3ISXA

Crystal structure of endoglucanase (tm1050) from thermotoga maritima at 1.40 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
335
structure length
335
Chain Sequence
b'HHHHMKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase
publication title Crystal structure of Endoglucanase (TM1050) from THERMOTOGA MARITIMA at 1.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 104
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3isxA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3isxA01
1TKFA 4ONWA 4ZY0A 4UF4A 5HVFA 5DS0A 2PJ3A 1KWMA 4UIAA 3VARA 4MCPA 4P4DA 4ZX9A 3SI1A 5HVGA 3ISXA 3KR5A 2PJ1A 4A37A 3FEEA 2CTBA 2AFUA 2AFOA 2AFXA 3PBBA 3ISZA 5K8NA 3WC7A 4NGNA 1TKJA 3VATA 2ZEEA 2GLJA 3WABA 2EK8A 2AFMA 4KSIA 5LRGA 3KHZA 3FVLA 1VHOA 3TX8A 2JBKA 3B35A 3PEIA 1TF9A 5HXDA 2Q43A 2ZEHA 3WT4A 4P10A 2GU2A 4MHPA 1CBXA 2ZEDA 3NH4A 3FF3A 2PJAA 2ZOGA 2OR4A 3KHXA 1LFWA 3BHXA 1VHEA 3B3TA 1F2PA 1FNOA 2QVPA 4BD9A 4B6ZA 3WC5A 2PIYA 3IFEA 5D8NA 2O53A 3KI9A 4OC2A 2HC9A 3RBUA 4JZ0A 3SJFA 3DGVA 1YW4A 3RZAA 2ZEFA 4OIDA 3V38A 5K8OA 2ZENA 1ZG7A 2GLFA 2F7VA 4ZY1A 4NGRA 1CPSA 5IB9A 4PPZA 2PJ7A 3IO1A 2NYQA 3D66A 3PBEA 3D7DA 1CX8A 3PB7X 4A94A 4DJLA 4ZYQA 7CPAA 2ZEPA 4NGQA 2C1CA 1PCAA 4Q7AA 1Z8LA 1CP6A 4P4FA 5K8PA 2JBJA 4RUHA 1BLLE 3D7GA 3D4UA 4K3NA 4MCRA 1M4LA 1CG2A 4NJRA 1XMBA 4LQGA 1Z2LA 2PJ5A 2V8HA 3FEDA 1TKHA 4X3RA 4P6YA 4NGSA 3PRTA 1DTDA 4DYOA 2AFWA 6CPAA 4R76A 1LOKA 4MCQA 2PCUA 1IY7A 4EFDA 4OIWA 5HVHA 2EWBA 4AXVA 1YLOA 4MCSA 3B3VA 2PIZA 1ZLIA 2CTCA 1TF8A 4A39A 3V7ZA 3CPXA 3TC8A 5THWA 2RFHA 3IIBA 2CIJA 3D7HA 3B2YA 3LMSA 3RAMA 2NSMA 3FH4A 3KL9A 4NGMA 4GM5A 4NJQA 5CBMA 2V8DA 5J1QA 3MRUA 3T8WA 4EWTA 2RB7A 3IC1A 2IMOA 1Q7LA 1Y0RA 1VIXA 1HEEA 4OC5A 2POKA 1XBUA 3CPAA 4OC1A 4OC3A 3DLJA 4UEZA 2PJCA 3KQZA 4X2TA 4PXBA 1ELMP 1UWYA 3H8FA 4P4IA 4MXUA 3IWWA 5K8MA 4UIBA 1QMUA 3NH8A 3KGQA 2PJBA 4OKOA 2ZEMA 2WYRA 1F57A 2WZNA 1F2OA 8CPAA 2V8VA 3L2NA 1ELLP 3KZWA 2QJ8A 1YMEA 3S9LA 3BI0A 3LWUA 3S9MA 2ZEGA 1LCPA 2JEWA 4OC0A 2IQ6A 2XEJA 4IK2A 3D68A 1HDUA 3PB8X 2IJZA 1RTQA 5JGFA 3PB4X 4R8FA 2PRQA 2VL1A 4YU9A 1YW6A 3GLJA 4P4JA 1ZLHA 3HUVA 2C6GA 1XFOA 2OOTA 4WWVA 1ZG9A 1ARMA 3NH5A 3BXMA 2G9DA 2O4HA 3D67A 1AMPA 1AYEA 5LRJA 1LANA 3HLPA 1NSAA 4IAVA 1ARLA 5D29A 3NFZA 4W9YA 4MHNA 1R3NA 3CT9A 4IHMA 3JRUA 1BAVA 3N5FA 3FJUA 1IGBA 1JQGA 3S9NA 4PXDA 2FVGA 2PJ0A 1ZG8A 1PYTB 2BCOA 1GYTA 2XEFA 4PXEA 3WC6A 1Y7EA 1BPNA 3IEHA 2PJ4A 4OMEA 4DUKA 5I4MA 1EE3P 2ZOFA 4MHYA 3QNVA 2PJ6A 4FAIA 4MRIA 2I3CA 3SI0A 2ABZA 1H8LA 4X8IA 3PB6X 4NFRA 4O23A 1TXRA 5ELYA 3KR4A 1XJOA 1R43A 2PJ9A 2AFSA 2V8GA 2CF4A 2C6PA 2HB6A 2PJ2A 5LRKA 4TNUA 4FBEA 3CDXA 3FX6A 4UEEA 5LYDA 2ZELA 3B7IA 1LAPA 4WJBA 4P4EA 3K2KA 2F8HA 3BI1A 3SJGA 4Z65A 4PXCA 2PVVA 3FMCA 1CP7A 4ZY2A 4PQAA 3GUXA 3VH9A 4P45A 4YWYA 4JYWA 3KASA 3H8EA 2QYVA 3K9TA 1FT7A 2EK9A 4G1PA 1Z5RA 3SJXA 4F9VA 4ZX8A 1HDQA 2V77A 5JM6A 3FECA 5LYFA 4MHZA 2ANPA 3GB0A 4FUUA 3SI2A 4EMEA 4R7MA 3PFEA 1LAMA 3PFOA 1VGYA 3B3WA 5LYIA 1DE4C 5F09A 2GREA 4MMOA 4F9UA 3KQXA 1BPMA 3PB9X 4F8ZA 1OBRA 1QQ9A 4H2KA 3B3CA 5JH9A 2J9AA 2XEGA 3IJ3A 1Y0YA 2ZEOA 4OP4A 2XEIA 2Q4ZA 2BOAA 2C6CA 4TWEA 1CPXA 4NGPA 3SJEA 5LYLA 3B3SA 3I1UA 4UEFA 5CPAA 1YSJA 3MN8A 4FWUA 3NA6A 4R6TA 2PVWA 2PE3A 2Q51A 4ZI6A 2BO9A 4NGTA 4CPAA 3H8GA 2AFZA 4P4BA 4A38A 4P44A 2DEAA 3D7FA 1XRYA 2PJ8A 4OC4A
chains in the Genus database with same CATH superfamily
2WSAA 3GVJA 4IW3B 4X07A 1PKVA 1S7KA 4P4DA 2OZHA 3KR5A 2VXKA 4M4SA 2PJ1A 1M90D 4BMHA 2AFXA 2G3TA 3PBBA 4UA3A 3ISZA 3WC7A 2X6YA 3H9NA 3G6EB 2P6GA 3WBJA 2AFMA 3ASSA 3MHPA 3BCDA 4E0FA 4FD6A 3V7AA 4B13A 3W2HA 2I1LA 3CMMA 1PU9A 4PV6A 3R9FA 3TOAA 3TX8A 2ZW7A 3DDYA 4P10A 2FT0A 4AF7A 2G0BA 5EC4A 3NH4A 1H8EA 2OR4A 2EUIA 3TCVA 1F2PA 3GSIA 3CP2A 3S6GA 4B6ZA 4B3XA 3IFEA 3FXTA 2O53A 4OC2A 2HC9A 1Q81D 3RBUA 3RYOA 1YHQB 3VO2A 4PSXA 3WR7A 4B14A 2ZBVA 3OZVA 2CNSA 1OGJA 4XPDB 1WPCA 1ZG7A 2OBSA 4ZBGA 4ZY1A 2PJ7A 3PBEA 2V7QA 2YWFA 3ASTA 3FPKA 1Z8TA 2BV3A 3LVBA 4ZV4A 1KUYA 4RDJA 4ZYQA 7CPAA 2ZEPA 3CCVB 4KLVA 5K8PA 2JBJA 2R1IA 5F49A 1M4LA 3OE7A 1CG2A 2VZZA 4NJRA 4LQGA 2PJ5A 3FEDA 4LC0A 1V0FA 5FVJA 4HE5A 3F5BA 5H5JA 2HDNB 4NGSA 3PRTA 4JXQA 1DTDA 5GCNA 2V7XA 2AFWA 4UWIA 6CPAA 4RCZA 4KKSA 4MCQA 2DEUA 5KTDA 4KKTA 1ZM9A 1YJWB 4ONUA 4EFDA 5A28A 4G1VA 4Z4RA 4PC2A 4XONA 4XPKA 3CZXA 1XE1A 2CTCA 1TF8A 4XLCA 2BF4A 4HKFA 3V7ZA 3CPXA 2HV2A 3LQEA 4MFZA 1H42A 3GVLA 1PJ5A 4QUZA 4LX9A 3KL9A 1IHMA 2VZLA 4GM5A 3W6SA 4M6IA 5CBMA 2R7HA 4CAFA 4L8AA 3OW7A 1Q7LA 2DF5A 3Q3AA 4LBVA 4P12A 5H84A 1M4GA 3BLNA 2POKA 3ASQA 3WYAA 1M1KD 2Z6BD 4C7IA 2GFQA 4RD3A 3JVNA 4UEZA 4X2TA 1VQOB 4XNFA 4A30A 3I55B 1ELMP 2XNJA 1UWYA 2ZZFA 1JNYA 4CYNA 3GKRA 4MBUA 2CRVA 2DOGA 4MFLA 5K8MA 1QMUA 4PABA 3NH8A 2WYRA 4OP7A 1F2OA 4KSFA 3VMFA 3MGDA 5I0CA 2QJ8A 1IOFA 2FS5A 4KOVA 4RS2A 1NMTA 3S6FA 2X7BA 3CPWB 3S9MA 1TIQA 5HMNA 1Z9UA 3R95A 3P27A 1B6BA 2XEJA 4IK2A 4OPOA 1E64A 3PB8X 2QA4B 4PK3A 2BL1A 1QGZA 2FIWA 2J8NA 2OB0A 4M85A 3AVTA 4R8FA 2VL1A 4YU9A 4AB7A 4P4JA 3N7ZA 2C77A 4WZLA 1XFOA 2QEXB 2V31A 2Q4VA 3NH5A 4ORFA 4JLYA 3ZIAA 2XZOA 5A8AA 1EFTA 4UBRA 4RCYA 4P26A 5LRJA 3HLPA 3I56B 2W6JA 3R96A 1FNMA 5D29A 1EXMA 1R3NA 4YHBA 3JRUA 1VQ8B 4TN1A 4X5KA 1COWA 2FVGA 4B4DA 3ZUGA 2AJ6A 3Q38A 4X7FA 5FO0A 1EFUA 1IB0A 1H8HA 4XL9A 1GYTA 2XEFA 1BO4A 4MJ8A 1N0UA 5HKKA 1S7FA 2JJ2A 2B7BA 4RD4A 2DXQA 1N06A 4II2A 1QGAA 4WZEA 1EE3P 2YWGA 2ZOFA 4PC3A 3A3GA 5JQ4A 4CGLA 1OB0A 3EFAA 1GR1A 5AG6A 2WR8A 3PB6X 4NFRA 3PZJA 2B5OA 2QE7A 1ZM3A 3GIUA 5GV8A 3JTKA 5HH1A 2ZTNA 1MJAA 5ELYA 3W6XA 4RD2A 2E1RA 1XJOA 2HB6A 5J8FA 4OPVA 1NBMA 4UEEA 3W5HA 4YAUA 4ZCIA 1M44A 3CESA 1V0EA 4NEXA 4XD7A 4PSWA 3K2KA 2F8HA 2VJJA 4RN7A 1NE9A 5DWMA 4G1BA 2DERA 3CMAB 3MCAA 3EC4A 3ZZIA 3CTAA 3A8IA 4II9A 3OFNA 1EP1B 4NNJA 4JYWA 3Q39A 1M1DA 2Z3PA 2BVNA 1YJ9B 2F1LA 4ASUA 2QYVA 1IYLA 5EMNA 1HDQA 4ROXA 1XMTA 5JM6A 4EH1A 1MJ9A 3K9UA 4MHZA 2ANPA 2DYIA 4R7MA 1GJRA 3PFOA 1TTTA 1DE4C 4R3LA 3TO9A 3WNCA 4MMOA 1BPMA 3PB9X 4C68A 4OOVA 1WP6A 3V76A 4YAWA 1FNBA 4MFJA 1Y0YA 1JA0A 2FE7A 1YK3A 4OP4A 4ZCLA 2Q4ZA 2BOAA 5IYWA 5C88A 4Q7JB 4XR6A 4HNYB 1WU8A 2X6WA 1ELOA 4RJLA 4GQNA 1YSJA 3MN8A 3BY1A 2GJKA 3R1KA 1Q2CA 2Q51A 5KSWB 3U6KA 2WUUA 4Y49C 1A8PA 4CPAA 1W0KA 3GY9A 1WOOA 3E1YE 4KLWA 2P6FA 2FCKA 3B78A 1K73D 4RD0A 2ODFA 1H85A 2Z3MA 2K5TA 3FPPA 5HVFA 1CJWA 4DNTB 5DS0A 2PJ3A 1KWMA 1GVHA 4AVAA 4MFPA 3VARA 4MCPA 4JWPA 4ZX9A 1E63A 3ISXA 4TSFA 2PIAA 2LZJA 2ZL6A 4A37A 1Q82D 3W2FA 2CTBA 1VLYA 5K8NA 2XZLA 4GXHA 1F20A 3SLNA 3EO4A 3ZZUA 1TLLA 3JQQA 3ZPNA 3PUNA 4AVZA 4QC6A 1XEBA 2JBKA 5HXDA 2W6IA 3WT4A 1CBXA 4QV2A 1AUGA 4E2AA 3CCUB 1E43A 4XORA 5TR9A 1W87A 3BJ7A 3HAGA 2CNTA 4PC7A 1T5EA 2QVPA 4DQKA 4BD9A 2O28A 1QSTA 4HPSA 1B23P 5AG4A 1VQKB 2VI7A 4G6IA 3ZBTA 1QH0A 5IB0A 1YI2B 3SJFA 4YFJA 2ZZEA 4XN0A 4R57A 4RPBA 1YW4A 3RZAA 2ZEFA 4II3A 2ZXVA 4OIDA 1XE4A 3D3SA 2X3UA 2GIVA 2OU2A 1V0CA 2F4NA 2F7VA 1Z4RA 4NGRA 5IB9A 1VQNB 4CQJA 3D7DA 2PQ8A 3PB7X 4A94A 4E0AA 4DJLA 2QTLA 3U2QA 4B44A 4CGOA 4BINA 4NGQA 2C1CA 1VQ4B 1J4JA 4KOWA 3A1PA 1CP6A 3D4UA 1QUFA 1L0CA 4P25A 4MCRA 5AG5A 4FK8A 1XMBA 5G22A 4OOSA 4B43A 2BMWA 3RNZA 4X3RA 3WXMA 2D3NA 3R9GA 3LD2A 1EWYA 2M5SA 3WBKA 4OAEA 2VBSA 4P1VA 1PJ6A 1QFYA 4QFMA 3VWDA 1QG0A 1NB9A 1LOKA 2ZXIA 4M1KA 1SKYB 4BPRA 1IY7A 4OIWA 5HVHA 4MYUA 1EP2B 5G1ZA 4XNHC 4MCSA 5TV2A 3F0AA 3AVXA 1ZLIA 1YJNB 2JIZA 4X7EA 1YREA 3TC8A 2RFHA 2CIJA 5AGEA 1P0HA 2ZBUA 4KVME 3AVUA 2G3AA 2X85A 3BY2A 3SHPA 2Z3NA 2VQYA 4NJQA 4AVBA 5J1QA 2GK7A 3MRUA 4P6VF 2ZL5A 4QB9A 2YNEA 2Q04A 2BSWA 3GQBA 5F46A 4LBWA 1Y0RA 2F43A 2Q6LA 4YEJA 5HXBA 1HZEA 5CDFA 4OC1A 2R9VA 3KQZA 1P4MA 3F8KA 4PXBA 1P4NA 4P4IA 1SKQA 4UWJA 1E62A 3ZZTA 3U6BA 4UIBA 1G7CA 1F57A 4OLLA 8CPAA 2FL4A 1OGIA 4C0SA 3IU2A 3IGRA 3AVVA 3R6JA 1U2RA 2JDDA 3B82A 2C5BA 3BC9A 2JEWA 4OC0A 3QAHA 4XOPA 3CCLB 3H4QA 3A8KA 3FB3A 3D68A 4Y7CA 4C2XA 2HCJB 1S60A 5B6IA 3TTHA 3T9YA 1YR0A 3PB4X 1G7TA 1YW6A 1XIXA 3B8HA 5F4OA 1ZLHA 3HUVA 3AVWA 4Z4ZA 2Y0MA 3PA2A 4H89A 4HNWB 1DDIA 3CC7B 2C6GA 1VQMB 3OPOA 1ZG9A 1ARMA 2OK8A 2DY1A 3CCEB 1KZFA 5IV0A 2XGJA 4WZTA 3R9EA 1VQ9B 2QTZA 5J3OA 3DR6A 1PUAA 3TOBA 4CS0B 1AYEA 1LRZA 1S72B 2OK7A 5BSYA 4L89A 1ARLA 3NFZA 4W9YA 1OB5A 4YALA 4MHNA 2VBQA 3CT9A 2EIXA 3S9NA 1IGBA 4QVTA 5GV7A 1KZLA 4U9UA 5JBQA 4LQ6A 1S0UA 1Q9SA 4Z1MA 5FO1A 1E3ZA 1UD4A 2BCOA 4PXEA 4A2ZA 1BPNA 2E1BA 3CCQB 2Q6KA 4OMEA 4NXYA 2V4DA 3SKBA 2PJ6A 3QFSA 4AG9A 5E6TA 2B7CA 2ZW6A 3SI0A 1H8LA 4X8IA 3QFTA 1DDGA 4O23A 2DPTA 1X12A 1R43A 2AFSA 2V8GA 1BX0A 4TNUA 3CDXA 1CM0A 4KOTA 5THXA 3TO6A 3B7IA 2P3MA 1KC8D 5F4JA 3BI1A 4NSQA 3FJOA 2I00A 4TKOB 3A9LA 3H94A 3FMCA 4PAAA 4ZY2A 1AIPA 3GYAA 3FNCA 2YGWA 3GUXA 4X7CA 4FWTA 1WSRA 3CD6B 4KORA 5IX3A 2CY2A 1NJID 3K9TA 2EK9A 4G1PA 3SJXA 4AVCA 2D4OA 3OAAA 3DNSA 4PC1A 5LYFA 4MYTA 4G7XA 2CNDA 3PFEA 1QGYA 2JLMA 2Z11A 3A8JA 1VGYA 1XF8A 4X0CA 4R71A 3CCMB 5F4MA 4RDLA 4F8ZA 3JU4A 2HQYA 5JH9A 1UD8A 4U5YA 2PLFA 3EXNA 4CYQA 3SJZA 3B8GA 2OBRA 2XEIA 4KUBA 4X7DA 1MK4A 4NGPA 2J8MA 1R5BA 4YAOA 2RC6A 1V5VA 1KD1D 2WJYA 1E79A 4AF6A 4C7HA 3KEWA 4TMXA 2B4DA 4FWUA 4KOYA 2QN6A 1FRQA 5J8CA 2C2WA 4KOXA 2BO9A 4B11A 1ZUNB 2REFA 4DNCA 2C4UA 4F0YA 4P4BA 4TMVA 4A38A 2X0KA 2DEAA 2WJVA 1KK2A 4XLEA 2I79A 4KSAA 2QDXA 3RO0A 5C82A 3WQZA 4KVOE 4UF4A 1UD5A 3G71B 1QFJA 1W35A 4Q38A 4UIAA 1Z8WA 3G3SA 5BSXA 2F1MA 5G21A 2Z0ZA 4R87A 2Q7SA 2V7UA 3PENA 3VNUA 3IWGA 2AFUA 1YIJB 1VJSA 1UD6A 4XM3A 1K8AD 1FNDA 1TKJA 4QBJA 5KNLA 3VATA 2YNDA 2ZEEA 2GLJA 2J7KA 3TE4A 2OZGA 3FVLA 1S5KA 2B4BA 2V7WA 2BM0A 4KOSA 1VHOA 4UCPA 5J35A 3DR8A 1DARA 1CNEA 1RQPA 3B35A 4LBZA 3PEIA 2XNCA 3P26A 2Q43A 2ZEHA 2GU2A 1XB2A 1W2BB 1N0VC 4DK1A 1Y7RA 4E8OA 3FF3A 2ZOGA 3G05A 1LFWA 4Q36A 1VHEA 1BMFA 2D9RA 2GANA 3B3TA 1FNOA 2B5GA 3WC5A 1VQ7B 1UMKA 4ZCMA 3KI9A 4JZ0A 2OH1A 4UFVA 2NPFA 3DGVA 4Y49B 4C2ZA 1E1QA 3BCFA 5K8OA 1S7LA 2ZENA 1NB0A 2GLFA 2JDCA 3PGPA 4F0XA 1Q2YA 1JB9A 1ZM2A 1CPSA 4PPZA 3IO1A 2NYQA 3D66A 1B2RA 2Q0YA 1CX8A 1I1DA 3I9SA 3ASRA 1D1NA 3D2PA 1WOPA 3W2GA 1VQPB 1BX1A 1IJEA 4B47A 1PCAA 4A31A 1Z8LA 4C43A 4G7WA 1BLLE 3JQRA 5JPHA 1G7RA 4L8JA 2GPJA 2FSRA 3LACA 3GIRA 1Z2LA 1UFHA 1N08A 2V8HA 4CRZB 2B3UA 2ZW4A 2X6XA 1Q7YD 3JUWA 4KKUA 5L46A 4DYOA 3G4SB 4LUAA 2DIEA 1X10A 4R3KA 2PCUA 3W91A 4FD4A 2VNKA 2EWBA 3S6HA 2PSWA 3B3VA 2PIZA 4A32A 2DPSA 4DNRB 1ON0A 3CC2B 2X53S 4A39A 2Q6OA 4Z4TA 5F48A 2H5MA 2VJIA 4HIZA 3LMSA 1GHEA 2FIAA 2C5HA 1OZPA 3OZUA 1VF7A 4M2LA 4H6UA 1WDTA 3C26A 1I18A 4C2YA 3T8WA 4EWTA 3CCSB 2RB7A 3IC1A 4Y9RA 3QAYA 3PA1A 3SJPA 2OTLB 1YVOA 1JJ2B 4PGOA 2NMTA 1XBUA 3CPAA 4TMTA 4OC3A 3QFRA 1VQ5B 2PMDA 3DLJA 4HE6A 1I21A 2BGJA 3V8IA 4MXUA 1EP3B 2CNMA 2P6EA 4ZGQB 5H86A 1FDRA 2OTJB 3KGQA 2ZEMA 2WZNA 2KCWA 2PRBA 2CC2A 3L2NA 1ELLP 4P3IA 2AHOA 2WZPP 1BJKA 1EFRA 1K4JA 2EBJA 3LWUA 5A27A 1LCPA 4I49A 3TO7A 2RC4A 5IYNA 4CAEA 3Q6RA 4B10A 1HDUA 3SEJA 1RTQA 4CGNA 5JGFA 2Z3OA 1JWQA 4XNHB 1YLEA 2VNJA 2PRQA 5EMIA 4MY0A 5IYPA 3GLJA 4BBHA 2HLDA 1QSMA 1GAWA 4NCZA 3QB8A 2OOTA 1KMHA 4CGMA 3CB4A 3IWEA 2V7TA 1AMOA 4U9YA 2GE3A 4XN3A 2G9DA 2VBUA 4RDKA 1WSVA 2YWEA 3OJWA 1AMPA 4MY3A 1LANA 1NSAA 1Z8XA 5HZBA 4Z4UA 3OZWA 1IYKA 1BAVA 4QUSA 1JQGA 4DQLA 4PXDA 3DDDA 4FN5A 1R57A 4M3SA 1ZG8A 1YVKA 1PYTB 2BM1A 4KVXA 3NE5B 1KK1A 5KTCA 4M0LA 3P2HA 4P22A 5ISVA 3CXCB 1I8DA 4YGOA 3SXOA 3CXSA 2QIRA 4XKVA 4MHYA 3QNVA 1W9XA 2EVNA 4FAIA 4PK2A 2I3CA 3NE8A 1TUIA 1RO5A 2ABZA 4OOXA 2X8KA 3OEHA 3GVKA 1F60A 1Q2DA 2BEIA 3W5VA 3QE2A 2ZTGA 2PDOA 3KR4A 1SQHA 2PJ9A 3A35A 5LRKA 2CF4A 2C6PA 1W34A 2PJ2A 3A3BA 1QVFB 3FX6A 5LMZA 2HUZA 4XLHA 2ZELA 4KS9A 1YQEA 4WJBA 4P4EA 1N8RD 3WNDA 1OHHA 3CRZA 3EY5A 4Z65A 4UZEA 2PVVA 4PXCA 1T6YA 2REEA 4PQAA 1KRHA 1TVCA 1KQSB 1DG1G 4P45A 1W0JA 4UZUA 3PVDA 4FXUA 3LNNA 4IUSA 1K28D 1EFCA 1FT7A 1Z5RA 4QVJA 4F9VA 1HVXA 4JD6A 4ZX8A 2BGIA 2GK6A 1WORA 3FIXA 4FUUA 4XPLA 4CAXA 3NE7A 1U6MA 1RQRA 2JDIA 5KW9A 1FX0A 5LYIA 1S4MA 4Y9UA 2JJ1A 2GREA 4F9UA 1IICA 1QQ9A 4H2KA 2PC1A 3IJ3A 1M4IA 1VKCA 4B5PB 3IU1A 3OEEA 4TWEA 2P0WA 1SM4A 3WY9A 3B3SA 4UFWA 3I1UA 3S6KA 4WZKA 2R98A 5HZAA 4XLAA 2R6HA 1QSRA 4JMQA 4UEFA 5CPAA 3NA6A 1QSOA 2VBTA 3VNVA 1GO2A 1FY7A 3ZBUA 3I3GA 4NGTA 4M53A 1YX2A 5EBVA 1NDHA 1Y9KA 3H8GA 2AFZA 4XPDC 1VQLB 3LQ6A 4OPSA 1KTVA 4TT3A 3CCJB 2C78A 5CNPA 2F5IA 3D26A 1XRYA 2PJ8A 1VLOA 1TKFA 4ONWA 1N07A 4ZY0A 1I7PA 5A89A 3BNWA 4RD6A 4YRHA 4F7DA 2YNCA 1NRKA 3SI1A 5HVGA 1WK4A 3QSYA 1D8TA 4B5OA 1KUXA 3OWCA 1E3XA 1S7NA 3FEEA 2Z3LA 3ASPA 1QSNA 2AFOA 4RD1A 4Z4SA 1CNFA 4NGNA 1IIDA 3WABA 4N3NA 2EK8A 2ZXHA 1FNCA 4KSIA 3T53B 5LRGA 3KHZA 5IYQA 1RXTA 3T56B 1R5NA 1E1RA 2DCUA 1OB2A 1TF9A 4Z4VA 4UFXA 4MHPA 4RLZA 2NV4A 2ZEDA 3R6KA 5DN6A 2PJAA 4KUAA 3KHXA 1Q86D 2OYNA 1IU8A 3BHXA 4UCNA 2QECA 4CGPA 4NCNA 5FL7A 4P3YA 2BUEA 2BSAA 2GJPA 2PIYA 1G7SA 3PUMA 3T90A 5D8NA 4MI4A 2R8VA 3ZJ0A 1MJBA 3FKSA 3W2EA 2WPDA 1I12A 2V7VA 2XEXA 4CAWA 2RC5A 4QVAA 5H59A 3V38A 4TMWA 3P2FA 2AE6A 3ONUA 3D2MA 4X06A 1IJFA 3AVYA 2C27A 3CXPA 3T51B 1S3ZA 4Q7AA 1NSLA 3FRMA 4P4FA 2B58A 4RUHA 3ZZ0A 4KZTA 3PP9A 4MHDA 4XLFA 3D7GA 4K3NA 2VZYA 1UD3A 1KJZA 1TKHA 3ES9A 2VBVA 4UAJA 3TFYA 4P6YA 3VWEA 3CC4B 5IK2A 3BQJA 1N05A 4R76A 4U9ZA 5G20A 2BN4A 3QFCA 4AXVA 1QUEA 1YLOA 4NF1A 1M4DA 1VQ6B 5THWA 5TRDA 3IIBA 4CRYB 3D7HA 2D4PA 3LO8A 1T6ZA 3SXNA 3B2YA 2EFGA 3RAMA 4J0QA 2NSMA 3FH4A 3OOCA 3UY5A 3CMEB 4NGMA 2WSSA 2V8DA 3ZC3A 4A33A 4CYOA 4ACAA 4B3GA 3W2IA 2IMOA 3CXQA 1WTHD 1VIXA 1HEEA 4OC5A 2D3LA 3H5ZA 4CAVA 4JJXA 4PC6A 5BWAB 2ZL7A 4YXWA 2YWHA 2PJCA 3E20A 4XOTA 2ARHA 3H8FA 2VYQA 2QGGA 3BH4A 3IWWA 4KOUA 5FIUA 2GJRA 2PJBA 4OKOA 3SLDA 4XMYA 3W5UA 2V8VA 4RM0A 2C4TA 2XNDA 3OP1A 4EVYA 3Q6QA 3KZWA 3S9LA 1YMEA 3KKWA 3BI0A 2ATRA 1WWZA 1VHSA 2ZEGA 4H9GA 2IQ6A 5FNZA 1PJ7A 3VO1A 1BQEA 4G5GA 5AN9A 3J81k 2IJZA 5DWNA 2CW5A 4ZGYB 2ZZQA 2VNIA 2WPXA 1YITB 4MFKA 4K30A 4J3GA 4UCMA 1K9MD 2ZZGA 1J9ZA 4WWVA 2PR1A 4P9SA 2JEVA 5IYRA 4LBYA 2YNCC 4YELA 1YGHA 3BXMA 1XQBA 4MFQA 4OADA 2O4HA 3D67A 2KVOA 1KK0A 4IAVA 4RPDA 2Q6IA 1CQXA 1R5OA 2BPOA 1UD2A 4XKWA 2Q44A 4GS4A 4IHMA 2FX3A 3N5FA 2CBXA 4Z4WA 3FJUA 1D2EA 4CYPA 2QMUA 5DSZA 2PJ0A 3MMPA 1IOIA 2CK3A 4FD5A 2Q4YA 2WPWA 5E96A 1QX4A 2D74A 3WC6A 1Y7EA 2EO8A 3IEHA 4IF5A 1BOBA 2IL4A 2PJ4A 2PR8A 4DUKA 5I4MA 4MRIA 1HA3A 4YAFA 4B3FX 2B4DB 3OKXA 4F6AA 4UZFA 1TXRA 4HNXB 1QVGB 1B87A 1MRZA 4FBEA 3E0KA 3CW2A 4M6HA 2VEZA 4A95A 4AG7A 1ZO0A 4M6GA 2ZITA 1Y9WA 1YX0A 5LYDA 4TMZA 5A88A 1LAPA 3WNBA 3D8PA 3JQPA 3SJGA 4P2NA 4X05A 2Z3KA 2Z10A 1QFZA 5FA6A 5TY0A 2CXAA 1N71A 1A2ZA 1Z4EA 3G8WA 4R9MA 4B12A 1CP7A 1FRNA 2A4NA 3OW2B 2FXFA 3VH9A 5KTAA 1T6XA 4YWYA 4N3GA 4WQMA 4K1XA 3KASA 3H8EA 3FYNA 4ZGNB 2B3VA 1XOVA 4B5PA 4Z4YA 4FD7A 2V77A 3ONYA 3FECA 3GB0A 3AGPA 3SI2A 4EMEA 3AGQA 3RY8A 4DK0A 1LAMA 4AC9A 1ZM4A 3B3WA 1BLIA 2XZPA 5F09A 3BJ8A 3KQXA 1OBRA 2ZPAA 3B3CA 2J9AA 2GQFA 2XEGA 2B5GB 4B48A 1KK3A 1GAQA 1MABA 2VNHA 2ZEOA 3VR6A 4XQFA 4RI1A 1IB1E 4QHYA 2Q7BA 2C6CA 1CPXA 3SJEA 4ACBA 1BPLA 5LYLA 1JA1A 2JN9A 2J8RA 2DETA 3LODA 3FBUA 3I1FA 4R6TA 4H6ZA 2QMLA 2PVWA 2PE3A 2OBTA 4ZI6A 3TT2A 1WOSA 3CCRB 5AG7A 4NBSA 2OZUA 2ZW5A 3DSBA 3CP8A 4P44A 2HMAA 4JXRA 2XOKA 3OJXA 3D7FA 1KUVA 5F47A 4OC4A
chains in the Genus database with same CATH topology
1TKFA 4ONWA 4ZY0A 4UF4A 5HVFA 5DS0A 2PJ3A 1KWMA 4UIAA 3VARA 4MCPA 4P4DA 4ZX9A 3SI1A 5HVGA 3ISXA 3KR5A 2PJ1A 4A37A 3FEEA 2CTBA 2AFUA 2AFOA 2AFXA 3PBBA 3ISZA 5K8NA 3WC7A 4NGNA 1TKJA 3VATA 2ZEEA 2GLJA 3WABA 2EK8A 2AFMA 4KSIA 5LRGA 3KHZA 3FVLA 1VHOA 3TX8A 2JBKA 3B35A 3PEIA 1TF9A 5HXDA 2Q43A 2ZEHA 3WT4A 4P10A 2GU2A 4MHPA 1CBXA 2ZEDA 3NH4A 3FF3A 2PJAA 2ZOGA 2OR4A 3KHXA 1LFWA 3BHXA 1VHEA 3B3TA 1F2PA 1FNOA 2QVPA 4BD9A 4B6ZA 3WC5A 2PIYA 3IFEA 5D8NA 2O53A 3KI9A 4OC2A 2HC9A 3RBUA 4JZ0A 3SJFA 3DGVA 1YW4A 3RZAA 2ZEFA 4OIDA 3V38A 5K8OA 2ZENA 1ZG7A 2GLFA 2F7VA 4ZY1A 4NGRA 1CPSA 5IB9A 4PPZA 2PJ7A 3IO1A 2NYQA 3D66A 3PBEA 3D7DA 1CX8A 3PB7X 4A94A 4DJLA 4ZYQA 7CPAA 2ZEPA 4NGQA 2C1CA 1PCAA 4Q7AA 1Z8LA 1CP6A 4P4FA 5K8PA 2JBJA 4RUHA 1BLLE 3D7GA 3D4UA 4K3NA 4MCRA 1M4LA 1CG2A 4NJRA 1XMBA 4LQGA 1Z2LA 2PJ5A 2V8HA 3FEDA 1TKHA 4X3RA 4P6YA 4NGSA 3PRTA 1DTDA 4DYOA 2AFWA 6CPAA 4R76A 1LOKA 4MCQA 2PCUA 1IY7A 4EFDA 4OIWA 5HVHA 2EWBA 4AXVA 1YLOA 4MCSA 3B3VA 2PIZA 1ZLIA 2CTCA 1TF8A 4A39A 3V7ZA 3CPXA 3TC8A 5THWA 2RFHA 3IIBA 2CIJA 3D7HA 3B2YA 3LMSA 3RAMA 2NSMA 3FH4A 3KL9A 4NGMA 4GM5A 4NJQA 5CBMA 2V8DA 5J1QA 3MRUA 3T8WA 4EWTA 2RB7A 3IC1A 2IMOA 1Q7LA 1Y0RA 1VIXA 1HEEA 4OC5A 2POKA 1XBUA 3CPAA 4OC1A 4OC3A 3DLJA 4UEZA 2PJCA 3KQZA 4X2TA 4PXBA 1ELMP 1UWYA 3H8FA 4P4IA 4MXUA 3IWWA 5K8MA 4UIBA 1QMUA 3NH8A 3KGQA 2PJBA 4OKOA 2ZEMA 2WYRA 1F57A 2WZNA 1F2OA 8CPAA 2V8VA 3L2NA 1ELLP 3KZWA 2QJ8A 1YMEA 3S9LA 3BI0A 3LWUA 3S9MA 2ZEGA 1LCPA 2JEWA 4OC0A 2IQ6A 2XEJA 4IK2A 3D68A 1HDUA 3PB8X 2IJZA 1RTQA 5JGFA 3PB4X 4R8FA 2PRQA 2VL1A 4YU9A 1YW6A 3GLJA 4P4JA 1ZLHA 3HUVA 2C6GA 1XFOA 2OOTA 4WWVA 1ZG9A 1ARMA 3NH5A 3BXMA 2G9DA 2O4HA 3D67A 1AMPA 1AYEA 5LRJA 1LANA 3HLPA 1NSAA 4IAVA 1ARLA 5D29A 3NFZA 4W9YA 4MHNA 1R3NA 3CT9A 4IHMA 3JRUA 1BAVA 3N5FA 3FJUA 1IGBA 1JQGA 3S9NA 4PXDA 2FVGA 2PJ0A 1ZG8A 1PYTB 2BCOA 1GYTA 2XEFA 4PXEA 3WC6A 1Y7EA 1BPNA 3IEHA 2PJ4A 4OMEA 4DUKA 5I4MA 1EE3P 2ZOFA 4MHYA 3QNVA 2PJ6A 4FAIA 4MRIA 2I3CA 3SI0A 2ABZA 1H8LA 4X8IA 3PB6X 4NFRA 4O23A 1TXRA 5ELYA 3KR4A 1XJOA 1R43A 2PJ9A 2AFSA 2V8GA 2CF4A 2C6PA 2HB6A 2PJ2A 5LRKA 4TNUA 4FBEA 3CDXA 3FX6A 4UEEA 5LYDA 2ZELA 3B7IA 1LAPA 4WJBA 4P4EA 3K2KA 2F8HA 3BI1A 3SJGA 4Z65A 4PXCA 2PVVA 3FMCA 1CP7A 4ZY2A 4PQAA 3GUXA 3VH9A 4P45A 4YWYA 4JYWA 3KASA 3H8EA 2QYVA 3K9TA 1FT7A 2EK9A 4G1PA 1Z5RA 3SJXA 4F9VA 4ZX8A 1HDQA 2V77A 5JM6A 3FECA 5LYFA 4MHZA 2ANPA 3GB0A 4FUUA 3SI2A 4EMEA 4R7MA 3PFEA 1LAMA 3PFOA 1VGYA 3B3WA 5LYIA 1DE4C 5F09A 2GREA 4MMOA 4F9UA 3KQXA 1BPMA 3PB9X 4F8ZA 1OBRA 1QQ9A 4H2KA 3B3CA 5JH9A 2J9AA 2XEGA 3IJ3A 1Y0YA 2ZEOA 4OP4A 2XEIA 2Q4ZA 2BOAA 2C6CA 4TWEA 1CPXA 4NGPA 3SJEA 5LYLA 3B3SA 3I1UA 4UEFA 5CPAA 1YSJA 3MN8A 4FWUA 3NA6A 4R6TA 2PVWA 2PE3A 2Q51A 4ZI6A 2BO9A 4NGTA 4CPAA 3H8GA 2AFZA 4P4BA 4A38A 4P44A 2DEAA 3D7FA 1XRYA 2PJ8A 4OC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKF A;  4ONW A;  4ZY0 A;  4UF4 A;  5HVF A;  5DS0 A;  2PJ3 A;  1KWM A;  4UIA A;  3VAR A;  4MCP A;  4P4D A;  4ZX9 A;  3SI1 A;  5HVG A;  3ISX A;  3KR5 A;  2PJ1 A;  4A37 A;  3FEE A;  2CTB A;  2AFU A;  2AFO A;  2AFX A;  3PBB A;  3ISZ A;  5K8N A;  3WC7 A;  4NGN A;  1TKJ A;  3VAT A;  2ZEE A;  2GLJ A;  3WAB A;  2EK8 A;  2AFM A;  4KSI A;  5LRG A;  3KHZ A;  3FVL A;  1VHO A;  3TX8 A;  2JBK A;  3B35 A;  3PEI A;  1TF9 A;  5HXD A;  2Q43 A;  2ZEH A;  3WT4 A;  4P10 A;  2GU2 A;  4MHP A;  1CBX A;  2ZED A;  3NH4 A;  3FF3 A;  2PJA A;  2ZOG A;  2OR4 A;  3KHX A;  1LFW A;  3BHX A;  1VHE A;  3B3T A;  1F2P A;  1FNO A;  2QVP A;  4BD9 A;  4B6Z A;  3WC5 A;  2PIY A;  3IFE A;  5D8N A;  2O53 A;  3KI9 A;  4OC2 A;  2HC9 A;  3RBU A;  4JZ0 A;  3SJF A;  3DGV A;  1YW4 A;  3RZA A;  2ZEF A;  4OID A;  3V38 A;  5K8O A;  2ZEN A;  1ZG7 A;  2GLF A;  2F7V A;  4ZY1 A;  4NGR A;  1CPS A;  5IB9 A;  4PPZ A;  2PJ7 A;  3IO1 A;  2NYQ A;  3D66 A;  3PBE A;  3D7D A;  1CX8 A;  3PB7 X;  4A94 A;  4DJL A;  4ZYQ A;  7CPA A;  2ZEP A;  4NGQ A;  2C1C A;  1PCA A;  4Q7A A;  1Z8L A;  1CP6 A;  4P4F A;  5K8P A;  2JBJ A;  4RUH A;  1BLL E;  3D7G A;  3D4U A;  4K3N A;  4MCR A;  1M4L A;  1CG2 A;  4NJR A;  1XMB A;  4LQG A;  1Z2L A;  2PJ5 A;  2V8H A;  3FED A;  1TKH A;  4X3R A;  4P6Y A;  4NGS A;  3PRT A;  1DTD A;  4DYO A;  2AFW A;  6CPA A;  4R76 A;  1LOK A;  4MCQ A;  2PCU A;  1IY7 A;  4EFD A;  4OIW A;  5HVH A;  2EWB A;  4AXV A;  1YLO A;  4MCS A;  3B3V A;  2PIZ A;  1ZLI A;  2CTC A;  1TF8 A;  4A39 A;  3V7Z A;  3CPX A;  3TC8 A;  5THW A;  2RFH A;  3IIB A;  2CIJ A;  3D7H A;  3B2Y A;  3LMS A;  3RAM A;  2NSM A;  3FH4 A;  3KL9 A;  4NGM A;  4GM5 A;  4NJQ A;  5CBM A;  2V8D A;  5J1Q A;  3MRU A;  3T8W A;  4EWT A;  2RB7 A;  3IC1 A;  2IMO A;  1Q7L A;  1Y0R A;  1VIX A;  1HEE A;  4OC5 A;  2POK A;  1XBU A;  3CPA A;  4OC1 A;  4OC3 A;  3DLJ A;  4UEZ A;  2PJC A;  3KQZ A;  4X2T A;  4PXB A;  1ELM P;  1UWY A;  3H8F A;  4P4I A;  4MXU A;  3IWW A;  5K8M A;  4UIB A;  1QMU A;  3NH8 A;  3KGQ A;  2PJB A;  4OKO A;  2ZEM A;  2WYR A;  1F57 A;  2WZN A;  1F2O A;  8CPA A;  2V8V A;  3L2N A;  1ELL P;  3KZW A;  2QJ8 A;  1YME A;  3S9L A;  3BI0 A;  3LWU A;  3S9M A;  2ZEG A;  1LCP A;  2JEW A;  4OC0 A;  2IQ6 A;  2XEJ A;  4IK2 A;  3D68 A;  1HDU A;  3PB8 X;  2IJZ A;  1RTQ A;  5JGF A;  3PB4 X;  4R8F A;  2PRQ A;  2VL1 A;  4YU9 A;  1YW6 A;  3GLJ A;  4P4J A;  1ZLH A;  3HUV A;  2C6G A;  1XFO A;  2OOT A;  4WWV A;  1ZG9 A;  1ARM A;  3NH5 A;  3BXM A;  2G9D A;  2O4H A;  3D67 A;  1AMP A;  1AYE A;  5LRJ A;  1LAN A;  3HLP A;  1NSA A;  4IAV A;  1ARL A;  5D29 A;  3NFZ A;  4W9Y A;  4MHN A;  1R3N A;  3CT9 A;  4IHM A;  3JRU A;  1BAV A;  3N5F A;  3FJU A;  1IGB A;  1JQG A;  3S9N A;  4PXD A;  2FVG A;  2PJ0 A;  1ZG8 A;  1PYT B;  2BCO A;  1GYT A;  2XEF A;  4PXE A;  3WC6 A;  1Y7E A;  1BPN A;  3IEH A;  2PJ4 A;  4OME A;  4DUK A;  5I4M A;  1EE3 P;  2ZOF A;  4MHY A;  3QNV A;  2PJ6 A;  4FAI A;  4MRI A;  2I3C A;  3SI0 A;  2ABZ A;  1H8L A;  4X8I A;  3PB6 X;  4NFR A;  4O23 A;  1TXR A;  5ELY A;  3KR4 A;  1XJO A;  1R43 A;  2PJ9 A;  2AFS A;  2V8G A;  2CF4 A;  2C6P A;  2HB6 A;  2PJ2 A;  5LRK A;  4TNU A;  4FBE A;  3CDX A;  3FX6 A;  4UEE A;  5LYD A;  2ZEL A;  3B7I A;  1LAP A;  4WJB A;  4P4E A;  3K2K A;  2F8H A;  3BI1 A;  3SJG A;  4Z65 A;  4PXC A;  2PVV A;  3FMC A;  1CP7 A;  4ZY2 A;  4PQA A;  3GUX A;  3VH9 A;  4P45 A;  4YWY A;  4JYW A;  3KAS A;  3H8E A;  2QYV A;  3K9T A;  1FT7 A;  2EK9 A;  4G1P A;  1Z5R A;  3SJX A;  4F9V A;  4ZX8 A;  1HDQ A;  2V77 A;  5JM6 A;  3FEC A;  5LYF A;  4MHZ A;  2ANP A;  3GB0 A;  4FUU A;  3SI2 A;  4EME A;  4R7M A;  3PFE A;  1LAM A;  3PFO A;  1VGY A;  3B3W A;  5LYI A;  1DE4 C;  5F09 A;  2GRE A;  4MMO A;  4F9U A;  3KQX A;  1BPM A;  3PB9 X;  4F8Z A;  1OBR A;  1QQ9 A;  4H2K A;  3B3C A;  5JH9 A;  2J9A A;  2XEG A;  3IJ3 A;  1Y0Y A;  2ZEO A;  4OP4 A;  2XEI A;  2Q4Z A;  2BOA A;  2C6C A;  4TWE A;  1CPX A;  4NGP A;  3SJE A;  5LYL A;  3B3S A;  3I1U A;  4UEF A;  5CPA A;  1YSJ A;  3MN8 A;  4FWU A;  3NA6 A;  4R6T A;  2PVW A;  2PE3 A;  2Q51 A;  4ZI6 A;  2BO9 A;  4NGT A;  4CPA A;  3H8G A;  2AFZ A;  4P4B A;  4A38 A;  4P44 A;  2DEA A;  3D7F A;  1XRY A;  2PJ8 A;  4OC4 A; 
#chains in the Genus database with same CATH topology
 2WSA A;  3GVJ A;  4IW3 B;  4X07 A;  1PKV A;  1S7K A;  4P4D A;  2OZH A;  3KR5 A;  2VXK A;  4M4S A;  2PJ1 A;  1M90 D;  4BMH A;  2AFX A;  2G3T A;  3PBB A;  4UA3 A;  3ISZ A;  3WC7 A;  2X6Y A;  3H9N A;  3G6E B;  2P6G A;  3WBJ A;  2AFM A;  3ASS A;  3MHP A;  3BCD A;  4E0F A;  4FD6 A;  3V7A A;  4B13 A;  3W2H A;  2I1L A;  3CMM A;  1PU9 A;  4PV6 A;  3R9F A;  3TOA A;  3TX8 A;  2ZW7 A;  3DDY A;  4P10 A;  2FT0 A;  4AF7 A;  2G0B A;  5EC4 A;  3NH4 A;  1H8E A;  2OR4 A;  2EUI A;  3TCV A;  1F2P A;  3GSI A;  3CP2 A;  3S6G A;  4B6Z A;  4B3X A;  3IFE A;  3FXT A;  2O53 A;  4OC2 A;  2HC9 A;  1Q81 D;  3RBU A;  3RYO A;  1YHQ B;  3VO2 A;  4PSX A;  3WR7 A;  4B14 A;  2ZBV A;  3OZV A;  2CNS A;  1OGJ A;  4XPD B;  1WPC A;  1ZG7 A;  2OBS A;  4ZBG A;  4ZY1 A;  2PJ7 A;  3PBE A;  2V7Q A;  2YWF A;  3AST A;  3FPK A;  1Z8T A;  2BV3 A;  3LVB A;  4ZV4 A;  1KUY A;  4RDJ A;  4ZYQ A;  7CPA A;  2ZEP A;  3CCV B;  4KLV A;  5K8P A;  2JBJ A;  2R1I A;  5F49 A;  1M4L A;  3OE7 A;  1CG2 A;  2VZZ A;  4NJR A;  4LQG A;  2PJ5 A;  3FED A;  4LC0 A;  1V0F A;  5FVJ A;  4HE5 A;  3F5B A;  5H5J A;  2HDN B;  4NGS A;  3PRT A;  4JXQ A;  1DTD A;  5GCN A;  2V7X A;  2AFW A;  4UWI A;  6CPA A;  4RCZ A;  4KKS A;  4MCQ A;  2DEU A;  5KTD A;  4KKT A;  1ZM9 A;  1YJW B;  4ONU A;  4EFD A;  5A28 A;  4G1V A;  4Z4R A;  4PC2 A;  4XON A;  4XPK A;  3CZX A;  1XE1 A;  2CTC A;  1TF8 A;  4XLC A;  2BF4 A;  4HKF A;  3V7Z A;  3CPX A;  2HV2 A;  3LQE A;  4MFZ A;  1H42 A;  3GVL A;  1PJ5 A;  4QUZ A;  4LX9 A;  3KL9 A;  1IHM A;  2VZL A;  4GM5 A;  3W6S A;  4M6I A;  5CBM A;  2R7H A;  4CAF A;  4L8A A;  3OW7 A;  1Q7L A;  2DF5 A;  3Q3A A;  4LBV A;  4P12 A;  5H84 A;  1M4G A;  3BLN A;  2POK A;  3ASQ A;  3WYA A;  1M1K D;  2Z6B D;  4C7I A;  2GFQ A;  4RD3 A;  3JVN A;  4UEZ A;  4X2T A;  1VQO B;  4XNF A;  4A30 A;  3I55 B;  1ELM P;  2XNJ A;  1UWY A;  2ZZF A;  1JNY A;  4CYN A;  3GKR A;  4MBU A;  2CRV A;  2DOG A;  4MFL A;  5K8M A;  1QMU A;  4PAB A;  3NH8 A;  2WYR A;  4OP7 A;  1F2O A;  4KSF A;  3VMF A;  3MGD A;  5I0C A;  2QJ8 A;  1IOF A;  2FS5 A;  4KOV A;  4RS2 A;  1NMT A;  3S6F A;  2X7B A;  3CPW B;  3S9M A;  1TIQ A;  5HMN A;  1Z9U A;  3R95 A;  3P27 A;  1B6B A;  2XEJ A;  4IK2 A;  4OPO A;  1E64 A;  3PB8 X;  2QA4 B;  4PK3 A;  2BL1 A;  1QGZ A;  2FIW A;  2J8N A;  2OB0 A;  4M85 A;  3AVT A;  4R8F A;  2VL1 A;  4YU9 A;  4AB7 A;  4P4J A;  3N7Z A;  2C77 A;  4WZL A;  1XFO A;  2QEX B;  2V31 A;  2Q4V A;  3NH5 A;  4ORF A;  4JLY A;  3ZIA A;  2XZO A;  5A8A A;  1EFT A;  4UBR A;  4RCY A;  4P26 A;  5LRJ A;  3HLP A;  3I56 B;  2W6J A;  3R96 A;  1FNM A;  5D29 A;  1EXM A;  1R3N A;  4YHB A;  3JRU A;  1VQ8 B;  4TN1 A;  4X5K A;  1COW A;  2FVG A;  4B4D A;  3ZUG A;  2AJ6 A;  3Q38 A;  4X7F A;  5FO0 A;  1EFU A;  1IB0 A;  1H8H A;  4XL9 A;  1GYT A;  2XEF A;  1BO4 A;  4MJ8 A;  1N0U A;  5HKK A;  1S7F A;  2JJ2 A;  2B7B A;  4RD4 A;  2DXQ A;  1N06 A;  4II2 A;  1QGA A;  4WZE A;  1EE3 P;  2YWG A;  2ZOF A;  4PC3 A;  3A3G A;  5JQ4 A;  4CGL A;  1OB0 A;  3EFA A;  1GR1 A;  5AG6 A;  2WR8 A;  3PB6 X;  4NFR A;  3PZJ A;  2B5O A;  2QE7 A;  1ZM3 A;  3GIU A;  5GV8 A;  3JTK A;  5HH1 A;  2ZTN A;  1MJA A;  5ELY A;  3W6X A;  4RD2 A;  2E1R A;  1XJO A;  2HB6 A;  5J8F A;  4OPV A;  1NBM A;  4UEE A;  3W5H A;  4YAU A;  4ZCI A;  1M44 A;  3CES A;  1V0E A;  4NEX A;  4XD7 A;  4PSW A;  3K2K A;  2F8H A;  2VJJ A;  4RN7 A;  1NE9 A;  5DWM A;  4G1B A;  2DER A;  3CMA B;  3MCA A;  3EC4 A;  3ZZI A;  3CTA A;  3A8I A;  4II9 A;  3OFN A;  1EP1 B;  4NNJ A;  4JYW A;  3Q39 A;  1M1D A;  2Z3P A;  2BVN A;  1YJ9 B;  2F1L A;  4ASU A;  2QYV A;  1IYL A;  5EMN A;  1HDQ A;  4ROX A;  1XMT A;  5JM6 A;  4EH1 A;  1MJ9 A;  3K9U A;  4MHZ A;  2ANP A;  2DYI A;  4R7M A;  1GJR A;  3PFO A;  1TTT A;  1DE4 C;  4R3L A;  3TO9 A;  3WNC A;  4MMO A;  1BPM A;  3PB9 X;  4C68 A;  4OOV A;  1WP6 A;  3V76 A;  4YAW A;  1FNB A;  4MFJ A;  1Y0Y A;  1JA0 A;  2FE7 A;  1YK3 A;  4OP4 A;  4ZCL A;  2Q4Z A;  2BOA A;  5IYW A;  5C88 A;  4Q7J B;  4XR6 A;  4HNY B;  1WU8 A;  2X6W A;  1ELO A;  4RJL A;  4GQN A;  1YSJ A;  3MN8 A;  3BY1 A;  2GJK A;  3R1K A;  1Q2C A;  2Q51 A;  5KSW B;  3U6K A;  2WUU A;  4Y49 C;  1A8P A;  4CPA A;  1W0K A;  3GY9 A;  1WOO A;  3E1Y E;  4KLW A;  2P6F A;  2FCK A;  3B78 A;  1K73 D;  4RD0 A;  2ODF A;  1H85 A;  2Z3M A;  2K5T A;  3FPP A;  5HVF A;  1CJW A;  4DNT B;  5DS0 A;  2PJ3 A;  1KWM A;  1GVH A;  4AVA A;  4MFP A;  3VAR A;  4MCP A;  4JWP A;  4ZX9 A;  1E63 A;  3ISX A;  4TSF A;  2PIA A;  2LZJ A;  2ZL6 A;  4A37 A;  1Q82 D;  3W2F A;  2CTB A;  1VLY A;  5K8N A;  2XZL A;  4GXH A;  1F20 A;  3SLN A;  3EO4 A;  3ZZU A;  1TLL A;  3JQQ A;  3ZPN A;  3PUN A;  4AVZ A;  4QC6 A;  1XEB A;  2JBK A;  5HXD A;  2W6I A;  3WT4 A;  1CBX A;  4QV2 A;  1AUG A;  4E2A A;  3CCU B;  1E43 A;  4XOR A;  5TR9 A;  1W87 A;  3BJ7 A;  3HAG A;  2CNT A;  4PC7 A;  1T5E A;  2QVP A;  4DQK A;  4BD9 A;  2O28 A;  1QST A;  4HPS A;  1B23 P;  5AG4 A;  1VQK B;  2VI7 A;  4G6I A;  3ZBT A;  1QH0 A;  5IB0 A;  1YI2 B;  3SJF A;  4YFJ A;  2ZZE A;  4XN0 A;  4R57 A;  4RPB A;  1YW4 A;  3RZA A;  2ZEF A;  4II3 A;  2ZXV A;  4OID A;  1XE4 A;  3D3S A;  2X3U A;  2GIV A;  2OU2 A;  1V0C A;  2F4N A;  2F7V A;  1Z4R A;  4NGR A;  5IB9 A;  1VQN B;  4CQJ A;  3D7D A;  2PQ8 A;  3PB7 X;  4A94 A;  4E0A A;  4DJL A;  2QTL A;  3U2Q A;  4B44 A;  4CGO A;  4BIN A;  4NGQ A;  2C1C A;  1VQ4 B;  1J4J A;  4KOW A;  3A1P A;  1CP6 A;  3D4U A;  1QUF A;  1L0C A;  4P25 A;  4MCR A;  5AG5 A;  4FK8 A;  1XMB A;  5G22 A;  4OOS A;  4B43 A;  2BMW A;  3RNZ A;  4X3R A;  3WXM A;  2D3N A;  3R9G A;  3LD2 A;  1EWY A;  2M5S A;  3WBK A;  4OAE A;  2VBS A;  4P1V A;  1PJ6 A;  1QFY A;  4QFM A;  3VWD A;  1QG0 A;  1NB9 A;  1LOK A;  2ZXI A;  4M1K A;  1SKY B;  4BPR A;  1IY7 A;  4OIW A;  5HVH A;  4MYU A;  1EP2 B;  5G1Z A;  4XNH C;  4MCS A;  5TV2 A;  3F0A A;  3AVX A;  1ZLI A;  1YJN B;  2JIZ A;  4X7E A;  1YRE A;  3TC8 A;  2RFH A;  2CIJ A;  5AGE A;  1P0H A;  2ZBU A;  4KVM E;  3AVU A;  2G3A A;  2X85 A;  3BY2 A;  3SHP A;  2Z3N A;  2VQY A;  4NJQ A;  4AVB A;  5J1Q A;  2GK7 A;  3MRU A;  4P6V F;  2ZL5 A;  4QB9 A;  2YNE A;  2Q04 A;  2BSW A;  3GQB A;  5F46 A;  4LBW A;  1Y0R A;  2F43 A;  2Q6L A;  4YEJ A;  5HXB A;  1HZE A;  5CDF A;  4OC1 A;  2R9V A;  3KQZ A;  1P4M A;  3F8K A;  4PXB A;  1P4N A;  4P4I A;  1SKQ A;  4UWJ A;  1E62 A;  3ZZT A;  3U6B A;  4UIB A;  1G7C A;  1F57 A;  4OLL A;  8CPA A;  2FL4 A;  1OGI A;  4C0S A;  3IU2 A;  3IGR A;  3AVV A;  3R6J A;  1U2R A;  2JDD A;  3B82 A;  2C5B A;  3BC9 A;  2JEW A;  4OC0 A;  3QAH A;  4XOP A;  3CCL B;  3H4Q A;  3A8K A;  3FB3 A;  3D68 A;  4Y7C A;  4C2X A;  2HCJ B;  1S60 A;  5B6I A;  3TTH A;  3T9Y A;  1YR0 A;  3PB4 X;  1G7T A;  1YW6 A;  1XIX A;  3B8H A;  5F4O A;  1ZLH A;  3HUV A;  3AVW A;  4Z4Z A;  2Y0M A;  3PA2 A;  4H89 A;  4HNW B;  1DDI A;  3CC7 B;  2C6G A;  1VQM B;  3OPO A;  1ZG9 A;  1ARM A;  2OK8 A;  2DY1 A;  3CCE B;  1KZF A;  5IV0 A;  2XGJ A;  4WZT A;  3R9E A;  1VQ9 B;  2QTZ A;  5J3O A;  3DR6 A;  1PUA A;  3TOB A;  4CS0 B;  1AYE A;  1LRZ A;  1S72 B;  2OK7 A;  5BSY A;  4L89 A;  1ARL A;  3NFZ A;  4W9Y A;  1OB5 A;  4YAL A;  4MHN A;  2VBQ A;  3CT9 A;  2EIX A;  3S9N A;  1IGB A;  4QVT A;  5GV7 A;  1KZL A;  4U9U A;  5JBQ A;  4LQ6 A;  1S0U A;  1Q9S A;  4Z1M A;  5FO1 A;  1E3Z A;  1UD4 A;  2BCO A;  4PXE A;  4A2Z A;  1BPN A;  2E1B A;  3CCQ B;  2Q6K A;  4OME A;  4NXY A;  2V4D A;  3SKB A;  2PJ6 A;  3QFS A;  4AG9 A;  5E6T A;  2B7C A;  2ZW6 A;  3SI0 A;  1H8L A;  4X8I A;  3QFT A;  1DDG A;  4O23 A;  2DPT A;  1X12 A;  1R43 A;  2AFS A;  2V8G A;  1BX0 A;  4TNU A;  3CDX A;  1CM0 A;  4KOT A;  5THX A;  3TO6 A;  3B7I A;  2P3M A;  1KC8 D;  5F4J A;  3BI1 A;  4NSQ A;  3FJO A;  2I00 A;  4TKO B;  3A9L A;  3H94 A;  3FMC A;  4PAA A;  4ZY2 A;  1AIP A;  3GYA A;  3FNC A;  2YGW A;  3GUX A;  4X7C A;  4FWT A;  1WSR A;  3CD6 B;  4KOR A;  5IX3 A;  2CY2 A;  1NJI D;  3K9T A;  2EK9 A;  4G1P A;  3SJX A;  4AVC A;  2D4O A;  3OAA A;  3DNS A;  4PC1 A;  5LYF A;  4MYT A;  4G7X A;  2CND A;  3PFE A;  1QGY A;  2JLM A;  2Z11 A;  3A8J A;  1VGY A;  1XF8 A;  4X0C A;  4R71 A;  3CCM B;  5F4M A;  4RDL A;  4F8Z A;  3JU4 A;  2HQY A;  5JH9 A;  1UD8 A;  4U5Y A;  2PLF A;  3EXN A;  4CYQ A;  3SJZ A;  3B8G A;  2OBR A;  2XEI A;  4KUB A;  4X7D A;  1MK4 A;  4NGP A;  2J8M A;  1R5B A;  4YAO A;  2RC6 A;  1V5V A;  1KD1 D;  2WJY A;  1E79 A;  4AF6 A;  4C7H A;  3KEW A;  4TMX A;  2B4D A;  4FWU A;  4KOY A;  2QN6 A;  1FRQ A;  5J8C A;  2C2W A;  4KOX A;  2BO9 A;  4B11 A;  1ZUN B;  2REF A;  4DNC A;  2C4U A;  4F0Y A;  4P4B A;  4TMV A;  4A38 A;  2X0K A;  2DEA A;  2WJV A;  1KK2 A;  4XLE A;  2I79 A;  4KSA A;  2QDX A;  3RO0 A;  5C82 A;  3WQZ A;  4KVO E;  4UF4 A;  1UD5 A;  3G71 B;  1QFJ A;  1W35 A;  4Q38 A;  4UIA A;  1Z8W A;  3G3S A;  5BSX A;  2F1M A;  5G21 A;  2Z0Z A;  4R87 A;  2Q7S A;  2V7U A;  3PEN A;  3VNU A;  3IWG A;  2AFU A;  1YIJ B;  1VJS A;  1UD6 A;  4XM3 A;  1K8A D;  1FND A;  1TKJ A;  4QBJ A;  5KNL A;  3VAT A;  2YND A;  2ZEE A;  2GLJ A;  2J7K A;  3TE4 A;  2OZG A;  3FVL A;  1S5K A;  2B4B A;  2V7W A;  2BM0 A;  4KOS A;  1VHO A;  4UCP A;  5J35 A;  3DR8 A;  1DAR A;  1CNE A;  1RQP A;  3B35 A;  4LBZ A;  3PEI A;  2XNC A;  3P26 A;  2Q43 A;  2ZEH A;  2GU2 A;  1XB2 A;  1W2B B;  1N0V C;  4DK1 A;  1Y7R A;  4E8O A;  3FF3 A;  2ZOG A;  3G05 A;  1LFW A;  4Q36 A;  1VHE A;  1BMF A;  2D9R A;  2GAN A;  3B3T A;  1FNO A;  2B5G A;  3WC5 A;  1VQ7 B;  1UMK A;  4ZCM A;  3KI9 A;  4JZ0 A;  2OH1 A;  4UFV A;  2NPF A;  3DGV A;  4Y49 B;  4C2Z A;  1E1Q A;  3BCF A;  5K8O A;  1S7L A;  2ZEN A;  1NB0 A;  2GLF A;  2JDC A;  3PGP A;  4F0X A;  1Q2Y A;  1JB9 A;  1ZM2 A;  1CPS A;  4PPZ A;  3IO1 A;  2NYQ A;  3D66 A;  1B2R A;  2Q0Y A;  1CX8 A;  1I1D A;  3I9S A;  3ASR A;  1D1N A;  3D2P A;  1WOP A;  3W2G A;  1VQP B;  1BX1 A;  1IJE A;  4B47 A;  1PCA A;  4A31 A;  1Z8L A;  4C43 A;  4G7W A;  1BLL E;  3JQR A;  5JPH A;  1G7R A;  4L8J A;  2GPJ A;  2FSR A;  3LAC A;  3GIR A;  1Z2L A;  1UFH A;  1N08 A;  2V8H A;  4CRZ B;  2B3U A;  2ZW4 A;  2X6X A;  1Q7Y D;  3JUW A;  4KKU A;  5L46 A;  4DYO A;  3G4S B;  4LUA A;  2DIE A;  1X10 A;  4R3K A;  2PCU A;  3W91 A;  4FD4 A;  2VNK A;  2EWB A;  3S6H A;  2PSW A;  3B3V A;  2PIZ A;  4A32 A;  2DPS A;  4DNR B;  1ON0 A;  3CC2 B;  2X53 S;  4A39 A;  2Q6O A;  4Z4T A;  5F48 A;  2H5M A;  2VJI A;  4HIZ A;  3LMS A;  1GHE A;  2FIA A;  2C5H A;  1OZP A;  3OZU A;  1VF7 A;  4M2L A;  4H6U A;  1WDT A;  3C26 A;  1I18 A;  4C2Y A;  3T8W A;  4EWT A;  3CCS B;  2RB7 A;  3IC1 A;  4Y9R A;  3QAY A;  3PA1 A;  3SJP A;  2OTL B;  1YVO A;  1JJ2 B;  4PGO A;  2NMT A;  1XBU A;  3CPA A;  4TMT A;  4OC3 A;  3QFR A;  1VQ5 B;  2PMD A;  3DLJ A;  4HE6 A;  1I21 A;  2BGJ A;  3V8I A;  4MXU A;  1EP3 B;  2CNM A;  2P6E A;  4ZGQ B;  5H86 A;  1FDR A;  2OTJ B;  3KGQ A;  2ZEM A;  2WZN A;  2KCW A;  2PRB A;  2CC2 A;  3L2N A;  1ELL P;  4P3I A;  2AHO A;  2WZP P;  1BJK A;  1EFR A;  1K4J A;  2EBJ A;  3LWU A;  5A27 A;  1LCP A;  4I49 A;  3TO7 A;  2RC4 A;  5IYN A;  4CAE A;  3Q6R A;  4B10 A;  1HDU A;  3SEJ A;  1RTQ A;  4CGN A;  5JGF A;  2Z3O A;  1JWQ A;  4XNH B;  1YLE A;  2VNJ A;  2PRQ A;  5EMI A;  4MY0 A;  5IYP A;  3GLJ A;  4BBH A;  2HLD A;  1QSM A;  1GAW A;  4NCZ A;  3QB8 A;  2OOT A;  1KMH A;  4CGM A;  3CB4 A;  3IWE A;  2V7T A;  1AMO A;  4U9Y A;  2GE3 A;  4XN3 A;  2G9D A;  2VBU A;  4RDK A;  1WSV A;  2YWE A;  3OJW A;  1AMP A;  4MY3 A;  1LAN A;  1NSA A;  1Z8X A;  5HZB A;  4Z4U A;  3OZW A;  1IYK A;  1BAV A;  4QUS A;  1JQG A;  4DQL A;  4PXD A;  3DDD A;  4FN5 A;  1R57 A;  4M3S A;  1ZG8 A;  1YVK A;  1PYT B;  2BM1 A;  4KVX A;  3NE5 B;  1KK1 A;  5KTC A;  4M0L A;  3P2H A;  4P22 A;  5ISV A;  3CXC B;  1I8D A;  4YGO A;  3SXO A;  3CXS A;  2QIR A;  4XKV A;  4MHY A;  3QNV A;  1W9X A;  2EVN A;  4FAI A;  4PK2 A;  2I3C A;  3NE8 A;  1TUI A;  1RO5 A;  2ABZ A;  4OOX A;  2X8K A;  3OEH A;  3GVK A;  1F60 A;  1Q2D A;  2BEI A;  3W5V A;  3QE2 A;  2ZTG A;  2PDO A;  3KR4 A;  1SQH A;  2PJ9 A;  3A35 A;  5LRK A;  2CF4 A;  2C6P A;  1W34 A;  2PJ2 A;  3A3B A;  1QVF B;  3FX6 A;  5LMZ A;  2HUZ A;  4XLH A;  2ZEL A;  4KS9 A;  1YQE A;  4WJB A;  4P4E A;  1N8R D;  3WND A;  1OHH A;  3CRZ A;  3EY5 A;  4Z65 A;  4UZE A;  2PVV A;  4PXC A;  1T6Y A;  2REE A;  4PQA A;  1KRH A;  1TVC A;  1KQS B;  1DG1 G;  4P45 A;  1W0J A;  4UZU A;  3PVD A;  4FXU A;  3LNN A;  4IUS A;  1K28 D;  1EFC A;  1FT7 A;  1Z5R A;  4QVJ A;  4F9V A;  1HVX A;  4JD6 A;  4ZX8 A;  2BGI A;  2GK6 A;  1WOR A;  3FIX A;  4FUU A;  4XPL A;  4CAX A;  3NE7 A;  1U6M A;  1RQR A;  2JDI A;  5KW9 A;  1FX0 A;  5LYI A;  1S4M A;  4Y9U A;  2JJ1 A;  2GRE A;  4F9U A;  1IIC A;  1QQ9 A;  4H2K A;  2PC1 A;  3IJ3 A;  1M4I A;  1VKC A;  4B5P B;  3IU1 A;  3OEE A;  4TWE A;  2P0W A;  1SM4 A;  3WY9 A;  3B3S A;  4UFW A;  3I1U A;  3S6K A;  4WZK A;  2R98 A;  5HZA A;  4XLA A;  2R6H A;  1QSR A;  4JMQ A;  4UEF A;  5CPA A;  3NA6 A;  1QSO A;  2VBT A;  3VNV A;  1GO2 A;  1FY7 A;  3ZBU A;  3I3G A;  4NGT A;  4M53 A;  1YX2 A;  5EBV A;  1NDH A;  1Y9K A;  3H8G A;  2AFZ A;  4XPD C;  1VQL B;  3LQ6 A;  4OPS A;  1KTV A;  4TT3 A;  3CCJ B;  2C78 A;  5CNP A;  2F5I A;  3D26 A;  1XRY A;  2PJ8 A;  1VLO A;  1TKF A;  4ONW A;  1N07 A;  4ZY0 A;  1I7P A;  5A89 A;  3BNW A;  4RD6 A;  4YRH A;  4F7D A;  2YNC A;  1NRK A;  3SI1 A;  5HVG A;  1WK4 A;  3QSY A;  1D8T A;  4B5O A;  1KUX A;  3OWC A;  1E3X A;  1S7N A;  3FEE A;  2Z3L A;  3ASP A;  1QSN A;  2AFO A;  4RD1 A;  4Z4S A;  1CNF A;  4NGN A;  1IID A;  3WAB A;  4N3N A;  2EK8 A;  2ZXH A;  1FNC A;  4KSI A;  3T53 B;  5LRG A;  3KHZ A;  5IYQ A;  1RXT A;  3T56 B;  1R5N A;  1E1R A;  2DCU A;  1OB2 A;  1TF9 A;  4Z4V A;  4UFX A;  4MHP A;  4RLZ A;  2NV4 A;  2ZED A;  3R6K A;  5DN6 A;  2PJA A;  4KUA A;  3KHX A;  1Q86 D;  2OYN A;  1IU8 A;  3BHX A;  4UCN A;  2QEC A;  4CGP A;  4NCN A;  5FL7 A;  4P3Y A;  2BUE A;  2BSA A;  2GJP A;  2PIY A;  1G7S A;  3PUM A;  3T90 A;  5D8N A;  4MI4 A;  2R8V A;  3ZJ0 A;  1MJB A;  3FKS A;  3W2E A;  2WPD A;  1I12 A;  2V7V A;  2XEX A;  4CAW A;  2RC5 A;  4QVA A;  5H59 A;  3V38 A;  4TMW A;  3P2F A;  2AE6 A;  3ONU A;  3D2M A;  4X06 A;  1IJF A;  3AVY A;  2C27 A;  3CXP A;  3T51 B;  1S3Z A;  4Q7A A;  1NSL A;  3FRM A;  4P4F A;  2B58 A;  4RUH A;  3ZZ0 A;  4KZT A;  3PP9 A;  4MHD A;  4XLF A;  3D7G A;  4K3N A;  2VZY A;  1UD3 A;  1KJZ A;  1TKH A;  3ES9 A;  2VBV A;  4UAJ A;  3TFY A;  4P6Y A;  3VWE A;  3CC4 B;  5IK2 A;  3BQJ A;  1N05 A;  4R76 A;  4U9Z A;  5G20 A;  2BN4 A;  3QFC A;  4AXV A;  1QUE A;  1YLO A;  4NF1 A;  1M4D A;  1VQ6 B;  5THW A;  5TRD A;  3IIB A;  4CRY B;  3D7H A;  2D4P A;  3LO8 A;  1T6Z A;  3SXN A;  3B2Y A;  2EFG A;  3RAM A;  4J0Q A;  2NSM A;  3FH4 A;  3OOC A;  3UY5 A;  3CME B;  4NGM A;  2WSS A;  2V8D A;  3ZC3 A;  4A33 A;  4CYO A;  4ACA A;  4B3G A;  3W2I A;  2IMO A;  3CXQ A;  1WTH D;  1VIX A;  1HEE A;  4OC5 A;  2D3L A;  3H5Z A;  4CAV A;  4JJX A;  4PC6 A;  5BWA B;  2ZL7 A;  4YXW A;  2YWH A;  2PJC A;  3E20 A;  4XOT A;  2ARH A;  3H8F A;  2VYQ A;  2QGG A;  3BH4 A;  3IWW A;  4KOU A;  5FIU A;  2GJR A;  2PJB A;  4OKO A;  3SLD A;  4XMY A;  3W5U A;  2V8V A;  4RM0 A;  2C4T A;  2XND A;  3OP1 A;  4EVY A;  3Q6Q A;  3KZW A;  3S9L A;  1YME A;  3KKW A;  3BI0 A;  2ATR A;  1WWZ A;  1VHS A;  2ZEG A;  4H9G A;  2IQ6 A;  5FNZ A;  1PJ7 A;  3VO1 A;  1BQE A;  4G5G A;  5AN9 A;  3J81 k;  2IJZ A;  5DWN A;  2CW5 A;  4ZGY B;  2ZZQ A;  2VNI A;  2WPX A;  1YIT B;  4MFK A;  4K30 A;  4J3G A;  4UCM A;  1K9M D;  2ZZG A;  1J9Z A;  4WWV A;  2PR1 A;  4P9S A;  2JEV A;  5IYR A;  4LBY A;  2YNC C;  4YEL A;  1YGH A;  3BXM A;  1XQB A;  4MFQ A;  4OAD A;  2O4H A;  3D67 A;  2KVO A;  1KK0 A;  4IAV A;  4RPD A;  2Q6I A;  1CQX A;  1R5O A;  2BPO A;  1UD2 A;  4XKW A;  2Q44 A;  4GS4 A;  4IHM A;  2FX3 A;  3N5F A;  2CBX A;  4Z4W A;  3FJU A;  1D2E A;  4CYP A;  2QMU A;  5DSZ A;  2PJ0 A;  3MMP A;  1IOI A;  2CK3 A;  4FD5 A;  2Q4Y A;  2WPW A;  5E96 A;  1QX4 A;  2D74 A;  3WC6 A;  1Y7E A;  2EO8 A;  3IEH A;  4IF5 A;  1BOB A;  2IL4 A;  2PJ4 A;  2PR8 A;  4DUK A;  5I4M A;  4MRI A;  1HA3 A;  4YAF A;  4B3F X;  2B4D B;  3OKX A;  4F6A A;  4UZF A;  1TXR A;  4HNX B;  1QVG B;  1B87 A;  1MRZ A;  4FBE A;  3E0K A;  3CW2 A;  4M6H A;  2VEZ A;  4A95 A;  4AG7 A;  1ZO0 A;  4M6G A;  2ZIT A;  1Y9W A;  1YX0 A;  5LYD A;  4TMZ A;  5A88 A;  1LAP A;  3WNB A;  3D8P A;  3JQP A;  3SJG A;  4P2N A;  4X05 A;  2Z3K A;  2Z10 A;  1QFZ A;  5FA6 A;  5TY0 A;  2CXA A;  1N71 A;  1A2Z A;  1Z4E A;  3G8W A;  4R9M A;  4B12 A;  1CP7 A;  1FRN A;  2A4N A;  3OW2 B;  2FXF A;  3VH9 A;  5KTA A;  1T6X A;  4YWY A;  4N3G A;  4WQM A;  4K1X A;  3KAS A;  3H8E A;  3FYN A;  4ZGN B;  2B3V A;  1XOV A;  4B5P A;  4Z4Y A;  4FD7 A;  2V77 A;  3ONY A;  3FEC A;  3GB0 A;  3AGP A;  3SI2 A;  4EME A;  3AGQ A;  3RY8 A;  4DK0 A;  1LAM A;  4AC9 A;  1ZM4 A;  3B3W A;  1BLI A;  2XZP A;  5F09 A;  3BJ8 A;  3KQX A;  1OBR A;  2ZPA A;  3B3C A;  2J9A A;  2GQF A;  2XEG A;  2B5G B;  4B48 A;  1KK3 A;  1GAQ A;  1MAB A;  2VNH A;  2ZEO A;  3VR6 A;  4XQF A;  4RI1 A;  1IB1 E;  4QHY A;  2Q7B A;  2C6C A;  1CPX A;  3SJE A;  4ACB A;  1BPL A;  5LYL A;  1JA1 A;  2JN9 A;  2J8R A;  2DET A;  3LOD A;  3FBU A;  3I1F A;  4R6T A;  4H6Z A;  2QML A;  2PVW A;  2PE3 A;  2OBT A;  4ZI6 A;  3TT2 A;  1WOS A;  3CCR B;  5AG7 A;  4NBS A;  2OZU A;  2ZW5 A;  3DSB A;  3CP8 A;  4P44 A;  2HMA A;  4JXR A;  2XOK A;  3OJX A;  3D7F A;  1KUV A;  5F47 A;  4OC4 A; 
#chains in the Genus database with same CATH homology
 1TKF A;  4ONW A;  4ZY0 A;  4UF4 A;  5HVF A;  5DS0 A;  2PJ3 A;  1KWM A;  4UIA A;  3VAR A;  4MCP A;  4P4D A;  4ZX9 A;  3SI1 A;  5HVG A;  3ISX A;  3KR5 A;  2PJ1 A;  4A37 A;  3FEE A;  2CTB A;  2AFU A;  2AFO A;  2AFX A;  3PBB A;  3ISZ A;  5K8N A;  3WC7 A;  4NGN A;  1TKJ A;  3VAT A;  2ZEE A;  2GLJ A;  3WAB A;  2EK8 A;  2AFM A;  4KSI A;  5LRG A;  3KHZ A;  3FVL A;  1VHO A;  3TX8 A;  2JBK A;  3B35 A;  3PEI A;  1TF9 A;  5HXD A;  2Q43 A;  2ZEH A;  3WT4 A;  4P10 A;  2GU2 A;  4MHP A;  1CBX A;  2ZED A;  3NH4 A;  3FF3 A;  2PJA A;  2ZOG A;  2OR4 A;  3KHX A;  1LFW A;  3BHX A;  1VHE A;  3B3T A;  1F2P A;  1FNO A;  2QVP A;  4BD9 A;  4B6Z A;  3WC5 A;  2PIY A;  3IFE A;  5D8N A;  2O53 A;  3KI9 A;  4OC2 A;  2HC9 A;  3RBU A;  4JZ0 A;  3SJF A;  3DGV A;  1YW4 A;  3RZA A;  2ZEF A;  4OID A;  3V38 A;  5K8O A;  2ZEN A;  1ZG7 A;  2GLF A;  2F7V A;  4ZY1 A;  4NGR A;  1CPS A;  5IB9 A;  4PPZ A;  2PJ7 A;  3IO1 A;  2NYQ A;  3D66 A;  3PBE A;  3D7D A;  1CX8 A;  3PB7 X;  4A94 A;  4DJL A;  4ZYQ A;  7CPA A;  2ZEP A;  4NGQ A;  2C1C A;  1PCA A;  4Q7A A;  1Z8L A;  1CP6 A;  4P4F A;  5K8P A;  2JBJ A;  4RUH A;  1BLL E;  3D7G A;  3D4U A;  4K3N A;  4MCR A;  1M4L A;  1CG2 A;  4NJR A;  1XMB A;  4LQG A;  1Z2L A;  2PJ5 A;  2V8H A;  3FED A;  1TKH A;  4X3R A;  4P6Y A;  4NGS A;  3PRT A;  1DTD A;  4DYO A;  2AFW A;  6CPA A;  4R76 A;  1LOK A;  4MCQ A;  2PCU A;  1IY7 A;  4EFD A;  4OIW A;  5HVH A;  2EWB A;  4AXV A;  1YLO A;  4MCS A;  3B3V A;  2PIZ A;  1ZLI A;  2CTC A;  1TF8 A;  4A39 A;  3V7Z A;  3CPX A;  3TC8 A;  5THW A;  2RFH A;  3IIB A;  2CIJ A;  3D7H A;  3B2Y A;  3LMS A;  3RAM A;  2NSM A;  3FH4 A;  3KL9 A;  4NGM A;  4GM5 A;  4NJQ A;  5CBM A;  2V8D A;  5J1Q A;  3MRU A;  3T8W A;  4EWT A;  2RB7 A;  3IC1 A;  2IMO A;  1Q7L A;  1Y0R A;  1VIX A;  1HEE A;  4OC5 A;  2POK A;  1XBU A;  3CPA A;  4OC1 A;  4OC3 A;  3DLJ A;  4UEZ A;  2PJC A;  3KQZ A;  4X2T A;  4PXB A;  1ELM P;  1UWY A;  3H8F A;  4P4I A;  4MXU A;  3IWW A;  5K8M A;  4UIB A;  1QMU A;  3NH8 A;  3KGQ A;  2PJB A;  4OKO A;  2ZEM A;  2WYR A;  1F57 A;  2WZN A;  1F2O A;  8CPA A;  2V8V A;  3L2N A;  1ELL P;  3KZW A;  2QJ8 A;  1YME A;  3S9L A;  3BI0 A;  3LWU A;  3S9M A;  2ZEG A;  1LCP A;  2JEW A;  4OC0 A;  2IQ6 A;  2XEJ A;  4IK2 A;  3D68 A;  1HDU A;  3PB8 X;  2IJZ A;  1RTQ A;  5JGF A;  3PB4 X;  4R8F A;  2PRQ A;  2VL1 A;  4YU9 A;  1YW6 A;  3GLJ A;  4P4J A;  1ZLH A;  3HUV A;  2C6G A;  1XFO A;  2OOT A;  4WWV A;  1ZG9 A;  1ARM A;  3NH5 A;  3BXM A;  2G9D A;  2O4H A;  3D67 A;  1AMP A;  1AYE A;  5LRJ A;  1LAN A;  3HLP A;  1NSA A;  4IAV A;  1ARL A;  5D29 A;  3NFZ A;  4W9Y A;  4MHN A;  1R3N A;  3CT9 A;  4IHM A;  3JRU A;  1BAV A;  3N5F A;  3FJU A;  1IGB A;  1JQG A;  3S9N A;  4PXD A;  2FVG A;  2PJ0 A;  1ZG8 A;  1PYT B;  2BCO A;  1GYT A;  2XEF A;  4PXE A;  3WC6 A;  1Y7E A;  1BPN A;  3IEH A;  2PJ4 A;  4OME A;  4DUK A;  5I4M A;  1EE3 P;  2ZOF A;  4MHY A;  3QNV A;  2PJ6 A;  4FAI A;  4MRI A;  2I3C A;  3SI0 A;  2ABZ A;  1H8L A;  4X8I A;  3PB6 X;  4NFR A;  4O23 A;  1TXR A;  5ELY A;  3KR4 A;  1XJO A;  1R43 A;  2PJ9 A;  2AFS A;  2V8G A;  2CF4 A;  2C6P A;  2HB6 A;  2PJ2 A;  5LRK A;  4TNU A;  4FBE A;  3CDX A;  3FX6 A;  4UEE A;  5LYD A;  2ZEL A;  3B7I A;  1LAP A;  4WJB A;  4P4E A;  3K2K A;  2F8H A;  3BI1 A;  3SJG A;  4Z65 A;  4PXC A;  2PVV A;  3FMC A;  1CP7 A;  4ZY2 A;  4PQA A;  3GUX A;  3VH9 A;  4P45 A;  4YWY A;  4JYW A;  3KAS A;  3H8E A;  2QYV A;  3K9T A;  1FT7 A;  2EK9 A;  4G1P A;  1Z5R A;  3SJX A;  4F9V A;  4ZX8 A;  1HDQ A;  2V77 A;  5JM6 A;  3FEC A;  5LYF A;  4MHZ A;  2ANP A;  3GB0 A;  4FUU A;  3SI2 A;  4EME A;  4R7M A;  3PFE A;  1LAM A;  3PFO A;  1VGY A;  3B3W A;  5LYI A;  1DE4 C;  5F09 A;  2GRE A;  4MMO A;  4F9U A;  3KQX A;  1BPM A;  3PB9 X;  4F8Z A;  1OBR A;  1QQ9 A;  4H2K A;  3B3C A;  5JH9 A;  2J9A A;  2XEG A;  3IJ3 A;  1Y0Y A;  2ZEO A;  4OP4 A;  2XEI A;  2Q4Z A;  2BOA A;  2C6C A;  4TWE A;  1CPX A;  4NGP A;  3SJE A;  5LYL A;  3B3S A;  3I1U A;  4UEF A;  5CPA A;  1YSJ A;  3MN8 A;  4FWU A;  3NA6 A;  4R6T A;  2PVW A;  2PE3 A;  2Q51 A;  4ZI6 A;  2BO9 A;  4NGT A;  4CPA A;  3H8G A;  2AFZ A;  4P4B A;  4A38 A;  4P44 A;  2DEA A;  3D7F A;  1XRY A;  2PJ8 A;  4OC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...