3ISXA

Crystal structure of endoglucanase (tm1050) from thermotoga maritima at 1.40 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
335
structure length
335
Chain Sequence
HHHHMKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Endoglucanase (TM1050) from THERMOTOGA MARITIMA at 1.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Endoglucanase
total genus 104
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3isxA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3isxA01
2WZNA 1R3NA 4IK2A 4OIWA 3WT4A 4NGRA 2BO9A 1TXRA 2PJ2A 3KQZA 1KWMA 3BI1A 1XJOA 4FUUA 2ZEHA 1ZG9A 2PJ9A 3IWWA 1YMEA 3SI2A 2PJ6A 5LYDA 2OR4A 1GYTA 2PIZA 5JH9A 2ZEOA 2ZOGA 2PJ8A 2O53A 4NJQA 2F8HA 3FEDA 3IC1A 4UIBA 5ELYA 2XEGA 4Q7AA 4UF4A 5JGFA 1ARMA 1PCAA 3H8EA 2V8DA 2CTCA 4K3NA 3VATA 1XFOA 1F2PA 4P10A 3PB4X 2F7VA 3D7HA 4NGQA 4DUKA 2PVWA 3DLJA 1YSJA 4IHMA 4F8ZA 4Z65A 3QNVA 2C6PA 3SJEA 3HUVA 4X2TA 4MHPA 2PJAA 4NFRA 4DYOA 3PFEA 4ZY2A 2PRQA 4WWVA 4EFDA 1LFWA 3B2YA 1IY7A 4OP4A 2C1CA 2XEIA 1XMBA 2ABZA 2AFSA 4A37A 4UEZA 2BOAA 3NH4A 3B3WA 3K2KA 1PYTB 2VL1A 3NA6A 3LWUA 3CPXA 4MCPA 1CPXA 2XEJA 2PCUA 4BD9A 2FVGA 3GUXA 3IEHA 3WC6A 4OKOA 2OOTA 1ELMP 3TX8A 1BLLE 4OC4A 2AFOA 2PJ7A 3PBEA 4NGMA 3IJ3A 2Q4ZA 2V77A 2ZOFA 5K8NA 4MCQA 3RAMA 3VARA 1Z2LA 1Y0YA 3LMSA 2PJBA 2HB6A 4P4IA 2CIJA 4MHYA 2GLJA 4AXVA 2JBJA 2PJ5A 3D7DA 2AFZA 3KASA 2Q43A 2EK9A 2ANPA 5D8NA 3KR4A 2ZEFA 4MMOA 4A38A 1DE4C 2I3CA 3D4UA 3H8GA 1Y7EA 2ZEGA 2ZEMA 2J9AA 5J1QA 3IFEA 4OC0A 3FJUA 4NGPA 3BXMA 1BPMA 4P4FA 2JEWA 4P44A 1QMUA 5D29A 1FNOA 4OC5A 3DGVA 2JBKA 1ZG7A 2DEAA 3B3TA 4GM5A 3KQXA 2WYRA 3L2NA 1CG2A 4NGTA 4ZI6A 4UIAA 4P4DA 2C6CA 2PJ0A 4O23A 4PXDA 3T8WA 1Y0RA 4MXUA 5F09A 4UEFA 2IQ6A 4FAIA 6CPAA 3S9MA 1EE3P 3PB9X 1LAPA 5LRKA 3KHXA 1ELLP 3S9NA 4TWEA 3TC8A 1TF9A 3FF3A 2QVPA 2IMOA 4OMEA 3D7GA 1HDQA 1FT7A 1ZLHA 4WJBA 1VIXA 2HC9A 4PXEA 3KI9A 3FVLA 2AFXA 1DTDA 1CP7A 8CPAA 2PIYA 2AFWA 2PJ1A 4PQAA 1LOKA 3MRUA 3B3VA 3D67A 3GLJA 3PEIA 3BHXA 3FMCA 1VGYA 3KR5A 3GB0A 1VHEA 1BAVA 4A39A 2POKA 3V38A 5THWA 3V7ZA 4ZYQA 1CX8A 3SI1A 1LAMA 2CTBA 4R76A 7CPAA 5CPAA 4MHZA 4X8IA 2PE3A 1Z8LA 3B7IA 3WC7A 4TNUA 2V8HA 5HVFA 4LQGA 3HLPA 3JRUA 2IJZA 1RTQA 4ZY0A 3CT9A 1JQGA 3VH9A 2C6GA 1HDUA 3D7FA 3WC5A 4OIDA 2EWBA 1UWYA 3PBBA 4YU9A 3PB8X 4F9VA 2ZEDA 4F9UA 1M4LA 1VHOA 1F57A 2V8GA 4IAVA 2PJCA 3MN8A 1AMPA 4OC1A 2GREA 3SJGA 4PPZA 4ZX9A 4EMEA 4EWTA 3D68A 2GLFA 4UEEA 4MCSA 4X3RA 5DS0A 3ISZA 3PFOA 3B3CA 1XRYA 4MCRA 2PVVA 5HVHA 1TKHA 3SJFA 1NSAA 5K8PA 1ZG8A 4JYWA 3CDXA 5LRGA 5HXDA 3IO1A 1BPNA 3I1UA 4R8FA 3NH8A 4A94A 3SJXA 3KZWA 3FX6A 1LCPA 3B35A 5CBMA 3PRTA 1TF8A 1TKJA 4DJLA 3NH5A 1CBXA 2NYQA 4ONWA 4PXBA 4FBEA 3FECA 3RBUA 4P45A 4OC2A 1CP6A 4P4JA 4P4BA 3K9TA 1CPSA 2ZEPA 3B3SA 4NJRA 1F2OA 3CPAA 4OC3A 2G9DA 3WABA 3D66A 3KL9A 1LANA 1Z5RA 4G1PA 1Q7LA 1IGBA 1TKFA 2EK8A 5LYFA 3KGQA 4R6TA 2QYVA 1YW4A 5IB9A 2PJ3A 2RFHA 4JZ0A 4B6ZA 5LRJA 2O4HA 1ZLIA 4ZY1A 5HVGA 3IIBA 2NSMA 2AFMA 2QJ8A 2RB7A 1AYEA 3ISXA 3NFZA 5LYLA 1HEEA 2BCOA 2XEFA 3N5FA 3PB7X 3FEEA 5K8MA 2GU2A 5I4MA 2V8VA 4ZX8A 3SI0A 4RUHA 3H8FA 2ZENA 3PB6X 3KHZA 4YWYA 5K8OA 1ARLA 3BI0A 2PJ4A 4FWUA 4CPAA 4P6YA 1H8LA 2Q51A 4W9YA 4KSIA 1QQ9A 4MHNA 5LYIA 1R43A 4NGSA 2ZEEA 4H2KA 4PXCA 3S9LA 1OBRA 1YW6A 4P4EA 4NGNA 1YLOA 1XBUA 2CF4A 4MRIA 3RZAA 2ZELA 5JM6A 3FH4A 4R7MA 2AFUA
chains in the Genus database with same CATH superfamily
1TUIA 1R3NA 4Z4RA 1WOSA 4IK2A 1MK4A 1XEBA 2I1LA 3T56B 3WNCA 3OWCA 1NBMA 4DNCA 4FUUA 1I18A 2D3NA 1ZG9A 3G4SB 1MJBA 5G22A 4C43A 4J0QA 2PIZA 4YALA 4A95A 3CC2B 1KJZA 2V7TA 2YNDA 3IC1A 4M2LA 1Q2CA 2DERA 4Q7AA 4XLHA 3WXMA 4RI1A 4OPOA 5THXA 4OADA 1OGJA 5JGFA 4ROXA 5CDFA 4QUSA 3H8EA 5L46A 4LBVA 1Z4RA 5HKKA 4U9UA 3CP8A 2EFGA 1BQEA 2F7VA 1XE4A 1YSJA 5KSWB 1Q81D 3WBKA 3QNVA 2C6PA 1M44A 4XKVA 2OB0A 2VZZA 2Q6LA 4ZY2A 4WWVA 2XGJA 1LFWA 3I56B 3B2YA 1R57A 4MYUA 2BSWA 4PSXA 3ZBTA 1BX1A 3B3WA 2X6XA 5ISVA 5HZBA 2VXKA 1PYTB 3NA6A 3LWUA 3CPXA 3CCMB 1CPXA 3EFAA 4ONUA 4G1BA 2WJYA 1VQ4B 1V0EA 1FNCA 2J8MA 3R6JA 3IWEA 3HAGA 5AG7A 2WUUA 2Q6IA 1VQLB 3PBEA 2V77A 4ORFA 4R3KA 1YLEA 1XOVA 1Z2LA 1Y0YA 3AGPA 2Q04A 3RYOA 2JIZA 1YGHA 3A3GA 3ZZ0A 4AXVA 4QB9A 2AFZA 3AVVA 1I1DA 4Z4YA 2ZW7A 3KASA 4YFJA 1VQ5B 2Z0ZA 2ANPA 5D8NA 4MMOA 1QUEA 3H8GA 3CTAA 1IICA 4NEXA 1X10A 1X12A 4C7IA 4XL9A 4L8JA 3R9GA 2ZEMA 4LBZA 4R9MA 5J1QA 5G1ZA 3IFEA 2YWEA 4FD5A 4B5OA 2RC6A 1BOBA 4NGPA 4P4FA 4QBJA 1WTHD 5LMZA 3E0KA 4YELA 5GV7A 4QVJA 1JWQA 5AG5A 4HKFA 2NV4A 3JQRA 4TMWA 1YX0A 4OLLA 1KK1A 5J35A 1ZG7A 3DNSA 3KQXA 2VBQA 2ZZQA 1CG2A 5HMNA 4ZI6A 3TE4A 5GV8A 3S6HA 3F8KA 4PXDA 4RPBA 1UMKA 3GY9A 1B23P 4UZFA 1G7SA 5EMIA 3S9MA 1Z8TA 3AGQA 3AVTA 1ELLP 4UZEA 3CMEB 1FNMA 3ZIAA 2B4BA 5FL7A 2I00A 1TF9A 2DY1A 4RDLA 1FY7A 2D4OA 4RS2A 3D7GA 1DDGA 1MJAA 2FS5A 1VF7A 2BF4A 4UCMA 3CCUB 3KEWA 4PXEA 3LODA 1QSOA 1JA0A 1DTDA 2PIYA 1G7RA 3WNBA 2OBTA 3JUWA 1M4GA 3MRUA 2FXFA 3B3VA 4B5PB 3BJ7A 2Q4VA 1P0HA 4YAUA 2QEXB 1VGYA 3GB0A 4BMHA 4P2NA 4B10A 2BL1A 1U6MA 2QA4B 3G8WA 2B3VA 3GSIA 3V7ZA 4ZYQA 3SI1A 3ZC3A 4R76A 1S3ZA 4LC0A 3FRMA 1Z8LA 3EY5A 5FO0A 5AG4A 2JDIA 2QN6A 1KZLA 3B7IA 5H59A 3S6GA 4TNUA 2V8HA 3D8PA 4CGPA 4FXUA 2VI7A 4LQGA 5IB0A 2C2WA 3JRUA 4XPKA 3FPKA 1RTQA 4XPDC 4ZY0A 3VH9A 1RQRA 2QMLA 2GK7A 4DK0A 1A2ZA 2BPOA 4KOVA 2YGWA 4OIDA 3DDYA 3PBBA 1I12A 4YU9A 4F9UA 1VHOA 4Q36A 4AF6A 1UD2A 2JDDA 2PJCA 3BCDA 3SJGA 3VNUA 1QFYA 1N0UA 4EMEA 2BVNA 4B3FX 1IOFA 4EWTA 5C88A 1ZUNB 3A3BA 3SXNA 4ACBA 4U9YA 3BLNA 4UFVA 3TT2A 3PFOA 4XN0A 3JU4A 1K9MD 5HVHA 3H9NA 1YR0A 3OKXA 3SJFA 2GPJA 5K8PA 2B7BA 3V8IA 4JYWA 5LRGA 3IO1A 4XLAA 1N07A 3GIRA 2EVNA 1M1KD 4R71A 5IX3A 1KUYA 1COWA 3SJZA 5CBMA 1TF8A 1E64A 2VNKA 4QV2A 4DJLA 3GVJA 3OPOA 4PGOA 2OBRA 2HUZA 4TT3A 2NYQA 4ZGQB 2QE7A 3QB8A 4P45A 3EC4A 4P4BA 4P4JA 3SLNA 3K9TA 1CPSA 3F0AA 2ZL6A 3S6KA 1UD3A 4OC3A 4HPSA 2G9DA 2C5HA 4Y49B 1R5OA 4XLCA 4A33A 3H4QA 1Y7RA 1YW4A 5IB9A 3T51B 3SHPA 2Q7SA 4B6ZA 1WOOA 2O4HA 1BJKA 1GO2A 2Y0MA 2RB7A 1NSLA 1AYEA 4FD7A 3NFZA 4MYTA 2BEIA 1WSVA 1VQOB 4KVME 4KUAA 1XB2A 2ZL7A 3N5FA 3PA1A 4RPDA 2ZZGA 4X06A 2ZZEA 4KZTA 3SI0A 4MY3A 3PB6X 3KHZA 5K8OA 5TR9A 1RQPA 4DQLA 2DETA 3TOAA 4NGSA 4H2KA 3S9LA 2VBVA 1YW6A 1NJID 4P4EA 4NGNA 1K8AD 4K30A 4B13A 2PIAA 3LQEA 5JM6A 1J4JA 4ZBGA 1E62A 2HLDA 4NGRA 4C2ZA 2BO9A 3E1YE 2PJ2A 3TTHA 3KQZA 1QGYA 1KWMA 2ZEHA 4AVZA 1R5NA 2PJ9A 3IWWA 4MBUA 1YMEA 1H8EA 2FE7A 4CYQA 5J3OA 2PRBA 1D1NA 5F4JA 4UZUA 4XPDB 2GQFA 1GYTA 1CM0A 3KKWA 5JH9A 4M4SA 2ZL5A 2XNJA 2CNDA 4G7WA 1XF8A 2O53A 4NJQA 4AVBA 3FPPA 1WP6A 2C77A 4KKSA 1AIPA 2BM0A 5E6TA 2FIAA 2JJ2A 1PCAA 1UD5A 5DWNA 3PENA 1VQNB 3I55B 4MI4A 5JBQA 1NE9A 4HNYB 1S72B 4ZGNB 1OB5A 3PB4X 1HVXA 4BBHA 2PVWA 5TY0A 3OZVA 5FO1A 4AF7A 4F8ZA 4RDKA 5A88A 5GCNA 5A28A 3NE5B 3SJEA 4X2TA 1WSRA 4M6IA 4X07A 2PJAA 4NFRA 5IYRA 3FXTA 4EFDA 4XLFA 2HQYA 4KOUA 2C1CA 2XEIA 2ABZA 2CW5A 1OHHA 4LX9A 4XONA 4WZEA 4QC6A 2RC5A 3Q6QA 1IB1E 1EXMA 2Z3LA 2WZPP 4KKUA 2OBSA 3CXPA 5DSZA 2V4DA 1T5EA 2PCUA 4KKTA 3CCEB 4BD9A 1SKQA 3NE8A 3GUXA 4CRZB 3WC6A 2B4DA 4XNHC 4YEJA 3SKBA 3CXSA 4OKOA 1VQ7B 3QFSA 4QFMA 3IGRA 4XOPA 1E79A 3IJ3A 3LD2A 1JNYA 3Q38A 4EVYA 1K28D 5K8NA 3ASQA 1FNBA 4II2A 3LMSA 4CS0B 4MHYA 2F5IA 3FNCA 3W2EA 1JA1A 3WNDA 1YVKA 2YNCA 3GVKA 3G6EB 5F48A 2EIXA 1ON0A 4RN7A 1H8HA 5HH1A 3KR4A 3R9EA 5F47A 4X7CA 1WWZA 2I3CA 2JLMA 1E3ZA 4KOTA 2ZEGA 3EXNA 3WY9A 1H85A 2VNIA 3PUMA 4FWTA 2B5GB 1Z8WA 2AE6A 2ZXHA 1UD6A 2J7KA 3G71B 4P44A 4R3LA 2PMDA 4LBYA 4OC5A 3OE7A 1WDTA 1IYKA 1ZM4A 3ZPNA 4XD7A 5IYPA 2JBKA 3GYAA 3QFTA 3ZBUA 4GM5A 2WYRA 2ZBUA 3JTKA 1E63A 1SQHA 4P4DA 1BLIA 4E0FA 5J8CA 3B8GA 2X8KA 2OZHA 2AHOA 5IYNA 1T6XA 4P26A 2IQ6A 2JDCA 2WPXA 3IU2A 1BMFA 4P9SA 4UWJA 4KS9A 4UAJA 4TWEA 3TC8A 3G3SA 3PP9A 3S6FA 2BM1A 1HDQA 1WPCA 1FT7A 1ZLHA 3FYNA 3CESA 3OJXA 3FVLA 4OOXA 1S7NA 3FJOA 1CP7A 1S4MA 3OW2B 1MABA 1V5VA 4XR6A 2PR8A 1W9XA 3CD6B 4G6IA 4ZCIA 4GQNA 3GLJA 2JEVA 4MFPA 3W2IA 4G1VA 2FT0A 3PEIA 4RLZA 2CY2A 3KR5A 1JB9A 3DR8A 1ELOA 2V31A 1VHEA 1PJ6A 5CNPA 5A89A 5THWA 2CTBA 3ASRA 4GS4A 7CPAA 3TO7A 4MHZA 3VWDA 1YJNB 3GQBA 3CP2A 5HZAA 4KOYA 1S7FA 4TSFA 3DSBA 1GAQA 4A31A 5HVFA 1TVCA 4XORA 2J8RA 1IB0A 3HLPA 4N3GA 1M4DA 2GJPA 5DWMA 4KORA 2HDNB 2P0WA 4U9ZA 1Q9SA 1JQGA 3OZUA 4AG9A 1HDUA 3CCQB 1UWYA 1N71A 2V8GA 1QVFB 4IAVA 2R6HA 3P26A 1CNFA 3MN8A 4NSQA 4OC1A 2GREA 3ZJ0A 2GLFA 5IYQA 2WJVA 1IJFA 4UEEA 4MCSA 2R9VA 1YI2B 4X3RA 5DS0A 4ZGYB 3R6KA 3B3CA 3MHPA 1NSAA 3R9FA 5HXDA 2CNTA 3OFNA 1BPNA 3PA2A 4R8FA 1M90D 1P4NA 4PC6A 3KZWA 4JMQA 4HE6A 4YHBA 1VQ9B 4RD2A 4F7DA 4IW3B 1W0JA 2X6WA 4MJ8A 3PRTA 2E1BA 4RJLA 3NH5A 3GIUA 2D3LA 2OTJB 5B6IA 1UD4A 4MFKA 4ONWA 4DNTB 4P3IA 4YGOA 4J3GA 3CCRB 3OW7A 3A8IA 4NJRA 1F2OA 3CPAA 5H86A 5F4MA 4OAEA 4XNFA 3WABA 2P3MA 4FD4A 4UFWA 1ZM3A 3D66A 3KL9A 3KGQA 2QYVA 4L8AA 5F49A 3G05A 2RFHA 4Z4UA 2Z11A 2PR1A 1S60A 4Y9RA 2WPDA 4H9GA 1EP3B 2XEXA 2OTLB 5JPHA 3OEHA 4JLYA 2BN4A 4ZY1A 3B82A 1KUVA 5I0CA 4B14A 4KSFA 5LYLA 4XPLA 5G21A 4M0LA 3PB7X 3FEEA 4TMVA 2ZTGA 1N8RD 2GU2A 3H5ZA 4MFQA 1VJSA 2V8VA 4ZX8A 4KVXA 1WU8A 4B5PA 4RUHA 1KTVA 1GR1A 3FIXA 1Q2YA 2G3AA 2XOKA 2PJ4A 3BI0A 4P6YA 1H8LA 2Q51A 2VYQA 3QSYA 1QQ9A 4MHNA 1GAWA 4G7XA 1R43A 3VO2A 3ZZTA 2ODFA 2YWFA 1ZO0A 4UCPA 4MRIA 2CF4A 1YHQB 3RZAA 1XE1A 3FH4A 4R7MA 2R1IA 2AFUA 4CYPA 2R8VA 4OIWA 2XNCA 4B12A 1TXRA 4OOSA 1VQ6B 2NPFA 3A9LA 3BI1A 1QG0A 1E1QA 1YX2A 3R1KA 3SI2A 2PJ6A 4FK8A 5KTCA 4OPVA 2ZXVA 3BQJA 2JJ1A 3CC7B 2ZOGA 2XZOA 1NDHA 4RDJA 5FIUA 3FEDA 4UIBA 2BGJA 5ELYA 4DQKA 5G20A 4YXWA 4UF4A 2GFQA 2VZLA 1ARMA 1GVHA 5BSXA 2V8DA 3Q6RA 2CTCA 1MJ9A 2Z3OA 3VR6A 2Q0YA 1XFOA 1EWYA 1F2PA 5F46A 3W2FA 4P10A 4NGQA 1PJ5A 1W87A 5E96A 1IYLA 3DLJA 3PGPA 4IHMA 2V7WA 1EFUA 2C4UA 2XZPA 4HE5A 1QSMA 4MHPA 3PFEA 3W6SA 4UBRA 4A30A 1QFJA 3U2QA 4EH1A 4R87A 1IY7A 4E8OA 4E0AA 2LZJA 2BOAA 3NH4A 1OB0A 2FSRA 3VMFA 5FNZA 3BC9A 2OYNA 2VL1A 1KUXA 4U5YA 4HIZA 2VJIA 4X05A 1WORA 1D8TA 1NB9A 2FVGA 3AVWA 3OJWA 1KK3A 4M6GA 2OOTA 4CYNA 4PC3A 3U6BA 1G7CA 4OC4A 3QAYA 4RD4A 2REFA 2CRVA 2Q4ZA 2ZOFA 4PC7A 1UD8A 4II9A 1XQBA 4CAWA 1E3XA 1TLLA 2P6FA 1FX0A 2HB6A 4P4IA 4KSAA 3W2HA 2JBJA 2PJ5A 4C0SA 2XNDA 4MFLA 2Q43A 2EK9A 4B11A 2ZEFA 1XIXA 1DE4C 4K1XA 4WZLA 1PU9A 4F0XA 2Z3MA 2J9AA 1F60A 1P4MA 5FVJA 5JQ4A 2PQ8A 4ACAA 3BXMA 1BPMA 4CAFA 3CMMA 1QMUA 3CC4B 4TN1A 1FNOA 2H5MA 3OAAA 3FB3A 1Z9UA 1Z8XA 3IU1A 2VEZA 2DEAA 2Q6OA 1TIQA 1QFZA 4BINA 4NGTA 4Y49C 2PJ0A 3RNZA 4O23A 3T8WA 2OK8A 4PABA 1EP1B 3SLDA 3QFCA 4MXUA 2R98A 5AGEA 5KTDA 5F09A 1QSTA 1YVOA 3MGDA 3UY5A 1Q7YD 3U6KA 1EE3P 3PB9X 3ZZIA 1LAPA 2F1MA 1NRKA 1EFRA 3B8HA 3TCVA 2HV2A 3FF3A 1BX0A 2D4PA 3ONYA 2QDXA 2QVPA 3LACA 1R5BA 2C5BA 2CK3A 3CXCB 3CXQA 2BV3A 4WJBA 2YNCC 1T6ZA 1VLOA 3BY2A 2FIWA 4RD6A 2AFXA 1W2BB 2B3UA 4CAXA 3VNVA 8CPAA 2B7CA 3BY1A 4NCNA 4OPSA 4KOSA 4H6UA 3VWEA 4LBWA 2QGGA 5DN6A 2WR8A 1YJWB 1LOKA 2W6JA 4JJXA 1S7KA 2ZW5A 4RD0A 3FMCA 3W6XA 4XMYA 1EFCA 2R7HA 1E1RA 1XMTA 2BUEA 4CGOA 2POKA 3V38A 3LVBA 2DCUA 4ZCLA 1CX8A 4BPRA 1RO5A 4CAVA 1Y9KA 4ZCMA 5KW9A 3JVNA 2OZGA 4X8IA 2PE3A 1VQ8B 4XM3A 3WC7A 3PVDA 2NMTA 3WBJA 1PUAA 2QMUA 4NNJA 3OEEA 3DDDA 3W5UA 1YQEA 5EBVA 3CT9A 4ZV4A 2DIEA 1S5KA 3WC5A 4RD1A 4RM0A 2VJJA 3D2MA 2C4TA 3CCVB 4XKWA 4KLWA 1M4LA 1IU8A 3FBUA 5IV0A 4NF1A 4PPZA 4ZX9A 1H42A 4QHYA 3W5VA 1L0CA 4P1VA 1I8DA 2B5OA 4Z4TA 4GXHA 3NE7A 2YWHA 2G3TA 3ISZA 2FCKA 2CBXA 2OZUA 1WOPA 1B87A 5J8FA 1N08A 1KK2A 4XN3A 1Y9WA 2QTLA 2PC1A 2V7QA 4A94A 2XZLA 1VQPB 2F4NA 4Y7CA 4H6ZA 4Z4SA 3B35A 2GJRA 1YK3A 3ZZUA 4AC9A 1TKJA 1GJRA 1I7PA 2I79A 1FDRA 3I1FA 1VHSA 4CGLA 3BCFA 2ZPAA 2M5SA 2ZTNA 4FBEA 1KK0A 4OC2A 4UA3A 2DXQA 2GK6A 1N05A 2X0KA 1W34A 4XNHB 4F6AA 4X0CA 2REEA 3E20A 1KRHA 2YNEA 4CYOA 3CPWB 1Q82D 4Z1MA 1LANA 1Z5RA 1Q7LA 1KMHA 1TKFA 3ES9A 2EK8A 5LYFA 2O28A 4Z4ZA 4R57A 3OZWA 4N3NA 2P6GA 4M6HA 4WZKA 4JZ0A 3W91A 4NXYA 3FKSA 5AN9A 2E1RA 4B47A 4Y9UA 3P2HA 2X3UA 5LRJA 4X7DA 1ZLIA 1YITB 3T90A 2NSMA 2AFMA 4ASUA 2QJ8A 2Z3PA 2YWGA 1MRZA 2Q44A 2V7UA 3I3GA 1HEEA 2BCOA 5A27A 2XEFA 5C82A 2ZXIA 3ZUGA 1QUFA 1D2EA 1RXTA 1N06A 1NB0A 5K8MA 3SXOA 4PAAA 1U2RA 1QGAA 1KD1D 3AVXA 4Q7JB 3A8JA 3H8FA 2ZENA 4YWYA 1ARLA 4FWUA 3WQZA 4Z4WA 2GE3A 4CPAA 3F5BA 2HCJB 1PJ7A 5LYIA 1YIJB 1I21A 1BO4A 2GANA 4OP7A 2ZEEA 1B6BA 4X7FA 4IUSA 4JXQA 3A35A 2ZELA 4AVAA 4MY0A 3OP1A 3WYAA 1Q2DA 2WZNA 3V76A 3WT4A 4XOTA 2OK7A 1E43A 3WR7A 2Z3NA 1XJOA 3OOCA 4RCZA 4PV6A 2IL4A 3SJPA 2VQYA 5LYDA 3LO8A 2OR4A 2ZZFA 3MCAA 1GHEA 1S7LA 3T9YA 4NBSA 2ZEOA 2PJ8A 1KQSB 4P22A 2F8HA 2CNSA 3GKRA 2ZITA 2XEGA 3D2PA 3RY8A 4RD3A 1ZM2A 4TKOB 4K3NA 3VATA 3TOBA 2ARHA 1IOIA 5H84A 4CAEA 4P12A 1LRZA 3D7HA 2ATRA 4DUKA 3Q39A 4Z65A 2DOGA 4Z4VA 3HUVA 5KNLA 2ZBVA 2B58A 4DYOA 2VBUA 1W0KA 5BSYA 2PRQA 5KTAA 3CW2A 5BWAB 3B78A 1QX4A 1TTTA 4OP4A 1XMBA 2AFSA 4A37A 2G0BA 3RO0A 4UEZA 2CNMA 4C7HA 4I49A 1FRNA 2DPSA 3ASPA 4TMZA 3K2KA 2P6EA 1S0UA 3A8KA 4MCPA 1HA3A 2XEJA 3CB4A 1K73D 4CRYB 1DARA 4E2AA 3SEJA 3H94A 1QSRA 4NCZA 1BPLA 3IEHA 2AJ6A 1HZEA 2C27A 4M3SA 3TX8A 1ELMP 4M53A 2Z3KA 1BLLE 2AFOA 2PJ7A 3EO4A 4NGMA 4YRHA 4P25A 2V7XA 3AVYA 4MCQA 3RAMA 3VARA 4KOWA 2PJBA 3JQQA 2CIJA 2PDOA 4MFJA 2GLJA 3P27A 4HNXB 3D7DA 3GVLA 1UFHA 4YAWA 1AUGA 4A38A 3D4UA 3J81k 1Y7EA 1CNEA 3BH4A 1Q86D 3AVUA 4OC0A 3TFYA 4CGMA 3FJUA 2CC2A 4A32A 1DDIA 1SM4A 4A2ZA 1F20A 2JEWA 1OB2A 2DYIA 5D29A 1EP2B 2OU2A 4UCNA 1SKYB 3C26A 4PC1A 3Q3AA 3DGVA 1IJEA 3B3TA 5TV2A 1KC8D 3L2NA 3N7ZA 4KUBA 2J8NA 2W6IA 4OOVA 4B48A 4UIAA 5EC4A 3V7AA 2FX3A 2C6CA 5FA6A 1Y0RA 5A8AA 1OZPA 3ASTA 3D26A 3LQ6A 5IK2A 1YJ9B 2K5TA 3CCJB 3W5HA 4UEFA 4FAIA 4KVOE 2D9RA 6CPAA 3CRZA 2OH1A 4KLVA 5LRKA 3CZXA 1QGZA 3QFRA 4B4DA 3KHXA 3S9NA 1VLYA 2Z6BD 3TO6A 2A4NA 3VO1A 2IMOA 4PK3A 1T6YA 2X6YA 4OMEA 2WSSA 2EO8A 1VIXA 2CXAA 5HXBA 5TRDA 2HC9A 4JWPA 4M1KA 3KI9A 4AVCA 2QECA 2PLFA 4JD6A 2QIRA 2BSAA 2AFWA 2PJ1A 4TMTA 2C78A 2GJKA 4PQAA 1AMOA 3D67A 1FNDA 1FRQA 2FL4A 3PZJA 2WSAA 3P2FA 3BHXA 4QUZA 3QE2A 1V0CA 1VQMB 2EBJA 3ONUA 4II3A 1JJ2B 1BAVA 4LUAA 2BGIA 4A39A 3D3SA 4YAFA 2F43A 1DG1G 2DEUA 1LAMA 3PUNA 4C2YA 2GIVA 5CPAA 4RCYA 1M1DA 4PC2A 2JN9A 5EMNA 3QAHA 2X85A 2IJZA 2Q4YA 1G7TA 3TO9A 2D74A 1V0FA 3W2GA 2C6GA 5F4OA 3D7FA 4PK2A 4B3GA 1QVGB 2EWBA 3PB8X 4F9VA 2WPWA 2ZEDA 4FD6A 2F1LA 2Z10A 4QVTA 4CQJA 2HMAA 3BNWA 2VNHA 2V7VA 1F57A 4H89A 2BMWA 1KZFA 1VQKB 1AMPA 4UWIA 5AG6A 3D68A 3T53B 1K4JA 3CMAB 3CCSB 3IWGA 1XRYA 4P3YA 4LQ6A 4WZTA 4UFXA 4MCRA 2PVVA 4L89A 1TKHA 5H5JA 4X7EA 4JXRA 4HNWB 4G5GA 1ZG8A 3CDXA 3I1UA 4WQMA 2DPTA 3NH8A 2KCWA 3SJXA 3DR6A 4Q38A 2QTZA 1A8PA 2VBSA 3FX6A 1LCPA 3LNNA 4AG7A 1YREA 4IF5A 3R95A 2VBTA 1PKVA 2VNJA 1CJWA 4C2XA 1CBXA 4TMXA 4P6VF 4PXBA 4QVAA 3FECA 3RBUA 4C68A 3K9UA 1CP6A 2ZEPA 3B3SA 2ZW4A 4PSWA 4XLEA 1B2RA 4DNRB 4M85A 4XQFA 2Q7BA 4G1PA 3R96A 1J9ZA 1IGBA 4MFZA 3CCLB 4R6TA 1W35A 1IIDA 2PJ3A 2B4DB 4B43A 4AB7A 1IHMA 1QH0A 1NMTA 2PSWA 2VZYA 5IYWA 5HVGA 3IIBA 3MMPA 2Q6KA 3ISXA 1VKCA 3I9SA 4CGNA 1WK4A 3BJ8A 1EFTA 1CQXA 5I4MA 4KOXA 3ASSA 1M4IA 2EUIA 1Z4EA 1N0VC 2KVOA 4B3XA 4YAOA 1OGIA 2X7BA 2DF5A 4X5KA 3A1PA 4W9YA 4KSIA 2RC4A 4F0YA 1ZM9A 2ZW6A 3JQPA 4PXCA 2B5GA 2X53S 1OBRA 1QSNA 4DK1A 1YLOA 4B44A 1XBUA 4FN5A 4MHDA
chains in the Genus database with same CATH topology
2WZNA 1R3NA 4IK2A 4OIWA 3WT4A 4NGRA 2BO9A 1TXRA 2PJ2A 3KQZA 1KWMA 3BI1A 1XJOA 4FUUA 2ZEHA 1ZG9A 2PJ9A 3IWWA 1YMEA 3SI2A 2PJ6A 5LYDA 2OR4A 1GYTA 2PIZA 5JH9A 2ZEOA 2ZOGA 2PJ8A 2O53A 4NJQA 2F8HA 3FEDA 3IC1A 4UIBA 5ELYA 2XEGA 4Q7AA 4UF4A 5JGFA 1ARMA 1PCAA 3H8EA 2V8DA 2CTCA 4K3NA 3VATA 1XFOA 1F2PA 4P10A 3PB4X 2F7VA 3D7HA 4NGQA 4DUKA 2PVWA 3DLJA 1YSJA 4IHMA 4F8ZA 4Z65A 3QNVA 2C6PA 3SJEA 3HUVA 4X2TA 4MHPA 2PJAA 4NFRA 4DYOA 3PFEA 4ZY2A 2PRQA 4WWVA 4EFDA 1LFWA 3B2YA 1IY7A 4OP4A 2C1CA 2XEIA 1XMBA 2ABZA 2AFSA 4A37A 4UEZA 2BOAA 3NH4A 3B3WA 3K2KA 1PYTB 2VL1A 3NA6A 3LWUA 3CPXA 4MCPA 1CPXA 2XEJA 2PCUA 4BD9A 2FVGA 3GUXA 3IEHA 3WC6A 4OKOA 2OOTA 1ELMP 3TX8A 1BLLE 4OC4A 2AFOA 2PJ7A 3PBEA 4NGMA 3IJ3A 2Q4ZA 2V77A 2ZOFA 5K8NA 4MCQA 3RAMA 3VARA 1Z2LA 1Y0YA 3LMSA 2PJBA 2HB6A 4P4IA 2CIJA 4MHYA 2GLJA 4AXVA 2JBJA 2PJ5A 3D7DA 2AFZA 3KASA 2Q43A 2EK9A 2ANPA 5D8NA 3KR4A 2ZEFA 4MMOA 4A38A 1DE4C 2I3CA 3D4UA 3H8GA 1Y7EA 2ZEGA 2ZEMA 2J9AA 5J1QA 3IFEA 4OC0A 3FJUA 4NGPA 3BXMA 1BPMA 4P4FA 2JEWA 4P44A 1QMUA 5D29A 1FNOA 4OC5A 3DGVA 2JBKA 1ZG7A 2DEAA 3B3TA 4GM5A 3KQXA 2WYRA 3L2NA 1CG2A 4NGTA 4ZI6A 4UIAA 4P4DA 2C6CA 2PJ0A 4O23A 4PXDA 3T8WA 1Y0RA 4MXUA 5F09A 4UEFA 2IQ6A 4FAIA 6CPAA 3S9MA 1EE3P 3PB9X 1LAPA 5LRKA 3KHXA 1ELLP 3S9NA 4TWEA 3TC8A 1TF9A 3FF3A 2QVPA 2IMOA 4OMEA 3D7GA 1HDQA 1FT7A 1ZLHA 4WJBA 1VIXA 2HC9A 4PXEA 3KI9A 3FVLA 2AFXA 1DTDA 1CP7A 8CPAA 2PIYA 2AFWA 2PJ1A 4PQAA 1LOKA 3MRUA 3B3VA 3D67A 3GLJA 3PEIA 3BHXA 3FMCA 1VGYA 3KR5A 3GB0A 1VHEA 1BAVA 4A39A 2POKA 3V38A 5THWA 3V7ZA 4ZYQA 1CX8A 3SI1A 1LAMA 2CTBA 4R76A 7CPAA 5CPAA 4MHZA 4X8IA 2PE3A 1Z8LA 3B7IA 3WC7A 4TNUA 2V8HA 5HVFA 4LQGA 3HLPA 3JRUA 2IJZA 1RTQA 4ZY0A 3CT9A 1JQGA 3VH9A 2C6GA 1HDUA 3D7FA 3WC5A 4OIDA 2EWBA 1UWYA 3PBBA 4YU9A 3PB8X 4F9VA 2ZEDA 4F9UA 1M4LA 1VHOA 1F57A 2V8GA 4IAVA 2PJCA 3MN8A 1AMPA 4OC1A 2GREA 3SJGA 4PPZA 4ZX9A 4EMEA 4EWTA 3D68A 2GLFA 4UEEA 4MCSA 4X3RA 5DS0A 3ISZA 3PFOA 3B3CA 1XRYA 4MCRA 2PVVA 5HVHA 1TKHA 3SJFA 1NSAA 5K8PA 1ZG8A 4JYWA 3CDXA 5LRGA 5HXDA 3IO1A 1BPNA 3I1UA 4R8FA 3NH8A 4A94A 3SJXA 3KZWA 3FX6A 1LCPA 3B35A 5CBMA 3PRTA 1TF8A 1TKJA 4DJLA 3NH5A 1CBXA 2NYQA 4ONWA 4PXBA 4FBEA 3FECA 3RBUA 4P45A 4OC2A 1CP6A 4P4JA 4P4BA 3K9TA 1CPSA 2ZEPA 3B3SA 4NJRA 1F2OA 3CPAA 4OC3A 2G9DA 3WABA 3D66A 3KL9A 1LANA 1Z5RA 4G1PA 1Q7LA 1IGBA 1TKFA 2EK8A 5LYFA 3KGQA 4R6TA 2QYVA 1YW4A 5IB9A 2PJ3A 2RFHA 4JZ0A 4B6ZA 5LRJA 2O4HA 1ZLIA 4ZY1A 5HVGA 3IIBA 2NSMA 2AFMA 2QJ8A 2RB7A 1AYEA 3ISXA 3NFZA 5LYLA 1HEEA 2BCOA 2XEFA 3N5FA 3PB7X 3FEEA 5K8MA 2GU2A 5I4MA 2V8VA 4ZX8A 3SI0A 4RUHA 3H8FA 2ZENA 3PB6X 3KHZA 4YWYA 5K8OA 1ARLA 3BI0A 2PJ4A 4FWUA 4CPAA 4P6YA 1H8LA 2Q51A 4W9YA 4KSIA 1QQ9A 4MHNA 5LYIA 1R43A 4NGSA 2ZEEA 4H2KA 4PXCA 3S9LA 1OBRA 1YW6A 4P4EA 4NGNA 1YLOA 1XBUA 2CF4A 4MRIA 3RZAA 2ZELA 5JM6A 3FH4A 4R7MA 2AFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZN A;  1R3N A;  4IK2 A;  4OIW A;  3WT4 A;  4NGR A;  2BO9 A;  1TXR A;  2PJ2 A;  3KQZ A;  1KWM A;  3BI1 A;  1XJO A;  4FUU A;  2ZEH A;  1ZG9 A;  2PJ9 A;  3IWW A;  1YME A;  3SI2 A;  2PJ6 A;  5LYD A;  2OR4 A;  1GYT A;  2PIZ A;  5JH9 A;  2ZEO A;  2ZOG A;  2PJ8 A;  2O53 A;  4NJQ A;  2F8H A;  3FED A;  3IC1 A;  4UIB A;  5ELY A;  2XEG A;  4Q7A A;  4UF4 A;  5JGF A;  1ARM A;  1PCA A;  3H8E A;  2V8D A;  2CTC A;  4K3N A;  3VAT A;  1XFO A;  1F2P A;  4P10 A;  3PB4 X;  2F7V A;  3D7H A;  4NGQ A;  4DUK A;  2PVW A;  3DLJ A;  1YSJ A;  4IHM A;  4F8Z A;  4Z65 A;  3QNV A;  2C6P A;  3SJE A;  3HUV A;  4X2T A;  4MHP A;  2PJA A;  4NFR A;  4DYO A;  3PFE A;  4ZY2 A;  2PRQ A;  4WWV A;  4EFD A;  1LFW A;  3B2Y A;  1IY7 A;  4OP4 A;  2C1C A;  2XEI A;  1XMB A;  2ABZ A;  2AFS A;  4A37 A;  4UEZ A;  2BOA A;  3NH4 A;  3B3W A;  3K2K A;  1PYT B;  2VL1 A;  3NA6 A;  3LWU A;  3CPX A;  4MCP A;  1CPX A;  2XEJ A;  2PCU A;  4BD9 A;  2FVG A;  3GUX A;  3IEH A;  3WC6 A;  4OKO A;  2OOT A;  1ELM P;  3TX8 A;  1BLL E;  4OC4 A;  2AFO A;  2PJ7 A;  3PBE A;  4NGM A;  3IJ3 A;  2Q4Z A;  2V77 A;  2ZOF A;  5K8N A;  4MCQ A;  3RAM A;  3VAR A;  1Z2L A;  1Y0Y A;  3LMS A;  2PJB A;  2HB6 A;  4P4I A;  2CIJ A;  4MHY A;  2GLJ A;  4AXV A;  2JBJ A;  2PJ5 A;  3D7D A;  2AFZ A;  3KAS A;  2Q43 A;  2EK9 A;  2ANP A;  5D8N A;  3KR4 A;  2ZEF A;  4MMO A;  4A38 A;  1DE4 C;  2I3C A;  3D4U A;  3H8G A;  1Y7E A;  2ZEG A;  2ZEM A;  2J9A A;  5J1Q A;  3IFE A;  4OC0 A;  3FJU A;  4NGP A;  3BXM A;  1BPM A;  4P4F A;  2JEW A;  4P44 A;  1QMU A;  5D29 A;  1FNO A;  4OC5 A;  3DGV A;  2JBK A;  1ZG7 A;  2DEA A;  3B3T A;  4GM5 A;  3KQX A;  2WYR A;  3L2N A;  1CG2 A;  4NGT A;  4ZI6 A;  4UIA A;  4P4D A;  2C6C A;  2PJ0 A;  4O23 A;  4PXD A;  3T8W A;  1Y0R A;  4MXU A;  5F09 A;  4UEF A;  2IQ6 A;  4FAI A;  6CPA A;  3S9M A;  1EE3 P;  3PB9 X;  1LAP A;  5LRK A;  3KHX A;  1ELL P;  3S9N A;  4TWE A;  3TC8 A;  1TF9 A;  3FF3 A;  2QVP A;  2IMO A;  4OME A;  3D7G A;  1HDQ A;  1FT7 A;  1ZLH A;  4WJB A;  1VIX A;  2HC9 A;  4PXE A;  3KI9 A;  3FVL A;  2AFX A;  1DTD A;  1CP7 A;  8CPA A;  2PIY A;  2AFW A;  2PJ1 A;  4PQA A;  1LOK A;  3MRU A;  3B3V A;  3D67 A;  3GLJ A;  3PEI A;  3BHX A;  3FMC A;  1VGY A;  3KR5 A;  3GB0 A;  1VHE A;  1BAV A;  4A39 A;  2POK A;  3V38 A;  5THW A;  3V7Z A;  4ZYQ A;  1CX8 A;  3SI1 A;  1LAM A;  2CTB A;  4R76 A;  7CPA A;  5CPA A;  4MHZ A;  4X8I A;  2PE3 A;  1Z8L A;  3B7I A;  3WC7 A;  4TNU A;  2V8H A;  5HVF A;  4LQG A;  3HLP A;  3JRU A;  2IJZ A;  1RTQ A;  4ZY0 A;  3CT9 A;  1JQG A;  3VH9 A;  2C6G A;  1HDU A;  3D7F A;  3WC5 A;  4OID A;  2EWB A;  1UWY A;  3PBB A;  4YU9 A;  3PB8 X;  4F9V A;  2ZED A;  4F9U A;  1M4L A;  1VHO A;  1F57 A;  2V8G A;  4IAV A;  2PJC A;  3MN8 A;  1AMP A;  4OC1 A;  2GRE A;  3SJG A;  4PPZ A;  4ZX9 A;  4EME A;  4EWT A;  3D68 A;  2GLF A;  4UEE A;  4MCS A;  4X3R A;  5DS0 A;  3ISZ A;  3PFO A;  3B3C A;  1XRY A;  4MCR A;  2PVV A;  5HVH A;  1TKH A;  3SJF A;  1NSA A;  5K8P A;  1ZG8 A;  4JYW A;  3CDX A;  5LRG A;  5HXD A;  3IO1 A;  1BPN A;  3I1U A;  4R8F A;  3NH8 A;  4A94 A;  3SJX A;  3KZW A;  3FX6 A;  1LCP A;  3B35 A;  5CBM A;  3PRT A;  1TF8 A;  1TKJ A;  4DJL A;  3NH5 A;  1CBX A;  2NYQ A;  4ONW A;  4PXB A;  4FBE A;  3FEC A;  3RBU A;  4P45 A;  4OC2 A;  1CP6 A;  4P4J A;  4P4B A;  3K9T A;  1CPS A;  2ZEP A;  3B3S A;  4NJR A;  1F2O A;  3CPA A;  4OC3 A;  2G9D A;  3WAB A;  3D66 A;  3KL9 A;  1LAN A;  1Z5R A;  4G1P A;  1Q7L A;  1IGB A;  1TKF A;  2EK8 A;  5LYF A;  3KGQ A;  4R6T A;  2QYV A;  1YW4 A;  5IB9 A;  2PJ3 A;  2RFH A;  4JZ0 A;  4B6Z A;  5LRJ A;  2O4H A;  1ZLI A;  4ZY1 A;  5HVG A;  3IIB A;  2NSM A;  2AFM A;  2QJ8 A;  2RB7 A;  1AYE A;  3ISX A;  3NFZ A;  5LYL A;  1HEE A;  2BCO A;  2XEF A;  3N5F A;  3PB7 X;  3FEE A;  5K8M A;  2GU2 A;  5I4M A;  2V8V A;  4ZX8 A;  3SI0 A;  4RUH A;  3H8F A;  2ZEN A;  3PB6 X;  3KHZ A;  4YWY A;  5K8O A;  1ARL A;  3BI0 A;  2PJ4 A;  4FWU A;  4CPA A;  4P6Y A;  1H8L A;  2Q51 A;  4W9Y A;  4KSI A;  1QQ9 A;  4MHN A;  5LYI A;  1R43 A;  4NGS A;  2ZEE A;  4H2K A;  4PXC A;  3S9L A;  1OBR A;  1YW6 A;  4P4E A;  4NGN A;  1YLO A;  1XBU A;  2CF4 A;  4MRI A;  3RZA A;  2ZEL A;  5JM6 A;  3FH4 A;  4R7M A;  2AFU A; 
#chains in the Genus database with same CATH topology
 1TUI A;  1R3N A;  4Z4R A;  1WOS A;  4IK2 A;  1MK4 A;  1XEB A;  2I1L A;  3T56 B;  3WNC A;  3OWC A;  1NBM A;  4DNC A;  4FUU A;  1I18 A;  2D3N A;  1ZG9 A;  3G4S B;  1MJB A;  5G22 A;  4C43 A;  4J0Q A;  2PIZ A;  4YAL A;  4A95 A;  3CC2 B;  1KJZ A;  2V7T A;  2YND A;  3IC1 A;  4M2L A;  1Q2C A;  2DER A;  4Q7A A;  4XLH A;  3WXM A;  4RI1 A;  4OPO A;  5THX A;  4OAD A;  1OGJ A;  5JGF A;  4ROX A;  5CDF A;  4QUS A;  3H8E A;  5L46 A;  4LBV A;  1Z4R A;  5HKK A;  4U9U A;  3CP8 A;  2EFG A;  1BQE A;  2F7V A;  1XE4 A;  1YSJ A;  5KSW B;  1Q81 D;  3WBK A;  3QNV A;  2C6P A;  1M44 A;  4XKV A;  2OB0 A;  2VZZ A;  2Q6L A;  4ZY2 A;  4WWV A;  2XGJ A;  1LFW A;  3I56 B;  3B2Y A;  1R57 A;  4MYU A;  2BSW A;  4PSX A;  3ZBT A;  1BX1 A;  3B3W A;  2X6X A;  5ISV A;  5HZB A;  2VXK A;  1PYT B;  3NA6 A;  3LWU A;  3CPX A;  3CCM B;  1CPX A;  3EFA A;  4ONU A;  4G1B A;  2WJY A;  1VQ4 B;  1V0E A;  1FNC A;  2J8M A;  3R6J A;  3IWE A;  3HAG A;  5AG7 A;  2WUU A;  2Q6I A;  1VQL B;  3PBE A;  2V77 A;  4ORF A;  4R3K A;  1YLE A;  1XOV A;  1Z2L A;  1Y0Y A;  3AGP A;  2Q04 A;  3RYO A;  2JIZ A;  1YGH A;  3A3G A;  3ZZ0 A;  4AXV A;  4QB9 A;  2AFZ A;  3AVV A;  1I1D A;  4Z4Y A;  2ZW7 A;  3KAS A;  4YFJ A;  1VQ5 B;  2Z0Z A;  2ANP A;  5D8N A;  4MMO A;  1QUE A;  3H8G A;  3CTA A;  1IIC A;  4NEX A;  1X10 A;  1X12 A;  4C7I A;  4XL9 A;  4L8J A;  3R9G A;  2ZEM A;  4LBZ A;  4R9M A;  5J1Q A;  5G1Z A;  3IFE A;  2YWE A;  4FD5 A;  4B5O A;  2RC6 A;  1BOB A;  4NGP A;  4P4F A;  4QBJ A;  1WTH D;  5LMZ A;  3E0K A;  4YEL A;  5GV7 A;  4QVJ A;  1JWQ A;  5AG5 A;  4HKF A;  2NV4 A;  3JQR A;  4TMW A;  1YX0 A;  4OLL A;  1KK1 A;  5J35 A;  1ZG7 A;  3DNS A;  3KQX A;  2VBQ A;  2ZZQ A;  1CG2 A;  5HMN A;  4ZI6 A;  3TE4 A;  5GV8 A;  3S6H A;  3F8K A;  4PXD A;  4RPB A;  1UMK A;  3GY9 A;  1B23 P;  4UZF A;  1G7S A;  5EMI A;  3S9M A;  1Z8T A;  3AGQ A;  3AVT A;  1ELL P;  4UZE A;  3CME B;  1FNM A;  3ZIA A;  2B4B A;  5FL7 A;  2I00 A;  1TF9 A;  2DY1 A;  4RDL A;  1FY7 A;  2D4O A;  4RS2 A;  3D7G A;  1DDG A;  1MJA A;  2FS5 A;  1VF7 A;  2BF4 A;  4UCM A;  3CCU B;  3KEW A;  4PXE A;  3LOD A;  1QSO A;  1JA0 A;  1DTD A;  2PIY A;  1G7R A;  3WNB A;  2OBT A;  3JUW A;  1M4G A;  3MRU A;  2FXF A;  3B3V A;  4B5P B;  3BJ7 A;  2Q4V A;  1P0H A;  4YAU A;  2QEX B;  1VGY A;  3GB0 A;  4BMH A;  4P2N A;  4B10 A;  2BL1 A;  1U6M A;  2QA4 B;  3G8W A;  2B3V A;  3GSI A;  3V7Z A;  4ZYQ A;  3SI1 A;  3ZC3 A;  4R76 A;  1S3Z A;  4LC0 A;  3FRM A;  1Z8L A;  3EY5 A;  5FO0 A;  5AG4 A;  2JDI A;  2QN6 A;  1KZL A;  3B7I A;  5H59 A;  3S6G A;  4TNU A;  2V8H A;  3D8P A;  4CGP A;  4FXU A;  2VI7 A;  4LQG A;  5IB0 A;  2C2W A;  3JRU A;  4XPK A;  3FPK A;  1RTQ A;  4XPD C;  4ZY0 A;  3VH9 A;  1RQR A;  2QML A;  2GK7 A;  4DK0 A;  1A2Z A;  2BPO A;  4KOV A;  2YGW A;  4OID A;  3DDY A;  3PBB A;  1I12 A;  4YU9 A;  4F9U A;  1VHO A;  4Q36 A;  4AF6 A;  1UD2 A;  2JDD A;  2PJC A;  3BCD A;  3SJG A;  3VNU A;  1QFY A;  1N0U A;  4EME A;  2BVN A;  4B3F X;  1IOF A;  4EWT A;  5C88 A;  1ZUN B;  3A3B A;  3SXN A;  4ACB A;  4U9Y A;  3BLN A;  4UFV A;  3TT2 A;  3PFO A;  4XN0 A;  3JU4 A;  1K9M D;  5HVH A;  3H9N A;  1YR0 A;  3OKX A;  3SJF A;  2GPJ A;  5K8P A;  2B7B A;  3V8I A;  4JYW A;  5LRG A;  3IO1 A;  4XLA A;  1N07 A;  3GIR A;  2EVN A;  1M1K D;  4R71 A;  5IX3 A;  1KUY A;  1COW A;  3SJZ A;  5CBM A;  1TF8 A;  1E64 A;  2VNK A;  4QV2 A;  4DJL A;  3GVJ A;  3OPO A;  4PGO A;  2OBR A;  2HUZ A;  4TT3 A;  2NYQ A;  4ZGQ B;  2QE7 A;  3QB8 A;  4P45 A;  3EC4 A;  4P4B A;  4P4J A;  3SLN A;  3K9T A;  1CPS A;  3F0A A;  2ZL6 A;  3S6K A;  1UD3 A;  4OC3 A;  4HPS A;  2G9D A;  2C5H A;  4Y49 B;  1R5O A;  4XLC A;  4A33 A;  3H4Q A;  1Y7R A;  1YW4 A;  5IB9 A;  3T51 B;  3SHP A;  2Q7S A;  4B6Z A;  1WOO A;  2O4H A;  1BJK A;  1GO2 A;  2Y0M A;  2RB7 A;  1NSL A;  1AYE A;  4FD7 A;  3NFZ A;  4MYT A;  2BEI A;  1WSV A;  1VQO B;  4KVM E;  4KUA A;  1XB2 A;  2ZL7 A;  3N5F A;  3PA1 A;  4RPD A;  2ZZG A;  4X06 A;  2ZZE A;  4KZT A;  3SI0 A;  4MY3 A;  3PB6 X;  3KHZ A;  5K8O A;  5TR9 A;  1RQP A;  4DQL A;  2DET A;  3TOA A;  4NGS A;  4H2K A;  3S9L A;  2VBV A;  1YW6 A;  1NJI D;  4P4E A;  4NGN A;  1K8A D;  4K30 A;  4B13 A;  2PIA A;  3LQE A;  5JM6 A;  1J4J A;  4ZBG A;  1E62 A;  2HLD A;  4NGR A;  4C2Z A;  2BO9 A;  3E1Y E;  2PJ2 A;  3TTH A;  3KQZ A;  1QGY A;  1KWM A;  2ZEH A;  4AVZ A;  1R5N A;  2PJ9 A;  3IWW A;  4MBU A;  1YME A;  1H8E A;  2FE7 A;  4CYQ A;  5J3O A;  2PRB A;  1D1N A;  5F4J A;  4UZU A;  4XPD B;  2GQF A;  1GYT A;  1CM0 A;  3KKW A;  5JH9 A;  4M4S A;  2ZL5 A;  2XNJ A;  2CND A;  4G7W A;  1XF8 A;  2O53 A;  4NJQ A;  4AVB A;  3FPP A;  1WP6 A;  2C77 A;  4KKS A;  1AIP A;  2BM0 A;  5E6T A;  2FIA A;  2JJ2 A;  1PCA A;  1UD5 A;  5DWN A;  3PEN A;  1VQN B;  3I55 B;  4MI4 A;  5JBQ A;  1NE9 A;  4HNY B;  1S72 B;  4ZGN B;  1OB5 A;  3PB4 X;  1HVX A;  4BBH A;  2PVW A;  5TY0 A;  3OZV A;  5FO1 A;  4AF7 A;  4F8Z A;  4RDK A;  5A88 A;  5GCN A;  5A28 A;  3NE5 B;  3SJE A;  4X2T A;  1WSR A;  4M6I A;  4X07 A;  2PJA A;  4NFR A;  5IYR A;  3FXT A;  4EFD A;  4XLF A;  2HQY A;  4KOU A;  2C1C A;  2XEI A;  2ABZ A;  2CW5 A;  1OHH A;  4LX9 A;  4XON A;  4WZE A;  4QC6 A;  2RC5 A;  3Q6Q A;  1IB1 E;  1EXM A;  2Z3L A;  2WZP P;  4KKU A;  2OBS A;  3CXP A;  5DSZ A;  2V4D A;  1T5E A;  2PCU A;  4KKT A;  3CCE B;  4BD9 A;  1SKQ A;  3NE8 A;  3GUX A;  4CRZ B;  3WC6 A;  2B4D A;  4XNH C;  4YEJ A;  3SKB A;  3CXS A;  4OKO A;  1VQ7 B;  3QFS A;  4QFM A;  3IGR A;  4XOP A;  1E79 A;  3IJ3 A;  3LD2 A;  1JNY A;  3Q38 A;  4EVY A;  1K28 D;  5K8N A;  3ASQ A;  1FNB A;  4II2 A;  3LMS A;  4CS0 B;  4MHY A;  2F5I A;  3FNC A;  3W2E A;  1JA1 A;  3WND A;  1YVK A;  2YNC A;  3GVK A;  3G6E B;  5F48 A;  2EIX A;  1ON0 A;  4RN7 A;  1H8H A;  5HH1 A;  3KR4 A;  3R9E A;  5F47 A;  4X7C A;  1WWZ A;  2I3C A;  2JLM A;  1E3Z A;  4KOT A;  2ZEG A;  3EXN A;  3WY9 A;  1H85 A;  2VNI A;  3PUM A;  4FWT A;  2B5G B;  1Z8W A;  2AE6 A;  2ZXH A;  1UD6 A;  2J7K A;  3G71 B;  4P44 A;  4R3L A;  2PMD A;  4LBY A;  4OC5 A;  3OE7 A;  1WDT A;  1IYK A;  1ZM4 A;  3ZPN A;  4XD7 A;  5IYP A;  2JBK A;  3GYA A;  3QFT A;  3ZBU A;  4GM5 A;  2WYR A;  2ZBU A;  3JTK A;  1E63 A;  1SQH A;  4P4D A;  1BLI A;  4E0F A;  5J8C A;  3B8G A;  2X8K A;  2OZH A;  2AHO A;  5IYN A;  1T6X A;  4P26 A;  2IQ6 A;  2JDC A;  2WPX A;  3IU2 A;  1BMF A;  4P9S A;  4UWJ A;  4KS9 A;  4UAJ A;  4TWE A;  3TC8 A;  3G3S A;  3PP9 A;  3S6F A;  2BM1 A;  1HDQ A;  1WPC A;  1FT7 A;  1ZLH A;  3FYN A;  3CES A;  3OJX A;  3FVL A;  4OOX A;  1S7N A;  3FJO A;  1CP7 A;  1S4M A;  3OW2 B;  1MAB A;  1V5V A;  4XR6 A;  2PR8 A;  1W9X A;  3CD6 B;  4G6I A;  4ZCI A;  4GQN A;  3GLJ A;  2JEV A;  4MFP A;  3W2I A;  4G1V A;  2FT0 A;  3PEI A;  4RLZ A;  2CY2 A;  3KR5 A;  1JB9 A;  3DR8 A;  1ELO A;  2V31 A;  1VHE A;  1PJ6 A;  5CNP A;  5A89 A;  5THW A;  2CTB A;  3ASR A;  4GS4 A;  7CPA A;  3TO7 A;  4MHZ A;  3VWD A;  1YJN B;  3GQB A;  3CP2 A;  5HZA A;  4KOY A;  1S7F A;  4TSF A;  3DSB A;  1GAQ A;  4A31 A;  5HVF A;  1TVC A;  4XOR A;  2J8R A;  1IB0 A;  3HLP A;  4N3G A;  1M4D A;  2GJP A;  5DWM A;  4KOR A;  2HDN B;  2P0W A;  4U9Z A;  1Q9S A;  1JQG A;  3OZU A;  4AG9 A;  1HDU A;  3CCQ B;  1UWY A;  1N71 A;  2V8G A;  1QVF B;  4IAV A;  2R6H A;  3P26 A;  1CNF A;  3MN8 A;  4NSQ A;  4OC1 A;  2GRE A;  3ZJ0 A;  2GLF A;  5IYQ A;  2WJV A;  1IJF A;  4UEE A;  4MCS A;  2R9V A;  1YI2 B;  4X3R A;  5DS0 A;  4ZGY B;  3R6K A;  3B3C A;  3MHP A;  1NSA A;  3R9F A;  5HXD A;  2CNT A;  3OFN A;  1BPN A;  3PA2 A;  4R8F A;  1M90 D;  1P4N A;  4PC6 A;  3KZW A;  4JMQ A;  4HE6 A;  4YHB A;  1VQ9 B;  4RD2 A;  4F7D A;  4IW3 B;  1W0J A;  2X6W A;  4MJ8 A;  3PRT A;  2E1B A;  4RJL A;  3NH5 A;  3GIU A;  2D3L A;  2OTJ B;  5B6I A;  1UD4 A;  4MFK A;  4ONW A;  4DNT B;  4P3I A;  4YGO A;  4J3G A;  3CCR B;  3OW7 A;  3A8I A;  4NJR A;  1F2O A;  3CPA A;  5H86 A;  5F4M A;  4OAE A;  4XNF A;  3WAB A;  2P3M A;  4FD4 A;  4UFW A;  1ZM3 A;  3D66 A;  3KL9 A;  3KGQ A;  2QYV A;  4L8A A;  5F49 A;  3G05 A;  2RFH A;  4Z4U A;  2Z11 A;  2PR1 A;  1S60 A;  4Y9R A;  2WPD A;  4H9G A;  1EP3 B;  2XEX A;  2OTL B;  5JPH A;  3OEH A;  4JLY A;  2BN4 A;  4ZY1 A;  3B82 A;  1KUV A;  5I0C A;  4B14 A;  4KSF A;  5LYL A;  4XPL A;  5G21 A;  4M0L A;  3PB7 X;  3FEE A;  4TMV A;  2ZTG A;  1N8R D;  2GU2 A;  3H5Z A;  4MFQ A;  1VJS A;  2V8V A;  4ZX8 A;  4KVX A;  1WU8 A;  4B5P A;  4RUH A;  1KTV A;  1GR1 A;  3FIX A;  1Q2Y A;  2G3A A;  2XOK A;  2PJ4 A;  3BI0 A;  4P6Y A;  1H8L A;  2Q51 A;  2VYQ A;  3QSY A;  1QQ9 A;  4MHN A;  1GAW A;  4G7X A;  1R43 A;  3VO2 A;  3ZZT A;  2ODF A;  2YWF A;  1ZO0 A;  4UCP A;  4MRI A;  2CF4 A;  1YHQ B;  3RZA A;  1XE1 A;  3FH4 A;  4R7M A;  2R1I A;  2AFU A;  4CYP A;  2R8V A;  4OIW A;  2XNC A;  4B12 A;  1TXR A;  4OOS A;  1VQ6 B;  2NPF A;  3A9L A;  3BI1 A;  1QG0 A;  1E1Q A;  1YX2 A;  3R1K A;  3SI2 A;  2PJ6 A;  4FK8 A;  5KTC A;  4OPV A;  2ZXV A;  3BQJ A;  2JJ1 A;  3CC7 B;  2ZOG A;  2XZO A;  1NDH A;  4RDJ A;  5FIU A;  3FED A;  4UIB A;  2BGJ A;  5ELY A;  4DQK A;  5G20 A;  4YXW A;  4UF4 A;  2GFQ A;  2VZL A;  1ARM A;  1GVH A;  5BSX A;  2V8D A;  3Q6R A;  2CTC A;  1MJ9 A;  2Z3O A;  3VR6 A;  2Q0Y A;  1XFO A;  1EWY A;  1F2P A;  5F46 A;  3W2F A;  4P10 A;  4NGQ A;  1PJ5 A;  1W87 A;  5E96 A;  1IYL A;  3DLJ A;  3PGP A;  4IHM A;  2V7W A;  1EFU A;  2C4U A;  2XZP A;  4HE5 A;  1QSM A;  4MHP A;  3PFE A;  3W6S A;  4UBR A;  4A30 A;  1QFJ A;  3U2Q A;  4EH1 A;  4R87 A;  1IY7 A;  4E8O A;  4E0A A;  2LZJ A;  2BOA A;  3NH4 A;  1OB0 A;  2FSR A;  3VMF A;  5FNZ A;  3BC9 A;  2OYN A;  2VL1 A;  1KUX A;  4U5Y A;  4HIZ A;  2VJI A;  4X05 A;  1WOR A;  1D8T A;  1NB9 A;  2FVG A;  3AVW A;  3OJW A;  1KK3 A;  4M6G A;  2OOT A;  4CYN A;  4PC3 A;  3U6B A;  1G7C A;  4OC4 A;  3QAY A;  4RD4 A;  2REF A;  2CRV A;  2Q4Z A;  2ZOF A;  4PC7 A;  1UD8 A;  4II9 A;  1XQB A;  4CAW A;  1E3X A;  1TLL A;  2P6F A;  1FX0 A;  2HB6 A;  4P4I A;  4KSA A;  3W2H A;  2JBJ A;  2PJ5 A;  4C0S A;  2XND A;  4MFL A;  2Q43 A;  2EK9 A;  4B11 A;  2ZEF A;  1XIX A;  1DE4 C;  4K1X A;  4WZL A;  1PU9 A;  4F0X A;  2Z3M A;  2J9A A;  1F60 A;  1P4M A;  5FVJ A;  5JQ4 A;  2PQ8 A;  4ACA A;  3BXM A;  1BPM A;  4CAF A;  3CMM A;  1QMU A;  3CC4 B;  4TN1 A;  1FNO A;  2H5M A;  3OAA A;  3FB3 A;  1Z9U A;  1Z8X A;  3IU1 A;  2VEZ A;  2DEA A;  2Q6O A;  1TIQ A;  1QFZ A;  4BIN A;  4NGT A;  4Y49 C;  2PJ0 A;  3RNZ A;  4O23 A;  3T8W A;  2OK8 A;  4PAB A;  1EP1 B;  3SLD A;  3QFC A;  4MXU A;  2R98 A;  5AGE A;  5KTD A;  5F09 A;  1QST A;  1YVO A;  3MGD A;  3UY5 A;  1Q7Y D;  3U6K A;  1EE3 P;  3PB9 X;  3ZZI A;  1LAP A;  2F1M A;  1NRK A;  1EFR A;  3B8H A;  3TCV A;  2HV2 A;  3FF3 A;  1BX0 A;  2D4P A;  3ONY A;  2QDX A;  2QVP A;  3LAC A;  1R5B A;  2C5B A;  2CK3 A;  3CXC B;  3CXQ A;  2BV3 A;  4WJB A;  2YNC C;  1T6Z A;  1VLO A;  3BY2 A;  2FIW A;  4RD6 A;  2AFX A;  1W2B B;  2B3U A;  4CAX A;  3VNV A;  8CPA A;  2B7C A;  3BY1 A;  4NCN A;  4OPS A;  4KOS A;  4H6U A;  3VWE A;  4LBW A;  2QGG A;  5DN6 A;  2WR8 A;  1YJW B;  1LOK A;  2W6J A;  4JJX A;  1S7K A;  2ZW5 A;  4RD0 A;  3FMC A;  3W6X A;  4XMY A;  1EFC A;  2R7H A;  1E1R A;  1XMT A;  2BUE A;  4CGO A;  2POK A;  3V38 A;  3LVB A;  2DCU A;  4ZCL A;  1CX8 A;  4BPR A;  1RO5 A;  4CAV A;  1Y9K A;  4ZCM A;  5KW9 A;  3JVN A;  2OZG A;  4X8I A;  2PE3 A;  1VQ8 B;  4XM3 A;  3WC7 A;  3PVD A;  2NMT A;  3WBJ A;  1PUA A;  2QMU A;  4NNJ A;  3OEE A;  3DDD A;  3W5U A;  1YQE A;  5EBV A;  3CT9 A;  4ZV4 A;  2DIE A;  1S5K A;  3WC5 A;  4RD1 A;  4RM0 A;  2VJJ A;  3D2M A;  2C4T A;  3CCV B;  4XKW A;  4KLW A;  1M4L A;  1IU8 A;  3FBU A;  5IV0 A;  4NF1 A;  4PPZ A;  4ZX9 A;  1H42 A;  4QHY A;  3W5V A;  1L0C A;  4P1V A;  1I8D A;  2B5O A;  4Z4T A;  4GXH A;  3NE7 A;  2YWH A;  2G3T A;  3ISZ A;  2FCK A;  2CBX A;  2OZU A;  1WOP A;  1B87 A;  5J8F A;  1N08 A;  1KK2 A;  4XN3 A;  1Y9W A;  2QTL A;  2PC1 A;  2V7Q A;  4A94 A;  2XZL A;  1VQP B;  2F4N A;  4Y7C A;  4H6Z A;  4Z4S A;  3B35 A;  2GJR A;  1YK3 A;  3ZZU A;  4AC9 A;  1TKJ A;  1GJR A;  1I7P A;  2I79 A;  1FDR A;  3I1F A;  1VHS A;  4CGL A;  3BCF A;  2ZPA A;  2M5S A;  2ZTN A;  4FBE A;  1KK0 A;  4OC2 A;  4UA3 A;  2DXQ A;  2GK6 A;  1N05 A;  2X0K A;  1W34 A;  4XNH B;  4F6A A;  4X0C A;  2REE A;  3E20 A;  1KRH A;  2YNE A;  4CYO A;  3CPW B;  1Q82 D;  4Z1M A;  1LAN A;  1Z5R A;  1Q7L A;  1KMH A;  1TKF A;  3ES9 A;  2EK8 A;  5LYF A;  2O28 A;  4Z4Z A;  4R57 A;  3OZW A;  4N3N A;  2P6G A;  4M6H A;  4WZK A;  4JZ0 A;  3W91 A;  4NXY A;  3FKS A;  5AN9 A;  2E1R A;  4B47 A;  4Y9U A;  3P2H A;  2X3U A;  5LRJ A;  4X7D A;  1ZLI A;  1YIT B;  3T90 A;  2NSM A;  2AFM A;  4ASU A;  2QJ8 A;  2Z3P A;  2YWG A;  1MRZ A;  2Q44 A;  2V7U A;  3I3G A;  1HEE A;  2BCO A;  5A27 A;  2XEF A;  5C82 A;  2ZXI A;  3ZUG A;  1QUF A;  1D2E A;  1RXT A;  1N06 A;  1NB0 A;  5K8M A;  3SXO A;  4PAA A;  1U2R A;  1QGA A;  1KD1 D;  3AVX A;  4Q7J B;  3A8J A;  3H8F A;  2ZEN A;  4YWY A;  1ARL A;  4FWU A;  3WQZ A;  4Z4W A;  2GE3 A;  4CPA A;  3F5B A;  2HCJ B;  1PJ7 A;  5LYI A;  1YIJ B;  1I21 A;  1BO4 A;  2GAN A;  4OP7 A;  2ZEE A;  1B6B A;  4X7F A;  4IUS A;  4JXQ A;  3A35 A;  2ZEL A;  4AVA A;  4MY0 A;  3OP1 A;  3WYA A;  1Q2D A;  2WZN A;  3V76 A;  3WT4 A;  4XOT A;  2OK7 A;  1E43 A;  3WR7 A;  2Z3N A;  1XJO A;  3OOC A;  4RCZ A;  4PV6 A;  2IL4 A;  3SJP A;  2VQY A;  5LYD A;  3LO8 A;  2OR4 A;  2ZZF A;  3MCA A;  1GHE A;  1S7L A;  3T9Y A;  4NBS A;  2ZEO A;  2PJ8 A;  1KQS B;  4P22 A;  2F8H A;  2CNS A;  3GKR A;  2ZIT A;  2XEG A;  3D2P A;  3RY8 A;  4RD3 A;  1ZM2 A;  4TKO B;  4K3N A;  3VAT A;  3TOB A;  2ARH A;  1IOI A;  5H84 A;  4CAE A;  4P12 A;  1LRZ A;  3D7H A;  2ATR A;  4DUK A;  3Q39 A;  4Z65 A;  2DOG A;  4Z4V A;  3HUV A;  5KNL A;  2ZBV A;  2B58 A;  4DYO A;  2VBU A;  1W0K A;  5BSY A;  2PRQ A;  5KTA A;  3CW2 A;  5BWA B;  3B78 A;  1QX4 A;  1TTT A;  4OP4 A;  1XMB A;  2AFS A;  4A37 A;  2G0B A;  3RO0 A;  4UEZ A;  2CNM A;  4C7H A;  4I49 A;  1FRN A;  2DPS A;  3ASP A;  4TMZ A;  3K2K A;  2P6E A;  1S0U A;  3A8K A;  4MCP A;  1HA3 A;  2XEJ A;  3CB4 A;  1K73 D;  4CRY B;  1DAR A;  4E2A A;  3SEJ A;  3H94 A;  1QSR A;  4NCZ A;  1BPL A;  3IEH A;  2AJ6 A;  1HZE A;  2C27 A;  4M3S A;  3TX8 A;  1ELM P;  4M53 A;  2Z3K A;  1BLL E;  2AFO A;  2PJ7 A;  3EO4 A;  4NGM A;  4YRH A;  4P25 A;  2V7X A;  3AVY A;  4MCQ A;  3RAM A;  3VAR A;  4KOW A;  2PJB A;  3JQQ A;  2CIJ A;  2PDO A;  4MFJ A;  2GLJ A;  3P27 A;  4HNX B;  3D7D A;  3GVL A;  1UFH A;  4YAW A;  1AUG A;  4A38 A;  3D4U A;  3J81 k;  1Y7E A;  1CNE A;  3BH4 A;  1Q86 D;  3AVU A;  4OC0 A;  3TFY A;  4CGM A;  3FJU A;  2CC2 A;  4A32 A;  1DDI A;  1SM4 A;  4A2Z A;  1F20 A;  2JEW A;  1OB2 A;  2DYI A;  5D29 A;  1EP2 B;  2OU2 A;  4UCN A;  1SKY B;  3C26 A;  4PC1 A;  3Q3A A;  3DGV A;  1IJE A;  3B3T A;  5TV2 A;  1KC8 D;  3L2N A;  3N7Z A;  4KUB A;  2J8N A;  2W6I A;  4OOV A;  4B48 A;  4UIA A;  5EC4 A;  3V7A A;  2FX3 A;  2C6C A;  5FA6 A;  1Y0R A;  5A8A A;  1OZP A;  3AST A;  3D26 A;  3LQ6 A;  5IK2 A;  1YJ9 B;  2K5T A;  3CCJ B;  3W5H A;  4UEF A;  4FAI A;  4KVO E;  2D9R A;  6CPA A;  3CRZ A;  2OH1 A;  4KLV A;  5LRK A;  3CZX A;  1QGZ A;  3QFR A;  4B4D A;  3KHX A;  3S9N A;  1VLY A;  2Z6B D;  3TO6 A;  2A4N A;  3VO1 A;  2IMO A;  4PK3 A;  1T6Y A;  2X6Y A;  4OME A;  2WSS A;  2EO8 A;  1VIX A;  2CXA A;  5HXB A;  5TRD A;  2HC9 A;  4JWP A;  4M1K A;  3KI9 A;  4AVC A;  2QEC A;  2PLF A;  4JD6 A;  2QIR A;  2BSA A;  2AFW A;  2PJ1 A;  4TMT A;  2C78 A;  2GJK A;  4PQA A;  1AMO A;  3D67 A;  1FND A;  1FRQ A;  2FL4 A;  3PZJ A;  2WSA A;  3P2F A;  3BHX A;  4QUZ A;  3QE2 A;  1V0C A;  1VQM B;  2EBJ A;  3ONU A;  4II3 A;  1JJ2 B;  1BAV A;  4LUA A;  2BGI A;  4A39 A;  3D3S A;  4YAF A;  2F43 A;  1DG1 G;  2DEU A;  1LAM A;  3PUN A;  4C2Y A;  2GIV A;  5CPA A;  4RCY A;  1M1D A;  4PC2 A;  2JN9 A;  5EMN A;  3QAH A;  2X85 A;  2IJZ A;  2Q4Y A;  1G7T A;  3TO9 A;  2D74 A;  1V0F A;  3W2G A;  2C6G A;  5F4O A;  3D7F A;  4PK2 A;  4B3G A;  1QVG B;  2EWB A;  3PB8 X;  4F9V A;  2WPW A;  2ZED A;  4FD6 A;  2F1L A;  2Z10 A;  4QVT A;  4CQJ A;  2HMA A;  3BNW A;  2VNH A;  2V7V A;  1F57 A;  4H89 A;  2BMW A;  1KZF A;  1VQK B;  1AMP A;  4UWI A;  5AG6 A;  3D68 A;  3T53 B;  1K4J A;  3CMA B;  3CCS B;  3IWG A;  1XRY A;  4P3Y A;  4LQ6 A;  4WZT A;  4UFX A;  4MCR A;  2PVV A;  4L89 A;  1TKH A;  5H5J A;  4X7E A;  4JXR A;  4HNW B;  4G5G A;  1ZG8 A;  3CDX A;  3I1U A;  4WQM A;  2DPT A;  3NH8 A;  2KCW A;  3SJX A;  3DR6 A;  4Q38 A;  2QTZ A;  1A8P A;  2VBS A;  3FX6 A;  1LCP A;  3LNN A;  4AG7 A;  1YRE A;  4IF5 A;  3R95 A;  2VBT A;  1PKV A;  2VNJ A;  1CJW A;  4C2X A;  1CBX A;  4TMX A;  4P6V F;  4PXB A;  4QVA A;  3FEC A;  3RBU A;  4C68 A;  3K9U A;  1CP6 A;  2ZEP A;  3B3S A;  2ZW4 A;  4PSW A;  4XLE A;  1B2R A;  4DNR B;  4M85 A;  4XQF A;  2Q7B A;  4G1P A;  3R96 A;  1J9Z A;  1IGB A;  4MFZ A;  3CCL B;  4R6T A;  1W35 A;  1IID A;  2PJ3 A;  2B4D B;  4B43 A;  4AB7 A;  1IHM A;  1QH0 A;  1NMT A;  2PSW A;  2VZY A;  5IYW A;  5HVG A;  3IIB A;  3MMP A;  2Q6K A;  3ISX A;  1VKC A;  3I9S A;  4CGN A;  1WK4 A;  3BJ8 A;  1EFT A;  1CQX A;  5I4M A;  4KOX A;  3ASS A;  1M4I A;  2EUI A;  1Z4E A;  1N0V C;  2KVO A;  4B3X A;  4YAO A;  1OGI A;  2X7B A;  2DF5 A;  4X5K A;  3A1P A;  4W9Y A;  4KSI A;  2RC4 A;  4F0Y A;  1ZM9 A;  2ZW6 A;  3JQP A;  4PXC A;  2B5G A;  2X53 S;  1OBR A;  1QSN A;  4DK1 A;  1YLO A;  4B44 A;  1XBU A;  4FN5 A;  4MHD A; 
#chains in the Genus database with same CATH homology
 2WZN A;  1R3N A;  4IK2 A;  4OIW A;  3WT4 A;  4NGR A;  2BO9 A;  1TXR A;  2PJ2 A;  3KQZ A;  1KWM A;  3BI1 A;  1XJO A;  4FUU A;  2ZEH A;  1ZG9 A;  2PJ9 A;  3IWW A;  1YME A;  3SI2 A;  2PJ6 A;  5LYD A;  2OR4 A;  1GYT A;  2PIZ A;  5JH9 A;  2ZEO A;  2ZOG A;  2PJ8 A;  2O53 A;  4NJQ A;  2F8H A;  3FED A;  3IC1 A;  4UIB A;  5ELY A;  2XEG A;  4Q7A A;  4UF4 A;  5JGF A;  1ARM A;  1PCA A;  3H8E A;  2V8D A;  2CTC A;  4K3N A;  3VAT A;  1XFO A;  1F2P A;  4P10 A;  3PB4 X;  2F7V A;  3D7H A;  4NGQ A;  4DUK A;  2PVW A;  3DLJ A;  1YSJ A;  4IHM A;  4F8Z A;  4Z65 A;  3QNV A;  2C6P A;  3SJE A;  3HUV A;  4X2T A;  4MHP A;  2PJA A;  4NFR A;  4DYO A;  3PFE A;  4ZY2 A;  2PRQ A;  4WWV A;  4EFD A;  1LFW A;  3B2Y A;  1IY7 A;  4OP4 A;  2C1C A;  2XEI A;  1XMB A;  2ABZ A;  2AFS A;  4A37 A;  4UEZ A;  2BOA A;  3NH4 A;  3B3W A;  3K2K A;  1PYT B;  2VL1 A;  3NA6 A;  3LWU A;  3CPX A;  4MCP A;  1CPX A;  2XEJ A;  2PCU A;  4BD9 A;  2FVG A;  3GUX A;  3IEH A;  3WC6 A;  4OKO A;  2OOT A;  1ELM P;  3TX8 A;  1BLL E;  4OC4 A;  2AFO A;  2PJ7 A;  3PBE A;  4NGM A;  3IJ3 A;  2Q4Z A;  2V77 A;  2ZOF A;  5K8N A;  4MCQ A;  3RAM A;  3VAR A;  1Z2L A;  1Y0Y A;  3LMS A;  2PJB A;  2HB6 A;  4P4I A;  2CIJ A;  4MHY A;  2GLJ A;  4AXV A;  2JBJ A;  2PJ5 A;  3D7D A;  2AFZ A;  3KAS A;  2Q43 A;  2EK9 A;  2ANP A;  5D8N A;  3KR4 A;  2ZEF A;  4MMO A;  4A38 A;  1DE4 C;  2I3C A;  3D4U A;  3H8G A;  1Y7E A;  2ZEG A;  2ZEM A;  2J9A A;  5J1Q A;  3IFE A;  4OC0 A;  3FJU A;  4NGP A;  3BXM A;  1BPM A;  4P4F A;  2JEW A;  4P44 A;  1QMU A;  5D29 A;  1FNO A;  4OC5 A;  3DGV A;  2JBK A;  1ZG7 A;  2DEA A;  3B3T A;  4GM5 A;  3KQX A;  2WYR A;  3L2N A;  1CG2 A;  4NGT A;  4ZI6 A;  4UIA A;  4P4D A;  2C6C A;  2PJ0 A;  4O23 A;  4PXD A;  3T8W A;  1Y0R A;  4MXU A;  5F09 A;  4UEF A;  2IQ6 A;  4FAI A;  6CPA A;  3S9M A;  1EE3 P;  3PB9 X;  1LAP A;  5LRK A;  3KHX A;  1ELL P;  3S9N A;  4TWE A;  3TC8 A;  1TF9 A;  3FF3 A;  2QVP A;  2IMO A;  4OME A;  3D7G A;  1HDQ A;  1FT7 A;  1ZLH A;  4WJB A;  1VIX A;  2HC9 A;  4PXE A;  3KI9 A;  3FVL A;  2AFX A;  1DTD A;  1CP7 A;  8CPA A;  2PIY A;  2AFW A;  2PJ1 A;  4PQA A;  1LOK A;  3MRU A;  3B3V A;  3D67 A;  3GLJ A;  3PEI A;  3BHX A;  3FMC A;  1VGY A;  3KR5 A;  3GB0 A;  1VHE A;  1BAV A;  4A39 A;  2POK A;  3V38 A;  5THW A;  3V7Z A;  4ZYQ A;  1CX8 A;  3SI1 A;  1LAM A;  2CTB A;  4R76 A;  7CPA A;  5CPA A;  4MHZ A;  4X8I A;  2PE3 A;  1Z8L A;  3B7I A;  3WC7 A;  4TNU A;  2V8H A;  5HVF A;  4LQG A;  3HLP A;  3JRU A;  2IJZ A;  1RTQ A;  4ZY0 A;  3CT9 A;  1JQG A;  3VH9 A;  2C6G A;  1HDU A;  3D7F A;  3WC5 A;  4OID A;  2EWB A;  1UWY A;  3PBB A;  4YU9 A;  3PB8 X;  4F9V A;  2ZED A;  4F9U A;  1M4L A;  1VHO A;  1F57 A;  2V8G A;  4IAV A;  2PJC A;  3MN8 A;  1AMP A;  4OC1 A;  2GRE A;  3SJG A;  4PPZ A;  4ZX9 A;  4EME A;  4EWT A;  3D68 A;  2GLF A;  4UEE A;  4MCS A;  4X3R A;  5DS0 A;  3ISZ A;  3PFO A;  3B3C A;  1XRY A;  4MCR A;  2PVV A;  5HVH A;  1TKH A;  3SJF A;  1NSA A;  5K8P A;  1ZG8 A;  4JYW A;  3CDX A;  5LRG A;  5HXD A;  3IO1 A;  1BPN A;  3I1U A;  4R8F A;  3NH8 A;  4A94 A;  3SJX A;  3KZW A;  3FX6 A;  1LCP A;  3B35 A;  5CBM A;  3PRT A;  1TF8 A;  1TKJ A;  4DJL A;  3NH5 A;  1CBX A;  2NYQ A;  4ONW A;  4PXB A;  4FBE A;  3FEC A;  3RBU A;  4P45 A;  4OC2 A;  1CP6 A;  4P4J A;  4P4B A;  3K9T A;  1CPS A;  2ZEP A;  3B3S A;  4NJR A;  1F2O A;  3CPA A;  4OC3 A;  2G9D A;  3WAB A;  3D66 A;  3KL9 A;  1LAN A;  1Z5R A;  4G1P A;  1Q7L A;  1IGB A;  1TKF A;  2EK8 A;  5LYF A;  3KGQ A;  4R6T A;  2QYV A;  1YW4 A;  5IB9 A;  2PJ3 A;  2RFH A;  4JZ0 A;  4B6Z A;  5LRJ A;  2O4H A;  1ZLI A;  4ZY1 A;  5HVG A;  3IIB A;  2NSM A;  2AFM A;  2QJ8 A;  2RB7 A;  1AYE A;  3ISX A;  3NFZ A;  5LYL A;  1HEE A;  2BCO A;  2XEF A;  3N5F A;  3PB7 X;  3FEE A;  5K8M A;  2GU2 A;  5I4M A;  2V8V A;  4ZX8 A;  3SI0 A;  4RUH A;  3H8F A;  2ZEN A;  3PB6 X;  3KHZ A;  4YWY A;  5K8O A;  1ARL A;  3BI0 A;  2PJ4 A;  4FWU A;  4CPA A;  4P6Y A;  1H8L A;  2Q51 A;  4W9Y A;  4KSI A;  1QQ9 A;  4MHN A;  5LYI A;  1R43 A;  4NGS A;  2ZEE A;  4H2K A;  4PXC A;  3S9L A;  1OBR A;  1YW6 A;  4P4E A;  4NGN A;  1YLO A;  1XBU A;  2CF4 A;  4MRI A;  3RZA A;  2ZEL A;  5JM6 A;  3FH4 A;  4R7M A;  2AFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...