4Z4TA

Crystal structure of gii.10 p domain in complex with 75mm fucose
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
314
structure length
311
Chain Sequence
b'KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTVGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 71
structure length 311
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4tA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4tA01
4X7CA 3ASTA 3R6JA 4Z4VA 4RDJA 4QV2A 3PUNA 4P1VA 4Z4YA 3Q3AA 4X7DA 5IYPA 5IYNA 4ROXA 4X0CA 3SKBA 4OPVA 3SLNA 5J35A 4OOVA 4QVAA 4Z4RA 5F4OA 5F4JA 4Z4WA 4OPSA 4RM0A 4RLZA 4P25A 5IYQA 3PVDA 3SLDA 5BSYA 5IYWA 4WZKA 5HZAA 3Q39A 4WZEA 3Q6QA 3BQJA 2ZL7A 4OPOA 4Z4SA 3Q38A 2OBSA 3RY8A 4QVJA 4Z4TA 3BY1A 4OOSA 4X06A 4Z4UA 3SEJA 3SJPA 2ZL5A 3R6KA 5BSXA 3Q6RA 3V7AA 5J3OA 4Z4ZA 1IHMA 4X7FA 3BY2A 3ASQA 4P12A 4X7EA 3ASPA 4RDKA 3PA1A 4P2NA 4OOXA 4WZTA 3D26A 3ASRA 4X05A 4RPBA 4X07A 3LQEA 5F4MA 4OP7A 3PA2A 4P26A 2OBTA 2ZL6A 3ONYA 5IYRA 5E6TA 5HZBA 3LQ6A 3ASSA 4WZLA 4QUZA 4RPDA 2OBRA 5KW9A 3ONUA 3PUMA 4P3IA 4RDLA
chains in the Genus database with same CATH superfamily
3LO8A 4FXUA 1VQMB 3T56B 3CP2A 3ZBTA 4Z4VA 4PC1A 4RDJA 2XZPA 3CMEB 4AF6A 1QGZA 2B7BA 1Y0YA 4YAFA 1VQKB 4XR6A 2HLDA 4XKWA 1EXMA 2XOKA 1EWYA 5THXA 3WNCA 1QUEA 1YITB 3JQRA 3FKSA 1WP6A 4AC9A 1V0EA 3QFCA 1PKVA 3BCDA 1E62A 2EIXA 4DNRB 1T5EA 2YWEA 2PLFA 3JQQA 5B6IA 1K9MD 3B8HA 4RD3A 1W34A 1F60A 3E1YE 3LVBA 2CC2A 3SLNA 1FNMA 4FWTA 1EP3B 1WOPA 4JMQA 2XZLA 3DDYA 3CTAA 3P26A 5HXBA 5F4JA 2JN9A 1OGIA 5H5JA 1R5BA 3B82A 4TKOB 3G05A 1AMOA 1BLIA 5EMNA 3WY9A 5IYQA 1B2RA 3QFTA 4XLAA 1VJSA 2X0KA 1PJ6A 3OZUA 4ZGQB 5BSYA 4RD1A 4Y9UA 4PC6A 4WZKA 1YI2B 2QEXB 1VQPB 1QGAA 1S4MA 1S0UA 4DQKA 4G5GA 1N0UA 1SM4A 4ASUA 1R5OA 5TRDA 2JDIA 1KD1D 3WQZA 1K28D 2PIAA 2DETA 4OPOA 3VNVA 3QFRA 3Q38A 1K73D 2OBSA 3RY8A 1WOSA 4WQMA 4B47A 4HE6A 4P3YA 3WYAA 2VNHA 4RCYA 4IW3B 2BV3A 4B3XA 4Z4UA 4PC7A 3SEJA 2YWGA 1KMHA 2V7TA 4M53A 3VO2A 2WR8A 4PGOA 1IHMA 4G1BA 2KVOA 3CPXA 4P12A 1T6ZA 4XOPA 4RDKA 3GIRA 3ZZUA 3CCRB 1VLOA 5A89A 2HDNB 5IK2A 4OOXA 4WZTA 1FX0A 1JJ2B 5FO0A 4X07A 1W9XA 5F4MA 4P26A 1N08A 5A88A 2OBTA 3CMMA 2ZZEA 3KL9A 2BMWA 5IYRA 1TVCA 2LZJA 1I18A 5DSZA 3WBKA 3A8KA 2BGJA 1XQBA 4QUZA 5DN6A 4YXWA 4RD2A 2W6JA 1KK0A 1T6XA 3VNUA 1KJZA 5JBQA 3OW2B 4ZGNB 2C5BA 3PENA 1PJ5A 2OYNA 4M0LA 2C4UA 1WPCA 4P3IA 4C0SA 3A8IA 3AVVA 3CXCB 1NB9A 2CK3A 3G71B 1N05A 2C2WA 2HCJB 2J7KA 2XNCA 4TMXA 2ZITA 2RC5A 2X6YA 1DARA 5A8AA 1EFCA 2GJKA 3QE2A 1I8DA 3PUNA 1UD4A 1R5NA 2BF4A 2PMDA 2YWHA 4LC0A 4RDLA 2Z6BD 1FRNA 4QHYA 3W5UA 4KKUA 1VQ9B 1VQ7B 1WSVA 3E20A 4X7DA 3AVXA 2WJYA 2XNDA 2JJ2A 5TR9A 1V0FA 4RD0A 2D3LA 2R9VA 2WZPP 2DY1A 3CRZA 3GQBA 3ZUGA 4OOVA 3T53B 2BPOA 1QFZA 5F4OA 1H85A 3CPWB 3ZZTA 4Y7CA 2XGJA 4M1KA 3MCAA 4NNJA 1G7SA 3AGQA 3BNWA 4OPSA 2GREA 1UMKA 4RM0A 4Q7JB 1E1QA 1F20A 1V5VA 2V7VA 3ES9A 3PVDA 5TV2A 4DQLA 1VF7A 4B3GA 2W6IA 1VQ5B 2DEUA 2BGIA 2WYRA 1E3XA 2VBSA 2QE7A 3BCFA 3CCSB 1KK3A 2WZNA 2CBXA 2ZTNA 3CCEB 2ZZFA 1W0KA 2OTJB 3W2EA 3Q39A 3W2IA 1KC8D 1SKQA 2VBVA 1QVGB 2V7XA 1IJFA 3FPKA 4X8IA 1YIJB 1KTVA 2GPJA 3QFSA 1N06A 1VLYA 4MYUA 4DK1A 4Z4SA 2X85A 2C4TA 3CB4A 2E1BA 1UD2A 3AVTA 3ISXA 1YHQB 1SKYB 3H94A 1VHEA 2RC6A 5L46A 1FNCA 3ZZ0A 4WWVA 5GV7A 2ZL5A 1XB2A 4B44A 4XQFA 3OKXA 5BSXA 1N07A 3AVWA 1BPLA 4BPRA 1W87A 2C78A 3BY2A 2CNDA 2VZLA 4TMZA 4XM3A 4AVZA 1G7CA 1JA1A 3CCLB 3ZC3A 1FDRA 3OP1A 3JQPA 1MABA 1K8AD 2F43A 1ZM3A 1CNFA 1ZM9A 1G7TA 3WNBA 3A3GA 3LQEA 3OAAA 2HMAA 1WORA 3VMFA 1UD5A 1DG1G 4XNFA 2BM0A 5GV8A 3U6KA 3G4SB 3LQ6A 3ASSA 2ZZGA 4Z1MA 1XFOA 2CF4A 1GO2A 4UZEA 4KKSA 1TLLA 4WZLA 3W2HA 3CMAB 3CD6B 1M1KD 2GK7A 1YJWB 3GSIA 2OTLB 2FVGA 4XONA 4P22A 1D1NA 3T51B 4M2LA 4DK0A 1Q9SA 2R6HA 2BSAA 5KW9A 1EP1B 3MMPA 3J81k 1H8HA 4B4DA 1BX1A 2AHOA 3H9NA 1HA3A 2D9RA 4X7CA 1S72B 1DDIA 2EFGA 1NB0A 3HAGA 4G7XA 3R6JA 1W2BB 1GVHA 3ZIAA 3LNNA 4C43A 1YJ9B 3WXMA 4XLFA 3VR6A 1UD8A 4GQNA 4QV2A 1E63A 1KK1A 4YELA 4II2A 2PE3A 2QDXA 1EP2B 3Q3AA 4XD7A 3SJZA 3OEEA 2XEXA 3FJOA 5TY0A 1GAWA 2F1MA 1QFJA 3OE7A 4UZUA 4LBZA 1H42A 4XOTA 4ZCMA 5IYPA 5IYNA 4ROXA 3SKBA 3OEHA 1BX0A 1EFRA 1D8TA 3W5HA 4B43A 4OPVA 1YJNB 2XZOA 2VNKA 3CCQB 2QMUA 4QVAA 4Z4RA 4R71A 5AN9A 1OHHA 3U2QA 2C5HA 2CRVA 1ZUNB 2E1RA 3A1PA 4M4SA 1P4MA 2YWFA 5FIUA 2ZBVA 3A8JA 4ZV4A 3SLDA 1GJRA 2CW5A 2ZXIA 1QH0A 3I1FA 2WPDA 5HZAA 1VHOA 2X53S 1QGYA 4NCNA 4WZEA 2FX3A 4EH1A 2VJIA 3G6EB 3CW2A 3BQJA 1B23P 2GJRA 3P27A 2ZZQA 4B3FX 1BMFA 3OJXA 2ZL7A 4TT3A 1COWA 1KZLA 1E64A 5CDFA 4LBVA 4QVJA 4DNTB 1H8EA 1WU8A 1JA0A 4N3GA 3OZWA 4RCZA 2B7CA 2P3MA 2X3UA 1UD6A 2DCUA 3ZBUA 3SJPA 3W2GA 4ZCLA 3Q6RA 3V7AA 1E79A 1RQPA 4E0FA 4Z4ZA 4YAOA 1VQNB 4P6VF 1J9ZA 4YHBA 1KRHA 1XE1A 3ASQA 4X7EA 3W5VA 2V7WA 1VQ6B 1IJEA 2DYIA 4G1VA 4TSFA 1NJID 1WDTA 4XN0A 5FNZA 3A35A 1AIPA 4P2NA 2D74A 1TTTA 3D26A 3CCVB 4X05A 3CCUB 4XMYA 1Q86D 2XNJA 2QN6A 5KSWB 4RLZA 3QSYA 2JJ1A 4II3A 3ONYA 4P6YA 1ELOA 1N0VC 1GR1A 5HZBA 4F7DA 4P9SA 2DOGA 4PC3A 4XN3A 1HZEA 4LBYA 1Y0RA 2WJVA 5HKKA 2DERA 2F1LA 2X8KA 4RPDA 2WSSA 4G7WA 4XLEA 2VNJA 1KK2A 1E1RA 2OK8A 4H9GA 2F4NA 2NPFA 2GJPA 2NV4A 3CCMB 4YAWA 1T6YA 3CC7B 4HE5A 2ZXHA 3PUMA 3CP8A 2Q6LA 4YEJA 4FK8A 3ASTA 4XKVA 1VQOB 2X6XA 5LMZA 1OB0A 5FO1A 4ZCIA 4L8JA 3I55B 4PABA 1QX4A 2V7QA 2Q6KA 1MRZA 4P1VA 1GAQA 4Z4YA 4XL9A 2M5SA 1M90D 3U6BA 1N8RD 4K1XA 1TUIA 2V31A 4PC2A 4TN1A 2VYQA 2QA4B 1D2EA 4XLCA 3GVJA 4UAJA 4RJLA 4J0QA 1RQRA 4X0CA 1KQSB 1JB9A 2C77A 1VQ4B 2VNIA 4LBWA 5J35A 1WOOA 4MYTA 2OK7A 1A8PA 1YLOA 2V4DA 1G7RA 1BJKA 2VJJA 1ZM2A 1PJ7A 3VO1A 1QFYA 4Z4WA 3CC4B 1WTHD 2X6WA 2QGGA 3OZVA 1W35A 4NBSA 1EFTA 4P25A 1DDGA 4TMVA 3NE5B 4UZFA 5H59A 3A3BA 1CNEA 2ZTGA 3CESA 2VBUA 4RD4A 3MHPA 4QFMA 1E43A 2QTLA 3WNDA 5IYWA 3AVUA 3JU4A 4RD6A 1Q81D 3Q6QA 1BQEA 1EFUA 1YX2A 1W0JA 4XLHA 1OB5A 3CC2B 2DIEA 1HVXA 4XORA 1JNYA 4Z4TA 2ZBUA 2JIZA 2I1LA 3GVKA 1NBMA 3BY1A 4OOSA 4X06A 1IB0A 1Q82D 2B5OA 3AGPA 3R6KA 4YALA 1I7PA 5J3OA 1FNDA 4FN5A 4X7FA 5FL7A 3WBJA 1QUFA 4TMWA 4ACAA 1FNBA 3ASPA 3BC9A 2V7UA 4HIZA 1UD3A 3PA1A 3W2FA 3CCJB 4AF7A 1FRQA 2BM1A 3BH4A 2BVNA 1VQLB 2VBTA 2Q6IA 1ZM4A 4PAAA 1NDHA 3I56B 1VQ8B 3OJWA 5DS0A 1CQXA 3ASRA 4ACBA 3KEWA 4RPBA 2QTZA 4OP7A 2GQFA 3PA2A 4CQJA 3ZPNA 2Q6OA 2ZL6A 4YAUA 1OB2A 1E3ZA 4B48A 3AVYA 1OGJA 5E6TA 2GK6A 1NRKA 5FA6A 4N3NA 4TMTA 2D3NA 4Y9RA 4U9UA 3GVLA 4KKTA 1Q7YD 3FPPA 3OFNA 2OBRA 1U2RA 3B78A 5KNLA 3V76A 3OOCA 1QVFB 3OPOA 3ONUA 4G6IA 3OW7A 2BN4A 1QG0A 1WSRA
chains in the Genus database with same CATH topology
4X7CA 3ASTA 3R6JA 4Z4VA 4RDJA 4QV2A 3PUNA 4P1VA 4Z4YA 3Q3AA 4X7DA 5IYPA 5IYNA 4ROXA 4X0CA 3SKBA 4OPVA 3SLNA 5J35A 4OOVA 4QVAA 4Z4RA 5F4OA 5F4JA 4Z4WA 4OPSA 4RM0A 4RLZA 4P25A 5IYQA 3PVDA 3SLDA 5BSYA 5IYWA 4WZKA 5HZAA 3Q39A 4WZEA 3Q6QA 3BQJA 2ZL7A 4OPOA 4Z4SA 3Q38A 2OBSA 3RY8A 4QVJA 4Z4TA 3BY1A 4OOSA 4X06A 4Z4UA 3SEJA 3SJPA 2ZL5A 3R6KA 5BSXA 3Q6RA 3V7AA 5J3OA 4Z4ZA 1IHMA 4X7FA 3BY2A 3ASQA 4P12A 4X7EA 3ASPA 4RDKA 3PA1A 4P2NA 4OOXA 4WZTA 3D26A 3ASRA 4X05A 4RPBA 4X07A 3LQEA 5F4MA 4OP7A 3PA2A 4P26A 2OBTA 2ZL6A 3ONYA 5IYRA 5E6TA 5HZBA 3LQ6A 3ASSA 4WZLA 4QUZA 4RPDA 2OBRA 5KW9A 3ONUA 3PUMA 4P3IA 4RDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X7C A;  3AST A;  3R6J A;  4Z4V A;  4RDJ A;  4QV2 A;  3PUN A;  4P1V A;  4Z4Y A;  3Q3A A;  4X7D A;  5IYP A;  5IYN A;  4ROX A;  4X0C A;  3SKB A;  4OPV A;  3SLN A;  5J35 A;  4OOV A;  4QVA A;  4Z4R A;  5F4O A;  5F4J A;  4Z4W A;  4OPS A;  4RM0 A;  4RLZ A;  4P25 A;  5IYQ A;  3PVD A;  3SLD A;  5BSY A;  5IYW A;  4WZK A;  5HZA A;  3Q39 A;  4WZE A;  3Q6Q A;  3BQJ A;  2ZL7 A;  4OPO A;  4Z4S A;  3Q38 A;  2OBS A;  3RY8 A;  4QVJ A;  4Z4T A;  3BY1 A;  4OOS A;  4X06 A;  4Z4U A;  3SEJ A;  3SJP A;  2ZL5 A;  3R6K A;  5BSX A;  3Q6R A;  3V7A A;  5J3O A;  4Z4Z A;  1IHM A;  4X7F A;  3BY2 A;  3ASQ A;  4P12 A;  4X7E A;  3ASP A;  4RDK A;  3PA1 A;  4P2N A;  4OOX A;  4WZT A;  3D26 A;  3ASR A;  4X05 A;  4RPB A;  4X07 A;  3LQE A;  5F4M A;  4OP7 A;  3PA2 A;  4P26 A;  2OBT A;  2ZL6 A;  3ONY A;  5IYR A;  5E6T A;  5HZB A;  3LQ6 A;  3ASS A;  4WZL A;  4QUZ A;  4RPD A;  2OBR A;  5KW9 A;  3ONU A;  3PUM A;  4P3I A;  4RDL A; 
#chains in the Genus database with same CATH topology
 3LO8 A;  4FXU A;  1VQM B;  3T56 B;  3CP2 A;  3ZBT A;  4Z4V A;  4PC1 A;  4RDJ A;  2XZP A;  3CME B;  4AF6 A;  1QGZ A;  2B7B A;  1Y0Y A;  4YAF A;  1VQK B;  4XR6 A;  2HLD A;  4XKW A;  1EXM A;  2XOK A;  1EWY A;  5THX A;  3WNC A;  1QUE A;  1YIT B;  3JQR A;  3FKS A;  1WP6 A;  4AC9 A;  1V0E A;  3QFC A;  1PKV A;  3BCD A;  1E62 A;  2EIX A;  4DNR B;  1T5E A;  2YWE A;  2PLF A;  3JQQ A;  5B6I A;  1K9M D;  3B8H A;  4RD3 A;  1W34 A;  1F60 A;  3E1Y E;  3LVB A;  2CC2 A;  3SLN A;  1FNM A;  4FWT A;  1EP3 B;  1WOP A;  4JMQ A;  2XZL A;  3DDY A;  3CTA A;  3P26 A;  5HXB A;  5F4J A;  2JN9 A;  1OGI A;  5H5J A;  1R5B A;  3B82 A;  4TKO B;  3G05 A;  1AMO A;  1BLI A;  5EMN A;  3WY9 A;  5IYQ A;  1B2R A;  3QFT A;  4XLA A;  1VJS A;  2X0K A;  1PJ6 A;  3OZU A;  4ZGQ B;  5BSY A;  4RD1 A;  4Y9U A;  4PC6 A;  4WZK A;  1YI2 B;  2QEX B;  1VQP B;  1QGA A;  1S4M A;  1S0U A;  4DQK A;  4G5G A;  1N0U A;  1SM4 A;  4ASU A;  1R5O A;  5TRD A;  2JDI A;  1KD1 D;  3WQZ A;  1K28 D;  2PIA A;  2DET A;  4OPO A;  3VNV A;  3QFR A;  3Q38 A;  1K73 D;  2OBS A;  3RY8 A;  1WOS A;  4WQM A;  4B47 A;  4HE6 A;  4P3Y A;  3WYA A;  2VNH A;  4RCY A;  4IW3 B;  2BV3 A;  4B3X A;  4Z4U A;  4PC7 A;  3SEJ A;  2YWG A;  1KMH A;  2V7T A;  4M53 A;  3VO2 A;  2WR8 A;  4PGO A;  1IHM A;  4G1B A;  2KVO A;  3CPX A;  4P12 A;  1T6Z A;  4XOP A;  4RDK A;  3GIR A;  3ZZU A;  3CCR B;  1VLO A;  5A89 A;  2HDN B;  5IK2 A;  4OOX A;  4WZT A;  1FX0 A;  1JJ2 B;  5FO0 A;  4X07 A;  1W9X A;  5F4M A;  4P26 A;  1N08 A;  5A88 A;  2OBT A;  3CMM A;  2ZZE A;  3KL9 A;  2BMW A;  5IYR A;  1TVC A;  2LZJ A;  1I18 A;  5DSZ A;  3WBK A;  3A8K A;  2BGJ A;  1XQB A;  4QUZ A;  5DN6 A;  4YXW A;  4RD2 A;  2W6J A;  1KK0 A;  1T6X A;  3VNU A;  1KJZ A;  5JBQ A;  3OW2 B;  4ZGN B;  2C5B A;  3PEN A;  1PJ5 A;  2OYN A;  4M0L A;  2C4U A;  1WPC A;  4P3I A;  4C0S A;  3A8I A;  3AVV A;  3CXC B;  1NB9 A;  2CK3 A;  3G71 B;  1N05 A;  2C2W A;  2HCJ B;  2J7K A;  2XNC A;  4TMX A;  2ZIT A;  2RC5 A;  2X6Y A;  1DAR A;  5A8A A;  1EFC A;  2GJK A;  3QE2 A;  1I8D A;  3PUN A;  1UD4 A;  1R5N A;  2BF4 A;  2PMD A;  2YWH A;  4LC0 A;  4RDL A;  2Z6B D;  1FRN A;  4QHY A;  3W5U A;  4KKU A;  1VQ9 B;  1VQ7 B;  1WSV A;  3E20 A;  4X7D A;  3AVX A;  2WJY A;  2XND A;  2JJ2 A;  5TR9 A;  1V0F A;  4RD0 A;  2D3L A;  2R9V A;  2WZP P;  2DY1 A;  3CRZ A;  3GQB A;  3ZUG A;  4OOV A;  3T53 B;  2BPO A;  1QFZ A;  5F4O A;  1H85 A;  3CPW B;  3ZZT A;  4Y7C A;  2XGJ A;  4M1K A;  3MCA A;  4NNJ A;  1G7S A;  3AGQ A;  3BNW A;  4OPS A;  2GRE A;  1UMK A;  4RM0 A;  4Q7J B;  1E1Q A;  1F20 A;  1V5V A;  2V7V A;  3ES9 A;  3PVD A;  5TV2 A;  4DQL A;  1VF7 A;  4B3G A;  2W6I A;  1VQ5 B;  2DEU A;  2BGI A;  2WYR A;  1E3X A;  2VBS A;  2QE7 A;  3BCF A;  3CCS B;  1KK3 A;  2WZN A;  2CBX A;  2ZTN A;  3CCE B;  2ZZF A;  1W0K A;  2OTJ B;  3W2E A;  3Q39 A;  3W2I A;  1KC8 D;  1SKQ A;  2VBV A;  1QVG B;  2V7X A;  1IJF A;  3FPK A;  4X8I A;  1YIJ B;  1KTV A;  2GPJ A;  3QFS A;  1N06 A;  1VLY A;  4MYU A;  4DK1 A;  4Z4S A;  2X85 A;  2C4T A;  3CB4 A;  2E1B A;  1UD2 A;  3AVT A;  3ISX A;  1YHQ B;  1SKY B;  3H94 A;  1VHE A;  2RC6 A;  5L46 A;  1FNC A;  3ZZ0 A;  4WWV A;  5GV7 A;  2ZL5 A;  1XB2 A;  4B44 A;  4XQF A;  3OKX A;  5BSX A;  1N07 A;  3AVW A;  1BPL A;  4BPR A;  1W87 A;  2C78 A;  3BY2 A;  2CND A;  2VZL A;  4TMZ A;  4XM3 A;  4AVZ A;  1G7C A;  1JA1 A;  3CCL B;  3ZC3 A;  1FDR A;  3OP1 A;  3JQP A;  1MAB A;  1K8A D;  2F43 A;  1ZM3 A;  1CNF A;  1ZM9 A;  1G7T A;  3WNB A;  3A3G A;  3LQE A;  3OAA A;  2HMA A;  1WOR A;  3VMF A;  1UD5 A;  1DG1 G;  4XNF A;  2BM0 A;  5GV8 A;  3U6K A;  3G4S B;  3LQ6 A;  3ASS A;  2ZZG A;  4Z1M A;  1XFO A;  2CF4 A;  1GO2 A;  4UZE A;  4KKS A;  1TLL A;  4WZL A;  3W2H A;  3CMA B;  3CD6 B;  1M1K D;  2GK7 A;  1YJW B;  3GSI A;  2OTL B;  2FVG A;  4XON A;  4P22 A;  1D1N A;  3T51 B;  4M2L A;  4DK0 A;  1Q9S A;  2R6H A;  2BSA A;  5KW9 A;  1EP1 B;  3MMP A;  3J81 k;  1H8H A;  4B4D A;  1BX1 A;  2AHO A;  3H9N A;  1HA3 A;  2D9R A;  4X7C A;  1S72 B;  1DDI A;  2EFG A;  1NB0 A;  3HAG A;  4G7X A;  3R6J A;  1W2B B;  1GVH A;  3ZIA A;  3LNN A;  4C43 A;  1YJ9 B;  3WXM A;  4XLF A;  3VR6 A;  1UD8 A;  4GQN A;  4QV2 A;  1E63 A;  1KK1 A;  4YEL A;  4II2 A;  2PE3 A;  2QDX A;  1EP2 B;  3Q3A A;  4XD7 A;  3SJZ A;  3OEE A;  2XEX A;  3FJO A;  5TY0 A;  1GAW A;  2F1M A;  1QFJ A;  3OE7 A;  4UZU A;  4LBZ A;  1H42 A;  4XOT A;  4ZCM A;  5IYP A;  5IYN A;  4ROX A;  3SKB A;  3OEH A;  1BX0 A;  1EFR A;  1D8T A;  3W5H A;  4B43 A;  4OPV A;  1YJN B;  2XZO A;  2VNK A;  3CCQ B;  2QMU A;  4QVA A;  4Z4R A;  4R71 A;  5AN9 A;  1OHH A;  3U2Q A;  2C5H A;  2CRV A;  1ZUN B;  2E1R A;  3A1P A;  4M4S A;  1P4M A;  2YWF A;  5FIU A;  2ZBV A;  3A8J A;  4ZV4 A;  3SLD A;  1GJR A;  2CW5 A;  2ZXI A;  1QH0 A;  3I1F A;  2WPD A;  5HZA A;  1VHO A;  2X53 S;  1QGY A;  4NCN A;  4WZE A;  2FX3 A;  4EH1 A;  2VJI A;  3G6E B;  3CW2 A;  3BQJ A;  1B23 P;  2GJR A;  3P27 A;  2ZZQ A;  4B3F X;  1BMF A;  3OJX A;  2ZL7 A;  4TT3 A;  1COW A;  1KZL A;  1E64 A;  5CDF A;  4LBV A;  4QVJ A;  4DNT B;  1H8E A;  1WU8 A;  1JA0 A;  4N3G A;  3OZW A;  4RCZ A;  2B7C A;  2P3M A;  2X3U A;  1UD6 A;  2DCU A;  3ZBU A;  3SJP A;  3W2G A;  4ZCL A;  3Q6R A;  3V7A A;  1E79 A;  1RQP A;  4E0F A;  4Z4Z A;  4YAO A;  1VQN B;  4P6V F;  1J9Z A;  4YHB A;  1KRH A;  1XE1 A;  3ASQ A;  4X7E A;  3W5V A;  2V7W A;  1VQ6 B;  1IJE A;  2DYI A;  4G1V A;  4TSF A;  1NJI D;  1WDT A;  4XN0 A;  5FNZ A;  3A35 A;  1AIP A;  4P2N A;  2D74 A;  1TTT A;  3D26 A;  3CCV B;  4X05 A;  3CCU B;  4XMY A;  1Q86 D;  2XNJ A;  2QN6 A;  5KSW B;  4RLZ A;  3QSY A;  2JJ1 A;  4II3 A;  3ONY A;  4P6Y A;  1ELO A;  1N0V C;  1GR1 A;  5HZB A;  4F7D A;  4P9S A;  2DOG A;  4PC3 A;  4XN3 A;  1HZE A;  4LBY A;  1Y0R A;  2WJV A;  5HKK A;  2DER A;  2F1L A;  2X8K A;  4RPD A;  2WSS A;  4G7W A;  4XLE A;  2VNJ A;  1KK2 A;  1E1R A;  2OK8 A;  4H9G A;  2F4N A;  2NPF A;  2GJP A;  2NV4 A;  3CCM B;  4YAW A;  1T6Y A;  3CC7 B;  4HE5 A;  2ZXH A;  3PUM A;  3CP8 A;  2Q6L A;  4YEJ A;  4FK8 A;  3AST A;  4XKV A;  1VQO B;  2X6X A;  5LMZ A;  1OB0 A;  5FO1 A;  4ZCI A;  4L8J A;  3I55 B;  4PAB A;  1QX4 A;  2V7Q A;  2Q6K A;  1MRZ A;  4P1V A;  1GAQ A;  4Z4Y A;  4XL9 A;  2M5S A;  1M90 D;  3U6B A;  1N8R D;  4K1X A;  1TUI A;  2V31 A;  4PC2 A;  4TN1 A;  2VYQ A;  2QA4 B;  1D2E A;  4XLC A;  3GVJ A;  4UAJ A;  4RJL A;  4J0Q A;  1RQR A;  4X0C A;  1KQS B;  1JB9 A;  2C77 A;  1VQ4 B;  2VNI A;  4LBW A;  5J35 A;  1WOO A;  4MYT A;  2OK7 A;  1A8P A;  1YLO A;  2V4D A;  1G7R A;  1BJK A;  2VJJ A;  1ZM2 A;  1PJ7 A;  3VO1 A;  1QFY A;  4Z4W A;  3CC4 B;  1WTH D;  2X6W A;  2QGG A;  3OZV A;  1W35 A;  4NBS A;  1EFT A;  4P25 A;  1DDG A;  4TMV A;  3NE5 B;  4UZF A;  5H59 A;  3A3B A;  1CNE A;  2ZTG A;  3CES A;  2VBU A;  4RD4 A;  3MHP A;  4QFM A;  1E43 A;  2QTL A;  3WND A;  5IYW A;  3AVU A;  3JU4 A;  4RD6 A;  1Q81 D;  3Q6Q A;  1BQE A;  1EFU A;  1YX2 A;  1W0J A;  4XLH A;  1OB5 A;  3CC2 B;  2DIE A;  1HVX A;  4XOR A;  1JNY A;  4Z4T A;  2ZBU A;  2JIZ A;  2I1L A;  3GVK A;  1NBM A;  3BY1 A;  4OOS A;  4X06 A;  1IB0 A;  1Q82 D;  2B5O A;  3AGP A;  3R6K A;  4YAL A;  1I7P A;  5J3O A;  1FND A;  4FN5 A;  4X7F A;  5FL7 A;  3WBJ A;  1QUF A;  4TMW A;  4ACA A;  1FNB A;  3ASP A;  3BC9 A;  2V7U A;  4HIZ A;  1UD3 A;  3PA1 A;  3W2F A;  3CCJ B;  4AF7 A;  1FRQ A;  2BM1 A;  3BH4 A;  2BVN A;  1VQL B;  2VBT A;  2Q6I A;  1ZM4 A;  4PAA A;  1NDH A;  3I56 B;  1VQ8 B;  3OJW A;  5DS0 A;  1CQX A;  3ASR A;  4ACB A;  3KEW A;  4RPB A;  2QTZ A;  4OP7 A;  2GQF A;  3PA2 A;  4CQJ A;  3ZPN A;  2Q6O A;  2ZL6 A;  4YAU A;  1OB2 A;  1E3Z A;  4B48 A;  3AVY A;  1OGJ A;  5E6T A;  2GK6 A;  1NRK A;  5FA6 A;  4N3N A;  4TMT A;  2D3N A;  4Y9R A;  4U9U A;  3GVL A;  4KKT A;  1Q7Y D;  3FPP A;  3OFN A;  2OBR A;  1U2R A;  3B78 A;  5KNL A;  3V76 A;  3OOC A;  1QVF B;  3OPO A;  3ONU A;  4G6I A;  3OW7 A;  2BN4 A;  1QG0 A;  1WSR A; 
#chains in the Genus database with same CATH homology
 4X7C A;  3AST A;  3R6J A;  4Z4V A;  4RDJ A;  4QV2 A;  3PUN A;  4P1V A;  4Z4Y A;  3Q3A A;  4X7D A;  5IYP A;  5IYN A;  4ROX A;  4X0C A;  3SKB A;  4OPV A;  3SLN A;  5J35 A;  4OOV A;  4QVA A;  4Z4R A;  5F4O A;  5F4J A;  4Z4W A;  4OPS A;  4RM0 A;  4RLZ A;  4P25 A;  5IYQ A;  3PVD A;  3SLD A;  5BSY A;  5IYW A;  4WZK A;  5HZA A;  3Q39 A;  4WZE A;  3Q6Q A;  3BQJ A;  2ZL7 A;  4OPO A;  4Z4S A;  3Q38 A;  2OBS A;  3RY8 A;  4QVJ A;  4Z4T A;  3BY1 A;  4OOS A;  4X06 A;  4Z4U A;  3SEJ A;  3SJP A;  2ZL5 A;  3R6K A;  5BSX A;  3Q6R A;  3V7A A;  5J3O A;  4Z4Z A;  1IHM A;  4X7F A;  3BY2 A;  3ASQ A;  4P12 A;  4X7E A;  3ASP A;  4RDK A;  3PA1 A;  4P2N A;  4OOX A;  4WZT A;  3D26 A;  3ASR A;  4X05 A;  4RPB A;  4X07 A;  3LQE A;  5F4M A;  4OP7 A;  3PA2 A;  4P26 A;  2OBT A;  2ZL6 A;  3ONY A;  5IYR A;  5E6T A;  5HZB A;  3LQ6 A;  3ASS A;  4WZL A;  4QUZ A;  4RPD A;  2OBR A;  5KW9 A;  3ONU A;  3PUM A;  4P3I A;  4RDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...