1KK0A

Structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
405
structure length
399
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDHSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGLVGGVLGGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVGTEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords eIF2gamma
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 96
structure length 399
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk0A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk0A01
2GILA 4G01B 3B85A 2DY1A 1NL3A 4U02A 5FBRB 2HDNB 1IB0A 3A36A 4LV8B 4AG5A 3O8RA 2VP9A 4X8LA 1P3JA 3GLFB 2X77A 3NBXX 3NHAA 1TLLA 1YZGA 2GK6A 3CZQA 1XPOA 3IQXA 1DDIA 3ECCA 5FUYA 4M8NE 3EC2A 2IK8A 4NCJA 3KKMA 3AEZA 1UM8A 4WAUA 3K8YA 4O25A 1HH4A 5FL3A 2EFCB 2ZTSA 2VNJA 2RGDA 4G1BA 2A5GA 4BEJA 3G71B 1QHNA 3CRW1 4IFBA 5EMNA 4Q1AA 2H7VA 2GAOA 2IA5A 2JATA 2QAGC 3FGNA 5P21A 4CEJA 4TMWA 1AKEA 1XJ0A 2CRVA 1S1CA 3KXKA 4BFYA 3NXSA 3MAAC 1NF3A 2KSQA 3I1FA 3DDCA 2PZGA 1G291 1XP8A 2ZREA 3LFUA 1T0HB 1F2UA 5DN6A 4MYHA 4RSGA 3CXCB 5THXA 5FPSA 3UMSA 2Z6VA 3KKOA 3QJYA 3A6PC 3W8NA 2RKOA 4JSYA 1NMZA 5CYPA 3S1AB 2WMNB 3W6PA 1D8TA 3L0OA 4ASUA 1E62A 4Q01A 1CP2A 1GSIA 1SHZA 3MWJA 3L8ZA 1DELA 4MA4A 4JYCA 3QXSA 5JJLA 2J3EA 1JAHA 4LPKA 2QBYA 2ZAMA 1Z0KA 121PA 2BJWA 4LV6A 4TL6A 2DBYA 1XJCA 4Q4AB 5AJYA 3PG5A 5FPHA 4PGOA 1N25A 2H8KA 4A0RA 2W00A 1G64A 3VQTA 1GDDA 1JR3E 3C16C 2WWWA 3TK1A 3TSZA 1MRSA 2RGEA 2ZEJA 2V6JA 2C04A 5CITA 1AS3A 5FPYA 1VCOA 3CCQB 1XTKA 1ZRHA 1XU4A 2CL0X 3DKPA 4LV5B 2XITA 4KODA 4US0R 3WP1B 1P60A 1X8JA 4ERNA 1R5OA 1Z6AA 4MKHA 2MSEB 1Z6YA 4AYTA 3RS4A 5BN4A 2IYVA 2TMKA 4XTCS 1SXJA 1M7HA 3L8YA 2ZR0A 2CEAA 2IXEA 4M1OA 2X2FA 2R6DA 3LWNA 2O8DA 4CF7A 3G6EB 5DIFA 4AD8A 4RD4A 3BWDD 1S4QA 1SM4A 5C1BA 1KK1A 3VO1A 4PHTA 3QFRA 1II0A 3R7WB 5BN3A 1ZM3A 2IYWA 2PIAA 5K8LA 4A0HA 1OJLA 4EKDA 4KITB 4A9AA 2IXGA 1D6JA 1U2RA 4NCNA 2CCJA 2WV9A 4FW9A 1KY3A 4NMMA 4P0TA 4X8OA 5EUQB 3T1QA 3ZC3A 4POAA 4D0NA 4YMVA 2VQSA 1KI3A 1K6MA 2FGJA 5FUWA 2IYQA 5FTJA 2V8OA 3BXZA 2XZLA 2W83A 5ELXA 2ODWA 3I61A 4KFUA 2PX3A 4B6FA 5IRCD 1UPTA 4LHXA 2JAQA 3BJIC 2DCUA 5H68A 2PJRA 1Q0UA 1M90D 1G17A 1G8HA 2FG5A 2JLQA 2RHMA 1RJ9A 2EFHB 4XJXA 5KO2A 4CVNA 4GL2A 1VQNB 1QZXA 4OQNA 4PAOA 4UJ3A 2D7DA 2FA9A 4M0LA 3E5HA 1IN4A 4Q1CA 2FSFA 2QAGB 1E9SA 5BN5A 4ZCMA 2WJGA 1E2GA 1EP2B 2BEJA 5FTMA 5HCIA 5SZIA 2I4IA 4BFSA 4DSNA 5FTKA 2Q9CA 4KO8A 1W7AA 1U99A 2R44A 2GEVA 3CCLB 1A7JA 2ERXA 4HDCA 3REGA 4ESVA 4ZGNB 5EE9A 5E7MA 5A4JA 1FOEB 4EFMA 1BX1A 1OKKA 1AQUA 3CCEB 2OCYC 1BMFD 3W6OA 3JQRA 3VKHA 3L2OB 2VSOA 1BYUA 5JSZB 5K8TA 2PMKA 3BFXA 1KO7A 2A78A 1P9WA 2A9KA 4C0HA 3HYTA 5FPKA 1AGPA 2FFQA 3GLGA 4H1VA 1TQ2A 3A1VA 2QP4A 1DEKA 2XJ9A 1FNCA 3V4RA 4H9GA 1KSHA 4XD7A 3Q9LA 3P20A 1W2BB 1QHGA 1SVLA 3AP3A 2V7QA 3E1SA 4JT2A 2GWHA 3AVOA 4PQFA 3SQWA 2ECKA 1FQJA 1DPFA 2J1LA 4LJ7A 4MKFA 3VTKA 2B8WA 3VU9B 1IAQA 2QGNA 3IIJA 2DWPA 4V0KA 5H70A 2VZLA 3WP0A 2VNIA 4UNQA 4ZCIA 3QXJA 4JLOA 1R0WA 2H18A 1K5DA 1ZU5A 2QEQA 3PEYA 3QOFA 4TMTA 2QUZA 4YXWD 2JLYA 4EAQA 4U5XA 2G3YA 5JHHB 2ZE5A 4JMPA 1XE1A 2B7BA 1Z07A 1P2TA 1R4AA 2CVHA 2RGBA 4CEHA 3K0CC 3ND8A 5G40A 4NYMR 5AJWA 1KD1D 4N1AA 4LI0A 2YOHA 2IHYA 2HF8A 5BXQC 1HTWA 3SJBA 2RC5A 3THWA 2E87A 1J8MF 3HR7A 2N46A 5FL7A 1EFTA 3J81k 1R6BX 2WMOB 4DC9A 2YJTD 2WKPA 1VHLA 3X1YA 3C41J 1UJ2A 1H42A 4NCKA 3T1VA 4R2HA 3KZ1E 3SNHA 3LW8A 1G4UR 2J7PA 1Q57A 1Z28A 1G3MA 1H85A 3FWYA 2Y8EA 3KKPA 2O8FA 1ELOA 1FP7A 3CX6A 2C99A 2CK3D 1UBGA 2XZOA 2JLVA 3TR5A 1EFHA 3EC1A 3CR8A 2CHVA 1C1YA 1GL7A 3AUXA 4TMZA 1NVVQ 1T3LA 4YQFA 3SYNA 5BWMA 3M0EA 3LXRA 2HJVA 1E99A 4URZR 3R9IA 2IW3A 4Z8XA 4TTPA 1KYIA 2GCOA 3GJ7A 1L8QA 1P5ZB 1ESMA 2JASA 2R65A 2RMKA 2OK8A 3X1ZA 4B2IA 2P3SA 5J5CA 4FCTA 3LXXA 1N0VC 2ZRNA 3WYFA 1OFHA 3AKDA 3RC8A 3QXHA 2ZYUX 4HAUA 4DDUA 4E07A 4NYIQ 2A5JA 2BGIA 1VQ9B 2NOAA 2X19A 2KBFA 3B1VA 4YHBA 2Q3FA 4DLUA 4QL3A 3PUXA 3T5DA 2ZI7A 1T3SA 4C43A 5B64A 1VCIA 3QF7A 4JLPA 3IO5A 2NQ2C 1OXXK 3MJHA 3U3OA 4DLTA 1S3GA 4GNKA 4YMWA 1QG2A 3PEVA 2QP3A 5KDLA 1FNBA 2ZI4A 2JJ2D 3K0AA 2LKCA 5IHPA 3IBGA 3KJGA 5HCNA 3FKSA 5J47A 4HI0E 2HV8A 4G5OA 5TMPA 1JR3D 2W6JD 1RC8A 1HE8B 3LO5A 1W46A 3L0PA 1US8B 1GP2A 3RSLA 1FW6A 4BE7B 4KFTA 3MHPA 1T5IA 3M6AA 5IK2A 4P33A 4LYHA 3PVSA 3RNLA 1M7GA 1R8QA 2QU8A 1YZUA 1CU1A 4B32A 1G21E 4UNRA 4LBVA 1G4AE 5AK0A 5FUXA 1I7PA 3BBPA 1IY0A 3RWOA 1EP3B 3GEEA 3C7KA 3UG6A 3GPLA 3W9YA 1TVCA 1S2MA 1CLUA 3KFXA 3Q5EA 3W6NA 4DLZA 4JLAA 2Q3HA 1QF9A 4P4SB 4XVUA 3RSOA 3GLGE 1Z63A 1NIPA 1N0WA 1O3YA 3TGPA 3KXIA 3OJXA 1IOZA 1MO5A 1W36C 5EP2A 2D62A 1H65A 1GJRA 2ZSEA 1DARA 2DFLA 421PA 1N0UA 1XMJA 1T6NA 1KI9A 1E9RA 1EXMA 1SXJC 2ZRMA 2C78A 4IEEA 4ABYA 2IXFA 5CM9C 1MRNA 1TQ4A 3CX7A 3KX2A 3NTUA 1E1QA 4Y9RA 3VNVA 2KB0A 2QAJA 1VYUA 3PUWA 4MKGA 2ZANA 2ZE7A 4RZ3A 1SVOA 2WAXA 4TSFD 3ZVNA 3AP1A 4F4CA 3WXMA 2D3WA 3A4NA 4HLUA 4KSCA 4LJ6A 1NRJB 5BQ5A 4QJ3A 5C4GB 2MMCA 1XJQA 1FUKA 2IEZA 4TLAA 1DG3A 2QDXA 1IONA 1E79A 1VECA 1TADA 3AVVA 1K8AD 1E2KA 1KDOA 1OGJA 2GJ9A 2VHCA 2CJWA 1VDZA 1EFRD 2YV5A 1B2RA 5GADl 1SVSA 3I5YA 5JJIA 1G7RA 1RVDA 5HTKA 4M53A 2IC5A 2V6IA 3CZPA 1P7CA 4OQMA 5EE1A 3U3JA 4C0QC 2HYIC 5EE3A 3SZRA 3FPKA 4O3MA 1S0UA 1GZSA 1WE2A 1E2QA 4M9QA 3RAPR 2WSSA 1TQDA 3QF4A 1GKYA 2DWOA 4PR0A 1FDRA 3ZIAD 4GZMA 4HZUA 2IF0A 5E7IA 3U3RA 4TZ0A 1NLFA 1UDWA 1Q22A 1OLOA 5H1YA 3AGPA 3Q7QA 4WZAE 1W0JD 3BGWA 1XF9A 2GCPA 2ZRPA 2F9MA 1WDTA 3DM9B 4Q5IA 4L8GA 2PMDA 5HE8A 3IIMA 2IYRA 3CCUB 2JGNA 2MMGA 2BMFA 4ZPXA 5JMTA 4TYPA 2RGGA 3U4QA 5A5GA 1IN8A 3AP2A 4QXAA 1YE8A 2GXQA 2ONKA 1E2PA 3WBJA 4PHGA 4A2PA 1QHSA 3QFSA 3TAUA 2IYTA 4HYYA 4NKRA 4RKFA 4CYMA 2FEMA 3LV8A 4V0NA 5FTLA 3B60A 3O8CA 2NTYC 3U2QA 4EUNA 3CPEA 4BECA 4QJ4A 4DT1A 4Z1MD 4JVMA 2FZLA 3RC3A 4D2IA 3KQUA 2YKGA 4IEIA 1VHTA 1JECA 1KTVA 1AKYA 2J46A 4HATA 4IHQA 4WA7A 4YDSA 4YAOA 1UKVY 1XXHE 3IPXA 2JJ1D 1F48A 3BB3A 1QDEA 3M1IA 5JCZA 4LGMA 4YONB 4GZLA 2EFEB 3IILA 4DQLA 3MWKA 4OI2A 1SHKA 4BPRA 4M22A 3C5CA 3ZVRA 2H5EA 2AD1A 2WBLC 3H2YA 1EX6A 4PHFA 1YJ5A 3TW8B 4UNPA 3CH5A 4DCTA 2UVQA 1W36B 4GBMA 4HEJA 4TYNA 5AUNB 2IS4A 3KL4A 4PPNA 4B4DA 5KDDA 2GKSA 3SQXA 1D2EA 1QHHB 3JZAA 4CEIB 4II7A 3FHCB 3SC3A 3CMEB 1NSTA 2FJUA 1E4YA 5KNBA 4V0LA 1EK0A 2NO0A 4YMTA 4LJAA 2NZ8A 1R10A 2OCAA 2QE7A 2SHKA 1CJMA 4IVRA 4A2WA 3GLIE 1KK2A 2ZI3A 4BZXA 1PVOA 2ONJA 1A1VA 2FE4A 5TXGA 2ZS7A 2H92A 2PZEA 1RPZA 1AK2A 3CW2A 3QKSB 1W48A 1IXSB 3KUDA 5A0FA 1RRCA 2QTLA 1E2JA 4I4LA 3UMFA 4N0EA 3LD9A 5KPDA 1NP6A 4KVGA 5JEDA 1G6HA 4EDHA 2QEXB 1DS6A 1VCMA 2QROA 1M34E 5AUPB 3QG5A 4GPTA 1J9ZA 2FPLA 2EU8A 2VRWA 2HJGA 3HPQA 1NVXQ 2D74A 2DFKB 3SJCA 2VF8A 2FSHA 3GJ8A 1KMHB 3GJXC 3K9HA 2FFBA 2J7KA 1CTQA 3ICEA 3NIBA 1NI3A 1OFTA 1QG0A 2BJVA 3BB1A 3QNUA 3VFDA 3ZS8A 1XNJA 2IBMA 3H84A 1P62B 1QVGB 1OPXA 4IDHA 2P2LA 1OF1A 4PO8A 2XNCA 3CH4B 3VHLB 3ETLA 3ZQJA 1ONBA 3THXA 1U8ZA 4IOJA 1ZD1A 3SU8A 4CRWB 2BDTA 3Q72A 4OK3A 4Q7KA 5JS8A 1NSFA 4O2RA 3CKLA 1GG2A 1JR6A 3P27A 2WIBA 1DAHA 1CBUA 2V1XA 4FD2A 3R8CA 3P32A 4ZV4A 5E95A 1DAFA 4M4SA 1IN7A 1N6OA 2DB3A 1WBBA 3N5CA 1KRHA 2QTFA 2EIXA 4TN1A 5CLLA 3CF0A 2JLWA 2WWGA 2X8AA 3GLGB 3ZLJA 4OJQA 4BGDA 1EESA 2ZRBA 1CJKC 3UKDA 3BORA 3QQ5A 1NIJA 2EW1A 2CLCX 1S9DA 2QI9C 1WP9A 5KU1A 3O8DA 3RRNA 2ZETA 3AF1A 3K09A 5GJCA 2BMEA 2ZQ5A 1Z22A 2VHJA 1NBMA 4URUR 1ZNXA 3ADKA 2NPFA 4Q4JB 2E9SA 4J0QA 1HV8A 1QG4A 4HUQA 1XTIA 4QM7A 5CIQA 1Z0IA 2W6ID 1Z83A 4TLDA 2PLRA 2GEUA 2HLDA 1QBKC 1D9ZA 2WJIA 2RH5A 2ZRCA 4EPWA 2V7QD 1OXTA 3LAWA 4OI0A 2F1HA 4GDFA 1FZQA 3U6KA 4CEHB 4LHZA 3W34A 1QFZA 2ZI5A 2ZS8A 1QGAA 3VR2A 3U44A 2PLFA 821PA 4B76A 4LJ9A 3CF6R 5CB6A 3KB2A 2KI5A 2WZQA 2OLJA 4RFVA 4H1UA 4Q7JB 1WB9A 3A4MA 1XCMA 2BBWA 3IQWA 5GV8A 2QENA 1GRNA 4C2TA 1MH1A 3AUYA 4S35A 1F60A 2UZIR 2JLRA 3EXAA 3FFAA 4DLYA 4EIWA 2YWHA 3BD9A 1CRPA 1CNFA 1RRGA 1XEXA 1BO6A 2YHSA 3PIRA 4HLUC 1EP1B 5H59A 2DFNA 4Q19A 4QBGB 3VX3A 2VSFA 2QMEA 2ZJYA 4RJLA 2GJSA 2FU5C 1G8YA 4ZO4A 1KKMA 1AIPA 4AKHA 1E2DA 3ZQ6A 2WOOA 1BOFA 2Q3MA 4B3DA 2FPKA 3WY9A 2XAUA 1KY2A 5CYOA 1N5LA 5L3QA 1E1RA 1Q20A 4GSYA 3K70C 4XOIA 3UWOA 1VG1A 2ZJOA 1TF7A 2BBTA 4L4UA 1Z0DA 4LX0A 4CZ2A 1U8YA 2GCOB 4EPXA 4Y7CA 3GFOA 1JB9A 1GL9B 2D4HA 2V54A 1FQKA 3ZVMA 1IJEA 4FMCB 1KDTA 4A0GA 1G8FA 4C30A 3QPVA 3U6BA 1PZNA 1OW3B 4XIGS 3H0KA 1OHHA 3OEHD 1WCV1 2R6GA 4PC3A 3KTAA 4JLNA 4EPVA 2PT5A 3WRYC 2JDID 1HA3A 1KJZA 1TTTA 4B74A 4IOMA 4Q1DA 1N6IA 3QPWA 4Q9HA 4HE6A 1DVRA 1ZC3A 1ZM7A 3EG5A 3FMOB 5M04A 1Z2AA 5K8UA 3TVDA 1MV5A 3LBHA 2CNWD 1GAQA 3QXXA 4Q1BA 5DO9A 2BKEA 3WHKA 1E2HA 4B2LA 2AXPA 1GNPA 2O52A 3EZ6A 3K0AB 1NKTA 3CRZA 1K5GA 1MO6A 1OYYA 1ZUHA 2BCGY 4WZBE 5C18A 1XX6A 3KQHA 4LJ5A 4M1SA 2VF7A 4NL4H 3R8FA 4IDOA 1JJ7A 2A7QA 4UXJA 2ZRKA 3TKLA 1OB2A 1XBTA 4C0BA 1PLJA 5C2JB 4ZGQB 4BLPA 1CNEA 5JS7A 2AXNA 4W5JA 4XTRA 5CDFA 4NBSA 2VNHA 3FYHA 5AJXA 4A4DA 3TMKA 2XOKA 2BWJA 3GLIB 4F7DA 3A1UA 4YAWA 3BRWD 1G3RA 4UNSA 1XD2A 5CK5A 4DKXA 3TSWA 1W35A 1NNEA 4RD1A 1Y3AA 1GILA 4DSOA 4NYIR 1Q44A 4F38A 2BVNA 4DCNA 2L0XA 4C9BA 1P9RA 4D81A 5CM8B 4QKQA 1KNXA 4A82A 4N3GA 1CJVC 1G41A 1L4UA 2ERYA 3T61A 1T8TA 4BEBA 4V03A 2O8FB 4OK6A 2XSZA 4WXRA 4WIAA 4MH0R 3BERA 3LVBA 1XRJA 2PEZA 3AM1A 4XWKA 3WMEA 2PBRA 3BB4A 3L43A 1F2TB 1VIAA 4LWZA 5F9FA 2FEOA 1NBME 2A30A 2J0UA 1UFQA 6Q21A 2A3RA 2O0HA 5DSZA 1II8B 1V5WA 4MGKR 5B58C 4B73A 4AG6A 5JBQA 5LB4A 1S8FA 4NH0A 2BHRA 5FOTA 3BH0A 2ZYWX 4QC2A 1XMIA 2GDJA 1JQLB 1L4YA 2OM2A 1LF5A 3HR8A 1OB5A 2OBLA 1ESNA 2ZVQX 1UAAA 2QQ0A 4AYWA 1QHYA 3F3YA 4AKEA 4EJSC 3BE4A 5GJVC 5LPNA 4R2IA 1SULA 3OZWA 2IL1A 2QSZA 5FR1A 4DCSA 2O8EB 1NMXA 3R20A 4A6PA 3K70B 3P4XA 3ZZUA 4URWR 2VP0A 1QVFB 3F8TA 2BPOA 5IF9A 4QOSA 1OE0A 1UADA 4CT4B 1NN5A 3UMRA 5DNYB 2QT1A 2OBNA 3SJAA 4AWXA 3QF4B 1R5NA 2C77A 1COWD 1YI2B 4ZI3A 5TDHA 3SYKA 3T5GA 4IXMA 3KQKA 4HZUB 5JWRA 1LW7A 3MLEA 1IHUA 4DLVA 2JIZA 4LBZA 4EFNA 4HB2A 5FOSA 1NMYA 4TQUS 3K70D 4Q21A 1W34A 2GHIA 2ZJ5A 1H8EA 3CF2A 2VP2A 3HJNA 4IOLA 5DHAA 4DEYA 5JFGA 3FHTA 4OQLA 1RRFA 2OAP1 4V0MA 1W2HA 3PR1A 2GK7A 5JECA 1KI7A 3IPYA 1DO0A 5D3MA 1Q12A 1A5TA 3IDQA 3WNDA 4JS0A 2XXAB 2FSGA 1E2FA 3PCRB 2OTLB 2F3RA 2WSMA 4AIIA 4MRPA 1XPUA 4PAMA 2FNAA 2WKQA 2ZSBA 2W0SA 1RFLA 2F1JA 4HE5A 1FFHA 2OE2A 3SI7A 2ZXUA 4E5UA 3GMTA 3K53A 1XDBA 3OEED 4BFUA 3B13B 2Z4SA 4DT1B 4BFTA 2GJAA 2REXB 3KXLA 4AY2A 3EAQA 4BFVA 5KNCA 2VA8A 4UQOA 3EPHA 5GVSA 3LLUA 4JVLA 1G3QA 2O0JA 4D6PA 3CONA 4A15A 1R7RA 1E9FA 5AUQA 2RGXA 3K09C 3CD6B 3T34A 3ND9A 3C15C 1XTSA 4QGHA 5EE5B 4C2UA 1N6HA 1FNMA 1IJFA 3GP8A 1T8UA 2FWRA 1IN5A 1QFYA 1D2MA 1N5IA 2G83A 4A0FA 5E4FA 4P6VF 3EPKA 4B3FX 1N6LA 2GZAA 3QBVA 3W3AA 4DIDA 4NPHA 1KMQA 1W4CA 1XD9A 2EYUA 3ASYA 4BFXA 4WXPA 2AL7A 4Q02A 1ZC4A 1SVKA 1G7TA 1A82A 3KUCA 3VR5A 3C8UA 4DBLC 3VAAA 1ZAKA 4B47A 1UEIA 1G19A 1ZD9A 2FDCA 2OFWA 5JEEA 4TMKA 2Z83A 2QP9X 3OE7A 4PPQA 3QY0A 1W5TA 4EJSB 4LYJA 1KOFA 1JEDA 2AR7A 4UAJA 2QRZA 3GD7A 1G8GA 4HZIA 3I56B 1ZUNB 2C9YA 1PV4A 1OXUA 3ES9A 3ZZ0A 4QGFA 3WNBA 4GT1A 4Q9KA 1ZNZA 3PXGA 3BS4A 1TU4A 2BBSA 4DB2A 1XZQA 3SHFA 4A8JC 5IT5A 1KKLA 2R62A 3CNNA 3TUZC 3NWJA 2BMWA 3OHMA 4TZ6A 2H17A 2REBA 4E03A 4B75A 1JBKA 1MABA 2IUSA 2W58A 2NMVA 2AD5A 2XEXA 2YVUA 5J4YA 4LDJA 4ZKEA 2XB2A 1KSJA 1II9A 2IS6A 4DUGA 2DERA 1KDPA 2DEUA 2WICA 2OBMA 4PC7A 2J45A 5FI1B 1OH6A 4B3GA 2YWEA 3ZD6A 5G41A 3WMFA 3X1WA 3TQFA 4ZCLA 3NC0C 3B1XA 1QFJA 1JQJC 3O8BA 2RGNA 2IYYA 5KUTA 5ANRB 1KC8D 2H57A 3MGCA 3SOPA 2VHQA 3MFYA 4NZYA 4RCZA 4BRWA 4DZZA 3DKVA 4RD2A 3KJIA 2C98A 3DO6A 1ZYUA 2FH5B 2YOFA 5TVKA 4NU0A 1KI6B 4M9ZA 4ZIRA 4C0KA 1E63A 4QHYA 1IQPA 2JLSA 3VO2A 3FMFA 2NGRA 3B9QA 1HY3A 5KTYA 1G1MA 4Q4HA 1Z3IX 4LOAA 4OQFA 2P0EA 1P6XA 1D1NA 1L2TA 1SXJE 4B71A 1AS2A 4Q48A 4R9UC 4K8OA 3VNUA 4PSKA 1Z5ZA 4V0ME 2QMUA 2HXSA 3I62A 2ZRGA 2G77B 2R8RA 2WWIA 4JYBA 1JPJA 1VG0B 3ASZA 3D8BA 4PZZA 4TL8A 2ZR9A 2GA8A 3U3MA 5J4HA 4MDEA 2OCPA 5DH9A 4DVGA 5BYJA 1DG1G 8OHMA 1G16A 4JJKA 4PX9A 4HDOB 1NVUQ 3SN6A 2CL7X 2XNDA 2YWFA 2OV2A 2G6BA 1E2NA 2OTJB 3NEYA 4JL6A 3WBKA 1RYFA 3A58B 4FWIB 1T9HA 1G9XA 2O8BA 4DQKA 1NBMD 1N6KA 3TAHA 1UBFA 3BIFA 5EXTA 3T12A 2WPDA 4GP7A 2KJQA 5H5JA 5JWOA 5FBWB 2K5UA 3CO5A 4GMXA 4JVSB 1VMAA 3W90A 1W5SA 3LBNA 1SVMA 2GZHA 3A1SA 5TY0A 3D31A 4Q00A 1N5KA 1ZVQA 5EZ5A 4IDPA 2BEKA 1KK3A 3MWYW 3ZD7A 3QKRB 4KBGA 4TTQA 4B34A 4D25A 3RRZA 1X86B 2ANCA 2ZAOA 4XWOA 1I4LD 4FI3C 4JSTA 1XFAA 3K0SA 3AVWA 3CRMA 5HKKD 1Z6GA 3U7EB 4G3XA 1EFUA 3OF5A 1SVIA 1Z47A 3QVUA 3THYA 1QUFA 1MOZA 5FI0B 4DXAA 1H8HD 2ZVPX 4A8JB 1RIFA 3UIEA 4ZI2A 2O8CA 3B9PA 1YRBA 3QPUA 5CB8A 2EFDB 3KFVA 1MKYA 2IX3A 1NVWQ 1B0UA 1J99A 1HUQA 1IXZA 4JL8A 3E20A 4N3NA 4YALA 1AS0A 2BOVA 3LY5A 5DE3A 2YNMA 3UXMA 1UKZA 4Q9JA 2GXUA 4WZ6A 4B33A 1OFUX 1P9NA 4JBWA 2V3CC 5AJZA 3HDTA 3VX4A 2B6HA 4MYCA 3FPAA 3AVTA 1OV4A 2BMDA 2HEIA 4TT3D 4F7WA 2KWIA 2WM9B 3A37A 4NYJR 3RS2A 1E6CA 3B2EA 4IJMA 5KNDA 2VO1A 2H1LA 2BIFA 2VHUA 4JLJA 4D80A 4GI7A 4I1SA 2F9LA 4OJKA 5FOUA 5SZJA 2AWNA 4KSBA 5DYIA 1Q3HA 2PZFA 1CQXA 2RB4A 2O5VA 4PO1A 1Q82D 5EXPA 1UKYA 2OG2A 4HAVA 1EX7A 2FPMA 2B8TA 1MT0A 1P2UA 1YZLA 4AF7A 2AN9A 1G5RA 2QPAA 3FTQA 4L16A 3OZVA 2LWIA 4KCGA 4PTLA 2OCBA 3LNCA 1JB1A 1E2LA 3DMNA 3K0FA 4F93B 2VYFA 2Z0MA 4B3BA 3IUYA 3S1AA 2ZUCA 3QBTA 1SZPA 4HAWA 2CLDX 4QHTA 3RS3A 3SHWA 3TLXA 1AM4D 1G3IA 4TYWA 3OIYA 2WIAA 4I1VA 1U9IA 4HB4A 1GFIA 1HQYE 2CVFA 3UG7A 2J5XA 3WYAA 4RZ2A 1R0YA 2GVZC 3OZUA 4RKEA 3G82C 3CCJB 3PUYA 4Z54A 4KI0A 3HU3A 2ZROA 1KHTA 3UANA 4DSTA 4CEJB 1G6OA 4OHWA 3FOZA 4PPGA 1E94E 5F98A 2B5OA 1U90A 3GJ3A 3REFA 1AN0A 5JRJA 2RCNA 4R71A 1F2UB 1GTVA 4PSVA 5L3VA 4PC6A 4GOXA 4KYIB 2XNSA 1NKSA 4GRAA 3TBKA 4EPTA 4QG7A 3JQPA 1X8KA 2OO7A 2ZJAA 4X8HA 2IYLD 4QFMA 2J0UB 2REOA 1MO4A 3OFNA 4L9WA 3I32A 4R7ZA 3AGQA 5EE0A 2JCSA 1M2OB 4B3XA 4OYHA 3IHLA 5CJ2A 4CT5A 2PH1A 1CEEA 4NP6A 3CCSB 1YRAA 5DN6D 3B6EA 3VKGA 2BC9A 4G1UC 5TV2A 1Q86D 2G1KA 2ZU0C 4UNNA 3HP1A 4DIEA 2QBYB 4JLVA 4FCWA 4CW7A 1X1RA 1I2MA 2VP5A 4KLZA 4O2LA 4RZXA 1M7BA 3T06B 1U0LA 2J0QA 3VMFA 1HT1E 5E7JA 2WWXA 1VKJA 4OK5A 2CHGA 3R7WA 5EP3A 4ASUD 2OFXA 4FMBB 5JJKA 2CE7A 3SDZA 1XCGB 4BZQA 1VYVA 1FNDA 3QFCA 2WVJA 3A1TA 3MCAA 4LBWA 1LFDB 1CR2A 2QMHA 3MMPA 1N8RD 4IW3B 4TQAA 4YLGA 5DISB 1RYHA 3QE2A 3RS5A 2A5DA 1UMKA 5FOXA 4KXFB 1JA0A 2R6FA 3EARA 1GIAA 3NH6A 1Z0JA 1SXJB 2F3TA 4F91B 3R9WA 2AFIE 2QA4B 2RGNC 2O8DB 1LS1A 3QENA 1DADA 3UPUA 1W36D 4M1KA 1E96A 2QTVB 4GFDA 3X1XA 3CM0A 5G3YA 2OAQ1 2BGJA 5FA6A 1VYTA 1W4RA 3LVRE 2WJVA 3NBYC 1BMFA 3GJ0A 3NDPA 3ZVLA 2ZR7A 1Z29A 1SXJD 5EXSA 2KBEA 3DVLA 3LH5A 4L9SA 2GCNA 4ZDKA 5GJBA 1CF4A 5HPYB 3L82B 2YINC 3AF4A 2NO6A 3CNOA 1DAIA 2C9CA 5L3RA 2WTUA 3H1TA 4K81B 4BUJA 2CDNA 1GKIA 4QBFA 3TW4A 1XEWY 1ZM4A 1YKSA 3OZXA 3DOEA 2QN6A 4UJ5A 5B2ZA 3H4MA 3FB4A 4BQSA 4DSUA 2O0KA 4YAUA 4PSAA 2AWOA 3D6TB 2ZRFA 4RZUA 2I1QA 1RJ9B 4WW0A 1HE1C 3QIAA 4Q7LA 5JSZA 4OBEA 4P32A 1DDGA 4BZPA 2ZM5A 1IN6A 4M2LA 1LVGA 4HAXA 5HZKA 4ARZA 5UKDA 2ZUDA 4TYQA 2YC4C 3AB3A 1KAGA 2R6HA 1Q81D 1K8RA 1P2SA 4YXWA 1U94A 3CCRB 3L0IB 4C4PA 1NG9A 1T5LA 2ODBA 3SFZA 1F20A 2VHTA 3UWKA 4QNRA 3ONWA 3CLVA 4B35A 3AKYA 4GP6A 1E3MA 2PT7A 3B1YA 1CKEA 1VQKB 4KFSA 3VU9A 5FTNA 1BX0A 5DI9A 5EUMA 4RD0A 1X6VA 3L0SA 3CWQA 3T35A 1LS6A 3QXCA 1S1MA 3ADBA 1NN0A 1Q1EA 3EA0A 1YZTA 2DETA 3HPRA 4A2QA 1GNQA 3AF0A 4DLWA 2JA1A 1P72A 3BOSA 3EPLA 2RGAA 3QKUA 4LJ8A 4QGGA 1K9MD 1KI1A 1VQ7B 3BC1A 2ORIA 2GEDA 1OKKD 4LPSA 4B6EA 1F3OA 4NHOA 4LRWA 2CNDA 1TUEA 2ZSFA 3SBEA 3LVQE 1A4RA 4R98A 2ZE8A 4C0AC 4BRUA 2QY9A 5KDOA 2CK3A 2EFGA 5EXXA 1DBSA 2WAYA 4URYR 3LQRA 4M1TA 4MQBA 2F6RA 4QJ5A 1ZUIA 5KSPA 4LHWA 3AH8A 4XWAA 1DAKA 2Z5FA 4XD7D 3ICQB 1J8YF 2BN4A 3DZDA 1E9CA 4Y0VA 3B1WA 2IYUA 2VIIA 2FX3A 2J0SA 3FE2A 3G0HA 4MGIR 2QRNA 1KI8A 2IHBA 4FMDF 3NHBA 1FX0A 3I5XA 2UKDA 2F1IA 2OXRA 4Q7MB 2AKAB 1GWNA 3I92A 3IKJA 5KHOC 3EPJA 4D4KA 3THWB 1AZTA 2XTMA 1E0KA 1E9DA 1Q1ZA 2VL7A 4BFWA 2QNRA 3TUIC 1EWYA 1KZGB 1XZPA 1Z0AA 3CBQA 1E0JA 1EWRA 2QMOA 4FCVA 1OT3A 3EX7C 2OK7A 3BK7A 3CRVA 3SJZA 2IEYA 4AF6A 1YJNB 1K73D 3GFPA 5DI3A 4TLEA 2DPXA 1X3SA 4DDWA 3GJ6A 4EFLA 1JXMA 3VR6A 1OH5A 5JLJA 2ZI6A 5FL7D 1JR3A 2W6JA 3C5HA 3RVBA 3RYTC 1VQOB 4EQ6A 2OUKA 3HYRA 1N5JA 2IF2A 4D0LB 5L3SA 3TRFA 1FUUA 2FZ4A 2WOJA 1JNYA 3WNCA 3QFTA 2CBZA 2J7PD 3E2IA 3NKVA 1YZKA 3SE0A 4D4MA 721PA 1M1KD 3T15A 1XD8A 5EZ6B 3DZ8A 4MYUA 2D06A 2ZE6A 1P4SA 1IBRA 1ODFA 1GVNB 1U9IC 3MWLA 1IM2A 2P65A 4O0MA 1W1WA 4DEXA 3I8SA 3TIFA 2P5SA 1Q1QA 1U98A 1US8A 1AZSC 4FWTA 3Q7PA 4IDQA 3I55B 3SBDA 1KO8A 3IIKA 1G20E 4QGAA 3ZJYA 3GJ4A 2O8BB 1VQ8B 4MRNA 1Y63A 2QQEA 3AKCA 1NLYA 2GXSA 2N1BA 2VSXA 3OESA 1PJRA 3ADCA 2NG1A 1JJVA 3PJRA 4HLCA 3FKQA 5FBQB 2HUPA 1YVDA 4V0OA 1BS1A 2C5LA 3CUEF 4RFSA 4C7OA 1WMSA 2A5YB 2OSBA 4M1WA 3KDSE 1HT2E 4G0NA 4P4SA 1ZINA 4DRZA 3C14C 2ZUBA 4M9XA 4TSFA 1JA1A 2FOLA 2HYDA 3K0CA 4F92B 2R2AA 1L7VC 2MSCB 1UF9A 4QM6A 1NVVR 1WXQA 4OI1A 1OXVA 2CCGA 4EPYA 3KJHA 1S9HA 3OAAA 2WJJA 3E1YE 3PV0A 1ZBDA 3ZZTA 1C9KA 4W5WA 5IDVA 2ZITA 4OHXA 3CCMB 1I4TD 4E22A 2VP4A 3M4YA 1EFRA 4P4UA 3FKSD 2F55A 2QZ4A 3RHFA 1GUAA 2NIPA 1UKEA 4LYFA 1A8PA 2HF9A 4PO9A 3EIQA 4OI4A 4URXR 2J0VA 3MSXA 3ADDA 1W49A 4HB0A 2PCJA 2GF9A 4TYYA 4FN5A 5IK2D 3IEUA 3QE0A 4DLSA 3ZIAA 2ZRLA 4G5RA 1JJ2B 3V00A 3CRRA 3U61B 4C0SA 1W0JA 1E64A 1GNRA 1SKQA 2OHFA 1W4AA 5FOVA 2D2FA 3EASA 5F3WB 1KQSB 4XVRA 1DTSA 1E0SA 2NO9A 4JIMA 4KVAA 2ORVA 3CR7A 3PEUA 3Q85A 4TTRA 1WQ1R 4NCHA 1CIPA 3K9GA 4LHYA 4AC9A 1CULC 5AN9A 1C4OA 3H86A 4KHZA 3TNFA 1SKYE 2V1UA 2J87A 3IO3A 1E1QD 1Z2CA 2CJWB 5JHGB 4Z1MA 3K0FB 4XVQA 1M1YE 2HT1A 1QGZA 3QUSA 3W2IA 2JJ1A 2ZS9A 1RW4A 2GRJA 4OHZA 4MUAA 3JVUA 1NJFA 4YMUA 5G53C 4ZDJA 4TWZA 1E79D 5D3QA 3SS8A 1D5CA 1R0XA 1W0KA 2A5FA 1TF5A 2XTZA 4JT4A 5J4KA 1R5BA 3IBYA 3B8HA 2WJYA 4Y9UA 5C46F 4KV9A 2ZPTX 4PQRA 1RRPA 1SQ5A 1HEIA 4K1XA 4UKDA 1N6NA 4B3CA 3VR3A 5J4VA 3IGFA 2HMAA 4NTZA 4DDTA 5FBVB 4LHVA 2G9NA 2WSSD 3U4QB 1T3HA 1G3UA 1YZNA 4NE2A 3X2SA 4KFRA 2JLZA 4U7DA 5DGXA 1QRAA 1E9AA 3W5VA 1FMJA 3QVVA 1FPMA 1DAGA 3NC1C 1KDRA 1U8AA 1KNQA 1UBEA 3AV0B 3PFIA 3CRQA 2XB4A 2B92A 2QPTA 4Q18A 3Q3JB 1QHHA 3NG1A 1U0JA 4CEIA 4MUBA 3TVTA 1DAEA 1RKBA 3CPWB 2NZJA 4G5SA 3KKNA 5AUOB 1OH8A 4TLBA 1NJID 4W5HA 3OFND 1S3SA 1TUIA 3TQCA 1GRQA 3F5FA 5EQTA 3W8RA 4BLQA 1OYWA 4KYUA 2OLKA 3HU2A 3QKSA 2XNJA 1U0HC 5GVRA 4WBSA 5GV7A 2NO7A 4RY2A 2Q0HA 3DMDA 2ZI9A 1BH2A 1UDXA 4MRRA 1ZW6A 2WJHA 1OIVA 1GO2A 2AKYA 4LK2A 3SYLA 4EH1A 4URVR 2J41A 4S2EA 4US1R 5FH9A 4TL7A 1OIXA 4IVQA 2MSDB 2NPIA 2AX4A 3RRYA 5JI3E 1KMHA 2EQBA 1D9XA 5CDFE 1F5NA 2ANBA 2DFTA 3DHWC 1Q21A 4JLDA 1TU3A 3TSOA 2FV8A 1BJKA 2GBLA 2ZYTX 2IYZA 3EIHA 1XEWX 1Z0FA 4L15A 4M1MA 2AK3A 4A1FA 4OQXA 4MITA 3JQQA 4AK9A 3V4FA 5EP1A 1N3BA 1G7SA 3W2GA 3I73A 1VG8A 2ODEA 1VQPB 2G0NA 3LBIA 4HAZA 5EP4A 1GR1A 5DHFA 2QE7D 2OFOA 3AVYA 4Q03A 2QM8A 1CJUC 3EZ9A 3I72A 4V02A 3LX5A 4UXHA 3CMAB 2QT0A 5FBLB 4F4JA 1ZNWA 5B57C 2V55B 2H16A 3OIVA 2CHQA 2V4ZA 1KIMA 3CNLA 1W87A 4LBYA 1GVHA 5HZHA 3T1TA 1NG1A 1Z8FA 2F43A 1J90A 3TR0A 2JLUA 3G4SB 4ARZB 4KLNA 5LBIA 1YHQB 3W5UA 1TQ6A 4FMCF 2HCBA 2JEOA 4JLBA 2W6IA 4AYXA 1E2MA 1Q1BA 3THXB 4K46A 1U81A 621PA 1AA9A 5FFMA 1EFCA 3MRSA 5FOWA 3GFTA 3LRPA 4RCYA 1Z06A 2ZJ2A 3QSYA 1ZIOA 1HYQA 4DJTA 2N42A 1GL6A 1E69A 1TNDA 5CLQA 1BKDR 4Q9LA 4Q4JA 1VTKA 2XZPA 3OIWA 4JBYA 1NN3A 2VTKA 4I99A 1ZU4A 4G5GA 4HDQB 3AVQA 1TL7C 2QPOA 4F4IA 5JCPA 2W2TA 5BW8A 2IT1A 4NONA 5AWFC 1VCNA 1NY6A 1JEEA 4BPBA 4BLOA 4AKGA 1YR6A 3CX8A 2Q21A 3N2IA 4PPFA 4TQ9A 5JWHA 3ZS9A 1QVAA 3ZYCA 2FF7A 3K0EA 3RRMA 2EVWX 3MUFA 4M1YA 5CIWA 1AGRA 2ZJ8A 3D3QA 1YR8A 4EPRA 1NY5A 2GAAA 2OT3B 2ZRIA 3N2EA 2EWVA 1GOTA 1TX4B 2C8VA 3MG9A 4HUQB 1FRNA 4I1OA 5JI2E 3LQQA 1P75A 1JALA 3GJ5A 1KJWA 5B30A 3W5JA 3U7HB 1NJGA 4JLKA 2QORA 1SVWA 4HLQB 4BLTA 2AFHE 5H8WA 1SGWA 1CS4C 1FP6A 1OFIA 1SKYB 3NEJA 4U00A 1G5PA 4NDZA 3U44B 1LNZA 1FX0B 1KSFX 1YZQA 1W47A 3NBFA 3OEHA 2G1JA 4IVPA 4XH9B 5FUVA 5J40A 1XTQA 1YR7A 3GCGA 1YJWB 3VR4A 4PC1A 2WKRA 2JDIA 5CK4A 3AQ4A 2HLDD 1OXSC 3FJOA 5DYGA 5JRZA 2X3UA 3OW2B 1IY1A 4MKIA 4MGYR 3AVXA 3CCVB 3DM5A 4FXPA 3U60B 4G1VA 1ZJ6A 3I8XA 1CR0A 2KE5A 3V9PA 2CNWA 3QEJA 4CGZA 1KI2A 1XEXB 4PAQA 3GLHA 2GXAA 1JPNA 1I2DA 5DI3B 3IHWA 5KSOA 2BF4A 4TLCA 4PXAA 1ZM9A 2CL6X 3D7MA 5KOYA 2YWGA 1XXHA 3Q5DA 3TUJC 3WYGA 1XEFA 1E98A 1LF0A 3I4LA 4JBXA 4DCVA 2ZSDA 2X2EA 4EQ6B 1YITB 5L3QB 3P1JA 5L3SB 1S72B 4JKYA 4P31A 1VIYA 3W2EA 3CPJB 1YQTA 2VBCA 2HCJB 4AKIA 4ACAA 1VPLA 4I1UA 5KSYA 2ZIAA 2J59A 2BM0A 5LB2A 2W0MA 3KKQA 3CIOA 3CWZA 3SFVA 2GPJA 4IFEA 1ZD8A 4LJ4A 1RZ3A 1P73A 4DLXA 1GITA 3B82A 3GLFA 2YC2C 1KGDA 2GTPA 3TH5A 3CC7B 1ZCAA 1E1RD 2A2ZA 3KTAB 4NCIA 4D82A 4M9SA 1X1SA 2IYSA 3FFBA 2C9OA 3EZFA 4Q66C 3EW9A 3RABA 3GLIA 1NDHA 1KO5A 4HUTA 4PC2A 2D7CA 2P67A 1O87A 2IS1A 2P6RA 1ETUA 1ZIPA 4P3YA 2Q9AA 3LW7A 2CLSA 3B1ZA 4RFSB 4TL9A 1R2QA 1QUEA 4OHVA 2G0TA 3EA5A 1XTJA 4C7OB 1VQ5B 1OHHD 1TMKA 5BYKA 2BV3A 2IUTA 3RS7A 4B44A 4ACBA 4GOKA 4GOJA 1VG9B 1N6PA 2GNOA 4QRHA 1ZP6A 2ATXA 2ATVA 4FMDB 4U9UA 1WA5A 2ASEA 4HLDA 4MRSA 2EYQA 5AR1A 3RDPA 1OH7A 3NBZC 1QHIA 3JZMA 1GAJA 3W3ZB 5SZHB 4IOKA 1CXZA 4Z8YA 4JVNA 2ZRHA 4Q47A 3OIUA 4Z51A 1F2TA 1YIJB 1QX4A 3A8TA 1XCPA 1II8A 2UZ3A 3AF3A 3EWSA 1E9EA 4W7SA 3CC4B 1XD2B 2B7CA 1M6NA 2V9PA 3DOFA 4HSEA 1CR1A 1G5TA 1GRRA 1P61B 1Z6TA 2I1VB 4GMDA 4DLRA 3OAAD 2ZU6A 3PITA 4WVFA 5FR2A 5L8VA 3RS0A 3U3KA 4MGZR 1PLKA 3SEAA 1COWA 4ZKDA 2PEYA 1Z08A 4Q4AA 1KSGA 4BASA 2Q9BA 2XOKD 4LSGA 2O8EA 1AJEA 3HU1A 1XWIA 4KAXA 1M74A 3W5HA 2PCLA 3WMGA 4XSHA 2ZRJA 2CE2X 1FTNA 3G5UA 2LCFA 2CXXA 4YDHB 1HQCA 2GBLC 2QTHA 1E2IA 1YHNA 5K8IA 4XSGA 4BLSA 2C96A 2FFAA 3BAFA 4M21A 1NLZA 2VYQA 1W2GA 2QA5A 1UBCA 3CC2B 1P2VA 2IYXA 3U7FB 2XSZD 3ZGXA 1YU9A 4UXIA 1KO1A 3BH6A 3LA6A 1ANKA 3U7GA 4TMXA 5TR9A 4RD6A 3OEEA 2JLXA 2Z4RA 2BMJA 4DDVA 1T4GA 3TE6A 3JVVA 5KPJA 1BIFA 3VKWA 2XXAA 1M8PA 4ILEA 1PLLA 2CMKA 3AKEA 1E0AA 1TEXA 2DWQA 3W5IA 4BLRA 2J9RA 2BM1A 1XPRA 3NDBB 4WQMA 4B48A 2VLIA 3GLHE 2GVDC 4ZDIA 1R0ZA 3BFKA 4QHSA 1F6BA 4MRVA 4LUCA 1KO4A 3B78A 2PL3A 1UEJA 5SZKB 4LZZA 1Z6XA 1X8LA 2OILA 1LB1B 5J4LA 1B23P 4QNMA 4YMSA 3PENA 2OESA 1T91A 3FDIA 5D3MB 1ZM2A 1FRQA 1W0KD 4FINA 1J7KA 4FK8A 2ODNA 2JIZD 1A2BA 3KB1A 3PEWA 1XMSA 2QAGA 3V76A 1LY1A 2WWYA 3WHLA 3QKTA 1YJ9B 1CJTC 1H8ED 3OJWA 1IY2A 2XTNA 3EWAA 4C0JA 5KSWB 1KZ7B 3CPHA 3K1JA 2E1RA 5LD2C 4MDFA 4G5QA 2IWRA 1PUJA 3Q8XB 3LX8A 4L5BA 4KU4A 3GLFE 1OGIA 4N0DA 3A1WA 5CJPA 1KJYA 4AURA 4OHYA 2AHOA 1EGAA 1T0JB 5EJEA 4Q1FA 1OSNA 4B43A 2ZJZA 2BBOA 3NH9A 2B21A 5HXBA 3PUZA 4IXNA 4W9MC 1W4BA 4NYMQ 4D4LA 4WOPA 2GQFA 2YYZA 2RC6A 4LC1A 4PHHA 4D4JA 3B7GA 3E70C 3QG1A 2HT6A 3MD0A 3GEHA 1GAWA 1NN1A 3NVAA 4P4TA 1WBDA 2FSIA 4EJSA 1GM5A 4ON9A 2VNKA 3THOA 1XB2A 1QH0A 2XX3A 1FMLA 3EZ2A 2QTZA 1MR3F 4CDGA 3HWSA 1S96A 3PQCA 1KAOA 1I4DD 2F1RA 1N6RA 2EWWA 2P5TB 3BH7A 2YOGA 3VHXA 3P4YA 3BFVA 1D2NA 2BKUA 1LTQA 4D0GA 2VEDA 4PZLA 2ORWA 3QEOA 5C4MA 4IDNA 1V43A 1EG7A 1QHXA 4D26A 4OKSA 4HB3A 1AMOA 4BFZA 2ZYVX 1RE0A 2BSAA 3RLFA 1QVRA 3W2HA 3LLMA 2D2EA 4RD3A 3DPUA 2QG6A 1XMVA 1DAMA 3ZBTA 3P26A 1FL9A 3RWMB 1BQEA 2OXCA 1VQ4B 2OZEA 1FNNA 3EZ7A 1Q7YD 1E2EA 3FMIA 1KI6A 2AK2A 3FHOA 3RANA 4DB4A 1TPZA 3F0TA 5F9HA 4JKIA 2FN4A 1YR9A 2X1VA 2F43B 4LYAA 4YC7A 3OE7D 3LO8A 1MABB 4LCBA 4US2R 2C2HA 2HXYA 3GEIA 1DO2A 4C0LA 2OEPA 4B2PA 4A36A 1IXRC 2CCKA 5LDDC 3UK6A 1KK0A 2R6CA 3QI2A 3VR1A 2C95A 4ESHA 2QL6A 5HE9A 2NO1A 2WWHA 3SR0A 3DL0A 4JLMA 1OIWA 1VQ6B 4JZKA 4X8MA 1E32A 1PUIA 2IUUA 2W2VA 3EIEA 4PQYA 1KI4A 4JJZA 3U5ZB 1R8SA 2F7SA 3AVUA 2C03A 2VPPA 3KQNA 3CB4A 2GZDA 5KSZA 3GQBA 2DR3A 4LY6A 4ZDWA 4E09A 3UATA 4DUGD 4ZIRB 4KBFA 4OL0A 221PA 2VP6A 4BWYA 2RHDA 5LD2B 2PX0A 2XJ4A 4A6XA 2BCJQ 3DEFA 2JJ2A 4A92A 4QBHA 4Q4HB 2ZRAA 2FMXA 2XGJA 1HURA 4KJZA 1ZCBA 4LJYA 4RVCA 4Y0AA 1G18A 1N2CE 4Q1EA 2W2XA 2RGCA 3A4LA 2YZ2A 3FMPB 3TJZA 3MJRA 5HKKA 4LC0A 3T1OA 1JAIA 2P6UA 2WWFA 2LKDA 4Q9IA 1JI0A 1H8HA 4C3ZA 4NYJQ 4ITRC 3W2FA 2G88A 1TF2A 4JL5A 2IS2A 4TMVA 1AQYA 2ZJBA 3QKRA 1E4VA 3AVPA 2IWHA 2WHXA 4PANA 521PA 1J2JA 3ZDQA 3WRXC 1Q3TA 2JJ8A 3KJEA 4DWJA 2VH5R 4FIDA 2PJZA 3LDAA 4PFSA 1TAGA 1JXOA 2RAPA 4CIDA 3N70A 2I3BA 5FPTA 3FVQA 4DCUA 4A8JA 3B5JA 2QGZA 2Q6TA 2GESA 1MO3A 1VQLB 1G7CA 4TT3A 1A2KC 3K9LA 2GETA 4MYTA 5F2EA 1FTSA 5JZVA 3KQLA 1QGYA 4DHEA 2GJ8A 4QBIA 2DHRA 3PUVA 5HR5A 1VQMB 2ZSAA 4Q4LA 5TB5A 1CRQA 1E9BA 3IEVA 5AJVB 1TEVA 4HAYA 2XNDD 3O47A 5GJWC 2R6AA 2FGKA 3C4JA 4PZYA 3R9XA 4I81A 1W44A 4IKEA 3GLHB 2WPDD 5DLQC 1J70A 2FFHA 1GKUB 2GF0A 2QSYA 3ZH9B 1G8PA 2Z43A 2R9VA 1XXHB 5G3ZA 3THYB 1ZNYA 1WRBA 3K9NA 2GJKA 2QM7A 1XTRA 3AF2A 5KYKA 3ZBUA 1ZMXA 2O8CB 4IRUB 3X1DA 4AI6A 2DYKA 1LV7A 5TARA 5E3HA 1CR4A 3I3SR 2P6NA 1DE0A 1BYIA 1WF3A 4YAFA 1EWQA 1DOAA 2ZRDA
chains in the Genus database with same CATH superfamily
2GILA 3MUOA 1SC3A 4G01B 4K6FA 3B85A 4MUFA 3OFJA 3NS7A 1HQDA 4TTVA 3WKAA 1NGSA 1ORWA 3M2TA 4OA8A 3MWEA 4JI0B 4M7OA 1SR8A 2DMRA 4ZMRA 2R8OA 2X77A 1JS1X 2AA3A 1QP7A 2SBTA 3EWIA 1L5RA 3SQNA 1L4LA 5JZBA 4FR0A 1Z5WA 1EQUA 1X87A 4IIBA 4KIUA 1SZCA 4NCJA 3A7EA 2L19A 3K6RA 2EF0A 3ROZA 1O95D 3RBXA 1C9YA 1EVIA 1D4OA 4FYHA 4QDXA 3KSMA 4O25A 1MRZA 4Q3OA 1UQRA 2EFCB 2ZTSA 3BY1A 1C80A 2A5GA 2RGDA 2VN8A 3L7OA 5LUAA 3DAPA 3GN1A 3NBKA 3ZD8A 2BDUA 1VMKA 2GAOA 2IA5A 3AJ9A 3N7AA 5P21A 5E9JA 4CEJA 5EGNA 4TMWA 1QYXA 2R751 2VAMA 3QYJA 3L0CA 4MVJA 3KXKA 5T3UA 2XMQA 1KQFA 1ICIA 2G17A 3C2QA 2R1VA 4NCXA 1VPWA 3DDCA 3WL8A 5A4FS 1V1RA 1T0HB 2RK3A 3ET4A 4UD6A 4G41A 5GY7A 3CUKA 3LPAA 4XLHA 5AW0A 4RSGA 3DYVA 3CXCB 5FPSA 3UMSA 1LPNA 2R5FA 5AXBA 6YASA 3NMUF 2FQWA 4JSYA 3U0VA 2WILA 1WM1A 3LUDA 3ZCSA 2ZCUA 3R41A 4MVYA 2P41A 5SV2A 2Q9UA 4R6XA 3PXDA 4ASUA 1CY2A 4CQMA 1NP3A 2COKA 3W7BA 2CV0A 1C7FA 3COVA 2Q3DA 1FSZA 5T64A 4EM6A 1I7SB 2A4KA 1WTAA 1VL1A 3UPDA 4XMYA 1N3IA 1PYGA 3STHA 3L8ZA 3N5KA 1DELA 3JQCA 4JYCA 1ECGA 1EGVB 2CN1A 4HH3C 1NXVA 3AFIA 4MRMB 3AEQA 5LZ8A 2LDXA 5KQGA 2QBYA 2I2DA 4BNFA 1Z0KA 1JE1A 4RWEA 5FV7A 3T3EA 3A1NA 4Z0TA 5CCXA 4MVXA 5FPHA 1TVEA 1A4IA 5EQDA 4HP8A 3WS7A 5A02A 1MJHA 3Q8LA 3BPSA 1XHFA 2ZPAA 2F1KA 3VQTA 3ESDA 3Q6QA 3AHEA 3H2ZA 4RU1A 3BD7A 1Z0SA 2VT7A 1JHQA 1K3FA 4QULA 4C7BA 4Z53A 4WNAA 5EESA 5CITA 2OQ2A 3D1JA 3LJKA 4B7AA 1VCOA 3D02A 1QGOA 3CW9A 1Q0SA 4YUXA 4OXNA 3ROQA 2XITA 1YLOA 4RL6A 3AJAA 1X8JA 4UTOA 1Z6AA 3LNTA 1DBIA 3VR0A 4XTCS 3E8MA 4WT7A 3C6ZA 3RHTA 4U0JA 1VSBA 4UPDA 4BCCA 3RFTA 2UUAB 2IXEA 3BL6A 1XJWA 4CF7A 4DANA 2LV8A 3ZCXA 1SM4A 3FVTA 2AX3A 3VO1A 3N7UA 5C1BA 1QF7A 1II0A 2ZIFA 3L1IA 5T4BA 1VYHA 4KN6A 4FHCA 4XPIA 3WLFA 1BEZA 2G9UA 3CZ9A 4KQ1A 3RVDA 1ZVVA 4KITB 5JH7F 4BVAA 1M10A 1D6JA 1XO1A 1FE8A 1XZFA 2CCJA 2H1CA 1KY3A 2OLEA 2WSIA 3I9MA 4OHOA 4XDHA 5EUQB 3T1QA 5E1DA 3W1VA 4BVBA 1KBZA 2NT4A 1PEDA 1V96A 2X5OA 4D0NA 5MGBA 2EL9A 5FTJA 2V8OA 3H3JA 2AJDA 2D3LA 2XZLA 2W83A 4D9JA 5ELXA 1EYZA 1NW9B 1OBFO 1QOZA 1ZD2P 2C00A 2LRHA 2ODWA 2PX3A 2QW0X 2DCUA 3B6ZA 3O3NB 1N2CB 4QECA 1H23A 1POXA 1PX2A 3D3JA 4ZZ0A 2X40A 2EFYA 3MCVA 3BK2A 5CT8A 2QRVA 1RJ9A 4OO3A 3RLIA 2X2PA 1TJYA 2Q28A 2C2KA 1VQNB 3GJTA 5HFNA 2D7DA 3D8UA 3OPXA 1CDZA 1T3GA 4YRLA 3IE1A 3RUDA 2GBGA 5BUZA 3SZGA 1WY7A 4Q1CA 5ITVA 3V2UA 2FSFA 3ZJ4A 3B89A 3WQSB 1Z56C 5FTMA 3RASA 4BVEA 4RTLA 5EQJB 2Q9CA 1K92A 3R1IA 1LI7A 1NAIA 5DNDA 4KNVA 1ILWA 3ZKAA 2GEVA 1A7JA 1Z82A 4N49A 3P5BA 4RMNA 1QFSA 2GREA 2CLEB 4IKPA 4A8HA 1NM5A 4Y2YA 5IJAA 5FT9A 2GO7A 3KYJB 4BP8A 4G25A 4F86A 6REQB 2MINA 3UY4A 1P4JA 2JFZA 5H0IA 1A96A 1AQUA 3KWFA 3IBCA 1BMFD 4UVIA 1DBRA 1I0IA 2YUIA 4DRXA 5ADUS 2VSOA 1TYEB 1VZ3A 3FGPA 3QLUA 2JZNA 2YIDA 3B3AA 4OI0A 1TB4A 3ZDEA 1A27A 1VL5A 5TQ2B 1KO7A 2A9KA 2XCQA 3VYSB 3EQ6A 1AGPA 1Y3CE 2OXFA 2OQIA 3K0KA 5B3KA 2JFYA 2XJ9A 1XQ9A 1J39A 4H9GA 3L3BA 4XDGA 4XD7A 2ECQA 5AVYA 2P11A 1IWOA 4K6HA 4QJBA 3DAYA 3UH0A 2IIVA 3CUVA 2GR9A 3GAFA 1SVLA 3P20A 3E1SA 4U7TB 2GWHA 2Z5GA 4EW6A 2XLCA 2ECKA 4PLPA 4LJ7A 2N0SA 4IG4A 4MKFA 1EFAA 2B8WA 1BQ3A 2RJOA 1LI5A 2QGNA 2QV7A 1Z13A 2DWPA 5H70A 5B12A 2VZLA 4UNQA 3QYFA 1C1HA 2I4MA 3QXJA 1BD3A 1R0WA 1K5DA 2LUOA 4HCJA 1YBHA 3QOFA 4YMHA 1AQJA 3PEYA 1Z5OA 3R7DA 2FLVA 1I6WA 4HQRA 4NABA 1KAMA 1V45E 4EAQA 5JHHB 4MHTA 1U0GA 1O94C 2ZE5A 2B7BA 1P9OA 1UJMA 1V2GA 1Z07A 2A9QA 2CVHA 1R4AA 2PS9A 3FNIA 4WASA 5TE9A 4D9FA 4BFCA 1O0CA 3T3NA 2FW1A 3QE3A 9ABPA 4K5QA 5BSEA 3ND8A 3NOQA 1ENOA 5JALA 1OR8A 2XWQA 1L5HB 4CFZA 2NYRA 3PGMA 4MS3B 2GERA 1CY4A 3GGCA 1UMCA 3SJBA 4TROA 2Q6VA 5EL0A 4LMPA 2Y1KA 1QV7A 3C8HA 1YJ8A 4F3YA 1DQZA 3ED1A 5JAHA 3FFTA 4KKSA 4FVTA 4N12A 4RGBA 3HR7A 2N46A 1EFTA 3J81k 2D2VA 4D3YA 3WGIA 4HTAA 3KD2A 3HCPA 3FSGA 1H42A 2ZZGA 3KD3A 2M6LA 5LIPA 3T1VA 4R2HA 4YRSA 1KEPA 1HX7A 4S1PA 5B1EA 1PT9A 2OWEA 1Z28A 3BE6A 1TI7A 4NG5A 4ITUA 1XIVA 2EDCA 3BGIA 3BAZA 3CX6A 3EGDA 1KDYA 2VJMA 1E92A 2J8ZA 4BE4A 3ZHTA 1DUIA 3Q7RA 4PX5A 3U0BA 3ER6A 3EC1A 4HWOA 4PR3A 1GL7A 1LBHA 2IY7A 1T3LA 3SR3A 1GN9A 1Z73A 3IT3A 3MTDA 2I4RA 3LXRA 2AR9A 1M0WA 1KMCA 1EP9A 3TLYA 5IC4A 1WMDA 2B1IA 3FZGA 3D4PA 3J81A 1KYIA 2J6IA 3GJ7A 5A89A 1P5ZB 4D8UA 2WLSA 3FWZA 4RGVA 4P2GA 3AF6A 1O1YA 4MVWA 4B2IA 1ISMA 1FBNA 2H2WA 4M8KA 1BE1A 2YMQA 2ZRNA 1F3LA 1GD1O 1T4DA 3H7AA 2NUTB 3QXHA 3OP1A 1J8DA 1YJXA 3AOEA 1VQ9B 4DLUA 3URMA 3Q9SA 4AUKA 4YHBA 4K9OA 3UJAA 3PUXA 2I0FA 2B6NA 3T53B 1T3SA 4EWLA 3QF7A 4TQGA 1CRWG 1T2AA 2C8LA 2Y93A 4HDRB 4JLPA 5AHRA 1SUAA 2FY8A 3G2NA 3L8DA 5D8DA 1OXXK 4KXWA 2FDRA 4NY1A 1ORTA 3U3OA 1FXWF 2OGZA 4E1VA 5ILOA 1R9NA 4GNKA 1N2IA 1QG2A 4XQFA 1FNBA 2I54A 3VPDA 2XUZA 1PFUA 2LKCA 1WVIA 3A10A 1YQXA 2Q4BA 5IHPA 1DTWB 1U8UA 3H04A 3KJGA 3UAVA 2NZWA 2CNNA 2H2DA 3VU3A 1GNVA 2YIJA 4EHJA 5J47A 4HI0E 2HV8A 2P2ZA 4G5OA 3TEJA 2YX1A 3WGZA 2HRZA 3DOIA 4X7BA 4EA7A 1XT6A 1HE8B 3K5HA 1SD1A 4HAOA 5AW8A 4G5YA 4LWPA 2I2AA 1GSHA 4F2GA 3RSLA 2FEXA 5BRNA 1GCGA 1RYDA 4BE7B 1PU2A 4KFTA 3PTAA 4YBRA 3VNAA 2Q7XA 4R2XA 1T5IA 4ZRMA 1J2EA 4CKBA 5LXTB 1YZUA 4GXTA 1RKXA 5JASA 3BRQA 4QYSA 2HBZA 2HH9A 1G4AE 1E3XA 1WSAA 2M1XA 3RWOA 4OIFA 4PFQA 4NOMA 3GEEA 5DLDA 3RIMA 2XODA 3W9YA 2HU2A 1CLUA 2ZT5A 3Q5EA 1UD3A 3L4EA 4DLZA 5HJEA 1KJIA 2CMDA 4P34A 1QF9A 1FDUA 3T3IA 1XJ5A 1JTFA 4XVUA 3GLGE 1Z63A 2O2ZA 1MNAA 2MWMA 3KXIA 1IOZA 1MO5A 1NQOA 5J2TF 2F00A 1MOSA 1PR6A 1V9CA 3EW7A 5EP2A 2B69A 4G5FA 3V1UA 2C4WA 2PUEA 1N0UA 1M2JA 1XMJA 4GE0A 4MIYA 3RK1A 2VDUE 2O57A 3NR2A 1ESDA 3FOFC 4AMZA 3UT5A 1I1OA 1RRVA 2GEKA 4ABYA 1K66A 2EKPA 3KDAA 4CG2A 3NW9A 2Z9DA 1R8YA 1FP4A 3DL4A 3FNFA 3PK0A 4Y9RA 2QAJA 1EJ6A 2KB0A 4RZ3A 5DGTA 4ZEOA 3RUEA 2B94A 1WU8A 4UZSA 4F4CA 3LRXA 1NYTA 2FQQA 2D3WA 1G5IA 2YS6A 3A4NA 4DMUB 4QJ3A 2W7TA 4Q3DA 5K99A 2OBYA 4EB6B 1Y5RA 1XJQA 2GVNA 4PGMA 1OA1A 1PGPA 2GSWA 3EK2A 4QBTA 5DGIA 4BGIA 4R84A 4Y6QA 5I9BA 3D5QA 4V24A 2BELA 2GJ9A 1KDOA 2AZTA 2VHCA 3NXKA 3PA6A 2CJWA 2AMJA 4OAQA 4EUKA 2YYAA 2J67A 4ZK6A 2WK1A 5GADl 4IFIA 2VOJA 4GGMX 1G7RA 1Y98A 1RVDA 2XDQB 2X6RA 3OTIA 4DJDC 2IC5A 4J3FA 1P7CA 2BFDA 3U3JA 5A5EA 5KJ1A 1ZGZA 4EHIA 4KQKA 1KTIA 2X53S 3FPKA 1IHMA 1TA4A 3L77A 4J4TA 3SZRA 3V1KA 1GZSA 4M7PA 1I6KA 1WE2A 3F96A 1E2QA 4M9QA 4PG6A 2WSSA 1TQDA 4Z4IA 3IJRA 1GKYA 4U7FA 2DWOA 5K09A 1HDIA 2R2GA 4IVNA 4RTQA 5KZMB 4ZI5A 3N75A 2V7EA 3GVPA 5BSWA 4TZ0A 4L2IA 1UDWA 3BCRA 5H1YA 1U3WA 2B2XA 2DJIA 4UMFA 4YPOA 1W0JD 1BQ4A 3DDNA 5HGJA 3BGWA 3SC2B 3WAKA 4I4CA 2O06A 1EUDB 3U7QB 4Q5IA 4YAKA 2UXDB 4L8GA 2P7HA 4W1QA 2FEPA 1ZK0A 5B1HA 5C1IA 2JGNA 4O4JB 2REQA 3N07A 1NM5C 4FFWA 3GSIA 1QSGA 2I3ZA 4QXAA 4X45A 4QQRA 4PHGA 2ONKA 3L7BA 3WBJA 3AOGA 4KMRA 4QATA 4BAZA 3GLRA 4B80A 1PFVA 2VLBA 2HPZA 2P2SA 2ZSHA 4HYYA 4HQOA 2BAGA 2OQVA 1A8SA 4CYMA 1E3LA 4C0WA 4V0NA 3Q3GE 1NNUA 4BMPB 1ECJA 3LSYA 2R7KA 2BKLA 4HYEA 3UJ6A 3DTYA 3PQ4A 1EFKA 1JHRA 1YBMA 1WXGA 3VPXA 3SC6A 4AWAA 3CO0S 4EUNA 5A0TA 4BECA 4RSHA 2YKGA 4GP9A 1YKGA 3LWZA 1M75A 1O9HA 1VHTA 1Y7TA 2DBRA 4IEIA 2MT9A 3BGVA 4YDSA 3R7NA 4UQLA 1XXHE 4I6GA 1F48A 2LPMA 3SEZA 5HUJA 2VDRB 3CA8A 3OQHA 3ZWYA 4XCQA 4H27A 3PA2A 3SCZA 2W90A 2P8JA 1O6FA 4LRUA 4QUDA 4NBKA 4TN5A 4NZ9A 3Q1LA 5IBQA 1KZ1A 4M22A 1I14A 3AW9A 3C5CA 3RYFB 3SLKA 4Y2RA 3ZNPA 4B5KA 4N5DA 4PLHA 1IBKB 1YJ5A 3CEMA 5LBUA 2N9UA 5L95A 2B4AA 3DQPA 5ALHA 1MJGA 4KGDA 3QMVA 3KL4A 3BWMA 5DM1A 2O20A 5KDDA 2AOTB 2GKSA 3PXAA 2Z6UA 3HO1A 2IUEA 1D2EA 1FFWA 1F51E 2VT6A 3ET5A 4WKNA 4WTOA 1F7VA 2FVGA 4II7A 3FHCB 3WGMA 1KVUA 3SC3A 2OCIA 5CP8A 1E4YA 1K4YA 1C3JA 2NO0A 1JHDA 4JLWA 3N6XA 3D6JA 2QE7A 1AGXA 4LJAA 4RKYA 1DHRA 5NLLA 4WINA 1Z17A 3TDKA 4BZXA 2Q2QA 5K01A 3TOVA 3TJMA 4P1VA 2FE4A 5JNVA 4IYRA 1JLMA 4FOLA 4WESB 3DJFA 2X0KA 4GI2A 4ZYYA 3KR1A 3O94A 3GW8A 4MO2A 3QH4A 5A0FA 1YL6A 4ENPA 1Z5VA 2QTLA 1SU4A 3D0KA 2BZ0A 4I4LA 4Y6GB 3PRKE 4QUZA 1NP6A 5JEDA 4RMGA 4EDHA 5I5GA 2QEXB 2ZJ0A 4PPYA 2Z3WA 4INAA 1DS6A 1KL7A 1VCMA 2XVAA 1M34E 1Q19A 2HNAA 3DP7A 4AFNA 1ZUNA 3AETB 3SX2A 5IAAA 1ESZA 1WU7A 1H5UA 1NVXQ 4FONA 2PGJA 4HTFB 2DFKB 5BSKA 1MTOA 2FSHA 3ETEA 5E0KB 1C8VB 2XADA 4XX0A 2FFBA 1CYDA 2W6OA 4QLOA 1CTQA 1J24A 1NI3A 4CKYA 2TSYB 1P62B 1DQNA 1OPXA 2J31A 4IDHA 4H2DA 3T7CA 1TYAE 5IN4A 1OF1A 5HIAA 4PO8A 5JZOA 3SWWA 1RS0A 4L08A 3VHLB 4BO1A 3H6GA 4ZU3A 4ZN6A 1LWOA 1TYCA 1U8ZA 3JWGA 2NUPB 3OJCA 3RC9A 2Q2VA 1YCGA 1YS6A 4PYKA 1N78A 2G71A 1CUUA 3MJVA 4N4AA 4GUAA 1Z8DA 1JEAA 1CZUA 2QQGA 3F6RA 1WZEA 3AOEC 1SG9A 3CKLA 1GG2A 4PSUA 1QM5A 1JR6A 3G85A 3TLGB 3E7PA 3TMYA 4ZP1A 1L8OA 1DAHA 1L7QA 5BT9A 3V1MA 3WL3A 3P32A 2C94A 1H2BA 1BN7A 1JIQA 2IIPA 1BHO1 3RIEA 3N5CA 4RHCA 2QTFA 2EIXA 4OPMA 4KEAA 3GAZA 5MHTA 3I5UA 3M89A 3CF0A 4MQEA 3HJAA 3P9IA 4OXQA 2PRZA 3GLGB 2VTVA 1J0XO 3NE5B 2PZMA 1PJ4A 4CJXA 1EESA 4GWKA 4DR1B 3BORA 3A31A 4HIZA 1NIJA 1VMIA 2HBQA 3LG2A 5GQSA 3UYKA 2CLCX 4OQYA 4YFVA 5CFLA 1S9DA 5KYWB 1T8YA 1AK9A 1WP9A 1Y3HA 2IJGX 3K0HA 3MWFA 3TSAA 1GADO 5L3ZA 4ZGWA 2ZETA 3AF1A 1F6WA 2G63A 2Y99A 5GJCA 3G79A 4UM9D 2BMEA 3WWPA 1QRSA 1G42A 1TJNA 3G7NA 3U7GA 2VHJA 2Z56A 4HJXA 1ZNXA 6AT1A 1WUHS 3T9AA 2E9SA 5JAOA 3Q41A 1UPFA 5D5QA 4B7ZA 1Y1TA 1GZDA 1NUHA 1SKUA 3B20A 1GPMA 1T9ZA 1TZMA 1NXTA 1MGOA 2ZRCA 1N2ZA 3WQHA 4G7XA 5IHXA 2JH9A 1MH9A 2WHEA 2ZYIA 1NBWB 4GDFA 4IIVA 4QU8A 1ZZGA 3EN0A 5ETJA 3K05A 3U6KA 4RK6A 1JG7A 5FJIA 4CEHB 4LHZA 2PRKA 2Q5CA 3U44A 3OETA 3KAQA 4L6IA 5AHOA 4DW8A 4E1BA 821PA 3FYCA 2I2CA 4LJ9A 4K28A 4QXPA 1RYZA 3PDIB 2WZQA 3PEEA 4CF5A 4QDUA 3H6KA 4WFKA 1WB9A 3IQWA 6ADHA 3VAZA 4R1LA 3ZEAA 1GRNA 2D5AA 4C2TA 3AUYA 4Y1RA 3QE9Y 4IP0A 4EIWA 2PANA 4FS3A 4MV8A 5B7GA 4BJ1A 1GPH1 1YHZA 1J20A 2IZ5A 2PFGA 2QTMA 3BQNB 4UREA 2JBWA 2NU6B 2DFNA 5H59A 3TQIA 2O1XA 4YP0A 3M8KA 1QZTA 3DR3A 4ZO9A 1IRIA 1CDDA 5D6OA 4NCBA 3S0JA 2VSNA 3CPXA 1KKMA 1X1CA 2BJHA 1AIPA 3HKDB 4HWPA 3ZQ6A 4UU8A 4AKHA 3TI9A 4JH0A 2W2LD 5IT4A 1BOFA 3BF7A 2B4YA 3WY9A 2FPKA 3EXEA 4L6CA 5F35A 1KY2A 5L3QA 2FZVA 3ZJVA 1DRVA 2COEA 3K70C 1VLYA 2ENUA 1VG1A 1K89A 2BBTA 2PQ2A 4LX0A 4M0KA 2GCOB 4OYYA 3GFOA 4EPXA 1GL9B 1WCIA 4DHWA 3BT7A 4EB8A 4DV2B 3ZJTA 3LPNA 4DMCA 1V48A 1C3OA 4WHMA 4A0GA 3WNQA 3A6DA 1KJQA 1JIVA 1LQTA 1YRQA 4AJEA 3BL8A 3Q3CA 3E0QA 4QU5A 1OX6A 1R6UA 1CHDA 3HJRA 2JDID 1HA3A 2RK6A 2XTJA 1MQAA 3FLMA 5B3LA 2GZSA 4X7MA 1N6IA 3IHKA 3DPSA 1DVRA 2W11A 1KS9A 1NFQA 3FMOB 1XE3A 4Y1EA 2IYAA 1QCYA 1MV5A 1VKOA 2RBEA 2CNWD 3DE4X 1JEQB 5DO9A 1YS7A 3HJBA 1DV1A 1E2HA 3WHKA 2YH2A 3EZ6A 4TLLB 4RVFA 5HF8A 1ZUHA 1MO6A 2E3JA 1OYYA 4OPSA 3H4IA 4LXQA 4WZBE 1B8NA 2L18A 3L18A 4F97A 8LDHA 3UOWA 3W4JA 3KQHA 2OV1A 4XQEA 4FB5A 2HSJA 1ZD3A 4IDOA 1T9CA 2A7QA 2AFVA 4UXJA 4PYRA 1HEUA 4H7JA 4KXUA 5C2JB 3T1YB 1O7JA 3R5FA 2M32A 4U2CA 3BZUA 1NV8A 3DT9A 4TS9A 2IXTA 3VR5H 5C7YA 1FYVA 4HFMA 4OB7A 1ATZA 1B6RA 4OSEA 3PX3A 3TMKA 2XOKA 2BWJA 4YROA 5ESRA 1JSCA 2ARKA 4BKRA 4YAWA 2WAOA 1G3RA 4MTCA 4D6XA 4URFA 1XDUA 3LPLA 4Z9FA 1W35A 1NNEA 4RD1A 1Y3AA 1GILA 1O77A 1ZIDA 3HFRA 3KYIB 3LUKA 1T8WA 2YVAA 3VSAA 1VBFA 3O7MA 1Q44A 1QFMA 3ZE8A 1VCHA 1HDEA 4DCNA 3OCVA 3EOAI 3RH0A 4D81A 3BIXA 4S2UA 4WCFC 5LA6A 4PRZA 1ZA1A 3AEKA 3ASVA 1CJVC 1G41A 3A35A 1SELA 3T61A 4BEBA 2GJRA 4ZK2A 2CNBA 1M34B 2HJHA 4V03A 2YXEA 4FGJA 3T9BA 2EAUA 2XSZA 2XYHA 4WXRA 3ZOKA 3MRTA 4MH0R 3BERA 1XRJA 3Q6IA 2OD9A 5KYUB 4XWKA 5MDHA 1CDOA 1KYYA 1DIGA 1ZIYA 2AF3C 2PPVA 1VIAA 3EWNA 1VB3A 3AY3A 1K3TA 2AS0A 3PFHA 3QLJA 4FC7A 4ML3A 2NTEA 2OBXA 5DSZA 1UOPA 2A57A 5J59A 6Q21A 1UD8A 4B73A 1SBTA 2M5SA 3F67A 4AG6A 4L0QA 2CW5A 4NH0A 3CP8A 2BHRA 3DBLB 3RAGA 4H6WA 5KVSA 1ZK4A 4M86A 3MCTA 2VDOB 1J2YA 1T1GA 2GDJA 3JATA 3UBTA 3DE3X 3Q6RA 2HY7A 1OB5A 2QPLA 1QKIA 2OBLA 2ZIWB 4XQ0A 2QQ0A 1FYFA 4AYWA 2XUKA 4GEKA 4PLGA 1KDZA 1NF2A 4I5DA 2I1WA 3BE4A 2WR8A 5KCZA 2B37A 4ALJA 2D3NA 3R5TA 4MV7A 4EKYA 3OKAA 1PZMA 2QSZA 2VRBA 3UMYA 3FB1A 5I9SA 2PR2A 3R20A 1L6RA 3D6FA 3G89A 4KC0A 3DVAB 3C5EA 2PGLA 2Q5LA 3M4NA 4TKUA 4URWR 3I9FA 1KRXA 3F8TA 2QRGA 5T8KA 1F0NA 1LNQA 1REQB 2YJ3A 4KXXA 4RS3A 2VFAA 2EF1A 3OM8A 2E18A 1X7WB 5JMPA 3WQBA 1PL7A 2HO4A 1R5NA 4ZI3A 2QRUA 1HT3A 1LNSA 2QM0A 3W0LB 2Q4TA 4BWVA 5JWRA 1LW7A 3MLEA 3DAFA 3ORRA 2JIZA 1M73E 2EEPA 2I66A 2NN3C 3RTEA 1NMYA 4TQUS 4LXGA 3K70D 4AJNA 4RSRA 3WJ7A 1XNGA 4CM9A 4BMOB 3NU1A 1HGXA 1U31A 2J6HA 3HJNA 3MMSA 4INJA 3RHSA 4IOLA 2NLOA 2R87A 2X1LA 3VNRA 4DEYA 2OAP1 4V0MA 3UMVA 1IYZA 3PR1A 2GK7A 4CTOA 4AZWA 1KI7A 1DO0A 3I76A 1ONPA 2EKDA 5LBTA 1TK9A 3H8SA 3IDQA 2PRJA 4JS0A 4DV5B 2XXAB 1YRWA 2WSMA 3F5QA 5M29A 4W9RA 5YASA 1XPUA 4PAMA 3G2IA 4LTDA 2WKQA 2BEWA 1JG2A 5A71A 2ZXUA 3K53A 3G5AA 1GY8A 4IIJA 5IZCA 4X9XA 5DS0A 5JSHA 4O2BA 3RROA 1F14A 3KXLA 4XEUA 2DLDA 3ZHYA 2XRZA 4I3FA 5J63A 4DUPA 3IKMB 3O8OB 4EI9A 3G68A 4HGZA 1BROA 3DH0A 4JVLA 1EZ4A 1G3QA 1P7ZA 2OY0A 3C3CA 4OHRA 1RPJA 4PX3A 4B84A 4D6PA 4EARA 1L7OA 4LF9B 1UP7A 1UMBA 2PY6A 1M6HA 1NVEA 1XHLA 2TS1A 3G1WA 4ESVA 4ROTA 2CHFA 4H0CA 5FP0A 1NBAA 3DMHA 2ZWVA 4DADA 2X0JA 1XTSA 4I50F 4QGHA 4C2UA 3EEYA 4ZCPA 3CW8X 1OBCA 4E2XA 2FWRA 1RYNA 3TZKA 4HVCA 1QFYA 1BU8A 1WKCA 4R0MA 1N5IA 3TZQA 4CM7A 3MTEA 3NEPX 4YIKA 2WYRA 4IAOA 2QVYX 1A50B 2GZAA 3QBVA 2CBXA 2OZLB 3W3AA 5FADA 5AW4A 1TW3A 1N7JA 3C85A 3ROGA 3S40A 4NECA 4C4TA 5GZ6A 3ASYA 3H83A 1H2RS 1SA0B 4Q02A 1SVKA 3RSGA 3WAGA 4FGZA 3ZDRA 4ARBA 2FRVA 3TXYA 4YJDA 3VAAA 1MB2A 1ZAKA 1YDEA 4KQMA 1UEIA 4Z4HA 2FDCA 1H2WA 1ZGCA 5JVDA 1VE5A 2WUEA 4CV3A 5JNUA 1FS4A 2IE8A 2R96A 2Z83A 2QP9X 3OE7A 2AEMA 2Q45A 3K8OE 1W5TA 4OQQA 4LYJA 4PPQA 3UXEA 1IIRA 3QFHA 3I9OA 5IKXA 4JI2B 4BMNA 1ZW1A 5K3FB 5C34B 2VA9A 3ZZ0A 3IJPA 3WNBA 2Y0BA 3QW2A 1TM7E 1X1AA 2KLBA 4GT1A 4PYMA 1VPDA 4YASA 1I32A 1R4ZA 1CQZA 2R62A 3FNRA 4I55B 4I1PA 3IE0A 3TUZC 3NWJA 2LIPA 3OHMA 3PHCA 4TZ6A 3PDJA 4PM4A 1W30A 2X9NA 4B75A 4DCJA 4Z4YA 2VJBA 1Y4UA 4MEBA 1YD7A 4YJHB 5K3SA 2W58A 4DDHA 2AD5A 1IOWA 4HWGA 2YVUA 3G2OA 2VDWA 4LDJA 3RBZA 5J4YA 1P80A 3DPIA 1USUA 2XB2A 5AXAA 4WZBB 1TYBE 1UODA 3TTTA 2DERA 2WICA 2I33A 4B3GA 2J45A 4REMA 4NS4A 2YWEA 1ZY2A 1RABA 2HF7A 2AGVA 4P7GA 3ZD6A 2OZVA 3B1XA 4BMSA 5JD3A 1P4GA 1TKRA 5BOVA 3BQJA 2B4TO 5JSUA 1EGMB 2JAUA 5KUTA 1NXQA 2AQHA 3L4JA 2H57A 2VHQA 3WK5A 4RCZA 1A9YA 1OILA 3DKVA 5E6UB 3KJIA 1C8KA 1BFDA 1WOYA 1Y80A 1T9AA 2C98A 4U39A 3AHHA 3FCYA 1C41A 1ZICA 2YOFA 4IIYA 4G1EB 5CJJA 2C3PA 4CKXA 4C0KA 4EKEA 1E63A 3KLNA 2ZXEA 2ZJFA 2HBYA 3GL9A 1IQPA 3RTCA 2E82A 1RAGA 2Y1FA 1MXFA 2NGRA 1K86A 3KS9A 4QYTA 1HY3A 2O7RA 3WR5A 2JHCA 4C7VA 5F64A 4EOGA 2YFYA 3MNFA 3DCNA 5CLJA 2J3DA 1R4MA 1GZVA 2QMQA 3CG4A 2P0EA 3OT4A 2B82A 2A9JA 1P6XA 1VJRA 1VPTA 4KVFA 6NULA 4L1KA 4CUJA 1IZZA 2FWNA 2RHRA 4K8OA 4QAJA 5G0SA 3VNUA 4QICA 3KKKA 6LDHA 2FP4B 4AP6A 3ZV4A 1SWWA 3WYCA 5J1SB 4JYBA 4N47A 4KLAA 4DY6A 1VG0B 1U6KA 4PZZA 3HUEA 4Y6RA 1ZR4A 1Q0LA 1HSZA 1Z0UA 2H5JA 4ALMA 5J4HA 4Z4ZA 3ZY6A 1E61A 5CXSA 2PKQO 1EWKA 3VI3B 5JO0A 3C39A 3JWEA 5JQGA 5FWNA 4PX9A 4NU6A 1XKLA 1UBSB 4Q7QA 3VXKA 1QONA 2I62A 2Q8QA 3A9TA 3Q7EA 5AIAA 2A5LA 5HDBB 5TRTA 2XNDA 1RHKA 1XWFA 4CL2A 2G6BA 1E2NA 4JL6A 4LZNA 2WY2D 4BX9A 1L5YA 3O3CA 5BWNA 3OE5A 1RYFA 2AH5A 3FUUA 3SZMA 3IUJA 5ECDA 5KW9A 2QQ5A 1UBFA 2YJ5A 4KZKA 3T12A 4GP7A 3LUJA 4LG1A 5JWOA 1GRVA 3LY8A 2K5UA 3K73O 3R6GA 2E7ZA 2BDEA 3KT0A 1VMAA 4JVSB 3LUBA 5DVZA 3W90A 2H1SA 4X1OA 4CN8A 4LXUA 4W5RA 1LD3A 1RAFA 4LDAA 4QYMA 1J9GA 4FYWA 3HDGA 5CEJA 5K3OA 5LQMA 1QQBA 4X97A 1DEXA 1TXGA 1WR8A 3L8FA 4B34A 5FWXA 1SAYA 1W5AA 3HEBA 1I4LD 1PHPA 4MUIA 1HFWA 1JH8A 3DF7A 4ZV9A 3OT5A 4U9HS 2IHJA 2WD7B 4EGSA 1R5JA 2QUJA 4KDFA 1LVHA 5CTJA 9LDBA 3I01M 4G3XA 3U7EB 3ZV3A 4NBVA 1Q17A 3QVUA 1QUFA 3PHJA 2KYRA 1WHTA 3HKBA 2VCHA 3PD0A 5L40A 2PGXA 4ETMA 3B9PA 4OGKA 1XZNA 2ACKA 4K9DA 3DVSX 4F3NA 2Q3EA 4HNHA 1NYLA 5ILGA 1L5VA 1B0UA 2AC2A 4R3WA 5T8KC 1STOA 3UHPA 4JL8A 4R9NA 5BW5A 3E20A 3LY5A 3NHYA 2OR3A 2BOVA 3I9NA 4RYDA 5I9TA 2GF2A 4Q9JA 3CSDA 5TPZD 3UXMA 5C51B 4XDYA 1H9CA 4JBWA 4CQLB 2V3CC 3KVYA 4KXQA 5AJZA 3TTVA 5EIXA 1QVVA 3V55A 1RQLA 5L45A 4TV8F 3EVGA 1A4XA 3HU5A 2CJYA 3C6MA 1W85B 3A37A 4MINA 2R86A 2I87A 1E6CA 4MPRA 4M49A 3WADA 4XAQA 3IJEB 3UMBA 1CEYA 1KEEB 4IJMA 4ZPJA 1M1NA 1P0CA 5DWQA 2ZTVA 2BIFA 5GMOA 4GI7A 2NUAB 4BB9A 4D80A 4HMPA 3E7XA 3CESA 2DKFA 1B8OA 3FIUA 3KJFA 4LDZA 4KSBA 4G37A 1VLMA 1Q3HA 5FNVB 5B37A 4UVDA 1Z0ZA 3K6SA 3GK3A 1QNLA 2Q3BA 5DB4A 2ZT6A 1DXQA 1AZLA 1Q7EA 2OYSA 5GONA 4LVNA 4MQUA 1S6YA 4XN0A 5KAPA 4AF7A 3UGQA 1BMTA 3RU7A 3T7DA 4PYJA 2AN9A 4N7MA 1OLUA 3C98A 4CL8A 2G9ZA 4U7HA 3EEQA 1CUWA 2OHHA 2OCBA 2BGLA