1GJRA

Ferredoxin-nadp+ reductase complexed with nadp+ by cocrystallization
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title Mechanism of Coenzyme Recognition and Binding Revealed by Crystal Structure Analysis of Ferredoxin-Nadp(+) Reductase Complexed with Nadp(+)
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 87
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2001-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1gjrA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1gjrA02
2CNDA 1D8TA 3G6EB 4RD2A 3G71B 4RD4A 4B44A 3ZC3A 1GR1A 1KTVA 1KK0A 1JJ2B 1DG1G 4WQMA 2GPJA 5FA6A 2BGJA 3QSYA 2QTZA 3MMPA 3OZUA 3QFSA 1FNCA 1SKQA 3VO1A 4F7DA 3VO2A 3CMEB 3CCLB 3W2FA 3P26A 3CC4B 1ZM2A 2BVNA 2HMAA 4BPRA 4PC2A 1VQ8B 3ZBUA 3SJZA 4P6VF 4RD3A 5TR9A 4MYUA 1QG0A 4ZGQB 1JNYA 2YWGA 3U6KA 3CXCB 2EIXA 3I56B 4LBYA 4PC6A 3AGQA 1NJID 4H9GA 3FJOA 3CW2A 1QX4A 4M1KA 1IJFA 1Q86D 1FDRA 2DCUA 4EH1A 2OTLB 1B23P 1H85A 1ZM4A 3WBKA 1BX0A 4LBZA 1QVFB 2GQFA 3W2IA 2BGIA 1K73D 1OGJA 1EFCA 3OJXA 1U2RA 1R5OA 4FN5A 2VNIA 4M0LA 5KSWB 1KJZA 1G7RA 4YALA 1VQKB 2DETA 4RCYA 4YAFA 2VNKA 4PC1A 4PGOA 1QUFA 4FWTA 1QH0A 2XNJA 3WNCA 3CCMB 2BN4A 1QFJA 1JB9A 3WNBA 2B7BA 1KK3A 2QA4B 2QTLA 4B3XA 4ZV4A 3W2HA 1JA1A 1GO2A 4MYTA 1W34A 1OB2A 4YAUA 2C78A 1E62A 4UAJA 1KK2A 3ZZTA 3W2EA 3I55B 1QFZA 2BSAA 1G7SA 4YHBA 2YWFA 1F20A 1B2RA 2D74A 4G1BA 1WDTA 4FK8A 1QVGB 1E63A 4ZGNB 1N8RD 3WNDA 4LBVA 4M53A 1VQ7B 2QMUA 1HA3A 4QHYA 3AVYA 1J9ZA 4AF6A 2B5OA 3QE2A 4N3GA 4TN1A 3W5VA 2VYQA 3VNUA 1AIPA 1M90D 1R5BA 1YJ9B 4PC7A 3ZZUA 1G7CA 3WYAA 3CCUB 1QUEA 3CD6B 1GAWA 1BJKA 1CQXA 2BM0A 4NBSA 1YJWB 1FNBA 2HCJB 2EFGA 4HE5A 1H42A 1TVCA 2XNCA 4TMVA 1EXMA 2QN6A 1EP1B 1VQ6B 1IJEA 1AMOA 3CCRB 1FNMA 3CPWB 3JQRA 1K8AD 2DERA 1KQSB 1Q7YD 4R71A 3J81k 3E20A 1FNDA 1DDGA 4G5GA 1EFUA 4C43A 3AGPA 4B4DA 1TUIA 1A8PA 4TMXA 3E1YE 1VQ9B 4TMZA 1QGAA 3U2QA 3OJWA 4LBWA 3LYUA 2CRVA 5TY0A 1E64A 1KK1A 3VNVA 1CNEA 2B7CA 2RC5A 5HXBA 1N0VC 1YIJB 1KC8D 3G4SB 2BM1A 3CCVB 1FRNA 2RC6A 2HDNB 1CNFA 4ACBA 1Q82D 4QFMA 3ZBTA 3V76A 1IB0A 1QFYA 3PENA 4NCNA 4U9UA 1F60A 3ZZ0A 4HE6A 3B78A 3WY9A 1VQLB 1VQNB 4LC0A 5EMNA 3AVXA 4TMTA 3LRXA 5H59A 4ZCIA 2C77A 4B48A 4RD1A 1XE1A 4YAOA 1EP2B 1KRHA 1VQ5B 2FX3A 4M4SA 3CCSB 4P3YA 4B43A 3CCEB 4Y9RA 1K9MD 3W5UA 2PIAA 1R5NA 2AHOA 1XB2A 1OGIA 2YWHA 1D1NA 3P27A 1ELOA 3AVUA 2PMDA 4C0SA 4ACAA 3CCJB 1QGYA 3VMFA 1QGZA 3I1FA 4PC3A 2BPOA 1BX1A 1N0UA 3AVVA 1I7PA 3AVTA 3W2GA 1SM4A 2R6HA 3FPKA 1ZM3A 2DEUA 1TLLA 1ZUNB 3QFTA 2E1RA 4Y7CA 1GJRA 4DQKA 3U6BA 5DSZA 3MHPA 4IW3B 4ZCLA 3B82A 1DDIA 1UMKA 2VNJA 5TV2A 3QFRA 4RD0A 4J0QA 4Y9UA 2XEXA 5JBQA 3WXMA 1GAQA 1EP3B 2PLFA 4RCZA 1W87A 1TTTA 5THXA 2YWEA 3B8HA 4RJLA 5H5JA 2DY1A 1VQOB 4N3NA 1S0UA 2VNHA 4DQLA 3LVBA 1KD1D 2OTJB 2X3UA 1YHQB 3LO8A 3CCQB 3AVWA 3ES9A 3JQPA 1D2EA 1EFTA 3CC2B 1FRQA 3A1FA 1OB5A 1GVHA 4AF7A 1NDHA 1Q81D 2BMWA 1DARA 3CRZA 4G1VA 1ZM9A 4RD6A 1W35A 5GV8A 1JA0A 3MCAA 4AC9A 1W2BB 2QEXB 1VQMB 1M1KD 1S72B 4YAWA 1VQ4B 5GV7A 2OK8A 1YITB 3OZVA 4K1XA 4Q7JB 3WBJA 2BF4A 3CB4A 3CMAB 3OW2B 1BQEA 1EWYA 3OZWA 1VQPB 4M2LA 2QDXA 5AN9A 3JQQA 4B47A 4ZCMA 1YJNB 1G7TA 4TMWA 2ZITA 2VZLA 1YI2B 2BV3A 3W5HA 3QFCA 2OK7A 2J7KA 3CC7B 2NPFA
chains in the Genus database with same CATH superfamily
3IVCA 4LISA 1BN7A 2CEKA 1H94A 2ZI6A 4KTTE 3DD5A 4M8IA 1NBMA 5FOUA 3TPZA 2XHZA 3B3GA 2G1KA 2ZYAA 4MYCA 3WLJA 3HYCA 1W44A 4MJXA 5ILGA 2C3YA 2B1JA 4MCIA 3DWEX 4NCJA 4CM4B 1ADBA 3S2IA 3EB9A 4ID9A 3C8UA 3HA2A 3P19A 1M6VB 1JQJC 4Y2UA 5G4KA 2ZM5A 4JXKA 5BT9A 1XKQA 5J1SB 5CH5A 4GMFA 4MQ6A 4JCOA 5CX1A 3CVVA 4OGFA 2VSYA 3IDQA 4F4HA 1MRZA 1HOXA 1ZIOA 3I39X 3BEOA 3ER6A 1QAOA 4O0LA 4BNXA 4LECA 4V0NA 4FC7A 5L4NA 5EIEA 1AXRA 3CX6A 1D6MA 1R88A 1PFGA 1MT3A 3IO5A 3CS3A 3UXEA 4FGSA 4R5MA 2DRIA 4BGDA 2QD2A 3ENKA 5E7JA 2RB4A 1ZNZA 1G9SA 2O3UA 4N6GA 3QFSA 2NV0A 2PT9A 3MQ4A 3L7CA 1KIAA 1Q1AA 4QRIA 4ZHQA 2O4CA 1M8PA 5EZYA 3C5WP 3IV9A 3QF4B 4J0DA 3SJCA 5IULC 3N75A 1PL0A 2JGRA 1M6HA 1NVTA 3V4FA 3RIEA 4BFUA 5IDVA 2C5BA 5BSHA 4P6VF 2QV0A 4G5XA 4OA8A 4P38A 1T4CA 4F5EA 3ROZA 5GY7A 4PLTA 4KITB 3RJTA 1Y4SA 4JB2A 4BNDA 2GD1O 5ALEA 3B48A 1QRSA 4RK0A 2NXNA 2VDLB 5F4OA 4LBYA 3A6KA 4BB9A 5AVWA 1J2JA 2MR5A 1KO7A 2EBWA 4JMLA 3KE9A 5G0SA 2ZAYA 4WD3A 1J09A 3KOWA 3PKJA 1AQIA 1Y3DE 3LRTA 3THOA 6YASA 1NX6A 2ODQA 1Z0IA 3GUCA 1PZMA 2G9RA 1YLOA 1VJTA 1OWMA 2FETA 2WVJA 4HDMB 4JUIA 5EAIA 3JD0A 1TQ6A 2QAGC 2OLEA 3TBHA 3VPHA 4XDGA 3OWXA 1ZNYA 4H1TA 5AM0A 2DFVA 2B37A 1TVMA 3D8SA 1UD5A 1ORRA 2C2WA 3HNRA 4ZOQI 4G4GA 2JLQA 3K9LA 2ZYWX 4JT8A 3RJZA 3ZHQA 1CUSA 2P1ZA 3V8MA 3GI1A 2NU6B 4OUKX 5AD1A 3J80A 4O4LF 2Y1XA 2ZS8A 3H1AA 1QVFB 4NNPA 3UJAA 4PZYA 1X7GA 2NT3A 1I18A 3FBWA 1XKXA 2AYZA 2VHVA 2WFZA 4D0GA 1RM4A 3TRDA 1T43A 3EVEA 2KI5A 4Z0TA 5H81A 4D02A 2VRCD 1LLFA 3HG7A 4FOOA 1DKPA 1QFMA 1SIBE 2VK8A 4IFTA 4LY3A 3P9NA 4PQRA 2C2XA 2JH8A 1BHO1 2V7QD 4U2KA 4XSVA 5AJVB 5J5AA 2DQKA 2QUIA 2P2ZA 5DGHA 2OZLA 3TLGA 1PFVA 1RI2A 3EIEA 3BDIA 4D4GA 1J0DA 3VDMA 4INAA 1USIA 5F2OA 1Y1TA 2H0RA 1U0JA 1V8DA 3U3ZA 1Z0AA 3HVHA 4H1UA 1ES9A 5D3MA 2FMKA 1RJWA 3K8QA 4FOTA 1VA5A 3DEJA 4CDGA 2POCA 4GBED 4NP6A 4E7OA 5JIBA 3THXB 3UWDA 3AHDA 4CE6A 4BLWA 4CT5A 5AW9A 3LBIA 2OP1A 2F8LA 3NONA 2QNBA 4YMIA 4P4TA 1D6JA 2J3IA 1CPYA 2NT4A 2R8XA 1AQUA 1T3ZA 4H59A 1OFTA 3EXEA 5KOJA 1TU3A 3B38A 3TM4A 3V3KA 1GP2A 3P5SA 2KW5A 1VL5A 1JB9A 3HCPA 2FKNA 4M0PA 3AI2A 4P98A 1MQ9A 1ESZA 2Y0CA 3WLTA 4YRLA 1IZ9A 4JS0A 3F3YA 4R8SA 4UULA 4DAOA 1HQCA 1BMFA 1RIIA 4ZV4A 2YUTA 1G6HA 2FFAA 1BRMA 4K6HA 4CHGA 5CDFE 4TMFA 1RYYA 1P60A 2HMUA 4R2XA 2O2IA 5C34B 5BO5A 1XZLA 5IG2A 1K7XB 4DMHA 2ZATA 3LLSA 3TTXA 1WL8A 3DEIA 4DADA 4ALLA 4FDMA 1KR5A 5I9LA 3ET4A 2ZI4A 4ZYVA 1CF4A 2AJTA 2D1TA 3QEBZ 1MJHA 2WM9B 3UPUA 3EXFA 3S2ZA 2I6QA 1TJYA 3ZE1B 5FOWA 3UK1A 2PZLA 1ECFA 1I3OA 2J7PA 3BJEA 1DIRA 1B2RA 1FVFA 1UKYA 3D8BA 3DOFA 3EAQA 5DNWA 4M9SA 3WHKA 3D0OA 4R3WA 5L95A 3NFYA 3KUKA 4TV8F 3UAYA 5EWJB 5CD1A 3A11A 4DMGA 2XQFA 3FGZA 3PB3A 2ZR9A 4R2MA 4BYGA 3QENA 2HR1A 2WSSD 4GMXA 1J0AA 4GGPA 4N8DA 2JFUA 4ENPA 1HG0A 4DCCA 4I9FA 2DFLA 4RIEA 1QFXA 2PA0A 2HT1A 2OG1A 3QBJA 1NR7A 4X20A 4ZZ3A 4AM8A 5EWMB 2W93A 4KYVA 5LXTA 1XZHA 1T3TA 1N8KA 2IX9A 2LE0A 3ABRB 3K2QA 3NS7A 4Q24A 4R1PA 3HDJA 3WMRA 1PZNA 4MWCA 1TK2A 2C5GA 2P2DA 2YS6A 3IUMA 3K3PA 1UKBA 5EMKA 3U7JA 1WUHS 1WXQA 3IT0A 3R9WA 4RDKA 2NXWA 4GE3A 4MV9A 1U81A 3M83A 4NOLA 1N77A 1X8KA 1Z37A 2KYRA 3ROQA 4YO8A 4LDZA 5JECA 4R84A 2ODAA 3EXIB 5F1PA 1FA9A 2Q2NA 1KQFA 5B1YA 1UEJA 4ZQEA 3KHSA 3KL4A 2J3HA 4ADSG 1J6UA 3DLIA 4FKBA 1N2ZA 1Z38A 2C9ZA 3MTDA 3QVVA 1YFLA 1VJ5A 4PIVA 3C7AA 1EXMA 2AMYA 4FYIA 3RFVA 2JGEA 1NGSA 3MTAA 4IO0A 3RHSA 1XQ1A 2QN7A 3ZOKA 1M0EA 2GPYA 3M3PA 1NIJA 1YRBA 3B6KA 2ZBGA 3LK6A 1JDTA 2WJAA 4JBHA 4Q3LA 4WRRA 5C2JB 1HE4A 1WB4A 1CB7A 4UTOA 1P9LA 1U8AA 2J6BA 3C5CA 4KIUA 4LF6B 1HLFA 4BV2A 3IPLA 4F92B 5TS3A 2BTQA 5BSEA 1M1NB 2HBZA 3NBMA 5BWMA 5JZBA 1AGRA 1RHUA 3EH2A 3KZCA 4I1PA 4ISBA 1IBSA 1Q1NA 2HA4A 2X6WA 3C6BA 3EISA 4DLVA 4LWPA 4H27A 4RC9A 5CYPA 4UARA 2YJNA 4ZHQF 2OGSA 3L0DA 4X62B 4ND7A 4IQFA 1WQ1R 3GFGA 3NHZA 4WT7A 5EZYF 3UK0A 5DTIA 1E2KA 1SKUA 1V6CA 1XG5A 2ZB7A 3I5MA 5LD2B 5DEIA 5I8PA 3AMVA 4OX9B 3GCGA 1T5BA 1UL1X 3RFCA 5F4MA 1ST3A 2YCBA 3KAJA 3EPRA 5F2KA 4TTAA 5F73A 4C89A 3LP6A 2C84A 3PHBE 1ZSYA 1XCMA 4RIFA 2WF7A 5KCMA 1MQSA 1RXEA 1NKTA 1GQ2A 4QREA 1H2YA 2VLBA 3RT1A 3JX9A 6CHYA 1COWA 1TZJA 2C99A 3JQDA 4IMIB 3CLUC 4L3OA 4RFVA 4V03A 4Q9LA 4JYAB 5JJLA 4CM8B 4YS6A 5LPNA 3CCVB 3I9NA 2F2TA 2P75A 4MWSA 3DE4X 2GJSA 4UMFA 5ARBA 4CEHA 2H0QA 1QMGA 1ZR2A 1K2VN 2WPNA 3F73A 3NDPA 3D0KA 1KY2A 1YMUA 2AOTB 2C03A 4DCVA 1MKYA 5WRFA 1PJSA 4JOBA 4ZVRA 2OYRA 2BFNA 5CJJA 3TJZA 4AT1A 4XFDA 1GTL1 2RCYA 1KJ8A 2I2DA 2X4DA 1DIGA 3ETNA 2B8NA 3ZCXA 4TKZA 2J9FB 4M1ZA 2H65A 1J8QA 1UM8A 1M8JA 2QE7D 1M54A 5EE9A 3PE3A 3THYA 2DX7A 2H2AA 1KDYA 1JKIA 3IMCA 3TO5A 5T41A 4EB6B 2PWPA 5G41A 1LBIA 4I6EA 4Z9YA 1FU4A 1XXHB 2B4TO 1GSIA 3HJRA 1F8YA 1XDDA 1X6VA 2VYND 3NH9A 1JKMA 4XORA 4FGKA 1ZNXA 2ZDGA 1FMLA 2M6LA 3EDOA 2Y1KA 3IP5A 4R9UC 4RMJA 4BIMA 3IE1A 1T1IA 2QRGA 4LWOA 1AV6A 4FCVA 3SYLA 1Q0RA 1T4BA 2C1ZA 3VM6A 2RMKA 4FINA 1VQ5B 4KLRA 2FP3A 2NAPA 2Q9AA 3CC8A 3OURA 4NE7A 1EWRA 5T8KA 4F3TA 3PUWA 4DV4B 2VPQA 3SPXA 4LHWA 2FPSA 3NTRA 4UHCA 1Y3CE 3UJ7A 3BHJA 2VJPA 3CPEA 4L57A 1WV0A 3K9FC 3OZFA 1NMEA 2GVNA 3FE2A 4WBNB 4ZOEA 1JQ5A 1F12A 4B3RB 4MVJE 1LQ2A 2MMGA 3FYUC 3FROA 4GLJA 4NG4A 2E4WA 1XROA 3RVKA 4D57A 4RTMA 2PD3A 3CNHA 3Q7RA 1Z8DA 1J5EB 1Z4JA 4ODIA 5AUOB 3RYTC 4OREX 1RT9A 4MS3B 1G4HA 5IT4A 4I2VA 5LVAA 1ZZEA 3ZCVA 2YWHA 1UC8A 3L49A 1B14A 3RW9A 3GRZA 2DGDA 2XXBA 1M6YA 1XX6A 4FT2A 5A6SA 1QGZA 2AK3A 4KP7A 4ZPJA 2XVXA 2DG2A 4HXEB 5KBYA 1OQAA 3S3TA 2G67A 3BYZA 3T4XA 2A4MA 4JP1A 4M9CA 4O25A 3W5AA 4GMDA 2HJWA 2V03A 1N8SA 2PRIA 1UXIA 3AESA 1A8HA 2R48A 1K3FA 1BX1A 1E5DA 2RGBA 1BWPA 3EZNA 3JZFA 3MK31 3HB5X 4W6ZA 1UJ6A 4KFUA 2HRZA 2PWYA 1XOIA 1JN0A 1PWYE 4YI3A 3C3JA 2F43A 2FEKA 4HC4A 3WRYC 5JHHB 4C6TB 4ZARA 3ZGLA 4BBAA 5AVSA 3GJXC 2KM1A 3HDYA 3PDJA 1C0PA 1TKBA 2XNDD 3L7JA 3C8MA 1RMYA 4P6YA 2AEMA 3DAOA 1EVKA 4LMPA 1L5VA 1UCFA 2CWWA 1X70A 2VPWA 3CG0A 5B3JA 4AYXA 3TE7A 3C45A 3DTNA 3SOPA 2EJTA 1Z2CA 2D8AA 2FMHA 3DCJA 4KR2A 3HKBB 2GHQA 3UKDA 1FDTA 2JJ1A 2CCGA 2IHJA 1WMSA 3QI2A 3SC2A 4EAQA 2DR2A 1PZEA 2FFQA 4CIVA 3K9GA 3AP2A 1G8HA 4KRFA 1A4IA 2J8ZA 3JPYA 3ZBPA 5A5GA 4Y1FA 3Q8WA 4QXOA 3G9XA 3O8QA 3QOXA 5ES3A 1ZCJA 5IJZA 3DR3A 4ZVSA 5AW6A 4IS2A 3WA6A 4RD0A 3ZI0A 3WAKA 1OYWA 2QTBA 2W8BB 3LLCA 1B7GO 2XEXA 2OXRA 3FKQA 5ERYA 3NTOA 4PU0A 4JKIA 4D3SA 1Z33A 3NC4A 4K81B 4CM7A 2V54A 5HZBA 5LXTF 3MFYA 3UMGA 2FN9A 3IUBA 3IR7A 1WLYA 2JVKA 4LKOA 4XQ0A 4D81A 1VLLA 3CZQA 3KOMA 3UFXB 3DJFA 2ZJAA 1IOZA 3DE6X 1D4AA 2VHYA 3FMIA 2GN9A 5HBGA 1OC2A 2ZRAA 3SVZA 3HP1A 1E7SA 5LOVF 2A94A 3MUEA 2DY1A 4Z2YA 2PXXA 1FFHA 5AVZA 2C58A 2OHJA 2X5KO 3JVVA 4QDZA 2VPPA 4CTJA 2GAAA 4Q34A 2OCIA 2YN0A 1Z4IA 3VV3A 3FPCA 2A3RA 2NVOA 3CCQB 1XMPA 4B3CA 4YUWA 3DG9A 3L4SO 1A2KC 1E8MA 4DW8A 4QICA 3V1MA 3ITDA 1E3LA 3NTXA 3OLWA 5HDBB 4E33A 1KVUA 1HE8B 3P4YA 2Y68A 3FFXA 3BKXA 4TQGA 2XT6A 1AQYA 1QK5A 3AJ8A 1KGDA 2AH5A 3BD9A 4JB8A 4CRWB 1E18A 1OGYA 4XONA 1NDHA 1Q81D 1QDUA 2FEOA 3GIDA 5JD5A 4CG0A 3G05A 1LI5A 1U7HA 3JZIA 1H2AS 3KT0A 4N82A 4Z51A 3U60B 4OBEA 3AU9A 1LBHA 3OZ7A 4QJ3A 1SB8A 2IPLA 3G59A 1EIZA 1DXOA 2Z3WA 3R3ZA 4FZJA 2RHLA 4G01B 2QSJA 2X9NA 5I8ZA 2C04A 2VBTA 3R4CA 5DP1A 1S72B 3R6WA 3COWA 2F00A 3VVBA 4G23A 1SUSA 4HQFA 2FE4A 1GGMA 2I80A 1F0PA 2WU1A 3QG5A 4C3ZA 2JHFA 3QOFA 1CYDA 4RDIA 3K70B 2CLMB 4OGLA 4RXTA 3RVPA 3EUFA 2DHDA 1ZJWA 4WJKB 1LDMA 1V3VA 2A9RA 2BF4A 2QRVB 3KJQA 4DUPA 2OMEA 2QZSA 4JMQA 3AWIA 1C0EA 2OKGA 4DLUA 4EHJA 1FSPA 1U28C 2LBPA 1ODLA 1R3UA 5C1PA 1LFDB 1EFHA 3DONA 3GLRA 4ZRMA 3SY8A 4BDTA 5HZMA 1XD2A 3LE8A 3MPUA 4Q02A 2G36A 2QV7A 3QXGA 5BV0A 3W5CA 1Z29A 3GGSA 2DPGA 2WWIA 1ZVJA 1W94A 2BMAA 5AJUA 3C7CB 2UXBB 5HKOA 1EWTA 2M5SA 3GFSA 3EGWA 4J7CA 1AHIA 4JODA 5K0ZA 4JI2B 1QGED 3R9IA 5CT5A 2J33A 3QUBA 4OYHA 3T5GA 1DAGA 2GDJA 5IDYA 1S2OA 3R7FA 4BLUA 3EEIA 3MS7A 2PUJA 3UFBA 2I22A 2PU5A 1VE6A 3DB1A 2CNDA 3RAGA 1BPLA 2PWZA 2PJDA 2VNSA 3OCZA 5LUBA 3LDUA 3NOVA 2G6BA 5CB4A 3NRBA 4CKEA 4XUEA 1GNRA 2YJ3A 3EOZA 4U8GA 2XT0A 1NLUA 2WZDA 4XD2A 1IN8A 5ALHA 1ENZA 1SQFA 5ER6A 1FIUA 2O8DB 3V80A 2DFDA 4JLPA 1YQEA 1I4OA 4LWQA 3ZU6A 4UTRA 1NOKA 3JATB 4HNHA 2Z6AA 2H1RA 2CXSA 3BRSA 2X8WA 3K20A 1QTQA 3UCEA 2FCRA 2ZXUA 4O33A 3NTQA 2B4YA 1XDGA 4BUZA 3IIJA 4OD0A 4CL2A 1E4EA 3A9WA 1GKIA 1QYIA 4RZQA 3STHA 4CQMD 2PYIA 4D8VA 2J4CA 5FR1A 1MBZA 2LW7A 3I76A 2B0CA 4M0DA 3T3MB 5A5EA 5LP6B 3GHHA 3BT7A 1Q83A 1W29A 1H5NA 2OCGA 4N4AA 1W85B 4YQZA 5FD8A 4GLLA 4CZ2A 1S3IA 5CFNA 4J6FA 1BHJA 3BIFA 3JARB 4FFPA 3GAZA 1PTJC 1E99A 2BMVA 3H9UA 4FFLA 1GQSA 1KFKB 2OEPA 3N8IA 3OE1A 4WN9B 2P79A 1EJ0A 1PL8A 4K9SA 4O4JA 5E6UA 3BCRA 2A5DA 2F9MA 5EJ8A 4FMBB 3VTZA 4R3UC 1DWOA 4BKQA 1RWXA 4PN3A 621PA 5ADWA 2XOKD 2VP4A 2D1FA 4OOXA 4C0XA 5LQUA 1Y48E 3NWBA 3O8CA 1GQQA 1VPWA 1C14A 1MPTA 1JHXA 1ISRA 4MGIR 3CZ4A 4P31A 3W4IA 3MOSA 2PQMA 5FBKA 1Z83A 2X76A 2DZDA 2AA3A 3C6KA 3R5TA 4S2EA 1NLFA 3GL9A 5CMLA 1F2DA 5G3ZA 2VJMA 3PEVA 3SQNA 4CNBA 1KC1A 4Y2XA 4HVLA 3IBYA 4DXDA 5CNJA 3LNNA 4EJSA 1XEAA 3PNMA 2MTBA 4G4JA 4PPYA 3ZWYA 5BSUA 3QJYA 4E5VA 5JS6A 5LQNA 4Y67A 2WT4A 1V11B 3SK0A 4CLHA 5B3KA 2CXUA 1RTKA 1VBMA 2ZIXB 4QYIA 4DA0A 5JXJA 4P22A 5L46A 3LC2O 3O3CA 4MICA 4EI9A 4F1KA 4M1KA 1WPCA 2QE6A 3JD1A 1OXKB 4LGVA 4C0BA 1E5VA 3IOMA 3FRHA 3OCUA 5FWYB 5JFGA 3OX4A 2FJPA 1GTG1 2P9YA 2YHIB 1ZC3A 1LDYA 1SZDA 3HB7A 3SSNA 4P1VA 2Q2QA 2ENWA 5CM8B 3WGQA 3NV9A 1L6RA 2CZGA 3T94A 3VNAA 3QMVA 3VVCA 5JYCA 1G18A 3V2HA 3T9BA 2FUCA 3AQ4A 5GZ1A 1L7AA 2AN5A 2HCBA 3CONA 3GGOA 1FZQA 1WSBA 1Z47A 5HUHA 1A72A 2W6ID 2OZKA 2BKEA 4GPZA 3T7RA 4KZPA 4WCDA 2YYAA 3Q8MA 3QPUA 3KUDA 4JGBA 5A6VA 3V8PA 5KU7A 2CNKA 4UQLA 2RGYA 5C8YA 4I81A 3GVXA 4IOJA 4MO9A 4PANA 3T52A 1E8NA 1NNUA 3QKIA 4WXRA 3TE6A 3PEYA 5JJKA 5E0OA 1JQKA 3ECSA 3E0QA 1C9MA 2EHJA 3HNOA 1E7MA 1JILA 4N47A 1VYHA 2W2OA 5YASA 2GZAA 5FI5A 1J9GA 1Q6ZA 3NBUA 3I62A 3V8NA 2CCJA 1CY7A 1CE8A 2B20A 4HYTA 5FBLB 5IVIA 2FG5A 3IP7A 1VBKA 2CXQA 4MV4A 1NYRA 2H7CA 4PICA 4R1QA 2OBSA 4RPHA 1GAXA 1WABA 4KGVA 1DVRA 4PSVA 3CUKA 2VDMB 4Z4QA 3ELWA 5F23A 1Y34E 1ZOLA 3OZAA 4ZAXA 1AKTA 2HF8A 4YAFA 3R40A 3PXDA 3SS9X 4AMYA 5J4YA 4DR3B 1GTMA 1QH0A 1EH5A 1H65A 2I6FA 3N28A 1OWLA 1IWOA 4GXTA 5DGCA 5C3UA 2R86A 2X85A 3WNCA 4Y2SA 4AKSA 2OM2A 3CCMB 2B6NA 1T3GA 1T4MA 2QNRA 5EXEA 1TK3A 2PMCA 3UATA 4B4KA 1E2LA 1NNI1 4O29A 4CMGA 1VJSA 1H2HA 1PL7A 3DW3X 2A0XA 1C1HA 3C1AA 2VKTA 1VIYA 2GUGA 3I8OA 3V7WA 1LPNA 2ACEA 2AUNA 4K9MA 1KXZA 1W93A 1CY6A 3CKMA 2B99A 3PHLA 1UXGA 3E48A 4TSFA 3B6MA 1DXHA 1E62A 4S1TA 5B37A 4UAJA 4E5YA 5IBRA 4N48A 5FPKA 2RGRA 3MAAC 1GT91 2ONYA 3AP1A 3K1JA 4RLSA 1CR6A 1YHNA 3IV7A 4LUCA 4FB5A 5HM6A 3LUPA 1RP1A 1Z25A 3HA3A 2PYDA 4BO1A 2Q07A 5LZ2A 2D74A 4G1BA 2WSBA 2QN3A 4M21A 4M36A 3M0EA 4O3FA 3L8EA 5TARA 3TWOA 1KI4A 2Z4TA 4EQ6A 1QKKA 1YJAA 3MQ2A 1ABBA 1TC2A 2WNIA 1LJUA 1MAVA 4CR7A 4XAQA 1PTKA 4WESA 4B84A 3LGXA 3BZBA 1MC4A 1JR3A 1HF3A 1OIVA 1BMQA 3LVQE 2NOAA 1TPYA 3ORHA 2QL6A 4G0XA 1C4KA 4KQXA 3SBEA 3G0BA 3HFGA 1PGNA 4IDNA 1RABA 4UM7A 1GKYA 2GZSA 3RSQA 2MYUA 4U1RA 1N6PA 4JLWA 2AJBA 2O3QA 3ENVA 4E30A 3GJ8A 2JJ8A 4KGXA 2DF8A 4NCHA 3OQ1A 2NSHA 3U26A 3NAQA 3EW7A 2ZEJA 2Y0BA 1Q92A 4QVKA 4WHMA 3I0MA 1HZEA 1C8BA 4CN8A 1Z8HA 2H1FA 5IAAA 2W6CX 1M90D 1AF4A 3FNEA 3MINA 4BNJA 4E88A 1G7CA 1JQBA 1KJQA 1SOWA 3A4IA 4MP6A 4DIFA 4EY5A 5K0CA 4ZT3A 4KREA 3RUHA 3MRTA 4HJRA 2BP7B 4J7XA 2D1YA 4Q9IA 1YJXA 3CJRA 2DM6A 3P0JA 2J07A 4UREA 5K03A 3TZEA 4DV5B 4REQA 1T0UA 3L7DA 5CB4F 3O74A 1E1QD 4GSKA 4UU8A 1UAGA 1NUTA 1Y8AA 1J0CA 1DKOA 3ORYA 4BLSA 2ZZFA 3IQWA 1QIKA 5HZHA 5KNDD 4I9NA 4ZVUA 3UKJA 2PZKA 2YVLA 5A02A 3AOGA 4E2ZA 2AUTA 2V8BA 4IH9A 4WKGA 2KLBA 3BGSA 1HH4A 3ZIAD 2ZJFA 1D9XA 2Q0SA 4LHSA 3TTUA 3W6OA 1AMOA 2R5NA 4B3MB 5BN5A 3SIRA 4IZHA 4I9UA 1MW8X 2FN4A 3P0EA 1QU2A 1ZGBA 4JROA 4FJ0A 4IIXA 5EHXA 2WYRA 1II8B 4QM6A 1VCMA 3W3AA 1GADO 2IS6A 4TRMA 3ZDYB 2O2ZA 4JJFA 2WQZA 1Z5VA 4Y6PA 4YV1A 2VXYA 3FWYA 3ISXA 2Q6VA 5EEGA 3AGPA 3HUUA 1EE9A 5A88A 3OC0A 4GPIB 3OCJA 4WCVA 4H6WA 2IXDA 1OW3B 3HACA 3O9ZA 1MG0A 2FRDC 3ADBA 2BELA 4O4JF 3OQOA 3NBQA 4YO7A 1I1OA 1NE2A 1F6DA 4JEIA 4IOMA 3WYNA 4F38A 2OBRA 4Q47A 2FMUA 2IS1A 4ZOCA 5E6RA 3QXSA 3ZI7A 5BQ3A 1SCNE 2YHAA 1ZN2A 2J08A 3F0TA 4QATA 1F1BA 2QLMA 1TDJA 2QMQA 4ER0A 2NPOA 2ZIAA 5C7LO 5I9SA 3GC6A 5A9SB 3L6UA 5P8WA 4M38A 2GFIA 3F6EX 4XQ9A 1A0OA 2ZTHA 2MR6A 4L74A 2C4HA 5HS6A 4FFBA 1QYDA 1RYFA 4W4TA 3FLMA 1MPXA 4YI5A 1RFLA 4CIWA 2V7XA 4RH0A 5EE0A 4A16A 3G4SB 2WYHA 1C4OA 1ZK4A 2PH1A 5GONA 4YYZA 5HIIA 2XKKA 4AI6A 2ZRQA 3GOQA 2XF8A 1FS5A 1HL3A 2QGGA 1SXIA 2RC6A 2FI1A 4IUCS 4F8YA 1WW2A 3HWSA 3LUJA 5ER9A 5BMVA 1XEXB 4X3PA 1VIDA 4YV7A 3DFIA 4B2IA 2EDAA 2LIPA 3V76A 1NR1A 4FDAA 3P9PA 3NLLA 5BUSA 3DVAB 3UT0A 2O05A 1ONOA 4R1SA 3E3NA 3H9CA 4IILA 3ZZ0A 3DMTC 3BUSA 4C0KA 4YJDA 3AT1A 3T4PA 3WLOA 1QLHA 2CZQA 4UQPA 1RLJA 1WSRA 4J90A 3LL4A 1JWLA 2QM7A 3GFQA 2R6AA 4NRDA 2R7LA 3CEHA 3IEUA 5TSDA 4BNGA 4AK9A 2CF4A 5J3JA 1UP6A 2PKXA 4X8MA 1UBJS 1DOHA 1YRHA 1ZAKA 2FQWA 4HMQA 4HQ6A 4U0JA 3RASA 1E9AA 4EHKA 1XE1A 4LQCA 4GLOA 2CLKB 3VR6D 1SHTX 1DAKA 2GTIA 1T0HB 3IMKA 2R00C 3H84A 1FU8A 2CLDX 5C8YF 5L53A 5EESA 5JYBA 5LKAA 3QU9A 4GOJA 1QHHA 2YZ7A 2B78A 3RRFA 1U9ZA 4CMBA 3I9OA 4GBJA 4QRDA 3T1VA 3ZOZA 2ZU0C 3F67A 4WWVA 2BD0A 3PNPA 2ETXA 3R6LA 3MOGA 1HMPA 2YCLA 5EZYB 3W1VA 1XYYA 2LXNA 3GRFA 4C7KA 4C2BA 3NVAA 1LPBB 4R2HA 1YRAA 5M29A 1B16A 2BHSA 4FSDA 4I3GA 4WL0A 4JI5B 1QYVA 3BSYA 3K53A 1XQVA 2GVZC 5IWAB 4M1EA 5FI0B 1N8TA 3HZZA 4LJ5A 1WCV1 2XTMA 3ZGXA 4MAMA 1OC4A 4ARIA 3CCJB 2X6XA 4N12A 2VBVA 3ADPA 1XTJA 5JRJA 3DBRB 5DISB 2C7PA 2QZJA 3IA2A 4QJ5A 5U4XA 2XODA 3ZXUB 2PGXA 4KFRA 3TN7A 4L5JA 3RC9A 1YA4A 2IVZA 2JFYA 2GJRA 1LPSA 3N0WA 3GLIA 1JI0A 2QTHA 1NN3A 3WI7A 3OH8A 4PZEA 3WWEA 3WYGA 4BV3A 2XDAA 2MYNA 4BZQA 3VSDA 2QX7A 2PY6A 1ORHA 4O2BB 1PUXA 1MOQA 1PX2A 1YE5A 2F3TA 2G4VA 2XPCA 4Q7MB 2CFTA 1E1RA 2Z2YA 3IDOA 4DRXA 1VSBA 3I01A 4X8LA 1X0XA 3Q3JB 4DWOA 3O1IC 3PHHA 4ZVMA 3SYRA 1K3TA 3A37A 3C43A 4YCMA 3NH6A 5FPYA 1JXQA 5E7MA 2OORA 4DARA 3E7FA 3H86A 1U8XX 2HHAA 2ZI5A 4NIMA 4XGKA 1DQNA 4E0BA 1W36B 3HC7A 3STYA 3O4VA 2A92A 4US2R 3C6ZA 2YXDA 1BSVA 1TZ2A 4DLBA 2PGDA 3KV3O 1W59A 4AECA 3MXTA 6REQB 2O5RA 1YQXA 4JT9A 4BVFA 1NXWA 3EJWA 2CE7A 1TYEB 3A1VA 5K99A 2IS2A 3IDFA 1RLTA 3TLCA 2PYZA 1X7ZA 1IDN1 3PF9A 4LFAB 3HLYA 1IBMB 3WLFA 2Y92A 5H16A 5DLQC 4RMHA 3DKPA 4KO1S 1R6TA 2XTZA 3DS8A 3PXEA 5DBEX 3RODA 3FCSB 5TRTA 1GAQA 4Z4HA 4G0WA 1TTTA 1C41A 1I51A 2GPTA 3FR7A 3N2LA 2OCAA 4DUGA 2R8PA 3QE4A 1T9KA 3CLRC 3LQQA 4OHCA 3A6EA 4URWR 1JU4A 3HJAA 3V1YA 2PH7A 4Z54A 5FBVB 3GGJA 4OMDA 2Q5FA 4RXMA 1YVEI 4B73A 3F3MA 3EGDB 3TD9A 5LQRA 4MQBA 1CG6A 2K2QB 4JUDX 4P0PB 1W4ZA 5BWBA 2NTVA 2RAPA 5CW2A 1JEOA 4MI1A 3UJBA 5GADl 4GC9A 5EKDA 4IIHA 4MVJH 3ER8A 2HYDA 3NOQA 3A05A 3UAVA 5CGZA 4F2GA 5IU6A 2KBFA 3PC6A 2C8KA 1ECGA 2GA9A 2GEUA 2LIVA 3NC1C 4BX9A 1T3SA 1GEGA 2QRMA 3PQ6A 3M6MD 3W5IA 1NFRA 1ZXLA 4B9AA 4YC7A 4MKZA 4B3IA 1EVEA 4PY2A 4YX9A 2RAFA 1USKA 1Q50A 1C8KA 2ZYDA 5HW0A 2JGAA 3L4BC 2CV0A 1H2ZA 3CLSC 5AK3A 5TDHA 5B5SA 4MW0A 1UBHS 2AZMA 2PG3A 3EXFB 3KJEA 5DX0A 1KETA 3M70A 2VDPB 1AHPA 1PYDA 2ZRDA 2D0OB 3NIGB 4ES6A 2B5WA 5JZ9A 3AR9A 1Q9SA 1ZMRA 3BX1A 4G67A 3K6RA 4BO0A 4Z4YA 3C6YA 5KTNA 4D0LB 1QK3A 3PXBA 3W6NA 3G89A 5FT9A 1W47A 4KN9S 5BVGA 4WZLA 1C29B 1NYLA 1VG9B 5FDFA 3H5RA 4M9ZA 3ZE8A 1U9IC 1P0MA 2HJHA 2PEZA 2WWFA 3O3NB 3Q72A 4JYCA 4Q39A 3C3BA 3X1YA 4AUMA 1DJNA 4TVSA 4RLZA 2HWYA 4JYBA 3ESQA 4RENA 4BX0A 3LOQA 3G02A 2G5CA 4YH1A 4B47A 4ZCMA 1J5PA 4D41A 2EP7A 1G3IA 2Q4TA 3HCAA 4X20B 1M2HA 3A1EA 1OBHA 4DVJA 2NZVG 4DV3B 2XRYA 1U5BB 1VMAA 3W0LB 2V6BA 4XDYA 5FL3A 1PG0A 3QFCA 2OK7A 1XZGA 2WU3A 3B89A 3MXOA 3TFQA 5BMVF 2K87A 3CC7B 3L0ZA 4P3OA 1CVLA 4XASA 1E0SA 2ODTX 1M1YA 3BS4A 2O8VA 2NUBA 1GU1A 1VIAA 3G6EB 3BRQA 1PR0A 4FLEA 2C7VA 3USCS 2OCDA 3GGCA 2UZ0A 4RIIA 1I30A 1J0EA 1I8DA 1NLYA 5EJ7A 5EYPA 1QHYA 4J16A 2B83A 4FD2A 5KNLA 1F6WA 3DEYX 4EX7A 4R41A 1XZMA 5D87A 5LIPA 3GGGA 3AF5A 1P4RA 4KAJA 4QBTA 4AMUA 3U44A 3LPNA 3G6KA 5H3LA 1A8UA 4DIUA 5FUMA 2WF8A 5DIZA 3TEJA 2HA7A 2ZP1A 1N2GA 4XQCA 4QYXA 5FPHA 3QFHA 4H3SA 3PGLA 4OI1A 4AJHA 5ABPA 3JTEA 1GGEA 5EMMA 3B6EA 3P2IA 5B7PA 3DWGA 1OH8A 1ESEA 1L1QA 1VM6A 2D3TA 4BJ6A 1CUIA 1WU7A 2BTQB 1T8UA 2OB1A 3CBGA 3MJEA 4P4UA 3ASSA 4HLUA 1RZRD 2CSXA 3HJFA 3K9WA 2AD5A 1C7ZA 2B61A 3PVCA 3T61A 3V1NA 5CB8A 1VLYA 5T67A 3WGJA 4Q4AB 5LZ9A 3AKDA 2EQBA 1A8SA 4M49A 3GU3A 2DP4E 1D5WA 4C0LA 3H2IA 4GP6A 1W88B 3KKNA 2CVOA 3I2GA 4LRTB 3DBLA 3FETA 5AM2A 5EEHA 1MG5A 4L95C 1E2PA 4DQDA 1EG7A 3Q7TA 4J1SA 2ZGVA 5CEJA 5KWJA 3OHSX 2UDPA 1EFRA 3HY3A 1MLDA 2QUKA 4HAUA 5E6SA 4WY5A 5KEIA 3EEBA 1DO2A 2CVQA 1MHTA 3PA2A 3KXDA 1HE5A 2AE1A 3CZ9A 4DSAA 3COJA 2PBZA 1F4VA 2BKLA 2A8YA 3R7WA 4N6OA 3I56B 5EQFA 4EYSA 3H5WA 1DMRA 2ZTGA 2NSJA 3PGXA 5FXMA 3V46A 2EP5A 5ELXA 3AVPA 1M34E 2WR8A 1NF3A 2GF2A 3RR2A 2ECPA 5LN1A 3CNNA 1C1DA 3Q8XB 3K1AA 4KQ1A 2V96A 5JV5A 5AJWA 4LGMA 4TZ6A 5BYAA 5IYNA 3EVFA 3LYAA 2ERYA 3FUVA 3GJ4A 4RHXA 4BNZA 1U6IA 3R7LA 4S1OA 1QHEA 2UZAA 2NWQA 1KBQA 3WDSA 5BRAA 4MQ4A 3UJDA 3LDHA 2QQ5A 5FORA 1FYFA 2D54A 1JIUA 1KJWA 2P6OA 3SQLA 4EH1A 1EBUA 5AW4A 2IEYA 1VJ1A 3AR6A 3H83A 2H1LA 4HB4A 4O8ZA 1O9BA 3NYIA 3VR2A 3GLFA 4IMJB 5LIRA 3B3AA 5B36A 3OJXA 5DXAA 4MS1B 2A7QA 3DF7A 4S2UA 5FNVA 1J70A 1P1RA 2GO7A 3AC0A 2I4TA 1Q1QA 3ZV3A 3I05A 3D6HA 1ECBA 1POXA 2X7JA 4A4DA 5ENVA 3AUAA 1TM5E 5CVVA 1I5RA 5EVCA 4ENRA 1LTQA 3AF4A 4JSTA 3DJYA 5EHZA 2XUFA 5KSWB 4FGZA 4R9SA 4FMCF 3ZYCA 4MIYA 1KSHA 5EMLA 5HKLA 3O0TA 4YJ3A 5M7EA 2ZUSA 3HVKA 5HF8A 1G20E 1NUUA 1USVA 2H1VA 1NRKA 1O96A 5M34A 3KELA 3SDZA 2G28A 3JD2A 3HO6A 3IXLA 4ZODA 2BTOA 3SN6A 5LQCA 3NTUA 5F3WB 1KMNA 1LB1B 4HZIA 4PAQA 2GCOB 3UMSA 1XMIA 1DP4A 1XBTA 4FX5A 4GZLA 3ELBA 3K5HA 4Q12A 3B1ZA 1EZZA 2F1RA 1GN9A 3I9FA 1HOTA 4FWTA 3AFOA 2JRCA 4ICIA 4DQXA 3O4RA 3R6JA 5A6SB 3TQHA 2VF7A 2XNJA 1RZVA 1HORA 3ZK9A 4PYOA 4Q3BA 3RC2A 4MRPA 2EKQA 4E31A 4LZAA 5IT5A 4ND3A 4DBVO 4C30A 4YT4A 1KVQA 3M5DA 3UK7A 3VNQA 1QTRA 4W9NC 4W5RA 2QLLA 5HCUA 1KHHA 1M2FA 3MT0A 3QSGA 2UXCB 4C3OB 4PPGA 4I55A 3C7TA 3IHKA 4OQXA 4QLAA 2DJIA 3OO1A 5B55A 5I5GA 2Q3FA 2QYOA 3DKKA 2IYTA 4AUKA 3RTGA 1E6LA 1ORWA 1SUBA 3N2EA 2C78A 4AWBA 4RE5A 4BV8A 2G17A 3CE9A 1XSEA 3ROMA 1WP6A 4OQYA 2I66A 2GHIA 4EOGA 3EWNA 3QWBA 4IIBA 2IU0A 4NESA 1KEPA 1SVMA 5CUQA 3EAFA 1XAGA 2X22A 4YHBA 3I04M 2QT0A 5KOHA 4O4IA 3COZA 5A4KA 1TT5A 4NXNB 3I1JA 1TI7A 2HDOA 2RKBA 2PS1A 1OZHA 2WWTA 4G89A 1N6HA 2RK3A 3IE0A 3AR5A 3R44A 4KYIB 3OKFA 3K8OE 3BZWA 1ATZA 1FBTA 4QUDA 1DBVO 3WKCA 5JC8A 1UMBA 4C01A 2W8ZA 5L3VA 4M89A 1W5FA 2ADFA 2YNMD 2YZKA 2OP0A 2ZAOA 1KP3A 1VQ7B 4ZA2A 4GECA 1XNHA 8GPBA 4P9SA 4RSMA 5IRCD 1BXRA 1GARA 2QVZX 2ZAGA 1VHWA 2UYOA 2VJNA 3KS9A 3KQUA 1XNQB 4OQMA 4ALKA 1I14A 1U8TA 3D8UA 4TUYB 4XXHA 5G40A 1HG1A 1JSLA 3HCEA 4KVGA 3SXUA 4D4KA 5CA1B 3PQEA 1MTZA 2C4MA 4G5SA 1RM3A 1M75A 1ZGJA 4CYMA 5IS2A 5JS7A 5B3AA 1PLKA 1CJTC 4UMVA 4YRGA 3TW6A 4CFSA 3Q8LA 5IPFA 2BBOA 4RTLA 3PXUA 4LMAA 1VJGA 4W5HA 4S35A 1JYEA 4TXLA 4DPLA 4YMUA 3FPEA 1FMTA 2GOYA 3OIVA 4N03A 4JZKA 1I9GA 2VEDA 3KYCA 3L84A 3MCUA 4FBMA 2XWSA 1V1JA 1UD4A 1NJ5A 3C5EA 4HUQB 4JY7A 4ZD6A 1L7NA 4BMNA 5C9ZA 2QMOA 5HF6A 3VHRA 3ZWOA 1P4GA 4F72A 5REQB 4OX9Y 3E9EA 1B93A 4QUGA 4ZT6A 5SZJA 1WEKA 1ZR4A 1K5DA 1OBVA 2BFEA 3LFUA 4QDXA 3UMMA 4GMKA 4AYTA 3F4BA 3PC8A 2MOKA 4JI0B 3RYCA 1KEEA 1CDZA 4GG1A 4HDQB 3U7QB 4Q7LA 5ICFA 4BTEA 4JLNA 4JVMA 5FLXA 1YZ3A 4IIDA 4D98A 2L69A 2RDMA 4MDEA 3BY1A 2RGXA 2HSDA 1KKMA 1IM8A 1U0FA 3B1KA 2B4AA 1T8SA 5E9QA 4GYKA 1LX7A 3UPTA 4F6CA 1CY2A 1B3BA 2QM8A 3E1KA 1YI8A 2CDCA 4A1OA 2F8SA 4BO8A 4IOLA 3SWWA 1AMNA 1C1XA 1G3MA 1Y1SA 5KX5A 5EHQA 4PQYA 4U7HA 2GNOA 1OPXA 5DYWA 5JOQA 3RVLA 2APJA 3B52X 1XTZA 3EF3A 2BRUC 1JXAA 3FCOA 3L8CA 2P67A 4IIJA 3UANA 1GDDA 1RQPA 4K0RA 3IP9A 2FWBA 2GS9A 4HB0A 4HEA6 3DPIA 4KNWA 2ZR0A 1ZHHA 2Q4BA 1P2GA 1Q44A 5ENDA 4DNRB 2BM1A 2VHZA 1P6XA 4RYLA 3BD6A 2VP6A 3OLQA 1AURA 4R8LA 4R8VA 5GQSA 3V1LA 4IWXA 4HN9A 4WDRA 2FP4A 5C1OA 2J9GA 1WLSA 4NAVA 5CCBA 3HWRA 4QD3A 1N08A 2O0KA 2P9ZA 1ECJA 1OLSA 3P2MA 1SXJC 3P9RA 4H1HA 4L8YA 4EG5A 2QZPA 3C1OA 2OSVA 3AR3A 3PYMA 5AW5A 2C7GA 4A2QA 4CKEB 4F4CA 4Q4JA 5GGYA 3KALA 4F04A 1Z3IX 4MEBA 2XT9A 1WPXA 1M7HA 2YR0A 4KV7A 1ZICA 2WTXA 3NUZA 2IRWA 1GL7A 4HNRA 1I0ZA 4TYQA 3NM6B 1IMJA 1NZFA 2HSGA 2X2PA 5BQ5A 4JBYA 1D0IA 2VDKB 4IDGA 2LDXA 2GREA 2X7HA 1F0YA 4YJ2A 1KZLA 1U7TA 3A6LA 3ESRA 3HJHA 3UIEA 5FNVF 2X0FA 2Q3BA 1ZU5A 4F11A 3DLBA 3MNFA 1D07A 2CK3A 1RYEA 2NO0A 1EGAA 3DAGA 1A4RA 3I04A 1G21E 3S2UA 2A5LA 5JVDB 1NXQA 5F33A 1RXUA 2I4IA 1T35A 1S2LA 2JLSA 3D7RA 3NPMA 2QR2A 4CM3A 3C8ZA 2JRLA 3JQ6A 2Z57A 5TLSA 1P81A 1KMMA 1Q20A 2CDRA 4U2FA 3F8TA 1GPJA 1BMFD 4YJ3F 4YCAA 3LC0A 4FILA 5CVDA 5E6UB 5AKJA 4CTKA 2BOVA 5JSZB 4OAPA 3A35A 1A69A 1LK7A 3BWXA 4I66A 3REFA 3A2KA 2AOUA 4CIAA 4UDYX 1P7PA 5DHSA 1I4EB 4QBGB 3SKYA 4WK2B 2I65A 1HMYA 3OQJA 5FI3A 2AS0A 2FHSA 4RPJA 3PWSA 1W2WB 4INZA 1W46A 4PG7A 1UJ4A 1Q7EA 1Y8QA 3AHFA 3MWYW 3ST7A 4C0JA 4B34A 1NFFA 1A2BA 1DQRA 4YRRA 2VOJA 1JALA 2VAXA 1XCLA 1GTVA 3VX4A 2V9ZA 4N7RA 3L41A 4MLCA 3PDWA 4OGGA 5A9TA 4DEVA 1NKSA 4I55F 3JWJA 4HDKB 2ZR7A 4OPSA 3AUJB 3F9CA 1ZLXA 1XZ8A 2AN4A 4BAUA 3B12A 3CUUA 4I9HA 4YP6A 4NMLA 1ENPA 1TM7E 1M6NA 2R85A 3QX8A 2J67A 5IAJA 4DLZA 1P1FA 1V9LA 4P5PA 3RVJA 2PUFA 3G1WA 4X06A 1I10A 3LWDA 2JI9A 3CEAA 4H1WA 1V95A 5BQXA 5KTPA 5KPJA 1YH3A 1OYYA 2EL7A 5M5BA 4DR1B 1PBTA 1QRDA 3N2NA 4O4IF 2HF7A 4FE7A 5LC1A 1F0KA 3CURA 3ZJ5A 1UQTA 4KH0A 2SECE 4DG5A 5I4KA 1T2UA 4PLFA 1OAOC 4HDNA 3W6PA 3JSXA 2XF2A 4WCFB 4A92A 3EEYA 1SC9A 1RYBA 1XDSA 2XCRB 2O54A 4ATNA 1KVSA 2QLJA 1AM4D 1V5EA 5TV2A 1TVKA 3GH3A 3M6AA 4QOFA 4RX1A 4ZI5A 3IRUA 5KUTA 4MAFA 4PLZA 5CLGA 2ANBA 2I6UA 3N6XA 4KQKA 4G5OA 4XLZA 5F21A 4A0HA 3DKRA 1A82A 3CMMA 2EQ5A 1R37A 2ZIUB 3PLRA 4M0UA 2FMTA 2Z1MA 4CQNA 4EYOA 3OEWA 2ZJ3A 1OI7A 4U39A 3OJFA 4LSMA 1N2BA 1JSCA 5DCWA 1YKGA 3RKUA 3ZHTA 4XN0A 3QBTA 1TKAA 4DDVA 4JLJA 2XBLA 3AB8A 3DTVA 3RABA 2GJPA 3RT7A 3UJCA 4YQEA 3AHIA 4K6MA 2W70A 2NU8A 4FEEA 3E7XA 1CE8B 1ULAA 4RH1A 3STVA 4AFNA 4DBZA 2GLXA 2JKVA 3OF3A 3I8SA 1NR5A 5H5JA 3IC5A 4L5YA 3BCSA 5ETJA 3ETJA 5EJ5A 1ZGCA 1NVXQ 2ZPUA 2H4JA 4IDCA 1AA9A 4XX0B 1UC9A 1E9RA 2PBLA 2LZ0A 4FSHA 1G0OA 1Y8ZA 1QH8A 2HU8A 4MV8A 4BMPB 5J58A 1TW3A 1X1CA 3NGMA 4QQFA 3E5RA 1RQNA 1E1CB 1UJ2A 4MR9A 4MWZA 5FBZA 1XVLA 4DR7B 1IM2A 1L4MA 3AERA 3AG6A 3AHGA 3DM9B 5BSGA 5L3QA 3T1YB 4XNFA 4AJOA 2IHUA 4RLFA 3HKCB 2C9BA 3IPAA 5HIJA 3BWEA 4KR3A 1TAQA 5E3JA 3O94A 2IPAB 4DK1A 4QECA 4CU5A 5CB0A 1M3SA 4GRAA 1RFGE 3TUIC 1C9DB 1YR8A 1O57A 3E61A 5C7OO 2X1MA 1L7PA 1DARA 1U02A 3MMNA 2YJZA 2Y9MB 1X7YA 5E2AA 1ZCZA 2OUIA 3JVIA 2HCFA 5AVRA 2H92A 1JA0A 2BEWA 5ESDA 1GXSB 3A1PA 1NONA 4I14A 1A95A 4R16A 4L08A 1YFKA 4R1NA 4RHFA 2Z58A 1GFSA 4BTVA 3E23A 4F21A 2G09A 1UPCA 1GUFA 4XOUA 5JE8A 3ZDXB 4EGSA 5ITVA 2WVGA 3MTEA 1G8YA 5E3HA 4F3RA 5JDIC 4MUNA 1I7QB 1HFJA 3V42A 3WAGA 1YA6A 2ZIZA 2E55A 4YRSA 3CB4A 3L8HA 5CXSA 5KX5F 4AKHA 4UBOA 3KQOA 1AH2A 4YROA 4DCMA 2P4SA 4G97A 3RTEA 4EW2A 3RRMA 3Q3EA 3WHIA 5JUWA 3ND9A 5HRAA 5K4GA 2ZIEA 1P2SA 1ZJ4A 4IG9A 1FLNA 5LCXA 4C5CA 4EEXA 2O0JA 3HN2A 4IIJF 3TL3A 3PYXA 3GRAA 3HK2A 1B0AA 3SQWA 3LVRE 1DO0A 5A3JA 1DC7A 2FUG1 3I09A 4IIEA 1UKEA 2YXBA 3P9CA 4Y2TA 1FRFS 1PKXA 4HH4A 4Q19A 5HUQA 1G2QA 3O26A 3SR0A 4FONA 3WMXA 1GSAA 3PQ7A 3W5HA 1O2DA 4ITVA 1LLQA 3QVXA 2WUWE 1SMKA 2PSFA 3F4LA 1FFCA 1S1MA 3LY5A 1ZMTA 2WF9A 2VTEA 4OOSA 3NM4A 4WGGA 4Q3KA 5TQJA 4YJFA 1W36D 4P7GA 2XMBA 4HBGA 1DMSA 2LPMA 2NV6A 2IXBA 2W2KB 3QA9A 3WWDA 4REQB 1CJUC 4QGHA 4QVIA 4RKQA 1H2EA 1UT6A 3CX7A 3D8HA 1ZL2A 3G71B 1JT2A 2YV3A 2ZL5A 4PG6A 3E5MA 3KB1A 3ZC3A 1A04A 1E3TA 3KTOA 3EG9B 2GJAA 5FUQA 2PD4A 2VQSA 2I4OA 2IEGA 4OQZA 1T6NA 4UHDA 4RSRA 3P2OA 3ASYA 1C3OA 1N5KA 4I36A 2FSVA 4OXYA 1US8B 5FF9A 5FL7D 5THKA 3V8BA 4BNKA 4O4HB 2GPJA 4WLFA 1R6UA 2JIOA 3P4UA 1DIOB 3FKSA 1EQUA 1GNQA 2JBAA 3OA0A 4YJ2F 4D74A 3ESBA 2WF5A 4AJKA 1VE7A 3E9QA 5ARDA 4X07A 3JD3A 3PDIB 5KYWB 4DR5B 2PUAA 2C7QA 3SKBA 2JIDA 4RV4A 1U6JA 1LVUA 3FWKA 1IJKA 3IQFA 3JASA 4FKZA 5JSHA 1RBQA 2D4AA 4BGVA 5FYDA 2F1LA 2J0QA 4ZO8A 1R4MB 1ARZA 1VBFA 2DFTA 4WKNA 3TDKA 1RACA 2AWOA 1Y4AE 3W2FA 2JAUA 3PQDA 2C0QA 3P9QA 3P2JA 3DT8A 5F98A 3O2QB 4L4XA 4RA6A 5F7ZA 4ARZB 1MAHA 2W2LD 2BVNA 1W30A 4XKJA 4ZJZA 4UOQA 2EV9A 4PGGA 4YNBA 2CHGA 2TMGA 4H35A 3U1BA 2JJYA 4HO1X 1U3DA 2NUAB 3WJ1A 3QVUA 2HCRA 2I6SA 2X8KA 5TR9A 1YDHA 1P1JA 2R1ZA 3P5BA 2EOAA 1XP5A 3HFRA 1X1SA 3LXUX 3S5UA 1QZ3A 4XLFA 3TUZC 4AS3A 1NTOA 3FNQA 2JJ1D 3SQOA 3C8DA 2P9QA 5GONB 2QL9A 3ICPA 2P35A 4PTLA 1R0KA 2XB8A 4YJHA 2V7TA 2OV8A 2NPIA 4QPPA 2ZBPA 1D03A 2GN2A 3FOEC 1R0RE 3IPCA 3Q3HA 4IEIA 1QHFA 2VAWA 4MLPA 1SUFA 3ASTA 2XYQA 1QR2A 1YNOA 4MMZB 3WL8A 2AYYA 2A78A 3M4XA 1AHNA 2I4NA 3B5JA 3OQIA 1WUJS 1LBSA 2CSUA 1VG1A 3VH1A 3PHJA 3WO0A 3W8RA 4ESOA 2EJBA 5EFZA 3KZXA 4DILA 1P0IA 1UADA 4YHHB 3OTGA 4BE4A 4OBWA 4HDSB 1G5IA 3ERCA 4EKGA 3TVDA 4HAZA 3HV2A 5BSFA 3AUFA 1ZM4A 3D5QA 2YV2A 1FTWA 1WE2A 3FPHA 1H6DA 1HDXA 2F3UA 4I8XA 4NCBA 2C3UA 3HVUA 1PWZA 2GCPA 4YVFA 1BEEA 3DVSX 1CERA 3Q7PA 2HU2A 3WRWA 1NB9A 1MORA 3GRPA 5IYRA 4BKPA 4V24A 4ZREA 3VPAA 4R2IA 2BHLA 4C2UA 1I7LA 3IFSA 3IIIA 4M86A 2QTAA 3C85A 4MSUA 3ZD8A 4F60A 3ZX4A 1EFPB 1HT0A 4FHFA 3RCBA 4N76A 4DDTA 2Y2VA 3LKVA 5ALRA 4D5EA 3AHCA 4FHDA 3HM9A 2XDYA 3E3LA 3CLVA 1PJ2A 3LY9A 3ODGA 4G4SO 1THGA 1G42A 4LV8B 4NDNE 1XRMA 3EIFA 1NULA 3FDXA 4PFSA 4RK5A 4US0R 1YS6A 4TKUA 4FD3A 1Z2DA 1C7JA 1CUEA 4KCGA 5C46F 2F1IA 3W6ZA 1QF6A 3CNQS 3MWEA 2C5EA 3O03A 2JHPA 1K9VF 5ED4A 4TGLA 5INTA 3AJEA 1L4HA 3T15A 4JC0A 3T3GA 1RKQA 5K9ZA 2AQKA 3DZIA 4B6OA 2C4UA 1MVLA 3SZOA 1NURA 3GEIA 4IYJA 2YN4A 5J2TA 2YDYA 3FOBA 2OV4A 3KB6A 3W79A 1CSEE 3DL4A 5IC4A 4HDOB 5FHQA 3VSCA 4CM6A 4LGCA 1QFJA 2UZ1A 1GPNA 4HAOA 3IAXA 1JTFA 1M2KA 2ZRGA 3A6HA 1ZI8A 3WDLA 5J3OA 3DOJA 1ZD9A 4Z4UA 3LP5A 3UMFA 4PFQA 1GL3A 4GX5A 1M7GA 1K66A 4OH7A 3FAKA 4OFBA 3C3MA 4CCSA 1O6BA 3ZHYA 1QQBA 1N33B 4MYTA 1WOPA 3AW8A 3FGPA 4HD8A 4N8EA 1BS1A 4PNHA 5EGSA 5FHRA 1L0BA 3NV7A 3F9IA 4U7WA 4U7FA 1AY0A 2EATA 4M0MA 3WZLA 4PZLA 2XH8A 4NBLA 1J06A 4GI1A 5JARA 4LCEA 3ILHA 2QI9F 1G7SA 2QA5A 2YWFA 3IESA 1JAHA 1E59A 3TMYA 2BMJA 2IDKA 3IQXA 3ZE6A 5IX8A 3D54D 2WAXA 1R66A 1N2IA 1UJ5A 4TTSA 1Q7GA 5JDCC 2Y05A 4O63O 4MW6A 1E63A 2PZBA 5DF1A 2X8LA 1BFKA 1XYGA 2Y93A 3RANA 2KWIA 4NKRA 4WSOA 1RS0A 3GUUA 3OQHA 1P0CA 1RSZA 2FE1A 3EGXA 2GM9A 1X38A 3QXCA 5CT9A 3BZUA 4LDQA 4YJKA 3V4SA 2OHXA 2ZXFA 5E2IA 2FF7A 4V2IA 4CI0B 4N3BA 4EPXA 4GWKA 4XCXA 2A9FA 4A03A 5HTOA 4G86A 1WS6A 2NYVA 1VTKA 3FM9A 3MT7A 2L17A 2IZZA 5TQ0A 5ERGB 4QJBA 5BN3B 2FW6A 3AZPA 4GOLD 4LNHA 5B53A 3NHKA 1UINA 4PC7A 1I6LA 2QK4A 3B6ZA 3F97A 2L82A 3QHQA 1XJ5A 4RULA 4HS9A 1O97C 3N2KB 5IDWA 4MKRA 4NDZA 2KX7A 2W4MA 3RJMA 2C98A 2R6JA 2WIFA 4GOMD 4XYMA 1G2IA 1CUCA 4WN3A 5KYUA 1WBDA 1EG2A 1ZGHA 2QAGB 4RL6A 4C20A 3EE6A 4V0RA 1ADJA 4MB2A 5JNTA 3WQZA 1W0JA 1T5IA 4QL3A 1ZRHA 3PE4A 1K92A 2R96A 3GQBA 2B8JA 1SCBA 1TVCA 2HM7A 2ZE5A 4RDHA 4EA8A 2JLUA 3NALA 3JALB 1ZCBA 2FW7A 1TLTA 1X94A 4UM5A 1WUKS 4AP5A 5F1OA 2XZOA 3R7DA 1RXCA 3T8YA 3DPUA 3CCRB 1OX4B 1KYZA 1NQ5A 1ULTA 4G37A 3GJ0A 4PGFA 1PKEA 2ZTUA 5HRUA 1Z6ZA 4MUAA 1OX6A 1XU4A 2I7DA 1BW9B 3L5KA 4P83A 4HWKA 3I9MA 4L9SA 1TAUA 1NT4A 3DQPA 1MO3A 1WVGA 3NDRA 3E20A 5J47A 1P9WA 1GQRA 1V71A 2WYVA 4MRVA 5LZ5A 1O58A 3WRXC 5KSOA 3ONFA 3E1YE 4URFA 5CXXA 2WWVD 2E1BA 5GWXA 3DDYA 1DT3A 4NYJR 3FLAA 1R0ZA 3HJGA 3VR5D 1N4DA 4BMVA 1V16B 4FLMA 4EW3A 1SZCA 4MWDA 4R2JA 1DELA 3R3YA 3DV0A 1AKVA 4OG2A 3KSAC 3M1LA 1T5LA 2JLBA 2WKWA 1JDBC 1M73E 1WDWB 1TUBA 3BB1A 1F8GA 2RC5A 3WKBA 5HXBA 4GVLA 1LX6A 5AVTA 3PFHA 4FFSA 5BV1A 4Q48A 1J24A 1IEQA 9GPBA 4MOWA 4ER7A 4X7FA 2EYQA 2PZAA 5KWEA 2BW0A 2H7XA 2FEWB 1UBGA 1BJTA 5FUVA 3GRRA 1X87A 4GHWA 4V1CB 2A1UB 4NAUA 1QP8A 2OY0A 2QP3A 2VQDA 3EFOA 2P27A 4FFWA 1N25A 1JU9A 4YWHA 3ZQ4A 4RQTA 1MABB 5ILOA 1GNLA 2H7YA 3TG8A 1U5AA 1F60A 2R47A 2VXCA 3REOA 3C8HA 5D3ZA 3RUPA 5T3YA 4NENA 5JRZA 3X1DA 5GP1A 1GYRA 4XWKA 4OB7A 3U4CA 3M8KA 3M6FA 2VA9A 4JASB 4WINA 3IO3A 2HHJA 3LLUA 5AKIA 4U9HS 3IURA 3WV4A 1L5OA 1T2FA 5LQAA 1CZKA 1WD7A 1JPJA 2X15A 4XGRA 1DKUA 2QWXA 3Q85A 3CVXA 3UAZA 3RRXA 3DT6A 1TJ5A 3JQGA 2ZRKA 1N2SA 1SHZA 2O07A 2IW3A 2W6MA 3SF8B 3MMSA 1NKVA 1R00A 2F59A 2QGNA 2XTAA 2AMFA 2R6ZA 4B43A 1W25A 3Q6MA 3UJ8A 1W4LA 2OCYC 3GUVA 5FX2A 1QE0A 4FEYA 5CT4A 3EHEA 4M0FA 4S1NA 2IYZA 3I72A 2O7VA 1C3LA 4FB4A 4X1IB 1XZFA 1YASA 3HWX1 4HSGA 4P5DA 1WCIB 3IYLW 2X2EA 4WZAE 4MA0A 2LUOA 4NYMQ 2ZG6A 4GR5A 2VLIA 4L3WA 3VR4H 3K31A 1ISMA 3P52A 1SXPA 2DBQA 1EB8A 2PVPA 2YXPX 2YICA 2FZCA 3PFIA 2XWPA 1KP2A 1IFXA 2N9UA 1Q7CA 2ZPTX 2CXHA 3MZ0A 4TSFD 1SOMA 3MUNA 4HF7A 2V31A 1H6AA 4LXIA 3Q88A 4QYTA 5EJIA 2BFDA 2PMDA 3LT4A 3X1XA 3JS5A 2WHPA 3O8DA 3L7AA 4IJWA 4A8JA 5AW7A 5J2TF 1SD2A 3LW7A 3NDIA 4Q6BA 5BV8A 3GZ4A 1XZJA 5U9CA 4C06A 3C4QA 2BWJA 2EF1A 1PWEA 1EK6A 2FCAA 3JQ9C 3DBOB 4GBMA 2PPLA 2G8LA 2TS1A 2YOGA 3UTCA 1V7PC 3HBFA 3KO8A 3OJ0A 1N7JA 4ZGGA 3COYA 3BH6A 1X80B 3UPDA 5JCJA 4XJXA 1Z08A 2RAVA 3FMGA 1FBNA 1R0BA 4MQUA 4P93A 4Q1BA 2MSWA 4HKTA 2NGRA 2Q41A 4LF9B 5F9MA 2K2WA 1JR3D 4GLFA 4PAOA 4JXJA 3I6QA 1C9EA 2AQIA 2I3GA 4WOBA 4X94A 4YMVA 3QV2A 2Z08A 1Q12A 1KIMA 2PZ8A 4F3NA 1DCFA 2AW5A 3CF4G 2ZJ4A 3KJNA 4N5MA 4ZKEA 3QFTA 5D8DA 2BFAA 1FFBA 5AM5A 5DCUA 1ML3A 2NAFA 4P08A 4B82A 4WKOA 1DAPA 1MC5A 1RQLA 2C3OA 4C7OB 1VQ1A 4REOA 2F1OA 1RWMA 1IAQA 3P0HA 4FFVA 4GQIA 3GLFB 3SM3A 4M1SA 1XCBA 1NZJA 5L6MB 2FUEA 3D6MA 3F7OA 1LNQA 3BXHA 3CM0A 3II6X 3KBBA 1ID8A 2XBUA 4FBGA 5HE8A 3QFRA 1BA3A 3H87A 3R3VA 4RMIA 1EGHA 3C6QA 5BSVA 2BDEA 3QVWA 2R2AA 2NUTA 2AFHA 3JXEA 2CV1A 2QY9A 3AI1A 4KPUA 1GY8A 2PMKA 1QGOA 2DWCA 4WGFA 4BASA 4F5ZA 4H7FA 1EP3B 3PDCA 1H8HA 2IP4A 3N9IA 3U0VA 3DOCA 2YWEA 1KYWA 4YJ3B 3C16C 4CV0A 4L4RA 2GESA 1E1MA 2XIQA 5IJWA 1R4NA 4JDPA 3HN7A 4KQIA 3STUA 2I71A 5GJBA 2GFQA 3H5LA 3NANA 1MB4A 4YUYA 1WMEA 4E3ZA 1LSJA 3W3AD 3OESA 2NZUG 1KL7A 1WCYA 4GGOA 4JGGA 3COPA 3C7DB 1XZPA 4KODA 3G5AA 3PPXA 1XWWA 4IEEA 2OTJB 2EFCB 5JC1A 3M6WA 1DFHA 4DJ5X 3S1SA 4U3JA 3HU5A 1AK9A 5KNDH 1E77A 2E6KA 3AEUA 2OZPA 1ZMOA 3A4MA 3DGEC 4CFYA 2ZSIA 1XXHE 1YTLA 1SBYA 3OLVA 4FNMA 5BNFA 3EPHA 4LRWA 4D3ZA 1JMVA 1J49A 5HCIA 1O8BA 1FXUA 4I5EA 4BEBA 1YUNA 3GJ5A 4KLAA 4OHPA 2Q45A 4CV3A 2BFMA 1PR4A 4PSCA 1NSTA 1L7XA 2D1SA 4C2TA 2WTEA 1Z4OA 4KTVE 2YASA 5KCZA 4DVGA 1H2RS 5GV8A 2WK1A 3H7IA 3LPMA 1OMOA 1JGTA 3MCAA 3QEOA 2PBFA 1AZLA 1Y4DE 2PE3A 3I6IA 1FXWA 3KL2A 4Q1EA 4S1VA 4PX5A 1TYAE 2C54A 2ROQA 2O50A 1DQZA 3VKVA 5KJ1A 1SPXA 5LD2C 3CO0S 5FTWA 5KOHB 4JVSB 1TT5B 2DKNA 3BL5A 5HG0A 1K0FA 1SOAA 3NO4A 3OWOA 1YMVA 5DYGA 2IH4A 3M81A 1GUDA 4OB8A 3N07A 4BNYA 4JBGA 1N0WA 3BN3A 4B4WA 2ZYTX 4LTDA 5D6OA 3KT3A 2DSTA 1EFDN 1R9MA 1BQEA 1UMBB 3CKKA 5K1ZA 2OO5A 2FPWA 4DF3A 3EXHC 4WPGA 3SLDA 2PKYX 5G02A 5SZIA 4EX6A 1KFBB 3RSSA 1H6BA 3KVVA 4FQ5A 1R1DA 5CH8A 3RWBA 3D8TA 2ZBDA 4NARA 4HNGA 4HSEA 4LXYA 2EZ4A 4RDCA 5I7EA 2FEMA 3J7TA 4YXWA 3D6VA 3MAJA 4P81A 3R8XA 1ADGA 1BXRB 1NPDA 1NYQA 1RHRA 4KXMA 1YGPA 4RS3A 5F1YA 3U62A 3W8DA 2BHTA 1T13A 4ZDJA 1UBTS 3DV2A 4UZUA 4P3IA 2D5CA 3GXOA 4RY8A 1MX1A 4MUXA 5E4JA 2DH6A 2P2NA 2QZ4A 3HJNA 2WSLA 4WZEA 1F17A 3F6PA 2OLKA 1UBNA 3HZHA 2LNDA 2W00A 1Q5PA 4UUNA 5BW4A 5T4FA 3PIIA 1AVTA 3MOIA 2IX3A 1J42A 4EY4A 3BL6A 4KRYA 4ZZ2A 5IDQA 2XE7A 3K2EA 5JW6A 3Q11A 5CVCA 2IV7A 3HXTA 2PXHA 1M1XB 1T8PA 3HDGA 1E66A 2IZOA 5DMXA 5KTYA 2O2YA 2FQ1A 4OLFA 1J0BA 2BI4A 2O2JA 3SICE 2N47A 3T9EA 3DOHA 4NAHA 2P6UA 4FGUA 4M87A 4JC5A 5JRDS 2I7VA 2QG6A 4MYHA 4OJNA 4P86A 4QEDA 4UNNA 2JARA 1Y9JA 1N9ZA 2VC2B 2WWHA 4JL5A 3TEFA 3V4VB 4MVJI 4G81A 4NE9A 5GINE 1C7RA 4PBSA 1RRCA 4TMYA 5ALOA 3OFJA 5KDOA 5KQGA 2VPYA 1F38A 2HNAA 4ND8A 3TECE 4GEKA 1NSFA 1I36A 3M4JA 1NUAA 1QC5A 4M7RA 1N2HA 3WGMA 3OZUA 3T95A 3W06A 2Z2IA 1DAMA 3UV3A 2UUBB 6PFKA 3ZLJA 5B2EA 1M9NA 1SK9A 2CF6A 1I01A 3R7BA 3RAJA 4IXWA 1E1YA 3RKRA 4XWOA 4EHAA 4M0KA 3AUXA 4LQDA 4WA8A 4XI9A 3K4HA 4MUGA 3M1AA 4QSHA 3VHLB 4EGCB 4EHFA 4F2PA 4K6CA 5CG1A 3KAKA 4HX5A 2JLZA 2IYSA 2NVWA 3AEYA 1E1RD 1G5FA 7YASA 1TC1A 2AK2A 4CCYA 3FGOA 4L50A 1PS0A 4P82A 5K5EA 1NW3A 1R0XA 1V0JA 3QWHA 5JHGB 5K8UA 4PSUA 3AFMA 2IW1A 4BDSA 3ND7A 4IKEA 1E98A 2QJTA 3CCFA 4TXNA 3RQIA 3DOUA 3PEFA 3WIOA 4E94A 5LBIA 3BORA 2WLTA 5BVHB 8ADHA 1MFZA 1KH1A 4QDOA 2Z09A 2IV3A 1BKDR 1AMUA 3L8DA 1XHLA 2Q7OE 3TBKA 3A8JA 1NJID 1UZLA 2AVNA 1XN1A 3O8OA 5DK6A 3T3EA 2VT6A 2IIVA 4AJJA 3JQ8A 3K0FA 3T3NA 3I34X 3QY9A 1VMDA 4QBKA 4U2EA 2YWDA 2J0SA 16PKA 1R12A 1P33A 1JQAA 5IAEA 1I6MA 3BXFA 1QX4A 5T57A 4D3DA 4QZVA 5K0FA 2AW3A 2Y1GA 4PTYA 1SG9A 4JLAA 4BN5A 5HPYB 2JFPA 5IK2A 2OFPA 4GMHA 3VI3B 3M5CA 3KT8A 3CO5A 1I3KA 1Q2XA 1XHFA 2DPYA 4MGHA 1VHDA 3DMGA 3ZW7A 4BC0A 3T5MA 5BPHA 2DR0A 3WGHA 3BMNA 3W9BA 4F1JA 9MHTA 3CPJB 5AVOA 3CZ5A 1XTSA 4R1LA 5CYFA 1G5PA 2PNFA 4HZUA 1A2OA 4K6GA 4XWWA 4RTNA 1ODSA 1KOLA 3HEAA 4RUKA 4CDNA 5LU8A 4HNAB 3R6GA 2FZKA 4XUGB 1EFCA 2GK4A 4PHFA 4CMIA 3LS2A 2KMLA 5CBPA 3EY4A 1IHDA 2P77A 5CRIA 3CVOA 3LQYA 2AMLA 4WNYA 1FX1A 1X7DA 2AC7A 2IWHA 1QV9A 4GPAA 4K40A 4BQSA 1D2MA 2NSYA 3L7LA 1U8ZA 1XRSB 4M1TA 1EK0A 1R9NA 4FN5A 3A4YA 2CJFA 1OTXA 2AWNA 1DTWA 2QTTA 4NWIA 1N7GA 2XSZD 2AYXA 3JAMA 2SNIE 3LT5A 2QTVA 1U4SA 4AVYA 3KSUA 4NV1A 4AJIA 4H6PA 2OQIA 3A6JA 4NVRA 2AOUB 3DYIA 1ISGA 1TZBA 5EL0A 1Y3FE 4JQOA 4Q3EA 3VR1A 1GZHB 2RGGA 7MDHA 1WB5A 2ZSUA 3GEEA 4UAUA 2BY4A 1QRAA 3O2NA 4JQYA 2ZRFA 3G9TA 1RKBA 2Y9PB 2WJVA 1O5OA 1QZTA 2MJLA 2Y0DA 3ED5A 4ITRC 4J7UA 2XR1A 3AEQB 1Y8QB 3OEHA 5DNDA 4BVBA 1SU7A 3W90A 1YCFA 2QR3A 1FQJA 1N34B 1UEIA 1S7GA 4ZVKA 4OGWA 4C4YA 5J4VA 3TZCA 2IHBA 2QA4B 3BERA 3LPLA 1B0ZA 2B4QA 1EI9A 2QTLA 1H4VB 5IP5A 4CIBA 2BBWA 3G5MA 3LNCA 2CHVA 3KD3A 4EEKA 1HNZB 3UC5A 2CJWB 4RZHA 2KB0A 3N7AA 3NWOA 3WGTA 5EA2A 2SCUB 2PZJA 1ZESA 4Y2HA 1QKJA 1P17A 4MZDA 3SLKA 3Q3AA 1G8MA 4JK3A 4KMSA 1LA2A 4G2NA 5CPBA 1PRYA 1V6AA 4DCPA 4EJ2A 3ASPA 3GVCA 1VGVA 3QPVA 5LZ7A 4NS4A 5LLSA 1FXWF 3DEHA 4NK4A 1JR4A 5EIBD 5ENZA 3GNTA 2FB9A 2BFFA 4F45A 3KSBC 3E9YA 3KTAA 4M1YA 1B4DA 3D3WB 3IERA 3IALA 3OTQA 1DWQA 2Q5QA 3EODA 4GX0A 3PGJA 3K70D 2GD2A 2WG2A 3G23A 2I1VB 3DFKA 2YXLA 3P2EA 5E9AA 3RSHA 4DLSA 4LQLA 1GUAA 1WX1A 5JNVA 4RIGA 4UVDA 3A6FA 1VIVA 3BE4A 1YKSA 2HRBA 1ODTC 1RZ3A 1GPUA 1WXFA 3EIQA 3G85A 3K0CA 3Q4GA 1JQEA 3RK4A 3VOSA 3TRKA 2F3RA 3C3XA 1JLMA 2ZI7A 1JH8A 3GPBA 1N6KA 1QHSA 1CF2O 5FBHA 3RD5A 1IDOA 4ZAGA 4XJVA 2BFWA 1M6EX 1DRKA 2CC2A 5JFTA 7ADHA 5IANA 5B1DA 2ONKA 3QUAA 3SR4A 5LQKA 3BDVA 5DEOA 4ZI7B 3QE2A 1PDWA 4NOJA 4WZBB 4TN1A 4O2LA 3N0TA 3VH4A 4D80A 2Y1EA 1V6SA 4I46A 2I7XA 2G9UA 4JLKA 3S4YA 3T7CA 4ZYWA 4G0UA 4DB2A 3DW1X 4A1FA 1TTQB 4MW9A 4I3HA 3GWGA 5A0TA 1P77A 2JGKA 1W36C 2D6FA 1DBWA 3UMJA 1M0SA 3P20A 2PZMA 5EJEA 1DRWA 3ZQKA 5IM4A 5FO1A 1QH8B 5DHTA 5TF4A 2VK4A 2YJ6A 2P5UA 1X7HA 4YACA 1DKLA 1ZD5A 3MLAA 4HXYA 4DMRA 1RPZA 2GBGA 2WHRA 3AERB 5EJ6A 2EJVA 4O1IA 3F5QA 1M83A 3PJRA 1ILWA 1ACMA 1XALA 3MCVA 3AM4A 1YIAA 3ZKWA 3CJQA 3GFTA 4CF6A 1EP1B 2O1EA 5EWLA 4B17A 4FP9A 4I08A 4LOHA 2JD1A 1YS4A 2ZJ8A 2XD4A 2CLHB 4JITA 5KMGB 1M72A 2B9VA 3U4IA 4HPWA 1RXVA 5LP6C 1AUXA 1DKQA 1K97A 2OE2A 4FM9A 3PI7A 1K8AD 1EFRD 4QIHA 3V7YA 1UBEA 5FTKA 4DRYA 4PV7A 3WWPA 4RQAA 3ZNQA 4WASA 1K88A 1KQSB 3HSYA 4XWYA 1C3XA 1E3IA 2Q4RA 2DHCA 1D1TA 1VOTA 1ZRSA 1JVSA 4KIGA 3L4KA 2WQ7A 5TPWA 1C0IA 3HJCA 4Y2VA 3JWPA 1CUAA 3IKTA 4WNAB 4EUFA 5L40A 5DWQA 5JQGA 1EE2A 2XBMA 1PW7A 5DN9A 1LLDA 3K72B 3RG8A 4O59O 5C5IA 1XVTA 4YRZA 1EM8A 1OWNA 1EK2A 2GK3A 1LJLA 1ZOSA 2QTMA 4B7CA 4BMZA 3VU1A 1YC2A 2DYKA 3QVGB 4HFRA 4MPPA 1L5FA 1E64A 3FFTA 3P9KA 3R09A 4MHSA 4Q1AA 4ZV7A 3IR6A 3UY4A 1C3JA 1GZ6A 2EGGA 2V7QA 3WGNA 4AY3A 3CUVA 2ACWA 3QW2A 1NJFA 3QG1A 4PCVA 2XECA 5HQJA 3ROKA 1USWA 3N8DA 3FVQA 2JA1A 2J9ZB 1E3SA 4AN1A 3G82C 1A9QA 4YQYA 1V26A 1EHYA 4WERA 2HLHA 2ZJOA 2C5LA 4QOIA 3KHUA 4A2CA 1BWRA 1S4MA 1J1ZA 4W7HA 4OJTA 4BGIA 3E4CA 7MHTA 4OU4A 1X7WB 5KU1A 1IN1A 3RUAA 5D3QA 2BMDA 2IYUA 5EY5B 2PUCA 2SHKA 4HB2A 4XX1A 4YR7A 2R68A 4OQDA 5EINA 4N7BA 4R0MA 5ECGC 1GDTA 1LRJA 4GSLA 4L8FA 1HK7A 4ECEA 4RLQA 3B78A 2HBYA 2EKZA 1OXSC 3ZCUA 1RW4A 4Q93A 2R8YA 2H07A 4DT1A 1IY9A 5HNKA 2HHHB 1MOSA 5ICGA 2QY6A 1BD4A 3H6HA 2QBYB 1XMQB 1IZYA 3PHIA 2GXSA 4KYUA 3GN2A 1UP7A 4UCWA 1XKLA 1Y5LA 5K3FA 4JI3B 4E6EA 2GYYA 3LOUA 4GZ6A 1TE2A 3SXJA 5HKBA 5IUJC 3U4QB 2HV8A 4POAA 4RD1A 4ZQFA 3VJMA 3BJIC 1EGMB 1Y82A 4MCAA 1CETA 1RI5A 2N1MA 4RV9A 3O2SB 3N2IA 4DM3A 5KAPA 2JIMA 3ELDA 1EBFA 4NQRA 4BMYA 3QRWA 1G4UR 4TWZA 1NW4A 4PZCA 3LCRA 4MKIA 4QRHA 4Y6OA 5BSWA 3RTAA 4ZV9A 1F7UA 1U65A 4PSKA 4QDKA 3GLVA 1WZ2A 4KJXA 4MR7A 2BF7A 4Q1FA 3RV4A 1P8AA 2ZTMA 4ENWA 4OXKA 1II0A 1NM5C 2A33A 1GGNA 1QANA 4RDLA 1KZ4A 3JR7A 3MW8A 1I33A 4NI5A 3G2OA 3ETCA 3PQFA 3PT9A 5E1MA 1NI4B 3M89A 1XU7A 2WSSA 4NOMA 2CHFA 4MQEB 5E7IA 1ELOA 3AVUA 1GSOA 2C00A 3R74A 2MIIA 4UNPA 4ENVA 2QX4A 5L7TA 2OGWA 5C53B 3ICQB 2QVLA 4C0SA 4ACAA 4PQGA 3DDHA 3I1FA 3U4MA 1JE1A 1F51E 5BNZA 1IM5A 2HQSA 2C96A 3QFFA 2IOFK 2XY4A 2QRJA 5JSYA 5JNSA 2Z5LA 3G49A 2HMSA 1DAFA 1N0UA 1IN5A 3C6MA 3K09C 1FRZA 1Z07A 3R0VA 4G8DA 4KR0A 4BFLA 2GM5A 5E0KB 4KR9A 4FR5A 3L07A 3ZXXA 3OY2A 3ZS8A 1YB1A 4EG4A 3ONVA 2FLWA 5LSAA 1OUMA 3TLJA 3H9NA 1MGPA 3N2GA 3W2GA 1OLXB 4MW4A 4PLVA 4EUEA 1LK0A 1KDPA 2EGUA 1ZM3A 4OHZA 3QUCA 1GNVA 2I6GA 3RARA 1O95C 1RMQA 1H4SA 2PGAA 3S81A 1EM6A 1MEOA 3W4JA 2GUWA 3ZG6A 3FNIA 5GPBA 4BIIA 5CD9A 1KFJB 1N3LA 4WNCA 2I1QA 3DMPA 3DZFA 3L04A 3L6EA 4ZCLA 1BAPA 3B82A 1QONA 3C3EA 2FHPA 3NETA 3KJGA 4LQ4A 5FWXA 3SJUA 2O48X 2H18A 3KKQA 4DWJA 5J23A 4C22A 2EXXA 2JAWA 2AIRA 2VBGA 4PYJA 2E37A 3ZQ6A 4C78A 4RHCA 4RZIA 3S44A 2WKQA 2CYCA 2FZLA 2VF4X 2G76A 3IVMA 3TMKA 3G1TA 1NN5A 4HRAA 2ODWA 4XR4A 3Q9NA 1Z88A 1WJGA 5JD3A 2DR3A 3EH1A 5F35A 5GAJA 3QUTA 1N6LA 3EQ2A 1X2EA 1JDSA 5DBOA 1FY2A 1VIMA 5DHUA 2G0TA 2AFIB 5KYNA 4GP9A 3TLYA 5CEFA 2A5YB 1MMFB 2VNHA 2G25A 4FCCA