1WU8A

Crystal structure of project ph0463 from pyrococcus horikoshii ot3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
256
Chain Sequence
MITLTTDFGLKGPYVGEMKVAMLRINPNAKIVDVTHSVTRHSILEGSFVMEQVVKYSPKGTVHVGVIDPGVGTERRAIVIEGDQYLVVPDNGLATLPLKHIKVKSVYEIIPDKIRKFTGWEISSTFHGRDIFGPAGALIEKGIHPEEFGREIPVDSIVKLNVEPRKEGDVWILKVIYIDDFGNVILNLENYEKPRTVELLDFNLRLPYLETYGLVEKGEMLALPGSHDYLEIAVNMGSAAERLNVKVGDELRVRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of project ID PH0463 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PH0463
total genus 65
structure length 256
sequence length 256
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 1wu8A02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 1wu8A01
2WR8A 2ZBVA 5LMZA 2V7TA 2Q6IA 4CQJA 2C4TA 2CC2A 2V7VA 2Q6KA 2C4UA 2Q6OA 2V7UA 5FIUA 2V7XA 2Q6LA 1RQRA 1RQPA 2C5HA 2CBXA 2V7WA 2C5BA 2CW5A 2C2WA 2F4NA 2ZBUA 1WU8A 5B6IA
chains in the Genus database with same CATH superfamily
2ATCA 1UXOA 4RFSA 4YMIA 1OGJA 1R0LA 4H18A 1XLTC 2FLWA 1F8UA 1NBHA 2IUSA 3QA9A 4BATA 5FPHA 1RKBA 3GT3A 5C80A 5J1SB 3FPGA 3M2TA 1BE0A 2YJ4A 4GLOA 1QPBA 1R3UA 3U56A 4TV8B 5KKNB 2IS6A 1AZSC 4C78A 2NP7A 5FHQA 5IVIA 4AMVA 4D25A 1H0KA 2XGGA 3ISJA 2HIMA 2GPAA 4YIHA 3H4IA 2CZGA 2NU6A 2VBIA 3A4MA 4C29A 5JRZA 1IBCA 5ALTA 1KO5A 1K6JA 2JIZD 2QMZA 3IJRA 4JB2A 4LWZA 2FZCA 3KZKA 4CRWB 2YYYA 4HDRA 5DI3B 5E2AA 3CJQA 3FTDA 3OU6A 1F8XA 1SO8A 2PX3A 3H5LA 3QU2A 4FIDA 4F9EA 3K0CA 4NTZA 4IQGA 4GI5A 1KWGA 2LDXA 1ZAYA 3OY2A 3E2PA 4H77A 4BZXA 2VDNB 2X14A 5L3QA 2CK3D 1DBVO 1DQZA 3SYLA 4BVKA 3ZYCA 3LVFO 2X8BA 3E9CA 3EZNA 3FPEA 1E2JA 2FJPA 3LVRE 3MQFA 1NVAA 1I4EB 1E7RA 4NOJA 4W8GA 4LHVA 4D9NA 3HMKA 1K8YB 2VPQA 1UZAA 1ZGCA 3EAQA 3RUCA 3T7AA 4AF6A 1M2GA 1PWYE 1R10A 2WKRA 4LK2A 5ED0A 4XIIA 3MBIA 4Z0HO 1X74A 2BFCB 5JSUA 3FWPA 4F7WA 4KC0A 3B48A 4OJKA 1QLHA 3I42A 2PZMA 2CK3A 3H8VA 4M46A 1EVJA 2IV3A 4B09A 3UMRA 5KEIA 1PJ3A 2DE0X 2BW0A 2BWJA 1SKYE 3CNEA 1ZSVA 4J29A 2WWFA 4RELA 4JMPA 4UPDA 3ILYA 5HGXA 1G8SA 3PEVA 1RQ2A 1YHNA 1EFVB 1YHYA 1HORA 1P4GA 1E2QA 3DDNA 1RXVA 4IDBA 1HQDA 4TWZA 2D7CA 1ZRSA 2FR0A 3TL2A 5IF9A 3GMTA 1WSBA 1G38A 4YCCA 1M34A 1R00A 1E2DA 3LFUA 1QTRA 4J43A 4A8PA 5B55A 3SQLA 5KYWB 3Q3AA 1AX9A 2G4CA 1KEKA 1NVXQ 1JZSA 1T1JA 2YHBA 1I7PA 1MW9X 1Z5GA 3HV0A 4NZNA 3OJXA 4BLQA 1D0VA 3CURA 4ZZ3A 4R7GA 5B3JC 1Y3CE 4U7GA 1KEUA 2INGX 3QFHA 4M9XA 4NR0A 1PS9A 4XCQA 121PA 1L5VA 4ENUA 3UUEA 4BRZA 1LQ2A 4J0CA 4KDRA 4LBZA 1LA2A 2HEIA 3NVMB 4L5IA 3ZE8A 5B6JA 1QU3A 1W9MA 1EUDB 1F14A 1CHNA 2HX1A 3KS9A 1XZIA 2VDWB 3H5NA 3HB1A 3LLMA 3P4UA 3PDUA 4NX2A 4P54A 4JT2A 5IC4A 2YWFA 1TD9A 2YRFA 4G0WA 1LBHA 2PKRA 4Z1MD 3P27A 3I6MA 2VBUA 1NC3A 1RWQA 2LCIA 5IN5A 4Y2RA 1ZBDA 1NUUA 2PXCA 3KZNA 1GAEO 1BS1A 4H4EA 1LTHR 5IYZB 5GONB 2WWXA 2FPWA 3G85A 4CQMD 1QHFA 2B4QA 1BU8A 4KPGA 3TEFA 1VPWA 1XMOB 4J6FA 4MJXA 1PL0A 2ZRQA 4EZIA 4MV4A 1G17A 1H2YA 2NSYA 2VOEA 1KMMA 1VPLA 5BWOA 2HSWA 3BWVA 4CEHB 3SN6A 1HTBA 1NVVR 2VPXA 5FJJA 1SOUA 4IGAA 5E8JA 2R5NA 2HT1A 3VNBA 3F90A 1YQ9A 2GUGA 1V11A 3UYKA 5BPHA 1FSZA 4N0EA 4PX9A 5CNKA 3TTVA 1BDIA 1SKUA 3I04A 2W70A 5B3LA 3L02A 1MAUA 1ZGBA 2QN3A 3QVVA 1NBMA 1YA6A 2R7AA 2GD2A 2BFNA 1D4ZA 1SEPA 3I58A 3HCFA 2VPIA 2C2ZA 5FPYA 3F2IA 1HFWA 4LHSA 3UHPA 2C94A 1FP4A 1V4VA 4KQCA 1NKVA 3V7UA 4K9RA 4DJ5X 2HIAA 3C6QA 1U4NA 4XM3A 4B40A 2C2HA 1WCXA 1CJBA 2REQA 3C85A 3KPWA 1VHJA 2CYAA 4N9WA 2ZYHA 5B1SA 4LZOA 4EHKA 2FUG6 3GO4A 5KNCH 1ZHFA 1R7RA 1U8ZA 2BF7A 1Y5LA 3KWLA 1FTNA 2GJAA 4BO9A 4FBLA 4NXNB 1AN0A 1GEGA 3FHOA 3AIIA 4ZMBA 3PTAA 4QDZA 2MIIA 3KB2A 4ND7A 1LPSA 1V8BA 3D0OA 1OC2A 3LF2A 2GESA 3N2KA 1WHTB 3KQLA 2DCUA 2V7UA 1TA0A 3PF9A 4OCZA 5CT8A 3T41A 1EXNA 2FW8A 3KO8A 4HUQB 2H1FA 3LQ4A 3R5FA 4Q3AA 4PC2A 2CHGA 1ID8A 5HIKA 4I50B 1W73A 3AM4A 5GV7A 4GYYA 4ZO8A 5K7SA 5KTKA 2Q5FA 5AJVB 3H9NA 2QAGB 4US0R 2H4HA 4IV0A 1QHEA 3PUKA 1ZRHA 1FQOA 3S2IA 1KI4A 1X1CA 1VSBA 3EOAI 4MKIA 4RCVA 5JYBA 4XAQA 1JEYB 5EHQA 2XMBA 1MX9A 3VO8A 2B4AA 2AW5A 3NBQA 2OBRA 4RPBA 2H2HA 3ZWCA 4JI5B 2ZIEA 2F55A 1KH3A 3PYMA 5A9SB 1H2WA 2P2YA 4WBNB 5IS2A 3WB0A 4K05A 4H3VA 5ELXA 2B0JA 3NRJA 4DR5B 1I01A 3A3BA 3PWSA 4R81A 4TVKA 2HF7A 3LDUA 5EERA 3RS7A 3TIXB 3HXMA 1JVNA 3GPIA 4Z4WA 1XMQB 4IDHA 4X05A 5CVDA 3GQBA 3DWEX 4I50F 4MUHA 4B3CA 3SJ7A 3D7RA 3OZVA 2RAVA 4R4JA 4CLHA 2F3TA 2YDYA 1VB3A 4HQNA 4U2GA 1LU9A 1E79D 4U5QA 4BFWA 4TVOA 3CUWA 3KUUA 5CFLA 2VTDA 3ESQA 4HRAA 1GA4A 2WI8A 3VZCA 3ZTYA 5ERGB 3OIGA 5HMMA 4PSKA 2R8RA 4DZTA 2GXQA 1N5MA 1Y3FE 2XY4A 1RBYA 1HYHA 1DIOB 5ECGC 2C8JA 4FNMA 3WX0A 1IWPB 1H2FA 2A7QA 2P4SA 3WNZA 4RKYA 1QIKA 4RBNA 1C7EA 1U1EA 2PRIA 1PWHA 3DAYA 4O25A 3IUMA 1AU9A 1BTOA 4ER5A 3FNRA 1QP4A 1SN7A 1EU1A 3Q88A 1QK5A 3DKVA 3QHPA 2ASEA 4I9HA 4R3UC 3QYFA 5IH3A 4BV3A 1GNPA 1W29A 5IBPA 4TKVA 1GU0A 1D1QA 2HBZA 2Z09A 2Z30A 4B2LA 4BNKA 4OYRA 2R86A 3G5TA 3CW9A 3IURA 4B3DA 2CXSA 1N6OA 3KLPX 4KXXA 4NJEB 5JAZA 3A6PC 5K1ZA 1BMDA 4R9UC 3UUWA 3HMQA 5LCXA 1VE9A 3MRXA 3VKGA 2D1TA 2R8ZA 1ISJA 1BS9A 1S8NA 2AI3A 2HCFA 3C8ZA 3H6KA 1I8TA 2XAUA 3PNYA 1WMDA 2WJVA 2QUZA 3BILA 1CUVA 1RCFA 1REQA 2B94A 2FWPA 4HTFB 3ZQ4A 2A30A 4KG7A 5DWVA 1A98A 1JFFA 4ZODA 2HJHA 2RAUA 1OW3B 2YJGA 2GX6A 3CW2A 4YH1A 3KDAA 1Q81D 4MOWA 1NG1A 1YLOA 3NJ8A 1ZXLA 1D5WA 1NVWQ 2JI4A 3MWJA 4TV9A 3DO6A 2D4HA 3ULKA 4ZYUA 4YRIA 4W5NA 5FO1A 3IR6A 3T9AA 2C4HA 5I7WA 2AFHE 5KNDA 1LS1A 1PN3A 2QF7A 2C7RA 2F8TA 4R51A 3V8PA 1G64A 1DBIA 1JHPA 3CTMA 4XVCA 1ZS9A 1O4VA 3ADOA 1Z9BA 2GEFA 4DDTA 5EMNA 2IHJA 1U63A 2G1KA 2BEKA 3MC1A 2QRHA 2GSWA 2LBPA 3FCUB 4AO7A 3LGXA 4K46A 3KUKA 3GUCA 1TO1E 3T7KA 1W5EA 5BW4A 1SXPA 4GL4A 3ND6A 2NQTA 2PA0A 4XLAA 3D4NA 3H19A 2H1SA 4CTJA 1JPNA 1JDBB 3WXBA 1JG6A 2BI8A 1ISHA 4B48A 2ADMA 3O3OB 1E6CA 3LCJA 1ZKMA 1P5RA 2C7OA 1JEJA 3GEBA 2XNJA 2WNSA 3WGTA 1ADGA 3D6FA 3VR3A 4C04A 1UDBA 1OXTA 4HUJA 1YI1A 1VKJA 3B82A 2CJFA 4QDOA 3CUVA 3VNVA 2JFNA 2ZE6A 4RL6A 1K75A 2XD9A 1WSAA 1IBKB 3SQWA 4ZC8A 4KB5A 4QEDA 4P82A 4PICA 4TXHA 3F8SA 5TQJA 4HAOA 2XCIA 4DA8A 1AO3A 1Y0YA 2BVNA 1FB5A 1PVVA 4Y9UA 1TYEB 2ZXEA 3EB9A 3OOEA 5C3UA 4QSHA 4D46A 1WHSB 2MMCA 4V3BA 1YVPA 1Z0IA 1BVRA 2VAMA 3C8HA 1XAHA 3PFNA 4OPVA 1T1RA 2IE0A 2PD3A 2W5UA 2WKQA 3DFUA 3E82A 1EINA 3ZX4A 1JG4A 1J0CA 2GTHA 2C31A 2N46A 3AIOA 5D87A 2VHXA 4MWGA 3IT2A 1V6AA 2RC5A 2AVNA 4FE4A 3ECSA 3A10A 4MQLA 3R9WA 2X58A 2X0KA 1GNRA 1U0HC 4IDDA 3VDXA 1ESEA 1VCMA 1B8PA 2JIOA 2OCLA 1XD2B 3LL4A 5AJYA 3LTNC 1ZVVA 4M1MA 4W99A 2P7HA 2WJJA 4S3MA 1X87A 1Q14A 2O8VA 3TWOA 1R64A 3EDYA 3W3AA 2XXAB 1U0JA 2CVPA 2Y0EA 2YFQA 1R3DA 5J43A 1M2EA 1I3NA 1DIRA 2GJ4A 2OLEA 3BSFA 1FP6A 1HR0B 3P71T 3MELA 3EPPA 3P2EA 2WIJA 3KWJA 4UMFA 3OI7A 5LQDA 2JFVA 4D56A 3RBXA 3E61A 1V8FA 1U5AA 3RIHA 1JWBB 1GAJA 1ISMA 4WUVA 3DPSA 1K9SA 4HAVA 4KXQA 4BO8A 3KTAA 2EJVA 2H92A 2WKWA 1HLPA 5LBTA 4BVLA 1O57A 5KDLA 3T3EA 2ZTVA 1KYZA 3MAGA 3O82A 4H7PA 3QJGA 4A36A 5AW8A 3WNQA 2XSZA 1CVRA 1E58A 4ZGBA 1L5FA 1O03A 3TSAA 4UU7A 3UJNA 1GUZA 1E1QD 1Z4KA 1VPTA 2C78A 5E95A 4LRWA 1IL0A 2AOWA 3NHZA 4CF4A 2CHEA 1V41E 4V0KA 3SK0A 3TQIA 5GGXA 3AB3A 2GAOA 4YREA 3GFQA 1EDOA 1N2HA 2EX1A 2XE8A 3OTIA 5J59A 4Z2AA 5IUJC 2DY1A 3CN9A 5IFLA 1S8OA 4KXLA 4YMWA 1AKUA 3B70A 1H0RA 3Q7TA 2EG9A 5G4LA 3F6BX 1L8QA 2PIDA 3H7IA 3LUPA 4RF2A 4ALIA 5HX7A 4UEWA 5BQPA 1YV9A 5CA1B 1VYVA 4WCFB 4BMZA 1E1QA 2DBRA 3AR9A 3DE4X 1CQIA 5ADHA 2RFLA 1Z7WA 4J2TA 3EXHC 1AKMA 5BNWA 4JKYA 1XHEA 2GN9A 3F3MA 1ZNWA 4ZI7A 4PQGA 2CBZA 3DYIA 3RD5A 3AOEC 4I1UA 1C9KA 4FC7A 2X22A 4U7DA 3TOCA 4P86A 1UJMA 3OZDA 5EEGA 2WFMA 1OZHA 4IRMA 3RGWS 3CRZA 4M83A 5LP6C 5HJEA 1D2HA 3TPFA 3TOSA 3QQ5A 1Z16A 3H7AA 3NPMA 5EIOA 4L4ZA 2HDNB 4ALLA 2BGKA 3U2QA 3AESA 1E60A 4YPFA 4MLCA 4G0NA 2DFLA 3EIEA 2Z6UA 1FFEA 1O95A 5ALXA 5C4IA 1UPFA 1Z73A 2ZI6A 3M3HA 5CK4A 3K71B 1UUFA 3ICCA 1BE8A 3KIPA 4B31A 5B7PA 3H4VA 3HVJA 3CLSC 3ZZNA 2PBLA 5FX2A 4N54A 2ZZEA 3GCGA 4M1SA 1N8RD 1FLVA 3LOQA 4WNAA 3N39C 1YR6A 2HJRA 3JAWB 3SP1A 1CZNA 3DPUA 1DMRA 3LGSA 5B1IA 4D4KA 1YMQA 3AF5A 3V1KA 1Q95A 1I1OA 5CFRA 2NN3C 1KZ7B 1SU4A 5A5DA 2MSNA 3G8DA 2ZVJA 2I5PO 4N6OA 4OXYA 3LLUA 5CYGA 3MBKA 4P6VF 4IEIA 5DWDA 4K9OA 5EUQB 4ZU6X 1W93A 1V37A 2R48A 1EM8B 1UJCA 3QVUA 4B3XA 3G88A 4BLUA 4O4HA 2Q21A 1GHTA 4MA5A 5BSWA 1QHHB 1W9HA 2Z4TA 2X4LA 4QG3A 1NTOA 1A4XA 3I1JA 3GCZA 2YXBA 1TAQA 4V3CA 2EW1A 4QYSA 1ADFA 1N5KA 3WGUA 3RYCA 1T3HA 4AKGA 4MYTA 3QU9A 3E15A 4OU4A 4XQFA 1Y7LA 1AHNA 4Y2QA 1EGHA 4ZP1A 5ENZA 4Z2YA 4LF4B 1YK0A 1KJNA 1NIPA 1G2OA 2CNLA 3GBSA 4Q4HB 1U2QA 1UFRA 4F4HA 2R97A 1RJFA 1SELA 2QMYA 2CFSA 3T56B 3O1IC 1XZPA 1NJGA 2PJZA 4LZNA 1JEOA 1PV2A 1M73E 3DFZA 3AUXA 4KYTA 4FJ2A 4FXPA 4M1OA 4GZ6A 4DCMA 3HBMA 6REQA 1GU1A 1X80B 2EJUA 3F5FA 4WXRA 2QTTA 3ESXA 2CJXA 4X95A 4Z4SA 2PL9A 3L0SA 5HZMA 2G77B 3H3FA 4B32A 1SUFA 4EGAA 3A05A 3WLLA 2H1RA 5JFOA 5K3BA 4GXNA 4IOMA 1KORA 3HM2A 3VU0A 1DIAA 1Q1AA 1XIVA 2Z8ZA 1C50A 3C5VA 3R6WA 3SBDA 3HNPA 4ZT4A 4XJVA 4E12A 2Z57A 5A3RA 1XNQB 4EJ6A 2FW1A 3T7DA 2YJTD 4W5HA 2EIHA 5KQRA 1U1IA 3G1TA 1NBWB 3AFIA 4ZKDA 5HP4A 5SY6A 1A71A 2YRWA 3Q8WA 3RWBA 1T9KA 3GPLA 3B6KA 2OV3A 3NDRA 1SVNA 1JKIA 1U81A 3EG5A 3KZMA 2QUKA 2R7KA 5JCOA 1FTQA 2A3RA 3CLTC 3NYRA 4RZQA 3TLEA 3BHMA 1GNLA 1H4TA 5CM8B 1I4DD 3HDVA 1JEAA 4R1NA 4JN6B 4NJEA 1A5AB 3F96A 2P2CA 3T94A 4PRKA 2G6TA 2MYUA 4X93A 3PF8A 2CLHB 2EZ9A 2ZRBA 3TQOA 2ZYIA 3HEMA 3B51X 1ZGAA 3GAAA 1IY9A 3LKZA 3NHKA 1XU7A 4J0GA 4P4SB 3TMAA 4ITUA 1ACMA 3O74A 2YIJA 4NS4A 4YJ3B 3FG9A 3G9UA 2E87A 4HEQA 4BNFA 1DEAA 4RD3A 5EHNA 4JNCA 1CT9A 2E5FA 1Z3CA 3PQEA 4TXMA 3RS0A 4ALKA 1R27A 1OU4A 2WG0A 3OE5A 3OFKA 2PMKA 2QLFA 2WTBA 1I0IA 4E3WA 5LLDA 3KXPA 5DEOA 5K8VA 4AU1A 3IFSA 4RULA 1WG8A 4D0GA 5BVHA 4BU1A 3RJTA 1Z6GA 1WW2A 2HBRA 4U63A 3C43A 4HGYA 4FYPA 2FFAA 4L8GA 4U3JB 1IEWA 3RTAA 4ABYA 4B4UA 5JD5A 5H8WA 5JC8A 5TQ0A 5A4DA 2BKUA 5CX1B 2Q6IA 1WXEA 4D9CA 5FPPA 2IYWA 1FDWA 3F5DA 4IRXA 1VL8A 2PT5A 1W4LA 2CXTA 4C7BA 3DDWA 3ETNA 5HRCA 1H3EA 2ZDHA 2AJDA 1JHRA 3QYJA 4ISCA 2AD5A 2H4WA 2D1QA 2P65A 3PQ2A 2RGYA 4O2BB 5B7QA 5JXIA 1DIGA 4PANA 2BBSA 3SGLA 5FLYA 1HI9A 2Q5CA 1JSRA 3AR7A 4PGAA 3R7LA 1FXWA 5HWSA 4XD7A 4PX3A 3SG0A 4YCNA 4BQFA 2I9PA 2Q1YA 3R44A 1TU4A 2OVFA 4XSVA 4ZJYA 4GBED 3F3KA 3B1ZA 3G7NA 3DF9A 1JEYA 4OYHA 2RH8A 3D6JA 3OCJA 3BCFA 3PYLA 1XQ1A 3MYYA 4IF6A 4DN6A 3FOBA 3H9CA 4A2WA 2A1TR 1OFHA 2X8AA 3HKDB 3QBDA 5D6NA 4MX8A 1RJEA 4G5OA 3JYQA 1X42A 2W43A 3PGJA 3TZCA 4G7WA 3GIRA 3BORA 5ALDA 3CXUA 1YC5A 1W88B 2HBQA 1CU1A 4IWNA 5KU1A 1ZVQA 3L4JA 1M72A 3C4QA 3H0EA 1NWHA 5C52B 2LUOA 3TDMA 2R44A 3HJBA 2IYOA 1VLHA 1FRFS 4AC9A 1H5NA 3UKJA 5ALVA 2E21A 2PMWB 1W34A 4WBSA 4PBSA 2XH8A 1XRLA 3W78A 1ENOA 1G5RA 2J4CA 3BG5A 3CEAA 1BCSA 5A7HA 5JBNA 1V5EA 4IX9A 3TM4A 1NQUA 1QG0A 3K70D 1UP4A 2MINB 1O77A 2HWXA 4D99A 3UJHA 1FSSA 4FOPA 5KINB 5E3HA 1A9TA 1K7FB 1TUEA 4DGQA 4C2TA 2HFKA 2QPLA 1RWWA 3TXAA 1YFKA 2UYGA 3GWZA 1DWPA 2W71A 5JUWA 1JEQB 1OBHA 2FGKA 2IP1A 1IE3A 1F06A 3FPPA 4IGKA 4EPVA 1SC3A 2XOXA 3BZUA 1M2NA 1CUEA 3PQ5A 3BXXA 3N8IA 1RHMA 5JNSA 2QGZA 3TINA 1IQRA 1VQ9B 1E96A 1KDOA 3A4YA 4XM2A 3PICA 4X92A 3QELB 1LV7A 3BXHA 2AEFA 5ANRB 1YZVA 2NXWA 3VU3A 4UTVA 3IHKA 2VBVA 2XBUA 4UXIA 1C7RA 3K8YA 1KK0A 3Q87B 4L75A 4WRRA 4RKFA 5H59A 3T6KA 4DIOA 3OQ1A 3R5XA 1W85B 1XZ8A 3IDZA 3U3XA 3M1IA 4UTOA 4MRRA 2YN0A 4W6ZA 1J42A 2FSGA 3K9CA 1FZQA 1I9GA 3O47A 3OZIA 3EGOA 1ECBA 3HB7A 1OB0A 3F8WA 5FPKA 1L7BA 4FFBA 4L2IA 4J7XA 5KYKA 4M8SA 1U3TA 1BH6A 1PL7A 2FPGA 3JVEA 1MA0A 4KAXA 1Q2XA 2PRSA 4RJ2A 1MOQA 3BH0A 3ZK8A 4F9FA 4ZCRA 1SGWA 1ZM3A 2VJLA 2FZWA 1FNNA 4V0MA 1ORIA 1TZKA 3IVMA 3JASB 1V1JA 3WLHA 2OAEA 2G88A 3NW9A 1BA3A 1QJCA 2G4VA 4XORA 5GIPE 3CVUA 1H6CA 1P1JA 5HPYB 3GK3A 1B15A 3EEYA 2EFEB 2F3PA 4QUBA 4O0MA 1KP2A 2VYVD 3COZA 2FB9A 5BURA 2BM1A 4X8IA 1Z56C 1MB0A 4NLLA 4QDUA 1SURA 2GFQA 3IIJA 2P6NA 3RANA 5L3SB 3VSBA 4CKZA 4F3KA 2LWIA 2N3ZA 4Q18A 4Q01A 3HV2A 2EFDB 4H4CA 1RPTA 4H7HA 4D9EA 4EYQA 4EFNA 3GEPA 3GBPA 1RWNA 5AHOA 5C4GB 7MHTA 2E1RA 3NWPA 1FFBA 5IDXA 5H1YA 1YRLA 1WP6A 3HUEA 1Y5IA 1LPMA 1AK9A 1TYDE 3AU9A 2C4TA 3D7LA 4FE3A 2G83A 3ER6A 4QOGA 3DMPA 5DOVA 1M8PA 1KJIA 3DEJA 3I8OA 3LWZA 1EIWA 1P62B 4KKVA 2PL5A 4M9SA 3MG9A 1O5IA 2A2ZA 3DGEC 1WOSA 1V8DA 2LD4A 4NJMA 1K6EA 3ND9A 1WBJB 2ZSFA 4UAGA 4YECA 5IZCC 2RGBA 3L0BA 4R8SA 4FX2A 1VIDA 1Q91A 3WIVA 5CVJA 4QULA 1WB9A 2ZT5A 4KR2A 4R2MA 4Q4JA 2Q3HA 3RYIB 1EJBA 2P3MA 5FA6A 1EGAA 1MR3F 2IBTA 4G8BA 1V96A 4AKIA 2I3DA 2QRQA 5H82A 2YBDA 4E30A 4OXKA 3TX2A 3W0LB 1G3UA 2VO1A 1IM5A 2FFRA 2VP2A 1RWKA 3ONUA 4ISBA 1KAQA 4MKRA 2Y4NA 3ZXUB 1UT6A 1CERA 2QMQA 4EECA 1N1GA 4FZJA 1QRSA 3FTEA 3A9WA 3UIEA 2CZCA 2Y0CA 1SBHA 2D59A 3OJ0A 4NEQA 1E5XA 3GUVA 4S1OA 4XKWA 1HT2E 5MN6A 3RAJA 4A1OA 5L3QB 1AZWA 1VHDA 3CLUC 1OXBB 2VCEA 1QFZA 2RGWA 4W9NC 2H5IA 1OI7A 4WA7A 3BEDA 4DLTA 1S2LA 4ZMRA 1Z3IX 3MS7A 3OJLA 1Y8ZA 3KHTA 4PO3X 2OCYC 3IT0A 3UXEA 4COOA 4QU0A 4K2AA 1ZIYA 2WMDA 4EO9A 4J1SA 5D3KA 2E49A 2Q3JA 3RIMA 5CNIA 1YF3A 1W87A 4MQ5A 5F9FA 5JATA 4MQ6A 4MH0R 5JLAA 1IG3A 4K2HA 5JSKA 3IB3A 3BMXA 4QUKA 1CQZA 4K9DA 5H3CA 3HP1A 5A6SB 1QAOA 1OI3A 2ZG6A 3FBGA 4WZAE 1FJXA 3ZE9A 1YKSA 3FOAA 1RYFA 4OB6A 5ESRA 2VZ8A 4J2HA 3G7UA 1E8DA 1DFHA 2EDAA 4BJ5A 1QMGA 2WWHA 3H5AA 1JB1A 1JG1A 1WDLA 1PJ7A 1GFIA 4IIGA 5JAHA 2O19A 2O8EA 1YNSA 3LWBA 1P3DA 4PGHA 5T4EA 1UJNA 1TLLA 1IYZA 2YHSA 3TGWA 4B35A 1AB5A 1BO6A 4B73A 2GUWA 3QKRB 4RH3A 4N5DA 5DNCA 2WF5A 1N0VC 1HDGO 3Q5GA 1W1UA 2WSBA 3NNNA 2B2CA 5A7GA 4ATNA 1K73D 4NYIQ 4CIDA 5FEMA 1OLSA 3R24A 2OTLB 3HE3A 2ATEA 1RQRA 1ISIA 3ASRA 2IVFA 4RJKA 4TX1A 5THQA 2QTAA 3RS8A 1MOSA 3EC7A 3VRHA 5GWXA 2YV4A 3ONWA 2JLCA 2O7RA 4GGMX 5SV2A 1GL9B 4E5VA 4C08A 1TTTA 3N2GB 4PNHA 4C4PA 4Z51A 1ZGGA 3RADC 1OTYA 1PZXA 1UMCA 1D9ZA 2IZ5A 2DLDA 4C43A 2P1ZA 1WXXA 2ZE7A 2IT1A 1RI1A 1ZD8A 1JU9A 1T1SA 4GE3A 4GM0A 5DH9A 4ZRMA 3OJWA 4AJEA 5A2GA 3NAQA 5FBRB 5BSHA 2I2DA 2CVZA 3O9ZA 3N74A 4RMJA 2ADFA 2BJVA 1H8HA 1XRNA 3WIBA 3GNSA 2QM3A 5C7OO 4BFCA 2B8TA 1R0YA 1JFRA 1SVMA 2WG2A 3QEMB 1UANA 3ZVKA 1O54A 3QLVA 3WMRA 2K7FA 1VQ6B 3TUIC 3K4PA 3Q15C 1AG9A 4Z4HA 5CFMA 2B92A 4NBWA 3IE2A 1E61A 2JA1A 4J3NA 2VP5A 2VJYA 3QOWA 3NOVA 1SXGA 5AJWA 3DYVA 1EUZA 3PXXA 1A7AA 3N2LA 1MAVA 3ICOA 4BX2A 3AI2A 5F1OA 3VBEA 4B17A 2CY0A 1DTEA 1RM4A 1ND5A 4NYJQ 4S1NA 3ZGNA 2OZLB 1NY5A 2UZ1A 2VDPB 5BMOA 5H4GA 1RU3A 3R0QA 1W47A 4UHDA 1J0XO 2EW8A 1EUCA 2OHFA 4G26A 1N6NA 1WA5A 2P9BA 3F1KA 4LMAA 4PNPA 1ZK2A 4DLAA 3S68A 3GUZA 1NXTA 3OU2A 3A25A 3WBBA 4J8PA 2GZDA 3RSQA 1MV8A 4IUDS 4S1PA 4B6OA 3PWZA 4EWLA 1VM6A 5BN4B 4ECAA 3M8KA 1TCUA 2OSBA 4EB3A 4PYQA 4B6FA 2GBPA 1PDVA 1B8OA 4D9FA 3V8EA 1Y1KE 3AONB 1J8MF 3L1VA 4HDRB 3HJNA 1UOQA 3ZWKA 2F64A 2X9NA 2YUTA 3DE1X 3R9KA 1HKUA 1YL5A 1XVIA 2O3QA 3N0RA 4LHEA 1W5TA 4JLNA 2CZQA 3P9PA 1PR5A 1R4MA 5TGTA 4ZJUA 2JHGA 5LQCA 2OOSA 1X15A 1GPWB 3OSZA 1DINA 3I0MA 3FDZA 2V97A 3SE7A 3DUWA 3LTEA 5DCYA 4D79A 1GRRA 2YICA 4CE6A 3JZFA 1E4OA 1N06A 2VK4A 4NE7A 3ZGLA 2ETVA 1PQWA 4P2GA 3T9BA 3RR2A 3F9RA 1DXOA 4G0OA 5IJ9B 4H3KB 5CT6A 4UM5A 2DWOA 5C51B 4LI0A 4LWPA 4XR6A 1YJQA 3VYVA 4BNJA 1UXHA 4RE6A 2AC2A 4F8YA 3I1YA 3DD5A 3PDHA 3QW2A 3S28A 2CUTA 3H99A 2IYVA 4EEKA 1ZESA 2FMFA 2R47A 3PJDA 4GRIA 1U7UA 2DPYA 3GGJA 1R1DA 4ZDWA 3K1AB 4A2CA 4RA9A 2PXAA 2Z4RA 3LF1A 1L1FA 2FWRA 4BKMA 3WNDA 4KJXA 1T91A 4NARA 4WCFA 5CEJA 5DU2A 2NZUG 2Z08A 4G0UA 2A6PA 2F1MA 1M0EA 3M89A 1JFTA 4XWWA 4C22A 4AVZA 1LK0A 4EY6A 3OIYA 1LDGA 3QVWA 3QPDA 5CITA 3W2FA 4I9GA 2YDXA 1J0EA 1R8SA 5F7JA 5TX7A 4ROXA 4RQUA 3T1YB 2M1XA 1SVSA 4KQKA 5DHFA 7MDHA 5EJ9A 1GJRA 3IJEB 2JDIA 4L3OA 5K3DA 3G6WA 1SUSA 3L04A 1FX1A 3A1SA 1JPUA 1MHPA 3EODA 1KR5A 4G09A 3TFWA 4B1FA 5IJ9A 1Y4DE 1IRXA 1E89A 2VIIA 2ZI3A 2Y1XA 3S7ZA 3WIEA 4RTLA 4JLJA 3D5EA 3GFOA 5EP4A 2G0AA 1P1FA 3S6JA 4BDSA 1BS2A 2ZTLA 3SSMA 3VKFA 2JI6A 4CDRA 1O9GA 3CKLA 4YRPA 2A94A 5LYJA 1T0HB 1U65A 4LQDA 2BR4A 4N3AA 1UFQA 1EB8A 2QD4A 4JX9A 5B58T 4JA2A 2O5EA 3CR8A 5T7BA 2ZJOA 3H9JA 2JK0A 5FNZA 2VS1A 4K87A 3O2SB 3UV6A 3RAEC 3NC0C 5E3JA 3ANSA 1BWPA 2CXOA 5JH7F 4UDYX 4URHA 1OH6A 1VQNB 1Y34E 5A1TA 4GP6A 1KRHA 1RCTE 2RCYA 2R2AA 1PG0A 2FN7A 2X0JA 2NO6A 4GXTA 1NLYA 1TJ5A 2E0IA 3PS9A 3N0XA 3PRJA 2WSLA 4UW9A 4MVJA 1Q0TA 2RE8A 1XD2A 2C2MA 1NM5A 2YY7A 4BBPA 1A5ZA 2QY9A 3BK7A 2IKQA 5CA0B 4YR7A 1IUPA 4Z3DA 4I2VA 4HG2A 3VHXB 1I6LA 1JALA 1I3OA 1EP2B 3FKSA 2X3UA 1BJTA 2R7MA 4ZWNA 4BO4A 4RXMA 1E69A 1MFPA 3NBKA 2WYIA 1CY7A 1F9EA 1HDXA 4TMYA 3L05A 4LJAA 3UWMA 2I4IA 1TT5B 3I39X 2P30A 3ZY4A 4BB6A 1KYIA 5D01A 4XCVA 4CKEB 1V5WA 3HN7A 4GMDA 4HLUA 5DP1A 3SZ3A 4DLWA 2V6IA 3PKZA 1JA9A 3KRTA 1XNJA 5T4FA 1TECE 3T9FA 4QE3A 1X1BA 2DUMA 3O4GA 3TMYA 1YQWA 1AH2A 2H9AA 1MO2A 4JVNA 4NAHA 3ZBPA 4E94A 3FSRA 4Q02A 5IBRA 3ETEA 3UQZA 1JHQA 4ZO6A 3R5TA 3PQ4A 1Z12A 4L8YA 1UJ5A 1YRYE 3RW9A 1QGED 3LP8A 2F6RA 2TRSB 4E5YA 3LFHA 5LZ7A 5AW5A 3A70A 1AJEA 3CH6A 3OKAA 3M9LA 3JZIA 4CM5A 3COJA 2AG0A 3BQMB 3FI0A 1U28A 3HCWA 1WETA 4R31A 5FLKA 2GFIA 1NW4A 2EF0A 4MS1A 4NCIA 4P5DA 1A95A 3Q41A 5I4KA 1DPFA 1PNTA 4KZKA 4YO7A 4DHWA 1AKRA 3KYCB 5LWQA 2FZ5A 5DYYA 3BCHA 3CF4G 3I8XA 2B1JA 3ZBTA 2C2KA 2QL7A 3JRXA 3TLKA 2JLZA 4URWR 3U44B 3QTBA 1OKKA 3PSAA 2O54A 1KJ8A 3OF3A 2Z98A 1CUYA 3O83A 3C7KA 3PZBA 3CMEB 3OPMA 1ICEA 4NENB 4U2CA 1JHZA 4O1HA 2IWRA 3RUIA 4XIJA 5CYOA 4DG8A 1BHSA 2NLOA 4OI0A 4M86A 2QRZA 4UCFA 2W8BA 1Z26A 1UQTA 1WRBA 3I4CA 4PG5A 5G0UA 4MKFA 1NT4A 2XB6A 3UEOA 1J8QA 1VYUA 3ZV3A 1IPHA 3HZZA 3CCLB 2QEQA 3K2EA 3N75A 3OMWA 4IO1A 3GXOA 3HCRA 1UKAA 4R2IA 4ZV7A 4R40A 4YRAA 3AFMA 2YOGA 1IVYA 1NNUA 3AO0B 1DT5A 3SEJA 2H7YA 4ZVTA 2GGSA 4F2PA 3V8RA 5HXAA 3H86A 2YBEA 4LK3A 4ZREA 1PR0A 1Q5PA 3KU1A 2WJPA 2IK8A 1NB9A 3E8SA 4LF7B 3AILA 1PGQA 4MNTA 2B9EA 2NOAA 3U3JA 2PA3A 1QANA 4F71A 3TTUA 1RBQA 5BMVA 2XYHA 3M6XA 2YV2A 1TADA 2XYRA 3JS5A 3QIAA 1UXKA 1IUKA 3L0DA 2C7GA 3A7EA 3MLBA 3QEMA 2O8CB 3P26A 3A3NA 3BICA 3DTVA 1N2CE 2GJPA 2I1WA 1KVSA 4FUTA 4UU8A 2QTVA 3IRVA 3O90A 2C4MA 2X40A 4IQFA 4G07A 3F7TA 1SZDA 2FR1A 4GKBA 4KWIA 4LYDA 5AKKA 3VZSA 4D81A 2AN1A 1QJ4A 4RX1A 3VDNB 4EY4A 2YIMA 2BV3A 3BXPA 4TUYB 2JATA 3W2EA 4CQLA 3QVJA 2PZGA 4WCVA 1RE0A 4NYIR 1ZJZA 4TVBA 3K9NA 3UK7A 1GLNA 4X90A 4NY1A 4TPKA 1GKLA 2P6PA 1DP4A 3GZ4A 4OQZA 4K9LA 3QI2A 3TLGB 3ZS9A 2ESRA 4WXPA 1FU8A 1FK8A 1KZ4A 2BP7B 1MIHA 3OD5A 5F21A 4MWSA 4Q48A 3ZE6A 2PL3A 3ZD9A 2E4XA 3SWWA 1LZLA 1VA5A 4EL5A 3AR4A 3HCEA 4ENVA 1HT1E 4OIMA 4AG3A 3AHIA 2I87A 4KWTA 5LR6A 1NWCA 3UHJA 4IYJA 4AP9A 4HFJA 4TKUB 2E3JA 1ZN7A 4B7UA 4M4SA 3RUFA 1Y33E 3F6YA 4U00A 3TQHA 3MJDA 2YNMC 4Z0PA 1MAWA 1YB7A 3QVGA 1KKLA 2P40A 1M0SA 1TYCA 2WFLA 5LDDC 3MN1A 5KYUB 3UJCA 1L5YA 2B6HA 1T0JB 3IKMB 4PZDA 3IAEA 4DLVA 5HOEA 2OD9A 4DAEA 1N34B 3GPBA 2A8YA 1M8JA 3W6NA 3B6IA 3FH0A 1NI3A 3HPRA 5IEJA 1LUAA 5H5JA 3ASQA 3F8TA 4XMYA 4QUDA 1C7JA 3KM0A 4A6EA 4JEMA 1MP0A 1SRRA 1E92A 3P2KA 4HDSB 4JJ6A 3RVSA 2CFOA 1Y48E 4YHBA 2ZTNA 4NAUA 3U7QB 2RAFA 4L4SA 4PLVA 3U1TA 3BUSA 1KI6A 5DPMA 2CXNA 4ARAA 3D9QX 4KR3A 2A0WA 5E6SA 2PKXA 1KRXA 1VL1A 2AR0A 4FMDF 3NCHA 1PR2A 2VDLB 4L1KA 5AICA 4FN5A 3QE4A 2PD6A 3PD1A 3A1FA 2H00A 1M7GA 2XQVA 4CI9A 2HU5A 3DNPA 2WHQA 2FLKA 3HCOA 3OT1B 5K5EA 5KVCA 1AKNA 1WW3A 1GILA 1M8GA 2FQQA 2HXYA 2PY6A 2V45A 1X7ZB 4JP3A 4MINA 2AE2A 5TVKA 4BNDB 1CZRA 4CEJA 1K66A 3Q0IA 3IL2A 2VDJA 2FMIA 3WMFA 5A9SA 5KWVA 2F43A 3COVA 1FLDA 3ENNA 4GP7A 1AD2A 2RKWA 3E7FA 3GGDA 3RC8A 2I1QA 3SZRA 3VTZA 2GXAA 4HOYA 5WRFA 3AETB 1ODJA 1WMFA 4BHTA 2OFWA 1P0PA 3TIFA 1X7YB 4EJ0A 2GBFA 2JEOA 3IKLA 1OBOA 2BSXA 5KQLA 2EW2A 5B36A 4DJJA 1JEDA 2BGUA 5AT1A 4IMJB 5AVJA 3INTA 1YJNB 1XRQA 2BM8A 3E5RA 3FKSD 4MVYA 2B1IA 2VJIA 1II8A 2C8KA 3U4QA 1SQSA 3H4TA 3WQSB 2QGGA 3SFVA 9ABPA 4Y9SA 5JNRA 1NBAA 2O05A 2ZTSA 3NKLA 1TUBB 3QX9A 1HPLA 2W2OA 2XVAA 3GT0A 4MXDA 5H81A 3STYA 2OPBA 2ZL6A 1A8HA 4AY3A 1L7QA 2RGNC 4YQZA 2YWXA 4KW7A 3W5BA 4XI9A 4Z3OA 1BIFA 2IY9A 3ZWXA 4DEYA 2JBHA 1ECPA 1IN7A 3FLMA 5M3BA 3PKJA 3ZD8A 1KWKA 4IY1A 4WZAA 1PLLA 4QNMA 1MQSA 1RXEA 4JWKA 4BNDA 1E77A 5K8IA 4CEJB 2X9VA 3RKUA 3QEAZ 4XIFA 4EMUA 1UBFA 1ISGA 2V5VA 1XO1A 3RRZA 3ZJ4A 1RXSA 2QX8A 3GJSA 1XYVA 4L74A 1TVMA 4RF5A 5LBIA 3T54A 1NXXA 2ZRIA 3LHKA 4KVFA 1MRNA 3AJRA 3IYLW 1T6BY 5HYVA 4AZVA 2I65A 3F5SA 4MJ7A 1P75A 3OQMA 4PIVA 4YYZA 1EFLA 1TM2A 3P4YA 5JAQA 1YK1A 1WKBA 5C34B 3ZIAD 4ER6A 5BORA 1X7YA 3A9TA 3U3DA 4R9NA 1VQ7B 1EFRD 5AKEA 3VNRA 3ZV7A 1AN9A 3DZJA 1LK7A 4LYAA 5SYAA 2BZ1A 4H6PA 3W1WA 1T3SA 2IYAA 5DGIA 4PC7A 2NUTA 1VQ1A 3WI7A 2DIEA 1M6VB 2Q7XA 4O2BA 2ZPAA 5KJ1A 5A06A 3D6VA 5D2CA 3LUFA 1L5OA 1FRZA 4L6CA 4DC1A 1I36A 1J8YF 4G0ZA 1DU4A 2DT8A 5IJ0B 5GONA 1YI0A 1UKVY 3LX5A 5I9IA 2XLCA 1T5DX 5K2OA 1G6OA 1GCGA 1TC2A 3RQIA 1JI3A 5KJ6A 1JI0A 1L4LA 3UFXB 2BEVA 2HA4A 4POOA 2BFEA 3N58A 1KJWA 3CVWA 1Q83A 4PV7A 4X1OA 1NNEA 4E2YA 3CPJB 3TD2A 2C2OA 5E4JA 1F0PA 3E9RA 3CGGA 1VRVA 4L72A 1EP9A 1KFEB 1UEIA 3EZXA 3I23A 4MHOA 4FDTA 2HTFA 1TVCA 1KC3A 5A71A 3A6GA 3M5DA 3SU8A 4UFOA 1RRVA 2EFHB 5KJEA 4WJKB 4CMJA 4D4IA 1F4VA 3F67A 2JGRA 2E18A 1SUBA 2D06A 3LXMA 4LHXA 4ENSA 1PD0A 3BTOA 1AQLA 1Y8CA 4G1MB 4BXOA 1MRZA 2OCXA 1QDEA 3M81A 4AMUA 4MA4A 1F7UA 3V4VB 4KQXA 2AUTA 4ZHQA 2GPYA 3L1HA 3TQRA 2ZANA 4GWKA 4E1AA 4MITA 2YC2C 3PXBA 1JTFA 2KPOA 4CKWA 3QU7A 2F67A 1UKCA 2FG7C 1TA9A 4OYLA 4K8RB 1NXVA 3ORSA 4XLCA 1ZM4A 1P9WA 1VSQA 4G0MA 4TMVA 1E1MA 4HDQB 2HAEA 3ZIDA 4EIWA 1R8XA 4E6EA 3GDFA 2UXDB 1Y9DA 2CJWA 1XDDA 4CF6A 3ZS8A 3ADCA 1IBRA 4MVJG 4BMXA 4BP3A 1E1LA 3G6KA 1FW6A 3ZHBA 2AMYA 2QGNA 4H1HA 1XCMA 2RIRA 4HUQA 4MB6A 4QJ5A 4LOKA 1D6SA 3OZGA 4UM9B 2VH2A 4YONB 2FSUA 4V1CA 4A0RA 3A4VA 4OH1A 1E6MA 2VWQA 3WQZA 3B38A 1C7FA 2DH6A 4M1TA 3C6YA 2X6YA 4FQ5A 1IZ9A 1FX0A 1YE8A 1RI3A 2DAPA 2ZCJA 1QHHA 4IDPA 4H3SA 1JSZA 1G9TA 5KSPA 1JLHA 4C5BA 3CMMA 1ZK1A 3FTPA 3VJKA 3VV2A 1NYTA 2PU7A 3EQ8A 2KI5A 4ND5A 3VUFA 2R84A 3R4VA 3RYHB 2BEWA 3CO5A 4CL3A 4ZJZA 3FLEA 1U0NA 2ROQA 3I37X 2IHYA 1EDEA 1JYEA 2OCBA 2OV1A 1FBNA 1VOTA 2GJSA 4KMRA 1DQYA 1U5BA 3OCCA 5D3MB 1GYQA 3WRWA 4CM3A 1D2NA 2LIVA 2P2NA 2OO7A 2C2GA 4D42A 4DXHA 1U7TA 1K2WA 1R4ZA 2ORED 1EDDA 3PA6A 4UAUA 1EI9A 5B3JA 3LG2A 4F2DA 1CRZA 1YDWA 4Q3OA 5JAUA 4XR4A 3THXB 1MB9A 2DM6A 5IP5A 2EZ4A 1JE0A 4F85A 2ECPA 1U04A 2J9FA 1J0AA 4BEVA 2H06A 3HFSA 2WWVD 4LRQA 4CDGA 3CX8A 1OD6A 5IABA 3CC7B 4P1ZA 5K6AC 4RZXA 2QKYA 4LJYA 3I6IA 5G0VA 2V9PA 1QPGA 1HEYA 2XHZA 2AI1A 3FLAA 1Q2UA 4TZKA 4XUGB 3ZV6A 2JIBA 1M2OA 2OA0A 3PDCA 5I45A 5FBKA 1E79A 4WNIA 3VC1A 3LY9A 3T0IA 1OH5A 1GVNB 2VEDA 3I5MA 3ZHYA 4K03A 4PWYA 3CJTA 4HDAA 3AI7A 3J80A 1T3GA 4RORA 2FSVA 5G1PA 3ZW9A 4BQNA 3CVYA 4TKUA 3D1JA 2JBWA 1PKVA 2OGTA 2JGAA 1QE3A 2JFOA 2PR2A 2WUGA 1H6BA 3PFCA 3Q9LA 3D4PA 2O2GA 4P36A 5AP9A 3QEJA 5C7IO 2O8BA 2H7XA 3LY7A 3P2OA 1WULS 4M6WB 3LOUA 2A5DA 3INGA 5AKZA 3VPFA 4AVYA 4TYNA 5HFNA 4NONA 1WNFA 2EP8A 3LYLA 1BRMA 1IVSA 2YJ6A 1DX6A 4MRMA 1F12A 1W76A 4MS1B 3T7EA 3PGKA 2O3UA 3UGKA 1GZ5A 3UOAB 1BROA 4RKWA 1YS2X 2FSIA 4WVFA 2HO5A 5FLEX 4Q9HA 2QJFA 1OFTA 4XJTA 5TNXA 1N0UA 1HFJA 1N9GB 1RLOA 4HGOA 4BRUA 2BH2A 3KR2A 3SZGA 4MWTA 1ICIA 3L9WA 2DC1A 4MQBA 1OTXA 4B4WA 4CQJA 1ODLA 2R00A 3H2BA 3ICVA 5BUSA 3KR0A 5KTPA 2HF9A 1J39A 3AR2A 4UD6A 5I7UA 1ZIPA 3ICQB 1FRVA 3SNHA 2ZYRA 2C0QA 3BCSA 3DB1A 2QMOA 5B1DA 3A6EA 4RGYA 1M83A 2CF5A 3TLAA 5HVNA 1Q84A 4ERXA 2E6KA 3OT5A 4JJGA 1ZSYA 4QOEA 1SQ6A 4ZO9A 1QIFA 3K0AA 4MR9B 1HLGA 2C5EA 5HTKA 3ET5A 3IIIA 4L02A 4LAFA 3EZ9A 4AKTA 4HC4A 4MRPA 5I9BA 4G1FA 2QRMA 4FS8A 3TRFA 3HR4A 1G7RA 4EPYA 2FR8C 3U4DA 3DOEA 1ZH2A 3AUJB 4YGXB 1XCOA 2B20A 2I03A 3D8RA 3BPSA 4IKPA 4O2AB 1GP2A 3FPFA 4OHVA 4X7BA 3Q5EA 1RVV1 1XWFA 1QP8A 1MX1A 3SC4A 1CZOA 3LSTA 4L76A 3HP4A 3AC0A 3LYHA 1LSOA 1JLKA 1YGYA 4ZOLB 4B8WA 4BB0A 5C18A 5JYCA 3GVHA 4PRYA 1ZZEA 4MB2A 1CYEA 1KH2A 5EIAA 5JQGB 2OT3B 3EXG1 1IVNA 3SDBA 3EOZA 4IXWA 2REBA 4Q1VA 3KETA 2AN9A 5GZ6A 3DZHA 2DPGA 4L50A 5HUQA 1PK9A 5KTTA 3IP5A 4GFDA 1W0JD 3DV2A 3KTFA 1VLJA 4OGLA 2CNWA 3F9CA 1TE2A 1KBQA 3P94A 3A4NA 3VVBA 2ZXUA 3EQ7A 4JT9A 4WNYA 521PA 3WMGA 4BBJA 3BMQA 2OAP1 1SULA 3DC7A 3MTJA 4OMCA 4CIBA 1I5RA 3CLTD 1TKCA 4CU5A 4C7XA 4AO6A 2AW3A 2GAAA 4ZVUA 4QJ4A 3KPJA 2SICE 4MV3A 2ZM6B 2CSXA 4KRXA 3R6TA 4MUNA 2GASA 4BMOB 4DYHA 4EDHA 1ZZGA 4UUQA 1QHIA 9ATCA 1D2CA 4OMFG 5J40A 4D9JA 1TKRA 2J0SA 2UZIR 2PGAA 2GVZC 3PPYA 5HE9A 1WPQA 3P9ZA 1UD5A 2FWIA 2Q45A 1XQ9A 4L5BA 3KEWA 1QYCA 2FXVA 3UXYA 3QG1A 3KTDA 4BJ3A 4ZZIA 2EU8A 2A9QA 3GUYA 4Y6LA 1GOTA 4IIJF 2ZM5A 2H57A 3KCQA 1RW4A 1KK3A 2GPJA 2XOKD 2H5EA 3KL4A 4V0ME 7REQA 5LP6B 1A9YA 1D4FA 2BTEA 1HG0A 2X0EA 1CNMA 1HL7A 4LHWA 4GKVA 4ZXPA 5T64A 1XUOA 2FWMX 4Q7EA 5A0TA 1Z5WA 3DHEA 4C0JA 4NFHA 1IRIA 1WZCA 5AH0A 2QR2A 5K20A 1L7VC 2A84A 1TM5E 4DNPA 3VHXA 4BQEA 1O94D 1NY6A 1I5OA 3HU1A 1WPCA 1XI2A 4X71A 5BN1A 3GDWA 1JDTA 4QLAA 1Z18A 2I91A 2YWGA 1U9ZA 2P11A 3I0NA 3IDSA 3P2IA 4PHHA 3B5IA 5F77A 4D3SA 2XCQA 3BGVA 3DW3X 2IUUA 3M33A 3FWHA 4HYEA 2IE8A 3TAXA 4K6MA 1P5FA 5BYKA 2C2BA 1E4YA 1OB5A 2GZRA 3SQNA 4MIOA 4QYTA 3RARA 4RPDA 2I4TA 2DKNA 3MA0A 4J0FA 2ZZGA 1NLMA 2GCOA 2LXNA 2Q4BA 2X85A 4HGQA 4NG4A 3F49S 3LK7A 3PQ8A 4DSUA 1F2TB 3DFIA 2SCUA 1EX7A 1XG5A 4P81A 3CVJA 3OM0A 1ATIA 2O23A 4NIMA 1JWLA 2UZ1B 5KX5B 1QH8B 3AFNA 4Y2XA 1O5TA 2AG1A 1QX4A 5FORA 4B2YA 4BQIA 1VKOA 2VRCA 3IVRA 1DJMA 3AM3A 4Y6OA 3QV2A 5E0KB 5K8LA 1UD4A 4LKOA 4YRNA 2VBSA 5EIBC 3CVOA 1DO8A 2OV8A 5ALMA 3MTDA 2JFWA 5CPBA 4DLNA 3SX4A 3EZYA 1S96A 2UYYA 1YRAA 4IWXA 3FHTA 2Z6BD 1GKYA 3EWNA 2CWWA 1SBIA 4MV9A 4Q6WA 5ETJA 1HLDA 5FNVA 4JC4A 1HE3A 5IYNA 5MGBA 3AK4A 4J91A 4K9SA 3N70A 4RDLA 4XVUA 5T8KC 1EFPA 4Q1EA 3S29A 3HB0A 3TZKA 3VNQA 5B4VA 3VQTA 3K6SB 1UD3A 2ZXHA 1N6HA 2AS0A 2HV9A 1J8FA 1DBQA 2R6R1 3CX3A 3TJRA 4ZEWA 3VYWA 2DQKA 1IB0A 3I9V1 2D2XA 3BHJA 3A1TA 3NLLA 3GDGA 1U7HA 3PNQA 2G9QA 2QWXA 1ZGZA 3IBSA 4WBXC 1TM4E 2PRJA 4B2IA 5U9CA 5KIAA 2PWBA 1CQXA 2YH2A 4Y2UA 1IAVA 3UJPA 3JWHA 5LMZA 1O95D 2R8EA 3D6MA 4U5XA 3VZBA 1GWNA 4G24A 4G5YA 1LF0A 1Z8DA 2R6JA 4KIJA 4MVJH 4BNNA 4O0LA 5FOUA 2ORIA 2BUCA 4OPMA 3TR0A 2HPVA 5LP6A 1HYBA 3E9EA 3I6BA 3EBOA 2DHDA 1V7CA 2Q2OA 3R3HA 5F51A 3PGXA 5FUQA 3WE7A 3C15C 3QUQA 4CV0A 4FFWA 3DMDA 1VC2A 1KAHA 3WYCA 4YJ3A 4MW9A 5FR2A 4OJTA 4KHPB 1XVVA 1NRKA 2P7IA 2RH9B 5BNIA 4N76A 1GQQA 3IEUA 1J0BA 3WAKA 3NM4A 3QA3E 1UBJS 4LOJA 5KSWB 1ZY2A 1QYRA 4F7DA 4N03A 3PQ7A 4G3XA 1L7AA 3K5WA 4KPUA 1CQPA 4KXYA 4WY8A 2G9UA 5JJIA 1D6JA 1GQ2A 1S3SA 2Y66A 1YT5A 1JV2B 2PCJA 3U9SA 4FX5A 4MPTA 2D1SA 3CA8A 1IZZA 1FDVA 1KAGA 2QN9A 1XLWA 3WK9A 4AN4A 2P4UA 2A3NA 3RIYA 3CPSA 3JZMA 5LZ5A 3U6BA 1TIBA 3EGDA 5HHTA 4L16A 4PWZA 3P96A 3IQIX 4IXMA 5FI0B 5ILQA 1T6YA 3TQQA 3LA6A 4IINA 3VOBA 2Z4SA 3FVWA 3ZGZA 1SWVA 3AXTA 3WFJA 1O96B 1C14A 5FL7A 3AHFA 1VP9A 1Q7TA 1UKEA 2O59A 3UMJA 2JC3A 3EMBA 3OZUA 3K53A 3KJGA 2AZMA 4I55A 3IVAA 2C20A 4JYMA 5KKAA 3UKDA 4N1AA 4P92A 4C6SA 1ZCBA 4C21A 1R0KA 1TOAA 3ETHA 3HDGA 1ORWA 2QTWB 1UBGA 2AOUA 4XA8A 4BZQA 4ZIRA 1ST3A 5AUPB 2Y05A 2WFZA 1YX2A 4Z0NA 2OV4A 2XDQA 4AD8A 5CFZA 3PC7A 1Q9SA 3FDXA 4OU5A 4RVCA 3NDJA 3U1BA 3H6GA 4HAWA 3VV3A 3K6RA 2I6SA 3NG1A 4HBZA 5KYXA 2R1ZA 3DBVO 2C4VA 2OR3A 3K9FC 4LJRA 4OO3A 1LBTA 2J4DA 2IXGA 4ND2A 4KTVE 5CJ2A 1MRSA 5IARA 3RRFA 1SC1A 1S0UA 4BLSA 3QOFA 2JARA 3V9PA 4KBFA 4XKVA 1SUWA 4KQIA 3HXPA 1VA4A 2NSHA 2XRZA 3CRW1 1GRQA 1I7NA 3EK2A 2V54A 1L4KA 5F78A 1FY2A 2QVGA 2BEWB 5EZQA 1S6YA 3AF0A 1WQ3A 2NV4A 2IYSA 2F3UA 3RVLA 3NI2A 5FR1A 1FYXA 5L3ZA 3OQIB 4S0XA 5IULC 1NMZA 3CRMA 1IBSA 4I55B 4YP1A 2I4OA 2OM6A 4MGIR 4CTMA 2NTEA 1P5JA 3VOAA 3V7YA 3GCDA 1D5CA 3EGWA 4NU8X 5SZIA 1HBJA 5B64A 3RASA 1KFKB 2Q28A 1YU6A 2NNWB 3BF7A 3R9XA 4GZLA 2F1KA 3UZUA 2P2ZA 1G5TA 3E35A 4MCAA 4R0VA 3WV4A 1LPNA 3MCVA 5EHZA 4H27A 2GYUA 5BSRA 3AF2A 3JX9A 3LPNA 1AKQA 4KAFA 5T3YA 1KRWA 1RAFA 2C3YA 2IXAA 3BRWD 4X7CA 1I1NA 4XIGS 3ZQKA 1OXUA 3SLKA 4BE4A 3HVUA 2GK7A 2FTKE 1KO8A 4W1SA 2WF7A 5EKXA 4AIRA 2QB5A 4FEYA 4Q9JA 3G9TA 3AW8A 3ENKA 4QECA 5EKTA 2GBLC 3VO9A 4DCVA 4KSCA 3CZCA 4FFBB 1LBEA 4L2IB 1RM5A 1GAQA 1H4VB 3FZQA 1WPXA 4TXNA 1QORA 1G7CA 4P7GA 4RE5A 5AK4A 4MIYA 5ER9A 2G5PA 2DOGA 3RS2A 4E22A 1SBTA 4R8VA 4C0BA 3DW1X 2F9FA 2WA2A 2IXFA 3FF1A 1V1RB 8OHMA 4D26A 4L8FA 4W9RA 1NTRA 2RI6A 4KMSA 3O92A 1IQPA 3HK2A 3HZHA 2YWBA 5LQNA 3SJAA 1UBTS 1CEEA 2PUWA 2WWRA 4RPGA 1GNQA 2FWNA 1H9AA 3BQ9A 2X8WA 2LTAA 2XEXA 4DQLA 5IEBA 3X1WA 3ZV5A 2JFXA 1JR2A 3AKDA 5FDFA 1YOBA 4YJHA 5H3HA 4B84A 3M82A 2QRKA 3KQKA 1U3DA 2FFQA 4LXXA 2XB4A 2Q07A 3H5IA 3OCUA 4L9RA 3OE7D 2IPLA 5ELLA 3U4CA 3UUFA 4C01A 1FJ2A 2JJYA 3B6JA 3U3OA 1USUA 3ABRB 3HS3A 5GM2A 4YACA 3GL9A 5TGZA 2W42A 4WBNF 4P38A 4BNMA 2J07A 1G291 2FSFA 1V39A 4R41A 1I8DA 3TX6A 1EG7A 2BEJA 1STOA 3EISA 3VM6A 4FMCB 3JD2A 1Q82D 3GRPA 3GJYA 1JB9A 1JQDA 1LH0A 2QPOA 2XNKA 5FNVF 4AJJA 5KSZA 3E7WA 1PJ2A 2CCKA 3L82B 3RRNA 2OXEA 1A2QA 4PG4A 4RHCA 4FFLA 3RG2A 4N40A 3DD1A 4RM2A 4L9SA 3PJRA 1BWSA 5KNCA 4KFSA 3DA8A 2WDZA 4F1JA 2ET6A 4JKOA 1X7XB 2H3HA 2ISQA 1XCPA 3KU4A 3M6VA 4N5NA 3QE3A 3FNQA 4FFNA 1VJCA 1DC5A 3EWIA 3B7GA 5ESWA 3V4RA 2C4UA 4M0CA 5LU8A 5J3OA 2OUIA 4RNCA 3KSRA 3Q3EA 3P9NA 1CKEA 1FVXA 1M2HA 4DQVA 4DT1B 2ODAA 4JBLA 1QYIA 2A1TS 3NHLA 4MZXA 4TSFD 4D6YA 1PX0A 1THTA 3U5TA 5ED4A 2D74A 2EDCA 2IOFA 4QGAA 5EFOA 4CG2A 3ZKWB 5IYZA 5KPJA 2HO4A 1DRKA 3B78A 2J46A 3GLSA 2V98A 1FJGB 2ZR8A 3E0QA 1DKUA 1SHUX 4F3CA 5JSQA 3BGOS 4RD1A 4OJNA 4RNDB 5L3RA 2YY5A 3BGDA 2PBRA 4X24A 1YZYA 5J2TB 1IHOA 2YJ5A 1R15A 1Z0KA 2Z5VA 4IXTA 2WAAA 4FYMA 3Q3JB 2RAPA 1Q1NA 3JYHA 1EAYA 2ZUVA 1LI4A 2I34A 2VHQA 1XEXB 3KJXA 4INPA 2J3JA 3NDPA 3WG9A 4N8DA 2D1RA 3GX1A 3HYLA 3JYOA 3L8EA 5HFAA 2QYTA 3JASA 4GW3A 3ZI4A 2PAFA 5KVAA 1EVZA 2DJ5A 2NMVA 4PFJA 3PFKA 5JXGA 1KMHB 3T9DA 2W2TA 3A36A 1JZQA 2ZB8A 3HKEB 3NWOA 3QV1A 5A9TA 1K4MA 3EASA 4FCVA 4N0PA 3KLOA 1CLEA 3R5HA 3T1HB 3ZH9B 3NFYA 3O4RA 1MU0A 2YQ5A 3DMHA 4K3VA 2Y9MB 2PXHA 1G2QA 1QDLB 1J7JA 3ET4A 3K9WA 4KVZA 3IQZA 4B7AA 3H1EA 4W82A 1JN0A 1WMEA 3O3CA 3EUAA 4YJFB 4ZARA 3FMOB 2GWRA 3O8BA 3RYHA 4A03A 4E32A 4EG3A 3BGSA 3ZHXA 3EIWA 5JHGB 1M3SA 7YASA 3BWEA 4J03A 2FZ4A 4X6LA 1TJYA 3UCXA 3ZDFA 3U13A 1BH2A 5BSVA 2HEGA 5FUMA 4Y1EA 3KKMA 1U1FA 3MMPA 2AXEA 3PCXA 1UC4B 1NW3A 5FPSA 2FRVA 1A9ZA 2PX0A 5ALPA 2D7JA 5LYJF 3R7BA 3C3WA 2XCSB 1Q1EA 4RPIA 3B7PA 3JYPA 3FYCA 1XEXA 3WTBA 3LECA 2JW5A 4HS9A 2OWEA 3X2SA 1N0HA 2IQIA 5FPQA 2GM9A 3I32A 4FZRA 3CPWB 1OXKB 4OOXA 2GAJA 4PG6A 4U9HS 4AZ0A 2X53S 1JDUA 1DFGA 3ANXA 1K89A 4C3ZA 5LIRA 3K8OE 3RFTA 4GPIB 3AEQB 3UCEA 3WGMA 3AY3A 2AXQA 3QE2A 2DR2A 3H8JA 2ST1A 2RGDA 4YNBA 3QFSA 1W4AA 2GMWA 3GNTA 1U3WA 1N6IA 3IMCA 3UYLA 4OB7A 4PW0A 4BZZA 1HRKA 5AI5A 3WSTA 3C5WP 4DY4A 3CO0S 4MKXA 1AUPA 3LC7O 3V6LA 1P1RA 1LVHA 5IJZA 1F0YA 3HB4X 3UJ7A 1PHRA 1IJFA 5PGMA 3G9QA 1GV1A 3GMSA 3QEOA 4XFKA 4FMPA 2FPOA 1CZHA 4MCHA 4CLOA 4LHZA 1JR3A 3B6EA 3FAZA 4G9BA 1JFFB 3DTTA 3HYNA 3LYUA 4QNNA 3W3ZB 2JFYA 5CIYA 2HHJA 1ORRA 3RSOA 4DUGA 3PPWA 1U0OC 2I4NA 1DQSA 1PSWA 4HB3A 1SD5A 2IYNA 1XRSB 5MN4A 5GIOE 4DLYA 1QF9A 2HA6A 3P2YA 2JKZA 3IV7A 4J9VA 4Y6RA 1HFEL 2C00A 3ETDA 2A9VA 1FS5A 3MJSA 1C7IA 1JA1A 2ZR9A 1P80A 3BY1A 1OIVA 3E2IA 5D00A 3RU9A 4US2R 4TROA 1M1KD 1F6WA 5CDFE 4XQCA 1YE5A 2P2DA 2MWMA 4QWMA 4PYOA 1YO6A 1N4DA 3WZMA 1P7CA 1SH7A 4PZEA 5EIFA 1V8ZA 2OECA 3O8DA 5E7QA 5JT1A 1TF7A 3NHJA 2OZKA 3HCDA 3D6TB 3UAYA 1L4BA 3LKVA 3BC9A 1ZJ4A 1JXMA 5IUKC 5TQ0B 1W9XA 1FNSA 1BQ4A 2XYGA 1RR6A 2HDOA 5IKXA 4II2A 2P67A 1Y5RA 1T6ZA 3FFXA 2V4DA 1VGVA 4G9EA 4H31A 4RIEA 1MNAA 3DR3A 4BPBA 2WMNB 4O4IF 3LO8A 2IUEA 1O95C 1ACLA 3WL4A 1K6MA 3IAS6 1U0SY 3QNUA 3V1UA 3VSEA 4JXKA 1O2DA 1XD8A 2Q3DA 3FWKA 5AR1A 5KOIA 2WYOA 4YEJA 1CP2A 3TOXA 4DM7A 3F5QA 2Z0MA 1NMEA 4G1VA 1QTQA 1KA9H 5ALNA 3QXXA 3IR7A 3IO5A 3PQ6A 2FEAA 2ZBFA 2QD2A 1DQRA 1BDMA 2OG2A 3HHPA 1P7WA 3DZGA 4XDZA 3ORQA 1E18A 2I6UA 4BUJA 2C9OA 5DMHA 3QLEA 1B43A 4KI7A 1TCVA 3G0CA 4JMLA 2ZSAA 2IIBA 4N39A 4OQNA 1OFUX 2Z9BA 4RZHA 2CD7A 1G4UR 3JQ8A 1YJ8A 1ZNQO 4QXAA 1MG5A 3FYUB 5E3IA 4X7MA 1HQYE 1UC5B 1ARZA 4YPVA 4YAOA 1HDCA 1R5JA 1RAHA 2Y1DA 4HD8A 2FPXA 3OT4A 4EG5A 5JZBA 4S1WA 4N0MA 3L46A 4OAPA 221PA 5DYNA 2JHPA 3AV3A 4JVOA 1YVRA 2AKAB 1OT3A 2WM8A 3PT9A 4LDZA 3RJ9A 1U0TA 2PRYA 2CC2A 2Q9CA 3NMUF 2OORA 2YXNA 1OXVA 3EMKA 3FA2A 3CZMA 1DDGA 4XX1A 3U40A 3V46A 3LS2A 3V3KA 5L46A 4KV7A 2D8MA 3KCNA 4A1FA 4EOGA 1NZFA 1X7WB 1PFWA 1QG4A 1ISFA 4N7BA 4AY6A 2VPZA 4IM7A 5DULA 2G9NA 2IEBA 3VOTA 2ZR7A 3G6EB 4I8XA 5K0ZA 4F06A 3WBKA 4RPKA 3S5UA 3G17A 1Z29A 1B7GO 3KQQA 3EAFA 2NUAA 3R75A 2QI9F 2Q0XA 4M0MA 1U3UA 2L18A 1N7IA 2X8LA 4L28A 1YCFA 3RFCA 1KE1A 4BJ6A 3CX7A 4Y1FA 1BX3A 2XODA 1DRJA 1ZUWA 4N47A 1YRWA 2O7SA 4OJYA 1JIUA 5FYQA 2VJDA 2H31A 4A15A 1TEXA 2BCEA 2WZQA 2EFJA 5MF6A 2NADA 5K8TA 3X1JA 4DLLA 1MJFA 3DL7A 2EBWA 2GK4A 4ZVMA 5GY7A 3X1KA 1SRQA 2FF7A 2E85A 4B5LA 5JZSA 4OXXA 1MBZA 4CJXA 3VR3D 4XR9A 4D6XA 3BB4A 1B2RA 1LWNA 3EQ9A 2Y99A 4Q9DA 2B7BA 3Q8KA 4F86A 2XV1A 3TW8A 2P69A 3K9LA 1HDEA 2H0RA 4L0CA 2R4TA 2WKSA 2VJNA 3EA5A 4AY4A 4BFTA 4QDTA 1VKNA 4G56A 4I08A 4V2IA 5EHIA 1USIA 2IC5A 2WMOB 3CF0A 3LI2A 2UUCB 2AJCA 3FD8A 4GDMA 1FS4A 2VH5R 3DKRA 4WY5A 3UHAA 5BQ3A 2YHIB 4LZJA 2I22A 3CRNA 4DF3A 4C3OB 3OWOA 5A3VA 2GERA 1RLJA 4U6SA 2NVBA 5FV4A 3FY4A 3JV7A 1HE5A 1QR2A 4MTCA 2FMTA 2EGHA 1KZ9A 4P6YA 2EG5A 3NBYC 5J5VA 1H6DA 1JPJA 5I7SA 1WXGA 4JB3A 5CCDA 1AGYA 1NGSA 1W4ZA 2HK9A 4I3HA 4P33A 2FRXA 4NPAA 5DKFA 3NDBB 5TRTA 1SC9A 4AG6A 2PQ0A 3DM5A 2FAXA 3OWXA 4YRCA 3JAMA 4BFVA 2BMEA 4CTOA 3EEIA 2GHRA 4HNVA 3UJ8A 3EZ6A 2AYZA 3CRRA 1GGMA 2D5BA 5A2QA 3RT9A 1F2TA 4INOA 1C9JA 3ESBA 4HN2A 2K87A 2F17A 3M5PA 3H5TA 1QB7A 1GPYA 3RS5A 1PNOA 5KW9A 2QW0X 1F0KA 5PNTA 1NF9A 3DEHA 4R2JA 2GYWA 4G4IA 2ZKIA 3GN2A 2W2NA 3ROPA 2CFCA 3TGLA 5IVKA 4GLLA 5BQOA 3SJCA 1FRQA 1QGUA 2DTDA 5E8RA 4AP6A 1E5QA 3SC3A 2NZ8A 3G68A 1E66A 3NJ4A 4MDYA 2GLUA 2FGJA 4RPLA 5TMPA 1D2EA 2AH5A 4X6YA 5AJTA 2X1MA 2V1UA 4DJAA 1BW9B 2AN5A 1QDUA 1L7EA 3GH1A 4EDFA 4G4GA 5GJBA 3DQZA 4C2BA 3OU7A 4O33A 5EFZA 3O0DA 3VPSA 4J4HA 3SICE 4DBVO 4FSHA 2QXUA 1B3RA 4OLAA 3T8YA 4WADA 3FHLA 3ZHUA 2JKYA 5CB4A 1RD4A 3TSYA 2YVLA 2C3PA 4Z4CA 3WWEA 4DC9A 2JVJA 4QXMA 4E6PA 4Y67A 2WD9A 4AKHA 2R2GA 5BN3B 4XUDA 3UJDA 1K5PA 3NHWA 1VRWA 1KI2A 3DVAA 2HV8A 2JFHA 4UEKA 1SCKA 4HXYA 1CS0A 1L7PA 5CR9A 5ILGA 3OZBA 1PTKA 4F2GA 1NVBA 2LE0A 5JNTA 3B1VA 4XVHA 3SLDA 1J00A 1CYDA 2CVQA 5D5HA 1ORHA 5HKKD 2XCRB 4JQYA 4PIMA 4PSCA 4AN1A 1AV6A 3SX2A 2VR1A 4RDKA 2Y77A 2P0AA 4FOLA 2GJ8A 4AJHA 1CY0A 4EO4A 2HMWA 3KHUA 5LUBA 1EUQA 4Z7NB 4GG1A 2HSZA 2PQ2A 1IZ8A 2FVGA 5JWOA 2EERA 3IUNA 1Q21A 4QWWA 1IZYA 1KFJB 1RLIA 3GZJA 1KPHA 3JQBC 4MGKR 4NATA 1KO4A 2JLVA 2XUHA 2NTVA 4G2NA 3RSSA 3Q9UA 3K73O 5F1PA 4F3RA 1FZTA 1PL6A 2BR3A 3KB6A 3LIPA 2WF9A 3KYDB 5M34A 3VR4H 3BFXA 3P5SA 3RYTC 1I9CA 4A0FA 1MXFA 4RK1A 3HYSA 3M1AA 4G7XA 4OM7A 4K81B 4BKUA 5K4HA 3HU2A 2QE7D 4D9KA 1EUCB 3NYQA 1RC0A 1XQBA 1V3TA 2RD2A 2E4VA 4O8ZA 4P7BA 4RLQA 4FC6A 4EHIA 3OKXA 2OQRA 2CVOA 3C5CA 2O3JA 5C7LO 5IFKA 4KACA 3RHFA 4F1KA 1ZFNA 2WUDA 4AB1A 2XVYA 1EVYA 1MVOA 2IEDA 4IEFB 1IM8A 2GM3A 4LJ9A 3KQWA 1T4CA 1UEXC 2NWQA 4DWVA 1L5HA 2Q5JA 2ZSHA 2QTBA 3GA7A 3L8YA 4QYWA 3ZJTA 2FPMA 4Y9DA 3W8DA 4BLVA 5BVHB 3VMFA 4J6EA 4D82A 3KQUA 1LQTA 4EH1A 1C0LA 4FYJA 2H1LA 4X60A 3O91A 4JAVC 2C96A 4M9ZA 2GNPA 3UAWA 3RKRA 4NCAA 3A37A 1ABEA 5GADl 1ZK0A 1Q3KA 1TC1A 3R3VA 2FP3A 2ZW9A 9MHTA 2J4FA 3ITEA 1A72A 1FSGA 1DJPA 2ECQA 1BG6A 2JZNA 1HO3A 1R66A 1B1AA 4HEA6 5ES3A 3RV3A 1Q44A 4NS1A 3TVDA 5A4MS 4KO4S 1DC6A 2CLSA 2GK6A 4LMPA 3H8SA 1NAIA 3HG7A 2X15A 4P58A 4XE5A 4G41A 5E0OA 4ZCLA 4LWOA 1N2IA 2ATIA 3D43A 3CCSB 2HU7A 4QV2A 2G70A 2AOVA 3CPXA 1GGHA 1XYGA 3BWMA 3W5UA 4HQLA 2ANCA 2YY6A 2W2PA 3REFA 4P5PA 3IIEA 4KUEA 4YUVA 4D0NA 1PDWA 3DLAA 5T3UA 1OGIA 4S24A 1DG3A 2ZJFA 4PYRA 3Q6RA 4PCVA 2WWIA 1HH4A 4PZAA 1WCV1 5TDHA 5JPCA 2YS6A 1QGAA 1FFHA 4ED9A 3TUJC 4M0UA 4F96A 5BXQC 1KAMA 1T26A 3NOXA 4UTRA 1JKJB 1C1YA 1SKBA 2A9JA 1QLJA 1W0KD 1P33A 4PVCA 1SG6A 4NFYA 3S5JA 4PGMA 3E70C 4D4HA 4YT8A 2IHNA 4A5OA 4TWBA 1K08A 1A9RA 2QNRA 1Z4QA 5EJGA 2JGEA 4HLDA 1L5GB 4HTAA 3RYFB 5AUOB 5C8VA 1RPZA 4F2WA 4D43A 1GZDA 4N3CA 3WIUA 2BHLA 2PMFA 3D6NB 5GZ3A 3UMMA 1XTBA 2OY0A 3ILSA 3S99A 1CIVA 3E3AA 4PSUA 5C7YA 4GP9A 3GXBA 2Q1UA 2W2LD 3K20A 5K3OA 2ZWAA 4GL2A 4D0LB 4HZGA 4P4NA 1F5NA 5BWCA 1RBZA 3NT4A 1QUEA 3CM0A 1JQ5A 4FHEA 1T2FA 3A26A 1QMPA 3NHAA 5DSTA 3QPUA 5IM5A 3F2VA 3VZQA 3O7MA 1G21E 1SBZA 1TF2A 2IITA 3OF5A 4MQEA 4WMLA 4KRYA 1KMNA 1XDSA 2X0RA 4ENPA 3L8MA 5M04A 1M6YA 3OG9A 5KCMA 1PJSA 3AYZB 3VX3A 2D3LA 1G3IA 2Q4TA 2XEDA 3RM3A 3DVLA 3PFGA 3A35A 3B89A 3HDYA 3T1QA 4MYUA 4CMCA 5ADUS 8LDHA 3FHCB 2ZVDA 1X1AA 1M1YA 3QVOA 5IT5A 3WIDA 1SUPA 3AGQA 5B4UA 2ZR0A 2GD1O 1I3LA 4KMOA 1JXAA 3M0EA 4YP7A 5TMBA 2FDXA 1R0WA 3VPAA 2OGWA 4NZYA 3V5NA 1XR3A 1YVUA 4RVHA 3OW2B 4X66B 1J70A 1UZLA 2HH9A 4YCLA 2VNKA 3QKTA 4AXXA 1PQPA 4NF2A 1T5TA 3GDOA 3JSXA 1YB5A 4FHCA 4KAJA 3D4OA 2O2JA 1QWOA 2CRVA 4RPCA 1PGJA 2REXB 4MAMA 4XWAA 3S1LA 1RZ3A 4DLZA 4AAYA 3THWA 2ZUEA 4HL6A 3E8XA 5KVVA 3OOWA 3QBJA 3D6HA 3LUKA 4AMYA 1JJ2B 3I45A 2R1TA 2WEKA 2ZTHA 3KJZA 3T7JA 5CBPB 4KREA 2WIDA 1ZM2A 1EFVA 1T4DA 1E6KA 1I1QB 1KU6A 1L8XA 1YS1X 1CIPA 1CUSA 4IJMA 5JCJD 3KSBC 1XPUA 4MP3A 2F2TA 1QOPB 1T1GA 1E1RD 4XH9B 3TSZA 2QLLA 4QHYA 4K9MA 2GM4A 1YUMA 3OEEA 1PEYA 3VSDA 4DDWA 1P6QA 1JYFA 5C9ZA 3CGWA 3TNDA 2YMLA 4XWOA 3IQWA 2WDPA 4P32A 3CISA 2ZYAA 4OHOA 3RNLA 3R40A 3QLUC 1H8ED 3TL6A 3LKBA 1G55A 2P41A 2P8SA 2QL6A 4L27A 1NBIA 1IC6A 4ZVRA 3ROMA 4DNOA 1CCWA 2ZSBA 1XALA 4ER7A 2Z5LA 5KTSA 4JLAA 3NIWA 1T2DA 2YZ2A 5CLHA 1Z0AA 1JR4A 4UZUA 1EH5A 4LNAA 5JMTA 4W9MC 3F7NA 2Z2ZA 1ZMOA 1TQ4A 3E23A 1FFXA 2GKGA 2NGRA 3IP9A 2JH8A 3KZ1E 4H16A 4D8XA 1W6UA 3OJEA 4YS6A 5IDYA 2PM8A 3GLTA 3R3ZA 4BV2A 3ELYA 2DWUA 1WB6A 3L06A 1UMCB 3EIUA 3GLFB 3MWKA 3BAZA 4O3FA 2ABWA 2NT4A 2XOEA 3VHQA 4O3MA 4PRZA 3DHWC 4AURA 4DCUA 1MCZA 4G84A 1N6KA 3WYDA 1GAWA 1MAAA 3A11A 2FUEA 1N2XA 1UWKA 1DSSG 3HZOA 2MJLA 1B6RA 3Q3HA 4W5RA 4B3IA 5GOZA 4UVGA 2GEDA 5BT9A 4HRVA 2D2FA 1DKMA 3HDTA 3LY8A 4HYTA 1IOWA 2XIQA 5FF9A 1F2VA 1OH8A 1TK9A 2CL6X 4X6UA 3G8YA 3HUDA 3ES9A 1LB1B 2HLDD 4GRAA 4LY3A 4DDUA 3MCZA 5AVWA 4OB8A 4CV1A 1GCAA 2Z5GA 4RLHA 3FOEC 1DTSA 1S2OA 3EIXA 2LV8A 3HEBA 5AW0A 2Q4RA 4XYEA 5DBFA 5JR3A 2XDAA 1XFAA 1YZTA 1YD7A 4RV4A 2JGDB 2RKOA 1GCIA 5HK8A 1W94A 3ANLA 3JWIA 4FR0A 4UMVA 1NX6A 2ONKA 4QASA 2Y67A 1W88A 1EK1A 4NENA 5ALSA 3WLRA 5B58C 10MHA 4I4TA 3D6AA 2RG1A 3VR0A 1W59A 2R00C 3QIVA 4MQUA 4Z3KA 3WLQA 5F1YA 1P9NA 1C9YA 3IX7A 4KIUA 3W90A 2UZ4A 1MG0A 3AUSA 3ENWA 4JP5A 3SQMA 1B0AA 5DW3A 3C3YA 3DDOA 4RK7A 1X70A 5DB4A 3DBRB 3ZNPA 2EL9A 2ONYA 2P4HX 1ZD9A 2MYNA 3DOOA 4MO2A 2NU8A 1OZ0A 2QRVA 3FDFA 1QZTA 4LVNA 2B25A 3FZEA 2Y6VA 3K1AA 1IONA 1YDFA 4I9NA 4QGHA 3TSWA 3H2ZA 2XRYA 1KEEB 1WHSA 2WICA 4MUXA 1SU7A 1B93A 2W58A 2YNMA 1R9GA 5AI9A 1MAHA 2VP4A 3TAHA 4LXGA 4UULA 2P91A 3NQ41 5AK0A 3X44A 1ZHHA 1JG2A 5TLSA 2PBFA 2PFGA 4DHEA 4LVOA 3MWEB 5IM4A 4AJ1A 1QO7A 3G5LA 1EGVB 3HEAA 2DR0A 4FCWA 5HJ5A 2X2OA 4MW4A 4JU9A 2QN7A 4RV9A 1HXHA 1THGA 2QNIA 3S2GA 2B30A 2RHWA 5CVVA 1U2DC 1GT91 3VZDA 4MUBA 3ZGVA 3CTAA 3JD1A 4XARA 1DFIA 1N57A 2IZ1A 3H2JA 3HKCB 4NCXA 4A8JA 3ROKA 1BDHA 3PUIA 4FXUA 1U5CA 5JCXA 2XMPA 4FS3A 3FDIA 3LCCA 4HWSA 2HQ1A 2IIPA 4JC8A 3UUGA 1H05A 1JXQA 4EY3A 1YTUA 1E0AA 3ED5A 1U94A 2AIRA 3HN2A 1V35A 3Q3VA 4FLMA 1U3GA 1N0WA 1ZINA 3OIVA 4WL0A 4KJZA 1L6RA 5FUVA 4YT2A 2XGOA 1U7PA 3GA5A 2B0CA 2W48A 3K1YA 3PXEA 3MEQA 1QV9A 3EARA 2NZWA 4TS9A 3PWTA 5ALLA 2Z2XA 2VT7A 1DC4A 2VHUA 5G2OA 1ZUD1 2O2YA 5AM1A 4FM9A 3EH1A 4PZ9A 2JLAA 4GMHA 1PU2A 3BWCA 1PZNA 3MAAC 3NTUA 2CD9A 3FVTA 2R25B 1XP8A 1QVVA 2D62A 4RK6A 1Q6YA 4AYWA 4NECA 3WJ1A 1QVAA 2F3RA 3H1BA 4PEVA 3EFHA 3JXEA 3BERA 4MZDA 4IOKA 3KR9A 4NQRA 2XWJI 4WFIA 3CV3A 3QXSA 1VI5A 1IHUA 3MIZA 2DUJA 4MWOA 3OQNA 1YL6A 1D6MA 2XE6A 3HDJA 2C1ZA 5B7GA 1Y1LA 3DG9A 3BH7A 1N2JA 4FFOA 4JV5B 4MUFA 1XDWA 4DLSA 3LGAA 4KO2S 3GZNA 3W8RA 1N25A 4OFWA 4DKJA 3E20A 4HWGA 4EP1A 4KPYA 5JADA 2V7WA 2JAPA 4JJEA 1E32A 5HXBA 3DBHA 3KEGA 1Q7BA 3JALB 2QVZX 4MRSA 5A0FA 1X9HA 3TD6A 3KEFA 4A8TA 4KRFA 4AL4A 4AJOA 3GMDA 1WU8A 1M2VA 2C98A 4NEHB 1FMTA 3WLMA 1W48A 1WUIS 3LQEA 2JAUA 3IOCA 1Z6PA 3TVYA 4FR2A 2Q27A 4EELA 5G40A 2HQBA 1P4HA 2RB4A 2R96A 4XGNA 5BQFA 2EGGA 3HI6A 3OTHA 1HA3A 4WKBA 2QSJA 1T3TA 4KGVA 1EGMB 3ZDAA 1T10A 3WLKX 5A4IS 3G1WA 5EEHA 2JIDA 3DE6X 3MTGA 4G6IA 2C5HA 1SXJE 3G9ZA 2VWPA 4KLAA 1XEWX 3RHSA 4B6QA 1QM5A 4S2UA 1ZOOA 4ZCIA 4UTPA 3HGTA 3G1UA 3L8ZA 3S8EA 4K40A 4DGSA 2B9VA 2DQZA 1ZW6A 2J5RA 1T15A 1NQAO 3W8FA 1DUIA 3VAYA 4P0QB 5TQ2A 1RQGA 3Q4GA 3L0ZA 2WJAA 3CC2B 3AZQA 2XD4A 1BQ3A 3H9QA 4QC2A 2DRIA 4R1UA 3WL3A 2PN1A 1P6XA 1TYAE 1T2VA 4JD5A 4HS4A 4W4TA 4YFVA 2EX4A 5FI5A 4XOPA 3VKVA 2OCDA 4AFNA 4I46A 3EPJA 1N2GA 1W30A 3FGZA 3I2YX 2OQIA 3CUKA 4PS1A 4CQMB 3DMYA 4DR4B 3SIRA 1J20A 1U4SA 3WHKA 3UOWA 1TMYA 2FPPB 1YQGA 1QXSA 1E2FA 4IHJB 4KE9A 1V43A 4PLHA 2I7VA 4X1KA 1P39A 2A5JA 1XA4A 2C5LA 4I50A 4JL6A 4AX4A 4LZAA 4LOAA 4RIFA 2E9SA 3SEQA 5FWYB 3LBFA 3A6LA 2Q46A 5C0OE 3BNWA 4LV6A 1CUAA 4KKUA 4RANA 5DT9A 4D4GA 3HABA 3QE9Y 5JWHA 4EEXA 2O2SA 3DM9B 2K5UA 4DXDA 2UVQA 1YJ9B 2V96A 2ZU0C 1G8KA 4HQFA 4YRSA 4G5HA 1GLVA 1IOVA 3AUUA 1AUOA 2TMYA 4RIHA 3VTFA 1QRTA 2HR1A 5J4HA 3A2KA 5KWSA 1ODIA 2CXUA 2FVYA 4E88A 2IF0A 2BDTA 2WUVA 3IKTA 1WVGA 4FYVA 3REQB 3WL8A 3KDPA 1NNSA 4N5MA 4LBVA 4OL9A 1JIIA 2IYFA 1QRUA 1T9GR 3MTEA 5ERXA 3BMOB 3OPQA 3WNBA 1CQJA 2IPAB 4CKBA 4WGGA 4AS1A 1JF8A 4ITVA 1CFZA 3O31A 4JU8A 1H1DA 5F52A 1RABA 3Q1LA 4IDNA 5E6SB 1P1IA 3QM1A 4DIMA 2X42A 1RZRD 3TPCA 3PJFA 1M6NA</