4NBSA

The structure of aif2gamma subunit h20f from archaeon sulfolobus solfataricus complexed with gdpcp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDFGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
publication title The structure of aIF2gamma subunit H20F from archaeon Sulfolobus solfataricus complexed with GDPCP
rcsb
source organism Sulfolobus solfataricus
total genus 106
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4nbsA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4nbsA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nbsA01
3W3AA 5JEEA 4KFTA 1ZIOA 2ZPTX 3FFBA 2FSFA 1OKKD 1ZNYA 3DVLA 2GVZC 1I4TD 3Q7QA 4BFUA 3U3RA 2EIXA 2FDCA 4P33A 1E2IA 2OO7A 4AIIA 1M1YE 1GJRA 1KZGB 4MGYR 2BMEA 1BJKA 1G4AE 1VCMA 1W44A 2GETA 3QUSA 4V0MA 3PV0A 4PX9A 5UKDA 3HYTA 1RYFA 3CCVB 1IJEA 3CBQA 1L4YA 4U02A 3X1XA 2ZJAA 2WWIA 2VSXA 4NYJR 1J70A 5G40A 1N0WA 2OCAA 4Z1MA 2QZ4A 3HU2A 3I5YA 3P32A 4P4UA 5SZHB 1A82A 3EARA 3QF4A 4PR0A 3VNVA 3CR8A 2Z5FA 2OILA 3RRMA 1XP8A 1P61B 1I7PA 1KIMA 4B34A 5HZKA 4PZZA 2ZSDA 5J4LA 3LQRA 1AZSC 5J4YA 2B5OA 1Z6TA 4TMXA 4QXAA 1NLZA 1XPOA 4P6VF 1P75A 3PUWA 4PPNA 1DPFA 1F2TB 5G3YA 1W87A 2JAQA 1XMSA 3ADCA 4M53A 2ZROA 1Z29A 1CNEA 1D2NA 5JWOA 4EUNA 1OF1A 2VYFA 4ABYA 4KVAA 3I1FA 3QXHA 3GEEA 1FPMA 4HZIA 3KKOA 1ESNA 5FBLB 2ANBA 4D0NA 2QDXA 1KMQA 3N70A 3RS7A 4EAQA 5JECA 5JMTA 1T0JB 1F5NA 2X3UA 3LQQA 3QXCA 4DC9A 3IQXA 4FCVA 2XXAB 5IK2D 2QE7D 2D7CA 2OK8A 2K5UA 3BBPA 2I1QA 3SQWA 1XFAA 4ACBA 2B6HA 3PUZA 2NO0A 3TH5A 4B32A 4DLVA 1M1KD 4QNRA 3H2YA 3WBJA 4OYHA 1Z0KA 4NCJA 3CCSB 4MDEA 2AFHE 2OFXA 5HPYB 5CYPA 4Q4JB 3LO8A 2BDTA 2KBEA 3CZQA 1G291 2C04A 2F43B 3THOA 3GFOA 4BFXA 1VQ7B 3ICEA 1GZSA 2VLIA 1ZUHA 3LDAA 5AJWA 1W2BB 1DELA 1T5LA 5KSYA 3NHAA 1VYUA 1YIJB 2LKDA 2PEYA 1NLYA 1NJID 2QBYA 1II8B 1SXJE 3C16C 1OXXK 3NBXX 4RFVA 4W5HA 2IYQA 4GNKA 1T3SA 1CRQA 2W83A 3C5HA 5DYGA 2QM8A 3L0SA 2O0JA 2J87A 4S35A 1RFLA 3GFPA 4LJ5A 4OHYA 2RH5A 4LYAA 4WAUA 1KOFA 2GK7A 4DZZA 3SJAA 2BSAA 4M1KA 2V1XA 3RS5A 3T1OA 3W8RA 3OZUA 2ODWA 1J9ZA 3A1WA 4QOSA 3QVUA 3U61B 3T34A 4Q48A 5FUVA 3I8XA 1G6OA 2YZ2A 3DEFA 5D3MB 1KQSB 1FNNA 2FEOA 4RVCA 4E03A 1KY2A 4JLNA 1XEXB 4MKIA 4TN1A 1N5LA 2FPKA 1T91A 1Q44A 4KXFB 2VHQA 2CJWB 4OI0A 2ORVA 4B4DA 4EPWA 4Q02A 4HLCA 1FMJA 3TK1A 1K73D 3U4QA 4MGZR 3SYNA 3ZBUA 3BD9A 4ZDJA 3W2FA 4NCIA 2ZI7A 1XZQA 5B30A 4Q9JA 3N5CA 2IYWA 4O2LA 1CKEA 4XWKA 3UKDA 4C4PA 1AA9A 1Q12A 1SVLA 2HLDA 3VQTA 2AFIE 4YAUA 4IVQA 4KU4A 1UADA 3X1ZA 3U7EB 5JHHB 2HJGA 3MGCA 4HLDA 1MO5A 2WWHA 5DLQC 1I4LD 3K0CC 2P2LA 3W5VA 1GP2A 2QA5A 3NBFA 4K1XA 2BBTA 5DI3A 3CO5A 5TVKA 1VQ9B 2RB4A 2VIIA 1G5TA 1ZBDA 1GNRA 1Z6YA 1U0LA 4EJSB 1XD2B 4PO1A 2OAQ1 3O8CA 4V0LA 2BC9A 1FNDA 2RKOA 2DB3A 2FZLA 2J0VA 4CZ2A 4BPBA 2BIFA 2HXSA 1YRBA 3GLGA 2ZR9A 2AWNA 3DMDA 4XSHA 2KE5A 4Q7KA 1ZJ6A 2RGCA 1OXUA 3OEEA 4KO8A 1S0UA 3C4JA 4HSEA 3WXMA 2FF7A 5C2JB 3W5IA 5EZ6B 3ZVNA 3W2GA 4BLRA 3UPUA 4ITRC 1OB2A 1W48A 5FFMA 1KSFX 4G5GA 4Q47A 1QG0A 1TADA 1KDTA 2F1HA 4MA4A 3GQBA 4QHYA 1OGIA 1NKTA 1NVVR 3GCGA 1CULC 3T06B 4NMMA 2XOKD 4ZI3A 2JIZA 3NIBA 4LBZA 1W36D 2Y8EA 4KLZA 4ZO4A 1DADA 4BFVA 1K8AD 2B8TA 2VHCA 2OSBA 3ASZA 5DHAA 1JA0A 3JQQA 1U8AA 3GLHE 4N0EA 1XCMA 5B64A 1HE8B 2AWOA 4DLWA 4AF6A 2GZDA 3X1YA 3ZIAA 2LKCA 3OHMA 1GNQA 1ZUNB 2H7VA 3OE7D 2G0NA 1RIFA 4JT4A 4TZ0A 3WP1B 1LV7A 2ZS8A 2H17A 2JLZA 3A6PC 1M90D 3UWOA 4ARZB 3THYB 2J0QA 1YITB 1AS2A 2IEYA 3K0AB 3CF0A 2GJSA 2JLQA 3W9YA 4AKGA 5LB4A 1E94E 4MKFA 4OHWA 3GLFB 1EESA 3B1ZA 4YDHB 3BC1A 1HYQA 2QP3A 3LNCA 2FFHA 2QU8A 3UATA 1QFYA 2P6UA 4II7A 4B44A 2CHVA 2IUTA 4ERNA 4ESHA 1VCIA 2WBLC 1YR6A 4B47A 3FOZA 3HPQA 5L3VA 4OQNA 3L8YA 4A2WA 2XNDD 3R8CA 4ZDWA 1RPZA 1TEVA 2VH5R 3E70C 4LHYA 2O8EB 2RC6A 4PSKA 2CLCX 1CJMA 3H84A 4U7DA 1L4UA 3JZMA 1D1NA 3AVUA 2YWGA 1OXSC 4KFRA 2XAUA 3RS4A 3AVVA 4KFSA 3T35A 1AZTA 5J47A 3B9QA 3AVXA 5AUOB 1N2CE 1QG2A 1XD8A 2RGNA 3GJ6A 4NPHA 1KSGA 2ZRJA 4JVMA 1M2OB 5H70A 2O0KA 1YHQB 3CH5A 4YMSA 4DRZA 4DSNA 2NIPA 3AP3A 5CIWA 4YC7A 2ZU6A 4QG7A 4BZQA 2A2ZA 1NLFA 4P31A 2NZJA 4UAJA 3ZJYA 4XJXA 1QUEA 5FTNA 2JLYA 1VQKB 2UZIR 4A2QA 3Q7PA 4D81A 1GAWA 5FTLA 3LLMA 1LB1B 1EX6A 3F3YA 4CW7A 3TBKA 2ORWA 1M74A 3TKLA 4EPVA 3VKHA 2B21A 1XU4A 2A9KA 5DHFA 1K8RA 3T1QA 2DBYA 4Y9UA 3W6OA 5LD2C 2IL1A 3PEUA 3I5XA 3WHKA 2WSSD 2FOLA 2H57A 3PUVA 4HAUA 1RVDA 1PJRA 1XDBA 4TTRA 2JCSA 4PFSA 2BEJA 1E99A 2W0MA 1YHNA 1Q1EA 1DAGA 3BGWA 3SYKA 3KL4A 4EKDA 5C1BA 1RRFA 2HV8A 3NDPA 1QFJA 2QNRA 3B1VA 5LBIA 2IUSA 4LRWA 4Z51A 4PPQA 3CX8A 1PLKA 1Z47A 1YZKA 4YQFA 4CEHA 4Q4HA 3EZFA 4QL3A 3CW2A 3PJRA 4MYUA 3CWZA 721PA 3ONWA 1N3BA 1EK0A 1W0JD 2QSYA 2J7KA 4H1VA 1RRGA 1XEWY 4R98A 3EPHA 2FG5A 4IOLA 4NYIR 1E2JA 1VYTA 1UPTA 1ZM2A 1HV8A 2DWOA 3KJEA 4IDOA 3ADDA 1A8PA 2BMDA 3L43A 2J0SA 5FPSA 2QMHA 4QBFA 4Q1FA 1AGRA 1DBSA 2WOOA 1J8MF 1TU4A 1CR4A 4QKQA 5C18A 4PSAA 4URUR 1NG9A 4RJLA 4DCSA 2YWEA 3LX8A 3R8FA 3M4YA 3KFXA 1CQXA 4DDVA 4OI1A 2XOKA 1MRSA 4L15A 4PQYA 3ZDQA 4EPTA 3AF1A 4MKHA 4NDZA 3AEZA 3TLXA 1G9XA 3B7GA 2P6NA 1S9HA 3NG1A 3TVDA 2Q3MA 1H65A 3KKQA 5CLQA 3CPEA 2YKGA 2HYIC 2VA8A 5SZIA 1SQ5A 4P3YA 1G3MA 4L8GA 2A5GA 4ZCMA 2XEXA 2BHRA 4HDQB 4D4KA 2R65A 5C46F 4B2IA 1MT0A 1VKJA 1G7SA 3EIQA 4LDJA 4CEIB 3CWQA 4XD7A 2YWHA 3CUEF 4IDNA 3AP1A 3DZDA 2GCOB 4XVQA 1SXJD 2Q9BA 4AI6A 5J5CA 3NVAA 4BLQA 4A0GA 2V6IA 2WKQA 4JL5A 1JJVA 2FV8A 4CT5A 3U3JA 3VTKA 3TUIC 4TL7A 2YHSA 2JASA 5DI9A 3J81k 2RGAA 2PCLA 1X6VA 3IEUA 3SS8A 1QVFB 4HZUB 4QRHA 1YRAA 4URXR 1E0AA 2O0HA 5BWMA 5KNBA 4DT1A 3HR8A 1U8ZA 4C0LA 3P4XA 2C9OA 3U4QB 3VX4A 1KI6B 2WIAA 4AC9A 1GRNA 1JXOA 1ZCAA 4Q18A 1ZC3A 4FWTA 4JL8A 2H92A 2J45A 4ZCIA 1H8EA 1LS1A 4HLQB 4IOMA 4NE2A 2FWRA 3NEYA 2IYRA 5KSPA 3WMEA 1GWNA 2FA9A 1KK0A 1KK3A 1BO6A 1T4GA 4FMBB 1EWRA 2CDNA 2IYXA 4ASUA 2XGJA 3BRWD 1B0UA 2WJJA 4PC3A 4DIEA 2PBRA 5TARA 1E6CA 1G18A 1VQLB 2C96A 1CXZA 5KDOA 4OQXA 5GADl 1E64A 4P0TA 5EXXA 1CJVC 2NMVA 4TMVA 3QXJA 1XPRA 4EPXA 4BZPA 5AR1A 5DI3B 1QF9A 3KKNA 4JVNA 4LV5B 1J7KA 4UXHA 2KSQA 2XXAA 4FMCF 2OM2A 2G1JA 2BMFA 1T8TA 5FBWB 3VR2A 3OJWA 2GPJA 3SEAA 3NBYC 2RHMA 1RC8A 4O25A 4CGZA 1H8HD 1X86B 3C14C 3NH9A 4DCNA 3GLGB 2Z83A 3IIJA 1W5SA 5HCIA 3GJ8A 4Q4JA 2VZLA 3G0HA 3CR7A 1VG9B 2F43A 3VMFA 2O5VA 2FPLA 1NVXQ 1WB9A 1AMOA 1OYWA 2NO7A 4HB0A 5F2EA 1CJUC 3F8TA 4IXNA 1X3SA 2J7PA 1II8A 3CNLA 3GJ5A 4JZKA 1MO6A 4PGOA 2OESA 1VECA 4XOIA 4TLAA 1CRPA 2ZRLA 2YNMA 3IIKA 2FNAA 5GV7A 4LPKA 3G82C 4A0RA 3X1DA 1IQPA 5E7IA 1H85A 2QA4B 1G16A 1W0JA 2ATVA 1KHTA 2IYTA 4B33A 1E2KA 4LV8B 5CYOA 1P9RA 2WV9A 2FFAA 1G41A 1HT1E 3CONA 4Q9KA 4XTCS 3ZGXA 5FH9A 1BYUA 5AJVB 1Z08A 4C0SA 2GNOA 5D3MA 5E7JA 4V02A 3SOPA 5JI2E 4B71A 1XEXA 3KQNA 2EFEB 1E2PA 2C2HA 2H8KA 3BXZA 1UJ2A 4WIAA 3Q8XB 1KKLA 2A5YB 1Z28A 3FHCB 1F20A 4IVPA 1OYYA 4FN5A 3O8DA 1S4QA 1KJYA 3VHXA 2PT5A 1KJZA 2LCFA 4NH0A 4M2LA 2BOVA 2W6ID 4D80A 4LWZA 1KI2A 1Z0JA 3OW2B 1M7BA 2NTYC 3PFIA 2XNJA 4TLCA 5EXSA 2ZI9A 3K70C 4TSFD 2BN4A 4NCNA 4GI7A 4LYJA 1Z6AA 5IT5A 2V1UA 1KI7A 2WJIA 1F48A 3LFUA 1CJKC 2F3RA 4OKSA 3AB3A 4W5JA 2ERXA 4CEJB 2VP5A 1KY3A 4BZXA 2PZEA 1V5WA 5BYJA 2BM1A 3SHFA 1XE1A 3HWSA 3TNFA 4U00A 2EFCB 1JBKA 3KB1A 1G8YA 1KI9A 4GSYA 3SJZA 1WMSA 1XTIA 2KJQA 2IYUA 3KX2A 1N5IA 4O2RA 4EJSA 3KQLA 5G53C 1AJEA 4LV6A 1XD2A 2RC5A 4IW3B 2OUKA 3P4YA 3QOFA 1TQ6A 1QFZA 1NN1A 1WE2A 1W47A 1N8RD 3RS0A 1KTVA 2J46A 3FB4A 4LC0A 2HF9A 2OEPA 1YJ5A 4UNNA 1P2SA 4QJ4A 3NBZC 4WZ6A 2ZRFA 4E5UA 4HLUC 1EWQA 3RHFA 2OBMA 4LJYA 1E9BA 4XSGA 5EMNA 3ZZTA 4EPYA 1U2RA 2D74A 1NMZA 3U7GA 4FINA 2BBSA 2D62A 4YAWA 2JJ2A 1N6KA 5EE3A 4BGDA 2WAYA 3WRYC 4JIMA 4POAA 3FMPB 1M7GA 1NN3A 4IJMA 5HTKA 3WRXC 1FFHA 4GOKA 3RS3A 4DDUA 5D3QA 1ZU5A 2EVWX 3LD9A 4UXIA 1NVUQ 3RRYA 4IDHA 4LHXA 4KBGA 4PO8A 4B2LA 1WBBA 2OLKA 1TUIA 4GP6A 4LSGA 1SKYE 2GEVA 4PAMA 3ZVLA 2ZE7A 4TT3D 4AG5A 4MUAA 4AY2A 2J1LA 4RCYA 2PZGA 3KQHA 2AR7A 3KUCA 1S96A 3T15A 1KNXA 3CX6A 4AKHA 2YV5A 2ZI4A 2BWJA 2OCPA 4Q4HB 4V0KA 3R9IA 2ZE5A 3EPLA 5P21A 5AUPB 4ARZA 2IUUA 1IB0A 3AF0A 3CXCB 4BFSA 2WWGA 1FNCA 1AK2A 1KNQA 1OHHD 3AVOA 1II0A 3F0TA 1H42A 3K0AA 4B3BA 3IO3A 3ECCA 4GFDA 3U7FB 4M4SA 4JLVA 1BMFD 1KI1A 2XJ9A 4TLEA 2VP9A 1JJ7A 3GLFA 4B3CA 2XTMA 3O8RA 1N6IA 2BJWA 2CNWD 4Q1BA 4A4DA 4BRUA 1FOEB 2VNKA 5FUYA 1OPXA 1ZM7A 1P2VA 1K6MA 4RKEA 1P73A 2ZREA 5AUQA 2AX4A 1T8UA 4JSYA 3TUJC 3HP1A 4TL6A 2V7QA 2O8EA 3HU1A 2QM7A 3IBGA 1IOZA 4X8MA 1G1MA 4FMDF 5FR1A 4MRRA 1W36B 1QZXA 2D2FA 4A8JB 4XWAA 4P32A 4PC6A 4Q03A 2CMKA 2BGIA 1AS3A 3FPAA 2C99A 3RVBA 2E87A 5EXPA 2DWPA 1TL7C 1G19A 3LWNA 4N1AA 1TEXA 1UBCA 4ZI2A 4TMKA 3GP8A 1ESMA 2GEDA 2ZRAA 4ON9A 4B76A 2Z6VA 3TSZA 5F3WB 2QGZA 4Q4LA 2VHTA 3TMKA 3B78A 4KFUA 2W6IA 3PUYA 4F4IA 3UMFA 1XXHE 2G9NA 5EP1A 4TSFA 2GXSA 2GXQA 1KKMA 3AF4A 3GJ3A 4PHHA 3PG5A 2NO9A 3H4MA 4XVRA 5JWRA 2WWXA 2IYZA 1COWD 2CXXA 4Q4AB 4RZXA 2JJ1D 2R8RA 1Q57A 2IWHA 5CDFE 1OFIA 4YXWD 1Z07A 4B6EA 4NYIQ 3CD6B 3FGNA 4MYHA 5JJIA 1NN5A 1NJFA 1XEFA 1ZMXA 2ANCA 1YZTA 3T1VA 4DT1B 4LJ4A 1T9HA 2Q9AA 4D26A 1OJLA 1XNJA 2VP4A 3DHWC 3EA0A 3VKGA 3QEJA 2QAGA 1NBMA 5L8VA 3NH6A 5B2ZA 1UEJA 2CK3A 5DYIA 4IVRA 1DO2A 2XNSA 1P72A 4QJ5A 6Q21A 1P5ZB 3T12A 3QBVA 3O47A 3UK6A 2QPTA 3AGPA 3RAPR 4DBLC 2PMDA 1R2QA 4HUQB 1Q7YD 1E9EA 2CCJA 4ZDKA 4F92B 1O3YA 5E95A 4Z8YA 3ETLA 3LA6A 121PA 4JYCA 4EFLA 1CIPA 2JLRA 3EC1A 1VQ8B 1IXSB 1E2MA 3LV8A 3ZS9A 1GL9B 1VG0B 5BN4A 5HKKD 1G8HA 4JT2A 3LX5A 2BPOA 1IN5A 4KODA 2QRZA 4V0NA 2OE2A 3W5UA 4BFWA 4HEJA 4B3DA 1EGAA 1FQJA 2IYVA 5G3ZA 1ZYUA 1QHHB 3IBYA 3QKRB 1JA1A 2ZS9A 2A5FA 3WBKA 4I81A 1UKVY 1ZRHA 2CHGA 2MSEB 4URWR 1EFRA 2OTJB 2GF9A 2ZYUX 3OJXA 3KDSE 1M34E 3FYHA 4PZLA 5GVRA 4TMTA 1OFHA 5EE1A 1OH5A 4BQSA 1GAQA 2ZVPX 3AF3A 4DWJA 4DDWA 1QHIA 2QRNA 3UG6A 3UMRA 2EWVA 4DXAA 4PPGA 1M8PA 4EQ6B 1E1QA 2WZQA 2HDNB 2ZJZA 4MKGA 5FTMA 3SFZA 4OK6A 2FJUA 3QEOA 3D6TB 3IGFA 2FE4A 2DFNA 5JRJA 1QVAA 3GFTA 4F4JA 4GOXA 1N0VC 4EJSC 1HUQA 2IHYA 2V4ZA 4YONB 4CEIA 1XWIA 4TTPA 1OHHA 2DPXA 4WZBE 4CVNA 3A58B 4BPRA 2X2EA 4K8OA 2GCOA 2G6BA 4KAXA 1GDDA 3DMNA 3IO5A 4IOJA 3VO1A 3EW9A 4Q00A 3REGA 1N0UA 2CNWA 2RGBA 2QT0A 3H0KA 3KFVA 4TLBA 2VSFA 2OTLB 2O52A 1AIPA 1OV4A 3UWKA 4LHZA 521PA 3I32A 2QI9C 1ZCBA 3K0SA 1E2QA 4RZUA 4BLSA 4HZUA 4WW0A 4DIDA 1FX0B 3VO2A 4A6XA 5CK4A 4TTQA 3CCEB 2CEAA 3CM0A 2FX3A 3M1IA 2CLSA 4LBVA 1A1VA 1KI6A 4KHZA 4OHZA 3GLIE 4US1R 4UNPA 5JBQA 1SULA 1G5RA 1WRBA 4X8LA 3K1JA 3SZRA 1G7CA 3HPRA 4RY2A 3QPWA 3CH4B 4KV9A 1IBRA 1BOFA 1BS1A 3TR5A 4TLDA 1S1MA 3ASYA 3IILA 5J4VA 5JSZA 2HYDA 1R7RA 4AKIA 2D4HA 3BOSA 4FCTA 2ZAOA 2IA5A 3WYAA 1DO0A 5FTJA 1OKKA 4PHGA 4WOPA 5DIFA 2EWWA 3GJ7A 4F91B 5FUXA 2JDID 4LYFA 1KO7A 1SXJB 1MV5A 2OHFA 3KXIA 4YLGA 1WQ1R 2H5EA 3W2EA 3TR0A 1XJQA 4NONA 1VPLA 3RABA 2BMWA 3Q85A 3C41J 2JJ1A 5L3QA 3U3MA 3V4RA 2CVFA 1FQKA 1Z6XA 4M9QA 3QKUA 4WXRA 5GJWC 3LW8A 4TYYA 2V6JA 1Q0UA 2C9CA 2LWIA 4DSTA 2ZYTX 4US0R 4JKIA 1SGWA 3KXKA 1G21E 3ZQJA 1JR6A 4D6PA 2JGNA 1QHSA 3CPJB 4DCUA 4L5BA 4URYR 1BH2A 4DLSA 3U60B 1PUIA 3GEIA 4KITB 3U6BA 4GMDA 4JLKA 1OLOA 2WWFA 1VDZA 2OBLA 1JEEA 4YMWA 2ZEJA 1KGDA 2QAJA 5FOTA 1FRNA 1UMKA 1E9DA 1QUFA 1W4RA 2GRJA 4TWZA 2VO1A 2BCGY 2G0TA 1F2UB 2EFHB 1SHKA 2XTNA 2CL6X 2JJ8A 1T5IA 3QVVA 1NY5A 5J4KA 3MRSA 2F6RA 2ZJ8A 1Q81D 2QTVB 1NIPA 5FOXA 1P4SA 1S9DA 4MUBA 1IN4A 3LBNA 1YJNB 5HKKA 2VYQA 4MYTA 1X8JA 3ZZUA 1EP3B 1Q86D 1GG2A 4WZAE 4O3MA 3SBDA 4HI0E 4AURA 5F9FA 3B13B 5IK2A 4KCGA 1R0WA 1Z0IA 2QE7A 2PIAA 3FKQA 3M6AA 1E9RA 3NEJA 4F38A 3VR1A 4I1UA 4YMVA 1M7HA 4F4CA 1AQYA 4NYMQ 4I1OA 2QORA 3BB3A 1RZ3A 1PVOA 1JECA 4ZCLA 2UVQA 2RMKA 1TAGA 4LK2A 3MD0A 3W5JA 1JB1A 4JBYA 1AKEA 2ZJ2A 4HYYA 3U2QA 1U9IA 2ZSFA 3BH7A 5THXA 2GZHA 2QT1A 4CEJA 3G71B 3U3KA 4OI4A 5FOVA 1VQNB 4QBGB 3FKSD 1E79D 1XTJA 5IF9A 4G0NA 4V0ME 1QGAA 3RC3A 2ZM5A 4Q66C 4TYNA 8OHMA 1TF5A 1FP7A 1GL6A 1JAIA 1FL9A 5FL7D 4MGKR 1Z6GA 3B60A 3BS4A 4I1VA 3EZ2A 4BFZA 1G8PA 4R2HA 3CF2A 2IS4A 1AGPA 2PJRA 4C7OB 3CF6R 2IF2A 2G83A 4LJ8A 4Q7JB 2UKDA 3M0EA 1ZIPA 3SQXA 3NC1C 4CT4B 5BN3A 2VNJA 2JLVA 2GAOA 4JVLA 3SYLA 2XSZD 5FPYA 2G1KA 2GBLA 5L3RA 2DR3A 1KO8A 4F7WA 1A7JA 1XEWX 4UQOA 1IN6A 1G6HA 3CRQA 3NC0C 1HH4A 2DFLA 3ZVRA 2FSHA 4IOKA 3RRNA 3GLHB 4F93B 3QE2A 2BEKA 1DDIA 3QSYA 1R0YA 3K0FB 4C30A 3OEHD 2HCJB 3T5GA 4ZGQB 2ZI5A 4X8HA 2N46A 3ZBTA 4GPTA 4MH0R 4JBWA 4MRVA 2R2AA 2IXGA 1SVKA 4NKRA 1ZD1A 3CPWB 2DEUA 3GJ4A 3KKMA 1KDPA 4FWIB 3DOFA 4IKEA 2QEXB 1Z0FA 2IYLD 5E4FA 5TB5A 2Z43A 4UJ5A 5EP3A 5L3SA 2ZE8A 3QY0A 3IEVA 4R71A 3JVUA 3BH0A 5H5JA 3GPLA 2OZEA 2JDIA 3GD7A 4DJTA 4ZV4A 821PA 1YI2B 4CF7A 3QIAA 1VHTA 1Q1BA 5J40A 1D6JA 3MSXA 1VQ6B 4JVSB 4OQFA 2L0XA 3T5DA 3HJNA 2QAGB 2WJVA 3RSOA 4WXPA 2AL7A 4ESVA 2DY1A 3MWLA 1TU3A 1HTWA 1RYHA 1TQ4A 1NKSA 2EQBA 2GZAA 2XTZA 5EXTA 4BFYA 1GILA 2XB4A 2ZYVX 1LVGA 1NIJA 5K8TA 5JJKA 4BLTA 5CB6A 2H18A 3VKWA 4G5QA 2BV3A 4A2PA 4L16A 2B92A 2PX3A 5G41A 1FTSA 2WKPA 1E4YA 5AUNB 4JLJA 5TV2A 2YINC 4N3GA 2YOHA 4TL8A 5JLJA 1DEKA 4PZYA 3TGPA 4FMCB 2Q21A 1XCGB 2ZRHA 2FEMA 3K09A 2G77B 2XITA 2P3SA 2ZE6A 4LI0A 4EFMA 3RC8A 1GAJA 1P6XA 2CVHA 3PVSA 3Q9LA 4Q7LA 2RHDA 5EQTA 1NY6A 1VMAA 4KI0A 4NCKA 1GVNB 2Q3FA 2WWWA 4OL0A 3SN6A 1JPJA 3FWYA 1NNEA 3I8SA 4M1MA 3LW7A 3RRZA 2R44A 2YYZA 4U5XA 4A8JA 1DAFA 4FI3C 4JYBA 3PR1A 1QBKC 1W4CA 1IY1A 3HU3A 1ANKA 1ZINA 5KSZA 4C9BA 2NGRA 1D5CA 1S72B 3D8BA 3K9NA 3PITA 1R5OA 4M1SA 5EP2A 1V43A 3W8NA 4WA7A 3LAWA 2QUZA 3NXSA 1HQYE 4NYJQ 3VR3A 1HY3A 4LJ7A 4C0KA 1G3RA 2IEZA 3OE7A 1Z8FA 3I61A 5CIQA 3I55B 2OLJA 2GKSA 1YR8A 4QBIA 4ZKDA 1A2BA 1YR9A 2IC5A 2PLRA 1EX7A 4QBHA 4DLUA 1F60A 2P0EA 4ACAA 5EZ5A 4N0DA 2FH5B 2ZRIA 2J0UB 5FI1B 3OZWA 4NCHA 1KI8A 4E22A 3I92A 1GRQA 4RFSA 1DAMA 2QMUA 2QN6A 4Q4AA 3EZ7A 5FPHA 1U0JA 2OFOA 3AKYA 1EFTA 5IDVA 3EPJA 1KSJA 1XMIA 5CJPA 3BWDD 1S1CA 2R6CA 1QGYA 1GTVA 2XNDA 4AYWA 3QENA 3NHBA 2ZRBA 4BEBA 2QMOA 1W2HA 5FL7A 2OT3B 3I73A 3CRVA 1N5JA 3BIFA 2Z4RA 5TXGA 3MWJA 4B3XA 1S3GA 1HE1C 3G4SB 5DGXA 2QTLA 4W5WA 3HR7A 5AJYA 3V00A 4P4SB 2PJZA 4JS0A 2P5TB 4C0QC 2HEIA 3W6NA 1KO4A 4MDFA 1ODFA 4AG6A 1ZP6A 3L0IB 2GA8A 4DSOA 4B35A 1TQ2A 1YZLA 3C8UA 4JLMA 2HCBA 2VPPA 4PQRA 1RKBA 5JSZB 2R6GA 4GT1A 3AVYA 2FPMA 2ZI3A 5HE9A 4HUQA 3KJGA 4ZDIA 4PC7A 1Q1ZA 4B74A 3LVRE 1L7VC 3WNCA 3CCQB 3TSOA 4QFMA 2R6FA 4IFEA 4B3FX 3FDIA 1F3OA 4DB4A 1E32A 2AK3A 1UM8A 2ORIA 5JJLA 1DAHA 3ZD6A 4QNMA 1HEIA 1TF7A 1Z5ZA 5CM9C 3PEWA 2ZSBA 2IS6A 2ZVQX 5L3QB 5EE0A 3QKRA 1QHHA 3PIRA 4QHSA 5TR9A 1W7AA 1X1RA 2FFBA 2PL3A 3KXLA 1A4RA 3OIYA 4HDOB 3VR6A 1TMKA 3WY9A 2WSSA 2ZJOA 1E9FA 3EASA 3KZ1E 1XXHA 2QY9A 1U9IC 2QTHA 3SFVA 1NRJB 1XF9A 4P4TA 2B7CA 3ZD7A 1DARA 1JQJC 5DN6D 4MITA 3VHLB 1ZVQA 1P2UA 4GMXA 4LBYA 4MRSA 1Z0AA 2ZU0C 3TRFA 2QENA 1DE0A 1E2HA 2CL0X 4EQ6A 3OIUA 4Q7MB 5KDLA 4DVGA 4BRWA 3G6EB 3CRMA 4DSUA 3B82A 1IN8A 3K9HA 1RJ9B 4W7SA 3GMTA 2CNDA 2W6JD 2W58A 2CE7A 1G5PA 3RS2A 5DISB 5FA6A 1G7TA 2OXRA 2G3YA 2QTZA 3IQWA 2IXFA 5C4MA 1RW4A 4V03A 1E4VA 2RGNC 3VU9B 5DE3A 1OXVA 2R6HA 1ZNXA 1E69A 4FCWA 4DLRA 2Q9CA 2WM9B 2GBLC 1E0KA 4TYWA 2VSOA 1WDTA 4KJZA 4HB4A 4QGGA 3TSWA 3NWJA 1IN7A 1LNZA 1MKYA 3TIFA 2PEZA 2ZYWX 3QPUA 1II9A 5JEDA 1DDGA 1KSHA 4BLOA 4DQLA 2BKUA 1JQLB 1WP9A 1AQUA 2GESA 1XTQA 1FX0A 1GKUB 2VRWA 1E9SA 3ZLJA 1E1RD 2QGNA 2FSGA 3V9PA 5FBQB 2RGGA 1NP6A 2I3BA 3ICQB 5E7MA 1P9NA 2VQSA 5FTKA 3BJIC 2WAXA 4KVGA 1IJFA 4OK3A 1E0SA 1KO5A 1YKSA 2CE2X 3TUZC 1P60A 2GXUA 2AKAB 3B2EA 3FHTA 5H1YA 4RZ3A 1ZC4A 2C8VA 1YZQA 2AHOA 2JLSA 1MO3A 5GV8A 1N5KA 2F3TA 4M21A 4ZIRB 2A5JA 1KK2A 4R2IA 4FMDB 1T3LA 3QKTA 3KQKA 1PV4A 5F9HA 1Z83A 2MSCB 4DCTA 4PHFA 1HQCA 4EIWA 1N6OA 3VFDA 1G8GA 3QBTA 1Z06A 2FU5C 1XCPA 3AV0B 4PXAA 1SXJA 1VQPB 4BWYA 1LF5A 2X8AA 2KBFA 1QH0A 1QHGA 3LO5A 1HURA 4JLOA 3OAAD 2ZRKA 4XVUA 2O8DB 5KYKA 1D2EA 4DKXA 3EIEA 1NVVQ 5HR5A 1N6RA 2GWHA 1P9WA 2WTUA 1UEIA 3EC2A 2XJ4A 4R7ZA 1GFIA 1XTSA 3AH8A 3I56B 3K09C 5FBRB 5FOUA 2MMCA 3N2EA 3H86A 4IEEA 1Y3AA 2D3WA 2ZRDA 1QVRA 3B9PA 1DVRA 4D82A 2QPAA 2XZOA 4PTLA 5AN9A 3ADKA 2NOAA 3W90A 4KSBA 1TF2A 3VAAA 1U94A 1W36C 3CMEB 1F2UA 4A8JC 3W5HA 2F1RA 4LHVA 3L0OA 2JATA 2P5SA 2O8BA 3GLIA 1E2LA 2GJ8A 4TQ9A 1GR1A 2WIBA 4XTRA 4GDFA 4Q9LA 5L3SB 1YJWB 3TJZA 1FUUA 1N6LA 2PX0A 4ZPXA 1YZGA 1Q1QA 3U5ZB 3MAAC 2GILA 3SU8A 1YQTA 2GCPA 3CIOA 2ZRMA 2EFDB 4LY6A 5CLLA 3U44A 1U98A 3CRW1 1VQ4B 4LCBA 5KNCA 5H8WA 4LZZA 3THWB 2BGJA 5FPTA 5BN5A 1PUJA 3EIHA 1OT3A 4D2IA 1IXRC 2FZ4A 3V4FA 3PEYA 2A5DA 2VNIA 1H8HA 1OFUX 1EFUA 2ZAMA 1XBTA 3MFYA 3B85A 3ND9A 2DYKA 2D2EA 3A37A 2EYQA 4KBFA 3K70B 2C5LA 5K8LA 1BKDR 4FK8A 1ZM9A 4URVR 1ZM4A 1W0KD 3A1TA 1JJ2B 4LPSA 2C95A 4AD8A 3K8YA 3IPXA 2GHIA 1GL7A 3BE4A 3DKPA 4CIDA 4L4UA 2P67A 4IDQA 1CJTC 1KMHA 4G01B 3CC4B 3V76A 4PSVA 3QI2A 2AD1A 1GKIA 1IXZA 1KAOA 1UBGA 5EE5B 1E2GA 2XX3A 3CRRA 1DG1G 1TLLA 1XTKA 3FMIA 4A0FA 1Z3IX 1KRHA 4OJKA 4UJ3A 1FNBA 2HT1A 3T1TA 4C7OA 4R9UC 2WHXA 2DETA 1LY1A 4Q5IA 4K46A 1LW7A 2FGJA 2F1IA 3CCUB 2F1JA 5TDHA 1MRNA 3U3OA 2BM0A 2JEOA 1QRAA 1E2DA 5DH9A 4CRWB 5IHPA 3AGQA 4N3NA 4UKDA 2O8FA 3QE0A 3FMFA 2FFQA 2EFGA 1E1RA 1SKYB 4FD2A 4Y0AA 421PA 3GLHA 1KD1D 2IS1A 3K0FA 5DNYB 4F7DA 2NO1A 5JS8A 3TW8B 3C15C 4Q1DA 5H68A 3DOEA 3RANA 3WYGA 4AYXA 5DSZA 2ZRPA 4OQMA 4BFTA 2Q3HA 1XJCA 4RFSB 1CR1A 2QP4A 1ETUA 3CCJB 1ZD9A 2J3EA 2I4IA 1YZUA 2DFTA 2MSDB 4JLAA 5CM8B 2R62A 2R6AA 3JQRA 4RD0A 3IDQA 3TAUA 1YR7A 3R7WB 4YAFA 1E98A 3I4LA 4PC1A 3RSLA 3MG9A 1SZPA 1AM4D 3EZ9A 3CPHA 4I4LA 1YU9A 3QPVA 2VF7A 4D4MA 1S8FA 1U8YA 2OAP1 3OAAA 3K9GA 2HUPA 2EW1A 1L8QA 3RYTC 3SBEA 2ZUCA 2V9PA 3EAQA 4BEJA 4A36A 5FUWA 1AS0A 1IY2A 4Z8XA 1OH7A 1MABB 1G20E 3SHWA 1E2FA 2A78A 2WJYA 2YOFA 3HYRA 4AKEA 4OK5A 1BIFA 4A82A 2J5XA 4PPFA 4MQBA 1FRQA 3KQUA 3OEED 2ERYA 3T61A 1VQMB 2ODEA 1R0XA 3MHPA 3B1WA 4B43A 3BORA 1TVCA 1BX1A 2HMAA 2WMNB 3CLVA 3N2IA 2P65A 4JJKA 4L9SA 1OIWA 2BKEA 2EU8A 2NO6A 4TYQA 4JKYA 4L9WA 2DCUA 5EJEA 2IBMA 4HE5A 2ZR0A 4RD4A 1NI3A 4BE7B 1ZD8A 1PLLA 2W00A 3E1SA 4IXMA 4NTZA 2P6RA 1I2DA 1SVOA 5HE8A 1TPZA 1W34A 2VHUA 3U6KA 1KYIA 1XXHB 2N42A 2GJ9A 3G5UA 2JIZD 5GJCA 4LBWA 1I2MA 1JR3E 4AF7A 2BMJA 3IUYA 3Q72A 1HT2E 2ZRCA 4PAQA 4TT3A 3I62A 3LXXA 3DM5A 4NL4H 1O87A 4D25A 1NSTA 4FW9A 3DM9B 4URZR 2ZRGA 1DTSA 3BERA 3UANA 4A9AA 3ZIAD 4GBMA 4DDTA 1SXJC 1XJ0A 3WMFA 4JLPA 1E2EA 1QHNA 1UF9A 4PO9A 2CLDX 3QG5A 3TE6A 3LY5A 2J41A 4Q19A 3SNHA 4QJ3A 1QG4A 1BMFA 1W0KA 3KKPA 3Q3JB 3QF7A 1WBDA 2ZUDA 5A4JA 3W2IA 2J0UA 5JFGA 2GAAA 3JQPA 3O8BA 4YMTA 4RZ2A 3EZ6A 1XMJA 5AK0A 3FVQA 3A8TA 4M1OA 1KJWA 3I72A 4Q01A 4EPRA 1NDHA 4TMWA 2NZ8A 2VL7A 1P2TA 1WCV1 1KK1A 3D3QA 3CCLB 4C0AC 3QG1A 4LC1A 3UMSA 2OFWA 2PT7A 3MMPA 1YJ9B 3VNUA 2NPIA 4NBSA 2REBA 4G5OA 1BYIA 1LFDB 2ZI6A 4NP6A 5LB2A 1JI0A 1XTRA 4Q9IA 3X1WA 2ATXA 1NSFA 2BCJQ 3MJHA 4P4SA 5BW8A 4WVFA 2ZR7A 3CCMB 1N6HA 3IHWA 5SZJA 3EG5A 3AVTA 4I99A 1UFQA 1KDRA 4BASA 4DLTA 2IXEA 2V55B 3CB4A 4NHOA 3AKCA 3P1JA 3AQ4A 2GXAA 4OHVA 4BLPA 4QC2A 4D4LA 3JVVA 1VCOA 1US8B 1FP6A 3A1UA 1TNDA 2A3RA 3UG7A 3C5CA 2QL6A 2VP2A 2JLWA 3L2OB 1QHXA 4M22A 1OIVA 1B23P 1DOAA 1WA5A 3OF5A 1CF4A 2WPDD 1R4AA 3KB2A 3B8HA 1CR2A 1KAGA 3AVQA 4Q1EA 1D2MA 2J59A 3A1SA 3EWAA 1KI3A 3L8ZA 1COWA 4QGAA 1A5TA 3K53A 2NQ2C 4M8NE 4HATA 3DZ8A 4YXWA 5HCNA 2WMOB 2IHBA 3WNBA 2WICA 3K70D 5H59A 1IAQA 2AN9A 3CCRB 4E07A 4C43A 4JMPA 1CS4C 1KO1A 4NZYA 5E3HA 1QX4A 5ANRB 4EFNA 1EXMA 2Q0HA 3QKSA 2E9SA 1Q82D 4HAVA 1Z63A 1U81A 4HB2A 4OQLA 3AVPA 3VX3A 5KTYA 4RCZA 5FI0B 2NG1A 4LJ6A 4E09A 2KB0A 1D8TA 4OHXA 3GLFE 1T6NA 2JLXA 1RJ9A 4IFBA 4PQFA 2IS2A 4LGMA 3UIEA 2O8BB 3GLIB 3OIVA 4G3XA 5EUQB 1UDXA 4QGFA 2FSIA 2IF0A 2WSMA 3JZAA 3VU9A 3S1AB 2PZFA 3UXMA 5KSOA 1SM4A 2OV2A 1R8SA 2ZTSA 3QJYA 2PCJA 4DEXA 3DKVA 3LXRA 5AJZA 5CJ2A 5KUTA 3U7HB 4RD6A 3U44B 3AF2A 1WF3A 3BFKA 2GK6A 4B73A 4DCVA 3ADBA 5FR2A 3LBHA 5FPKA 2ZJ5A 2ZS7A 2A7QA 1OSNA 3Q5EA 3PENA 3K0EA 1NN0A 3CRZA 1N6NA 1YZNA 3LH5A 2BF4A 4TYPA 3EX7C 4XIGS 5CK5A 2W2TA 5JCZA 5JZVA 1Z2AA 3QXXA 3PUXA 2AXPA 3VR4A 4G1BA 2O8CB 1AKYA 4TZ6A 2GJKA 4EDHA 4C3ZA 5JI3E 2Z0MA 2ECKA 1KMHB 5KSWB 3Q5DA 2ZETA 5GVSA 4C0HA 3F5FA 4C0JA 4RD2A 3KTAB 4ZIRA 2X2FA 3CKLA 4JBXA 1IONA 3R9XA 4V0OA 2X1VA 2QAGC 5C4GB 3THXB 2OCYC 1G64A 3FMOB 4XD7D 1U90A 1NMXA 2F9LA 4LUCA 3MLEA 4CDGA 4HAWA 1R5BA 2PLFA 3B1XA 2QG6A 5HZHA 2VF8A 2OG2A 3QFSA 3R20A 3ZVMA 3P27A 2O8DA 3CMAB 4B48A 3CC7B 1VIYA 3AKDA 4HB3A 3WMGA 4WBSA 3SC3A 1NBME 1E3MA 1ELOA 2IK8A 1MH1A 1R5NA 3RLFA 2O8FB 1TUEA 3DL0A 1UKEA 1UKZA 3BK7A 1VTKA 2QSZA 1R0ZA 1XZPA 3EPKA 4C2UA 4GRAA 2A30A 1H8ED 4RD3A 1QVGB 3B5JA 2PH1A 4QHTA 1SVSA 2IYYA 3ZH9B 4YHBA 1VQOB 1S3SA 3TQFA 1DAIA 3WYFA 4Q21A 4A1FA 2BJVA 4ASUD 3GEHA 2OCBA 1T0HB 5BQ5A 1SKQA 1OB5A 4DEYA 4AYTA 1PZNA 1JAHA 1OXTA 4PANA 1QGZA 4Z54A 5FOSA 1BX0A 1XD9A 3RDPA 2HXYA 3MWKA 4GZMA 2F7SA 2ZXUA 2V3CC 3OFND 2REXB 4YALA 2WPDA 3AUYA 2QEQA 4Y7CA 5KOYA 2GCNA 5SZKB 1HA3A 1YE8A 2CCKA 3E1YE 2C77A 4Y9RA 3THWA 1JXMA 1CTQA 3C7KA 3NKVA 5AWFC 1ZAKA 2J9RA 2D06A 2QMEA 3VR5A 2V8OA 4UNQA 5EP4A 3MCAA 1TTTA 2YOGA 3EXAA 2CBZA 5B58C 1VIAA 4UXJA 3ZQ6A 1B2RA 5IRCD 1CEEA 2MMGA 3QF4B 1W49A 1VCNA 1X8LA 4D4JA 4UNRA 1J90A 1OW3B 2ZUBA 1Y63A 3GJXC 4KSCA 3A4MA 4M1TA 3FE2A 3QFCA 2J7PD 1N6PA 5DO9A 5JRZA 1L2TA 3CZPA 1D9XA 5KPJA 1XPUA 4HAXA 4IDPA 5K8UA 1KI4A 1FW6A 1KZ7B 4OJQA 1C4OA 3A4NA 4UNSA 1P7CA 1GITA 2HF8A 4X8OA 3CX7A 2X77A 3BFXA 1E9AA 1E96A 2XZLA 2RGDA 1LS6A 3ZS8A 2H16A 2ASEA 4HAYA 2ZSAA 1U99A 4HLUA 3TW4A 2CRVA 1FDRA 2IYSA 3AKEA 1DAEA 5BXQC 2CHQA 5LPNA 2GJAA 1JR3D 1Q20A 4LJ9A 1IM2A 4TQUS 4A15A 4D0GA 3MUFA 1ONBA 1G4UR 1ZUIA 4DHEA 3BAFA 3OZVA 1W1WA 4C2TA 2KI5A 4C0BA 4DLYA 1RRPA 5LD2B 1G3IA 3B6EA 4YMUA 1W35A 1DAKA 4B2PA 5M04A 2QBYB 4O0MA 1N25A 2TMKA 4A0HA 3SR0A 3IIMA 1E62A 1W5TA 2HT6A 3FKSA 5CITA 1E79A 4YDSA 1G7RA 4DUGD 3R7WA 3FFAA 4K81B 1W4BA 2W2VA 3KJHA 2FN4A 4MGIR 2VP0A 4H1UA 2RGXA 5AJXA 3D7MA 1EG7A 3WHLA 3ND8A 3GLGE 4D0LB 2UZ3A 3R9WA 4JLDA 2IT1A 2RGEA 4NU0A 1UBFA 3WP0A 2WWYA 5TY0A 2OK7A 2BBOA 1G17A 3W2HA 1I4DD 3RWMB 1X8KA 3OZXA 2GF0A 2EYUA 1E0JA 4Q1CA 2ZSEA 2R6DA 3FHOA 2I1VB 1LTQA 1W46A 1MABA 2XSZA 3A4LA 3NDBB 1NG1A 1U0HC 2GQFA 1NVWQ 4RD1A 4IEIA 3ZC3A 3QQ5A 4J0QA 4PC2A 1OFTA 3CC2B 1PLJA 3OEHA 1IHUA 2B8WA 3KUDA 3E2IA 3W34A 4M9SA 4TL9A 2GDJA 2IW3A 1D9ZA 2CL7X 3BFVA 3I3SR 2JLUA 1UDWA 1M6NA 221PA 2VEDA 2JJ2D 4XWOA 3LRPA 1NF3A 4JLBA 5FBVB 2NPFA 1KC8D 4W9MC 3SE0A 4QGHA 2ZIAA 1F2TA 2VBCA 3E20A 3L82B 1SHZA 5K8IA 3RWOA 1GO2A 1MR3F 1K9MD 3HDTA 4GP7A 1RE0A 2WKRA 4GZLA 4G5SA 4HAZA 3OFNA 3SDZA 1EFHA 2YC4C 3QKSB 4HUTA 3RNLA 1CNFA 3QFTA 4TMZA 3BB4A 1VG8A 1TQDA 3NTUA 5FL3A 5CDFA 3TVTA 4ZKEA 1JNYA 2ZQ5A 4M1YA 2C78A 1OH8A 4FXPA 3GJ0A 1W2GA 4AWXA 3DO6A 4HDCA 1YVDA 4M9XA 4OBEA 4DQKA 3TAHA 1VQ5B 1OE0A 4MYCA 3L0PA 3ZZ0A 2V54A 2Q6TA 3LVBA 2X19A 5KO2A 1Q3TA 3A1VA 5J4HA 3LVQE 3E5HA 4B6FA 2C03A 4WQMA 1OGJA 2CCGA 1JB9A 1BQEA 1C9KA 1GNPA 5KU1A 1S2MA 2IX3A 2G88A 3W3ZB 1X1SA 4IHQA 1FMLA 2HJVA 3IKJA 3PCRB 3WNDA 1Q3HA 4YAOA 3REFA 2IWRA 2JA1A 1GM5A 4XH9B 3ES9A 1SVMA 3SI7A 4LYHA 3MWYW 4ZGNB 3IPYA 1K5DA 2V7QD 2WJGA 2YVUA 5CB8A 3OESA 5FOWA 1GSIA 1P62B 1CU1A 1NMYA 3PEVA 1XB2A 2ZJYA 1E2NA 1C1YA 3CNOA 2D7DA 3BH6A 1EP1B 2AK2A 3AP2A 4BUJA 3LLUA 3IHLA 1SVWA 4BECA 5GJBA 1OIXA 1JR3A 4B3GA 2CJWA 1DG3A 3LBIA 4LHWA 1US8A 1GOTA 1UAAA 4I1SA 1RRCA 3K9LA 1XMVA 4HE6A 1GVHA 4ILEA 1EFCA 3FPKA 1FZQA 1FUKA 1AN0A 4G5RA 2YWFA 1J8YF 1CR0A 2OBNA 2QROA 2DERA 1G8FA 2KWIA 2WJHA 2WVJA 1DS6A 2ZJBA 3PQCA 1ZNZA 5JS7A 1TX4B 1G3QA 4DUGA 2AKYA 2N1BA 2QPOA 3QNUA 1E9CA 3SJCA 1EWYA 1Q21A 2W2XA 2ZANA 4Z1MD 1R10A 4M0LA 2ZITA 3EA5A 2WOJA 4FIDA 1ZU4A 1J2JA 4G1UC 1UKYA 4LX0A 5LDDC 4NYMR 2B7BA 4QM7A 2VP6A 4KYIB 4U9UA 2H1LA 2E1RA 5TMPA 1NBMD 2SHKA 2QTFA 2CK3D 1QHYA 2VNHA 3P20A 4DLXA 621PA 3A36A 1R8QA 5JCPA 3FJOA 4LOAA 1GKYA 5ELXA 1P3JA 3D31A 4M9ZA 3AM1A 3AUXA 2XB2A 1ZM3A 1A2KC 3S1AA 2R9VA 1MOZA 3OIWA 1F6BA 2ONJA 4DB2A 3ZYCA 1VYVA 2YJTD 4B75A 2QQ0A 5KDDA 2F55A 3B1YA 5KHOC 1SVIA 4TQAA 3W6PA 1K5GA 2DFKB 2YC2C 1R6BX 2VTKA 4Y0VA 2W0SA 4CYMA 4H9GA 4PHTA 3PXGA 1VG1A 3BB1A 5GJVC 5JWHA 2FMXA 2XZPA 2VHJA 2DWQA 3X2SA 1VHLA 2DHRA 1EP2B 4KYUA 3P26A 1EFRD 1ZNWA 4US2R 2ONKA 5JHGB 4PAOA 4MRPA 4Q1AA 1W4AA 5KPDA 3DDCA 2RCNA 5DN6A 2O8CA 2QQEA 4M1WA 2FGKA 4QM6A 1MO4A 4GL2A 4A92A 1E1QD 4G1VA 3QXSA 4A6PA 2ZRNA 2GVDC 3FTQA 2C98A 1XX6A 1J99A 1E63A 1Q22A 2BBWA 4OI2A 1CLUA 3K0CA 1T3HA 3KTAA 3MJRA 2W6JA 5KNDA 2C9YA 4MRNA 4CEHB 4EH1A 2RAPA 5A0FA 4LJAA 1GUAA 3THXA 4IRUB 5A5GA 3THYA 1NL3A 3TQCA 4AK9A 1IY0A 2Z4SA 1CP2A 1LF0A 2OXCA 3DPUA 1JEDA 4JJZA 3QFRA 3KJIA 5EUMA 2REOA 4JSTA 4RSGA 1Z22A 3EWSA 1FNMA 5HXBA 2AXNA 4S2EA 1QDEA 3SJBA 1JPNA 2BVNA 4JL6A 2ODNA 5EE9A 4KLNA 1GRRA 1WXQA 2PMKA 2QP9X 1NJGA 1Z2CA 1CBUA 4GOJA 2GEUA 5BYKA 1G3UA 3CNNA 4DLZA 5B57C 1Z0DA 2ODBA 3H1TA 1XRJA 2F9MA 2XNCA 1FTNA 1KDOA 1ZW6A 3AVWA 1JALA 4Q9HA 5F98A 1OH6A 1GIAA 2AD5A 4RKFA 1UBEA 2GTPA 2HLDD
chains in the Genus database with same CATH superfamily
2NQTA 4UCWA 4KFTA 2EQ5A 1NHGA 1V26A 2FSFA 3E82A 3N39C 2GK3A 4FZVA 4YCMA 2GVZC 4IYRA 1I4TD 1DXOA 4P98A 5B3JA 1FUEA 2ATEA 4JP3A 1ZJWA 4RY8A 2R8BA 3A9VA 1ZK1A 1UC8A 4M0KA 9ATCA 3UJ6A 2XCUA 2NUTB 1M1YE 3LWBA 4CM5A 3M6WA 3IJEB 2QLJA 4NAUA 1FZTA 3KUKA 2GETA 3QUSA 3SY8A 4U8GA 3T3IA 4BIIA 4MR8A 5HM8A 1PZMA 1Q7RA 5UKDA 1RYFA 3S8EA 3AM5A 2WTXA 3D8SA 1MTOA 4BATA 3RTAA 3R5JA 5HQTA 1EB9A 4DLKA 2DBRA 5JISA 3THRA 3AC0A 5BNTA 1IM5A 1TLFA 2OCAA 4M9CA 1DFGA 3NVDA 4P4UA 5IXYA 2AG1A 2A9OA 3Q0IA 4PR0A 3VNVA 3P0RA 3RRBA 3SC4A 3N2GA 2OILA 1DZ3A 3BMNA 1PEDA 2XBMA 1OX5A 2QD2A 3OO0A 4YAGA 1Z88A 1MIOA 2ZSDA 4PZZA 3QLUA 1S2IA 5DM4A 1QANA 1AZSC 2CDRA 2B5OA 1ZITA 3IOCA 1Z13A 4XYGA 4Y6QA 2NYRA 4LXQA 4HN2A 1NBEA 2GBCA 4IDAA 4P6VF 3OKPA 2HFKA 1XPOA 2R1VA 4L8YA 4OLJA 4D9CA 1J24A 3IMKA 4GPIB 1XA3A 1W87A 5B3AA 4M53A 2ZROA 3SG0A 1HF3A 3ZDFA 1SC9A 4C4RA 2Z8ZA 4KIGA 2VYFA 1FC0A 1QGED 3AR7A 1LLQA 2VUHB 4I5EA 1EJ6A 1LZKA 4HZIA 3KKOA 1JI3A 3G5MA 2ANBA 3PGKA 4PIVA 1Q6YA 1NJSA 5A7HA 1BGVA 2OOSA 2IV2X 3RS7A 3C6QA 3KHTA 2Y67A 3SLRA 2VPYA 4CF4A 3EYWA 2P9CA 2O7NA 3DHYA 3ZHCA 4Y1RB 5GOZA 3FOCA 2RDMA 3L92A 3KKKA 5AKJA 3S44A 5DMXA 3ZK9A 1ZEJA 1XFAA 2PUEA 4ACBA 3PUZA 1Y9EA 2NO0A 4I9HA 2VBTA 1M1KD 3DUWA 3V8MA 3H2YA 5CDTA 2CFCA 4G8JA 3QU7A 2OQRA 3I3OA 2P30A 3KLBA 5LMZA 2RHBA 1DKLA 1BXZA 1QKKA 4WN9A 5CYPA 4H0FA 3LO8A 2KBEA 4L4ZA 1U2DC 3VZRA 1QB7A 2I0FA 1G291 2C04A 3PGA1 4M0CA 4UD2A 1GZSA 1PQWA 3NGXA 1PQUA 1ZUHA 1OZ0A 1GZ5A 2VH2A 3LDAA 4NEQA 2P27A 5KSYA 3R7LA 2LKDA 4D9JA 2E82A 5CT6A 5BVGB 2GLUA 1NJID 1QP7A 1II8B 2WFZA 3NBXX 1OXXK 3BK1A 3JWPA 2Q49A 4W5HA 2IYQA 2ZT6A 3MK31 2K2WA 4NS1A 4QECA 2V4MA 4FFSA 1OILA 5D3KA 1T3SA 4LRYA 3LUDA 5HRAA 1DAPA 2CGEA 2QM8A 2MYTA 4OB6A 5AXDA 2H4WA 2J87A 4BV8A 3O4JA 2C7OA 4H0CA 1WY5A 3ICVA 3WQBA 4A26A 4MB6A 5NULA 4FSDA 2D54A 3AHDA 3KYDB 3UO8B 1YCFA 1EK2A 1DOZA 3F74A 3NHJA 1HGXA 3T1OA 4YBRA 4B4UA 3GEBA 2CFRA 3NT2A 3VVBA 3QVUA 3T34A 4H27A 1KQSB 2PR7A 4TM8A 4C7VA 2Y9MB 3ANSA 5DHRA 2FEXA 1M33A 1QO9A 4EP1A 2FPKA 1T91A 4B79A 1Q44A 3TMYA 2LIPA 1H0HA 2CJWB 4FFMA 5CURA 4OP2A 3T1YB 4OI0A 4ZAXA 4B4DA 4DJJA 1FMJA 3WB2A 3ODGA 3UJBA 4MGZR 5IJXA 2EGGA 3IXQA 3SYNA 4A91A 3ASRA 1N5RA 4NBWA 4WEQA 3AG5A 1YV9A 3RSCA 4CCWA 2CXRA 2P3OA 2Y92A 3N5CA 1GZDA 2Y4OA 3DBVO 3HP7A 4MR7B 4UMVA 4F2WA 1NV8A 1ZWLA 5BYBA 2Y71A 1LX7A 1AA9A 1MF7A 1O8BA 3PUMA 2YWRA 2VWQA 3LBFA 1SVLA 1VSQA 3NC4A 1CZHA 1LBEA 3VH4A 4EUEA 3FYUB 2EFYA 2QJFA 2CFIA 4DC1A 5HTOA 4YAUA 1T2NA 5C3UA 4UATA 1X1EA 3AERA 3U40A 1I4LD 2BEWA 2FX2A 2P2LA 3CE6A 5FFFA 4EITA 1GP2A 2QTCA 3NBFA 4Z0TA 5KOJB 3FI9A 5IM4A 2BBTA 3L7BA 3OZAA 1E3JA 4OHFA 5DI3A 1KMIY 1Y5NA 1VQ9B 1CZLA 2VIIA 4G0QA 1U0LA 1MV8A 2AOVA 2MJLA 1V3QE 1YDHA 1ZKMA 2OAQ1 2V9CA 3E1GA 4MHOA 2ZUSA 4PLZA 4RV9A 3O8CA 1V16A 5L51A 3E84A 1XAJA 2YICA 3GGSA 3QEKA 2FZLA 5DM70 3KAJA 4EX6A 3DL7A 3CSDA 2VPIA 5HZBA 3FPBA 4JQZA 4EBBA 4NJOA 2J3KA 2AWNA 2AMJA 2OBBA 1KBZA 1B8OA 3DMDA 3OPVA 1ZJZA 1SC3A 1ZGBA 3UICA 3LP5A 4KO8A 1UFKA 4WRRA 1CSEE 4YJ2B 2E0IA 1Z16A 3UYKA 1C5KA 3MJSA 4ZCQA 3AHHA 1NP3A 3B1FA 3W5IA 3P2MA 3AHJA 1EFLA 3UPUA 1CVIA 4ITRC 1V71A 4D3YA 3M49A 2Q3DA 2P2YA 1KSFX 4G5GA 1NT2A 2H0RA 3LOPA 5E6UB 3ZY4A 4ANFA 2BLNA 1NW7A 2XMBA 4QHYA 1OGIA 4MQFB 4E2XA 1LRJA 4UPDA 5BQXA 1ZJJA 4PZ9A 3LCVB 3ITEA 1ADYA 1LJLA 1Z5NA 5J3OA 4CFYA 3Q4GA 4LKRA 4LDQA 5CH8A 5EPOA 4Z4RA 2Y8EA 3G02A 1K8AD 3J81A 4W7IA 3VGJA 3DCYA 3CE9A 3ED1A 2XDYA 5GM1A 3AL3A 4N0EA 5DCLA 5DX0A 5DKFA 2O7QA 3FGPA 3PQDA 4F2PA 2XOXA 2XE6A 3HKCB 1KA9H 4RTKA 5B3JC 3N76A 4AF6A 1ZS9A 1VM6A 5TQ0A 1GAEO 3VR3D 4R3NA 4Z3DA 3OHMA 4JT4A 1PCXA 5JPIA 3A6PC 1RR6A 4ARZB 4KR3A 2JC3A 3QNWA 1AS2A 1AZWA 3CJTA 3CF0A 1HG0A 2DLNA 5TE9A 4HN9A 4HPWA 2BH2A 2WU8A 3OOSA 1ISGA 2BE9A 3B1ZA 1WUYA 5EWMA 5G0UA 4DG5A 3DOCA 4YDHB 2HNAA 4B17A 1HYQA 3LNCA 4RTRA 4WFKA 5BV7A 3TD2A 1CCWA 5CD9A 2FSPA 1ZK4A 1GTL1 1QFYA 2ZBRA 4QPPA 4P34A 5LQSA 4B44A 2IUTA 2WIKA 4HDRB 3DGFC 4ESHA 4KKSA 1VCIA 3B70A 3KZXA 1DBPA 4B47A 2OECA 4OBBA 4DDKA 5JYDA 4BDSA 4V1CA 1MC5A 1BN6A 1LZLA 1PT6A 1YKFA 3AZQA 1TEVA 3FLEA 3QLUC 4CQMA 4F2DA 4TVSA 4FNMA 4JOSA 2M6LA 3H84A 3W04A 3G9TA 4R4JA 5LBUA 1B8VA 1PHPA 3HYCA 3U3DA 1QIFA 4FLEA 4KFRA 2XAUA 2R7AA 5JAIA 4BGIA 1REQA 5I7SA 3UFXA 3RUPA 3ZXIA 2IV7A 1AZTA 2C2MA 1Z82A 3ORYA 5A9RA 3CC8A 1KXZA 1LBSA 3UMYA 4MHSA 3UHFA 1N2CE 2RGNA 1KSGA 1V1RA 1AF4A 1DXHA 4JVMA 1A71A 3F6YA 1T36A 4TKUA 2O0KA 3BXGA 2HBZA 3TEFA 4QTXA 5JCOA 5LZ5A 2NIPA 3AP3A 1JIQA 4YC7A 5TEWA 5F23A 4D46A 4EY7A 2NZJA 3PUHA 2W70A 4WACA 3AKZA 4L74A 1P4MA 1Y0RA 3M81A 5ADWA 4Q3AA 2V65A 2GAIA 5FTNA 5I48A 4A2QA 3Q7PA 1GZHB 1JYFA 3H1FA 4LJLA 1LPSA 2XYPA 4YP5A 1EFDN 3TKYA 1LB1B 1NYLA 5FTLA 1GQQA 3PA6A 1U6KA 1SOAA 4QIHA 1EE9A 2OZLA 5EWLA 3ZI0A 1L7EA 3PNBA 4QVKA 1CY2A 1UBKS 5BURA 1ESEA 2DSTA 3M5CA 4M0FA 4F46A 3EXHB 1U0RA 4ZEVA 1IPEA 1Z18A 1GTJ1 3PEUA 3VR6D 1F8UA 1N07A 1WEHA 2D4AA 2FOLA 3AF5A 3MJCA 4HQNA 4HAUA 3DE5X 3WLHA 1XDBA 3MQFA 1F4VA 1CEYA 1OV6A 5FEMA 2W0MA 3SYKA 2QPLA 3M1YA 3R3YA 5DCYA 4XM1A 5AVQA 3NDPA 5J23A 1SCJA 2KPOA 4LRWA 4EO4A 2Q8NA 1KFKB 1MIHA 3CX8A 4PPQA 3WL4A 2CHEA 5CT8A 4R8KA 1KQNA 4YQFA 3NR2A 3ZE6A 3OQIA 2O5RA 1NTRA 3W7BA 3F4LA 4R6XA 3CW2A 2CFSA 721PA 3ONWA 1UXOA 1N3BA 1BWSA 2QTTA 4LOKA 4MW1A 1RWMA 4L0DA 1XEWY 4UVEA 1VLJA 3QITA 4PPYA 2FG5A 4I2VA 4TWAA 5E6RA 4CMBA 4M7RA 4RF3A 5CB4F 3ZHZA 1SB9A 1HV8A 2WTAA 4H7HA 3AFHA 2JFPA 2FK7A 3JYOA 1MAHA 2J0SA 1MRZA 1X38A 1ZD3A 3PGLA 2RSLA 4M1EA 4N48A 1FXSA 3NHWA 4P54A 1U1GA 2ZR8A 5AM1A 1TU4A 4CMIA 1CR4A 4URUR 1NYTA 2LZ0A 4RJLA 2VRBA 4BUCA 5IDQA 1XYYA 2NPOA 3IQIX 4RPCA 4DDVA 1C9MA 3U4HA 3ONUA 2XOKA 3EZNA 4L15A 4EPTA 2VZ0A 3D2LA 3A06A 3LKVA 2YHIB 3FPLA 1M8KA 2P6NA 2I80A 3ZCRA 3NG1A 4GOLD 3TVDA 5DX1A 1FLVA 1H65A 2LBPA 3KKQA 3CPEA 3EFOB 1B7GO 5A4FS 4P3YA 4FZ3A 5IEJA 3HUTA 3Q3CA 4M9RA 5C1OA 2A5GA 5FIUA 3G1TA 2R65A 3F8WA 4H7IA 3HUEA 3M3HA 4WA8A 3WKCA 4ZT3A 4HDNB 5AHOA 1VKJA 2ZT7A 1G7SA 3O9MA 3RBXA 1RJDA 5LUAA 3N7TA 3ONEA 4QODA 4C0WA 4D9FA 3DVQX 2UAGA 4CM8A 3RU7A 3KOOA 1RWPA 4ZARA 3STYA 4IZIA 3QW2A 1IIBA 3DZDA 4HTAA 4M88A 1N1MA 1VP3A 3JQGB 5F1YA 1C3OA 2AUTA 4BLQA 2COKA 2PRJA 1FFCA 3PIDA 4PG4A 1Q0ZA 2PUCA 4FGWA 4P5DA 4M36A 1T34A 3QVMA 4DJAA 2ON6A 3VTKA 2YHSA 3I2JA 1SXQA 3WJ1A 4HF7A 2H65A 2JGRA 3QHAA 2RGAA 1X6VA 4KH1A 2HQ1A 4G0XA 4URXR 1QBGA 4QRHA 1U4SA 4EW3A 5KQMA 3E3AA 4C0LA 1U8ZA 4MCHA 1SIOA 4C7BA 2GLXA 3VX4A 3U4QB 4AC9A 3QTTA 4UTRA 3MCTA 4ONEA 2C3MA 4BECA 4ZCIA 4HLQB 1ZMOA 4YPVA 1T5DX 1XVIA 3NEYA 2IYRA 4Q3CA 4YT8A 1EINA 3LTEA 1GQSA 3F9RA 1P0QA 4BNJA 3VUEA 2QR2A 4ASUA 1AQ6A 1VGVA 3WGZA 1BXKA 1W85B 2OGUA 2VCYA 3JYLA 3V48A 5U1PA 3OZTA 3DC2A 2PBRA 5DYYA 1E6CA 3DXZA 1O1YA 4W8GA 1CXZA 1JHOA 3PRJA 5EA2A 5JU6A 1QH9A 1UC5B 4YI3A 2UUBB 2DUUA 1CJVC 2NMVA 1XDWA 4OP1A 5KKAA 4BZPA 3S55A 1J2RA 1ID8A 2Y1KA 1HYEA 3SHWA 1J7KA 1HDXA 4FMCF 1CF2O 2Q3LA 2PWBA 3A2MA 2BMFA 5CLHA 1LCIA 2H1VA 2GB4A 4KQKA 5C7LO 4D43A 2Q3EA 2IZ0A 4HRXA 4W1PA 1P4HA 1TZJA 2WE8A 3H8VA 4PABA 2KLHA 1YFZA 2GARA 1KPIA 3HXTA 3IEKA 4FQ5A 4O25A 4PN3A 1ABFA 3C14C 2QG4A 2WQ7A 4YRFA 4BO9A 3GLGB 2IIBA 3GJ8A 2Y1WA 4HQLA 4Q4JA 3RUFA 4FYXA 3EZXA 1TAQA 2X6XA 1VG9B 3CR7A 3NDJA 2F43A 2O5VA 1I6WA 4RYLA 4ZTBA 1NI5A 2IYOA 4DR5B 1WB9A 1OYWA 3LKBA 1CVLA 1T5BA 1RS0A 1CJUC 3F8TA 3UAXA 3ZX4A 4RDHA 4BX9A 4DABA 5HF9A 3AHIA 4FN4A 1GA1A 2Y68A 4I4NA 1WD5A 4PGOA 2YBDA 3TLAA 2XD9A 4ZVTA 1VL6A 1GGNA 1CRPA 2NU7B 3FY4A 4A0RA 5CHEA 3G82C 3I42A 4MKXA 1CJCA 2PGNA 3W5SA 3X1DA 1LDMA 1WW3A 2DFPA 2XT6A 5E7IA 3K4QA 2F62A 2FZEA 3CISA 4G81A 1TYZA 3FNGA 2IYTA 3EZLA 4FGSA 3SKBA 2ZBDA 1E2KA 1JMKC 1U6IA 2D5LA 4FEGA 4Q9KA 1VJ0A 4XJVA 4XTCS 4RQBA 1MJGM 3P71T 5YASA 3ZGXA 4F56A 1BS2A 3V7FA 1R15A 3HYSA 4G8BA 4R2JA 1BYUA 2HLNA 3ZGOA 3DBHB 1Z08A 4XX0A 5D3MA 13PKA 4KP7A 1XF1A 2DSNA 2OZPA 3GCXA 1V96A 2M5SA 4V02A 5IU6A 2B4AA 5BNZA 1XEXA 3REQA 2EFEB 3IVXA 1E2PA 2C2HA 3QA9A 5CFQA 4FGKA 4WIAA 5K6RA 1Z28A 3LX6A 1MJ5A 5M2QA 4IP0A 3PQ7A 2C20A 4FN5A 2GZ2A 2CY0A 4WERA 3VHXA 2PT5A 4M2LA 2BOVA 4KRXA 1Y9AA 3I83A 1KI2A 2AEEA 2ID8A 2NTYC 1H1LA 4NXMB 2ADOA 4TLCA 3M4NA 3UWPA 3MWDA 3ZQKA 3K70C 2RAVA 1H6DA 2WJIA 2I9PA 3KL2A 4TTJA 1A7AA 1JU9A 3AB3A 4K9KA 4KXUA 2ERXA 3O8OA 1ZH2A 2GASA 4CG0A 3EVCA 1Z0UA 3H75A 4D82A 5KTSA 3U5TA 3N87A 4BZXA 4J2TA 1V5WA 3L7NA 1KY5A 1XE1A 1SD5A 2J48A 3CVUA 5JZMA 4RH0A 1C29B 1JBKA 4CDRA 4UMDA 5I7WA 1G8YA 1U63A 4JX9A 3SJZA 1X19A 3NLLA 3UMBA 2I29A 1WMSA 3KQLA 1WIWA 2IYUA 4FOLA 4R8VA 2CXPA 2VJKA 1V9SA 3NHSA 2QT9A 3MJEA 4NESA 4O33A 3QOFA 4N8SA 1DU4A 1QTRA 4KGZA 1CX9B 3H2BA 3FNFA 1KIFA 1U7OA 2V74B 3FB4A 3HB1A 1JHYA 1VE1A 2DGDA 3OTHA 4ZXFA 3RVOA 3OCXA 5HJ5A 4Y9SA 5CVJA 1CY0A 2DFVA 1DRUA 4JBIA 1H66A 1L4HA 1OLUA 5JO0A 2G5CA 2BFDA 1VLHA 3BGSA 2ZUFA 2OBMA 2OBTA 1E9BA 2YVQA 4LJYA 4XSGA 2AC7A 2D74A 2FR1A 4GPEA 3EULA 4FINA 2BBSA 5ALRA 4DR1B 4UBKA 2OYRA 1N6KA 2VCHA 2H7YA 4IJKA 4R5MA 2VRCD 4CF6A 2JHGA 5E7QA 4AXXA 2E1BA 4MNTA 1M7GA 1NN3A 3PJFA 1FFHA 2Y6UA 3NHKA 4GOKA 3R6JA 1SRRA 4YJHA 3L3BA 1DGQA 2CUTA 2XF2A 4MUYA 3LD9A 4UXIA 1NVUQ 1T0IA 1NYQA 4Z7NB 3NEPX 4LXYA 5JH7F 3CF4G 2ZAIA 3M2PA 1WBBA 4LFCB 3PDCA 2HHAA 3D7RA 4M55A 1J42A 5HKOA 3SM3A 3T7RA 4DM4A 3ET5A 1Q0PA 2ZE7A 3LT1A 1O2DA 3NHZA 2M6KA 1DLIA 4RCYA 3OQBA 1FIUA 2YXLA 5C8YA 1KNXA 1SUPA 1BXGA 6NULA 1RWKA 4YP7A 3VH3A 1L8LA 4B31A 1ZUNA 2OCPA 2NAPA 2QZ9A 1V3TA 2GD1O 4Q4HB 4W4TA 4Y67A 3SC6A 1PR9A 2BFMA 1GDTA 2ZP1A 4X62B 5CB4A 1Q7GA 2II6A 4ZVRA 4TKVA 3C3XA 5EFZA 5ECWA 3D3NA 3BXFA 3PDIB 1OHHD 1B8UA 3K0AA 4D3SA 3HXQA 4E6PA 4BWFB 1XKLA 2JBAA 5F78A 1BMFD 1VE3A 5IM4F 5CB0A 1CJBA 4RM3A 3GLFA 2A5LA 1E58A 3GPCA 3LM8A 5IM5A 4B1FA 5DVZA 3OC0A 4Q1BA 4AUEA 1SY7A 4EHFA 1OI2A 2I2FA 1FOEB 3G7NA 4DRYA 1XDSA 2WVGA 1AB6A 3VZBA 3DOJA 1QLHA 1KY4A 4RKEA 4JYZA 1P73A 1PSZA 2ZREA 2RBKA 3QFHA 4IDCA 5AUQA 1M5RA 1UMCB 2AX4A 4DLAA 4PYLA 5LNK6 2HSWA 4AJPA 2MHCA 2ERCA 1Z4KA 2D9RA 1Y1RA 3HP1A 2B9VA 3DZBA 2V7QA 2XKBA 1CUHA 2IEGA 2QM7A 4P8RA 1TC1A 1JZTA 3TRIA 2ODAA 2FWPA 4A5SA 4AG3A 5ULLA 4RA6A 2BGIA 2BTQA 2VTDA 2XODA 5AVVA 4BQQA 3K6SB 2VT7A 2OPHA 5E0KB 1XNRB 4PONA 3DSRA 1GARA 3IVMA 5A3RA 1GPKA 3DOUA 1GLVA 4RE5A 4BQPA 3U7JA 1FRFS 1QS0A 3EODA 3KB6A 3PTZA 4HGPA 2R8OA 1UT6A 3M6FA 5I7HA 5HBRA 4NENB 3W8EA 3H3JA 1PF7E 3WK9A 1Y4UA 1HZJA 2P40A 4RTJA 2Z6VA 1NNI1 1SK8A 3M9XA 2VHTA 1IVYA 1O08A 1Z5VA 3K5WA 3PWSA 1YC2A 2CZCA 3VSCA 3FVWA 4QOGA 3UMFA 1A95A 1XXHE 4YAEA 2BTOA 5KQSA 2XDQA 1KKMA 3GJ3A 1TUBB 1L5RA 3GDHA 5JWRA 4JP8A 4XWWA 4BKMA 1O89A 4CM7A 4IILA 1COWD 5JAPA 3D7LA 4Q4AB 3WL3A 2JJ1D 1Q57A 4W8OA 4E1AA 3GZ4A 3S4YA 3R74A 4B6EA 1F8YA 2YWJA 4XB2A 1OI3A 5F4JA 3FGNA 2ANCA 4N3CA 3F6RA 1TM4E 4DT1B 5KI6A 1T9HA 2NV6A 2V59A 3F97A 1VI2A 3I53A 3DHWC 3A6HA 1Y6RA 1PKXA 3WX0A 2NV4A 3G8DA 4IGKA 4FSHA 1IY9A 1Z7GA 3DF9A 4MUHA 4DREA 2WPNA 3OOWA 4ER6A 2X8LA 4I3HA 1IZ8A 1FTGA 1WP4A 2HOQA 2IXTA 2XUAA 1DO2A 1M6VA 2R5FA 3HN7A 1KVSA 3KPWA 4E5KA 1M66A 2ZBQA 4FB5A 1MC1A 3VTAA 3QBVA 5A1JA 4B6GA 2QPTA 3AGPA 1P7PA 1ZUD1 2KW5A 4HDKB 4ML3A 1Z33A 4YUWA 3Q1KA 4HUQB 4U5QA 1E3DA 1GL3A 1E9EA 3ND5A 5DHUA 5BN1A 1SOUA 2OAGA 3I5UA 1O3YA 2H5LA 4Y2HA 3VJLA 4A5OA 3LA6A 4EFLA 121PA 1JDVA 2GNPA 3N8GA 3EC1A 4ARUA 4OMCA 3DQZA 1E2MA 1N2CA 3BWEA 1VG0B 3O3OB 3P96A 2GPAA 4UVIA 3LX5A 3ZV3A 2G1PA 2X8BA 1R74A 1ENPA 3TZLA 1LLCA 3QP9A 2JRLA 3W5UA 3MN1A 4BFWA 3MM4A 5ITVA 1JLLA 4B3DA 4Z0HO 1H69A 1EGAA 1FQJA 1GUDA 3IMFA 3QOXA 5GZ6A 1QHHB 1LVHA 2Z8YM 2I4RA 1FLNA 2BFBB 3UCFA 1SQ6A 2CHGA 1DIOB 4URWR 4HFJA 1EFRA 1SA0A 3I6QA 1OH5A 3TRHA 4J6FA 3H2ZA 1GAQA 2ZVPX 3DXFA 2VDRB 1EHYA 4DWJA 4DDWA 3QMVA 4Z4UA 2XLBA 2EWVA 3JQBA 1B0ZA 4PPGA 4Q3OA 3A1EA 4G4SO 1U1IA 4MKGA 3DTTA 3SFZA 3ZGNA 3SMVA 3AYZB 3QEOA 4BLWA 2B83A 5FI3A 2IOYA 1ZOOA 3D6TB 2E4ZA 2FE4A 3GB9A 4S1VA 5AMXA 3RHSA 4B4VA 3O9ZA 2IP2A 3MINB 2CLFB 3GWGA 3Q38A 4ZHQB 4UAUA 4C6HA 1MXHA 4CEIA 1XWIA 2ZGVA 1TIKA 2HKIA 1EK6A 5AW4A 2ONYA 3PLRA 5E2AA 2OTCA 3V2UA 4GXTA 2G6BA 4C05A 1DMSA 4KAXA 5LJLA 1ZKDA 1GDDA 3IO5A 5F5NA 1RJFA 4DNPA 2XMRA 2CNWA 3KQMA 2AUNA 4J7XA 4ZZ2A 3ZK8A 1NUHA 1V1MB 2QT0A 1TM1E 2QVLA 4TV8B 1BWPA 3KFVA 3OA2A 3FDZB 4FMPA 4IHJF 4QUKA 3UAGA 4CT0A 2L69A 2O52A 1OV4A 4CF3A 521PA 1EEHA 1NPDA 3MMZA 1AKRA 2B4YA 4V2IA 1E2QA 3CN9A 1XRMA 5A89A 3JQ9C 4RADA 5GGXA 1FX0B 4LTNA 4A6XA 4DIDA 5HJEA 2D6FA 1ZJ5A 2GN0A 3EUEA 4N47A 4EJ2A 3M1IA 3O1IC 1VF7A 3FR7A 4IPTA 4OOEA 3IRVA 1A9XA 4KHZA 3GLIE 1A1VA 2DR0A 3PKIA 4OXIA 3QE9Y 4UNPA 1JF8A 4X8LA 1SULA 4YB8A 1MH9A 5BMVA 3SZRA 4EB3A 1G7CA 4ETWA 3TRDA 4UCXA 1YVRA 2QF7A 3R7DA 2D2VA 2QJRA 3F90A 2X0FA 2YN0A 3UGTA 2GPBA 1ZZEA 4UU1A 5E1MA 3ZCSA 2GPWA 4KV9A 4EJFA 1ZGZA 3HADA 4TLDA 3TR5A 4ZYTA 1IHMA 3AIOA 1R7RA 2WT9A 4BKPA 4F21A 4N03A 5JQGF 2JCYA 1DO0A 5FTJA 1C30B 2EOAA 2RGYA 1JGTA 3K9QO 2A4KA 2FPPB 1TK2A 3LXUX 3EEBA 4C1NA 5T7BA 4C6RA 5DYTA 4AIRA 1CQWA 4XPIB 4YQEA 3N2ZB 3HFGA 1MQ8B 4PGGA 3FHLA 3SVZA 4L27A 3LF1A 5F4ZA 1N4DA 3QKIA 1M1NA 1KFEB 3NYIA 1Z17A 2DE0X 3NDRA 4NH4A 2BSQA 4O2BF 5EJ8A 3PPVA 1P9OA 2ZWPA 5LFAA 1UK9A 3E9YA 3HS3A 3PFNA 3W78A 3C41J 1NQOA 1VE5A 4IVNA 3ZXUB 2JGAA 2V6GA 5EJIA 4BJHB 5BPFA 4GR9A 3V4RA 4GX5A 1Z6XA 1XYGA 1XFDA 5FORA 3OQOA 4DGQA 1AE1A 2DF8A 3N6VA 4BNYA 4N5LA 4HQFA 4BP3A 2ZYTX 3BIOA 4D42A 1G21E 3X2EA 3OOJA 3U60B 1ZI8A 1PUIA 3UBMA 3U6BA 2RHTA 4GMDA 4MW4A 3RVNA 4JOQA 3ZWOA 1VDMA 2QRMA 2ZJ3A 4W6QA 2F17A 2QAJA 4YMWA 4PSUA 3VOTA 3L06A 2X1MA 4XZ3A 1AUVA 1W4RA 2GRJA 2PXHA 2BCGY 2G0TA 5T41A 3RFUA 5HW0A 5AXBA 1FB5A 5JH7A 1UINA 4QT0A 4IM7A 1N2OA 5J4KA 4JASB 3F7OA 2KHZA 1RI2A 1GZUA 3MGGA 4JNCA 5CTJA 5JV5A 3IVGA 3JQDA 1M2WA 3K0HA 4LHEA 3VKUA 2PRYA 4XW2A 1G60A 1PT9A 5B6JA 1PTKA 1S9DA 5M7EA 2ZUEA 1G6Q1 1ZBQA 3RT9A 2IKQA 4OXKA 1TW2A 3ESBA 3NT5A 2I65A 3ZZUA 1JWBB 1X8JA 2W6MA 1GG2A 2QD3A 4WZAE 1QF7A 5F9FA 4AURA 3KLOA 1NI4A 1R0WA 5K3FA 2Z1NA 4NV0A 2PIAA 3I5MA 4G7XA 4WCFA 4A10A 1W6UA 2ZIVB 3FKQA 4E5PA 3T4PA 4W5QA 1G38A 1TJYA 1V41E 3TSYA 1B1CA 3PA1A 3AEQA 4AZ3B 4ZZ0A 4TS4A 1M7HA 4R9VA 2CJFA 1XMXA 4NYMQ 4BFSA 5EJGA 4TXMA 3H65A 3I04M 3ZDXB 2DG2A 1EXVA 1K06A 3RAFC 1OBVA 1TAGA 1XJ5A 1FDVA 3MD0A 2YS6A 3B7WA 1T1GA 1KPHA 2B36A 2F67A 2FY8A 4JBYA 5LR6A 2D8AA 1DPGA 1U9IA 1O94D 5ARCA 1BX3A 5THXA 2NZYA 2QT1A 2ZWVA 4GXNA 3G71B 4CEJA 3U3KA 3G3EA 4F04A 4OI4A 1UJCA 4Q3EA 5K99A 1T9KA 2XB6A 1ZJYA 3IT3A 5IF9A 1QGAA 2ZM5A 3Q3VA 1N57A 4Q66C 4TYNA 8OHMA 1GL6A 2HMYB 4LGCA 1A2OA 3LLVA 3WR5A 3DT6A 2AXQA 3CP2A 4A8PA 4BFZA 2CLLB 4X7DA 4LWPA 4R2HA 3TOCA 2R7LA 4DAOA 2B2NA 2H4HA 2M6SA 4C7OB 3SXJA 3RG2A 2WG2A 3OICA 4R8MA 2XQVA 4LJ8A 4C5AA 3KSRA 5C5CA 2GJRA 1ZIPA 5IYZF 4MAFA 3GFGA 1VCHA 1XQBA 4DA9A 3GLUA 4JVLA 4XWTA 3ZHRA 4EARA 2GBLA 1IZ9A 2HMVA 5HKLA 4KXXA 3RNOA 4ALJA 1G6HA 3AESA 1J2YA 2ORYA 1HLGA 2CJYA 1O8CA 1AG9A 2EERA 4IOKA 5G1OA 3RRNA 1V2HE 1K9VF 3K0FB 1E1MA 3ZWDA 4C30A 3OEHD 3VAZA 4DDMA 1T6YA 2IBTA 2Q5QA 2QAIA 2WG1A 4ZHSA 1M2JA 5DN9A 1JFTA 2Z1MA 4N82A 4WDQA 3ZBTA 3T9CA 1R37A 3NIWA 1LDGA 4BHTA 1ZD1A 3CPWB 4JEUA 4XM2A 3K6JA 1DP4A 4XCVA 1Z0FA 2XECA 4WLVA 2G6TA 5E4FA 4QBTA 5TB5A 5JZBA 2Y9PB 2M32A 3JQBC 4MMYB 2J3HA 5EP3A 1SU4A 3QY0A 3OU6A 4R71A 2P3QA 3IEVA 3DH0A 3ZKWB 1AA6A 4IXWA 3QBJA 3EMBA 1LSJA 4PAAA 4JMQA 3MT9A 4ECAA 3FTEA 4B8YA 2JDIA 4YJ3F 3VNSA 4DJTA 821PA 2AJBA 3NAMA 1VHTA 4PGFA 2JI4A 3MSXA 1MOPA 4DPLA 1D6MA 5K3SA 4QG3A 1N9GB 3HJNA 1BMDA 1QZTA 2UYOA 4WXPA 4UOEA 3MWLA 1TU3A 1UIMA 4C1BA 3LWZA 1NKSA 1QLWA 4BFYA 2XB4A 3HV0A 4TXHA 4YCDA 4YREA 3HEMA 5CB6A 2X1LA 4G5QA 4L16A 3UB4A 2BFEB 2AH5A 5HHTA 4DRXB 4J0IA 2J85A 1G5IA 1RI1A 5TV2A 1T9BA 5AUNB 1W4LA 1NOJA 3OEYA 3TGPA 1RZRD 2B8JA 4QFCA 4UHBA 5D85A 4UAVA 2RONA 3K6KA 5LXTF 2XCTB 1MFZA 4YJGB 2XITA 4MI1A 2A1TS 1UH5A 4GGOA 1P6XA 4DV0B 3PVSA 4PINA 4Q7LA 2RHDA 3I12A 1K3TA 1KE2A 1N2IA 3HJFA 4AQYB 1ZRMA 1MC4A 3DLCA 2DC1A 2WWWA 2ZYHA 4LGVA 1FSGA 1JFVA 1JPJA 2YMQA 4WXHA 4TKLA 4GE0A 4M1MA 3RRZA 3BC9A 3NWOA 2YYZA 4R1NA 4A8JA 3NDIA 4KGXA 4BB0A 2JFWA 4X3OA 3TRJA 2W9XA 1RCUA 2J6IA 1EH5A 5KWIA 4DV1B 1KH3A 5DXFA 1C1XA 5TPWB 1U2ZA 2NGRA 3ZHYA 1S72B 3K9NA 3TD6A 3JVDA 3NTLA 4WA7A 2P2NA 1H2BA 2I62A 3LAWA 3OT1A 4NYJQ 2VK8A 1C1HA 3VR3A 3ITDA 4DM7A 3FWPA 1F17A 4K3UA 4F9EA 4DK0A 1UAYA 1XRQA 2B69A 5MN4A 1MU0A 3N2KB 1MX1A 1BOOA 3BIXA 3V7NA 4KUEA 1K28D 4IIVA 1PR4A 1SXHA 3UFBA 3DMHA 1LTHR 2V7UA 4QBHA 4DLUA 1F60A 3WLPA 1XTVA 2BE7A 2P0EA 3V9AA 6AT1A 5IABA 5D86A 5IG2A 1O0SA 1USWA 2OPBA 4N0DA 2J0UB 3OZWA 3A28A 5D87A 2SNIE 4NCHA 3ZW8A 4RJJA 2XLCA 1GRQA 4LMBA 1YC5A 2QMUA 3KWLA 4RZSA