3ISXA

Crystal structure of endoglucanase (tm1050) from thermotoga maritima at 1.40 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
335
structure length
335
Chain Sequence
HHHHMKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase
publication title Crystal structure of Endoglucanase (TM1050) from THERMOTOGA MARITIMA at 1.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 104
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3isxA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3isxA01
5THWA 2OR4A 2V8GA 5HVFA 1CP7A 1YMEA 2XEFA 3KGQA 2O53A 6CPAA 3LMSA 4MXUA 2PVVA 3B3TA 5K8NA 2AFOA 4PXCA 2AFMA 3PB9X 5JH9A 2ZEMA 4O23A 2PJ0A 1TXRA 3H8EA 4UF4A 1Q7LA 3IIBA 4NGSA 1LAMA 3V38A 5IB9A 1FNOA 1VHEA 3IJ3A 4OMEA 4ONWA 2AFXA 4X3RA 2PJ2A 3PRTA 2RB7A 4MCSA 3B3SA 3B35A 1RTQA 4TWEA 5LRGA 5CPAA 4UEFA 1OBRA 3FECA 4EWTA 5HVHA 2V8DA 1FT7A 4YWYA 4A94A 1LOKA 2BOAA 4TNUA 4DUKA 1DE4C 4ZI6A 5J1QA 3PFOA 4NFRA 4NGQA 5K8MA 3WC7A 2JEWA 3KHXA 2CTCA 3GUXA 1LFWA 3KR4A 3GLJA 3HUVA 2AFSA 4K3NA 4EMEA 2ZEFA 5D29A 4OKOA 1AYEA 3IC1A 4FUUA 2BO9A 1XMBA 3D7GA 1CX8A 4P4EA 3NFZA 4PXDA 4MCRA 1TKHA 1XFOA 2ABZA 1XJOA 2JBKA 5ELYA 3T8WA 3D66A 3IO1A 2PJ9A 3WC5A 1ELLP 5LYLA 5JGFA 1XRYA 3K9TA 5LYDA 3GB0A 3NH8A 2IQ6A 4P4BA 3KI9A 3B3CA 3SJGA 4PQAA 3SI1A 4NJRA 4AXVA 3DGVA 4MHPA 2HB6A 2GLFA 4A37A 3L2NA 2Q4ZA 1HEEA 3HLPA 3D68A 3CPAA 2PE3A 2CIJA 5DS0A 2PVWA 3PBBA 1Y7EA 4IHMA 2PJCA 2GREA 3S9LA 4ZX8A 1ZG7A 2GLJA 1LAPA 3D67A 1CP6A 2IMOA 1VHOA 2PIYA 3KHZA 1LANA 3RZAA 4R6TA 1HDUA 1Z8LA 4MHZA 3QNVA 3SJXA 3RBUA 2Q51A 3CT9A 2XEIA 2F8HA 3MN8A 1NSAA 4WWVA 2QJ8A 1BPMA 3SJFA 4ZY0A 2PRQA 2RFHA 2VL1A 3D7HA 3PBEA 4EFDA 1CPSA 2PJ4A 1PYTB 2ZEDA 3DLJA 1ZLHA 2OOTA 1F57A 1QQ9A 4YU9A 3KZWA 4OC2A 1CBXA 2O4HA 4A38A 3RAMA 4UIBA 3MRUA 3ISZA 1F2PA 4MCPA 2BCOA 4UEZA 3JRUA 1BAVA 3KQZA 8CPAA 4PXBA 3LWUA 3PFEA 4OC3A 3NH4A 2V8VA 2F7VA 1KWMA 2PJ5A 2V77A 2ZOFA 1ZG8A 2PJAA 3VH9A 4F8ZA 1DTDA 3IEHA 4P4DA 4R7MA 2ZEPA 1Z2LA 3CPXA 2Q43A 1ELMP 4NGTA 1TF8A 4H2KA 1UWYA 3PB8X 3ISXA 5LRJA 1R3NA 2AFWA 1F2OA 1ARLA 3FVLA 3BI1A 4JYWA 4FAIA 2PJ8A 3B3VA 4NJQA 1YSJA 3NA6A 4DYOA 1JQGA 3H8GA 3PB4X 5I4MA 1Y0RA 4FBEA 4MHYA 4OC4A 4UIAA 4MMOA 2EWBA 2C6GA 5HXDA 4F9VA 4MHNA 2ZOGA 4OC0A 4R8FA 2I3CA 4OP4A 1R43A 4UEEA 1Z5RA 1HDQA 3K2KA 3I1UA 3KR5A 1Y0YA 2NSMA 2PJBA 3FMCA 1ZG9A 4JZ0A 3VATA 3NH5A 1ZLIA 4A39A 4P10A 4GM5A 5JM6A 4P4JA 4G1PA 1PCAA 2ANPA 1VIXA 7CPAA 2QYVA 4X2TA 3IFEA 5HVGA 3WC6A 5K8OA 1EE3P 1TKFA 3FEDA 2POKA 3V7ZA 4MCQA 4F9UA 2PJ3A 1LCPA 2DEAA 2PCUA 4P45A 2JBJA 2EK9A 3FH4A 1M4LA 4P4IA 2ZEEA 2EK8A 4OIDA 3PB7X 4R76A 2XEJA 4WJBA 3TX8A 2PIZA 3B2YA 5K8PA 3WT4A 3IWWA 4OC5A 5LRKA 1GYTA 2AFUA 3VARA 3PB6X 5LYIA 4ZYQA 4Z65A 1XBUA 2ZEHA 5D8NA 1ARMA 4MRIA 1BPNA 1VGYA 3SI0A 3FJUA 2ZEOA 5CBMA 2ZEGA 2C1CA 2WYRA 3FF3A 3FX6A 4BD9A 4IK2A 4KSIA 4RUHA 3H8FA 4NGNA 4Q7AA 4CPAA 4DJLA 4X8IA 4NGMA 2PJ7A 4LQGA 4ZY2A 2ZENA 3FEEA 1IY7A 2V8HA 4W9YA 3KQXA 3B3WA 2AFZA 2ZELA 2CTBA 2GU2A 2IJZA 4NGRA 2NYQA 1BLLE 3BXMA 4P4FA 1YLOA 5F09A 5LYFA 4OIWA 1CG2A 3SI2A 4ZY1A 2CF4A 2HC9A 3WABA 2G9DA 4ZX9A 1H8LA 1AMPA 4OC1A 3D7FA 4NGPA 2C6PA 3KL9A 1YW4A 1QMUA 2QVPA 2PJ1A 4P44A 2FVGA 3CDXA 1IGBA 4B6ZA 3BHXA 2WZNA 2XEGA 3TC8A 4PXEA 4PPZA 1TKJA 3N5FA 2J9AA 3SJEA 3D4UA 3B7IA 3KASA 4FWUA 4P6YA 3BI0A 4IAVA 2C6CA 3PEIA 3S9MA 3S9NA 1CPXA 1TF9A 2PJ6A 3D7DA 1YW6A
chains in the Genus database with same CATH superfamily
3P27A 2V8GA 1DARA 4KOSA 1TVCA 5HVFA 1CP7A 1IU8A 1OGIA 1IJFA 4B3FX 4YALA 1I18A 1PU9A 4Z4YA 4KORA 1ZO0A 4O23A 3U6KA 3CMAB 3EFAA 4UF4A 3V38A 5GV7A 5HZBA 3PA2A 1N08A 3R95A 2PJ2A 3PRTA 3B3SA 3B35A 1RTQA 4PSXA 1YLEA 2X6XA 2P6FA 1FT7A 4YWYA 4HNWB 3CD6B 1DE4C 4ZI6A 5J1QA 3WNBA 4F0XA 2OZGA 2V7UA 2OK8A 4NFRA 5F4OA 2R1IA 5A88A 4KVME 2V7WA 3CC4B 3A3BA 5DN6A 3KHXA 3GLJA 2X3UA 1FNCA 2OZHA 1YI2B 5D29A 4YRHA 2GFQA 3SEJA 4KOTA 1CX8A 3H5ZA 2VJJA 3NFZA 3ZC3A 3RYOA 4AVBA 3OEHA 4H6ZA 3V76A 5ELYA 3T8WA 3IO1A 3BY1A 5A27A 3OAAA 2WPDA 4OOSA 5JGFA 1XRYA 3K9TA 1M44A 4HE6A 2DETA 3IWEA 3KI9A 1M4IA 2C4UA 1IICA 3B3CA 4PQAA 3SJGA 1OZPA 1WTHD 3DGVA 2GLFA 1DDIA 3AGQA 3L2NA 2Q4ZA 3KEWA 1NJID 3HLPA 4QVJA 4DK0A 1SM4A 1WWZA 4LBWA 2Z3LA 3PBBA 2D9RA 4AF6A 1S7FA 1QFYA 2VBVA 1UMKA 2CNMA 1KUXA 5EBVA 1ZG7A 1LAPA 5CNPA 5G21A 4PC3A 3BQJA 1Z8TA 3GIRA 4TSFA 2HQYA 5LMZA 2Z3MA 3KHZA 2ZW4A 1Z8LA 4CYQA 3WNCA 1S7KA 1EFCA 1OGJA 3EY5A 1VQOB 1XEBA 3CCUB 1F60A 3G4SB 2Q4YA 1NSAA 3TTHA 3SJFA 3KKWA 2RFHA 4A33A 1G7SA 3AVWA 1CPSA 3BY2A 2B5OA 4PABA 3TCVA 2WPXA 2OOTA 4XN0A 1F57A 1W0JA 4ZGYB 4X06A 1CBXA 1GAWA 5J35A 5J3OA 2CC2A 1MABA 4ZGNB 3C26A 5AG4A 1QG0A 1G7CA 3LQ6A 2WSAA 3MRUA 2BCOA 4UEZA 3VNVA 4X05A 3QSYA 8CPAA 2V7VA 4PC1A 2HV2A 3LWUA 3PFEA 4BMHA 3IWGA 4PK2A 2F43A 3R6KA 4I49A 2FIAA 2CRVA 3ZPNA 4P2NA 2V77A 1XIXA 1ZG8A 3W2GA 2ZOFA 4MI4A 4XPDC 3VH9A 1DTDA 4P4DA 3FJOA 3VNUA 1BO4A 2OTLB 5KSWB 4Z4ZA 1Z2LA 1CQXA 3CXSA 4XPDB 1JNYA 3CPXA 4XR6A 4NGTA 4C2XA 1VQ6B 3PUNA 2ZTGA 2R98A 1YITB 2R7HA 2W6JA 2AFWA 3A8IA 1KK0A 1F2OA 2CBXA 1ARLA 4XPKA 2VI7A 1V5VA 1AMOA 4KLWA 2PJ8A 5E96A 4KSFA 1R5NA 2ZXHA 1YSJA 3QFTA 1XMTA 3A3GA 2CK3A 1K4JA 4FBEA 3I56B 4MHYA 4X07A 1KMHA 4OLLA 1KUVA 4M1KA 4MHNA 2C2WA 1KK2A 1OHHA 3WYAA 4B48A 5H86A 2BN4A 1QX4A 1Z5RA 5C82A 4Z4TA 1HDQA 3K2KA 1A2ZA 3R6JA 3KR5A 3ZZ0A 4K1XA 4WZLA 3JQQA 2NSMA 4A32A 3FMCA 5B6IA 1T6YA 4JMQA 5TRDA 3NH5A 3CXPA 4MYUA 3FPKA 4YAWA 3E0KA 3G3SA 3OZUA 7CPAA 5HVGA 4NSQA 3V8IA 1N05A 4Y7CA 2ODFA 3DR8A 2Q7SA 1S72B 2VXKA 2ZXVA 2FE7A 4TMVA 3V7ZA 5G1ZA 1LCPA 4ACBA 3FH4A 2EK8A 2OBTA 4YGOA 3DDYA 2CNDA 3PB7X 2BF4A 2DYIA 1IHMA 4DQKA 2BSWA 4MHDA 4X5KA 1E3ZA 4WJBA 1BX1A 4F6AA 4WZKA 4RI1A 4TT3A 3JU4A 3TX8A 2PIZA 2ZZEA 3VO2A 1VQKB 2I79A 2X8KA 3WT4A 2H5MA 5LRKA 2YWHA 5JBQA 2FCKA 2GJRA 5LYIA 1P4MA 1XBUA 4QB9A 4TN1A 4OOVA 1UD2A 4B3GA 5D8NA 1BPNA 4RDJA 4XORA 1K9MD 2D3NA 1VLOA 2ZEOA 4P3IA 3Q39A 1I8DA 2C1CA 3FX6A 1EWYA 1S0UA 4NGNA 2CNTA 3ZUGA 4CPAA 4DJLA 1QUEA 5G20A 3B78A 4JXQA 1IB1E 2PJ7A 4LQGA 4ZY2A 1GHEA 3CCEB 3CP2A 3PA1A 2ZENA 4LQ6A 1IY7A 2OK7A 2ZBVA 3KQXA 4RLZA 2AFZA 2ZELA 2CTBA 4KOYA 2GU2A 3FIXA 3CCLB 4NGRA 3BXMA 4P4FA 2ARHA 3CCVB 3H94A 4C0SA 5F09A 5LYFA 4OIWA 4ZY1A 1IOIA 1W35A 5FL7A 3VMFA 3CZXA 3NE7A 4ZX9A 2OTJB 1H8LA 1QSOA 3QAHA 2VBSA 2B5GA 3EXNA 4KZTA 4A30A 1OB2A 1TIQA 2P0WA 3ZJ0A 3KL9A 1PKVA 1S60A 4P44A 2PJ1A 4JD6A 1XQBA 1B23P 1Z9UA 3J81k 3PP9A 4DQLA 3SXOA 1M4GA 4HIZA 1QGYA 3FB3A 2VNKA 1B87A 4PPZA 1Z8WA 3SJPA 4Q7JB 3OE7A 3D4UA 1NDHA 3CMEB 1Q2YA 2QA4B 3BI0A 2G3TA 4Q36A 5KW9A 4A2ZA 1Q7YD 3S9MA 3S9NA 4FXUA 4B14A 1N0UA 1R5BA 1EFUA 5THWA 4Y9RA 3CCMB 1N06A 2Z0ZA 1YMEA 4CGNA 2PR1A 4JWPA 1ZM3A 3Q3AA 3P2FA 4QUZA 1IB0A 3B3TA 2AFOA 2AFMA 1TXRA 4KKUA 1KTVA 4M3SA 3G05A 1VQ8B 2HLDA 3IJ3A 1UD5A 3A9LA 2F1LA 4OMEA 4J3GA 4ONWA 4LC0A 1RQRA 4X3RA 3DDDA 1YREA 3CRZA 4MCSA 4E8OA 1T6ZA 4OP7A 3PUMA 1OBRA 4DNCA 4EWTA 2B58A 3R9GA 5IYQA 4PSWA 2BPOA 4A94A 1XE1A 4TNUA 4XLFA 4RCZA 3ZBUA 4A31A 1S5KA 1D1NA 2DY1A 1MK4A 3N7ZA 2G3AA 3QAYA 2WR8A 2I1LA 2B4BA 3S6KA 1E79A 4OOXA 3KR4A 1R57A 4EVYA 4CAFA 5KTCA 3HUVA 2AFSA 4PC6A 1NB9A 4AF7A 5H84A 4C2YA 5F47A 2DOGA 4IF5A 4OKOA 2BM0A 3IC1A 3IU2A 2BO9A 4FUUA 1V0CA 4P4EA 1Q86D 4MCRA 2DCUA 4PAAA 1FRNA 1Y9KA 2ABZA 1XJOA 3AVTA 2JBKA 1KQSB 5IYPA 1KZLA 3ONYA 2GANA 1Q82D 3ZZTA 2GE3A 3P2HA 5LYDA 3ZBTA 3LODA 4KOWA 2X7BA 4P4BA 3GVJA 4Y9UA 3A1PA 2I00A 1N0VC 4N3NA 3OOCA 4YHBA 4II9A 2B4DA 3A8JA 1BX0A 3ASSA 3FPPA 2F4NA 1WP6A 4KOXA 3D68A 4CYOA 2GK6A 2PE3A 5BSYA 4B11A 2X6YA 2PJCA 2ZL5A 1J4JA 4XOTA 2GREA 5TY0A 2OBSA 3S9LA 1ZM9A 3RNZA 2EFGA 5IX3A 4LUAA 3D67A 2IMOA 4YELA 1VHOA 1YJNB 1S3ZA 4UBRA 2XOKA 3RZAA 4G1BA 4X0CA 2RC6A 4MHZA 4PC2A 3RBUA 1MJBA 5THXA 2XEIA 2CNSA 1EFTA 1E3XA 4XQFA 2PRQA 1DDGA 3D2MA 5A89A 1KD1D 2VL1A 2V4DA 1VQNB 1XE4A 4XNHC 2LZJA 3R1KA 2HCJB 3W5UA 3H9NA 4TKOB 1PYTB 2ZEDA 2ZZGA 5FA6A 3SHPA 4LBVA 3OJXA 4XNHB 3KZWA 1VQ7B 4ZCMA 1E1RA 4AVAA 2K5TA 4F0YA 4CGPA 4R3LA 4G5GA 3ISZA 3WQZA 4P1VA 4RD2A 2FXFA 5AG6A 2V7QA 3GIUA 2VQYA 1XF8A 3BJ8A 2HDNB 3GVLA 2WZPP 2P6GA 1G7TA 4KUBA 1D8TA 5AN9A 4WZTA 2QDXA 2Q43A 1R5OA 1TF8A 2X85A 4XLHA 3ISXA 2D74A 5IV0A 2Q44A 1E43A 4XKWA 4Z4WA 1NRKA 5FIUA 4RPBA 2BV3A 2J8MA 3T56B 1M1KD 3U2QA 1EP3B 3B3VA 3F5BA 5BWAB 3NA6A 3GY9A 4DYOA 2EIXA 1JQGA 4BPRA 2RC4A 2VZYA 3PB4X 5I4MA 3OEEA 1KJZA 1Y0RA 5HH1A 4XOPA 4OC4A 2C6GA 4KOVA 5HXDA 5FVJA 4ZGQB 4U9UA 3WBKA 4C2ZA 4M0LA 2FS5A 1I21A 2I3CA 4OP4A 1R43A 3CC2B 1N71A 4HNXB 4H9GA 3W6XA 3B8GA 3VR6A 2FT0A 3SXNA 4ONUA 2FSRA 3WXMA 3Q6QA 1QSMA 3MCAA 5AGEA 1YK3A 1YGHA 3CMMA 4JZ0A 3HAGA 1ZLIA 4KLVA 1QFJA 4A39A 1WOSA 4E0AA 4P10A 4GM5A 4P4JA 4RS2A 1PCAA 4RDLA 4QC6A 2C78A 3PZJA 1NSLA 3WC6A 2JDCA 2PR8A 1BMFA 3OW7A 5H5JA 2Z3PA 5K8OA 1TKFA 3QE2A 2PLFA 2M5SA 5DWMA 4U5YA 2ZL7A 4XLAA 2ZEEA 1EP1B 4Y49C 1VQPB 4R76A 2V31A 4UFWA 1TUIA 1I7PA 1M4DA 4Y49B 4X7CA 4CYPA 5TV2A 2BUEA 2WSSA 4X7EA 3IWWA 5JPHA 1CNEA 1GJRA 4Z65A 4R3KA 1U6MA 1JWQA 4P22A 2Z3OA 1ZM2A 4MRIA 1EFRA 3FJUA 1XOVA 4FD4A 1AUGA 4RN7A 3FF3A 3SLNA 2KCWA 1QSNA 4U9ZA 3S6FA 3AVUA 1B2RA 4HE5A 4Q7AA 4M4SA 2CW5A 5FO1A 2B3VA 4N3GA 4C43A 3T53B 3R96A 3OZWA 2C5HA 3FEEA 4ACAA 3W2FA 3B3WA 4G7WA 3BH4A 2NYQA 1DG1G 2QMUA 4P26A 4MFPA 2JDDA 5IYRA 4B4DA 1BJKA 4C7IA 4G7XA 3CP8A 1Q2DA 2FIWA 1CG2A 3SI2A 1QSRA 4UZFA 3TFYA 2O28A 4KSAA 3WABA 1ON0A 4KOUA 2G9DA 4Q38A 1AMPA 4CRYB 3QFRA 4JJXA 1W0KA 3D7FA 2DERA 1YW4A 2CXAA 2QVPA 1YQEA 3TOAA 2GQFA 4B6ZA 3FBUA 3TC8A 2QGGA 3T9YA 4CAVA 2B7BA 4UAJA 4H6UA 2PMDA 5BSXA 2A4NA 4B5PB 4XMYA 4P6YA 4IAVA 2C6CA 1TLLA 2YWFA 4U9YA 2OBRA 2QMLA 3T51B 2VNJA 1PJ5A 1IOFA 3IGRA 5EC4A 3PENA 3TO9A 3DR6A 1PJ7A 4NNJA 2XEFA 2D4OA 6CPAA 3LMSA 2R8VA 5AG5A 1UFHA 4PXCA 2PJ0A 4L89A 4M6IA 3IIBA 1LAMA 1GO2A 3CXQA 5IB9A 1EP2B 2WUUA 1VHEA 5IB0A 3R9EA 2JJ1A 4TMWA 5CDFA 3QB8A 5JQ4A 2GJKA 4QVAA 4QV2A 2RB7A 4C68A 2ZW7A 1X12A 5H59A 4UZEA 3I1FA 4UCMA 2VBUA 4TWEA 5LRGA 3FECA 1QUFA 4MFQA 4L8AA 4RPDA 5HVHA 2BOAA 3DNSA 4RM0A 2Q0YA 2VNIA 4B10A 3W91A 2DXQA 2XNCA 4P3YA 1VLYA 2REFA 3WC7A 2JEWA 2BVNA 2CTCA 4MFJA 3CW2A 4B44A 1Q2CA 1A8PA 3IU1A 4K3NA 4EMEA 3U6BA 1ZM4A 1I12A 4ORFA 3TOBA 5L46A 2NV4A 2C5BA 1TKHA 3QFSA 2Q6OA 2W6IA 1XFOA 3ASQA 4Z4VA 3FRMA 3MHPA 3D66A 4KVOE 2PJ9A 2JDIA 1CM0A 1Q9SA 5LYLA 4UWIA 3AVYA 4B43A 3GKRA 1W9XA 4M6GA 2XZOA 3GB0A 4XNFA 1YR0A 2QE7A 4UWJA 3SI1A 4NJRA 2VYQA 2DPTA 3B82A 2NMTA 4AXVA 5HKKA 4MHPA 4CQJA 1WPCA 1K73D 1KC8D 1HEEA 1YX0A 2CIJA 4J0QA 5DS0A 2DPSA 1SKYB 1Y7EA 4XKVA 3ASRA 3A35A 1IYLA 1RXTA 1PJ6A 3W2IA 4ZX8A 4F7DA 4LBYA 2GLJA 4R57A 4RDKA 3Q38A 1N07A 5IYNA 4R71A 3LVBA 1KRHA 2PIYA 5FNZA 3W6SA 4R6TA 1P0HA 3W5VA 4OADA 3QNVA 4RCYA 3OW2B 3CT9A 3CXCB 2GIVA 1CNFA 3MN8A 2QJ8A 2FL4A 2RC5A 1BPMA 1UD3A 4ZY0A 1GR1A 4QHYA 2JIZA 3RO0A 3EC4A 3PBEA 3B8HA 1BOBA 2JN9A 3DLJA 1ZLHA 2EO8A 4ZBGA 1E63A 3D3SA 4OC2A 1BQEA 3QFCA 2O4HA 5GCNA 4PC7A 3OZVA 2VZZA 3RAMA 4CYNA 4JXRA 3AVVA 4YAUA 1EXMA 4L8JA 3JRUA 1BAVA 3KQZA 4KUAA 4PXBA 4LBZA 4OC3A 4B13A 2F7VA 2PJ5A 1S4MA 1H85A 3JVNA 4Z4UA 3JUWA 3CCSB 4F8ZA 1D2EA 3GQBA 3IEHA 1IIDA 1S7NA 2OYNA 4P12A 2ZEPA 1E62A 2GPJA 3D26A 4FWTA 1ELMP 4H2KA 2VEZA 1YX2A 1UWYA 4UZUA 5LRJA 2XZLA 2E1BA 1KZFA 1VQLB 3Q6RA 4BINA 2QN6A 3BI1A 4JYWA 4NJQA 1H8HA 4XN3A 2PQ8A 1FX0A 4UFXA 2ZZQA 4MBUA 1V0EA 3V7AA 4UIAA 3S6GA 3F8KA 4F9VA 4B12A 2X53S 4R8FA 4X7FA 2JEVA 2YNCC 4OPVA 4UEEA 4DNTB 2Z10A 2XGJA 2AE6A 4HPSA 4TMXA 4RD3A 4RD0A 2PJBA 1ZG9A 1MJ9A 2IL4A 5A8AA 5JM6A 1YHQB 4G1PA 4FD7A 4Z4RA 3LQEA 4YFJA 2QYVA 4EH1A 4X2TA 3IFEA 2XEXA 1YJWB 1K28D 2PDOA 4FK8A 3UY5A 1EE3P 3FEDA 1QH0A 2POKA 4MCQA 5GV8A 2PJ3A 1L0CA 1AIPA 2DEAA 2PCUA 4P45A 2J8NA 2EBJA 1M4LA 2WJYA 4RD1A 2BGJA 2FX3A 1FNDA 1BLIA 3P26A 2OZUA 2XEJA 2R6HA 3JQPA 3MGDA 3B2YA 3W2HA 2Z3KA 5EMNA 1X10A 4K30A 4OC5A 4AVCA 2VBTA 1GYTA 2AFUA 3PB6X 4ZYQA 4CRZB 2ZEHA 5F4JA 1ARMA 4B3XA 1VGYA 4RD4A 4CGLA 1CJWA 2DIEA 4P6VF 2YGWA 2ZEGA 1VKCA 1K8AD 1H8EA 4BD9A 4IK2A 4KSIA 1VHSA 1HA3A 4OPOA 3H8FA 4PV6A 3TE4A 4ASUA 4X8IA 4CGOA 3TT2A 3OWCA 3JQRA 4XPLA 2QTLA 4II3A 5J8CA 1H42A 4W9YA 2G0BA 1MRZA 2XNJA 4M6HA 3LNNA 3GVKA 4MJ8A 1VQ9B 4JLYA 1VQ4B 3WR7A 3OP1A 1OB5A 4MFZA 1YLOA 1QVGB 1WSRA 4G6IA 4X7DA 4LX9A 2ATRA 1F20A 2JLMA 4II2A 2V7XA 1M1DA 2QTZA 1VJSA 4OC1A 4YXWA 5I0CA 3G8WA 2C6PA 4QFMA 4AG9A 1FDRA 2X0KA 5F4MA 1OB0A 1NB0A 4UA3A 3CC7B 2WZNA 1GVHA 3ASTA 4PXEA 4BBHA 1E1QA 2BGIA 2ZBUA 4FD6A 3BJ7A 1WU8A 2J9AA 4XONA 3CCJB 4E2AA 2WPWA 3KASA 2BL1A 4XLCA 1CPXA 1TF9A 4AB7A 3ZZIA 1U2RA 3LACA 4M85A 2OU2A 1T6XA 4XLEA 2OR4A 1PUAA 4XM3A 3SKBA 5HZAA 5TR9A 3KGQA 2EUIA 2O53A 4C7HA 3FKSA 2Z3NA 4MXUA 4CAWA 2PVVA 1W2BB 1WSVA 5K8NA 5F46A 4Z1MA 3PB9X 5JH9A 4ZCIA 2ZEMA 4NF1A 3H8EA 1Q7LA 3W5HA 4NGSA 1W87A 2C77A 2P6EA 1FNOA 3JTKA 1FY7A 2AFXA 2D4PA 4KVXA 3WBJA 2AJ6A 1RO5A 3W2EA 1NMTA 4RD6A 5CPAA 4UEFA 2VJIA 2V8DA 1GAQA 5C88A 1LOKA 2Q6IA 4DUKA 3G71B 4ROXA 3GYAA 2YNEA 1NE9A 1KK1A 1JJ2B 1WOOA 3PFOA 2AHOA 1VQMB 5ISVA 1RQPA 4FD5A 4NGQA 5K8MA 3G6EB 4QUSA 2C27A 3GUXA 1YVOA 1LFWA 4PGOA 1JA0A 1T5EA 4UCPA 3TO6A 2ZEFA 1AYEA 1IYKA 3D7GA 1XMBA 4PK3A 4WZEA 4QBJA 1YJ9B 4UCNA 2GJPA 1YIJB 4PXDA 3E1YE 2C4TA 3SJZA 4KKTA 2Q7BA 3ASPA 3AGPA 5E6TA 4TMTA 4DNRB 4HNYB 4NXYA 3SLDA 3WC5A 1ELLP 3D2PA 2V7TA 4IW3B 3BC9A 2CY2A 2DF5A 3NH8A 2IQ6A 3I3GA 4M53A 4CGMA 2HB6A 4A37A 1P4NA 2YNDA 3TO7A 1QSTA 4QVTA 2PIAA 2YWGA 3CPAA 3EO4A 5IYWA 2VBQA 2PVWA 4IHMA 2P3MA 1HZEA 5A28A 5HXBA 4B5PA 2XNDA 2OB0A 2YWEA 3WY9A 3CCRB 1V0FA 2VZLA 3F0AA 2DEUA 1CP6A 3CTAA 2BSAA 4MYTA 5G22A 1QGZA 3OKXA 3VWDA 4YAFA 1LANA 4DK1A 2REEA 1HDUA 4G1VA 4HKFA 3SJXA 2Q51A 1KUYA 3PVDA 2F8HA 4IUSA 1M90D 3CESA 4Z4SA 4WWVA 1IJEA 1S7LA 2F5IA 1QGAA 4CS0B 1Z4EA 4P25A 4NCNA 3D7HA 2HUZA 1Y7RA 4EFDA 4CAXA 2PJ4A 4OAEA 3A8KA 1COWA 2B3UA 2ZL6A 3GSIA 1WK4A 1UD4A 1W34A 4NCZA 4YAOA 1NBMA 1QQ9A 4YEJA 2Q6KA 3FXTA 4YU9A 3BNWA 1FNBA 3PGPA 5F48A 5F49A 2PC1A 1Q81D 4MY3A 4A38A 4H89A 4UIBA 4GQNA 1F2PA 4MCPA 2KVOA 2ZTNA 1Z4RA 3I55B 3DSBA 3NH4A 2WJVA 2B7CA 1QVFB 3RY8A 1FRQA 2V8VA 4MFLA 1Z8XA 1KWMA 4AG7A 5AG7A 4B5OA 2PJAA 2BM1A 3CPWB 4R7MA 3ES9A 2BMWA 2Z11A 3NE8A 2OH1A 4WQMA 3OFNA 3PB8X 2QECA 1R3NA 4GS4A 1FNMA 3E20A 5DSZA 2ZW5A 3FVLA 2QEXB 4FAIA 3T90A 4AVZA 2X6WA 3ZIAA 2XZPA 5FO0A 3H8GA 3R9FA 2VNHA 4RJLA 3VO1A 4MMOA 2EWBA 2PRBA 2J8RA 4MFKA 5KNLA 1MJAA 3D8PA 4R9MA 4P9SA 2ZOGA 4OC0A 2ZXIA 4CAEA 2ZITA 1WORA 2B5GB 3CB4A 3I1UA 3LD2A 3VWEA 2Q4VA 1YVKA 1Y0YA 2Q04A 2PSWA 1LRZA 3VATA 1ZUNB 1UD6A 1VQ5B 1WOPA 1G7RA 3MMPA 4R87A 3LO8A 4M2LA 2ANPA 4MY0A 1VIXA 1Y9WA 2Q6LA 5HMNA 4B47A 1QFZA 4ZCLA 4A95A 4F9UA 3BCFA 3I9SA 2D3LA 2EK9A 2JBJA 4P4IA 4OIDA 4UFVA 4AC9A 2EVNA 1B6BA 4ZV4A 2ZZFA 1WDTA 3ONUA 1SQHA 1HVXA 1ELOA 5K8PA 5EMIA 2HMAA 3K9UA 2E1RA 3VARA 2ZPAA 1E64A 3BCDA 3AVXA 3SI0A 2NPFA 1J9ZA 4NBSA 4OPSA 5CBMA 2WYRA 3H4QA 4RUHA 1I1DA 2Y0MA 4GXHA 4TMZA 1XB2A 4NGMA 2R9VA 2ZW6A 1JB9A 3OPOA 2BEIA 2V8HA 5KTDA 1KK3A 3WNDA 4E0FA 2IJZA 1BLLE 3FNCA 3BLNA 1BPLA 2JJ2A 4FN5A 1VF7A 2CF4A 4KS9A 2GK7A 2HC9A 3S6HA 4NGPA 2B4DB 1QMUA 3NE5B 2FVGA 3CDXA 2YNCA 1UD8A 1IGBA 5DWNA 3BHXA 5IK2A 2XEGA 4KKSA 3ZZUA 1TTTA 4XD7A 4NEXA 3FYNA 1TKJA 3N5FA 5KTAA 3SJEA 1SKQA 3B7IA 4XL9A 4FWUA 3OJWA 3PEIA 3CCQB 2PJ6A 5J8FA 3D7DA 1N8RD 2F1MA 1JA1A 2J7KA 1YW6A 2QIRA 2Z6BD
chains in the Genus database with same CATH topology
5THWA 2OR4A 2V8GA 5HVFA 1CP7A 1YMEA 2XEFA 3KGQA 2O53A 6CPAA 3LMSA 4MXUA 2PVVA 3B3TA 5K8NA 2AFOA 4PXCA 2AFMA 3PB9X 5JH9A 2ZEMA 4O23A 2PJ0A 1TXRA 3H8EA 4UF4A 1Q7LA 3IIBA 4NGSA 1LAMA 3V38A 5IB9A 1FNOA 1VHEA 3IJ3A 4OMEA 4ONWA 2AFXA 4X3RA 2PJ2A 3PRTA 2RB7A 4MCSA 3B3SA 3B35A 1RTQA 4TWEA 5LRGA 5CPAA 4UEFA 1OBRA 3FECA 4EWTA 5HVHA 2V8DA 1FT7A 4YWYA 4A94A 1LOKA 2BOAA 4TNUA 4DUKA 1DE4C 4ZI6A 5J1QA 3PFOA 4NFRA 4NGQA 5K8MA 3WC7A 2JEWA 3KHXA 2CTCA 3GUXA 1LFWA 3KR4A 3GLJA 3HUVA 2AFSA 4K3NA 4EMEA 2ZEFA 5D29A 4OKOA 1AYEA 3IC1A 4FUUA 2BO9A 1XMBA 3D7GA 1CX8A 4P4EA 3NFZA 4PXDA 4MCRA 1TKHA 1XFOA 2ABZA 1XJOA 2JBKA 5ELYA 3T8WA 3D66A 3IO1A 2PJ9A 3WC5A 1ELLP 5LYLA 5JGFA 1XRYA 3K9TA 5LYDA 3GB0A 3NH8A 2IQ6A 4P4BA 3KI9A 3B3CA 3SJGA 4PQAA 3SI1A 4NJRA 4AXVA 3DGVA 4MHPA 2HB6A 2GLFA 4A37A 3L2NA 2Q4ZA 1HEEA 3HLPA 3D68A 3CPAA 2PE3A 2CIJA 5DS0A 2PVWA 3PBBA 1Y7EA 4IHMA 2PJCA 2GREA 3S9LA 4ZX8A 1ZG7A 2GLJA 1LAPA 3D67A 1CP6A 2IMOA 1VHOA 2PIYA 3KHZA 1LANA 3RZAA 4R6TA 1HDUA 1Z8LA 4MHZA 3QNVA 3SJXA 3RBUA 2Q51A 3CT9A 2XEIA 2F8HA 3MN8A 1NSAA 4WWVA 2QJ8A 1BPMA 3SJFA 4ZY0A 2PRQA 2RFHA 2VL1A 3D7HA 3PBEA 4EFDA 1CPSA 2PJ4A 1PYTB 2ZEDA 3DLJA 1ZLHA 2OOTA 1F57A 1QQ9A 4YU9A 3KZWA 4OC2A 1CBXA 2O4HA 4A38A 3RAMA 4UIBA 3MRUA 3ISZA 1F2PA 4MCPA 2BCOA 4UEZA 3JRUA 1BAVA 3KQZA 8CPAA 4PXBA 3LWUA 3PFEA 4OC3A 3NH4A 2V8VA 2F7VA 1KWMA 2PJ5A 2V77A 2ZOFA 1ZG8A 2PJAA 3VH9A 4F8ZA 1DTDA 3IEHA 4P4DA 4R7MA 2ZEPA 1Z2LA 3CPXA 2Q43A 1ELMP 4NGTA 1TF8A 4H2KA 1UWYA 3PB8X 3ISXA 5LRJA 1R3NA 2AFWA 1F2OA 1ARLA 3FVLA 3BI1A 4JYWA 4FAIA 2PJ8A 3B3VA 4NJQA 1YSJA 3NA6A 4DYOA 1JQGA 3H8GA 3PB4X 5I4MA 1Y0RA 4FBEA 4MHYA 4OC4A 4UIAA 4MMOA 2EWBA 2C6GA 5HXDA 4F9VA 4MHNA 2ZOGA 4OC0A 4R8FA 2I3CA 4OP4A 1R43A 4UEEA 1Z5RA 1HDQA 3K2KA 3I1UA 3KR5A 1Y0YA 2NSMA 2PJBA 3FMCA 1ZG9A 4JZ0A 3VATA 3NH5A 1ZLIA 4A39A 4P10A 4GM5A 5JM6A 4P4JA 4G1PA 1PCAA 2ANPA 1VIXA 7CPAA 2QYVA 4X2TA 3IFEA 5HVGA 3WC6A 5K8OA 1EE3P 1TKFA 3FEDA 2POKA 3V7ZA 4MCQA 4F9UA 2PJ3A 1LCPA 2DEAA 2PCUA 4P45A 2JBJA 2EK9A 3FH4A 1M4LA 4P4IA 2ZEEA 2EK8A 4OIDA 3PB7X 4R76A 2XEJA 4WJBA 3TX8A 2PIZA 3B2YA 5K8PA 3WT4A 3IWWA 4OC5A 5LRKA 1GYTA 2AFUA 3VARA 3PB6X 5LYIA 4ZYQA 4Z65A 1XBUA 2ZEHA 5D8NA 1ARMA 4MRIA 1BPNA 1VGYA 3SI0A 3FJUA 2ZEOA 5CBMA 2ZEGA 2C1CA 2WYRA 3FF3A 3FX6A 4BD9A 4IK2A 4KSIA 4RUHA 3H8FA 4NGNA 4Q7AA 4CPAA 4DJLA 4X8IA 4NGMA 2PJ7A 4LQGA 4ZY2A 2ZENA 3FEEA 1IY7A 2V8HA 4W9YA 3KQXA 3B3WA 2AFZA 2ZELA 2CTBA 2GU2A 2IJZA 4NGRA 2NYQA 1BLLE 3BXMA 4P4FA 1YLOA 5F09A 5LYFA 4OIWA 1CG2A 3SI2A 4ZY1A 2CF4A 2HC9A 3WABA 2G9DA 4ZX9A 1H8LA 1AMPA 4OC1A 3D7FA 4NGPA 2C6PA 3KL9A 1YW4A 1QMUA 2QVPA 2PJ1A 4P44A 2FVGA 3CDXA 1IGBA 4B6ZA 3BHXA 2WZNA 2XEGA 3TC8A 4PXEA 4PPZA 1TKJA 3N5FA 2J9AA 3SJEA 3D4UA 3B7IA 3KASA 4FWUA 4P6YA 3BI0A 4IAVA 2C6CA 3PEIA 3S9MA 3S9NA 1CPXA 1TF9A 2PJ6A 3D7DA 1YW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5THW A;  2OR4 A;  2V8G A;  5HVF A;  1CP7 A;  1YME A;  2XEF A;  3KGQ A;  2O53 A;  6CPA A;  3LMS A;  4MXU A;  2PVV A;  3B3T A;  5K8N A;  2AFO A;  4PXC A;  2AFM A;  3PB9 X;  5JH9 A;  2ZEM A;  4O23 A;  2PJ0 A;  1TXR A;  3H8E A;  4UF4 A;  1Q7L A;  3IIB A;  4NGS A;  1LAM A;  3V38 A;  5IB9 A;  1FNO A;  1VHE A;  3IJ3 A;  4OME A;  4ONW A;  2AFX A;  4X3R A;  2PJ2 A;  3PRT A;  2RB7 A;  4MCS A;  3B3S A;  3B35 A;  1RTQ A;  4TWE A;  5LRG A;  5CPA A;  4UEF A;  1OBR A;  3FEC A;  4EWT A;  5HVH A;  2V8D A;  1FT7 A;  4YWY A;  4A94 A;  1LOK A;  2BOA A;  4TNU A;  4DUK A;  1DE4 C;  4ZI6 A;  5J1Q A;  3PFO A;  4NFR A;  4NGQ A;  5K8M A;  3WC7 A;  2JEW A;  3KHX A;  2CTC A;  3GUX A;  1LFW A;  3KR4 A;  3GLJ A;  3HUV A;  2AFS A;  4K3N A;  4EME A;  2ZEF A;  5D29 A;  4OKO A;  1AYE A;  3IC1 A;  4FUU A;  2BO9 A;  1XMB A;  3D7G A;  1CX8 A;  4P4E A;  3NFZ A;  4PXD A;  4MCR A;  1TKH A;  1XFO A;  2ABZ A;  1XJO A;  2JBK A;  5ELY A;  3T8W A;  3D66 A;  3IO1 A;  2PJ9 A;  3WC5 A;  1ELL P;  5LYL A;  5JGF A;  1XRY A;  3K9T A;  5LYD A;  3GB0 A;  3NH8 A;  2IQ6 A;  4P4B A;  3KI9 A;  3B3C A;  3SJG A;  4PQA A;  3SI1 A;  4NJR A;  4AXV A;  3DGV A;  4MHP A;  2HB6 A;  2GLF A;  4A37 A;  3L2N A;  2Q4Z A;  1HEE A;  3HLP A;  3D68 A;  3CPA A;  2PE3 A;  2CIJ A;  5DS0 A;  2PVW A;  3PBB A;  1Y7E A;  4IHM A;  2PJC A;  2GRE A;  3S9L A;  4ZX8 A;  1ZG7 A;  2GLJ A;  1LAP A;  3D67 A;  1CP6 A;  2IMO A;  1VHO A;  2PIY A;  3KHZ A;  1LAN A;  3RZA A;  4R6T A;  1HDU A;  1Z8L A;  4MHZ A;  3QNV A;  3SJX A;  3RBU A;  2Q51 A;  3CT9 A;  2XEI A;  2F8H A;  3MN8 A;  1NSA A;  4WWV A;  2QJ8 A;  1BPM A;  3SJF A;  4ZY0 A;  2PRQ A;  2RFH A;  2VL1 A;  3D7H A;  3PBE A;  4EFD A;  1CPS A;  2PJ4 A;  1PYT B;  2ZED A;  3DLJ A;  1ZLH A;  2OOT A;  1F57 A;  1QQ9 A;  4YU9 A;  3KZW A;  4OC2 A;  1CBX A;  2O4H A;  4A38 A;  3RAM A;  4UIB A;  3MRU A;  3ISZ A;  1F2P A;  4MCP A;  2BCO A;  4UEZ A;  3JRU A;  1BAV A;  3KQZ A;  8CPA A;  4PXB A;  3LWU A;  3PFE A;  4OC3 A;  3NH4 A;  2V8V A;  2F7V A;  1KWM A;  2PJ5 A;  2V77 A;  2ZOF A;  1ZG8 A;  2PJA A;  3VH9 A;  4F8Z A;  1DTD A;  3IEH A;  4P4D A;  4R7M A;  2ZEP A;  1Z2L A;  3CPX A;  2Q43 A;  1ELM P;  4NGT A;  1TF8 A;  4H2K A;  1UWY A;  3PB8 X;  3ISX A;  5LRJ A;  1R3N A;  2AFW A;  1F2O A;  1ARL A;  3FVL A;  3BI1 A;  4JYW A;  4FAI A;  2PJ8 A;  3B3V A;  4NJQ A;  1YSJ A;  3NA6 A;  4DYO A;  1JQG A;  3H8G A;  3PB4 X;  5I4M A;  1Y0R A;  4FBE A;  4MHY A;  4OC4 A;  4UIA A;  4MMO A;  2EWB A;  2C6G A;  5HXD A;  4F9V A;  4MHN A;  2ZOG A;  4OC0 A;  4R8F A;  2I3C A;  4OP4 A;  1R43 A;  4UEE A;  1Z5R A;  1HDQ A;  3K2K A;  3I1U A;  3KR5 A;  1Y0Y A;  2NSM A;  2PJB A;  3FMC A;  1ZG9 A;  4JZ0 A;  3VAT A;  3NH5 A;  1ZLI A;  4A39 A;  4P10 A;  4GM5 A;  5JM6 A;  4P4J A;  4G1P A;  1PCA A;  2ANP A;  1VIX A;  7CPA A;  2QYV A;  4X2T A;  3IFE A;  5HVG A;  3WC6 A;  5K8O A;  1EE3 P;  1TKF A;  3FED A;  2POK A;  3V7Z A;  4MCQ A;  4F9U A;  2PJ3 A;  1LCP A;  2DEA A;  2PCU A;  4P45 A;  2JBJ A;  2EK9 A;  3FH4 A;  1M4L A;  4P4I A;  2ZEE A;  2EK8 A;  4OID A;  3PB7 X;  4R76 A;  2XEJ A;  4WJB A;  3TX8 A;  2PIZ A;  3B2Y A;  5K8P A;  3WT4 A;  3IWW A;  4OC5 A;  5LRK A;  1GYT A;  2AFU A;  3VAR A;  3PB6 X;  5LYI A;  4ZYQ A;  4Z65 A;  1XBU A;  2ZEH A;  5D8N A;  1ARM A;  4MRI A;  1BPN A;  1VGY A;  3SI0 A;  3FJU A;  2ZEO A;  5CBM A;  2ZEG A;  2C1C A;  2WYR A;  3FF3 A;  3FX6 A;  4BD9 A;  4IK2 A;  4KSI A;  4RUH A;  3H8F A;  4NGN A;  4Q7A A;  4CPA A;  4DJL A;  4X8I A;  4NGM A;  2PJ7 A;  4LQG A;  4ZY2 A;  2ZEN A;  3FEE A;  1IY7 A;  2V8H A;  4W9Y A;  3KQX A;  3B3W A;  2AFZ A;  2ZEL A;  2CTB A;  2GU2 A;  2IJZ A;  4NGR A;  2NYQ A;  1BLL E;  3BXM A;  4P4F A;  1YLO A;  5F09 A;  5LYF A;  4OIW A;  1CG2 A;  3SI2 A;  4ZY1 A;  2CF4 A;  2HC9 A;  3WAB A;  2G9D A;  4ZX9 A;  1H8L A;  1AMP A;  4OC1 A;  3D7F A;  4NGP A;  2C6P A;  3KL9 A;  1YW4 A;  1QMU A;  2QVP A;  2PJ1 A;  4P44 A;  2FVG A;  3CDX A;  1IGB A;  4B6Z A;  3BHX A;  2WZN A;  2XEG A;  3TC8 A;  4PXE A;  4PPZ A;  1TKJ A;  3N5F A;  2J9A A;  3SJE A;  3D4U A;  3B7I A;  3KAS A;  4FWU A;  4P6Y A;  3BI0 A;  4IAV A;  2C6C A;  3PEI A;  3S9M A;  3S9N A;  1CPX A;  1TF9 A;  2PJ6 A;  3D7D A;  1YW6 A; 
#chains in the Genus database with same CATH topology
 3P27 A;  2V8G A;  1DAR A;  4KOS A;  1TVC A;  5HVF A;  1CP7 A;  1IU8 A;  1OGI A;  1IJF A;  4B3F X;  4YAL A;  1I18 A;  1PU9 A;  4Z4Y A;  4KOR A;  1ZO0 A;  4O23 A;  3U6K A;  3CMA B;  3EFA A;  4UF4 A;  3V38 A;  5GV7 A;  5HZB A;  3PA2 A;  1N08 A;  3R95 A;  2PJ2 A;  3PRT A;  3B3S A;  3B35 A;  1RTQ A;  4PSX A;  1YLE A;  2X6X A;  2P6F A;  1FT7 A;  4YWY A;  4HNW B;  3CD6 B;  1DE4 C;  4ZI6 A;  5J1Q A;  3WNB A;  4F0X A;  2OZG A;  2V7U A;  2OK8 A;  4NFR A;  5F4O A;  2R1I A;  5A88 A;  4KVM E;  2V7W A;  3CC4 B;  3A3B A;  5DN6 A;  3KHX A;  3GLJ A;  2X3U A;  1FNC A;  2OZH A;  1YI2 B;  5D29 A;  4YRH A;  2GFQ A;  3SEJ A;  4KOT A;  1CX8 A;  3H5Z A;  2VJJ A;  3NFZ A;  3ZC3 A;  3RYO A;  4AVB A;  3OEH A;  4H6Z A;  3V76 A;  5ELY A;  3T8W A;  3IO1 A;  3BY1 A;  5A27 A;  3OAA A;  2WPD A;  4OOS A;  5JGF A;  1XRY A;  3K9T A;  1M44 A;  4HE6 A;  2DET A;  3IWE A;  3KI9 A;  1M4I A;  2C4U A;  1IIC A;  3B3C A;  4PQA A;  3SJG A;  1OZP A;  1WTH D;  3DGV A;  2GLF A;  1DDI A;  3AGQ A;  3L2N A;  2Q4Z A;  3KEW A;  1NJI D;  3HLP A;  4QVJ A;  4DK0 A;  1SM4 A;  1WWZ A;  4LBW A;  2Z3L A;  3PBB A;  2D9R A;  4AF6 A;  1S7F A;  1QFY A;  2VBV A;  1UMK A;  2CNM A;  1KUX A;  5EBV A;  1ZG7 A;  1LAP A;  5CNP A;  5G21 A;  4PC3 A;  3BQJ A;  1Z8T A;  3GIR A;  4TSF A;  2HQY A;  5LMZ A;  2Z3M A;  3KHZ A;  2ZW4 A;  1Z8L A;  4CYQ A;  3WNC A;  1S7K A;  1EFC A;  1OGJ A;  3EY5 A;  1VQO B;  1XEB A;  3CCU B;  1F60 A;  3G4S B;  2Q4Y A;  1NSA A;  3TTH A;  3SJF A;  3KKW A;  2RFH A;  4A33 A;  1G7S A;  3AVW A;  1CPS A;  3BY2 A;  2B5O A;  4PAB A;  3TCV A;  2WPX A;  2OOT A;  4XN0 A;  1F57 A;  1W0J A;  4ZGY B;  4X06 A;  1CBX A;  1GAW A;  5J35 A;  5J3O A;  2CC2 A;  1MAB A;  4ZGN B;  3C26 A;  5AG4 A;  1QG0 A;  1G7C A;  3LQ6 A;  2WSA A;  3MRU A;  2BCO A;  4UEZ A;  3VNV A;  4X05 A;  3QSY A;  8CPA A;  2V7V A;  4PC1 A;  2HV2 A;  3LWU A;  3PFE A;  4BMH A;  3IWG A;  4PK2 A;  2F43 A;  3R6K A;  4I49 A;  2FIA A;  2CRV A;  3ZPN A;  4P2N A;  2V77 A;  1XIX A;  1ZG8 A;  3W2G A;  2ZOF A;  4MI4 A;  4XPD C;  3VH9 A;  1DTD A;  4P4D A;  3FJO A;  3VNU A;  1BO4 A;  2OTL B;  5KSW B;  4Z4Z A;  1Z2L A;  1CQX A;  3CXS A;  4XPD B;  1JNY A;  3CPX A;  4XR6 A;  4NGT A;  4C2X A;  1VQ6 B;  3PUN A;  2ZTG A;  2R98 A;  1YIT B;  2R7H A;  2W6J A;  2AFW A;  3A8I A;  1KK0 A;  1F2O A;  2CBX A;  1ARL A;  4XPK A;  2VI7 A;  1V5V A;  1AMO A;  4KLW A;  2PJ8 A;  5E96 A;  4KSF A;  1R5N A;  2ZXH A;  1YSJ A;  3QFT A;  1XMT A;  3A3G A;  2CK3 A;  1K4J A;  4FBE A;  3I56 B;  4MHY A;  4X07 A;  1KMH A;  4OLL A;  1KUV A;  4M1K A;  4MHN A;  2C2W A;  1KK2 A;  1OHH A;  3WYA A;  4B48 A;  5H86 A;  2BN4 A;  1QX4 A;  1Z5R A;  5C82 A;  4Z4T A;  1HDQ A;  3K2K A;  1A2Z A;  3R6J A;  3KR5 A;  3ZZ0 A;  4K1X A;  4WZL A;  3JQQ A;  2NSM A;  4A32 A;  3FMC A;  5B6I A;  1T6Y A;  4JMQ A;  5TRD A;  3NH5 A;  3CXP A;  4MYU A;  3FPK A;  4YAW A;  3E0K A;  3G3S A;  3OZU A;  7CPA A;  5HVG A;  4NSQ A;  3V8I A;  1N05 A;  4Y7C A;  2ODF A;  3DR8 A;  2Q7S A;  1S72 B;  2VXK A;  2ZXV A;  2FE7 A;  4TMV A;  3V7Z A;  5G1Z A;  1LCP A;  4ACB A;  3FH4 A;  2EK8 A;  2OBT A;  4YGO A;  3DDY A;  2CND A;  3PB7 X;  2BF4 A;  2DYI A;  1IHM A;  4DQK A;  2BSW A;  4MHD A;  4X5K A;  1E3Z A;  4WJB A;  1BX1 A;  4F6A A;  4WZK A;  4RI1 A;  4TT3 A;  3JU4 A;  3TX8 A;  2PIZ A;  2ZZE A;  3VO2 A;  1VQK B;  2I79 A;  2X8K A;  3WT4 A;  2H5M A;  5LRK A;  2YWH A;  5JBQ A;  2FCK A;  2GJR A;  5LYI A;  1P4M A;  1XBU A;  4QB9 A;  4TN1 A;  4OOV A;  1UD2 A;  4B3G A;  5D8N A;  1BPN A;  4RDJ A;  4XOR A;  1K9M D;  2D3N A;  1VLO A;  2ZEO A;  4P3I A;  3Q39 A;  1I8D A;  2C1C A;  3FX6 A;  1EWY A;  1S0U A;  4NGN A;  2CNT A;  3ZUG A;  4CPA A;  4DJL A;  1QUE A;  5G20 A;  3B78 A;  4JXQ A;  1IB1 E;  2PJ7 A;  4LQG A;  4ZY2 A;  1GHE A;  3CCE B;  3CP2 A;  3PA1 A;  2ZEN A;  4LQ6 A;  1IY7 A;  2OK7 A;  2ZBV A;  3KQX A;  4RLZ A;  2AFZ A;  2ZEL A;  2CTB A;  4KOY A;  2GU2 A;  3FIX A;  3CCL B;  4NGR A;  3BXM A;  4P4F A;  2ARH A;  3CCV B;  3H94 A;  4C0S A;  5F09 A;  5LYF A;  4OIW A;  4ZY1 A;  1IOI A;  1W35 A;  5FL7 A;  3VMF A;  3CZX A;  3NE7 A;  4ZX9 A;  2OTJ B;  1H8L A;  1QSO A;  3QAH A;  2VBS A;  2B5G A;  3EXN A;  4KZT A;  4A30 A;  1OB2 A;  1TIQ A;  2P0W A;  3ZJ0 A;  3KL9 A;  1PKV A;  1S60 A;  4P44 A;  2PJ1 A;  4JD6 A;  1XQB A;  1B23 P;  1Z9U A;  3J81 k;  3PP9 A;  4DQL A;  3SXO A;  1M4G A;  4HIZ A;  1QGY A;  3FB3 A;  2VNK A;  1B87 A;  4PPZ A;  1Z8W A;  3SJP A;  4Q7J B;  3OE7 A;  3D4U A;  1NDH A;  3CME B;  1Q2Y A;  2QA4 B;  3BI0 A;  2G3T A;  4Q36 A;  5KW9 A;  4A2Z A;  1Q7Y D;  3S9M A;  3S9N A;  4FXU A;  4B14 A;  1N0U A;  1R5B A;  1EFU A;  5THW A;  4Y9R A;  3CCM B;  1N06 A;  2Z0Z A;  1YME A;  4CGN A;  2PR1 A;  4JWP A;  1ZM3 A;  3Q3A A;  3P2F A;  4QUZ A;  1IB0 A;  3B3T A;  2AFO A;  2AFM A;  1TXR A;  4KKU A;  1KTV A;  4M3S A;  3G05 A;  1VQ8 B;  2HLD A;  3IJ3 A;  1UD5 A;  3A9L A;  2F1L A;  4OME A;  4J3G A;  4ONW A;  4LC0 A;  1RQR A;  4X3R A;  3DDD A;  1YRE A;  3CRZ A;  4MCS A;  4E8O A;  1T6Z A;  4OP7 A;  3PUM A;  1OBR A;  4DNC A;  4EWT A;  2B58 A;  3R9G A;  5IYQ A;  4PSW A;  2BPO A;  4A94 A;  1XE1 A;  4TNU A;  4XLF A;  4RCZ A;  3ZBU A;  4A31 A;  1S5K A;  1D1N A;  2DY1 A;  1MK4 A;  3N7Z A;  2G3A A;  3QAY A;  2WR8 A;  2I1L A;  2B4B A;  3S6K A;  1E79 A;  4OOX A;  3KR4 A;  1R57 A;  4EVY A;  4CAF A;  5KTC A;  3HUV A;  2AFS A;  4PC6 A;  1NB9 A;  4AF7 A;  5H84 A;  4C2Y A;  5F47 A;  2DOG A;  4IF5 A;  4OKO A;  2BM0 A;  3IC1 A;  3IU2 A;  2BO9 A;  4FUU A;  1V0C A;  4P4E A;  1Q86 D;  4MCR A;  2DCU A;  4PAA A;  1FRN A;  1Y9K A;  2ABZ A;  1XJO A;  3AVT A;  2JBK A;  1KQS B;  5IYP A;  1KZL A;  3ONY A;  2GAN A;  1Q82 D;  3ZZT A;  2GE3 A;  3P2H A;  5LYD A;  3ZBT A;  3LOD A;  4KOW A;  2X7B A;  4P4B A;  3GVJ A;  4Y9U A;  3A1P A;  2I00 A;  1N0V C;  4N3N A;  3OOC A;  4YHB A;  4II9 A;  2B4D A;  3A8J A;  1BX0 A;  3ASS A;  3FPP A;  2F4N A;  1WP6 A;  4KOX A;  3D68 A;  4CYO A;  2GK6 A;  2PE3 A;  5BSY A;  4B11 A;  2X6Y A;  2PJC A;  2ZL5 A;  1J4J A;  4XOT A;  2GRE A;  5TY0 A;  2OBS A;  3S9L A;  1ZM9 A;  3RNZ A;  2EFG A;  5IX3 A;  4LUA A;  3D67 A;  2IMO A;  4YEL A;  1VHO A;  1YJN B;  1S3Z A;  4UBR A;  2XOK A;  3RZA A;  4G1B A;  4X0C A;  2RC6 A;  4MHZ A;  4PC2 A;  3RBU A;  1MJB A;  5THX A;  2XEI A;  2CNS A;  1EFT A;  1E3X A;  4XQF A;  2PRQ A;  1DDG A;  3D2M A;  5A89 A;  1KD1 D;  2VL1 A;  2V4D A;  1VQN B;  1XE4 A;  4XNH C;  2LZJ A;  3R1K A;  2HCJ B;  3W5U A;  3H9N A;  4TKO B;  1PYT B;  2ZED A;  2ZZG A;  5FA6 A;  3SHP A;  4LBV A;  3OJX A;  4XNH B;  3KZW A;  1VQ7 B;  4ZCM A;  1E1R A;  4AVA A;  2K5T A;  4F0Y A;  4CGP A;  4R3L A;  4G5G A;  3ISZ A;  3WQZ A;  4P1V A;  4RD2 A;  2FXF A;  5AG6 A;  2V7Q A;  3GIU A;  2VQY A;  1XF8 A;  3BJ8 A;  2HDN B;  3GVL A;  2WZP P;  2P6G A;  1G7T A;  4KUB A;  1D8T A;  5AN9 A;  4WZT A;  2QDX A;  2Q43 A;  1R5O A;  1TF8 A;  2X85 A;  4XLH A;  3ISX A;  2D74 A;  5IV0 A;  2Q44 A;  1E43 A;  4XKW A;  4Z4W A;  1NRK A;  5FIU A;  4RPB A;  2BV3 A;  2J8M A;  3T56 B;  1M1K D;  3U2Q A;  1EP3 B;  3B3V A;  3F5B A;  5BWA B;  3NA6 A;  3GY9 A;  4DYO A;  2EIX A;  1JQG A;  4BPR A;  2RC4 A;  2VZY A;  3PB4 X;  5I4M A;  3OEE A;  1KJZ A;  1Y0R A;  5HH1 A;  4XOP A;  4OC4 A;  2C6G A;  4KOV A;  5HXD A;  5FVJ A;  4ZGQ B;  4U9U A;  3WBK A;  4C2Z A;  4M0L A;  2FS5 A;  1I21 A;  2I3C A;  4OP4 A;  1R43 A;  3CC2 B;  1N71 A;  4HNX B;  4H9G A;  3W6X A;  3B8G A;  3VR6 A;  2FT0 A;  3SXN A;  4ONU A;  2FSR A;  3WXM A;  3Q6Q A;  1QSM A;  3MCA A;  5AGE A;  1YK3 A;  1YGH A;  3CMM A;  4JZ0 A;  3HAG A;  1ZLI A;  4KLV A;  1QFJ A;  4A39 A;  1WOS A;  4E0A A;  4P10 A;  4GM5 A;  4P4J A;  4RS2 A;  1PCA A;  4RDL A;  4QC6 A;  2C78 A;  3PZJ A;  1NSL A;  3WC6 A;  2JDC A;  2PR8 A;  1BMF A;  3OW7 A;  5H5J A;  2Z3P A;  5K8O A;  1TKF A;  3QE2 A;  2PLF A;  2M5S A;  5DWM A;  4U5Y A;  2ZL7 A;  4XLA A;  2ZEE A;  1EP1 B;  4Y49 C;  1VQP B;  4R76 A;  2V31 A;  4UFW A;  1TUI A;  1I7P A;  1M4D A;  4Y49 B;  4X7C A;  4CYP A;  5TV2 A;  2BUE A;  2WSS A;  4X7E A;  3IWW A;  5JPH A;  1CNE A;  1GJR A;  4Z65 A;  4R3K A;  1U6M A;  1JWQ A;  4P22 A;  2Z3O A;  1ZM2 A;  4MRI A;  1EFR A;  3FJU A;  1XOV A;  4FD4 A;  1AUG A;  4RN7 A;  3FF3 A;  3SLN A;  2KCW A;  1QSN A;  4U9Z A;  3S6F A;  3AVU A;  1B2R A;  4HE5 A;  4Q7A A;  4M4S A;  2CW5 A;  5FO1 A;  2B3V A;  4N3G A;  4C43 A;  3T53 B;  3R96 A;  3OZW A;  2C5H A;  3FEE A;  4ACA A;  3W2F A;  3B3W A;  4G7W A;  3BH4 A;  2NYQ A;  1DG1 G;  2QMU A;  4P26 A;  4MFP A;  2JDD A;  5IYR A;  4B4D A;  1BJK A;  4C7I A;  4G7X A;  3CP8 A;  1Q2D A;  2FIW A;  1CG2 A;  3SI2 A;  1QSR A;  4UZF A;  3TFY A;  2O28 A;  4KSA A;  3WAB A;  1ON0 A;  4KOU A;  2G9D A;  4Q38 A;  1AMP A;  4CRY B;  3QFR A;  4JJX A;  1W0K A;  3D7F A;  2DER A;  1YW4 A;  2CXA A;  2QVP A;  1YQE A;  3TOA A;  2GQF A;  4B6Z A;  3FBU A;  3TC8 A;  2QGG A;  3T9Y A;  4CAV A;  2B7B A;  4UAJ A;  4H6U A;  2PMD A;  5BSX A;  2A4N A;  4B5P B;  4XMY A;  4P6Y A;  4IAV A;  2C6C A;  1TLL A;  2YWF A;  4U9Y A;  2OBR A;  2QML A;  3T51 B;  2VNJ A;  1PJ5 A;  1IOF A;  3IGR A;  5EC4 A;  3PEN A;  3TO9 A;  3DR6 A;  1PJ7 A;  4NNJ A;  2XEF A;  2D4O A;  6CPA A;  3LMS A;  2R8V A;  5AG5 A;  1UFH A;  4PXC A;  2PJ0 A;  4L89 A;  4M6I A;  3IIB A;  1LAM A;  1GO2 A;  3CXQ A;  5IB9 A;  1EP2 B;  2WUU A;  1VHE A;  5IB0 A;  3R9E A;  2JJ1 A;  4TMW A;  5CDF A;  3QB8 A;  5JQ4 A;  2GJK A;  4QVA A;  4QV2 A;  2RB7 A;  4C68 A;  2ZW7 A;  1X12 A;  5H59 A;  4UZE A;  3I1F A;  4UCM A;  2VBU A;  4TWE A;  5LRG A;  3FEC A;  1QUF A;  4MFQ A;  4L8A A;  4RPD A;  5HVH A;  2BOA A;  3DNS A;  4RM0 A;  2Q0Y A;  2VNI A;  4B10 A;  3W91 A;  2DXQ A;  2XNC A;  4P3Y A;  1VLY A;  2REF A;  3WC7 A;  2JEW A;  2BVN A;  2CTC A;  4MFJ A;  3CW2 A;  4B44 A;  1Q2C A;  1A8P A;  3IU1 A;  4K3N A;  4EME A;  3U6B A;  1ZM4 A;  1I12 A;  4ORF A;  3TOB A;  5L46 A;  2NV4 A;  2C5B A;  1TKH A;  3QFS A;  2Q6O A;  2W6I A;  1XFO A;  3ASQ A;  4Z4V A;  3FRM A;  3MHP A;  3D66 A;  4KVO E;  2PJ9 A;  2JDI A;  1CM0 A;  1Q9S A;  5LYL A;  4UWI A;  3AVY A;  4B43 A;  3GKR A;  1W9X A;  4M6G A;  2XZO A;  3GB0 A;  4XNF A;  1YR0 A;  2QE7 A;  4UWJ A;  3SI1 A;  4NJR A;  2VYQ A;  2DPT A;  3B82 A;  2NMT A;  4AXV A;  5HKK A;  4MHP A;  4CQJ A;  1WPC A;  1K73 D;  1KC8 D;  1HEE A;  1YX0 A;  2CIJ A;  4J0Q A;  5DS0 A;  2DPS A;  1SKY B;  1Y7E A;  4XKV A;  3ASR A;  3A35 A;  1IYL A;  1RXT A;  1PJ6 A;  3W2I A;  4ZX8 A;  4F7D A;  4LBY A;  2GLJ A;  4R57 A;  4RDK A;  3Q38 A;  1N07 A;  5IYN A;  4R71 A;  3LVB A;  1KRH A;  2PIY A;  5FNZ A;  3W6S A;  4R6T A;  1P0H A;  3W5V A;  4OAD A;  3QNV A;  4RCY A;  3OW2 B;  3CT9 A;  3CXC B;  2GIV A;  1CNF A;  3MN8 A;  2QJ8 A;  2FL4 A;  2RC5 A;  1BPM A;  1UD3 A;  4ZY0 A;  1GR1 A;  4QHY A;  2JIZ A;  3RO0 A;  3EC4 A;  3PBE A;  3B8H A;  1BOB A;  2JN9 A;  3DLJ A;  1ZLH A;  2EO8 A;  4ZBG A;  1E63 A;  3D3S A;  4OC2 A;  1BQE A;  3QFC A;  2O4H A;  5GCN A;  4PC7 A;  3OZV A;  2VZZ A;  3RAM A;  4CYN A;  4JXR A;  3AVV A;  4YAU A;  1EXM A;  4L8J A;  3JRU A;  1BAV A;  3KQZ A;  4KUA A;  4PXB A;  4LBZ A;  4OC3 A;  4B13 A;  2F7V A;  2PJ5 A;  1S4M A;  1H85 A;  3JVN A;  4Z4U A;  3JUW A;  3CCS B;  4F8Z A;  1D2E A;  3GQB A;  3IEH A;  1IID A;  1S7N A;  2OYN A;  4P12 A;  2ZEP A;  1E62 A;  2GPJ A;  3D26 A;  4FWT A;  1ELM P;  4H2K A;  2VEZ A;  1YX2 A;  1UWY A;  4UZU A;  5LRJ A;  2XZL A;  2E1B A;  1KZF A;  1VQL B;  3Q6R A;  4BIN A;  2QN6 A;  3BI1 A;  4JYW A;  4NJQ A;  1H8H A;  4XN3 A;  2PQ8 A;  1FX0 A;  4UFX A;  2ZZQ A;  4MBU A;  1V0E A;  3V7A A;  4UIA A;  3S6G A;  3F8K A;  4F9V A;  4B12 A;  2X53 S;  4R8F A;  4X7F A;  2JEV A;  2YNC C;  4OPV A;  4UEE A;  4DNT B;  2Z10 A;  2XGJ A;  2AE6 A;  4HPS A;  4TMX A;  4RD3 A;  4RD0 A;  2PJB A;  1ZG9 A;  1MJ9 A;  2IL4 A;  5A8A A;  5JM6 A;  1YHQ B;  4G1P A;  4FD7 A;  4Z4R A;  3LQE A;  4YFJ A;  2QYV A;  4EH1 A;  4X2T A;  3IFE A;  2XEX A;  1YJW B;  1K28 D;  2PDO A;  4FK8 A;  3UY5 A;  1EE3 P;  3FED A;  1QH0 A;  2POK A;  4MCQ A;  5GV8 A;  2PJ3 A;  1L0C A;  1AIP A;  2DEA A;  2PCU A;  4P45 A;  2J8N A;  2EBJ A;  1M4L A;  2WJY A;  4RD1 A;  2BGJ A;  2FX3 A;  1FND A;  1BLI A;  3P26 A;  2OZU A;  2XEJ A;  2R6H A;  3JQP A;  3MGD A;  3B2Y A;  3W2H A;  2Z3K A;  5EMN A;  1X10 A;  4K30 A;  4OC5 A;  4AVC A;  2VBT A;  1GYT A;  2AFU A;  3PB6 X;  4ZYQ A;  4CRZ B;  2ZEH A;  5F4J A;  1ARM A;  4B3X A;  1VGY A;  4RD4 A;  4CGL A;  1CJW A;  2DIE A;  4P6V F;  2YGW A;  2ZEG A;  1VKC A;  1K8A D;  1H8E A;  4BD9 A;  4IK2 A;  4KSI A;  1VHS A;  1HA3 A;  4OPO A;  3H8F A;  4PV6 A;  3TE4 A;  4ASU A;  4X8I A;  4CGO A;  3TT2 A;  3OWC A;  3JQR A;  4XPL A;  2QTL A;  4II3 A;  5J8C A;  1H42 A;  4W9Y A;  2G0B A;  1MRZ A;  2XNJ A;  4M6H A;  3LNN A;  3GVK A;  4MJ8 A;  1VQ9 B;  4JLY A;  1VQ4 B;  3WR7 A;  3OP1 A;  1OB5 A;  4MFZ A;  1YLO A;  1QVG B;  1WSR A;  4G6I A;  4X7D A;  4LX9 A;  2ATR A;  1F20 A;  2JLM A;  4II2 A;  2V7X A;  1M1D A;  2QTZ A;  1VJS A;  4OC1 A;  4YXW A;  5I0C A;  3G8W A;  2C6P A;  4QFM A;  4AG9 A;  1FDR A;  2X0K A;  5F4M A;  1OB0 A;  1NB0 A;  4UA3 A;  3CC7 B;  2WZN A;  1GVH A;  3AST A;  4PXE A;  4BBH A;  1E1Q A;  2BGI A;  2ZBU A;  4FD6 A;  3BJ7 A;  1WU8 A;  2J9A A;  4XON A;  3CCJ B;  4E2A A;  2WPW A;  3KAS A;  2BL1 A;  4XLC A;  1CPX A;  1TF9 A;  4AB7 A;  3ZZI A;  1U2R A;  3LAC A;  4M85 A;  2OU2 A;  1T6X A;  4XLE A;  2OR4 A;  1PUA A;  4XM3 A;  3SKB A;  5HZA A;  5TR9 A;  3KGQ A;  2EUI A;  2O53 A;  4C7H A;  3FKS A;  2Z3N A;  4MXU A;  4CAW A;  2PVV A;  1W2B B;  1WSV A;  5K8N A;  5F46 A;  4Z1M A;  3PB9 X;  5JH9 A;  4ZCI A;  2ZEM A;  4NF1 A;  3H8E A;  1Q7L A;  3W5H A;  4NGS A;  1W87 A;  2C77 A;  2P6E A;  1FNO A;  3JTK A;  1FY7 A;  2AFX A;  2D4P A;  4KVX A;  3WBJ A;  2AJ6 A;  1RO5 A;  3W2E A;  1NMT A;  4RD6 A;  5CPA A;  4UEF A;  2VJI A;  2V8D A;  1GAQ A;  5C88 A;  1LOK A;  2Q6I A;  4DUK A;  3G71 B;  4ROX A;  3GYA A;  2YNE A;  1NE9 A;  1KK1 A;  1JJ2 B;  1WOO A;  3PFO A;  2AHO A;  1VQM B;  5ISV A;  1RQP A;  4FD5 A;  4NGQ A;  5K8M A;  3G6E B;  4QUS A;  2C27 A;  3GUX A;  1YVO A;  1LFW A;  4PGO A;  1JA0 A;  1T5E A;  4UCP A;  3TO6 A;  2ZEF A;  1AYE A;  1IYK A;  3D7G A;  1XMB A;  4PK3 A;  4WZE A;  4QBJ A;  1YJ9 B;  4UCN A;  2GJP A;  1YIJ B;  4PXD A;  3E1Y E;  2C4T A;  3SJZ A;  4KKT A;  2Q7B A;  3ASP A;  3AGP A;  5E6T A;  4TMT A;  4DNR B;  4HNY B;  4NXY A;  3SLD A;  3WC5 A;  1ELL P;  3D2P A;  2V7T A;  4IW3 B;  3BC9 A;  2CY2 A;  2DF5 A;  3NH8 A;  2IQ6 A;  3I3G A;  4M53 A;  4CGM A;  2HB6 A;  4A37 A;  1P4N A;  2YND A;  3TO7 A;  1QST A;  4QVT A;  2PIA A;  2YWG A;  3CPA A;  3EO4 A;  5IYW A;  2VBQ A;  2PVW A;  4IHM A;  2P3M A;  1HZE A;  5A28 A;  5HXB A;  4B5P A;  2XND A;  2OB0 A;  2YWE A;  3WY9 A;  3CCR B;  1V0F A;  2VZL A;  3F0A A;  2DEU A;  1CP6 A;  3CTA A;  2BSA A;  4MYT A;  5G22 A;  1QGZ A;  3OKX A;  3VWD A;  4YAF A;  1LAN A;  4DK1 A;  2REE A;  1HDU A;  4G1V A;  4HKF A;  3SJX A;  2Q51 A;  1KUY A;  3PVD A;  2F8H A;  4IUS A;  1M90 D;  3CES A;  4Z4S A;  4WWV A;  1IJE A;  1S7L A;  2F5I A;  1QGA A;  4CS0 B;  1Z4E A;  4P25 A;  4NCN A;  3D7H A;  2HUZ A;  1Y7R A;  4EFD A;  4CAX A;  2PJ4 A;  4OAE A;  3A8K A;  1COW A;  2B3U A;  2ZL6 A;  3GSI A;  1WK4 A;  1UD4 A;  1W34 A;  4NCZ A;  4YAO A;  1NBM A;  1QQ9 A;  4YEJ A;  2Q6K A;  3FXT A;  4YU9 A;  3BNW A;  1FNB A;  3PGP A;  5F48 A;  5F49 A;  2PC1 A;  1Q81 D;  4MY3 A;  4A38 A;  4H89 A;  4UIB A;  4GQN A;  1F2P A;  4MCP A;  2KVO A;  2ZTN A;  1Z4R A;  3I55 B;  3DSB A;  3NH4 A;  2WJV A;  2B7C A;  1QVF B;  3RY8 A;  1FRQ A;  2V8V A;  4MFL A;  1Z8X A;  1KWM A;  4AG7 A;  5AG7 A;  4B5O A;  2PJA A;  2BM1 A;  3CPW B;  4R7M A;  3ES9 A;  2BMW A;  2Z11 A;  3NE8 A;  2OH1 A;  4WQM A;  3OFN A;  3PB8 X;  2QEC A;  1R3N A;  4GS4 A;  1FNM A;  3E20 A;  5DSZ A;  2ZW5 A;  3FVL A;  2QEX B;  4FAI A;  3T90 A;  4AVZ A;  2X6W A;  3ZIA A;  2XZP A;  5FO0 A;  3H8G A;  3R9F A;  2VNH A;  4RJL A;  3VO1 A;  4MMO A;  2EWB A;  2PRB A;  2J8R A;  4MFK A;  5KNL A;  1MJA A;  3D8P A;  4R9M A;  4P9S A;  2ZOG A;  4OC0 A;  2ZXI A;  4CAE A;  2ZIT A;  1WOR A;  2B5G B;  3CB4 A;  3I1U A;  3LD2 A;  3VWE A;  2Q4V A;  1YVK A;  1Y0Y A;  2Q04 A;  2PSW A;  1LRZ A;  3VAT A;  1ZUN B;  1UD6 A;  1VQ5 B;  1WOP A;  1G7R A;  3MMP A;  4R87 A;  3LO8 A;  4M2L A;  2ANP A;  4MY0 A;  1VIX A;  1Y9W A;  2Q6L A;  5HMN A;  4B47 A;  1QFZ A;  4ZCL A;  4A95 A;  4F9U A;  3BCF A;  3I9S A;  2D3L A;  2EK9 A;  2JBJ A;  4P4I A;  4OID A;  4UFV A;  4AC9 A;  2EVN A;  1B6B A;  4ZV4 A;  2ZZF A;  1WDT A;  3ONU A;  1SQH A;  1HVX A;  1ELO A;  5K8P A;  5EMI A;  2HMA A;  3K9U A;  2E1R A;  3VAR A;  2ZPA A;  1E64 A;  3BCD A;  3AVX A;  3SI0 A;  2NPF A;  1J9Z A;  4NBS A;  4OPS A;  5CBM A;  2WYR A;  3H4Q A;  4RUH A;  1I1D A;  2Y0M A;  4GXH A;  4TMZ A;  1XB2 A;  4NGM A;  2R9V A;  2ZW6 A;  1JB9 A;  3OPO A;  2BEI A;  2V8H A;  5KTD A;  1KK3 A;  3WND A;  4E0F A;  2IJZ A;  1BLL E;  3FNC A;  3BLN A;  1BPL A;  2JJ2 A;  4FN5 A;  1VF7 A;  2CF4 A;  4KS9 A;  2GK7 A;  2HC9 A;  3S6H A;  4NGP A;  2B4D B;  1QMU A;  3NE5 B;  2FVG A;  3CDX A;  2YNC A;  1UD8 A;  1IGB A;  5DWN A;  3BHX A;  5IK2 A;  2XEG A;  4KKS A;  3ZZU A;  1TTT A;  4XD7 A;  4NEX A;  3FYN A;  1TKJ A;  3N5F A;  5KTA A;  3SJE A;  1SKQ A;  3B7I A;  4XL9 A;  4FWU A;  3OJW A;  3PEI A;  3CCQ B;  2PJ6 A;  5J8F A;  3D7D A;  1N8R D;  2F1M A;  1JA1 A;  2J7K A;  1YW6 A;  2QIR A;  2Z6B D; 
#chains in the Genus database with same CATH homology
 5THW A;  2OR4 A;  2V8G A;  5HVF A;  1CP7 A;  1YME A;  2XEF A;  3KGQ A;  2O53 A;  6CPA A;  3LMS A;  4MXU A;  2PVV A;  3B3T A;  5K8N A;  2AFO A;  4PXC A;  2AFM A;  3PB9 X;  5JH9 A;  2ZEM A;  4O23 A;  2PJ0 A;  1TXR A;  3H8E A;  4UF4 A;  1Q7L A;  3IIB A;  4NGS A;  1LAM A;  3V38 A;  5IB9 A;  1FNO A;  1VHE A;  3IJ3 A;  4OME A;  4ONW A;  2AFX A;  4X3R A;  2PJ2 A;  3PRT A;  2RB7 A;  4MCS A;  3B3S A;  3B35 A;  1RTQ A;  4TWE A;  5LRG A;  5CPA A;  4UEF A;  1OBR A;  3FEC A;  4EWT A;  5HVH A;  2V8D A;  1FT7 A;  4YWY A;  4A94 A;  1LOK A;  2BOA A;  4TNU A;  4DUK A;  1DE4 C;  4ZI6 A;  5J1Q A;  3PFO A;  4NFR A;  4NGQ A;  5K8M A;  3WC7 A;  2JEW A;  3KHX A;  2CTC A;  3GUX A;  1LFW A;  3KR4 A;  3GLJ A;  3HUV A;  2AFS A;  4K3N A;  4EME A;  2ZEF A;  5D29 A;  4OKO A;  1AYE A;  3IC1 A;  4FUU A;  2BO9 A;  1XMB A;  3D7G A;  1CX8 A;  4P4E A;  3NFZ A;  4PXD A;  4MCR A;  1TKH A;  1XFO A;  2ABZ A;  1XJO A;  2JBK A;  5ELY A;  3T8W A;  3D66 A;  3IO1 A;  2PJ9 A;  3WC5 A;  1ELL P;  5LYL A;  5JGF A;  1XRY A;  3K9T A;  5LYD A;  3GB0 A;  3NH8 A;  2IQ6 A;  4P4B A;  3KI9 A;  3B3C A;  3SJG A;  4PQA A;  3SI1 A;  4NJR A;  4AXV A;  3DGV A;  4MHP A;  2HB6 A;  2GLF A;  4A37 A;  3L2N A;  2Q4Z A;  1HEE A;  3HLP A;  3D68 A;  3CPA A;  2PE3 A;  2CIJ A;  5DS0 A;  2PVW A;  3PBB A;  1Y7E A;  4IHM A;  2PJC A;  2GRE A;  3S9L A;  4ZX8 A;  1ZG7 A;  2GLJ A;  1LAP A;  3D67 A;  1CP6 A;  2IMO A;  1VHO A;  2PIY A;  3KHZ A;  1LAN A;  3RZA A;  4R6T A;  1HDU A;  1Z8L A;  4MHZ A;  3QNV A;  3SJX A;  3RBU A;  2Q51 A;  3CT9 A;  2XEI A;  2F8H A;  3MN8 A;  1NSA A;  4WWV A;  2QJ8 A;  1BPM A;  3SJF A;  4ZY0 A;  2PRQ A;  2RFH A;  2VL1 A;  3D7H A;  3PBE A;  4EFD A;  1CPS A;  2PJ4 A;  1PYT B;  2ZED A;  3DLJ A;  1ZLH A;  2OOT A;  1F57 A;  1QQ9 A;  4YU9 A;  3KZW A;  4OC2 A;  1CBX A;  2O4H A;  4A38 A;  3RAM A;  4UIB A;  3MRU A;  3ISZ A;  1F2P A;  4MCP A;  2BCO A;  4UEZ A;  3JRU A;  1BAV A;  3KQZ A;  8CPA A;  4PXB A;  3LWU A;  3PFE A;  4OC3 A;  3NH4 A;  2V8V A;  2F7V A;  1KWM A;  2PJ5 A;  2V77 A;  2ZOF A;  1ZG8 A;  2PJA A;  3VH9 A;  4F8Z A;  1DTD A;  3IEH A;  4P4D A;  4R7M A;  2ZEP A;  1Z2L A;  3CPX A;  2Q43 A;  1ELM P;  4NGT A;  1TF8 A;  4H2K A;  1UWY A;  3PB8 X;  3ISX A;  5LRJ A;  1R3N A;  2AFW A;  1F2O A;  1ARL A;  3FVL A;  3BI1 A;  4JYW A;  4FAI A;  2PJ8 A;  3B3V A;  4NJQ A;  1YSJ A;  3NA6 A;  4DYO A;  1JQG A;  3H8G A;  3PB4 X;  5I4M A;  1Y0R A;  4FBE A;  4MHY A;  4OC4 A;  4UIA A;  4MMO A;  2EWB A;  2C6G A;  5HXD A;  4F9V A;  4MHN A;  2ZOG A;  4OC0 A;  4R8F A;  2I3C A;  4OP4 A;  1R43 A;  4UEE A;  1Z5R A;  1HDQ A;  3K2K A;  3I1U A;  3KR5 A;  1Y0Y A;  2NSM A;  2PJB A;  3FMC A;  1ZG9 A;  4JZ0 A;  3VAT A;  3NH5 A;  1ZLI A;  4A39 A;  4P10 A;  4GM5 A;  5JM6 A;  4P4J A;  4G1P A;  1PCA A;  2ANP A;  1VIX A;  7CPA A;  2QYV A;  4X2T A;  3IFE A;  5HVG A;  3WC6 A;  5K8O A;  1EE3 P;  1TKF A;  3FED A;  2POK A;  3V7Z A;  4MCQ A;  4F9U A;  2PJ3 A;  1LCP A;  2DEA A;  2PCU A;  4P45 A;  2JBJ A;  2EK9 A;  3FH4 A;  1M4L A;  4P4I A;  2ZEE A;  2EK8 A;  4OID A;  3PB7 X;  4R76 A;  2XEJ A;  4WJB A;  3TX8 A;  2PIZ A;  3B2Y A;  5K8P A;  3WT4 A;  3IWW A;  4OC5 A;  5LRK A;  1GYT A;  2AFU A;  3VAR A;  3PB6 X;  5LYI A;  4ZYQ A;  4Z65 A;  1XBU A;  2ZEH A;  5D8N A;  1ARM A;  4MRI A;  1BPN A;  1VGY A;  3SI0 A;  3FJU A;  2ZEO A;  5CBM A;  2ZEG A;  2C1C A;  2WYR A;  3FF3 A;  3FX6 A;  4BD9 A;  4IK2 A;  4KSI A;  4RUH A;  3H8F A;  4NGN A;  4Q7A A;  4CPA A;  4DJL A;  4X8I A;  4NGM A;  2PJ7 A;  4LQG A;  4ZY2 A;  2ZEN A;  3FEE A;  1IY7 A;  2V8H A;  4W9Y A;  3KQX A;  3B3W A;  2AFZ A;  2ZEL A;  2CTB A;  2GU2 A;  2IJZ A;  4NGR A;  2NYQ A;  1BLL E;  3BXM A;  4P4F A;  1YLO A;  5F09 A;  5LYF A;  4OIW A;  1CG2 A;  3SI2 A;  4ZY1 A;  2CF4 A;  2HC9 A;  3WAB A;  2G9D A;  4ZX9 A;  1H8L A;  1AMP A;  4OC1 A;  3D7F A;  4NGP A;  2C6P A;  3KL9 A;  1YW4 A;  1QMU A;  2QVP A;  2PJ1 A;  4P44 A;  2FVG A;  3CDX A;  1IGB A;  4B6Z A;  3BHX A;  2WZN A;  2XEG A;  3TC8 A;  4PXE A;  4PPZ A;  1TKJ A;  3N5F A;  2J9A A;  3SJE A;  3D4U A;  3B7I A;  3KAS A;  4FWU A;  4P6Y A;  3BI0 A;  4IAV A;  2C6C A;  3PEI A;  3S9M A;  3S9N A;  1CPX A;  1TF9 A;  2PJ6 A;  3D7D A;  1YW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...