2VBVA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp and fmn
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
134
structure length
134
Chain Sequence
MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RIBOFLAVIN KINASE
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
total genus 23
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbvA01
3OP1A 2VBSA 5TRDA 2VBTA 1T6YA 2P3MA 4UZEA 1NB0A 5A88A 2VBVA 3BNWA 1N08A 2VBUA 1N05A 5FNZA 5FO1A 1S4MA 5A89A 3CTAA 3ZUGA 1N06A 2I1LA 1NB9A 1P4MA 5FO0A 1T6ZA 1MRZA 1Q9SA 2OYNA 1N07A 4UZFA 2X0KA 5A8AA 1T6XA
chains in the Genus database with same CATH superfamily
3ZBUA 1K8AD 1FX0A 2XOKA 5L46A 1B23P 2ZTNA 1WP6A 2F1LA 4XKVA 4XLFA 4Q7JB 2HCJB 4Z1MA 3ZZUA 4P3IA 3VMFA 1KMHA 3VO2A 1W2BB 4PC2A 1YX2A 3ASRA 1UD5A 2RC6A 1PJ5A 4J0QA 3SEJA 4Z4ZA 2V7XA 3A8JA 2FX3A 4YXWA 3MHPA 2BF4A 3Q38A 1U2RA 2C5BA 2WR8A 1WPCA 1WTHD 2QA4B 2V7VA 3PENA 1YI2B 2DERA 2VJIA 3BC9A 1EWYA 3WBKA 1SKYB 2C4UA 2Q6LA 1VHEA 2B7BA 2BV3A 4B3FX 3QFSA 5HKKA 3CTAA 2VNKA 2ZL5A 4HIZA 3SKBA 3W2EA 1W35A 5TR9A 2I1LA 5THXA 4RDJA 1VQ7B 3AGPA 4OPOA 1KQSB 4K1XA 4NNJA 1K9MD 2DY1A 3I56B 2W6IA 4RCZA 2D3LA 4M2LA 4AF6A 3AVVA 2VZLA 4QV2A 2FVGA 1MABA 4LBWA 1EFTA 4P6VF 4YHBA 2C5HA 3CCUB 4P6YA 1VQ8B 2X6WA 1M1KD 3E1YE 1N0UA 2V7UA 3CP8A 4P9SA 3CPWB 5AN9A 3WXMA 4YAUA 4YELA 1VLYA 5GV8A 4B4DA 3OZVA 3U2QA 1QVFB 3W2HA 1Q81D 1VQOB 4DQLA 3WQZA 5B6IA 4DNRB 3ES9A 1WDTA 4OOVA 1PJ6A 1W34A 2VJJA 1E64A 5HZBA 4OP7A 4X7CA 4XOTA 3ZIAA 3I55B 3ASTA 3G71B 4RD1A 1TLLA 1KK2A 3CC4B 1NBMA 2BGIA 3HAGA 1KZLA 1YJNB 4X0CA 2QMUA 2ZITA 4OPVA 2WPDA 3OP1A 5TRDA 4DK1A 4QUZA 3ZZ0A 1BPLA 2GJPA 4N3NA 3AVUA 5IYNA 3WNDA 1GAQA 4TKOB 2V7WA 2JN9A 3BQJA 4RD0A 2LZJA 1YIJB 1AIPA 3FPKA 3AVXA 3MCAA 2GQFA 2Q6IA 4H9GA 1DARA 2VNJA 1CNEA 4M1KA 4II2A 1ZM9A 2C2WA 3ASSA 1E62A 3U6KA 2GK7A 4TMVA 4FN5A 5TV2A 3CC7B 1N8RD 1T6XA 1QUEA 2VBSA 2V7QA 1UD4A 5GV7A 3R6JA 4XD7A 1VQ9B 2DEUA 1VLOA 1OB2A 1EP1B 3W2FA 1ELOA 1S4MA 4XLHA 4XONA 4RD6A 5CDFA 2PLFA 1Q7YD 1CNFA 4XR6A 2R9VA 3LNNA 3QFCA 3J81k 1ZM2A 1NJID 3CCLB 2JIZA 1GAWA 4WQMA 3A1PA 3CESA 1S0UA 3W2IA 2OBSA 4X7EA 1H85A 4Y9RA 3CCQB 1TVCA 4DQKA 4X7FA 1G7SA 2XZOA 3KEWA 3GQBA 4KKSA 3CMMA 1SKQA 1WU8A 1RQPA 1Y0RA 3BCDA 3D26A 2VBVA 1R5OA 1YLOA 2WJYA 1VQMB 1N08A 5LMZA 4II3A 2EIXA 1EFCA 4KKUA 2YWFA 1IJEA 4LC0A 4TMTA 4YAOA 5H59A 3V76A 3G4SB 1QVGB 1GVHA 2GK6A 1FNDA 3CCEB 3ZC3A 1H8HA 3SLNA 1YITB 1NB9A 4PGOA 2BGJA 3ZPNA 4Z4TA 1UD3A 4G1VA 4P22A 4M0LA 3AVWA 1MRZA 1H8EA 4Z4RA 1E1RA 4M53A 1B2RA 4Z4UA 2CRVA 1N07A 1YHQB 1NDHA 2GJRA 2Q6KA 4Y7CA 4ZGNB 4Z4YA 4OOSA 5JBQA 3B82A 3JU4A 4XN0A 2CK3A 1JA1A 5A88A 1K28D 3CMAB 4Z4WA 1T5EA 5DN6A 4XM3A 4GQNA 4ZV4A 5KNLA 4DK0A 3OW2B 3CPXA 3CW2A 1I8DA 3T51B 1QX4A 5A89A 1JB9A 2WJVA 1D8TA 3OW7A 2QGGA 3JQRA 4RPDA 5IK2A 1G7TA 1OGJA 4E0FA 5FO0A 4Z4VA 4P3YA 3SLDA 4G7WA 1VQPB 1EP2B 1QFYA 4XORA 1YJWB 3B78A 2XZPA 1WOSA 2CC2A 4QVAA 2XZLA 1WSVA 3ASQA 4OPSA 2X0KA 3A35A 2YWEA 1VQKB 1ZUNB 1XFOA 1QFZA 3ONUA 4ZCIA 1BX1A 3LVBA 2PE3A 4F7DA 2OTJB 4G1BA 2BPOA 4B44A 1BMFA 4NBSA 5F4MA 1VQ6B 2X3UA 1QGAA 3I1FA 1I7PA 4R71A 3ONYA 1QG0A 3PA1A 4N3GA 3NE5B 4RDLA 4QFMA 1N06A 2WYRA 4PAAA 1VHOA 2X6YA 1E63A 2C4TA 4FK8A 3FKSA 4WZKA 2CBXA 3ZBTA 1Q9SA 1WOPA 4XQFA 4G7XA 4M4SA 2OK8A 1E3XA 2ZZGA 1IJFA 1W9XA 1JNYA 3Q6QA 2GJKA 1V0FA 3BNWA 1H42A 4ACAA 4WZTA 1R5BA 5IYQA 3GSIA 2F43A 3MMPA 5FNZA 4AF7A 1PKVA 4TN1A 1EFRA 4ZCLA 4PABA 5EMNA 4G6IA 4YEJA 4Y9UA 4B3GA 3JQPA 4PC3A 3WY9A 5J3OA 3DDYA 1K73D 1VQ5B 3R6KA 3FPPA 4RDKA 1HA3A 2ZBUA 2F1MA 2JJ1A 3RY8A 1BQEA 5DSZA 4UZFA 3W5VA 1QUFA 2ZTGA 2D9RA 4YALA 4RD3A 3T56B 1G7CA 1UD2A 3ASPA 3Q3AA 3U6BA 3OFNA 2X85A 1G7RA 2XNCA 4NCNA 4UZUA 1E79A 3OKXA 3VR6A 1IB0A 3VNUA 1KRHA 2C78A 5BSYA 1VQNB 1FNMA 3OZUA 5FL7A 2DCUA 4FXUA 3AVTA 2DIEA 2NV4A 2PIAA 1RQRA 1N0VC 4PC6A 1QGYA 4XL9A 2QDXA 1OGIA 1EFUA 4LBYA 1KC8D 1KK1A 1FRNA 1ZM4A 4RJLA 5KW9A 2ZL7A 1NRKA 3SJPA 3B8HA 2M5SA 2P3MA 1D1NA 5KSWB 3OAAA 3Q6RA 1F20A 3ISXA 4TSFA 1GR1A 3CP2A 4XKWA 2GPJA 3OEHA 1KD1D 3H9NA 3T53B 1A8PA 3GVJA 1UD6A 2VNHA 3ZUGA 1V5VA 1HZEA 2OBRA 3CXCB 1VF7A 4ZGQB 4P25A 1P4MA 5FA6A 3FJOA 3CCJB 1T6ZA 4X05A 2QEXB 4P1VA 4RM0A 4X06A 4WZEA 1W87A 2QN6A 3OEEA 2RC5A 5J35A 4IW3B 1FNCA 4XLCA 3CCVB 2ZXHA 1SM4A 2J7KA 1D2EA 4BPRA 3VO1A 4UZEA 4AC9A 4G5GA 2HDNB 1QH0A 2Q6OA 2VYQA 2CNDA 4YAWA 2HLDA 3JQQA 3OE7A 3GVKA 4L8JA 3PUNA 2DOGA 5F4JA 5FO1A 4U9UA 4Z4SA 2E1RA 4TMXA 1Y0YA 1WOOA 2D3NA 3OJXA 1XE1A 1AMOA 4C0SA 3BH4A 5HXBA 4B48A 3BY1A 3WNBA 4RCYA 4P26A 2WSSA 4CQJA 3LQEA 1DDIA 3ZZTA 3OZWA 1GO2A 2AHOA 2ZXIA 3OPOA 4KKTA 1NB0A 3CB4A 2ZL6A 4ASUA 2WZNA 4TT3A 1COWA 2E1BA 2V4DA 1FRQA 1OHHA 1UD8A 3GIRA 1E43A 1IHMA 2OTLB 4DNTB 2DYIA 2W6JA 4HE6A 4PC7A 2C77A 4TMWA 2CW5A 4EH1A 2PMDA 2KVOA 1R5NA 3A3GA 1EXMA 5IYWA 4XNFA 4WZLA 3OJWA 4TMZA 2QTLA 1BJKA 2HMAA 1J9ZA 3WBJA 1Q86D 4P12A 4LBZA 2BM1A 1VQ4B 4B3XA 2XGJA 1DDGA 2ZBVA 4MYUA 4HE5A 2BN4A 2JJ2A 4B47A 4AVZA 3W5HA 4C43A 1M90D 3CD6B 2V31A 4FWTA 4RD2A 3CC2B 1EP3B 2QE7A 2X8KA 4RPBA 2XNDA 3W2GA 2VBUA 2GREA 4XLAA 1QGZA 4ZCMA 1FNBA 4YAFA 2ZZFA 1TTTA 1W0KA 1VJSA 4UAJA 3BCFA 3QFRA 1DG1G 1PJ7A 3P27A 3KL9A 2V7TA 3WNCA 5H5JA 2BM0A 4RLZA 2OYNA 4XN3A 5F4OA 5TY0A 3CRZA 4B43A 3QSYA 4PC1A 2ZZEA 3P26A 4X07A 2NPFA 3PUMA 1YJ9B 1T6YA 1KJZA 3QFTA 1FDRA 3CCRB 1KK0A 2EFGA 2ZZQA 3Q39A 3AVYA 2XNJA 3PVDA 1UMKA 4WWVA 3H94A 1CQXA 1N05A 2R6HA 4X7DA 2DETA 1I18A 2OK7A 5IYPA 1V0EA 2Z6BD 1OB5A 4XLEA 2BMWA 3AGQA 4QVJA 3SJZA 3V7AA 3G6EB 1GJRA 1KK3A 3BY2A 1BLIA 4ACBA 1Q82D 3WYAA 5IYRA 2B5OA 1BX0A 5BSXA 2XEXA 2F4NA 4RD4A 4MYTA 2D74A 1OB0A 2JDIA 4X8IA 2BVNA 4XMYA 1WORA 4OOXA 3GVLA 3QE2A 5A8AA 2CF4A 2X53S 3E20A 2YWHA 3A8IA 2VBTA 4JMQA 5DS0A 5HZAA 2VNIA 3W5UA 1JA0A 1TUIA 1ZM3A 3A8KA 1W0JA 1KTVA 1QFJA 1XQBA 4ROXA 3VNVA 2BSAA 3CCSB 2B7CA 1E1QA 2QTZA 2WZPP 2X6XA 1WSRA 3G05A 3LO8A 2OBTA 1E3ZA 2YWGA 4QHYA 1HVXA 3PA2A 1JJ2B 3LQ6A 5FIUA 4P2NA 1VQLB 3A3BA 5E6TA 3CMEB 1F60A 1XB2A 4LBVA 4XOPA 1S72B 3CCMB 3OOCA
chains in the Genus database with same CATH topology
3OP1A 2VBSA 5TRDA 2VBTA 1T6YA 2P3MA 4UZEA 1NB0A 5A88A 2VBVA 3BNWA 1N08A 2VBUA 1N05A 5FNZA 5FO1A 1S4MA 5A89A 3CTAA 3ZUGA 1N06A 2I1LA 1NB9A 1P4MA 5FO0A 1T6ZA 1MRZA 1Q9SA 2OYNA 1N07A 4UZFA 2X0KA 5A8AA 1T6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OP1 A;  2VBS A;  5TRD A;  2VBT A;  1T6Y A;  2P3M A;  4UZE A;  1NB0 A;  5A88 A;  2VBV A;  3BNW A;  1N08 A;  2VBU A;  1N05 A;  5FNZ A;  5FO1 A;  1S4M A;  5A89 A;  3CTA A;  3ZUG A;  1N06 A;  2I1L A;  1NB9 A;  1P4M A;  5FO0 A;  1T6Z A;  1MRZ A;  1Q9S A;  2OYN A;  1N07 A;  4UZF A;  2X0K A;  5A8A A;  1T6X A; 
#chains in the Genus database with same CATH topology
 3ZBU A;  1K8A D;  1FX0 A;  2XOK A;  5L46 A;  1B23 P;  2ZTN A;  1WP6 A;  2F1L A;  4XKV A;  4XLF A;  4Q7J B;  2HCJ B;  4Z1M A;  3ZZU A;  4P3I A;  3VMF A;  1KMH A;  3VO2 A;  1W2B B;  4PC2 A;  1YX2 A;  3ASR A;  1UD5 A;  2RC6 A;  1PJ5 A;  4J0Q A;  3SEJ A;  4Z4Z A;  2V7X A;  3A8J A;  2FX3 A;  4YXW A;  3MHP A;  2BF4 A;  3Q38 A;  1U2R A;  2C5B A;  2WR8 A;  1WPC A;  1WTH D;  2QA4 B;  2V7V A;  3PEN A;  1YI2 B;  2DER A;  2VJI A;  3BC9 A;  1EWY A;  3WBK A;  1SKY B;  2C4U A;  2Q6L A;  1VHE A;  2B7B A;  2BV3 A;  4B3F X;  3QFS A;  5HKK A;  3CTA A;  2VNK A;  2ZL5 A;  4HIZ A;  3SKB A;  3W2E A;  1W35 A;  5TR9 A;  2I1L A;  5THX A;  4RDJ A;  1VQ7 B;  3AGP A;  4OPO A;  1KQS B;  4K1X A;  4NNJ A;  1K9M D;  2DY1 A;  3I56 B;  2W6I A;  4RCZ A;  2D3L A;  4M2L A;  4AF6 A;  3AVV A;  2VZL A;  4QV2 A;  2FVG A;  1MAB A;  4LBW A;  1EFT A;  4P6V F;  4YHB A;  2C5H A;  3CCU B;  4P6Y A;  1VQ8 B;  2X6W A;  1M1K D;  3E1Y E;  1N0U A;  2V7U A;  3CP8 A;  4P9S A;  3CPW B;  5AN9 A;  3WXM A;  4YAU A;  4YEL A;  1VLY A;  5GV8 A;  4B4D A;  3OZV A;  3U2Q A;  1QVF B;  3W2H A;  1Q81 D;  1VQO B;  4DQL A;  3WQZ A;  5B6I A;  4DNR B;  3ES9 A;  1WDT A;  4OOV A;  1PJ6 A;  1W34 A;  2VJJ A;  1E64 A;  5HZB A;  4OP7 A;  4X7C A;  4XOT A;  3ZIA A;  3I55 B;  3AST A;  3G71 B;  4RD1 A;  1TLL A;  1KK2 A;  3CC4 B;  1NBM A;  2BGI A;  3HAG A;  1KZL A;  1YJN B;  4X0C A;  2QMU A;  2ZIT A;  4OPV A;  2WPD A;  3OP1 A;  5TRD A;  4DK1 A;  4QUZ A;  3ZZ0 A;  1BPL A;  2GJP A;  4N3N A;  3AVU A;  5IYN A;  3WND A;  1GAQ A;  4TKO B;  2V7W A;  2JN9 A;  3BQJ A;  4RD0 A;  2LZJ A;  1YIJ B;  1AIP A;  3FPK A;  3AVX A;  3MCA A;  2GQF A;  2Q6I A;  4H9G A;  1DAR A;  2VNJ A;  1CNE A;  4M1K A;  4II2 A;  1ZM9 A;  2C2W A;  3ASS A;  1E62 A;  3U6K A;  2GK7 A;  4TMV A;  4FN5 A;  5TV2 A;  3CC7 B;  1N8R D;  1T6X A;  1QUE A;  2VBS A;  2V7Q A;  1UD4 A;  5GV7 A;  3R6J A;  4XD7 A;  1VQ9 B;  2DEU A;  1VLO A;  1OB2 A;  1EP1 B;  3W2F A;  1ELO A;  1S4M A;  4XLH A;  4XON A;  4RD6 A;  5CDF A;  2PLF A;  1Q7Y D;  1CNF A;  4XR6 A;  2R9V A;  3LNN A;  3QFC A;  3J81 k;  1ZM2 A;  1NJI D;  3CCL B;  2JIZ A;  1GAW A;  4WQM A;  3A1P A;  3CES A;  1S0U A;  3W2I A;  2OBS A;  4X7E A;  1H85 A;  4Y9R A;  3CCQ B;  1TVC A;  4DQK A;  4X7F A;  1G7S A;  2XZO A;  3KEW A;  3GQB A;  4KKS A;  3CMM A;  1SKQ A;  1WU8 A;  1RQP A;  1Y0R A;  3BCD A;  3D26 A;  2VBV A;  1R5O A;  1YLO A;  2WJY A;  1VQM B;  1N08 A;  5LMZ A;  4II3 A;  2EIX A;  1EFC A;  4KKU A;  2YWF A;  1IJE A;  4LC0 A;  4TMT A;  4YAO A;  5H59 A;  3V76 A;  3G4S B;  1QVG B;  1GVH A;  2GK6 A;  1FND A;  3CCE B;  3ZC3 A;  1H8H A;  3SLN A;  1YIT B;  1NB9 A;  4PGO A;  2BGJ A;  3ZPN A;  4Z4T A;  1UD3 A;  4G1V A;  4P22 A;  4M0L A;  3AVW A;  1MRZ A;  1H8E A;  4Z4R A;  1E1R A;  4M53 A;  1B2R A;  4Z4U A;  2CRV A;  1N07 A;  1YHQ B;  1NDH A;  2GJR A;  2Q6K A;  4Y7C A;  4ZGN B;  4Z4Y A;  4OOS A;  5JBQ A;  3B82 A;  3JU4 A;  4XN0 A;  2CK3 A;  1JA1 A;  5A88 A;  1K28 D;  3CMA B;  4Z4W A;  1T5E A;  5DN6 A;  4XM3 A;  4GQN A;  4ZV4 A;  5KNL A;  4DK0 A;  3OW2 B;  3CPX A;  3CW2 A;  1I8D A;  3T51 B;  1QX4 A;  5A89 A;  1JB9 A;  2WJV A;  1D8T A;  3OW7 A;  2QGG A;  3JQR A;  4RPD A;  5IK2 A;  1G7T A;  1OGJ A;  4E0F A;  5FO0 A;  4Z4V A;  4P3Y A;  3SLD A;  4G7W A;  1VQP B;  1EP2 B;  1QFY A;  4XOR A;  1YJW B;  3B78 A;  2XZP A;  1WOS A;  2CC2 A;  4QVA A;  2XZL A;  1WSV A;  3ASQ A;  4OPS A;  2X0K A;  3A35 A;  2YWE A;  1VQK B;  1ZUN B;  1XFO A;  1QFZ A;  3ONU A;  4ZCI A;  1BX1 A;  3LVB A;  2PE3 A;  4F7D A;  2OTJ B;  4G1B A;  2BPO A;  4B44 A;  1BMF A;  4NBS A;  5F4M A;  1VQ6 B;  2X3U A;  1QGA A;  3I1F A;  1I7P A;  4R71 A;  3ONY A;  1QG0 A;  3PA1 A;  4N3G A;  3NE5 B;  4RDL A;  4QFM A;  1N06 A;  2WYR A;  4PAA A;  1VHO A;  2X6Y A;  1E63 A;  2C4T A;  4FK8 A;  3FKS A;  4WZK A;  2CBX A;  3ZBT A;  1Q9S A;  1WOP A;  4XQF A;  4G7X A;  4M4S A;  2OK8 A;  1E3X A;  2ZZG A;  1IJF A;  1W9X A;  1JNY A;  3Q6Q A;  2GJK A;  1V0F A;  3BNW A;  1H42 A;  4ACA A;  4WZT A;  1R5B A;  5IYQ A;  3GSI A;  2F43 A;  3MMP A;  5FNZ A;  4AF7 A;  1PKV A;  4TN1 A;  1EFR A;  4ZCL A;  4PAB A;  5EMN A;  4G6I A;  4YEJ A;  4Y9U A;  4B3G A;  3JQP A;  4PC3 A;  3WY9 A;  5J3O A;  3DDY A;  1K73 D;  1VQ5 B;  3R6K A;  3FPP A;  4RDK A;  1HA3 A;  2ZBU A;  2F1M A;  2JJ1 A;  3RY8 A;  1BQE A;  5DSZ A;  4UZF A;  3W5V A;  1QUF A;  2ZTG A;  2D9R A;  4YAL A;  4RD3 A;  3T56 B;  1G7C A;  1UD2 A;  3ASP A;  3Q3A A;  3U6B A;  3OFN A;  2X85 A;  1G7R A;  2XNC A;  4NCN A;  4UZU A;  1E79 A;  3OKX A;  3VR6 A;  1IB0 A;  3VNU A;  1KRH A;  2C78 A;  5BSY A;  1VQN B;  1FNM A;  3OZU A;  5FL7 A;  2DCU A;  4FXU A;  3AVT A;  2DIE A;  2NV4 A;  2PIA A;  1RQR A;  1N0V C;  4PC6 A;  1QGY A;  4XL9 A;  2QDX A;  1OGI A;  1EFU A;  4LBY A;  1KC8 D;  1KK1 A;  1FRN A;  1ZM4 A;  4RJL A;  5KW9 A;  2ZL7 A;  1NRK A;  3SJP A;  3B8H A;  2M5S A;  2P3M A;  1D1N A;  5KSW B;  3OAA A;  3Q6R A;  1F20 A;  3ISX A;  4TSF A;  1GR1 A;  3CP2 A;  4XKW A;  2GPJ A;  3OEH A;  1KD1 D;  3H9N A;  3T53 B;  1A8P A;  3GVJ A;  1UD6 A;  2VNH A;  3ZUG A;  1V5V A;  1HZE A;  2OBR A;  3CXC B;  1VF7 A;  4ZGQ B;  4P25 A;  1P4M A;  5FA6 A;  3FJO A;  3CCJ B;  1T6Z A;  4X05 A;  2QEX B;  4P1V A;  4RM0 A;  4X06 A;  4WZE A;  1W87 A;  2QN6 A;  3OEE A;  2RC5 A;  5J35 A;  4IW3 B;  1FNC A;  4XLC A;  3CCV B;  2ZXH A;  1SM4 A;  2J7K A;  1D2E A;  4BPR A;  3VO1 A;  4UZE A;  4AC9 A;  4G5G A;  2HDN B;  1QH0 A;  2Q6O A;  2VYQ A;  2CND A;  4YAW A;  2HLD A;  3JQQ A;  3OE7 A;  3GVK A;  4L8J A;  3PUN A;  2DOG A;  5F4J A;  5FO1 A;  4U9U A;  4Z4S A;  2E1R A;  4TMX A;  1Y0Y A;  1WOO A;  2D3N A;  3OJX A;  1XE1 A;  1AMO A;  4C0S A;  3BH4 A;  5HXB A;  4B48 A;  3BY1 A;  3WNB A;  4RCY A;  4P26 A;  2WSS A;  4CQJ A;  3LQE A;  1DDI A;  3ZZT A;  3OZW A;  1GO2 A;  2AHO A;  2ZXI A;  3OPO A;  4KKT A;  1NB0 A;  3CB4 A;  2ZL6 A;  4ASU A;  2WZN A;  4TT3 A;  1COW A;  2E1B A;  2V4D A;  1FRQ A;  1OHH A;  1UD8 A;  3GIR A;  1E43 A;  1IHM A;  2OTL B;  4DNT B;  2DYI A;  2W6J A;  4HE6 A;  4PC7 A;  2C77 A;  4TMW A;  2CW5 A;  4EH1 A;  2PMD A;  2KVO A;  1R5N A;  3A3G A;  1EXM A;  5IYW A;  4XNF A;  4WZL A;  3OJW A;  4TMZ A;  2QTL A;  1BJK A;  2HMA A;  1J9Z A;  3WBJ A;  1Q86 D;  4P12 A;  4LBZ A;  2BM1 A;  1VQ4 B;  4B3X A;  2XGJ A;  1DDG A;  2ZBV A;  4MYU A;  4HE5 A;  2BN4 A;  2JJ2 A;  4B47 A;  4AVZ A;  3W5H A;  4C43 A;  1M90 D;  3CD6 B;  2V31 A;  4FWT A;  4RD2 A;  3CC2 B;  1EP3 B;  2QE7 A;  2X8K A;  4RPB A;  2XND A;  3W2G A;  2VBU A;  2GRE A;  4XLA A;  1QGZ A;  4ZCM A;  1FNB A;  4YAF A;  2ZZF A;  1TTT A;  1W0K A;  1VJS A;  4UAJ A;  3BCF A;  3QFR A;  1DG1 G;  1PJ7 A;  3P27 A;  3KL9 A;  2V7T A;  3WNC A;  5H5J A;  2BM0 A;  4RLZ A;  2OYN A;  4XN3 A;  5F4O A;  5TY0 A;  3CRZ A;  4B43 A;  3QSY A;  4PC1 A;  2ZZE A;  3P26 A;  4X07 A;  2NPF A;  3PUM A;  1YJ9 B;  1T6Y A;  1KJZ A;  3QFT A;  1FDR A;  3CCR B;  1KK0 A;  2EFG A;  2ZZQ A;  3Q39 A;  3AVY A;  2XNJ A;  3PVD A;  1UMK A;  4WWV A;  3H94 A;  1CQX A;  1N05 A;  2R6H A;  4X7D A;  2DET A;  1I18 A;  2OK7 A;  5IYP A;  1V0E A;  2Z6B D;  1OB5 A;  4XLE A;  2BMW A;  3AGQ A;  4QVJ A;  3SJZ A;  3V7A A;  3G6E B;  1GJR A;  1KK3 A;  3BY2 A;  1BLI A;  4ACB A;  1Q82 D;  3WYA A;  5IYR A;  2B5O A;  1BX0 A;  5BSX A;  2XEX A;  2F4N A;  4RD4 A;  4MYT A;  2D74 A;  1OB0 A;  2JDI A;  4X8I A;  2BVN A;  4XMY A;  1WOR A;  4OOX A;  3GVL A;  3QE2 A;  5A8A A;  2CF4 A;  2X53 S;  3E20 A;  2YWH A;  3A8I A;  2VBT A;  4JMQ A;  5DS0 A;  5HZA A;  2VNI A;  3W5U A;  1JA0 A;  1TUI A;  1ZM3 A;  3A8K A;  1W0J A;  1KTV A;  1QFJ A;  1XQB A;  4ROX A;  3VNV A;  2BSA A;  3CCS B;  2B7C A;  1E1Q A;  2QTZ A;  2WZP P;  2X6X A;  1WSR A;  3G05 A;  3LO8 A;  2OBT A;  1E3Z A;  2YWG A;  4QHY A;  1HVX A;  3PA2 A;  1JJ2 B;  3LQ6 A;  5FIU A;  4P2N A;  1VQL B;  3A3B A;  5E6T A;  3CME B;  1F60 A;  1XB2 A;  4LBV A;  4XOP A;  1S72 B;  3CCM B;  3OOC A; 
#chains in the Genus database with same CATH homology
 3OP1 A;  2VBS A;  5TRD A;  2VBT A;  1T6Y A;  2P3M A;  4UZE A;  1NB0 A;  5A88 A;  2VBV A;  3BNW A;  1N08 A;  2VBU A;  1N05 A;  5FNZ A;  5FO1 A;  1S4M A;  5A89 A;  3CTA A;  3ZUG A;  1N06 A;  2I1L A;  1NB9 A;  1P4M A;  5FO0 A;  1T6Z A;  1MRZ A;  1Q9S A;  2OYN A;  1N07 A;  4UZF A;  2X0K A;  5A8A A;  1T6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...