1WU8A

Crystal structure of project ph0463 from pyrococcus horikoshii ot3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
256
Chain Sequence
MITLTTDFGLKGPYVGEMKVAMLRINPNAKIVDVTHSVTRHSILEGSFVMEQVVKYSPKGTVHVGVIDPGVGTERRAIVIEGDQYLVVPDNGLATLPLKHIKVKSVYEIIPDKIRKFTGWEISSTFHGRDIFGPAGALIEKGIHPEEFGREIPVDSIVKLNVEPRKEGDVWILKVIYIDDFGNVILNLENYEKPRTVELLDFNLRLPYLETYGLVEKGEMLALPGSHDYLEIAVNMGSAAERLNVKVGDELRVRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PH0463
publication title Crystal structure of project ID PH0463 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
total genus 65
structure length 256
sequence length 256
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 1wu8A02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 1wu8A01
2C5BA 2C4TA 2ZBVA 5B6IA 2CC2A 2CBXA 5FIUA 2C5HA 2V7XA 2V7TA 2V7VA 2ZBUA 2Q6KA 2V7WA 1RQRA 2V7UA 5LMZA 2Q6LA 2C2WA 2Q6IA 2WR8A 1RQPA 2Q6OA 4CQJA 2F4NA 2CW5A 2C4UA 1WU8A
chains in the Genus database with same CATH superfamily
4OI4A 5E7MA 3DO8A 2EJUA 4GOOD 3EZNA 4D4JA 1PR1A 1SIOA 4GS5A 3WMXA 4P58A 4IOLA 3VHQA 4BS9A 5E6RA 3GUZA 1CS0B 1E2HA 4RA9A 3AW9A 5C5CA 3DE1X 2VAWA 1DXYA 4H0NA 1BFKA 4L2IB 5JALA 1QIKA 3PF8A 3QFFA 3WLLA 3B1YA 3I05A 2C7QA 2FU5C 4Q3EA 1V45E 2BCJQ 1EJBA 3LC1O 1MABA 1E4OA 1XD9A 3IPLA 3MVEA 4GWGA 4RANA 2H3EA 3V7FA 4HYQA 2O5EA 4QXRA 2W7TA 1DG3A 2X0KA 1E9BA 1LPSA 2PLRA 3BRWD 1E9FA 3P0FA 5K6RA 4G0OA 1B14A 1KR5A 3FTNA 3G79A 1YFLA 4Z1MA 1X9IA 4BXOA 2BHLA 2Z09A 4XIIA 3UGQA 4G4IA 1TTTA 4WN3A 2Y92A 3GGOA 2MJLA 1AQLA 4XGRA 4Y6RA 5JV5A 4R16A 2EP8A 5HHTA 5I45A 3GLIB 1XZ8A 3HE3A 3VPAA 4FNGA 4RK5A 3HAGA 4RK7A 2YDYA 1ZINA 5AO9A 4DWWA 1VSVA 1ZI9A 4D57A 1FOEB 3DTVA 3N7UA 3QTTA 4KQ9A 4XWTA 2AOUA 3P0EA 3W7VA 5HUQA 4U0KA 3ICOA 1BCRA 2Q99A 5AVWA 1UJMA 3N0WA 3EIOA 1AHIA 4MVJE 2O2CA 2UUCB 4F1KA 3QX7A 3UAOA 3H18A 3NAZA 4HNQA 4YPFA 1RQLA 5BVHA 2VYQA 1U99A 3ASQA 1G291 2ZAOA 3R0XA 4ZDWA 3WK4A 1U94A 3TGWA 1H69A 5ADVA 2OBRA 4P34A 3R9KA 3U80A 3A7EA 4BN4A 4BVFA 3C3EA 4CG2A 4I7EA 2BBOA 5EQTA 2OA0A 2X0DA 5AW8A 1Q21A 1RDFA 1X77A 2HYIC 3I4LA 1HA3A 1N8SA 2ZZNA 5KDLA 5FHRA 3JQQA 2NU9B 3J81k 2JFVA 4TYPA 3ROZA 3HCDA 2TMYA 2WT8A 1VL5A 3V48A 3FZQA 4B8ZA 3TAXA 2VBVA 3NKLA 3OE5A 3AUXA 4WXPA 3G85A 3GW8A 4B8YA 2G1PA 3KSDO 3KR2A 3CEHA 3SBXA 1YK0A 4ZC8A 1FYWA 1JU9A 4DMCA 3CLSC 5A4DA 5J58A 3A6FA 1XRPA 1WUTA 1VXRA 2CFTA 3Q9NA 1DADA 4I99A 2XVMA 1RWVA 2ZWVA 2B69A 2FTKE 4NAUA 4RIEA 4YROA 5TQ2B 3FDJA 4YDQA 1DS6A 1YRQA 2AYZA 1ADBA 2GETA 5BQ5A 3UWDA 1DG9A 3QKWA 2WHRA 1OHHA 1LBTA 4BNDA 5JQGB 1ABEA 2JHGA 1OWOA 3CLHA 3JS5A 4M9SA 4P2GA 1SKAA 3AF3A 3KZVA 5FPYA 1TCCA 5EWLA 5LWHA 3AFIA 3V2GA 2LIPA 4BO4A 1CRZA 4B2PA 3JYOA 4M3NA 2WA2A 2OCAA 3KJZA 3KZKA 2F1LA 4OATA 3K20A 4BCBA 1SKMA 1D1SA 3HLKA 4ZK6A 3AI1A 4ZQBA 1JG2A 1V8PA 2JIMA 2DU8A 2O0JA 4RF5A 1BDHA 3B51X 2HBQA 4GR4A 4IHJF 3IMCA 3OM1A 4OJKA 3DE7X 1LPNA 1W59A 5CVJA 4HVTA 4UAUA 4ZO7A 1JR3D 4ZI7F 1KK0A 5CDYA 5ITWA 1ZUIA 3ZD6A 1V3VA 2PZLA 3ETCA 3LFHA 4HN2A 1KP2A 1SXIA 3TUIC 2O2GA 5DM1A 1V1RA 3BD9A 1E6UA 2WU4A 3KOMA 2BY4A 3NWOA 6CHYA 4YP1A 3OTOB 4P83A 1X8LA 3O38A 3Q6IA 3VVLA 4HEJA 3ROEA 5K05A 3U4CA 2BE7A 2FZKA 3RS9A 1BQ3A 1G2PA 4N1AA 2X22A 4Z7JA 1YMVA 1OAOC 3QXHA 4LMBA 5I7UA 3DOFA 1WUYA 3OEHA 3C6XA 1R0WA 3K8ZA 3OETA 4AP6A 2UVPA 1WXFA 3BE5A 1BN7A 2PMEA 2FMKA 1M0TA 3I58A 4W1RA 1USWA 2VRNA 1U5AA 4BLPA 5FPHA 4IUCS 5LMUB 1L4MA 2PBLA 1GGEA 2ZB7A 4N7MA 5A0VA 4NFHA 3I52A 2PWPA 1AMUA 1A9RA 4D2IA 3AYZB 5EIEA 4CKWA 1XCJA 5ALYA 3MT9A 2HA7A 4O4LA 4X41A 4GXNA 1ZIPA 2CY0A 2AUMA 4Q4HA 4A8TA 1Y6ZA 4B47A 3BWXA 3M70A 1NY5A 1NKTA 1XTQA 1Z5GA 1Z38A 3BD8A 1Q2UA 1UOOA 4FFWA 2R60A 4YC7A 3DE3X 2N1BA 5ALQA 1JIUA 3ZQUA 3K0KA 5TR9A 1PVOA 2XNJA 2AKYA 4GMDA 3NYQA 4MGKR 4XRRA 1QFZA 1HNNA 2EYUA 3N28A 4LZNA 1OWNA 1MQ8B 3ZHVA 2WHPB 3LZDA 2JN9A 4W1SA 1RTTA 2I80A 2JVJA 3RBZA 4HC4A 3PE3A 5AQEA 3SXUA 4TN1A 2P2YA 5B57C 4TKVB 1H0KA 3AUKA 3MWEA 4TVBA 1O97D 4ZDKA 4M86A 3RS3A 4D56A 4RA6A 1N3YA 1BMFA 4LRYA 4B74A 5AW2A 1JFVA 2K7ZA 3E1KA 3HP7A 3AI2A 2EJBA 2C4MA 3HJTA 1PSWA 4E2WA 1BDJA 1P9NA 1RXIA 3L05A 5JXGA 2W6ZA 2UZIR 3WYBA 4Y98A 2YKGA 4OB6A 3JQGA 3H2GA 4KGVA 5CFNA 1LBIA 2DC1A 3QU7A 5ELMA 5FBLB 4X66B 3NM6B 3DL4A 2GF9A 5BXQC 4QATA 2MYNA 3ZWKA 4YAOA 3OQOA 4RPDA 1PYGA 2A0FA 2L42A 3CR7A 4FFNA 1QH1B 3EXEB 4J1TC 3H2SA 4A5OA 2B25A 1NPYA 1RVV1 4G0VA 4C5BA 1J0DA 3M8KA 1KFBB 3SG0A 1T4CB 3T1QA 2YVAA 3OPVA 4HDKB 1H66A 1Y0BA 4HX2A 4NZZA 1UBMS 1NTRA 4FGJA 4OU4A 5G53C 3DHWC 5GONA 3WKEA 3G7NA 4MCAA 1Q5PA 3M1YA 1P6XA 1XMOB 3SZMA 2BYTA 3ENQA 1YB5A 5KU7A 4WUTA 2LKDA 5K4HA 2B3DA 3X1KA 4K9PA 4YMWA 3WFIA 4AJPA 1F6BA 2CYAA 4RE5A 5LZ8A 4EPXA 1XEFA 3ZC3A 4KPGA 4XUDA 3V4VB 2A5FA 1Z74A 4O59O 3DJYA 3UV6A 3ZD7A 3NV7A 1YASA 2HEGA 1VPVA 2J6HA 5K1ZA 4JV5B 5TQ0A 3WMRA 3CZMA 1F9EA 3I1YA 1OY1A 4MINA 2LDBA 4AQ7A 4NECA 1TD1A 1FDTA 2C7RA 5CAEA 1A77A 1QSGA 4XD7D 4NONA 4ZQHA 3GCZA 1KO1A 4YT4A 1ULAA 3AVPA 2VR1A 1T25A 1XFDA 3GL9A 2E55A 3DGEC 4OP1A 2J31A 2R85A 4X95A 3H42B 3H1BA 5A5FA 1CRWG 4HDNA 1S5PA 2AL7A 4F6CA 3ABOB 5JUWA 3L8GA 5HKKA 4W5JA 4CR8A 4W9MC 4R84A 2EAUA 4QDTA 4OYRA 2RHLA 4EAAA 5IN4A 3T1OA 1FRZA 2X5XA 4NG4A 2HSZA 2JIRA 2O0LA 3INRA 4NY1A 4UTXA 2IH4A 2QN3A 4URZR 1P62B 4W1PA 4EGJA 5UKDA 1N0WA 3OG9A 2V7QA 4LHWA 1W8IA 4ZZIA 3QF7A 1UZMA 1T29A 1XC7A 3GJ5A 1JAIA 3KPWA 4QJ3A 3EVDA 3IV6A 1QG6A 3T1HB 2JARA 3QF4B 5LUBA 3HXQA 3KTDA 3EG9B 1VHOA 2HL6A 3NU1A 3QRWA 4DCTA 4CLRA 5FOQA 1UDXA 5L4LA 3P45A 2P69A 3S8YA 4ARSA 3QOXA 4FFLA 2QZZA 5EI5A 1GCAA 4ND4A 2ZI4A 1PS0A 4M38A 4ZOLA 1SKQA 1WMEA 2OUIA 4PGAA 4A2PA 1EHCA 1KJYA 3GA7A 4ZYYA 2RARA 1M6HA 2H6EA 1CLEA 3MOGA 4CEIB 4BATA 1P18A 3CCQB 2GAFA 1F5SA 2GVZC 3D5EA 4FOOA 3H9JA 1K5HA 4YGXB 3S5UA 3WP0A 2O7SA 1KTVA 1ILWA 2JCGA 3AR4A 1JG6A 2H63A 4LCBA 4KDCA 2Q4BA 2Z4RA 1H2EA 1RC0A 2I03A 1XMIA 3GBSA 4LOLA 4D9BA 3X3HA 4JZYA 5CIQA 3PPWA 4LDAA 2DSNA 2P0AA 4HEA6 4OL9A 2WBLC 4URXR 1QGOA 1Y4DE 2GJRA 4GQNA 2NTJA 3PPVA 1ZAYA 3U3XA 5JD3A 2P6PA 4UHJA 2EFJA 5K0NA 5KOHA 1YH3A 2MIIA 3WGLA 5DIZA 4C22A 4TL6A 3KYIB 3ZHQA 3BHJA 4ENUA 1UMCB 1SBYA 2VL7A 2WVGA 1QAQA 3BWVA 5LYYA 3GLGB 4HYYA 5KKNB 4AZ3A 2XQJA 4A8JC 1FFSA 1CR2A 2XYPA 3K35A 1ORTA 3NDIA 4MW7A 2I91A 1F38A 1H93A 3AV3A 2MSDB 3CC4B 4NATA 1RAHA 1UP4A 4FHZA 4F38A 1ZOIA 4J07A 4AJ9A 3E84A 5MHTA 3DNFA 2GYYA 4WT7A 1I7SB 1E0SA 4FGUA 3GRFA 2CSUA 2CJYA 2EW8A 4A0RA 4F85A 4CL2A 1U8XX 2BZ0A 1PVVA 3GLHB 3R20A 3R24A 4RMGA 1LLUA 1UMDA 5ALUA 4AUEA 1G8HA 1LJUA 5BOVA 1K68A 1CUUA 4K46A 5HFAA 4DG5A 3ICVA 4JLNA 4CKZA 5TC4A 1GPDG 2X1VA 2VKQA 1QC5B 3T7JA 1AF4A 1YJ5A 2LCFA 1JEEA 3PVCA 4R2XA 2R8EA 3I2FA 3I6MA 4M0LA 5BUCA 3AUFA 2ZJ4A 1Z83A 3CQ9A 4ID3A 1RAEA 5A3QA 4W8HA 1C8KA 1EB9A 2YN2A 4TXNA 2HW8A 1B41A 3HVHA 3L46A 1LF5A 5L3ZA 3QVGB 4BJ3A 3HZZA 3U7FB 4B7AA 3S29A 3IPAA 2DMRA 4E3ZA 1P29A 4AAYA 2YV5A 3U81A 2W2NA 3J80A 4URUR 2C1ZA 1W4AA 3Q10A 3HACA 4IEEA 3SLDA 2PM8A 2Q46A 4FDVA 3NHRA 2FVGA 2V7UA 1MV5A 3GDOA 3LOQA 3UCEA 1E1CA 5JTTA 2Q5FA 3DZJA 4W7HA 3LCUA 3DEHA 2YASA 1NVMB 2DQKA 2EZ4A 4QU8A 2A9KA 4DYVA 1DGQA 2FN8A 3ZGZA 3E18A 4LG1A 2N75A 2A58A 3MTAA 4FWIB 2XNCA 2BLNA 4DTIA 2B78A 2NUPA 5CYOA 2Q41A 4S0ZA 2XOXA 2Q3LA 1DJLA 4KWCA 4MDHA 4PGOA 1JQJC 1PG5A 1ZAKA 2C77A 2CVZA 1S2GA 2HHAA 2PKEA 2Q3FA 4KIWA 5T57A 2WY2D 3TFOA 4CKBB 2HAEA 4A8HA 5FI1B 4CKYA 4DA8A 1VBNA 5REQA 3JQ8A 3RKRA 4PRZA 4B2IA 2B6NA 2PSFA 3UWMA 1E3TA 2ZVQX 1TMGE 4UNRA 2FR1A 3K1AA 5DNUA 3BH4A 1GA4A 4FK8A 3WLPA 4YJ2F 3BYZA 2J0SA 3ETEA 4L8WB 3RAJA 3EZFA 4Q1DA 4N7JA 4F4HA 1OW3B 1P4MA 1PSZA 4G5GA 4XAQA 4OI0A 4HJRA 2EWVA 1B74A 4QUJA 2R3SA 4GIBA 4P4UA 4HMOA 1JHUA 1E92A 4S24A 3HDGA 5LMCA 4IOMA 5D6OA 4E46A 4EW1A 2WJVA 4BASA 2O1EA 3B48A 3BA1A 3CEJA 4ERNA 3T9AA 4QX6A 1VIAA 2PEYA 1ZIYA 1NULA 2P1RA 4ZN6A 2BWJA 3GEBA 5AM0A 3A6DA 2ZYWX 2NQ2C 4JL8A 5J1SB 2VHEA 1QO7A 4LC1A 1X14A 4K6GA 3HWWA 5C1IA 2C9CA 2W42A 4GPEA 1BHO1 3A58B 3KVNA 4CLOA 3VV3A 6REQA 2Y66A 1UPBA 1A96A 1NP6A 4Y2HA 4QELA 5CK5A 4NOMA 1R8JA 1BYUA 1O3YA 3QVSA 2ABWA 4LN1A 4TQ9A 1L1RA 1ZRSA 3JWHA 3Q2KA 2OB1A 3OF3A 4YCNA 1J2RA 1L1FA 3VHRA 1XZAA 3LQ6A 3IJRA 4JFAA 4JI1B 4DREA 3GAZA 3AIKA 3DMGA 5DLPA 4GC5A 4KGDA 1KE1A 5F78A 1NONA 4QOEA 1CZHA 5FBHA 4D9EA 1JH9A 1G8FA 3CC7B 2I9PA 3SC4A 4BDSA 1S01A 4FLMA 1JPJA 1T1RA 4PFSA 4RESA 4U9HS 3DE4X 3VKUA 1GG5A 4ENRA 3KSBC 1ABFA 1L5SA 2C31A 2VF8A 4LJ5A 4ZTBA 4YUWA 5CFZA 3I62A 4H7EA 1VBKA 1E4EB 3G59A 3ZX4A 1ICIA 4UULA 3V34A 3M1LA 4C0HA 1FP4B 5H80A 1I4EB 2P5SA 2B36A 1AURA 3RROA 3BMOB 5I9TA 3UMGA 4KP7A 2C2BA 3AI3A 2GNAA 3TZ6A 1ADGA 3WY9A 3EMVA 2Z9BA 3K9GA 3TR5A 1I1QB 1ONPA 3PEYA 3RUIA 5BSRA 3DGFC 1U0FA 1N8TA 1NU8A 4Q16A 3TRJA 4UTPA 1VSBA 2WSLA 1C3JA 3AR8A 3K6SA 2O5CA 4UOZA 4CUKA 1JIVA 4S1WA 1WABA 3S44A 4RMNA 5KWEA 3NTLA 2NAFA 4KQWA 3JQAD 1L8XA 3LHSA 4X3PA 2X8KA 1FDVA 1PVDA 5GGXA 4MV7A 3OA0A 1A88A 1QHIA 1E89A 1JR4A 3FKJA 4Y9RA 3PDUA 2E4YA 4KSYA 4PZYA 3W5AA 3KYDA 3GLFA 2BP7B 1ENZA 4B0OA 5THKA 5A89A 5DBHX 3SJCA 4XI9A 3B8HA 4CI9A 3M83A 5IT0A 4YGYA 1G18A 4MA0A 2YRFA 4RTSA 3RLIA 3DDOA 4DARA 1G4HA 2H85A 2IDMA 3IELA 3KT3A 4V38A 3V8VA 2ZANA 3X1WA 1NW7A 3G5TA 2RH5A 2OHIA 4YO7A 5B4VA 5CD9A 1J1IA 2BUCA 4PHGA 5FR1A 3L77A 2LTAA 2V6BA 1XB2A 1WP9A 3ZDCA 3T7EA 3CNNA 4JZKA 2CMGA 5ADUS 1B2RA 4YMTA 4PONA 3EFHA 4I8IA 4L6AA 2JW5A 3RRXA 3E58A 1AV7A 5CLQA 1UPCA 3EWAA 4FGZA 3A1VA 3K5HA 3L7CA 1P7WA 4FNMA 5HCUA 5LXTF 3UB4A 1WXXA 3S70A 4AKEA 1XA3A 3K0AB 4AJEA 4UKDA 2A88A 4FINA 5BV0A 1EJ6A 4IDCA 2YHIA 2FY8A 2XVYA 5D5PA 3GLQA 4ZO9A 5T8KC 4P4GA 4NAVA 3TQQA 1K28D 2QR3A 4ZYVA 1E58A 1DC6A 1ODFA 4FEEA 5EIHA 4X1KA 4B9EA 1CDEA 3AZPA 2QN1A 4ND3A 2W6ID 4BNIA 1E3IA 5AVZA 4UZSA 3DOUA 4GI7A 3A10A 3STUA 4O5AA 3NRJA 3DYIA 1C2YA 1DPFA 1CE8A 1T9KA 1VZ3A 3DHEA 3OESA 4GO1A 2IBTA 1CBUA 2KSQA 4S35A 1WOSA 1IY2A 2V58A 3A05A 1KVRA 5IVIA 4BMSA 4D9CA 1D5CA 2ODQA 4MEBA 4DR3B 1VE7A 5F9MA 1P6UA 4R69A 4DV7B 4KJXA 1G2IA 1FVXA 1KDTA 5DO9A 4BMVA 2E1RA 1W1IA 3GJQA 1PRYA 1R6TA 2A2ZA 3WLOA 4BB6A 4BKQA 4KIGA 4PBTA 1AMNA 4KACA 5BRNA 1C9EA 4Y2QA 1ZNXA 1PZGA 4DMGA 2GM5A 2WK1A 4CMEC 1QQ5A 1SFRA 3W9BA 2HCBA 1BQ4A 1BVRA 2A57A 4AUKA 4EG5A 1QYVA 4DQKA 3Q8XB 4XGIA 2QX8A 1II8B 1T2EA 1UDBA 1ZX1A 2SICE 2QF7A 1IL0A 2XNDA 1Q1AA 5AKEA 5TARA 4W5OA 3V9PA 2EHJA 4EYGA 1ZSYA 5AKLA 1H8ED 3CUTA 4GAEA 3C3JA 4LYHA 4TWRA 1LKZA 5DH9A 2OORA 1VA4A 4Z4RA 4XDYA 1E96A 3JQFA 3I5YA 3KKOA 1JFTA 1EUYA 1DAGA 1V8ZA 5CXQA 3TBFA 2JPDA 4FM9A 3R9XB 2RHJA 4M1TA 4RK1A 4W5WA 3BC1A 2G7ZA 3B1KA 4X1OA 2EIXA 4ZXPA 4YXWD 4TWJA 1VFPA 2AXQA 3IURA 4FC6A 1SU4A 5F21A 8AT1A 2XQFA 4BZXA 2VNHA 3LWBA 1SBZA 1Y3AA 4RPJA 3A3PA 4PAGA 4ZAGA 2OYCA 3W90A 1FUKA 3PX7A 2WUWE 3VHXA 5HIIA 3ZVLA 4D9MA 3PNMA 3VPSA 4BQFA 1V7QA 1LFDB 3DHNA 1N1MA 2JK0A 3FHOA 4LYDA 4YRBA 2I5PO 2ZM5A 3ZDBA 2E3JA 1FZTA 1H1LA 4TL9A 5G4LA 3UKOA 4M87A 1I5EA 1C1YA 2KW5A 4MHSA 3BL5A 4DEVA 3Q3JB 2XE7A 4Q34A 5IABA 3H11B 4CETA 3U09A 3JRXA 4K5QA 4YQYA 1SZCA 2AHRA 4ARVA 3ZJTA 4DNFA 4F9FA 1N9KA 4BX2A 1XA0A 3WGQA 3WIEA 3DBRA 1NJ5A 3GDWA 2D5CA 3T34A 5A4MS 1B0UA 3FCYA 3LC0A 2C7GA 2J59A 3E9NA 3P2JA 5KCMA 4LC9A 2OMKA 3RTAA 5JCJA 3WK8A 4RSGA 3EUAA 1DLJA 2OESA 4MW6A 3VZBA 1ZONA 3MRVA 1ST3A 4UXIA 3A6PC 5JWRA 4BKOA 3TQSA 4DGQA 4A8PA 1FY2A 1S9HA 3NPAA 4WZEA 5TT1A 4C3VA 1R6UA 3CIFA 3Q1KA 2SCUB 3I8XA 5GINE 4JB0A 3NG1A 4E4TA 2BGJA 2WWWA 3DV0A 1IN8A 1JHZA 2JEYA 2VJMB 4L8LA 5CG1A 3PFIA 1GQOA 3ABQB 4LYGA 3HWX1 3OIYA 3BAFA 2QM8A 3L6DA 4HAVA 3R3JA 1AS3A 3K15A 4MUHA 3UKJA 1RR6A 2W4IA 4XLAA 5DYNA 3AGPA 2CHEA 5DM2A 1H05A 4LXGA 3OAAA 2XWQA 1I6WA 5F1YA 1UDRA 4R9RA 4Y2UA 1WU8A 3VTAA 5JNSA 4DUGA 1E7WA 1THGA 3L8YA 4UFOA 2H2HA 3REQB 3GZNB 3ZJYA 1BWRA 1E2IA 4UD2A 6AT1A 3OLVA 2NVBA 3HGMA 4IJ6A 4ARUA 2CHQA 1KU6A 1NI4A 1OBHA 1T5HX 1UIMA 2OCDA 5LOVA 3KB8A 3EGIA 2MINB 3LFUA 2ADMA 1E64A 1AGRA 2EKQA 2IKQA 2ZKLA 4PE5B 1U3GA 1L4FA 5TMDA 4MYHA 3RC7A 3T4UA 3AB3A 4C29A 2H4HA 4DA6A 1Y6QA 2IXDA 3W4KA 3EEYA 2Q27A 2QRHA 4ARIA 4G8BA 4JAVC 1I0LA 4MUEA 3DKRA 4N3AA 1FFBA 4IXNA 1EM8B 1TIBA 2VDQB 3C7KA 3I55B 5CCBA 1CETA 1ZUNB 1Y9ZA 1ECGA 1EE9A 4PZCA 1E3EA 2DPMA 5KJFA 5CA1B 2JAUA 1VCMA 3R41A 1QIEA 3GFPA 2E9SA 1X1QA 2ZVPX 3QYPA 3R3VA 2DBVO 1NJID 3H7AA 4JWKA 3H5IA 2H9YA 4FU0A 3LPCA 2H4XA 3H1PA 2R6FA 2F17A 5EWMA 2AFHA 2QB5A 4U6NA 4CF7A 1DC5A 4NHEA 2VSOA 1CFJA 4Q47A 3WKAA 3FE2A 4JUFA 3RVKA 2ASVA 3HVRA 1DAIA 1EZZA 3RYIB 3GLTA 2WPNA 1WPGA 1HH4A 2WZDA 3I04M 3N8DA 4D26A 1CF4A 2WV7A 4H59A 3VX3A 2O5VA 1YSCA 2G5GX 2C58A 4FW9A 1RRGA 5E1MA 5HWSA 1WOMA 3A1PA 4UATA 5IZCC 4L9SA 2Z04A 1LLQA 2JGDB 5EXXA 3C7AA 1EFRD 3NUQA 2GN9A 2QTLA 2QJOA 2GD0A 2RHWA 2ZBDA 3BGVA 2EFCB 2PRIA 3JZFA 3KHTA 4Y67A 4OIFA 4NPCA 3P0RA 4MAFA 1Q1EA 1R5JA 2D3NA 4OFBA 3WRXC 1Q0UA 1PR5A 3HBNA 4U2BA 2C8JA 1W9HA 2JBWA 2REXB 3GGCA 1VJRA 1QWSA 3A32A 1BNCA 2YQ4A 1K92A 1ZCBA 1TYZA 2JRCA 3TAHA 4XOTA 1B16A 3E2PA 3PJFA 3SAJA 3PT9A 4N47A 3OQMA 1RQPA 1ZGJA 4MRAA 3QFRA 4M2LA 3KB2A 4PY2A 3SSOA 5A4KA 3TO5A 5KTNA 1WPXA 3D5TA 1FMTA 3D3WA 4RHUA 4CT4B 4CF5A 4JI0B 4KMOA 1QR2A 2GXSA 4HLUA 5ECDA 2QTVB 4LGCA 3MOIA 3TNYA 5EG5A 4PLTA 4DOMA 1D8AA 1Z15A 3DV2A 3SZGA 5EGSA 3M1IA 1VCNA 5K6AC 2ZB3A 2MMGA 3FPEA 4S12A 1BS2A 3NM4A 1D0SA 1Y3HA 1BH2A 3COSA 3EXIB 4MS4B 1R1DA 4R71A 3MQ4A 1KZ4A 5F3DA 1WDLA 4HGOA 1Z6AA 3AHHA 4KXWA 2NXCA 4AZSA 1YZHA 4QXAA 1G5IA 1MQ9A 3ZDFA 1X92A 1CZOA 4OFZA 4GLJA 4ONEA 2EKZA 3CVJA 3L1UA 1XRMA 2WHYA 3T3DA 2KE5A 4LFCB 5LPNA 1JECA 3WSVA 1S7CA 1PW5A 4LCJA 1JLHA 2JFFA 5CLFA 1ORVA 1UJ4A 3FWNA 3STWA 4TKUB 4DNPA 1CG6A 1TAUA 3H83A 3A3NA 2X3YA 4Y6GB 3ZWXA 4IV5A 2BGNA 2VHYA 2VA8A 2F59A 3LUKA 1P2SA 4AF6A 4Q9HA 4B3HA 4JI7B 3O8QA 3TF5A 2B5WA 1JAZA 2IYZA 1U1CA 2ZXEA 5DV9A 2Q2WA 3GRZA 1Z5WA 2FUCA 2ZRNA 3Q5EA 4PLYA 4ZOCA 1SCQA 2GCOA 3PJGA 1IDN1 1JYSA 3JZMA 4L0DA 1DC8A 7REQA 2ZYAA 3I64A 2QDKA 4IIDA 4RVCA 2NU7A 3FTFA 3TZHA 5HJ7A 1RKUA 5B2EA 2R5NA 1EVJA 4C7MA 5BMVA 2H51A 4YAJA 3T3GA 2X2FA 1U0BB 3P20A 5I8WA 3EPRA 4JWTA 1KR2A 2FK8A 1WY7A 3WIVA 4K86A 3ZD8A 1RPJA 1UT6A 1A9YA 4N9QA 4ZO8A 4UOQA 3G2MA 4LMAA 5IXJA 1RQNA 4EI9A 1DRJA 1F3OA 4GGOA 2FX2A 2ODAA 2XQIA 4TZKA 3AI7A 2OILA 3GLFE 4XN0A 2BOVA 3PEVA 4PXAA 4D6YA 1ZIOA 3ACBA 3KOUA 3ICPA 2OXCA 3UK7A 2R4QA 2R65A 5IKXA 1J0XO 4E7PA 5H3CA 1Z7YA 1RHKA 2ZREA 3DBLA 3C5HA 1IHPA 3COVA 4EJSC 3GRUA 3QW4B 4O8ZA 4L5IA 4HB0A 5F7JA 2CLOB 3AV0B 1Q91A 4QNNA 1AUPA 1H4VB 1LRKA 1QH8A 1WCWA 1Z4LA 3DEJA 3TINA 4ROXA 1A71A 1HKHA 5ALRA 4QEDA 2QGFA 4EL0A 4QYWA 1HYHA 1EM6A 2C97A 2NTYC 3BWMA 3ROMA 3U17A 2A9PA 1O8CA 2YFHA 1SQ5A 5J4KA 4OQNA 4XM2A 4ZEWA 1FNDA 3OJ0A 3OQVA 2VF7A 2AI2A 3C6BA 2C4NA 5F2KA 1SQGA 3P9YA 3TRFA 1KY5A 3ZG6A 1BRTA 4RELA 1GARA 1K7SN 5JS2A 3TNJA 3O7WA 1Z16A 3SD7A 1OYWA 1BQEA 5TQJA 1RI1A 3QOYA 2YWJA 1ILEA 4Y30A 5CH8A 3ROXA 3KZCA 1YHZA 2R25B 3G8AA 3LMKA 1Y1PA 4GMFA 3RDPA 3WLSA 1T26A 1ZYUA 5FPTA 4DPLA 3BAZA 5AI6A 4M8KA 5IP5A 1MMFB 1T10A 2GTPA 1KI7A 3AY6A 1FP7A 5KI6A 1FFXB 3EGWA 4Q7KA 1YF3A 2GYWA 2W00A 4WW0A 9ABPA 2J3MA 1T1GA 2ECOA 5BWBA 1KSHA 3HZRA 3WL7A 2IU0A 2ENUA 2VOEA 3BSWA 3M34A 1NZFA 2HYDA 3QWIA 4DDVA 1BRMA 1Q1NA 2IYSA 4JELA 3L0IB 5KMGA 1XCOA 4JLSA 3WB1A 2IY9A 1W35A 3AP3A 4DT1B 5EIBC 1XE3A 2GDJA 5D86A 1TDJA 2QUBA 3EEQA 1K8AD 4MCHA 1L7QA 4OYHA 2C7PA 3TMKA 1H4TA 4QJ5A 1A98A 3P9SA 1O95A 3D6NB 1F8YA 2DUMA 1WTHD 4LUCA 2O54A 2ZM6B 1MU0A 1KZLA 1ZJZA 2EATA 1IY9A 4LNAA 5I9LA 3ZX5A 4UBJA 3I2IA 8ATCA 3PPYA 1W2GA 4CIAA 2NM0A 3CC8A 1ND5A 4DR6B 3IRUA 4KN5A 5LM3A 4FD2A 1WLYA 3TM5A 4D45A 4OHYA 3LNNA 4O0MA 1OXSC 3ZE6A 2VBGA 2CHVA 1V8FA 1V2GA 3MINA 2PKRA 1OYYA 3K31A 4WADA 5D87A 3KE8A 4R2IA 2PCJA 2AE2A 1WVMA 4E31A 2ZRPA 3HSYA 4OV6B 2OHJA 3P0HA 3ZLVA 3PDHA 3WYEA 3RC3A 4MTCA 2DTEA 1KSFX 2PVPA 5EHQA 4D4LA 1TZCA 2J07A 3KWJA 4JHLA 4N5LA 2JI6A 1S8NA 3HJBA 5C7IO 2DQZA 1DKUA 5JSZA 2GX6A 3CNLA 3VPHA 3WIUA 1H0SA 2P40A 4PR0A 3UAVA 3RKSA 4F6RB 1A8QA 4AKTA 1RTKA 5CHYA 1U04A 1NV8A 1CB0A 3R0QA 4TN5A 4D1YA 2E82A 5I8PA 2RI0A 3EBLA 4ZVQA 3DFZA 2QXUA 3NGMA 3OEED 3TLGB 4NESA 2PGIA 2CZGA 2I33A 4IFIA 4R81A 5BNTA 2VSQA 1Q0TA 5B7GA 3CLTC 5FKJA 3SCZA 4C2UA 4N54A 4CCAA 1JA1A 3QVVA 3ZY3A 2QSJA 3FDZA 3HGQA 4LHEA 1U7UA 1SN7A 1HVXA 4FZVA 4YJHB 5DWQA 1QVVA 3T12A 2ACVA 3U9TA 3E9ZA 2YY7A 5D1HA 1W34A 1GWNA 3DL7A 3NHFA 1GZ4A 4XCQA 3OHSX 4WDRA 3ZZ0A 3PX3A 5AHKA 3P4YA 5JSUA 3F2VA 2GH1A 1HQYE 1IB0A 2CEKA 2O8DA 2R96A 4PTYA 3P7MA 4RPIA 2VPIA 4XWOA 1TQ8A 1NF3A 5THQA 4ZIRA 4LBVA 2FMXA 2Z2ZA 3OUUA 2I0FA 3T52A 1T5EA 4TV9B 4PTLA 3OU7A 3TNFA 3DMTA 2ZATA 4E5UA 2XYVA 4TXLA 5GWXA 4LNUA 3KXPA 3P4XA 1QHYA 1R0ZA 2AJBA 4QV2A 3PJEA 3W3AH 3QA3E 4MB6A 2MR6A 2PL9A 1HZEA 2WAAA 1QYIA 1U65A 3TPCA 3U31A 4NSNA 4OXXA 4TRJA 3NDPA 2BBTA 1XZHA 4Z9XA 3ICQB 3CNQS 1ZPDA 1S2LA 2HTEA 3GT4A 3MELA 3QPVA 1NUPA 1GCOA 2DSTA 2HADA 3I9KA 4BO0A 2VDLB 2IRWA 1L5OA 4FMDB 4J2TA 4MWOA 4NEHB 4QHSA 4B0PA 2V4MA 3VR3D 3GC6A 3F2IA 4MCJA 1SU6A 4YAGA 1VJGA 3AEQA 4CEJB 2P4UA 1PLKA 4GX1A 2IYNA 4KZKA 3HU2A 5DF1A 1J49A 1P7VA 4QPJC 3LG2A 4GPAA 1VQOB 3WLTA 1ETHA 3N58A 2HWUA 3VUEA 3EEFA 3BOSA 3HI6A 3L6OO 3W5IA 3SBEA 5AJWA 3WISA 1P2VA 3DPSA 4JOSA 4RU1A 1HT1E 1M8JA 1Q0ZA 2GM4A 4LRQA 1G8PA 5ILOA 2NU6A 4YREA 4CTMA 1M2EA 1XLTC 3B7PA 1QCDA 2G40A 3C8ZA 3QBDA 4CR6A 2YVLA 3CZCA 4BUZA 4XDZA 4W99A 5I9MA 4AURA 4GPTA 2CZQA 1GTL1 1SBQA 5A2GA 5KVAA 1KEWA 1U0HC 3ONVA 1P5FA 1UBTS 4FZ3A 5DLYA 5HK8A 2CC2A 4NG5A 3TMYA 4RPGA 4AJ2A 3L9XA 3MJFA 4JLWA 4BBJA 1CUSA 4QYTA 2X1HA 4Q82A 3SIPA 5L6LB 1J70A 4KPUA 4LCEA 3K9QO 4DMRA 2QD5A 5E7QA 1JDTA 3E5MA 1CUVA 4EHKA 3O31A 4RKQA 2GRJA 2JLAA 2A59A 3ET5A 1UWVA 1Z26A 2WIBA 4WBNF 2GR9A 4JU9A 3TS1A 3MRTA 1YS6A 1CJBA 2AZ4A 2PPVA 4BEBA 1P1KA 2OBYA 3FKSA 2ZJ2A 3NAQA 4LQ4A 2IXBA 2MYUA 2J3KA 4NIMA 2BFOA 1V3QE 1WBBA 5FPSA 2DBRA 2B6HA 1I7NA 2FNAA 1J9EA 3ORSA 2WAMA 3RK1A 3ZIUA 1H22A 2W2LA 1FS5A 1NV9A 2BFWA 4MDFA 4LVNA 3WKDA 1GG8A 2QXYA 4H31A 3B6KA 3T4EA 4H77A 5EUCA 2DLNA 3V6MA 4H16A 4TS1A 5AI9A 5DE3A 2GPBA 4OXNA 3GWGA 3C2QA 2NP7A 1H8HD 3B9RA 1XSEA 4QOJA 5LYJF 1QIHA 2XLCA 4ZT6A 5B30A 1R4MA 2GESA 1CFZA 2KM1A 3K71B 2OXRA 1R0KA 2A1TR 2CCGA 3FUCA 1DXHA 3DMRA 5SY6A 2R1TB 2YY6A 5CURA 1QVAA 1BHQ1 4RDIA 3WRWA 2CCKA 1YQQA 2BJVA 2HU5A 1P1CA 3C7CB 3ZKWA 3HJNA 4TV8B 4AIIA 1QRAA 3VI4B 3R7FA 1E4YA 4C4PA 2QNBA 4Z4QA 1KORA 2QPAA 3HKCB 4D8WA 4F21A 1MIHA 2DKNA 4WZKA 2EF0A 2NLOA 2RSLA 3EEIA 1WMDA 1IOZA 4X05A 2CXPA 3AYXB 3B3QA 2QAGB 3DMDA 4NDZA 4LHSA 1UDCA 2P7IA 4ND7A 4X94A 1X1SA 4I5DA 5CGZA 1OXMA 3GN1A 2JFXA 4E2FA 1IUOA 3FB4A 2DERA 5EMNA 3UJ9A 1Q7TA 2I6SA 4NYMQ 3IAS6 4YRNA 3QW2A 1ZN9A 2GYVA 2NU8B 4MP8A 4PLWA 1G21E 4ZV4A 4W6QA 5JH7B 4QDUA 4MJ3A 4QNRA 4ML3A 5CU7A 3CVUA 2R6HA 3QFSA 2J3QA 3R5FA 3PKJA 4DSUA 4E5VA 5B12A 5FWNA 5DHUA 1NYLA 4LXUA 1G9SA 1FBNA 2IGTA 3T8YA 5I01A 4EFLA 3K0SA 2DHCA 2GK7A 3EZXA 3A4YA 1G6KA 2PQMA 3SVLA 4UM9D 4P35A 2J6CA 2C95A 3CUWA 1WCIB 2GBLC 3RIMA 4QREA 4F11A 1AKWA 2FWNA 3OZWA 1L8QA 2ZRFA 3A3YA 3CZ9A 1UCFA 4H6WA 3PXGA 3WGMA 5EXSA 4GQBA 1XG5A 3R2JA 5CNMA 1T15A 4N0DA 4WDQA 3H2YA 2OHVA 1PL0A 2R6AA 3FSJX 3SNKA 1TPYA 1PV4A 3QSYA 3V55A 2GZSA 5ISMA 1PDWA 2XTAA 1GAWA 5KYXA 4Q3LA 1VSUA 1KQNA 3X44A 1VQ5B 1VMAA 3UT6A 2O3TA 3QPWA 3TB6A 2OHGA 3FY4A 3LT0A 2BEVA 3LUPA 5L51A 1ZQ9A 4MIEA 2ET6A 2Y9MB 3LQEA 2NUBA 3DVAB 3H5NA 3NFRA 4UVDA 2Z6QA 3PHIA 3NAGA 1T9GS 3UAXA 4I50F 4Y6OA 4RPHA 3QELA 5L3QA 1R9JA 2JFWA 1Z33A 2PXHA 5IC5A 4NCIA 5FWYB 2D6FA 3GSIA 2QRQA 1VYTA 5ALLA 5GV7A 3RJ5A 2XKKA 1S0UA 4IDPA 3E4DA 4OSEA 2BEWB 2YZMA 1W5BA 3FNBA 3H9NA 1FFHA 3IP3A 3PUWA 2JI8A 4AUMA 2QLFA 3FPBA 4GL2A 1K9SA 2HWXA 3AJEA 2HA4A 3OZSA 3T9BA 5LQNA 1CR6A 5CXXA 4XM3A 1X80A 4ITRC 4MI6A 2JAHA 3KO8A 3U4DA 4MQ5A 4XSVA 4RCVA 1PHPA 5FR2A 3DLBA 2ODWA 2ZS9A 1QH0A 4AMGA 4TS9A 3H84A 3IJEB 1DBIA 1X9HA 3O1IC 3UK1A 1J8YF 1H2FA 3BUSA 3QKIA 5CLJA 4EY8A 5AK4A 5HSGA 2RI6A 1E3MA 4G4SP 1DEAA 4JNKA 2C5BA 3OOHA 1JFSA 1CNMA 1M34B 2PH3A 4K0RA 4HNAA 4GBED 1B8NA 2C9ZA 1KIMA 3KQUA 3EVEA 3C4QA 4KH0A 3ZHSA 5JS1A 1HEYA 4NNJA 1SOVA 2C07A 5C5IA 2IXAA 3JD3A 4MIKA 2I65A 2NTEA 3CISA 1DJQA 4GZMA 1E2BA 3EPPA 1XD8A 3EXHA 4I1IA 4XM0A 4GDFA 5B6PA 3NZEA 1CYDA 3U6KA 2JLRA 1FJHA 5IYRA 4G1EB 3RU2A 5HZAA 2X9VA 3CYFA 2HRCA 3IDOA 4IIBA 2QM3A 1GPKA 3DMHA 1UR5A 5F1KA 2BMAA 3A8IA 1ZN7A 3KSRA 3R6TA 1XXLA 4CHGA 4E32A 3GARA 3W7BA 1YJ9B 3F74A 4EQ6B 5BSMA 3V3TA 2OOSA 4QA9A 3A3BA 2XCOA 3WSWA 1FE8A 2ORED 4C88A 1ODSA 1TJNA 3QMVA 3ENZA 2Z8YA 2ATIA 3SZUA 4EKEA 5AM2A 1W5TA 5IDWA 1FP6A 2FMFA 1TF5A 1TAQA 2VH1A 3O93A 1JDPA 4UMEA 1P44A 3NMUF 3WNVA 5CCEA 1YVDA 3KAJA 2Q3HA 1IXYA 2IZ7A 5FP0A 1QZZA 1FUIA 2DY0A 4GWLA 4EI8A 5A7FA 1YZTA 1XN4A 3FLMA 4RQAA 3LPMA 5AOVA 3VOAA 1QG4A 4X7CA 1YI1A 2HWKA 4HL6A 1GJRA 2XUFA 2N46A 4WE3A 4O4JB 3DCNA 1F5NA 3DHVA 1LF0A 3LS2A 1T0UA 1I36A 2BM8A 2WKWA 1RJ9B 2L82A 4MQLA 1VPWA 1MPXA 3WQQA 5E0KB 4YX9A 4M1MA 2DFTA 4QRDA 5L6MB 7MHTA 4LZPA 4QDJA 3VU3A 2IOFA 4UBOA 3LGSA 4FXUA 4N5MA 1JN0A 4EPRA 3VNVA 1AKNA 2GM9A 1HE8B 4NCXA 1DUVG 4KW7A 5AI5A 3VU1A 5JECA 1QGAA 3IE1A 1MG0A 3Q2OA 3K73O 3RVLA 4JVLA 1FVOA 4EIWA 3BQJA 4PSDA 2XDQA 4Q5IA 3K09C 1OFUX 4I9NA 3JW8A 4QT4A 1COWD 2ATVA 5K3DA 4XWWA 4AJOA 1K6IA 4C7OB 4CE6A 4Q12A 5EP1A 2I8AA 4DMFA 2ZSKA 1RSZA 2I6TA 4LF6B 2OZPA 5LZ4A 3NBZC 3KC2A 3Q5DA 4A2CA 2Q0QA 4Z4CA 4KFTA 2BSQA 1ADCA 5LQJA 3OJEA 4EAQA 1M54A 3HKBA 3LQFA 1AB6A 1KBZA 4JKYA 1UD6A 3PUMA 4RDHA 4B87A 1RE1A 3HXMA 4XPIA 2GPJA 3JWIA 1SOMA 2QJFA 3MTEA 3G5LA 3IMKA 4WSOA 1SB9A 4AN0A 3ESYA 2XUAA 2BFDB 2GKOA 4DUYB 1N05A 1C9MA 1JHDA 2GPSA 4UUAA 3W5BA 1CYEA 3DE0X 5ELLA 2VDJA 3R23A 1GA6A 5JZMA 1A50B 1E1QD 1ORHA 4JD5A 4UAVA 2NPIA 3UK0A 1IBKB 2DPGA 4M6WB 1NQOA 2C57A 2EGUA 5TGTA 2KS6A 1V47A 3AHIA 2JI9A 4CYMA 4EGCB 4UCQA 1AK9A 4AG3A 4BAZA 4LF5B 3JYNA 4MARA 4EB3A 1TB4A 2WM3A 3N2ZB 4ZHQB 1U3VA 3MTIA 2I2BA 1UEXC 2R66A 3E5RA 4MR9B 5KNBH 3H04A 3KT6A 3F6SA 2PYZA 3G8BA 1UKAA 3FI9A 4CM3A 4X20A 2PUAA 1O9HA 2Y93A 2A33A 3O83A 3COJA 1MX3A 2SKDA 4W1QA 1OH5A 1WPCA 4JOQA 3TSZA 4L5AA 4AJ1A 2VYNA 2A1IA 2EP7A 1GGHA 4Q7EA 1HFWA 5JZSA 1G17A 3KLOA 2JLWA 1N5OX 3BK2A 1SIBE 2ZJ8A 1NXSA 4IRUB 4OMDA 4OCZA 4BFCA 2XKAA 3F6YA 2WYIA 3TNDA 1XX6A 2OFOA 1BHSA 1D07A 3C6YA 2PX2A 4CNQA 1Z12A 5KYGA 1ZJ5A 3H1AA 4I5FA 3RR2A 5AJHA 3QEMA 2PCLA 4O63O 4XIGS 5EZYA 1A5TA 1V3TA 3QUQA 1LVHA 1OTHA 4KQXA 4YI3A 4F12A 4R0NA 1WB4A 5ITSA 2CUZA 4BVLA 4N01A 3PG5A 5HKLA 2NSYA 2QP9X 3G0OA 4YACA 1OH7A 1T6YA 2WYWA 4Z4SA 2NMVA 3GRVA 4I19A 3TRKA 4A27A 3BWBA 4OUDB 4ZT4A 1P91A 2ZJFA 1L8OA 3AESA 4TSFA 2XR1A 4L9WA 2VP3A 1FJGB 3OBIA 3EISA 2JLVA 2PMBA 1YMQA 3PRYA 3CMCO 1NBMD 4PW0A 4LDNA 1ZOSA 1JDJA 3LPLA 3O92A 4ZCQA 3SE0A 2BC9A 3CH5A 1HXHA 1SQFA 4DG8A 1WF3A 4AYWA 2JAOA 2YXPX 1XK6A 1KZYC 3SLGA 3E7XA 3MTJA 4NMMA 1ZC4A 3PR3A 4J0FA 3NTOA 1S8FA 4Q9DA 1SBTA 2WTUA 5IKMA 3D43A 4DV5B 1YRHA 2WF9A 2DWQA 3C70A 3LUHA 1VIYA 4PC3A 1EWTA 3GF4A 3N0RA 4MKXA 4MTLA 3B9QA 4W8OA 1N2SA 5FOUA 4JT4A 5I7AA 3PJDA 3LT2A 3OO1A 1MJGM 1D6JA 3AU9A 3FWYA 4NYMR 4O4HA 4EVQA 2X53S 3ZZUA 4WKGA 3I9V6 1EU1A 4V0ME 1HM5A 1IWBB 2WE7A 1VLJA 2XW6A 3DMFA 1KJZA 3QTBA 4FDLA 4QKQA 2W83A 1E7RA 4EL5A 3BJZA 1XZFA 3DNPA 3RSFA 4JL5A 4N6GA 3AKCA 2X8JB 3O1LA 3HJRA 1W2WB 1XZGA 3MZ0A 1HKUA 4A0SA 3OQ1A 2DBZA 2D54A 2VK4A 5JI3E 4X6YA 1FYFA 3K4PA 4CTKA 4X8MA 3ADKA 5E0OA 4KI0A 4O2BB 5JMTA 4WKPA 5IT9A 4GEKA 2AVNA 3W8DA 1PP4A 2ESRA 1VJ0A 4INAA 3X1DA 2YDXA 4J0GA 4CCWA 4DAOA 4R0MA 3TUZC 2OTJB 2Q9CA 2RHRA 3OQIB 4WK0B 3A2MA 3A2LA 1WCV1 5DTRA 4O02B 3RIGA 2Q8NA 1CQPA 2VKTA 1B8VA 5E2AA 4KMRA 4B6QA 4PIVA 3RC1A 4R5HA 2PD6A 2CV1A 3U49A 4LZLA 2DH6A 1Y42X 3D8HA 3OICA 2ON6A 4RMHA 4URYR 3T7CA 4DJDC 1O0CA 2ZI3A 3LP6A 5I7EA 3I28A 1ISJA 1EFVA 3FYUA 4GSKA 1DC3A 4B84A 4C6TB 1X13A 3GUCA 3U7QA 1Z0SA 4EY7A 3RC8A 3K2IA 2LPMA 3M33A 3ZIDA 2FPMA 2Q3JA 2W2TA 3KZOA 4KXMA 4LHVA 2R2AA 4D3SA 3B36A 1UXKA 4FCCA 3HUDA 3SKYA 4OI1A 4XDGA 2FZVA 3TIXB 5C31A 2G1AA 3II6X 2VT3A 3CUSA 4ERXA 5EYPA 4HVAA 1YC5A 4TTJA 2CUKA 2O7NA 4Q9IA 1QWOA 2JHCA 1NDHA 4RM0A 2WAXA 3RYHA 4TMTA 1MB9A 4IGFA 3ZN2A 4YASA 4I08A 3RREA 2C4WA 4NCKA 4DNRB 2W8BA 3A6JA 3NUZA 1G5HA 1U7XA 3N0TA 2CLFB 5I4BA 3G02A 2LXNA 3EGOA 1G66A 4TS3A 2E1PA 7YASA 2IEGA 2SBTA 4JB3A 1I0ZA 2CLHB 2QN2A 3FROA 3O3MB 4XPZA 3LAWA 1CPYA 4E11A 5IXSA 4JXXA 3K0BA 2B7CA 1OLXB 1QR6A 1MT0A 2ISQA 2X4IA 3EFEA 4C6SA 4NZNA 2BHTA 1GTSA 3DM9B 5D84A 4F7WA 1AZLA 2X0IA 3ZUGA 1FDWA 3T5BA 4CWAA 4WA7A 1X19A 3VR4A 4HR7A 3CVYA 4Z4IA 3U7GA 1YQDA 2A4KA 3WQZA 1TTHA 3T3OA 3JYQA 5DYTA 3PL1A 3S81A 4OK5A 1SZJG 3CX4A 5WRFA 7GPBA 4H4CA 4RVGA 2FPRA 2ZTNA 2GEVA 3GT3A 1XCGB 3B2EA 3B85A 2Q21A 3OQBA 1EBFA 4PLVA 3PC8C 5HZKA 3TWOA 4K03A 3GRYA 2YHSA 4GLBA 5KZMB 2IXEA 2DEUA 3JQAB 5FLXA 1PR2A 2HBRA 3ASYA 1XVLA 2I6QA 2OUKA 4KLCA 1EBUA 1GDDA 4FGLA 4TWZA 4BNYA 3W9YA 1TEXA 5DHRA 1E1RD 3LDAA 1I2BA 2C4HA 4L27A 3ZGVA 4Z54A 2XD4A 1L7MA 3Q3VA 4CT5A 2XAUA 3T9DA 3A1TA 2FFJA 2FPOA 3M6LA 4ACAA 2HV8A 3NXSA 1JR3A 4HF7A 4MMYB 4MWDA 1NJGA 2KQUA 1UM9A 4M1EA 2O1XA 2BFFA 3EDYA 3TLYA 3OT1A 3UXHA 4BLQA 2ZJ3A 3CVXA 1PQYA 1T36B 1SPBS 2ONKA 4LDJA 5JY6A 3P9RA 5KPDA 3KU4A 2FVXA 2O3RA 4OB7A 2XIQA 2DF8A 3ED1A 3QOFA 4IR7A 1NVFA 4EK9A 1Q1GA 1LUAA 3VU9A 2PX0A 3D7KA 4EUSA 3PXCX 1I2CA 5H4GA 1AGNA 2IODA 1U2GC 3G0HA 1YZUA 2IZZA 4P4LA 3H8JA 3NEJA 3UT0A 3P4UA 4I9GA 4MICA 5EIAA 5H0IA 4ENQA 5JLAA 5CB4A 2HBYA 3IT0A 4PHHA 1C1XA 1DBVO 1H2HA 2E4AA 2JI7A 1JV2B 2V0CA 1N34B 3AM5A 1BGWA 3TW8A 1MRZA 3DKVA 2XY4A 2VQSA 4G37A 5KSWB 3RBAA 4PZZA 3MFYA 5C2JB 3S2GA 1J24A 2D5BA 2RH8A 3B1VA 4O4LF 2G36A 4Y8VA 1N1EA 1X8XA 1SKYE 1F2TA 1FYXA 2OT3B 2ZDQA 4GG1A 4PWYA 5JAHA 3H1FA 3U5TA 3I83A 1TL7C 2D5AA 4OAOA 2OGWA 4YCJA 3TZCA 4ZHSA 3LUJA 4RK0A 4AKGA 3ANMA 4TMFA 5E7JA 2XMDA 5FRDA 4E4YA 1WWKA 1GU1A 4DZTA 3AR6A 5AFSA 4UPVA 5EEHA 4OFWA 4ES6A 5IEJA 3L6EA 4HGQA 3A6LA 3WNQA 2IL1A 5H9WA 5H02A 2IFTA 1TZMA 2IYYA 4YQEA 1C50A 2JGKA 3O91A 4QWMA 5TQVA 3KVYA 4IYRA 5AXDA 1W0KD 2CXNA 2WB2A 1BKDR 2ATXA 2BELA 3MGKA 3OQNA 3CZPA 2BHRA 3BDIA 3N05A 1DKOA 2GKGA 3CF2A 4J3FA 2QE7D 2PFGA 1ULBA 1VE6A 5ED0A 1KDYA 1JR6A 1WOPA 1DAKA 4MW4A 2B9VA 3GJTA 5GJWC 5A0TA 1CVLA 1NUAA 3KVRA 5H82A 2W2VA 5JMOA 5JXWA 3AINA 5DASA 3VDRA 3Q7RA 2HNKA 3W2TA 1IN7A 4OLJA 2WJAA 3CPWB 4MVXA 2QYTA 3WLNA 4R3WA 3D7MA 2B1GA 3THWB 1SU8A 2NO4A 3JWJA 4C3OB 3RRZA 2QRLA 3A26A 4FOPA 4I5EA 2VTDA 3DMPA 4IHJB 4J94A 1MQSA 5G0UA 4E2XA 3TTUA 3NDBB 5FUMA 5HKBA 1U8EA 3A2NA 1Y63A 1G20A 3GNTA 3S2ZA 4ZI7B 1GN8A 4MVJD 2DIEA 4RZXA 4GM1A 4UW9A 3S2IA 1ESZA 5BURA 3HYRA 3NVAA 4JOCA 2ZJAA 1EUDA 3FETA 4WLNA 4KE7A 4NK5A 5EPOA 3CB4A 4NBLA 5GONF 4S2EA 2J46A 2BI7A 3D8UA 2CW5A 3T7DA 3PDCA 2H2DA 3CF6R 5EE9A 5IM5A 1NOKA 3RSSA 1T13A 2QVXX 3NHAA 4ZVNA 1EYZA 1Q20A 3RU7A 5I7HA 2XTZA 3L8CA 1YDMA 1G63A 3L9WA 1NT2A 1N33B 1Y5IA 1MH9A 2JIZA 4WLOA 4ZI5A 1OE0A 3H9CA 2P4HX 1SELA 1YNOA 3AH8A 3PFKA 3PUJA 3HWRA 1N5IA 2FXIA 5F4ZA 1RQRA 1V5VA 2DHEA 4XCVA 2VATA 2D0OB 1N9GA 4LZZA 2Z56A 1BCSB 3WRYA 4BTVA 2WWRA 3I01M 3LE8A 4IIJA 2BM9A 4LQLA 1JT9A 2YVUA 3ANLA 5HFJA 4GOMD 4Z99A 4L5CA 2JD2A 4PSCA 2ZJZA 1ONOA 1OR8A 5ESRA 4C43A 4BX8A 4FYWA 4Z4HA 2Q1XA 1VYHA 2I1VB 3F3YA 2PE5A 3QBVA 1E3WB 2GZ3A 3ONDA 5KW9A 5ALNA 3OC0A 5DTMA 1KERA 1BO6A 2A7QA 1MENA 1T5LA 2OLJA 3NC1C 3OHMA 3ZDAA 3W4IA 3PFHA 4QU5A 4QXPA 3AEXA 1GSAA 4C2TA 2Y1DA 5JJ5A 2DG2A 2ZE8A 4Q21A 4RLSA 2HPHA 4X54A 5GJCA 1ICEA 1Z0IA 5TMEA 2G1KA 4C0SA 2BUBA 1AXEA 1TT7A 1YE5A 2YCLA 3IAFA 3IUNA 4I9UA 4B5KA 4EB0A 1R8YA 4UVHA 1T5OA 4CF3A 5KUTA 4N3NA 4DV3B 1FF9A 5KWJA 4OGKA 1RJDA 1DEOA 1IAVA 1R15A 4ZU6X 3W1WA 1DDIA 3E9CA 4I14A 2V3WA 4EH1A 4B73A 1SMKA 1M33A 1WZCA 3KTFA 2DTXA 3ZK7A 4D99A 5IN5A 2GJKA 1OU0A 4CKEA 3WGNA 1G5QA 3AFOA 3LX5A 5A71A 1QO0D 3VAAA 4EG3A 3HK2A 1VMIA 3VR2A 3U4MA 3WC4A 3BXHA 5K0GA 3JU3A 2A92A 1MO5A 2QTFA 4PG4A 1PJLA 1LW7A 3RV4A 4TKMA 2BGGA 1KYVA 1ZW1A 2IEDA 5JZBA 4UZFA 1GSOA 1OX6A 3IC5A 4BZWA 3PNLA 4EP1A 4OI2A 1KWKA 1FJXA 2B20A 3ZYCA 4ZOLF 4QO7A 4ZPXA 5CLGA 2P79A 1SUAA 1P4JA 4JVNA 1U4OA 2FEPA 1C3EA 2J5QA 2WILA 1MHPA 2GD2A 2JAPA 4IEFB 5KNBA 1FIUA 1YR7A 2EW1A 3BE6A 1H6CA 1ODKA 4ISBA 1IB6A 4NFYA 2FXVA 4XKVA 1WZNA 2QRVA 1XRSB 3L84A 2GBPA 4ZFNA 4MV5A 4UDXX 4FIDA 5AT1A 5GAJA 3CV3A 5IYZF 1W8DA 4IICA 5HQ3B 4OJYA 1EJ0A 2R8YA 3Q88A 3K5IA 5C51B 3TW0A 4N3GA 4H3VA 1WAMA 3PV0A 4UHBA 1ZGCA 2OAP1 3BVPA 3VJKA 4ZAYA 1CUEA 3THXB 1ACMA 1NJ2A 1THZA 3OO0A 1D1TA 3K9BA 4F4IA 1RHUA 5FFNA 3RS2A 1M1NB 2GN6A 3F96A 4FYPA 5M34A 4KQHA 4FI3F 4RL4A 3DKPA 4F97A 4OF4A 3SR0A 2VI5A 3KAPA 4NCNA 5IYQA 1MRSA 4YUZA 1FTQA 1I9GA 2F9FA 1NC1A 4PZDA 2W98A 4IHAA 1JWAB 3IJ5A 3KHKA 4ZZ2A 1A5ZA 4RD4A 1KZ9A 1A72A 1XRNA 2NOAA 4P3KA 2HT6A 1ZWLA 2BGIA 1N08A 1M2JA 3HUTA 2QZJA 3TQCA 1M66A 1P9WA 1YDHA 2J45A 4JL6A 4P26A 1L4LA 1PX2A 1F14A 1A04A 4L3VA 1HDOA 4IGIA 5DISB 2G9RA 2ZCVA 1CHDA 4KKSA 1RM5A 3B6JA 2GLTA 4JI6B 1DAEA 3VYTB 4ARCA 4NOKA 2O2SA 1Q92A 1JQAA 2AH5A 1NUTA 2H4WA 1PTKA 3N8NA 1Q19A 1ZMBA 2E4UA 4RH1A 3ZVRA 3WAJA 1TCAA 5E6UA 3ZTTA 4KUHA 4V0NA 2NV6A 3YASA 1MTZA 1GSIA 1YJXA 1ZN8A 4J6FA 5EMLA 3E8XA 1R64A 1U9JA 2GOYA 1OV6A 1XLWA 2YVKA 4KR2A 4HFRA 1U9YA 2QI9C 1SCKA 1M0EA 1SVUA 3HB9A 5C37A 1UEIA 1YU9A 4I1PA 1TW2A 5FTKA 4EEZA 2MHCA 2JVKA 4EHFA 1SU7A 3ID6C 1OXKB 4Q9LA 3L4SO 5F2NA 3F90A 4TROA 2I4IA 3DKIA 2JIOA 4RLFA 3FUTA 2CJXA 4LWZA 5IKOA 5IAAA 1VLVA 1NVUQ 1A3CA 1Y4AE 3GVCA 1AF7A 4R41A 3FVQA 4WFQA 4ARAA 1Y9DA 1PNOA 1M1ZA 2I1LA 2RCYA 5BWOA 2A9OA 3G05A 1H2BA 4JLBA 4NBSA 1WZ2A 3OUTA 2Q1YA 1MVLA 1W48A 5EQDA 4DUZB 4K1LA 1A9OA 1GYQA 1FLNA 4TUYA 4E88A 1T9AA 5JAQA 1SZPA 4HQRA 1N7JA 1O6GA 4IIXA 4RIFA 2PUCA 2XHZA 1AE1A 1XZDA 1MW8X 4QTUB 2ZJBA 4HDQB 1S6YA 3CO0S 1DKNA 2O3QA 5FOTA 1IULA 3S1LA 5K8UA 2P30A 1QS0B 1E2LA 1NNEA 4DR7B 4TTPA 4YI5A 2WLSA 4MW0A 3V8RA 3KHUA 4GDMA 4JBNA 2YHUA 3E15A 3IEXA 5CHEA 5L7WA 4AECA 3BWCA 5F23A 1GXSB 1TVCA 2QL5A 1EDBA 1V5WA 4K81B 2WPDA 3U1BA 4P80A 6Q21A 2XXAB 1JIKA 2F62A 5C34B 2CJWB 3U3OA 4ZQCB 4Q7JB 4KR7A 4LY9A 2YYYA 2DAPA 1WOYA 2Q5HA 2CVQA 1C3OA 2VNSA 3A1NA 3TPFA 2AS0A 2CLCX 4N9WA 1WMAA 2GBCA 5F4JA 2WFAA 3TD6A 1VLYA 3O2NA 4MQMA 5KPJA 2FSVA 2R6CA 4CIDA 1Z13A 1KGSA 3RYCB 1OBOA 4OAPA 3G9UA 4R1SA 2X85A 4EUHA 5TRTA 1FTGA 1NBIA 1LY1A 3MA0A 1VLMA 4IFEA 4E2YA 4GZ5A 1MAWA 4KREA 1GFZA 4WCVA 1JG1A 5BN3A 3AY3A 3JSXA 1EIZA 2HMSA 3ONEA 1A2BA 3C39A 4I6GA 1SOAA 3F5SA 4IUYA 1VQ4B 3FMOB 1X0VA 4IO1A 5DU2A 4BNKA 2OV2A 4EG1A 5C46F 4DA9A 5CDFE 2BZGA 1NVWQ 1V3UA 4RPLA 5EHXA 5KJCA 2F6RA 2QRGA 3GJYA 4ILKA 3OUZA 2FZEA 2JFOA 2ZTUA 1PFQA 4NV3A 3UK2A 4QBHA 5CX1B 4ZVMA 3RLFA 3SI7A 1FQWA 1W5AA 2HF2A 1LX7A 2P6MA 5FT9A 2IX9A 4K6KA 1PV2A 3H9EO 1ZEJA 2JGEA 3AG5A 3AGQA 1YQXA 2BF7A 4LSMA 4M8IA 3ZLBA 3G2IA 1JEDA 1RXVA 4FBGA 4MQFA 2FQYA 1W4LA 2HCTA 3BILA 1PKXA 1W52X 2V03A 2WF8A 3C14C 4WZBA 3K9FC 3BTVA 4IIEA 2R7MA 1U1EA 3REOA 2GZ2A 1O87A 3ZCPA 5JEEA 1IU9A 4II7A 3OM9A 1NLMA 3ND5A 1ODLA 3R5JA 5K3OA 2KVOA 3FHJA 4G36A 4LDPA 3VH3A 5K0EA 5DNCA 1V2HE 4RUKA 1LV8A 1XDUA 4MKFA 5A8AA 1NMQA 4AROA 1BJTA 3ZDRA 2OXFA 1HQDA 3MWGA 1NLUA 2M2IA 1Q7RA 1ECLA 2EBFX 3DZHA 1BAPA 3CLRC 2PVSA 2XH8A 3WS7A 4BNJA 3ZJUA 3MILA 3BY1A 3L0YA 3DONA 2OC4A 1V37A 1W4ZA 3L6RA 4PM4A 4OHBA 4PX9A 5DK4A 5ECYA 4RJIA 5HTKA 4X1IB 3DW3X 2ZBVA 1HDCA 3HFSA 4X24A 1EA5A 2ACWA 2NZXA 4V1CB 1WP4A 3IHKA 2EBHX 1Q7CA 3HKDB 3TZKA 5ICFA 1ZMXA 2CD7A 5HYVA 4U6QA 5FO0A 1NWHA 4DMKA 2V7TA 5I3CA 4ID9A 5CYGA 5TMBA 3Q3AA 1BWSA 3MGGA 2B8WA 1XJWA 3RS5A 5DSZA 1QZ3A 4XOPA 3KEGA 4DUPA 5IDQA 2G0TA 4KSBA 1UZUA 2NSJA 3CNBA 3OIDA 4Z2AA 4BVKA 4TPKA 2XUOA 3MS7A 4Z1MD 2OZKA 4FQ5A 4WGGA 4YFVA 4JX8A 5FH9A 5KYWB 2PSSA 4P1VA 4CIXA 1YVPA 5D01A 3THYA 4WN9B 4YMIA 1R5OA 4KCGA 1WXWA 1QCZA 3QKUA 4R1QA 1NXVA 1CY7A 4UHHA 4C2AA 2X0NA 4X1YB 4CJXA 2AD1A 4TMXA 2GLXA 4GYJA 3DTVD 1RU3A 1T5BA 3W5SA 5J4VA 5CEEA 1R2QA 2WMOB 2Q7XA 3PYMA 1XL0A 2PS0A 2RD2A 6YASA 5C5DA 4UEQA 1E62A 1CUHA 2I7TA 1G20E 2ILTA 4QO8A 4EB6A 2AQKA 3NC0C 2ZRGA 5TIIA 1D2NA 4LJ6A 3SZOA 2V9PA 3LWNA 2VLBA 2CYBA 6LDHA 1U2SA 3G9QA 4CTOA 4GXQA 3WYNA 5F7ZA 2G5TA 4CN8A 4GW3A 4V0SA 3RUDA 3E2IA 2E5LB 1FS6A 2GYUA 2JKZA 4AC9A 1EFPB 2C0CA 3DXXA 4L51A 2YIDA 4KQ2A 4D3DA 2BDTA 1TEZA 1A76A 2GAOA 3H65A 3A2KA 3WWEA 1DT5A 2H9AA 1JR2A 3HVKA 1C7FA 5AM1A 2YHAA 3UAWA 5CXUA 1DIOB 1N2CB 5DKFA 1DX4A 2HIHA 1ZCFA 2BEUB 3M6FA 4R98A 3T94A 3U5ZB 5I9IA 3HLTA 1JKJA 2BSXA 2IW3A 2VTVA 3WLJA 2RG1A 1XN1A 3FLEA 3EF1A 3E35A 4GGMX 4UPEA 1SB8A 3W4JA 2I87A 1LPPA 2BMFA 1X1RA 4DIDA 1ADFA 5MF6A 3W2GA 1ANKA 1NRKA 1BG6A 9LDBA 4DV6B 2XUZA 3D4OA 3U4QA 3EGXA 3OFSA 3WYAA 1MT3A 3RODA 2O8CA 3RS8A 3CLUD 1X7WB 3FHLA 3N6RA 4NBWA 4UE6A 1KI2A 1R0XA 3O4JA 4F92B 1GITA 1U5BB 4JGGA 4JI4B 2DUWA 2OAGA 3G0DA 1QOQB 4F2HA 3DAGA 1Z07A 3LLUA 5JDCA 1CQXA 4WZ6A 5TGDA 4BWYA 1RKXA 1PZFA 4B3CA 2VHQA 1D9ZA 3DDNA 3GYBA 4LK2A 4KRYA 3H5TA 4MQ6A 4DQVA 1IXSB 3FYDA 4Z7OB 2OYNA 1YS2X 3D81A 4NRDA 1UM8A 4NARA 3MNFA 3LHDA 2QNIA 3DV9A 5DT9A 2IV7A 1XCMA 2I4OA 4IVNA 1I7DA 3CNOA 3GH3A 3CSUA 4MWGA 5EWJA 4MV3A 3E9YA 3IKLA 4AO8A 1UC8A 4MKIA 4A6PA 1Y5NA 3R0IA 2PU5A 4E5SA 4X7DA 3FSRA 1GNRA 4AJIA 3P2YA 5T67A 2JFPA 4QTXA 1B26A 4RVDA 4S0XA 5C1OA 4DQUA 2YQ5A 1JE0A 4IW3B 5JU6A 2GASA 1UC9A 4AVZA 1JJ7A 2IE8A 4I81A 4U2FA 4GKBA 3QE9Y 2A9QA 2YWCA 2Y0PA 1QM5A 2FKAA 3LT5A 4HH1A 5FB3A 4RY9A 2CNLA 2NZUG 1U7DA 1KU0A 1VLHA 2A1UA 1KC1A 1PJAA 2B1IA 3L2OB 1X7YB 4U7DA 5LXTB 3OEHD 4XOIA 4PS0A 4IG4A 3P27A 5L3VA 2HF7A 1NUHA 3OPNA 4HG2A 4EA7A 3GNLA 3N2KB 2UUAB 4US1R 1G8SA 1OU4A 1U6JA 1TJ3A 1TLFA 3H2BA 3I9NA 1MEEA 1YMUA 4FOLA 4FZRA 1JTFA 5AW1A 4RKYA 2NXJA 3WVNA 4ZRNA 4K9SA 3EBOA 3H5LA 4XYMA 4D9GA 2B92A 4ZOQI 3M9WA 3IOBA 4DDWA 3PVSA 3BSSA 4XJXA 3LA6A 3MOSA 1E6EA 3HNOA 3W0LB 1NQUA 4IJWA 3P9KA 4FLEA 4HXGA 3D2CA 2V8BA 4V0OA 3GLIE 4GEGA 1SBNE 1ZH2A 3CX7A 1CXZA 4I4LA 4L3WA 4EY5A 1BXGB 3A3KA 3EVZA 2I99A 3WAKA 4C7KA 1DKRA 2JZOA 4YUXA 3A4IA 5BR7A 1LS6A 3SKVA 1CP2A 3ZK9A 1GAEO 4FEGA 4KLRA 1E2UA 2XQGA 3F5QA 3IOMA 5DSXA 4OBBA 3EQZA 1CWUA 2BL4A 3ZW7A 2AQHA 3RU3A 1PJ3A 3ZDDA 4PAAA 2XCQA 1J8MF 1MB2A 2Z9CA 2CB9A 3BWDD 4IXTA 2QSYA 3QUBA 5T3YA 3IR5A 3RBXA 5IANA 5LOVF 2HJSA 2Q8PA 4V0QA 2PTGA 1EGMB 1MC4A 2ZUVA 3GZTB 4KAAA 2UXDB 1VHEA 4HDMA 3PXEA 5ER6A 5EJ7A 3SM3A 3NOXA 3DHYA 2X9QA 1CKEA 1JH8A 2LGJA 3MBOA 4K6CA 1FJ2A 3VHLB 5A4JA 2BFNA 2O8NA 3ELUA 4PANA 4Q48A 1BMFD 4QHTA 1U7TA 1M75A 5FFFA 5LB4A 2WQ6A 2QENA 2OCLA 3GLKA 1LC3A 1DEXA 1B2LA 3JAWA 1W9MA 1M2FA 1Q14A 4MUIA 1DTWB 2R1ZA 4XA8A 4IEIA 3FTCA 3OZ7A 4KYTA 5LDDC 3CRVA 4BB0A 2DWOA 2EKDA 1RXEA 3I6IA 3I9LA 3GPCA 5JVDF 1PX0A 1NM5C 3E6AA 3MMPA 2HR1A 1AUOA 2IBSA 3EAQA 3QITA 2A30A 1GCUA 1KDZA 3VTZA 1JHXA 3D3NA 2Q4EA 3C1AA 3NBAA 2WA1A 4LPKA 2FJ0A 2R62A 2ZJOA 4MAMA 4UDOA 4ND2A 4JJKA 3M3DA 4YR9A 3P8ZA 4TXHA 4N8EA 2JHFA 4LWOA 2IC5A 4GM4A 4ALNA 3L82B 4II3A 5GZ6A 3CUKA 2O3JA 3RASA 2IYRA 1KY3A 2WKQA 2R6DA 3KQWA 2VDUE 4MEJA 5J3OA 1QBGA 1R4NB 2WC1A 1Q7BA 3CH7A 3L1VA 3KWFA 4G5SA 4RQUA 1DRKA 3CXRA 4H0CA 2OXIA 4A0FA 3ORHA 4BIMA 1HZZA 1PN3A 3VI3B 4A7PA 3AOGA 3EFBA 1W581 3RSHA 4D0NA 4DCPA 4FWBA 1XTVA 1LK7A 2D3WA 2PDAA 5IUJC 1ZHHA 1FLAA 4OHCA 5CNJA 4N03A 4C6HA 5JAUA 1E99A 5E3IA 1QHXA 3GBVA 2BDEA 2DZDA 3MAJA 3CEPB 4XX1A 4E30A 4GKKB 3HM2A 5FV7A 2P90A 4BNZA 5CITA 4UOEA 4IKEA 3BHIA 5FD8A 4GI2A 4WFIA 1AG9A 1SXGA 1KFCB 3RWBA 1W36D 4ZANA 4KB5A 4P38A 2ZU6A 4BNMA 1D2HA 3ZVNA 1ACJA 2EJCA 1D1QA 3GUYA 3PU6A 2GKSA 3WHPA 4BGVA 1YR2A 3EFOA 3UENA 3UQZA 4CMAA 4QGHA 2UAGA 1FW8A 1J1ZA 3V42A 2GEJA 3LTEA 5HKKD 1VB5A 2FR8C 1EVQA 4KN8A 2ZBRA 4NZOA 4X6LA 1PQPA 3GX1A 1SCNE 1ORDA 3DNMA 2FPLA 3KU1A 2V7WA 3NT5A 3KPUA 3OZGA 4ALLA 1HX7A 4BLSA 1DO0A 4IVPA 4C4XA 1W47A 2XLBA 4DRYA 1G41A 3CLKA 3M9LA 4PGGA 4BYGA 1CQIA 1IWOA 1TVKB 2ZTSA 3DR3A 3QBJA 5D51S 4BNLA 1TM5E 2V7QD 2QBYB 4UCFA 3RYFB 4Z4TA 2VPPA 1C7ZA 5LP6A 1I4DD 3WWCA 2CYCA 4ZEOA 1ZJYA 4PEVA 1VHQA 4TL7A 1SHJA 1QOZA 5GV8A 1U0LA 3N2NA 3Q38A 4X91A 2L69A 3DR5A 4EX7A 1SBIA 1JIJA 1CZKA 1GQSA 1YGPA 1VRWA 5GQSA 1W76A 2LBPA 3UGKA 2IEIA 1MR3F 2FETA 2RAPA 1XTSA 1F8GA 3DD1A 3G7SA 1UPUA 1V8DA 3RSOA 4B45A 3ABSB 1Q83A 4WCFB 1QQAA 2X6YA 1FU8A 3UYLA 1BJKA 5A1JA 3STVA 1RXCA 1MFPA 4ZV7A 1J2JA 4Z49A 5A5DA 1H5QA 1C1HA 1GKKA 1M1YA 2DLDA 3HXPA 5K0JA 4IUBS 4P0QB 1RMQA 1ZNQO 4MWBA 2B8TA 4BAGA 3EYWA 2Z1DA 4LY6A 3VPDA 5A2QA 3UJ7A 3ZWMA 2VHTA 2GJ9A 2E4ZA 4DMHA 1UPAA 3EW9A 3GD5A 4LYFA 2J1LA 3OLQA 4MS3B 5IYNA 1X7ZB 4R2LA 2NUAA 4ZVUA 3ECCA 1D0VA 2IIBA 3PZBA 3Q7TA 2XUDA 1K3TA 2FZWA 2FPXA 3L0PA 3TZQA 2VJOA 4WINA 3QE3A 5LQSA 2VK2A 5C5EA 1E2GA 1JDSA 3A9RA 1F2UA 2R6GA 2WWVD 3MYYA 4EJ2A 2QJWA 2M6KA 1II9A 2VUIB 2I66A 3AM4A 5JS6A 1M3SA 3G49A 1SC1A 3HVIA 4I2VA 2AKEA 2W6CX 3OW7A 1S2OA 2IZOA 4R5MA 1KAQA 3M9XA 1T3HA 2XUPA 3FUWA 3OKPA 4PZEA 3V8MA 2OV6A 4ZYTA 2RGDA 4DA0A 3WHLA 3TH5A 4ND8A 4PZPA 3HR8A 4X62B 3EUEA 1G3RA 4BP3A 1WNTA 2EQAA 4IJVA 1B7GO 4A0QA 2PR7A 3UV3A 2PFSA 2X4DA 4JLVA 4PG6A 1BEZA 1IWPB 1C30B 1S8OA 3L93A 3F6RA 1FCJA 3H9GA 4HATA 4TZ0A 3NETA 4BVAA 2Q9BA 3BFXA 1Q1ZA 3PQ6A 4CMIA 1DZIA 4WESB 2N1MA 2QA5A 5GJBA 1GVHA 2BKAA 2C92A 1KP9A 2QQ0A 5KVSA 4FCWA 1WETA 1GGKA 1PGQA 3G0CA 3PQ2A 2RAFA 1YS9A 1J0EA 3B1JA 3CG4A 4EYKA 1VQMB 1KF0A 1KMMA 1NR5A 3M6WA 3QJYA 2J5KA 2G76A 1QXSA 4HAYA 4JH0A 4H2DA 1BXZA 4FIZA 3GK3A 1VGQA 3BKWA 3A8TA 3T51B 2GF0A 3VSBA 3L0DA 1EWQA 3ZY4A 2R8BA 3UJNA 1T8RA 3UV7A 1QOPB 3KQMA 4C4TA 4DFDA 4Z3KA 1UDWA 3CTAA 2H5LA 3S7TA 5JJBA 3OKXA 1DCMA 2ECKA 2CBGA 5HMMA 1UMBA 3LYHA 4JASB 2BH2A 4M9CA 1UK7A 1P1BA 2AKAB 3KNZA 4B31A 1L9XA 3B7WA 4DF3A 1Z6GA 1UANA 3VDNB 4JBGA 3SFZA 3JQ7B 1C4KA 2CV0A 4OQDA 1UBRS 3H97A 2FQ1A 3PUXA 4EY6A 2VQFB 5K3AA 3RUPA 4BMXA 4Y6LA 3BM5A 3N2EA 3OC6A 2CD9A 1B23P 1J0CA 2AYYA 3I39X 3KL4A 4HB3A 5U1PA 4N0PA 2BGWA 3L7BA 2ZXIA 2NUTA 3ZNPA 4DLZA 4C3UA 4LA4A 5KNLA 3IUSA 3B6MA 1CRLA 4LYJA 4DLWA 3CVVA 3FPGA 5HMLA 1IN4A 4PTZA 1JKMA 3MW8A 4FDAA 3UJBA 4L8GA 2XECA 3WXBA 1KI4A 1O4VA 4DLLA 1DKMA 4WL0A 1XMQB 3DZKA 2Y0EA 1GAXA 3NDJA 2V74B 2RGBA 4R8KA 1I2MA 1KH2A 4DSNA 1RACA 4RIGA 3TXXA 2ADOA 5JIBA 4QUAA 1FRNA 5LIPA 3KBOA 3Q8LA 1V35A 1JEQB 3HB1A 4QYXA 1NX6A 2G8LA 2Z1MA 3DL2A 1OX4B 1PZHA 5EQJB 5FUYA 4DW8A 2AJDA 4LTDA 1B8PA 3L7MA 4JJFA 4WNAA 4CM4A 2Y1FA 3L07A 1KVQA 4JLKA 5EIOA 3ZE2B 4I1YA 1A2OA 2E5FA 2GEFA 2R5FA 4HTFA 3UBTA 4NENB 4RYDA 1OLOA 2FSHA 1AKEA 1IBCA 2DVMA 1JYFA 3H5AA 3IEKA 3KFXA 1MTOA 4RQTA 4Z2YA 3T7TA 3QVOA 2YBDA 3OFVA 3OZDA 5FEMA 2YJ5A 4GMHA 5B64A 5BW4A 4MS1B 4PSKA 2QLTA 4ZEMA 1CIJA 4J9UE 3ZHUA 1KEUA 1T1JA 4F9TA 3IEVA 1EA7A 1QFMA 3TOCA 1WV1A 2V7VA 2OO7A 4QYSA 5B2FA 3B78A 4U3JA 2X13A 3OOYA 2BD0A 2YJTD 5BNZA 5IJZA 4IS3A 1AKTA 5DK6A 3TDKA 4NBRA 5DYWA 2F8TA 2P0YA 4H7IA 4LE2A 3B2NA 1M2NA 4US0R 4IILA 1O0BA 1NXPA 1DELA 1FXSA 1I9CA 2BGKA 2ZRIA 4YELA 1RYMA 2A9FA 5B1DA 4GUDA 3UWPA 4AQDA 4HNTA 3ISJA 4NJEB 1XCPA 4QYMA 4PBRA 3B1ZA 4UAGA 2OFFA 4B82A 1RFGE 4J4HA 4CMCA 2G8NA 4FONA 3H5RA 4DDUA 5ITVA 2NVOA 3DA8A 4Z3OA 4HRVA 1XYVA 5K9ZA 1KVSA 2BTQA 2X2PA 3FM9A 3MWDA 4LV6A 5I47A 1P7YA 1Z7BA 2AN3A 4N4AA 3L3BA 2VJKA 2PUEA 2C78A 1BN6A 1NWCA 3LDGA 2NO0A 5I7RA 4ABYA 1VIDA 3AVVA 2PMFA 4P32A 4EG7A 1UKVY 2QG4A 3EGDB 3LVRE 4OKNA 5IS2A 4RTKA 5HZBA 3KBBA 3GLHE 1L1QA 1LDMA 1I18A 1PEKE 4G5HA 5AVYA 5BN5B 1UC4B 3OA2A 3HBFA 3JATA 3K3PA 3ASTA 5COQA 2OB2A 3K92A 2JAXA 1VQ6B 3OP4A 3RRFA 2WSSA 1JZSA 1NJSA 3RKUA 2J4CA 3E7DA 2E37A 1ZM7A 2ZT8A 1B0ZA 1LVGA 3D0QA 3LBIA 1I5OA 1NMYA 4FXOA 4DV1B 4Z4EA 3D1JA 3T7RA 3M3PA 2QMOA 2RI1A 1GRNA 3EOAI 4MAAA 4ALJA 3FVRA 4CL3A 2D2XA 5CJPA 3ZR4B 1J2YA 4FEAA 4LVUA 4JYBA 1IZYA 4FHGA 2JLSA 3OHPA 1IFXA 3ZVKA 3FMFA 4LXHA 5GTDA 1JP7A 2CNKA 4MUYA 4P6YA 3JALA 1UH5A 5KC9A 3LHFA 2VTBA 9GPBA 2QN9A 4NDAA 1JIQA 4U2DA 1YI2B 1X8JA 1PL7A 1YDWA 2GCPA 5FCDA 1NUQA 2APJA 4UTNA 1VJ5A 2ZUCA 1JPNA 3STHA 1USGA 3I5UA 3GIRA 1ZGGA 4FKBA 3AO0B 4BRUA 4WVFA 2DKOA 1G3QA 2F1JA 1N0IA 1RI4A 2FHPA 1NMEA 3HL4A 4DLKA 1XPJA 1WSAA 3DS8A 1JA9A 3U4HA 1KZ6A 1XEWY 4BO6A 2XF2A 1H3NA 1SPXA 2PWYA 1FQJA 2XD9A 2IS6A 1MFZA 2PZAA 3Q6MA 4CG1A 5K99A 1U8ZA 2ZYGA 1ZMRA 2F1IA 4DIEA 2ZETA 5JDIA 4BV2A 1A8UA 4Q9NA 4HSGA 2QLNA 4D25A 1CSEE 221PA 5ICSA 2VH2A 2E85A 3PDIA 4XXHA 4YN3A 1YR6A 1J7KA 1FSZA 2CCJA 2EX4A 1BVHA 4MHOA 1ODCA 4YMHA 3ZK8A 4F3RA 1SUCA 1J0AA 4HS4A 4CM8B 3UGTA 1TPZA 2OM6A 3CJRA 5DN6A 3AEKB 3PD7A 1Q3TA 2FCRA 2PSDA 4FDUA 2E4WA 3HDJA 3GUHA 3GFOA 4G85A 3WMFA 2OG1A 1T0BA 2WT4A 2NVUB 1VECA 4TZ6A 3QVXA 5HW0A 1ZICA 4HNGA 1L5NA 3RS0A 4ZJUA 1GTG1 4QUEA 2HPAA 4WZAA 5CMLA 2ZAIA 4DCOA 2VNAA 3ON5A 4DNTB 1GQQA 3SPXA 5M2QA 4BC0A 3C41J 3K70D 3EXG2 3I30X 5EHGA 4N8SA 5CBKA 2G4CA 3TDNA 1RRPA 1YE3A 4GX0A 5GOZA 3T1YB 1YBHA 1KY2A 1G6OA 3D4PA 4JGIA 3RGGA 3SHQA 1CIVA 1F8FA 1VE3A 1FZQA 1YFZA 2OV8A 3KSMA 3R3WA 1SC4A 3DULA 3IXLA 4J9VA 5K3FB 2PX6A 5TGZA 2GPTA 3WA6A 1Z25A 4NZPA 3BMCB 4ODIA 1AMOA 2XNDD 3E82A 2BM1A 3FX2A 2P65A 4HWPA 2FPPB 5BWNA 1DHTA 2IS2A 3R44A 2HSJA 1AQ6A 5AKYA 5LC1A 3AETB 1RWOA 3N39C 5BV2P 5EMKA 2AN9A 1Z0AA 4X90A 2XZDA 2BTOA 3E2MA 4UUQA 3F78A 4IAOA 2WJHA 4RYLA 4WA8A 5BOSB 1GSHA 4RJ2A 3RT9A 4C6RA 5CA1F 3B1FA 1IVSA 1YX2A 2MSCB 4IOJA 1LV7A 1I2DA 1MN6A 3ZBTA 2ECQA 1NJFA 2FG7C 4PHCA 4PNZA 4BGIA 1SVMA 3R3ZA 2IHBA 5BP7A 4OHVA 2Z5VA 1R7RA 2OBLA 1V11B 1K8ZB 1S4QA 3I73A 2PUJA 3M4NA 1NJ6A 2IHYA 4Q4AB 4B7UA 4UTRA 2ODPA 3L7YA 3GPLA 1F4VA 5KNCH 4FNAA 1F2DA 2OFWA 2QGNA 3I92A 3Q1LA 3RG2A 3KYCA 3JQRA 1A9TA 1KI6A 2QDXA 4LZWA 4OSOA 4BRZA 4EI2A 1QHHA 2PZMA 3AILA 4H3KB 2OKGA 4TTQA 4U7HA 4XR9A 4B6JA 4ND6A 2AC4A 3FNGA 7AT1A 4KHZA 1NZJA 3QY0A 1D03A 1LLDA 1SCDA 3BMQB 1CTQA 2PEZA 4MQEA 4ZODA 3PCTA 3G0IA 1ZH8A 4UUPA 4DADA 5JAOA 3OJXA 2OFPA 3K1TA 1M7GA 5JCJD 4B4UA 2BFBA 4FYKA 4RKRA 1L7VC 4RZSA 5B58C 3IR6A 3GIWA 2VRBA 4L75A 2A3NA 3EMKA 3NS7A 4ZU1X 3HKEA 4G9EA 2KHZA 3T5DA 4EJMA 1GU0A 2ZPUA 3K96A 1IZ8A 2PT7A 3QPUA 1SXJA 3HVJA 1N36B 4Q02A 4G6ZA