2VBVA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp and fmn
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
134
structure length
134
Chain Sequence
MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN KINASE
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
total genus 23
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbvA01
2I1LA 3OP1A 5FO0A 4UZEA 1NB9A 3ZUGA 2VBSA 1N08A 5FNZA 4UZFA 1N06A 1N07A 1P4MA 1T6XA 2VBTA 5A89A 1T6ZA 1Q9SA 1NB0A 2X0KA 3BNWA 2OYNA 1MRZA 2P3MA 2VBVA 5A88A 5TRDA 5FO1A 2VBUA 5A8AA 1N05A 1S4MA 1T6YA 3CTAA
chains in the Genus database with same CATH superfamily
4TMVA 1OB2A 2NV4A 2DEUA 2GREA 4ROXA 1FNCA 1ZM9A 3BCDA 3MMPA 1T5EA 3QE2A 2WYRA 2X6WA 4TN1A 3GIRA 3JQRA 1W9XA 3DDYA 2ZBUA 4K1XA 1QG0A 4WZTA 3CCEB 5F4MA 2V4DA 1IJEA 4GQNA 1WU8A 4DNTB 2WSSA 4B3GA 3VR6A 1FNDA 5CDFA 2VNKA 1QH0A 4WWVA 3GSIA 1GVHA 1KD1D 4TMWA 4B47A 4XN3A 3ASTA 2V7QA 2GQFA 1F60A 5KSWB 3LQEA 3W2GA 5FO0A 4G7XA 4XOPA 2YWEA 3MCAA 4RD4A 1OB0A 1TLLA 2VYQA 4XN0A 1UMKA 1WPCA 4TKOB 1TTTA 3OPOA 2XOKA 4YALA 1BPLA 1Q81D 1I7PA 4X7DA 4RD0A 2FVGA 5IYPA 2C4TA 4YAFA 2V31A 2XNJA 4II3A 3PA1A 4X7FA 4ZGNB 3VO2A 1VF7A 2F1MA 1E3XA 1VQ6B 2QDXA 3V76A 4WQMA 5IYQA 4WZKA 1W35A 1AIPA 1KK3A 1OB5A 1SM4A 3CTAA 1H8HA 2B7CA 2OTLB 3I55B 1D1NA 1EFRA 4X7CA 3PENA 3QSYA 2GJPA 5FNZA 3P27A 4DNRB 1GO2A 2BPOA 4JMQA 1VQ9B 4IW3B 1A8PA 1T6XA 1P4MA 4NBSA 4OOVA 4QHYA 4G7WA 4E0FA 3PVDA 1UD2A 1KK0A 1SKQA 1WDTA 2R6HA 2F43A 1SKYB 1FNBA 2BM1A 1I8DA 3QFCA 4AC9A 5HKKA 1KRHA 5B6IA 2OBRA 1UD3A 3G71B 3OJWA 1HVXA 2HMAA 3OW2B 1WTHD 3FPPA 2BM0A 3CRZA 2CF4A 3PA2A 3WYAA 1V0EA 2VNHA 4TMTA 4PABA 1VQLB 2OBTA 5EMNA 4XD7A 3WBJA 4FWTA 4J0QA 1JJ2B 2J7KA 1Y0YA 4B3FX 4WZLA 1PKVA 2JDIA 4RD3A 1QFYA 2V7WA 2HCJB 3W2HA 4ZV4A 2ZL7A 5HZAA 2CBXA 2JJ2A 3Q3AA 2WR8A 1FDRA 3Q38A 1CNFA 2WJVA 1VQ7B 3OFNA 4XL9A 3A1PA 4HIZA 4X8IA 3ASPA 1EFCA 2QA4B 2Q6LA 1KZLA 2DCUA 4H9GA 4Z4UA 1CNEA 2ZL6A 3CW2A 3WNBA 4YXWA 2F1LA 3AVYA 4Z4WA 1VHEA 1OGJA 2X6XA 2NPFA 2EIXA 1ZUNB 3W2IA 3LNNA 3W2EA 5AN9A 1KQSB 1COWA 2XNDA 4RD6A 1NB9A 3A8JA 2X3UA 2X6YA 1EP2B 1CQXA 4XLCA 4XLHA 1VJSA 1G7RA 4Z4SA 2FX3A 2VBTA 2VZLA 4Z4RA 1F20A 4G1VA 4HE6A 3OOCA 2BMWA 4RLZA 1VQ4B 3AVWA 2BSAA 4OOSA 3WBKA 3CC4B 4X7EA 3SLDA 4MYUA 4ZCIA 3WNDA 1QGAA 5BSYA 4PGOA 1Y0RA 2GPJA 3ASRA 4LC0A 2C77A 1NBMA 1QVFB 1RQPA 2XGJA 1TVCA 4B3XA 3WXMA 1YLOA 4Y9RA 2XEXA 2GJKA 5H59A 3B78A 4UZUA 3I1FA 1NDHA 1K8AD 4B44A 5KW9A 3ISXA 1V0FA 1OGIA 1XE1A 4P9SA 5KNLA 1E64A 5FIUA 4B43A 4CQJA 1E3ZA 1M90D 2OYNA 1PJ5A 2M5SA 1VLOA 5TRDA 1B2RA 2GJRA 4P1VA 4KKTA 1M1KD 1K9MD 2I1LA 1UD4A 1JA1A 4M2LA 3OP1A 4B4DA 4RPBA 3A3BA 2Q6OA 4RM0A 1DDIA 3ONYA 3Q39A 2VJIA 1HZEA 2GK6A 4L8JA 2ZTGA 4XLAA 1G7CA 1QGYA 2JIZA 3OEEA 1YITB 3BY2A 1K28D 1UD5A 1VQ8B 1Q9SA 1ZM4A 3AVUA 5FA6A 4YAUA 5TY0A 1BX1A 1KK1A 5TR9A 3BQJA 2WPDA 1PJ6A 4PC2A 1VQNB 1MRZA 4G5GA 2BF4A 1E63A 2E1RA 4LBWA 5H5JA 3CESA 5A88A 3A8IA 2V7TA 2ZXIA 4MYTA 4OPVA 2XNCA 2CRVA 4ZCLA 4UZEA 1IB0A 1N0VC 1QVGB 3CMEB 4LBVA 5J35A 2XZOA 2YWHA 1BLIA 3I56B 2D3NA 2DYIA 4EH1A 3OZWA 2WZPP 3W5VA 2DIEA 4X0CA 2HLDA 3R6JA 1QGZA 4XKWA 5E6TA 4X05A 4AVZA 4RCZA 3PUNA 1S72B 3CCMB 2JJ1A 3CCUB 1GAWA 1NB0A 2GK7A 2RC6A 4B48A 3CCSB 3SLNA 2ZXHA 3FPKA 3WY9A 1D2EA 4Y7CA 3D26A 1VLYA 5GV7A 1KJZA 1DARA 1E79A 1S4MA 1YJNB 1Q7YD 3V7AA 3U6BA 3WNCA 3B82A 5IK2A 2B5OA 3AVVA 1E43A 3T56B 2PIAA 3G05A 5FL7A 4Z4TA 4RD2A 3LVBA 4XLEA 3VMFA 2Q6IA 2ZL5A 4P6VF 4ZCMA 1NRKA 4II2A 4PAAA 2C5BA 3HAGA 1MABA 3CPXA 2CK3A 1T6ZA 3OW7A 3P26A 2ZITA 4Q7JB 4OPSA 2ZZEA 4QVJA 4XQFA 3QFRA 4DK0A 4XNFA 1VQKB 1N0UA 4M1KA 4Y9UA 4OP7A 3ASSA 4ACBA 5A8AA 4M53A 5THXA 3VO1A 4G1BA 4U9UA 1W2BB 2D9RA 3ZIAA 2VJJA 3U6KA 4QVAA 3T51B 3FKSA 3ZBUA 4N3GA 1GJRA 4C43A 3WQZA 4TMXA 4M4SA 3CCVB 1FRNA 1N06A 3SKBA 2RC5A 2KVOA 4XOTA 3U2QA 1U2RA 3OEHA 3QFTA 4PC7A 3FJOA 3AVTA 1B23P 2WJYA 2ZTNA 3B8HA 2C78A 1JNYA 3BCFA 3NE5B 2OK8A 4X07A 3W2FA 3GVJA 3LQ6A 2WZNA 3ZPNA 1UD8A 4P3IA 1QFJA 2YWGA 4ACAA 3A35A 1VHOA 2P3MA 2B7BA 2X8KA 4PC1A 4UAJA 4DQKA 5IYRA 1E1QA 2F4NA 1R5NA 2Z6BD 1ELOA 1UD6A 2HDNB 3KL9A 1VQ5B 1ZM3A 4P3YA 1EWYA 1W0KA 2BGIA 2BGJA 4XMYA 2CC2A 1FX0A 1FNMA 1ZM2A 3ZZUA 3ES9A 3PUMA 4BPRA 1V5VA 3JU4A 1DDGA 4P26A 1I18A 2CNDA 3VNVA 1BQEA 3GVLA 1E62A 2QEXB 3ZBTA 2XZPA 2D74A 4XM3A 5LMZA 4AF7A 3AVXA 2PE3A 2VBVA 5FO1A 1WOPA 2BV3A 3R6KA 4G6IA 3AGPA 1WOOA 4FN5A 3E20A 1XB2A 4RDJA 4PC6A 1JB9A 1E1RA 3CCLB 4Z1MA 2V7VA 4N3NA 3ZZTA 3QFSA 5JBQA 1N07A 1W0JA 4TMZA 4Z4ZA 3JQQA 3ASQA 3OZVA 4QFMA 1HA3A 1EFTA 1AMOA 3A3GA 4DK1A 3VNUA 2C2WA 3LO8A 2EFGA 1J9ZA 4X06A 3CP8A 3T53B 1EP3B 4P25A 4FK8A 2Q6KA 3OKXA 4TSFA 5TV2A 5L46A 4XONA 1VQOB 2DOGA 4OOXA 1G7TA 1TUIA 2DERA 4RDLA 1S0UA 3ZZ0A 2DY1A 4RD1A 1EP1B 1KTVA 1YIJB 2OTJB 4YAOA 5F4OA 3OJXA 1H8EA 2VNIA 3CC7B 5IYNA 1YHQB 1W34A 1JA0A 3OAAA 1EXMA 2XZLA 2X85A 1BJKA 3H94A 4XLFA 3CCJB 3OZUA 4NCNA 4XKVA 2X0KA 3BNWA 1DG1G 2QTZA 2PMDA 4R71A 3CMMA 4ZGQB 5DS0A 4YHBA 4KKUA 3GQBA 3AGQA 3W5HA 1YJ9B 3BC9A 4P6YA 1YI2B 2QE7A 3G4SB 2VNJA 2VBSA 2OK7A 1YX2A 2ZZGA 2PLFA 2OBSA 5DN6A 1WOSA 1BMFA 1OHHA 1QFZA 2BVNA 4ASUA 1EFUA 4WZEA 1W87A 2AHOA 3CB4A 3CP2A 3ZC3A 5A89A 1H85A 2LZJA 2X53S 2QMUA 3CMAB 3CC2B 1Q82D 5GV8A 3OE7A 4QUZA 4YELA 1GAQA 2C5HA 3H9NA 4PC3A 2ZZFA 5BSXA 5IYWA 3Q6RA 1IHMA 4LBZA 2VBUA 1FRQA 1XFOA 1N05A 5J3OA 3CCRB 3SEJA 1R5OA 4HE5A 4XORA 1D8TA 2V7XA 4C0SA 1KK2A 3A8KA 3GVKA 3JQPA 3MHPA 2ZZQA 3ZUGA 1XQBA 1N08A 4YAWA 3SJPA 4UZFA 2QGGA 4RCYA 1VQMB 4P22A 2DETA 2W6IA 4TT3A 5DSZA 2D3LA 4AF6A 4QV2A 1WSRA 1WSVA 2E1BA 4M0LA 2R9VA 2QTLA 3SJZA 3KEWA 4P2NA 4Z4VA 3G6EB 2ZBVA 3Q6QA 3E1YE 1NJID 3RY8A 4XR6A 1YJWB 1Q86D 4NNJA 1N8RD 1T6YA 1QUFA 2JN9A 1KC8D 4FXUA 4LBYA 4KKSA 4OPOA 1WP6A 4F7DA 3ONUA 1H42A 3BH4A 3CCQB 3CPWB 1GR1A 3BY1A 2QN6A 2C4UA 4RPDA 1RQRA 4RJLA 4P12A 1KMHA 4YEJA 1R5BA 2BN4A 1IJFA 1WORA 2V7UA 1K73D 2CW5A 1QX4A 1G7SA 5HXBA 2W6JA 3CXCB 2YWFA 5F4JA 4Z4YA 1PJ7A 3W5UA 5HZBA 4DQLA 4RDKA 3J81k 3CD6B 1QUEA 1BX0A 1VQPB
chains in the Genus database with same CATH topology
2I1LA 3OP1A 5FO0A 4UZEA 1NB9A 3ZUGA 2VBSA 1N08A 5FNZA 4UZFA 1N06A 1N07A 1P4MA 1T6XA 2VBTA 5A89A 1T6ZA 1Q9SA 1NB0A 2X0KA 3BNWA 2OYNA 1MRZA 2P3MA 2VBVA 5A88A 5TRDA 5FO1A 2VBUA 5A8AA 1N05A 1S4MA 1T6YA 3CTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1L A;  3OP1 A;  5FO0 A;  4UZE A;  1NB9 A;  3ZUG A;  2VBS A;  1N08 A;  5FNZ A;  4UZF A;  1N06 A;  1N07 A;  1P4M A;  1T6X A;  2VBT A;  5A89 A;  1T6Z A;  1Q9S A;  1NB0 A;  2X0K A;  3BNW A;  2OYN A;  1MRZ A;  2P3M A;  2VBV A;  5A88 A;  5TRD A;  5FO1 A;  2VBU A;  5A8A A;  1N05 A;  1S4M A;  1T6Y A;  3CTA A; 
#chains in the Genus database with same CATH topology
 4TMV A;  1OB2 A;  2NV4 A;  2DEU A;  2GRE A;  4ROX A;  1FNC A;  1ZM9 A;  3BCD A;  3MMP A;  1T5E A;  3QE2 A;  2WYR A;  2X6W A;  4TN1 A;  3GIR A;  3JQR A;  1W9X A;  3DDY A;  2ZBU A;  4K1X A;  1QG0 A;  4WZT A;  3CCE B;  5F4M A;  2V4D A;  1IJE A;  4GQN A;  1WU8 A;  4DNT B;  2WSS A;  4B3G A;  3VR6 A;  1FND A;  5CDF A;  2VNK A;  1QH0 A;  4WWV A;  3GSI A;  1GVH A;  1KD1 D;  4TMW A;  4B47 A;  4XN3 A;  3AST A;  2V7Q A;  2GQF A;  1F60 A;  5KSW B;  3LQE A;  3W2G A;  5FO0 A;  4G7X A;  4XOP A;  2YWE A;  3MCA A;  4RD4 A;  1OB0 A;  1TLL A;  2VYQ A;  4XN0 A;  1UMK A;  1WPC A;  4TKO B;  1TTT A;  3OPO A;  2XOK A;  4YAL A;  1BPL A;  1Q81 D;  1I7P A;  4X7D A;  4RD0 A;  2FVG A;  5IYP A;  2C4T A;  4YAF A;  2V31 A;  2XNJ A;  4II3 A;  3PA1 A;  4X7F A;  4ZGN B;  3VO2 A;  1VF7 A;  2F1M A;  1E3X A;  1VQ6 B;  2QDX A;  3V76 A;  4WQM A;  5IYQ A;  4WZK A;  1W35 A;  1AIP A;  1KK3 A;  1OB5 A;  1SM4 A;  3CTA A;  1H8H A;  2B7C A;  2OTL B;  3I55 B;  1D1N A;  1EFR A;  4X7C A;  3PEN A;  3QSY A;  2GJP A;  5FNZ A;  3P27 A;  4DNR B;  1GO2 A;  2BPO A;  4JMQ A;  1VQ9 B;  4IW3 B;  1A8P A;  1T6X A;  1P4M A;  4NBS A;  4OOV A;  4QHY A;  4G7W A;  4E0F A;  3PVD A;  1UD2 A;  1KK0 A;  1SKQ A;  1WDT A;  2R6H A;  2F43 A;  1SKY B;  1FNB A;  2BM1 A;  1I8D A;  3QFC A;  4AC9 A;  5HKK A;  1KRH A;  5B6I A;  2OBR A;  1UD3 A;  3G71 B;  3OJW A;  1HVX A;  2HMA A;  3OW2 B;  1WTH D;  3FPP A;  2BM0 A;  3CRZ A;  2CF4 A;  3PA2 A;  3WYA A;  1V0E A;  2VNH A;  4TMT A;  4PAB A;  1VQL B;  2OBT A;  5EMN A;  4XD7 A;  3WBJ A;  4FWT A;  4J0Q A;  1JJ2 B;  2J7K A;  1Y0Y A;  4B3F X;  4WZL A;  1PKV A;  2JDI A;  4RD3 A;  1QFY A;  2V7W A;  2HCJ B;  3W2H A;  4ZV4 A;  2ZL7 A;  5HZA A;  2CBX A;  2JJ2 A;  3Q3A A;  2WR8 A;  1FDR A;  3Q38 A;  1CNF A;  2WJV A;  1VQ7 B;  3OFN A;  4XL9 A;  3A1P A;  4HIZ A;  4X8I A;  3ASP A;  1EFC A;  2QA4 B;  2Q6L A;  1KZL A;  2DCU A;  4H9G A;  4Z4U A;  1CNE A;  2ZL6 A;  3CW2 A;  3WNB A;  4YXW A;  2F1L A;  3AVY A;  4Z4W A;  1VHE A;  1OGJ A;  2X6X A;  2NPF A;  2EIX A;  1ZUN B;  3W2I A;  3LNN A;  3W2E A;  5AN9 A;  1KQS B;  1COW A;  2XND A;  4RD6 A;  1NB9 A;  3A8J A;  2X3U A;  2X6Y A;  1EP2 B;  1CQX A;  4XLC A;  4XLH A;  1VJS A;  1G7R A;  4Z4S A;  2FX3 A;  2VBT A;  2VZL A;  4Z4R A;  1F20 A;  4G1V A;  4HE6 A;  3OOC A;  2BMW A;  4RLZ A;  1VQ4 B;  3AVW A;  2BSA A;  4OOS A;  3WBK A;  3CC4 B;  4X7E A;  3SLD A;  4MYU A;  4ZCI A;  3WND A;  1QGA A;  5BSY A;  4PGO A;  1Y0R A;  2GPJ A;  3ASR A;  4LC0 A;  2C77 A;  1NBM A;  1QVF B;  1RQP A;  2XGJ A;  1TVC A;  4B3X A;  3WXM A;  1YLO A;  4Y9R A;  2XEX A;  2GJK A;  5H59 A;  3B78 A;  4UZU A;  3I1F A;  1NDH A;  1K8A D;  4B44 A;  5KW9 A;  3ISX A;  1V0F A;  1OGI A;  1XE1 A;  4P9S A;  5KNL A;  1E64 A;  5FIU A;  4B43 A;  4CQJ A;  1E3Z A;  1M90 D;  2OYN A;  1PJ5 A;  2M5S A;  1VLO A;  5TRD A;  1B2R A;  2GJR A;  4P1V A;  4KKT A;  1M1K D;  1K9M D;  2I1L A;  1UD4 A;  1JA1 A;  4M2L A;  3OP1 A;  4B4D A;  4RPB A;  3A3B A;  2Q6O A;  4RM0 A;  1DDI A;  3ONY A;  3Q39 A;  2VJI A;  1HZE A;  2GK6 A;  4L8J A;  2ZTG A;  4XLA A;  1G7C A;  1QGY A;  2JIZ A;  3OEE A;  1YIT B;  3BY2 A;  1K28 D;  1UD5 A;  1VQ8 B;  1Q9S A;  1ZM4 A;  3AVU A;  5FA6 A;  4YAU A;  5TY0 A;  1BX1 A;  1KK1 A;  5TR9 A;  3BQJ A;  2WPD A;  1PJ6 A;  4PC2 A;  1VQN B;  1MRZ A;  4G5G A;  2BF4 A;  1E63 A;  2E1R A;  4LBW A;  5H5J A;  3CES A;  5A88 A;  3A8I A;  2V7T A;  2ZXI A;  4MYT A;  4OPV A;  2XNC A;  2CRV A;  4ZCL A;  4UZE A;  1IB0 A;  1N0V C;  1QVG B;  3CME B;  4LBV A;  5J35 A;  2XZO A;  2YWH A;  1BLI A;  3I56 B;  2D3N A;  2DYI A;  4EH1 A;  3OZW A;  2WZP P;  3W5V A;  2DIE A;  4X0C A;  2HLD A;  3R6J A;  1QGZ A;  4XKW A;  5E6T A;  4X05 A;  4AVZ A;  4RCZ A;  3PUN A;  1S72 B;  3CCM B;  2JJ1 A;  3CCU B;  1GAW A;  1NB0 A;  2GK7 A;  2RC6 A;  4B48 A;  3CCS B;  3SLN A;  2ZXH A;  3FPK A;  3WY9 A;  1D2E A;  4Y7C A;  3D26 A;  1VLY A;  5GV7 A;  1KJZ A;  1DAR A;  1E79 A;  1S4M A;  1YJN B;  1Q7Y D;  3V7A A;  3U6B A;  3WNC A;  3B82 A;  5IK2 A;  2B5O A;  3AVV A;  1E43 A;  3T56 B;  2PIA A;  3G05 A;  5FL7 A;  4Z4T A;  4RD2 A;  3LVB A;  4XLE A;  3VMF A;  2Q6I A;  2ZL5 A;  4P6V F;  4ZCM A;  1NRK A;  4II2 A;  4PAA A;  2C5B A;  3HAG A;  1MAB A;  3CPX A;  2CK3 A;  1T6Z A;  3OW7 A;  3P26 A;  2ZIT A;  4Q7J B;  4OPS A;  2ZZE A;  4QVJ A;  4XQF A;  3QFR A;  4DK0 A;  4XNF A;  1VQK B;  1N0U A;  4M1K A;  4Y9U A;  4OP7 A;  3ASS A;  4ACB A;  5A8A A;  4M53 A;  5THX A;  3VO1 A;  4G1B A;  4U9U A;  1W2B B;  2D9R A;  3ZIA A;  2VJJ A;  3U6K A;  4QVA A;  3T51 B;  3FKS A;  3ZBU A;  4N3G A;  1GJR A;  4C43 A;  3WQZ A;  4TMX A;  4M4S A;  3CCV B;  1FRN A;  1N06 A;  3SKB A;  2RC5 A;  2KVO A;  4XOT A;  3U2Q A;  1U2R A;  3OEH A;  3QFT A;  4PC7 A;  3FJO A;  3AVT A;  1B23 P;  2WJY A;  2ZTN A;  3B8H A;  2C78 A;  1JNY A;  3BCF A;  3NE5 B;  2OK8 A;  4X07 A;  3W2F A;  3GVJ A;  3LQ6 A;  2WZN A;  3ZPN A;  1UD8 A;  4P3I A;  1QFJ A;  2YWG A;  4ACA A;  3A35 A;  1VHO A;  2P3M A;  2B7B A;  2X8K A;  4PC1 A;  4UAJ A;  4DQK A;  5IYR A;  1E1Q A;  2F4N A;  1R5N A;  2Z6B D;  1ELO A;  1UD6 A;  2HDN B;  3KL9 A;  1VQ5 B;  1ZM3 A;  4P3Y A;  1EWY A;  1W0K A;  2BGI A;  2BGJ A;  4XMY A;  2CC2 A;  1FX0 A;  1FNM A;  1ZM2 A;  3ZZU A;  3ES9 A;  3PUM A;  4BPR A;  1V5V A;  3JU4 A;  1DDG A;  4P26 A;  1I18 A;  2CND A;  3VNV A;  1BQE A;  3GVL A;  1E62 A;  2QEX B;  3ZBT A;  2XZP A;  2D74 A;  4XM3 A;  5LMZ A;  4AF7 A;  3AVX A;  2PE3 A;  2VBV A;  5FO1 A;  1WOP A;  2BV3 A;  3R6K A;  4G6I A;  3AGP A;  1WOO A;  4FN5 A;  3E20 A;  1XB2 A;  4RDJ A;  4PC6 A;  1JB9 A;  1E1R A;  3CCL B;  4Z1M A;  2V7V A;  4N3N A;  3ZZT A;  3QFS A;  5JBQ A;  1N07 A;  1W0J A;  4TMZ A;  4Z4Z A;  3JQQ A;  3ASQ A;  3OZV A;  4QFM A;  1HA3 A;  1EFT A;  1AMO A;  3A3G A;  4DK1 A;  3VNU A;  2C2W A;  3LO8 A;  2EFG A;  1J9Z A;  4X06 A;  3CP8 A;  3T53 B;  1EP3 B;  4P25 A;  4FK8 A;  2Q6K A;  3OKX A;  4TSF A;  5TV2 A;  5L46 A;  4XON A;  1VQO B;  2DOG A;  4OOX A;  1G7T A;  1TUI A;  2DER A;  4RDL A;  1S0U A;  3ZZ0 A;  2DY1 A;  4RD1 A;  1EP1 B;  1KTV A;  1YIJ B;  2OTJ B;  4YAO A;  5F4O A;  3OJX A;  1H8E A;  2VNI A;  3CC7 B;  5IYN A;  1YHQ B;  1W34 A;  1JA0 A;  3OAA A;  1EXM A;  2XZL A;  2X85 A;  1BJK A;  3H94 A;  4XLF A;  3CCJ B;  3OZU A;  4NCN A;  4XKV A;  2X0K A;  3BNW A;  1DG1 G;  2QTZ A;  2PMD A;  4R71 A;  3CMM A;  4ZGQ B;  5DS0 A;  4YHB A;  4KKU A;  3GQB A;  3AGQ A;  3W5H A;  1YJ9 B;  3BC9 A;  4P6Y A;  1YI2 B;  2QE7 A;  3G4S B;  2VNJ A;  2VBS A;  2OK7 A;  1YX2 A;  2ZZG A;  2PLF A;  2OBS A;  5DN6 A;  1WOS A;  1BMF A;  1OHH A;  1QFZ A;  2BVN A;  4ASU A;  1EFU A;  4WZE A;  1W87 A;  2AHO A;  3CB4 A;  3CP2 A;  3ZC3 A;  5A89 A;  1H85 A;  2LZJ A;  2X53 S;  2QMU A;  3CMA B;  3CC2 B;  1Q82 D;  5GV8 A;  3OE7 A;  4QUZ A;  4YEL A;  1GAQ A;  2C5H A;  3H9N A;  4PC3 A;  2ZZF A;  5BSX A;  5IYW A;  3Q6R A;  1IHM A;  4LBZ A;  2VBU A;  1FRQ A;  1XFO A;  1N05 A;  5J3O A;  3CCR B;  3SEJ A;  1R5O A;  4HE5 A;  4XOR A;  1D8T A;  2V7X A;  4C0S A;  1KK2 A;  3A8K A;  3GVK A;  3JQP A;  3MHP A;  2ZZQ A;  3ZUG A;  1XQB A;  1N08 A;  4YAW A;  3SJP A;  4UZF A;  2QGG A;  4RCY A;  1VQM B;  4P22 A;  2DET A;  2W6I A;  4TT3 A;  5DSZ A;  2D3L A;  4AF6 A;  4QV2 A;  1WSR A;  1WSV A;  2E1B A;  4M0L A;  2R9V A;  2QTL A;  3SJZ A;  3KEW A;  4P2N A;  4Z4V A;  3G6E B;  2ZBV A;  3Q6Q A;  3E1Y E;  1NJI D;  3RY8 A;  4XR6 A;  1YJW B;  1Q86 D;  4NNJ A;  1N8R D;  1T6Y A;  1QUF A;  2JN9 A;  1KC8 D;  4FXU A;  4LBY A;  4KKS A;  4OPO A;  1WP6 A;  4F7D A;  3ONU A;  1H42 A;  3BH4 A;  3CCQ B;  3CPW B;  1GR1 A;  3BY1 A;  2QN6 A;  2C4U A;  4RPD A;  1RQR A;  4RJL A;  4P12 A;  1KMH A;  4YEJ A;  1R5B A;  2BN4 A;  1IJF A;  1WOR A;  2V7U A;  1K73 D;  2CW5 A;  1QX4 A;  1G7S A;  5HXB A;  2W6J A;  3CXC B;  2YWF A;  5F4J A;  4Z4Y A;  1PJ7 A;  3W5U A;  5HZB A;  4DQL A;  4RDK A;  3J81 k;  3CD6 B;  1QUE A;  1BX0 A;  1VQP B; 
#chains in the Genus database with same CATH homology
 2I1L A;  3OP1 A;  5FO0 A;  4UZE A;  1NB9 A;  3ZUG A;  2VBS A;  1N08 A;  5FNZ A;  4UZF A;  1N06 A;  1N07 A;  1P4M A;  1T6X A;  2VBT A;  5A89 A;  1T6Z A;  1Q9S A;  1NB0 A;  2X0K A;  3BNW A;  2OYN A;  1MRZ A;  2P3M A;  2VBV A;  5A88 A;  5TRD A;  5FO1 A;  2VBU A;  5A8A A;  1N05 A;  1S4M A;  1T6Y A;  3CTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...