4Z4TA

Crystal structure of gii.10 p domain in complex with 75mm fucose
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
314
structure length
311
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTVGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 71
structure length 311
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4tA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4tA01
3R6KA 4X0CA 4WZKA 3ONYA 1IHMA 5E6TA 4Z4TA 5HZBA 4RM0A 4RDJA 4Z4VA 3V7AA 4RDKA 5IYNA 3ASTA 4QUZA 3LQEA 3Q6QA 5J3OA 2ZL5A 3Q6RA 4ROXA 3RY8A 4QVJA 5BSYA 3PUNA 3Q38A 4X7EA 3PA2A 3SKBA 4X05A 4X7FA 4Z4RA 4X06A 5J35A 4OPVA 4Z4YA 4WZTA 4Z4WA 3Q39A 2OBRA 3SJPA 3SLNA 4OPOA 4P25A 3SEJA 3BY2A 2ZL6A 3BY1A 4Z4SA 2ZL7A 5F4JA 3D26A 4RDLA 4P3IA 4X7DA 5IYRA 5F4OA 5BSXA 3BQJA 4P1VA 4WZLA 3SLDA 4Z4ZA 4P26A 2OBSA 3PA1A 3ONUA 3PVDA 4OOVA 4OPSA 3ASQA 4RPBA 4RLZA 5F4MA 3ASRA 4P12A 3PUMA 5IYQA 5HZAA 2OBTA 3Q3AA 4OOSA 4QV2A 4P2NA 4Z4UA 5KW9A 4QVAA 4RPDA 4X7CA 4OOXA 3LQ6A 5IYWA 3ASSA 3ASPA 5IYPA 3R6JA 4X07A 4OP7A 4WZEA
chains in the Genus database with same CATH superfamily
4X0CA 3FKSA 1WSVA 1QUEA 3ONYA 3QFCA 3E20A 2X6XA 2OYNA 4G7WA 1IHMA 3P26A 1Q9SA 4XLHA 3U6BA 2V7TA 4P9SA 4B3GA 3WNBA 1G7TA 1JA0A 4Z4TA 1XFOA 2R9VA 2WPDA 1WSRA 4TT3A 4NCNA 1E3XA 4ZCIA 2GK7A 3ASTA 1T6YA 4NNJA 3AVWA 1QGZA 1I8DA 4Y9UA 3Q6QA 1W34A 4MYTA 3CC4B 4R71A 4ROXA 4RD2A 3RY8A 1VQMB 1W87A 4P6YA 1FNMA 4YALA 5IK2A 3CCLB 4TMVA 5BSYA 4QFMA 4L8JA 2W6JA 2XZOA 5FO0A 2V7UA 4X05A 4Z4RA 1EP1B 3MCAA 2V7XA 2DEUA 3B8HA 2EFGA 4J0QA 1GVHA 3G71B 3A35A 2XNJA 3JQPA 1VQNB 2OK7A 4XQFA 1VLYA 4XN0A 4P3YA 2CRVA 4DK0A 2P3MA 2CC2A 3NE5B 2D3LA 4C43A 2VNHA 4TSFA 3SLNA 1SM4A 4XKVA 1OGIA 1ZM4A 3CPWB 4OPOA 3SEJA 3SJZA 3H9NA 4TMWA 1VQPB 2YWHA 2RC5A 1T5EA 1QVFB 4Z4SA 4RD0A 2M5SA 1AIPA 2DOGA 1UMKA 1J9ZA 2ZXHA 3BH4A 3GVKA 4M2LA 4PGOA 5GV7A 3W5HA 3WNCA 5KSWB 4RD4A 2BVNA 3A8KA 5F4JA 3D26A 1RQRA 2AHOA 2B7CA 4ACBA 1COWA 2C78A 2BGIA 4DK1A 5AN9A 2HMAA 2F43A 5H5JA 1MRZA 1V0FA 5IYRA 3CCJB 2ZZEA 5F4OA 1RQPA 3CP2A 3OEHA 2F1MA 3W2EA 3PENA 3BQJA 1K9MD 4P1VA 1GAQA 1D1NA 1Y0RA 3SLDA 2XNCA 2RC6A 4P26A 1QH0A 3PA1A 4B4DA 3J81k 1Q86D 1BMFA 3PVDA 5TV2A 3CCQB 2HCJB 1R5NA 1EFUA 1PJ7A 2OTLB 2ZTGA 1E3ZA 1WTHD 2FX3A 2QTZA 1WOOA 3ASQA 4RPBA 5B6IA 1KJZA 4RLZA 1YI2B 5F4MA 4P12A 1WPCA 3KEWA 3ZC3A 3ZIAA 1E43A 3CPXA 2BSAA 3OPOA 1N08A 2OBTA 4PC7A 4QV2A 3AVXA 2CNDA 2YWFA 1QFJA 4XNFA 3OAAA 2X0KA 4UZEA 3ZZTA 1Q7YD 3LQ6A 1G7RA 5IYWA 3ISXA 2C5BA 2GJKA 2V7QA 4X8IA 5EMNA 4G6IA 1BJKA 1KK0A 3U6KA 4OP7A 4DNTB 3CRZA 3FJOA 2QE7A 1N0UA 4Y9RA 2QMUA 2V31A 3CC2B 1A8PA 1GAWA 4AF7A 3B78A 5E6TA 1KRHA 1YJWB 4TN1A 1H8HA 3GQBA 2V4DA 4DQKA 2XOKA 1EFTA 2X85A 1PJ5A 1EFRA 3A3GA 5IYNA 5DS0A 3OW7A 1U2RA 2LZJA 1NDHA 3CCRB 3CD6B 2X6WA 3OFNA 1OB2A 4G1BA 1VQLB 2Q6IA 4H9GA 3U2QA 1H8EA 1WU8A 2ZBVA 1S0UA 4XORA 3W2IA 3PUNA 3Q38A 3QFRA 1VQKB 2VNJA 1XE1A 4X7EA 1VQ5B 1T6XA 4PABA 1E64A 2VYQA 5TY0A 2NPFA 2HLDA 4M4SA 4UAJA 3W5UA 4X06A 1KQSB 2C77A 4AVZA 3A1PA 1VQ8B 1F20A 1QGYA 1JB9A 2PIAA 4WZTA 4Z4WA 1TLLA 1BX1A 1VHOA 3Q39A 2VZLA 4TMTA 3T51B 3SJPA 3DDYA 3H94A 1YHQB 2XNDA 4P25A 4XLCA 3A3BA 5HKKA 3BY2A 2C4UA 1D8TA 3CTAA 3GIRA 3CMEB 3CMAB 1YJ9B 2YWEA 2E1BA 4FXUA 4FK8A 3ZBUA 3OZUA 3OEEA 1Q81D 1CNFA 1ZM9A 4AF6A 4CQJA 4M53A 1E1RA 4YAWA 1TTTA 4LBWA 2WR8A 3G4SB 3W2HA 2Q6OA 3A8IA 3W2GA 1B2RA 4WWVA 3VNUA 2B7BA 1DDGA 4KKUA 1YLOA 3OOCA 4Y7CA 1E63A 3QFTA 5A89A 2JDIA 4LBVA 3VNVA 5A88A 4OOVA 4YEJA 4Z1MA 4YXWA 1ELOA 2GJRA 3FPPA 5GV8A 3WXMA 1D2EA 2NV4A 1R5BA 1FNDA 1WORA 3LO8A 2D9RA 4QHYA 4XKWA 5FA6A 5THXA 1N0VC 4ZGNB 2Q6KA 3MHPA 5FNZA 1YITB 1M1KD 3PUMA 1B23P 5HZAA 1DG1G 4OOSA 4HE6A 1N06A 1QX4A 4XR6A 2CF4A 4Z4UA 2B5OA 1V0EA 1W0JA 1OB0A 2I1LA 4X7CA 4YELA 2ZBUA 1I7PA 1UD6A 1W0KA 4LC0A 2GREA 4OOXA 4II2A 1FDRA 4G1VA 3ES9A 5IYPA 5DSZA 3CB4A 3R6JA 4AC9A 1QG0A 3I1FA 1EXMA 4WZEA 3R6KA 2WZPP 1R5OA 1EWYA 5FO1A 2VBVA 4WZKA 2C2WA 1VLOA 2D74A 4GQNA 3ZZ0A 1GO2A 2DETA 1FRNA 1M90D 2FVGA 1VQOB 1BX0A 2Q6LA 2GQFA 5HZBA 1P4MA 1DARA 4RM0A 4C0SA 2XZLA 3QFSA 3QE2A 1UD8A 3WYAA 3W2FA 4B3FX 1YJNB 1N8RD 3AVTA 1CQXA 1WDTA 4B3XA 1UD3A 1G7SA 4TMXA 3LQEA 1DDIA 1SKQA 1YX2A 5JBQA 1EP3B 4XD7A 2YWGA 4XM3A 4TKOB 4PAAA 2V7VA 3CCMB 2KVOA 2W6IA 3CESA 2F4NA 3CP8A 4ZV4A 5CDFA 4YAOA 1W2BB 4E0FA 4PC6A 5LMZA 2VNKA 4ZCMA 3ZBTA 4YAFA 1NJID 3FPKA 2XEXA 1HVXA 3CXCB 2JN9A 2DYIA 1WOPA 1H42A 4M1KA 4PC3A 2ZL6A 3BY1A 3AVUA 3G6EB 1CNEA 2R6HA 2C4TA 1KTVA 1H85A 1OHHA 4YHBA 3T56B 4U9UA 3V76A 3I56B 4B47A 1VQ7B 5TR9A 1KZLA 2VBUA 4F7DA 3G05A 1Q82D 2EIXA 3GVJA 1ZM2A 4RDLA 1VF7A 3VMFA 2WYRA 1E62A 1EFCA 1W9XA 1HA3A 2F1LA 4KKTA 5BSXA 2ZZQA 5FIUA 1FX0A 4RD1A 2BPOA 1KMHA 4UZUA 3ZUGA 1NB9A 1XB2A 2OBSA 2WSSA 4G5GA 4WQMA 1K73D 3GVLA 2ZXIA 1WOSA 4OPSA 1AMOA 2J7KA 1FRQA 1E79A 4ZGQB 3QSYA 1ZUNB 3OZWA 1W35A 4N3NA 4XONA 2QEXB 2GPJA 3ASRA 1KC8D 5HXBA 3JQRA 2JJ2A 4EH1A 5IYQA 3WY9A 2X3UA 1BPLA 2WZNA 4ACAA 1YIJB 2ZITA 4ZCLA 3WBJA 3HAGA 4TMZA 1WP6A 5KW9A 3OE7A 1SKYB 4QVAA 3CMMA 4RPDA 5TRDA 4IW3B 3VO1A 4DNRB 1IB0A 3ZZUA 3OW2B 3GSIA 4XOPA 2D3NA 3ASSA 3ASPA 2JIZA 2QA4B 3W5VA 3JU4A 1S72B 4X07A 2BM0A 4XOTA 3MMPA 1G7CA 1OGJA 2WJYA 5DN6A 1JNYA 3OJXA 1N05A 4G7XA 4PC2A 1OB5A 1K28D 4UZFA 1FNCA 4RDJA 4JMQA 4Z4VA 1V5VA 2Z6BD 2V7WA 4LBZA 3V7AA 2X53S 4RDKA 2VBSA 4RD6A 2PLFA 2OTJB 4QUZA 1QFZA 2ZTNA 2WJVA 2CK3A 1IJEA 1QUFA 2GK6A 3OJWA 3A8JA 4P22A 2DERA 2BF4A 4N3GA 4PC1A 4K1XA 1GR1A 2ZL5A 5J3OA 3Q6RA 4RCZA 1N07A 2ZZFA 4KKSA 4LBYA 4QVJA 1VQ6B 4B43A 1PKVA 3PA2A 2DIEA 4RCYA 3SKBA 2PE3A 1VHEA 1QVGB 2XZPA 4X7FA 3T53B 2X8KA 2QDXA 1ZM3A 3KL9A 4B44A 5J35A 4OPVA 1FNBA 1UD2A 4II3A 1KK1A 4Z4YA 1NRKA 2JJ1A 2BM1A 2OBRA 3E1YE 4Q7JB 3I55B 1TUIA 2DCUA 1S4MA 3BCFA 4XL9A 4DQLA 2VBTA 3P27A 4HIZA 3AVVA 1UD5A 1E1QA 1NBMA 2VJJA 1JA1A 2X6YA 3BC9A 3OKXA 2PMDA 3AVYA 3ZPNA 5KNLA 3AGQA 2BN4A 2HDNB 2VJIA 2ZL7A 1JJ2B 3AGPA 3CW2A 1VQ4B 2OK8A 4XLFA 4XMYA 3CCEB 4XN3A 3BNWA 2QTLA 1QFYA 1VJSA 4P6VF 5A8AA 4B48A 1HZEA 1I18A 2CW5A 1PJ6A 3OP1A 1EP2B 3WNDA 4P3IA 2C5HA 3CCSB 4X7DA 2DY1A 1BLIA 1Y0YA 1KK2A 1NB0A 3BCDA 3B82A 2QN6A 2GJPA 1T6ZA 4RJLA 3WBKA 4WZLA 4Z4ZA 4YAUA 1MABA 3ONUA 2BMWA 1QGAA 4BPRA 4HE5A 4XLEA 2VNIA 2E1RA 3WQZA 5L46A 1BQEA 1VQ9B 2CBXA 4FWTA 5H59A 2XGJA 4ASUA 5FL7A 1TVCA 3VR6A 4NBSA 3CCUB 4MYUA 3JQQA 3VO2A 3CCVB 2BV3A 1K8AD 1IJFA 3Q3AA 3OZVA 4P2NA 4FN5A 2BGJA 3LNNA 1F60A 1KK3A 2QGGA 1XQBA 1GJRA 2ZZGA 1UD4A 4XLAA 3CC7B 3LVBA 4RD3A 4M0LA 1KD1D
chains in the Genus database with same CATH topology
3R6KA 4X0CA 4WZKA 3ONYA 1IHMA 5E6TA 4Z4TA 5HZBA 4RM0A 4RDJA 4Z4VA 3V7AA 4RDKA 5IYNA 3ASTA 4QUZA 3LQEA 3Q6QA 5J3OA 2ZL5A 3Q6RA 4ROXA 3RY8A 4QVJA 5BSYA 3PUNA 3Q38A 4X7EA 3PA2A 3SKBA 4X05A 4X7FA 4Z4RA 4X06A 5J35A 4OPVA 4Z4YA 4WZTA 4Z4WA 3Q39A 2OBRA 3SJPA 3SLNA 4OPOA 4P25A 3SEJA 3BY2A 2ZL6A 3BY1A 4Z4SA 2ZL7A 5F4JA 3D26A 4RDLA 4P3IA 4X7DA 5IYRA 5F4OA 5BSXA 3BQJA 4P1VA 4WZLA 3SLDA 4Z4ZA 4P26A 2OBSA 3PA1A 3ONUA 3PVDA 4OOVA 4OPSA 3ASQA 4RPBA 4RLZA 5F4MA 3ASRA 4P12A 3PUMA 5IYQA 5HZAA 2OBTA 3Q3AA 4OOSA 4QV2A 4P2NA 4Z4UA 5KW9A 4QVAA 4RPDA 4X7CA 4OOXA 3LQ6A 5IYWA 3ASSA 3ASPA 5IYPA 3R6JA 4X07A 4OP7A 4WZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6K A;  4X0C A;  4WZK A;  3ONY A;  1IHM A;  5E6T A;  4Z4T A;  5HZB A;  4RM0 A;  4RDJ A;  4Z4V A;  3V7A A;  4RDK A;  5IYN A;  3AST A;  4QUZ A;  3LQE A;  3Q6Q A;  5J3O A;  2ZL5 A;  3Q6R A;  4ROX A;  3RY8 A;  4QVJ A;  5BSY A;  3PUN A;  3Q38 A;  4X7E A;  3PA2 A;  3SKB A;  4X05 A;  4X7F A;  4Z4R A;  4X06 A;  5J35 A;  4OPV A;  4Z4Y A;  4WZT A;  4Z4W A;  3Q39 A;  2OBR A;  3SJP A;  3SLN A;  4OPO A;  4P25 A;  3SEJ A;  3BY2 A;  2ZL6 A;  3BY1 A;  4Z4S A;  2ZL7 A;  5F4J A;  3D26 A;  4RDL A;  4P3I A;  4X7D A;  5IYR A;  5F4O A;  5BSX A;  3BQJ A;  4P1V A;  4WZL A;  3SLD A;  4Z4Z A;  4P26 A;  2OBS A;  3PA1 A;  3ONU A;  3PVD A;  4OOV A;  4OPS A;  3ASQ A;  4RPB A;  4RLZ A;  5F4M A;  3ASR A;  4P12 A;  3PUM A;  5IYQ A;  5HZA A;  2OBT A;  3Q3A A;  4OOS A;  4QV2 A;  4P2N A;  4Z4U A;  5KW9 A;  4QVA A;  4RPD A;  4X7C A;  4OOX A;  3LQ6 A;  5IYW A;  3ASS A;  3ASP A;  5IYP A;  3R6J A;  4X07 A;  4OP7 A;  4WZE A; 
#chains in the Genus database with same CATH topology
 4X0C A;  3FKS A;  1WSV A;  1QUE A;  3ONY A;  3QFC A;  3E20 A;  2X6X A;  2OYN A;  4G7W A;  1IHM A;  3P26 A;  1Q9S A;  4XLH A;  3U6B A;  2V7T A;  4P9S A;  4B3G A;  3WNB A;  1G7T A;  1JA0 A;  4Z4T A;  1XFO A;  2R9V A;  2WPD A;  1WSR A;  4TT3 A;  4NCN A;  1E3X A;  4ZCI A;  2GK7 A;  3AST A;  1T6Y A;  4NNJ A;  3AVW A;  1QGZ A;  1I8D A;  4Y9U A;  3Q6Q A;  1W34 A;  4MYT A;  3CC4 B;  4R71 A;  4ROX A;  4RD2 A;  3RY8 A;  1VQM B;  1W87 A;  4P6Y A;  1FNM A;  4YAL A;  5IK2 A;  3CCL B;  4TMV A;  5BSY A;  4QFM A;  4L8J A;  2W6J A;  2XZO A;  5FO0 A;  2V7U A;  4X05 A;  4Z4R A;  1EP1 B;  3MCA A;  2V7X A;  2DEU A;  3B8H A;  2EFG A;  4J0Q A;  1GVH A;  3G71 B;  3A35 A;  2XNJ A;  3JQP A;  1VQN B;  2OK7 A;  4XQF A;  1VLY A;  4XN0 A;  4P3Y A;  2CRV A;  4DK0 A;  2P3M A;  2CC2 A;  3NE5 B;  2D3L A;  4C43 A;  2VNH A;  4TSF A;  3SLN A;  1SM4 A;  4XKV A;  1OGI A;  1ZM4 A;  3CPW B;  4OPO A;  3SEJ A;  3SJZ A;  3H9N A;  4TMW A;  1VQP B;  2YWH A;  2RC5 A;  1T5E A;  1QVF B;  4Z4S A;  4RD0 A;  2M5S A;  1AIP A;  2DOG A;  1UMK A;  1J9Z A;  2ZXH A;  3BH4 A;  3GVK A;  4M2L A;  4PGO A;  5GV7 A;  3W5H A;  3WNC A;  5KSW B;  4RD4 A;  2BVN A;  3A8K A;  5F4J A;  3D26 A;  1RQR A;  2AHO A;  2B7C A;  4ACB A;  1COW A;  2C78 A;  2BGI A;  4DK1 A;  5AN9 A;  2HMA A;  2F43 A;  5H5J A;  1MRZ A;  1V0F A;  5IYR A;  3CCJ B;  2ZZE A;  5F4O A;  1RQP A;  3CP2 A;  3OEH A;  2F1M A;  3W2E A;  3PEN A;  3BQJ A;  1K9M D;  4P1V A;  1GAQ A;  1D1N A;  1Y0R A;  3SLD A;  2XNC A;  2RC6 A;  4P26 A;  1QH0 A;  3PA1 A;  4B4D A;  3J81 k;  1Q86 D;  1BMF A;  3PVD A;  5TV2 A;  3CCQ B;  2HCJ B;  1R5N A;  1EFU A;  1PJ7 A;  2OTL B;  2ZTG A;  1E3Z A;  1WTH D;  2FX3 A;  2QTZ A;  1WOO A;  3ASQ A;  4RPB A;  5B6I A;  1KJZ A;  4RLZ A;  1YI2 B;  5F4M A;  4P12 A;  1WPC A;  3KEW A;  3ZC3 A;  3ZIA A;  1E43 A;  3CPX A;  2BSA A;  3OPO A;  1N08 A;  2OBT A;  4PC7 A;  4QV2 A;  3AVX A;  2CND A;  2YWF A;  1QFJ A;  4XNF A;  3OAA A;  2X0K A;  4UZE A;  3ZZT A;  1Q7Y D;  3LQ6 A;  1G7R A;  5IYW A;  3ISX A;  2C5B A;  2GJK A;  2V7Q A;  4X8I A;  5EMN A;  4G6I A;  1BJK A;  1KK0 A;  3U6K A;  4OP7 A;  4DNT B;  3CRZ A;  3FJO A;  2QE7 A;  1N0U A;  4Y9R A;  2QMU A;  2V31 A;  3CC2 B;  1A8P A;  1GAW A;  4AF7 A;  3B78 A;  5E6T A;  1KRH A;  1YJW B;  4TN1 A;  1H8H A;  3GQB A;  2V4D A;  4DQK A;  2XOK A;  1EFT A;  2X85 A;  1PJ5 A;  1EFR A;  3A3G A;  5IYN A;  5DS0 A;  3OW7 A;  1U2R A;  2LZJ A;  1NDH A;  3CCR B;  3CD6 B;  2X6W A;  3OFN A;  1OB2 A;  4G1B A;  1VQL B;  2Q6I A;  4H9G A;  3U2Q A;  1H8E A;  1WU8 A;  2ZBV A;  1S0U A;  4XOR A;  3W2I A;  3PUN A;  3Q38 A;  3QFR A;  1VQK B;  2VNJ A;  1XE1 A;  4X7E A;  1VQ5 B;  1T6X A;  4PAB A;  1E64 A;  2VYQ A;  5TY0 A;  2NPF A;  2HLD A;  4M4S A;  4UAJ A;  3W5U A;  4X06 A;  1KQS B;  2C77 A;  4AVZ A;  3A1P A;  1VQ8 B;  1F20 A;  1QGY A;  1JB9 A;  2PIA A;  4WZT A;  4Z4W A;  1TLL A;  1BX1 A;  1VHO A;  3Q39 A;  2VZL A;  4TMT A;  3T51 B;  3SJP A;  3DDY A;  3H94 A;  1YHQ B;  2XND A;  4P25 A;  4XLC A;  3A3B A;  5HKK A;  3BY2 A;  2C4U A;  1D8T A;  3CTA A;  3GIR A;  3CME B;  3CMA B;  1YJ9 B;  2YWE A;  2E1B A;  4FXU A;  4FK8 A;  3ZBU A;  3OZU A;  3OEE A;  1Q81 D;  1CNF A;  1ZM9 A;  4AF6 A;  4CQJ A;  4M53 A;  1E1R A;  4YAW A;  1TTT A;  4LBW A;  2WR8 A;  3G4S B;  3W2H A;  2Q6O A;  3A8I A;  3W2G A;  1B2R A;  4WWV A;  3VNU A;  2B7B A;  1DDG A;  4KKU A;  1YLO A;  3OOC A;  4Y7C A;  1E63 A;  3QFT A;  5A89 A;  2JDI A;  4LBV A;  3VNV A;  5A88 A;  4OOV A;  4YEJ A;  4Z1M A;  4YXW A;  1ELO A;  2GJR A;  3FPP A;  5GV8 A;  3WXM A;  1D2E A;  2NV4 A;  1R5B A;  1FND A;  1WOR A;  3LO8 A;  2D9R A;  4QHY A;  4XKW A;  5FA6 A;  5THX A;  1N0V C;  4ZGN B;  2Q6K A;  3MHP A;  5FNZ A;  1YIT B;  1M1K D;  3PUM A;  1B23 P;  5HZA A;  1DG1 G;  4OOS A;  4HE6 A;  1N06 A;  1QX4 A;  4XR6 A;  2CF4 A;  4Z4U A;  2B5O A;  1V0E A;  1W0J A;  1OB0 A;  2I1L A;  4X7C A;  4YEL A;  2ZBU A;  1I7P A;  1UD6 A;  1W0K A;  4LC0 A;  2GRE A;  4OOX A;  4II2 A;  1FDR A;  4G1V A;  3ES9 A;  5IYP A;  5DSZ A;  3CB4 A;  3R6J A;  4AC9 A;  1QG0 A;  3I1F A;  1EXM A;  4WZE A;  3R6K A;  2WZP P;  1R5O A;  1EWY A;  5FO1 A;  2VBV A;  4WZK A;  2C2W A;  1VLO A;  2D74 A;  4GQN A;  3ZZ0 A;  1GO2 A;  2DET A;  1FRN A;  1M90 D;  2FVG A;  1VQO B;  1BX0 A;  2Q6L A;  2GQF A;  5HZB A;  1P4M A;  1DAR A;  4RM0 A;  4C0S A;  2XZL A;  3QFS A;  3QE2 A;  1UD8 A;  3WYA A;  3W2F A;  4B3F X;  1YJN B;  1N8R D;  3AVT A;  1CQX A;  1WDT A;  4B3X A;  1UD3 A;  1G7S A;  4TMX A;  3LQE A;  1DDI A;  1SKQ A;  1YX2 A;  5JBQ A;  1EP3 B;  4XD7 A;  2YWG A;  4XM3 A;  4TKO B;  4PAA A;  2V7V A;  3CCM B;  2KVO A;  2W6I A;  3CES A;  2F4N A;  3CP8 A;  4ZV4 A;  5CDF A;  4YAO A;  1W2B B;  4E0F A;  4PC6 A;  5LMZ A;  2VNK A;  4ZCM A;  3ZBT A;  4YAF A;  1NJI D;  3FPK A;  2XEX A;  1HVX A;  3CXC B;  2JN9 A;  2DYI A;  1WOP A;  1H42 A;  4M1K A;  4PC3 A;  2ZL6 A;  3BY1 A;  3AVU A;  3G6E B;  1CNE A;  2R6H A;  2C4T A;  1KTV A;  1H85 A;  1OHH A;  4YHB A;  3T56 B;  4U9U A;  3V76 A;  3I56 B;  4B47 A;  1VQ7 B;  5TR9 A;  1KZL A;  2VBU A;  4F7D A;  3G05 A;  1Q82 D;  2EIX A;  3GVJ A;  1ZM2 A;  4RDL A;  1VF7 A;  3VMF A;  2WYR A;  1E62 A;  1EFC A;  1W9X A;  1HA3 A;  2F1L A;  4KKT A;  5BSX A;  2ZZQ A;  5FIU A;  1FX0 A;  4RD1 A;  2BPO A;  1KMH A;  4UZU A;  3ZUG A;  1NB9 A;  1XB2 A;  2OBS A;  2WSS A;  4G5G A;  4WQM A;  1K73 D;  3GVL A;  2ZXI A;  1WOS A;  4OPS A;  1AMO A;  2J7K A;  1FRQ A;  1E79 A;  4ZGQ B;  3QSY A;  1ZUN B;  3OZW A;  1W35 A;  4N3N A;  4XON A;  2QEX B;  2GPJ A;  3ASR A;  1KC8 D;  5HXB A;  3JQR A;  2JJ2 A;  4EH1 A;  5IYQ A;  3WY9 A;  2X3U A;  1BPL A;  2WZN A;  4ACA A;  1YIJ B;  2ZIT A;  4ZCL A;  3WBJ A;  3HAG A;  4TMZ A;  1WP6 A;  5KW9 A;  3OE7 A;  1SKY B;  4QVA A;  3CMM A;  4RPD A;  5TRD A;  4IW3 B;  3VO1 A;  4DNR B;  1IB0 A;  3ZZU A;  3OW2 B;  3GSI A;  4XOP A;  2D3N A;  3ASS A;  3ASP A;  2JIZ A;  2QA4 B;  3W5V A;  3JU4 A;  1S72 B;  4X07 A;  2BM0 A;  4XOT A;  3MMP A;  1G7C A;  1OGJ A;  2WJY A;  5DN6 A;  1JNY A;  3OJX A;  1N05 A;  4G7X A;  4PC2 A;  1OB5 A;  1K28 D;  4UZF A;  1FNC A;  4RDJ A;  4JMQ A;  4Z4V A;  1V5V A;  2Z6B D;  2V7W A;  4LBZ A;  3V7A A;  2X53 S;  4RDK A;  2VBS A;  4RD6 A;  2PLF A;  2OTJ B;  4QUZ A;  1QFZ A;  2ZTN A;  2WJV A;  2CK3 A;  1IJE A;  1QUF A;  2GK6 A;  3OJW A;  3A8J A;  4P22 A;  2DER A;  2BF4 A;  4N3G A;  4PC1 A;  4K1X A;  1GR1 A;  2ZL5 A;  5J3O A;  3Q6R A;  4RCZ A;  1N07 A;  2ZZF A;  4KKS A;  4LBY A;  4QVJ A;  1VQ6 B;  4B43 A;  1PKV A;  3PA2 A;  2DIE A;  4RCY A;  3SKB A;  2PE3 A;  1VHE A;  1QVG B;  2XZP A;  4X7F A;  3T53 B;  2X8K A;  2QDX A;  1ZM3 A;  3KL9 A;  4B44 A;  5J35 A;  4OPV A;  1FNB A;  1UD2 A;  4II3 A;  1KK1 A;  4Z4Y A;  1NRK A;  2JJ1 A;  2BM1 A;  2OBR A;  3E1Y E;  4Q7J B;  3I55 B;  1TUI A;  2DCU A;  1S4M A;  3BCF A;  4XL9 A;  4DQL A;  2VBT A;  3P27 A;  4HIZ A;  3AVV A;  1UD5 A;  1E1Q A;  1NBM A;  2VJJ A;  1JA1 A;  2X6Y A;  3BC9 A;  3OKX A;  2PMD A;  3AVY A;  3ZPN A;  5KNL A;  3AGQ A;  2BN4 A;  2HDN B;  2VJI A;  2ZL7 A;  1JJ2 B;  3AGP A;  3CW2 A;  1VQ4 B;  2OK8 A;  4XLF A;  4XMY A;  3CCE B;  4XN3 A;  3BNW A;  2QTL A;  1QFY A;  1VJS A;  4P6V F;  5A8A A;  4B48 A;  1HZE A;  1I18 A;  2CW5 A;  1PJ6 A;  3OP1 A;  1EP2 B;  3WND A;  4P3I A;  2C5H A;  3CCS B;  4X7D A;  2DY1 A;  1BLI A;  1Y0Y A;  1KK2 A;  1NB0 A;  3BCD A;  3B82 A;  2QN6 A;  2GJP A;  1T6Z A;  4RJL A;  3WBK A;  4WZL A;  4Z4Z A;  4YAU A;  1MAB A;  3ONU A;  2BMW A;  1QGA A;  4BPR A;  4HE5 A;  4XLE A;  2VNI A;  2E1R A;  3WQZ A;  5L46 A;  1BQE A;  1VQ9 B;  2CBX A;  4FWT A;  5H59 A;  2XGJ A;  4ASU A;  5FL7 A;  1TVC A;  3VR6 A;  4NBS A;  3CCU B;  4MYU A;  3JQQ A;  3VO2 A;  3CCV B;  2BV3 A;  1K8A D;  1IJF A;  3Q3A A;  3OZV A;  4P2N A;  4FN5 A;  2BGJ A;  3LNN A;  1F60 A;  1KK3 A;  2QGG A;  1XQB A;  1GJR A;  2ZZG A;  1UD4 A;  4XLA A;  3CC7 B;  3LVB A;  4RD3 A;  4M0L A;  1KD1 D; 
#chains in the Genus database with same CATH homology
 3R6K A;  4X0C A;  4WZK A;  3ONY A;  1IHM A;  5E6T A;  4Z4T A;  5HZB A;  4RM0 A;  4RDJ A;  4Z4V A;  3V7A A;  4RDK A;  5IYN A;  3AST A;  4QUZ A;  3LQE A;  3Q6Q A;  5J3O A;  2ZL5 A;  3Q6R A;  4ROX A;  3RY8 A;  4QVJ A;  5BSY A;  3PUN A;  3Q38 A;  4X7E A;  3PA2 A;  3SKB A;  4X05 A;  4X7F A;  4Z4R A;  4X06 A;  5J35 A;  4OPV A;  4Z4Y A;  4WZT A;  4Z4W A;  3Q39 A;  2OBR A;  3SJP A;  3SLN A;  4OPO A;  4P25 A;  3SEJ A;  3BY2 A;  2ZL6 A;  3BY1 A;  4Z4S A;  2ZL7 A;  5F4J A;  3D26 A;  4RDL A;  4P3I A;  4X7D A;  5IYR A;  5F4O A;  5BSX A;  3BQJ A;  4P1V A;  4WZL A;  3SLD A;  4Z4Z A;  4P26 A;  2OBS A;  3PA1 A;  3ONU A;  3PVD A;  4OOV A;  4OPS A;  3ASQ A;  4RPB A;  4RLZ A;  5F4M A;  3ASR A;  4P12 A;  3PUM A;  5IYQ A;  5HZA A;  2OBT A;  3Q3A A;  4OOS A;  4QV2 A;  4P2N A;  4Z4U A;  5KW9 A;  4QVA A;  4RPD A;  4X7C A;  4OOX A;  3LQ6 A;  5IYW A;  3ASS A;  3ASP A;  5IYP A;  3R6J A;  4X07 A;  4OP7 A;  4WZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...