1KK2A

Structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdp-mg2+
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
405
structure length
396
Chain Sequence
b'SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords eIF2gamma
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
total genus 97
structure length 396
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk2A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk2A01
1LV7A 1ANKA 1JAHA 3BORA 2AKAB 2N1BA 4EJSC 2F3TA 3CWQA 4LJ9A 3CRMA 5A5GA 5CK5A 3KJHA 2WAYA 4KXFB 4U5XA 5SZKB 3MLEA 2I1QA 2ZXUA 2E87A 4PFSA 3NBXX 2PBRA 1E9FA 3NBZC 2ZJOA 3I72A 1XEXB 5E3HA 4FIDA 4Q19A 2C98A 2FE4A 4CYMA 4NONA 3QXJA 3GLHE 2JJ8A 2ZPTX 4QJ3A 3GLIE 4F7WA 1GL9B 2FPKA 4GBMA 5FBWB 1MO4A 4CZ2A 1SVWA 2X1VA 3CCLB 3QF7A 4Q9KA 1Z63A 4V0OA 2R9VA 2JJ2D 8OHMA 1T0JB 3L0OA 1DPFA 1ZD8A 3EIQA 2C78A 2QAGC 5H1YA 5KOYA 2O8CB 4MYTA 1U8AA 3T15A 1DAKA 1IN6A 1F2UB 1Z0DA 4CVNA 3GLFB 4QHYA 2QEXB 2CXXA 4HLCA 2XNCA 4S35A 5JFGA 4Q7MB 2FH5B 2YYZA 3VTKA 3PUVA 3AVPA 1G7SA 1WBBA 3CF2A 2IYUA 1II9A 1OXUA 5BXQC 1QUEA 3JZAA 3N2IA 4B47A 3D6TB 2JCSA 1WP9A 2O52A 3GJ5A 1TUIA 4C0KA 1MT0A 3NC1C 2VQSA 2B8WA 3LLMA 1YJNB 5FOSA 4D26A 2BHRA 1R0WA 1E9DA 4OHVA 2IYVA 1N6PA 2IYTA 4P3YA 2LKCA 4BFUA 3JQPA 3NIBA 2ODNA 2IUUA 4OK3A 1Z3IX 3CD6B 1W4CA 1W47A 3A36A 2GEDA 1XEXA 2WWIA 1G3RA 2CMKA 3BRWD 3UG6A 5CB6A 2BMEA 2G77B 3THWB 2GZHA 421PA 4BFTA 4TTQA 4DIEA 2BOVA 3QFRA 4C43A 3DEFA 3Q7QA 1DOAA 1NBMA 2R2AA 1IN5A 2ZSDA 1E3MA 1YZLA 5TR9A 5FPSA 4CRWB 4O2LA 4C3ZA 2AWOA 3CCVB 2AL7A 2Q9CA 3TUJC 1UKYA 2OV2A 3MGCA 2KSQA 121PA 2O8CA 1WXQA 3C16C 5H8WA 2AK2A 2XTNA 1E1QA 1F2UA 5DYIA 3GLFA 2WZQA 5L3QB 1NN0A 2ZTSA 3BH7A 3RRYA 1QHNA 2GETA 1FNNA 2EVWX 2O0JA 3L82B 4CF7A 1XTQA 2B21A 3CIOA 2QU8A 4KITB 2F1IA 1M2OB 1CP2A 3BXZA 4OK6A 5FBRB 4TYWA 4LBZA 1YVDA 4A92A 1S1MA 1FMLA 1YZTA 1RC8A 5EE9A 1Z8FA 4E07A 3KKNA 1SXJD 4RD2A 2ANCA 1R0XA 2AFHE 4KFTA 2OFWA 4EKDA 2PH1A 1UDXA 3P20A 4O0MA 4F38A 4P4SA 2PJRA 5HZHA 5K8IA 4KFSA 2AN9A 2WWWA 3A4LA 5CLLA 3KDSE 2QPTA 3QQ5A 3AQ4A 3TUIC 4D80A 1KAGA 4IDHA 3M6AA 4Q18A 1N25A 2IW3A 3THWA 2VF7A 721PA 2QTZA 2JJ2A 1UJ2A 1VQMB 3AVWA 1VQKB 4K81B 3W8RA 3X2SA 1S9DA 2WPDD 4LC1A 3GFTA 4I81A 1ZNWA 3ZBTA 2FFAA 5F9HA 3ND9A 3B60A 3ZS8A 3U3JA 3QFTA 1E9AA 5L3QA 3V9PA 4N3GA 1JQJC 1FW6A 1NDHA 2J0SA 4A2WA 4HLQB 2I3BA 4XD7A 3PJRA 2WWFA 2OCAA 2QORA 3W6NA 4CEHB 5HKKD 2RGNC 2XZPA 5F3WB 4PXAA 1EP3B 4BUJA 2C9OA 2MMCA 4TTPA 2YZ2A 4WXRA 1SGWA 1E2EA 4Q7KA 4ZPXA 1SVMA 1W0KD 2V9PA 3JZMA 3RANA 2FZ4A 2QQEA 4RD1A 4QL3A 2ZYTX 1TU3A 4ILEA 1VG8A 1KO8A 1XTKA 3VMFA 3KXLA 2RC6A 3BAFA 3VR5A 5GVSA 3CPEA 5IHPA 1NVVQ 1OB5A 2G9NA 4BEJA 4MRNA 1GAQA 4HLUC 1D8TA 2CE2X 4M53A 4LV5B 4IOLA 2OG2A 2WKPA 5BQ5A 2QDXA 3K1JA 1MABB 3N2EA 2PLRA 4NE2A 4B3XA 2J59A 3PEYA 5FTJA 1HH4A 3KUDA 5J5CA 1S0UA 3U5ZB 4TYPA 4DWJA 3EZ2A 1VQ6B 2H18A 3ZVLA 4TL9A 1CJTC 1P6XA 4OHZA 2LCFA 2JLWA 2H16A 1KK1A 3GFOA 3T1VA 3A1WA 1QGYA 3I8XA 2N46A 4CEHA 4GP6A 2HMAA 2BPOA 4QM7A 4R71A 1YRBA 4NCKA 2IL1A 2D3WA 1JJ2B 2LKDA 1K73D 2YOFA 2YVUA 1SKQA 3TMKA 3W3ZB 2B7BA 1OYYA 4MUBA 3ZLJA 4TLDA 4YMUA 1COWD 1YITB 4YDSA 4BGDA 2G3YA 1EESA 2WHXA 3BE4A 3KKPA 5GVRA 1D2NA 1XEWY 5LB4A 1U99A 2GCNA 2ZR0A 2IYLD 4XVRA 4M1OA 1HUQA 4HLDA 4LWZA 3X1XA 3ADCA 3LA6A 3O8DA 4AKIA 1E2PA 4MH0R 1U2RA 2WWHA 4Y9UA 3WNBA 4F4CA 5KDLA 1TLLA 1YJWB 1MABA 1XEWX 2ZI6A 1G3UA 4JLVA 5JI2E 3KB1A 4WBSA 3UMRA 1KJYA 1KY2A 4Q00A 1KI1A 1JR3D 4R9UC 2OT3B 4US0R 2EU8A 3RYTC 3LBIA 3FKSD 2OXRA 2F7SA 5JS7A 2CCGA 1LY1A 4NMMA 4QBIA 4MKGA 3NBYC 1W0KA 2HT1A 4BLPA 2ZE8A 2FNAA 3QKRB 1SVIA 3KXIA 4Q7LA 2VL7A 1GUAA 4BFWA 3PEWA 4R2IA 2IX3A 4UNQA 2O8DB 2HDNB 2BBOA 4DEXA 2FFBA 5GJWC 5CDFA 2D7DA 4XVQA 1Q44A 3EZ7A 4YAWA 2R62A 4TL6A 1FDRA 2C95A 1P9RA 2KJQA 5DYGA 4CDGA 1VIYA 3EXAA 2H8KA 2EWWA 1VHLA 3AF3A 3OZVA 3CCRB 4Q47A 1WMSA 4JL6A 1P72A 4NL4H 3QI2A 2ZYVX 2P65A 1GWNA 4JBWA 4BQSA 2W2XA 4L16A 2WBLC 4TZ6A 2VRWA 4TLBA 1RJ9B 2XNDD 2ZIAA 2ZRIA 1DDGA 1XB2A 5C4MA 1KI2A 3C7KA 3BC1A 4UNPA 4NZYA 2NQ2C 2ZRMA 1OIXA 4G5QA 3ONWA 4HEJA 3PEVA 2OLKA 3N5CA 1NY6A 4ASUA 3C5HA 3U6KA 2G1JA 1U98A 2OILA 2ZYWX 4QRHA 1OKKD 4BFZA 1IN8A 1N5IA 1P5ZB 1UBCA 3A1UA 2BDTA 4IDOA 5EXXA 4MDFA 3TNFA 3AGPA 1SZPA 2P0EA 4D2IA 1TUEA 3Q72A 4U00A 2QPOA 2GZAA 3QKRA 4ZIRB 2VHUA 3TW4A 1COWA 4DB4A 1MRSA 4KFUA 2O8DA 4URYR 5SZHB 3KJIA 4V0KA 2IHYA 1FRQA 1W2GA 3AM1A 1RZ3A 1MOZA 4LV8B 1KI4A 1W4AA 3TQFA 1RPZA 1NLZA 4U9UA 1DTSA 1RW4A 4AIIA 3VX4A 1G17A 4AG5A 1E96A 1E2QA 1TAGA 1VPLA 3IQXA 1CR4A 1XWIA 1Z6AA 5BWMA 4DB2A 1X1RA 1OT3A 1RJ9A 4YALA 1XJ0A 4Y7CA 1Z6YA 2J45A 3U7HB 3G82C 3WYFA 3RABA 1SULA 3H1TA 3PUYA 2ZI4A 3BFVA 3QF4B 3TVDA 1CJVC 4IVQA 1YKSA 2PCLA 2ZRDA 4Z8YA 1HT1E 4HDOB 3RWMB 1E62A 3BH6A 1AS2A 2OBNA 1IONA 4LUCA 2EFGA 5K8UA 3PVSA 4HB2A 5EQTA 4KYIB 3RSOA 5FUWA 3BJIC 2WV9A 1M7GA 4BZQA 4DRZA 1EFUA 4Q4HB 4B73A 3BD9A 4UXIA 3SI7A 3WY9A 3H86A 2WAXA 5IRCD 2WSMA 4ZIRA 1OH7A 2D4HA 2EQBA 1G7RA 1YRAA 3ZVRA 1U0HC 2QP9X 2XXAB 5AN9A 3ZBUA 2Z0MA 2VZLA 2BVNA 1QG0A 1ZAKA 3HYTA 2CL0X 1WDTA 2J46A 1X6VA 1YHNA 4WVFA 1XP8A 3LO5A 3LV8A 4M21A 4MRVA 3TH5A 3TKLA 1QHHB 4URVR 5KDOA 4OI2A 3WRYC 3UANA 2ANBA 2GDJA 2E9SA 2NIPA 1GRRA 2OBLA 1Y63A 4V03A 3V4RA 3P1JA 3SC3A 4I1OA 5JRJA 2QSZA 4RKEA 3ADBA 4TMZA 1Q20A 2FPLA 2EFCB 2BCJQ 3WNCA 3VKGA 1AMOA 2ODWA 5IDVA 1RRGA 3QF4A 1CLUA 5AJZA 1CBUA 1LNZA 1XD2B 1OKKA 1R8SA 3AKDA 3ZJYA 4TMWA 5E95A 3FHOA 3QPVA 1XCMA 2Z6VA 4JLKA 5HE8A 4HSEA 3I8SA 1IN7A 3B9QA 2E1RA 4FMCB 3TIFA 4JZKA 4URUR 1OFIA 2VP4A 5CB8A 1BYIA 2JDIA 1ZM3A 1M74A 2MSCB 2WKQA 2OSBA 3CZPA 2HF9A 3ECCA 3PENA 1NY5A 2VHTA 1JAIA 1FQKA 4Q1DA 5JEEA 1D6JA 1W46A 3FB4A 2ZJYA 3CLVA 1QHHA 2KBFA 4HAUA 2JLZA 3OEEA 3I92A 1XNJA 4H1UA 2QMEA 1OXSC 2IS6A 1DEKA 2IYWA 2ZEJA 2Z83A 5CIWA 2CDNA 2F55A 1EX7A 4HUQB 4PPGA 2GKSA 2DCUA 1LTQA 2AD1A 4Q9IA 2P6RA 4DBLC 1Z2AA 4LY6A 2GF0A 1AJEA 4D4JA 2P5TB 3KKQA 5EUQB 2CK3D 1XD2A 3CNOA 3MAAC 3AV0B 1IN4A 2IYRA 4ZCMA 3IPYA 1L8QA 2IK8A 2IS2A 1XXHE 2CBZA 2GXQA 3DVLA 2BEJA 4DCSA 1G5RA 4RD6A 2O8FB 1OJLA 4AWXA 3BERA 2RGEA 1GAWA 1YZQA 4FMDB 4KVAA 2OE2A 1E9SA 2RKOA 1NG1A 1NI3A 2HF8A 2WM9B 3KXKA 5E4FA 3FWYA 4CEJB 2QRNA 1TQ2A 4B48A 4R98A 1GAJA 3GFPA 3VR2A 1KSGA 4JYCA 1NIPA 2J7PD 4IVRA 2G1KA 4UNNA 4WXPA 4ZDWA 2ZSEA 1O87A 3HWSA 1W36C 4OQFA 5C4GB 4TT3D 1N5LA 3BGWA 3SR0A 3TAHA 3EWAA 2Q9BA 1SM4A 3R8CA 4A0FA 3QXXA 3IBYA 1Q21A 1FNMA 1HEIA 1UKEA 2ZROA 4IDNA 2VSFA 2QP4A 3AKEA 3Q8XB 3G0HA 3WMGA 3D7MA 5KUTA 4PC2A 5AJXA 2KI5A 4JL5A 1KIMA 4C0BA 5F2EA 1KKMA 3JVVA 4HUQA 4JLJA 2GJKA 2OK7A 3DKVA 1HQCA 4EFNA 1DARA 4RZXA 5TMPA 3IHWA 2GVDC 4HE6A 2JA1A 5L3SB 1KK3A 3NEJA 4YQFA 1FNDA 1Z0KA 5CITA 4TQAA 2P6NA 2Q0HA 3F8TA 3X1YA 4UQOA 3OJXA 1YR7A 2BJWA 3SHWA 3TJZA 1R4AA 2QAJA 3IQWA 1KI8A 3BOSA 4KLZA 2O8FA 1JR6A 2OCYC 4OHYA 1NSFA 2HXSA 4LJ5A 1FQJA 2CNWD 2OAP1 5H70A 4CEJA 1HT2E 1G3QA 3CRW1 1N6LA 1Q1QA 5HPYB 3MWYW 1E99A 2F3RA 2G0NA 4LBYA 5C1BA 2Z4RA 1DS6A 2ECKA 4KYUA 3TUZC 1JEEA 3LLUA 3LBNA 1NLFA 1WBDA 1Z07A 2ATVA 2CLDX 1XJCA 2XEXA 1LW7A 1GM5A 1NMYA 1XBTA 4C9BA 2BMWA 4IOMA 3VU9A 2QA5A 1MO6A 4OJQA 4CIDA 2FFQA 6Q21A 1R2QA 1F2TB 1TADA 4EQ6B 2FGKA 1B2RA 1GKYA 3AVVA 1J7KA 2OCBA 4LV6A 1PJRA 2ZI5A 5KYKA 2W6ID 2OFXA 4B6EA 1GITA 1UDWA 3EG5A 3CONA 3LVQE 3RS4A 1J8MF 4B34A 1OHHD 2FOLA 4AURA 4P31A 3HJNA 1EXMA 1ELOA 2REBA 2GVZC 1QVFB 2IYXA 1M1KD 2OEPA 1I4LD 3W2EA 2ZRKA 1KK2A 1E2MA 4TMKA 2WTUA 3R9WA 1KSHA 1OFHA 1NP6A 3W34A 4HAWA 3UATA 1KI9A 1XMSA 3ZVMA 3B1ZA 3KX2A 3TK1A 1FNBA 3FPKA 1ZW6A 2LWIA 2A5DA 2ZJ2A 5CM9C 5FA6A 5FOXA 1Z6XA 2DEUA 1OPXA 4GOXA 2QY9A 2HLDD 3NVAA 1DO2A 1P9NA 2P6UA 3OIWA 2CRVA 1LS1A 1Z06A 1PV4A 1F2TA 4UNSA 2BGJA 4EQ6A 3SJCA 4L9SA 3HDTA 1IBRA 1R10A 4TL7A 5AJVB 821PA 1N6HA 1VTKA 4MITA 1ZUHA 1KKLA 5LD2C 3EZ9A 3T35A 2CNWA 3KFVA 2QP3A 1W2HA 5CIQA 4DIDA 1NLYA 2VNIA 1P2VA 4OYHA 2GJ9A 3SNHA 1VQPB 1GO2A 4AC9A 4YDHB 5J40A 1G18A 3K9HA 4G1UC 4DXAA 2ODEA 2A2ZA 2RGBA 2ATXA 2VA8A 4JYBA 3AVQA 4XWKA 4JLOA 4A36A 2CCKA 1FL9A 1ZNZA 4JT4A 3EPJA 5JSZA 1XMIA 1L4YA 5DI3B 3SZRA 1J9ZA 2BSAA 3CRQA 2DHRA 3EARA 4YAFA 3EPLA 3J81k 3BIFA 4HAXA 3RC8A 1P73A 2ZI3A 5B30A 1JALA 3MD0A 2GNOA 2H92A 2JLRA 3U3OA 2W6IA 4IOJA 5FUXA 1EFRD 4PSAA 4U02A 4IXMA 2H57A 2A30A 4PTLA 2PZGA 5FOUA 3X1WA 1E2JA 5JWHA 4C0JA 5CYOA 2YV5A 1AA9A 2HXYA 4M4SA 2C5LA 4F91B 3AB3A 2VIIA 4NCNA 3RVBA 3C8UA 1YHQB 4LBVA 2F1HA 3FFAA 3WP1B 1RKBA 5IF9A 1VYVA 1B0UA 1VDZA 4D0GA 2ZRGA 3O47A 1MH1A 1QRAA 1T5LA 1Z28A 3KJGA 4HUTA 3L2OB 3QEOA 2CHVA 1DAFA 3CO5A 3S1AB 1XCPA 2ZM5A 1WCV1 4R2HA 2PX3A 4DDWA 4BECA 4AI6A 1R8QA 2GZDA 5CJPA 1NBME 1J8YF 4DLTA 1JECA 1KRHA 4QGGA 1VG9B 3G4SB 2JIZA 4YLGA 3FGNA 1NL3A 4AD8A 2XTZA 3IDQA 1G8HA 1JI0A 3CXCB 3CPJB 3A8TA 5E7IA 4OQNA 5EP2A 3DPUA 3QPWA 3CX6A 3H4MA 4LJ4A 1HY3A 3CMEB 5DI3A 1ETUA 3SBDA 4MYHA 5AUOB 4ACBA 1GL7A 3GLFE 4IEEA 3RDPA 3FYHA 2QA4B 4MKHA 2JLXA 1NVWQ 1UF9A 1T8UA 4JMPA 1NSTA 3DOEA 4GNKA 4LYAA 3G71B 2AR7A 2BF4A 1T3LA 3LX5A 3NXSA 4I99A 4Y0VA 2UZ3A 2HV8A 3FJOA 3CB4A 1Q3TA 1IOZA 1IY1A 2VPPA 3OEHA 1P60A 4ERNA 1Q57A 4QGFA 4JVMA 1QBKC 1XRJA 4LSGA 1T9HA 4BE7B 3SE0A 3MUFA 4BPBA 2GCPA 1QFZA 1E64A 5JBQA 2C96A 1G7CA 2VHQA 1G291 2HJGA 2C03A 2VSXA 2WWXA 4M1YA 3GLHB 4LHZA 3S1AA 3TQCA 2W2TA 2QT0A 5FBQB 5L8VA 1E1RD 2YC2C 2CVHA 2GXAA 3DL0A 2GHIA 1EFCA 4HB3A 3ETLA 3A1SA 5KPJA 4N0EA 1G8YA 3MHPA 4WAUA 2GTPA 3OIVA 1XTIA 4JT2A 4US2R 4TWZA 3TLXA 5D3QA 1RYFA 2IWRA 5HTKA 5BN4A 1FFHA 3CF6R 5L3VA 1IJFA 1CRPA 2GAAA 2FMXA 1AKYA 3QE2A 2B6HA 3U3MA 4NCHA 4NYMQ 4IOKA 2OFOA 4HAZA 4QHTA 3E1SA 4OJKA 1NVXQ 4CW7A 4F93B 2NO7A 4Q4LA 3SQWA 1FUUA 1KO4A 1NF3A 1Z0JA 2OTLB 1H85A 2Z5FA 1TNDA 2FJUA 2FZLA 4PQRA 4UAJA 1I2DA 4G5OA 5DHAA 3VQTA 1QUFA 1E4VA 3QENA 1QF9A 1TMKA 5LB2A 3IO5A 4U7DA 1K6MA 4IEIA 4D6PA 1N6KA 3ZD7A 1Q22A 4NYMR 1NIJA 5EE0A 1QZXA 2Q3FA 4PZYA 4LPSA 1UM8A 3K0CA 3W2GA 4OI0A 4PZZA 1ZU4A 3DO6A 5AR1A 3M0EA 4LHYA 1D5CA 2IXGA 3PR1A 1XTJA 2AXPA 3VNVA 2ZJ5A 3MFYA 2A9KA 3LD9A 2QM8A 4A82A 5JRZA 2BCGY 2FSIA 2QMUA 2VP0A 2JJ1D 4LGMA 2PEYA 3W90A 5FL7D 2BMJA 1UAAA 3OAAD 4GZLA 2XB2A 3KQLA 1TPZA 1YJ9B 5KNBA 3I32A 2DERA 2FN4A 3U60B 3EPHA 2Q9AA 2NO0A 2VP9A 3UPUA 3TSWA 1AS3A 3BBPA 1DDIA 3SYNA 221PA 1SXJB 2XITA 3AH8A 5GJBA 3P26A 1YZNA 5KSWB 1W49A 1NG9A 5EMNA 4JVNA 4KI0A 2XSZD 5FOTA 4K46A 3W9YA 2NG1A 2F9LA 5B64A 2BKEA 4LJYA 2ASEA 1WF3A 5CM8B 3R7WB 1QVAA 3UKDA 1ZVQA 2JEOA 2JLSA 1S72B 1DAIA 1UPTA 1C4OA 1E2GA 3T61A 1XZQA 5JECA 4EUNA 1XF9A 1G64A 5EP4A 4G5SA 3SFZA 5CYPA 3T06B 3THOA 4KVGA 3A37A 2WOJA 1S9HA 5EJEA 2EIXA 4Q1AA 3BFXA 3IIMA 1Q0UA 3U2QA 3L8YA 2GQFA 1XDBA 4PSKA 1KZ7B 4DLWA 4L8GA 4EPYA 1Z22A 1UADA 3CX8A 1F48A 2BGIA 4V0MA 2AX4A 4RZ2A 1F60A 2ZE6A 4IHQA 4B32A 1ZNXA 2WICA 4EFMA 4PGOA 3QXSA 2YKGA 3NG1A 4JIMA 4EPXA 1RFLA 1OFTA 3UXMA 3A1VA 1EX6A 3QBVA 3QIAA 2ONJA 1QHGA 1BOFA 3LXRA 5KNCA 2AHOA 1MRNA 1SXJA 1ZM2A 4TQ9A 2HYIC 1C1YA 1BJKA 2K5UA 3WMFA 1LS6A 4LOAA 4ZDKA 1G6HA 1Y3AA 4A0GA 1E9RA 1JJVA 2OM2A 5CDFE 2WSSD 2DFLA 2GK6A 2J7KA 4KO8A 2ZR7A 3NKVA 1ZM9A 2ZS9A 1E2NA 4Q66C 2JASA 1IHUA 2FEOA 2R6AA 1TQ6A 3R7WA 2QUZA 1E32A 4PANA 1FTNA 4Y0AA 5JMTA 3L0IB 4NCJA 5BN3A 4WA7A 3W2FA 3EZFA 3TVTA 3GJ0A 2JJ1A 5JJLA 5FL7A 1U9IA 3RS5A 3OAAA 2DWQA 5B57C 1G8PA 5BYJA 4DDTA 1AQYA 1KMQA 4QFMA 2BBTA 2WPDA 2HEIA 4Q48A 2B7CA 2GILA 5DISB 2ODBA 3FHCB 4QHSA 5J4HA 2GF9A 2XZLA 1M7BA 3N70A 5SZIA 2GA8A 4JSTA 3F5FA 4Q03A 4C0LA 2XSZA 2FV8A 3SN6A 3W6PA 2X2FA 3WHKA 3LWNA 5HKKA 2IWHA 3AGQA 4PC7A 1JA0A 1Z2CA 2XX3A 3ADKA 1H8HD 3MRSA 1TVCA 1KNQA 2QG6A 1QGZA 4P4UA 5JJIA 4QXAA 1DAEA 3K9NA 4B43A 1I4DD 1H42A 1F20A 1JPNA 3VR4A 1T8TA 4X8LA 1EGAA 4BRWA 1T0HB 2BC9A 2WJHA 3B1WA 2IEYA 4EIWA 2GEVA 2C04A 2CL7X 4DHEA 4OQXA 3CW2A 2GAOA 2YC4C 3K09A 1JB9A 4C0HA 5FTLA 1GOTA 3ADDA 4OQLA 3WRXC 3K70D 1ESMA 3LH5A 3JQQA 4RZ3A 2ZANA 4WZBE 2ZITA 4L4UA 1VQNB 3FKQA 5IK2D 3VR3A 1K9MD 4IXNA 1EWYA 3U61B 4AKGA 2ZUDA 1GRNA 2R6DA 1A2KC 4QJ4A 3SBEA 4JBXA 1Z6TA 1CU1A 3CKLA 3EPKA 5CK4A 4A0HA 2IS1A 3KQKA 1G8GA 3AUYA 1ZUNB 2KB0A 2YWFA 4PC6A 3CCMB 1W44A 3W8NA 5JCZA 3HU3A 1N8RD 2DWOA 3H84A 4DLYA 3QFCA 1D9ZA 5C2JB 2ZAOA 3OE7D 2WSSA 1CNFA 5DH9A 3ND8A 1YIJB 4KJZA 2ZRBA 1UKVY 4DSUA 1VQ8B 1GRQA 2FX3A 3KTAB 2IF0A 4FN5A 4XSHA 2RGDA 3LNCA 1R0ZA 1GKUB 1Z0IA 3OW2B 3HYRA 3K70B 4A1FA 2A7QA 1KY3A 4P32A 2Z4SA 1I4TD 1G21E 1NKSA 3FHTA 3BFKA 2GXSA 2V4ZA 3R8FA 3U3KA 1DO0A 2RGCA 5TDHA 3CZQA 2DFNA 1PZNA 2HJVA 1Z0AA 2NO9A 4AYXA 2PT7A 3HP1A 5J47A 3QPUA 2W6JD 4LHVA 4X8MA 5TB5A 1JA1A 2J87A 2YNMA 3RS2A 2GBLA 1QG2A 2WVJA 5EXTA 2VF8A 4L15A 3LAWA 4KAXA 1EWQA 1G5PA 1P9WA 4YHBA 3WNDA 4DQLA 4Y9RA 1VECA 1JR3A 2VBCA 4TSFD 2ZUCA 3AUXA 1Q86D 1J2JA 3FKSA 1YQTA 1XD9A 3GD7A 3A4MA 2GEUA 2W0SA 2AWNA 2X19A 4Z51A 4B35A 2ORIA 3CM0A 3DHWC 3ZQ6A 1Q81D 3BB3A 1E2IA 2C9CA 3BS4A 5DLQC 1QHIA 1S8FA 3KTAA 4JJZA 4H9GA 2OO7A 2FPMA 2WJJA 2KE5A 2R44A 1L2TA 1W7AA 2V1XA 1DELA 4M0LA 4IRUB 5KSOA 1VCIA 1IJEA 5IK2A 2CVFA 2QTVB 1FPMA 5JWRA 4OQMA 1CR0A 1JXOA 5FR2A 1XJQA 2CHGA 2I1VB 4HB0A 4MGIR 2NMVA 3LY5A 3QNUA 2PL3A 5FOVA 3QSYA 3RAPR 4FMCF 2XNDA 3KFXA 4DCTA 1NN3A 3KL4A 1ZYUA 4I1SA 1PVOA 1NNEA 3WXMA 3TE6A 2OTJB 1A2BA 1XEFA 3FPAA 1KO5A 1SVOA 2OLJA 3K8YA 3OE7A 4PO8A 5UKDA 3V76A 5E7MA 5C18A 4OKSA 2YINC 1UEJA 1K5DA 4RD0A 1UEIA 2BKUA 2J9RA 2ERYA 3SJBA 3ZYCA 3NHAA 3LRPA 4QBGB 1W2BB 1HURA 4XSGA 5H5JA 1E98A 3CC7B 4XTRA 3ZH9B 4FMBB 2ORWA 4Q5IA 4RY2A 4TYYA 4BPRA 2ERXA 1CJMA 1OFUX 5EZ5A 1SXJC 4M22A 4MYCA 1X8JA 4E5UA 5FPYA 1G9XA 1GNQA 1BYUA 3DKPA 5JZVA 4Q4HA 1CJUC 4MGKR 1VQ9B 2FSHA 4AY2A 2A78A 3IEVA 1NJFA 2JGNA 2W6JA 4I1UA 4NTZA 4K8OA 4B4DA 1QG4A 3KQHA 1AZTA 1Q1EA 2XXAA 2IT1A 4RSGA 2HCBA 3EC1A 4LC0A 3U4QB 1JBKA 1UFQA 4EJSB 4MQBA 3L0SA 2FF7A 1AGRA 1FRNA 1ZD1A 3WP0A 2ZRHA 4FMDF 2RGGA 1G41A 3ASYA 3RLFA 4QNRA 1U8ZA 5HR5A 5HCNA 1XZPA 2B92A 2DR3A 4X8OA 3QFSA 1VMAA 2VLIA 1G3MA 2O0HA 1QX4A 2BMDA 3L8ZA 4FXPA 4B2IA 1TEXA 4NPHA 3MMPA 3GLGB 4ESVA 4OK5A 4C0AC 2OHFA 1II8B 1YZGA 5DN6D 1G3IA 3IIKA 4CGZA 3SDZA 3AVTA 4Q4JB 5EE3A 4YMTA 1XPRA 2VO1A 3QXCA 4PAMA 5K8LA 1KJZA 2Q21A 5LBIA 2GJSA 1E9CA 3IKJA 2PMKA 3LO8A 1G20E 1EP2B 1PUIA 3A6PC 2YWHA 1N6OA 4OI4A 5EUMA 2QAGB 2WJGA 4ABYA 3CCUB 4PHGA 3EAQA 3NDBB 3HPRA 1JJ7A 1L4UA 2A5JA 2RMKA 4PC3A 1Z29A 1X86B 3EA5A 3B85A 3K09C 3VR6A 2QROA 3U4QA 2IEZA 4GMXA 2ZRFA 3BB1A 3O8RA 1EP1B 3QG5A 1VCNA 4P0TA 4Q1BA 1VKJA 3WHLA 5M04A 3DMNA 4GOKA 4GOJA 2VTKA 1K5GA 4NYJQ 1YR8A 4HZUB 4RFSB 2VHJA 621PA 3ZVNA 4D4KA 1KK0A 3AVXA 2ZE7A 4YAUA 1R5BA 4IKEA 3DOFA 1NMXA 3TGPA 3GLGA 2XJ4A 3RSLA 3W5JA 3SJZA 1II8A 1M8PA 1IB0A 3RC3A 5KHOC 4Q4JA 4RD3A 1ZCBA 4AF7A 1YU9A 2DWPA 3IHLA 3Q85A 1S3SA 4NYJR 1ZMXA 2L0XA 1OSNA 3OIYA 3QKTA 3AF0A 4MGYR 1ZU5A 3UWOA 1W4BA 4BFVA 2BM1A 3GJ4A 3I62A 1ZCAA 4I1VA 3W5HA 4B3FX 2PJZA 4WOPA 1J99A 4LBWA 3GQBA 2VYQA 4DLRA 1R7RA 1S4QA 1J70A 2H5EA 4MGZR 4PPQA 2XOKD 4AYWA 2ZSFA 4G0NA 2VP5A 4Q01A 2QSYA 2GBLC 3EWSA 5KTYA 4M2LA 3Q5DA 2A5FA 2NPFA 4ZKEA 5EE1A 3CR7A 5J4KA 3CNLA 3GJ8A 4QBFA 1OIWA 1E79D 4OHWA 3AVYA 2SHKA 3AF2A 4FWTA 1KDTA 2CK3A 4G5RA 5DN6A 2ZUBA 4HZUA 3I56B 4RFSA 1E63A 4JBYA 2PCJA 4KSCA 2CEAA 4TMXA 1W5SA 3PCRB 1D2MA 4ZI2A 4JLBA 1KDPA 2R6GA 4X8HA 1ZNYA 5L3SA 1N0WA 1GNPA 1W87A 4QNMA 1BQEA 3RS0A 5A0FA 3W2IA 2Q3MA 1IY0A 2IS4A 1E2DA 2J7PA 1M7HA 1Q1BA 2REOA 3DZ8A 3B8HA 1P62B 3NEYA 2ZREA 3IBGA 3K70C 2J3EA 4Q9JA 2XGJA 1OH5A 4TT3A 4HAYA 2DETA 1P7CA 1T4GA 1KNXA 3F0TA 1QH0A 1SKYE 1X8LA 1QDEA 4TN1A 4W5WA 3D31A 2BEKA 1YJ5A 3ICQB 1GILA 4B76A 521PA 2V55B 4JJKA 5TV2A 1WB9A 1G4UR 4Q21A 4DEYA 3UMFA 5AUNB 4TZ0A 3AF1A 3VKWA 4CT4B 4C30A 4M1WA 5EE5B 2J0UB 3QY0A 4GRAA 4URZR 3T1OA 3QVUA 4LPKA 3WMEA 1E0KA 5HE9A 1ESNA 3F3YA 4LI0A 1D1NA 2IA5A 5BW8A 1G16A 2QM7A 4G01B 4Q7JB 1IM2A 2RHMA 1VQ5B 3QOFA 4YAOA 2ZS8A 4NDZA 2RGAA 1Q7YD 4BLTA 3ZDQA 1QHSA 3PQCA 4TYQA 3GPLA 2ZAMA 4LRWA 1DAGA 4LHXA 1YI2B 3Q5EA 4E03A 2YOGA 4ZV4A 1VYUA 2BBWA 4E22A 3GJXC 5JEDA 3I5YA 1X8KA 1E79A 1HQYE 2ZJ8A 1NN5A 1OH6A 1E2KA 1GDDA 3FMPB 4L5BA 5P21A 2ZRCA 5TXGA 4M1KA 4ZCIA 1W0JD 2NZ8A 3UG7A 2J5XA 2D74A 4CT5A 4D82A 4AG6A 1TF5A 4M9QA 1KAOA 3LW8A 1P4SA 1AZSC 5HCIA 1N0VC 3I55B 1QFJA 4ZCLA 4KFRA 5DI9A 5DHFA 1CTQA 2RGXA 3P4XA 4TL8A 3U7FB 2J0UA 1CF4A 1XFAA 1BX1A 4WQMA 1OHHA 4WW0A 4LK2A 4KCGA 2QENA 1PUJA 3TRFA 4XVUA 2ZJZA 4C2TA 4W5JA 1XE1A 1KGDA 2REXB 3K53A 4DJTA 2DPXA 4EPVA 1Q1ZA 1MO3A 1X3SA 1IXRC 4IVPA 1ZIOA 2O0KA 4D25A 4S2EA 3SOPA 2YHSA 1NBMD 2JLQA 3OZWA 4RJLA 1YR6A 3FDIA 1I2MA 4GI7A 1HV8A 1GZSA 4GDFA 4Q9HA 4Q1FA 2QN6A 2DFTA 1RRPA 1KI3A 1AIPA 1OW3B 1XX6A 1E1QD 2GJ8A 3BB4A 1Z47A 2HLDA 1L7VC 2OUKA 4PAOA 5AJYA 3QG1A 5FTMA 3SYKA 4QC2A 4BFXA 5K8TA 1OYWA 1JXMA 3VR1A 2UKDA 3B1XA 1G7TA 4PHFA 2FA9A 2ZE5A 3CNNA 1GL6A 2J1LA 5DE3A 4D0NA 2EW1A 5KDDA 4BFYA 1QHYA 1OXVA 1T91A 1XTSA 5KU1A 3KZ1E 1BH2A 2VP6A 5J4VA 3PG5A 2VEDA 2V3CC 1GSIA 1JQLB 1KI6B 2IYZA 3LQRA 2QMHA 4RFVA 1N0UA 3RNLA 4DSTA 1HA3A 2R6FA 3CCQB 2VNHA 4DCVA 1ZC4A 1TF2A 2A5GA 1U8YA 4XIGS 3T12A 3Q9LA 4LYJA 4MRRA 3REGA 2QMOA 2XNSA 4RCYA 3M1IA 1G1MA 3GJ6A 2IHBA 4BWYA 3FOZA 3GLIB 3NH9A 4F4IA 1D2EA 4MA4A 5EP1A 2WJYA 3H2YA 3NTUA 4BZPA 2BV3A 3LDAA 1KZGB 1W0JA 1OGJA 1A1VA 2AFIE 4JSYA 2CHQA 3EZ6A 2EFDB 4DQKA 1CKEA 1E69A 4Q02A 3AP1A 4K1XA 2D7CA 5FI1B 1EFRA 3MSXA 1AK2A 1A82A 2DFKB 4AKEA 1D9XA 3PXGA 1ZP6A 4V0LA 4XD7D 3CBQA 4P4SB 3WYAA 1HTWA 2QE7D 2NZJA 3KKOA 4PZLA 5FR1A 1YZUA 1LFDB 2FDCA 1N2CE 3DM5A 1GJRA 3AP3A 3I3SR 5KPDA 1KI6A 4N1AA 4YC7A 3RWOA 5KSZA 1LF5A 1KC8D 3R20A 4UJ3A 1SVLA 3LXXA 1UKZA 4XTCS 3NHBA 2ZVPX 4B74A 2QPAA 2CLCX 1TQDA 5AWFC 1RE0A 3KB2A 3U7GA 1T5IA 4IDQA 2IBMA 4DZZA 4P33A 3K0AB 4GMDA 1G8FA 1SHKA 1G6OA 3GLHA 4BEBA 2WWGA 3SEAA 4B3DA 3GLIA 2G83A 2ZRNA 4D81A 1GKIA 2OAQ1 3GMTA 3PUXA 4UNRA 1GVHA 3T34A 1E2LA 2ZI9A 4BZXA 4EPTA 1DADA 3I4LA 1I7PA 4V0ME 1FMJA 1BO6A 2OXCA 2V6JA 1F3OA 3E5HA 3QKSB 3RHFA 1GNRA 4EPRA 3CC2B 1PLJA 1VCMA 2QQ0A 1X1SA 1CQXA 1ZINA 3THYB 5IT5A 2YJTD 4B2PA 1SXJE 4TLEA 3U6BA 3SJAA 4TLAA 4UJ5A 1OF1A 1RYHA 3OHMA 4BRUA 1Q82D 1PLKA 1T3HA 4A6PA 3U44B 1CR2A 3NC0C 3GEIA 1VQ7B 1MKYA 2W58A 4B3GA 3TSZA 4NU0A 1CEEA 4DLZA 5DIFA 1E1RA 2ZS7A 3BH0A 2PX0A 4II7A 1ONBA 3X1DA 4AF6A 4LHWA 3K9LA 2UZIR 3L43A 5FPHA 3W5IA 2ZU6A 3K0AA 4D0LB 1XPUA 1E2FA 2QGZA 1GVNB 1GTVA 2RC5A 2ZRJA 4JKYA 2V54A 4PQYA 3FMOB 1N5JA 3TW8B 4A9AA 2JLVA 3G6EB 4D4LA 2C99A 3OZXA 1R5NA 5F98A 2GCOB 2TMKA 5FL3A 5L3RA 4LDJA 4KU4A 2QE7A 3VO2A 3LFUA 3QKSA 4JVSB 3FVQA 3H0KA 3K0FB 5KSPA 2QTLA 3NWJA 4A4DA 4Q1EA 3THYA 4DSNA 1MO5A 3W3AA 3E1YE 4PHHA 4ACAA 5LDDC 1OH8A 5F9FA 3ZZ0A 2ZU0C 3QJYA 3U44A 4PC1A 3CR8A 3O8BA 4B75A 1DAHA 2O8BB 3IO3A 2XNJA 3NH6A 2CL6X 1C9KA 1OXTA 3QBTA 4PPNA 3TAUA 3V00A 1EFTA 3CH4B 5LPNA 4LYFA 4LX0A 3B82A 3OESA 2C8VA 3EW9A 1CXZA 3P32A 5AUPB 1EK0A 2BIFA 1NMZA 4W5HA 3ZQJA 1ZRHA 1P75A 2EFEB 5FTKA 2RH5A 4ZDIA 2QBYB 4G5GA 4PHTA 3RS7A 1TL7C 3CMAB 4LJAA 1KSJA 3B9PA 3A1TA 3CRRA 5FH9A 4PPFA 2J0QA 1DE0A 2OBMA 3MG9A 1K8AD 3K0EA 4PX9A 2D2FA 3PEUA 3I1FA 2KBEA 5J4YA 1FNCA 4HB4A 1P2SA 1NVVR 4W7SA 3R9XA 1TQ4A 5DO9A 4DLSA 4LJ8A 2GCOA 1KTVA 2VP2A 3FTQA 1OB2A 2ZSAA 4DSOA 2UVQA 4XWAA 2DB3A 2Q3HA 4POAA 5DNYB 3K0FA 4B3BA 4L9WA 3QEJA 1BX0A 4IFEA 4RVCA 1AGPA 1P2TA 1V5WA 2ONKA 3M4YA 4ASUD 2FGJA 2V6IA 5FUVA 1VQOB 3RRZA 4C7OB 3AVOA 1NRJB 1YR9A 4NCIA 4NKRA 3IILA 1W36B 3AKCA 1JEDA 5FI0B 2GK7A 3ZZTA 2O8BA 1H8ED 2P2LA 4OHXA 2BBSA 3E70C 3GEHA 3MWLA 4NYIQ 3UIEA 3V4FA 2C9YA 4EPWA 1W5TA 1Z08A 2RB4A 4UXJA 2XJ9A 5DGXA 5EXSA 2F9MA 3PFIA 1B23P 4WZAE 3ASZA 4BLSA 1ZIPA 2WKRA 2QBYA 3PIRA 3W6OA 3R9IA 3VHXA 3C14C 3K0SA 2Z43A 1ODFA 3FMIA 3ZGXA 3CCSB 1CJKC 1U94A 1NVUQ 4HZIA 2V7QD 2MSDB 2GPJA 4HAVA 2HCJB 2NGRA 2ZRPA 1AM4D 4NYIR 2XTMA 3CH5A 5GJCA 4FD2A 1JR3E 1RRFA 1Q12A 2V8OA 3CC4B 2C2HA 1SVKA 2W2VA 1XCGB 4M9ZA 4A6XA 1G19A 2RAPA 2CCJA 2D62A 4JL8A 2W0MA 1KDOA 2B8TA 1KQSB 4I4LA 4E09A 3HPQA 4ON9A 4KHZA 3EA0A 4QOSA 1KO1A 2NTYC 1E0JA 4C7OA 2XAUA 2NO1A 1FUKA 1G4AE 3MCAA 1S3GA 5H59A 3DM9B 5JHGB 4YMVA 3B1VA 4LCBA 1P2UA 2R6CA 2V1UA 4F7DA 2Y8EA 4AK9A 2F43B 3ICEA 2X2EA 1A5TA 4B3CA 4KODA 2QGNA 4N3NA 3RRMA 1N5KA 2VSOA 5G53C 2PEZA 4WIAA 2WMNB 3QUSA 2YOHA 3KJEA 1A8PA 4W9MC 1KD1D 1VIAA 4Q1CA 1E94E 1EG7A 2HT6A 1ZM4A 3K0CC 4ZKDA 5JWOA 1FP7A 1US8B 4ARZB 1AQUA 1BMFD 1WA5A 1RRCA 1AKEA 3KUCA 3PUWA 2FFHA 3OIUA 4TMVA 1WRBA 4MKIA 1XMJA 1VQ4B 4QKQA 1SVSA 5H68A 1G5TA 1GR1A 4XJXA 5GV8A 1A4RA 4A0RA 1NJID 3PV0A 4Z8XA 1H8EA 2WJVA 5SZJA 3NBFA 1H8HA 4IFBA 1HE8B 2IXEA 1KI7A 3OJWA 1PLLA 2O5VA 5CLQA 5HXBA 3KQNA 2DBYA 1M34E 1K8RA 4UKDA 1OIVA 3DMDA 2JDID 5THXA 4HI0E 1TF7A 5AUQA 3IPXA 1O3YA 3C4JA 4FCWA 1A7JA 2F43A 4NBSA 3X1ZA 4DDVA 1FX0B 1VG1A 2QL6A 4GL2A 3B5JA 5KO2A 2G88A 2V7QA 4C0SA 3L0PA 3MJRA 4HE5A 3B1YA 1FP6A 3FE2A 1S1CA 2I4IA 1NKTA 4AYTA 4C4PA 4O25A 4QJ5A 4XOIA 3OEED 1R0YA 1AS0A 4HATA 1VHTA 3T5GA 1T6NA 4M1TA 4HDCA 4YMWA 2GWHA 5C46F 5LD2B 1US8A 4ARZA 4A8JB 4MYUA 1DVRA 3AKYA 5CJ2A 1JB1A 2GJAA 4IDPA 3QE0A 1FZQA 3CRZA 3CX7A 4DLXA 4KLNA 1ZJ6A 4DDUA 1BKDR 2IC5A 1W34A 2P3SA 4GP7A 3LW7A 2BWJA 4Q9LA 3AVUA 4FCVA 1N3BA 4O2RA 4B33A 3D3QA 4FCTA 3CCEB 2EFHB 4ZGNB 2JATA 1UBFA 4GT1A 3AP2A 4C0QC 4FK8A 4GFDA 2WOOA 4G1BA 4JLMA 4ESHA 4P6VF 2PIAA 3CUEF 1P61B 5FUYA 5G40A 2VNJA 2BMFA 4GSYA 4BLOA 4B71A 2BJVA 4DCNA 1FX0A 1UBGA 2OZEA 4M9XA 4BASA 1E9EA 2X77A 2PLFA 2AD5A 4RKFA 4A15A 3FFBA 1UBEA 3VAAA 1BMFA 4PAQA 2DY1A 1LF0A 4FINA 3SFVA 3WBKA 3C5CA 4OI1A 4F4JA 3B7GA 1KO7A 3HR7A 4EFLA 3OFND 3ES9A 3DDCA 3LBHA 3CWZA 1KJWA 1U9IC 3ZC3A 3NDPA 4A8JA 1DG3A 2BM0A 5GV7A 2ZI7A 2G6BA 2PT5A 4ITRC 2C77A 2BN4A 2IF2A 2WMOB 4BLQA 4TSFA 1IXZA 2DYKA 5JI3E 2PZFA 2H17A 1CS4C 5A4JA 2H7VA 3GLGE 1V43A 3HU1A 1R5OA 2PZEA 2EYUA 5GADl 3EASA 5TVKA 2IYQA 2ZJAA 4CEIB 2B5OA 4XH9B 1EWRA 3MJHA 2H1LA 3EIEA 3SS8A 2QI9C 2ZR9A 2EYQA 1OLOA 3GJ7A 4PO9A 2NO6A 4FI3C 4LYHA 4FWIB 3SYLA 3EX7C 1GG2A 3RS3A 3KKMA 3C15C 4DLVA 4GZMA 3IGFA 4BFSA 5AJWA 2JLYA 1E0SA 2R8RA 1CR1A 1MV5A 3K9GA 2F1JA 4KBFA 3D8BA 1N6NA 2R65A 4JLPA 1TEVA 3MWJA 4NHOA 3B13B 2WJIA 2RCNA 1XD8A 4JKIA 2GESA 5TY0A 2J0VA 3ZS9A 4FW9A 1U81A 1ZBDA 2FG5A 4QG7A 4QGAA 5BN5A 3I5XA 3A4NA 1ZC3A 4ZO4A 1JNYA 3TSOA 1F6BA 3T1TA 2O8EB 2JAQA 3CCJB 2RHDA 4EJSA 5B58C 3IUYA 2GXUA 2OCPA 2CNDA 2R6HA 2VH5R 3DZDA 4V0NA 3SU8A 3CPWB 1EFHA 1E2HA 3HR8A 3SHFA 1TU4A 2ZSBA 2IYSA 3VX3A 1Q3HA 4F92B 2X8AA 3OZUA 3THXB 4O3MA 2HUPA 1XXHB 2P5SA 3AF4A 1NJGA 1T3SA 1MR3F 3U3RA 5KNDA 2QTFA 4CEIA 1M1YE 4DKXA 5JCPA 3ZD6A 2EWVA 4B44A 2AKYA 3HU2A 2VHCA 3PUZA 5EP3A 1M90D 2OK8A 1OGIA 2QZ4A 4TMTA 1VCOA 1OV4A 3FMFA 5FOWA 1KOFA 3ZIAD 3VKHA 1CRQA 1J90A 3VHLB 3B78A 3CRVA 3I73A 5DSZA 3E2IA 4DC9A 4DUGD 1R6BX 1F5NA 2CJWB 5ANRB 3VU9B 3GJ3A 4MKFA 4A2QA 4C2UA 1OXXK 2QAGA 4YONB 2QTHA 3OF5A 3QKUA 3OFNA 4Z1MD 1HE1C 1E4YA 3IEUA 4JVLA 4P4TA 3UK6A 5FTNA 2ZRAA 1OE0A 1TTTA 2IXFA 3JVUA 4HDQB 5JHHB 5FFMA 3A58B 3WBJA 1S2MA 1VYTA 3QXHA 1M6NA 2WWYA 3O8CA 1HYQA 2O8EA 2VYFA 2N42A 1FTSA 1CULC 3Q3JB 4DLUA 1FOEB 4M8NE 4XWOA 1IY2A 4RZUA 1KMHB 4BLRA 2ZETA 2YWEA 4H1VA 3ZZUA 1W4RA 4M1MA 4Z54A 1IQPA 4ZI3A 2F6RA 1RIFA 3Q7PA 4OL0A 3E20A 3EIHA 3PITA 3VNUA 4EDHA 2YWGA 1GP2A 2WIAA 3THXA 1KSFX 1XXHA 3UWKA 1DBSA 1QHXA 2HYDA 4TYNA 4KSBA 1TX4B 3TBKA 4ZDJA 4NP6A 4MDEA 4JLNA 1DAMA 5D3MB 5ELXA 4M9SA 4DCUA 4LZZA 1LB1B 4LJ6A 4QBHA 1N6IA 3QVVA 4IJMA 4PR0A 1KDRA 2D2EA 4YMSA 1WQ1R 4TTRA 2AXNA 2QNRA 2CJWA 3B2EA 4RCZA 3GEEA 4G1VA 5FPTA 2MSEB 2P67A 4YXWD 1ZM7A 1LVGA 3P27A 2JLUA 1II0A 2CLSA 5E7JA 3VFDA 4B2LA 5TARA 1ZUIA 4V02A 2W83A 4HYYA 3U7EB 3AEZA 4Q4AB 1IXSB 1BIFA 1XMVA 4R7ZA 4J0QA 4DT1B 4EH1A 1ZD9A 1E9BA 1KMHA 2ORVA 4MUAA 5G41A 5J4LA 3TR5A 2FU5C 1QGAA 1JPJA 3REFA 1BS1A 2XB4A 1DG1G 2PMDA 4PO1A 5FBLB 5B2ZA 4URXR 1IAQA 2ZVQX 3ZIAA 3W5VA 2A5YB 3B6EA 1U90A 3G5UA 4N0DA 4TLCA 1W48A 5AK0A 2AK3A 4EAQA 2IUSA 4DUGA 5JJKA 1H65A 5JSZB 2NPIA 5D3MA 3T1QA 5KSYA 2FWRA 4GPTA 2JIZD 4Z1MA 3TR0A 4MRSA 3GP8A 1Z83A 2MMGA 1KYIA 4JLDA 1CIPA 3LX8A 2KWIA 5BYKA 1QFYA 1QVGB 1U0JA 1XTRA 1SKYB 1W35A 3WYGA 5HZKA 3UMSA 3VO1A 1SQ5A 2IUTA 1XPOA 4PSVA 3EC2A 2WIBA 2OESA 4KBGA 2QEQA 2J41A 1Z0FA 4M1SA 2XOKA 3LVRE 4MRPA 3C41J 4B6FA 1WE2A 1GIAA 3T5DA 2X3UA 2FSGA 5GJVC 2A3RA 3RRNA 1E0AA 4AKHA 2FEMA 5EZ6B 2IYYA 3W2HA 4Q4AA 4ZGQB 1VG0B 2RGNA 3JQRA 1Z5ZA 4QGHA 4A8JC 4DT1A 1S96A 1Z6GA 2CE7A 5EXPA 1UMKA 3BWDD 3I61A 5JS8A 3OEHD 1CNEA 4TQUS 4WZ6A 2QRZA 2NOAA 4PQFA 1E6CA 1XU4A 4KV9A 4D4MA 2GRJA 3GCGA 1P3JA 5FBVB 3LQQA 4URWR 4QM6A 2D06A 3KQUA 1YE8A 2G0TA 4NH0A 3CF0A 5JLJA 4LJ7A 1YZKA 3CPHA 4HLUA 1SHZA 5G3ZA 2W00A 3IIJA 3P4YA 4DVGA 1NN1A 2ZRLA 1N6RA 4YXWA 2ZYUX 4IW3B 2ZQ5A 2FSFA 1GFIA 5FPKA 1U0LA 2XZOA 3SQXA 4JS0A 1AN0A 3W5UA 3LVBA 1QVRA 1KHTA 4A2PA 4UXHA 1W1WA 1W36D 2F1RA 1VQLB 2Q6TA 3BK7A 4OBEA 2ZJBA 4G3XA 4JLAA 2QT1A 2VNKA 4US1R 5G3YA 3MWKA 1RVDA 4RD4A
chains in the Genus database with same CATH superfamily
1PGNA 4A6EA 4XYMA 1Y3BE 1ZH6A 2OBBA 1FSSA 1YDFA 2N1BA 4BTLA 1MXHA 5AHKA 1TCVA 1NRXA 3UMMA 1TVKB 4WK2B 1ECFA 5AM3A 3ZWYA 4P22A 5A5GA 1L4LA 4JX9A 2W6ZA 4LGCA 3JALB 5EPOA 3ADCA 4ALLA 3UB3A 2ZDHA 4KXFB 2ZXUA 3G8AA 1BZYA 1DTEA 2GPSA 4HL6A 4PFSA 2X42A 3QNMA 1VKHA 1K7FB 3ZUPA 3HA3A 3NBZC 2AOUB 3I72A 1T36A 1XEXB 4IZHA 5E3HA 2FE4A 3H2BA 4RTNA 1DQRA 2FB9A 4CYMA 1GTMA 4X62B 1H5NA 2DR0A 5DHSA 3QXJA 3ZGZA 1CDDA 2ZPTX 2ZZGA 1ZD4A 4F7WA 2Y9PB 4CV1A 1ODIA 3P5SA 4GBMA 5A8AA 2MTBA 1SVWA 2VT3A 5ITSA 1PK9A 2PQ0A 1Z63A 2C7QA 3A14A 5E2AA 1QP0A 4I5IA 3G49A 1KBOA 4FX5A 4IRXA 2DUUA 1EBBA 4MJ3A 4U2GA 1T0JB 2G9VA 3KM0A 1DPFA 4UBIA 3YASA 2Q4TA 3F4BA 3TLCA 1H6DA 2O8CB 4XFDA 1IN6A 1Z0DA 3R4CA 3PA2A 4QHYA 4S35A 2XNCA 2ID7A 2FH5B 3FPSA 4Q3LA 4WEQA 3GPCA 4J4BA 5KNBD 2IYUA 5JMPA 2Y3IA 1EUCB 5FIUA 5BXQC 3JZAA 3HEBA 3H7IA 2FEKA 3N2IA 4W5OA 2O52A 4RGYA 4X20A 2RJ3A 4H7HA 1U1GA 2H2WA 3NC1C 2H06A 2P4UA 5TJHA 2B8WA 2GD1O 3D3WA 4J1SA 2FSVC 4TUYB 4YGYA 2BHRA 1R0WA 4E11A 3R3JA 4KKVA 4RVSA 4FT4A 3MAGA 2IYVA 1N6PA 2B4RO 2PHZA 4ZVQA 2LKCA 1UBTS 3DYIA 1EVQA 1YVRA 4XNFA 1Z3IX 3SXPA 1OYVA 3CD6B 3KSBC 1JKJB 1IMJA 2WU8A 1V9SA 2CMKA 2ZR8A 3N8HA 4ZOBA 1FXSA 3U9TA 3FRJA 5CB6A 5C8YB 5EHXA 5IAGA 5IKMA 3THWB 4PGAA 4X0CA 1PQ4A 1V7CA 2O07A 1DWOA 3D7NA 2BOVA 3D8HA 4KLAA 3Q7QA 4CKXA 1DOAA 3LDHA 4Z9AA 1N7JA 3VVBA 2R2AA 4UCFA 2OQIA 1Z45A 1ZXLA 1E3MA 3U0VA 5IUNC 3PXXA 4CRWB 4JI0B 4C3ZA 1EGMB 2AFIB 1PQWA 4OAPA 3W5SA 2HMTA 3CCVB 2Q9CA 4PAGA 4AUEA 1F0PA 1UKYA 2M9MA 2OV2A 3OY7A 4NZ9A 2W70A 4LDNA 1GQSA 2TMGA 2TMDA 4YYEA 5F4MA 2QX4A 1QIFA 3H5IA 4KTTE 2O0LA 1E1QA 1F2UA 1KEEB 2ZXIA 4G65A 2Q29A 5L3QB 4PYKA 2VAVA 3O21A 4WCVA 3RRYA 1GKLA 2PD3A 4JBGA 1M2OB 1CP2A 4Q6WA 5IJ9A 1FFWA 4F5YA 2FZEA 1TT5A 2W22A 3KU1A 2DBQA 4PVDA 4TYWA 2E55A 1V11B 3F2VA 5EE9A 4QYMA 1R74A 3NTXA 5EXDA 5JAUA 3L7BA 1ZCZA 2AFHE 1TKAA 3QY9A 3FJYA 2WIFA 1DXOA 2HZBA 1AHHA 2PJRA 2ZL5A 1QONA 2Y0EA 4PX3A 3KVNA 5E7QA 3KDSE 2G08A 1I18A 1ZN8A 3QQ5A 1C7ZA 2F9FA 2ODQA 3AQ4A 4DWVA 3TI9A 1L7DA 2RIPA 1N25A 4DQ0A 2XQIA 3HGQA 721PA 1SC9A 3MRVA 1YRHA 4RNDB 2QTZA 3QEMB 1KVRA 1T2UA 1U2PA 4TV8B 1VQMB 1T4BA 1JZTA 1V8OA 2R4QA 3ELYA 4PEVA 4WX2B 4E08A 1VQKB 4HEHA 1V9LA 1HL3A 3NUGA 1P29A 4K81B 4KH0A 1BGWA 4DNTB 3LCJA 4LF8B 1K6XA 3X2SA 5KVAA 4EZEA 1S9DA 2WPDD 3DEKA 3G5LA 3GEPA 3RREA 1YNSA 4NS1A 3U3JA 4QVAA 3KSMA 2Y1FA 1E3WA 4N3GA 3KK0A 4DTIA 2P62A 3N8NA 4F2PA 1K7SN 5HS4A 4M49A 5I6DA 4XRRA 3COSA 4YY3B 2FWIA 2YIJA 1MQSA 3ZWPA 2IUEA 5HKKD 1IRXA 1G5QA 1NXSA 4ZAFA 4MWOA 3RROA 1N2CA 1GGJA 1E3ZA 1FZTA 4BUJA 2WNSA 1MW9X 2C9OA 3GD5A 2NP7A 4XGKA 3HA5A 1E2EA 5TPZA 1IHDA 4NU8X 2B3TA 3DWIA 2FZ4A 5G4KA 3A9UA 2RGRA 4RD1A 3L05A 4HFJA 4IQ0A 1TU3A 2E89A 2QVBA 3GWGA 5ALJA 5L7YA 1VG8A 1NBAA 2Y92A 4MQFA 4RDIA 4PTZA 1B74A 3KXLA 4MTLA 2RC6A 5JVDF 5GVSA 3NHKA 5IHPA 1CUGA 1RZUA 1GA6A 4GMKA 1OB5A 4PPYA 3IV9A 2G9NA 3TCXB 4C89A 4OUDA 1GAQA 4O08A 3EFOB 3ZWVA 4CG2A 5K0JA 2CE2X 4RA9B 1U5BA 5F7OA 2JEZA 4IOLA 2OG2A 3PC2A 3PWTA 2FEAA 5BQ5A 3ZWDA 1ESEA 2RHCA 3GNQA 5BXYA 4MLCA 3AL2A 3STXA 1NX6A 3WWEA 1ODJA 3CRNA 1N2OA 3KP1A 1G0NA 1LKZA 1Z16A 5CDSA 4B3XA 2J59A 4FYVA 2GBGA 4K9MA 4X6YA 1QJ4A 1ZRSA 2O2CA 3P0HA 5J5CA 3PGMA 5C5EA 1JEYB 5CD1A 2WF8A 3EEBA 2EF1A 1JYFA 3ZWBA 4DWJA 3SJ7A 1P6UA 5B1YA 1UJNA 2H18A 4WLEA 1ECBA 2HDWA 4TL9A 4A27A 3BZBA 1P6XA 5L6LB 1V95A 1RWBA 4Z4FA 2VS1A 1XO1A 2Y27A 4OHZA 2PVSA 2I91A 2LCFA 1Y4SA 3LHIA 3GFOA 4WHMA 1QGYA 1LJLA 2RCYA 3JZIA 3GAZA 2IV3A 4Q3CA 2VK8A 3IESA 4QM7A 1YVPA 4V24A 4P5EA 3SC4A 1YRBA 3LF1A 3PJGA 1IUPA 2XMRA 2IL1A 4PRZA 2ORED 4MPTA 2OV8A 4RM3A 3LOPA 4IBOA 1JJ2B 1IK6A 1PVVA 3WSTA 2VDMB 1F51E 4DXDA 1JG1A 2B7BA 3PEFA 3ORRA 4MUBA 5AM1A 4IUDS 4YRNA 1YITB 2AMVA 5ES4B 4DK0A 1DXHA 5EJAA 4ZI7F 4BGDA 3A6ZA 3RH0A 2WHXA 3BE4A 3GBPA 5LB4A 1U99A 2GCNA 1MOPA 1YZHA 4ZEXA 3DMFA 4D9GA 3CHYA 1MB3A 4ENRA 4QSMA 1V16B 3OZAA 2V59A 1F0NA 3LA6A 3O8DA 3UHAA 4RLHA 4FKBA 3OHPA 1NUAA 5AI5A 3O8QA 3OCWA 4G9GA 1C30A 4BO9A 4LHSA 4BRZA 1MABA 1XEWX 3F71A 2UYYA 3TIIA 4ETIA 3VSBA 1A5BB 1USWA 3BKWA 4U7HA 5SY4A 4BB0A 5C8XA 3FPJA 1NF9A 1SBNE 3CXRA 3E9RA 3Q3HA 4Q00A 3FPFA 3RYTC 3NIGB 4O4HF 1AUOA 4BB9A 2AOXA 2ZKIA 3LBIA 4QA9A 1LY1A 5JG7A 3LDGA 3C87A 4KQMA 4O8CA 4PYMA 1RHQA 1MU0A 4BLPA 5EJMA 3A6JA 5KTKA 4R9RA 3Q9UA 3DVQX 2OMEA 2VL7A 1O97C 1MNQA 2FPRA 2YBDA 3BE6A 5EIWA 1D2GA 2X0DA 1T3TA 5IYWA 4ZOLB 3K9CA 2O8DB 2ZYAA 4LQDA 5TSDA 3VHRA 5CDFA 4WZAB 1R4NA 4XVQA 2WD9A 2IPMA 3COYA 2AFRA 4YAWA 3EZ7A 5CXXA 5CYFA 1FDRA 1GL3A 5BO5A 5K8CA 2KJQA 4XIFA 4LGYA 3PIDA 3GAAA 2Q1UA 1VHLA 1XTVA 2R84A 4RMNA 3UCFA 2ZYVX 3H3XA 2P65A 2ECQA 3H6GA 5BV2P 4FDUA 1QMPA 2W2XA 2GI4A 4CLOA 2I22A 1J07A 3CU5A 3MCWA 4EQZA 1RJ9B 3ESYA 5CCXA 1NDUA 1E7QA 1BAPA 1XB2A 2BCEA 3CY6A 5G1PA 4CG3A 5C4MA 4ZMRA 3W5BA 3ENVA 1B8PA 5GOTA 4P4LA 3W9BA 3RSSA 3D3KA 2ZRMA 1N2IA 1OIXA 4NR0A 3SEQA 4FGZA 5HRUA 1HRDA 3V2IA 2N47A 3WLJA 2N1MA 1BWQA 4X6UA 4RDJA 4ASUA 4H6PA 3C5HA 5D5QA 4GEGA 4J6FA 5FPPA 1XT6A 4BU0A 1ORRA 3A1UA 2BTEA 2P0EA 3M3DA 4D2IA 1O8BA 2J08A 1D2HA 3ACDA 3Q72A 2IDMA 2GZAA 4IPTA 4YUAA 1SFRA 1U7DA 4F2WA 4QATA 5KAPA 3ICPA 3URMA 3IP5A 4AJ1A 3PA6A 1HZEA 5CEEA 4URYR 4XX0A 2IYNA 2WZPP 2VK4A 4FGWA 4DRXA 3DC7A 1W2GA 4L3OA 3E35A 4QXOA 1PV1A 1RZ3A 1Y5MA 1W4AA 2A0KA 3QMPA 4BMCA 3AM1A 1VIMA 1IJKA 1NLZA 1RPZA 2G07A 5C80A 2PNFA 3I0ZA 3R3ZA 1V7QA 4UUNA 4HVLA 1H2AS 2KYRA 1NVTA 4MVXA 3V8RA 4XKVA 1YKFA 3VX4A 4HFNA 1E2QA 3IQXA 1XWIA 2R7KA 4LWPA 4RENA 4WZBA 3ZDEA 1F17A 2OO5A 4OHCA 5IC4A 1OT3A 4YALA 3S29A 2ZIZA 4FR5A 3I9V1 4PX2A 4YBRA 3OZFA 3TTXA 3KKLA 4WFIA 1Q1GA 3H2SA 1YL5A 2ATCA 3H1TA 1NVMB 3PUYA 3QGMA 4PV7A 1HDYA 3TD6A 3LQKA 2FAXA 4FZ3A 2IOHA 4Z8YA 4HDOB 1YQ9A 3RWMB 3T1NA 1E62A 1KIAA 3BH6A 2VJMA 4YJ3A 1R5JA 1VXRA 2SBTA 2EFGA 1QGOA 2BHLA 2CFIA 5LSAA 2QNBA 4RJJA 2V7GA 3QEMA 4KYIB 1P19A 1Q74A 3RSOA 3W9UA 2J3JA 3L1JA 5B2EA 4KWTA 1LBEA 4QDUA 4ZV7A 4B6GA 1X87A 4GC9A 3W78A 1UXKA 2D0PB 2JFVA 3BD9A 4UXIA 1Q95A 5JT1A 2Z04A 3EXG2 3CLUC 4R5MA 4ZIRA 1OH7A 2D4HA 5C53B 5K9ZA 2IH2A 1PS8A 1CZNA 1LXCA 4ID3A 4Z4VA 4YR7A 5AN9A 4RVUA 3ZBUA 1M66A 2Z0MA 2QRHA 2BVNA 1XC7A 3D9QX 3B6KA 3T7RA 3ZXYA 3HRKA 3UT5A 2BGKA 2E6UX 4D9MA 2B2XA 1CEYA 3LO5A 4M21A 1K8XB 1Z62A 4H7DA 3KETA 2VTVA 4ZYLA 1DTWA 2XT6A 3VR6D 5AKEA 2F8LA 4N3CA 4EBBA 3UMYA 1W85A 5ER6A 3SC3A 3N0TA 3NTQA 4IGIA 3IOMA 1PU2A 2AW5A 4IF6A 4ENVA 5JRJA 5IM5A 1Q20A 1C1DB 3RVOA 1SJ9A 3S70A 1KH1A 2PBFA 3KWMA 3VZDA 4J75A 3N39C 1CBUA 3M81A 1XD2B 3ZW8A 1R8SA 3ED5A 3IP9A 3ZJYA 1NT4A 2W48A 4LECA 4IIYA 1XCMA 4RHTA 4RVNA 4CF3A 1MXFA 2BFEA 3GIWA 4JLKA 4UVGA 3MRXA 1IN7A 3G8YA 5B6IA 1TO6A 3BGVA 1MJNA 3WADA 1C2YA 4JZKA 1OFIA 2VP4A 4RY0A 1BYIA 1SD5A 3NNDA 3UJ8A 4BNLA 3IIIA 1EK6A 2TSYB 4Q05A 3DUFA 1XZDA 1DJMA 1JILA 2YQZA 4MIKA 4RH3A 1RWOA 2HWKA 3DVSX 3OIFA 3ECCA 3FPEA 4ARVA 1R3UA 3TTTA 5JNTA 3J7AC 4FFMA 5B3JA 3V7AA 2DP4E 3KHUA 3OQJA 4AZTA 4GYWA 1FQKA 2TYSB 4I4NA 3FB4A 1WZNA 3SVTA 4AVYA 4CV2A 5LP1A 1MX1A 2ZJYA 3WJ1A 2I66A 2XMBA 3LUJA 1XAIA 4LTNA 1DB3A 4G41A 2E0IA 1M83A 3I92A 1DBVO 3E6AA 3MCUA 2QMEA 5AXBA 4ZYXA 1OXSC 4ZYVA 5AVQA 3VNRA 2ZEJA 3NHLA 1RPJA 4HLNA 2F55A 4JUCA 2CDNA 3KHTA 3LK7A 4ZAVA 1RRMA 1Z7GA 1BS9A 4Q9IA 2P6RA 2H1HA 2X8JA 3CYFA 1BFUA 1E7SA 2HU5A 3TOCA 4KVZA 3WDSA 5HK9A 4KE9A 2MWMA 3ZHUA 2X6WA 1TM4E 3ONYA 2IYRA 1RP7A 5AHXA 4ZALA 1HEUA 4C4OA 1UKAA 2H51A 4D6YA 2NPOA 3AETA 4DWWA 4DCSA 2VWHA 2BEJA 5EL0A 4KPGA 1UBRS 1OJ7A 1M2GA 5KVQA 1G60A 3H2HA 3ROZA 4AWXA 2C5BA 2RGEA 3DMYA 3MBKA 5AVZA 3VI3B 1YS6A 1CWUA 2BGUA 2HF8A 1JPUA 2WM9B 2ZBPA 4L1KA 3UVEA 4F3NA 3CXUA 1MDBA 3FWYA 3GARA 1CEQA 1TQ2A 3JTMA 4R98A 3GT7A 5BSRA 3TQHA 1V8ZA 2HO5A 3A7DA 3GFPA 3OCCA 1JH8A 1KSGA 4TS9A 4K6FA 1PQUA 4QYTA 1KEPA 2UYHA 4OPVA 5D85A 2PSHA 4IVRA 4ZT3A 1VQ1A 3ADPA 5K2MA 1ZZEA 4O5AA 4X24A 2BGWA 2OZVA 3ACBA 3F49S 1UXGA 2WUEA 2B7LA 4BP9A 5CJJA 4TT3D 3BGWA 3VZQA 2JRCA 3EWAA 1PEDA 2Q9BA 1SM4A 2KQUA 3R8CA 4S05A 5A5DA 4RU1A 3IBYA 1Q21A 3WOVA 4Z4CA 1M3SA 1EQAA 4E13A 4J7CA 3Q3IA 2VSFA 3EH2A 2QP4A 3REOA 2GB4A 5EJFA 3AX6A 4BUCA 1XN1A 4EB6A 3M2TA 2DZDA 3A9CA 5AJXA 3CIFA 1PV2A 1KARA 2VPTA 4JL5A 1ZK0A 1IIRA 1YOVA 4YWHA 5HBGA 1FFSA 2PNJA 4AECA 4C3UA 4YJHB 1GD1O 1A69A 1XRRA 5FOSA 1DARA 3AR3A 3HM9A 1W0CA 4DM3A 2GVDC 3ZI4A 1DJLA 4HE6A 2JA1A 4RF5A 2FEPA 3TQTA 1EDZA 1YXMA 1Z0KA 3PKZA 1YFKA 3X1YA 4UQOA 1P4HA 4C7BA 2DUMA 3T9EA 2O8FA 1KI8A 4KLZA 4CXMA 5AKXA 3V2UA 3JVEA 4MCJA 4LY9A 5M3BA 3HMKA 3UT0A 4RVDA 2CNWD 3BCHA 1NV8A 3GFFA 3PPYA 3A7EA 5JC1A 1D2CA 1SCAA 2E85A 1BEUB 1N6LA 3Q9SA 4QAQA 3M4JA 1E99A 1XYVA 4G56A 4O4IF 2ECKA 2Z9DA 4YBZA 1ZWKA 2V98A 1JEEA 3AM4A 3BFJA 1NLFA 3JASA 4WWVA 1Z07A 4FFRA 4BGVA 2AOVA 2ATVA 2CLDX 3HG7A 2R6R1 5F2NA 2XEXA 4KE7A 2AMLA 3CMCO 4L9AA 5IZCC 2JIPA 1DO8A 4M55A 3R6DA 4C9BA 3JATA 2FMTA 4CMEC 2IHNA 4GDMA 3C1OA 3NYIA 1Y5NA 4IO1A 3PPIA 2QA5A 1U0TA 3KS9A 3NW9A 1H1DA 2WT9A 2FFQA 2QLBA 4FEYA 4P3OA 1X3LA 1LC3A 4DHWA 1OB0A 1DIBA 3RFVA 2X9VA 2JHAA 2Z1DA 3B5EA 1XCLA 4GYKA 1ETHA 1GKYA 2Z8XA 3F8WA 4M1ZA 3SNKA 4O3FA 1JIKA 3WLAA 2W6ID 1ZX1A 5A9SB 3M3PA 3RS4A 4Z4HA 5DU2A 4UAGA 1CJCA 4QYIB 4B34A 4O2AA 1OHHD 3ETCA 4F4UA 1IPFA 4AURA 4YRRA 3UWMA 2DF8A 3HJNA 5FJJA 2EKPA 2W37A 4YCJA 4TV9B 2RHHA 3OP1A 1JI3A 2REBA 4S1OA 3ZU5A 1R6TA 1QVFB 1Z0UA 2OEPA 2F17A 1L5QA 3W2EA 4R2XA 2H9IA 4UNIA 4D98A 3L7DA 1SO8A 1KSHA 4RPCA 2NUAB 1U5AA 4P8RA 2BGGA 3UATA 1CE8A 1UC8A 3GA0A 4ZEWA 1T5BA 1J56A 1XMSA 3QLEA 3B1ZA 1EP9A 1UUFA 3TOXA 3LT4A 2D1RA 5T6MA 1G5FA 3IERA 1ZW6A 1PTJC 2FUG6 3AYZB 3FMGA 2YR0A 3ZGLA 2ZJ2A 3BPSA 3A04A 2P9QA 1SD2A 2QY9A 4QREA 4Y6RA 3ROEA 4BKMA 5IT0A 3PX2A 3NVAA 4N18A 1DO2A 5CB4F 2FDXA 2IITA 3QSGA 3L04A 1T10A 4BKRA 4Q7QA 2G70A 2RH9B 2JPDA 2OCXA 3HDTA 2VUTA 1UQTA 1XZ8A 2N3ZA 3PNMA 3FUTA 3WKDA 3WV4A 1QR2A 5AJVB 4KMMA 2XCSB 1N9GB 1KKLA 5LD2C 2P3LA 1GTL1 3EZ9A 5CVEA 4CN8A 4QODA 1W2HA 2VUHB 2PBZA 3DT6A 2BE9A 2W2MA 5JCZA 1P2VA 2Z1NA 4OYHA 2GJ9A 3SNHA 1BWSA 1BHQ1 1C29B 3NHRA 4L7QA 3RE1A 1Y3IA 2DG2A 3IVCA 2I9PA 3G0IA 1AV6A 1T6BY 5J40A 1G18A 3ASSA 3F2IA 3K9HA 4DXAA 1Q0QA 1FNSA 1TK3A 4P3KA 1PKEA 4HYTA 2Q5IA 4PZ9A 2RGBA 2ATXA 1IH8A 1EGHA 2P9BA 1NAIA 3HUEA 1A72A 4JLOA 4MLPA 4KN8A 1FL9A 2X4LA 2GDZA 3A6LA 1MB0A 5JSZA 1L4YA 5DI3B 1S6YA 1J9ZA 1I2AA 1RPAA 4BMNA 4CM4A 2BSAA 3C8MA 2NP6A 3CRQA 4U7GA 5C7LO 3VR2A 4AW9A 2GD0A 3WV5A 4YAFA 1EVIA 2IOQA 3FDZB 4IGFA 2Q5CA 1BEZA 3J81k 1MF7A 4HAXA 2PO5A 1P73A 4PG4A 4UDOA 1UQRA 2PZMA 3INYA 5F78A 3T9CA 4BNTA 2GNOA 1FSPA 4IOJA 3JR7A 4G86A 3ZE0B 4C2BA 2H57A 4UTXA 1GSOA 3ILYA 3X1WA 1ULAA 4UTRA 1PD1A 5G2OA 3H9JA 3W8FA 5BY2A 4DCGA 2PUFA 3V7YA 3OJCA 3VO8A 4WJZA 1HE3A 5G4LA 4F91B 2Q1YA 1LV8A 4NCNA 3OI7A 3IAHA 1YHQB 3FFAA 3FLBA 1RKBA 1VYVA 1XDWA 1B0UA 4RM2A 2XDYA 2ZRGA 1NP7A 4IDGA 4C1BA 1Z28A 3N86A 4J03A 1OREA 1IOWA 2CHVA 4GQNA 4Q3NA 3S1AB 1UPBA 1OWLA 1XCPA 1GG5A 2FN9A 2PX3A 3IBFA 2NU8B 2FPGA 1X0VA 4KQIA 1PK7A 1R8QA 1PWZA 4AI6A 4JGGA 1JECA 1KRHA 1EB9A 2I4NA 1VG9B 5ECGC 4D3ZA 2JIZA 2E7ZA 5CLHA 2LIVA 5TQJA 3TZKA 4AD8A 4NV3A 3BHMA 4TLLB 4EDFA 1X38A 2J3HA 2V7BA 3DVRX 3L7OA 3TL3A 3SC2A 2CMGA 5CVUA 1TCCA 3B70A 1IL0A 3H4MA 1HY3A 3DEIA 1E1LA 3ORQA 3SBDA 3TQSA 4MDHA 3L8GA 2FKAA 4MYHA 1XA4A 2K7ZA 2CNKA 2R2GA 4IEEA 2VYVD 5CP8A 2QA4B 3RDPA 4JUBA 4QPZA 1P0CA 1UF9A 1T8UA 3ETGA 4HGRA 4JMPA 1RXEA 3O90A 1T4MA 4KO2S 1J2TA 4BWFB 4MJ7A 1X7ZB 3ZBPA 1RDFA 1SQFA 1WTAA 1OZ0A 1HT3A 3LX5A 1E8MA 1UINA 4Y0VA 2HV8A 5KZMB 4LIPD 3CB4A 4KP7A 4S2UA 3SBXA 2CMDA 2EIHA 3JARB 2VPPA 1Y81A 5BW4A 3WBBA 3OEHA 3AIIA 2VYCA 3CSSA 5LLSA 1QLJA 1Q57A 2P0YA 5D01A 5IJAA 4LSGA 1XRJA 4N7BA 1DHRA 4RF3A 4AX8A 3I9FA 4M7WA 3VBEA 4BE7B 5ICFA 2UXCB 1SXHA 1ZI6A 1W88B 1QIIA 1QFZA 1Q0TA 2VHQA 3AOEC 2F48A 2AFVA 2PU5A 1L5YA 1Q17A 5JNWA 4LHZA 1H2EA 3TQCA 2VTBB 5FBQB 2Q2WA 1PF7E 3WRXA 3IP6A 2G63A 3DL0A 1WCWA 4D9HA 4FQ8A 1KEKA 3H2KA 1NVDA 4BJHB 5JXWA 3A8KA 3QU4A 2GN8A 4AICA 2WR8A 5LC1A 1G8YA 5CPFA 2GTPA 3KYDA 3OIVA 1VLYA 2EGGA 5FWAA 5ERXA 3B9BA 5JMOA 4H35A 4MIYA 2WUDA 4LSMA 5D3QA 2IWRA 4WFQA 1Y6QA 4IMRA 3ZGNA 5ISMA 4B6PA 4IHKA 2Z1MA 4BQIA 3UGTA 2FRDA 3BIJA 3HYNA 3SLDA 1HXHA 4REQA 3IR7A 3RGGA 1DJOA 1QYVA 1J00A 4ZAWA 1DKQA 2OFOA 4R6XA 5I8ZA 2WKSA 2PM8A 3E22B 4M99A 3DR5A 1WB5A 4XLZA 4BO5A 4X7CA 1NVXQ 3G3EA 4MULA 4WESB 4Q4LA 2GSDA 2H29A 1FUUA 3T7EA 3UFXA 1L5HB 1Z0JA 3IULA 3E05A 5FTWA 5FX2A 2OTLB 3RG8A 1J21A 4BB6A 3DBHA 3R0ZA 3MB5A 3VQTA 1QUFA 1E4VA 1UK8A 2QW0X 2VCEA 4U6QA 5IDXA 3DDHA 4N6OA 5CVVA 1QORA 4CMJA 1DIOB 3ZD7A 3IT3A 3S2YA 3NRJA 2E5WA 2VPWA 5EE0A 1BDIA 2Q3FA 3IVAA 1AKRA 4LPSA 4BV2A 2CXNA 2A0WA 1ORTA 4OI0A 4Z86A 1ATIA 3DO6A 1LCIA 1R6DA 1XRQA 2A94A 3M0EA 4EW6A 1D1QA 2GF2A 2IXGA 1XTJA 3N74A 3NHUA 4MW0A 3RF6A 3KVOA 3VNVA 3O7WA 4IS3A 3MFYA 1CY1A 2A9KA 3LD9A 4DV6B 1GQRA 5AVRA 4BJ3A 2B99A 1FFXB 2JJ1D 4IZ6A 1SWVA 1T2EA 2PEYA 3W90A 2RB5A 2Y93A 3PVCA 4LVNA 2XKBA 3R6GA 2GEBA 2R85A 1VZ3A 3FCYA 4OREX 1YJ9B 4GVLA 5KNBA 3JAKA 3LYAA 5M34A 2VJIA 1N2XA 2NO0A 2HADA 3H1PA 2PL5A 3PLRA 3T5BA 4ZHQB 4DG9A 1UBHS 3TSWA 3BBPA 5FV7A 3UC5A 2JJQA 3EQ6A 2DTEA 1SXJB 1HG0A 3HCDA 3S4YA 4UUPA 4NG5A 3TZ6A 1OAAA 3HUTA 3P26A 1NBIA 5KSWB 4Z49A 1NG9A 5GJBA 1RQPA 4J7XA 3O8NA 4JVNA 3R7NA 1NRKA 2EKDA 1C7FA 3L1HA 4K46A 5FOTA 3W9YA 1HBJA 2HSDA 1PX0A 3DVAB 5JO9A 1HE2A 5B64A 5A7GA 1P5JA 2ASEA 1WF3A 1QVAA 3UKDA 5BSYA 1BDJA 4AMBA 4KN5A 5IAOA 1DAIA 1GA1A 1UPTA 3PUIA 3T61A 3KD3A 4ZYTA 5CD9A 1XZQA 5BN3B 3DLCA 1JHUA 3WK5A 4MLDA 4EUNA 3JXEA 1QNFA 5EP4A 1N77A 4YELA 1XCOA 3THOA 4KVGA 4CLRA 4DJFC 4QFDA 2EIXA 2TECE 3BFXA 3H4TA 2SECE 4IWXA 4Q1AA 5AIAA 1QPBA 4HHEA 4M0PA 2BM8A 3U2QA 4LMRA 2V45A 3L8YA 4A2WA 1U4SA 4PSKA 1GAXA 2O2DA 3W4JA 4CM8B 5CX1B 5B7GA 2V97A 3HZRA 4UBLA 3GGOA 1PJ3A 3CX8A 2NSDA 3K5WA 4OFBA 3ASTA 3RAFC 1SXQA 1DLJA 3EC7A 2OYSA 2ZE6A 1XRPA 4IHQA 4LXUA 4LXTA 1J39A 3M83A 5SV2A 4FM9A 4BIIA 3IAS6 1K7YA 1KXZA 1C41A 5TQVA 3NG1A 1JAZA 1Y4UA 3TM4A 2NUTB 3KFLA 4IDEA 4YCAA 2FJPA 1OCEA 2ZIWB 2AVDA 2K5UA 1XNHA 2FPIA 1MTOA 2GCIA 4NU5A 3ZDAA 3DAGA 1BXGA 2GX6A 1TE2A 5CDFE 2QN8A 1H2YA 3GNLA 4DILA 5ICEA 4UZEA 1RI2A 3PGXA 4G7WA 3NKVA 1ZM9A 2J4CA 4GWGA 4H6XA 4Q66C 2JASA 1IHUA 3H2IA 3KNZA 3ZCVA 4GQAA 4C20A 4K03A 5TT0A 1RM4A 3GH1A 1TAQA 4Y0AA 4NCJA 4OSOA 4P08A 1Z74A 1W25A 4HDAA 3TVTA 3UJ9A 2H2DA 4A0QA 3CCBA 1AOXA 1ZMTA 2VDKB 3P0EA 1P80A 1H69A 3RS5A 3OAAA 4HRAA 3AY7A 4WKOA 1CUYA 1WVMA 2DWQA 5LKRA 4MS4A 4F96A 3KR9A 3KWJA 1AE1A 2WM3A 3RUDA 1LUAA 1AQYA 1CQIB 2WPDA 4BV9A 2QSJA 5GINE 1DKLA 2B7CA 2GILA 2NV4A 2HV9A 4JJIA 3WO0A 4LDZA 5AK4A 2R11A 4QHSA 1CUEA 4LRQA 2XZLA 1QYDA 2VOJA 2WF5A 3G5TA 2GA8A 4JSTA 3F5FA 5KKAA 2XSZA 3W6PA 4DV7B 3Q7SA 1FDVA 1H0SA 3RBVA 3U39A 5K20A 2GM4A 3RIMA 5HKKA 1FU7A 4I4TB 3AGQA 1BHSA 4Z9YA 2XX3A 2QYHA 3BMCB 3ADKA 3HM2A 4Z4QA 2XVZA 2FMIA 4IEFB 4X91A 3ONEA 5AH0A 4AS1A 1KNQA 2GAJA 4QXAA 4GICA 4KK4A 2OAEA 1H42A 1N3LA 1XV5A 4WK6A 3VR4A 1CY7A 4G0YA 4X8LA 3MINA 4EKEA 4EG6A 5J1SB 4ZCQA 2Q5LA 1DBPA 1T0HB 2BC9A 1FS6A 3B1WA 3EGEA 4O1IA 5TX7A 2M6LA 2GEVA 3UZUA 2P9ZA 3CW2A 1XJWA 2GAOA 1LBQA 2EJBA 3FZGA 4YJ3F 4KR9A 4C0HA 2X15A 5EHZA 4R8LA 5ICCA 3LH5A 1XDZA 4MQEB 2EJUA 4RZ3A 2ZANA 1QVZA 4WZBE 5HJ2A 5BUQA 1QX3A 2ZITA 4L4UA 3VR3A 2K6GA 4JI6B 5C5IA 3U61B 4XL9A 4KPUA 7MHTA 4KJXA 3DHNA 3O4IA 1HR0B 1YKGA 2GYWA 1C50A 1T29A 3LUFA 3BGOS 5K3FA 1CUBA 1VIDA 4WD3A 3EPKA 3FNEA 5CK4A 1EHIA 2LP4Y 4L6AA 3V8QA 4CQLB 1PZGA 3AUYA 2X23A 2L18A 2YFKA 3N2NA 1VC2A 2YWFA 3QXGA 1NUUA 1MUUA 3HU3A 1N8RD 2H9YA 2ADMA 2PKRA 2XWSA 5KTPA 1D9ZA 1JN0A 4MWBA 2F8MA 1RAIA 2WSSA 5DH9A 1SELA 3REQA 4KJZA 2Y9MB 3UXEA 3ZZ1A 2J5RA 4DSUA 4DLPA 4JYAB 3UPTA 1IJBA 5T8KC 1U8EA 2P27A 4BCCA 4FN5A 1TA4A 2W4QA 2D1TA 4XCXA 1IHOA 1R0ZA 1RAHA 4GPAA 1Z0IA 4KUGA 4MW4A 3RNOA 4ZICA 1JIUA 1LBSA 4JBNA 5C34B 5IEJA 4P32A 3HCPA 1PNVA 1WXGA 1STOA 3OCUA 3D8UA 1FUYB 1Z15A 3K6JA 4IIBA 2V4ZA 4TTSA 2PS0A 5C3MA 5GZ1A 3R8FA 2OCIA 1K89A 2C3OA 4IRMA 5TDHA 3OLVA 1Z0AA 4AYXA 4JLSA 4DJEC 1Q1AA 4CR8A 5J47A 3QPUA 3R5FA 4LHVA 3RC1A 1SUWA 1MJHA 4QTTB 5CPBA 2C83A 1MAVA 4UUQA 2X1HA 1XL0A 3RS2A 1QG2A 2ATEA 3C48A 3HV2A 3ELDA 2WVJA 4MVYA 2AJDA 1BW9B 3OTQA 3V80A 4TXMA 3LAWA 2GFHA 4XW2A 1EWQA 4BMPB 3AHFA 1IB6A 2PSDA 4DABA 1VECA 1ZEJA 3K1YA 2BFDB 4MWDA 1H1LA 1CUHA 1RMTA 3PTZA 4RA6A 1UK9A 4L9RA 2AWNA 2X19A 5ALIA 5F5LA 4KW7A 2ORIA 4Q3OA 1BRTA 4C6RA 1XQ1A 1Q81D 2Z6QA 1SUCA 1JBQA 3L0CA 4PRKA 3M9LA 4P35A 4WCFA 5DLQC 4B17A 2VPQA 2KX7A 1M34B 2OO7A 2XMSA 3VTFA 3GG9A 5J2TB 2R44A 1L2TA 1CQZA 3DV0A 1W7AA 1DELA 2WIDA