1WU8A

Crystal structure of project ph0463 from pyrococcus horikoshii ot3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
256
Chain Sequence
MITLTTDFGLKGPYVGEMKVAMLRINPNAKIVDVTHSVTRHSILEGSFVMEQVVKYSPKGTVHVGVIDPGVGTERRAIVIEGDQYLVVPDNGLATLPLKHIKVKSVYEIIPDKIRKFTGWEISSTFHGRDIFGPAGALIEKGIHPEEFGREIPVDSIVKLNVEPRKEGDVWILKVIYIDDFGNVILNLENYEKPRTVELLDFNLRLPYLETYGLVEKGEMLALPGSHDYLEIAVNMGSAAERLNVKVGDELRVRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of project ID PH0463 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PH0463
total genus 65
structure length 256
sequence length 256
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 1wu8A02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 1wu8A01
2Q6IA 2ZBUA 2F4NA 2WR8A 5B6IA 2C5HA 1RQPA 2C4UA 2Q6OA 1WU8A 4CQJA 2CW5A 1RQRA 2V7WA 2C4TA 2C5BA 2CC2A 2ZBVA 2V7UA 2V7VA 2V7XA 5LMZA 5FIUA 2Q6KA 2V7TA 2C2WA 2Q6LA 2CBXA
chains in the Genus database with same CATH superfamily
3SX2A 5AQEA 3LRXA 4Z0HO 2IDMA 1KJ8A 3C97A 5FR2A 1Z62A 4FFVA 5SZJA 1DBQA 1Q50A 3UGQA 1DQZA 2WNSA 4TMVA 2QRVA 4QVIA 3W1EA 1KDOA 2K2QB 2YOGA 3EEFA 1ST2A 1R0SA 4ZZ3A 2C7QA 1DE0A 3NVMB 1ZVVA 4XUGB 4LHWA 1I9CA 2J6IA 1EWYA 1QOZA 3H5AA 1T0UA 3B2NA 3DWFA 3QH4A 4DM3A 1UK9A 4RETA 4M98A 2O8DA 2P9YA 4QQFA 3B1YA 3WYBA 4N8DA 5ALHA 3OT1A 1FLVA 3HQ4O 4ILEA 4U2EA 4B3CA 3GUVA 1Z07A 4NEQA 4GGMX 2FPGA 3U3XA 1MJHA 1G5HA 1BS9A 4NBLA 1IM5A 1C0PA 2HKIA 1RIFA 4E46A 5DYYA 5KTRA 1XF1A 2G71A 4OA8A 4GSYA 1KRWA 1ZGBA 1E3MA 3KQNA 3WLMA 3GFPA 1VBFA 1QHHA 3M4NA 1BJTA 4R9VA 4QWWA 4BU1A 2BKAA 3QBTA 4L51A 1E6EA 1Z36A 1UT8A 4UEOA 4HB2A 1FJXA 1P0IA 2J6HA 1LV7A 5C34B 5BMVF 2RB5A 1CR1A 2A1TR 3DMNA 4X20A 5EJ5A 1XK6A 2FX2A 3TTXA 3GQBA 2PGOA 1ZJJA 2YNMC 4ZVLA 1UJ2A 1ZMRA 4TRMA 4DV1B 3PNSA 1U99A 2JIQA 1SHJA 3EY9A 4QUEA 4Y6QA 1R7RA 4Y6SA 2DR0A 5DHAA 4EHIA 3NAQA 5IZ4A 3W5CA 2YZNA 5LU9A 2J9RA 3GDHA 4LISA 4F3YA 2B1QA 3DMTA 4GGPA 2RAUA 4ZA2A 2NXWA 5AP9A 3K30A 3KDAA 1INLA 1IQRA 1Y0BA 3LY5A 1QTNA 3ZJ4A 1G7CA 5F9FA 2ZYGA 3CKKA 3H42B 4K81B 4CM7A 1SIOA 4CIDA 2DQ4A 3BRSA 3ZW8A 5HJEA 3UAXA 1X42A 2W2NA 1N9ZA 1FDTA 4A8TA 5BP7A 3R7WB 2Z4TA 4ZOEA 2NZUG 2R9VA 1BD3A 1QH0A 6Q21A 3WNDA 2ECQA 1EM8A 3AF2A 4IAOA 4BN0A 4EMSA 4BZPA 1URPA 2HO4A 2O8EA 3JZFA 1RAHA 4OPVA 1BH2A 2DMRA 5AO9A 4LFCB 7MDHA 1FQKA 3NH9A 2YDYA 1ZA1A 1V26A 3HPRA 1LBIA 3K94A 3BFVA 1G5IA 2DHDA 2J5RA 2W6ID 4JX8A 4X92A 2H0RA 3HCFA 3OQIB 4I3HA 2A94A 4V03A 8OHMA 2JLSA 1WULS 3O73A 5CNJA 3CX4A 3MWEA 1WPXA 3C4QA 4Y9UA 3IDAA 4F97A 3OJXA 3THWA 1UD2A 2UU9B 2FR8A 2HA5A 1I2MA 1T5LA 2IJGX 2XY4A 4L9AA 1H2XA 1UPAA 3ETEA 1C3OB 3DGEC 4RV9A 3A1FA 3OWHA 1NIPA 5LZ2A 4J9UE 3SHFA 3NBXX 5EHIA 2JDIA 4JUIA 1RJGA 4E07A 1RJ9B 3AU8A 4LKOA 4BKUA 3ZKWA 1OSNA 1X80B 3HV2A 4F85A 2ZB3A 3RSLA 5A0VA 4CM4A 1QRDA 1YBHA 3GJ8A 2C61A 1DEXA 2ZIUB 3NDJA 1NXVA 1VB5A 2X1HA 4UHDA 3AKCA 3TNLA 1O0SA 1VLMA 1KO8A 1MAVA 4P0TA 3L9XA 4JYMA 4ZU6X 2IY8A 4BAZA 1TB4A 1RM3A 1MJFA 2B2XA 2MSNA 4QUDA 1VMEA 2V6BA 1S89A 4I6JA 2H52A 5DI3A 5AMXA 1HKUA 1SEPA 4XSGA 3EDCA 2ZZQA 3CCQB 1E66A 1FY2A 1QQ7A 5KDDA 1Z4JA 3OMWA 2CT8A 1EQAA 2Z8XA 3Q1KA 3ER9A 5FORA 4FD3A 3W4JA 4DZTA 3DGFC 1B93A 3T7AA 1E64A 4UNNA 2QVBA 2O0MA 3ZHZA 1YL5A 5KU1A 2WM9B 3IAHA 4FOTA 2HWUA 3L7KA 4AO7A 4FSXA 2CVZA 4KV9A 5HQ3A 1P45A 3V8MA 3FTEA 2GPJA 4LA4A 3B1FA 1KF0A 1FRNA 4N8EA 4AZWA 2CZGA 3VPGA 3ICWA 1NNSA 1T8SA 3FMGA 1STOA 1EXNA 3RU3A 1AKTA 4YRSA 2A0YA 3LM8A 4QU9A 1XG5A 4YFYA 3JYHA 3A32A 3IMEA 4ZVQA 4YPOA 3WGTA 1X6VA 4H7JA 4UZEA 4X7DA 3JQ6A 1ZD3A 1X1BA 3NONA 4M9SA 4EW6A 1PWHA 2H7XA 5EMMA 3P1JA 3QP9A 4K1XA 3D8TA 3GCGA 3NBZC 1M72A 2FWNA 4MGYR 2XQJA 1LSJA 1L3BA 3G0DA 4FXUA 2EBFX 1H9BA 2E1RA 2V65A 4B47A 2Y1XA 4WBXC 4OXKA 5L46A 4ZT4A 3FGOA 1EFRA 3BSSA 1SQ5A 3I2GA 2I8LA 4M1QA 3FPJA 1U7OA 5IN5A 2JPDA 4C4TA 4CCSA 1XXHB 5EP3A 2BEVA 2NU9B 5KKCA 5K0ZA 3D7LA 3IBYA 1WR8A 1HSOA 1Z0DA 3KK0A 1IPEA 3N5KA 3A1WA 2DWUA 4KOEC 4HZUB 4X7RA 2NO1A 1SBIA 1Z6AA 1Z2PX 4HX2A 1MB2A 4XCXA 4Q3EA 1HPLA 1P74A 4OBBA 2NYUA 3QIVA 4CF4A 4UTZA 1UJNA 3ELDA 4LMRA 3GNSA 1U9ZA 3ULKA 4AWBA 4GX5A 2RJOA 1RKXA 1ZOOA 2ZRLA 3Q7RA 2C2MA 3CW2A 3GDGA 1DELA 3HJRA 4UDNA 2HADA 1RCUA 2FWJA 3HFJA 1YBAA 4C3OB 1W35A 2YASA 1G42A 1VL8A 2XOKA 1UODA 2FSPA 1TFRA 3I6ZA 3IPAA 1GARA 3ZS9A 4E09A 2VBIA 1C29B 1JB1A 4MVJF 2RGNC 3Q0TA 2Q6IA 5HJ7A 3TI9A 1KVUA 2D1RA 2HPAA 4YJGA 1XN4A 2HDHA 1Z4KA 3D0RA 2GN6A 1XTTA 2IV7A 5JAPA 2BC9A 2BKUA 2E49A 3R7AA 5K9ZA 3C6ZA 1LB1B 3O8QA 4UXJA 2HXSA 2P2NA 4W8GA 3PE6A 4YP6A 3TPZA 4B6RA 2O59A 2A9KA 5AT1A 3ZE8A 4RENA 4E0BA 2C9BA 4ABTA 3AP2A 3PGXA 2X6RA 3VVLA 5AXDA 1KH3A 4P4SA 4JP5A 2B20A 2P2ZA 3ESXA 5JW6A 2A4MA 1E63A 4KXQA 5INTA 3PWTA 1ITZA 3BRQA 3ECSA 2M6KA 3PXEA 4A6PA 5IWAB 3B89A 5DCWA 3THXA 2Z5LA 4JUAA 3CY6A 3B9QA 2B61A 4OCZA 4ZVOA 4U7DA 2AG1A 2W7TA 2FV8A 1DKMA 3F5SA 3QPVA 4EHLA 4D9MA 3H87A 3MPUA 3OLYA 1F2VA 1VBKA 1JDTA 3DA8A 2RGGA 3GNLA 3VVBA 1R37A 3X43A 4C78A 3VZSA 4UZSA 1KZGB 1E1CB 3QMPA 1AKRA 4OBEA 4QOJA 2VQ6A 4R1UA 5K3FA 4R2WA 3V1MA 4PQGA 1Q1EA 4BRWA 1XP5A 4N18A 1DWQA 4UUPA 2VTKA 3FA2A 4KXNA 4JI7B 1Z17A 3H05A 3WOHA 1TUBA 1E2FA 4H9GA 1RRVA 2Q6VA 3UWDA 3PJRA 1Q86D 4N9QA 1A88A 2TRSB 1TMYA 3OMXA 2QDKA 1SB9A 2GEUA 4YLYA 1GPYA 5K09A 4RZQA 2DBYA 1OA1A 4LZZA 4WLFA 4RPGA 2A5YB 1EI9A 4DSZA 2QZ9A 3K0CC 2VKTA 3DXZA 5TS2A 1WMFA 4MVJM 5LPNA 3IQWA 4YI3A 4YP0A 3FZNA 3BXXA 3KUCA 3GY0A 4ZTZB 2P2SA 4LK3A 2Z43A 3O1HB 4Z4CA 2OM2A 2PRZA 1VHQA 2P6PA 4WOCA 4CQLB 4YUWA 5DM70 1IRXA 1QYDA 2IP1A 2AV6A 3VZRA 4V2UA 1GWNA 2LKCA 4C05A 3VU9A 4L5CA 2G07A 3OIDA 4C1BA 5K6TA 1Y80A 2NXEA 1BFDA 4I50B 1SC3A 2AUMA 5BMVB 3LC2O 3V8VA 4PSDA 1Q17A 3U9SA 4YCMA 2XCQA 3IAS6 1VYUA 3Q12A 1UBEA 1TZMA 2DCUA 1UC9A 2C96A 5FNVA 3VNQA 3WIUA 1IH8A 5HGJA 3UG7A 1GILA 1P17A 3RUCA 4NH4A 5F73A 2JLXA 1S2MA 4R2KA 3VPSA 4CKXA 4KQFA 3VQTA 3EMVA 4N3NA 4DDVA 2QTVB 5EYPB 3T61A 1GM5A 3AF4A 4CKCB 3TLGB 2A2ZA 3QOXA 1Q6ZA 4L15A 5FOTA 4E6EA 2QEQA 3CRZA 4FPXA 1CUBA 3R9XB 4Y9RA 3ZDEA 1XDUA 3DOHA 4PNHA 4AJNA 1DBIA 1M2EA 2O3SA 3N8KA 3QI2A 1TKRA 4MJ3A 2VP6A 4P12A 2OL4A 2J0UB 2FOXA 2PYDA 3KUXA 3HI6A 2I6XA 4G67A 3BVPA 3ZN2A 3ZXXA 3I2IA 3MTDA 1J39A 2N75A 4WXMA 5D7NA 2H59A 1O3YA 2DKNA 4H7EA 2WWGA 1SBQA 4I5FA 4X63A 5DLPA 2GA9A 1IEXA 3FVVA 4KXUA 2YWEA 1EDDA 2EFCB 2G25A 2GPBA 3TEMA 1ZGCA 1K6EA 2G9QA 2IUEA 3UK0A 3EEOA 4RVSA 3WL3A 3QM1A 4KIGA 1IB6A 3L49A 3FI9A 4ZYVA 1GCIA 5LB4A 4S1VA 4F56A 5H83A 1Q0LA 3ROPA 2X9GA 3E4DA 4L5JA 1PFGA 4RH1A 2D6FA 1NQUA 3IVRA 4G4SO 4GOJA 5F2OA 3N59A 2AW5A 1OI7A 4WT7A 3DVAB 4Z7NB 1G20B 5KSZA 3GFBA 1XX6A 1ID1A 4CMCA 1JQLB 1DC7A 2R86A 3L18A 1P9NA 2YZMA 3DNMA 3L8DA 1Z28A 4OK5A 3AY7A 4TSFA 1QKJA 1RHMA 4BEJA 4Z7OB 3KE8A 5A1TA 1E2NA 3E22B 1XEXB 4EGAA 2Q45A 3EFHA 1V3UA 5LN1A 1WV0A 3OQHA 1ARZA 4Q03A 1HYBA 1MEJA 2GEFA 1EYZA 3VC3A 5HM6A 3SS7X 2VUIB 3IHKA 2QD2A 5BQPA 2JC3A 1K75A 1W5BA 2M98A 4J3FA 5JNVA 3KJFA 2BISA 3BXHA 4HRYA 3BMNB 1FC0A 4FOPA 4B3XA 3O93A 4JMLA 2V4MA 4REMA 5TMBA 3B52X 1JR3E 3HCNA 2JFPA 1HG0A 3VJKA 2Q50A 3T9EA 3V46A 4N6NA 3WV4A 2NWQA 1AVTA 3TUJC 2DH6A 2C0QA 3EVFA 1DKNA 1YITB 1EVJA 2WP0A 3OCJA 4AG5A 1W7AA 1Q0SA 1ZWKA 1B4DA 3N8GA 1QP0A 4D4HA 3T5MA 5B3KA 5JFTA 4Y6RA 2P9EA 4BNLA 1Z2DA 3VISA 1E20A 1YVDA 5F1PA 3WQQA 2P5TB 3QU4A 1RI5A 4C7JA 1N4AA 3WSTA 1SU7A 3SZGA 2Q5QA 2AH5A 4WZTA 2FRDC 2VH2A 4MUBA 3BAFA 1FDUA 2WT8A 1FFAA 1U98A 2P75A 1P3DA 4E1BA 2DBQA 3L6RA 2YHUA 2ZSFA 2DFKB 5BW6B 4C0HA 1BMDA 5G41A 3CPSA 3FCXA 3K70D 1FFWA 3LTNC 4EUEA 1YSCA 1Z0UA 3IP8A 4BZXA 1CRPA 3HBNA 4NLLA 2A5LA 1TF5A 5CCBA 1GQFA 3TQFA 3M4XA 3HG7A 3TQRA 2BGLA 5JZ9A 4WIAA 4P31A 4OIFA 2Y1LA 4DMGA 4F4UA 4UZUA 3MCUA 5EEHA 4CLOB 1ACJA 1RWNA 4PYIA 3OQNA 5CFPA 2B92A 1Z26A 1GZ7A 3GDFA 3AI3A 2NO7A 4RPBA 2QUKA 9MHTA 3PC6A 1BYIA 2J7PD 1PZFA 2ZS9A 3H6HA 4RE5A 5LQDA 3H83A 1RM5A 3RSFA 4G1BA 4RTMA 4HI0E 2FJUA 4N5HX 3A1VA 1H8EA 4R3UC 4QKQA 2XMCA 1UZMA 2ZTGA 1DCKA 1UXGA 2CFCA 2IYUA 2OV4A 2WJIA 1H0RA 3ACCA 3LX6A 4IV8A 5D5QA 1B7GO 2JAWA 1VBMA 2ILTA 4D8UA 1SBCA 4L5YA 5EZ5A 1VYHA 4DCNA 1V1JA 1W6UA 1WLYA 4CMBA 4WNYA 3BTUA 4RAOA 2H1OA 1G18A 2EP8A 3RC2A 4LVCA 1PTJA 1WDKA 1WZCA 1HX7A 3M4YA 3VI3B 1RAAA 3DDOA 2ZB4A 3DBRA 3DF7A 4HL6A 1IY9A 3TUZC 5IYRA 3TECE 5IYPA 3W8FA 4B7ZA 3IBSA 3H86A 4RTNA 1A97A 1UFVA 3QI7A 4JI6B 4TRJA 4GM4A 1TL7C 2QYTA 3G88A 2DPHA 3I12A 2BMJA 5J1SB 4XLHA 1FNCA 1P4RA 4R2HA 3MN1A 3P2YA 1JXOA 4X07A 4CLOA 2WFZA 4HNHA 4DREA 2IPNA 2Q3JA 4J0IA 3P5BA 4KRXA 2IW1A 2V6MA 4P83A 1N0IA 3MELA 2M2IA 1H2HA 4F8JA 2FQYA 3V8PA 1EUCA 2Z4SA 3ZLBA 4OK3A 3VO8A 2W0MA 4M7RA 2PU5A 4Y18A 5LXTB 1MQAA 2OTLB 2C98A 2UZ1B 3IIMA 2FR8C 4LDAA 2P30A 1QJCA 4MWCA 4RYDA 3OPVA 5SZIA 2YDXA 1XSEA 2E4YA 3UWOA 1AXRA 4Z1OA 1F4VA 4EFMA 1JAIA 2P7IA 1EUQA 1CJVC 1RIIA 3HB7A 4FFWA 1OAOA 1O1YA 4UQLA 3CUSA 3ZHBA 4CMJA 1BS1A 2FX3A 1Z0FA 4Q3BA 4XLLA 4X1KA 3TW4A 3THWB 1W4AA 4YMHA 4XEHA 2ZRHA 4C03A 3JATB 2Y1CA 1N6LA 4LZNA 3ZUPA 1BGWA 1SVIA 1V5WA 4H1UA 5K4HA 3D5TA 4R2XA 1OBCA 5A5GA 2J8ZA 3ROEA 4DBLC 2XB2A 2H18A 4ZDKA 5BURA 3GJ6A 1A9XB 4LF6B 1ZRNA 3NE5B 1WSBA 2Y66A 4AP5A 1SUEA 2XV1A 3FR7A 1IWBB 1BHJA 4KKVA 1XTRA 4AZ0A 4GG1A 4DIBA 1E5VA 3RF7A 1JXQA 4F46A 1QFMA 1GFZA 1QIEA 1Q14A 3ROQA 3U4QA 1Z2OX 4LYGA 4PQYA 2OKCA 1U5AA 3O7WA 4IF4A 4XWGA 4RQUA 2R1UA 4C6RA 4YECA 2ZJ0A 4X8HA 4ZJPA 1O8BA 1XHLA 3QLJA 3AGPA 3CCUB 4BVHA 1Y5MA 4IFBA 4XORA 4NV1A 4RM2A 4Y6PA 1ABBA 4JB0A 3DZKA 1N6RA 1GITA 1E3SA 1QONA 1J9EA 3T3GA 1P8AA 5B55A 2ZJ3A 2QZ4A 1QZXA 2HJVA 3RVPA 2IHTA 3IJPA 2H17A 5F3DA 1N5RA 1O97C 2HIHA 3FHCB 3WZLA 1MUUA 4YCCA 4IFIA 1BFKA 4AKTA 4G5HA 1B8NA 4RESA 3STUA 3I6IA 4EIWA 2ZT5A 3OPYA 2NU8A 3IMFA 1NQVA 3CESA 3S2SA 3UHFA 3V1YA 4PGOA 1N77A 4TUYA 3FJYA 3E1SA 3D8HA 3EGDA 2B5OA 1RCFA 3EIWA 4JI0B 1EJ6A 1LV8A 2TS1A 2H2HA 3C3PA 3NDRA 3A2KA 4R6XA 5JY1A 1EE1A 2FZKA 5DHSA 1TF7A 3P96A 1VGVA 2VQEB 2BEVB 2NU9A 4B3BA 4BWGA 2BI4A 2R751 1YE5A 4CPDA 3IQZA 3Q0EA 3QUQA 2JS7A 3H5VA 4F5DA 3TNJA 4OFXA 1NUUA 4IHAA 2OD2A 3T7EA 3U3JA 5B4TA 1VCNA 4FHDA 4NPCA 3D31A 1V95A 1MEEA 4J0CA 4KIWA 4HEA6 5A9RA 5IMSA 3SQWA 4J2TA 4RA9B 2VXBA 3HUFA 5ILQA 2XDWA 2OP1A 4JYPA 4X06A 1BW9A 3KPVA 1I0IA 4G1MB 1GAWA 1RFGE 2JFFA 3CLHA 1AGNA 1XYGA 4I55A 4Y2GA 3CEAA 3V4OA 1WP9A 3ZDFA 2F8TA 2J85A 1DWOA 4UVHA 2CLEB 4DB2A 1SFRA 1QYXA 1S02A 4YT5A 4ZYZA 1G98A 1XWFA 2I5PO 4KE8A 3FHOA 1V8PA 4JLJA 2E3JA 2QTTA 1QH8B 2WJ3A 3WR5A 3VBCA 5B12A 5CITA 5ITVA 1HTBA 2OO3A 3QKIA 1U3TA 2OHVA 3Q1LA 3RTCA 1Y7TA 4L1KA 5REQB 4P7BA 1AKQA 5TDHA 3WL6A 1EK2A 1IPFA 1W30A 2IU3A 2XNKA 3DDNA 3MD0A 4O2AA 1GTSA 2FSVC 4L0DA 4MA4A 4ZJUA 4ETWA 3CXRA 4JWTA 5H9WA 4IYRA 5LBIA 621PA 1JU3A 1XQXA 1J06A 2FDRA 1QO7A 1Z68A 2WSLA 2ZJ5A 4NZZA 1Y6JA 3BIFA 4HTAA 3PNLA 1GFIA 3KALA 5ES4B 2COUA 5A1JA 3WL8A 4YRJA 1YJ5A 3KCQA 4EI2A 1NXOA 2FWAA 2BFEB 1MU0A 2VTDA 3HA7A 1L7NA 3HZOA 3BGOS 3DBIA 1S3GA 1X8JA 2QTZA 1WMAA 2WJHA 3CG4A 3HBMA 3IQXA 4NONA 3BGSA 3COJA 3S2FA 3D1LA 4OU4A 4Z54A 1XE3A 1C0IA 2ISSD 2I4LA 1YO6A 2CXSA 5HR5A 1Q1GA 3G17A 1AHPA 5KB3A 1JG4A 1THZA 4EG8A 1GA6A 1EGHA 3JYOA 3QY0A 4XVRA 5I9TA 1XEWX 4DG8A 1EDZA 4B5LA 1E1MA 2DUNA 3OJFA 2J0VA 3SIRA 4K46A 3FLMA 4LV5B 1T24A 2BJVA 4F6RB 3AHGA 1NW9B 4J75A 1HQDA 3JVVA 4GAEA 4H08A 5B2ZA 1TUBB 3VPHA 3PQ3A 4QXQA 4TUYB 1ODCA 4FDMA 4FTWA 2OXIA 1PV4A 4UEQA 3AKZA 1HF3A 4YRCA 3AY3A 5ERGB 3R3YA 1P7YA 2JDID 2PUVA 2PZ8A 3R7LA 5CFLA 1M8FA 3NKLA 3ZR4B 4IVNA 5K0TA 2UZIR 4C7KA 4R0MA 5HFJA 4GOXA 3NIDB 4RJTA 2W11A 1UK6A 3MWLA 4L4ZA 4Y2UA 5FOSA 4J16C 3PYXA 1U0LA 4L4XA 5IZCA 5EUMA 3DAOA 3M9XA 5KJ1A 1DIRA 1H1DA 1SG9A 1ND5A 2CXXA 4GOLD 2QR2A 2V7XA 1D04A 2JGMA 1OYWA 4HGRA 1EB9A 2JGFA 4AYXA 4DQDA 4OJNA 2NZ2A 5G02A 1DDOA 3RJ5A 1F0PA 1B43A 2ZI3A 4KWEA 3LPDA 5EEGA 3ZD8A 6GPBA 1YI0A 3RVLA 1ZVQA 2CVFA 1KO4A 2NYAA 3I8SA 1WKCA 2DKOA 3JQ8B 1IJKA 3PDHA 3GLTA 2FZVA 1JG6A 3E70C 5IEBA 3SKYA 3VR5H 1Z6ZA 3IC5A 1AHNA 4M1KA 1BFUA 1NM5A 4ZGBA 1YQWA 1YA4A 1Y8ZA 4OI0A 4L28A 5L53A 4CRWB 1HKHA 3HWRA 5KYYA 3P19A 3VJRA 3OZAA 1AMNA 4E51A 5DZSA 1C1YA 2FSIA 1W9XA 3H7AA 1KJJA 1RKUA 1AU9A 4WACA 1Y7IA 1FVXA 3GRCA 3A31A 3ZE9A 4DSTA 3SLDA 3LNNA 1M8GA 2CN1A 3DVAA 4GM1A 2Z9DA 3NQ41 3HCEA 3OPOA 4B73A 4B3GA 1G4HA 1NY5A 1A4UA 4OO3A 2ZUVA 2HN9A 1M8JA 2P6OA 2RFLA 3QLVA 4FDAA 3GW8A 4Q3OA 3TZQA 2VA8A 1I6MA 3ZNPA 4YXWA 1UBCA 2V55B 1AZSC 1Y3CE 4M1YA 2BHRA 4CJXA 3IXLA 3UT5B 5EMKA 5BORA 4DMCA 5AK4A 2W5UA 3EYAA 5CT9A 4AMZA 3D4PA 2GASA 2VF4X 1ZGGA 5LL6P 3WGGA 2FRXA 3WP1B 5A04A 3FOEC 2B9VA 3BWCA 3R20A 5DX1A 5JANA 2ORIA 2YZGA 1SG0A 3M1AA 2OFXA 3JQFA 3GEEA 5EMHA 4FEEA 4GPD1 3I37X 4JP2A 3W5AA 1UDAA 2DP4E 3B7PA 2JH3A 3KZCA 5F9MA 5FUXA 3EDYA 4YTEA 2DY1A 3EEYA 1K6MA 2YVUA 4NX2A 5JARA 2Q3BA 4LJ7A 2GILA 5GONB 1Z0IA 5ILGA 1E6KA 1OGYA 5T4HA 2HUPA 4MW7A 2H3HA 5FV4A 3PNKA 4JJGA 1VPDA 3NHAA 5I7RA 2GJ9A 4I4TF 4U2BA 3KD3A 1OH7A 2WJPA 3F7TA 4E94A 4Q24A 3LA8A 2FZ4A 3DDZX 2ZSDA 5HP4A 2PKWA 1C41A 2FLVA 3VO2A 2OTJB 1ZX1A 3NCHA 2HEIA 4GU5A 2Z6VA 3E5NA 4QJ5A 3BQMB 4J3JA 1PHPA 3PPYA 1NW6A 4DIMA 1RZRA 2D5LA 2J3HA 2HA2A 5DHTA 4TLDA 2W71A 5AHRA 1QCYA 4IINA 2BH9A 3E23A 4IIHA 4CKBB 2NUAA 1PUXA 3UMVA 4IDEA 1VQMB 1BWRA 2QORA 2DCMA 3L1HA 5CM8B 3EPJA 4DQ0A 1HBJA 4IBOA 2QMEA 1XRNA 5HKLA 1QV7A 3ZCRA 2PLNA 4RM3A 3MVEA 1R50A 1Z13A 3AILA 4IDHA 4X1IB 2X0DA 4ABYA 5D84A 1RKBA 3INRA 1ZL0A 2HC9A 4UAJA 4H7HA 2VSQA 2ZS7A 1GUZA 5GMOA 1WXXA 5IVPA 2W2LD 1XALA 3S70A 3D3WA 2PL3A 1RI1A 1FXSA 3WGZA 1VQOB 1RAEA 4OFBA 3L93A 3I0MA 4XNFA 1L7RA 1TZCA 2JRLA 4GI5A 3B1ZA 2PBLA 2IQIA 3MF4A 2HY7A 4MCHA 4EDFA 4W5OA 2W83A 5DEOA 1TF2A 1MOPA 1SHTX 2F9FA 3LUBA 4GXQA 3S2IA 2IS6A 3PFWO 5J47A 3AJDA 3KYDA 3GCZA 2DWPA 1U80A 3DZBA 3KQHA 1G6KA 2VYVA 3COYA 5ICGA 2HF2A 5MF6A 3NVKI 4IDNA 1YFKA 1T5OA 5GGYA 1WVGA 2DY0A 1I94B 1AJEA 1Z6YA 2ZZEA 1HLDA 3S7TA 2ZUEA 4Q4LA 3EVBA 3TDNA 4D8YA 2PQ6A 2BFOA 3NU1A 2VWPA 4POAA 2HT6A 3RSOA 4RC9A 5AKKA 1HG1A 1L4LA 1HT1E 4RHXA 1U1GA 4OL9A 4UU1A 2L69A 1X9HA 2Z6BD 4K6OA 2R5FA 4RXUA 2XYRA 2EATA 3K8YA 4DJ5X 1E2IA 5FF9A 3ETLA 4PC2A 4R9NA 1P80A 1GGNA 5EN4A 2ECFA 3IAFA 1JQBA 2HCBA 3A6KA 5AVZA 1T5HX 4ROXA 2C5GA 3CCMB 2PD6A 3MMPA 4FYMA 4IFTA 5CTAA 1YMQA 4FW8A 3SJBA 3VYUB 1CR2A 4Z4FA 1Y9AA 1U9JA 1N3LA 1NPTO 4RLZA 2SCUB 2MSKA 3GEDA 3L7IA 4Q0MA 4ITVA 4AMGA 1VIDA 1ND6A 5J23A 3GLFB 3OSUA 4TQ9A 1S2OA 3IQIX 2WFLB 3G23A 1KMIY 4X0CA 5K20A 4JI8B 2JLAA 3FYUA 3WQBA 2CLFB 3NT4A 3RB8A 4BMVA 2BE7A 1NJFA 4GZ3A 4FINA 3EN0A 4NBWA 4TTQA 1M2KA 3KL4A 5LA6B 3IP6A 1XD2A 4DCMA 2VDJA 1UADA 4JC0A 4FBLA 3ZW9A 2AX3A 3LC1O 4BO2A 2XTJA 1QAQA 1KYTA 3AB3A 3ILYA 1NOIA 4QLOA 2JFUA 4L2IA 4OVKA 4P7GA 1PNTA 3JRNA 1B26A 2KBEA 4E3ZA 1N1GA 3D5EA 4TRRA 3R3UA 3GRVA 2WIAA 2PLFA 2PSSA 4H17A 2NQ8A 3AKEA 1WQ3A 4HLNA 4P9NA 2EZ4A 3NEPX 3HR8A 2GCEA 5HIJA 2ON6A 2ZYHA 3H4TA 2IOQA 2ZWVA 2WR8A 3K6JA 5HF9A 2AUNA 3KXKA 4OM7A 4WINA 3E7FA 3FLAA 1N2XA 1EX1A 4M1WA 3PIRA 3AEUB 1YS2X 2P8JA 5J43A 1A9TA 2X5OA 2FSUA 4KV7A 1R00A 1DEOA 2H2GA 2R7LA 2ERXA 1RWPA 1RWWA 4NG4A 3K1TA 3Q6QA 2ZK7A 3IQFA 2WMYA 3K72B 1BG6A 1XZIA 3MUEA 3PD0A 3WYEA 1CFZA 3DJFA 1UKBA 2H16A 3G0BA 2GPAA 3G85A 3O8LA 1O6BA 5FDFA 1OWLA 5EZYF 1SQ6A 3ZPNA 2VDKB 4PRLA 2XLCA 5DH9A 3SFZA 3V6LA 3STWA 2G88A 1T2CA 2ODAA 2WINI 3O92A 3F6RA 1UPTA 4D8TA 2QEXB 1YS4A 5A4MS 3PCRB 5EKDA 4DR3B 4QEZA 4DQLA 4TYPA 5KTYA 1EFUA 3NRBA 4HH3C 2G40A 1H1LB 4P4SB 1YCFA 1Z82A 3HYLA 2QM8A 2O1SA 1AF4A 2VUTA 2JKZA 1Z08A 5TE9A 4CLRB 4F11A 1MVNA 2Q5HA 3CE6A 4RXTA 5DLQC 1HI9A 4TQGA 2UUPA 1UJBA 4C14A 1E9EA 4EBBA 1L2TA 2VUSA 5B1SA 3SR0A 3L77A 5ETJA 4CG2A 4CMHA 3HKBB 3G6WA 5I9NA 4BNVA 2WKPA 3O91A 4ETIA 4F2DA 4OHRA 1YQQA 3BRWD 1OPRA 2XECA 3CCBA 4M49A 2O2IA 4M1TA 4LDJA 1ZRSA 2WFAA 3H4IA 3P71T 4JZYA 3RHFA 3QNWA 4B71A 5CA1F 2AZMA 3OI7A 2CBZA 5H81A 2OCDA 5IKEA 4BLQA 2Z3VA 1OH6A 4F93B 1U8XX 1XTZA 1YIOA 3OLVA 1E5TA 3OX4A 4L74A 1FL9A 2A3RA 4GR5A 4LXXA 4KFUA 5KKNB 1VBNA 4H77A 4W5WA 4BQRA 2PV0A 4Y30A 2VQFB 1M2OB 1XLVA 1J1UA 5IK2A 1JA9A 1F14A 4GZLA 3CVYA 4DV7B 1AX9A 3ENKA 1IXZA 3SIXA 4OSEA 2ZR8A 4H59A 3KTDA 1NKVA 4CT4B 1P7CA 2XPCA 4DLVA 1T9HA 2V7QD 3D4IA 4B4VA 4W5QA 3WDKA 3VMFA 1F0YA 2GLTA 3MLBA 2O05A 3TZEA 3KFLA 5TS3A 3ZKWB 1Y8RB 4R8SA 4BNTA 1NWCA 1U0NA 3CKYA 4X44A 5EJ9A 3OQMA 2P2LA 2DF8A 3IJ5A 5CA0B 4D9HA 1VE9A 4KQMA 3QX3A 1V8ZA 3FTNA 3I2KA 1IY0A 1N5JA 2FHPA 1TJYA 2VJYA 3K3PA 3F71A 5B58T 4DHWA 2ZGVA 5B2EA 1ZU5A 4M9RA 2NO5A 1QNLA 1EVEA 1OW3B 3WL7A 1XRSB 1KI9A 2AOVA 1A5BB 4OM8A 1T9ZA 2WYRA 3CPWB 2H5EA 2ZVJA 3CF0A 5B3JA 4YQFA 4GX2A 4O4IB 5CLIA 2R60A 1C9NA 3D26A 3HBAA 3HUUA 3ZGXA 3ESBA 4LWQA 1KERA 2YRXA 3AWIA 3WO0A 1L4BA 4U2KA 4DLLA 5B7QA 1RPZA 4HDRB 1A50B 2WHEA 2BKEA 1CQJB 2O2DA 1KAHA 1V11A 1Y1LA 5I9MA 2C1EA 3RGGA 4WA8A 3H99A 1ZXBA 2ATCA 2ORWA 2V3CC 3TCKA 2Q4TA 3RAJA 3ICCA 2I91A 2JGEA 5A4FS 2DOGA 1JG3A 3F7MA 3V3TA 1MTOA 3PHLA 1YRBA 1WTHD 2NQ2C 2PLWA 5MFZA 5GINE 3ER6A 1T6XA 1P60A 1SXJE 1ZI9A 3K5IA 3MZ0A 4XSHA 5G53C 5GM2A 2WKWA 4L6IA 4HH1A 4DWOA 2IZZA 3SEZA 3QEBZ 3UYKA 1YIDA 2MYUA 2OHXA 4URVR 1KO5A 2WJJA 1JIXA 3AEXA 4ZVVA 3DPUA 2X14A 1M1YE 2WIBA 3Q2KA 1R0KA 4REQB 5BSVA 3WBBA 2B30A 2JK0A 4MUHA 4AKGA 2XSZA 1DS6A 1SOVA 3SC4A 2I6SA 2H2FA 3EXFB 1UBMS 4I9UA 2ZJAA 4OI2A 3I52A 4RK1A 2JCYA 3N58A 4P4LA 3NHBA 4HJRA 1SKYB 4QM6A 2QG4A 1PKEA 1ONNA 5LYJB 4QRIA 4ESEA 2E48A 2F1OA 3MTIA 1OFUA 1KE2A 3X1MA 3W2TA 3ZGYA 2WPDA 1J09A 1GR0A 3I76A 3SQDA 2ZZNA 3BD7A 1OX4A 4GD3Q 3QU5A 1JFFB 3QE9Y 2GI4A 1D6NA 1KO1A 1M76A 4YRLA 1M0WA 4P35A 4A8JA 1NLFA 3Q98A 1JHVA 3K05A 2C07A 5KYYB 1FSFA 1Y1TA 3JQ8A 3F74A 1BQ4A 5EQDA 3MQFA 2FPOA 3LF2A 1U2RA 1OFHA 1R4NA 4FGKA 3NT2A 1NUSA 5AESA 3STYA 3GSIA 4Y2QA 2Y9MB 2PS0A 4MW4A 2JAQA 2K4MA 1T9GR 1N7JA 4HXGA 4HUJA 4EGCB 4IILA 5ITSA 5IXJA 1W4RA 3V1KA 4AW9A 6CHYA 2QK4A 5H70A 3ISVA 4AZVA 2PKEA 4LE2A 4WVLA 1J90A 1RP7A 1ZCJA 2JI8A 4J16A 1UZUA 5H3LA 1SD5A 2G0TA 3B9PA 1XR3A 3ETJA 4IUYA 5C4MA 3I53A 1N0HA 5K3BA 5TVKA 1DMSA 1XEXA 4Z4QA 5CVEA 2EHJA 4PZZA 4EEKA 1ULSA 1X19A 4WCDA 1M6NA 2LGJA 3GL9A 4A1OA 3ILHA 3MJSA 1BPLA 4J4BA 4OV6B 1OX4B 2HWYA 5HDQA 2Y9PB 4WKPA 1NHWA 3T7IA 2G17A 3ZD7A 3R7DA 2HLDA 3UJPA 3EULA 4O3MA 5K3AA 1T8RA 5JH7F 2L82A 1MKYA 1R3DA 3F8TA 3C3JA 3AHDA 3I1YA 2H48A 3IUBA 1EJ0A 1F4LA 2GBLA 3D4BA 4ZOLF 2NUTA 3DJYA 2IYAA 2Y0EA 3FRIA 3GT0A 1G20E 2FPIA 2X2FA 3FKSA 4K9MA 4S0XA 1K6IA 4LXYA 2C5HA 1RQPA 3GVPA 2YOFA 5KI6A 4TMFA 4G5XA 1J99A 4YV2A 1FMLA 5BW5A 3A3PA 3V4ZA 1RNLA 3IPXA 1AUXA 3BTSA 3ZVKA 2ZTUA 3HU2A 2W6IA 4R05A 5DHFA 2VTBA 3N7AA 1PQUA 3H3JA 3AKYA 1SKQA 1JE0A 4PGAA 5E1DA 3TQCA 3WTCA 3HLYA 1R0YA 3IJRA 1I9GA 4F38A 2EERA 3QJGA 1RACA 2IHYA 1J8DA 3U80A 3UJCA 2OFOA 2ST1A 3VXKA 4EGJA 2UUAB 1E1YA 1J24A 2QRVB 2SNIE 2YJ3A 1MFZA 3AWDA 5AVVA 2A5JA 4D8XA 4YXWD 1QDLB 2OGSA 3IVXA 5K3CA 2QG9A 3THXB 1POWA 2QRZA 4E2WA 2NTVA 2BHTA 2Q9BA 3I4LA 3OCWA 3KSUA 4YMVA 1PEDA 3T7TA 1IBRA 2PAFA 3WLRA 4BFWA 3T3NA 2WG1A 2KYRA 3FBTA 3ZQ6A 1NIJA 2VNKA 1U4OA 3A9TA 2O2SA 2YJZA 4FU0A 1CQPA 1QTIA 1R4ZA 4RHTA 4FZVA 4AJ2A 1DRUA 2AF4C 3ZHQA 3GMSA 5H80A 1YWGO 2WIKA 5FYDA 5EJIA 4DL9A 1UMCB 4YAGA 1FVHA 2OY0A 3E5HA 2O48X 2Y0DA 3UG6A 3VR5D 4TYNA 3N2GA 2WF8A 3ZHCA 2D5BA 2QJOA 1B1AA 4I50A 4AS2A 2ZTSA 4URXR 5DCUA 3DCNA 3KAKA 4MITA 3OEYA 2V6GA 3DTVA 1H05A 4GYYA 1AA9A 3V00A 3O8OB 3AXTA 1BW9B 3PI6A 4MV8A 5JROA 1NN0A 2OHGA 3F6CA 3LHDA 4NDNE 2OQRA 5I7EA 3OESA 2CRVA 1K9SA 3OPXA 4KG7A 3R3VA 4KVZA 3T35A 3LXXA 4YO7A 3F6BX 1T9GS 2WHPB 3GJXC 2XBMA 1E2GA 3TNFA 4O4JF 1D2MA 1BDBA 2B1IA 1QLJA 2A58A 1QANA 2W6QA 3VUFA 2YQ5A 4RJKA 4P5PA 1QFJA 3V48A 3MSCA 2BBWA 1PWEA 2O0KA 3W9BA 2ERYA 3ZJ5A 2L18A 1YONA 3MRVA 4Z4TA 4BKRA 3NDPA 1G2PA 4NNJA 4ZT7A 2GJ4A 4KUGA 1MMFB 3KWLA 2Q2QA 2HEGA 2XGJA 4MVJP 4C2AA 4CHGA 2Z8YA 1PR1A 1Z39A 5I7VA 3DQZA 3ID6C 4F9GA 3P52A 2BOVA 3IILA 1Q0HA 4NG5A 3WB2A 2GN1A 1K0FA 4BFUA 1CUAA 1ZA2A 1IEVA 2GXQA 5B3AA 3T1NA 2EWVA 3K1AA 3PUJA 2XYPA 2GCNA 1VJRA 5ADVA 3BXGA 1OAOC 1ATIA 1K6JA 1LPAB 2GM9A 1R3UA 1AKUA 1QR2A 1OYOA 2HV8A 3MOSA 3PNQA 4YEDA 3CCFA 1U65A 2PMCA 2HYIC 2W6JA 1C3VA 1NP3A 1KI6B 2Q1YA 1QU2A 2H11A 3WYNA 3ZQ4A 1ESNA 4KLZA 4HPWA 4HDQB 3AXSA 1LLCA 3HHEA 3PGVA 2WFLA 2YBEA 5CLQA 3R0XA 3GDWA 1Z5NA 2IUFA 2CHEA 3HVRA 2O57A 3SMQA 3EQ2A 5FXMA 4A73A 3OPMA 5CPFA 4QPNA 4CKEB 2CZCA 1Y9DA 4IWYA 4X97A 3CG0A 3VU9B 4LOHA 4UJ5A 5BW4A 1VE6A 1KXJA 2ZAIA 1SCNE 2V98A 4INAA 4OK6A 1BX3A 1KP3A 1TW2A 3U4AA 7GPBA 5AM3A 3G7SA 5LZ9A 1SVSA 3Q8WA 3O8DA 5JXJA 4IXNA 2HRBA 2RHWA 4CMAA 1KQGA 1HNXB 2HJGA 5CDSA 1XMSA 1PR5A 1OAAA 3I64A 3RFCA 2BM1A 4XYBA 1GNPA 3SYTA 3TRJA 3V3KA 2W6ZA 2AZTA 4X20B 1K3TA 4KPUA 1AUOA 1V2HE 3N9IA 4IKPA 3IP3A 3ZHSA 2PU7A 2WI8A 1KY2A 1YU6A 3H0EA 3P2KA 2JJ8A 1SUPA 2GKGA 3K70B 5J2UB 4C4SA 4CLXA 1NURA 4AULA 2OFPA 3HO6A 4EMBA 3PZRA 3GHYA 1AF7A 1W5FA 1UM9B 2H63A 2ZR7A 3IP7A 5KREA 4M0EA 3ESQA 1XTPA 4C5CA 2QUHA 5CYPA 5AM0A 1V2GA 1LW7A 3KP1A 4LUCA 4MRMB 4RMHA 1GSHA 3W90A 4GBJA 4HB4A 4I4CA 1Z38A 2PM8A 3LBIA 1TPYA 3AM4A 1KGDA 1UK7A 2H5JA 2YYAA 3KJIA 3QK7A 4M21A 2W4MA 4M8LA 4CW7A 4EZIA 3CU5A 3ETCA 4H3KB 4JCCA 1CDZA 3FVRA 5TPZA 3ZW7A 1P1CA 2VRNA 3OICA 1PI3A 3MK31 5C1DA 4R1TA 3K4PA 3E53A 4V2IA 4QXPA 4S1NA 2R6CA 3S0JA 2AJTA 1BXZA 1TM5E 2P6NA 3EGVA 2ZUSA 5C8DA 1CYEA 5IVHA 3KHSA 2EKZA 1ZIPA 1RRMA 1KRXA 1JSRA 3KKNA 1F0KA 3KXLA 1OYVA 5FPTA 4DMHA 3NHWA 1A76A 3MJVA 1XEAA 2GYVA 3Q9LA 3IDFA 2MT9A 3CUTA 4H7IA 3ROMA 2BBTA 4AJ4A 4PC1A 1BDHA 1LDYA 5L3RA 1QCCA 4CFSA 4R83A 4ZI7A 3HO1A 4QXMA 1R8JA 1SELA 4QECA 5BQFA 4KX3A 5J35A 4P3IA 3B1WA 3PITA 4BTEA 5F4MA 4HUQA 1KHTA 4HXYA 4PLVA 4ZVSA 5TPWA 1Q3HA 3RIEA 3VHRA 2P77A 1CUYA 3ZWNA 1JJ2B 1E4EA 4CDNA 1YB2A 1L7EA 3F7OA 3HSSA 4DUGA 3FNRA 3BDIA 3CX3A 3EOBI 4BO8A 1KQOA 5EPOA 1L1QA 3B1XA 2ZRGA 2I8AA 3TZKA 4ZZ0A 5EHGA 3LCVB 5AH0A 2P27A 2GCOA 3LBHA 1D2AA 3NTLA 5ECWA 4OB8A 5KQGA 5TMPA 2JLWA 2RGRA 2G1AA 1M1YA 1T1SA 6REQB 2GO1A 1IXKA 2HD4A 2IHZA 3GUZA 1TQ2A 4DQXA 3FYHA 3OU2A 4ZC8A 3CO5A 4LJ5A 1D8AA 3S2EA 5ULLA 4KTVE 5F78A 2VZ8A 4CIWA 4PGFA 1JR2A 1UWCA 3LL4A 1CS4C 3O4IA 3ROKA 1S8NA 5J9FA 5A05A 4EW1A 1U3DA 4EHFA 1N07A 3OZVA 3REOA 3RGWS 3UBTA 4BP3A 2A9VA 1ZNWA 4HD8A 1V9CA 1PNOA 1GSAA 3KSMA 2FN9A 4AWXA 4M0LA 4Q9LA 5ENZA 4FFBA 3F9RA 4XUEA 5FWDA 4B40A 1HUQA 1Z9BA 4QOGA 4CKBA 3TLYA 3F2VA 4RBNA 5K1ZA 1AXEA 1PEYA 1RHJA 3BMOA 4MR7A 4WQMA 4O1MA 4UBKA 1NTRA 3PPXA 1QPGA 5BYBA 5IUNC 1KOJA 5JWRA 4BPBA 4YRAA 2CXRA 1BS2A 3FNIA 4MCAA 1ZG3A 2COEA 5I6DA 1ZN7A 1E58A 2XMPA 3H8JA 3PE4A 3V2UA 3QSYA 3W2HA 1CY4A 4EVIA 2HM7A 1P75A 4F4FA 2GT1A 4JHLA 5IFKA 3RU7A 2G63A 1A27A 3U40A 2HHAA 3R23A 1NUAA 2XOEA 1KVRA 2B6HA 3FZGA 3GP5A 3OLCX 1TW3A 4MMZB 3AZPA 2X8AA 2ATXA 3ZCPA 4PX9A 3L4KA 4OFZA 1JGTA 4WOBA 4FBGA 3CGGA 1N5KA 1T9KA 2C5LA 5GPBA 3VX4A 4DHEA 3WK6A 4JSTA 3E1YE 1XL0A 1WSWA 1W46A 3NEJA 4BVJA 2UYGA 2YTZA 3LRTA 4CM6A 1FTWA 3A1EA 3ASPA 2AE2A 3QHPA 3CR7A 4N4AA 4YRRA 3QKRA 2BEWA 1KJIA 4FEYA 4ROTA 2VOEA 3BWEA 4D45A 4C6SA 1YR3A 2ZBDA 4UHBA 1UC4B 1W8DA 3G2PA 5M7EA 2RD2A 4GFDA 4YO8A 3NTXA 4BLWA 4FGSA 1UOQA 3CLKA 2WSSA 2K7ZA 5ABPA 5KQSA 3UFBA 3COVA 3DL2A 4B6JA 1JNXX 3T1HB 2CXOA 2OENG 3KSAC 1EIWA 3L8FA 4ZI5A 1Z74A 5JMPA 3G2HA 2O6HA 1QF6A 2J3QA 4KX5A 4X00A 3Q7EA 5KWVA 4ESVA 1YDEA 2VBCA 4C3VA 3TIIA 1MORA 4IQGA 5KDLA 4PU0A 3W9SA 2HRZA 2NVUA 3DYVA 2YWCA 4JT2A 3Q2IA 4MQEB 1RKQA 1YHQB 1P1KA 5K8IA 1L3IA 1SBZA 1WTAA 3DWEX 3PX7A 5IVIA 4IOLA 5EKUA 3LFHA 5COBA 1OHHA 3U5ZB 3H5WA 1YBMA 2QT1A 5JQGF 4OQFA 4W7IA 1P1HA 3COWA 5ENVA 2QLNA 1YF3A 2ZRDA 3B1JA 1KK3A 3EWNA 2AG5A 2X77A 2RGWA 2D0PB 1ORWA 2LXNA 2CDNA 2WD9A 3MWEB 3SSAA 3TW8B 4D3DA 2PWZA 4UFPA 3VU0A 2GJPA 4HN9A 2B6NA 3OX3A 3DEJA 3JCZA 5C4IA 2H3EA 5J5VA 3F3MA 2WU1A 2E4VA 3MCWA 2J32A 3BIJA 4DA6A 1JFLA 3FROA 3TLGA 4H4EA 3GELA 5A3SA 3NHMA 3FDJA 3QVGA 5JSZB 2ACVA 2GFHA 1XRQA 4NDZA 2WG0A 1QCZA 2RGXA 3JSAA 4TMKA 4XH9B 2H4XA 3SF0A 1VL1A 1MENA 2DTDA 2F1LA 4LYJA 1IPHA 4CFZA 1BQEA 3A8JA 4YLGA 2QZZA 1UKVY 1EKXA 4GVPA 4LMBA 2B98A 5CB0A 2H1SA 2Z2XA 4CM9D 3IBTA 3O0DA 3M70A 4UUMA 1W1WA 3AIIA 3QXGA 4ER3A 3WHKA 4F3NA 1BXRA 5D6NA 1TYEB 2FE1A 1RFLA 2P9JA 3Q85A 5IABA 2R11A 2IZ0A 2H4ZA 2IW3A 4LY0A 4Q00A 1S7GA 1AOXA 5I45A 4JI2B 2CYCA 2FZCA 3O84A 4Y2HA 3T7CA 2UVQA 5AKXA 2OR3A 3LFTA 5CX4A 4ECAA 4MB6A 1XO1A 3ELWA 5GVRA 2GPTA 2XE7A 1A82A 1UDRA 3KPYA 1W96A 3HB9A 5K3OA 4QTUB 4MP8A 1E6LA 2AC7A 3QVGB 2FSVA 1ZU4A 1CRWG 2OV3A 1K27A 1CEXA 3PCXA 3Q40A 3VZQA 1YDGA 3ZWWA 1AO0A 1WDTA 1JJBA 1SO8A 2ODTX 2GVDC 1EFRD 3EPRA 4TZKA 4TXHA 1KAMA 2FPGB 1QVAA 1U3CA 1VPLA 3R0QA 2IYSA 5GIPE 4WADA 5GZ6A 4GWGA 3EDMA 3F4KA 4CMKA 1CDEA 4US1R 2FJ0A 1XZPA 1JKXA 4WN3A 721PA 1CQZA 1K7SN 4AN0A 1BVYF 5TVGA 3CCRB 1C3EA 2X3UA 4OPOA 1NFQA 1U3WA 3IPCA 5ICFA 2ZZGA 1DPGA 5ICEA 2JAPA 2XEXA 5HIIA 5DIZA 5KMGB 4RDJA 3L7CA 1RT9A 3MYRA 4G0PA 4IWNA 4PZAA 5DWDA 4IMIB 4ZV9A 3VC1A 4NU0A 4HGNA 1AUQA 2WWXA 4NJMB 1C4KA 5KVQA 2P5YA 3DMRA 2ACKA 2I7DA 1B1CA 3TLEA 1EXWA 2G70A 2JIZD 2OCLA 1E5LA 3RFTA 1KU6A 3RVKA 3F73A 5L40A 2QN1A 5ERXA 1MOSA 2ZI7A 2ZM5A 3SBXA 1CRQA 3A8KA 1F5NA 1YS9A 3EUWA 3PEYA 5B3LA 1K3FA 3UJNA 3AEKB 3N6XA 3GLFA 3EXEA 2WWYA 4L6AA 4OHCA 5CHEA 4FQ7A 2Z09A 2Q7DA 4EARA 5KYNA 2OXTA 3L1JA 4RA6B 1FP4B 4LDQA 5DBGA 2MWMA 2BGJA 2O2HA 2F90A 5DCYA 5DO9A 4D7AA 1T4CB 2VJBA 4DYHA 1T3ZA 1SXPA 4XQEA 4U9UA 2ACWA 5JUWA 1NPYA 2JIMA 5JHHB 2LIPA 1U6IA 3F3KA 3EK2A 2P67A 3BB1A 1AKWA 1T2AA 3H1GA 2QW1A 3NAMA 2V7GA 4H4CA 1CQIA 2OP0A 5DWVA 4BNUA 5U4XA 1DJLA 3VVMA 1GTG1 4JOSA 1NBOA 1KP9A 5AVSA 2OBRA 1W85A 4O33A 3VR5A 4DC0A 1Y5RA 4K9DA 1E98A 4EHBA 4JJIA 2P0EA 2ZTMA 4I50F 1N2OA 3BJMA 4R8KA 1UXHA 2GCPA 1J70A 2EQBA 3OU6A 3HFSA 1YJAA 3KJQA 1OD6A 3WRYC 3TOSA 3KAPA 3TZ6A 3GVJA 4BPRA 4KQJA 5LQAA 3BIOA 3CLTC 1FCJA 2P7HA 2KJQA 1KDVA 3TGLA 1Y3FE 1VJSA 3C14C 1HK7A 5LBTA 1QWOA 2E4XA 4IR7A 1WZ2A 1FSSA 3KZMA 3SSMA 2B4YA 1R74A 1WW2A 4RZSA 4X8MA 1OILA 3RSQA 3D43A 1SXGA 2G09A 3DE7X 4HZUA 1X38A 2GJSA 2CV0A 2OMEA 3DLAA 5CAEB 2J7KA 2Z56A 2GETA 2OCGA 2EJWA 4PW0A 2CE2X 1IFXA 1J0EA 2RG1A 2XAAA 1P2UA 4IV0A 4EGSA 4PNEA 2R8PA 2W42A 1ZGZA 2CBGA 1GT91 3TLCA 1KMHB 3LQ6A 2I3GA 5JATA 1D9XA 4JV5B 1U4SA 1X0XA 2OSVA 2DPLA 4AJOA 4EJSC 1NMXA 3ZOZA 3KPWA 4LE1A 1EH5A 4UDXX 2C7RA 1OHHD 4F86A 1ZW1A 1KOLA 1IB0A 4TTVA 2E4WA 2RI6A 2DSTA 2GAAA 3A2NA 5ALJA 1KIMA 1UBTS 1DT3A 2OOKA 5EZQA 3T51B 1XKQA 1UPXA 3GLQA 4AN1A 3DLCA 4BCDA 3GAMA 2DGDA 4ZTUB 4JDUA 4EPVA 1YHZA 1D4OA 4OIMA 2IWHA 4ZAZA 3RV3A 1IZ9A 2GRUA 2Q21A 4NAVA 1JHDA 2R7KA 5DRTA 4I9GA 5AVWA 3C7AA 4MJXA 2H85A 2VSYA 3G8AA 1S4QA 2CNOA 2XMZA 3TL6A 3VR2D 4HUTA 2PUJA 2FFRA 4TTIA 5BR8B 2RK3A 2DXIA 3FRJA 1RMYA 3JQCA 3BXZA 4PSAA 4Q18A 5EXEA 1E8NA 4NIMA 1YS6A 3GJ0A 3UAVA 1C4OA 3BHMA 4QD3A 4WZBA 3NYWA 1WQ4A 3V7AA 1QGZA 3O9MA 3R5TA 4QPZA 2H1WA 4L08A 2ZJBA 3DKPA 3WFJA 2OLEA 4ZOQI 1Q15A 4ITRC 4RM0A 5J40A 1XLTA 4C7BA 1K5HA 4X1KB 4R0NA 2N1MA 1FUYB 1C0EA 1HTTA 4RMIA 5DP2A 5KNCA 4TL7A 1OFUX 2XAUA 2VSFA 3KLOA 3FDZA 5KOJA 4BNGA 1ZGHA 1K92A 3K8OE 3KFXA 1TZJA 2QTCA 1RQ2A 3BMXA 2BKLA 3QMMA 1JHYA 5ES3A 1O9HA 3IODA 3GLHA 4Q9KA 2AI2A 5AKJA 3VNRA 3LLCA 2FXVA 1J8YF 4NYIQ 3UMSA 5BUCA 3AHJA 3PFIA 3SXJA 1NXQA 5FLKA 4D9CA 4IIGA 2JGJA 2XQIA 1PQWA 1I4WA 3OT1B 4KCGA 4XGKA 4IRXA 4C0SA 3USCS 3NNSA 4FJ2A 5CNMA 1SUAA 5F7OA 2DOKA 4GT1A 1YBFA 2BSXA 2D2VA 2OAQ1 2GGSA 2FB9A 2FVXA 3BFJA 2BFBA 3LDUA 3T52A 4LWOA 1U7WA 4A0QA 1QH1B 2PN1A 2VHXA 1KP2A 3NPMA 1Q84A 5T57A 1DQRA 4D92A 4CR6A 4YT8A 2AIRA 3B1VA 1JSZA 3T0GA 1L1FA 2YWRA 3HXKA 1PD1A 1QHNA 4FZ3A 3RKRA 5HUJA 2WQ6A 5JSYA 4WK4B 3DZ8A 1GXSB 2XD9A 3ZIUA 1BMQA 2G1JA 2P9TA 4M0DA 2J1LA 3KO8A 1L9XA 1KVSA 4GZMA 4O4IA 1AC5A 1Y98A 1NI5A 1Z2NX 4U0KA 3F98A 2QLMA 5DYIA 3RT1A 3TUIC 1ZESA 3A6JA 1NT2A 2YFYA 4PCUA 1WOOA 3WB1A 3LO8A 1ZEJA 1VMIA 1XEWY 2AA3A 2V5UA 4U3JA 4Z4SA 5DM4A 5EWMA 3TSCA 4GRIA 5IJAA 2ADMA 3EDRA 3JPYA 5G4LA 3NOVA 3V8BA 4M1OA 1ANKA 1NRJB 1DRVA 1GRCA 5B53A 5C52B 2ORVA 4OUDB 4FS3A 4BGDA 1SRRA 2QVGA 3GAAA 4EI7A 1Q11A 1ZAYA 5DN6A 1B8VA 5DT9A 3GIDA 1H42A 5KSWB 2DT8A 121PA 4FFBB 5EHQA 3KTAB 2ZE7A 1GAQA 1LLUA 2Q99A 1DKRA 3OZFA 3O03A 3F97A 2P78A 3M1YA 5L4LA 4O1IA 3T6KA 4M8KA 3WRWA 4MV3A 3D6NB 2FQ1A 4HAOA 1PJZA 1RABA 4AIIA 1MHPA 5JDIC 5JVDA 5FI3A 4YK7A 1R27A 2P4EA 4OKSA 421PA 2Z3ZA 4M1ZA 1VKNA 3L7LA 4RVCA 2H2IA 4JODA 1GUFA 1PJ5A 3ES9A 4LOAA 4DDKA 1Q81D 1XCMA 2MINB 3BMCB 3L7OA 4UVDA 3TR0A 1CUIA 1ZJ4A 3ANSA 1F2UB 4LZPA 3VKVA 3ZHRA 2HRCA 3NJ8A 4P54A 1B6SA 1YD7A 3AVPA 4G5FA 4MB2A 3GLRA 3FPCA 2NO4A 4LZAA 4ARVA 4D4IA 4DYVA 2WWFA 1YHNA 3KJXA 2NU8B 2IRWA 3R0JA 4QFCA 4U6SA 3QKRB 3EXG2 4DWJA 1PR2A 3CLRC 4J0GA 3GVXA 4LZLA 4B1FA 1UKZA 2J4DA 3ZWXA 1FP6A 1AKNA 2KLBA 3A9SA 3Q5GA 4X7BA 2R1VA 2B8WA 3CXUA 4K26A 4BNYA 1OC4A 3OEEA 3C6MA 1V4BA 1X8KA 3D6JA 4KGDA 2Y77A 5HMLA 1ZXXA 3JASB 4HQFA 1JXAA 2QSUA 4W63A 3HCOA 1ZM3A 3TB6A 3R74A 4Y1RA 5I5EA 1JLLB 1PZGA 3NNNA 2BLLA 2VRCD 5BWCA 3IVAA 2MYNA 1KEWA 2DUUA 4NU8X 3VSEA 4B6QA 2P11A 4Y2PA 2B7CA 1G7RA 2V5AA 2EZ9A 1YMUA 4K6GA 5FEMA 5CFMA 3FF1A 2PK3A 3D8BA 4KQ1A 4C4AA 4S12A 4CG0A 4CUKA 4GM0A 1EA7A 4JC5A 1CVRA 1O94D 4Y6GB 2R2GA 1JDUA 1T2FA 2E7ZA 4FWTA 2R4UA 1RYZA 2E4ZA 3H2ZA 4Z0NA 4KMMA 5BSFA 4XWKA 1ZYUA 2EX0A 1DC4A 4H1HA 5BSMA 3OU7A 4M9XA 3IV6A 1OB0A 2C2YA 4MPTA 5AKYA 4ZC1A 1JPVA 4HH0A 2AN1A 2VJAA 3S4YA 3S5JA 1U28A 3P9QA 4XIIA 1PF7E 5LKAA 3SQXA 3FMOB 4MDYA 1X9IA 2PX5A 1A5SB 1P6XA 2PKQO 2YJNA 2QBYB 2VT2A 3P9YA 2BSAA 4B3IA 4W1PA 1U7XA 1CY6A 5DJ5A 4B9AA 4QDZA 3V8NA 2ZTVA 3JTEA 4QREA 5K8UA 2CNLA 3G2OA 1WNTA 1JQ5A 1VGRA 1VFPA 2JFHA 5DK6A 3RG8A 5FPPA 3QHAA 3TG2A 3ZV3A 3A27A 2XKKA 1BDMA 1E8DA 1MX9A 2RHGB 3H65A 1JECA 3WJ2A 2NYVA 4FFOA 3OFJA 3ZXUB 5ELXA 1QX4A 3O3MB 1N2BA 1V5VA 4RZIA 5EHNA 3A04A 4FSDA 3O8OA 1G19A 3SY8A 2WW8A 4XTRA 2QR5A 1JLMA 2F1KA 3K2IA 5JRZA 2M6SA 3L4EA 3G49A 4JNKA 5AIAA 3PSAA 3EVNA 3DBRB 1VHJA 5KU7A 1AGXA 1NDQA 2GK4A 1HFKA 3O38A 1XC7A 4G5RA 5DMXA 5CH3A 4GUAA 4Q3NA 2LR0A 5K0FA 3K32A 1I1HA 1O95D 4DEXA 1ZSNA 3ESCA 2JGRA 2NSLA 2AQ8A 4KI7A 1J1ZA 5K3DA 3VSAA 5E6TA 1JVNA 1RRFA 2PZBA 2RK4A 1HE1C 4O4HA 3CLSC 3DMTC 4MW0A 4Y2VA 2DKFA 3B6JA 2RGNA 3RUDA 4C7OB 4R84A 4EKEA 4OOVA 5ALIA 3RIGA 4UE2A 2HJ9A 4UFOA 3DMYA 1XZLA 4KAAA 3K9FC 1JYSA 3I0ZA 1NATA 4IIDA 4X1YB 5LVAA 1QHYA 1QZUA 1V16A 1PKVA 2BTOA 2E4AA 2WJAA 5E2IA 4AVYA 3DLPX 4IWXA 4OQLA 4Q12A 4ZT5A 5C5IA 5YASA 3MWDB 1H2RS 1U9CA 3A70A 4X6LA 3VU8A 1WKVA 4DIKA 3R6KA 4HGZA 5CPBA 3GA7A 3U44B 4V0OA 1BGXT 4N5IX 3UB4A 1IN6A 4BMSA 1PFQA 3ADOA 4MYRA 1Z35A 3ND9A 4BC1A 4KWHA 1N2HA 3FPGA 4LXTA 3BAZA 4NOJA 2FNAA 7REQB 4ND6A 2VYVD 1ZN9A 5EKXA 3SIWA 3WB0A 3KZVA 4HGOA 4DBVO 2ADOA 3OPYI 5HUHA 3KEWA 2BONA 2C58A 4EJ0A 4BBPA 4ENTA 4RKYA 4UU0A 5JAMA 5G2OA 2O14A 3LMKA 5LM3A 5FLXA 1JEYA 3N39C 4FN5A 1NMYA 3OIGA 1JMVA 1XZNA 3CEPB 1PNQA 2AOUB 1JDZA 4YIKA 2Q6KA 3COPA 4AKSA 1TGYA 2ZROA 1F8FA 3GRKA 4R4JA 3T94A 5LCXA 5FFMA 4Q37A 1CFJA 5C4GB 3HCCA 3DV0B 1THTA 1CNMA 2GESA 2YCBA 4NTZA 4XM2A 3TXXA 4E08A 4GMDA 4WFIA 1M6VA 1I3KA 1NJGA 1SVKA 3EBLA 3G8DA 4Q48A 3LL7A 5DBIA 2IYVA 5CNIA 2OSBA 4YX9A 1Z47A 5KO2A 5KCZA 4GPAA 2HLDD 5HQ3B 1SKYE 3VDQA 5A9SB 5KYWB 5JXHA 4F84A 1T9BA 1I2AA 4HDRA 4OHUA 4CZ2A 5LWQA 5D51S 1T9DA 4OFWA 1TJNA 1SCDA 3WE7A 1JEEA 1DZ3A 1IULA 2AXPA 2CLDX 3D6VA 3N74A 4L9RA 4PVCA 5EFOA 4X05A 1U4NA 3UC9A 2WU0A 1J20A 1EHCA 2B78A 3DE3X 3Q88A 4KXYA 4BZQA 3WADA 4BMPB 1NQXA 4EUKA 4Z2AA 4R31A 1JX6A 2AKAB 3B6ZA 4WMLA 2OHIA 1TAUA 1M1XB 3OBIA 4Q15A 3NZEA 1I5EA 4KH1A 4RMGA 2IZ7A 1BTOA 2V6FA 3IKJA 1PJLA 5GONA 1OZGA 1Y82A 2BF4A 5F5NA 1W4ZA 2QMQA 5KOHB 3IT3A 4LY3A 4RAQA 4PZYA 3O1IC 2VHTA 2OZVA 1GG9A 1HQCA 2EW8A 3JWHA 4ZZ2A 1ZK2A 3ZXSA 4QNMA 3RTBA 2GPYA 5K05A 4X5OA 4Z8YA 2WM3A 1WOMA 2GFIA 1KFCB 2ZBGA 4NYMR 1QTQA 3T56B 3ROXA 1EA5A 1DC3A 4JT8A 3F1KA 4JL6A 3LTEA 3GMTA 3KUDA 1RXUA 1PAUA 2G83A 2PZEA 1CG6A 3T3EA 3TBFA 1ODIA 1VKHA 2H08A 1JQAA 1JYFA 1HH4A 4A1FA 4BE7B 5F4JA 4GPIB 1M9NA 3AU9A 1VHWA 4BNKA 4E14A 1ZITA 1UBGA 2FZEA 4E1VA 5LMUB 2C7PA 5E95A 3FN4A 3PC3A 2IS4A 2D62A 4QFBA 1K9MD 2OMKA 221PA 2XMDA 1E3EA 1QIIA 3A3OA 3HZHA 4TVKA 3GLGE 4MULA 4WL0A 4EVSA 1KU0A 3QF7A 3EODA 1CUCA 1TMKA 3DP7A 5TQ2A 1U3VA 3SJAA 4AMUA 2P6UA 4Z9FA 4CLHA 1YVEI 4JKOA 4P5DA 4AWAA 2PD3A 4B4UA 2CMHA 1Q22A 1TO6A 4LV6A 4RGQA 2G7MC 1VQKB 4QOFA 1QBKC 1W87A 1IIBA 2RBGA 3K2BA 3MLEA 4UASA 4RPCA 1N6OA 5F4ZA 1RE0A 2O23A 3I1IA 4IXDA 4XXHA 4PWYA 3AVOA 1YZKA 4W1SA 4GX1A 5DOZA 3OQ6A 1J21A 5CYGA 2OZLA 5EIEA 8MHTA 1WBJB 1Y5IA 2I62A 2VWQA 1FYVA 4R54A 4ZCPA 4WTOA 3S40A 3V2GA 5EC8A 2WWRA 3E9CA 4NXNB 3RE1A 1J97A 3GVLA 2O4CA 3DOUA 4ZAVA 2OGUA 4UHKA 4A10A 2IH4A 4OP3A 3MRSA 4QO8A 2EKQA 2B9EA 4MUKA 2YXBA 1N33B 1E2KA 2F62A 1XD8A 2CFTA 3F9CA 1XTSA 2IEBA 3BK2A 3SK0A 4AJLA 1G5RA 3PRKE 4PNZA 4B81A 4EELA 2XT6A 4GOOD 1LLDA 1CJKC 5EIBC 3RVSA 2C82A 2EKDA 5BWBA 3ORYA 1F3OA 1KR5A 4PG6A 4BL5A 4CG1A 1IN5A 3QIAA 5AW9A 3M1LA 3AI1A 4YAJA 3UBMA 4H0FA 2Q49A 3EXHB 4C5BA 1A8IA 2ATVA 5EESA 5CD9A 1XZFA 5D01A 1D07A 1CW2B 4G7WA 3ZCVA 1M2GA 4TX1A 3WGIA 4LK2A 4GI7A 3IIEA 5C51B 2X2PA 5LQMA 3IEUA 3QBVA 4AQ7A 5HXAA 3GHHA 5JBIA 4YRBA 5KJFA 4JEUA 4XAQA 1K7FB 5FOWA 5JCJD 4J3NA 1XZ8A 1U8EA 1H2EA 1W6RA 5EIHA 1X7XB 5E7JA 1OROA 3T5GA 4L8WB 3VNBA 1G6OA 4KBGA 5K8JB 3O2QB 3L0ZA 1SK9A 3OAAA 5BY2A 2PT6A 5LP6A 1GTL1 3ZV5A 3ODGA 4PAMA 1TIBA 1G8KA 2FK8A 2BRUA 2IP4A 2ID8A 1LSOA 2VBTA 2NAPA 4GMXA 4LV8B 2YWXA 5FFNA 3ZZNA 1HOXA 3G8BA 2V4ZA 4DIDA 2WSMA 5LDHA 2WWTA 3JR7A 5C31A 2AX4A 3G7NA 3KLNA 3QU9A 3NYRA 2RI1A 2ZJ1A 4F45A 4EKYA 4JZKA 1AUPA 3ZPXA 4EHJA 5BQXA 5C8YF 4C7OA 3OP4A 1L4HA 2JIZA 4HR7A 4IXTA 4LDZA 4QJ4A 4RDCA 4LS3A 4KR9A 4C08A 1MLDA 3IURA 5IT0A 1UFQA 2Q3HA 3MWFA 1ONBA 5AW7A 5J58A 3V1LA 1JU4A 2XB8A 3R77A 2WYUA 4WXYB 3EVGA 2Q7OE 2I7TA 3ZXIA 4CQMA 4YPVA 1GNSA 2NTJA 3WGKA 4AF6A 1U9IC 1OYYA 3D4NA 4BJ6A 3ZDXB 3P9IA 4NBVA 3X1ZA 1ESDA 3ZY5A 1U63A 1W4BA 1CJTC 4KNYA 2IUSA 5M2QA 4G26A 4K9OA 1NMQA 3ND7A 4UMDA 4CTJA 4DMKA 821PA 3LDHA 3CZ9A 3A6HA 1B42A 2REXB 5EMNA 3DFZA 4FR2A 4QUKA 4IHQA 1YQEA 3LX5A 1WDWB 2NZJA 4RDKA 2VBGA 3CLTD 4N65A 4NFLA 1KVQA 4OUKX 2ZR9A 5IF9A 3DVQX 4MJ7A 2W2KB 4WOJA 3DOIA 1W88B 3PUXA 4INPA 2PTGA 4FHZA 4FT4A 4REOA 4C4PA 4E03A 1T43A 3H8WA 1L5YA 4NI5A 5C37A 1GDDA 4L95C 1U1DA 1LVHA 3M33A 4I55F 2ID7A 2PQ2A 4JYBA 4DT1A 1YOVA 4YRMA 4CR8A 3ASSA 5TQ0B 1K2VN 4XM3A 4RD3A 1QO0A 3QXSA 3GBPA 3H8VA 1UJCA 3JALA 4URUR 5EA2A 5A3VA 5TPZD 5JLJA 3ZDCA 1Q0TA 3JQAD 3BK7A 2CCJA 1E60A 2DWOA 1OF1A 2YHBA 2UXDB 2YXNA 2QY6A 2WSBA 2Z57A 2KPOA 2XCLA 3EQZA 2ONYA 2QNRA 2VPWA 3TRFA 2AJDA 4ZCLA 5DBOA 1PW7A 3FPBA 3U26A 4E32A 4ND8B 2QMHA 4BX9A 5JNUA 3VKHA 2VBSA 5EIBD 4Q3CA 3OKAA 1TKAA 2QL6A 3TIFA 1OXMA 2P62A 4DXAA 1YH3A 3SEQA 2H9YA 3OIWA 4MV7A 5E7IA 2P3QA 4NZYA 2BEKA 2HDWA 1NKSA 3OF5A 3FPPA 3RS2A 3L7AA 4MV9A 2QGGA 3GV0A 4QSHA 1IE3A 1Q44A 3OX2A 3RRMA 3LUPA 2PE5A 1RYNA 1W48A 4KN9S 3BULA 3CX8A 4E70A 3RHSA 4XWOA 1QP4A 1FSGA 3GVCA 3STXA 2NZ8A 3ZCQA 4BFYA 1E2DA 2H8KA 5AUOB 4B2YA 4QXOA 3L8ZA 1TCBA 2C4VA 4KPGA 2FOLA 5DKFA 4YUAA 4ODIA 4JVOA 2P1RA 2ZRNA 1OT5A 1J2EA 2PGDA 3GH3A 1DX6A 1MX5A 4CEJB 3IIJA 2AJCA 2E9SA 5M5BA 3DAFA 1TVMA 1GA1A 1KQNA 3AFOA 2NV4A 2FEPA 1LNSA 1XDZA 2HGSA 1WMSA 1LI5A 2FCAA 3NOQA 3ZHTA 2PMEA 3L05A 2H0AA 4JL8A 3LPAA 2GF9A 1VC2A 4IQ8A 2JLUA 4RTLA 3H11A 1GPH1 3JD2A 2AHOA 2C9OA 1TJ4A 8GPBA 1U31A 3QVXA 3WNZA 3CNQS 1SVOA 4AMVA 4UTRA 1W36B 5F76A 5I3ZA 3G1UA 1ICEA 2XZOA 3CSSA 1G4UR 2HPHA 4K2HA 1CSEE 1COZA 1L4NA 1NF3A 1M5TA 1RDFA 4M99A 4QASA 3LVQE 3SQNA 3WQRA 4DAEA 1CUZA 4X93A 2MJLA 2ZKIA 5SZHB 5I48A 3IQEA 3IUEA 2GMWA 2WHXA 3KXDA 1RHRA 5DLEA 3W6PA 4EZEA 3OEHA 1J8VA 1WF6A 3BF8A 4Q47A 1N05A 3QUSA 4D3FA 2Y8EA 4RY9A 4DNTB 3EA4A 3PTLA 2XXBA 4WRRA 5EUCA 5K0BA 4WAUA 3J81A 1D7OA 1BLIA 1BKSB 1N5OX 2EP7A 1C1DB 3WL4A 4KQIA 3AOEC 2W98A 3FOAA 3RQSA 5CG1A 1MABB 1EM8B 2A3NA 3IUJA 3THYA 3U7JA 2QLJA 3IIIA 4BJ1A 3O82A 2JLCA 3I2YX 2O2YA 2VNSA 2QA4B 4WE3A 1GTMA 3AP3A 4OSOA 2XOKD 2R44A 3KSZO 4C21A 3DB1A 3MTJA 3S8YA 1NZJA 2QUAA 3V1TC 2OB1A 5HKAA 1JHQA 1H6CA 1UMBB 3HVJA 1C7FA 4P34A 4DR4B 2ZUTA 1QRUA 2B7LA 3N8HA 2WBLC 4D99A 2EKLA 2QPOA 3UT0A 1BYUA 4AD8A 2B4QA 4CTOA 2OO5C 3CPXA 2BE9A 3NBKA 4MS3B 1QCDA 1W5EA 2D13A 4YCSA 3DHYA 3ZGZA 4EY6A 4KR6A 1Z3IX 2AK3A 2Y76A 5AK0A 4QNRA 4XONA 1YC5A 4R98A 2O8FB 3EUEA 2QP9X 2VHYA 1RWXA 4GPZA 4NE9A 2V6JA 2V0NA 4ND7A 2JGDB 2X40A 3GRYA 4CL2A 1C3JA 4EG6A 3JQDA 2HHJA 1Z37A 3HCWA 2KBFA 1FU7A 4PABA 3I45A 4ZCSA 2I99A 4I14A 5KYUA 1II8A 1U6KA 2P91A 1MEOA 2WC1A 2Q62A 4G01B 3T1VA 2ADFA 4E13A 3BYZA 5FBZA 1OWMA 4P1ZA 1KRHA 2V7UA 2BI8A 3O2NA 3OHSX 4Q9DA 5T8KA 4CN8A 4DW8A 1FTQA 3UW3A 2C83A 5KSYA 2I6QA 4MAMA 1HTWA 3GUHA 2X0FA 1R0WA 1I2DA 4KFRA 3FDIA 1PWXA 2GCOB 3TTWA 1EFVB 3FE2A 4RVOA 3B85A 1A8QA 2XUFA 1MC8A 4V3BA 1E9SA 2EBUA 3BXPA 3R7WA 4U39A 1IVSA 1I10A 2P8SA 4M9CA 4HBGA 4IKEA 4ZOLB 3ZHUA 4FHFA 3FHJA 5JNWA 3UJ6A 1DP4A 2Y2VA 1E96A 1I1QB 5JH7B 1XV5A 1KYZA 3BJRA 3LKBA 5EXPA 4BFTA 3EMDA 2VAXA 3O94A 4BO1A 3VR0A 2FQWA 3RT9A 1YI8A 5FIUA 2GNOA 2IA5A 3H5TA 1XZDA 1WIWA 1O95C 1QQTA 2D5CA 2P4HX 3HN7A 4WZAB 3U7QB 2INGX 2WTAA 5IAEA 4N01A 5TX7A 2HLNA 1HDIA 4KN5A 4LSMA 5K99A 4Q34A 2I0FA 3AKDA 4MVJH 4G07A 2ABWA 4GMFA 3SS9X 3UPTA 1SIWA 3MCTA 2E6KA 4LHZA 5TR9A 1KSGA 1SMKA 3L8HA 3RJ9A 2GYYA 2XITA 3WGHA 4M1MA 2PY6A 2I4IA 4R7ZA 4UW9A 5H02A 3N7UA 4FOOA 4Y2SA 1Q1AA 4PGMA 2XGGA 4YRPA 2CDAA 3ZX5A 4BFLA 3OTIA 3O4FA 1HEIA 2QD1A 4Y98A 4QOSA 2FFQA 2CSXA 4OD0A 4MQMA 5DLDA 5IBQA 2PAAA 1QOQB 4HQLA 5LMZA 1EGQA 2QRUA 1X2EA 1SCBA 4NE2A 4DWWA 1CY2A 3FOWA 5A5FA 2XZDA 2P3MA 4B75A 1H6BA 3GLGA 1RWQA 5IYQA 2FMXA 2H1HA 1DKUA 1RRPA 3BMQA 4JQYA 3RPEA 3U4DA 4EG7A 3INTA 2QWXA 3DEYX 4HQ6A 4PAQA 5A4JA 3QFSA 2B82A 2EF0A 4HIZA 1NM5C 2LWIA 2XX3A 3GCXA 3V76A 1XCPA 1JKJA 4M6WB 4OG2A 3OTGA 2BELA 2AWNA 2I4TA 3Q2OA 3OZUA 1VA5A 4L0CA 4LJAA 4KYTA 3JQFC 5DHRA 1Z7EA 3SIPA 1I32A 1Z5OA 1SD1A 2CL7X 1THMA 2EX4A 1ULHA 2C2OA 2JA2A 2CB9A 1WXWA 2QENA 3QLVC 4JUBA 3GIWA 1UP6A 4KXMA 3QEAZ 4RABA 4LZWA 4NBNA 1KPGA 2O1XA 4YCJA 1W9HA 2Z9BA 4Q1DA 5IULC 3SDZA 4D5EA 3JX9A 3H9NA 2AMVA 1G8GA 4PX3A 1N2CA 3TTVA 3BBLA 1W34A 2GKOA 4RL6A 4MJLA 1KXZA 4HNRA 4TVBA 4JBYA 4JUCA 4KDFA 2QT9A 1KJYA 2W6JD 3RUHA 4CL8A 1WDLA 1CQJA 4N39A 1WHTA 2ZYIA 3RS3A 1ZQ1A 1E1RD 4P7JA 1P18A 1DUIA 1XQ1A 3CWQA 3K0AA 2X23A 2JGKA 4QDUA 5I9LA 1W0KD 5GWXA 1GN8A 4QEKA 3TXYA 2FPPA 2R8ZA 3QLUC 4Z1MD 2B25A 2RGUA 4FYPA 2OYCA 1ZD4A 5JCOC 5IM4F 3DO6A 4ARZB 4E5MA 3OTOB 5L6MB 5JU6A 2G82A 3KHKA 3G89A 3OD1A 1BX0A 4NJMA 4B6SA 1YR1A 2ZRCA 3CE9A 3D54D 4PHTA 4U1RA 2Z58A 2FF7A 3EEBA 4MK4A 4DJFC 3CW8X 3DOFA 4LDNA 1O5IA 4U2GA 5AW2A 4YQEA 3FIUA 5C5EA 4O2RA 3SDSA 1NI4B 1QK4A 3F78A 3IV9A 3IUYA 4HLCA 4LMAA 4AURA 5HOQA 4JWKA 1XAGA 2JLYA 2YKGA 2FR1A 4YRTA 1UD6A 2JFQA 2H1RA 1E1LA 1R64A 3VOSA 1IZ8A 5KNDD 3ABRB 5DYTA 4BIMA 3GK3A 4CIAA 3WWOA 3O6VA 1SVWA 4D8WA 2ZWOA 5BPFA 2V1XA 4P3PA 1GLNA 2FE4A 1DAMA 1G3UA 5F5LA 2C31A 1JL3A 5H5JA 1Y4ZA 5C80A 1W85B 4B4WA 1NUHA 3CH7A 4NHOA 1IUKA 3FMFA 3C7CB 1EMDA 3QTBA 4GX0A 5JBNA 1RM0A 2PL1A 2RH8A 3L1IA 3L6EA 3MAJA 4FFRA 4KYVA 4YA6A 1LEHA 4X3CA 2DE0X 2BR4A 1X74A 3TQIA 1WOSA 4ZEXA 4CDGA 1SGWA 1X7HA 2AMJA 1LJLA 4BLPA 4TT3A 3P26A 1E4EB 1MO2A 3KHTA 4Y6OA 2WB2A 3GLIB 3IE2A 4G0NA 2I2DA 3EF3A 5AOCA 4A8PA 1R10A 4Z4ZA 4NVRA 1P4AA 1GRQA 1KEVA 1UQRA 2ZJ2A 3AR9A 3KEMA 3W79A 2GK3A 1DXOA 3TEFA 4GP6A 4FMPA 1GGFA 4Y3UA 4IP0A 4LOLA 1MIOA 2X9NA 4N12A 3X2EA 1PVDA 2CFSA 1JDBB 2JATA 1YB7A 1ORHA 3WNBA 2PQ0A 5K0NA 3Q3AA 1NF2A 1KK0A 4PINA 4DM7A 5E9QA 4WSOA 4V39A 1G8HA 3ZHXA 4QBTA 1J7JA 3K9QO 4LF7B 1JEYB 4DM4A 1BN7A 3QVUA 4D9BA 3UB2A 1M10A 1OBFO 4A8HA 3ZDYB 3CMAB 3AK4A 3HRKA 1JR6A 5KWJA 2X0KA 4B35A 4EO7A 3OW7A 4HDCA 1QQBA 1VQLB 3Q3CA 4PLFA 4LHSA 1RBQA 3O3NB 4MQBA 3ZCXA 4BGVA 1KJ9A 1U7TA 5DNVA 4Z1MA 2EZTA 2WRZA 4MLZA 1SVLA 3FWZA 4RA9A 4ZQHA 3U60B 2HR1A 1U0BB 5JOQA 1YRHA 4KJZA 1IUOA 4BBJA 3CWCA 1FMFA 3CC7B 3BXFA 2C7BA 1RJDA 2MR5A 1BOFA 1OI4A 4P58A 1FUEA 3Q3HA 1RD4A 2DQZA 4RJ2A 1S5PA 1ZM9A 3DLBA 3INNA 2WNHA 3ELBA 1PFVA 2D2XA 1TVKA 1E92A 5KHLB 2R00A 3LO5A 5D8DA 4YAOA 1G21E 1IK6A 3LT2A 4RFLA 9GPBA 2R68A 2ZIGA 1RXVA 2AL7A 1GKYA 2H7CA 1H94A 1ST3A 3F8SA 3R6WA 1TDJA 4TTAA 4UUQA 2FR0A 1CJCA 5C3UA 3ZY3A 1M7BA 4Q7JB 3LIIA 3U1TA 5ALOA 1QE0A 4G5YA 3JTMA 4LX8A 1NSYA 3JVEA 4ZQCB 3VZDA 4ZN6A 4JY7A 3IX7A 4KACA 1TU3A 1UR5A 3L0BA 4DA9A 3MD9A 4EEZA 1XI2A 3UNXA 4P7KA 1Y34E 2CXPA 1TC1A 2K2WA 4H7PA 5EXDA 4WNAA 1DPFA 1JEAA 2YVAA 3MS4A 3C85A 3UCXA 3C87A 1DRWA 4U0JA 4BQQA 5BV2P 1GAXA 4TV8B 5FBQB 3N2GB 4BEBA 3H9UA 3N5CA 2XUPA 4ZD6A 5IU6A 1WBDA 2ZOSA 5A3RA 1F5SA 4MB0A 2JLRA 1RZVA 3NC4A 1QRAA 1N0UA 3PGMA 2Q2NA 2DJ5A 2WWHA 4OHVA 2PLRA 2O3TA 4R1NA 3TAHA 2GZAA 4B80A 1T15A 3FSGD 2BR5A 4IEIA 3SCZA 1B14A 1ZUWA 5JD6A 2GWRA 2XNSA 1VSUA 3M6IA 1ZVMA 1XJQA 2PGLA 3HVKA 1TE2A 5A03A 3A3GA 5IRCD 4N7JA 2FKNA 4R5MA 4DIEA 1RJEA 2VNIA 1A9RA 1V41E 3M6UA 2JJMA 3CSUA 3LLMA 5L6LB 2FK7A 2FF5A 4WLNA 3EEIA 3UQZA 3AYZB 4TPKA 4IS2A 2YC4C 4OP2A 3N3BC 3OZBA 3T0IA 3TSAA 3QWBA 2IYPA 1RXIA 3OM0A 4IL5A 1PN3A 4TLLB 4EBFA 1KSJA 1KFKB 3EWIA 4V02A 4YJDA 4C20A 1VE7A 3PR2B 2HRDA 5KS2A 4W1QA 3QEJA 3FDZB 4LOIA 3VH1A 3E3LA 3AH8A 4B32A 4TWIA 2DPYA 2H4FA 4FOSA 1JLSA 1UBHS 1N2CE 1WXEA 2WJGA 2R8XA 1VL2A 3QLTA 3GNTA 6ABPA 1YQUA 4LXUA 2ACEA 1KAGA 5EUQB 4E5PA 1FRQA 2PIAA 3LPNA 4KJXA 1HQYE 2BFMA 1TTHA 3SR4A 3F6YA 2AT1A 3QWFA 2VZEA 3BDAA 3DXFA 5CYFA 5KQPA 3Q3EA 3I5XA 1ZONA 3ZZUA 5BN5A 1ADYA 3QVMA 2ZRKA 5HPYB 2PSFA 2YMMA 1OX5A 2OWDA 1JMKC 4OYHA 3RI3A 2C1ZA 1VLLA 4LPSA 2VL7A 2WUGA 3IPYA 1BC5A 4R8VA 5CP8A 1RLUA 2X0NA 4M0KA 4DGSA 2P9ZA 2WPNA 3DL4A 2IZ6A 4KKSA 2AUTA 4GDMA 1FDRA 4QV2A 2L0XA 4GOMD 4EYQA 5CLFA 1GKUB 2QM3A 4B7CA 5K0SA 2Q3DA 2VPPA 2XE4A 1WUIS 4LJ4A 2QE6A 3HA5A 4CU5A 3PFGA 4Q3LA 5JAQA 3WSWA 3DR5A 2VCYA 2FCRA 4ISBA 2JASA</