2VBUA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
131
structure length
131
Chain Sequence
VKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RIBOFLAVIN KINASE
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
total genus 21
structure length 131
sequence length 131
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbuA01
1NB0A 1N07A 2VBUA 1MRZA 4UZEA 2I1LA 2P3MA 2VBSA 1T6ZA 3CTAA 1N06A 1S4MA 5FNZA 2OYNA 3ZUGA 1Q9SA 3OP1A 4UZFA 5A88A 1NB9A 1P4MA 1T6XA 5A89A 1N08A 1T6YA 5TRDA 5FO0A 5FO1A 2VBVA 2X0KA 3BNWA 5A8AA 1N05A 2VBTA
chains in the Genus database with same CATH superfamily
1FRQA 2ZXIA 2VBUA 1JA1A 2ZZQA 4ASUA 3W2GA 1DDIA 4OP7A 1T6ZA 2JDIA 4Z1MA 1S4MA 1QFZA 1Q9SA 4QFMA 1RQPA 3ZZ0A 4G7XA 2LZJA 1H8EA 2F4NA 2XNJA 4KKSA 1N08A 1E64A 1QGZA 2F1LA 2GJRA 3CCLB 1NBMA 3VNUA 1IHMA 2XZPA 1JB9A 4YELA 3R6JA 2D9RA 3G6EB 3G71B 2ZL7A 3CMMA 3CD6B 3AVUA 3Q6QA 2B5OA 3CXCB 4P3YA 1S0UA 1QX4A 4Y9UA 1VHEA 3B78A 3CP2A 4OPOA 5HXBA 4DQKA 2V31A 1N07A 4RD3A 4LC0A 4UZEA 2J7KA 4PC2A 3FKSA 1H8HA 2P3MA 2VBSA 4MYUA 3V7AA 1F60A 1VJSA 3T56B 1VQNB 1OGIA 4UZUA 3OW2B 2AHOA 4ROXA 3LQEA 2Q6KA 2CC2A 5IK2A 4RD6A 4TMZA 2ZZEA 4FN5A 3WBKA 1AMOA 2WZNA 1CQXA 1BLIA 1OGJA 1YLOA 4G6IA 2OBRA 4WZLA 3SJZA 5F4MA 3W2FA 3CPXA 1VQMB 1DDGA 4XONA 1R5OA 2Q6IA 4ZCLA 1BJKA 4OOXA 4PGOA 5E6TA 3V76A 1WDTA 2XZLA 2D3LA 4G7WA 3DDYA 5H5JA 5TY0A 1PJ6A 3W2IA 3T51B 3BY1A 1KQSB 2WPDA 2JJ2A 3OEHA 4M2LA 2XNDA 4CQJA 2GREA 4ZGQB 1FNMA 2ZITA 4P9SA 1NB9A 4OOVA 4II3A 1S72B 1OB0A 1G7RA 3OW7A 3OEEA 1EWYA 4GQNA 1WOSA 2V7VA 1GO2A 2ZTGA 4QHYA 1UD4A 1EFUA 1FRNA 3ASSA 4PC3A 3RY8A 2X6XA 3SKBA 3PVDA 3CCVB 2WJVA 1OB2A 1Q81D 3PA2A 2DYIA 4N3GA 4XN3A 3WNCA 1R5NA 4OOSA 3G05A 5GV8A 5H59A 1E63A 3WNDA 4X7DA 1K73D 3OJWA 4MYTA 4NBSA 1ELOA 1E3ZA 2ZL6A 5LMZA 4P6VF 2DERA 4XKWA 4WWVA 1TVCA 1KRHA 3CPWB 1CNFA 1XE1A 2VNHA 2HLDA 2M5SA 1COWA 5TV2A 1YX2A 1W9XA 1VF7A 2BF4A 1VQPB 2GPJA 4LBZA 5AN9A 5DS0A 1Q7YD 4RD1A 1XB2A 2B7BA 3A3BA 1WORA 2ZL5A 4B43A 4P1VA 1MRZA 3OKXA 4RJLA 1BPLA 2BMWA 3ONUA 3G4SB 1JNYA 3MHPA 4RCYA 1VLYA 2DY1A 3WYAA 2ZZGA 1JJ2B 4E0FA 3VO2A 3CCEB 1T5EA 2BGIA 3OOCA 4PAAA 2WR8A 3OE7A 1YITB 4EH1A 3GIRA 3VMFA 1HA3A 3CCQB 1VQ5B 1I7PA 3Q3AA 2VBVA 1FNBA 1ZM4A 3B8HA 2EFGA 2JJ1A 1UD3A 1KTVA 3E1YE 4TMWA 4M4SA 2V4DA 2R9VA 3E20A 3LNNA 3FPKA 3ZBTA 4TKOB 2ZXHA 3CCSB 3JQQA 5J35A 1EP1B 5F4JA 1Q82D 2X6WA 1WSVA 1EFRA 5JBQA 2Q6LA 2PLFA 1IB0A 4B3GA 2XZOA 5DSZA 1E43A 3QFRA 2YWEA 1WTHD 4X8IA 4M53A 4R71A 1V5VA 3BH4A 1OB5A 1KMHA 1GAQA 1FX0A 2JIZA 4PC1A 4YALA 2VJJA 5TRDA 5THXA 4DQLA 1E1RA 3BNWA 4RCZA 5A8AA 3CW2A 1WU8A 2VBTA 3BCFA 3HAGA 2CW5A 1YHQB 4ZGNB 3SLNA 3P26A 3CC2B 1GJRA 3Q39A 4DNTB 1VLOA 1VQ6B 3BQJA 4TMTA 2NPFA 1SKYB 3ES9A 3ASQA 5FIUA 4II2A 2C78A 1JA0A 2EIXA 4YAFA 1W0JA 1IJFA 2OBSA 3VO1A 4AF6A 4K1XA 4XN0A 4X7FA 2NV4A 3A3GA 1N05A 4G1VA 4RD4A 2GQFA 2W6JA 4Z4WA 2E1RA 2GJKA 2D3NA 3NE5B 3BY2A 4LBYA 3CTAA 1KZLA 4RPDA 1KD1D 3OAAA 3OZUA 3OP1A 4ZCIA 4M1KA 3GVKA 4HE5A 2ZBVA 4WZEA 4DK1A 3PENA 1M90D 3QFTA 4XOPA 4DK0A 2V7TA 5L46A 1VQ7B 1EXMA 4UAJA 4RDKA 1UD2A 1QG0A 2FVGA 4AF7A 2PE3A 2VYQA 4TMXA 2YWHA 3ZZTA 2QE7A 1E62A 3I1FA 4DNRB 3OZWA 5KNLA 4PC7A 2X53S 1NDHA 2OK8A 1TLLA 4LBWA 4XLCA 1PJ7A 1EP3B 3CESA 5DN6A 2OTJB 5FNZA 2BM0A 5EMNA 1AIPA 1WOOA 4YAUA 3CC7B 1E3XA 4XLAA 4KKTA 4N3NA 1G7SA 1BX0A 4G1BA 4BPRA 1YJWB 2VZLA 2XEXA 1ZM9A 4M0LA 4ACAA 3J81k 1GAWA 1WOPA 2OBTA 1YI2B 1VQ9B 2QTZA 1UD5A 1W2BB 2GK6A 5FA6A 3LVBA 4WZTA 1Y0YA 2RC6A 4C43A 3AVTA 3AVWA 4U9UA 3CCJB 5IYQA 4TN1A 5KSWB 3PUNA 3A8IA 1YJ9B 2OYNA 3U6BA 2DEUA 1VQ8B 4Y7CA 4XD7A 3W5HA 1ZM2A 2CK3A 2VNJA 1QGAA 3OFNA 4UZFA 4YAOA 1P4MA 4AVZA 3LQ6A 5HKKA 4Z4VA 1HVXA 4Z4TA 1VQOB 1PJ5A 3SJPA 1J9ZA 4WQMA 4JMQA 5CDFA 3ASPA 3JU4A 4FK8A 2OTLB 1KK1A 1NJID 1VQ4B 1VQLB 2BV3A 4ACBA 3ZPNA 2X6YA 2ZTNA 1EFTA 2QTLA 3JQRA 2F1MA 1M1KD 2BSAA 2QN6A 4ZV4A 1GVHA 1W0KA 3ZC3A 4C0SA 2W6IA 2B7CA 1H42A 2XGJA 2C4TA 2BM1A 3WNBA 1QVFB 2D74A 3OPOA 1WSRA 4B47A 4OPSA 4QUZA 5HZBA 3Q38A 2V7WA 3R6KA 4FWTA 1YJNB 3LO8A 3AGQA 5A89A 4RD2A 2CF4A 5BSYA 1ZUNB 1T6YA 1I18A 2GK7A 4QVJA 5FO0A 2HCJB 1WP6A 4X7CA 1BMFA 3OZVA 1A8PA 1UMKA 3A8KA 3MCAA 1KK0A 1UD8A 4X07A 2BGJA 4QVAA 3U2QA 5TR9A 1KC8D 2WZPP 2I1LA 4OPVA 3ISXA 1FNDA 4FXUA 1OHHA 2PMDA 3W2HA 4P2NA 4RDJA 2HMAA 3W5UA 2WYRA 1Q86D 3ASRA 3ZIAA 5IYWA 3ASTA 1UD6A 3SLDA 3CRZA 2XNCA 3WQZA 1K8AD 1E1QA 1EP2B 2C5BA 2C4UA 2X85A 2DIEA 3QE2A 3KL9A 3PA1A 1K9MD 3WXMA 3A8JA 4XOTA 4XM3A 1XFOA 3OJXA 1G7TA 4P6YA 1N0VC 2VJIA 3CP8A 3SEJA 4YXWA 4XNFA 4P22A 3T53B 5BSXA 1YIJB 2FX3A 1D8TA 4ZCMA 3CCRB 4X7EA 3QFCA 1B23P 4Z4RA 2YWFA 1RQRA 3CC4B 1W35A 4XMYA 1QGYA 1W34A 2JN9A 2X8KA 3Q6RA 3W2EA 4Z4UA 1KK3A 1W87A 2QMUA 2WSSA 4IW3B 1HZEA 2F43A 4PC6A 4F7DA 5IYRA 2QA4B 1D1NA 1BX1A 3MMPA 4XKVA 2BPOA 2HDNB 3KEWA 5FO1A 1EFCA 4B4DA 1NRKA 3U6KA 2QGGA 3WY9A 2CRVA 2V7UA 4PABA 3GVLA 3PUMA 4RDLA 1V0EA 3GSIA 4P25A 4Z4YA 3WBJA 4XORA 3ZZUA 5B6IA 3GQBA 4TSFA 1I8DA 4XLFA 3QSYA 1VQKB 1FDRA 1TUIA 1N06A 4Z4SA 4XQFA 1BQEA 4XR6A 4RPBA 4H9GA 1IJEA 3AVVA 2BVNA 5A88A 3AVYA 4XLEA 3CMAB 3FJOA 1T6XA 4TT3A 1KK2A 1U2RA 2ZZFA 2Z6BD 4YHBA 4B48A 3QFSA 2XOKA 1SM4A 1TTTA 4G5GA 2X3UA 4NNJA 3I56B 2C5HA 2X0KA 3GVJA 2GJPA 5F4OA 4P12A 4X06A 1SKQA 1PKVA 1NB0A 2DOGA 2YWGA 4TMVA 5FL7A 5GV7A 3VR6A 1D2EA 1QFYA 3CB4A 2CBXA 3AVXA 3ONYA 2C2WA 3ZUGA 2VNKA 4P26A 4X0CA 1KJZA 3ZBUA 2DETA 4XL9A 3A1PA 4RLZA 1E79A 1QFJA 2KVOA 2CNDA 1QH0A 1R5BA 2V7QA 3H9NA 2E1BA 5IYPA 3CCMB 4QV2A 1QUFA 4B3FX 3P27A 4NCNA 4WZKA 4LBVA 1VHOA 3BC9A 4X05A 1GR1A 4Z4ZA 3VNVA 4Q7JB 3A35A 4YEJA 1CNEA 4AC9A 2BN4A 1DG1G 1MABA 1ZM3A 2OK7A 2DCUA 4KKUA 2QEXB 1G7CA 4HE6A 1N8RD 4J0QA 1B2RA 1Y0RA 3I55B 4B3XA 3BCDA 5IYNA 3CCUB 3CMEB 2QDXA 4HIZA 3W5VA 2RC5A 2C77A 1DARA 1K28D 4B44A 2WJYA 5HZAA 1WPCA 1V0FA 2ZBUA 5J3OA 3FPPA 1F20A 3D26A 4L8JA 3AGPA 1H85A 1FNCA 4RM0A 4YAWA 4Y9RA 4XLHA 1N0UA 2PIAA 2Q6OA 3H94A 3JQPA 1QVGB 2V7XA 1QUEA 4P3IA 5KW9A 4RD0A 1XQBA 2R6HA 3B82A 2VNIA
chains in the Genus database with same CATH topology
1NB0A 1N07A 2VBUA 1MRZA 4UZEA 2I1LA 2P3MA 2VBSA 1T6ZA 3CTAA 1N06A 1S4MA 5FNZA 2OYNA 3ZUGA 1Q9SA 3OP1A 4UZFA 5A88A 1NB9A 1P4MA 1T6XA 5A89A 1N08A 1T6YA 5TRDA 5FO0A 5FO1A 2VBVA 2X0KA 3BNWA 5A8AA 1N05A 2VBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB0 A;  1N07 A;  2VBU A;  1MRZ A;  4UZE A;  2I1L A;  2P3M A;  2VBS A;  1T6Z A;  3CTA A;  1N06 A;  1S4M A;  5FNZ A;  2OYN A;  3ZUG A;  1Q9S A;  3OP1 A;  4UZF A;  5A88 A;  1NB9 A;  1P4M A;  1T6X A;  5A89 A;  1N08 A;  1T6Y A;  5TRD A;  5FO0 A;  5FO1 A;  2VBV A;  2X0K A;  3BNW A;  5A8A A;  1N05 A;  2VBT A; 
#chains in the Genus database with same CATH topology
 1FRQ A;  2ZXI A;  2VBU A;  1JA1 A;  2ZZQ A;  4ASU A;  3W2G A;  1DDI A;  4OP7 A;  1T6Z A;  2JDI A;  4Z1M A;  1S4M A;  1QFZ A;  1Q9S A;  4QFM A;  1RQP A;  3ZZ0 A;  4G7X A;  2LZJ A;  1H8E A;  2F4N A;  2XNJ A;  4KKS A;  1N08 A;  1E64 A;  1QGZ A;  2F1L A;  2GJR A;  3CCL B;  1NBM A;  3VNU A;  1IHM A;  2XZP A;  1JB9 A;  4YEL A;  3R6J A;  2D9R A;  3G6E B;  3G71 B;  2ZL7 A;  3CMM A;  3CD6 B;  3AVU A;  3Q6Q A;  2B5O A;  3CXC B;  4P3Y A;  1S0U A;  1QX4 A;  4Y9U A;  1VHE A;  3B78 A;  3CP2 A;  4OPO A;  5HXB A;  4DQK A;  2V31 A;  1N07 A;  4RD3 A;  4LC0 A;  4UZE A;  2J7K A;  4PC2 A;  3FKS A;  1H8H A;  2P3M A;  2VBS A;  4MYU A;  3V7A A;  1F60 A;  1VJS A;  3T56 B;  1VQN B;  1OGI A;  4UZU A;  3OW2 B;  2AHO A;  4ROX A;  3LQE A;  2Q6K A;  2CC2 A;  5IK2 A;  4RD6 A;  4TMZ A;  2ZZE A;  4FN5 A;  3WBK A;  1AMO A;  2WZN A;  1CQX A;  1BLI A;  1OGJ A;  1YLO A;  4G6I A;  2OBR A;  4WZL A;  3SJZ A;  5F4M A;  3W2F A;  3CPX A;  1VQM B;  1DDG A;  4XON A;  1R5O A;  2Q6I A;  4ZCL A;  1BJK A;  4OOX A;  4PGO A;  5E6T A;  3V76 A;  1WDT A;  2XZL A;  2D3L A;  4G7W A;  3DDY A;  5H5J A;  5TY0 A;  1PJ6 A;  3W2I A;  3T51 B;  3BY1 A;  1KQS B;  2WPD A;  2JJ2 A;  3OEH A;  4M2L A;  2XND A;  4CQJ A;  2GRE A;  4ZGQ B;  1FNM A;  2ZIT A;  4P9S A;  1NB9 A;  4OOV A;  4II3 A;  1S72 B;  1OB0 A;  1G7R A;  3OW7 A;  3OEE A;  1EWY A;  4GQN A;  1WOS A;  2V7V A;  1GO2 A;  2ZTG A;  4QHY A;  1UD4 A;  1EFU A;  1FRN A;  3ASS A;  4PC3 A;  3RY8 A;  2X6X A;  3SKB A;  3PVD A;  3CCV B;  2WJV A;  1OB2 A;  1Q81 D;  3PA2 A;  2DYI A;  4N3G A;  4XN3 A;  3WNC A;  1R5N A;  4OOS A;  3G05 A;  5GV8 A;  5H59 A;  1E63 A;  3WND A;  4X7D A;  1K73 D;  3OJW A;  4MYT A;  4NBS A;  1ELO A;  1E3Z A;  2ZL6 A;  5LMZ A;  4P6V F;  2DER A;  4XKW A;  4WWV A;  1TVC A;  1KRH A;  3CPW B;  1CNF A;  1XE1 A;  2VNH A;  2HLD A;  2M5S A;  1COW A;  5TV2 A;  1YX2 A;  1W9X A;  1VF7 A;  2BF4 A;  1VQP B;  2GPJ A;  4LBZ A;  5AN9 A;  5DS0 A;  1Q7Y D;  4RD1 A;  1XB2 A;  2B7B A;  3A3B A;  1WOR A;  2ZL5 A;  4B43 A;  4P1V A;  1MRZ A;  3OKX A;  4RJL A;  1BPL A;  2BMW A;  3ONU A;  3G4S B;  1JNY A;  3MHP A;  4RCY A;  1VLY A;  2DY1 A;  3WYA A;  2ZZG A;  1JJ2 B;  4E0F A;  3VO2 A;  3CCE B;  1T5E A;  2BGI A;  3OOC A;  4PAA A;  2WR8 A;  3OE7 A;  1YIT B;  4EH1 A;  3GIR A;  3VMF A;  1HA3 A;  3CCQ B;  1VQ5 B;  1I7P A;  3Q3A A;  2VBV A;  1FNB A;  1ZM4 A;  3B8H A;  2EFG A;  2JJ1 A;  1UD3 A;  1KTV A;  3E1Y E;  4TMW A;  4M4S A;  2V4D A;  2R9V A;  3E20 A;  3LNN A;  3FPK A;  3ZBT A;  4TKO B;  2ZXH A;  3CCS B;  3JQQ A;  5J35 A;  1EP1 B;  5F4J A;  1Q82 D;  2X6W A;  1WSV A;  1EFR A;  5JBQ A;  2Q6L A;  2PLF A;  1IB0 A;  4B3G A;  2XZO A;  5DSZ A;  1E43 A;  3QFR A;  2YWE A;  1WTH D;  4X8I A;  4M53 A;  4R71 A;  1V5V A;  3BH4 A;  1OB5 A;  1KMH A;  1GAQ A;  1FX0 A;  2JIZ A;  4PC1 A;  4YAL A;  2VJJ A;  5TRD A;  5THX A;  4DQL A;  1E1R A;  3BNW A;  4RCZ A;  5A8A A;  3CW2 A;  1WU8 A;  2VBT A;  3BCF A;  3HAG A;  2CW5 A;  1YHQ B;  4ZGN B;  3SLN A;  3P26 A;  3CC2 B;  1GJR A;  3Q39 A;  4DNT B;  1VLO A;  1VQ6 B;  3BQJ A;  4TMT A;  2NPF A;  1SKY B;  3ES9 A;  3ASQ A;  5FIU A;  4II2 A;  2C78 A;  1JA0 A;  2EIX A;  4YAF A;  1W0J A;  1IJF A;  2OBS A;  3VO1 A;  4AF6 A;  4K1X A;  4XN0 A;  4X7F A;  2NV4 A;  3A3G A;  1N05 A;  4G1V A;  4RD4 A;  2GQF A;  2W6J A;  4Z4W A;  2E1R A;  2GJK A;  2D3N A;  3NE5 B;  3BY2 A;  4LBY A;  3CTA A;  1KZL A;  4RPD A;  1KD1 D;  3OAA A;  3OZU A;  3OP1 A;  4ZCI A;  4M1K A;  3GVK A;  4HE5 A;  2ZBV A;  4WZE A;  4DK1 A;  3PEN A;  1M90 D;  3QFT A;  4XOP A;  4DK0 A;  2V7T A;  5L46 A;  1VQ7 B;  1EXM A;  4UAJ A;  4RDK A;  1UD2 A;  1QG0 A;  2FVG A;  4AF7 A;  2PE3 A;  2VYQ A;  4TMX A;  2YWH A;  3ZZT A;  2QE7 A;  1E62 A;  3I1F A;  4DNR B;  3OZW A;  5KNL A;  4PC7 A;  2X53 S;  1NDH A;  2OK8 A;  1TLL A;  4LBW A;  4XLC A;  1PJ7 A;  1EP3 B;  3CES A;  5DN6 A;  2OTJ B;  5FNZ A;  2BM0 A;  5EMN A;  1AIP A;  1WOO A;  4YAU A;  3CC7 B;  1E3X A;  4XLA A;  4KKT A;  4N3N A;  1G7S A;  1BX0 A;  4G1B A;  4BPR A;  1YJW B;  2VZL A;  2XEX A;  1ZM9 A;  4M0L A;  4ACA A;  3J81 k;  1GAW A;  1WOP A;  2OBT A;  1YI2 B;  1VQ9 B;  2QTZ A;  1UD5 A;  1W2B B;  2GK6 A;  5FA6 A;  3LVB A;  4WZT A;  1Y0Y A;  2RC6 A;  4C43 A;  3AVT A;  3AVW A;  4U9U A;  3CCJ B;  5IYQ A;  4TN1 A;  5KSW B;  3PUN A;  3A8I A;  1YJ9 B;  2OYN A;  3U6B A;  2DEU A;  1VQ8 B;  4Y7C A;  4XD7 A;  3W5H A;  1ZM2 A;  2CK3 A;  2VNJ A;  1QGA A;  3OFN A;  4UZF A;  4YAO A;  1P4M A;  4AVZ A;  3LQ6 A;  5HKK A;  4Z4V A;  1HVX A;  4Z4T A;  1VQO B;  1PJ5 A;  3SJP A;  1J9Z A;  4WQM A;  4JMQ A;  5CDF A;  3ASP A;  3JU4 A;  4FK8 A;  2OTL B;  1KK1 A;  1NJI D;  1VQ4 B;  1VQL B;  2BV3 A;  4ACB A;  3ZPN A;  2X6Y A;  2ZTN A;  1EFT A;  2QTL A;  3JQR A;  2F1M A;  1M1K D;  2BSA A;  2QN6 A;  4ZV4 A;  1GVH A;  1W0K A;  3ZC3 A;  4C0S A;  2W6I A;  2B7C A;  1H42 A;  2XGJ A;  2C4T A;  2BM1 A;  3WNB A;  1QVF B;  2D74 A;  3OPO A;  1WSR A;  4B47 A;  4OPS A;  4QUZ A;  5HZB A;  3Q38 A;  2V7W A;  3R6K A;  4FWT A;  1YJN B;  3LO8 A;  3AGQ A;  5A89 A;  4RD2 A;  2CF4 A;  5BSY A;  1ZUN B;  1T6Y A;  1I18 A;  2GK7 A;  4QVJ A;  5FO0 A;  2HCJ B;  1WP6 A;  4X7C A;  1BMF A;  3OZV A;  1A8P A;  1UMK A;  3A8K A;  3MCA A;  1KK0 A;  1UD8 A;  4X07 A;  2BGJ A;  4QVA A;  3U2Q A;  5TR9 A;  1KC8 D;  2WZP P;  2I1L A;  4OPV A;  3ISX A;  1FND A;  4FXU A;  1OHH A;  2PMD A;  3W2H A;  4P2N A;  4RDJ A;  2HMA A;  3W5U A;  2WYR A;  1Q86 D;  3ASR A;  3ZIA A;  5IYW A;  3AST A;  1UD6 A;  3SLD A;  3CRZ A;  2XNC A;  3WQZ A;  1K8A D;  1E1Q A;  1EP2 B;  2C5B A;  2C4U A;  2X85 A;  2DIE A;  3QE2 A;  3KL9 A;  3PA1 A;  1K9M D;  3WXM A;  3A8J A;  4XOT A;  4XM3 A;  1XFO A;  3OJX A;  1G7T A;  4P6Y A;  1N0V C;  2VJI A;  3CP8 A;  3SEJ A;  4YXW A;  4XNF A;  4P22 A;  3T53 B;  5BSX A;  1YIJ B;  2FX3 A;  1D8T A;  4ZCM A;  3CCR B;  4X7E A;  3QFC A;  1B23 P;  4Z4R A;  2YWF A;  1RQR A;  3CC4 B;  1W35 A;  4XMY A;  1QGY A;  1W34 A;  2JN9 A;  2X8K A;  3Q6R A;  3W2E A;  4Z4U A;  1KK3 A;  1W87 A;  2QMU A;  2WSS A;  4IW3 B;  1HZE A;  2F43 A;  4PC6 A;  4F7D A;  5IYR A;  2QA4 B;  1D1N A;  1BX1 A;  3MMP A;  4XKV A;  2BPO A;  2HDN B;  3KEW A;  5FO1 A;  1EFC A;  4B4D A;  1NRK A;  3U6K A;  2QGG A;  3WY9 A;  2CRV A;  2V7U A;  4PAB A;  3GVL A;  3PUM A;  4RDL A;  1V0E A;  3GSI A;  4P25 A;  4Z4Y A;  3WBJ A;  4XOR A;  3ZZU A;  5B6I A;  3GQB A;  4TSF A;  1I8D A;  4XLF A;  3QSY A;  1VQK B;  1FDR A;  1TUI A;  1N06 A;  4Z4S A;  4XQF A;  1BQE A;  4XR6 A;  4RPB A;  4H9G A;  1IJE A;  3AVV A;  2BVN A;  5A88 A;  3AVY A;  4XLE A;  3CMA B;  3FJO A;  1T6X A;  4TT3 A;  1KK2 A;  1U2R A;  2ZZF A;  2Z6B D;  4YHB A;  4B48 A;  3QFS A;  2XOK A;  1SM4 A;  1TTT A;  4G5G A;  2X3U A;  4NNJ A;  3I56 B;  2C5H A;  2X0K A;  3GVJ A;  2GJP A;  5F4O A;  4P12 A;  4X06 A;  1SKQ A;  1PKV A;  1NB0 A;  2DOG A;  2YWG A;  4TMV A;  5FL7 A;  5GV7 A;  3VR6 A;  1D2E A;  1QFY A;  3CB4 A;  2CBX A;  3AVX A;  3ONY A;  2C2W A;  3ZUG A;  2VNK A;  4P26 A;  4X0C A;  1KJZ A;  3ZBU A;  2DET A;  4XL9 A;  3A1P A;  4RLZ A;  1E79 A;  1QFJ A;  2KVO A;  2CND A;  1QH0 A;  1R5B A;  2V7Q A;  3H9N A;  2E1B A;  5IYP A;  3CCM B;  4QV2 A;  1QUF A;  4B3F X;  3P27 A;  4NCN A;  4WZK A;  4LBV A;  1VHO A;  3BC9 A;  4X05 A;  1GR1 A;  4Z4Z A;  3VNV A;  4Q7J B;  3A35 A;  4YEJ A;  1CNE A;  4AC9 A;  2BN4 A;  1DG1 G;  1MAB A;  1ZM3 A;  2OK7 A;  2DCU A;  4KKU A;  2QEX B;  1G7C A;  4HE6 A;  1N8R D;  4J0Q A;  1B2R A;  1Y0R A;  3I55 B;  4B3X A;  3BCD A;  5IYN A;  3CCU B;  3CME B;  2QDX A;  4HIZ A;  3W5V A;  2RC5 A;  2C77 A;  1DAR A;  1K28 D;  4B44 A;  2WJY A;  5HZA A;  1WPC A;  1V0F A;  2ZBU A;  5J3O A;  3FPP A;  1F20 A;  3D26 A;  4L8J A;  3AGP A;  1H85 A;  1FNC A;  4RM0 A;  4YAW A;  4Y9R A;  4XLH A;  1N0U A;  2PIA A;  2Q6O A;  3H94 A;  3JQP A;  1QVG B;  2V7X A;  1QUE A;  4P3I A;  5KW9 A;  4RD0 A;  1XQB A;  2R6H A;  3B82 A;  2VNI A; 
#chains in the Genus database with same CATH homology
 1NB0 A;  1N07 A;  2VBU A;  1MRZ A;  4UZE A;  2I1L A;  2P3M A;  2VBS A;  1T6Z A;  3CTA A;  1N06 A;  1S4M A;  5FNZ A;  2OYN A;  3ZUG A;  1Q9S A;  3OP1 A;  4UZF A;  5A88 A;  1NB9 A;  1P4M A;  1T6X A;  5A89 A;  1N08 A;  1T6Y A;  5TRD A;  5FO0 A;  5FO1 A;  2VBV A;  2X0K A;  3BNW A;  5A8A A;  1N05 A;  2VBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...