1KK0A

Structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
405
structure length
399
Chain Sequence
b'SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDHSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGLVGGVLGGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVGTEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords eIF2gamma
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
total genus 96
structure length 399
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk0A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk0A01
1KQSB 1W44A 2GK6A 4DSOA 3WNDA 2IHBA 2IWHA 4W7SA 1WDTA 1OIXA 2O0HA 3KTAB 3GLGB 1XTRA 2BMWA 1Z06A 3CKLA 5CM8B 1CJVC 4PPNA 3QXCA 3FWYA 5C4MA 2AKYA 2GEDA 2MMGA 5DGXA 5CLLA 3DMDA 5EXTA 4A82A 1P60A 4LJ8A 3J81k 4MGYR 3U4QA 1EX7A 1VQPB 3AVQA 4PPGA 1CS4C 1V43A 2Q21A 1Z22A 2ZI6A 3EC1A 4YDHB 3V9PA 3WRXC 3K70B 4B73A 2AWNA 1XJCA 2ZE8A 2YV5A 3B5JA 3LBNA 5F9HA 4NMMA 2QROA 4DLYA 3UG7A 3T12A 4QGHA 1VQ7B 4EPTA 4HATA 4GSYA 1OFTA 3QSYA 1BMFD 2H7VA 3ICQB 4HB0A 1KK2A 2W2XA 1E9AA 1N5KA 1RIFA 2OFWA 3HP1A 2OK7A 3BFKA 3RS2A 3L8ZA 3U4QB 1S2MA 2PEZA 4NYMQ 4R71A 4DDTA 4E5UA 4JJZA 2WJIA 1QHGA 3FPAA 4Q1AA 1MRNA 4JLKA 2A5FA 4A8JA 5JMTA 4BFZA 3PUVA 1CBUA 4JYCA 3UG6A 1SXJD 2ZXUA 4JSYA 1ZC4A 2ZRHA 4DZZA 1T6NA 1UAAA 1OKKA 3U6KA 4HE6A 3GEEA 4A8JB 3DZDA 2QTZA 4CYMA 3QVUA 3QKSA 2NZ8A 2ZI5A 3FKSD 2GCPA 4RZ2A 3RLFA 2GJAA 1XFAA 3T34A 1DO2A 1P2SA 2IS6A 3B82A 3UXMA 4CT4B 1SZPA 4OKSA 5IHPA 4LBVA 4O3MA 4PC7A 4CZ2A 1Q7YD 1ZRHA 1RRPA 3K0SA 1NMZA 3L43A 4DB2A 3A1TA 2V6IA 3QKSB 2BSAA 1U8YA 3UMSA 3QG1A 4B43A 1S72B 3IBYA 3ICEA 2ZRKA 1GL9B 4PHFA 5LB2A 1PUIA 4GOJA 2XZLA 2ASEA 3CCLB 1ZM3A 1V5WA 2H1LA 3QQ5A 3ZGXA 1QGYA 2I3BA 4OJQA 4HDQB 3OEHD 1TUEA 1Z28A 4D0LB 1JA1A 2A5DA 2RCNA 2QEXB 4MYTA 2B5OA 1IBRA 2ZM5A 1E32A 2CXXA 1ZNWA 4LHYA 4TWZA 5J47A 4YALA 2R6FA 1QFJA 2RGBA 4LYAA 3EW9A 5BWMA 3VKGA 2VBCA 1XBTA 3I5XA 4HB4A 2MSEB 4JLJA 1R4AA 2Q3HA 1R0ZA 2P65A 2V9PA 3W2HA 2QAJA 1E4VA 3JVUA 4FINA 3K9NA 2JLWA 3ZVRA 4GOKA 2D2EA 1MT0A 2Z83A 3FE2A 1CIPA 3SJBA 4BFVA 1NLZA 4KSCA 1EWYA 4OYHA 4RFVA 5HCNA 2E1RA 1US8A 3RS0A 2WPDA 1J8MF 1GNQA 4KI0A 4PPFA 3AKDA 5FBQB 4U5XA 1JR6A 2N1BA 1DO0A 3BERA 1VIAA 4Y0VA 3U3KA 5AN9A 1BO6A 1UF9A 3V76A 2RC6A 4MRNA 3L0SA 5FA6A 5FL7A 3GJ4A 1XE1A 4ZDKA 4UXJA 5JCPA 1KDTA 1WA5A 5KHOC 2ATVA 2XNJA 1F3OA 1KY3A 2CK3D 3UMFA 1K5DA 2UZ3A 4XVUA 1AZSC 2HJGA 3IBGA 5KYKA 3HU1A 3L2OB 4QHTA 2P6UA 1FTSA 3BXZA 4YONB 1A2KC 3B1WA 3KJEA 2AR7A 4B3CA 3B85A 4E03A 1WMSA 4HLUC 2BOVA 3V4RA 4TLAA 4LI0A 1NL3A 4EPRA 4UXIA 4WW0A 3S1AA 4EIWA 3V00A 4BZXA 1LV7A 1KO1A 1W46A 1ODFA 4TMXA 2ZSFA 4JIMA 3LBIA 5AK0A 5E4FA 3ZZ0A 3KL4A 4TYQA 5EE3A 1E9BA 1TUIA 1K9MD 2QT1A 1E9EA 1OHHD 2J9RA 4MGZR 3S1AB 3X1XA 4BFWA 1JAHA 4JLNA 1AGRA 1Z0IA 1TQ6A 3VKHA 1FUKA 3X1YA 5B57C 2CRVA 1RC8A 2XJ9A 3IIJA 3BD9A 3TUZC 5JHGB 4PX9A 5IK2A 4BASA 3FKQA 1D8TA 4XD7D 1Q82D 1KJZA 4AWXA 3U2QA 4LUCA 2BEKA 4BPBA 3R9XA 2FDCA 1VIYA 3RS3A 3T61A 1S96A 4YAUA 4WOPA 2IYUA 2R6AA 2ZJ5A 3HR7A 2H8KA 3NC0C 1Z6TA 4DLRA 1KJWA 2CNWD 1X8LA 2HMAA 1OT3A 3CPJB 3A1UA 4PZLA 4BLSA 3RWOA 2PLFA 3A36A 3ZVMA 2RGCA 4QRHA 2X2EA 3O8DA 2IL1A 2XAUA 4LOAA 1XCMA 4IVQA 5IRCD 4UNSA 3LRPA 1KI9A 5FH9A 1LFDB 5KDOA 2Q9BA 3JQRA 1P6XA 4AC9A 1AK2A 3VAAA 1FNCA 1EFHA 1VQ6B 3GJ3A 4LJ4A 1N6HA 4D2IA 2IUSA 3RDPA 2P0EA 4Y7CA 1Z0DA 4D4JA 5KO2A 1FMJA 1P9RA 2EFGA 4R2HA 1L2TA 3ZBTA 3N2IA 4R9UC 2GETA 2GVZC 1KI6A 3W3ZB 1OH8A 3W2GA 2VF7A 1QFZA 4GP6A 5DO9A 1RE0A 2ZYTX 2W6JA 1CULC 3K9GA 4JLOA 4Q9HA 4Q4AA 5B30A 2V4ZA 1IN8A 5DN6D 4LHXA 2AFHE 1FFHA 4KFTA 2ZYVX 4LJ6A 2J0QA 4JL8A 3OE7A 1KI6B 4Q1CA 1GVNB 3GP8A 1KZ7B 2O5VA 4KAXA 3SHWA 3OZVA 2ZS8A 4Q4AB 2D3WA 5FPHA 3EPKA 4FCVA 4YC7A 2Q3FA 3SNHA 5G40A 3UKDA 2G3YA 4GZLA 2FOLA 2ZS9A 2P5TB 2KBFA 4NYIR 5K8LA 1YZNA 1UADA 4QBGB 1N6KA 3OFND 5FOSA 5FOXA 1XD8A 1QHHA 3TR5A 4U00A 4DLZA 1VQNB 2B6HA 2VRWA 4C0HA 2NO7A 1U81A 2YZ2A 2JLSA 2KI5A 4QC2A 1NSFA 4AKIA 2ZSAA 4I1VA 5JRJA 4D0GA 5BN5A 3O8BA 1HYQA 2YYZA 4DDUA 1AQYA 2NG1A 3K0AA 1WRBA 1M7HA 1QHHB 2JATA 2XTMA 2QMOA 3LBHA 2GHIA 1GRRA 3CO5A 1UFQA 4Q1DA 4D4KA 1P73A 4B3GA 5KDLA 1YZUA 2IYYA 4LSGA 2F1RA 3K0AB 4BFSA 3AVVA 1P2TA 4WZBE 3VFDA 2XTZA 1NVXQ 3RS7A 1FL9A 2CVHA 2ZI3A 4YQFA 2J0VA 5H68A 1E1RA 3W6OA 2WIAA 2VYQA 3WYGA 2W6ID 1CRPA 2PEYA 5EP1A 1KMHA 1A8PA 2IYVA 2JGNA 3KXIA 2WWGA 4FMCB 1U0JA 4RFSA 1OGIA 4OI1A 1CRQA 1KC8D 2GJSA 2KB0A 4TMVA 2FEMA 5J4LA 3W90A 2EFEB 1KMHB 1G64A 1SXJE 5FOTA 3CW2A 5HR5A 1P4SA 3CH4B 1SXJA 4KFUA 1DOAA 4HE5A 1ESNA 1VHTA 3DOEA 4RFSB 4KSBA 4OHYA 2YC4C 4P3YA 1XEWX 4ZI2A 2V8OA 3Q8XB 4EQ6A 1FNBA 1N5LA 2CE2X 2DB3A 2JIZD 3K0CC 2KBEA 4B3FX 4B48A 4DIEA 1W0KD 4FD2A 1NSTA 1SXJB 2GBLC 1J90A 5H70A 3CPHA 2BBSA 2IYWA 5G41A 4NL4H 2EVWX 2BVNA 2IX3A 3UK6A 2QN6A 1W4RA 4EQ6B 5AUOB 4JT4A 4AI6A 2F9MA 1AGPA 1G7CA 1G3QA 3SYKA 4K81B 3FB4A 2HXSA 4RZXA 1X6VA 2F6RA 2ZRIA 3LFUA 2FJUA 5JSZA 3KXKA 2IYLD 4M8NE 4F38A 4C2UA 1R5NA 2CHVA 4IFEA 2VP9A 1VTKA 1QGAA 2BJVA 1YZKA 4Q1FA 2FSIA 3OEED 2V54A 1PLJA 5DI3A 3RS4A 4YMVA 4US2R 4IOKA 5TXGA 3TQFA 5JSZB 2FGJA 3D8BA 5BQ5A 3I3SR 2WOOA 1MR3F 4MDEA 1UBFA 3OAAD 5FR2A 3U7FB 5JBQA 1EP3B 3M1IA 2J3EA 3ZQ6A 4B44A 3AVXA 1GNRA 1NP6A 5DI3B 3RHFA 4FMBB 4QKQA 3FMIA 3E1YE 2QSZA 2VNJA 2IF0A 4W9MC 1DELA 1IM2A 1WB9A 5TDHA 3EX7C 5K8IA 4NCIA 1XZPA 2FGKA 3DM9B 4DCNA 3E20A 2ZRAA 1ZCAA 3BC1A 1PJRA 5E95A 1Z47A 4JVSB 2ZJ8A 4S35A 5KSOA 4QGAA 3SQXA 3KZ1E 5H5JA 1XMVA 3NKVA 4IDPA 4H9GA 4MA4A 3ZLJA 4ZDIA 1GAQA 3SI7A 1UDWA 5BW8A 5HPYB 3KQUA 1DAFA 2XNDD 3C4JA 2WHXA 4CEJA 1RRGA 1EFTA 2FN4A 3A1VA 2CK3A 4IDQA 3AEZA 3U3MA 3X2SA 3I8XA 4XTCS 3JQQA 3VR1A 2I1QA 4KO8A 2FSGA 2WWWA 3QENA 2G9NA 4EJSA 3LXRA 5K8TA 2CVFA 3AKEA 3HPRA 1H8EA 3TQCA 5THXA 2F43A 4GPTA 4CEJB 1GUAA 2ZI9A 3QE0A 2QPOA 1D2NA 1U99A 2OXRA 1L4UA 2V7QD 1G1MA 3MWLA 4MUAA 4GNKA 4RD4A 2BMFA 3OIYA 4EJSB 4HAUA 4LHVA 1A7JA 4LZZA 3RABA 1E96A 4IDNA 2F43B 4WXRA 1Q22A 1RYFA 2WJJA 3GJ7A 3RRNA 3U7GA 1MKYA 2OCYC 3RYTC 1NNEA 1OHHA 1XMJA 5HZKA 3BH0A 3U3JA 4DLWA 4L4UA 1G6OA 1DS6A 2GJ8A 2P5SA 2RGNC 4KFSA 4Q4HA 3CNNA 1HY3A 1ANKA 1J9ZA 3CF2A 2XSZD 3TW8B 1E99A 3LWNA 3UIEA 1CR0A 2CL0X 4MRRA 4BPRA 2FFQA 4OQXA 4XD7A 1II9A 3GLHE 3I62A 4EFNA 3GLHA 5CITA 4NU0A 4QBHA 2EWVA 2ZUBA 2XB2A 4V0KA 4XJXA 5EE1A 1YZTA 4Q4HB 4LYJA 5G53C 2ZE5A 4LJYA 4GBMA 1B23P 1M8PA 1CLUA 1E64A 3GLHB 2QMHA 3NHAA 5DHAA 3RRZA 4I1SA 3LDAA 4CRWB 2XJ4A 1PLKA 1PZNA 2ZUCA 4YAFA 1ZM7A 5EXXA 1VG8A 1Q81D 2H18A 1DAKA 2ORIA 2GESA 2ZU0C 1TU4A 4RJLA 5JI2E 1KO4A 2WKRA 1W4BA 2ZJAA 1KDOA 1QG0A 2JLZA 3HYTA 5B2ZA 3TAUA 3BGWA 1S8FA 3MG9A 4TT3D 4YHBA 2C5LA 2RGEA 4EFLA 4KBFA 2GF0A 4PFSA 2Q9CA 3KJHA 1OPXA 1D2EA 2AX4A 2ERYA 1S0UA 2ZSEA 4AK9A 1RKBA 1G291 1EX6A 1R0XA 2KJQA 4JVLA 2D62A 2BCJQ 5DN6A 1JEEA 4I99A 2VQSA 2OAP1 3ETLA 4MKIA 4OK6A 2V1UA 4UJ5A 4V0ME 2IS4A 1SKQA 2C9CA 4AYWA 1F2UA 2GK7A 5EP3A 4F91B 1F48A 1SVSA 4ESHA 4QFMA 2A5JA 3E1SA 3KX2A 4LX0A 1XWIA 5KTYA 1M90D 2WJGA 4C0SA 4DCSA 3O47A 2ZE7A 1IXZA 5JEEA 2R44A 4N1AA 1KSJA 3W5UA 1G6HA 1JAIA 2J1LA 1Q3HA 1R10A 2P67A 4QJ3A 4PQYA 4P33A 1F2UB 2JLVA 2GXAA 3LQRA 1RFLA 1DAIA 2LCFA 3EIQA 4TMWA 1ONBA 3Q9LA 1YZGA 2AXPA 5EQTA 2WWYA 2WKPA 1S9HA 1G17A 4TSFD 4K1XA 4D6PA 3CRMA 1Q1ZA 1Z0FA 2EWWA 2QGNA 2ZRPA 4PC1A 5FTJA 2NO0A 2FFBA 2GNOA 4PAOA 521PA 4MGIR 3L8YA 3P32A 5J4KA 3MMPA 3VHXA 3GLIE 3WY9A 1E0JA 2RHDA 3GLIA 5F9FA 4DSUA 1BYIA 2IYXA 3TMKA 4BZQA 4OQMA 2OCAA 5HTKA 4Y0AA 3VR5A 4R7ZA 2ECKA 1QHNA 1W36D 2W6IA 1SGWA 2V1XA 2O0KA 4BFXA 2ZJOA 2ZJBA 3DDCA 4JL5A 3GPLA 4IHQA 2R2AA 4I81A 1UKYA 2QI9C 1G4UR 3PEVA 2W2TA 4ZV4A 1CJMA 1Q1QA 1HV8A 1T5IA 2VNKA 2ZANA 1N6LA 1G20E 2AL7A 5EE5B 1E1QD 2QAGB 4F4IA 2DCUA 4TL8A 2BBOA 1CEEA 2QSYA 3G82C 3QIAA 2WJHA 1QH0A 4RCZA 4JKYA 3WRYC 4Q9KA 2K5UA 4DRZA 2GKSA 4CDGA 2BGJA 4M1OA 1T0JB 3DVLA 4B3DA 4RD0A 1XPRA 3CPEA 3IDQA 2GDJA 3HPQA 2W2VA 3DKPA 5HKKD 2WSSD 2JIZA 4Q7MB 1PV4A 3LNCA 4LV8B 1SKYE 4FI3C 4M1YA 3TVTA 4D82A 1IJFA 1Z63A 4P0TA 3DKVA 1K8AD 2QE7D 2ZR0A 2YWEA 1CNFA 4B3BA 1HEIA 5GV7A 4K46A 1I2DA 3ZYCA 4DCTA 4DSTA 1OB5A 5JS8A 2GZHA 1JQLB 1G5RA 3CONA 5M04A 2WJYA 4B2IA 3SOPA 2FZ4A 3EG5A 2JAQA 1QVRA 3CB4A 2GXSA 3LQQA 3R20A 4LY6A 4O25A 1YJ9B 3QE2A 1W5SA 1FPMA 4NYIQ 3W3AA 2QM8A 3BH6A 3VNVA 5AUNB 4ESVA 4B47A 2XITA 3OEEA 1CNEA 2BM1A 1G7SA 1E94E 1M7BA 4I1UA 2O8FA 1KOFA 2YHSA 1E9RA 2ZEJA 3M0EA 2F1IA 3T15A 1YRBA 1KKLA 5JRZA 2J41A 5F3WB 1SHZA 4MYCA 4FW9A 5CB8A 4IEIA 1X1RA 3CR8A 4MYHA 5AJZA 5GJCA 5J40A 3ZZTA 1P75A 2PH1A 4OQNA 1R8QA 4TLCA 4M1MA 2PMDA 3W5JA 2HEIA 2QT0A 4JBWA 2O8FB 3HR8A 1GM5A 3AF4A 3NHBA 5CM9C 4PHHA 3TUIC 2FG5A 2P3SA 1NBMD 1SQ5A 3DMNA 2ZSBA 4N0EA 3K0FA 3FHTA 3FMPB 2IWRA 2BIFA 2VL7A 4C0AC 1ZMXA 1TTTA 1R2QA 2J0SA 4AYXA 1H85A 2ZTSA 1KAGA 1MV5A 1G3RA 4KFRA 1DPFA 1KI8A 3T5GA 1TQ2A 2W00A 2JLQA 4F92B 2YOHA 1I2MA 2WBLC 2GEVA 1LW7A 1E2NA 221PA 1JXOA 2XOKD 1FX0A 2WKQA 3PENA 3K09C 4JZKA 4RD3A 4KITB 3TSOA 3K0FB 3A6PC 1WCV1 2GTPA 4PQFA 3KUCA 4BFUA 4XH9B 4OBEA 5E3HA 3NG1A 1AQUA 1II0A 1LY1A 4GMXA 4LHZA 5FUXA 4FK8A 1XD9A 1KK1A 2JJ1D 3PEWA 5FL3A 4P6VF 3REGA 4X8LA 1KI7A 1FX0B 1G18A 1JQJC 4HLCA 1TEVA 1ESMA 4C0KA 4G5GA 1SVKA 1QRAA 1W1WA 2V7QA 3D6TB 5J5CA 5KSPA 3VR6A 3B1XA 4UQOA 4ZCLA 2HT6A 1XPUA 4PO8A 2HJVA 4KCGA 2J46A 4HZIA 1G8YA 1VQ9B 1ZNXA 4B6FA 5LBIA 2CNDA 1KDRA 1PUJA 3I61A 4FCWA 1BQEA 4L5BA 1OYYA 2GZDA 4HB3A 3SBEA 2YC2C 3B9PA 1P2VA 3B2EA 4X8MA 3B9QA 4LJ5A 1GAWA 4LBYA 4DQKA 1Y3AA 1ZP6A 2FPKA 4D26A 2XSZA 3E70C 2ZRCA 3W8NA 1RVDA 1R5BA 4C2TA 1W48A 1QG4A 1SVWA 1YE8A 1ZIPA 1Q57A 3QBVA 3PCRB 3ZVLA 1ZD9A 3SQWA 5C1BA 2QTLA 4E22A 3ASZA 2JJ2D 5D3MA 3GFPA 2QDXA 1M6NA 2C98A 5P21A 4OHZA 4MH0R 3NH6A 4TLDA 4F7DA 3L0OA 1PVOA 1W34A 2FH5B 1TNDA 1ZU5A 3BB1A 2QTFA 3PEUA 3GJ0A 1NKSA 1Z2CA 2H57A 5EMNA 4OK5A 3AVUA 2CLSA 8OHMA 5A0FA 5D3MB 1EK0A 1H8HD 2ZRBA 4LBWA 3CIOA 3BS4A 1LTQA 3CLVA 1QUEA 5AUQA 4A0RA 4Y9UA 5HE8A 2YOGA 2ZYUX 4FMDB 5GJWC 2B92A 1Q86D 1YRAA 1ZW6A 2VP2A 3NC1C 3X1WA 4PR0A 1EFUA 2FZLA 4G1VA 2ZRFA 3CRQA 2IUUA 2B21A 4B35A 5FOWA 4B75A 1Z6AA 3EIHA 3NEYA 3CM0A 4LC1A 1VQ4B 2FE4A 3JQPA 1ZM4A 2QMEA 3TR0A 4M0LA 3VQTA 1WBDA 1VCNA 3L0IB 5UKDA 2BHRA 3I73A 3CCUB 1GG2A 2OBMA 4BEJA 1ZM9A 4AD8A 2QP9X 2GAOA 1E9CA 2PCLA 4A2WA 3H2YA 3FJOA 4B2LA 5ANRB 2PZGA 3AUYA 5JS7A 2REBA 4HDCA 4FWTA 4AKHA 1XF9A 3IIKA 3ZH9B 1XTQA 1US8B 2BM0A 1YHQB 1LVGA 3H0KA 3H86A 1MO4A 5DISB 2W83A 1E2GA 1FUUA 2BCGY 2ODNA 1G21E 5TVKA 5FTLA 1KMQA 5IDVA 4XWAA 3I72A 4YLGA 2JLYA 1GKYA 2AK2A 4Q7KA 4G1UC 4NDZA 3NWJA 1NVWQ 5AUPB 3UWKA 1ZIOA 3CCRB 1XCPA 2HUPA 5HE9A 1KHTA 4HLUA 2FSFA 3E5HA 1RZ3A 2QEQA 2O52A 4DHEA 1Z08A 4TSFA 2ZAOA 3EZ7A 2C96A 2J45A 1VQOB 3IQWA 1NJFA 3I5YA 3RNLA 4A9AA 2PJRA 5IF9A 3G4SB 1G5PA 3JZMA 4PANA 2R6HA 1P5ZB 1XTJA 1TVCA 2B7CA 3NIBA 5KNCA 3PG5A 3NTUA 2VTKA 1BYUA 1G3IA 2TMKA 3LLMA 4EUNA 3NDPA 4HAZA 4C9BA 1KAOA 2XNCA 5L3VA 1W36C 3TRFA 3CD6B 1W5TA 2GEUA 4QJ5A 3RANA 2OXCA 1SULA 3VR4A 1GNPA 5TMPA 1P7CA 3AF1A 4G01B 3TJZA 3TKLA 4NCJA 2PX3A 1ZUIA 1U9IC 1Z0KA 2QQ0A 3SEAA 1VYUA 2VNIA 1UPTA 4EPXA 4QHSA 1QX4A 5IT5A 1G8FA 4B74A 1NY6A 3FMOB 2IYTA 3GCGA 3FHOA 3BBPA 2PT7A 1GTVA 3SZRA 1E1QA 3DZ8A 1N25A 1E0SA 2G77B 3U3OA 5CYOA 2BPOA 5FTKA 5CIWA 2IT1A 3T06B 3K9HA 5CLQA 1RW4A 1COWD 2ERXA 2FNAA 2ZETA 2L0XA 1OXTA 2CL6X 3IILA 4HEJA 1BS1A 2CCJA 2DYKA 3U7EB 4Z1MA 1IOZA 4LJ9A 3K8YA 4D0NA 4HZUA 3D7MA 5E7MA 5HKKA 2WSSA 1ZC3A 3THYA 1CJKC 1KRHA 5FFMA 2W0MA 2QE7A 3WBKA 4IFBA 4QBIA 5HXBA 2OT3B 3C16C 1AJEA 2DFTA 4ACAA 1TF7A 3FTQA 3H4MA 1Q21A 2CLCX 1GIAA 1VPLA 2RGXA 2F1JA 4G5OA 4HZUB 3THYB 1PLLA 3QNUA 3IKJA 2Q0HA 3NVAA 4FIDA 1NJGA 1DAHA 5GV8A 2C2HA 3QJYA 3T1OA 3LW7A 3UWOA 4B34A 1TF5A 5LB4A 3IHLA 1AMOA 3B78A 4ZO4A 2I1VB 3MRSA 2G83A 2WWFA 4G5QA 4US1R 5FI1B 3SR0A 4WBSA 5EE0A 1S3SA 1OLOA 3LA6A 1RRFA 3VX4A 1ZNYA 3PV0A 2V3CC 3PFIA 1O87A 1BX1A 4Y9RA 4Q9JA 3A58B 4ZI3A 3GEHA 4JYBA 1P9WA 1XEFA 2J7PA 2A7QA 3NBZC 1XDBA 1KD1D 2QM7A 1P9NA 3FGNA 3Q7PA 2YWFA 3P4YA 1JPJA 3U6BA 4US0R 1VQLB 1M74A 4WIAA 4XVRA 5LD2C 4HLDA 2OE2A 3AB3A 2FWRA 4ZGQB 1L7VC 1NBME 1DADA 5KPJA 1NBMA 3LD9A 4MRSA 4DLVA 1UBEA 3AKYA 1GRQA 2V6JA 3U3RA 2KWIA 5AWFC 1OH7A 2GXQA 4URXR 2FX3A 4PC3A 1KK3A 1DDGA 1D1NA 4Z8YA 3ZVNA 2GZAA 2NOAA 2E9SA 3CMEB 4HUTA 3GLFE 4UJ3A 1TAGA 2XOKA 3FFBA 4Q47A 3LVQE 5SZIA 3GLFA 2MSDB 2PZEA 1BX0A 2GQFA 2B8WA 3EWAA 3M4YA 4X8HA 3RAPR 1AKYA 5EXSA 4Q03A 1BMFA 5GJBA 4QGGA 3TW4A 4BFTA 2R6GA 2VF8A 3QF7A 2BBTA 1ZUHA 2JJ1A 2WOJA 2XX3A 4UNRA 5JFGA 3NXSA 1QHYA 4KJZA 4FMCF 3GMTA 4I4LA 3GLFB 4G0NA 2VSXA 1T9HA 3AF0A 2F3TA 2HLDD 1E79D 2HCBA 4MKGA 4G3XA 2IC5A 4PC2A 2BKEA 2Z4RA 2IBMA 2AXNA 4C0LA 1N6NA 2QQEA 3ADKA 3UMRA 2EIXA 2FMXA 4M1TA 1IY0A 5CJPA 1DARA 3IUYA 3QFRA 1NN1A 2AKAB 3FKSA 1X3SA 1F5NA 2VP6A 5AJVB 1DTSA 1P72A 1MABA 3K0CA 2GBLA 4DQLA 2J5XA 3AUXA 1G3UA 3P1JA 4YAOA 1NF3A 3DOFA 1HTWA 2C8VA 2G0TA 4TLBA 5L3RA 4M22A 2ANBA 1FZQA 3B13B 4ZCIA 4JBYA 1XEXA 2Q3MA 4LRWA 1UKVY 3U60B 1ZM2A 1Z0JA 2C04A 2R9VA 3KB1A 3O8RA 1MABB 2XB4A 5FBRB 2QENA 2OUKA 3SE0A 4V0NA 1VQ5B 3OEHA 4CGZA 1E2EA 2VHJA 4IXMA 2DWOA 3PUYA 4UAJA 1XEXB 4BLOA 2ZIAA 5EXPA 4TMTA 5BN3A 2BGIA 1C9KA 2QP4A 3CF6R 1L8QA 2ZE6A 1JR3D 2FSHA 2ZVQX 1NY5A 4EPYA 1ZD8A 2YKGA 2DEUA 4RKEA 3REFA 3M6AA 1QUFA 2C77A 1YVDA 5SZKB 4OQFA 4J0QA 3LVRE 1GDDA 1Z07A 5BXQC 4YMSA 1NG9A 3WP1B 2HYIC 1FW6A 3I4LA 4BEBA 2JASA 4HAXA 1VKJA 2RB4A 1N0UA 2OILA 5H8WA 2ZYWX 4NCHA 4ZDWA 1ZD1A 4MDFA 1FP6A 2H5EA 4B76A 3W9YA 3A4MA 2CEAA 1S9DA 1CTQA 2EFCB 4LV6A 4C0BA 4CW7A 2ZROA 4FCTA 1IHUA 2LWIA 1EGAA 4Q21A 1OF1A 4QM7A 1N2CE 3OHMA 1JI0A 3D31A 4LJ7A 2GAAA 3WMEA 3CH5A 3OZWA 2XEXA 4RZ3A 4TL9A 1IJEA 3P26A 1XXHE 1MO3A 4BLRA 4KHZA 2JDID 3CCQB 1JEDA 3GFTA 4LJAA 1NIJA 3RSLA 4BRWA 4LPSA 3P20A 2A78A 5FI0B 1E2FA 4MITA 5EE9A 4O2LA 2WSMA 4DDVA 5BYKA 5DHFA 3MJHA 4N3NA 1JECA 5JEDA 3AP1A 4N3GA 2YJTD 1AS0A 4B33A 3EASA 821PA 1TL7C 1KO5A 3MAAC 5EUMA 2VEDA 4NCNA 2IEZA 4DLSA 3T1TA 4OHXA 3EWSA 1IAQA 1QHXA 3Q85A 1I4LD 3EPHA 1XTIA 2IEYA 3SJCA 2OTJB 4DC9A 2DY1A 3VO1A 2ZS7A 1EXMA 3BIFA 3ZIAD 3MHPA 1KKMA 1JPNA 4KVGA 1K6MA 4QL3A 2RGNA 1KSGA 3WXMA 2ZITA 4QM6A 2FFHA 1Z8FA 4NTZA 3O8CA 2QA4B 1T0HB 2CNWA 1YHNA 3F5FA 2F3RA 3VU9A 1NN3A 1E2IA 2F1HA 1ZINA 4GT1A 2GWHA 2H16A 2VIIA 3CZQA 4ZKEA 1B0UA 1M2OB 4ZPXA 4LC0A 3WHKA 3AQ4A 3DHWC 3SYNA 5EP2A 4TL6A 3T1QA 4URUR 3SJAA 3LVBA 1E98A 4QXAA 4PC6A 1Q12A 2NMVA 3VU9B 1Y63A 1COWA 1FNMA 4WA7A 1DAEA 1DEKA 2B8TA 4A6XA 2WV9A 4M1SA 5A4JA 1W87A 5JJIA 1HT2E 2VO1A 2N42A 1GOTA 3R7WA 4DCVA 3RWMB 2CBZA 2Z6VA 5JCZA 2IS2A 1W2HA 4F93B 3WYAA 1KJYA 4TQ9A 1YR9A 2PL3A 2O8CA 1SHKA 2PX0A 121PA 3QY0A 3HU3A 1IY2A 1OE0A 1UKZA 4H1VA 2ONJA 5DNYB 1Z29A 1VG9B 3EC2A 2NO1A 3R7WB 1C4OA 4JBXA 3KB2A 3N70A 3T5DA 4DDWA 3G71B 1T4GA 2YWHA 4BZPA 1QHIA 4F4CA 2AD5A 2PMKA 2ZR7A 4F4JA 5FUVA 5L3SA 2ZI7A 4V0MA 1CKEA 2O8CB 4NE2A 3RC8A 1QVFB 2VP0A 2IW3A 1YQTA 5TR9A 1EP1B 1GKIA 2AK3A 2X77A 5DI9A 4DEYA 3CRVA 1E0AA 2VZLA 1T3HA 3TH5A 1K5GA 5A5GA 2UKDA 4A4DA 2XXAA 4FXPA 4ON9A 2HDNB 3LY5A 1DVRA 1I4DD 1TX4B 3CWQA 2VYFA 3V4FA 5L3SB 3OFNA 4JJKA 3THOA 4BLTA 3C14C 2GRJA 4YXWD 1D6JA 2ZRNA 4EDHA 4DUGD 3K1JA 4QNRA 5FL7D 5JWHA 1YKSA 2GF9A 1Q20A 2XXAB 4YDSA 2VHUA 1JXMA 1Z6GA 1W7AA 1U2RA 3VO2A 4YMWA 1JNYA 1XMIA 4CT5A 2MMCA 2RMKA 1D9ZA 3QF4A 2OK8A 3VMFA 3ZBUA 3QFSA 2QA5A 3BE4A 4TYPA 3VR2A 3ZS8A 4L9SA 1D5CA 1FTNA 5ELXA 5HCIA 4C43A 1XP8A 2F9LA 4S2EA 3BK7A 2GPJA 2H17A 4Q7JB 2QORA 4CVNA 1E9DA 3ND8A 2D7CA 2ONKA 3MWKA 3WMFA 5J4HA 3CCSB 1DAGA 4W5HA 6Q21A 3G5UA 1KI2A 3QF4B 2XZOA 1UBCA 1ELOA 1SM4A 3EZ9A 2VNHA 2FV8A 2C95A 3HU2A 3GLIB 1RRCA 3T35A 5CK4A 1OV4A 4BECA 1DG3A 1MOZA 2IXEA 2RC5A 3CF0A 5D3QA 3W6NA 1OW3B 4G5SA 1KDPA 1M1YE 5FBWB 3MFYA 1Q3TA 1Z83A 2IYQA 4QOSA 2QAGC 4D81A 2RGAA 1T91A 5BYJA 3RSOA 1J70A 4Q01A 5DLQC 5TARA 5GADl 2X19A 5JJKA 5C4GB 2PBRA 3ZQJA 2D7DA 4JT2A 2OV2A 1N5IA 1DBSA 1J99A 3BH7A 4QNMA 2YVUA 3HDTA 1OFHA 3VKWA 2QTHA 4ARZA 4AF6A 2VA8A 4P32A 4FN5A 4BWYA 3THXA 5FPTA 1W0KA 2OAQ1 1G16A 2F7SA 2WZQA 2OZEA 3TBKA 1GJRA 2ZU6A 3LX5A 1WE2A 3H1TA 3QEOA 3BOSA 1OSNA 2ZSDA 1XJQA 1BJKA 4ZKDA 4DJTA 5FOUA 3OIVA 1KYIA 3AVTA 4ARZB 4JSTA 3THXB 3VTKA 4PO1A 4RD6A 3GFOA 1SKYB 1EWRA 4IVRA 1NMXA 4Q9IA 4M1WA 2EFDB 3ZD7A 3SYLA 1ZUNB 3EA5A 5F98A 4ZCMA 4UNPA 1F20A 3AVYA 1SVIA 4TZ0A 3FDIA 2NZJA 2A9KA 1XZQA 4RD2A 3A4NA 1JR3E 3DM5A 5GVRA 1Z0AA 4GI7A 1JR3A 1NRJB 5GVSA 1AKEA 3PUZA 4AYTA 4A2QA 2QZ4A 1CU1A 2R6DA 1P61B 2O0JA 1NN0A 3FYHA 4XSGA 1N6IA 3OE7D 3KFXA 5JLJA 3H84A 3OAAA 3PEYA 4BUJA 4LV5B 2AHOA 3OJXA 2JLRA 3B7GA 3CBQA 3W5IA 4D4MA 3WNBA 3EZFA 4LYFA 3TVDA 2SHKA 1HQYE 4LCBA 4Q5IA 3G0HA 2WVJA 3SFVA 2QP3A 1GR1A 4YMUA 1JALA 4JKIA 2GA8A 3GLGE 1F6BA 4TQAA 3IQXA 3SU8A 2IHYA 3IPXA 3E2IA 4HAYA 4O2RA 3GLGA 1FP7A 1TU3A 1Z3IX 3TLXA 1KY2A 4AKEA 2YOFA 2NQ2C 3AM1A 3LAWA 5DYIA 1XMSA 2IUTA 1OGJA 3OIWA 4Q02A 5FUWA 4B6EA 4OI0A 3VR3A 4MGKR 2HYDA 2GXUA 4QJ4A 3K70C 3AVOA 3MWJA 4KYIB 2ORVA 4NCKA 2XNDA 1VCOA 3I92A 4NYJR 4TMKA 4RY2A 3SJZA 2VLIA 4PO9A 3K09A 1VHLA 3JVVA 1AM4D 3KKQA 2CCGA 4XWOA 1NDHA 1QVGB 3SHFA 3CX7A 3FPKA 3QG5A 1A2BA 2JDIA 2BDTA 4LBZA 4A0GA 2Q9AA 3TSWA 4PXAA 4EFMA 2G1JA 2IK8A 1NIPA 1NKTA 2CL7X 2WWHA 4OI4A 2RAPA 2EU8A 2NGRA 1LS1A 4Z54A 3R8CA 1E1RD 1R0YA 4V02A 1JJ7A 4GFDA 3OIUA 4NP6A 4QGFA 5AR1A 4ASUD 1YJWB 2VP5A 2IXFA 1N6OA 4MRPA 3NBYC 2GVDC 4A8JC 1LNZA 4Q19A 2G88A 2XTNA 3Q5EA 3EXAA 4D4LA 2F55A 4RCYA 3AKCA 4IRUB 3C7KA 1CR2A 4PAMA 4URYR 4NPHA 4GL2A 3QFTA 2VHQA 3K53A 3ADCA 3QUSA 1HQCA 1TMKA 3QPWA 2NPIA 3LXXA 1UMKA 3ZIAA 1YI2B 1ZCBA 2WMNB 3KJGA 3IEVA 4IKEA 2ZQ5A 4LDJA 2O8DA 4E09A 3KUDA 4AIIA 1N0WA 4LK2A 3BB4A 2QG6A 4JS0A 4NH0A 4IVPA 1YU9A 2QRZA 1JA0A 1JJVA 3Q7QA 1OJLA 5E7JA 2BEJA 2IS1A 2EQBA 2JJ8A 2ODEA 4DVGA 1G7TA 4QG7A 5JJLA 2D74A 2W58A 2O8DB 1HH4A 1R6BX 3TSZA 1GWNA 1TPZA 1I7PA 1F60A 2EFHB 5KU1A 1DE0A 1E63A 1G7RA 4MKFA 1AIPA 3CMAB 3NH9A 4M2LA 5C18A 1OXVA 2BJWA 4BE7B 3LO5A 2REOA 4FMDF 2QL6A 1VQKB 1KNQA 2EYUA 4M21A 5KUTA 3MJRA 2DWQA 1N3BA 2FPMA 2NIPA 2OTLB 3EARA 4PZYA 2V55B 4M4SA 1N0VC 2XZPA 3KQHA 3ECCA 4D80A 3PJRA 3WHLA 4TT3A 1AN0A 4W5WA 2BKUA 5G3YA 1C1YA 5TV2A 1D2MA 1P3JA 2Z5FA 2OEPA 4IXNA 3BFVA 4PQRA 2ZR9A 4GP7A 1P2UA 4V0LA 1YIJB 3ND9A 1IN6A 3B1YA 5GJVC 5LPNA 4GZMA 1DAMA 5EUQB 4B4DA 2FF7A 5EZ5A 3TK1A 3RC3A 1CF4A 1XD2A 4LGMA 5KPDA 4MKHA 5JWRA 3I8SA 3WBJA 3QFCA 1Q0UA 5LDDC 3DO6A 1IQPA 3CRZA 4UKDA 2A5YB 2PJZA 2NO9A 1NLYA 4YAWA 1KI3A 1ZU4A 4EAQA 1W49A 4Q7LA 3U44A 4KXFB 4BLPA 2X8AA 3TIFA 1XD2B 2QU8A 2MSCB 4CEIA 1MO5A 4YXWA 2WTUA 4DKXA 1NVUQ 4DUGA 4AURA 1N6RA 4P31A 4PTLA 4CIDA 5H1YA 3U44B 3BORA 4PSKA 1T8TA 4JLVA 2IXGA 1Q1EA 2QNRA 4QBFA 1CR4A 1N6PA 3C8UA 1RJ9A 4CEIB 2REXB 4HI0E 4DXAA 1FRQA 2BMEA 3QPUA 2H92A 3Q72A 3CUEF 1H8ED 4A2PA 2W0SA 2C9OA 4M53A 2CLDX 2G0NA 2P2LA 2EYQA 2DBYA 2VHCA 3HJNA 4Z8XA 1KGDA 1RJ9B 1E0KA 4IOMA 4HAWA 1WXQA 4NBSA 2WWIA 1NVVR 2VP4A 2OLKA 3MUFA 4KBGA 4IOLA 5KNDA 2ZRDA 4WZAE 4FWIB 4OI2A 2J7KA 5C46F 1OFUX 2JA1A 1LS6A 2VPPA 2Z43A 3CX6A 1U9IA 3QKTA 4OJKA 3W34A 4Q9LA 1YJNB 5H59A 3W6PA 1VG1A 1NMYA 2G6BA 2OCBA 2RGGA 2HF9A 1GFIA 1W36B 4CF7A 4DBLC 2JLXA 4F7WA 4TYNA 1IXSB 3C15C 3TGPA 2HF8A 4HLQB 4XOIA 2OESA 3GJ6A 1OYWA 1E9FA 1HT1E 4AG5A 1EFCA 4IJMA 3BFXA 1X8KA 4JVNA 1BH2A 4TLEA 4PHTA 2ODBA 3CZPA 2OFOA 1W2GA 2PZFA 1G8HA 3R9IA 1A4RA 1VDZA 1W2BB 1E62A 1G8GA 4GMDA 4IDOA 2YNMA 2LKCA 4IEEA 3QXHA 1AZTA 1E2KA 1KNXA 3TAHA 4URVR 2OSBA 2FPLA 1XX6A 3RVBA 5C2JB 2BBWA 5FTMA 1IONA 1K73D 1VYTA 4NKRA 1MO6A 2QMUA 4R98A 3UPUA 1GL7A 1HE8B 1E4YA 1WP9A 2OBNA 4LWZA 1CJTC 3B6EA 1W0JD 1GSIA 2XNSA 3CRW1 3LH5A 5FBVB 3BJIC 1E69A 1OXXK 3Q3JB 4RSGA 4RZUA 2OM2A 2P6NA 3NEJA 1QG2A 4JLPA 1R7RA 3KKMA 3F0TA 2BMJA 2OHFA 1NJID 621PA 5E7IA 3CCMB 3DEFA 1GVHA 1EG7A 3WNCA 2IYSA 2OG2A 2VSOA 3W2FA 4IOJA 4PSAA 3FFAA 1NG1A 1XCGB 3G6EB 4PHGA 2BN4A 4OQLA 1Z6XA 4LPKA 4C0QC 1Q1BA 4B32A 2R62A 1SVLA 4MYUA 3IPYA 1GAJA 1SVMA 4IDHA 4POAA 4C3ZA 1S1CA 4DIDA 3WMGA 3LW8A 4DLUA 3CWZA 1WBBA 4EPWA 1UJ2A 3SS8A 1II8A 3ZJYA 2VSFA 5KOYA 3TNFA 4D25A 1A5TA 1NI3A 1E2DA 4BQSA 1NN5A 2DFNA 2WJVA 4XWKA 4U7DA 3AGPA 3QXJA 2ZVPX 4A0HA 1XB2A 3L0PA 4Q66C 4Q48A 2X3UA 3A1SA 4B71A 5LD2B 1AS2A 3HWSA 1UEIA 5FUYA 3CC4B 3QOFA 2QRNA 2RHMA 1P62B 3EPJA 2FFAA 1II8B 5CYPA 3KQKA 1XTSA 2G1KA 1Z5ZA 3LO8A 4CEHA 1IB0A 3U7HB 2AWOA 3OW2B 3OZXA 1E2LA 2JEOA 1WF3A 1VCIA 3CX8A 3NBFA 3CC2B 1KO8A 1WQ1R 1W4CA 1OIWA 3GJ5A 2D4HA 1U0LA 4ITRC 3CCVB 1R0WA 4IW3B 1YR7A 2CE7A 2QPTA 2RH5A 2RKOA 3KJIA 3Q5DA 4MQBA 5FPYA 5SZJA 3THWA 4C7OA 4PZZA 1FMLA 1N5JA 3QBTA 4N0DA 4CEHB 721PA 3RRYA 3SN6A 5JECA 3EZ6A 4JMPA 1E2JA 4Q4JA 4DLTA 4Q00A 4ASUA 1TLLA 1JB1A 1EFRD 2ZAMA 2OO7A 3L82B 1CQXA 3OJWA 1VQ8B 3IO3A 1FNNA 4MUBA 2IYZA 3THWB 5DE3A 5SZHB 1MH1A 1U94A 2D2FA 4C7OB 2IYRA 2GCNA 2ODWA 3ASYA 4RD1A 3W5VA 3T1VA 3WYFA 3W2EA 1J2JA 1SXJC 3PXGA 3FMFA 1EWQA 4Q4JB 1E2MA 1OIVA 3PITA 4W5JA 1TADA 1KI4A 2IA5A 4NYMR 5F2EA 4DLXA 5FPKA 1NLFA 3OESA 3EA0A 2R8RA 1G41A 2J87A 2KE5A 1G9XA 3KKPA 4V0OA 1KSHA 2JJ2A 1T5LA 1DG1G 1GILA 2DFLA 2WAYA 1S1MA 5G3ZA 1G8PA 3U61B 1ZYUA 1FDRA 2C78A 4KV9A 4M9QA 1M34E 1CP2A 4UNQA 3ZD6A 2AN9A 1E6CA 2QPAA 2QUZA 4ILEA 3I1FA 1XTKA 2FU5C 4HSEA 4KLZA 5AJWA 3RRMA 1JBKA 1H8HA 4L8GA 1GKUB 3AP3A 3PIRA 2VHTA 4HYYA 2PIAA 1OH6A 2XGJA 3KKOA 1M7GA 2NO6A 2WIBA 1OXUA 1FNDA 2FEOA 3HYRA 5HZHA 4HAVA 4LYHA 2FA9A 1YZLA 1SVOA 2D06A 5JWOA 2WWXA 2CJWA 4KLNA 3IGFA 5L8VA 4V03A 1LF0A 4DB4A 1A1VA 1O3YA 1IY1A 4XSHA 4OHWA 2O8BA 1FQJA 3A1WA 2JLUA 1J7KA 1E2HA 1VMAA 2A30A 2BWJA 2Z4SA 1RYHA 1YITB 3GD7A 4NYJQ 4JVMA 1Z6YA 3F8TA 4P4TA 2WMOB 3GQBA 2CJWB 1G19A 1CJUC 1BKDR 3TE6A 1E2QA 4AKGA 5EZ6B 4NHOA 4C4PA 5B64A 1LF5A 2O8BB 4AF7A 2J0UA 2A5GA 3B1ZA 5JHHB 2CHGA 2OLJA 3K70D 3PUWA 3QKRA 2BC9A 2RGDA 4KVAA 3I56B 4WQMA 3ZDQA 1D9XA 2O8EA 1VQMB 2ZJYA 1XXHA 2UVQA 2CHQA 2J0UB 4WVFA 4A0FA 3N2EA 4XVQA 2E87A 1KIMA 3FOZA 4TQUS 3GJXC 1U0HC 2OBLA 4KU4A 3KQLA 3QPVA 3QKRB 3IHWA 1GL6A 4XIGS 3SFZA 2X1VA 5JI3E 3W5HA 3C5CA 1GRNA 2DHRA 4M9XA 3IIMA 3RS5A 2O8EB 3GEIA 4EJSC 1GO2A 2DETA 1XXHB 3CCEB 4UNNA 1YR8A 3U5ZB 3W2IA 2HXYA 2PLRA 3UATA 1QDEA 1QVAA 3EIEA 3SC3A 4NONA 2QY9A 2CDNA 3EPLA 5FBLB 4DSNA 1EESA 4I1OA 2DWPA 4RVCA 5KNBA 4BLQA 1JJ2B 1QHSA 1X86B 1QBKC 4PAQA 1OB2A 4L15A 1GZSA 4ZIRA 3LLUA 1VECA 1OXSC 1Z2AA 2DPXA 3ADDA 4U02A 3QKUA 4KYUA 4XTRA 1J8YF 1KTVA 1OKKD 1Q44A 4TTQA 4URZR 1X1SA 3MGCA 1W4AA 3KQNA 5K8UA 4TTRA 1T8UA 5KSWB 1G5TA 3I32A 3B8HA 1EP2B 1G4AE 4JLAA 4ZIRB 5FTNA 1AS3A 2ZRMA 1ZNZA 2Y8EA 2Z0MA 1UKEA 2ZREA 1K8RA 1OFIA 2ZRGA 1F2TA 1U8ZA 2PT5A 3EZ2A 3AVPA 1GITA 4X8OA 4ERNA 4B3XA 5J4VA 1FRNA 3EAQA 3KFVA 1DDIA 5FPSA 1TQDA 3WP0A 2WAXA 3GJ8A 5EJEA 3AVWA 3CNLA 1OH5A 1KK0A 2CCKA 1ZBDA 4L16A 1IN4A 4Z51A 3B60A 5AJYA 1HURA 1GP2A 1UDXA 1F2TB 2DFKB 3MLEA 4A36A 2GJ9A 3FVQA 4JL6A 3AF3A 4C30A 1QGZA 2AFIE 2BF4A 5KSYA 4NZYA 1ZAKA 3K0EA 4HDOB 5DH9A 3QEJA 5KSZA 4RKFA 4PSVA 3R9WA 2UZIR 5CDFE 4EH1A 2GILA 5FR1A 5CDFA 1HUQA 2OFXA 3MD0A 4Q1BA 4M9ZA 1XRJA 1ZJ6A 2VH5R 4JLDA 1KSFX 2QBYA 3CRRA 2AD1A 1W0JA 4AY2A 4DT1A 2DR3A 2C99A 3X1DA 2WM9B 4TN1A 2LKDA 3AF2A 2R6CA 1KI1A 3PVSA 3OZUA 4AG6A 1I4TD 4JLBA 4K8OA 4UXHA 4P4UA 4A15A 2WPDD 1QFYA 2QBYB 5TY0A 3CC7B 1W47A 2PCJA 2Q6TA 3DL0A 4DT1B 1L4YA 4URWR 4QHYA 4WAUA 4BFYA 2DERA 1HA3A 1T3LA 1U98A 1U8AA 1N8RD 2B7BA 1MRSA 2WICA 4EPVA 3CCJB 4WXPA 3ONWA 3PUXA 3JZAA 4R2IA 5EP4A 4TL7A 1XEWY 3ES9A 5DSZA 1W35A 1H42A 3BRWD 2EW1A 3DPUA 5L3QA 4OL0A 1CR1A 5CIQA 3PQCA 3UANA 1NVVQ 1UEJA 2ZJ2A 4A6PA 2BV3A 3MCAA 3R8FA 4P4SA 2A3RA 4GDFA 2IF2A 3LV8A 2HCJB 5CB6A 3ZC3A 3IEUA 1FQKA 1G3MA 5TB5A 4DEXA 1S3GA 1B2RA 2HT1A 1JB9A 5L3QB 1QF9A 2X2FA 1IN7A 2OCPA 3KKNA 4TMZA 4ACBA 1CXZA 4OHVA 4GOXA 2P6RA 3AGQA 3LX8A 3ZS9A 5AJXA 1E3MA 4P4SB 3A37A 4O0MA 1E9SA 2ANCA 4A92A 5B58C 3MSXA 4OK3A 2KSQA 3P4XA 2J59A 4G5RA 4WZ6A 1XNJA 5DYGA 5IK2D 2ATXA 1RPZA 2HLDA 5CK5A 1E79A 1H65A 1KO7A 4HUQA 4Q18A 421PA 3CNOA 5J4YA 1YJ5A 4GRAA 5KDDA 1R5OA 4LHWA 2BMDA 4BGDA 4PGOA 2C03A 3BB3A 2QAGA 4Q1EA 3A4LA 1ZVQA 3KDSE 2ZUDA 1EFRA 4TZ6A 4L9WA 4TYYA 3F3YA 1IXRC 4Q4LA 3SBDA 2CMKA 2NTYC 4DCUA 2ZI4A 4HUQB 3BAFA 2I4IA 3N5CA 1VCMA 3KXLA 2GJKA 4JLMA 2QGZA 2C9YA 2N46A 3X1ZA 1ETUA 4HB2A 4BRUA 1A82A 2R65A 1AA9A 4B2PA 2YINC 5FOVA 4II7A 2HV8A 4ABYA 3QXSA 4TTPA 1KZGB 1TF2A 4ZDJA 2YWGA 3C5HA 3MWYW 3PR1A 2NPFA 3AV0B 3D3QA 3VX3A 3QXXA 4Z1MD 1HE1C 1UM8A 3VNUA 3FHCB 4YMTA 1VYVA 1XPOA 2ORWA 4ZGNB 3QVVA 3OF5A 1XU4A 3IO5A 1UBGA 1YZQA 3QI2A 1IN5A 3W8RA 3B1VA 3P27A 4H1UA 3CPWB 2W6JD 2ZRJA 4EKDA 4U9UA 1YR6A 4M9SA 4G1BA 1S4QA 4PPQA 4MRVA 1BIFA 1VG0B 3SDZA 1TQ4A 3TUJC 4A1FA 3AP2A 2ZRLA 5JZVA 1XJ0A 1M1KD 2A2ZA 2ZJZA 3AH8A 3C41J 2JCSA 1E2PA 2GCOA 3ZZUA 3CR7A 4KODA 3CXCB 3I55B 1R8SA 3BWDD 5DIFA 4M1KA 1T3SA 1X8JA 1LB1B 1FOEB 2QTVB 3NDBB 2ZPTX 1U90A 4C0JA 5CJ2A 3A8TA 3K9LA 3KTAA 3VHLB 3ADBA 1TEXA 2GCOB 3NBXX 4DWJA 5BN4A 4TYWA 4E07A 1BOFA 1QZXA 2J7PD
chains in the Genus database with same CATH superfamily
2E6KA 1W44A 1ZO8A 1CRZA 4HO1X 4ENSA 2QU7A 4OB6A 2IWHA 4W7SA 1NF9A 4EVSA 3IBFA 3OIGA 4E0BA 5BR8B 1CUAA 2RI0A 5CM8B 4XX0B 2YY7A 3WK8A 3I64A 3T54A 4OMFG 3QXCA 3D8HA 1RXWA 3NTOA 2AKYA 1NAHA 3KQMA 3LUGA 3M8KA 4YEJA 4RA6A 3WL6A 4MLCA 1P60A 3F73A 1PL6A 1WW2A 1OXKB 1WEKA 4C6TA 1V6SA 1UIRA 1G55A 5FT9A 2IPAB 5LQRA 2EQAA 4YT5A 3U4QA 3AVQA 1VQPB 1WP6A 2A1UB 5CA0F 1HYHA 1C2YA 2Q21A 3HTXA 2VJOA 2RIPA 1CJSA 3K70B 4B73A 2RARA 2ZE8A 5D87A 5F9HA 3DTNA 2UYHA 3FX2A 4ZYWA 1FYEA 1VQ7B 1JJAA 4EPTA 4CKWB 1LLDA 1OFTA 3QSYA 1QH1A 2W2XA 4D9KA 4Z3DA 3BFKA 4GF5A 1XL0A 2OO3A 5C9ZA 2DUUA 5AK5A 1TT5A 1WXIA 1ZK2A 2HM7A 3B1FA 2XUPA 5KVAA 5E9AA 1IZZA 1SHJA 3HN2A 3PUVA 4ZYXA 2PUCA 5BSVA 4MV1A 2EKQA 2QTAA 1SXJD 4OXIA 4EHBA 2ZXUA 1Z17A 1ZC4A 1I3KA 1XFDA 3GROA 2Q0SA 4FFBB 1I30A 2GCEA 4DZZA 1T6NA 2FPGB 3N7TA 3CCCA 4OIFA 3GJQA 4HE6A 3CKMA 3KBOA 4CYMA 3H1EA 3N7UA 2ZI5A 4G0VA 2GCPA 2EHDA 3RJ5A 2GJAA 4TWIA 5LXTB 5K5EA 1P2SA 3OPYA 3TXYA 3BMQB 5E6TA 1SZPA 1LLQA 1UFKA 1YUNA 2SCUB 3A4TA 3EK2A 4M87A 1XQ1A 3TVYA 4O3MA 4N6OA 4XQ0A 5GM1A 1N1EA 3G2QA 2GN8A 3NR2A 3MT7A 4K9OA 5JQGF 5JXIA 2QVBA 4DB2A 3A1TA 2V6IA 3LOPA 3QKSB 4PS1A 3UMSA 2IH5A 4B3RB 1Z2OX 4G36A 4P34A 2LZJA 3IOYA 3BCDA 2Q5QA 1L7DA 1X70A 3KHUA 4G4IA 1PUIA 2RI1A 2CZQA 1XNGA 3HVHA 4Y3UA 2ASEA 3QQ5A 2K7ZA 5D5PA 2CN1A 2I3BA 4P9SA 4KYIB 4OJQA 1EFVB 1RRKA 4HDQB 1WHTA 1NKVA 4Y2HA 3W2TA 4QREA 5IM4A 2CYBA 5DM60 4LF6B 2CLFB 2VT7A 1IBRA 1NPYA 4ZEWA 2L42A 1KZ4A 5F21A 1WUYA 5HDBB 4YALA 1L5VA 1K8ZB 1QFJA 3ZWDA 4LYAA 3ANMA 1L1FA 5BWMA 3H1AA 1IDOA 2VBCA 13PKA 2Q46A 2VJCA 5I9BA 2IEIA 1ISRA 3ASRA 2PBLA 3ESRA 3MJEA 3KEWA 2IXAA 3MHTA 4XLAA 2V9PA 3D64A 4TTVA 1W9HA 3K9NA 3KOXA 2JGKA 3MINA 4LDRA 4TRNA 1UXOA 3T7TA 5LQMA 5J35A 2D2EA 4PX3A 1M2WA 2FK8A 2Z83A 3FE2A 1IMJA 4EYSA 1NLZA 1KBOA 1KGSA 2BELA 1O5TA 2QL9A 3CQ9A 2DUJA 2O2EA 4UMDA 5GAJA 1WVGA 2ISSD 1US8A 3CJQA 2XWPA 1EB9A 1J8MF 1GNQA 1H6BA 2J9YB 4MVJH 5FBQB 1JR6A 1ID8A 1K8YB 3QPAA 1V48A 2AQKA 2VAPA 1VIAA 3BERA 4MIEA 3EULA 3U3KA 3G2JA 2AEMA 1BO6A 1N34B 3AETA 1ZOIA 4ZJYA 2IIBA 2QX6A 3WDMA 3VVCA 2H5LA 1U7PA 3L0SA 1M83A 1HORA 3DL4A 4GD3Q 4J76A 5B1DA 3GJ4A 5EC8A 1HFEL 1Q74A 3USCS 4E1BA 5CYGA 5JCPA 4U7HA 2ATVA 4Y9DA 2W6CX 3A9WA 3ETCA 5T4EA 4QHTA 3VZSA 2J3DA 4NMXB 1Q95A 1Y8AA 3QVSA 4XL9A 4K6FA 1M0TA 4PXYA 5K8JB 3ZGZA 1YV9A 3E4CA 4AZ0B 3TL2A 1I5RA 2R68A 1KIAA 4XJSA 1TK9A 3GV0A 1LQ2A 2ECOA 4HLUC 1YQ9A 1Y5NA 4GE0A 3EQ7A 4RZQA 2HHJA 4BZZA 4CF6A 4JUIA 1KO1A 1W46A 3JQ8B 4KUHA 2RHCA 5CDGA 1YR1A 4BMXA 4RX1A 3LBIA 2WJ3A 3MCUA 3VNRA 1F14A 5DHUA 1ZGGA 1L4FA 3KL4A 2OMKA 5CNJA 1E9BA 3GRRA 5CDUA 1PFGA 1H6DA 3S29A 4BFWA 1JAHA 3WGYA 3H5OA 2VDMB 3SY8A 1W9XA 1KQFA 4JLNA 5BSKA 1TQ6A 1WBJB 3S2SA 3OP4A 1A7UA 3DVAA 5I3CA 4DW8A 2XJ9A 4ZHQA 1HNWB 3LQYA 3NNNA 5IK2A 3ORHA 4CM7A 1SXPA 5I7AA 3MJFA 4QUHA 1KJZA 2COEA 3QEMB 2QYSA 4ZALA 4V1CA 2J5QA 4BNZA 1XRLA 3NATA 5DFAA 3BEDA 5HRUA 4YAUA 1P29A 4WOPA 2R6AA 4N5MA 2ZBQA 5K4HA 1GUBA 3IAS6 3EPPA 4PZLA 1C8VB 1X8LA 2Y76A 4BLSA 3A1UA 5E38A 4A26A 4DCMA 4Q4DA 1N0HA 4MSUA 3V4SA 2VLBA 3A36A 4FGZA 5AVZA 3K20A 4BKUA 4EKYA 3ZVMA 3O8DA 2C3OA 1F2DA 4B17A 4TS4A 3RIYA 3LF1A 2OY0A 1SC4A 5DXFA 5BMVB 2JJQA 4TVKA 1MEJA 3SC4A 5I7EA 2QDKA 3LRPA 2B0CA 2O8NA 2QMQA 3A6JA 4JXKA 2AOUB 4OB7A 2V45A 4KJXA 3Q9NA 3HC7A 3L4BC 4G23A 4BQNA 3VAAA 2V7WA 2VPQA 5IF3A 1YKFA 3GJ3A 4C7BA 4F06A 4LJ4A 5ARCA 1CUUA 1U4OA 2IP2A 1R6XA 3PK0A 4NE7A 3RDPA 4Y7CA 5FUMA 5AVXA 2P2NA 2LDXA 3KC2A 1XYVA 1P9RA 2BFCA 1L2TA 2YS7A 4I55F 5CD1A 2AZXA 3W2GA 2VF7A 1SY7A 1XDUA 2NU7B 4LQCA 4QTYA 5HRCA 3VYVA 1KEVA 1OT5A 5JNVA 4FOTA 4R81A 2WD7A 1D09A 2DX7A 2LP4Y 5EGSA 4BAGA 2IQ5A 4JLOA 1PKVA 5TQ2B 2V4ZA 4BMSA 4GKBA 1D03A 4MVXA 5F51A 4LQ4A 5IJAA 4EGAA 3SLNA 1P4AA 1VJRA 4I8DA 2JN9A 2J0QA 1NXTA 2JGAA 3LCJA 1KI6B 4NJOA 1KZ7B 4B46A 5KQMA 5CLJA 4I50A 3H11A 1Z18A 4CFSA 5FEMA 5FTWA 4OAOA 3GARA 4ZICA 7REQA 5JW6A 2ZS8A 2H59A 3TTWA 1XU7A 2V3WA 3EPKA 3R77A 2Q3FA 3C7TA 4FJ2A 1QRSA 1EE9A 2RH4A 4OHMA 3UKDA 4BMCA 1DV2A 4QECA 4BMYA 4LG1A 4YJ3B 4E7PA 4TV9F 3TXXA 2P5TB 1ISGA 5I9LA 2KBFA 1YZNA 1N6KA 4YWHA 4UEJA 4DLZA 3H9EO 4CT0A 1TKCA 5IX8A 1ZGZA 2CC2A 5HZAA 1U81A 3QV1A 2YZ2A 1RJGA 2JLSA 4HRXA 3DUFA 4QC2A 8MHTA 3JARA 2DZDA 4MGHA 5JRJA 4D0GA 1DKQA 5KQRA 2F3QA 1AQYA 1TM4E 4MLZA 1O96B 4GBGA 3HZRA 4AY3A 2QMOA 3LBHA 1DEAA 5IVHA 4CUKA 3GT3A 4LZAA 4F6RB 1P73A 4PZ0A 4B3GA 3WRWA 5ERYA 4ZANA 4IZOA 2GKOA 5BN5B 1M66A 2F1RA 3UUFA 3Q98A 4BFSA 4ID3A 4CETA 3BTSA 3EZXA 3CG0A 3JWGA 3RS7A 1SC1A 2ZI3A 3VR5D 1C14A 3JQ9A 3WYGA 3OETA 1VMKA 1JF8A 1RKUA 2PEYA 2W6ID 2FTKE 2XV1A 2WTMA 4XYEA 3LTNC 4TN5A 4XR4A 3D7RA 4BJ6A 3W06A 2WT9A 4U2CA 2R87A 5KAPA 3C3AA 2VZ0A 4BL5A 3L41A 1ULAA 2FYTA 2XMQA 3DV2A 2IIPA 4EY7A 4WZBB 1KC8D 1TMOA 2GJSA 3PL5A 1Z5PA 2FEMA 4RTLA 2V03A 3MQFA 5EIWA 2EFEB 4WKCA 3GVJA 3C6YA 1P31A 3OQJA 3CW2A 4B4VA 2I71A 1NFRA 1F4VA 2J9FB 3SICE 3T41A 2VJQA 4WNYA 3DOEA 1FSGA 4NENB 4RFSB 4Z4WA 3HXLA 4OHYA 2YHUA 1VP3A 1XEWX 4ZI2A 1R6DA 3Q8XB 4XCQA 4CR7A 4EQ6A 1N5LA 1M2HA 3ABOB 1ZEJA 3JAWB 4LOHA 3QX7A 4B3FX 2KBEA 4Q6BA 5EOVA 4DIEA 1W0KD 1KRWA 3EFHA 1U7ZA 1P3Y1 1SXJB 2Q4EA 3EXG1 2O5RA 3CPHA 4YEDA 2JH3A 2EVWX 4G24A 4UTRA 3IAFA 1UXGA 2FPSA 3UC5A 2IOHA 1SD1A 3P0IA 4K88A 2G72A 2XUOA 1DC6A 3HGMA 4FYWA 4KWCA 4MUJA 4N3CA 3R74A 3WL7A 1AMNA 2ZT8A 1E8NA 1AGYA 2JIPA 3JU4A 4K81B 2HXSA 2F6RA 4V2IA 3TZ6A 3L7DA 1Q0TA 4MMZB 2FJUA 1P7VA 2VF2A 3K8OE 3OUUA 2FN8A 2ZAGA 2O1WA 4F38A 1R5NA 3C3WA 2BL4A 2QZZA 3H0EA 3QLUA 3CFYA 3IQGX 4GGMX 4OM7A 4B4OA 5B2EA 3PNVA 4WX2B 3FWKA 5AP9A 4ZO6A 5B58T 1YZKA 5K0GA 2PH3A 1HRKA 2WKWA 3DEHA 2O9JA 3OEED 1Y4DE 4KB5A 1EX1A 1YQUA 3DOOA 4RSRA 3JQ7B 1Y4ZA 1PL7A 2X14A 4R2XA 3LGXA 3SFTA 4BMPB 2VTDA 2H4FA 2JD1A 1Y1QA 3N75A 3KB6A 4EO4A 5BQ5A 5FCDA 3I3SR 2PLWA 2QLBA 1UD3A 3BXOA 3FI0A 3DQZA 1Z74A 3A1EA 5DHSA 4BTEA 5JBQA 1EP3B 1DBPA 1WP4A 4DWOA 3DKKA 3AVXA 1GNRA 4WJZA 3U31A 3ZQ6A 3MFQA 5LUAA 1Q7GA 1V9CA 4DR7B 4G2TA 5CVDA 1L5LA 4EKNB 2VNJA 1Z73A 1DELA 5FLKA 3DDWA 3Q3CA 1DLJA 1JH8A 2GK4A 3LHIA 4EL0A 2ZVJA 1JHZA 4Y18A 1J0BA 3RYIB 5K8IA 1RHMA 2QR2A 3VPXA 4EKGA 4BDSA 1MQSA 1ZZEA 1D0VA 2D8MA 4E5KA 3ZOKA 16PKA 4NOMA 4Y2YA 5A89A 3RK1A 2IE8A 2ZJ8A 4CIVA 4FDUA 3RBZA 4ARCA 4DPKA 3IQDB 1RAGA 3ZLJA 4BBZA 2NSLA 4ZDIA 4MAFA 1E58A 1UDWA 4R68A 5HPYB 2BGTA 2Z9DA 4WKPA 4CGYA 3O0DA 3C4JA 3LM8A 4GL4A 5KTMA 1U4NA 4AIRA 1RRGA 1EFTA 2GR9A 2FN4A 3C6MA 3EXIA 1DC4A 2BFNA 3AEZA 1ZQ9A 1T6YA 3O0TA 1CZUA 4FHDA 2NUAB 1GQSA 1BFUA 1NZFA 4CIBA 3E9YA 4MQLA 2G9NA 2FSGA 2WWWA 1ONOA 1RLMA 3AKEA 4CV2A 3HPRA 3KQQA 4HJRA 1H8EA 1PSZA 4NG5A 2I65A 4ZC1A 3E82A 3FPJA 4CKYA 1OWNA 1PZEA 3I9OA 3QE0A 4ZVRA 3KEFA 4BNHA 5DM2A 1CZNA 5CXXA 4MUAA 4HFRA 4GNKA 2I3ZA 4JP1A 1Y8RB 2NT4A 1R0KA 3EE6A 1ODIA 1AN9A 3OIYA 4HMQA 3N8KA 3WWEA 3ER6A 2FUEA 2B3TA 4EJSB 4ND8B 1A7JA 1ZITA 2HWUA 1E96A 4IDNA 4YV0A 2F43B 4RIFA 9GPBA 4YRMA 4LF5B 1RYFA 5DZSA 5IU6A 2JFNA 1NYQA 3G7NA 3D5QA 4YCLA 5A9RA 1XMJA 4W6QA 1EDOA 1ADCA 3I58A 4CI9A 3HXOA 2GJ8A 4Q4HA 2O05A 2ZQZA 1E99A 1HFJA 3LWNA 1CR0A 4MYDA 4Z6KA 1ORTA 2CL0X 2XRFA 3V8PA 1VKOA 5B1SA 3BREA 3R23A 4IIXA 4EFNA 3NTLA 2UUPA 2ZYAA 5CITA 4QBHA 5D1NA 4R2WA 2NO5A 1XCOA 2YXNA 4LHEA 1F8XA 1S6YA 1YD7A 4XJXA 3S28A 5F2OA 3PKJA 4RENA 1MZVA 1P1IA 4D3FA 4X7DA 5G53C 3U9TA 3WGKA 5FFNA 3BWCA 3KYCB 4GBMA 3MW8A 4EGQA 1M8PA 2HPAA 3Q7SA 4EUSA 3RT7A 5KX5F 3GLHB 2AFIA 3NHAA 3C5VA 2GHTA 3RI3A 3IT0A 5L95A 1G1AA 4D0SA 4GBJA 3F4LA 4YAFA 1ZHHA 5EXXA 3K4PA 3QPCA 1Q81D 1DAKA 3DFKA 1V0JA 2YJZA 3OD1A 4H59A 4DY6A 4EMSA 4DR1B 1UXJA 3H3FA 2C7BA 3EUEA 3N0VA 2AIRA 4RJLA 1Y6RA 3WQZA 1NJSA 1MPTA 1QG0A 3MWDB 2V7TA 3A14A 1M1UA 3BGWA 3MG9A 4M9RA 4TT3D 4YHBA 1OWMA 2WZCA 3IEKA 3TAUA 9LDBA 5EIXA 1ZIXA 5JAHA 2R6ZA 2Q9CA 3OM0A 4L73A 2ERYA 2R3SA 4AK9A 3WGQA 1JEQB 5DIZA 4BEVA 4JI2B 4V2UA 5D5HA 3S0JA 5DN6A 1AHHA 4QO7A 1JEEA 3CINA 4LF4B 3AMVA 3R76A 5BW4A 3A1DA 1P9OA 2FW9A 2VQSA 3CZCA 4UC0A 5I8ZA 1OLSB 3GZNB 1X7DA 1E4EA 3LUDA 5DNEA 2G0AA 4Z4UA 1V5FA 2QIOA 1NSYA 3IA2A 4AYWA 2GK7A 1F2UA 4F91B 5ITSA 1F48A 1LWNA 4LWPA 4F8JA 2A5JA 3MWEA 4S1OA 2AV6A 1Q3KA 3GRAA 3IP1A 2BFOA 1JWLA 3VSBA 4IJ6A 2XH8A 2ZE7A 3OCCA 4LF8B 5JEEA 1RQLA 2R44A 4N1AA 1KSJA 2OV4A 1BEZA 1G6HA 1JAIA 2A0UA 3CCFA 3NQ41 3GIDA 4KZKA 3C5WP 1T25A 3OPXA 3QSGA 2BI7A 2P67A 3BHNA 3JCZA 4PQYA 2IUFA 4QJ3A 3V33A 2RHWA 4JLUA 5BSYA 1PT6A 4Z49A 5KOHA 1VKRA 2X4GA 2O1XA 4GM1A 5E1MA 2RD2A 1DAIA 2I1WA 2YIVX 4K2AA 4K5QA 4LE2A 1YZGA 1WCIA 5EQTA 1X13A 2YHIB 4DEVA 3HJFA 1G17A 1H9BA 2EP5A 1I3OA 3QMWA 3RPEA 2XWQA 3L79A 3A6EA 3I0NA 3RV4A 5U9CA 3A1FA 1E5DA 4F85A 2HKIA 1E9VA 1ZKDA 1TRKA 1E7MA 1O54A 2WP0A 3ANNA 3OM8A 3KRTA 2GNOA 2C2GA 3ODGA 4L0QA 521PA 3DEAA 3P32A 4EL5A 5I9IA 5J4KA 7GPBA 4OFWA 3VHXA 4Y6PA 3IR7A 4X6UA 1GV1A 1JUDA 1J5XA 3IAAA 3KJZA 4B31A 3QTTA 4AJ1A 1QMGA 1QS0A 2CFSA 2ZCVA 4B8YA 2OCAA 2G5PA 2VP3A 1UBRS 4I6EA 2ADFA 3PIIA 3ENNA 4G0UA 4R7ZA 3HAGA 2VUIB 3DDNA 1TJYA 4BNUA 1K6JA 1PQ4A 2V1XA 2O0KA 4UTXA 4EY4A 1WOOA 2ZJBA 1JG7A 2WABA 4IHQA 5SY4A 3DCYA 3P9PA 3VPAA 2QI9C 1G4UR 1RBZA 1SC9A 2JFPA 1AK9A 2W2LA 5CVUA 5KHAA 3TCKA 3ZW8A 3GVLA 2OHVA 1EK6A 3H97A 1NNSA 1RYMA 4NABA 4ZARA 1VLYA 3R3YA 5L3ZA 3ZV4A 1LC0A 2OYSA 3G82C 4RM0A 2VTBB 3LQ6A 1B43A 3QKIA 4JXJA 1TD9A 1ZH2A 4RCZA 1FLNA 4Q9KA 4EFDA 2GKSA 1HDIA 4EG3A 5KC9A 3WMXA 2V7GA 2WU0A 4WEOA 3KVVA 2I3AA 3IDQA 3KUKA 3HPQA 3DBLA 4LZLA 2ECQA 3DKPA 4O2BB 1EDBA 4Q7MB 1AB6A 1G20B 1SC6A 4UHJA 1XU9A 1OCEA 3WRVA 3V7AA 4DANA 1L6RA 1RYEA 4M1YA 4YJ2A 4RQUA 4CFZA 3RGWS 1Z63A 2JIDA 1K8AD 5KWJA 3IMCA 3P9XA 1U6JA 1UFOA 4IP0A 4N5IX 1PWEA 4L2IB 4FYYA 1OU4A 1FU8A 4UD2A 2GBFA 2PGOA 3EEBA 1QSGA 4WASA 3IUJA 4N76A 1K27A 3CRNA 2A8YA 1T8YA 2OYNA 4EG4A 5IVKA 4XKWA 3GVXA 3JQFC 4KQEA 2DQKA 2I2AA 1XROA 3EG5A 2JAQA 1QVRA 1ZRSA 1QYVA 1YACA 2JGDB 3E3LA 4I8XA 4MI1A 4WLEA 3UYLA 1ZR4A 3H9BA 4QDZA 3BGVA 1YJ9B 1EB8A 4I6GA 4NYIQ 3W3AA 3LF2A 1KQPA 3BH6A 3TOCA 3VNVA 2XITA 1CNEA 2O8FA 2YHSA 4BVHA 2F1IA 3T15A 1TO1E 4X7BA 5C34B 5F3WB 3CLTD 4MYCA 2P9ZA 2XKAA 4FP9A 1HR0B 2AQIA 5JZBA 3Q40A 5J40A 3M34A 4RLZA 3ZZTA 4WSOA 2PH1A 3G2MA 4UATA 2OHXA 3AI7A 2QT0A 4JBWA 4K9QA 2DJ5A 2VRBA 5DSXA 4C04A 2ONYA 5F4ZA 2JAHA 3NHBA 3O21A 5CM9C 4PHHA 4HGZA 4BP3A 1NBMD 4FR5A 5MDHA 1NBIA 1T9AA 2XODA 4ZT4A 3K0FA 3BSFA 2Z6BD 1EAYA 2IWRA 1GDTA 4X9XA 2VL7A 4C0AC 1ZMXA 3SK0A 4J0DA 4AYXA 3KYIB 1MV5A 1U1FA 2VJNA 3UAZA 4HF7A 4I36A 1MZPA 1CQJB 2YXPX 2D13A 2W00A 2JLQA 3F3MA 1AH2A 2YOHA 1I2MA 4B40A 1H2HA 4DNFA 1LW7A 3DOHA 4JZKA 1WCV1 2GTPA 3KUCA 3ICPA 4BFUA 4XH9B 5JS1A 4OBEA 2JAPA 5AW7A 3BXPA 2AF3C 4MQMA 1E1DA 4V1CI 1NMSA 4P6VF 1XZIA 2RH9B 5AVKA 4EEXA 2OV8A 3M9LA 3FMVA 1FX0B 1GHTA 3QVKA 4C0KA 1NW4A 3NCHA 4G5GA 4OOSA 2QQFA 1WZIA 1SVKA 1O89A 1QH1B 4PY2A 1QRAA 2OC4A 2V7QA 3AR6A 1WZEA 2BISA 4DYHA 3H99A 3QITA 4L8VA 2H06A 4X5OA 1KOLA 2FPUA 4R69A 3ROPA 4PN7A 1WY5A 5FKJA 1VQ9B 1ZNXA 3VNQA 3AEUB 4B6FA 3MUNA 4BNGA 2CNDA 1KDRA 3ZJ4A 3BEOA 4E5PA 3I61A 4FCWA 1BQEA 2ZZQA 1OYYA 5ITWA 2XZTA 5DBOA 3A3KA 4CLRA 1EVEA 4MPJA 3K0HA 1VJSA 3SBEA 1P2VA 4JWTA 4ER7A 4DQKA 5LXTF 3RUAA 1YRYE 4RL6A 2FPKA 2QK4A 2ZR8A 3KPJA 2ACKA 4CKEB 4QGBA 3W8NA 1R5BA 1ZIPA 1YE8A 1AGXA 5EPEA 4H7FA 3OWHA 2P9TA 3ROEA 3WHPA 3ZVLA 4IQ0A 5C1BA 1OZ0A 2QTLA 5LA6B 2A92A 3L6BA 4KQCA 4QXPA 5TPWA 1U0BB 2DPLA 1M6NA 1LD3A 1P1HA 3AUJB 3KVYA 4MWBA 3NH6A 4OHZA 4F7DA 1EQAA 1YK1A 2HQSA 1W34A 3L0OA 1PVOA 2FH5B 1TNDA 3NM4A 5LMZA 4WCFC 4PLZA 5AFSA 3MLAA 3FSJX 1O4WA 1ZSVA 4BTVA 1QZZA 4MW4A 4PLHA 2X23A 3QLVC 4MTCA 4B9EA 2AMVA 1YC5A 1I6LA 3RU2A 8OHMA 1XK7A 2JGEA 1KYVA 5DCLA 2KVOA 1GPYA 1JGTA 1JWBB 1WDKA 3EGOA 3IP3A 4LXHA 5EKTA 1QUEA 2ZOSA 3GVIA 3OT5A 2BDEA 2AEJA 1N36B 2UZAA 1SQ0A 4NZNA 5BNIA 3SZ3A 2O3JA 3R6LA 3FKJA 4P35A 2H2DA 4PABA 1A9OA 1YRAA 2VP2A 4QWMA 3MMNA 5AHRA 3DXFA 1KWGA 3TOVA 5HDQA 4JEMA 4WBNA 4XRGA 4G1VA 4Q24A 1L5OA 1ODCA 4ZO9A 4B35A 1EINA 4QPNA 3EIHA 2GAJA 2R7NA 3F6CA 2NTJA 4P92A 4V39A 5BVHA 1VQ4B 4OMUA 3GU3A 4RDLA 2P5UA 5CVCA 5JNTA 2XRZA 5AK3A 1EBUA 2QMEA 3P9SA 3TR0A 2DUMA 1TIKA 2G4VA 2HBQA 2VVTA 2SKDA 1XK6A 3Q1KA 4DVJA 4RH3A 1WABA 3B89A 2BHRA 5UKDA 4H08A 4AN4A 3VRHA 4YRJA 1WSBA 2P1RA 2QP9X 1U02A 3OW7A 2C3PA 2PCLA 4A2WA 1T5TA 1YI1A 2ON6A 3L1UA 3I6YA 1ST3A 2REBA 2WJPA 3PYMA 5JS7A 3BTVA 5J3JA 4FWTA 3KV1A 1I4EB 4JOBA 3JY6A 4Q12A 4FBMA 1NYRA 1KIFA 1US8B 4HC4A 3IVMA 3LOQA 4UULA 4PRLA 1UZLA 1CUXA 2ZATA 5F35A 2XNKA 3ZWOA 3O74A 4OTZA 5E2BA 1E1LA 4XGNA 1U2GA 2Y1KA 2ODNA 3H16A 3P8ZA 4RM3A 3L6EA 1G21A 1V71A 1YULA 2F9FA 3IKMB 3ASSA 4YLGA 2L82A 2JLYA 1DHTA 1O9GA 3PTZA 4FZRA 5FX2A 1L5SA 1NVWQ 1E7SA 2E6UX 2XR1A 5KNCH 2XKKA 5HE9A 2XTAA 3PNBA 5JC1A 2FSFA 3DB2A 4BFCA 4ICIA 4P7KA 5K3FA 3LKVA 3QVTA 4KE8A 5EKDA 1Q50A 3D5TA 4IV5A 1VQOB 1STOA 5KVQA 1VPDA 4NLLA 4NQZA 4R51A 1R4MB 3I5YA 2NZWA 3G4SB 4JHXA 3VR4H 3JZMA 4PANA 4AQDA 5IM5A 1XTJA 5JYCA 4TUYB 1TVCA 2B7CA 3TBHA 1RAHA 2J3KA 4IDEA 4HYTA 3H7AA 3NTUA 4MS4A 2PUEA 2JFXA 2GHRA 5T3YA 1EK1A 3NV7A 2VTKA 2WUGA 2ZL6A 1PNQA 2XVXA 4JJIA 3CEMA 2J6BA 2Q7OE 4NQRA 4EUNA 5IDYA 3ZCTA 3IVAA 4QYTA 5IZ4A 3G79A 1W36C 2XNCA 1NGSA 1R9GA 4IHJB 2YYYA 4UEQA 1X19A 2BGRA 4QJ5A 1JHQA 2OXCA 1RMTA 5TMPA 1R0BA 4ZEVA 3AF1A 1I0LA 4MUKA 2AOTB 3LVFO 1XQYA 1ZUIA 3L77A 3SEAA 2PZ8A 1VYUA 3PF8A 3OTGA 3N2ZB 2MSLA 3LXMA 2AG6A 4YJFB 3FHOA 3DBOB 4H6PA 4NJMA 3SZRA 3OZGA 5BMVF 5KYXA 2D1RA 3JQ6A 2WIGA 2OXTA 3NXKA 4QRIA 5EWMB 3AHHA 3EVZA 3NIFB 3UH0A 3FH0A 5DV9A 1JKJB 2CFTA 2IT1A 5T4FA 3T06B 1KJIA 4PNEA 1FA9A 2RFLA 1QQTA 3F8WA 3NASA 2FNAA 1ES9A 3OLZA 1C7QA 3CT6A 5BSRA 5BVGA 4DRXB 5H4GA 2Z1DA 5CX1A 1UDAA 1HFWA 4DA4A 4P12A 3UNXA 5E7MA 4D0NA 2VXBA 1IUOA 5E6SA 2QUHA 4OGKA 3RROA 3T9FA 5FFMA 3ZDEA 1PHRA 1BDBA 1O0SA 5D00A 5AI6A 1E3WA 4HDMA 6LDHA 5BSHA 1AJEA 4FYMA 3QELA 1TF7A 3IR6A 4FR2A 3ZWMA 3D4NA 1KY5A 3ACDA 1Q21A 4HRAA 5DSTA 2Q1UA 5HZMA 5BNTA 3BCHA 3THYB 2Z6UA 1BHSA 1QGDA 2AFHA 2XUGA 1P4HA 3NHWA 3NVAA 4FIDA 1IJBA 4YP9A 2C2HA 5JDIC 3QJYA 1G8AA 3T1OA 1C8LA 5DP2A 3A04A 3EYAA 4ZOLA 3T3HA 7AT1A 3B78A 3LT2A 4OQZA 4ND4A 2FCRA 1SCUA 4P98A 4DSZA 4AF8A 3GDHA 3GELA 4D8UA 4G5QA 3E0QA 3SR0A 1CB7A 1HEYA 1JMKC 1OLOA 1IWBB 2D54A 5H7XA 1CZOA 1KVRA 5KTSA 3T7RA 3PV0A 2F64A 1SG0A 4A8TA 3U40A 4TV8A 2VTVA 5E4YA 4Y9RA 4YJ3F 4ZI3A 1FXWA 1P0MA 3HO8A 4WDQA 1P9WA 4PTYA 4BO1A 3HKEB 3MUOA 5ADVA 2CV0A 3SHQA 4ZN6A 3EQ6A 3UAGA 1UPAA 1F6DA 1GUFA 3QEKA 3WWDA 4US0R 1EFLA 1MMFB 5ULLA 4HLDA 1K6XA 2P6OA 3DTVD 4DMHA 2FWRA 2CSXA 4WXHA 2WR8A 1UD5A 1RYDA 2WJZB 5KPJA 4KZPA 1O94C 3T95A 1RWKA 3EEFA 4YR9A 4MWEA 1EWVA 1NXWA 3RFCA 4BV2A 1F38A 4MRSA 4ZJUA 5LLTA 1VLMA 3BWEA 3AKYA 4WI1A 1GRQA 5GONB 4P22A 4YHHB 1OH7A 4AUKA 3RRXA 3ROZA 4FZ3A 1TQHA 1Y5LA 3CE9A 3M6XA 1PGOA 2Y2VA 5FNVA 5A02A 1NBHA 3IXLA 3EIFA 1J1UA 3P0EA 4X65B 2XB9A 2HRZA 3W1VA 1VIVA 1RWXA 3DZKA 3Q10A 2B99A 2XOKA 2MCFA 4BIMA 3GLFA 4IG9A 2PZEA 2DU8A 1P0QA 1FFEA 3EWAA 2XQIA 2ACVA 3V34A 2JGJA 4L8LA 3LLSA 1BXKA 1G2PA 2O50A 1PD0A 3L1IA 4QGGA 2E3JA 2F4VB 3VO8A 3QF7A 5JNSA 3RSCA 2Q99A 3AHIA 4OJNA 3M4XA 2UUOA 4WOJA 5H0IA 3GMTA 4I4LA 2JBAA 1TYAE 2XMCA 1D2RA 3OQIB 3PC2A 1QKJA 4PYIA 2PSDA 2XCTB 1JFTA 1XZLA 2PSFA 5C8YB 1AK1A 3GEPA 3AF0A 1T6BY 2FP3A 2HLDD 3E27A 2HCBA 5DK4A 4G3XA 2G07A 2BKEA 5AK4A 1OA1A 3JQAA 1TFUA 3M6UA 3ZXIA 2AXNA 5AM2A 3TZCA 1RMYA 1SMKA 3N2GA 2QQEA 4TKMA 3RC7A 3DE7X 1N3LA 4NDAA 3F9CA 1GLNA 4YLEA 1IY0A 1T2DA 3AHDA 4G9GA 2XCLA 3EXG2 4B82A 1H5NA 3QFRA 2FN9A 3FBTA 3BCFA 2D2IA 4V0SA 4F4FA 1L5ZA 2PJDA 4FKBA 3IVXA 3IX7A 4XB1A 4FHFA 4MI6A 1J09A 1R0SA 1T8PA 3D4LA 4K05A 4KXMA 2IV3A 2VP6A 4PTZA 4M8IA 2Y77A 2ZG6A 1Y3FE 4QUKA 3SF8B 3D7NA 2J30A 3U39A 4AZWA 2I4NA 4PO3X 3X43A 1XI2A 1G5FA 4LE0A 3WLAA 3P1JA 4HDNB 2FRDA 3DOFA 4TLBA 2C8VA 3ZI0A 2G17A 4M3NA 4HQLA 4U8GA 1H2EA 3B13B 4PPYA 4ZCIA 4C2AA 1XEXA 2VQ3A 3G2LA 4ZWNA 3SIPA 3EQ2A 1Z0JA 3O8RA 1S8NA 1V8FA 4WJKB 5ELMA 3ESZA 3WG9A 1EHIA 4FEAA 3SE0A 1K9VF 3H3JA 1VQ5B 1BROA 4KPFC 2BRUA 3EJWA 4HIZA 2C9DA 2TMYA 4UAJA 2X2OA 3CUUA 1RDFA 4IWYA 4TMTA 4C1BA 2BGIA 2B6NA 1YWGO 1AE1A 1L8QA 3ELUA 2ZVQX 4JI0B 5AM4A 1TFRA 3T7CA 1Q2UA 3FCXA 5CNIA 5BNFA 2DEUA 2GASA 4LRTB 4C4YA 1YVDA 2LZ0A 1SXGA 1R4ZA 3NS7A 4J0QA 3LVRE 3K6RA 4WT7A 4UARA 1P17A 5FUBA 4V3BA 1SCNE 2A35A 3OF2A 1NG9A 2Y1EA 2AE1A 3A70A 5ALOA 1YTLA 4BEBA 1DKMA 3V5NA 1MC1A 4A27A 5TPZD 5ALJA 4E13A 2VI5A 1N06A 2AN4A 4INJA 1ZD1A 2VG8A 2GLTA 2H5EA 4EELA 1VLLA 5IVPA 1C30B 3NHJA 4N47A 3W9YA 5FWDA 1NUHA 2HF2A 1IULA 4J7CA 3E7XA 1RXVA 1CTQA 2IGTA 1SK9A 4CW7A 4Q3NA 2FQYA 3REOA