1KK2A

Structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdp-mg2+
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
405
structure length
396
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords eIF2gamma
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
total genus 97
structure length 396
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk2A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk2A01
4GOKA 2DCUA 1UBFA 3FYHA 2LKDA 4UXIA 2D74A 1VG8A 1XCGB 1FOEB 2CCJA 2PX0A 1I4DD 1UBGA 4CW7A 1YE8A 3B82A 1E1RD 4YAWA 1NP6A 5EUMA 2VNKA 1UBCA 3PJRA 1E1QA 2JLYA 5EP4A 3VHLB 3SC3A 4AYTA 2ZI6A 1NBMA 1W46A 2WAYA 2ZI4A 4IDOA 2QE7A 4C0HA 2ZE7A 3U4QB 3VO2A 1YHQB 3DL0A 2N46A 3TMKA 4B6EA 3TJZA 5A5GA 3PFIA 2CLSA 2ZYWX 2ZU0C 5KSYA 5KHOC 2CCGA 3U3JA 3CB4A 821PA 3RANA 1FNMA 4ZPXA 4Q7MB 5HKKA 2ZJYA 1QVAA 1W4AA 1P73A 2CK3A 4EQ6A 1S9HA 2UZIR 1JQLB 4Q9IA 3A37A 1MT0A 1NN1A 4ZCIA 4G5QA 4QJ5A 3NTUA 2R8RA 5AUOB 1FP6A 1KI2A 1AMOA 2HDNB 3K09C 1JXOA 1U9IA 4BWYA 1IN5A 1W0JD 4MKFA 1VQMB 4RFSB 5EZ5A 4GP6A 3QVVA 2Q9AA 1E1RA 1XMJA 2ZRFA 3FVQA 4NZYA 1G41A 3CPJB 4QGGA 4TLAA 4UNNA 5FOTA 2XNJA 4ZI2A 1TEXA 3H4MA 2QTLA 2VLIA 3IHWA 4HAUA 3RABA 2WKQA 2F1HA 2QPTA 3ZD6A 4ACAA 1E9CA 5CK4A 4Z8XA 1EGAA 1O87A 2QMEA 2ZU6A 1IHUA 4JJKA 4R98A 4B33A 2OESA 1M8PA 1MO5A 2GJ8A 1DEKA 1AS2A 4EJSA 2IYSA 1BX0A 3HYTA 1E94E 5K8UA 2EVWX 2WIAA 4KAXA 3RNLA 4L8GA 1GNQA 1ZINA 2CXXA 2GESA 4FIDA 3U3MA 3W5IA 2FJUA 5F2EA 4D25A 3F8TA 4XWOA 3C7KA 5H68A 4DIDA 5CIWA 4F92B 4HLQB 3ASYA 1YI2B 3PUXA 1FZQA 1WBDA 1AJEA 1ANKA 1RRFA 4LBZA 2OBMA 2QAGA 1U8ZA 4HZIA 4B76A 2BHRA 1G8HA 2FZ4A 2JAQA 2OHFA 3D8BA 1GFIA 1I2DA 1PJRA 2F6RA 1A5TA 4PPQA 1PLLA 1I4LD 1XJCA 3E5HA 1YR6A 3PXGA 5JCZA 3L8YA 4JLBA 1II8A 1S3GA 1AK2A 4HAXA 1G291 1E9SA 5DI3B 4BRWA 3NG1A 1YKSA 1IN4A 4EFLA 4MA4A 1ZCAA 4LV8B 2CVHA 1Q57A 2OEPA 2HLDA 2ZRDA 3IQWA 1EX6A 1N0VC 3A36A 3KKOA 2GXUA 2IHBA 2RMKA 3LQQA 1OXVA 3A58B 3DKVA 1LW7A 2QTFA 4Y9RA 5E7IA 3T5GA 3VKHA 4UXHA 1AS0A 4B3GA 1MH1A 4I81A 1D2MA 4D4JA 5FBQB 2O8CA 3SYNA 3QG5A 1Z6AA 3LY5A 2WOOA 1N0WA 4IFEA 2KE5A 4YDHB 4X8LA 4D82A 4JVSB 4Q7KA 2C96A 4S35A 4K1XA 3BD9A 3OIUA 3SS8A 1DOAA 2KJQA 1VQ6B 2ZUCA 4CT5A 4V02A 4TMVA 2ZJAA 1P2VA 1EFHA 4NYMQ 3CIOA 5DSZA 2ZRLA 2F1RA 4Q9KA 4TYWA 2W83A 1HE8B 1E9BA 2ODNA 1E0JA 3C5HA 1U81A 3C16C 3TQCA 5HCIA 4EUNA 8OHMA 5EXPA 3AKYA 5BN5A 2NZJA 1VQLB 1R0WA 3CRMA 2E87A 1BH2A 1R2QA 2WWXA 4DSTA 2GNOA 5FH9A 3OEEA 4Q1AA 4JLVA 2V8OA 3N2EA 4ZIRB 1SHZA 2VYFA 4KXFB 3ADKA 3ZIAD 4D81A 3NWJA 1A2KC 1CNEA 2ECKA 2NO0A 5GVRA 3TAHA 2FF7A 2FV8A 4Q02A 1Q3TA 1OPXA 5GJCA 3UANA 5AJVB 2FSHA 1N6OA 2VSXA 3TVDA 4DQKA 1KHTA 1HE1C 1Q0UA 3FGNA 3BB4A 1Q1QA 1Z0JA 2GVZC 2GKSA 3L0SA 4G01B 3EZ2A 2NOAA 4JLJA 4AG5A 2B5OA 1JPNA 4ZKEA 3CMAB 3SJAA 4R71A 3W2EA 2ASEA 4ASUD 4BZPA 4LYAA 4X8HA 1LV7A 1OB2A 3KB1A 5J47A 1EESA 1Z6GA 2VTKA 1G18A 3K70B 4OK6A 2IS4A 2Q6TA 1PVOA 2QPOA 1F2UA 2OTLB 1ZNXA 3ZIAA 2A5JA 2YC2C 1OIXA 1FX0A 1Z0IA 2HEIA 4KFSA 3CH4B 5KYKA 1Z07A 4ZDIA 1RE0A 1FMLA 1NVUQ 4PPFA 1NY5A 2QQ0A 3FFAA 3KL4A 4Q48A 2BKUA 2DHRA 5TR9A 4MRNA 4DSNA 3EIEA 4A4DA 1FNDA 1SKYB 4QHTA 1QHNA 3B13B 4JIMA 3PEVA 3AKDA 5AWFC 5E3HA 4DCUA 2WPDD 2W0SA 4ITRC 1RIFA 3RRYA 2IYQA 1UKZA 1T3LA 3U5ZB 1UKYA 2HJGA 3I32A 1QHHB 2BVNA 4RCZA 3LAWA 4QJ3A 2A30A 2OCAA 3KDSE 5IT5A 3KKPA 2VF8A 4RZUA 2B21A 1CULC 2CCKA 2VZLA 3GLIB 1YR9A 2XOKD 4KCGA 5FI0B 4NH0A 4LDJA 1YJ9B 5GVSA 1S1MA 3W2HA 3K0FA 4TT3A 3RHFA 5GV8A 2D06A 4XJXA 4HE5A 1H8HD 3W90A 1II9A 4QNRA 4HAWA 2A9KA 3ND9A 3TRFA 4TMWA 1J2JA 3A8TA 4NCKA 3EW9A 2GDJA 4IKEA 3K0AB 4Q9HA 3LBIA 4XSGA 5J4VA 3FJOA 1PLKA 2CHVA 4O3MA 3KTAA 1B23P 2QRZA 4PAQA 4XVUA 4W9MC 1V5WA 1YRAA 2GZHA 1OFHA 3K09A 1W4RA 1XTRA 2BMEA 4NYIQ 4XD7D 1KRHA 1P2SA 1ZYUA 4P3YA 1NIPA 1TU3A 2WPDA 4LSGA 4DVGA 4Z51A 1Q12A 1U2RA 3LLUA 4Q4HB 1E64A 1SKYE 3HJNA 5LB4A 2ZR0A 1X8JA 1EP1B 1VYTA 5TXGA 4B3CA 5LD2B 1ETUA 1QHGA 2VIIA 4Y0AA 4BQSA 1KIMA 1OSNA 2WHXA 2EFEB 3HU1A 5TB5A 1IXSB 1CIPA 2FU5C 5E4FA 2RGBA 1TF5A 4QBIA 3JQQA 4A82A 4D6PA 3B9PA 4DSUA 5JSZA 4KLZA 3WP1B 4NCNA 2R6HA 4JLAA 1B2RA 4UNPA 2RGNA 4IOLA 1F60A 3GLIE 3MFYA 1XTJA 2WM9B 3E20A 3GLHA 2R44A 2J1LA 2P5TB 4D2IA 1F2TA 2ZE6A 3EC2A 4JL8A 3K9GA 4D0LB 4M9ZA 2GAOA 4DJTA 2BKEA 5HE8A 4O25A 3TBKA 2FFQA 5AR1A 1G17A 1RJ9B 4AG6A 2I1QA 1XCMA 3UK6A 4XD7A 4F4CA 4G1UC 3CRRA 3UATA 3RC3A 5K8TA 5HZKA 3CRZA 2CBZA 4URVR 3P4YA 3PEWA 1K6MA 4YAOA 1P75A 2CVFA 4Q9JA 2GJAA 3ICEA 1L4YA 1DAKA 1E2QA 2NPIA 4D4LA 2OXRA 5H59A 1AN0A 1TEVA 4IVPA 4BLRA 1H42A 3SJZA 3FDIA 4ARZB 4ZCLA 2RAPA 2YKGA 4A8JB 4Q21A 2AWOA 2AXNA 2ZAOA 2ORVA 5EMNA 3RRNA 1GG2A 2YOFA 4Q4AB 2FSGA 4BASA 2VQSA 2F43B 5EE5B 3QFTA 4F93B 4POAA 4CEHB 1NKSA 2QROA 1NN3A 3CM0A 2JJ8A 3QF7A 1XE1A 2RB4A 1IXRC 2B7CA 1KKLA 1HT2E 1X1SA 2GEUA 4FI3C 3FHTA 3RSOA 4A2PA 1KY2A 5DHFA 2W58A 3VKWA 1E2IA 1Q82D 1T5LA 4CYMA 2GBLA 3HU2A 4WA7A 3K8YA 3A4MA 1VQ8B 3CKLA 1SVMA 1GO2A 3JVUA 2XSZD 3GPLA 4P4TA 4QRHA 1W47A 3CNOA 3BE4A 4P0TA 3AVQA 2CJWA 4PANA 4D0NA 2QP4A 4Q4JA 4D4MA 4BFWA 4PSVA 4MYHA 2ODEA 4M1SA 3IPYA 4EFMA 1ZJ6A 4X8OA 1VCOA 1COWD 4OQLA 4V0OA 4AWXA 3G6EB 4PR0A 2WJJA 3RVBA 2YYZA 2QRNA 1AQUA 4PSKA 3MAAC 3L82B 2E9SA 3B85A 4AI6A 1J99A 2C9CA 1Z0FA 4ERNA 1XD2A 3VTKA 421PA 2V9PA 5CDFE 1Z2AA 3GEEA 4G5GA 1OYWA 5C1BA 3I73A 2AHOA 1Q1BA 1RRCA 3QE2A 2WSMA 3D31A 2YWGA 2XX3A 4B43A 1JR3A 2HXSA 3A1UA 3TVTA 2XSZA 2YNMA 1OGIA 3KKQA 2OLJA 2VHJA 4LPKA 2J7PA 4B2IA 3O8RA 2LKCA 1E79A 4RD1A 2DY1A 3IO3A 4LX0A 4X8MA 4JVMA 3ASZA 1KQSB 3ADDA 1CRQA 2IUTA 4GZMA 2H1LA 4B3FX 1QG4A 4W7SA 3R9XA 2BIFA 2ATXA 1A7JA 3GMTA 2AFHE 1COWA 2IYRA 2O0HA 1WDTA 3AV0B 2BBOA 2Z83A 3ZH9B 3SQXA 4EDHA 5CJ2A 4URXR 2PCLA 3GLFB 3AF1A 1IB0A 4AF6A 1EFCA 2A5YB 4IJMA 2WAXA 4ZV4A 2FH5B 1N0UA 2RGGA 2F3TA 4W5HA 3JQPA 4AK9A 1G20E 5EP1A 1GRRA 4RKFA 4JSYA 4XWKA 4L9WA 1S96A 3K0SA 3G4SB 3BB1A 2DB3A 1R0YA 1RW4A 3CO5A 5KSZA 3FMIA 2BJVA 2EU8A 5JWOA 2IEYA 2OXCA 3KKNA 1XMVA 2A2ZA 1NRJB 3PIRA 4BLQA 2FFAA 4ZDJA 3X1XA 2G83A 1R8QA 4QGFA 2IC5A 1BS1A 4YHBA 2MSDB 1GP2A 1GOTA 1SVLA 1YQTA 1E62A 2ZE5A 3EZFA 1KNXA 5G3YA 1FL9A 1Z2CA 4IOKA 1GIAA 3T1OA 1CS4C 4HLDA 4LY6A 5JS7A 3LV8A 1G6OA 1YZNA 3SR0A 4Z1MD 2N42A 3FPAA 4LUCA 1OH7A 3SI7A 3LQRA 2CLDX 4L4UA 4AKGA 4FXPA 5AK0A 2FGJA 5AJYA 1GVHA 4TYYA 1YJWB 3BS4A 4V0LA 3UKDA 2ZM5A 3U7FB 3H0KA 1ZIOA 3UXMA 5BQ5A 1Q3HA 2QN6A 5BWMA 1U98A 3GLFE 2L0XA 1N5LA 2WMOB 4K46A 1Z63A 1G9XA 3PENA 2O8EB 3DM5A 3HU3A 4QNMA 4IDNA 3PG5A 1XEWX 2V1UA 4FMCB 4JLOA 5G40A 1E2KA 2X2EA 2ZS9A 3HDTA 3W3AA 3JVVA 3UWKA 2QBYB 3B7GA 4EJSC 4YLGA 1G7TA 3QXXA 4U5XA 5SZIA 2ANBA 4LHVA 3RS7A 4Z1MA 3GJ7A 5IRCD 4AKIA 1P3JA 1U99A 2YWFA 3S1AA 3CH5A 4DC9A 5G41A 2HCJB 4QC2A 2IK8A 1CJUC 1IJEA 1GKUB 4OI2A 5LBIA 4WXRA 2QMUA 2Z0MA 2BMJA 3MWKA 4S2EA 1SQ5A 2QAGC 3EA5A 3Q85A 2ZS7A 4TMTA 4WZ6A 3ZQ6A 1QF9A 3QKUA 4FMBB 4GZLA 1R7RA 1HY3A 4W5JA 2OCYC 3AH8A 2O5VA 4LC0A 1TU4A 3GJ3A 3TUIC 1RYFA 3AVYA 4B32A 4A1FA 4CRWB 1IONA 1NSTA 3T5DA 1J9ZA 1XRJA 4OL0A 1U0HC 4GOJA 4JVLA 4R9UC 1LY1A 1HURA 1WE2A 1ZU4A 4WZAE 1FUUA 3QKRA 1UKVY 5EP2A 1OW3B 4PHHA 3W2IA 5BN3A 3QEOA 4ZGQB 5DNYB 3CCMB 2VSOA 1YR8A 1XB2A 1IJFA 4GPTA 3KJGA 3TNFA 1KI6A 4I1VA 3LWNA 1QFJA 4U7DA 2AK3A 2ZRNA 2NMVA 4JLMA 4E07A 3EPKA 1IY2A 1U90A 3BAFA 4K81B 4R2HA 2YWHA 3X2SA 5ELXA 1ZD1A 1DADA 2OILA 2XB4A 3DDCA 4GMDA 3HR7A 2H7VA 3A1SA 3MG9A 4PX9A 5AJXA 1JXMA 4Q47A 5DYGA 1UKEA 1T91A 2G1KA 4URUR 5KO2A 1JA0A 3KJHA 1T9HA 1KTVA 1P7CA 2RH5A 2XEXA 1G5PA 2GEDA 5HPYB 1KY3A 1DO2A 2PEZA 2LWIA 1ZC3A 3NHBA 2ZQ5A 2XAUA 2AD5A 4BFSA 2V4ZA 1YRBA 4CEIB 4UXJA 4HZUA 1W4BA 3W6NA 2R65A 1KZ7B 4C0KA 2HMAA 2O8FB 2CE2X 1OIVA 1Z5ZA 4LJ4A 2GCOB 2RHDA 4LOAA 3GP8A 4TZ6A 1KMHB 1XXHA 3LO5A 4JBXA 4PHFA 4O2LA 4N0DA 1EFTA 2A5FA 2QTVB 1GR1A 4LGMA 4LYFA 2BCGY 2QPAA 3SN6A 1R8SA 1XF9A 2DBYA 5EZ6B 5E7MA 5EJEA 2O8DA 4GSYA 3R7WA 2IS6A 2P6NA 2CEAA 5JBQA 1M74A 1QUFA 3SFVA 4DCVA 1NF3A 4LBVA 3KXIA 5J4KA 5GADl 4UNSA 1DTSA 2GXQA 4GT1A 4URZR 3ZBTA 3NXSA 4LBYA 3RWOA 1CTQA 1SXJC 1N5JA 1ZUIA 2XNCA 3EIQA 3SYKA 2PCJA 5CLQA 2BSAA 3TLXA 1XZPA 2ZRHA 3TR5A 5FFMA 1RVDA 2HUPA 1DARA 5FR1A 1KNQA 3NBFA 4PPNA 1LF5A 1C9KA 4NONA 1W36C 1NBMD 3OF5A 3BH0A 4DB2A 3VFDA 1S1CA 2QE7D 4HAZA 3DPUA 3N5CA 2QG6A 2ZTSA 1DAGA 4B3BA 4HAYA 2PBRA 1KK3A 4A0FA 4GL2A 2XITA 2QENA 3L43A 2DFTA 3AF2A 4DLZA 2ERYA 5HKKD 4LJ5A 4MGIR 2PMKA 3QUSA 1HT1E 4BFVA 1WP9A 5CM9C 4AF7A 4I99A 2ORIA 1RYHA 1AZSC 4MYCA 3QXJA 3IHLA 3KFVA 3G0HA 4IHQA 4LHZA 2BM0A 3AP1A 2OAQ1 4RZ3A 5FL3A 5FOSA 3MCAA 1AKYA 4KFRA 3MUFA 2QDXA 2P2LA 3A6PC 4L15A 1XTSA 2CNWA 1N8RD 2QT1A 5B2ZA 1GTVA 1R5NA 4US1R 1UDXA 3G82C 2EFGA 1W0KA 4LJAA 4RD4A 1PUIA 2G0NA 3K9LA 3OAAA 4DLUA 1OIWA 2MSCB 2AFIE 1XU4A 2ZYUX 1HA3A 1OXSC 2OBNA 4AYWA 2FPMA 4DRZA 3I61A 1NMYA 4BEJA 2IYUA 3OJXA 1TTTA 1ZMXA 2V1XA 2OK8A 4LBWA 3NBZC 4QOSA 3R20A 4JL5A 4L16A 2J87A 4BRUA 3B1VA 2CDNA 2DPXA 1GNRA 3PVSA 1E96A 4LJYA 5F9HA 5C46F 4AD8A 2Z4SA 3B9QA 3LBNA 4EPXA 3W5UA 5F98A 4FCWA 1DAEA 2OK7A 3ZZUA 1QHYA 2BWJA 5FBVB 2B6HA 1M7GA 4XOIA 4QM6A 1AIPA 3ZC3A 2AXPA 4YQFA 1X3SA 4I1SA 2ZYVX 5JWHA 1NSFA 3V9PA 3ONWA 5CLLA 3X1YA 1FUKA 1E9EA 1P9NA 1RKBA 1JNYA 4N0EA 3RS2A 5DN6D 5JECA 1T6NA 1QHSA 4U9UA 2FGKA 2IYTA 3CRQA 2WWHA 4C2TA 1BKDR 2HXYA 4NYMR 1Q20A 3H86A 4OJKA 4M1KA 3V00A 1GL6A 3AQ4A 1IY0A 1VQKB 1L8QA 4PXAA 3L2OB 5SZJA 1TVCA 3U6BA 3WYGA 3DKPA 5UKDA 2HLDD 1ZU5A 5SZHB 4RFSA 3B78A 2BGIA 1Z06A 1TPZA 5BYJA 2GVDC 4Q03A 2RGNC 4WBSA 1K8AD 4MRRA 1N6NA 3HWSA 3QFRA 1DBSA 1FQJA 3UIEA 3I72A 3N2IA 1K73D 1Z0AA 2VNJA 2ZJ2A 3RLFA 3THOA 3IO5A 1OH8A 1G8PA 3JQRA 3TSOA 1KYIA 4KSBA 3MMPA 4QKQA 1PUJA 2GJSA 4MDEA 1F3OA 5DN6A 3W5JA 1KMQA 2VNIA 2ZVQX 4Z54A 1VHLA 2PZGA 1G19A 5JCPA 4KU4A 5CB8A 1H85A 2RGAA 1GDDA 5IDVA 2ZSDA 3W5VA 4JKIA 1NVVQ 4IXMA 4U00A 2JJ1D 1SZPA 1QVGB 4LC1A 4M1TA 4OYHA 3CBQA 1W87A 2OT3B 4CIDA 2BEKA 2Z4RA 1CP2A 1E0SA 2Q3FA 3KQHA 3FOZA 3KQNA 3FKQA 5KNBA 1E2FA 4JYCA 2QA5A 2A5GA 1I7PA 1VMAA 1X8LA 3WYAA 3IIJA 1WQ1R 1GAQA 2OBLA 3OEED 3QEJA 2J3EA 4M1WA 1BJKA 3CXCB 1AGRA 1YIJB 2WJGA 3VAAA 2J0QA 5DI3A 3CCLB 1QH0A 3M1IA 4C7OA 3O8BA 4PPGA 4QM7A 3O47A 2GBLC 4G5SA 1P6XA 1UPTA 1AS3A 5L3QB 2O8CB 2OCPA 4BPBA 1J90A 1Z22A 3NH9A 2REOA 5J40A 1LVGA 3K0CC 1D9XA 1IBRA 1NJGA 1SVKA 3GJ0A 3LD9A 4YMWA 2JJ1A 2AN9A 1SXJD 1T0JB 4HUQB 4LV5B 3U3RA 1Z6YA 1S0UA 3I1FA 4GMXA 1XTKA 3QF4B 1E9DA 4YDSA 1VQ9B 2QI9C 2XZPA 3G5UA 4A6PA 1S8FA 2Q21A 2VP9A 4DWJA 2Q0HA 1R6BX 3CX6A 1W36D 2BOVA 2D2FA 3JZMA 2PMDA 3FPKA 1TADA 4O0MA 2XB2A 4KODA 4D4KA 3WXMA 3Q7QA 5JRZA 2D2EA 1KI3A 1AM4D 2J0VA 3OZXA 4MGKR 4A2WA 1YJ5A 2G88A 1I2MA 3FMPB 1UEJA 1SVOA 3CX7A 2WJYA 2WVJA 3B6EA 4XTCS 4TTPA 1YZQA 1DO0A 1Z47A 1JR6A 2ZYTX 3IEVA 6Q21A 2XZLA 3NVAA 4DLSA 2WZQA 4F4IA 2V7QA 4NYIR 4TMZA 3W2FA 1QZXA 1NLYA 2C04A 3T61A 1GL7A 4KVAA 1SXJA 3DO6A 4IW3B 2B92A 1ZVQA 4ZIRA 4AY2A 1KK0A 1SVWA 3EZ7A 4L5BA 4AKEA 1UJ2A 4KVGA 3BOSA 3R9IA 3W9YA 2ZRPA 4BLPA 2QA4B 1NN0A 1SGWA 3AP2A 4UJ3A 4NP6A 1OXXK 1VECA 4ZGNB 3LW8A 4I4LA 3OESA 1KAGA 4PHTA 3CF2A 3T15A 1OH5A 1CNFA 4H1UA 3T34A 3BFVA 1OF1A 3EAQA 4B73A 3A1VA 4KBGA 4A92A 1KZGB 3VMFA 2WOJA 3EARA 1OLOA 4OKSA 1G21E 3T1TA 5DISB 3CCRB 1VPLA 4TT3D 1WB9A 1FNNA 2GAAA 3LVBA 1J8MF 2FFBA 3FE2A 2QY9A 2ZVPX 1SKQA 2EW1A 4NPHA 221PA 4M53A 3WBJA 2JDIA 4G5RA 1KJZA 3GEIA 3QVUA 2JLUA 3C14C 3HPRA 3VR6A 4WZBE 4ILEA 3WMGA 1FQKA 2XNDD 2ATVA 4CEJB 4M2LA 2AL7A 3SJBA 3W6OA 5F9FA 3M6AA 5B30A 1QX4A 1JJ7A 1IXZA 3TAUA 1Q7YD 1OFUX 1E69A 2DWOA 1OGJA 2C03A 1G8GA 1RFLA 4Q00A 1ZM7A 2QNRA 2CRVA 3MWYW 4YMSA 1JBKA 2GF9A 2PEYA 2D62A 1DPFA 1Q1ZA 4QL3A 4TQ9A 1XJQA 3EG5A 2G1JA 3QXSA 1GAWA 3T35A 2GETA 1F20A 3P32A 2R6FA 2P3SA 4AIIA 3VX3A 3U60B 3QXCA 3T12A 4JMPA 1L2TA 2BJWA 4LRWA 4Q1DA 5JJKA 3SDZA 3B60A 4BLOA 4TTQA 2GZDA 2R6DA 1HYQA 1WBBA 1QHHA 2IHYA 2PT5A 4IOMA 1EWRA 3IIMA 1XEFA 5CK5A 5A4JA 2WIBA 1Z6TA 2XTZA 3GLIA 2XNDA 5BW8A 1GILA 1E6CA 3W3ZB 2QM8A 3LVRE 4HSEA 1GNPA 3AUXA 4OBEA 1CJTC 1BO6A 4C0BA 1P72A 5KTYA 1H8ED 2W2XA 5EE0A 2RKOA 4DDVA 1KI7A 5KSPA 1G7CA 2NG1A 2QORA 3KXKA 1UAAA 5GJWC 5FPHA 3GJ4A 1RRPA 4V0MA 2IS2A 3V76A 4Y0VA 4JS0A 4P31A 4FCTA 5L8VA 1TL7C 3ZJYA 2JLXA 1MABB 1FMJA 3OEHA 3QSYA 3LDAA 4XVRA 4RCYA 4MITA 2R2AA 4C0QC 3QFSA 1W49A 4Q4HA 3CD6B 3AF0A 2YV5A 4NCHA 3REFA 4FW9A 1K9MD 2KWIA 1YR7A 2JLRA 2GQFA 5KUTA 3REGA 1M7BA 3UG6A 1FNBA 3AKEA 1VQNB 2ZXUA 2NO1A 2IA5A 4PTLA 3RSLA 2ZRMA 2PIAA 2HJVA 2WV9A 3VU9A 2GXAA 3MLEA 2OSBA 4PC1A 4XH9B 2GPJA 1H8EA 3QXHA 1XEWY 2V55B 2V6JA 2BGJA 2WKPA 3IDQA 5J4LA 4QFMA 2NQ2C 1ODFA 2WTUA 2TMKA 1KSFX 5FOUA 3NEYA 4C0LA 4PC6A 2ZSBA 1ZCBA 1MO3A 5GV7A 3R8FA 5JJIA 5JI2E 3WMEA 1QFZA 1L7VC 4PZZA 4E09A 3MJRA 4IDQA 4NHOA 4HATA 5FTMA 5JLJA 2VHTA 1KK1A 3NKVA 4EIWA 2NO9A 5KOYA 1Q1EA 3OIYA 3TW4A 4JBYA 2O8BA 2JLZA 1R5BA 3DOEA 5K8LA 3LNCA 5FR2A 4KO8A 3OFNA 1GZSA 2O0JA 4EPTA 4ARZA 2ZJBA 2JIZA 1TUIA 2WWIA 5BXQC 1W4CA 2EQBA 1NJID 1DAIA 4P4SB 3HPQA 3LLMA 5HR5A 2EWWA 5CDFA 1DAHA 1JR3D 4NMMA 5DLQC 4C0SA 1E9RA 4MDFA 2F43A 4N3NA 2J7PD 3TSWA 3MHPA 3CC7B 1E79D 1YHNA 3FHOA 3SE0A 2ZAMA 4NCIA 1Z0DA 3K0CA 3VX4A 1Z8FA 2Q3HA 4BFTA 3ADBA 4AC9A 3PEYA 3OIVA 4DCTA 3KQUA 2QGZA 2WSSA 5HE9A 3PUWA 121PA 3AB3A 2WBLC 1M90D 2X3UA 1XPUA 2C95A 4FMCF 3KQKA 4H1VA 4EPRA 4TN1A 3GFTA 5B58C 3THWA 1Q21A 4A9AA 4F7DA 1VCMA 1XD2B 2QGNA 2ZRCA 4M8NE 2H57A 2Q3MA 4RY2A 1KJYA 5GJVC 4BLTA 1CF4A 4F4JA 5EXXA 3IUYA 3OZUA 2YC4C 3MGCA 2GRJA 4R7ZA 1QUEA 2KBEA 5H8WA 2JASA 3KUDA 3TE6A 1VQOB 2VO1A 2Z6VA 1US8B 3EZ9A 2ZS8A 4YXWA 2QT0A 4RD0A 4WAUA 4E22A 4DLVA 3QKSB 3THXB 2IYLD 3PITA 4MQBA 2JCSA 3RRMA 4TTRA 1EG7A 2MMCA 2FFHA 2OG2A 5FTNA 3EIHA 3DMNA 4Q9LA 3RS5A 5KU1A 2IXFA 1E9AA 3I92A 4DBLC 3QI2A 4FWIB 4HB3A 5FTKA 4NTZA 3TUJC 3CR7A 4CVNA 1G8FA 4JT4A 1N6PA 4JZKA 1TX4B 3U3OA 4HDQB 2ZETA 1Z28A 2BMDA 3NDPA 5TMPA 2RGCA 1XNJA 5FBLB 4BFZA 2RGDA 5TY0A 3H1TA 4Q1FA 1GUAA 4KV9A 4RD6A 4LCBA 1HQYE 1II0A 3BORA 3KXLA 3QQ5A 1T8TA 4FMDB 4DLWA 3W34A 2P6RA 3LXXA 2VPPA 3WNCA 3GLFA 3LVQE 4A6XA 2ZJOA 2H5EA 1C4OA 3X1WA 2GXSA 5JFGA 1O3YA 5FUVA 5FL7A 1A82A 3GLGB 4MKIA 4DDTA 2IS1A 2VBCA 4B34A 1IM2A 2YINC 2VL7A 4GFDA 1E2JA 2KB0A 1W5SA 3AGQA 1S2MA 1Q81D 4ABYA 1XX6A 2JJ2D 3WMFA 2D7CA 4KSCA 2NPFA 1KDOA 3AGPA 3CCVB 4DLTA 1CR4A 4TLCA 1S3SA 4OI4A 1OE0A 3IQXA 1EFRA 3SBEA 4NBSA 3CUEF 3PUYA 4UNQA 4I1UA 1N5IA 1FW6A 1MRNA 2WJVA 5FOVA 5IK2A 2QQEA 1DG3A 3ZS9A 4QBFA 1F5NA 2FSIA 3OZVA 1BX1A 1KC8D 1M1YE 3GFPA 3VR1A 5JEEA 5KDOA 4Q1EA 4P4UA 1KJWA 2QU8A 3TKLA 2XGJA 2X8AA 4QHSA 4GRAA 1R0ZA 2FA9A 3VO1A 3BIFA 3ZS8A 2FPLA 3SYLA 4JJZA 1UDWA 2W0MA 1GWNA 5LPNA 3WNDA 1T4GA 2HF9A 4TL9A 3OW2B 3SQWA 4KHZA 1SULA 4LV6A 4C43A 1ZM2A 1D2NA 4M1OA 2VH5R 3GLGE 3CNNA 2FN4A 4UAJA 2J5XA 2V3CC 2H92A 1AGPA 2JJ2A 4OHXA 4BECA 5BN4A 2QBYA 4WOPA 3PCRB 5EUQB 5L3SB 3W8NA 4JBWA 2OZEA 2OE2A 3DZDA 2J9RA 2G9NA 2XZOA 3E1YE 2I4IA 3DEFA 3R8CA 1JJ2B 3EPJA 3QPWA 2ZRGA 4MYUA 1EK0A 4DKXA 1TQDA 1CLUA 3RAPR 4JT2A 3V4RA 4D26A 3C5CA 2KI5A 3WRXC 2QEXB 4C30A 1G3MA 2OUKA 1M6NA 1OYYA 4KI0A 1WMSA 5HTKA 1HTWA 3AP3A 2RCNA 3LBHA 5BYKA 4N3GA 3H2YA 1Z6XA 4QG7A 3L0PA 1XDBA 1W1WA 3CWZA 2BN4A 2ZI7A 1DDIA 4PC2A 1BIFA 2J46A 2NO7A 3QY0A 4JL6A 4UQOA 4B44A 4HLCA 4J0QA 2GJKA 2OFWA 1KO5A 1U0LA 5D3MB 1P9RA 2ZREA 2DERA 4MRPA 5J5CA 1MOZA 4OQNA 3QJYA 3I56B 4MRSA 3VR5A 2ZI3A 1KI6B 1WXQA 4RZXA 1R0XA 3U44B 4M9SA 3QBTA 2FDCA 4PO1A 4FINA 4M0LA 3UPUA 1FFHA 3SNHA 2PH1A 2W00A 2VP5A 2J0UA 4C0AC 4Q01A 4D0GA 1IN8A 2NTYC 3LXRA 5AJZA 4ZCMA 3CC2B 1FTNA 1G8YA 3Q3JB 2QL6A 2XXAB 2BCJQ 3FTQA 4GDFA 4HUTA 2J0SA 2EYUA 3BK7A 4TMKA 2F3RA 3RS4A 4LPSA 5G3ZA 5JZVA 1MO6A 2VHUA 4UKDA 3OE7A 1QHIA 2C2HA 2BPOA 3AVUA 3LX5A 3AVWA 2KBFA 1LS1A 1QVRA 1CR2A 4GI7A 2BC9A 3UWOA 2ZJZA 1GM5A 4US0R 4HB2A 1DDGA 3U61B 4YMUA 2PJZA 1VKJA 4YMTA 1VQPB 3OIWA 4TZ0A 3BBPA 1XZQA 3D7MA 3IILA 1X8KA 3NC0C 3PR1A 5FI1B 5FUXA 1FDRA 3VNUA 4C0JA 1CKEA 3P26A 3O8CA 1IQPA 4LHWA 3CONA 4OI1A 3CCQB 2JEOA 5TV2A 1KSJA 1R4AA 1ZUNB 1ZD8A 3TW8B 1BOFA 3VR4A 1XMSA 1E32A 1IY1A 4CEIA 2BBTA 1IN7A 2A7QA 3UMSA 1V43A 2DFNA 2GWHA 3QPUA 4DLRA 4DLXA 5JEDA 1EFUA 3EWSA 3EX7C 1KO8A 2OFOA 3W6PA 1NMZA 2F55A 2ERXA 2ZUDA 4JYBA 4NCJA 1PZNA 3TSZA 3KB2A 3BB3A 2GZAA 3ZLJA 1UFQA 4PO9A 2ONKA 1OHHA 2IF2A 3GCGA 3LH5A 2YVUA 4CT4B 2CNWD 2CE7A 2GJ9A 4RVCA 3EWAA 4TLBA 4V0KA 1U94A 2IX3A 1C1YA 1RPZA 1W0KD 4G1VA 4O2RA 3OAAD 4RKEA 2C78A 4DHEA 1QVFB 1G4UR 2HYIC 3ZZ0A 1SVIA 3F0TA 4B74A 1EP2B 3CRW1 4HB0A 3BFXA 2CL6X 2WWGA 3Q7PA 4IVRA 4BLSA 4DCNA 3VQTA 4MKGA 4M22A 3RS3A 4RFVA 1JI0A 3MWLA 5TDHA 1XEXA 1UM8A 1E2MA 1XTIA 5ANRB 3RS0A 5F3WB 5FPSA 4JLPA 5J4HA 4DT1B 1XMIA 1A8PA 3IBYA 1GVNB 2V54A 1YZLA 3K70C 2DFLA 4LWZA 4HI0E 3ZVNA 3TQFA 1KI8A 4TLDA 4DDWA 3THYA 3TIFA 4ESVA 3CPWB 4IRUB 2VF7A 1BMFA 4DCSA 3NBXX 1CJKC 1NVVR 2NO6A 4C3ZA 1P4SA 5FPYA 4MH0R 3A4NA 4MUAA 1JALA 4JLKA 2OV2A 2A3RA 3CRVA 3I8XA 2H18A 4MGZR 4KYIB 1KI1A 5CYPA 3SZRA 3B2EA 2AR7A 4JVNA 5G53C 5FUYA 1QGYA 1JAIA 1RRGA 1W34A 1VG9B 1CU1A 2QSZA 1ONBA 1VIAA 1FRQA 3H84A 1XFAA 3GJ5A 4XIGS 3SHWA 3I55B 5E7JA 3LA6A 4II7A 2HF8A 1ZUHA 3GQBA 3DMDA 1J7KA 2VP4A 1Q22A 2HCBA 1ZNZA 3ZVLA 5P21A 2G0TA 1D8TA 3IKJA 2W6JD 3SBDA 2QZ4A 4EQ6B 1T3HA 1E63A 3I3SR 1QGZA 3BC1A 4A36A 3U4QA 5FOXA 1YZGA 4IEEA 1A4RA 2PZEA 4Q1CA 5JHGB 5CM8B 5JHHB 1ZNWA 5AUPB 1IAQA 1L4UA 3T06B 1E2GA 3CPEA 1Z0KA 2DWQA 4FCVA 3AUYA 1MO4A 1N6IA 4M1MA 5E95A 1Q86D 2OFXA 1HQCA 3TUZC 2VYQA 4FWTA 4TYPA 1KDPA 5EXTA 1NN5A 1FNCA 2QTZA 2CHGA 4R2IA 3KQLA 1NG1A 2GK7A 2AX4A 4MRVA 3E1SA 2IYYA 1HV8A 3QBVA 4JLDA 1XPOA 2NZ8A 4KFTA 4EJSB 4B3XA 3B1XA 1NBME 2JLVA 1OV4A 1NL3A 4LHXA 3BWDD 4US2R 4LYJA 2ZJ5A 5LD2C 4HDOB 5D3QA 2W6JA 3ZGXA 3I4LA 1JB9A 4B48A 1AKEA 3BXZA 4OI0A 4GBMA 1P60A 1QGAA 2WJIA 3FFBA 2R6AA 3F5FA 4A2QA 3B1ZA 3DVLA 5J4YA 3BJIC 2ZR7A 2QAGB 2CNDA 2OTJB 3WNBA 3QKTA 3KZ1E 521PA 3ZVRA 3ZZTA 2BM1A 2XNSA 4PZLA 1OKKD 2VHQA 3KUCA 3VR2A 1N3BA 2F9MA 1N6HA 2FNAA 5JWRA 1N25A 2X1VA 1GRQA 1II8B 721PA 4HDCA 4EFNA 2JLWA 2F7SA 5SZKB 1EX7A 2CLCX 3NIBA 3CCSB 1W0JA 4DXAA 2GCPA 1QDEA 4A15A 3AM1A 3ICQB 1P2UA 2Q9BA 3EXAA 4Q5IA 2X77A 1R10A 2DWPA 2EFCB 2QUZA 2BEJA 2X2FA 4OJQA 1OJLA 1KDRA 4ZDKA 1T3SA 4P32A 2H17A 3AVVA 2QSYA 1QFYA 1JEDA 4A8JC 2BF4A 1TMKA 3JZAA 4C7OB 1NDHA 3WHLA 3OJWA 1OT3A 2YZ2A 1XP8A 4NYJR 3CZPA 4FK8A 3VR3A 2E1RA 1S72B 1YVDA 1T0HB 3TK1A 3Q72A 4WVFA 1CJVC 2VSFA 5H1YA 2V7QD 2XJ4A 4NL4H 5L3RA 1OH6A 1OKKA 3SOPA 1BQEA 1W2HA 2FE4A 1KSGA 1DAFA 1XJ0A 3VKGA 2D7DA 1TLLA 1QG2A 3GJ8A 2IWRA 4E5UA 3BERA 4Y9UA 4Q66C 2G6BA 4TMXA 2I3BA 2I1VB 4TL8A 1NVXQ 2PJRA 5L3QA 1DVRA 4M9QA 4LI0A 1NMXA 3BGWA 4PHGA 4YAUA 1U0JA 5FPKA 2J41A 4Z8YA 4Q18A 3I62A 2KSQA 5C4GB 3CCUB 4B2PA 3ES9A 1LNZA 2YHSA 1XPRA 1OXUA 4HUQA 4OHWA 2ZI9A 4A0RA 4M4SA 3P27A 1DG1G 1W7AA 2J7KA 5FA6A 3QF4A 3NDBB 2JDID 2SHKA 1P62B 1J8YF 3OZWA 4BFXA 2IW3A 3PV0A 1E9FA 3K70D 2IYWA 2C9YA 2X19A 2C98A 2C9OA 3AF4A 4LZZA 3U7EB 1ZAKA 2JLSA 4NE2A 4PC3A 5KNDA 1SXJB 4UNRA 5H5JA 2OCBA 3ND8A 2O52A 1YZUA 4DEYA 4DIEA 3EASA 2ZUBA 2ZR9A 4B71A 3AVPA 4IXNA 4JSTA 4B2LA 4QHYA 1MV5A 1UMKA 2ZITA 4MYTA 1RC8A 2C5LA 1W36B 3EPHA 1NY6A 2ZRKA 1W35A 4HE6A 2YOHA 2CHQA 4M9XA 2BDTA 3BFKA 2RC5A 1XTQA 2N1BA 3QE0A 1FPMA 2AWNA 4DLYA 1VQ4B 1ZC4A 1F2UB 3KJIA 4I1OA 1FP7A 2J59A 3M4YA 3C41J 1FX0B 4A0HA 1MKYA 4FN5A 1HUQA 2G3YA 2OO7A 2PZFA 3CR8A 4NYJQ 3RYTC 3X1DA 3W8RA 3CZQA 4EH1A 4HB4A 1ZW6A 1FTSA 4LHYA 3RWMB 5EE9A 4EAQA 5DHAA 4YALA 1XD8A 2ZSAA 1QG0A 3MD0A 5DI9A 4NKRA 2IWHA 3CPHA 2A78A 5FTLA 1T5IA 1Z29A 4BUJA 1NNEA 1A2BA 2C99A 2MMGA 3X1ZA 3I5YA 3DZ8A 4HLUA 1SXJE 2VP0A 5DH9A 3CW2A 1N5KA 2WKRA 4WIAA 1NG9A 3IIKA 4KLNA 1EP3B 4DZZA 2DETA 4EPVA 4CDGA 3TGPA 4CEJA 3UMRA 1CEEA 1G6HA 3FHCB 4QGHA 1SHKA 2D4HA 3OEHD 5IHPA 3K0FB 4PC7A 4N1AA 1WA5A 2BBSA 3NC1C 3QFCA 1TAGA 4CF7A 2PL3A 4XWAA 2QM7A 4WQMA 4B75A 4TYNA 4ASUA 2H8KA 1XWIA 5FTJA 2QMOA 3CCEB 3B8HA 3Q9LA 1TQ2A 3E70C 4OHYA 1KDTA 5L3VA 5EP3A 3KTAB 1KKMA 4Q1BA 4BEBA 2JA1A 5KSWB 4QGAA 3EPLA 3WRYC 2ZI5A 1CR0A 2VRWA 5A0FA 5DYIA 4WXPA 1Y3AA 3KJEA 3BH7A 4ON9A 5DE3A 3LO8A 2FSFA 3K0AA 4ZDWA 2GTPA 3AEZA 4DUGD 5JS8A 1NLZA 1LTQA 1VQ5B 3FMFA 4G5OA 5CJPA 1CJMA 4AYXA 1DELA 1YZTA 3EZ6A 5LDDC 4RD2A 3FKSD 5JSZB 1VYVA 4TWZA 3RC8A 1NLFA 2REXB 2D3WA 2AKYA 2FEOA 5JRJA 5AUNB 3CF0A 4OQMA 2ZE8A 2FOLA 1VG0B 3GLHB 2VA8A 1Z3IX 2AD1A 1F2TB 1Z83A 1W2GA 4M1YA 3OFND 3HR8A 3J81k 4LJ6A 4QJ4A 2JIZD 3CWQA 4TQUS 2CMKA 2EWVA 4V0NA 1F48A 3HP1A 2XOKA 1G7RA 3U7HB 1VCNA 5KDLA 1MABA 3VU9B 3ZBUA 2H16A 2OLKA 1ZNYA 2CL7X 1TNDA 1G3RA 2AKAB 1H8HA 2XTMA 5M04A 1UADA 2VNHA 5TARA 2EIXA 1VHTA 3C8UA 4XTRA 5DIFA 3FWYA 5LB2A 3L0OA 4DUGA 4YAFA 2G77B 2WSSD 3CCJB 1RJ9A 4LK2A 2MSEB 1P2TA 1UF9A 3BH6A 4FMDF 3C4JA 3FKSA 3PEUA 2ZRAA 1M7HA 1P9WA 1VDZA 4Y7CA 2JATA 1G3IA 2W2TA 2B8TA 5FPTA 4V0ME 3WBKA 3R9WA 2ZROA 4G3XA 4BZXA 3ZDQA 4ZKDA 1ZM3A 4TYQA 3MSXA 2XTNA 3FB4A 3CC4B 4KBFA 3B1YA 3TR0A 3ZQJA 3QPVA 2O8BB 1KO4A 1QHXA 1KO7A 2QP3A 4A8JA 4PAMA 1G5TA 3HYRA 4PQFA 3WYFA 3GLHE 5EXSA 4PZYA 5CYOA 3GEHA 5CITA 3GJXC 4Q4AA 4CEHA 3WP0A 3W5HA 2P65A 3QG1A 5K8IA 4OQFA 4YXWD 2WMNB 2CJWB 4IDPA 4P6VF 5TVKA 4KFUA 4Q4JB 3AVXA 621PA 1Q44A 4QBHA 5KNCA 1E2NA 2QP9X 5C18A 4B6FA 2QMHA 4C4PA 5HCNA 4B3DA 3BRWD 5IF9A 3W2GA 4P4SA 4PSAA 4HYYA 3GFOA 1OFIA 1D2EA 3UMFA 1DE0A 4IFBA 5H70A 1E0KA 2V6IA 1CXZA 2BMFA 3Q5EA 5THXA 5HXBA 2ONJA 3THWB 2FEMA 3I5XA 3SEAA 2FZLA 4CZ2A 2PLFA 4RJLA 4LYHA 1JB1A 4NDZA 1M34E 1ZIPA 1BYIA 1E99A 2AK2A 1UEIA 3O8DA 4URWR 3ZD7A 5GJBA 1XBTA 1BYUA 2IUSA 4NU0A 2FX3A 5FL7D 5AN9A 1LS6A 4OHZA 2OM2A 2UVQA 3PUVA 1SM4A 1GAJA 1TQ6A 4TL7A 1E4VA 1G3UA 4BZQA 1E2DA 4Q4LA 2ZRJA 1D9ZA 3AVOA 1ZBDA 1B0UA 4XSHA 3CLVA 1G4AE 1YU9A 1W48A 2P0EA 3IPXA 2F9LA 2WICA 1P5ZB 1US8A 3A1TA 3T1VA 4DB4A 3MWJA 2IF0A 1EFRD 3QKSA 4DSOA 4KYUA 3THXA 5HZHA 3QIAA 2K5UA 3Q8XB 1K5DA 2C77A 1GITA 5IK2D 1ZP6A 1YJNB 3T1QA 2R9VA 4GOXA 3MRSA 1E4YA 2GEVA 2W6ID 3V4FA 4E03A 3U7GA 3DHWC 1KGDA 4PQRA 2ORWA 1M2OB 2CL0X 3AKCA 3B5JA 3I8SA 2R62A 4GP7A 2REBA 2Z43A 3U2QA 1KSHA 2IYVA 4YONB 2B7BA 1J70A 4GNKA 1JR3E 1ZRHA 2BBWA 2QTHA 4F91B 4TLEA 3LRPA 1E2LA 2IL1A 2IYXA 4Q7JB 1QBKC 4K8OA 4ESHA 3KX2A 2VHCA 2JLQA 2P67A 1EWYA 1D1NA 1N2CE 1W44A 2WWWA 3DM9B 2GK6A 1N6LA 5DGXA 2ANCA 3MJHA 1WF3A 1YZKA 2O0KA 4TSFD 5EQTA 4A0GA 3GLGA 2IT1A 4IVQA 2GCNA 4PO8A 5B57C 4BGDA 4FD2A 1VG1A 2VEDA 2YOGA 3RDPA 2WJHA 2W6IA 4KJZA 1VIYA 2PX3A 3VHXA 3Q5DA 2ZANA 1XD9A 1G3QA 3LW7A 1JA1A 1U9IC 1PLJA 3VNVA 4RZ2A 2J45A 4OQXA 1W5TA 2IXEA 4V03A 4EPYA 3G71B 2OAP1 2O8EA 3B1WA 1TUEA 4M21A 3A1WA 1YITB 3PQCA 3S1AB 3SU8A 3IEUA 3N70A 1ZM9A 1NVWQ 1WCV1 4JKYA 4LJ9A 1G7SA 1GJRA 2DYKA 5CIQA 2Y8EA 3D6TB 1GSIA 4B4DA 3NH6A 4TSFA 4DQLA 1TF7A 2A5DA 4ZI3A 1GRNA 3IGFA 5CB6A 2ZRBA 3K9NA 4QBGB 1VCIA 3SHFA 3P4XA 1G5RA 2HV8A 1EXMA 1JPJA 1FRNA 2RHMA 3F3YA 2QEQA 4HEJA 2FPKA 2RC6A 4EPWA 1NI3A 5B64A 5C4MA 1S4QA 1I4TD 1WRBA 2B8WA 3OE7D 4U02A 1JEEA 4DEXA 3CNLA 3WHKA 1ZD9A 3OHMA 1KI4A 3RRZA 4IDHA 3FMOB 2Z5FA 4RSGA 5L3SA 3AVTA 2ZIAA 3NHAA 5AJWA 2R6GA 2ZPTX 1OXTA 1AQYA 2JGNA 2UZ3A 1A1VA 3QKRB 4RD3A 1E3MA 4JLNA 4Q19A 4ZO4A 1D5CA 1R5OA 1IOZA 4BPRA 1JQJC 1VQ7B 2BMWA 2HT1A 4XVQA 4AKHA 1SVSA 4F7WA 4F38A 1HH4A 1KAOA 1OFTA 2P6UA 3P20A 3ADCA 4PFSA 1JECA 3KFXA 4L9SA 3K1JA 4CGZA 4YMVA 4TQAA 2IXGA 1NJFA 4IEIA 3QNUA 1LFDB 3ZYCA 1CR1A 2ZSEA 4G0NA 3GJ6A 3P1JA 2EFHB 4BFUA 1X6VA 2DR3A 1UBEA 4DDUA 3SFZA 5KPDA 4EKDA 1EWQA 2J0UB 1P61B 5KDDA 4P33A 2NGRA 2R6CA 5D3MA 4OK5A 1KK2A 5JMTA 3GD7A 5AUQA 4OK3A 4LJ8A 1G16A 3K9HA 1IN6A 1U8YA 4MUBA 1OHHD 2WWYA 4PGOA 1T8UA 1Y63A 4IOJA 1CRPA 1E2HA 1XCPA 4PAOA 3U44A 1GL9B 1NKTA 4H9GA 2EYQA 5EE3A 1ESNA 3NBYC 2GF0A 1OB5A 2QAJA 1JJVA 4URYR 2C8VA 4AURA 4C9BA 4QXAA 1PV4A 4HZUB 2VP2A 3M0EA 4PQYA 1DAMA 4HAVA 2IUUA 4YC7A 5FBRB 2WWFA 2XXAA 1KI9A 2PLRA 1F6BA 1XXHB 4D80A 1D6JA 5FBWB 3SJCA 2EFDB 2DFKB 3CMEB 1G64A 4WW0A 1G1MA 1LF0A 1K5GA 2FMXA 1NIJA 3QOFA 5DO9A 1W2BB 3CF6R 3U6KA 2UKDA 3LFUA 3NEJA 1N6RA 1X86B 1Z08A 2O8FA 2O8DB 3LX8A 3R7WB 4B47A 4ACBA 2GCOA 2GHIA 4LJ7A 1KMHA 3U3KA 2RGXA 2IBMA 5EE1A 2IEZA 2YWEA 1E2PA 5KSOA 3A4LA 2ZJ8A 4W5WA 3CX8A 1BMFD 1KD1D 1U8AA 1HEIA 1E2EA 1E98A 1MR3F 2IYZA 2LCFA 2NIPA 3ECCA 4KITB 3ETLA 4C2UA 2ODWA 5JJLA 5FUWA 3ZVMA 3DOFA 3PUZA 2ZEJA 1E0AA 2F1IA 2FWRA 1RZ3A 2VP6A 4OHVA 1X1RA 4MGYR 5C2JB 5JI3E 3WY9A 4TL6A 1VYUA 2DEUA 1CQXA 1N6KA 2PT7A 4Q7LA 4UJ5A 1S9DA 3IBGA 3K53A 1ELOA 4B35A 2GA8A 5KPJA 1VTKA 2BV3A 1DS6A 2GILA 3D3QA 1TQ4A 1XXHE 1XEXB 3KKMA 1AZTA 1GKIA 1K8RA 2HYDA 2YJTD 1E1QD 2Q9CA 2W2VA 4MKHA 3C15C 3QENA 2RGEA 2FG5A 1H65A 1KO1A 3UG7A 4BFYA 3AF3A 1QRAA 2HT6A 1CBUA 2XJ9A 3EA0A 1LB1B 5FOWA 4BE7B 3THYB 3L0IB 2ODBA 1ESMA 3E2IA 1JAHA 2ZSFA 3L8ZA 1ZM4A 1M1KD 2F1JA 3EC1A 1GKYA 3K0EA 4G1BA 1MRSA 1KOFA 2P5SA 1TF2A 2CK3D 4HLUC 4DT1A 1AA9A 2ZRIA 3TH5A
chains in the Genus database with same CATH superfamily
4DS3A 2UYGA 5L7WA 4GOKA 4OO3A 4EFKA 2HRCA 4QYXA 2HRZA 3HSKA 4C04A 2FPGA 5TQVA 2XB6A 2CCJA 5K0FA 2IZ6A 1UBGA 5LP6F 1WZIA 4FE3A 1AZWA 2J6HA 3K72B 3ENQA 4YECA 4YAWA 3KOOA 1IUPA 1NP6A 3Q7IA 3W7AA 1JDTA 2LDBA 4G09A 4W9RA 3C6MA 4F4HA 2JLYA 5EP4A 4Z7QB 2RJ3A 3VHLB 1ZCFA 2VPQA 5TT0A 1VHDA 5HBRA 5JAUA 1XNQB 2GKGA 2QRVB 2AYXA 4ZVTA 4FKMA 3H97A 3RFVA 3QEMB 2CLSA 3IKVA 3SS9X 4YIHA 3INGA 2VAMA 2ZJ4A 4WJZA 2FZGA 5G02A 1ID8A 1JW9B 2DBVO 1KHHA 1PQYA 3OFKA 1QAOA 2JK0A 1FJGB 1P73A 4QVJA 1Z62A 1NJ5A 3ORHA 1S9HA 3WBFA 4Q9IA 3A37A 4MWSA 3ZDDA 1EFVB 1JVSA 1MT0A 4ZCIA 4G5QA 4CI0B 5LIPA 1IG3A 3ZEAA 1BFUA 3WFJA 5AUOB 4ZP1A 2YIVX 2R48A 4FE4A 4FQ7A 3K09C 1ND6A 4MW1A 5DEIA 1XA4A 1IN5A 2ODAA 3QHQA 4DLPA 3A10A 5EZ5A 1SCQA 5MGBA 3UV3A 1XMJA 2C61A 3FVQA 1Z15A 1G41A 3CPJB 2Q4EA 4UNNA 1L6IA 4HAUA 2QTLA 2BEWA 3RABA 2H52A 3L3BA 4E5VA 2O1EA 3DTVA 3RRBA 3SX2A 1SC9A 5A04A 3OJOA 2Q62A 2ZK7A 1QO9A 2IHVA 1E9CA 3P0IA 4HWPA 4Z9FA 3L4JA 1EGAA 3ZHSA 4JJKA 3C7DB 4R98A 1JEQB 4B33A 1M8PA 1FP2A 2NUTA 4IIVA 5A5FA 4F8EA 5F23A 2HWKA 2PVSA 1XQ1A 1AS2A 3EC7A 1DMSA 1U3VA 3VR3D 1CF2O 1XRSB 2XVAA 4B4KA 1Q74A 1M83A 2EVWX 1W5FA 3EOZA 4WGFA 1ZINA 2X85A 4NU6A 2PRSA 4FIDA 5F2EA 2EJVA 5JZBA 3ROPA 5KYWA 4KPEC 3C7KA 5H68A 4DIDA 5CIWA 1K6JA 4RHUA 2IP2A 3L4BA 2PKRA 4HLQB 1JIIA 1YI2B 3PUXA 4QXRA 4MV3A 2AC4A 3PP8A 4XIFA 3T1NA 3G88A 1AJEA 2OBMA 4PIVA 5CNJA 1SUFA 2ZQZA 5HMMA 3TNYA 4MAFA 4KGDA 2FZ4A 4XE5A 3D2CA 1GFIA 1PJRA 3BK1A 2OFFA 3GRCA 3VDXA 1UOQA 1M8JA 3WQBA 5AVUA 5ITVA 1A5TA 3H11A 4PPQA 1UK7A 2QRJA 3ICVA 4MVXA 5F12A 4X65B 2IZ0A 2I4NA 2V7EA 3OM9A 4M8LA 1D7OA 3L8YA 1JFTA 1SXGA 2Y76A 3DE7X 3JVIA 3HKDA 5CR9A 4DNTB 2H2AA 1JHPA 3EFHA 4BRWA 5LP6B 4LKOA 1QOZA 2PV0A 1YKSA 4OGWA 1GUBA 3VNBA 4MA4A 3AWIA 2ZRDA 3IQWA 4M89A 3B9BA 3M33A 2CUKA 3BMNB 3D54D 3M6IA 1G8AA 4MIEA 4YDQA 1TYBE 1HE3A 4JP5A 1Z4NA 1N0VC 3FB1A 3KKOA 2CDRA 1JDVA 2I8CA 3LQQA 4J0EA 2VA9A 4O5AA 3GZNB 1WR8A 4Y9RA 2W43A 3T5GA 3OJFA 5KNDD 4UXHA 2A9QA 4R7GA 1MH1A 2PA0A 4I81A 2XMZA 3OJLA 4P53A 3GPIA 4IX9A 5DU2A 4ZTBA 1IQ0A 5HF5A 1D1TA 3O7WA 1X87A 2NXEA 4EECA 1ZAYA 1ABBA 5E9JA 3KEGA 3BMCA 4BDSA 5IBPA 1KEVA 1JBEA 2KE5A 3U7RA 3VNQA 4YRSA 1T8SA 2QTNA 4HVLA 1WW2A 1NHGA 4P80A 4QEKA 3Q9UA 3SS8A 4B6PA 3DFKA 3L79A 1DOAA 4C08A 4YRAA 1Q0ZA 2HJWA 2ZR8A 2R1VB 2ZUCA 5KWJA 1GUFA 5IN5A 5BV0A 4TMVA 1EGHA 4CM8A 2J3MA 1O89A 3NAGA 1EVIA 2RHJA 3LC7O 2F1RA 3LT0A 2VDRB 1CFJA 2BGNA 5JMPA 1DRWA 3L0ZA 1QMGA 3QMPA 1U81A 2IIPA 2JEZA 3T0IA 5HCIA 1BX3A 2X53S 5K99A 2ASVA 3R3VA 4KPGA 2AJDA 3MTJA 3GO4A 4TRNA 3Q7TA 5EXPA 1GZHB 4OXNA 5KHAA 5BN5A 2NZJA 1UZAA 4J16C 1R74A 3CRMA 3HKBA 1R2QA 2PNJA 4BZZA 4AU1A 1S01A 2HZBA 2WYUA 1Y3HA 1WNTA 5BSUA 4BMSA 3FHJA 2C20A 3TTVA 4ZIRB 4KXFB 4YCLA 4KQIA 4BJ1A 4HGZA 2X6QA 9GPBA 4FFBA 2PKWA 1SXQA 3BSWA 3W1VA 1CNEA 2NO0A 5GVRA 5K3AA 4B6SA 2FF7A 3F5SA 1O96A 3EGCA 4IF6A 1QKKA 3ETHA 1Q3TA 4CDNA 3UANA 2A1TR 1N2OA 4BNUA 1FBNA 2FSHA 5K4HA 2GSWA 1NPDA 4G4GA 1BFDA 4MW6A 3B5EA 2VYCA 1B1CA 5T3UA 1AKMA 2A9PA 1OWMA 3EULA 3BB4A 1Q1QA 2GVZC 3L0SA 2QUKA 5H16A 4IUYA 4F3KA 2NOAA 2O8NA 1YR2A 4UHBA 3IA7A 3ZY4A 2J4FA 1KJIA 4OAPA 1XNRB 2J08A 3HDYA 4E2XA 4JBHA 2OXIA 3UJ3X 5EFOA 1E3DA 4DAEA 3DLHA 1OB2A 4EVQA 4RVDA 1EESA 1A4XA 1Z6GA 4GWKA 2OC9A 5J2TA 2RARA 3IC5A 1Q7TA 1YF3A 1EMDA 3DVAA 1YULA 1GFZA 1JSRA 3ESZA 3MN1A 3ONVA 1ZCZA 4RHXA 4JI1B 1H4SA 4ZVLA 4AJ2A 1ZA2A 2OTLB 1ZNXA 2E55A 3ZIAA 2HSDA 3WLIA 3TAXA 4TS3A 1OIXA 1T2EA 4KFSA 1Z5WA 3AXSA 3CH4B 1W1IA 5FEUA 2YIJA 5DHSA 1RE0A 1FMLA 4UNIA 3WQHA 2XBLA 1MEOA 4EL0A 1NVUQ 4C4ZA 4Z0TA 3KL4A 3U1BA 5LMZA 7AT1A 2DHRA 4MRNA 1Z73A 4A4DA 4LMAA 4ZMRA 1QRUA 4QHTA 4H59A 2C31A 2DMRA 1DBVO 3WIUA 1K3FA 1ZR4A 5AM1A 5EGNA 2R84A 2W0SA 3I4FA 1VGQA 2EZ9A 3KZOA 4Q82A 5LZ8A 3RRYA 2B2NA 2FMTA 4CLRA 3WK9A 1T3LA 1UKYA 2EP7A 3ZVKA 1FSPA 1QHHB 5LWQA 1AC5A 3R3HA 4QJ3A 2I9PA 4XLTA 4EUEA 1E5XA 2CY0A 1VLVA 2EATA 3KDSE 3A9RA 3S8YA 4OH1A 4RZUA 3W6ZA 3G9XA 3GLIB 4KCGA 2XOKD 4TX1A 2YCLA 5GVSA 5JNVA 1RWPA 3DKRA 3RHFA 1JJFA 4PRYA 4U2GA 3NFYA 4HDMB 4P3PA 3OX1A 2WDZA 2A9KA 1P5FA 2J3KA 1T8WA 3N1UA 3ND9A 4HH1A 4B6OA 3HG7A 4TMWA 1ORHA 1OYVA 4JUFA 1YBAA 3EDYA 4PBTA 3LBIA 3GD5A 3OSZA 1I4OA 3A4IA 3H5OA 2NXWA 2PH3A 2DPMA 2Q4DA 3TKAA 4O3MA 4NE9A 1B23P 3SEQA 2YHAA 4M6WA 3K09A 3L9XA 4JJGA 4XD7D 1NE7A 1J2UA 4MICA 1F8FA 1NIPA 1TU3A 1ZYUA 4R54A 5ED0A 3MTEA 2OCIA 4IIFA 2F1LA 3CN9A 4DVGA 4F3TA 3GFGA 3K9QO 2SECE 1U2RA 2X7HA 3CC8A 1U2GA 3C6QA 3HJNA 5LB4A 2IP1A 1SR8A 2I2BA 5IDYA 3R5HA 1Q2XA 4WY8A 1D1QA 1JHXA 4YP7A 1QHGA 4BDTA 5C5EA 3CUUA 2WHXA 1G5HA 4HDNA 3A2MA 3PFKA 1W5EA 1LWOA 1H2YA 1XZLA 2JH3A 1FY2A 2RGBA 5EYPA 4LF9B 1TF5A 4NBVA 5BNTA 4A82A 4D6PA 5LDGA 2V7UA 2R6HA 3SVZA 1OLUA 4JR0A 4UNPA 2YXLA 3RFFA 1BC5A 4BB9A 3GLIE 1I4EB 3E20A 2HREA 2C5EA 4W5OA 2ZE6A 1YCFA 4W6ZA 4C01A 3FSRA 4R1QA 4M9ZA 2LR0A 3IAXA 1DTEA 3WGIA 5KC9A 1E2BA 3L4SO 5ALRA 2FFQA 3GA0A 1QBGA 4K6CA 5AR1A 3J80A 1MDBA 4LDAA 3SOZA 4BYGA 1DU4A 4HZGA 3UK6A 1A9XB 4WASA 3SXJA 4ZCSA 2WU3A 3VSEA 4CM3A 4F4CA 3VYSB 4CHTA 2CBZA 4URVR 1T4MA 1CY4A 4BTLA 3Q3AA 4OYRA 2CVFA 3AOGA 5FNVF 3RUPA 4CFSA 6REQA 4RIFA 3LCUA 1V5EA 3V1LA 3SMVA 2PUBA 3SIWA 1E2QA 1U3FA 1V9CA 2IHZA 3WMRA 4D4LA 4QPJC 4UOEA 1QQ7A 2OXRA 5IJXA 2CLFB 1GSHA 3OWXA 3QBEA 2I91A 3SJZA 3FDIA 1NW9B 4V39A 2Y93A 1LSSA 4Q21A 4AICA 4CU5A 5JNRA 1OAOA 3E2MA 1TB4A 5ADUS 2XD9A 1UR5A 4Y6PA 3GG2A 2AVDA 5EMNA 2ORVA 2OHXA 3AJ9A 3FWKA 1E1CA 4L4ZA 2VQSA 2F43B 1BMDA 1ORVA 1HBJA 2XI4A 5K3FA 4ND3A 4CF4A 4CEHB 5DM0A 5DGIA 4R16A 1BXKA 2CLMB 3CM0A 4XUCA 3EYWA 3ZJ4A 2RB4A 1VE1A 1IXRC 4YK7A 4JZYA 3SZGA 3VC2A 2B7CA 1V5FA 3FVTA 1BROA 3NHUA 4NR0A 1HT2E 4DMCA 2PU5A 5TQ2B 2B2CA 2JFVA 4TQGA 4A2PA 1KY2A 5EIBC 1BKYA 1E2IA 1T5LA 1K5HA 4CYMA 2ZBUA 1YCHA 3K8YA 4WA7A 4ZU1X 1VQ8B 5K3CA 3AHHA 3AUKA 1TRKA 1MGPA 1MD9A 4IO1A 4QRHA 4YGXB 3H4VA 4ZQEA 3T7AA 3CNOA 3BE4A 3UT5A 5HZMA 3R5TA 4EUHA 3MWDB 3K2IA 4P2NA 1AGXA 4BFWA 5IAEA 2ORYA 5BR1A 4M1SA 4ZOAA 4Z4TA 1OXMA 3IPYA 1RHQA 4EFMA 1KJQA 4JNKA 4X8OA 1COWD 1I33A 4I3HA 3AJRA 2NZYA 1J5PA 1GPKA 3IT1A 3LUBA 4PR0A 1B8UA 1QTNA 1TYCA 2QRNA 4PSKA 4XDYA 3PRJA 2E9SA 3I9V1 3SIPA 1DX6A 2GR9A 2E4ZA 2OGTA 2GERA 1IBKB 421PA 2J9ZB 2Q0SA 3DLAA 3IP8A 4KPUB 2XMQA 4HX5A 1A72A 2J3HA 5CDFE 4E12A 5EWLB 5IM5A 4YEJA 1V2GA 2YL2A 1EJ6A 1XVIA 3D7LA 1Y0RA 3H1AA 4TUYA 4AG3A 2HPHA 3MT0A 1JKXA 3FW1A 2BFDB 2WFLA 3D31A 4ZOLA 1K88A 4RDLA 1X94A 2YWGA 1RZRD 3DBLA 3Q6NA 4S1VA 4E11A 1JR3A 2CNLA 3QKWA 3BUSA 1AQIA 3EEQA 4AJ4A 2OLJA 3KQOA 4D9KA 1RQRA 3UOGA 4FYHA 1P7WA 5ENZA 4QTYA 2NVBA 4GEGA 2XYVA 1UMBB 3IOCA 3HUTA 5IAGA 3THRA 3ADDA 2IUTA 1BDJA 2XUAA 4IJUA 2C7GA 1QG4A 2TMGA 1J0CA 2PNFA 4JJ6A 3T5MA 4ZJZA 2NT4A 1O95C 4CIAA 2C3MA 3IIIA 2WTBA 1XTZA 1MV8A 2BBOA 2HRRA 5BOSA 1UEXC 3E9YA 3PGA1 5FNVB 1EFCA 5JS1A 2UYCA 3WI7A 1L3CA 3NW9A 1N0UA 3PNMA 5AW3A 5HHTA 2BKXA 4CMIB 2UZ0A 3V8QA 4QQNA 5EP1A 4EYSA 1IE3A 1CW2B 1I8TA 1PFQA 2CYBA 2XR1A 3D3NA 3H1FA 4JSYA 1HSZA 1Z4LA 4KNWA 5JQWA 3G4SB 1O1YA 3BB1A 4JGGA 3K0SA 1B1AA 4OMFG 4UHCA 2OBSA 3FGOA 5CFPA 3IEMA 1PK7A 1RTKA 1PGPA 2BJVA 2ALJA 3O4GA 4MV6A 1R4MB 2A2ZA 1YI8A 1KARA 2IUYA 5ILQA 4EVRA 1NPTO 3U19A 3VPAA 5B6IA 2IC5A 2P2ZA 2MSDB 2ZE5A 1ZDMA 5ALNA 1YMQA 4XFKA 1M8KA 4LRYA 1WCIA 1Z2CA 3VZSA 4CMBA 4GQBA 2HJHA 1CS4C 2X6WA 4HLDA 3TZCA 2B82A 2WEKA 4Z1MD 3SR0A 1K2WA 3WZ2A 4LUCA 4G4SP 3RASA 5IJZA 3V8NA 4ER7A 1QU2A 4I3GA 2OMEA 3LQRA 1K92A 4YI3A 4BJ5A 3DMGA 1KQPA 2K2QB 2C42A 1D03A 3B52X 3UJ6A 4NMLA 4TYYA 4HWGA 2R6ZA 2PVPA 1WP4A 3CMCO 5J9FA 4OUDB 3UKDA 4CLEA 4D0RA 4Y6LA 4ZQGA 3UXMA 5I51A 5BQ5A 4F85A 1Q3HA 4FYIA 5HCUA 4O1HA 3OTWA 2QYOA 5BWMA 1U98A 3F98A 5KVAA 2DUWA 3GNSA 4BNKA 4XLLA 2R68A 3RFXA 1N78A 2P68A 1G9XA 4R84A 4S05A 3K9FC 2DKOA 2B9VA 1OAKA 2P2SA 2P9ZA 2VDPB 2XXJA 4IDNA 4DM4A 1B0ZA 1XEWX 1SQ0A 2E4XA 4GEKA 4IKOA 4TTJA 4ZXPA 1J2RA 3ZHZA 2W2NA 1E2KA 4BB6A 4DY6A 4QAQA 1AO0A 3L40A 3QUCA 1AHPA 4RTJA 4C4XA 1P0IA 5JV5A 2QBYB 1MJGA 1VE6A 1TUBB 2QG9A 1BA2A 2DSNA 4LHVA 4A91A 2JI7A 4TZTA 4DIFA 2D0OB 5AD1A 2D1RA 5IRCD 3SIXA 4J4TA 4AKIA 1P3JA 2I4MA 1U99A 2YWFA 4DC9A 2VQFB 3T3OA 5G41A 2PE5A 2HCJB 4WCDA 1OR8A 5DK6A 1NDUA 3N58A 3M49A 4G9EA 2JAXA 1Y82A 2HUNA 3DE1X 3HCDA 1HOTA 2RI1A 3PC8A 3BD7A 4OSEA 5LBIA 1ZXXA 1YC5A 4WXRA 1I1OA 2QMUA 2Z0MA 4XPZA 2BMJA 3MWKA 4Q93A 1Q6ZA 2PN1A 2QAGC 1O5TA 1WS6A 2ZT6A 3CEJA 3Q85A 4S2EA 4Y2JA 3RVOA 4ENRA 5F7JA 4OA8A 2FK7A 4UZSA 5FFFA 3WK5A 1QF9A 4DADA 3VZRA 1WPQA 3KAKA 5IMSA 2D9RA 4G0MA 4YJHA 3BT7A 2C5SA 1ULSA 2V58A 2E2WA 3AH8A 3VH2A 5K0GA 3CFYA 4NBKA 3K6RA 5BWCA 2CJFA 2V59A 3GJ3A 2B7LA 6CHYA 3GI1A 4B79A 3LP8A 1DC3A 1XN4A 2H2HA 4MYDA 4A1FA 2MU1A 1DI0A 1MX5A 3DQQA 2ZIWB 3BXGA 5CM2Z 3PUKA 1ZU4A 1FRFS 2WJ3A 4C0XA 3I2GA 3N6RA 3FTPA 3GRRA 3A1FA 5BN3A 4FFOA 3HFJA 4ZGQB 2P5YA 4HNTA 3QVLA 1ND5A 3LECA 2WVAA 1ZUWA 1NBWB 2D54A 2YJNA 3M4NA 5EJ2A 1KI6A 5I45A 3LWNA 1LSOA 2C94A 3V7NA 2NMVA 1JAYA 1XMPA 4HGRA 3SEZA 1A4IA 4HGOA 1PCXA 1E3EA 4C4SA 1DRVA 4CKBB 2WD8A 5IVIA 3C3YA 5CAEA 5AJXA 2XUHA 1ZR2A 2PLAA 1RD4A 3NHYA 4C7XA 2G1KA 5KO2A 3KJHA 3O38A 2Y67A 1EP9A 1KTVA 2FRDA 4BY9E 1G5PA 2C59A 1PQUA 3QZUA 3FCEA 4RK6A 2ZQ5A 3OECA 2XAUA 1N9GB 3F7TA 3Q11A 5AT1A 3UKJA 4CLXA 3VNAA 4LVOA 1YJBA 2FPPA 1VJDA 3EH2A 3WB1A 1YRBA 2BCEA 2PKCA 3DLCA 4GOOD 2OCDA 1U3DA 2R65A 4L6IA 1JXQA 5ELLA 4YS6A 2JB9A 2XTJA 1MJFA 3NHJA 4X1IA 5A3SA 1YIAA 4JBNA 3AUSA 1KYYA 2XD4A 4LJ4A 2EIHA 3CE6A 2VRCD 4KXXA 1KMHB 3UTDA 3TF5A 4TZ6A 3LO5A 3CHYA 4JBXA 5DF1A 2RHRA 4N0DA 2QTVB 1C4KA 4QEZA 4UD6A 2CMGA 5LQDA 1YAHA 1D4FA 4LGMA 4M88A 1YD7A 2BCGY 4D92A 1JPUA 2PUFA 2EZ8A 1TGVA 2DBYA 2BEVB 3ICWA 4JITA 3UJCA 4B4OA 3HN6A 4DNPA 4E51A 2CDAA 4LMRA 2O8DA 4GSYA 1CC1S 2IS6A 2CEAA 3LGSA 3A3GA 1UP4A 2R8ZA 1RMTA 2VBIA 4WLNA 3SFVA 1G8KA 4JELA 1O6GA 2IU6A 2O7SA 2O7RA 5J4KA 1BVYF 1F0PA 2GXQA 5GADl 3E53A 3LUDA 1VPWA 2VPTA 4GR5A 1SXJC 5EIEA 1F9AA 3CT6A 1KC1A 1N5JA 2QD1A 1ZUIA 4WKGA 1PN3A 5TEWA 1CV2A 2Q4RA 3IUSA 4RVHA 2PCJA 3HCBA 3RJ9A 1KYZA 4L8LA 2R1TB 3DXXA 1D2GA 4LXQA 4GVPA 2GYVA 5CDGA 3RKSA 5FR1A 1L5GB 4ZT3A 4TOIA 1QTRA 1C9KA 5TMDA 4RTPA 2JCBA 4B46A 4DRXB 4HAZA 4LE2A 3T9DA 2G82A 2ZTSA 4WWHA 2BE9A 4LG1A 4XD2A 3RYFB 3S7TA 3TZQA 5ICGA 1KK3A 4MW4A 5LZ7A 3O9VA 1X92A 1LGYA 4EZEA 3L43A 3MILA 2OWEA 3SJUA 3VOSA 5JG7A 4LJ5A 4IEFB 5JALA 1O95A 2VAWA 4ENVA 2PPVA 4BZWA 3ZHYA 1HT1E 4BFVA 1WP9A 5CM9C 3PTZA 1RYHA 1AZSC 2RHTA 4MYCA 2ZBVA 3CO0S 2NUTB 1DKNA 1SUAA 3F7NA 4HY3A 3T4XA 2BM0A 4YR9A 4NCBA 2OAQ1 3I9NA 2E4AA 3TNJA 3GC6A 5FL3A 5FOSA 1BVRA 1A5BB 4MQMA 1WUIS 3ZCVA 2JFHA 2EGUA 4RLFA 1IJBA 1GFSA 1XYYA 1D3AA 3R6WA 5EJGA 2CNWA 3SDSA 4B17A 5FLXA 2OZPA 2P62A 2P1ZA 4AJ9A 2DTEA 2LCIA 3E7FA 4I1RA 3K9LA 1YZYA 3ZCRA 3ZGZA 1OIWA 2MSCB 2YV1A 5EFZA 1I32A 4DRZA 1JTVA 3ASUA 1O0SA 5CX1A 2ODQA 3BWXA 1NMYA 4BEJA 2B5VA 3NI2A 3ZK8A 1CB0A 3STHA 3TE7A 3V32A 3ABRB 1V6CA 2OK8A 3QVWA 2DPLA 5MN6A 2PS3A 3EXG1 3SBOA 2XYHA 4HXFB 5CNMA 4LJYA 5I8PA 5F9HA 4BNHA 4AD8A 2Z4SA 3LBNA 5B3JC 3W5UA 1ZCJA 3L6EA 1DAEA 2JFBA 2OK7A 3INNA 3U17A 5I7EA 2G28A 3RADC 3I6ZA 1AIPA 2V0NA 4GKVA 5D00A 1QFSA 4M3NA 5CLLA 1FUKA 1P9NA 1IDOA 2FPOA 3T5CA 1E6EA 2WNIA 1JNYA 2DE0X 3DAGA 3ET5A 4PLPA 4ZMBA 2H08A 1UAYA 5J43A 3NBQA 2IJGX 2VDJA 1QHEA 1QHSA 2IYTA 3CRQA 3K3PA 3G7SA 3HS3A 1JHVA 1GSAA 1M73E 4K9RA 5FHQA 1WNFA 3H86A 3IPCA 1TYDE 4AY6A 3DTVB 3AQ4A 1WJGA 3IDAA 2G76A 1PG0A 3G89A 3L2OB 3PNQA 3EIOA 4X7MA 1E1DA 2OYRA 5SZJA 2I1WA 5LWHA 1TVCA 4M7OA 1UPCA 4MS4B 3AHGA 3AY6A 4UULA 3DKPA 5E6TA 1CY7A 4OXQA 2IXTA 3BY1A 2H1OA 5SZHB 2X0NA 1TD9A 3ZGYA 2PGLA 1TPZA 3TCXB 2AW5A 4WBSA 1B0AA 5KVQA 1ZOSA 3HWSA 4ODIA 5EZYA 3RARA 4M87A 4D8UA 2I4OA 3C6YA 4WN3A 3NHSA 3HA2A 2DSTA 2I2AA 1OH8A 1E3ZA 1NMSA 5ALOA 2C07A 3IO5A 4AUEA 4HT3B 5TQ0B 4ZTUB 2DHEA 2MTBA 1I30A 4IQGA 1NVFA 3TSOA 3ORYA 3QEBZ 3I5UA 3PNSA 3PRHA 1PUJA 2GJSA 4BVJA 3WGJA 5ITWA 2ZBRA 4P0PB 1NBAA 1KMQA 1KBQA 1N92A 2Q1UA 2VF4X 2ZVQX 3EQ7A 3ITKA 4LNUA 4A16A 4JQZA 4KU4A 3BH4A 4NY1A 5JCPA 1H85A 1QH1A 5IDVA 1WDWB 3PIIA 2ZSDA 3H11B 5T5QA 1NVVQ 4B09A 5FX2A 5KYUA 2XLCA 2AC7A 1SZPA 4LC1A 4N01A 4BXOA 3WRXA 3CBQA 1OY1A 4WK4B 3ZE7A 3D3WA 2FW7A 4HMPA 2OT3B 3FG9A 3HKDB 2BEKA 2OAEA 4KR3A 3HVRA 3FMVA 3JSAA 4LFCB 1CP2A 1IU9A 1QNLA 3SPXA 4RY8A 3KQHA 3FOZA 3KQNA 4G24A 3FKQA 5KNBA 1F7VA 2C2OA 2YWRA 2R86A 3MMNA 3ROEA 1OLXA 5GOTA 3LGXA 4RTNA 5DGTA 4QIHA 3H7AA 5KCMA 1I7PA 1VMAA 2A1UA 3WYAA 2C3UA 2XZTA 1WQ1R 5EXDA 1JYEA 4YROA 1ZSVA 2DHDA 3RIEA 2OO3A 1ZZEA 1IL0A 3G2OA 5KYGA 1YIJB 2WJGA 3VAAA 2R00A 2O3TA 5DI3A 4EY6A 3O8BA 1CY6A 1WKVA 1MQ8B 1IOWA 2GBLC 1UPTA 4IS3A 1K8QA 1EZ1A 3DCJA 2O7QA 3JQ7A 1EQ2A 1AXGA 1FFXA 2OCPA 1R88A 3A9WA 1L4MA 2W93A 5EI5A 4PSDA 3SNKA 3HM9A 2REOA 1AH2A 3KQSA 1CUYA 4KRGA 5J40A 1T4BA 1D9XA 3GJ0A 1DAPA 1NJGA 1TA0A 2AN9A 5DCYA 4BNDB 4F71A 4YY3B 3AIMA 4CKEA 4BNYA 3CLRC 3ENWA 2XB8A 3U3RA 1VLZA 1S0UA 2CVQA 3NYRA 5TEVA 3HJUA 2NVUB 2WFMA 5B1HA 4Z7JA 2LGJA 1VQ9B 2ZAGA 4TWBA 3G5UA 3IE0A 4QOGA 5JAPA 5B53A 3VNSA 5CBPB 2Q0HA 1R6BX 1UANA 3PSHA 2BOVA 2Q1TA 3BILA 2BONA 3KL2A 3NVKI 3FPKA 3I9KA 3ITDA 5BN5B 3PE6A 3BGSA 1XZIA 3NETA 3DEKA 4RMNA 4AJJA 3NIWA 3PHHA 3A11A 2BFBB 4J0JA 3Q7QA 4YP0A 3TBFA 4XNFA 3C7AA 1TJNA 2OFPA 3GIWA 3RJZA 4MGKR 4A2WA 2VWQA 1YJ5A 3M4JA 4BWVA 2HMUA 5LUAA 4FFBB 1AV7A 2Q5FA 2OB1A 5EMHA 2VDQB 1KY5A 4XTCS 3WQQA 3S44A 1X9GA 2DR2A 3H17A 5CYFA 1NUPA 4FD3A 1JR6A 3PTAA 3VR6D 4BTEA 6Q21A 4G0UA 2XZLA 1Z5NA 4OAQA 2GKOA 5JAIA 1Z25A 4JFAA 2OHVA 3JZDA 4NYIR 2DTDA 4I0WB 2FPWA 1GL7A 4HJRA 3PZBA 1SXJA 1EK5A 1VJRA 2H9YA 3B3GA 4Y9TA 1UJ2A 4KVGA 1M2VA 3BOSA 2R87A 3R9IA 3U62A 1TXGA 3TLJA 1OXXK 1VECA 4LF5B 1TO2E 2P3QA 1W5AA 2EF0A 2FZEA 3HM2A 1KFKB 4WADA 4F9GA 4QQRA 1VSVA 3W4KA 3ZOKA 2ZTVA 4KWEA 1OF1A 3DWFA 1BGWA 3EAQA 3ZE8A 1FMFA 3LGAA 4HEQA 1KZGB 1XC7A 3EARA 1OLOA 3U3ZA 3ZLBA 4P81A 4C7MA 3CCRB 5FQOA 2GAAA 3A9CA 3LVBA 1J8MF 2FFBA 3FE2A 2QY9A 3MINA 4IIBA 4NPHA 2ONZA 4Z0HO 4M53A 1QPZA 1AUQA 2WTEA 3BAZA 3KVOA 1KJZA 5DASA 3QVUA 2JLUA 5GIOE 4Q05A 4K9OA 2YWDA 3OFSA 1AURA 1V71A 4JC4A 4RWZA 5JOQA 3HJFA 5DM2A 3IJEB 1WUTA 1RBYA 3RTCA 4G23A 4HXEB 4AX4A 3H3FA 4M2LA 3W6OA 1L5YA 1WDKA 4CEJB 5MHTA 3HY4A 1KOGA 5B30A 1QX4A 1X77A 5A0TA 4L1KA 2X5OA 3K1ZA 1Q7YD 1I1HA 3NHFA 1UJ6A 4BVAA 2LV8A 4W5QA 3LQYA 3NKLA 3RVDA 1I2BA 5FRDA 3ZPNA 1P3DA 1B43A 2CRVA 3MWYW 1SY7A 1SKMA 13PKA 3IP6A 4ZCRA 1GDTA 1UQTA 2DPYA 5B1SA 3D8RA 3UFXA 4G97A 3CV3A 2GETA 3ZY5A 2DOGA 3SHVA 3AU9A 2W6OA 4B5LA 4IIJF 1SUIA 4I9UA 4COOA 1A27A 2BJWA 3CNEA 3DNPA 4HYQA 4BNZA 5KNBH 3B60A 5FUMA 5IDQA 2CYAA 4TTQA 4BLOA 3NE5B 2NO5A 1RM3A 2ZUUA 1BG6A 1CERA 2K7ZA 2IXDA 2PT5A 4EA7A 1WBBA 1I0IA 4YMUA 4HHEA 3WK6A 4P35A 3K1TA 3TFQA 2XNDA 4KVZA 1GILA 5HUHA 3RIYA 1HFJA 1U04A 4HDAA 3I04M 4HSEA 4OBEA 3GRYA 4BAUA 1BO6A 2Y3IA 4C0BA 1C2YA 1P72A 1VZ3A 3KYCA 4G2NA 1F06A 2W2XA 1X1CA 3VPFA 4KQEA 2AF3C 3MA0A 3ZLVA 3VAZA 3RSFA 3MWFA 2JGAA 3D0RA 2XCUA 3C8ZA 3GJ4A 1RRPA 2Q29A 3G8CA 3K7EA 4G37A 4M86A 5KTMA 2HF2A 4Y0VA 3ROGA 2DLDA 1GTL1 3EMDA 4GRDA 4JP2A 4YP1A 3RJMA 4B4UA 5L8VA 4HDNB 1ZUD1 5CFMA 1SRQA 1X39A 4FMPA 1VBFA 3O3MB 3PHCA 4GUDA 4PGFA 5HXAA 1Y3BE 1MABB 3VO9A 2ZZEA 3QSYA 2XGMA 1QP8A 4GYKA 4RCYA 4P3OA 4RLQA 1ORTA 2PXCA 4MITA 4IR7A 4DG8A 1ECPA 4Q4HA 4MWOA 3PU6A 3CD6B 3GVXA 2C9ZA 2YV5A 4NCHA 5EIOA 5JXJA 4RHYA 5L45A 1ZGGA 2X8JA 4AZSA 1W25A 3COPA 1PL8A 3T6KA 2AEMA 3DHVA 1TPYA 1M7BA 2ADFA 2PR7A 2WY2D 1FNBA 3ZCPA 2LE0A 4FEAA 2ZXUA 1LC3A 2PIAA 1TQ8A 2W6MA 3A9VA 4OBXA 1NU8A 1ZO8A 1DXOA 1GDHA 3UJNA 1A5AB 2W8BA 3EZGA 4CL2A 1NAIA 1HVXA 3M70A 3MQ2A 1C1HA 3FGPA 3QWHA 2I87A 2WDPA 1TO6A 5J4LA 3WAGA 1VLJA 2NQ2C 1GD1O 4OBBA 5J63A 2WTUA 4G0WA 2EFJA 2TMKA 4WUVA 4DR7B 1WQ3A 4UE2A 5FOUA 1J06A 3LQ6A 2G25A 3MBKA 3RKRA 1ADBA 4IP0A 4PC6A 3DC2A 1ZCBA 4HWTA 3GZ4A 1YS6A 2HQBA 3A1NA 1ZH0A 4ZAGA 3WMEA 4YYZA 1L7VC 1M8FA 3D0OA 2P35A 4PRLA 5IYNA 1AHNA 5CB4A 4IDQA 5FTMA 1BU5A 4FUQA 5JLJA 1EGQA 1Q7EA 2X6XA 4E5DA 4YEDA 3MSCA 1FSGA 2Z6BD 1E1CB 3E7WA 2A92A 4OFXA 2PUDA 3OIFA 1H2WA 2NO9A 3FUTA 1ULZA 6LDHA 2E5LB 3OIYA 1FS5A 2LUOA 3IKLA 4GPD1 1C9NA 1R5BA 1U3GA 3HGMA 1W4LA 3NTVA 5FR2A 4D0SA 3D7SA 1KQ3A 2P4QA 3CLHA 1TUIA 4DMHA 5ICCA 1W4CA 1THTA 3NGMA 3OPVA 3LLMA 2ZIGA 2EWWA 1DAHA 4F04A 1JR3D 3BCDA 4D79A 2G7MC 2HSEA 4YUZA 3EFOA 4HAOA 3MHPA 3CC7B 4LZLA 4MLDA 3U48A 1PEDA 2O7VA 2X5JO 2ZAMA 1N5DA 1Z0DA 4UPEA 1UL1X 1C7EA 3E05A 3T38A 3VX4A 1WWKA 2GN4A 2Q3HA 2C4VA 4AC9A 1S3FA 5CEFA 1C50A 3UFBA 1DJPA 1G2OA 3CW9A 3IMEA 4RXTA 3DHYA 1KQOA 1FNSA 3KVNA 1EWTA