4Z4TA

Crystal structure of gii.10 p domain in complex with 75mm fucose
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
314
structure length
311
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTVGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norwalk virus
total genus 71
structure length 311
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4tA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4tA01
2ZL7A 5KW9A 4Z4YA 4QV2A 4X0CA 5E6TA 4P2NA 5F4JA 4QVAA 4WZTA 4P3IA 4X7DA 3V7AA 5IYWA 2OBTA 4ROXA 5IYPA 3D26A 4WZKA 3Q3AA 3PUMA 2OBRA 5J3OA 5F4MA 4P26A 4OOVA 3SLDA 4Z4VA 5J35A 2ZL5A 4X07A 4RM0A 4X7FA 3SLNA 3BQJA 4X7EA 4P25A 4Z4WA 3ASTA 3PA1A 3R6JA 5F4OA 4OP7A 4OPOA 3SEJA 4WZEA 2OBSA 3RY8A 3SJPA 3ASRA 4OOXA 3LQEA 5HZAA 4Z4UA 5BSYA 4WZLA 3R6KA 3Q39A 3BY1A 3LQ6A 3PA2A 3Q38A 4X05A 4RPBA 4P12A 3ONUA 4RDJA 4OPSA 3PUNA 3ASQA 4P1VA 4RLZA 4OOSA 4Z4SA 3BY2A 1IHMA 4Z4ZA 3SKBA 4Z4TA 3PVDA 4X06A 5BSXA 5HZBA 5IYRA 3ASPA 4RDLA 5IYQA 4X7CA 3Q6RA 4QVJA 2ZL6A 4RPDA 4RDKA 3ONYA 3Q6QA 5IYNA 4QUZA 3ASSA 4OPVA 4Z4RA
chains in the Genus database with same CATH superfamily
2JIZA 4G7XA 2QDXA 4Z4YA 2XNCA 4TMVA 1SM4A 4J0QA 2WJYA 2VBVA 1D2EA 1K28D 5E6TA 3I1FA 4B4DA 1J9ZA 1YIJB 2VJIA 4FWTA 1UD2A 3FPPA 1NJID 3ISXA 4R71A 1ZM2A 2CF4A 2QGGA 3W2IA 1NDHA 3CCUB 1EFUA 1KRHA 1V0FA 2Q6OA 2ZXIA 2B5OA 1NBMA 3BNWA 2C77A 2KVOA 2NPFA 1KD1D 1EFCA 2C4UA 3CCEB 3WQZA 1KK3A 2BGJA 4DK0A 1VJSA 2W6JA 4B44A 1YHQB 1WPCA 4G1BA 2F4NA 3PUMA 4BPRA 5F4MA 3WY9A 3ZBTA 1KC8D 4OOVA 4M53A 3U6KA 3T51B 4Z4VA 4P22A 1N08A 4ACBA 1SKQA 2BM1A 1AIPA 1YX2A 4XKVA 3OW2B 1KMHA 3CC2B 1E63A 2OTJB 4YAFA 2ZL5A 1KK1A 2R6HA 2BPOA 4YAWA 5H59A 1COWA 2BVNA 2CW5A 3WBJA 4G6IA 1CNFA 1W0KA 2CRVA 4P25A 3ZUGA 4Z4WA 2I1LA 2VNHA 4TN1A 4XOTA 1V5VA 1VQ5B 3CCQB 3SEJA 1VQ4B 4Q7JB 3SJPA 2X6XA 1E79A 1FNBA 1PJ7A 4YXWA 1E62A 3CCMB 3LQEA 5HZAA 4Z4UA 1B2RA 2D3NA 2VBUA 3Q39A 1HA3A 3MMPA 4DNTB 1WTHD 3CP2A 3LQ6A 3PA2A 4P9SA 3WNBA 1VQ9B 3B78A 1ZM3A 5A89A 2WJVA 4B48A 4NCNA 5GV7A 5TRDA 4RDJA 2GJRA 3OOCA 4OPSA 4XLCA 1FNCA 1WORA 3SJZA 4XLAA 1N8RD 4RD2A 3CC4B 3AGPA 3BY2A 3CP8A 3CRZA 4XN3A 2JJ1A 4Z1MA 4Z4TA 1S0UA 1QVGB 1H8HA 1Y0YA 3AVTA 4YAOA 2WPDA 3G71B 5HZBA 3WBKA 2EFGA 1IJEA 4GQNA 5CDFA 4X7CA 1UD5A 1EP2B 3Q6RA 1F60A 3FKSA 4N3NA 2X6WA 2YWGA 4UZEA 2LZJA 3LNNA 3BH4A 4XORA 1D8TA 2XEXA 4M0LA 3VO1A 4XQFA 1VQOB 3I55B 4PABA 1E43A 1KK2A 4Z4RA 2GJKA 5KW9A 1FX0A 4EH1A 3W2EA 3CCJB 2VBTA 3CESA 3P27A 3PENA 1HVXA 4X0CA 5DSZA 4ZCLA 2BV3A 3GQBA 3OJXA 2DIEA 5A88A 1F20A 3LO8A 3KEWA 2AHOA 4HIZA 4N3GA 4Y9UA 1T5EA 4C43A 1WSRA 1OB2A 1VQMB 2GJPA 5H5JA 1UD4A 4WZTA 4TKOB 2D3LA 3HAGA 4U9UA 2DERA 3H9NA 4ACAA 5B6IA 4DQLA 1E3ZA 5IYPA 1QFJA 4WZKA 4RD4A 3W2GA 1RQRA 2DETA 1R5OA 1WOPA 4YELA 5IK2A 3VO2A 2ZZQA 5J3OA 2OYNA 2F1LA 1H85A 4M4SA 1EP1B 3OZVA 5FIUA 4AVZA 2ZZEA 5EMNA 3QFSA 4X07A 5HXBA 2E1BA 2ZTGA 1SKYB 3SLNA 2XNDA 4XD7A 4B3XA 3JQRA 3WYAA 3BCDA 1WP6A 2RC6A 2XOKA 3R6JA 3PA1A 2WR8A 4OP7A 4PGOA 5F4OA 2VJJA 1W34A 4PC6A 1N05A 2NV4A 3CMAB 2ZBVA 5FO1A 1GVHA 5FA6A 2DCUA 1PJ6A 3GSIA 3T56B 4L8JA 5AN9A 2QN6A 4OOXA 1I18A 4B3FX 3G05A 5KSWB 3ZPNA 1DG1G 1W2BB 1K73D 4NBSA 3OE7A 3A1PA 3U6BA 1EXMA 4RD3A 1VF7A 2GK7A 3ES9A 3W2FA 4C0SA 4ZGQB 2FVGA 2XZOA 3AGQA 4P12A 4B47A 4G7WA 1VHEA 2QA4B 2GREA 1M1KD 2EIXA 1K8AD 4F7DA 1JA1A 4RD1A 1KJZA 3ASQA 1IB0A 4P1VA 3E20A 2J7KA 4RLZA 4Z4ZA 1VQ6B 2X6YA 1T6ZA 3SKBA 5FNZA 4YEJA 5DS0A 2V7WA 3AVUA 1FNDA 5BSXA 5IYRA 1VQKB 3A3GA 4HE6A 2Z6BD 5IYQA 1UD8A 4H9GA 2BMWA 2BM0A 4IW3B 2ZBUA 1E3XA 4YAUA 1WOSA 3OKXA 3P26A 4XL9A 4TMWA 1JB9A 3ONYA 3Q6QA 5IYNA 2WZNA 3WXMA 4HE5A 4RCYA 1QUFA 4QHYA 2ZL7A 1N0VC 2V7QA 1VQ8B 2GPJA 1W87A 4G1VA 1DDGA 2M5SA 4UZFA 1E1RA 1JA0A 1B23P 1KK0A 1IJFA 1I7PA 1YITB 4K1XA 1YJWB 2B7CA 1G7TA 2X53S 1XQBA 4JMQA 4RD0A 3CW2A 1QGYA 3OZWA 1NB0A 3CXCB 1Q81D 3WNCA 2DY1A 4YALA 1EWYA 1VHOA 4LBWA 4TSFA 4Y7CA 4X7DA 2HDNB 2FX3A 2OK8A 3OP1A 1M90D 4XOPA 1G7CA 1EP3B 3QE2A 3V7AA 3WNDA 4X8IA 4DNRB 2V7TA 3E1YE 4RD6A 5IYWA 2R9VA 2OBTA 2HLDA 3D26A 1FRQA 1VQNB 1GAQA 2BF4A 3GIRA 4PC1A 3FPKA 4XLFA 5TR9A 3JU4A 3QFCA 1Q86D 1UD3A 4NNJA 3SLDA 1TUIA 3A8IA 1GAWA 4M1KA 5J35A 2XZPA 1H8EA 3GVLA 3W5UA 2C5BA 4RM0A 4TMXA 2JJ2A 3JQQA 3OZUA 2CK3A 2DOGA 3AVYA 3BQJA 2W6IA 4WWVA 5TY0A 4LBVA 1VLOA 2C78A 4AF6A 1FRNA 3OAAA 1YJ9B 3ASTA 2HMAA 3ZBUA 1ZUNB 1QH0A 2OK7A 2VBSA 3GVKA 2VNKA 4PAAA 2GK6A 1FDRA 2F1MA 5THXA 2OBSA 1DDIA 4Y9RA 2QTZA 4FXUA 1CQXA 4KKSA 1VLYA 2Q6IA 4KKTA 2Q6LA 1TVCA 5BSYA 1PKVA 1KTVA 3A8KA 3R6KA 5LMZA 4YHBA 5A8AA 1UMKA 2QE7A 3CD6B 2VYQA 1R5BA 2VZLA 3Q38A 3CCVB 1UD6A 2QEXB 4CQJA 1OHHA 3ONUA 4ZV4A 1QUEA 2X0KA 2X85A 3JQPA 4G5GA 5KNLA 1H42A 4P6VF 1WOOA 3CPWB 4DK1A 3PUNA 1XFOA 1ZM4A 3CMMA 3KL9A 4XM3A 5TV2A 3VMFA 4TT3A 4E0FA 2C2WA 1BX1A 4UAJA 2XNJA 4XONA 1AMOA 3OPOA 3PVDA 3QFRA 4FK8A 2PLFA 3W5HA 3ASPA 1QX4A 1T6YA 1N06A 4P3YA 1VQLB 1PJ5A 4XMYA 1GR1A 1QFYA 1V0EA 4PC2A 2QTLA 3NE5B 4PC7A 3B82A 1XE1A 4PC3A 3W2HA 2ZXHA 3BC9A 1R5NA 1I8DA 4ZCIA 4II3A 3QSYA 4DQKA 3ASSA 3OJWA 4UZUA 1JJ2B 1K9MD 3AVXA 2VNIA 4P6YA 2BGIA 3I56B 3AVWA 4QV2A 2OTLB 2VNJA 1CNEA 1W9XA 4P2NA 2D9RA 2RC5A 4QFMA 2Q6KA 5F4JA 3MHPA 4QVAA 1KZLA 4XNFA 1NRKA 3CB4A 1BMFA 3AVVA 3B8HA 2C5HA 1N07A 3OFNA 1MABA 2P3MA 1KQSB 4MYTA 2WZPP 3GVJA 4P3IA 3ZZUA 4MYUA 4B3GA 3OW7A 3A8JA 3H94A 2D74A 1G7SA 2V7VA 5HKKA 3CCLB 3DDYA 3BCFA 4XR6A 2XZLA 4II2A 1QFZA 4FN5A 1OGJA 2YWFA 3CCSB 4LBYA 1BQEA 4ROXA 2JDIA 1U2RA 3VNVA 1BPLA 3Q3AA 2X8KA 4ZGNB 1S72B 1GJRA 2ZZFA 2OBRA 4ASUA 2CNDA 3CTAA 2ZITA 5FO0A 4LBZA 4P26A 3ZC3A 3CC7B 1OB5A 2PE3A 1TTTA 1VQ7B 3J81k 3V76A 1QGAA 1ZM9A 5FL7A 1JNYA 2V31A 2C4TA 3U2QA 1EFRA 3CPXA 4M2LA 1MRZA 3VR6A 3G6EB 4XKWA 1Q9SA 1YJNB 2YWHA 4LC0A 3QFTA 4X7FA 4B43A 4X7EA 1DARA 1WSVA 1ELOA 1G7RA 1QGZA 1T6XA 1QG0A 1EFTA 4AC9A 4OPOA 5L46A 4RCZA 3A35A 4WZEA 1N0UA 1W0JA 3RY8A 1Q7YD 2DEUA 3W5VA 4TMZA 1TLLA 4XLEA 3ASRA 4XN0A 1GO2A 2V7UA 3LVBA 4TMTA 1BJKA 2V7XA 2CC2A 3OEEA 4WZLA 1RQPA 2GQFA 3OEHA 3CMEB 3FJOA 3ZZTA 1OB0A 2XGJA 3CCRB 3VNUA 1HZEA 3BY1A 4WQMA 1XB2A 2PIAA 2BN4A 3A3BA 4X05A 4RPBA 2WYRA 1OGIA 2HCJB 2B7BA 4KKUA 2X3UA 1P4MA 4ZCMA 4AF7A 1W35A 5JBQA 4RJLA 1YI2B 5DN6A 4OOSA 5GV8A 1Y0RA 1YLOA 3MCAA 2V4DA 4Z4SA 1S4MA 1IHMA 3ZZ0A 2CBXA 2ZZGA 4X06A 1A8PA 2BSAA 3ZIAA 1WU8A 4RDLA 1NB9A 1E64A 2DYIA 1E1QA 4XLHA 3T53B 1Q82D 1FNMA 4QVJA 2WSSA 2E1RA 2ZL6A 2YWEA 1BX0A 2QMUA 2F43A 1VQPB 1QVFB 1BLIA 2PMDA 4RDKA 4RPDA 3G4SB 4QUZA 1WDTA 2ZTNA 1D1NA 2JN9A 4OPVA
chains in the Genus database with same CATH topology
2ZL7A 5KW9A 4Z4YA 4QV2A 4X0CA 5E6TA 4P2NA 5F4JA 4QVAA 4WZTA 4P3IA 4X7DA 3V7AA 5IYWA 2OBTA 4ROXA 5IYPA 3D26A 4WZKA 3Q3AA 3PUMA 2OBRA 5J3OA 5F4MA 4P26A 4OOVA 3SLDA 4Z4VA 5J35A 2ZL5A 4X07A 4RM0A 4X7FA 3SLNA 3BQJA 4X7EA 4P25A 4Z4WA 3ASTA 3PA1A 3R6JA 5F4OA 4OP7A 4OPOA 3SEJA 4WZEA 2OBSA 3RY8A 3SJPA 3ASRA 4OOXA 3LQEA 5HZAA 4Z4UA 5BSYA 4WZLA 3R6KA 3Q39A 3BY1A 3LQ6A 3PA2A 3Q38A 4X05A 4RPBA 4P12A 3ONUA 4RDJA 4OPSA 3PUNA 3ASQA 4P1VA 4RLZA 4OOSA 4Z4SA 3BY2A 1IHMA 4Z4ZA 3SKBA 4Z4TA 3PVDA 4X06A 5BSXA 5HZBA 5IYRA 3ASPA 4RDLA 5IYQA 4X7CA 3Q6RA 4QVJA 2ZL6A 4RPDA 4RDKA 3ONYA 3Q6QA 5IYNA 4QUZA 3ASSA 4OPVA 4Z4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZL7 A;  5KW9 A;  4Z4Y A;  4QV2 A;  4X0C A;  5E6T A;  4P2N A;  5F4J A;  4QVA A;  4WZT A;  4P3I A;  4X7D A;  3V7A A;  5IYW A;  2OBT A;  4ROX A;  5IYP A;  3D26 A;  4WZK A;  3Q3A A;  3PUM A;  2OBR A;  5J3O A;  5F4M A;  4P26 A;  4OOV A;  3SLD A;  4Z4V A;  5J35 A;  2ZL5 A;  4X07 A;  4RM0 A;  4X7F A;  3SLN A;  3BQJ A;  4X7E A;  4P25 A;  4Z4W A;  3AST A;  3PA1 A;  3R6J A;  5F4O A;  4OP7 A;  4OPO A;  3SEJ A;  4WZE A;  2OBS A;  3RY8 A;  3SJP A;  3ASR A;  4OOX A;  3LQE A;  5HZA A;  4Z4U A;  5BSY A;  4WZL A;  3R6K A;  3Q39 A;  3BY1 A;  3LQ6 A;  3PA2 A;  3Q38 A;  4X05 A;  4RPB A;  4P12 A;  3ONU A;  4RDJ A;  4OPS A;  3PUN A;  3ASQ A;  4P1V A;  4RLZ A;  4OOS A;  4Z4S A;  3BY2 A;  1IHM A;  4Z4Z A;  3SKB A;  4Z4T A;  3PVD A;  4X06 A;  5BSX A;  5HZB A;  5IYR A;  3ASP A;  4RDL A;  5IYQ A;  4X7C A;  3Q6R A;  4QVJ A;  2ZL6 A;  4RPD A;  4RDK A;  3ONY A;  3Q6Q A;  5IYN A;  4QUZ A;  3ASS A;  4OPV A;  4Z4R A; 
#chains in the Genus database with same CATH topology
 2JIZ A;  4G7X A;  2QDX A;  4Z4Y A;  2XNC A;  4TMV A;  1SM4 A;  4J0Q A;  2WJY A;  2VBV A;  1D2E A;  1K28 D;  5E6T A;  3I1F A;  4B4D A;  1J9Z A;  1YIJ B;  2VJI A;  4FWT A;  1UD2 A;  3FPP A;  1NJI D;  3ISX A;  4R71 A;  1ZM2 A;  2CF4 A;  2QGG A;  3W2I A;  1NDH A;  3CCU B;  1EFU A;  1KRH A;  1V0F A;  2Q6O A;  2ZXI A;  2B5O A;  1NBM A;  3BNW A;  2C77 A;  2KVO A;  2NPF A;  1KD1 D;  1EFC A;  2C4U A;  3CCE B;  3WQZ A;  1KK3 A;  2BGJ A;  4DK0 A;  1VJS A;  2W6J A;  4B44 A;  1YHQ B;  1WPC A;  4G1B A;  2F4N A;  3PUM A;  4BPR A;  5F4M A;  3WY9 A;  3ZBT A;  1KC8 D;  4OOV A;  4M53 A;  3U6K A;  3T51 B;  4Z4V A;  4P22 A;  1N08 A;  4ACB A;  1SKQ A;  2BM1 A;  1AIP A;  1YX2 A;  4XKV A;  3OW2 B;  1KMH A;  3CC2 B;  1E63 A;  2OTJ B;  4YAF A;  2ZL5 A;  1KK1 A;  2R6H A;  2BPO A;  4YAW A;  5H59 A;  1COW A;  2BVN A;  2CW5 A;  3WBJ A;  4G6I A;  1CNF A;  1W0K A;  2CRV A;  4P25 A;  3ZUG A;  4Z4W A;  2I1L A;  2VNH A;  4TN1 A;  4XOT A;  1V5V A;  1VQ5 B;  3CCQ B;  3SEJ A;  1VQ4 B;  4Q7J B;  3SJP A;  2X6X A;  1E79 A;  1FNB A;  1PJ7 A;  4YXW A;  1E62 A;  3CCM B;  3LQE A;  5HZA A;  4Z4U A;  1B2R A;  2D3N A;  2VBU A;  3Q39 A;  1HA3 A;  3MMP A;  4DNT B;  1WTH D;  3CP2 A;  3LQ6 A;  3PA2 A;  4P9S A;  3WNB A;  1VQ9 B;  3B78 A;  1ZM3 A;  5A89 A;  2WJV A;  4B48 A;  4NCN A;  5GV7 A;  5TRD A;  4RDJ A;  2GJR A;  3OOC A;  4OPS A;  4XLC A;  1FNC A;  1WOR A;  3SJZ A;  4XLA A;  1N8R D;  4RD2 A;  3CC4 B;  3AGP A;  3BY2 A;  3CP8 A;  3CRZ A;  4XN3 A;  2JJ1 A;  4Z1M A;  4Z4T A;  1S0U A;  1QVG B;  1H8H A;  1Y0Y A;  3AVT A;  4YAO A;  2WPD A;  3G71 B;  5HZB A;  3WBK A;  2EFG A;  1IJE A;  4GQN A;  5CDF A;  4X7C A;  1UD5 A;  1EP2 B;  3Q6R A;  1F60 A;  3FKS A;  4N3N A;  2X6W A;  2YWG A;  4UZE A;  2LZJ A;  3LNN A;  3BH4 A;  4XOR A;  1D8T A;  2XEX A;  4M0L A;  3VO1 A;  4XQF A;  1VQO B;  3I55 B;  4PAB A;  1E43 A;  1KK2 A;  4Z4R A;  2GJK A;  5KW9 A;  1FX0 A;  4EH1 A;  3W2E A;  3CCJ B;  2VBT A;  3CES A;  3P27 A;  3PEN A;  1HVX A;  4X0C A;  5DSZ A;  4ZCL A;  2BV3 A;  3GQB A;  3OJX A;  2DIE A;  5A88 A;  1F20 A;  3LO8 A;  3KEW A;  2AHO A;  4HIZ A;  4N3G A;  4Y9U A;  1T5E A;  4C43 A;  1WSR A;  1OB2 A;  1VQM B;  2GJP A;  5H5J A;  1UD4 A;  4WZT A;  4TKO B;  2D3L A;  3HAG A;  4U9U A;  2DER A;  3H9N A;  4ACA A;  5B6I A;  4DQL A;  1E3Z A;  5IYP A;  1QFJ A;  4WZK A;  4RD4 A;  3W2G A;  1RQR A;  2DET A;  1R5O A;  1WOP A;  4YEL A;  5IK2 A;  3VO2 A;  2ZZQ A;  5J3O A;  2OYN A;  2F1L A;  1H85 A;  4M4S A;  1EP1 B;  3OZV A;  5FIU A;  4AVZ A;  2ZZE A;  5EMN A;  3QFS A;  4X07 A;  5HXB A;  2E1B A;  2ZTG A;  1SKY B;  3SLN A;  2XND A;  4XD7 A;  4B3X A;  3JQR A;  3WYA A;  3BCD A;  1WP6 A;  2RC6 A;  2XOK A;  3R6J A;  3PA1 A;  2WR8 A;  4OP7 A;  4PGO A;  5F4O A;  2VJJ A;  1W34 A;  4PC6 A;  1N05 A;  2NV4 A;  3CMA B;  2ZBV A;  5FO1 A;  1GVH A;  5FA6 A;  2DCU A;  1PJ6 A;  3GSI A;  3T56 B;  4L8J A;  5AN9 A;  2QN6 A;  4OOX A;  1I18 A;  4B3F X;  3G05 A;  5KSW B;  3ZPN A;  1DG1 G;  1W2B B;  1K73 D;  4NBS A;  3OE7 A;  3A1P A;  3U6B A;  1EXM A;  4RD3 A;  1VF7 A;  2GK7 A;  3ES9 A;  3W2F A;  4C0S A;  4ZGQ B;  2FVG A;  2XZO A;  3AGQ A;  4P12 A;  4B47 A;  4G7W A;  1VHE A;  2QA4 B;  2GRE A;  1M1K D;  2EIX A;  1K8A D;  4F7D A;  1JA1 A;  4RD1 A;  1KJZ A;  3ASQ A;  1IB0 A;  4P1V A;  3E20 A;  2J7K A;  4RLZ A;  4Z4Z A;  1VQ6 B;  2X6Y A;  1T6Z A;  3SKB A;  5FNZ A;  4YEJ A;  5DS0 A;  2V7W A;  3AVU A;  1FND A;  5BSX A;  5IYR A;  1VQK B;  3A3G A;  4HE6 A;  2Z6B D;  5IYQ A;  1UD8 A;  4H9G A;  2BMW A;  2BM0 A;  4IW3 B;  2ZBU A;  1E3X A;  4YAU A;  1WOS A;  3OKX A;  3P26 A;  4XL9 A;  4TMW A;  1JB9 A;  3ONY A;  3Q6Q A;  5IYN A;  2WZN A;  3WXM A;  4HE5 A;  4RCY A;  1QUF A;  4QHY A;  2ZL7 A;  1N0V C;  2V7Q A;  1VQ8 B;  2GPJ A;  1W87 A;  4G1V A;  1DDG A;  2M5S A;  4UZF A;  1E1R A;  1JA0 A;  1B23 P;  1KK0 A;  1IJF A;  1I7P A;  1YIT B;  4K1X A;  1YJW B;  2B7C A;  1G7T A;  2X53 S;  1XQB A;  4JMQ A;  4RD0 A;  3CW2 A;  1QGY A;  3OZW A;  1NB0 A;  3CXC B;  1Q81 D;  3WNC A;  2DY1 A;  4YAL A;  1EWY A;  1VHO A;  4LBW A;  4TSF A;  4Y7C A;  4X7D A;  2HDN B;  2FX3 A;  2OK8 A;  3OP1 A;  1M90 D;  4XOP A;  1G7C A;  1EP3 B;  3QE2 A;  3V7A A;  3WND A;  4X8I A;  4DNR B;  2V7T A;  3E1Y E;  4RD6 A;  5IYW A;  2R9V A;  2OBT A;  2HLD A;  3D26 A;  1FRQ A;  1VQN B;  1GAQ A;  2BF4 A;  3GIR A;  4PC1 A;  3FPK A;  4XLF A;  5TR9 A;  3JU4 A;  3QFC A;  1Q86 D;  1UD3 A;  4NNJ A;  3SLD A;  1TUI A;  3A8I A;  1GAW A;  4M1K A;  5J35 A;  2XZP A;  1H8E A;  3GVL A;  3W5U A;  2C5B A;  4RM0 A;  4TMX A;  2JJ2 A;  3JQQ A;  3OZU A;  2CK3 A;  2DOG A;  3AVY A;  3BQJ A;  2W6I A;  4WWV A;  5TY0 A;  4LBV A;  1VLO A;  2C78 A;  4AF6 A;  1FRN A;  3OAA A;  1YJ9 B;  3AST A;  2HMA A;  3ZBU A;  1ZUN B;  1QH0 A;  2OK7 A;  2VBS A;  3GVK A;  2VNK A;  4PAA A;  2GK6 A;  1FDR A;  2F1M A;  5THX A;  2OBS A;  1DDI A;  4Y9R A;  2QTZ A;  4FXU A;  1CQX A;  4KKS A;  1VLY A;  2Q6I A;  4KKT A;  2Q6L A;  1TVC A;  5BSY A;  1PKV A;  1KTV A;  3A8K A;  3R6K A;  5LMZ A;  4YHB A;  5A8A A;  1UMK A;  2QE7 A;  3CD6 B;  2VYQ A;  1R5B A;  2VZL A;  3Q38 A;  3CCV B;  1UD6 A;  2QEX B;  4CQJ A;  1OHH A;  3ONU A;  4ZV4 A;  1QUE A;  2X0K A;  2X85 A;  3JQP A;  4G5G A;  5KNL A;  1H42 A;  4P6V F;  1WOO A;  3CPW B;  4DK1 A;  3PUN A;  1XFO A;  1ZM4 A;  3CMM A;  3KL9 A;  4XM3 A;  5TV2 A;  3VMF A;  4TT3 A;  4E0F A;  2C2W A;  1BX1 A;  4UAJ A;  2XNJ A;  4XON A;  1AMO A;  3OPO A;  3PVD A;  3QFR A;  4FK8 A;  2PLF A;  3W5H A;  3ASP A;  1QX4 A;  1T6Y A;  1N06 A;  4P3Y A;  1VQL B;  1PJ5 A;  4XMY A;  1GR1 A;  1QFY A;  1V0E A;  4PC2 A;  2QTL A;  3NE5 B;  4PC7 A;  3B82 A;  1XE1 A;  4PC3 A;  3W2H A;  2ZXH A;  3BC9 A;  1R5N A;  1I8D A;  4ZCI A;  4II3 A;  3QSY A;  4DQK A;  3ASS A;  3OJW A;  4UZU A;  1JJ2 B;  1K9M D;  3AVX A;  2VNI A;  4P6Y A;  2BGI A;  3I56 B;  3AVW A;  4QV2 A;  2OTL B;  2VNJ A;  1CNE A;  1W9X A;  4P2N A;  2D9R A;  2RC5 A;  4QFM A;  2Q6K A;  5F4J A;  3MHP A;  4QVA A;  1KZL A;  4XNF A;  1NRK A;  3CB4 A;  1BMF A;  3AVV A;  3B8H A;  2C5H A;  1N07 A;  3OFN A;  1MAB A;  2P3M A;  1KQS B;  4MYT A;  2WZP P;  3GVJ A;  4P3I A;  3ZZU A;  4MYU A;  4B3G A;  3OW7 A;  3A8J A;  3H94 A;  2D74 A;  1G7S A;  2V7V A;  5HKK A;  3CCL B;  3DDY A;  3BCF A;  4XR6 A;  2XZL A;  4II2 A;  1QFZ A;  4FN5 A;  1OGJ A;  2YWF A;  3CCS B;  4LBY A;  1BQE A;  4ROX A;  2JDI A;  1U2R A;  3VNV A;  1BPL A;  3Q3A A;  2X8K A;  4ZGN B;  1S72 B;  1GJR A;  2ZZF A;  2OBR A;  4ASU A;  2CND A;  3CTA A;  2ZIT A;  5FO0 A;  4LBZ A;  4P26 A;  3ZC3 A;  3CC7 B;  1OB5 A;  2PE3 A;  1TTT A;  1VQ7 B;  3J81 k;  3V76 A;  1QGA A;  1ZM9 A;  5FL7 A;  1JNY A;  2V31 A;  2C4T A;  3U2Q A;  1EFR A;  3CPX A;  4M2L A;  1MRZ A;  3VR6 A;  3G6E B;  4XKW A;  1Q9S A;  1YJN B;  2YWH A;  4LC0 A;  3QFT A;  4X7F A;  4B43 A;  4X7E A;  1DAR A;  1WSV A;  1ELO A;  1G7R A;  1QGZ A;  1T6X A;  1QG0 A;  1EFT A;  4AC9 A;  4OPO A;  5L46 A;  4RCZ A;  3A35 A;  4WZE A;  1N0U A;  1W0J A;  3RY8 A;  1Q7Y D;  2DEU A;  3W5V A;  4TMZ A;  1TLL A;  4XLE A;  3ASR A;  4XN0 A;  1GO2 A;  2V7U A;  3LVB A;  4TMT A;  1BJK A;  2V7X A;  2CC2 A;  3OEE A;  4WZL A;  1RQP A;  2GQF A;  3OEH A;  3CME B;  3FJO A;  3ZZT A;  1OB0 A;  2XGJ A;  3CCR B;  3VNU A;  1HZE A;  3BY1 A;  4WQM A;  1XB2 A;  2PIA A;  2BN4 A;  3A3B A;  4X05 A;  4RPB A;  2WYR A;  1OGI A;  2HCJ B;  2B7B A;  4KKU A;  2X3U A;  1P4M A;  4ZCM A;  4AF7 A;  1W35 A;  5JBQ A;  4RJL A;  1YI2 B;  5DN6 A;  4OOS A;  5GV8 A;  1Y0R A;  1YLO A;  3MCA A;  2V4D A;  4Z4S A;  1S4M A;  1IHM A;  3ZZ0 A;  2CBX A;  2ZZG A;  4X06 A;  1A8P A;  2BSA A;  3ZIA A;  1WU8 A;  4RDL A;  1NB9 A;  1E64 A;  2DYI A;  1E1Q A;  4XLH A;  3T53 B;  1Q82 D;  1FNM A;  4QVJ A;  2WSS A;  2E1R A;  2ZL6 A;  2YWE A;  1BX0 A;  2QMU A;  2F43 A;  1VQP B;  1QVF B;  1BLI A;  2PMD A;  4RDK A;  4RPD A;  3G4S B;  4QUZ A;  1WDT A;  2ZTN A;  1D1N A;  2JN9 A;  4OPV A; 
#chains in the Genus database with same CATH homology
 2ZL7 A;  5KW9 A;  4Z4Y A;  4QV2 A;  4X0C A;  5E6T A;  4P2N A;  5F4J A;  4QVA A;  4WZT A;  4P3I A;  4X7D A;  3V7A A;  5IYW A;  2OBT A;  4ROX A;  5IYP A;  3D26 A;  4WZK A;  3Q3A A;  3PUM A;  2OBR A;  5J3O A;  5F4M A;  4P26 A;  4OOV A;  3SLD A;  4Z4V A;  5J35 A;  2ZL5 A;  4X07 A;  4RM0 A;  4X7F A;  3SLN A;  3BQJ A;  4X7E A;  4P25 A;  4Z4W A;  3AST A;  3PA1 A;  3R6J A;  5F4O A;  4OP7 A;  4OPO A;  3SEJ A;  4WZE A;  2OBS A;  3RY8 A;  3SJP A;  3ASR A;  4OOX A;  3LQE A;  5HZA A;  4Z4U A;  5BSY A;  4WZL A;  3R6K A;  3Q39 A;  3BY1 A;  3LQ6 A;  3PA2 A;  3Q38 A;  4X05 A;  4RPB A;  4P12 A;  3ONU A;  4RDJ A;  4OPS A;  3PUN A;  3ASQ A;  4P1V A;  4RLZ A;  4OOS A;  4Z4S A;  3BY2 A;  1IHM A;  4Z4Z A;  3SKB A;  4Z4T A;  3PVD A;  4X06 A;  5BSX A;  5HZB A;  5IYR A;  3ASP A;  4RDL A;  5IYQ A;  4X7C A;  3Q6R A;  4QVJ A;  2ZL6 A;  4RPD A;  4RDK A;  3ONY A;  3Q6Q A;  5IYN A;  4QUZ A;  3ASS A;  4OPV A;  4Z4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...