4NBSA

The structure of aif2gamma subunit h20f from archaeon sulfolobus solfataricus complexed with gdpcp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDFGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
molecule tags Translation
source organism Sulfolobus solfataricus
publication title The structure of aIF2gamma subunit H20F from archaeon Sulfolobus solfataricus complexed with GDPCP
rcsb
total genus 106
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4nbsA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4nbsA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nbsA01
2W6ID 1ZBDA 1NJFA 2XTMA 3B7GA 3G71B 4EQ6A 3K9NA 1XNJA 2BGJA 2NIPA 3TSZA 2VHTA 1BX1A 1KNQA 5BN5A 1M2OB 2C98A 2OUKA 1CULC 3BBPA 2XEXA 1W0KA 5UKDA 3VR4A 2AXPA 3EX7C 1Z47A 1KTVA 1KJWA 1M74A 4EJSA 1IN5A 3WMEA 4GZLA 4A1FA 5JWOA 2J45A 1NBME 5FOXA 5IRCD 1HE1C 2OXRA 2OFWA 5JHGB 2P67A 3SNHA 2YWEA 4F4CA 2HLDD 3CMAB 4HAWA 3CCEB 3ZVRA 1VQMB 3EZ6A 2IHBA 2J46A 4RD3A 1P9RA 4TLAA 4YMUA 1GM5A 1P2UA 1H65A 1KO1A 1NF3A 2PZGA 4A0GA 4DVGA 4TZ0A 4NH0A 4KODA 3CCVB 2VA8A 4PHHA 5FL3A 1COWD 4L8GA 1AM4D 1BQEA 2HLDA 1KIMA 4WVFA 4ASUA 1JQJC 2H92A 2VNHA 4MA4A 4B71A 4CEJA 3FMPB 4PZLA 4XVRA 4AI6A 2GK6A 4C7OA 4B35A 1DAGA 1LNZA 1X86B 3OW2B 4PAMA 4URXR 4IEEA 3W5UA 2ZANA 4Q1CA 1U94A 1W0KD 2FZLA 3DOEA 2AFIE 4EFNA 4XVQA 1N6IA 4IXNA 3T5DA 4FWTA 4CW7A 1LFDB 2DERA 4KVGA 2W2VA 4YALA 5FUVA 3NHBA 1A1VA 4AC9A 1DEKA 1LF5A 1SXJD 1XFAA 4F7DA 4DQKA 4LRWA 3U5ZB 4WZ6A 4P33A 4ZIRA 4HAYA 4Z8YA 3VU9B 1FNDA 3FMIA 3TSWA 3W8NA 2CEAA 1CS4C 2EQBA 1EX6A 1RRPA 3HR7A 5AUPB 4DUGD 2DHRA 1X8KA 1I4TD 1E1QA 1ZJ6A 2EWWA 3G82C 1QHYA 1ZCAA 1E63A 3QG1A 4HAVA 1M90D 5FOSA 3RNLA 3UMFA 4AIIA 1PV4A 2OESA 3FTQA 2F9LA 2NTYC 5L3QB 1G16A 4IJMA 5G3ZA 5J4VA 2W6JA 1Z06A 2IBMA 3SZRA 2P6NA 3U60B 5EP1A 2RGAA 3AQ4A 5F3WB 4MITA 1LB1B 4EPRA 3OE7A 1G8HA 1Z0IA 3FJOA 2VP4A 3AKCA 3G4SB 4NZYA 1NG1A 1CP2A 3T12A 5TVKA 3W3AA 1U99A 2C2HA 4ZKEA 3RRZA 4Q9LA 3ZJYA 2QTVB 4C3ZA 4OK5A 1YI2B 5CK5A 3FE2A 3CC2B 2GETA 2N46A 2NZ8A 2CCKA 5EXPA 3U3RA 1D5CA 4AF7A 3Q85A 1EP1B 4PFSA 2XXAB 1BYUA 2HYIC 1KMHA 1GL6A 3HYTA 3KJEA 2DFLA 2QNRA 2ZE6A 1FTSA 5BW8A 3KTAA 5FI0B 3QPWA 4HLUA 2J87A 4TQUS 1WXQA 4C4PA 2VSFA 1RYHA 4LX0A 1E2FA 3EZ9A 2G6BA 4GMXA 4QXAA 1HQCA 4LY6A 3SR0A 2C9CA 1D9XA 1W4RA 3HPRA 4O25A 3FFAA 1DAKA 3PEYA 3NTUA 5GJWC 1G6OA 2G0NA 3RRNA 2JJ1A 2ODBA 3IHWA 1QHGA 5GVSA 1VYVA 5CK4A 4FCVA 2VYFA 2FFBA 1PLJA 1SZPA 4AF6A 4JT4A 1KO5A 1E79D 1EX7A 1EFCA 4B6FA 4C0HA 1DAHA 3PEVA 1UKEA 1ZP6A 3LX5A 2ATVA 2TMKA 4ITRC 5CM9C 1G291 4EFMA 3VKHA 4EH1A 1XMJA 4I1OA 1Z2CA 4PGOA 3MFYA 4DDWA 1P9NA 3EW9A 2F7SA 5AUQA 3ZS9A 4FN5A 3W5JA 3WYGA 5IK2D 2NQ2C 2X8AA 3M6AA 2OK8A 1GKUB 1H85A 3RS3A 2ZYVX 2JDIA 1AK2A 421PA 2XOKA 1R0YA 4PPFA 4C0SA 2QTHA 621PA 1SHZA 2Z4RA 1CKEA 1Q1ZA 1JQLB 2OV2A 3KX2A 3OZWA 1U9IC 4IFBA 4HZUA 3I92A 4NYJQ 1VQ9B 3OIYA 2O8BA 3EA5A 1NG9A 2EU8A 2WIBA 5CJPA 4URYR 1CJTC 4LYHA 5L3RA 3U3OA 4GZMA 5JS8A 5KSZA 1ZAKA 2QSZA 3ND9A 4D4JA 3EIQA 1MH1A 1J99A 2EVWX 3TQCA 3MAAC 2J7PA 4HYYA 2O0KA 2Q9AA 4QNMA 3O8CA 1YJ9B 1K6MA 1YRBA 2CRVA 1J7KA 1K8AD 3ZGXA 2HF8A 1NLFA 4OJKA 1UBCA 1XZPA 3U6BA 3QF7A 1H8ED 4A8JA 1MABA 1UEJA 2OLKA 1KZGB 5DI3A 5K8UA 4KHZA 1UKZA 5G41A 1ZU4A 3EIEA 1MRNA 2REOA 4EJSB 4D26A 1AGPA 3C5HA 2RGNA 2PEZA 4PC2A 3C5CA 1R8QA 4UNPA 5G53C 1RPZA 4II7A 4K1XA 2CDNA 3HR8A 4IVQA 4XSHA 2EFGA 2DY1A 5JMTA 1NBMD 4P4UA 1D1NA 1O3YA 5GJCA 1COWA 4Q5IA 3I1FA 3THWB 4MYUA 5DH9A 2ATXA 3PV0A 4OYHA 4YXWD 2JA1A 4US2R 2O8FA 3R20A 1ONBA 3OZVA 3KUDA 2VEDA 5AN9A 5DN6D 2QL6A 1KD1D 1YHNA 4GT1A 1GUAA 1KI1A 2ZRKA 4TSFA 4BFVA 4OK6A 2NO0A 3UMSA 2GZHA 1TUEA 1HE8B 4PC1A 3CPJB 3L0IB 4MYHA 3BRWD 3UWOA 1XPRA 3LVQE 4Q9HA 1Q1QA 521PA 2ZI4A 4MRPA 3EASA 3L0OA 2WKQA 4M1YA 3ICEA 1LY1A 2MSDB 3NEYA 3QXCA 2VIIA 3OIUA 2VNJA 2N1BA 1BH2A 2QQEA 3PENA 5K8IA 3DKVA 5JRZA 5KNBA 2XB4A 4R7ZA 4QBGB 3P32A 4JBWA 1IBRA 2W83A 3E1YE 5KNDA 4MDEA 3C4JA 4OHWA 3FDIA 4NONA 2FPMA 2H8KA 1QHHA 2LKDA 3OZUA 2PH1A 5EE0A 3KFXA 2AWOA 3GFTA 3PG5A 2RGGA 2GBLA 1XPOA 3W3ZB 1G5RA 4UXIA 3T1VA 3Q8XB 5EP3A 2HEIA 2X3UA 4YMWA 4TTRA 3UIEA 2CXXA 1U0JA 3B1WA 3T1OA 3Q5EA 2JLWA 4BGDA 1VQ6B 5L3VA 1Z2AA 3AH8A 1QVGB 2ZITA 1HYQA 4B3FX 1VG1A 5AJXA 5DE3A 3WMFA 2FFAA 2WKPA 5LB4A 3DEFA 2ASEA 4IEIA 3ETLA 3SOPA 5JBQA 3JVUA 1DADA 4ESVA 3MWLA 4XWAA 4HLQB 4S2EA 1QRAA 1W47A 5KSOA 1E2QA 2ZSDA 1RW4A 1Z3IX 4NL4H 4Q47A 4X8MA 1VMAA 3A1TA 5CYOA 5FPHA 3R9XA 5EE1A 1TEVA 3K9GA 1NSFA 4LHVA 1Q21A 4JLBA 4DLRA 1UPTA 4XTCS 1XTIA 2JAQA 1XMVA 2GHIA 4IXMA 4PAOA 4DLWA 1L2TA 2VP0A 2YJTD 2VSXA 5F2EA 5EP4A 1DDIA 3NHAA 1U0HC 3CRQA 1KDTA 1UDXA 3GD7A 3L2OB 4KLZA 4OHXA 3TK1A 4A9AA 4A82A 1X6VA 3OEED 2FZ4A 1OHHD 5FR1A 4IOKA 1MABB 1UF9A 1MOZA 2D2EA 3BWDD 2EFEB 2H18A 3QY0A 4Y0VA 5C4MA 1CR4A 1R5OA 1EG7A 1P7CA 4F4JA 1II8A 1GVHA 1WBDA 3OEHD 1DAEA 2PCJA 1QBKC 121PA 1SGWA 1RRCA 4C7OB 1E3MA 4Q9JA 1A4RA 4MUBA 4NCNA 4UQOA 4M53A 1F20A 2ZTSA 2IYSA 2IYYA 2A5FA 4TLDA 1QF9A 1NMZA 1KO4A 2BV3A 4HEJA 3CZQA 3W5VA 2ZETA 1NVUQ 2ZJAA 1TVCA 3U3MA 2O8BB 4RKEA 4B76A 1UJ2A 3QNUA 2P6UA 4EUNA 3C15C 2KI5A 3RANA 2E87A 5DYGA 1G3IA 4KYIB 4DC9A 2DBYA 4LC1A 2ODNA 1SXJE 2D4HA 2FWRA 3SFZA 4A2WA 2YOHA 2DEUA 3K0SA 3W9YA 1OB5A 1CXZA 1P72A 2A30A 5JLJA 2IA5A 5L8VA 3ADBA 4IOJA 4DIEA 1GDDA 1OB2A 1U81A 5TDHA 4JS0A 4EQ6B 2IWHA 3QF4A 1Q57A 4NE2A 5HPYB 1KJZA 3QVVA 2DWQA 3NC0C 2ZSAA 4P6VF 4BEJA 1RJ9B 5FTMA 4AYTA 2IXGA 2CE7A 2RAPA 2ZS8A 2V8OA 1JA0A 1G3MA 3QVUA 5E95A 3SJAA 2XNSA 1ZUIA 5HR5A 4TYWA 1W36C 2HCJB 3RABA 1GJRA 3BH6A 2NPFA 3AB3A 5GV8A 3NDBB 4R98A 4JSTA 1EP2B 4US0R 1GVNB 2VQSA 2YKGA 1OSNA 2V1XA 1WRBA 4LPKA 1XEXA 3VAAA 2ORWA 4HAXA 1E2NA 4LJ7A 2AKYA 3WNDA 4JLJA 2GDJA 2V6IA 3KJIA 1ZMXA 1OHHA 1LS6A 2X19A 3AF4A 4GSYA 3SS8A 4A2PA 4BZPA 4QJ4A 1G17A 1Z0KA 5B57C 5KPDA 2HT1A 3AVYA 3QFCA 2HYDA 3TAUA 1FMLA 3C14C 1L4YA 1VCMA 5BYJA 4ZI2A 5G3YA 5J5CA 1C9KA 2QRNA 3GJ5A 4D81A 2IS6A 1ZM9A 2G77B 4PHGA 3FVQA 5H59A 4PSVA 1R0WA 4GOKA 4JLKA 1DBSA 2H57A 4RD2A 4E07A 1VIYA 1ESMA 721PA 4HB4A 3KQNA 2O8EA 1EGAA 4DCTA 3W2IA 1T4GA 3K0CC 1SVLA 4M4SA 1DAIA 1WDTA 1U2RA 1OIVA 2GPJA 1LVGA 2VBCA 2WIAA 2F3RA 3VO2A 4QBIA 1RYFA 2GVZC 1NN3A 2QDXA 4QJ5A 2JJ8A 2JJ1D 2ZRMA 2XGJA 3ASYA 1VQKB 3SI7A 2IUSA 2IYXA 1TF2A 4DLUA 3RRYA 3BH7A 1D6JA 1XJQA 2GAOA 1W87A 2PEYA 2J3EA 1VIAA 2QT0A 4HAZA 4LJ4A 4EPTA 2ZE5A 2QM8A 3RSOA 3EZFA 4ARZB 4BASA 1YR9A 4DRZA 1ZD9A 3K70C 3U3JA 1KO8A 4UNNA 3FMOB 5D3QA 2JLYA 4MQBA 2ZJ5A 3ZIAA 1VECA 2QT1A 2PMKA 2GVDC 1WA5A 2PLRA 3PCRB 3VR6A 1CU1A 4D6PA 4OHZA 5FR2A 3QENA 2XXAA 4FMDB 1ZM7A 3B9QA 5FBRB 5JCZA 2HXYA 3PUYA 2OTJB 1Z07A 2ECKA 4E22A 2CNWD 3AGQA 2G1JA 2OBMA 1G21E 4LSGA 4ZCMA 3RVBA 5IF9A 1F6BA 1Q1EA 1X8JA 2FV8A 4RCYA 1SVMA 2QRZA 5FBVB 4EDHA 3EZ2A 3ADDA 2A5YB 1KGDA 1KK3A 3E20A 3AP2A 1EFUA 4ACBA 1ZYUA 5H8WA 3UKDA 2QE7D 3A1WA 3P4YA 3VHLB 1E1QD 2CHGA 2ZJZA 3IUYA 4TSFD 1QFJA 5L3QA 2OZEA 2XTNA 1XE1A 1FNNA 2F43A 2GQFA 4ZCLA 2J9RA 5KSWB 3N5CA 2OBNA 4QBHA 2AL7A 4NYIQ 2RC5A 4NYMQ 5J4KA 4EKDA 3VNUA 4IOLA 3CO5A 1N2CE 3K0FA 1G6HA 4FMBB 4JLOA 3OJWA 2CLSA 2IYTA 4LJ5A 1YJNB 1W7AA 2FOLA 4DDTA 1OH8A 2JLRA 4DBLC 3DM9B 1E98A 2XX3A 2A78A 4GRAA 3W6PA 2ERYA 1P61B 1D2NA 2ZRBA 4FXPA 3EC1A 2QBYB 1N6OA 1IN7A 3JQPA 1S3GA 2H17A 3N70A 1AA9A 4HUQB 3ES9A 3QJYA 4YAWA 3KUCA 3I4LA 1F2TB 3K53A 4BLTA 1NNEA 1NP6A 1Q20A 4OQLA 4L15A 1FQJA 3SU8A 4ERNA 1D2MA 5EE5B 4QNRA 4PAQA 1JR6A 4Q19A 2QSYA 2WVJA 5GADl 4LK2A 5EUMA 3WYFA 3SQWA 1DVRA 3OFND 3RHFA 4AG5A 1W35A 1TL7C 2ZRCA 4HLUC 3UG6A 3PJRA 1SVSA 3HU1A 2D62A 1G7SA 4KFTA 2D06A 4G5SA 4M21A 3SBEA 4CDGA 1M7HA 3BE4A 3BXZA 2CK3D 2GWHA 3LRPA 3U7HB 2ZIAA 3UG7A 2PX0A 3CRZA 3I56B 2Q6TA 2O52A 4CEHA 3FPAA 2FSGA 4HZIA 4TQAA 2JLUA 3D8BA 1GIAA 1AIPA 3H0KA 3TW4A 1YITB 4HAUA 3RSLA 2W6IA 4LI0A 5BXQC 1G1MA 3IBGA 1DARA 4N3GA 2P2LA 3AVVA 5AJZA 3JZAA 2D3WA 4C43A 1Q0UA 3W90A 1E62A 3CB4A 5J4LA 2Z4SA 4AD8A 2XJ9A 2MMGA 2CL7X 4OQXA 5L3SB 1ZU5A 3DHWC 4P4SB 2XJ4A 3VNVA 4XOIA 3R9IA 4DHEA 3K1JA 1TQ4A 1OXVA 3U7GA 3BORA 1W2GA 3LBIA 3U4QA 2CL6X 3D31A 3TKLA 1E9EA 2GCNA 1U8ZA 4EAQA 4GI7A 1AN0A 1M1YE 2EYUA 1JJVA 1K8RA 3K09C 4HI0E 3W34A 1QVRA 1QFYA 4AKEA 4B2PA 1EWYA 2ZS9A 4KLNA 4TL8A 5D3MA 1Z29A 1FZQA 2DPXA 2VTKA 2ZJ2A 4OKSA 1M34E 1RVDA 3AKYA 5LPNA 1VQ4B 4EPXA 1II9A 1GL9B 1GKIA 4Q00A 2LCFA 5K8LA 1RKBA 1QVFB 3IIMA 2FE4A 4C2TA 1FX0B 4BRWA 1G41A 2AXNA 5IHPA 2REBA 1SKYE 3K0FB 2WPDA 1G5TA 2A7QA 2A5GA 2QI9C 2ZYTX 5CDFA 1E0SA 2C99A 1QHXA 2O0JA 1PUIA 3PITA 4HDOB 1OFUX 1SKQA 2VHJA 3WBKA 3DZDA 3OAAD 5DI3B 4KSBA 1NY6A 1U9IA 1JJ7A 4N1AA 4FI3C 2WSMA 5CIWA 1X1RA 2ZI5A 1TQDA 2GXUA 3DOFA 3REGA 3QEOA 3QKUA 3WP0A 3B82A 4DIDA 1DG3A 2QA5A 1Z0AA 2ONKA 3IPYA 2QMHA 1ZM4A 2FNAA 3OIVA 4L9SA 4N0EA 2RGNC 4JJKA 4X8OA 4P32A 5A5GA 2G0TA 4C2UA 1TU4A 3CC4B 4GL2A 5FTJA 2Q0HA 4NMMA 4DDUA 2F1JA 2RCNA 1NIJA 2YWHA 1QHHB 2FJUA 2OBLA 4YDHB 2UZ3A 4XWOA 4JYCA 4Q4JA 2VP5A 3ZVMA 3LFUA 3TR0A 4NYIR 2F3TA 1CRQA 3F3YA 3FKQA 1XBTA 1AMOA 4FCTA 3P4XA 1S9DA 3L8YA 4M22A 1M1KD 4LV5B 1Z0DA 1R7RA 3RWMB 4B32A 2ODEA 3MWKA 3VMFA 1EFHA 3X2SA 1T0JB 4Q66C 3PIRA 2IW3A 2BMEA 3RS2A 2QEXB 4M1SA 4V0NA 5C2JB 5D3MB 4TYNA 3EARA 4B48A 2QE7A 5AR1A 2IYLD 4A4DA 3F0TA 1JNYA 2O8DA 4CVNA 1W46A 1ZD1A 4PPQA 3TUIC 4JSYA 1T5IA 4PSAA 2V55B 4JL6A 4V02A 4C30A 3PUVA 1S8FA 2C8VA 2GCOA 3K8YA 2OAP1 4XWKA 4ASUD 5FH9A 4Q03A 1RZ3A 4YHBA 1E9FA 1DOAA 1ZNXA 2VO1A 1X1SA 5AUOB 2XZLA 4IVRA 1XTJA 3MJHA 3DKPA 3KQLA 3ZIAD 1JA1A 1KK0A 3A58B 2JGNA 4I1VA 4ILEA 4OHVA 5FUWA 2VSOA 4BUJA 1QUFA 3CCRB 1N6HA 2OFOA 4RD6A 4NP6A 5DSZA 3VFDA 1TNDA 4DSNA 1N0VC 4A0RA 1X3SA 4QOSA 3BGWA 3SJBA 3OHMA 3PXGA 1W36B 2QTZA 1QX4A 2Q21A 1YZNA 2OHFA 4MRRA 3ZH9B 1NSTA 1NMXA 2RKOA 5SZJA 3HU2A 3CRW1 4PZZA 1UDWA 3AF2A 5KNCA 3HPQA 4PC6A 4B4DA 3OESA 5JRJA 2J5XA 5DLQC 4G01B 3M1IA 2ZRAA 5LB2A 2X77A 3ZVLA 2RB4A 2ZI9A 4B6EA 2OE2A 3O8RA 3CD6B 1UKYA 1DO0A 3MMPA 2VF8A 3VX3A 4E5UA 2ZPTX 1W2BB 1RJ9A 4MKHA 3K09A 4A36A 1A5TA 1NLZA 5CLLA 2J0UB 1VG0B 3JQQA 1S9HA 2V7QA 4Q1DA 1AJEA 1PJRA 1FQKA 4URZR 4OI0A 2XNDD 3QFTA 5B58C 4UJ5A 4ABYA 3ZD7A 2WJHA 3UWKA 5AJVB 4LBWA 4U00A 2BGIA 4NU0A 2YZ2A 4PQYA 3C41J 4PHTA 2XNDA 4DZZA 1R4AA 5DNYB 1MR3F 4M9XA 3AUYA 5H5JA 2KBFA 2RHMA 3U61B 5C1BA 2CCGA 2WWHA 1SQ5A 3L0PA 2A5JA 5ANRB 3BERA 1GOTA 2JJ2A 1BIFA 3FMFA 4P0TA 5J40A 2H5EA 3CX7A 4V03A 4V0ME 1XX6A 3NBFA 5E3HA 3P27A 4H1UA 4B3GA 4W5JA 3GP8A 4TTPA 1XD9A 3MCAA 4IDPA 1Q1BA 3IO3A 4ZKDA 5KU1A 3MSXA 1DDGA 1IY2A 4V0OA 1E99A 4NHOA 3L82B 5FUYA 4J0QA 4C0QC 2VYQA 4BFTA 3TW8B 4U02A 2QMUA 2G1KA 5A4JA 4PX9A 2B7BA 5CDFE 1FW6A 1K9MD 2FA9A 1OW3B 4X8HA 1XCPA 1NRJB 1W34A 2B92A 2GILA 2OK7A 1GP2A 3K70D 3ZDQA 3ZD6A 3KTAB 1YU9A 1DG1G 3KZ1E 3LWNA 1I7PA 2ERXA 1T9HA 4HLDA 4HB3A 3UANA 1G3RA 2HUPA 2NO1A 2YOGA 2A9KA 4GBMA 3IEVA 2O8DB 4Y0AA 4DLSA 4A6XA 2WJIA 2VPPA 4TYQA 2VH5R 2PJRA 2Q9BA 4OBEA 2GCOB 3VR1A 3E2IA 2OLJA 4A15A 1MO6A 1PUJA 3CZPA 2DR3A 1G8PA 3QSYA 1N6KA 1YJWB 1YZKA 2GJ9A 2RGXA 2FN4A 3NIBA 4XVUA 3QIAA 3IEUA 3B1YA 2FSIA 2GNOA 2ZRGA 4BLOA 4KJZA 4CIDA 1Z63A 1UAAA 2ZE7A 3OEHA 3A4LA 3GMTA 4NCKA 2BC9A 1UKVY 3ZC3A 2GJAA 3TVTA 1ANKA 1R0ZA 1A8PA 1SXJB 4BQSA 1VHTA 4PHFA 3X1YA 4MDFA 2W2TA 4RSGA 3QFSA 4EPYA 1R5BA 1YZGA 3C8UA 3FGNA 2JLVA 3R8FA 2VL7A 4M1KA 1TAGA 2XAUA 3U7FB 2RMKA 4LPSA 4R2IA 2WWXA 4H1VA 4Q9IA 4M1TA 4KSCA 2W0SA 4WIAA 1QHIA 4YDSA 3TE6A 1F3OA 3TIFA 1K5GA 1SVOA 4QGGA 2IWRA 3A1SA 1NN1A 2K5UA 2WSSD 1HT2E 4JLNA 2R9VA 2OCAA 1GG2A 1KZ7B 2Q3MA 4R71A 5GV7A 3BFVA 3RDPA 3PR1A 4OK3A 4UXJA 2BJWA 1AS3A 3UMRA 3BFXA 1S2MA 3KKNA 4D2IA 1P6XA 4XD7D 3H1TA 3RC8A 2BSAA 3A4NA 1KC8D 2J1LA 2YV5A 4D4LA 1XTRA 2ZI6A 3R8CA 4Z51A 4KFSA 1CNFA 3CR7A 2J59A 3AVXA 1G20E 1UBFA 4Q4LA 3THXB 1J8YF 3U2QA 3N2EA 3GJ0A 4D0NA 1HH4A 4TL7A 1FOEB 1OKKD 1E2JA 1XEWX 5ELXA 4MYCA 4AKHA 4D0LB 3JVVA 5LD2B 3A1UA 2WTUA 2ZSFA 2BN4A 4BFUA 2PL3A 3LO8A 4DB4A 4NKRA 1W1WA 1FX0A 2VHUA 4DLXA 2ORIA 2DFTA 2ZYUX 4RFSB 3VTKA 4A6PA 2F55A 5BN4A 3O8BA 1LV7A 2CK3A 5FBQB 4F4IA 1ODFA 2YOFA 3PEUA 1G19A 2HF9A 4YMTA 2P0EA 1W4BA 4LGMA 3VR2A 2A2ZA 2V9PA 3KDSE 1W2HA 1E2DA 2ZJOA 4V0MA 1T6NA 4JLAA 1N6RA 1A82A 2WV9A 3TMKA 2R65A 5THXA 2QGNA 2QP4A 2IHYA 3FFBA 2FG5A 4BPBA 2W00A 1KI4A 2J0UA 4UNQA 4YMVA 1GKYA 2XSZD 3QG5A 4DWJA 3TUZC 2G83A 5J4YA 3H4MA 1EWRA 1GITA 2ZU6A 5FOVA 1P2TA 4ACAA 1US8B 2BWJA 4WAUA 3WNCA 1P5ZB 3ZZTA 1S3SA 4W5HA 1WBBA 1F2UA 4CEIA 1C1YA 1HURA 4QGHA 1II8B 4A2QA 2N42A 2D7CA 1JECA 1JR3E 1U8YA 2WAYA 3ADCA 3W8RA 3LQQA 1OLOA 1XXHE 5EE9A 1KK2A 2OAQ1 4PO9A 4RD4A 2Z43A 1CR1A 1A2BA 3W5IA 5C4GB 5E7JA 1E4YA 4JJZA 3GJ4A 4JVMA 5HE8A 3K0CA 4DCNA 1EXMA 4LYAA 2GZAA 1T3HA 4Y9RA 2Z0MA 5FTKA 4C9BA 3JQRA 4OQFA 4QGAA 4R2HA 1NL3A 4I4LA 4BECA 3UPUA 4URUR 4D80A 4M8NE 4Q1FA 1FP7A 4CT5A 4BFYA 1M7BA 3KJGA 1UFQA 4C0KA 1G4UR 3MWYW 4IDOA 3CPEA 1IJEA 4UNSA 3BK7A 4C0LA 1HUQA 4ZCIA 1VCIA 2AK3A 3SHWA 5HZHA 4G3XA 3EA0A 4IFEA 2OM2A 2JDID 1N5LA 1ZIPA 1H8HA 4IDHA 2ZJBA 1JALA 2QP9X 3PFIA 1WCV1 3LVRE 4JL8A 4KBGA 4GNKA 3WNBA 1EESA 2BM0A 3LVBA 3WBJA 4B47A 1C4OA 1FUKA 3LW8A 4XSGA 1W36D 2BMJA 4PTLA 3PUWA 5HE9A 1F5NA 3CX6A 1GTVA 3KKQA 1NKSA 4ZDJA 2BCGY 1WF3A 1Q82D 4ON9A 1E9CA 4RZUA 1SKYB 2QAGC 4R9UC 2ZR9A 3CR8A 2OO7A 1O87A 3FWYA 3H84A 1MO5A 3BJIC 3AKEA 1E6CA 4M2LA 4B43A 1ZINA 3B2EA 2ZSBA 3GFOA 4M1OA 4Q7LA 3OEEA 5FBLB 4BEBA 3U7EB 4LYFA 4NPHA 1KI9A 1YZTA 4FW9A 5KTYA 1XB2A 3BD9A 3SYNA 2FGKA 5DGXA 2WWIA 3IGFA 3VR5A 2BMFA 3A8TA 1T5LA 2W58A 1E79A 1M8PA 3W2GA 1XD2B 5CYPA 3V4FA 4F92B 1DO2A 1N8RD 2GXQA 1CBUA 3AP3A 3LO5A 1D9ZA 1E0JA 4RVCA 4AG6A 1HQYE 1FTNA 2F6RA 3K0AA 4Z8XA 3LAWA 4KO8A 1VYTA 5FA6A 1P3JA 3Q3JB 4L4UA 4QHTA 4LJ9A 2YC2C 3Q5DA 3I61A 4DDVA 1YRAA 1OF1A 4UKDA 3EG5A 1OE0A 5FPTA 4HE6A 1TPZA 3CH5A 3QE0A 5TV2A 4Q7JB 5JJLA 5E7IA 1VQPB 2YINC 1Z22A 1S4QA 1QUEA 3CRRA 3SBDA 1N25A 3CRVA 3DZ8A 1U8AA 3CC7B 1QGAA 3TNFA 1CQXA 3EPJA 2FMXA 1OH6A 1YZQA 1IHUA 4E09A 3GEHA 1GWNA 4MRVA 3BS4A 1XCGB 3LLUA 3IHLA 3ND8A 1UM8A 1S1MA 2GBLC 2CHQA 4DLTA 3OE7D 5FOTA 2GRJA 1G7CA 1YZLA 3T1QA 3IQWA 2QUZA 3HWSA 4BZQA 2G88A 3CCQB 1OGJA 2Q3FA 5GJBA 1Z5ZA 3B6EA 2V6JA 3GPLA 1GRNA 1XD8A 5KHOC 1NLYA 2ZJYA 1E2KA 2C04A 4A0HA 3NXSA 2CVFA 2CJWB 2GCPA 3P26A 3THYA 2WKRA 4IDNA 3LQRA 2IUUA 3W6NA 1JR3A 4B3XA 3RS4A 2D74A 4LHXA 5TB5A 2DWPA 3X1WA 5TXGA 3THYB 2WZQA 3SE0A 3CCSB 4P3YA 3IKJA 1EFTA 5BN3A 1I4DD 5DN6A 5HKKD 3W2EA 1HV8A 1E64A 2XZOA 3LXXA 2GJKA 1US8A 4ZV4A 1Z8FA 2DYKA 1CNEA 1GAQA 3U6KA 1KHTA 1OV4A 3AF0A 3SYKA 2BDTA 5JFGA 1OH7A 3L8ZA 2IYWA 3SYLA 5JI3E 4QKQA 4F7WA 3K9HA 2WJVA 2V4ZA 2GEUA 2ZQ5A 4EIWA 2DWOA 3KXIA 2L0XA 2LWIA 4LZZA 4B3DA 1E94E 3T15A 1Q3TA 1Z28A 3QXSA 5L3SA 2J0SA 4GOXA 4G1UC 4JLMA 2NO9A 3BH0A 3AF3A 4B33A 5FL7A 2R6FA 3GQBA 2JASA 3GLFA 1Z0FA 4NCIA 4PZYA 3IIKA 1L8QA 4YAOA 1YR8A 1UMKA 1ZNZA 4D82A 4X8LA 5DISB 1CLUA 3AVQA 1AKYA 1BO6A 4JVSB 3DO6A 1AZTA 3IDQA 4BPRA 1S72B 1SULA 3QKRB 4D0GA 2VP2A 2YNMA 3MJRA 1RRFA 5JJIA 3AVWA 4P4SA 1VYUA 2EWVA 4TYYA 1KMQA 3AEZA 2NO6A 2VP6A 4F91B 4DUGA 5K8TA 1F60A 1EFRA 1XD2A 3EIHA 4OL0A 4XD7A 3VKWA 2ZU0C 4POAA 4CT4B 2WBLC 3W5HA 4FMDF 2ZROA 1QHSA 1BKDR 1RIFA 3LNCA 3BB1A 2XITA 4JL5A 3AP1A 2IUTA 3I73A 2FU5C 1ZCBA 5EMNA 5TARA 3VKGA 2GF0A 3CWZA 3A6PC 1GNPA 2H16A 1NMYA 3CPWB 3B78A 2C95A 2Q3HA 5E7MA 5AWFC 1GAJA 1E9SA 4CYMA 1XTQA 1CJMA 1XZQA 4MRSA 3RS5A 3GLIE 3KXLA 3KQUA 3SHFA 3VQTA 2F9MA 2BIFA 1E69A 2V3CC 3S1AB 2W0MA 2R6AA 3FKSA 2VF7A 3BB3A 3B85A 5KO2A 4CZ2A 2QBYA 1NDHA 4IOMA 3HU3A 2WSSA 1XWIA 4GOJA 5B64A 3Q7PA 1IOZA 4JLDA 4Q7KA 4K8OA 1FNCA 2BVNA 4Q21A 2JCSA 4WA7A 1I2DA 1CJVC 1II0A 2VHQA 3LD9A 2OCYC 3LX8A 3K0AB 3T5GA 4DKXA 3K70B 2V1UA 3CMEB 1NVVR 5HCIA 2BMDA 3TSOA 1P75A 3MLEA 1S1CA 4A0FA 4ESHA 2YVUA 4FMCF 3CNOA 3ZLJA 4WZBE 3CLVA 2O5VA 4L16A 2OFXA 1UEIA 3CCUB 1Z0JA 3E70C 3EXAA 2ZVQX 4Z1MA 3UK6A 1OXXK 3WRXC 6Q21A 2RH5A 2XNJA 3HJNA 1RC8A 1R2QA 3I55B 1YQTA 3I8SA 5DYIA 3SDZA 2YHSA 4OQMA 1SVWA 4YXWA 4B75A 4M9SA 3CF2A 4W7SA 1GILA 3TUJC 1NBMA 2WMNB 2A3RA 3AVPA 3UXMA 4MRNA 4JKYA 2NOAA 4TLCA 1QG0A 1WQ1R 2ANBA 3D6TB 4DCSA 4TT3D 1JI0A 2BF4A 3R7WB 5AJWA 1XXHA 1N3BA 2KJQA 1IQPA 3QKRA 3VO1A 4Y7CA 1N6NA 3OFNA 3EPKA 4M1MA 1E2HA 1YKSA 3B1XA 3CX8A 4U9UA 1QG2A 2ZAMA 1YVDA 3ECCA 4LHYA 2FX3A 5DO9A 4DSTA 1FUUA 1AQYA 1KKMA 1OYYA 3H86A 1PVOA 1Q12A 5HKKA 2EYQA 3BOSA 2HJVA 4JVNA 2IF0A 5KPJA 3PEWA 2EFCB 3ZBUA 2QU8A 2YWFA 3B5JA 5LBIA 1GNQA 4NTZA 2BCJQ 4TL9A 1R8SA 1Y63A 4TL6A 1KI8A 1G7TA 2DFNA 3WHKA 4Q4HA 4WOPA 1G9XA 4LC0A 5KDDA 1LW7A 5TR9A 3G6EB 4KFUA 5SZIA 3AKDA 4KCGA 3EAQA 3RLFA 1FPMA 1N6PA 4BRUA 3LH5A 2WJYA 3P20A 5DHAA 5EZ6B 4WXPA 4BLPA 1G4AE 1U0LA 2GKSA 1OT3A 1H8EA 1KI6A 5BYKA 4O3MA 1IB0A 5FOWA 2WWFA 1Y3AA 3GLIB 4WQMA 3KKMA 1KJYA 1OJLA 2R2AA 4U7DA 1TQ6A 4MGYR 4G5QA 1Z6XA 4K81B 3V4RA 2XOKD 2F43B 3NKVA 5EXTA 2PT5A 1ZIOA 4O2RA 4QJ3A 3THXA 5AK0A 2ZR7A 2PZEA 4E03A 4Q4JB 2ZXUA 4DJTA 1ESNA 1KDRA 5BQ5A 1KQSB 1XEFA 4HSEA 2BBTA 2ZRIA 1TTTA 3FYHA 3BFKA 2QROA 4N0DA 1JAIA 4GP7A 3I8XA 1M7GA 3LBNA 4O0MA 1Z08A 5HTKA 1G8GA 2R6GA 3W6OA 4LBVA 4QL3A 4KI0A 1ZW6A 3LA6A 4OI2A 2IL1A 4L5BA 4BFZA 1ELOA 4LWZA 5E4FA 2C9YA 3AGPA 1DS6A 1YE8A 1ZRHA 2LKCA 1XP8A 1KO7A 1LTQA 3K9LA 1G3QA 5HCNA 3LDAA 3HP1A 3CCLB 4G5RA 4ZI3A 1N5KA 1XMSA 3NH9A 2D7DA 2RGEA 4ZDIA 2JATA 3NWJA 4YQFA 3EPLA 1VTKA 3NDPA 2B21A 2VRWA 5GVRA 2BHRA 1NJGA 4LV8B 3B1VA 1XF9A 1U90A 3DDCA 1KAOA 2OCBA 3GLIA 3GLGA 2EFDB 3IQXA 4P31A 1Z6YA 3TAHA 4TMXA 2VZLA 1KI6B 4Q4HB 3S1AA 1WP9A 2AK2A 1MV5A 1XPUA 3EWSA 4L9WA 2IXEA 1OGIA 4Q4AA 4DLZA 1E1RD 2DCUA 1VG8A 2ZUBA 3QF4B 1KYIA 5F98A 2F1HA 2GEDA 4V0KA 1Z6AA 3QXJA 1N5JA 2A5DA 3GJ3A 2ANCA 1JB9A 3ONWA 3QKSA 4LHZA 3RYTC 2JLXA 3ZBTA 1MRSA 2W6JD 2ZRFA 4KXFB 2YYZA 1M6NA 1GSIA 3EPHA 2F1RA 1FL9A 1OIWA 1Q3HA 4TMZA 2BBSA 4YAFA 4G5OA 4S35A 3R7WA 4BFWA 2WWYA 4UAJA 3KB1A 5JSZB 4RD1A 4WBSA 3PUXA 4RY2A 1B2RA 3SQXA 3PUZA 4B73A 1R6BX 2IT1A 3B9PA 5FPSA 5AUNB 3OJXA 4AK9A 5DHFA 3X1XA 4DCUA 2O8CA 1QGZA 3KB2A 2QPTA 4PR0A 3T61A 3T06B 1QG4A 2J0VA 4A92A 4MKIA 2PX3A 5FL7D 1W48A 3ZS8A 5EZ5A 1GL7A 2C78A 5FBWB 1FP6A 1N0UA 3KL4A 1N6LA 4YONB 2AFHE 4W9MC 4B44A 2G3YA 1MO4A 1ZVQA 4KYUA 4PANA 4QHSA 3C7KA 2ZJ8A 4QM7A 3GJXC 3I62A 2P3SA 2WPDD 3TJZA 1E9DA 3DPUA 2P6RA 3W2HA 3T34A 2CNWA 4Q18A 3ZVNA 1E0AA 1FMJA 2QEQA 4H9GA 4WZAE 4UXHA 2NGRA 1Q81D 4G1VA 1V5WA 2IEZA 3JZMA 1HTWA 1TQ2A 4JZKA 4KVAA 1BOFA 4G5GA 2B7CA 4JBYA 1NI3A 4Q4AB 2J7KA 3LBHA 1JPNA 3F5FA 1KNXA 2ZEJA 2E9SA 2AR7A 4CF7A 5FOUA 3HDTA 2ZRJA 4BFXA 2QPOA 821PA 3Q7QA 1HEIA 1WMSA 5DIFA 3CIOA 1XJ0A 4QFMA 1J9ZA 3M4YA 4TT3A 2MSCB 5M04A 1OXTA 1JR3D 8OHMA 2XSZA 2YWGA 5H1YA 5B2ZA 2YC4C 4FK8A 2IYRA 2I1VB 5SZKB 3MWJA 3GJ6A 5TY0A 1VQ8B 2QG6A 5EUQB 5F9FA 3VHXA 2C5LA 2WOOA 1AZSC 3QEJA 2WAXA 2FH5B 1E2MA 5B30A 4CEJB 5KUTA 3X1ZA 1E9BA 1G7RA 4DSUA 1E2PA 2WWGA 3RRMA 2MMCA 1TLLA 4BLRA 1CIPA 3N2IA 4MH0R 4B3BA 4Y9UA 2QP3A 1D2EA 3ZZUA 1XTKA 4HDCA 3CWQA 2ZREA 2ORVA 3CM0A 4FCWA 3TVDA 2HJGA 1BS1A 1LS1A 3QOFA 2FSFA 4NCHA 2KE5A 5KSYA 3BB4A 4URWR 5JEDA 4JLPA 4IDQA 1QHNA 3GEEA 3BC1A 1G8FA 2UVQA 4F38A 1ZD8A 1OXUA 2WOJA 1I4LD 1NIPA 2V7QD 1FRNA 2GJSA 3GCGA 2E1RA 2PCLA 4OJQA 4XTRA 3GJ8A 1Z83A 2GEVA 5CLQA 4AYXA 3WHLA 4C0BA 3ZZ0A 3IILA 1P2SA 3THWA 1G5PA 3B1ZA 3NC1C 3QBVA 3FOZA 1VG9B 1K73D 4DB2A 4KBFA 1E2EA 2P65A 1OH5A 1ETUA 3NBZC 3VU9A 2GTPA 3QKSB 4KFRA 4QC2A 4EPVA 1JBKA 1FFHA 4PPGA 3CPHA 2IEYA 3GEIA 4MUAA 3THOA 4NBSA 4FIDA 2CL0X 2O0HA 3L43A 4ZGNB 2WJGA 3CH4B 1DE0A 1RE0A 3FHOA 4RZ2A 2BBWA 1FRQA 2FPLA 2XTZA 1N5IA 3KXKA 4XH9B 3QI2A 4TN1A 4I81A 1IJFA 2B8WA 2AWNA 2ZRLA 3QXHA 3NBXX 5EE3A 1IONA 4IHQA 2P5TB 3L0SA 2QAGA 4Q48A 1JJ2B 4PXAA 2R6DA 2HDNB 1TU3A 5FI1B 1Q44A 1CTQA 1DAMA 1TMKA 3WXMA 3MG9A 4LBZA 2QN6A 1J90A 1IN4A 2PLFA 2OSBA 4G0NA 4LJ8A 3CW2A 5BWMA 1SHKA 4Q02A 3CNNA 1T8TA 2IXFA 3QXXA 4TMKA 4BLQA 1KRHA 3KQKA 1QH0A 1GRQA 5JCPA 2FFHA 1J8MF 4CGZA 1JB1A 2CLDX 1IY1A 3GLFE 2ZUDA 1QVAA 2ONJA 3SJZA 1VDZA 5JSZA 3B8HA 4LV6A 4Q01A 4UNRA 1T3SA 4MKGA 3WP1B 4MGIR 3QQ5A 2IYZA 2ZRNA 2J0QA 1CF4A 2ZRHA 1ZC3A 1SXJC 3QKTA 1B23P 1X8LA 2QM7A 2CBZA 4US1R 5JJKA 3NBYC 1TUIA 2FEOA 4LJYA 3QUSA 3OIWA 2QAGB 1TEXA 2B8TA 5J4HA 3DM5A 2IX3A 3ASZA 4ZGQB 1NY5A 1V43A 4TTQA 2DB3A 1EP3B 1IN6A 5FFMA 3Q9LA 1W49A 2AHOA 3TR5A 1CR0A 2GESA 4RFVA 3ZQ6A 3R9WA 1KAGA 5G40A 1TF5A 2R8RA 2GK7A 1OFIA 4DT1B 4NYJR 4NYMR 1XJCA 4QGFA 4B2IA 2O8EB 3W2FA 2X2EA 4DT1A 1YJ5A 1QZXA 4OQNA 4LBYA 2I3BA 3GLHA 2VLIA 5FUXA 2EFHB 3AM1A 1CEEA 5LDDC 2R44A 3WMGA 4A8JB 1YR6A 2IYUA 1W4AA 3G5UA 5FTLA 1E9AA 2QZ4A 2ZI3A 3FHTA 1XDBA 1P62B 1DAFA 4JT2A 2DFKB 2J7PD 2ZS7A 2ZVPX 4LJ6A 3CF6R 3Q72A 3LY5A 3D3QA 4AKIA 1XEXB 3CCJB 3LLMA 1SM4A 3CXCB 1E4VA 5EXSA 2IYQA 4CEHB 2QAJA 1ZM2A 2IF2A 3RS0A 4B34A 3LV8A 4DQLA 1VCOA 3V76A 4AWXA 2R6CA 3SFVA 4K46A 1S96A 4XIGS 1BJKA 3FPKA 4BWYA 3G0HA 3I32A 1MT0A 3QBTA 5CM8B 2EW1A 4TWZA 2NO7A 4AURA 4TLEA 4G1BA 2GZDA 4P4TA 3VX4A 2RGDA 3BAFA 1P4SA 2BEKA 2QMOA 2BJVA 2ZI7A 2CVHA 5F9HA 2FFQA 4Q1AA 4BE7B 2BBOA 1T0HB 1IXZA 3DMDA 4HDQB 4YLGA 3MHPA 2HMAA 2VNIA 4UJ3A 5JS7A 1QFZA 2PBRA 1NVWQ 2NZJA 3O8DA 3GLFB 1XCMA 1XU4A 2GXSA 2OEPA 2PZFA 4HB2A 1NN5A 2OT3B 4DLVA 1Q86D 1ZUNB 2GAAA 3M0EA 2X1VA 1NJID 3B60A 4WXRA 1MO3A 1L4UA 1KY2A 1JPJA 1E9RA 1OFHA 3A36A 2XNCA 3QPVA 4TYPA 2CHVA 4C0AC 3GJ7A 2BOVA 4JLVA 1VQ7B 4Q7MB 3K0EA 5FPYA 1KKLA 2JLZA 1JEDA 3AF1A 1A7JA 1G64A 1BMFD 2NPIA 4I1UA 4LDJA 4B2LA 2AN9A 2OILA 1OKKA 2KBEA 2F1IA 3SC3A 1TF7A 3ADKA 2GF9A 3NH6A 3CRMA 1E2IA 3C16C 1KSFX 1T3LA 3P1JA 2IC5A 1MKYA 3AVOA 5KDOA 1YHQB 5KYKA 4QM6A 2O8CB 3ZYCA 4O2LA 3E1SA 3SN6A 4DEYA 4DCVA 2FSHA 2Z83A 2QPAA 1KMHB 2RGBA 3NEJA 4YAUA 3TBKA 2IS4A 2BPOA 1VQ5B 3V00A 3UATA 1TX4B 4RJLA 1PZNA 3IIJA 3I3SR 1XEWY 3U3KA 2NMVA 4JIMA 3TLXA 2FEMA 1GFIA 2CJWA 4EPWA 5JECA 2RGCA 4BLSA 2BMWA 2C77A 1KI2A 3FHCB 5A0FA 3QFRA 2R6HA 4LOAA 4IVPA 3EWAA 1G18A 3REFA 4I1SA 3TQFA 4DSOA 4QRHA 3I5YA 1R0XA 4QHYA 2WM9B 4FINA 2C96A 221PA 1NN0A 3F8TA 1WB9A 4M9QA 1ZNWA 4B3CA 4HUQA 4HE5A 5KDLA 4D25A 5J47A 4D4MA 2CCJA 1GR1A 1R10A 5CITA 1F48A 3IO5A 2RC6A 1HA3A 2ZUCA 2EIXA 3J81k 4Q1EA 1HY3A 4DEXA 2V54A 1P60A 3EZ7A 1IM2A 1FNBA 1E96A 1SVKA 2ZRDA 3D7MA 4KITB 2XB2A 4YC7A 4ZIRB 5GJVC 1KI7A 5CB8A 5AJYA 4BZXA 1GZSA 1PLLA 4OI4A 5H70A 1AKEA 4M9ZA 2OCPA 4TMTA 3RS7A 1SXJA 1GO2A 3ZQJA 1I2MA 3EC2A 4EFLA 1ZC4A 4I99A 4FMCB 4LUCA 4RFSA 4D4KA 1Z6TA 1U98A 3RWOA 4AYWA 1IXRC 1E2LA 1UBGA 2FGJA 3T1TA 4MKFA 1P2VA 4JYBA 4URVR 4RZXA 1VQNB 4MGKR 1CJKC 1W5TA 2SHKA 1EWQA 4QG7A 4QBFA 4IW3B 1AS0A 4KV9A 2JLQA 4ZO4A 1J70A 1AS2A 1W4CA 2IS1A 1W44A 4IRUB 3FB4A 2Q9CA 3I5XA 3CKLA 1E2GA 1CR2A 1KI3A 2WMOB 3KKPA 4MGZR 2PIAA 3MD0A 2PJZA 4RZ3A 2VNKA 2GXAA 3MRSA 4HZUB 1NVVQ 2GJ8A 3WYAA 3CONA 1OIXA 1QDEA 1KSGA 4Q1BA 4NCJA 2D2FA 4BFSA 2JJ2D 5FTNA 1BMFA 4GFDA 4XJXA 1VCNA 3VR3A 5DI9A 2QENA 2I4IA 3X1DA 3PVSA 2OTLB 2HV8A 4LJAA 4ARZA 2C9OA 2CE2X 3GFPA 4PQRA 3BIFA 4F93B 2QGZA 4IKEA 1VKJA 1DELA 2UKDA 1KOFA 1IAQA 4PC3A 2BEJA 2OXCA 2KSQA 5P21A 5LD2C 2QORA 2CLCX 1GAWA 3WY9A 4KAXA 4W5WA 1WE2A 4PO8A 1P73A 4TQ9A 2AD5A 1IY0A 1FNMA 1E0KA 2GA8A 1VQOB 2RHDA 1TADA 3H2YA 3O47A 5KSPA 3KQHA 1PLKA 1H8HD 1CJUC 1JXMA 1KSHA 1KSJA 1VPLA 2B6HA 4GDFA 3KKOA 5JHHB 3KFVA 5IDVA 4HUTA 5H68A 2C03A 2X2FA 4JVLA 1NVXQ 3TH5A 5EXXA 4PSKA 5JWHA 4OHYA 1XXHB 3GLGB 3QE2A 2ZM5A 2Z5FA 1EK0A 3DL0A 1JAHA 5SZHB 1RRGA 1OXSC 2B5OA 2G9NA 2AKAB 1XMIA 2R62A 5JWRA 5TMPA 1JXOA 2QQ0A 3IBYA 3IPXA 5EQTA 1GRRA 3QPUA 5C18A 4TZ6A 1UADA 1OPXA 1Z6GA 3A37A 4JBXA 3GLGE 2BM1A 4HB0A 4GMDA 3V9PA 2JIZA 2PT7A 5FPKA 5JZVA 2HCBA 2AX4A 1RFLA 3DVLA 2P5SA 1BX0A 4EJSC 2OG2A 3LW7A 4YMSA 2QTFA 3U44A 4TMVA 2ZSEA 1HT1E 2Z6VA 1F2UB 4CEIB 2QY9A 3U44B 1FDRA 4ZDWA 4CRWB 3MGCA 1KK1A 4WW0A 2CMKA 2QA4B 4HLCA 3B13B 4JMPA 1G8YA 4NDZA 4RCZA 1YIJB 2NG1A 3SJCA 5EJEA 4PO1A 1IN8A 4PPNA 1F2TA 2FDCA 4LYJA 3E5HA 3TRFA 2IYVA 2WHXA 1Q22A 5HXBA 2BKUA 5CIQA 5CJ2A 3CUEF 2IK8A 1KY3A 4M0LA 2UZIR 5IT5A 2FF7A 1W0JA 4Q9KA 4GP6A 4DXAA 1L7VC 2QTLA 1IXSB 3KJHA 1AGRA 4HATA 2W2XA 2HXSA 4RKFA 1S0UA 1R5NA 3CNLA 1BYIA 3GLHB 4AKGA 2DETA 1B0UA 2WWWA 3RC3A 4DLYA 2WICA 2WJJA 4PQFA 1W0JD 4ZPXA 2ZYWX 1NKTA 3OF5A 2HT6A 4V0LA 4OI1A 3RAPR 3NVAA 1E1RA 1ZUHA 4PC7A 5IK2A 3AVTA 1J2JA 2CNDA 4MYTA 3U4QB 3GLHE 1ZM3A 3A4MA 1QGYA 1YZUA 3DMNA 1XTSA 1T8UA 3OZXA 4Z1MD 3TGPA 1T91A 2H1LA 4KU4A 1KDOA 3AVUA 2H7VA 2KB0A 1OYWA 2KWIA 2ODWA 4FD2A 2J41A 5C46F 3NG1A 3FKSD 2JEOA 1A2KC 3CBQA 4M1WA 2ZR0A 2PMDA 4TMWA 2MSEB 1XRJA 1UBEA 2BKEA 3ICQB 3WRYC 2JIZD 2JLSA 4N3NA 4A8JC 1KDPA 1OFTA 4B74A 1ZNYA 2IS2A 1DTSA 2QMEA 4Z54A 1K5DA 3AUXA 1E32A 4TLBA 4LHWA 3LXRA 1LF0A 2XZPA 2I1QA 3A1VA 3AV0B 3OAAA 2ZAOA 1CRPA 3MUFA 5KOYA 1H42A 1VQLB 1SVIA 1AQUA 4GPTA 3PQCA 1P9WA 1N0WA 4U5XA 3T35A 1Q7YD 2ZE8A 4C0JA 3SEAA 4RD0A 2VHCA 3CF0A 4ZDKA 5CB6A 1DPFA 1W5SA 2AD1A 4JKIA 4FWIB 1JEEA 1GNRA 3HYRA 4LCBA 2VP9A 3CCMB 2FPKA 2ZRPA 1YR7A 3I72A 5JEEA 1D8TA 2Y8EA 5HZKA 1G3UA 4AY2A 2O8FB 1EFRD 5JI2E 2REXB 1VHLA 5EP2A
chains in the Genus database with same CATH superfamily
2W6ID 3Q6QA 2I7XA 2XTMA 1NJFA 1O97C 3KBOA 3IE0A 2O1WA 1LPSA 4GWLA 5AKYA 3ZE0B 4EQ6A 2P3QA 3LQ1A 1NUTA 3ESZA 1YXMA 1VSVA 3O2NA 2NIPA 4NRDA 3ZNQA 4JNCA 2VHTA 2CYBA 5BUZA 3VA7A 4CL0A 5AQEA 5UKDA 3EX7C 4R1LA 1FXWA 1XELA 1L1QA 2I7VA 2AXPA 2UYQA 1GQSA 2Y3IA 4ALKA 1KTVA 1KJWA 2J9ZB 3UKDA 3PSAA 1SUSA 3EGXB 1IN5A 3ANTA 4EJSA 3H2JA 2J45A 2JIRA 3UB2A 4DA8A 1PDVA 4GU5A 1DGQA 4QUBA 5IRCD 2G1UA 4YDRA 4XLFA 1PTKA 2CNOA 4H6PA 1HDEA 5JHGB 2PZMA 2P67A 4WBXC 3KYJB 2JJQA 2YWEA 1TOAA 4F4CA 3KKLA 3N07A 1E7RA 1Y4ZA 5TPWB 1HG0A 2DT5A 2J46A 4FR2A 3AI1A 3HVUA 2A1TR 1KO1A 5FULA 1H2ZA 2W6OA 2HLNA 3ZG6A 4GZ5A 4A0GA 4DVGA 1WW2A 4YRFA 3JR7A 4BVHA 1NBWB 2IRWA 5A5FA 1DKOA 3R76A 3NMUF 1KIMA 5IJAA 1GUBA 1U5BA 3DE4X 3QMWA 4N6GA 5JLAA 2H92A 3N05A 4CEJA 4RLFA 1HNWB 3FMPB 1ZWLA 3NT2A 4AJ2A 1AHHA 1XNHA 1TC2A 2HA3A 4BNMA 3D3KA 4G65A 1DAGA 1LNZA 1UXIA 3OW2B 3HS3A 1TIPA 1H0RA 3PFHA 4PAMA 4BAZA 1DRVA 2AJBA 4MPDA 5HX7A 4JI3B 4PWZA 3W5UA 2ZANA 4MW1A 3AHIA 1V26A 1W0KD 2FZLA 3I09A 5D3KA 4ZGGA 2EKBA 3VDXA 4IXNA 3DQPA 4JJ6A 1D0VA 2AG6A 5L7WA 1LFDB 2VBSA 2JGFA 3A35A 3C3DA 2DERA 5M7EA 4WY2A 3FCOA 2G1AA 4U0JA 3TGLA 4NXNB 1LDGA 3AR6A 4KYVA 4WZ6A 3RSSA 3SXPA 1Z5WA 2PLAA 3KTOA 2H2FA 4RU1A 3BL6A 2CFOA 1FNDA 4C4ZA 5JNVA 4KK3A 1C5KA 1JHYA 1U7OA 2MWMA 4XDGA 4EL0A 5IDXA 2EQBA 3HR7A 1LNQA 2PMWB 4DIBA 3AZPA 3DV2A 1P4JA 3HLKA 3HN7A 3HU5A 3Q7RA 5DCLA 3FBTA 3PB3A 4N7RA 3UNXA 4CM3A 3HUDA 2MINB 1E1QA 2EWWA 2FRVA 1PX2A 3LP5A 4DG9A 1GPLA 1ZCAA 2XE4A 3JASB 3PGLA 4HAVA 3SQXA 4IF6A 4Q4CA 4YHHB 2OESA 1PTJA 3CUTA 2NTYC 3EGOA 2GN9A 3HCOA 4PZ9A 5L3QB 2GKGA 3CPSA 5J4VA 1AUPA 1VLYA 1KJNA 4D9CA 3SZRA 2P6NA 3AQ4A 1CZUA 4PCLA 1LB1B 2C0CA 5CVEA 4NG5A 5IAKA 2VJBA 1U7TA 4NZYA 1XZBA 4HNQA 3IJRA 3KR0A 4WKPA 4BP8A 3W3AA 3CZ9A 4R31A 4BCDA 4Y1EA 3AUJB 3NOQA 4NZ9A 3S4YA 2FWNA 3P2EA 4UEOA 3W8DA 3PLRA 3KP1A 2C4UA 1SCUB 1V37A 2CUTA 2N46A 3QVXA 4NJMB 4YECA 1P7YA 5EXPA 3KO8A 4V2IA 5CLIA 4AF7A 4N8SA 1KF0A 2A3NA 4EGCB 2HYIC 1KMHA 1IVNA 2RFLA 3HYTA 1AK9A 1B0ZA 2IP4A 2QNRA 4EX6A 1OCEA 5C8DA 4JYAB 4YAJA 1J39A 5FI0B 1N06A 4IUYA 4W8GA 3L1UA 3PZBA 4OBXA 2NX2A 1H0SA 1TEHA 4K05A 2VSFA 4C4PA 3RVKA 2O54A 1RYHA 4LX0A 4BNIA 4FDUA 4EG1A 2HR1A 3VU3A 4DNTB 1BW9A 1L3CA 4QXAA 5EYPA 1HQCA 4LY6A 4PCVA 2C9CA 2QQGA 1W4RA 3HPRA 1KP2A 4RXUA 3ZQKA 5CB4F 5F4OA 1Z5PA 4HQKA 1G6OA 1QLJA 3AXTA 4FHCA 2JAHA 4CF4A 4BKMA 1GFWA 1ZJ5A 2BTQA 5GVSA 4XORA 5F4MA 1VYVA 3JXEA 4FCVA 4ZTBA 1JFFB 5HUHA 2VYFA 1A7AA 2FFBA 2ZIZA 3L7KA 3V1TC 4AF6A 1GPYA 3SXUA 2OD7A 3LC7O 4I55A 3GI1A 4C03A 2P68A 4G24A 1E79D 4OQYA 4JLSA 4PIMA 3ZDBA 3HE3A 1EFCA 3CV3A 4C0HA 4Z4ZA 3C7TA 3I9JA 3OZRA 4YFVA 3RVPA 5KTNA 3LX5A 3VKHA 2TMKA 3CEHA 2FPRA 2JLAA 1EA5A 3HK2A 4G4JA 1YMUA 2P2DA 4OKIA 3ZUPA 4IUDS 3V6LA 3DTTA 4DNXA 4FN5A 3DVAB 3UMGA 1F17A 2ZP1A 1FFSA 3LCCA 3FBGA 4BMDA 1GKUB 4QWMA 2G40A 3DVRX 3RS3A 1Z4LA 3KTDA 3PEEA 5FEMA 1ULHA 5LDHA 4QTZA 4D8UA 3LWBA 1EBBA 4EG3A 2QTHA 3DGEC 5C1DA 4LIPD 3HXQA 1CKEA 1XZLA 4JWKA 1JQLB 3KX2A 4HZUA 2O8BA 2ZYRA 3CUWA 4HP8A 4ZICA 3TF5A 2HA6A 4I6GA 3Q1KA 5LNK1 3KFLA 5C51B 1H05A 4ZAFA 2QGGA 2R3SA 3V8RA 3A0RB 3H9GA 4UTVA 4JXKA 1OA1A 5DYYA 5LIRA 2PSJA 2FWAA 1M1UA 3GMIA 3TQCA 3ERCA 3RS9A 3I45A 4QNMA 1YJ9B 1E20A 1K6MA 3UT0A 3OOEA 5G1OA 3AL2A 4EUHA 1GUDA 1X15A 4F96A 3STVA 5AO9A 2CLMB 3QF7A 1H8ED 4Z4IA 1C8BA 4YGYA 2I3DA 4UZSA 1AKQA 5CAEB 1KZGB 5EA2A 2JEZA 3NCTA 3KOUA 4K6GA 2Z5LA 2XNKA 4K28A 5G41A 3DVSX 3CJRA 3IA7A 1L4GA 1MRNA 1SOVA 2ZZGA 5HIIA 4MPJA 1JIIA 1CQJB 2PEZA 4D8TA 1XTUA 1Z7YA 1STOA 2BFFB 3C5EA 4LY9A 1VFNA 4H77A 3NAMA 4II7A 5J2TF 1UZMA 1ZKMA 2EP7A 2CDNA 2MJLA 1P1FA 2WD8A 2X1HA 4GOLD 3N9IA 2EFGA 4IVQA 5C5IA 5TE9A 2EARA 2VA9A 4Q5IA 3AZOA 3I1FA 3ETGA 1I9GA 4US2R 3THWB 2PA0A 1UMBA 2JA1A 4YXWD 1S2NA 5HKAA 4Q24A 1DJMA 3N58A 3MT8A 2OOSA 4WWHA 2OOKA 4NZOA 2QL6A 4IP0A 4WOCA 4BO9A 2Q07A 1APBA 1GUAA 4QEKA 3V7YA 1E3SA 1AD2A 1ZICA 4EA6A 1YJBA 1JU9A 4XZ3A 4BFVA 3DFIA 1UPCA 2VKTA 2XUFA 2D4AA 3PGMA 4JEIA 5BSRA 1HE8B 3HJCA 3L0IB 3UWOA 3G2LA 1DBRA 4RGQA 2WYOA 4MQFB 4XOUA 3L0OA 1K7XB 1GN8A 1SCIA 3BTUA 2FQ1A 1ISFA 2ZYDA 2VATA 2JHCA 1YFJA 1SRQA 1YMQA 5KYWB 1Z4PX 3NVDA 1XG5A 1H0KA 3BA1A 4R8LA 4WFJA 2ZAYA 3TVYA 3DMHA 2PH7A 1M8JA 1YJQA 1EVZA 3P32A 1JEYB 2DQZA 2SKEA 4MDEA 1JA9A 2I0FA 3C4JA 4OHWA 4EY5A 1FVHA 2YHIA 1PEKE 2R68A 3FDIA 5JAUA 2FPMA 1ICEA 5GONA 4X1YA 1W85A 5EY5B 2AWOA 2PUVA 3V34A 2RGGA 1KEKA 1XPOA 3S2EA 1NVKA 1CQIA 1E77A 2ZSJA 4QATA 3W3ZB 3Q8XB 5EP3A 2HEIA 3UIEA 2YV1A 1TUGA 1ESZA 2ST1A 3W78A 3O2QB 5KEIA 5IU6A 2CXXA 4C4RA 1FNSA 3WIDA 4B83A 1PJBA 3Q5EA 2JLWA 4JJGA 5D7NA 3Q7EA 5HA5A 4DGQA 2TRSB 4DNQA 3LQKA 3OM9A 1Z26A 4C88A 2ZITA 3TIGA 2CSUA 2B20A 2I54A 4ZAYA 5G0SA 4YCMA 1W96A 5DE3A 5DHPA 1DIBA 1IHYA 1P5HA 3SOPA 1FYFA 2ASEA 4IEIA 2DFDA 3DDYA 1WMFA 2G0AA 4ESVA 1WDKA 3P2OA 4C3UA 2VSQA 3C2QA 1UWLA 4S2EA 1IBCA 4OLFA 5M29A 5F64A 2P2YA 2JFFA 4HDKB 1VMAA 3P8ZA 3REQB 5KBYA 2ZVDA 4WBNB 3B3JA 4N39A 4II2A 3T7KA 1VF7A 3CUKA 2H9YA 1TA0A 1C3VA 1Q21A 2JAQA 2AQIA 1XMVA 1L2TA 5JMOA 5JMWA 1B7GO 1KL7A 4E11A 1QGUA 4B9AA 5FCDA 3SF0A 3K9CA 4DR4B 4EWLA 3L2OB 4X1YB 1QRRA 2H9AA 4KLZA 5JR3A 3MS4A 3HSYA 2G36A 1R8XA 1GQQA 4JUCA 3PFCA 3LTEA 4B6JA 1PFKA 3QBEA 1UF9A 1C0IA 3V1YA 2B1GA 4HWPA 4ALJA 5C4MA 2FW1A 5ALOA 1R5OA 2B8NA 5K3FA 4DR6B 4OMDA 4F4JA 2O2GA 2RH9B 4K2AA 4GM1A 1WBDA 3MB5A 1QBKC 3ODGA 2QX8A 2CDAA 4EX7A 5IKPA 1A4RA 1XZAA 3AFGA 2DGDA 4Z3OA 4M53A 1X13A 1Y7IA 2JKYA 3D4PA 4UMFA 5BNWA 4OPVA 3PNPA 4YAKA 1M1XB 1LA2A 1P4HA 3NOVA 4B80A 2AC4A 4O3FA 2O59A 2JHFA 1VPDA 2G06A 1DLIA 3UGJA 4BZZA 1KO4A 2YWCA 3O9MA 2YJ5A 4HEJA 4TWAA 1WXDA 5JYDA 3GLSA 3W5VA 4REOA 4YI5A 3UJBA 3W7VA 4AFNA 5L51A 4RKEA 1DC5A 3CW8X 3SIXA 2ALJA 3QNUA 3C15C 2KI5A 3ORSA 1AKRA 2WJ3A 3WZ2A 1G3IA 2C0PA 1CZKA 2XYGA 3KSUA 3FTDA 1Z25A 4KYIB 4DBZA 2ODNA 2FWPA 3JTMA 5AJTA 2D4HA 3ROGA 1N08A 3UAOA 4HJXA 1Z4QA 3HNOA 5CB4B 2ARKA 3OLQA 5FWXA 3W9YA 1LNSA 2CXNA 3T7RA 5A5DA 2A30A 1JHOA 1T10A 3ZZMA 2IA5A 1YJXA 1I3NA 1ISIA 1EUYA 1JLLB 4M0KA 5FLXA 3Q8MA 1Z36A 2AJDA 1CIJA 2ODAA 4EQ6B 3L7OA 1N5OX 1KJZA 4KAJA 4D3YA 1GXSA 2DWQA 3NC0C 2ZSAA 1RJ9B 3SYRA 4YCDA 3FNRA 5A3JA 1G66A 3HCAA 4Z0PA 1TMYA 3A8KA 3QVUA 1D2RA 1W36C 1U2SA 2VTDA 3IXQA 4LXXA 3C3BA 4GXQA 3V4SA 1DKQA 4PNEA 3NDBB 1WPQA 4ZQFA 3RFCA 2YKGA 1EM8A 4RULA 4X07A 4J2TA 3I1YA 1JDZA 3OP1A 1WRBA 4HDMB 3G0BA 3LPCA 3M33A 4TTSA 5K45A 2ORWA 1PQ4A 3OY2A 4LHEA 1YRLA 1Z0ZA 1VLJA 4OA8A 2X19A 3PXEA 4A2PA 1H1LA 2PKRA 2Z56A 1G17A 4EHJA 4YUXA 5EOVA 5B57C 4RHEA 2HYDA 1EEHA 2RARA 2XQFA 4FE7A 4UHCA 5DKFA 5EWLB 1L4YA 2OLEA 1LLQA 4YJ2F 2DKOA 4Z3KA 5BN3B 1U0NA 3D0RA 5G3YA 5J5CA 3H1EA 2QRNA 3JR3A 3GJ5A 4IF4A 2ZKLA 2FKNA 1DV2A 2GHQA 3FCUB 4AJLA 2G77B 2ZTUA 1XMOB 4XQFA 1MB4A 4YRBA 3A3BA 4NX2A 1CF9A 4JOCA 2H57A 3MN1A 3BJMA 2RE8A 3O2SB 4W9NA 2JL1A 4E07A 3F47A 4ZVLA 5I7SA 721PA 3IT0A 2FPUA 1EGAA 3AR8A 4QYWA 3U1BA 2X0FA 1I4OA 1IQRA 1ITZA 1SVLA 1ZHFA 2GR9A 3NBKA 4KXXA 4PTYA 3T3NA 2BGGA 2ZZFA 2WQ7A 4JBNA 1IG0A 2A8YA 3KT0A 4Q7EA 5JLJA 3ACDA 2XDAA 4MI6A 5TPZA 1USIA 8ABPA 4RPHA 4QJ5A 5T4FA 4QPZA 3FDZB 2JJ8A 5CVJA 4OPOA 3ASYA 1VQKB 1U7DA 2QI9F 4OQDA 1EGVB 2IUSA 2Q0QA 4ZAVA 4LDNA 4D9JA 1A69A 3RG8A 4A03A 2P6OA 3SNKA 1TZ2A 1UEXC 3A1EA 3D3NA 3H18A 3IALA 3G8DA 3L93A 2GAOA 4D6XA 5MDHA 1KZHA 1E66A 2J3EA 1T26A 2O3TA 1N2XA 4I8DA 4LJ4A 1YNOA 3UM9A 3LK7A 4KLCA 2BFEA 3FUXA 1YR9A 1U63A 2OZKA 3TTTA 3C45A 3ZLBA 2A7XA 1IOVA 3AOEA 1I0LA 4MQBA 4P3PA 3ZIAA 5JZSA 5B7NA 4HCJA 2PMKA 3PCRB 3Q0IA 1WP6A 3VR6A 4D6PA 1WUTA 3ESYA 5AQ1A 5AKJA 4NBUA 3RNOA 3VZBA 4GBJA 1NBHA 3AEUB 2X76A 1V16A 1ZH0A 3D0OA 3NJ4A 5B1IA 1UOPA 2BHLA 3C8MA 4GYJA 2J5BA 2NO5A 4IQ4A 1CVLA 3AR4A 4C6TB 6ADHA 2XGGA 2I4TA 4ZCMA 2AB0A 1UBOS 5U9CA 1VHWA 5JCJA 1C3OB 2BFDB 3O8QA 1E1DA 2GDZA 3FSGA 1ZLXA 4RCYA 2FX2A 4I66A 3TW6A 4AS2A 4BQIA 4NNOA 3ADDA 2A5YB 1L5HB 4OU5A 1XRSB 4OQEA 2HSEA 3OQVA 4OOVA 2QE7D 3AB8A 3PXUA 2QW0X 4NULA 3T3PB 2X0IA 2ZJZA 4Q3NA 4FB4A 4Z4EA 3WS7A 3M49A 4JOSA 5L3QA 4P9NA 2XTNA 3WKEA 1UJBA 3H5IA 5GZ6A 5ARCA 3WQZA 4QBHA 3ZWAA 3IS3A 2E1PA 2MT9A 2Y6UA 3WGNA 2MSKA 1EBFA 1E8NA 2IIQA 5A6VA 4YP0A 3BXOA 4JLOA 1J0XO 1GCGA 3PNVA 1OXBB 4B4VA 2FOLA 4D02A 2O2XA 3VH1A 5DEOA 3Q9NA 4DBLC 4MINA 1RXWA 4ARUA 1D2NA 2ZRBA 1ZIYA 3C6XA 3MTBA 4FXPA 5GTDA 5I9IA 2QBYB 1KXZA 1WB6A 2PPLA 3NV9A 3B89A 3WMWA 3L6BA 1Q7GA 2R4UA 3FOCA 5MN5A 2H4JA 5IT9A 1S3GA 2FQWA 4EFKA 4XN0A 1K6XA 1HDYA 4KO4S 2VTBA 1SFRA 4HUQB 2CJYA 1U1DA 7MHTA 3CUYA 5GPBA 3WZLA 1AF7A 5K6RA 2ZSUA 3KUCA 1RADA 2VAWA 3I4LA 5D1NA 2GFQA 4BLTA 4CM4B 3R6JA 1CJBA 3KWFA 5AD1A 2LP4Y 4L15A 1FQJA 4G67A 1JR6A 3W1VA 3WL8A 2QSYA 1AKWA 2HGZA 3BX1A 3HDHA 5EJIA 4F6LA 1YDGA 1RWMA 4KREA 3WYFA 3SEQA 2O7RA 3LIIA 3RHFA 3OFND 2XZDA 4XKJA 4XMYA 4N48A 2LGJA 3UG6A 1WKCA 1LJ8A 2VT3A 1ENZA 3JYOA 3VR5H 1R0BA 1U28A 3GA7A 4FYMA 4N7JA 5E6SB 5K3FB 3SBOA 4WN9A 1HLFA 4DMFA 1NGSA 2XCLA 5TMBA 3LRPA 5JISA 1I24A 2DPGA 2XMBA 3ROEA 2Q5JA 2WZNA 4G85A 2ZRQA 1DFHA 4K9NA 2C54A 3ICVA 3S5JA 3WB9A 4DCGA 2O52A 5DPMA 4CEHA 2H5IA 1NUSA 1EE1A 4GP9A 4TQAA 4FS3A 3V4PB 3TW4A 1ZCFA 3ZLVA 1YITB 2GYYA 3UXYA 2GCIA 2XHZA 2H2GA 4KKUA 1Y4UA 3IBGA 1N92A 3G8BA 3AVVA 2AXEA 4P5EA 4P25A 1Q0UA 3ET5A 3TIXB 4EY6A 5I7UA 5J4LA 3CPXA 1EVEA 1Y5MA 2HKIA 4ZO6A 2MMGA 4QASA 3L1KA 2CL7X 3H05A 2X7JA 4XKWA 3H0CA 3FZEA 1DKRA 1Z5NA 3DHWC 4OLJA 1T2NA 4KXLA 3ICCA 3RYHA 1U2QA 3R9IA 2Z6AA 4S24A 3GXOA 3PUIA 3TD6A 4Q0MA 5K1ZA 4Q37A 2K4MA 5CT8A 1W75A 1E9EA 1H66A 2F8MA 2VJMA 1U8ZA 1DJQA 2VUHB 4M99A 3ESRA 4HI0E 4HS9A 1JJVA 1K8RA 1XQ9A 4RMGA 4F1KA 1QFYA 4B2PA 3O4RA 5F77A 5FWAA 4B3SB 1SBCA 4Y6GB 1LFAA 2XF8A 4GE0A 3GRZA 1FZQA 3OETA 2I03A 3AKYA 3EFHA 1VQ4B 4OUDA 4X5OA 3WYDA 3EXFB 4KMMA 4ZOEA 2Z57A 4Q00A 4R9SA 3DB2A 4DABA 2LCFA 1QE5A 2PGIA 5EL0A 5K8LA 1SNYA 5J2TA 2WG0A 5C34B 4I6JA 3ZJUA 1DI0A 1FX0B 3GUVA 3SJUA 3VJLA 3R4VA 4BNWA 1PN3A 3HKBA 2VJIA 1MVLA 2CD7A 1G5TA 3G0OA 2A5GA 4ZD6A 5CDFA 2ZYTX 3LS2A 3MEQA 2C99A 4JI5B 4CF6A 3PITA 1UJNA 1OFUX 1OX6A 1SKQA 4UZUA 1QR6A 4M86A 1EX9A 4UUMA 4RETA 3BFJA 1EVQA 1JFSA 2IZ1A 5KYXA 2FK7A 4AY6A 2V65A 3SLKA 3ANNA 2WSMA 1DQPA 3PQ2A 1X1RA 5CIWA 3TTXA 4YJDA 1EH5A 1ISMA 1TQDA 4HQRA 2EKLA 4DAEA 2E89A 3QEOA 3FROA 3AESB 3MYYA 1QC5A 2G08A 1KIFA 2YIJA 3I4FA 3WP0A 4L9SA 2QA5A 4N0EA 3GMSA 4A1FA 4DIDA 1ZM4A 4YXFA 4CCAA 5A5GA 4KWTA 1VMEA 1D6MA 2IITA 4QNNA 4RH3A 3DS8A 4DIUA 4C7BA 2Q0HA 4NMMA 3ETEA 2XUJA 2CUNA 2RCNA 3C4QA 5A9TA 2FJUA 1GA1A 2OBLA 4IYRA 4X1IA 5TS2A 1QIJA 2OQIA 4JYCA 4XWOA 3TR0A 2F00A 4NYIR 3HDGA 5H02A 5JASA 3T7TA 3GEDA 4JQOA 9LDBA 3F3YA 1FBNA 3SIPA 4MYSA 2C31A 3WQHA 3SVLA 1AMOA 3W5CA 4KQXA 3UWDA 1KQGA 1CUWA 3L8YA 3AHDA 4RHUA 1Z0DA 4E5DA 2XWJI 5CNIA 3MWKA 3OFKA 4HDSB 4YWJA 1EFHA 2XRFA 3ZHRA 1SCQA 4DY4A 4Q66C 1TMGE 2FZKA 2IW3A 3MD9A 2WHPA 3BSWA 4V0NA 3RS2A 3HGMA 1PT6A 3CUSA 4LSWA 1VC2A 4TYNA 5DX1A 4HF7A 3P9ZA 4MJXA 1PGNA 4N65A 5AR1A 2IV2X 5JH7F 3F0TA 1JNYA 1JTEA 2Y1FA 4I0WB 1W46A 4JBLA 4PGAA 5F1OA 4CUZA 4Y2QA 3UK0A 5AVKA 3HNPA 1FYEA 3TUIC 4BNDA 2WF5A 4PSAA 4Y6OA 2V55B 3T7DA 2EG5A 1KWKA 2I8CA 3PUVA 1S8FA 2SECE 1X7ZA 1ZUWA 2GCOA 4HDRB 5BW6B 2MSLA 3UMJA 4ASUD 1MUUA 3DWIA 1RZ3A 4XWKA 3CP2A 1GSOA 5FH9A 4J7XA 1E9FA 3KOMA 3T5BA 3EW7A 2VAPA 2VO1A 1L5MA 3A9RA 4IVRA 3RIMA 2DHDA 5EWMB 4F4FA 5BSKA 5LZ7A 2ZZEA 4I1VA 2P1DA 2JGNA 6PFKA 4CL2A 4ODIA 1TA9A 3OCCA 2OFOA 3IMFA 1Z33A 4NP6A 1B8NA 1N32B 5DSZA 3VFDA 2W6ZA 2BFAA 3TEJA 4YELA 4Z7JA 1P9LA 3BGWA 3SJBA 4BQNA 5TMEA 3R4CA 3OTQA 4BQRA 4G09A 2Q21A 3F4BA 4F1WA 1DZIA 4FXUA 1D1QA 1WUHS 1XAJA 2FWMX 3IOCA 5SZJA 3C98A 2HWWA 5E6UA 3VBEA 1WIWA 4PZZA 1EZ4A 4IXDA 3T7SA 3HPQA 4CDNA 4CR7A 5KNCA 4JI2B 3COYA 2D0DA 2ZUEA 2ZRAA 2RB4A 2ZI9A 5MF6A 4WN3A 2PKXA 4DYVA 3M2TA 2I33A 3MMPA 2PX5A 1ENPA 2VF8A 3U31A 1IVYA 3VX3A 1QP0A 2XQGA 3I37X 5AYVA 4IIFA 2J48A 1B8PA 4MUHA 2LXNA 4TRJA 4A36A 5CLLA 4BLUA 3PKZA 2V7QA 1B93A 1I2AA 1WKVA 1GZUA 1PJRA 3G0CA 4Q1DA 1K5HA 3H97A 3P0JA 3TZHA 4MO9A 3WHIA 2QR2A 2WJHA 3UWKA 1IM8A 1PBTA 5HKLA 3VTFA 3PQ6A 3NUGA 2MIIA 4OQZA 2BGIA 2NSYA 4X0CA 3K05A 4MPTA 4NU0A 4DR7B 1WOPA 4PQYA 3C41J 1WOSA 4PHTA 3WYEA 4DZZA 4BNGA 1MR3F 4XARA 5K0BA 4IJUA 3A05A 1JGTA 2HQRA 2I8LA 1V1RB 1W59A 3BPSA 1V3TA 3D6UA 3L0PA 4CLHA 5KYYA 1BIFA 1VXRA 3FMFA 4IIDA 4R5MA 3WRYA 5KWIA 3AEXA 2OA0A 2H5EA 4ITVA 1TKAA 4BN4A 2ZWVA 3NHYA 2V9ZA 1BXGA 2JCGA 3GUUA 3JQ8A 4ES6A 3P27A 1LLCA 1EK5A 1KKUA 4LZPA 4Q3OA 5FOQA 2BEUB 4W5JA 3GP8A 5JCXA 1XD9A 1J5XA 1H4TA 1RM5A 3O91A 3MSXA 4FE4A 4G84A 4V0OA 4NHOA 1S2DA 2H8GA 3IQIX 4QQFA 3SE7A 1LUAA 2Y2VA 2VYQA 4CI0B 4BFTA 3TW8B 3DE3X 1DC7A 1O95C 3U4HA 1FW6A 2B7BA 2IHTA 1K9MD 3WLKX 4QLAA 3U4MA 3QMVA 4DQUA 2IP2A 1RWVA 2PVSA 4W7IA 2B92A 4CIXA 5BV7A 7ABPA 3IODA 2JZOA 3SEFA 3DWGA 5CHYA 4ARIA 2I8AA 2OV3A 3HA7A 2YHIB 3EG9B 1P0PA 2C8JA 1YU9A 4X1OA 1F8YA 1HDRA 2X3FA 3EDRA 2H4YA 4YIHA 2PSHA 5AW3A 3U19A 1PRYA 5KI6A 1JFRA 1G3RA 2XCOA 4Y2UA 1LBTA 4HEHA 2YOGA 2XT0A 4BNVA 2H52A 2O8DB 1XCOA 2WJIA 4RK0A 4HDKA 4IJ6A 3D2AA 2ATEA 1H9CA 3E2PA 2PX4A 5CPFA 3C87A 4MLDA 4A15A 3NEAA 3KSRA 4BBZA 4MVJH 1C3JA 1U8CB 5B3AA 1G8PA 2GJ9A 2NYAA 4XVUA 1HEYA 2WUWE 3HKEA 3QIAA 2PJUA 3BXFA 3D2LA 5JV5A 2ZAIA 2LCIA 2C5BA 2YFQA 4ENTA 2Q3EA 1HGXA 4KJZA 2ZE7A 1J0BA 2HWKA 2JFXA 3DTVA 5JIBA 4RDLA 4NCKA 4XGNA 1TJ3A 4WY5A 3L40A 1VI6A 4RSRA 1BTOA 2GJAA 3EF1A 3THSA 3TVTA 1R0ZA 1HI9A 3DOCA 2W2TA 4RSGA 1VRVA 3QFSA 5C8YB 1R5BA 1TJNA 1YZGA 3C8UA 3FGNA 2QZSA 3HKCB 1C7JA 4YX9A 4M1KA 4MIOA 4UD6A 3DGFC 1ND5A 4WKBA 2RMKA 4LPSA 4R2IA 5T8KC 3U7FB 1QU2A 3QHQA 4KSCA 2REQB 1QRTA 3CF4A 4WIAA 1ECBA 4YDSA 2IXDA 2PT9A 4L3OA 5KWEA 2D54A 2WSSD 3FPFA 2QNIA 4OXRA 3V2IA 4Q7QA 4ZK6A 4R71A 2ZQYA 3BFVA 5GM2A 3PR1A 2PKYX 4UXJA 2BJWA 1E92A 7MDHA 1YBMA 2HLHA 4CMHA 1VPEA 4HRAA 2YV5A 2WUVA 4ROTA 4D4LA 3NDJA 4LOLA 3GUHA 1XTRA 4E2ZA 4WOJA 1DT5A 3BBLA 3TNDA 2P9GA 1EYZA 4MAMA 5C8VA 3AERB 5A3QA 5K99A 3LDHA 2BH9A 3A2NA 4MHOA 5EHQA 2JKVA 4YFYA 1G20E 1R18A 3SM9A 1WOOA 1UBFA 4RE6A 1HYGA 4YO7A 4MV0A 3U2QA 3IRVA 3PC7A 3GJ0A 2HSJA 5HKOA 1C8VB 2XODA 2IUFA 3GT7A 1SQFA 3C8DA 3IPRA 4G2NA 3S2YA 1FOEB 1OKKD 2HF2A 3EGEA 4I19A 4G0WA 1I14A 2DWUA 4MYCA 3GELA 2C1ZA 4YRLA 4BMXA 4ZTZB 5CLJA 2FPOA 3WGKA 5TQ2A 3PWTA 2QX6A 4Y9DA 5BT8A 1WEKA 2PL3A 1K88A 2ZDHA 1XGKA 2ZUTA 4BAGA 1I4WA 3FFXA 1WR8A 4NKRA 3N0WA 1W1WA 4QOGA 4MVJD 3VTKA 4ETNA 4IHAA 4D9NA 5BN4A 2NP7A 3PA1A 1GGKA 2Q2OA 5A4FS 2R47A 4AZ0B 1MX5A 2ZVJA 4PQEA 3VR2A 2V9PA 2Q2QA 3I6ZA 3LFTA 4V0MA 1P7WA 1REQA 2AC2A 3RLIA 2YXDA 3IMGA 4NH4A 4H2DA 2R65A 3FFBA 3D1LA 2ERCA 4BPBA 1K08A 3IAAA 3SK0A 4EVQA 1SUAA 1EHYA 3CESA 2XY4A 2X5JO 4L0CA 4OOSA 1U7UA 1YRQA 5F4BA 2DKFA 5J4YA 3GFSA 3ZU5A 1BW9B 4NK4A 2Z8ZA 4IJWA 1E1MA 1NHGA 1JXQA 1P2TA 2WNHA 4ACAA 3DDSA 3OC6A 1US8B 4MV7A 2BWJA 4BX9A 5KJFA 3HDYA 3SM3A 4BNYA 3P0EA 4GX2A 4BRZA 2A9OA 3HCPA 3PC8A 2OC4A 5A7HA 2FZ5A 1F2UA 4OP7A 3PU6A 4EF6A 4FP9A 3NAZA 2CT8A 1PD0A 3JYNA 1II8B 5FV7A 3S2UA 1XRPA 4WINA 2HPHA 4ZVQA 1KARA 1QYXA 2WSIA 3BZWA 3KPVA 4A2QA 3I0ZA 3NTOA 5KQSA 3E7PA 4F1JA 1UD3A 1D7OA 4IR7A 3LQQA 3G59A 2PLWA 2B2XA 4I4NA 3UCEA 3TL6A 3WHPA 1MFPA 3FYDA 4PO9A 4RD4A 2YMQA 3NS7A 5TIIA 2BSXA 1A2BA 4WV3A 4E2FA 3NWPA 1JS1X 4P2GA 4TRNA 1U0TA 1CQZA 2ZIFA 3RS8A 1EXMA 4LYAA 4KDEA 1T3HA 4Y9RA 3FRIA 5CD9A 3R6WA 4QGAA 1N2ZA 3LM8A 5SY9A 1BU5A 3VDQA 3EBPA 1FXUA 3G9UA 4CN8A 4QUZA 1VHQA 3T0GA 4CR6A 2GBGA 4H16A 4ERXA 3IQDB 4FYHA 3RJTA 4OJYA 4CT5A 3RTCA 1G4UR 3JVEA 4IDOA 1SUCA 2Q6OA 2GK3A 4UNSA 4Q34A 2CV1A 2OYSA 3FDZA 3IDOA 3GDGA 4LTNA 4ZCIA 3BL5A 4QXRA 5BV1A 1VCIA 1D6SA 3FSGD 4AJHA 4V1CB 1WM1A 4G3XA 4ND6A 4GSKA 2OM2A 3CZAA 4QDZA 1DXYA 3RODA 3U9LA 4MV4A 1OYVA 2I6FA 2XWQA 4JZYA 2XVYA 4CKBB 3JAMA 3PIDA 2XQIA 3N8NA 4G1CA 4H7EA 1E60A 4B47A 3MGKA 3PE3A 3BXGA 1FUKA 4XSGA 1W36D 4JDUA 3L7LA 4YWHA 4G2TA 2BHSA 3S44A 3VV3A 3C48A 4C4AA 3F7TA 5KMGA 2BFPA 4KWHA 3IVCA 1GTVA 3FD8A 3H7IA 2BCGY 4ZT7A 2ZB3A 1Q82D 1ZZGA 2CFSA 1GTJ1 5HF8A 2NVBA 3DE6X 1YL6A 1KETA 4K5QA 2FEWB 5DHRA 2Z8XA 1BVUA 1CHDA 5DCUA 2W6MA 2PE5A 1C7RA 2I7CA 2X4GA 1L5QA 4DM3A 1MO5A 3LHDA 1JHMA 1VJRA 4R6WA 4B43A 1V8OA 3B2EA 1PGJA 4KGXA 2Q3DA 4BEBA 4EJFA 3G9XA 4LYFA 1WO8A 4NPHA 3WLMA 1Q2XA 2V5UA 3PL1A 3SYNA 1GLNA 3N8GA 5ITZA 4YCCA 2B78A 4K9DA 3S29A 2BMFA 2A1UA 2WJWA 3A8TA 5DLDA 4HX9A 2QD3A 3V7WA 3VUEA 4TTTS 2YNMC 3TZBA 4W6QA 1M8PA 3PXAA 4D3ZA 2VBVA 3DOJA 1XD2B 4EFLA 3NE5B 1T4CA 4ZGWA 5IYZA 3NT5A 4EEKA 1HL3A 1DO2A 3WQQA 4E46A 1N8RD 3AP3A 3H1FA 4PZDA 1X0XA 1NF8A 1I3LA 3N0VA 1A27A 4BJ5A 4CLDA 3E23A 2F6RA 4J0HA