1KK0A

Structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
405
structure length
399
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDHSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGLVGGVLGGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVGTEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
molecule keywords eIF2gamma
total genus 96
structure length 399
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk0A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk0A01
4GP7A 2QRZA 5DO9A 1KK3A 1XJQA 3CMAB 1Z28A 3KUCA 2G9NA 5CB8A 1KDTA 3OJXA 1GKIA 1P2TA 1E9FA 1FNBA 1N2CE 1OFTA 4KFUA 2IYVA 4M1OA 3WY9A 5JHGB 2YZ2A 4WBSA 4JLJA 3PEYA 1DPFA 2C5LA 3M1IA 2GBLA 2OZEA 4BLPA 1P60A 4D82A 4C2UA 2IK8A 2RGXA 4OQFA 2GKSA 5TY0A 4ILEA 2ZJ5A 2CL6X 2J5XA 4WOPA 4A8JA 4F91B 4PGOA 4BEJA 4M9XA 4XTCS 2VQSA 3VR6A 4XWKA 4AYXA 4BLSA 3NH9A 2ZRCA 3PITA 2HJVA 3A1SA 1XTSA 2DCUA 4LJ4A 4B3BA 1N0UA 4LBVA 3CRMA 4QOSA 4RY2A 5DLQC 3G6EB 1NN0A 1N25A 2Q9CA 1JBKA 6Q21A 3RC8A 3CB4A 3E20A 2PMKA 1E9CA 5TB5A 3NBZC 3U3RA 3U61B 2OLJA 3LVQE 1GL6A 2O8CB 2WV9A 1ODFA 5FTJA 4C9BA 1W36D 2C95A 3IUYA 1XX6A 3CZQA 3H2YA 2XB2A 5FL7A 2DERA 4G3XA 1BX0A 4HLQB 4AF6A 3HDTA 4JLAA 4TLCA 5FL3A 2XGJA 3BXZA 1IN7A 2O0JA 3OEHA 3QSYA 2IBMA 2WPDD 2WIBA 1F60A 2O0KA 1ZCBA 2EW1A 4KCGA 2DHRA 1JB1A 4BFTA 4A1FA 2ZU0C 5JS8A 1CRPA 3ADDA 3NXSA 2GAAA 2GWHA 4B2LA 2C2HA 3B1YA 4EPVA 2ZRAA 3C8UA 5TARA 1ZM4A 1ZNXA 5L3QB 2CK3D 3GLFA 4WZAE 1KJZA 5CITA 4JL6A 1JQLB 3I8SA 5JI2E 2XZPA 4W9MC 1QDEA 4QJ5A 3LQQA 4ZI2A 4XOIA 3MHPA 4UNPA 2H1LA 4BFWA 1E2HA 1PJRA 1JA1A 2REXB 3QUSA 4NCJA 2IX3A 4FK8A 1A8PA 1SXJC 121PA 3F5FA 4JL5A 3T34A 1JJ7A 5KDDA 4U5XA 5DN6A 2IW3A 2FG5A 3P4XA 2BGIA 1VG0B 4RD2A 2JLQA 5GJWC 1G6HA 3WBKA 2CDNA 3K0CA 3V76A 5C4GB 2XAUA 1O3YA 1C1YA 1VYUA 2ZTSA 4NONA 4DB4A 2P5TB 4LHZA 3LVBA 3VKWA 3P27A 4KVGA 1WF3A 4LSGA 3EIQA 5JEEA 1OGIA 4W5HA 4GOXA 2QMUA 2FZLA 4TLEA 3UWKA 5JJIA 3T61A 4G01B 4IRUB 4D25A 3K0CC 3T1QA 3TSZA 4Q47A 4US0R 4BRWA 2WSSA 1CU1A 4EPTA 1DAGA 5B64A 5FUYA 2B6HA 5H68A 2V1XA 4TLDA 4MH0R 1VQOB 1NMZA 4LCBA 2A5YB 3C14C 1BX1A 3LVRE 4MRVA 5CDFA 4ZDKA 5JZVA 2C8VA 1PUIA 2ZJYA 3CCEB 3QJYA 3W9YA 5TMPA 2DPXA 5FI1B 1U9IA 4TZ6A 1CBUA 1FFHA 5KNCA 2IYTA 2ZPTX 4IFBA 4Q5IA 4A0HA 4DEXA 2VF8A 5CLLA 1ZBDA 2H18A 1S9DA 4EJSC 3FPKA 4OK3A 3KQHA 3B1WA 4GT1A 1EP1B 5J4HA 3PCRB 8OHMA 1CRQA 2Z5FA 3LY5A 4UXIA 3U4QB 1E0JA 1N5IA 3OE7D 2F7SA 3SYKA 2GK6A 4NH0A 5SZHB 2ZU6A 4PPQA 3KKPA 3MJRA 5F9HA 4F38A 4RZUA 5P21A 2EVWX 3EA0A 3NEJA 3V4FA 4BRUA 3K0FA 5TV2A 3PEWA 4FCVA 2JATA 2Y8EA 3LW8A 3PXGA 1EFUA 1OV4A 4ZI3A 4CEIA 2K5UA 4LYAA 3T06B 2QA5A 2GILA 3AP3A 4R71A 5J5CA 4QGGA 4O25A 3FPAA 1OXXK 4QHTA 3CXCB 4ESHA 5EJEA 2W6IA 1L4UA 5KHOC 1ZINA 4LV6A 3L0IB 4TLBA 2OK7A 2EWVA 3TMKA 1QVAA 4A6XA 3THXB 2FGKA 2KB0A 3K09C 3Q7PA 1IXSB 2OESA 2RGNC 4X8HA 3THWB 3KXKA 4ARZB 4AWXA 1ZNYA 1HT1E 4U7DA 3KZ1E 4HLUA 3JZMA 1RW4A 4MGIR 2CK3A 5KNDA 3U44B 2Z6VA 3ASZA 3CRRA 4URWR 1JB9A 4TTQA 2ATXA 4Q1CA 4OHZA 4DHEA 2IEZA 2RH5A 3T35A 4AK9A 1DEKA 2HCBA 1Z63A 4HZUA 4PHHA 4V03A 4ZPXA 2J0UB 4B75A 2OV2A 4HB0A 4KFRA 4NTZA 2XEXA 3AVWA 1A2BA 1JEDA 1KAOA 1V5WA 4KITB 1R7RA 5FR2A 1XEFA 2BHRA 1KY2A 2JJ2A 4KI0A 5KU1A 1G8HA 3A1TA 1OYYA 4Z1MD 3RC3A 4H1UA 1SXJA 4HDCA 4K8OA 2ZITA 1Z22A 3D7MA 1A2KC 2OAP1 2ORVA 2W83A 4UNSA 2A5FA 3B5JA 2IXGA 2E87A 4PTLA 4Q4HB 5FFMA 1D9XA 1G3IA 3AUYA 2FX3A 3BB4A 3GEEA 3LH5A 3HU3A 2GEVA 2VRWA 2XNDD 2YWHA 2FU5C 4IKEA 521PA 3GLGB 1G7SA 2CJWA 5CDFE 3R8FA 1C4OA 1NSTA 1II0A 2MMCA 2OUKA 2W0MA 3E2IA 3FDIA 4PC2A 5IT5A 2B8TA 1Q3TA 2WSSD 5K8TA 3GEIA 4ACAA 2J3EA 1DADA 2WWWA 3D8BA 3FHCB 1COWD 3IEVA 2YNMA 1Q3HA 1Z08A 5G53C 1Q7YD 1L2TA 4KBGA 1RC8A 1TU3A 1NY5A 2ZE7A 5FPTA 1HH4A 4JKYA 4CVNA 4EH1A 1QVGB 1E2LA 2ZANA 1J9ZA 2BEKA 4IVRA 1CP2A 1MT0A 4Q03A 2ODNA 1HURA 1T4GA 3GCGA 1GVNB 4PC6A 4HZUB 5DHFA 3SZRA 5EZ5A 2EFGA 4GFDA 2WJVA 3JVUA 5HZHA 2FE4A 3PENA 2ZS7A 4HDQB 5HE9A 2FN4A 3CCQB 1Q57A 3OE7A 1W0KD 1Q0UA 3ZQ6A 3ZD6A 1N6KA 3CLVA 4M21A 1E2PA 2EU8A 3TR5A 1FW6A 2O8DA 3EZ2A 3I92A 4P6VF 1DOAA 1S9HA 1OFIA 4NE2A 1K9MD 1XD9A 2Q0HA 2QSYA 1VQNB 3C41J 1U0LA 2IC5A 1W0KA 3AGQA 1SXJE 2OBNA 2A5GA 2MSDB 3WMGA 4XIGS 2V3CC 1N6IA 1DAKA 1U8YA 3GJ5A 1WXQA 1DARA 4HSEA 4B48A 4G5GA 2GCNA 2OBLA 3QFSA 4MGYR 1NF3A 4NCHA 1FUUA 1TF2A 4PANA 1YJ5A 1MO4A 2AWOA 4EPYA 2PJRA 1ZD9A 2IYZA 2QPOA 3KL4A 4F92B 1WB9A 1EFHA 4Q4JB 4BZQA 3C5CA 2B8WA 2MSCB 3DEFA 4Q48A 2CHVA 2GZDA 4LBWA 2A3RA 5BW8A 3IILA 1KJYA 2YC4C 3DL0A 3EZFA 1P2SA 4LI0A 3QPWA 2WMOB 1YI2B 4IDNA 2G77B 4GI7A 1VQ8B 3ZC3A 4KV9A 3TSOA 3KFXA 3S1AA 3QNUA 1KRHA 5DI3B 1R8SA 1US8B 2BEJA 2F1HA 1RRCA 4MITA 3CIOA 1CNEA 1NJFA 2IL1A 4ZIRA 4LUCA 2OM2A 1S2MA 4DDUA 3H1TA 1XE1A 3O8BA 1JI0A 2CVFA 4LRWA 2F43A 2V54A 3RSLA 4XSHA 4AKEA 1D2MA 2WWIA 2GF9A 4ON9A 2GEDA 2PX3A 3GJ4A 3ZDQA 4O2LA 3GLIA 4AI6A 4A15A 1SXJD 3U3JA 4N0EA 1MO3A 2R6GA 4FINA 2BSAA 1G16A 4IVPA 4AG6A 5FOVA 3SBEA 4TYQA 2VYQA 3VNVA 2B92A 2ZI7A 3AVXA 1CQXA 1FRQA 1GAQA 3WXMA 1GRRA 4OJKA 1RZ3A 2ZJ8A 4XVUA 2GESA 3BFKA 3KQLA 4AYWA 2VLIA 1W4AA 1GUAA 1MH1A 3FWYA 5EXPA 1EFRA 1OXSC 3CH5A 4FI3C 2XTMA 2WKQA 4GPTA 1HUQA 3OW2B 2OILA 4Q9JA 4KU4A 1SKYE 2H7VA 5AN9A 3U6BA 4TL6A 1CR2A 3SI7A 3SJBA 4B3CA 4TMTA 4JZKA 1NVVR 4LC1A 1XXHE 3REGA 3AQ4A 4D4KA 3K70B 1KC8D 2ANBA 1DS6A 3VAAA 2YHSA 4PC1A 1NN5A 1F6BA 1XMSA 3SN6A 3ZJYA 5JEDA 3VFDA 2AFIE 1KSHA 3MMPA 1BQEA 1CIPA 4OHXA 3RRNA 1FNDA 2P3SA 4TQUS 1KKLA 1T3LA 3K70C 2XTNA 4PSKA 3X1YA 4BLOA 4E03A 1YJ9B 1R0ZA 3B1ZA 1AJEA 1GNQA 1W49A 2FSFA 1UDWA 2G88A 4RZ3A 1JPJA 4BFYA 2QAGB 3SJZA 4DXAA 1IXRC 2ZAMA 3SFZA 3EZ9A 1IXZA 2EFEB 1E1QA 2W2XA 3CNLA 2C04A 4IDQA 4A8JC 2GETA 1KKMA 2A78A 4QRHA 3R9WA 3LLMA 2F43B 1XBTA 2VHUA 3GPLA 5HPYB 4NZYA 821PA 1KSJA 3OIWA 4Q1FA 1F2UA 1FQKA 1CNFA 1G7RA 4JJZA 1IY1A 1HTWA 4R2HA 2V6JA 1UEIA 5LB2A 2WJIA 3RS5A 4ZGNB 4JL8A 3K09A 2WKPA 2G6BA 3O8CA 5AWFC 1YHNA 2G3YA 1CJVC 3AVOA 3F0TA 3ZLJA 3R9XA 1E6CA 4PQFA 3JVVA 2C03A 2OG2A 5F3WB 1X1SA 1Q1BA 1N0VC 3QBVA 2WTUA 1CULC 3RRYA 1NIJA 2Q9BA 5AJXA 2HUPA 1E4VA 2BPOA 1VQ4B 3T1TA 1AQYA 4MGKR 1R6BX 1M90D 2CCGA 1DAHA 1TTTA 3ZIAD 5CIQA 1FTNA 2JEOA 1E69A 2REOA 3VO2A 1QF9A 2QBYB 3I4LA 3RWMB 4QJ4A 4OQXA 1PVOA 2ZVQX 4GRAA 4WZBE 1QVRA 4OBEA 4EQ6B 2FEOA 3ES9A 1DG1G 2F1RA 2BKEA 1E2QA 2E9SA 4ITRC 4CT4B 2NO6A 1S1CA 2PZFA 4O2RA 2RGGA 2VP4A 2ZETA 2VYFA 2EFDB 1UPTA 1W0JA 1XTQA 2V1UA 3CCJB 1IN6A 4DCTA 1DDIA 1ZC4A 2NO7A 5BYJA 1K5DA 1E79D 4HAYA 1B0UA 4AKIA 2QM7A 4HUQA 3A37A 1LTQA 5KTYA 4CF7A 3LQRA 5K8IA 2NQ2C 3BB1A 3VNUA 3WMEA 1DAEA 1IY0A 4IOLA 1Y3AA 5EE0A 1GAWA 2ZRIA 4DRZA 2GEUA 2XJ9A 2GRJA 1QFYA 1I4DD 3GLHA 3I62A 4B2PA 1XPOA 2QTVB 2JDID 1W36B 4ZCIA 3W2IA 3DPUA 4EFNA 4ZKDA 4B3XA 1XTKA 1EFTA 3U3MA 1WQ1R 5G3ZA 4QGAA 4DCVA 1BMFD 3X1ZA 2ZSEA 3HR7A 2BM0A 1IOZA 1G3MA 1TUEA 3BIFA 2XXAA 1M2OB 3RVBA 2F55A 2AX4A 2IS2A 4A82A 2ONKA 2RMKA 3CCMB 3W3ZB 1EG7A 1QZXA 3O47A 3DM9B 4KAXA 3WYFA 3WHLA 3SOPA 1Z2CA 2BJWA 2CLSA 4LJYA 1DO2A 1JR3A 3ICQB 2J0QA 2BCGY 4URVR 4YMTA 1VKJA 4OKSA 5J4VA 2JLYA 2WJHA 4IDHA 4C4PA 1G64A 3LBNA 1IN4A 3G0HA 2A7QA 1MV5A 4MKIA 3ZQJA 4CIDA 5KYKA 2PIAA 4RD4A 1E2FA 3X1XA 3WBJA 3NHBA 4YLGA 4MUAA 1NSFA 2G0NA 1NKTA 3BFVA 5AUPB 2KJQA 2GXAA 1ZJ6A 3I72A 3E1YE 1W48A 5B58C 4V0LA 4DLVA 1OXVA 1QGAA 2ZRGA 2QORA 4TTPA 2CLDX 2EFCB 3KQNA 2QUZA 1ZM7A 3REFA 2ZR9A 4HATA 1U0HC 2ONJA 2R65A 5E7JA 3RRZA 2ZRMA 4TMWA 2QP3A 4C0JA 4OK5A 5JRJA 4F7DA 1YRBA 1XEXB 4Q1BA 2GF0A 2EYQA 2EWWA 2I1QA 1Z83A 1DELA 5GADl 3WP0A 3KQUA 3HYRA 4K81B 2J7PA 4FN5A 4B35A 4FCWA 3QOFA 3B82A 5JBQA 4XH9B 3QE0A 1U81A 3RANA 1G291 3T5GA 2FH5B 4B3FX 4DT1A 3A6PC 3CM0A 2BBOA 3LRPA 1RRFA 2J0VA 1K8RA 1YZQA 3P20A 3KKNA 2Q3FA 3TUIC 4PSAA 5C2JB 1G7CA 4FW9A 5EUMA 1CR0A 2WSMA 2ZJAA 2O8BB 1R5OA 1NVWQ 5D3QA 1PUJA 4LJ6A 1XU4A 1I4TD 3RSOA 1B2RA 3WRXC 1RVDA 1BO6A 4DEYA 4QKQA 3U3OA 5SZJA 3THYB 4PO8A 2W2TA 2GZHA 3R8CA 4N3GA 3EPHA 4JT2A 1S3SA 4L8GA 3QBTA 2NO9A 4LJ7A 4PQRA 4A36A 1ZM9A 4ESVA 4LHXA 4Y9RA 2IF2A 1Y63A 1OFUX 3AGPA 5EE9A 4E22A 5KUTA 1FX0A 4KHZA 2X1VA 1SZPA 1R2QA 1X8JA 5J47A 1SVSA 4Z51A 1A4RA 1ZRHA 3PUVA 1AS2A 2MMGA 4TSFD 1MKYA 2GJKA 3IO3A 4FMDF 4PQYA 2ASEA 2C96A 2WPDA 5AJZA 4BE7B 1S4QA 4M0LA 2REBA 2HDNB 1A82A 1YJNB 2IYQA 2BVNA 1H42A 2OEPA 3TNFA 2PMDA 2YWGA 3CR8A 1XXHA 2O8EA 4L4UA 4KO8A 4I1OA 2BN4A 4FXPA 2AD1A 1MABA 2XXAB 4LJ5A 1PLJA 4O0MA 1II9A 2AK2A 4JLMA 3H4MA 4KSCA 5AK0A 3BC1A 1AS3A 4E5UA 3ONWA 1ZIPA 3EW9A 2FSGA 2W58A 3QI2A 1GP2A 2QQEA 2QPAA 1Q82D 2XOKA 2VHTA 3QY0A 2FDCA 4BPBA 1TU4A 2RKOA 4YMWA 2HF8A 1KI4A 4US1R 5AJVB 3THXA 4M9QA 1IJEA 2OCPA 5FOSA 2W2VA 2GCOA 4Q4HA 5BQ5A 2KBFA 2RHDA 3A1VA 2IT1A 4I1VA 5K8LA 3IQWA 1G19A 5DGXA 1JA0A 5CK4A 2IXEA 5IHPA 1W35A 3WYGA 2NMVA 4NU0A 4YC7A 1B23P 3TVTA 1AGPA 5GJCA 1FX0B 3SC3A 2JIZD 1DDGA 2CJWB 4HAWA 3M4YA 3B6EA 2BKUA 4MRPA 2YYZA 3N5CA 1OXTA 1II8B 3G82C 3OIYA 3CCLB 3BH0A 5EE5B 3PEUA 3CCUB 2IWHA 1OIWA 1CJTC 2MSEB 2OO7A 3PUWA 2O8FA 2N46A 4EPRA 4DLSA 4QFMA 1IM2A 4PX9A 1KI6A 3P4YA 2DEUA 2QMEA 1JQJC 4G5SA 4TTRA 5AJYA 3VR4A 4IOJA 2FFHA 3RNLA 4A2PA 4IOMA 3G5UA 5H8WA 2XNCA 1ZNWA 2WICA 1KO7A 2AN9A 3E1SA 1BYIA 2ZS9A 1OB5A 4TL7A 2OBMA 3DOEA 3PQCA 1WBDA 3TGPA 3GJ7A 2ZRKA 5DI3A 1JAIA 4C0BA 5HKKD 1EGAA 3AKEA 1DBSA 4EIWA 2FPLA 1Z6XA 4DDWA 5JFGA 1KNQA 1FDRA 1W5SA 2AFHE 2VP2A 1JNYA 3THYA 3V4RA 1U8ZA 2DR3A 221PA 3CWQA 2XNSA 1TMKA 2BBWA 4EJSB 4A9AA 5B30A 3TW4A 3X1DA 2UZIR 3K8YA 1CS4C 3IKJA 3UXMA 3ZBTA 5FPYA 3OZUA 1LF0A 2D7CA 1SGWA 2BIFA 2WBLC 1QHXA 1XZQA 3AKCA 3VO1A 4A2QA 3RAPR 1YR9A 1KO8A 3IQXA 5G40A 4NYIR 1KZ7B 2D4HA 1SULA 4F4CA 3ZZTA 1RJ9B 1XDBA 3BWDD 3DKPA 3BH6A 3PEVA 3U5ZB 1KY3A 4IJMA 3AF4A 1VQ9B 2BC9A 1JEEA 2QTZA 2V9PA 3ASYA 2GHIA 2AKYA 4P31A 5JSZA 1TQDA 3SEAA 3CZPA 3H0KA 1BOFA 2PZGA 1Z2AA 3AH8A 3IO5A 3OIVA 2AKAB 4PAMA 3W90A 1TADA 2Z4RA 3K0SA 1D1NA 2GJAA 3BJIC 1BMFA 4DLRA 4OI0A 1KJWA 3CC7B 4AKHA 4RFSB 4LHYA 4C0AC 3DVLA 1Z6GA 3WHKA 3U7EB 1IQPA 1XRJA 2Z83A 4ZCLA 4I99A 4Q19A 2VP5A 4PZZA 2GPJA 2AXNA 1F20A 2ZRPA 2B7CA 2VSXA 2DY1A 3OAAA 2ZE8A 1HV8A 2C9YA 4F7WA 1E9DA 1IONA 1SVMA 1YZKA 2QN6A 2VP6A 4D80A 4JLBA 4I81A 1E32A 3FMFA 1G20E 1S96A 2B7BA 3ZYCA 1KI2A 2QI9C 1JJVA 4B32A 2WMNB 4RCZA 1W7AA 5FBQB 4N3NA 3RS3A 2FFQA 3Q72A 2FWRA 4UNQA 1FMLA 1GNRA 1OFHA 1Z0FA 1PV4A 5F98A 4Y9UA 4QXAA 5KSZA 3U6KA 5CYPA 3KB2A 2ZM5A 4M9SA 3W2EA 5B2ZA 1BH2A 3SHFA 1CTQA 1VCOA 2GDJA 4G1UC 2RB4A 2OAQ1 1FL9A 2IYLD 2WWYA 5AJWA 1KI6B 1WP9A 3RS0A 3W8RA 4DC9A 2XZOA 1GDDA 1W34A 3B85A 4MKFA 1JR3E 3RS2A 3Q3JB 2FOLA 1Z0DA 4Q9HA 3VX3A 2BMWA 4CYMA 1ZAKA 3AKDA 2QM8A 2XZLA 4MGZR 4BLRA 3EIEA 4Q7MB 4TQ9A 5C46F 4JVMA 1YHQB 3AB3A 3TBKA 4V0ME 1KIMA 3BE4A 4UAJA 1LY1A 1N6LA 4UXJA 2JASA 1NY6A 1E96A 2QAGA 1QHHA 2QNRA 4M1YA 2XTZA 3TKLA 4WA7A 1E0AA 4TMVA 3QXXA 2ZRDA 5C18A 2OXRA 4R7ZA 3MGCA 1XCPA 2EIXA 4YMSA 3O8DA 4D26A 3NDPA 1LS6A 4DSOA 5FR1A 3ZVLA 1VQ5B 4I4LA 1PLLA 4OI1A 3TIFA 3MCAA 4RKEA 4B3DA 4TMZA 4IEEA 1VHTA 5JWHA 1XPRA 4TN1A 3CMEB 3EZ7A 1ZVQA 3JZAA 2GVZC 2Q3MA 4OQMA 1G5TA 5BYKA 1KDPA 3CCRB 5IRCD 2HYIC 2FMXA 1K6MA 3CNOA 3IDQA 4KLNA 1H65A 3AEZA 1HYQA 1R4AA 2CBZA 1R10A 1YR8A 5DSZA 1G18A 1YZNA 3OZXA 3GMTA 4HAUA 1W87A 1E2KA 1TX4B 3UKDA 2X2FA 4Q4AB 1EFCA 3PG5A 4FCTA 3W6OA 3QF4B 1W2GA 3AP1A 4Q00A 2LKCA 4HLCA 2JGNA 2WZQA 4JLNA 2QMOA 4EAQA 5K8UA 4A0FA 2V55B 4B44A 5JMTA 3VHXA 2GAOA 2RGDA 1HEIA 1WMSA 2H5EA 1EP2B 1XNJA 3B1XA 1EFRD 2QDXA 4AURA 1UADA 1E0SA 3SHWA 3CF0A 3GFTA 1J99A 1NJID 2BBTA 4EPXA 2CXXA 3QVVA 4FWIB 5LD2C 1IBRA 5FOWA 5JI3E 3L82B 4R98A 2VF7A 4XVQA 1QHHB 1VYVA 4S2EA 2QTLA 2RC5A 3BGWA 5GVSA 3MWJA 4M1KA 4ASUA 3Q5EA 2VHQA 2D2EA 4C3ZA 3W2FA 2GNOA 5L3RA 1EK0A 3CW2A 1YR7A 4M1TA 3QKRA 5H5JA 4I1UA 4Q4LA 3NKVA 1Q1EA 2RGBA 4GL2A 2PL3A 2IEYA 2IUTA 1K73D 5IF9A 3BH7A 2JJ1A 5AUOB 1TQ6A 5CJ2A 4C7OB 1A5TA 2ZI9A 1ZD8A 3G4SB 1TF5A 5CK5A 3VKHA 1IAQA 5JS7A 1SKQA 5GV8A 3KKQA 3KDSE 4AG5A 4BQSA 5JCPA 1DG3A 3KX2A 3J81k 1IN5A 1FRNA 4HZIA 3MG9A 2F9LA 1G7TA 2XSZD 3W5IA 5KO2A 3FGNA 1XCGB 3W6PA 5D3MA 1X3SA 3GQBA 2ZSFA 3OZVA 2RCNA 2QA4B 4GZMA 3TQFA 4C2TA 2VL7A 2IYUA 4IDPA 4DIEA 4Q1DA 4IFEA 5LB4A 1YZTA 3L0OA 4GOJA 3ECCA 4HUQB 1G17A 3RS4A 5HCNA 1T3HA 1UEJA 3TSWA 1TEVA 2AXPA 3AF3A 2HMAA 2JAQA 1VCIA 2ZYUX 4NDZA 4LX0A 4DLXA 2HJGA 3FHTA 4KVAA 1HE1C 2FPMA 2GJ8A 4I1SA 4CEHA 1DVRA 3IPYA 3I32A 3R9IA 3DHWC 3W6NA 2NO1A 1NLFA 1E2DA 3DZ8A 4BFVA 1EWRA 1DAFA 3U44A 3LX8A 2D74A 1A1VA 4TMKA 3GJ0A 5KOYA 1T0JB 2ZI3A 3HPRA 3ZVNA 1U8AA 3UG7A 3HJNA 2H57A 3KKMA 5E7IA 1MRNA 1E9RA 1GL9B 3D31A 4K1XA 1N3BA 3QXSA 3LWNA 4M1SA 4NCNA 3EWSA 2IS1A 1KDOA 1XMIA 3NH6A 1KOFA 1OH6A 3W2GA 4B6EA 3KTAB 4Z1MA 1FQJA 4C7OA 1P3JA 2A5DA 4RD1A 4M1WA 3X1WA 1G3UA 1E2JA 3LX5A 2CVHA 4LPKA 4P4SA 3OHMA 1HQYE 2VNJA 3BBPA 3DZDA 1NKSA 1RRPA 3NEYA 2JLXA 1GKUB 1NVVQ 5FI0B 5KDOA 4LYJA 3UATA 1GRQA 3BB3A 1OW3B 2DB3A 4Q7JB 2NG1A 1PZNA 3SE0A 3IBYA 2DFNA 2O8CA 3IBGA 2ATVA 1KD1D 2O8BA 4V02A 2X8AA 3OF5A 1E9EA 5JHHB 4KXFB 1N6PA 1G8GA 3VR3A 2ZR0A 2X2EA 1U98A 4MDEA 5FBWB 4BZXA 2QTHA 3NBYC 4M1MA 3H84A 5FPSA 4OHWA 5KPJA 2ZUCA 4BPRA 1UBCA 1ETUA 5FA6A 5G3YA 3C4JA 4U00A 4JLKA 4LJAA 4OQLA 3WYAA 5DE3A 2CEAA 4TWZA 1VQKB 2ZUDA 3NC0C 3TUJC 2YOHA 1FUKA 4DZZA 3N2EA 1G5PA 3U2QA 4QGHA 3MWKA 3ND8A 2ZEJA 3GLFB 3FJOA 3NDBB 4BASA 2P5SA 1M8PA 3VQTA 1YU9A 2YOFA 3QXJA 4TL8A 4W7SA 1JR3D 4G1BA 1Q1QA 2XJ4A 2NPIA 3SFVA 3SYLA 1ONBA 1GR1A 1II8A 5A0FA 2V7QA 2VA8A 2L0XA 1R0YA 1TQ2A 4GZLA 1QHSA 3BD9A 1QHGA 3QQ5A 3DMDA 3SNHA 3CONA 4C0QC 4YALA 1OB2A 2RHMA 3HP1A 2V7QD 3RRMA 4TYYA 3QPVA 4B47A 4DLUA 5L8VA 4KLZA 2ODBA 3QE2A 2BMEA 2XX3A 4UXHA 2IYWA 4DDTA 4NCKA 4QM7A 5DYIA 2GBLC 1T5LA 2BMFA 3AF2A 4B43A 4LJ9A 3QG1A 4W5JA 3VX4A 1OT3A 3QG5A 1E98A 4DSUA 2G1KA 3K1JA 1I2DA 4PZLA 4WXPA 3VR1A 1G41A 1RPZA 1X8KA 1Z07A 2PT7A 2W6ID 1ZM3A 2WJYA 1NN1A 3UMSA 4NBSA 1HE8B 1D6JA 1W46A 2P67A 4NMMA 4D4MA 3AM1A 4Q1AA 1E2MA 2VBCA 1P2VA 4H1VA 5HTKA 3BOSA 1IJFA 4M22A 1EX6A 1YR6A 1Z6TA 4DQKA 3KFVA 4ABYA 3EPJA 1W2BB 1ZIOA 4LV8B 3EPLA 4R9UC 3ZS9A 1QHIA 1UKVY 4LY6A 5THXA 4M4SA 4JVLA 4XTRA 3TE6A 4PHTA 5JJLA 2X3UA 3PVSA 1E1QD 1MABB 2QGNA 5L3VA 2QPTA 4ZDJA 4DQLA 4YDHB 1P72A 1J8MF 3F3YA 4B2IA 4LJ8A 4C0HA 4C30A 4ZDWA 3IIKA 5FUWA 1ZM2A 4XVRA 5EUQB 2R6HA 2DFTA 2J41A 1XF9A 3OFND 4TT3A 4DUGA 1S1MA 1BIFA 1G21E 1X1RA 4D2IA 4DLTA 1T6NA 1EXMA 4DCNA 4JJKA 2FGJA 1U94A 5E7MA 2IHBA 2Q6TA 4QBFA 4JMPA 4M8NE 3T1VA 1YJWB 3PUYA 1AKYA 4S35A 2NGRA 1Z0IA 4NKRA 5JJKA 3SDZA 3OIUA 3EX7C 3GJ8A 2FA9A 1OSNA 1OKKA 3I3SR 4NCIA 4D0LB 4URYR 4CEIB 3ZD7A 3L8YA 1VMAA 1NP6A 3BS4A 4G5RA 3SJAA 2WHXA 3EC2A 2OFWA 4WW0A 3KJIA 1YITB 4AF7A 3VMFA 2VHJA 1SHZA 1AIPA 4Q01A 2VZLA 2GVDC 2QENA 1Z6YA 4JLDA 3ICEA 1GKYA 2G1JA 2P6UA 2PCLA 3GJXC 2DETA 2R6FA 1CJKC 2ZSBA 3CPHA 2WWXA 1Q12A 2ZRNA 1I4LD 3FMPB 3QKUA 2F9MA 5EP4A 1N6NA 3WP1B 4UNRA 3QF7A 5CIWA 2WOJA 1ZP6A 4IOKA 1F5NA 1J2JA 2R44A 2XOKD 5HR5A 2H92A 2BMDA 1QX4A 2J45A 3KJHA 3X2SA 5DN6D 2PBRA 4Z54A 1Q86D 4HLDA 2FPKA 4FMCB 3CCVB 4JKIA 5KDLA 3UANA 1KDRA 1QGYA 1VG8A 2C99A 5DISB 2ZJ2A 1Z3IX 1H8ED 2WJGA 4P4UA 4D6PA 3CNNA 5J4YA 3L8ZA 2VH5R 1UF9A 1E62A 1XMVA 1G4AE 1KSFX 3MWYW 4KSBA 1UBFA 2FZ4A 3KJGA 3QKSA 4D81A 3CKLA 3SQWA 3RYTC 4FMCF 4LZZA 1LFDB 1U9IC 1GL7A 3HU1A 3TJZA 4TZ0A 3GFPA 2CL0X 3UMFA 4A6PA 2ERYA 2ZROA 1RKBA 1M1KD 1QUFA 3IPXA 3P32A 4JBWA 4V0KA 2ZSDA 5JECA 2JA1A 2YWFA 3SYNA 5CM8B 2LWIA 4DLZA 4M53A 1DAIA 2W0SA 1FNNA 4Q7KA 4PAQA 4QC2A 2JLWA 2G83A 3C5HA 3OEHD 2IHYA 2ZYWX 4QJ3A 3U7HB 4Y7CA 2OFOA 2HEIA 4GP6A 4ARZA 3ADKA 1QH0A 2RGAA 4H9GA 1D2EA 5FL7D 2QP4A 1RJ9A 5BN3A 1LV7A 2BWJA 4LGMA 4DIDA 4QBHA 3M6AA 1ZC3A 1YRAA 3TRFA 4Q9LA 4BEBA 3JQRA 2NZJA 2BM1A 1NRJB 5KNBA 3I1FA 3B60A 3GD7A 3PIRA 4Y0VA 5CJPA 3Q85A 2IUUA 2QEXB 3T12A 3W8NA 1DE0A 3JQQA 3F8TA 3LA6A 2A30A 4IVQA 3VKGA 2CNWD 5BXQC 1VQMB 2GTPA 1TQ4A 2HYDA 2JLUA 4G1VA 4NHOA 5TDHA 4RVCA 4E07A 1QHNA 4HDOB 3CRW1 3LXXA 3AVVA 5J40A 3CWZA 3WRYC 1GFIA 4LWZA 4M2LA 2D7DA 2ZJZA 1LW7A 4PC3A 1J90A 2R2AA 2BJVA 4KFTA 2R9VA 5FOXA 2F3RA 2ZRFA 2QRNA 2EQBA 2VNIA 2BF4A 4LOAA 4MYUA 4Q66C 2O8DB 3QKSB 1XTIA 1JECA 2ZJOA 4CZ2A 2AD5A 2QMHA 4DLYA 2YJTD 2VHCA 3QKTA 3EARA 1GAJA 3M0EA 2C9OA 5FBVB 4JIMA 1TF7A 2FFBA 1QFZA 1GO2A 2IYSA 4C43A 4CEJB 3BFXA 1XTRA 3ADBA 3TAUA 1P5ZB 2XNDA 3E5HA 3U3KA 4D0GA 2D06A 1Q81D 2GA8A 2QT1A 4UNNA 2CE2X 1YKSA 2CCKA 4XJXA 3AKYA 4BFSA 4F4JA 3TVDA 4YXWD 5A5GA 1W4CA 4CDGA 3P1JA 2R8RA 2UZ3A 5TR9A 4LPSA 2ZE6A 4YXWA 2CRVA 2Z0MA 1W0JD 4TYPA 1ZYUA 5AR1A 1P7CA 2WAYA 4LDJA 3WNDA 3DDCA 3W3AA 3CCSB 5EP2A 1MO5A 2ZIAA 1GG2A 4AIIA 4QL3A 1M7HA 3GLIE 5EXXA 3RLFA 3LFUA 3OFNA 4DUGD 5HE8A 3OESA 4Q18A 3FKSA 3KB1A 4FMBB 2LKDA 4ZIRB 3NBXX 1QVFB 1KK2A 4WVFA 1EWQA 2QU8A 1W5TA 4X8LA 5IK2A 1M7GA 4NPHA 4RKFA 4KYIB 3K0EA 4NYJQ 2IYRA 2OCBA 2XSZA 5HCIA 1W44A 4KJZA 2C78A 2RC6A 2CHGA 4KODA 1YZLA 2IS6A 4V0MA 3LXRA 5TVKA 3CRVA 5FUXA 5EQTA 5JRZA 4CEHB 1IB0A 3D6TB 2GZAA 4Q9KA 4WXRA 1ZNZA 4B76A 3U7FB 2HLDD 2VSFA 2J7KA 1TAGA 3FYHA 3UG6A 2HCJB 4DT1B 3QVUA 1D2NA 1JR6A 1S72B 1BS1A 1NMXA 2D2FA 1R5NA 4JT4A 2Z4SA 5KSOA 1OH5A 1E2NA 1VIAA 2JJ2D 3H86A 4BFXA 4CW7A 3T5DA 1N5LA 1US8A 1VTKA 3I56B 1RE0A 4YAUA 1OIVA 2G0TA 3QFRA 1UBGA 1HT2E 3SS8A 4HB2A 2AL7A 4BZPA 5HXBA 2JLZA 3GJ3A 1W1WA 1SVOA 4IDOA 5CLQA 1P2UA 5E4FA 3I5YA 3LDAA 4K46A 1T8TA 2CHQA 4A4DA 2J1LA 5J4LA 4G5QA 1OKKD 1FNMA 2ZQ5A 3GLHE 3KJEA 4OYHA 3VU9A 4QNMA 3W5VA 1AN0A 2DBYA 2ZI6A 4MYCA 4Z8XA 4DBLC 3QPUA 3EWAA 1E2IA 3EAQA 2WM9B 3FFAA 2F6RA 2J9RA 3IHLA 4JLVA 1G9XA 3DM5A 1J7KA 4JVNA 4NYMQ 2LCFA 3QKRB 5ELXA 2O52A 4DB2A 1XEWY 2ZXUA 5HZKA 1CJMA 2QP9X 3IGFA 3LV8A 2YC2C 1UBEA 3CRQA 4HAXA 4EFLA 1L8QA 2J7PD 4JBXA 5FTNA 1KK0A 1DAMA 1SHKA 2GQFA 1DO0A 1UDXA 2ZAOA 4NYMR 5FUVA 4FIDA 3A4MA 3HWSA 2OLKA 1EX7A 2UVQA 5GJBA 5HKKA 1Z0AA 4PHFA 1XXHB 2NPFA 2O8EB 2KE5A 1GWNA 1Z47A 1JALA 2NZ8A 1AKEA 2YOGA 1E4YA 3LBHA 4PSVA 1F48A 1E3MA 4RZ2A 1SKYB 1UAAA 5FTLA 2ZR7A 1Z29A 4BFUA 1KAGA 4GOKA 1JXMA 3NG1A 2P0EA 5KSYA 5M04A 1VQPB 4HLUC 4LV5B 1U0JA 2C98A 2FEMA 4JLPA 3KXLA 4V0NA 4L9WA 4CRWB 3BK7A 4EQ6A 4PXAA 3B8HA 3KKOA 1E9SA 3CPJB 2D3WA 3W34A 4B3GA 4GMXA 2ZI4A 5EXTA 1NNEA 2Q21A 5DNYB 3K0AB 4B34A 1N5KA 4PR0A 4ZO4A 4RD6A 4D4LA 4F93B 4P3YA 4IHQA 2ZUBA 3AVUA 2GCOB 3TAHA 4A2WA 4HE6A 1BYUA 1GTVA 3ETLA 3GJ6A 3A36A 1FZQA 1XCMA 1X8LA 1VCMA 2AK3A 1XD2A 3CX6A 4XWOA 1QGZA 1WDTA 4JSYA 3L0SA 1MRSA 1MOZA 4G5OA 3KQKA 3I61A 1I2MA 4YHBA 4R2IA 1R0XA 1UFQA 4LHVA 4HI0E 3RHFA 1TL7C 2SHKA 5L3SA 1OHHD 4B74A 4DDVA 3W5JA 4AKGA 1NLYA 5H70A 4X8OA 4DVGA 1ZUIA 1YZGA 2J46A 5F2EA 3SU8A 1UKEA 2ORWA 3GLHB 4MRNA 2A5JA 2V8OA 2B5OA 3FMIA 3QIAA 1ZU4A 4QBIA 1NVUQ 1U2RA 1FOEB 5AUQA 3V00A 5JWOA 4O3MA 5DYGA 1XP8A 2QBYA 3TW8B 4DLWA 4J0QA 4BWYA 1W47A 1G1MA 3I73A 2WIAA 3CD6B 1GOTA 4Z8YA 3AVYA 3EG5A 2VO1A 1XTJA 1JXOA 2J0UA 3B9PA 1LS1A 4MYTA 4MKHA 1Q44A 4Q1EA 3FE2A 3L43A 4D4JA 1F2TA 4PO9A 2IWRA 2DFKB 1YZUA 2RAPA 3TUZC 2ERXA 1KZGB 2OK8A 3CH4B 1KO5A 1GIAA 3B7GA 1SVIA 1VQ6B 2UKDA 3MSXA 4CT5A 1SXJB 1P62B 2PZEA 1JJ2B 3VU9B 4B71A 1CF4A 2VNKA 2OTJB 4PAOA 1TLLA 1G5RA 3PUXA 3DO6A 3ZBUA 4L16A 1AM4D 2QEQA 4Q9IA 3I5XA 5FH9A 2PEZA 2ZRBA 1KMHA 2WAXA 2GCPA 1CR1A 1QG0A 1T5IA 1N6OA 1QFJA 4MRSA 3AVQA 1ZCAA 5L3SB 3EA5A 4LC0A 1W2HA 1UM8A 2PCJA 1VHLA 2QE7D 3NHAA 3LO8A 3A4LA 4Q4JA 4BLQA 1FPMA 1G8YA 5H59A 4XSGA 4QBGB 5IDVA 4ZKEA 3D3QA 3Q5DA 4IXNA 5JSZB 5FPKA 3R7WA 1GM5A 1R0WA 1ESNA 4W5WA 1R8QA 3EC1A 3PV0A 2OFXA 1YVDA 1WRBA 2JLSA 1VECA 3AF1A 4P0TA 4WIAA 3FOZA 5CM9C 5SZIA 1I7PA 1NJGA 4M9ZA 2ODEA 4Q02A 5G41A 4B4DA 1R5BA 1XB2A 2WWFA 2FJUA 4RFSA 3ZVMA 2W6JA 4RSGA 3S1AB 2OHFA 3GP8A 4LK2A 3GLGE 5EE3A 3NWJA 3MRSA 5IK2D 3Q9LA 2CNDA 1SVWA 2XNJA 1E1RD 4ZCMA 1NDHA 5JLJA 4JVSB 1ZW6A 1LNZA 1UMKA 1ZD1A 4EUNA 1E1RA 4JYBA 1GVHA 4YAWA 3W2HA 2KWIA 4XWAA 1H8EA 2NOAA 1IN8A 4A0GA 1K8AD 2XITA 1TUIA 4UJ3A 2EFHB 4UJ5A 4MA4A 4MQBA 1XWIA 1WCV1 4PO1A 4PPNA 2OTLB 2VP0A 2CMKA 1YE8A 4LBZA 3ADCA 1NVXQ 3QEOA 3W5HA 2KSQA 1EWYA 2F1JA 3VR2A 4U9UA 3SR0A 4DCUA 2QQ0A 1TVCA 2VSOA 3T1OA 2JJ1D 4PZYA 4JS0A 1AMOA 2GXUA 4YMVA 3RS7A 1KGDA 3NBFA 3MLEA 1XMJA 1BKDR 3KUDA 3LW7A 1TNDA 1QUEA 4OHYA 1KI8A 4DSNA 1OH8A 2HV8A 5A4JA 4URXR 3R7WB 5DHAA 3CC2B 3IHWA 3MAAC 4Q21A 4ASUD 5H1YA 1OPXA 1AZSC 1Q22A 4POAA 3TQCA 3E70C 3K53A 1CJUC 2BV3A 2WWHA 3ND9A 4IEIA 2ANCA 3UWOA 4BECA 1J70A 4WQMA 5AUNB 1F2TB 4OJQA 4RZXA 4AYTA 1YQTA 1GITA 1WE2A 2A2ZA 3QXCA 4A92A 4PC7A 4PHGA 3K70D 1JPNA 3OEED 1L4YA 1XD8A 4TLAA 2JJ8A 4RJLA 3AV0B 3I8XA 4FWTA 1SVLA 3G71B 3L0PA 4PFSA 3O8RA 1NLZA 4GMDA 4BGDA 4ACBA 1IHUA 4TT3D 4TQAA 2JDIA 1F2UB 2IUSA 3LD9A 2C77A 3CBQA 4A8JB 1GNPA 1LB1B 2HXYA 1M1YE 2RGEA 3K9LA 1KMHB 2OCAA 2QL6A 1CLUA 3B1VA 2QAGC 3THOA 4IW3B 2ZRJA 5CYOA 3OZWA 2BGJA 4URUR 3B2EA 3C7KA 1OLOA 1W4BA 2A9KA 2GJSA 2PH1A 3C16C 3FKSD 5DI9A 2PT5A 1CXZA 4B6FA 2H16A 4Q4AA 1H8HA 3LLUA 3WNCA 1A7JA 4Y0AA 3TLXA 2HF9A 421PA 1M6NA 2N42A 3DOFA 2O8FB 1XJCA 4ZGQB 4HE5A 3FB4A 4TYNA 1M34E 1N5JA 1VDZA 1AA9A 3P26A 1JAHA 3AVPA 3DKVA 4MUBA 1LVGA 1P4SA 1NI3A 3ZH9B 1XPUA 4HEJA 2CE7A 1RIFA 4B33A 3FFBA 4II7A 4GBMA 1OF1A 2R6CA 4GNKA 4PPGA 3ZIAA 3PFIA 4OI2A 1VIYA 1Z0KA 2PX0A 3K9HA 1G4UR 3QFCA 5EMNA 1G3QA 3QENA 4EFMA 1ZUNB 1P9NA 3PR1A 1AK2A 2R6DA 5LD2B 3PUZA 3BRWD 1RYFA 1OXUA 2KI5A 3K0FB 4FD2A 1LF5A 2OXCA 4HAZA 3ZGXA 3UMRA 4BFZA 1ZMXA 3AVTA 3AF0A 5J4KA 5L3QA 4YDSA 1QBKC 4U02A 3IEUA 3UIEA 5KPDA 2IYYA 4QM6A 4UQOA 3GFOA 2CCJA 2FNAA 4MKGA 1NBME 4HB4A 3SQXA 1RRGA 4L9SA 4CEJA 3Q8XB 5B57C 3FTQA 3BERA 4GSYA 4QGFA 3HR8A 2NO0A 5TXGA 2HXSA 3CPEA 3THWA 4N1AA 2QSZA 2ZJBA 2HLDA 3A58B 3A4NA 2JCSA 2AHOA 2ZS8A 4P4SB 1IY2A 4QHSA 1Q20A 5BN5A 4L15A 4TYWA 4OQNA 1QG2A 1S8FA 2O0HA 3CC4B 1QHYA 1PLKA 3BAFA 1E9AA 2ZI5A 4AY2A 2H17A 2V4ZA 2EYUA 2QGZA 2R62A 3CF6R 3CUEF 4OL0A 3AP2A 1KHTA 3UK6A 1GZSA 1Z6AA 1G3RA 3OAAD 1TPZA 3HYTA 4P32A 4Q7LA 4ERNA 5ANRB 2IS4A 1UKYA 3CX8A 3FVQA 1MO6A 3QFTA 2GJ9A 1P6XA 2JLVA 1N8RD 1V43A 5EP3A 2F1IA 4WAUA 5DIFA 2IF0A 3UPUA 1GILA 5EP1A 4RD0A 1EESA 4C0SA 2YINC 1D9ZA 1OE0A 2FF7A 2Q3HA 2QROA 2WOOA 1Q21A 3K9NA 2VP9A 1KI9A 2WJJA 3FKQA 1T91A 2HT1A 3NC1C 2OSBA 3MD0A 1S0UA 1RYHA 4BLTA 2HT6A 1U99A 2N1BA 3LBIA 3EPKA 2WKRA 1E64A 4NYJR 1L7VC 2DYKA 5LBIA 3VR5A 4EDHA 4QNRA 5FBLB 2J87A 4A0RA 2OCYC 5FTKA 2I1VB 3AUXA 1KNXA 1KI7A 1XEWX 3U4QA 4YQFA 1OIXA 4HAVA 2FSIA 3EZ6A 2VPPA 4OK6A 1ZUHA 3ZZUA 1EP3B 1NBMA 4RFVA 1XEXA 3CF2A 4KYUA 4MYHA 1W36C 3EXAA 2R6AA 5BN4A 1H85A 5GV7A 3SJCA 5DH9A 2YVUA 3ZVRA 2W00A 4DJTA 4OHVA 4FMDB 3C15C 1NIPA 5FPHA 4US2R 2FV8A 4C0LA 2VTKA 2DFLA 4IXMA 2ZYVX 4HB3A 2GK7A 2Z43A 3JQPA 3HU2A 4QG7A 4DWJA 1HA3A 3GLFE 2BDTA 2ORIA 2QT0A 4C0KA 1FMJA 1N6RA 4KFSA 3KXIA 5SZKB 2QTFA 2XB4A 1ESMA 3WMFA 1VG9B 3NVAA 4YAOA 1E2EA 4URZR 4MRRA 2P6NA 3NIBA 5EE1A 2ZVPX 1N0WA 1P73A 5LPNA 2ODWA 1K5GA 3B9QA 5UKDA 3V9PA 2X77A 3QXHA 1E0KA 2VNHA 5FBRB 3FMOB 3N70A 2D62A 5KSPA 2CLCX 2IA5A 1GRNA 4JYCA 3MUFA 2F3TA 2CNWA 3ZZ0A 5C4MA 4RCYA 2WVJA 2ZYTX 4EPWA 1P61B 1E99A 2B21A 4P33A 4LBYA 1P9RA 1YIJB 1D8TA 1VPLA 2RGNA 3HPQA 4JBYA 2RGCA 3BORA 3MJHA 1TEXA 4WZ6A 4QHYA 1O87A 2QG6A 4GDFA 1XJ0A 1SM4A 1VG1A 3FHOA 5EXSA 1QG4A 3VHLB 4LYHA 2JLRA 3RWOA 1CR4A 1VYTA 2ZRHA 1NL3A 1GSIA 1T9HA 4LYFA 2H8KA 2YKGA 1HQCA 2IXFA 5FOUA 5FOTA 3QF4A 2DWPA 1NG9A 1KK1A 2AR7A 4NYIQ 1BJKA 1NG1A 5E3HA 2ECKA 3A8TA 2YWEA 1G8PA 1U90A 4D0NA 2J0SA 2ZREA 2BCJQ 2OT3B 1COWA 1E2GA 1Z06A 4AD8A 3GLGA 3TH5A 2ZSAA 1KYIA 1UJ2A 5F9FA 3TK1A 1KO1A 2X19A 2I3BA 1P75A 2W6JD 1Z5ZA 1NMYA 1Z0JA 3LO5A 1DTSA 1XD2B 2BMJA 3IIMA 1ANKA 4YAFA 1WBBA 4DCSA 4RD3A 1MR3F 1FNCA 3L2OB 5E95A 1CEEA 3I55B 4ZV4A 1QRAA 4TSFA 2PLFA 1M7BA 3OEEA 3T15A 2PLRA 3IIJA 1VCNA 3RDPA 2NIPA 4MDFA 1E94E 1D5CA 2FSHA 5FTMA 4EKDA 3W5UA 2JIZA 1N6HA 5KSWB 1X6VA 2ZE5A 1G6OA 5JCZA 2OE2A 3LNCA 3MWLA 1FP6A 3EASA 5EZ6B 1KSGA 2PEYA 2E1RA 1RFLA 1SVKA 3CX7A 3DMNA 3EIHA 3K0AA 4OI4A 4DKXA 2Q9AA 5LDDC 1OHHA 2YV5A 4CGZA 5D3MB 4TMXA 1KTVA 2KBEA 1VQLB 2QY9A 3GLIB 1S3GA 2VIIA 4X8MA 4YONB 4YMUA 1H8HD 3VTKA 4DSTA 2BBSA 2BOVA 2DWOA 5C1BA 1KO4A 2O5VA 3CRZA 1SQ5A 1KMQA 1UKZA 1KI3A 3K9GA 3N2IA 4HUTA 4ZDIA 2P2LA 3B78A 4V0OA 3GEHA 1FP7A 4JLOA 1GJRA 5GJVC 1OGJA 4UKDA 3CR7A 3QEJA 1KI1A 2GXQA 1AGRA 2J59A 2QZ4A 1HY3A 4XD7D 1FTSA 4JSTA 4L5BA 4KBFA 5CB6A 1KQSB 1CKEA 4NP6A 4XD7A 4EJSA 2QAJA 3SBDA 3Q7QA 4HYYA 1OYWA 3CO5A 3TR0A 1X86B 621PA 1T0HB 2C9CA 2PJZA 3MFYA 4AC9A 2CL7X 2ZRLA 5JWRA 1F3OA 1M74A 3R20A 1Q1ZA 1E79A 721PA 1AS0A 1OJLA 2DWQA 3WNBA 3ZS8A 4PPFA 2AWNA 1VQ7B 4P4TA 1XZPA 1G8FA 3U60B 1AQUA 4F4IA 1C9KA 1E9BA 2VEDA 3U7GA 2WWGA 4N0DA 3PJRA 3KTAA 3OJWA 1P9WA 4B73A 1AZTA 1E63A 2NTYC 2P6RA 3RABA 5BWMA 2GXSA 4G0NA 1XFAA 1Z8FA 3LAWA 2P65A 3NTUA 1NBMD 1T3SA 1W4RA 3A1WA 3A1UA 2TMKA 4LHWA 1OH7A 1ELOA 1J8YF 1NN3A 4E09A 5GVRA 2QE7A 2FFAA 4NL4H 1WA5A 4BUJA 1T8UA 2I4IA 2V6IA 3B13B 2IYXA 4TL9A 3CPWB 1ZU5A
chains in the Genus database with same CATH superfamily
2HQ1A 5DO9A 3QOYA 4PO3X 1HBJA 3RT9A 3KUCA 1CUFA 3ZE1B 1AUOA 3N0RA 5CB8A 4YP0A 5JSHA 1OBOA 3AFHA 4MVJD 5H9VA 4MLDA 4J07A 1GKIA 1E9FA 1FNBA 2MDTA 1A9TA 3TSCA 2IYVA 5JNUA 2Y1GA 4YWJA 3WY9A 1JDSA 4WBSA 3EXFA 5AHXA 2C5LA 1OI3A 2GBLA 3E05A 2OZEA 1ZWKA 1P60A 4C2UA 3EFOA 2IK8A 4K05A 4F1JA 1OAOA 2H4XA 4W5NA 2GKSA 1MC5A 1R0BA 3ETEA 5IDYA 1UJMA 4F91B 3UWMA 4M9XA 1WKBA 4HQKA 2MR6A 4L4SA 4UE6A 5L95A 4HTFB 5K0JA 2EG5A 1YOVA 2OZVA 3B5EA 3Q0EA 1SRRA 2CJYA 2PKRA 4F5YA 4CCAA 5D5HA 3D43A 4BGEA 3DE4X 4MV3A 5F35A 1PR6A 2VQEB 4QVKA 4X92A 5ALSA 3GI1A 4MIOA 4I3HA 4X7EA 5G02A 3IB3A 2RAVA 5IAJA 1SOAA 1X9HA 3CB4A 1QYDA 1E9CA 5L4SA 3NBZC 4JI2B 1Z15A 2HA7A 1E1DA 1GL6A 2ISQA 2PHZA 2PQ6A 1ODFA 2WV9A 4Q0MA 1A71A 1BU8A 5E3IA 2C95A 1W36D 3C43A 2RFLA 4MV1A 5IT4A 2XB2A 3KJNA 1LRLA 2DERA 2J8ZA 4EUHA 4E5YA 3HDTA 1P5RA 3LLSA 4RQUA 5C0OE 3DAOA 2X58A 4O4HA 4BBJA 4OP2A 1HPLA 4RNDB 1SPBS 1F60A 4F86A 3I2KA 1JQKA 4B7ZA 3RVPA 1F8XA 3GVXA 4EJ0A 4BFTA 5EUCA 4NK5A 1F8GA 1KVTA 1PSZA 3HUUA 3MWEA 3NXSA 5TMBA 2GAAA 2VDJA 4I1RA 2GWHA 4JBNA 4B2LA 3HUEA 3KNZA 4C78A 2C2HA 1H2WA 2ZRAA 3C8UA 1GU7A 3HJAA 4REMA 3GLFA 3L4KA 2YRFA 1O08A 3MOIA 4PG8A 1WZNA 3I8SA 5EJ7A 5JI2E 4B3SB 4N47A 3FHLA 4A03A 2OLEA 1T5TA 2H1LA 4BFWA 3A1EA 1PJRA 4HXYA 3QNWA 1JA1A 3QUSA 4FK8A 1L1QA 2LE0A 1SXJC 3OT4A 4KXVA 5DN6A 2IW3A 4XIIA 4EHNA 2BGIA 1RZVA 1CUXA 1VG0B 2JS7A 1G6HA 1ZK2A 4HGZA 2J3MA 3K0CA 4PLTA 5C4GB 3X44A 4GRDA 2ZXIA 3ZHRA 2NYAA 1VYUA 4BO8A 2ZTSA 2IV2X 4DB4A 3KU4A 5JVDF 4LDNA 1IVYA 1PT8A 3ESQA 1GYQA 2PYDA 4WEOA 4I55A 3VKWA 1MC8A 3GAZA 4YCBA 2V7VA 4I9NA 3SM3A 5HKOA 2FVXA 3EIQA 1OGIA 1P0FA 4GOXA 4J1TA 1IK4A 5DPMA 4A0SA 4BC0A 1M8FA 3KOYA 1UXIA 2L17A 1YJQA 3T61A 3BWCA 4MB6A 4YRKA 4H7PA 4CMGA 4DJAA 3LHIA 3F9RA 3KQVA 4X64B 4J0IA 4D25A 2RG1A 3K0CC 2VRNA 3MCWA 3TSZA 4Q47A 2WSSA 1JG7A 1DAGA 1GUYA 3IQIX 2Q4EA 4MVJA 1XTZA 5FUYA 5MN4A 4GR4A 4DYHA 4PCLA 1WBJB 4A2CA 5B7GA 1U8EA 4AJ9A 1VQOB 3RIMA 2AFHB 4Q82A 4RZQA 4MRVA 3LVRE 3UK1A 3WXBA 1WJGA 4K9QA 5JZVA 2ZJYA 2XTAA 3EYAA 2P4UA 4L5IA 3W9YA 1AKWA 3DJYA 1U9IA 3V8RA 4H7JA 4BP1A 4FXUA 1CBUA 4J75A 2MSKA 3I39X 3AV3A 4ND1A 3PICA 5CDSA 3H97A 1JQ5A 1RJFA 3PI6A 4BMXA 4WLUA 4UPDA 4PLZA 3KQHA 3F8WA 3M5CA 2BZSA 4GT1A 4LXTA 5A4DA 1EJ0A 5J4HA 3PCRB 5E9JA 1V16B 3LY5A 3SXPA 5ES4B 1MQ9A 4F2PA 2ACEA 1N5IA 2YMQA 2WHPB 1Y6ZA 1D4OA 4EG8A 3DEYX 5CYGA 5LA6B 2M32A 2PR2A 3WLAA 3MJRA 1KYVA 5F9HA 1FTGA 3C8ZA 5E9QA 3WGJA 1QCDA 2Q4OA 1MCZA 2Q5FA 3FF1A 3T0FA 1E3LA 4M38A 3UH1A 3V4FA 1TYAE 4G0XA 3WK4A 4F9GA 2YUIA 3HSYA 3K0FA 2CMDA 1RS0A 2DPGA 3I0ZA 3RH0A 2B2NA 4FCVA 4UTVA 3IP8A 1ONNA 2EP5A 2NU9A 2Y8EA 3PXGA 2J9FA 2HSEA 3RVSA 2AZXA 1Z12A 4JZYA 1PUXA 2QA5A 4R71A 1H0SA 1T2EA 2Z6UA 3ZDDA 4QGGA 1R0RE 1ES9A 4O25A 2YL2A 4PBSA 4U7TB 1OXXK 2M6RA 4C3OB 3IP9A 3UBTA 2W6CX 2ZR8A 4LTMA 2C7PA 1M83A 1RXVA 3P71T 1CZOA 3CLUD 1ZINA 1QVAA 5T3UA 5F1KA 2KB0A 2XYPA 2RGNC 3DW1X 3OZAA 2QLBA 3KXKA 1W73A 2X22A 3BX1A 1OX4B 1HT1E 4U7DA 1G60A 3BE5A 2Z9CA 3WR5A 2H1IA 3HDVA 3CRRA 1CZRA 3UAXA 2Y0EA 3JYLA 1JB9A 2SKEA 4OQYA 4Q1CA 4R6XA 4AKSA 4DHEA 5JAZA 2I1LA 1LI7A 1Z2EA 2IEZA 2JFHA 3M81A 3OPYI 3KLNA 1AQ6A 1G9SA 3KV3O 2C4MA 4RU1A 4C4XA 5FYQA 1ZD4A 3SF8B 1PK9A 3E9RA 2PA3A 3CUWA 3R5KA 2J0UB 4B75A 3W2TA 1H05A 2PX5A 4CL2A 4KFRA 4YRBA 3AVWA 1L7EA 1I80A 1KAOA 4C4OA 1T9GS 5BPFA 2GN2A 2QZJA 5FWAA 3LXUX 1RAAA 2C3PA 2YV2A 3D26A 1UH5A 1V96A 4JBGA 1G8HA 3HBNA 5IYQA 1LCIA 3A1TA 4BN5A 1SUBA 4FHCA 4D44A 4EHJA 4H2DA 1SXJA 2QLMA 5ESWA 3BGVA 4B84A 4WNYA 1YCHA 2ZITA 1LGYA 2ORVA 2OAP1 1ULAA 4DR2B 1Y7TA 2A5FA 3SEAA 1LLDA 4JH0A 2BFFB 3AG6A 4H4EA 2E87A 1TZKA 4Q4HB 4TROA 4AUNA 1SKMA 4ALJA 3UJ3X 3CZMA 1QZ3A 3AUYA 3F6SA 5T67A 3BB4A 4QOFA 3K8OE 1FMCA 3HU3A 4HDMA 2VRWA 2XNDD 2YWHA 1QLJA 3NE5B 2FU5C 3CSSA 3GLGB 1G7SA 1YLOA 1C4OA 1CV2A 2QX6A 1O4WA 4O1HA 4OQ4A 1NSTA 2MMCA 3OWHA 2CB9A 2DTEA 4YELA 2DJIA 3E2IA 3FYUC 4MVXA 3IE1A 4JROA 4PC2A 2G5CA 2WUVA 2B8TA 3DE1X 4JB2A 1Z56C 4UAUA 3NTVA 4NOMA 3FWPA 5I9IA 3ELWA 1ADGA 4OF4A 2YWBA 2YNMA 1Q3HA 5JMOA 1Q7YD 2IZ0A 3DWIA 4XR4A 2IIPA 3TW8A 4KBGA 3SK0A 5KQLA 1RC8A 1TU3A 4XASA 2ZE7A 4O4HF 3UJ9A 3VC1A 2X3FA 2IGBA 2IPXA 2AEFA 2EGGA 3LCCA 1PWHA 4LMAA 1VI6A 2CW5A 1BTOA 4TX1A 1J9ZA 4H0CA 1UJ4A 2GAIA 2TMGA 2OXTA 4EWLA 3C1TA 4AJHA 4AJNA 3OZSA 3HV2A 1GVNB 4PC6A 1M0EA 5AW6A 5I8WA 4HDKA 1I18A 1YS1X 2VJIA 3KWLA 3N2KA 1VSQA 5LOVF 3OE7A 2XD4A 4EB3A 1UOPA 3KQTA 1W0KD 3KVVA 1WHSA 2HSWA 5C31A 3M6FA 2EU8A 4G84A 3RF6A 2D0DA 2O8DA 1DKMA 5FFNA 1J97A 3I92A 1U0RA 4NE2A 2MCFA 1OFIA 3J81A 1XD9A 3C41J 1SWVA 2IC5A 1K7FB 1SXJE 2JEYA 1DAKA 2ZWVA 2AYYA 3MB5A 1U0FA 4IGFA 4LDPA 4B8WA 2AC4A 3GUHA 1DARA 2OR3A 3U39A 4HSEA 5EXEA 3A6KA 2I8CA 3P52A 2PMWB 4GOLD 4RH0A 4C22A 5HZMA 1V11A 2GCNA 1JW9B 4BDSA 5CG1A 4MGYR 2PTHA 2VK2A 3QWAA 1NF3A 4NCHA 3AR9A 4OLJA 4PANA 1YJ5A 1MO4A 2AWOA 2VT6A 3JQAA 4KLRA 4M8IA 3CUKA 3IJEB 3KL4A 3NDJA 4P7FA 4F92B 1GGFA 4G85A 4BZQA 7AT1A 5ECWA 1UMDA 3C5CA 4PHCA 4DV2B 1CUSA 1CQWA 3IJ5A 5IKPA 1A4IA 2YWXA 2ZRQA 3HH8A 1PNQA 1T35A 3VU8A 3ZCVA 3VOTA 3EAGA 2F1OA 2A59A 3DL0A 3OZIA 4LI0A 3M1YA 4X7BA 4K26A 1RBMA 1P0PA 3O26A 3C8DA 3TSOA 5IJWA 4Z4QA 1LPPA 2AT1A 3QNUA 3K96A 1KRHA 3CZAA 4UUOA 4C30A 2NN3C 4INJA 2VDWB 4F5WA 1RRCA 2WU1A 1LI4A 2VYND 3VH3A 2GM4A 3CIOA 1CNEA 2ZSKA 1NJFA 1UBUS 4R1NA 3T41A 1KEEA 1CWUA 4DDUA 1P5FA 2I4OA 3BF7A 4RX1A 4YRPA 1Q3KA 3O8BA 2AFVA 2GLUA 4QBTA 2D13A 3RSLA 1RQPA 1GQOA 4RIFA 3PHJA 2CV1A 3PUMA 2WWIA 4LVOA 2GF9A 1L5GB 2GEDA 3GJ4A 3RTGA 3C3WA 3ZDQA 2C4NA 4AI6A 1EDZA 2FRXA 1NYLA 2W2MA 2AN3A 1H4VB 1KF0A 2CL5A 1J2UA 5ENVA 3U3JA 4FINA 3ER8A 4AG6A 4D6YA 4ES6A 3WGZA 4TYQA 2ZI7A 1Z8HA 3UJBA 4DBLE 1CQXA 1FRQA 1GZ3A 4OJKA 4YV7A 2P9TA 4PPYA 3R5FA 3AEUA 3FETA 2PRKA 5T3YA 1FU8A 4R8RA 16PKA 1DMRA 2QD1A 1NE2A 3RFVA 4AYWA 1LNQA 3V7WA 2ZUEA 1QFMA 3LQFA 2WKQA 1HUQA 2X8KA 2OILA 3BDIA 3OTHA 2W2KB 4KAJA 4KU4A 2H7VA 5AN9A 4O2AA 2I34A 4X41A 1XRMA 4ER6A 5AQ1A 3AFGA 4FTWA 2W2QA 1XXHE 3KHKA 3AQ4A 3REGA 4DDKA 2ANBA 4P3PA 4X07A 3TDKA 3VAAA 4PC1A 1XMSA 4E5NA 4MVCA 1YRHA 2HQSA 2PUWA 3GZ4A 4HF7A 4LZNA 1LD3A 2HH9A 2QVLA 1PFGA 1U8TA 4OHXA 1FNDA 1KEZA 4FGWA 2NO4A 1RYDA 1J8VA 2RK4A 3X1YA 3I04A 2VAVA 3HI4A 2V4UA 4JXJA 3QFFA 1YJ9B 1R0ZA 2Y1XA 4AIRA 4B6SA 5IX8A 3B1ZA 1RWVA 1AJEA 1K5HA 3JQ6A 4KAFA 3UFXB 1IOLA 1RYMA 3DE7X 1AHNA 1IHPA 2LDBA 1F38A 3OQHA 4HQ0A 1JPJA 4RZ3A 1YS4A 1GQ2A 2QAGB 2H54A 2IY9A 3NUZA 4OKNA 3HCBA 5HMMA 3CT6A 4RJJA 4J91A 4DXAA 2NUPB 3SWWA 2FUKA 3GUZA 1L7RA 1PO7A 3QELA 4RABA 3CNLA 4IDQA 4A8JC 1YL6A 3FI0A 2D2IA 2F43B 1XBTA 4LY3A 4U7PB 3UV3A 2QTAA 5HPYB 5L45A 1CUVA 4Y2RA 1YMQA 2B4RO 4HCJA 3JV7A 3OLZA 4A8TA 3IOMA 1XVUA 3N3BC 4JJZA 1HTWA 4Z9FA 3W7BA 3D6NB 1XDGA 3S7TA 1HYHA 1T2NA 2W4QA 2PLNA 3E8SA 3U81A 4IIDA 2I2CA 3RS5A 1DBWA 3DV0B 5DM4A 2GD6A 5IBPA 1QC5A 1X14A 1ZGJA 1C9JA 2PUVA 3K09A 4JEIA 4XJSA 2G6BA 3O8CA 4BX8A 1JKMA 2G3YA 5IANA 3ZLJA 3F0TA 4R8KA 4U7JA 4DPKA 2W6NA 2DQSA 3JVVA 1RWQA 2HJSA 3I5UA 4PQFA 1G0OA 1X1SA 2E89A 1Q1BA 3QBVA 3GAFA 3ZLUA 1WSRA 4WOBA 5KMGB 1NIJA 3ZV6A 2Q9BA 5FPQA 3S2GA 1AQYA 3KU1A 2CCGA 3AI1A 3GIWA 3ONUA 2XE6A 1C4WA 5CIQA 1UOEA 1BHO1 5D00A 1ONOA 1R4MA 2A14A 3WYCA 4MCHA 3I4LA 3IAXA 4X44A 3RWMB 4QJ4A 1UL1X 2FCRA 1EJ2A 4JMQA 5K0GA 1YFLA 1PVOA 2ZVQX 3UM9A 3W8FA 4GRAA 5DB4A 2R8PA 5HGJA 2FEOA 3ES9A 3LWDA 1DG1G 4PLCA 5DTJA 2IPOA 3CF4G 3VVBA 1Q1NA 3KWFA 2F17A 4NLLA 4CG1A 3C7TA 2CYBA 2PZFA 4O2RA 4C7XA 1SU8A 4HX2A 5JNWA 5ALNA 2PZAA 1DZ3A 1UPTA 4FFPA 1XTQA 5LXTB 2V1UA 5G2OA 1IN6A 5IC6A 2VK1A 3ZGNA 3DVAB 4Z4WA 1OLSA 3TTYA 1J1UA 3GRPA 1Q0HA 1Z0ZA 2P69A 2VXYA 4HAYA 1B0UA 1O6GA 1XF1A 4IWYA 1IAVA 4AKIA 1RC1A 1ULUA 3EDOA 2IV3A 3GD5A 1HR0B 4S2UA 3FGPA 3B89A 3EEQA 3A37A 5EJAA 3IAS1 3OKCA 2ZJ1A 1Q0RA 2W98A 3DUWA 5KTYA 2JH9A 3EZLA 2CVPA 3P7MA 4CF7A 3JQBA 3Q9UA 1ADFA 4NJOA 2AKEA 5EE0A 1UDCA 2H65A 2WTXA 2ZTMA 3H13A 1GAWA 4P2BA 5AKHA 4C3VA 3WIBA 4O6VA 3N2GB 1Y0BA 2Q6VA 2J5QA 3DQZA 1QPZA 2IPMA 3I62A 4J3JA 4HYQA 4L27A 2QTVB 3LDUA 1W1UA 4WESA 5K0LA 4B2PA 1XPOA 3WA7A 2H7YA 2IDJA 4KQ9A 1ZKMA 1AN9A 4ZKDA 2FUEA 4PYNA 4ZCPA 1TJYA 1EFTA 2O4UX 2QUIA 2IJGX 5KTSA 3F90A 2HPZA 1GGNA 2C9DA 5BMVB 1MB2A 1N9GA 3KD3A 2BTOA 5AW4A 3L4EA 1MA0A 1IOZA 2XCQA 3U3ZA 1GPKA 1AKUA 1IG3A 1M2OB 5CVVA 5HEKA 1QFXA 3ACDA 1WB4A 2F55A 2AX4A 5ITWA 2IS2A 3W9BA 4A82A 1DOZA 2RIRA 2UZ0A 5JJIA 4Z4YA 5KYTA 3DDHA 1W8DA 3EF3A 1QZXA 1NYQA 1PZXA 2IKQA 3DM9B 3H3XA 1Y9EA 3O47A 4KAXA 1MOSA 1P5JA 4M6WA 4PRZA 2NNLD 5AIBA 1JR3A 1U6KA 2ZBGA 3KJFA 4KWHA 4RDKA 2H1WA 2FAXA 2B9VA 4OP1A 2P2CA 3O9VA 1VKJA 2Q99A 2C4VA 1NXQA 5J4VA 4R1MA 4C14A 4L51A 3G0HA 1JI3A 4FOOA 4W82A 4JX9A 1QSGA 4MKIA 1P3Y1 3ZQJA 4C20A 4RD4A 1DKRA 1QMPA 3WWOA 5FJJA 3X1XA 4C7MA 2AOUA 5FFFA 1OLXB 4JQOA 2XMPA 1EA7A 1OMOA 4YLGA 2K7FA 2KX7A 2IH4A 1SB8A 3R0QA 3IMKA 1A8IA 3OCVA 5JATA 1SQSA 3E15A 4TTPA 2CDAA 3KQNA 2O3TA 4GICA 5CD9A 4MVJM 3UB2A 2ONJA 4AJ2A 2R65A 3R3UA 2F3UA 1NBWB 5BV1A 5HOQA 2YZGA 4JBLA 1C2TA 1UZNA 1QYVA 4YTEA 5D87A 2FKNA 3EVEA 3A04A 2QX7A 3TNJA 2Y6VA 4F7DA 3HGQA 1YRBA 2OQIA 2QTVA 4Y6PA 4X05A 1DO8A 4RQBA 3BSFA 4OQEA 4QLBA 1K7EB 5GADl 2AVDA 4CI9A 4FN5A 2O2IA 4EUFA 4YPFA 1LSUA 3ENQA 1JT9A 3HP7A 2GFIA 1QHEA 3QE0A 3T5GA 4GD3Q 4B3FX 3ZWCA 3JQAD 1U04A 3LRPA 4C03A 1BAPA 1YZQA 4TWJA 4EKYA 4PSAA 5C2JB 5HZGA 1RJDA 2IOYA 3U0BA 1CR0A 4X20B 1ZWLA 1UD2A 4WZLA 4NC9A 3W1VA 4AECA 7REQB 3ER9A 3SG0A 2EIHA 1ZH0A 1QOQB 1JH9A 1NVWQ 1XZJA 2EARA 5D3QA 1L7BA 3WRXC 3RSOA 4FN4A 5BT8A 4OEHA 1BO6A 3ZHOA 5DMHA 1AH2A 4WBNF 4O5OA 3THYB 4DANA 1E5VA 4NE9A 3LXMA 5HIIA 2XYGA 5AKYA 4LOJA 3R8CA 5FRDA 3AINA 5LUBA 4FCCA 3RTEA 3SZUA 3DLHA 3EPHA 5JNRA 2NO9A 3FVVA 4GWGA 1TJ5A 4O1IA 4WWHA 4PQRA 2R1ZA 4A36A 1SEPA 3M4NA 4Y9RA 1YNOA 2QLLA 4CMJA 3MJSA 2AG8A 3EQ8A 4F46A 4LK3A 3CLHA 4RTOA 2VS1A 1UD4A 2HWKA 3QY9A 4PSCA 3HJRA 4V2IA 3DXZA 1ZRHA 2O0MA 1AS2A 1T8SA 1VE3A 2MMGA 2YMPA 2GJKA 1MKYA 2GSWA 4ZZ1A 3IO3A 5E38A 2BI8A 3T1NA 3ZG6A 1YE5A 1RAGA 3HGTA 4DCMA 4UBIA 1UD6A 3ISVA 3OZ7A 3GEGA 4O2BA 1Y8CA 4OA5A 3EXHC 5K0EA 1YJNB 4OREX 2RH8A 3R3JA 4FVTA 1VJ0A 1H42A 1ZK4A 2OEPA 2Q5QA 5EHGA 3TNFA 3C8MA 3FMVA 4IDCA 4QFDA 4L4UA 1PV1A 4FXPA 3TLGA 4F96A 3PA2A 1MABA 1FLNA 3H5TA 4JMLA 4MUEA 2A92A 1WABA 1FXSA 4KSCA 1M2WA 3R0JA 1JV2B 3RAGA 3NTXA 3HACA 1SOVA 4AZ0B 4ZT4A 4FUTA 3BGDA 3GDWA 2AOTB 4LMPA 1EDOA 1HETA 2W58A 1Q82D 3NDIA 2FDCA 3KYDB 4XQEA 1JTVA 4HZGA 2HU8A 5EWLA 3A32A 4KGVA 5K0CA 4X60A 1QR6A 3C5WP 5AJVB 1LX6A 1XKXA 2QLFA 4NOLA 3THXA 1NZJA 2C7OA 1KH2A 5IJXA 2OV8A 2M6LA 4O4LF 4CU5A 1A4XA 3N8IA 4X0CA 3A1VA 3HCNA 1G19A 1OX5A 2EZUA 1OTHA 2IXEA 4GMKA 5JZSA 1G21B 4IO1A 3D8NA 5F12A 3TQSA 1UPCA 4N6OA 5GY7A 3EA4A 4G8DA 5GJCA 1FX0B 1WWKA 3TZKA 1DBIA 5HKLA 3LUPA 2HM7A 4DWVA 1R1DA 4KXUA 2PUGA 1V4VA 3AR2A 2PAFA 4MRPA 5MGBA 2GJ4A 3FLEA 2OBRA 2VXOA 1PNOA 3G82C 4IM7A 4QYWA 3CCLB 1UFVA 3PXAA 4F8EA 2NXEA 2G5GX 4I66A 3CCUB 1GSOA 4PLGA 4Y2JA 2I76A 5F1PA 2X0IA 4UFPA 5C5DA 2MSEB 2CZCA 3K1ZA 2UUPA 1LZKA 4EPRA 1O0SA 2XMZA 1DX4A 1KI6A 2BY4A 2WYVA 2P1RA 3FGOA 3OZRA 3V4SA 4D9IA 3I01A 3S68A 5B3KA 3IT1A 4IAOA 4A2PA 5BSEA 3LGSA 4DYVA 1IEWA 1BPLA 2WICA 1BE1A 4UOQA 5EKXA 2AN9A 2WE7A 5I7VA 1GTZA 3ZX4A 4TL7A 1KVQA 1WBDA 1VB3A 3GJ7A 1PR9A 4RIEA 2YV3A 3LGXA 2A88A 4G0PA 3E27A 3ED1A 5I7SA 2PKYX 4MWGA 2Y67A 4K5QA 1Y7HA 2GDZA 2Y1LA 2HA4A 3RU7A 3L0BA 4GI1A 4YRCA 1DBSA 5IZ4A 3F7MA 2DLCX 2FPLA 2XV1A 2AFHE 1FDRA 1W5SA 1XKQA 3A9WA 1JNYA 1I9GA 3EEYA 4QRDA 4WKCA 4QODA 3DEIA 2IS4A 4FJ1A 2WFMA 2XNSA 1TMKA 5KTTA 3NVKI 3IS3A 5A2GA 1QB8A 1P7PA 4A9AA 5BR8B 2BE7A 3CLSD 1CS4C 1OROA 1QE5A 5DCYA 3PDHA 3H9GA 5ES3A 3UXMA 2WBLC 2BIFA 3GC6A 3N2ZB 3Q1LA 4GPEA 1XZQA 5T4HA 2YZNA 1ULBA 3DYVA 2J9ZB 1XLTA 3D2CA 3L0CA 4A2QA 3RAPR 4DIFA 3RB8A 5ADHA 1YU6A 2ZTLA 2P6OA 1OBHA 3WNQA 1KZ7B 2RH4A 3B7WA 3L0ZA 1C1DB 1ZOSA 2EW2A 1LDGA 3EMVA 3DP9A 3GGGA 3MQ4A 4ER0A 2XKAA 3RJZA 1ZX1A 2WYUA 3L7MA 4IJMA 3TZCA 4F4HA 2EKLA 2IU3A 3PXBA 3SQOA 5DV9A 4DRXA 3GRVA 3LF1A 4F4UA 4UCWA 1NPTO 3M9WA 1LBHA 3RHSA 1ZI8A 2SECE 4ROTA 5B1IA 3V8QA 1YQGA 3LPNA 1W4ZA 3IO5A 3N0TA 4MW2A 1WD7A 2Y99A 4GI3A 4P22A 4DLRA 3K0SA 4DKJA 5ALWA 3ZHCA 3QLVA 1F9AA 2FW1A 5A06A 3D8RA 1MV8A 1EWKA 2W2NA 1WPQA 3WG9A 1PAUA 5AD1A 3NHRA 1FBTA 4C0AC 1JIJA 1Z6GA 2YWJA 3DVLA 5ALUA 5BT9A 3VH2A 4EQZA 2I9KA 4NXNB 3HZZA 1XRJA 3C3XA 4I99A 4LHEA 4UU0A 5EI5A 3R7NA 1SCAA 3N05A 1H3NA 2AXNA 2RKBA 3FCOA 3AUKA 4GGPA 4RA6B 2ZE8A 1X19A 1NF9A 1XKLA 2W42A 1GGMA 3DHNA 3VHRA 1SVMA 5BSXA 3P94A 3V5NA 4U2KA 3PNPA 1E32A 3FMFA 4YP7A 1S96A 3LA8A 4BNYA 4CGYA 3H9BA 1JJVA 4B32A 1NRIA 4MQEB 1ZW1A 5HJEA 1T5SA 2EBUA 2FWRA 4ANFA 1PZEA 1LBQA 3ZW8A 4M1QA 5EEGA 1L5QA 5J1TB 1MDBA 4YLEA 5LYYA 5T7BA 4Y9UA 2D8MA 3VYUB 5F98A 5CA1A 4X7RA 1FCJA 4DZTA 5K0TA 2R7KA 2OBXA 3ZQUA 3PIDA 2Q62A 4M9SA 1UIRA 3T3NA 2FUCA 4KR7A 3RK0A 3SHFA 5I7WA 1WXEA 2GDJA 4JSRA 2OAQ1 2DUNA 1I33A 4X1KB 3RJMA 2C9BA 1GUBA 5KYVA 1GDDA 2W5UA 3B85A 1P0MA 4MKFA 1ZEMA 2MSLA 1A9SA 2RHBA 3LY7A 3OX2A 4NEHB 5HFNA 3U4CA 2R48A 4C4YA 3AJ9A 3JZIA 4Q9HA 2C92A 3IHKA 5LA6F 4YRIA 2XOXA 5KYWB 3AKDA 1FMTA 1XUOA 3IBTA 1WPRA 1FEZA 3HVUA 5LIPA 2QVGA 3GAAA 4HEA6 2OHIA 1Y34E 2V5UA 1Y4ZA 4OLAA 1JN0A 1QGDA 3PXDA 5TLSA 5COQA 3OIDA 1EXVA 3M4ZA 4NFHA 5HCUA 4G0OA 1X7DA 5JSYA 2GPBA 4HFRA 3WISA 1Y5MA 3QXXA 4YRNA 1RSZA 3MGCA 2AF3C 3PGKA 3QP9A 2UYHA 3DH0A 1FTYA 1OV6A 4L2IA 5IVIA 4XKWA 1UQTA 3NGMA 4Z4UA 4Z4RA 1ISIA 1M3SA 1BNCA 4B3DA 4HGYA 4ZAFA 3MCAA 4EYKA 4YRGA 4X62B 5K45A 3PFFA 3K30A 4PIPA 1XZLA 2V6MA 1OILA 3DS8A 4TN1A 3GWGA 3CMEB 3PFWO 2XDAA 3JZAA 1OOEA 2REQA 3EVAA 3I9OA 3OPYB 4OQMA 2HPHA 2JBWA 4OHMA 1G5TA 2B1QA 2ODTX 3OURA 1KDPA 3PKJA 3VDMA 1G2QA 5F78A 2QVYX 1K6MA 3CNOA 3R0ZA 3DAGA 4K40A 4KLNA 5C1IA 1MQ8B 3I9NA 1R4AA 2IVFA 1XDSA 2FQYA 2Q1WA 1PEDA 4JA0A 4KZKA 1R10A 5TGTA 1G18A 2BFEB 4RF4A 4TTSA 2WJPA 2JLWA 1CJCA 3HKCB 3MUNA 4CKBB 2RB5A 2VJNA 3KPUA 5HP4A 1KETA 3FROA 3HG7A 1EFCA 1F2DA 4MA5A 3L9WA 3W6OA 4Y2HA 3D6MA 4HNTA 2QUHA 3L9XA 2QMOA 4JD5A 4RMHA 1LTHR 3AY3A 3K8QA 4KQ2A 4B44A 4DA9A 3VHXA 1W9MA 4E3WA 5JSUA 1HEIA 3CESA 1Z4PX 2J3DA 1E18A 1THZA 3KEQA 3MSCA 4KLCA 2ZIFA 2GZMA 5A71A 1B00A 3Q9NA 1XNJA 1DEAA 3GDOA 1WY7A 2Z95A 3KJXA 2EQ5A 1V0EA 4ERXA 2IYPA 4FT2A 4FJ2A 2FVYA 3M8KA 1J99A 2YQ4A 5H3CA 1J1IA 1NJID 2BBTA 5G4LA 5J43A 4FWIB 1IBRA 1KYYA 2WUEA 5FOWA 1O94C 1WOYA 4R98A 4LDRA 1K0FA 2O4CA 4G1EB 2H1VA 5E7QA 3OFJA 2RC5A 3ZWYA 1Z9BA 4M0CA 4AMYA 2VHQA 3TLYA 4GE3A 4D8UA 1P1RA 5L3RA 1EK0A 3CW2A 4UAVA 4AO7A 3QKRA 5AM2A 3HYLA 4K9PA 3CZ5A 5K09A 1C7RA 2CF6A 1P77A 1Q1EA 2RGBA 3GROA 1DXYA 2GT1A 1G5QA 2CUKA 2PNFA 1XHFA 2YRXA 3FWHA 3S99A 1T5EA 3ZE7A 1Q0TA 4H7DA 1ZCFA 2XVMA 1U5AA 2ZI9A 5FF9A 3K8ZA 3GGOA 1LRKA 4OGKA 4YJFA 3VKHA 1SKQA 1EJ6A 1NB9A 1QANA 1NXOA 4NU6A 5LUAA 1I4EB 3L6RA 1DG3A 4DNOA 1IN5A 5KJEA 4HZIA 3MG9A 2F9LA 3C6MA 2HFJA 5BVGA 5C51B 2LCIA 3W5IA 4B5LA 2Q0XA 2OZLB 3OE4A 2VAPA 2BGRA 3D3NA 1L7MA 3PQEA 3IRUA 3G68A 5D3MA 5DLDA 1X3SA 4MKXA 3WL5A 1USIA 2QA4B 3IPLA 5AXDA 4C2TA 5ARCA 1GGKA 2UVDA 2VL7A 4DA4A 2XDQB 1Y9ZA 1U4NA 3EISA 2HDHA 1RHQA 4QUZA 1YZTA 3ELUA 3HWX1 3A3KA 4W4TA 4Z49A 1G17A 1RHUA 5KX5F 5HCNA 1N2GA 1T3HA 2PU7A 3JPWA 4DMKA 3HP4A 1TEVA 4L6CA 4RPIA 4H6VA 1DXQA 4J2OA 2L2QA 1KWGA 5E9WA 4NU5A 2D00A 4U7FA 1RLOA 4HH0A 5FWXB 4LX0A 3WQSB 2VPWA 2HJGA 3BMQA 3D81A 5MHTA 1NC1A 1XCJA 2GJ8A 2MJLA 1Y5NA 3TL2A 1HRDA 1KH3A 3LC2O 3I32A 1DINA 1TMYA 4L0QA 2HW8A 4OSPA 4HFMA 2OVBA 4P83A 4EG7A 2VHWA 1QK5A 3SXUB 1WMBA 1LBEA 2POQX 1HKUA 3AXTA 4Q9AA 3KIPA 1D03A 1EHYA 4FJ0A 3ZWXA 1DI0A 1KYTA 1C7IA 1RZUA 3WJ7A 1D07A 1YGYA 4N03A 1UXKA 4GMGA 5E6TA 3MQ2A 3TECE 4HGPA 4MQMA 2NSLA 5E7IA 1MRNA 1PS8A 1RKUA 3D31A 4K1XA 4XKJA 3U4DA 3QXSA 5M29A 3LY8A 1FRZA 1B8PA 1TA4A 2NVBA 3JX9A 4EB0A 5AVQA 3BY2A 3ON5A 4AY6A 5K4HA 2ETVA 4KGDA 2EEPA 3GNQA 1Z13A 3VR5D 1OH6A 2I6FA 4L0CA 4C7OA 4Z1MA 1FQJA 2QS9A 1UWKA 1P3JA 2YICA 3NAZA 1E8DA 4M1WA 4PONA 3X1WA 2G70A 2W6PA 1G3UA 2IPNA 1GU0A 5IBCA 1BFUA 1A9XB 3L7YA 5FXMA 3K6SA 2UXBB 1O6CA 1TJ4A 4JUAA 1Y6FA 4NG4A 2IUYA 4EG0A 2VNJA 4P6YA 2C8JA 2HOQA 4KR2A 1G59A 2QN2A 1RRPA 3LBFA 3NEYA 2JLXA 1ABEA 2HK9A 3BSWA 1NVVQ 1MQAA 3QYPA 4P3NA 1ECFA 5FI0B 1AG9A 4D8YA 5CBPA 4C7BA 2QG4A 4ZODA 1ADBA 1L5VA 4EG5A 2NG1A 5IC5A 2X7JA 3IBYA 2DFNA 5FADA 3IBGA 3JYNA 4ZK2A 3RC7A 1KD1D 1ADYA 1U5BA 1YQXA 2X8AA 3QWIA 4G4JA 4OP3A 1E9EA 1L5WA 3P9QA 3ESZA 1W96A 1YVUA 1SKUA 4LVNA 5BOVA 3SSMA 3WMWA 1ZGHA 3OX4A 4AZ0A 1IB6A 2X2EA 3T9AA 3HXTA 5KVQA 1Q0ZA 1U98A 3G9UA 3I45A 1A9ZA 2I33A 1DKPA