1KK2A

Structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdp-mg2+
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
405
structure length
396
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
molecule keywords eIF2gamma
total genus 97
structure length 396
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk2A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk2A01
2KBFA 1SXJC 2JJ8A 4LYHA 1II8B 5IK2D 2BDTA 3NXSA 5L3SB 5EP1A 3ZZTA 1ONBA 4B3XA 2OBNA 4O3MA 2IUSA 3ADKA 3FMPB 2ZI6A 1GFIA 4MA4A 4XIGS 3CCRB 1TF7A 3L0OA 3REFA 3QJYA 3NC0C 1HT1E 2QGZA 2WJGA 4FMBB 5FOTA 3GFOA 1QDEA 5H68A 2JLSA 3KFXA 3AP3A 4C3ZA 2YKGA 3O8BA 4DCNA 1XTSA 2RKOA 4C7OB 4HLUC 2B8TA 1FL9A 3EWSA 2RGAA 1YZLA 3LBNA 3UMFA 1W4CA 1M34E 1KIMA 1Z29A 2BBSA 3NTUA 2CVHA 3GPLA 2J87A 1IN4A 1YRBA 1XWIA 2GWHA 1KDTA 5IHPA 4JMPA 2BF4A 3AVYA 1G291 2DCUA 1P2SA 1ZRHA 1NBMA 2QE7D 4Q47A 5CYPA 4AWXA 1R0YA 2OLJA 3ZIAA 4D81A 821PA 4V03A 1N2CE 2D2FA 4PSAA 4RVCA 1T5IA 4F92B 1FMJA 2XNSA 3ZVMA 2RB4A 4UNRA 2QMUA 2XOKA 2ZE5A 4A2QA 2V7QD 3DHWC 2V1UA 3K0AB 1E9DA 1NN3A 3THXB 5JFGA 4NHOA 2GCOA 3OF5A 2HXSA 1GRRA 4DDTA 2GETA 2G9NA 1A5TA 4I1SA 5KPJA 3ZYCA 1YR8A 4ZDIA 2QA5A 1OT3A 1I2MA 1ZD9A 3KDSE 4D4LA 1P9WA 4NCIA 5D3MA 4Q9JA 2QA4B 2ZRAA 4HB4A 2WTUA 1ZM9A 3OW2B 1IXSB 3KJEA 4A2WA 4UXHA 4M0LA 4DUGA 1KHTA 2CNDA 4HLUA 2CHQA 4B73A 1OKKD 4V0ME 3OFND 1WMSA 3OAAA 5JJIA 2N1BA 3LLMA 4MRVA 5ANRB 2JGNA 1XXHB 4DIEA 3PR1A 2IXGA 1CJUC 3JZAA 2FZ4A 4PZLA 4Y0VA 1YZKA 5F2EA 3RRZA 1Z3IX 5JZVA 1KMHA 3B85A 1KRHA 3CONA 2DFTA 2Q3HA 3S1AA 4EKDA 3AV0B 2QM7A 2ZRLA 4E07A 3AP1A 3B82A 2GBLC 4Z1MA 2IYLD 2RHMA 1FRNA 4QOSA 4DLUA 3FFBA 1ZYUA 1OYWA 1ZINA 3CCMB 1XCPA 2EWWA 4IDPA 5TXGA 5KNBA 3LRPA 2NZ8A 2BPOA 4BRWA 2W2VA 3SS8A 3QKSA 4JLPA 1ZCBA 2EWVA 4IOKA 2QZ4A 1AIPA 1I4TD 5L3RA 3ZDQA 3QG1A 2QAJA 2IHBA 2BC9A 3CZPA 4QBGB 3RRNA 4YXWD 1GOTA 1JJ7A 4MKGA 5HXBA 3AVVA 2XEXA 2P5TB 3QBVA 2HF9A 4B2IA 4XWKA 1X3SA 1XTIA 3W2EA 3RS2A 1CKEA 2GCPA 2ANBA 2IA5A 1UEJA 3PUWA 5K8TA 1OSNA 3CMEB 1CTQA 1TU4A 2QMOA 2Z5FA 3AF2A 3BERA 1AK2A 4EQ6A 5BN3A 3MWYW 2RGCA 1ZU4A 1KI6A 5GJCA 4D25A 2GXUA 2X2EA 3DZDA 4DSTA 4EQ6B 3O8CA 1E6CA 2EYUA 3M4YA 4Q4HA 2D4HA 4S2EA 1E2GA 4KVGA 2CXXA 4MGZR 1KY2A 2IS2A 1BMFA 3BJIC 2AWOA 1TUEA 5H1YA 1IHUA 1GL9B 1UKZA 4DDUA 1I4DD 3OZWA 3VKWA 3WP0A 4NCHA 2JDID 3GLHA 5EXXA 3B6EA 4BASA 4A15A 5CIWA 4LHWA 4XVQA 4AI6A 3THYB 4V0MA 1UFQA 4PPFA 3R20A 1CR2A 2XXAA 2DEUA 2ZSFA 4KSBA 1E2IA 4IVRA 5J40A 1D9ZA 1OKKA 3W5JA 3LH5A 1W36B 1W4BA 2IYXA 2VBCA 5B64A 1VCNA 4JJKA 1FFHA 2QP3A 4YAOA 2OTLB 2YNMA 3MFYA 1UADA 2HEIA 1A2BA 2HJVA 3A1TA 1YJWB 3W3ZB 1QUFA 4A0FA 1FMLA 5FPSA 4YHBA 1AKEA 2ZS7A 1F2UB 1Z47A 4QG7A 4AF7A 4GFDA 4Q9KA 1JALA 3KJHA 4JL6A 1NMXA 2D62A 1Y63A 2IXFA 3CF2A 3N70A 4JVMA 5E7JA 3THYA 1Q44A 3EPJA 1NJID 1KSHA 4NTZA 2KSQA 2W6IA 4J0QA 2V1XA 4YDHB 2CHGA 3ZQ6A 4WAUA 5EXPA 4GZLA 1EGAA 4IDHA 5KSWB 3H2YA 1HTWA 2ZYVX 3NBYC 4W7SA 2HT6A 2JJ2A 1KNQA 2WKRA 2JLVA 2X3UA 1ELOA 4HEJA 4IRUB 2BEKA 2VRWA 2O8BA 3IUYA 3TK1A 2W00A 4NPHA 3MD0A 2FE4A 5JJLA 1DAGA 1RJ9B 2BEJA 2OEPA 3K9HA 3EW9A 3MLEA 1ZNXA 1UKVY 5JRJA 3K9NA 3N2IA 2ZM5A 2ZQ5A 4GNKA 4EAQA 1E2KA 3QFCA 2F43A 1QG2A 3B9QA 3H86A 1DELA 3CPHA 4L8GA 4DSOA 3RRMA 1FUKA 3NVAA 3L0SA 2P2LA 1Z07A 2RAPA 3IIJA 4BLTA 4PAOA 4ASUD 3GLHE 3K0FA 1ZVQA 3L43A 2JLXA 1E79D 4IOLA 2WBLC 4PHHA 1U0JA 4C7OA 2JIZD 3KFVA 3U3RA 4M1SA 3GLIA 1D9XA 4CW7A 3SFVA 1LVGA 2IYQA 4CEIB 2DB3A 4HAYA 4NYIR 4CT5A 5DIFA 4OK3A 5LD2B 2EFEB 2ZRDA 2F6RA 1LW7A 4HDCA 1LS6A 4OHXA 4Q19A 4HAWA 1GTVA 2ODNA 3I4LA 1TTTA 4LJ7A 1OYYA 1SXJE 2DERA 1R0XA 2G0NA 4PQFA 4KFTA 121PA 2HCBA 4PR0A 4JBXA 4OHYA 3ZVNA 4IOMA 4IJMA 5J4YA 4NYJR 1D8TA 4NBSA 4CIDA 2BGIA 1CIPA 1H8EA 2R6DA 1II0A 4JLDA 3RDPA 3K70D 3QFRA 3EZ9A 3QPUA 3CB4A 4XSGA 4ZIRB 3JQQA 2Z0MA 1KJZA 1U9IA 3B1ZA 2GVZC 2ZRPA 2ZVQX 2R9VA 2HT1A 4LHZA 2AL7A 5D3MB 2QPAA 1H85A 2WMOB 2F3RA 4PSKA 1O87A 3K0SA 2QRZA 1E9CA 4A36A 4P3YA 3AGPA 4US1R 2QENA 1GDDA 4JLJA 4ACBA 1M7HA 3IBGA 1G4UR 4X8HA 3TRFA 5LB4A 2NIPA 4PPQA 1VHTA 1E9RA 5EE3A 1YZNA 3EA5A 2FF7A 4D4JA 4OQFA 1OXSC 2FG5A 1CNEA 5JWOA 2NG1A 4G5GA 1MO4A 3EC1A 5CK5A 1VQOB 1ZIOA 3I56B 1IJFA 3QOFA 5K8IA 3Q72A 1TEVA 2A5DA 4A6XA 3BOSA 1CNFA 2ATVA 3CX7A 1YR6A 2QUZA 4KBGA 4G5SA 5KYKA 2QMEA 2YHSA 3NH6A 4O2RA 4AF6A 4B3CA 1W4AA 2ZANA 2HF8A 1N5IA 3A6PC 1JXOA 5IRCD 3HYRA 1NIJA 2FZLA 2BMEA 4DSNA 2JJ1D 2FOLA 2HYDA 1YZQA 1E9FA 3P20A 1ZMXA 3MSXA 3W8NA 2ZS8A 4PAQA 1II9A 1MT0A 3SNHA 2RGEA 4PO8A 1MRSA 3WYAA 1F6BA 2YJTD 3MG9A 4A8JA 1E2FA 1R0ZA 4G5OA 4KVAA 1V43A 2H8KA 4G5QA 4GOJA 1G8YA 3VR6A 4HLCA 3IBYA 4A8JC 1R0WA 1AS2A 3NEYA 3OEHD 5JMTA 1G5TA 3FHCB 5EQTA 5AUQA 4JLOA 1KZ7B 3OFNA 1S3GA 3DVLA 4TYYA 1JAIA 4CEJB 2DBYA 1F48A 1GRQA 1RJ9A 5EJEA 1CJKC 4Z8YA 5L3SA 1II8A 4OI2A 1W36C 3KJIA 3LD9A 5FBWB 1D1NA 2AXPA 4MKFA 4A92A 2W58A 3FKSD 3OJWA 2EFCB 1JJ2B 2CEAA 3P1JA 2OCBA 2FFQA 3T5GA 3G5UA 1GL6A 4HATA 5FTMA 4L15A 1E98A 1FQKA 3IHWA 3RS3A 2Z83A 3MMPA 1KK0A 1F5NA 4P4SB 5JECA 4LX0A 1AS0A 1T4GA 5LDDC 1RRFA 2WVJA 1EFHA 1NVXQ 2GF9A 2OSBA 3C8UA 4IFBA 2GILA 1XPRA 4DCUA 2D7DA 4LBWA 4QC2A 2IWRA 2ZJYA 5P21A 2ODEA 4XOIA 3TE6A 1SVOA 3W5VA 2AR7A 1NSTA 2ERYA 2RH5A 1BOFA 2VO1A 3D6TB 4M22A 4U00A 4V0NA 4TMWA 4QFMA 2DETA 1NJGA 4ZGQB 2OCAA 2BSAA 3PV0A 2GJKA 2CCJA 1W4RA 2QDXA 5GVRA 2YC4C 1E2QA 3KKPA 4XVRA 1PVOA 4LCBA 3VFDA 1JNYA 2FEOA 4NYIQ 4EPWA 721PA 1NL3A 1XFAA 2FGJA 2DWOA 2XXAB 1HA3A 1R8QA 2GJ9A 1YVDA 2OO7A 3I73A 1RE0A 2RHDA 4AKHA 3BH7A 5JCPA 3GLGB 1XEXB 4OL0A 2J41A 1AJEA 1X1SA 4PC2A 2OT3B 3AUYA 4HZUA 2GF0A 1KO8A 4Q4LA 3Q5EA 2H7VA 4YAUA 3SJCA 2PEZA 1XJQA 2P6UA 2C8VA 1Q7YD 4RZ3A 4LV5B 4DCTA 2IYUA 4IW3B 1P73A 3TBKA 1P2TA 1Z08A 4MKIA 4TYNA 1E99A 4JL5A 3BK7A 3VO2A 3ZZUA 1CU1A 4A6PA 3I1FA 4FINA 5EMNA 4Z8XA 5FOUA 2QBYB 1K5GA 4UNPA 4OI4A 1IJEA 3WBJA 1P4SA 2KWIA 5CIQA 3UG7A 4A4DA 5J47A 1CJTC 2V7QA 5FPHA 1MKYA 3DM5A 4QGFA 1FP7A 3BH0A 2IYTA 2V55B 2WWGA 3HPQA 2GEUA 3SQWA 3LVBA 1WB9A 4GDFA 1G7SA 1QFJA 2NTYC 3GEEA 2F1RA 1XB2A 3PENA 1XTKA 2JA1A 2QQEA 4TSFD 3UG6A 3NBXX 3NHAA 1Q86D 5LBIA 2GZHA 4KYUA 1LF5A 2NMVA 2QP9X 3GLFA 1A2KC 5AJXA 1TX4B 1E1QA 2FDCA 1ZU5A 2X8AA 2EIXA 1XP8A 5L3QB 2FFBA 1VDZA 2NPFA 3SYKA 3NHBA 1N6HA 3AM1A 1W0KD 2GBLA 3PQCA 4LHXA 4M9SA 2H16A 2PLRA 2QTVB 3MWLA 3RANA 5TMPA 4JJZA 4CEHB 1MOZA 2W2TA 2CJWB 4LBZA 2OXCA 3RS4A 3T15A 1K8RA 1ZNYA 2ZJBA 4ARZA 3G71B 3TR0A 5HKKA 2W6JA 1NY5A 1GO2A 3TUJC 4Q4AB 2XX3A 1OFTA 1MV5A 4TTPA 1UPTA 4FCVA 3TQFA 1L4YA 1Q20A 4AKEA 4DLXA 2XJ4A 1RC8A 1XEFA 4QNMA 4YALA 2C78A 1NMZA 5DH9A 5FUXA 1S9HA 2WAXA 5AWFC 1VQ4B 3D3QA 1RIFA 3I8XA 1DS6A 3LXXA 4ZI3A 4M4SA 1IXZA 1TEXA 2XOKD 1SXJA 2CNWD 3BGWA 3QUSA 4R7ZA 4M9ZA 2WIAA 2QAGC 2WICA 4FN5A 4F7DA 3ZVLA 4D0NA 4A2PA 3TNFA 1ZIPA 1KO5A 1XF9A 3D31A 3U4QB 1M90D 2DPXA 1U2RA 1ANKA 5G40A 3CCQB 1K73D 2PT5A 1ZD1A 4QGGA 3GLIE 4DSUA 2JATA 3A8TA 4TN1A 4FIDA 1U0LA 4B76A 3SJAA 5KTYA 4NONA 1OB2A 1E2PA 4B35A 2GCOB 1LFDB 5HCNA 1QUEA 3K0AA 4HYYA 1G3MA 3DMNA 3THXA 4HB0A 2V3CC 5KSYA 4GL2A 2YWEA 5GV8A 4IXMA 3BE4A 4TQ9A 1Q1ZA 1ETUA 1JR6A 3OAAD 2ZR7A 3QY0A 3HU3A 4BFZA 1DAHA 3EASA 4E03A 1G3RA 2XSZA 3D8BA 4US0R 2R6FA 1E0AA 4M21A 1EG7A 4OQNA 1OIWA 1M7GA 1OH5A 4V0LA 1EX7A 4ON9A 1F60A 3HP1A 1N3BA 1KK2A 1KSFX 1VYVA 1SHKA 3CIOA 3GQBA 2IX3A 1OH8A 1M2OB 4PAMA 2FGKA 2ZXUA 2IS6A 1GAQA 2ZJ5A 1VYTA 2CCGA 3QXCA 5JEDA 4WZAE 2A2ZA 2BKUA 3L82B 2ZUBA 3T06B 3B1VA 2ZI7A 3EZFA 3LQQA 2J0UA 4O2LA 4DCSA 4DT1A 4GRAA 4PZZA 4B74A 2WKPA 3M6AA 4CT4B 3Q7QA 3AVTA 1GUAA 3Q85A 1N6NA 3VMFA 1VCMA 3MWKA 5FBVB 4C0KA 2QE7A 5IK2A 4IOJA 4EJSB 2IUTA 2GJAA 1Z2CA 1YR7A 1R8SA 1H65A 2NO1A 1JR3A 1MR3F 1CJMA 2A7QA 4Q02A 2RCNA 1FPMA 4U02A 2V9PA 5EE1A 5KSPA 4TYQA 2Q0HA 3SE0A 2C9OA 4B71A 2VSOA 1ZBDA 5FI0B 3TVTA 3EXAA 5EP3A 3I92A 1CR1A 4LJAA 2QY9A 2W2XA 1U8AA 3P27A 5K8LA 1CEEA 4NCNA 1S3SA 1YJ9B 4PPGA 2XNDA 1E2MA 2WPDA 5HZKA 2DFNA 3BRWD 4JKIA 3RSLA 1IY0A 3VR4A 1UBFA 5KDOA 5EP4A 2RGGA 4PZYA 3B5JA 4B3BA 1Z0JA 4HZUB 3I5XA 4CYMA 3A37A 4H1UA 4GZMA 1ZAKA 4TLBA 5A5GA 2OK7A 3U3MA 2GVDC 2YV5A 3LO5A 5JJKA 4D26A 1QVGB 5JSZA 1G19A 1OV4A 3CF0A 4PFSA 4WVFA 5HCIA 1GR1A 2CLSA 4HAUA 3ZS9A 4LGMA 3F8TA 5B30A 3I3SR 2VIIA 1JA1A 4Q7LA 2KJQA 2QMHA 1DAIA 1KDPA 3R7WB 4ZI2A 1YKSA 1QGZA 1N6PA 2JCSA 3TMKA 1PZNA 2VP2A 3I62A 4TL8A 4RKFA 4EFMA 4AKGA 1QHHB 1KYIA 4RD3A 1U8ZA 4OYHA 2VHUA 3ZC3A 3T5DA 4B32A 2O8FB 1C1YA 3PG5A 1M7BA 2CNWA 4BUJA 4RD2A 3ICEA 2JJ2D 4MH0R 4XH9B 1EFRD 4DXAA 4N3GA 2C9YA 2WWHA 4O0MA 3A36A 1FOEB 1AMOA 1VG8A 2QQ0A 2IXEA 2F1IA 3PEUA 4KU4A 4D0GA 4Q9HA 3WMEA 3THWB 4QHSA 4TMVA 3MRSA 2GZAA 4URUR 2EW1A 2PL3A 1NVUQ 3IEVA 4LPSA 1IOZA 1J90A 3FWYA 2RC6A 3C4JA 1CRQA 3ADBA 4PQRA 4ZKDA 1Q57A 1YR9A 3IIKA 4TZ6A 1D2MA 4C43A 2VNJA 4D6PA 2JLWA 4YDSA 2CLDX 3A4MA 3EWAA 3WRXC 2ZRHA 3VR2A 3QEOA 2GKSA 2I1VB 2RC5A 3H1TA 1NF3A 1BJKA 1LS1A 4TLDA 2BKEA 2O5VA 3TLXA 4CEJA 4G1BA 2Q6TA 2GAOA 3NEJA 1OFIA 1PUJA 4URWR 3WRYC 3RC8A 3Q3JB 4JVNA 4TMKA 1H8ED 4BFYA 2OXRA 4LJYA 2R2AA 2JLZA 1W47A 2G83A 3U7EB 2IS1A 3VR5A 5AJYA 2E87A 3Q7PA 4P32A 1QFYA 3CM0A 1VHLA 2GRJA 4XJXA 5CDFE 2ORVA 3AVWA 1SM4A 1OHHA 3EZ7A 4R2HA 4LDJA 2O0KA 1PJRA 3QSYA 1VYUA 3CNNA 2FJUA 2VQSA 3CRQA 4RFVA 1MRNA 5BW8A 3ONWA 4LJ9A 5KDDA 2WPDD 421PA 4RD6A 3LXRA 1GIAA 2FH5B 2VHTA 3C5CA 2ZU0C 1G3UA 2WV9A 1UMKA 4OK5A 5EUMA 5G3ZA 1VQLB 2MMGA 2GQFA 5H8WA 1D2EA 2HMAA 3B7GA 5AJWA 1J70A 1W87A 1HE8B 4LC0A 4Q1CA 5JRZA 2RGNA 2WJIA 1E79A 1HUQA 4QBHA 4KLNA 3AVQA 2FPMA 3UK6A 4LPKA 2C04A 3ASZA 2VNKA 3AVOA 3UMSA 2KB0A 2CDNA 1OXUA 3JZMA 3E20A 2W0SA 2ZPTX 3R9IA 5THXA 4AYTA 3QF4A 3TIFA 4MUBA 2OE2A 3LBIA 4FI3C 5FFMA 2HDNB 1EWQA 3SOPA 3CRRA 2GHIA 4KV9A 1GVHA 4ABYA 1NVWQ 4FMCB 2IW3A 1ZM4A 2ZTSA 4XD7A 1TVCA 3I8SA 2FSHA 4C2TA 1NKTA 2NQ2C 3TAHA 4L9SA 5KPDA 1KI2A 4DZZA 1HQYE 4Q1DA 1M74A 4M1TA 3VHLB 1U9IC 3K9LA 5BXQC 1SXJB 5F9FA 1W5SA 4BZPA 4TMTA 2Q3MA 3GFPA 3AF0A 1ZUNB 1Z6AA 3PFIA 3MJRA 2V6IA 3ND9A 4R2IA 1A7JA 2WWXA 3E1SA 2C99A 2B7BA 4AD8A 4BLQA 2OLKA 4L4UA 4C0BA 3F5FA 2W6JD 1N0UA 5ELXA 3OIVA 2V6JA 5FL7A 3Q9LA 1WRBA 1KSGA 2J0VA 2ZI5A 4GPTA 4DT1B 4Q1AA 1QHXA 2J0UB 4ACAA 2PX3A 4QM6A 2XB4A 2FPKA 2CLCX 1JPNA 3H4MA 4PANA 4F38A 5DI9A 4CEIA 4PC6A 4OHVA 4ERNA 1N6IA 2I1QA 3CLVA 2BJWA 3CUEF 4KHZA 3IIMA 3ZVRA 1G8FA 4BFXA 1E1RA 1QVAA 2IYWA 4B75A 5B2ZA 1KJWA 1G7CA 2IF2A 2QORA 4HE6A 1VTKA 1E2DA 2ZR0A 1R10A 1T3HA 5CM8B 3AF4A 3SC3A 1VQ5B 4FMDB 1GP2A 4BPRA 4EH1A 1ZCAA 4KODA 2H1LA 4AG6A 4UAJA 2DR3A 4KFSA 2B6HA 2FV8A 3OEEA 5F98A 1Z6GA 2KI5A 4P31A 4EPRA 3IO5A 1DG1G 3U6KA 3K70C 2IYVA 2PX0A 3T12A 2XTNA 2XNCA 5H70A 4BFTA 4XTRA 3K70B 1S96A 1XCMA 2IBMA 1IBRA 1JB9A 3OIYA 5DO9A 3CZQA 4BEBA 2EU8A 2GTPA 2VZLA 1RZ3A 2VSFA 1OPXA 1QG0A 3OEHA 3UXMA 2YOHA 1QFZA 4KFUA 3U4QA 2ZIAA 3REGA 1TQ2A 4DDWA 2O8BB 1E0KA 2JAQA 3EA0A 2GK6A 1VQ8B 5FOSA 4R9UC 1L4UA 1Z0FA 1RVDA 3A58B 1SVLA 2PH1A 1JAHA 5K8UA 1UBEA 3LFUA 1XPUA 4I81A 3EARA 1S9DA 1ZNWA 3X1XA 4Q5IA 1WE2A 1EP3B 1HURA 5FOVA 4DKXA 3GLGA 2LKDA 1X8LA 4CRWB 4UJ5A 2EFGA 4LV6A 2XZPA 1ZUIA 5CYOA 3I32A 1OXTA 3OZUA 4WZBE 1NMYA 2VNHA 2P3SA 1YZUA 1DBSA 3PITA 1BQEA 2MMCA 1NVVQ 2F9MA 4K46A 5FBRB 3V9PA 2OFWA 1FNDA 2NPIA 5JHGB 1S1MA 1G16A 1G9XA 3TR5A 3TGPA 2IC5A 1TLLA 4M9QA 3PUYA 3CPWB 1GZSA 2QGNA 5JEEA 3EC2A 4BECA 3OESA 1JR3E 3A1WA 3R9WA 5EE5B 2ECKA 2E1RA 1HH4A 3QNUA 3AF3A 1CXZA 4EPXA 4XD7D 4NYJQ 1OXVA 2BVNA 3M1IA 3QKRA 3GLHB 3QPWA 1LB1B 2QT0A 1G64A 4GOKA 4Q48A 5HKKD 1UDWA 1WCV1 1S0UA 4RFSB 5B58C 1G3QA 2D2EA 2RGNC 2WJVA 4K8OA 2EVWX 1W1WA 4TSFA 2O8DA 5DNYB 2ZRGA 2REBA 2VYQA 5D3QA 2GPJA 1X86B 1X8KA 3OZXA 3VHXA 3SDZA 1KI6B 5CJ2A 1J99A 5A0FA 1IN5A 2A9KA 1UBCA 4FK8A 1AKYA 5CB8A 3G0HA 1T8TA 3QF7A 3KZ1E 1WDTA 5FPTA 5FR2A 4IVPA 4EDHA 2CL7X 1UDXA 2YZ2A 1GAWA 3E1YE 1XD9A 4KSCA 3B1YA 1Q81D 4PX9A 2QTLA 5JHHB 1K6MA 2R65A 4OHZA 3SZRA 2AHOA 4A8JB 3PIRA 1O3YA 2YWGA 1TNDA 1QZXA 2Z43A 3LVQE 4M53A 3C14C 3KUDA 4LJ5A 1XCGB 2G1KA 4M1MA 3U7FB 1NI3A 4P0TA 2F55A 3SQXA 5FOWA 3ADDA 2QSYA 1B2RA 1HQCA 4JBYA 3KQKA 1XBTA 4C0HA 2KBEA 1XEWX 4W5WA 2YOFA 3H84A 4Q4JB 3SBDA 3CR8A 5EP2A 3C16C 1KO4A 3U3KA 3FKSA 4DRZA 2WSMA 5IDVA 2P6RA 1NVVR 3W6OA 2OBLA 4G3XA 5H59A 5CB6A 2W83A 5J4KA 1E4VA 1R2QA 3IQXA 4MRNA 3HWSA 3VTKA 1PV4A 1OGJA 4DHEA 1JEEA 5KNDA 1UKYA 4P4SA 3QQ5A 2BMDA 3IKJA 2JIZA 3AKCA 1SVMA 5AJZA 5GV7A 4N3NA 3SJZA 2OM2A 2Z6VA 3M0EA 2J0SA 3GJ3A 2FEMA 4TMZA 2BJVA 4YMSA 1P2UA 1KAGA 4WOPA 2JDIA 1TQ6A 1NDHA 3DDCA 4CVNA 5F9HA 3I55B 2J7PA 4R71A 2HCJB 1QHSA 1QF9A 1FNMA 3FE2A 2J1LA 4MRRA 1OHHD 1P9RA 2Z4RA 4I1OA 4P4UA 3O8RA 1KD1D 5DGXA 1Q1BA 1R4AA 2AK3A 3B2EA 5DI3A 3GJ8A 4LOAA 2F3TA 1ODFA 2C9CA 2C98A 3AGQA 4DLYA 3I61A 1W0KA 3MGCA 2OFOA 1BIFA 1HEIA 3QKUA 5FUWA 3T1VA 2FFHA 1JQLB 1G7RA 4QHYA 2DWQA 3BC1A 3BORA 1JA0A 1AQYA 1OLOA 5AR1A 3ZIAD 2CK3D 3THOA 2VP4A 4DEYA 1Q82D 1DAEA 4L16A 4Q7JB 2VNIA 1Q1QA 1TQDA 4OK6A 3GLIB 4BZXA 3LBHA 1IM2A 4F93B 1U0HC 1QHNA 3T61A 2NO9A 2QSZA 3QIAA 3VX3A 2P5SA 1XMJA 4XWAA 4DQKA 4MGYR 5FI1B 4ESVA 5H5JA 3NKVA 3E2IA 1E63A 1S1CA 3BH6A 1P75A 2BBOA 4RD0A 4Q7KA 4QJ5A 4C0QC 1HY3A 2ZSBA 5BN4A 4TZ0A 4G0NA 1XU4A 2BBWA 4W9MC 4RZUA 1Y3AA 3IDQA 1JQJC 5TVKA 2AX4A 1YI2B 3SFZA 1U81A 3DO6A 4ESHA 3VR3A 4OQLA 1IN6A 1FX0B 2OG2A 4KJZA 4Q9IA 5G41A 4ZV4A 3VO1A 2PJZA 1RKBA 1NNEA 4RSGA 2QPOA 2ORIA 1OIXA 1E4YA 3CC2B 4QHTA 2WIBA 1XTJA 1G3IA 4JT4A 2F1JA 1BYUA 4WBSA 3W2IA 2ZAOA 2AD5A 4Q9LA 1Z0AA 3W2GA 4XWOA 2QEQA 4ZIRA 1SVIA 3GD7A 3NH9A 3HDTA 3UWKA 4DB2A 1XZPA 5TR9A 3W9YA 4PC3A 4IDNA 1N6RA 1W48A 4Q1BA 1RYFA 1CQXA 2ZU6A 6Q21A 3DEFA 3PUVA 4TLEA 4ZDKA 5A4JA 1J9ZA 5J4VA 1IONA 4NU0A 2Q9CA 5DLQC 3AQ4A 4P4TA 3TKLA 4AURA 2NZJA 5KNCA 2TMKA 3ZJYA 3CCUB 3K0CC 2AKYA 2KE5A 3VKHA 4UJ3A 3LX5A 1BKDR 1E64A 1NG1A 2Q9BA 1Z6TA 2JLUA 4YAFA 1XMSA 2B21A 2ODBA 3PCRB 1W0JA 4HAVA 2B92A 3CX8A 4S35A 4BLOA 5JCZA 1S8FA 4D4KA 2NOAA 3BFKA 3FFAA 3AVPA 4M1WA 1XTRA 2G6BA 2NGRA 1AN0A 1OGIA 4Q00A 3PUZA 3LW8A 1QVFB 2GJ8A 1TQ4A 1X1RA 1Z0DA 8OHMA 3SHFA 3W2FA 4LHYA 3CRW1 1LV7A 3HR7A 2QAGB 1YJ5A 2FFAA 1EXMA 1YE8A 1OH7A 4IDQA 1T3LA 2XTZA 3SBEA 1E32A 2CL0X 2PZFA 1CULC 3TW8B 3HPRA 1SKYE 1WF3A 3GEHA 4QKQA 4ASUA 4QJ4A 2F7SA 3C41J 1W2GA 2RGBA 4V0KA 5CK4A 3HR8A 4DLSA 1YIJB 3G4SB 3DOFA 4F91B 3GLFB 4KAXA 3P4YA 2CBZA 5IT5A 3PJRA 4PTLA 1R5NA 2IF0A 3I5YA 2QT1A 3RS0A 2DY1A 3CR7A 5TV2A 1P60A 1BMFD 1RRPA 2JLYA 1I7PA 2ZSAA 1DDIA 4XSHA 3G82C 4YMVA 3K1JA 3WP1B 1T6NA 4GSYA 3EPKA 2F9LA 3SU8A 4GMDA 4NZYA 1TAGA 3DKPA 1UF9A 4C30A 2G0TA 5F3WB 1NIPA 4V02A 1GWNA 2PMKA 3FHOA 5FUVA 5FH9A 3RVBA 1S2MA 3CX6A 1YITB 1M6NA 2CE7A 1XDBA 4DLZA 2RGXA 4PC7A 1SVWA 3BB1A 5AJVB 2QROA 4POAA 2PMDA 4UNSA 3AB3A 3KTAB 3GJ0A 3LDAA 2DWPA 3LA6A 4NE2A 4ZCMA 4B33A 2ZE8A 3KUCA 2BMFA 2ZRKA 4IDOA 3QKSB 5HZHA 2R6AA 3FHTA 1KK1A 1M1KD 1CRPA 2ZITA 4PC1A 1KJYA 4JZKA 4A0RA 1SVKA 1DARA 4PO9A 3V4FA 4FWIB 2BCJQ 1VG1A 1QHGA 1S72B 4EPVA 2OZEA 1Q3TA 4PGOA 2C95A 3FTQA 3IHLA 1Q12A 1RW4A 1BX1A 2H92A 4DC9A 1ZJ6A 4C0SA 1XRJA 1YZGA 3V76A 4E09A 5JLJA 3IPYA 3GLGE 1WQ1R 3VNUA 5AN9A 5DISB 1RRGA 2WWYA 4QL3A 1E62A 4AYWA 5L8VA 2ONKA 4KYIB 5KHOC 3U7GA 4PHTA 2A30A 3BS4A 2ZSEA 2XGJA 3AEZA 3TW4A 5EUQB 2SHKA 2OILA 1E2EA 4TL9A 3Q5DA 2XTMA 1W35A 1UEIA 1OJLA 2A5YB 5G53C 5JBQA 3SN6A 1FNNA 3LV8A 1X6VA 2LKCA 3W2HA 4DLWA 1ZUHA 3FB4A 5UKDA 4ZCIA 3DZ8A 3MJHA 2BOVA 1U99A 3GEIA 4M1YA 3EAQA 1G8HA 2Q21A 4MDFA 1E2LA 2YOGA 1N5JA 3IGFA 1G20E 2VL7A 4ZGNB 3MHPA 3TQCA 1K9MD 3SYLA 3RAPR 2MSCB 3QI2A 4TTQA 4WZ6A 3CC4B 5JWRA 2Y8EA 4Z54A 3GMTA 1NLFA 1NLZA 1IY2A 2OUKA 1GAJA 4LJ6A 1EP1B 2IEZA 3L8ZA 4Z1MD 4RCZA 2UZ3A 2O0HA 4DLVA 3AP2A 1EFCA 4JVLA 3CCEB 3C5HA 3FMIA 1LNZA 4B3DA 1W49A 1P61B 1SZPA 5EXTA 5AK0A 2DYKA 2IYRA 3QPVA 2D74A 1N5LA 3AKEA 1P72A 4R98A 1R5OA 2WMNB 4A0HA 2WAYA 3TAUA 1QGAA 3QBTA 3ES9A 1PLLA 4H9GA 4HSEA 2BM1A 2OCYC 4HUQB 4N1AA 4U5XA 4QNRA 5E7IA 3FPKA 4QGHA 3ZLJA 2HXYA 5TDHA 1E96A 4Q66C 1F2TA 1G17A 4NDZA 1MO5A 4JLMA 4MYTA 4B2LA 1XTQA 1L2TA 1GM5A 2DFLA 4DVGA 1W2BB 3X1YA 2CE2X 3AUXA 5LB2A 4HDOB 5JWHA 4BLRA 2J3EA 2VEDA 4JSYA 4PO1A 4D0LB 1J8YF 1E94E 3W5HA 1GNPA 2J7PD 2AN9A 2ZRNA 3DPUA 1KSJA 4NMMA 1N8RD 4W5JA 2WJYA 4URXR 2ZSDA 3N5CA 3K9GA 3U3OA 1KKLA 5KSZA 4B6EA 2RMKA 3RS5A 4D4MA 2WWFA 3TVDA 4GP7A 2B7CA 3DOEA 3TUIC 3NBFA 4JLAA 2QTFA 1T3SA 2GXQA 2D06A 5DHAA 3HJNA 1R5BA 4BRUA 2ZS9A 1L7VC 1TADA 4LUCA 3WHLA 1CR4A 3WY9A 4BEJA 4FCWA 3U7HB 4G01B 1P2VA 4C2UA 1IN7A 1UBGA 3A1SA 2CRVA 1I4LD 4XTCS 4B2PA 3UANA 3KQLA 4L5BA 3PEYA 1OH6A 4N0DA 3QKTA 1KDOA 2VYFA 2Z4SA 3B9PA 3BB4A 3EPHA 4UKDA 2VF8A 3IILA 3CW2A 2CVFA 3KB1A 3A1VA 3W6NA 2A3RA 1OB5A 1GILA 1MABB 3X1DA 3WYFA 3VR1A 3SYNA 3QE2A 4C4PA 2CCKA 2NO6A 2X19A 4NYMR 4Q1EA 3UMRA 4Q7MB 1N5KA 3PUXA 5JS8A 2GA8A 2JEOA 1KI8A 2WZQA 2AKAB 3SI7A 3OEED 3K0FB 3T1QA 4MDEA 4HLDA 2FSGA 4LYJA 2IEYA 4FD2A 5KO2A 5FA6A 3ICQB 3BXZA 1NRJB 1Z83A 3N2EA 2W6ID 1AGPA 2ZJ2A 4PPNA 3GJ7A 4JKYA 5JI2E 2UKDA 3K09A 4MGIR 1P3JA 1M1YE 5SZHB 2LCFA 4TMXA 3KXKA 4JL8A 4ZPXA 1JI0A 3DM9B 3VKGA 1DADA 2QG6A 2DHRA 3B13B 4U7DA 2BMWA 4RJLA 3TH5A 4UXIA 2BN4A 1G8GA 1GSIA 1VIYA 2REXB 5EE0A 3TUZC 1W36D 5DI3B 4LYFA 1KI9A 3ZD7A 1BO6A 4JVSB 3KXIA 4HZIA 4EJSC 3K53A 4MQBA 4B3GA 5HE8A 3OZVA 1E1QD 1SVSA 1VECA 4JLKA 4QRHA 1ZW6A 2HYIC 1F3OA 1JXMA 1N6OA 3OHMA 4QBFA 1OF1A 5FBLB 4D2IA 2QNRA 4HLQB 1K8AD 4GT1A 4MITA 1AZTA 4OBEA 1NLYA 2B5OA 4JLVA 1ZM2A 2QEXB 4RY2A 4ZDJA 3QKRB 4K81B 3CH4B 1WA5A 2GEDA 2P6NA 1Z8FA 3EIEA 3U3JA 1Q3HA 3L8YA 4TT3A 4M1KA 3QE0A 1AQUA 2ZJ8A 4P6VF 4DLTA 3KQNA 1BH2A 1D5CA 4TYWA 5C1BA 3SEAA 3ZD6A 1V5WA 4CDGA 4HUTA 3MCAA 2A5GA 2ODWA 4OKSA 5C4MA 4OI0A 2O8FA 1GKUB 3RYTC 1B23P 1TL7C 1K5DA 4DDVA 1KMQA 1E3MA 1QHHA 4OJKA 4C0AC 4URVR 5AUNB 3RLFA 1AM4D 4GP6A 5CM9C 4EPYA 4GOXA 2AFHE 2PT7A 3QXJA 4BE7B 2EQBA 2IYZA 2IUUA 1ZM3A 1UM8A 3H0KA 1FDRA 4OQXA 4RKEA 3AKYA 2R6GA 2ZEJA 1TMKA 3FGNA 1A8PA 5LPNA 5FTJA 3U61B 2YWHA 4M8NE 5JSZB 3WNBA 1N6LA 4LSGA 2WWWA 1U90A 3BBPA 3KTAA 1CR0A 5E3HA 1W2HA 3NG1A 2OAQ1 4B6FA 3C15C 1KK3A 1XD8A 4NCKA 1NJFA 4OQMA 1E0JA 3KQHA 2EFHB 3KJGA 1SKYB 2WOOA 3B60A 2IS4A 1CS4C 3X2SA 5GADl 1A4RA 4WQMA 1AS3A 4UNNA 2JASA 4F4CA 4PHFA 2XAUA 3C7KA 4JYCA 1GRNA 4Q4HB 3NDPA 5IF9A 5B57C 1J2JA 3FPAA 2ZE7A 2ZAMA 2XNJA 3B1XA 2WHXA 4JLBA 1QH0A 4DQLA 2H17A 1BS1A 2UVQA 2PIAA 5EXSA 4A1FA 3LLUA 3J81k 2ZRMA 1UJ2A 3A4LA 2FSIA 3CPEA 1A82A 4F4JA 2ZVPX 3W6PA 3FJOA 2G3YA 4RFSA 3ZH9B 1SGWA 1SULA 1ESNA 1N6KA 4K1XA 3CCSB 2BHRA 2REOA 1ESMA 4OI1A 3WNCA 3QVVA 1PUIA 2YC2C 4MKHA 5FTKA 2G1JA 4URZR 4JSTA 4E5UA 3K0CA 1JECA 1GNRA 1XXHE 4AYXA 1TF5A 3CNOA 3GJ4A 4NYMQ 621PA 2AFIE 2R44A 1Z5ZA 1R7RA 4I1UA 3ZZ0A 2XITA 2VP6A 2ZRIA 3U44B 3QFSA 1ZC3A 3KL4A 3UIEA 2NO0A 2QAGA 2C03A 2AWNA 3FVQA 4KCGA 3JQPA 1KMHB 2HLDD 3K8YA 5FL7D 1W0JD 4UNQA 3X1WA 1Z0KA 4WIAA 3VU9A 4YLGA 4D80A 2P0EA 1FW6A 2ZUCA 1XPOA 4GI7A 1CF4A 3CMAB 1M8PA 1CLUA 2ZYTX 2ZRFA 2ZRCA 5GJWC 3RWMB 2XJ9A 1YZTA 1XXHA 2YYZA 1DDGA 5DHFA 4BZQA 2VP5A 4EFNA 3TSOA 3WYGA 1P9NA 2AXNA 2PZGA 2WM9B 2WSSA 2GEVA 2XB2A 1US8A 1KO7A 1SQ5A 2R6HA 2X2FA 2Q9AA 1Z22A 3WHKA 4BFUA 2C96A 4BQSA 3V4RA 2XSZD 3RRYA 1RRCA 1BYIA 1US8B 2W0MA 4BGDA 2VTKA 2NO7A 3EPLA 3QF4B 3FYHA 1FX0A 1G6HA 1SXJD 2QN6A 1W5TA 2R6CA 1T0JB 2WSSD 2ORWA 4NP6A 2FPLA 3AVXA 2ATXA 2YINC 4TTRA 4YMWA 1N0VC 4U9UA 1JBKA 1FQJA 4LI0A 4FXPA 4TLCA 5CJPA 3LVRE 3B8HA 3O8DA 5DYGA 3U6BA 4KXFB 4IFEA 1T0HB 2OBMA 4AY2A 1VCOA 1G41A 1NKSA 2CL6X 2E9SA 3AH8A 4JBWA 3B78A 1L8QA 4TL7A 4WA7A 1D6JA 2VHCA 1CBUA 4YXWA 5BWMA 4A0GA 2F1HA 5FPYA 1Q21A 2GZDA 1YHNA 5FUYA 5BN5A 3EX7C 4M2LA 2CK3A 3ECCA 4TYPA 5BYJA 3OJXA 4IEIA 4MUAA 5CLLA 5TARA 2GNOA 3GJ5A 3T34A 4WXRA 5J4HA 4G1VA 2QPTA 4I99A 5AUOB 5L3QA 1IAQA 3ZGXA 1KDRA 4LK2A 1VG9B 1RPZA 4L9WA 1FZQA 3NBZC 4IXNA 4DCVA 1COWA 4HI0E 4TL6A 1DE0A 2ZI4A 1NBMD 4NCJA 4AKIA 1UAAA 3ZQJA 1JB1A 1GNQA 2GDJA 2J46A 4LRWA 3W8RA 1XX6A 2ZJOA 5CLQA 2ZUDA 4Y7CA 3WBKA 3R8CA 1Z6XA 2HLDA 4KITB 3VX4A 5FBQB 1FTNA 4QBIA 1X8JA 3R8FA 2OHFA 1E9AA 2P65A 4LC1A 3SJBA 1ZM7A 3O47A 1GG2A 4BFSA 1QHIA 3UATA 4XVUA 2C77A 1JPJA 3QXXA 4KLZA 1F20A 4CF7A 3FOZA 4DIDA 2P67A 3QXSA 1G5RA 3F0TA 2O8EA 1KAOA 3RABA 1AA9A 1H8HD 1JR3D 3SHWA 3CXCB 3MUFA 2ZJZA 2H5EA 3RHFA 4Z51A 1DAMA 1XD2A 1NBME 4YQFA 4I1VA 2O8CA 1KC8D 3OIWA 1VQPB 2I3BA 2VP0A 3VNVA 1IXRC 1FNBA 4KFRA 4PQYA 5J5CA 4N0EA 1KI4A 2A5FA 2QRNA 3B1WA 3CWZA 3LAWA 2J45A 4Q4JA 4QJ3A 1LY1A 1PLKA 4TWZA 4M1OA 3X1ZA 4B48A 4YMUA 4D82A 1ZD8A 2VLIA 2WKQA 5G3YA 3K0EA 2VPPA 4QXAA 2WOJA 3U5ZB 3A1UA 1VQ9B 1VQ7B 2J0QA 2J5XA 3CH5A 3CPJB 1EWRA 3AF1A 4GMXA 3LO8A 4B43A 3VAAA 3E5HA 1GKIA 3CC7B 1XJ0A 2IT1A 3FDIA 3R9XA 3VQTA 1VG0B 2GESA 3EZ6A 1DAFA 2IYSA 3WXMA 3IO3A 1J7KA 2ZR9A 3DMDA 1GL7A 2A5JA 2G77B 4NH0A 1E2HA 3DKVA 5E4FA 1QGYA 2OK8A 4JIMA 4DJTA 1QX4A 4F7WA 2O8EB 1IN8A 1XNJA 1VQNB 2WJJA 3F3YA 3HYTA 2BCGY 1KZGB 4C0JA 4YMTA 2PLFA 4FMCF 3KKOA 3L2OB 5DN6A 2Q3FA 4RZ2A 2O8DB 1EFRA 5C2JB 2EFDB 3QFTA 1TPZA 1YRAA 2VHJA 2PEYA 4G5RA 4LBVA 4BWYA 2HJGA 4LY6A 5LD2C 1DG3A 4V0OA 1VPLA 1A1VA 4WW0A 3CCVB 4DWJA 4EJSA 3CO5A 4LBYA 4DEXA 1HE1C 3CD6B 1W44A 2C2HA 5AUPB 3GCGA 2ZYWX 3EIQA 2FA9A 4IKEA 4LJ8A 1TUIA 4US2R 2IK8A 1G21E 5CDFA 3RC3A 4EIWA 1W7AA 1KI3A 4JT2A 1DAKA 2D7CA 3CWQA 4Y9RA 1VCIA 1D2NA 4PXAA 1NSFA 5FTNA 3LWNA 2ZE6A 2VF7A 4HAZA 1QRAA 2ZJAA 3K09C 1TF2A 3CRZA 2VA8A 2ZRBA 1QBKC 1CJVC 3WMGA 5C46F 3L0IB 4HE5A 4RCYA 1NN0A 2N42A 2V54A 3W5IA 2XZOA 2PCLA 1GVNB 3HU1A 3W3AA 5GJBA 4LWZA 2K5UA 3ASYA 5CITA 1E9EA 2ERXA 1EFUA 1Q1EA 2MSEB 3U60B 1HT2E 2BIFA 1DO2A 1I2DA 3IQWA 4JS0A 3LNCA 3AVUA 2ZI3A 5SZKB 1E0SA 1LTQA 1AZSC 1XD2B 1XEWY 3P4XA 3BWDD 2JLQA 3CNLA 3JVUA 4BFWA 2FSFA 2OFXA 3GJ6A 2JLRA 4ZDWA 5HTKA 4EUNA 3NDBB 1P7CA 1NG9A 2IWHA 1XMIA 1FNCA 3BFXA 1WBDA 1VKJA 3DL0A 2JJ1A 3NWJA 1XE1A 5KDLA 1W46A 5C4GB 1COWD 3JQRA 3ZBUA 1EX6A 4HAXA 5DSZA 3KKMA 1GJRA 5BQ5A 1ZNZA 1RYHA 3EZ2A 1E9BA 3T1TA 2FMXA 5C18A 2X1VA 1IY1A 5KOYA 2IYYA 2FX3A 2H18A 1MH1A 3QEJA 1G8PA 1N25A 2RGDA 2VHQA 4AC9A 3RNLA 3EIHA 4CGZA 1DOAA 3GP8A 3KQUA 3UPUA 4IVQA 4Y0AA 4UQOA 1Z0IA 1LF0A 4KBFA 1VQMB 3OE7A 4Q1FA 4PSVA 3TSWA 4GBMA 3V00A 1KNXA 3ZS8A 5HPYB 2IHYA 2J59A 3QG5A 2ASEA 2ZROA 2XNDD 4B47A 4LZZA 3P26A 3ETLA 5DYIA 2QU8A 1J8MF 4RZXA 1F2TB 1IB0A 1EFTA 5FR1A 2J9RA 4ZO4A 3NC1C 2QTZA 2V4ZA 2GXSA 2GK7A 1MO3A 2OTJB 4EPTA 3ADCA 4CEHA 1IQPA 2VH5R 4HUQA 5GJVC 2MSDB 2D3WA 2VSXA 3GJXC 1JEDA 5E95A 2WWIA 3FMFA 4Q21A 1KOFA 1U94A 4MYCA 3MAAC 3IPXA 4A9AA 1YU9A 3CCLB 1NN1A 2ZETA 1C9KA 4BLPA 4MYUA 4FMDF 1OIVA 2ANCA 1PLJA 1OFUX 3T35A 3UWOA 2OCPA 3T1OA 3I72A 3W34A 4AIIA 5DN6D 2O0JA 1E1RD 1KTVA 1P62B 5GVSA 2F43B 2OAP1 3CF6R 1MO6A 3D7MA 4W5HA 1FP6A 4OHWA 2CHVA 2I4IA 5KSOA 1T9HA 1C4OA 1DVRA 1Q22A 1WP9A 3LW7A 5FL3A 5J4LA 2QBYA 2R62A 1P5ZB 1GKYA 5EZ5A 3CKLA 4B44A 3TJZA 1KI7A 1FRQA 1RFLA 1WBBA 5E7MA 5EE9A 4QGAA 3L0PA 4HB3A 1G4AE 1OE0A 1H42A 3IEUA 4HB2A 2GXAA 3AKDA 4Q03A 4YAWA 1BX0A 1DEKA 2HUPA 2V8OA 3RWOA 4C9BA 1EK0A 1YJNB 1QVRA 4WXPA 4F4IA 3PEWA 1FUUA 2C5LA 3WNDA 2IL1A 1DTSA 5SZJA 3HU2A 1KKMA 2BWJA 1TU3A 3RSOA 1EP2B 2ONJA 2QL6A 2YVUA 3VU9B 4DBLC 3A4NA 4FW9A 4IHQA 221PA 2PJRA 4BLSA 1F2UA 1EESA 1Z6YA 4Q4AA 4YC7A 1E2JA 4I4LA 5JI3E 1E9SA 3Q8XB 4ARZB 4C0LA 1XMVA 1G1MA 2BGJA 2CJWA 4TQAA 3G6EB 3JVVA 1YHQB 2A78A 2OV2A 3NIBA 1WXQA 1JJVA 3GLFE 3OE7D 3U44A 1N0WA 4MRSA 2L0XA 4ZKEA 2B8WA 2ZRJA 1SKQA 1SHZA 3TSZA 3BB3A 3BD9A 4HDQB 4RD4A 3BIFA 4AG5A 4BFVA 4B4DA 2HV8A 4CZ2A 4DLRA 4DB4A 1KY3A 4Y9UA 4TQUS 4M9XA 1DO0A 3P32A 5KU1A 3BFVA 3E70C 3EG5A 3PVSA 2GAAA 4B3FX 4DUGD 3QVUA 2CMKA 521PA 1H8HA 2PCJA 4X8MA 4O25A 3W90A 4FWTA 4PHGA 4ILEA 5SZIA 4URYR 5KUTA 4KO8A 2DFKB 1G6OA 2GCNA 1EWYA 4ITRC 1Q0UA 1ZC4A 1NY6A 1R6BX 2QM8A 5HR5A 2BMJA 1QHYA 3THWA 1KGDA 2ZI9A 1VIAA 4LHVA 3MWJA 3ZBTA 3W5UA 4QM7A 1Z2AA 4MYHA 4NL4H 5TY0A 4NKRA 2XZLA 1E2NA 3U2QA 1VQ6B 3UKDA 4BPBA 4II7A 3SR0A 1DPFA 1HV8A 1G5PA 1NN5A 1YQTA 2R8RA 3KB2A 4TLAA 1HYQA 1Z06A 2OESA 3FMOB 4G1UC 1NP6A 4A82A 3PXGA 4E22A 1XEXA 1T5LA 1U98A 1OXXK 2FWRA 5FPKA 1AGRA 4EFLA 4LJ4A 3BAFA 5JS7A 1B0UA 2VP9A 3CRMA 3LY5A 5FTLA 1UKEA 4FCTA 5DE3A 3R7WA 2O52A 1T91A 1G18A 3OIUA 4TT3D 1GITA 4B34A 4JYBA 5FOXA 1Z28A 3QENA 4Q18A 4X8OA 3FKQA 2BBTA 4IEEA 1U8YA 1KQSB 1T8UA 2EYQA 2ZREA 1S4QA 5EZ6B 4ZCLA 3KXLA 2QP4A 2H57A 1E69A 1CP2A 2YWFA 1MABA 4RD1A 4H1VA 2QTHA 3RS7A 2BM0A 3CBQA 2ZYUX 3S1AB 2O8CB 3LQRA 2PZEA 2AD1A 1XJCA 4UXJA 5L3VA 2FU5C 2FNAA 2QI9C 5BYKA 1VMAA 2LWIA 1XZQA 3GFTA 2X77A 2GJSA 2J7KA 4LYAA 2WJHA 2G88A 4X8LA 4AK9A 2FN4A 4LV8B 4P33A 2BV3A 1FTSA 4MGKR 4MRPA 3CCJB 4JLNA 1Z63A 1P6XA 1VQKB 1KI1A 1W34A 1OW3B 2PBRA 2UZIR 4YONB 5TB5A 3WMFA 3CRVA 3LX8A 4OJQA 3ND8A 3KKQA 4KI0A 1OFHA 5HE9A 2AK2A 3PEVA 1QG4A 1G7TA 3KX2A 3QXHA 4Q01A 3KKNA 5M04A 1KO1A 2N46A 1ZP6A
chains in the Genus database with same CATH superfamily
3NNSA 4E14A 1SXJC 4LYHA 1I33A 3VYSB 4L27A 1II8B 1C7FA 2ATIA 4HDNB 5L3SB 4HXYA 3RVNA 4M1ZA 3Q1LA 1GV1A 3GOQA 3RUIA 4J3NA 3UHAA 2IUSA 3Q87B 5L95A 1E7RA 4G0UA 4RIFA 1RPTA 4X8IA 2ZI6A 3CR3C 3M6MD 3ZW8A 3CCRB 3L0OA 4LZWA 3NI2A 3QJYA 3VU1A 1CIVA 3EGCA 3F67A 3NC0C 2WJGA 3PWTA 2VT7A 4IMJB 1ZHOA 5FOTA 4EUKA 3GFOA 2PE3A 5H68A 3LUJA 1JSRA 4YCSA 4Q6WA 3KFXA 3L4SO 4C3ZA 4FR0A 2OC9A 4DCNA 1OD6A 5BPFA 2QLJA 2RKOA 3OQHA 2JAUA 3PBKA 2B8TA 4MS1A 1XA4A 1NM5C 1XDSA 2X76A 2ZBDA 3G9XA 1YZLA 3KCQA 5THQA 1M34E 3FIUA 2BBSA 3L6EA 3NTUA 3TZEA 5KQGA 4OX9B 4WKBA 1NNUA 3I2IA 4H7IA 1QC5B 4Z7QB 3G13A 5BNTA 5JAHA 1AGNA 5JRJA 4BFLA 2FMTA 1KEEB 1HFJA 1JTFA 1NBMA 1A95A 2ZB7A 3BZUA 2NNLD 4AWXA 3ZIAA 4C5AA 1TFRA 4V03A 821PA 2Y68A 1EVKA 1A5SB 1TK9A 3CUSA 3OWHA 2AOTB 4D4HA 3IAM6 4WFIA 1QIIA 3L04A 1Y6RA 2XOKA 1NFFA 2AUTA 2V7QD 3DHWC 1E9DA 5FP0A 5JFGA 1C9DB 1SOVA 4LNUB 4UZSA 1Y89A 1RHRA 1A5TA 3WL8A 5C5DA 1JDJA 3C8ZA 1KYTA 3ZYCA 2HNAA 2O50A 2XVXA 4I8XA 1WKBA 4DJFC 2AZXA 5MGNA 1W8DA 3VZRA 5D3MA 4MI9A 4Q9JA 2QA4B 5AI9A 5KVAA 1YFLA 3OZBA 5H83A 2XV1A 4RA9A 1ZL0A 4UXHA 4ZCPA 1ODJA 3QJ5A 4BJ1A 1REQB 2JANA 3FN4A 4HLUA 5J23A 1GNLA 1UDRA 4UASA 4V0ME 3RIMA 1A76A 4MYDA 3OAAA 5EN4A 1B8VA 1T4CB 4MRVA 5AK3A 3CVWA 3K0KA 5A89A 2JGNA 4DM4A 1XXHB 4Z4ZA 1X94A 5LFAA 4KE7A 2OQVA 2YHBA 2G25A 3ANNA 4BJ6A 4PG8A 4OA5A 5CW2A 3EYWA 1BA3A 4XEUA 2QUIA 3JZAA 4Z9XA 1TO2E 3FTFA 3RRZA 3OC0A 4G9GA 1RYNA 2FE1A 3FNRA 4E08A 1FXWA 4ZFNA 4EHAA 2FRDA 2QS9A 3CONA 5IVDA 1UC8A 1QF6A 3MWDA 4MP3A 2ZULA 4EKDA 1JWLA 4BNVA 4E07A 3UJDA 2RHJA 1IUNA 3ACDA 2PLAA 4CL2A 1ILEA 5KTPA 2HBQA 2EBWA 1WDLA 3TZQA 4XYMA 3FFBA 3KKLA 3UWDA 2JPDA 1NR1A 1PNVA 3WZ2A 1XCPA 2EWWA 4R0NA 4P3OA 1OYVA 3ABQB 4LRSB 4E5NA 3QKSA 3LBFA 4IOKA 1SUBA 4JITA 5L3RA 1CFZA 3VDMA 1ZVJA 2DQKA 3FOEC 3SM3A 4WKOA 3EEYA 4BMZA 2BC9A 3NT4A 4HGOA 4J8PA 2H2FA 3DBRB 4KO4S 1QLHA 4BQEA 1SKUA 2HF9A 1DHTA 1SUEA 3H5WA 3ZEAA 1Y5RA 2O6LA 5ILOA 3RS2A 1EAMA 2Q4TA 3KWMA 4MUHA 3UMVA 1Z5NA 2D2IA 2X8JB 3KOUA 5KVSA 1FK8A 3PPIA 4L8WB 5IKXA 4I6GA 2O7QA 4DUZB 4RM0A 4JXKA 4Q6BA 1AK2A 2IZZA 5BN3A 1U0EA 1WUTA 4HQRA 1OAAA 3Q4GA 3GNQA 2GXUA 2X2EA 3GELA 2Z98A 4OPMA 2IU0A 4DSTA 1XI2A 4O4HB 1R8XA 1Q91A 4EQ6B 3WKDA 5H3CA 1U2SA 3RASA 4Q4HA 2D4HA 3O8CA 3FUCA 4S2EA 1E2GA 1C8LA 1Y7PA 1Z17A 1PT7A 2CXXA 1KZ9A 5IYRA 3A6GA 3AIKA 4HNGA 4Q9NA 2BTQB 1TUEA 4D9EA 2IS2A 1HMPA 4XL9A 5A04A 3T38A 1G5QA 5CCEA 3ZI7A 3Q2OA 3ND6A 1GZVA 1XCOA 2B8EA 3H65A 4ZHQA 3B6EA 2JVJA 3D1LA 4A15A 5CIWA 3UF0A 3WYDA 1T34A 4AI6A 1VKRA 3Q5GA 2AX3A 3HYLA 4HQLA 1N2SA 1UFQA 2P5YA 4PPFA 5K3SA 5BXYA 1CR2A 4IFTA 2XXAA 2YYSA 1H2WA 3AJAA 1SQGA 4KL8S 4WXHA 4IVRA 4CLRA 5JVDA 4E11A 1WP6A 4MVJH 3LLCA 3S2FA 3JZIA 2A5LA 1KMIY 1K6XA 1JDNA 3TCNA 4IUDS 1JLLA 3PEFA 1VCNA 2W98A 4JJKA 4OXXA 4ML3A 1U4SA 1WCIB 5CNIA 2VTBB 3LXUX 3NEPX 4ZMSA 2OTLB 1N3YA 2HJVA 3HJFA 4R1LA 2PSSA 1YBFA 3A1TA 3P2EA 4IS2A 3SSOA 1IRXA 1IL0A 3HABA 2HSJA 1I7NA 4XLEA 1UCFA 5LZ8A 4BGUA 3R6WA 2R6JA 4MS4B 2EL7A 2XMRA 3IERA 4BO9A 3O03A 4HWSA 2D62A 3ABIA 4CLRB 1FJ2A 1Y63A 4EA9A 2UYCA 1KOGA 2FXVA 4HS9A 1N4AA 2XRYA 2D2VA 4GE3A 4JVMA 5IANA 4UE6A 2JG3A 4OY3A 4BOYA 4DRXA 3MCWA 2K7ZA 2FX5A 4U9HS 1GGMA 4IAOA 3K92A 1L4LA 4H18A 4C5CA 1FVFA 2BZ1A 1NXQA 2FWJA 2KSQA 3PP8A 4U8HA 1JLMA 1QYVA 1Q0LA 4HAOA 3PHHA 1R64A 3P0IA 3JYOA 1R4ZA 4HH4A 1RJFA 4GZLA 4C01A 2RI0A 4LE2A 3G5TA 3CN7A 2JJ2A 2IYPA 4Z9FA 3HZZA 1KNQA 1H3NA 4C08A 1D1TA 1X77A 4MV6A 3STXA 2JLVA 3O4RA 1VMKA 3JQ9C 3O38A 1C9MA 2B37A 4IJUA 4D5GA 2O8BA 3M9LA 2QR3A 4NBTA 3TK1A 2OXEA 3C8MA 3EFBA 1NONA 5LXTB 3MD0A 2FE4A 3W3AH 2VA9A 3W34A 2BEJA 3KSZO 3EW9A 4NNPA 1R0BA 3PVCA 5G4LA 3T5BA 2X8JA 3K9NA 3N2IA 4QO7A 2IH2A 2JS7A 4XCVA 1WXHA 4RK5A 3WL4A 4EAQA 3FI9A 3V4OA 2UXCB 1JPVA 3EXIA 3B9QA 3V55A 3ZE2B 3HRIA 1Q0SA 2C9MA 2WABA 3NO4A 3ROXA 1RAEA 2WT4A 1DELA 1KOLA 4I3HA 4OH7A 2PGNA 3HVIA 5HUJA 1U0GA 4P86A 4QSHA 3VR2D 2X4DA 1B3RA 1GSAA 2RAPA 5CAEB 2IUUA 4BLTA 3RVMA 2C5FA 2QX6A 3NDJA 1N3IA 1UK9A 3GLHE 4AMVA 4QUJA 1NM5A 4MAMA 4NG4A 5FTWA 1YS1X 3JZDA 4Z7JA 5K2MA 3SKVA 5AXAA 1E79D 3EVEA 3F9RA 3JYQA 4ZT6A 3U0BA 3F4KA 4PYLA 4C7OA 5LMZA 5MN4A 1X9HA 1OZFA 1QGUB 2RIPA 1P7ZA 1CUXA 3SFVA 1LVGA 1K8QA 3L9XA 3SYTA 4CT5A 5CD9A 4LY0A 2ZRDA 4Z0PA 2F6RA 3HEAA 3AM5A 1XN1A 3OPNA 1RAGA 1MJHA 1U1IA 2C2MA 3TSCA 2G1PA 4XX0B 2L2QA 2X0FA 2ODNA 4X7PA 2PU7A 5HIMA 1DP4A 6CHYA 3B6JA 1OYYA 2O3JA 4MPTA 3Q2KA 1CUGA 4EZBA 1I3OA 1K27A 1VE6A 4R8SA 5AMXA 2NUAB 4QGSA 3ACBA 3ADPA 4ROSA 5LQSA 2Q3CA 1RVV1 2UYYA 2ZKIA 4IJMA 1KKUA 3DB2A 3JPYA 5J4YA 3FBWA 1AQ6A 3ENNA 1D8TA 3VHRA 1H2HA 4NBSA 3C8HA 1H8EA 1CIPA 4JLDA 5A4KA 4I9NA 9GPBA 3K70D 1TIBA 4B3MB 1DQSA 5FADA 3KTDA 4QYIB 1U9IA 3RIHA 2GVZC 2V4MA 2ZRPA 4M0FA 2QQGA 4C22A 4FFMA 2AL7A 5D3MB 2QPAA 1H85A 3URMA 1TKBA 1XLVA 3JQDA 4BV3A 1O87A 1ADJA 3QMMA 2X6QA 3WZMA 1IPEA 1ECBA 1ZHFA 3AGPA 4JC4A 4HVCA 1J39A 1Q74A 2RB5A 2QTCA 1FY2A 3OTIA 4EGCB 1N7IA 4PPQA 3QOYA 1VHTA 1YZNA 2ZBFA 1KMMA 3EA5A 4UVDA 3GRAA 4LF7B 3H2JA 4KQMA 4Y6PA 4HF7A 4YK7A 2NG1A 5K0LA 4RQUA 2R8XA 5CX1B 4G5GA 1KXZA 1MO4A 1ZGBA 5CK5A 1UUFA 3DH0A 1CRLA 1YMVA 1QANA 4YLEA 3Q6MA 1AKVA 1TLFA 2E4ZA 1BHO1 5ALOA 3F73A 2ATVA 4U6QA 1UZNA 1YR6A 2QUZA 4YIHA 1EI9A 2QMEA 4XQCA 4O2RA 4R6XA 4EW2A 1E5TA 2JJYA 2ZANA 4G2NA 3T7JA 1CQJB 1T9GS 2WFLB 1SOAA 1Y1LA 3A6PC 1MV8A 3LOPA 4DRYA 5IRCD 4UVEA 1N8KA 1F8UA 2FOLA 3NGMA 1E9FA 3P20A 4QE3A 3V8RA 4AB1A 1R15A 3PFBA 4PAQA 4DY4A 2RGEA 1MRSA 2YJTD 5A3QA 3DWIA 1UMDA 4MUNA 1N2BA 1JDUA 3N8IA 4UM9B 1PWXA 4G5QA 3RSCA 4Z4VA 1U6KA 1QH8B 1G8YA 4ZRDA 2FLVA 5IVHA 3IBYA 5E1OA 4A8JC 4BN0A 1AS2A 3NEYA 4N18A 5JMTA 1C3XA 3FHCB 3HUUA 4DMMA 5BYBA 1UD2A 1JAIA 1P81A 1MAWA 1HNXB 3BTSA 1F48A 1GRQA 1VM6A 3AQIA 3VO9A 4IG9A 1CJKC 4Z8YA 4CWAA 1CEXA 1II8A 5L3SA 1H2BA 2A3NA 1GTG1 2PGDA 3ESYA 1FFXB 2NXJA 3FUWA 4KN9S 1D1NA 5F23A 3WGYA 3FKSD 2EFCB 5HWSA 3DAFA 2X8BA 2AOVA 4Q82A 2OCBA 4HY3A 1POXA 3GK3A 5IBRA 3G5UA 4ZTBA 1LH0A 3M33A 1X2BA 4FFLA 3LS2A 3O4GA 3E9ZA 3FOBA 3NORA 5FTMA 4MW0A 1E98A 3ER9A 2MOKA 3IA7A 1EA7A 1U2GA 3DO8A 2YV2A 3MMPA 1KK0A 1H69A 3GUVA 5ALMA 2AEJA 5JECA 2F3QA 5AI0A 2Q2VA 2QYHA 2ZB2A 4O08A 5GZ6A 3HKBB 2JIOA 2CUTA 2QD3A 2OSBA 3OPYA 4IFBA 3RW9A 1SZJG 2GILA 5KB3A 2BD0A 3W4IA 3HUFA 3TLZA 1X7ZA 1PS9A 2FK7A 3BIOA 3IAS6 3PHBE 5CBKA 1FC0A 1DXOA 3TEFA 1TCUA 5C7YA 4AO7A 4QC2A 2IWRA 1RIIA 3I4CA 5P21A 1AMUA 4RHFA 3TE6A 2O1WA 2ERYA 2FW0A 2IY7A 2RH5A 2VO1A 4RPHA 3PL5A 4U00A 4UM9D 4QFMA 1C0EA 1Y7IA 4ZGQB 1W581 4QRDA 3UK7A 5E1DA 1PJBA 3JATB 2GJKA 3NAZA 3RPEA 2QDXA 5LA6F 2PFGA 3HJHA 5MF6A 4Z9BA 5JCPA 1JNYA 3L7JA 5F73A 1L7MA 3FTCA 5EJMA 4YPFA 4EPWA 1RC1A 1NL3A 1XFAA 4IKOA 2XXAB 3NTLA 3GI1A 1QNLA 1UPBA 3BH7A 4N65A 3UC9A 4AJKA 4EHFA 1P1HA 1XEXB 3P9YA 4OL0A 2J41A 4R1SA 3RVSA 4PC2A 1AJEA 1N06A 2OT3B 3AUYA 3B1JA 4UFOA 4B3IA 1KO8A 2FMIA 2HK9A 2EJCA 2G09A 4XFJA 3RKSA 2CV0A 3TRDA 4YAUA 3JU3A 2P6UA 2EJVA 3GGSA 1M2WA 1W2WB 4RZ3A 5JYBA 4RTKA 2EEZA 4Y9SA 5J2UF 4LCEA 1Z08A 1JXAA 1C8BA 2CJXA 1E99A 1Z2NX 3M4JA 2BP7B 2XDQA 1RI3A 3DC2A 1N2CA 3WYEA 1OBOA 5EMNA 4HOYA 3L0CA 3Q9UA 4A5OA 1SBIA 2DZDA 4E70A 1K5GA 2QBYB 4OI4A 2NTVA 1YB2A 1P4SA 1WORA 4HEA1 4P2GA 4FFNA 5CXQA 1PJ5A 3MJTA 1CJTC 4ED9A 4BB6A 2D5AA 1MKYA 4QGFA 2BLNA 1FP7A 2XQKA 1ZKMA 4GDFA 4KTVE 1XN4A 3K5WA 3V3KA 2D3NA 2FVGA 4BBZA 4RH3A 2GKOA 3PENA 1XTKA 3TQQA 3VBEA 3NBXX 1P3DA 3ITDA 1CUHA 4NC9A 3O7MA 2GZHA 2Y1DA 4Q24A 4ARSA 2NMVA 1J8VA 4NEQA 1EFDN 2V0NA 5BVGA 3NUQA 4O59O 2OWDA 2I7XA 3DOIA 3E7DA 2ATEA 4E15A 2FDCA 4G7XA 3SWWA 1XP8A 4ND4A 5DLPA 2FFBA 3LKDA 4WGGA 3RK0A 4HWTA 2X0JA 5I7RA 4DNTB 2Q1YA 1GZ6A 2NPFA 3H7IA 1EDDA 3SIRA 1AOXA 3K4HA 4JUFA 2GBLA 3ZKWB 4QLOA 4IO1A 1U3FA 1UBOS 5CU7A 4LF6B 4AMBA 2CB0A 4CEHB 1JVNA 3W5BA 1ZNYA 3EVDA 3NPAA 2JLBA 3G71B 4ARZA 3C85A 2Q7XA 1I7LA 1QFXA 3GQBB 4HO1X 2W6JA 3G6WA 3KG2A 2BGKA 4ZAZA 1JDPA 1DXYA 2PANA 2WU8A 2XX3A 3FG9A 1MV5A 1V71A 4AP5A 3GVJA 1TMYA 4R3WA 5J63A 1R9MA 4BJ5A 2QYOA 1UPTA 4DLXA 1Q20A 2W5UA 5IZCC 1XEFA 5ALYA 2LVBA 4CGYA 2C78A 5FUXA 4WBNB 2B25A 5IMBA 2G4LA 3VPXA 1VQ4B 3F4LA 1HDZA 1O57A 4V3CA 3K1YA 2ZG6A 3DTNA 2P4HX 1M6VA 2BGMA 3FBGA 3QUSA 4NR0A 5JJIA 1HOXA 1DFIA 4R7ZA 4YREA 2GH1A 4FN5A 5CH5A 4F7DA 3ND5A 1U5BA 1MX9A 3ZVLA 5I7FA 1RXVA 4X7FA 1JKJA 4NENB 1Q11A 2GUWA 3AHIA 1ZIPA 4U8GA 4UOQA 4A2PA 1KO5A 4AZVA 3SEQA 4HEHA 3D31A 1RWKA 1M90D 1U2RA 1ANKA 4NBLA 4XM2A 3RIYA 1JHRA 1T2UA 3BRQA 3A8TA 3D8HA 5K3AA 4B76A 3E27A 3IEXA 4M0CA 4RTQA 1E2PA 2GCOB 2P11A 2NVBA 4HYYA 1G3MA 3AY0A 1P1BA 4IXMA 3LDHA 2NU9B 1UFKA 1Q1ZA 4Y9TA 1VL5A 5CXSA 4FXUA 2HQOA 4FSXA 4RGYA 4ER5A 4WBNA 3KQOA 1DAHA 2C4KA 3EASA 3DLCA 3NFRA 4MVJF 4US0R 4F97A 2Z57A 4M21A 3G85A 4MJXA 1OIWA 3GDFA 3NBUA 3S2ZA 1KEEA 2HHHB 3P9XA 4X20B 3AW8A 3OTGA 4ON9A 2DPMA 2C83A 1UZMA 3ACCA 3F4BA 3CIOA 3H1EA 4NF2A 1TCCA 2D1RA 4PAMA 4UBMA 5CJJA 3ZWVA 4I3GA 3EB9A 5AVVA 1B6RA 2CCGA 3QXCA 3PJEA 2UVPB 1Y5MA 3L82B 2Y0CA 4K0KB 2W22A 5ENDA 1ORTA 1YK0A 4B85A 1BW9A 1J9GA 2J0UA 4O2LA 4DCSA 5HXAA 1PNRA 4E0FA 4EQZA 2QZPA 3TX6A 2CD9A 5GY7A 4RL4A 3VZCA 2QV0A 3NIWA 4G24A 2OAGA 1LKZA 5K0BA 2J9FB 1T1RA 1TM2A 3WDMA 4CT4B 3DV2A 1EK1A 3A7DA 1P77A 1N6NA 2PXCA 2HA2A 3KIPA 4LY3A 1EXVA 3L77A 5IK2A 4RLFA 2EKBA 2IUTA 1XQBA 1E1NA 1E3WB 4QU8A 3PUIA 5BW6B 3RADC 5KIAA 2NO1A 2ORED 4JI6B 2H1OA 1MR3F 3H83A 5BWNA 2YXNA 5KJFA 1AD2A 3JQ9A 3TL2A 2QJWA 1QYCA 1WVMA 4O1MA 4HNRA 4OLFA 5D86A 5BR4A 4B71A 5DBEX 1B6GA 4N03A 5FI0B 1JYSA 2OYRA 1QWOA 4PN3A 2C2YA 3OWOA 4RULA 1RHQA 2P9YA 3GLSA 3Q41A 4L8LA 3VPHA 3WQBA 2A9PA 6LDHA 2XUGA 4W8OA 5DNVA 3BL5A 1ZDMA 2HK7A 1YJ9B 2XNDA 1TT5A 3DKKA 3H87A 3HCRA 2B4YA 1E2MA 3PDHA 4NZNA 4QDTA 4JKIA 5D01A 5DGTA 5JCOA 1O7JA 1WXGA 2JGLA 4G37A 3LA8A 4H7EA 3E3OA 4RSMA 2FQXA 3FYUC 2IP2A 3CEJA 4MUXA 5EP4A 1C7RA 3T3MB 1IN1A 4MYRA 1Z0JA 3SKYA 5BUZA 3BCSA 2DF8A 1E3ZA 2PD6A 3A37A 4IR7A 2PWAA 4I2NA 3KYCB 4TLBA 5A5GA 4PG4A 3SQDA 3FFWA 3IEKA 3V8EA 4RPBA 2AEFA 2FWIA 5COQA 3N6XA 4PFSA 4WVFA 4Y2UA 5K99A 1YOBA 1THMA 2IH5A 1B00A 1L5HB 3F8TA 3LF2A 4LGMA 5B30A 4TMYA 3WGVA 4NLLA 3T4EA 4JMQA 1L4KA 1DAIA 1V8ZA 2ZIVB 2P2SA 2QE6A 1DLJA 1L4NA 1PZNA 2ODPA 4HWKA 5FNVA 3E0QA 3I62A 2X58A 1LBHA 3ABZA 3JSAA 4YLYA 2Z6UA 1QHHB 4WZKA 3BWXA 4FX5A 4UBNA 3WKAA 1P0IA 1U8ZA 2JC3A 2P2DA 3ZC3A 1G66A 3T5DA 1YULA 2YQZA 3PG5A 2XTAA 2AOUA 2B8JA 2PKEA 4BUJA 3N28A 4RD2A 4J90A 3ICEA 4XH9B 5TRDA 4N3GA 1NYLA 3ET5A 1ZRMA 1THZA 4M0MA 2C9YA 3S2UA 4XASA 5JC1A 2OSVA 1WG8A 3W4JA 5JFTA 5C37A 5HF6A 4Q37A 1V8OA 1KFEB 1AMOA 1JVSA 1M34B 4KU4A 2OZVA 3LECA 4FZRA 3BSFA 4Q9HA 1RBZA 5ALDA 1T2VA 2PL3A 5AK5A 4BVJA 1XV5A 1CDZA 1EEHA 3ROMA 4P25A 5EOVA 1QSGA 5FA8A 5LWHA 5J2UB 1QCZA 1SBQA 4X24A 2H29A 2IGBA 4GR9A 1XZ8A 4AZ3B 2OENG 4GSLA 5AKHA 1P8JA 2FUG1 3FWHA 2ZRHA 2CLIB 3I9V1 4BMVA 4LAFA 2GKSA 1AC5A 2I1VB 5DNEA 3UO8B 3D6HA 5A2QA 3FZNA 2FUKA 1LS1A 1JA9A 3QEBZ 2O5VA 4BU0A 5AVXA 4G1BA 4BMSA 1GPKA 4W5QA 1OFIA 3LL7A 1ZK4A 3I05A 4GOMD 3KKKA 4TMKA 2Q3LA 1IDN1 2R2AA 2G83A 3C6QA 3LPDA 3VR5A 1ZPDA 1YU6A 4YRZA 1OUMA 2E87A 1JBEA 1RAHA 4OATA 3DQQA 1ZONA 4GEKA 4RENA 1RRKA 2PG3A 5CDFE 2ORVA 1A96A 3EF3A 1SQSA 1EHYA 4R2HA 3OIGA 4KVZA 2DULA 4MWSA 3ONYA 4I4NA 4PBSA 3ZQ4A 4C7BA 4DF3A 1VYUA 3CNNA 3U4QA 1B14A 1XTUA 2QRHA 4RFVA 1P1JA 1MRNA 2WFLA 3CW8X 4PLVA 4RVFA 2BELA 2E4XA 4LJ9A 5BW8A 4ZEXA 1LLQA 2QUKA 3KDAA 4RD6A 3ZWQA 5B5SA 1ODKA 4G0QA 4HCJA 1TJNA 2WV9A 4JP5A 3VNSA 4AN4A 2GN2A 5H8WA 2HMAA 2XH8A 4HMPA 1J70A 1HE8B 1E1MA 4G1CA 2DE0X 3G79A 2WJIA 3FPLA 1VHWA 2ZT5A 2V7PA 3LQ6A 4PCVA 1TYCA 3TW0A 3UK6A 4CIWA 2ZBPA 1CYEA 4JBNA 1PG2A 5T5QA 1VCHA 3ASZA 2VNKA 2ABWA 3BMQB 2KB0A 1SOUA 4CQMA 1GQOA 2I4NA 3CINA 3E20A 2W0SA 3JZMA 3KU1A 5THXA 4JNKA 5EIWA 2D0DA 5DEOA 4J2OA 3TIFA 5K6AC 5AI6A 2GD2A 1MX3A 2OE2A 2XQFA 1JDZA 3A14A 4GXNA 5CUQA 5FFMA 4FTWA 1NVWQ 2ACEA 1THGA 4BVGA 1ZM4A 4XD7A 2QKYA 2ZTSA 1IPFA 1NKTA 3ODPA 3TAHA 2LZ0A 1G0OA 5CH3A 4NZOA 3UBMA 1NAIA 5KPDA 3DEZA 1FFDA 1RP7A 3IC5A 2Z8YA 4IMRA 2XYRA 4UTOA 1XZLA 1SXJB 3D8UA 1W5SA 3PIDA 5GWXA 1T6XA 3ZGOA 4D9GA 2XCTB 5F9FA 2L17A 1TGVA 1WB6A 2V6IA 3A1CA 3DDHA 3ND9A 1E2BA 4R8LA 4GGPA 3G7UA 1G6Q1 1JV2B 4JOSA 1OI2A 3B8EA 5E9AA 3T7DA 2FW8A 2W6JD 3IEMA 3H2HA 1AHNA 2V6JA 5F3RA 4ROXA 2V74B 4IQFA 5BWLA 2CV2A 3R41A 1KSGA 5KX5B 4JC8A 2VWHA 3KELA 3FFTA 4Q1AA 4ACAA 4EELA 4QM6A 1W88A 2DPGA 1DUVG 1OAOC 4TV9A 2CLCX 4PANA 2WJZB 3L5OA 2AKEA 1N6IA 1NTOA 2FR1A 3CUEF 3VYRB 5BVHB 1G8FA 1N2JA 5A2GA 1E1RA 1QVAA 4B75A 5B2ZA 1XFDA 5E4JA 4Z3KA 2IF2A 3PQ6A 1VTKA 5LQCA 4CKBB 2A9JA 2G5TA 3EULA 1R10A 1P74A 1T3HA 3LKBA 1ZBQA 3AF4A 3DULA 3SC3A 4RY9A 4U2EA 1E1CA 4EH1A 1UK6A 3DYIA 4EY4A 2FV8A 5ADVA 4WFKA 3F78A 3TTWA 3N8GA 2WILA 2H48A 5ERXA 5IJXA 1E5DA 2DTDA 1OBHA 1PI3A 1O96B 1RHKA 3Q3VA 1OI7A 2OHXA 4A03A 2ERCA 4HP8A 3ZK8A 1S96A 1XCMA 3MPUA 2IBMA 3MUNA 4YI5A 3IEIA 3S2SA 2ZWVA 1Y6ZA 1S02A 3KSRA 3LPLA 3MT9A 4Y8VA 1Y3HA 1ENZA 3KR2A 1ONNA 2W6NA 4EZIA 3G8AA 5LIRA 3OEHA 5T8KA 4Z4GA 3TVYA 4U7JA 3TI7A 5IFLA 2YOHA 3QM1A 5BP7A 2H06A 2C0CA 1PR1A 2C4VA 4KFUA 3LPMA 4KK3A 2W37A 3RVLA 4F3YA 2O8BB 1ULBA 4HK4A 4ZPJA 2CSUA 1VQ8B 2P3QA 3NHFA 4EYKA 2X0EA 1ISRA 1E1DA 1L4UA 1PG5A 1RVDA 1Z0FA 2EFJA 3QVXA 1ZGJA 3LCVB 4JK3A 3HXQA 4EY8A 3DCNA 5TE9A 1I2AA 1YR1A 3EARA 2XXJA 2K6GA 2Y67A 4UDYX 1ZNWA 1M67A 1XXLA 2B20A 2CDAA 3E18A 4DDHA 1HURA 5FAKA 4KKVA 2VDQB 4BNUA 1X8LA 3C6XA 4RJ2A 2EFGA 2HZ7A 3SZLA 3VJLA 3WK9A 5CYOA 2P9CA 5JYEA 1H4VB 2JHGA 1HT0A 4FGKA 1WU8A 2UZAA 3NALA 2QRVB 2ZJ3A 4FYHA 1GUDA 4P81A 2WT9A 4BFCA 4X0CA 1NMYA 3L79A 4BKUA 4MS4A 2P3SA 2RH8A 2AFIA 1BQEA 1TXGA 1ZGCA 3EH1A 5CCXA 1MC5A 1NVVQ 5EXEA 5KNDD 3DXYA 3B36A 1U5AA 2CMHA 2IPNA 2NPIA 3GP5A 3GT7A 4OYLA 3HP7A 4MW1A 3TR5A 4WLOA 3DF7A 1JKIA 3OX1A 4B6PA 3TLJA 1P8AA 2PKQP 4MROA 3AHJA 5D5QA 3TZBA 1JIXA 1PT9A 1MAVA 3EXG1 4Z0TA 2R87A 1YF3A 2QW1A 3QVJA 1NVAA 4CIAA 4BECA 2ZXFA 5AJHA 1FFSA 1W8IA 4CM6A 3QX3A 3R9WA 2X9LA 4MV4A 2ECKA 3O8NA 3ZU2A 5E3JA 2RONA 2E1BA 1GA1A 2BVNA 1ZJ5A 4QOHA 2BEUA 1RQLA 1RBQA 2MJLA 1LB1B 3SHTA 2LD4A 4PSCA 1IOWA 5HKKD 5A62A 4RFSB 3A1EA 1G3QA 2BFBB 5KYYB 2QLTA 4YRIA 3N8KA 5ALPA 4IXWA 4TSFA 5DNYB 2VYQA 3IKVA 1X86B 3OZXA 3EFOA 3VHXA 3WK6A 1DRKA 1JNXX 2A1TS 4YO7A 2WTNA 1IN5A 4H6XA 5TS3A 4FK8A 2BDEA 1G2OA 3V2UA 3V80A 3N87A 3QF7A 4BLUA 4DAOA 1ABFA 1WABA 4EEXA 2ZZQA 1TD1A 4EDHA 4RE6A 2J3MA 4KSCA 1XELA 4KWTA 3D0RA 2GO7A 5LZ7A 4D9JA 3ZV6A 4RHUA 4PX9A 4TRRA 5K09A 1GFZA 1NQ5A 5I3CA 1UXHA 2A14A 3SZRA 1F2DA 2AHOA 1OZAA 2E4YA 2NNWB 3AEUB 3U4AA 3LX4A 4CMGA 1GCGA 4RMHA 2JKZA 1O3YA 3GIRA 1L5ZA 2EAUA 1K97A 4OXYA 5DJ5A 3EPRA 5DNDA 4C78A 3PUJA 1DC8A 1NRXA 2VUIB 4M53A 2XZDA 2XYGA 2WAMA 3WOHA 1NI3A 5D7BA 3ZV5A 3SQXA 3OY2A 1J9EA 2XGMA 1NYRA 3RU3A 4DKXA 1C8KA 2HZBA 3NIDB 1B2RA 2HK6A 5AJUA 3ZH2A 4GOOD 1XBTA 4ZHSA 3BY2A 3ET4A 2JI4A 5HK9A 2O7RA 4LMRA 1DTWA 3T56B 2YOFA 3H84A 3ZDDA 5NLLA 3SBDA 4DCPA 4R8VA 3SZMA 1YB6A 3EAFA 5H4GA 4KRYA 2IUYA 2NZXA 2XUZA 4IV0A 5HQ3A 3PL1A 4WWHA 2RGUA 2I6XA 3OPXA 3AJ9A 3Q2IA 2GJ4A 5H59A 1E5QA 1JQ5A 4FMPA 3S7TA 2A6PA 1F38A 2C29D 4GICA 3UB2A 5CB6A 1R2QA 3IQXA 3IUJA 4DSAA 3HWSA 4YUAA 3CCBA 3F6PA 1O4WA 5FF9A 4F04A 4FCCA 2I0FA 4R2WA 4TUYF 3K2IA 4TKUA 3KPJA 3QFFA 2ST1A 3AKCA 3PXAA 4BKRA 4F3KA 3GLKA 1UBNA 3CV3A 2NTJA 2RDMA 1QIFA 3K35A 4E33A 4HV4A 3DD5A 2DWUA 4BN5A 2BJVA 2WTBA 4ZOQI 6AT1A 1P2UA 1DCMA 1KAGA 1M1NB 1TUBB 3AHGA 5IC6A 4CVNA 1NDHA 3DDCA 4EOGA 1VA5A 6REQB 5F9HA 4NJOA 2HCJB 1QF9A 3FE2A 5JG7A 5IM4A 4KQHA 4F5YA 5JU6A 1OHHD 1UP6A 1W30A 3U0VA 3IP6A 4NZ9A 4BS9A 2MSLA 3SBOA 3PC3A 5G4KB 1VJ5A 1VBKA 4MSUA 4B1FA 1GTSA 4E5VA 3GJ8A 3VH2A 2F3TA 1KS9A 1ODFA 3H3JA 3DBHA 5KINB 1KZ4A 4GO1A 5F1OA 1Y37A 2DAPA 2F8MA 3C6MA 3MGCA 1LTHR 1RPNA 1ZZEA 2D1YA 3BJMA 4F3NA 3GDOA 3FNBA 1Q0ZA 4HTFA 4GBJA 4RTJA 5EZSA 3MJCA 2ZZGA 1AQYA 1QVVA 2WKWA 1K75A 3AOEA 3FCXA 3RK1A 3THOA 3ZIAD 2QPLA 3OCZA 4L16A 5DCWA 1B1AA 1TJ4A 3LT0A 1ORDA 1Q1QA 1U8XX 2NT3A 3L40A 3TL3A 3FNIA 5CM2Z 2NUTA 4HNAB 2FUNB 3S28A 1R6DA 4QPZA 1U0HC 3T61A 5T7BA 5EFOA 1EUDB 1WSDA 3E0XA 3O1IC 3QIAA 4LJSA 1WBJB 4O5AA 1K2WA 1Q1AA 4YAGA 3UFXB 3I1IA 2JCYA 4MGYR 1Y8ZA 1TVKB 4ESVA 1GLGA 3E2IA 1S1CA 1X7GA 1F0KA 1MX1A 1P75A 2BBOA 3E7FA 3IBCA 4Q1VA 3KQPA 5IAAA 2CFSA 3VSCA 1N05A 1HDGO 3HB9A 3BD6A 3JALA 4C0QC 1HY3A 3R9KA 5JXIA 1FYVA 5IH3A 1PYDA 1XU4A 1BMTA 2JK1A 3V1YA 4QRIA 3ZNNA 3SYRA 1RZUA 4WK0B 2AX4A 1EE9A 2IEBA 4MQEB 3ILVA 2VTEA 4URHA 5DHTA 1XKXA 4OQLA 3VR3A 4ESHA 4FB4A 1U8EA 1XIVA 5K0NA 5KWJA 3HTXA 3MD9A 2WB4A 1X80A 2OG2A 3EIXA 3HSYA