1KK2A

Structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdp-mg2+
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
405
structure length
396
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords eIF2gamma
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 97
structure length 396
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk2A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk2A01
3PQCA 2ZAOA 4XSHA 3RNLA 4X8HA 1XFAA 3QFTA 3UXMA 3A8TA 5LBIA 2OBMA 3GJ6A 2J3EA 3V4RA 3NKVA 4OI0A 4F91B 3B5JA 2OCYC 1UF9A 2Q0HA 1QFZA 2ZREA 3U4QB 1G41A 1M74A 1MO5A 3ND8A 1CBUA 1GUAA 1Q86D 1VIYA 5DE3A 5DHFA 3TW8B 3LVRE 1RVDA 2FGKA 5K8TA 1XJQA 1XZPA 5UKDA 2ERXA 3B6EA 3I1FA 1W7AA 2XTMA 3IPXA 4CDGA 5L3RA 2KB0A 5JCPA 2IYVA 1IN6A 2ZS9A 3QPWA 4JLMA 1E98A 1EGAA 4K46A 3FMIA 3AF4A 1E2MA 1QRAA 2G6BA 3VR5A 1SKYB 2AHOA 2Q21A 4TYWA 2C9OA 1OT3A 1IN5A 2ODBA 2JLWA 4LYJA 1KYIA 3CZPA 4YMUA 1XEXB 1NN3A 1U0LA 4DB2A 4Q1CA 3N2EA 2J9RA 4IW3B 2O8EB 3K0EA 5JJKA 3CF6R 3KFVA 1FX0B 4YAUA 3LW8A 4XH9B 2B21A 1YQTA 1LS1A 1ZW6A 2J0UB 2WJHA 1G7RA 1I4TD 4BLOA 3LQRA 3R8CA 3KTAB 2ZJOA 5H68A 4ESHA 1E62A 1RW4A 2R65A 5LD2B 4KV9A 2BEJA 2H16A 1ONBA 1XEWX 2XZPA 2VL7A 3NDPA 3QKSA 5DSZA 1E32A 4M0LA 4M4SA 2C03A 3CRQA 4NYIR 2PLRA 3HR7A 2F1IA 2CNWD 1KKLA 3A1VA 1GOTA 4IXNA 4B75A 2OK8A 2LCFA 4GPTA 4URUR 1KC8D 3BS4A 4IEEA 4ACAA 1WRBA 4IFEA 3GLHB 3CPHA 2GHIA 2ZJZA 1AZTA 621PA 5TMPA 4D82A 4JLBA 1X8LA 1F20A 1XZQA 4RKFA 1CR2A 5L8VA 3T35A 1Z3IX 4V0KA 5GADl 2FSGA 3CRW1 1IY1A 2VP6A 1QVFB 1IN8A 3PFIA 1XJCA 1G19A 2BM0A 3OEHD 2ZJAA 2GEUA 4P31A 4PANA 4TTPA 3SZRA 4CIDA 2O8DB 4BZPA 2C2HA 1G5TA 4A0RA 1QG2A 2QZ4A 3PIRA 2W2TA 3GLIA 2PZGA 3TUJC 1U0JA 4LYHA 2DB3A 5GJVC 2AXNA 4LUCA 4KI0A 1NN0A 1II8B 3AP3A 3EARA 1GO2A 2ZSFA 3B60A 1QHNA 1DDGA 2QQEA 5M04A 5KTYA 1EP2B 1N8RD 1ZD1A 4O2LA 3AUXA 4JL6A 3W2GA 1VQNB 2X2FA 3H86A 4D4KA 3K9NA 1UKZA 3FMOB 1RRCA 3UANA 1FRQA 2DWPA 1OF1A 1NN1A 4AF6A 1Q3HA 3QSYA 1GKIA 3DKVA 1F6BA 2FOLA 2FWRA 4LGMA 1U98A 1TU3A 3HPRA 2IS4A 1MO3A 2I4IA 3I3SR 2OM2A 4YXWD 2J7PA 2OAP1 4M8NE 3VKWA 1E4VA 1U94A 1NIJA 4EJSA 1VYTA 4DLUA 3OZUA 1GWNA 3CWQA 3AP2A 1G4AE 1BX1A 2QBYA 2GILA 1KI3A 4TMXA 1GL9B 5HXBA 1Q7YD 4XD7D 3TUIC 4C7OB 4JLVA 1W0JA 3CPJB 1QHGA 3LDAA 4LV6A 1X8JA 2B6HA 1VQKB 1SXJB 4JSTA 4QJ4A 2DFKB 1PV4A 2IHYA 4QJ3A 3SBDA 4LRWA 1WCV1 2ZEJA 2B8WA 4KFRA 2J59A 4WAUA 3MWJA 2O8CB 3OIUA 2XXAB 4ZDWA 1LV7A 3NHBA 2FPLA 1TLLA 2VH5R 5FUXA 1X86B 3LX8A 2NOAA 5FBWB 2DWOA 2ZYWX 3IIJA 4LDJA 5DH9A 1TU4A 3CNNA 3R7WB 1YVDA 3CXCB 4RD0A 1ZM7A 3MWYW 3GLFE 1E2EA 3UATA 1CF4A 1ZU4A 2XEXA 3C5CA 2RC5A 2N46A 2GCOA 3B1XA 4GMDA 4LPKA 4RSGA 3VHLB 1XMSA 4B3FX 1KI1A 5FL7D 1LVGA 1KO1A 2ZAMA 1DAHA 1XTSA 2ECKA 3BRWD 3L0SA 1XEFA 1TUIA 1F2TB 1VCOA 1W2GA 2GVDC 2Q9AA 4HZUB 2BJWA 3OFND 3QEOA 5CJPA 4O2RA 4YHBA 4A9AA 4DZZA 1K8AD 2R44A 3ZBTA 3CCVB 3AF0A 4P6VF 1JB1A 4PC1A 4WA7A 1U9IA 3FGNA 1NMYA 4JIMA 1E4YA 1OSNA 1J9ZA 4MYTA 1Q12A 1W0KD 421PA 1ZUIA 2W0MA 3EC1A 4ARZA 4NYMR 4XWAA 2VP5A 4GOKA 3LFUA 2Z6VA 4LJ5A 1W4RA 3NIBA 2D06A 4IVQA 5JRJA 4LX0A 4FMDF 1Z06A 5JEEA 2IX3A 4P4SB 4ZDJA 5JWOA 1E1RA 2FSIA 4PAOA 3U6KA 1PUJA 5A5GA 2QENA 2VZLA 1OE0A 2UKDA 3NEJA 3R7WA 2A5YB 3QIAA 1YJ5A 3QF7A 1QF9A 1OH5A 1E2PA 2P2LA 1ANKA 3TMKA 1FPMA 4QOSA 1MRSA 1YE8A 4C0LA 2Q3HA 4B74A 1E6CA 3J81k 1F2TA 1MR3F 3BH0A 3N70A 4FCTA 2JLYA 1BMFD 3ONWA 2WKPA 1I4LD 4Q5IA 4BFUA 5C46F 4DUGA 2EFHB 3THYB 4TT3D 2QORA 3DO6A 4IOLA 4B3BA 5IK2D 3VMFA 1JA0A 4B2IA 4G0NA 1S9HA 4TQAA 4M53A 4I4LA 1JEDA 3WNBA 3OESA 2A2ZA 4KSBA 1GL7A 3OEEA 1E2GA 4MYUA 3VX3A 4BRWA 2QMEA 3CIOA 4S2EA 2CE2X 1YITB 2ODWA 1KAGA 1TPZA 4FMCB 4ZDIA 1QVAA 3QFSA 3U7HB 2FE4A 2AXPA 3Q3JB 1Q57A 1BJKA 4Q7MB 4AI6A 1SKYE 3IQXA 3CLVA 3QE2A 2ZE6A 4K81B 3DDCA 1M7BA 2QM8A 1F2UB 3SNHA 2O8BA 3T61A 1Q82D 3D6TB 5EE9A 3IQWA 5IT5A 2VYQA 4CEHB 4Z54A 4XOIA 3VHXA 4BPBA 5K8UA 4NPHA 1E9EA 2FGJA 3IGFA 3RS2A 3SHWA 2Q9CA 4M9QA 3U2QA 3DMNA 1JR3A 3DMDA 3PENA 2OBLA 3AVQA 2V1XA 4R9UC 4WIAA 3B82A 1J70A 4CGZA 4C2TA 3AB3A 1NNEA 1H8HA 4JMPA 4Q4JA 4L15A 3VAAA 1A7JA 3CMEB 2KSQA 3MUFA 2HLDD 5LB4A 1Z0DA 4DSOA 1ZC3A 2WZQA 3DHWC 4RD4A 2J1LA 3WHKA 1E2LA 2FFHA 3RC3A 2GCNA 3KJGA 2ZR7A 1LTQA 4F7DA 3WRYC 4BE7B 1H8EA 3QG5A 1NLZA 1XD2A 2ZJ5A 3HDTA 2YHSA 4DLVA 4EQ6B 5BYJA 2BM1A 3GLHE 3U6BA 4LHYA 1D1NA 4Q19A 1NBMD 2ZRMA 3WRXC 2XZLA 4HAUA 2F1HA 4Y9RA 3AGPA 1XNJA 4B4DA 2GKSA 3C7KA 4HATA 3THXA 2QAJA 1VKJA 3G4SB 4KHZA 5JEDA 2BBSA 5H8WA 2QP3A 4Q7JB 2DFTA 2FPMA 2VRWA 3E1SA 4K8OA 5C4MA 1XCMA 2CVFA 2OCBA 2OFXA 4B73A 4LBZA 3EIHA 5B2ZA 1LS6A 2C04A 2AFIE 2J41A 2D3WA 2NTYC 4PAMA 4HAZA 3ECCA 2B92A 1R10A 2NIPA 1ODFA 4F93B 5LD2C 1VG1A 1UBFA 4B6FA 2G9NA 3UIEA 1NDHA 521PA 1IHUA 3Q7PA 2OFOA 3EAQA 4N1AA 1XPUA 1FQJA 2A3RA 3RHFA 3TBKA 2YWGA 3DM5A 2EYQA 3OAAA 3REFA 4TWZA 2GCPA 1RPZA 1P6XA 2F7SA 3QY0A 3RVBA 3CF0A 3O8DA 5JCZA 2DHRA 4CZ2A 5J4VA 3DVLA 4ZPXA 4OHYA 4BQSA 2FPKA 4IEIA 3X1WA 5F9HA 2XTZA 4C0KA 3U3KA 1Q21A 3U3OA 3EPLA 3OJXA 3HPQA 3CCSB 4M9ZA 1G3MA 3CMAB 5F9FA 1E9BA 2I1QA 1SXJE 2NO0A 4ZO4A 2VHQA 3KQLA 2EVWX 1AM4D 3ZZUA 2JATA 1ESMA 2JLVA 4YALA 5EP4A 4F4CA 4AF7A 3ADCA 2VNHA 1K5DA 3CC4B 2ONKA 2OXCA 3OE7A 3L43A 4IOMA 3DL0A 4PSVA 1W1WA 1ZCAA 4GNKA 4EAQA 4HSEA 2XNCA 1KK2A 1S3SA 3EA5A 1ZNXA 2DEUA 3TNFA 2VP9A 2P3SA 4J0QA 3W5IA 1J8MF 3K09C 4A0HA 2BGIA 2ZRCA 2MSDB 4Q4HB 1CTQA 4DCTA 1OYWA 4NHOA 3G0HA 4GFDA 4AKIA 1DADA 2R6DA 3E5HA 5KU1A 2HJVA 5AUNB 1XCPA 2A5GA 4ABYA 2W2XA 1CNFA 5KPDA 2AWOA 2ZRDA 4C0QC 1NKSA 1XTRA 2CE7A 4B2LA 1FNBA 1JNYA 2GBLA 3IIMA 4PQRA 4N3GA 1HA3A 2OAQ1 3ZLJA 2WV9A 4D4LA 1YZLA 2EFCB 4N3NA 2RGDA 3PEVA 3I61A 2D4HA 3LWNA 1KDPA 1CEEA 2GRJA 2FV8A 3AH8A 3CM0A 1NG9A 3KKPA 4OK3A 2KBFA 1WF3A 1EX6A 3NTUA 1SXJC 5CK4A 5DI3B 4LBYA 3MAAC 3A37A 4ZV4A 5TV2A 4Q1BA 3QKUA 4UJ5A 4DXAA 3KQKA 1U99A 2RB4A 3X1ZA 2PIAA 4DC9A 1S96A 4A36A 2A9KA 1PLKA 3F8TA 4JLOA 1VQOB 4DEYA 5L3SA 4TL7A 4MYCA 4MKFA 3EASA 4F4IA 6Q21A 1Z83A 4DT1A 3LQQA 4D0NA 2ZU6A 4RZXA 5BN4A 3R8FA 3CCLB 3Q9LA 3R20A 5EUMA 1ZUHA 3I5YA 4P4UA 1N6HA 1C1YA 1T0JB 3NC0C 2A5DA 3PCRB 1CLUA 4G3XA 1T6NA 4JT2A 3SHFA 5JI2E 1AA9A 3BH7A 5CYPA 2WPDA 1LFDB 2GWHA 1LNZA 3CPWB 3WYAA 1L7VC 2QGNA 1UJ2A 4LK2A 4BFXA 4DLWA 1TUEA 4GOJA 3PUWA 4CRWB 4TMTA 2QMOA 2O5VA 4D6PA 5B57C 2JDID 2IS1A 1HE1C 4DDUA 1SVMA 2EFEB 4OJQA 1L2TA 2XNSA 1Z8FA 3BB4A 4PZLA 5JWRA 4URVR 1A82A 2JLZA 3GMTA 4TMZA 1NMZA 2BIFA 3AVXA 3BE4A 3CRMA 3I56B 3EA0A 2QSYA 4NCIA 4UXJA 1OKKA 1M1YE 3EWAA 3NDBB 4RJLA 3WP0A 1NKTA 2JJ8A 3KKOA 4Q9KA 4C30A 4A82A 2OZEA 3HP1A 3RS7A 4W5JA 4KFTA 1G8HA 2AD5A 2B7CA 4AY2A 3P20A 1IM2A 1CRQA 1R0ZA 4DIDA 4DWJA 3ZZTA 2WHXA 2DFLA 1RJ9A 3I55B 2D2EA 2VHJA 2JIZD 1TQ4A 4PHFA 5TDHA 3B1VA 1M90D 3WNDA 1E2HA 4O0MA 2VSFA 5DNYB 2RCNA 2ZXUA 2V54A 4RFSA 1WBDA 2PZFA 2YNMA 4JYBA 1EESA 1T5IA 4Y9UA 4PC7A 1KNXA 1ZNYA 4TLEA 3O8CA 1YJWB 2D7DA 1CRPA 1E1QD 4AKHA 2C98A 1TTTA 2H7VA 2GJ9A 2P5TB 2V7QD 1FNMA 5H59A 2BHRA 1E79A 2WICA 3CONA 3KXIA 3LRPA 4LJYA 4PZZA 5TVKA 1IN7A 2IBMA 4WXRA 4JSYA 4FIDA 2GJSA 3GEIA 1EX7A 1HH4A 1BIFA 3EW9A 2AL7A 4NONA 1WA5A 2P65A 5E3HA 2GXUA 2X3UA 1G21E 5KDDA 4ESVA 3K1JA 1WE2A 1NIPA 4LC0A 1KO8A 5SZJA 5L3QB 4B3GA 2V1UA 3NEYA 4UNRA 1YHQB 2RHMA 3GLGA 4FK8A 5DLQC 4C0JA 1FNDA 3TSWA 3MMPA 2IW3A 4GZMA 3EZ7A 1COWA 3CCJB 1PUIA 1O3YA 1Y63A 1Z07A 1PJRA 2CJWB 1V43A 4DLXA 3GFOA 4QL3A 1ZYUA 1OB5A 4BEJA 2BBOA 5JHHB 2CNDA 2OLKA 5FTKA 3TSOA 1XD8A 3KJHA 1R5BA 3RC8A 2HCJB 1MO6A 5KOYA 4WXPA 1L8QA 2ZANA 4TL6A 2ZITA 1SVKA 1E2NA 1VHTA 4E09A 1WMSA 4DSUA 5J4KA 1IAQA 4Q1FA 1UKEA 3A36A 3EIEA 1GNPA 2ZS8A 1IJFA 2BC9A 4D26A 3WXMA 1OH7A 2QTHA 2Z4SA 3FWYA 1QHYA 3Q5EA 2Y8EA 2GQFA 4RCZA 5FOUA 5FUWA 1VQLB 821PA 3K0CC 4NCJA 5BN5A 1NRJB 1UM8A 1NSFA 2FH5B 4KVGA 3PJRA 1RRGA 1T3SA 4JBWA 1R5OA 5FTMA 3K0SA 4HB0A 3GEHA 3THOA 3LBIA 3JZAA 4PXAA 4A6XA 3BFVA 2QT1A 2GJ8A 2XAUA 3AVPA 4QHSA 3V76A 1RE0A 3LLMA 5AJWA 4MGZR 3I72A 4AKGA 5CB8A 4DBLC 5EJEA 2V6JA 2OILA 4ACBA 5ANRB 3A1TA 4U00A 4RY2A 2VHUA 4Q4AB 2WM9B 3C14C 4PHTA 4QXAA 4UXIA 3U3MA 1W36D 4XSGA 3CB4A 4WOPA 5C1BA 1KGDA 3WMEA 2R6FA 3ZGXA 3AVUA 1W4BA 2G1JA 4NYMQ 4QBHA 3X1XA 3LA6A 1ZP6A 4OKSA 3RSLA 2QA5A 1P5ZB 5HE8A 1E2QA 1T3HA 2JAQA 4QBIA 2JEOA 1Z6XA 5FBLB 4YMVA 1QBKC 1F60A 2VTKA 4WZ6A 4HLQB 4HLUA 4TL8A 1DEKA 3IBGA 5GV8A 2XSZA 3ZIAD 4JLKA 4LI0A 4CEIA 4PSKA 3IO3A 2VO1A 2GESA 3EG5A 2GZAA 2FNAA 3K0AA 2FEMA 2ZR9A 2E87A 3IEVA 4LJ8A 3FJOA 1X8KA 2CXXA 2ZYUX 1N0VC 2JJ2D 4HLDA 5AUPB 4EJSC 1N6KA 1GDDA 3M4YA 4BFYA 3SQXA 1G3QA 1NLYA 2RMKA 4P32A 4BGDA 1VCNA 2YC2C 2G77B 1D2NA 5J4LA 5ELXA 2IF2A 3CNOA 1AQUA 4M22A 2ZROA 1IB0A 3QFRA 1T91A 1GAJA 4M1OA 2CL7X 2WJVA 2OESA 1E96A 2ZUBA 1P62B 1XTJA 3L8ZA 3HWSA 1XPOA 4B76A 4EIWA 1U8AA 1YR8A 2ZU0C 5BW8A 3R9IA 3AF3A 3CZQA 3I92A 3SC3A 3KFXA 4QNMA 3EZFA 4FN5A 4LJ4A 5FOVA 2V55B 3U7GA 3L0IB 3L82B 1W87A 2ZE5A 1P2SA 2VSXA 4G5SA 1R6BX 4AKEA 1UBGA 4XVQA 2GTPA 5J47A 3ZS9A 1W5TA 2F9MA 3CW2A 2HXYA 2W83A 2WMOB 3IHWA 1LF0A 4DDWA 1P9NA 2VLIA 3QKSB 4MRVA 4A8JA 2MSEB 4OI1A 1KY3A 4FWTA 4JVNA 2WSMA 4UAJA 3ZD6A 4HLCA 4NMMA 1P73A 3CO5A 2ZRJA 5LDDC 2V3CC 4EPWA 4JBXA 3PXGA 1IJEA 2ODEA 3RLFA 5K8IA 2A5FA 4MRPA 4II7A 4TLAA 4LBVA 4E5UA 1P61B 5P21A 1TF2A 1T3LA 3PEYA 2X19A 1VECA 3QXXA 4ERNA 1VCIA 3SJCA 2EFDB 3QVUA 4BECA 1TADA 2QGZA 3KQHA 4F92B 5KPJA 2R8RA 1K8RA 4JYCA 4Y7CA 4M1MA 3QBTA 4Z1MD 2ZJ8A 1UMKA 3B1ZA 2ZRPA 2Z0MA 3ZH9B 1KIMA 1Q1BA 2EW1A 2XJ9A 5D3MA 1BS1A 1MT0A 5B64A 2ZSAA 3SFVA 4HI0E 3GLIB 1G20E 1XXHA 5KHOC 2YOFA 2BDTA 4IKEA 4JLAA 3WHLA 1Z2AA 1ZU5A 4HUTA 1JQJC 4AYWA 4G1BA 4A92A 2QAGA 2ZI7A 2ZYVX 3UK6A 4LJ9A 2FDCA 2FJUA 1QFYA 3KUCA 1Z6AA 2GEDA 2CBZA 5FUYA 3LD9A 3AKEA 1Z0JA 3CF2A 3NVAA 4YDHB 2CLDX 3CCUB 3VU9A 5HCNA 1OV4A 3T15A 3R9WA 4KBGA 4OI2A 1MH1A 1R4AA 3MFYA 4ASUA 3ASZA 1EFRD 1KZ7B 5EP2A 1ZM9A 4NDZA 4RD2A 3H84A 3GJXC 1SQ5A 4EJSB 1VTKA 5E4FA 2W6JD 4WQMA 2QBYB 4TMVA 3ADBA 2IC5A 3VKHA 2OT3B 1DARA 3C16C 3P32A 1CULC 2IS2A 1GTVA 2QPOA 1KQSB 4IDPA 1OH6A 2VQSA 2ZTSA 4AIIA 1VDZA 3A6PC 2FX3A 5AJVB 1KMHB 2PLFA 1DO0A 1G17A 1F48A 2ERYA 2RGGA 3P1JA 4FW9A 3TH5A 1TAGA 1D9XA 3FMPB 4Q01A 1Z2CA 1WP9A 4UKDA 2GF0A 3CUEF 1SXJD 3VR4A 3FFAA 2DR3A 4UNPA 2F43A 2OV2A 4KFUA 3WBKA 2ATXA 3C15C 5EE0A 2BF4A 3RS5A 4OHWA 3QENA 3ETLA 4PC3A 3SE0A 1XBTA 3MJRA 1KY2A 1M8PA 2GCOB 4OK6A 4AG6A 3VO1A 4QFMA 4IRUB 1W35A 1M7HA 1I2MA 1JQLB 3LH5A 3U44A 1G291 1E69A 3W5JA 2V4ZA 4PFSA 2EFGA 1BKDR 1W5SA 2WSSD 3GJ8A 1XD9A 1DG3A 1OXSC 4E22A 4DDVA 4LCBA 5FPKA 1YZKA 1JAIA 2RGAA 4QKQA 1Z5ZA 4PPFA 3T1VA 1P7CA 4PR0A 1Z6TA 1A8PA 4D4MA 1KMHA 1XX6A 1DG1G 2ZR0A 1P2TA 4ARZB 2SHKA 3JQQA 1CJKC 3KDSE 3T34A 1QHXA 4FMCF 1E0KA 1G4UR 1CJTC 1U81A 4ZI3A 2GEVA 1TNDA 4V02A 3ZYCA 3OEED 1G3IA 2R9VA 3DPUA 2CL6X 3GCGA 3LY5A 4G01B 1TF7A 2GXAA 3Q85A 1XPRA 5EXPA 4JJKA 2IT1A 1FTSA 3L0PA 2QEQA 2YYZA 1CR1A 5FPYA 1IOZA 4KCGA 4BLTA 1XJ0A 3TR0A 4A4DA 2CNWA 2ZI6A 5L3VA 3FVQA 2ZUCA 2E1RA 3AQ4A 2IWHA 4PAQA 1XDBA 4WZAE 2FA9A 2FFBA 1A1VA 1KSHA 2G1KA 4IDQA 4TYYA 5JJIA 1OFHA 4LSGA 4XWKA 3K70B 2ZJYA 1NVVQ 1EFHA 1Z47A 2EQBA 2FU5C 3OEHA 4YAOA 4PQFA 5BN3A 3RYTC 4UXHA 4CYMA 1N5LA 1W2HA 3CX6A 1NVUQ 1S1MA 1G6HA 4OBEA 1EFCA 1IY2A 4YLGA 3D3QA 2VHTA 1G64A 1V5WA 4D4JA 1DAMA 3CH5A 3N5CA 4HAVA 2AKAB 2GDJA 2ZRIA 4JLJA 4MQBA 2YWHA 2YOHA 4XTRA 1N6PA 1W44A 1EWQA 2D74A 2VNJA 1Q1EA 1KMQA 1VQ7B 3L8YA 1W48A 1JR6A 2O8BB 2W00A 5DO9A 2RAPA 2VP2A 3WMGA 4DLZA 1JJVA 4DCUA 3CR8A 2CL0X 1RYFA 3VNUA 1KNQA 1T0HB 5IRCD 1N0WA 1G7TA 2XNDA 1SVLA 4YXWA 1QGZA 1GM5A 4QM6A 1ZINA 1YJ9B 1NN5A 3CRRA 3HU1A 4Q4JB 3W2IA 2BWJA 3CCQB 1VG9B 3KKQA 4NBSA 4V0MA 4JJZA 4O3MA 4XD7A 4LC1A 4ZDKA 2TMKA 1KK3A 3FHTA 4UJ3A 1VQ4B 2HT6A 4EDHA 3VX4A 5FUVA 4R7ZA 1W36C 3AF2A 1P60A 1Q1QA 1G9XA 5FI0B 4GBMA 3NBXX 2BMEA 2C9YA 4OHZA 3C8UA 1FRNA 4NL4H 2OHFA 1VQ5B 3SEAA 3TQFA 1XD2B 5FTJA 3I32A 4XIGS 2ZRAA 5HKKD 1B23P 3LV8A 2YWEA 1SVOA 1G7CA 5JS7A 3HJNA 4CEJA 4BUJA 1ZM3A 1QH0A 1ZD9A 5FL7A 1DS6A 3THXB 1Q44A 2DY1A 3QF4A 1FP7A 2QA4B 1SHKA 3AVYA 1F5NA 2D62A 3OFNA 1UKYA 1GNRA 1NP6A 1JJ2B 3LBHA 4WBSA 4XVRA 3VR6A 3GLIE 4MGIR 3LVBA 3OZWA 4HYYA 2VBCA 2W2VA 3QXHA 4GDFA 1JALA 1HYQA 3IEUA 2R6HA 2O8FA 3Q7QA 2C99A 2IK8A 1X1RA 1W0KA 5GVSA 4TSFD 4TN1A 1HQCA 1J8YF 1NVXQ 1XTKA 1K6MA 3BFKA 1EP1B 1GFIA 4LJ7A 1WQ1R 1NI3A 4JVMA 5AJYA 2HMAA 1K5GA 4IOKA 3EZ9A 2G0NA 4Q1DA 3LBNA 2IUTA 2QRNA 3THWA 4B71A 1QHIA 3BC1A 1I2DA 3DZ8A 4BFTA 2OK7A 2YC4C 2E9SA 3NBYC 3OZXA 5FTLA 2XTNA 4Q4LA 2HV8A 2QEXB 1KI6A 4Q48A 4BRUA 4G5QA 2NPFA 4L8GA 1BMFA 3BOSA 2H8KA 1ZD8A 4JLNA 2H18A 4TT3A 1EK0A 5KDOA 3PR1A 4LWZA 1CJUC 5IK2A 1G3UA 1G8YA 2X2EA 1M1KD 4JS0A 4OL0A 4PZYA 1AS2A 4G5GA 4CVNA 3FMFA 1W46A 3IIKA 3THWB 2WMNB 1VG0B 4RZUA 3LW7A 3TVTA 1BYIA 5CIWA 2YOGA 1G6OA 5F2EA 3FPKA 1OPXA 5FPHA 4B48A 2KE5A 1PLLA 4NCHA 4UQOA 4BZXA 2QUZA 3QQ5A 4QNRA 2ZSBA 1R5NA 3CCMB 3ZD7A 3NG1A 3G71B 4POAA 1G18A 2HF9A 1VQ6B 2PT5A 3CC7B 2WOJA 4OQLA 5E7IA 2C77A 2GETA 1QVGB 2PX3A 3PV0A 5CIQA 2GF9A 3KB2A 1J90A 1G5PA 1MV5A 2XJ4A 4HUQA 3CPEA 1XRJA 1P3JA 2NGRA 3S1AB 4KAXA 1JI0A 1II9A 4LZZA 5KSOA 1LW7A 1U8ZA 1PLJA 2Z5FA 2QI9C 1L4YA 4H1VA 2GXQA 3NBZC 3IKJA 3NWJA 1E0AA 4KJZA 4BFSA 2XB4A 5C18A 1SULA 1GIAA 3V00A 2AFHE 4TLCA 4Q7LA 4AK9A 3U5ZB 3QOFA 4Q21A 3A1WA 5DYIA 1QZXA 2LKDA 3GJ5A 2VIIA 1DVRA 1E2IA 2J46A 1Z22A 3D8BA 1RZ3A 1GG2A 5L3SB 3A4LA 3AVWA 1E9AA 4LOAA 2WIBA 3ZVNA 5EE1A 2CK3D 2ZI5A 2Z4RA 4DT1B 3QBVA 3SU8A 3CR7A 3DOEA 1KJWA 4TZ6A 2N1BA 2QTZA 3RANA 2RGNA 5EZ6B 5BYKA 1G8FA 4MA4A 3ASYA 2CCJA 1YI2B 2JLRA 4KBFA 2Q3FA 4URWR 1C4OA 1NBMA 3S1AA 5CB6A 1YZUA 2FF7A 1HTWA 2NZ8A 4KLNA 3M1IA 1A2KC 2GA8A 5FA6A 4Q9LA 4OHVA 3PEWA 4YAFA 1DAKA 1U9IC 2ZRBA 2JLQA 3WNCA 1H65A 1UBEA 5AJXA 3TVDA 1R8QA 3AKDA 2PJRA 2WWHA 4GP6A 3K8YA 1YZNA 4Q7KA 1EP3B 5J4HA 3BD9A 1YR6A 4BPRA 2VHCA 3CNLA 1KJZA 3RRNA 4C4PA 2ZRKA 2IYSA 4BLQA 3TKLA 1NVVR 4IDNA 2UVQA 5DHAA 1LY1A 4Q9JA 4JL5A 2BKEA 1US8A 1OGJA 4P4TA 2GZHA 2DBYA 2IXGA 4Q02A 2IYYA 1VMAA 2X1VA 4F4JA 2XZOA 2DERA 1XE1A 1CKEA 4A2PA 2VSOA 4BLPA 1UPTA 4R2HA 3SN6A 3EX7C 1BX0A 5JWHA 1YRBA 1RJ9B 1A2BA 1JR3E 2QRZA 3VNVA 2AK2A 1SHZA 3BH6A 2J0QA 3FKQA 3FDIA 4LY6A 1QHSA 4RD3A 5AWFC 1OXTA 4RFSB 4CT4B 1M2OB 5D3QA 2IS6A 3K70C 2RGEA 2NQ2C 2ODNA 1GL6A 3KXKA 1S0UA 2R6GA 4DDTA 1ETUA 4F7WA 2BJVA 2P67A 3RRMA 1GILA 2QE7A 1DDIA 1JJ7A 4CW7A 4LHWA 2HT1A 5DN6D 1K9MD 1XMJA 2OEPA 4ZI2A 4G5OA 4BFWA 2H17A 4KXFB 3LLUA 1R0XA 4QGGA 4C2UA 3SJZA 1R2QA 1OFTA 1HY3A 4YC7A 3W3ZB 1J99A 5BXQC 5KSZA 1AQYA 4FINA 2ZSDA 4ILEA 3I4LA 2UZ3A 5FFMA 4US2R 5EP1A 2DETA 4RFVA 2ORWA 5HZHA 2ZE7A 3UG6A 2ANBA 5JBQA 3B7GA 1YIJB 3GLGB 4D25A 2GAOA 2ZI9A 1NG1A 4EFNA 2QL6A 2ZVQX 3TLXA 1QHHA 3ZS8A 2Q9BA 1NJID 3L2OB 1E2FA 3AKCA 5AR1A 2DCUA 4Q1EA 2CCGA 3FHOA 1OHHD 4HAYA 4MKIA 4Z8XA 4MKGA 1AK2A 3LVQE 2XNJA 2FSHA 2XOKD 3BK7A 1TEXA 4GMXA 2OFWA 4Y0VA 1KDRA 3AKYA 5EE5B 4D81A 2GJAA 3AM1A 4PPGA 4ZIRA 1GSIA 4RCYA 4C43A 1TMKA 1KK1A 2PT7A 3BB3A 4Q9IA 4I1UA 4DRZA 5FBRB 1KDOA 4I99A 3ZQJA 1KJYA 4PO9A 3W9YA 1EFUA 4BLRA 4TQ9A 4DKXA 4OQMA 4M9XA 4JL8A 3QXCA 4QGAA 2RGBA 1SKQA 4QG7A 2ZIAA 3RABA 1TQ2A 3A1SA 4N0EA 4MUAA 1OB2A 4WZBE 2QTLA 1CJVC 1D8TA 2ATVA 3LXRA 3JVUA 3NH6A 4RVCA 2J7KA 3K0FA 5HE9A 5C2JB 2FMXA 1P4SA 5BWMA 1E94E 2CRVA 2JJ1D 2OLJA 2ZE8A 2PEYA 1NL3A 3HR8A 5CM8B 3UG7A 2WJIA 2BPOA 3PEUA 4PQYA 4OK5A 4D2IA 4US1R 2ZI3A 1QGAA 1KHTA 1R0YA 3FKSD 1ZM4A 4V0OA 1MABA 1DOAA 4QHTA 4HE5A 2GZDA 3K53A 4NE2A 2W6ID 1YZQA 3FHCB 1AKYA 1XWIA 4Q00A 1B2RA 3K9GA 4URXR 2B5OA 5AUQA 2FEOA 2OXRA 2PL3A 1QX4A 4MRNA 5H5JA 3GQBA 3PUXA 3IDQA 4HDOB 1FNNA 2WJYA 5CLQA 2CLSA 4B47A 4M1TA 3UWOA 4E03A 2P6RA 4GL2A 1FP6A 3T1OA 2JDIA 4GRAA 4DLSA 1KI9A 1X1SA 2H5EA 3TJZA 1Q0UA 3GJ0A 1GRNA 2CHVA 4OHXA 3U3RA 3IO5A 3E70C 1F3OA 5J5CA 3TRFA 4EPRA 4P33A 1E63A 4YMWA 4CEIB 3UMSA 3KJEA 4MH0R 1FNCA 2PJZA 2REBA 4TZ0A 3K0AB 5CYOA 3NC1C 3KUDA 2OSBA 4Q1AA 3QXSA 1NJFA 1XMVA 4NH0A 2NO6A 3OF5A 1MO4A 1T8UA 2QNRA 3I8XA 4IDOA 4L4UA 4CT5A 4D0GA 2XGJA 3E20A 3ADKA 3KL4A 4B6EA 2JIZA 1OLOA 4TLDA 4W9MC 2OG2A 5FH9A 5FR1A 1AIPA 3QPVA 1T8TA 1KZGB 5FPSA 3AGQA 1G7SA 1XU4A 1VHLA 1N5IA 4YMSA 5TR9A 1HT2E 2ZUDA 3Q5DA 1E1QA 4WVFA 2F55A 2F3RA 2V7QA 5JSZA 4M1YA 3M0EA 5EXTA 5K8LA 2IEYA 1VQPB 2WWFA 2RC6A 1UFQA 5JRZA 1Y3AA 3GJ7A 2MMGA 5FI1B 2PX0A 2QDXA 1RRFA 1X3SA 1ZRHA 3MCAA 2UZIR 1N6IA 1HV8A 1HQYE 2WOOA 8OHMA 4E07A 2EYUA 3IHLA 4PHHA 4URYR 3RWOA 3GFPA 4W5HA 4A8JB 1XB2A 3G6EB 2OO7A 2GBLC 2ZM5A 2Z83A 1IN4A 3B2EA 4BASA 1NVWQ 1OXVA 2VF7A 4KSCA 1EFTA 2R62A 3CRVA 4MKHA 1KO4A 2WJJA 4PC6A 2ORVA 5SZHB 1EXMA 4Q18A 2DFNA 2ZRLA 4TQUS 4S35A 1S4QA 1NF3A 3MWKA 2Q3MA 4L9SA 4GZLA 1DTSA 1DE0A 1N25A 5GVRA 2X77A 2PMKA 2GVZC 1P9WA 2AR7A 1UKVY 5AN9A 1ESNA 1VCMA 3PG5A 1UEIA 4LHXA 1GAWA 4OQNA 1VPLA 3SBEA 2NPIA 3T1QA 3GLFA 3C4JA 4H1UA 1UADA 3B85A 1JECA 4ON9A 4QBFA 5D3MB 4PGOA 1VQMB 3V9PA 1CS4C 1XXHB 3E1YE 3RSOA 1FDRA 1B0UA 3VFDA 3ZJYA 2ZETA 2VNIA 2I3BA 3VR3A 2WWIA 1M7GA 4M1SA 4Z51A 3F0TA 3HYTA 2QAGB 2AK3A 5F98A 1E9DA 1HE8B 4TL9A 2BMDA 3TIFA 3W5VA 2AD1A 2O0JA 3FYHA 4TMKA 4A2QA 2QTVB 5B30A 1Z0AA 2HXSA 1H42A 1CR0A 3DKPA 4UNQA 2AKYA 1P2VA 1VYUA 4G5RA 1G16A 1QUEA 3VU9B 3KXLA 4KVAA 4PPQA 1IXSB 3G82C 3WY9A 2JLUA 2VYFA 4HB2A 2AX4A 3L0OA 3EPKA 1CR4A 2BBWA 5CM9C 2HCBA 4AYXA 1BQEA 3X1DA 1J2JA 4H9GA 1Z0KA 2OE2A 1HEIA 2Z43A 1M6NA 4G1UC 4I1SA 2C95A 3OZVA 5KSWB 4PTLA 4DIEA 2J7PD 4ZCIA 4TYPA 3GLGE 3CWZA 3A4MA 3BWDD 1E3MA 3WP1B 1OW3B 3ZVLA 2BSAA 4ZCLA 1D6JA 1A4RA 2QROA 2Q6TA 2F1RA 3MRSA 4TYNA 3U61B 1JEEA 1D2EA 3UMRA 3ZIAA 1SGWA 4C0AC 3UMFA 3QEJA 2ZRNA 1TQ6A 1W0JD 1O87A 3GP8A 5AK0A 5EXXA 3U4QA 4EH1A 3CD6B 4DHEA 1GJRA 1UDWA 2WKQA 1KKMA 5IHPA 2EIXA 2FZLA 2F43B 4MITA 1Z0IA 4Q66C 1NSTA 1GVNB 1Z0FA 3QNUA 1DAGA 2JJ2A 2V8OA 2WAXA 3WMFA 1KTVA 1W34A 5FOXA 3JQRA 4IJMA 2F1JA 5G40A 2RGXA 5KYKA 4HB3A 1N3BA 3U44B 4BLSA 1N5JA 3C5HA 3TGPA 3AVVA 4QM7A 4I81A 1ZIOA 3CC2B 4EPXA 2CCKA 2VF8A 5CLLA 2ZVPX 1OIXA 2IF0A 4IDHA 2KI5A 1BO6A 1G3RA 1CJMA 2VEDA 1R8SA 2JA1A 3FPAA 2WBLC 3ZC3A 4HDQB 4HEJA 4C3ZA 3I5XA 1HT1E 1XEXA 1CNEA 4LYFA 2QMUA 3GPLA 3BJIC 4MRSA 2BV3A 5FOSA 3JZMA 3TUZC 2K5UA 3MWLA 1QG0A 4AC9A 1BH2A 4IXMA 3NHAA 2O8EA 1FMLA 1FX0A 3CKLA 5EQTA 3OIVA 3WYFA 4RD6A 3BB1A 3TK1A 1VIAA 1XCGB 3WBJA 1OFUX 1VQ9B 3MLEA 1E99A 2HDNB 1OFIA 2J0UA 3AEZA 5G3YA 2ONJA 2IA5A 3V4FA 3VR2A 1GRQA 3AVTA 2RHDA 3KTAA 4LHVA 2QU8A 2C8VA 2IYRA 5FOWA 1YZGA 4DQKA 2FN4A 1XTIA 2YKGA 2P5SA 1E1RD 3RS0A 1NMXA 1ZVQA 1UBCA 3BBPA 3QG1A 3ICQB 3P26A 3LO5A 3O47A 1ZMXA 5CDFA 1GITA 3CX8A 4P0TA 4D80A 4HE6A 2G3YA 3KB1A 5THXA 4QHYA 4ZKEA 2W58A 3AVOA 1KSJA 2GJKA 4KYUA 2IYWA 3GJ3A 3O8BA 3W34A 4Y0AA 3QVVA 1KO5A 4X8MA 3AF1A 1E9CA 3TAHA 4Z1MA 3GLHA 1JXMA 4A15A 4DUGD 4AD8A 5EE3A 4RD1A 4BFVA 4MYHA 2CLCX 1SVIA 2F6RA 3W3AA 4RZ3A 1Q1ZA 5JECA 3KZ1E 3K9HA 4KYIB 1FQKA 2XNDD 4EFLA 1GZSA 4W5WA 3K70D 4Q47A 2I1VB 5IDVA 1KOFA 1WXQA 4JVLA 2NO7A 5CJ2A 1Q3TA 2BEKA 4X8OA 1K73D 3LNCA 1ELOA 2O8DA 2P0EA 5KO2A 3T5GA 4KFSA 2J5XA 4DEXA 4LJAA 2GXSA 4W7SA 5J40A 2XB2A 1GAQA 2IYXA 2OUKA 3B9PA 2HJGA 5EXSA 3DOFA 3SJBA 5KNDA 1R0WA 1XF9A 2OBNA 2YV5A 2L0XA 4U5XA 1II8A 5GJWC 4A2WA 1AN0A 2B8TA 3NBFA 4GT1A 1Z6YA 2VP4A 4V0LA 1Q22A 1AGPA 1FFHA 2FFQA 4DSNA 1EFRA 2D2FA 3QPUA 2X8AA 5FOTA 3EPJA 1ZNWA 3K09A 1N0UA 4FXPA 1BOFA 3DZDA 4UNSA 4YQFA 5H70A 2A78A 1GKYA 4NP6A 3ES9A 2N42A 4MRRA 1LB1B 2W6JA 3BAFA 3KX2A 4HLUC 4L9WA 1GVHA 1JR3D 3JQPA 4LV8B 2BBTA 5FPTA 2MMCA 2ZJ2A 4NYJQ 5TB5A 1E9RA 3AP1A 3VR1A 4IVRA 2OTLB 1H8HD 3U7EB 2H1LA 4QGFA 5TARA 3TAUA 2A7QA 1W4AA 1YR9A 1U8YA 2V9PA 2IXEA 4C7OA 5HTKA 4ASUD 4U9UA 1OIWA 4WW0A 1E64A 1EG7A 1ZBDA 2GK6A 1SXJA 4XJXA 5GJCA 1AMOA 4ZKDA 2QP4A 3GJ4A 2CMKA 3HU3A 1H8ED 2O8CA 3B8HA 1N6NA 1X6VA 2KWIA 3E2IA 2ZRHA 2XXAA 1IY0A 3FTQA 3X2SA 4PO8A 4CEJB 3QJYA 2C96A 3RWMB 1G1MA 5HZKA 5AJZA 1M34E 3RS3A 3ZDQA 5IF9A 3QF4B 4QJ5A 2BKUA 2WSSA 2RGCA 5JLJA 4DB4A 4RZ2A 4V0NA 5G41A 1HURA 1XXHE 1GNQA 4B43A 4HZUA 1CP2A 4I1OA 2F9LA 3T06B 1FUUA 1FMJA 1I4DD 2O8FB 3FB4A 3PUZA 1MOZA 3CX7A 4US0R 1E2DA 2IEZA 3GFTA 4A8JC 2HYDA 2IUUA 1KO7A 3QKRB 4LJ6A 1KI4A 2YJTD 1AKEA 3RRYA 1E9FA 2NO9A 4I1VA 2ANCA 4KITB 2WWGA 2R2AA 1TX4B 4KO8A 1TF5A 2ZRFA 1TVCA 2AN9A 1A5TA 2QPTA 4DCNA 1KSFX 4NTZA 1KK0A 4FCVA 3D7MA 2DWQA 1TEVA 4P4SA 2REOA 3JVVA 3QE0A 1KI6B 3OAAD 1QFJA 4HAXA 2GAAA 4PO1A 4QRHA 4OI4A 4BZQA 3WYGA 5KUTA 2R6CA 3U7FB 2GPJA 221PA 3T12A 1IQPA 2PCJA 5AUOB 5DIFA 5A4JA 3KQUA 4JLPA 1JA1A 1OXXK 4KLZA 3O8RA 2ZRGA 2YWFA 4JZKA 3P27A 2QT0A 1E0JA 1GKUB 2REXB 4V03A 3SR0A 3ZBUA 3THYA 4B2PA 5HPYB 1XP8A 2B7BA 3BORA 3RS4A 4PSAA 2J0SA 1QDEA 2PBRA 3QKRA 4GSYA 1UEJA 1IONA 3EPHA 2QAGC 1QGYA 1YKSA 3W5HA 1N6RA 1NJGA 4M9SA 1ZUNB 1FUKA 1J7KA 3PUYA 3W5UA 3B1WA 2PH1A 3SYNA 1G8PA 3OHMA 2YVUA 2QG6A 4QBGB 3OE7D 4JBYA 4Z8YA 3BGWA 2IYTA 3TR5A 3TQCA 3U60B 4M1KA 3QFCA 4HB4A 2QMHA 4EPTA 2ZS7A 4FCWA 4RKEA 3ZVMA 4FMDB 3CBQA 2CEAA 1S3GA 5CDFE 1DAEA 1S9DA 4B33A 1RRPA 3CRZA 4B34A 1DO2A 4B35A 3EZ2A 3SFZA 4HUQB 3AV0B 4TYQA 2IYZA 2CHGA 2G83A 1F2UA 3AUYA 1G8GA 2PZEA 5SZKB 3ZVRA 3B13B 3ZZ0A 3Q8XB 1JB9A 1QUFA 3BIFA 2HEIA 1AS0A 4CEHA 4TTRA 1Z6GA 3P4XA 2ZQ5A 4MDEA 2LWIA 3SYKA 5TXGA 4XVUA 2A5JA 2QQ0A 5A0FA 5KSPA 2GNOA 3BXZA 1P75A 1YU9A 3ICEA 4PHGA 2DYKA 5JZVA 4AWXA 3DEFA 5J4YA 2H92A 1YR7A 2G0TA 2D7CA 3IPYA 3QUSA 3Q72A 3W6NA 4LYAA 3UKDA 3CH4B 5G53C 4DVGA 1GR1A 3I73A 2BGJA 2WTUA 3MGCA 4KODA 4B3XA 1N5KA 4R98A 5HKKA 2F3TA 2MSCB 3W8NA 5H1YA 1CU1A 3K0CA 4NCNA 1T9HA 4XTCS 3W90A 4A1FA 1W49A 121PA 3ADDA 3OIWA 5JMTA 4EQ6A 4LPSA 4IVPA 1OXUA 2EWWA 4JLDA 1KI7A 3VQTA 1UDXA 3BFXA 1DPFA 4MUBA 3HYRA 1FTNA 2GK7A 3SOPA 2QSZA 3B78A 3TSZA 5E7MA 1FZQA 2WPDD 4GP7A 4JT4A 2ZJBA 2HLDA 4M1WA 5HR5A 1QG4A 5KSYA 2A30A 4HDCA 2WVJA 5DGXA 1HUQA 1KI8A 4YONB 2CHQA 4TSFA 3T5DA 3W2EA 1S2MA 4B32A 4B3CA 5GJBA 4P3YA 2QE7D 1G5RA 1US8B 4MGYR 4ZGQB 5CITA 1ZJ6A 1SVWA 3MSXA 4PX9A 1JXOA 5JJLA 2EU8A 1AJEA 3FFBA 2BVNA 2RH5A 1OKKD 4A6PA 1Z28A 5JI3E 3SI7A 4C9BA 3R9XA 1NLFA 5KNCA 1FW6A 3IILA 3OJWA 5EMNA 1DAIA 4JVSB 4BWYA 4ZCMA 2ORIA 4B44A 3DM9B 2PEZA 3EXAA 3M6AA 1RFLA 2ZYTX 3NXSA 2BN4A 4TMWA 4V0ME 5E7JA 1GP2A 1NY6A 3QKTA 3EIQA 3SDZA 5KNBA 1L4UA 3LO8A 2QN6A 4M21A 4O25A 1WB9A 4NZYA 2LKCA 2EWVA 4X8LA 5SZIA 1AS3A 3EWSA 1VQ8B 4LBWA 3HU2A 4EKDA 1N6OA 2IYQA 2QP9X 4GOXA 1KD1D 1C9KA 3KKMA 1E79D 3I8SA 1DELA 4DLTA 1ZNZA 1RC8A 1QVRA 2IUSA 4JKYA 2FG5A 4NYJR 3H0KA 2IXFA 5FTNA 2BCGY 4YMTA 1JBKA 3PUVA 2WIAA 1U0HC 1QHHB 1KRHA 4TLBA 1S1CA 4DCSA 2ASEA 1WDTA 4DSTA 2O52A 2NMVA 3W6OA 4Q4HA 1KDTA 3F3YA 1KI2A 5JFGA 1COWD 5EP3A 3PITA 4HZIA 1AZSC 1MRNA 4D0LB 2HYIC 3ND9A 4Q9HA 1E2KA 4ZIRB 1JPNA 3LXXA 3X1YA 3A1UA 3TW4A 2W0SA 4NKRA 3RAPR 4QC2A 1W4CA 4FD2A 1RKBA 1DAFA 1YJNB 4CF7A 2CDNA 1TQDA 2OCPA 2KBEA 3OIYA 4FWIB 2P6NA 5FBVB 2V6IA 2JGNA 1IXZA 4Q03A 2QY9A 4N0DA 2NG1A 4NCKA 3H4MA 2IYUA 4ITRC 5DI3A 3K0FB 3BERA 3U3JA 4C0HA 1N6LA 2VA8A 1YHNA 4DJTA 4U7DA 1E9SA 1OGIA 3G5UA 1ZM2A 1XTQA 1MKYA 3KKNA 2CK3A 4DLYA 1Z29A 4EFMA 3MHPA 1OH8A 3ZQ6A 1H85A 2BOVA 2G88A 2WAYA 3MD0A 4NU0A 3QXJA 3REGA 4C0BA 3NH9A 1D9ZA 4NYIQ 3W2HA 1MABB 4G1VA 2PCLA 1SM4A 1YZTA 4EPVA 4R71A 3FE2A 4YDSA 2BMWA 2HUPA 3B1YA 5LB2A 3RDPA 2ZPTX 2VNKA 1FOEB 2VPPA 3I62A 4JKIA 4MGKR 2NZJA 4OQFA 2HF8A 3W6PA 1Z63A 2JASA 2QTFA 3W2FA 1OYYA 3H2YA 4OQXA 5DI9A 4QGHA 3KQNA 2J45A 2OCAA 3D31A 4B3DA 1R7RA 3FOZA 4FI3C 4DCVA 3VO2A 4ZGNB 5LPNA 5KDLA 1D5CA 3CCRB 1EWRA 4XWOA 2C78A 2ZI4A 3VTKA 4MDFA 1RIFA 3GD7A 1U2RA 3MJHA 5HCIA 3SQWA 2XSZD 1SZPA 5E95A 4HAWA 2JCSA 1P9RA 1T4GA 2O0KA 3C41J 3T1TA 2VP0A 1W2BB 4IHQA 2OTJB 2IHBA 3VKGA 1FL9A 2J87A 2XX3A 1I7PA 4BFZA 1TL7C 1YRAA 1XEWY 1ZAKA 1U90A 1S8FA 3A4NA 3CCEB 3P4YA 2IWRA 5G3ZA 5JS8A 1ZC4A 4KU4A 3EC2A 4OJKA 4LV5B 1GRRA 5FL3A 1Q81D 1PVOA 2PMDA 1PZNA 5BQ5A 1CXZA 2DPXA 5JSZB 4C0SA 4IOJA 4LHZA 2JLXA 5DN6A 3A58B 4TTQA 4U02A 1D2MA 1VG8A 1DBSA 2AWNA 2FZ4A 3KJIA 2O0HA 2BMFA 4DLRA 2KJQA 3SJAA 5B58C 1N2CE 2ZSEA 5FBQB 5C4GB 1KSGA 4AYTA 1WBBA 1LF5A 2WWYA 5F3WB 4M2LA 1NBME 4K1XA 5DISB 4DQLA 4AURA 1OJLA 2QM7A 2IL1A 3PVSA 4PPNA 5L3QA 2H57A 1T5LA 2C9CA 4GI7A 3IUYA 1Z08A 5CK5A 1OIVA 1OHHA 5EUQB 4A0GA 1Q20A 2XOKA 5DYGA 3OW2B 1XMIA 1P2UA 3H1TA 2CJWA 2BCJQ 4EPYA 1BYUA 1VYVA 3LAWA 3GEEA 3LX5A 1UAAA 4BEBA 3K9LA 5GV7A 2IYLD 2CVHA 3MG9A 4L5BA 4OYHA 4URZR 3TE6A 2FFAA 1RYHA 1II0A 1CQXA 1W47A 2WJGA 3B9QA 1EWYA 2NO1A 3GLFB 721PA 3N2IA 4YAWA 2WWWA 1JAHA 4A0FA 3RRZA 4AG5A 3F5FA 5FR2A 2C5LA 3UPUA 1CIPA 4EUNA 2J0VA 2RGNC 2R6AA 4PC2A 2P6UA 2JLSA 1P72A 5JHGB 2JJ1A 4F38A 2FSFA 2WKRA 1S72B 4IFBA 3IBYA 4FMBB 4L16A 1ZCBA 3SS8A 3FKSA 1NY5A 2YINC 1ZIPA 1IBRA 1KAOA 1JPJA 2W6IA 2XITA 5EZ5A 3UWKA 2BMJA 1E2JA 1W36B 1IXRC 2RKOA 1E0SA 2QPAA 3SYLA 2WWXA 5TY0A 1AGRA 3EZ6A 3QI2A 4Q4AA 1SVSA 4R2IA 4UNNA 3W8RA 2YZ2A
chains in the Genus database with same CATH superfamily
3PQCA 2ZAOA 4PVDA 4C4AA 1KJQA 1KEEA 5HS4A 5L46A 1LUAA 3UXMA 5BWNA 3AFOA 4EFDA 3H18A 4L5AA 4E30A 2J3EA 4JXZA 2JD0A 1DUVG 3HYSA 2G5TA 4X97A 2WVAA 3L4EA 4QTZA 3UV6A 4GUDA 1UD6A 3U9LA 3GEBA 2OCYC 1NXOA 2Q0HA 2AF3C 4WZAA 4NIMA 4Q16A 3VKVA 4W5OA 3QNWA 3JQBC 1M74A 3LQ4A 1P1JA 5SV2A 3UQZA 2IW1A 5E1MA 3T3GA 1P4GA 1EAMA 3F4BA 2OM6A 2Q5OA 2J8ZA 3TW8B 3OM0A 2DHQA 4GRIA 2Z5LA 4G9GA 3LOQA 2XTMA 3C3BA 3QWBA 2GK4A 3QQPA 3NTLA 4WD3A 3DFFA 1IN6A 2ONYA 2ZS9A 2CDBA 3GBPA 5E2IA 5IMBA 3HN6A 5KOJB 4MRMB 4I8DA 3F96A 4EMUA 4MIYA 2L2QA 2G6BA 1SKYB 2AHOA 3TLZA 4GWGA 2YMPA 3B5EA 3HCOA 3KS9A 3LZ6A 2JLWA 3WNQA 1ZGHA 4LYJA 1PK9A 4XWTA 3CZPA 4G5XA 4E1BA 1YAHA 4MV4A 1LBSA 1NN3A 1BCRA 3LJKA 2Y1KA 1OX4A 1YQXA 2ZT6A 3FRHA 3ONFA 2OYRA 3GRAA 2M1XA 4JWKA 4CL2A 2J9RA 2VYCA 1F7VA 1LCIA 2NXNA 4UBIA 3AHEA 1NU6A 3W1VA 2O8EB 3UKJA 4H18A 1FX0B 4YAUA 2X9LA 3UCFA 2BGMA 1RXCA 2V0GA 2SECE 2W42A 5K0GA 1ZW6A 2YXEA 2YHUA 1J9GA 1G7RA 3RJMA 5M5BA 2Q0XA 3FNRA 1BHSA 3GEGA 3R8CA 3WK8A 3MYRA 3LNNA 1UKAA 3T52A 5KJ6A 1LI7A 3DAPA 4XJVA 5H68A 3PKJA 4BO4A 2ZM6B 1XEWX 3NDPA 3U3DA 2QR3A 4FEAA 1J97A 1OWMA 4M0LA 2FUKA 3OCZA 3F3KA 4I8XA 2C03A 1ISSA 1QIFA 2PRJA 5I8WA 2PLRA 3HR7A 2IFTA 1RPAA 3C3CA 3HZZA 3A2LA 1ITZA 1LH0A 4WKGA 5BV7A 5AVXA 1KKLA 3A1VA 1GOTA 1XA4A 3ABZA 4B75A 1MG0A 2JD1A 4GPTA 4URUR 5TGZA 3BY1A 1KC8D 1K98A 2NSYA 2Z5GA 4CM5A 4LG1A 5JSKA 3DDSA 4EUHA 1DTWA 2GHIA 621PA 4KLCA 2DX7A 4DIEA 4JLBA 5CG1A 1F20A 3Q5GA 3U9SA 1ABBA 3EMDA 2LCIA 3KWMA 5LSAA 2FSGA 1IY1A 2J07A 1YNSA 3EF3A 3C6XA 4MINA 4P3OA 1XJCA 2BM0A 4CIDA 4PANA 3GMDA 4OF4A 4UULA 4I36A 5JMOA 1IOWA 1GUFA 3LSYA 1SZDA 1Y42X 2C2HA 3WLFA 3M49A 1QG2A 1C4XA 4XX0A 2W2TA 2DUUA 4G1MB 2CEKA 1HE4A 1OA0A 4PO3X 1N78A 2XPCA 1YI8A 1EAYA 3OZTA 2BELA 3CRNA 5GJVC 4ZGBA 2XCTB 4C4YA 4JJIA 2YL2A 5CFLA 3A04A 2ZSFA 2Q4RA 1QHNA 4IJ6A 4I5FA 3SE7A 5KTYA 5M04A 1YMVA 4NE7A 1ZD1A 1PHPA 2V6GA 3AUXA 3HBMA 1H0RA 3HLTA 2UUPA 4L0CA 3ZDFA 2X2FA 3C7CB 3O8LA 3K9NA 5B6PA 1AO0A 3OZFA 4TKUA 5FWDA 2DWPA 4BV2A 1OF1A 1NN1A 4R9SA 2ECPA 4MV9A 4EVIA 4YLYA 2FPRA 1GKIA 3OCJA 3GFBA 4PYLA 4BMXA 5BSUA 2FWRA 3QVMA 2BW0A 2JA2A 3FNBA 4YRDA 1WMEA 3JQAA 2HMYB 4CHTA 4GR4A 4DLUA 1P4HA 3IP5A 4IIDA 3P4UA 4FUTA 1MC5A 1BX1A 1I36A 3GXBA 3WYDA 2GILA 2I6XA 1E1YA 4LNAA 1W5EA 1W0JA 2WHQA 3GPBA 1X8JA 2AFIA 3WK4A 4U7TB 4KE7A 1YB7A 2DFKB 3G0DA 3GAZA 3VVMA 1FMTA 2UZ1A 4JX9A 4ER7A 2ZEJA 1JFVA 3BJRA 3DBRB 3L0CA 3EVDA 1LV7A 1TLLA 2AXEA 2NU6B 1WDLA 2WT4A 4EB8A 1X86B 5A6VA 1Z3CA 1E6EA 2DWOA 4Y18A 4JCCA 5LQKA 2W43A 1ADFA 4LDJA 1TU4A 5DH9A 3PWTA 2FMTA 1E5QA 1I01A 3R7WB 1ZM7A 2BEWA 3CH7A 2C4MA 1E2EA 3MWYW 3UATA 2ZXFA 2N46A 5JSQA 1JFFA 4B3FX 1HK7A 2FUG6 4K87A 4RPIA 5T64A 1CFZA 1LVGA 1JI3A 3ZDEA 2CLIB 1XEFA 4HRXA 2HU7A 2WILA 2O7SA 2ZCUA 5AJTA 4BAGA 4F11A 5BOSB 1M2VA 3OFND 5AVRA 5CJPA 5CFZA 1USUA 2NXWA 3HKEA 5FNVF 4DZZA 1ZL0A 1T15A 1V5IA 2E4AA 1DQPA 2R44A 1QOPB 4P6VF 4MQEB 4PRZA 5DTIA 4F60A 2UYCA 4LAFA 1U9IA 1GXSA 2MU1A 2I2WA 2PMFA 2QUIA 1XLWA 2X13A 3PGKA 1E4YA 1OSNA 4L6IA 1VLVA 3V4LA 1RP1A 4GP9A 1Z8NA 4JQZA 2BMVA 2EEZA 5E9QA 5AVYA 3H8VA 3D9QX 3T94A 3A6HA 6ABPA 3HA3A 1MC8A 2AFHA 2QN7A 3AIOA 4OQQA 1TA0A 3H7AA 3NT5A 4LX0A 4RHCA 4AJKA 5JEEA 2GD1O 4MLDA 4O6VA 3ZUPA 4ZDJA 2XF8A 4IWNA 2DJ5A 5JWOA 3AUJB 1D2GA 4MJ3A 1XF1A 1SO8A 2FSIA 3U6KA 1PUJA 2IKSA 3E9EA 2QENA 3N0TA 3NEJA 5JZSA 1UD5A 3L9XA 2A5YB 3DLBA 3QF7A 3IODA 5DGHA 1P7VA 1XDZA 5JAQA 4D96A 1T5SA 3TMKA 4L85A 4BAUA 3N87A 1I6LA 1PJLA 2W2KB 2DQ4A 1MLDA 2PYIA 4FCTA 2G9RA 2XCQA 3D3WA 3ONWA 3PE3A 3PHHA 5A4KA 3TVYA 5C46F 3QUBA 1M2FA 2VFAA 4DUGA 4CIXA 2QORA 4B3BA 5IK2D 1DC8A 1LBIA 1ADJA 2IU6A 3JYNA 2Q2OA 4TQAA 3SC6A 2VHYA 5A6SA 2O23A 1JEDA 3WNBA 2HMWA 3OEEA 5HZAA 3L0BA 3UJ7A 2H07A 4NJEB 2GUGA 3P19A 3IIIA 1SIUA 2BTQA 3D4NA 3NAGA 1U2SA 3S70A 3ONDA 1ZK0A 2CE2X 1YITB 2W4MA 1ZXLA 1K7CA 1CK4A 1K1EA 3HC7A 1ZI8A 3GVCA 3TQIA 3ACDA 5CFNA 5FKJA 3LGXA 2FE4A 3WKDA 3GIWA 4ARCA 3GVLA 3ASVA 4R54A 3TR6A 4P22A 3IQXA 3KZXA 3IELA 1JKJA 1V4NA 3QE2A 4U7PB 1TYCA 1HVXA 3H5IA 1BN6A 4L3VA 1M7BA 1NOJA 1IBKB 5K0BA 3ASPA 1S02A 3IMEA 3H1GA 1AGYA 1GQSA 3QYPA 2V96A 1Q82D 3SNHA 3T61A 2O8BA 1R0CA 1Z5GA 3K6SA 3R6TA 4Z54A 5FEUA 5SICE 3MJSA 1E9EA 3RIYA 1ZCJA 3IGFA 3RS2A 4BE4A 2Q9CA 3P0JA 3KT3A 5AMXA 5KNDH 5KMGA 3DMDA 2AB0A 2PDAA 3AVQA 4NJOA 2OKCA 4CGZA 3ABSB 1Y82A 3AB3A 1Y6RA 1GN9A 1A98A 2P2CA 1P9LA 4AJEA 4CKYA 4AY4A 1DFGA 3CMEB 2PBLA 3IAS6 5ICMA 3MD9A 1HT3A 1B6GA 1PKXA 2CWDA 1BG6A 2LVBA 1E4EA 2HLDD 4MQFA 2XTJA 2YXLA 1Z0DA 4UD2A 1XHLA 1ZC3A 3INYA 4Y1RB 3ZLVA 4AP5A 3BCDA 5LN1A 1E2LA 3DHVA 3UBTA 3KJGA 3IR5A 4CQLB 2ZR7A 3ON5A 5T4HA 3GT0A 2PBZA 4JT9A 3WRYC 4EKGA 3BSYA 4ZAVA 1Y48E 5CNMA 3HXQA 4OAOA 4NBUA 5AIBA 1KH3A 4D9FA 3GLHE 3U6BA 5KX5A 1MGPA 1BFDA 4FHEA 5L51A 1VLLA 3C1AA 4Y9RA 3QP9A 5AJUA 3Q9SA 5AKZA 2VBTA 1X2BA 5EQJB 3G5LA 3TLAA 4AKTA 2EKDA 3THXA 4Y2XA 2QAJA 3JQEA 4KHZA 2FN7A 4W9NA 3RKRA 5JEDA 4KGVA 1U4OA 2CWWA 1MX9A 3R5SA 3RARA 1NVKA 5JROA 1XCMA 3HDQA 2OCBA 3G2JA 1LZKA 5K4AA 3QEMB 4WGFA 2HZ7A 1H6CA 1AXEA 5B2ZA 2VCHA 2J9ZB 2UYQA 1VYHA 4LWPA 4EY6A 1JLMA 2NTYC 1SBTA 3LTEA 4AXXA 4ZAGA 1MOPA 4HAZA 1VFNA 1R10A 3BA1A 5J2UA 1ST2A 3KQYA 4JP8A 3DJFA 3AHIA 3SHQA 3UIEA 4S3MA 3L05A 1IHUA 1XPUA 2YW9A 4ATNA 3M2TA 3GFVA 1FQJA 2NV6A 3ONVA 4ZOLA 3WLHA 1X14A 4U7HA 5AKYA 4YMLA 4RHEA 1RHKA 3SK0A 5T7BA 4B3HA 1NE2A 3TDKA 3ZDBA 2EKBA 3DM5A 1EUCB 2EYQA 4DNOA 2ZKIA 2H3EA 1W6RA 4NEQA 1J00A 2I54A 4Y2SA 3QY0A 3SQNA 1GCIA 3L02A 5FP0A 4CZ2A 4PYKA 3E3LA 4CPDA 3C1OA 1BU8A 1T10A 3UFXA 5NULA 3ZD8A 3OM8A 4MP3A 5ECYA 4BQSA 5CFOA 3MBKA 4ODIA 5F9HA 2AIRA 5IYPA 4FONA 4C87A 4C0KA 1V11A 3ZXXA 2ECFA 1RXVA 3U3OA 4E2ZA 4FNMA 1U3GA 2IYEA 3CJQA 2H63A 1BCSB 2O2HA 4CCYB 1KEZA 4Z4IA 5JMPA 1Q0ZA 5F9FA 2BM9A 4JCOA 4X1YB 1SXJE 4REQB 4DLYA 2O59A 1IM5A 3LPLA 3PF8A 3S7TA 3I53A 4K9KA 3ZZUA 3QBJA 3JALB 4JX8A 4IRXA 2JLVA 3ADCA 3THWA 1XTZA 4G37A 2Y0CA 4KQKA 3DL0A 1VGRA 3NANA 4KQFA 4R9RA 3AY0A 1EJ0A 3QVTA 4XKVA 1XZGA 2RIRA 3L1UA 1N8KA 3NWOA 4FDAA 4EAQA 5JQGF 2JGDA 3L6RA 3TTTA 2P4EA 4AJ1A 3TNFA 2M6LA 2VP9A 3KJNA 4NJMB 4BLUA 4QOIA 1J8MF 4A0HA 1O5IA 2MSDB 4J0DA 2P27A 4K40A 2WU3A 1DADA 1XCLA 2V4UA 3E5HA 5FO0A 3WI7A 5AUNB 1XCPA 1H0SA 5JFOA 4REOA 1OLXB 2W2XA 3N0VA 3P45A 5J63A 2MINB 3F1LA 4EBBA 5E6SA 5BRAA 1NOIA 3S81A 3EJ6A 4WCFA 1XTRA 1RJWA 2B9VA 1PL6A 3PNVA 1EUYA 1DJMA 3OZ7A 1HA3A 4GH5A 2WV9A 1HR0B 3DP7A 1H5UA 4LK3A 2GN6A 1J23A 4X6LA 2D4HA 3LWNA 3V1LA 1IHMA 3DOIA 1QPZA 1CEEA 1F0KA 2FV8A 4BX2A 4CKEB 1F9EA 3F78A 1T5HX 4G85A 4MW0A 5K3AA 1Q17A 1QB7A 3Q9UA 3EH1A 3V55A 3LDGA 1SXHA 3Q7EA 1MIOB 1VZ2A 3FETA 3FUTA 5C1PA 4PLTA 5DI3B 3UUWA 1VE7A 1CQJB 5BVHB 2Q6VA 4ZV4A 3KWJA 1NV8A 3KNZA 1QIEA 3A4VA 3PQ3A 5CNIA 1U99A 5ESXA 4KX5A 3I9V1 4QYSA 2EX0A 3OLCX 3UMMA 1XC7A 3AFMA 4QYIB 4OQEA 3F8TA 2XBLA 1JF8A 4PHFA 5C7LO 5I7RA 5L3SA 4DA4A 4TL7A 2VQDA 1KZ1A 4IH1A 1L1RA 3LQ2A 2FLVA 4NF2A 5FLKA 4G5HA 3JQ7B 3HBJA 4ZU1X 3LQQA 4IKPA 4K3UA 4EMBA 2H00A 2W5UA 4RZXA 1A4IA 2XDQB 5EYPA 3RAJA 3SEQA 3V4OA 1E1MA 5FDFA 1MA3A 5EUMA 5EWJA 3C3WA 4P4UA 4LJKA 1FRZA 2RAUA 3FWHA 4UMDA 2ZIFA 5DM70 2A5DA 1IZ0A 1SK9A 4G3XA 4BRSA 5TGTA 5A9TA 5TS2A 3CLSD 5CFQA 5IUNC 5JJ5A 3B6KA 1CIJA 3N70A 4FFOA 1YACA 4JT2A 4FKMA 4GYJA 1QGUA 1X7DA 3QE4A 3PHBE 5HF6A 1YOVB 2J3DA 2GWHA 4FHZA 4NOKA 3CPWB 1L7VC 2QGNA 4CL8A 1UJ2A 1KE2A 2R8PA 4JQSA 1YBMA 3F8SA 1TUEA 2P9GA 4GOJA 2DG2A 2CGEA 3BD6A 4IYJA 5JOQA 1AD2A 4AZTA 2O5VA 2GZSA 3PDIA 5AKEA 1F3LA 1HE1C 4FS3A 3C1TA 2EFEB 4RPGA 4UTXA 4K9QA 5JWRA 3OETA 2QXYA 4RFLA 1GQYA 1A82A 4URVR 1JMVA 3CCFA 3ZW7A 5EKDA 2HX1A 4PE5B 3EF0A 1QFXA 1ZGGA 1GKKA 3IVCA 3CRMA 1DQNA 2C2MA 2R1UA 4NCIA 5HX7A 1M1YE 4L78A 3NDBB 1JIQA 4A82A 4Q9KA 1PFYA 1V6AA 3EBPA 4J07A 3T4PA 4W5JA 2AD5A 4AY2A 4WBNB 2AA3A 3DZCA 3G5AA 1UXOA 1RXEA 3P20A 4XM0A 1R0ZA 1IB6A 1IG0A 1Q0QA 2AV6A 4D6XA 3ELYA 4DIDA 2IP1A 4DWJA 1RJ9A 2CNBA 2FUNB 5ALWA 3WGUA 2VHJA 2OLEA 3T1YB 1M90D 5EIBD 3WNDA 4AUNA 4E5SA 2HH9A 3BF7A 2Z6AA 3G2MA 3IP7A 4J7CA 3EGOA 4FUQA 3RVLA 4NE9A 4D8VA 4KKXB 3DEKA 3I9FA 4IX9A 3H5OA 4Y9UA 5EESA 4BQNA 5H4GA 3J7AC 2QLFA 2I65A 5IJ0B 1CRPA 2C98A 1PJ7A 1USIA 4MVJE 1Z38A 3KXIA 3LQFA 4PZZA 1JKIA 1UINA 2PYDA 2A9QA 5TVKA 3CKMA 2IBMA 1Z2NX 4G7XA 2EDCA 3HCRA 1NV9A 2UDPA 4INAA 3AEQB 3GEIA 1KGSA 1HH4A 1J56A 2BFPA 4LRXA 5KHAA 4PGAA 2AL7A 3D5TA 3TXAA 3T3NA 1WOMA 2PGXA 2P65A 2JHFA 2GXUA 1G21E 5CT4A 4UUAA 2QUHA 1WE2A 3NYQA 1CUFA 1NU8A 5IEJA 1WZNA 1ZR2A 2E1PA 3NEYA 1JLLB 4ZV7A 2GZ3A 5E4JA 1A8IA 4GNRA 5JAPA 5E8JA 2WUWE 3HKBB 3TQHA 3CEPB 5IVKA 5HMMA 1S8OA 3R3ZA 1NDQA 1COWA 1PUIA 1SCBA 3C3KA 4X20B 2PNJA 3EA4A 4XR4A 1PJRA 2CJWB 2PSJA 4RJTA 4Q4DA 4BEJA 3L9WA 4EA6A 1NI4A 3OEYA 1C8VB 1S89A 4L75A 5AVKA 1P2GA 1XK7A 3LUCA 1G4HA 4RVFA 1UL1X 4OLBA 5IZCA 3RC8A 1MO6A 4IDAA 3THXB 2ZANA 2FXIA 4O1IA 5LIRA 2HWXA 1E2NA 3CVUA 4DF3A 2XNHA 5DTRA 1IAQA 1UKEA 1KY4A 2W2PA 2ZS8A 1K0UA 3O4IA 4B84A 3PHCA 3QYAA 5JBNA 4ND3A 2PKQP 3WXMA 2I4RA 1JHXA 5D7NA 4AJ2A 2O3QA 4EZBA 4YV7A 2Z4SA 1OH7A 3FWYA 4QDKA 1QHYA 3Q5EA 3WGGA 2CXTA 2AJDA 2WM3A 1VQLB 5FUWA 4MHTA 3QUAA 4EOGA 4AMZA 1NRJB 2VPXA 3ZDAA 1DGQA 2FH5B 1KOLA 4G1EB 4EBFA 3KR0A 4Z4RA 2CLLB 4D79A 1M10A 3THOA 1NR7A 1YBVA 1Z7BA 2UXDB 2P1ZA 2X7XA 3ABOB 1IHYA 2XAUA 3D59A 3SAJA 1RWMA 1BW9B 4DV2B 3V76A 3S55A 3STXA 4ZTZB 1RCFA 1RE0A 4IFTA 3A4TA 4L6AA 4UCFA 4S05A 3I72A 3BWCA 1VC2A 4QPDA 5CA0F 4P53A 3PNMA 3DE4X 2G25A 2O5EA 2AI1A 3PGMA 1U3VA 1ZICA 4G4GA 1NULA 1N2GA 2J3LA 3C7AA 3A1TA 3PGJA 1MVNA 3ZWPA 3USCS 4RY2A 3ZWWA 3WKBA 3BULA 4QXAA 3L5KA 1KBOA 4LJSA 3QFFA 1CDEA 2QRHA 1KR5A 2CKMA 2PWBA 1ZIYA 1GCUA 3G3EA 4WOPA 3HFJA 3RYIB 4D0RA 3DOCA 3RSLA 2R1VA 3RT9A 3M5WA 2DFDA 3WWCA 1MQ8B 2K2QB 4M86A 4DR3B 4Z86A 1CCWA 2FN8A 3PZRA 4HVLA 1D2CA 5FBLB 4BNHA 4YMVA 1UD3A 1G5IA 1JH8A 1QBKC 1MX3A 2D0DA 2OO5A 2VTKA 1C7EA 4HQNA 2JIBA 4JB3A 5ELMA 1EM6A 2JLBA 3R77A 1U2GC 1W93A 3PICA 4WZ6A 5F35A 2Q99A 1EIZA 4S1WA 3SEZA 1XZFA 1UKCA 2GZAA 4FYVA 3SHTA 1ORTA 2OBTA 2ZR9A 1GA6A 1V16B 1BS2A 5ALLA 4F04A 2LGJA 2R5WA 2ZYUX 4ZOLF 2X0RA 1RWVA 2RH4A 3A6KA 3R7AA 2DIEA 1JEQB 1KBQA 5HQTA 3PCTA 1PGPA 1NLYA 1N8NA 3FA2A 4DNPA 2G36A 4HQ6A 4BX0A 1D2NA 2XD4A 2YFQA 3MBIA 1AQUA 3UXEA 3CNEA 4IJVA 3M6WA 3QFRA 1T91A 3TLGB 3FM9A 4M1OA 1TA9A 2C1ZA 4JNCA 3K0KA 2PS3A 2P9HA 2WIFA 1RI3A 3FJ1A 5IPFA 1P62B 4F9TA 1ZIDA 4LMPA 3PYXA 4ZHQF 1Y9ZA 3HWSA 1IVNA 4CLHA 3EXIA 3CN9A 4TRMA 3R3UA 2AZDA 3I2IA 3PDJA 3SC3A 5F7XA 1JSXA 5FOVA 4UPVA 2VDRB 4M49A 4YGXB 2H85A 2HPZA 4RHYA 3O74A 3EDRA 4JFRA 2QVLA 1R6BX 5C0OE 3RVSA 4FEGA 1UBGA 4PTZA 3E5MA 4XVQA 2GTPA 5DHSA 3ZE1B 1Z73A 3CW2A 3H5AA 3D7NA 4YREA 3KHTA 2VDJA 1XZJA 3QKSB 4MRVA 1TMOA 4A8JA 2MIIA 2PD6A 1YMUA 1Y5MA 4FWTA 1MB4A 3WFJA 4UAJA 2WG1A 5CDGA 1ADBA 2IGBA 1FC0A 4B6PA 4GKJB 1HZEA 2AQKA 4LYDA 1EJ6A 3MJEA 5ARDA 5LDGA 3VZQA 2FMFA 2JZOA 4ZZ1A 4II7A 4HCJA 5K8IA 5CR9A 5P21A 2Q07A 1YR2A 2JGRA 1DC7A 2EKQA 3M4JA 4E5DA 1XU9A 5IJWA 4RADA 3K71B 2CV0A 2CDRA 2H2IA 3DW3X 4IIHA 3T3PB 5C5EA 3RE1A 1DKMA 1EH5A 2HTEA 1KZLA 3LK6A 3H83A 3ZE6A 1SBHA 1QIGA 4M1MA 2ACVA 4ZYVA 1DC5A 1ZX1A 5DXFA 4ZVRA 1E6KA 1IM8A 3GVKA 2DQZA 3NR2A 2ZRPA 3W3AD 1MBZA 1JWAB 4JBIA 1KIMA 2EW1A 4GBJA 3WNVA 2AOUA 2V8BA 1LPMA 4RDCA 2Y68A 1U1DA 5DK6A 1RYYA 5G02A 4ZVPA 1E60A 3GLIB 3WIBA 1ZUD1 2PQ2A 4TRNA 2G67A 4JLAA 3WHLA 2Q2VA 1QPGA 2Z6BD 1ZU5A 2FE1A 2G9VA 3EAFA 3GV0A 3IESA 3QELA 1YHZA 2O3RA 4HQKA 3C98A 2WZCA 4ZQIA 3UK6A 3GFSA 3UB2A 4WESA 4GYWA 2FDCA 2J32A 1DOHA 4WFJA 3VJRA 1Z6AA 3LC1O 3PWZA 3WJAA 5BSMA 4V0RA 3AKEA 1Z0JA 4HNRA 4R5HA 3CF2A 3P2EA 3PUMA 4TMFA 4B6QA 1YVPA 2Q5FA 2CF6A 1TIKA 3WKEA 3WLRA 5TNXA 4EJMA 1PT6A 2WJZB 2BFFB 4KBGA 2ZJ1A 3W05A 2CJFA 2YWRA 1EIWA 3ASZA 1EFRD 1G8AA 3D1LA 5T57A 5ICGA 5DTJA 3ZU3A 4JWTA 2HA5A 3BE6A 1MG5A 4RD2A 4NDZA 3TI9A 1CUCA 1Y5RA 5EVCA 4FJ0A 4QPPA 3RS9A 2R60A 2XYGA 5DX0A 5IM5A 2VAWA 2LV8A 1EUQA 5JNVA 5E4FA 4FGKA 2W6JD 2VTBB 3WLQA 4N48A 4WQMA 4TMVA 5CH8A 2J9FB 3U4HA 1ZMRA 2QSJA 4CMAA 4PSUA 3W8FA 2ZAIA 4OH1A 2QPOA 1KQSB 3PYLA 4V39A 5DP1A 2IY7A 2NX2A 1IVYA 4AIIA 1VDZA 3DKRA 3E0QA 2FX3A 1FFWA 3EGCA 3EVZA 4IIJF 4BTEA 1F48A 1DQYA 3P1JA 4RVDA 1ACLA 1TAGA 2EZ4A 2G70A 3FMPB 3WLEA 4R69A 4NRDA 1QSGA 1WP9A 4DR4B 4RTPA 4NCXA 5FIUA 2VK4A 3FFAA 3VR4A 5LJLA 4UNPA 3EN0A 1AUQA 4GKKB 3OWHA 1WLSA 4X7CA 1FP2A 2ATXA 3C15C 3QWHA 5EE0A 4P35A 4OHWA 3RS5A 3QENA 4IJUA 1LNSA 1KP2A 1T2DA 2G76A 4J43A 1KY2A 4OK6A 4AJ4A 1RM5A 4QFMA 3D6VA 1V37A 4JR0A 2P35A 3WYCA 1I2MA 4EVSA 3U44A 1G291 5GM2A 1E69A 1D4ZA 1W5SA 5CLJA 3GJ8A 1KEKA 1XD9A 2R68A 4NFLA 4TSKA 3SVTA 1CB0A 2BUAA 4JFAA 4E22A 1ZWKA 1VI2A 1Z4IA 2B99A 4LCBA 4Q4CA 1JAIA 2PMWB 4YJHA 4PPFA 3T1VA 4QKQA 7REQB 4BQOA 4HN2A 3V7NA 3D4BA 1Z6TA 3O9ZA 3ZVKA 5D01A 1M2KA 4B5LA 3IOEA 1XX6A 2ZR0A 4GZ6A 1P2TA 5SYMA 2OO3A 2P9CA 4ARZB 1CJKC 4XRRA 3NOVA 4B4OA 7YASA 1KTIA 4ECAA 4TWBA 2JANA 1R6VA 2PVSA 1E0KA 3ZGZA 1CWUA 2XT0A 3DDNA 1EGVB 3GYBA 2AEJA 1E3EA 3KLNA 2GEVA 3FCSB 4RDLA 2CMHA 2VJCA 4TGLA 1G3IA 5LMUB 2CL6X 3LY5A 3ZHBA 2KM1A 4HWRA 3Q85A 4ZCTA 1T6YA 4LF9B 4JJKA 5E8RA 2IT1A 2PXXA 1G8SA 3HYNA 4QO7A 2YYZA 4MSUA 4K7JA 5EUBA 1W9XA 1RQNA 3FPGA 4BLTA 4EG8A 3L5OA 5DLYA 3UFBA 4A4DA 1UXHA 3ELBA 3DTTA 2V59A 1M6WA 1LJUA 2X3YA 2ZUCA 3FVQA 1TU0A 3GHHA 4WPGA 5JV5A 1D6NA 2G5CA 3MRXA 3RVOA 4DQ0A 3CBGA 4RJIA 3NEAA 3OE1A 2IZ5A 1V45E 2VDVE 4WZAE 1Z7EA 2OBBA 3ERCA 1Q0LA 3PLAE 3I64A 4NV1A 3KSRA 4MWEA 2B4RO 2C31A 4TYYA 1WD7A 1OFHA 2QD2A 3KSUA 4LSGA 3IFSA 3AERA 1EFHA 3DR3A 4NULA 3OEHA 1A9QA 3L8DA 4AT1A 4UOZA 1Y7LA 5ADWA 1DRJA 3RYTC 2D0IA 3SMQA 4UXHA 3HZRA 4IYRA 1G6HA 3IOYA 1M2WA 1IY2A 3HRIA 3HUDA 4L5IA 3D6FA 1W73A 4L07A 3Q3VA 4HOYA 1V5WA 4JC8A 4BX3A 3RRJA 1LPAB 3B20A 2WMDA 3MXOA 4D8TA 3AFNA 5HVNA 2AKAB 2OBSA 4JLJA 4ZODA 4DTCA 1M67A 6ADHA 4LXUA 4XTRA 2QN8A 1N6PA 1W44A 2QX8A 2Y76A 2PLWA 1Q1EA 4F3CA 2J6IA 1VQ7B 3GBSA 1W48A 4MO2A 1MCZA 3ULKA 1EX9A 3W78A 2M98A 3DTVA 2RAPA 2VP2A 4EEZA 3I5MA 3TXYA 2UUBB 1DV2A 1NAIA 1JHPA 2CL0X 3CR8A 3JZIA 2II6A 2XYVA 2FP4B 1MGOA 3BIOA 3VNUA 3IQHX 2NU9B 3ORSA 5IARA 3R7LA 5K0SA 3UKOA 1WZ2A 1KNQA 2P4UA 4OXKA 1VE1A 1U2PA 2Z9DA 3UWSA 1JLSA 1O9BA 1YIAA 1M5RA 1RE1A 1T35A 1ZINA 3CRRA 1Y9EA 3KPUA 5DU2A 3SR3A 1IUKA 1HLPA 2QJTA 3W2IA 2YZKA 3X44A 1VG9B 4HDNB 1K4KA 4MZDA 2H3HA 1MA0A 4O3MA 3KEGA 3WA6A 5I9IA 13PKA 5E3IA 3K20A 3FHTA 1EVZA 1VQ4B 2C57A 2JGIA 3OZEA 4EDHA 1MPXA 4FFBB 4FSHA 4F2GA 5HIAA 5DLDA 4E1VA 2Y6UA 1WG8A 3JYQA 1E6MA 3HP7A 4GBMA 4KO2S 4BQQA 2BMEA 4ESOA 4HVCA 1X7HA 4HFJA 4I66A 1PWYE 1LJ8A 4RMNA 1CD5A 3HJGA 4MI3A 3MC1A 3SEAA 1VQ5B 1DUIA 1WZCA 2CV1A 1XD2B 4FDLA 5CBPB 2X2PA 4BY9E 2ZRAA 1R4ZA 3B2NA 5LKRA 2HQBA 1CUYA 3KUKA 2XB6A 4G24A 2WYUA 1B23P 3E9YA 4HMPA 4X85A 4DMLA 3FF1A 1I3CA 3GZTB 3H2SA 2IU3A 4IKOA 3MNFA 3ESQA 4GPIB 4XQEA 1XZBA 1O95A 1Z2OX 1YA8A 2OQ2A 5DTMA 2YV3A 1A9RA 1R64A 1RJDA 3BUSA 4QU0A 4R8SA 4MV7A 4BUJA 2QYOA 5E6UB 4ZVUA 3R0ZA 1KFJB 2CUKA 5J58A 5JZ9A 4WX2B 1Q44A 3IPLA 3R6DA 3QF4A 1JJFA 1FP7A 2QA4B 3OQ1A 5U4QA 3AVYA 2WNHA 5EFOA 1VLZA 2QLMA 1UBKS 1GNRA 1JJ2B 3PTLA 4AMYA 4QDZA 1HM5A 3K6KA 1ZPDA 1HYGA 4DMCA 4S1OA 2OHJA 4J03A 1XRMA 4N8EA 4GDFA 2BEVB 2X76A 3IEUA 5TPWB 1U9YA 4MR9B 1LK7A 3ZWBA 3MTGA 1X1RA 4XMYA 3EWIA 3NTVA 1RU3A 4NZOA 4JBNA 3P0RA 4TSFD 4TXLA 5IC4A 3BFKA 3NVDA 4LJ7A 3INNA 4XOUA 5FJIA 3OQHA 3BH4A 1JDVA 2AMFA 2OCGA 4JVMA 4H77A 4MTLA 5CYFA 3T6KA 2UU9B 2OZLA 4G9EA 3JYLA 4IOKA 5KC9A 5K0FA 4EHJA 3TGLA 3CVOA 5C80A 4ENUA 2VP3A 2RJNA 3TZ6A 4B87A 4XYLA 2IUTA 3DFIA 2QRNA 3I23A 5CDHA 3OUTA 2WIJA 4B71A 1I2DA 2E4XA 4YP5A 5KNCD 2BZGA 3NBYC 2WF6A 4RTJA 2ZTHA 3RBXA 4BTLA 3BHIA 1Y8RB 2NPFA 4L8GA 2HWKA 4AO7A 4MZXA 3VC1A 2V7WA 3RUFA 5IVDA 4PG6A 2W22A 2H8KA 3TZBA 3ZE8A 1ZSYA 5CLFA 3N0WA 4PF1A 3PWKA 1YK0A 2X23A 3RUIA 3IA7A 3FYCA 2FY8A 3PNYA 3PR1A 5AVJA 3ZWCA 4KO4S 4R8VA 1M1KD 1DKOA 4MA0A 3LXMA 4OL0A 4LRUA 3JX9A 1VIVA 4BC1A 4G25A 1VOTA 4CVNA 3JQDA 2IPOA 3FMFA 3AUSA 2WMNB 1O5OA 4UAGA 1PFQA 1UC5B 2REQA 3TVTA 3F5MA 3C24A 2WIKA 4X95A 5F2OA 3WR5A 4B48A 3HVKA 2BKAA 3C45A 3OPVA 4NICA 5B4VA 4DQDA 3RAFC 1AN9A 4GR9A 4HTAA 2AOTA 5JCJA 2NZ2A 2QUZA 1PQYA 3D3KA 2EATA 4Q37A 4FBLA 1V3VA 1R5NA 3ILSA 3K30A 1T9DA 1PJQA 3O5AA 1PR5A 1EBUA 1QH8A 4NU8X 1G18A 2HF9A 4J7AA 4POAA 5EGSA 1VQ6B 4PBRA 1GQFA 2VUHB 5E7IA 2FPXA 4EARA 5EZYF 4F56A 2QXTA 3O3CA 4EG4A 1MV5A 2XJ4A 2P11A 4BO2A 1XRJA 5LOVB 3WGIA 1Z17A 3SJPA 1OI3A 4QBKA 3ORRA 1YZ3A 2VWGA 2ORED 4MW7A 4YRIA 4RHXA 5JISA 3CLRC 3WL7A 4AICA 1THMA 4KX3A 1OXKB 2VHEA 3WMWA 3NWJA