2VBVA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp and fmn
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
134
structure length
134
Chain Sequence
MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN KINASE
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
total genus 23
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbvA01
2P3MA 2X0KA 2OYNA 5TRDA 1P4MA 1T6ZA 5FO1A 1T6YA 4UZFA 4UZEA 2VBSA 1MRZA 1N05A 3BNWA 3CTAA 2VBUA 3OP1A 2VBVA 5A8AA 5FNZA 1S4MA 1T6XA 1N06A 2VBTA 5A88A 2I1LA 5A89A 1NB9A 1N08A 1NB0A 3ZUGA 1Q9SA 1N07A 5FO0A
chains in the Genus database with same CATH superfamily
2F1LA 3H9NA 3LNNA 3GVJA 2ZL6A 4G5GA 1A8PA 1VHEA 3CD6B 1TVCA 1FRQA 2ZTNA 2CK3A 2V7WA 1YJWB 1W87A 4E0FA 2X6WA 4FWTA 4XLAA 4P3IA 1WP6A 1VLYA 2VJIA 3W5UA 2CBXA 4Z4WA 1BX1A 5A89A 3LVBA 1EFRA 3CC7B 4XD7A 1UD2A 1D1NA 2R9VA 4FXUA 1QFJA 4MYTA 4QUZA 2F1MA 3CPXA 2XZOA 4QVJA 3ZZ0A 1N0VC 4B4DA 2XEXA 1CNFA 1VJSA 3A8IA 1BPLA 2Q6LA 3CESA 4PABA 5FIUA 4RDJA 2VYQA 3E1YE 4UAJA 3PUMA 2M5SA 1QGAA 1K28D 3CC4B 3GIRA 1VQOB 3ES9A 2QTZA 2ZBUA 2CNDA 1DG1G 4EH1A 3CCSB 3AGPA 4Y9RA 3WBJA 2WJVA 1TLLA 3AVTA 2XZLA 3Q3AA 3T53B 1BMFA 3CMEB 2WR8A 1FDRA 2X53S 2BSAA 1TTTA 2OTJB 3CW2A 1E1QA 1M90D 3ONYA 5FO1A 4YXWA 3DDYA 3CCEB 3G6EB 4Z4TA 1D2EA 1XFOA 2ZITA 1KZLA 2R6HA 1V0FA 1ZM4A 2C4TA 1WOOA 5IK2A 3QFSA 1ZM3A 3P27A 4QVAA 3H94A 1E79A 2EFGA 4NBSA 3QFCA 4TKOB 2V7QA 1E62A 1W9XA 1EWYA 3FPPA 1OB5A 1EP2B 2PMDA 4NCNA 3A1PA 4RD4A 3ZUGA 2FX3A 4P1VA 4X7DA 1VF7A 4B3XA 1M1KD 3BY2A 4XONA 3FKSA 3I1FA 4OP7A 3G05A 4R71A 1UD8A 3VNUA 1G7SA 2BPOA 1WSRA 1ZUNB 2Q6IA 4OPVA 2ZL5A 3OPOA 4X05A 1VQ7B 4HE5A 2ZZFA 2DCUA 1UD5A 2ZXHA 4Q7JB 2JN9A 2VNIA 1FNDA 3OP1A 1H85A 3ZC3A 3WQZA 5A8AA 4XORA 3U2QA 3BC9A 2BN4A 4QHYA 3MHPA 1WDTA 2ZL7A 1VQ4B 2XOKA 5A88A 1NB9A 1VLOA 2VJJA 2XNCA 2QDXA 2D3NA 4P6VF 1XB2A 1JNYA 1FNBA 4RM0A 4G7XA 2DEUA 3GQBA 1E64A 3ISXA 2EIXA 4Z4ZA 5FO0A 2XNDA 3AVVA 3BCFA 4ASUA 1P4MA 4G1VA 3RY8A 2C5HA 1YITB 1YJ9B 3CCJB 2ZZGA 3T51B 2OK8A 1U2RA 1MABA 2B7BA 2C4UA 2PE3A 3WY9A 3Q39A 1E1RA 4Z4SA 3ZBTA 2CRVA 4OOSA 4Z4YA 2CW5A 3CB4A 2ZZEA 4DNTB 3Q6QA 3Q6RA 2F43A 4ZCLA 4ACAA 4X7CA 3ZBUA 4X06A 2D3LA 4RCYA 1NB0A 1QGZA 3B8HA 3GVLA 4XLEA 1Q9SA 4B44A 1I18A 4KKSA 3R6JA 2ZZQA 3VR6A 4LBYA 2KVOA 4YAFA 1W0JA 5E6TA 4QFMA 2YWGA 2D74A 3OFNA 5IYQA 1R5OA 5H59A 5J35A 3OZUA 3B78A 2Q6KA 3GVKA 3E20A 2GJRA 4WZKA 1WORA 5IYNA 1FNCA 1EFTA 3ASPA 4K1XA 1Q7YD 1H8EA 5DSZA 3W2IA 1RQRA 4RD6A 1PJ6A 4ROXA 4HE6A 1KK2A 2W6IA 1JA0A 2BM0A 2X3UA 4XOTA 4PAAA 3AGQA 4P9SA 1J9ZA 1NRKA 4TMVA 3V76A 2OYNA 4CQJA 2V7XA 3AVWA 1N0UA 1T6ZA 3A3GA 4XLHA 4C0SA 4XN0A 2VBSA 3CCUB 3AVXA 3OKXA 1W34A 2BF4A 2NV4A 4TMZA 1B23P 1N05A 3CTAA 4RJLA 1E63A 3AVYA 4WZTA 2VBVA 3VO2A 1KJZA 3OZWA 4AC9A 2C77A 4AF7A 3FJOA 4TMWA 3VNVA 5KSWB 4P22A 3SLNA 3ASTA 4M0LA 1Q86D 2GK7A 3OJXA 1DARA 3QFTA 3CCQB 4IW3B 2B7CA 2OBSA 4OOVA 5KW9A 4G6IA 2GQFA 4AF6A 3SJPA 1WU8A 1KD1D 2OBRA 3OAAA 4M1KA 2PIAA 3BH4A 4KKTA 4XKWA 3W2FA 2OK7A 3CPWB 3CMMA 4PC3A 1VQKB 4X07A 1VHOA 4X8IA 2HDNB 1OB0A 4NNJA 3SKBA 1YI2B 1MRZA 3BNWA 1JB9A 1S0UA 5DS0A 1JJ2B 2DY1A 2WJYA 1NJID 3OW7A 3QE2A 1T6XA 5DN6A 3U6BA 2X85A 3CRZA 5F4MA 4X0CA 2DETA 4HIZA 4DK1A 2B5OA 4ZCMA 1WTHD 2DIEA 2C5BA 5H5JA 4TMXA 2GPJA 5BSXA 2JIZA 3CMAB 2V4DA 3BCDA 4J0QA 2QN6A 4M4SA 1QUFA 1YIJB 2JJ1A 3CC2B 3OW2B 1KC8D 1UMKA 3SEJA 4ACBA 5TRDA 4N3NA 4P6YA 4UZUA 1S72B 4P26A 4L8JA 2E1BA 3WNBA 4M53A 4MYUA 3A3BA 2C2WA 4F7DA 3KEWA 2VBUA 2VZLA 4TN1A 1VQ9B 4WQMA 2WZPP 2QTLA 1QFYA 1S4MA 3W5VA 3VO1A 3CP8A 1COWA 2BGJA 2VBTA 3NE5B 4FK8A 2QGGA 1KMHA 2NPFA 3QSYA 4QV2A 3CXCB 5GV8A 1JA1A 1IJFA 3WBKA 1SKYB 3FPKA 2X6XA 4LC0A 4XLFA 1W2BB 1YLOA 1D8TA 3JQQA 4FN5A 2YWHA 5IYPA 1BLIA 1PKVA 3JQRA 4RDKA 1T5EA 1G7CA 1RQPA 5JBQA 1ZM9A 3V7AA 4DQKA 1FX0A 3OEEA 3A8JA 5L46A 1R5BA 3WYAA 4XKVA 3I55B 4M2LA 1V0EA 3CCMB 1QG0A 2WYRA 3LQEA 1CNEA 3ONUA 4XLCA 4PC1A 2ZTGA 4OOXA 2ZXIA 3QFRA 4RD3A 1YHQB 1DDGA 4G1BA 1PJ5A 1N08A 2V31A 5HZAA 1OB2A 4OPOA 1Y0RA 2DERA 1F60A 4II3A 1VQMB 1WOSA 2QE7A 1IB0A 2WZNA 2F4NA 4XN3A 1TUIA 4P12A 2X8KA 4PC6A 4B47A 3WNDA 1T6YA 1GO2A 4B3GA 1QUEA 4N3GA 1VQ8B 1ZM2A 4Z4RA 2V7UA 1YX2A 4TT3A 5HXBA 3SJZA 3VMFA 1EXMA 1E3ZA 2ZBVA 1KK1A 4Y7CA 4PGOA 2Q6OA 4B3FX 1W35A 3HAGA 4YAUA 2XGJA 4ZV4A 2WPDA 4B43A 2AHOA 1QX4A 2BV3A 2I1LA 1WPCA 4LBWA 4P3YA 4Z4UA 5J3OA 3J81k 4XL9A 1SM4A 5THXA 1EFCA 5HZBA 3T56B 2CC2A 1VQ6B 3W2HA 2GJKA 1UD4A 3BQJA 2P3MA 4RPDA 1OHHA 3W2EA 5IYRA 4II2A 4RD2A 1QVFB 1BQEA 1BX0A 1IHMA 4UZEA 1AIPA 3OE7A 3JU4A 3D26A 4RD1A 3ZIAA 1XE1A 4GQNA 4YALA 1N8RD 1NBMA 1EFUA 2OBTA 4WWVA 1E3XA 1EP3B 4YEJA 5FNZA 1Q82D 4DNRB 1Q81D 1KK0A 3KL9A 4RDLA 1V5VA 5EMNA 4DQLA 3CCLB 1FNMA 1UD6A 3OJWA 4C43A 2FVGA 1QGYA 1GVHA 1YJNB 1K73D 2E1RA 1BJKA 1H8HA 1GAQA 1K9MD 1QH0A 1VQNB 2BMWA 2XZPA 2VNJA 4YHBA 3SLDA 1QVGB 3CCRB 2GJPA 3OEHA 3W5HA 1IJEA 4XQFA 1KQSB 3I56B 4XOPA 1GAWA 3A35A 3G71B 3U6KA 1QFZA 4RLZA 1G7RA 3W2GA 1HVXA 2JJ2A 2CF4A 4X7EA 2GREA 3JQPA 4PC7A 4TMTA 1G7TA 1WOPA 4Z4VA 2BM1A 3Q38A 2QMUA 2DYIA 1KRHA 4ZGNB 5GV7A 2V7VA 4XR6A 5FA6A 3PA2A 5B6IA 4YAOA 1F20A 1AMOA 4TSFA 2D9RA 3PENA 3BY1A 3R6KA 4RD0A 1W0KA 2RC6A 1GJRA 4JMQA 5F4OA 1VQ5B 5FL7A 3CCVB 1KTVA 2QA4B 4LBZA 1E43A 1H42A 3G4SB 2Z6BD 2J7KA 2V7TA 1PJ7A 3CP2A 2PLFA 2OTLB 2QEXB 4ZCIA 5BSYA 1OGJA 1HZEA 3MCAA 4B48A 1R5NA 1FRNA 3PVDA 1VQLB 2WSSA 1K8AD 2HLDA 2HCJB 1N07A 3ASRA 3PA1A 1XQBA 3PUNA 3ASQA 4AVZA 2X0KA 4DK0A 5TY0A 3OZVA 1DDIA 5CDFA 3GSIA 3ZPNA 3P26A 1HA3A 2DOGA 4UZFA 2YWEA 4XM3A 2GK6A 4OPSA 3ZZUA 2LZJA 1VQPB 3WNCA 2VNKA 1NDHA 5F4JA 3LO8A 4ZGQB 2VNHA 2RC5A 5KNLA 1CQXA 4WZEA 1N06A 4P25A 5IYWA 1WSVA 4P2NA 1UD3A 1I8DA 3ZZTA 2W6JA 4G7WA 4KKUA 4RPBA 1OGIA 4WZLA 4Z1MA 4BPRA 1B2RA 3A8KA 4PC2A 1SKQA 2BVNA 1GR1A 4X7FA 4YELA 1KK3A 2X6YA 4H9GA 2YWFA 2C78A 4U9UA 3AVUA 1ELOA 3B82A 5TR9A 5HKKA 4Y9UA 1I7PA 5LMZA 2XNJA 4RCZA 4XMYA 2BGIA 3ASSA 1Y0YA 5TV2A 3WXMA 3OOCA 2JDIA 3LQ6A 4LBVA 5AN9A 2HMAA 1EP1B 4XNFA 4YAWA 3MMPA
chains in the Genus database with same CATH topology
2P3MA 2X0KA 2OYNA 5TRDA 1P4MA 1T6ZA 5FO1A 1T6YA 4UZFA 4UZEA 2VBSA 1MRZA 1N05A 3BNWA 3CTAA 2VBUA 3OP1A 2VBVA 5A8AA 5FNZA 1S4MA 1T6XA 1N06A 2VBTA 5A88A 2I1LA 5A89A 1NB9A 1N08A 1NB0A 3ZUGA 1Q9SA 1N07A 5FO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P3M A;  2X0K A;  2OYN A;  5TRD A;  1P4M A;  1T6Z A;  5FO1 A;  1T6Y A;  4UZF A;  4UZE A;  2VBS A;  1MRZ A;  1N05 A;  3BNW A;  3CTA A;  2VBU A;  3OP1 A;  2VBV A;  5A8A A;  5FNZ A;  1S4M A;  1T6X A;  1N06 A;  2VBT A;  5A88 A;  2I1L A;  5A89 A;  1NB9 A;  1N08 A;  1NB0 A;  3ZUG A;  1Q9S A;  1N07 A;  5FO0 A; 
#chains in the Genus database with same CATH topology
 2F1L A;  3H9N A;  3LNN A;  3GVJ A;  2ZL6 A;  4G5G A;  1A8P A;  1VHE A;  3CD6 B;  1TVC A;  1FRQ A;  2ZTN A;  2CK3 A;  2V7W A;  1YJW B;  1W87 A;  4E0F A;  2X6W A;  4FWT A;  4XLA A;  4P3I A;  1WP6 A;  1VLY A;  2VJI A;  3W5U A;  2CBX A;  4Z4W A;  1BX1 A;  5A89 A;  3LVB A;  1EFR A;  3CC7 B;  4XD7 A;  1UD2 A;  1D1N A;  2R9V A;  4FXU A;  1QFJ A;  4MYT A;  4QUZ A;  2F1M A;  3CPX A;  2XZO A;  4QVJ A;  3ZZ0 A;  1N0V C;  4B4D A;  2XEX A;  1CNF A;  1VJS A;  3A8I A;  1BPL A;  2Q6L A;  3CES A;  4PAB A;  5FIU A;  4RDJ A;  2VYQ A;  3E1Y E;  4UAJ A;  3PUM A;  2M5S A;  1QGA A;  1K28 D;  3CC4 B;  3GIR A;  1VQO B;  3ES9 A;  2QTZ A;  2ZBU A;  2CND A;  1DG1 G;  4EH1 A;  3CCS B;  3AGP A;  4Y9R A;  3WBJ A;  2WJV A;  1TLL A;  3AVT A;  2XZL A;  3Q3A A;  3T53 B;  1BMF A;  3CME B;  2WR8 A;  1FDR A;  2X53 S;  2BSA A;  1TTT A;  2OTJ B;  3CW2 A;  1E1Q A;  1M90 D;  3ONY A;  5FO1 A;  4YXW A;  3DDY A;  3CCE B;  3G6E B;  4Z4T A;  1D2E A;  1XFO A;  2ZIT A;  1KZL A;  2R6H A;  1V0F A;  1ZM4 A;  2C4T A;  1WOO A;  5IK2 A;  3QFS A;  1ZM3 A;  3P27 A;  4QVA A;  3H94 A;  1E79 A;  2EFG A;  4NBS A;  3QFC A;  4TKO B;  2V7Q A;  1E62 A;  1W9X A;  1EWY A;  3FPP A;  1OB5 A;  1EP2 B;  2PMD A;  4NCN A;  3A1P A;  4RD4 A;  3ZUG A;  2FX3 A;  4P1V A;  4X7D A;  1VF7 A;  4B3X A;  1M1K D;  3BY2 A;  4XON A;  3FKS A;  3I1F A;  4OP7 A;  3G05 A;  4R71 A;  1UD8 A;  3VNU A;  1G7S A;  2BPO A;  1WSR A;  1ZUN B;  2Q6I A;  4OPV A;  2ZL5 A;  3OPO A;  4X05 A;  1VQ7 B;  4HE5 A;  2ZZF A;  2DCU A;  1UD5 A;  2ZXH A;  4Q7J B;  2JN9 A;  2VNI A;  1FND A;  3OP1 A;  1H85 A;  3ZC3 A;  3WQZ A;  5A8A A;  4XOR A;  3U2Q A;  3BC9 A;  2BN4 A;  4QHY A;  3MHP A;  1WDT A;  2ZL7 A;  1VQ4 B;  2XOK A;  5A88 A;  1NB9 A;  1VLO A;  2VJJ A;  2XNC A;  2QDX A;  2D3N A;  4P6V F;  1XB2 A;  1JNY A;  1FNB A;  4RM0 A;  4G7X A;  2DEU A;  3GQB A;  1E64 A;  3ISX A;  2EIX A;  4Z4Z A;  5FO0 A;  2XND A;  3AVV A;  3BCF A;  4ASU A;  1P4M A;  4G1V A;  3RY8 A;  2C5H A;  1YIT B;  1YJ9 B;  3CCJ B;  2ZZG A;  3T51 B;  2OK8 A;  1U2R A;  1MAB A;  2B7B A;  2C4U A;  2PE3 A;  3WY9 A;  3Q39 A;  1E1R A;  4Z4S A;  3ZBT A;  2CRV A;  4OOS A;  4Z4Y A;  2CW5 A;  3CB4 A;  2ZZE A;  4DNT B;  3Q6Q A;  3Q6R A;  2F43 A;  4ZCL A;  4ACA A;  4X7C A;  3ZBU A;  4X06 A;  2D3L A;  4RCY A;  1NB0 A;  1QGZ A;  3B8H A;  3GVL A;  4XLE A;  1Q9S A;  4B44 A;  1I18 A;  4KKS A;  3R6J A;  2ZZQ A;  3VR6 A;  4LBY A;  2KVO A;  4YAF A;  1W0J A;  5E6T A;  4QFM A;  2YWG A;  2D74 A;  3OFN A;  5IYQ A;  1R5O A;  5H59 A;  5J35 A;  3OZU A;  3B78 A;  2Q6K A;  3GVK A;  3E20 A;  2GJR A;  4WZK A;  1WOR A;  5IYN A;  1FNC A;  1EFT A;  3ASP A;  4K1X A;  1Q7Y D;  1H8E A;  5DSZ A;  3W2I A;  1RQR A;  4RD6 A;  1PJ6 A;  4ROX A;  4HE6 A;  1KK2 A;  2W6I A;  1JA0 A;  2BM0 A;  2X3U A;  4XOT A;  4PAA A;  3AGQ A;  4P9S A;  1J9Z A;  1NRK A;  4TMV A;  3V76 A;  2OYN A;  4CQJ A;  2V7X A;  3AVW A;  1N0U A;  1T6Z A;  3A3G A;  4XLH A;  4C0S A;  4XN0 A;  2VBS A;  3CCU B;  3AVX A;  3OKX A;  1W34 A;  2BF4 A;  2NV4 A;  4TMZ A;  1B23 P;  1N05 A;  3CTA A;  4RJL A;  1E63 A;  3AVY A;  4WZT A;  2VBV A;  3VO2 A;  1KJZ A;  3OZW A;  4AC9 A;  2C77 A;  4AF7 A;  3FJO A;  4TMW A;  3VNV A;  5KSW B;  4P22 A;  3SLN A;  3AST A;  4M0L A;  1Q86 D;  2GK7 A;  3OJX A;  1DAR A;  3QFT A;  3CCQ B;  4IW3 B;  2B7C A;  2OBS A;  4OOV A;  5KW9 A;  4G6I A;  2GQF A;  4AF6 A;  3SJP A;  1WU8 A;  1KD1 D;  2OBR A;  3OAA A;  4M1K A;  2PIA A;  3BH4 A;  4KKT A;  4XKW A;  3W2F A;  2OK7 A;  3CPW B;  3CMM A;  4PC3 A;  1VQK B;  4X07 A;  1VHO A;  4X8I A;  2HDN B;  1OB0 A;  4NNJ A;  3SKB A;  1YI2 B;  1MRZ A;  3BNW A;  1JB9 A;  1S0U A;  5DS0 A;  1JJ2 B;  2DY1 A;  2WJY A;  1NJI D;  3OW7 A;  3QE2 A;  1T6X A;  5DN6 A;  3U6B A;  2X85 A;  3CRZ A;  5F4M A;  4X0C A;  2DET A;  4HIZ A;  4DK1 A;  2B5O A;  4ZCM A;  1WTH D;  2DIE A;  2C5B A;  5H5J A;  4TMX A;  2GPJ A;  5BSX A;  2JIZ A;  3CMA B;  2V4D A;  3BCD A;  4J0Q A;  2QN6 A;  4M4S A;  1QUF A;  1YIJ B;  2JJ1 A;  3CC2 B;  3OW2 B;  1KC8 D;  1UMK A;  3SEJ A;  4ACB A;  5TRD A;  4N3N A;  4P6Y A;  4UZU A;  1S72 B;  4P26 A;  4L8J A;  2E1B A;  3WNB A;  4M53 A;  4MYU A;  3A3B A;  2C2W A;  4F7D A;  3KEW A;  2VBU A;  2VZL A;  4TN1 A;  1VQ9 B;  4WQM A;  2WZP P;  2QTL A;  1QFY A;  1S4M A;  3W5V A;  3VO1 A;  3CP8 A;  1COW A;  2BGJ A;  2VBT A;  3NE5 B;  4FK8 A;  2QGG A;  1KMH A;  2NPF A;  3QSY A;  4QV2 A;  3CXC B;  5GV8 A;  1JA1 A;  1IJF A;  3WBK A;  1SKY B;  3FPK A;  2X6X A;  4LC0 A;  4XLF A;  1W2B B;  1YLO A;  1D8T A;  3JQQ A;  4FN5 A;  2YWH A;  5IYP A;  1BLI A;  1PKV A;  3JQR A;  4RDK A;  1T5E A;  1G7C A;  1RQP A;  5JBQ A;  1ZM9 A;  3V7A A;  4DQK A;  1FX0 A;  3OEE A;  3A8J A;  5L46 A;  1R5B A;  3WYA A;  4XKV A;  3I55 B;  4M2L A;  1V0E A;  3CCM B;  1QG0 A;  2WYR A;  3LQE A;  1CNE A;  3ONU A;  4XLC A;  4PC1 A;  2ZTG A;  4OOX A;  2ZXI A;  3QFR A;  4RD3 A;  1YHQ B;  1DDG A;  4G1B A;  1PJ5 A;  1N08 A;  2V31 A;  5HZA A;  1OB2 A;  4OPO A;  1Y0R A;  2DER A;  1F60 A;  4II3 A;  1VQM B;  1WOS A;  2QE7 A;  1IB0 A;  2WZN A;  2F4N A;  4XN3 A;  1TUI A;  4P12 A;  2X8K A;  4PC6 A;  4B47 A;  3WND A;  1T6Y A;  1GO2 A;  4B3G A;  1QUE A;  4N3G A;  1VQ8 B;  1ZM2 A;  4Z4R A;  2V7U A;  1YX2 A;  4TT3 A;  5HXB A;  3SJZ A;  3VMF A;  1EXM A;  1E3Z A;  2ZBV A;  1KK1 A;  4Y7C A;  4PGO A;  2Q6O A;  4B3F X;  1W35 A;  3HAG A;  4YAU A;  2XGJ A;  4ZV4 A;  2WPD A;  4B43 A;  2AHO A;  1QX4 A;  2BV3 A;  2I1L A;  1WPC A;  4LBW A;  4P3Y A;  4Z4U A;  5J3O A;  3J81 k;  4XL9 A;  1SM4 A;  5THX A;  1EFC A;  5HZB A;  3T56 B;  2CC2 A;  1VQ6 B;  3W2H A;  2GJK A;  1UD4 A;  3BQJ A;  2P3M A;  4RPD A;  1OHH A;  3W2E A;  5IYR A;  4II2 A;  4RD2 A;  1QVF B;  1BQE A;  1BX0 A;  1IHM A;  4UZE A;  1AIP A;  3OE7 A;  3JU4 A;  3D26 A;  4RD1 A;  3ZIA A;  1XE1 A;  4GQN A;  4YAL A;  1N8R D;  1NBM A;  1EFU A;  2OBT A;  4WWV A;  1E3X A;  1EP3 B;  4YEJ A;  5FNZ A;  1Q82 D;  4DNR B;  1Q81 D;  1KK0 A;  3KL9 A;  4RDL A;  1V5V A;  5EMN A;  4DQL A;  3CCL B;  1FNM A;  1UD6 A;  3OJW A;  4C43 A;  2FVG A;  1QGY A;  1GVH A;  1YJN B;  1K73 D;  2E1R A;  1BJK A;  1H8H A;  1GAQ A;  1K9M D;  1QH0 A;  1VQN B;  2BMW A;  2XZP A;  2VNJ A;  4YHB A;  3SLD A;  1QVG B;  3CCR B;  2GJP A;  3OEH A;  3W5H A;  1IJE A;  4XQF A;  1KQS B;  3I56 B;  4XOP A;  1GAW A;  3A35 A;  3G71 B;  3U6K A;  1QFZ A;  4RLZ A;  1G7R A;  3W2G A;  1HVX A;  2JJ2 A;  2CF4 A;  4X7E A;  2GRE A;  3JQP A;  4PC7 A;  4TMT A;  1G7T A;  1WOP A;  4Z4V A;  2BM1 A;  3Q38 A;  2QMU A;  2DYI A;  1KRH A;  4ZGN B;  5GV7 A;  2V7V A;  4XR6 A;  5FA6 A;  3PA2 A;  5B6I A;  4YAO A;  1F20 A;  1AMO A;  4TSF A;  2D9R A;  3PEN A;  3BY1 A;  3R6K A;  4RD0 A;  1W0K A;  2RC6 A;  1GJR A;  4JMQ A;  5F4O A;  1VQ5 B;  5FL7 A;  3CCV B;  1KTV A;  2QA4 B;  4LBZ A;  1E43 A;  1H42 A;  3G4S B;  2Z6B D;  2J7K A;  2V7T A;  1PJ7 A;  3CP2 A;  2PLF A;  2OTL B;  2QEX B;  4ZCI A;  5BSY A;  1OGJ A;  1HZE A;  3MCA A;  4B48 A;  1R5N A;  1FRN A;  3PVD A;  1VQL B;  2WSS A;  1K8A D;  2HLD A;  2HCJ B;  1N07 A;  3ASR A;  3PA1 A;  1XQB A;  3PUN A;  3ASQ A;  4AVZ A;  2X0K A;  4DK0 A;  5TY0 A;  3OZV A;  1DDI A;  5CDF A;  3GSI A;  3ZPN A;  3P26 A;  1HA3 A;  2DOG A;  4UZF A;  2YWE A;  4XM3 A;  2GK6 A;  4OPS A;  3ZZU A;  2LZJ A;  1VQP B;  3WNC A;  2VNK A;  1NDH A;  5F4J A;  3LO8 A;  4ZGQ B;  2VNH A;  2RC5 A;  5KNL A;  1CQX A;  4WZE A;  1N06 A;  4P25 A;  5IYW A;  1WSV A;  4P2N A;  1UD3 A;  1I8D A;  3ZZT A;  2W6J A;  4G7W A;  4KKU A;  4RPB A;  1OGI A;  4WZL A;  4Z1M A;  4BPR A;  1B2R A;  3A8K A;  4PC2 A;  1SKQ A;  2BVN A;  1GR1 A;  4X7F A;  4YEL A;  1KK3 A;  2X6Y A;  4H9G A;  2YWF A;  2C78 A;  4U9U A;  3AVU A;  1ELO A;  3B82 A;  5TR9 A;  5HKK A;  4Y9U A;  1I7P A;  5LMZ A;  2XNJ A;  4RCZ A;  4XMY A;  2BGI A;  3ASS A;  1Y0Y A;  5TV2 A;  3WXM A;  3OOC A;  2JDI A;  3LQ6 A;  4LBV A;  5AN9 A;  2HMA A;  1EP1 B;  4XNF A;  4YAW A;  3MMP A; 
#chains in the Genus database with same CATH homology
 2P3M A;  2X0K A;  2OYN A;  5TRD A;  1P4M A;  1T6Z A;  5FO1 A;  1T6Y A;  4UZF A;  4UZE A;  2VBS A;  1MRZ A;  1N05 A;  3BNW A;  3CTA A;  2VBU A;  3OP1 A;  2VBV A;  5A8A A;  5FNZ A;  1S4M A;  1T6X A;  1N06 A;  2VBT A;  5A88 A;  2I1L A;  5A89 A;  1NB9 A;  1N08 A;  1NB0 A;  3ZUG A;  1Q9S A;  1N07 A;  5FO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...