1KK2A

Structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdp-mg2+
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
405
structure length
396
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
molecule keywords eIF2gamma
total genus 97
structure length 396
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk2A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk2A01
4OL0A 4A9AA 1EK0A 1NJGA 1ZCBA 4QGAA 4EH1A 2WV9A 1TF7A 5LPNA 2W2XA 3SJCA 5JFGA 3BOSA 2C95A 2HDNB 4AKHA 1LB1B 2QP3A 4CW7A 4P31A 3TLXA 4Q1CA 4KFSA 3W9YA 3SNHA 3T5GA 1Q86D 2ZVQX 2JEOA 3SJAA 3T1QA 3OJWA 4YXWD 4BEJA 3JZMA 2A3RA 1G7RA 1N5KA 4PPNA 4EJSB 3GLIA 1R5BA 2WBLC 1SHZA 2C9CA 4LC0A 2QORA 2VNHA 2R6CA 4QBHA 1E4YA 2CHGA 2FWRA 3W6NA 4FK8A 1R0ZA 3TUIC 1OXUA 4DIDA 5DI3B 1DG3A 1RRGA 2J45A 2ZJ5A 3VMFA 4AKGA 2QPTA 1UEIA 2ANBA 3BB1A 3ND9A 3QUSA 1T8TA 3Q85A 4A4DA 1VTKA 3NG1A 1IN7A 1BO6A 3R8CA 1W4AA 1DADA 1S3GA 1DEKA 4PO8A 1RZ3A 1F2TB 2ZJ8A 1F20A 1GAWA 3U2QA 1NVXQ 4F93B 1XEWX 3CBQA 1DOAA 3L0IB 5BXQC 3AVQA 2HXYA 1Z08A 4IHQA 3JQQA 3KKMA 1XEXA 3VX3A 1U9IC 1AK2A 2R62A 3KTAB 4MKFA 3ZD7A 3WMFA 2VF7A 4BFWA 1G8PA 2REOA 4WQMA 2ERXA 1E2KA 4C0QC 2ATXA 2OLKA 4K46A 4B4DA 5DO9A 1OFUX 3WHKA 3UKDA 1ZC4A 1SXJA 2NG1A 1UBCA 2GBLC 2ZE6A 1I4TD 4PQYA 4PC6A 5KHOC 1DVRA 5KYKA 4PC7A 1ZCAA 2NGRA 4RCYA 1CULC 1QRAA 3PIRA 1EESA 2RGBA 4DCTA 5FOVA 5KDDA 1OH6A 4MA4A 3K0EA 2GBLA 5FUYA 3TGPA 3QKRA 3SFZA 2OT3B 5UKDA 3TQCA 1JPNA 4LHYA 3Q7QA 1IXSB 1WA5A 2WJGA 4OK6A 3I56B 4QHYA 4M1SA 4P4UA 5G41A 4RCZA 2VHCA 1FP6A 121PA 2XB2A 4FMDB 1NKSA 1GKUB 4IDHA 2QM8A 1FFHA 2LKDA 1HURA 1OIVA 1J70A 1QGYA 2F43B 1ZM2A 2OV2A 4NYIR 1NN0A 2GCOA 2NZJA 2Q9AA 5GJBA 4Q7JB 1FNDA 2ZJYA 3I72A 3OE7A 4M2LA 4PQFA 4P3YA 1A2KC 2O5VA 1X1RA 1X8JA 2VP0A 4MKIA 4LYJA 1BJKA 1KIMA 5B57C 3EIEA 3OFND 4ZKEA 2Q3FA 1RIFA 5KPDA 2IW3A 2E1RA 3C4JA 3OESA 5FL7A 4GFDA 1FOEB 2FU5C 5BW8A 1KDTA 1G21E 1NP6A 4BPRA 1T0HB 3WNDA 3B1XA 3OE7D 3ZQJA 5DYGA 1H8EA 2RAPA 3WP1B 2AR7A 3THOA 3NIBA 5FR1A 4EPVA 3OIWA 3AVYA 1OKKD 1IQPA 1WE2A 2EVWX 1Z29A 2YINC 1E69A 3I61A 4ACAA 1BS1A 5JEDA 4IFEA 3EPJA 1QVFB 4MH0R 4CRWB 1ZNXA 2J5XA 1SVKA 3O8BA 4B73A 3C7KA 3G71B 4CT5A 2HEIA 1A7JA 5HXBA 1KOFA 3PFIA 3C5HA 2YOHA 4LJ9A 4G5SA 4BECA 3AVPA 2VP2A 3I8SA 4XJXA 2JGNA 4WZAE 3LLMA 2XAUA 1EFHA 3RWOA 4DVGA 4ASUD 2FSHA 2XNSA 4XWAA 1D6JA 2QN6A 4DCSA 2J7PA 5C4MA 5HPYB 3BJIC 5AJYA 1ESMA 3I5XA 2J0VA 4NONA 1W5TA 3CPWB 3A8TA 2X19A 4OQLA 1W0JD 2A9KA 2EYQA 3LNCA 2XNDD 5H8WA 1SGWA 2DWQA 4LSGA 1XMIA 2GXUA 4URXR 4A0GA 2HLDA 2ZAMA 4IOLA 4XD7A 2HYIC 1ZM4A 2F1HA 3JVUA 5EXPA 2VSFA 1S1MA 4M1TA 3AP3A 1U8AA 2GHIA 2RB4A 521PA 5SZKB 4B33A 5TXGA 2C99A 3MRSA 1GFIA 5D3MA 1U94A 4V0NA 3GLHA 5LD2C 3I62A 2XNDA 4P32A 1R8QA 2ZRKA 3R20A 2H8KA 2ZU0C 4LBYA 4MGYR 1GKIA 4GZMA 2G77B 1KI6B 3MGCA 1FDRA 3A1SA 3BH7A 4M9XA 4UKDA 1CBUA 3NVAA 3SJBA 4G5GA 4D4LA 2PMKA 1ZJ6A 1KTVA 1DELA 3CPHA 2GVDC 4KV9A 2F1RA 4UXHA 3P4XA 4DLZA 2ERYA 4B2LA 3LX8A 2FFAA 1E2QA 1DBSA 3BAFA 5JCPA 5HCIA 4I4LA 2HCBA 3W5UA 2AWOA 5DLQC 5CB6A 1SXJC 1W48A 5CM8B 1TLLA 3CWZA 1SM4A 3VR4A 1E2GA 2V6IA 4URYR 1W34A 1OIWA 2GESA 3LWNA 3M4YA 1JI0A 2ONJA 1Z6AA 4XOIA 2ZU6A 3OAAA 1H8HD 4R2HA 4IVRA 2FEMA 2RGNA 4JL8A 4K8OA 1XMVA 1MO5A 3GJ7A 3QEJA 3GPLA 1SXJB 2W83A 3BORA 5GVRA 4TLCA 1HQCA 2J59A 4NYJR 2BN4A 5CIQA 2C9OA 3CCUB 3CZQA 1AS2A 4HB3A 1AZTA 1COWD 3CC7B 1Z0AA 1N0VC 3ZH9B 2CL6X 5TMPA 3QKTA 1G3QA 1OXVA 4KFRA 4GMDA 3TQFA 1N8RD 4Q4LA 1LS6A 1XFAA 3LBHA 3LQRA 3AF3A 3E5HA 4I81A 5JS8A 4JJZA 2WWGA 3EIHA 3QXSA 1LNZA 1S3SA 1YI2B 4OYHA 1XTRA 1UJ2A 4DDUA 1CF4A 2A5GA 1XWIA 2BM1A 2RH5A 4C0HA 3REGA 3M0EA 1R8SA 2BMDA 3QG1A 1GTVA 3KQKA 4F7WA 3MMPA 1Z0FA 4I99A 2BMEA 4XD7D 4HAXA 1A82A 1OFHA 2C9YA 1Q12A 1XMJA 2QPOA 5AUNB 3EPLA 1G8YA 1KDOA 2PCLA 2FN4A 4DLRA 1XCMA 3B9PA 2CCKA 2H5EA 4V0MA 4X8LA 4DQLA 3EASA 4B6FA 1J99A 1VMAA 1QG4A 2P65A 2XTNA 1XE1A 1XD2B 2BWJA 2OFXA 2Q0HA 4HLQB 1II8B 4TTPA 1GG2A 3WMGA 1M7GA 4L8GA 1KI8A 4B74A 2JLWA 2BJVA 2R6AA 3FMOB 5AUPB 2CEAA 5LB2A 5FPYA 2J46A 2AXNA 3KFVA 1FNNA 2QAGB 3S1AB 3I3SR 2CDNA 1EX7A 4EFLA 4Q1FA 3ICEA 2OO7A 4QFMA 1X8KA 2IEYA 3AVOA 2RC5A 1T3HA 3QJYA 4CF7A 3ETLA 1IAQA 2JJ1A 2C98A 1UDWA 4DBLC 4ZKDA 1Z5ZA 3U3OA 1JJVA 3T61A 3U44A 1CRPA 4LJYA 4LWZA 3UIEA 4JVNA 5FPHA 2ODWA 1G1MA 1XCGB 2BBWA 1F60A 2WMNB 1ZUHA 2GZDA 4QKQA 3QPWA 4U00A 3X1XA 3GQBA 1KMHA 3RHFA 4Y7CA 3O8RA 3CRZA 1Z63A 1NMYA 2ZAOA 4KLNA 3PUXA 1YRBA 1KQSB 3EW9A 1KI2A 1GAJA 2IUUA 4LV8B 1DAMA 4C4PA 1U0LA 1VQPB 1YKSA 1IN6A 2CCJA 2JDIA 1XRJA 3NBXX 4KYIB 1P2VA 4DJTA 1YR7A 1IM2A 2VHJA 4DXAA 1AKEA 2BKEA 3CXCB 4BRWA 2R2AA 1KI3A 3QFTA 2IWRA 5FOTA 1Q20A 3GCGA 3QKSB 4Q1DA 1M1KD 1KNXA 3CH4B 4Q66C 5E7JA 5L8VA 1T5IA 4IDNA 4OK5A 1DE0A 1US8A 4LHWA 3QE2A 4DLTA 3CCRB 4WW0A 4HSEA 1N6HA 2YWEA 2XTZA 3C14C 2IEZA 3WP0A 4TL8A 2JLUA 4UXIA 4DC9A 2C8VA 2V7QD 1TVCA 1UBGA 4TSFA 4BWYA 1FMLA 3OFNA 1QVGB 4DSNA 1IB0A 2O8CB 3IO5A 5FA6A 1KSFX 4PZYA 4P6VF 1NY6A 2V6JA 5LBIA 5AUOB 5C1BA 1RVDA 3GFTA 4A82A 5FL7D 1PV4A 5ELXA 1KI7A 1T0JB 3QSYA 3DM5A 1W35A 4R7ZA 3PR1A 1P6XA 5FOXA 4UNNA 2P2LA 3WYGA 3QF4B 5HZHA 2XOKA 4US2R 4OI4A 4BFVA 3MWLA 2ZI7A 2QA4B 3L2OB 3RDPA 4HI0E 3SC3A 3IPYA 5M04A 4BLSA 5JBQA 2BEKA 5DH9A 4DEYA 4A0HA 1AGPA 1RJ9A 2H16A 3K09A 1IXRC 2O0JA 1Z0KA 1E9AA 1ZD1A 4RD2A 2EFCB 1CIPA 3HU3A 2WWXA 4AYWA 4GT1A 1U98A 3DKPA 4YAUA 2CLSA 1BH2A 1Q1EA 2HT1A 4NCNA 1UKZA 4TYWA 2D2EA 2QMHA 2ONKA 3FTQA 4FWTA 4QL3A 3DOEA 2FGKA 4DLWA 3VO2A 1U8YA 4YONB 4RD3A 3BWDD 5JECA 1LV7A 1GRNA 1TTTA 3CNOA 4CDGA 3KB2A 3SI7A 5KNCA 4NYMR 3CH5A 2JATA 4D0GA 2Q21A 3R8FA 3X1ZA 2ZSDA 3LO8A 1IN4A 4QBFA 1W44A 4H9GA 2PX3A 1VIYA 1S1CA 4MRSA 3T35A 2IC5A 2YOFA 2ZR0A 2GEDA 5KSWB 3IKJA 3ADKA 1N6PA 1W49A 4ZDWA 4JIMA 2AKYA 3BS4A 1Z3IX 4PPGA 2IF0A 2X8AA 4V02A 2WOOA 1OSNA 1XTKA 3X1DA 3CNNA 1GNQA 3GEIA 2AK2A 2DFTA 1ZD8A 2GAOA 4OI1A 2GXQA 2X77A 3WY9A 4M1MA 4BQSA 3GLFE 1ZINA 3AGPA 4B3FX 3CRMA 4RSGA 4YMUA 2Z83A 5CJPA 2WWFA 2MMCA 4PZZA 4MGKR 3FHOA 1AIPA 4M22A 1TNDA 2R6DA 1M7BA 1II0A 2BEJA 4JMPA 4TSFD 1VYVA 3Q7PA 1GDDA 2GK7A 4I1VA 2OILA 5H70A 2JASA 2YZ2A 5G53C 1E96A 3P1JA 3CNLA 1W2BB 1EWYA 2RMKA 4KO8A 3LO5A 4OBEA 5GV8A 4LCBA 4DZZA 4W9MC 1OV4A 4F38A 2QRNA 3PG5A 2XGJA 1T6NA 3V76A 2J87A 2J9RA 1G5PA 2Q3MA 1Z6YA 1TADA 1EFCA 1Q0UA 2QMEA 5JWHA 3B1WA 2EQBA 3T1OA 1CR0A 4JVLA 1NVWQ 1TEVA 3ICQB 4ZCLA 3UWOA 2ZRDA 1OE0A 1R10A 3HP1A 2PZFA 4B48A 1GVHA 3LD9A 1KRHA 2RGGA 1C1YA 1NY5A 1JNYA 3CRVA 5H5JA 1GVNB 1H65A 2ZSEA 5EE1A 3WNBA 1RW4A 4YDHB 2H1LA 3EC1A 1N6LA 2UVQA 3ZVNA 4O0MA 1NBMD 4CYMA 4GP6A 1ZMXA 2KBEA 2ZJOA 1BYUA 1KSHA 4UNRA 2QT1A 2ZSFA 1E9FA 1XPRA 1G5TA 5JZVA 1HA3A 4Q7KA 5FI0B 3H2YA 5JHHB 1O87A 3REFA 4HE5A 1YIJB 3KQUA 1HYQA 5CLLA 4TN1A 4MDFA 2GXAA 4OJKA 4PPQA 5LDDC 1S96A 3AKCA 1S9DA 2G9NA 1BKDR 1NSTA 1QHSA 2XSZA 1YJ5A 3Q9LA 5EE3A 2PZGA 1TUIA 2O8CA 3KX2A 2R6HA 3IDQA 3LA6A 5FBVB 1E1QD 2RKOA 3ZDQA 4OQFA 4UAJA 1E9EA 2MSEB 5EUMA 2RHMA 1VCMA 3N5CA 5IT5A 3QF4A 4A2PA 3JQRA 1SQ5A 2B5OA 2J0UB 4IXNA 1JAHA 1E0SA 4Q1BA 1YHNA 3AF0A 3R7WB 1Q44A 1YQTA 3RRZA 4YMVA 4C3ZA 3SEAA 2VYQA 4LHZA 4S35A 1OH7A 3RAPR 4ZIRB 3CCEB 2BSAA 3K0AA 2XZOA 1Z2AA 1AS0A 4HAWA 2PL3A 4J0QA 2ZXUA 2ATVA 3UANA 4IFBA 5C4GB 3KJEA 1OGIA 3DL0A 1E4VA 1RYFA 2EFEB 2DWOA 2HYDA 3FMPB 3RSOA 1JJ7A 1PUJA 4AG6A 1N6IA 5DI9A 3LW8A 3QFSA 2XX3A 1KY2A 3AKYA 2CCGA 2OHFA 1PLKA 4URWR 1VQNB 1AM4D 2GCPA 1KC8D 2EFDB 3A4MA 3K9GA 4HLCA 4HB0A 1E2IA 4B3BA 2L0XA 4QXAA 1OH8A 1ZRHA 1IJEA 4OKSA 4TYNA 1YR9A 2FX3A 4B6EA 4FI3C 3EPHA 2X1VA 3BC1A 4YMTA 3TAUA 1FQJA 3CX7A 4LHXA 2AXPA 2QQEA 3AP2A 4QNMA 3C5CA 1E2PA 4JS0A 1SVLA 4DQKA 3GJ4A 3WHLA 3EWSA 1XX6A 4Z8XA 1KNQA 3GFPA 2TMKA 4G1UC 2XZPA 2FG5A 3HR8A 3CR8A 1KDRA 1KK2A 4BUJA 1QGAA 2R44A 4YALA 1H42A 3I73A 4EFNA 3LBNA 2DCUA 1HTWA 4M1WA 4X8OA 2GETA 3A58B 3ADCA 1V43A 5D3QA 5AJZA 5IDVA 5L3QB 1TQDA 4D0NA 1XJQA 1S72B 4EPXA 2FF7A 2B7CA 5TY0A 2G1KA 3AUYA 3T5DA 1F2TA 3CCQB 3CR7A 4A0RA 2WICA 2ZE7A 1D5CA 4RZ3A 2ZRHA 1JR3D 1ZVQA 3AGQA 2QNRA 3K0FB 3THYB 3LH5A 4POAA 2W2VA 2FEOA 4ZGQB 5JWOA 3CC2B 1CR4A 4QC2A 4KAXA 4B2PA 1D8TA 1VQOB 3KTAA 2J0SA 3G6EB 4B44A 4ZGNB 4EPTA 4N0EA 4O3MA 4TZ0A 2QA5A 2D2FA 1AJEA 1OXSC 1ZW6A 3LQQA 1A5TA 2ZRMA 3AEZA 4M21A 3RANA 5DN6D 1OKKA 1FMJA 1KKLA 5F98A 4M53A 2HJVA 4ILEA 5DHAA 2BBTA 2WJHA 5IK2D 1Z28A 3IO3A 2BIFA 5KSZA 3TSWA 4TT3A 4V03A 2OEPA 2PZEA 3W2GA 3AUXA 3K53A 3MD0A 2GJSA 1K8RA 1NF3A 3OZXA 3SYLA 5G40A 4TMTA 3BBPA 1O3YA 4HB2A 2FFQA 2V9PA 4F4JA 4PX9A 1YJ9B 2F55A 1CJUC 1E2NA 4FW9A 2R6FA 2ZRPA 4NL4H 1HE1C 4GPTA 1YU9A 3CONA 3VQTA 3L8ZA 2IYRA 5A0FA 4KVGA 3VR3A 2IA5A 4F4IA 2CXXA 2V54A 2IUSA 3NEJA 4W7SA 2JA1A 4B76A 1JB1A 5JCZA 2D7CA 2VLIA 4M9QA 1RPZA 2XNJA 3MLEA 3SQXA 4O2RA 4YQFA 3T15A 4DRZA 2YVUA 1E9RA 1UBFA 3KKPA 3U7FB 2C03A 2GQFA 3T34A 5KO2A 5JSZB 3DO6A 2HF9A 2ZRBA 4E07A 1QUFA 4IRUB 1WRBA 3NBYC 4DT1B 3IBYA 2J0UA 5JS7A 3LFUA 2QAGA 3X2SA 2JLSA 2ODBA 1A2BA 1GP2A 3K9LA 3QEOA 3ZIAA 2OK7A 1Q3HA 5HTKA 1W36B 3SFVA 3WBJA 1K5DA 3DDCA 1H8ED 2GAAA 1XU4A 3FWYA 4AY2A 4YAWA 4A36A 3U44B 1Q57A 4BFTA 1W36D 8OHMA 4ZCIA 4HUTA 4GSYA 5JMTA 1NN5A 2CVFA 2IYSA 2R8RA 1TPZA 4DB2A 3X1WA 2Q9CA 3CF2A 5CYPA 4LPKA 1E9BA 3FE2A 3NDPA 3ZIAD 1W36C 2VSOA 3VFDA 4BFYA 1UADA 4NE2A 2C04A 3NTUA 4Q1AA 1R6BX 4LBZA 2IX3A 1E79D 4OK3A 2JLXA 4ZCMA 3OAAD 4DLXA 5C2JB 1KI1A 3CB4A 2B8TA 2KWIA 3DZ8A 5LD2B 1NRJB 2QMOA 1F3OA 1VQKB 1E2LA 1IJFA 2X2FA 1E3MA 3GJXC 2FJUA 4GZLA 5GADl 4IDQA 4JLKA 4PAMA 1Q1BA 5DYIA 3SJZA 3K70C 2J7PD 1Q21A 2BBOA 2ZR9A 1TUEA 3AVXA 3L0PA 2YWFA 2XJ9A 4RFSB 2WKPA 5P21A 4FIDA 3ZGXA 4D4MA 4XIGS 4XWOA 3B7GA 3HJNA 1T9HA 3WYFA 2RGXA 4AC9A 1NLFA 4L16A 1XEFA 3CM0A 5JJIA 4ON9A 2VNJA 2AD5A 1G3IA 5FUXA 1LF5A 4UNPA 3EX7C 4V0KA 2IYYA 2NIPA 1N3BA 1Z6XA 4Q00A 3ND8A 1AKYA 1E2JA 3MSXA 4OHWA 4QGGA 5FBWB 2XEXA 3R9XA 2A5FA 5L3QA 3PCRB 2HUPA 3OEHD 4DLVA 4WZBE 1OGJA 5E3HA 4JVMA 2PCJA 2QQ0A 1QX4A 5BN4A 1JB9A 2ORIA 4UNQA 1GRQA 1MO6A 1PLLA 2ZRAA 2IK8A 1OT3A 1NDHA 1VG0B 2XB4A 4OQNA 4KFTA 4AG5A 1KI9A 1SVWA 4FWIB 4B35A 2OAQ1 2ZRLA 3PV0A 1SXJE 1B23P 2KB0A 3LXRA 3THYA 4TWZA 1UAAA 4LGMA 4TL7A 5CK4A 3EZFA 2QP4A 1SVSA 2OBNA 2VP4A 4YLGA 4Z8YA 4M4SA 4N3GA 2OM2A 1QUEA 1UBEA 4KBFA 4ZI3A 4L4UA 1G291 1VQ7B 2B21A 1LS1A 1Q1ZA 4C0SA 1QVRA 4PC3A 5KSPA 4GDFA 4MKGA 4JLMA 1QHGA 3RS3A 2OUKA 5IRCD 5TARA 4AKEA 2MSCB 2C2HA 3M6AA 2CL0X 5J4YA 4D25A 1R0YA 4RZXA 1CEEA 1XJ0A 1WCV1 1VQLB 3GJ3A 4DEXA 3OIUA 3QIAA 1BX1A 2BGIA 4V0OA 1K9MD 1GNRA 2VNIA 1ESNA 1EWQA 1R5NA 4US1R 2YNMA 1XTQA 1L2TA 3PXGA 1XD8A 2H92A 2NPIA 1SHKA 1P62B 2ZTSA 3G0HA 1HT2E 5DSZA 1JR3E 5H59A 1T3LA 3G4SB 4EJSC 1SKYE 3I32A 5B64A 2Z4RA 3QXCA 1F6BA 2Q9BA 3D6TB 4MUAA 1E9DA 2QU8A 3CCMB 1CR1A 3L0SA 5KNBA 4EJSA 2ZRIA 1T5LA 3QY0A 4U7DA 2VHUA 5KSOA 4F4CA 2CBZA 1G3MA 2H57A 4JLAA 3VU9A 4E03A 2QTFA 2PBRA 3RSLA 3GMTA 3KZ1E 2JDID 4Q18A 3TRFA 4B2IA 2EU8A 3B60A 1QHHA 2BVNA 1F2UA 1N25A 1TEXA 2I1QA 3DZDA 1G4UR 3FDIA 2X3UA 3P20A 4L15A 1E6CA 3DKVA 4L5BA 4JLOA 4RKFA 3Q72A 1N6RA 5CK5A 3X1YA 1XXHB 3UG6A 3W2EA 2WKQA 4N0DA 3QKUA 1UM8A 2OFOA 1FRNA 3WNCA 5KPJA 4EIWA 2FH5B 4URUR 2SHKA 4Q9IA 5CITA 1YZQA 3Q3JB 3HU1A 1G20E 2RC6A 1IN8A 3MWYW 4HUQB 1UPTA 1G3RA 3B85A 4MGZR 5J4HA 821PA 1MO3A 1VECA 1MABB 1XEXB 2WSSA 4G5QA 3RC3A 4TQAA 3VR6A 3KFXA 4DLUA 4BZQA 1DTSA 2BOVA 3CKLA 3ZYCA 3RC8A 1GAQA 2VYFA 1FPMA 3AVVA 2BCJQ 3J81k 1GNPA 5F2EA 4BASA 4MRRA 5AWFC 3LX5A 4A8JC 1Q82D 3AVWA 1MRNA 2WOJA 3QG5A 1IXZA 5AJXA 5L3RA 2GILA 3U3JA 1TL7C 5B30A 4FN5A 4KSCA 2FPKA 3CW2A 1KO8A 2G0TA 3VKGA 1FUKA 2JIZA 2ECKA 3A4NA 4MKHA 3QOFA 4IEIA 4TQUS 3EIQA 4DIEA 2RGDA 3EXAA 5IK2A 5L3SB 2QTZA 3SU8A 5CM9C 1NJID 3K8YA 3NH9A 3QPUA 4TZ6A 4F91B 2O8BB 2CE7A 3CPEA 5FPTA 3Q8XB 1JAIA 1QHIA 4QBIA 2I1VB 3IGFA 3WBKA 1W0JA 4P33A 1U0HC 3M1IA 1ZIPA 1FRQA 5J4LA 3T12A 5J4VA 1FZQA 2V4ZA 4AYXA 3BRWD 4WXPA 4Q9JA 5SZHB 3QF7A 3V9PA 5G3ZA 2JIZD 4MRNA 1V5WA 1J7KA 3EWAA 1W0KD 2KJQA 4OI0A 2G83A 2D3WA 2FV8A 4KFUA 3QKSA 5FTNA 2ZREA 4LZZA 4KODA 1DPFA 2GTPA 2GF9A 1QVAA 5JWRA 5HZKA 3NDBB 1RE0A 4G5RA 1Z0DA 1VYUA 1XZPA 5TDHA 4F92B 4B47A 4TMWA 4PPFA 1RRPA 1CNEA 4PTLA 3EARA 1P61B 2GEVA 3O8CA 1MT0A 3EC2A 3R7WA 1UKVY 2G0NA 1M90D 1H85A 1Q7YD 1E98A 4ABYA 4AI6A 4ZIRA 1ZM3A 2QEXB 1IOZA 1IY1A 4Q9LA 4QNRA 2GJ9A 4DSTA 4BEBA 3SQWA 2NO0A 4QGHA 1PVOA 4QHTA 5JI3E 4XWKA 3CCJB 1FP7A 2LCFA 2ZSBA 2CNDA 1EWRA 2EW1A 4EFMA 1LY1A 3I55B 4TLAA 3H1TA 4TYPA 4RD6A 4C0AC 3CCSB 1G5RA 2X2EA 2WWYA 1KYIA 1D2EA 4CEIB 3U3KA 2VSXA 3KL4A 3PEUA 3LVQE 2BGJA 1BYIA 2ZR7A 1VIAA 4ZDIA 1T4GA 2W0SA 2ZIAA 4LPSA 4Q9HA 1QFYA 1P60A 5G3YA 5FOSA 2DEUA 3K70D 1A8PA 4AF6A 1OXTA 1W46A 2N1BA 1IN5A 4QJ5A 1M8PA 4KYUA 2HMAA 3KXLA 3QVUA 1CQXA 2AD1A 2H17A 4TMKA 4Y9UA 1TQ4A 3QFCA 3ZZ0A 3ONWA 5DHFA 1NSFA 4W5JA 4LI0A 3KKOA 4JYCA 1NVVR 2F3TA 1OF1A 2XITA 1M1YE 5DNYB 1JBKA 1WXQA 721PA 2E9SA 5EUQB 2F7SA 2PLFA 2W2TA 5AN9A 1YZTA 2QGZA 4YAOA 3HU2A 1MRSA 4ZI2A 1KI4A 4IVPA 5D3MB 2WHXA 4WXRA 2DR3A 4PSKA 3DMNA 4TMZA 1PJRA 1XTIA 1EP2B 3SHFA 1DS6A 1R4AA 2HT6A 4AK9A 4Q4AB 2W6JA 4MDEA 2VEDA 4JSTA 3ZVRA 3CPJB 4C0JA 1OFTA 3IBGA 3TKLA 1UDXA 2WM9B 2IS2A 2HLDD 1Z8FA 2HXSA 1G6OA 3H86A 1L4YA 1VG9B 2EWVA 3VTKA 5KOYA 1AZSC 4FINA 3VR1A 1OB5A 1EG7A 1XMSA 1E9CA 1AS3A 2A78A 4HZIA 3W2HA 5K8IA 2QUZA 3EA5A 2BJWA 4C0BA 2NO1A 2FFHA 3MHPA 3VNVA 4Z1MA 3SR0A 5GJVC 5E4FA 4LX0A 2PEYA 4NH0A 2QY9A 5B58C 3SN6A 2ASEA 2OFWA 3EG5A 1Q3TA 3TSZA 1YE8A 3CO5A 1OH5A 1VDZA 4JLDA 5TB5A 1VQ5B 1AMOA 1E2HA 3JZAA 1BMFD 1X8LA 4TYYA 1EXMA 2ZI6A 4EKDA 3IIJA 4LRWA 3RWMB 3ZS9A 2XXAB 5GJWC 3N2IA 1G7TA 3DMDA 1JALA 5EP1A 1EFRA 2WWHA 2DPXA 3THWA 3B13B 3QXJA 1VHTA 1GZSA 4IOMA 4PO9A 4R98A 3AM1A 3DEFA 2ZS8A 4D2IA 4D82A 2FFBA 2P5TB 2IHBA 4Q02A 1W87A 1YJNB 4IVQA 2OCBA 4LJ4A 1NBME 2AX4A 5FBQB 3CC4B 2ZITA 2F9MA 1G3UA 1N0WA 2CMKA 3L82B 4QHSA 4XVQA 3GLGE 1E2DA 4W5WA 2KSQA 4YAFA 4DLSA 1F48A 1G16A 3GLHE 4MUBA 3PEWA 3FPAA 4NYMQ 2FSFA 4URVR 4JT4A 2ZYUX 4EPRA 2DYKA 4US0R 4LV5B 1GL6A 2QL6A 2W00A 2VF8A 3T1VA 1P3JA 1DDIA 2GNOA 5EP3A 5BYJA 1E2FA 3W3ZB 1AN0A 3ZBUA 4N3NA 1CS4C 2ZI3A 3I8XA 2WPDA 4NCIA 5FPSA 2ANCA 3SS8A 1NG1A 1HH4A 3R9WA 4KBGA 5CIWA 2QSZA 1Z6TA 4AYTA 1XD2A 5TR9A 1W2GA 1E0JA 5HCNA 4PAOA 3WMEA 1HT1E 1YZNA 2C77A 2QEQA 2ZEJA 3A6PC 4KU4A 5BN5A 1HY3A 1L7VC 4LJ5A 5F9HA 4GL2A 4LBVA 1X6VA 5FFMA 2XOKD 4NZYA 2GK6A 3BB3A 3ECCA 1DARA 1TMKA 2A2ZA 2OXCA 1CJMA 1ONBA 5CDFA 1XEWY 4HB4A 2B6HA 2GJAA 4KHZA 2BDTA 1Z07A 3IILA 1P4SA 1U0JA 4CEIA 3HDTA 2ZJZA 4UNSA 2ZUCA 1P72A 3BXZA 4Q1EA 4NKRA 3CIOA 4HDCA 3WXMA 1XNJA 1RYHA 1JR6A 3QXHA 2OBLA 4WIAA 3THXB 5EP2A 2QTLA 1BMFA 4PHHA 1CTQA 2Z4SA 4Y9RA 2KE5A 4LYHA 2QSYA 2ZJBA 3FB4A 2ZETA 3K0CA 4R9UC 2G6BA 4FMDF 3K1JA 2JJ1D 4RFSA 5DGXA 1Y63A 3SE0A 2QBYA 3NC0C 2VPPA 3QI2A 2IHYA 3AF1A 4LV6A 2XJ4A 4FCVA 1QDEA 1XP8A 1CJKC 4QM6A 4QBGB 3W5HA 3GJ0A 3TW8B 3PEYA 2ZRFA 2NO7A 2RHDA 3TMKA 1NN1A 1ZU5A 3U3RA 4EPYA 3O8DA 1C4OA 4D26A 3FHCB 2OBMA 1KAOA 2Z6VA 1N6OA 4K81B 4JBWA 2OZEA 3FKSA 1S8FA 2FA9A 2E87A 2DWPA 2CE2X 2F3RA 4A92A 1OHHD 1KJZA 1HQYE 2BCGY 4PHFA 5E7IA 1QHYA 2WPDD 4I1SA 1ETUA 1TU4A 2LKCA 3NKVA 4HAUA 4FCTA 2G3YA 1DO2A 4YDSA 2OG2A 2VHQA 3W5JA 4B34A 2VL7A 2GVZC 2JJ2A 2P0EA 3CUEF 3TSOA 4OHXA 2CNWD 3MUFA 3G82C 4MITA 3TNFA 1I7PA 2FGJA 1VYTA 3ZQ6A 2BKUA 2ZRNA 4H1UA 2WWIA 4B3GA 4LC1A 3U3MA 2V1XA 1FL9A 1AQYA 3AB3A 1WB9A 1NLYA 4CEJA 1QG2A 1Z06A 4YMSA 1KK0A 4AF7A 3K9HA 5KUTA 5L3VA 3W6PA 1SULA 1ZIOA 1NN3A 3GLGB 4KITB 1NVVQ 1VQ6B 1B2RA 1N5LA 2O8FA 2JJ2D 3ES9A 4Z51A 3K09C 1L4UA 1DAEA 1M2OB 1CU1A 1N6NA 1YZUA 1CJVC 4BPBA 3FJOA 4JLPA 2H18A 2QPAA 5FTMA 4EQ6A 3GLFB 1G17A 3BK7A 3CF6R 2BHRA 1K5GA 5FR2A 4C0LA 1M7HA 3H4MA 2R9VA 2F43A 4C43A 4TMVA 3E1YE 4Q7LA 4YMWA 1T8UA 3KJIA 1E2EA 2ZPTX 1YJWB 2VHTA 5E95A 4HATA 1Z0IA 4QRHA 1RRCA 3NC1C 2FE4A 1Z47A 2NQ2C 4B3DA 1L8QA 4Y0AA 1JECA 2ORWA 4RJLA 5FTLA 4LJ7A 1MKYA 3WRXC 3DPUA 4JJKA 1PLJA 2CHVA 1P2TA 1TU3A 5GV7A 3ZLJA 4EDHA 3ZS8A 2ZM5A 1G19A 2EYUA 3VKHA 1ZNWA 2IS4A 3FOZA 3N2EA 2OTLB 5DN6A 2XSZD 1JPJA 4OQMA 3A1TA 3KXIA 4Q21A 4Q5IA 3R9IA 4MYUA 4X8HA 4NU0A 4RFVA 5GJCA 2YC2C 1R7RA 1Z0JA 1A1VA 2OK8A 4TLDA 2CRVA 3OZWA 4ASUA 4DHEA 4A2QA 2Z5FA 2GJKA 4GMXA 4HLDA 4DCNA 2YWGA 3W2IA 1JJ2B 4ZV4A 1II9A 4ITRC 4A6XA 2OSBA 4U9UA 2B92A 3TR5A 3MWKA 2UZ3A 4HDOB 4IDPA 1GL7A 2F1JA 1E63A 5EXTA 4TMXA 4NPHA 3BB4A 2A5YB 4V0LA 2BC9A 3UWKA 3QBTA 2W6IA 1OLOA 2JLZA 1F5NA 2AHOA 3QQ5A 3VO1A 1ZNYA 1BOFA 3K70B 2OLJA 2ZS9A 2GPJA 5FBRB 2O8DA 1G7CA 1QG0A 4B32A 2CNWA 2EFHB 3OIYA 1JXMA 3VNUA 2AL7A 2MSDB 5SZIA 3EA0A 2ZQ5A 3O47A 2O8BA 621PA 1XD9A 3LLUA 3TK1A 1LFDB 4HE6A 2BMFA 4IOKA 2FPMA 2PT5A 4JL6A 4TL6A 5EZ6B 2DFLA 1E79A 1KJWA 1OYWA 2P5SA 1EP1B 2QBYB 4OHVA 4NDZA 1WQ1R 2AWNA 1E99A 1P75A 3SDZA 2A7QA 1I4DD 3H0KA 4OJQA 2GF0A 4OHZA 3A1UA 2VRWA 4HZUB 4KI0A 4D0LB 4EUNA 1OW3B 2JLVA 5AJWA 3VAAA 1FNCA 1DO0A 1CRQA 2PIAA 1JEDA 1KJYA 2ZRGA 3B2EA 4CIDA 5BYKA 1CR2A 3F3YA 2D4HA 4I1UA 3B1YA 4IKEA 2Z43A 3IIKA 1W1WA 1KZ7B 1N5IA 2D62A 5HKKA 2DFKB 4II7A 3GJ8A 3Q5DA 1OFIA 1I2DA 1U99A 3K9NA 3EZ2A 3EZ9A 1XTJA 3CX8A 2OTJB 1QHNA 2JLRA 2GXSA 3W8RA 2ZROA 4KXFB 4NYIQ 1ZUIA 4PZLA 5AK0A 4LOAA 3RRMA 4JVSB 1AQUA 1NVUQ 3F5FA 3LAWA 4QJ3A 2QTVB 3JVVA 4I1OA 2BM0A 2FSIA 1JQJC 1KK3A 4O2LA 5HKKD 4DB4A 2A30A 1P2SA 3GJ6A 4YXWA 2IF2A 3ZD6A 3A36A 4CEHA 1ZNZA 5DISB 1WBDA 1GJRA 2ZI9A 3U7EB 4PXAA 4ZO4A 3MG9A 4CGZA 3AQ4A 4WA7A 2N42A 4EAQA 1X86B 1IY2A 5EXSA 3K0AB 5J40A 4DWJA 4Q48A 4R2IA 1FTSA 4JSYA 5BQ5A 1IONA 2K5UA 2CJWB 3CD6B 1E0KA 3UXMA 4HEJA 4PFSA 3LY5A 2WIAA 3UPUA 4P4SA 3KQLA 5HE8A 2NMVA 4CEJB 1VG1A 5JHGB 1NJFA 3P27A 3SBDA 2OXRA 3RRNA 1PUIA 2DY1A 2OAP1 5FOWA 2ZJ2A 4OI2A 1XDBA 4AD8A 1EGAA 1ZP6A 4A2WA 5KSYA 3U4QB 2QRZA 2GA8A 2Q6TA 3B5JA 2GRJA 2G1JA 2J3EA 4TT3D 5KDLA 1HUQA 4ESHA 3I1FA 3OZUA 2O8EA 1GWNA 3CMAB 1MR3F 4DDWA 1S0UA 1GR1A 3U5ZB 1KD1D 2ZRJA 2ORVA 1FX0B 2CK3D 1IBRA 4U5XA 1UMKA 2NO6A 2F1IA 5C46F 1M34E 3QXXA 1NIJA 5LB4A 5HR5A 2R65A 1VCIA 5KTYA 1GKYA 1M74A 1KZGB 4ARZA 2IS1A 5JEEA 1YZLA 1KKMA 2F9LA 3RNLA 3VU9B 1KO5A 4Q7MB 1G9XA 4PANA 2W0MA 2EWWA 1QZXA 1XJCA 3HYTA 3B8HA 2GZAA 1JA1A 3UG7A 1QHHB 3CWQA 1F2UB 1YZGA 4G1VA 3NHAA 5FTJA 1GM5A 1XCPA 1NMXA 1II8A 3NHBA 1W0KA 4L9WA 3N70A 4M9ZA 4C0KA 4C2TA 3NEYA 4M1KA 4D4KA 4BE7B 1S2MA 1OB2A 3PENA 6Q21A 4DDTA 3S1AA 1VQ9B 1QFJA 1YHQB 2ZSAA 1NI3A 1GRRA 4TTQA 2WJYA 2O0HA 3Q5EA 3PUWA 4NHOA 1SKYB 2YJTD 2DBYA 3VX4A 2P6NA 2GDJA 1ZM7A 3CRRA 3IHLA 4MYCA 4PSVA 4BLQA 2Q3HA 3D8BA 4HUQA 5JJLA 2VNKA 2IXGA 3K0FA 3KJHA 4KSBA 1H8HA 5HE9A 3V4FA 4JYBA 3L0OA 2ODNA 3F8TA 1SXJD 3A1WA 2NO9A 3AP1A 4Q4JB 5CLQA 4JL5A 4TL9A 2FZ4A 3IHWA 3CCLB 4JKYA 4L9SA 2ZE8A 2O8DB 1U81A 2WSSD 2EIXA 2QZ4A 1NKTA 1TAGA 2ZYVX 1VCNA 4MRPA 5EE5B 3W5VA 3ZZTA 4DCVA 1I4LD 4QM7A 2QENA 1CP2A 5KDOA 1P7CA 4BZPA 2C78A 2YHSA 3NBZC 2QP9X 1KY3A 4A8JB 4BZXA 5FOUA 4P0TA 5L3SA 5FL3A 1OYYA 2DFNA 4NYJQ 3SYNA 4JKIA 1W2HA 3BIFA 1EP3B 1TF5A 4V0ME 4GP7A 2IL1A 4YC7A 2IYLD 3HPQA 5CYOA 3HWSA 3E20A 3GEHA 1NG9A 2UKDA 1W4RA 4BFXA 1Z2CA 4WAUA 5SZJA 4NP6A 3I4LA 3SYKA 3PEVA 3B82A 4NBSA 3AVUA 3PVSA 2QDXA 1US8B 3TBKA 2JJ8A 3QENA 5JRJA 4AIIA 4NTZA 3MWJA 2RCNA 2AK3A 4HYYA 3W5IA 4D80A 5JLJA 4FXPA 2QE7D 2AFIE 1G4AE 4QGFA 4ZPXA 4OHYA 4G01B 2ZUBA 4DLYA 4ESVA 3LDAA 3IEVA 2GKSA 4BLTA 2IYQA 3OEHA 3NXSA 1VPLA 1Z6GA 4X8MA 3WRYC 2P6UA 3V4RA 5EP4A 5JSZA 1E0AA 3BH6A 1TF2A 3HYRA 4DT1A 1OPXA 3AKDA 2QT0A 5FPKA 3E1SA 5FI1B 1W47A 5CB8A 2G88A 2FSGA 4QOSA 1DG1G 3RLFA 3GLIE 4RKEA 3TJZA 1FTNA 1RJ9B 4PC2A 2WKRA 3FPKA 1R5OA 2CJWA 2KBFA 5KU1A 2W6ID 4XVRA 5EQTA 2QAJA 3UMRA 4RVCA 4CVNA 1GILA 1MV5A 1J9ZA 3P4YA 2PLRA 3QPVA 1BQEA 1D9ZA 2ZE5A 4UQOA 1KO7A 3U6BA 4WOPA 4ZDJA 1X1SA 3LVBA 3B78A 3RABA 3UATA 3U60B 4Z1MD 1G64A 3U4QA 4YHBA 3ZJYA 2IS6A 1WMSA 1E9SA 2ZJAA 4DSOA 4RY2A 5J5CA 1EFTA 3TAHA 4DSUA 2ZRCA 3FYHA 1FQKA 1FX0A 2AFHE 3W2FA 4JBYA 3PITA 4HLUC 2IYZA 1OJLA 4JBXA 3H84A 1WBBA 3DHWC 4JLJA 1BX0A 1W5SA 1VHLA 1QF9A 2VP9A 4Q9KA 2JAQA 4NCKA 1Q22A 1TQ6A 1GOTA 1KGDA 1ZM9A 3GLHB 3RS7A 1VQ8B 1ANKA 1CKEA 3RS0A 2JLQA 3P26A 4JLNA 2C96A 1COWA 2CLDX 5BWMA 4XH9B 3W34A 3RS5A 5IHPA 1N0UA 1OXXK 2WJJA 3KB1A 1Z22A 4LUCA 5DI3A 2PX0A 4MYTA 3C8UA 4M8NE 3CF0A 1RRFA 3SOPA 2V55B 2ZI4A 1D2NA 1ZYUA 2RGNC 2D06A 3NBFA 4KCGA 2W6JD 4WZ6A 3PJRA 4RD4A 1MO4A 4PGOA 2LWIA 4QG7A 4BFUA 1YZKA 3OEEA 421PA 1SVMA 4Z54A 2QROA 2JLYA 5GVSA 3LBIA 5J47A 2V1UA 1AGRA 4Q4JA 1XF9A 2HV8A 4UXJA 5KNDA 4IXMA 2ZS7A 1XBTA 1VQMB 2IUTA 4NCHA 1T3SA 4LJ6A 4C9BA 4ACBA 1DAFA 4D4JA 2IYXA 2IWHA 4NCJA 1K6MA 1WP9A 2HF8A 2BBSA 3EZ6A 4A8JA 2YOGA 1Z83A 3TIFA 1ELOA 4HAYA 1KSJA 2WIBA 1QH0A 1NL3A 2PT7A 3QKRB 4KLZA 3GLFA 5FH9A 5BN3A 3EZ7A 2YV5A 1SZPA 2MMGA 3DM9B 3ADBA 1NMZA 4M9SA 2VIIA 3FGNA 4OQXA 1CNFA 3OF5A 4TQ9A 3KKQA 3BERA 4GBMA 2WJVA 4BFZA 2VZLA 3TVDA 2QI9C 4GI7A 4BLOA 4PC1A 1VQ4B 2GZHA 1XTSA 4IEEA 1A4RA 4FMBB 1XPOA 1YR8A 2GCOB 3IIMA 1CJTC 4TLEA 4XTRA 1G7SA 1M6NA 1HE8B 1UEJA 2ZUDA 1VCOA 1WF3A 2OCYC 3KKNA 1FNMA 4R71A 1G8FA 3PQCA 2QAGC 2VP6A 4HAVA 5IF9A 2PMDA 1GSIA 1XZQA 2FOLA 1SKQA 1XXHA 2GCNA 2IBMA 4LHVA 4A6PA 2CVHA 4AURA 2PJRA 4GNKA 1EFRD 1MH1A 1YITB 1MOZA 2FZLA 2NZ8A 2WJIA 3TUJC 2IXFA 1SVIA 4ERNA 3EPKA 1UKEA 1P5ZB 4BLRA 2D74A 2DERA 3LW7A 4C7OA 1E2MA 5FBLB 1IHUA 3UK6A 4B43A 4B75A 3OIVA 5B2ZA 2R6GA 4C2UA 3PUVA 1MABA 1T91A 3OEED 3BFXA 1J8MF 4RD0A 4RZUA 1FW6A 2PJZA 2QM7A 2O0KA 3PUYA 1CXZA 2V7QA 4RD1A 4DDVA 3C15C 1W4BA 1LF0A 4HAZA 1DAKA 1OIXA 2NOAA 2CHQA 2WSMA 3KJGA 2RGCA 3CLVA 5H1YA 3U61B 2I3BA 3IPXA 3UMFA 2FPLA 1LVGA 1TQ2A 4F7DA 4MRVA 1DAIA 3QVVA 3KXKA 5FTKA 3AH8A 3FVQA 3W8NA 1I2MA 3SHWA 1JA0A 2P3SA 3E70C 2REBA 3B6EA 3V00A 4E09A 3THXA 3MFYA 3BGWA 2V3CC 1W4CA 4LK2A 1XPUA 4HDQB 3EAQA 2NPFA 1NLZA 3CRW1 4KJZA 3QFRA 4K1XA 1B0UA 1J2JA 3RVBA 1ZAKA 4HZUA 2C5LA 3BE4A 2GJ8A 2ODEA 4U02A 3I92A 4G5OA 5AJVB 4Q4HB 5TVKA 3ASYA 3JQPA 4XVUA 3IQXA 1ZUNB 3B9QA 3DOFA 5H68A 4XTCS 1EX6A 1VG8A 1RC8A 4PQRA 1JEEA 4UJ3A 2VP5A 4Q19A 4IOJA 2IYVA 4Y0VA 2IT1A 1YR6A 2XTMA 2UZIR 3OZVA 3K0CC 4G1BA 3B1ZA 1JXOA 1UKYA 3GFOA 4GRAA 2XZLA 1E1RD 3QBVA 3PUZA 4B71A 3C41J 2WAXA 3CZPA 1ZBDA 2P67A 3CRQA 3W90A 2QE7A 1KI6A 4BFSA 1HV8A 2FMXA 1E62A 3OJXA 4JT2A 2D7DA 1U8ZA 2GWHA 1FNBA 1WDTA 2QMUA 5JI2E 4BRUA 2REXB 2AKAB 1KSGA 3DVLA 1G41A 1QBKC 4Q47A 3RYTC 2GEUA 5A4JA 1X3SA 3ADDA 2YC4C 1GIAA 2P6RA 1E1RA 3D31A 2OESA 3LV8A 2VA8A 3L43A 3CX6A 2XNCA 1HEIA 4Q03A 2RGEA 5THXA 4Q01A 2Z0MA 4AWXA 3GP8A 4FCWA 1DAGA 1KMQA 2VTKA 3W3AA 5FUWA 1J8YF 5AUQA 2VBCA 3VKWA 1ZC3A 2N46A 1LTQA 2A5DA 4BLPA 4D6PA 1U2RA 1NNEA 3ZBTA 3IEUA 1Q1QA 4XSGA 1K73D 4PSAA 3MAAC 1GITA 3C16C 4GOXA 5EXXA 1P73A 5F3WB 1P9WA 3GLGA 2O8FB 3UMSA 3U6KA 2O8EB 5K8LA 3SZRA 2RGAA 1G6HA 2H7VA 4FMCB 5TV2A 1GUAA 4FMCF 4WVFA 1CLUA 2I4IA 2HJGA 4A15A 4PHGA 2QTHA 2NTYC 4EQ6B 1OHHA 3AF4A 4ZDKA 2FDCA 2EFGA 2QGNA 3WYAA 3P32A 4MQBA 2HCJB 3A37A 3TUZC 1E94E 1P9RA 5JJKA 2ZANA 1Y3AA 3ZZUA 3GLIB 1Q81D 1D1NA 1UF9A 3AV0B 4ARZB 5AR1A 1KHTA 3B1VA 2VO1A 3GD7A 3LVRE 3E2IA 4G3XA 2PEZA 2PH1A 1QGZA 2J7KA 1S9HA 3FFBA 2B8WA 2WMOB 4E22A 5J4KA 5EE0A 1R0XA 2VQSA 3A4LA 5DIFA 1RFLA 4AKIA 3CCVB 3HR7A 1S4QA 3HPRA 2OCPA 4S2EA 4TLBA 4Q4AA 4N1AA 3QNUA 3NWJA 4LJAA 3TW4A 4QJ4A 1NBMA 2W58A 1R0WA 2DHRA 4IDOA 4M1YA 3W6OA 3I5YA 2DB3A 4CT4B 1E64A 2CL7X 3BD9A 4PHTA 1JR3A 2OCAA 5ANRB 4LY6A 3BFVA 4C7OB 4GOJA 4BGDA 3BFKA 4PO1A 3U7GA 4CZ2A 1KO4A 2JCSA 3MJRA 3VR5A 2WAYA 1GO2A 1EFUA 3IUYA 4LYAA 2IYTA 3CMEB 3L8YA 1P2UA 5E7MA 2OE2A 3AF2A 1QFZA 3K0SA 4IW3B 1GL9B 1KAGA 3KDSE 4H1VA 1TX4B 3ASZA 3T06B 3ZVMA 1E32A 3MJHA 4A0FA 1XB2A 4M1OA 1U90A 1YVDA 1E1QA 4EPWA 3SBEA 1QHXA 2B7BA 1KMHB 1DDGA 1U9IA 5K8UA 2XXAA 2ZYTX 1D2MA 4JZKA 4W5HA 4IJMA 5EJEA 2YYZA 2KI5A 1G18A 3OW2B 1KDPA 5CDFE 4TTRA 3THWB 1R2QA 2IYUA 5DE3A 1IY0A 1C9KA 4JLVA 5EZ5A 1LW7A 4DCUA 3FFAA 2IYWA 3FKQA 2O52A 3VHLB 221PA 1J90A 3MCAA 1ZD9A 2ZVPX 2WVJA 1N5JA 4NMMA 4Q4HA 4LDJA 1YRAA 2J0QA 4URZR 3FHTA 1FUUA 4M0LA 3G5UA 3GJ5A 3RS4A 3IQWA 2F6RA 3KQHA 1N6KA 5A5GA 1UFQA 5EE9A 3ZVLA 3KUCA 4TYQA 1SVOA 3LRPA 5C18A 2FNAA 2ZYWX 2A5JA 5FUVA 3QE0A 1K8AD 3GEEA 4DKXA 4UJ5A 2CK3A 4KVAA 2BMWA 2BF4A 1G8HA 4LYFA 1ZU4A 1BIFA 2WWWA 5K8TA 3KQNA 3F0TA 4B3XA 1ODFA 3FKSD 2DETA 2V8OA 4PAQA 3VHXA 5JRZA 5F9FA 1W7AA 3A1VA 3BH0A 4D81A 3NH6A 4A1FA 1DAHA 4O25A 3KUDA 1P9NA 2IXEA 3FMFA 2AN9A 1G8GA 2J41A 4PR0A 3AKEA 3LXXA 4RZ2A 2BV3A 3TVTA 1KK1A 4CEHB 3AVTA 3RRYA 1VKJA 2VH5R 5CJ2A 4LBWA 4GOKA 4MYHA 1RKBA 4B3CA 4E5UA 3D3QA 4WBSA 2BMJA 4DUGD 5EMNA 2YKGA 1PZNA 4C30A 2YWHA 3U7HB 3OHMA 4XSHA 1XXHE 4P4TA 3TR0A 1JQLB 3ZC3A 1D9XA 4JLBA 4MGIR 2WZQA 2ZI5A 4HLUA 3TH5A 3RS2A 4P4SB 1KO1A 4LJ8A 3VR2A 1N2CE 3D7MA 4FD2A 4G0NA 1AA9A 2J1LA 2WTUA 3TE6A 2Y8EA 1NIPA 2QG6A 3T1TA 3FMIA 2BPOA 2CLCX 4DUGA
chains in the Genus database with same CATH superfamily
3P5SA 4OL0A 4RYLA 3D1VA 4QGAA 4Q1VA 3MS7A 4IGFA 3O26A 2VJDA 5LPNA 4MW1A 1F14A 2I87A 2JW5A 2HDNB 2QP3A 3WICA 3TLXA 4ZEVA 1A9YA 4Q1CA 5LFAA 2RK6A 4KFSA 1UPBA 1UZLA 1XKLA 3P97A 3NYRA 3T5GA 1Q86D 2JEOA 3IKTA 1F7UA 1N5KA 1ECLA 2DR2A 3EA4A 4RGQA 4DILA 4HEQA 4NJEB 3DNFA 3MJ4A 2C9CA 2VNHA 2J5RA 2JN9A 4BV9A 5KX5B 1R0ZA 3TUIC 1HDYA 3BCSA 5K1ZA 1AA6A 3HI6A 4HWRA 4H17A 2IYFA 4X7PA 4B82A 1UEIA 5LZ5A 1T8TA 4MI3A 1PZXA 2AW5A 3EPPA 2PMEA 2RBKA 1DADA 1S3GA 3EOZA 3KSBC 4PO8A 3A1PA 4CUJA 3NASA 2XT9A 3HY6A 1KFBB 1GAWA 3LWZA 2UZAA 1CW2B 3LZCA 3CBQA 4FNAA 4J90A 4P86A 4V24A 5BXQC 1GZUA 3MJEA 2RGWA 2OKGA 4RPCA 2IXDA 1MVNA 4AX8A 3NAZA 3BXEA 3OJLA 4RNCA 5BSGA 2NUPA 2ERCA 2NVWA 3BIJA 2GZ1A 4JOQA 2NU8B 3AUAA 1U9IC 1JBEA 3WV4A 3ENWA 1L7MA 4BFWA 1YS9A 4OF4A 1H4SA 2X40A 4EMUA 4CMCA 2C9DA 2JAOA 2I8CA 1Z4PX 3IEPA 4G0ZA 4TKOB 1PJ6A 3PGKA 2QJFA 3O4JA 1ZC4A 2CEKA 3KKZA 3SIPA 4R3NA 1WIWA 5J2TF 2GBLC 4WY2A 4ZYWA 4PQYA 4PC6A 1A9RA 2PM8A 1CULC 2MWMA 3MB5A 2BM8A 4E22A 2ZZFA 3EMVA 1V95A 1Y9EA 4GLJA 4IKOA 4YRPA 1ID1A 1J5PA 2GBLA 3AHDA 1KBOA 3CVOA 5AKGA 3TGPA 2OT3B 1QO0D 2HWKA 1RLUA 1JPNA 3LUGA 1SY7A 4GX0A 1WA5A 3OLXA 3I56B 4QHYA 4ZAGA 3K2IA 3L01A 3LHSA 3LUJA 1EFKA 5AOCA 4O4HA 2QQ5A 1P33A 2VKQA 1D7AA 2DX7A 3DOCA 121PA 1GFWA 3LCUA 1FXUA 4IH9A 5DB4A 2ID7A 1RD4A 1XLUA 3IQGX 1N3LA 4FMDB 2QM8A 1WSBA 4HDNB 5LDHA 5JNRA 5LQJA 1HURA 4CV1A 3JD1A 2PXAA 2F43B 4MLPA 3C6BA 4HS9A 3K35A 4RBNA 4O4LF 2OV2A 3ZTWA 1NN0A 1V8FA 2GCOA 1SWWA 2VQ6A 4GXTA 4Q7JB 4BN5A 2QYSA 3I72A 4ARIA 3WG9A 1WB4A 3QVGB 4PQFA 4OX9B 1G8MA 4N40A 1Q6ZA 2GERA 1X1RA 2P2YA 2QRVB 2VP0A 1HSZA 2HSEA 1KORA 1BJKA 1PG2A 2PGIA 3IT3A 2ETVA 5A89A 2AFIA 3KL9A 3ASQA 1ZN2A 1I2ZA 1NC1A 2BEVB 4ZKEA 2Q3FA 8MHTA 3L7CA 1VE3A 3H5IA 4JUIA 4ZVOA 4BQQA 3C4JA 3PYMA 4BQOA 1LI7A 5LP6A 4R69A 1H2FA 2QD2A 1NP6A 3ZQJA 1T0HB 2CXTA 1IY9A 5DBEX 4JGIA 4AX4A 3M5DA 3HRKA 3ZDAA 2A1UB 4C4SA 2EZ9A 3NIBA 1QQBA 1QFXA 2AR0A 2WIFA 4WZLA 1N9GA 2GT1A 3AVYA 3DDYA 2QRHA 2FZGA 2XTJA 1WHTB 3I9LA 4RPHA 2YINC 3G7NA 5FD8A 2YJGA 1V7QA 3DBHA 4M38A 4BV3A 1E69A 2DPGA 4MR8B 4ACAA 1DI0A 1PZHA 1M6HA 4BVJA 1LQUA 1EBFA 2YWRA 4GI1A 4TKUA 3RFTA 3EPJA 5LXTA 1E6MA 4MH0R 1ZNXA 2I66A 4OLFA 2QN8A 1V5GA 1NJ2A 2I4LA 2Z5LA 3O8BA 4B73A 4CT5A 1CEQA 1V9CA 3A3YA 2HEIA 1A7JA 1QZTA 1ORVA 1M0WA 4C4OA 4UFNA 3WQSB 2LIVA 1N2OA 3OLCX 5I4IA 1S02A 1HRDA 1NW9B 2SCUA 1LJLA 1E1CB 2K2WA 1NZDA 2ZR8A 4WESA 1GNLA 1VPWA 3E9ZA 3LDHA 2IQ5A 5CAEA 2YW2A 4O08A 4AG3A 4Q93A 3T9DA 4Z2YA 2FSHA 2NZWA 4ASUD 2LZ0A 2QN6A 2FLKA 4H7FA 1NKVA 4JITA 4UOQA 1SG9A 3WGGA 1N06A 5AJYA 4JI0B 2I80A 2J0VA 4NONA 1W5TA 3FUVA 3EFHA 3ZGOA 3CPWB 1KJNA 3A8TA 3G13A 2GB4A 4GM1A 2C9BA 4CM4B 5H8WA 2DWQA 4G4GA 4OPSA 4H0FA 4UE6A 5EQFA 1Z0SA 4UEQA 5CVVA 1IJBA 2ZAMA 3SS9X 4KSYA 4IOLA 1J8QA 1NGSA 1C41A 2AJLI 1XCLA 3QA3E 2OQVA 4LJSA 4MPJA 4B3JA 1J09A 5C5IA 3TB4A 4P3PA 3R24A 4YV7A 1LNQA 7GPBA 4DV6B 5HP4A 3ZJUA 1DFGA 2G9UA 2RB4A 2BGTA 4N0PA 5HS6A 4F04A 3AILA 4I66A 3MRSA 2EFJA 4R8KA 1GFIA 4DVJA 2DFDA 4NEQA 3I62A 3AK4A 1R8QA 2ZRKA 4FQ7A 2H8KA 3TPZA 1XLVA 3D3WA 1Q15A 2G77B 4DQ0A 4EJ2A 3MGCA 4YCLA 4INAA 4UKDA 2FDXA 1DRVA 3DZJA 3A1DA 3OE5A 4FVTA 5GQSA 4NBRA 1MPTA 1KRXA 2PMKA 3T3EA 3EULA 3W7VA 2MT9A 1V1MA 1N5MA 4DLZA 4D8TA 3P4XA 1ONSA 3D8NA 2Q4EA 4HNGA 4V38A 1LV8A 1FFCA 4PZPA 2PFKA 4EG1A 1W1UA 2RH8A 3ZTTA 1SBTA 2GD0A 2LCIA 5HCIA 2Y1KA 2OD7A 2BEWB 2PV7A 5CX1A 3UA4A 3JRXA 1SXJC 4NICA 2ZSJA 1TLLA 2IEBA 3CWZA 4WE3A 2NU8A 1SM4A 4B6QA 1E2GA 4RUKA 2H5JA 1CY7A 2PRIA 1XQ6A 2GESA 3C3KA 4URYR 4WY5A 1JKMA 3M4YA 4HPWA 3HKDA 4WNYA 4DNOA 1G5IA 3Q7RA 1FEZA 4E2FA 3A9RA 4XOIA 5GZ3A 1EUDB 5FCDA 1O94C 5FQNA 5CURA 3EDOA 3GJ7A 3FOAA 3TRJA 1RHQA 1RWKA 2W8ZA 1PJAA 1SXJB 2GN9A 3BORA 3GZ4A 3QEJA 2PRYA 1OTXA 4CTOA 2O1WA 2CN1A 4UBNA 2HNAA 2BN4A 4XWYA 4F4HA 3CZQA 3OHSX 4PCUA 1AS2A 1BW9A 1DQYA 3ACBA 5LLSA 1UXJA 2FZCA 3GA7A 1OC2A 3OTGA 1Z0AA 1N0VC 3ZH9B 2YJ6A 3DUFA 3BM5A 4KFRA 1TIPA 3ELBA 4TYMA 2B7LA 4BP8A 1GPMA 5JD3A 1LS6A 3LQRA 3SHVA 5ABPA 3AF3A 1ECBA 1GUDA 3AM3A 2HHJA 3GRCA 4JJZA 2WWGA 5IKPA 1ZX1A 4PX2A 1S3SA 4CL2A 3JVIA 3FYCA 3FPBA 1C1HA 3PP8A 5AI6A 2BI8A 1DUIA 1T9AA 1WMEA 1XQVA 1ZUD1 2HIMA 4YACA 3UK1A 4QUBA 1APBA 2BM1A 2RH5A 4YT5A 5KMGA 3KETA 4C0HA 2ZIZA 1Z16A 3K8ZA 3MTAA 3MBIA 4NECA 2NT3A 1DX6A 4Y1RB 3ZD8A 1OYOA 4TN5A 1K9VF 4JYZA 1ZD5A 4EHBA 3PUMA 1KJ9A 2GBIA 1YCFA 2Y0CA 2DULA 1Z0FA 3BXPA 4I99A 3IOMA 4BMCA 4I1PA 2GYWA 1V7PC 3EVBA 1JKXA 5FJIA 3RT1A 1Q12A 4GXQA 3ZHSA 3MNFA 1OASA 2E55A 5AUNB 3EPLA 4I6GA 3ZJTA 3F2IA 4DLRA 1SZJG 4F56A 2DBZA 3FJ1A 2GZMA 4O3FA 2ZWOA 3AYXB 2R8PA 4GUAA 1J99A 3DWGA 2GHQA 2P65A 1L1RA 2BWJA 4IIUA 5B1HA 2A1UA 1T36B 2BJVA 3DFFA 4DRYA 1UC8A 5AUPB 1MN6A 4F5YA 2AXNA 4QUGA 5FFNA 3KFVA 3DWFA 1LC3A 3DBHB 3I3SR 3K0BA 3RIGA 1DQSA 1OBHA 4I36A 2OO7A 3ICEA 1FYWA 1JSZA 2X8KA 2A0XA 1SWVA 1T3HA 2ZB7A 1E7SA 3EEBA 4RVDA 1PV2A 2GNAA 4M8LA 5E3IA 1P1IA 1EJBA 3JWPA 2H07A 3U44A 4D8YA 3L6RA 4C5BA 1ES9A 1GA4A 1ZGCA 4CM8A 1F60A 1Z7EA 2WMNB 4FGUA 4UHHA 3QPWA 5U4XA 5LMNB 2QMYA 4NESA 1QV9A 1ECFA 4JB2A 4NOJA 5CAEB 3VR6H 1KMHA 4G4JA 4Y7CA 1VQ1A 5LYJA 1JE0A 1W4LA 4X66B 3O8RA 4EVRA 2G82A 2NO5A 4KLNA 4U39A 3PUXA 2PU7A 4CQMB 2QRKA 2OC9A 3HEAA 3SEZA 4B5KA 1C7QA 1UQUA 1HNZB 1GNVA 4G0QA 2J9YB 1GAJA 4KXXA 1GUFA 3I6ZA 3PD7A 1LVUA 4AN4A 4BYGA 1JZQA 4MV6A 1HFKA 3WAJA 4ZJYA 3VI4B 3QUCA 1AX9A 1XRJA 4ZRNA 2DSNA 1SKUA 4KYIB 2O8VA 3PSHA 3QX9A 4UTRA 6LDHA 3CXRA 4U7GA 1YR7A 1IM2A 2H1FA 3CXCB 2OG1A 3WWOA 2I7VA 2VVTA 3UHOA 5CGZA 5FOTA 2PR7A 1S2DA 5JXWA 1Q20A 4Q1DA 3E0XA 4TQGA 3X3HA 2G9QA 5L8VA 5E7JA 5PGMA 1T5IA 3LPAA 4YROA 2GJ4A 3IOCA 2X0DA 1NRWA 1OWNA 4AIRA 4QRIA 2GBPA 4WW0A 1N6HA 2YWEA 1Z82A 2XDYA 1NYTA 2YWBA 4UXIA 5F5XA 4D02A 2JGRA 2JLUA 3FSRA 2O2ZA 1TVCA 3C97A 4TSFA 5D84A 3R9XB 1QVGB 4J4HA 1JU4A 2WIGA 2Z2KA 2C4WA 3OZGA 4K9NA 3MJFA 4LISA 3ANTA 5ECDA 3TD6A 4CBVA 5HRAA 1RVDA 1QYIA 3OECA 1P5FA 4WBXC 3RU2A 1NTRA 2R5FA 1Q7CA 2NNWB 3LP5A 3M34A 1JEOA 1AUXA 4ETMA 1EM8B 2QNIA 3PQFA 4WCDA 5FOXA 4B84A 1XFOA 1ODSA 3B2QA 5HZHA 3WC4A 4NNOA 4US2R 5GZ6A 3L2OB 1N07A 1YXMA 3A6FA 4CKBB 4AJ9A 3IPYA 4I55B 2VNSA 5AW3A 3K5HA 1KDVA 2NO4A 5CA0F 1EXNA 1G5QA 1T5SA 3Q39A 3EVZA 3KLMX 3ORFA 2H16A 3R9KA 2WU3A 4KO2S 1WR8A 3BGOS 4A0HA 2FWIA 1C8VB 5DNEA 1U3UA 2I6GA 1C1DB 1JJBA 4QUAA 1Z5UA 4A26A 1CIPA 3HU3A 1ZRSA 1UDCA 1XQWA 2GX6A 5B4VA 4KO1S 2FMIA 1HDOA 3DKPA 4WZAB 3R7SA 2ZBDA 1H2YA 3WYNA 2D2EA 2QMHA 3IMKA 2XUIA 4FWTA 1P0QA 3FTQA 4QL3A 3ZY5A 1BVRA 4DLWA 1LPNA 1U7OA 3T9FA 4Z3KA 3VO2A 3KR9A 5DPMA 1U8YA 2H2GA 4RL4A 4WY8A 3BWDD 4DUPA 1WQ4A 4QFCA 5JECA 2D00A 1EFLA 3CNOA 3EGCA 1M8KA 3KB2A 5GM1A 1QK4A 4WKPA 4NYMR 1FFYA 2JATA 2J3MA 5DX1A 4YRNA 2Q21A 3QW4B 1JHUA 1YMQA 2QN9A 3D5QA 1IN4A 2TMDA 4WNIA 3STXA 4F5DA 3UGKA 4H9GA 4ZVVA 5KMGB 2BKLA 1T10A 3BILA 3NT5A 4MRSA 3TD9A 2IC5A 4DDHA 2NT4A 4QX6A 3GEGA 1MX3A 2RH9B 2GDZA 4OQDA 4RSHA 3L4JA 1P6UA 2XMQA 4JIMA 3OURA 1KWGA 3BS4A 3G5AA 4TV8B 1EDBA 1PTJA 3U5TA 4PPGA 3EQ7A 2X8AA 4V02A 1PT8A 1TVKB 1PE0A 1PWZA 2XVZA 3A35A 3UWPA 1P4HA 3X1DA 1G42A 3G68A 3GEIA 2AK2A 1V5FA 2DFTA 2EHJA 1G20B 2GXQA 3GGOA 3HN7A 3QQPA 2EP8A 4PBSA 4B3FX 2W6CX 3GOHA 4COOA 1JNXX 3MQ4A 2IGTA 3R3HA 4WLFA 5DCUA 2Z83A 1L5ZA 2WWFA 1GTJ1 2MMCA 5HG0A 4PZZA 4MGKR 1DPGA 3AG5A 5A4IS 1K0FA 3UUEA 1TNDA 5L3ZA 4BEVA 2R6DA 3I1YA 1KL7A 1II0A 4N6GA 3PR3A 4JQOA 4U3JA 3ND7A 3RIMA 3Q7PA 1GDDA 2GK7A 1T35A 2BGKA 2I54A 2C54A 1MAAA 1RWQA 2YZ2A 2B4QA 2R5NA 5CBPB 4L0DA 1C14A 4MS4A 2R1VA 4N82A 5CMLA 2BDUA 5FNZA 3RG2A 3IC5A 3G2IA 3LO5A 4OBEA 2QJOA 3NHFA 4W9MC 1A9OA 1LTHR 4R5MA 1WXDA 4QYSA 1SD1A 3SZGA 1Q1AA 1Z9BA 2XGJA 1NQOA 3V76A 2PKXA 4ZI7A 3I12A 5KINB 2B61A 1Z6YA 4QU5A 2BUBA 1TKBA 3B6MA 3BK2A 3BL8A 4CCYA 2XKBA 4F11A 1TADA 1XQ1A 2Z98A 1Q0UA 3UW3A 1TYAE 1AUOA 2E3JA 2QMEA 3AFIA 4YO7A 5EN4A 4LF6B 4JB3A 1JQEA 1U0NA 5A4KA 4ZCLA 3HWRA 4NZNA 5AVWA 1RZVA 3LD9A 4EB8A 3B1JA 3LJKA 4FZVA 2ZTMA 1QR6A 1XVLA 2RGGA 5JOQA 3SMQA 2FWJA 3CRVA 1H65A 1GVNB 2FPSA 3KB6A 2C97A 1K6XA 5EE1A 1FVOA 1USIA 3AEKB 4FT2A 4YDHB 2UVQA 3VR5H 1PL6A 2W6MA 4HQRA 4UBMA 5J1SB 1ZMXA 1NUQA 2GEFA 3V4SA 3VNBA 4XYEA 1E9FA 1WVGA 1Z5VA 2EW8A 3BAZA 4JT9A 1NVEA 3ZUGA 5J59A 3T9EA 1XPRA 2XIJA 4GPIB 3KWLA 1F0NA 5T6BA 4JHLA 4UDYX 5KTOA 4DV3B 1T29A 3KQUA 1SK8A 5L53A 1JKFA 4WJZA 1UOQA 3IQFA 3G2OA 1CUWA 2BGLA 4UZUA 3HZOA 4OJKA 3H5RA 4PPQA 4YGXB 4KQIA 3C39A 3AKCA 3W1EA 5AESA 1AKMA 1R6DA 3A70A 4ZT3A 2HLHA 4MKZA 3TW0A 2QW1A 3L8DA 2HCFA 1WJGA 3UAWA 4X20B 2O8CA 4KUEA 3R7FA 1EQAA 4WWVA 3NBKA 4OVKA 1ABEA 4C3VA 1JX6A 2R6HA 2EL9A 2XRFA 3L8MA 3ZDQA 4B4KA 2XODA 5FV7A 3KIPA 4BO6A 4MI9A 1E9EA 4RHXA 5EUMA 4H27A 4RTSA 2Z4TA 3C5WP 1C2TA 3BPSA 3AJAA 1J2YA 4G9GA 4ZQEA 4UCXA 5IT5A 1SQ5A 4ZT7A 1UKCA 3AF0A 2WDZA 4MCIA 1Q44A 3RRZA 5I9BA 1AKTA 4MIYA 4YMVA 1H6CA 2VAVA 4MICA 4LHZA 5IBQA 4D74A 1WUIS 2VPZA 5CXUA 1OH7A 4RIHA 4ZIRB 3OICA 1I9CA 2PL3A 4XQEA 4J0QA 4Q7QA 2ZXUA 1HLGA 3C4QA 1MA0A 2GUGA 3ZXXA 1OGIA 5AI8A 3DL0A 1C4KA 2LR0A 4MV0A 2HMVA 1Y1KE 2E4YA 1ESCA 1GPH1 4ZVMA 3AHJA 3RUHA 3FCAA 2C8KA 2WTAA 3FMPB 1E1NA 1PUJA 4ZQGA 1V96A 1X13A 3VPFA 4QEZA 1A4IA 3IQIX 3WXBA 3UT0A 3ZLBA 4F9EA 5AIAA 2ZXFA 1VHQA 5D6NA 2CCGA 4W1SA 1VYHA 4YK7A 5BXYA 3VPGA 3KEOA 4URWR 3P2KA 3KJFA 3D8UA 1F9EA 2GCPA 4BRSA 5IUNC 2EFDB 1A9TA 2MU1A 4HLCA 4AMUA 4CL0A 2IKSA 4MUHA 4Q34A 2L0XA 4QXAA 3D6FA 4EJFA 1U0EA 3TWOA 1PZEA 2XUPA 1J42A 4NZMA 4YDQA 4FPXA 4FI3C 2XZDA 2OV3A 3V8RA 2G7MC 4LHXA 1L1QA 1NBWB 3IDFA 3AP2A 2H63A 3MT9A 4OM7A 3Q0TA 4TWRA 3GFPA 4G1UC 2A9VA 1C9YA 1WLYA 4RZSA 4CLOB 1AZLA 1ZH8A 3TW8A 5C1IA 1K8ZB 2XWBF 3CR8A 1FDTA 4HOYA 3ZCRA 4H1TA 2QIOA 3NDIA 1V25A 1QGAA 5KTTA 4YALA 3TOZA 1K8XB 3CLRC 1H42A 4ZI5A 3TPFA 3UO8B 3Q11A 1YQGA 4RH1A 2DCUA 3PUJA 4KTTE 1Z73A 2I7DA 4LNUB 4M1WA 4M98A 1KZYC 3HXLA 3JXEA 5AJZA 4ZTUB 5IASA 4W5NA 2OQRA 3BREA 4HDSB 3AR5A 3T41A 1I5OA 4D0NA 1XJQA 1Q0ZA 3I45A 3MOGA 4YRRA 2G1KA 5TY0A 3T5DA 1U11A 2FRDC 1VSVA 3H11B 1X19A 3KCQA 3KPVA 3MC1A 3OTOB 3F3SA 1CY6A 4BNIA 3U17A 3FUCA 2ZE7A 3OZEA 3HCEA 5AVRA 5JO0A 2EKBA 5KTPA 1WHSA 1XNHA 4QUKA 3K16A 2PX2A 1Z2OX 1VHOA 1RAEA 2QNRA 3ESQA 1CUBA 2G0AA 2QTCA 2NUPB 3BFJA 4HKTA 3H6HA 1D8TA 1QWSA 1WUTA 4KR7A 4JX8A 3S2ZA 2D0DA 3GLGB 2JIBA 4Q0MA 4L5JA 4TZ0A 3LL7A 3EOAI 3N2LA 1M83A 5CFZA 2B1RA 1ZW6A 3OFVA 5JDIA 2AFHB 3ZQKA 3R5HA 1OBVA 3CV3A 4JDUA 1OKKA 4OGLA 3T51B 3IKMB 1BE8A 4KQKA 4Y2JA 2FHSA 3ISTA 1B3RA 2DTXA 4B3IA 4BWFB 3B6JA 4ILEA 4YCJA 5IK2D 3ROPA 2BIFA 5J2UA 3TSWA 4K9SA 4JBIA 4MB2A 1E66A 2JGLA 3WLSA 2R68A 1SCQA 3WYCA 5I48A 1J0DA 1SHUX 3AUXA 3OIGA 4YPFA 2RKWA 2VDOB 3K53A 1NF3A 4MW0A 4J0DA 4DJ5X 3ZWVA 1ACMA 2A9RA 1ZLXA 3BBPA 1Y4SA 2F1MA 1HVXA 2V9PA 3G59A 4IAOA 4NATA 1DWQA 1YJ9B 2G6TA 3UFBA 1E2NA 2OHHA 2DYIA 1F4LA 4Q3BA 4RHTA 4UMEA 4ZO6A 1HE1C 2V5VA 2HU5A 5GZ1A 1YU9A 3CONA 2Q6IA 2F8LA 1QK3A 4BNGA 4N41A 3WRYA 1NXTA 1QH1B 5A0FA 2CVQA 1OU0A 4F4IA 2ZJ0A 3O03A 2V54A 2ZL6A 3IP1A 3K4HA 3NEJA 4IRXA 2FMFA 5DTMA 5JCZA 1BRMA 1D2GA 1Y8RB 2XNJA 1S5PA 2R7KA 3MLEA 4M9QA 4CG2A 2VBIA 5JCOC 2DUJA 2W11A 4O2RA 2BCEA 3P52A 4J03A 3CJRA 1UBFA 3KKPA 3T15A 3U7FB 3RKUA 2GQFA 4MYSA 4Y6OA 1FLDA 3ZE9A 1RMQA 2YN4A 4KWTA 1ZCJA 3BGIA 3OU2A 1P1FA 1VIVA 4P7BA 1QUFA 1MOPA 2J6BA 3J81A 1SZCA 1OXKB 2Z5VA 4PIMA 1P0IA 3PVDA 4FR2A 1SQ0A 4KEAA 1NW3A 2PMFA 4X7RA 2ODBA 3NGLA 4ZOEA 2W70A 2OK7A 5C51B 2GRUA 5EJMA 5IT9A 2W48A 3TQQA 3TZBA 1TPYA 3EHDA 1WHTA 1VHJA 4XJVA 3KEGA 4EOGA 1UWCA 1P0FA 1IZ8A 5FADA 3DEAA 3F4BA 1B6TA 1J8VA 2NTVA 4ZCIA 2BFNA 2IX9A 4PQEA 4ZC8A 5HEKA 4JI1B 4JQYA 4HGPA 3OG9A 4CM8B 2Z2YA 3ML1A 3F6BX 3RVJA 2PRZA 5CYPA 3KTOA 2Y1FA 4RKYA 1E9BA 3NDPA 3V3KA 2YY6A 4D3ZA 2AZ4A 2FUEA 2O3RA 4KGVA 2DBQA 4FJ0A 1R6BX 5JZOA 2W6OA 1E79D 4OK3A 4E7OA 4E2WA 4ZCMA 2AOUA 3OAAD 1KI1A 3HCFA 3QJGA 4XCVA 3RH0A 1NRJB 1NQTA 3HQ4O 1WSWA 1E2LA 4K05A 2PVCA 3P0EA 1D2AA 3OCJA 3JR3A 1ZIXA 4GZLA 1SEVA 4NS1A 5DSTA 5BNFA 4N8SA 4PAMA 3BL5A 3K70C 4PINA 1Q21A 2FPGA 5CW2A 3PR2B 5TSDA 3FPLA 4JI2B 3OOJA 2C9MA 2H0QA 4UARA 1NWHA 2XYVA 5P21A 4KPFC 5TQ2B 4A10A 2ZTHA 3TNDA 1I7NA 3HJNA 4HPJB 1MC1A 5JAZA 4JYPA 1Z4JA 4TXMA 1NLFA 3CM0A 2Z09A 1H4VB 5FNVA 4WHMA 3NYIA 1R15A 5FUXA 4MEJA 4ML3A 4GP9A 4UNPA 4D6XA 4ESEA 2IYYA 1N3BA 4Q00A 3NAGA 4IJUA 4ND5A 4JUDX 4QGGA 4Y2QA 3U0VA 2QYHA 4ENVA 4DBVO 3R9XA 2WIKA 4R1LA 4LDPA 2A5FA 1EXWA 2P9FA 4RZHA 4OX9Y 1K7XB 3HFSA 1FCJA 1OGJA 1WX1A 1KE1A 2I33A 1JB9A 1CY8A 2EBWA 2ORIA 3KOOA 4UNQA 1QCCA 4O2AF 4GX1A 2XB4A 1OT3A 5JTTA 5SY6A 4FWIB 5AW5A 1Q1NA 2ZUWA 4QQRA 3LT0A 1B23P 3ETCA 3L9WA 3I4FA 1YBHA 5IKEA 1GCAA 4I55A 4LGMA 5DW0A 5CK4A 3EZFA 2JFGA 1SIBE 1VE5A 5T6MA 3QMVA 3VBCA 4OXXA 1FA9A 3MWFA 2OBNA 5AKEA 1NR5A 2Y71A 5FRDA 4LF7B 4O1IA 4M4SA 1AURA 4KBFA 2AFHA 1G291 4GQBA 3CS3A 3CCBA 5EIWA 3TD2A 2CUTA 1C7EA 1WPCA 1GQFA 4C0SA 1R9MA 1QVRA 3O38A 1Q7EA 5HZBA 1CUDA 3T5BA 2XWJI 4Y9DA 4JLMA 1QHGA 5IRCD 4BNXA 2E7ZA 2WFZA 5TF4A 4EA8A 3M6AA 4FONA 1T1EA 3RVQA 5J4YA 4D25A 2DLDA 1R0YA 4RZXA 4CI9A 2YUTA 2IIQA 3IEXA 3I9FA 4KR9A 1VQLB 2CNOA 3LTNC 3PFCA 1DZIA 4JUAA 4BJ1A 1BX1A 2BGIA 1FIUA 4KNYA 4HMQA 1YDEA 3TYXA 1H4QA 5AM3A 5M34A 2ID9A 3KOMA 3TXAA 1XTQA 2E4VA 2H92A 1P62B 2DC1A 1NB9A 1HT2E 1RLTA 3C3BA 3K72B 4LX8A 2Q41A 3FRJA 3G4SB 3RR2A 1XI2A 4J0KA 4TXNA 4E32A 4EJSC 3C4VA 4RTMA 3U9TA 1NW8A 2Q9BA 5IJAA 4EEZA 1E9DA 1QH1A 3V3TA 4KE8A 1FFSA 1XR3A 4KQGA 1TJPB 1P3Y1 4FOSA 1K89A 1WB5A 5BSMA 4EJSA 4F96A 4KQ1A 3GD5A 4F4CA 5FUMA 2CV2A 4K2HA 2BONA 1DIRA 2O2HA 5K05A 2IOHA 1QE3A 1B8OA 2RHOA 3E3NA 3G7SA 4DREA 3AM4A 3AR8A 3PD1A 3W4JA 2LD4A 4KI7A 1O5OA 1QHHA 2WNIA 3DZDA 1N25A 2I1QA 1J49A 3FDIA 1HKHA 3NUZA 1S2IA 1KZ1A 2Y2UA 3P20A 4GC5A 5KVCA 2QWXA 1RWOA 1AXEA 3RSHA 2JS7A 2WKQA 4LRTB 1PVDA 3QKUA 3KEWA 4G4IA 1UMDB 1BGXT 1L7DA 3G88A 3NKLA 1VKZA 3OCVA 5ICCA 1H66A 3DHVA 5HOEA 3VZSA 2FH5B 4M1EA 4R1SA 3BRQA 4PRKA 4URUR 2AYZA 1YZQA 3JCZA 4IDGA 5LP6C 5JCXA 3IP9A 2I34A 3LQYA 4R5HA 1G9SA 1LI5A 3IAS6 3NEAA 1G8KA 1L3BA 1O8BA 4MGZR 3EMBA 4I46A 3UKJA 1UD3A 1ZPDA 3RC3A 1JFLA 3GRPA 3KWFA 1PQUA 3GR6A 1JJFA 1J5EB 3WGIA 4PTZA 2XCQA 4P83A 1GNPA 1JHXA 1AC5A 1XA4A 3MMSA 4BASA 1D1PA 4N7JA 5FDFA 5M5BA 2YMQA 4D46A 1Q82D 4HVCA 3FOCA 4OM8A 1OU4A 1PFGA 5L3RA 5EFZA 3S70A 1SQGA 2GILA 1E4EA 1TL7C 4BO7A 5CNIA 3WBFA 3CW2A 3TLKA 1KO8A 2DHQA 1V8BA 1FUKA 2VJKA 4MKHA 4E51A 2FOIA 2FJPA 4JI3B 2FZVA 4TQUS 1ISIA 5IK2A 3EXAA 1FB5A 4DMLA 1VJTA 1NWCA 3PTZA 4U6NA 5CM9C 1VXRA 3UMCA 2O8BB 4TRJA 5CVCA 4DHWA 2CE7A 1LSJA 4QBIA 3M1IA 4RKRA 1ZIPA 1FRQA 2AMJA 4O29A 2I8AA 2ID4A 2QRUA 1T25A 5BQPA 3ZKWB 1D4ZA 3ZU6A 4AJLA 4R31A 2I4MA 2YMPA 4R2KA 4Q9JA 4JV5B 3GRKA 4D9NA 2GPYA 1YONA 2HDOA 1HTTA 3JWJA 4X7EA 3OTWA 4MRNA 1ECJA 5EEHA 1CZRA 4FHEA 1H0HA 5G3ZA 3GNSA 4BBZA 2QVYX 2F1OA 4D98A 4BY9E 1DIHA 2C8JA 1O2DA 1XC7A 1XPJA 3BXOA 1DXYA 1A96A 3W9SA 1F0KA 2HTEA 1PR3A 1VHEA 6AT1A 4K0KB 2R6R1 4P98A 3DBLB 3VR0A 4BX2A 4CODB 1VKRA 1YB4A 3U49A 4RA9A 1Z0DA 3F1LA 2VLBA 3HN2A 1EWKA 3QVTA 1BG6A 4ISBA 3WGTA 4XLHA 4BNUA 4FMPA 2EZ8A 4B47A 4TMWA 3HMKA 3PNKA 3NVMB 1RRPA 1L5VA 1VLMA 2O9JA 3CYFA 3JY6A 1XZNA 4PTLA 1T3ZA 3V8VA 3O4RA 3L6CA 3NHUA 2G0NA 3H99A 4JH0A 1M90D 3UK2A 1DUSA 3F6YA 3DWIA 1BE1A 1E98A 4QTXA 4MCJA 4ABYA 4YDRA 4AI6A 4A8TA 3ANMA 4ENSA 5IFLA 1IY1A 2QEXB 1IOZA 4UUAA 4DSTA 2NN3C 3SQWA 1BXRB 1GPJA 2ZIXB 1XTUA 3AOEA 3IAHA 4W8OA 4DY6A 3TL2A 2O57A 4DG8A 3EXFA 4IV8A 2MJLA 4IV0A 2PGNA 3IIIA 2CFCA 2R3SA 3IULA 3ANXA 4Q3AA 2Q5JA 1MZVA 2X2EA 1KYIA 2GD1O 1WQ3A 2XR1A 2XE4A 3GFGA 3CJTA 3U3KA 3KL4A 1M1XB 3V5NA 4BB9A 4ZFNA 1IRXA 1T2AA 1T4GA 4BQFA 5HKOA 3IT0A 2IOFA 2DEUA 3H7AA 3GPDG 2WHRA 3WLTA 3N2GA 4JP8A 2XMPA 5EQJB 3T4PA 3RSQA 2AD1A 4TKLA 3S8EA 4Y9UA 3QP9A 3OWXA 1ULBA 4TKVB 5DHFA 3VRHA 1RBZA 2QT9A 1MGOA 1DRKA 4X84A 3V8QA 2NZYA 1NVVR 3ZCSA 1QH9A 4HGOA 3RGGA 4NBVA 1CUEA 1ODIA 3OT1A 1C7IA 4CKEA 5JASA 1WXQA 3NOVA 1J23A 721PA 4ID3A 1J9EA 2FR1A 4ETWA 1L5RA 4W1RA 2PLFA 5AVKA 5CFLA 4JFAA 2QGZA 4YAOA 2VK4A 2E6KA 1B0AA 3DAGA 3IT1A 2I2CA 7MDHA 1BVHA 4JVOA 5D3MB 2WHXA 2DQYA 3SLDA 2XLCA 2ATIA 2GPTA 1HE5A 1PJRA 3DMNA 3BA6A 3V7NA 5LSAA 1EP2B 1DC8A 2ZSIA 3QIVA 4X8IA 4JODA 4AK9A 3TQTA 2BTOA 4OFXA 4Q24A 4YBZA 1MUUA 3CPJB 1VFNA 3H18A 3TKLA 4C0JA 1XA3A 4D9MA 2QL5A 4I5GA 2WM9B 2HLDD 2WM2A 4IHKA 3KAQA 4ZHSA 1NRKA 1IQRA 2CGEA 3PPYA 1AZSC 3AI2A 1YGPA 4JHXA 4K6CA 2VFAA 3BXGA 3BMCB 2IDKA 4L8FA 4D9BA 4EI7A 1AKUA 2A78A 4HZIA 1DEHA 2KM1A 2QUZA 3RHSA 2ZT5A 4DAEA 3CE9A 2FFHA 3TTVA 2BP7A 1L5WA 4ENUA 3VNVA 3PXEA 5KHLB 4NFLA 4WH0A 1UK6A 2Z9CA