1KK0A

Structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
405
structure length
399
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDHSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGLVGGVLGGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVGTEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords eIF2gamma
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
total genus 96
structure length 399
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk0A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk0A01
4A6PA 2FNAA 3CCVB 4ZCMA 1N6IA 4MGKR 2VP4A 4ZKEA 1U8YA 5KHOC 2CE2X 5ANRB 4AD8A 2OEPA 1XTJA 4MYHA 2VNIA 3LV8A 2ODWA 3VR6A 5FBRB 2IYVA 3DOFA 1G18A 1Z0IA 5E7MA 4LZZA 2GTPA 4QHSA 1KSHA 3DEFA 3GLFB 1ZIOA 4MITA 2ZYWX 4LX0A 2XNJA 3X2SA 4F4IA 2C77A 3MAAC 1KC8D 4YXWD 4FXPA 2FSGA 5BYJA 1XCPA 2ZRMA 3MWKA 1Z6XA 3JVVA 4OHZA 2G3YA 3FGNA 3ZVRA 4XH9B 5BXQC 2FZLA 1Z3IX 4IEIA 1HQCA 3K70C 2SHKA 3RC3A 4TMZA 1XCMA 3VKGA 1JECA 3EG5A 1XZPA 2VIIA 3LVRE 3RYTC 4BLRA 3GLIB 1QZXA 4CDGA 4JVNA 5FOUA 2F1HA 2QG6A 4OK3A 1KO8A 2F1RA 4IVPA 3ZDQA 5KYKA 1WDTA 3A1SA 3QXJA 4JT4A 3LWNA 3X1ZA 4Q4HA 1MH1A 2FZ4A 4J0QA 4F91B 2ZAMA 4BFWA 2R6HA 4II7A 3U4QA 1OFIA 4IOJA 4L8GA 3B82A 4TMTA 1VYTA 2HV8A 2QROA 2J46A 3ZBTA 1CLUA 4Q7LA 4QBFA 5GV7A 2EFGA 2Q3FA 2W0MA 1CS4C 3UANA 1KDOA 2WWYA 1CF4A 5J4VA 2F1JA 1XTIA 4Y9UA 3GJ4A 3IBYA 5HCNA 3GFPA 4C7OA 2AHOA 4EKDA 3THXB 1UBFA 1PUIA 2IF2A 5DO9A 3BWDD 3OJXA 3C7KA 5J40A 2Z43A 1X8LA 3KXLA 5JHGB 3TAUA 5DN6D 4LBVA 1TQ2A 3BB1A 1IN7A 1E79A 5LB2A 4PC7A 2OLKA 5G41A 4BFZA 4B4DA 1Q82D 3QKSB 3OESA 4PSKA 1Z28A 4MDEA 1GR1A 4QG7A 2KI5A 1Z08A 1N5KA 3W3ZB 1AA9A 2FPMA 3AVTA 1UBCA 3BXZA 4ZDIA 3ZVNA 2ZQ5A 4RZXA 4BPBA 2CCJA 2GQFA 2BPOA 1SKYB 1ZNYA 2GK6A 3AB3A 3EAQA 4M1OA 2P6RA 2I1QA 4GRAA 1T3LA 2QAGB 1XRJA 4EPXA 1U2RA 2QY9A 1JNYA 1TQ6A 1WP9A 4KSCA 1A2KC 1IXZA 1L2TA 2ZTSA 4G5SA 3PFIA 3Q7PA 2BBOA 4X8MA 4G3XA 2GZDA 2JATA 3ZLJA 1J8YF 1M2OB 4GZLA 3P4YA 5KO2A 4Q1BA 3GLHA 2OCPA 1K73D 4Z8XA 3SBDA 5FUXA 2YINC 4I1SA 1GTVA 1IY2A 1YKSA 4IDNA 4JLKA 4HATA 4QNMA 4G1VA 1W4AA 4TYNA 1E9RA 1DAMA 4RVCA 4KXFB 3E20A 4MGZR 1OXSC 3MD0A 3O47A 4CT4B 4JLDA 4RD0A 4IXMA 5L3SB 1T9HA 4L15A 1D2EA 2V54A 3BB3A 1R0XA 1R8QA 2Z0MA 4E22A 3GLGB 1JXOA 2VEDA 2ZYVX 4B44A 4K8OA 1VCMA 4PC2A 2ZJ2A 4GBMA 4WOPA 1SVKA 2GAAA 3R7WB 2DR3A 4EQ6A 5F3WB 4LHWA 2RCNA 4PC3A 3NHAA 1OJLA 2A30A 5C1BA 4PZLA 5FL7D 4NL4H 4M1WA 1TUIA 1ANKA 3C14C 1YR7A 3S1AA 5C4MA 5AN9A 3RS7A 4DIEA 1CULC 1CKEA 2O0KA 2ZRCA 3CH4B 4NONA 3ZBUA 1VQ6B 3NBFA 4P4SB 1PJRA 2RAPA 3TKLA 4CEHA 3F5FA 4NCHA 2WOJA 3U7EB 1N6RA 3D8BA 1UPTA 3U44A 1XBTA 4Y0AA 2QMEA 4DXAA 1P2SA 2BC9A 4ZIRB 4A2QA 2IUSA 1US8A 2C98A 1MO5A 1KDPA 2NZ8A 2J7PA 1GAQA 1U9IC 2KBEA 4LYFA 1OXUA 4IJMA 5EP4A 3AVXA 1M1KD 3NH6A 1OH8A 1WBDA 1G20E 2O52A 3NWJA 3VR4A 1E4YA 2H18A 4HYYA 1VKJA 1X3SA 3QNUA 4QJ5A 4K81B 2FPKA 1FRNA 1XMIA 2UZIR 2V6JA 2WICA 2XSZA 3AF0A 2V6IA 1NLYA 3IPXA 1P61B 1VCOA 2QGZA 4B6EA 1GO2A 2VP9A 2ZXUA 1LV7A 5SZIA 3WP0A 2PZEA 1WMSA 2EQBA 4H9GA 3A1VA 3TR5A 3TQFA 1KK3A 3PJRA 3CRQA 3WBKA 5JFGA 1YZNA 1OFHA 2DHRA 5AR1A 5J4KA 1LW7A 1G8FA 3GJ7A 1Z07A 1G7TA 2J7KA 3TW4A 3W5JA 1FNBA 3RS3A 3B8HA 2L0XA 4AURA 1NF3A 2IK8A 2BOVA 4B3FX 1ZP6A 1EWQA 3WY9A 2QTLA 4XOIA 1FQKA 3N70A 3LY5A 1OT3A 5H70A 4PX9A 2JEOA 4BFVA 4GNKA 2Q9CA 1GKUB 5FOSA 5HR5A 4B6FA 2ZR0A 1E2EA 3R8FA 1FRQA 3VHXA 1W4BA 2MSEB 3PUZA 5GJWC 3RHFA 4ILEA 4JMPA 2QTHA 3PQCA 3SFZA 1Z47A 3KL4A 3TAHA 4DEYA 3KQUA 3KJIA 4QXAA 1Q0UA 3CF2A 2DWQA 3CCJB 1C4OA 1Q1ZA 2PL3A 2BKEA 1D8TA 1NP6A 2A5DA 4KU4A 3TMKA 1MABB 2BMDA 2ZRLA 1YJ9B 4PXAA 3X1XA 1J7KA 1VYUA 4Q00A 4FMDB 4AKIA 2IYXA 3CX7A 4NCJA 3CPHA 3KFXA 4ERNA 4B74A 3CRVA 4RCZA 4PPNA 1P73A 2G0TA 2J3EA 5BYKA 4NBSA 1FL9A 2PMDA 3ETLA 3REGA 3T35A 4MUAA 2DWPA 3QXXA 3AVUA 1GAJA 1KY3A 2GKSA 4OKSA 2ZR7A 4TMWA 4F92B 4LCBA 4WXRA 2MSCB 1YIJB 4RY2A 1W4CA 2IT1A 3X1DA 2WVJA 4HZUB 4OI4A 2HT1A 1GL9B 3THWB 1NG9A 4U9UA 2VP2A 2R65A 2HJVA 3GEIA 4ABYA 1FP6A 2IEZA 2R6FA 3CXCB 2B7CA 2OXRA 3UG6A 3OAAA 4WBSA 1DO0A 1T0JB 1F2UA 4TTQA 2F9LA 4JL5A 4TTPA 2P5TB 1X1SA 2Y8EA 1Q1EA 2GDJA 5CK5A 2UZ3A 3CMEB 1JR3A 1XZQA 1W47A 2QM7A 3BH7A 3F0TA 3H84A 4TQAA 5CK4A 3VR2A 4GL2A 1U90A 1ZM2A 3Q72A 4KJZA 3QQ5A 4RSGA 1HEIA 5FR1A 3FHOA 3D7MA 3TSOA 4A1FA 1S72B 3V76A 1RJ9B 5BN5A 3I73A 4AKHA 3Q9LA 4DCTA 1SM4A 2OBNA 2DFLA 5JSZA 2A5FA 3RWOA 2WWFA 3DOEA 4FWIB 3RABA 3L8ZA 1X8JA 2PEYA 3MRSA 5B30A 4YMVA 2X2EA 2OTLB 1GKYA 4JZKA 4Q21A 2J9RA 1IONA 2W2TA 4P3YA 2FFBA 3K0FA 2ZROA 3FYHA 2XZLA 2ZITA 4ESHA 4JIMA 4OI0A 2CHQA 1L4YA 3TBKA 2ZAOA 1TF5A 2IHYA 5HE9A 3VO1A 1G7RA 1NDHA 4HDCA 3B5JA 2CJWB 2HJGA 1XXHA 3RDPA 3KKOA 4ZDKA 4TLCA 3OZWA 4DEXA 1HT2E 3FB4A 4XIGS 1W44A 4W5WA 2PZFA 3U4QB 4EFLA 1E98A 3EW9A 1PLJA 1F5NA 5TR9A 2ZRKA 4MUBA 2XOKA 4FCWA 3FMIA 2AFIE 1T5IA 4E07A 4ACBA 3WRXC 1SVMA 1Z22A 5FUYA 1PZNA 5D3MA 4C7OB 5DYGA 2YZ2A 4AF7A 3CRRA 5FTNA 4DLXA 2VHCA 1ONBA 4EDHA 5HZKA 5TY0A 1OGJA 4PTLA 4IFEA 4FK8A 4QBHA 3FKSA 4LJ8A 1BQEA 2LKCA 3C8UA 5KTYA 4WW0A 1MO6A 1CNEA 1DAFA 1T3SA 2IYSA 2ZE6A 3ZQ6A 5H5JA 2ZYTX 3HJNA 3VR5A 2WKQA 3U60B 2BMEA 1S3GA 2QTFA 2GCPA 3C16C 2KSQA 5G3ZA 1W46A 1OYWA 4ZI2A 4U02A 2A2ZA 2E9SA 3FKQA 2GETA 2DFNA 3JQPA 4B3BA 2NPFA 2A9KA 3QF7A 2VA8A 3AF3A 3AUXA 3BB4A 3CPEA 4JKIA 3PITA 4BGDA 1M7BA 3KUCA 4FINA 1H8HA 2H16A 3SYNA 4B3XA 1EG7A 1FNCA 1OYYA 2CL7X 3T1OA 2V1XA 3B9QA 1EESA 1NBME 1RYFA 4US0R 1KIMA 3EZ7A 2CDNA 2CCGA 3LQQA 5B57C 5KDOA 4FI3C 3WMFA 4MRNA 1QF9A 2GF9A 5AJWA 1YU9A 1JR3E 1QVRA 2YWFA 3EIEA 3CNOA 4QM6A 4PO1A 4BFSA 4C4PA 4XVUA 5JEDA 1OW3B 4EPVA 1DPFA 1E63A 4BE7B 1XJQA 3RRMA 3ICEA 4NE2A 1VQLB 3B13B 1UJ2A 3VR3A 2RGNA 3G82C 2RHMA 1XTSA 3OEEA 1TADA 1BKDR 2GCOB 4LI0A 5EXXA 3MMPA 3CWQA 1S8FA 1YJWB 1ESNA 2RGXA 4RZUA 3KUDA 3BFKA 4K1XA 3FPKA 4QGAA 3W5HA 3E5HA 1NRJB 4D0GA 4LSGA 4A8JA 2BVNA 1Z0DA 4OL0A 1DDGA 1R2QA 4I99A 3SEAA 2JIZA 2GK7A 3IIKA 2HYIC 1TNDA 2CK3D 5DSZA 3MHPA 1VQ9B 1QBKC 1EXMA 4PAMA 1X1RA 1P75A 5EP2A 3WNCA 4D81A 1JAHA 2REBA 3MJHA 4GZMA 4M9SA 2V7QD 1JJ2B 5DHAA 1HV8A 3U44B 2WPDA 5LB4A 1Q22A 5FBLB 4IDQA 2X1VA 1NJID 1IBRA 3K1JA 5DHFA 1XXHE 2GXUA 3KZ1E 4MGYR 1US8B 5H68A 2QA5A 2XITA 2ORVA 4KITB 5HTKA 3KJHA 5TV2A 3FTQA 1T8TA 1U99A 1N5IA 1XTKA 1HTWA 1KI3A 4MKHA 3TW8B 1BH2A 4LV5B 2OK7A 4MDFA 2PH1A 4JVLA 2G0NA 4LRWA 2A3RA 4LPSA 3UXMA 4HLCA 4PHGA 4IRUB 3AM1A 4K46A 5FI1B 2DYKA 4PPFA 5EZ6B 4PO9A 4I1VA 4Q9JA 1G64A 4F7DA 4WQMA 2J7PD 1LY1A 3O8BA 2OK8A 1AGPA 4KODA 5G53C 3U3KA 4NCNA 1NIJA 2H7VA 4XWAA 4D26A 3FHTA 2VSOA 3VX3A 1OHHD 4XD7A 4LBYA 4MQBA 2BBSA 3I4LA 5EE1A 5KSPA 5GJBA 2XZPA 1G3UA 1U8AA 5EQTA 1ZW6A 5K8UA 3ZZUA 1UBEA 1XEWY 2N42A 1G3IA 5J47A 5CJPA 1FX0A 4CZ2A 3RSLA 2GZHA 1E2MA 1RRPA 2FE4A 5KNBA 1LS1A 2OTJB 3JZMA 3K9NA 1CR2A 4G5GA 1Z0FA 4AF6A 4LYAA 1YHNA 4LYHA 2QPTA 1J70A 2B6HA 4DSUA 4JLPA 1B2RA 2QA4B 2V8OA 1YITB 2FGJA 5L3SA 721PA 1M90D 4IOMA 4DCUA 1JJ7A 3QKUA 4ZPXA 3HPRA 2F3RA 1DG1G 1UKYA 2GF0A 1VPLA 3MWLA 3OZXA 5GJVC 4DZZA 3Q8XB 3GLGA 1BYIA 2J5XA 3K0SA 3OIYA 4P4UA 1OH5A 2O8EA 1D2MA 2ODBA 3ZYCA 1CJTC 1E96A 1OXXK 1RKBA 4ITRC 3QVUA 3W3AA 4WVFA 4X8LA 1ZBDA 2GJSA 1AK2A 3TVDA 3WMEA 3TSWA 5AWFC 1BS1A 3QE2A 1H8EA 2QEXB 3ICQB 1W36C 3DO6A 4RZ2A 1BOFA 3P32A 2CRVA 4PQFA 5E4FA 4C0BA 1SQ5A 1IJFA 4WXPA 2GRJA 4Z51A 2G77B 2FWRA 5EUMA 1E99A 3PEYA 4Q18A 2CHVA 2EYUA 5E95A 3NEJA 5AUQA 5FPKA 4D4KA 2W2XA 1ZM3A 1G5RA 5FL3A 2C2HA 1SZPA 1CRPA 1E9SA 1ZM9A 1E62A 2ORIA 5EE9A 3TVTA 3TGPA 1F48A 2C9YA 3UWKA 4E03A 2BWJA 3KQNA 1S2MA 4P6VF 2B7BA 1XFAA 3SE0A 2ANCA 1XD8A 2KBFA 3SI7A 3MLEA 1F2UB 3QFTA 2BSAA 1SKQA 3LNCA 1G1MA 4LUCA 1P5ZB 4KHZA 1RE0A 2F7SA 5KSOA 4HLQB 3VKWA 1AIPA 3L8YA 2IUUA 3RS5A 4R98A 5JS7A 1VG0B 1BIFA 3IDQA 4G5QA 4DUGA 1YJ5A 4M1KA 4N1AA 5JZVA 4DT1A 1G6OA 3Q5DA 4ARZB 4Q5IA 1II0A 4IXNA 5D3QA 3DPUA 3QFRA 1BJKA 2LCFA 4PHHA 4P32A 4KYUA 4V0KA 5JSZB 2KB0A 4BEJA 2FPLA 4UNNA 4D0LB 2HCJB 1OKKA 4N0DA 4UJ5A 4PR0A 1CU1A 2D2FA 2QT0A 1BX0A 3PEWA 1P2TA 1NY6A 1OIVA 1E9CA 1NVVR 4JLNA 1EWYA 4GMDA 2FMXA 4M1TA 2XB2A 2BM0A 1P72A 3K0FB 1RFLA 2WWHA 3T5DA 1TL7C 4XSHA 4AYTA 3GEEA 1VECA 2XXAB 1IJEA 2X3UA 1TEXA 4M8NE 3N2IA 4TT3D 2OO7A 4CEJB 2VH5R 4EFNA 1XXHB 5FPHA 3R9XA 4DQLA 4MRSA 1VG1A 4A2WA 4R7ZA 2ODNA 1XDBA 5DE3A 1E69A 2ZUBA 1G3QA 1FP7A 3I3SR 2BJWA 2XTNA 3BRWD 3AVYA 3G6EB 3TJZA 4BFUA 3PUWA 4JLMA 1Z0KA 3I55B 1XF9A 2IEYA 1JAIA 5D3MB 1Z0JA 1ZD1A 5AJZA 1E32A 1TVCA 4N3NA 1GKIA 2JJ2A 4URWR 3X1WA 3VHLB 3K9HA 2RGGA 2W2VA 3C41J 3EC2A 2ZU6A 3UIEA 2H5EA 1VQPB 3FDIA 3Q5EA 3D6TB 4OJQA 4HAWA 4Q7MB 4G01B 1E1RA 1PLKA 4JSTA 5JRZA 3CUEF 1G21E 2CNWD 2HLDA 2PBRA 1WB9A 3CCEB 4QC2A 4LHYA 3SU8A 4NKRA 1E2IA 1GITA 5IHPA 2JCSA 3W5IA 3PENA 1NIPA 1ZC4A 2HUPA 2YHSA 2Z83A 3EA0A 4RFSA 4EJSA 4LJYA 3THXA 4GI7A 1UEIA 4F7WA 2VBCA 3SS8A 4B3CA 2CEAA 2JJ8A 3RSOA 3PEVA 1H85A 2FU5C 3FKSD 4ZI3A 3CC7B 1TQDA 2GNOA 4EPTA 1NG1A 2Q3HA 1Z2AA 1TU3A 1Y3AA 1RJ9A 3CC2B 1Z8FA 1E64A 2WMOB 5FOVA 1LTQA 3U5ZB 1G4AE 4F38A 2ZSFA 4AK9A 2Q9BA 2QE7A 2OBMA 1GSIA 4Y9RA 1FOEB 3AGPA 1R5BA 4V0LA 4HB0A 4C2TA 4LV6A 2RGBA 1FNNA 2FSIA 3JVUA 1K6MA 3WYAA 1N0UA 1FFHA 3W6OA 1Q7YD 1G19A 1E9AA 5TMPA 4NDZA 1G3RA 5DH9A 3IBGA 3VQTA 3A37A 1VG9B 2ASEA 3I72A 1P2VA 4DLVA 4I81A 1KI1A 4P33A 2BEKA 2ZJ5A 3BAFA 1OIXA 4B2IA 4A8JB 1W0KA 1W49A 3WNDA 2A5YB 3OIWA 4UJ3A 1KSJA 4OHYA 2IUTA 1XD9A 1Z29A 2JJ1A 4OQNA 2CJWA 2KWIA 4PQRA 3NC1C 3EPLA 4M1YA 1SVOA 4TL8A 5GVRA 2NG1A 1II8B 4AI6A 4MRRA 4ESVA 2ZS8A 3GJ0A 3U3RA 3U61B 4PSVA 4KFUA 4DLYA 2AL7A 4Z1MD 1P62B 3QXCA 5UKDA 2CVFA 2VHQA 1IOZA 4OJKA 2ZRGA 5C18A 2EWVA 1A5TA 3TQCA 1SXJA 3ZIAD 2DEUA 4QL3A 2W6JD 2ANBA 4C0HA 2C99A 3KKQA 1O3YA 3VU9B 4O3MA 5EXTA 2XNCA 2Q3MA 3O8CA 2W6ID 4BFYA 3CRZA 4P31A 4HLUA 4A0FA 1KRHA 4DCSA 2WSMA 3CZQA 3QENA 3ASYA 4ZCLA 2GVDC 4G5RA 4S2EA 3CCMB 2IYTA 1OGIA 1KI4A 4Q03A 3T1QA 4GP7A 4YQFA 3FFBA 2DB3A 1SGWA 1LNZA 2X77A 4YAWA 1R0YA 4PPQA 4QOSA 1GRNA 5DIFA 1G9XA 2EFEB 2IXFA 3NVAA 2GPJA 1UKVY 1A7JA 4G5OA 5DLQC 3ZC3A 1JB1A 5SZJA 4V0NA 2O8FA 1G8YA 1I2MA 3SQWA 4BECA 1XNJA 3HPQA 4LJ5A 4UXIA 4PHTA 1VCIA 1FMJA 2VNHA 1WRBA 2A5JA 3QOFA 1E9BA 1E6CA 2AK3A 1I2DA 2ZRJA 1ZNWA 1E4VA 1FX0B 3K09C 3CBQA 3RLFA 4CGZA 2FFAA 4YAFA 3VR1A 1Z06A 2VYFA 1IN5A 1AZSC 1J99A 4NZYA 1ZU4A 1TX4B 5FH9A 2ZANA 4G1UC 1ZJ6A 3NEYA 1JEEA 3A4LA 4GMXA 4KSBA 2IWHA 4DKXA 3RWMB 1NSTA 1YZGA 1KZ7B 2VL7A 3A36A 4GSYA 5HZHA 3CB4A 2WJVA 2BIFA 3IHLA 5BWMA 3DVLA 1U94A 2GCOA 4L4UA 1A2BA 2OUKA 1Q21A 2E1RA 2ZJOA 2REOA 1IN8A 4M1SA 2PCJA 2IHBA 3BC1A 4XWKA 1GL7A 2QN6A 2PMKA 4Q1DA 2O8EB 2J59A 2IS2A 1QG2A 3DKVA 4YHBA 2ZI4A 4Q4AA 5F2EA 1RPZA 1YHQB 4DLWA 2YV5A 1VCNA 2WJJA 2PIAA 1JB9A 4NP6A 4ACAA 3EPHA 2DY1A 1ZUIA 1I4DD 221PA 1AM4D 1F2TA 2YVUA 1AS3A 3HU1A 3TSZA 4AWXA 3DL0A 3NDPA 4LY6A 2BGIA 4BPRA 1UF9A 3GJ5A 3HP1A 4D6PA 3BGWA 1YRBA 4OK6A 3SN6A 3U7HB 1KTVA 3CF0A 4OK5A 5FR2A 1ODFA 2G83A 2GA8A 3X1YA 4Q9KA 2CLSA 3KJGA 4M0LA 4HAUA 1P60A 4B73A 1G8HA 1YZQA 1LF0A 1NKSA 2FF7A 3O8DA 3PG5A 5GJCA 1Q1BA 4M4SA 4AC9A 1SXJE 2WSSD 1FPMA 1GFIA 2VQSA 3B1VA 2AXPA 4QGFA 2QBYB 2ZE8A 2ZSAA 2GXQA 1N8RD 1RRCA 2B92A 3GJ8A 1EFRD 1J2JA 4IHQA 4MRVA 4Q9LA 3M1IA 1SVIA 2OT3B 4DT1B 4ZDJA 1HT1E 3CRMA 4PZZA 4FMCF 1M74A 4GPTA 5JCZA 1DAGA 1QX4A 2YNMA 4A2PA 3VNVA 1YZUA 2X2FA 2QQEA 4KLZA 5C46F 1YR8A 1P7CA 4XVRA 3OE7D 2ZI3A 4FIDA 4URXR 1XPRA 4TZ6A 3FWYA 4L9SA 1ETUA 3LBHA 2C9OA 5EXPA 1Z6YA 2C95A 3BH6A 1IY1A 1KO4A 1TAGA 3T61A 5ELXA 3K9GA 2IYWA 3NIBA 4URUR 3ZGXA 2H8KA 4JLAA 2RGCA 3PV0A 2EFCB 1O87A 4YC7A 1A82A 2B8WA 4ZDWA 1ZVQA 4DLZA 1UDWA 1DAEA 4TL9A 3L43A 1ZM7A 5LD2B 1QVGB 2XGJA 1TF2A 2CHGA 3EZ2A 1VG8A 3QVVA 2QI9C 2IYLD 3P4XA 3FHCB 2AN9A 2D2EA 3M6AA 4GFDA 4WZBE 3HU2A 1GM5A 1JA1A 4AIIA 1KI2A 1X8KA 2UKDA 4MYCA 5A4JA 3K9LA 2YC4C 3LH5A 3KKMA 4LJAA 1MR3F 1N6PA 3LD9A 3LXRA 4QBIA 2GXAA 2QP9X 1IY0A 1V43A 2F9MA 1KMHB 1GP2A 1T8UA 1XMSA 3AF1A 2GJ9A 5JBQA 1H65A 2IA5A 2P67A 3H0KA 3KX2A 1TLLA 2WIAA 1N5JA 4JT2A 1CJKC 3T5GA 4GOKA 3ADCA 2RHDA 4M22A 2O8CB 2V9PA 3NH9A 3H2YA 1COWD 3G0HA 1XCGB 4R9UC 1VIAA 3NTUA 1OPXA 1KAGA 2ZVQX 1CNFA 4LHZA 2GAOA 3THYA 2JGNA 3TNFA 3U7GA 6Q21A 3CC4B 3GD7A 3IILA 3SHFA 1E2PA 8OHMA 2XNDA 2CL6X 2ZSDA 4C0LA 1JR6A 5J5CA 2VRWA 3CR8A 3RS0A 2VP0A 4JLBA 4EJSB 5HXBA 1BMFA 1P2UA 1KJWA 3M4YA 1NBMA 3VMFA 1M6NA 3QG5A 4RFSB 5SZHB 1FDRA 1E1QD 2JJ2D 1X6VA 2IXEA 2OCBA 1VQKB 2QM8A 4JJZA 3EX7C 2BDTA 3U7FB 5IK2D 1MOZA 4IDOA 1GRQA 5SZKB 1W2HA 3DDCA 3CD6B 3RRZA 1R6BX 4HDOB 2ZYUX 3CPJB 2QMOA 1AKEA 5EXSA 1E1RD 3LAWA 4JLVA 1GVNB 2ZRIA 4ARZA 2HLDD 2QT1A 3A6PC 2XAUA 2XNSA 1OIWA 4BLQA 2AX4A 1F6BA 1M7HA 2CBZA 5TXGA 4G0NA 1ZINA 5EP3A 3OEHD 2PCLA 4CT5A 1TMKA 5L3QA 4FMBB 1IAQA 2J1LA 1JA0A 5EE0A 4UNQA 4RD3A 2G6BA 3C4JA 4JBXA 1W36B 3GQBA 3DM9B 3LLMA 3U2QA 1WQ1R 1HA3A 3AKEA 3OFNA 4RZ3A 2XXAA 2Q0HA 2DBYA 4PGOA 2B21A 4W9MC 1IN4A 4V03A 2GEUA 1IXSB 1VQMB 5FBVB 5C2JB 2OZEA 1EGAA 3FMFA 4TN1A 4CEJA 1NMZA 1NVVQ 1EFTA 2QSZA 2B8TA 1GIAA 1U9IA 3LLUA 1KZGB 4Q7JB 2C5LA 3K0CC 2V1UA 5H1YA 1NN5A 2OG2A 2P5SA 3ND8A 1KDTA 4BQSA 1JI0A 2BBTA 2J41A 4JKYA 3SJAA 4DLRA 3TE6A 1NY5A 2ZJYA 2HMAA 5BQ5A 2QAGC 3WHKA 4MA4A 5EE5B 2C96A 5FPYA 1N3BA 3CZPA 2MMGA 4F93B 1SXJB 2GBLC 1QVFB 3QXSA 3CMAB 2BCGY 3W6NA 4MKGA 1CJVC 1W0KD 1KJZA 3SDZA 1W0JA 4R2IA 1Z6GA 3QJYA 3SJCA 3I1FA 1OH7A 1CRQA 4NH0A 4US1R 4V0ME 1GRRA 1MT0A 2OHFA 4DLTA 2G1KA 4EPRA 2RC6A 3A4NA 2OBLA 1J8MF 3QFSA 3W5VA 5LDDC 2YWEA 4BZQA 3QSYA 3UG7A 1BO6A 4KFSA 4AY2A 3CWZA 3LX8A 1NKTA 1XTQA 1QHGA 3GJ6A 1M34E 2QRZA 4JL6A 2O8FB 4KO8A 1E94E 2ZS9A 1E79D 2FG5A 3PCRB 3TUJC 3ZJYA 4F4CA 4V02A 2ZUCA 2VLIA 4NTZA 3FJOA 4QJ4A 4OI1A 4B71A 4YXWA 2ZRDA 3IHWA 5M04A 1CR1A 1QDEA 5KPJA 4RFVA 1KAOA 1FW6A 4YAOA 4US2R 1Q86D 3K53A 1J90A 1MKYA 2WHXA 4D2IA 1QVAA 4JVMA 3CX8A 3OZVA 1QHHA 4DDVA 3AEZA 3MWJA 3T1TA 2DCUA 4C43A 1TU4A 2NZJA 4TWZA 2FDCA 3LRPA 1E2DA 1VMAA 1N6LA 3BFXA 2TMKA 2VNJA 4IDHA 3OIVA 2PJZA 4H1VA 4Q4AB 4BLSA 4XSGA 2KJQA 4KI0A 4P4TA 4V0OA 2O8DA 1JPNA 4QHTA 4Q9HA 4IEEA 4DCNA 4TLBA 1XPUA 1CBUA 2WOOA 2Q21A 1I7PA 3AF2A 1II8A 5TDHA 1F2TB 5CM8B 1UADA 4MYTA 2ZVPX 3GCGA 3UMRA 2HXYA 3PUVA 4KBFA 1FQJA 5DGXA 4Q1FA 2CNDA 1XWIA 2YOHA 3GEHA 4DLSA 621PA 4DRZA 2R44A 4LHXA 5KSYA 4PPGA 3B85A 1QHSA 3VU9A 2ZRHA 1OB5A 3B78A 4TYPA 5DN6A 3SBEA 2IF0A 3V4FA 4BUJA 4N0EA 3H1TA 5JRJA 2MSDB 3IQWA 2QMHA 3KXIA 2NO7A 4DHEA 4IKEA 2JLVA 1VQ8B 2J0UB 1UKZA 4N3GA 1W5TA 4OQXA 1P9RA 1ZM4A 1XX6A 3AQ4A 4Y7CA 1KKMA 3K0AB 3B1YA 3LX5A 5JCPA 5CB6A 4GOJA 3JQQA 1QGAA 4O2LA 3K70B 4EUNA 1Q57A 4BZXA 3IIMA 4DIDA 2RKOA 2OCAA 4WZAE 2GESA 3WP1B 3RANA 3LO8A 5CYPA 2XSZD 1J9ZA 4GP6A 4B3DA 1Z2CA 3LFUA 2W0SA 5CJ2A 1EK0A 1L7VC 1XJ0A 1YQTA 4QM7A 3ZQJA 4NMMA 1FUKA 3L0IB 1IN6A 2EU8A 2C9CA 2HYDA 3FMOB 1DS6A 2AK2A 4TYQA 1T5LA 5KU1A 3ZZTA 1S4QA 1JPJA 2AD5A 1G291 3JZAA 3CIOA 4LK2A 1VYVA 1Z63A 1GVHA 2ZJBA 1YZKA 1DDIA 2IL1A 2AKAB 3ONWA 1L4UA 3RRNA 5DNYB 2CMKA 5JHHB 2WBLC 3UWOA 1TF7A 4G1BA 4B32A 1GNPA 4UXJA 2XTMA 1KO5A 2GEDA 5FL7A 2F3TA 4Q1EA 1RRFA 1II9A 1ZYUA 3NHBA 3I32A 1E2QA 5LBIA 3ECCA 3MJRA 1YI2B 3UKDA 1HYQA 3FFAA 4HB4A 2J0SA 5H59A 3E70C 2XTZA 3GMTA 1IQPA 2XJ4A 3D3QA 3KQKA 4W7SA 5CIWA 1JEDA 2QSYA 1DG3A 4BEBA 1QG0A 3I62A 1U8ZA 2YOFA 4LJ6A 2UVQA 4KFRA 5CDFE 5KSZA 3THYB 3PUYA 2IBMA 1NN3A 3IIJA 3CRW1 4KVAA 3OW2B 2BN4A 1OXVA 5DI3A 2CVHA 2RH5A 1P9NA 2AWOA 3H86A 3W2FA 5EE3A 4TLEA 5JWHA 4URZR 3OZUA 1DEKA 4URVR 4JL8A 5AUPB 2ZSEA 2FH5B 1XMJA 1MO3A 5FTKA 3AKYA 5GADl 4BASA 3ZD7A 3GLIE 4OI2A 1G41A 2QBYA 2A5GA 4PANA 5FBQB 1VQ5B 1T4GA 4PFSA 2QQ0A 2O8BA 5HE8A 2JDIA 2C78A 3G5UA 2OAQ1 4IOKA 2VZLA 2OE2A 4PAOA 2WJIA 1DAHA 3OAAD 3QY0A 2HCBA 1XEFA 1TUEA 3CX6A 4M53A 1QFYA 2GCNA 2PZGA 4X8OA 1NVXQ 4C0SA 2A78A 4OHXA 2IWRA 3I56B 3EC1A 2BHRA 2DWOA 3KB2A 3L0OA 2H57A 3LA6A 5FPTA 3TK1A 3MUFA 1JR3D 3BFVA 3OF5A 2VSFA 2OV2A 4KVGA 1T91A 1OLOA 5AK0A 3FPAA 1NMYA 3KKNA 1BX1A 4DVGA 2V4ZA 3JQRA 4IVRA 2GXSA 1XD2B 5EZ5A 3FMPB 5B58C 4HE6A 2FEOA 2ZRNA 2ERXA 5K8TA 1I4TD 1AMOA 2WKRA 1N6KA 4Q4LA 2NO1A 5FI0B 1YRAA 1SKYE 1JQJC 3LDAA 1YJNB 3LBIA 821PA 5JEEA 3RS2A 1OSNA 2FFQA 4UNPA 1OFUX 3V4RA 1E2NA 2VO1A 3L0SA 3IO3A 1NN1A 1I4LD 3WBJA 5FPSA 4EPYA 1KQSB 1KMHA 1MRSA 1F60A 2H17A 2WAXA 3GJ3A 4BLPA 4TQ9A 1K8RA 1W4RA 2OLJA 1FNMA 1AQYA 3ADKA 5FTMA 4LV8B 4C30A 5KNDA 4A36A 2O8CA 1DBSA 2F1IA 2RGEA 2FX3A 3CR7A 4HAVA 1KYIA 3B2EA 3T06B 1Z83A 2NO6A 2QNRA 3LW8A 4NCKA 3RS4A 4EPWA 2OFWA 3L2OB 3QXHA 2NPIA 2J0VA 1YZLA 3N2EA 4I4LA 4LBWA 2XOKD 4HSEA 4TSFA 2LWIA 5HKKA 4W5HA 2P3SA 3ZD6A 4NYIQ 1DE0A 4TMVA 2OFOA 2C03A 1GDDA 1VQNB 2XJ9A 3WRYC 4DJTA 3IQXA 1GJRA 4A6XA 2ATXA 1UMKA 4IDPA 3A8TA 2OM2A 1EX6A 3AVPA 5FOWA 1R0WA 2J0QA 1UEJA 3TUIC 1Q20A 5EP1A 3BORA 1PLLA 2FFHA 3CO5A 4LDJA 3R9IA 4A82A 1M8PA 1NLFA 3BD9A 4Q1CA 1DTSA 2VNKA 3J81k 1IHUA 4NU0A 4F4JA 1XPOA 1AJEA 1KK2A 3C15C 3BS4A 1LFDB 1KJYA 2VHTA 3CNLA 1MO4A 2ERYA 4IOLA 2YOGA 2ZS7A 1QH0A 3KTAB 4MH0R 5EUQB 1QGYA 1MRNA 1JBKA 1NMXA 5AJVB 1QHHB 1NLZA 1WE2A 4ASUA 2QU8A 1H8HD 3W90A 3W8NA 4C2UA 3CF6R 4NYJR 5FA6A 3CM0A 4D80A 3P20A 4C9BA 3QPUA 3ZVLA 1KI7A 3NBYC 4A15A 4HAZA 2C04A 4Q4JB 3DMNA 2O8DB 1ZUHA 2JA1A 3PVSA 4DSOA 2IYZA 3QPVA 4XWOA 3QKRA 4C0QC 5FOTA 5CYOA 4C0JA 3QF4A 4NHOA 1Q44A 1E0JA 4YMWA 5C4GB 3OEED 1DO2A 5KUTA 1CTQA 4XJXA 1Q3HA 4FW9A 3ES9A 4YALA 4YAUA 2NMVA 2F55A 1N0WA 1C9KA 1YVDA 4HUQA 4QGGA 3IEUA 4KYIB 5JI3E 1N6HA 3BH0A 4UNSA 1SVWA 4KFTA 4E5UA 1ZD9A 4DQKA 4CW7A 1AGRA 2JIZD 5DISB 4QJ3A 4Q02A 1XU4A 1Z0AA 3A1UA 1NJGA 2R8RA 2HDNB 4KBGA 1N6NA 4YONB 3EZ9A 3H4MA 4BRUA 3F3YA 4DCVA 4A92A 2F6RA 2WPDD 3CCSB 5KNCA 4IFBA 1Q12A 3NC0C 1RYHA 2ONJA 4PC1A 4TYYA 3RNLA 2WAYA 3BBPA 1H42A 3CKLA 4JJKA 3WHLA 1A1VA 1DAKA 2FEMA 1QFZA 2IYUA 1GAWA 2OCYC 1D6JA 3WYFA 1FMLA 2R62A 4EIWA 5JS8A 5J4YA 2LKDA 5AJYA 3BOSA 4BFXA 4AG5A 3KFVA 4LBZA 1G16A 4FMCB 4BWYA 5E7JA 5KOYA 1RRGA 2Z4SA 3T34A 1PVOA 2J87A 1KI6A 2J45A 3AVOA 1WBBA 4B48A 1KHTA 4E09A 5J4HA 1D9ZA 3GFOA 3SR0A 4WAUA 4ZV4A 2EIXA 2FN4A 2ZI9A 2VHUA 2AKYA 1AKYA 5BN4A 2OSBA 3KQLA 1ZNZA 1E2GA 3B60A 4R2HA 2FOLA 4CVNA 4CEIA 3P27A 1A8PA 3QEOA 4EFMA 1G7CA 2FJUA 3A1TA 3SZRA 1VQ4B 2PLRA 3K0EA 3L82B 3EWSA 4XD7D 1WCV1 4UQOA 4B75A 3SYLA 2NGRA 1XTRA 5LPNA 4QGHA 1W35A 4HB3A 3VNUA 2OXCA 4GT1A 1GZSA 1M7GA 3KJEA 5FTJA 3B1WA 2CK3A 3G4SB 4B43A 2P65A 2ZPTX 5IDVA 2P6UA 4DBLC 1U0LA 4LJ4A 5K8IA 1HQYE 2D3WA 3WXMA 1QG4A 1E2KA 2V7QA 3NG1A 4NYMQ 4TMKA 2G9NA 4Q66C 1GWNA 5JWRA 2PJRA 4FD2A 5DI9A 5F9HA 2VP5A 4B47A 4DB2A 2QDXA 2R2AA 2RGDA 3QEJA 1U0HC 1E0SA 3AP2A 3VAAA 1KSFX 3NKVA 4CYMA 2P0EA 5CM9C 4C3ZA 5DI3B 3VTKA 5JMTA 1H8ED 1KMQA 3EASA 3KDSE 4IVQA 2XZOA 1SHKA 5F98A 2OAP1 1KNXA 1KOFA 1QHXA 2I3BA 2QTVB 5J4LA 3V00A 1HH4A 3LQRA 2J0UA 2QUZA 1DAIA 4B76A 4ZCIA 2ZRBA 2G1JA 4Q7KA 5TB5A 2Z6VA 3K0AA 4L9WA 1DELA 4Q48A 2ZJAA 4D0NA 5HCIA 2O8BB 1GOTA 1XJCA 4QFMA 4TMXA 4MGIR 3VKHA 2FV8A 2BMJA 5AUOB 4Q19A 1FNDA 3Q3JB 4QRHA 5KDLA 1KNQA 5TVKA 1OHHA 1QGZA 1VQ7B 2HF8A 2JLYA 4W5JA 1VTKA 1G8PA 4DDUA 1D5CA 1XEXA 2N46A 2PX0A 2F43A 3B1ZA 1VQOB 2GHIA 2WV9A 1AZTA 3B1XA 4YLGA 2IYQA 2AFHE 1Y63A 5H8WA 1IM2A 3QBTA 2AWNA 2EW1A 3CONA 4DUGD 2QTZA 2JLWA 4YMUA 2WIBA 2JDID 3B6EA 2VP6A 5G40A 2BGJA 5FFMA 4BZPA 3SJZA 3OHMA 4HI0E 5HPYB 4H1UA 5CITA 2CXXA 5CIQA 4PO8A 4TLAA 1PV4A 1OKKD 121PA 3W5UA 3FE2A 4B3GA 1E3MA 4ZGNB 3HDTA 3W8RA 2WWXA 2WWWA 4V0MA 4QBGB 4YDSA 3SOPA 1Z5ZA 3CLVA 4Y0VA 1K8AD 2DERA 1C1YA 3KB1A 4AYXA 2IYRA 2PEZA 4TL6A 3GLHE 3MWYW 1R5NA 5KSWB 1YE8A 4A9AA 3L0PA 4NYIR 1B0UA 1QHNA 3QPWA 1X86B 5A5GA 4FN5A 1FZQA 5FUVA 5B2ZA 1N0VC 4UNRA 1E9EA 2ZI6A 3TRFA 1DVRA 3NXSA 2IW3A 2QORA 1EWRA 2X8AA 3ZS9A 4M9XA 1KGDA 2BBWA 4D4JA 2RGNC 4DB4A 4R71A 4LC1A 5KPDA 2VPPA 3WYGA 3I92A 5JLJA 3E1YE 4AKEA 2QP3A 2BMFA 3Q85A 4M9ZA 3EARA 3K09A 1U0JA 4HEJA 1W7AA 2GJ8A 4U5XA 4HUTA 1ZIPA 1NNEA 3FOZA 1QHIA 2ZI7A 4A8JC 1BYUA 1W87A 2QL6A 3QUSA 4XTRA 1CR0A 1Z6AA 2YKGA 2FA9A 5JECA 3P1JA 2ZJZA 1N5LA 1XEWX 3E2IA 1T6NA 1KK1A 3FVQA 1K5GA 4QNRA 4U7DA 4TSFD 2YC2C 5JWOA 1QFJA 4WIAA 5HKKD 1WXQA 2Q6TA 3CW2A 1RZ3A 4M21A 3B9PA 1NN0A 2FGKA 3MG9A 2NQ2C 3DMDA 2K5UA 1E2FA 1E9DA 3GFTA 3RC8A 2BKUA 3SYKA 2WJGA 2EFDB 3OIUA 1E2LA 3TH5A 3UMSA 2EFHB 3AKCA 3W6PA 2ZUDA 5K8LA 2EVWX 2CL0X 2BM1A 3V9PA 2ZE7A 3LO5A 1EP1B 4A0HA 4GOXA 2XB4A 3I5XA 5B64A 1EFUA 1R4AA 1R10A 1E0KA 3HR8A 4TT3A 4CF7A 2HEIA 3AVVA 1KDRA 1S3SA 4JS0A 1XD2A 2HXSA 1S9DA 4URYR 1GUAA 2CE7A 2QE7D 1CXZA 1G5TA 3QKRB 3RRYA 1ZUNB 1N6OA 1FTNA 2GEVA 3A1WA 3HYRA 2HF9A 1ESMA 2Z5FA 1UAAA 2D4HA 3W2GA 1UKEA 3QF4B 3EPKA 1SVSA 3T1VA 2ZRPA 4B34A 2BJVA 2GZAA 1RIFA 2ZR9A 1W36D 2I1VB 2MMCA 2DFTA 4ASUD 4D4MA 3BERA 4NPHA 4TTRA 4OBEA 2RC5A 4EH1A 1MV5A 3KKPA 1N25A 2R6CA 4HUQB 4M9QA 3I8XA 1S96A 5GV8A 4ZO4A 421PA 1R0ZA 4FMDF 1ZU5A 1UBGA 1TQ4A 4LPKA 2JASA 3R9WA 2JJ1D 2KE5A 2EWWA 5L8VA 3LXXA 1HE8B 3NDBB 4Q4HB 1QUFA 2VF8A 3AH8A 3RVBA 4DWJA 1KKLA 3T15A 5IF9A 4YMTA 2OESA 1NVUQ 4FCTA 2CNWA 3EXAA 2NOAA 2IS4A 4RD1A 2R9VA 4BLTA 2H92A 4OHWA 3ND9A 5EMNA 4U00A 3O8RA 3I61A 1SXJD 2ODEA 2YYZA 1UM8A 2WMNB 1W2BB 4A4DA 3W2IA 3IEVA 4LYJA 2ZI5A 2BMWA 4JYCA 2C8VA 2A7QA 2B5OA 1LB1B 2GJAA 1Z6TA 3EPJA 3DM5A 1KO7A 3QG1A 4RKEA 1G7SA 1KI6B 3B7GA 1E2JA 4AYWA 2ZM5A 4Q1AA 3OJWA 3QKTA 3SFVA 4JYBA 5FTLA 2ORWA 2ZJ8A 3AVQA 3CH5A 1YR6A 2O0HA 3AP1A 3SJBA 3EWAA 4PZYA 3G71B 5GVSA 3ADDA 2P6NA 1S0UA 3KTAA 4CEIB 3AP3A 2VSXA 5A0FA 1JALA 3U6BA 1ELOA 2ZSBA 2QZ4A 3LW7A 4Z8YA 3P26A 4RD6A 2WM9B 3R8CA 1A4RA 1OH6A 4AG6A 3REFA 1LS6A 3DKPA 5IT5A 1CIPA 1ZAKA 1UFQA 2ZRAA 4NYMR 3GLFA 3GP8A 1L8QA 1GL6A 3GLHB 4DDTA 3U6KA 4P0TA 2IXGA 1NSFA 1KD1D 2XX3A 4Q4JA 4CRWB 3AF4A 4OHVA 1G4UR 3MGCA 1VHLA 3IKJA 3RAPR 4JLJA 4BRWA 5CDFA 1DADA 2REXB 4B33A 2QRNA 4NYJQ 1TEVA 3BK7A 4HAYA 4PAQA 4PQYA 4TLDA 1EFHA 3SC3A 1E2HA 5KDDA 4QHYA 1EX7A 1NL3A 2JAQA 4Z1MA 1PUJA 4LOAA 3GPLA 1Q81D 3WNBA 3UPUA 3DZDA 3I8SA 3NBZC 4B2LA 3AVWA 2WWGA 5JJKA 2DETA 5CB8A 3ZIAA 4EQ6B 4O25A 3UATA 2G88A 5FOXA 3CNNA 4DC9A 3GLIA 2W6JA 1QRAA 1ZRHA 1D1NA 2W6IA 3S1AB 521PA 4HAXA 3U3OA 1RW4A 4TYWA 2WWIA 4OQFA 1HUQA 1HY3A 4CEHB 1GNQA 5CLLA 3DZ8A 4I1UA 1LF5A 1GILA 3TUZC 4NCIA 3PUXA 5JI2E 3GJXC 3IUYA 3D31A 2WJYA 3TR0A 2O0JA 2AXNA 3NBXX 1JJVA 3W2EA 5LD2C 1OV4A 4LC0A 1KY2A 2AR7A 2WZQA 1HURA 1AS2A 4C0AC 2IS1A 2FSHA 4S35A 4JBWA 2QENA 1WF3A 3KXKA 2PT5A 5TARA 2GWHA 1TPZA 2DPXA 1F20A 3T12A 1ZC3A 4JVSB 1UDXA 2ZEJA 3IPYA 3IGFA 4JSYA 4XTCS 3QKSA 1OF1A 2Q9AA 2RB4A 2XEXA 1IB0A 2ZU0C 1XEXB 2FSFA 1VHTA 2DFKB 2F43B 2VYQA 4HB2A 4B35A 1W34A 3ADBA 4KCGA 3A58B 3K0CA 1NI3A 1EP2B 1P3JA 3EZ6A 1P4SA 4A0GA 5FUWA 2QPAA 4BLOA 3AKDA 3PR1A 2V3CC 1AS0A 1CR4A 3CPWB 1G6HA 4DDWA 2VTKA 5EJEA 2QAGA 2IC5A 3K70D 3CCUB 2CCKA 1NJFA 2CLDX 3Q7QA 2GBLA 2PLFA 1G5PA 3LBNA 3PEUA 5JJIA 2PT7A 4LWZA 1ZCBA 4Q47A 1OB2A 4UAJA 4EJSC 2AD1A 1ZMXA 2NO0A 1CJMA 2BCJQ 3MSXA 4HE5A 3C5HA 1CP2A 1XP8A 3I5YA 3QBVA 4HZIA 4ZKDA 5CLQA 3SHWA 2WJHA 2W00A 2R6GA 1HE1C 2EYQA 3AUYA 1RC8A 2E87A 3GLFE 4M2LA 2NTYC 5P21A 3SQXA 1LVGA 2I4IA 4ZGQB 1JQLB 2Z4RA 4D25A 1SHZA 2NO9A 1G17A 3KQHA 4OQLA 4Q9IA 4LJ9A 1T3HA 4RD2A 3MFYA 3AGQA 2BEJA 3R7WA 5F9FA 3IO5A 5G3YA 3ZVMA 3BIFA 3AV0B 4RJLA 2D74A 1S9HA 1W2GA 1SVLA 2JLRA 3QIAA 4P4SA 2D06A 3N5CA 1XE1A 2NIPA 2WSSA 5JJLA 2BV3A 1R7RA 5L3RA 3HYTA 1KSGA 2ZIAA 4KV9A 4AKGA 2HT6A 2BF4A 2P2LA 5FBWB 4ZIRA 2D7DA 4WZ6A 1IXRC 4KLNA 1YR9A 1EFRA 3EZFA 1DOAA 1DARA 2D7CA 4WA7A 1QUEA 4C0KA 3M0EA 4RD4A 2RGAA 1AQUA 3THOA 2ZREA 4FWTA 1CQXA 2QAJA 2XNDD 3E1SA 1D9XA 4UXHA 1E0AA 5E3HA 3BE4A 2OILA 4B2PA 3OE7A 2WTUA 2IX3A 1SULA 4LHVA 1BMFD 1NBMD 3EIQA 2X19A 2GILA 1QHYA 3ASZA 4PHFA 2JLQA 1K9MD 2ZETA 1YZTA 2PX3A 3EA5A 1B23P 1NVWQ 1RVDA 5THXA 1SXJC 2QEQA 5BW8A 1W48A 2O5VA 3MCAA 5AJXA 1P6XA 2VHJA 3QFCA 5E7IA 1G8GA 3CCLB 1EP3B 1S1MA 2D62A 2RMKA 3W2HA 1GG2A 2QMUA 4HLUC 4CIDA 2GJKA 1S1CA 1V5WA 1WA5A 3HR7A 4QKQA 1E9FA 3A4MA 3ZS8A 3W34A 1ZNXA 3BJIC 1W5SA 1ZD8A 2YWGA 3CCQB 2CLCX 4YDHB 2R6AA 1FUUA 3LVBA 1FTSA 5L3QB 5L3VA 4PC6A 4DSTA 1P9WA 2IYYA 1KI9A 3EIHA 3SNHA 1U81A 2N1BA 4KAXA 4I1OA 1T0HB 2V55B 2YJTD 4M1MA 4UKDA 3U3JA 3F8TA 2R6DA 4RCYA 4MRPA 4OQMA 4EAQA 4HLDA 3ZZ0A 2ATVA 1U98A 4D82A 2ONKA 2JLXA 4TZ0A 2H1LA 4O0MA 2ZRFA 3QI2A 4GDFA 1ZCAA 1KI8A 1XMVA 1OXTA 2JLSA 3OFND 3PXGA 1Q1QA 2VF7A 4OYHA 4PSAA 3W9YA 3UMFA 4ON9A 2JLZA 4LGMA 1MABA 3VX4A 5IRCD 1COWA 4MKIA 1R8SA 1EFCA 4JLOA 4TL7A 3TLXA 1AN0A 4L16A 4XVQA 2W58A 4Z54A 4MYUA 3ZH9B 5AUNB 1VDZA 5BN3A 3HU3A 4X8HA 2QP4A 1JXMA 2W83A 4L5BA 2QGNA 1R5OA 1D2NA 4HDQB 3DHWC 4Q01A 4BFTA 1Q3TA 1TTTA 3GLGE 1E1QA 2OFXA 3R20A 1M1YE 3C5CA 1G3MA 3LVQE 3VO2A 3PIRA 4D4LA 5DYIA 2QPOA 4TQUS 1VIYA 2WKPA 5IK2A 4IW3B 1W0JD 1W1WA 1N2CE 2GVZC 3CCRB 1F3OA 1GNRA 1KO1A 1KK0A 4HZUA 4RKFA 3WMGA 3THWA 3TIFA 4DLUA 1CEEA 4MKFA 2ZE5A 1OFTA 4JBYA 1XB2A 4LJ7A 2ECKA 3UK6A 1CJUC 4FCVA 3QE0A 3VFDA 2JLUA 3HWSA 4A0RA 4O2RA 4YMSA 4DSNA 1K5DA 3K8YA 3OEHA 1OE0A 3U3MA 4POAA 2IS6A 2YWHA
chains in the Genus database with same CATH superfamily
1EBBA 1T4BA 3WL4A 3L0BA 3K4QA 5JNUA 4ZCMA 2GERA 2OB1A 5AM0A 5KHOC 4BQQA 4RZHA 3AU9A 1XTJA 5FBKA 2VNIA 2WAAA 5E6SB 2CBXA 4QVGA 3QLUA 1X2BA 5FWXB 1P1CA 3L18A 5H3CA 2GTPA 4QHSA 4E7PA 3WB0A 3HVRA 4NZZA 5FORA 4U0KA 3TN7A 2UXBB 2AN3A 3OD5A 1NVBA 1EU1A 1ZIOA 1L5VA 2PJUA 4H7EA 4LX0A 4Q3DA 2J08A 3F6SA 2E1BA 4WZEA 2EJTA 4FXPA 4X6LA 4XIIA 4BQNA 2AJDA 1UK9A 2XF2A 5ADVA 1HX7A 2W48A 1VKRA 1YS9A 1XYYA 4IF6A 3TLJA 4JEMA 2WYOA 4K86A 5J59A 4K9OA 4HXEB 5AJHA 2V58A 1KBQA 3HO6A 1NUQA 2WHQA 3V3KA 3P9QA 5KW9A 3ZVRA 1CUDA 2ZYRA 3T3GA 2EXXA 1S02A 1Z3IX 1HQCA 2H52A 2VHZA 3K70C 1T2UA 2NACA 1CVRA 2VXOA 4YY3B 4TMZA 4X95A 4KE6A 4V39A 3RVPA 4U7WA 4YRRA 4BX0A 4BLRA 2OXFA 2F1HA 1JWAB 3DE2X 4UFNA 3LY8A 1KO8A 2F1RA 1E4EB 2Y1GA 4IVPA 4AZWA 4GICA 3D6NB 3HUEA 2YZGA 4J0QA 2W6OA 1E1YA 3SSMA 4YJ2F 3A2NA 4HIZA 1GN9A 2IXBA 3QBDA 2BFCB 2VJQA 4NMLA 3BWEA 3B82A 2HV8A 1SK9A 3HBMA 4N6NA 3ZNNA 2Z57A 1CLUA 5F77A 1N2SA 2QUKA 3BZBA 1WZNA 1ZA2A 4E2YA 3UANA 1PI3A 1CF4A 1KJIA 1N2HA 1KMMA 2C2OA 1XTIA 4M87A 4YLEA 4AS2A 2CY0A 3NTOA 3DOCA 1UL1X 4LMAA 5HCNA 3WL8A 3A6ZA 1GEEA 5JSFA 3RIXA 5D2CA 3EF3A 3DULA 4LGVA 3TRIA 2XCSB 1PUIA 1TK9A 1M8KA 4IGEA 3C7KA 5THQA 4YUYA 3E15A 1R9NA 2C5EA 1X8LA 3PUIA 3KXLA 4PCLA 1ILWA 1TQ2A 3DONA 3UJ7A 4ZO7A 3GCZA 3PIDA 1Q82D 3HO1A 3ESDA 3GC6A 1IQUA 4QG7A 2H85A 2DFDA 3P94A 1Z08A 4HEA6 3G8YA 2JFXA 5TEWA 4QE3A 3GN2A 3B70A 3URMA 3MOIA 8AT1A 3ZVNA 5JQWA 1L3BA 2BHSA 1MV8A 2FUKA 2CCJA 2WDPA 4HNAB 4MPRA 1SKYB 5ERGB 1XMQB 3LOQA 3B2NA 2JG3A 1I32A 1NYRA 1PQ4A 2I1QA 4GRAA 4U2BA 1W9HA 4X97A 4KHPB 2ZB7A 1TYAE 5E9WA 1B6GA 1FFAA 3DL4A 4KSCA 3AHIA 1A2KC 1PWZA 2ZTSA 5EIAA 5IUNC 3ERCA 1J97A 3PFIA 3RYCA 3NBKA 3Q11A 3SSNA 4LE0A 1MX1A 1L1RA 2G8NA 2GZDA 3OURA 5HEKA 2RHCA 3TZKA 1M2OB 4GZLA 4A5SA 4Q1BA 2OCPA 2Q5IA 5FUXA 1AB5A 1QTRA 3RC9A 1JYEA 1E3QA 1GTVA 1IY2A 1C5KA 1YKSA 3NJ4A 1FU7A 2O1XA 2UYYA 4BKUA 4DMKA 4MHTA 4G1VA 2ENUA 1UD2A 1K86A 4RVCA 3R44A 3E20A 4REQA 4YR9A 4MMXB 5ES4B 5JH7A 2YIVX 5D84A 4MYDA 1T9HA 2Q5QA 5KX5A 1KYZA 1UQUA 2W2NA 2QZPA 1UD5A 3BB3A 1TLTA 3W5DA 5GIPE 3FYDA 3WRYA 3BJZA 5FYQA 1JW9B 4JOQA 4E22A 1JXOA 4BNYA 1LKZA 2UUCB 4B44A 4YACA 4PC2A 2ZWIA 3C6QA 2CJPA 2DR3A 2Y9MB 3JAWB 5C1IA 1V8DA 1RTTA 2RCNA 4EEZA 4D0RA 4YPOA 1UMDB 4LF5B 4OFXA 1CQJB 3EFOA 3K2IA 4NL4H 1RQNA 1YR7A 1V11B 1CUXA 3IBFA 4B4KA 2EW2A 3ET4A 1JZSA 4DIEA 1CULC 1NXPA 1Q5PA 2O0KA 4W9RA 3PR3A 1QO0A 3AESA 1WVMA 3D64A 1PJRA 4KIUA 4P4SB 3L1KA 3D4PA 4L4RA 2HW8A 4X54A 1WXGA 5AW8A 3LQEA 4B09A 4MUKA 3D8BA 1UPTA 4NZOA 4UEJA 4C1NA 3U44A 4DMFA 2BR4A 1ID8A 3RU2A 2AZDA 2GD6A 3C7CB 3WDSA 5FNVB 4YROA 1US8A 2C98A 2BGKA 2H7XA 4A91A 3U9LA 5AVYA 1H0HA 2Q3DA 4WLEA 2GK3A 4LYFA 1OXUA 2B9VA 1UZAA 5EP4A 1T10A 2OR3A 2OBYA 2XUHA 1G20E 1CERA 2O52A 4DTCA 4LHSA 1E4YA 2H18A 3QNUA 2FPKA 3USZA 1FRNA 2V6JA 2BZGA 2XSZA 3O38A 3O8OB 2IV7A 2UVPA 4X3PA 3T9DA 3MS7A 4J0EA 4Z5XA 1YI1A 3COYA 2QGZA 3BQMB 3TTSA 3A31A 1W88B 3A28A 1M67A 4MV0A 4S1PA 1KDZA 2VDUE 3LWDA 2JGEA 5HZMA 1SKUA 4E7OA 5FI3A 1D4FA 2JARA 3ADOA 3WP0A 4YV2A 5D8DA 4XN0A 5FO0A 1WMSA 5DV9A 5CB4B 2P9QA 4H9GA 3A1VA 1EINA 2V31A 2M98A 2QR3A 1KK3A 3QXGA 5KSPA 3QMPA 3TR5A 3PJRA 1ODCA 5FHQA 2DHRA 4QGBA 2X8BA 1G8FA 3PFFA 3GJ7A 1Y8ZA 2UZ4A 3V8PA 1TLFA 3BRQA 3TW4A 4AURA 4RVNA 2L0XA 3MIZA 1Y1KE 3VA7A 2WUFA 2C5HA 4M8IA 2XCIA 1EWQA 3WY9A 2QTLA 4RDJA 1V0FA 4XOIA 3DPSA 1ML3A 1LQ2A 5H70A 2JEOA 3HZHA 3KJQA 4FCCA 4E3WA 1GKUB 5B1YA 2DSTA 2YIDA 1EWVA 4X1IA 2CF4A 3R4CA 3Q7IA 4LA4A 3PA8A 3VHXA 1W4BA 1PS9A 2QTHA 4GL4A 4RENA 3ZE9A 4BEVA 1XSEA 1Z2DA 3R5SA 1YRQA 1KQGA 4DEYA 3L8DA 3HFRA 3PFBA 2A1UA 2OOKA 4KQJA 4RA9B 2DWQA 1BHJA 1KJQA 2W2MA 2BKEA 5JD3A 2NYAA 4KU4A 3TMKA 4IJKA 5DCWA 5TC4A 3T5MA 3X1XA 1EQAA 4G8CA 1WMAA 4UHFA 5EEGA 5BR4A 2C4HA 5ILOA 2BHNA 4FMDB 2IYXA 1MRZA 3GBVA 1GZ5A 4QTZA 4ZT7A 4ERNA 3FOWA 5SYNA 5HBRA 3ULKA 2FP3A 2A57A 2VHWA 2W6MA 3BD8A 3FFTA 3AF5A 3I2HA 4IQ4A 4MAAA 5T7BA 2G0TA 4JZYA 5ECYA 1JMYA 5HK9A 1M83A 2PMDA 2QTTA 3ETLA 2FMTA 1P4HA 3FYTA 3AVUA 1UZLA 5EEHA 4YUXA 1KY3A 3B20A 3EEBA 3PJEA 2PRSA 4KQXA 4RK4A 4F92B 4DR4B 1JXQA 1UJNA 3FF4A 4BDTA 1YIJB 4RY2A 2EJBA 3I6ZA 2IW1A 1QR6A 2Q50A 2WVJA 3MN1A 3H2HA 3X1DA 2ILVA 2NV6A 3CNHA 5B1EA 2WP8J 1NG9A 1T13A 4M86A 2VDOB 3K1AB 3FDJA 2HJVA 4EYQA 1JIQA 3EGDA 5BWCA 2DUJA 2RHGB 2Z9CA 4AJNA 4GYYA 1A8QA 5DXJA 1YDWA 4ISCA 1IG3A 2PWZA 4X5OA 3IPRA 4QWMA 2NNWB 3AUKA 4TTPA 1PW5A 3BY1A 4FBMA 5AK6A 5IZ4A 4AJIA 3K5HA 1Q1EA 3G23A 4PONA 4BO4A 4F5YA 3L6DA 2XB9A 3C5VA 3NB0A 2UZ3A 5FWDA 1XZQA 1U3WA 3VR2A 4QZVA 1M1UA 5CK4A 3U40A 2NSHA 1DUVG 5LZ2A 3VJKA 1QO9A 2ARKA 3QQ5A 4F12A 1HEIA 3HY3A 1A0OA 1P8JA 3MINA 4NFHA 1L5NA 4QYSA 2BEWA 2WKSA 3D7MA 2D0PB 3RVQA 5DRYA 3NOVA 3C3MA 3I73A 1ILEA 2OBNA 2EP5A 4CR6A 5IBRA 4CIXA 3LBAA 4GXTA 4ML3A 2WWFA 2H2AA 2ZUUA 3GT0A 4GQNA 3FCCA 1H1LB 3VAZA 2PEYA 2RK3A 5B30A 4ZAFA 2X2EA 2OTLB 2OZVA 4I5GA 2J9RA 4KK3A 4LG1A 1UPUA 1Y9ZA 5C7OO 4P3YA 1ZOOA 2FFBA 3K0FA 2NXNA 3H87A 3OCCA 1W8IA 5LQKA 1AC5A 3L7NA 3ZWYA 3NBQA 5DK4A 3ZYZA 4BNNA 4L0DA 2ET6A 3H3FA 4JIMA 4RUKA 3AEKA 3IBTA 3LTEA 4MA0A 5A7HA 3MAJA 4XM2A 1TF5A 3TDMA 3VO1A 1A69A 1L7PA 1RJEA 3HGQA 2HJGA 4HDCA 4ND5A 1E8DA 4ZVSA 3OUZA 5C31A 4MDYA 1Z62A 3OZWA 4NZNA 4PYKA 1LV8A 1AUVA 4TRJA 5CT5A 1W44A 4W5WA 1E3ZA 3S70A 3EQ6A 1RU3A 5KYXA 2PZFA 3BMQA 3U4QB 1J5EB 1K1EA 1RPJA 3OZRA 1UFVA 2R79A 1PLJA 1ZVMA 1AG9A 5TR9A 2HPHA 1D2HA 2VDNB 2X9NA 3FYUA 3LXMA 4P5PA 3PDIA 3IUNA 2XWBF 3E8XA 2RHRA 2OPHA 2CXNA 3V33A 2ZT8A 3PDJA 1DAOA 2GMWA 4QYTA 2EW8A 1OUMA 2IEBA 2E2WA 2YZ2A 3CRRA 1OLXB 5DYGA 5FTNA 1NW8A 3FLAA 4FFNA 4EB0A 4UAGA 3P9KA 1DHRA 5MN6A 2EBWA 2QV0A 1DKOA 1O9GA 3MS2A 4UHHA 3IHTA 4LNUA 2OENG 3TE7A 5HZKA 1OGJA 1HYGA 4IFEA 2NV4A 4JJGA 1LLQA 2P4QA 1BQEA 2LKCA 1MT3A 3CE9A 5REQB 3GBPA 5LQJA 4IWXA 4C4OA 1G9SA 1T3SA 2IYSA 2YJNA 2ZE6A 3KUXA 3F3SA 4DCPA 5ALOA 3VR5A 3JVIA 3WHIA 2BMEA 3U1BA 1S3GA 1DOZA 2BRUA 2G63A 2HMYB 3AW8A 3MWEB 4J3FA 2QTFA 3T5BA 3QYAA 4OQEA 2KSQA 3KOYA 4OYYA 1RJFA 2LGJA 5G3ZA 4AN1A 2HU8A 1CUGA 3U26A 5JIBA 3FKQA 2E9SA 2GETA 2AQIA 2WKWA 1YC2A 3QF7A 3AF3A 3CPEA 4H15A 4JKIA 3PITA 5DTMA 4ZC1A 4ZQBA 5T8KC 1M7BA 1Y8RA 3KUCA 5MGNA 1TEZA 1PJ3A 1TJYA 3OLWA 1EG7A 3H18A 2J3MA 2WAMA 1WQ3A 1OV6A 1YE3A 1MX3A 5AKXA 4NCBA 2ZZNA 4K8RB 1RYFA 4US0R 1KIMA 2CDNA 2CCGA 3I6IA 4ND2A 5KDOA 1YDGA 2V59A 1QRSA 4YV1A 1QF9A 4TKLA 4LJKA 1JR3E 1QVRA 2VLBA 3V32A 2NZYA 4MUHA 5LR6A 4EPVA 1DPFA 1KJJA 3GV0A 3EBOA 2O7QA 3IVGA 3L07A 4YA6A 4BE7B 5BSFA 4CTJA 4PZDA 4YQZA 1DV1A 3Q7RA 3G82C 4MV7A 2RHMA 3DEIA 2XQVA 4LI0A 2GCOB 2HWKA 4OBWA 5CFRA 3MMPA 3F6EX 1YHYA 3ND6A 1LK0A 1CT9A 1S8FA 3DAHA 2HL6A 4GMFA 2C2KA 5DN9A 2J6BA 4IGAA 3FPKA 4IXTA 3QWHA 4U2EA 4YT8A 1MB3A 3ASPA 2VUUA 1Z16A 3GG9A 2BVNA 4A8JA 4OL0A 4RJ2A 2OV6A 5HF6A 3SEAA 2JIZA 3NM6B 4PS0A 3ELUA 4KPGA 5CTAA 4RH1A 4U7PB 3RREA 1LPOA 2XUOA 1VQ9B 1ACMA 3CURA 4PAMA 1EXMA 5LZ9A 3ZDDA 4BC0A 3K9WA 1KYWA 2RCYA 2B4YA 4RWEA 3TSCA 2K7FA 1JAHA 3LP6A 2VNSA 4GZMA 4JYZA 4M9SA 1JJ2B 1I7NA 1TYCA 4P3XA 5DHAA 4BTEA 5AVQA 4WN9B 2AEJA 5LB4A 3OCXA 2MHCA 2QVLA 3LHSA 3OHSX 4IDQA 4M54A 4XDZA 2X1VA 3SEFA 2JKYA 2NU8B 3SIPA 4UU1A 3CX4A 4IUDS 1XXHE 5LA6F 4JLWA 4IS3A 4KWIA 5EPEA 3KZ1E 1PU2A 1GT91 4FC6A 4CU5A 4IGIA 4UZUA 1NDUA 1YCDA 2PA0A 4DDHA 3O21A 2VZ9A 4KXWA 2V4UA 3KSRA 4DV0B 1GQQA 5TV2A 2OFPA 2YWDA 2ZT5A 2C4MA 3KJHA 4Z0PA 3KEFA 3FTQA 2XRYA 1ZJ4A 3DZKA 1OREA 5KAMA 1XTKA 2EFYA 3LY7A 4H6VA 1K89A 4L7QA 4LV5B 3TW8B 2B5WA 1PG2A 3WLSA 3N8GA 4JVLA 2G0NA 5IZCA 1N1EA 5DEIA 1DMSA 4LPSA 1U6JA 4J9VA 5HDBB 2AI1A 2JGDA 4L76A 5G1NA 3AM1A 3QRWA 2FEAA 2J4FA 3IAXA 4CTKA 7REQA 1K98A 1C3XA 3LQ1A 3TEFA 3N2ZB 1AQIA 3E61A 2RE8A 1N4AA 5FJIA 4RIFA 4WBXC 3DBOB 4RPHA 4ZPJA 3WDKA 3D2CA 2ZAIA 5AK5A 4YV0A 4D3YA 1AGPA 4KODA 2ZTVA 5H80A 3TVYA 3Q6MA 4BOYA 4E5PA 2DKOA 3VI3B 2C9MA 1GZUA 1I10A 5JBIA 4MQBA 5JR3A 4OXXA 1PCXA 3ENWA 3NNSA 1M2KA 4XOUA 5EE1A 5JAQA 4JEIA 4OSOA 1CQIB 3KFLA 2Q07A 5DMXA 3WIEA 1XG5A 1ZW6A 1UANA 3OZFA 3ZZUA 1F8FA 1XEWY 5K8UA 3HKDA 1ZH2A 4W5NA 1FX0A 4CZ2A 5LMCA 4N47A 5C3MA 3A3KA 3NHZA 2FE4A 3BGSA 2C7PA 3K9NA 3TQRA 4NZMA 3UAYA 2LUOA 2WJAA 1IZ9A 2B6HA 3DZBA 4JQZA 1B2RA 2V8OA 5EYPA 1YACA 3AF6A 1M2HA 3X2FA 1QZTA 2AXEA 2AFIB 3TMAA 2I99A 6LDHA 1U6IA 2GLUA 3I6YA 4KX3A 4E6EA 5I47A 5L3SA 3BZUA 1JJ7A 3LDGA 4NJMB 1M2NA 4NABA 4FYYA 1T0BA 5A5EA 5IWAB 2F3RA 3T3OA 2BFBB 2B99A 2GF0A 2GEKA 3EA4A 3VJLA 3KYBA 3GLGA 3K0SA 1RXUA 1Y6JA 4DKJA 1AF4A 1OH5A 4RNDB 3JWGA 1IEWA 3BIWA 4YJHB 3ZYCA 4ITRC 3F78A 4OLHA 3GFGA 1NC3A 4X8LA 4KKSA 4DHWA 4G89A 3KZOA 1EH5A 5COQA 2ZULA 2E21A 5KKNB 2ENWA 5K3EA 3P32A 1B4DA 2AFRA 3DBHB 3OT1A 1LBEA 1MOQA 1SQ5A 1T8SA 1T2FA 1WZIA 3F47A 4FYWA 4MQMA 5CNMA 1WAMA 4L5CA 2HD4A 2GRJA 1YA4A 4Y1GA 2QNIA 4CKCB 1E99A 2HMSA 1EK6A 3A7DA 4DV1B 1JG2A 2IDKA 2P11A 3LCRA 4KGDA 2EYUA 5E95A 3ZEAA 1I94B 4D4KA 2HJRA 2ID9A 2ZTUA 4BNVA 1G5RA 4FR5A 3IB6A 5CR9A 4N5HX 3STYA 4ZWNA 1Y48E 3FBWA 2Y05A 2R48A 4X6XA 4F04A 2AF4C 3K16A 4P6VF 2B7BA 1SCAA 4TM8A 1BA2A 1NURA 2HNBA 3OY7A 3EXIA 2VQEB 3QFTA 1TDJA 1U9JA 1YUNA 1MG0A 4BCBA 1P5ZB 4TXMA 4CF6A 4G0ZA 5KSOA 1Q84A 4HLQB 4A8PA 5CCEA 3AR8A 1AIPA 3NUZA 4YP0A 2IUUA 2W8BA 4KXYA 3QUTA 2PSSA 5C53B 4DUGA 5LJLA 2QVCA 3HXPA 4GI2A 4Q5IA 5T6BA 1II0A 5D3QA 4CQLB 1ZMOA 3UTCA 4ZI5A 3ZV7A 1E1KA 4P83A 3ZK8A 1JLSA 1Y37A 4KYUA 1IDOA 4J1TC 2KB0A 2GO7A 1E5QA 2VSQA 3O84A 2FPLA 2FRDA 1YVUA 2HCJB 2HWYA 4L2IA 5HA5A 4YHHB 1WPGA 3MTAA 4ZZ0A 3VYVA 2OD2A 5TPZD 1U8EA 3RVNA 1C1DA 1PTJC 2D2FA 3ZBQA 2P90A 1H4TA 4BFCA 2IHJA 1XVIA 1IB6A 1YAHA 3PXUA 3QOXA 5DFAA 4U3JB 4M1TA 1RFLA 2VDQB 1C7FA 1TL7C 1AGXA 4PIPA 1DWPA 5JSUA 1MW8X 1TFUA 4IIJB 4B46A 1XDUA 1E6UA 2X3UA 4TMYA 2VPIA 5IFKA 3ER9A 4UD6A 4KZPA 4G6ZA 3S2IA 2OO7A 2NTJA 3GRAA 2J4DA 5CUQA 3U7FB 3MEQA 5ECDA 1ACJA 4CEJB 3SYMA 5FI5A 4EFNA 4DQLA 1VG1A 1HI9A 4PGFA 3ORHA 4TXNA 1P7PA 4HX9A 2ZUBA 4P58A 4B1FA 4LRQA 3PHGA 1ZITA 3GOHA 3PS9A 3AVYA 1DT3A 1QV7A 4N12A 2WW8A 1M0EA 4F8EA 3PUWA 1YQEA 2ID4A 1P6UA 2Y1DA 4UPEA 1Z0KA 3I55B 2W4QA 3E23A 3M49A 3O7WA 3PXCX 1Z0JA 3T3PB 4DA6A 4DR1B 3N2NA 4N3NA 1T6BY 2JJ2A 4CKBA 2O23A 4ND7A 1XZIA 3HGMA 3KXDA 3VHLB 2HU2A 2RGGA 5I7UA 3EC2A 1EVQA 3FDIA 3A3OA 1FTWA 4HAWA 3PKIA 2FPSA 4MLCA 4C01A 3TLEA 3T7KA 3FWNA 3SG0A 3G05A 4QELA 1RPAA 1KYQA 1SB8A 4PYNA 3TBHA 3I76A 4LHYA 4KXMA 1BS9A 4QC2A 4RXTA 3SU8A 1GITA 1IOLA 5IHPA 1T5DX 2YHSA 4I9UA 4LJYA 3SOZA 2XMPA 3DVSX 5ED0A 2JI4A 2YHAA 4J2HA 4RDLA 5GTDA 4U4AA 1U7HA 4G7WA 1PVDA 1XN1A 2VK8A 3GL9A 4AJLA 4FILA 1YB7A 5AJTA 4YT2A 4KO1S 3T4PA 4B4UA 4CFZA 4ZTZB 1JSRA 3ZCVA 4IBOA 1CR6A 4N03A 2IXTA 5E9JA 1AOXA 3PVCA 1PEKE 1TQDA 3E7WA 1WV1A 4RVOA 1LLCA 4Z9XA 4EYEA 1XI2A 2Q3HA 1Z2AA 3FNHA 2WD8A 1RJ9A 5AKGA 2PUFA 5DP1A 1UKCA 1LTKA 1I9GA 4I46A 1B6SA 2D7JA 2ZKLA 3OO0A 2OBMA 4F6LA 1OFGA 1BEUB 2BI7A 1A5AB 2VWHA 4V0LA 2I2AA 2QLJA 5FNZA 3A3NA 5GM1A 3WGUA 1FNNA 2NU6A 2FSIA 2PWPA 1OU4A 1X2EA 1U1GA 1NW7A 2Q3JA 1RI3A 1Q7YD 1M1NA 1G19A 1PYDA 2JD0A 3Q3IA 1M76A 2ZIFA 3EN0A 1G3RA 1YZ3A 4YRAA 3FLBA 3ZHRA 3OH8A 4RPDA 2APJA 2PQ2A 2R7NA 5DGCA 3W7AA 1QE0A 3N6VA 4H2DA 1KI1A 1NV8A 1EDOA 3FR8A 4K9NA 1V16B 5JDIA 5CLFA 1Z2PX 3BAFA 5HGJA 4NEGA 3WNDA 2A5YB 1J5XA 2CJYA 4BVGA 4C6SA 3LT2A 1CYEA 1XD9A 1Z29A 4GS5A 1ZO8A 4GWKA 2WYWA 1YR2A 3FAZA 4W1RA 1PFYA 4PG5A 3NAGA 4TL8A 3X3HA 4BMDA 3T38A 2ZBQA 1Q95A 4KL8S 5DM70 4HS9A 3BBLA 5LMNB 4PSVA 2H5LA 4DLYA 1HBJA 2OORA 5UKDA 3TZHA 1K5PA 3AZOA 3Q3GE 3DXZA 4G5YA 1WXWA 5C18A 3ENNA 2B1GA 1E1NA 3LQ6A 4QDKA 1SXJA 4BZWA 3OPVA 1V25A 4O4HB 4CNBA 2C99A 4I55B 1Z7WA 1SQFA 3DEZA 3O8CA 4ZOLA 4P31A 4HLUA 4P7BA 1U1FA 5LP6B 2WSMA 5LIRA 3CZQA 5JARA 4HBZA 1SAYA 1GPMA 1V7QA 2TECE 3FPEA 3GNSA 4ZCLA 3P2MA 1X94A 1BVRA 4GGMX 2OMEA 4TT8A 3UUWA 4JB2A 3W77A 3NYWA 3O8LA 3CCMB 1XZNA 4S2EA 2F64A 4OJYA 4K9SA 1PJZA 4WCFB 3L92A 4YRBA 2ZAYA 1P17A 2BGUA 2F62A 3C6YA 3JRWA 4TUYA 3T1QA 1QRTA 1O94C 1FU8A 2X77A 1YKFA 4YAWA 3G8AA 3QVOA 4OP1A 3FR7A 4PPQA 4R8VA 4EUHA 4QOSA 3KZXA 1UDAA 4F1KA 1GRNA 1A4UA 1PL8A 2L17A 5DIFA 1L1QA 4KFCA 1YTLA 2CXUA 4TRNA 1ODJA 1SQ6A 2DC1A 1A7JA 2VHEA 1Y5LA 3OP1A 3N86A 3PRYA 3UT0A 1KPGA 2O8FA 2C2XA 2ZSKA 4IIGA 3SQWA 4BECA 3HBFA 1XNJA 3H9QA 3PEEA 2P1RA 2X2PA 4NJEB 4O2BB 1N4DA 1QOZA 2XCLA 4LJ5A 5K3DA 3HBJA 3VUEA 1FMJA 1QAOA 2MSLA 4QDZA 2PVSA 1I2DA 4LDZA 4YT5A 1E4VA 4PRZA 3T3DA 4ID9A 4D9EA 1R8XA 1ZQ1A 3TLBA 3VR1A 2R7LA 1Z06A 2VYFA 4FHZA 2G1PA 1E43A 5A62A 4YJDA 1WJGA 1ZU4A 3SHTA 5FH9A 2B4AA 2JZCA 1O8CA 2DQSA 5A7GA 3V8BA 4J29A 3GARA 2DPYA 2IWHA 3RJ9A 4DKXA 2B8NA 1KZ7B 1OCEA 2YVKA 3EQZA 2VEOA 3GVHA 4CUZA 2WJVA 1O6GA 4MEAA 5EWLA 5BWMA 3DVLA 3HB1A 2OUKA 1QS0B 2ZJOA 2REOA 2H51A 3KD2A 3KOOA 3KWMA 2PCJA 2JKZA 3BC1A 1PJ8A 1GL7A 1SUFA 3RBAA 2O8EB 2J5QA 2J59A 4MJLA 1L1FA 3H04A 4MAMA 2B0CA 4KLRA 2XWSA 1OPRA 1UMBB 4P53A 1BHQ1 1DV2A 4JVOA 1CZLA 2C54A 4EUKA 1VCNA 5A6SB 1TO6A 2JAUA 1EFDN 4X71A 2GAJA 1ZUIA 4UM9B 1BU5A 1PS0A 5AI0A 2YVUA 1B26A 2Q1SA 4RMNA 2Y1WA 2WHRA 2PS1A 1DXHA 2BGIA 2ZLBA 5KINB 3H1PA 1DU4A 1UF9A 1V1RB 3GJ5A 1AGYA 3BGWA 3BD7A 1L7NA 1JU3A 1ONNA 2JAWA 1J06A 1PR5A 2HA5A 4PZEA 1K8ZB 1JDUA 2GPAA 2FW7A 1ZK1A 1QJ4A 2AQ8A 1PR4A 2IZ1A 3C1TA 2J9XB 3IT1A 1GUBA 3KJGA 5DX1A 3X1YA 4CFSA 4M0LA 1P19A 2J85A 4G85A 1C9YA 4WZTA 1G8HA 1QCCA 1LF0A 5CFMA 3REQA 2Z98A 1NKSA 3UNXA 2EWMA 5CCXA 3IDOA 4B4WA 4G0OA 3V2UA 3WK4A 4K2AA 2XOXA 1AMNA 4AC9A 3MSCA 2NUTA 4KLAA 5B3LA 2DPMA 1Q7BA 1NVFA 2QMQA 2WSSD 4MXDA 3V4SA 1FPMA 1GFIA 4J0IA 4CUKA 1SUDA 1AKMA 1UPFA 3I2YX 4N5NA 3LSTA 3QX8A 4E3ZA 3D6UA 1N06A 1NJ1A 1Y9JA 2VYNA 3ZHXA 1SIBE 1RRCA 2JN9A 1MHTA 4E5DA 5CVDA 2HMWA 2WZCA 3GJ8A 4MRVA 4ZDJA 3LWBA 4MGEA 1HT1E 3CRMA 5K99A 1MXHA 5AVSA 3EXEB 5JCZA 1QX4A 4O2AB 4WFKA 1BXGA 3D0KA 4LN1A 5BYBA 1M73E 2XT9A 5I7RA 4KX5A 2E85A 3CTMA 3LX4A 3QKIA 4FGUA 4GOMD 3MT0A 1P7CA 3OE7D 4N18A 4NEHB 1XZBA 3DEHA 4TZ6A 3QUCA 1X7ZB 2R1TB 3LBHA 2C9OA 4YRZA 1RAGA 1RHUA 4JQCA 4D3SA 3IULA 5EA2A 3OTOB 4DV2B 4A16A 5CXQA 1XEAA 1XNRB 1T5EA 1XTVA 1JKJA 1ML4A 5EHNA 4AJEA 1VE7A 3G8DA 3S68A 4DLZA 4DY4A 2PWYA 1SBCA 2WDZA 4K3VA 1YDEA 3DTNA 5EESA 5LD2B 3RFXA 3SF8A 2A86A 1SD1A 4YWJA 5EXEA 3EZ2A 2JRLA 2QI9C 1NUTA 3P4XA 5DKFA 5KB3A 1AX9A 2D2EA 2R00A 3E5MA 3RFTA 1IZ7A 3S7ZA 1GM5A 3BL5A 1JA1A 1RCUA 2R6R1 3ANSA 4LKRA 5BN1A 4FU0A 1FJ2A 4MYCA 1NXOA 3FTFA 2YC4C 2GM3A 1P2DA 3CW8X 4IM7A 4OU4A 1PSWA 1YASA 2ISCA 3DFIA 3HABA 4KR9A 2GXAA 4DCCA 3VTAA 1V43A 2ACEA 1F06A 1XMSA 3NRJA 2C3MA 2H5IA 2AG6A 4ZQHA 3O73A 1JFFA 3EBLA 4KQCA 5G0VA 3ADCA 1TLLA 1HYBA 1N5JA 2QN2A 1GGHA 2OC4A 1MIHA 2GSDA 1BPLA 2RHDA 2BUCA 3NH9A 5IVKA 1WPCA 2NUAA 2JIQA 4LQDA 2Q0SA 1COWD 1QIEA 2QKYA 1K75A 2FZWA 5GONF 3PK0A 2DBRA 3FCYA 3AEUB 1C80A 4FDTA 4QODA 1QIGA 1X3LA 4WLNA 3WLMA 4JBNA 1V37A 2ZVQX 4LHZA 4EDFA 4EI8A 3THYA 1RYEA 3EOBI 1RBYA 3R7BA 2AOTB 3ZBPA 5IJ0A 3IILA 1UZNA 3SHFA 4C20A 1KQOA 1XDGA 1KZ9A 1UBUS 5F78A 3URKA 2PQ0A 5A3SA 3OVMA 4GAEA 5BSKA 4OQZA 2WWTA 2X22A 4EJSB 3B3FA 3CLHA 1M6NA 1PJQA 2AS0A 1DX9A 1JDSA 1FDRA 1VL6A 2UAGA 3M6VA 4HXGA 2JJ2D 2X1LA 5PNTA 4AJHA 4S0ZA 5IYNA 2QM8A 3OWXA 1VQKB 1VC2A 2HA3A 4CWAA 3W5BA 3EX7C 2LPMA 3E7XA 1ZWKA 3D1LA 2QVGA 2BDUA 3F8SA 1E5TA 4CMAA 2B2NA 1Y3BE 1ECGA 1VLZA 2ILTA 4TYMA 4MQLA 1SD5A 2UDPA 5BNZA 3LAWA 1U28C 4JLVA 1GVNB 3RUAA 3UT5B 2GFQA 4Y2UA 2ZBEA 4CMEC 3CYFA 4GP9A 2QNBA 3EEIA 3K0HA 4TKVA 2R0QC 5CP8A 2BAGA 3S0JA 5DU2A 1HDCA 1NPTO 2ETXA 2AX4A 1HLFA 2XWQA 2NVWA 2JGFA 2Z95A 4OCZA 2VXCA 5HZAA 1WUHS 1QVVA 1J56A 2CBZA 2JS7A 3I5UA 3PLRA 4H7JA 4I9NA 3OEHD 2PCLA 5BNFA 1XOIA 3JQEA 1S6YA 1TA4A 4UDXX 5J2TB 1N57A 3ASVA 4KE8A 4BQFA 3QVLA 4IHJF 4UNQA 3P2OA 1E7WA 1JS1X 1J24A 1W36B 2Z6QA 5JTTA 1BXZA 4A8TA 4EITA 5BR1A 4EHLA 1W5EA 4AIRA 4QLOA 3DEYX 1XZEA 1UJ6A 4OMFG 2XXAA 3S2SA 1W9XA 2C4UA 1TC1A 2BFOA 6ABPA 2HZBA 1AKVA 2HF7A 2OHGA 4PLPA 3RKSA 4UD2A 1EGAA 4N7MA 5FBVB 4J16A 3GOQA 2AKEA 2VJCA 2QSZA 4PEVA 1XF1A 2B8TA 3JRNA 3P2KA 3LLUA 1L8OA 1AHIA 2JIDA 1FP4B 3W06A 4J94A 2V1UA 1ZBQA 2OG2A 2C1ZA 4V0QA 2YQ4A 2IPMA 4JKYA 2I76A 4R9RA 3TCNA 1EGMB 3R1IA 2HMAA 3OOJA 1EE2A 4XE5A 4YJFB 4FYIA 2C96A 5EE5B 3DW3X 1EZ1A 3EOZA 1VL8A 2MMGA 2FVXA 4FLFA 1L4EA 4H7DA 1A27A 4RH0A 3RSSA 4EGJA 1J2TA 4N3AA 3CMAB 3NUGA 4O5OA 3W6NA 1R0RE 4HGRA 2NVOA 4KMSA 4TS3A 4GVPA 2AFVA 3GDFA 4BBPA 1P44A 1HNXB 2CDAA 4HQFA 3A9UA 3SJCA 3QLJA 2BFDB 1OH7A 4UBMA 4YEDA 3ON5A 1K2WA 1JZTA 4UCQA 2E82A 4MR8A 1S7GA 1EAYA 1CDEA 1ORRA 2G06A 3A2LA 3PCTA 3WIVA 4UEOA 4KI7A 2ZM6B 3JQAA 1PQYA 3ZWXA 2YXEA 1CRZA 5LDDC 2YWEA 2VQDA 4WZAA 1OOEA 1LZKA