2VBUA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
131
structure length
131
Chain Sequence
b'VKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN KINASE
molecule tags Transferase
source organism Methanococcus jannaschii
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
total genus 21
structure length 131
sequence length 131
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbuA01
3ZUGA 1N06A 2X0KA 1MRZA 1S4MA 1T6YA 2I1LA 1N05A 2VBSA 2VBTA 2VBVA 1NB9A 5A88A 2VBUA 1Q9SA 4UZEA 3CTAA 1N07A 5A8AA 3BNWA 1T6XA 3OP1A 1P4MA 2P3MA 5FO0A 1N08A 5TRDA 5A89A 1NB0A 4UZFA 1T6ZA 5FNZA 5FO1A 2OYNA
chains in the Genus database with same CATH superfamily
3I56B 1W87A 1N06A 1QFZA 1WSVA 2KVOA 3OEEA 4PGOA 1R5OA 3W2IA 1B23P 1XFOA 3A1PA 4XM3A 1E3XA 1QUFA 1KK1A 4HE6A 4M0LA 3V76A 1CQXA 4XONA 4PC2A 1N0UA 3FPKA 2WJYA 4XOTA 3WNBA 2GK7A 4TKOB 1P4MA 3PVDA 4XLFA 4C0SA 1YJNB 1JB9A 4DQKA 3GVJA 3CW2A 1E3ZA 2GK6A 4G1VA 3A8KA 5DSZA 3ES9A 3H94A 1EWYA 2DCUA 4IW3B 3U6KA 4PC1A 2X0KA 1H85A 2Q6KA 2X6YA 4P9SA 3I1FA 2FVGA 4G7WA 1D2EA 5A88A 2V7WA 2Q6LA 2D74A 4Y7CA 3T53B 1TUIA 3G6EB 1E63A 3CTAA 2C78A 3GQBA 4RPBA 4Z4VA 1VQLB 3BNWA 2YWGA 2NV4A 1UD4A 3MCAA 4ZCLA 1WOSA 4L8JA 5F4JA 5JBQA 3GVLA 2DERA 4UZUA 1H8HA 4TN1A 3BC9A 3SKBA 2QEXB 2CF4A 5J3OA 3LNNA 1BX0A 2Q6OA 4PC3A 4X06A 1S4MA 3OFNA 4E0FA 1UMKA 1N05A 3J81k 4OOVA 3CCVB 4Y9UA 3FJOA 1QH0A 2XNDA 5IYRA 3T51B 1GR1A 1D8TA 2BV3A 3W5HA 2X53S 2OK8A 1IB0A 3A3GA 3OE7A 4DQLA 5HZAA 1I7PA 3JU4A 4Q7JB 4YAUA 3KL9A 1JA1A 1GAQA 3WQZA 4G5GA 1QGZA 2GJPA 3CMEB 1S0UA 3SLDA 3VO2A 4NBSA 3CCMB 2ZTGA 3AVUA 2V7XA 2R6HA 4LBZA 3E20A 5FL7A 1VQMB 4B48A 1UD5A 3BY2A 1OB2A 1I8DA 1RQRA 1QFYA 1N8RD 1V0EA 4RD6A 3SJPA 1UD2A 4X8IA 3ZPNA 1DDGA 1VLYA 3G4SB 2BM1A 1FDRA 1VJSA 3CD6B 2ZZFA 3QE2A 2XZLA 4UZEA 1GVHA 2VZLA 2VNKA 3FKSA 4RD1A 3OJWA 1E43A 3V7AA 3ASSA 5EMNA 1Y0RA 1PJ5A 4WWVA 5FO0A 1FNBA 3LQEA 4XLHA 1VQ8B 2BF4A 4PC6A 2VJJA 4TMWA 4XMYA 1F60A 2XNCA 4B43A 4X7EA 4OOXA 3ZZ0A 3PA1A 1W9XA 2VNHA 1TLLA 2OBTA 3LQ6A 2BN4A 1E62A 1V5VA 4RDKA 5FIUA 3WBKA 2OBRA 3JQRA 4OPVA 2XGJA 5F4MA 4ACAA 4P3IA 3OPOA 2OK7A 1OGIA 2CNDA 2D3LA 4M2LA 4RD2A 3ZBTA 1EFTA 4YXWA 1QGAA 1K73D 4ZGNB 1OB0A 4WZEA 2WZPP 1OB5A 4PC7A 3OW2B 3AVXA 2DETA 4KKSA 1KTVA 1M90D 3VNVA 3NE5B 1FNCA 4RDLA 1T5EA 4QUZA 1E1QA 4XD7A 5DN6A 2QA4B 1VQ9B 3OJXA 4XKWA 3AGPA 2Z6BD 2QGGA 1FNMA 4Z4ZA 1KD1D 2WR8A 1EXMA 4RLZA 1VHOA 3P26A 5A8AA 4FN5A 4HIZA 1OGJA 3PENA 1FNDA 2E1BA 1N0VC 3FPPA 1KK0A 2QDXA 4MYUA 4RJLA 4N3GA 4TMVA 1T6ZA 1QVFB 2E1RA 2YWHA 4ASUA 3W2FA 3BQJA 1QGYA 2X6WA 2HLDA 1E79A 2I1LA 3VMFA 4AC9A 1GAWA 1W35A 2VBSA 3Q39A 4TSFA 1TTTA 3W2EA 4F7DA 1NJID 5FA6A 3JQPA 4GQNA 5L46A 4RCZA 1VF7A 3PUNA 4NNJA 4Z4YA 4RD3A 2XOKA 2C2WA 4FK8A 4RPDA 1W0KA 3E1YE 1UD8A 3OKXA 3SEJA 1GJRA 2CC2A 2GJRA 4J0QA 2VNJA 4YAFA 1SKQA 1WPCA 3VR6A 5BSYA 3JQQA 3BCDA 1BQEA 1G7SA 3CCSB 3SLNA 4XORA 3AVYA 1WORA 2OTJB 4BPRA 2RC5A 2EIXA 2ZL6A 4X0CA 2JJ1A 2HMAA 4WQMA 2V7UA 4U9UA 1KK3A 2X85A 4P1VA 4EH1A 1UD3A 1VQ6B 2B7BA 1VHEA 4Y9RA 2C4UA 1XB2A 2X6XA 1ZM2A 4ZCMA 2B5OA 2ZL5A 5KNLA 4II3A 3Q38A 4P12A 4P25A 3RY8A 2YWEA 2XNJA 1VQ7B 4JMQA 3WBJA 1VQNB 1ELOA 3B8HA 5HXBA 2OBSA 1EP1B 5KW9A 3A35A 3BY1A 4M4SA 1D1NA 4OPSA 1XE1A 1BPLA 2RC6A 4Z4WA 1SKYB 5TR9A 5FO1A 3GIRA 1CNFA 2WPDA 2W6JA 3ZUGA 1IHMA 4TMXA 3AVVA 5KSWB 3OZUA 3OZVA 1Q82D 5LMZA 2QTLA 2C77A 1KQSB 5IK2A 1R5BA 1NB9A 2VBTA 4RM0A 5GV8A 4XKVA 2F1MA 5IYWA 1Q9SA 4XN0A 3P27A 4QHYA 4YHBA 3GVKA 1HVXA 5TRDA 4Z4UA 1WSRA 2WZNA 1VQPB 4DK0A 2GJKA 2PIAA 2JJ2A 5H59A 3CCLB 1KK2A 3CCQB 1YJWB 4UZFA 3BCFA 3R6JA 1NRKA 3KEWA 1HZEA 3CMAB 1W34A 4K1XA 2OYNA 4QVAA 1VQOB 3CC4B 3W5VA 4B3XA 2J7KA 2GPJA 2F1LA 4TT3A 3PUMA 4YAOA 1W2BB 2YWFA 3ASRA 3PA2A 2V7QA 3AVWA 1J9ZA 2PE3A 4H9GA 2X8KA 4R71A 4RDJA 1COWA 2ZZEA 2WJVA 4HE5A 3Q3AA 1IJFA 4WZTA 1DDIA 4B4DA 1I18A 1Y0YA 1QX4A 2QE7A 3CPXA 2M5SA 1VQKB 4TMTA 1JJ2B 3CPWB 4RD0A 4XQFA 4X05A 3WY9A 2XZOA 2BGJA 4G7XA 1Q7YD 2HCJB 3ZZTA 1M1KD 1PKVA 4LC0A 2CRVA 4AF7A 4X7DA 1YHQB 2BVNA 4M53A 1T6YA 1K28D 2ZITA 4XN3A 4FWTA 5BSXA 4QFMA 2BM0A 2VBVA 3CXCB 2BMWA 1XQBA 3WNCA 1AMOA 1FRNA 3ONUA 3ONYA 5CDFA 3CCJB 4ZV4A 2PMDA 4PAAA 1H8EA 2D3NA 2QTZA 3AVTA 4G1BA 3VO1A 2GQFA 3B82A 3CCRB 2GREA 2XEXA 1YITB 2DY1A 1ZUNB 5IYNA 4FXUA 2PLFA 1W0JA 2ZXHA 4PABA 1VLOA 3G71B 3Q6RA 1RQPA 1DG1G 2CK3A 3ZZUA 4ACBA 1ZM9A 3OEHA 4OP7A 3ASTA 5B6IA 2R9VA 1E1RA 1IJEA 3LO8A 3A8JA 5F4OA 2DYIA 3ZIAA 1U2RA 1CNEA 3CESA 2QMUA 1G7CA 2ZBVA 4P3YA 5H5JA 3SJZA 4C43A 4ZGQB 1TVCA 1EP2B 4P2NA 4WZKA 2ZBUA 1YX2A 4XLAA 2P3MA 2WSSA 1B2RA 3OOCA 5HZBA 1E64A 1NB0A 4KKUA 2C4TA 4P22A 3ASPA 4XLCA 3CP8A 4AVZA 3VNUA 1WOOA 5GV7A 2C5BA 1ZM3A 2C5HA 1KZLA 2V4DA 2F43A 3HAGA 2B7CA 3U2QA 1EFCA 1Q86D 1MABA 3R6KA 3DDYA 3CCEB 4YELA 4B47A 3CMMA 2V7TA 1HA3A 1OHHA 2VNIA 1V0FA 4P6YA 1K8AD 2BSAA 2DOGA 1NBMA 4X7FA 5IYQA 4Z4RA 3OAAA 1ZM4A 3OP1A 2F4NA 1WU8A 1NDHA 2EFGA 1BLIA 1GO2A 3WYAA 2FX3A 4XLEA 1DARA 4TMZA 1EFUA 4G6IA 5A89A 2DEUA 4RD4A 4B3FX 4DNTB 2LZJA 5FNZA 2XZPA 2QN6A 1H42A 3QFCA 1YI2B 4OPOA 3WXMA 3WNDA 2VYQA 2OTLB 4WZLA 4DK1A 1WDTA 2CW5A 1FRQA 4XL9A 2DIEA 1KRHA 1G7TA 3T56B 2WYRA 4CQJA 1T6XA 3H9NA 4M1KA 4N3NA 4YEJA 3CRZA 4NCNA 1QUEA 4B44A 1F20A 1VQ5B 3ASQA 5IYPA 2VJIA 2ZZQA 1QG0A 2BPOA 1QVGB 1BX1A 2JN9A 4MYTA 4KKTA 1FX0A 3CC2B 1YJ9B 2JIZA 5TV2A 4ROXA 4ZCIA 1JA0A 2BGIA 3MHPA 5AN9A 1BJKA 1YLOA 2X3UA 1KMHA 3W5UA 3A8IA 5TY0A 1BMFA 3GSIA 2D9RA 3Q6QA 3CB4A 4P6VF 3D26A 2JDIA 2HDNB 3B78A 5THXA 3I55B 4II2A 4P26A 4YAWA 4X07A 3BH4A 3W2HA 1AIPA 2ZXIA 1WTHD 1WP6A 1R5NA 4XNFA 4QVJA 4X7CA 2V7VA 1EFRA 3OZWA 5HKKA 5E6TA 1A8PA 2ZL7A 3AGQA 1MRZA 1S72B 1KJZA 2W6IA 1G7RA 3ISXA 3CCUB 5DS0A 4YALA 2NPFA 1QFJA 3W2GA 1JNYA 4AF6A 3QSYA 3CC7B 2VBUA 1KC8D 5J35A 1UD6A 1PJ6A 4UAJA 2AHOA 3MMPA 1N07A 4Z1MA 3A3BA 3ZBUA 1PJ7A 4LBWA 2V31A 4XOPA 3G05A 3U6BA 4B3GA 3QFTA 1N08A 1YIJB 1WOPA 4OOSA 1SM4A 4XR6A 1Q81D 3QFSA 1K9MD 4QV2A 1VQ4B 4LBVA 2CBXA 3ZC3A 4Z4SA 1EP3B 3OW7A 3QFRA 2ZTNA 4Z4TA 3LVBA 2Q6IA 3CP2A 4RCYA 4DNRB 4LBYA 2ZZGA
chains in the Genus database with same CATH topology
3ZUGA 1N06A 2X0KA 1MRZA 1S4MA 1T6YA 2I1LA 1N05A 2VBSA 2VBTA 2VBVA 1NB9A 5A88A 2VBUA 1Q9SA 4UZEA 3CTAA 1N07A 5A8AA 3BNWA 1T6XA 3OP1A 1P4MA 2P3MA 5FO0A 1N08A 5TRDA 5A89A 1NB0A 4UZFA 1T6ZA 5FNZA 5FO1A 2OYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZUG A;  1N06 A;  2X0K A;  1MRZ A;  1S4M A;  1T6Y A;  2I1L A;  1N05 A;  2VBS A;  2VBT A;  2VBV A;  1NB9 A;  5A88 A;  2VBU A;  1Q9S A;  4UZE A;  3CTA A;  1N07 A;  5A8A A;  3BNW A;  1T6X A;  3OP1 A;  1P4M A;  2P3M A;  5FO0 A;  1N08 A;  5TRD A;  5A89 A;  1NB0 A;  4UZF A;  1T6Z A;  5FNZ A;  5FO1 A;  2OYN A; 
#chains in the Genus database with same CATH topology
 3I56 B;  1W87 A;  1N06 A;  1QFZ A;  1WSV A;  2KVO A;  3OEE A;  4PGO A;  1R5O A;  3W2I A;  1B23 P;  1XFO A;  3A1P A;  4XM3 A;  1E3X A;  1QUF A;  1KK1 A;  4HE6 A;  4M0L A;  3V76 A;  1CQX A;  4XON A;  4PC2 A;  1N0U A;  3FPK A;  2WJY A;  4XOT A;  3WNB A;  2GK7 A;  4TKO B;  1P4M A;  3PVD A;  4XLF A;  4C0S A;  1YJN B;  1JB9 A;  4DQK A;  3GVJ A;  3CW2 A;  1E3Z A;  2GK6 A;  4G1V A;  3A8K A;  5DSZ A;  3ES9 A;  3H94 A;  1EWY A;  2DCU A;  4IW3 B;  3U6K A;  4PC1 A;  2X0K A;  1H85 A;  2Q6K A;  2X6Y A;  4P9S A;  3I1F A;  2FVG A;  4G7W A;  1D2E A;  5A88 A;  2V7W A;  2Q6L A;  2D74 A;  4Y7C A;  3T53 B;  1TUI A;  3G6E B;  1E63 A;  3CTA A;  2C78 A;  3GQB A;  4RPB A;  4Z4V A;  1VQL B;  3BNW A;  2YWG A;  2NV4 A;  1UD4 A;  3MCA A;  4ZCL A;  1WOS A;  4L8J A;  5F4J A;  5JBQ A;  3GVL A;  2DER A;  4UZU A;  1H8H A;  4TN1 A;  3BC9 A;  3SKB A;  2QEX B;  2CF4 A;  5J3O A;  3LNN A;  1BX0 A;  2Q6O A;  4PC3 A;  4X06 A;  1S4M A;  3OFN A;  4E0F A;  1UMK A;  1N05 A;  3J81 k;  4OOV A;  3CCV B;  4Y9U A;  3FJO A;  1QH0 A;  2XND A;  5IYR A;  3T51 B;  1GR1 A;  1D8T A;  2BV3 A;  3W5H A;  2X53 S;  2OK8 A;  1IB0 A;  3A3G A;  3OE7 A;  4DQL A;  5HZA A;  1I7P A;  3JU4 A;  4Q7J B;  4YAU A;  3KL9 A;  1JA1 A;  1GAQ A;  3WQZ A;  4G5G A;  1QGZ A;  2GJP A;  3CME B;  1S0U A;  3SLD A;  3VO2 A;  4NBS A;  3CCM B;  2ZTG A;  3AVU A;  2V7X A;  2R6H A;  4LBZ A;  3E20 A;  5FL7 A;  1VQM B;  4B48 A;  1UD5 A;  3BY2 A;  1OB2 A;  1I8D A;  1RQR A;  1QFY A;  1N8R D;  1V0E A;  4RD6 A;  3SJP A;  1UD2 A;  4X8I A;  3ZPN A;  1DDG A;  1VLY A;  3G4S B;  2BM1 A;  1FDR A;  1VJS A;  3CD6 B;  2ZZF A;  3QE2 A;  2XZL A;  4UZE A;  1GVH A;  2VZL A;  2VNK A;  3FKS A;  4RD1 A;  3OJW A;  1E43 A;  3V7A A;  3ASS A;  5EMN A;  1Y0R A;  1PJ5 A;  4WWV A;  5FO0 A;  1FNB A;  3LQE A;  4XLH A;  1VQ8 B;  2BF4 A;  4PC6 A;  2VJJ A;  4TMW A;  4XMY A;  1F60 A;  2XNC A;  4B43 A;  4X7E A;  4OOX A;  3ZZ0 A;  3PA1 A;  1W9X A;  2VNH A;  1TLL A;  2OBT A;  3LQ6 A;  2BN4 A;  1E62 A;  1V5V A;  4RDK A;  5FIU A;  3WBK A;  2OBR A;  3JQR A;  4OPV A;  2XGJ A;  5F4M A;  4ACA A;  4P3I A;  3OPO A;  2OK7 A;  1OGI A;  2CND A;  2D3L A;  4M2L A;  4RD2 A;  3ZBT A;  1EFT A;  4YXW A;  1QGA A;  1K73 D;  4ZGN B;  1OB0 A;  4WZE A;  2WZP P;  1OB5 A;  4PC7 A;  3OW2 B;  3AVX A;  2DET A;  4KKS A;  1KTV A;  1M90 D;  3VNV A;  3NE5 B;  1FNC A;  4RDL A;  1T5E A;  4QUZ A;  1E1Q A;  4XD7 A;  5DN6 A;  2QA4 B;  1VQ9 B;  3OJX A;  4XKW A;  3AGP A;  2Z6B D;  2QGG A;  1FNM A;  4Z4Z A;  1KD1 D;  2WR8 A;  1EXM A;  4RLZ A;  1VHO A;  3P26 A;  5A8A A;  4FN5 A;  4HIZ A;  1OGJ A;  3PEN A;  1FND A;  2E1B A;  1N0V C;  3FPP A;  1KK0 A;  2QDX A;  4MYU A;  4RJL A;  4N3G A;  4TMV A;  1T6Z A;  1QVF B;  2E1R A;  2YWH A;  4ASU A;  3W2F A;  3BQJ A;  1QGY A;  2X6W A;  2HLD A;  1E79 A;  2I1L A;  3VMF A;  4AC9 A;  1GAW A;  1W35 A;  2VBS A;  3Q39 A;  4TSF A;  1TTT A;  3W2E A;  4F7D A;  1NJI D;  5FA6 A;  3JQP A;  4GQN A;  5L46 A;  4RCZ A;  1VF7 A;  3PUN A;  4NNJ A;  4Z4Y A;  4RD3 A;  2XOK A;  2C2W A;  4FK8 A;  4RPD A;  1W0K A;  3E1Y E;  1UD8 A;  3OKX A;  3SEJ A;  1GJR A;  2CC2 A;  2GJR A;  4J0Q A;  2VNJ A;  4YAF A;  1SKQ A;  1WPC A;  3VR6 A;  5BSY A;  3JQQ A;  3BCD A;  1BQE A;  1G7S A;  3CCS B;  3SLN A;  4XOR A;  3AVY A;  1WOR A;  2OTJ B;  4BPR A;  2RC5 A;  2EIX A;  2ZL6 A;  4X0C A;  2JJ1 A;  2HMA A;  4WQM A;  2V7U A;  4U9U A;  1KK3 A;  2X85 A;  4P1V A;  4EH1 A;  1UD3 A;  1VQ6 B;  2B7B A;  1VHE A;  4Y9R A;  2C4U A;  1XB2 A;  2X6X A;  1ZM2 A;  4ZCM A;  2B5O A;  2ZL5 A;  5KNL A;  4II3 A;  3Q38 A;  4P12 A;  4P25 A;  3RY8 A;  2YWE A;  2XNJ A;  1VQ7 B;  4JMQ A;  3WBJ A;  1VQN B;  1ELO A;  3B8H A;  5HXB A;  2OBS A;  1EP1 B;  5KW9 A;  3A35 A;  3BY1 A;  4M4S A;  1D1N A;  4OPS A;  1XE1 A;  1BPL A;  2RC6 A;  4Z4W A;  1SKY B;  5TR9 A;  5FO1 A;  3GIR A;  1CNF A;  2WPD A;  2W6J A;  3ZUG A;  1IHM A;  4TMX A;  3AVV A;  5KSW B;  3OZU A;  3OZV A;  1Q82 D;  5LMZ A;  2QTL A;  2C77 A;  1KQS B;  5IK2 A;  1R5B A;  1NB9 A;  2VBT A;  4RM0 A;  5GV8 A;  4XKV A;  2F1M A;  5IYW A;  1Q9S A;  4XN0 A;  3P27 A;  4QHY A;  4YHB A;  3GVK A;  1HVX A;  5TRD A;  4Z4U A;  1WSR A;  2WZN A;  1VQP B;  4DK0 A;  2GJK A;  2PIA A;  2JJ2 A;  5H59 A;  3CCL B;  1KK2 A;  3CCQ B;  1YJW B;  4UZF A;  3BCF A;  3R6J A;  1NRK A;  3KEW A;  1HZE A;  3CMA B;  1W34 A;  4K1X A;  2OYN A;  4QVA A;  1VQO B;  3CC4 B;  3W5V A;  4B3X A;  2J7K A;  2GPJ A;  2F1L A;  4TT3 A;  3PUM A;  4YAO A;  1W2B B;  2YWF A;  3ASR A;  3PA2 A;  2V7Q A;  3AVW A;  1J9Z A;  2PE3 A;  4H9G A;  2X8K A;  4R71 A;  4RDJ A;  1COW A;  2ZZE A;  2WJV A;  4HE5 A;  3Q3A A;  1IJF A;  4WZT A;  1DDI A;  4B4D A;  1I18 A;  1Y0Y A;  1QX4 A;  2QE7 A;  3CPX A;  2M5S A;  1VQK B;  4TMT A;  1JJ2 B;  3CPW B;  4RD0 A;  4XQF A;  4X05 A;  3WY9 A;  2XZO A;  2BGJ A;  4G7X A;  1Q7Y D;  2HCJ B;  3ZZT A;  1M1K D;  1PKV A;  4LC0 A;  2CRV A;  4AF7 A;  4X7D A;  1YHQ B;  2BVN A;  4M53 A;  1T6Y A;  1K28 D;  2ZIT A;  4XN3 A;  4FWT A;  5BSX A;  4QFM A;  2BM0 A;  2VBV A;  3CXC B;  2BMW A;  1XQB A;  3WNC A;  1AMO A;  1FRN A;  3ONU A;  3ONY A;  5CDF A;  3CCJ B;  4ZV4 A;  2PMD A;  4PAA A;  1H8E A;  2D3N A;  2QTZ A;  3AVT A;  4G1B A;  3VO1 A;  2GQF A;  3B82 A;  3CCR B;  2GRE A;  2XEX A;  1YIT B;  2DY1 A;  1ZUN B;  5IYN A;  4FXU A;  2PLF A;  1W0J A;  2ZXH A;  4PAB A;  1VLO A;  3G71 B;  3Q6R A;  1RQP A;  1DG1 G;  2CK3 A;  3ZZU A;  4ACB A;  1ZM9 A;  3OEH A;  4OP7 A;  3AST A;  5B6I A;  2R9V A;  1E1R A;  1IJE A;  3LO8 A;  3A8J A;  5F4O A;  2DYI A;  3ZIA A;  1U2R A;  1CNE A;  3CES A;  2QMU A;  1G7C A;  2ZBV A;  4P3Y A;  5H5J A;  3SJZ A;  4C43 A;  4ZGQ B;  1TVC A;  1EP2 B;  4P2N A;  4WZK A;  2ZBU A;  1YX2 A;  4XLA A;  2P3M A;  2WSS A;  1B2R A;  3OOC A;  5HZB A;  1E64 A;  1NB0 A;  4KKU A;  2C4T A;  4P22 A;  3ASP A;  4XLC A;  3CP8 A;  4AVZ A;  3VNU A;  1WOO A;  5GV7 A;  2C5B A;  1ZM3 A;  2C5H A;  1KZL A;  2V4D A;  2F43 A;  3HAG A;  2B7C A;  3U2Q A;  1EFC A;  1Q86 D;  1MAB A;  3R6K A;  3DDY A;  3CCE B;  4YEL A;  4B47 A;  3CMM A;  2V7T A;  1HA3 A;  1OHH A;  2VNI A;  1V0F A;  4P6Y A;  1K8A D;  2BSA A;  2DOG A;  1NBM A;  4X7F A;  5IYQ A;  4Z4R A;  3OAA A;  1ZM4 A;  3OP1 A;  2F4N A;  1WU8 A;  1NDH A;  2EFG A;  1BLI A;  1GO2 A;  3WYA A;  2FX3 A;  4XLE A;  1DAR A;  4TMZ A;  1EFU A;  4G6I A;  5A89 A;  2DEU A;  4RD4 A;  4B3F X;  4DNT B;  2LZJ A;  5FNZ A;  2XZP A;  2QN6 A;  1H42 A;  3QFC A;  1YI2 B;  4OPO A;  3WXM A;  3WND A;  2VYQ A;  2OTL B;  4WZL A;  4DK1 A;  1WDT A;  2CW5 A;  1FRQ A;  4XL9 A;  2DIE A;  1KRH A;  1G7T A;  3T56 B;  2WYR A;  4CQJ A;  1T6X A;  3H9N A;  4M1K A;  4N3N A;  4YEJ A;  3CRZ A;  4NCN A;  1QUE A;  4B44 A;  1F20 A;  1VQ5 B;  3ASQ A;  5IYP A;  2VJI A;  2ZZQ A;  1QG0 A;  2BPO A;  1QVG B;  1BX1 A;  2JN9 A;  4MYT A;  4KKT A;  1FX0 A;  3CC2 B;  1YJ9 B;  2JIZ A;  5TV2 A;  4ROX A;  4ZCI A;  1JA0 A;  2BGI A;  3MHP A;  5AN9 A;  1BJK A;  1YLO A;  2X3U A;  1KMH A;  3W5U A;  3A8I A;  5TY0 A;  1BMF A;  3GSI A;  2D9R A;  3Q6Q A;  3CB4 A;  4P6V F;  3D26 A;  2JDI A;  2HDN B;  3B78 A;  5THX A;  3I55 B;  4II2 A;  4P26 A;  4YAW A;  4X07 A;  3BH4 A;  3W2H A;  1AIP A;  2ZXI A;  1WTH D;  1WP6 A;  1R5N A;  4XNF A;  4QVJ A;  4X7C A;  2V7V A;  1EFR A;  3OZW A;  5HKK A;  5E6T A;  1A8P A;  2ZL7 A;  3AGQ A;  1MRZ A;  1S72 B;  1KJZ A;  2W6I A;  1G7R A;  3ISX A;  3CCU B;  5DS0 A;  4YAL A;  2NPF A;  1QFJ A;  3W2G A;  1JNY A;  4AF6 A;  3QSY A;  3CC7 B;  2VBU A;  1KC8 D;  5J35 A;  1UD6 A;  1PJ6 A;  4UAJ A;  2AHO A;  3MMP A;  1N07 A;  4Z1M A;  3A3B A;  3ZBU A;  1PJ7 A;  4LBW A;  2V31 A;  4XOP A;  3G05 A;  3U6B A;  4B3G A;  3QFT A;  1N08 A;  1YIJ B;  1WOP A;  4OOS A;  1SM4 A;  4XR6 A;  1Q81 D;  3QFS A;  1K9M D;  4QV2 A;  1VQ4 B;  4LBV A;  2CBX A;  3ZC3 A;  4Z4S A;  1EP3 B;  3OW7 A;  3QFR A;  2ZTN A;  4Z4T A;  3LVB A;  2Q6I A;  3CP2 A;  4RCY A;  4DNR B;  4LBY A;  2ZZG A; 
#chains in the Genus database with same CATH homology
 3ZUG A;  1N06 A;  2X0K A;  1MRZ A;  1S4M A;  1T6Y A;  2I1L A;  1N05 A;  2VBS A;  2VBT A;  2VBV A;  1NB9 A;  5A88 A;  2VBU A;  1Q9S A;  4UZE A;  3CTA A;  1N07 A;  5A8A A;  3BNW A;  1T6X A;  3OP1 A;  1P4M A;  2P3M A;  5FO0 A;  1N08 A;  5TRD A;  5A89 A;  1NB0 A;  4UZF A;  1T6Z A;  5FNZ A;  5FO1 A;  2OYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...