2VBUA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
131
structure length
131
Chain Sequence
VKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
molecule keywords RIBOFLAVIN KINASE
total genus 21
structure length 131
sequence length 131
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbuA01
1Q9SA 1P4MA 5FO0A 1N08A 1MRZA 1N06A 2VBUA 1NB9A 2I1LA 1T6YA 4UZEA 1N07A 1T6ZA 1S4MA 4UZFA 1N05A 2VBTA 5A88A 5TRDA 5A8AA 3ZUGA 5FNZA 2P3MA 1NB0A 2VBVA 3BNWA 2OYNA 5FO1A 3CTAA 1T6XA 2VBSA 3OP1A 5A89A 2X0KA
chains in the Genus database with same CATH superfamily
4WWVA 2QGGA 1VQ8B 1OGJA 2R9VA 5GV8A 3MCAA 3BY1A 2M5SA 5B6IA 1VQ7B 2WR8A 3A1PA 3CB4A 5FO0A 3T53B 3LQEA 4RM0A 4WZKA 3BCDA 1Q81D 3OJWA 4NCNA 2DYIA 2BGIA 1T6YA 4ZCIA 4ACBA 4II3A 1S4MA 4P3IA 4X7DA 4XNFA 1ZM2A 4JMQA 2VJIA 1QGAA 2F43A 5JBQA 5FL7A 4U9UA 3GVLA 1D2EA 1VLOA 2ZXIA 3HAGA 1KMHA 1GR1A 3A3GA 3LNNA 2BGJA 2VJJA 1VQNB 2QE7A 2ZITA 4RPBA 2X8KA 2X85A 2NV4A 1VHOA 3WNDA 4X06A 1Y0RA 5LMZA 4UZEA 3BC9A 4PC1A 1W34A 2ZZEA 1VHEA 2CNDA 1WU8A 4RCZA 2BN4A 1V0FA 3W5VA 2XNJA 4QUZA 4Z4ZA 4M53A 4TMTA 1NB0A 3OE7A 4X7FA 5DS0A 4X7CA 1EFCA 1QFJA 3P27A 2WSSA 1JA1A 2X0KA 1BQEA 4M0LA 4Y9RA 5J35A 3OFNA 1MABA 4Y9UA 3SLNA 3W2HA 4G7XA 3CP8A 3CMMA 4N3GA 3ISXA 4OPVA 2VNIA 1IJEA 1G7RA 3FPPA 2W6JA 4G1BA 4C43A 2BPOA 2X6XA 4EH1A 1N07A 1T6ZA 3CCSB 3QFTA 1W35A 1FNMA 4P9SA 1Q86D 3WYAA 3OEHA 5A88A 2V7WA 4AC9A 4ASUA 2Q6OA 3CTAA 3QFSA 2V7TA 4AF7A 2BF4A 3GVKA 4XMYA 4WZEA 2FVGA 3LVBA 2V7VA 1WSRA 2ZBUA 5IK2A 4P3YA 4Z4TA 4B48A 3BCFA 3GVJA 1RQRA 3ONYA 1D8TA 2V7QA 4ACAA 1COWA 3OAAA 4XLEA 5F4JA 4DNRB 2CRVA 1MRZA 3CRZA 3ZZ0A 3H94A 1IJFA 1BX0A 2HLDA 2XGJA 4WZTA 1JB9A 2GREA 4MYTA 2OK8A 2WYRA 1E79A 1YX2A 3SEJA 1UD4A 4LBVA 2DOGA 3ASTA 4RDJA 1KC8D 2XZLA 3JQQA 1KK3A 3RY8A 1S72B 1R5OA 1QG0A 2VNJA 4X05A 3ZBTA 2CC2A 2I1LA 1KZLA 1FNBA 3SJZA 1KD1D 1Q82D 1K28D 4ZCLA 3SKBA 3V76A 1UMKA 1ZM3A 1ELOA 3JU4A 1D1NA 4YAWA 1S0UA 2CW5A 3AVWA 2Q6LA 1QVFB 4PC7A 3OW2B 1TTTA 3CCQB 3VNUA 2KVOA 3ASPA 2XZOA 3CPWB 1BX1A 3Q3AA 1OB0A 4YELA 1E64A 3AGPA 3GSIA 1N05A 4UZFA 5TY0A 1M90D 1UD5A 4YAUA 1W2BB 2YWHA 1U2RA 2V31A 4P2NA 4TMVA 1E62A 1VQLB 3CMEB 4ZGNB 2BM0A 5HKKA 4G1VA 2D3NA 3G6EB 1SKQA 4J0QA 2E1BA 3T51B 4Z4SA 3OPOA 3CCMB 1ZM4A 1YJWB 1QGZA 1R5BA 2D9RA 1W0KA 2C5HA 1BPLA 2GK7A 3BQJA 3VR6A 3Q6RA 1BMFA 3BY2A 3CMAB 4AVZA 4HE5A 3I55B 1KK1A 4FK8A 2F1LA 1VJSA 2Q6KA 4LBZA 4BPRA 1GJRA 2OYNA 3Q6QA 1Y0YA 4FWTA 1T5EA 2Q6IA 4B3GA 1BLIA 4N3NA 2PIAA 5F4MA 4WQMA 1E1QA 1UD2A 2ZL5A 2AHOA 4B47A 2ZTGA 3OEEA 2XOKA 3B78A 1FRQA 4MYUA 3CCUB 2HCJB 4XM3A 1N08A 4G7WA 4XLCA 4X07A 1FRNA 1G7SA 1I8DA 4XLAA 2E1RA 3QSYA 3CXCB 5GV7A 2WZPP 5BSYA 3G05A 3KEWA 3B82A 2DIEA 1KTVA 1UD3A 4Z4UA 1W9XA 3PUMA 4L8JA 4Z1MA 2C78A 1GVHA 4TSFA 4RD3A 5F4OA 2JN9A 2OTJB 3ASQA 3U6BA 5BSXA 3ZZTA 4RCYA 2ZZQA 1QX4A 4PC2A 1WOSA 3JQRA 3OZUA 1VQKB 4OOSA 3QFRA 2C2WA 4PC3A 3PENA 3A8IA 3V7AA 2XNDA 3T56B 2V7XA 2XNCA 2DERA 3ONUA 5H5JA 4NNJA 3OZWA 1B2RA 4DNTB 1NJID 4PAAA 5J3OA 4P22A 3R6KA 1E63A 4ZV4A 2VNHA 3FJOA 1XFOA 2Z6BD 2OTLB 4P1VA 3AVUA 3GIRA 1GO2A 1EWYA 1M1KD 4XLHA 2RC6A 1B23P 3CESA 3SJPA 2DETA 1YITB 2BSAA 1AMOA 1QFYA 5IYPA 2VBVA 1VQ5B 1PJ5A 2CK3A 2VNKA 3DDYA 1H8HA 4H9GA 1F20A 4UAJA 4DQKA 2WJYA 3GQBA 3W2EA 1VF7A 4AF6A 3ZIAA 2X6YA 3VO1A 4B3FX 2HMAA 4XKVA 3WBKA 1F60A 1SKYB 1NBMA 3U6KA 3CC7B 5HXBA 1N0VC 4M2LA 1V5VA 1N8RD 4ZGQB 2WJVA 2WZNA 1JJ2B 3I56B 1BJKA 2VBTA 1UD6A 1VQMB 3ZUGA 4Y7CA 2GK6A 4UZUA 1QUEA 2X6WA 2BMWA 3FPKA 4QVAA 4YEJA 3AVXA 2PLFA 2PMDA 3PUNA 3JQPA 1PJ7A 1VQ6B 1AIPA 2X3UA 4G6IA 4TN1A 4M1KA 2V4DA 4PABA 3A3BA 2BV3A 1WOPA 1E1RA 1OHHA 2V7UA 1EFUA 1SM4A 3B8HA 3WXMA 3W2GA 4RD6A 4Q7JB 3ZZUA 4B43A 2QEXB 3W5HA 3CCJB 2ZZFA 3OW7A 5FIUA 1KK0A 1CQXA 2XEXA 4OOVA 1YJ9B 4XQFA 1RQPA 1H85A 4ROXA 5KNLA 2ZTNA 3CPXA 3CCRB 3AVTA 1YJNB 5TRDA 2QDXA 5FNZA 1XB2A 4OPSA 2YWFA 3ZBUA 4QV2A 5IYQA 3I1FA 5IYWA 2VBSA 4E0FA 5EMNA 2X53S 4TMXA 4P12A 4DQLA 1K73D 2JJ1A 4QFMA 1NDHA 1WSVA 1QUFA 1WPCA 2JJ2A 4OOXA 3ASRA 3U2QA 1EP1B 3NE5B 4RD4A 3W2IA 1OB2A 3LQ6A 1GAQA 2DY1A 3CP2A 5DN6A 5TV2A 1QH0A 4LBYA 5IYNA 2W6IA 3A8JA 4YAOA 4FN5A 3MMPA 4WZLA 4DK0A 2OBTA 2WPDA 3OJXA 4OP7A 4B4DA 4RD2A 1YLOA 5AN9A 1KJZA 3G4SB 4ZCMA 4HE6A 3P26A 4P25A 1FNDA 4RD0A 3W5UA 1XQBA 5KSWB 2RC5A 1HVXA 1CNFA 2R6HA 1V0EA 5KW9A 4QHYA 4P6VF 4G5GA 4B3XA 4XLFA 1FNCA 1CNEA 5CDFA 1QFZA 3BH4A 3CC4B 3R6JA 2OK7A 1H8EA 1WDTA 2GJRA 3CW2A 2J7KA 4XOPA 1YIJB 1NRKA 1VQ9B 4XL9A 4Z4VA 1TLLA 2OBRA 5THXA 1WORA 2P3MA 2QN6A 5HZAA 2ZBVA 1PJ6A 1Q7YD 1T6XA 5A89A 1KK2A 1JA0A 3WBJA 4YALA 3VNVA 3FKSA 2HDNB 4K1XA 5HZBA 4X8IA 3WY9A 1P4MA 4XONA 1JNYA 4TKOB 4NBSA 4P26A 1N06A 4Z4YA 3CCLB 1YHQB 2PE3A 3OKXA 1WOOA 1DG1G 3AGQA 2C5BA 2GQFA 1EXMA 2ZZGA 1EP2B 1WP6A 1E3XA 3ES9A 1HZEA 2BM1A 3ZC3A 2QA4B 4TMZA 4X0CA 3CC2B 4YXWA 1I7PA 1W0JA 1UD8A 5TR9A 3QE2A 1FDRA 2F4NA 1KRHA 2XZPA 1EP3B 2DCUA 2JIZA 4GQNA 2FX3A 1FX0A 4XKWA 2EIXA 5FA6A 1OB5A 4Z4RA 1G7TA 4TT3A 3SLDA 1XE1A 1VLYA 3OZVA 1E3ZA 1OGIA 3MHPA 2GJPA 2VBUA 1NB9A 2YWGA 3WNCA 4RLZA 5L46A 1ZM9A 4XOTA 3QFCA 3ASSA 5DSZA 2GPJA 2OBSA 2YWEA 4B44A 1PKVA 2B7CA 4YAFA 4XORA 3BNWA 2VZLA 3E20A 4YHBA 3AVYA 4FXUA 1ZUNB 2CF4A 2QTZA 2C4UA 4C0SA 1QVGB 3PA2A 4LC0A 4XN3A 3KL9A 1A8PA 2GJKA 4OPOA 1R5NA 1N0UA 1WTHD 3Q38A 4DK1A 4XN0A 4RD1A 3OOCA 1Q9SA 3Q39A 4KKTA 3E1YE 1K9MD 1J9ZA 4PC6A 1I18A 4IW3B 1H42A 1DDIA 1GAWA 3PA1A 1QGYA 2C4TA 4Z4WA 2DEUA 4R71A 1IHMA 2VYQA 2D74A 2ZL7A 3A8KA 4CQJA 3H9NA 2LZJA 1E43A 4KKSA 4F7DA 1YI2B 3CD6B 4M4SA 4TMWA 3G71B 3WNBA 1TVCA 4HIZA 4RPDA 1HA3A 3WQZA 3LO8A 3OP1A 4X7EA 1DDGA 2BVNA 3PVDA 1DARA 1TUIA 4P6YA 4QVJA 3A35A 2C77A 4RJLA 1K8AD 2ZXHA 4II2A 1EFRA 1EFTA 4RDLA 4LBWA 3CCEB 1VQ4B 2D3LA 2B7BA 4XD7A 3VO2A 3CCVB 1VQPB 2QMUA 4PGOA 3D26A 4KKUA 2NPFA 3AVVA 5H59A 2CBXA 2F1MA 1G7CA 2EFGA 3VMFA 5A8AA 1VQOB 1KQSB 2B5OA 2ZL6A 5IYRA 1W87A 4XR6A 5FO1A 3ZPNA 2JDIA 1IB0A 3W2FA 3J81k 5E6TA 2QTLA 4RDKA
chains in the Genus database with same CATH topology
1Q9SA 1P4MA 5FO0A 1N08A 1MRZA 1N06A 2VBUA 1NB9A 2I1LA 1T6YA 4UZEA 1N07A 1T6ZA 1S4MA 4UZFA 1N05A 2VBTA 5A88A 5TRDA 5A8AA 3ZUGA 5FNZA 2P3MA 1NB0A 2VBVA 3BNWA 2OYNA 5FO1A 3CTAA 1T6XA 2VBSA 3OP1A 5A89A 2X0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9S A;  1P4M A;  5FO0 A;  1N08 A;  1MRZ A;  1N06 A;  2VBU A;  1NB9 A;  2I1L A;  1T6Y A;  4UZE A;  1N07 A;  1T6Z A;  1S4M A;  4UZF A;  1N05 A;  2VBT A;  5A88 A;  5TRD A;  5A8A A;  3ZUG A;  5FNZ A;  2P3M A;  1NB0 A;  2VBV A;  3BNW A;  2OYN A;  5FO1 A;  3CTA A;  1T6X A;  2VBS A;  3OP1 A;  5A89 A;  2X0K A; 
#chains in the Genus database with same CATH topology
 4WWV A;  2QGG A;  1VQ8 B;  1OGJ A;  2R9V A;  5GV8 A;  3MCA A;  3BY1 A;  2M5S A;  5B6I A;  1VQ7 B;  2WR8 A;  3A1P A;  3CB4 A;  5FO0 A;  3T53 B;  3LQE A;  4RM0 A;  4WZK A;  3BCD A;  1Q81 D;  3OJW A;  4NCN A;  2DYI A;  2BGI A;  1T6Y A;  4ZCI A;  4ACB A;  4II3 A;  1S4M A;  4P3I A;  4X7D A;  4XNF A;  1ZM2 A;  4JMQ A;  2VJI A;  1QGA A;  2F43 A;  5JBQ A;  5FL7 A;  4U9U A;  3GVL A;  1D2E A;  1VLO A;  2ZXI A;  3HAG A;  1KMH A;  1GR1 A;  3A3G A;  3LNN A;  2BGJ A;  2VJJ A;  1VQN B;  2QE7 A;  2ZIT A;  4RPB A;  2X8K A;  2X85 A;  2NV4 A;  1VHO A;  3WND A;  4X06 A;  1Y0R A;  5LMZ A;  4UZE A;  3BC9 A;  4PC1 A;  1W34 A;  2ZZE A;  1VHE A;  2CND A;  1WU8 A;  4RCZ A;  2BN4 A;  1V0F A;  3W5V A;  2XNJ A;  4QUZ A;  4Z4Z A;  4M53 A;  4TMT A;  1NB0 A;  3OE7 A;  4X7F A;  5DS0 A;  4X7C A;  1EFC A;  1QFJ A;  3P27 A;  2WSS A;  1JA1 A;  2X0K A;  1BQE A;  4M0L A;  4Y9R A;  5J35 A;  3OFN A;  1MAB A;  4Y9U A;  3SLN A;  3W2H A;  4G7X A;  3CP8 A;  3CMM A;  4N3G A;  3ISX A;  4OPV A;  2VNI A;  1IJE A;  1G7R A;  3FPP A;  2W6J A;  4G1B A;  4C43 A;  2BPO A;  2X6X A;  4EH1 A;  1N07 A;  1T6Z A;  3CCS B;  3QFT A;  1W35 A;  1FNM A;  4P9S A;  1Q86 D;  3WYA A;  3OEH A;  5A88 A;  2V7W A;  4AC9 A;  4ASU A;  2Q6O A;  3CTA A;  3QFS A;  2V7T A;  4AF7 A;  2BF4 A;  3GVK A;  4XMY A;  4WZE A;  2FVG A;  3LVB A;  2V7V A;  1WSR A;  2ZBU A;  5IK2 A;  4P3Y A;  4Z4T A;  4B48 A;  3BCF A;  3GVJ A;  1RQR A;  3ONY A;  1D8T A;  2V7Q A;  4ACA A;  1COW A;  3OAA A;  4XLE A;  5F4J A;  4DNR B;  2CRV A;  1MRZ A;  3CRZ A;  3ZZ0 A;  3H94 A;  1IJF A;  1BX0 A;  2HLD A;  2XGJ A;  4WZT A;  1JB9 A;  2GRE A;  4MYT A;  2OK8 A;  2WYR A;  1E79 A;  1YX2 A;  3SEJ A;  1UD4 A;  4LBV A;  2DOG A;  3AST A;  4RDJ A;  1KC8 D;  2XZL A;  3JQQ A;  1KK3 A;  3RY8 A;  1S72 B;  1R5O A;  1QG0 A;  2VNJ A;  4X05 A;  3ZBT A;  2CC2 A;  2I1L A;  1KZL A;  1FNB A;  3SJZ A;  1KD1 D;  1Q82 D;  1K28 D;  4ZCL A;  3SKB A;  3V76 A;  1UMK A;  1ZM3 A;  1ELO A;  3JU4 A;  1D1N A;  4YAW A;  1S0U A;  2CW5 A;  3AVW A;  2Q6L A;  1QVF B;  4PC7 A;  3OW2 B;  1TTT A;  3CCQ B;  3VNU A;  2KVO A;  3ASP A;  2XZO A;  3CPW B;  1BX1 A;  3Q3A A;  1OB0 A;  4YEL A;  1E64 A;  3AGP A;  3GSI A;  1N05 A;  4UZF A;  5TY0 A;  1M90 D;  1UD5 A;  4YAU A;  1W2B B;  2YWH A;  1U2R A;  2V31 A;  4P2N A;  4TMV A;  1E62 A;  1VQL B;  3CME B;  4ZGN B;  2BM0 A;  5HKK A;  4G1V A;  2D3N A;  3G6E B;  1SKQ A;  4J0Q A;  2E1B A;  3T51 B;  4Z4S A;  3OPO A;  3CCM B;  1ZM4 A;  1YJW B;  1QGZ A;  1R5B A;  2D9R A;  1W0K A;  2C5H A;  1BPL A;  2GK7 A;  3BQJ A;  3VR6 A;  3Q6R A;  1BMF A;  3BY2 A;  3CMA B;  4AVZ A;  4HE5 A;  3I55 B;  1KK1 A;  4FK8 A;  2F1L A;  1VJS A;  2Q6K A;  4LBZ A;  4BPR A;  1GJR A;  2OYN A;  3Q6Q A;  1Y0Y A;  4FWT A;  1T5E A;  2Q6I A;  4B3G A;  1BLI A;  4N3N A;  2PIA A;  5F4M A;  4WQM A;  1E1Q A;  1UD2 A;  2ZL5 A;  2AHO A;  4B47 A;  2ZTG A;  3OEE A;  2XOK A;  3B78 A;  1FRQ A;  4MYU A;  3CCU B;  2HCJ B;  4XM3 A;  1N08 A;  4G7W A;  4XLC A;  4X07 A;  1FRN A;  1G7S A;  1I8D A;  4XLA A;  2E1R A;  3QSY A;  3CXC B;  5GV7 A;  2WZP P;  5BSY A;  3G05 A;  3KEW A;  3B82 A;  2DIE A;  1KTV A;  1UD3 A;  4Z4U A;  1W9X A;  3PUM A;  4L8J A;  4Z1M A;  2C78 A;  1GVH A;  4TSF A;  4RD3 A;  5F4O A;  2JN9 A;  2OTJ B;  3ASQ A;  3U6B A;  5BSX A;  3ZZT A;  4RCY A;  2ZZQ A;  1QX4 A;  4PC2 A;  1WOS A;  3JQR A;  3OZU A;  1VQK B;  4OOS A;  3QFR A;  2C2W A;  4PC3 A;  3PEN A;  3A8I A;  3V7A A;  2XND A;  3T56 B;  2V7X A;  2XNC A;  2DER A;  3ONU A;  5H5J A;  4NNJ A;  3OZW A;  1B2R A;  4DNT B;  1NJI D;  4PAA A;  5J3O A;  4P22 A;  3R6K A;  1E63 A;  4ZV4 A;  2VNH A;  3FJO A;  1XFO A;  2Z6B D;  2OTL B;  4P1V A;  3AVU A;  3GIR A;  1GO2 A;  1EWY A;  1M1K D;  4XLH A;  2RC6 A;  1B23 P;  3CES A;  3SJP A;  2DET A;  1YIT B;  2BSA A;  1AMO A;  1QFY A;  5IYP A;  2VBV A;  1VQ5 B;  1PJ5 A;  2CK3 A;  2VNK A;  3DDY A;  1H8H A;  4H9G A;  1F20 A;  4UAJ A;  4DQK A;  2WJY A;  3GQB A;  3W2E A;  1VF7 A;  4AF6 A;  3ZIA A;  2X6Y A;  3VO1 A;  4B3F X;  2HMA A;  4XKV A;  3WBK A;  1F60 A;  1SKY B;  1NBM A;  3U6K A;  3CC7 B;  5HXB A;  1N0V C;  4M2L A;  1V5V A;  1N8R D;  4ZGQ B;  2WJV A;  2WZN A;  1JJ2 B;  3I56 B;  1BJK A;  2VBT A;  1UD6 A;  1VQM B;  3ZUG A;  4Y7C A;  2GK6 A;  4UZU A;  1QUE A;  2X6W A;  2BMW A;  3FPK A;  4QVA A;  4YEJ A;  3AVX A;  2PLF A;  2PMD A;  3PUN A;  3JQP A;  1PJ7 A;  1VQ6 B;  1AIP A;  2X3U A;  4G6I A;  4TN1 A;  4M1K A;  2V4D A;  4PAB A;  3A3B A;  2BV3 A;  1WOP A;  1E1R A;  1OHH A;  2V7U A;  1EFU A;  1SM4 A;  3B8H A;  3WXM A;  3W2G A;  4RD6 A;  4Q7J B;  3ZZU A;  4B43 A;  2QEX B;  3W5H A;  3CCJ B;  2ZZF A;  3OW7 A;  5FIU A;  1KK0 A;  1CQX A;  2XEX A;  4OOV A;  1YJ9 B;  4XQF A;  1RQP A;  1H85 A;  4ROX A;  5KNL A;  2ZTN A;  3CPX A;  3CCR B;  3AVT A;  1YJN B;  5TRD A;  2QDX A;  5FNZ A;  1XB2 A;  4OPS A;  2YWF A;  3ZBU A;  4QV2 A;  5IYQ A;  3I1F A;  5IYW A;  2VBS A;  4E0F A;  5EMN A;  2X53 S;  4TMX A;  4P12 A;  4DQL A;  1K73 D;  2JJ1 A;  4QFM A;  1NDH A;  1WSV A;  1QUF A;  1WPC A;  2JJ2 A;  4OOX A;  3ASR A;  3U2Q A;  1EP1 B;  3NE5 B;  4RD4 A;  3W2I A;  1OB2 A;  3LQ6 A;  1GAQ A;  2DY1 A;  3CP2 A;  5DN6 A;  5TV2 A;  1QH0 A;  4LBY A;  5IYN A;  2W6I A;  3A8J A;  4YAO A;  4FN5 A;  3MMP A;  4WZL A;  4DK0 A;  2OBT A;  2WPD A;  3OJX A;  4OP7 A;  4B4D A;  4RD2 A;  1YLO A;  5AN9 A;  1KJZ A;  3G4S B;  4ZCM A;  4HE6 A;  3P26 A;  4P25 A;  1FND A;  4RD0 A;  3W5U A;  1XQB A;  5KSW B;  2RC5 A;  1HVX A;  1CNF A;  2R6H A;  1V0E A;  5KW9 A;  4QHY A;  4P6V F;  4G5G A;  4B3X A;  4XLF A;  1FNC A;  1CNE A;  5CDF A;  1QFZ A;  3BH4 A;  3CC4 B;  3R6J A;  2OK7 A;  1H8E A;  1WDT A;  2GJR A;  3CW2 A;  2J7K A;  4XOP A;  1YIJ B;  1NRK A;  1VQ9 B;  4XL9 A;  4Z4V A;  1TLL A;  2OBR A;  5THX A;  1WOR A;  2P3M A;  2QN6 A;  5HZA A;  2ZBV A;  1PJ6 A;  1Q7Y D;  1T6X A;  5A89 A;  1KK2 A;  1JA0 A;  3WBJ A;  4YAL A;  3VNV A;  3FKS A;  2HDN B;  4K1X A;  5HZB A;  4X8I A;  3WY9 A;  1P4M A;  4XON A;  1JNY A;  4TKO B;  4NBS A;  4P26 A;  1N06 A;  4Z4Y A;  3CCL B;  1YHQ B;  2PE3 A;  3OKX A;  1WOO A;  1DG1 G;  3AGQ A;  2C5B A;  2GQF A;  1EXM A;  2ZZG A;  1EP2 B;  1WP6 A;  1E3X A;  3ES9 A;  1HZE A;  2BM1 A;  3ZC3 A;  2QA4 B;  4TMZ A;  4X0C A;  3CC2 B;  4YXW A;  1I7P A;  1W0J A;  1UD8 A;  5TR9 A;  3QE2 A;  1FDR A;  2F4N A;  1KRH A;  2XZP A;  1EP3 B;  2DCU A;  2JIZ A;  4GQN A;  2FX3 A;  1FX0 A;  4XKW A;  2EIX A;  5FA6 A;  1OB5 A;  4Z4R A;  1G7T A;  4TT3 A;  3SLD A;  1XE1 A;  1VLY A;  3OZV A;  1E3Z A;  1OGI A;  3MHP A;  2GJP A;  2VBU A;  1NB9 A;  2YWG A;  3WNC A;  4RLZ A;  5L46 A;  1ZM9 A;  4XOT A;  3QFC A;  3ASS A;  5DSZ A;  2GPJ A;  2OBS A;  2YWE A;  4B44 A;  1PKV A;  2B7C A;  4YAF A;  4XOR A;  3BNW A;  2VZL A;  3E20 A;  4YHB A;  3AVY A;  4FXU A;  1ZUN B;  2CF4 A;  2QTZ A;  2C4U A;  4C0S A;  1QVG B;  3PA2 A;  4LC0 A;  4XN3 A;  3KL9 A;  1A8P A;  2GJK A;  4OPO A;  1R5N A;  1N0U A;  1WTH D;  3Q38 A;  4DK1 A;  4XN0 A;  4RD1 A;  3OOC A;  1Q9S A;  3Q39 A;  4KKT A;  3E1Y E;  1K9M D;  1J9Z A;  4PC6 A;  1I18 A;  4IW3 B;  1H42 A;  1DDI A;  1GAW A;  3PA1 A;  1QGY A;  2C4T A;  4Z4W A;  2DEU A;  4R71 A;  1IHM A;  2VYQ A;  2D74 A;  2ZL7 A;  3A8K A;  4CQJ A;  3H9N A;  2LZJ A;  1E43 A;  4KKS A;  4F7D A;  1YI2 B;  3CD6 B;  4M4S A;  4TMW A;  3G71 B;  3WNB A;  1TVC A;  4HIZ A;  4RPD A;  1HA3 A;  3WQZ A;  3LO8 A;  3OP1 A;  4X7E A;  1DDG A;  2BVN A;  3PVD A;  1DAR A;  1TUI A;  4P6Y A;  4QVJ A;  3A35 A;  2C77 A;  4RJL A;  1K8A D;  2ZXH A;  4II2 A;  1EFR A;  1EFT A;  4RDL A;  4LBW A;  3CCE B;  1VQ4 B;  2D3L A;  2B7B A;  4XD7 A;  3VO2 A;  3CCV B;  1VQP B;  2QMU A;  4PGO A;  3D26 A;  4KKU A;  2NPF A;  3AVV A;  5H59 A;  2CBX A;  2F1M A;  1G7C A;  2EFG A;  3VMF A;  5A8A A;  1VQO B;  1KQS B;  2B5O A;  2ZL6 A;  5IYR A;  1W87 A;  4XR6 A;  5FO1 A;  3ZPN A;  2JDI A;  1IB0 A;  3W2F A;  3J81 k;  5E6T A;  2QTL A;  4RDK A; 
#chains in the Genus database with same CATH homology
 1Q9S A;  1P4M A;  5FO0 A;  1N08 A;  1MRZ A;  1N06 A;  2VBU A;  1NB9 A;  2I1L A;  1T6Y A;  4UZE A;  1N07 A;  1T6Z A;  1S4M A;  4UZF A;  1N05 A;  2VBT A;  5A88 A;  5TRD A;  5A8A A;  3ZUG A;  5FNZ A;  2P3M A;  1NB0 A;  2VBV A;  3BNW A;  2OYN A;  5FO1 A;  3CTA A;  1T6X A;  2VBS A;  3OP1 A;  5A89 A;  2X0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...