1GJRA

Ferredoxin-nadp+ reductase complexed with nadp+ by cocrystallization
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Coenzyme Recognition and Binding Revealed by Crystal Structure Analysis of Ferredoxin-Nadp(+) Reductase Complexed with Nadp(+)
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
total genus 87
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2001-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1gjrA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1gjrA02
2VNKA 5DSZA 3A1FA 1AIPA 5GV8A 1N8RD 2DERA 1KD1D 2E1RA 4WQMA 2NPFA 4Q7JB 1VQ8B 4RCZA 1DDIA 1KRHA 3CCUB 1YJNB 1R5OA 2J7KA 3P27A 4B44A 1TTTA 3AVVA 3VNUA 1QFJA 3AGPA 2VNHA 5HXBA 3W5HA 4PC2A 4B43A 2C78A 1QUFA 3SJZA 3U6KA 1UMKA 3VO1A 4G5GA 1BJKA 4PC7A 2QTZA 2BF4A 3LVBA 1QFYA 4ZV4A 1QX4A 3B8HA 2BMWA 1KTVA 3PENA 2HMAA 3OZUA 4RCYA 1QGAA 2R6HA 1OB2A 1M90D 2DETA 1XB2A 3E1YE 1H42A 2FX3A 1OB5A 1TUIA 4ZCIA 1VQLB 2BN4A 4NBSA 1D8TA 1IB0A 3CCVB 3QFSA 3OZVA 4YAFA 4RD0A 3CCMB 4RJLA 1F20A 3U2QA 2BM0A 2VZLA 1U2RA 4M53A 1EFCA 4FWTA 4RD4A 1CNEA 3ES9A 4LBZA 2OTJB 1BX1A 5KSWB 3CCLB 2OK8A 2QA4B 3OJXA 5JBQA 1FNMA 3VO2A 1JNYA 3AGQA 4RD6A 1G7RA 3B78A 4M1KA 3WBKA 4TN1A 2CRVA 2YWFA 1QG0A 3CCRB 1N0VC 2BGJA 3VNVA 1YI2B 3CRZA 2VNIA 3JQRA 1QVFB 1A8PA 4BPRA 4YAUA 1Q7YD 1GO2A 3QFCA 1EFUA 1F60A 3VMFA 3W5VA 4MYUA 1GAQA 1ZM4A 1ELOA 4TMWA 2XEXA 5GV7A 1QFZA 4ZCLA 3WNDA 2BVNA 3W5UA 1ZM2A 4FK8A 4B4DA 3OZWA 1HA3A 1VQMB 5TR9A 4LBYA 3CC4B 2HCJB 1W87A 3ZC3A 3ZZ0A 1D2EA 5TV2A 1Q82D 2D74A 1GAWA 3MMPA 2XNCA 4PGOA 2QDXA 4LC0A 5THXA 3CB4A 1VQ9B 4M4SA 3OW2B 1GR1A 1EXMA 3MCAA 1EP1B 1KJZA 3LYUA 1VQKB 4P3YA 3ZZTA 4UAJA 4EH1A 1VQOB 3AVXA 4RD1A 3W2HA 2QMUA 4Y7CA 1AMOA 4DQLA 1SM4A 4YAOA 3WXMA 4ZCMA 2BSAA 2BV3A 3J81k 1G7TA 2GPJA 3CXCB 2HDNB 3AVUA 1SKQA 3JQQA 1ZUNB 2PIAA 3CD6B 3CC2B 4PC1A 1GJRA 3CC7B 2C77A 4AF7A 1K73D 5TY0A 3I1FA 3AVTA 1BX0A 4YAWA 4C43A 3V76A 4ACAA 2DCUA 1N0UA 1R5NA 1OGJA 3WNCA 1FRNA 1J9ZA 3WY9A 1YITB 1S0UA 1OGIA 5H5JA 1CNFA 3OJWA 3QFTA 4RD2A 1YHQB 4RD3A 1K8AD 3FJOA 3CCJB 1EWYA 4AF6A 4ZGQB 1G7CA 1QGYA 3G6EB 1W2BB 1FRQA 1BQEA 2GQFA 2ZITA 4B48A 4TMVA 3ZBUA 4K1XA 1VQ6B 4TMZA 5FA6A 1E63A 3AVYA 3P26A 2VNJA 4B47A 1YIJB 1DG1G 2QN6A 4M0LA 4J0QA 4TMXA 3QSYA 1KK0A 4HE6A 4P6VF 1D1NA 1KC8D 1FNCA 1I7PA 1KK1A 3U6BA 3B82A 1XE1A 1B23P 4R71A 4IW3B 4QFMA 4QHYA 4LBWA 2EFGA 1Q86D 1NDHA 3CMAB 1EFTA 1VQNB 2X3UA 4G1VA 1K9MD 4M2LA 1WDTA 4ZGNB 4ACBA 2YWEA 3LO8A 4AC9A 3W2IA 3AVWA 1VQ4B 3E20A 2DY1A 2AHOA 2RC5A 1E64A 4FN5A 3W2FA 3ZZUA 4DQKA 1VQ7B 4LBVA 1FDRA 5EMNA 1ZM3A 3MHPA 1R5BA 1DARA 4MYTA 3QE2A 1JA1A 1GVHA 1E62A 2CNDA 2BM1A 3FPKA 2EIXA 3G71B 1CQXA 5H59A 2B7BA 1IJFA 4G1BA 4Y9UA 3CCQB 4F7DA 3WNBA 4YHBA 2B5OA 1Q81D 1JA0A 1W35A 3ZBTA 4TMTA 3JQPA 2QEXB 1EP2B 1JJ2B 1YJWB 2BPOA 1W34A 2YWHA 1JB9A 3W2GA 5AN9A 3WBJA 2BGIA 3CPWB 1H85A 1KK3A 2XNJA 3CW2A 1S72B 2OTLB 3LRXA 1QGZA 1YJ9B 4C0SA 1FNDA 4HE5A 4B3XA 2DEUA 1VQ5B 4PC3A 2VYQA 2RC6A 1NJID 3G4SB 1TLLA 2B7CA 3QFRA 3I55B 1B2RA 1ZM9A 1VQPB 1QVGB 1G7SA 3CCEB 2QTLA 1IJEA 3CMEB 1EP3B 3W2EA 2PLFA 3CCSB 4YALA 1QH0A 2PMDA 1KQSB 1KK2A 4N3NA 4Y9RA 3WYAA 4N3GA 3I56B 2OK7A 1FNBA 4U9UA 4PC6A 1M1KD 4NCNA 1QUEA 2YWGA 1TVCA 4H9GA 1DDGA
chains in the Genus database with same CATH superfamily
1E6LA 1JBQA 2REOA 3H6HA 3AF1A 4X7CA 1Y4AE 1PDWA 3V2IA 4C5AA 5I8PA 4RIFA 1W85A 1Z2NX 3HCOA 3BKXA 3NG1A 3CCUB 4HH3C 4R81A 5CM2Z 5COAA 1OGYA 5EXTA 1JEYB 3MCVA 4CTOA 5EJ7A 1FW6A 2IDMA 4D02A 1GA6A 1II9A 2IK8A 3AKDA 3ACBA 2I78A 1NC3A 1DCFA 3P71T 3SE0A 1GG8A 2OCDA 1GPKA 2PL9A 3GFRA 1M2VA 2EBUA 2OBNA 3HABA 3O9VA 2WUEA 3OZFA 5JI2E 1Y6JA 4MVJH 1M67A 1HQYE 3F90A 4YJFA 1MGOA 2VSQA 1KS2A 4DAEA 5ENVA 3GHHA 3NHWA 2J3HA 1O77A 4M88A 4OLHA 1T8UA 1WUJS 3QXGA 4BMYA 5A4AA 1QZTA 1RPZA 1VRWA 1CJSA 2ZWAA 2ACEA 4C3UA 1ZONA 3PVZA 2E5LB 2EWWA 5GJCA 3N0RA 3PQ2A 3EVFA 2J5RA 1U5AA 1DRKA 2Q3CA 2OHJA 2QT9A 4V2IA 1AF7A 1L8LA 4WZEA 4EMSA 2C7OA 4HAXA 1EDZA 1BJKA 1CUUA 1E60A 1A8HA 1L7DA 1K5HA 3FBWA 3O21A 3TZKA 3NHSA 1RJEA 3HDHA 4K9MA 4ZIRA 3IDAA 4L2IB 1Z29A 2RSLA 3OT1B 4DMHA 3VTFA 1BG6A 2H4FA 3M6FA 4Z49A 3PUHA 5FWNA 1ZMRA 1I5RA 5DO9A 1QLHA 1QOQB 4MITA 3UFBA 4UZSA 2O5VA 1SUPA 5CLFA 3IQGX 5KMGA 1P7VA 1W8DA 4JBWA 3HYNA 4M8KA 3EQZA 1TYBE 3F4LA 4XWYA 5CPBA 1B00A 3IVGA 4QUAA 1WUKS 4RM2A 4BGUA 2GHTA 4YVFA 3DNPA 2PL3A 3FNBA 3VUFA 4KSYA 5H81A 3CGWA 3E9ZA 5EJ8A 4UNRA 1E3SA 4P2NA 5ES3A 5CEFA 3RUAA 5C52B 2F4VB 3IBGA 4ZOQI 1QXSA 5LYYA 2GOYA 4X7RA 2H9YA 2YJ5A 3D31A 1YS7A 1F20A 2QRMA 1H3FA 1NFQA 1ESMA 1WTCA 1C7IA 3EEYA 4BVEA 4RAOA 1Q0TA 4B6RA 4MVWA 1H5QA 2BM0A 5TXGA 4EWLA 3CZMA 5HUHA 5TS2A 1ADJA 1GY8A 2YOHA 3FTEA 1E7WA 3IQZA 2GN9A 3H9QA 4MR9A 2HJHA 5AK3A 1XD2B 2EKLA 5ANRB 3DBHB 3ZD8A 2GEUA 1ZS9A 2OBBA 4ER7A 4U7TB 2ZG6A 1MOSA 2PY6A 4M22A 5E2IA 5AKXA 3RVRA 5IAGA 2G4VA 1Z15A 5ALGA 4GR5A 1JSZA 1NJ6A 1VCMA 1WSBA 3EDMA 2WF8A 3KNZA 2J9RA 3R2JA 2Y1GA 5AJHA 5FPTA 1ONPA 1KU0A 4ZXFA 2XHZA 5TGZA 1S3SA 2PUHA 4EGCB 5IT9A 1K28D 1EWKA 4IHKA 1SOUA 4HTAA 3NVDA 2GCGA 4OBXA 3W8RA 3REFA 4IV5A 3FUXA 1U0SY 4L7VA 4Z4QA 3LXUX 4QM6A 4I1PA 3HJUA 4TV8A 3AL3A 3RGWS 1ESEA 2DHQA 3L04A 5KKAA 1RD4A 3CCFA 1S2OA 4OU4A 2WD9A 4Z4GA 1G2IA 4KQXA 2VK8A 3E7PA 3PNOA 3QUBA 4G01B 3WWYA 3GLIE 3T1VA 2PS9A 3DUWA 1QVRA 3M5CA 4BPRA 2I0FA 4IDPA 4M1TA 3RYTC 1VGVA 4ZCQA 1K98A 3JD3A 2KWIA 3IL2A 2PZLA 3WL5A 2E85A 5ICMA 1OASA 4BGEA 1E2PA 4P33A 2V7UA 1M2KA 1N2BA 2AYXA 4PZLA 1FS4A 3VMFA 2AFHB 3M5WA 4E6PA 1HR0B 4MYUA 1DAFA 2F64A 4TMWA 1ELOA 2RHTA 3OKAA 1Z5PA 3GO4A 1QFZA 3O4VA 1P3Y1 3GZ4A 3LY9A 3GLHE 4BX8A 2EW1A 3HXLA 1NMEA 1BROA 3HYRA 1NXXA 3I8XA 4I81A 3TZCA 4B84A 4Z4WA 3TG2A 2IS6A 2X5NA 2F67A 4UXJA 4C7BA 2AJTA 3BCDA 4NKRA 1RZ3A 3BRWD 3WWPA 2AOTA 4PGFA 3R3JA 4RXUA 1MB9A 2H1SA 1C8VB 1DWPA 3AESB 3CZAA 2Y0DA 3KQYA 3LWNA 4LSGA 4X9XA 4LBYA 1WF6A 4MUHA 4F9TA 4QXAA 4L9WA 2WG2A 3A1TA 1JPUA 2Q3BA 2QSUA 1E5TA 3H99A 4TMFA 4KBYA 3ZLVA 2FV8A 5HM6A 2P2YA 2ZJ8A 5LD2B 1DB3A 1A72A 1KI3A 1QZXA 2NO0A 3IAM6 2X0DA 1ZCBA 2BFOA 4O2AB 5IP5A 1CJMA 4C22A 1E6KA 1UFKA 1E9RA 4DJFC 2XDAA 4O5OA 5AW9A 1AQNA 2X0IA 4O8ZA 3L1VA 3ACDA 2ZJ2A 5I47A 1HDCA 2AXPA 1AVTA 2VF2A 1W25A 2JJ1D 4MW4A 2GRAA 3KXLA 4EQ6A 2QRHA 4NG5A 2R1ZA 3W6ZA 1U81A 1JR3A 3LF1A 3C98A 2IDKA 3DFIA 1PJ2A 3GT0A 4OMDA 3LQFA 5T8KC 2WTXA 4BTEA 2BM9A 4M6WA 1CY8A 1T5SA 3M9LA 1ENPA 2JGEA 2XCLA 3PHLA 4JMLA 4MLCA 4AN4A 2VHYA 1L5MA 1INLA 1AT1A 3E53A 5KOHB 1TM5E 2GK4A 4QGAA 5HJ7A 4P5PA 1OTHA 3ITKA 2AI1A 2RBEA 4M1ZA 4ZHSA 4XM1A 5EJEA 5LP6B 1G20A 2IYSA 3DCJA 4IGIA 4H7KA 2XUPA 1NQWA 3PFIA 3QUQA 4O4LA 4ONEA 4DXDA 4RK1A 4NQRA 3QEAZ 3F1LA 3PCRB 3CX7A 1ORIA 3PHIA 4D4GA 4J6FA 3FMPB 3PR1A 1MF7A 3FDFA 1JLRA 2JNWA 1U0LA 3C6QA 4JQYA 1V3VA 3WC4A 3EAFA 4N49A 1F7UA 5HXAA 4CMGA 4EGFA 4AKHA 2G71A 4GO1A 5AOVA 1CD5A 1JZTA 3LNTA 4L72A 4ZAVA 5FEMA 3RABA 4EUEA 2Y92A 5GZ1A 2PKCA 3G79A 1JKMA 3D02A 2FWBA 1GJRA 1CW2B 2FMFA 4HDOB 2FVXA 2ZL7A 1DEXA 4D4LA 5BVGB 3VR6D 1VI6A 2X8LA 4CFZA 4OXQA 1D2MA 2HNAA 5K0ZA 1VCNA 1DG3A 3JRWA 3FVRA 4YAWA 4MKIA 1C14A 4KIFA 2MHCA 3EGXB 4YJ3F 4DM4A 5L3QA 5D87A 2GJRA 4MUYA 2YIVX 1GTJ1 4G1UC 3RSOA 3NXSA 4MQEA 3RTCA 2PUEA 3QHAA 1R5NA 3EH2A 3VPXA 2FSGA 5FRDA 2QMHA 1I24A 3G7SA 4R9SA 1UDCA 1XA0A 4RF4A 3DBRA 4CV1A 1OFGA 3BOSA 4ESHA 3KUKA 3PE6A 1IY8A 2HU8A 2DQSA 4WAUA 2EJBA 1Q1GA 3BD9A 1QV7A 1XNJA 1XYGA 2EG9A 3I01A 1U0GA 3HBLA 1JIUA 3G2IA 1YKSA 2JZNA 1DJMA 2QB5A 1FTNA 1KZ9A 2ZZKA 1FB5A 1XTQA 4MWEA 5AM5A 4RV4A 2IOFK 4DTCA 1SVMA 1IQ0A 3RC2A 3ESZA 3FOAA 2LW7A 3MYYA 1QIEA 1KVRA 1THTA 5MFPA 3PDUA 1P7PA 4EK9A 4YYZA 2Q46A 4J9VA 3AR2A 3R8FA 2P4EA 1VJSA 5JCJA 5TARA 5D51S 3WGTA 2W2NA 4Z0TA 1BQ3A 5ELMA 5A4MS 4ND8A 2GN0A 2QI9F 1YF3A 1CVLA 4KYTA 3AO0B 1N78A 3L46A 3A7DA 4KMOA 4Y9DA 4WFIA 3AEKB 3P96A 4ZCRA 4QUBA 4HNUA 2VZ0A 1X8LA 1SIUA 4MROA 5F51A 1V45E 2QWXA 2ZRPA 2P90A 2XGOA 3HFRA 3IP6A 3IUYA 2OY0A 3AIOA 4Y30A 5AOAA 2A0KA 2P9CA 3D7SA 2HD4A 4G0UA 3RM3A 1R88A 1B8OA 1WG8A 3AOEC 4MR9B 2M6KA 2F6RA 4X64B 4DVJA 3PHBE 5DJ5A 3IPYA 5LQMA 1EX6A 5I51A 4B17A 5BRJA 1MP0A 3ZKWA 2JBHA 2M1ZA 3IVMA 3HJRA 4UVIA 3QBEA 4KKXB 5HZKA 3OX1A 4TTSA 2PTHA 3D4OA 4ZI7F 2Q21A 2W22A 2B4TO 4TROA 1L7MA 2PWBA 3AR7A 1C29B 3GJ8A 4Y2HA 3GVPA 1XE1A 2UZ0A 4X1YB 4CG0A 1XTJA 5F4BA 2FZ4A 5CU7A 2GD1O 1W5AA 3QSGA 2RDMA 5F76A 1Q92A 3UA3A 3VUEA 4R5MA 3OHPA 3GJZA 4F6RB 1Z39A 2NSHA 3H1TA 2LXNA 1VHQA 1D4FA 1SCDA 5MN4A 2QGFA 5KOYA 4OHPA 4RTQA 3Q9LA 1U5BA 5TF0A 3R7DA 4X84A 4C89A 2Y93A 3LNNA 1DDOA 1UWCA 3B20A 4Q02A 3FMVA 2FAXA 4Z4CA 3R09A 3TNDA 3U16A 1M73E 5G0SA 2CF4A 1N1MA 3QEBZ 2YFHA 2ZIEA 3DOEA 1J0BA 1FU7A 2HBYA 3Q87B 4MQBA 1XF1A 3SXUA 3VGJA 4GL2A 2ZYUX 4XSHA 4PYQA 1I3NA 4XTRA 3QOWA 3RVQA 5K0TA 1Z62A 1UKBA 1UQTA 1IEWA 2G4CA 2ZRKA 4IJUA 4GGPA 4M0UA 2IT1A 1NUAA 4KXVA 1E5DA 5IKPA 3H8SA 3WVNA 5B3KA 4V0MA 5IJXA 3IAS1 2G7MC 4IHJA 4JWKA 3SHVA 4RAQA 3EMBA 4PQYA 2E18A 1E64A 3IUNA 3TINA 1KOJA 1NLYA 2GK6A 1FLNA 3K9HA 4JI4B 1II8A 2I5PO 2PKQO 1IATA 1E92A 2MYUA 2Q3FA 2YC4C 4IX9A 3JQAB 1E7RA 1ZXXA 2HCBA 4YJ2F 4KLAA 1P0CA 3GIRA 3NANA 4IR7A 4QDXA 3ZQKA 5HBGA 2H2IA 4DZZA 4ZEVA 2ZTNA 5KU7A 2PLAA 5KSPA 3DZDA 2NU8A 4CCAA 3CNQS 4CV2A 2VDRB 1YR9A 3F4KA 2IX9A 2ZRJA 2R65A 4A6XA 3QX3A 5BNTA 3GW8A 3GSIA 2VP4A 1R5BA 4GMFA 1VI5A 3IV6A 1R0XA 2F1HA 1TCBA 4XCVA 1I4LD 2C5LA 1IPHA 1U0OC 2R85A 2F55A 2XW6A 3Q3AA 4JI0B 4XPIB 4BNGA 3W9UA 1RU3A 3D4IA 4ZDWA 1LTHR 3BZBA 4FBMA 5LLSA 4BFCA 4CLHA 3W06A 4CM3A 3RFTA 4KQWA 3PC6A 2X22A 5DI9A 3TGWA 4CEJA 4BO7A 2G67A 4ND7A 5DWDA 3KOXA 2NSDA 3R76A 3V1KA 1ZW1A 1YHNA 1DI0A 4MUMA 3ZHQA 3IA2A 4D81A 1GRCA 4CEIA 3MB5A 4GYKA 1TO1E 4KQHA 1B1AA 1XZJA 3LY5A 4OH1A 3QENA 5KNCD 3ZX5A 1W2WB 4XNFA 1NR1A 5EIAA 1U9YA 2CXQA 1HDGO 5KVAA 4TWIA 2P3LA 2QEQA 3AHCA 3THWB 4X71A 1DRJA 3GL9A 1QMGA 1Q84A 2DFDA 3EC2A 3S1AA 1GRRA 1T34A 1VYHA 3EWIA 1IBLB 4N9QA 1CDDA 4YX9A 2JA1A 3KZCA 2KSQA 4MEAA 1GOTA 2A1IA 5D01A 2J6CA 2X15A 4D0GA 3Q8LA 4EQZA 1E5XA 1PR5A 3GMDA 3A11A 2X42A 2JJ1A 2R4UA 2VF8A 1J09A 1VJTA 3PITA 3U7IA 4B2YA 2AI3A 3J80A 2GEVA 4EENA 3FOEC 2QX9A 3L8HA 3BRSA 4NBVA 3VKVA 3IILA 2CK3A 5AN9A 4B3GA 2BRUA 5CXSA 3G2QA 1TGVA 3CPWB 1MJFA 4D42A 4DCUA 1P19A 2H31A 1KIAA 1I9GA 1U4NA 3LOQA 2JIBA 5KYXB 1L9XA 1TUBB 1M8JA 1EVQA 3DPSA 4MCIA 1NPTO 3UWMA 5JNRA 3DBOB 4RPHA 2RAFA 2RGBA 4R51A 3CRMA 4JJ8A 3DFUA 2D1YA 1YLOA 4AJHA 1TAQA 1Z4LA 1CR6A 2XBMA 1J1ZA 4BO6A 1EX9A 2J45A 1VIYA 1BRTA 1UP7A 3LUCA 5C3UA 3LT4A 2VYCA 3RFVA 2FVYA 1DWUA 3IP8A 2W11A 4ZCPA 4GZ3A 1GITA 2Q5JA 1F51E 4DGQA 5JXWA 1NJID 4XPZA 4WN9A 3EYWA 1IY9A 4XOPA 1BS9A 1PJ8A 3HDVA 2PMBA 4R6XA 5L7YA 2IPNA 5ULLA 1MG5A 4AY4A 2GILA 1J24A 1MAAA 2IIBA 1U90A 2H4WA 3OQ6A 2UYQA 2WM2A 5AVXA 4UHFA 1FQKA 3KAPA 1OC4A 2I6GA 2V96A 1TOAA 2VDKB 1RAHA 4N54A 3NCHA 4OQPA 2OXCA 4X6YA 4MI6A 2CXUA 4CM5A 4CL0A 1PN3A 1M1UA 1UANA 3L7AA 4HEA1 2BD0A 4D82A 1SZJG 3RS2A 1TB4A 1BAPA 3C6MA 3RBAA 3F7NA 2COKA 4ASUD 4QYIA 4XQGA 2I9KA 4V0SA 4DR6B 4DS3A 4NXNB 3LTNC 2OXIA 2WAOA 2NWQA 4BVGA 3EGDB 5FH9A 5KIAA 2OK7A 4G0WA 2OCKA 1ISPA 3UXEA 1FZQA 2C3MA 2FWAA 3NHRA 4CKEA 2HADA 4DMMA 1A1SA 4FJ0A 2WVAA 3CKMA 3T7RA 4KQGA 1M6YA 1P1KA 2PSSA 3UJBA 5JXHA 4FEAA 3C3YA 1RBMA 3V8QA 3U48A 3OCWA 2BEWB 1DKUA 3TRKA 4L85A 4DHEA 3BH4A 1E1QA 1Y37A 3BEDA 4K6CA 3EOZA 4WEQA 4BLTA 3GLHA 4F3RA 5KS2A 1ZOLA 3L4KA 1DCKA 3E2PA 3MQ4A 1PNQA 2BZSA 2R60A 4BWGA 1A76A 4DMRA 3NBXX 2IYEA 2ZTMA 1AO0A 4J16A 1ONSA 4ZT3A 1UJNA 1QOZA 3D2AA 3L9XA 1H69A 1II0A 1PBTA 5AVZA 3GJ5A 2G0TA 5JJ5A 1UZMA 1WAMA 4QOEA 2HLDD 4DWOA 3OQPA 2YHIA 4EATA 3BXOA 3T9FA 2XIQA 1I7DA 4G0VA 5JRDS 4ZRDA 5JISA 3KETA 3EC7A 4KR0A 2REXB 1AGPA 5E38A 3ICVA 5TQ2A 4TT3D 1WETA 1TVKA 3K73O 3M9XA 5EA2A 1N05A 1HYHA 4V39A 4F3TA 1LLFA 2C78A 2FSVC 2Y3IA 1FS5A 1KGDA 3B53X 4ALMA 4GH5A 1UMDB 3KQLA 3JZDA 3C48A 2Z4RA 3AWIA 2K2WA 4R4JA 2PGJA 2P6MA 4CKBB 2VHWA 1C1DA 3PC7A 4IOJA 2AZMA 2CN1A 2QTZA 4Y0VA 4B87A 2E82A 2BF4A 4JROA 4ZV4A 4DNTB 3C1AA 5FTWA 4I1YA 3E4DA 1ZQ1A 4IQGA 2P5UA 3GVXA 2R1TA 3WDLA 1P3JA 3MERA 4NPCA 4MRPA 1XVLA 2BMWA 3BXPA 2QG4A 4YCDA 1PL7A 4B7AA 5HRUA 4NZOA 4YXWD 1LDEA 4A4DA 4G5SA 2Q1WA 1T8SA 2W6IA 4U2EA 4A3SA 4Q1EA 2YJ3A 5JS8A 4FPXA 1WSRA 1EAMA 4CN9A 2DETA 2QM3A 2H7CA 2XYGA 1C4KA 3DAYA 1VG0B 4MPJA 3UQYS 5BMVB 5IK2D 3TVDA 4CI0B 4O3FA 1Q7BA 4I9FA 1K75A 4FXPA 4QOJA 1N4DA 1CZHA 1L3CA 4M7PA 2XUDA 2XJ9A 1XZLA 4MPDA 4Q9KA 5EJAA 1L4HA 1M1XB 1SVSA 5LN1A 2BSQA 1MAHA 2CLSA 2OZVA 3M9WA 3SDBA 3DE0X 4X06A 1CRWG 4RVSA 5J2TB 3ERCA 3VTAA 1JTFA 2X8WA 2XUJA 2NUTB 1Z7GA 3P9QA 1JIVA 4HAVA 2E4ZA 2HRRA 5FTMA 5ITWA 4BCBA 5ERGB 5C5EA 1CB0A 4XGQA 3FSGD 3P9KA 3AI2A 1NXVA 3KOOA 2BEUB 1M75A 4YT8A 3T7DA 2VBIA 1PL8A 2TRSB 1KDPA 3LTEA 1NSYA 2BR5A 3ITEA 4H7PA 4Q3BA 3U39A 4B46A 4K86A 3J7TA 4O1IA 1YUNA 3TXYA 2RH4A 1OFHA 2RFLA 3LA6A 3QKUA 1BX1A 3L0PA 5EHQA 5C1OA 1Z5GA 5AW4A 5I7HA 2CUTA 3MCTA 1RM0A 4GPAA 1WBBA 3B6IA 4TL7A 4RHFA 2Y27A 2NT4A 1WW3A 5TDHA 1VCHA 4G37A 2CZGA 1W5SA 1YB2A 3VDNB 3E82A 3KKLA 1Y33E 3B78A 2V0CA 4M76B 5DV9A 4LJLA 2GWHA 1DKNA 1KXJA 2PEYA 1OWNA 4ARSA 2UUCB 4LRUA 1G6KA 1HURA 3PWSA 4OU5A 3G0HA 4EW2A 5IHXA 3A6JA 4GPIB 4H60A 1N0VC 2JEZA 2PAAA 4B3SB 3DV0B 4B3FX 4KIUA 1FX0B 3CRZA 5CLGA 2AZ4A 1L4GA 2XOKA 3B9QA 1FQOA 3V7FA 4LJRA 2P2NA 1W96A 2XOKD 2GZ3A 4Q16A 4UBMA 2G63A 5IVKA 3F7MA 4ZDIA 2ZIXB 4NNJA 4FLFA 3RSZA 4EI9A 4F11A 1JDNA 3FD8A 3QFCA 1JGTA 2CUZA 5C5DA 1L4KA 5HOQA 4IDBA 1T2DA 2GGSA 3NEJA 3QPCA 1KETA 1HTTA 1FQJA 3RS7A 2R47A 3IMEA 4O08A 5CDYA 3IP5A 1NRKA 1GPH1 2Q6LA 1YQQA 3L41A 1PJTA 3GVIA 1V8ZA 5H83A 4BWYA 3DZIA 3DQPA 1RTKA 1VBMA 3JALB 1O8BA 1U65A 4UCFA 2FOIA 2VJIA 1DADA 1BKYA 1DUSA 1QFSA 3CRW1 3ONYA 1LI4A 1FFBA 2EQBA 1XDWA 1KAGA 1QGDA 2YN0A 2Z4TA 3DAOA 2ZK7A 3NDPA 1R66A 2HGZA 3O75A 3Q88A 1MCZA 3T15A 4DV6B 5U1PA 1JTEA 1RYNA 5CFQA 4GICA 1E2GA 3VZQA 2L0XA 3O4HA 3A4NA 1QK5A 2UUPA 4LFCB 3ZDBA 1JHXA 4V3BA 4AK9A 4PG8A 4JVLA 1U2PA 4N9WA 3DJYA 1P6UA 5T3UA 4WNAB 5ALPA 1P8JA 2P4QA 3D6VA 1IQRA 3R6LA 1BWSA 1H1DA 4G1CA 3AOEA 4YJGB 5I5EA 2PVCA 2AJBA 3A9UA 5IJ9B 4LHWA 1I1HA 1Q44A 2BP7A 1A4UA 2UVPB 2V6JA 3C41J 4K81B 2CK3D 2WIBA 3VM6A 2H1LA 1XCPA 4BNUA 2I9PA 1VDMA 3GG2A 4CI9A 2FMTA 4Z7QB 1VP9A 4KQCA 4TSKA 3HXQA 2BT4A 1JX6A 2F9FA 3V4VB 1P9LA 5GINE 3CW8X 5JADA 1NMYA 5JTUA 1O1YA 2OYNA 2J1LA 1RYYA 1XTRA 3AHHA 4G1EB 2A5JA 1NX9A 1PL6A 3Q5GA 4MGIR 5C8YA 1VQKB 4P3YA 2CL0X 2GTIA 3FTPA 5LMUB 3BJMA 1ZGZA 4G6IA 1GL3A 5B1IA 4BQIA 1AMOA 1H65A 3FWKA 3OC6A 2AFIE 3O95A 1E3LA 2DXIA 2IY9A 1NOJA 1H5NA 4ZCMA 3OOEA 4WTOA 1O96A 3PQ5A 1QQ5A 2R00A 3EF3A 4F38A 1WBDA 3J81k 2QZJA 3ANNA 1ONNA 2V7BA 1K6IA 1NVVQ 1YS2X 2HH9A 2WJIA 3MS2A 4YRDA 2O1XA 4PCUA 3WQQA 1EUDA 1QLWA 1OUMA 3I8OA 4KDEA 3OKXA 3Q10A 4MX8A 3UAWA 2J9FB 2MMGA 5JJCA 4S0ZA 4ZVTA 4RETA 1JMYA 4A0RA 1SCKA 3IBYA 4XQCA 4WN3A 5B1SA 4Z2AA 3EG9B 3FMIA 5FUBA 3ZWPA 1YQTA 2JFPA 3CINA 4YC7A 4RKQA 3SJUA 1ZSVA 2O54A 1SU4A 3KWMA 4H0NA 3BBLA 3BMQA 3ESBA 4TX1A 3BE8A 3NGMA 3OM0A 3UTCA 1PDVA 3EFBA 2EQAA 1QVWA 2W6PA 3HP1A 4QARA 4Y1EA 2Y9MB 4BNVA 3LX4A 2B8TA 4CM8B 3ZPXA 3G9TA 1ADYA 1LSJA 1X86B 4FE4A 4H3HB 5FTNA 3EEIA 1LW7A 3KOYA 2I7CA 5AHRA 1Z7BA 4FYJA 3BHMA 3ZDRA 3TUZC 4CEHA 4K9QA 2WG1A 3TTYA 1GQQA 1L0BA 4ZEXA 1F4VA 1FTWA 1R0BA 4RDJA 3KEGA 1H8HA 1XU7A 3KYCB 2Y1CA 1E1QD 4J49A 1HXHA 1CJKC 5A0VA 5GONF 4AWAA 3GVKA 1J2TA 2BEJA 3DWIA 3RT1A 5IF3A 4Z1MD 3UYLA 1FFDA 3H5LA 1JDSA 3DKIA 3ZOKA 2W70A 2AFRA 4Y6LA 5FQOA 2AN1A 4F21A 1QYCA 4JL8A 1CR2A 4UHHA 3D7MA 2OSVA 3CEHA 3ZHUA 2GCOA 2RHDA 3WY9A 5EEGA 3BTVA 3G8BA 3T9DA 3VH3A 4DIKA 3BEOA 4XKJA 3U37A 1P73A 1U9IC 1H0KA 3WLOA 3O31A 4EGJA 3OPXA 3E0QA 1QPGA 4GXRA 4HDSB 4PPNA 4QLOA 4RFVA 3VR5A 1YS1X 3GDFA 3OCCA 3RS5A 4PRYA 1EFPB 4ZZ1A 2BFCA 4R5HA 2Q9AA 3R4VA 1JFTA 1K8YB 1JR3E 2XCQA 2VQ6A 3F9IA 2J3EA 3KAJA 1GNSA 1KPHA 4W7HA 1S4QA 2CJYA 3AWDA 2I71A 3KQQA 1YAHA 2OC4A 3PGVA 2GT1A 3A05A 3T7TA 3WLTA 1EUZA 1YB7A 1W2BB 3N8DA 4DBLC 2ZCJA 1V37A 5DULA 3IX7A 3RJZA 5A6VA 1IVNA 1VPWA 1U3WA 4BFYA 4Q05A 3LHFA 3F49S 5DLEA 2CLMB 3ABRB 4GPBA 4I1RA 2PWPA 1ZK0A 2VNJA 2GLTA 3C3AA 1OX4A 3N53A 4HZUB 4BMOB 5IKXA 1ZJ4A 3JQGA 3WIOA 1H3EA 2GHIA 2MU1A 2Z2IA 2H8GA 3S2SA 4AJPA 4EA6A 9ATCA 5FBVB 1U0FA 3FWPA 1FFCA 5A9TA 2JIMA 5KTSA 3MGCA 4L5YA 3L77A 2Q9UA 4AB1A 3DP7A 1Y0YA 1Q6YA 1YIDA 2BZ1A 3M4XA 4REOA 1FPQA 1D1NA 1CLEA 1Y89A 3ELWA 4IXNA 3H9NA 1O57A 3M6XA 4HN2A 2Z0MA 4RPGA 4LJYA 5TEVA 1RFLA 3IURA 3N8GA 1G64A 1B23P 4O2BF 2X6QA 4D2IA 5BN1A 2IH2A 1WKCA 3CURA 5EUBA 5H80A 3K30A 4NHEA 3N59A 1U0RA 2X2OA 4G5HA 2WM8A 3OZSA 3WK5A 3EASA 1UPTA 4N5LA 1SEVA 4FNMA 5DHPA 4YUYA 3QE4A 3EPJA 4NMXB 2VSYA 4BV8A 1E79A 2IDZA 4M37A 1BDHA 4XWTA 2XE6A 3PICA 4N3AA 1E79D 1M1ZA 3TW8B 1RCTE 4TL6A 3A6ZA 2HC9A 4OLFA 2CYAA 2E5WA 2VTEA 3E7XA 4L6IA 4DLLA 4PIMA 2VUHB 3C1TA 3U56A 4EJ6A 4I1UA 3ZE1B 3UJ8A 4UD6A 2CNWA 1WDTA 4Q01A 1H66A 4DCSA 4B34A 5GP1A 1XNQB 2YWEA 1WUTA 2G17A 2Q4DA 3PS9A 4QHSA 3EGIA 5ENZA 1YUMA 3M81A 4RHEA 1PKEA 3LYAA 1BCSB 2BDUA 3EGCA 2JRLA 4QDOA 1C1DB 1T9GS 5F4ZA 1Z2PX 3JAWA 4E22A 3KSAC 4IXMA 5LB4A 5E95A 1XZDA 2GZHA 3A3BA 5KI6A 4PS0A 4D41A 1YR3A 5FWXA 5JG7A 1FYVA 1DAPA 4KXNA 4OXNA 1FXWF 2V5VA 3BGWA 3H83A 1W36D 4Z4VA 2PUGA 1K3TA 1DAOA 2NGRA 1XRRA 4UHEA 4K03A 5TT0A 3GQBA 3ZHVA 2P9TA 1Y5LA 2G6BA 4MKRA 5A4KA 3ZNPA 1KY5A 4P82A 5K01A 2OVFA 4AX8A 4Q9LA 2OGWA 1T91A 4TSFA 4NJEB 4KE7A 1VL0A 1MC8A 1MKYA 2ZRAA 3RYFB 4GYJA 4COKA 1AE1A 2V6BA 1XLTA 3MHPA 2A0FA 3H2JA 5E9AA 3GLSA 4ER6A 2IIPA 4GRIA 1R6UA 3ZHBA 4BAGA 1JU9A 2PH1A 4GXNA 1SQ6A 3D3WB 5HCUA 4MO2A 4LGCA 2X2PA 2JA2A 2WWXA 1OXVA 1P1HA 3GT7A 3Q3GE 4MMYB 3E9NA 3R5TA 5DMHA 1SU8A 2NIPA 2Y05A 3MM4A 4FYYA 1UKZA 1T26A 2QZPA 2QMYA 4R41A 4PM4A 4RSRA 5CH8A 1JFSA 3BWDD 4ERNA 1V8DA 4IIJB 4G5XA 1WZ2A 2C8JA 1AN9A 1QVAA 3PEEA 3A7EA 4PBTA 4AL4A 1LQ2A 3GLQA 4J9UE 1E59A 1V9SA 4US2R 3WSWA 4P3KA 4E31A 2A5GA 1I18A 1VKNA 2O5EA 3PSAA 1DAKA 2H63A 5KTMA 1M83A 4E5UA 3CCQB 1PUIA 2H1VA 4DB4A 1ZICA 1BMFD 1PIWA 3OIUA 2DYIA 1XMJA 2OL4A 1D2RA 1GPDG 1QG6A 4G84A 2AC2A 2BCEA 3VZCA 3GLTA 5EE5B 3V7YA 3SSOA 4W5OA 4AF8A 3HWX1 4J7UA 1LBQA 1VPEA 3OP4A 4Q34A 4D9MA 2O7RA 3Q7IA 3VTZA 3VYWA 3SIXA 3H0CA 1WIWA 2NU9A 2ZW9A 1YXMA 1V1RA 3B6ZA 1LNQA 3MXOA 3CG4A 2XUFA 4ARZB 3PR2B 3C5EA 4KQIA 3DCNA 2V4ZA 1K2VN 3JQ7A 4ZOLA 2XHEA 4HXFB 3H2YA 1KARA 3ILSA 4YAKA 2GJPA 4YV0A 5C1DA 1W75A 5GIPE 1T4GA 4HNTA 2WHPB 4PZEA 1T6NA 3CXUA 3E9DA 3G2MA 3MGBA 2Z95A 2E6UX 2DAPA 5CYFA 5FAXA 4EHHA 1M34E 3TTSA 3EY4A 2YJ4A 3ETJA 4AMGA 5LL6P 1SWWA 3GGOA 1SG0A 2WD8A 5CDFE 3DZCA 1BO6A 2Z98A 4C0SA 3V4SA 4V1CB 4UBNA 2AEMA 1JU4A 3CV3A 3R5FA 1NA5A 3D3EA 1JKXA 4INAA 3B6EA 2NSLA 4XB1A 1UL1X 3DV2A 1N5RA 3MW8A 4G4SO 1EEHA 4PC3A 3FW1A 2OYCA 2P5TB 3GX1A 1GNRA 5KHAA 3RREA 3E15A 2WPDA 2WP0A 4WLEA 3UPTA 2P35A 4UHBA 4UVEA 1KFJB 2A2ZA 4CF6A 4MV3A 4GLJA 4UMEA 5BSFA 9ABPA 5KYUB 1JWAB 1WTHD 1USVA 4XVCA 1DFHA 2CFTA 5AJWA 4BO8A 2F8LA 4MKFA 1NVGA 1OLUB 1S8AA 3CCSB 4G09A 4JYMA 4NATA 3F9RA 5FUWA 3UG7A 1ZNXA 4V1CA 5IYZA 1VE1A 1I6MA 2DULA 1BE6A 1ESZA 1UPCA 3EGEA 4JLDA 2GPAA 4JQCA 4NS4A 1GPJA 4KK3A 3NATA 4MJXA 4FFMA 4EY6A 4DCPA 4LYEA 2VOJA 4KQKA 3O73A 4N3GA 3I56B 2BRUC 3BD6A 3QWHA 2DWPA 4OQNA 4DIUA 1P4JA 2Z8YA 1K66A 3COYA 3K70B 3C97A 3UJ7A 2DWQA 1CRZA 5TPWA 1RLUA 5KYWB 4RGVA 3ICQB 3V4OA 3SF0A 1YKGA 1Z0SA 2GEJA 2Q62A 3T35A 1E2KA 1HDOA 3L79A 4OFXA 5EMJA 3QZUA 4RTNA 3BNWA 5DSZA 2VAWA 2IPLA 3Q7EA 2BGRA 4AUMA 1HE2A 1Z18A 3L40A 5EIXA 1KEUA 2IEBA 3EHDA 4FDVA 1WY5A 2NVBA 4F2HA 4W8HA 3RCBA 4E7PA 4YP7A 3GEIA 1HRDA 1GHTA 3G2JA 4XUCA 3R44A 1VPLA 2J7KA 4HEHA 4XUDA 1BH6A 2H1HA 2RGNA 3R3XA 1F14A 4RL4A 4WKGA 1BLIA 2H9AA 3U3XA 1XMQB 1YB6A 3PEVA 2VNHA 2FW0A 4AZ3B 4JBHA 4OYLA 5EIBC 3HGTA 3PJRA 3W8FA 1YB1A 1B8PA 5CJ2A 3U5ZB 5FNZA 1LF0A 3BY1A 3VR0A 2IA5A 3RARA 1Z5VA 2ZI3A 5J2UF 5DM0A 1Y7LA 2EXXA 3C3BA 3AKEA 4UBKA 3GAZA 5ECWA 4AQYB 2R1VA 3OKCA 4BLSA 1PNTA 3WLQA 2XV1A 1PZEA 2COEA 2PCJA 3D0RA 3FZGA 2M98A 3ZIUA 5JAUA 2YS7A 3ZCPA 5JV5A 1BDBA 2GPNA 2QA5A 4JR0A 5FI5A 1Q91A 1W2GA 3H9UA 3SNHA 3C3EA 3KJGA 3PNMA 4EY3A 4HATA 1DXYA 4LIPD 1FFWA 3VAZA 3EB9A 3X1ZA 3AJAA 5I4KA 1AS2A 2JK0A 1F8UA 2G8LA 4OUDA 1ZD4A 2PRKA 3AR3A 3NHFA 4D56A 5IKEA 2IP2A 1VDZA 1IMOA 2X41A 4IUYA 4KDRA 4L8FA 3KX2A 1XB2A 2QS9A 4E6EA 2P9ZA 2FX3A 2QX6A 4B3BA 4YRBA 1Q3KA 3LQ2A 1F9AA 1MJNA 1N7HA 5AJUA 5KYUA 3S44A 4ZCIA 3OCJA 4CBVA 1N9GA 5HQ3B 1T1RA 1XRLA 5JJIA 4AJ2A 1YZLA 5JZSA 4FR5A 3C5VA 3UHAA 1G55A 3VR6H 2W2VA 1I3OA 4RFSB 1UIRA 1LWNA 1E6UA 5EESA 2BY4A 3DUFA 1US8A 3ZZNA 2AHRA 3VU0A 3ZX4A 5E7JA 4X6XA 4DG5A 5B30A 1JT2A 4YLGA 4ZKEA 3N2GB 1OWOA 2PMCA 3DXZA 3TDMA 4DANA 2FUCA 3Q8KA 2HWKA 3AQIA 4H1UA 1ZVQA 3SZRA 1CNEA 5LP6A 4C0JA 3ES9A 4BZPA 3ILXA 5HFJA 3OPQA 3W04A 5AW3A 5HGXA 4KLRA 2PZGA 3RYIB 2C54A 4OHCA 3I5UA 3WLIA 3GH1A 1IN5A 1Z6YA 2EP5A 1KQFA 1O6GA 4G89A 3A58B 4LDRA 4GYWA 4YPOA 4NU0A 3RD5A 1KTIA 4JEMA 3ZE0B 3B60A 4KPFC 4CKCA 1W0KA 5AM1A 4XIIA 1XDSA 4INJA 1WUIS 2PBZA 1G21A 2DFKB 3QTLA 2HL6A 2OCGA 3L4SO 3ADDA 3RVJA 2NACA 1J00A 1HMPA 2G0AA 1BXGB 3NVMB 4TN1A 3OZIA 4P7GA 3CLHA 1U2GA 1ISRA 1V0JA 4QU5A 5K3FA 3AY6A 1TQ8A 4BLOA 4KXMA 3C7AA 3W8EA 3ZU4A 1P44A 2J33A 3AHDA 3NC1C 3BMCB 1HC7A 4GU5A 5D5QA 3RIGA 1A7AA 1QH8B 3JQRA 2W5UA 3D4PA 2XNKA 3ECSA 2J31A 2Q8PA 4ASUA 1ODSA 2QQGA 1UBHS 3NAQA 5J63A 4MARA 3OLZA 1QB7A 1LPOA 2VDJA 1NXQA 1DTEA 1KVTA 3RYHB 4Z5XA 5KQMA 2IIVA 1JAZA 1UBKS 2ZI6A 3AY0A 1GU0A 4Q9HA 1LY1A 1Q20A 1X42A 4XORA 1QB8A 2PNFA 3DH0A 4MIKA 3HU3A 3LKBA 4AG6A 4QEDA 1LA2A 2EEPA 4WGFA 1TKRA 4QYSA 1ZJZA 1O4VA 4R2LA 3WR5A 1PAUA 1XTSA 3D26A 5EMHA 2ZXUA 1WD5A 1VGRA 2VT7A 3M4NA 4UNSA 1RAAA 1O0SA 1UXHA 4RXMA 4EMBA 2VO1A 1MO6A 4AM8A 5FLYA 2HN9A 4DR4B 4YEDA 3N7UA 1C8BA 5IVPA 5DGDA 5J1SB 1QH1B 3RF7A 5FBKA 3OLXA 5K4HA 5DNUA 3FUUA 2Q3DA 3H0EA 5IBQA 4IYJA 3UGQA 4XB2A 1PTKA 4B6OA 5K0FA 3D1VA 4RM0A 2QD1A 1AQIA 1TO6A 5AJZA 3WICA 2EX1A 2AOTB 2B69A 2IZ0A 1UMCA 2H0AA 3ECCA 3M4ZA 1VLLA 5LIRA 2J32A 2YHBA 4IDHA 4CT0A 5GWXA 1VFPA 5JO0A 3PD0A 1C1XA 1O6FA 4N82A 3SP1A 3CT6A 2VEOA 3PDJA 1N57A 5G0UA 1WZNA 3OZDA 4B35A 4CLOB 4MI9A 3FGNA 3CB4A 1YS4A 3QBTA 4U00A 2ZUDA 2QUJA 3HSSA 4BQOA 5LZ9A 2JJQA 3P9RA 2NVUB 2UAGA 5ALXA 1IUNA 3HCNA 4B8ZA 3LECA 3FB1A 2H0QA 3OJEA 4LFBB 4ZZ0A 1GNPA 3AM1A 5JYDA 2BMFA 3UJ9A 4UOQA 2AFHE 5J35A 1DEKA 4DYHA 3RHFA 2ZZMA 1MLDA 2CVHA 5AO9A 1WKVA 4Y7CA 1U8UA 3D54D 3NIWA 4KWHA 4WOKA 4ZU1X 2ZB4A 4KRXA 8ABPA 3UANA 2A78A 3M6MD 4L0CA 5LU9A 3BIJA 2WIKA 5HVNA 1YOVB 1U2DC 1TJPB 1C0PA 3MWDB 3O5AA 2CDRA 4IMPA 3I28A 4IOLA 4O4LF 5CA0A 4BN5A 3MTQA 3PXXA 3CXCB 3IUMA 1XZPA 4KN5A 4WLNA 4RZXA 5KYGA 1W0JD 1TZBA 2PR2A 4CMBA 4CKZA 3VR4A 3UMFA 3GJRA 1FDWA 3I64A 1YJQA 4Y8VA 1SKQA 5CT9A 4BZZA 1E7SA 4QUJA 1NNUA 2A94A 4IVNA 5GONB 3R8XA 4X1KB 5LM3A 1U0TA 1QMPA 2UV8A 5CD1A 4ZV7A 2XYVA 4CT4B 1IHOA 3LDAA 3D3QA 1MAUA 3MJRA 4YN3A 3REGA 1RHKA 4L4UA 1PNRA 3L0BA 3N39C 3WAGA 4LOHA 3KZKA 1IVSA 2IWHA 1P2TA 4I55F 4URHA 4W4TA 5JDCA 1JXAA 1ZM7A 1G8SA 1LBEA 1SHUX 3OWOA 4P53A 1QANA 4IILA 4PGGA 4IZHA 5EG5A 2ZBGA 1JQ3A 2HQSA 3ON5A 1QIIA 1DKOA 1Q12A 3T3IA 2VDLB 4OJKA 4DA7A 3R7LA 2HR1A 3M49A 1VBNA 3KQVA 1GYRA 4DFDA 1C2TA 1YR7A 3I62A 4EHBA 2BMAA 3A10A 5C7LO 3OM9A 4B75A 1U8XX 1KOFA 2ERXA 4FUQA 4IV0A 4RELA 2QQ0A 1PGOA 2GO7A 1L5LA 1XX6A 4EO9A 5CW2A 5KINB 4U02A 1RBQA 1ZH6A 3OF5A 1N1EA 4QWMA 4DQDA 2K7ZA 5FL7D 4DIEA 2E2WA 4EJSA 1RJ9B 1T4MA 3B3FA 3CUTA 4Z3OA 3LQRA 3ONFA 4BGDA 4ZKDA 1RC8A 5K8TA 2F7SA 3A1WA 5EWMB 2ZAMA 1S7GA 1F0PA 1TM1E 2V1XA 1A82A 4MVJM 4BVFA 2A9JA 1KI4A 4OSPA 3KQPA 4E5VA 5LZ4A 2WD7B 4GW3A 1YDHA 2ABWA 4J0EA 3SHFA 4KRFA 4JUBA 4CUJA 3MJDA 1H3NA 4R1PA 5KQRA 1IM8A 4X95A 1QYWA 3QQPA 4RSGA 1JIQA 1EZZA 5M7EA 3KEOA 3SF8A 1PZHA 4JT8A 1Y3FE 3EIQA 1NXOA 1U8ZA 1BOFA 3RUEA 2FQYA 5FA6A 1RHUA 4KE9A 1K0UA 5TRDA 1GPYA 1X1QA 2WUDA 4WDQA 2JGIA 1FDOA 3WMWA 4O59O 3GRVA 5H9VA 3TTTA 4H1HA 4J0QA 1S3GA 4NAVA 3FCSB 3SC4A 2O4CA 4HO1X 3JRNA 4R1UA 4B6SA 2FB9A 2ZYRA 1ZX1A 4AIRA 1MDBA 1PJ3A 1ZN9A 2ZWOA 1KC8D 2CHGA 5CVEA 3UN1A 4EKEA 3K6SB 2AX3A 4MWDA 3TLCA 2R2GA 4BV3A 2YVAA 2ZSIA 1F3OA 3DBVO 4B4VA 2GHQA 1OA1A 3CP2A 2C31A 3BIWA 3BWBA 1HX7A 4MKGA 5EZYF 3PEFA 1ZP6A 2LDBA 4FHFA 3T41A 2FH5B 3MN1A 4H17A 3VO9A 2EFGA 1QKKA 1EJ6A 2DUWA 3DDOA 4M1YA 4RADA 3EYAA 2P3OA 3ZV7A 3WL7A 4RLZA 1JW9B 1KEPA 1TTPB 2A5FA 2WM3A 2YJGA 3CX6A 3GPDG 1M6VB 3F8TA 5E8RA 4MW1A 3A4LA 2Z8YM 3WDMA 3BCSA 1SCUB 1ZRMA 3H5NA 3FOCA 4PW0A 2ZU0C 2F1KA 1ESDA 3GNSA 4WT7A 1BE1A 3U3RA 1NPYA 2QSJA 2PL1A 2GDJA 1KVQA 3CE6A 3DE1X 1PT9A 5T6MA 2XDWA 4F2DA 5AVVA 3RVKA 3MPUA 4Y2VA 3FJ1A 4XQEA 2HU7A 4KI0A 1JIKA 4NV0A 3BK2A 4KQJA 4LY3A 4A5SA 3KSRA 3QNMA 3DMDA 2LZJA 1PQ4A 4LK3A 5BUCA 1VQ4B 3L3BA 2FQQA 2F8MA 2ZWMA 1KFKB 2G4LA 3PB3A 1VF7A 3G3EA 4CCSA 3COJA 2ACVA 1M66A 2Q07A 4DNOA 4F5DA 5GONA 4Y2QA 3MWLA 4RSHA 4J4BA 4RY9A 2IX3A 1E3XA 1N6RA 4IFTA 4CM9D 1YU9A 4H0FA 4C2BA 3O6VA 2Q4EA 3ZNOA 1CHNA 4P6YA 3GELA 3H1FA 2X9LA 4PF1A 3RUPA 4UTOA 3RU2A 4Q93A 4XL9A 1LCIA 3CBGA 2FZ5A 2N3ZA 1TQ2A 2X7JA 3GRKA 1DARA 1P3DA 2C2ZA 3K15A 3MLEA 4N3BA 1YONA 3NDIA 2VUTA 5A62A 2IYQA 4MAAA 2WJGA 5BNIA 1GVHA 3KJHA 4C5BA 5EMKA 3FDJA 4PWYA 2FEKA 2A5DA 2Z9DA 2ZWVA 4M9CA 2KMLA 4KNVA 4EX7A 1RYFA 2ZBQA 3GT3A 221PA 3L6EA 4KNWA 2X2EA 2AZTA 1CQXA 4X7DA 3FGPA 5HKLA 3ETEA 1G8PA 3GLFA 5L9AA 3JW8A 4C87A 1A9OA 3EEBA 1Z22A 2XNHA 3B5JA 1NN1A 3IC5A 3O92A 4XOIA 1GN8A 1JFVA 5TGTA 4INPA 1RRPA 2OZKA 2WZQA 2YIDA 3O26A 3S0JA 1WMFA 1Y5IA 2OV1A 3QXJA 4LJ7A 2VQSA 1X74A 2XZTA 2RIPA 3FM9A 2I76A 5GVRA 3VXKA 4YV1A 2DPGA 1RHQA 3KHSA 2NO4A 4F85A 2CE2X 3RRFA 4UASA 3DT6A 2GCNA 2IUEA 4CF5A 2XTAA 3BK1A 4RO0A 2IXEA 4DIMA 5F4MA 4WPGA 5K8LA 3ZBTA 3AONB 3UMGA 1JJFA 3FCAA 3JQPA 4IDDA 3FMGA 4R1LA 1E8MA 1WM1A 3W78A 4LF4B 3LPLA 1EP2B 4Q3DA 4IOKA 4MS1B 2LV8A 1H2EA 1RT9A 3ICOA 1X77A 4CIYA 5AVRA 3LK7A 1Z6TA 5DTRA 2O8DB 2ZPAA 3ROQA 2Q1XA 3IQHX 3S40A 4WESB 4JB2A 5JCJD 2VBGA 1E43A 3KTFA 3WBJA 5DN6D 5EJ2A 2XB6A 1C3LA 5D85A 3LQ1A 2MJLA 2O9JA 5LZ5A 4B3CA 4AZSA 3VJRA 1GTG1 4TLCA 3CW2A 3HG7A 4I46A 4M0CA 2CJPA 2B8JA 4XD7A 2V3WA 2W6JD 4FOOA 4H4EA 4IIJF 3HJGA 4NJMA 4NY1A 4O4HF 2L19A 4NPHA 2YFQA 2HZBA 2HSEA 2NXJA 4FC7A 4YPFA 2FFJA 1RAEA 2GWRA 3MS7A 1RAGA 3CZ4A 2HQOA 4ZWNA 3T5TA 2GBIA 5CDFA 1S9HA 3TMYA 4AROA 1NZJA 3JAKA 1VQPB 4P84A 4UNQA 3SKYA 2HIHA 3GZNB 4F5YA 4RK6A 5DNWA 3II6X 1E20A 1XZGA 4MRRA 4OFBA 4W1PA 2FTKE 5FNVB 1UAAA 2EOAA 1NJSA 3OI7A 1CG6A 4JMPA 4QKQA 5AWFC 2BI8A 4DQXA 3R7WB 5EEHA 2HPAA 4IMRA 1RKUA 3HR8A 4AD8A 3CVVA 3TTWA 4AJLA 1XQYA 2I6FA 3CGGA 1E5QA 4TVBA 1FJHA 1FYDA 2ZIWB 4E14A 1YJ8A 2KE5A 2WIDA 3R5XA 5BRAA 1PR3A 4ZOLF 2RH8A 2KQUA 4KKUA 1YNOA 1SBZA 5JCXA 3MAJA 5IYWA 4R0VA 5IUJC 1V8PA 1A7JA 3H8WA 4U9UA 3FPJA 2R00C 3PA2A 4MVJF 4TLAA 3SJ7A 2IHTA 4BKPA 5CFOA 2WIGA 4EHAA 3O3MB 2Z6BD 1N1DA 1QTIA 2JGKA 1P91A 1NRIA 2RCNA 1M7GA 1SMKA 2IXDA 1EX7A 5DTIA 1J4AA 1N7IA 4JXJA 5LOVB 1DDGA 1OX4B 4HZUA 4M49A 1AHNA 2ID7A 2CBZA 2NNWB 4JOBA 3V6MA 2QXUA 2XT6A 2R8ZA 1GRVA 1QBGA 3NM5A 4NV1A 3TXXA 3K9FC 1L6RA 2A3NA 1UBCA 1FEZA 1Q7CA 3I6YA 3QKWA 2HA6A 3VHXA 4JC0A 4D99A 2V7QA 3DBHA 2PX0A 1M34A 4GC9A 5C18A 4HP8A 2ZTLA 1NQOA 4NV3A 2CB0A 1TRKA 1SXJA 5JHHB 3E05A 4RTMA 1TTTA 3W1VA 4X6LA 3AVVA 2VSXA 2WLTA 3Q3EA 3I12A 5LZ8A 2FUG6 3JYPA 2IYNA 2CXXA 3DMTA 5AK4A 5GGXA 3BMNA 2BFBA 4Y2UA 4B43A 1NIPA 1WHSA 1FJ2A 1EE2A 2B2XA 2OFXA 1RQ2A 3QYAA 4U2DA 4XIGS 1EB8A 4NMWA 4JCOA 5JEDA 3U81A 4YR7A 3LLVA 1X80B 2FF5A 4OXRA 4LGYA 1Y9EA 4KPGA 3ANYB 4KIJA 3HV2A 3W7VA 3C5WP 2CZCA 3QWBA 1N7GA 5L45A 4ZEWA 3EZ9A 1SKUA 2C82A 5LQUA 1V8BA 3TTUA 3RC8A 4DGSA 1GG9A 3NRCA 2EJCA 4JYPA 4TZ6A 1DS6A 2BJVA 5I48A 3BWEA 3GRZA 1YDWA 2OZLA 1Y1RA 1IZ0A 3LVBA 5IK2A 3U09A 4F4UA 3P9YA 1W9MA 4JP2A 2EZ9A 3UAGA 1APBA 4ML3A 3GZJA 1T8TA 3SK0A 3H5TA 4KN6A 4KZKA 1A3CA 2HSDA 1KMCA 1CS4C 1N5DA 1JDUA 4DLVA 4WK6A 3NT4A 4Q9JA 4RCYA 4WASA 1GPNA 5DX1A 3Q85A 3GIDA 3ORQA 4CV3A 1ICIA 1NVDA 1CYEA 4L51A 2AC4A 1OZHA 2HLPA 3UT5B 3HA7A 3F71A 1T4CB 2O23A 3IR5A 3OHSX 3ORRA 3HMQA 3U80A 1R4MA 2FKNA 4OQZA 4NBNA 5LNK1 1IB0A 4ALNA 2O1SA 1NN0A 1WR8A 1Z16A 2ZIZA 4IICA 1XTKA 2Z5FA 4GX5A 3VI3B 2B1GA 1NJ2A 1KPGA 1MXFA 1P74A 1SAYA 2B3DA 4HGZA 4QSMA 3W90A 4BDTA 5IN4A 4RTPA 1WE2A 2I1LA 3L7BA 2WWWA 4XFDA 4DILA 4HL6A 1KRWA 3CYFA 4IFIA 1QO0D 1ONBA 2FEWB 1XMOB 4FHZA 5C7YA 1Z35A 4MW0A 2PUWA 1N2IA 1KQOA 3CUKA 1FFAA 4LBZA 1UQUA 3X1XA 2FPPA 1NAHA 4XJXA 4Z4EA 4ZDJA 2FW7A 5AHWA 2YV2A 3QXSA 3CCLB 4E21A 5K8CA 3GPBA 3OY2A 1Z0DA 3OE5A 1XUOA 1JFLA 5DM4A 5GADl 2HJRA 5K99A 4FOSA 3BSFA 2E6KA 2RHGB 2YV4A 4ZQCB 5K51A 2JDID 1J21A 1A96A 2BDEA 3BBPA 3KFLA 4R8VA 3AGQA 1C3XA 2NZXA 4EEZA 1N5MA 2DHDA 4Q0MA 5EUCA 5BSRA 5DNEA 1XVAA 3TRFA 2ZTSA 4HX9A 1QHHA 1CK4A 4D80A 3CCRB 4YRKA 1CY1A 4OJNA 2VJPA 3IIEA 1ZK1A 2OUIA 5LXTF 5K9ZA 1QG2A 4JLVA 2BW0A 4DSOA 1JQKA 2RHBA 1YNSA 2ZI7A 2IHJA 4HKTA 3DOIA 2ZM6B 1GO2A 2XJ4A 3OG9A 1XJCA 1DXOA 2FVGA 4H3SA 4BU1A 1XAGA 4N6NA 3O8RA 5CVDA 2GJSA 2WT4A 3ETNA 1Y3IA 1HFWA 5H4HA 1E2DA 3UPUA 1A69A 3TOSA 1FFXA 2RGCA 5HKOA 1ZM4A 2C4NA 3T61A 1IOLA 5CYGA 3L1KA 3VHLB 4FCCA 1J8YF 1GGMA 3UCXA 4LXHA 1SBYA 1LK5A 4XM2A 1ADFA 2XRYA 3I04M 5DRYA 3GDOA 4TTTS 2WZPP 4W7SA 3RYFA 1H94A 2GKSA 2XYHA 4KWIA 3W5UA 2FFQA 4MYCA 1WDLA 3TQHA 1E94E 1P2DA 1YA6A 4UU7A 3GDGA 1LLQA 1U3TA 2BGMA 5LJLA 4K6MA 4P32A 1SA0A 1G42A 1OFTA 2QN1A 1TJ5A 4IIHA 5LP1A 4MGYR 4MQFA 1OU4A 1Y4UA 621PA 3PR3A 1TX4B 5E7MA 2VDNB 1GV0A 3IAAA 5B2ZA 3ZLBA 2CL6X 3KLOA 1SKMA 2OHIA 5J4VA 2XZLA 4D97A 4EA9A 2HXSA 2ZAIA 3DOUA 1Z2AA 5TV2A 1DAIA 2CJFA 3LY7A 1OWPA 1UBFA 3DYVA 3N0XA 3QVKA 4LSZA 2H4YA 2BFWA 3DBRB 3INRA 2YOFA 1AC5A 4WLFA 5CFRA 2ZJFA 2V7EA 3D7NA 4MEJA 2E55A 2PX5A 1FYXA 1JE1A 2V7PA 4JI2B 3T0GA 4BX3A 4JQSA 2IP4A 3R7WA 4AJ4A 5GQSA 5FJIA 3PA8A 1VYVA 5BWCA 4NECA 5DLDA 2OECA 3E9QA 5E6UA 1GGHA 5B7QA 1KR2A 4REMA 3B1WA 3PT9A 1HL7A 3IKTA 3LYUA 2XLBA 4TSFD 2VNAA 4U7FA 3O47A 3CWQA 4AAYA 4RD1A 2CXHA 2PH3A 3P5SA 4Q03A 4AICA 3I9V6 2VSFA 4FNOA 1ECCA 1J49A 3RFCA 2IS2A 4R8MA 1KSJA 2C57A 3IKJA 5IDXA 2I4TA 1L7EA 1ZD3A 4XDZA 4M36A 4JLAA 4N8DA 3JD2A 4J4HA 4MLDA 4DWJA 3Q38A 5EQFA 2IBSA 2ZJ7A 4HGNA 1BU5A 3DTVB 4C07A 2QXYA 2AE2A 2R68A 2V65A 4LGMA 6REQA 4RA9B 4KPUB 2O2YA 2K7FA 3HUUA 2YMLA 4JXKA 1T5EA 2BF7A 1VIDA 2OVBA 2V6MA 4FGLA 4GZLA 3S8MA 5KWEA 2FZWA 3TRDA 3U1TA 5F3WB 1N2CA 4C0KA 2X6WA 1Y1KE 2YQZA 4KK4A 5KQLA 1QR2A 2I2XB 3T1YB 3HRIA 2MIIA 4JJZA 4MS1A 3SJCA 4WJLA 1RE1A 1L5FA 3UEOA 1I0LA 1QQAA 4K0KB 2OG1A 2ONJA 3TSZA 3ZK8A 2Q4BA 3ZU6A 3KZ1E 3OD1A 4WY5A 2R7LA 3VSEA 1QF7A 4URZR 3RW9A 2HRBA 2ONZA 2Z2YA 1MNAA 2W42A 2CDNA 2GK3A 1P18A 2F1JA 3FI0A 1JXMA 4I9HA 4YHHB 4G5FA 2AR9A 1PT7A 3CLSD 3TE6A 2XX3A 1RXIA 1MRNA 2WU3A 5AM0A 2HPZA 3G7NA 5KHLB 3HTXA 2IPOA 2Q5OA 3AKYA 1U7OA 2OTCA 3BSYA 3SZUA 3LK6A 4JXXA 4R1NA 3AH8A 4B71A 1OLOA 1WB9A 3HJHA 2IV2X 4MQFB 2BYTA 3IALA 2A7QA 3B3JA 3NC0C 1LV8A 2D8AA 4TUYB 2QZZA 2OKCA 3W1WA 4FP9A 4GX2A 3KJEA 2NQ8A 1LSUA 2CCGA 1QHSA 3QEOA 2ZWIA 3QEMB 2ZBEA 4MVJA 3DAHA 3GXOA 2NUTA 2PK3A 3W77A 1YHQB 3IBFA 4RD3A 4FYIA 5F12A 2UUAB 3F97A 5FLEX 4FINA 5JQWA 4I6JA 2JGNA 3ZS9A 1DP4A 2IBTA 4AF6A 1FFXB 1RP1A 1TKCA 1D4OA 3BULA 4BFZA 1JXQA 1O8CA 2DR0A 2C99A 1V95A 4M89A 5ALEA 3T12A 4DMLA 2GASA 2XAAA 3E22A 3HY4A 1FXUA 4FMDB 4LXTA 2IYXA 4BEBA 3I9NA 5JFTA 5KVQA 2ZAOA 2I3AA 3I3SR 3QEKA 3H19A 5EZ6B 1I7QB 1F2TB 2PKYX 2HSGA 1E2EA 1ZVKA 4M55A 4ZVKA 1CPYA 2X4LA 1HDZA 4D9KA 5KNDD 5KNLA 3L84A 4L1KA 2AN4A 4AYTA 2ZBVA 1DT5A 3UJHA 4ZREA 3DL2A 3N87A 2HA7A 3IXQA 3LBYA 3REOA 2HO4A 3LP5A 4A8PA 1CUFA 1T2AA 3P9NA 4OI1A 3GGDA 1RZRA 4OP1A 1H4SA 2PFKA 4YAEA 1GPLA 5H9WA 3B82A 4U7JA 1RVDA 4LYHA 5B36A 3BDVA 3MTEA 3TE7A 3KSBC 2ZJ1A 2Z1MA 5KMGB 5BT9A 4E13A 3CMMA 4QDJA 4BX2A 2P2DA 3DGFC 4FUTA 3L9WA 1NXSA 4WN9B 1X0VA 4ZHQA 3C5HA 3T5AA 1LVHA 3GMSA 4KREA 3ONUA 3TIXB 1OI4A 5ADUS 5LKRA 4C7OB 5AUPB 3T5MA 2GARA 1JU3A 2YWJA 2SBTA 1T3TA 1EXVA 1T5IA 4Z0HO 2G07A 4DLYA 1EWQA 3KOMA 4B85A 3E18A 1N92A 5IM4A 2VHUA 1J2JA 4M38A 1OLSA 3LO8A 5I6DA 3TGLA 4AC9A 3F0TA 5JYEA 4CIWA 4G65A 4B82A 4CM8A 2I4IA 4WE3A 5SZIA 3HBFA 4Z3KA 1MAWA 1R6VA 1AURA 3QK7A 3H84A 2JJ2D 2P9GA 3PC8C 4OMUA 2HDWA 4R9NA 4YJGA 1N8TA 1TJNA 3CA8A 3L7LA 2PWAA 1BMDA 3AF2A 1T2NA 4Z4TA 3C4VA 3E4CA 4X7FA 4DY6A 1TCVA 1GSHA 3CRNA 3DUFB 1J7JA 1UJ2A 3SR4A 4Y2XA 3ZN2A 5EPEA 3V4FA 5CDUA 1K7CA 2RGXA 2BOVA 4F1JA 3LLSA 4KVAA 2JEOA 7MDHA 5FUXA 2CBXA 1VP3A 5DU2A 1S2GA 1DOAA 1XK7A 4OGWA 3CHYA 4Z99A 1ACMA 4JDUA 3BWCA 4CE6A 2CB9A 3I39X 1CZOA 1P4MA 4P26A 1X19A 2OFFA 3CLUC 3OA2A 4ZPXA 5CLQA 1Q0LA 3PX2A 3TBFA 1ZIXA 3EXG2 4FKZA 5DNCA 1X2BA 1XMPA 2VPXA 3QH4A 1SNYA 4BRWA 2ZZEA 3AHJA 1DKPA 3LP8A 1RQPA 1BVUA 3FG9A 2EKDA 4TXMA 2JLAA 4B80A 4OB6A 1PSWA 3I9LA 5EQTA 3C3DA 1RI3A 1SHTX 4BN0A 3UJDA 3IQWA 3NTXA 3Q6NA 4FW8A 2AMVA 3R0XA 4ARVA 5IN5A 2FDRA 1HZZC 3HKBA 3QXHA 3AM5A 5IH7A 3S2YA 9LDTA 5MFZA 3TRIA 1SUCA 2WMYA 3LVQE 4PLHA 1RRKA 2WRZA 1LRJA 5T3YA 4AZWA 5A4JA 3U4MA 1LJ8A 1G8FA 4G1BA 1I30A 2ZRBA 4JUAA 3TMAA 5EWJA 1A04A 1S3IA 3UNXA 3V1LA 2HWUA 4MLZA 3RDPA 4QOGA 4D9JA 2D4AA 2WT9A 3CR8A 3FCOA 3TZQA 4FD3A 2V3VA 2P3QA 1R9GA 2LIPA 3WKBA 4Y6PA 3URMA 4DYDA 2BHSA 2HIMA 3UO8B 4YRJA 4D0SA 2R6CA 2BUAA 4G4JA 2WF7A 3X2EA 1HY3A 1SA0B 1N25A 3ER6A 4J0GA 1KWKA 1OJ7A 1KZYC 4RGBA 4BNJA 1I2BA 4K6OA 2FPRA 2GYYA 3DMGA 1B4DA 4K1LA 1S5PA 2BKAA 4KFTA 4UTPA 3SQXA 4UCXA 4M1OA 3CF4A 3Q7TA 3HB4X 3ZNQA 1TJ4A 2QGZA 3CN7A 3CNNA 4JBGA 4PV7A 4F0JA 2DSTA 5K0EA 4W5NA 1CR4A 4DCNA 3WWEA 1W9XA 1QH1A 3V4ZA 3V8BA 2NU7A 4NBUA 4ZA2A 1HLFA 4BOYA 3G8YA 1KK3A 1K4KA 4J2OA 2C7GA 1NWHA 1KSHA 2O3UA 3RVOA 2WHXA 3KZVA 3DVQX 4AY5A 3A37A 2Z1NA 2XWJI 2C9MA 2O52A 4D9IA 5JQGF 2ZCVA 1V41E 1ZMTA 5CA1F 5HS4A 1TD1A 2YJZA 1K9VF 4C4TA 2ZR0A 5DHQA 1CUIA 2R79A 3D8UA 3DXXA 2G1KA 3L0OA 1BX3A 4R3NA 3IDFA 5J5AA 2H08A 2FDXA 3V4PB 4IJ5A 3EJ6A 3OVMA 4CL2A 4P0QB 2BKEA 2ISCA 3PPIA 1L4FA 1M72A 3FYCA 2KLBA 1GP2A 1NVBA 3TH5A 1U2ZA 2MR5A 2R5NA 1F38A 1T6XA 3GDWA 4GUAA 1IZYA 4QDTA 1E9BA 3E8SA 3NBFA 1S2IA 3BHNA 3KSUA 4LRQA 4M0DA 1LQTA 3EPRA 4QOFA 3HVHA 3OPYA 3ROTA 2C3PA 3EK2A 4RHCA 3TCXB 1QH8A 4DE5A 1UJCA 3D2CA 5ER9A 5JCOC 3CUWA 4Q9DA 5CGZA 3MILA 3WADA 1OYVA 1HUQA 4MRMA 2CV2A 3U7HB 1Q6ZA 3N6VA 1YL6A 3FYUC 3PXBA 4LYGA 4XIJA 1SVIA 2YNMD 4C4OA 1UM9B 4F1KA 2IYVA 1Y4SA 2REQA 1FBNA 1Y8QA 1KK2A 3DHNA 3COVA 4N3NA 1RAIA 1JKJA 1TCAA 1TIPA 1X7GA 1XO1A 2PKEA 3DV0A 2WJ4A 3HVJA 1HQDA 3PDHA 5ALUA 1G8GA 3WJ1A 1NI4B 1D1QA 3HDYA 4PQRA 1CP2A 2CWDA 5LJIA 3L5OA 3R9XA 3H9JA 1D2CA 1PNOA 4Z4UA 2II6A 2ON6A 3OZEA 3W6PA 1AUQA 1XVUA 3N2KA 1M2FA 3GEDA 1ID1A 1EUQA 2IYFA 4E5MA 5FPPA 2CD7A 3VSDA 2ASEA 3FVTA 2KBEA 3QYFA 5DBEX 3JQ8B 1UXOA 3EFHA 3URKA 5B12A 1L4MA 1R8YA 3S8EA 5DGIA 4OA5A 2JGAA 3ZW8A 4ZJPA 3SWWA 3QF4B 1LRKA 3TEJA 3UT5A 1WOPA 4NK4A 4WCDA 3DL0A 3BA6A 5DHRA 2PGLA 4I66A 1UWVA 3RNLA 2YRXA 5C8XA 1Z4KA 4B44A 2X8JA 1I2DA 3IVAA 2Q6TA 5JDCC 3LQEA 1DWOA 2H8KA 2SECE 2J5QA 4FE7A 4DQUA 4LF5B 1WPCA 2PIDA 3KT0A 2IPAB 1C30A 4IZ6A 1ZD9A 2GEDA 2HMTA 2RHJA 3EMVA 1PJSA 3NWJA 3C3KA 5LZ2A 2VI5A 4W6ZA 3ZH2A 3LQ6A 4ZAGA 3SYLA 5DTQA 4R3UC 4M9XA 5JMOA 2W4IA 1OXKB 1AXRA 4G7XA 3VO1A 1YV9A 3GN1A 4QPZA 3SZLA 3U19A 5LLTA 4RULA 4G5GA 1FP4B 3TLGA 2DPYA 3CUVA 3ESQA 3HE3A 3EVEA 2Q0SA 2E5FA 2D1SA 2VF7A 4IPTA 2GB4A 3U44B 1WJGA 3SBXA 4BVLA 2P27A 3L8EA 1PK7A 5BQXA 2GPYA 3HU5A 4G0XA 4IXWA 3ESRA 3EPKA 2B61A 2X0KA 2D1QA 2FXIA 3GBPA 1B0AA 3M6LA 3ZQ4A 1LK0A 1XI2A 3E5NA 3KZNA 4JK3A 3CT4A 4P2BA 3DD5A 1AKRA 4GBGA 1BYIA 1TW2A 3I04A 4GKVA 1FL9A 3SFTA 2GVZC 3DBLA 1YAJA 1AUXA 2M6RA 2XTZA 2R6HA 1Z3CA 2P0AA 3KELA 3PE4A 4E03A 2FP3A 1RADA 4EHJA 2ZJ5A 2IHNA 1Z6AA 3B6MA 1TUIA 3FYHA 1Z74A 1DFGA 3A3OA 3BA1A 3D5TA 2G9ZA 1IG0A 3FBGA 2HK7A 3LGSA 4NZZA 3KEMA 3N76A 4Q3KA 3UOWA 5JSFA 1U2DA 3CZ9A 1BHO1 1FVXA 1X13A 1QHIA 2IOQA 2ZBPA 4NBSA 1D8TA 3AQ4A 3EG5A 4U5QA 1LS6A 2PGOA 5F7ZA 3SYNA 4RWEA 1YBHA 2BEVB 1N75A 3TLBA 1XAHA 4CKWB 3TZBA 1P31A 3S7ZA 4E70A 3WYGA 3SBEA 2AKAB 4DV1B 4UFPA 3C3MA 3EZGA 3FYDA 2QPTA 1R6DA 3AVQA 3A6GA 4OKIA 2IU4A 1JEEA 1N7JA 1B42A 2C4WA 4FT2A 4JSTA 4PONA 2I2FA 2QTWB 4ADSG 1YDGA 1G20E 3CJTA 3QE0A 5FI3A 2PMFA 3N3AC 1QGED 3ZWVA 2ZT8A 1FS6A 3G68A 3RWBA 5IRCD 2ERCA 1T8PA 4Q00A 2PGNA 5KSWB 1IJKA 4FEGA 2AFIB 4C5CA 1P7ZA 1YHYA 2W37A 1GFIA 3D8BA 1X3LA 4W5TA 5LP6F 4IEEA 2JI6A 4B5KA 2C98A 3COZA 2C5SA 2YN4A 3FH0A 3UKJA 2BAGA 1JNYA 3WP1B 2Y66A 3IKLA 2VCYA 3QMPA 4MQMA 3NH9A 4GZ5A 5JBIA 2CLKB 2OO5A 4I14A 1QHGA 2FW9A 4CQJA 4D45A 3DVAB 3BCHA 4MGHA 3WIUA 1J20A 3ODPA 3UICA 1E2QA 4RVUA 4WACA 5EZSA 1N3LA 1SCIA 1Q1EA 3KBOA 1RQ7A 3FCUB 4Q1FA 4POOA 2CNLA 3R7FA 2PZJA 3E3AA 5LB2A 4RK7A 1EUDB 1OBFO 1OF1A 1Q7YD 5AKKA 5F64A 4YRMA 2X19A 3GRAA 4N5NA 1DRVA 3A1PA 3EDCA 3HWRA 3WL3A 1U2GC 1QE0A 1BXRA 4AMZA 4IAOA 1F60A 1EA7A 3DHWC 3GHYA 1EDBA 4BO0A 3DDNA 3SIWA 2M32A 3DDWA 4QXRA 3CKLA 4TS3A 4NZNA 3OTIA 3F5SA 4L0QA 5GV7A 2IV7A 2HREA 4DEXA 1OX6A 2DFLA 4D46A 4E1BA 3ROFA 4PCVA 4L2IA 2BMDA 4QVGA 5F9HA 2IEGA 1DUIA 2ZUBA 3OJLA 3F96A 5DGHA 5DGTA 4LQLA 3LD9A 5FOTA 4DSTA 5AVTA 3PIRA 1DIOB 2OV4A 1HA3A 3OZRA 1SQFA 3B1FA 3BE4A 5C1PA 2ZJYA 4LOKA 4EFDA 5KQPA 4BMNA 4DQ0A 1P60A 2XA9A 1TC2A 1NVKA 2O8VA 2P6UA 1DC5A 5IMBA 2C3OA 3ME5A 3UH1A 1GEGA 4QOSA 1ZD1A 3M6IA 1SC6A 3MS4A 4V0KA 3RNOA 3OUUA 1EXWA 1NDQA 2NV2B 1SH7A 4RYLA 5TPWB 1W44A 2HPVA 3PNKA 2P5SA 5GY7A 1IHUA 4OOFA 2UYOA 3P2MA 4M1MA 3X2SA 2PXAA 2IW3A 2I4MA 2JKYA 1S4MA 3EW9A 2X9VA 2IF2A 4LZLA 1GNVA 4C1BA 3LYLA 4MQUA 4ZZ2A 4TT3A 3H18A 3NBMA 3EZ6A 2VFAA 4H7DA 3ST7A 4F8JA 3TTXA 2ZT5A 4WZBE 2IYYA 1ZMXA 5L46A 2O3QA 3JPWA 3LV8A 5DTMA 3WGUA 4HUQA 1D1TA 1YFKA 3I2GA 4F72A 4Z7OB 4DRZA 5ICSA 4XXHA 4LHXA 5TNXA 1CUEA 1NP7A 2YHAA 4L0DA 4MP8A 3T1QA 3HFJA 3W5JA 1NMQA 2QQEA 2O8CB 1WPRA 4MH0R 4R2MA 4XM0A 4P2GA 4BO9A 2V6GA 4TKZA 2QTAA 4GQAA 4NYJQ 5AI8A 3RTAA 4WY2A 4IRMA 1J8MF 2WE8A 3MT8A 4JVMA 3L6CA 4DM3A 1LVGA 2D7CA 2O2GA 2JASA 2XUGA 7REQB 4H7FA 1ZZEA 4II7A 2VKQA 3A9TA 2QLLA 1GGEA 3IKMB 5ESDA 1NNLA 3T9AA 2QE7A 3VR3A 721PA 3QUSA 1OZ0A 1PF7E 1P1FA 2HDNB 2ID9A 3FIJA 3TR5A 4IRXA 4HDNB 2P69A 2HBZA 3IEMA 3SLNA 3HLTA 4NBLA 2WLSA 5AI4A 2Z8ZA 1Z88A 2QVGA 3HCCA 3JCZA 3R5KA 1MXHA 2PBLA 2WABA 4JLUA 4ZOLB 5AQEA 3CM0A 2JKVA 2X23A 3COPA 1N2GA 3DB2A 1S02A 4UM8B 3UUWA 4IGFA 5COBA 1M0EA 2VOEA 1YI1A 1RYBA 1HWYA 2NAFA 3PZRA 4FIDA 2FK8A 4O63O 1SRRA 4Q39A 4NFLA 3C24A 2C77A 1DPGA 4OF4A 2XUQA 2DLCX 2H5EA 2WYOA 3B6JA 4KLZA 1UK7A 3AINA 4KO3S 3TZHA 5BR1A 3TPFA 5CB4F 2NVUA 5KTPA 4PR3A 1K5GA 2HSZA 1N07A 2PVSA 4QVJA 1XZCA 4GKJB 4WXYB 2P3MA 4PXSA 2PH5A 1XJWA 3RLIA 3VZRA 1CJBA 1RWQA 3KD2A 2WJJA 1R10A 5CDSA 1SG6A 3JWEA 1KAHA 2EDCA 3DDZX 2G28A 1XN4A 2V8OA 4G81A 1VE7A 3COWA 2NZVG 2E89A 4J0KA 2DCUA 1AKUA 1ZVMA 3DPUA 4AS2A 4PZUA 3CTAA 4C7KA 1YZTA 1M1YB 3I9FA 4D3FA 1JWLA 2QT1A 4C2AA 1Z25A 2X9GA 3AEZA 4EPRA 5JIBA 3AC0A 3OQOA 3AUSA 1K3FA 2FPOA 4IX1A 1KP9A 4LXQA 4WBNA 1GQSA 3DEKA 3I6QA 4P3NA 2OCBA 2J4CA 4YCAA 4IJMA 3GG9A 4OP7A 1ORVA 1CFZA 1T4DA 5TIIA 2JGLA 3DZGA 1PWHA 1O03A 1ZKMA 3I8SA 2R4QA 5E0OA 1JG7A 4LJSA 3G5MA 4W1SA 1XF9A 2D3WA 1EHYA 4C7OA 1GUDA 3N70A 4ZMRA 4YO8A 4TWRA 4UJ5A 4QASA 1ANKA 4TS4A 5BVGA 1E6MA 5SICE 3TFOA 4PCLA 3R8CA 4BUZA 4QGBA 4A1OA 3QY9A 4LE0A 5AW7A 3AB8A 3WLEA 5CH3A 4PZDA 4BVHA 3FWHA 4TMVA 3OF2A 4P3OA 3UMCA 1BW9B 2GPBA 2MSKA 2OZEA 4JVNA 4KVGA 1Y8RB 5TGDA 1KSGA 3OU7A 3NBYC 3SQMA 3NHJA 3IERA 4F2WA 3M2PA 1YJBA 1T3HA 3BGOS 1H9CA 1XEAA 3G5LA 4NIMA 5ETJA 3IEUA 5L8VA 4XR4A 5CVVA 3K0EA 2XECA 3W3AA 2O2SA 3HY6A 3ZQJA 1U7PA 3MTDA 4GRAA 3B48A 3TOXA 3TLKA 5BN4A 5BWNA 2I6XA 5K6TA 5EPOA 4LTNA 4TUYA 4GD3Q 4TWAA 3VZBA 2YINC 1GEEA 4JT4A 5CA1A 1ODTC 2WPNA 2GPSA 2Q41A 4PZ9A 4JJAA 4QC2A 3W5SA 1RPJA 3KXIA 3S5JA 4IW3B 4P83A 2A35A 3UMYA 1NW9B 4FGZA 4QHYA 5K3AA 4EHDA 2QGGA 1JLHA 1X6VA 2DMRA 3UGJA 3O3OB 4JAVC 3RBXA 3L92A 4XYEA 2CJWA 2QL9A 3MG9A 5DHSA 2HPHA 1GNQA 4XWAA 1ZN7A 2AN5A 2XUHA 1CWUA 2FW1A 4L4XA 4ZQGA 3I37X 4H1TA 2NYUA 4RVDA 1UZAA 3R6DA 5CB4A 2A92A 2NO7A 3JSAA 1EIWA 4KMSA 4D9GA 2FJ0A 3VYUB 1MTOA 5I5GA 5HKKD 2XE8A 1C5KA 4LTMA 4Q37A 2R4TA 5A05A 1U3VA 4WZZA 3TLMA 2VLBA 4RVGA 1FP4A 2FOXA 2IDJA 4GI1A 4HNQA 4YFYA 1TW3A 1JG4A 2FLVA 4P34A 3K0SA 1XQBA 1FYEA 3ZWNA 1Z38A 3DDUA 5EYPA 5B1DA 4AVZA 1CEXA 4MR7A 2BHLA 2FW8A 3MJVA 3OT4A 3PNLA 4R7TA 1OXSC 1F48A 1SUDA 3AEYA 3PYLA 4HX5A 5JQGA 1E1MA 1Q77A 2ODNA 4GP7A 2W6OA 1C9NA 2VT2A 3I9JA 2R87A 3FWNA 3JQAD 4HXYA 3L4JA 4DNRB 1KH1A 1NC1A 1P5FA 1RKBA 2YVUA 3ZJ5A 5KTYA 2YZKA 3MT9A 4D7AA 4DK0A 4Q1CA 4OXYA 1KI9A 3DOJA 4MDFA 5LLDA 5DNVA 4PHGA 1UMBB 3SDSA 3QU2A 4E0BA 2VWQA 3ZYZA 2OBMA 4PPQA 4FE3A 4OCZA 1JQLB 2XUKA 3A9RA 3P2EA 2C9DA 3NVAA 4GBJA 4X1IB 3KU1A 3JQFA 1YK1A 3KM0A 4TT8A 4C1NA 5CCXA 3GVJA 1E4EA 4JYZA 4GDFA 1Z12A 1YBVA 4WFJA 4A6EA 5CW1A 1AV7A 2OBXA 1IXYA 3MF4A 4IKPA 3CEMA 1ULUA 4BE7B 5KUTA 2AV6A 3ZHOA 1I3MA 3ITDA 2X53S 1C4WA 5BO5A 2GH1A 4NCAA 4W9RA 3GA7A 4EKNB 2QJRA 3ZIAA 2YQ4A 3G71B 1V35A 5DCLA 3TZLA 2ZYWX 3HACA 1VSUA 5ALDA 4EHIA 2WJ6A 3NTUA 4EW3A 4FS3A 1CY2A 4ZC8A 1XU4A 4HAUA 3Q3HA 5TLSA 4LJAA 2IHUA 3UBMA 2QLJA 2JPDA 1GDDA 4BHTA 2B8NA 4DDMA 4FS8A 2C5AA 2IUYA 3L4EA 5SY6A 1AUPA 3RKUA 1UF9A 3UV3A 3IHWA 2N9UA 1MQSA 2H52A 3BC1A 4WSOA 3BFPA 4C88A 4WVFA 1GZVA 2VDOB 3GCZA 3VRHA 4C6SA 4CDGA 2YJ6A 3I5YA 3LCMA 1N4AA 1ETUA 5J1TB 3W3ZB 4S1TA 4PG7A 4QJ3A 1JR4A 1BWPA 1MVLA 2ECOA 2O8NA 2WZDA 4CF7A 4I4TF 3X1JA 4M8SA 2R8YA 1PGQA 4UBIA 4AWBA 3EZNA 1IN8A 3PGKA 2WOJA 4N5HX 4OHRA 3SCZA 3N75A 3TX2A 1EK6A 1N36B 4KVZA 2FFBA 4M9RA 4O2AA 1R0WA 4E51A 2OQRA 4OQFA 4RFS