2VBUA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
131
structure length
131
Chain Sequence
VKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN KINASE
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
total genus 21
structure length 131
sequence length 131
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbuA01
1T6YA 1P4MA 1T6ZA 1N07A 1N05A 2VBVA 4UZFA 5FO1A 3OP1A 5FO0A 5TRDA 3ZUGA 5FNZA 5A88A 2VBSA 1N06A 1T6XA 2P3MA 1N08A 5A89A 2I1LA 1MRZA 2VBTA 4UZEA 2X0KA 1NB9A 2VBUA 3CTAA 1Q9SA 5A8AA 1NB0A 1S4MA 3BNWA 2OYNA
chains in the Genus database with same CATH superfamily
4XONA 1P4MA 5TY0A 2HCJB 1E62A 3ASTA 3BCDA 1VLOA 2EFGA 3SJPA 2VJJA 3ZBUA 1V5VA 1S0UA 1E1QA 3HAGA 1CNEA 4ASUA 2DIEA 1KK2A 1E1RA 4Q7JB 3OFNA 1BPLA 1QX4A 1K28D 2XOKA 3QFRA 1WOSA 1H8HA 2WZNA 4RDLA 1NBMA 2BM0A 2VJIA 3BY2A 1VQ4B 1HVXA 1I8DA 2VYQA 1VQ8B 1F20A 1BMFA 1XE1A 3ZPNA 2VNJA 1VQ5B 1QH0A 1HA3A 3V7AA 4Y9RA 2DY1A 1VQ6B 1WPCA 4UZFA 5IK2A 3CP2A 3PVDA 4XL9A 2FVGA 4P1VA 1VQPB 3QFTA 5GV8A 3PA1A 4Z4TA 4TMZA 1DARA 2V7QA 4RD4A 2CNDA 1PKVA 2NPFA 5AN9A 4XLHA 3OZVA 2XNCA 2ZZGA 4G6IA 1H8EA 1GAWA 3I55B 1IB0A 1WSRA 4ZV4A 2JJ1A 3PA2A 3CCUB 1N0UA 2Q6KA 1VQLB 2BPOA 5IYQA 4II2A 1E43A 4X8IA 1I18A 5J3OA 1KD1D 1E3XA 4TSFA 1OGIA 4FXUA 4XORA 3ONUA 2VBVA 4H9GA 3BH4A 1WU8A 3FJOA 3WBJA 3WNDA 5BSYA 1QFYA 1FNDA 3G05A 3GVKA 3Q3AA 4RDJA 2W6JA 5L46A 3BCFA 4OPOA 4TT3A 5KSWB 4PGOA 2XZLA 2VNKA 1EXMA 4BPRA 1J9ZA 2LZJA 4XN0A 4B48A 2FX3A 2HDNB 4PC1A 4NNJA 3WBKA 3WQZA 2C77A 2WZPP 3CPXA 1FNMA 2EIXA 5IYNA 2ZL6A 3A8JA 4X07A 1KZLA 1SM4A 2ZBVA 1S4MA 3BNWA 4N3GA 4NCNA 1QUFA 4P2NA 3FPPA 4MYUA 1VQMB 2X6WA 4Y7CA 2GREA 4F7DA 1VQNB 5THXA 3B78A 3GVJA 2CF4A 1QGAA 5CDFA 3ZZ0A 2CW5A 4OOSA 3PUMA 3BC9A 1KMHA 4RD2A 1OGJA 4FN5A 3CCVB 4ACBA 1T6XA 3CPWB 2KVOA 2BV3A 2V7WA 2PLFA 3A3BA 2WJYA 1BX0A 2QTZA 3ASQA 2I1LA 2Q6IA 1VHOA 4XLFA 3AVWA 2ZL5A 4LBVA 4UZUA 3ASRA 1PJ6A 5A88A 2OYNA 4M53A 3SKBA 4IW3B 4Y9UA 2WSSA 2B7BA 1G7RA 2ZITA 1NDHA 1YJWB 1UD3A 2HLDA 4PAAA 4WZTA 4G5GA 1EFCA 4XLAA 2QA4B 4WZKA 4HIZA 4OOXA 1VQOB 4YAFA 3BQJA 5H5JA 4B3GA 1UD6A 4DK0A 1UMKA 4AC9A 3W2FA 4Z4WA 1RQPA 2D9RA 5EMNA 1NB9A 3ASPA 2B7CA 1QFZA 2B5OA 1WORA 4Z1MA 2E1RA 1T6ZA 1YHQB 4RD3A 1EFUA 3WXMA 5DSZA 3KL9A 3AVXA 4ZCMA 2WR8A 1FDRA 1ELOA 1W87A 1WOPA 4FK8A 5B6IA 1KQSB 1PJ5A 1VQ9B 1D1NA 1KK0A 4AVZA 1WTHD 2QE7A 4B44A 3AVTA 2VBSA 4KKUA 4PC3A 2Z6BD 3CCEB 1U2RA 1KK1A 3OAAA 4DNTB 3CC7B 1Q7YD 3R6JA 1N8RD 2C2WA 3LVBA 1MRZA 1KK3A 4RD6A 5KW9A 1M1KD 2BGJA 4X0CA 3ZBTA 1WDTA 3CTAA 1JB9A 4J0QA 1NB0A 3A1PA 3CCLB 2QN6A 2RC6A 3WY9A 1Y0RA 3ISXA 1GVHA 4P6YA 1R5BA 1YITB 2C4TA 2V7VA 4XOTA 3QSYA 2GK7A 2C78A 1ZM9A 4RPBA 4ACAA 4X7DA 5TRDA 1S72B 1IJEA 4DK1A 1BX1A 1COWA 2BM1A 5HZBA 1YI2B 1B2RA 2ZZQA 1DDGA 1SKQA 3LO8A 2P3MA 4X7EA 3SLDA 1QGYA 2BMWA 2XZPA 4P25A 2ZZFA 4HE5A 1BLIA 4PC6A 3AVYA 2C5HA 2DOGA 2X6XA 4P26A 4RJLA 2BVNA 3B82A 3PENA 1H42A 4Z4ZA 1OB2A 4X7CA 1FRQA 1G7CA 4ZCIA 1T5EA 2NV4A 3CESA 3W5UA 2D74A 2F43A 4G1BA 3G4SB 2YWFA 4K1XA 1YIJB 4G1VA 4P3YA 4YAUA 4M2LA 3VMFA 1ZUNB 3Q39A 4U9UA 2ZL7A 3QE2A 1UD8A 3ZZTA 1TLLA 4WQMA 2XZOA 1K9MD 4QHYA 4QVJA 4C0SA 4P22A 4ROXA 1JNYA 2QDXA 2WYRA 4XKWA 1UD2A 4YEJA 2DYIA 4FWTA 3OKXA 1YJ9B 1W2BB 3Q6QA 2CRVA 1OB5A 4RPDA 4Z4SA 3WYAA 2VNIA 2ZTGA 1KJZA 3FKSA 4ZGQB 4LBYA 4P9SA 2JIZA 4QV2A 1VQKB 2OTLB 4OP7A 4UAJA 1E3ZA 3CC4B 4TMTA 5FA6A 1WSVA 2X53S 2F1MA 4R71A 5FO1A 1UD4A 1DDIA 4TMVA 4M0LA 3OP1A 5FO0A 1A8PA 2GK6A 5FNZA 1XB2A 4KKSA 1BJKA 4RCYA 3CCSB 1TVCA 2ZXHA 4OOVA 3AGQA 3SLNA 1Q81D 3A8KA 2DERA 1Y0YA 1ZM3A 3G71B 4PABA 1KC8D 4XQFA 2X8KA 4M1KA 3ZIAA 3LQ6A 3PUNA 2WPDA 5TR9A 1ZM2A 4RLZA 5FL7A 4TMWA 3Q38A 3ES9A 3VO2A 1W0KA 3CC2B 2XNJA 1HZEA 2DEUA 4B3XA 1W34A 4JMQA 2J7KA 4OPSA 3DDYA 3OZUA 4QFMA 4QUZA 5TV2A 2YWEA 1BQEA 4XLEA 2X6YA 2RC5A 4B4DA 5F4MA 5LMZA 4NBSA 1QVFB 3SEJA 3W2GA 3W2EA 4N3NA 1D2EA 3CW2A 3CD6B 4LC0A 2DETA 2JJ2A 2QGGA 1E64A 3AGPA 4XN3A 4XD7A 3ZC3A 3T56B 3Q6RA 1RQRA 3P26A 2V7TA 1YLOA 5JBQA 2QTLA 4Z4RA 2Q6LA 3U6BA 1VHEA 2QEXB 1N07A 3VNVA 1QUEA 1JA1A 3A35A 3BY1A 4HE6A 1Q82D 3WNCA 3AVUA 2JN9A 3OW7A 2C4UA 2XNDA 4LBWA 1GAQA 3OPOA 1OHHA 2M5SA 2JDIA 1N06A 2QMUA 3MCAA 5HZAA 3CCJB 3A3GA 1JJ2B 5FIUA 3JU4A 4QVAA 5GV7A 4Z4UA 2W6IA 5A89A 4EH1A 4Z4YA 4AF7A 2D3LA 4YAOA 3W5VA 3WNBA 3GQBA 3QFSA 5IYWA 1GR1A 3CMEB 4WZEA 2PIAA 1EP1B 3CCMB 4PC2A 4XR6A 4XMYA 3I1FA 1T6YA 1N0VC 1I7PA 2OBTA 4B47A 4RD0A 3E20A 1VF7A 2YWHA 3T51B 4RD1A 3GIRA 5E6TA 1FX0A 2R6HA 2ZXIA 4B43A 4OPVA 3OE7A 2CK3A 3ZUGA 2AHOA 2X85A 3T53B 4CQJA 4E0FA 3CRZA 3OOCA 2CC2A 4LBZA 1D8TA 4RM0A 4XM3A 2PE3A 3D26A 3ONYA 3V76A 1CQXA 1AMOA 3OJXA 2X0KA 2ZTNA 2CBXA 1W9XA 2ZBUA 5A8AA 3ASSA 4GQNA 1EFTA 3G6EB 2OK8A 4ZCLA 1R5OA 5DS0A 3RY8A 2YWGA 1XFOA 1WP6A 3MMPA 1B23P 1ZM4A 1YX2A 5H59A 5BSXA 4X05A 1W0JA 1G7SA 2GJPA 2OTJB 2E1BA 4YELA 3U6KA 4AF6A 1JA0A 2VNHA 2BGIA 3CCQB 4YALA 4PC7A 1N08A 1V0FA 3W2IA 5F4JA 1GO2A 1EFRA 1K8AD 2VZLA 1EP3B 2F1LA 4X7FA 2VBUA 1Q9SA 4G7XA 4Z4VA 1FNBA 1CNFA 5J35A 1FRNA 3W2HA 3CXCB 4M4SA 3QFCA 5IYRA 2BN4A 3P27A 2V7UA 4B3FX 1XQBA 4XOPA 2OK7A 2Q6OA 3GVLA 1VLYA 4P3IA 2WJVA 4RDKA 3VO1A 3VR6A 2GJRA 2OBSA 4P12A 1E63A 3JQPA 3CB4A 3MHPA 1MABA 2V4DA 5F4OA 3ZZUA 3B8HA 3E1YE 2D3NA 3SJZA 1VQ7B 2VBTA 4YHBA 3KEWA 1H85A 2XEXA 2R9VA 2GPJA 4X06A 5HXBA 2GQFA 4C43A 4TN1A 3H94A 3AVVA 4YAWA 3OEHA 3NE5B 1IHMA 1V0EA 4WWVA 4L8JA 5KNLA 4XNFA 1G7TA 1QGZA 1PJ7A 3CMMA 3JQQA 2HMAA 3W5HA 2PMDA 2GJKA 3CP8A 2X3UA 3I56B 1NRKA 3CMAB 4RCZA 3GSIA 2XGJA 3A8IA 1F60A 5IYPA 1QVGB 3FPKA 1W35A 1DG1G 3OJWA 2OBRA 3CCRB 1AIPA 1YJNB 3J81k 1SKYB 2C5BA 4UZEA 3U2QA 1K73D 1GJRA 4XKVA 4KKTA 1VJSA 2ZZEA 4DQLA 4DNRB 2BSAA 4DQKA 1Q86D 4WZLA 1NJID 3LQEA 1QG0A 2BF4A 1KTVA 1WOOA 1N05A 2F4NA 3OZWA 3VNUA 1UD5A 1R5NA 1E79A 3JQRA 4TKOB 4XLCA 1EP2B 4II3A 1TUIA 3H9NA 4MYTA 1OB0A 2DCUA 2V31A 1KRHA 3OEEA 2V7XA 4P6VF 5DN6A 3R6KA 4ZGNB 3OW2B 3LNNA 1EWYA 1FNCA 1QFJA 4YXWA 1TTTA 5HKKA 1M90D 4TMXA 1IJFA 4G7WA
chains in the Genus database with same CATH topology
1T6YA 1P4MA 1T6ZA 1N07A 1N05A 2VBVA 4UZFA 5FO1A 3OP1A 5FO0A 5TRDA 3ZUGA 5FNZA 5A88A 2VBSA 1N06A 1T6XA 2P3MA 1N08A 5A89A 2I1LA 1MRZA 2VBTA 4UZEA 2X0KA 1NB9A 2VBUA 3CTAA 1Q9SA 5A8AA 1NB0A 1S4MA 3BNWA 2OYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6Y A;  1P4M A;  1T6Z A;  1N07 A;  1N05 A;  2VBV A;  4UZF A;  5FO1 A;  3OP1 A;  5FO0 A;  5TRD A;  3ZUG A;  5FNZ A;  5A88 A;  2VBS A;  1N06 A;  1T6X A;  2P3M A;  1N08 A;  5A89 A;  2I1L A;  1MRZ A;  2VBT A;  4UZE A;  2X0K A;  1NB9 A;  2VBU A;  3CTA A;  1Q9S A;  5A8A A;  1NB0 A;  1S4M A;  3BNW A;  2OYN A; 
#chains in the Genus database with same CATH topology
 4XON A;  1P4M A;  5TY0 A;  2HCJ B;  1E62 A;  3AST A;  3BCD A;  1VLO A;  2EFG A;  3SJP A;  2VJJ A;  3ZBU A;  1V5V A;  1S0U A;  1E1Q A;  3HAG A;  1CNE A;  4ASU A;  2DIE A;  1KK2 A;  1E1R A;  4Q7J B;  3OFN A;  1BPL A;  1QX4 A;  1K28 D;  2XOK A;  3QFR A;  1WOS A;  1H8H A;  2WZN A;  4RDL A;  1NBM A;  2BM0 A;  2VJI A;  3BY2 A;  1VQ4 B;  1HVX A;  1I8D A;  2VYQ A;  1VQ8 B;  1F20 A;  1BMF A;  1XE1 A;  3ZPN A;  2VNJ A;  1VQ5 B;  1QH0 A;  1HA3 A;  3V7A A;  4Y9R A;  2DY1 A;  1VQ6 B;  1WPC A;  4UZF A;  5IK2 A;  3CP2 A;  3PVD A;  4XL9 A;  2FVG A;  4P1V A;  1VQP B;  3QFT A;  5GV8 A;  3PA1 A;  4Z4T A;  4TMZ A;  1DAR A;  2V7Q A;  4RD4 A;  2CND A;  1PKV A;  2NPF A;  5AN9 A;  4XLH A;  3OZV A;  2XNC A;  2ZZG A;  4G6I A;  1H8E A;  1GAW A;  3I55 B;  1IB0 A;  1WSR A;  4ZV4 A;  2JJ1 A;  3PA2 A;  3CCU B;  1N0U A;  2Q6K A;  1VQL B;  2BPO A;  5IYQ A;  4II2 A;  1E43 A;  4X8I A;  1I18 A;  5J3O A;  1KD1 D;  1E3X A;  4TSF A;  1OGI A;  4FXU A;  4XOR A;  3ONU A;  2VBV A;  4H9G A;  3BH4 A;  1WU8 A;  3FJO A;  3WBJ A;  3WND A;  5BSY A;  1QFY A;  1FND A;  3G05 A;  3GVK A;  3Q3A A;  4RDJ A;  2W6J A;  5L46 A;  3BCF A;  4OPO A;  4TT3 A;  5KSW B;  4PGO A;  2XZL A;  2VNK A;  1EXM A;  4BPR A;  1J9Z A;  2LZJ A;  4XN0 A;  4B48 A;  2FX3 A;  2HDN B;  4PC1 A;  4NNJ A;  3WBK A;  3WQZ A;  2C77 A;  2WZP P;  3CPX A;  1FNM A;  2EIX A;  5IYN A;  2ZL6 A;  3A8J A;  4X07 A;  1KZL A;  1SM4 A;  2ZBV A;  1S4M A;  3BNW A;  4N3G A;  4NCN A;  1QUF A;  4P2N A;  3FPP A;  4MYU A;  1VQM B;  2X6W A;  4Y7C A;  2GRE A;  4F7D A;  1VQN B;  5THX A;  3B78 A;  3GVJ A;  2CF4 A;  1QGA A;  5CDF A;  3ZZ0 A;  2CW5 A;  4OOS A;  3PUM A;  3BC9 A;  1KMH A;  4RD2 A;  1OGJ A;  4FN5 A;  3CCV B;  4ACB A;  1T6X A;  3CPW B;  2KVO A;  2BV3 A;  2V7W A;  2PLF A;  3A3B A;  2WJY A;  1BX0 A;  2QTZ A;  3ASQ A;  2I1L A;  2Q6I A;  1VHO A;  4XLF A;  3AVW A;  2ZL5 A;  4LBV A;  4UZU A;  3ASR A;  1PJ6 A;  5A88 A;  2OYN A;  4M53 A;  3SKB A;  4IW3 B;  4Y9U A;  2WSS A;  2B7B A;  1G7R A;  2ZIT A;  1NDH A;  1YJW B;  1UD3 A;  2HLD A;  4PAA A;  4WZT A;  4G5G A;  1EFC A;  4XLA A;  2QA4 B;  4WZK A;  4HIZ A;  4OOX A;  1VQO B;  4YAF A;  3BQJ A;  5H5J A;  4B3G A;  1UD6 A;  4DK0 A;  1UMK A;  4AC9 A;  3W2F A;  4Z4W A;  1RQP A;  2D9R A;  5EMN A;  1NB9 A;  3ASP A;  2B7C A;  1QFZ A;  2B5O A;  1WOR A;  4Z1M A;  2E1R A;  1T6Z A;  1YHQ B;  4RD3 A;  1EFU A;  3WXM A;  5DSZ A;  3KL9 A;  3AVX A;  4ZCM A;  2WR8 A;  1FDR A;  1ELO A;  1W87 A;  1WOP A;  4FK8 A;  5B6I A;  1KQS B;  1PJ5 A;  1VQ9 B;  1D1N A;  1KK0 A;  4AVZ A;  1WTH D;  2QE7 A;  4B44 A;  3AVT A;  2VBS A;  4KKU A;  4PC3 A;  2Z6B D;  3CCE B;  1U2R A;  1KK1 A;  3OAA A;  4DNT B;  3CC7 B;  1Q7Y D;  3R6J A;  1N8R D;  2C2W A;  3LVB A;  1MRZ A;  1KK3 A;  4RD6 A;  5KW9 A;  1M1K D;  2BGJ A;  4X0C A;  3ZBT A;  1WDT A;  3CTA A;  1JB9 A;  4J0Q A;  1NB0 A;  3A1P A;  3CCL B;  2QN6 A;  2RC6 A;  3WY9 A;  1Y0R A;  3ISX A;  1GVH A;  4P6Y A;  1R5B A;  1YIT B;  2C4T A;  2V7V A;  4XOT A;  3QSY A;  2GK7 A;  2C78 A;  1ZM9 A;  4RPB A;  4ACA A;  4X7D A;  5TRD A;  1S72 B;  1IJE A;  4DK1 A;  1BX1 A;  1COW A;  2BM1 A;  5HZB A;  1YI2 B;  1B2R A;  2ZZQ A;  1DDG A;  1SKQ A;  3LO8 A;  2P3M A;  4X7E A;  3SLD A;  1QGY A;  2BMW A;  2XZP A;  4P25 A;  2ZZF A;  4HE5 A;  1BLI A;  4PC6 A;  3AVY A;  2C5H A;  2DOG A;  2X6X A;  4P26 A;  4RJL A;  2BVN A;  3B82 A;  3PEN A;  1H42 A;  4Z4Z A;  1OB2 A;  4X7C A;  1FRQ A;  1G7C A;  4ZCI A;  1T5E A;  2NV4 A;  3CES A;  3W5U A;  2D74 A;  2F43 A;  4G1B A;  3G4S B;  2YWF A;  4K1X A;  1YIJ B;  4G1V A;  4P3Y A;  4YAU A;  4M2L A;  3VMF A;  1ZUN B;  3Q39 A;  4U9U A;  2ZL7 A;  3QE2 A;  1UD8 A;  3ZZT A;  1TLL A;  4WQM A;  2XZO A;  1K9M D;  4QHY A;  4QVJ A;  4C0S A;  4P22 A;  4ROX A;  1JNY A;  2QDX A;  2WYR A;  4XKW A;  1UD2 A;  4YEJ A;  2DYI A;  4FWT A;  3OKX A;  1YJ9 B;  1W2B B;  3Q6Q A;  2CRV A;  1OB5 A;  4RPD A;  4Z4S A;  3WYA A;  2VNI A;  2ZTG A;  1KJZ A;  3FKS A;  4ZGQ B;  4LBY A;  4P9S A;  2JIZ A;  4QV2 A;  1VQK B;  2OTL B;  4OP7 A;  4UAJ A;  1E3Z A;  3CC4 B;  4TMT A;  5FA6 A;  1WSV A;  2X53 S;  2F1M A;  4R71 A;  5FO1 A;  1UD4 A;  1DDI A;  4TMV A;  4M0L A;  3OP1 A;  5FO0 A;  1A8P A;  2GK6 A;  5FNZ A;  1XB2 A;  4KKS A;  1BJK A;  4RCY A;  3CCS B;  1TVC A;  2ZXH A;  4OOV A;  3AGQ A;  3SLN A;  1Q81 D;  3A8K A;  2DER A;  1Y0Y A;  1ZM3 A;  3G71 B;  4PAB A;  1KC8 D;  4XQF A;  2X8K A;  4M1K A;  3ZIA A;  3LQ6 A;  3PUN A;  2WPD A;  5TR9 A;  1ZM2 A;  4RLZ A;  5FL7 A;  4TMW A;  3Q38 A;  3ES9 A;  3VO2 A;  1W0K A;  3CC2 B;  2XNJ A;  1HZE A;  2DEU A;  4B3X A;  1W34 A;  4JMQ A;  2J7K A;  4OPS A;  3DDY A;  3OZU A;  4QFM A;  4QUZ A;  5TV2 A;  2YWE A;  1BQE A;  4XLE A;  2X6Y A;  2RC5 A;  4B4D A;  5F4M A;  5LMZ A;  4NBS A;  1QVF B;  3SEJ A;  3W2G A;  3W2E A;  4N3N A;  1D2E A;  3CW2 A;  3CD6 B;  4LC0 A;  2DET A;  2JJ2 A;  2QGG A;  1E64 A;  3AGP A;  4XN3 A;  4XD7 A;  3ZC3 A;  3T56 B;  3Q6R A;  1RQR A;  3P26 A;  2V7T A;  1YLO A;  5JBQ A;  2QTL A;  4Z4R A;  2Q6L A;  3U6B A;  1VHE A;  2QEX B;  1N07 A;  3VNV A;  1QUE A;  1JA1 A;  3A35 A;  3BY1 A;  4HE6 A;  1Q82 D;  3WNC A;  3AVU A;  2JN9 A;  3OW7 A;  2C4U A;  2XND A;  4LBW A;  1GAQ A;  3OPO A;  1OHH A;  2M5S A;  2JDI A;  1N06 A;  2QMU A;  3MCA A;  5HZA A;  3CCJ B;  3A3G A;  1JJ2 B;  5FIU A;  3JU4 A;  4QVA A;  5GV7 A;  4Z4U A;  2W6I A;  5A89 A;  4EH1 A;  4Z4Y A;  4AF7 A;  2D3L A;  4YAO A;  3W5V A;  3WNB A;  3GQB A;  3QFS A;  5IYW A;  1GR1 A;  3CME B;  4WZE A;  2PIA A;  1EP1 B;  3CCM B;  4PC2 A;  4XR6 A;  4XMY A;  3I1F A;  1T6Y A;  1N0V C;  1I7P A;  2OBT A;  4B47 A;  4RD0 A;  3E20 A;  1VF7 A;  2YWH A;  3T51 B;  4RD1 A;  3GIR A;  5E6T A;  1FX0 A;  2R6H A;  2ZXI A;  4B43 A;  4OPV A;  3OE7 A;  2CK3 A;  3ZUG A;  2AHO A;  2X85 A;  3T53 B;  4CQJ A;  4E0F A;  3CRZ A;  3OOC A;  2CC2 A;  4LBZ A;  1D8T A;  4RM0 A;  4XM3 A;  2PE3 A;  3D26 A;  3ONY A;  3V76 A;  1CQX A;  1AMO A;  3OJX A;  2X0K A;  2ZTN A;  2CBX A;  1W9X A;  2ZBU A;  5A8A A;  3ASS A;  4GQN A;  1EFT A;  3G6E B;  2OK8 A;  4ZCL A;  1R5O A;  5DS0 A;  3RY8 A;  2YWG A;  1XFO A;  1WP6 A;  3MMP A;  1B23 P;  1ZM4 A;  1YX2 A;  5H59 A;  5BSX A;  4X05 A;  1W0J A;  1G7S A;  2GJP A;  2OTJ B;  2E1B A;  4YEL A;  3U6K A;  4AF6 A;  1JA0 A;  2VNH A;  2BGI A;  3CCQ B;  4YAL A;  4PC7 A;  1N08 A;  1V0F A;  3W2I A;  5F4J A;  1GO2 A;  1EFR A;  1K8A D;  2VZL A;  1EP3 B;  2F1L A;  4X7F A;  2VBU A;  1Q9S A;  4G7X A;  4Z4V A;  1FNB A;  1CNF A;  5J35 A;  1FRN A;  3W2H A;  3CXC B;  4M4S A;  3QFC A;  5IYR A;  2BN4 A;  3P27 A;  2V7U A;  4B3F X;  1XQB A;  4XOP A;  2OK7 A;  2Q6O A;  3GVL A;  1VLY A;  4P3I A;  2WJV A;  4RDK A;  3VO1 A;  3VR6 A;  2GJR A;  2OBS A;  4P12 A;  1E63 A;  3JQP A;  3CB4 A;  3MHP A;  1MAB A;  2V4D A;  5F4O A;  3ZZU A;  3B8H A;  3E1Y E;  2D3N A;  3SJZ A;  1VQ7 B;  2VBT A;  4YHB A;  3KEW A;  1H85 A;  2XEX A;  2R9V A;  2GPJ A;  4X06 A;  5HXB A;  2GQF A;  4C43 A;  4TN1 A;  3H94 A;  3AVV A;  4YAW A;  3OEH A;  3NE5 B;  1IHM A;  1V0E A;  4WWV A;  4L8J A;  5KNL A;  4XNF A;  1G7T A;  1QGZ A;  1PJ7 A;  3CMM A;  3JQQ A;  2HMA A;  3W5H A;  2PMD A;  2GJK A;  3CP8 A;  2X3U A;  3I56 B;  1NRK A;  3CMA B;  4RCZ A;  3GSI A;  2XGJ A;  3A8I A;  1F60 A;  5IYP A;  1QVG B;  3FPK A;  1W35 A;  1DG1 G;  3OJW A;  2OBR A;  3CCR B;  1AIP A;  1YJN B;  3J81 k;  1SKY B;  2C5B A;  4UZE A;  3U2Q A;  1K73 D;  1GJR A;  4XKV A;  4KKT A;  1VJS A;  2ZZE A;  4DQL A;  4DNR B;  2BSA A;  4DQK A;  1Q86 D;  4WZL A;  1NJI D;  3LQE A;  1QG0 A;  2BF4 A;  1KTV A;  1WOO A;  1N05 A;  2F4N A;  3OZW A;  3VNU A;  1UD5 A;  1R5N A;  1E79 A;  3JQR A;  4TKO B;  4XLC A;  1EP2 B;  4II3 A;  1TUI A;  3H9N A;  4MYT A;  1OB0 A;  2DCU A;  2V31 A;  1KRH A;  3OEE A;  2V7X A;  4P6V F;  5DN6 A;  3R6K A;  4ZGN B;  3OW2 B;  3LNN A;  1EWY A;  1FNC A;  1QFJ A;  4YXW A;  1TTT A;  5HKK A;  1M90 D;  4TMX A;  1IJF A;  4G7W A; 
#chains in the Genus database with same CATH homology
 1T6Y A;  1P4M A;  1T6Z A;  1N07 A;  1N05 A;  2VBV A;  4UZF A;  5FO1 A;  3OP1 A;  5FO0 A;  5TRD A;  3ZUG A;  5FNZ A;  5A88 A;  2VBS A;  1N06 A;  1T6X A;  2P3M A;  1N08 A;  5A89 A;  2I1L A;  1MRZ A;  2VBT A;  4UZE A;  2X0K A;  1NB9 A;  2VBU A;  3CTA A;  1Q9S A;  5A8A A;  1NB0 A;  1S4M A;  3BNW A;  2OYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...