4IJMA 1SQ5A 1T8UA 4I1VA 3FOZA 2MSDB 1XEWY 4PSVA 2JLWA 1HYQA 5BN3A 3OZUA 4N0EA 4NU0A 4UJ3A 3UMSA 4TT3A 1LVGA 1NVVQ 4D4MA 2LKCA 1XP8A 2J41A 4MGYR 4A92A 2UKDA 5FL3A 1MT0A 1NY5A 3UWKA 1G6HA 3GD7A 1XD9A 2HT6A 2YOGA 3BE4A 2XZLA 1Z28A 4D4LA 2GVZC 5AUQA 4QHSA 4IFBA 1G8YA 1R0WA 1EP1B 5IK2D 1NNEA 1Q86D 2C9YA 5FBVB 3M1IA 3IIJA 1E69A 4KV9A 4HDOB 4Q9IA 2JLXA 5DH9A 1SVLA 3FPAA 2OBLA 2IYRA 2V1XA 3OF5A 3LO5A 1TU3A 4GI7A 4DC9A 4CT5A 3REGA 3KB1A 5C4GB 1C4OA 4Q4AB 3MFYA 4Q18A 2HEIA 1FTNA 4HAVA 4B43A 4Q5IA 1AKYA 4XTRA 1VYTA 1NF3A 1XPOA 1M34E 1W48A 4TLAA 4PHHA 3KQLA 1ZRHA 1BYIA 1OH7A 2AX4A 2CNWA 3E70C 1RRGA 2J7PD 3N2IA 1XD2A 5AJYA 2F3TA 2ZSAA 3SJCA 2OTLB 4J0QA 3GLIA 1QX4A 4LBVA 4ASUD 1XD2B 4LK2A 1OYYA 1W4CA 4I4LA 4Y0AA 1GAWA 3GLIB 4Z1MA 4MH0R 2D06A 3QKUA 5FUYA 1U81A 1KAOA 3SJBA 1A4RA 3U3RA 5ANRB 4ZI2A 2PJRA 4D82A 3TQCA 2PEZA 1L7VC 3SHWA 3W2FA 3ONWA 3DO6A 2ZITA 3HR8A 1EESA 1FMJA 2QORA 5BQ5A 4IOLA 1Q1BA 2AFHE 1ZIPA 2AKAB 1KO5A 1X1SA 1KO4A 3K8YA 3OE7A 5SZJA 2QP4A 1OIWA 1WMSA 2V9PA 3O8DA 2WJJA 2B7BA 1Z22A 4LHVA 3SBDA 2FPMA 4JVLA 3GLHA 5CJPA 2VIIA 4JLBA 1G21E 1I4DD 3GLHB 2I4IA 2ZRNA 4EDHA 1LY1A 2OCAA 4M4SA 2VEDA 1Z07A 4DSNA 5HE8A 3U6KA 4Y7CA 2OXRA 2OXCA 3U44A 4HZIA 5J4VA 4UXIA 1GJRA 3U44B 4GZMA 4QBHA 1JR3D 2RMKA 1RJ9A 4ZV4A 1EX6A 2GETA 4LJAA 3IEVA 4PO9A 5FTNA 3I61A 1N8RD 2YOFA 4QC2A 1N5KA 2RAPA 2RH5A 2DR3A 4OBEA 3T15A 4WZAE 1KTVA 1M74A 3R9IA 4DCNA 1BYUA 2FPLA 3DM9B 2EFHB 1E2KA 1YR6A 2BBWA 4URUR 2KJQA 1IONA 2WMOB 2BOVA 1FQKA 4IKEA 2NGRA 4M1MA 5EXTA 4QXAA 4ZDIA 1VCNA 2OK8A 1R0YA 4FK8A 1KYIA 4AK9A 2Z83A 2AD1A 3UXMA 1CKEA 1YHNA 4TQAA 5EUMA 2HCJB 1Z6GA 1H8ED 2WJIA 1N6HA 1ZIOA 2BJVA 3SJAA 3UMRA 4XOIA 3PUZA 4B2LA 3ZD6A 2O8DA 5HKKA 2QU8A 3NDPA 2O8DB 5CYOA 4A0HA 3DOEA 3W6NA 1GTVA 2C5LA 3SBEA 3QI2A 4DIEA 4WVFA 1KC8D 4FINA 4OHVA 2FA9A 3T1OA 5JJIA 1F3OA 3CCLB 5FOUA 1A2KC 2HLDD 4DEYA 1B2RA 1G4AE 1K5DA 2BIFA 1WQ1R 3M6AA 4RY2A 2EIXA 1X8LA 4LJ9A 1VQ8B 1HTWA 1TEXA 1U9IC 5JEEA 1VQ6B 1OGIA 3LBIA 1ZINA 2HYDA 3L0IB 1Z06A 4MQBA 3NHBA 1GRRA 1DDIA 2WOJA 2FGJA 3AP3A 4BQSA 2OUKA 2ZRIA 3GJ7A 3I73A 2YYZA 121PA 1KDTA 3VR4A 3ZLJA 4LJ8A 1XWIA 4Q1AA 4KFRA 3ZIAA 2FNAA 4EPVA 4HUQA 3IBGA 4M9XA 3RNLA 2AK2A 1SVKA 4HUQB 3B6EA 2C9CA 3SFZA 2IBMA 4FCTA 1DAKA 821PA 3W5UA 1Z5ZA 2QPOA 2CVFA 3I55B 5FPYA 3C4JA 1JBKA 2D3WA 2ZSDA 3K0AA 3GFOA 1E2DA 4ZPXA 1LS1A 2A5GA 4TL9A 1WBDA 3K0AB 4YONB 4G01B 3HYTA 2YOHA 4XWAA 3WRYC 2VP4A 1P9NA 4C0BA 1A7JA 2XOKA 5F9HA 3GP8A 1ZJ6A 4PQYA 1IXSB 3R8CA 1G7SA 2BGJA 3UG6A 2FDCA 4TLCA 5LD2C 3WHKA 1AM4D 3VMFA 3PEYA 4A0RA 4Q4HB 2NOAA 1RYHA 2IYQA 4XWOA 2F7SA 2Q0HA 3K0EA 1BJKA 2GJSA 3KKNA 3TRFA 3MD0A 5JJKA 3KJIA 3G71B 2V54A 2ZROA 4P0TA 3IBYA 3VO2A 1BIFA 3MSXA 3U3JA 1VQNB 4PX9A 4A2PA 1KGDA 1Z0FA 4HYYA 2ASEA 3BH6A 3KKOA 4O25A 4YMVA 1W0KD 3W9YA 4CYMA 2HCBA 4NKRA 2YWEA 1E9RA 2OFOA 3AVYA 3N70A 1DAFA 5B30A 3D7MA 4DLUA 2QMEA 3QEJA 4D2IA 2D74A 5KUTA 4U5XA 3FTQA 5DYGA 2GXUA 3U3MA 1E1RA 4PZYA 4A8JA 2Z4SA 1A2BA 1XTJA 4G5RA 4DCSA 1DO0A 1ESMA 4A8JB 1OXUA 1AS3A 4WOPA 4ZCMA 1HT2E 4UKDA 1PUJA 4NE2A 3JVUA 5HE9A 2EFDB 5AWFC 4GSYA 3P4XA 4EJSC 3DEFA 4PC2A 2QTZA 4PC7A 2H92A 4CIDA 3L43A 5KDOA 4JLMA 3CO5A 3CZQA 4FMDF 3U2QA 5LDDC 4TL8A 1KK0A 2R6HA 3Q9LA 4TL7A 4BFVA 1GNQA 1JR3E 2JDIA 3EXAA 1YIJB 5EMNA 1R5NA 2JJ1A 3CC4B 2IX3A 5J40A 4KITB 3GLGE 2OZEA 5EZ6B 3EPHA 1FNCA 1V5WA 1NN0A 2DBYA 1QVFB 3QF4A 4B48A 2BGIA 2JJ2D 3EX7C 1RE0A 1JEEA 3KFXA 4E03A 1OJLA 3CRMA 4AF6A 4CEHB 2DFTA 1QG4A 2ZQ5A 3QPVA 4PXAA 2GZDA 1ZU4A 2IHBA 4D80A 4MKFA 5GJBA 3HPQA 1FOEB 1T9HA 1W4AA 4WXPA 5H68A 4W9MC 1DTSA 2G1KA 1RFLA 4PSKA 3LY5A 1XX6A 1E9EA 3UPUA 2BDTA 5AR1A 2FX3A 2I3BA 2N42A 4E5UA 1ZVQA 4JL5A 1ZYUA 2BCGY 1Z6YA 4Q00A 1U94A 1QVGB 2IC5A 4CGZA 4BGDA 3QXHA 1NBME 4LJYA 1YJWB 5CM9C 5J4YA 1N6KA 4YAUA 1UBFA 5DE3A 4URYR 5IF9A 2FV8A 2JIZD 1IXRC 3CX7A 1OXSC 4WZBE 5L3VA 1W36B 3RS3A 3LDAA 2Q9AA 4QBIA 1W0JA 3D8BA 2ANCA 4QBGB 4BLSA 1A1VA 1NMYA 4AKGA 1DAEA 5FPHA 4URVR 2GESA 3PXGA 1GIAA 1YRAA 4PC1A 2JASA 5FBQB 4US2R 2OEPA 3VX3A 4HLDA 4QOSA 1Q1QA 5ELXA 3IDQA 5SZIA 1VHLA 4Q7LA 1RVDA 4PPFA 3LBHA 3W2GA 1MV5A 3B82A 2AWNA 1AN0A 4QHYA 2V8OA 2EYUA 4O0MA 3LVQE 3RS7A 4TSFD 3IKJA 1E2JA 3TH5A 5E3HA 5IHPA 3MWLA 4KI0A 2WWWA 2ZI7A 1NLZA 4DRZA 1IB0A 4YAFA 1OFHA 1N0VC 3QPUA 2C96A 2VP9A 1RIFA 3RC8A 1P75A 3FPKA 1CQXA 2ECKA 5FUVA 5HXBA 1NLYA 5FTKA 5FTMA 3PENA 1X6VA 2GBLA 4YMSA 4I1UA 1NP6A 3BFKA 2IF2A 3K9GA 1JECA 3WMGA 3PEWA 2F6RA 4HI0E 5KSOA 4C2TA 5DISB 1OHHA 2EQBA 4HE6A 4A15A 1KSGA 3RDPA 3CCUB 1FUUA 1M7HA 3KJEA 1VYUA 4PC6A 4M22A 4KLNA 3AM1A 5CK5A 1NMXA 1G3UA 1HH4A 3ZBUA 4TYYA 3G4SB 1T0JB 3RRYA 4KSCA 2NMVA 4LWZA 4IDPA 3C15C 4UQOA 1X8JA 4DDUA 4KODA 2V55B 4KFUA 2VNHA 2CL6X 1JA0A 1ZD9A 3MWKA 2DFNA 2QTLA 1AIPA 3PQCA 3GLIE 3KUDA 1Q7YD 1XTRA 1RC8A 1YVDA 3REFA 2R2AA 2GXQA 2OK7A 3C41J 4B2IA 2VHJA 3CMEB 1KI7A 4NYIQ 4DEXA 4Y9UA 2GZHA 3ADDA 4LPSA 5FBLB 3PIRA 4BRWA 3U7HB 4D4JA 1TADA 3VR2A 5CB8A 5G3YA 1EFRA 3ZVNA 2JAQA 4TMZA 2YC2C 4IXMA 3WMEA 1KZGB 1T0HB 4TN1A 3AKEA 2VSFA 4PAMA 4D6PA 1H42A 3SJZA 3GEHA 3B8HA 3QG1A 2P6NA 4BFUA 1DVRA 4W5WA 4BRUA 4BZPA 1N3BA 1G18A 3BB1A 5JI3E 2FEOA 2QE7A 2ZRKA 1ZBDA 2ZYVX 4PTLA 4HB3A 2VNIA 2XSZD 4QJ3A 1YZUA 3BS4A 3TQFA 2O8CA 5F9FA 2O8CB 3L0SA 3DM5A 5FPSA 5KU1A 1U90A 4RZ2A 4RSGA 1G7CA 2QTVB 3PEUA 3CF6R 5CDFE 2W6JD 2C98A 3LX5A 2HJVA 2FPKA 1NJFA 2W2XA 1OFTA 2XZPA 3R20A 4OI1A 1KK3A 1VYVA 1S3GA 1CR1A 2P5TB 3CC2B 2WVJA 4CW7A 2HXSA 4RZ3A 1GNPA 5HCNA 3GJ0A 1FNDA 3JQRA 5C1BA 1P72A 5K8IA 4DUGD 3EA0A 3QENA 4B3CA 1FNMA 1IXZA 1E0SA 1JJVA 4QM7A 3I72A 1TX4B 3TBKA 1E32A 3E1YE 2VNKA 2WWHA 1ZMXA 1E9CA 5DYIA 2AWOA 2QI9C 2CK3A 2VRWA 2XAUA 1DDGA 5DN6D 3DL0A 3CRZA 1Z6AA 1FP6A 4M9ZA 4PHFA 5LD2B 1KJZA 1CRQA 4AG5A 4OK3A 3U4QB 1ZD8A 4F92B 2PLFA 2PZEA 2C77A 4ZO4A 3IHLA 4MKHA 1KK1A 2VYQA 1YZQA 1XFAA 3ZBTA 3IIKA 2FG5A 4L9WA 1IY2A 4ABYA 1RYFA 4US1R 4PQFA 4JKYA 1XNJA 1G8PA 1N6OA 221PA 2H1LA 5TVKA 1R2QA 2XTMA 3FKSD 3BD9A 3B1YA 5H8WA 4B73A 1Q82D 5KSZA 3GJ4A 4B2PA 1UJ2A 5H1YA 1DEKA 3GEEA 3NHAA 4KFTA 4LBZA 1XJ0A 4JBYA 8OHMA 2NPFA 2PMKA 3VAAA 1NY6A 3U7FB 2X2FA 4WBSA 3EPJA 5JCZA 4BECA 2P2LA 4ACAA 3U7GA 1W49A 1EFUA 1ODFA 3BJIC 3RWOA 1T3SA 4YMTA 2F1IA 2BM0A 3WNCA 1VCIA 1YZLA 2ZYTX 1T91A 4A2QA 5BXQC 2V7QD 4NL4H 4EFNA 3VKGA 2EFCB 1X3SA 1Q21A 3CCQB 1H8HD 2Z4RA 1DO2A 3DZ8A 4LYAA 4BWYA 1EP2B 2WWYA 3EARA 2CHQA 4MDFA 1WDTA 2J59A 1D8TA 3TVDA 1W4RA 3BORA 3OAAD 1U0HC 3NH6A 4NHOA 1OXXK 3JQQA 1KKMA 2RGDA 3CBQA 2HT1A 1IQPA 2G1JA 2GPJA 2IK8A 1CTQA 4TYWA 2REXB 2FOLA 2ODEA 1QGZA 3D31A 4LYJA 3RS5A 2RGEA 1JJ7A 1QHXA 2YC4C 2AL7A 3DPUA 4WQMA 4LI0A 1MOZA 2WJYA 1KI8A 1OB5A 1AA9A 1G9XA 4ASUA 5DHAA 4KYUA 1E9FA 3PV0A 1SM4A 3WY9A 5TY0A 1P6XA 3K53A 1GUAA 3W3AA 2QL6A 3CMAB 1YZKA 1COWD 2ZI3A 1OB2A 2ZR9A 4HAUA 1JQJC 1ZUIA 3SFVA 2CDNA 3EZ9A 2ZRAA 1JQLB 1N0UA 4L16A 2YHSA 3TSWA 4MDEA 1Q44A 3K9HA 1SULA 4LCBA 4H1UA 5H5JA 3QUSA 4D0GA 2GJ8A 1JAHA 4TQ9A 1E6CA 5CM8B 1IY1A 2QAJA 1P9WA 1ZW6A 2VP0A 2O8BA 1P4SA 2ZE6A 2WTUA 2FFQA 4Q9JA 3T12A 1BH2A 1U8YA 4NCNA 3CRRA 4A6PA 2WM9B 2IW3A 2KB0A 2WIAA 3OJXA 3X1XA 2P67A 4JVNA 5DI3A 1Q1EA 1BX1A 2PMDA 1I4LD 4YALA 1UBEA 3PUYA 3ZQ6A 4A4DA 3ADBA 5DI3B 1UKEA 1ZNYA 2CCJA 1JR3A 1MR3F 2HMAA 5HPYB 3C14C 4QM6A 1NN1A 1UBCA 2FFHA 3NG1A 3SNHA 2BJWA 4FI3C 2XZOA 5G3ZA 3EWAA 3C16C 3U61B 4RD0A 1M1KD 2ZS7A 4Q9KA 2EU8A 3QFTA 1UDWA 1BQEA 2WSMA 4JYCA 4E07A 3THXA 1KY3A 4RD3A 2QTHA 5TXGA 3THXB 4BLRA 1QGAA 1IHUA 1O87A 1QVRA 2WAXA 2NG1A 2V6IA 3FB4A 1F6BA 5JS7A 1Q20A 3SDZA 2VYFA 2KE5A 4LHXA 1R0ZA 1IBRA 3SC3A 5A4JA 3AGQA 3VNVA 3CB4A 2BMEA 3LLMA 3I8XA 1ZCAA 1KY2A 4URXR 2BM1A 1XD8A 2B21A 4GMXA 5J47A 1CR2A 1P2UA 2E9SA 3CONA 3EIQA 3X1WA 5JCPA 2GJKA 1SVIA 3K09A 2BBSA 4OHYA 2GKSA 4RVCA 4E09A 3BFXA 1H8EA 5EE5B 4DQLA 1FUKA 2GXSA 3MAAC 4JSTA 2ZU6A 4DCUA 1YRBA 2CL7X 3I5XA 4B6FA 3ECCA 2ZM5A 2B6HA 5TV2A 5L3RA 1YZNA 1M6NA 1J2JA 2R9VA 1JB1A 1E2PA 2H16A 3GJ8A 1GR1A 4QNRA 1F2UA 2IS1A 4YQFA 2CLDX 4HAZA 1F2UB 2HLDA 1VG0B 1KMHA 2MSCB 1HQYE 2R65A 3BC1A 4PQRA 2IS6A 1KMHB 5FTLA 4ZKDA 5EE9A 1W36D 4LHWA 3RS0A 1NDHA 2O8FA 2ZRPA 2IEZA 4A8JC 1K6MA 1UFQA 2RHMA 2ZREA 2B5OA 2YWFA 1J90A 2O8FB 3KQNA 3G6EB 2OBMA 3LVRE 1K9MD 4EAQA 2NO0A 2ZRHA 4LGMA 3B13B 3V4FA 2FMXA 4C0QC 2WSSD 2GILA 3BAFA 5AN9A 1OPXA 4PAQA 4AKHA 4PC3A 3CUEF 2X77A 4IRUB 3CD6B 1D2EA 3VFDA 1N5LA 1XMVA 4TTPA 1D5CA 4W5HA 4TMXA 4Z8XA 2F43A 2YINC 4LSGA 2ZE7A 3ICQB 2WKRA 1ZUNB 3TMKA 1W87A 5DHFA 2F43B 1R6BX 2MMCA 3OZVA 1G41A 2AXPA 3PITA 4TMKA 4W7SA 3WP1B 1BS1A 4DIDA 3CR8A 4CF7A 1DADA 5JSZA 3CF2A 3LD9A 3W8RA 4FMDB 2ZETA 2O8EA 5DSZA 3QVVA 4KXFB 4OQXA 5JSZB 3I62A 4N1AA 1CNEA 2Z6VA 3TW4A 1YU9A 1PVOA 2QA5A 4GT1A 1P62B 1SVOA 4Q21A 1GILA 1UF9A 1GO2A 4RZUA 3B9PA 5FOSA 5DIFA 1W2HA 1VIYA 3ZZ0A 1SXJD 3IO3A 4IEIA 1Q1ZA 1KDOA 4JJKA 4ZIRA 4WAUA 1NIJA 3MWJA 4IOKA 5C18A 1R4AA 2Q9CA 1S8FA 5D3QA 3K70D 1SVSA 1VQOB 4KFSA 3FDIA 2GRJA 4LY6A 2ZRMA 5EE1A 3R7WA 5K8LA 3PJRA 1Y63A 3A4MA 3R7WB 2ZANA 1KQSB 1EFHA 4EPRA 1FFHA 3EIEA 4GRAA 1GL6A 1W0KA 2VHCA 1KSJA 2DWQA 3TW8B 5B57C 2P6UA 1Z0JA 4QKQA 3FMFA 4FXPA 5AK0A 1Q57A 3KB2A 3K0SA 2E1RA 4B75A 1U99A 5HZHA 4L15A 3MJHA 4R71A 4Z8YA 1K8RA 2GK6A 4MRVA 2B8TA 3I8SA 1IOZA 1B0UA 1KK2A 1F2TA 3QKSA 2WWFA 3KJHA 3FMPB 1F2TB 1OXVA 3LFUA 2J7KA 2GF0A 5FFMA 5JZVA 3E2IA 5DNYB 1LTQA 2P65A 1PJRA 4R98A 4A6XA 3KXLA 1FRQA 5CDFA 1C1YA 3CCMB 4EUNA 2ANBA 4LJ4A 1R0XA 2ZE5A 1RJ9B 4JLDA 3VTKA 1G6OA 3AF1A 3NEJA 3AB3A 4YXWD 1XCMA 1Z63A 2P5SA 1D6JA 3A1VA 1AQUA 5EQTA 1R10A 5KDDA 4TYQA 3VQTA 2GBLC 1DPFA 2IUSA 2ZUBA 4D4KA 3A1WA 1T3HA 3SS8A 1NVXQ 2JJ2A 4BZQA 4FIDA 3DHWC 3CWZA 4XIGS 1F48A 2D7CA 5KDLA 1RRPA 4A2WA 4IVQA 3GEIA 5L3QA 1Z2CA 1J8MF 2D7DA 5L3QB 4XVQA 1M7GA 1E2HA 1KI1A 1YE8A 1XTIA 4XD7D 3QF7A 2HJGA 2J9RA 5AJVB 2J87A 1IM2A 4OHZA 3TUJC 4PZLA 2PH1A 3QFSA 4QGFA 2G0NA 3ZZTA 2NZJA 1WF3A 4NBSA 2YV5A 3KZ1E 3O47A 3ZVRA 2VP5A 3H2YA 4UNRA 4JKIA 3ICEA 4ITRC 1HY3A 3RANA 3CC7B 1VQMB 1IY0A 1Q22A 3K0CA 3PEVA 1Q3HA 1UPTA 2QEXB 4ILEA 5E95A 4FCWA 4YC7A 4EFMA 1MH1A 3NKVA 3FE2A 3D3QA 4V02A 2BVNA 5KPJA 2GJ9A 3L8ZA 4D25A 1G291 2PL3A 3NC0C 2L0XA 2VF7A 5A5GA 4XWKA 4B4DA 4HAYA 1FZQA 5H70A 2Q3FA 2C95A 3WMFA 1UM8A 2DFKB 4WXRA 2CLSA 4S35A 3KKQA 5LB4A 4IFEA 4KBGA 4U02A 1Z6XA 5EE3A 3EPLA 3KQKA 1U8ZA 3T61A 5F98A 3C8UA 4OYHA 2XJ4A 3F3YA 4Y9RA 1KNXA 1II9A 3SHFA 1E0JA 5CYPA 2BC9A 4TSFA 5BW8A 5IDVA 2XNDD 2XNCA 3OEED 3TIFA 3GLFE 4G1BA 1A5TA 4LYHA 3P1JA 3CKLA
chains in the Genus database with same CATH superfamily
1BW9B 4F46A 4QX6A 1E94E 2C57A 1EINA 3HEBA 4DLYA 1DAIA 1IL0A 3MHPA 2VZEA 4RETA 2O2ZA 3JQAD 4H7DA 4MI9A 4PZCA 5IT0A 2C3UA 3Q4GA 2I9PA 1QRAA 3HDYA 4IFIA 1QF9A 2G83A 2D3TA 1EWQA 4HDQB 1YDWA 5DGTA 4GF5A 1E20A 1BS9A 2X1HA 3DTVB 3IHKA 3OD1A 3UHFA 1B6TA 4HQOA 3UZUA 1E2NA 1JGTA 1FUYB 2I7VA 3KR0A 4WIAA 1ZR4A 2OTJB 1NW6A 5KJ6A 1GL7A 4HADA 3FTFA 2LVBA 2PZ8A 1C9NA 1GRQA 2RGBA 3R5TA 1KZ4A 3AOEC 1RXYA 2NO9A 2YBDA 4XTCS 4Z4VA 2P30A 2QAGA 2WZQA 3AFMA 4BP8A 4DQXA 3CV3A 1QIGA 1PJCA 1E8NA 2OZVA 4PBTA 2IPAB 2V6JA 4YCSA 4P58A 4TLEA 5BSUA 5C7IO 1KVSA 1C1XA 1WS6A 1JG7A 3PC2A 1PR1A 4RU1A 5LMCA 1M2EA 4E7PA 8GPBA 3RVOA 4P7GA 3AUYA 3MHTA 5C46F 2O9JA 1BN7A 1GLVA 1YD7A 4MUAA 4GM0A 2FG6C 1YWGO 1Z7GA 4FOSA 5LZ2A 1NXWA 4RW0A 3KDPA 3O1IC 4ZHSA 3KKEA 4FYIA 5DULA 1V1MA 1NF2A 3IQGX 3CTAA 3ABIA 3BXEA 2EJCA 3QVMA 4DCGA 5BNTA 5THQA 2GBFA 1DAMA 3QE0A 1XHFA 3CX8A 2OOKA 3AG5A 4B6EA 4NBKA 4EG3A 1YIAA 4XCQA 2TECE 4S24A 1ODCA 3AF5A 2B8NA 4U2FA 1ZI8A 2IYYA 4XWGA 2G77B 5KNCH 2GCIA 4JYMA 4XVCA 4X8MA 4I46A 1YGPA 1K5GA 3AM5A 2Q6OA 4RPJA 4E2WA 3A10A 1FQJA 4MLZA 4FFPA 1QYIA 4JLJA 1V9SA 3CRVA 4ZC8A 1SBYA 2XQIA 1XR3A 1YQQA 3D3WA 2KBFA 5IAAA 1NV9A 2O2EA 4KLZA 1YC5A 1AQ6A 1R9GA 3EZ7A 1W96A 4GMHA 2VSQA 4GNRA 1A3CA 4MKGA 5DXFA 5GVRA 3UGTA 1IWOA 2OO3A 4RHEA 2P0YA 2WI8A 3BRQA 1KORA 2BCJQ 2LWIA 5AJWA 4DA8A 3OE5A 3SYLA 1E4VA 3QWAA 2V65A 3HEAA 4JEIA 3FSJX 4ON9A 5LWQA 4UM7A 2AG1A 5IAGA 2BEWB 2X0FA 4UTNA 1UDCA 4PYIA 5F2NA 3VU9A 2HU2A 4BO7A 2PRJA 2VA8A 1SCJA 1BE0A 3QF4B 4LMPA 5FFNA 4FDTA 3RRNA 3LDGA 4OHPA 4HB2A 2NU8A 4FT4A 2HSEA 2QM8A 4N01A 1U1EA 1IJFA 2Q2WA 3GJ6A 3LPCA 2Q3EA 1MAHA 3O82A 3NLLA 1MJNA 1LDYA 3DKRA 3TD6A 4N0QA 5D3MA 1MPXA 3PTLA 4TTJA 2O2JA 3BT7A 1R74A 3CU5A 1MKYA 1AV6A 1LK5A 4ZVPA 2FSSA 2GARA 2QV7A 4FWIB 4W5QA 4CKCB 2WJVA 2IPLA 2QGZA 2WK1A 3N7UA 4P35A 3RREA 3RVNA 2X85A 5ALEA 1GLNA 3KSUA 3KAKA 4N8DA 1JSCA 3BXXA 4FLMA 2WHQA 3FPFA 5F35A 3CJQA 1ZMTA 4AMUA 5TGDA 1IU9A 4UPEA 3JSAA 4HJRA 1HWYA 2FETA 3JAWB 1ZUHA 10MHA 3BH0A 3GGGA 4RFVA 4MP6A 3GRKA 4YH1A 5C0OE 2XGGA 2Q07A 4PZUA 2X0KA 1QHNA 3G2HA 3LP8A 4KPYA 1KJNA 2GM3A 3FVQA 4U2EA 4KAJA 4ZDIA 4ND7A 4FDAA 2RC6A 3QELB 4FLEA 4KMOA 1Z25A 5GONA 4BLQA 1SG0A 4G5HA 1N5JA 2QN2A 2AUMA 5GIPE 1FFEA 2X5JO 4WZZA 4TZ0A 4KIFA 4L57A 1U11A 1L8OA 1XZEA 3B1XA 1Y7IA 3HU3A 4WK4B 3IMFA 5THKA 1QBKC 2WEKA 4AU1A 4LGVA 3QVTA 1GGVA 1NIPA 1T29A 3MCAA 1F0KA 4NZOA 2M6KA 2XDYA 3EZ2A 1JR4A 4P5PA 3UWMA 1KRWA 3RAPR 4MV8A 5KI6A 3ZCVA 5HIAA 3PHBE 1MRSA 2J8ZA 1QE3A 3RYHB 2W2QA 3AHEA 1UEJA 4R7ZA 1DQYA 2XR1A 4BKRA 3T1HB 4H31A 3Q3CA 1MO6A 2IYWA 3SN6A 4O29A 1QBGA 2IYSA 2O0JA 3KTAA 5JDCA 3IOCA 2I3GA 2OBSA 3WQQA 2HF8A 2UYYA 2Y8EA 1CG6A 1KI6B 4MVJD 4RIIA 5U1PA 3BA6A 1OBHA 1U5CA 2WJWA 2B8EA 5IAEA 2AR9A 4F5YA 4RK6A 3HJUA 4NAUA 4E22A 3FHTA 1NTRA 2WMDA 5NULA 1VGRA 3RVBA 1QIJA 4JUCA 2XCLA 2JFFA 2YHAA 3TQTA 3N8IA 4QUKA 4PQEA 3B1JA 1BMTA 3BILA 4KQ9A 4V0RA 3EVEA 3WIBA 5C4IA 5ES4B 4F2GA 2J0UA 1QYWA 4LY3A 5TMPA 4WK0B 4U00A 1E64A 1SJ9A 1B23P 4X6YA 1TEVA 2WFMA 4BWFB 1YZTA 4AFNA 1ZGJA 4AIIA 5FYQA 5BN4A 2MT9A 3DVSX 1FBTA 1FDOA 2EKDA 1G7RA 2OCKA 2WKPA 2WYUA 2XX3A 3WTCA 2XKAA 4DNQA 3S1SA 2ZR0A 3M4YA 3ZVLA 2Y1LA 4QUEA 1L2TA 1QKKA 4MB0A 3AI7A 1SUCA 2H06A 3RTGA 2BR3A 4RJLA 1QHGA 2H1RA 3C3CA 3VZRA 1DXQA 1UMCA 1OH8A 5IYQA 5A71A 1E9VA 1U28A 3A11A 1Y0RA 2ZT5A 3GBVA 3NDIA 4OIFA 4TS4A 4J9VA 2J4CA 5EP4A 3PUXA 3K5WA 2ZK7A 2ZIXA 2OC4A 2ZSBA 3DCJA 3KCNA 5JT1A 3GN1A 1XK6A 1E77A 4X65B 2ADFA 3QK7A 5D3ZA 3T38A 2BUCA 2X6XA 2H4JA 4HVTA 4ZJPA 2QR5A 2OQIA 2BSAA 4LXHA 4YHBA 3PUWA 2N47A 4Q01A 5EP1A 3QU4A 4B09A 3ILXA 2ZTHA 3OPVA 5TQ2A 1T1SA 4DMMA 3IB3A 3QXJA 4RTJA 1RWBA 1PVDA 1WBJB 3EK2A 3TS1A 3P9CA 1RLJA 5IP5A 3PGXA 3LQ6A 5JMPA 1JKJB 1O6ZA 4B5LA 1G9TA 4HZUA 3EIXA 1BVRA 2FUG6 1LC0A 4ZYTA 1WKVA 2ZZEA 2DSTA 3LK6A 4OGWA 5HK9A 1OT5A 2ZPTX 5FD8A 4C07A 3VH4A 5JXIA 5EERA 4XR6A 4IOMA 4JUFA 2J31A 1HQKA 3VI4B 1OV4A 4A82A 2F8TA 4Z53A 1QPBA 3IEKA 4MHSA 1GQ2A 1CPYA 3L04A 1H9CA 1A4IA 1IG3A 4TXNA 4ARUA 3CFYA 3L6BA 1K5HA 3OOWA 2BF4A 5FOTA 3Q87B 3BIFA 2WWGA 4XLLA 3RC3A 3VTFA 1UEIA 1JQBA 4BCCA 1I3CA 4CJXA 1O3YA 1SUIA 2XNSA 4QGGA 3G1WA 5DRYA 1V45E 3ZDQA 4EGCB 9ATCA 2XXAA 1KL7A 4D7AA 1Q6ZA 4MPDA 2CNKA 4F4FA 1YDHA 2JFPA 4IR7A 5HBGA 1Y3AA 2IKSA 2JBHA 2XRFA 3W90A 3UAVA 3VAZA 4B5KA 1PEAA 2A9KA 1GCAA 4KUHA 4N0DA 5BN5B 3Q8XB 4PXYA 4BQRA 3BH7A 3VM6A 2QSZA 4CGYA 1YL5A 3H5OA 1X1DA 3G0BA 3KQTA 3BF7A 2ODWA 1BVUA 4G5OA 5A3SA 2ZUEA 3VPHA 4YRAA 3H0KA 3PI6A 3QBJA 4DV2B 2XUHA 2XYGA 2H2WA 3GT0A 4OI2A 3VYVA 4IO1A 4LZWA 2NVUA 3BK7A 4BFCA 3IAUA 4MIOA 2VQ3A 5FDFA 5DOVA 3CUTA 3LDFA 4CLOB 1T6NA 2I62A 1T1IA 1XLUA 4KDEA 3ZYCA 1M2FA 3CX3A 5CJ2A 2V4MA 3ZD8A 4XOTA 4MGZR 4EB8A 1K7CA 2WDPA 3HV2A 1QG0A 2P41A 3F7NA 5J5CA 1P3Y1 4F38A 2BKAA 2C31A 2FRDC 1NMZA 1TCUA 3GZ4A 4M1OA 3ZGZA 2NM0A 1SG9A 1CWUA 1FP1D 1RYYA 2H57A 3EGWA 2GRAA 3E05A 3BEDA 3PYLA 1ADGA 5KYVA 5JWOA 4KUEA 1E3ZA 3GEBA 4UBIA 3O8CA 4OUKX 4PLVA 3EVCA 3GLFA 1GTZA 4EBBA 4ME6A 1P9LA 3NORA 5AW8A 2CVQA 2XA9A 4DA4A 2YWDA 1E43A 2PBRA 4MOWA 1P2FA 4G0YA 4MQUA 5HQTA 4RZXA 1XTSA 4D4HA 5GJBA 3ZNNA 2W2TA 2WT8A 4UXJA 1YFJA 4IHKA 1SXIA 4LC9A 2RONA 4BX9A 1E3TA 4PX3A 5IKOA 4EKDA 5I9BA 3MJEA 1LF0A 4HYQA 5IKMA 4CM9D 3EXFA 2DPHA 3EAFA 1FNNA 1P74A 3LA8A 4ZAFA 3WKEA 4EG8A 5K0EA 4ITUA 4HOYA 2BPOA 2YV1A 3LUJA 4JQZA 2QQFA 4Q7JB 4Y9SA 4GM1A 4PLTA 1T4BA 1JIJA 5GZ1A 1HXHA 3JRWA 4G0XA 4F4IA 3AVUA 2ZTNA 4BNZA 3WNVA 1XXHE 3PL5A 2FMUA 3VXKA 2V7BA 2XB4A 3DZBA 2HDHA 2WV9A 1NXOA 3ND6A 4D8TA 1HFEL 4H59A 3SE7A 1WB6A 5CG2A 2RFLA 3FMOB 4P3NA 4DPLA 1SXJB 3QBVA 2Q6TA 5FPTA 1Y8QA 4AWAA 1QV9A 3B6ZA 3HXKA 4QUJA 4Q9LA 3K0CC 4OF4A 5JBIA 1FX0B 4LXQA 4G6IA 1YS6A 1ULZA 3SVLA 2ZWIA 1NR5A 1WUYA 1ES9A 1VYHA 4JOCA 5MF6A 3BQ9A 1JNYA 3B1WA 5KNBA 5CFRA 2UVQA 3HYLA 3NEAA 2DBZA 4FGWA 4R8KA 1USUA 1EDBA 1V5IA 1YDEA 1YQ9A 3HMQA 1NVWQ 2A5FA 2GVNA 4M99A 3IDSA 3TECE 3CLVA 3WOVA 1E7WA 3CCJB 2V97A 2Z1DA 2D1TA 3DR3A 2HFKA 3PHGA 2M2IA 4OK5A 5EZQA 4A6DA 3ZWCA 3SQXA 5KWJA 2CXXA 1E79D 1N05A 1N7JA 2VXBA 3CE6A 3F47A 2R00A 1OYWA 4OK6A 4X1IA 1UZMA 3RC2A 2VKQA 3LHDA 1NQTA 4Z0TA 3HB5X 4LYYA 3JALA 4CIXA 2NO7A 5E2BA 3EMBA 4AXXA 1OT3A 4B9AA 4CV3A 1ISHA 1JLLA 2Q45A 4NDAA 2PKEA 1Y4DE 1VRCA 5CD1A 1VLOA 1B8UA 3AHIA 4DOMA 3MT8A 2BSQA 5DF1A 1G8GA 4HXFB 5E6RA 4BOYA 4EUEA 5G0SA 4NOMA 4B4WA 4C0KA 1OWLA 4EW2A 4FKMA 1SZPA 2A0FA 1DG9A 3F7MA 4UXHA 2OAP1 3IIEA 1MEEA 1SUPA 5JAIA 4MV1A 4UATA 3UUFA 2EJBA 4O1IA 4KYIB 4QUIA 4Y9DA 1XSEA 1OGJA 1N06A 2GPSA 4DLKA 2ZI6A 5CCDA 1LFDB 4YCBA 3T9EA 2OMKA 4XJSA 1VG1A 2R7NA 3RK1A 3DOCA 4GNKA 6NULA 5K09A 3A4TA 4BO0A 3QKRA 3ABRB 4MGKR 4F12A 4BJ1A 1U5BB 5AQ1A 3BAZA 3GNLA 5U4XA 3JR3A 3KVRA 4NOKA 4GS5A 3TRIA 3KT3A 2O8VA 1ZLYA 3B9RA 2JAOA 3U26A 5KWIA 4KJZA 2ID4A 4J0HA 3TE6A 1KMMA 1A50B 2IY8A 1J7JA 2PFKA 2VDQB 2CFCA 3FPGA 1V3TA 6CHYA 1PV4A 2F9FA 1SCAA 2UZ1A 4YLEA 5F2KA 4JP1A 1F20A 1VMDA 2XUIA 4AKIA 1WPGA 2DMRA 4XI9A 4DA9A 3WIVA 3FWHA 3LTNC 2HHHB 1OCEA 3BRWD 3KSMA 2UXCB 4XJXA 4EP1A 3IULA 1RZRD 2RAVA 2UAGA 4TPKA 3WYFA 1PIWA 2Q29A 3BKXA 1AE1A 4LDJA 2D9RA 4J7AA 4V1CI 2H1FA 1HLFA 4GKAA 5FI0B 1P7ZA 3R7NA 4EI9A 5C53B 4NZYA 1ILEA 5THXA 3QWHA 5ETJA 2PFSA 3EASA 5FLKA 3QI7A 4EVIA 4DDTA 1M66A 3ROXA 3UQYS 4DM3A 3A1PA 1TIPA 1Q0RA 4WBXC 3LHSA 4ALMA 3SY8A 1VECA 4OLJA 4O4JB 4C3ZA 1XVIA 1EE2A 1T34A 3HUUA 1K1EA 1PWHA 2NZYA 2ZYIA 3ITEA 3F5QA 4HLQB 5KYNA 4HV4A 5GM1A 3E84A 3A1UA 1C3OA 5AYVA 2W2MA 1CZKA 1KE2A 3IEXA 5HTOA 2ZJ2A 1HZJA 4PSCA 5A9TA 1HRKA 4OHKA 4DRXB 3Q5EA 4BZXA 4WW0A 4UNQA 5IZ4A 1C29B 2NZ8A 2YRWA 3ORYA 2BEJA 4JWTA 1DT3A 2EBHX 3P9RA 4RKQA 3GB9A 3OCCA 3ANLA 2A84A 3FRIA 4YI3A 1NAHA 3ZS8A 3T4PA 1QANA 3SJUA 5FJJA 3H6GA 1Z4QA 2NXJA 2XW6A 3RSLA 1NFRA 1TM2A 1YXMA 2WG2A 3K5IA 3TW6A 4DDUA 4Z51A 5AVUA 5I8ZA 1ORIA 1MABA 1PR0A 2HPHA 1K2WA 3H2JA 4EPYA 1U7HA 2EWWA 2OG2A 3AF0A 3QYAA 1FVHA 2WWXA 2DULA 4URWR 3TG2A 5BYAA 2FPSA 1EPUA 5B4UA 3NO4A 1K92A 1Z0ZA 2NPOA 2GEJA 1C1HA 1NASA 2B34A 3VKWA 5KVSA 3IUEA 1UQUA 2JH8A 1VQPB 2V96A 4H1WA 4BBAA 1EE9A 4FM9A 1JU3A 5FNVF 1OKKD 1T2VA 2BW0A 2GHRA 1T3LA 2QD3A 4R68A 1MX1A 3W6PA 3O73A 2QEQA 1NVKA 3CH4B 3FZNA 3SYKA 4TM7A 2O2GA 2YQ4A 3RJZA 5D84A 1USGA 4ZI5A 5SYAA 5A4KA 2F4VB 2QYSA 3PF9A 1ZM4A 1TNDA 4BNIA 1RABA 3D4LA 3LL4A 1MN6A 4LXGA 4QTYA 4PHGA 4A0QA 3DAHA 2YWBA 2ZZQA 2VPPA 3GXOA 4HP8A 2X0EA 4AUKA 4B4UA 5DLPA 1DBRA 3ZNQA 3TLMA 1KAHA 2XQFA 3G5MA 5AHXA 4AAYA 1OI7A 2QXUA 4ARSA 4BFYA 1K28D 1UUFA 2E2WA 3MWEB 3PUKA 4NWIA 2W4QA 4XN0A 3LO8A 1XTQA 3CPXA 1Y37A 4KXQA 5F77A 3PC7A 3OEHA 1AHIA 2IZZA 4EYEA 3ELYA 4PCVA 3W5JA 1E2LA 1T8PA 5DGXA 1J70A 5LU9A 4LF5B 2I22A 3RT9A 2R1TA 3SJPA 2EFYA 3EULA 5CT6A 2VHTA 3MNFA 4X63A 1I1NA 4F2WA 1BVHA 5ALOA 1PSZA 3C3EA 3AWIA 1BWRA 2Q3HA 3AEQA 4G4JA 4AYWA 1AKQA 3HSYA 4JUDX 1OBFO 2ACEA 2RHRA 1ELOA 4PE5B 1KBZA 4H7PA 3ZCXA 1TZKA 1MDFA 1K5PA 2REOA 3DV0A 4PPGA 2Q7OE 3ZZNA 4V0NA 4XM2A 3OP4A 3BCFA 1JTVA 1PJ8A 3VGPA 1L1RA 4GBGA 4XLFA 3F97A 1WXHA 2FP4A 1GQSA 2NTJA 3M89A 2A8YA 2PG3A 4ZAXA 3D6AA 2XXJA 1O57A 3DJFA 4N49A 4DHEA 1OGYA 5CT8A 2PGXA 1IPHA 2ZRQA 1H4VB 1C3VA 3AY0A 1XRQA 4ARBA 3M5CA 1AKUA 5AW7A 4DA7A 4GZLA 1SXQA 2LUOA 3BD8A 4J16C 1KI9A 2OGZA 1EA7A 4NFYA 2NV4A 4Z4ZA 1A8SA 2M9MA 2QW0X 4EVRA 4KFCA 3HDGA 3UTDA 4AXBA 2BLNA 2YQ5A 1X94A 2OSVA 4FZ3A 1D1QA 1FK8A 4X7MA 2YY5A 4B6OA 4Q3KA 4ESOA 1ZU5A 1OBCA 4V0OA 4EKIA 3MCWA 1BMDA 1NXVA 3O26A 4C0AC 5HYVA 1BKDR 5BRAA 1W9HA 3L8YA 4LHYA 5ILQA 3ESRA 3DZDA 1QFSA 1RC1A 3N0VA 5IM4F 5EEGA 1T0UA 1T13A 1CUGA 2O0HA 4LJ7A 4RQBA 1AKWA 3SQDA 2HW8A 4XWTA 1KI2A 4GD3Q 5LVAA 1X1QA 5EJ7A 2JLCA 4C08A 3R5JA 4JUBA 2UUCB 2D2EA 1CV2A 5JG7A 1SCNE 3RSOA 1XDDA 2WE7A 3A1TA 2V45A 1ONOA 3AHHA 4KR6A 5BOVA 5C35A 4ARIA 4PSAA 2G06A 5H02A 5LCXA 4B33A 1BHQ1 5E9QA 1K89A 4EUHA 1S2LA 1LS6A 1R8QA 1U7ZA 4NBRA 3LHIA 5F4ZA 3S1AB 4TKVA 4OFXA 4QOIA 3RROA 3EJ6A 1CUUA 2NU6B 1Y1LA 4X05A 2X19A 3ROMA 1JSRA 1XDUA 5LP6A 1DBWA 2EJVA 2FSUA 4KCGA 3WL5A 1H2FA 3GJ5A 3M81A 4ER3A 5JFGA 1OFUA 2Z30A 3LXRA 2VTKA 4N3GA 2P78A 1WHTA 2ZJOA 3ETEA 1G4UR 2NU9B 2XGSA 1AG9A 1OLSB 3BHNA 3ESZA 5B3JA 2P1ZA 4HMPA 3HUTA 1Z4KA 3G82C 3KR9A 5ADHA 3AVQA 2PUCA 4W9NC 4TWZA 3AETA 1I3LA 4PRZA 4DRYA 2QD5A 3OIYA 3OICA 1WLYA 5I7RA 4K40A 4KR0A 4LYGA 3UWOA 2GOYA 2AR7A 3A14A 4JMPA 1IHDA 4F06A 2EYQA 1T5TA 3T9CA 2OVBA 3ISVA 3HFSA 3O03A 4PICA 5B36A 1REQA 1HQCA 4G1EB 4JENA 4MLPA 2ODBA 3T1QA 4TT3D 2YFKA 3OBIA 3UOGA 4MEAA 2OV3A 2C3PA 2QX6A 3HADA 3IUSA 3OU2A 4GR4A 1CJTC 2R6R1 2ZVPX 1FS4A 3ZVKA 3GH1A 1GQOA 4UU8A 3UENA 1R7RA 2K87A 5UKDA 3FZEA 4CLDA 3UATA 1IUOA 3ZJYA 2IL1A 4L78A 1NA5A 2O3UA 5HZKA 3TL2A 4BO4A 3B1ZA 3WGOA 3U56A 4TLDA 4YLYA 3EW7A 3WWDA 1KKLA 1HO3A 3ESBA 1UK8A 5AHWA 3T7TA 2FWMX 1C0LA 2B1QA 2H4ZA 3D6TB 3W6OA 3BB3A 3FCEA 2WQZA 2G76A 3GMIA 4I9FA 3KKMA 4WFKA 5G4LA 3RFXA 3AU8A 3A6ZA 4DV4B 3OOJA 4TS9A 3T52A 1KAMA 1W4BA 2V4ZA 3E9QA 4J4BA 3IQHX 1YE3A 2YH2A 2ZIGA 2KX7A 2PLNA 3GP3A 3IPYA 3ZJTA 4NMWA 4BVFA 3TINA 3I3SR 4RH0A 1NJSA 1SB9A 1C30A 3JD0A 4O4JF 4WDRA 5JPIA 3T3GA 3UJHA 5J58A 2D5LA 2HRQA 1XZBA 2X8LA 2QHXA 4JBWA 4BB9A 1OVGA 4HQLA 4ZJYA 3LYHA 3HY3A 3T9BA 4OQLA 3ELUA 4GXRA 4PANA 2C94A 3TDKA 2HHAA 4DBVO 3T53B 1ZM7A 3WGQA 4ETNA 4MKZA 2EBUA 4PGHA 4BAZA 1EUQA 2JGJA 1XE1A 2VZLA 3ETJA 3EYAA 3TTSA 4AY3A 5CVJA 1ETHA 4Z1MD 2O5VA 5H81A 2CXTA 3IJRA 2V7XA 4TMVA 5C3MA 3KXKA 1TOAA 5JXWA 1CK4A 1DJNA 2IOQA 3OPNA 1QGOA 1QDUA 3TLZA 3FFBA 4YRNA 3S2UA 3AKYA 2BGRA 3TQOA 2RCNA 1YJCA 3NIFB 1YQTA 1KP2A 4NULA 5LQMA 4TV9F 4Z6KA 3PQ2A 3O38A 1GHTA 5EGSA 5KNDA 3KSRA 2C0PA 4R8LA 4CFSA 1XEWX 3DSRA 1VKOA 5LXTA 2VBIA 3FOCA 4JZKA 4NMLA 3FFWA 1KDZA 1T24A 1ILWA 4ADSG 4EEKA 3HB9A 4OGKA 1GAXA 2HTEA 2ZAMA 4TM8A 2OGTA 1D1NA 1CRLA 4WZ6A 2W7TA 1HQDA 2QRZA 1MW9X 1N1EA 2QX7A 3PDUA 4FFBA 4O2BB 4AN1A 2DUUA 4KGZA 1TQ2A 1TF5A 3W2HA 2QP9X 1G16A 4GX2A 3OZXA 5A9SB 2BHTA 1Z0IA 1UJ4A 4PLHA 4RAOA 4E33A 3O5AA 1AQJA 1SXJC 5HZGA 1RXUA 2IOFA 3CBGA 4QXPA 5M04A 5JMWA 2FPUA 4G36A 1RI2A 1O9BA 2LZ0A 2R6DA 4KVZA 4WOKA 4YO7A 5BYKA 2P2DA 5JIBA 2BFOA 1M1ZA 3VKHA 2Q62A 3FBWA 5IFLA 1QK4A 2P3SA 1DAHA 2BKEA 3BHMA 5FWXB 1VL5A 4FGLA 3ZE1B 2R85A 1PUXA 1MFZA 3LQ4A 4CEHA 1IHPA 2QQEA 2DETA 4I1SA 4J1TA 2VPWA 2OQRA 2GD6A 2A14A 4LDZA 3DR5A 2DWCA 1HPLA 4U2GA 5C8XA 2W6ZA 1CJUC 1NU8A 4YFVA 2R5NA 2J3EA 2ZIAA 3E22A 1DFHA 3GRVA 5EL0A 1EXWA 3NT5A 4MR8B 2QGGA 2G04A 3CMCO 2PMFA 3QX8A 3HHPA 4RF2A 3CH5A 4HLUA 1JN0A 1U2ZA 3CQ9A 4OBBA 3Q3AA 3BFPA 4RELA 3A06A 4XEHA 3SC2B 1BKSB 4BU1A 1JIVA 3BMCA 5DHTA 3WO1A 1HSOA 2J3DA 5K8UA 1CP3A 3H6KA 2QMQA 1ENYA 3PFIA 4JJ4A 2ZZNA 4F2HA 1K88A 4MUHA 3D43A 4C76A 5L3SB 1NX6A 4IEFB 4TWIA 5TR9A 4QJBA 3AJ8A 3QOWA 3SK0A 1PZXA 4EX7A 1ZSYA 4O63O 1MA3A 1S8NA 3PIIA 4E94A 1BLIA 3OQJA 4TWJA 3G68A 2EFGA 1XWWA 1LPMA 4DBLE 1CLEA 1GP2A 1U7DA 1W46A 3ADKA 4AZVA 3OQIA 5TT1A 1Z8HA 4C20A 2YFHA 5DNWA 2GN0A 1F0NA 4RKFA 3DV9A 3T7IA 4DBZA 2I8CA 4C5BA 3OMLA 5TQ0A 1CQJA 1DCFA 1V9LA 4HYTA 2KLBA 1WZ2A 3TKLA 2OR3A 2A67A 2W4IA 3R7BA 4FYPA 5HFNA 5K3SA 4LFBB 2R8PA 3ASUA 3MTBA 4H0CA 1G20E 4DQKA 4Q48A 1SIBE 2R8RA 2EP7A 2FPIB 3VR4D 1MO2A 3IEUA 3CWQA 4JLOA 4N12A 5DX1A 3OAAA 1L4UA 2BFPA 4REQA 5TPWA 3NMUF 1VLYA 1MJHA 1MB3A 1NUHA 2CF6A 1JUDA 1K08A 2A78A 2C07A 4XLTA 3ZHRA 5I9LA 4GW3A 1HEIA 2W9XA 1E6UA 2VCYA 3MELA 1FA9A 3HFGA 3KKLA 2EERA 4W63A 2UZ4A 2H52A 1VSBA 3I83A 1SKYE 3USCS 3L7CA 1CW2B 1ZC3A 4JLNA 3FOBA 5EIAA 1P5ZB 2QP3A 2CNNA 4KEAA 3S29A 2O5CA 1G0NA 2R4QA 4KQXA 3JVVA 5JXHA 4HNTA 2WKQA 3JR7A 3P2IA 4PCLA 4C4YA 2ZVQX 3OZTA 1CSEE 2WVAA 3HCAA 1C2TA 1IN7A 1PJSA 3ZNOA 1QIFA 2Y3IA 1EFKA 4GXQA 3TW0A 3U81A 5A4IS 3VSAA 1P6QA 2VF8A 3JAKB 1ZK0A 2CMFA 1JAIA 1D04A 1CVIA 1JZQA 2CJWA 5FUQA 2ZI4A 2DQYA 4FFBB 3FYDA 1LLFA 1EBFA 4LUCA 1YRQA 1XU4A 4WNIA 4M2LA 5FADA 5FHQA 3PNKA 1WUIS 2D5BA 1YSCA 5A04A 1XEXA 4BYMA 5JZBA 3OC0A 3I4LA 1PLLA 3LUPA 4D9EA 1BOFA 4PR0A 4QG7A 1CUXA 1YS1X 3ZU2A 2F9LA 1AD2A 1WQ4A 1D2NA 3NDJA 1TF2A 3B52X 1VSUA 1WUKS 1PJ7A 2ZRCA 4ND1A 2FWAA 1GT6A 3B1VA 3PA6A 2ZVJA 2R7LA 3ED1A 3NTXA 2ZJAA 3O8QB 1G8FA 4KXVA 4MUYA 2P9BA 1L4NA 3ZU3A 4D9MA 1ORWA 2GK3A 1R5BA 3QYPA 3NTRA 4NDZA 1Z2AA 1DIBA 3BMOA 4GKBA 4WY5A 5EYPB 1U0FA 1QB7A 2D5CA 3WBJA 1HDRA 2J33A 2WKWA 3P2OA 3A3OA 3I32A 4RD6A 3Q8WA 5AW9A 2X9LA 1U9IA 5CFQA 4WL0A 1KYVA 1JDZA 5ITZA 2QUKA 3VAYA 3I56B 1Y34E 4CDGA 2YJGA 4MI6A 2C03A 4OEHA 2AI1A 3T54A 5CITA 3GVJA 1T4CB 1VE6A 1FCJA 1ZN2A 2PUTA 2C7RA 3SZUA 4KGXA 1NE7A 1NQXA 1U0OC 1VBKA 1Z35A 1EXMA 2KI5A 4JT9A 1EWRA 2L82A 3JASB 1R5OA 4IYJA 2XE4A 4RA6B 4Z49A 4YUZA 5ERGB 2KLHA 4NNJA 5EPUA 2C8JA 4Q1VA 1QCZA 3T1VA 1UAGA 3TLYA 3H9UA 1PYGA 1Z18A 5LBIA 1BMFA 1F38A 4C4SA 5HVNA 1HDCA 1ZRSA 1CBUA 3VPAA 2XADA 5FOWA 5FNVB 3C3DA 3P20A 4N6NA 5JVDF 1LDBA 2QMHA 2JAPA 4NEGA 4M87A 1FRFS 3OSUA 1SBNE 4WHMA 1T9CA 1TTQB 3ZVMA 1SXGA 1ZPDA 2ODNA 2ARKA 4P3OA 3DDSA 1V16A 5AJHA 1WWKA 3CH7A 4NP6A 4Z0NA 1XVVA 2QLLA 5K3EA 4NRDA 1WBBA 3T0GA 5MFZA 3TJRA 1KU0A 1TTHA 3M6WA 2ZIZA 2XMCA 4AF7A 2TSYB 4BASA 1DKNA 2H4WA 1KC3A 3UQZA 3SVZA 4ID9A 5JNTA 4JC5A 2JFBA 3HVRA 3U4QA 1DMRA 1QH1B 4F5EA 3EIOA 1GVNB 1Z5VA 4ZAYA 4JBGA 1M2OA 1UQTA 5D6OA 3MMSA 1N75A 4YCAA 4KKUA 3V4SA 2XWBF 1NP3A 4I5GA 1TPZA 3E27A 3L7KA 3RRFA 1DEXA 2P7HA 4X7EA 3LPMA 2A9OA 1PDOA 3J81A 5IBPA 4P84A 5BR1A 521PA 1ULBA 1PNTA 4O3FA 1W1WA 3UA4A 3U1BA 1W581 3C8DA 5FR1A 4UTVA 4IHAA 5JC8A 3TL6A 2BRUA 2QL7A 1Z7YA 1SHLA 2IYXA 5KAMA 3I5AA 3I9LA 1TK9A 2FHSA 2HA2A 4MPRA 4W7IA 5DW3A 5ARDA 5HCIA 2C9ZA 2YXEA 4B3FX 1A82A 3UJ6A 3PLAE 2P75A 4NFHA 1UWLA 2Q6IA 2W5UA 3RV3A 3TAHA 3B6KA 5JO0A 5ALGA 5INTA 1E6EA 3FETA 1OE0A 3ZZUA 2UVPB 2ZUCA 3DDNA 3AUSA 3TIIA 1NLFA 4LWOA 4EJSB 4PO3X 5KVCA 3NDBB 4GPTA 2NUTA 1RT9A 1JIKA 5JNWA 4ESVA 4E7OA 2GNAA 2VPQA 3ONYA 4OLAA 3EEFA 1YI0A 3O91A 2JLZA 1WXDA 2YWHA 4P08A 5AUNB 1RYZA 3V2IA 4C06A 1Y48E 3TZKA 1FYFA 1IH8A 1SOAA 2CXNA 2H1WA 2RG1A 5AJTA 4ZN6A 3IILA 5BV7A 3O4RA 4M21A 2QQ0A 5HEKA 4ZHQA 2WPDA 2GNOA 4C7OB 3E5MA 4C29A 2BI4A 2RK3A 3E9CA 5CLGA 1XRRA 2XMQA 3UMVA 1L7RA 4UUPA 2B2CA 3ZJVA 3QY9A 1GWNA 3R0ZA 4G8DA 4EY3A 2NXEA 2W70A 1N7HA 4L5JA 5GIOE 2PCLA 2H17A 1HDGO 1FDIA 2HGZA 5CXUA 1XWFA 3GZTB 4R05A 5CVUA 1Z8FA 2RGYA 1VIAA 1WU7A 7MHTA 4KQMA 4BJ6A 2FK7A 2QAIA 1N25A 2EL7A 2PZGA 1BA3A 1J25A 2BZSA 3RODA 3HM2A 1TCAA 3ODPA 2Q4TA 3P71T 5K8VA 4P4SB 3H4MA 4C4OA 3RS4A 1MX3A 4L9SA 3D7SA 2XMRA 1XT6A 4OQNA 3AR5A 2AOTB 3VR3A 4ZOCA 5AD1A 1V4BA 2C1EA 4F56A 4DM4A 4X71A 2PGNA 2XB2A 4HSEA 4JROA 1FVFA 4J94A 3SXUB 3VR2D 3NAQA 4TWRA