1QFZA

Pea fnr y308s mutant in complex with nadph
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
308
structure length
308
Chain Sequence
b'QVTTEAPAKVVKHSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
publication title A productive NADP+ binding mode of ferredoxin-NADP+ reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 95
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qfzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qfzA02
4K1XA 2PMDA 1KD1D 3W5HA 4Y7CA 1S0UA 3P26A 1GR1A 3CD6B 3OZVA 4EH1A 1YI2B 1D1NA 2B5OA 2XEXA 3W2FA 4U9UA 1W87A 2QDXA 5H59A 3QSYA 2BGIA 1H42A 1JNYA 5TY0A 4MYUA 1DG1G 3AGQA 3U6BA 4YAFA 5THXA 2HDNB 1NJID 1D2EA 4NCNA 1QUEA 2VNKA 4AF7A 2PIAA 3WNDA 3WNBA 3WXMA 2HCJB 1KJZA 1W34A 3V76A 2BSAA 3CCQB 1QFYA 3CRZA 1CNEA 4R71A 4DQKA 2YWHA 3JQPA 1E63A 1JB9A 3MMPA 1R5OA 2FX3A 1QVGB 4NBSA 1N8RD 4LBYA 1VQOB 1DARA 3AVTA 1G7TA 1OB5A 4TMZA 3VMFA 1EP1B 1YJNB 4PC1A 1VQ4B 1YHQB 4Q7JB 4AC9A 1I7PA 3VO2A 1JJ2B 1E64A 1ZM4A 4RD0A 2OK7A 1GAQA 1S72B 3PENA 2E1RA 1GO2A 1BQEA 3CCEB 4B47A 4IW3B 1K9MD 2DY1A 3CPWB 1TUIA 4RD3A 1VQ7B 1XB2A 1SKQA 2R6HA 4FWTA 4PC2A 3CXCB 2OTJB 1QGAA 3ZBUA 4YHBA 1W2BB 4PC7A 1Q82D 4PGOA 4LBZA 1M90D 5DSZA 1E62A 2QTLA 3AVXA 3QFSA 1N0VC 1CQXA 3ZZ0A 1R5NA 1QUFA 1EFUA 3QFRA 2BM0A 3U6KA 1QVFB 4M4SA 4WQMA 2OTLB 1VQ5B 1KK2A 1YJWB 2BPOA 1KK0A 4PC3A 4HE6A 4TN1A 2BN4A 3VNVA 1EFCA 1J9ZA 4C43A 3OZUA 3G4SB 1ZM2A 1VQ9B 3B82A 3E20A 2BV3A 3U2QA 2BMWA 3W5UA 3FJOA 1YIJB 1HA3A 4QFMA 3CC7B 1OGIA 3OJWA 3CW2A 3LO8A 1EFTA 2VNIA 4P6VF 1W35A 2RC5A 1VQ6B 3AVYA 1YITB 4ZGQB 2YWFA 1QX4A 1N0UA 2GPJA 5AN9A 1U2RA 1KK3A 1D8TA 2B7BA 3AVWA 1KC8D 3W2HA 3QE2A 1QGZA 3W2EA 2YWGA 1VQKB 1IJFA 3MHPA 4Y9RA 1ZUNB 1YJ9B 5KSWB 2BF4A 2C78A 1FNCA 4ZCIA 1QGYA 1ZM3A 1VQ8B 3VO1A 1R5BA 1Q86D 3J81k 3E1YE 4M53A 1QG0A 1UMKA 3CCJB 4N3GA 4G1VA 1DDIA 1TLLA 3LRXA 3CC2B 3FPKA 2VNJA 3A1FA 2J7KA 4TMVA 3W2IA 2NPFA 4J0QA 4B44A 1FNDA 2XNCA 4YAWA 2ZITA 4RD1A 4UAJA 4ACAA 3WY9A 4RCZA 2AHOA 3JQQA 3LYUA 2OK8A 3OZWA 3CCUB 1OB2A 2VYQA 3ZC3A 3ZZUA 1BJKA 4ZGNB 3B8HA 1AMOA 4TMWA 3B78A 4H9GA 3G6EB 1Q7YD 2CNDA 3JQRA 1AIPA 1JA1A 4YAOA 1KK1A 1CNFA 2DERA 1DDGA 2QN6A 3QFCA 4G1BA 3ES9A 3P27A 2BGJA 3WYAA 5TR9A 1KRHA 1VQNB 4LBVA 3CCMB 5GV7A 1EXMA 3ZBTA 2D74A 4ZCLA 1Q81D 3CCRB 3AVUA 4F7DA 2B7CA 2VZLA 1ZM9A 1GJRA 3WBKA 1VQMB 3QFTA 1A8PA 4TMTA 2EIXA 1QH0A 1F20A 2EFGA 5TV2A 1QFZA 4FN5A 2HMAA 4B4DA 3G71B 1TTTA 5HXBA 4C0SA 1JA0A 1SM4A 3AVVA 1GVHA 2PLFA 3CMAB 1G7RA 5GV8A 4M2LA 4TMXA 4RJLA 2X3UA 4BPRA 4M0LA 2C77A 4ZV4A 3WNCA 3WBJA 3ZZTA 4RD6A 1EP2B 4YALA 3CCSB 5EMNA 1VQPB 3AGPA 3MCAA 4Y9UA 1KQSB 4B48A 2VNHA 1FRQA 1EWYA 2RC6A 4B43A 1NDHA 4LBWA 4G5GA 1OGJA 4PC6A 1FRNA 4ACBA 1QFJA 3OJXA 3CC4B 3W5VA 1IB0A 4HE5A 1TVCA 3I55B 1IJEA 2QTZA 4AF6A 1XE1A 5FA6A 1ELOA 2QMUA 1VQLB 2CRVA 1M1KD 2BM1A 4M1KA 3VNUA 1FDRA 1FNMA 4N3NA 3CB4A 1K73D 3CCLB 1BX0A 3CCVB 4ZCMA 1GAWA 1G7CA 1FNBA 4QHYA 2QA4B 2DEUA 2GQFA 3W2GA 1BX1A 2YWEA 4LC0A 4RD2A 1H85A 4P3YA 2XNJA 4RCYA 1EP3B 2DCUA 1WDTA 4RD4A 3I56B 4MYTA 3I1FA 2DETA 3CMEB 4YAUA 4B3XA 4FK8A 4DQLA 1F60A 2QEXB 1B2RA 5H5JA 1B23P 1G7SA 3LVBA 5JBQA 3SJZA 1KTVA 2BVNA 1K8AD 3OW2B
chains in the Genus database with same CATH superfamily
4OH7A 3MINB 1T3HA 3DCIA 1I8DA 4TRRA 4KKUA 4CV2A 4BNJA 1DUIA 4WOBA 5DM4A 4JEIA 1R10A 1S0UA 1L2TA 5EWMB 4I5EA 4TLCA 3OMWA 3PUVA 3JWGA 1ZWLA 2HHLA 3O47A 1T2DA 2D9RA 3BE6A 3HFJA 3EF1A 5C31A 3RD5A 2AW5A 5A1TA 1YI2B 5KNCD 2XEXA 2W2LA 3QPUA 2IV7A 4PLYA 2IYNA 3NG1A 5J2UB 3G68A 1BKSB 2JGFA 2QG4A 3SVZA 2GSWA 3EUAA 1P1KA 4J91A 3MRVA 4JX8A 2GVZC 4MLPA 2IV2X 5AW8A 4D9MA 2HMUA 3D9QX 4O2BF 3SC3A 5TRTA 1ZCBA 4IICA 2K7ZA 1NLMA 1H42A 3H6GA 2OBLA 2ZB4A 4DPMA 4YAIA 1XQBA 3H4VA 4LCBA 2HKIA 4MVJF 4N7RA 5JEEA 4CLEA 5B6IA 4FSXA 4U7DA 5K1ZA 1SB9A 4N9WA 3VM6A 3WLMA 4RYDA 2V7EA 3UK2A 1OT3A 3VO8A 1AKNA 1PDVA 3RUAA 4NZPA 4TROA 4PE5B 1W1WA 3A6GA 2M2IA 2E1PA 3D31A 1DPFA 2KQUA 3NHJA 4FFBB 3COYA 3IV9A 5BNTA 3AFHA 2A7XA 3ASTA 1ECLA 3EVNA 4OAPA 4JUDX 1CUEA 3S1LA 1F51E 2CLMB 1APBA 4I4TB 4ENSA 3IS3A 2YXEA 1AF4A 3HUFA 3NKLA 4DC0A 2PZAA 1FMLA 1NE2A 1R3DA 2Q8QA 3QPBA 2ZYAA 3O95A 4GKBA 4M1YA 4M1MA 4OQMA 3U0BA 4G5HA 2HCJB 3F9CA 4AVYA 4P7BA 4DCTA 2W4IA 4HZUB 1BCRB 4Y2SA 3CRZA 3FUTA 2INGX 3IGFA 4UQLA 1XEWY 3GHYA 3PXAA 3HCDA 1XROA 3D59A 4PPQA 4CL2A 5ABPA 1JB9A 4PANA 1L5SA 1PS9A 1UAYA 3BB4A 4X93A 2BFNA 1U3UA 1II8A 3KLMX 2YJ4A 3MILA 4BO0A 2J3MA 5B4VA 4GZ3A 4AJ2A 5JS1A 1ISIA 4RA9B 1N8RD 1U5BB 4B79A 2AN4A 5IXSA 1O6BA 5KIAA 3IUMA 3OUUA 4LXXA 2OPBA 4HVCA 2HRBA 5JI2E 1V4VA 1JE0A 3TEFA 4IKPA 1OH7A 3HJFA 5JR3A 1VA4A 3RU3A 1YR3A 3MMNA 4K9KA 2BFEA 4U2GA 3EMBA 1B74A 5GZ6A 1TX4B 5L3SA 5EIOA 4Y67A 2ZBFA 2CJFA 3FTNA 4X7BA 2F64A 4D0NA 3MWFA 2Q1SA 4DWVA 1PT7A 2EP8A 1LA2A 2HK8A 2IDJA 1L9KA 2J3EA 3H3JA 3JZIA 3OZFA 2Y67A 4XLEA 5T7BA 5JO0A 4TUYB 1E9EA 4N0QA 1QHEA 5H0IA 2JHFA 3FDIA 4RKYA 4YFYA 4QXQA 4JI1B 3K4QA 5AK4A 1Y0BA 1I10A 2GN4A 4QTUB 2WYVA 2NXWA 2O8DA 3E7PA 2O5RA 4IQ8A 1NMEA 4GMKA 4OB8A 3WLKX 2OK7A 1STOA 1MA0A 4YCCA 1PZGA 2AH5A 3A31A 4NE9A 3ZY2A 3ISVA 1NVUQ 4HDRA 1W8DA 4OPMA 1N2HA 1OTYA 4E94A 1RYEA 1GTG1 3HXOA 2A78A 4M60A 5COBA 1QIGA 3HRKA 4MV1A 3SP1A 1WP4A 1ZI9A 2XCLA 4FKBA 3VR2D 2BCGY 2ZVJA 3ISJA 2VI5A 5DGIA 3CPWB 3RIGA 3PLAE 1H4TA 1IJBA 3GGCA 3QKRB 4EO7A 2D1QA 3SMQA 1DEOA 4YRKA 4F86A 4C04A 1GU1A 2ZSUA 3EZFA 5KNBA 1XPOA 3TNYA 4F85A 4QVIA 2UUBB 5EFOA 2IX3A 3LUDA 3OY7A 1U4OA 2CUZA 4WACA 2UUCB 1U7TA 4XOUA 3IBTA 2FSUA 4DS3A 2QVXX 3FYUC 1OY1A 2WLSA 1V8OA 2K6GA 2J3QA 3WGQA 2QM8A 2D7CA 3I34X 2O2SA 4HTFB 1AKWA 2BGNA 3PUKA 3SYNA 4MWTA 3V9AA 4DM3A 3GUZA 3WVNA 1JDUA 4WD3A 5D87A 2AWNA 2EFHB 2GF2A 1P1JA 2PKQO 3F47A 1R5NA 1QLWA 3LLMA 1QUFA 3GRFA 1ND6A 4OBBA 4OI4A 3V80A 4CFSA 4RJTA 2BUCA 5AHKA 4QJ3A 3UYLA 2Z43A 4YIHA 5LDGA 1KMIY 2PZJA 2I91A 1VRWA 2ZIWB 1QVFB 3WRYA 4WQMA 2W93A 3G5AA 5EGNA 4CVNA 3O4VA 4OGLA 4QTXA 1B0AA 3L04A 3UHAA 4X9XA 4RTKA 3GLGA 4UU1A 2QUIA 4INAA 4IUBS 1KK0A 1BO6A 1XFDA 2Q9AA 1RXVA 3JWIA 4MQEA 3GYBA 2FI1A 3VKGA 1F8FA 3H5VA 3X2EA 1EFCA 2I6XA 1F7VA 1JFTA 4HH0A 4X1YB 3ASVA 3MLAA 1EESA 3G4SB 4DCVA 1SCJA 5ESXA 4BJ5A 4XQGA 1ZFNA 3ORRA 4BV8A 1JQDA 4E32A 5ES4B 3VRHA 1RABA 3IKVA 4JODA 2K2QB 4BQFA 2C2HA 4DYDA 1E2DA 4AZTA 5LZ5A 2NAPA 3IJEB 3NW9A 1VJSA 4B6JA 2XT0A 1A7AA 1B42A 3NOXA 3OO1A 2WA2A 1W0JD 1PVDA 3MG9A 3OJWA 3RARA 121PA 3C3AA 1TKBA 3WBBA 2QAJA 3VR5D 2QRVB 4AQYB 1AK1A 2C58A 1H5NA 3G9XA 3LK7A 3AU9A 4HOYA 4ZEOA 4ARAA 1SCAA 1SKBA 3A1NA 3N59A 3U44B 5KC8A 1T0BA 5P21A 2OZPA 1CB0A 1PO7A 4YJHB 3IAM6 4BNVA 3MJDA 5CDHA 4BO6A 3KPYA 5K0BA 3OFKA 4BTEA 2Q9CA 2XXBA 1U2RA 1KK3A 1FQJA 1MPXA 1AURA 4PNZA 4R69A 3ZXIA 5T4BA 1EUCB 1Z6YA 2WIBA 2R4TA 3PV0A 5JQGA 1GR0A 3U4MA 4E33A 1G60A 2CKMA 4TYPA 1QKKA 1K7XB 5LQAA 3FNEA 4JAVC 1J23A 4L15A 3U40A 2GBLA 1FS6A 4TWIA 1WXIA 3P4UA 4LQDA 1OMOA 3KP1A 4IJ5A 3LKDA 3KKQA 3DOIA 4Z4HA 1IVYA 1IJFA 4CMAA 4JS0A 3L43A 4Q7QA 1GSHA 2ZRDA 3O4GA 4CTOA 3JZDA 4HDCA 3N3AC 1GTRA 1Y1TA 1QP4A 2P9ZA 1ZMTA 5DGXA 3HQ4O 2ZJ7A 1XZIA 4FYXA 4G0NA 3QU2A 5ALQA 1KOLA 4CLXA 3UJ9A 1CPYA 3WAKA 4YNBA 5DNCA 5A9RA 1N0IA 4XONA 3OP1A 3EEYA 4HB2A 4QGHA 1QLJA 1MB9A 2AOWA 2QMZA 3SM3A 1AV6A 3K6RA 1LD3A 5AK0A 4WXPA 2AV6A 5LMZA 1OXXK 3CC2B 1Q5PA 1R4NA 2POCA 4L2IB 5HS6A 5LQNA 2IEDA 5CAEA 1RC8A 3A1FA 2QG6A 1C0IA 2J7KA 3H8SA 1C7ZA 4WKPA 1IZ7A 4RPIA 4TMVA 2XKBA 3WKEA 2MTBA 4QGGA 3W9SA 1GKIA 2QVYX 5E4FA 3EDRA 3GRYA 1DMSA 5KNCA 3NBKA 4ER5A 2CCJA 2UVQA 4X94A 3KYJB 4AKTA 1VZ3A 1JEEA 3MGBA 3AP2A 4CKEA 5T41A 3VHXA 2ZITA 4GBMA 3GJ8A 4UEWA 2O07A 1O0SA 1K2WA 2GZ2A 1YGYA 2VR1A 3T7RA 5ICMA 1T5DX 3OQ6A 4HH1A 5B4UA 1Z08A 5L7WA 1B41A 1G19A 2VT7A 2JFYA 1QPZA 2CLOB 2QA5A 4MS1B 4ZDWA 2C2BA 1BNCA 2Q5JA 3BTVA 1HYGA 2PR2A 1EK2A 4P3XA 1T2AA 1LPSA 2PIDA 3E23A 1KMHB 2O3QA 3EGIA 4JKOA 1NVXQ 2A9VA 2B1IA 1E3WA 2FRVA 2R25B 4JBHA 1RKXA 3CZPA 1YVEI 4P92A 3IV6A 4YJ2B 5BV7A 4YJFA 5T4EA 4FLMA 5C2JB 1G20A 1RHQA 2J9FA 2PX2A 1DKLA 1K8QA 4FX2A 4IJWA 2CNDA 2QQ0A 1E9AA 3IILA 4L8VA 1ML3A 4OJQA 5FOTA 3SQMA 2I0FA 1JDBB 2D2VA 3RWOA 4ZZ0A 1TIBA 1XTZA 2J33A 2A4KA 5GONA 3L8HA 5A4JA 2OHHA 3H5WA 2ZRLA 4TSKA 5K4AA 2O8FA 1H6BA 3PVDA 3WMGA 4AO8A 2AKEA 3ZIDA 1Q6YA 1Z12A 5DFAA 4GPEA 3TZKA 4KDEA 3D8TA 5LJLA 1ZCZA 4ER0A 4XPIB 1L5HA 5IYZA 2WJYA 1KAEA 3ECCA 4O0MA 4E6EA 1YKSA 3DONA 4MYDA 1LLFA 1C4XA 4TZKA 4BNDB 4S04A 4ZEXA 4YJGB 2VCHA 4NBKA 4HWTA 1RQXA 1UEIA 1XZ8A 3CCRB 2ZK7A 1QSGA 1CUUA 221PA 2FMUA 2VH2A 1P1HA 4GECA 4F7DA 1KETA 1WVGA 4ZEVA 5IDXA 2QORA 1ISGA 4F9EA 1PJTA 1RKVA 1NRXA 3K0HA 3TPZA 5E95A 5GGYA 4FNMA 4FMDB 1CQIB 5LXTB 3RVKA 5B37A 2BGWA 4OQEA 5KNLA 4HR7A 1QIKA 4M0KA 3D4NA 4M6WB 3L7AA 4OKIA 4YRJA 1H9CA 2Z2ZA 1ISSA 3IHWA 5EVCA 3DLCA 5D3ZA 3C3MA 3AX6A 3Q9LA 4ZOEA 1A7JA 1QBKC 3JQ7A 1EG2A 4EUNA 4OOSA 1XRPA 1CWUA 2HMAA 1KEWA 3NDIA 4HK4A 1TTTA 3DR5A 4L51A 5EESA 3ZHBA 1ZNWA 3QKUA 3GVKA 4M98A 5CIWA 1YZQA 4QPNA 3DBLB 2D7JA 5C1DA 3MJEA 4MDEA 3KS9A 4IZ6A 5KDOA 2XGMA 2FP4A 3KOUA 4FOPA 1G63A 3FNHA 1T9GS 4NI5A 5A4FS 2CCGA 2FSFA 3L8MA 3M4NA 4KO8A 2JLZA 3JQAB 1MOQA 3ND5A 4UFNA 3STWA 5A4MS 1N5JA 5AVXA 4MZDA 3E9RA 1QV7A 1VBFA 2L42A 4UTZA 3VYRB 5AJUA 3HB7A 4BN4A 2OV6A 1XWFA 2YDYA 1V16B 3WLQA 2RHMA 1AX9A 1UBOS 3HG7A 3PVZA 3FDZB 1GDDA 3TQIA 5EXSA 4FWBA 3G82C 1M8KA 1V4BA 2E89A 1DRVA 1WTCA 4M8NE 5JW6A 4IOKA 4I3FA 4V3CA 7AT1A 3T1TA 1XEFA 5FADA 4OX9Y 4B0OA 5L45A 1UQTA 1T8TA 2W5UA 2AX3A 3RKUA 4RIEA 3GPBA 1CY0A 5D51S 4RETA 4UZUA 3LCJA 3A25A 4I99A 2A0WA 4D4IA 1UMCA 2WNIA 4YI5A 5JAOA 1Z74A 3FMPB 2GREA 1J9EA 2ZRKA 2Q0HA 1T5IA 3AF0A 2PVPA 4Q1VA 5G1OA 3ZQJA 3DO6A 1A82A 2C84A 3ZXXA 1ADFA 2F2TA 4CMCA 3PHJA 4MIKA 1T3LA 1ULAA 3DL7A 2A1UA 1CYDA 3EVZA 1U3VA 3ZX5A 4LC1A 3CHYA 4BV3A 4E5NA 3K9NA 3TR0A 5AW3A 5AM4A 1OJLA 4HXYA 3K20A 4G5OA 4L73A 4ASUD 2JJQA 3FYUA 2JFGA 3TPFA 1QXSA 1U2ZA 4JENA 3UAOA 2WABA 3AM5A 4Q82A 2VF5X 2E4UA 1BSVA 3Q3IA 4G09A 3HBJA 4V0KA 3U3MA 4EKDA 3LCMA 2X6TA 3A6DA 1UMDA 1F8YA 4C0QC 1PT8A 3C8MA 3LDHA 1P2UA 2FPPB 4QBKA 3VR5A 5C7LO 3ER9A 1PF7E 2XMZA 4E12A 4TXJA 2YXPX 2B94A 3CX4A 4JR0A 4S1PA 2NVUB 3AKZA 3FTFA 2X53S 1H22A 2CLHB 4LHZA 3F6BX 2XXJA 3O26A 4MSUA 4ZRMA 1DOHA 4QHYA 2EIHA 5IW8A 2R8ZA 2AMJA 1G8JA 3OF3A 4JXKA 4JGIA 2DUUA 1I0IA 1QC5B 2V7XA 1ZOIA 4KHPB 1WHSA 3PUXA 2I3DA 5HEKA 5J4LA 2PUBA 4OQFA 8MHTA 3O4JA 4RPJA 2CXSA 2X9VA 4ZJYA 5EPEA 3I28A 4JYAB 2ECFA 3AZOA 4EITA 1DJLA 1C3EA 1JB1A 1AM4D 1I2MA 4P36A 1GPLA 1NJFA 2ZCUA 2TMKA 4KGXA 2HR1A 1UPAA 1IATA 1V1RB 3JSAA 3NHZA 4FC7A 2AJBA 2M1XA 5CVVA 3TN7A 1EHYA 4RD2A 4PY2A 1KQGA 4YTEA 3C0KA 4YEDA 1F38A 1M8FA 3UJ8A 4UVHA 5CW2A 4IMIB 1SNYA 4PO1A 1R27A 3PA8A 4GIBA 2WC1A 5HUHA 1U2PA 4XLTA 3SLDA 3R7FA 2PX6A 3O6VA 1IONA 4DNRB 4DIUA 4U1RA 3BA6A 3CEAA 1ZZEA 4FCVA 1JG3A 4GC9A 4X1OA 1X14A 2BWJA 5DSXA 5LBUA 2CCKA 1LSUA 2NN3C 3KQOA 4L22A 4ZZIA 4YAUA 2KMLA 4ISBA 1FYXA 1KI7A 4LZWA 2Z04A 3CM0A 3GLUA 1E7RA 1F6DA 3MMXA 2C9YA 4EJSC 1L4MA 1S2GA 1ZKMA 2O8BB 1R6UA 3OPYB 4JBXA 1BZYA 1XTPA 4OK6A 4Q9HA 1S4QA 4EY8A 2VQSA 4KI7A 1EUQA 2Z95A 1ZHHA 4XGRA 1Z37A 1BJTA 1RLTA 3CWZA 4AROA 4MR8A 1I4OA 3BDAA 1A27A 2PMDA 3LT0A 3ETEA 1SAYA 2JZNA 4KE8A 4NBUA 1PHPA 1R37A 4KVFA 4Y7CA 4DJAA 1GR1A 2OV8A 4RPCA 1XLVA 2H65A 3L0DA 4NPHA 1A97A 4GRIA 2RD2A 2ZBEA 5DNDA 4X07A 1NM5C 2H8KA 4YREA 5AW9A 3AY0A 1QU3A 2ZRAA 3BMXA 3FSRA 4H3KB 1P6UA 3LE8A 5J35A 1DX4A 3ZLBA 4BFUA 2IXFA 3EPLA 1EUDA 2H54A 3K5HA 2GK4A 5ALTA 4L9SA 2BEUB 3S2IA 1XVVA 5ENZA 2IBSA 1C0LA 1PR3A 3E3MA 3KRTA 4DIEA 4MZXA 4ND5A 1L3IA 4JJAA 3ZK8A 1DB3A 3GJ7A 1GPDG 1LJLA 2ZXIA 2JGAA 2W2TA 1G5RA 1KFEB 3FPGA 5BNFA 3CNEA 1IXKA 3P5SA 4LI0A 4M99A 4NFSA 5HTKA 1E8DA 2X0FA 4UTXA 2J85A 4NAUA 3LY5A 4Z99A 1J56A 1YFKA 1OW3B 3AESB 3IBGA 3AEXA 3WLNA 3ZHYA 5JUWA 1BC5A 1WQ1R 1ZNZA 3JQFC 3QH4A 4X7FA 4R41A 4AJ1A 4O29A 1U9IC 1D6JA 4YRMA 5DHQA 3JALB 1XZLA 2VF4X 3GLHA 4K81B 2I4NA 1ZS9A 4HIZA 4OHFA 2I65A 3J81A 3NAGA 3ZNOA 4A10A 4BO4A 3OECA 4PLZA 2WTUA 1SFRA 3GZNB 3GFQA 1DSSG 1Z16A 3ENWA 4MITA 2HQRA 1X2BA 2J5QA 1UM9B 3P9QA 4NMLA 3AB8A 4YIKA 3W79A 2R48A 4M1QA 1ZD4A 4DJ5X 2J59A 1PQWA 1JZTA 2P30A 4M86A 5ECWA 1QYXA 3VR6D 4D80A 3IP6A 4LF4B 3DD1A 5EINA 3CMMA 2RFLA 3ENVA 1G4HA 1E0KA 1UK7A 2VXBA 1W5AA 3L79A 3R6JA 1N3IA 3DVQX 3MOSA 4IILA 5LP6B 3ICWA 4CPDA 1AZTA 2P9HA 3PF9A 2EX1A 3WLSA 4BB9A 4EECA 3SG0A 4BQSA 1DTWA 3ZE9A 4I55B 4JROA 4WZBB 1Z0SA 1VCHA 2D3LA 2WU3A 2OP1A 3HRHA 4IF6A 4LMAA 1I3LA 5EC8A 1FTYA 4TX1A 5EY5B 4DUYB 3TQTA 4ZOQI 4NFLA 3GMSA 5ESWA 3T4EA 3L7IA 3CVWA 2NYUA 2H2AA 4IIJF 3U4CA 2WU0A 4KXXA 4ZOBA 3C1UA 5LOVA 4LXUA 1NNLA 2C2YA 2Z57A 1PQUA 2P7IA 3TFQA 5JD5A 5DGTA 5DX1A 5FNVB 5AUQA 4Z7NB 1XLTC 5A3RA 3T1HB 3IMCA 2O2YA 1UZNA 2KM1A 3P19A 4FONA 4GFDA 1SQ5A 2ZBQA 3ZGNA 1Y6QA 3LTNC 3AFMA 3N8GA 4FP9A 4X1IA 5LP6F 3A3NA 4OVKA 3AJRA 3B7WA 2ZU6A 5B1HA 1XPRA 2QI9F 2WZQA 5DHPA 3E7DA 3LMKA 2IS4A 5GVSA 3UAXA 4TTVA 3X1MA 1Z7BA 4AURA 3ETGA 3WGJA 2NSJA 1RQ7A 4PAOA 4MAMA 4QYMA 4F8JA 3ER6A 4PIVA 4YP5A 3NKFA 1T43A 5JO9A 3B2QA 1U0SY 2BGLA 4D5EA 3V6LA 1QIDA 1ZVKA 2VHTA 5ILGA 3RC2A 1XTBA 1KC1A 2H07A 2I1QA 2WPDD 2AN1A 3GZ4A 4RQUA 3UV6A 1U8XX 4FWTA 1ADCA 2CF6A 3TTSA 3RJ5A 3IIIA 2FVGA 1DJOA 4NV0A 2WMNB 1M8GA 2YS6A 4BECA 2HNAA 3S2YA 1DKQA 1P9OA 3V55A 4J43A 1GAXA 1BW9A 5AKXA 5DHUA 4FZ5A 1J2EA 2QNBA 4ZZ2A 4GPBA 2IKQA 3BQJA 2ZRJA 1XPJA 4WAUA 1GGKA 1T91A 1DC5A 3QW4B 1C1HA 3INTA 2ZE8A 4GPTA 1M5RA 3U17A 1GL6A 3TBHA 2XITA 2OO5A 4FEGA 5ALIA 4MWGA 3NIBA 1E6UA 4GKAA 2QZPA 1EA7A 1GL7A 5A4KA 3ZDFA 4K6GA 5BOVA 2IIBA 3I8SA 5KAMA 4CKYA 5BN3A 4PQEA 1MABA 3ZWVA 3PP8A 2YIJA 3FTQA 4EGFA 3TSCA 1FFXA 1FLVA 1Q7TA 1U7PA 2JJYA 2OHOA 1SBIA 3BZUA 3H11A 2PL5A 3LWDA 4BMVA 1GKYA 3EB9A 3EVEA 3K6KA 1BS2A 1UWKA 4ASUA 1F2DA 3KPVA 4JNKA 3FIJA 4IMRA 4PC3A 1GYPA 5AW6A 3OU6A 4EHHA 2BN4A 4WBSA 5B3JC 3BKWA 2JGLA 3VNVA 1N92A 5AW1A 4B6SA 4EX6A 1MZPA 3UXHA 2QR3A 4MPRA 1TA4A 3GLFA 1UP4A 3LQEA 1II8B 2XVAA 5A5VA 4N48A 2VSFA 3JZMA 5FBZA 5EMMA 2DGDA 3W5UA 1Z68A 1HA3A 5K8CA 1GPKA 3VPAA 2R79A 1DHTA 2IW3A 2AUNA 1RZUA 5EHQA 2GUGA 5B5SA 4BMYA 4JLMA 5H81A 5K6AC 2HW8A 1UJ2A 3OU7A 1PJ4A 3KWJA 3ODPA 2Y1WA 1IDOA 1M33A 3OIGA 2IU4A 5SZKB 3T52A 3J80A 2B4TO 1ZD1A 5L3SB 1UJ4A 2GETA 821PA 4W1RA 4Y98A 3B8EA 3G7NA 1F6WA 4CQMD 2Q0SA 3NB0A 1SKAA 2TYSB 4ZGQB 4RM0A 5IUNC 1CRPA 3W6OA 3A6HA 5JBNA 3FYSA 3NNNA 1UXGA 3FDXA 4LKOA 5FLEX 1RJ9A 1KFJB 3V9PA 4FGSA 3N3BC 5KB3A 5KEIA 1L0BA 1GNTA 3T5AA 3A7DA 4NOJA 3HXPA 3ZGZA 2O8DB 1CE8A 3OPNA 3DE1X 4HWSA 1YQ9A 5BQ3A 3ADKA 3OFVA 3PSAA 1FTGA 2NTVA 2ADFA 2HJHA 4P2BA 1CQWA 4HUTA 3KYIB 4QU8A 2V7VA 4HDRB 4V0SA 3VNRA 4E2XA 2VDRB 2VYFA 2GKSA 3HB1A 4CFYA 1EEXB 3T15A 3OUTA 3JV7A 1BEUB 3C14C 3RW9A 4Y9RA 2ZSAA 3KM0A 4ZCIA 2H7CA 1E6KA 2IDZA 2OV3A 4YV1A 3GCDA 4B3SB 3PNMA 4EW2A 1POXA 3C7DB 1AXRA 4ZMSA 4XCXA 3UMCA 1XQ6A 1ZRHA 3WMFA 3FGZA 4B35A 5EQFA 4FTWA 2OWEA 2PX5A 2AE2A 3AB7A 2OESA 3S70A 4GMGA 3DOHA 1JV2B 1G5HA 4Q3NA 3EISA 3LRXA 2R00C 4L4ZA 2PWAA 2MDTA 4IJ6A 3LGSA 2C54A 1PJ6A 3MTEA 2CF4A 1EGHA 4UNRA 3KQKA 1PS8A 3MAAC 2ZSEA 3RSGA 1NDQA 1P81A 2ZSDA 1PX0A 4HS9A 4LOIA 4DLTA 1ZGCA 1O6GA 3OQPA 3OHPA 3FF4A 3GEEA 2YCLA 2IVZA 1M1ZA 2ZSKA 3T99A 3WMWA 2ZUEA 4TV9A 1CQZA 3FSJX 5CFRA 1Y4UA 2O7RA 3JSXA 4RVNA 1RIIA 2H8GA 2UUPA 2VFAA 4RWEA 2YXLA 3QU9A 3CZMA 3GLGB 4ANFA 3KCNA 2B8TA 4OBXA 5TRDA 2YHBA 4NCKA 2JD1A 4ALIA 4CIYA 3CX3A 1UXHA 4YDRA 4HLUC 3AU8A 5CYPA 5LBIA 3PQ8A 1ULZA 5JAIA 3AR6A 1JI3A 3AIOA 2GPAA 2ACVA 3R4VA 3PA2A 3OJ0A 5WRFA 4EB6A 3C87A 4EGAA 4YXWD 1QTNA 3DC7A 1AS3A 1E4OA 1ZX1A 1THTA 2HMYB 3DMYA 4Q1FA 2Q5EA 1P7WA 2I6FA 3NDPA 1J4AA 3K2QA 4FHEA 1EE2A 1OSNA 1Q1AA 1YZUA 3ZY5A 4YAGA 1OH5A 4J90A 4NMXB 4QDKA 3CY6A 1R0CA 4MVJH 5JZMA 2UZ4A 3EEBA 4H6PA 4URWR 3HEAA 3ZQ4A 3BSFA 4YRNA 2ERXA 2FEOA 2OO3A 3LHSA 4BCBA 4F60A 5A5GA 3DM9B 3UM9A 3TMYA 3ERCA 3X0DA 1YRYE 2OCYC 5L4SA 4RVHA 3F6YA 1JQLB 2FW8A 5MGNA 4UHFA 4B2PA 5HX7A 4J03A 1QOQB 3HU3A 4LBVA 3QV1A 1U0GA 4LGCA 3V8NA 1KZGB 3D8BA 5GV7A 1DWQA 4ZCLA 1G41A 4IDPA 1JWAB 3GFRA 4HAUA 4I4CA 3AOGA 4X6XA 4I81A 4ML3A 2VJQA 1S1CA 3RASA 4XWOA 1WPGA 3D8SA 3BPSA 2C59A 4MVWA 5AVOA 1F2UA 1ETUA 3LPMA 5IDQA 2VAXA 3VNAA 1FDIA 2PSFA 3JQFA 3LCRA 3B13B 3COVA 4RV4A 1Z5GA 2YZMA 2V98A 3PC8C 3CXUA 4HB4A 2UXDB 3WBKA 3I2HA 1V7ZA 2BMFA 5KKAA 3HP7A 2ASVA 4M9UA 4TRNA 2GCNA 4JQSA 3QFTA 5EUCA 2ZI7A 1NNSA 3LUPA 1ISFA 1N08A 2QRJA 1YRAA 3EASA 4PR0A 3AJEA 3FYTA 3M6XA 1AC5A 3K0FA 2C7GA 4AF8A 2HJGA 1UBEA 2XH8A 5JMTA 3G71B 1ZIDA 5IM4A 3JXEA 4TVSA 1TUGA 4GVPA 1FMFA 2JLAA 1IWPB 1XXLA 1G3UA 1H1TA 1OFUA 3P9RA 4HEA6 5IFLA 5L3QA 1R4NB 2WIGA 4ESHA 4EKYA 4A82A 3AVVA 4R1SA 4XLZA 2CHVA 2CBXA 2GHQA 1G2OA 2KW5A 1NUAA 4URFA 3SDSA 3NIDB 2AYZA 5LA6A 4HGQA 2Q1UA 1XE3A 3GFBA 1EFHA 2JH8A 4OY3A 4CMBA 1OFUX 4MPDA 4BBPA 4TMXA 1O1YA 1NTOA 2WWRA 2ZAYA 2PXAA 3UCEA 1ZVQA 5IBQA 2HX1A 4CKEB 5SYNA 4BFWA 3VPHA 1PV2A 3FD8A 4UTNA 3SJCA 4NX2A 5FYDA 5FAKA 1L4HA 1W1IA 3OEYA 5BUCA 2GEBA 1OA1A 4FGZA 1E1RD 1Q20A 3ZDDA 3P2MA 5DTQA 3OURA 4KDCA 5TPWA 1IXYA 1P3DA 3EWSA 4RD6A 1G5PA 1N75A 1XLTA 2P4QA 2V5AA 2WHXA 3GHHA 4IDHA 1H23A 1JG7A 4S3MA 1RYNA 2POQX 1S8OA 2LD4A 2A8YA 4PQGA 2EYUA 4NEQA 4EG7A 1T5SA 1UOEA 2F8LA 3IP1A 2NSYA 4J0FA 1E3WB 4W5HA 4BNIA 3C8UA 5FI3A 5AD1A 5AI4A 1QKJA 5GY7A 2J45A 1CJVC 4ZGGA 4YJFB 2IZ1A 2ZBUA 1JLMA 2J9FB 3I9OA 2DULA 1R8XA 4PABA 2VXOA 4M89A 4RC9A 1A9SA 3JYHA 4WLOA 3G0HA 3T1QA 2HMVA 2DUJA 2EXXA 3M2PA 3KPUA 1FRNA 2XEDA 2QGNA 2O8FB 5I01A 4H6WA 2PSDA 2JFXA 3AI7A 4LDZA 4CCSA 7GPBA 1DKUA 1WUTA 1TTHA 5JAZA 1MEOA 1HQYE 1G8KA 3NT5A 4WY5A 3UIEA 3ANYB 4BFLA 4C20A 1GARA 5LQJA 4NXMB 3FYCA 1KJNA 3L46A 4C0AC 1XCLA 5IYZB 1FMCA 4PRLA 3PC7A 2QYSA 4HB3A 4JJKA 4FBGA 2PX0A 2WM9B 4UQPA 5T5QA 3PC4A 5DNAA 4MYSA 1OIXA 3I1YA 3NPMA 3ASZA 1FJGB 2CZQA 2H2GA 2XE8A 3DDSA 4J7XA 3BYZA 5DN6A 1YL5A 3QX7A 5HF9A 5AVZA 1IXSB 4PYOA 3CB4A 1F0NA 3M4JA 3OU2A 4IKEA 4KAAA 2ATVA 2EOAA 3S44A 1VECA 1XWIA 3VZDA 1OC4A 4PZ9A 1QO7A 2XA2A 4FBMA 3L7JA 3LAWA 4WT7A 3V4PB 3WJ2A 5BQFA 1UF9A 4TKMA 2VPQA 3KR2A 2GRUA 2PL9A 3RVSA 2FP3A 1RRKA 3T1YB 4HGRA 2PLAA 3JQ7B 4IQFA 1XTTA 1YVUA 2JH9A 4O1MA 2HXSA 1K63A 3T3EA 1ZH8A 1JT9A 1GPYA 5BY2A 2IL1A 1BX1A 2FJ0A 2VZ8A 3EMKA 2IQ5A 5I5EA 5EA2A 4BJ6A 2KLHA 3Q3VA 3GCXA 3BK7A 2O0MA 1UBJS 4XX0A 5E0OA 5HZAA 4MJ3A 2FP4B 3DVSX 2B61A 3RKRA 4YMHA 1BG6A 3LZDA 2VWQA 5K6AA 3R9WA 5FEMA 2JVIA 1CUJA 1EX6A 4D79A 4PLTA 4DCUA 4FFSA 2WJVA 2A4MA 1EJ6A 1ZK0A 3I56B 2C4MA 4MYTA 4KKSA 5EP4A 4KK4A 2GRAA 5IYWA 2IY7A 4E03A 5A6SA 4DPKA 3RTBA 4IDQA 2EG5A 4KR0A 1G18A 5IF3A 2AI1A 4V03A 4D0SA 3RT9A 5CFOA 4OQLA 2QMHA 2UU9B 1K7YA 1IRIA 1DQNA 3B1YA 3MJVA 4AS2A 3TWOA 3K9FC 4LVCA 3TLMA 3WC4A 2W90A 1QVZA 4MI3A 2GZ3A 1JALA 3Q15C 4WFJA 2ZSIA 1U28C 3STTA 2HU8A 2H1RA 2IDKA 3MWGA 3TSYA 421PA 4D9NA 4NRDA 2AKAB 2NV0A 1WSWA 5FBQB 2WD9A 1TJ4A 5AK6A 1NP7A 4PYQA 4YACA 4B75A 1NVDA 3AFGA 2VIIA 1SVSA 4XUCA 1YB6A 3CZ9A 2QEQA 1UMCB 4NPCA 4Q02A 1WZEA 1RQ2A 3OZVA 3DC2A 4FNGA 2RGXA 3NIFB 3ZW7A 1KYIA 1V9CA 1T4CB 2C1EA 2OBBA 3EBPA 1YK1A 4E2FA 1D4ZA 4AKHA 4YXWA 1T9GR 3F7OA 3BB1A 3L6RA 2YJ6A 4GBGA 2A1UB 3HUDA 4BO9A 5IJ0A 3DLBA 2QL5A 1Q1GA 2V0NA 2C3YA 4IIYA 4KHZA 4ZQEA 1IH8A 1EBFA 3GNQA 1QF9A 4R9UC 1IULA 1XEWX 2R00A 2WTEA 3H8WA 4PFSA 3FYUB 1IBCA 1Q3TA 4YAEA 2XUKA 2FWMX 2JJ1D 4LE0A 3QYJA 4V1CI 3LGAA 3BDVA 2I7VA 4ALLA 1UMDB 1X7WA 5I4KA 3UJCA 3V1MA 4XN3A 2CDCA 5CD1A 2Y4OA 1GZ6A 1DV1A 2IQIA 2FEWB 3DULA 1A1SA 1GQOA 1ZMXA 2B37A 1XT6A 4IQ4A 2ID7A 3RTEA 3BXEA 4K2HA 4KP7A 5CD9A 2O7SA 5FTLA 3T3NA 4E09A 5JNRA 3G5LA 4DJFC 1LQTA 4YMIA 4S24A 1IVNA 4KACA 3A3KA 1R6VA 3IMGA 3NXSA 3KB8A 4JT8A 4PVCA 1OC2A 4RK0A 1I6MA 4WOCA 1J1UA 3G0DA 4HRAA 4BFTA 2ICAA 1WHSB 4HLUA 2GAFA 3PCRB 4MRMA 2FWIA 1XRMA 3JAWA 2PKCA 5L51A 2VBSA 2OVBA 4QASA 2H3HA 1XKXA 4RSMA 1PNVA 4B6QA 3NHPA 4BVEA 5GZ1A 4HHEA 1NJGA 4PRYA 2QTBA 4UM9B 1JU3A 1ZI8A 1B8PA 3NGXA 2PYIA 5BN5A 2G80A 2ZXHA 2X9QA 3SHWA 2FFJA 4LTDA 4MEBA 1RWPA 3WTCA 1VCIA 2FSSA 2QLJA 5EIHA 3WZMA 1E9CA 4LXTA 1CRWG 3DZFA 3F90A 2HA4A 3BAZA 4HEQA 2C98A 1UC4B 5LXTA 1OXTA 1B0ZA 1ZDMA 2QQEA 3M8KA 4K46A 2NZJA 5IG2A 3L01A 4Y2QA 1U0OC 3E0XA 1O77A 3IFSA 5EMHA 4PSDA 3VTZA 1SXPA 3HWSA 4CIVA 4LQ4A 3WLFA 5ICCA 4MVCA 3KJNA 3W9YA 4FT4A 4YV2A 4WE3A 1WVIA 2ZSFA 1C1DA 3PDUA 5K0NA 5KX5F 1AA6A 3A8KA 3GQBA 1ZN8A 3VDMA 4LHWA 1F2TA 1XKLA 4GR5A 1PVVA 2FFRA 2OHGA 4P7KA 4F72A 5IJZA 2ZP1A 2QX7A 2W9XA 1JJ2B 4MUGA 2Z5LA 3D2AA 2D3WA 3OEWA 3PGVA 2AR0A 4PAGA 4WIAA 3VZQA 5IASA 1G6OA 1MXHA 3MS7A 2I2BA 2O2GA 3I9LA 3KOWA 3L7MA 4Q6WA 3H9QA 3T8YA 4O4LF 5E6RA 2EWMA 3PC8A 4TTSA 5J4HA 1QANA 5G53C 4BLQA 5B4TA 1E1RA 1I1OA 3HDHA 3M7IA 1FX0A 2QD1A 2W2MA 2XKJE 4N41A 4GEGA 3LT5A 1IOLA 3L7CA 4DUGA 3QEBZ 1RZ3A 2P79A 5EJEA 4FEEA 3QUCA 1E89A 2EL9A 3E8SA 3P71T 4EAQA 1N4DA 4W6QA 3WL8A 2YFKA 2JJ2D 2P2LA 1FW8A 4PC2A 2WICA 5DMXA 4Z0HO 2QTTA 3U48A 4EGQA 2IH4A 2HIHA 2QTMA 3R44A 3L7DA 2RMKA 1W36C 3IVXA 1RYZA 4TZTA 3ZLTA 2QJRA 2VPYA 1XA4A 1ML4A 3ORSA 4PGOA 5AOBA 1PWHA 4K9OA 3ORFA 1II9A 3IULA 1B0UA 2EVWX 2O1SA 1GEGA 4NDNE 4RLHA 1J39A 4N39A 3FWYA 1G64A 2VXCA 4OUKX 1DIOB 4Y1EA 3QX9A 2P1RA 2AXNA 1NNEA 2QN3A 2GB4A 2QXUA 3BRCA 3C6ZA 4CEIA 1UQUA 5KTNA 5KYKA 2O06A 3RSSA 2C5LA 2Q4EA 3LYAA 2WTNA 3A28A 3FNIA 3QFRA 4Z9BA 2YMQA 4NYJR 3E3AA 3H9CA 5LBTA 2IBTA 2R8RA 3F9RA 3D6MA 1J21A 1H4QA 3ZDCA 1DRKA 1N5RA 1T0HB 1RYFA 1Y5LA 4GQBA 4RE6A 2F3SA 1ZA2A 3GLHB 3QSGA 2KJQA 4PSKA 1DINA 2GN9A 5TGDA 3SN6A 3NHUA 5IC6A 3I6IA 1JFRA 2R68A 3DWIA 3MUFA 2PZBA 2O2EA 1E7QA 4LDAA 4ZVRA 3I05A 4K28A 1YVPA 2G82A 4Y0AA 5B57C 1BJRE 3GNLA 3C3DA 2W2OA 1ZM2A 3ZUGA 1A5BB 2X4LA 3EH1A 1YRHA 3NHKA 4QLAA 3A1TA 2ROQA 4WUTA 5DV9A 5K3SA 1XX6A 4MHOA 3ID6C 1OLOA 3K7EA 3ZU2A 5J23A 3TVDA 3M9LA 1RVV1 1NXQA 1UDXA 1L8LA 4B4VA 4F1JA 3HJHA 1A9YA 4G1EB 5GJVC 3I6QA 1DTWB 1KR5A 2E7ZA 2Z98A 2GK6A 3WYBA 3UGJA 1HBJA 2IS6A 2PUWA 3G0GA 3TB4A 1QCYA 2CUNA 5L4NA 1P6XA 2XRYA 1IOVA 2J3IA 1IHYA 4WBXC 4F6LA 1IZ0A 1G291 1OJ7A 4Q15A 4TVBA 4JUCA 2FWJA 3GFFA 3K8ZA 1NW7A 2ZXFA 3EDYA 4XUGB 2J3JA 2OYSA 1GCAA 1ND5A 3RVRA 4BATA 3OA2A 1ZLXA 3Q0IA 4RORA 3TNFA 1N0UA 3WLOA 1FTQA 3AKEA 5JH7F 3EPJA 2XY4A 1FK8A 1ZVJA 3CSDA 1IN4A 3ICPA 3H0KA 3W05A 3A9VA 1HT2E 1ZCAA 2PWZA 3K8YA 4X1IB 1R2QA 3FMVA 2AC7A 2ZXEA 1NU8A 1OILA 1NHGA 4C3ZA 3ORHA 2WEKA 4PHTA 2ZAOA 3NNSA 5A5DA 2DKOA 1K75A 2HGZA 2P65A 3MHTA 1T2CA 1WW8A 1P7VA 1YT5A 4GLFA 2VTBA 1EK6A 2XQJA 4J76A 2PS9A 1AHHA 4HTAA 4NG5A 1HO3A 1YBAA 1WTHD 2ZPTX 1VM6A 2DQ4A 2WTMA 3BIJA 4GRAA 2JN9A 1ODJA 2XADA 4MYRA 5LD2C 1RAEA 3BILA 3FX2A 3WL6A 3ZPXA 4D97A 1PFWA 2ZWAA 3DAFA 2IXAA 2WG2A 1ZM3A 1F1BA 2WYWA 2YRWA 3NHMA 3QITA 3CKMA 3LHFA 3UY4A 4A6PA 4YX9A 3E1YE 2G40A 2I4IA 2XVXA 1YCDA 1UMKA 4M36A 4NH4A 3SBEA 4C29A 1H5QA 3NBYC 4I4LA 3CCJB 5I9IA 3IL2A 4YT5A 10MHA 2Z6QA 1TMGE 2NT4A 2RBEA 1HNXB 4WEQA 3B1WA 3DKKA 2ZAMA 4CMHA 4K87A 3L1KA 4EUFA 1BW9B 2F4VB 1E5LA 1G9TA 1TJYA 4DDVA 1D9ZA 2PR7A 2WSYB 4CYMA 3IE2A 2OBFA 5IBCA 2DPGA 5EPOA 1O87A 2H0QA 1F8XA 1Z39A 5CW1A 3UWSA 2TS1A 5M5BA 5BO5A 2K87A 2N1MA 4J1NA 1PR5A 1Z56C 4PPYA 1E3JA 2PTGA 3EJ6A 1OYWA 3AMVA 1FJ2A 1TZCA 5D2CA 2AEEA 5BN3B 3LI2A 1JE1A 3PTAA 1MABB 4P0PB 4W4TA 1FFXB 3BM5A 3H11B 5K3OA 4G23A 5CA1B 5JV5A 2COUA 3DMNA 2GH1A 5ALVA 2JJ1A 1KZHA 2OK8A 1H2BA 3Q6MA 4U7PB 4B9EA 4ETIA 3QKIA 1AUOA 2AR9A 1KY5A 2CDNA 3ZZUA 2LTAA 2BTQA 3RI3A 3VOTA 5BQXA 1NQVA 5C4IA 4YCMA 3KUUA 3KSUA 1I7DA 4G6IA 1ZXBA 3A1SA 3QF7A 1MX3A 2F3QA 3M2TA 3PL1A 3E9MA 5KWEA 5JXGA 5HE8A 2QV7A 2IYPA 3AG5A 5EIBD 1GGJA 4MRSA 1V26A 2X4IA 3HJBA 1XCJA 1Y3IA 2G0AA 2EGHA 2J4CA 2RCYA 3PUZA 3LBYA 4AS3A 1I2BA 1MV8A 1TJ5A 4YONB 1SQ6A 1UBHS 3MSXA 3N7UA 2FG6C 4V2UA 2BM8A 4EVIA 3R0JA 3NATA 1WPQA 2EBWA 4QTTB 1JR3E 3H84A 2XE7A 1F3LA 3D6VA 5DYYA 1UBTS 3HR8A 3I9MA 3A8JA 1GZHB 4IO0A 4J2OA 3ZHUA 2OB1A 1N2CE 1UJ5A 2ZIZA 3PR1A 4H3VA 4MA4A 4NOMA 4PXYA 3E3LA 3NHSA 2Y0DA 4Q16A 5G3YA 1J0XO 3WYGA 4C4AA 2Z2JA 3AF3A 5KTTA 1RJ9B 1DJPA 1V2HE 2VYCA 3PFKA 3L7BA 3LW7A 2M6SA 3PQ2A 4JGBA 4O4IF 2O8EA 1DCTA 2A86A 4BWYA 2B7CA 1CE8B 1R5JA 2R6FA 4CV0A 4HDOB 4QULA 1JIKA 4X8HA 5AOCA 2A9PA 4Q39A 4H0FA 5TT1A 3HGTA 1E3EA 3DEZA 2Q50A 4G5XA 1NI4A 1ZM9A 3OLCX 5F5LA 5GVRA 1AA9A 1OB0A 3EW9A 5ERXA 5KI6A 3ZDAA 3ISXA 4U7TB 1N34B 4H2DA 4XVRA 3A6EA 3WIDA 3H0CA 3ILYA 4KIUA 1RWVA 3Q6NA 4M9SA 4N6GA 1TUEA 1QFZA 1CK4A 2G06A 3KKLA 4U3JA 2I3ZA 4C01A 2YYZA 3L0PA 4OMDA 4RJIA 1IZ8A 2P4SA 2ZZKA 1EGMB 1UXOA 3LWNA 1A96A 3WLTA 2X86A 2D3TA 3K9HA 3TJZA 3DT6A 3REFA 4YRIA 1R8YA 3OCUA 2JEYA 1PFQA 2H4YA 2P5TB 3IERA 3C74A 3PT5A 3UQZA 2FRDA 3NEYA 3QE4A 4AAYA 4WBNF 2XBUA 3U61B 4DXAA 1VYTA 3OX4A 4KNYA 4KQ1A 4PPNA 1YMQA 2ORVA 1W85A 3E9NA 1GNLA 1T9BA 5AVVA 4W5OA 2JJ2A 4C7MA 4TV9B 4I2NA 2BRUC 1JLHA 1SC3A 3GCZA 3RQIA 2FPLA 4NEGA 4R4JA 4D45A 4YR7A 1KOFA 2IPAB 3W0LB 5CLFA 4F11A 1GQYA 4JLVA 1TO2E 4KIGA 3ELUA 1IY8A 4EF6A 1MC8A 3L2OB 3VOSA 5BSKA 1NVGA 3TRDA 3RY8A 2YINC 3G85A 4H7DA 3OCWA 5C34B 3WWOA 5BPHA 2OHVA 2CSUA 3AYZB 4RCVA 2FWPA 1GQSA 1KI6A 1ZWKA 3CEMA 3OPXA 3OEEA 2JFFA 1E9FA 3QVTA 4A8TA 1WCIA 2YX1A 1FRQA 4RW0A 5KQLA 4QM6A 5GOTA 1IZZA 4LJ5A 4EY6A 1XRRA 3UWOA 1WO8A 3X1XA 2OO7A 4B43A 5D6OA 3B7PA 3OIDA 2G28A 3BGVA 4PO8A 1OU0A 4PC6A 2YZ2A 4TLEA 4ZRNA 3VTKA 3VAAA 4AQDA 5EKUA 3P2KA 2RHLA 4PFJA 2LNDA 3ESRA 2AFIB 5EQJB 5ARCA 4C4RA 2Y71A 3TEMA 4J7AA 3HCPA 3KOYA 4P98A 1LCIA 3SS9X 1XRNA 1TVCA 4ZU3A 1A9XA 1Z0UA 5ANRB 4YBZA 5IS2A 1Z6PA 3ZKWA 5KSZA 1X0VA 2IEGA 4COOA 4F9GA 1W7AA 1RD4A 1VCOA 3L4JA 3D4LA 5FA6A 5CURA 1ZLYA 3HVHA 1ZGJA 4G89A 1AKYA 1HH4A 2YR0A 3UAWA 3PUMA 4EG0A 4F4UA 4CUJA 5KS2A 3QK7A 3RE1A 4YPOA 3ET5A 3O2SB 3D3EA 5B6PA 3OM8A 1VDZA 2DUWA 3AIKA 4DA4A 1F2UB 1PL6A 2JZOA 3CO5A 3AIMA 1YR2A 4QOFA 3V7FA 1TTPB 2G88A 3AG6A 2R6AA 3CCLB 1EFLA 3NGMA 3CF0A 4ID9A 4DKXA 4MVJE 2R2AA 3ZVLA 1N2XA 2ZL6A 1R88A 3PX7A 6NULA 2NYRA 4P8RA 1FNBA 1ZUHA 5B36A 1YMUA 3DZJA 5F78A 5CA0F 2QA4B 3V7NA 2I55A 1LVUA 2EKBA 2VYVD 2Z30A 3WS7A 5FPQA 3KT8A 4HAVA 3PQ7A 4MVJP 1C9EA 4KJXA 1P7YA 1NVVR 3K0FB 1EVZA 3FYDA 4B40A 2ZYTX 4REMA 2JKZA 5LN1A 3FHTA 1BH6A 3IMEA 3N86A 4JY7A 1RWWA 5COAA 4UKDA 2VKTA 4FMCF 2QPOA 3HXTA 3EIWA 2J4DA 3NIWA 2EJVA 4HAWA 4NEHB 4O4JF 4BKMA 3GDHA 1WXWA 4OXIA 5L3QB 4MNTA 1SVIA 3AT1A 3D3WA 2O4CA 3CEHA 5GM1A 5ALMA 4D44A 1HOTA 1QH1A 2EFEB 5IAGA 1HQDA 1KNXA 2KYRA 1W47A 5LA6B 1TD9A 5F3WB 1TGYA 2AK2A 2DPHA 2COEA 1ADBA 2RJ3A 4ITUA 2VBUA 5MN5A 3L8EA 2B35A 2UDPA 3QWIA 3N87A 3VSAA 4H4DA 3EIXA 2CK3D 4XM2A 1UKBA 3CMEB 5I48A 3W3AA 3ME5A 1Y5NA 5AM5A 2NUTA 2MSDB 2XXAA 2BMVA 1DQRA 1OBOA 4LJ7A 4FK8A 3K1JA 4JL6A 2YYAA 5CPBA 5I9MA 3TR5A 4NJOA 5EZQA 3SXUA 1OI3A 1YZGA 3CWQA 5KSOA 2PO7A 4JEHA 4M1TA 4B7ZA 1PR0A 1QQAA 2HA2A 2CLIB 1D4FA 1KNQA 5LZ8A 3TRHA 4LY6A 3L1IA 1NBHA 3GB9A 1CUVA 1RIFA 2PN1A 4FQ8A 4AUKA 3B6EA 2H2HA 2B92A 2VRBA 4QXRA 3ROEA 2BT4A 5SYMA 1LPBB 4FGLA 3HWRA 3E9EA 2E4WA 4BWGA 2X9NA 3HLTA 4OIFA 3W5HA 5AM0A 4JLJA 3DE5X 3OIFA 1YJBA 5KC9A 2E1BA 1BN7A 4DA8A 4DRZA 3W8DA 4Y9DA 1FYWA 1KU0A 3B2EA 4F8YA 1M75A 5BUSA 5DWDA 1U9CA 3A9WA 3DUWA 4J8PA 2R2GA 5D3MB 3KEOA 1E2GA 3AF1A 1AKMA 3BMOA 3GEHA 3QJ5A 4DR5B 2R65A 2RGNC 1U3TA 4MCAA 5CLGA 4F84A 3GJ5A 5FFFA 4WK2B 3M6FA 4Q05A 2ODBA 1Y7HA 3A32A 3KEQA 4L6AA 4BX8A 1WEKA 2BC9A 3K4HA 5BW5A 1A4XA 1SG6A 6REQA 1Z17A 4JOBA 3CNOA 4FS8A 4W8GA 1CIJA 3X44A 1K6IA 3MWDA 3OSZA 4MYUA 2IYWA 3DS8A 3PNBA 4R05A 1S5PA 1XP5A 4C03A 4G1UC 4AKSA 3ONDA 2M6RA 5F7OA 2HA0A 2QTAA 2FF5A 4P4NA 5BWNA 3BTUA 1A95A 2NVBA 1KAHA 3M6WA 3O91A 4OHOA 3D6HA 1JR3D 2REBA 3PRHA 4NV3A 2QYOA 3NEJA 4FYMA 2EHJA 4DV3B 2OMKA 1FXWF 6YASA 3TW0A 3Q7PA 3VYTB 1T8UA 2QL9A 2JB9A 4DR6B 3SQDA 1FXSA 4BNYA 5DYTA 3KFXA 1LW6E 2PWYA 3ZU6A 1HFEL 3MUEA 3DJYA 4ZXFA 5TE9A 5KOYA 5HF5A 3RADC 1T9DA 3W06A 3E22B 2GARA 2GSDA 3BHIA 2VAPA 1J2JA 2FLVA 3EC1A 3KUDA 4YO7A 5SYAA 3WP1B 5BSGA 3N0RA 2JLVA 4QPDA 4B4KA 1XC7A 3HVJA 1MFPA 2NZ2A 2CLKB 3A1CA 4ENPA 1OKKD 2H4ZA 2YV2A 4K3UA 3W5SA 4JHLA 1I7QB 1PD0A 3EODA 1MAHA 5K3BA 2YH2A 1ZBQA 5C35A 1C3VA 4XX0B 4D4MA 4X7MA 3KEMA 2BI8A 1BOOA 1DAOA 4QUBA 4DR2B 1G98A 2MYUA 2NZUG 3JQ9C 4KQKA 4XSHA 4N3AA 3LOUA 4NECA 2PNJA 1J8FA 2GYWA 2APJA 3O2JA 4M7RA 4TMZA 4Q1BA 4JUAA 4LJSA 2H57A 1E5TA 2ZWOA 4RKRA 3CSSA 3V8MA 4NU6A 2I9KA 1E4VA 3AIIA 5A6SB 3IELA 4E70A 3IO3A 4X20A 1L8QA 3EVTA 2IOHA 5HKAA 5BR1A 1B0PA 3RU7A 1UD2A 1V1MA 2GGSA 3U16A 5LYYA 1XD9A 2CYAA 4ARUA 4Q9IA 4BLUA 2JW5A 2NUAA 1DX6A 1JX6A 2FY8A 2GTHA 2PMCA 4H3HB 3TUIC 4MDFA 4JVOA 4Q7JB 1C4KA 1FJHA 2H4JA 3C5WP 3F6CA 2VKQA 3QIAA 1CFJA 2OTCA 4B3DA 1NB9A 2KPOA 2R6CA 2GASA 5K7SA 3UPTA 1A76A 3OKAA 5A9SA 1KERA 1A5AB 4PO3X 4C0JA 2YS7A 4C4YA 4DMUB 5BYBA 4ZK6A 1AUVA 3KKPA 1QVWA 5TIIA 2PVCA 3D0KA 4KE6A 4MRVA 3CWCA 4UMVA 2ABWA 4WUVA 3SLGA 3K0CC 3T0FA 1T6YA 1JKIA 1FOEB 3ELWA 4Z0TA 3V1UA 5IH7A 4RD3A 1ZO8A 3JWHA 2BBTA 2QV0A 1XTQA 1BXRA 3L92A 4X8OA 2FDCA 5C1PA 3JRNA 4IO1A 5IYNA 2CUTA 4NCXA 1T8RA 2XB8A 3OCJA 2D7DA 1TU3A 4CTJA 4JJ7A 1JHMA 2P27A 4Q01A 3TJMA 4MQUA 1VHEA 3MGGA 2MU1A 5IJ0B 3LW8A 2RE8A 2ZRQA 3O2NA 4EL5A 6PFKA 1OD6A 2FMTA 3LQFA 4I9NA 4NMMA 1L7XA 4HFRA 4UFPA 1IEWA 1UWCA 2H5LA 2CD7A 2HRQA 2QNIA 3II6X 2Z5VA 4G0OA 4QJIA 2QTLA 3Q8WA 4BFVA 5A1JA 2R47A 2PUFA 4L9AA 2HUNA 5HDQA 1ZXLA 4C5AA 4QECA 4CQLA 5KQSA 1X7WB 2Y6VA 4R6XA 4L3VA 5DBOA 5IRCD 3PJDA 4A15A 4REOA 5F2EA 4MDYA 2BRUA 2H1SA 4G0VA 3LQ6A 1P31A 3U6KA 3EG9A 4HDMB 4KQWA 3U13A 4E5KA 4NE7A 4FMBB 3WJ7A 2YZKA 1G4AE 3ZZMA 3QENA 4D3YA 4F5WA 2PQ2A 2B0JA 4MIYA 2HA3A 2DRIA 1NC1A 1Y4AE 3I2JA 3LD9A 3PEYA 1MAVA 1GCIA 2IOQA 2WUVA 4HQNA 1SUFA 4MRMB 3ZHQA 4RHFA 4EGSA 1CG6A 3JWPA 4DV6B 4MQ4A 3URMA 3JAWB 1UANA 2GJKA 2AZXA 5BRJA 3HUEA 1JG1A 1GL9B 1LRJA 5DEIA 4EHDA 4MVJD 3EXG2 5LZ4A 4X44A 3BWCA 1LDGA 2E6UX 5BN5B 1XA0A 3QHQA 3MB8A 4QFMA 2BMAA 1K97A 3IUSA 1V8DA 2VYVA 3GH3A 4AK9A 1P6QA 4OYHA 4ZO9A 4RTPA 2H4FA 4M22A 3T54A 4YRBA 1HFKA 3SY8A 2M5SA 1LRKA 4Z4VA 1LSOA 4I9FA 3HY3A 1W9MA 1VE7A 1WF3A 4JVMA 3FPSA 4KGZA 4ZVUA 1SWVA 2C8KA 1I2CA 2B82A 2WVHA 3H9BA 3MOIA 1R4MA 1JUDA 2X40A 3ZYCA 4JU9A 1V0JA 5DPMA 4TWJA 1U1CA 3GQBB 3VC7A 4MMXB 4MW9A 4BAZA 2HN9A 4JASB 1F2TB 1U0RA 3ZY6A 1ZHOA 1K27A 2WE8A 4RK5A 4BL5A 1MQ8B 2F9LA 2LZJA 3KT6A 4H15A 2HY7A 1TRKA 3B9PA 3PHCA 1KVQA 4OJYA 3L8GA 3ROXA 4EUKA 3W2HA 4LZPA 4LF6B 1Z3CA 2I29A 2NTYC 1XSEA 2HQBA 1GG5A 4IRXA 3VJLA 4C1BA 2FWAA 4L5JA 4QVAA 4H4CA 2CK3A 2FEMA 2PMFA 2SBTA 3ROPA 4Z4QA 3Q2KA 3PYXA 1SIOA 3ZIAD 2P77A 3GLSA 1JHYA 2F4NA 4PW0A 4S0XA 3O90A 5KSPA 5BSRA 3ASQA 3B1FA 4BJ3A 1FX0B 2X5OA 3C6MA 4E22A 5DTMA 4KXWA 1NAIA 1XNGA 1Q86D 1M72A 4FM9A 3M1YA 1FVHA 3HDTA 4AVZA 3BD6A 4UEJA 3I0ZA 3NNDA 1U8TA 1CJKC 1GL3A 1ZINA 2WUEA 5A8AA 5EQDA 3S99A 3ZN2A 1W96A 3RM3A 2GT1A 3N2KA 2PNFA 4X6UA 5ILQA 4Z53A 5LDHA 3WDSA 3ZWCA 1JXQA 4C0BA 1AF7A 2H5IA 3K5PA 4R1MA 2ONJA 1MDFA 4ZYZA 4V24A 1KL7A 4ZAZA 4UDXX 5GIOE 4AO7A 4J0QA 1Z4JA 4JITA 1ZJ5A 3RS0A 3B48A 3AR3A 3QXSA 4DXHA 4IXDA 4NVRA 1VI6A 1DLJA 2BY4A 3GR6A 3HFRA 3INGA 4HAOA 4M9ZA 4FMPA 4C4SA 2NO6A 1TO1E 3DOUA 3JZAA 5DGCA 2YQZA 5KQRA 3R6TA 4JUIA 3EUWA 3OE7D 4G3XA 1TJNA 2QX4A 5AICA 4HT3B 4WKNA 1MIOA 2C2WA 1IXRC 2XTNA 3S2FA 3T9AA 1F9AA 3QQPA 1GTVA 4N03A 1KZ4A 3BCSA 4LMPA 5DXAA 4ALJA 4JC4A 1YNSA 2HLDA 5AVQA 3JQEA 2O1EA 2CNOA 3C8HA 4PZYA 4FHGA 2GF9A 3L49A 5DCYA 3A4NA 1JR3A 2C88A 2PCJA 3LX6A 2XKAA 1YK0A 2Y1LA 3OQIB 4AUEA 1MJ5A 3IPRA 1EUYA 4KDRA 3TRIA 4PRKA 4JI0B 1N2CA 1IEQA 3HYRA 2PMEA 3UUGA 1DBQA 4AP9A 1EP9A 3X1DA 4BLTA 4C88A 4YAOA 1SKUA 3D5TA 1EWTA 3EVDA 3WYDA 1NW5A 1X8JA 4EYOA 1CNFA 2I7TA 4DBZA 1YZLA 3PBKA 2PT6A 2DERA 1PGJA 1DDGA 1Z8DA 3MCWA 2I2WA 1TQ2A 3NT2A 2ZWIA 1JPNA 1TAGA 3IDZA 2LR0A 3A6KA 4OHRA 1Z45A 4BMNA 1YONA 1OKKA 4KXUA 3H8VA 4PQYA 1XZAA 1J2RA 1JJIA 2Q62A 2RI6A 5BV0A 2K7FA 2WYHA 4R31A 1F4PA 1OFIA 3E48A 2FKNA 4RDJA 3G9ZA 2Z0MA 2UZAA 4MLCA 2X6YA 2WMOB 1UJNA 2SICE 1EQAA 2GX6A 2HJ9A 2NV2B 3DTVD 4BQOA 3Q8MA 2W43A 2VJJA 1JPJA 1KOJA 2J6IA 1JJBA 1HTBA 3TRKA 4M37A 3PKJA 5EYPA 5G0UA 5JFOA 4ZYVA 1CY1A 1E2NA 1JJ7A 2PZ8A 1JKJA 4QXPA 1PFVA 4MGYR 2VTBB 1IHOA 1RRVA 4Z3DA 2RAFA 1DU4A 3H05A 5C80A 3FFWA 5SY9A 4AJLA 4D41A 3A26A 2QZZA 1X1BA 2Y1FA 3QVSA 3ZJYA 1LJ8A 1RAAA 1B8NA 3CF2A 4FN5A 1KE1A 4GMFA 4FQ5A 3W90A 5JROA 4C4OA 3U3DA 2YIDA 1ZY2A 4KRFA 2HIMA 5HXAA 1N6HA 5K0LA 1TM4E 5D1HA 3HXLA 3EZXA 3LX8A 4GRDA 3ZE1B 1LQUA 1BWSA 1E69A 2GJSA 3I6YA 4JQZA 4Z86A 1WBJB 3SMVA 1Q7CA 3S28A 2BTOA 1BD4A 4WZKA 3GCWA 4OJKA 1QK3A 2QRQA 4MA5A 1YVRA 4XR9A 5CHEA 4KO4S 4L4UA 3JQ9A 5CB4A 1W75A 4CCYA 5GOZA 1X42A 2OHIA 1JI0A 5GV8A 2X0NA 1NR7A 3LDUA 1SQGA 3FZGA 4N5DA 2JDID 2BMEA 1O94D 4TZ6A 1DDOA 3F4LA 1C50A 4HY3A 2LKDA 2VAVA 1WABA 1L6IA 3R76A 5DGDA 4ZAVA 3RC3A 1DGQA 4DAOA 2R1VA 4L0MA 3S7ZA 3BC9A 3ZZTA 5CLHA 3UMMA 4MWBA 3WQQA 4DV2B 2GBCA 3UMSA 4DC9A 3A36A 5JZVA 4DMMA 1XU9A 1J90A 2BTQB 3TSOA 1R12A 1UXKA 4M1EA 4P86A 5HIJA 2I8CA 2BF7A 1EWKA 1EVIA 4G5YA 4B48A 2FPIA 2OM2A 4GPAA 4WZZA 1QRAA 4CM8A 5IABA 1TQ8A 1B2LA 2OR3A 2ATCA 4F9TA 1DC4A 2DU8A 4EHIA 3ESAA 2F43A 2Z8XA 3K0CA 3RVLA 1Y63A 1U11A 3T7SA 2ZBPA 2PKXA 1QTIA 3NBAA 1A4RA 1NL3A 1E6EA 2EHDA 2YJNA 3DDHA 3JRXA 1ZOOA 1IB0A 1CDEA 3OJCA 2N75A 4HE5A 1ZIXA 1AZWA 4O2BA 5BVHA 1E1LA 2OXRA 3NTQA 2XJ4A 5IM5A 1GZ7A 2AI3A 2GAJA 2XUHA 3GA7A 2ZYHA 5C5IA 1G55A 1WJGA 4MVJA 1HDOA 2FVYA 3KOOA 1CY2A 1ELOA 4LIPD 3F97A 3DDOA 1ABBA 5FWAA 1SHKA 1X7XA 3T34A 3W5IA 3UICA 3KAPA 2CRVA 1V6SA 1AMNA 2PRJA 2EBUA 3CJTA 3FCAA 4J0KA 1X8LA 4M8SA 4P5PA 1WZCA 1FFAA 3OVMA 4P81A 3UXMA 2WQ6A 4MCHA 3D7NA 1EJ2A 3GAMA 3BL5A 3RRBA 3GT0A 1WVMA 3L5OA 5EHIA 4TYMA 5KVSA 3H2KA 4IWXA 2GMWA 1DIAA 2CYCA 1NXSA 1GAWA 4HCJA 3OCXA 1G1MA 1EEHA 2JKYA 2QAGC 1ISJA 2MSEB 3VKHA 5B1DA 4FILA 3OZAA 4DQUA 4LDRA 4JELA 2IYTA 4NDZA 4KQCA 4E5YA 2EU8A 3RU2A 4U3JB 1TI7A 4N8DA 5K20A 5FQNA 4JOQA 2ZSHA 2FV8A 2PY6A 4OF4A 1PZMA 1A8IA 3HXMA 4TQAA 4OX9B 3AV3A 3HUTA 3ICOA 5TPZA 1JQ3A 1CR2A 2XQGA 3T4XA 1GRNA 4U2BA 1BH2A 1ZI6A 4V0MA 1IM2A 2C7PA 3UFXB 4YCAA 3ZIAA 1XRQA 3PQCA 4C07A 4RK7A 3V5NA 3JX9A 1VIYA 4W8HA 3VR3D 4JMQA 5KKNB 3F5DA 1LBQA 3A6LA 1Y8ZA 1YI1A 1RI1A 2L0XA 3ICEA 2B0CA 5TF4A 1W85B 3Q1KA 1SQSA 3C6QA 3IAFA 2ZJYA 5C8VA 3RV3A 2HK7A 3F7MA 1MCZA 4MUIA 4RQTA 4TLBA 3WGVA 3CX7A 4YCLA 2DKNA 3PVCA 5C53B 2CFIA 4ZDKA 1WUKS 2Y92A 1L1RA 4WNCA 5F2NA 2AMFA 2YASA 2VSNA 5A4AA 1NN3A 3H1BA 1DAHA 4OXRA 1F60A 5F3RA 3VU0A 1U2EA 2VHCA 2CWWA 2Y76A 4JOSA 3ZWKA 3M6AA 3NTRA 4IHJA 4OLJA 1KJYA 2VP6A 1JIUA 1Q0UA 2I6SA 5KTKA 3TBKA 3ILHA 1H2EA 2ISCA 1I6KA 2H51A 3VSDA 1QAQA 2Z08A 3N2LA 1K8AD 1LZKA 3OW2B 1KI6B 3IQWA 4KX3A 3ELDA 3IEVA 3W5BA 9ABPA 3FFBA 2BI4A 4K05A 1J24A 5E7IA 1UOPA 1N9KA 1WCIB 4R0VA 1BA3A 4QDTA 2VDQB 4QC2A 1FSPA 3OE7A 2WYRA 3K6SB 4E5MA 2ZI3A 4BO7A 4WZLA 5K9ZA 2Z1DA 4MX8A 4C2BA 1DAIA 1KO5A 1QDEA 3T53B 3W2FA 5CR9A 3RABA 4A2CA 3R2JA 4PS1A 2YY5A 3GU3A 4CM5A 2DSNA 1I2DA 1PJ2A 4RZSA 1ZNYA 5FO0A 1FC0A 4LW8A 4C7XA 2BGKA 3I12A 2DHRA 3D7KA 5JBIA 3DE2X 1PX2A 3GUCA 2RK3A 2F1IA 3B6IA 1UZUA 4RXTA 3NV7A 4H1HA 3U7EB 2FRXA 2XF8A 4LGMA 4BRWA 3FZYA 8GPBA 1JDTA 4FZRA 3AGQA 4J29A 3V1KA 4UAGA 1J22A 2VJIA 3KOMA 3L7NA 1RAFA 1SG0A 4PX3A 2M32A 1CVRA 1T9AA 1MXFA 1GNRA 2HGSA 2MYPA 2PMWB 4WK0B 4YMVA 3IPXA 3LL7A 5K6RA 3LXRA 4S1NA 5TC4A 2BFMA 3FOZA 3RR2A 1PLLA 1YAHA 5J40A 2Y0BA 5EZYF 4QAJA 4EVQA 1T0PA 2DR2A 1TF5A 5LQSA 4GWGA 3ZJ5A 3DTVA 2VRNA 1R4ZA 4E5DA 4R8KA 2GJ8A 3MNFA 2Y6UA 5EHXA 3DHEA 1G8AA 2B4YA 2YWJA 3DVAA 2EFYA 2JCSA 1LDMA 2YWHA 4W7SA 3FW1A 4KWEA 5DOZA 3L8FA 4M83A 2ILVA 5FJJA 4ZK2A 4GG1A 3OOCA 2GTPA 5DP2A 5ED4A 1P91A 2HQOA 2I6GA 3PJRA 1BQ4A 2ONZA 1R5OA 2RHGB 4PLPA 2PWPA 4OPVA 3D7RA 3TNJA 3TX6A 3D3WB 4Y6QA 4WA7A 1N32B 2XYGA 3CP2A 4GMHA 3RFFA 4ZWNA 2WD8A 4DIDA 1QH1B 1ADGA 1SK9A 2ZRNA 3VGPA 2B8EA 2E5LB 2QRUA 2A9JA 3K9CA 4DRXA 3KU4A 4NZMA 1CJCA 3PTZA 3QEJA 3VV2A 1CF9A 1D09A 2IPMA 3RAEC 3O1JC 3T94A 2NUTB 2QRMA 2XXAB 4B83A 2CDRA 4GBED 5T64A 4B87A 1EAMA 1ZJJA 1PK7A 1D1TA 3SXUB 1RTTA 4NZNA 4Q4CA 4Z4TA 4J3NA 1PK9A 3LY9A 2WJ4A 1I7PA 3PPIA 2GLUA 3WLPA 1E5XA 1P3Y1 1RVDA 2ZI6A 3I3SR 2FZLA 1UJCA 3ML1A 1UIMA 1XAGA 4HPJB 2JDIA 2ZS8A 2ZATA 3CPHA 1O94A 1AK2A 3Q6RA 4HWOA 1DIBA 2YV5A 1ST3A 2G9VA 4QVGA 3PXGA 2VNAA 3QYPA 3KNZA 4DVJA 4LY9A 3D0OA 4HAXA 1U3DA 2NACA 4KQMA 3B1JA 3CH5A 1KVTA 2EERA 2QUAA 2RDMA 4JL5A 3TLAA 4ZMBA 4MJLA 1MO6A 2FU5C 2H1LA 2Q3CA 3LSTA 3LQ2A 3UMYA 5IJXA 1BX3A 1KZ6A 1DXHA 3BMOB 3MXOA 4JIMA 1K4YA 3LNCA 5BMVF 2EP5A 3AJ8A 3HKDA 4O33A 3I8XA 2J5XA 4PC7A 1ORRA 2BL4A 1CLUA 4I1RA 4BXOA 5EZ5A 3ENKA 1N1GA 1WV0A 2I76A 3MWDB 4G9EA 4HQ6A 3I76A 1JFLA 2JF0A 5CJPA 2JFNA 1SKYB 1DRJA 1ULUA 3R3JA 3CZRA 4L6IA 3I5UA 3G0OA 3ZZ0A 5CNJA 5JD6A 3G2OA 4TTIA 1TYEB 4ZFNA 1POWA 1E5QA 2C00A 5HUQA 5ALFA 5A3SA 2XZTA 1VPVA 3OPOA 4RK1A 1VHWA 3IPYA 2HA6A 1HXHA 1ISMA 1EFRD 3D4OA 3R4CA 1P2TA 3EGXA 2QDKA 1Q7BA 3EGCA 2UYCA 2WDPA 2WTXA 1X8XA 3CT6A 3NWOA 3DXXA 3P1JA 4U9IS 3IOBA 1CZHA 1M2GA 2Z83A 3C15C 2LWIA 3K35A 4FDTA 3UK0A 4L5CA 4IV8A 4G5RA 2ZJAA 4AX4A 1F1JA 2W4MA 3AHDA 1Z4NA 3R1IA 3R3YA 3U3JA 4GW3A 2E55A 2CY0A 3PDIA 4K9RA 4CJXA 3JAMA 3KHUA 1WLSA 2ZB8A 1JLSA 4MDHA 4NBRA 1LNQA 3EDCA 4NPAA 1FFCA 2BFPA 3O8QA 4FDLA 4EJ0A 2FFBA 5DXJA 5DWVA 4ZCSA 4UM5A 3AR8A 3HVIA 3URKA 2BKXA 3VGJA 3QX8A 3ZXSA 4EMTA 4EW6A 5KOIA 1UJMA 2O2XA 1UBFA 1RXUA 3DLPX 3SC2B 5JTTA 1MB3A 4M9RA 5TQ2A 4IDFA 3WYFA 1M7GA 3PG5A 4YXFA 4NF2A 4PFQA 5JDCC 6GPBA 4XL9A 2GQ0A 3F9IA 4QOIA 5A03A 1AKRA 2MYNA 2N3ZA 3ZE0B 4UUMA 2ZYIA 4B9AA 3L4BA 2FLWA 1L3BA 3GRVA 2OFWA 1A7KA 2RGBA 2JAQA 3DKIA 4X20B 1YITB 5FUVA 1E98A 3QLJA 2HFJA 2P35A 3D3JA 5TEVA 4E31A 1V1MB 1XQXA 1N78A 1LI4A 3C3BA 4PGFA 3EAGA 2NUAB 1QRSA 3ZCTA 1H6DA 5AN9A 1II0A 1U3GA 3PKIA 4MWEA 3GBPA 4DNOA 2JHCA 4LDJA 3VR3A 5DXFA 3KOZA 1Q74A 4MGIR 1NBME 5C7OO 1FUIA 2JFWA 2QI9C 1QTQA 4GGOA 5B55A 2C2KA 1CHDA 5D00A 3A1EA 2DF8A 1Y9EA 2V7PA 3VXKA 2JKVA 1DKOA 2JHPA 2YMLA 4HP8A 4ND1A 3TBFA 3LVQE 3GPLA 2I7DA 3HB5X 4YRCA 5IDYA 5A9SB 2QT9A 1LK0A 3LWZA 4UZEA 1FS5A 1HDXA 4QUHA 3EY9A 2IGTA 4LRQA 3T3HA 3AONB 4XIYA 1BE6A 4RFSA 4YP7A 3R3ZA 1RJGA 4FOLA 5AHRA 1T36B 3SPXA 3FNFA 2F55A 4F6RA 2QN8A 3RYFA 1DPGA 2BF4A 5FT9A 4BDSA 1HT3A 1JTVA 2TECE 3ZPNA 2VRWA 3HB0A 3KALA 3KLNA 4NBWA 3TW8A 3VR4H 5FTJA 2FN4A 1BXRB 1R5BA 4RY2A 2VA9A 2WIFA 3J81k 1VG1A 3CX6A 3H3FA 3WK6A 1HC7A 4XQCA 1XFOA 3R77A 1L7BA 5J43A 2IU3A 2P2NA 1N3LA 3WQZA 2F1LA 3SR3A 3WGKA 3TAUA 2CJYA 4XFJA 4FR5A 1TLLA 1XXHA 4L8GA 3W4JA 1U4SA 2E0IA 4QBFA 4UMEA 4ZHQF 5JJCA 1XVTA 2ZYDA 3PXCX 3FPKA 5U1PA 2EDCA 1FQWA 2JBAA 3TW6A 2XWBF 2HPAA 1WNFA 3BRWD 3RF6A 3IDOA 2FW7A 3W2IA 3LFHA 2PT7A 3RS3A 3GMTA 2O8CA 3RRYA 2Q4RA 4RLFA 2BP7A 3L05A 2WUFA 2W4QA 4XVUA 4FB4A 4CQLB 3F8SA 2PGNA 4DDUA 1S8NA 3RUCA 3BGWA 1THGA 3CNQS 1HURA 5EEHA 3WTBA 1ZGAA 1DKNA 1Q7GA 3REOA 5TXGA 5BMOA 3EG9B 1J8QA 2EQ5A 4GI5A 3WY9A 3UB4A 4UTPA 1L7RA 2GA9A 1N6OA 5K3FA 3C1OA 3T41A 1HNWB 2XYVA 3ICCA 2C7QA 2CVZA 5A4DA 3MCUA 2VJPA 4R9RA 1J20A 4O1HA 4XIGS 4P1VA 4QBGB 4KSYA 3PU6A 1RTKA 4U02A 1N57A 3H99A 4E0BA 1ZK1A 1UDAA 2J5BA 3O2QB 1W5FA 1PJLA 2J4FA 3K9GA 1L5YA 3VZCA 4DTCA 1HX7A 4LXHA 1CUIA 2CL7X 1YX2A 3NHFA 1K0UA 3E5HA 5TB5A 5KVCA 2CVPA 1JP7A 5JSUA 2I8AA 2I22A 4DLUA 5C51B 3WRWA 4X64B 4AX8A 4N0PA 1EFKA 3DBOB 4NQZA 2QN6A 4FR0A 5KHOC 5I5GA 4WKBA 3OHSX 4GM0A 1MX1A 3DFIA 3RLFA 5AW2A 1NYRA 1R4MB 5CT8A 1KRHA 3A3PA 1JZSA 1BHQ1 2O3TA 4TS9A 3DXYA 2OILA 5ALWA 2TRSB 2FZGA 4AU1A 3F7TA 3Q87B 1FZQA 1QHGA 3PHIA 4S0ZA 5KQGA 3PRYA 3N0TA 3AY6A 3EIUA 4QBHA 1THZA 4ZVSA 4OHKA 1XJQA 4X0CA 3CRQA 3TW4A 2RHCA 3TLZA 3CVOA 1GEEA 2OZVA 3OOSA 3EXFA 4F91B 5JZBA 2Q0QA 1HDIA 2BGTA 2ZUUA 3UA3A 3ITNA 5EJ8A 5ALHA 2W2PA 3DEKA 4QTZA 3BAFA 4UVIA 3IDFA 4TSRA 2XD9A 1A8PA 1JHRA 3DFKA 5IYPA 2ZTHA 4F3NA 4UEKA 2ZVPX 1VYVA 4KNVA 3NVMB 1OYVA 2OLEA 2RI1A 1IBMB 3KZKA 2LE0A 1N07A 3N2KB 4WLFA 1EK0A 4KU4A 5KNBH 3IQXA 3GJ0A 3FSGD 5B58T 3T61A 3HN2A 5HQ3A 1LX7A 3GGGA 3ZNPA 4R5HA 4XIFA 1SY7A 4AB1A 3IEUA 4B7XA 2WAYA 1RYMA 3OFNA 1EXWA 2X58A 1K88A 3LQYA 1WRBA 2FPKA 4JCCA 4XOPA 1XU4A 3LIIA 2CHGA 4BC1A 3MBKA 4RF5A 2AOUA 5IMBA 5BW6B 2G71A 4GQNA 4XKVA 4EELA 3AM4A 3V4OA 1WU7A 3QVVA 5IKPA 1PGOA 3HKCA 4IRMA 4QL3A 2P6UA 1KOGA 1QFMA 3IPAA 1Y3AA 2F67A 2XDAA 4A0RA 4DEVA 3P32A 3VU8A 2XLBA 2XWJI 5IDVA 3HMQA 1Q77A 1QOZA 1MIOB 3WBJA 1YUBA 3TL2A 4YALA 5BT9A 4ZTZB 4H18A 3K05A 2ZTSA 2WWIA 4LZLA 5B3KA 4EHFA 3O8DA 2GZDA 1BOFA 1Y4ZA 5THKA 4DIOA 4ZYUA 3ZJUA 2I4RA 2OKCA 1TK9A 3UKJA 1GKKA 4M88A 1MNQA 1P2GA 3OZEA 2PFGA 1E1YA 1VPEA 2PV0A 2XNDD 4L85A 2V7TA 1H69A 3UATA 1V8PA 3DBIA 3WR5A 5BXYA 3SLNA 2G83A 3NWEA 1N2CB 5AHWA 5TF0A 4BB0A 4DT1A 2P3OA 3HL0A 3STYA 1K5PA 5ECGC 9ATCA 1CV2A 1SEVA 1L1EA 4Y6RA 1IY0A 4E1BA 1JEQA 3WISA 3MN1A 4GDFA 3IDSA 1CLEA 1RLMA 2IEIA 4IGFA 5KUTA 4LWQA 3K1AA 5ISMA 1S6YA 4C2AA 2F3PA 5JSQA 2Z9DA 2JARA 3NEAA 3V4RA 3D4IA 2XBMA 1QWSA 2OCKA 4UNNA 3MM4A 5F76A 3T1NA 2Y2UA 1BS9A 4U7GA 3GJYA 3IQDB 4YJDA 5ESRA 4MGKR 5HMLA 1QRRA 4HLDA 3RSFA 3KVOA 3DQPA 2ZXUA 2XTZA 3UF0A 3MWJA 2VP0A 1C41A 4GXTA 1V39A 3TIIA 2ZAGA 1VIAA 5EYPB 4FDAA 3BCRA 1ECCA 4KBGA 1K73D 2HWYA 4CLRA 2JLYA 1JKJB 4NMHA 1X9IA 1D04A 2OXTA 4EYEA 3T5GA 4D8WA 3A4TA 3CLVA 1CFZA 4N8SA 4UVDA 5AVUA 1RCUA 1FTNA 2N1BA 1YKGA 2XDQA 3K0EA 1NN0A 4JJIA 3ZDYB 1NBMD 5GM2A 3L02A 4F46A 3T6KA 2AOXA 4CHGA 4DCJA 1ZVVA 3ZI7A 1RPTA 2ARKA 1TD1A 3ZWDA 4WJLA 4R81A 4L07A 1MORA 4P4TA 1BGXT 3Q10A 3PFBA 1BXGA 1VLLA 5FR1A 5DHSA 5K99A 3ZQUA 3QKSA 5ETJA 1PCXA 4JSTA 4MKFA 4N5LA 5TMBA 3TQRA 1U99A 2VWPA 3KJFA 4MV7A 3IIJA 4IGIA 3BWYA 3IP5A<