3ISXA

Crystal structure of endoglucanase (tm1050) from thermotoga maritima at 1.40 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
335
structure length
335
Chain Sequence
HHHHMKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase
publication title Crystal structure of Endoglucanase (TM1050) from THERMOTOGA MARITIMA at 1.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 104
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3isxA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3isxA01
3N5FA 1LAMA 5LYFA 1Z2LA 2EK8A 3KI9A 4GM5A 1XFOA 4ZYQA 5K8MA 1F2PA 4F8ZA 2ZEFA 3KQXA 4UEEA 3FMCA 1IGBA 2XEFA 2Q51A 1LAPA 2PJ2A 1FNOA 4P45A 1F57A 2RFHA 2Q4ZA 2NSMA 1Q7LA 3FF3A 2PIZA 3KHXA 3NH5A 4MCQA 3KQZA 4NJQA 3H8FA 4NGSA 4OC2A 1Y0YA 2PJ6A 3D68A 4ZY2A 5JM6A 2V8HA 3ISXA 3H8GA 4FBEA 4P6YA 4MCPA 2XEJA 4OKOA 1AMPA 4MHNA 5THWA 4EWTA 2HC9A 2GLFA 3NH8A 1CP7A 4TNUA 3VARA 1FT7A 5JH9A 3FH4A 5CPAA 3SI1A 1CBXA 4MHZA 1M4LA 3T8WA 4PXBA 3BI1A 2POKA 2XEGA 4NGMA 3NFZA 4Z65A 2V8DA 4OIWA 3IO1A 3BXMA 2GREA 1BPMA 4MMOA 4OC1A 4F9UA 2JBJA 4F9VA 3JRUA 2EK9A 3KHZA 3B3TA 4P4EA 5I4MA 1Y7EA 2C6CA 3LWUA 3VATA 3MRUA 1NSAA 2CTCA 2ZENA 2JBKA 4LQGA 2EWBA 4P4FA 5JGFA 2V8GA 3FVLA 4MHPA 4UIAA 3D66A 1YW4A 2NYQA 3B3WA 1CG2A 2ZEDA 4YU9A 3SJFA 3K2KA 1PCAA 2ZEEA 2WZNA 2CIJA 3B3SA 1OBRA 3VH9A 3HUVA 4A37A 4MCSA 1JQGA 3IFEA 2BO9A 4ZX9A 1TF8A 1Z5RA 3H8EA 1YW6A 4UIBA 2V8VA 1H8LA 5D29A 2AFMA 2PJ5A 2ZOFA 2FVGA 3SJXA 1YMEA 2PJCA 4OC0A 4CPAA 4OC4A 4TWEA 4WJBA 4X8IA 3B35A 3NA6A 5K8PA 4NGTA 1ZLHA 2AFWA 2QJ8A 2ZEPA 1PYTB 3PFEA 3IC1A 4P44A 3GLJA 4ZX8A 2RB7A 1ZLIA 1BPNA 3GUXA 2BOAA 3FEEA 3IIBA 4FAIA 5HVHA 2BCOA 2O53A 2C6GA 1TKJA 3IWWA 3WC5A 4R6TA 2ZELA 2AFXA 3PB4X 3WC6A 1ARMA 3PB9X 1TF9A 2ZOGA 3B2YA 8CPAA 4WWVA 3RBUA 4AXVA 2F8HA 5K8NA 3IJ3A 3CPXA 5K8OA 4P4JA 3BI0A 1KWMA 3GB0A 4P4IA 3PB7X 4EMEA 3PBBA 3KL9A 4EFDA 2PE3A 3L2NA 4W9YA 3WABA 4R7MA 1Z8LA 2ZEOA 1ZG9A 3SJGA 1DE4C 4NJRA 4NGPA 4R8FA 2I3CA 3B3VA 4UEZA 2PVWA 3K9TA 2PJ8A 2CTBA 1IY7A 1LFWA 4OP4A 3D7GA 3IEHA 3TX8A 4NGQA 4DYOA 2PJ1A 3PEIA 2PJAA 1VHEA 3CT9A 3TC8A 1QQ9A 4OIDA 1ELMP 1XMBA 4DJLA 2IQ6A 4G1PA 2QVPA 2O4HA 3CPAA 3KR4A 5HVFA 1AYEA 2AFZA 2G9DA 4MXUA 3D67A 2JEWA 4JZ0A 3PRTA 4P4BA 1UWYA 5CBMA 4BD9A 1CP6A 3HLPA 3PBEA 4A94A 3MN8A 3QNVA 1XBUA 4MRIA 5IB9A 3NH4A 1ARLA 1LANA 4Q7AA 4X3RA 2OOTA 1GYTA 2J9AA 3I1UA 1YSJA 7CPAA 4ZY0A 3SJEA 3D7FA 2CF4A 3V38A 4JYWA 4NGNA 4UEFA 3KZWA 4H2KA 3BHXA 1HDQA 1XRYA 3RAMA 1VIXA 1QMUA 2C6PA 4IHMA 3FJUA 3FEDA 4K3NA 2OR4A 1CPSA 4FUUA 4PXCA 3FX6A 3RZAA 3S9NA 4MCRA 2PCUA 3D7DA 2DEAA 4FWUA 5LRJA 5LYIA 1RTQA 3WC7A 2GLJA 2ABZA 4ZI6A 2ZEMA 4PXEA 1LCPA 4B6ZA 3D7HA 4IAVA 4A38A 2PIYA 2AFUA 2ZEHA 4P4DA 2XEIA 2AFOA 2PJBA 4OC5A 5LYLA 4ZY1A 1TXRA 5LRGA 3WT4A 4O23A 3B7IA 2V77A 5LYDA 3KASA 1LOKA 4NGRA 4DUKA 2QYVA 4ONWA 1XJOA 2WYRA 1Y0RA 4X2TA 2PJ9A 2PJ3A 4KSIA 3B3CA 2IMOA 1VHOA 2PJ4A 4PXDA 2ANPA 2PVVA 1ZG7A 4NFRA 2GU2A 1HEEA 1HDUA 2PRQA 1EE3P 1CPXA 4OMEA 4OC3A 3CDXA 3S9MA 2ZEGA 2PJ0A 3KR5A 1R43A 2AFSA 4MHYA 5HXDA 4UF4A 1R3NA 2HB6A 3FECA 3PB6X 3S9LA 5ELYA 3DLJA 4YWYA 5J1QA 5LRKA 3PB8X 5F09A 3LMSA 3SI2A 4P10A 3SI0A 1TKFA 1BLLE 4PQAA 3KGQA 2F7VA 4R76A 3PFOA 4A39A 5DS0A 2C1CA 4RUHA 2VL1A 2Q43A 1F2OA 5HVGA 1ZG8A 6CPAA 3DGVA 1TKHA 1BAVA 2PJ7A 3V7ZA 1VGYA 1YLOA 2IJZA 1DTDA 1CX8A 3ISZA 5D8NA 3D4UA 1ELLP 4IK2A 4PPZA
chains in the Genus database with same CATH superfamily
2HUZA 1Z2LA 1FY7A 3NE8A 5FA6A 3LODA 4KOVA 2F4NA 1XFOA 2YNDA 4NXYA 3G05A 3TOBA 2I00A 4MFKA 1IB0A 2ZEFA 5BSXA 4QUZA 4LC0A 1QVGB 4UEEA 3ASRA 2XEFA 1KJZA 1PU9A 2Q51A 2OZHA 1JB9A 2PJ2A 2VBUA 5E6TA 3NE5B 1WOSA 4C0SA 4ZV4A 2H5MA 2NSMA 2O28A 4XQFA 1NSLA 3JQQA 5FIUA 1VHSA 2XNJA 2Q6OA 4NJQA 4ZY2A 4FBEA 2D3LA 3HAGA 2R7HA 1M4GA 1AMPA 2WJYA 4AB7A 2HC9A 3ZZ0A 1W0JA 2PIAA 2JIZA 4GS4A 2D4PA 3FH4A 5CPAA 3SI1A 1CJWA 2A4NA 1U6MA 1M4LA 2PSWA 3SJPA 3BI1A 1FRQA 2XEGA 1QGAA 3NFZA 4OPOA 4RCZA 3SXOA 2V8DA 1Q2CA 1BPMA 3FYNA 4N3GA 4F9VA 3TE4A 3KHZA 2PLFA 5AG7A 4B43A 2OK8A 1M4IA 4FD7A 4AG9A 3MRUA 3GQBA 1NSAA 4FD4A 4KOUA 4LQGA 4KZTA 1KRHA 1Y7RA 1VQ7B 2V8GA 1V5VA 3GSIA 3D8PA 4UIAA 4DK0A 2Z3PA 1T6ZA 5G22A 2ARHA 3SJFA 3K2KA 4H89A 1PCAA 1V0EA 3Q38A 2WZNA 3WNCA 3T90A 1VLOA 2P0WA 1MABA 2Z0ZA 4R87A 4MCSA 1E1RA 2X53S 1RQPA 1N0UA 1QFYA 2ZW6A 4UIBA 1N71A 4C7HA 1VKCA 4ZBGA 3DR8A 4LQ6A 3W6SA 1PUAA 4YAUA 2ZOFA 4JMQA 2J8NA 2GPJA 1F20A 2PJCA 2FT0A 4OPVA 1LRZA 3CRZA 4B5PB 4TWEA 5F49A 3B35A 3NA6A 2FX3A 5G1ZA 3B82A 2QJ8A 4XLAA 4PABA 3TO6A 4P44A 4ZX8A 3GUXA 4RD6A 1Q7YD 2BOAA 4FAIA 1TTTA 2VBTA 5HVHA 2BCOA 1HZEA 4ACBA 1OGIA 1CNFA 1ARMA 3WYAA 2WJVA 1IOFA 2CY2A 3QFTA 3ZJ0A 1J4JA 5EMNA 5AG4A 4PSXA 1QGZA 2Z6BD 4UZFA 3I56B 3VNUA 1EFUA 3VR6A 5K8OA 4P4JA 4QC6A 2ATRA 3PB7X 2CRVA 3BY1A 4RD4A 2J7KA 5C82A 4PK2A 2ZZEA 2PE3A 5ISVA 4KLWA 3V8IA 3LACA 4R7MA 4TN1A 3DNSA 3CD6B 3S6FA 2XGJA 2PVWA 2QTLA 4XPDB 1EWYA 3PGPA 3D7GA 4Z4VA 2B3VA 3TX8A 4NGQA 2PJ1A 1VQ6B 4E2AA 4J3GA 1XE1A 1R5NA 3RNZA 5C88A 3FXTA 4MFQA 4OIDA 4QFMA 1KUVA 3ZZTA 3CC7B 2IQ6A 1E3XA 4G1PA 3KR4A 3LNNA 3A35A 3VWDA 4H9GA 1M4DA 1VQPB 3D67A 3GVLA 3CCMB 2JEWA 3PRTA 3JQRA 3CXCB 4P4BA 1UWYA 3QSYA 2JN9A 1CP6A 2DERA 5HKKA 2OBTA 3ASTA 1QUEA 4F6AA 3PBEA 3A9LA 3QNVA 2ZPAA 1LANA 1V0CA 1GYTA 2J9AA 4PK3A 2RC5A 4JXQA 4NEXA 2ZL7A 4II9A 3S6KA 2C4TA 2GJRA 2VNKA 1P4MA 1S5KA 3CZXA 4NGNA 3TFYA 2AJ6A 3CB4A 3RAMA 3U6BA 1GHEA 4M6GA 2C6PA 3ASQA 3FJUA 3FEDA 1OZPA 1B23P 1CPSA 1NBMA 1N8RD 4FUUA 3FX6A 4M1KA 2QEXB 5EBVA 2J8RA 4BMHA 5KTCA 4MCRA 1UD6A 4QV2A 3D7DA 2XEXA 4Z4RA 4FWUA 1EP3B 2R6HA 1RTQA 5IX3A 2G3TA 2RC4A 2GLJA 4PXEA 3BLNA 5TR9A 4B14A 4JLYA 4XM3A 3J81k 3OPOA 4B6ZA 3PA2A 2PIYA 3OEEA 1QGYA 4P22A 2HCJB 4KOSA 4P3IA 5G21A 4FWTA 1XOVA 2OZGA 5GCNA 3Q6QA 1YHQB 4HNWB 3PUMA 2CK3A 1QG0A 3WBJA 5LYDA 3IU2A 1K4JA 2D9RA 2WZPP 1LOKA 2VNHA 4E0FA 2OK7A 2WYRA 3SXNA 3B3CA 2IMOA 1OB5A 2P6FA 2PJ4A 3CXSA 1ZG7A 4RN7A 3OOCA 1HEEA 3H4QA 4F0YA 4OC3A 3EC4A 3S9MA 2AFSA 5FNZA 1NE9A 1ZM2A 1W0KA 4Z4ZA 4ZGNB 4BBHA 4WZKA 3OZUA 2PR8A 1DG1G 5ELYA 4B3FX 1YQEA 2C78A 3QFRA 2BM1A 1ZM3A 4B13A 4AG7A 4OLLA 4Z4WA 3PB8X 1S7FA 2PMDA 4P10A 4JXRA 4G7XA 4X7EA 1BLLE 3KGQA 3ZZUA 4TMTA 4R76A 4A39A 1KQSB 2GQFA 2C1CA 2Q4VA 4XNFA 2R1IA 3FPKA 1TKHA 1Q86D 3B8HA 3CCQB 3R6KA 2HMAA 5D8NA 3D4UA 1ELLP 4KKUA 4RJLA 2BM0A 4HNXB 1Z9UA 4XLHA 2EK8A 4TMZA 3KI9A 1IOIA 2VZLA 5K8MA 1X12A 2ZTGA 2YNCA 4JD6A 4M6IA 2QE7A 4H6ZA 4L8JA 4XMYA 3FMCA 1IGBA 4KUAA 4ONUA 1FNOA 4P45A 1D2EA 5CNPA 2RFHA 1WTHD 2XZLA 2X7BA 3FF3A 1IIDA 1VQNB 4X06A 4MCQA 4NGSA 4OC2A 4MFJA 3D68A 2V8HA 3H8GA 4MY0A 1PKVA 2XEJA 3OWCA 3GVJA 4MHNA 4A95A 3E0KA 4R3LA 1YR0A 4AVZA 4XPKA 3NH8A 4GQNA 2VYQA 5DN6A 5JH9A 2YNCC 1CBXA 3W5VA 1YITB 1KK2A 1KK0A 3G6EB 4X7CA 2DIEA 1N06A 1K8AD 3D2MA 1QSMA 1SQHA 3BCDA 1A8PA 1NMTA 2DPTA 4XORA 3QFSA 3IO1A 3BXMA 3CESA 4R71A 2Q7SA 1CNEA 4X7DA 4B47A 1KUYA 2BPOA 1S7NA 4B10A 2ZBUA 4WQMA 3LWUA 1Z8WA 2DOGA 1Q2DA 2ZENA 5A27A 2LZJA 3R1KA 4OOSA 1EFRA 4MFZA 1EP1B 4R57A 3V7AA 1FDRA 2DETA 4Y49C 2HLDA 3ZBUA 1S3ZA 3CW2A 4CYNA 2JDDA 1BPLA 3CP8A 3AGQA 2ODFA 4CAEA 3AGPA 2EIXA 2OYNA 2ZEEA 3JU4A 4YGOA 3E20A 1BX0A 4U9UA 3HUVA 4A37A 1UD3A 4AVBA 3BNWA 4C2YA 2VZZA 2BO9A 3IFEA 1TF8A 4M85A 3SLNA 1Z5RA 4LBZA 4MBUA 4UA3A 2HV2A 2Y0MA 4A32A 3OFNA 3CCLB 3E1YE 5F4MA 2BV3A 1H8LA 4RD2A 5D29A 1H8EA 4OPSA 2Q7BA 2AFMA 5AG6A 3LVBA 3CCEB 2FVGA 1YMEA 3EO4A 1VQ4B 3BY2A 1OB2A 3T53B 3A8KA 1VQ9B 1ZLHA 2AFWA 1H42A 4PGOA 3GYAA 5DWNA 4XOPA 3IC1A 5TV2A 4CYOA 5A89A 4LUAA 3CTAA 3GLJA 2RB7A 2AHOA 1G7CA 1Q9SA 1I1DA 4OAEA 3VWEA 3ONUA 2F1LA 4KOWA 2O53A 1QH0A 1TKJA 3IWWA 3SKBA 2ZELA 4TT3A 3PB9X 4R3KA 2ZOGA 8CPAA 2REFA 2Q6IA 5K8NA 4RDLA 4TMWA 3OJWA 1E1QA 3CPXA 3OZWA 1VQOB 2VZYA 4P2NA 3F8KA 4H6UA 2Q6LA 3W2IA 1JA1A 3OEHA 3K9UA 2EBJA 4XKVA 3DR6A 4EFDA 3L2NA 3SEJA 1RQRA 2CC2A 3WABA 1OGJA 4UWJA 2ZEOA 4TKOB 3LD2A 5TRDA 1VF7A 1VLYA 4NJRA 4F0XA 2D4OA 2KVOA 2I3CA 4KORA 3B3VA 1J9ZA 1NB9A 2PJ8A 5G20A 4OP4A 2WSSA 2XZPA 4NSQA 4DYOA 5EC4A 1M90D 4G7WA 2PJAA 1ZO0A 1FRNA 3WNBA 2GANA 4RD3A 1NRKA 1VHEA 1IU8A 3CT9A 5HXBA 3TCVA 4NF1A 4EH1A 5KTDA 4KSAA 5KTAA 2VNIA 3A8IA 2RC6A 3OKXA 1VQ8B 5A28A 2EVNA 2QVPA 2BVNA 4MFPA 2O4HA 5HVFA 4B4DA 1Z8XA 4OADA 2AFZA 4KKSA 3D3SA 1Y9WA 3BJ7A 5I0CA 3Q39A 4CAVA 4A94A 1MRZA 1XBUA 3I55B 3NH4A 2R8VA 3DDDA 4X3RA 1W34A 1YSJA 7CPAA 4NNJA 1P4NA 3SJEA 1E43A 2CF4A 4ZGQB 1W35A 2V7UA 2YWFA 2FE7A 4JWPA 3KZWA 2QGGA 4XPLA 1WK4A 4AVAA 4B3XA 1VIXA 1WSRA 1QMUA 4K1XA 3P2HA 2VEZA 2WPXA 4IHMA 3QAHA 1AUGA 1S4MA 4RDJA 4KVME 4PXCA 3H5ZA 3RZAA 1RXTA 2I1LA 1YVOA 2CNTA 3F5BA 5E96A 1AIPA 1VQ5B 5LYIA 2HDNB 3R9FA 3CCSB 4PSWA 1E64A 3SJZA 4XR6A 2FL4A 4TSFA 3D7HA 1YIJB 4YXWA 3I1FA 1TUIA 1IB1E 2AFUA 4P4DA 4B44A 4ZCMA 2XEIA 4G1BA 1E63A 3TTHA 3PZJA 4K30A 3MMPA 1WORA 4ZY1A 3TO9A 1SKQA 5LRGA 4Q36A 4O23A 3FJOA 2V77A 2PRBA 4HKFA 3DDYA 1COWA 3S6HA 3CCUB 4DUKA 4C2XA 2FSRA 4LBYA 4X2TA 5BSYA 1YJWB 3WNDA 4PXDA 2PVVA 1YLEA 2GU2A 4CGNA 1CM0A 2Z3NA 1CPXA 3VMFA 2NV4A 2ZEGA 3CPWB 2PJ0A 4MY3A 4MHYA 1Z4EA 4KUBA 4DQLA 1KTVA 5J35A 3S9LA 4Z4TA 4P6VF 3BH4A 5LRKA 2XZOA 5FO1A 2X8KA 4J0QA 1QUFA 3LMSA 3S6GA 1YI2B 3P27A 2ZXVA 2R98A 1KZFA 4TMVA 3CC4B 1VQMB 4PQAA 4DNRB 4MI4A 2F7VA 4UFVA 2IL4A 1EXMA 3OW2B 1UFHA 4PC7A 4YALA 2V4DA 2ZXHA 4RUHA 2OTLB 2VL1A 5HVGA 3WQZA 3EXNA 1W2BB 2P3MA 2OZUA 3V7ZA 1D8TA 2VJIA 1M44A 3ISZA 4MYTA 4IK2A 3AVXA 4PPZA 3KKWA 3QAYA 1T6YA 3W91A 4ZYQA 3JTKA 2QTZA 1DDIA 2Q4YA 3FRMA 1DARA 3ONYA 3KQXA 2XOKA 3OP1A 3JQPA 4QVAA 2DEUA 1MJBA 5F48A 2EFGA 1I7PA 2Q4ZA 2YWHA 1R57A 4LX9A 1U2RA 1KK1A 2PIZA 3KHXA 3NH5A 4ROXA 3KQZA 4KSFA 3H8FA 4Y49B 4U5YA 4P6YA 1N08A 1G7SA 4NBSA 4MCPA 4A33A 2X3UA 5IYNA 4C7IA 1BQEA 4EWTA 4YRHA 5A88A 1H8HA 3CCVB 3W2EA 4QB9A 5AG5A 1CP7A 4KS9A 4TNUA 3VARA 1W87A 1FT7A 2ZL6A 3AVUA 2C5HA 4MHZA 4XNHC 3ASPA 3T8WA 1VJSA 5HMNA 2FCKA 3BJ8A 1GJRA 2V7WA 2ZW5A 4Z65A 4YEJA 4P3YA 4UAJA 4JJXA 4OIWA 3OZVA 2Q6KA 2GREA 4MMOA 1K28D 5H84A 2D74A 3AVVA 4B5OA 2EK9A 4P4EA 5I4MA 1Y7EA 1IJFA 4DNTB 3F0AA 2C6CA 3VATA 5JQ4A 2CTCA 4RS2A 1XF8A 2JBKA 1NDHA 2DYIA 2EWBA 5FO0A 4P4FA 1N07A 4E8OA 2OTJB 4RLZA 5IB0A 1XE4A 1HA3A 2V7XA 4FN5A 2XNCA 1B87A 1E3ZA 3R96A 1CG2A 2ZEDA 4YU9A 1QX4A 4M3SA 4CRZB 3WY9A 3W2GA 4RD0A 1OBRA 3VH9A 2VBQA 2Z3LA 4XD7A 1I12A 3CCJB 2F43A 1JQGA 3WR7A 3VO2A 3H8EA 4CAWA 1FX0A 3NE7A 2EUIA 2WPWA 2V8VA 3TO7A 2OU2A 3H94A 4AF6A 4HE6A 2PJ5A 2FXFA 3CMEB 4G5GA 2CBXA 1Z4RA 3SJXA 4GXHA 4MJ8A 4FK8A 2VI7A 3EFAA 1Y9KA 4CPAA 2C4UA 1QSTA 4OC4A 2W6JA 4X07A 3T9YA 5K8PA 1I18A 4MFLA 4NGTA 2ZEPA 3RY8A 5LMZA 1FNDA 3MCAA 1ZLIA 3QB8A 2OBSA 5BWAB 1FNCA 1M1KD 1NB0A 2DCUA 2YGWA 1B2RA 2ZL5A 4P26A 2C6GA 3ES9A 4R6TA 2AFXA 3PB4X 4Y9RA 3WC6A 3H9NA 1Z8TA 3GIUA 3B2YA 2W6IA 4CGPA 1GAQA 4TMXA 4B12A 4HPSA 1S60A 1EFCA 4XLFA 4WWVA 4KOTA 4AXVA 1N05A 2F8HA 4KKTA 4B3GA 1F60A 5IYQA 1EFTA 1E62A 4DNCA 1CQXA 1YX0A 4HE5A 1AMOA 3I3GA 3GB0A 4P4IA 3PBBA 3KL9A 1BOBA 5KSWB 1FNMA 2CNDA 2CW5A 4W9YA 3GY9A 1JNYA 2BSWA 1Z8LA 1ELOA 1ZG9A 4XOTA 1DE4C 4QUSA 4NGPA 2JDIA 4R8FA 2Q44A 1UD2A 4U9ZA 3Q3AA 4Z1MA 3SHPA 3K9TA 2CTBA 1LFWA 4AF7A 2DY1A 1WWZA 1S7KA 3IEHA 4CRYB 3PEIA 1YVKA 1G7TA 4YAWA 3TC8A 2FIWA 1QQ9A 4AVCA 1ELMP 4A30A 4CGOA 2GIVA 3R9EA 3CPAA 4M53A 4MXUA 4JZ0A 3EY5A 5CBMA 4BD9A 1JJ2B 4QVJA 4CGMA 3HLPA 5HH1A 3OAAA 2QA4B 4QBJA 3IU1A 2ZITA 2OOTA 1XIXA 3I1UA 4EVYA 1WPCA 1H85A 4PV6A 2ZXIA 3CMMA 2BGIA 2CNMA 3TT2A 4II2A 3V38A 4KOYA 4JYWA 1BMFA 1TIQA 4L89A 4UFXA 4A2ZA 5IYWA 1XRYA 4WZLA 3U6KA 3B78A 3W5UA 4YELA 1NJID 3CMAB 5H59A 3T51B 1PJ7A 3G8WA 4N3NA 4XL9A 5TY0A 4FXUA 1YX2A 2PCUA 3ZC3A 2HQYA 2NMTA 5LRJA 2KCWA 1Q82D 4ZCLA 4ZI6A 2BL1A 4ZGYB 1BX1A 1L0CA 2WUUA 4IAVA 3P2FA 3V76A 1M1DA 4A38A 5L46A 2VNJA 2E1RA 2ZEHA 3VNVA 3JVNA 4R9MA 2FIAA 5GV8A 2OBRA 4FD5A 3PENA 5F47A 2DXQA 4HNYB 1UD5A 5H86A 5LYLA 3PVDA 3B7IA 4G1VA 3KASA 4NGRA 4ONWA 1B6BA 4OP7A 1Y0RA 1BO4A 2PJ9A 4RI1A 2PJ3A 3Q6RA 4UBRA 3FPPA 4IUSA 4OOVA 4F7DA 2C2WA 3A3GA 3CP2A 5JBQA 4PC6A 3IWGA 2DF5A 4NFRA 1DDGA 2QMLA 1V0FA 1KZLA 2ZZFA 1EE3P 4Z4UA 4OMEA 4CS0B 1W9XA 2ZW4A 1JWQA 1HVXA 5HXDA 4UF4A 5AGEA 5EMIA 4Z4YA 1R3NA 2HB6A 3G4SB 3PUNA 3BC9A 4QVTA 2QECA 1ZM9A 1BJKA 4PC3A 5J1QA 3VO1A 1SKYB 1SM4A 4XKWA 1G7RA 4HIZA 3SI2A 1BLIA 4CYPA 4RM0A 2YWEA 2E1BA 1QFZA 4XN0A 5DS0A 1QVFB 2OH1A 2WSAA 1MJAA 1OB0A 3DGVA 3P26A 1WP6A 2PJ7A 3OW7A 3IGRA 1YLOA 2IJZA 3CCRB 1CX8A 2VJJA 3WBKA 1IICA 4CAFA 4XNHB 4XLCA 4M2LA 2YNEA 3N5FA 1LAMA 5LYFA 2GJKA 4GM5A 4Z4SA 1VQKB 2BMWA 1F2PA 4F8ZA 2PQ8A 1XB2A 1GVHA 1UD4A 4II3A 1LAPA 1T6XA 4G6IA 5FVJA 4LBVA 1F57A 1WU8A 3I9SA 1Q7LA 2VXKA 2V7TA 1OHHA 3MGDA 3AVTA 1S72B 1Y0YA 2X0KA 2PJ6A 5JM6A 1EP2B 2B3UA 3ISXA 3CXPA 3ZZIA 5JPHA 2EO8A 1IHMA 2GK7A 4IF5A 4OKOA 4RD1A 5THWA 4RCYA 4P25A 2BGJA 1KD1D 2GLFA 1Q2YA 4UCMA 1S0UA 3RYOA 4B48A 1UD8A 4YAFA 4L8AA 3IWEA 3G3SA 2JJ1A 4PXBA 2ZBVA 2POKA 4NGMA 4ACAA 4B11A 1UMKA 3R6JA 3ZPNA 3RO0A 3W6XA 4OC1A 2GK6A 4F9UA 2JBJA 2CXAA 3JRUA 4RPBA 2GJPA 3B3TA 4DK1A 5B6IA 4RDKA 4NCZA 5JGFA 4MHDA 3FVLA 4MHPA 1YJNB 1KUXA 1ON0A 4X05A 4CQJA 3D66A 1YW4A 2NYQA 3B3WA 2ZW7A 1KK3A 2B5OA 4QHYA 2CIJA 3BCFA 3B3SA 2QDXA 2JDCA 3B8GA 5A8AA 4YAOA 4ZX9A 2P6GA 3PP9A 4WZTA 1YK3A 2D3NA 2QMUA 1YW6A 1E79A 2I79A 5F4JA 4I49A 4C68A 1QSRA 1QSOA 2B7CA 2ZZGA 2B5GB 1A2ZA 2Z11A 4Y7CA 5KW9A 3ZUGA 4OC0A 1R5OA 4XONA 1P0HA 3GIRA 4WJBA 4X8IA 4PC2A 1MJ9A 2ZTNA 5DWMA 2WPDA 2AE6A 1I21A 1PYTB 4YHBA 3PFEA 4P9SA 1K9MD 4B5PA 4IW3B 3W2HA 1BPNA 4CYQA 2J8MA 2B4BA 2JJ2A 2B4DB 1Q81D 3FEEA 3IIBA 2P6EA 4AC9A 3WC5A 2GE3A 1WDTA 4UFWA 2PR1A 2PDOA 4Q7JB 2BEIA 4X7FA 1TF9A 2Q0YA 3W2FA 3AVWA 2JEVA 4Y9UA 4P12A 1MK4A 2QN6A 3RBUA 4BINA 5J8CA 3ZBTA 4UZUA 4U9YA 3IJ3A 2M5SA 2GFQA 3ZIAA 4M0LA 3BI0A 1KWMA 4Q38A 4EMEA 2F1MA 3ASSA 4KVOE 4XN3A 2Z3MA 3PA1A 1YGHA 3SJGA 2YWGA 3T56B 1T5EA 1IJEA 4UEZA 3FNCA 2X85A 2G3AA 5HZAA 5J3OA 4YFJA 1IY7A 2F5IA 4ASUA 4XLEA 3JUWA 4A31A 4MYUA 1WOPA 5IYRA 5H5JA 1XQBA 3FKSA 2B7BA 4BPRA 1PJ5A 1XMBA 4DJLA 3FBUA 4M6HA 2Z10A 5F4OA 1AYEA 5KNLA 3FIXA 1TVCA 2G9DA 3GVKA 5CDFA 2G0BA 5FL7A 2BF4A 1FNBA 3U2QA 2C5BA 4WZEA 1ZM4A 2XNDA 4M4SA 1GAWA 2BUEA 4ORFA 3LQ6A 4ZCIA 1R5BA 1GO2A 2X6YA 3MN8A 1D1NA 4MRIA 5IB9A 1ARLA 4Q7AA 1RO5A 2DPSA 4X5KA 4RPDA 4ZY0A 3GKRA 4NCNA 3D7FA 4KLVA 2C27A 3SLDA 2R9VA 3LQEA 4UEFA 4XPDC 4H2KA 5J8FA 3BHXA 1HDQA 2B5GA 1XMTA 5AN9A 3D26A 4C43A 2BN4A 4K3NA 2OR4A 4UWIA 3S9NA 3CXQA 4DQKA 5HZBA 5IV0A 2X6XA 1IYLA 1VQLB 2DEAA 5IYPA 1ZUNB 4KVXA 2B4DA 3WC7A 2ABZA 2BSAA 2QIRA 2ZEMA 4CAXA 1LCPA 3KEWA 2K5TA 3WXMA 3A3BA 3QE2A 4UCPA 4KOXA 2ZZQA 4OOXA 2AFOA 2PJBA 5THXA 3C26A 1WSVA 4OC5A 4X0CA 2JLMA 4LBWA 1TXRA 1S7LA 3R95A 3G71B 3WT4A 1I8DA 4P1VA 5F46A 3OE7A 4FD6A 1QSNA 2Z3KA 1YREA 1K73D 5DSZA 2QYVA 3R9GA 1XJOA 1QFJA 2WR8A 1JA0A 4UZEA 4KSIA 4C2ZA 1KMHA 3FB3A 1VHOA 5GV7A 1IYKA 2ANPA 3W5HA 3D2PA 4PC1A 1HDUA 2PRQA 4UCNA 1YJ9B 2PC1A 3UY5A 3CDXA 3KR5A 1XEBA 3QFCA 1R43A 3TOAA 3AVYA 3N7ZA 3DSBA 3FECA 3PB6X 1TLLA 3BQJA 2NPFA 1GR1A 3DLJA 4YWYA 1PJ6A 2REEA 2VBVA 4E0AA 2V7QA 3A1PA 5F09A 2X6WA 1X10A 2CNSA 2Q04A 3SI0A 1TKFA 4CGLA 5IK2A 2V7VA 3PFOA 3CC2B 2V31A 3LO8A 3A8JA 2B58A 2Q43A 1KC8D 1F2OA 1ZG8A 4PAAA 6CPAA 2OB0A 3MHPA 1WOOA 2C77A 1BAVA 1VGYA 3OJXA 1DTDA 2VBSA 1N0VC 2VQYA 2Z3OA 2FS5A
chains in the Genus database with same CATH topology
3N5FA 1LAMA 5LYFA 1Z2LA 2EK8A 3KI9A 4GM5A 1XFOA 4ZYQA 5K8MA 1F2PA 4F8ZA 2ZEFA 3KQXA 4UEEA 3FMCA 1IGBA 2XEFA 2Q51A 1LAPA 2PJ2A 1FNOA 4P45A 1F57A 2RFHA 2Q4ZA 2NSMA 1Q7LA 3FF3A 2PIZA 3KHXA 3NH5A 4MCQA 3KQZA 4NJQA 3H8FA 4NGSA 4OC2A 1Y0YA 2PJ6A 3D68A 4ZY2A 5JM6A 2V8HA 3ISXA 3H8GA 4FBEA 4P6YA 4MCPA 2XEJA 4OKOA 1AMPA 4MHNA 5THWA 4EWTA 2HC9A 2GLFA 3NH8A 1CP7A 4TNUA 3VARA 1FT7A 5JH9A 3FH4A 5CPAA 3SI1A 1CBXA 4MHZA 1M4LA 3T8WA 4PXBA 3BI1A 2POKA 2XEGA 4NGMA 3NFZA 4Z65A 2V8DA 4OIWA 3IO1A 3BXMA 2GREA 1BPMA 4MMOA 4OC1A 4F9UA 2JBJA 4F9VA 3JRUA 2EK9A 3KHZA 3B3TA 4P4EA 5I4MA 1Y7EA 2C6CA 3LWUA 3VATA 3MRUA 1NSAA 2CTCA 2ZENA 2JBKA 4LQGA 2EWBA 4P4FA 5JGFA 2V8GA 3FVLA 4MHPA 4UIAA 3D66A 1YW4A 2NYQA 3B3WA 1CG2A 2ZEDA 4YU9A 3SJFA 3K2KA 1PCAA 2ZEEA 2WZNA 2CIJA 3B3SA 1OBRA 3VH9A 3HUVA 4A37A 4MCSA 1JQGA 3IFEA 2BO9A 4ZX9A 1TF8A 1Z5RA 3H8EA 1YW6A 4UIBA 2V8VA 1H8LA 5D29A 2AFMA 2PJ5A 2ZOFA 2FVGA 3SJXA 1YMEA 2PJCA 4OC0A 4CPAA 4OC4A 4TWEA 4WJBA 4X8IA 3B35A 3NA6A 5K8PA 4NGTA 1ZLHA 2AFWA 2QJ8A 2ZEPA 1PYTB 3PFEA 3IC1A 4P44A 3GLJA 4ZX8A 2RB7A 1ZLIA 1BPNA 3GUXA 2BOAA 3FEEA 3IIBA 4FAIA 5HVHA 2BCOA 2O53A 2C6GA 1TKJA 3IWWA 3WC5A 4R6TA 2ZELA 2AFXA 3PB4X 3WC6A 1ARMA 3PB9X 1TF9A 2ZOGA 3B2YA 8CPAA 4WWVA 3RBUA 4AXVA 2F8HA 5K8NA 3IJ3A 3CPXA 5K8OA 4P4JA 3BI0A 1KWMA 3GB0A 4P4IA 3PB7X 4EMEA 3PBBA 3KL9A 4EFDA 2PE3A 3L2NA 4W9YA 3WABA 4R7MA 1Z8LA 2ZEOA 1ZG9A 3SJGA 1DE4C 4NJRA 4NGPA 4R8FA 2I3CA 3B3VA 4UEZA 2PVWA 3K9TA 2PJ8A 2CTBA 1IY7A 1LFWA 4OP4A 3D7GA 3IEHA 3TX8A 4NGQA 4DYOA 2PJ1A 3PEIA 2PJAA 1VHEA 3CT9A 3TC8A 1QQ9A 4OIDA 1ELMP 1XMBA 4DJLA 2IQ6A 4G1PA 2QVPA 2O4HA 3CPAA 3KR4A 5HVFA 1AYEA 2AFZA 2G9DA 4MXUA 3D67A 2JEWA 4JZ0A 3PRTA 4P4BA 1UWYA 5CBMA 4BD9A 1CP6A 3HLPA 3PBEA 4A94A 3MN8A 3QNVA 1XBUA 4MRIA 5IB9A 3NH4A 1ARLA 1LANA 4Q7AA 4X3RA 2OOTA 1GYTA 2J9AA 3I1UA 1YSJA 7CPAA 4ZY0A 3SJEA 3D7FA 2CF4A 3V38A 4JYWA 4NGNA 4UEFA 3KZWA 4H2KA 3BHXA 1HDQA 1XRYA 3RAMA 1VIXA 1QMUA 2C6PA 4IHMA 3FJUA 3FEDA 4K3NA 2OR4A 1CPSA 4FUUA 4PXCA 3FX6A 3RZAA 3S9NA 4MCRA 2PCUA 3D7DA 2DEAA 4FWUA 5LRJA 5LYIA 1RTQA 3WC7A 2GLJA 2ABZA 4ZI6A 2ZEMA 4PXEA 1LCPA 4B6ZA 3D7HA 4IAVA 4A38A 2PIYA 2AFUA 2ZEHA 4P4DA 2XEIA 2AFOA 2PJBA 4OC5A 5LYLA 4ZY1A 1TXRA 5LRGA 3WT4A 4O23A 3B7IA 2V77A 5LYDA 3KASA 1LOKA 4NGRA 4DUKA 2QYVA 4ONWA 1XJOA 2WYRA 1Y0RA 4X2TA 2PJ9A 2PJ3A 4KSIA 3B3CA 2IMOA 1VHOA 2PJ4A 4PXDA 2ANPA 2PVVA 1ZG7A 4NFRA 2GU2A 1HEEA 1HDUA 2PRQA 1EE3P 1CPXA 4OMEA 4OC3A 3CDXA 3S9MA 2ZEGA 2PJ0A 3KR5A 1R43A 2AFSA 4MHYA 5HXDA 4UF4A 1R3NA 2HB6A 3FECA 3PB6X 3S9LA 5ELYA 3DLJA 4YWYA 5J1QA 5LRKA 3PB8X 5F09A 3LMSA 3SI2A 4P10A 3SI0A 1TKFA 1BLLE 4PQAA 3KGQA 2F7VA 4R76A 3PFOA 4A39A 5DS0A 2C1CA 4RUHA 2VL1A 2Q43A 1F2OA 5HVGA 1ZG8A 6CPAA 3DGVA 1TKHA 1BAVA 2PJ7A 3V7ZA 1VGYA 1YLOA 2IJZA 1DTDA 1CX8A 3ISZA 5D8NA 3D4UA 1ELLP 4IK2A 4PPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5F A;  1LAM A;  5LYF A;  1Z2L A;  2EK8 A;  3KI9 A;  4GM5 A;  1XFO A;  4ZYQ A;  5K8M A;  1F2P A;  4F8Z A;  2ZEF A;  3KQX A;  4UEE A;  3FMC A;  1IGB A;  2XEF A;  2Q51 A;  1LAP A;  2PJ2 A;  1FNO A;  4P45 A;  1F57 A;  2RFH A;  2Q4Z A;  2NSM A;  1Q7L A;  3FF3 A;  2PIZ A;  3KHX A;  3NH5 A;  4MCQ A;  3KQZ A;  4NJQ A;  3H8F A;  4NGS A;  4OC2 A;  1Y0Y A;  2PJ6 A;  3D68 A;  4ZY2 A;  5JM6 A;  2V8H A;  3ISX A;  3H8G A;  4FBE A;  4P6Y A;  4MCP A;  2XEJ A;  4OKO A;  1AMP A;  4MHN A;  5THW A;  4EWT A;  2HC9 A;  2GLF A;  3NH8 A;  1CP7 A;  4TNU A;  3VAR A;  1FT7 A;  5JH9 A;  3FH4 A;  5CPA A;  3SI1 A;  1CBX A;  4MHZ A;  1M4L A;  3T8W A;  4PXB A;  3BI1 A;  2POK A;  2XEG A;  4NGM A;  3NFZ A;  4Z65 A;  2V8D A;  4OIW A;  3IO1 A;  3BXM A;  2GRE A;  1BPM A;  4MMO A;  4OC1 A;  4F9U A;  2JBJ A;  4F9V A;  3JRU A;  2EK9 A;  3KHZ A;  3B3T A;  4P4E A;  5I4M A;  1Y7E A;  2C6C A;  3LWU A;  3VAT A;  3MRU A;  1NSA A;  2CTC A;  2ZEN A;  2JBK A;  4LQG A;  2EWB A;  4P4F A;  5JGF A;  2V8G A;  3FVL A;  4MHP A;  4UIA A;  3D66 A;  1YW4 A;  2NYQ A;  3B3W A;  1CG2 A;  2ZED A;  4YU9 A;  3SJF A;  3K2K A;  1PCA A;  2ZEE A;  2WZN A;  2CIJ A;  3B3S A;  1OBR A;  3VH9 A;  3HUV A;  4A37 A;  4MCS A;  1JQG A;  3IFE A;  2BO9 A;  4ZX9 A;  1TF8 A;  1Z5R A;  3H8E A;  1YW6 A;  4UIB A;  2V8V A;  1H8L A;  5D29 A;  2AFM A;  2PJ5 A;  2ZOF A;  2FVG A;  3SJX A;  1YME A;  2PJC A;  4OC0 A;  4CPA A;  4OC4 A;  4TWE A;  4WJB A;  4X8I A;  3B35 A;  3NA6 A;  5K8P A;  4NGT A;  1ZLH A;  2AFW A;  2QJ8 A;  2ZEP A;  1PYT B;  3PFE A;  3IC1 A;  4P44 A;  3GLJ A;  4ZX8 A;  2RB7 A;  1ZLI A;  1BPN A;  3GUX A;  2BOA A;  3FEE A;  3IIB A;  4FAI A;  5HVH A;  2BCO A;  2O53 A;  2C6G A;  1TKJ A;  3IWW A;  3WC5 A;  4R6T A;  2ZEL A;  2AFX A;  3PB4 X;  3WC6 A;  1ARM A;  3PB9 X;  1TF9 A;  2ZOG A;  3B2Y A;  8CPA A;  4WWV A;  3RBU A;  4AXV A;  2F8H A;  5K8N A;  3IJ3 A;  3CPX A;  5K8O A;  4P4J A;  3BI0 A;  1KWM A;  3GB0 A;  4P4I A;  3PB7 X;  4EME A;  3PBB A;  3KL9 A;  4EFD A;  2PE3 A;  3L2N A;  4W9Y A;  3WAB A;  4R7M A;  1Z8L A;  2ZEO A;  1ZG9 A;  3SJG A;  1DE4 C;  4NJR A;  4NGP A;  4R8F A;  2I3C A;  3B3V A;  4UEZ A;  2PVW A;  3K9T A;  2PJ8 A;  2CTB A;  1IY7 A;  1LFW A;  4OP4 A;  3D7G A;  3IEH A;  3TX8 A;  4NGQ A;  4DYO A;  2PJ1 A;  3PEI A;  2PJA A;  1VHE A;  3CT9 A;  3TC8 A;  1QQ9 A;  4OID A;  1ELM P;  1XMB A;  4DJL A;  2IQ6 A;  4G1P A;  2QVP A;  2O4H A;  3CPA A;  3KR4 A;  5HVF A;  1AYE A;  2AFZ A;  2G9D A;  4MXU A;  3D67 A;  2JEW A;  4JZ0 A;  3PRT A;  4P4B A;  1UWY A;  5CBM A;  4BD9 A;  1CP6 A;  3HLP A;  3PBE A;  4A94 A;  3MN8 A;  3QNV A;  1XBU A;  4MRI A;  5IB9 A;  3NH4 A;  1ARL A;  1LAN A;  4Q7A A;  4X3R A;  2OOT A;  1GYT A;  2J9A A;  3I1U A;  1YSJ A;  7CPA A;  4ZY0 A;  3SJE A;  3D7F A;  2CF4 A;  3V38 A;  4JYW A;  4NGN A;  4UEF A;  3KZW A;  4H2K A;  3BHX A;  1HDQ A;  1XRY A;  3RAM A;  1VIX A;  1QMU A;  2C6P A;  4IHM A;  3FJU A;  3FED A;  4K3N A;  2OR4 A;  1CPS A;  4FUU A;  4PXC A;  3FX6 A;  3RZA A;  3S9N A;  4MCR A;  2PCU A;  3D7D A;  2DEA A;  4FWU A;  5LRJ A;  5LYI A;  1RTQ A;  3WC7 A;  2GLJ A;  2ABZ A;  4ZI6 A;  2ZEM A;  4PXE A;  1LCP A;  4B6Z A;  3D7H A;  4IAV A;  4A38 A;  2PIY A;  2AFU A;  2ZEH A;  4P4D A;  2XEI A;  2AFO A;  2PJB A;  4OC5 A;  5LYL A;  4ZY1 A;  1TXR A;  5LRG A;  3WT4 A;  4O23 A;  3B7I A;  2V77 A;  5LYD A;  3KAS A;  1LOK A;  4NGR A;  4DUK A;  2QYV A;  4ONW A;  1XJO A;  2WYR A;  1Y0R A;  4X2T A;  2PJ9 A;  2PJ3 A;  4KSI A;  3B3C A;  2IMO A;  1VHO A;  2PJ4 A;  4PXD A;  2ANP A;  2PVV A;  1ZG7 A;  4NFR A;  2GU2 A;  1HEE A;  1HDU A;  2PRQ A;  1EE3 P;  1CPX A;  4OME A;  4OC3 A;  3CDX A;  3S9M A;  2ZEG A;  2PJ0 A;  3KR5 A;  1R43 A;  2AFS A;  4MHY A;  5HXD A;  4UF4 A;  1R3N A;  2HB6 A;  3FEC A;  3PB6 X;  3S9L A;  5ELY A;  3DLJ A;  4YWY A;  5J1Q A;  5LRK A;  3PB8 X;  5F09 A;  3LMS A;  3SI2 A;  4P10 A;  3SI0 A;  1TKF A;  1BLL E;  4PQA A;  3KGQ A;  2F7V A;  4R76 A;  3PFO A;  4A39 A;  5DS0 A;  2C1C A;  4RUH A;  2VL1 A;  2Q43 A;  1F2O A;  5HVG A;  1ZG8 A;  6CPA A;  3DGV A;  1TKH A;  1BAV A;  2PJ7 A;  3V7Z A;  1VGY A;  1YLO A;  2IJZ A;  1DTD A;  1CX8 A;  3ISZ A;  5D8N A;  3D4U A;  1ELL P;  4IK2 A;  4PPZ A; 
#chains in the Genus database with same CATH topology
 2HUZ A;  1Z2L A;  1FY7 A;  3NE8 A;  5FA6 A;  3LOD A;  4KOV A;  2F4N A;  1XFO A;  2YND A;  4NXY A;  3G05 A;  3TOB A;  2I00 A;  4MFK A;  1IB0 A;  2ZEF A;  5BSX A;  4QUZ A;  4LC0 A;  1QVG B;  4UEE A;  3ASR A;  2XEF A;  1KJZ A;  1PU9 A;  2Q51 A;  2OZH A;  1JB9 A;  2PJ2 A;  2VBU A;  5E6T A;  3NE5 B;  1WOS A;  4C0S A;  4ZV4 A;  2H5M A;  2NSM A;  2O28 A;  4XQF A;  1NSL A;  3JQQ A;  5FIU A;  1VHS A;  2XNJ A;  2Q6O A;  4NJQ A;  4ZY2 A;  4FBE A;  2D3L A;  3HAG A;  2R7H A;  1M4G A;  1AMP A;  2WJY A;  4AB7 A;  2HC9 A;  3ZZ0 A;  1W0J A;  2PIA A;  2JIZ A;  4GS4 A;  2D4P A;  3FH4 A;  5CPA A;  3SI1 A;  1CJW A;  2A4N A;  1U6M A;  1M4L A;  2PSW A;  3SJP A;  3BI1 A;  1FRQ A;  2XEG A;  1QGA A;  3NFZ A;  4OPO A;  4RCZ A;  3SXO A;  2V8D A;  1Q2C A;  1BPM A;  3FYN A;  4N3G A;  4F9V A;  3TE4 A;  3KHZ A;  2PLF A;  5AG7 A;  4B43 A;  2OK8 A;  1M4I A;  4FD7 A;  4AG9 A;  3MRU A;  3GQB A;  1NSA A;  4FD4 A;  4KOU A;  4LQG A;  4KZT A;  1KRH A;  1Y7R A;  1VQ7 B;  2V8G A;  1V5V A;  3GSI A;  3D8P A;  4UIA A;  4DK0 A;  2Z3P A;  1T6Z A;  5G22 A;  2ARH A;  3SJF A;  3K2K A;  4H89 A;  1PCA A;  1V0E A;  3Q38 A;  2WZN A;  3WNC A;  3T90 A;  1VLO A;  2P0W A;  1MAB A;  2Z0Z A;  4R87 A;  4MCS A;  1E1R A;  2X53 S;  1RQP A;  1N0U A;  1QFY A;  2ZW6 A;  4UIB A;  1N71 A;  4C7H A;  1VKC A;  4ZBG A;  3DR8 A;  4LQ6 A;  3W6S A;  1PUA A;  4YAU A;  2ZOF A;  4JMQ A;  2J8N A;  2GPJ A;  1F20 A;  2PJC A;  2FT0 A;  4OPV A;  1LRZ A;  3CRZ A;  4B5P B;  4TWE A;  5F49 A;  3B35 A;  3NA6 A;  2FX3 A;  5G1Z A;  3B82 A;  2QJ8 A;  4XLA A;  4PAB A;  3TO6 A;  4P44 A;  4ZX8 A;  3GUX A;  4RD6 A;  1Q7Y D;  2BOA A;  4FAI A;  1TTT A;  2VBT A;  5HVH A;  2BCO A;  1HZE A;  4ACB A;  1OGI A;  1CNF A;  1ARM A;  3WYA A;  2WJV A;  1IOF A;  2CY2 A;  3QFT A;  3ZJ0 A;  1J4J A;  5EMN A;  5AG4 A;  4PSX A;  1QGZ A;  2Z6B D;  4UZF A;  3I56 B;  3VNU A;  1EFU A;  3VR6 A;  5K8O A;  4P4J A;  4QC6 A;  2ATR A;  3PB7 X;  2CRV A;  3BY1 A;  4RD4 A;  2J7K A;  5C82 A;  4PK2 A;  2ZZE A;  2PE3 A;  5ISV A;  4KLW A;  3V8I A;  3LAC A;  4R7M A;  4TN1 A;  3DNS A;  3CD6 B;  3S6F A;  2XGJ A;  2PVW A;  2QTL A;  4XPD B;  1EWY A;  3PGP A;  3D7G A;  4Z4V A;  2B3V A;  3TX8 A;  4NGQ A;  2PJ1 A;  1VQ6 B;  4E2A A;  4J3G A;  1XE1 A;  1R5N A;  3RNZ A;  5C88 A;  3FXT A;  4MFQ A;  4OID A;  4QFM A;  1KUV A;  3ZZT A;  3CC7 B;  2IQ6 A;  1E3X A;  4G1P A;  3KR4 A;  3LNN A;  3A35 A;  3VWD A;  4H9G A;  1M4D A;  1VQP B;  3D67 A;  3GVL A;  3CCM B;  2JEW A;  3PRT A;  3JQR A;  3CXC B;  4P4B A;  1UWY A;  3QSY A;  2JN9 A;  1CP6 A;  2DER A;  5HKK A;  2OBT A;  3AST A;  1QUE A;  4F6A A;  3PBE A;  3A9L A;  3QNV A;  2ZPA A;  1LAN A;  1V0C A;  1GYT A;  2J9A A;  4PK3 A;  2RC5 A;  4JXQ A;  4NEX A;  2ZL7 A;  4II9 A;  3S6K A;  2C4T A;  2GJR A;  2VNK A;  1P4M A;  1S5K A;  3CZX A;  4NGN A;  3TFY A;  2AJ6 A;  3CB4 A;  3RAM A;  3U6B A;  1GHE A;  4M6G A;  2C6P A;  3ASQ A;  3FJU A;  3FED A;  1OZP A;  1B23 P;  1CPS A;  1NBM A;  1N8R D;  4FUU A;  3FX6 A;  4M1K A;  2QEX B;  5EBV A;  2J8R A;  4BMH A;  5KTC A;  4MCR A;  1UD6 A;  4QV2 A;  3D7D A;  2XEX A;  4Z4R A;  4FWU A;  1EP3 B;  2R6H A;  1RTQ A;  5IX3 A;  2G3T A;  2RC4 A;  2GLJ A;  4PXE A;  3BLN A;  5TR9 A;  4B14 A;  4JLY A;  4XM3 A;  3J81 k;  3OPO A;  4B6Z A;  3PA2 A;  2PIY A;  3OEE A;  1QGY A;  4P22 A;  2HCJ B;  4KOS A;  4P3I A;  5G21 A;  4FWT A;  1XOV A;  2OZG A;  5GCN A;  3Q6Q A;  1YHQ B;  4HNW B;  3PUM A;  2CK3 A;  1QG0 A;  3WBJ A;  5LYD A;  3IU2 A;  1K4J A;  2D9R A;  2WZP P;  1LOK A;  2VNH A;  4E0F A;  2OK7 A;  2WYR A;  3SXN A;  3B3C A;  2IMO A;  1OB5 A;  2P6F A;  2PJ4 A;  3CXS A;  1ZG7 A;  4RN7 A;  3OOC A;  1HEE A;  3H4Q A;  4F0Y A;  4OC3 A;  3EC4 A;  3S9M A;  2AFS A;  5FNZ A;  1NE9 A;  1ZM2 A;  1W0K A;  4Z4Z A;  4ZGN B;  4BBH A;  4WZK A;  3OZU A;  2PR8 A;  1DG1 G;  5ELY A;  4B3F X;  1YQE A;  2C78 A;  3QFR A;  2BM1 A;  1ZM3 A;  4B13 A;  4AG7 A;  4OLL A;  4Z4W A;  3PB8 X;  1S7F A;  2PMD A;  4P10 A;  4JXR A;  4G7X A;  4X7E A;  1BLL E;  3KGQ A;  3ZZU A;  4TMT A;  4R76 A;  4A39 A;  1KQS B;  2GQF A;  2C1C A;  2Q4V A;  4XNF A;  2R1I A;  3FPK A;  1TKH A;  1Q86 D;  3B8H A;  3CCQ B;  3R6K A;  2HMA A;  5D8N A;  3D4U A;  1ELL P;  4KKU A;  4RJL A;  2BM0 A;  4HNX B;  1Z9U A;  4XLH A;  2EK8 A;  4TMZ A;  3KI9 A;  1IOI A;  2VZL A;  5K8M A;  1X12 A;  2ZTG A;  2YNC A;  4JD6 A;  4M6I A;  2QE7 A;  4H6Z A;  4L8J A;  4XMY A;  3FMC A;  1IGB A;  4KUA A;  4ONU A;  1FNO A;  4P45 A;  1D2E A;  5CNP A;  2RFH A;  1WTH D;  2XZL A;  2X7B A;  3FF3 A;  1IID A;  1VQN B;  4X06 A;  4MCQ A;  4NGS A;  4OC2 A;  4MFJ A;  3D68 A;  2V8H A;  3H8G A;  4MY0 A;  1PKV A;  2XEJ A;  3OWC A;  3GVJ A;  4MHN A;  4A95 A;  3E0K A;  4R3L A;  1YR0 A;  4AVZ A;  4XPK A;  3NH8 A;  4GQN A;  2VYQ A;  5DN6 A;  5JH9 A;  2YNC C;  1CBX A;  3W5V A;  1YIT B;  1KK2 A;  1KK0 A;  3G6E B;  4X7C A;  2DIE A;  1N06 A;  1K8A D;  3D2M A;  1QSM A;  1SQH A;  3BCD A;  1A8P A;  1NMT A;  2DPT A;  4XOR A;  3QFS A;  3IO1 A;  3BXM A;  3CES A;  4R71 A;  2Q7S A;  1CNE A;  4X7D A;  4B47 A;  1KUY A;  2BPO A;  1S7N A;  4B10 A;  2ZBU A;  4WQM A;  3LWU A;  1Z8W A;  2DOG A;  1Q2D A;  2ZEN A;  5A27 A;  2LZJ A;  3R1K A;  4OOS A;  1EFR A;  4MFZ A;  1EP1 B;  4R57 A;  3V7A A;  1FDR A;  2DET A;  4Y49 C;  2HLD A;  3ZBU A;  1S3Z A;  3CW2 A;  4CYN A;  2JDD A;  1BPL A;  3CP8 A;  3AGQ A;  2ODF A;  4CAE A;  3AGP A;  2EIX A;  2OYN A;  2ZEE A;  3JU4 A;  4YGO A;  3E20 A;  1BX0 A;  4U9U A;  3HUV A;  4A37 A;  1UD3 A;  4AVB A;  3BNW A;  4C2Y A;  2VZZ A;  2BO9 A;  3IFE A;  1TF8 A;  4M85 A;  3SLN A;  1Z5R A;  4LBZ A;  4MBU A;  4UA3 A;  2HV2 A;  2Y0M A;  4A32 A;  3OFN A;  3CCL B;  3E1Y E;  5F4M A;  2BV3 A;  1H8L A;  4RD2 A;  5D29 A;  1H8E A;  4OPS A;  2Q7B A;  2AFM A;  5AG6 A;  3LVB A;  3CCE B;  2FVG A;  1YME A;  3EO4 A;  1VQ4 B;  3BY2 A;  1OB2 A;  3T53 B;  3A8K A;  1VQ9 B;  1ZLH A;  2AFW A;  1H42 A;  4PGO A;  3GYA A;  5DWN A;  4XOP A;  3IC1 A;  5TV2 A;  4CYO A;  5A89 A;  4LUA A;  3CTA A;  3GLJ A;  2RB7 A;  2AHO A;  1G7C A;  1Q9S A;  1I1D A;  4OAE A;  3VWE A;  3ONU A;  2F1L A;  4KOW A;  2O53 A;  1QH0 A;  1TKJ A;  3IWW A;  3SKB A;  2ZEL A;  4TT3 A;  3PB9 X;  4R3K A;  2ZOG A;  8CPA A;  2REF A;  2Q6I A;  5K8N A;  4RDL A;  4TMW A;  3OJW A;  1E1Q A;  3CPX A;  3OZW A;  1VQO B;  2VZY A;  4P2N A;  3F8K A;  4H6U A;  2Q6L A;  3W2I A;  1JA1 A;  3OEH A;  3K9U A;  2EBJ A;  4XKV A;  3DR6 A;  4EFD A;  3L2N A;  3SEJ A;  1RQR A;  2CC2 A;  3WAB A;  1OGJ A;  4UWJ A;  2ZEO A;  4TKO B;  3LD2 A;  5TRD A;  1VF7 A;  1VLY A;  4NJR A;  4F0X A;  2D4O A;  2KVO A;  2I3C A;  4KOR A;  3B3V A;  1J9Z A;  1NB9 A;  2PJ8 A;  5G20 A;  4OP4 A;  2WSS A;  2XZP A;  4NSQ A;  4DYO A;  5EC4 A;  1M90 D;  4G7W A;  2PJA A;  1ZO0 A;  1FRN A;  3WNB A;  2GAN A;  4RD3 A;  1NRK A;  1VHE A;  1IU8 A;  3CT9 A;  5HXB A;  3TCV A;  4NF1 A;  4EH1 A;  5KTD A;  4KSA A;  5KTA A;  2VNI A;  3A8I A;  2RC6 A;  3OKX A;  1VQ8 B;  5A28 A;  2EVN A;  2QVP A;  2BVN A;  4MFP A;  2O4H A;  5HVF A;  4B4D A;  1Z8X A;  4OAD A;  2AFZ A;  4KKS A;  3D3S A;  1Y9W A;  3BJ7 A;  5I0C A;  3Q39 A;  4CAV A;  4A94 A;  1MRZ A;  1XBU A;  3I55 B;  3NH4 A;  2R8V A;  3DDD A;  4X3R A;  1W34 A;  1YSJ A;  7CPA A;  4NNJ A;  1P4N A;  3SJE A;  1E43 A;  2CF4 A;  4ZGQ B;  1W35 A;  2V7U A;  2YWF A;  2FE7 A;  4JWP A;  3KZW A;  2QGG A;  4XPL A;  1WK4 A;  4AVA A;  4B3X A;  1VIX A;  1WSR A;  1QMU A;  4K1X A;  3P2H A;  2VEZ A;  2WPX A;  4IHM A;  3QAH A;  1AUG A;  1S4M A;  4RDJ A;  4KVM E;  4PXC A;  3H5Z A;  3RZA A;  1RXT A;  2I1L A;  1YVO A;  2CNT A;  3F5B A;  5E96 A;  1AIP A;  1VQ5 B;  5LYI A;  2HDN B;  3R9F A;  3CCS B;  4PSW A;  1E64 A;  3SJZ A;  4XR6 A;  2FL4 A;  4TSF A;  3D7H A;  1YIJ B;  4YXW A;  3I1F A;  1TUI A;  1IB1 E;  2AFU A;  4P4D A;  4B44 A;  4ZCM A;  2XEI A;  4G1B A;  1E63 A;  3TTH A;  3PZJ A;  4K30 A;  3MMP A;  1WOR A;  4ZY1 A;  3TO9 A;  1SKQ A;  5LRG A;  4Q36 A;  4O23 A;  3FJO A;  2V77 A;  2PRB A;  4HKF A;  3DDY A;  1COW A;  3S6H A;  3CCU B;  4DUK A;  4C2X A;  2FSR A;  4LBY A;  4X2T A;  5BSY A;  1YJW B;  3WND A;  4PXD A;  2PVV A;  1YLE A;  2GU2 A;  4CGN A;  1CM0 A;  2Z3N A;  1CPX A;  3VMF A;  2NV4 A;  2ZEG A;  3CPW B;  2PJ0 A;  4MY3 A;  4MHY A;  1Z4E A;  4KUB A;  4DQL A;  1KTV A;  5J35 A;  3S9L A;  4Z4T A;  4P6V F;  3BH4 A;  5LRK A;  2XZO A;  5FO1 A;  2X8K A;  4J0Q A;  1QUF A;  3LMS A;  3S6G A;  1YI2 B;  3P27 A;  2ZXV A;  2R98 A;  1KZF A;  4TMV A;  3CC4 B;  1VQM B;  4PQA A;  4DNR B;  4MI4 A;  2F7V A;  4UFV A;  2IL4 A;  1EXM A;  3OW2 B;  1UFH A;  4PC7 A;  4YAL A;  2V4D A;  2ZXH A;  4RUH A;  2OTL B;  2VL1 A;  5HVG A;  3WQZ A;  3EXN A;  1W2B B;  2P3M A;  2OZU A;  3V7Z A;  1D8T A;  2VJI A;  1M44 A;  3ISZ A;  4MYT A;  4IK2 A;  3AVX A;  4PPZ A;  3KKW A;  3QAY A;  1T6Y A;  3W91 A;  4ZYQ A;  3JTK A;  2QTZ A;  1DDI A;  2Q4Y A;  3FRM A;  1DAR A;  3ONY A;  3KQX A;  2XOK A;  3OP1 A;  3JQP A;  4QVA A;  2DEU A;  1MJB A;  5F48 A;  2EFG A;  1I7P A;  2Q4Z A;  2YWH A;  1R57 A;  4LX9 A;  1U2R A;  1KK1 A;  2PIZ A;  3KHX A;  3NH5 A;  4ROX A;  3KQZ A;  4KSF A;  3H8F A;  4Y49 B;  4U5Y A;  4P6Y A;  1N08 A;  1G7S A;  4NBS A;  4MCP A;  4A33 A;  2X3U A;  5IYN A;  4C7I A;  1BQE A;  4EWT A;  4YRH A;  5A88 A;  1H8H A;  3CCV B;  3W2E A;  4QB9 A;  5AG5 A;  1CP7 A;  4KS9 A;  4TNU A;  3VAR A;  1W87 A;  1FT7 A;  2ZL6 A;  3AVU A;  2C5H A;  4MHZ A;  4XNH C;  3ASP A;  3T8W A;  1VJS A;  5HMN A;  2FCK A;  3BJ8 A;  1GJR A;  2V7W A;  2ZW5 A;  4Z65 A;  4YEJ A;  4P3Y A;  4UAJ A;  4JJX A;  4OIW A;  3OZV A;  2Q6K A;  2GRE A;  4MMO A;  1K28 D;  5H84 A;  2D74 A;  3AVV A;  4B5O A;  2EK9 A;  4P4E A;  5I4M A;  1Y7E A;  1IJF A;  4DNT B;  3F0A A;  2C6C A;  3VAT A;  5JQ4 A;  2CTC A;  4RS2 A;  1XF8 A;  2JBK A;  1NDH A;  2DYI A;  2EWB A;  5FO0 A;  4P4F A;  1N07 A;  4E8O A;  2OTJ B;  4RLZ A;  5IB0 A;  1XE4 A;  1HA3 A;  2V7X A;  4FN5 A;  2XNC A;  1B87 A;  1E3Z A;  3R96 A;  1CG2 A;  2ZED A;  4YU9 A;  1QX4 A;  4M3S A;  4CRZ B;  3WY9 A;  3W2G A;  4RD0 A;  1OBR A;  3VH9 A;  2VBQ A;  2Z3L A;  4XD7 A;  1I12 A;  3CCJ B;  2F43 A;  1JQG A;  3WR7 A;  3VO2 A;  3H8E A;  4CAW A;  1FX0 A;  3NE7 A;  2EUI A;  2WPW A;  2V8V A;  3TO7 A;  2OU2 A;  3H94 A;  4AF6 A;  4HE6 A;  2PJ5 A;  2FXF A;  3CME B;  4G5G A;  2CBX A;  1Z4R A;  3SJX A;  4GXH A;  4MJ8 A;  4FK8 A;  2VI7 A;  3EFA A;  1Y9K A;  4CPA A;  2C4U A;  1QST A;  4OC4 A;  2W6J A;  4X07 A;  3T9Y A;  5K8P A;  1I18 A;  4MFL A;  4NGT A;  2ZEP A;  3RY8 A;  5LMZ A;  1FND A;  3MCA A;  1ZLI A;  3QB8 A;  2OBS A;  5BWA B;  1FNC A;  1M1K D;  1NB0 A;  2DCU A;  2YGW A;  1B2R A;  2ZL5 A;  4P26 A;  2C6G A;  3ES9 A;  4R6T A;  2AFX A;  3PB4 X;  4Y9R A;  3WC6 A;  3H9N A;  1Z8T A;  3GIU A;  3B2Y A;  2W6I A;  4CGP A;  1GAQ A;  4TMX A;  4B12 A;  4HPS A;  1S60 A;  1EFC A;  4XLF A;  4WWV A;  4KOT A;  4AXV A;  1N05 A;  2F8H A;  4KKT A;  4B3G A;  1F60 A;  5IYQ A;  1EFT A;  1E62 A;  4DNC A;  1CQX A;  1YX0 A;  4HE5 A;  1AMO A;  3I3G A;  3GB0 A;  4P4I A;  3PBB A;  3KL9 A;  1BOB A;  5KSW B;  1FNM A;  2CND A;  2CW5 A;  4W9Y A;  3GY9 A;  1JNY A;  2BSW A;  1Z8L A;  1ELO A;  1ZG9 A;  4XOT A;  1DE4 C;  4QUS A;  4NGP A;  2JDI A;  4R8F A;  2Q44 A;  1UD2 A;  4U9Z A;  3Q3A A;  4Z1M A;  3SHP A;  3K9T A;  2CTB A;  1LFW A;  4AF7 A;  2DY1 A;  1WWZ A;  1S7K A;  3IEH A;  4CRY B;  3PEI A;  1YVK A;  1G7T A;  4YAW A;  3TC8 A;  2FIW A;  1QQ9 A;  4AVC A;  1ELM P;  4A30 A;  4CGO A;  2GIV A;  3R9E A;  3CPA A;  4M53 A;  4MXU A;  4JZ0 A;  3EY5 A;  5CBM A;  4BD9 A;  1JJ2 B;  4QVJ A;  4CGM A;  3HLP A;  5HH1 A;  3OAA A;  2QA4 B;  4QBJ A;  3IU1 A;  2ZIT A;  2OOT A;  1XIX A;  3I1U A;  4EVY A;  1WPC A;  1H85 A;  4PV6 A;  2ZXI A;  3CMM A;  2BGI A;  2CNM A;  3TT2 A;  4II2 A;  3V38 A;  4KOY A;  4JYW A;  1BMF A;  1TIQ A;  4L89 A;  4UFX A;  4A2Z A;  5IYW A;  1XRY A;  4WZL A;  3U6K A;  3B78 A;  3W5U A;  4YEL A;  1NJI D;  3CMA B;  5H59 A;  3T51 B;  1PJ7 A;  3G8W A;  4N3N A;  4XL9 A;  5TY0 A;  4FXU A;  1YX2 A;  2PCU A;  3ZC3 A;  2HQY A;  2NMT A;  5LRJ A;  2KCW A;  1Q82 D;  4ZCL A;  4ZI6 A;  2BL1 A;  4ZGY B;  1BX1 A;  1L0C A;  2WUU A;  4IAV A;  3P2F A;  3V76 A;  1M1D A;  4A38 A;  5L46 A;  2VNJ A;  2E1R A;  2ZEH A;  3VNV A;  3JVN A;  4R9M A;  2FIA A;  5GV8 A;  2OBR A;  4FD5 A;  3PEN A;  5F47 A;  2DXQ A;  4HNY B;  1UD5 A;  5H86 A;  5LYL A;  3PVD A;  3B7I A;  4G1V A;  3KAS A;  4NGR A;  4ONW A;  1B6B A;  4OP7 A;  1Y0R A;  1BO4 A;  2PJ9 A;  4RI1 A;  2PJ3 A;  3Q6R A;  4UBR A;  3FPP A;  4IUS A;  4OOV A;  4F7D A;  2C2W A;  3A3G A;  3CP2 A;  5JBQ A;  4PC6 A;  3IWG A;  2DF5 A;  4NFR A;  1DDG A;  2QML A;  1V0F A;  1KZL A;  2ZZF A;  1EE3 P;  4Z4U A;  4OME A;  4CS0 B;  1W9X A;  2ZW4 A;  1JWQ A;  1HVX A;  5HXD A;  4UF4 A;  5AGE A;  5EMI A;  4Z4Y A;  1R3N A;  2HB6 A;  3G4S B;  3PUN A;  3BC9 A;  4QVT A;  2QEC A;  1ZM9 A;  1BJK A;  4PC3 A;  5J1Q A;  3VO1 A;  1SKY B;  1SM4 A;  4XKW A;  1G7R A;  4HIZ A;  3SI2 A;  1BLI A;  4CYP A;  4RM0 A;  2YWE A;  2E1B A;  1QFZ A;  4XN0 A;  5DS0 A;  1QVF B;  2OH1 A;  2WSA A;  1MJA A;  1OB0 A;  3DGV A;  3P26 A;  1WP6 A;  2PJ7 A;  3OW7 A;  3IGR A;  1YLO A;  2IJZ A;  3CCR B;  1CX8 A;  2VJJ A;  3WBK A;  1IIC A;  4CAF A;  4XNH B;  4XLC A;  4M2L A;  2YNE A;  3N5F A;  1LAM A;  5LYF A;  2GJK A;  4GM5 A;  4Z4S A;  1VQK B;  2BMW A;  1F2P A;  4F8Z A;  2PQ8 A;  1XB2 A;  1GVH A;  1UD4 A;  4II3 A;  1LAP A;  1T6X A;  4G6I A;  5FVJ A;  4LBV A;  1F57 A;  1WU8 A;  3I9S A;  1Q7L A;  2VXK A;  2V7T A;  1OHH A;  3MGD A;  3AVT A;  1S72 B;  1Y0Y A;  2X0K A;  2PJ6 A;  5JM6 A;  1EP2 B;  2B3U A;  3ISX A;  3CXP A;  3ZZI A;  5JPH A;  2EO8 A;  1IHM A;  2GK7 A;  4IF5 A;  4OKO A;  4RD1 A;  5THW A;  4RCY A;  4P25 A;  2BGJ A;  1KD1 D;  2GLF A;  1Q2Y A;  4UCM A;  1S0U A;  3RYO A;  4B48 A;  1UD8 A;  4YAF A;  4L8A A;  3IWE A;  3G3S A;  2JJ1 A;  4PXB A;  2ZBV A;  2POK A;  4NGM A;  4ACA A;  4B11 A;  1UMK A;  3R6J A;  3ZPN A;  3RO0 A;  3W6X A;  4OC1 A;  2GK6 A;  4F9U A;  2JBJ A;  2CXA A;  3JRU A;  4RPB A;  2GJP A;  3B3T A;  4DK1 A;  5B6I A;  4RDK A;  4NCZ A;  5JGF A;  4MHD A;  3FVL A;  4MHP A;  1YJN B;  1KUX A;  1ON0 A;  4X05 A;  4CQJ A;  3D66 A;  1YW4 A;  2NYQ A;  3B3W A;  2ZW7 A;  1KK3 A;  2B5O A;  4QHY A;  2CIJ A;  3BCF A;  3B3S A;  2QDX A;  2JDC A;  3B8G A;  5A8A A;  4YAO A;  4ZX9 A;  2P6G A;  3PP9 A;  4WZT A;  1YK3 A;  2D3N A;  2QMU A;  1YW6 A;  1E79 A;  2I79 A;  5F4J A;  4I49 A;  4C68 A;  1QSR A;  1QSO A;  2B7C A;  2ZZG A;  2B5G B;  1A2Z A;  2Z11 A;  4Y7C A;  5KW9 A;  3ZUG A;  4OC0 A;  1R5O A;  4XON A;  1P0H A;  3GIR A;  4WJB A;  4X8I A;  4PC2 A;  1MJ9 A;  2ZTN A;  5DWM A;  2WPD A;  2AE6 A;  1I21 A;  1PYT B;  4YHB A;  3PFE A;  4P9S A;  1K9M D;  4B5P A;  4IW3 B;  3W2H A;  1BPN A;  4CYQ A;  2J8M A;  2B4B A;  2JJ2 A;  2B4D B;  1Q81 D;  3FEE A;  3IIB A;  2P6E A;  4AC9 A;  3WC5 A;  2GE3 A;  1WDT A;  4UFW A;  2PR1 A;  2PDO A;  4Q7J B;  2BEI A;  4X7F A;  1TF9 A;  2Q0Y A;  3W2F A;  3AVW A;  2JEV A;  4Y9U A;  4P12 A;  1MK4 A;  2QN6 A;  3RBU A;  4BIN A;  5J8C A;  3ZBT A;  4UZU A;  4U9Y A;  3IJ3 A;  2M5S A;  2GFQ A;  3ZIA A;  4M0L A;  3BI0 A;  1KWM A;  4Q38 A;  4EME A;  2F1M A;  3ASS A;  4KVO E;  4XN3 A;  2Z3M A;  3PA1 A;  1YGH A;  3SJG A;  2YWG A;  3T56 B;  1T5E A;  1IJE A;  4UEZ A;  3FNC A;  2X85 A;  2G3A A;  5HZA A;  5J3O A;  4YFJ A;  1IY7 A;  2F5I A;  4ASU A;  4XLE A;  3JUW A;  4A31 A;  4MYU A;  1WOP A;  5IYR A;  5H5J A;  1XQB A;  3FKS A;  2B7B A;  4BPR A;  1PJ5 A;  1XMB A;  4DJL A;  3FBU A;  4M6H A;  2Z10 A;  5F4O A;  1AYE A;  5KNL A;  3FIX A;  1TVC A;  2G9D A;  3GVK A;  5CDF A;  2G0B A;  5FL7 A;  2BF4 A;  1FNB A;  3U2Q A;  2C5B A;  4WZE A;  1ZM4 A;  2XND A;  4M4S A;  1GAW A;  2BUE A;  4ORF A;  3LQ6 A;  4ZCI A;  1R5B A;  1GO2 A;  2X6Y A;  3MN8 A;  1D1N A;  4MRI A;  5IB9 A;  1ARL A;  4Q7A A;  1RO5 A;  2DPS A;  4X5K A;  4RPD A;  4ZY0 A;  3GKR A;  4NCN A;  3D7F A;  4KLV A;  2C27 A;  3SLD A;  2R9V A;  3LQE A;  4UEF A;  4XPD C;  4H2K A;  5J8F A;  3BHX A;  1HDQ A;  2B5G A;  1XMT A;  5AN9 A;  3D26 A;  4C43 A;  2BN4 A;  4K3N A;  2OR4 A;  4UWI A;  3S9N A;  3CXQ A;  4DQK A;  5HZB A;  5IV0 A;  2X6X A;  1IYL A;  1VQL B;  2DEA A;  5IYP A;  1ZUN B;  4KVX A;  2B4D A;  3WC7 A;  2ABZ A;  2BSA A;  2QIR A;  2ZEM A;  4CAX A;  1LCP A;  3KEW A;  2K5T A;  3WXM A;  3A3B A;  3QE2 A;  4UCP A;  4KOX A;  2ZZQ A;  4OOX A;  2AFO A;  2PJB A;  5THX A;  3C26 A;  1WSV A;  4OC5 A;  4X0C A;  2JLM A;  4LBW A;  1TXR A;  1S7L A;  3R95 A;  3G71 B;  3WT4 A;  1I8D A;  4P1V A;  5F46 A;  3OE7 A;  4FD6 A;  1QSN A;  2Z3K A;  1YRE A;  1K73 D;  5DSZ A;  2QYV A;  3R9G A;  1XJO A;  1QFJ A;  2WR8 A;  1JA0 A;  4UZE A;  4KSI A;  4C2Z A;  1KMH A;  3FB3 A;  1VHO A;  5GV7 A;  1IYK A;  2ANP A;  3W5H A;  3D2P A;  4PC1 A;  1HDU A;  2PRQ A;  4UCN A;  1YJ9 B;  2PC1 A;  3UY5 A;  3CDX A;  3KR5 A;  1XEB A;  3QFC A;  1R43 A;  3TOA A;  3AVY A;  3N7Z A;  3DSB A;  3FEC A;  3PB6 X;  1TLL A;  3BQJ A;  2NPF A;  1GR1 A;  3DLJ A;  4YWY A;  1PJ6 A;  2REE A;  2VBV A;  4E0A A;  2V7Q A;  3A1P A;  5F09 A;  2X6W A;  1X10 A;  2CNS A;  2Q04 A;  3SI0 A;  1TKF A;  4CGL A;  5IK2 A;  2V7V A;  3PFO A;  3CC2 B;  2V31 A;  3LO8 A;  3A8J A;  2B58 A;  2Q43 A;  1KC8 D;  1F2O A;  1ZG8 A;  4PAA A;  6CPA A;  2OB0 A;  3MHP A;  1WOO A;  2C77 A;  1BAV A;  1VGY A;  3OJX A;  1DTD A;  2VBS A;  1N0V C;  2VQY A;  2Z3O A;  2FS5 A; 
#chains in the Genus database with same CATH homology
 3N5F A;  1LAM A;  5LYF A;  1Z2L A;  2EK8 A;  3KI9 A;  4GM5 A;  1XFO A;  4ZYQ A;  5K8M A;  1F2P A;  4F8Z A;  2ZEF A;  3KQX A;  4UEE A;  3FMC A;  1IGB A;  2XEF A;  2Q51 A;  1LAP A;  2PJ2 A;  1FNO A;  4P45 A;  1F57 A;  2RFH A;  2Q4Z A;  2NSM A;  1Q7L A;  3FF3 A;  2PIZ A;  3KHX A;  3NH5 A;  4MCQ A;  3KQZ A;  4NJQ A;  3H8F A;  4NGS A;  4OC2 A;  1Y0Y A;  2PJ6 A;  3D68 A;  4ZY2 A;  5JM6 A;  2V8H A;  3ISX A;  3H8G A;  4FBE A;  4P6Y A;  4MCP A;  2XEJ A;  4OKO A;  1AMP A;  4MHN A;  5THW A;  4EWT A;  2HC9 A;  2GLF A;  3NH8 A;  1CP7 A;  4TNU A;  3VAR A;  1FT7 A;  5JH9 A;  3FH4 A;  5CPA A;  3SI1 A;  1CBX A;  4MHZ A;  1M4L A;  3T8W A;  4PXB A;  3BI1 A;  2POK A;  2XEG A;  4NGM A;  3NFZ A;  4Z65 A;  2V8D A;  4OIW A;  3IO1 A;  3BXM A;  2GRE A;  1BPM A;  4MMO A;  4OC1 A;  4F9U A;  2JBJ A;  4F9V A;  3JRU A;  2EK9 A;  3KHZ A;  3B3T A;  4P4E A;  5I4M A;  1Y7E A;  2C6C A;  3LWU A;  3VAT A;  3MRU A;  1NSA A;  2CTC A;  2ZEN A;  2JBK A;  4LQG A;  2EWB A;  4P4F A;  5JGF A;  2V8G A;  3FVL A;  4MHP A;  4UIA A;  3D66 A;  1YW4 A;  2NYQ A;  3B3W A;  1CG2 A;  2ZED A;  4YU9 A;  3SJF A;  3K2K A;  1PCA A;  2ZEE A;  2WZN A;  2CIJ A;  3B3S A;  1OBR A;  3VH9 A;  3HUV A;  4A37 A;  4MCS A;  1JQG A;  3IFE A;  2BO9 A;  4ZX9 A;  1TF8 A;  1Z5R A;  3H8E A;  1YW6 A;  4UIB A;  2V8V A;  1H8L A;  5D29 A;  2AFM A;  2PJ5 A;  2ZOF A;  2FVG A;  3SJX A;  1YME A;  2PJC A;  4OC0 A;  4CPA A;  4OC4 A;  4TWE A;  4WJB A;  4X8I A;  3B35 A;  3NA6 A;  5K8P A;  4NGT A;  1ZLH A;  2AFW A;  2QJ8 A;  2ZEP A;  1PYT B;  3PFE A;  3IC1 A;  4P44 A;  3GLJ A;  4ZX8 A;  2RB7 A;  1ZLI A;  1BPN A;  3GUX A;  2BOA A;  3FEE A;  3IIB A;  4FAI A;  5HVH A;  2BCO A;  2O53 A;  2C6G A;  1TKJ A;  3IWW A;  3WC5 A;  4R6T A;  2ZEL A;  2AFX A;  3PB4 X;  3WC6 A;  1ARM A;  3PB9 X;  1TF9 A;  2ZOG A;  3B2Y A;  8CPA A;  4WWV A;  3RBU A;  4AXV A;  2F8H A;  5K8N A;  3IJ3 A;  3CPX A;  5K8O A;  4P4J A;  3BI0 A;  1KWM A;  3GB0 A;  4P4I A;  3PB7 X;  4EME A;  3PBB A;  3KL9 A;  4EFD A;  2PE3 A;  3L2N A;  4W9Y A;  3WAB A;  4R7M A;  1Z8L A;  2ZEO A;  1ZG9 A;  3SJG A;  1DE4 C;  4NJR A;  4NGP A;  4R8F A;  2I3C A;  3B3V A;  4UEZ A;  2PVW A;  3K9T A;  2PJ8 A;  2CTB A;  1IY7 A;  1LFW A;  4OP4 A;  3D7G A;  3IEH A;  3TX8 A;  4NGQ A;  4DYO A;  2PJ1 A;  3PEI A;  2PJA A;  1VHE A;  3CT9 A;  3TC8 A;  1QQ9 A;  4OID A;  1ELM P;  1XMB A;  4DJL A;  2IQ6 A;  4G1P A;  2QVP A;  2O4H A;  3CPA A;  3KR4 A;  5HVF A;  1AYE A;  2AFZ A;  2G9D A;  4MXU A;  3D67 A;  2JEW A;  4JZ0 A;  3PRT A;  4P4B A;  1UWY A;  5CBM A;  4BD9 A;  1CP6 A;  3HLP A;  3PBE A;  4A94 A;  3MN8 A;  3QNV A;  1XBU A;  4MRI A;  5IB9 A;  3NH4 A;  1ARL A;  1LAN A;  4Q7A A;  4X3R A;  2OOT A;  1GYT A;  2J9A A;  3I1U A;  1YSJ A;  7CPA A;  4ZY0 A;  3SJE A;  3D7F A;  2CF4 A;  3V38 A;  4JYW A;  4NGN A;  4UEF A;  3KZW A;  4H2K A;  3BHX A;  1HDQ A;  1XRY A;  3RAM A;  1VIX A;  1QMU A;  2C6P A;  4IHM A;  3FJU A;  3FED A;  4K3N A;  2OR4 A;  1CPS A;  4FUU A;  4PXC A;  3FX6 A;  3RZA A;  3S9N A;  4MCR A;  2PCU A;  3D7D A;  2DEA A;  4FWU A;  5LRJ A;  5LYI A;  1RTQ A;  3WC7 A;  2GLJ A;  2ABZ A;  4ZI6 A;  2ZEM A;  4PXE A;  1LCP A;  4B6Z A;  3D7H A;  4IAV A;  4A38 A;  2PIY A;  2AFU A;  2ZEH A;  4P4D A;  2XEI A;  2AFO A;  2PJB A;  4OC5 A;  5LYL A;  4ZY1 A;  1TXR A;  5LRG A;  3WT4 A;  4O23 A;  3B7I A;  2V77 A;  5LYD A;  3KAS A;  1LOK A;  4NGR A;  4DUK A;  2QYV A;  4ONW A;  1XJO A;  2WYR A;  1Y0R A;  4X2T A;  2PJ9 A;  2PJ3 A;  4KSI A;  3B3C A;  2IMO A;  1VHO A;  2PJ4 A;  4PXD A;  2ANP A;  2PVV A;  1ZG7 A;  4NFR A;  2GU2 A;  1HEE A;  1HDU A;  2PRQ A;  1EE3 P;  1CPX A;  4OME A;  4OC3 A;  3CDX A;  3S9M A;  2ZEG A;  2PJ0 A;  3KR5 A;  1R43 A;  2AFS A;  4MHY A;  5HXD A;  4UF4 A;  1R3N A;  2HB6 A;  3FEC A;  3PB6 X;  3S9L A;  5ELY A;  3DLJ A;  4YWY A;  5J1Q A;  5LRK A;  3PB8 X;  5F09 A;  3LMS A;  3SI2 A;  4P10 A;  3SI0 A;  1TKF A;  1BLL E;  4PQA A;  3KGQ A;  2F7V A;  4R76 A;  3PFO A;  4A39 A;  5DS0 A;  2C1C A;  4RUH A;  2VL1 A;  2Q43 A;  1F2O A;  5HVG A;  1ZG8 A;  6CPA A;  3DGV A;  1TKH A;  1BAV A;  2PJ7 A;  3V7Z A;  1VGY A;  1YLO A;  2IJZ A;  1DTD A;  1CX8 A;  3ISZ A;  5D8N A;  3D4U A;  1ELL P;  4IK2 A;  4PPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...