3ISXA

Crystal structure of endoglucanase (tm1050) from thermotoga maritima at 1.40 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
335
structure length
335
Chain Sequence
HHHHMKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase
publication title Crystal structure of Endoglucanase (TM1050) from THERMOTOGA MARITIMA at 1.40 A resolution
rcsb
source organism Thermotoga maritima
total genus 104
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3isxA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3isxA01
3BXMA 2EWBA 2PJ2A 1LOKA 2JBJA 3PB9X 1QQ9A 2CTBA 3B3TA 1R43A 3SI0A 3S9LA 4UIBA 1Q7LA 3B3WA 1R3NA 2AFOA 4WJBA 2ZEGA 4PXBA 1VHOA 3GUXA 3PRTA 5JGFA 1HEEA 3WC6A 4MCPA 4EMEA 1F57A 4OC2A 4A39A 3BHXA 1Y0YA 1VIXA 2GU2A 3B3SA 2V8GA 2BO9A 2AFMA 4UF4A 3D7GA 2J9AA 4P4EA 3KQXA 4F9UA 3PB4X 5HXDA 6CPAA 3KZWA 1VHEA 2NSMA 3B2YA 1ZG9A 4GM5A 4OC4A 3WC7A 4ZI6A 1GYTA 3IWWA 4ZY0A 4MXUA 4H2KA 1YW6A 2V8HA 4RUHA 1PYTB 3PBEA 2EK8A 1ARLA 4R6TA 4NGQA 3FECA 5ELYA 2PCUA 1LANA 5D29A 2O4HA 2PJ8A 2IMOA 2C6GA 2AFWA 4PXCA 3KASA 2ZEHA 2XEFA 3SJEA 2IJZA 5LRKA 3IC1A 1EE3P 3V7ZA 1BPMA 1TKJA 4F8ZA 5K8NA 2PJBA 3S9NA 5LYFA 1ZLHA 4P4FA 3PB8X 3FVLA 4FAIA 1TF9A 3FX6A 4FBEA 3VARA 4BD9A 2PJAA 1IY7A 5K8OA 4R76A 2O53A 4IHMA 1YW4A 2C6CA 3RAMA 2RB7A 1HDQA 2XEGA 1XRYA 2ANPA 4UEZA 4NGMA 4A94A 4OC1A 4MCSA 1CP6A 4MCQA 4MHPA 2PIYA 3K2KA 4ZY2A 1AMPA 4OIWA 1TKHA 3WABA 4R7MA 2AFXA 2ZEFA 1ZG8A 2ZENA 3K9TA 4CPAA 3H8EA 2AFUA 4JYWA 1Y7EA 4TNUA 3KGQA 5K8MA 4OIDA 3FF3A 4NGRA 1BAVA 3I1UA 3KI9A 4NGPA 1TXRA 3FH4A 3ISZA 4AXVA 2ZEPA 1CG2A 4UIAA 3S9MA 1CX8A 3KR4A 2PVVA 3SJGA 4KSIA 4OC3A 3FMCA 3IFEA 3KQZA 4F9VA 1ARMA 1LCPA 3FJUA 3PB6X 5DS0A 4ZX9A 3BI1A 4R8FA 3D4UA 3D7FA 1DE4C 4EWTA 4OC5A 4NGNA 3KL9A 1FT7A 4FWUA 3B3CA 3LWUA 3MN8A 5LRJA 1LAMA 1Z8LA 4A38A 4OC0A 5LYIA 2V77A 1UWYA 1JQGA 1XBUA 4P6YA 2WYRA 2JBKA 4YWYA 1H8LA 4IAVA 3PFEA 1ZG7A 2V8VA 1FNOA 2FVGA 1PCAA 2CF4A 1CPSA 2DEAA 2CIJA 1Z5RA 2CTCA 1ELLP 5HVFA 5LRGA 2IQ6A 5CPAA 3GB0A 2PJ9A 4DYOA 2G9DA 1TKFA 3KHXA 3DGVA 4MCRA 2F7VA 2PJ3A 2HB6A 2HC9A 2PRQA 3IIBA 3PFOA 2I3CA 4X3RA 3ISXA 4UEEA 1LFWA 2PJ0A 2ZOGA 2ZOFA 4P45A 2XEIA 5D8NA 4P4IA 3GLJA 1BLLE 4PXEA 4UEFA 3SJXA 4EFDA 3WT4A 1XMBA 4Z65A 3KR5A 1QMUA 3PBBA 7CPAA 3N5FA 4OKOA 2AFSA 1XFOA 3HUVA 1CBXA 3RBUA 3NH4A 3CPAA 2PJ4A 1ZLIA 3B35A 4NGTA 2PJ7A 3SJFA 4MHZA 2ZEEA 4OP4A 2F8HA 2EK9A 4WWVA 2PJ6A 3PB7X 2ZEDA 2OR4A 1YLOA 3HLPA 1CPXA 2C1CA 3WC5A 2PE3A 2AFZA 3TC8A 4P10A 4O23A 5HVGA 3B7IA 5IB9A 1TF8A 5JH9A 5CBMA 3DLJA 3CDXA 4MMOA 3MRUA 2QYVA 3NFZA 4DUKA 4ONWA 5LYLA 3D67A 3L2NA 3RZAA 2WZNA 1M4LA 3VATA 3JRUA 5THWA 4PPZA 4P4JA 2Q51A 2ZEMA 3D66A 2BCOA 4Q7AA 4LQGA 4NGSA 3SI1A 3IO1A 1CP7A 2VL1A 3NA6A 3TX8A 2ZELA 3VH9A 4FUUA 1YMEA 1VGYA 4X2TA 5JM6A 4OMEA 1F2PA 4MHYA 4TWEA 1HDUA 3PEIA 3QNVA 4DJLA 5HVHA 4PQAA 4B6ZA 4JZ0A 3B3VA 3H8GA 2PIZA 3D7DA 3NH5A 3CT9A 1BPNA 1Y0RA 5LYDA 2QVPA 4P44A 2C6PA 4W9YA 2V8DA 3V38A 2ABZA 4P4DA 4PXDA 2PJCA 1OBRA 3LMSA 5F09A 3D68A 3KHZA 4A37A 1F2OA 2ZEOA 3SI2A 8CPAA 2XEJA 1ELMP 1AYEA 2BOAA 4ZY1A 3FEDA 5I4MA 1Z2LA 2PJ5A 2QJ8A 4NFRA 3FEEA 2POKA 2NYQA 4NJRA 2GLFA 4ZYQA 1KWMA 1XJOA 2GREA 3T8WA 3H8FA 2PVWA 1RTQA 1YSJA 4MHNA 2OOTA 3NH8A 3D7HA 4YU9A 4MRIA 3CPXA 4X8IA 3BI0A 4G1PA 4P4BA 5J1QA 4NJQA 4IK2A 2Q43A 2GLJA 4K3NA 5K8PA 1DTDA 2RFHA 3IEHA 1NSAA 3IJ3A 4ZX8A 1LAPA 2PJ1A 1IGBA 2JEWA 2Q4ZA
chains in the Genus database with same CATH superfamily
3BXMA 4CAXA 2PJ2A 2DXQA 4M85A 4G7WA 2Z3PA 3B3TA 4XOPA 3S9LA 4A33A 3B3WA 1XB2A 4H89A 2PR1A 1S7NA 3S6HA 4ZGYB 3EXNA 1XE4A 1G7TA 3TFYA 4UCNA 2F4NA 2V7VA 3OAAA 2YNCC 1VHOA 1KZFA 4Y49B 3CXSA 2CNDA 4CRZB 3CCEB 1HEEA 3WC6A 4OC2A 4HE6A 1R57A 2GU2A 2B5OA 1BLIA 2LZJA 1TIQA 3OW2B 3KQXA 1D2EA 4WZEA 1I8DA 4UFWA 3KZWA 6CPAA 3RY8A 4TMWA 3OOCA 1BX1A 2C27A 4GM5A 5FVJA 3WC7A 4XL9A 2YWEA 2FE7A 3IWWA 2QA4B 2ZW5A 4CYQA 4RUHA 1T5EA 2OU2A 3AVTA 2EK8A 2VYQA 1IIDA 1IOFA 2B5GB 1LANA 3SXOA 2V7XA 2VXKA 4MFJA 3ONUA 5AG5A 2AFWA 2VNIA 4Y9UA 1UD6A 2XEFA 1NSLA 3IC1A 4F8ZA 1TKJA 3S9NA 2PRBA 2QECA 4OOVA 4FAIA 4XLCA 1QSMA 2B58A 2JDCA 1ON0A 2QTLA 1IY7A 3WXMA 2Q6KA 2EUIA 3R1KA 1M1KD 4RD2A 2FIAA 1GAQA 4PGOA 2RB7A 1UD4A 2XEGA 1BQEA 2QE7A 4OC1A 4H6ZA 4YAUA 1CP6A 1K4JA 4MCQA 4ZY2A 1AMPA 4R7MA 2AFXA 2ZEFA 2ZENA 4CPAA 2G3AA 4TNUA 3KGQA 1I12A 4YAOA 4OIDA 3FF3A 4NGPA 2CC2A 3FH4A 2Z3MA 4F0XA 1Z4RA 4TT3A 1CX8A 2X53S 1WSVA 5HXBA 1N05A 3SJPA 2QGGA 3FMCA 3KQZA 1V5VA 1I7PA 3P26A 1KUYA 1SQHA 4M53A 3A1PA 3A3GA 3BI1A 4OOXA 1NBMA 1FX0A 3D4UA 1MRZA 2Z0ZA 4FD4A 2ZXHA 4OC5A 4NGNA 1F20A 1D1NA 4LBZA 4M0LA 1JB9A 4B4DA 4KOWA 1FNBA 3MN8A 1VKCA 1FRNA 4MYTA 4C7HA 4CAWA 4QVAA 2EIXA 3I1FA 3FPPA 5EMIA 3GY9A 1PCAA 2DEAA 4Z4TA 4YHBA 1Q86D 2HCJB 1BOBA 4MY3A 2FT0A 1R5OA 5FO0A 3GIRA 3EY5A 1QUEA 4ASUA 1QUFA 2GJPA 3LQ6A 4PC7A 4DYOA 2G9DA 1E3XA 4AVZA 2PQ8A 2X6WA 1IB1E 2PJ3A 1PJ5A 3AVYA 2GK6A 4X05A 4Z4VA 2A4NA 4XPDB 2FXFA 4UEEA 2JJ2A 1YVOA 4KKTA 4KVXA 4JD6A 4EFDA 1N07A 1P4MA 2ZL5A 3W5VA 4PSXA 1ZM2A 4PK2A 3DSBA 4C0SA 3B8HA 3WT4A 3VNVA 3QFSA 4OPSA 3V8IA 3SXNA 3EO4A 3PBBA 4P12A 1FRQA 3CCJB 1VQ9B 4XKWA 3OZVA 1PU9A 4QFMA 1IJEA 1S5KA 4JXQA 4QUSA 2VEZA 4RDKA 2WJVA 2GJKA 4NGTA 2B4BA 4MHZA 2F8HA 5CDFA 1WOSA 3ASPA 2PJ6A 3PB7X 4G7XA 2OR4A 3JQRA 1QX4A 3CPWB 1YLOA 3HLPA 4WZKA 1RQRA 1VLYA 1TVCA 2PE3A 2ZZFA 1N8RD 3I9SA 3JUWA 4P10A 5HVGA 3B7IA 3ZZ0A 1QVFB 1TF8A 2Q4YA 4P3IA 3T56B 3Q39A 3JQQA 4MMOA 3GVKA 2B7BA 5J8CA 4KLWA 5LYLA 5GV7A 1WOPA 3D67A 4RJLA 4QVTA 3L2NA 3RZAA 2WZNA 3VATA 4HPSA 3D8PA 5F4JA 3A9LA 3W2IA 2Q51A 4BPRA 2AE6A 1H8EA 2WZPP 3TO6A 1VHSA 5THXA 2XEXA 4XR6A 4JLYA 2P3MA 4XLFA 3LNNA 2PR8A 5JPHA 4TMZA 1XMTA 4X2TA 1QGYA 4OMEA 2B4DB 3W2EA 4TWEA 5G22A 4KOYA 2X6YA 2X7BA 1IOIA 4DNRB 3QNVA 2E1BA 4PQAA 2VI7A 2I1LA 3P27A 4ORFA 3Q38A 1CNFA 4QC6A 2YWHA 2QVPA 4YELA 2BM1A 2VZLA 2ZPAA 1OZPA 4NNJA 2V31A 4R57A 3D68A 3K9UA 3KHZA 1KTVA 4IF5A 1BMFA 1J9ZA 2CK3A 1S72B 1ELMP 3BCDA 1NDHA 5H5JA 5I4MA 1EFUA 3CXCB 1B87A 1AMOA 1QSOA 5AG7A 1XQBA 4MY0A 4RD3A 2G0BA 1KWMA 1VQ6B 4H6UA 3T8WA 4KKSA 4GQNA 2CNTA 3H8FA 2PVWA 5C82A 1RTQA 2I79A 2B3VA 2Q44A 2I00A 3NH8A 3BI0A 4K3NA 5K8PA 5TY0A 2OZHA 4X07A 4ROXA 4DK1A 1Z8XA 4AVBA 1RQPA 5DWMA 3AVVA 2Q4ZA 2AHOA 1N0UA 1H8HA 5IK2A 2EWBA 1LOKA 1JWQA 1ZO0A 4NF1A 2CTBA 1WP6A 1VQLB 2ODFA 3D3SA 3SI0A 4UIBA 2GANA 1ZM4A 2OYNA 3Q6QA 3WNBA 3MGDA 2BL1A 4AF6A 2VZYA 3MHPA 2ZEGA 4KS9A 3A8IA 1WK4A 1F60A 3PVDA 3VO2A 4NCNA 4C2ZA 5F46A 2ZW6A 4JWPA 4OPOA 4EMEA 4CQJA 4KVME 3G71B 4A39A 3PA2A 3BHXA 4B5OA 2OB0A 4Z1MA 1MABA 2V8GA 2AFMA 4RCYA 4P4EA 4F9UA 3CMEB 2QIRA 5IYQA 4PC6A 2OK8A 2P6GA 2C2WA 1N71A 3D2MA 2C4TA 4CGNA 1ZG9A 1JJ2B 3U2QA 3WBJA 1Y9WA 2DPTA 1JNYA 4ZI6A 1FDRA 1QFJA 4CGOA 2JIZA 4MXUA 1YW6A 5EC4A 4NBSA 1N0VC 2CY2A 4G1BA 4NGQA 3MMPA 3FECA 3ASQA 5ELYA 2PCUA 5D29A 1UD5A 4RDJA 2GE3A 2C6GA 5H84A 2FS5A 1T6YA 2REFA 4X0CA 1GR1A 1I18A 2WR8A 3KASA 4G6IA 2ZEHA 3V7ZA 3Q6RA 4MBUA 5LYFA 1ZLHA 4JJXA 3ASSA 3WQZA 4RD4A 3PB8X 3FVLA 1TF9A 2ATRA 4MJ8A 1QGAA 4FBEA 5KTCA 3TE4A 2PJAA 3GSIA 4YGOA 2G3TA 4KOTA 3AVWA 1YW4A 2C6CA 3BJ8A 4G5GA 4JMQA 3RAMA 4AC9A 4QHYA 4L89A 5F47A 4MCSA 1YITB 3EFAA 4XNHB 4MHPA 3S6KA 5BSXA 5E6TA 1OGJA 2B4DA 2B3UA 3ES9A 2VBUA 3H8EA 1E63A 4P25A 3QFRA 4NCZA 4AG9A 3W5UA 4L8JA 4XD7A 1BAVA 3KI9A 3TO9A 1TXRA 1IJFA 2ZEPA 3CXQA 4PV6A 3VO1A 3DR6A 2ZL6A 4DQLA 3SJGA 4QB9A 2D4OA 4KSIA 4OC3A 3VMFA 3F0AA 2X3UA 5DN6A 1I1DA 1K8AD 4UWJA 4F9VA 1LCPA 4CAEA 1LRZA 5DS0A 4P22A 3CCQB 4ZX9A 4PSWA 4R8FA 4QUZA 3CC7B 2OBSA 3H4QA 3N7ZA 3WNDA 4KUBA 1I21A 3R6KA 1VQKB 2Y0MA 4Z4UA 2VBSA 2B7CA 3LWUA 4E2AA 2X8KA 4Q36A 1LAMA 2YGWA 2P0WA 2V77A 1WSRA 1UWYA 1JQGA 1XBUA 4R9MA 4YWYA 5FIUA 4OAEA 3E1YE 2V8VA 2HUZA 5IYWA 3ZBUA 4C7IA 1VQNB 1KUXA 3OKXA 3PZJA 2WSSA 2JEVA 1Z4EA 1J4JA 3GB0A 5H59A 2PJ9A 3ZZIA 3DGVA 4B44A 2F7VA 2HB6A 2HC9A 2PRQA 3PFOA 2I3CA 3CCLB 3QB8A 1FNDA 4X3RA 1IU8A 2FL4A 3CCUB 2ZOGA 4RDLA 1WORA 2ZOFA 2ZTGA 1PKVA 2NPFA 5D8NA 1Q7YD 3GLJA 1BLLE 2CXAA 3SJXA 3H5ZA 3LO8A 1CQXA 4XN3A 2V4DA 2BEIA 3BNWA 1N08A 2DPSA 4M3SA 1S3ZA 5GV8A 1XFOA 3T51B 1W35A 3BY2A 4TMVA 1QSNA 4B48A 3G8WA 5G20A 2K5TA 3NH4A 1GAWA 2PJ4A 4Q38A 3TTHA 1ELOA 4OP4A 2EK9A 3T53B 2ZEDA 3OZWA 3F8KA 2ZBVA 3D26A 4LBVA 3RYOA 4O23A 2F5IA 2PMDA 5JH9A 4C2YA 3T9YA 3E20A 3G05A 4I49A 2QYVA 4DUKA 1HZEA 3KKWA 2KVOA 5ISVA 1Q9SA 4C43A 2F1MA 4KSAA 4X5KA 1UD8A 2C78A 1M4LA 3OWCA 4N3GA 1EP3B 3RNZA 3GIUA 2ZEMA 2BVNA 3CTAA 3D66A 4LQGA 1CNEA 2Z3OA 5DSZA 1HVXA 1YX2A 2D3LA 1V0CA 3SHPA 2R9VA 4B3GA 2V7QA 4QVJA 5A8AA 1MJBA 2Q6LA 3BQJA 1Y7RA 5A28A 4BINA 4BBHA 3HAGA 4B14A 2M5SA 3VH9A 4FUUA 3JQPA 4B43A 5F49A 2J8MA 3A8KA 4B47A 1F2PA 4MHYA 5TV2A 2VNKA 2ARHA 1IICA 1YJWB 2V7UA 3PEIA 3CB4A 1VQ5B 4R3LA 1BPLA 3H8GA 1YLEA 4XPDC 3GKRA 1TUIA 1IB0A 3TCVA 1S60A 5F4OA 1GHEA 2ZZEA 2P6EA 1YREA 4TN1A 3ASTA 3FIXA 2Z3KA 3BLNA 4W9YA 4AVAA 5KNLA 2VZZA 4PXDA 1OBRA 5F09A 4A37A 4CYNA 2W6IA 4B10A 2ZEOA 8CPAA 3U6KA 3TO7A 3G4SB 3QAYA 3B78A 4XNFA 1Q2DA 2VNHA 1Z2LA 2PJ5A 3WBKA 2BV3A 4RLZA 5FNZA 4NFRA 1KJZA 4X7EA 2YNCA 3R9GA 2GLFA 4ZYQA 5L46A 3WR7A 2VBVA 4XKVA 4MHNA 2BSWA 2OOTA 4YU9A 4MRIA 2NMTA 4X8IA 4P4BA 5J1QA 4IK2A 2VJJA 1OB2A 2GLJA 1ZUNB 4FD7A 1DTDA 3IEHA 3IJ3A 1LAPA 1V0FA 4BMHA 2PJ1A 2P6FA 2Q7BA 1KRHA 4UA3A 4F7DA 3PB9X 3DNSA 1S7KA 2IL4A 3FXTA 4ZV4A 1R43A 3IWGA 2J8NA 5TR9A 3OEHA 2WPWA 4XMYA 1ZM9A 3BJ7A 2AFOA 4WJBA 1JA0A 3BCFA 4RD1A 4CAFA 3PRTA 2GK7A 3CRZA 2GJRA 1XIXA 2DERA 4MCPA 1KZLA 4AVCA 2PLFA 3W2HA 4FN5A 4IW3B 5EBVA 2DIEA 1VIXA 4B13A 3B3SA 2VNJA 2WPXA 2BO9A 3D7GA 2J9AA 3PB4X 1E3ZA 1QGZA 4PABA 4Z4SA 2R8VA 1VF7A 1X12A 2NSMA 2DETA 3B2YA 4OC4A 3A35A 4RD0A 1GYTA 2REEA 4FXUA 4ZY0A 4XQFA 2PIAA 1KMHA 1PYTB 1W87A 4LBYA 5H86A 2Z3LA 3PBEA 1EFCA 1ARLA 3TOBA 1M90D 2WUUA 3LODA 4GS4A 1QH0A 4F6AA 3WYAA 1R5BA 5J8FA 2PJ8A 4A31A 1M4IA 5TRDA 3S6GA 2ZL7A 4KUAA 1S4MA 3SJEA 2IJZA 5LRKA 1EE3P 4MHDA 3OEEA 4YAFA 2PJBA 4MI4A 4P4FA 2Z11A 1DDIA 3GQBA 2HLDA 3PENA 4BD9A 1GVHA 1WTHD 2QN6A 4QBJA 4R76A 4ZCMA 4IHMA 5IYNA 2CW5A 1HDQA 1XRYA 2ANPA 2QDXA 2WJYA 4A94A 1IHMA 4YXWA 1T6ZA 2JN9A 3ASRA 2PIYA 3K2KA 3IGRA 1WU8A 4RCZA 3K9TA 1M1DA 1YHQB 3ZBTA 2AFUA 4JYWA 5LMZA 1Y7EA 4P26A 2X85A 4M4SA 4RM0A 2J8RA 1AUGA 2ZXIA 2C5BA 2OK7A 4YFJA 4UZFA 3MCAA 4KOVA 3ISZA 4AXVA 5KSWB 3S9MA 1YVKA 4ZGNB 2PVVA 3PGPA 5HKKA 3JU4A 3UY5A 3R6JA 1XF8A 4EVYA 4KSFA 3ZC3A 3I56B 1ARMA 1IYKA 3PB6X 1GJRA 5KTDA 3FPKA 1M44A 1DE4C 4EWTA 3CCMB 3KL9A 2BGJA 3OJWA 1S7FA 1D8TA 4U9UA 2ZW4A 4KOSA 3AVUA 1VLOA 4A38A 4OC0A 5LYIA 3CC4B 4Y9RA 4NSQA 1Q81D 1W34A 3FRMA 4M2LA 2WYRA 4Z4YA 2J7KA 4F0YA 4IAVA 1W9XA 1ZG7A 3QSYA 4A95A 3SLNA 2CF4A 3FB3A 2V7TA 5BSYA 1KQSB 4WQMA 5AG6A 3ZUGA 3BH4A 4XORA 2RC6A 5LRGA 2IQ6A 5CPAA 4OOSA 3H94A 2CNMA 4LUAA 3KHXA 2Q6OA 4MCRA 2Z6BD 2AJ6A 2XZPA 3AVXA 4Y7CA 5FL7A 3ISXA 3BC9A 3VWDA 1VQOB 1K73D 1QVGB 1Z8WA 5IYPA 2XEIA 4AF7A 5EMNA 3AGPA 1M4GA 4HNWB 1QFZA 2Z10A 4KORA 4C2XA 1XMBA 1OHHA 1E1QA 2YNDA 2XNDA 4XPLA 1QMUA 3CXPA 3N5FA 1KK3A 3W5HA 2AFSA 3FKSA 3NE8A 1VQ4B 2D4PA 3HUVA 3D2PA 1CBXA 3RBUA 4M1KA 2HDNB 2HMAA 1P0HA 3CP2A 2ZZGA 1FY7A 1ZLIA 3ZIAA 3B35A 2PJ7A 2ZEEA 1PJ6A 1YQEA 2BPOA 4E0FA 2HQYA 2CBXA 4B11A 3LACA 4PC2A 3B82A 1CPXA 2C1CA 3WC5A 1PUAA 1XOVA 1YJ9B 3TC8A 3SEJA 3LVBA 1B23P 3WNCA 1W2BB 2QMLA 3CMMA 4FD5A 1QSTA 5CBMA 2GPJA 4ZCIA 2DYIA 1YIJB 3I3GA 3DLJA 1NJID 1UFHA 1YX0A 4Y49C 3NFZA 1MJAA 4LQ6A 4OLLA 4H9GA 4ONWA 4N3NA 3DDDA 5JQ4A 1VQPB 4E8OA 1EP1B 1R5NA 3JRUA 3JVNA 5THWA 4UBRA 5G1ZA 2YWGA 2BCOA 4KOXA 3SI1A 1E1RA 3IO1A 4JXRA 4UAJA 2VL1A 3NA6A 2KCWA 4PK3A 3ZPNA 3TT2A 2OBRA 4M6IA 3OFNA 2ZELA 4L8AA 1UD2A 4FK8A 5A89A 1YMEA 1VGYA 4CYPA 3F5BA 1S7LA 5JM6A 1TLLA 3OP1A 1W0JA 4Z4RA 1HDUA 2DF5A 1KC8D 4MFQA 1KK0A 5HVHA 4J0QA 2VBTA 2GFQA 2RC4A 4B6ZA 3CCRB 2BMWA 5HZBA 2D3NA 3BY1A 5C88A 2X0KA 3G6EB 3NE7A 2R7HA 5J3OA 4CS0B 5J35A 2XGJA 1CJWA 3CT9A 1BPNA 2FIWA 1Y0RA 2F1LA 4X7CA 1EXMA 5LYDA 2BF4A 4KLVA 2R1IA 2FSRA 2E1RA 4P44A 4MFKA 2V8DA 3B8GA 3OW7A 3SLDA 3V38A 2QTZA 4PAAA 3FJOA 1BO4A 5HZAA 3W6SA 3LMSA 5E96A 2HV2A 3EC4A 3VWEA 1F2OA 3R96A 1L0CA 1X10A 3QFCA 1YK3A 3SI2A 1DDGA 2XEJA 3KEWA 2RC5A 4LBWA 2BOAA 3P2HA 4ONUA 2QJ8A 2ZTNA 1KK1A 5AN9A 3FEEA 2POKA 3WY9A 4M6HA 4E0AA 4NJRA 2JDIA 4II3A 4UZEA 1XJOA 4QV2A 1S0UA 1COWA 4YAWA 1RO5A 3JTKA 4CYOA 1AIPA 3ZZUA 4RPDA 3CPXA 4G1PA 3R95A 4NJQA 2Q43A 4ZCLA 2DOGA 1M4DA 2Q04A 3PUMA 2ZXVA 4TSFA 1NSAA 4P3YA 4U5YA 4P1VA 1Q2CA 1BJKA 1IGBA 4X06A 2DY1A 3FBUA 4II2A 5KTAA 2JBJA 1QQ9A 3CP8A 1Q7LA 4IUSA 4OADA 3DDYA 1R3NA 4ACBA 5IYRA 1Y9KA 3RO0A 4PXBA 3GUXA 5I0CA 5DWNA 5JGFA 3OJXA 2W6JA 1G7RA 2VQYA 1F57A 4CAVA 1Y0YA 4KOUA 1FNCA 4PC1A 5HH1A 2PC1A 4UF4A 4J3GA 4C68A 1A8PA 5HXDA 4DNCA 1JA1A 1VHEA 2Q7SA 4P2NA 3CD6B 1SKYB 4YALA 2Q4VA 1SM4A 1GO2A 1G7CA 3W91A 1H42A 4UCPA 5JBQA 4X7FA 1VJSA 2ZITA 1CM0A 4WZLA 3J81k 2ZW7A 1EWYA 4H2KA 2CRVA 2V8HA 4GXHA 3W2GA 2JLMA 4XLEA 1XE1A 4ACAA 1A2ZA 4R6TA 4K30A 1MJ9A 2OZGA 2O4HA 1KD1D 2IMOA 2BSAA 1OB5A 4G1VA 2Z3NA 1FNMA 4MFPA 4PXCA 3OE7A 4HE5A 1NMTA 3A3BA 1BPMA 5K8NA 1K9MD 3GYAA 3S6FA 1PJ7A 3FNCA 3R9EA 1N06A 2OZUA 3FX6A 1P4NA 3VARA 4UFXA 4P6VF 3OZUA 4WZTA 3GVJA 4LC0A 4OP7A 1B6BA 4FWTA 5K8OA 4UFVA 2O53A 3NE5B 4CGLA 3ZZTA 4AB7A 2QMUA 4UEZA 4NGMA 2FX3A 2DCUA 4AG7A 4HNYB 4OIWA 1TKHA 3WABA 1VQMB 3ZJ0A 4R87A 1ZG8A 5AG4A 1H85A 4XM3A 1HA3A 5K8MA 1VQ8B 4M6GA 4Z4WA 2X6XA 5CNPA 4B12A 3QE2A 4NGRA 3I1UA 5FA6A 1BX0A 2Q0YA 4A2ZA 1CG2A 3AGQA 2WPDA 4UIAA 4HKFA 4RS2A 3KR4A 3CESA 4FD6A 4XLAA 3P2FA 1YGHA 3LQEA 4TMTA 3IFEA 2B5GA 3FJUA 2XOKA 5HMNA 4II9A 1VQ7B 5IB0A 2XNJA 3D7FA 1E79A 1FT7A 2D9RA 4FWUA 4RD6A 5BWAB 3B3CA 3G3SA 2BUEA 1E62A 1U6MA 5LRJA 2BN4A 1Z8LA 2H5MA 2C5HA 3QFTA 3V7AA 3W6XA 3IU2A 1UD3A 4P6YA 2JBKA 3T90A 1U2RA 4XLHA 1H8LA 1YJNB 4UWIA 4B5PB 3PFEA 1FNOA 1E43A 2FVGA 1CPSA 1NE9A 4B3FX 2CIJA 4UZUA 1EFRA 2DEUA 3VNUA 1Z5RA 2CTCA 1WDTA 3CC2B 1RXTA 3IWEA 1MK4A 4HNXB 1ELLP 4YEJA 5HVFA 4PC3A 5FO1A 1TKFA 2D74A 4YRHA 4P9SA 3DR8A 1T6XA 3IIBA 3LD2A 4MFLA 2OBTA 2EBJA 1LFWA 2PJ0A 2JDDA 1KUVA 4P45A 1ZM3A 5IX3A 2ZZQA 5F4MA 4P4IA 4PXEA 4UEFA 3PA1A 3E0KA 4XOTA 4TKOB 4X7DA 5KW9A 3A8JA 3IU1A 4R71A 4Z65A 3KR5A 2BGIA 3V76A 7CPAA 4RN7A 2BM0A 4OKOA 3SKBA 4CGPA 2C4UA 2JJ1A 3CPAA 4Z4ZA 1QFYA 4DNTB 3SJFA 4A30A 3CCVB 4WWVA 4U9ZA 1NB0A 4NXYA 3FYNA 4MYUA 4ZGQB 2Q6IA 3SJZA 2AFZA 1OGIA 4XN0A 1Q2YA 5IB9A 2C77A 3CDXA 4RI1A 1EFTA 3ONYA 3MRUA 4EH1A 1EP2B 1DARA 2ZBUA 2VJIA 2EO8A 3TOAA 1QG0A 1E64A 4KVOE 2YNEA 5A27A 3CW2A 4DQKA 4PPZA 4B3XA 4P4JA 3PUNA 5B6IA 4Q7AA 1DG1G 4NGSA 1YI2B 2R98A 3OPOA 1NRKA 2EFGA 1CP7A 2OH1A 4Q7JB 2O28A 3H9NA 2GQFA 4KZTA 3TX8A 4NEXA 2V7WA 1WWZA 4RPBA 1XEBA 4XPKA 1TTTA 4XONA 2R6HA 3I55B 4R3KA 3QAHA 4DJLA 3R9FA 3GVLA 1OB0A 4JZ0A 3B3VA 3W2FA 2PIZA 1YR0A 3CZXA 4MFZA 3D7DA 3NH5A 1UMKA 3VR6A 2C6PA 2WSAA 4DK0A 2OTJB 4A32A 2XNCA 2ABZA 4P4DA 2PJCA 1IYLA 3U6BA 4KKUA 2XZLA 4UCMA 2F43A 2VBQA 5GCNA 1AYEA 5IV0A 1NB9A 2NV4A 4ZY1A 3FEDA 4XNHC 2XZOA 1Z8TA 3CCSB 2PDOA 4CGMA 3PP9A 2NYQA 4LX9A 4OPVA 2YWFA 2OTLB 2GREA 5A88A 4B5PA 1KK2A 4K1XA 1B2RA 1V0EA 1YSJA 3C26A 1WPCA 2EVNA 2CNSA 1G7SA 1W0KA 2QEXB 3D7HA 4TMXA 1Q82D 3CMAB 5F48A 1QSRA 2GIVA 2RFHA 4CRYB 4ZBGA 1Z9UA 4ZX8A 4HIZA 3Q3AA 5AGEA 1SKQA 4U9YA 2FCKA 5G21A 2JEWA 1WOOA 1K28D 2PSWA
chains in the Genus database with same CATH topology
3BXMA 2EWBA 2PJ2A 1LOKA 2JBJA 3PB9X 1QQ9A 2CTBA 3B3TA 1R43A 3SI0A 3S9LA 4UIBA 1Q7LA 3B3WA 1R3NA 2AFOA 4WJBA 2ZEGA 4PXBA 1VHOA 3GUXA 3PRTA 5JGFA 1HEEA 3WC6A 4MCPA 4EMEA 1F57A 4OC2A 4A39A 3BHXA 1Y0YA 1VIXA 2GU2A 3B3SA 2V8GA 2BO9A 2AFMA 4UF4A 3D7GA 2J9AA 4P4EA 3KQXA 4F9UA 3PB4X 5HXDA 6CPAA 3KZWA 1VHEA 2NSMA 3B2YA 1ZG9A 4GM5A 4OC4A 3WC7A 4ZI6A 1GYTA 3IWWA 4ZY0A 4MXUA 4H2KA 1YW6A 2V8HA 4RUHA 1PYTB 3PBEA 2EK8A 1ARLA 4R6TA 4NGQA 3FECA 5ELYA 2PCUA 1LANA 5D29A 2O4HA 2PJ8A 2IMOA 2C6GA 2AFWA 4PXCA 3KASA 2ZEHA 2XEFA 3SJEA 2IJZA 5LRKA 3IC1A 1EE3P 3V7ZA 1BPMA 1TKJA 4F8ZA 5K8NA 2PJBA 3S9NA 5LYFA 1ZLHA 4P4FA 3PB8X 3FVLA 4FAIA 1TF9A 3FX6A 4FBEA 3VARA 4BD9A 2PJAA 1IY7A 5K8OA 4R76A 2O53A 4IHMA 1YW4A 2C6CA 3RAMA 2RB7A 1HDQA 2XEGA 1XRYA 2ANPA 4UEZA 4NGMA 4A94A 4OC1A 4MCSA 1CP6A 4MCQA 4MHPA 2PIYA 3K2KA 4ZY2A 1AMPA 4OIWA 1TKHA 3WABA 4R7MA 2AFXA 2ZEFA 1ZG8A 2ZENA 3K9TA 4CPAA 3H8EA 2AFUA 4JYWA 1Y7EA 4TNUA 3KGQA 5K8MA 4OIDA 3FF3A 4NGRA 1BAVA 3I1UA 3KI9A 4NGPA 1TXRA 3FH4A 3ISZA 4AXVA 2ZEPA 1CG2A 4UIAA 3S9MA 1CX8A 3KR4A 2PVVA 3SJGA 4KSIA 4OC3A 3FMCA 3IFEA 3KQZA 4F9VA 1ARMA 1LCPA 3FJUA 3PB6X 5DS0A 4ZX9A 3BI1A 4R8FA 3D4UA 3D7FA 1DE4C 4EWTA 4OC5A 4NGNA 3KL9A 1FT7A 4FWUA 3B3CA 3LWUA 3MN8A 5LRJA 1LAMA 1Z8LA 4A38A 4OC0A 5LYIA 2V77A 1UWYA 1JQGA 1XBUA 4P6YA 2WYRA 2JBKA 4YWYA 1H8LA 4IAVA 3PFEA 1ZG7A 2V8VA 1FNOA 2FVGA 1PCAA 2CF4A 1CPSA 2DEAA 2CIJA 1Z5RA 2CTCA 1ELLP 5HVFA 5LRGA 2IQ6A 5CPAA 3GB0A 2PJ9A 4DYOA 2G9DA 1TKFA 3KHXA 3DGVA 4MCRA 2F7VA 2PJ3A 2HB6A 2HC9A 2PRQA 3IIBA 3PFOA 2I3CA 4X3RA 3ISXA 4UEEA 1LFWA 2PJ0A 2ZOGA 2ZOFA 4P45A 2XEIA 5D8NA 4P4IA 3GLJA 1BLLE 4PXEA 4UEFA 3SJXA 4EFDA 3WT4A 1XMBA 4Z65A 3KR5A 1QMUA 3PBBA 7CPAA 3N5FA 4OKOA 2AFSA 1XFOA 3HUVA 1CBXA 3RBUA 3NH4A 3CPAA 2PJ4A 1ZLIA 3B35A 4NGTA 2PJ7A 3SJFA 4MHZA 2ZEEA 4OP4A 2F8HA 2EK9A 4WWVA 2PJ6A 3PB7X 2ZEDA 2OR4A 1YLOA 3HLPA 1CPXA 2C1CA 3WC5A 2PE3A 2AFZA 3TC8A 4P10A 4O23A 5HVGA 3B7IA 5IB9A 1TF8A 5JH9A 5CBMA 3DLJA 3CDXA 4MMOA 3MRUA 2QYVA 3NFZA 4DUKA 4ONWA 5LYLA 3D67A 3L2NA 3RZAA 2WZNA 1M4LA 3VATA 3JRUA 5THWA 4PPZA 4P4JA 2Q51A 2ZEMA 3D66A 2BCOA 4Q7AA 4LQGA 4NGSA 3SI1A 3IO1A 1CP7A 2VL1A 3NA6A 3TX8A 2ZELA 3VH9A 4FUUA 1YMEA 1VGYA 4X2TA 5JM6A 4OMEA 1F2PA 4MHYA 4TWEA 1HDUA 3PEIA 3QNVA 4DJLA 5HVHA 4PQAA 4B6ZA 4JZ0A 3B3VA 3H8GA 2PIZA 3D7DA 3NH5A 3CT9A 1BPNA 1Y0RA 5LYDA 2QVPA 4P44A 2C6PA 4W9YA 2V8DA 3V38A 2ABZA 4P4DA 4PXDA 2PJCA 1OBRA 3LMSA 5F09A 3D68A 3KHZA 4A37A 1F2OA 2ZEOA 3SI2A 8CPAA 2XEJA 1ELMP 1AYEA 2BOAA 4ZY1A 3FEDA 5I4MA 1Z2LA 2PJ5A 2QJ8A 4NFRA 3FEEA 2POKA 2NYQA 4NJRA 2GLFA 4ZYQA 1KWMA 1XJOA 2GREA 3T8WA 3H8FA 2PVWA 1RTQA 1YSJA 4MHNA 2OOTA 3NH8A 3D7HA 4YU9A 4MRIA 3CPXA 4X8IA 3BI0A 4G1PA 4P4BA 5J1QA 4NJQA 4IK2A 2Q43A 2GLJA 4K3NA 5K8PA 1DTDA 2RFHA 3IEHA 1NSAA 3IJ3A 4ZX8A 1LAPA 2PJ1A 1IGBA 2JEWA 2Q4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BXM A;  2EWB A;  2PJ2 A;  1LOK A;  2JBJ A;  3PB9 X;  1QQ9 A;  2CTB A;  3B3T A;  1R43 A;  3SI0 A;  3S9L A;  4UIB A;  1Q7L A;  3B3W A;  1R3N A;  2AFO A;  4WJB A;  2ZEG A;  4PXB A;  1VHO A;  3GUX A;  3PRT A;  5JGF A;  1HEE A;  3WC6 A;  4MCP A;  4EME A;  1F57 A;  4OC2 A;  4A39 A;  3BHX A;  1Y0Y A;  1VIX A;  2GU2 A;  3B3S A;  2V8G A;  2BO9 A;  2AFM A;  4UF4 A;  3D7G A;  2J9A A;  4P4E A;  3KQX A;  4F9U A;  3PB4 X;  5HXD A;  6CPA A;  3KZW A;  1VHE A;  2NSM A;  3B2Y A;  1ZG9 A;  4GM5 A;  4OC4 A;  3WC7 A;  4ZI6 A;  1GYT A;  3IWW A;  4ZY0 A;  4MXU A;  4H2K A;  1YW6 A;  2V8H A;  4RUH A;  1PYT B;  3PBE A;  2EK8 A;  1ARL A;  4R6T A;  4NGQ A;  3FEC A;  5ELY A;  2PCU A;  1LAN A;  5D29 A;  2O4H A;  2PJ8 A;  2IMO A;  2C6G A;  2AFW A;  4PXC A;  3KAS A;  2ZEH A;  2XEF A;  3SJE A;  2IJZ A;  5LRK A;  3IC1 A;  1EE3 P;  3V7Z A;  1BPM A;  1TKJ A;  4F8Z A;  5K8N A;  2PJB A;  3S9N A;  5LYF A;  1ZLH A;  4P4F A;  3PB8 X;  3FVL A;  4FAI A;  1TF9 A;  3FX6 A;  4FBE A;  3VAR A;  4BD9 A;  2PJA A;  1IY7 A;  5K8O A;  4R76 A;  2O53 A;  4IHM A;  1YW4 A;  2C6C A;  3RAM A;  2RB7 A;  1HDQ A;  2XEG A;  1XRY A;  2ANP A;  4UEZ A;  4NGM A;  4A94 A;  4OC1 A;  4MCS A;  1CP6 A;  4MCQ A;  4MHP A;  2PIY A;  3K2K A;  4ZY2 A;  1AMP A;  4OIW A;  1TKH A;  3WAB A;  4R7M A;  2AFX A;  2ZEF A;  1ZG8 A;  2ZEN A;  3K9T A;  4CPA A;  3H8E A;  2AFU A;  4JYW A;  1Y7E A;  4TNU A;  3KGQ A;  5K8M A;  4OID A;  3FF3 A;  4NGR A;  1BAV A;  3I1U A;  3KI9 A;  4NGP A;  1TXR A;  3FH4 A;  3ISZ A;  4AXV A;  2ZEP A;  1CG2 A;  4UIA A;  3S9M A;  1CX8 A;  3KR4 A;  2PVV A;  3SJG A;  4KSI A;  4OC3 A;  3FMC A;  3IFE A;  3KQZ A;  4F9V A;  1ARM A;  1LCP A;  3FJU A;  3PB6 X;  5DS0 A;  4ZX9 A;  3BI1 A;  4R8F A;  3D4U A;  3D7F A;  1DE4 C;  4EWT A;  4OC5 A;  4NGN A;  3KL9 A;  1FT7 A;  4FWU A;  3B3C A;  3LWU A;  3MN8 A;  5LRJ A;  1LAM A;  1Z8L A;  4A38 A;  4OC0 A;  5LYI A;  2V77 A;  1UWY A;  1JQG A;  1XBU A;  4P6Y A;  2WYR A;  2JBK A;  4YWY A;  1H8L A;  4IAV A;  3PFE A;  1ZG7 A;  2V8V A;  1FNO A;  2FVG A;  1PCA A;  2CF4 A;  1CPS A;  2DEA A;  2CIJ A;  1Z5R A;  2CTC A;  1ELL P;  5HVF A;  5LRG A;  2IQ6 A;  5CPA A;  3GB0 A;  2PJ9 A;  4DYO A;  2G9D A;  1TKF A;  3KHX A;  3DGV A;  4MCR A;  2F7V A;  2PJ3 A;  2HB6 A;  2HC9 A;  2PRQ A;  3IIB A;  3PFO A;  2I3C A;  4X3R A;  3ISX A;  4UEE A;  1LFW A;  2PJ0 A;  2ZOG A;  2ZOF A;  4P45 A;  2XEI A;  5D8N A;  4P4I A;  3GLJ A;  1BLL E;  4PXE A;  4UEF A;  3SJX A;  4EFD A;  3WT4 A;  1XMB A;  4Z65 A;  3KR5 A;  1QMU A;  3PBB A;  7CPA A;  3N5F A;  4OKO A;  2AFS A;  1XFO A;  3HUV A;  1CBX A;  3RBU A;  3NH4 A;  3CPA A;  2PJ4 A;  1ZLI A;  3B35 A;  4NGT A;  2PJ7 A;  3SJF A;  4MHZ A;  2ZEE A;  4OP4 A;  2F8H A;  2EK9 A;  4WWV A;  2PJ6 A;  3PB7 X;  2ZED A;  2OR4 A;  1YLO A;  3HLP A;  1CPX A;  2C1C A;  3WC5 A;  2PE3 A;  2AFZ A;  3TC8 A;  4P10 A;  4O23 A;  5HVG A;  3B7I A;  5IB9 A;  1TF8 A;  5JH9 A;  5CBM A;  3DLJ A;  3CDX A;  4MMO A;  3MRU A;  2QYV A;  3NFZ A;  4DUK A;  4ONW A;  5LYL A;  3D67 A;  3L2N A;  3RZA A;  2WZN A;  1M4L A;  3VAT A;  3JRU A;  5THW A;  4PPZ A;  4P4J A;  2Q51 A;  2ZEM A;  3D66 A;  2BCO A;  4Q7A A;  4LQG A;  4NGS A;  3SI1 A;  3IO1 A;  1CP7 A;  2VL1 A;  3NA6 A;  3TX8 A;  2ZEL A;  3VH9 A;  4FUU A;  1YME A;  1VGY A;  4X2T A;  5JM6 A;  4OME A;  1F2P A;  4MHY A;  4TWE A;  1HDU A;  3PEI A;  3QNV A;  4DJL A;  5HVH A;  4PQA A;  4B6Z A;  4JZ0 A;  3B3V A;  3H8G A;  2PIZ A;  3D7D A;  3NH5 A;  3CT9 A;  1BPN A;  1Y0R A;  5LYD A;  2QVP A;  4P44 A;  2C6P A;  4W9Y A;  2V8D A;  3V38 A;  2ABZ A;  4P4D A;  4PXD A;  2PJC A;  1OBR A;  3LMS A;  5F09 A;  3D68 A;  3KHZ A;  4A37 A;  1F2O A;  2ZEO A;  3SI2 A;  8CPA A;  2XEJ A;  1ELM P;  1AYE A;  2BOA A;  4ZY1 A;  3FED A;  5I4M A;  1Z2L A;  2PJ5 A;  2QJ8 A;  4NFR A;  3FEE A;  2POK A;  2NYQ A;  4NJR A;  2GLF A;  4ZYQ A;  1KWM A;  1XJO A;  2GRE A;  3T8W A;  3H8F A;  2PVW A;  1RTQ A;  1YSJ A;  4MHN A;  2OOT A;  3NH8 A;  3D7H A;  4YU9 A;  4MRI A;  3CPX A;  4X8I A;  3BI0 A;  4G1P A;  4P4B A;  5J1Q A;  4NJQ A;  4IK2 A;  2Q43 A;  2GLJ A;  4K3N A;  5K8P A;  1DTD A;  2RFH A;  3IEH A;  1NSA A;  3IJ3 A;  4ZX8 A;  1LAP A;  2PJ1 A;  1IGB A;  2JEW A;  2Q4Z A; 
#chains in the Genus database with same CATH topology
 3BXM A;  4CAX A;  2PJ2 A;  2DXQ A;  4M85 A;  4G7W A;  2Z3P A;  3B3T A;  4XOP A;  3S9L A;  4A33 A;  3B3W A;  1XB2 A;  4H89 A;  2PR1 A;  1S7N A;  3S6H A;  4ZGY B;  3EXN A;  1XE4 A;  1G7T A;  3TFY A;  4UCN A;  2F4N A;  2V7V A;  3OAA A;  2YNC C;  1VHO A;  1KZF A;  4Y49 B;  3CXS A;  2CND A;  4CRZ B;  3CCE B;  1HEE A;  3WC6 A;  4OC2 A;  4HE6 A;  1R57 A;  2GU2 A;  2B5O A;  1BLI A;  2LZJ A;  1TIQ A;  3OW2 B;  3KQX A;  1D2E A;  4WZE A;  1I8D A;  4UFW A;  3KZW A;  6CPA A;  3RY8 A;  4TMW A;  3OOC A;  1BX1 A;  2C27 A;  4GM5 A;  5FVJ A;  3WC7 A;  4XL9 A;  2YWE A;  2FE7 A;  3IWW A;  2QA4 B;  2ZW5 A;  4CYQ A;  4RUH A;  1T5E A;  2OU2 A;  3AVT A;  2EK8 A;  2VYQ A;  1IID A;  1IOF A;  2B5G B;  1LAN A;  3SXO A;  2V7X A;  2VXK A;  4MFJ A;  3ONU A;  5AG5 A;  2AFW A;  2VNI A;  4Y9U A;  1UD6 A;  2XEF A;  1NSL A;  3IC1 A;  4F8Z A;  1TKJ A;  3S9N A;  2PRB A;  2QEC A;  4OOV A;  4FAI A;  4XLC A;  1QSM A;  2B58 A;  2JDC A;  1ON0 A;  2QTL A;  1IY7 A;  3WXM A;  2Q6K A;  2EUI A;  3R1K A;  1M1K D;  4RD2 A;  2FIA A;  1GAQ A;  4PGO A;  2RB7 A;  1UD4 A;  2XEG A;  1BQE A;  2QE7 A;  4OC1 A;  4H6Z A;  4YAU A;  1CP6 A;  1K4J A;  4MCQ A;  4ZY2 A;  1AMP A;  4R7M A;  2AFX A;  2ZEF A;  2ZEN A;  4CPA A;  2G3A A;  4TNU A;  3KGQ A;  1I12 A;  4YAO A;  4OID A;  3FF3 A;  4NGP A;  2CC2 A;  3FH4 A;  2Z3M A;  4F0X A;  1Z4R A;  4TT3 A;  1CX8 A;  2X53 S;  1WSV A;  5HXB A;  1N05 A;  3SJP A;  2QGG A;  3FMC A;  3KQZ A;  1V5V A;  1I7P A;  3P26 A;  1KUY A;  1SQH A;  4M53 A;  3A1P A;  3A3G A;  3BI1 A;  4OOX A;  1NBM A;  1FX0 A;  3D4U A;  1MRZ A;  2Z0Z A;  4FD4 A;  2ZXH A;  4OC5 A;  4NGN A;  1F20 A;  1D1N A;  4LBZ A;  4M0L A;  1JB9 A;  4B4D A;  4KOW A;  1FNB A;  3MN8 A;  1VKC A;  1FRN A;  4MYT A;  4C7H A;  4CAW A;  4QVA A;  2EIX A;  3I1F A;  3FPP A;  5EMI A;  3GY9 A;  1PCA A;  2DEA A;  4Z4T A;  4YHB A;  1Q86 D;  2HCJ B;  1BOB A;  4MY3 A;  2FT0 A;  1R5O A;  5FO0 A;  3GIR A;  3EY5 A;  1QUE A;  4ASU A;  1QUF A;  2GJP A;  3LQ6 A;  4PC7 A;  4DYO A;  2G9D A;  1E3X A;  4AVZ A;  2PQ8 A;  2X6W A;  1IB1 E;  2PJ3 A;  1PJ5 A;  3AVY A;  2GK6 A;  4X05 A;  4Z4V A;  2A4N A;  4XPD B;  2FXF A;  4UEE A;  2JJ2 A;  1YVO A;  4KKT A;  4KVX A;  4JD6 A;  4EFD A;  1N07 A;  1P4M A;  2ZL5 A;  3W5V A;  4PSX A;  1ZM2 A;  4PK2 A;  3DSB A;  4C0S A;  3B8H A;  3WT4 A;  3VNV A;  3QFS A;  4OPS A;  3V8I A;  3SXN A;  3EO4 A;  3PBB A;  4P12 A;  1FRQ A;  3CCJ B;  1VQ9 B;  4XKW A;  3OZV A;  1PU9 A;  4QFM A;  1IJE A;  1S5K A;  4JXQ A;  4QUS A;  2VEZ A;  4RDK A;  2WJV A;  2GJK A;  4NGT A;  2B4B A;  4MHZ A;  2F8H A;  5CDF A;  1WOS A;  3ASP A;  2PJ6 A;  3PB7 X;  4G7X A;  2OR4 A;  3JQR A;  1QX4 A;  3CPW B;  1YLO A;  3HLP A;  4WZK A;  1RQR A;  1VLY A;  1TVC A;  2PE3 A;  2ZZF A;  1N8R D;  3I9S A;  3JUW A;  4P10 A;  5HVG A;  3B7I A;  3ZZ0 A;  1QVF B;  1TF8 A;  2Q4Y A;  4P3I A;  3T56 B;  3Q39 A;  3JQQ A;  4MMO A;  3GVK A;  2B7B A;  5J8C A;  4KLW A;  5LYL A;  5GV7 A;  1WOP A;  3D67 A;  4RJL A;  4QVT A;  3L2N A;  3RZA A;  2WZN A;  3VAT A;  4HPS A;  3D8P A;  5F4J A;  3A9L A;  3W2I A;  2Q51 A;  4BPR A;  2AE6 A;  1H8E A;  2WZP P;  3TO6 A;  1VHS A;  5THX A;  2XEX A;  4XR6 A;  4JLY A;  2P3M A;  4XLF A;  3LNN A;  2PR8 A;  5JPH A;  4TMZ A;  1XMT A;  4X2T A;  1QGY A;  4OME A;  2B4D B;  3W2E A;  4TWE A;  5G22 A;  4KOY A;  2X6Y A;  2X7B A;  1IOI A;  4DNR B;  3QNV A;  2E1B A;  4PQA A;  2VI7 A;  2I1L A;  3P27 A;  4ORF A;  3Q38 A;  1CNF A;  4QC6 A;  2YWH A;  2QVP A;  4YEL A;  2BM1 A;  2VZL A;  2ZPA A;  1OZP A;  4NNJ A;  2V31 A;  4R57 A;  3D68 A;  3K9U A;  3KHZ A;  1KTV A;  4IF5 A;  1BMF A;  1J9Z A;  2CK3 A;  1S72 B;  1ELM P;  3BCD A;  1NDH A;  5H5J A;  5I4M A;  1EFU A;  3CXC B;  1B87 A;  1AMO A;  1QSO A;  5AG7 A;  1XQB A;  4MY0 A;  4RD3 A;  2G0B A;  1KWM A;  1VQ6 B;  4H6U A;  3T8W A;  4KKS A;  4GQN A;  2CNT A;  3H8F A;  2PVW A;  5C82 A;  1RTQ A;  2I79 A;  2B3V A;  2Q44 A;  2I00 A;  3NH8 A;  3BI0 A;  4K3N A;  5K8P A;  5TY0 A;  2OZH A;  4X07 A;  4ROX A;  4DK1 A;  1Z8X A;  4AVB A;  1RQP A;  5DWM A;  3AVV A;  2Q4Z A;  2AHO A;  1N0U A;  1H8H A;  5IK2 A;  2EWB A;  1LOK A;  1JWQ A;  1ZO0 A;  4NF1 A;  2CTB A;  1WP6 A;  1VQL B;  2ODF A;  3D3S A;  3SI0 A;  4UIB A;  2GAN A;  1ZM4 A;  2OYN A;  3Q6Q A;  3WNB A;  3MGD A;  2BL1 A;  4AF6 A;  2VZY A;  3MHP A;  2ZEG A;  4KS9 A;  3A8I A;  1WK4 A;  1F60 A;  3PVD A;  3VO2 A;  4NCN A;  4C2Z A;  5F46 A;  2ZW6 A;  4JWP A;  4OPO A;  4EME A;  4CQJ A;  4KVM E;  3G71 B;  4A39 A;  3PA2 A;  3BHX A;  4B5O A;  2OB0 A;  4Z1M A;  1MAB A;  2V8G A;  2AFM A;  4RCY A;  4P4E A;  4F9U A;  3CME B;  2QIR A;  5IYQ A;  4PC6 A;  2OK8 A;  2P6G A;  2C2W A;  1N71 A;  3D2M A;  2C4T A;  4CGN A;  1ZG9 A;  1JJ2 B;  3U2Q A;  3WBJ A;  1Y9W A;  2DPT A;  1JNY A;  4ZI6 A;  1FDR A;  1QFJ A;  4CGO A;  2JIZ A;  4MXU A;  1YW6 A;  5EC4 A;  4NBS A;  1N0V C;  2CY2 A;  4G1B A;  4NGQ A;  3MMP A;  3FEC A;  3ASQ A;  5ELY A;  2PCU A;  5D29 A;  1UD5 A;  4RDJ A;  2GE3 A;  2C6G A;  5H84 A;  2FS5 A;  1T6Y A;  2REF A;  4X0C A;  1GR1 A;  1I18 A;  2WR8 A;  3KAS A;  4G6I A;  2ZEH A;  3V7Z A;  3Q6R A;  4MBU A;  5LYF A;  1ZLH A;  4JJX A;  3ASS A;  3WQZ A;  4RD4 A;  3PB8 X;  3FVL A;  1TF9 A;  2ATR A;  4MJ8 A;  1QGA A;  4FBE A;  5KTC A;  3TE4 A;  2PJA A;  3GSI A;  4YGO A;  2G3T A;  4KOT A;  3AVW A;  1YW4 A;  2C6C A;  3BJ8 A;  4G5G A;  4JMQ A;  3RAM A;  4AC9 A;  4QHY A;  4L89 A;  5F47 A;  4MCS A;  1YIT B;  3EFA A;  4XNH B;  4MHP A;  3S6K A;  5BSX A;  5E6T A;  1OGJ A;  2B4D A;  2B3U A;  3ES9 A;  2VBU A;  3H8E A;  1E63 A;  4P25 A;  3QFR A;  4NCZ A;  4AG9 A;  3W5U A;  4L8J A;  4XD7 A;  1BAV A;  3KI9 A;  3TO9 A;  1TXR A;  1IJF A;  2ZEP A;  3CXQ A;  4PV6 A;  3VO1 A;  3DR6 A;  2ZL6 A;  4DQL A;  3SJG A;  4QB9 A;  2D4O A;  4KSI A;  4OC3 A;  3VMF A;  3F0A A;  2X3U A;  5DN6 A;  1I1D A;  1K8A D;  4UWJ A;  4F9V A;  1LCP A;  4CAE A;  1LRZ A;  5DS0 A;  4P22 A;  3CCQ B;  4ZX9 A;  4PSW A;  4R8F A;  4QUZ A;  3CC7 B;  2OBS A;  3H4Q A;  3N7Z A;  3WND A;  4KUB A;  1I21 A;  3R6K A;  1VQK B;  2Y0M A;  4Z4U A;  2VBS A;  2B7C A;  3LWU A;  4E2A A;  2X8K A;  4Q36 A;  1LAM A;  2YGW A;  2P0W A;  2V77 A;  1WSR A;  1UWY A;  1JQG A;  1XBU A;  4R9M A;  4YWY A;  5FIU A;  4OAE A;  3E1Y E;  2V8V A;  2HUZ A;  5IYW A;  3ZBU A;  4C7I A;  1VQN B;  1KUX A;  3OKX A;  3PZJ A;  2WSS A;  2JEV A;  1Z4E A;  1J4J A;  3GB0 A;  5H59 A;  2PJ9 A;  3ZZI A;  3DGV A;  4B44 A;  2F7V A;  2HB6 A;  2HC9 A;  2PRQ A;  3PFO A;  2I3C A;  3CCL B;  3QB8 A;  1FND A;  4X3R A;  1IU8 A;  2FL4 A;  3CCU B;  2ZOG A;  4RDL A;  1WOR A;  2ZOF A;  2ZTG A;  1PKV A;  2NPF A;  5D8N A;  1Q7Y D;  3GLJ A;  1BLL E;  2CXA A;  3SJX A;  3H5Z A;  3LO8 A;  1CQX A;  4XN3 A;  2V4D A;  2BEI A;  3BNW A;  1N08 A;  2DPS A;  4M3S A;  1S3Z A;  5GV8 A;  1XFO A;  3T51 B;  1W35 A;  3BY2 A;  4TMV A;  1QSN A;  4B48 A;  3G8W A;  5G20 A;  2K5T A;  3NH4 A;  1GAW A;  2PJ4 A;  4Q38 A;  3TTH A;  1ELO A;  4OP4 A;  2EK9 A;  3T53 B;  2ZED A;  3OZW A;  3F8K A;  2ZBV A;  3D26 A;  4LBV A;  3RYO A;  4O23 A;  2F5I A;  2PMD A;  5JH9 A;  4C2Y A;  3T9Y A;  3E20 A;  3G05 A;  4I49 A;  2QYV A;  4DUK A;  1HZE A;  3KKW A;  2KVO A;  5ISV A;  1Q9S A;  4C43 A;  2F1M A;  4KSA A;  4X5K A;  1UD8 A;  2C78 A;  1M4L A;  3OWC A;  4N3G A;  1EP3 B;  3RNZ A;  3GIU A;  2ZEM A;  2BVN A;  3CTA A;  3D66 A;  4LQG A;  1CNE A;  2Z3O A;  5DSZ A;  1HVX A;  1YX2 A;  2D3L A;  1V0C A;  3SHP A;  2R9V A;  4B3G A;  2V7Q A;  4QVJ A;  5A8A A;  1MJB A;  2Q6L A;  3BQJ A;  1Y7R A;  5A28 A;  4BIN A;  4BBH A;  3HAG A;  4B14 A;  2M5S A;  3VH9 A;  4FUU A;  3JQP A;  4B43 A;  5F49 A;  2J8M A;  3A8K A;  4B47 A;  1F2P A;  4MHY A;  5TV2 A;  2VNK A;  2ARH A;  1IIC A;  1YJW B;  2V7U A;  3PEI A;  3CB4 A;  1VQ5 B;  4R3L A;  1BPL A;  3H8G A;  1YLE A;  4XPD C;  3GKR A;  1TUI A;  1IB0 A;  3TCV A;  1S60 A;  5F4O A;  1GHE A;  2ZZE A;  2P6E A;  1YRE A;  4TN1 A;  3AST A;  3FIX A;  2Z3K A;  3BLN A;  4W9Y A;  4AVA A;  5KNL A;  2VZZ A;  4PXD A;  1OBR A;  5F09 A;  4A37 A;  4CYN A;  2W6I A;  4B10 A;  2ZEO A;  8CPA A;  3U6K A;  3TO7 A;  3G4S B;  3QAY A;  3B78 A;  4XNF A;  1Q2D A;  2VNH A;  1Z2L A;  2PJ5 A;  3WBK A;  2BV3 A;  4RLZ A;  5FNZ A;  4NFR A;  1KJZ A;  4X7E A;  2YNC A;  3R9G A;  2GLF A;  4ZYQ A;  5L46 A;  3WR7 A;  2VBV A;  4XKV A;  4MHN A;  2BSW A;  2OOT A;  4YU9 A;  4MRI A;  2NMT A;  4X8I A;  4P4B A;  5J1Q A;  4IK2 A;  2VJJ A;  1OB2 A;  2GLJ A;  1ZUN B;  4FD7 A;  1DTD A;  3IEH A;  3IJ3 A;  1LAP A;  1V0F A;  4BMH A;  2PJ1 A;  2P6F A;  2Q7B A;  1KRH A;  4UA3 A;  4F7D A;  3PB9 X;  3DNS A;  1S7K A;  2IL4 A;  3FXT A;  4ZV4 A;  1R43 A;  3IWG A;  2J8N A;  5TR9 A;  3OEH A;  2WPW A;  4XMY A;  1ZM9 A;  3BJ7 A;  2AFO A;  4WJB A;  1JA0 A;  3BCF A;  4RD1 A;  4CAF A;  3PRT A;  2GK7 A;  3CRZ A;  2GJR A;  1XIX A;  2DER A;  4MCP A;  1KZL A;  4AVC A;  2PLF A;  3W2H A;  4FN5 A;  4IW3 B;  5EBV A;  2DIE A;  1VIX A;  4B13 A;  3B3S A;  2VNJ A;  2WPX A;  2BO9 A;  3D7G A;  2J9A A;  3PB4 X;  1E3Z A;  1QGZ A;  4PAB A;  4Z4S A;  2R8V A;  1VF7 A;  1X12 A;  2NSM A;  2DET A;  3B2Y A;  4OC4 A;  3A35 A;  4RD0 A;  1GYT A;  2REE A;  4FXU A;  4ZY0 A;  4XQF A;  2PIA A;  1KMH A;  1PYT B;  1W87 A;  4LBY A;  5H86 A;  2Z3L A;  3PBE A;  1EFC A;  1ARL A;  3TOB A;  1M90 D;  2WUU A;  3LOD A;  4GS4 A;  1QH0 A;  4F6A A;  3WYA A;  1R5B A;  5J8F A;  2PJ8 A;  4A31 A;  1M4I A;  5TRD A;  3S6G A;  2ZL7 A;  4KUA A;  1S4M A;  3SJE A;  2IJZ A;  5LRK A;  1EE3 P;  4MHD A;  3OEE A;  4YAF A;  2PJB A;  4MI4 A;  4P4F A;  2Z11 A;  1DDI A;  3GQB A;  2HLD A;  3PEN A;  4BD9 A;  1GVH A;  1WTH D;  2QN6 A;  4QBJ A;  4R76 A;  4ZCM A;  4IHM A;  5IYN A;  2CW5 A;  1HDQ A;  1XRY A;  2ANP A;  2QDX A;  2WJY A;  4A94 A;  1IHM A;  4YXW A;  1T6Z A;  2JN9 A;  3ASR A;  2PIY A;  3K2K A;  3IGR A;  1WU8 A;  4RCZ A;  3K9T A;  1M1D A;  1YHQ B;  3ZBT A;  2AFU A;  4JYW A;  5LMZ A;  1Y7E A;  4P26 A;  2X85 A;  4M4S A;  4RM0 A;  2J8R A;  1AUG A;  2ZXI A;  2C5B A;  2OK7 A;  4YFJ A;  4UZF A;  3MCA A;  4KOV A;  3ISZ A;  4AXV A;  5KSW B;  3S9M A;  1YVK A;  4ZGN B;  2PVV A;  3PGP A;  5HKK A;  3JU4 A;  3UY5 A;  3R6J A;  1XF8 A;  4EVY A;  4KSF A;  3ZC3 A;  3I56 B;  1ARM A;  1IYK A;  3PB6 X;  1GJR A;  5KTD A;  3FPK A;  1M44 A;  1DE4 C;  4EWT A;  3CCM B;  3KL9 A;  2BGJ A;  3OJW A;  1S7F A;  1D8T A;  4U9U A;  2ZW4 A;  4KOS A;  3AVU A;  1VLO A;  4A38 A;  4OC0 A;  5LYI A;  3CC4 B;  4Y9R A;  4NSQ A;  1Q81 D;  1W34 A;  3FRM A;  4M2L A;  2WYR A;  4Z4Y A;  2J7K A;  4F0Y A;  4IAV A;  1W9X A;  1ZG7 A;  3QSY A;  4A95 A;  3SLN A;  2CF4 A;  3FB3 A;  2V7T A;  5BSY A;  1KQS B;  4WQM A;  5AG6 A;  3ZUG A;  3BH4 A;  4XOR A;  2RC6 A;  5LRG A;  2IQ6 A;  5CPA A;  4OOS A;  3H94 A;  2CNM A;  4LUA A;  3KHX A;  2Q6O A;  4MCR A;  2Z6B D;  2AJ6 A;  2XZP A;  3AVX A;  4Y7C A;  5FL7 A;  3ISX A;  3BC9 A;  3VWD A;  1VQO B;  1K73 D;  1QVG B;  1Z8W A;  5IYP A;  2XEI A;  4AF7 A;  5EMN A;  3AGP A;  1M4G A;  4HNW B;  1QFZ A;  2Z10 A;  4KOR A;  4C2X A;  1XMB A;  1OHH A;  1E1Q A;  2YND A;  2XND A;  4XPL A;  1QMU A;  3CXP A;  3N5F A;  1KK3 A;  3W5H A;  2AFS A;  3FKS A;  3NE8 A;  1VQ4 B;  2D4P A;  3HUV A;  3D2P A;  1CBX A;  3RBU A;  4M1K A;  2HDN B;  2HMA A;  1P0H A;  3CP2 A;  2ZZG A;  1FY7 A;  1ZLI A;  3ZIA A;  3B35 A;  2PJ7 A;  2ZEE A;  1PJ6 A;  1YQE A;  2BPO A;  4E0F A;  2HQY A;  2CBX A;  4B11 A;  3LAC A;  4PC2 A;  3B82 A;  1CPX A;  2C1C A;  3WC5 A;  1PUA A;  1XOV A;  1YJ9 B;  3TC8 A;  3SEJ A;  3LVB A;  1B23 P;  3WNC A;  1W2B B;  2QML A;  3CMM A;  4FD5 A;  1QST A;  5CBM A;  2GPJ A;  4ZCI A;  2DYI A;  1YIJ B;  3I3G A;  3DLJ A;  1NJI D;  1UFH A;  1YX0 A;  4Y49 C;  3NFZ A;  1MJA A;  4LQ6 A;  4OLL A;  4H9G A;  4ONW A;  4N3N A;  3DDD A;  5JQ4 A;  1VQP B;  4E8O A;  1EP1 B;  1R5N A;  3JRU A;  3JVN A;  5THW A;  4UBR A;  5G1Z A;  2YWG A;  2BCO A;  4KOX A;  3SI1 A;  1E1R A;  3IO1 A;  4JXR A;  4UAJ A;  2VL1 A;  3NA6 A;  2KCW A;  4PK3 A;  3ZPN A;  3TT2 A;  2OBR A;  4M6I A;  3OFN A;  2ZEL A;  4L8A A;  1UD2 A;  4FK8 A;  5A89 A;  1YME A;  1VGY A;  4CYP A;  3F5B A;  1S7L A;  5JM6 A;  1TLL A;  3OP1 A;  1W0J A;  4Z4R A;  1HDU A;  2DF5 A;  1KC8 D;  4MFQ A;  1KK0 A;  5HVH A;  4J0Q A;  2VBT A;  2GFQ A;  2RC4 A;  4B6Z A;  3CCR B;  2BMW A;  5HZB A;  2D3N A;  3BY1 A;  5C88 A;  2X0K A;  3G6E B;  3NE7 A;  2R7H A;  5J3O A;  4CS0 B;  5J35 A;  2XGJ A;  1CJW A;  3CT9 A;  1BPN A;  2FIW A;  1Y0R A;  2F1L A;  4X7C A;  1EXM A;  5LYD A;  2BF4 A;  4KLV A;  2R1I A;  2FSR A;  2E1R A;  4P44 A;  4MFK A;  2V8D A;  3B8G A;  3OW7 A;  3SLD A;  3V38 A;  2QTZ A;  4PAA A;  3FJO A;  1BO4 A;  5HZA A;  3W6S A;  3LMS A;  5E96 A;  2HV2 A;  3EC4 A;  3VWE A;  1F2O A;  3R96 A;  1L0C A;  1X10 A;  3QFC A;  1YK3 A;  3SI2 A;  1DDG A;  2XEJ A;  3KEW A;  2RC5 A;  4LBW A;  2BOA A;  3P2H A;  4ONU A;  2QJ8 A;  2ZTN A;  1KK1 A;  5AN9 A;  3FEE A;  2POK A;  3WY9 A;  4M6H A;  4E0A A;  4NJR A;  2JDI A;  4II3 A;  4UZE A;  1XJO A;  4QV2 A;  1S0U A;  1COW A;  4YAW A;  1RO5 A;  3JTK A;  4CYO A;  1AIP A;  3ZZU A;  4RPD A;  3CPX A;  4G1P A;  3R95 A;  4NJQ A;  2Q43 A;  4ZCL A;  2DOG A;  1M4D A;  2Q04 A;  3PUM A;  2ZXV A;  4TSF A;  1NSA A;  4P3Y A;  4U5Y A;  4P1V A;  1Q2C A;  1BJK A;  1IGB A;  4X06 A;  2DY1 A;  3FBU A;  4II2 A;  5KTA A;  2JBJ A;  1QQ9 A;  3CP8 A;  1Q7L A;  4IUS A;  4OAD A;  3DDY A;  1R3N A;  4ACB A;  5IYR A;  1Y9K A;  3RO0 A;  4PXB A;  3GUX A;  5I0C A;  5DWN A;  5JGF A;  3OJX A;  2W6J A;  1G7R A;  2VQY A;  1F57 A;  4CAV A;  1Y0Y A;  4KOU A;  1FNC A;  4PC1 A;  5HH1 A;  2PC1 A;  4UF4 A;  4J3G A;  4C68 A;  1A8P A;  5HXD A;  4DNC A;  1JA1 A;  1VHE A;  2Q7S A;  4P2N A;  3CD6 B;  1SKY B;  4YAL A;  2Q4V A;  1SM4 A;  1GO2 A;  1G7C A;  3W91 A;  1H42 A;  4UCP A;  5JBQ A;  4X7F A;  1VJS A;  2ZIT A;  1CM0 A;  4WZL A;  3J81 k;  2ZW7 A;  1EWY A;  4H2K A;  2CRV A;  2V8H A;  4GXH A;  3W2G A;  2JLM A;  4XLE A;  1XE1 A;  4ACA A;  1A2Z A;  4R6T A;  4K30 A;  1MJ9 A;  2OZG A;  2O4H A;  1KD1 D;  2IMO A;  2BSA A;  1OB5 A;  4G1V A;  2Z3N A;  1FNM A;  4MFP A;  4PXC A;  3OE7 A;  4HE5 A;  1NMT A;  3A3B A;  1BPM A;  5K8N A;  1K9M D;  3GYA A;  3S6F A;  1PJ7 A;  3FNC A;  3R9E A;  1N06 A;  2OZU A;  3FX6 A;  1P4N A;  3VAR A;  4UFX A;  4P6V F;  3OZU A;  4WZT A;  3GVJ A;  4LC0 A;  4OP7 A;  1B6B A;  4FWT A;  5K8O A;  4UFV A;  2O53 A;  3NE5 B;  4CGL A;  3ZZT A;  4AB7 A;  2QMU A;  4UEZ A;  4NGM A;  2FX3 A;  2DCU A;  4AG7 A;  4HNY B;  4OIW A;  1TKH A;  3WAB A;  1VQM B;  3ZJ0 A;  4R87 A;  1ZG8 A;  5AG4 A;  1H85 A;  4XM3 A;  1HA3 A;  5K8M A;  1VQ8 B;  4M6G A;  4Z4W A;  2X6X A;  5CNP A;  4B12 A;  3QE2 A;  4NGR A;  3I1U A;  5FA6 A;  1BX0 A;  2Q0Y A;  4A2Z A;  1CG2 A;  3AGQ A;  2WPD A;  4UIA A;  4HKF A;  4RS2 A;  3KR4 A;  3CES A;  4FD6 A;  4XLA A;  3P2F A;  1YGH A;  3LQE A;  4TMT A;  3IFE A;  2B5G A;  3FJU A;  2XOK A;  5HMN A;  4II9 A;  1VQ7 B;  5IB0 A;  2XNJ A;  3D7F A;  1E79 A;  1FT7 A;  2D9R A;  4FWU A;  4RD6 A;  5BWA B;  3B3C A;  3G3S A;  2BUE A;  1E62 A;  1U6M A;  5LRJ A;  2BN4 A;  1Z8L A;  2H5M A;  2C5H A;  3QFT A;  3V7A A;  3W6X A;  3IU2 A;  1UD3 A;  4P6Y A;  2JBK A;  3T90 A;  1U2R A;  4XLH A;  1H8L A;  1YJN B;  4UWI A;  4B5P B;  3PFE A;  1FNO A;  1E43 A;  2FVG A;  1CPS A;  1NE9 A;  4B3F X;  2CIJ A;  4UZU A;  1EFR A;  2DEU A;  3VNU A;  1Z5R A;  2CTC A;  1WDT A;  3CC2 B;  1RXT A;  3IWE A;  1MK4 A;  4HNX B;  1ELL P;  4YEJ A;  5HVF A;  4PC3 A;  5FO1 A;  1TKF A;  2D74 A;  4YRH A;  4P9S A;  3DR8 A;  1T6X A;  3IIB A;  3LD2 A;  4MFL A;  2OBT A;  2EBJ A;  1LFW A;  2PJ0 A;  2JDD A;  1KUV A;  4P45 A;  1ZM3 A;  5IX3 A;  2ZZQ A;  5F4M A;  4P4I A;  4PXE A;  4UEF A;  3PA1 A;  3E0K A;  4XOT A;  4TKO B;  4X7D A;  5KW9 A;  3A8J A;  3IU1 A;  4R71 A;  4Z65 A;  3KR5 A;  2BGI A;  3V76 A;  7CPA A;  4RN7 A;  2BM0 A;  4OKO A;  3SKB A;  4CGP A;  2C4U A;  2JJ1 A;  3CPA A;  4Z4Z A;  1QFY A;  4DNT B;  3SJF A;  4A30 A;  3CCV B;  4WWV A;  4U9Z A;  1NB0 A;  4NXY A;  3FYN A;  4MYU A;  4ZGQ B;  2Q6I A;  3SJZ A;  2AFZ A;  1OGI A;  4XN0 A;  1Q2Y A;  5IB9 A;  2C77 A;  3CDX A;  4RI1 A;  1EFT A;  3ONY A;  3MRU A;  4EH1 A;  1EP2 B;  1DAR A;  2ZBU A;  2VJI A;  2EO8 A;  3TOA A;  1QG0 A;  1E64 A;  4KVO E;  2YNE A;  5A27 A;  3CW2 A;  4DQK A;  4PPZ A;  4B3X A;  4P4J A;  3PUN A;  5B6I A;  4Q7A A;  1DG1 G;  4NGS A;  1YI2 B;  2R98 A;  3OPO A;  1NRK A;  2EFG A;  1CP7 A;  2OH1 A;  4Q7J B;  2O28 A;  3H9N A;  2GQF A;  4KZT A;  3TX8 A;  4NEX A;  2V7W A;  1WWZ A;  4RPB A;  1XEB A;  4XPK A;  1TTT A;  4XON A;  2R6H A;  3I55 B;  4R3K A;  3QAH A;  4DJL A;  3R9F A;  3GVL A;  1OB0 A;  4JZ0 A;  3B3V A;  3W2F A;  2PIZ A;  1YR0 A;  3CZX A;  4MFZ A;  3D7D A;  3NH5 A;  1UMK A;  3VR6 A;  2C6P A;  2WSA A;  4DK0 A;  2OTJ B;  4A32 A;  2XNC A;  2ABZ A;  4P4D A;  2PJC A;  1IYL A;  3U6B A;  4KKU A;  2XZL A;  4UCM A;  2F43 A;  2VBQ A;  5GCN A;  1AYE A;  5IV0 A;  1NB9 A;  2NV4 A;  4ZY1 A;  3FED A;  4XNH C;  2XZO A;  1Z8T A;  3CCS B;  2PDO A;  4CGM A;  3PP9 A;  2NYQ A;  4LX9 A;  4OPV A;  2YWF A;  2OTL B;  2GRE A;  5A88 A;  4B5P A;  1KK2 A;  4K1X A;  1B2R A;  1V0E A;  1YSJ A;  3C26 A;  1WPC A;  2EVN A;  2CNS A;  1G7S A;  1W0K A;  2QEX B;  3D7H A;  4TMX A;  1Q82 D;  3CMA B;  5F48 A;  1QSR A;  2GIV A;  2RFH A;  4CRY B;  4ZBG A;  1Z9U A;  4ZX8 A;  4HIZ A;  3Q3A A;  5AGE A;  1SKQ A;  4U9Y A;  2FCK A;  5G21 A;  2JEW A;  1WOO A;  1K28 D;  2PSW A; 
#chains in the Genus database with same CATH homology
 3BXM A;  2EWB A;  2PJ2 A;  1LOK A;  2JBJ A;  3PB9 X;  1QQ9 A;  2CTB A;  3B3T A;  1R43 A;  3SI0 A;  3S9L A;  4UIB A;  1Q7L A;  3B3W A;  1R3N A;  2AFO A;  4WJB A;  2ZEG A;  4PXB A;  1VHO A;  3GUX A;  3PRT A;  5JGF A;  1HEE A;  3WC6 A;  4MCP A;  4EME A;  1F57 A;  4OC2 A;  4A39 A;  3BHX A;  1Y0Y A;  1VIX A;  2GU2 A;  3B3S A;  2V8G A;  2BO9 A;  2AFM A;  4UF4 A;  3D7G A;  2J9A A;  4P4E A;  3KQX A;  4F9U A;  3PB4 X;  5HXD A;  6CPA A;  3KZW A;  1VHE A;  2NSM A;  3B2Y A;  1ZG9 A;  4GM5 A;  4OC4 A;  3WC7 A;  4ZI6 A;  1GYT A;  3IWW A;  4ZY0 A;  4MXU A;  4H2K A;  1YW6 A;  2V8H A;  4RUH A;  1PYT B;  3PBE A;  2EK8 A;  1ARL A;  4R6T A;  4NGQ A;  3FEC A;  5ELY A;  2PCU A;  1LAN A;  5D29 A;  2O4H A;  2PJ8 A;  2IMO A;  2C6G A;  2AFW A;  4PXC A;  3KAS A;  2ZEH A;  2XEF A;  3SJE A;  2IJZ A;  5LRK A;  3IC1 A;  1EE3 P;  3V7Z A;  1BPM A;  1TKJ A;  4F8Z A;  5K8N A;  2PJB A;  3S9N A;  5LYF A;  1ZLH A;  4P4F A;  3PB8 X;  3FVL A;  4FAI A;  1TF9 A;  3FX6 A;  4FBE A;  3VAR A;  4BD9 A;  2PJA A;  1IY7 A;  5K8O A;  4R76 A;  2O53 A;  4IHM A;  1YW4 A;  2C6C A;  3RAM A;  2RB7 A;  1HDQ A;  2XEG A;  1XRY A;  2ANP A;  4UEZ A;  4NGM A;  4A94 A;  4OC1 A;  4MCS A;  1CP6 A;  4MCQ A;  4MHP A;  2PIY A;  3K2K A;  4ZY2 A;  1AMP A;  4OIW A;  1TKH A;  3WAB A;  4R7M A;  2AFX A;  2ZEF A;  1ZG8 A;  2ZEN A;  3K9T A;  4CPA A;  3H8E A;  2AFU A;  4JYW A;  1Y7E A;  4TNU A;  3KGQ A;  5K8M A;  4OID A;  3FF3 A;  4NGR A;  1BAV A;  3I1U A;  3KI9 A;  4NGP A;  1TXR A;  3FH4 A;  3ISZ A;  4AXV A;  2ZEP A;  1CG2 A;  4UIA A;  3S9M A;  1CX8 A;  3KR4 A;  2PVV A;  3SJG A;  4KSI A;  4OC3 A;  3FMC A;  3IFE A;  3KQZ A;  4F9V A;  1ARM A;  1LCP A;  3FJU A;  3PB6 X;  5DS0 A;  4ZX9 A;  3BI1 A;  4R8F A;  3D4U A;  3D7F A;  1DE4 C;  4EWT A;  4OC5 A;  4NGN A;  3KL9 A;  1FT7 A;  4FWU A;  3B3C A;  3LWU A;  3MN8 A;  5LRJ A;  1LAM A;  1Z8L A;  4A38 A;  4OC0 A;  5LYI A;  2V77 A;  1UWY A;  1JQG A;  1XBU A;  4P6Y A;  2WYR A;  2JBK A;  4YWY A;  1H8L A;  4IAV A;  3PFE A;  1ZG7 A;  2V8V A;  1FNO A;  2FVG A;  1PCA A;  2CF4 A;  1CPS A;  2DEA A;  2CIJ A;  1Z5R A;  2CTC A;  1ELL P;  5HVF A;  5LRG A;  2IQ6 A;  5CPA A;  3GB0 A;  2PJ9 A;  4DYO A;  2G9D A;  1TKF A;  3KHX A;  3DGV A;  4MCR A;  2F7V A;  2PJ3 A;  2HB6 A;  2HC9 A;  2PRQ A;  3IIB A;  3PFO A;  2I3C A;  4X3R A;  3ISX A;  4UEE A;  1LFW A;  2PJ0 A;  2ZOG A;  2ZOF A;  4P45 A;  2XEI A;  5D8N A;  4P4I A;  3GLJ A;  1BLL E;  4PXE A;  4UEF A;  3SJX A;  4EFD A;  3WT4 A;  1XMB A;  4Z65 A;  3KR5 A;  1QMU A;  3PBB A;  7CPA A;  3N5F A;  4OKO A;  2AFS A;  1XFO A;  3HUV A;  1CBX A;  3RBU A;  3NH4 A;  3CPA A;  2PJ4 A;  1ZLI A;  3B35 A;  4NGT A;  2PJ7 A;  3SJF A;  4MHZ A;  2ZEE A;  4OP4 A;  2F8H A;  2EK9 A;  4WWV A;  2PJ6 A;  3PB7 X;  2ZED A;  2OR4 A;  1YLO A;  3HLP A;  1CPX A;  2C1C A;  3WC5 A;  2PE3 A;  2AFZ A;  3TC8 A;  4P10 A;  4O23 A;  5HVG A;  3B7I A;  5IB9 A;  1TF8 A;  5JH9 A;  5CBM A;  3DLJ A;  3CDX A;  4MMO A;  3MRU A;  2QYV A;  3NFZ A;  4DUK A;  4ONW A;  5LYL A;  3D67 A;  3L2N A;  3RZA A;  2WZN A;  1M4L A;  3VAT A;  3JRU A;  5THW A;  4PPZ A;  4P4J A;  2Q51 A;  2ZEM A;  3D66 A;  2BCO A;  4Q7A A;  4LQG A;  4NGS A;  3SI1 A;  3IO1 A;  1CP7 A;  2VL1 A;  3NA6 A;  3TX8 A;  2ZEL A;  3VH9 A;  4FUU A;  1YME A;  1VGY A;  4X2T A;  5JM6 A;  4OME A;  1F2P A;  4MHY A;  4TWE A;  1HDU A;  3PEI A;  3QNV A;  4DJL A;  5HVH A;  4PQA A;  4B6Z A;  4JZ0 A;  3B3V A;  3H8G A;  2PIZ A;  3D7D A;  3NH5 A;  3CT9 A;  1BPN A;  1Y0R A;  5LYD A;  2QVP A;  4P44 A;  2C6P A;  4W9Y A;  2V8D A;  3V38 A;  2ABZ A;  4P4D A;  4PXD A;  2PJC A;  1OBR A;  3LMS A;  5F09 A;  3D68 A;  3KHZ A;  4A37 A;  1F2O A;  2ZEO A;  3SI2 A;  8CPA A;  2XEJ A;  1ELM P;  1AYE A;  2BOA A;  4ZY1 A;  3FED A;  5I4M A;  1Z2L A;  2PJ5 A;  2QJ8 A;  4NFR A;  3FEE A;  2POK A;  2NYQ A;  4NJR A;  2GLF A;  4ZYQ A;  1KWM A;  1XJO A;  2GRE A;  3T8W A;  3H8F A;  2PVW A;  1RTQ A;  1YSJ A;  4MHN A;  2OOT A;  3NH8 A;  3D7H A;  4YU9 A;  4MRI A;  3CPX A;  4X8I A;  3BI0 A;  4G1P A;  4P4B A;  5J1Q A;  4NJQ A;  4IK2 A;  2Q43 A;  2GLJ A;  4K3N A;  5K8P A;  1DTD A;  2RFH A;  3IEH A;  1NSA A;  3IJ3 A;  4ZX8 A;  1LAP A;  2PJ1 A;  1IGB A;  2JEW A;  2Q4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...