1KK2A

Structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdp-mg2+
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
405
structure length
396
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
molecule keywords eIF2gamma
total genus 97
structure length 396
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk2A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk2A01
3GLHA 4KI0A 1KSGA 1EFUA 3RABA 3N70A 4M1TA 3U7EB 3IDQA 4RZXA 4DLZA 5FTLA 3U5ZB 1W4RA 1FMLA 2F43A 4DUGA 4XVUA 1JJVA 3GLGB 4PPQA 2ZROA 3SQWA 2F1JA 4GNKA 1NBMA 5BW8A 3A36A 3MRSA 3LWNA 3OAAD 4FI3C 3UIEA 2W6JD 2O8DB 5HZKA 4M9XA 4TTQA 4JYBA 2NQ2C 3AVXA 1R0WA 1E0JA 3CR7A 4I1OA 4JLPA 1E2GA 4D6PA 3OEHD 4R2HA 4FINA 1Q22A 2ZJBA 3SN6A 2XXAB 3VKHA 4DDWA 2W6ID 2PCJA 5FPTA 2WSSD 4Q4HB 3A4NA 4RFSB 3U3JA 2A5DA 4YC7A 4HLUC 1FNBA 4PHFA 2OO7A 4EPXA 1ZINA 2GDJA 3QXCA 4EPWA 2HLDD 1RFLA 3MUFA 4GMDA 2OSBA 4M9QA 1Z6AA 2OT3B 5KOYA 2QY9A 3KFXA 4ZDJA 3W2IA 1P9WA 4GDFA 5FPYA 4LUCA 5F2EA 3VX3A 1FX0B 4TSFD 1GJRA 3BE4A 3I4LA 2O52A 3CPEA 4HEJA 5GJWC 2GJ8A 4A4DA 4B6EA 2XB2A 1SVIA 1SULA 4OJQA 4B76A 1KK0A 2O5VA 2VO1A 2VHCA 2DEUA 3QF7A 4LV8B 2QTHA 2C9YA 2GXAA 2A7QA 2OK8A 1JA1A 1UKYA 2Z6VA 2AFIE 1JNYA 2OXCA 1KO7A 2JDID 2ZTSA 3V00A 1F20A 3MWLA 1JJ2B 4OHZA 4TMKA 2R6DA 4JLKA 1TQ4A 5JRZA 1QHXA 5JEDA 3K70C 3GLGA 4BRUA 4OK5A 4POAA 2JGNA 1KO4A 4G1UC 4BUJA 1G7TA 3CNNA 5KSYA 1PZNA 4LJ9A 4Q1BA 4Q4AB 4V0MA 1ZW6A 5C4GB 1Z2AA 4AI6A 3A1SA 1W36C 3X1DA 4C9BA 5EZ5A 1Z07A 3QXHA 5GJBA 4BLPA 1TX4B 2ZSBA 8OHMA 1Z6XA 1XE1A 1JB1A 3QKRB 4LYJA 3V4FA 1B0UA 1F2UB 2ZJ8A 4ARZB 1LF5A 3V9PA 3THWB 3H86A 4Q19A 1QRAA 4HAWA 2G9NA 4BEJA 1DE0A 1AS0A 4P32A 4FCWA 1XEFA 1XEXB 2YOGA 3SQXA 2QI9C 3IGFA 3UWOA 1KSHA 5HXBA 221PA 3K9NA 2G3YA 5FI1B 4M0LA 3E2IA 1MT0A 4HB0A 4QGHA 3VR2A 4GOKA 1Z6GA 2WJJA 3C41J 1HQCA 1GKYA 2BEKA 4QGGA 3FWYA 3B85A 1GAWA 2FN4A 1NLYA 1LV7A 5AWFC 4B34A 1KMHA 4QKQA 2D06A 3LX8A 2I1VB 4F7WA 2ZVPX 4YALA 2IUTA 1GUAA 1FNCA 4HAZA 2ZU6A 3QG5A 2JLYA 2EYQA 3WMFA 1HT1E 2HV8A 1Q57A 2W2TA 5G40A 4DLSA 5JEEA 3UG7A 1ZD8A 4KYIB 2EU8A 4FW9A 1V43A 1ZM7A 1SGWA 4TT3D 3CPHA 4US1R 3CCLB 1ZAKA 2NOAA 4HDQB 1M90D 3W5UA 1GTVA 1YR7A 1YR8A 4QM7A 1AQUA 4GBMA 4W5JA 5G3ZA 4LSGA 3GMTA 2ONKA 2A9KA 2IYWA 1GL9B 4XIGS 4ZV4A 3CD6B 2IYTA 4JKYA 2OBMA 2QTLA 3IPYA 4US2R 1UBGA 1Z06A 3QG1A 5DI9A 2QORA 1GG2A 1S96A 5B2ZA 3T06B 1UM8A 1E96A 5EE9A 1RIFA 3OESA 3DZDA 3R9WA 2FSIA 1HH4A 3SS8A 1H65A 1EG7A 3T5GA 4A92A 5J5CA 4ZDKA 4NU0A 4BLTA 3C4JA 4WIAA 4A6XA 4BLQA 3CR8A 3QKUA 3UXMA 3DO6A 3AEZA 4NYIR 3CC2B 3U3MA 1G20E 2JJ1A 3AF0A 4IOKA 5KTYA 2UKDA 1QG0A 1QVFB 2C77A 1VQLB 1N6RA 4Q7JB 1P75A 2VSXA 2VL7A 1FMJA 3K0FB 1E6CA 2CHQA 4E09A 2HEIA 3TVDA 3AP3A 1FDRA 2R6CA 1KI3A 4DB4A 1CIPA 1NJFA 1HY3A 1WF3A 3LBIA 2CLSA 1JR6A 4HLDA 5JSZB 1VQ5B 1VG9B 2GAOA 2ZRHA 4AD8A 3B60A 3OIWA 2MSDB 4UQOA 3GLHE 4LHVA 3BB1A 5JS8A 4EJSB 2VNJA 5EXPA 3CZPA 4IXMA 4B6FA 4B73A 2VYQA 3D6TB 2EW1A 3FHCB 4U9UA 3O47A 4YHBA 1W87A 3LY5A 3IBYA 3CC4B 2CHVA 2O0JA 4YAFA 3RYTC 1XPRA 1DDIA 1AGPA 1BYIA 4Z1MA 1XCPA 4PAMA 3ADDA 2OTLB 1XCMA 1ZYUA 1TMKA 3CW2A 3CUEF 5BXQC 4LBYA 3ZZTA 2A5GA 2ANCA 3JVVA 3KB2A 5FUWA 2BEJA 3ECCA 3DMDA 4M21A 3QBVA 1Z6YA 3HP1A 1W1WA 3F0TA 4V0KA 3TSZA 1DG3A 1L4UA 2W2VA 4DQLA 1TEVA 5J40A 1KI8A 1IOZA 2KE5A 4NE2A 3PXGA 3OE7D 2VHQA 5JWOA 4QHYA 3WHLA 3I72A 4LC1A 2PT5A 2GQFA 1CEEA 3A1WA 4GZLA 3CRMA 4D4LA 1F3OA 3EWSA 2ZRGA 3WBKA 3J81k 1XTIA 4O2RA 2ZVQX 3UMRA 1OPXA 2HCBA 2IUUA 2VEDA 1GRQA 5TXGA 4AF7A 3NH6A 2GILA 3TUZC 1XJ0A 4AC9A 4KBGA 1DVRA 3Q5DA 3P26A 3T1OA 1UKZA 1VHLA 2D7DA 3KQHA 3TAUA 4PQYA 1H42A 3AKYA 5G3YA 4JLDA 3WRXC 4PPFA 2C98A 5P21A 4RD6A 4URUR 1FOEB 1P73A 2QMEA 2G83A 3FFAA 2GEDA 2ZJYA 3PQCA 3Q9LA 1AQYA 3SFZA 3CMEB 1Z0DA 3AH8A 3CWZA 2OXRA 3ICEA 4OYHA 1KD1D 2C03A 4HDOB 4LJ5A 3DM9B 1FP6A 1S9DA 1YJ5A 4TL8A 1A5TA 3R20A 1KNQA 1CR4A 1FNDA 4JZKA 1JA0A 2FU5C 1E2KA 2QN6A 1ZRHA 2CK3A 4HAXA 1KMHB 4D80A 4KFTA 4PQFA 1NP6A 2XNDD 4ILEA 1E63A 3A1TA 4K8OA 2V54A 1KYIA 1K9MD 5JI2E 3KQNA 3LNCA 2HCJB 1KDTA 5SZIA 1NN5A 1DPFA 2GF0A 3OZVA 4DLYA 4QGAA 2QEXB 2FH5B 2FF7A 2LKCA 2F55A 1OIVA 3L8YA 4LJ7A 1P3JA 1QGAA 3GQBA 1II8A 3C15C 4CVNA 2R62A 3SZRA 2BBOA 1MRNA 4GP6A 1COWD 3C7KA 1N5LA 4Y0AA 1NY5A 4OI0A 3MFYA 4RD4A 1FP7A 2XTZA 4P4SB 3CXCB 1KI2A 2GXQA 4L9SA 1NVVQ 5AJZA 1JEEA 2O0HA 4FIDA 2VSOA 2ZRAA 3AKDA 721PA 1WBBA 4Y7CA 2IL1A 3R7WB 4IVPA 4KSCA 4B75A 4FWIB 1I4DD 4A8JA 4RD2A 621PA 2ZANA 1VHTA 4DSNA 4DT1A 3MGCA 3FPAA 3LXRA 1OGIA 4OKSA 4N0EA 4B32A 2YOHA 1XD9A 2JJ2D 3HYTA 1XMSA 1M7GA 3FE2A 4ASUD 3UMSA 3VR4A 3W5IA 2EWVA 3UG6A 4EFLA 5JJKA 1T3SA 2BKUA 1M74A 1J70A 1KK1A 5CM9C 2BGJA 2FX3A 3VKGA 2GBLC 1II8B 1OSNA 3LVQE 3NBXX 4F4JA 3GLFB 4YONB 4PGOA 1JR3E 2VP9A 3EPKA 1IBRA 2BKEA 4EPRA 4TQUS 1XXHB 2XSZD 3H84A 1W5TA 3U4QA 1EXMA 4L15A 5C18A 4NCJA 2NG1A 4DIDA 1S2MA 2AK2A 2A30A 5L3VA 4WVFA 5KSPA 3SU8A 3OEED 3CRVA 1VYVA 4LJ4A 5DSZA 4NMMA 3H4MA 3RRZA 3SBEA 1CXZA 1VQ8B 4RKFA 3EA0A 3SJCA 1JI0A 2A2ZA 2WJVA 2JIZA 4MYTA 5EUQB 1PV4A 1M2OB 1KMQA 4EAQA 2BMDA 5HTKA 2BM0A 1P2TA 2PBRA 3EXAA 3QENA 2C2HA 4EPVA 3DPUA 4LBVA 2AKYA 2FPLA 4TYYA 1WRBA 2DY1A 1Z63A 1G3QA 2F3TA 1OXUA 3IUYA 2ZR7A 3K9HA 3LW8A 3W90A 4HUTA 3WBJA 2WJYA 3D8BA 4HZUB 5G53C 1AZTA 3KTAB 1KI4A 2J9RA 4PSAA 2J0SA 4FN5A 5C4MA 2RKOA 2P65A 4HLQB 1OW3B 1NG9A 1DAFA 3CZQA 2D4HA 1E1QA 3OZXA 2A5YB 2DFLA 2DFTA 4I1VA 3ZS8A 1F6BA 1LFDB 4UNQA 3PG5A 2PEZA 1RJ9B 3TLXA 2ZR0A 2VZLA 4NYJQ 3PEYA 2DWOA 1RKBA 2WPDD 5TR9A 3CX8A 2PLRA 4MGYR 1W4CA 2V7QD 1E69A 2CJWB 3VX4A 1E2MA 3KKMA 1UDXA 4OK3A 2QZ4A 3K09A 4JT4A 3THOA 2ZSEA 5JWRA 4AKGA 1XTQA 1AA9A 1L8QA 1P62B 1Q1EA 3VNUA 4B47A 2NO0A 4CF7A 2C9CA 1HEIA 3TW8B 3U2QA 1AKEA 3SR0A 4H1VA 2J41A 1LB1B 4LOAA 1XDBA 4EJSA 2ZI7A 1HTWA 1KTVA 3E5HA 3EZ7A 4XVQA 4IDHA 3SYNA 2KWIA 3QVVA 1A4RA 2GJAA 1U9IA 2VNIA 4MKGA 3TR0A 3GJ7A 4IDQA 1P4SA 4ASUA 3LA6A 2WAYA 3EPHA 2JJ2A 3Q72A 3ZIAA 1W0JA 4U00A 1NL3A 3DL0A 4AYXA 2AWOA 3I32A 1QVGB 1U9IC 1E2JA 5FBQB 3CX7A 4NCKA 2PCLA 2XXAA 4G0NA 5HCNA 2VP0A 3KXIA 3AF2A 2Y8EA 1ZP6A 1B23P 5GV7A 2XZLA 2YZ2A 5JZVA 2X77A 1QDEA 3K53A 4TYWA 1E3MA 2RC5A 4U7DA 2H92A 3AVTA 3W2GA 5FR2A 1E1RD 3MWJA 4ZKDA 1E2EA 1E2HA 1WDTA 2J46A 1KOFA 5EP2A 5IK2D 2BMEA 1R0XA 1KJYA 4LWZA 3VMFA 1QFZA 5JRJA 1AN0A 2IYQA 2KBEA 2LKDA 2W6JA 2IS2A 3W6OA 5CITA 2WWXA 3CNLA 4DT1B 2RGBA 4OQLA 1IN4A 5FTKA 4ESHA 2C5LA 1GL6A 3RSLA 3EARA 1W0KD 1US8A 3F3YA 4ZIRA 5B30A 3G0HA 4ZKEA 4G5QA 1SHKA 4K81B 3L8ZA 1AM4D 1XZPA 2R65A 4FCTA 1XCGB 2VIIA 4XVRA 5AUOB 5H68A 5JS7A 2QGNA 2VP5A 4OL0A 4TZ6A 1E2QA 2C04A 4PO8A 4KAXA 1QHIA 5EZ6B 1NJGA 1SQ5A 1Z8FA 1YKSA 2IW3A 5CB8A 4AG5A 5LD2C 4B35A 1ZU5A 4OQFA 3OEEA 2UZIR 1HV8A 4JBXA 1RVDA 4D4MA 1YE8A 3A37A 3QFTA 3WNBA 1KKLA 4U02A 3AVWA 3KKQA 3TW4A 4PXAA 4YMUA 2IEYA 2F1RA 4TYPA 2D2EA 1J8YF 2VNKA 1D5CA 2QBYA 4HLCA 4CEIA 3KX2A 3LRPA 1OH5A 1J90A 3RS2A 3FKSA 2R44A 1G1MA 1KHTA 1UDWA 2B7CA 4JS0A 1X8LA 3ZH9B 2J59A 1XBTA 4MUAA 4N1AA 5E95A 4D82A 4EQ6A 1G5PA 4OHYA 1JAIA 1CJKC 4QBHA 3NC1C 2AR7A 2PX0A 2OCYC 3K0CA 4KVGA 4JSTA 4X8OA 3W8RA 1JR3A 2WJHA 3MWKA 3EC1A 3EIEA 2XTNA 1XWIA 1SXJB 3PUZA 2ZE6A 5EP3A 4RD1A 1OV4A 5GADl 3QEOA 1YR9A 1NMZA 4MKFA 1RZ3A 1GO2A 1KI7A 1SKYE 1TF7A 2XB4A 2GJKA 3DKVA 4NCHA 1E99A 4EUNA 1DAIA 3M1IA 4Q47A 2ZSAA 2CK3D 3I3SR 4F38A 3FMFA 1E4VA 1XJQA 4PAQA 3FMIA 2VTKA 5ANRB 1QH0A 2J0UB 1GKIA 2DB3A 1P72A 5IRCD 1M7BA 1I7PA 1E79D 1GRRA 2OAQ1 1A7JA 4L5BA 3PEWA 2FEMA 3BAFA 2ZEJA 1LNZA 4WA7A 1XJCA 1SXJC 2FPKA 4M1SA 2PEYA 2RHDA 3T5DA 1E2PA 1TU4A 3L0OA 2Q9CA 3LBNA 1R5BA 2DR3A 3BH0A 3K9GA 2IYZA 3R8FA 2OEPA 1KDOA 3KJGA 3ND8A 1T3LA 2F9MA 5KO2A 3T34A 4Q9HA 4HB2A 2HDNB 2B6HA 1P2UA 2WHXA 3TRFA 4DSUA 2GK7A 4A36A 4LX0A 2EFGA 1G6HA 3LH5A 3CRRA 2PZFA 4KFRA 3P4XA 3HU2A 4WW0A 2BPOA 1US8B 2JA1A 3D3QA 4ZIRB 1QF9A 1SXJE 2ZYVX 4AF6A 2FWRA 3K1JA 3OE7A 3OHMA 3SBDA 1W34A 4L4UA 1E9RA 1U8ZA 1VQMB 5JSZA 3U4QB 2GZHA 4PAOA 1HE8B 4PZZA 4A2PA 4M53A 5J4VA 1DAGA 5K8IA 5LPNA 5EMNA 1IY1A 5HPYB 2F43B 2B92A 2OUKA 3WXMA 4IOMA 5F3WB 4TTRA 3KJEA 2XJ4A 4TL9A 3IQXA 1IM2A 4JVLA 5EXTA 1QHSA 1R10A 4CYMA 5EE3A 4E5UA 5KNBA 5FFMA 4HI0E 2ODEA 4YAOA 4B2LA 2BBSA 5EP1A 2DWPA 4OQXA 5JBQA 3ZJYA 4TMWA 2NPFA 3E70C 3WP1B 1QVAA 3T15A 1TADA 2QP9X 1QUFA 3QE0A 1BX0A 2V8OA 4PHHA 1CLUA 1QG2A 2ZJOA 4Q9LA 3RDPA 2QAGB 3VR1A 3JVUA 2N46A 3U3OA 1AMOA 1DO0A 1NVUQ 1G8YA 4TYQA 5E3HA 4E22A 3ZLJA 2VHTA 1SM4A 2BOVA 1TUIA 1IONA 4PQRA 4OI1A 3GEHA 4C0HA 1JBKA 1SVMA 2BWJA 1KAGA 3CO5A 3HR7A 3NDPA 4Q4JA 4JVSB 2IX3A 4MYCA 3VNVA 2BF4A 3SEAA 1LY1A 1BO6A 5GV8A 4XTCS 1N0WA 1T9HA 4DSTA 5DNYB 4MRPA 3CRQA 3Q5EA 1AS3A 3ADKA 3LAWA 5KSZA 3VAAA 1WA5A 1Z0AA 4LJ8A 1JPJA 1NMYA 3PITA 3QSYA 2YHSA 1G16A 4TMXA 4Q7KA 4YQFA 5KU1A 5JWHA 1M1YE 1OIWA 3FTQA 4Q7LA 5KDOA 5LB2A 2BM1A 1HA3A 1YHQB 4LRWA 3TSOA 2JJ8A 3W6PA 2OLKA 4D25A 4FMBB 2EWWA 121PA 4KU4A 1FFHA 3OIYA 1WB9A 2DBYA 5B57C 1CU1A 5JMTA 1TF2A 5H1YA 2XTMA 4QBIA 1KZGB 1P2SA 1FNMA 1SZPA 4BRWA 3U7GA 1QG4A 4JSYA 3RLFA 2MMGA 1W2HA 5J4KA 3IIMA 3NG1A 2CJWA 3PVSA 1YZTA 5FOVA 3CMAB 2ANBA 2V6IA 3L0IB 4GOXA 4IVQA 1T0JB 2QRNA 4A15A 3L0SA 1TUEA 3GD7A 1XEWY 3AQ4A 4BZPA 3ZD7A 4LHXA 1N6HA 1NMXA 1KDRA 3IQWA 3TH5A 4QXAA 4LDJA 4JLBA 3BWDD 1P9RA 3DDCA 3BFXA 1KI9A 4MITA 3CCRB 3I92A 4Q48A 3TBKA 3TUIC 1E2IA 3HWSA 1W44A 1VMAA 1Q3HA 4EDHA 3DM5A 5M04A 3B8HA 5BYJA 4TYNA 2CNWD 2F7SA 2O8FA 4MGZR 4KHZA 3KFVA 1IN8A 4G01B 1ZUHA 2DPXA 2JLWA 3CONA 3T12A 3RC3A 5D3MB 3SJAA 1GP2A 2MSEB 4M2LA 1E32A 4CEIB 4A0RA 1W0KA 3B78A 5KNDA 3LVBA 1E1QD 4I1SA 2JCSA 2REBA 3TVTA 5FOUA 1IJFA 1EK0A 4UNNA 3RRNA 3T1VA 5GVSA 1FRQA 2YWGA 1ANKA 2TMKA 3IO3A 3OFNA 4HUQA 1E2NA 2A5FA 4TQ9A 1BIFA 5SZHB 2D74A 2XNJA 4M1MA 2J0UA 3CLVA 4NHOA 4DBLC 2X2EA 3QVUA 1YQTA 3B82A 1WQ1R 2ORWA 5CYOA 1Q12A 2C96A 3AVVA 1Z0JA 2V4ZA 4BFUA 5HZHA 4X8LA 4LZZA 4B2IA 2IT1A 4CEHA 2AXNA 2OFXA 1RRFA 3HU3A 1BMFD 3A1VA 1ESNA 2PZGA 1QGYA 1W35A 2JLZA 1OF1A 1N5IA 3GFPA 2Q0HA 3ASYA 4MA4A 4YLGA 1TL7C 2ZE5A 2Z0MA 3CH5A 1XMIA 4LHZA 1OH6A 1W49A 3U44B 4D4KA 4WAUA 5FUXA 2REXB 1PLJA 4BLRA 2WOJA 2O8DA 1ZM3A 3ZIAD 1VCOA 3O8DA 3ADBA 4C2UA 1RW4A 1WXQA 1PUJA 1N2CE 3I8SA 2ORIA 3AP1A 1M1KD 2QT1A 3MJHA 4AYTA 1I2MA 2XAUA 1GITA 5EJEA 5L3RA 3QEJA 4DC9A 3SYKA 1KO1A 1KNXA 4BEBA 1G21E 1ZIOA 2ATXA 2R6AA 4ITRC 1UMKA 2OCPA 4LCBA 4XD7D 3RRMA 3KUDA 4LGMA 4WBSA 4TSFA 3EPLA 1E62A 3GEIA 2ODWA 3DVLA 1TQ2A 1F2UA 3IHLA 4MGIR 4IEEA 4CDGA 3CH4B 4LPSA 821PA 5FH9A 2VQSA 3L43A 1GNPA 1ZNXA 1NLZA 1TPZA 4TTPA 2PMDA 1F48A 1YJ9B 1OT3A 3B1YA 4FMCF 1UPTA 3WY9A 2MSCB 1YR6A 2WVJA 1Z28A 3LQQA 1E2DA 1UKVY 3LVRE 2ZM5A 1OGJA 5AUQA 2E1RA 2F9LA 4TLDA 2P6RA 2NIPA 3T1TA 2C95A 2NTYC 1ZNZA 3PUVA 3RS5A 2YV5A 3K0AB 3VU9A 2XNSA 4J0QA 1OFUX 3EG5A 1IB0A 2PL3A 3PR1A 4AY2A 4DUGD 3FMOB 2FPMA 4KO8A 5JJLA 5FTMA 2CLCX 4Y0VA 3WP0A 3OAAA 2W83A 2QT0A 1IN6A 1DARA 3W2FA 4MRRA 2XNCA 4QBFA 2I1QA 4DDTA 1C1YA 4IOJA 3SHWA 3QPWA 2QE7A 2RGXA 4RD3A 1E2LA 3O8CA 2RGDA 1FW6A 5L3QA 1X1RA 4KXFB 4G1VA 1R4AA 1ZIPA 2ZRLA 1NI3A 1WCV1 5FPHA 1VPLA 2DFKB 3KQUA 4Q66C 4JKIA 4I99A 2CCJA 4P4UA 521PA 2P0EA 2JLRA 3U61B 4DB2A 2IYLD 3V76A 4OHWA 3PCRB 3M0EA 2QMOA 1G7SA 2QPOA 4DVGA 4II7A 3H1TA 1S1CA 1CNFA 2BDTA 2FMXA 3K0EA 4NYMR 1XTRA 3DEFA 4QHSA 1EP3B 5HKKA 1F2TA 3W5VA 4PHGA 4IEIA 4Q1CA 1RRPA 2VF8A 2YC4C 1ZNWA 3AVPA 3L2OB 3B1XA 4PZYA 3FHTA 3ZYCA 2IS6A 1T6NA 3QF4B 2QNRA 1RE0A 4BZXA 1VQ6B 4NPHA 2IC5A 1DELA 4HB3A 1NVXQ 3CPJB 4UKDA 5DHFA 2H8KA 4B71A 1KIMA 4LPKA 1XP8A 4M9SA 1BH2A 1KC8D 3DOEA 4NKRA 1P7CA 4JVNA 4Q02A 3X1ZA 1TLLA 2G0NA 3CCUB 4EKDA 1FUUA 3UWKA 3AUXA 2A78A 4XSHA 3KJHA 2ZUCA 2GBLA 5FUVA 3OJXA 3NEJA 3BD9A 1Q82D 1R0ZA 3HDTA 1G9XA 3JZMA 3I5XA 3A1UA 4PPNA 1YRBA 2GXSA 2NZ8A 2FNAA 3KKPA 4KSBA 5DIFA 2Q9BA 2R6GA 2XZPA 3BFVA 3IIKA 3THXB 2V1UA 4WXRA 2FFBA 1E9AA 3K0SA 1DOAA 2Q21A 4P6VF 1GZSA 2XNDA 4JJKA 4QJ3A 5CLLA 1ZUIA 4XWKA 2FE4A 1EESA 4IDPA 4QRHA 3IPXA 4EJSC 4LI0A 1SXJD 3TE6A 3REGA 4YMVA 3GCGA 3LXXA 2NO6A 3RC8A 1N6KA 4WQMA 2WZQA 4CZ2A 3NTUA 4A82A 3PEUA 3CCMB 1G3RA 2R6HA 4M1KA 4Z8YA 3BB3A 4A1FA 4QNMA 1VCNA 2OHFA 1UF9A 2EFCB 3ICQB 1P6XA 2IK8A 2DYKA 5CM8B 4W7SA 1T8TA 5LD2B 2VF7A 4KLZA 4HLUA 1TQDA 1XU4A 2D2FA 4JVMA 3DMNA 3AB3A 1N0UA 2C78A 2H7VA 4DHEA 2X3UA 3K0FA 4C0SA 2GWHA 1CBUA 1TEXA 2UVQA 2P6NA 4G5GA 2QRZA 4W5WA 1W36D 3GJ6A 3PFIA 2VHUA 4D4JA 4CEJB 5SZKB 1CNEA 4US0R 3EZ2A 3UKDA 2GRJA 1K8RA 1E9DA 1GOTA 3LD9A 1HURA 4DQKA 5CDFE 3RRYA 3B9PA 1E0KA 1N0VC 3QUSA 5E7JA 1EFRD 2QTFA 4B3GA 2GCPA 2QMUA 1Q0UA 1NG1A 2J5XA 4PFSA 5J4YA 1W46A 2ZRIA 5H59A 1KJZA 5EXXA 3NBYC 3SDZA 5JI3E 4GT1A 2YVUA 4IJMA 4URXR 5IK2A 2IBMA 1CTQA 3EAQA 3QBTA 4GFDA 2PJRA 4EPTA 3L0PA 4Z51A 4BE7B 5BQ5A 1QGZA 2QSYA 4D26A 4JBWA 2G1JA 2RCNA 4C0KA 1Q3TA 1YIJB 3K0CC 2ZITA 1OFTA 3B5JA 1ZMXA 3RS0A 4D0LB 5DI3A 3I8XA 1BKDR 4RY2A 3ZQJA 3GLFA 2CNWA 3AF3A 2F6RA 5KYKA 4AWXA 4F93B 3G71B 2IYXA 2QQEA 3ZQ6A 1YZQA 4XD7A 1E9CA 4EFNA 4XJXA 2L0XA 4QNRA 2MMCA 3F8TA 4X8MA 3LO8A 4QFMA 4C7OA 2XSZA 1T3HA 3A4LA 4NDZA 4P0TA 1G8PA 1W0JD 2NMVA 3ZZUA 2AX4A 3NHAA 2R2AA 5DGXA 2WWYA 4OJKA 1E2FA 1Q1ZA 5JFGA 1U0HC 2GCOB 4PTLA 5TY0A 3WNCA 3QXXA 5DH9A 4HYYA 1KI1A 3NDBB 2J7KA 4Q5IA 1VG1A 2ZYUX 3UATA 4DLTA 4WOPA 1N6LA 5IF9A 1U98A 2BHRA 3LDAA 4C43A 2YWFA 3OJWA 5D3MA 3GJ5A 1SVOA 3G5UA 4LHYA 5FOWA 4DCNA 4G5SA 3AKCA 3GLIE 2EFHB 1ZCAA 1BMFA 2W0MA 1NKSA 3B13B 2GHIA 1FPMA 3CF6R 1OJLA 4MRSA 4FMDF 2JLUA 1KSFX 2DETA 1IY0A 3SE0A 4EH1A 1MV5A 3KXLA 5FBWB 2FA9A 3U60B 3R9IA 2OCBA 5CJPA 4C0AC 2ASEA 4DEXA 1BJKA 1G3UA 1Z08A 1R2QA 4WZBE 3IEVA 4MH0R 1JECA 4FMCB 1TTTA 3K70B 1DAEA 3B9QA 3HYRA 3FOZA 1B2RA 4RZ2A 4ZDWA 1JQJC 3BGWA 5JCZA 1GNQA 5GJVC 1YJWB 2GEUA 4JBYA 4XH9B 1A2KC 3BERA 1K5DA 2CCGA 3K8YA 1E9EA 4YXWD 4TN1A 5K8LA 3OW2B 1ZJ6A 2H5EA 4KFSA 2BVNA 2E87A 4YMWA 4URYR 1NIPA 2O8BB 4S2EA 2J1LA 2QMHA 3CF0A 2EQBA 3IILA 4BASA 5DE3A 5TARA 2GK6A 4TLCA 1KI6A 2C9OA 3C5CA 2F3RA 2GVDC 2KJQA 4ZPXA 4UNPA 3ZVNA 4RCYA 2AN9A 3Q8XB 1S4QA 3AP2A 2B21A 3SOPA 1FX0A 3SFVA 1NSTA 2H1LA 1ZVQA 4IW3B 4A2WA 1E94E 3LLMA 3CCVB 5EE5B 5F9FA 1DADA 3N2IA 1YZKA 2IS1A 4IFEA 4DCVA 4W9MC 4KCGA 4OQMA 4O25A 4GPTA 4QC2A 1CR0A 3FVQA 1V5WA 1BYUA 1GDDA 3KZ1E 2ZS8A 4Q4HA 2BSAA 1RC8A 2IWRA 4RZ3A 1Q1BA 2RGAA 4BFYA 4G5RA 3VR6A 1UJ2A 4K1XA 1S3SA 3GJ4A 1CR1A 1Q44A 2X19A 4LBWA 1GL7A 5AUPB 3PENA 4ZO4A 1VQNB 2ZU0C 2CLDX 1G8HA 2GA8A 2ZRPA 4B43A 4BECA 1IJEA 5AR1A 2AD1A 3BBPA 4L16A 1U8YA 2HT1A 4HAUA 3AGPA 2QROA 2AL7A 2OK7A 1VQKB 2YWEA 4ERNA 2O8FB 4ARZA 3THWA 1N25A 3EZ9A 3VHLB 5JJIA 5L8VA 2NO9A 2ECKA 1G7CA 1KO8A 3WMGA 2BCGY 2GCOA 2VA8A 1U0JA 1DDGA 2ZPTX 4FXPA 2WBLC 2RC6A 4NL4H 3LQRA 421PA 4V02A 1NN0A 1G7RA 1NDHA 5TV2A 1QX4A 1FQJA 2ZI9A 3KTAA 4XSGA 1W7AA 3QKSB 3ZVLA 3PUYA 3I1FA 4BFSA 3CF2A 4LY6A 2RB4A 1IXRC 2QTVB 1P61B 1S72B 3I5YA 1YRAA 4GSYA 4MDEA 4LJ6A 3PUWA 1KGDA 1DTSA 1RRGA 4GI7A 2ODBA 3TAHA 1VCMA 1KJWA 2ZRCA 1G291 2WOOA 1H8HA 1N6OA 2PJZA 1R8SA 1EP1B 1VQOB 2WKQA 4LYAA 4FMDB 4S35A 5SZJA 4H1UA 3IIJA 2HXYA 4ZI2A 1JR3D 4EFMA 4DLWA 2X8AA 1JALA 3P1JA 3RVBA 5ELXA 1EFHA 4JYCA 3ASZA 3ES9A 1SVLA 1VKJA 3AF1A 4Q9JA 3TGPA 1XZQA 3IHWA 2QQ0A 3V4RA 3FMPB 2WICA 5HE9A 4KYUA 4M1YA 1XXHE 2OLJA 2R6FA 3ZBTA 3BS4A 3GLFE 2ODNA 2I3BA 3FJOA 4R7ZA 2ZRBA 2HXSA 2ZRDA 4NP6A 1XNJA 1CRQA 1A8PA 1ONBA 4V0NA 3EASA 4QJ4A 3N2EA 4BFZA 4P4SA 3NVAA 3RS4A 3OZWA 2DERA 1KAOA 5AJVB 1ETUA 5IT5A 4B2PA 1DAHA 4B3DA 2CL0X 2B8TA 3W6NA 3GFOA 4PZLA 1G5TA 3W5HA 1VYUA 2QPAA 4FD2A 5F9HA 1GILA 3KB1A 2HF8A 2OBNA 3BFKA 2FSFA 1QHNA 4F92B 4OBEA 3CCJB 4ZGQB 3AVYA 1G4UR 3ETLA 1DEKA 1S0UA 2ZJAA 2ZJZA 4UAJA 5C1BA 3GLIA 5FR1A 4NYJR 5TB5A 3U44A 4JLJA 1G8GA 5TMPA 1FNNA 1FZQA 4GRAA 2GZDA 3A8TA 3B1VA 3K0AA 3VU9B 5HR5A 4AURA 2H18A 1J9ZA 1BQEA 3B2EA 2O8EB 4HDCA 1CKEA 4CT4B 4Y9UA 1BX1A 2OE2A 4KBFA 1U99A 1W2GA 1TNDA 2GZAA 3M6AA 3C16C 5CJ2A 4R71A 2KI5A 3PJRA 4DXAA 3IBGA 4OI2A 2Z4SA 1R0YA 3TIFA 3AUYA 1U8AA 3B1ZA 1G19A 2CBZA 4RVCA 3TKLA 2WWFA 3LLUA 2QM7A 5GVRA 3GLIB 4EPYA 2FZLA 4RFVA 2WMNB 1E9FA 3DHWC 4IRUB 4DRZA 1CF4A 3NC0C 4B44A 4OHXA 5DISB 4DDUA 1CP2A 3LFUA 5KSOA 4AK9A 2QAJA 2H57A 5FBRB 3UMFA 1E9BA 4C4PA 5G41A 3G82C 5BWMA 1KRHA 1A1VA 3FYHA 1RRCA 1DS6A 2CMKA 1G64A 4DLRA 2GEVA 2OCAA 1UBEA 4DLXA 1QFJA 2BJWA 3NBZC 1YI2B 3VHXA 3W2HA 1OXVA 2IHBA 1F2TB 4TZ0A 3ZS9A 3P27A 3IO5A 4LV6A 4Q01A 1G3MA 4ZCIA 2G1KA 3QKRA 4Q4LA 4A8JB 1MO5A 3E1YE 4V03A 4JLOA 3I56B 5K8UA 5J47A 5KSWB 5FTNA 3BRWD 1KDPA 2ERYA 3QFRA 5FBVB 4G1BA 1GM5A 4TLEA 1D2EA 1Z5ZA 4C7OB 2BMJA 4DKXA 2PLFA 3FB4A 1BOFA 3FDIA 2PMKA 4N3NA 2RGCA 3N5CA 5C2JB 3RWOA 1RPZA 3E1SA 1N6IA 4HAYA 3MHPA 4NZYA 1D1NA 4M8NE 2VPPA 1Z0IA 2VHJA 3QJYA 2H16A 2BC9A 2IS4A 3FFBA 4F7DA 2QL6A 1PJRA 4DSOA 1W4AA 5FA6A 1E9SA 3WYGA 4D81A 1M34E 2WMOB 1QVRA 1Q1QA 1UEIA 1KY2A 2QUZA 3Q85A 2XITA 1XF9A 2VBCA 2BMFA 2WSSA 2ZAOA 1QBKC 2ZRFA 2GPJA 1XTSA 2ZYTX 3C8UA 4C0BA 3GLGE 1MABB 4I81A 2BJVA 3PV0A 1LVGA 2VH5R 2QE7D 1J7KA 2ZSFA 5A0FA 4UNRA 3ZDQA 4V0ME 5FPSA 5CB6A 2NO7A 2Q9AA 3AV0B 3THXA 2JLVA 3CX6A 1II9A 1S9HA 3A4MA 1FTNA 3G4SB 2ZRNA 1RYHA 3TSWA 1OLOA 2W58A 4G5OA 4O2LA 4ACBA 1EFRA 3W8NA 1NBMD 3WYFA 1KY3A 1U81A 4UXJA 3JQQA 2OV2A 2ZR9A 2A5JA 3EZFA 2O8CB 2RMKA 1LF0A 2HYDA 1CJMA 2JEOA 1QUEA 1FUKA 4Q4AA 4PC1A 3RNLA 3W5JA 4UNSA 3VQTA 4Q1FA 3S1AA 2ZSDA 3W34A 1DAMA 4TMTA 1ZBDA 1MH1A 3WNDA 2W00A 3NWJA 3QQ5A 2ZS7A 4AG6A 4DWJA 3AVUA 1J2JA 3TMKA 1UFQA 2X1VA 3BJIC 1KSJA 5CK5A 1D2MA 3EWAA 1NKTA 1QHYA 2GF9A 1OE0A 3FGNA 2YOFA 4PO1A 1NIJA 2RGGA 2OFOA 2ZE8A 4IHQA 1A82A 1GNRA 2CNDA 2WKRA 4NONA 2ZUBA 3BH7A 3LBHA 1IQPA 4B33A 1KQSB 1XTKA 3UK6A 2WAXA 4C0JA 3MSXA 4UXHA 4DLUA 3RWMB 4MYHA 1Q7YD 3LW7A 2IWHA 1DAKA 5FOTA 2ZAMA 4LJAA 3HPRA 1G17A 2KSQA 3RS7A 3FPKA 4L8GA 4M9ZA 4F4IA 3IKJA 3MLEA 1DO2A 2OZEA 2QU8A 4BQSA 2J0QA 1X3SA 1XRJA 1IXZA 2RGNA 4DZZA 2Q3MA 4Y9RA 2IYVA 2BIFA 1AGRA 1KZ7B 1M7HA 2JLSA 1W5SA 3NIBA 3BIFA 1UBFA 4PX9A 4YDSA 1CJUC 3MD0A 2AWNA 5B64A 2WPDA 1XPOA 1SKYB 1KI6B 4C3ZA 3H2YA 2RH5A 2BN4A 1CQXA 1EWYA 1VQ9B 1G18A 1I4TD 5L3SA 1ZC4A 6Q21A 3OZUA 1EX6A 2ONJA 2YWHA 1XD2B 3HPQA 1HUQA 3EIHA 1VYTA 1NN3A 2AFHE 2N42A 1EFTA 4PSKA 4RZUA 1OYYA 1VCIA 3D31A 4Q21A 2AD5A 4RKEA 5FI0B 3U3KA 3EZ6A 3PUXA 4WXPA 3JQRA 2ZJ5A 2J87A 5E7MA 3FHOA 2K5UA 3TNFA 1T4GA 4E07A 1EX7A 5BYKA 5DLQC 3QE2A 3K70D 2BGIA 4DLVA 3Q7PA 1SKQA 2J7PA 2GVZC 3R7WA 3AM1A 1YZUA 1PUIA 2QDXA 5HKKD 4IFBA 3VR3A 1NLFA 3PIRA 3HR8A 4C2TA 1OXTA 3DKPA 4M22A 1Y63A 1JEDA 3K09C 3AKEA 2P67A 4BWYA 1AS2A 1S3GA 2QA5A 4HE5A 4IOLA 5CIWA 5GJCA 4F4CA 5KHOC 1Q81D 3QPUA 2N1BA 3ZVRA 2BBTA 2P5TB 3KKNA 4YMTA 2GXUA 2G88A 3U6BA 1CS4C 2G77B 1ZD1A 1OH7A 1W2BB 5C46F 4ZGNB 1N3BA 1VECA 4HB4A 1K8AD 4WZAE 2RGNC 1R7RA 2XX3A 4MKHA 4HSEA 1KKMA 4NTZA 4AKHA 4OK6A 4JL8A 1YZGA 1GVHA 1GAJA 2OFWA 3AGQA 3KKOA 4YMSA 5KDDA 2D62A 3NKVA 2ZS9A 3QFCA 1HE1C 3VR5A 1Y3AA 1Z6TA 2Q3FA 4E03A 3CM0A 5AK0A 3EX7C 3VTKA 2P6UA 4BPBA 3OIVA 1O3YA 3X2SA 2QEQA 1P9NA 1K5GA 2ZREA 2IXEA 1SVKA 3CPWB 1COWA 4Q9KA 2WSMA 2Z43A 1OXXK 1Z22A 1OHHD 3CCQB 1XD8A 4XTRA 2HJGA 3AVOA 1RYFA 5DYGA 5JLJA 4A0FA 3O8RA 1YHNA 4KJZA 3EIQA 4ZCMA 3I55B 2CE2X 4DEYA 1JPNA 3HJNA 4URWR 3R8CA 4Z1MD 4O3MA 1R8QA 1BS1A 4K46A 3THYA 3VFDA 3I62A 4PANA 5LBIA 5H8WA 1U2RA 2QA4B 4JLMA 3RHFA 1XEWX 3CBQA 4P3YA 4IXNA 4A6PA 1A2BA 1YVDA 3ZC3A 1YZLA 2QENA 3NEYA 4NCNA 2IYUA 1GKUB 3H0KA 3BC1A 4OI4A 5CK4A 2X2FA 5HCIA 1H8HD 4CEJA 1EWRA 1QHHA 1K73D 2CDNA 3BK7A 2EYUA 3IEUA 2WWGA 3MWYW 3QI2A 4AIIA 2NO1A 1OXSC 2FSGA 3ZGXA 4BLOA 1PLKA 5CYPA 4Z8XA 2ORVA 4CRWB 1UKEA 4W5HA 3MMPA 2WKPA 1EFCA 4CIDA 2BBWA 2O8CA 3A6PC 4CEHB 1XMJA 1N6NA 4RD0A 2C8VA 5EXSA 4TLAA 3W3ZB 2JATA 3NBFA 4L9WA 1OYWA 1QZXA 4TWZA 2ZUDA 4JJZA 4Q18A 4FK8A 1W48A 3QF4A 1ZM4A 4PSVA 3U6KA 3B7GA 3QPVA 1UADA 3G6EB 1W47A 2WWHA 2EVWX 3AVQA 3SNHA 3KUCA 5THXA 1XX6A 4F91B 3AF4A 4HE6A 1MO6A 3Q7QA 3TJZA 2JJ1D 1YITB 3TK1A 1Z0FA 1YZNA 1J8MF 4MRVA 1OHHA 4N0DA 1N5KA 1FQKA 1OB2A 4TQAA 4HUQB 5D3QA 3UANA 2HF9A 4TLBA 2QSZA 1D6JA 3CWQA 4CW7A 2BV3A 2Z83A 1Z2CA 2VP4A 4B48A 2EFDB 2YNMA 2CL6X 5EQTA 3RS3A 4CGZA 3T61A 4LC0A 3GEEA 4IVRA 2XZOA 5FBLB 1X8KA 3TR5A 1OFIA 1E0SA 2VSFA 2XGJA 2Q3HA 4TMVA 5J4LA 1L2TA 5IHPA 3OF5A 4QHTA 4PC7A 3GPLA 1G5RA 5JHGB 1IAQA 4QOSA 1X1SA 5DO9A 3RAPR 5DHAA 4PR0A 4HAVA 3X1XA 4ZCLA 3CNOA 4C0LA 4QJ5A 5J4HA 2B5OA 2GESA 4MQBA 2W0SA 4TMZA 1X8JA 2GETA 3U7FB 4I4LA 3GP8A 1UEJA 4QM6A 1WE2A 3T35A 3SI7A 2HUPA 4ACAA 3MJRA 2D7CA 5A5GA 1P2VA 2HT6A 3FKQA 1EP2B 4DCSA 5KPJA 2V3CC 2CL7X 3EC2A 4D2IA 4B3CA 2GTPA 4KLNA 5KDLA 2IA5A 2REOA 2V55B 2ZE7A 3CIOA 2VRWA 4WZ6A 5H70A 1YJNB 1M6NA 4TL6A 2CHGA 2SHKA 3KQKA 1ODFA 2GJSA 4NYIQ 1PLLA 4Q1DA 4QG7A 4PPGA 2GJ9A 3KXKA 2J7PD 2ZIAA 1Q86D 2LWIA 1NRJB 3W3AA 5DYIA 3KQLA 4GL2A 4UXIA 2VYFA 1GWNA 3A58B 1R5OA 3NHBA 4LJYA 4C0QC 5HE8A 1OB5A 1UBCA 5EE1A 2ZRJA 4BFXA 2OAP1 2ZJ2A 1VIYA 1Z47A 2WIAA 2W2XA 4JL5A 1GRNA 4XOIA 3BORA 3KDSE 1ESMA 1GSIA 1MO4A 5FPKA 4BPRA 5L3QB 4RJLA 5LDDC 4X8HA 2I4IA 2ATVA 4KV9A 2PZEA 3BXZA 4YDHB 1Z29A 4AKEA 2FJUA 1VIAA 5FL3A 2P3SA 1HYQA 5AJXA 4DCTA 3NH9A 4R98A 5FOXA 3F5FA 2FGKA 2O8EA 4YAWA 1E4YA 4BFWA 1T8UA 4OQNA 2JDIA 2OG2A 3TQFA 4ABYA 4BFVA 4D0NA 5CDFA 3S1AB 2OBLA 3ZZ0A 2Z5FA 4KITB 1Q21A 3GJ8A 1I4LD 2RHMA 1C9KA 2CCKA 4I1UA 2PIAA 2G0TA 1E64A 5AN9A 4P33A 3SJBA 2CE7A 1R5NA 4N3GA 2J0VA 2ZXUA 2J45A 3OFND 2WV9A 1ELOA 4NBSA 1JJ7A 2OESA 1UAAA 5E7IA 2WWIA 4D0GA 3SHFA 1G4AE 3P20A 2E9SA 1LTQA 1Z3IX 4NH0A 3T1QA 3C5HA 5TDHA 2ZI4A 3HU1A 5FTJA 4DDVA 2YKGA 4B3FX 1KK2A 4M1OA 2HMAA 2GKSA 1D9ZA 5EP4A 5JHHB 2F1IA 3O8BA 4TT3A 1NNEA 4A9AA 2OTJB 5BN5A 1SHZA 1GAQA 5H5JA 2IF2A 1D9XA 2ZETA 1ZUNB 3QOFA 4JLNA 1NVWQ 2IF0A 4JT2A 1TU3A 2A3RA 1N5JA 3CCEB 1DBSA 4R2IA 3C14C 4RSGA 1E0AA 4M1WA 1XB2A 4LYHA 1TAGA 1WMSA 1JQLB 5JECA 3OIUA 1VQPB 1NVVR 2DCUA 2XEXA 3RANA 1XFAA 3X1WA 4QBGB 3I73A 3SC3A 2F1HA 1NSFA 2ZYWX 1E98A 4IKEA 4B74A 2QP4A 2YYZA 2CVHA 5K8TA 1XTJA 4ESVA 4XWAA 2GAAA 4BZQA 2AKAB 2JASA 3QIAA 2R9VA 3BOSA 2GNOA 1CJTC 4IDOA 1D2NA 4Q9IA 5E4FA 4YXWA 1CULC 3Q3JB 4RCZA 4B3BA 4XWOA 3ZD6A 1MOZA 3KJIA 4FCVA 3QXJA 4IDNA 2V9PA 2ZRMA 2QM8A 4LV5B 4EQ6B 1T5LA 2WIBA 1AIPA 1E1RA 2GCNA 2JIZD 1LS1A 1G6OA 1ZU4A 3EPJA 2DHRA 1SVSA 3MCAA 2XJ9A 1TVCA 4AYWA 3UPUA 4PC6A 1S8FA 3W9YA 1G8FA 2KB0A 2RGEA 3MG9A 2NZJA 2V6JA 4RFSA 1OKKD 1VTKA 4UJ3A 1EWQA 4JMPA 5AJWA 3JZAA 3VKWA 3W2EA 2JLXA 4B3XA 1NBME 2ZI5A 3K9LA 5L3SB 1MR3F 3TQCA 1N8RD 3GJ3A 1P60A 1E79A 5AUNB 1WP9A 1K6MA 2JAQA 2BMWA 2XOKA 3PEVA 4EIWA 1CJVC 4Q1AA 3U7HB 3GJ0A 2O8BA 4B4DA 4KFUA 1ZCBA 2D3WA 1DG1G 1GVNB 2IYYA 4MRNA 4BGDA 5JCPA 1ZD9A 2J3EA 4H9GA 1H8ED 4GMXA 1X86B 5A4JA 4QL3A 1JAHA 4UJ5A 2OM2A 1H85A 2B8WA 4ZI3A 4U5XA 3REFA 4OHVA 4A8JC 2G6BA 2HLDA 4LHWA 2FOLA 2VP6A 1NN1A 1YU9A 1SVWA 1ZM9A 2Q6TA 1Q20A 1I2DA 4LBZA 4NYMQ 3LX5A 4MKIA 2IYRA 1MKYA 2RAPA 4JIMA 1J99A 1ZNYA 1NJID 2YINC 3RSOA 4GOJA 4MGKR 2CEAA 4HZUA 3KL4A 4Q00A 2P5SA 4DJTA 1JB9A 4LK2A 1IY2A 2P2LA 3U3RA 1VDZA 1T91A 1GIAA 4O0MA 2ERXA 5IDVA 1FRNA 1W4BA 2W6IA 1U90A 1MO3A 1AZSC 2IYSA 2FV8A 4AKIA 3WHKA 3OEHA 4CT5A 3CRZA 4URZR 1VG0B 2CVFA 1HQYE 4QGFA 3BB4A 3X1YA 2AXPA 2AHOA 2ZQ5A 3I61A 3THYB 1XMVA 2UZ3A 3DOFA 3NXSA 4PHTA 3B6EA 4V0LA 3ADCA 2VP2A 4Q4JB 1Z0KA 1G41A 1U94A 1ZM2A 2C99A 3CC7B 3B1WA 1QHGA 2PH1A 1L7VC 2Z4RA 2ZI3A 2WTUA 3ONWA 1T5IA 2IXFA 5UKDA 2WJIA 2FFHA 2LCFA 1KK3A 1NY6A 5KPDA 1U0LA 2IXGA 4KODA 4V0OA 1FTSA 2AK3A 4PC2A 1GFIA 3QKTA 5KUTA 4HATA 4P4TA 1IHUA 2EIXA 3MAAC 3QKSA 5DN6A 4G3XA 4ZDIA 5DN6D 3SJZA 5FUYA 1TQ6A 2VLIA 1XD2A 3CKLA 4DCUA 1T0HB 2WJGA 1ZC3A 4PO9A 5B58C 4R9UC 3SYLA 3LO5A 2B7BA 2FFQA 2FGJA 1LW7A 1VQ4B 4A0GA 4M4SA 3BH6A 2BCJQ 5AJYA 2PT7A 3LV8A 4HZIA 4A0HA 4DIEA 2ZRKA 1OIXA 1OH8A 5CIQA 4Q1EA 3CCSB 5BN4A 1IXSB 1S1MA 3M4YA 4GZMA 4NCIA 2QPTA 3ND9A 1GR1A 1MABA 1SXJA 1XEXA 2NGRA 2OILA 1II0A 4FWTA 1AJEA 4LYFA 2WM9B 4JL6A 4C30A 3WRYC 1JXOA 2IHYA 4Q03A 4P31A 2QAGC 1AKYA 2ZI6A 3R9XA 1M8PA 1MRSA 3GLHB 2WWWA 3EA5A 1F5NA 1VG8A 2HJVA 1L4YA 1NF3A 2FZ4A 1IN7A 3D7MA 5FL7D 1XXHA 3JQPA 1VQ7B 1HT2E 2EFEB 2FEOA 4ON9A 3EW9A 2FSHA 2FFAA 4URVR 2DWQA 3TUJC 3L82B 4BFTA 1CRPA 1KO5A 5FL7A 1CR2A 1EGAA 3QFSA 1N6PA 2NPIA 4GP7A 2HYIC 4PC3A 2H17A 5FOSA 5DI3B 2R8RA 2QTZA 4BLSA 1JXMA 1X6VA 5F98A 1F60A 1R6BX 2FG5A 4MDFA 2DFNA 3FKSD 1D8TA 1XPUA 5EUMA 5BN3A 1O87A 5EE0A 4A2QA 1QHHB 1FL9A 2IUSA 2CRVA 2YJTD 1H8EA 2CXXA 3DZ8A 3E20A 1QFYA 3VO1A 3ZBUA 2JLQA 4KVAA 1G3IA 3WMEA 3ZVMA 2XOKD 1PVOA 4JLVA 5KNCA 2VNHA 1TF5A 2QAGA 2QG6A 5LB4A 5TVKA 4MUBA 3CB4A 3P32A 2QGZA 3QY0A 4YAUA 2YC2C 3QXSA 3VO2A 2KBFA 2O0KA 2PX3A 2IEZA 1RJ9A 1LS6A 3GJXC 1OKKA 1OFHA 2QP3A 2V7QA 5CLQA 1W36B 2QBYB 3CRW1 3GFTA 4MYUA 1Z83A 1AK2A 2V1XA 3P4YA 4TL7A 4Q7MB 1WBDA 3WYAA 1P5ZB 4Z54A 3QNUA 4JLAA 1IN5A 2FDCA 1C4OA
chains in the Genus database with same CATH superfamily
2ZT5A 2YHIA 4KI0A 1UJMA 4GX5A 4HH4A 3AI2A 3N70A 4M1TA 3N6RA 4DLZA 1Y8QB 4JUCA 1W8DA 4LOKA 1W4RA 1FMLA 2EZ8A 4DUGA 4XVUA 4AJOA 1JJVA 1TYAE 5EIOA 3GLGB 2INGX 1P31A 3JQAD 3ZDDA 1FDIA 1X7YA 3OAAD 4YWJA 1NOKA 1XRRA 3AFHA 3FPCA 4ZT5A 1ZD5A 3UMJA 3WMWA 2QMQA 3NEPX 5HZKA 3AJAA 3H2IA 1RBQA 4MVWA 3AUUA 4JYBA 1NV8A 4TTQA 2ODTX 1O0CA 4ZFNA 2FRDC 1W5AA 1E0JA 3BXOA 1EB8A 2WD9A 3V8MA 2ON6A 2QZSA 4R2HA 4D4GA 4GAEA 5KNDD 1WUYA 3O1IC 1X7XB 2BR4A 4JITA 4R6XA 5CNKA 4G4SP 1UXIA 4UARA 2WT9A 2WSSD 1D2AA 4FOPA 4OJTA 1MZVA 2JFFA 1WVIA 4K2HA 4LSWA 4FLFA 4W6ZA 4PHFA 3WMRA 3FOBA 5BNTA 5ELMA 3SOZA 3ZR4B 2VPZA 2HLDD 1FLVA 3UT5A 1BE6A 3PCXA 1NB9A 1CR6A 2IYOA 4GMDA 4RA9A 4I36A 3M6VA 3RK1A 4HNAB 3GDGA 3VR6H 2QY9A 3KFXA 4JA2A 5KTKA 3AHDA 1H2YA 3V2GA 1ZGGA 3WISA 2A59A 1FX0B 2VCEA 1YLOA 1Y7TA 2O52A 3CPEA 2C84A 2ZSKA 2QJOA 5ITWA 1JIJA 4A4DA 5F7XA 3DDZX 3RKSA 3R9KA 4OJMX 4BMXA 2HR1A 3NPAA 4GLJA 3Q4GA 3L8EA 3LY9A 4LWOA 2CUZA 3QF7A 3V42A 1B1CA 3A9WA 4OLBA 1ULUA 2Q45A 2SCUA 1IUKA 2UXDB 1IXKA 1W4LA 3BQ9A 4RMGA 1JA1A 2Z6VA 1FUEA 2YIMA 1JNYA 3UOWA 4MX8A 4ZALA 5L7YA 4BKUA 4W8GA 1FMFA 2WR8A 4MV9A 2XQVA 4AZ3B 5JNVA 2GN2A 5AH0A 4OHZA 3EXG2 1GZ6A 1TQ4A 3OW7A 1QHXA 1CEXA 4HEA6 3UJ3X 5JEDA 5EHQA 5JRZA 3K70C 3BWYA 4BRUA 2JGNA 2GRAA 2FPOA 2PSFA 3D64A 3VU3A 2ZSIA 4MB6A 5BYBA 2XI4A 4XVHA 1XHFA 1FS5A 2XUOA 3KLMX 1ZW6A 4Q4AB 5C4GB 1X9GA 4EW3A 5EZSA 2PRYA 2O6HA 3X1DA 1PWYE 3EWNA 5EZ5A 3QXHA 3INRA 3R6TA 1TX4B 2YV4A 3JWJA 4D9HA 1C7JA 1XE1A 1O6CA 2RCYA 4II3A 1JB1A 4GIBA 4GRDA 4QYSA 3TBHA 4CL8A 3PIIA 3QUQA 3THWB 3UGKA 2Y4NA 1QTRA 1PK8A 5IU6A 3JQDA 2CVPA 3VJRA 4FCWA 1TM5E 3HJRA 3SQXA 4LHEA 1LD3A 3IGFA 1BCSB 3KXDA 4NESA 2AOXA 2ZZKA 4QOEA 5EMKA 3O8NA 3UWOA 4DUPA 1HI9A 221PA 2G3YA 2HBQA 3K9NA 2Q3BA 4XLHA 4M0LA 3ETHA 3OG9A 1MT0A 1DCFA 1YS6A 2CD7A 3O3MB 4GOKA 2YVQA 1Z6GA 3IQIX 4NBVA 3OIDA 3RC9A 4PBTA 3SLRA 5FX2A 1N2CA 3PC8C 5E3IA 2H5IA 5FFNA 1GAWA 1KMHA 5DHTA 1EBBA 4QKQA 4Z2AA 2Z6UA 2WAAA 4E13A 4DJEC 4LI3X 2IUTA 1EJ0A 3VH3A 5B2FA 2ZU6A 2MTBA 3D6AA 5IUNC 2CHFA 2P4QA 4WLOA 1T1EA 1Q57A 3G6KA 4YCBA 4XWGA 2EU8A 2DE0X 3E7DA 4FW9A 4IJ6A 4Y2RA 1TVMA 1SGWA 2DT8A 2DUUA 3HH8A 1MQ8B 3ZJUA 4FSXA 4J0JA 1H2HA 2IU4A 4Z4UA 3Q11A 5BSKA 3O74A 3NANA 4R1MA 1YOVA 4Q4DA 5A4AA 3W5UA 1YR7A 1R1DA 3UVEA 5L3ZA 1KFKB 1Z18A 5DK6A 4RK4A 4LSGA 3GGCA 5I9LA 2D0DA 3HWX1 4H17A 4TWAA 2ONKA 2R7MA 2IYWA 1I0IA 2YXDA 3CD6B 3KT6A 1NVMB 3D0KA 3QMPA 2QTLA 3A4TA 2WIDA 3L1VA 3MOSA 2W2OA 3AZPA 3WL8A 4LMRA 3PA8A 2VHXA 3VISA 4ZGGA 2GYVA 1QFXA 1VBNA 3F4KA 3O93A 4HRAA 4RVFA 4EATA 3OESA 3DZDA 3VO9A 2ZBVA 1L7OA 3OT5A 2UYOA 3ESDA 4O4JA 4ZQEA 5ICEA 5IM4A 1NP3A 3T5GA 2W2KA 1SOUA 3Q1LA 4BLTA 1UT5A 3OKCA 4A6XA 4CMAA 4E31A 5J3JA 1F4PA 1ST2A 2X8WA 3FUTA 1W5FA 5HGJA 1G2PA 4PYOA 2JJ1A 2VA9A 3UKOA 3EVTA 1MJHA 4A0QA 3O95A 1SXGA 4UUNA 4PRLA 5HQ3A 3R5HA 3CT4A 3DB2A 1N6RA 2I3DA 5C0OE 4S1OA 5EQDA 4DF3A 1LLQA 3O38A 3QPAA 1JU9A 1JKXA 1RXCA 1JX6A 1WSDA 1ZOIA 2J09A 3P52A 4WI1A 3KL2A 1IM5A 3E81A 3JAMA 3PD7A 2E4VA 4YJGB 1CIPA 1WF3A 1HY3A 2VSQA 1SXIA 3LBIA 4O2AB 2CLSA 1XUOA 1XXLA 2OXTA 3KB8A 1RNLA 5DNDA 1MB9A 1QK3A 5JSZB 1VQ5B 3C24A 3JXEA 3WB1A 3OIWA 3I1JA 4N6OA 4PHCA 4AICA 3MRTA 4UATA 4XKJA 3A1FA 4PABA 5F64A 4O1HA 5ITZB 4DNPA 1JDZA 1KU6A 3BXFA 3M2TA 4IXMA 4MJ3A 1DQPA 3NMUF 3SXPA 3GD5A 2PPLA 4RQAA 3EMBA 4ZAVA 4RHUA 4ISBA 1AQ6A 3VJLA 2Q2VA 4KK4A 3ESXA 3KQWA 3D1VA 4LVCA 5JPDA 1DZ3A 2G08A 2AJLI 1U3VA 3RYTC 3WIUA 1F0PA 2D5IA 1WUJS 2IPAB 3IUBA 4LGCA 3SS9X 1AGPA 3UT6A 1ZVMA 3M1LA 1E6EA 1XCPA 3W8DA 4FT4A 4YMLA 3PIDA 1T8YA 2AC2A 3CUVA 1JT2A 4N41A 3ZJVA 3TWOA 3OPYB 2XYGA 4R83A 4UZEA 1GSAA 3UXEA 1ZYUA 5BXQC 3CW2A 4U7JA 1T9KA 2A5GA 2ANCA 2XRMA 2Y1XA 3E9YA 1K08A 2BEJA 1SUPA 1XZKA 3ESAA 3SEFA 3ONYA 1J0XO 4P4LA 2FZCA 2J4DA 1I1NA 1A76A 3KJXA 3F0TA 5C8VA 4RL4A 2XUGA 4DA8A 5IH3A 4W5RA 3TSZA 3ESCA 1XZCA 2B30A 2Y0PA 1L4UA 5A62A 1TEVA 1LBSA 1Y6QA 1SHTX 3AB8A 3GG9A 4W4TA 3CP8A 3A6LA 4ZT4A 4BO1A 4E2ZA 1RHJA 2VHQA 1V4VA 2YCBA 4X7FA 5K3OA 1DUIA 1PZFA 1F9AA 3I72A 3NETA 2PT5A 1RABA 3OOJA 4LC1A 4X1YB 5DBEX 3Q3IA 4QG3A 1CEEA 3PP8A 4GZLA 1N8KA 4E5MA 4D4LA 1ZITA 3EWSA 5GONF 1BFUA 2ZRGA 4P84A 2I22A 1X92A 4ZU3A 4O2RA 5AHWA 2ZVQX 3VDMA 1Y3IA 4IGKA 1U8EA 1ENZA 2E6KA 5TPZD 1XU7A 4J2HA 1K9SA 2HNBA 5TXGA 4K8RB 5K03A 1EQUA 5F7OA 2WQ7A 4ESOA 4YX9A 1VLJA 2BMVA 3X3HA 4GOOD 3HHPA 3KQHA 1I2AA 3TF5A 4BBPA 2XEDA 4PQYA 1HFKA 4WNIA 2WA2A 1GU1A 3SVZA 5P21A 1CW2B 1P73A 2QMEA 5C8DA 1YV9A 5CDHA 5JJCA 4HDAA 2VSNA 2ZJYA 2D0IA 4ZVSA 3CMEB 1F3LA 2FR8C 4HS9A 1P7PA 3QFHA 3ISTA 1KXZA 4LNUB 4UMFA 3S7ZA 3RSSA 2AEFA 3SY8A 3WGTA 4EJ6A 3PLNA 3EODA 3ZK9A 2MU1A 4MV5A 5CYFA 4ND8B 1X7DA 5MGBA 2K6GA 1F5SA 1F8XA 1JA0A 1QZUA 3PL5A 4Z4HA 2IIBA 2CK3A 3I28A 1V47A 4KFTA 4PQFA 4YGXB 1YIAA 5BUCA 3NDIA 4IX1A 1E63A 2NXEA 4K8OA 3LQ6A 5DLEA 3HJTA 5FJJA 4CGYA 1ZOOA 2QD5A 4IKOA 5SZIA 5DCUA 1DPFA 1JEQA 1HLGA 5DT9A 1K7YA 3I8OA 4JT9A 4W8HA 3ZK8A 5HRUA 2ZT6A 4HIZA 4WFIA 5ALIA 2KW5A 1OIVA 3NT5A 1D2RA 4LJ7A 3OP4A 1T1IA 1QGAA 4P7KA 5EJAA 5LIPA 1NA5A 1II8A 3C15C 1HX7A 4CVNA 2R62A 3SZRA 1KRWA 4MDYA 1DKPA 5C3MA 4IXWA 2UUPA 4X05A 3NJ4A 3RTGA 2M2IA 3JQFC 3FSRA 5BR1A 2VJIA 5E6SB 1WCXA 4Z4SA 4FFRA 3CXCB 4DNTB 3BXPA 5IYRA 3KVRA 5C7LO 5IG2A 3PQ2A 1NVVQ 5AJZA 1VHQA 4XQGA 5AVKA 2ZRAA 1E2BA 2YWRA 1OU0A 5ECDA 4W5TA 4IVPA 4N18A 4BWFB 2BONA 3DGEC 4B75A 1FVFA 1I4DD 1RBZA 4A8JA 2I65A 5B36A 621PA 4DSNA 1TT7A 1SG6A 1SB8A 3FPAA 3M5PA 4OJYA 3QX3A 1IM8A 4N0EA 4B32A 3OZBA 2E4YA 4GKVA 3VUEA 2JJ2D 2VDOB 2BEWB 1XMSA 2IEBA 3E22B 3VYVA 2NSYA 2OD7A 3VR4A 2EWVA 3PJDA 3FYUB 5JJKA 1J70A 1LTKA 1XELA 3NM5A 3ZU6A 1YUMA 2AEMA 2G7ZA 4EB6A 1OSNA 2V96A 4F4JA 4D8TA 1A0OA 4XYBA 1T35A 1L5OA 2VP9A 1BMDA 4OHOA 3RVDA 3MT8A 2X8LA 3H84A 3WDSA 3U4QA 4MAAA 2M6KA 4CE6A 5C18A 2ECPA 3S81A 2ZSJA 3SXJA 5IN4A 5ADHA 1U3WA 2AJBA 1C3OB 3PFHA 1WCWA 1NQUA 3SU8A 4RJTA 1L5YA 3JYLA 4LJ4A 3QLJA 5DSZA 4NMMA 4CMIB 3EC7A 2QB5A 2J9GA 5I7VA 1KZ1A 1CXZA 1RAGA 4RKFA 3KBBA 4TPKA 4B6RA 4P9NA 1NASA 2WJVA 1XHLA 1XZGA 4MCJA 4R1NA 4WXHA 1M2OB 1KMQA 4Y6PA 1MO2A 1RKXA 3GZNA 1YUNA 4EPVA 5JC8A 4LBVA 2CXQA 1IZ9A 2JFGA 3BK1A 4I9NA 4O2AA 4Q12A 3OX4A 4IRXA 3ROQA 4HXEB 5CA1B 1ISIA 1VB3A 1KI4A 3HU5A 3CKYA 2J6IA 2FMUA 4X7DA 4HLQB 1OW3B 4FYYA 4K2AA 1KY5A 3CZQA 4R1TA 4V0RA 4ZT7A 5CDUA 1JKIA 2Y4OA 3OZXA 1HE5A 2HPAA 3NB0A 1ORIA 3ZS8A 3QVTA 3RIEA 4FVTA 2FW6A 4KIJA 1LFDB 3H2SA 4D8UA 4XVCA 4YP6A 2DUJA 2PEZA 3I2HA 4P54A 5EHIA 1CUHA 1TUBA 1ORRA 1WCIA 3VGJA 3PEYA 2Z5LA 2DWOA 4LYYA 3EEOA 3DTNA 3H9EO 5TR9A 3TRIA 3CX8A 4MGYR 4RBNA 4IDEA 5EWMA 4QAQA 2P2CA 5I9BA 1ZL0A 2I78A 2NUPA 5I51A 3L93A 5BOSA 2FSUA 1HK7A 3HYNA 3IV9A 3OLYA 2A1TR 4OK3A 1D7AA 4Y2SA 4D9FA 1HNNA 4Y2YA 5JWRA 4MS3B 2F3UA 5BV1A 3WJ1A 1Q0PA 1PHRA 1TM3E 2CLHB 3TW8B 3U2QA 1IZZA 3IMGA 4CCAA 3A4YA 1FLDA 1ECPA 2ZDGA 2DU8A 2PRKA 3JR7A 1N9ZA 4EJSA 4H3VA 1HTWA 3E5HA 4IDHA 2FR0A 4BIMA 2KWIA 1AKUA 2QUBA 3B1FA 4KP7A 4PLCA 1NW8A 3I42A 4XI9A 3IDZA 2VNIA 3ZGYA 6REQA 1JHAA 4ASUA 1OI2A 2XT0A 2WAYA 1M2NA 2X4GA 1HQDA 3EPHA 1P1RA 3Q72A 3ZIAA 1XZEA 2VDPB 3MRXA 5ALDA 4BTVA 1F17A 5HBRA 3DL0A 3G5MA 3HFRA 3JD2A 4MDHA 4TM7A 2TMDA 3R40A 3WRYA 4BMCA 4BXOA 2B1QA 1C4XA 2HF2A 3CX7A 4NCKA 2PCLA 4WT7A 3KXIA 3AF2A 5JSHA 4CKCB 4R8KA 4TV8A 1KP3A 5B53A 4ALMA 2V7BA 3AY6A 3U81A 2YZ2A 3DLAA 3W4KA 1IVYA 1QDEA 1I8DA 2RC5A 4U7DA 2OBTA 3AVTA 3SCZA 2FMTA 3MWJA 1N34B 3ZDCA 2F1LA 1E2EA 1PNRA 1EAYA 4M46A 1SN7A 1ZWLA 3Q1KA 1WDTA 3MMNA 2J46A 1KOFA 1OASA 4BV8A 5IK2D 2PD6A 4HK4A 2GN6A 1JSCA 1GT91 2X13A 3VMFA 1QFZA 3C8ZA 4EDFA 3GYGA 2IYQA 2KBEA 1E6MA 3E84A 5L53A 3E4CA 4R54A 1XMPA 3Q6QA 2RGBA 2XODA 4OQLA 5HF8A 2EZTA 4BYMA 4F72A 5AIBA 4WKPA 2JGAA 3E22A 5FTKA 5CCEA 3B3JA 3AF6A 1REQA 1RLOA 1QTIA 3KPVA 3PUKA 5LMUB 4OKIA 3AZQA 3BRCA 3CUUA 3E1GA 3NHUA 4UAVA 4EY5A 4DMFA 3FYSA 2X6QA 1SHKA 4K81B 3BNWA 2R65A 1XCGB 4AMUA 4I6GA 5AUOB 2HQBA 5KTMA 2VP5A 1C8LA 2A9VA 4TZ6A 3RYFA 1JR2A 4Z4WA 3H1EA 4PO8A 3T0IA 4K26A 2QOEA 2H0RA 1WG8A 2OXEA 1Z8FA 2HRBA 3VI4B 9MHTA 4OQYA 2O5RA 3STWA 4CG1A 1M2VA 1XZLA 1EX9A 5MN5A 3ZCSA 4JK3A 2UZIR 1RAEA 4ZMRA 2JANA 4TXNA 5ITSA 1DINA 3QPDA 3AF5A 1C9NA 1AXRA 1EK5A 4X7PA 1NW3A 2PGIA 5FNZA 1V6SA 3FTFA 1ZIYA 4BTLA 3AVWA 3DZKA 3D0OA 3KKQA 3NGMA 3HK2A 3E18A 3UF0A 4YMUA 1XCLA 5K8VA 3TX2A 1L5LA 2ZWPA 2F8LA 2BCEA 2ZAGA 3F6EX 2D2EA 2OGWA 2R4QA 3CHYA 3KM0A 5FWYA 4Z1OA 3CURA 1D4AA 1XZDA 2ORYA 1YQDA 3BX1A 3WWEA 3K72B 4MI1A 3QIVA 2C0QA 2H0AA 2JCBA 3GUZA 5IEJA 5I45A 3ZGNA 3ZH9B 2PKWA 5E95A 4RK5A 4EQ6A 5JAMA 4CIXA 1NF2A 2AUNA 1ORDA 2P2ZA 1NF8A 3FWNA 5AVVA 1JAIA 3MILA 1SRRA 2BGLA 5EZYB 1MX3A 2AOUB 5AI4A 5WRFA 4ZHQA 2IIVA 3NWBA 1ABBA 2ENUA 2CJYA 3BXXA 1NVBA 3G6WA 3EYAA 4OB8A 3K0CA 4MI6A 4X8OA 3WKBA 4L74A 4NBNA 4EKIA 3T9BA 2B1IA 4BC1A 1N0IA 3FDZB 4BJ6A 4DKJA 2XTNA 10MHA 2Y1LA 1VE3A 2YN0A 5EP3A 1IUPA 4RD1A 2F2TA 4TKOB 3FPBA 4TV9A 3WWYA 1RPAA 2J3LA 4B8WA 5HUHA 3D8NA 1RXVA 3AJDA 2HKIA 1RZ3A 1J6UA 4NBLA 4PGGA 1KI7A 1SKYE 5JPIA 2VQ6A 3HMQA 4EUNA 3KEWA 1L6RA 3MT0A 3ZLUA 3G1TA 4RGYA 1XEAA 2DMRA 3I3SR 3KT3A 4W1RA 3V3TA 2Q5CA 3HI4A 1DQRA 3PPIA 4LDPA 4UEOA 3SF8A 4B46A 5ANRB 2NTJA 3I2KA 4BN5A 2J0UB 4F1KA 4IPTA 1M6YA 4F8JA 4G8DA 4DDHA 4E12A 5LNK6 5IRCD 3L6CA 3EG9B 3BSWA 1KMNA 5IPFA 1XR3A 2FEMA 2XH8A 4DOMA 4YIHA 2DGDA 3GGGA 2H0QA 4GYWA 4NJOA 1SXJC 4RDIA 4YROA 1QDUA 2RHDA 4OPMA 1M2GA 4Z99A 3L0OA 4MEAA 4ZVPA 1R5BA 2G06A 3BH0A 3K9GA 2IYZA 4M1ZA 5K3SA 4COKA 5CD9A 3R8FA 3WQRA 1PWXA 2QK4A 4K0RA 2I6QA 4ZARA 3WGNA 4GWKA 3LP8A 3DL2A 4CG3A 3KDPA 4Q9HA 4MUNA 2HDNB 3WGJA 2J67A 2PFSA 2RAFA 3TRFA 2FZWA 2GK7A 3RC7A 4EUFA 3OJFA 1PJTA 2EFGA 2XDQB 1UBJS 3RYCB 1RQXA 2PJDA 2PVCA 1EXNA 2PZFA 1OYOA 3JWIA 4MQMA 2UVDA 4JJIA 2P9BA 5DIZA 2AFIB 3D3QA 4DZTA 1SXJE 4AF6A 1ISFA 4KR2A 1W34A 4MZXA 1HYGA 5AICA 1E9RA 4YDRA 4AVYA 2VRNA 4EFKA 4YT4A 2V3VA 4DIFA 2BLNA 4YRIA 4B8YA 4KLAA 1ZVKA 1I1HA 2HA4A 2F43B 2QZPA 5HPYB 1XDDA 1X1CA 4M86A 4MW0A 4DJFC 3UV6A 4MLDA 1E4OA 2B2NA 2DR0A 3RVJA 4PIMA 5JSFA 4YCDA 3K15A 1EFDN 1LX6A 3KEOA 1FJ2A 2J48A 3FGZA 1GZDA 2VDWB 4RMIA 4PN7A 4LRSB 4F60A 2AXQA 5JBQA 2J6HA 5BP7A 2PH5A 4XSVA 5GZ6A 5K7SA 1DTEA 4DHWA 1QVAA 4OLJA 3ILYA 1B6TA 1R9GA 3IQGX 2VWQA 5AW4A 4H7PA 2ZJOA 5KQSA 4Q9LA 2QAGB 3DOJA 4RORA 3JVUA 1X19A 4UREA 3U3OA 2J07A 1ISMA 1DO0A 1P17A 1NVUQ 1M34A 1U1CA 1WTAA 3JAKB 1KPIA 3M33A 1CY1A 2VHTA 4FFDA 5IARA 3QXGA 4P86A 4RCVA 3EDCA 5K1ZA 1IONA 4OI1A 2J5RA 4J7AA 4C0HA 4G89A 4XGRA 4JLSA 1KAGA 1Y4AE 1Q0TA 1UOPA 5HX7A 3U39A 1OTXA 2BHTA 5AHOA 1YFLA 1PO7A 2OZLA 1MC4A 1ODIA 4X06A 2PY6A 2WM8A 3G9XA 3LUJA 3JD0A 3ONEA 1BO6A 4HQOA 4DMHA 5KNDH 1L7EA 5GV8A 1ML4A 2DHDA 2BFNA 2GR9A 3HE3A 3WXBA 5DNYB 1REQB 3TDNA 3CRQA 5KSZA 4WJLA 3D7KA 3LAWA 4RK7A 5CEEA 3QVGB 3VAAA 4H7FA 1TE2A 2CDRA 4LJ8A 1H6BA 1YWGO 3DDOA 5IMBA 2AZTA 3IXMA 1WPRA 1DGQA 5KU1A 2BDUA 1YX2A 2MOKA 3FTQA 5KDOA 2E82A 1U8UA 5BVHA 4CR6A 1N2JA 5BNIA 4TXMA 3DWIA 4PBSA 4XKVA 1F0KA 1NVAA 3GQBB 2Q6OA 2DT5A 1FFHA 2JGDB 4MIOA 2PZBA 2DBYA 1CJBA 2BEVA 2NM0A 2YRXA 1HDXA 4MR8B 1CU1A 4UU1A 3ZX4A 3A7EA 5JMTA 4TV8F 5IW8A 3ZK7A 1V41E 2B98A 2XTMA 3WIVA 3M3HA 1LW6E 5DOVA 1BEUB 2PKYX 4ER0A 1VLMA 1ODTC 2MMGA 3STHA 1PGQA 3OX2A 4M8SA 1SELA 3BFJA 2OHXA 3EEBA 3PK0A 4G07A 2PUEA 3O9MA 2FEWB 2WYOA 2CJWA 1RC8A 1Q0RA 1YZTA 2H4ZA 4A15A 2V6IA 1I3CA 4GOXA 4FBLA 2QRNA 4X6UA 1PZXA 3I6ZA 3CEMA 1TUEA 5HBGA 2Q8NA 3AQ4A 4BZPA 2Y1FA 1EGMB 1CC1S 4XEHA 3IRVA 5FBHA 3L46A 4P26A 3JX9A 3RYFB 2FSVC 3I9OA 3IQWA 3R3SA 3U31A 1JILA 4ZO7A 5H3CA 4BMSA 4BLUA 2QX8A 1P9RA 1WHTA 1MQAA 1D0SA 4REQA 4EK9A 4GE0A 4MITA 3RAEC 1QU3A 1DKQA 2C92A 4N6NA 4RQBA 5TEVA 1ZR4A 1E7SA 4UUQA 2WJ3A 3MYYA 5NLLA 4EDHA 2F00A 5A0TA 1N05A 4KEAA 4MVJP 4J2TA 4Z0PA 1OZGA 5BYJA 3V8PA 4E7PA 5M04A 4BP9A 3SQLA 1ZN8A 2F7SA 3ZGLA 1CRWG 1RJGA 2O8FA 3E27A 3IAHA 3ROZA 1ZUHA 8ADHA 3O92A 2JLWA 3R1IA 4Z53A 2EOAA 3WJ7A 2E21A 3OOSA 3DWFA 2AG6A 2ZBEA 2JCSA 2RE8A 4KVFA 3P0RA 5AVWA 3TVTA 1PX2A 3RBAA 1XKQA 4HAOA 3RT9A 2OV4A 2P5UA 1IL0A 1GQYA 2HJWA 1V9CA 2TMKA 3CV3A 4JQZA 3C8HA 1WD5A 4TQ9A 3U56A 2XLCA 2D74A 3FROA 2J0UA 1VJCA 1O03A 3KLPX 3QVMA 4UEQA 3WJAA 4U6QA 3B82A 3MQFA 2A58A 2ORWA 4UNIA 1Q12A 2ZDHA 5JSQA 1Z0JA 4Z3DA 5HZHA 1SCNE 4QBKA 4BFUA 2L17A 5LLDA 3OTOB 1MVNA 2H2HA 2JAWA 4L0QA 2YNMC 5K5EA 1GSOA 3GRRA 2QRQA 1WOOA 4Q3KA 4X8LA 3OPQA 1RM4A 3U09A 1G9TA 2C5AA 4B2IA 1W0CA 2VPWA 3KALA 4LE1A 2OFXA 1M2OA 3HU3A 1FIUA 3A1VA 2QLBA 3D8RA 2PZGA 5IVPA 2Y0DA 4ZYVA 1OF1A 5G2OA 2Q0HA 4D9EA 3QPCA 2Z0MA 2EZ9A 3HCCA 5HMMA 3WAJA 2XWJI 3EMKA 4ARAA 1RXYA 2GS9A 4DWVA 3NTRA 3ILSA 4JX8A 5FUXA 1PJSA 4XR6A 1X7ZA 3N2YA 2O8DA 3ELBA 2G4CA 3ADBA 2CJFA 1XO1A 1M33A 2HADA 4TV9F 3MJ4A 4I5IA 4RHCA 1PUJA 1JAYA 2DECA 4AKTA 2HZBA 2Q7XA 3AP1A 4N5IX 1EGQA 2H7YA 3ORRA 1IXYA 5L95A 2YS6A 3QEJA 4DC9A 3J7AC 2VYCA 3IP5A 3FBGA 4GYKA 1G21E 4X1KB 2ATXA 1XLTC 1JFFB 5IJ9A 2IDKA 2VHZA 2YASA 4WBSA 1KF0A 3GEIA 4P3PA 2ODWA 4MGIR 3A27A 3IHLA 4YJ2A 1H9CA 4IEEA 1V5GA 5C52B 2DFPA 2VQSA 1GNPA 1U65A 3L43A 3S28A 1TPZA 3EVCA 3IT3A 3NHLA 5FHQA 4R81A 2ACVA 3CNBA 1O9HA 3RODA 1YJ9B 1H23A 1ULTA 4KIFA 4MS3A 2DP4E 2O7QA 3ZKWB 1MH9A 2WVJA 3F5QA 1E2DA 2XVXA 2FEAA 2I4LA 3OJCA 3QX9A 2FE1A 4NLLA 4MUXA 4RX1A 4IUBS 4TSKA 5BOSB 1WZ2A 1KDVA 4TLDA 2P6RA 1GGEA 1BROA 2ZB7A 1V39A 3P9ZA 1YA6A 3ZY3A 2VJOA 3RS5A 1X38A 2F90A 4YQZA 4L5JA 1VI5A 3VU9A 3RYIB 1A7KA 2I8AA 4J0QA 1EM8A 4BGIA 1OFUX 3PR1A 3RSCA 4DUGD 2I6TA 1P0PA 3FMOB 3PD0A 1PG5A 2WKWA 1JW9B 2QRKA 4HRYA 1AKWA 3OAAA 1X7WB 4MRRA 4QBFA 1XZFA 2B36A 3V2UA 4IOJA 2WV7A 3QWHA 4MV0A 3OTGA 1OLXB 2C9BA 1L5RA 3QPWA 4AU1A 4MVJH 1ZGAA 4RD3A 2XD9A 3H5NA 1RLTA 3H5AA 4H7IA 2VJJA 2ZYGA 3BCRA 3CTPA 2ESRA 5L3QA 1E5LA 4DY4A 1X1RA 3F67A 3AMVA 4KE8A 3FGPA 4G86A 1P91A 1NI3A 1WCV1 2OC9A 2Q50A 1VPLA 2DFKB 2MSWA 2Q49A 4FJ1A 4W1QA 5ALWA 1VBMA 2QN2A 3GNSA 3U3XA 4YRZA 1H22A 3LXUX 4TXHA 1NLUA 3V76A 2EL9A 4NQZA 3BPSA 3TM5A 2GLXA 5K0EA 1BWRA 1HMYA 4X61A 4R40A 5CH5A 5BPHA 1E7QA 4KDFA 4GX1A 2RKWA 1S1CA 3IT1A 5AOCA 1X80A 1MB4A 2BDTA 2FMXA 2QVXX 5DHQA 5JCOC 4QHSA 5DM70 1DFGA 4HH1A 1F2TA 4PHGA 5JOQA 1E8DA 3AI7A 1PEKE 4L5CA 5GTDA 4NDAA 4UC0A 4QUKA 5D85A 5KTOA 5LMNB 3OKPA 3L2OB 3FTEA 3K3PA 3ZYCA 1SBZA 4FILA 3QF4B 4NEQA 1Y48E 1CHNA 1KEKA 2V4MA 3O03A 3ITEA 1DKLA 3KZMA 4IJVA 2H8KA 1GGVA 4CV3A 4D96A 1RQ2A 4LPKA 4LXQA 5KX5F 2PWYA 1G4HA 2I4OA 2C1XA 4S1PA 1IOVA 4FFNA 4FDTA 1LBTA 1P7CA 2Q99A 1TLLA 1J2TA 4A5OA 4HVTA 2HA0A 3IURA 4ZOCA 3D3WA 1O4VA 4XSHA 5E9AA 2EHJA 3ZWDA 3LDHA 2ZUCA 2O2SA 3IH5A 2GBLA 5DN9A 5FUVA 1QYVA 3OJXA 2ATIA 1Q82D 1NQTA 1WPXA 2LNDA 2QW8A 3JZMA 2H1VA 4N5NA 3A1UA 4PPNA 1LDYA 3HADA 4KC0A 3V8EA 2WJ6A 3KKPA 5DIFA 3BIWA 2WABA 2XZPA 4XPIA 4LCEA 1T4MA 2JHAA 4IM7A 2Q8PA 1D8AA 1NZDA 4FE3A 1Y34E 3CG0A 4JNCA 4WXRA 1DOAA 2QLJA 1T5TA 2WINI 5EQJB 2O7VA 2Z6BD 2VRCD 5DDIP 1KJNA 3RCBA 3S7TA 2FE4A 2FUKA 4P12A 3T9CA 4C76A 3U17A 5KYYA 1ZW1A 4EJSC 3IPXA 3FG9A 5CGQB 3N28A 3HYLA 5AW1A 1J1ZA 1MB3A 1H2RS 4U2EA 3TE6A 4BS9A 2DJ5A 4YMVA 4X1IB 1Z7BA 4EX6A 1VB5A 1N6KA 4TUYF 1JU4A 4X00A 1RZRA 1YK1A 4A82A 4BMZA 3FBTA 4AJ4A 4Z8YA 2A1UA 2C9ZA 1GTJ1 1UF9A 2BTOA 3R7DA 4CIVA 1ZJ5A 2JPDA 4JBLA 3UJBA 4ZT3A 4Z6KA 1DBRA 2YZNA 2ZKLA 1ODJA 2DYKA 2ZAIA 2BRUA 1R4MA 1JZQA 1BRTA 1MAAA 1SY7A 2Z5VA 3PGJA 4HLUA 3DMNA 4BX3A 3G88A 3B38A 3IR5A 1N7HA 1DT3A 3Q38A 4C0SA 5ER9A 1VJ0A 1J33A 1TEXA 4ZOBA 4RTNA 3ZUPA 4LSZA 4W5WA 3CSDA 2W37A 1FFSA 3PFIA 3UCEA 4D4JA 1ZK0A 3C3MA 2C54A 4I9FA 4KG7A 1CNEA 3GRKA 1CUVA 2EV9A 3VDRA 4JN6B 1GOTA 5KYUB 1R3UA 2J9XB 1HURA 3PHBE 3RRYA 3MLAA 2EJVA 3GLUA 2O06A 1EFRD 4QDZA 2QTFA 1UM9B 1L4HA 4P08A 4DQDA 4PLGA 3RVNA 2J5XA 5J4YA 2DBVO 3OZSA 2ZRIA 4ICIA 2OBXA 5EXXA 2VC2B 1KQ3A 1NJSA 2RIPA 2VHWA 3WC4A 3IAM6 3Q0IA 2FG7C 2HF7A 1Z26A 3D6NB 2IBMA 2CLMB 2Q1UA 1Y7HA 3OU7A 1AQIA 1X15A 3CE9A 4GFDA 4QRIA 3S0JA 2QVZX 4EPTA 1V96A 1O6BA 3QKIA 4BE7B 4Z51A 1QGZA 2QVCA 2IQIA 4EHNA 2FPSA 4BO7A 2RCNA 1WDMA 4F12A 3ZHCA 1G21A 1OFTA 3W7BA 3E3OA 3B20A 2AG0A 4MKXA 4MQEA 4NAHA 3GGJA 3UAZA 5CYGA 2XUDA 4OB6A 3ELWA 2F6RA 1PS9A 5KYKA 3D1LA 1MMFB 4F93B 4TWRA 2AMJA 1NPTO 2QQEA 1YZQA 1E9CA 4NEHB 3LZDA 2L0XA 4QNRA 1PS8A 2MMCA 3F8TA 4NATA 2YJZA 2KLBA 4G26A 5JQWA 3UHAA 4YV2A 2EWMA 1T3HA 4WA8A 3QVXA 4P0TA 1G8PA 4XGIA 2MCFA 1W0JD 2NMVA 3ZZUA 3HUDA 2AX4A 3BSYA 2F4VB 1J06A 1DBQA 5DGXA 4E70A 4OJKA 1E2FA 1KEZA 3T52A 1U0HC 4DMGA 4RLFA 5TY0A 4RTJA 1IAVA 3F97A 4HYYA 2VUHB 3LY8A 5IZCA 4F6CA 3UATA 3VAZA 1T9ZA 2MSNA 3B2QA 5ER6A 2AG5A 3MINA 3LDAA 1KEWA 2YWFA 2WTNA