1QFZA

Pea fnr y308s mutant in complex with nadph
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
308
structure length
308
Chain Sequence
QVTTEAPAKVVKHSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
publication title A productive NADP+ binding mode of ferredoxin-NADP+ reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
total genus 95
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qfzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qfzA02
3JQRA 4ZCMA 1N8RD 1TUIA 2BGIA 2QTZA 3W2IA 2BGJA 3AVXA 4YAOA 1VQ5B 1VQ8B 1GJRA 4F7DA 4ZGNB 3WBJA 4B4DA 2E1RA 3ZZUA 3CW2A 3CCRB 1FNMA 2PIAA 1D8TA 2BV3A 5GV8A 1XB2A 3FJOA 2OK8A 3JQQA 3P26A 1Q7YD 1D1NA 4YALA 3VO1A 1QGYA 1EXMA 5FA6A 3ZBUA 3WNDA 1B23P 3CXCB 4B44A 1W2BB 5H5JA 4LBYA 2QN6A 3B78A 1VQ4B 3OJWA 3J81k 4TMVA 1TVCA 4ZGQB 4N3GA 3CCJB 1KC8D 2EIXA 3WYAA 1OB2A 4RD6A 1IJFA 4FK8A 1BQEA 3U2QA 3G4SB 4LC0A 4RD1A 4G5GA 4TMWA 4EH1A 3I55B 1NDHA 1YJNB 2B7BA 3CMAB 1VQLB 1BJKA 1YI2B 4LBVA 5AN9A 2BF4A 4DQLA 4HE6A 3ZC3A 1FDRA 4G1BA 1QH0A 1BX0A 3ZZ0A 4PC7A 3WBKA 3QE2A 4U9UA 1TTTA 3VO2A 1JNYA 2GQFA 1R5OA 3AGQA 4PC1A 3G6EB 3OJXA 1QVFB 3W5UA 1KK0A 3MMPA 5JBQA 4M2LA 1VQOB 2DCUA 3WNBA 3QFTA 5TV2A 1OB5A 3LYUA 1QG0A 4PC3A 1SKQA 1KTVA 1E63A 2BM1A 3VNVA 1FNCA 5TY0A 3CPWB 4M0LA 4RCZA 3CCQB 1Q86D 1G7TA 3AGPA 3JQPA 1W34A 3CCSB 3WXMA 1YITB 4AF6A 2C77A 1DDGA 1G7CA 2CRVA 5HXBA 3LRXA 4Y9UA 2AHOA 3LO8A 4RD0A 4DQKA 2YWHA 2XEXA 2VNHA 2DERA 2DETA 1EP1B 1SM4A 2DY1A 1W35A 4C43A 1S72B 1W87A 1E62A 2CNDA 1YJWB 3PENA 4QHYA 2X3UA 4WQMA 3OZVA 4M1KA 1GVHA 3B8HA 1D2EA 1QUFA 2BVNA 1VQ7B 3AVVA 4AC9A 3VMFA 1HA3A 1WDTA 1ELOA 3A1FA 3OZUA 1Q81D 1BX1A 4RD4A 2XNJA 5THXA 1DARA 1JB9A 2ZITA 4MYTA 1QUEA 3V76A 4ZCLA 1N0VC 4UAJA 3CCLB 1ZM3A 2YWGA 1FNBA 1G7SA 2OTLB 1UMKA 2QTLA 3AVYA 1DG1G 4R71A 4TN1A 2VNKA 1GR1A 5H59A 2EFGA 2RC5A 1QVGB 3QFCA 1KK1A 3QFRA 3MHPA 4G1VA 1EP2B 1JA0A 1KQSB 4QFMA 1FRNA 2NPFA 2HDNB 3P27A 3CC7B 4TMTA 1K9MD 3AVTA 4P6VF 5TR9A 2XNCA 4YHBA 4TMZA 1ZM4A 4M4SA 3OW2B 4NBSA 1E64A 4RCYA 3CCEB 2BM0A 3LVBA 1YHQB 3CC4B 4BPRA 5GV7A 1KK2A 3G71B 1S0UA 1K8AD 5KSWB 1DDIA 1KJZA 3CC2B 4ZV4A 1YJ9B 1GO2A 3OZWA 3ZBTA 2QDXA 4RJLA 1I7PA 4IW3B 1VQMB 1EFTA 1EFCA 3B82A 3W2FA 2QA4B 1KK3A 1EP3B 1H42A 1CNEA 4PGOA 3W2GA 1JJ2B 2B7CA 3CCUB 2GPJA 4B43A 3CB4A 1Q82D 1VQ6B 4B3XA 1GAQA 1K73D 2FX3A 1H85A 2HCJB 4YAFA 1J9ZA 3ES9A 4H9GA 5EMNA 2BMWA 2HMAA 1ZM9A 2B5OA 4M53A 4RD2A 5DSZA 4B48A 2QEXB 1QFJA 3CD6B 1JA1A 1R5BA 4J0QA 3E1YE 3FPKA 4TMXA 4AF7A 3W5HA 2PMDA 2PLFA 4MYUA 4NCNA 2OK7A 1KRHA 3AVUA 4ACAA 2J7KA 1VQ9B 4C0SA 1F60A 3MCAA 1GAWA 3WNCA 3CMEB 1FRQA 4FWTA 1M90D 1CNFA 1QGZA 3WY9A 4Q7JB 2C78A 4RD3A 4HE5A 1YIJB 1OGIA 2D74A 4ZCIA 4LBZA 3I1FA 1R5NA 1FNDA 1KD1D 1EWYA 1QFYA 1VQPB 3W5VA 3CRZA 4Y9RA 4LBWA 3E20A 1AMOA 2YWEA 1QGAA 2RC6A 3VNUA 3ZZTA 4ACBA 4P3YA 2OTJB 1QFZA 2QMUA 3W2EA 1U2RA 3W2HA 4B47A 1VQNB 2BN4A 1NJID 2YWFA 1TLLA 1F20A 2VNJA 1EFUA 3U6KA 1QX4A 3QFSA 1CQXA 1B2RA 1AIPA 1N0UA 4PC6A 1XE1A 1VQKB 1IJEA 1ZM2A 3U6BA 2BSAA 2BPOA 2VZLA 1OGJA 2DEUA 2VNIA 3I56B 4N3NA 4K1XA 3CCMB 4YAUA 1G7RA 1M1KD 4PC2A 1ZUNB 2R6HA 3SJZA 4FN5A 3QSYA 4YAWA 3AVWA 4Y7CA 1A8PA 1IB0A 3CCVB 2VYQA
chains in the Genus database with same CATH superfamily
4D8UA 4RTQA 4EF4A 4M21A 5CFZA 3UMMA 4TWIA 1NF9A 4FDUA 5DTRA 2BDUA 1VI5A 1C7ZA 1YFKA 3LQQA 5AVZA 3E2MA 3JWHA 4NZZA 1A4RA 4PAGA 3RT1A 1NU6A 3P71T 3F7NA 1NXOA 4ZYUA 2ZSUA 3PD1A 4MUHA 4DJTA 1GJRA 4RANA 3GAAA 1EFAA 4RA9B 2IS2A 4JBNA 1MC4A 4Q01A 1I2ZA 1LSJA 1QXSA 3GCXA 1U7PA 2XXBA 1TYBE 3CLVA 4GOND 3TR0A 2P2LA 1E1CB 1PLLA 3M9WA 5GV8A 4FD2A 3T0IA 4B7ZA 3C4VA 1JEOA 3C7KA 3DMDA 2OK8A 1P2UA 2VRNA 1CZLA 1KI1A 3C6BA 3IDSA 4B3IA 2REQA 4ZHQB 4Z4CA 3HDQA 1Q6YA 1F3OA 2P8SA 3CONA 3NMUF 3AERB 1JJBA 3BXHA 1SRRA 4HVAA 3GV0A 2JLCA 3NNNA 2VK1A 3OFSA 1M0EA 4UCWA 4I4TA 4CI0B 1XMPA 1HSZA 3Q9SA 2IOQA 2QI9F 3SMVA 1DKLA 4B44A 4HB2A 2Q7XA 3O9VA 3S6JA 1IVSA 3Q85A 1XAHA 1NNUA 3QEKA 4WLOA 3ZLUA 5AHOA 3HP1A 5BT9A 3DE7X 1CVRA 1CS0A 2AEMA 2C9YA 4PG5A 2HV9A 1GSAA 1PEYA 1U5AA 2P4EA 4UEJA 2ZULA 1J2TA 4B45A 2NPOA 3ZN2A 1NUAA 3TOSA 3TSWA 1VBKA 4ARUA 1NA5A 3GO4A 2W48A 2ZSJA 3DE6X 3DDYA 2AN1A 2IYSA 3TX2A 5KNBA 2EX4A 4RD6A 2GF0A 1TMYA 5H9VA 2R8ZA 3E22B 1M5TA 3I58A 5CGZA 1QP7A 3LJKA 2YMQA 5KNDH 5JSZA 4YV0A 5T64A 3LY8A 2O4UX 1ATIA 2IPXA 2GN4A 3NHPA 3BXOA 2XUKA 2Q3EA 3GOHA 4QGHA 2B5VA 1XCGB 4TRRA 2WWRA 3B36A 1IBCA 2ZBRA 2F9MA 4L75A 1RU3A 1VG9B 3NUGA 4NBTA 5EL0A 3I55B 5K2MA 3ZNPA 4C0LA 4RQAA 3MPUA 1A69A 4BTEA 4D80A 4IQGA 4H18A 2YWBA 1X77A 3FPBA 3I2IA 2X7HA 4A8JA 4X45A 3B9BA 1M34E 5CFQA 2O2CA 5LM3A 2Q2QA 5E4FA 1YTUA 2O8FA 3SR3A 3M6XA 4L8WB 4M0EA 2VYVD 1SG9A 1TFUA 4C04A 2REQB 3CINA 2QSUA 2VCEA 3OD1A 4I3FA 1QH0A 3QJGA 3GUCA 3IPRA 3KOUA 5CTAA 5TMPA 1NC3A 3KQTA 3EQ7A 2FZVA 3FNRA 2R2GA 5JCJD 2AQ8A 4I4TB 4U9UA 3UWDA 1JA9A 4MI6A 4W6ZA 3WJAA 3DE0X 3EVAA 4GF5A 3D6HA 1M6EX 4F11A 5IYZA 1I2BA 2D7CA 2H52A 3DW1X 4OM8A 4EMTA 1D0SA 3GHHA 4O5OA 3G79A 2WYRA 4X61A 4D1YA 1CS0B 2EFCB 5BSUA 2R60A 4M37A 4X3PA 4EIWA 3W79A 1M67A 4PU0A 1SKYB 1KK0A 5FL7A 5INTA 2H31A 5J40A 3IEVA 4RO0A 4TSRA 3SJ7A 3MEQA 7MDHA 5CVVA 5BNFA 3UMYA 2XKAA 4G4IA 1ZCAA 1DC8A 4E0BA 2XXJA 3QQPA 2BR3A 5MN5A 2V7EA 1DEAA 2ZS8A 1PF7E 1RBZA 2R79A 4RIIA 2IH2A 4HDOB 1DJNA 4MW9A 4EEXA 3IBGA 3LVFO 5LD2B 1HDEA 1EWTA 4YB8A 1XTRA 4QZVA 2WG1A 1WW2A 2PZKA 4AG3A 4CLXA 1C41A 1XZQA 2GEUA 3ROGA 1SZDA 2J5QA 1N1GA 4ZOBA 3CPWB 1DAGA 1C7QA 2FZGA 2XVMA 2BMEA 2OENG 2E0IA 3K09A 4FP9A 2XT9A 3KB1A 1FFAA 4EPXA 2ZL7A 5I7RA 5LMUB 2PUBA 4MQUA 2P1DA 5BQOA 1ORIA 4A8JB 2KLHA 1BOFA 1GT91 3TKAA 5M04A 4LOKA 1V4BA 3H0KA 4KQMA 4H7EA 4XLTA 3K0SA 2O8FB 3T56B 3SM9A 4RNCA 2BLNA 1JHYA 3ETCA 5AKZA 2C77A 2O06A 5LB4A 3L0ZA 5D5QA 1H8ED 1CEEA 2ONCA 2XPCA 3NORA 1AUXA 3VJLA 1GU0A 2IIPA 1RZ3A 2H63A 3GFTA 5U4QA 4CV3A 3T7TA 3VR3A 2BKVA 5JYBA 1RWBA 1ZOPA 2RGXA 3NJ4A 4WVLA 4KPEC 4O4IA 2YWHA 5IYZB 5H68A 3VNAA 1JFTA 2XCIA 3H86A 2GCNA 1WY7A 4R98A 1L4LA 4DIUA 5AVWA 4JUCA 3RK0A 1R50A 3GL9A 5SICE 4XSGA 3SVTA 1E43A 1DU4A 1SM4A 3F4LA 3OZSA 4BX3A 1CUEA 4JLAA 2MSKA 3G6KA 2WY2D 5T4BA 4JZKA 1W4ZA 2VPQA 3U3KA 4BNMA 4EJSB 5JRZA 2HYIC 4UBLA 4J0DA 2UXCB 4YR7A 2R7MA 3CVVA 2ZBDA 4MQ4A 5KSZA 1KGSA 2AVDA 2OBMA 3W1EA 3QXXA 3KG2A 3I53A 2AEFA 3L1VA 2ZWOA 1VP3A 3F98A 1Y98A 2RARA 3O92A 3QU9A 1VPWA 3A6PC 4DCVA 3R40A 1T3GA 4FBGA 4OAOA 5DYWA 2IXBA 2EF1A 5H1YA 4TWRA 1Q1EA 4FR2A 4BNLA 1NTOA 2OB1A 5AKJA 1OUMA 4G0VA 1ULUA 3H9QA 4GQBA 4ID3A 1KWGA 5A62A 1ELOA 1YTLA 5BSYA 1RWNA 3ZX5A 2PWAA 3E58A 1PN3A 4ROXA 3W6OA 4PX2A 4AAYA 2CCJA 1P7WA 1YC2A 1MO4A 3LUAA 4D3DA 1BX1A 3OFND 4UBMA 3KB2A 3IESA 3UGJA 1QR6A 2P7HA 1BA3A 4BFTA 3G1TA 3RRXA 2R6DA 1EUDA 5KSPA 4MUYA 3RRMA 2O6HA 3IP8A 3KQYA 4EAAA 4WD3A 1A76A 4NZMA 1GYPA 2XJ9A 1Z8NA 3JWIA 1E98A 4CFSA 2WQ6A 3DCYA 3K0AA 4NFSA 3F49S 4EHFA 4EG6A 3FHLA 2FW8A 1OXKB 3V4OA 4BV2A 1ACMA 3PNYA 4F97A 4UAJA 2XNKA 4YEJA 3E7DA 4DYVA 4BEWA 1OCEA 1WUKS 4O4IB 3UXEA 1EVYA 2FUG1 4HYYA 5L6MB 3IBCA 1IRIA 4KDCA 1W9MA 4LE1A 2GT1A 1S9DA 1YBVA 2FB9A 1SU6A 2G1KA 3P96A 2BFWA 1LPMA 2B8JA 4YRFA 2YJZA 4OOEA 4BU0A 2G17A 2JGJA 1XVLA 4P5PA 4UZEA 3FPLA 4PQFA 2XTZA 5D87A 3N2GA 4F6LA 4R2XA 2QQ0A 2HUNA 3CG0A 1RPZA 3PSHA 4S04A 3CZCA 3OCXA 2PUGA 1N4DA 4BLPA 1F2VA 1CRQA 3OWOA 1R4ZA 3CE9A 4AZ0A 1ZCJA 2FSIA 5CB0A 4KW7A 1QVGB 1SKMA 3WHLA 2IW1A 3FWZA 3H99A 1FMTA 4EEZA 4IH4A 4RVDA 2R25B 3ZHUA 3CEPB 2IKQA 2HWXA 3V1UA 4QYXA 3M2TA 2OAP1 2Z8YA 4LNUA 2AL7A 2VWGA 3DZFA 1OD6A 3G5LA 3I1YA 3Q7QA 4MW6A 1E5TA 2Z5LA 4WIAA 1BLIA 5AI6A 2JIRA 1WUHS 1VLVA 3FMFA 4M3NA 4FN4A 3BA6A 4QX6A 5CLGA 2P79A 1YBHA 5LBTA 4YRBA 4PYLA 4Z4GA 3VMMA 2EDCA 3NTXA 2VQEB 4TROA 3SBDA 4EY8A 1Z16A 1ZOOA 1HRDA 4G4GA 3HWSA 2FMFA 5KKAA 3M2PA 3L7OA 3FSGA 5FKJA 3EAFA 4DG9A 2PRKA 4ZD6A 3RSQA 3GVHA 1Y9ZA 1JQBA 2DLNA 2I6SA 1DCMA 3K0AB 4J0IA 4MCIA 3G2LA 3IQEA 4RPJA 2C2HA 4E5SA 4FS3A 3ZE8A 3KPJA 4Q9LA 5CCEA 1DAOA 5L4SA 2MSWA 4Z0NA 3VR2D 3MFQA 2ZJ8A 5CR9A 3UUWA 2WHEA 3R41A 2OBTA 1EFDN 2V7VA 4NK4A 3RB8A 3U81A 4DSAA 2VIIA 2OLKA 4Q6WA 3TI9A 3IQDB 3QUQA 1L4BA 4IDHA 4DTIA 4CKZA 4Z4EA 3QGMA 1M73E 2IU0A 1LBSA 3C3WA 2QPLA 3RYIA 4WGGA 4EG5A 4AD8A 2VT3A 3EEYA 3EVNA 1PJBA 3F71A 3HCOA 1CV2A 2FZCA 3PR1A 2JI4A 4KVZA 2XVAA 2YQ5A 3N2GB 3STXA 4CL0A 2YY7A 3L7NA 4IKOA 4LMRA 4YJ3A 3H17A 5I7HA 5IKPA 4JI5B 1TQHA 4B5LA 1HFWA 3QLJA 2ZCUA 4ZXPA 4YUAA 1ZBQA 1AKVA 1ZH8A 2HDWA 2UVPA 3ITKA 5ALUA 4AZ0B 3USZA 4JI8B 1PDWA 1DINA 3Q98A 1V9CA 3QLTA 3T1YB 1A97A 4FI3C 2YZMA 2MSNA 4YLYA 3AESA 2PLNA 4BEVA 4LNUB 4D2IA 5KQSA 1Q7TA 3UMCA 1U04A 3F6BX 2NO6A 4QBFA 4W63A 1GPUA 2ZE6A 2HNBA 3IPLA 4E4YA 1YR1A 1SPBS 1TPYA 3I9JA 3FLMA 2B4RO 4HXFB 4LJKA 4OGKA 1CJTC 3RR2A 3E1GA 1BIFA 4E1AA 2XBLA 2GYUA 4B3XA 5IP5A 3R0IA 2DR0A 3WTBA 2IYFA 5FQOA 4ECEA 1ZD8A 3EVBA 3L0DA 1JSLA 2GVDC 5FULA 2RMKA 1XZEA 2GRAA 1F17A 3TPCA 1MH9A 4WDRA 3SNHA 4AJPA 5EINA 2Z2IA 3DSRA 4LCJA 3TOZA 4IH1A 1JXQA 5EJ9A 4D45A 1UPAA 4Q0MA 5T4EA 2VT2A 5FCDA 5LSAA 1NN1A 1DBPA 2W9XA 2IUUA 1V41E 4DA8A 5KOJB 3A2NA 1Q1AA 4BMOB 3OUUA 4J3FA 1Z6GA 1N3IA 1S96A 3GB9A 4FEEA 4DA4A 3W5HA 1EWVA 3IQXA 4KFTA 1A9ZA 1G60A 1R8YA 2JRLA 3RTDA 3DDSA 2YWDA 2ZIVB 5BO5A 4WHMA 3VPCA 3T3PB 4M60A 1IWBB 1KI9A 2JIBA 4NCNA 2JH9A 3F78A 1IUNA 4ZC1A 2ZYWX 1KRHA 5FPHA 1EK6A 4OA8A 3RYIB 1HH4A 1Y1SA 2EX0A 2JHCA 3BGSA 3MWDA 3ZWBA 2HTFA 2OV6A 2IA5A 1ENZA 2OXRA 3IHKA 2DUWA 4J49A 4BEJA 5ABPA 5JATA 2A9FA 1K7CA 1I10A 4YJ3B 3OCWA 3KQVA 2G77B 2IPOA 2Z5VA 3HZHA 3JQCA 4I66A 4Q3NA 4LTNA 2DFTA 4KXVA 1P44A 4RV4A 3PNSA 3VRHA 1EINA 3GU3A 5DYYA 4ZC8A 1SURA 2P5SA 3I2KA 2ZB2A 3IPCA 3PIIA 4MNTA 1XMQB 1PBTA 4MR9A 2Z6UA 4MWBA 3TLXA 3L7KA 3WLSA 2GAJA 4B9AA 1NQ5A 1XU4A 3IIEA 2RHLA 3PQDA 1Y42X 2EP7A 2P9CA 2ZSEA 4PNZA 4B87A 2IGTA 1PZFA 1I1NA 3QUAA 4WNYA 3QVSA 3WMWA 2VSFA 2ZB8A 2OZKA 3C3AA 1J39A 1IY0A 2ZJZA 3NBYC 5B1EA 1VLZA 4O63O 2XKBA 1PR3A 2VF2A 1JEAA 1T4BA 1ZS9A 2J9GA 1YUMA 3IV9A 1CERA 4J2OA 4ARVA 2Y05A 4QVGA 1IU9A 4LF4B 3W5VA 1Q0LA 1UJCA 5ALJA 2Q1SA 4O2AB 3I01M 2KI5A 2I9KA 2WU0A 1TF2A 5F2OA 3L4BC 2HBZA 2GJ9A 1GHTA 2HKIA 5JPIA 1Y9JA 3W04A 4M87A 4P22A 4CQNA 5L46A 2MDTA 2ZBVA 4D57A 4B47A 1QF7A 2JA2A 2WTNA 4MLDA 4Q66C 4XWWA 3AILA 4ZK2A 4X5OA 4ZYLA 2OYNA 5JYCA 1NR5A 1F06A 1O03A 1TLLA 2CHQA 2NV6A 5DV9A 4AYXA 1BXZA 2R47A 1S2LA 4U7DA 1P0QA 3R3ZA 1EDOA 3LK7A 4C2TA 4EHIA 2JI8A 3MWDB 5B1YA 4WESA 2J4DA 4AN1A 3TW0A 1DMSA 2FW9A 4GEGA 5CNJA 3TLGA 4PFSA 1GPBA 2ZSDA 2X14A 1MJNA 3KOZA 3S8EA 3KP1A 2ZB7A 4YJGA 1WF3A 2XLCA 1G8AA 5LZ9A 3TLJA 1U9CA 3WNVA 1BXRA 5B2FA 3VU3A 3A4VA 3ISVA 2AFHA 4GBED 1D2CA 5IYWA 4MIYA 3FCCA 4MR9B 4IDBA 3I32A 4BLOA 5IXYA 4RTSA 3ZHSA 5ERXA 2RHCA 5EVCA 1S8FA 4XIYA 5NULA 1EJ6A 4ZV9A 2H2AA 3UC9A 5I5GA 1OR8A 2YWXA 1E6CA 2M98A 3G17A 4RZXA 4ZQIA 3CE6A 4JR2A 3CCMB 3HLTA 2B6NA 4AMUA 2JG3A 4MWTA 2B9EA 2NNLD 3T4UA 2HSEA 3T53B 1T15A 4E31A 5KWIA 2ROQA 2YR0A 1S02A 2IBTA 5BYAA 2V9PA 3Q8MA 3PUZA 1RWMA 2V6JA 3LWBA 4PVCA 1F8UA 3ZWNA 4UREA 1JDSA 3ENVA 2YOGA 3JALB 3QWBA 1AG9A 1IB0A 1BE8A 1QIIA 1UAYA 1AXRA 2QYOA 4KRGA 3SK0A 1ISJA 3DEFA 3F67A 3B3AA 3H2HA 3R7BA 4HNHA 2GK6A 2QJWA 6REQA 2QVXX 3A6EA 3WLRA 2P3QA 3ZY3A 4R8VA 3KZ1E 1TM3E 2FA9A 4Q1FA 3O94A 2P5UA 1N3YA 1SCDA 3LY5A 3Q88A 3TKYA 3RSLA 1FPMA 4JWTA 3NEPX 3KVNA 1N77A 4B9EA 3G59A 3WBJA 4EO4A 5CBKA 3SF0A 5AI8A 3FWYA 3LHFA 1ZEJA 2V59A 3RS0A 3H65A 4XFDA 3WKBA 4BO8A 1DRKA 1T9HA 4BVKA 2IHNA 1M6WA 1YL5A 1UD6A 5REQA 4WK6A 4WESB 5ILOA 2VBFA 3OE7A 1DZ3A 1LQUA 1U3CA 2VN8A 2Z0MA 5T5QA 2J3QA 1J25A 1BDHA 3ETNA 1R74A 4MUAA 5GINE 1AY0A 1NRKA 1UKZA 1ZM7A 1ISMA 4YJGB 2ET6A 4ATNA 5DTMA 1PJZA 2OBSA 1BXRB 1FP1D 2VHUA 3A6DA 1RKQA 1MMFB 4Z4SA 1BEUB 2AFHB 2Q9BA 1XKLA 2YTZA 3EZNA 221PA 4JEIA 3C41J 4ZQHA 2C29D 4ZMRA 2GBLA 1NT2A 3QHPA 1USWA 2P4SA 2W8ZA 3UAZA 2V6IA 3JVVA 2QN6A 4TOIA 3FUXA 3O6VA 4EA9A 5FO1A 1M2VB 1CB7A 3OJWA 4TYNA 4ZVLA 5CJJA 1SC4A 2PUHA 4PZEA 4NBVA 1KRXA 2ZE8A 2F3TA 3AFGA 4PYQA 4HGYA 4CCYA 5CXQA 4F7WA 2JS7A 4BRZA 4EPVA 2R1ZA 1OAAA 4FBMA 4HNAB 4WLFA 2A67A 3GZ4A 3EPKA 3UCEA 1S9HA 1IJFA 1R6AA 2A78A 2PJDA 2XRYA 3N1UA 4OMDA 1G9XA 4RENA 1IYZA 1M0TA 4KO4S 1BQEA 1RFGE 3QJYA 2IOFK 3QWHA 6REQB 5IBCA 1CQJB 3FWNA 2O8CB 2C1EA 1P6XA 2OXEA 4M7WA 1IAVA 3EIEA 1CIJA 4TKVA 4X66B 1IQPA 4RD1A 4MA4A 4G5GA 4WLVA 1E9CA 4YMHA 4EH1A 5JSFA 2OILA 3LQ4A 1JDBB 2JGKA 2Z1DA 3M8KA 4HVTA 4YRLA 4XX0A 4FJ2A 3N39C 1LVGA 1J9EA 3N0VA 2WJGA 2IZ5A 3LRTA 4KQ6A 5REQB 1RBMA 2C9CA 1I6KA 1W75A 3E9EA 4OLFA 1YB2A 3ILYA 3HUFA 5FFFA 2OAQ1 4M1TA 2NSHA 3V1KA 4CN9A 1VRWA 2Q6LA 1ZNYA 2Q5LA 5FYQA 3P2YA 5LQUA 5FNVF 5IT4A 4B4UA 1YB6A 3GEEA 1V9SA 3WE7A 1OZFA 2F8TA 3AP2A 3OURA 3CSUA 5EZYF 5E6TA 1JLKA 4Q3BA 1HNZB 2BBOA 2ZOSA 3CKMA 2ATXA 4QYIA 1IATA 3QNWA 5D3QA 5D85A 4K28A 4BFLA 3M1LA 4AZ3A 2WJIA 3U4QB 1D2RA 3FXAA 4QU5A 5K3OA 1N5RA 3FIUA 3MT0A 1OWOA 4B6EA 4H1HA 1TTTA 2OL4A 2HWWA 2GQFA 1W59A 1J2RA 1LD3A 1TKAA 3HB5X 3U13A 1RAHA 2C9MA 3GJRA 3BGDA 3IAHA 4D99A 4NYJQ 4P4NA 4B3FX 3PYLA 2JCGA 3HR7A 2DE0X 5CT8A 2GXQA 3THXB 1PS8A 1LI5A 1N6RA 4TTVA 1BDMA 5KQPA 1E3ZA 3B7WA 3L8GA 2EGGA 1AB5A 4CCYB 4YPVA 4LRUA 3FSRA 3EZXA 3H2YA 1F4LA 2O1EA 2O5RA 5G1PA 1SN7A 2DIEA 1X74A 1WOSA 1I2CA 4XQGA 5KTRA 4RJKA 5A3VA 5LWQA 4BX2A 4RY0A 4DLAA 1KVQA 1CJUC 1FDSA 4MWCA 1Z83A 4YP0A 5BV2P 3LIPA 2QBYA 2PSHA 4C78A 5DMHA 2AN5A 4B0PA 5IC5A 1I30A 3FI9A 2RDMA 4JL8A 4TKVB 5EMHA 1P17A 2XCOA 4JP8A 4MVJM 4I4LA 3OJLA 5F2KA 4EQZA 4MMXB 2PXAA 1WPRA 5E95A 4N8EA 1OOEA 3GUYA 4XX0B 2YYYA 3L0SA 1MAUA 1TPZA 3F3YA 2PUCA 2QEQA 1RT9A 1UBTS 1R9GA 1Y8CA 2P6NA 2H4YA 4H6VA 5DEIA 3EOAI 3QEAZ 3ZD7A 3JZIA 5LKRA 3GEPA 3I3OA 4ZVPA 5BSEA 4U9IS 1EHYA 4X00A 3AZOA 1Z08A 3CCFA 4Z0PA 4D74A 4ZYVA 1IL0A 1HFJA 2C8KA 1EVZA 2ECPA 3DHVA 2CXQA 3P4YA 2C9OA 3RW9A 1AV6A 3I0ZA 2G4LA 1GQSA 4GE0A 2GRUA 1Z82A 4ES6A 4QYIB 4Z7JA 2C7OA 4ZOCA 2GEDA 1JBEA 2QJRA 3D54D 4ND8A 5TT0A 4XRRA 3ABSB 3AI7A 3C8DA 3NWPA 3WL7A 2AI2A 1RZRD 3WLLA 3MWYW 3VR5A 2H8KA 2GCPA 5FQNA 1SOMA 3W5AA 2N9UA 1V2HE 2EZUA 5KIAA 1EP1B 4MW7A 2R87A 2QM8A 4D6XA 3L4JA 4TKLA 2GLXA 2PR7A 5JI3E 5M29A 2NSJA 3BB4A 1PZHA 1IXSB 1DIGA 3SVLA 3KSBC 1TKBA 1YHNA 3DYBA 3IAXA 4YRDA 2IYYA 3ESRA 2E4YA 3VX3A 3ID6C 3BAFA 3GLHA 3MMSA 1E2JA 3NAZA 3RBVA 3C3BA 3OZVA 5CNKA 3PL1A 4JI2B 3Q7PA 1D2EA 2GBFA 3BBLA 4ETNA 1CDEA 4L7VA 1O7JA 5DNAA 3KEFA 1AKRA 2BVNA 1MV8A 5JXJA 1MV5A 1NVVR 5JY6A 3OQ6A 2QBYB 1BXKA 1C14A 1U0NA 1XDZA 4C6RA 5BWMA 3AEQA 3DHEA 1EDBA 1TJ3A 4MPJA 4EATA 1OTHA 1XQ6A 2O5EA 1KA9H 1C7FA 4Y18A 1OTXA 4PYKA 2CL5A 3CY6A 3L8MA 5GONA 3EH2A 5JE8A 1L8LA 4KQKA 4JA2A 3WGNA 4WCFC 3BIOA 2OUIA 3FWKA 2XDQA 1CLEA 1KBOA 1KZGB 3PGKA 4DXAA 1U2TA 5KYYB 2VHJA 2JFWA 3JPWA 3KFLA 3DO6A 4RW0A 3LHDA 2B20A 5C1DA 3IBTA 3OTGA 1DKUA 4U5QA 1CUDA 5ER9A 1V4VA 3LW8A 5FD8A 3ORYA 5JZVA 2HJHA 4AJLA 3VV2A 4EJ0A 2XAAA 3BIFA 4OXXA 4PFJA 1FQWA 4ND8B 1SQSA 1GNVA 2JFXA 4XDGA 3O03A 4X85A 3JXEA 3KJZA 5IDVA 3PNVA 4E15A 2NZWA 4U00A 1XAGA 4QGGA 1T2AA 1A2BA 5CXXA 1PR2A 3MS4A 1E6EA 1Y9EA 1OXUA 3HJBA 2H57A 3ABIA 4HN9A 1WETA 2PZJA 2G5TA 5I7FA 1K6XA 3AR6A 4P3XA 1U0HC 2XGOA 4PPFA 4XEHA 3JQGA 3E9YA 4IEFB 3DFZA 4FXUA 4D3ZA 1UPXA 1Q5PA 3AVPA 3GLHB 1BW9B 1FNNA 2VSYA 1TO6A 3ICCA 4IVNA 4RL6A 3WWZA 3I1JA 4AQDA 1X1AA 5KNBD 4W9RA 4RU1A 2RK4A 5DTQA 5BV8A 5KBYA 4CIXA 3B3QA 3A27A 2F2TA 4X1KA 3S1AA 3U26A 2Q5OA 3NG1A 1Z0KA 1EYZA 4BQRA 4X91A 2OBLA 2WSIA 3FBWA 4GOLD 2X8JA 4A1FA 4OTZA 1QRDA 4HUJA 4XZ3A 1DCFA 4WCVA 5F98A 2FH5B 3RRFA 2GBPA 5HUHA 4HYEA 1Z5VA 3A6ZA 3GA0A 4G9GA 4S12A 4P3PA 1PFUA 1T9GR 2NPFA 3N86A 1ZDMA 2D6FA 3BJMA 4V3BA 5GONB 3ZE2B 2O7NA 5DGHA 1WCYA 2DQKA 3QKRA 3BWEA 2RBEA 2XDQB 3GPDG 4AT1A 2HSDA 1W8IA 2O1WA 4Y2VA 3OFKA 1KC3A 5LQSA 4HGOA 3ZYZA 1HVXA 4LKRA 2W37A 3QBVA 5E3HA 1URPA 4B33A 1EHIA 4IV0A 2ZXFA 3UWKA 3KZCA 5C7OO 2EKLA 1LI4A 3O21A 2NZUG 3V4SA 5IX8A 1HFEL 1UMDA 2OA0A 3DKIA 3EUFA 4KQEA 4NH0A 4NRDA 4RHCA 1FEZA 3N53A 4GGMX 4V24A 3HRKA 3TINA 4BX0A 4WPGA 4GYYA 1L7PA 4EB8A 1ULTA 1U9ZA 2XMRA 1E0JA 4XPIA 1E59A 3W1VA 5JTTA 4P38A 3MT8A 1NHGA 2R62A 2Q0SA 4NLLA 4OP7A 1GPLA 1Y9AA 1JS1X 4C05A 1DHTA 1SVSA 1AT1A 3EMDA 1BN6A 5AJXA 5HIIA 3JQGB 3CLKA 1ODSA 1UANA 3EQ2A 4RKWA 2HU2A 1FTYA 4YJKA 5FL7D 4QATA 1YJ9B 5CT9A 4YDHB 3HSKA 3WIBA 4HXEB 3G7UA 4F2HA 1XJQA 2H92A 3OZWA 2E48A 1F6BA 4KIGA 3RIYA 1YIDA 1WBJB 2HYDA 1VHEA 1Z6AA 2BMDA 2II6A 1HMYA 2WKRA 2WWTA 1EXNA 3OE1A 3WAJA 2DPYA 1EVIA 4JSYA 5AW1A 3B82A 2VDMB 1NP6A 3BIWA 2D1RA 1JV2B 2ZUSA 4NXMB 4DSZA 3TQOA 1HTBA 3X2FA 2JPDA 1UWVA 4HFJA 4OQNA 1COWA 2FSSA 4PN7A 1JVBA 3UPUA 3D2BA 3KRTA 1P0CA 2WZDA 1NJ8A 1SVLA 5I3CA 1SHUX 4DHEA 5HMMA 2FGKA 3EZ7A 4AJNA 3LLSA 3CA8A 1L4FA 3QKRB 1WB5A 2CL0X 4RTJA 3T1HB 2OFXA 3HXPA 3E35A 3OKPA 5KVVA 2O0JA 2A58A 2HMWA 2VLIA 4U5XA 3ENQA 4DQLA 2P9JA 2V5AA 4D9MA 4B6JA 1ZM9A 3L1IA 3NTOA 2P2YA 2WJ4A 1JYFA 1A7KA 1CCWA 1WVMA 3C16C 3HJNA 4QFCA 5TVKA 2EJBA 1V7ZA 1UMDB 1MJGA 3H5WA 5D01A 5J4VA 4QBHA 1QWOA 4I4CA 2BCGY 4KO1S 3WX0A 4R4JA 4NJMB 4QELA 1KIFA 1PG5A 5KCMA 3E23A 1CQWA 3VR3D 3ONWA 3E3NA 3GXOA 4I55F 4L5BA 4XPIB 3U4MA 3LLVA 2VJYA 1U9YA 2WYIA 1Q1GA 3LT2A 2JGNA 3W1WA 2IBMA 1LBIA 3LBAA 3VZQA 1CFJA 2HX1A 1OVGA 4QBTA 4M1SA 1Q21A 4IMJB 3N3AC 2EZ8A 4WXRA 5FX2A 5KMGA 2W6ZA 3CN7A 3ZIDA 3FTPA 3WYDA 4EGJA 2VCHA 4R9RA 3H8JA 4DIFA 3OY2A 1IHDA 1EM8A 1T8RA 2IXEA 1PR4A 3ONFA 2D62A 5TRTA 3RVNA 1N05A 1M90D 3DBOB 4OLHA 2IV3A 1MA3A 1Z2CA 3M5WA 4R1QA 2O8VA 3HWWA 1CF2O 4FX2A 2LRHA 4RJJA 3DE3X 5JASA 4L0QA 1WHSB 4EWLA 2B36A 2PWYA 4GI7A 4P4SA 1PNVA 1B3RA 1T10A 2P68A 1XF1A 2GNAA 3DMFA 1FP2A 2D1YA 2CVZA 5F76A 3ZZNA 1QDEA 3KZNA 3GJ3A 1A9OA 1CY6A 3UJ7A 5ALTA 1TJ5A 3ILSA 2H85A 3TFWA 4W5QA 4K0RA 2RE8A 2JEOA 3ONUA 1VA5A 3O9ZA 3PGLA 5EI5A 4DCPA 5CD9A 1KOGA 1X8XA 1CNMA 2ZIEA 3AJ9A 4KEAA 5FWXA 3VR1A 4B75A 4WJLA 1E92A 2RC6A 4UUAA 2NQTA 1X1RA 4BLUA 4KMMA 1VCMA 2C2BA 1DP4A 1F1JA 4BU1A 3B38A 4JJ7A 2CXHA 4YS6A 1EAMA 2QVLA 4AWXA 1QVAA 2RONA 4DAEA 2P3OA 4ZN6A 4RH1A 1BJTA 4PICA 2VPTA 3WMEA 1UT6A 1DO2A 4RABA 5BW5A 2YWFA 1IZYA 4BVLA 1U4NA 4BUCA 2C96A 1E8DA 4E1VA 4YP5A 4QTUB 4WZEA 2WM9B 1OAOA 1QH1A 3RVMA 2BE9A 2OORA 2HW8A 1CULC 3MJ4A 1E7MA 2OTCA 3GYGA 4QXQA 4YGYA 1DBQA 2FEPA 2O4CA 2R1VA 3A4LA 3DT8A 3H19A 1T6XA 2GM5A 3LGAA 2ATIA 1MB9A 2ZR8A 3AR7A 4ZU6X 2ONKA 2OSBA 4MAAA 3UFXB 4DXHA 5KMGB 2WP0A 5BWLA 1UPTA 2H1VA 4Z4WA 1GTG1 4G0NA 3I9KA 2AUTA 4HTFA 4JP1A 1B8PA 1EM8B 1H2AS 2E4AA 2ORVA 4FONA 5D8DA 2FQXA 3DVAA 4J0JA 1O87A 2SCUB 3HC7A 4IOLA 2OWEA 4BECA 4LVOA 3DTVA 3BFJA 1BZYA 3LCUA 5EYPA 2YRWA 3I56B 1CLUA 1N2BA 3CW8X 2XB6A 3PI6A 4RVHA 4K7JA 5EKXA 4K1XA 4ER5A 4P4SB 3K1TA 5GZ3A 5JJIA 3H16A 2C97A 1TCAA 2BKEA 1QBGA 4LY3A 5ENZA 4LYYA 2Q0XA 1FZQA 4C29A 2ZSHA 4DVJA 2BRUC 1KE1A 2A33A 2Y4NA 4NE2A 1HORA 4NPCA 4AM8A 3VPXA 1V8ZA 3SJZA 1BROA 1Z7YA 3EDMA 3D1VA 3KPVA 2XYGA 2ZIUB 2NVOA 2A9VA 4P31A 4QVIA 3IVAA 4KLRA 4MROA 2DKFA 5EIBC 5FWXB 1FTGA 2DH5A 4U2KA 3HBJA 2G04A 4L8YA 2K4MA 3FSGD 4WZZA 3U60B 4ZCMA 1RYNA 2GNOA 2BGIA 2OFPA 1RQPA 1PG0A 2QTZA 3K5IA 3M6MD 3ZQKA 1BCRA 1E4EA 3R7NA 4QODA 2YXPX 5MGNA 4JI6B 4XIIA 3OLXA 2GWRA 3LF1A 1P5JA 2AG6A 5IAGA 3IV6A 5JYDA 3K0HA 5B1DA 4MLPA 3F4BA 4MEBA 4KPYA 2FWJA 2D59A 1B6TA 4D4GA 5CFNA 1QH1B 1D8TA 1ZMXA 3LLCA 3K7EA 4X24A 4NAUA 3ZK7A 4ABTA 2HJWA 4LZJA 2E87A 3ASZA 4A6XA 2YHBA 5KDDA 2ZE5A 4NMWA 4RESA 2UV8A 4OGWA 2R1VB 1VHLA 5KC8A 2VBSA 3I5AA 3RFXA 1M5RA 4KBYA 4MV8A 1QBKC 4RPGA 1PJ4A 2R8YA 1EXWA 2W98A 2NLOA 4IDDA 4TRMA 5DISB 2Q7OE 5E0OA 2Q8NA 2H7YA 1JWLA 3ZBUA 1TCCA 2HK7A 1ZW1A 3FYUC 3KSUA 4HTFB 1L2TA 1PD1A 2A0UA 2GD6A 3ZQ6A 4DQVA 3DVAB 4Y2UA 3KM0A 1W30A 3AR5A 3QVUA 4NCKA 4S1PA 3DTVB 5EYPB 3W9SA 5KJ1A 5DBHX 3HB9A 4L85A 1VQ4B 1ZH2A 4KQWA 1TCUA 2C7RA 1WMBA 1EU1A 3RRBA 4ZGQB 2DBRA 4FZ3A 4EJSC 1LV7A 1KEEA 4HFMA 1YB1A 3ZDZB 1LDYA 1IUOA 1ML3A 2FPLA 3H1GA 3H5IA 3K73O 2A9KA 3UW3A 3WYAA 4BQEA 1Z2DA 2XE8A 3HCDA 4XN0A 4DLTA 2QL5A 3GVPA 2HQRA 5E8RA 1YQGA 4PYIA 2GFHA 1CZNA 3AB3A 4I9NA 3PF9A 5DMXA 4GKAA 2R7NA 3ZGNA 1VBMA 4EL0A 1AQYA 1XI2A 1V3VA 3PC3A 4YJFB 4TV9F 1W6UA 2I8LA 1NWCA 3PA2A 1U0JA 1S8AA 4Q9JA 4XD2A 5FPYA 5BSRA 4ZI7F 1H93A 3EZ2A 2WOOA 1BCRB 1E4EB 1O97C 1AKEA 1VDZA 5FI1B 3EISA 3VC2A 3LDGA 3MTEA 5JSQA 3A1WA 3AW8A 3NGMA 1ZK2A 5K3FA 4G37A 3BC9A 1RJDA 3W7BA 4QTTB 1KO5A 2JAQA 1MGOA 1P39A 3DQPA 1H6CA 4IRMA 4L5YA 4RKRA 3SD7A 5KHAA 1SVWA 4OHMA 3GFRA 3ZWQA 3PHIA 3RUCA 3RCBA 1FQKA 2QORA 3GRRA 4LBVA 2AR7A 2LXNA 3AW9A 1NN3A 2Q99A 1SVUA 1WR8A 4DJDC 3HKEA 5I47A 4GMGA 4C2UA 4G0PA 9MHTA 3GNTA 1N9GA 5AHKA 1MT0A 3ERCA 5A4MS 2ZDHA 4UCFA 1S3GA 2A4MA 2AC4A 4WZAE 1HQYE 2JLRA 3SM3A 2OAEA 3V8RA 5J3OA 5DRYA 4JQYA 4PSAA 1J24A 3VA7A 4INPA 1XXHE 3MN1A 3NPAA 3H1AA 3FNQA 1ABFA 2AQKA 3QJ5A 4V38A 1NXPA 4UJ5A 4W6QA 3AGQA 2C5LA 2V7BA 3WVNA 5B58T 3GD7A 4IGEA 4QPJC 1DBWA 4MUGA 2X0FA 3H6GA 2WV9A 4UXHA 2VDRB 1DRWA 1Z06A 2XYRA 1O58A 3W5UA 1A7UA 2P2CA 1JI0A 1KEEB 1NDUA 1E60A 3FCOA 3G23A 1U94A 4M1QA 4D92A 5JLJA 4N48A 3L06A 4P32A 1F0PA 1P7VA 1GCGA 1P2SA 1BTOA 5CNMA 2JC3A 2CBGA 2Y9PB 3A3BA 1WUIS 1JKIA 2I80A 1KP2A 1SA0B 2VF4X 2WHPA 3P9ZA 1CPYA 4OQZA 4XYBA 2BFCA 3O4HA 4CG3A 2Q8PA 4KPFC 3AJ8A 1U5BA 4L07A 3C6ZA 5KYXA 4Q1EA 3ZWMA 5HPYB 2JGAA 1L5OA 2WIKA 1KARA 3P9PA 2R44A 4HEJA 3RREA 2FN3A 4LV8B 1WORA 1XLTA 1DAMA 3C24A 5K3FB 4E30A 4WBNF 1ACLA 3BVPA 3I2JA 4O25A 1XKQA 2BFDA 2VTDA 4GYKA 1A4XA 2RK3A 3GLFE 3W6NA 3EEOA 4PYMA 1V26A 1W34A 1E5VA 1QHSA 2WUDA 3O84A 3R23A 2QRQA 5TQ2A 6Q21A 1O5TA 3TZ6A 1AA6A 3OD5A 2ZRLA 3EOBI 1RC8A 1GV1A 2YVQA 2OCLA 3B1WA 621PA 4G84A 2V45A 1IQ0A 3OC6A 2H11A 3IQIX 3HKEB 4DLNA 1O5OA 2OBBA 4IJKA 4S1WA 2H4JA 3C6MA 1G7CA 1N9GB 3TD9A 4BX9A 3UT0A 3NHBA 4OQDA 4XKWA 1B0PA 2AD1A 4N0MA 2FEWB 5HFNA 1AKNA 5ILGA 3LFUA 2GEKA 3SE0A 3NC4A 1N75A 4FQ7A 3SU8A 3VHXA 2JN9A 4A3SA 2IDMA 2OZPA 3L5KA 4IAOA 3ANSA 4F56A 1YSCA 1YLOA 2Q8QA 1W2HA 1ZUIA 2XEXA 2OY0A 2WE7A 3I5MA 4KYIB 5KQGA 4G0UA 4MW1A 3LLUA 5CIYA 4MEAA 1Z5OA 3RG8A 1YHYA 1RPJA 1KEWA 1FLVA 1XYGA 1W35A 1WPGA 1ZLYA 3JR7A 4IHQA 3N70A 3UV3A 4E03A 3HXQA 3IPAA 4K6KA 2NMVA 2GNPA 1KI6A 3R76A 5H80A 1HDXA 5JS6A 2CNDA 1OXSC 2XUHA 1IOWA 4D9NA 1TCBA 2XA1A 5EAIA 1C1YA 2XYQA 3QVLA 2MOKA 3AOGA 2BFCB 2HLHA 2FFHA 3NBUA 2JVIA 2YW2A 5C1PA 4P7JA 1NX6A 3C5WP 2F4VB 1U5BB 1VXOA 5KYXB 2NOAA 2Y1LA 3KQSA 4KQCA 4ZALA 3K6JA 3UF0A 3UA3A 3UK1A 3O73A 4PCAA 2PVPA 3RGGA 2QTWB 4AJIA 4HNRA 1PZGA 1DTWB 4ZYZA 2GD0A 1JSRA 2XWPA 2YNMA 4O4LA 2WK1A 2G76A 4PO1A 1NBEA 2BFDB 4NBRA 3N0WA 4IUBS 3OPOA 1DTEA 4R2WA 1EVLA 2DOKA 2PUEA 4LQDA 5CLIA 4DNRB 4ER0A 1OXXK 5TQ2B 4EB0A 2ZTHA 1C0PA 5HTOA 1MBZA 2VEDA 3F3MA 5THXA 3MG9A 2JW5A 5DPMA 3SHQA 1N32B 4XB1A 1XC7A 5BSVA 1KYXA 1JZQA 1N9KA 2V5VA 3R8CA 1AQIA 1B7GO 3OE7D 3PWZA 5A04A 5K8UA 2AW3A 2X40A 2XUPA 4B79A 2UU9B 4W99A 4FFOA 1BQ4A 2XZDA 4L7QA 3VHXB 1LSSA 2C2KA 1T9GS 2I4IA 3A0UA 4CV1A 3HVRA 2RJNA 4TL7A 2ENUA 1DC3A 3JYLA 4KVFA 4QYMA 1HDZA 3L49A 4BFYA 1E8MA 4ND5A 4TTAA 3VO9A 1ZKMA 2WMOB 1R0RE 3N5KA 2YFHA 4XR6A 1E66A 3UTDA 3WGUA 1M6HA 3FAZA 1JIKA 2PXHA 4Q4HA 5E0KB 1H9CA 2B4AA 2I03A 2FHSA 1WXIA 3DOCA 4KH1A 3EFHA 2LP4Y 4OG2A 3VHLB 1Y89A 5K09A 4NF2A 2IYZA 2GK7A 3WQQA 1HKUA 1Y1TA 4I5GA 4Q93A 1TZKA 1KI6B 4REOA 4IQ8A 1E99A 3I76A 4CMKA 1MB0A 3CLTC 3AF2A 1JQLB 2A1IA 4KXFB 3OJFA 4RPKA 4DCNA 4NBNA 5I51A 4QRHA 3ZU4A 4DWOA 3FETA 1TGYA 3G9QA 1NLZA 3TZLA 5K4HA 2AWNA 1MA0A 3HDHA 4NU5A 4G1VA 3PNLA 2QJOA 4XMYA 4J0FA 4MR8B 1VHTA 2PAAA 1XK6A 4E2YA 5HF9A 1CB0A 1K8XB 5IJ9A 4UNSA 4GZ5A 2RI6A 4X0CA 1WABA 4OAQA 3HKDA 4O4LB 4IGKA 2ZYIA 1MAWA 1YONA 3MBOA 1GNQA 1GL3A 3IOCA 4OI0A 3I9V1 1V6CA 1YZUA 4HWSA 4Q24A 1Y5IA 4ZVSA 4L8JA 5D2CA 2P6PA 3BTVA 2PU5A 3FZQA 4OIMA 4M1YA 5ALZA 4DZZA 3TTTA 2R11A 3LWDA 4YJDA 4FB4A 4PLVA 2O3TA 3TSYA 2PL3A 2UAGA 1U7DA 1P1IA 1TK3A 4DAOA 4ZZIA 4I1YA 2C4KA 4TYYA 2VBVA 1I24A 5JROA 4A5SA 2Q41A 2PKYX 3D02A 5HQ3A 2C3MA 2FMTA 2O6LA 4ZGBA 4KVAA 1YVRA 3DB1A 4BEBA 5AKHA 1QDLB 3W6UA 3X43A 3A37A 3G0CA 3V4PB 4BCDA 3TI7A 1GRNA 1C7JA 1R6UA 1TECE 2HDOA 1EM6A 5SV2A 4OYYA 3BPSA 1MAVA 3D6TB 2MCFA 1FFBA 1SD2A 2AWOA 4Q4HB 3C3DA 1NIJA 3H84A 4YV2A 1AUVA 4NAVA 1G5TA 3DQZA 2HQBA 3PUXA 1CP2A 4D97A 1MHTA 4KR3A 3I8OA 2VQSA 2QTVA 5B4UA 4GMFA 4G0YA 5EJMA 5CPBA 3HL4A 1Z9BA 5CFPA 2G08A 2ADFA 2C4WA 5BNIA 1YJBA 5KQMA 3TJZA 3FCEA 4WZKA 1N5JA 1KJZA 5CEJA 3V7NA 5B58C 4G0XA 4PG4A 4OJTA 4TV8F 3U3OA 4DXDA 4TYMA 4IQ0A 3DC7A 5FXMA 2X0EA 3UWOA 3F1KA 3ICVA 2FKAA 2FTKE 4FVTA 4C4SA 1MCZA 4M22A 4LVUA 1T43A 2OMKA 5CB6A 4G4SO 1DE0A 2EEZA 3WLAA 2VNAA 4E5DA 1K2WA 2I2CA 3H9GA 3FFBA 4YDRA 3T06B 1CNEA 3V8QA 5SYAA 4P5EA 3HXKA 3NHRA 3GT0A 4KQ2A 3ILXA 5FADA 5IJ9B 4G5XA 3OHMA 3QFHA 1T34A 3K0FA 3PYXA 4IILA 2B7CA 1K27A 4MJ3A 4XIJA 3ADKA 5K6TA 1Z88A 1RLOA 2GPJA 4GPEA 5AI9A 3LDAA 4ROSA 5JH7A 1JHOA 2YJTD 1WIWA 1UP6A 2B69A 2WMYA 1KDTA 3TNLA 1B16A 4OU4A 1I2MA 3IH5A 4QSHA 2WTAA 3PT5A 1ZCZA 2A1UA 1UD2A 2GHTA 3ZWDA 5K0EA 3ZR4B 5C9ZA 3H4MA 1T3HA 4YCJA 4Z3OA 1L4YA 2D3LA 1X15A 3LBNA 3VO8A 1VKOA 1QZ3A 1RPNA 2L2QA 2ZTUA 3MTQA 1MH1A 4IX9A 4MS1B 5A7FA 5LQMA 2QAIA 4YRIA 1RYEA 2OHHA 3ZQJA 4QKQA 2KMLA 4IWYA 5HQ3B 4ISCA 1R5BA 1XL0A 1ZICA 3BXXA 3AKDA 4IXWA 5A3SA 1LPNA 1UDWA 1J4AA 3AUUA 4KXQA 4RMNA 3Q7RA 4YH1A 3RI3A 3TRKA 1XHEA 1EJ0A 1KKUA 1NBWB 4NFLA 2Q62A 3EDRA 4GQAA 4J0KA 4QA9A 4UUBA 1SVIA 4YMWA 3RYHA 2A92A 3ASUA 4HNSA 2ZXUA 3P2EA 2HCFA 1U98A 2ID8A 3T0FA 1H9BA 3ZKAA 4AJ9A 5BMVF 1X2BA 4AUKA 5AVSA 2CV2A 5ECDA 4BUJA 4HY3A 4ITRC 2QTVB 3DMTC 3VVBA 1W4AA 2GAFA 1EBFA 2QNIA 4G5OA 5EE3A 4QBKA 4IFIA 1U0FA 1VMKA 1UP7A 2TS1A 4UQPA 3UW1A 4QUDA 2IK8A 1NJ2A 1SBIA 2VDWA 4Q3LA 3CPEA 3JZDA 1PSZA 3SX0A 4LF9B 1CF4A 3GT7A 3RJMA 5DH9A 1J21A 3AWDA 1DFHA 2ASEA 3HS3A 1E9SA 4KLZA 3VH1A 3WRWA 4BQQA 4MDYA 1QLHA 3BD8A 2OGTA 1FRQA 1CXZA 2CNLA 3EA0A 4HMPA 1XTSA 3C3XA 2QM3A 2ZQZA 1EBBA 2NXNA 2VKTA 2LD4A 1JWBB 3QV1A 4ZVRA 3KBBA 1SXPA 4FNGA 3GI1A 1HLDA 4F3NA 4BDTA 1G2OA 1JFFA 1GFSA 1N1MA 4FCVA 5TQJA 2W2QA 4ZREA 2DF8A 1FFXB 1SKYE 3WL6A 4IGFA 3K0FB 2C1XA 1XP5A 1ZD9A 3GGOA 2QD4A 2ES4A 3GFSA 1W93A 5EN4A 3RVBA 5JH7B 5JMTA 2AJTA 3ZWOA 3OC0A 2AMYA 2D2XA 4BP8A 2OHFA 5HRCA 1J7JA 4KAAA 3K2EA 5BXQC 5MHTA 3E5MA 2WAMA 5JJKA 4X8HA 2P9GA 2A1UB 2VJLA 3DNFA 2XTNA 5KJ6A 3DCIA 1H2RS 2XDAA 1IG0A 3LQ2A 3KK0A 4ZCSA 5IH3A 4HVCA 3VAAA 4D02A 2ZTMA 2QUKA 1YQQA 4F4UA 1XX6A 3B53X 1V47A 1YMUA 3IXLA 1T3TA 4LZPA 3WP1B 1XZIA 3AEYA 3WLJA 4K6HA 1WP6A 1Z0AA 2I4RA 3EASA 2BGTA 3PR3A 5KCZA 2UYHA 5F3RA 1JDBC 5EXEA 3I2FA 3RC8A 3BM5A 1Y6ZA 3FHOA 4I4IA 3RYHB 2JHGA 3O4GA 4QSMA 2C58A 1E2HA 5TRDA 3E9ZA 4Q9IA 1TLTA 1SC9A 3LQRA 1FUIA 3D7LA 3K15A 3GGPA 1MC1A 3EW7A 3U3ZA 4HWOA 4H4DA 1NP3A 3QYFA 4JJEA 1C2TA 2ZJYA 2Y4OA 1V1MA 2PSFA 3T1OA 3ZVRA 4RTRA 3JD1A 1DEHA 2AR9A 2H7VA 2DVMA 4HEA1 4BDSA 1M8JA 2PLRA 3FTDA 1WQ3A 2QD2A 4FS8A 5F21A 3WOVA 2ZU0C 4I9HA 4XEUA 4AJOA 1EA7A 3H11A 4TQUS 3I5YA 1PVDA 4YTEA 2DQYA 4HP8A 3EY9A 1ODFA 1YCHA 4KDRA 1KIAA 4Q15A 2D5LA 3M9XA 1JFFB 1LDNA 1U9IC 3IT0A 2FNAA 2XYPA 3L9WA 3D6NB 4YASA 1WMFA 3O8OB 4BC0A 1PWEA 5CFOA 4P0PB 4OUKX 1XA0A 2Q2NA 3FOFC 1JUDA 3RKSA 3B1FA 4YI3A 3RU3A 1N1EA 3S3TA 3UJCA 1KXZA 5TMDA 2F59A 1LEHA 2Y71A 1T1GA 1KS9A 3O2SB 1T2CA 4H7JA 1E58A 4IDGA 5CVEA 2DLCX 3QSYA 4ZT2A 4XD7A 3EEQA 3GF4A 2J8ZA 4LTDA 1VB5A 4AECA 1PTJA 4IZHA 2VXYA 3G0OA 4D6YA 3GLGA 2GRJA 5EHZA 1HG1A 3MGGA 3PC4A 1NASA 2ZZNA 3BORA 1JHXA 1D9XA 3OLVA 4S24A 1N0IA 2COEA 4GSYA 4Y6LA 1AS0A 1GRVA 2M6KA 3T5MA 4KREA 4TTIA 3DTTA 3AVXA 4Z3KA 2HN9A 3HWRA 4AKTA 3G2PA 5HDBB 4RGQA 4NDNE 1IN6A 1OX4A 4EFDA 3ZDXB 1BVRA 4AZVA 3VR6A 4PX9A 5K3SA 4O0LA 3FGOA 2GJAA 3LXRA 1R2QA 3MUFA 4NEGA 2XR1A 1E0DA 1G4AE 1VGVA 2JDIA 4RGYA 2F1RA 2VPYA 2B8NA 2X42A 3LUBA 3FJOA 3TQCA 3UTCA 5JQWA 1OA0A 3T3OA 1I7LA 1UF9A 3PDWA 1E69A 1LA2A 2QD1A 3B1XA 4PQGA 1V1MB 3DP9A 4LAFA 4NIMA 4GPTA 3P26A 1GG8A 1AZWA 3C70A 4ZO4A 1K5GA 3KOYA 2XQFA 1AN9A 1YR9A 4L50A 2HAEA 3WGLA 3OPMA 1FDVA 5JEEA 2H5IA 3IT2A 2GFQA 1LI7A 2ZYDA 1UBHS 2W93A 4ND6A 5DE3A 3H11B 3MUEA 3VDNB 4BGUA 2W6CX 4DTCA 4HQ6A 1B8UA 1D6SA 1MX1A 4OK5A 3P32A 5DGXA 3BG5A 4ND1A 2I6QA 4KQGA 5J4HA 4GL4A 4PHTA 1IDOA 2V7QA 1KVSA 4Y2XA 3B8EA 1OSNA 4FT4A 4TMVA 3GDWA 3HM2A 4Z9XA 1Y48E 3RO7A 4EARA 3PEUA 5HS4A 1COWD 1G6Q1 2CLOB 5DHPA 2P9QA 4XVCA 2Z30A 4KG7A 1JKXA 1LVUA 1NJGA 4NP6A 1VL1A 1SQ5A 4NPHA 4YO7A 1U6IA 3T5GA 4CQMA 1Y34E 4JVMA 4JLKA 3BUSA 2ODEA 4X06A 2YMMA 4CMEC 4DVGA 1YDMA 3QTTA 5EXPA 3ZJ4A 4FK8A 3D8NA 4P81A 3GLGB 3DD1A 1OPRA 3DZ8A 1RMQA 1LWOA 4QUHA 3U2QA 2PRZA 1P7ZA 2Z3WA 3D6UA 1MX5A 1E89A 1N2OA 3DMGA 1KI2A 3GRKA 3K96A 4TPKA 3HI6A 5HR5A 1YDGA 3IELA 1F8XA 3BE4A 3OZ7A 5E9QA 3X2EA 3NBAA 1Z0FA 1IN4A 1PVVA 3PV0A 2B35A 2QG4A 1UWLA 3IIIA 2YRFA 2X0IA 3N2NA 3CVJA 3WRYC 3V33A 1N7GA 1OX4B 4X7BA 2XXAB 1Y4UA 4QDOA 1XA4A 5A9RA 3H94A 3LP6A 5CLLA 4TXNA 5CGQB 2XB9A 1V16A 4LVNA 3PCRB 5E1OA 2X1MA 1JQAA 2AC7A 3DFUA 3R6GA 2RH9B 3LL7A 3STHA 2JLUA 1T0HB 4G1BA 3NE5B 3IUNA 1R0YA 1J2EA 2QN3A 4IJUA 4E2ZA 5AW2A 1SC1A 2A1TR 2QP3A 4NBKA 5CDSA 2UUOA 4X7DA 2QUJA 1QGOA 3DWGA 2H2GA 4I4TF 1RYDA 4Z4QA 1AF4A 1AVTA 3A1NA 1MG0A 1QONA 3SYKA 4U6NA 5L3RA 3LBYA 4HAOA 1CZRA 2GA8A 2OECA 3FF4A 1UKVY 1AO0A 1VB3A 3ACDA 5HXAA 4GPBA 1NFFA 2VK8A 1Y3AA 1C4XA 3IDOA 1C7RA 4A2CA 4HJXA 3H3FA 1YAJA 1V1RA 4WXEA 4CQMB 5BN4A 2DCUA 1I9GA 4D0NA 1DXOA 1NM5A 3R3XA 1H23A 3GLSA 3E7XA 4CQJA 1WXWA 1D6MA 4KO3S 5AWFC 5ENVA 1FU7A 1JIIA 3F0TA 3GEMA 3NATA 1PUJA 1RI3A 3IRUA 4BKOA 1L5ZA 1WZEA 2IX9A 5J2UA 1IC6A 3EXEA 4IBOA 2ZRFA 5LDHA 1Y1LA 3WZMA 5LP6A 3QVWA 1E63A 4MVCA 3WP0A 3Q8LA 4BKRA 4IS3A 5U4XA 3HEBA 1H1LA 1L5VA 1B73A 4L51A 2PFSA 1ODJA 1ZJWA 3CCQB 1R0SA 2YQ4A 1EP9A 1VDMA 2ZRCA 4KH0A 5DHSA 3Q0EA 1V16B 1O57A 1IJBA 4RHUA 3G9TA 2VWQA 3ECAA 1SBHA 4UDNA 1V48A 1LTQA 2W2VA 5WRFA 5HHTA 5EE1A 1IVYA 2BC9A 2X0JA 1VMDA 4AF6A 3DONA 1OAKA 4CZ2A 4UAVA 1BGXT 4DNXA 2FPOA 4LX8A 1EZ4A 3OOWA 4IHJB 1R15A 1H4QA 4FBLA 1YDHA 1VPEA 4YT8A 5K03A 1WULS 2FEMA 1E3WA 1F12A 4HR7A 4MITA 4Q1AA 2DWUA 4R8SA 3V3KA 3JRXA 4DR3B 5BSHA 3C39A 4QUZA 3V6LA 3D2AA 5IYZF 4B71A 2VSQA 3CBGA 2CMFA 3GCZA 5JO9A 3CF6R 4WFQA 4K2AA 4KWTA 3D59A 3MM4A 5BV0A 3K16A 3DTVD 4J4HA 5DXFA 3W5CA 3GLIA 2K5UA 2H4HA 2XGSA 1BMTA 1P81A 5LR6A 3EPJA 1OLOA 2B8EA 1V2GA 2ZT5A 4L16A 4DDTA 4V1CA 4OQPA 1IHPA 2KBEA 1V1RB 2FZWA 2JFVA 3BHJA 3H3XA 3N05A 5BN4B 5FJJA 5JAPA 2WINI 3EW9A 3AHFA 4G0QA 4KVGA 5D3ZA 4QHYA 4YAGA 5A5GA 5EESA 5MFPA 3SI7A 3R3JA 4DWJA 1MXHA 1QUFA 2YICA 1PFVA 1SZPA 5TGZA 3TAHA 4OH7A 3L77A 2PGOA 1FLAA 1FFGA 3PXXA 3WYEA 2R6JA 5J2UB 3KAQA 5FR1A 1MGPA 4YJ2A 2Z2JA 1XNRB 2O23A 5LP6B 4I4NA 1TK9A 1U8CB 1NMSA 2CMHA 3HUEA 3T7JA 4DDWA 2H4XA 5BYBA 4E5NA 3SZMA 1H1LB 1ADBA 2YVLA 4G41A 4QUBA 2FWIA 4IR7A 3B6EA 2PPLA 3Q10A 3NONA 4LYAA 2J32A 5IXJA 2IE0A 5HEKA 3SYRA 4FEGA 5LMCA 4NYIQ 5JDCC 4HWPA 3CGWA 5JZBA 1PL6A 1U8ZA 4J7XA 3ZXSA 1U28C 4OF4A 2XNJA 1U8FO 1KJQA 2EL9A 1NN5A 1VTKA 4P0TA 2O7QA 5KQLA 4FM9A 3MGAA 3I9MA 4LJYA 3WDKA 2ZBGA 1I5OA 1XQ9A 1BS2A 4PG6A 4S2EA 1ZU4A 1KEPA 4EYQA 2HMTA 3DL4A 2ISQA 1E3WB 4YQZA 3IEKA 2FXIA 1RE1A 4PIVA 1BHSA 1UC8A 3L6DA 3WK6A 4V0ME 4W5HA 3V42A 4J2HA 4O4IF 2GMWA 5JQGA 1G3MA 3GUHA 4WNAA 1O0BA 3ZX4A 3IMCA 2YHAA 3K3PA 3B12A 1G21A 4URFA 5AI0A 2G1UA 1HZZA 1RJFA 4B85A 1HL7A 2JVJA 2L69A 4B3TB 3SS8A 3LT0A 3HPQA 4HGNA 1J0BA 4QQNA 4TN1A 2JD1A 2VWPA 1T6YA 4QJ5A 4DKJA 1U6KA 1O94A 3DMPA 4V1CB 2XV1A 3RHFA 4FNMA 4RACA 4WAUA 4BLVA 3QKSA 4RF3A 4TKMA 3CEJA 2BISA 2FEOA 5JPDA 2RC5A 5A05A 2ZVQX 3CZRA 4RKEA 1OZHA 1JN0A 4RVUA 4DR4B 4IOKA 2GEVA 3LOUA 5JAQA 1VJCA 2HV8A 3EXAA 2WTUA 2X9LA 4PAAA 2FW0A 3G8DA 4KN8A 3BRQA 4M76B 1TEZA 3VPDA 4QWMA 3WKAA 3WTCA 2GM4A 2AYZA 1LW7A 5L95A 2PMFA 1WXEA 3DWIA 3CZMA 2AN3A 2CUKA 4TMTA 1P1KA 3CMCO 3GFQA 4HPWA 4CU2A 3ZIAA 5JSKA 1IONA 2ZIAA 4N8DA 4WXYB 5B6PA 1PFWA 3C5VA 2A9PA 2ZKLA 4Q39A 4Q18A 1SVKA 1ZM4A 2IJGX 2MT9A 4Z0TA 3QIVA 4CEHB 3TSAA 3GCGA 4KXMA 1HE1C 1SRQA 1Y3HA 1Z7GA 3ZWAA 3MIZA 5IMBA 2HQOA 3KUUA 2IEAA 1S01A 2PRJA 4BFXA 1FQOA 3OCYA 1PWXA 2ONJA 1VMIA 1T2VA 1H65A 3DLPX 4OJYA 4BNHA 4EB3A 3UBTA 2R7LA 3OWXA 2ZVPX 5JQGB 3QXGA 4WNAB 3GJ4A 4EVSA 3D6VA 2X8LA 3BEDA 2XNSA 3OZAA 4LZOA 3CSDA 1AE1A 4HNQA 4IO1A 5G0SA 3A6KA 1T4DA 5AM4A 5GJWC 3STYA 1QYDA 1IQUA 2YHIA 3DQQA 2EGUA 3KXIA 2QG9A 3VAYA 2XTAA 2A94A 2CYCA 1XNJA 4I7EA 2O9JA 3OVMA 2BH9A 3IDAA 1H4SA 2NN3C 2PGIA 4YT2A 3JQ9A 3QKSB 3H9JA 1PK7A 4FCWA 1Y6JA 3WKCA 5E4JA 1KQFA 2OMEA 2YINC 2Z8XA 3QBEA 4UEWA 2DUMA 1XTPA 3E84A 4XDZA 5F4JA 5ITWA 1L7NA 4FHDA 4M8SA 4NJEA 1W47A 4DUYB 5CX4A 4KMRA 1JR3E 4J0HA 4ARBA 1T24A 2GHQA 3FYDA 3DUWA 4K9DA 4HCJA 1SD1A 3KT6A 4H0NA 4H3HB 4RWEA 1UKEA 3BF7A 3NXKA 3KTAB 5FTLA 2CL6X 1IH8A 2DKNA 4XJXA 5F12A 2BMJA 5T6BA 3GBSA 3D7NA 1TYZA 2P0EA 3BMNA 2FPSA 3ZI7A 2F3RA 1R1DA 4Z5XA 5BURA 5JZMA 1DIRA 4FT2A 5F52A 3VU8A 3H83A 2XKKA 3IKLA 1QCYA 1R0ZA 2CHEA 3FDFA 5L8VA 1YJ5A 3JYNA 4AY2A 2FQWA 3MUOA 4D9BA 2F1MA 1LUAA 5LN1A 1ZXLA 4Q7KA 4RMIA 1JE0A 3AR2A 2ZYTX 3JRWA 1ZJYA 2FFQA 1GKUB 1F14A 1M0SA 2QIOA 3PF8A 4PQYA 4LZLA 4XIGS 2O5CA 1O0CA 4JSTA 3OU2A 4DF3A 4EY3A 1PGPA 3TLKA 3ZDBA 4FYHA 4HLNA 5IHPA 1JEYB 1V3TA 3G2NA 3QE3A 3FPFA 1VJTA 3FRJA 4ZODA 1HYEA 1UDRA 5FV4A 3N2KA 4BMYA 5G41A 3OY7A 4KQ9A 4Q7LA 2FRXA 2YHIB 4EHJA 4HN2A 1P0MA 2NZYA 1QHEA 1VQ9B 2QSZA 4G1FA 1YBMA 4OATA 4OK3A 2R84A 2ZT8A 4YJ3F 4F5WA 5A2GA 3DOEA 2L42A 2NU6A 3JARB 3SS9X 1TMKA 3O5AA 4JT4A 4JBXA 3E1SA 4DYHA 5AMXA 5TLSA 3C8HA 5KWEA 3EMKA 2SECE 3WKEA 4XLLA 1TA4A 2HDHA 4B4KA 4NJEB 2GGSA 4YDQA 5AH0A 3U3RA 1P8AA 3IXQA 4BB6A 3IQHX 2DGDA 5T3UA 1C4KA 1QIDA 1V37A 2G4CA 3PLRA 3IR5A 1FDUA 1QHGA 4Q34A 5M2QA 1XMXA 3I12A 4G25A 2WT8A 2ZRNA 1Z4MA 2YNMD 3G0HA 4BO2A 4W5RA 4FUTA 1SBCA 1V7QA 3BMNB 2ZG6A 4HRVA 1SCJA 3B1YA 4EA6A 3DVSX 3QKWA 1FNDA 1NYRA 2GESA 4O2AF 1P1JA 1NN0A 4QXMA 4RA6A 4B7CA 4TZ0A 2G9UA 3H2IA 1CFZA 3NWOA 5HX7A 3GVKA 4J9UE 1XELA 2X77A 3EGWA 2YYAA 3QVJA 4FIZA 3GT3A 1Q15A 2OP1A 3PQ4A 2FVYA 3A6HA 5I5EA 2IV2X 1TVMA 5EKSA 5KU1A 1W0CA 2OBRA 3KWMA 3UB4A 1A50B 4HN4B 4C6SA 5IYQA 1QU2A 3OH8A 1G42A 1OFTA 1T26A 1BVUA 1VC2A 1VLOA 3LBFA 3N2KB 4LZAA 1X8KA 3OLZA 3TR6A 5FAXA 5K3EA 1JALA 1GPNA 1I4LD 4FLMA 4E07A 2DR2A 1PL7A 4TN5A 3ONEA 1N0HA 1Q7BA 3H5NA 5KYWA 3BMCA 5ALIA 1QMPA 1B2RA 4M0FA 2VAXA 1WWKA 1HEUA 3E9QA 2NU6B 3VUEA 3NALA 4LRXA 2VI5A 5ESDA 1W4BA 1VP9A 3VZRA 1U8TA 3IUPA 4KRFA 5DX8A 1ESZA 1N2ZA 2AYYA 4EW3A 1ZM2A 3CH4B 4DGQA 4EHKA 1X1TA 1Y5NA 4HMQA 3PI7A 5JY1A 1Y9DA 1GQOA 3PCTA 5FLEX 5IAKA 4GM1A 4LWQA 2PD3A 3NIDB 2OT3B 3AI3A 2VLBA 4I8DA 3EAGA 2I78A 2OC9A 2ZGVA 1WKVA 3PQ3A 1RIIA 1WMAA 2V7GA 1GYRA 4JS0A 4JI4B 1OV4A 5IKOA 1A1VA 2VBTA 2ZWPA 5T4FA 3K9QO 3N59A 1GDHA 3QZUA 4OD0A 1APBA 3J80A 2W11A 1XYYA 5FDFA 2QPOA 4UOZA 2QTTA 6PFKA 1WXQA 2PQ0A 3CCVB 4EKEA 2HPZA 5J4YA 3I04A 2IC5A 3MJDA 2Q07A 1YIAA 4S1TA 1WQ4A 1KQPA 1A7AA 4XGRA 5ED4A 2BM8A 3KSAC 3NRBA 2Z04A 3AV3A 3BXGA 5FIUA 1NVKA 2CXSA 2QUAA 3QYJA 5DM70 4RJ2A 4AJ4A 3WMFA 3ZZUA 3CW2A 3CCRB 4U8GA 1Q7CA 3RT9A 3K5PA 3KHKA 5AVTA 3WSWA 5KYWB 1NW9B 2PBLA 2QT0A 2OGZA 4CKEA 3EUEA 2ORYA 3W3AH 4GP7A 2BTOA 4NNJA 1RHUA 5JHGB 1WZ2A 3I9FA 1QGYA 2XVXA 3JQDA 4OBEA 1IBSA 1BHO1 3VV3A 4H1WA 2D7DA 5CT6A 5HRUA 3VPSA 1I51A 2DH6A 1QE3A 3PXEA 3ZBPA 3NBFA 3OO0A 1EWKA 4KN9S 4EW1A 2BGWA 2Z4RA 2HHAA 5CDGA 5A5FA 4OFWA 4GSKA 4ZEOA 5C1IA 4LXQA 3QVTA 2JLVA 2J0EA 2A7XA 4IUDS 2BKUA 1KJIA 3J81k 2NP7A 5KW9A 1M7BA 2DHCA 3ABQB 1GCUA 5AKIA 3KVRA 2BZ0A 1GPKA 3D43A 1ONSA 2R65A 3CNBA 3KWLA 3K4PA 1YE5A 3MLEA 2H1SA 4L9WA 3AR9A 3ZY6A 5JI2E 1XG5A 1G8MA 2HWYA 4LHXA 3ADPA 1T8WA 2D5IA 3O1HB 5FPPA 4KHZA 4BWVA 4C89A 2CVFA 4OCZA 2WFZA 5AM5A 5LBUA 3Q3VA 4EYSA 1NUSA 4PLTA 5F7JA 2WKQA 1ECLA 3GH3A 1A5ZA 2JF0A 5A3JA 5DBIA 3K6RA 1AURA 1JH8A 2I3BA 2DM6A 1TU0A 2JFBA 2RIPA 4QHTA 3CR8A 3UQYS 4OXQA 4LGVA 3SE7A 3I34X 3CMAB 3R74A 5F9FA 2EHJA 3CEAA 1B42A 3DZDA 1VJ5A 3DM5A 3A1UA 3FCSB 4GX0A 4E5YA 5HUQA 1ZJ6A 4GE3A 2HPHA 1FNSA 2BI4A 1KQ3A 2LGJA 1NBAA 2GR9A 1Y4SA 3O8QA 3OQVA 5CK5A 1W6RA 3CF4A 2VP0A 2O0HA 3EEIA 3GJYA 4CKEB 2PZEA 4XYLA 3QI2A 3DV2A 3SHWA 4E1BA 2P8JA 2IOHA 2UYQA 4CV2A 1HMPA 4BO1A 4IDEA 3PXBA 3OIGA 2J87A 3SIWA 3UXMA 4L6AA 3RWOA 5BWOA 3Q5EA 1GPAA 3KBOA 3R3SA 4R41A 2NXJA 1XK7A 1Q6ZA 3GG9A 4X7EA 2VUHB 5A3QA 3LQKA 4POAA 4DC1A 4C6TA 2J4FA 3VZPA 2ZJ1A 3HCBA 1YI8A 1AQUA 3KKKA 3OT1B 1GAEO 2JAUA 3WL3A 3B9QA 5ARBA 5HJ5A 3FUTA 4G86A 2Y1XA 2WZPP 2XUGA 3P5BA 4QLAA 5H81A 3FNBA 4UBNA 4FFSA 1JSZA 1XBTA 4WOJA 1ORWA 2CZGA 4GPZA 3RS9A 5HQTA 1VCNA 3BY1A 1J56A 1Y3BE 2QRVA 3IP6A 3OE4A 3OQJA 2ADMA 2VQ6A 2CCKA 4PFKA 1AMUA 2H48A 2VYNA 1RJGA 3GMSA 1R8XA 3PNOA 2VJDA 2WMNB 4JYBA 4YWHA 3A36A 2B37A 5AK4A 2AOWA 3RS4A 2ZZMA 4RM0A 2ZYGA 3D0OA 3KKLA 1RAGA 5I7AA 1M1UA 1Y7LA 1P4AA 1UFQA 3EXHB 2JHFA 3QTLA 1P91A 2WTMA 3KQPA 1Q91A 1R6TA 3T9AA 3MAGA 2EJUA 2W0SA 4RHTA 5TDHA 4B3SB 2Q2WA 5B3AA 4IZOA 3UOWA 1FMLA 4RSGA 5EMKA 1PQUA 3KFVA 3OBIA 4B34A 1A4IA 1NJ5A 3A8IA 4EA7A 5AKXA 4FFNA 3R24A 3O8QB 1K66A 3EVEA 5IT0A 1F2TA 2WDPA 4ZVOA 3GEHA 4UZSA 3OPYA 2PNJA 2OYSA 1XLVA 1ZNZA 1ENPA 2BBTA 3CJRA 3DZGA 3ODPA 4C0QC 4E88A 4K0KB 4PONA 1RYHA 1K5DA 2IT1A 5L7YA 2NVWA 2Y0PA 2ZSFA 4WN3A 3THRA 1QP4A 1P75A 2RHRA 3VBCA 1KAMA 2PT9A 1BEZA 1J97A 2FPRA 4LRYA 3TD2A 5HZBA 4QVJA 1THTA 1Y6QA 2X0DA 2FJUA 4PNPA 3EPLA 1TAQA 16PKA 4RQTA 4U7WA 4C6TB 1PL8A 2J85A 1HLPA 4HGQA 4CF6A 1SUIA 2WNSA 3CJQA 2DERA 3JVDA 2GYWA 4PZUA 4MVWA 2Z6VA 3O2QB 2XT0A 4DMHA 4Z6KA 2WF9A 5CX1A 1ZOIA 1GGKA 5BSMA 3H2BA 2TMDA 3E53A 3Q7EA 3OA0A 5E7MA 5HCIA 4Q4CA 4H7FA 4CM6A 1YAHA 2IF0A 4MX8A 4X8LA 2F7SA 3NB0A 2W6OA 3U16A 2ZJ7A 3R0JA 3L40A 1J09A 2QRVB 2F1HA 3LGSA 1Z4QA 4B6OA 1S3SA 1K4MA 4OBBA 2D54A 2BJWA 1FUUA 2FJ0A 3B8HA 2CFSA 3RLFA 4XD7D 4AMZA 5ELXA 3FTEA 2F64A 2VXOA 4C5CA 2FN8A 3TMAA 3WQRA 1TL7C 1M54A 5AW9A 3ZLJA 1YQEA 4LSZA 1DWPA 1UJ4A 2JCXA 3E9NA 3ZDFA 4CCAA 5JAZA 5LZ4A 3IPXA 3NHJA 4KPGA 3ZLBA 4US0R 4JP3A 4KWIA 2Y92A 1MQ8B 5H7XA 1N57A 4GECA 3WQHA 1LGYA 5EWMA 2WU4A 5HFAA 3KDAA 1K89A 3CVWA 5FOXA 1ILEA 3FYHA 3U4GA 4E5KA 4PO9A 1JG3A 1DAHA 3WK5A 3VR6D 5TB5A 2OLEA 1JDUA 2EKPA 3HB7A 2G40A 4UTNA 1KAHA 2JDID 1H0HA 3KALA 4XOIA 5B36A 1B74A 1F2TB 4LN1A 2RAUA 4M9SA 3KLMX 4JR0A 4I46A 4PWZA 1VE5A 4JT8A 2PEYA 4B4VA 2H54A 1T1IA 4ANFA 2RHOA 5ITSA 2NU7A 1XV5A 3A35A 3MRSA 2XWBF 5U1PA 5IZCC 2JH3A 4RETA 1MENA 3O1IC 2F17A 4FMDB 3CCLB 2WP8J 3NFYA 4R1PA 3HABA 3I6MA 2ZU6A 1UMCB 4JODA 3UY4A 1GADO 1ZL0A 1DC4A 2V1UA 2OHIA 2H2FA 4BVHA 3HM9A 1DWQA 4PZLA 1JJIA 1WE2A 2V7QD 5CX1B 5EUQB 1OI4A 5EGNA 3V7UA 3NASA 2Q6KA 1UJBA 1ETHA 1XRPA 1XR3A 1JNXX 2ODNA 1LZLA 3PRKE 4PTYA 2FZ4A 2GF2A 2OO3A 2QXYA 4JCCA 1XFAA 4U7TB 1JTVA 5SZKB 2XRMA 4CQMD 3CTMA 3TIXB 2DULA 1YDWA 1PD0A 3HJHA 2ONYA 3C3YA 3KLNA 4I1IA 5LCXA 2XA9A 1FMFA 2ZYHA 4R5HA 4TQGA 2AF4C 5KTMA 1V11A 2PMKA 3EMVA 4EITA 4B83A 2DFPA 4MJLA 5FBQB 4C14A 1FUKA 3PUWA 6ABPA 1X0XA 2GBCA 4XGQA 4WY5A 2FK7A 3OECA 3AKYA 5EIFA 1E0AA 3NDRA 1T2NA 3HU3A 5EWMB 4P12A 3PRJA 4W9NA 1Q3TA 2IYOA 5GONF 2QX6A 1L9XA 1EUCA 1UJ6A 5EJ4A 3KVYA 3EZLA 3WDMA 5B4VA 2XNCA 2JB9A 2FCAA 1S2MA 1EA5A 5E3JA 1Z29A 4BO4A 1FVXA 2AMFA 1SIOA 1T4GA 4NBSA 3MT9A 4AKIA 4V02A 4GVLA 4FMCB 4JX9A 5EP3A 1G5IA 2X86A 3D8SA 1KP3A 1ESDA 3ZU5A 4MV3A 5E38A 5FAKA 5HRAA 2NU7B 4GKKB 3LCMA 4Q9HA 2EW1A 3CNHA 1NV9A 5E7QA 2WIFA 1IXZA 3PJGA 1T2DA 4UHCA 4JB2A 1N7JA 4HSEA 4WKCA 1M10A 4DLXA 1X1DA 2FAXA 1VF7A 3PE4A 4KE9A 5K0TA 5IM4A 2DFNA 2V4ZA 4BB9A 5B30A 1CJVC 4URVR 1UK8A 3M1YA 3PUNA 2FP4A 5B57C 5CB4A 1H6AA 1POWA 2JFPA 4WL0A 4NS1A 2NUPA 3EVGA 1E61A 1OBFO 3IOEA 3MELA 1GSIA 4BS9A 1A9SA 1T9CA 5FWAA 3CC2B 3NI2A 3O2JA 3A6GA 4OQFA 1GO2A 4E46A 1JHMA 4QUKA 3N87A 1JHZA 4MWZA 4F72A 1GEGA 3GJ8A 2IW3A 2G0NA 2E9SA 2GD1O 4UU1A 3UGKA 2X15A 4HLCA 4WKGA 2E2WA 1P4RA 2PS9A 2VDVE 4GAEA 3AL2A 1Q12A 3DDNA 4MKZA 4YP1A 1G0OA 5F1OA 3RARA 4MO2A 3ZY5A 1TF7A 3U48A 2YXEA 3PC7A 1JJ2B 3TLMA 4Z8XA 1NX9A 1VHJA 4MUKA 4H3VA 4BKMA 3EG5A 5CP8A 5LQCA 1SUSA 2O2HA 4FYMA 1EUCB 1DWOA 4NESA 1Y0BA 2RH8A 4MULA 5D3MA 5T7BA 4MUJA 3FTQA 4ZWNA 1Q0PA 3AJEA 2PO7A 1H85A 2YZNA 4D0RA 4ZVTA 2Q1UA 2GJPA 3EVFA 1ZQ9A 2G67A 2IDKA 4H9GA 4RY2A 5D00A 2B5OA 2ZQYA 1USKA 4J1TC 5DYTA 1Y7IA 1Z8DA 2BZ1A 4X6LA 4DR6B 4MGKR 4EBBA 1MT3A 3KR0A 4Y2QA 1QFJA 1R6DA 5FNVA 3U61B 2IYXA 3SLGA 5DP1A 3U1VA 4B6FA 2JAPA 4RZSA 5JNUA 1VXRA 2AOXA 4ZOAA 1P6UA 1C5KA 2O8EA 4AF7A 3T5CA 4B74A 2QTHA 4Q48A 3ST7A 3OM1A 1OFUA 2PBRA 3U7EB 4ESEA 5E2AA 3TN7A 4XB2A 4XWKA 1KSJA 2FP4B 4XX1A 4DRZA 4ENRA 2G70A 1F5SA 5CB4B 1IG3A 3ZG6A 1TDJA 1YASA 3PICA 4XR9A 3GRUA 3WYBA 2BAGA 5B64A 2NUPB 2HK6A 1Z8FA 1E4VA 4UUOA 3WQSB 4EYOA 3UJPA 5J5CA 4MWGA 2DBZA 3MQ4A 2WJHA 4M54A 2B1GA 4G9EA 4CM4B 5E6RA 4XM3A 1Z0DA 3IIMA 1D7OA 1NFQA 3CMEB 2R00C 3DXFA 5KNCH 2DYIA 4HX5A 2X0NA 4KUGA 3SEQA 4IIGA 4B76A 1NATA 1VRVA 3UMRA 4XCVA 4MQFA 1NV8A 4L4ZA 2ZTSA 4PPGA 2PMWB 4G63A 1FJGB 4B3RB 2TYSB 5GZ1A 5IDYA 2CDRA 1RQ2A 3WISA 5LWHA 3KQOA 1PJCA 4KJXA 1X7XA 2UZ0A 5LYJA 3RFFA 1AJEA 4Q7JB 4XVUA 3UVEA 2IRWA 1J6UA 4BNGA 2Z6AA 3FJ1A 4FOLA 3C48A 4GPD1 4ZCIA 3BDIA 4QECA 2B5WA 4MKFA 3DL2A 1MZVA 4FR0A 3F5FA 4UBIA 5DWDA 3PUMA 4IDCA 4HS4A 3AMVA 1DZIA 3HN2A 3TLZA 2HCBA 2AV6A 5EE5B 2B3DA 4RPDA 4DR1B 2IHKA 3KKOA 5LFAA 1C1HA 2B2XA 4GDMA 1CUUA 2M6RA 3PFHA 5HE9A 4OREX 3OIVA 5FNVB 4P3YA 2OTJB 1KBQA 5JFOA 3ZI0A 4H7KA 3BF8A 4AYWA 3A8KA 5DVZA 3OOEA 3LPDA 4QAJA 4DB2A 2O8EB 2AQHA 4KYTA 4RVOA 4BMZA 1VPTA 1ADCA 3LUCA 3AUTA 2PZAA 1F20A 4O1MA 3ZBQA 4I1OA 4N5MA 1TW3A 1ZUHA 3EVCA 1GRRA 2EJCA 3CZQA 4WE3A 1SEPA 3IE0A 5TF4A 1GCAA 1TX4B 3UJA