3ISXA

Crystal structure of endoglucanase (tm1050) from thermotoga maritima at 1.40 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
335
structure length
335
Chain Sequence
HHHHMKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Endoglucanase (TM1050) from THERMOTOGA MARITIMA at 1.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Endoglucanase
total genus 104
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3isxA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3isxA01
3GUXA 5HVFA 4KSIA 1TXRA 1YW6A 3NH4A 3S9MA 2ZELA 3D7HA 5HXDA 2ZEOA 2GREA 2IJZA 3ISZA 4R8FA 1PYTB 2EK8A 2PRQA 4DJLA 3FEDA 2G9DA 2JBKA 4MRIA 2Q51A 4K3NA 3WABA 3D7DA 3SJFA 1Y7EA 2AFSA 4PXBA 3WC7A 3K9TA 5LRJA 2PJ1A 2OR4A 2QJ8A 2PJ0A 2PJ7A 2Q43A 2ZOFA 4Q7AA 4EMEA 1ELLP 4P4JA 4G1PA 2PE3A 1LAMA 4P4BA 2PJ5A 4PXEA 1QMUA 3PB8X 1TKFA 2GLFA 1FT7A 2F7VA 4ZX8A 4NGRA 3L2NA 2ZEEA 2NYQA 3KL9A 1TF9A 4ZY2A 4R76A 1EE3P 2OOTA 3DGVA 4UEZA 1HEEA 4ONWA 3FH4A 2XEFA 4OC4A 3MN8A 1XJOA 3ISXA 1BAVA 3PFOA 1CPXA 3IEHA 2RB7A 3TC8A 4MCRA 1GYTA 2PVVA 1VHOA 3PFEA 4R6TA 3B3WA 1CP6A 3KGQA 1F2PA 4FWUA 2CTBA 2PJCA 7CPAA 3GB0A 3B3VA 3PBEA 4UEEA 2C6CA 2F8HA 4OC5A 2ANPA 2V8VA 4LQGA 3D7GA 2PVWA 3KR4A 4P4FA 2HC9A 4UEFA 5ELYA 2AFMA 2J9AA 2XEIA 3IWWA 3H8EA 4MCPA 1ARMA 2BOAA 4FUUA 5JH9A 1XFOA 3PEIA 2VL1A 1Y0YA 4PXCA 4O23A 2PJAA 2CTCA 4IHMA 4P45A 4P44A 4BD9A 1M4LA 2C1CA 3CPAA 2XEJA 4WJBA 4FAIA 4OC3A 3PRTA 3JRUA 1ZLIA 2NSMA 5D29A 3CDXA 4A37A 2PJ4A 4F9VA 3TX8A 1Z8LA 2GU2A 4NGMA 2ZEGA 3BI1A 3SJGA 2BO9A 4X2TA 1NSAA 4NJQA 4P4IA 3I1UA 6CPAA 3B3CA 3V7ZA 3B3TA 4NGTA 3KHZA 3SI1A 2ZEHA 1TKJA 2QYVA 3BXMA 3B7IA 3SI2A 2BCOA 3PB4X 5DS0A 3VH9A 2WYRA 3NFZA 1Q7LA 4OMEA 2V77A 3PB6X 4DYOA 3B35A 1KWMA 1H8LA 4P4DA 8CPAA 3K2KA 3V38A 4OC2A 1HDUA 3IO1A 3RZAA 3T8WA 2PIYA 1BLLE 1BPNA 1LOKA 2PJ3A 4PXDA 4ZY0A 4MXUA 4B6ZA 2PJBA 4TNUA 3B3SA 3VATA 4X8IA 3RAMA 3S9LA 2Q4ZA 1PCAA 2V8GA 3WT4A 2ZEMA 3NH5A 5K8PA 1IY7A 2PIZA 2I3CA 1OBRA 4X3RA 4IAVA 2IQ6A 2PJ8A 1TKHA 4H2KA 4RUHA 5LRKA 3CPXA 3LMSA 1FNOA 4NGSA 3QNVA 4PPZA 5THWA 1CG2A 4NGPA 1LAPA 2AFZA 3BHXA 2ZOGA 4MHPA 3WC6A 3IC1A 3PB7X 4OC1A 4F8ZA 5I4MA 2ABZA 5LYFA 4NGNA 1YLOA 1QQ9A 5D8NA 2RFHA 4UIAA 2EK9A 5LYDA 1AMPA 2PJ6A 4F9UA 1XBUA 2EWBA 1ZLHA 1ARLA 2O4HA 2QVPA 4YU9A 4MMOA 4R7MA 3SJXA 4AXVA 3RBUA 5CPAA 1CX8A 4NJRA 4P4EA 2GLJA 4P10A 2V8HA 3VARA 1VGYA 3GLJA 1VIXA 2POKA 4MHNA 3KR5A 3KHXA 1LCPA 2DEAA 4Z65A 5JGFA 1ELMP 1VHEA 3PBBA 5K8NA 4P6YA 4ZYQA 3FX6A 4OIWA 2V8DA 3FJUA 4TWEA 4DUKA 4OKOA 5HVGA 1RTQA 2HB6A 3CT9A 2JBJA 2FVGA 5F09A 4NGQA 3D68A 3IIBA 1DE4C 2ZEDA 4WWVA 3H8FA 4FBEA 2PJ2A 5IB9A 2PCUA 3KASA 4MHZA 4YWYA 2WZNA 4ZY1A 3PB9X 1CP7A 1F2OA 3IFEA 2AFUA 5LYLA 2C6GA 3D67A 2CIJA 3HUVA 5HVHA 4EWTA 5K8MA 1YW4A 4OC0A 4A39A 4IK2A 3FF3A 3SJEA 4CPAA 2JEWA 3N5FA 1XMBA 4PQAA 1LANA 5JM6A 4GM5A 3H8GA 2AFOA 2ZEFA 1R3NA 1Y0RA 3B2YA 2ZEPA 1CPSA 3LWUA 4UIBA 2IMOA 1ZG8A 4JZ0A 3NA6A 3FECA 1HDQA 4OIDA 1F57A 2C6PA 2XEGA 2PJ9A 3KQXA 4MCSA 3MRUA 3KI9A 3FVLA 3DLJA 1ZG7A 1JQGA 3S9NA 4NFRA 4UF4A 1YSJA 1IGBA 4MCQA 4ZX9A 4W9YA 5K8OA 5J1QA 1ZG9A 4OP4A 1AYEA 3SI0A 2AFWA 3FEEA 4EFDA 5LYIA 3FMCA 2ZENA 3HLPA 1LFWA 2AFXA 3BI0A 4ZI6A 3D66A 1BPMA 4MHYA 3D7FA 1TF8A 1XRYA 5CBMA 3IJ3A 4A38A 3KQZA 3WC5A 2O53A 4JYWA 5LRGA 2CF4A 1UWYA 1CBXA 1YMEA 1Z2LA 4A94A 3D4UA 3NH8A 1R43A 1Z5RA 3KZWA 1DTDA
chains in the Genus database with same CATH superfamily
2PRBA 2XGJA 4RD0A 1TXRA 4XNFA 4NNJA 1M4GA 3S9MA 2ZEOA 4QV2A 4XN0A 3ISZA 1AIPA 1L0CA 1PYTB 2JDIA 3G05A 3PUNA 2Q7SA 1GJRA 4MFZA 4ASUA 4CGOA 3WABA 3OOCA 3D7DA 3OW7A 3PUMA 3W6SA 4YAWA 2PJ1A 1BJKA 1WSVA 4EVYA 4LBZA 4YELA 3OPOA 3ZBUA 3CCUB 1ELLP 4MFLA 5IYPA 4AF7A 4RD3A 4G1PA 2BPOA 1BLIA 1LAMA 5GCNA 4X7CA 3CCEB 4ZX8A 3QAHA 4ONUA 4UFWA 2J8RA 3L2NA 2NYQA 1MJ9A 1VQMB 3ZBTA 1EE3P 1QX4A 1QSTA 3IGRA 5G1ZA 1FNDA 4X07A 3PP9A 4XONA 1HEEA 2WJVA 2XEFA 3MN8A 2V7VA 3ISXA 1XJOA 1CPXA 4PGOA 2CK3A 4R9MA 1YGHA 3S6FA 1UD8A 1FX0A 4R6TA 4P3IA 2X6WA 4B44A 1I18A 1VJSA 5FNZA 3QB8A 4CQJA 2ATRA 3B3VA 2PR8A 1F20A 3CB4A 1Q2DA 1WK4A 4TKOB 4XKWA 1BO4A 2ZZEA 1X12A 4DQLA 1E63A 4Y7CA 4OC5A 2ANPA 3OZUA 1W87A 2C78A 4LQGA 3D7GA 2Z3KA 5AG5A 4A33A 1IHMA 2OYNA 2BUEA 1QSNA 3R6KA 2YGWA 2DEUA 2X85A 2ZTGA 2ZW6A 1VQLB 5ELYA 2AFMA 2J9AA 1X10A 3CMMA 4Q38A 1NRKA 2Z3PA 3PEIA 1Y9KA 2VBVA 4PXCA 4O23A 1NB0A 4P9SA 4IHMA 4P45A 4C0SA 4P44A 3CXQA 1XEBA 1Q7YD 2VBSA 4FAIA 3JRUA 4HE6A 2NSMA 3CDXA 5D29A 1KUYA 2PJ4A 2CNSA 4XNHC 1Z8LA 4NGMA 4UA3A 4UWIA 1T6YA 1BPLA 1XOVA 3CRZA 2BO9A 4Z4TA 4H6UA 2KCWA 2WPWA 2DPSA 4M6GA 4JXQA 1QUFA 3ZUGA 4F6AA 4KLWA 1VQ7B 4MY3A 4RN7A 3BXMA 3BJ8A 1FDRA 2BF4A 3H94A 3SI2A 3NE8A 1WTHD 1Q7LA 3WXMA 1LRZA 2PQ8A 2WSSA 4KOYA 2X6YA 3U6BA 8CPAA 1KUXA 3AVYA 4A2ZA 3QFRA 3PGPA 1BLLE 1BPNA 4ZY0A 2QTZA 2WUUA 2EUIA 3J81k 1YVKA 2VZZA 4PSWA 2Q4ZA 2XNJA 2V8GA 3NH5A 1IY7A 1MJAA 2I3CA 4CS0B 4IAVA 4FD4A 5IYNA 2X8KA 2X6XA 4M3SA 3CPXA 3LMSA 4LQ6A 1FNOA 5F49A 2Y0MA 5THWA 1CG2A 2YNCA 4NGPA 4H89A 2ZOGA 4MHPA 4E0FA 3WC6A 1I8DA 2CW5A 3IC1A 3PB7X 1W9XA 1WSRA 4Z4SA 2BVNA 3PZJA 2ODFA 1IJFA 5D8NA 4C7IA 2ZW7A 2C5HA 2EWBA 3QFCA 2O4HA 2BGIA 1YX2A 1CX8A 4ZBGA 4P4EA 4AVCA 1QSOA 1GVHA 4P10A 4E8OA 3EXNA 3G6EB 3F0AA 3R96A 4XLFA 4ZCIA 4Z4UA 1VGYA 2B3UA 2CNMA 4XPDC 2POKA 3BJ7A 2G0BA 4A32A 1AMOA 2Z3MA 1OGJA 1LCPA 1VF7A 4Z65A 1ELMP 4MFQA 3B82A 1UD3A 3PBBA 3QSYA 1COWA 5KTCA 1QFJA 3IWEA 4FD5A 3I3GA 2YWHA 5G21A 2EBJA 3AVVA 1QVGB 2ZXIA 2HB6A 1H42A 4RD1A 2GJKA 3VR6A 2QA4B 1MRZA 4EH1A 2XEXA 4WWVA 2VNJA 5F48A 3T53B 4XN3A 1QUEA 5IB9A 1KK3A 3SKBA 4G5GA 4B43A 3CESA 2ZL7A 4NBSA 4MHZA 2V4DA 2F1MA 3AVTA 3TFYA 4XKVA 4G1BA 3ONYA 2BSAA 3ASRA 1EFCA 1KJZA 5IK2A 2C6GA 3SHPA 4M4SA 1KMHA 3WBJA 1FRNA 5HVHA 5K8MA 3JQRA 4TMTA 1YW4A 3ONUA 2GK6A 4OC0A 3WR7A 4A39A 4CPAA 3N5FA 4YAFA 4IW3B 4B10A 4MFPA 1NJID 1E43A 5F4OA 3OW2B 1WWZA 3A8JA 2HMAA 4Y49C 2X53S 4H9GA 2FCKA 4JZ0A 1ZG8A 2Q6KA 3FECA 2NPFA 3NA6A 3OE7A 1N0VC 1UFHA 1F57A 3W5VA 2NV4A 2B4DA 3FJOA 3KQXA 3MRUA 4K1XA 3FVLA 1ZG7A 1JQGA 1ZO0A 4NFRA 3V8IA 5J8CA 3OWCA 3ZZ0A 1IGBA 2R6HA 4KKUA 1GAWA 4ZX9A 1YJ9B 2GFQA 1GR1A 2A4NA 4B5OA 1IJEA 4X7DA 3FMCA 3TE4A 2ZXVA 2ZENA 3SXOA 4HNXB 2WJYA 1Z9UA 4MHYA 4XOTA 3D7FA 2JDDA 2HDNB 1H8HA 4U9UA 3WC5A 3D3SA 3Q38A 4LBVA 1UWYA 4JMQA 2VZLA 1CBXA 4B48A 2VI7A 4CYPA 3NH8A 2V7QA 3DDYA 1FNMA 2BV3A 2GJRA 4JWPA 4B13A 4KSIA 3R6JA 4FXUA 3GVLA 2GREA 4OPSA 2F43A 3A8KA 3RYOA 1V0CA 2EK8A 1B23P 3GY9A 4E2AA 1YVOA 2G9DA 4Q36A 1XE1A 1S4MA 2Q51A 1OB0A 3SJFA 3WC7A 2AFSA 1YHQB 2CC2A 2PJ0A 2PJ7A 2F5IA 1FY7A 1BX1A 2ZOFA 4JXRA 3F5BA 5EC4A 2C4UA 1E1QA 1Q9SA 3S6GA 4QUZA 1QG0A 1UMKA 4PC7A 5KTDA 2PJ5A 4K30A 2R1IA 4PK2A 3G8WA 1EXMA 5AGEA 3PB8X 5FIUA 3DR8A 2WR8A 5THXA 4RDJA 1PKVA 2X0KA 3PENA 3KL9A 4ZY2A 2REEA 4HPSA 3ZC3A 1P0HA 3OFNA 3D2MA 3VO1A 3FH4A 1NSLA 4CGMA 1BAVA 3IEHA 2Q6LA 5H59A 3ASPA 2OK8A 1JA1A 2V7TA 3TC8A 4MCRA 2JJ2A 2PVVA 1K8AD 3B78A 5HH1A 1VHOA 4U9YA 1G7SA 4CYNA 5J3OA 3CMAB 1F2PA 2B4BA 1S60A 2C5BA 2CTBA 1Z4RA 7CPAA 4P25A 3BY2A 3OZVA 5JBQA 3CCSB 2ZTNA 1VQPB 2ZZGA 2PVWA 3KR4A 4TN1A 1WORA 3ES9A 5TR9A 3SXNA 4UEFA 3DDDA 1OZPA 4LC0A 3H8EA 5DWMA 4MCPA 1ARMA 2Q7BA 3CW2A 2BOAA 4FUUA 1S72B 4DK1A 2EVNA 1XFOA 4KKSA 1EFTA 2VL1A 1Y0YA 3EFAA 3I55B 4WZKA 4GS4A 2CTCA 2XZOA 2V31A 1W0JA 3ZZIA 4UCMA 2C1CA 3OZWA 2XEJA 4JD6A 4BINA 3H4QA 3PRTA 1K9MD 3OAAA 4X7FA 1WU8A 1T6XA 2QE7A 1M4DA 1S0UA 1NSAA 2QN6A 2JJ1A 4RI1A 4KVXA 2YWFA 2VJJA 4P4IA 3VNUA 6CPAA 3R1KA 4YAOA 2YWEA 1Q82D 2OH1A 4CGNA 4NGTA 3KHZA 3SI1A 1QFYA 1R57A 4XD7A 2Z6BD 4TSFA 1IIDA 1NB9A 1GO2A 4RCYA 2CRVA 1BQEA 5DS0A 1E3ZA 1VQ5B 4NCZA 3TO6A 2WYRA 1VLYA 3FPKA 4CGPA 2I1LA 4OMEA 1F60A 4UCNA 3AGQA 2C27A 3DNSA 2ZZQA 1MJBA 5JPHA 4Y49B 5AN9A 1R5OA 2JDCA 4OC2A 3NE7A 2BM1A 3ASSA 2GIVA 4MXUA 5E96A 4HIZA 4AC9A 2PJBA 5TY0A 2X7BA 4F0YA 3E20A 4X8IA 3RAMA 2J8NA 3CCQB 4Z4RA 1I7PA 4XLHA 5C88A 4GQNA 1PCAA 2OU2A 2ZEMA 5K8PA 3RO0A 1K73D 2V7UA 5A8AA 1IOIA 1DDGA 2C2WA 3W2EA 2IQ6A 2PJ8A 3OEEA 1XF8A 4PPZA 1IYLA 2W6JA 1M44A 4TMVA 2OZUA 3ASQA 4FWTA 4WQMA 4OC1A 4F8ZA 1WOOA 3ZZTA 3S6HA 4CYOA 5LYFA 4ORFA 4NGNA 1YLOA 4UIAA 4AB7A 2WPDA 1AMPA 4CRZB 5AG4A 4YU9A 4R7MA 4Y9UA 4AVAA 3RBUA 5CPAA 1U2RA 4MFKA 4NJRA 3LQEA 1IICA 4A95A 3CCRB 4MYTA 1S7NA 3VARA 3A35A 1VIXA 4CAWA 2G3TA 1WOSA 4BBHA 3KR5A 2VBUA 5FA6A 1V0FA 1V5VA 5GV8A 2DEAA 3CXSA 4X0CA 1VHEA 2XNDA 2Z0ZA 4OIWA 3I56B 4RDLA 3FJUA 2ZBUA 5FL7A 4KLVA 4TWEA 4KUBA 2VNKA 1B87A 3CCMB 2F4NA 3VMFA 4RPBA 1RTQA 2FL4A 3CT9A 2JBJA 2FVGA 2QDXA 1KTVA 2RC6A 3IIBA 1NDHA 3H8FA 5FO1A 5IYRA 1NE9A 2JEVA 2YNCC 5J8FA 3KASA 2D3NA 2DIEA 4KUAA 4WZLA 4RS2A 3V7AA 4XPKA 3VO2A 3W2FA 2VBTA 2VZYA 1HA3A 1N8RD 3ZIAA 3AVXA 3ZZUA 3CXCB 5CDFA 5LYLA 3D67A 4OADA 2P0WA 5IB0A 3R9EA 4R3LA 3SJEA 1QGZA 4CAFA 4PQAA 1LANA 3H8GA 1KK0A 2AFOA 4ZGQB 1Y0RA 1SQHA 1S7KA 2ZEPA 4FD6A 1R5BA 4XMYA 1ZM2A 4H6ZA 1SKYB 1HDQA 2ZZFA 3CCJB 1B6BA 1KZFA 2C6PA 2P6GA 2RC5A 2OZGA 3TCVA 4YEJA 2C77A 3KI9A 2GK7A 5BSXA 4MI4A 3S9NA 4BPRA 3G71B 4QVTA 3FPPA 1YSJA 2CNTA 3H9NA 4XNHB 4CAXA 4CRYB 3BY1A 1ZM3A 4W9YA 5K8OA 5DWNA 4PABA 1M1DA 2D3LA 1U6MA 4EFDA 2Q44A 5LYIA 1YR0A 1WP6A 3D66A 2QIRA 5CBMA 4G7XA 4RLZA 2O53A 4JYWA 5LRGA 4B4DA 2PIAA 4RJLA 4XLEA 1KZLA 2XZPA 1Z2LA 4A94A 3R95A 1R43A 4MY0A 2P3MA 2VXKA 1DTDA 3GUXA 4KVOE 5HVFA 3TTHA 2PMDA 1RQPA 3QFSA 1YW6A 5HXDA 4BMHA 2ZELA 3D7HA 3AVUA 2IJZA 1YX0A 4OPOA 1FNCA 5KTAA 4R8FA 3LQ6A 2EO8A 2F1LA 4M6IA 4DJLA 3FEDA 4AG9A 3G3SA 1EWYA 2B3VA 4MRIA 4XORA 3T90A 3K9TA 5LRJA 2OR4A 4II9A 2QJ8A 2Q4VA 1T5EA 2GJPA 2Q43A 4ZGYB 1KK1A 3B8GA 3CD6B 4NEXA 4EMEA 4LBWA 5E6TA 3R9FA 1TIQA 4Z4VA 2B7CA 5G20A 1TKFA 4MJ8A 2GLFA 1FT7A 2F7VA 4UWJA 1S7LA 1SM4A 2FSRA 2BEIA 1TF9A 4R76A 4Q7JB 1YJWB 4A30A 5JQ4A 2CXAA 4PV6A 5A88A 4UEZA 1D2EA 2REFA 2FIAA 4OC4A 3PFOA 4QC6A 2RB7A 1GYTA 1OGIA 1N07A 4AF6A 2JLMA 3BH4A 3CZXA 2ZW4A 4I49A 3PFEA 3JQPA 1CP6A 3SLNA 4C43A 3IU1A 1V0EA 3F8KA 4XPDB 2PJCA 2D9RA 3PBEA 4UEEA 3IU2A 2ZXHA 4HNWB 1M4IA 3LVBA 2F8HA 2ZL5A 2V8VA 5A89A 1Z4EA 4KOSA 4P4FA 1S7FA 2HC9A 2HLDA 1Q81D 1VQ6B 1KK2A 2WPXA 4X05A 3OEHA 4DK0A 5EBVA 2ZL6A 2M5SA 3PA2A 4OOVA 4G1VA 4RM0A 4ZCLA 2VBQA 3VNVA 4RD6A 2PJAA 4UFVA 1DARA 1QVFB 5FVJA 5F4JA 3ZPNA 1N0UA 3KKWA 3OJWA 4QVAA 3GYAA 3CCVB 4WJBA 2CBXA 5G22A 1BX0A 4G6IA 4OC3A 5GV7A 2DPTA 5FO0A 4R87A 4F9VA 5F4MA 4PSXA 2VJIA 3TX8A 3EO4A 3SJGA 2RC4A 1VQ9B 2AJ6A 2R7HA 2FS5A 4YALA 4CYQA 3VWDA 2QMUA 2NMTA 4NJQA 2AHOA 1JNYA 3P27A 3V7ZA 2I79A 4P2NA 1TUIA 2PC1A 3Q6QA 1TKJA 1OHHA 2GANA 2GPJA 2BCOA 3PB4X 5DN6A 4OOSA 3RY8A 3WNCA 1IOFA 3PB6X 4DYOA 3UY5A 2XZLA 4F0XA 1KWMA 1H8LA 4WZTA 5LMZA 2I00A 2LZJA 3FB3A 3V38A 2R8VA 2PSWA 2BN4A 1EFUA 3RZAA 3T8WA 4X06A 2QGGA 4KSFA 2OBSA 1LOKA 3TT2A 3K9UA 3CP2A 4M53A 1I12A 3A9LA 1VHSA 2Q6IA 1R5NA 1K28D 2OK7A 1M90D 2P6FA 2OB0A 2AE6A 3C26A 2B58A 4C68A 2FE7A 1VQOB 2PIZA 3I1FA 3LD2A 1N06A 4X3RA 5HZBA 4DNCA 4RDKA 4YAUA 4H2KA 1Z8XA 1MABA 3CC2B 3AVWA 3QNVA 4NGSA 3BHXA 1P4MA 5I4MA 2ABZA 1QQ9A 2RFHA 2W6IA 5LYDA 2PJ6A 1YLEA 2QVPA 2O28A 3SLDA 3JUWA 4J3GA 3SJXA 4AXVA 1DDIA 2VEZA 4NCNA 4QFMA 2V8HA 5KNLA 3GLJA 2FIWA 4MHNA 4P3YA 1DG1G 4B5PA 1W34A 4QUSA 2X3UA 3FYNA 1QGYA 2KVOA 1G7RA 3QE2A 1IU8A 5K8NA 2V8DA 1Y9WA 3LNNA 4RCZA 4U5YA 1QH0A 4DUKA 4N3NA 1XE4A 4OKOA 4Z1MA 1HVXA 2B5GA 3MCAA 2D4PA 5F09A 4NGQA 4YGOA 1DE4C 1Q2YA 1K4JA 4LBYA 2ZEDA 4FBEA 4KS9A 4U9ZA 2QTLA 5BWAB 2PJ2A 1PUAA 4PC3A 4B3GA 4UZFA 4QB9A 2DOGA 3Q39A 4UFXA 1FNBA 1IB1E 2Z3OA 1BMFA 2WZNA 4P6VF 1A8PA 4ZY1A 3FRMA 4OP7A 4MHDA 2DF5A 3U2QA 1JA0A 1F2OA 3V76A 3IFEA 4M1KA 2HQYA 4PC6A 2CIJA 4DQKA 4OOXA 3OJXA 4EWTA 3WBKA 4B11A 3WNDA 2EIXA 5HMNA 4IK2A 1ON0A 1IB0A 2JEWA 1XMBA 4XLAA 1KRHA 4XOPA 4N3GA 4IUSA 2ZPAA 2ZEFA 4P1VA 3W5HA 3B2YA 2H5MA 2J7KA 1CPSA 4UIBA 2IMOA 1Y7RA 3P2FA 2EFGA 3SJPA 2Q04A 2XEGA 2Q4YA 4MCSA 4B3FX 1SKQA 4UBRA 5H84A 4NXYA 4G7WA 4MCQA 4KZTA 3E0KA 1OB2A 1HZEA 1CJWA 1ZG9A 4OP4A 1D1NA 1J9ZA 1AYEA 3SI0A 2AFWA 2D74A 2YWGA 3CMEB 3FEEA 3T56B 2D4OA 3CC7B 4TT3A 1WDTA 3BCDA 4Z4WA 3WQZA 1LFWA 3BI0A 3IJ3A 3KQZA 1W0KA 4P26A 1P4NA 2BM0A 3W2GA 1YMEA 2C4TA 4FD7A 3D4UA 4ZCMA 1WOPA 1H8EA 1Z5RA 3KZWA 4YFJA 3D2PA 4M85A 4KORA 4KOWA 1PJ5A 1KQSB 2PLFA 3DSBA 4RD2A 3FNCA 1T6ZA 3WYAA 3BC9A 3NH4A 4M2LA 1E1RA 1YITB 4P22A 1G7TA 1ZUNB 1UD2A 3SEJA 4UAJA 2JN9A 4Y9RA 4IF5A 3RNZA 2PRQA 3CTAA 3EC4A 4HE5A 5HZAA 2JBKA 1YREA 1ZM9A 1MK4A 4K3NA 4MFJA 4LUAA 1TTTA 1QSMA 1CQXA 1Y7EA 4PXBA 1JJ2B 1QGAA 4ZGNB 4R57A 2Z11A 1CNFA 3JQQA 2FT0A 4RPDA 4Q7AA 5HXBA 3CPWB 2DCUA 1UD5A 2OBTA 4P4JA 2PE3A 4P4BA 4PXEA 1QMUA 4KVME 2OZHA 1EP2B 2B7BA 4NGRA 4LX9A 4C7HA 2ZEEA 3W91A 1EP1B 1YJNB 5HKKA 2HCJB 2ZW5A 1WPCA 1VQKB 4XM3A 1YQEA 3JVNA 2OOTA 3DGVA 5IV0A 3E1YE 5KSWB 2DYIA 4ONWA 4L89A 3BQJA 1YK3A 3LACA 2QMLA 1D8TA 1IYKA 1XQBA 2ZBVA 1M1KD 5DSZA 3GVJA 4XQFA 1A2ZA 4XLCA 3B3WA 1Q2CA 3CC4B 3BCFA 2VNHA 2B4DB 4UZUA 1ELOA 1UD4A 3KGQA 4FWUA 5CNPA 2YNEA 4J0QA 1KC8D 3GB0A 3JTKA 2C6CA 3EY5A 3GVKA 5ISVA 1TLLA 2BL1A 4B5PB 1RO5A 4FN5A 3QAYA 3T9YA 5F46A 3FXTA 4YHBA 4Z4YA 5EMIA 1E79A 2CY2A 2XEIA 3IWWA 1S5KA 1FRQA 1N71A 3TOAA 3P26A 5JH9A 3G4SB 4TMZA 2XOKA 3GIUA 4RD4A 4QVJA 3WY9A 4TMWA 4BD9A 1GHEA 1M4LA 2WZPP 1PU9A 3GIRA 3FIXA 3CPAA 1YIJB 3MGDA 1NMTA 1ZLIA 4XPLA 4A37A 4NSQA 4X7EA 1VQ4B 2GU2A 4YRHA 2ZEGA 3BI1A 2Z3LA 3TO7A 4C2YA 3WNBA 4X2TA 1XMTA 4QBJA 4PK3A 3R9GA 5IX3A 2DERA 5AG7A 5H86A 3I1UA 3GQBA 3B3CA 3B3TA 2Z10A 3BLNA 1VKCA 2OBRA 2ZEHA 4KOUA 3ZJ0A 2QYVA 4UZEA 3B7IA 4YXWA 2HUZA 3KEWA 5H5JA 4XL9A 2VQYA 3B8HA 1N08A 4F7DA 5I0CA 3A3GA 3VH9A 2IL4A 3NFZA 3I9SA 1EFRA 2VYQA 4PC2A 3GKRA 3H5ZA 2V77A 4B47A 2G3AA 3B35A 5IYQA 3Q3AA 4P4DA 3K2KA 4OPVA 1HDUA 3IO1A 2PIYA 2BGJA 4PXDA 2PJ3A 1B2RA 1Z8WA 4B6ZA 1KUVA 4ZV4A 2FX3A 4CGLA 1H85A 1XIXA 4TNUA 3B3SA 2GQFA 4CAEA 4ACBA 3VATA 4MBUA 4X5KA 2FXFA 3S9LA 2PR1A 1J4JA 3VWEA 2BMWA 3D26A 5TRDA 4R71A 2OTLB 3W6XA 3WT4A 5BSYA 4XR6A 5J35A 3LODA 3BNWA 1VLOA 1OBRA 1N05A 1TKHA 4RUHA 5LRKA 4ROXA 2P6EA 4OAEA 4KSAA 2E1BA 2JIZA 3HAGA 4WZEA 4PAAA 1LAPA 2AFZA 3N7ZA 5L46A 2HV2A 3A8IA 3NE5B 3FBUA 3ASTA 1E64A 2DXQA 2EK9A 3FKSA 4II2A 4F9UA 1XBUA 1ZLHA 1ARLA 3GSIA 4MMOA 1E3XA 1NBMA 1YI2B 1I1DA 4HNYB 2WSAA 4MYUA 2K5TA 2GLJA 4DNRB 1S3ZA 4B12A 4TMXA 1OB5A 3OKXA 1EP3B 1PJ7A 3A1PA 1W2BB 3PVDA 2E1RA 4FK8A 4ACAA 2R9VA 3KHXA 2ZITA 3W5UA 5JGFA 1E62A 4M6HA 4P6YA 4ZYQA 3FX6A 2GE3A 4B14A 4NF1A 5C82A 4L8AA 4AVZA 5A28A 1RQRA 3DR6A 5HVGA 4JLYA 2QECA 1GAQA 3CCLB 3Q6RA 5B6IA 1KD1D 3S6KA 3D68A 1TVCA 1G7CA 1CM0A 1QSRA 5AG6A 1Z8TA 1UD6A 3MMPA 2PDOA 2PCUA 4UCPA 3MHPA 4KOVA 3SJZA 2R98A 4M0LA 2V7WA 4KOTA 4HKFA 4E0AA 3T51B 1JB9A 3AGPA 2DY1A 4YWYA 2J8MA 3PB9X 2YNDA 1CP7A 2AFUA 4P12A 5EMNA 2Z3NA 3OP1A 1XB2A 5KW9A 1JWQA 2Q0YA 2QEXB 3HUVA 3FF3A 2VNIA 4DNTB 4Z4ZA 3IWGA 4GXHA 1VQ8B 2BSWA 4GM5A 5JM6A 3P2HA 1R3NA 3A3BA 3JU4A 4KKTA 2DETA 2V7XA 2ARHA 4II3A 1QFZA 3W2IA 5F47A 1BOBA 3LWUA 2B5GB 3CXPA 3CP8A 1ZM4A 2OTJB 4OIDA 3PA1A 1AUGA 1W35A 1Q86D 2PJ9A 4OLLA 4KOXA 4R3KA 3DLJA 1RXTA 1I21A 4UF4A 2B5OA 2CNDA 3W2HA 4JJXA 4L8JA 3QFTA 4C2XA 5J1QA 3U6KA 4CAVA 4B3XA 4QHYA 5A27A 3TOBA 5IYWA 3LO8A 3HLPA 2AFXA 4ZI6A 4PC1A 1BPMA 3D8PA 2XNCA 1TF8A 1XRYA 4A38A 4AVBA 2Q6OA 2CF4A 3TO9A 1VQNB 4AG7A 1CNEA 4C2ZA 5TV2A 1PJ6A 4A31A
chains in the Genus database with same CATH topology
3GUXA 5HVFA 4KSIA 1TXRA 1YW6A 3NH4A 3S9MA 2ZELA 3D7HA 5HXDA 2ZEOA 2GREA 2IJZA 3ISZA 4R8FA 1PYTB 2EK8A 2PRQA 4DJLA 3FEDA 2G9DA 2JBKA 4MRIA 2Q51A 4K3NA 3WABA 3D7DA 3SJFA 1Y7EA 2AFSA 4PXBA 3WC7A 3K9TA 5LRJA 2PJ1A 2OR4A 2QJ8A 2PJ0A 2PJ7A 2Q43A 2ZOFA 4Q7AA 4EMEA 1ELLP 4P4JA 4G1PA 2PE3A 1LAMA 4P4BA 2PJ5A 4PXEA 1QMUA 3PB8X 1TKFA 2GLFA 1FT7A 2F7VA 4ZX8A 4NGRA 3L2NA 2ZEEA 2NYQA 3KL9A 1TF9A 4ZY2A 4R76A 1EE3P 2OOTA 3DGVA 4UEZA 1HEEA 4ONWA 3FH4A 2XEFA 4OC4A 3MN8A 1XJOA 3ISXA 1BAVA 3PFOA 1CPXA 3IEHA 2RB7A 3TC8A 4MCRA 1GYTA 2PVVA 1VHOA 3PFEA 4R6TA 3B3WA 1CP6A 3KGQA 1F2PA 4FWUA 2CTBA 2PJCA 7CPAA 3GB0A 3B3VA 3PBEA 4UEEA 2C6CA 2F8HA 4OC5A 2ANPA 2V8VA 4LQGA 3D7GA 2PVWA 3KR4A 4P4FA 2HC9A 4UEFA 5ELYA 2AFMA 2J9AA 2XEIA 3IWWA 3H8EA 4MCPA 1ARMA 2BOAA 4FUUA 5JH9A 1XFOA 3PEIA 2VL1A 1Y0YA 4PXCA 4O23A 2PJAA 2CTCA 4IHMA 4P45A 4P44A 4BD9A 1M4LA 2C1CA 3CPAA 2XEJA 4WJBA 4FAIA 4OC3A 3PRTA 3JRUA 1ZLIA 2NSMA 5D29A 3CDXA 4A37A 2PJ4A 4F9VA 3TX8A 1Z8LA 2GU2A 4NGMA 2ZEGA 3BI1A 3SJGA 2BO9A 4X2TA 1NSAA 4NJQA 4P4IA 3I1UA 6CPAA 3B3CA 3V7ZA 3B3TA 4NGTA 3KHZA 3SI1A 2ZEHA 1TKJA 2QYVA 3BXMA 3B7IA 3SI2A 2BCOA 3PB4X 5DS0A 3VH9A 2WYRA 3NFZA 1Q7LA 4OMEA 2V77A 3PB6X 4DYOA 3B35A 1KWMA 1H8LA 4P4DA 8CPAA 3K2KA 3V38A 4OC2A 1HDUA 3IO1A 3RZAA 3T8WA 2PIYA 1BLLE 1BPNA 1LOKA 2PJ3A 4PXDA 4ZY0A 4MXUA 4B6ZA 2PJBA 4TNUA 3B3SA 3VATA 4X8IA 3RAMA 3S9LA 2Q4ZA 1PCAA 2V8GA 3WT4A 2ZEMA 3NH5A 5K8PA 1IY7A 2PIZA 2I3CA 1OBRA 4X3RA 4IAVA 2IQ6A 2PJ8A 1TKHA 4H2KA 4RUHA 5LRKA 3CPXA 3LMSA 1FNOA 4NGSA 3QNVA 4PPZA 5THWA 1CG2A 4NGPA 1LAPA 2AFZA 3BHXA 2ZOGA 4MHPA 3WC6A 3IC1A 3PB7X 4OC1A 4F8ZA 5I4MA 2ABZA 5LYFA 4NGNA 1YLOA 1QQ9A 5D8NA 2RFHA 4UIAA 2EK9A 5LYDA 1AMPA 2PJ6A 4F9UA 1XBUA 2EWBA 1ZLHA 1ARLA 2O4HA 2QVPA 4YU9A 4MMOA 4R7MA 3SJXA 4AXVA 3RBUA 5CPAA 1CX8A 4NJRA 4P4EA 2GLJA 4P10A 2V8HA 3VARA 1VGYA 3GLJA 1VIXA 2POKA 4MHNA 3KR5A 3KHXA 1LCPA 2DEAA 4Z65A 5JGFA 1ELMP 1VHEA 3PBBA 5K8NA 4P6YA 4ZYQA 3FX6A 4OIWA 2V8DA 3FJUA 4TWEA 4DUKA 4OKOA 5HVGA 1RTQA 2HB6A 3CT9A 2JBJA 2FVGA 5F09A 4NGQA 3D68A 3IIBA 1DE4C 2ZEDA 4WWVA 3H8FA 4FBEA 2PJ2A 5IB9A 2PCUA 3KASA 4MHZA 4YWYA 2WZNA 4ZY1A 3PB9X 1CP7A 1F2OA 3IFEA 2AFUA 5LYLA 2C6GA 3D67A 2CIJA 3HUVA 5HVHA 4EWTA 5K8MA 1YW4A 4OC0A 4A39A 4IK2A 3FF3A 3SJEA 4CPAA 2JEWA 3N5FA 1XMBA 4PQAA 1LANA 5JM6A 4GM5A 3H8GA 2AFOA 2ZEFA 1R3NA 1Y0RA 3B2YA 2ZEPA 1CPSA 3LWUA 4UIBA 2IMOA 1ZG8A 4JZ0A 3NA6A 3FECA 1HDQA 4OIDA 1F57A 2C6PA 2XEGA 2PJ9A 3KQXA 4MCSA 3MRUA 3KI9A 3FVLA 3DLJA 1ZG7A 1JQGA 3S9NA 4NFRA 4UF4A 1YSJA 1IGBA 4MCQA 4ZX9A 4W9YA 5K8OA 5J1QA 1ZG9A 4OP4A 1AYEA 3SI0A 2AFWA 3FEEA 4EFDA 5LYIA 3FMCA 2ZENA 3HLPA 1LFWA 2AFXA 3BI0A 4ZI6A 3D66A 1BPMA 4MHYA 3D7FA 1TF8A 1XRYA 5CBMA 3IJ3A 4A38A 3KQZA 3WC5A 2O53A 4JYWA 5LRGA 2CF4A 1UWYA 1CBXA 1YMEA 1Z2LA 4A94A 3D4UA 3NH8A 1R43A 1Z5RA 3KZWA 1DTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GUX A;  5HVF A;  4KSI A;  1TXR A;  1YW6 A;  3NH4 A;  3S9M A;  2ZEL A;  3D7H A;  5HXD A;  2ZEO A;  2GRE A;  2IJZ A;  3ISZ A;  4R8F A;  1PYT B;  2EK8 A;  2PRQ A;  4DJL A;  3FED A;  2G9D A;  2JBK A;  4MRI A;  2Q51 A;  4K3N A;  3WAB A;  3D7D A;  3SJF A;  1Y7E A;  2AFS A;  4PXB A;  3WC7 A;  3K9T A;  5LRJ A;  2PJ1 A;  2OR4 A;  2QJ8 A;  2PJ0 A;  2PJ7 A;  2Q43 A;  2ZOF A;  4Q7A A;  4EME A;  1ELL P;  4P4J A;  4G1P A;  2PE3 A;  1LAM A;  4P4B A;  2PJ5 A;  4PXE A;  1QMU A;  3PB8 X;  1TKF A;  2GLF A;  1FT7 A;  2F7V A;  4ZX8 A;  4NGR A;  3L2N A;  2ZEE A;  2NYQ A;  3KL9 A;  1TF9 A;  4ZY2 A;  4R76 A;  1EE3 P;  2OOT A;  3DGV A;  4UEZ A;  1HEE A;  4ONW A;  3FH4 A;  2XEF A;  4OC4 A;  3MN8 A;  1XJO A;  3ISX A;  1BAV A;  3PFO A;  1CPX A;  3IEH A;  2RB7 A;  3TC8 A;  4MCR A;  1GYT A;  2PVV A;  1VHO A;  3PFE A;  4R6T A;  3B3W A;  1CP6 A;  3KGQ A;  1F2P A;  4FWU A;  2CTB A;  2PJC A;  7CPA A;  3GB0 A;  3B3V A;  3PBE A;  4UEE A;  2C6C A;  2F8H A;  4OC5 A;  2ANP A;  2V8V A;  4LQG A;  3D7G A;  2PVW A;  3KR4 A;  4P4F A;  2HC9 A;  4UEF A;  5ELY A;  2AFM A;  2J9A A;  2XEI A;  3IWW A;  3H8E A;  4MCP A;  1ARM A;  2BOA A;  4FUU A;  5JH9 A;  1XFO A;  3PEI A;  2VL1 A;  1Y0Y A;  4PXC A;  4O23 A;  2PJA A;  2CTC A;  4IHM A;  4P45 A;  4P44 A;  4BD9 A;  1M4L A;  2C1C A;  3CPA A;  2XEJ A;  4WJB A;  4FAI A;  4OC3 A;  3PRT A;  3JRU A;  1ZLI A;  2NSM A;  5D29 A;  3CDX A;  4A37 A;  2PJ4 A;  4F9V A;  3TX8 A;  1Z8L A;  2GU2 A;  4NGM A;  2ZEG A;  3BI1 A;  3SJG A;  2BO9 A;  4X2T A;  1NSA A;  4NJQ A;  4P4I A;  3I1U A;  6CPA A;  3B3C A;  3V7Z A;  3B3T A;  4NGT A;  3KHZ A;  3SI1 A;  2ZEH A;  1TKJ A;  2QYV A;  3BXM A;  3B7I A;  3SI2 A;  2BCO A;  3PB4 X;  5DS0 A;  3VH9 A;  2WYR A;  3NFZ A;  1Q7L A;  4OME A;  2V77 A;  3PB6 X;  4DYO A;  3B35 A;  1KWM A;  1H8L A;  4P4D A;  8CPA A;  3K2K A;  3V38 A;  4OC2 A;  1HDU A;  3IO1 A;  3RZA A;  3T8W A;  2PIY A;  1BLL E;  1BPN A;  1LOK A;  2PJ3 A;  4PXD A;  4ZY0 A;  4MXU A;  4B6Z A;  2PJB A;  4TNU A;  3B3S A;  3VAT A;  4X8I A;  3RAM A;  3S9L A;  2Q4Z A;  1PCA A;  2V8G A;  3WT4 A;  2ZEM A;  3NH5 A;  5K8P A;  1IY7 A;  2PIZ A;  2I3C A;  1OBR A;  4X3R A;  4IAV A;  2IQ6 A;  2PJ8 A;  1TKH A;  4H2K A;  4RUH A;  5LRK A;  3CPX A;  3LMS A;  1FNO A;  4NGS A;  3QNV A;  4PPZ A;  5THW A;  1CG2 A;  4NGP A;  1LAP A;  2AFZ A;  3BHX A;  2ZOG A;  4MHP A;  3WC6 A;  3IC1 A;  3PB7 X;  4OC1 A;  4F8Z A;  5I4M A;  2ABZ A;  5LYF A;  4NGN A;  1YLO A;  1QQ9 A;  5D8N A;  2RFH A;  4UIA A;  2EK9 A;  5LYD A;  1AMP A;  2PJ6 A;  4F9U A;  1XBU A;  2EWB A;  1ZLH A;  1ARL A;  2O4H A;  2QVP A;  4YU9 A;  4MMO A;  4R7M A;  3SJX A;  4AXV A;  3RBU A;  5CPA A;  1CX8 A;  4NJR A;  4P4E A;  2GLJ A;  4P10 A;  2V8H A;  3VAR A;  1VGY A;  3GLJ A;  1VIX A;  2POK A;  4MHN A;  3KR5 A;  3KHX A;  1LCP A;  2DEA A;  4Z65 A;  5JGF A;  1ELM P;  1VHE A;  3PBB A;  5K8N A;  4P6Y A;  4ZYQ A;  3FX6 A;  4OIW A;  2V8D A;  3FJU A;  4TWE A;  4DUK A;  4OKO A;  5HVG A;  1RTQ A;  2HB6 A;  3CT9 A;  2JBJ A;  2FVG A;  5F09 A;  4NGQ A;  3D68 A;  3IIB A;  1DE4 C;  2ZED A;  4WWV A;  3H8F A;  4FBE A;  2PJ2 A;  5IB9 A;  2PCU A;  3KAS A;  4MHZ A;  4YWY A;  2WZN A;  4ZY1 A;  3PB9 X;  1CP7 A;  1F2O A;  3IFE A;  2AFU A;  5LYL A;  2C6G A;  3D67 A;  2CIJ A;  3HUV A;  5HVH A;  4EWT A;  5K8M A;  1YW4 A;  4OC0 A;  4A39 A;  4IK2 A;  3FF3 A;  3SJE A;  4CPA A;  2JEW A;  3N5F A;  1XMB A;  4PQA A;  1LAN A;  5JM6 A;  4GM5 A;  3H8G A;  2AFO A;  2ZEF A;  1R3N A;  1Y0R A;  3B2Y A;  2ZEP A;  1CPS A;  3LWU A;  4UIB A;  2IMO A;  1ZG8 A;  4JZ0 A;  3NA6 A;  3FEC A;  1HDQ A;  4OID A;  1F57 A;  2C6P A;  2XEG A;  2PJ9 A;  3KQX A;  4MCS A;  3MRU A;  3KI9 A;  3FVL A;  3DLJ A;  1ZG7 A;  1JQG A;  3S9N A;  4NFR A;  4UF4 A;  1YSJ A;  1IGB A;  4MCQ A;  4ZX9 A;  4W9Y A;  5K8O A;  5J1Q A;  1ZG9 A;  4OP4 A;  1AYE A;  3SI0 A;  2AFW A;  3FEE A;  4EFD A;  5LYI A;  3FMC A;  2ZEN A;  3HLP A;  1LFW A;  2AFX A;  3BI0 A;  4ZI6 A;  3D66 A;  1BPM A;  4MHY A;  3D7F A;  1TF8 A;  1XRY A;  5CBM A;  3IJ3 A;  4A38 A;  3KQZ A;  3WC5 A;  2O53 A;  4JYW A;  5LRG A;  2CF4 A;  1UWY A;  1CBX A;  1YME A;  1Z2L A;  4A94 A;  3D4U A;  3NH8 A;  1R43 A;  1Z5R A;  3KZW A;  1DTD A; 
#chains in the Genus database with same CATH topology
 2PRB A;  2XGJ A;  4RD0 A;  1TXR A;  4XNF A;  4NNJ A;  1M4G A;  3S9M A;  2ZEO A;  4QV2 A;  4XN0 A;  3ISZ A;  1AIP A;  1L0C A;  1PYT B;  2JDI A;  3G05 A;  3PUN A;  2Q7S A;  1GJR A;  4MFZ A;  4ASU A;  4CGO A;  3WAB A;  3OOC A;  3D7D A;  3OW7 A;  3PUM A;  3W6S A;  4YAW A;  2PJ1 A;  1BJK A;  1WSV A;  4EVY A;  4LBZ A;  4YEL A;  3OPO A;  3ZBU A;  3CCU B;  1ELL P;  4MFL A;  5IYP A;  4AF7 A;  4RD3 A;  4G1P A;  2BPO A;  1BLI A;  1LAM A;  5GCN A;  4X7C A;  3CCE B;  4ZX8 A;  3QAH A;  4ONU A;  4UFW A;  2J8R A;  3L2N A;  2NYQ A;  1MJ9 A;  1VQM B;  3ZBT A;  1EE3 P;  1QX4 A;  1QST A;  3IGR A;  5G1Z A;  1FND A;  4X07 A;  3PP9 A;  4XON A;  1HEE A;  2WJV A;  2XEF A;  3MN8 A;  2V7V A;  3ISX A;  1XJO A;  1CPX A;  4PGO A;  2CK3 A;  4R9M A;  1YGH A;  3S6F A;  1UD8 A;  1FX0 A;  4R6T A;  4P3I A;  2X6W A;  4B44 A;  1I18 A;  1VJS A;  5FNZ A;  3QB8 A;  4CQJ A;  2ATR A;  3B3V A;  2PR8 A;  1F20 A;  3CB4 A;  1Q2D A;  1WK4 A;  4TKO B;  4XKW A;  1BO4 A;  2ZZE A;  1X12 A;  4DQL A;  1E63 A;  4Y7C A;  4OC5 A;  2ANP A;  3OZU A;  1W87 A;  2C78 A;  4LQG A;  3D7G A;  2Z3K A;  5AG5 A;  4A33 A;  1IHM A;  2OYN A;  2BUE A;  1QSN A;  3R6K A;  2YGW A;  2DEU A;  2X85 A;  2ZTG A;  2ZW6 A;  1VQL B;  5ELY A;  2AFM A;  2J9A A;  1X10 A;  3CMM A;  4Q38 A;  1NRK A;  2Z3P A;  3PEI A;  1Y9K A;  2VBV A;  4PXC A;  4O23 A;  1NB0 A;  4P9S A;  4IHM A;  4P45 A;  4C0S A;  4P44 A;  3CXQ A;  1XEB A;  1Q7Y D;  2VBS A;  4FAI A;  3JRU A;  4HE6 A;  2NSM A;  3CDX A;  5D29 A;  1KUY A;  2PJ4 A;  2CNS A;  4XNH C;  1Z8L A;  4NGM A;  4UA3 A;  4UWI A;  1T6Y A;  1BPL A;  1XOV A;  3CRZ A;  2BO9 A;  4Z4T A;  4H6U A;  2KCW A;  2WPW A;  2DPS A;  4M6G A;  4JXQ A;  1QUF A;  3ZUG A;  4F6A A;  4KLW A;  1VQ7 B;  4MY3 A;  4RN7 A;  3BXM A;  3BJ8 A;  1FDR A;  2BF4 A;  3H94 A;  3SI2 A;  3NE8 A;  1WTH D;  1Q7L A;  3WXM A;  1LRZ A;  2PQ8 A;  2WSS A;  4KOY A;  2X6Y A;  3U6B A;  8CPA A;  1KUX A;  3AVY A;  4A2Z A;  3QFR A;  3PGP A;  1BLL E;  1BPN A;  4ZY0 A;  2QTZ A;  2WUU A;  2EUI A;  3J81 k;  1YVK A;  2VZZ A;  4PSW A;  2Q4Z A;  2XNJ A;  2V8G A;  3NH5 A;  1IY7 A;  1MJA A;  2I3C A;  4CS0 B;  4IAV A;  4FD4 A;  5IYN A;  2X8K A;  2X6X A;  4M3S A;  3CPX A;  3LMS A;  4LQ6 A;  1FNO A;  5F49 A;  2Y0M A;  5THW A;  1CG2 A;  2YNC A;  4NGP A;  4H89 A;  2ZOG A;  4MHP A;  4E0F A;  3WC6 A;  1I8D A;  2CW5 A;  3IC1 A;  3PB7 X;  1W9X A;  1WSR A;  4Z4S A;  2BVN A;  3PZJ A;  2ODF A;  1IJF A;  5D8N A;  4C7I A;  2ZW7 A;  2C5H A;  2EWB A;  3QFC A;  2O4H A;  2BGI A;  1YX2 A;  1CX8 A;  4ZBG A;  4P4E A;  4AVC A;  1QSO A;  1GVH A;  4P10 A;  4E8O A;  3EXN A;  3G6E B;  3F0A A;  3R96 A;  4XLF A;  4ZCI A;  4Z4U A;  1VGY A;  2B3U A;  2CNM A;  4XPD C;  2POK A;  3BJ7 A;  2G0B A;  4A32 A;  1AMO A;  2Z3M A;  1OGJ A;  1LCP A;  1VF7 A;  4Z65 A;  1ELM P;  4MFQ A;  3B82 A;  1UD3 A;  3PBB A;  3QSY A;  1COW A;  5KTC A;  1QFJ A;  3IWE A;  4FD5 A;  3I3G A;  2YWH A;  5G21 A;  2EBJ A;  3AVV A;  1QVG B;  2ZXI A;  2HB6 A;  1H42 A;  4RD1 A;  2GJK A;  3VR6 A;  2QA4 B;  1MRZ A;  4EH1 A;  2XEX A;  4WWV A;  2VNJ A;  5F48 A;  3T53 B;  4XN3 A;  1QUE A;  5IB9 A;  1KK3 A;  3SKB A;  4G5G A;  4B43 A;  3CES A;  2ZL7 A;  4NBS A;  4MHZ A;  2V4D A;  2F1M A;  3AVT A;  3TFY A;  4XKV A;  4G1B A;  3ONY A;  2BSA A;  3ASR A;  1EFC A;  1KJZ A;  5IK2 A;  2C6G A;  3SHP A;  4M4S A;  1KMH A;  3WBJ A;  1FRN A;  5HVH A;  5K8M A;  3JQR A;  4TMT A;  1YW4 A;  3ONU A;  2GK6 A;  4OC0 A;  3WR7 A;  4A39 A;  4CPA A;  3N5F A;  4YAF A;  4IW3 B;  4B10 A;  4MFP A;  1NJI D;  1E43 A;  5F4O A;  3OW2 B;  1WWZ A;  3A8J A;  2HMA A;  4Y49 C;  2X53 S;  4H9G A;  2FCK A;  4JZ0 A;  1ZG8 A;  2Q6K A;  3FEC A;  2NPF A;  3NA6 A;  3OE7 A;  1N0V C;  1UFH A;  1F57 A;  3W5V A;  2NV4 A;  2B4D A;  3FJO A;  3KQX A;  3MRU A;  4K1X A;  3FVL A;  1ZG7 A;  1JQG A;  1ZO0 A;  4NFR A;  3V8I A;  5J8C A;  3OWC A;  3ZZ0 A;  1IGB A;  2R6H A;  4KKU A;  1GAW A;  4ZX9 A;  1YJ9 B;  2GFQ A;  1GR1 A;  2A4N A;  4B5O A;  1IJE A;  4X7D A;  3FMC A;  3TE4 A;  2ZXV A;  2ZEN A;  3SXO A;  4HNX B;  2WJY A;  1Z9U A;  4MHY A;  4XOT A;  3D7F A;  2JDD A;  2HDN B;  1H8H A;  4U9U A;  3WC5 A;  3D3S A;  3Q38 A;  4LBV A;  1UWY A;  4JMQ A;  2VZL A;  1CBX A;  4B48 A;  2VI7 A;  4CYP A;  3NH8 A;  2V7Q A;  3DDY A;  1FNM A;  2BV3 A;  2GJR A;  4JWP A;  4B13 A;  4KSI A;  3R6J A;  4FXU A;  3GVL A;  2GRE A;  4OPS A;  2F43 A;  3A8K A;  3RYO A;  1V0C A;  2EK8 A;  1B23 P;  3GY9 A;  4E2A A;  1YVO A;  2G9D A;  4Q36 A;  1XE1 A;  1S4M A;  2Q51 A;  1OB0 A;  3SJF A;  3WC7 A;  2AFS A;  1YHQ B;  2CC2 A;  2PJ0 A;  2PJ7 A;  2F5I A;  1FY7 A;  1BX1 A;  2ZOF A;  4JXR A;  3F5B A;  5EC4 A;  2C4U A;  1E1Q A;  1Q9S A;  3S6G A;  4QUZ A;  1QG0 A;  1UMK A;  4PC7 A;  5KTD A;  2PJ5 A;  4K30 A;  2R1I A;  4PK2 A;  3G8W A;  1EXM A;  5AGE A;  3PB8 X;  5FIU A;  3DR8 A;  2WR8 A;  5THX A;  4RDJ A;  1PKV A;  2X0K A;  3PEN A;  3KL9 A;  4ZY2 A;  2REE A;  4HPS A;  3ZC3 A;  1P0H A;  3OFN A;  3D2M A;  3VO1 A;  3FH4 A;  1NSL A;  4CGM A;  1BAV A;  3IEH A;  2Q6L A;  5H59 A;  3ASP A;  2OK8 A;  1JA1 A;  2V7T A;  3TC8 A;  4MCR A;  2JJ2 A;  2PVV A;  1K8A D;  3B78 A;  5HH1 A;  1VHO A;  4U9Y A;  1G7S A;  4CYN A;  5J3O A;  3CMA B;  1F2P A;  2B4B A;  1S60 A;  2C5B A;  2CTB A;  1Z4R A;  7CPA A;  4P25 A;  3BY2 A;  3OZV A;  5JBQ A;  3CCS B;  2ZTN A;  1VQP B;  2ZZG A;  2PVW A;  3KR4 A;  4TN1 A;  1WOR A;  3ES9 A;  5TR9 A;  3SXN A;  4UEF A;  3DDD A;  1OZP A;  4LC0 A;  3H8E A;  5DWM A;  4MCP A;  1ARM A;  2Q7B A;  3CW2 A;  2BOA A;  4FUU A;  1S72 B;  4DK1 A;  2EVN A;  1XFO A;  4KKS A;  1EFT A;  2VL1 A;  1Y0Y A;  3EFA A;  3I55 B;  4WZK A;  4GS4 A;  2CTC A;  2XZO A;  2V31 A;  1W0J A;  3ZZI A;  4UCM A;  2C1C A;  3OZW A;  2XEJ A;  4JD6 A;  4BIN A;  3H4Q A;  3PRT A;  1K9M D;  3OAA A;  4X7F A;  1WU8 A;  1T6X A;  2QE7 A;  1M4D A;  1S0U A;  1NSA A;  2QN6 A;  2JJ1 A;  4RI1 A;  4KVX A;  2YWF A;  2VJJ A;  4P4I A;  3VNU A;  6CPA A;  3R1K A;  4YAO A;  2YWE A;  1Q82 D;  2OH1 A;  4CGN A;  4NGT A;  3KHZ A;  3SI1 A;  1QFY A;  1R57 A;  4XD7 A;  2Z6B D;  4TSF A;  1IID A;  1NB9 A;  1GO2 A;  4RCY A;  2CRV A;  1BQE A;  5DS0 A;  1E3Z A;  1VQ5 B;  4NCZ A;  3TO6 A;  2WYR A;  1VLY A;  3FPK A;  4CGP A;  2I1L A;  4OME A;  1F60 A;  4UCN A;  3AGQ A;  2C27 A;  3DNS A;  2ZZQ A;  1MJB A;  5JPH A;  4Y49 B;  5AN9 A;  1R5O A;  2JDC A;  4OC2 A;  3NE7 A;  2BM1 A;  3ASS A;  2GIV A;  4MXU A;  5E96 A;  4HIZ A;  4AC9 A;  2PJB A;  5TY0 A;  2X7B A;  4F0Y A;  3E20 A;  4X8I A;  3RAM A;  2J8N A;  3CCQ B;  4Z4R A;  1I7P A;  4XLH A;  5C88 A;  4GQN A;  1PCA A;  2OU2 A;  2ZEM A;  5K8P A;  3RO0 A;  1K73 D;  2V7U A;  5A8A A;  1IOI A;  1DDG A;  2C2W A;  3W2E A;  2IQ6 A;  2PJ8 A;  3OEE A;  1XF8 A;  4PPZ A;  1IYL A;  2W6J A;  1M44 A;  4TMV A;  2OZU A;  3ASQ A;  4FWT A;  4WQM A;  4OC1 A;  4F8Z A;  1WOO A;  3ZZT A;  3S6H A;  4CYO A;  5LYF A;  4ORF A;  4NGN A;  1YLO A;  4UIA A;  4AB7 A;  2WPD A;  1AMP A;  4CRZ B;  5AG4 A;  4YU9 A;  4R7M A;  4Y9U A;  4AVA A;  3RBU A;  5CPA A;  1U2R A;  4MFK A;  4NJR A;  3LQE A;  1IIC A;  4A95 A;  3CCR B;  4MYT A;  1S7N A;  3VAR A;  3A35 A;  1VIX A;  4CAW A;  2G3T A;  1WOS A;  4BBH A;  3KR5 A;  2VBU A;  5FA6 A;  1V0F A;  1V5V A;  5GV8 A;  2DEA A;  3CXS A;  4X0C A;  1VHE A;  2XND A;  2Z0Z A;  4OIW A;  3I56 B;  4RDL A;  3FJU A;  2ZBU A;  5FL7 A;  4KLV A;  4TWE A;  4KUB A;  2VNK A;  1B87 A;  3CCM B;  2F4N A;  3VMF A;  4RPB A;  1RTQ A;  2FL4 A;  3CT9 A;  2JBJ A;  2FVG A;  2QDX A;  1KTV A;  2RC6 A;  3IIB A;  1NDH A;  3H8F A;  5FO1 A;  5IYR A;  1NE9 A;  2JEV A;  2YNC C;  5J8F A;  3KAS A;  2D3N A;  2DIE A;  4KUA A;  4WZL A;  4RS2 A;  3V7A A;  4XPK A;  3VO2 A;  3W2F A;  2VBT A;  2VZY A;  1HA3 A;  1N8R D;  3ZIA A;  3AVX A;  3ZZU A;  3CXC B;  5CDF A;  5LYL A;  3D67 A;  4OAD A;  2P0W A;  5IB0 A;  3R9E A;  4R3L A;  3SJE A;  1QGZ A;  4CAF A;  4PQA A;  1LAN A;  3H8G A;  1KK0 A;  2AFO A;  4ZGQ B;  1Y0R A;  1SQH A;  1S7K A;  2ZEP A;  4FD6 A;  1R5B A;  4XMY A;  1ZM2 A;  4H6Z A;  1SKY B;  1HDQ A;  2ZZF A;  3CCJ B;  1B6B A;  1KZF A;  2C6P A;  2P6G A;  2RC5 A;  2OZG A;  3TCV A;  4YEJ A;  2C77 A;  3KI9 A;  2GK7 A;  5BSX A;  4MI4 A;  3S9N A;  4BPR A;  3G71 B;  4QVT A;  3FPP A;  1YSJ A;  2CNT A;  3H9N A;  4XNH B;  4CAX A;  4CRY B;  3BY1 A;  1ZM3 A;  4W9Y A;  5K8O A;  5DWN A;  4PAB A;  1M1D A;  2D3L A;  1U6M A;  4EFD A;  2Q44 A;  5LYI A;  1YR0 A;  1WP6 A;  3D66 A;  2QIR A;  5CBM A;  4G7X A;  4RLZ A;  2O53 A;  4JYW A;  5LRG A;  4B4D A;  2PIA A;  4RJL A;  4XLE A;  1KZL A;  2XZP A;  1Z2L A;  4A94 A;  3R95 A;  1R43 A;  4MY0 A;  2P3M A;  2VXK A;  1DTD A;  3GUX A;  4KVO E;  5HVF A;  3TTH A;  2PMD A;  1RQP A;  3QFS A;  1YW6 A;  5HXD A;  4BMH A;  2ZEL A;  3D7H A;  3AVU A;  2IJZ A;  1YX0 A;  4OPO A;  1FNC A;  5KTA A;  4R8F A;  3LQ6 A;  2EO8 A;  2F1L A;  4M6I A;  4DJL A;  3FED A;  4AG9 A;  3G3S A;  1EWY A;  2B3V A;  4MRI A;  4XOR A;  3T90 A;  3K9T A;  5LRJ A;  2OR4 A;  4II9 A;  2QJ8 A;  2Q4V A;  1T5E A;  2GJP A;  2Q43 A;  4ZGY B;  1KK1 A;  3B8G A;  3CD6 B;  4NEX A;  4EME A;  4LBW A;  5E6T A;  3R9F A;  1TIQ A;  4Z4V A;  2B7C A;  5G20 A;  1TKF A;  4MJ8 A;  2GLF A;  1FT7 A;  2F7V A;  4UWJ A;  1S7L A;  1SM4 A;  2FSR A;  2BEI A;  1TF9 A;  4R76 A;  4Q7J B;  1YJW B;  4A30 A;  5JQ4 A;  2CXA A;  4PV6 A;  5A88 A;  4UEZ A;  1D2E A;  2REF A;  2FIA A;  4OC4 A;  3PFO A;  4QC6 A;  2RB7 A;  1GYT A;  1OGI A;  1N07 A;  4AF6 A;  2JLM A;  3BH4 A;  3CZX A;  2ZW4 A;  4I49 A;  3PFE A;  3JQP A;  1CP6 A;  3SLN A;  4C43 A;  3IU1 A;  1V0E A;  3F8K A;  4XPD B;  2PJC A;  2D9R A;  3PBE A;  4UEE A;  3IU2 A;  2ZXH A;  4HNW B;  1M4I A;  3LVB A;  2F8H A;  2ZL5 A;  2V8V A;  5A89 A;  1Z4E A;  4KOS A;  4P4F A;  1S7F A;  2HC9 A;  2HLD A;  1Q81 D;  1VQ6 B;  1KK2 A;  2WPX A;  4X05 A;  3OEH A;  4DK0 A;  5EBV A;  2ZL6 A;  2M5S A;  3PA2 A;  4OOV A;  4G1V A;  4RM0 A;  4ZCL A;  2VBQ A;  3VNV A;  4RD6 A;  2PJA A;  4UFV A;  1DAR A;  1QVF B;  5FVJ A;  5F4J A;  3ZPN A;  1N0U A;  3KKW A;  3OJW A;  4QVA A;  3GYA A;  3CCV B;  4WJB A;  2CBX A;  5G22 A;  1BX0 A;  4G6I A;  4OC3 A;  5GV7 A;  2DPT A;  5FO0 A;  4R87 A;  4F9V A;  5F4M A;  4PSX A;  2VJI A;  3TX8 A;  3EO4 A;  3SJG A;  2RC4 A;  1VQ9 B;  2AJ6 A;  2R7H A;  2FS5 A;  4YAL A;  4CYQ A;  3VWD A;  2QMU A;  2NMT A;  4NJQ A;  2AHO A;  1JNY A;  3P27 A;  3V7Z A;  2I79 A;  4P2N A;  1TUI A;  2PC1 A;  3Q6Q A;  1TKJ A;  1OHH A;  2GAN A;  2GPJ A;  2BCO A;  3PB4 X;  5DN6 A;  4OOS A;  3RY8 A;  3WNC A;  1IOF A;  3PB6 X;  4DYO A;  3UY5 A;  2XZL A;  4F0X A;  1KWM A;  1H8L A;  4WZT A;  5LMZ A;  2I00 A;  2LZJ A;  3FB3 A;  3V38 A;  2R8V A;  2PSW A;  2BN4 A;  1EFU A;  3RZA A;  3T8W A;  4X06 A;  2QGG A;  4KSF A;  2OBS A;  1LOK A;  3TT2 A;  3K9U A;  3CP2 A;  4M53 A;  1I12 A;  3A9L A;  1VHS A;  2Q6I A;  1R5N A;  1K28 D;  2OK7 A;  1M90 D;  2P6F A;  2OB0 A;  2AE6 A;  3C26 A;  2B58 A;  4C68 A;  2FE7 A;  1VQO B;  2PIZ A;  3I1F A;  3LD2 A;  1N06 A;  4X3R A;  5HZB A;  4DNC A;  4RDK A;  4YAU A;  4H2K A;  1Z8X A;  1MAB A;  3CC2 B;  3AVW A;  3QNV A;  4NGS A;  3BHX A;  1P4M A;  5I4M A;  2ABZ A;  1QQ9 A;  2RFH A;  2W6I A;  5LYD A;  2PJ6 A;  1YLE A;  2QVP A;  2O28 A;  3SLD A;  3JUW A;  4J3G A;  3SJX A;  4AXV A;  1DDI A;  2VEZ A;  4NCN A;  4QFM A;  2V8H A;  5KNL A;  3GLJ A;  2FIW A;  4MHN A;  4P3Y A;  1DG1 G;  4B5P A;  1W34 A;  4QUS A;  2X3U A;  3FYN A;  1QGY A;  2KVO A;  1G7R A;  3QE2 A;  1IU8 A;  5K8N A;  2V8D A;  1Y9W A;  3LNN A;  4RCZ A;  4U5Y A;  1QH0 A;  4DUK A;  4N3N A;  1XE4 A;  4OKO A;  4Z1M A;  1HVX A;  2B5G A;  3MCA A;  2D4P A;  5F09 A;  4NGQ A;  4YGO A;  1DE4 C;  1Q2Y A;  1K4J A;  4LBY A;  2ZED A;  4FBE A;  4KS9 A;  4U9Z A;  2QTL A;  5BWA B;  2PJ2 A;  1PUA A;  4PC3 A;  4B3G A;  4UZF A;  4QB9 A;  2DOG A;  3Q39 A;  4UFX A;  1FNB A;  1IB1 E;  2Z3O A;  1BMF A;  2WZN A;  4P6V F;  1A8P A;  4ZY1 A;  3FRM A;  4OP7 A;  4MHD A;  2DF5 A;  3U2Q A;  1JA0 A;  1F2O A;  3V76 A;  3IFE A;  4M1K A;  2HQY A;  4PC6 A;  2CIJ A;  4DQK A;  4OOX A;  3OJX A;  4EWT A;  3WBK A;  4B11 A;  3WND A;  2EIX A;  5HMN A;  4IK2 A;  1ON0 A;  1IB0 A;  2JEW A;  1XMB A;  4XLA A;  1KRH A;  4XOP A;  4N3G A;  4IUS A;  2ZPA A;  2ZEF A;  4P1V A;  3W5H A;  3B2Y A;  2H5M A;  2J7K A;  1CPS A;  4UIB A;  2IMO A;  1Y7R A;  3P2F A;  2EFG A;  3SJP A;  2Q04 A;  2XEG A;  2Q4Y A;  4MCS A;  4B3F X;  1SKQ A;  4UBR A;  5H84 A;  4NXY A;  4G7W A;  4MCQ A;  4KZT A;  3E0K A;  1OB2 A;  1HZE A;  1CJW A;  1ZG9 A;  4OP4 A;  1D1N A;  1J9Z A;  1AYE A;  3SI0 A;  2AFW A;  2D74 A;  2YWG A;  3CME B;  3FEE A;  3T56 B;  2D4O A;  3CC7 B;  4TT3 A;  1WDT A;  3BCD A;  4Z4W A;  3WQZ A;  1LFW A;  3BI0 A;  3IJ3 A;  3KQZ A;  1W0K A;  4P26 A;  1P4N A;  2BM0 A;  3W2G A;  1YME A;  2C4T A;  4FD7 A;  3D4U A;  4ZCM A;  1WOP A;  1H8E A;  1Z5R A;  3KZW A;  4YFJ A;  3D2P A;  4M85 A;  4KOR A;  4KOW A;  1PJ5 A;  1KQS B;  2PLF A;  3DSB A;  4RD2 A;  3FNC A;  1T6Z A;  3WYA A;  3BC9 A;  3NH4 A;  4M2L A;  1E1R A;  1YIT B;  4P22 A;  1G7T A;  1ZUN B;  1UD2 A;  3SEJ A;  4UAJ A;  2JN9 A;  4Y9R A;  4IF5 A;  3RNZ A;  2PRQ A;  3CTA A;  3EC4 A;  4HE5 A;  5HZA A;  2JBK A;  1YRE A;  1ZM9 A;  1MK4 A;  4K3N A;  4MFJ A;  4LUA A;  1TTT A;  1QSM A;  1CQX A;  1Y7E A;  4PXB A;  1JJ2 B;  1QGA A;  4ZGN B;  4R57 A;  2Z11 A;  1CNF A;  3JQQ A;  2FT0 A;  4RPD A;  4Q7A A;  5HXB A;  3CPW B;  2DCU A;  1UD5 A;  2OBT A;  4P4J A;  2PE3 A;  4P4B A;  4PXE A;  1QMU A;  4KVM E;  2OZH A;  1EP2 B;  2B7B A;  4NGR A;  4LX9 A;  4C7H A;  2ZEE A;  3W91 A;  1EP1 B;  1YJN B;  5HKK A;  2HCJ B;  2ZW5 A;  1WPC A;  1VQK B;  4XM3 A;  1YQE A;  3JVN A;  2OOT A;  3DGV A;  5IV0 A;  3E1Y E;  5KSW B;  2DYI A;  4ONW A;  4L89 A;  3BQJ A;  1YK3 A;  3LAC A;  2QML A;  1D8T A;  1IYK A;  1XQB A;  2ZBV A;  1M1K D;  5DSZ A;  3GVJ A;  4XQF A;  1A2Z A;  4XLC A;  3B3W A;  1Q2C A;  3CC4 B;  3BCF A;  2VNH A;  2B4D B;  4UZU A;  1ELO A;  1UD4 A;  3KGQ A;  4FWU A;  5CNP A;  2YNE A;  4J0Q A;  1KC8 D;  3GB0 A;  3JTK A;  2C6C A;  3EY5 A;  3GVK A;  5ISV A;  1TLL A;  2BL1 A;  4B5P B;  1RO5 A;  4FN5 A;  3QAY A;  3T9Y A;  5F46 A;  3FXT A;  4YHB A;  4Z4Y A;  5EMI A;  1E79 A;  2CY2 A;  2XEI A;  3IWW A;  1S5K A;  1FRQ A;  1N71 A;  3TOA A;  3P26 A;  5JH9 A;  3G4S B;  4TMZ A;  2XOK A;  3GIU A;  4RD4 A;  4QVJ A;  3WY9 A;  4TMW A;  4BD9 A;  1GHE A;  1M4L A;  2WZP P;  1PU9 A;  3GIR A;  3FIX A;  3CPA A;  1YIJ B;  3MGD A;  1NMT A;  1ZLI A;  4XPL A;  4A37 A;  4NSQ A;  4X7E A;  1VQ4 B;  2GU2 A;  4YRH A;  2ZEG A;  3BI1 A;  2Z3L A;  3TO7 A;  4C2Y A;  3WNB A;  4X2T A;  1XMT A;  4QBJ A;  4PK3 A;  3R9G A;  5IX3 A;  2DER A;  5AG7 A;  5H86 A;  3I1U A;  3GQB A;  3B3C A;  3B3T A;  2Z10 A;  3BLN A;  1VKC A;  2OBR A;  2ZEH A;  4KOU A;  3ZJ0 A;  2QYV A;  4UZE A;  3B7I A;  4YXW A;  2HUZ A;  3KEW A;  5H5J A;  4XL9 A;  2VQY A;  3B8H A;  1N08 A;  4F7D A;  5I0C A;  3A3G A;  3VH9 A;  2IL4 A;  3NFZ A;  3I9S A;  1EFR A;  2VYQ A;  4PC2 A;  3GKR A;  3H5Z A;  2V77 A;  4B47 A;  2G3A A;  3B35 A;  5IYQ A;  3Q3A A;  4P4D A;  3K2K A;  4OPV A;  1HDU A;  3IO1 A;  2PIY A;  2BGJ A;  4PXD A;  2PJ3 A;  1B2R A;  1Z8W A;  4B6Z A;  1KUV A;  4ZV4 A;  2FX3 A;  4CGL A;  1H85 A;  1XIX A;  4TNU A;  3B3S A;  2GQF A;  4CAE A;  4ACB A;  3VAT A;  4MBU A;  4X5K A;  2FXF A;  3S9L A;  2PR1 A;  1J4J A;  3VWE A;  2BMW A;  3D26 A;  5TRD A;  4R71 A;  2OTL B;  3W6X A;  3WT4 A;  5BSY A;  4XR6 A;  5J35 A;  3LOD A;  3BNW A;  1VLO A;  1OBR A;  1N05 A;  1TKH A;  4RUH A;  5LRK A;  4ROX A;  2P6E A;  4OAE A;  4KSA A;  2E1B A;  2JIZ A;  3HAG A;  4WZE A;  4PAA A;  1LAP A;  2AFZ A;  3N7Z A;  5L46 A;  2HV2 A;  3A8I A;  3NE5 B;  3FBU A;  3AST A;  1E64 A;  2DXQ A;  2EK9 A;  3FKS A;  4II2 A;  4F9U A;  1XBU A;  1ZLH A;  1ARL A;  3GSI A;  4MMO A;  1E3X A;  1NBM A;  1YI2 B;  1I1D A;  4HNY B;  2WSA A;  4MYU A;  2K5T A;  2GLJ A;  4DNR B;  1S3Z A;  4B12 A;  4TMX A;  1OB5 A;  3OKX A;  1EP3 B;  1PJ7 A;  3A1P A;  1W2B B;  3PVD A;  2E1R A;  4FK8 A;  4ACA A;  2R9V A;  3KHX A;  2ZIT A;  3W5U A;  5JGF A;  1E62 A;  4M6H A;  4P6Y A;  4ZYQ A;  3FX6 A;  2GE3 A;  4B14 A;  4NF1 A;  5C82 A;  4L8A A;  4AVZ A;  5A28 A;  1RQR A;  3DR6 A;  5HVG A;  4JLY A;  2QEC A;  1GAQ A;  3CCL B;  3Q6R A;  5B6I A;  1KD1 D;  3S6K A;  3D68 A;  1TVC A;  1G7C A;  1CM0 A;  1QSR A;  5AG6 A;  1Z8T A;  1UD6 A;  3MMP A;  2PDO A;  2PCU A;  4UCP A;  3MHP A;  4KOV A;  3SJZ A;  2R98 A;  4M0L A;  2V7W A;  4KOT A;  4HKF A;  4E0A A;  3T51 B;  1JB9 A;  3AGP A;  2DY1 A;  4YWY A;  2J8M A;  3PB9 X;  2YND A;  1CP7 A;  2AFU A;  4P12 A;  5EMN A;  2Z3N A;  3OP1 A;  1XB2 A;  5KW9 A;  1JWQ A;  2Q0Y A;  2QEX B;  3HUV A;  3FF3 A;  2VNI A;  4DNT B;  4Z4Z A;  3IWG A;  4GXH A;  1VQ8 B;  2BSW A;  4GM5 A;  5JM6 A;  3P2H A;  1R3N A;  3A3B A;  3JU4 A;  4KKT A;  2DET A;  2V7X A;  2ARH A;  4II3 A;  1QFZ A;  3W2I A;  5F47 A;  1BOB A;  3LWU A;  2B5G B;  3CXP A;  3CP8 A;  1ZM4 A;  2OTJ B;  4OID A;  3PA1 A;  1AUG A;  1W35 A;  1Q86 D;  2PJ9 A;  4OLL A;  4KOX A;  4R3K A;  3DLJ A;  1RXT A;  1I21 A;  4UF4 A;  2B5O A;  2CND A;  3W2H A;  4JJX A;  4L8J A;  3QFT A;  4C2X A;  5J1Q A;  3U6K A;  4CAV A;  4B3X A;  4QHY A;  5A27 A;  3TOB A;  5IYW A;  3LO8 A;  3HLP A;  2AFX A;  4ZI6 A;  4PC1 A;  1BPM A;  3D8P A;  2XNC A;  1TF8 A;  1XRY A;  4A38 A;  4AVB A;  2Q6O A;  2CF4 A;  3TO9 A;  1VQN B;  4AG7 A;  1CNE A;  4C2Z A;  5TV2 A;  1PJ6 A;  4A31 A; 
#chains in the Genus database with same CATH homology
 3GUX A;  5HVF A;  4KSI A;  1TXR A;  1YW6 A;  3NH4 A;  3S9M A;  2ZEL A;  3D7H A;  5HXD A;  2ZEO A;  2GRE A;  2IJZ A;  3ISZ A;  4R8F A;  1PYT B;  2EK8 A;  2PRQ A;  4DJL A;  3FED A;  2G9D A;  2JBK A;  4MRI A;  2Q51 A;  4K3N A;  3WAB A;  3D7D A;  3SJF A;  1Y7E A;  2AFS A;  4PXB A;  3WC7 A;  3K9T A;  5LRJ A;  2PJ1 A;  2OR4 A;  2QJ8 A;  2PJ0 A;  2PJ7 A;  2Q43 A;  2ZOF A;  4Q7A A;  4EME A;  1ELL P;  4P4J A;  4G1P A;  2PE3 A;  1LAM A;  4P4B A;  2PJ5 A;  4PXE A;  1QMU A;  3PB8 X;  1TKF A;  2GLF A;  1FT7 A;  2F7V A;  4ZX8 A;  4NGR A;  3L2N A;  2ZEE A;  2NYQ A;  3KL9 A;  1TF9 A;  4ZY2 A;  4R76 A;  1EE3 P;  2OOT A;  3DGV A;  4UEZ A;  1HEE A;  4ONW A;  3FH4 A;  2XEF A;  4OC4 A;  3MN8 A;  1XJO A;  3ISX A;  1BAV A;  3PFO A;  1CPX A;  3IEH A;  2RB7 A;  3TC8 A;  4MCR A;  1GYT A;  2PVV A;  1VHO A;  3PFE A;  4R6T A;  3B3W A;  1CP6 A;  3KGQ A;  1F2P A;  4FWU A;  2CTB A;  2PJC A;  7CPA A;  3GB0 A;  3B3V A;  3PBE A;  4UEE A;  2C6C A;  2F8H A;  4OC5 A;  2ANP A;  2V8V A;  4LQG A;  3D7G A;  2PVW A;  3KR4 A;  4P4F A;  2HC9 A;  4UEF A;  5ELY A;  2AFM A;  2J9A A;  2XEI A;  3IWW A;  3H8E A;  4MCP A;  1ARM A;  2BOA A;  4FUU A;  5JH9 A;  1XFO A;  3PEI A;  2VL1 A;  1Y0Y A;  4PXC A;  4O23 A;  2PJA A;  2CTC A;  4IHM A;  4P45 A;  4P44 A;  4BD9 A;  1M4L A;  2C1C A;  3CPA A;  2XEJ A;  4WJB A;  4FAI A;  4OC3 A;  3PRT A;  3JRU A;  1ZLI A;  2NSM A;  5D29 A;  3CDX A;  4A37 A;  2PJ4 A;  4F9V A;  3TX8 A;  1Z8L A;  2GU2 A;  4NGM A;  2ZEG A;  3BI1 A;  3SJG A;  2BO9 A;  4X2T A;  1NSA A;  4NJQ A;  4P4I A;  3I1U A;  6CPA A;  3B3C A;  3V7Z A;  3B3T A;  4NGT A;  3KHZ A;  3SI1 A;  2ZEH A;  1TKJ A;  2QYV A;  3BXM A;  3B7I A;  3SI2 A;  2BCO A;  3PB4 X;  5DS0 A;  3VH9 A;  2WYR A;  3NFZ A;  1Q7L A;  4OME A;  2V77 A;  3PB6 X;  4DYO A;  3B35 A;  1KWM A;  1H8L A;  4P4D A;  8CPA A;  3K2K A;  3V38 A;  4OC2 A;  1HDU A;  3IO1 A;  3RZA A;  3T8W A;  2PIY A;  1BLL E;  1BPN A;  1LOK A;  2PJ3 A;  4PXD A;  4ZY0 A;  4MXU A;  4B6Z A;  2PJB A;  4TNU A;  3B3S A;  3VAT A;  4X8I A;  3RAM A;  3S9L A;  2Q4Z A;  1PCA A;  2V8G A;  3WT4 A;  2ZEM A;  3NH5 A;  5K8P A;  1IY7 A;  2PIZ A;  2I3C A;  1OBR A;  4X3R A;  4IAV A;  2IQ6 A;  2PJ8 A;  1TKH A;  4H2K A;  4RUH A;  5LRK A;  3CPX A;  3LMS A;  1FNO A;  4NGS A;  3QNV A;  4PPZ A;  5THW A;  1CG2 A;  4NGP A;  1LAP A;  2AFZ A;  3BHX A;  2ZOG A;  4MHP A;  3WC6 A;  3IC1 A;  3PB7 X;  4OC1 A;  4F8Z A;  5I4M A;  2ABZ A;  5LYF A;  4NGN A;  1YLO A;  1QQ9 A;  5D8N A;  2RFH A;  4UIA A;  2EK9 A;  5LYD A;  1AMP A;  2PJ6 A;  4F9U A;  1XBU A;  2EWB A;  1ZLH A;  1ARL A;  2O4H A;  2QVP A;  4YU9 A;  4MMO A;  4R7M A;  3SJX A;  4AXV A;  3RBU A;  5CPA A;  1CX8 A;  4NJR A;  4P4E A;  2GLJ A;  4P10 A;  2V8H A;  3VAR A;  1VGY A;  3GLJ A;  1VIX A;  2POK A;  4MHN A;  3KR5 A;  3KHX A;  1LCP A;  2DEA A;  4Z65 A;  5JGF A;  1ELM P;  1VHE A;  3PBB A;  5K8N A;  4P6Y A;  4ZYQ A;  3FX6 A;  4OIW A;  2V8D A;  3FJU A;  4TWE A;  4DUK A;  4OKO A;  5HVG A;  1RTQ A;  2HB6 A;  3CT9 A;  2JBJ A;  2FVG A;  5F09 A;  4NGQ A;  3D68 A;  3IIB A;  1DE4 C;  2ZED A;  4WWV A;  3H8F A;  4FBE A;  2PJ2 A;  5IB9 A;  2PCU A;  3KAS A;  4MHZ A;  4YWY A;  2WZN A;  4ZY1 A;  3PB9 X;  1CP7 A;  1F2O A;  3IFE A;  2AFU A;  5LYL A;  2C6G A;  3D67 A;  2CIJ A;  3HUV A;  5HVH A;  4EWT A;  5K8M A;  1YW4 A;  4OC0 A;  4A39 A;  4IK2 A;  3FF3 A;  3SJE A;  4CPA A;  2JEW A;  3N5F A;  1XMB A;  4PQA A;  1LAN A;  5JM6 A;  4GM5 A;  3H8G A;  2AFO A;  2ZEF A;  1R3N A;  1Y0R A;  3B2Y A;  2ZEP A;  1CPS A;  3LWU A;  4UIB A;  2IMO A;  1ZG8 A;  4JZ0 A;  3NA6 A;  3FEC A;  1HDQ A;  4OID A;  1F57 A;  2C6P A;  2XEG A;  2PJ9 A;  3KQX A;  4MCS A;  3MRU A;  3KI9 A;  3FVL A;  3DLJ A;  1ZG7 A;  1JQG A;  3S9N A;  4NFR A;  4UF4 A;  1YSJ A;  1IGB A;  4MCQ A;  4ZX9 A;  4W9Y A;  5K8O A;  5J1Q A;  1ZG9 A;  4OP4 A;  1AYE A;  3SI0 A;  2AFW A;  3FEE A;  4EFD A;  5LYI A;  3FMC A;  2ZEN A;  3HLP A;  1LFW A;  2AFX A;  3BI0 A;  4ZI6 A;  3D66 A;  1BPM A;  4MHY A;  3D7F A;  1TF8 A;  1XRY A;  5CBM A;  3IJ3 A;  4A38 A;  3KQZ A;  3WC5 A;  2O53 A;  4JYW A;  5LRG A;  2CF4 A;  1UWY A;  1CBX A;  1YME A;  1Z2L A;  4A94 A;  3D4U A;  3NH8 A;  1R43 A;  1Z5R A;  3KZW A;  1DTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...