4Z4TA

Crystal structure of gii.10 p domain in complex with 75mm fucose
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
314
structure length
311
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTVGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 71
structure length 311
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4tA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4tA01
4Z4UA 3Q6QA 3BY2A 3PUMA 3BQJA 5F4OA 4QVAA 4WZLA 2ZL6A 4P1VA 3SLDA 4ROXA 3ASRA 3PA1A 5IYNA 4X05A 4WZEA 4Z4VA 4P3IA 3SJPA 5IYQA 4RDJA 3R6KA 5F4MA 5HZBA 5J3OA 4RDLA 2OBTA 4QV2A 4RPBA 3SLNA 5F4JA 4OOSA 3Q38A 3ASTA 3LQEA 4X06A 3Q6RA 5J35A 4Z4TA 3BY1A 4Z4YA 5E6TA 4OPVA 2OBRA 3Q39A 4QUZA 4P12A 4OOXA 4RLZA 4OP7A 3ONUA 4QVJA 3LQ6A 3R6JA 4X7EA 4RPDA 3SKBA 5BSXA 4X07A 3PVDA 1IHMA 3RY8A 3ASPA 3PUNA 5IYWA 4OPSA 4X7DA 3ASQA 3PA2A 4Z4WA 5IYPA 4P2NA 4X0CA 3D26A 4RDKA 3ONYA 5IYRA 4P25A 5HZAA 2ZL5A 4RM0A 2ZL7A 3SEJA 4X7CA 4P26A 4WZKA 4OPOA 4Z4SA 4X7FA 4Z4ZA 5KW9A 2OBSA 3V7AA 4WZTA 4Z4RA 3Q3AA 4OOVA 5BSYA 3ASSA
chains in the Genus database with same CATH superfamily
3B82A 1XB2A 2ZTNA 4UZFA 3Q6QA 2ZITA 3BQJA 4XM3A 3H9NA 5F4OA 4QVAA 1ZUNB 4WZLA 1YIJB 1WU8A 4XL9A 1E79A 3LO8A 1EP2B 2JJ2A 1QGAA 1WSRA 1VQ6B 1NB9A 1A8PA 2BF4A 5H59A 3W2IA 5HZBA 1BPLA 1H42A 1VQ4B 1VQOB 3QFCA 2OTJB 3QFRA 4B4DA 1I8DA 1QFZA 1CNFA 2VNKA 3VNUA 4RPBA 4AC9A 3OPOA 2BVNA 4EH1A 4N3GA 1VF7A 4B3GA 1FRQA 2VZLA 3CCRB 4XLCA 2RC6A 1W35A 2CK3A 1BQEA 1GO2A 1KK0A 1N07A 4TMWA 2C78A 1VQKB 2CRVA 3CD6B 2OYNA 3GQBA 3ZZUA 4G7XA 4ACAA 2C77A 3WBKA 2QEXB 2C5BA 2X0KA 3G05A 5FL7A 3BY1A 1R5NA 3GSIA 1XFOA 4FK8A 4KKTA 4XLHA 4DQKA 4QUZA 4P12A 4RCZA 3BNWA 1BLIA 3KEWA 3PENA 4OOXA 1H8EA 4PC3A 4TMZA 4UZUA 3FJOA 1UMKA 3V76A 2VBTA 2BPOA 1T5EA 4XOPA 3CCJB 2Q6LA 4NBSA 2GK6A 3I1FA 5DN6A 2V7UA 1KJZA 4XKVA 1RQPA 1G7RA 4TMVA 1YX2A 2QN6A 3W2HA 2WSSA 1I7PA 1PJ5A 1V0EA 4RD4A 1JNYA 2OTLB 2RC5A 2E1BA 1FRNA 2BGIA 1XQBA 3WY9A 4GQNA 3GVLA 2ZZFA 4P6VF 3A3BA 4OPSA 3JQQA 3QFTA 4XLFA 1EWYA 4Z4WA 5DSZA 2PIAA 1EFRA 4P2NA 3G6EB 2ZXHA 2EFGA 4II3A 2QTZA 4RD6A 4X0CA 4YAOA 4NCNA 3D26A 5FO0A 2ZZEA 1JJ2B 3WQZA 4B44A 1QX4A 4RDKA 3ONYA 2DOGA 4LBVA 4XR6A 4F7DA 3J81k 5CDFA 3ZBTA 3CCEB 3OE7A 2JIZA 3W2GA 2GPJA 2ZTGA 3A8IA 5FNZA 2YWHA 3VO1A 4YAUA 5TV2A 1OGJA 2EIXA 4MYUA 2BM0A 2BSAA 1GJRA 3CTAA 1YLOA 2FVGA 5THXA 3WNDA 3A35A 1WTHD 4X7CA 2P3MA 1ZM3A 4OPOA 4UAJA 4ZCIA 4B43A 2HLDA 4OOVA 1VQNB 2X85A 3CW2A 1FX0A 2WYRA 5H5JA 4Z4UA 3CC7B 2QE7A 3BY2A 3OKXA 1K9MD 4YALA 3CCSB 1W34A 3U6BA 2V7QA 4K1XA 2JN9A 2X6WA 1KC8D 2M5SA 2YWGA 2ZL6A 1Q7YD 2D74A 4P1VA 1D1NA 2C2WA 2F43A 4WZEA 3CXCB 2W6JA 1VQLB 4Z4VA 1IJFA 4P3IA 1VQ5B 1OHHA 5F4MA 3VNVA 5EMNA 3QE2A 1SKYB 4NNJA 4II2A 4RDLA 1UD8A 3BCDA 2VYQA 2V31A 2HDNB 2VBVA 3CESA 3CMEB 2X3UA 1V5VA 4G5GA 4HIZA 4RD3A 4G1VA 3MMPA 4U9UA 2VJJA 3ISXA 3CRZA 3WYAA 4P6YA 2XZPA 3OZWA 1WDTA 4PC6A 2J7KA 1CQXA 3FKSA 3OEHA 1VQPB 3QSYA 5AN9A 4TMTA 4OOSA 2CBXA 4X06A 3T56B 3CC4B 1I18A 4FWTA 1KZLA 4Z4TA 5KNLA 3AVTA 2XZLA 1DDIA 3OZVA 4LBYA 4PGOA 1WP6A 3A8KA 1R5OA 1S72B 1TUIA 2BV3A 4OP7A 4RLZA 3ZUGA 2DYIA 2QA4B 3AVWA 1JA0A 1Y0YA 2V7VA 2F4NA 4TN1A 4QVJA 3LQ6A 1F60A 1QFYA 2VNIA 1QH0A 2W6IA 2CNDA 2VBSA 3A3GA 3B8HA 3LNNA 2WZPP 3LVBA 3JQRA 4ZCLA 3OW2B 4X7EA 1U2RA 2XNCA 4RPDA 1W0KA 4TKOB 3SKBA 3I56B 4X07A 4B3FX 3U6KA 3OW7A 1B23P 2V7TA 2Z6BD 1M90D 1E63A 1IHMA 3RY8A 3I55B 3ASPA 2WJVA 3H94A 4TMXA 1WOPA 1HA3A 4G7WA 1E3ZA 1TVCA 5GV8A 3CP2A 1VQ8B 1W9XA 3ASQA 3PA2A 1NDHA 4DQLA 1VLOA 1EP3B 4XD7A 2YWEA 1AIPA 1F20A 3E1YE 1SM4A 2GJPA 2D9RA 1N06A 3A8JA 1WORA 5IYRA 4P25A 1EXMA 2VBUA 1GAWA 2JJ1A 1K73D 2ZL5A 1J9ZA 1VLYA 4L8JA 4RM0A 4JMQA 2R9VA 2ZBVA 4LBZA 4XQFA 5GV7A 4QFMA 4WZKA 4RCYA 5LMZA 3ES9A 1CNEA 3P26A 1JA1A 4X7FA 1D2EA 4Z4ZA 4ZGQB 1RQRA 4N3NA 5KW9A 2CW5A 5HXBA 1Q86D 2BN4A 4M1KA 3Q3AA 4XKWA 4M4SA 4XN0A 3WXMA 3ASSA 1W0JA 2KVOA 4WWVA 1KK1A 1QGZA 2Q6OA 1T6ZA 3PUMA 4XMYA 4ZV4A 2BM1A 1E1QA 3BH4A 2V4DA 4TT3A 3CCVB 5FA6A 1YJ9B 1VHEA 2GK7A 2Q6IA 4AF6A 2VNJA 3DDYA 3CC2B 4DK1A 3SJZA 4ROXA 2X6YA 5IYNA 4IW3B 2GQFA 4DK0A 1IJEA 3CPXA 3R6KA 2YWFA 2JDIA 4RDJA 4WQMA 5J3OA 1KTVA 1B2RA 4AF7A 2OBTA 1XE1A 4P22A 3AGQA 3ZZTA 3CMAB 2NPFA 1UD2A 1OB0A 2R6HA 5F4JA 2BGJA 2PLFA 2CF4A 3GVKA 1N08A 4E0FA 5KSWB 1W2BB 1TLLA 4XLEA 2ZXIA 2DY1A 4M2LA 2X8KA 1E62A 1T6YA 2D3LA 1MRZA 2OK8A 3CPWB 3W5HA 3CCLB 2GJRA 4YXWA 4ZCMA 4H9GA 3Q38A 1ZM9A 2XEXA 1WOSA 1G7SA 1W87A 2XOKA 3OJXA 2GREA 4Z4YA 1G7CA 3W5UA 2F1MA 4TSFA 3AVVA 2OBRA 4P9SA 2B7CA 1WOOA 1KQSB 1DARA 4LC0A 1VJSA 1UD4A 1VQMB 3OFNA 2V7XA 2X53S 2HMAA 4Y9UA 2PE3A 1COWA 3R6JA 4PC7A 4RJLA 4MYTA 1VQ9B 5HKKA 3MHPA 5A8AA 4AVZA 4KKUA 3W5VA 1BJKA 3ZPNA 5B6IA 1H8HA 1FNMA 2DETA 3JU4A 2XNJA 1UD6A 3W2EA 2HCJB 3B78A 4B48A 3PUNA 5IYWA 1E64A 3OZUA 1BX1A 3BCFA 4QHYA 3W2FA 1YHQB 2DEUA 4C43A 4X7DA 3MCAA 1FNBA 5IYPA 1AMOA 2LZJA 1S0UA 3A1PA 2QMUA 3NE5B 3WBJA 1KRHA 3E20A 2CC2A 1N0UA 1VQ7B 1G7TA 1E3XA 4UZEA 1TTTA 4YAWA 1KK2A 3AVXA 1KD1D 5HZAA 3HAGA 1QG0A 3KL9A 1BMFA 4PC1A 2PMDA 1K8AD 2ZZGA 1SKQA 4B47A 1N8RD 1VHOA 2ZL7A 3P27A 3SEJA 4BPRA 1Q9SA 5TRDA 4Z4SA 2DERA 3CB4A 2OBSA 4Z4RA 1ZM4A 1E1RA 1D8TA 3CP8A 3BC9A 1NB0A 1KK3A 1FNCA 2XGJA 2BMWA 3WNCA 3FPKA 4M0LA 5DS0A 2AHOA 1N05A 1GAQA 4ACBA 4C0SA 4Y9RA 3SLDA 4DNRB 3ASRA 1QUFA 2ZBUA 3PA1A 4X05A 5FO1A 3CMMA 3SJPA 3FPPA 5IYQA 1T6XA 5A89A 1PJ6A 1QUEA 3VMFA 4ZGNB 1ZM2A 3OP1A 2C5HA 4Z1MA 1UD3A 4FN5A 4QV2A 4RD1A 4XN3A 1QVGB 4HE5A 4RD0A 3SLNA 4P3YA 1UD5A 2DCUA 1NJID 2C4TA 1DG1G 2VJIA 1DDGA 2FX3A 1Q81D 3T51B 1JB9A 1GR1A 3ASTA 3LQEA 5J35A 3Q6RA 3AVYA 1PKVA 3GIRA 2VNHA 1YITB 5E6TA 4OPVA 2QDXA 3Q39A 2ZZQA 1KMHA 2I1LA 1P4MA 4XORA 4LBWA 3ZBUA 1FDRA 4PAAA 4XOTA 3JQPA 3G4SB 3ONUA 3CCQB 5L46A 1IB0A 4G6IA 1OB5A 2E1RA 2WZNA 2XZOA 1M1KD 1K28D 1OB2A 4DNTB 1WSVA 3G71B 1EFCA 4Y7CA 1E43A 5BSXA 2V7WA 4R71A 1YJNB 1HVXA 3PVDA 4Q7JB 1EP1B 2QGGA 3OJWA 3GVJA 1V0FA 1ELOA 1Q82D 1QFJA 4YEJA 4M53A 1S4MA 5FIUA 1Y0RA 4ASUA 4CQJA 2C4UA 2GJKA 5IK2A 1YJWB 4B3XA 3VO2A 3T53B 1EFTA 2F1LA 1QVFB 3OEEA 1EFUA 5JBQA 1H85A 2NV4A 2D3NA 3QFSA 4RD2A 5TR9A 1PJ7A 2B7BA 2DIEA 2Q6KA 2OK7A 4YHBA 1NBMA 2QTLA 5A88A 4PC2A 1MABA 3CCMB 4HE6A 3CCUB 3ZZ0A 4YELA 4XLAA 1BX0A 4PABA 1OGIA 2WPDA 3OAAA 1HZEA 3WNBA 3AVUA 3VR6A 4X8IA 4XONA 4P26A 3ZIAA 4KKSA 1N0VC 4FXUA 4G1BA 3OOCA 2B5OA 3U2QA 4XNFA 5TY0A 1NRKA 3V7AA 1FNDA 4J0QA 2X6XA 4WZTA 1QGYA 2WJYA 3ZC3A 1YI2B 2XNDA 5BSYA 4YAFA 2WR8A 3AGPA 1WPCA 1GVHA 1R5BA
chains in the Genus database with same CATH topology
4Z4UA 3Q6QA 3BY2A 3PUMA 3BQJA 5F4OA 4QVAA 4WZLA 2ZL6A 4P1VA 3SLDA 4ROXA 3ASRA 3PA1A 5IYNA 4X05A 4WZEA 4Z4VA 4P3IA 3SJPA 5IYQA 4RDJA 3R6KA 5F4MA 5HZBA 5J3OA 4RDLA 2OBTA 4QV2A 4RPBA 3SLNA 5F4JA 4OOSA 3Q38A 3ASTA 3LQEA 4X06A 3Q6RA 5J35A 4Z4TA 3BY1A 4Z4YA 5E6TA 4OPVA 2OBRA 3Q39A 4QUZA 4P12A 4OOXA 4RLZA 4OP7A 3ONUA 4QVJA 3LQ6A 3R6JA 4X7EA 4RPDA 3SKBA 5BSXA 4X07A 3PVDA 1IHMA 3RY8A 3ASPA 3PUNA 5IYWA 4OPSA 4X7DA 3ASQA 3PA2A 4Z4WA 5IYPA 4P2NA 4X0CA 3D26A 4RDKA 3ONYA 5IYRA 4P25A 5HZAA 2ZL5A 4RM0A 2ZL7A 3SEJA 4X7CA 4P26A 4WZKA 4OPOA 4Z4SA 4X7FA 4Z4ZA 5KW9A 2OBSA 3V7AA 4WZTA 4Z4RA 3Q3AA 4OOVA 5BSYA 3ASSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4U A;  3Q6Q A;  3BY2 A;  3PUM A;  3BQJ A;  5F4O A;  4QVA A;  4WZL A;  2ZL6 A;  4P1V A;  3SLD A;  4ROX A;  3ASR A;  3PA1 A;  5IYN A;  4X05 A;  4WZE A;  4Z4V A;  4P3I A;  3SJP A;  5IYQ A;  4RDJ A;  3R6K A;  5F4M A;  5HZB A;  5J3O A;  4RDL A;  2OBT A;  4QV2 A;  4RPB A;  3SLN A;  5F4J A;  4OOS A;  3Q38 A;  3AST A;  3LQE A;  4X06 A;  3Q6R A;  5J35 A;  4Z4T A;  3BY1 A;  4Z4Y A;  5E6T A;  4OPV A;  2OBR A;  3Q39 A;  4QUZ A;  4P12 A;  4OOX A;  4RLZ A;  4OP7 A;  3ONU A;  4QVJ A;  3LQ6 A;  3R6J A;  4X7E A;  4RPD A;  3SKB A;  5BSX A;  4X07 A;  3PVD A;  1IHM A;  3RY8 A;  3ASP A;  3PUN A;  5IYW A;  4OPS A;  4X7D A;  3ASQ A;  3PA2 A;  4Z4W A;  5IYP A;  4P2N A;  4X0C A;  3D26 A;  4RDK A;  3ONY A;  5IYR A;  4P25 A;  5HZA A;  2ZL5 A;  4RM0 A;  2ZL7 A;  3SEJ A;  4X7C A;  4P26 A;  4WZK A;  4OPO A;  4Z4S A;  4X7F A;  4Z4Z A;  5KW9 A;  2OBS A;  3V7A A;  4WZT A;  4Z4R A;  3Q3A A;  4OOV A;  5BSY A;  3ASS A; 
#chains in the Genus database with same CATH topology
 3B82 A;  1XB2 A;  2ZTN A;  4UZF A;  3Q6Q A;  2ZIT A;  3BQJ A;  4XM3 A;  3H9N A;  5F4O A;  4QVA A;  1ZUN B;  4WZL A;  1YIJ B;  1WU8 A;  4XL9 A;  1E79 A;  3LO8 A;  1EP2 B;  2JJ2 A;  1QGA A;  1WSR A;  1VQ6 B;  1NB9 A;  1A8P A;  2BF4 A;  5H59 A;  3W2I A;  5HZB A;  1BPL A;  1H42 A;  1VQ4 B;  1VQO B;  3QFC A;  2OTJ B;  3QFR A;  4B4D A;  1I8D A;  1QFZ A;  1CNF A;  2VNK A;  3VNU A;  4RPB A;  4AC9 A;  3OPO A;  2BVN A;  4EH1 A;  4N3G A;  1VF7 A;  4B3G A;  1FRQ A;  2VZL A;  3CCR B;  4XLC A;  2RC6 A;  1W35 A;  2CK3 A;  1BQE A;  1GO2 A;  1KK0 A;  1N07 A;  4TMW A;  2C78 A;  1VQK B;  2CRV A;  3CD6 B;  2OYN A;  3GQB A;  3ZZU A;  4G7X A;  4ACA A;  2C77 A;  3WBK A;  2QEX B;  2C5B A;  2X0K A;  3G05 A;  5FL7 A;  3BY1 A;  1R5N A;  3GSI A;  1XFO A;  4FK8 A;  4KKT A;  4XLH A;  4DQK A;  4QUZ A;  4P12 A;  4RCZ A;  3BNW A;  1BLI A;  3KEW A;  3PEN A;  4OOX A;  1H8E A;  4PC3 A;  4TMZ A;  4UZU A;  3FJO A;  1UMK A;  3V76 A;  2VBT A;  2BPO A;  1T5E A;  4XOP A;  3CCJ B;  2Q6L A;  4NBS A;  2GK6 A;  3I1F A;  5DN6 A;  2V7U A;  1KJZ A;  4XKV A;  1RQP A;  1G7R A;  4TMV A;  1YX2 A;  2QN6 A;  3W2H A;  2WSS A;  1I7P A;  1PJ5 A;  1V0E A;  4RD4 A;  1JNY A;  2OTL B;  2RC5 A;  2E1B A;  1FRN A;  2BGI A;  1XQB A;  3WY9 A;  4GQN A;  3GVL A;  2ZZF A;  4P6V F;  3A3B A;  4OPS A;  3JQQ A;  3QFT A;  4XLF A;  1EWY A;  4Z4W A;  5DSZ A;  2PIA A;  1EFR A;  4P2N A;  3G6E B;  2ZXH A;  2EFG A;  4II3 A;  2QTZ A;  4RD6 A;  4X0C A;  4YAO A;  4NCN A;  3D26 A;  5FO0 A;  2ZZE A;  1JJ2 B;  3WQZ A;  4B44 A;  1QX4 A;  4RDK A;  3ONY A;  2DOG A;  4LBV A;  4XR6 A;  4F7D A;  3J81 k;  5CDF A;  3ZBT A;  3CCE B;  3OE7 A;  2JIZ A;  3W2G A;  2GPJ A;  2ZTG A;  3A8I A;  5FNZ A;  2YWH A;  3VO1 A;  4YAU A;  5TV2 A;  1OGJ A;  2EIX A;  4MYU A;  2BM0 A;  2BSA A;  1GJR A;  3CTA A;  1YLO A;  2FVG A;  5THX A;  3WND A;  3A35 A;  1WTH D;  4X7C A;  2P3M A;  1ZM3 A;  4OPO A;  4UAJ A;  4ZCI A;  4B43 A;  2HLD A;  4OOV A;  1VQN B;  2X85 A;  3CW2 A;  1FX0 A;  2WYR A;  5H5J A;  4Z4U A;  3CC7 B;  2QE7 A;  3BY2 A;  3OKX A;  1K9M D;  4YAL A;  3CCS B;  1W34 A;  3U6B A;  2V7Q A;  4K1X A;  2JN9 A;  2X6W A;  1KC8 D;  2M5S A;  2YWG A;  2ZL6 A;  1Q7Y D;  2D74 A;  4P1V A;  1D1N A;  2C2W A;  2F43 A;  4WZE A;  3CXC B;  2W6J A;  1VQL B;  4Z4V A;  1IJF A;  4P3I A;  1VQ5 B;  1OHH A;  5F4M A;  3VNV A;  5EMN A;  3QE2 A;  1SKY B;  4NNJ A;  4II2 A;  4RDL A;  1UD8 A;  3BCD A;  2VYQ A;  2V31 A;  2HDN B;  2VBV A;  3CES A;  3CME B;  2X3U A;  1V5V A;  4G5G A;  4HIZ A;  4RD3 A;  4G1V A;  3MMP A;  4U9U A;  2VJJ A;  3ISX A;  3CRZ A;  3WYA A;  4P6Y A;  2XZP A;  3OZW A;  1WDT A;  4PC6 A;  2J7K A;  1CQX A;  3FKS A;  3OEH A;  1VQP B;  3QSY A;  5AN9 A;  4TMT A;  4OOS A;  2CBX A;  4X06 A;  3T56 B;  3CC4 B;  1I18 A;  4FWT A;  1KZL A;  4Z4T A;  5KNL A;  3AVT A;  2XZL A;  1DDI A;  3OZV A;  4LBY A;  4PGO A;  1WP6 A;  3A8K A;  1R5O A;  1S72 B;  1TUI A;  2BV3 A;  4OP7 A;  4RLZ A;  3ZUG A;  2DYI A;  2QA4 B;  3AVW A;  1JA0 A;  1Y0Y A;  2V7V A;  2F4N A;  4TN1 A;  4QVJ A;  3LQ6 A;  1F60 A;  1QFY A;  2VNI A;  1QH0 A;  2W6I A;  2CND A;  2VBS A;  3A3G A;  3B8H A;  3LNN A;  2WZP P;  3LVB A;  3JQR A;  4ZCL A;  3OW2 B;  4X7E A;  1U2R A;  2XNC A;  4RPD A;  1W0K A;  4TKO B;  3SKB A;  3I56 B;  4X07 A;  4B3F X;  3U6K A;  3OW7 A;  1B23 P;  2V7T A;  2Z6B D;  1M90 D;  1E63 A;  1IHM A;  3RY8 A;  3I55 B;  3ASP A;  2WJV A;  3H94 A;  4TMX A;  1WOP A;  1HA3 A;  4G7W A;  1E3Z A;  1TVC A;  5GV8 A;  3CP2 A;  1VQ8 B;  1W9X A;  3ASQ A;  3PA2 A;  1NDH A;  4DQL A;  1VLO A;  1EP3 B;  4XD7 A;  2YWE A;  1AIP A;  1F20 A;  3E1Y E;  1SM4 A;  2GJP A;  2D9R A;  1N06 A;  3A8J A;  1WOR A;  5IYR A;  4P25 A;  1EXM A;  2VBU A;  1GAW A;  2JJ1 A;  1K73 D;  2ZL5 A;  1J9Z A;  1VLY A;  4L8J A;  4RM0 A;  4JMQ A;  2R9V A;  2ZBV A;  4LBZ A;  4XQF A;  5GV7 A;  4QFM A;  4WZK A;  4RCY A;  5LMZ A;  3ES9 A;  1CNE A;  3P26 A;  1JA1 A;  4X7F A;  1D2E A;  4Z4Z A;  4ZGQ B;  1RQR A;  4N3N A;  5KW9 A;  2CW5 A;  5HXB A;  1Q86 D;  2BN4 A;  4M1K A;  3Q3A A;  4XKW A;  4M4S A;  4XN0 A;  3WXM A;  3ASS A;  1W0J A;  2KVO A;  4WWV A;  1KK1 A;  1QGZ A;  2Q6O A;  1T6Z A;  3PUM A;  4XMY A;  4ZV4 A;  2BM1 A;  1E1Q A;  3BH4 A;  2V4D A;  4TT3 A;  3CCV B;  5FA6 A;  1YJ9 B;  1VHE A;  2GK7 A;  2Q6I A;  4AF6 A;  2VNJ A;  3DDY A;  3CC2 B;  4DK1 A;  3SJZ A;  4ROX A;  2X6Y A;  5IYN A;  4IW3 B;  2GQF A;  4DK0 A;  1IJE A;  3CPX A;  3R6K A;  2YWF A;  2JDI A;  4RDJ A;  4WQM A;  5J3O A;  1KTV A;  1B2R A;  4AF7 A;  2OBT A;  1XE1 A;  4P22 A;  3AGQ A;  3ZZT A;  3CMA B;  2NPF A;  1UD2 A;  1OB0 A;  2R6H A;  5F4J A;  2BGJ A;  2PLF A;  2CF4 A;  3GVK A;  1N08 A;  4E0F A;  5KSW B;  1W2B B;  1TLL A;  4XLE A;  2ZXI A;  2DY1 A;  4M2L A;  2X8K A;  1E62 A;  1T6Y A;  2D3L A;  1MRZ A;  2OK8 A;  3CPW B;  3W5H A;  3CCL B;  2GJR A;  4YXW A;  4ZCM A;  4H9G A;  3Q38 A;  1ZM9 A;  2XEX A;  1WOS A;  1G7S A;  1W87 A;  2XOK A;  3OJX A;  2GRE A;  4Z4Y A;  1G7C A;  3W5U A;  2F1M A;  4TSF A;  3AVV A;  2OBR A;  4P9S A;  2B7C A;  1WOO A;  1KQS B;  1DAR A;  4LC0 A;  1VJS A;  1UD4 A;  1VQM B;  3OFN A;  2V7X A;  2X53 S;  2HMA A;  4Y9U A;  2PE3 A;  1COW A;  3R6J A;  4PC7 A;  4RJL A;  4MYT A;  1VQ9 B;  5HKK A;  3MHP A;  5A8A A;  4AVZ A;  4KKU A;  3W5V A;  1BJK A;  3ZPN A;  5B6I A;  1H8H A;  1FNM A;  2DET A;  3JU4 A;  2XNJ A;  1UD6 A;  3W2E A;  2HCJ B;  3B78 A;  4B48 A;  3PUN A;  5IYW A;  1E64 A;  3OZU A;  1BX1 A;  3BCF A;  4QHY A;  3W2F A;  1YHQ B;  2DEU A;  4C43 A;  4X7D A;  3MCA A;  1FNB A;  5IYP A;  1AMO A;  2LZJ A;  1S0U A;  3A1P A;  2QMU A;  3NE5 B;  3WBJ A;  1KRH A;  3E20 A;  2CC2 A;  1N0U A;  1VQ7 B;  1G7T A;  1E3X A;  4UZE A;  1TTT A;  4YAW A;  1KK2 A;  3AVX A;  1KD1 D;  5HZA A;  3HAG A;  1QG0 A;  3KL9 A;  1BMF A;  4PC1 A;  2PMD A;  1K8A D;  2ZZG A;  1SKQ A;  4B47 A;  1N8R D;  1VHO A;  2ZL7 A;  3P27 A;  3SEJ A;  4BPR A;  1Q9S A;  5TRD A;  4Z4S A;  2DER A;  3CB4 A;  2OBS A;  4Z4R A;  1ZM4 A;  1E1R A;  1D8T A;  3CP8 A;  3BC9 A;  1NB0 A;  1KK3 A;  1FNC A;  2XGJ A;  2BMW A;  3WNC A;  3FPK A;  4M0L A;  5DS0 A;  2AHO A;  1N05 A;  1GAQ A;  4ACB A;  4C0S A;  4Y9R A;  3SLD A;  4DNR B;  3ASR A;  1QUF A;  2ZBU A;  3PA1 A;  4X05 A;  5FO1 A;  3CMM A;  3SJP A;  3FPP A;  5IYQ A;  1T6X A;  5A89 A;  1PJ6 A;  1QUE A;  3VMF A;  4ZGN B;  1ZM2 A;  3OP1 A;  2C5H A;  4Z1M A;  1UD3 A;  4FN5 A;  4QV2 A;  4RD1 A;  4XN3 A;  1QVG B;  4HE5 A;  4RD0 A;  3SLN A;  4P3Y A;  1UD5 A;  2DCU A;  1NJI D;  2C4T A;  1DG1 G;  2VJI A;  1DDG A;  2FX3 A;  1Q81 D;  3T51 B;  1JB9 A;  1GR1 A;  3AST A;  3LQE A;  5J35 A;  3Q6R A;  3AVY A;  1PKV A;  3GIR A;  2VNH A;  1YIT B;  5E6T A;  4OPV A;  2QDX A;  3Q39 A;  2ZZQ A;  1KMH A;  2I1L A;  1P4M A;  4XOR A;  4LBW A;  3ZBU A;  1FDR A;  4PAA A;  4XOT A;  3JQP A;  3G4S B;  3ONU A;  3CCQ B;  5L46 A;  1IB0 A;  4G6I A;  1OB5 A;  2E1R A;  2WZN A;  2XZO A;  1M1K D;  1K28 D;  1OB2 A;  4DNT B;  1WSV A;  3G71 B;  1EFC A;  4Y7C A;  1E43 A;  5BSX A;  2V7W A;  4R71 A;  1YJN B;  1HVX A;  3PVD A;  4Q7J B;  1EP1 B;  2QGG A;  3OJW A;  3GVJ A;  1V0F A;  1ELO A;  1Q82 D;  1QFJ A;  4YEJ A;  4M53 A;  1S4M A;  5FIU A;  1Y0R A;  4ASU A;  4CQJ A;  2C4U A;  2GJK A;  5IK2 A;  1YJW B;  4B3X A;  3VO2 A;  3T53 B;  1EFT A;  2F1L A;  1QVF B;  3OEE A;  1EFU A;  5JBQ A;  1H85 A;  2NV4 A;  2D3N A;  3QFS A;  4RD2 A;  5TR9 A;  1PJ7 A;  2B7B A;  2DIE A;  2Q6K A;  2OK7 A;  4YHB A;  1NBM A;  2QTL A;  5A88 A;  4PC2 A;  1MAB A;  3CCM B;  4HE6 A;  3CCU B;  3ZZ0 A;  4YEL A;  4XLA A;  1BX0 A;  4PAB A;  1OGI A;  2WPD A;  3OAA A;  1HZE A;  3WNB A;  3AVU A;  3VR6 A;  4X8I A;  4XON A;  4P26 A;  3ZIA A;  4KKS A;  1N0V C;  4FXU A;  4G1B A;  3OOC A;  2B5O A;  3U2Q A;  4XNF A;  5TY0 A;  1NRK A;  3V7A A;  1FND A;  4J0Q A;  2X6X A;  4WZT A;  1QGY A;  2WJY A;  3ZC3 A;  1YI2 B;  2XND A;  5BSY A;  4YAF A;  2WR8 A;  3AGP A;  1WPC A;  1GVH A;  1R5B A; 
#chains in the Genus database with same CATH homology
 4Z4U A;  3Q6Q A;  3BY2 A;  3PUM A;  3BQJ A;  5F4O A;  4QVA A;  4WZL A;  2ZL6 A;  4P1V A;  3SLD A;  4ROX A;  3ASR A;  3PA1 A;  5IYN A;  4X05 A;  4WZE A;  4Z4V A;  4P3I A;  3SJP A;  5IYQ A;  4RDJ A;  3R6K A;  5F4M A;  5HZB A;  5J3O A;  4RDL A;  2OBT A;  4QV2 A;  4RPB A;  3SLN A;  5F4J A;  4OOS A;  3Q38 A;  3AST A;  3LQE A;  4X06 A;  3Q6R A;  5J35 A;  4Z4T A;  3BY1 A;  4Z4Y A;  5E6T A;  4OPV A;  2OBR A;  3Q39 A;  4QUZ A;  4P12 A;  4OOX A;  4RLZ A;  4OP7 A;  3ONU A;  4QVJ A;  3LQ6 A;  3R6J A;  4X7E A;  4RPD A;  3SKB A;  5BSX A;  4X07 A;  3PVD A;  1IHM A;  3RY8 A;  3ASP A;  3PUN A;  5IYW A;  4OPS A;  4X7D A;  3ASQ A;  3PA2 A;  4Z4W A;  5IYP A;  4P2N A;  4X0C A;  3D26 A;  4RDK A;  3ONY A;  5IYR A;  4P25 A;  5HZA A;  2ZL5 A;  4RM0 A;  2ZL7 A;  3SEJ A;  4X7C A;  4P26 A;  4WZK A;  4OPO A;  4Z4S A;  4X7F A;  4Z4Z A;  5KW9 A;  2OBS A;  3V7A A;  4WZT A;  4Z4R A;  3Q3A A;  4OOV A;  5BSY A;  3ASS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...