1QUEA

X-ray structure of the ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 1.8 angstroms
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
303
structure length
303
Chain Sequence
TQAKAKHADVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP+ REDUCTASE
publication title X-ray structure of the ferredoxin:NADP+ reductase from the cyanobacterium Anabaena PCC 7119 at 1.8 A resolution, and crystallographic studies of NADP+ binding at 2.25 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 91
structure length 303
sequence length 303
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1queA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1queA02
1HA3A 1E63A 1N0VC 4ZCMA 1M90D 1QUEA 4TMVA 3B8HA 4RD2A 2HMAA 5THXA 1XE1A 3LVBA 4AF7A 1JJ2B 3FPKA 1KC8D 4ZCLA 2CNDA 4WQMA 1K9MD 5HXBA 1EFTA 3JQQA 3A1FA 3B82A 2BN4A 1KK0A 1GVHA 2C78A 3CCLB 1QFYA 1KTVA 1JNYA 1DDGA 3ZC3A 4RJLA 4FK8A 4Q7JB 4LBYA 2BM0A 4M1KA 2BV3A 2DEUA 1W2BB 1VQNB 1ZM3A 2YWHA 1F20A 1VQ7B 3CXCB 1TVCA 3WXMA 2VYQA 4RCYA 3AGQA 4TMZA 1KJZA 4P6VF 5GV8A 1H42A 4G1BA 3CCEB 1FRNA 4LC0A 1VQ8B 3VNVA 3LO8A 3JQPA 2DERA 3CCQB 1D2EA 1GAQA 3ZZTA 4C43A 1ZUNB 4H9GA 1FNMA 4B3XA 1W87A 1AMOA 1E64A 4YAOA 1A8PA 4F7DA 5H5JA 2YWEA 3WYAA 4PC3A 1K73D 3G6EB 4IW3B 4FWTA 1TUIA 1JA0A 2B5OA 2FX3A 3W2FA 3CD6B 4RD3A 2BMWA 1ZM2A 1FDRA 4QHYA 3CB4A 4ACAA 1E62A 2RC6A 5TY0A 2D74A 1EP2B 3LRXA 2OTLB 4RCZA 3CC4B 5DSZA 2R6HA 4N3NA 4Y9UA 1K8AD 4DQLA 4UAJA 4M0LA 4M53A 3PENA 1KD1D 3E1YE 2B7BA 2YWFA 4R71A 3CCRB 5GV7A 3I55B 1D1NA 3QSYA 4B47A 1Q82D 2GQFA 3V76A 1BX0A 4B43A 3CCMB 4PC2A 3LYUA 3W2HA 1EFCA 2BPOA 3AVWA 1CNFA 2XEXA 2X3UA 4MYTA 1U2RA 1BX1A 2HCJB 4G1VA 2QA4B 3SJZA 1R5OA 3CRZA 1NJID 1BJKA 1EP3B 1VQLB 1ELOA 2VNKA 4YHBA 4NBSA 1TLLA 2PMDA 1I7PA 2GPJA 1YHQB 3AVUA 1EFUA 4YAWA 1QUFA 1VQ6B 1IB0A 3W5UA 4ACBA 4G5GA 4YAFA 4YAUA 4FN5A 4J0QA 4TN1A 1R5NA 2NPFA 1EWYA 2QTZA 1J9ZA 2VNIA 1OB2A 1VQ4B 2RC5A 4TMXA 4ZCIA 3CCUB 1GO2A 1YIJB 3U6KA 4M2LA 3OZWA 3AGPA 1QG0A 4RD0A 4Y7CA 5EMNA 2OTJB 1OGIA 4RD1A 4MYUA 3CCSB 3OJXA 1FNCA 1QH0A 4NCNA 3CPWB 5FA6A 1Q7YD 2QTLA 2PLFA 1KK2A 3CC7B 4ZGNB 1QFJA 2BGJA 4BPRA 3J81k 1OB5A 4P3YA 1G7TA 1H85A 4TMWA 4RD6A 1KK1A 3QFCA 4Y9RA 1QGZA 4ZV4A 1VQ5B 1IJEA 4ZGQB 1FNDA 1F60A 3VO1A 3AVTA 3JQRA 1JB9A 3WY9A 4PGOA 4YALA 1KRHA 2XNJA 3CMAB 4B48A 3QE2A 1FNBA 2PIAA 4K1XA 1B23P 1Q86D 1QGAA 1M1KD 3WNBA 3OJWA 1SKQA 4PC6A 1XB2A 3ZZUA 4N3GA 1VQMB 3CCJB 1BQEA 4QFMA 2QEXB 1QX4A 1G7CA 1KQSB 3B78A 3OW2B 1GAWA 1QFZA 1VQKB 1DG1G 2AHOA 3W2IA 5KSWB 1G7RA 2VZLA 1N8RD 3VMFA 1B2RA 3ZBTA 5TV2A 1ZM9A 3CCVB 1NDHA 1YI2B 3AVXA 2E1RA 3QFTA 5H59A 1YITB 1D8TA 3U6BA 3WBJA 1VQ9B 3W2EA 1EP1B 3WNCA 3VO2A 2YWGA 5JBQA 4HE5A 3G71B 1G7SA 2QN6A 3P26A 3CC2B 2BGIA 4AF6A 2QMUA 2J7KA 2DETA 2DY1A 2OK8A 3I1FA 4PC1A 3ZZ0A 1GR1A 3E20A 1GJRA 1S0UA 2ZITA 4B44A 1IJFA 2DCUA 4RD4A 3W2GA 3ES9A 4PC7A 4TMTA 3ZBUA 1VQPB 1CQXA 2BSAA 1YJ9B 1DARA 3MHPA 3QFSA 4B4DA 3AVVA 4DQKA 3G4SB 1EXMA 3U2QA 2VNJA 4LBZA 5TR9A 1YJWB 1QGYA 2CRVA 1ZM4A 2EIXA 2B7CA 3W5VA 2EFGA 1QVFB 3WBKA 1AIPA 3VNUA 1SM4A 3P27A 1S72B 2BM1A 1FRQA 1DDIA 1JA1A 1YJNB 2C77A 3OZVA 3AVYA 3CW2A 3W5HA 4AC9A 1W35A 1QVGB 1W34A 3MCAA 2XNCA 4LBWA 4EH1A 4U9UA 4M4SA 3MMPA 1N0UA 4HE6A 1KK3A 1CNEA 2VNHA 3OZUA 4LBVA 2HDNB 1R5BA 1VQOB 2QDXA 2OK7A 1OGJA 3CMEB 3QFRA 4C0SA 1UMKA 1Q81D 1TTTA 3I56B 1WDTA 5AN9A 2BF4A 3FJOA 2BVNA 3WNDA
chains in the Genus database with same CATH superfamily
1HA3A 3W77A 1T3SA 2I8CA 3EZ9A 4TT8A 1OC2A 3VBEA 2V3CC 5I7VA 4FYWA 3WLIA 2IDJA 3IT1A 4OQLA 2FPXA 3PNQA 1E9AA 2L18A 3RVOA 2JI6A 4HQKA 3HBFA 4OKIA 5EESA 5LQKA 3IO3A 3UK7A 1T24A 1IHPA 5EAIA 2EOAA 1AUXA 2ONZA 4GPIB 3MJFA 3SSAA 4EGSA 2B4KA 5JC1A 1I0ZA 1JE1A 3SX2A 3PXGA 1KZGB 1ZCFA 4OP3A 3PVDA 2XMGA 3GMDA 4EW1A 4YUZA 5BUCA 4GMHA 1YDFA 4OGFA 4ARZA 1M6YA 5DHSA 4BNYA 3L6RA 3BZUA 3B82A 2VRWA 2Q6OA 4M98A 5ALFA 3HXKA 2Q9AA 4OYYA 2VH2A 4EG1A 5IZCA 3RLFA 3AZPA 3DAHA 4XEUA 3V1NA 3V8QA 1SBHA 2XECA 3ZI7A 4DQ0A 3LDGA 4U2FA 3ICVA 1T0PA 2QXUA 1WRBA 3CPEA 4HVCA 2ZUFA 4N41A 2C2WA 1N2BA 4KMOA 1O4WA 3AMVA 1EK6A 4MSUA 5LZ8A 3GLGE 3LQ4A 1UPCA 1ACLA 3GA7A 5BW6B 4DDMA 3MBOA 1KDYA 5AHXA 5EXXA 2XH8A 4G85A 4CU5A 5EWJA 1Y1SA 1TEZA 3LKBA 1P0IA 4J2OA 1PYGA 5I9LA 1R0SA 4KOEC 2BJHA 4C3OB 3DNMA 1Z34A 3LSTA 5JCOC 3SE7A 5L3RA 4MLDA 3TOZA 1ISJA 2B61A 2HBYA 4D43A 2QU7A 1MR3F 1L1EA 3ZWNA 5ADUS 2QMYA 4MV0A 3WO0A 3CNQS 3VZQA 4R1UA 4P3IA 1XF1A 1QFXA 4BIMA 1FUYB 2Y1OA 2H65A 2X2OA 2BHNA 3C3KA 3CLTD 4R31A 2DHRA 4D74A 5T8KC 2YFKA 5IRCD 3T56B 1SHUX 1DBVO 4R68A 4M8NE 1P2GA 1XWWA 1Y8AA 3SVZA 2PLAA 2KPOA 4TYPA 1KZ9A 1ZWLA 1LBTA 3I58A 5FJIA 1D4ZA 1UIMA 2PGXA 3QA9A 4AY4A 3LT4A 3C14C 2FJPA 4OLBA 1A7UA 1TVMA 4GRDA 4ML3A 4A2PA 4AMVA 5MDHA 2B36A 2ZOSA 2VKQA 1TCVA 4HFRA 2FZVA 3TSWA 1YL6A 5EKTA 3UG6A 3K1TA 4TWRA 2YUTA 1M2NA 5DHPA 1WZNA 1JP7A 2EJTA 1KU6A 3A26A 3HBJA 3I1IA 4OUKX 1L5YA 4QRIA 2J87A 3D64A 3NOOA 1F6DA 1MH9A 4L5BA 3OT1A 5F3DA 3C4QA 3EVDA 4J0DA 3U7RA 4L08A 1QE5A 3D6VA 3OFSA 1IY2A 1JQEA 1DO0A 2OESA 4LRSB 1V9SA 4WJZA 2CMDA 1YRYE 3ZZTA 1RP7A 2BGUA 1CB0A 1E2JA 3PHBE 3HNOA 3DGEC 3GJTA 2ZRHA 2XUZA 3N8HA 3B6ZA 1Y3AA 3CLUD 3NATA 5A3VA 4QWMA 4B3BA 1QXSA 1ZHFA 3K0HA 1MD9A 2OFPA 5CVDA 3OP4A 4KO3S 3NRBA 4YAOA 3H3FA 1AVTA 2IDKA 1J8FA 2EFDB 2X0KA 2X14A 2YC2C 3GUCA 4Q1FA 4ZI7F 2HDHA 3VTAA 3DLHA 3OPOA 2FGJA 2R6ZA 1PS9A 1THZA 1CR1A 1JQDA 1CQZA 3NASA 3G2NA 1RXCA 4MS3A 5TMDA 3LUKA 1R4NB 1BWQA 5I4BA 4HKTA 4X41A 1D0SA 1LVUA 1A98A 3IEKA 1YHZA 4D0GA 3QU5A 2XF8A 3I42A 1GUFA 5HQ3A 4M21A 1HDEA 2IVZA 3R0IA 4D56A 3H87A 2VYFA 4MQUA 4WK4B 2O07A 3WRVA 5F51A 1GU1A 1OLXB 3OTGA 4WNAB 4MUKA 5AVXA 2VJMB 1KYIA 3VTZA 5H9VA 5BWMA 2I4OA 5TY0A 3TAXA 5FOUA 1SUAA 1F4PA 1V25A 3QF7A 4I1RA 4UMFA 3TLGB 3HB0A 4MUNA 3VKVA 3W9BA 2H85A 3ZJ5A 4Y2UA 1YTLA 2EQBA 3BH0A 3IDOA 1UXKA 2VF2A 2IELA 3AKCA 3K0BA 1N75A 1OBOA 3MZ0A 1YQWA 4O33A 5HIJA 1ZD2P 5JS2A 2Y2UA 2Y0CA 4BNWA 3B3JA 4YLEA 3HA5A 5DJ5A 1WULS 5G53C 421PA 4DV1B 4UM5A 2RK3A 1X80B 3LQQA 1F0NA 1KHHA 2A86A 3BEDA 3ITKA 5KJFA 2ZYSA 3UHJA 2XWBF 3IUSA 4C4TA 4JC5A 4X54A 4C5AA 1V16B 1WNFA 2B1IA 2BKEA 5T6MA 4B3HA 2Z2XA 3KQWA 4XKWA 5HE9A 4ZGBA 2L82A 4XARA 1RKBA 1N2ZA 3IB6A 3V76A 4DV0B 1L4EA 1OUMA 3QXHA 3W2HA 2WT4A 2ZJBA 2JFBA 1M66A 4QU5A 5F5LA 3ZV3A 5JRJA 2QBYA 5M3BA 4PFQA 1RVDA 2UYCA 2AOTB 4P36A 4Q9IA 4Y7DA 4YIHA 2I71A 5JS8A 3A6EA 3OZGA 2OCLA 3ANSA 1Q1ZA 1Y8QA 3PGKA 3A1SA 4MYTA 3T5GA 3USCS 2OD9A 4OIMA 4DJ5X 4N0QA 1SN7A 3R41A 5I9IA 1W4ZA 2H51A 3LLVA 3EZNA 3I2YX 3ZVKA 2AG5A 3N8GA 3V7FA 1HRDA 4ZT5A 3I9V1 1KEEB 4NAUA 4RENA 2B35A 1VGRA 1LU9A 1NJID 5CW2A 1ZICA 2ZTSA 4K6GA 4MB2A 1Z63A 2YZ2A 1Q0QA 3CR8A 3JWHA 2HBZA 4MRMA 1KQNA 4J03A 1RRKA 3HCCA 1SOVA 2P9YA 2P75A 2IOHA 3N8NA 1QC5A 1YHQB 2NYUA 4KMRA 4WFQA 4CF5A 4QLBA 3X1KA 3QOXA 5IBQA 4RL4A 2J3JA 5K0CA 4UXIA 3GEPA 4ETWA 2VJOA 4K9MA 4HDSB 1LW6E 3IQZA 3I2GA 5E4YA 4NAHA 2J9ZB 4F91B 1KYZA 1EZ4A 4YWJA 4JBIA 4PBSA 2X0JA 3BFJA 3JYPA 3KJXA 2FPLA 1AA6A 4L2IB 1DL5A 4H35A 1L9KA 3JRNA 4CIXA 2WFMA 5GQSA 4OGWA 2EW8A 2BFCA 4IPTA 4JAVC 3R7FA 2QJWA 1PJSA 1LF0A 1NBAA 5JAOA 4BMPB 2J5RA 5JSUA 1NKTA 1XZQA 3KE9A 4ADSG 4C20A 1CD5A 5LUAA 5ALJA 3Q6QA 3BC1A 1J97A 1JHYA 3DE2X 3B2EA 4M8SA 3T0GA 3IT0A 4DMCA 2BRUA 2VNIA 3OX2A 4E5YA 1OHHA 4HNQA 1QFSA 3GRKA 2LNDA 3P2EA 4ILEA 1GO2A 4CL3A 5BNZA 2A5LA 5EYPB 4CMJA 2CF4A 3MGAA 2VR1A 4LJKA 4TZKA 2AR9A 4D80A 3FOZA 2OZVA 4BNHA 4F3KA 3VPAA 4C0JA 3ZLJA 3T1NA 3M6AA 1S8OA 3S0JA 4KGVA 5T64A 4QX6A 5HSGA 4KRFA 5FNVA 2ID8A 2H5JA 4UCQA 5L8VA 4MAMA 3B1VA 3ONVA 3IAEA 5BYBA 3O8DA 4QL3A 3CCSB 1L5LA 4IIGA 4QUEA 1LEHA 1NNSA 3BULA 1W581 2VSFA 4UD2A 3S2YA 1U9JA 3MQFA 4EQ6B 1KZYC 1WOPA 3KQVA 1GPJA 3MT7A 3RYHA 1KKMA 1QH1A 1Q1GA 2P4EA 3UJ8A 2ZEJA 1C1XB 1HLPA 3L8CA 2YIMA 4FC6A 3O3MB 3A9CA 3IQIX 1CJKC 1Q15A 1QVRA 4Q01A 4MVYA 1P5JA 4WUVA 5HTOA 2NT4A 2I91A 3G0HA 3PJFA 2ZR8A 2D1YA 4LVNA 2MSNA 3U31A 5A5EA 4P82A 3OD5A 3KSUA 3B3FA 3ZOKA 5L3VA 1OB5A 2G7MC 4HQFA 3THRA 2GCNA 5I9SA 2FX2A 3G0CA 4AWAA 1DKLA 2AFRA 2IE0A 3L82B 4EENA 3EAQA 1KK1A 5E6UA 2GYWA 4MIOA 4ZCSA 4EA6A 3OZTA 2WD9A 1W85B 3GF4A 3I01M 4KPUA 5DHAA 5LP6C 1T6NA 3I09A 1BMTA 4ZV4A 2W2KA 3ND8A 3PE4A 1IJEA 2NQ8A 2Y05A 4M76B 1UKAA 2ST1A 2VCYA 1UFRA 1EVIA 4GWGA 1FXWA 1UH5A 3FY4A 3UAYA 2X6RA 1XMVA 1RYDA 3GYBA 3WYDA 3FXAA 5GJWC 3F96A 3LWDA 5FTWA 5CYGA 2A5YB 3C45A 4EJ6A 3MBKA 5IBCA 3HAGA 5DYIA 1MB4A 4BNDB 2CV1A 4YALA 1ZK1A 1KRHA 3SZ3A 3AY7A 4K87A 1BH2A 3VV2A 1DBRA 3I9JA 1P8AA 4ZWNA 4HX2A 3EFOA 1R6BX 3GCDA 3N75A 1QHYA 4JVSB 1TRKA 4RV5A 3I61A 3N2GB 4MUAA 3ZDBA 1WKBA 3I64A 1QYXA 2ZI4A 5CVUA 4L28A 1RPTA 2OSBA 3O9MA 1FDWA 4G7XA 1G19A 4HQNA 5CA0F 4QREA 2R3SA 3DMGA 1SKQA 4LF7B 3ZZUA 4I9HA 4E6EA 3WLKX 4LRXA 4EG8A 2YICA 1P7PA 1IQUA 1PNQA 4MV7A 3AIKA 4JC4A 4YDQA 1NJ5A 4LE2A 4Z0TA 3DO8A 3ZCSA 3EPJA 3THXA 2OA0A 1QANA 5EIFA 2DQSA 1WX1A 1YRBA 2FQQA 3KPYA 4LRQA 4QE3A 2FMIA 3A3BA 1YVRA 4UHJA 2ZKIA 4D8XA 2GA9A 2PSFA 4ISCA 4TWAA 4UHDA 4YV0A 1CUWA 1ECCA 1A1SA 4CV1A 4DYDA 3KQKA 4B3RB 5AVRA 1EE1A 2VHUA 2X4DA 1R6UA 4Q7QA 4O4JF 3SQXA 2GCOB 2GN8A 3DPSA 2PJRA 4MVXA 1TM5E 3AJ8A 4J75A 4ZV7A 2CBXA 2JGFA 1VCMA 1WXXA 4U7HA 4RTPA 2ABWA 2E0IA 5KYUA 1TF2A 3RK1A 5L6MB 3LL7A 2PZMA 1WUKS 1K3UB 2ZUTA 4JVNA 3EEFA 4XVHA 3CWQA 3M4JA 4XLCA 1ODLA 4NULA 5G41A 3WOHA 1S89A 4DJFC 1QCZA 1QHFA 1WMFA 4I99A 3NORA 3GMIA 4L9WA 3EZXA 4GOND 3HBMA 3UF0A 1U9YA 3UWPA 4X97A 1WXHA 2OBRA 1EP1B 1ZS9A 4KXXA 3QELA 4ME6A 5FI1B 3U17A 2AKYA 3IBTA 2GFIA 2Z6QA 4HQRA 1NUHA 4L0QA 2BDTA 4YYEA 4EJSB 1N36B 2QN6A 2JFPA 2QTHA 3O3OB 3TQIA 4EZIA 1UBEA 1JLHA 3QTTA 4K0RA 3RHTA 3TWOA 4YAGA 2AKAB 1GFZA 4FFMA 1RFGE 4FU0A 1QX3A 5CNJA 4HFJA 1T2CA 3GJ5A 4JR2A 2AZTA 3QQPA 4L4SA 4ITRC 3BWYA 1DKMA 4WXYB 3N6VA 5CAEB 1HDOA 5JVDF 4BQQA 1QO7A 1IUOA 5FWXA 5DNDA 5BMVA 4LQLA 2F59A 3KHUA 2IH4A 2QM3A 1U5AA 1L5ZA 1H1TA 1JRLA 3M6VA 3AL3A 3ZY2A 4CKCB 1O5IA 5CIYA 4EHKA 2BELA 4L95C 5CFZA 4M7WA 2CDBA 3BB1A 3KRTA 3M3HA 1SKUA 2PS1A 1MKYA 4AX4A 3IR5A 5JWOA 2WWRA 1SCQA 2TMDA 2XMCA 2XWJI 4X95A 2FSVA 4YBZA 3VR4D 3C6YA 1EWRA 2AYZA 4NH0A 4RSRA 4F7WA 3TG2A 2HM7A 2QOEA 4GS5A 1JQ5A 4KO2S 1YR3A 4BBAA 1SQ6A 5KWVA 1WKVA 4B4DA 2J4FA 3R5SA 2JGEA 5IVPA 1LQTA 2Y1GA 4NLLA 3ILXA 1FLNA 1UD2A 4JKOA 4Q9HA 5E9AA 1RW4A 3KB6A 1CWUA 1ZGZA 2D1FA 3OJLA 5DU2A 5J3JA 2XMPA 5KOIA 1YR2A 2FU5C 2ADFA 1U3GA 2JAWA 3LLSA 3DC2A 2Z0MA 4RVFA 3WRYC 4CLXA 4M83A 4CF4A 1V71A 3UOWA 4BUCA 3GPDG 3PCXA 2PGLA 4QXQA 1FFHA 5AI6A 4MQEB 2FGKA 4CYMA 1EEHA 4CM5A 1VA5A 1UPTA 4LNHA 1AIPA 2ZE8A 5DBFA 2Q2NA 1MUUA 1VG9B 1WOYA 2VJAA 5BNTA 1KIAA 4PGHA 2XTNA 3ZYCA 1URPA 1JXAA 2QTWB 2R6R1 1GPYA 1RBMA 2A1UB 3D8RA 2R1UA 1VJRA 3G1TA 5M7EA 1GZDA 5FHQA 4D0LB 1N5KA 2O1EA 2W7TA 1K98A 1VE7A 3SYLA 1AHPA 1JIUA 3OZVA 2BFBB 5JBIA 1Q1BA 3W5HA 2G5TA 3IGFA 3SQOA 1HR0B 3I12A 4EATA 4GPZA 5BQOA 1QVGB 2ATXA 4AMBA 4W5RA 2XNCA 3C3AA 3ZU6A 1SEVA 2HT6A 5EEGA 3T5CA 4RC9A 5E95A 4AT1A 1JEEA 4KIFA 3PE6A 1S01A 4HWPA 4DT1A 3W8DA 1KK3A 2AK3A 3L43A 3RDPA 1GAJA 4Q3BA 3X3HA 1E2LA 4ZJYA 4W1SA 3OPQA 2GYYA 4FCCA 2ZLBA 4EB6B 5BY2A 1Y5IA 3ZWMA 3BHMA 2VNHA 3A9VA 3C3YA 4HDNB 4K7JA 4ZAVA 4BLUA 5DW0A 5AI8A 2VQEB 3O92A 3KHTA 3RGGA 2POCA 2AFVA 5EHQA 4PRZA 5K8IA 1G8MA 4MP8A 3K0SA 1C3LA 3NDIA 1OGJA 3CMEB 3G02A 4WH0A 4HWGA 1T5HX 3P2MA 4N0PA 4XDZA 2G67A 4U7WA 1H0SA 4NJEB 4PAAA 3FNRA 3T5DA 2PXAA 3ZWDA 3V55A 3SJBA 5IVKA 3IAUA 4JWTA 4CM8A 1P4SA 5JD4A 1YULA 3K4HA 3IRUA 5IXYA 2YMMA 2J5BA 4U0KA 4MUBA 4I6JA 3WNDA 2HA2A 3TYXA 1USVA 4R0NA 5FYQA 4C14A 5CXSA 4MW7A 1P6XA 3NNDA 3EZ6A 4FJ2A 4OTZA 2WIDA 2Q4DA 4YCDA 1WW3A 2IPNA 1LBHA 3NBYC 1JT2A 1XRRA 3AIMA 3FMVA 1LLQA 4W99A 2QQ0A 1ZXBA 3I4CA 3OUUA 7YASA 1KC8D 3NH9A 4GYJA 1G8HA 3CNOA 4IZHA 4N6NA 4YP7A 5A5DA 2HU2A 1WTCA 3MOIA 2KSQA 2H52A 5K0NA 4HDRB 3RS8A 4RORA 1JG1A 3PL1A 3PKZA 1SVOA 3AHCA 3HA2A 4G63A 4KPGA 3DE6X 1ZK4A 1PSDA 2NTYC 3NOVA 3HH8A 3OAAD 3ZIDA 1Z37A 4GOKA 4W5QA 2C61A 3WFIA 2ZDQA 3QUTA 1Z4JA 1EFVA 2C2ZA 3WGTA 4GL4A 4OD0A 2Y0EA 3DSRA 2HO4A 1JWBB 5CA1A 4ESHA 2W42A 1T0BA 1JTVA 1J6UA 1PZNA 1XZNA 3W5IA 2Y8EA 3ZI0A 1U3CA 3PK0A 4XYLA 2YWDA 2A30A 4L22A 4FYKA 2AZ4A 2C78A 1PQYA 3K0FA 3VMMA 4AY3A 3CF2A 3U4CA 1IATA 2EVWX 1NPTO 4DR2B 3SVLA 1OROA 5BP7A 3A1TA 4P4UA 1UPUA 1JQBA 1DJNA 1DC5A 4I2NA 4HNUA 1HDXA 3U16A 2AOWA 1OFUA 2AMLA 4Z51A 3GEGA 1NPDA 4I4CA 1ISFA 3GGGA 1F8GA 4QBHA 3G82C 1E3ZA 2HIGA 4G4IA 5C8YB 3M9LA 2EBHX 1PNVA 2XT0A 3IUQA 5EL0A 3W5JA 4RJIA 1BWRA 1BXGB 2R1VA 2YBDA 3L6OO 4CF3A 5KX5A 2Y67A 1OTXA 3S29A 3OOCA 1JEQA 1XD8A 2RBEA 4HLUA 4MYHA 1JX6A 4GI2A 1Y5MA 4BWVA 2A92A 1K66A 1XVVA 9ABPA 5EJ2A 4CKWB 2BE9A 3OWOA 3R6GA 5DISB 3ONNA 3T3HA 3M70A 4LWZA 1MPXA 4R1NA 2YS7A 3DE3X 1PFQA 1T5DX 3VR6D 4CMKA 1I1OA 5KTNA 4E1VA 1FTWA 1UBRS 5ILQA 2F8LA 3I2IA 4P6VF 1CLUA 2IV2X 5CNKA 4AY5A 1X7ZB 1PDOA 4KEAA 3TCNA 4Q93A 2PRIA 4QXOA 1G291 3BGDA 4OEHA 3IE1A 1MU0A 4JLUA 4YRIA 1D2HA 1P5FA 3CB2A 1TA4A 5FBWB 2XMZA 1FFXB 1E1RA 2SBTA 1OWPA 3L04A 4B7UA 2F90A 4JT8A 2P77A 3SHOA 5HZBA 1PS8A 2GZ3A 3ILSA 3DLIA 5NLLA 3HXQA 3FJ1A 1RIIA 1QWOA 2QPTA 2RHDA 2B0CA 1Y1QA 1N5JA 3OM0A 1R15A 1T2UA 2AH5A 2J07A 3KFXA 3EGEA 1WCV1 4YA6A 1NNI1 3EZFA 1GZSA 3EGWA 4GOXA 1SC1A 2L69A 4RVGA 1GAQA 3GBVA 5AJZA 3UHFA 4LSZA 1V0EA 1YAJA 3DPIA 1FDOA 1GUZA 3P0IA 4ZVSA 4EBFA 4OK5A 1GCGA 4NOMA 1PRYA 4HUTA 2F3RA 4PGFA 1B1AA 1E64A 1T1RA 2PPVA 2QTVA 2WVAA 2Q8PA 2WKWA 4LIPD 3ZXYA 2DYKA 3DZGA 4W1RA 1IYZA 3ZHVA 3EQZA 3K0CC 2W2OA 3NTOA 1A9SA 2W98A 1Y4ZA 5CW1A 3TNYA 1UBJS 4DM7A 5J4YA 1MGOA 4Z4HA 3L0CA 2YNMD 1KAEA 4J1TA 3A25A 2PE3A 1JSZA 2ZB4A 3KR0A 5DHQA 4FE4A 4HMOA 2GHQA 3W6PA 1N3YA 3N58A 3ZBPA 4F2DA 1TUIA 1BWPA 2RFLA 4RF2A 4EARA 3K0KA 3NBAA 3MYYA 4DQUA 1OKKD 4MGEA 3SMVA 2M6LA 1IWPB 3I62A 2HSWA 4J3JA 1U7WA 3DYIA 1G6HA 4W1QA 3HB9A 1UMBA 3HR4A 3K1YA 3ETHA 1YUNA 1FDRA 2VNSA 2G80A 5HZHA 4URFA 1NHWA 3KZMA 1ONBA 1YF3A 1O3YA 3ABSB 5CEFA 2V7XA 3E2IA 3E3AA 4W8HA 4X1KB 1R16A 1GTZA 1LH0A 4RKQA 5AVJA 4JJZA 3QVVA 5TGTA 1A9XA 5K7SA 2F8MA 4YDHB 1M3SA 3QVSA 1Z0IA 2BFNA 2GESA 2YWBA 1WSVA 1CK4A 1N1DA 4HWRA 3UMFA 3TTTA 4E12A 5CM2Z 2WYRA 1OBVA 1X8JA 5DXAA 1PR6A 2DTXA 4WZBE 3FOBA 3BJEA 3ZIUA 4RVSA 1YDWA 4M0LA 4DR7B 3LHKA 4M53A 3VSCA 2X8BA 5MN5A 4R71A 3DMYA 3F6PA 1JHDA 2N9UA 1D1NA 3DDYA 1P3JA 4LJ7A 4TV9F 3HS3A 1Q3KA 1EESA 1M73E 3GJQA 2CB0A 3O4VA 2R60A 3PQ3A 3D6HA 3F6YA 3A6JA 1T8UA 4PXSA 4RTJA 3BTSA 2EERA 3AHJA 3H6GA 2OMKA 4DKXA 3FJYA 4KNYA 1FFBA 4OFZA 3D8HA 2BTQB 2FWJA 4E2XA 4U7JA 3G0OA 3THYB 5JNLA 1Y1LA 3JTEA 4XYGA 4DIDA 4Q9DA 3W4JA 4UBOA 4I9GA 2OCBA 4Z4EA 5TNXA 2QG9A 1TB4A 2B8EA 1H3FA 3DQPA 5AKZA 8ABPA 3C70A 3H4IA 2VQSA 4QG7A 4UCXA 3EW9A 1C0EA 3N59A 1AMUA 1TYBE 1U1GA 4WY8A 3JY6A 1T26A 1I1HA 2QPAA 1ZVKA 3FPBA 4A0GA 4GNKA 3MUFA 2GHRA 1T2AA 1M2EA 4KH0A 4QVKA 5ED0A 4B4VA 4NICA 3T9CA 1I9GA 3D31A 4HMQA 3PFWO 1RE1A 4M0FA 3P0JA 2V6GA 4KYVA 4J0EA 4YO7A 3FLEA 4B82A 4BOYA 1GPKA 1NP6A 1RVV1 5DM0A 1ZIDA 1SD5A 5CLGA 3ITDA 2I87A 2TMYA 4M6WA 3WAKA 5HFAA 3OCYA 1YV9A 2QN8A 3WLEA 2FX5A 3DNPA 1U0OC 3ABRB 1RQRA 4R2LA 1KPIA 5K0TA 3G9TA 5FUVA 4A27A 5LQCA 4UCFA 3Q87B 4HNRA 3VX3A 2ZM5A 3LW7A 1XMOB 2C1XA 3WKAA 1P81A 4KREA 3CG0A 4XWGA 3FOFC 3QI2A 1UINA 3R5FA 4TTJA 4GBJA 3NDRA 3RREA 4R05A 1SCKA 2EKPA 3I3SR 2O5CA 3PUZA 2JI7A 1YRWA 3DBVO 2O19A 3CH4B 4TMXA 4FGKA 1A3CA 4Q48A 1XQWA 5BV8A 3GRAA 3EBLA 3G2OA 2GETA 4UHCA 2VK1A 5KKCA 4X8MA 1O77A 4Z3KA 1THGA 4H59A 4UU8A 2NU8A 3C8MA 1SKYB 1QGOA 3BSYA 5DF1A 3VOBA 2NO0A 1E8NA 3AY3A 1DAOA 1LSSA 1ZUNA 1TF7A 3PDWA 4GLOA 4HADA 5HFNA 3VDMA 1GWNA 4BEWA 3A7EA 4YRRA 4C4RA 1XTPA 3GR6A 2QJOA 4HRXA 3WB9A 1KY4A 2I1VB 1I7DA 1L7QA 3UWKA 5BWNA 5B1YA 4GLJA 1BGVA 1NUUA 4JUBA 3CMMA 3RJ9A 1DFHA 3VAZA 3QJYA 5EWMB 2ZYVX 3T6KA 1P3DA 2R47A 3THSA 1NBIA 3IAXA 1XMPA 2FMUA 3OE1A 4O4IA 3TLJA 1Z73A 4YAIA 2GSWA 5I9NA 1KK2A 3O8NA 1L1QA 2NUAB 5B2EA 2CV2A 1GPH1 4LGYA 1AXEA 2VPWA 1MHTA 1L5SA 3EOBI 2XOXA 4BAZA 3QOWA 4BFSA 3R44A 2FSSA 4MULA 1U0HC 5E4FA 1OXSC 2WMOB 1O8CA 5D51S 4CIVA 1D6SA 3IEUA 4A10A 3REQA 2O7SA 4Y2PA 2R8XA 4TL9A 3V7NA 4Y9RA 5BNIA 3QLJA 5DMHA 2WKPA 2R7KA 5ERGB 4OLJA 2XYRA 1I7NA 1YH3A 2WAAA 1UOOA 5D87A 1P9RA 1YMVA 5L3SA 2PS9A 2VBVA 2WUVA 1WABA 1TW3A 3DL2A 4NFLA 1WY7A 1WOOA 4RFSA 1ST3A 3BKWA 3G5UA 1PUJA 2AD5A 1WPCA 2R5NA 4RGVA 2PUHA 1F2TB 4IHAA 4H16A 3R40A 3SLNA 4N5NA 2VDWB 1L9XA 5F21A 3SEQA 3HN7A 4E13A 1NN0A 1QLJA 2BFFA 1H0RA 2JGNA 4LE0A 2BZSA 4B48A 3QV1A 2YFQA 1PJBA 3NHBA 3ETEA 4UTXA 3ABZA 4WOCA 3BGIA 3UMJA 4JC8A 2AFHE 5ICMA 4OBXA 4LE1A 1ISMA 4N0MA 1OIWA 3FWZA 4TRJA 3EZGA 1U2PA 2CEAA 2PLNA 1FSZA 2P3MA 3DWFA 3ITNA 4A0RA 1QH8A 3ZDRA 2OV4A 3ZK8A 1H3EA 4TSFA 4R4JA 1R0ZA 3HWWA 2GK6A 1SCUA 1SNYA 4L5YA 1XB2A 2WDPA 1T9DA 4M7PA 4TUYA 3U0VA 4A3SA 4DY6A 1U8CB 5C1BA 4N3GA 3HR8A 4D4GA 3NEJA 3PIRA 5A0TA 2Z58A 5JXJA 1KO7A 4WXMA 1USWA 3GAZA 2FFAA 4PLPA 1T5IA 3VNRA 4ROXA 2QZPA 3SR0A 4MGZR 4MIYA 4ZYVA 3TRJA 4EG0A 2DLNA 4OSOA 2LZJA 2OQ2A 5LP1A 3ZPNA 2WSBA 1QS0B 2JIRA 4YDSA 5CB4F 4CCYB 1N6IA 3UA4A 4DV6B 3VU0A 2O50A 1Q7CA 3OE4A 4MJXA 2G0AA 5DE3A 1RYMA 1N5MA 2NZ2A 4EYKA 4Q6WA 3EIQA 3GJRA 3FZGA 3OUTA 3PE3A 4A8PA 4BVHA 1J5EB 1US8A 3IALA 2JLYA 1JLRA 2F3SA 1DKQA 3PFCA 3C41J 1W0KD 2BGGA 3I2HA 3TGLA 5LL6P 2O5RA 3LPAA 4DXHA 3MHTA 5LOVB 3IULA 2NV6A 1FW6A 3CNHA 2YVUA 1KF0A 1VKZA 3SCZA 4CLOA 3AHHA 4MWDA 5EHIA 4OHFA 1YMQA 1W0JA 1DC6A 5HBGA 3TJRA 3LPNA 3X1ZA 3NTUA 1H0HA 3X2SA 3UFXA 4AJKA 2C4UA 2BMJA 4L6AA 4GAEA 3CLRC 3G05A 3GVJA 1GKKA 1KAOA 3V48A 1G7SA 2DHDA 2PTGA 3CC2B 4MR9A 3FCOA 2XOEA 4KX3A 4WNYA 5BSRA 1I3NA 2RH5A 1VIDA 1Z07A 2CZQA 3VU9B 3DC7A 2QMUA 3GRFA 3ONFA 3ZOZA 3BK7A 3RS0A 3ENVA 2WU0A 3IDFA 4M9CA 3FFWA 5HEKA 4RPLA 1CY1A 1ATIA 4UULA 5L9AA 2X1MA 1PEDA 4KCGA 2QLJA 3EGXB 2IOYA 4GICA 3ODGA 2GD1O 1Z18A 5DULA 1NOIA 3HTXA 5GJBA 3T8YA 4XE5A 5DP1A 5AOAA 4ZREA 3RT1A 1SA0B 4TMTA 1XP8A 2D54A 4KGZA 4OBEA 4KMMA 1A4IA 2Z83A 4WKBA 1YS4A 2WHPA 5BN5A 2IPLA 2V7EA 3LF1A 3UHAA 4BLSA 3N7UA 1F38A 1QNLA 1Q6ZA 3RUFA 4D4KA 3T0IA 1TCBA 2FZLA 1LTKA 2H2FA 3GJ7A 3MWEA 1NRIA 4X00A 5CYFA 1G4AE 3KEOA 4OK3A 1I7LA 3STWA 2Q3LA 2VNJA 4TKUA 3NHRA 4FDUA 4CG0A 1K6XA 1Y3IA 2GD2A 1KNXA 4NNOA 4B3JA 4YR7A 7ADHA 1BROA 2RH9B 5EPOA 2WF8A 2JGJA 1HX7A 4D9IA 3UXYA 1U0LA 4Q3DA 1JEAA 1K7XB 5ICEA 3KQLA 1N78A 5T7BA 4DDUA 3RO7A 1E6MA 1RM3A 2H1RA 3F9CA 4E6PA 3NP9A 4OCZA 2DYIA 4J91A 5J43A 1NB9A 1TUBA 2Z1DA 5CB6A 1SM4A 1PW5A 2JVIA 3R5HA 2H54A 4FINA 4Y2JA 1D6MA 2BM1A 2QT0A 2VATA 1QV7A 2N3ZA 4KYUA 4QO8A 3M9XA 4KQCA 5JYEA 5KSYA 5NULA 3QE4A 4HWOA 1YB7A 4WZKA 4U3JA 3QZUA 5M34A 4HB2A 4X8IA 3RQIA 3RRZA 5FNZA 2K87A 2WQZA 3V8MA 3G8BA 2WYOA 3SD7A 2IIVA 3E7DA 1YI0A 2JIOA 6CHYA 2NU6B 3IPRA 1PJLA 4U9UA 1KYTA 2FEPA 2FPOA 3FUWA 3KDAA 3N2KA 4DG5A 1THTA 1VLOA 3LH5A 2IGTA 4HE6A 4DUYB 1OREA 2GHIA 1POXA 3NE5B 1YRQA 2DC1A 1P77A 3JYNA 2IEBA 3GDWA 4C4YA 1YQDA 1UMDB 3D8NA 3RC3A 5AVKA 1OAOA 3G2JA 4LXXA 1GD1O 1JSLA 3NHKA 2D0PB 3DE5X 7REQB 2QGZA 1P19A 1K28D 3DHVA 5REQB 3AJ9A 5K3DA 5ELXA 1X9GA 2XD9A 2ZL5A 2W2PA 3PQCA 2Z57A 1VSUA 4FBGA 3O26A 1EYZA 2AF3C 2HL6A 3QI7A 4IH9A 5EGSA 3TRKA 3W8FA 4EDHA 1SHZA 4C0SA 4W4TA 3H1PA 1OILA 1SZCA 2JAOA 2CHUA 1MMFB 4XIJA 2IV7A 2J0QA 3QUBA 3Q9LA 5AKEA 5DXFA 3I56B 3F2VA 5I4CA 3ZHUA 4KVAA 4KRGA 5LWHA 4QWWA 4CCAA 1IY0A 4GR4A 5ICGA 5FO1A 2DULA 1BC5A 2ODEA 3DT6A 3QLVC 4IFBA 3F98A 5LM3A 3MCWA 2QV7A 4BKRA 3DVAA 4QOHA 3A3YA 4K3UA 1W88B 5TC4A 1KAQA 1CS4C 1XZKA 4UHFA 5DTEA 4Q03A 3B8HA 4CMHA 3NEAA 3HV0A 3W5SA 2GX6A 2CDAA 3IEMA 5FPHA 1UBKS 1M34B 1NATA 4RWEA 1ISIA 3QE0A 3JALA 3VH2A 2I99A 1YHNA 4G56A 4YP1A 1K9MD 3F97A 3B1WA 2NU7A 1P31A 1MG0A 3KYDB 3UWDA 4C0WA 3FMOB 1IULA 1IHOA 3OMXA 3DLPX 3MN1A 1PR4A 4NTZA 2ETVA 4RLZA 5F7ZA 3WIOA 4OOXA 1ORIA 2IYTA 2I4NA 5AP9A 3WWPA 3VPDA 2BN4A 4D98A 3U7FB 2J1LA 4RIHA 3JVUA 1MN6A 4Q15A 5JXIA 2KBFA 2VDOB 2FN8A 1IG3A 3QYJA 1PZGA 3ZWCA 1Z6GA 2EX4A 1T0JB 3CZPA 1KP2A 3IDZA 1U1DA 1VG8A 5F2EA 5AO9A 4RK4A 5FUYA 3HO6A 5JBNA 3JQDA 1SKBA 1VLVA 1JG4A 1E2HA 3OQ6A 1S96A 3ZC3A 4M0KA 4FDVA 1FY2A 3OQHA 2FRDA 3KVYA 1Z8DA 1IU9A 5CUQA 4W5TA 3H1GA 4Z9AA 2G1PA 2F1LA 3FYUC 2MT9A 4NECA 3T15A 4HTFA 5IC5A 4QT4A 4K40A 1E61A 2ORWA 4CEIA 1R6VA 2RHWA 2PT5A 3LT2A 4AG6A 1A9OA 2QD4A 4MUXA 1M6VA 1U7HA 2OXFA 3NNNA 4M9UA 5K3AA 1TNDA 4AJLA 1QU3A 1WDKA 4OGLA 5EY5B 3K2IA 1Q7EA 4N3BA 4YQZA 5EJ9A 2CFSA 2WUWE 3AYXB 4JMLA 4LHXA 1JG7A 4NX2A 5DM4A 4R81A 4FC7A 5TQ2B 3I1YA 3TNDA 4NEQA 1ISPA 4QDTA 5ALSA 5HUJA 4NZMA 3F74A 3PFNA 1C0PA 1U11A 1WJGA 1M2GA 1A9TA 2FOLA 2WT8A 3AW9A 1GG2A 2GXAA 3SYTA 4MWSA 1L3CA 5DZSA 4C29A 3DR3A 2XTJA 1Q83A 3PDIA 3OY2A 3ZCUA 2HJVA 4RS3A 3ZD8A 5B3KA 4BBPA 5K6RA 1T9CA 1GEEA 3HBNA 3C16C 1Q1AA 3CZ5A 2HPVA 2R68A 3PWTA 1MC8A 3ND7A 1NVDA 2E4WA 1X74A 5KOJB 1E3MA 1U7DA 2BLLA 2GJ8A 4EPXA 2EG9A 4KX5A 1PR3A 4LY6A 1U9ZA 3TQFA 4JL6A 2ZSDA 5T4FA 1S8NA 5KZMB 2WKRA 1LS6A 2O2SA 2Q4EA 5EQDA 3ADPA 3GUVA 4FHCA 3RC9A 1LDMA 2FFJA 2PZJA 2YY7A 5EIWA 2JFWA 3DP9A 3HNPA 3IURA 5FLKA 4C3VA 3FLBA 1IC6A 1NDUA 4YH1A 3A6HA 2QRLA 3LXUX 1UQUA 2AJCA 5SY4A 5DEIA 5JRDS 1YNOA 4RMJA 4ZPJA 5EXTA 1NUTA 4ZMRA 4FOSA 4N6GA 4HXYA 4DDVA 3SQNA 1CF2O 1W87A 2NV4A 1XLVA 2QM8A 1VHQA 1EG2A 2HCBA 1PZXA 4K6KA 2BGNA 1XPRA 1R7RA 4LI3X 5EQTA 2R2AA 1N25A 1T1GA 5CCXA 1YIDA 4ASUD 5A7HA 5K20A 2O8BB 4TT3A 1KZ6A 4XM0A 3Q1KA 4RDKA 3CP2A 1YZHA 1C3OB 4L3OA 2K7FA 3QEAZ 2P11A 3CNNA 4XDGA 3CW9A 4ARVA 1O96A 5CX1B 4FYHA 4GPTA 4QU8A 3SZMA 4FWTA 4DADA 1JA0A 3TI7A 4W9NA 4C7XA 1JKJA 1E3SA 2X1HA 2MDTA 2P5SA 2OP0A 4BB6A 5K8LA 3WLSA 3FE2A 4KAJA 1QIKA 1ZM2A 1FFAA 3CB4A 2VJCA 2OORA 1A77A 2QZSA 1GTL1 1VG1A 2EW1A 3C5VA 5KTTA 5MN4A 3IEIA 1NW5A 4CF7A 5JO9A 4F6RB 3AUJB 2BFEB 1GITA 2HDWA 5F4BA 5KTKA 1F8FA 2WSSD 3IQXA 3I6YA 3RFFA 5HCIA 1NV8A 1CUAA 3U61B 1XQVA 5BPHA 3KQHA 5LZ7A 3AG6A 2GMWA 4FEYA 3AESA 3LP8A 5LMNB 4MI3A 2Y1FA 3O91A 1UBOS 1D7AA 5CM9C 4F4HA 3ICCA 1JGTA 1B3RA 2X9VA 4TRRA 3C8UA 3N0VA 2JF0A 1Y8ZA 1C7RA 1RMTA 4FR2A 3E05A 1EINA 2ZW9A 2VBGA 3D0KA 3DAOA 4WDRA 5AK0A 3RUPA 2ACKA 3S3TA 4GYKA 3V2GA 2G9ZA 1AK2A 5GV7A 1DRUA 3QNUA 4H0NA 4H6PA 5AD1A 3PPVA 4L6CA 3VVLA 3ZKWA 5SYNA 1I1QB 1FTQA 4FPXA 1KI6B 2HMSA 4PY2A 5HQJA 1ZEMA 2CLFB 3JWJA 2WOOA 4D2IA 2M6RA 1ZD5A 4OXKA 4F46A 5LQUA 4B9EA 1PSWA 2DFPA 3AVWA 1YR7A 2NVUB 3F67A 4IGAA 1V1RA 1Z88A 2OHOA 2VWGA 3Q7EA 1R8JA 3BIWA 1RZVA 2WK1A 2BUCA 2YHIA 3DD1A 2J9RA 4OJKA 4U9IS 4CGZA 3D4PA 3I37X 5ALWA 4TTRA 5K0EA 3GUHA 2N75A 2CL7X 5CLIA 5DV9A 3M6LA 1AZLA 2FQYA 2HHCA 2ZWMA 3LIIA 1EDBA 1VLZA 1XNJA 4AZTA 5TQVA 3FYUB 5DK4A 1YE3A 1EXWA 4MUIA 1JHRA 2PUTA 4F56A 2VHJA 1BYIA 4M46A 3VPBA 4C08A 4BTLA 2ZCJA 5A04A 2XB8A 5AUQA 4Q9AA 1XLWA 4JOBA 4L4XA 1XZMA 4Q1CA 4Z4SA 5JADA 3MAGA 5CXXA 1VGVA 4NMXB 3RJ5A 1JPNA 3LBAA 1C8LA 2FHPA 5EZ5A 1IB0A 3Q72A 4OU5A 1IQRA 1JW9B 3WHIA 2M32A 1RMQA 2J6IA 3DDSA 2VAXA 1YZLA 4R1PA 3LLMA 3GJ3A 3WRXA 4EY6A 5FBHA 4LYHA 1XD2A 4FMBB 1XNGA 2DZDA 1FUEA 1YE5A 1X70A 3Q3VA 4N40A 4P7BA 4AWXA 1ADFA 1E0SA 4QODA 4B4UA 3EARA 2GN1A 3L77A 4YJKA 3DFIA 3N0WA 4DANA 5HMLA 2W71A 2IS4A 3GCGA 1W5BA 1B2LA 4P8RA 4Y6GB 1BH6A 2XV1A 1YACA 1SOAA 4JMPA 3LOUA 1FTGA 4JB2A 1BW9A 4QOFA 3E03A 3H5TA 4Z86A 1OI2A 2I62A 2YVKA 3KX2A 3L1JA 5BO5A 3NVDA 4XGRA 3SSNA 5ALGA 4W82A 2HJRA 3HBAA 2DRIA 4HAZA 2VC2B 2YYZA 2Q49A 2J0EA 2QP4A 1KGDA 3UQZA 3F2IA 1WV1A 1WEKA 1DMRA 5FOWA 4K0KB 4Y7CA 1J7KA 2ZS9A 3GARA 3QYPA 4ZVTA 5KO2A 1O0SA 2WNIA 5HIMA 4KI0A 2GJ4A 4L8YA 3BIXA 4K05A 4WV3A 2WNSA 1DBIA 2GPBA 2XF2A 3CLTC 4QDUA 3QU2A 5D7BA 2NO7A 2ZQYA 3HL0A 1DUIA 4YRSA 3JVDA 5LYJF 2JJYA 4HBZA 1W59A 3F6EX 3OX1A 2ZFUA 4MS4B 4O2AF 4OL0A 4GOMD 1KJWA 2FN3A 1T34A 4XR9A 5ES3A 2J7PD 1OC4A 1K4MA 4KQEA 3HJTA 2X4LA 4J9UE 1ZOIA 2V5UA 3JS5A 4AMZA 1EPUA 4I55B 4PE5B 4O2BF 5M29A 3QG1A 3AM4A 3IUPA 4E22A 1NI4A 4IR7A 2XUKA 3PA1A 1V7ZA 2VA8A 3BA1A 4DA9A 1WW8A 1WR8A 3HN6A 2QR3A 1PVDA 4RZ2A 3U81A 1H6DA 3F8TA 4XD2A 2J32A 1FRFS 1NW9B 2HZ7A 2OO3A 4FQ7A 3QBTA 3T5TA 4BJ3A 5GZ1A 1BX3A 3MTJA 3RNLA 3UKOA 2FW6A 5FT9A 2Q50A 3NBZC 3B3AA 1P1BA 1WCIA 2JLSA 2Z8XA 3NETA 4WRRA 4KRXA 4M0MA 3HKCA 5GVRA 1H1LA 4EG7A 1U1EA 1YFKA 3NHAA 1JAXA 2F3UA 3HLYA 5G1PA 1E2EA 3UCFA 4BU1A 4YPOA 1WB6A 1IZYA 3VO1A 3ZG6A 4C2UA 1TC2A 2ZROA 1ICIA 3B6JA 4O02B 1YOVA 1RZ3A 2MTBA 1Z4IA 3CLUC 3TM4A 2JGDA 3TBFA 2GBFA 3RVDA 1B0PA 4OQMA 2XNJA 4NI5A 4N8SA 2AK2A 4ALJA 1CUJA 2D2IA 1E9SA 1CS0B 3EDCA 1JR3A 1DLIA 1JVBA 1SULA 1FRVA 3HVKA 4MR7A 2NV0A 4OMUA 3ROFA 4B0OA 3G7UA 3OBBA 1QP8A 4CFSA 3DJFA 1C29B 1E3DA 3HEMA 4L8WB 1G8SA 1I0IA 4U1RA 4BBZA 1Q86D 2GK3A 3A27A 2ZB2A 3IQHX 3WNBA 4EW6A 2HEGA 4D57A 2JDIA 3T35A 5F4OA 4F5ZA 3ZY6A 4E5PA 3MGCA 4S24A 3H2SA 1GL3A 1M2OA 4WXPA 2VT2A 3WGJA 3ROTA 1VQMB 3JAWA 5IZ4A 3URKA 1A8IA 2DUNA 4LDJA 2P2NA 2WM8A 3ITEA 1BQEA 1VHEA 1NB0A 2OXCA 2QTNA 4IHQA 1QX4A 3AONB 3NM6B 3PPIA 4FSXA 1ZC4A 1I2CA 4L02A 4LFAB 4L7QA 1IRXA 3B78A 2O8CB 4TTSA 5KIAA 4MVJE 3KPWA 4GP6A 1WDLA 3PA8A 2HK7A 4MKZA 3KKZA 2YJGA 5C1PA 1ZZGA 3GEBA 3LT5A 3GPLA 1XTZA 1N8RD 3GFPA 3TEFA 1FLDA 2DKFA 2BMDA 3AM5A 1XTIA 1PWHA 2OCPA 3EVNA 1BAPA 4Y9SA 2JIMA 2J0VA 2DGDA 1KVQA 4LX8A 1G21A 2EZ4A 5FA8A 3X1XA 4TKOB 3E7WA 4KFTA 2NSHA 4R8RA 2OCAA 2BGMA 1N5OX 4EEXA 1Q0LA 4AQ7A 5CX4A 5T3UA 2WICA 1ONNA 1PKXA 3E2PA 4HPXB 5JH7F 1YITB 1NY6A 4HJRA 4RA9A 4AF8A 5SV2A 2CY0A 2EJWA 3WGKA 4EHDA 1EBUA 1UBCA 2QHXA 2GD6A 3IBFA 3CZCA 1KHTA 4RH1A 2JJ1D 4Q7KA 2IPOA 5EJFA 1ZX1A 2FWRA 3R3ZA 4ARZB 2I80A 3MTQA 1Q5PA 1M2HA 1J1UA 1ANKA 1X2BA 1ZSVA 1HF3A 1YZVA 2PNFA 3GP5A 5HXAA 2GBPA 3NHLA 3V6LA 3W06A 2QL9A 3WGVA 4DC1A 3DMTC 2RI6A 4LF9B 2DETA 2FSIA 4LV5B 3NIBA 3BG5A 1Z8FA 4HXEB 4S1NA 3CPJB 5CBKA 4JOQA 3W90A 1MGPA 3EYWA 5T6BA 1GG8A 5C35A 3FWNA 3KAQA 5EWJB 2VBIA 5JAUA 4FE3A 3U39A 4H7HA 2OPBA 4D4HA 1KYWA 1ULZA 2XBLA 3AHIA 4CETA 1OTHA 1HY3A 3CA8A 5J23A 3ZBUA 5FQNA 4QTTB 3LVFO 4MGHA 3TZ6A 1Y4DE 1H9AA 5C81A 4V39A 1U2ZA 1P2TA 3FMGA 3I5AA 2EQAA 3D4OA 3LCRA 3OPNA 3WL4A 4B1FA 2KYRA 4K28A 1ONOA 4NZPA 1E79A 1RYNA 1NHGA 1QAMA 4JYPA 1OASA 4X20A 1G6KA 5M04A 4I1SA 1Z7BA 2HRCA 2Q5HA 1EFPA 4MWEA 2E18A 2FWPA 4R1OA 1MXHA 2G9NA 4EK9A 3OTHA 3QY9A 2CJPA 1PJZA 1ZH6A 4INJA 4ALIA 3CU5A 1JQKA 2ZRGA 3M1LA 1L7PA 1U6JA 2EGGA 4IVPA 1NLZA 3SEZA 1UBUS 1W5EA 1TAGA 5H9WA 1Q1EA 3R3SA 4E1BA 3LJKA 4G2TA 4QPCA 3T4PA 3LNNA 1JPVA 2JCYA 1PZEA 2W93A 1G5HA 3JZDA 2AC4A 5DWVA 4ED9A 5BVHA 1GA6A 2BRUC 3KVOA 4FFSA 4GP7A 3BA6A 3E4DA 1E0KA 2L42A 3H11A 3I2KA 5LXTF 1IRIA 5D2CA 2V0NA 4YY3B 3O1JC 1XAHA 2TMKA 3OT1B 5GY7A 3A3GA 1C7QA 1WQ4A 4NOKA 4UEJA 5C18A 4EHFA 3ACDA 5JAZA 2XBMA 4EVIA 4UC0A 1KSHA 1VCIA 2C77A 2ZYWX 1ZXLA 3DDCA 1Y8RA 3AVYA 1W73A 3ELUA 2H1FA 4ZKEA 3WKDA 3ZTWA 4ZOLF 3JPWA 1XQYA 3TB4A 5K0ZA 3LUPA 1GPUA 1SVIA 3F9IA 4GZLA 4MUEA 1QORA 2RCNA 3JR3A 1B0ZA 4IKPA 5IFKA 2R4TA 3G2IA 3JX9A 4KR0A 2B7LA 4G5SA 5EMLA 1D0VA 2P5TB 4BQRA 5JUWA 2FDRA 3FCXA 2VSNA 4U02A 1Z5GA 3KTFA 5KCMA 1OXVA 1XXHE 4DCUA 4MS3B 4Y0AA 3VNSA 1UP7A 4CV0A 3OWHA 1E5XA 3BL5A 4LEIA 1BFDA 2Z1MA 4QXMA 3ER9A 4ER3A 1LDBA 1OWLA 4MQMA 3OTOB 5HQ3B 3H6HA 2MYNA 4IUCS 5EI5A 1NXOA 3CNLA 1T5SA 4JJAA 4K9SA 3RWMB 1LK5A 1BHO1 2GTPA 2QD3A 1H2FA 1NMZA 2DOKA 4II2A 3CLHA 2GJSA 2QVGA 2XYPA 3PC6A 3DD5A 4J8PA 2CKMA 2VDKB 3OEED 3FJOA 1OFTA 2I4IA 2FPGA 3M2TA 1Q21A 2IPAB 4JLBA 4MWTA 4B6QA 1NVEA 4B6EA 5L45A 5CH5A 5GONF 4AMGA 3DKRA 3IRVA 3R6WA 4HF7A 1RXVA 5G2OA 1T5OA 1V8OA 1GCIA 3QVKA 4TWIA 4TRNA 3WRWA 1Q1NA 4RD2A 1XE1A 3MCVA 3FSJX 4X8OA 2IU0A 2WZCA 1DV1A 1OD6A 2AL7A 5AI4A 5EOVA 2OSVA 3GPIA 1JJ2B 5FUBA 2RD2A 2R7AA 2N0SA 2XE6A 4UDYX 3ER8A 4Z8XA 3GIWA 2Z8YA 1VBMA 1MCZA 1YQQA 5EZYA 3R8CA 3EK2A 4JY7A 3RFVA 3TQRA 4WEOA 2ZB8A 1T3GA 5KNBH 3ZHXA 1B8VA 3A58B 3AUFA 5L46A 3HJAA 3VU3A 3PUYA 3QKRB 1G8GA 1RJWA 1WDMA 1DS6A 1CY6A 3JWEA 2OFOA 1STOA 3JZMA 4IJWA 2XEDA 1YNSA 2ZI3A 1V7PC 2QBYB 3Q3GE 2D8MA 1JHMA 2EKDA 1N07A 1E4EA 3KZKA 2XOKD 1KSGA 4A0SA 2C4HA 1BMFA 2G07A 4ZQGA 3VJKA 1DDGA 5K45A 2W6ZA 2Z6VA 1Y8QB 4O1MA 4CTNA 3E7XA 1LPAB 4FBLA 5D3KA 3ZGYA 3NIGB 4DBZA 2VJNA 5D85A 1B3BA 1O94D 1SURA 3DXYA 3JQGA 5KSZA 1YCFA 4FLEA 3CE9A 4Q7JB 1PV1A 2JHCA 4IDPA 5L40A 3MXOA 3F1LA 2X9NA 3M6MD 2L19A 1Y7TA 2V98A 4RK0A 3TF5A 1V5IA 5EC8A 2ZJ4A 3CZRA 4LXQA 1U65A 3A0UA 1I32A 4KXFB 4MRMB 2ZJ2A 1N9ZA 2H8KA 2H7XA 4YC7A 1QC5B 2RHGB 2PUEA 3LYHA 2PX8A 2J4DA 3IXLA 2OCDA 1B8NA 1WCWA 2IH2A 3V9PA 3BFKA 4H17A 3DZFA 3HFSA 5FO0A 1NX6A 1BVRA 4KP7A 2F43A 3WGYA 2O2YA 3C87A 4Y6QA 2ZUSA 3OEHD 1S3GA 1PGJA 4BXOA 3TM5A 3TSOA 3L8DA 3ZV6A 5KYYA 3LOPA 1K97A 1VDMA 4LNUA 2YXEA 2H8GA 5LA6A 2WWXA 3VAYA 2GAIA 3VVBA 2BFCB 4UBLA 2CYCA 4BV9A 4IUYA 1HBJA 5C5DA 3BTOA 1RKVA 1EVEA 3SFTA 1IN4A 3EVTA 3JTMA 4I6GA 4UTZA 3WA7A 4EVQA 4X05A 4JB8A 4KFCA 4JNCA 3OJEA 4ARSA 1ZISA 3TKLA 2JI8A 4YRFA 3EEYA 4H1UA 3CZQA 4RDIA 2I1WA 5LMCA 2QQFA 1ZIYA 2B3TA 5JYCA 3INYA 1T4MA 3W9YA 5CG1A 1P75A 3QTLA 2DPGA 1OYYA 2REOA 2E48A 2RHOA 2O6HA 4K9RA 1JJAA 3SZUA 2CFCA 1VKNA 4CT0A 1RHUA 3OQVA 4LAFA 2YZMA 3TK1A 1KPGA 5AUPB 2C97A 4IXDA 4QATA 5ALLA 1EUQA 1D07A 5ALHA 5FNVB 1E43A 1LPPA 3VJRA 1X3SA 2FSVC 3ULKA 4DCPA 1A5SB 4X60A 5DOVA 1BDIA 5C8DA 1EKXA 2F62A 3R77A 4X7CA 1QYVA 1E2IA 3IKMB 3RYHB 1J07A 1TO2E 1QH1B 4G86A 4V3CA 4YQYA 5ALRA 4CM6A 5C8ZA 1RADA 3MA0A 2JK1A 4BP9A 1QK5A 4J2HA 3LCCA 4COOA 1KVRA 2ZT7A 4Q02A 3A6PC 2IUYA 4M37A 1KJNA 3ZE1B 4RXTA 3FHTA 4ETIA 5BSVA 4WJLA 3L9WA 3Q98A 4MP6A 2A6PA 1CUIA 1ABEA 2HJHA 4GBED 5KTRA 3CD6B 3L8HA 3VA7A 2HQOA 4HGYA 4LHYA 2HWYA 3TQTA 5E6UB 4MVJH 5FOTA 4RTQA 4KPUB 4YFVA 3TW4A 3HCAA 1QYIA 1G5IA 2W2KB 2EFJA 4PHCA 2PRSA 2PUCA 4NWIA 4IMJB 4H1HA 1OAAA 2QY6A 4GLBA 5KWSA 1JLSA 3DZJA 5EIHA 1W5AA 3CC4B 1KMHA 3ZU3A 1REQA 2G1JA 5FH9A 3MLBA 1C0LA 2R7NA 4LRWA 5E1OA 1Q7BA 3MC1A 2O9JA 3EGOA 4F04A 4DQLA 2QAJA 1NBOA 3EFOB 4LPSA 3S1AA 4I1PA 1P2DA 2B98A 3AETA 2FXVA 2DWCA 3PFHA 3PXUA 4Q3LA 4QU0A 4XVRA 5A88A 1E9VA 4KKTA 1MB3A 5IC4A 4RIIA 1FDIA 4C07A 1KTIA 1U9IA 1BX0A 1RRGA 4G0XA 4XNFA 4WOJA 2L0XA 2WILA 4XJXA 5CFMA 2X2PA 4EUEA 1Z13A 3I4FA 3DJYA 4KQ2A 1ULTA 2ZBQA 4FHGA 1KDTA 2Z5FA 3WE7A 4H18A 1CEYA 2CL0X 3EF1A 3F5SA 1A7JA 1LFAA 3MTIA 1CC1S 5K2MA 1XTBA 1LBQA 1NBHA 3K73O 4QPPA 4RETA 4YUYA 3THXB 3O74A 3CKKA 5A3QA 2VUSA 3T7AA 2CHVA 1DXQA 2FVYA 3GSIA 1NDQA 2QJRA 3N8IA 4FHZA 4Y0VA 5LMZA 3CJRA 2B6NA 1DC7A 3CRZA 1NRWA 3LDUA 4BB9A 5JI3E 4RADA 2QT1A 1VJGA 3H7IA 4YHBA 1XTTA 5C7YA 3PGLA 1EXNA 5DT2A 4B2IA 1JIQA 1ZG3A 3CZMA 3VSEA 3OPVA 3A14A 1LBSA 1WUJS 3TECE 4LCJA 2NO4A 1VC2A 3I76A 2G06A 2RG1A 4QARA 4TQAA 5KYUB 3UJDA 4E3ZA 4PABA 2C31A 4EW2A 2IGBA 2OQIA 1XEWX 1RDFA 2EFYA 4AK9A 1IBKB 4D9FA 2CLMB 1UT5A 4B34A 3SJPA 4KAXA 3PXAA 3F4KA 2ZZFA 3R6TA 1EK2A 4OMDA 3RSGA 4D96A 2X13A 5BSYA 2IP2A 3GFOA 4XGKA 2WTEA 5HF6A 3QELB 3UJAA 3F3SA 1WUHS 1DQZA 4FGWA 1QF6A 5L4NA 4G41A 2FP4A 2VT3A 1R5NA 1BS1A 1EWYA 1U0GA 2DE0X 2Q21A 4WWVA 1Q44A 3QHAA 5AKIA 3QITA 1Y7IA 2Q5EA 4RS4A 2HCRA 4IFIA 3ED5A 3QUQA 3MUOA 1T5LA 2MINA 3PIIA 2A9OA 2AUNA 2H1CA 3IAS6 1TK3A 4XQCA 5G0SA 1C3JA 3ZCQA 1ZMTA 3CCUB 4KVZA 1MOQA 2PM8A 1RYEA 1NT4A 2DUJA 2NTNA 2F64A 1W1UA 3QGMA 4MLPA 3VC7A 4BCCA 1GNSA 5BMVB 1PBTA 4M9RA 4S0XA 1J0XO 5EUQB 2Y9MB 5TRDA 3WICA 1MJGM 3S1SA 1TFRA 4JYZA 3P45A 5A4MS 3ECAA 1TIBA 2NNLD 3MQ4A 1KC1A 3A4TA 4N49A 4MMZB 4ZT2A 3R23A 3S6JA 2O2CA 3NHJA 2DPLA 2KHZA 2JLVA 1L5QA 4I9NA 1UKCA 3M49A 4AO6A 4BYGA 3MXTA 4PO9A 2IX3A 1QZUA 3AOEC 2C5FA 1QH0A 2OZEA 1HNNA 2YN2A 5EEHA 4EI7A 1FJGB 3WK7A 5AM1A 3PRKE 1JBEA 5HCNA 1BVHA 5T4HA 2Y1XA 3UGJA 5EP4A 3NYQA 2P2DA 3QX9A 1D03A 5KPJA 5JLJA 4PCUA 1QZ3A 4OQPA 4PNZA 1X8XA 3KB1A 3AF3A 4YJ3A 3X1JA 4CMEA 3IEVA 3I23A 4JITA 1DQRA 2E87A 1X19A 1FNSA 1I80A 1K9SA 3BXEA 3FETA 5F2KA 3WOVA 4D0SA 1Y3HA 4OL9A 3IOYA 1B76A 1NVAA 4P2GA 3NC0C 2FFRA 2FAXA 4V0SA 5FP0A 2OD2A 2TRSB 4NU0A 4OFWA 4CI0B 1XL1A 1IG0A 2J3QA 4X3OA 4MB0A 4MV1A 2CFTA 2ZTVA 3C15C 1M9NA 3C6ZA 3KZCA 1KR2A 3GIRA 1GZ6A 3OQIA 1WQ3A 2CB9A 2QUKA 4XUDA 5G3YA 4JP2A 3UVEA 1A27A 2QTBA 4X7DA 2IP1A 1IHDA 3AC0A 4CKBA 4DJJA 2UZAA 2QX8A 4TLCA 1RQ2A 1XBTA 3HB4X 2ERXA 4NIMA 5DLDA 3SS9X 1N1EA 3DDNA 4BKPA 4F0JA 3C5CA 3M4NA 3UK6A 3ZXUB 1AKWA 1F7UA 1HT1E 1QSGA 3BXHA 2UUOA 1FNBA 2XBUA 3HLKA 1XPUA 4RU1A 2C9ZA 821PA 1B23P 5FPSA 4DT1B 2YNMC 4IIDA 1XEAA 2BEJA 3ILHA 3A8JA 4N48A 3ZLUA 5KC9A 3UT6A 2HBQA 1AB6A 2FWIA 4IDAA 1P1RA 4PYLA 1VXRA 3OA0A 1V8BA 1H65A 1HETA 3QBEA 2DIEA 1FL9A 1JEJA 1D2GA 2G5PA 1PS0A 2AMYA 2O3UA 2X58A 3OOHA 3OLYA 4HX9A 4XIFA 5DW3A 1KO4A 3PU6A 2LIVA 1CP3A 3QH4A 1E1NA 2CUKA 3I04A 1U0JA 4GBGA 4MOWA 1ZR4A 1PNRA 2WWHA 1L0BA 1K5GA 2HJSA 2V3VA 4AS3A 2G71A 3PTLA 2FPRA 5LB4A 5DASA 4ZI7A 1DG1G 4MKHA 1R6TA 4CM8B 4FYVA 2Q1XA 4QGFA 1UDAA 2RHHA 3SXUA 2AG1A 3IBYA 4H6VA 2VZLA 1K1EA 4PNHA 2Q1UA 2ZRDA 1ITZA 5U1PA 4WZAA 3GB9A 3QLUA 1DAIA 1AO3A 2XVXA 2P9ZA 3JW8A 3HDVA 1E18A 4X61A 3KEWA 2BH2A 3C24A 1W1WA 1ZQ9A 1U8UA 3KPUA 4Z3OA 2GWRA 1I8DA 1H9CA 3NKLA 4LQ4A 3QU9A 2IXTA 3NIDB 1KZ7B 2ZKLA 1WXEA 2ZI9A 5EJGA 1XU9A 2R1TA 2Q5LA 4F2HA 4IMPA 3DOUA 4L4RA 2QL5A 3E1GA 1BS9A 1V3UA 2RHRA 2YV3A 4Y2YA 4O0MA 3A1PA 4BVAA 4EY3A 2PVSA 1WBDA 4BFXA 3D3WA 4AJ4A 1X7GA 4BO9A 1QQ7A 1EA7A 3Q3JB 4F1JA 1EFVB 1CZUA 3TR5A 1NTOA 2OR3A 4NBLA 5CA1B 2J59A 3A4NA 3DZHA 2AW5A 2E2WA 2IV3A 1CETA 2FW7A 4L8FA 3S7ZA 5IYRA 1NJ6A 4G5OA 4G8CA 2PMEA 1ZH4A 4FWBA 3K0FB 3I1FA 1XTQA 4C0KA 1NWCA 3JQ8A 2OHGA 4YQEA 4TWBA 3HRIA 2FEOA 4D9KA 1O4VA 4ESEA 3EXG2 4LI0A 3E9YA 1T13A 1VPEA 4GOJA 1QWSA 2WJ6A 1X1TA 2WMDA 3BE5A 4INOA 4CKZA 5K8JB 5BSFA 2JL1A 1XVAA 1BG6A 4RFVA 4F38A 1BSVA 1UAAA 1WSRA 2PGAA 2PJZA 5HTKA 2R1VB 5KMGA 3ZDAA 4KR3A 1EVLA 1IHXA 1CQXA 2WU3A 4P7KA 3GW8A 5KX5B 3VO9A 4B83A 2JKZA 1JEQB 3BZWA 3OFKA 4MDHA 1SKYE 1VRVA 5EERA 3VZBA 3ZNQA 5KS2A 1YXMA 2QMQA 3NB0A 2QVCA 1FJ2A 3VKWA 2G8LA 4EWLA 5GP1A 3RODA 1V3VA 1WF3A 3SI7A 4DA4A 4O1IA 4EB3A 1KI9A 3LZDA 10MHA 2DXIA 4R8KA 1KI4A 4IYJA 1XCJA 4Z1MD 1GV1A 2PRJA 1JHAA 4NBUA 4CM4A 5ALTA 1WU8A 2DPYA 4DIUA 1XFDA 3U56A 2RJ3A 2GJPA 1DRJA 1T9AA 2W2QA 3FROA 2FFBA 2VIIA 3FCYA 3UY4A 5AESA 3KSAC 2PRKA 3IUNA 1L8LA 2XZPA 1LRLA 2E37A 3FN4A 3H5WA 3MJ4A 2HLDD 3OJOA 3QQ5A 2UZIR 4LOLA 4XWAA 3M3DA 4FN4A 1R18A 1ZQ1A 2LV8A 1DWOA 4P92A 3RAFC 3HKEA 1Z4LA 4DNQA 2HSGA 3NKVA 3FVWA 3L93A 1TZCA 4ZO6A 2IITA 1DCMA 4YT8A 2ZL6A 3GFSA 4XLHA 3AVOA 1WHSA 1DIHA 4RJKA 1M33A 3DEYX 2F6RA 1FRQA 1CX9B 3NAGA 2DWOA 4GYWA 5B1DA 3W34A 3WGUA 4PSDA 1RP1A 3WFZA 4PGAA 4KBYA 4BX3A 3S1LA 4ZARA 2YQZA 2GNPA 4TYNA 4RTNA 4GUDA 3DMHA 2O0LA 3T1OA 1O97D 4P0PB 4EH1A 3O8QA 2IIBA 4RQTA 2VJPA 4FXPA 4ZQIA 1O9GA 2QGFA 4C1NA 4Z54A 2QTVB 1R8SA 1T6BY 2WI8A 4JYCA 2BF7A 4ZAFA 4CMGA 4RK1A 1FOEB 3TS1A 3IVAA 2D2VA 4WTOA 3EJWA 3R7LA 2WJYA 3CX6A 5TXGA 4Y2GA 3GVHA 4EP1A 4AU1A 1NIJA 1KVSA 3FPHA 3HZRA 4ROSA 2HJWA 3IIIA 1U7PA 5I45A 4W5OA 2I33A 4OVKA 2XUPA 3IUJA 1ADBA 1LWNA 3H5AA 1R9JA 2XMSA 3M6FA 1G63A 1E1QD 3ONUA 2UVPA 1LY1A 3IAM1 2R1ZA 3HUTA 3CBGA 4CM7A 2FOXA 1XOIA 4JLKA 1Q74A 4Q9LA 2GRJA 5G4KA 3UWOA 1UMBB 3F49S 4D5EA 1DRKA 4OQEA 1HH4A 5C34B 5AN9A 3SS8A 1W2GA 2P6PA 2WT9A 1XYGA 2YCBA 1SXGA 4F96A 4P80A 4PAGA 3PYXA 4UEKA 2HHLA 1E6WA 3BGWA 4HMPA 1A9XB 3R3YA 4UTOA 4JEUA 1MX5A 3W7BA 1SK8A 3ZR4B 1CKEA 4AS1A 1F14A 2HK6A 3Q39A 1W4BA 3TX2A 4RMIA 1HE1C 3WMEA 3WLJA 3WLQA 3G2LA 1KMQA 1UFVA 2R11A 5I7SA 5F4MA 2PBFA 3OZRA 3ASZA 4XKVA 4IDEA 3D5QA 5JMPA 1RRPA 2VFAA 5H83A 1FSGA 1V35A 4FEGA 4H7IA 3O83A 1L5KA 3CRQA 3M5WA 3PVSA 3PQ6A 4AQYB 4P38A 4DC0A 5L53A 3KSDO 1DXHA 3HK2A 1LA2A 2BMAA 4IDFA 4NOJA 4BN5A 5HJ5A 2QWXA 4B35A 3G9QA 2YKGA 4R1MA 4OM8A 1U1IA 2VP2A 3IQDB 1TTHA 1DEOA 2ORVA 4A2CA 5JSKA 1K3TA 5C4GB 1KBQA 3V6MA 4CHTA 2CLIB 2ZBVA 3E9EA 5H3LA 1W0CA 1WB4A 2OAGA 2B78A 2COUA 4XIGS 4XL9A 1L7EA 3M1YA 3AJDA 1EEXB 2A59A 2C2MA 3NWPA 4HFMA 2Z04A 4LZAA 3OQMA 3BF8A 4L78A 4OOFA 5IC6A 3UPTA 1ZEJA 2OHFA 2QJTA 1IXSB 2HLHA 2PKYX 5CLJA 3T38A 3BNWA 4R1QA 4AG3A 4ZYXA 3A2LA 5CA0A 1SXPA 3KT0A 5H7XA 5H16A 3KAPA 4HB4A 3SY8A 4S3MA 4LECA 2QSJA 5C51B 3HVRA 4GZMA 3C5EA 4ID3A 2OQVA 3O8CA 1BDHA 1E0AA 1AU9A 1HTBA 1Z6TA 4U2KA 5KNBD 3GLSA 3VUEA 3CVYA 2HI0A 3O75A 2RIRA 3I2JA 3WWZA 4D9MA 2XYVA 5D1NA 1RHQA 2BGTA 4K86A 3L0PA 4M6WB 4KUEA 4BZZA 1GDTA 1IEWA 1EJBA 2C88A 2YWXA 3A8IA 3CX3A 4Y2XA 4W7IA 1HKUA 2B4AA 2JD0A 1KJZA 3TKYA 2F1KA 4GXRA 3DFMA 1XEFA 1I4WA 2A9RA 2J85A 1YCHA 1RLJA 2R00A 3U49A 5I6DA 1Z2NX 4FJ1A 3CBQA 1NVBA 4RUKA 2Z56A 3QKUA 4IRXA 4LRUA 2ZAGA 3HKBA 1VMAA 3OD1A 2PMWB 2Q07A 4ZXFA 4PXAA 3IHLA 1GFWA 1VSQA 2TS1A 1N8TA 3RKRA 1NKVA 1PR9A 3R5JA 4IUDS 3FYDA 3ROPA 1SZDA 3CXUA 1PFWA 3KPJA 3L7YA 4FDLA 4ENSA 5FHRA 4YP9A 1CE8A 3O21A 4FYPA 4MV6A 4R54A 4EELA 1WBBA 3MWKA 1V8PA 4IX1A 2NU8B 2NLOA 4G25A 4C6RA 4EI9A 2P65A 5A4FS 1HYEA 3FUXA 3T41A 2NX2A 5D01A 5D6NA 1NFRA 3NHSA 1ZUNB 4H1TA 4Z8YA 4O4HA 4G1CA 2Z6UA 2VHWA 5BT8A 3CLVA 3M34A 5EKDA 4YJGA 2OG2A 3BE8A 3F5DA 1U4OA 2ZR0A 2AIRA 1W75A 3ET4A 3LQ2A 4IDBA 4HLDA 5H5JA 1FF9A 3AP1A 3MGGA 2B21A 3MG9A 2XA2A 3DXXA 4M55A 3ZWXA 1F6WA 3T9EA 5I8ZA 3C3CA 1W1IA 4PC3A 1MV8A 5ICFA 1KU0A 4H7EA 4O4IB 1PQWA 1PGOA 3RF7A 1BGWA 4B8ZA 5IKXA 4MYCA 5C8YF 1Q12A 3FB4A 4BGEA 4IW3B 1JDSA 2OV1A 2E21A 2ZE5A 2ZUBA 1H2XA 2V7BA 2VT6A 3EMVA 3I1JA 4JBHA 1QQBA 4JYMA 4MYRA 3OEYA 2MSEB 1IDN1 1V6SA 2B5OA 2OAQ1 4XWTA 5KDOA 1P9WA 1A9ZA 4H3KB 3REQB 5DLEA 4UMVA 3AXSA 2I67A 4AMYA 1T0HB 2EP8A 3HC7A 4HPWA 5JMOA 2YWJA 1E62A 2RC6A 1UIRA 2CLKB 4KQ1A 4OQFA 3ZEAA 3KXKA 4DW8A 1W49A 4RX1A 1U1FA 2AW3A 2HOQA 4XUEA 1VP3A 5TQJA 4OMFG 3SM3A 1I8TA 3PFGA 2OTLB 4LJSA 4RFSB 2R8EA 3N39C 5FI5A 5L3SB 1NNUA 2ZM6B 2Z2IA 4NF2A 4YROA 3I0MA 1P4MA 1GLVA 3AO0B 1O5TA 4HL6A 4XKJA 2ZRFA 1J1IA 3EY4A 5FKJA 2RAFA 2I7DA 4LZWA 5BYJA 3ROZA 3P0RA 3UOGA 3D43A 3TLCA 2BFFB 1N6LA 4HH3C 1TCUA 2O1XA 4O3FA 2IS2A 4I1UA 2QQGA 1HE4A 3I55B 2Y4NA 1O89A 4QQ8A 2C94A 1K63A 3NPMA 4LXHA 2GGSA 5DRTA 1M34E 1QH8B 1RXIA 1N2XA 4NFSA 4J3NA 4JHXA 4OLFA 1SCUB 1YVPA 3I4LA 4BX2A 4MVJD 1OBCA 2X1VA 3MWYW 4TUYB 1JDBB 4URXR 1EFCA 3MELA 3PUNA 4ECEA 2X9LA 5HKAA 1MW8X 4RFLA 2KB0A 1NVMB 3T3NA 3G8DA 2W6OA 5K9ZA 2P9EA 2VXCA 3AY0A 3Q38A 2Z9DA 4RXMA 5CRIA 4KI7A 4PG8A 4YV1A 5HJEA 6YASA 2DR3A 1MO2A 2WE8A 3WP0A 5T57A 4QDXA 5DO9A 2HF2A 3OI7A 1U2RA 2QA4B 1MORA 5TE9A 2BZ1A 4GLFA 3ZEIA 1D4AA 1LTQA 3KQOA 3Q7IA 4BV2A 2G7ZA 2R6JA 3C7CB 1EBFA 1CQJA 1EAYA 1T15A 2HXYA 3GUUA 1PT6A 2WV9A 3B9PA 1BJKA 1IHMA 5EJMA 3TW6A 4L74A 3RFTA 1K68A 3HWX1 3L2OB 1US8B 4GX1A 2YFYA 5FEUA 3CF4A 2F1RA 4DLUA 4JI4B 1E0JA 1N6NA 2YN4A 1NV9A 2VBCA 3H0CA 3O2QB 1GFSA 2WIGA 5HZMA 3N0RA 1HZZA 3P4UA 4H4EA 3LXXA 2ISQA 4EKYA 4KITB 1PG0A 3H94A 2BBWA 2IF0A 3PP8A 5EP3A 2X2FA 5FJJA 3NHMA 3KSZO 4CLOB 4TZ0A 1SCJA 1YZNA 4V2IA 4QOSA 5B55A 3VSDA 3M6WA 3ISTA 2XITA 3B8EA 1TI7A 1QNFA 2RONA 1MEJA 1J70A 1E3WA 1QIJA 3EDYA 3H04A 3K9BA 4O0LA 4RKYA 2AHRA 5ALIA 1YDGA 3L1IA 3L40A 3MJRA 1Z33A 1TKCA 2C0QA 5IYQA 1U8FO 3N05A 3OKFA 2G40A 4GC5A 1N5IA 4E09A 3JXEA 3UFXB 1UR5A 1O6ZA 4WZTA 3ASYA 1JVSA 3EMDA 2XVYA 4MR9B 5E9WA 4ESVA 1PL6A 4XGQA 5EQFA 5JCJD 4R7GA 3CONA 2WTMA 2HNAA 2D5AA 2FA9A 3M4YA 3D5TA 1KARA 4AN1A 1OB2A 3PDJA 3Q7SA 1SUBA 4G0MA 4UUPA 4BAGA 5J3OA 2PJUA 1I6LA 4GEGA 1X2EA 2VP4A 3HM9A 1SPBS 3EXG1 4UPVA 4PV7A 2AV6A 3UWMA 2WQ7A 1J2RA 1YT5A 3K9LA 1UZAA 3ZY4A 2PR2A 3LKZA 2GREA 1VJ0A 1NUSA 2IS6A 2CXUA 1Z29A 1WZEA 1HT2E 1Q2UA 1MNQA 1UBGA 1Z0FA 2EKLA 2IYRA 3BRWA 4JOCA 4BJ6A 1NMXA 1XQ9A 2FUNB 3L41A 3U62A 4C3ZA 2CUZA 3GBSA 3HACA 3PUVA 1NC1A 3TSAA 1BKYA 5BN5B 1W76A 2WHPB 2ERCA 2HLPA 4HEQA 5AI0A 2HC9A 3ET5A 4ZOEA 4NCNA 3RSCA 3ZLTA 4YRBA 5DLYA 4WADA 4BNTA 1XTSA 3F78A 1ABBA 2IUSA 4I0WB 5AJVB 2IQIA 3ESXA 3WK4A 2IYOA 1HG0A 5ALZA 2QYTA 3W3AA 5EE3A 1KS2A 2WMNB 3MWEB 2ADMA 5C1DA 2WF9A 4UFPA 3UXHA 4FKBA 1OTYA 5AJTA 1Z2PX 3K96A 4TKUB 1BXRA 3G7SA 4P25A 4BO2A 3ESAA 4MKIA 3CGWA 1G7TA 1U8ZA 1CLEA 2GEVA 2XSZA 3HFGA 3LX4A 3BWCA 1SG9A 4FFLA 4E46A 2XNDA 1RC1A 2Q62A 1YKFA 1T36A 4B31A 3AQ4A 1CDZA 3KJQA 1MC1A 2E3JA 2EGUA 1E2PA 2PGIA 1DJOA 3VC1A 4YAKA 3P1JA 3OZAA 1AQJA 2X7XA 4N1AA 5DGCA 3DOJA 1BEEA 1ULSA 3GLTA 3CINA 1I51A 1NQUA 3V46A 1SQGA 2PBZA 1TUBB 2I03A 4OO3A 2XCSB 1NOJA 4WT7A 5B58T 2P0AA 3KEGA 4P08A 1XXHA 4Y98A 1JYSA 3RWOA 1L1RA 2BM8A 1QIDA 4LZZA 4GQIA 2FETA 1UF9A 4O8ZA 2VWHA 3PSHA 5AVWA 4PS0A 3SLDA 4U3JB 3ENKA 1V5FA 4MK4A 1ST2A 4NCXA 5GJCA 3K6SA 1BO6A 5D86A 5AKJA 5E0KB 1P9OA 3ZGXA 4CU2A 5G02A 1LLFA 1I3KA 3FFAA 2A57A 2AJ8A 1Z08A 2WYUA 3G68A 4UEOA 3ZE7A 2ORED 4ZEMA 1SPXA 2DWQA 3N2KB 4Q3AA 4B85A 5A9RA 4MKGA 5KJCA 2C03A 3WYBA 4BP3A 1QF7A 2ROQA 4CUJA 1U7UA 1YJAA 2V58A 4KZPA 4C6SA 3ZWAA 1T25A 1ZVMA 1YL7A 2OBXA 2UUCB 2VHVA 1SQFA 5ELLA 4F6CA 1G20A 1MPTA 1QE0A 2A9KA 2B20A 1TIPA 3JQAA 1S3FA 3DEAA 3GJSA 1ID8A 2HA7A 5ED4A 4OHCA 1KOJA 4L8GA 1JKXA 3FNIA 4R2KA 4W9NC 1HORA 4PRKA 2HBRA 1HSOA 4A2QA 2PK3A 5HS6A 2OBSA 2HA3A 2ZANA 3MK31 2JIZA 1ZNYA 4KNWA 1XL0A 2OORC 3JQCA 1RWBA 2M1ZA 3OCZA 4HYTA 1J0EA 1ODJA 4UXJA 4BMXA 1FFCA 3A4VA 3HJHA 4I4LA 3QW4B 4JJ4A 1G7RA 3FX2A 3L05A 2H7CA 2I22A 2XZLA 4AJ9A 4EA7A 4FFDA 1GSIA 2VHTA 4ER6A 3DVAB 1M5RA 4BASA 1PL7A 3VPCA 1C9EA 3AVQA 3GEEA 4QD3A 3GLRA 3H4VA 3MMNA 4O4LB 4REMA 4ZAYA 2VSXA 4BECA 1BFKA 1DAEA 3LFUA 2OKCA 2E1RA 4B4WA 3PR3A 2KLBA 3PKJA 3E9CA 2BHTA 3DUFA 3WGZA 3JALB 5CLQA 4YP6A 4M8LA 2E4ZA 4LUCA 2NU7B 2WG0A 4IICA 5EINA 1G5RA 1OCEA 3SU8A 3FM9A 1DIGA 1V48A 5ILGA 1RBYA 2DUUA 2QVZX 3PBKA 5JSQA 4E88A 1H8ED 5JBQA 1E3XA 4UUNA 4MS1A 1DAPA 1UFKA 5JS1A 1KFKB 2PSDA 1UODA 2SKDA 1QRAA 1HURA 2XGSA 2X42A 1CUZA 1FFYA 4IIEA 2OGSA 4GVPA 1XPOA 1P18A 4G7WA 2ECPA 4LYJA 2DFDA 4DNOA 1RKQA 1YB2A 4FGUA 2P6MA 4PBRA 3RYFA 2B9VA 4EI2A 4QQFA 2ODBA 1D1PA 4F06A 2E9SA 2EKBA 4IV5A 4Q7EA 1U6KA 1GGVA 1LLDA 2DCUA 3GLVA 4EQZA 4HTFB 3NGLA 4ZYZA 1DG3A 3KB2A 3HJFA 4CLHA 2JFUA 4LJLA 1M6VB 2GO7A 1EK0A 1PVVA 2QN9A 3I9LA