1QUEA

X-ray structure of the ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 1.8 angstroms
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
303
structure length
303
Chain Sequence
TQAKAKHADVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP+ REDUCTASE
publication title X-ray structure of the ferredoxin:NADP+ reductase from the cyanobacterium Anabaena PCC 7119 at 1.8 A resolution, and crystallographic studies of NADP+ binding at 2.25 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 91
structure length 303
sequence length 303
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1queA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1queA02
3B78A 1B2RA 1QUFA 2B7BA 2HDNB 4TMZA 4B47A 1DDGA 3WYAA 4K1XA 1Q81D 3ZZUA 1QX4A 2QN6A 1CNFA 2QA4B 3W5HA 3OJWA 3CMAB 1K73D 1DG1G 1GO2A 4RJLA 3WXMA 1FNCA 2BPOA 1YI2B 1W35A 4RCYA 1VQKB 2QDXA 3B82A 2BN4A 3OW2B 4G1BA 3QFRA 1G7SA 1A8PA 4LBZA 1QH0A 4ZV4A 3JQQA 1KJZA 1DARA 2YWEA 3SJZA 1KRHA 4ACAA 1E63A 1UMKA 3OJXA 3QFSA 3ZZ0A 4B3XA 3QE2A 3CCQB 4AF6A 5H59A 5HXBA 1JA0A 3U2QA 3I1FA 3LVBA 1R5NA 1QGYA 2BV3A 4FN5A 5GV8A 3V76A 1FDRA 4C0SA 2OTLB 4UAJA 2B7CA 4TMXA 3CC4B 1JB9A 1ZM3A 2QTZA 4ZCIA 3QSYA 1S0UA 3W2FA 4DQKA 4Y9UA 2YWGA 3CCJB 2EIXA 3E1YE 1GJRA 4F7DA 2XEXA 3VO2A 4B44A 2VNHA 1QGZA 1H85A 4QFMA 2BVNA 3CCRB 4YALA 3VNUA 2QMUA 4G1VA 1ELOA 3W2IA 2ZITA 2HCJB 2BF4A 3W5VA 4C43A 4B4DA 3CW2A 2VZLA 2DCUA 2PIAA 1K9MD 1H42A 2QTLA 1FNMA 2BMWA 5JBQA 4RD1A 1N8RD 5TV2A 3E20A 4B43A 3AVUA 3I55B 3VMFA 4ZCMA 5FA6A 5H5JA 3AVWA 1N0VC 4Q7JB 4ZCLA 3AVYA 3I56B 4TMTA 1VQLB 1VQ7B 1KK1A 1W87A 3CMEB 3VNVA 1XB2A 4RD0A 1VQ6B 1ZM9A 1I7PA 3J81k 3W2GA 1ZUNB 4Y9RA 4J0QA 4IW3B 1G7RA 3WNDA 1VQPB 3LYUA 2BM1A 1M1KD 3CD6B 4BPRA 2BGJA 1GVHA 1QUEA 3P27A 1VQNB 3AVXA 3OZVA 4ZGNB 2PMDA 1KK0A 4TN1A 3WBKA 1QFYA 4HE6A 1EXMA 1YJ9B 4RD2A 3FPKA 1EP1B 2YWFA 3MMPA 3G4SB 2GQFA 2OK8A 3LO8A 1EFCA 4ACBA 1R5OA 3MCAA 4HE5A 4N3NA 1KQSB 3WNBA 3ZBTA 1JJ2B 1DDIA 4PC1A 3CCSB 2X3UA 5TY0A 1YITB 3AVTA 1KTVA 4YAFA 2DEUA 1YIJB 3G71B 3U6BA 1EFUA 4M4SA 3CCVB 1IB0A 4FWTA 2EFGA 4U9UA 1AIPA 4P6VF 1VQMB 3CPWB 3CCUB 2OK7A 1Q7YD 4MYUA 1G7CA 1W34A 4PC7A 1SKQA 3LRXA 1QG0A 2CNDA 1EWYA 4RD6A 1IJEA 2E1RA 5DSZA 1YJWB 2R6HA 3VO1A 4AF7A 2FX3A 3JQPA 1YJNB 1CNEA 1IJFA 1GR1A 1BJKA 5AN9A 1Q82D 2XNCA 1QVGB 5KSWB 2PLFA 2XNJA 4B48A 1EFTA 4WQMA 1B23P 1E64A 1U2RA 1QGAA 1KD1D 3QFCA 3CB4A 2YWHA 2C78A 3AGQA 2VNJA 2J7KA 1TTTA 1FRNA 4PC3A 3FJOA 4TMVA 1K8AD 4YHBA 2DY1A 3G6EB 1D8TA 3ZBUA 3U6KA 4G5GA 1J9ZA 1OB5A 3CXCB 1YHQB 2B5OA 3ES9A 1GAQA 1JNYA 1QVFB 1SM4A 4LC0A 4DQLA 2AHOA 4RD4A 4Y7CA 3CRZA 1KC8D 4PC6A 1R5BA 4YAUA 1W2BB 5TR9A 1ZM4A 1HA3A 1F20A 3CCMB 1BQEA 4MYTA 1VQ8B 4M0LA 1M90D 2OTJB 1OGJA 3CC7B 1G7TA 1VQ4B 4H9GA 5GV7A 2DETA 3OZUA 3AVVA 3QFTA 1VQOB 1S72B 3W2EA 5THXA 3P26A 5EMNA 1GAWA 1F60A 1TVCA 4EH1A 1FNBA 1XE1A 4P3YA 2NPFA 3A1FA 1NDHA 4YAWA 4AC9A 1D1NA 1BX1A 1JA1A 1OB2A 1KK2A 1TLLA 2GPJA 4LBVA 2BGIA 4QHYA 3PENA 2VNIA 1D2EA 4R71A 2CRVA 4PGOA 3ZZTA 1EP2B 3ZC3A 4FK8A 2HMAA 4RD3A 2RC6A 4LBWA 1AMOA 3WNCA 2C77A 1EP3B 4ZGQB 4N3GA 4LBYA 2DERA 4YAOA 3AGPA 1N0UA 4PC2A 4NCNA 2BSAA 2RC5A 4M53A 3CCLB 3CC2B 3WBJA 3B8HA 3JQRA 3W2HA 3MHPA 4TMWA 1WDTA 2VNKA 3OZWA 1VQ5B 4NBSA 3WY9A 3W5UA 2BM0A 4RCZA 1QFZA 2VYQA 1NJID 1FRQA 4M1KA 2D74A 1BX0A 1E62A 1FNDA 1ZM2A 1OGIA 1VQ9B 1QFJA 1CQXA 1Q86D 1KK3A 2QEXB 1TUIA 4M2LA 3CCEB
chains in the Genus database with same CATH superfamily
3Q5EA 1XT6A 4LDAA 4EUKA 4BXOA 1YIDA 4LS3A 2DFKB 4PYMA 3U81A 2EQ5A 4B47A 2ZR8A 4B79A 3R6WA 1ACLA 3DS8A 2B4TO 1EQ2A 1JWBB 3EK2A 3ZG6A 5AM5A 4F71A 1Y48E 1KP2A 1L1QA 2I2AA 5FOXA 3ZU2A 4S0ZA 2I4NA 1HOTA 4AJJA 3TGWA 1YS4A 1OV4A 3KP1A 2Q3LA 1WPXA 3GAAA 3MRTA 4AAYA 3A9WA 2ODWA 2AJTA 1BNCA 4Q93A 4REMA 3ROFA 4D97A 1DBWA 2QB5A 4DNFA 3MXOA 2QP4A 4MQFA 4FKZA 5HJ2A 5IWAB 4RMGA 5BUQA 4CEIB 1W52X 2Z0MA 4CKZA 1BN6A 1JEQA 2FEKA 3RFUA 2O8CB 4X6UA 1R6DA 2ZVJA 2V9ZA 3HDHA 4GKVA 4MROA 2BN4A 3LBFA 2OSVA 3P2YA 1TIKA 4FINA 2BGMA 4PGFA 3WJ2A 1PK7A 2JI4A 3WS7A 1FTNA 1Z8DA 1CP3A 4E3ZA 5C8DA 5HYVA 3K09A 4UQOA 1XTJA 2XR1A 3NEPX 2RHMA 4MZDA 2FW6A 5C1IA 1BKDR 2QIOA 1V8PA 3MLBA 3P0IA 1H0KA 1T8WA 4X95A 3JQQA 3G7SA 1V5EA 4I19A 1CHNA 3OPNA 5AKZA 5ED0A 3TF5A 2ZCJA 1E6KA 2AWNA 3C5WP 4PNZA 4JYZA 3COJA 5BUSA 2VA9A 2J9YB 4QVIA 2OCYC 1P1JA 1E1CA 4DCJA 3JZAA 2BSQA 3MSCA 4G1CA 2O8FB 4KQCA 4OHRA 3Q7RA 4R2XA 1X3SA 2CV0A 1QYVA 2X1HA 1P1BA 3A37A 5AQEA 1SQSA 4Z8YA 3BBLA 3CZAA 3GN2A 1M75A 1S1MA 1KZLA 1Y7IA 2ZI6A 3GUYA 3PC3A 3ZU3A 1PZGA 2X9LA 4EUSA 3AUSA 4L75A 3J7TA 2O8EB 3N9IA 4XA8A 2C88A 1U8CB 3M81A 1ZGBA 3GYGA 4D9JA 3WK4A 5CA1A 4IILA 1TM3E 2EXXA 4NE2A 4F2DA 4YRAA 3LUKA 4L9RA 4RVCA 4H7IA 4F06A 4F11A 1C8LA 2AOUB 2QORA 4PNPA 5LLDA 1NMYA 2BL4A 1NIPA 3PFNA 4N12A 4JHXA 3SHQA 1Q9SA 4EFKA 4ESHA 3KOZA 3BGIA 4K7JA 2X5JO 4BDSA 4NOKA 1BU5A 1L5NA 4I3HA 4WZAE 2GJRA 4RV9A 4Z3DA 3GQBA 4HR7A 5AUOB 1ONNA 2V98A 4J7XA 4HNRA 5IN4A 4QDZA 1OWMA 4MX8A 2WG0A 3BB1A 4XJTA 1VL1A 1ZA2A 4FXUA 1JSCA 2EZ9A 4U6QA 1NN0A 2QTWB 2WA1A 5KKAA 2IYPA 2RK4A 2IW3A 4Y9UA 1NN5A 1ZLYA 2RHOA 3I2GA 1RIFA 1F48A 3ERCA 4MKRA 3D7NA 3EVBA 2J59A 4CKCB 5C8XA 2XEXA 1JLMA 3W77A 2VNHA 5JS6A 5L6LB 3H7AA 3WYDA 4GSKA 2PE5A 5EQDA 3BMOA 1WWKA 3QUCA 1Z6PA 3CX6A 1WD7A 2NQ8A 4HWKA 1QE3A 3DBVO 1ECGA 2YMPA 5CVDA 1KYXA 1QFMA 5E4JA 3PE3A 4DSUA 4NBUA 5JATA 1WB9A 3DHWC 3CRW1 1P7YA 1SBQA 3NM4A 3OW7A 4EHDA 1PWEA 3TVTA 2AXPA 3SX0A 2A9JA 1GQSA 1QDEA 2EBWA 3CF4A 3DFZA 3UMVA 3IEMA 1AC5A 3FAKA 3SLRA 5I4KA 4WI1A 4F9FA 2H2GA 3PKZA 1D5WA 5JBQA 4D3SA 4E5PA 4BXOB 4HNSA 1V37A 1K6IA 4FDTA 1A98A 4ARCA 2NO5A 3EBOA 1PEKE 6NULA 1KYZA 1PKVA 1W8DA 2C7PA 2HNBA 4R1UA 3RQIA 3BTVA 1JKJA 3QWBA 1QO0A 4ZKDA 1XJWA 2PO7A 2O5CA 1ZM7A 2OO5A 5FA6A 3C4JA 4CG3A 3JWIA 2DFPA 2OLEA 1EZZA 4M38A 4CI0B 3IMGA 2WZPP 2H11A 5EERA 2R6AA 2I65A 3GNQA 4P58A 3VR0A 4NCBA 1ZIXA 3QF4A 2SNIE 3SSAA 4CM5A 4PWYA 1RM0A 5C4IA 3HSSA 2C03A 2FH5B 1DWQA 5CXXA 3GLGA 3G0GA 2PX0A 5B7NA 3I5XA 2Q5FA 4KO8A 2Z4TA 4TMYA 2IK8A 2QV7A 5DEIA 1B8OA 4FMBB 2YDYA 5B1HA 2OZKA 4A2WA 2E55A 2AR0A 2JI8A 3QYJA 3T1NA 2Z3ZA 1B14A 2X4DA 5HUQA 2F2TA 3J81k 3VO8A 1CUHA 2WTUA 1KL7A 3AEQB 1VLLA 3GNLA 2YOFA 1VJRA 4WBNA 1XQYA 3GFVA 4H1VA 3MJEA 4BMXA 3S2FA 4PLZA 3AB3A 4L51A 2NTNA 4LXUA 3OQNA 4K87A 5EKSA 2PBRA 5A02A 4PZ9A 1TVKA 3JD3A 4Y67A 4GKAA 3PK0A 1WXHA 2GCGA 1X1SA 1XF1A 3BTOA 1I2ZA 2LUOA 3NV9A 3AV3A 3P27A 4MVJE 3T0IA 1CIJA 1QKKA 2FUKA 3EXIB 2NW6A 5CVUA 4ZVKA 3U09A 3THXA 3RYIB 3WB2A 3SVTA 4NU0A 1N5DA 4GX5A 3RU2A 2WJPA 4CGZA 3CVWA 4ESVA 3ZEIA 1FU4A 4YS6A 5CA1B 5DZSA 2F1IA 4QTUB 4UDYX 4EG6A 1UM9A 5CA1F 2B61A 1B1CA 3DXXA 2QI9F 1HDIA 1WP6A 4U8GA 4BQQA 5F3RA 4BNVA 1MB9A 1LBIA 2OV8A 2ZRIA 5KJ6A 3ER8A 1G2OA 1NVBA 2CYAA 2BI4A 4LOHA 1G21E 3CGGA 3D4BA 2HIGA 3O90A 4HQFA 1GZ4A 3A1TA 4GWGA 1H6DA 3E9MA 4BNNA 1UAYA 4E5MA 4Z4WA 1R9MA 3OQJA 2GMWA 1TZ2A 4TLEA 5FWNA 3GDGA 1CU1A 3N75A 1YZHA 2XBUA 1F06A 3FSGD 3H4TA 3GL9A 1JBQA 3MJSA 4EB3A 1YFZA 3DXYA 3KQWA 3LPLA 4HKTA 3GNTA 1A88A 1I3NA 1O89A 1UPXA 1S02A 2G17A 3PZBA 4FBMA 3AKDA 4OHVA 2CDAA 5CFRA 1Z9BA 1USGA 3OE4A 4UXJA 4GGPA 2BLNA 1U8UA 2FF7A 3JWJA 1K88A 3SAJA 2H17A 2PO5A 3WOVA 1FP7A 1XKTA 1B0PA 1RQPA 1X0VA 3WNBA 2A14A 3E3NA 3EQ9A 3PNBA 4FZ5A 4JIGA 4NG5A 3C5EA 4D9IA 3WO1A 5JUWA 1RXVA 2QT1A 1FBTA 1DDIA 2R97A 3QU7A 1S2LA 1X1DA 2DWUA 2JJYA 3DVRX 3DFFA 4KP7A 4QIHA 4FFDA 1VKZA 3IVMA 4F12A 2C2WA 2JA2A 3F3MA 2DQZA 1ZD2P 4TTSA 3ETEA 3VR5H 1QIFA 3TM5A 4X7EA 4MULA 1JG3A 1E0JA 2X4LA 4HNGA 4WZAA 1D1TA 4WL0A 1XU4A 5M29A 4YRRA 1F4LA 4J76A 3BNWA 4JR1A 2O54A 2PUHA 3MZ0A 2P6UA 4MGHA 1I7QB 1EFUA 1SOUA 4GPZA 3CCVB 2PRSA 4LGMA 4TZTA 1E69A 1X0XA 1Y6JA 1R3UA 2ADMA 1VQMB 3CJTA 3OCVA 4FW8A 1KI9A 2BGTA 1Y7TA 4QBKA 3SK0A 2O06A 2XT9A 4LHVA 2BMEA 2O52A 2IPXA 4ZZ3A 4FE4A 2OK7A 3AESA 2H1LA 3K96A 3BWBA 2XZDA 4C6SA 4RHTA 4GF5A 1C8KA 2OB2A 1P0IA 4TOIA 1XAJA 2HFKA 1ZU4A 3QVXA 5K0CA 1W2HA 3O8QB 2J85A 4C3OB 4IDGA 1HQYE 2K7ZA 3LCMA 1IMJA 3L8DA 3GLGB 4YRNA 1QDUA 2YIJA 5REQB 1QGUA 4DJFC 1RJWA 1A9TA 2GCIA 3IMEA 3G2JA 1NVVR 3PXEA 4QECA 4R4JA 5CM9C 5ENDA 5GZ6A 4MUNA 2VUTA 1U9JA 2KPOA 4NZ9A 1SHTX 3AR9A 1JQBA 2KLBA 3V80A 3VPAA 2XJ9A 3BEOA 3GEGA 3IQGX 3PGKA 3Q6NA 1DTWA 3WSVA 1W36D 2XTNA 2O8BA 2XWJI 1IJFA 4TT3A 1H3NA 4MVYA 3R7BA 1BJKA 5AN9A 2CCJA 4NJOA 3OCXA 1RAAA 2I22A 4CZ2A 3GOQA 4JJAA 3FD8A 4HYQA 1QLHA 1VG8A 2CXSA 3BIWA 3BCHA 3EFOA 5EIBD 1E3EA 1TVKB 4WZKA 3IBTA 4CDRA 3UUFA 3SXPA 5L4LA 1XMJA 1QCCA 5IYRA 3L92A 4QATA 3T41A 1AE1A 2OYSA 3EHEA 4H7HA 2J6IA 1C7RA 3L84A 2RI1A 1G8GA 5EWJA 3IQZA 3THXB 4M1WA 1PZNA 1YAJA 5DN9A 1FRNA 4I50B 3N76A 4C2TA 1M1XB 3CUEF 3E3AA 3RWBA 2PKXA 4DMCA 1DBQA 4DEYA 2FR8A 2LGJA 2R60A 1UM9B 4I50F 2ZZNA 1FUUA 4XIYA 2JFQA 2A5DA 4NWIA 2FI1A 4QQFA 5G1PA 4A91A 2NYAA 2B83A 4MGKR 5JS1A 4TTRA 2X0RA 4N7JA 1O9HA 1E2JA 2PUVA 1LC0A 3N0XA 2Q6KA 3CXCB 1DKQA 1JQEA 3PD0A 1ATZA 1V7ZA 4JSTA 4M86A 3H84A 1VCOA 2IX9A 3VC3A 1NMSA 1PHPA 1ST2A 1WMEA 3ES9A 3OI7A 3UA3A 4ALMA 2Y1DA 5ES4B 3OLVA 1JNYA 5FQNA 3M4NA 3EZNA 2P0YA 3N8IA 2V1UA 2EFDB 4XLAA 2A4MA 3I4FA 2XT0A 5IYZA 4JBNA 3VTFA 1K68A 3VSAA 2FAXA 1T3ZA 2Q6IA 1MAAA 1TO6A 3MILA 1YA6A 3PA8A 3C70A 1EVZA 1XU7A 1YQUA 3GA7A 3LKDA 4MUIA 1I7LA 1SEPA 1U0OC 3BK7A 3BYZA 4OQLA 2NIPA 1Z34A 3THOA 2GREA 4BCBA 1RZRD 1UT6A 3OJEA 121PA 1KOLA 3IQDB 2KMLA 5CTAA 4YCDA 4V1CB 2C3UA 4XGQA 5AIAA 1W2BB 4PHFA 2D3LA 3GVJA 1WD5A 3BE6A 5COBA 1AQLA 3TEJA 4A9AA 3EBLA 4G1FA 4RLZA 4R2MA 1ID8A 3RYCA 4GWKA 1PZMA 4LIPD 4S12A 2X4IA 5H02A 3L1JA 3C8ZA 3GFBA 4IUBS 4KDCA 1QF7A 2XNHA 3AERA 1ZEMA 1ZJJA 3KJIA 2V4UA 3OX2A 1D09A 1G21A 1BE8A 1NW9B 1X92A 3M6IA 2X76A 4OHCA 4PCLA 4WZAB 2AQ8A 5EESA 5K8UA 1E3QA 2C61A 2TSYB 4LHSA 5BQOA 3OQMA 1X1TA 4C22A 3M5WA 4MICA 4A6EA 2XVXA 5IW8A 1VQOB 3E4DA 1VL2A 2HPHA 2KYRA 1CJTC 5IZCC 1W5TA 1CY0A 1XZQA 4IIXA 2CDBA 2P7HA 1DKOA 4H27A 1Z3CA 3PNYA 3TVDA 4EH1A 2P4EA 1PW7A 4A2QA 1FNBA 2VSXA 3GRYA 3SS7X 1TJYA 3SHVA 4XR6A 5EUBA 5DCYA 1LSOA 4CFYA 4PNHA 3EYAA 4XQ9A 1VHJA 2ZS7A 2NO0A 5I4IA 3G5TA 3NTVA 3ZWMA 2D0IA 1TCCA 3IDOA 3WIVA 1Z13A 3LI2A 1IK4A 3C1TA 4K9NA 5A9TA 2I71A 2IP4A 2W8ZA 3PDIB 4H3HB 4K9DA 4M9SA 4N01A 4E5VA 2LCQA 4HUQA 2IHJA 4YT8A 4EO4A 1YMVA 3HSKA 3ZD7A 2AFHE 3VSDA 1ZJZA 4ZQHA 2A0UA 2J5XA 1SKBA 3IAUA 3CPEA 4UVIA 4B82A 5B5SA 4U2KA 3Q8KA 1VE6A 2CVPA 5AVQA 3TXXA 5CX1A 3WE7A 1TFRA 1ECBA 2QGGA 2YV2A 2MOKA 2XUFA 3QX7A 3K2QA 1W93A 2GN9A 2YZ7A 2IPNA 1RE1A 2QJFA 3W6UA 1PBTA 1KZ1A 1DE0A 2HSGA 4X54A 1GGMA 1A2BA 2NX2A 4CKWA 2CV2A 3L0ZA 3TZLA 1WEKA 5I9TA 1ZH8A 2VBTA 4QYWA 4R5MA 5CCDA 3CUKA 3EFOB 3RSGA 1DTEA 1GDHA 2BFMA 2ETXA 2FE4A 3QUAA 1FP6A 3B8HA 5KNLA 4RHXA 2CL0X 4EW1A 5LMZA 4IIDA 4XQCA 4OBEA 2Y2UA 2XYVA 1AKEA 3V7WA 4C4PA 2NSJA 2WFLB 2WWRA 3THYA 1XZLA 3KX2A 4N0EA 2CLIB 2OHFA 2DH6A 3MBOA 2HXYA 1KEWA 2ENUA 3QJYA 2EV9A 2EKBA 1YGPA 3LX8A 3UK6A 4YAGA 5F2NA 2ZBRA 3E3LA 2YXLA 2BFOA 3WIEA 2PV7A 1V8ZA 2W9XA 5EIWA 4CF6A 2CF5A 1ULZA 2AG1A 2AN1A 4MMZB 1LA2A 1Y89A 1Z7WA 5ILGA 1N6PA 1HE5A 1YJ8A 4JGGA 1DOZA 2G72A 1UAAA 1XRJA 5DCUA 3TLKA 3TD6A 1W4ZA 2VSFA 2X15A 3A6FA 5HIIA 2EZTA 2D1YA 2ETVA 2E6KA 2FPUA 3W6NA 2I6FA 4YT5A 4REOA 4XD7D 4PQFA 1GSAA 3VDMA 2PHZA 3GMTA 3LHIA 3K31A 4DMGA 2P9BA 4WOPA 2E87A 1L7EA 3B2NA 1QBKC 2C8VA 3M2TA 2Q1TA 3KYDA 4NPAA 2O2SA 3WAJA 4IOMA 3T7CA 4PYKA 1VHOA 3A6DA 2NACA 4MVJF 1XLVA 3QE0A 4NV0A 3BGOS 2XUQA 2RAVA 3P2EA 4INJA 4HGNA 4WTOA 3CX3A 4AQYB 4QYIA 3ZDXB 1PFQA 4RWEA 1LWNA 4UHCA 4II2A 2QN3A 2D00A 1K2WA 2XUGA 2IQ5A 5EG5A 3ZZUA 1C2YA 5KO2A 2AWOA 4G97A 1D3AA 2HM7A 4IZIA 3SS9X 3OHMA 5IVHA 3AERB 2RBGA 1Z6AA 4IJWA 1O57A 4MWCA 5IFKA 1EFLA 4P3OA 3WKAA 3ASZA 2JDID 3UCFA 1U2GA 1WHTA 2FSGA 1OE0A 3RFFA 3EARA 4Y2QA 3HY6A 3VU9B 1M8FA 3KQNA 5JPIA 3N28A 3UMBA 1M6YA 3L0PA 4Z2AA 4B35A 4K6KA 1FFWA 1Z8HA 1Z6ZA 4UZUA 4ZEWA 1USKA 3WTCA 4V0OA 4Z99A 4Y2UA 1E9AA 5KTRA 8ATCA 2EBHX 4Q1VA 2DZDA 2JCSA 2V74B 5DXAA 1P0CA 3IESA 1QH0A 4UE2A 4DA7A 1IXRC 1AXEA 4ZIRA 1O5OA 2PBLA 1PR2A 1GP2A 3FIJA 2X0EA 2HUNA 1FFXA 3G02A 3IP6A 5AOVA 4U8HA 5H4GA 1JEJA 1AHPA 3TOVA 1OLUB 4NS4A 3SJZA 4URHA 5CH5A 2X41A 1U9IA 3OQVA 4D7AA 1Y4ZA 4PO9A 1Z5UA 3ZE8A 1VHQA 1WXXA 2ZOSA 4ER0A 3TKLA 1ZBQA 4IHQA 3DR5A 2O6HA 2B25A 4LE2A 3TYXA 1VBFA 4CUKA 4ZI3A 3UB3A 1TLFA 3JQFC 5GZ3A 1B0AA 4URZR 4F9GA 5TT0A 1FQJA 1YZVA 2ZXUA 1AUQA 4IEFB 4FQ5A 4OOEA 1AUVA 3NRJA 2JBWA 1ZUD1 1X39A 2EKDA 3E9EA 3E8MA 2Z57A 4G1EB 2VHTA 5CX1B 3V7UA 2Q0SA 1G3RA 1KYQA 1V11B 3KSAC 2W6IA 2HHJA 2CYCA 3I04A 2VDLB 1PDOA 4RC9A 2GYWA 3WSWA 4B80A 2E5LB 3AHEA 4QTYA 5JAZA 4O4LB 2JGEA 1RYFA 1MZPA 1L7VC 3UK2A 1YZNA 4PG5A 4O4LF 1R5NA 1JHVA 1TW2A 2ISCA 1M1YB 1AXRA 3FOAA 3KLPX 2E5WA 4KACA 5DHQA 3ROPA 1QHNA 1U7XA 4DA4A 1LPAB 2ZSJA 2CVZA 2G5CA 1N3IA 3OLZA 2B7CA 1JAZA 1KIAA 3W4JA 3GJ7A 4PPGA 2QKYA 1BGVA 1DQSA 4UMFA 2I3BA 2BMFA 3OT1A 1Z0UA 1HL3A 3OURA 5A5GA 3GDOA 2ZE8A 1FLNA 1G5RA 2G40A 5EZ5A 3T9AA 4FTWA 2O8VA 2BFDB 2J6CA 2JN9A 2RH5A 4QJ5A 3CMMA 1FPQA 4J3NA 1Y3DE 1TEHA 1KFJB 3WVNA 1AGPA 3ZDFA 1JHXA 2CYBA 2WIGA 3BXOA 3IPRA 5F9MA 2P9GA 4DDHA 1NYLA 4LRXA 4EP1A 1P19A 2NP7A 3WA6A 4E11A 1H85A 2WWVD 2EVWX 4I6JA 1X87A 4RM3A 3VVBA 3STXA 2HSWA 3V6LA 1V5FA 3I6ZA 5E6UA 2IEDA 2WHPA 3CNNA 3A6PC 3PG5A 5GMOA 2A33A 1E1YA 2VHZA 4ZYZA 4ZK2A 4U7DA 4C7OA 1N8NA 3CLUD 4A5SA 3OMLA 2VPXA 4KSCA 5HILA 3VC7A 3S70A 1L5QA 2ZKLA 1LQTA 2LXNA 1IN1A 3FNBA 3RS7A 4AUKA 1KTIA 3Q6QA 3ZLTA 3DYBA 5CD1A 3SQNA 1S1CA 1W9MA 1CUZA 3SYTA 2X0KA 2HU7A 3JYQA 4DR7B 4WK0B 3LIPA 3LL4A 3LZ6A 3M1LA 4XLLA 4I4IA 4QYIB 4JA0A 4I55A 2P30A 1OU0A 3EWSA 5LYJB 1JDZA 3F1KA 3FDXA 4HH4A 3HY4A 2XSZD 1EE9A 5H5JA 4PX2A 3ZD8A 2CZQA 3GVXA 3U40A 5DPMA 3ZDEA 1RKQA 3AVYA 4UZSA 2W8BB 4X64B 3VR4A 3RJMA 1YAHA 3TZKA 4LFAB 3UOWA 5BNIA 3A1UA 3ANXA 3OTQA 4ISBA 4U5QA 5J4HA 4DC0A 1YB7A 1EK1A 4P84A 5LQJA 2B8EA 3AUAA 3JQ9C 4F3NA 4KR6A 1CZLA 1P9RA 5ALSA 4Z7QB 1J8FA 1KOGA 1ODSA 1QYXA 3A28A 1XK6A 3HJNA 4MUGA 1E6UA 3R3VA 3ICCA 4C0AC 4HY3A 1MD9A 4QJ3A 5EWMB 4R1LA 5HW0A 5F5XA 2HF2A 1ENYA 3DP7A 3QRWA 4ZIRB 4UDNA 1A8SA 3AKYA 3GRRA 4GDMA 4IW3B 1JW9B 3HCOA 4PGMA 4F3KA 3KJFA 1XPJA 4IDBA 3TR0A 1PJSA 5CFZA 4R51A 1YUBA 1Y8QA 3TZEA 1PEAA 2AZTA 3BK2A 2ZJZA 4E5SA 2BELA 1HWYA 3BSSA 2PFKA 1K4YA 1KDVA 4OXRA 2PA0A 1M1KD 5L7YA 3V1KA 3TZCA 2H7VA 1U0HC 4H6XA 4H7FA 3ILXA 4GICA 4C4RA 5JBIA 5TMPA 5FA8A 4S0XA 4Y0AA 3USZA 4NRDA 4GPEA 3LQRA 1VXOA 2Q0QA 3COZA 1GTRA 1Y8RB 4GE3A 4YEDA 3DPSA 5DISB 5E3IA 4B6SA 2HDOA 5JI3E 4DJ5X 1TRHA 3BAZA 1N7JA 1V71A 1XZAA 3VVCA 4PIPA 2NVBA 3TNLA 3SEJA 2BFWA 4DG5A 5IJXA 4RWZA 4EF6A 5JJBA 2J3EA 1BXZA 1GPBA 1OBFO 2ZRPA 4JJGA 1SEVA 1RRMA 2RGRA 1YI1A 1AGRA 4QVAA 1AKWA 3DCIA 3ONDA 3ZW8A 5CDHA 1RTTA 1Y7HA 3HJHA 1KEEA 2WSSA 1EXMA 2YUIA 2GK6A 4JCOA 4AY6A 1WV0A 4L2IA 3S8EA 2CFOA 4JLDA 2Y9MB 4TRMA 4UM7A 1SUIA 3UM9A 3HBAA 3V3TA 3OT1B 4A7PA 1P7WA 1HYGA 2BONA 3ZW7A 1SU4A 2V3VA 4V0ME 4JYCA 3S8YA 2ZZKA 3Q3HA 4LZLA 2AFHB 3NIDB 1TF7A 1B73A 3ORYA 3EMDA 2UVQA 4MKZA 2MINA 3DGFC 4ACBA 3GIDA 4N18A 3ADCA 1NNLA 1N2OA 4BO7A 3D6VA 4NMMA 2J7PA 1TU0A 4YJGB 4TLMB 4DM7A 3OZSA 2JFGA 2Z30A 4R2KA 5ABPA 2MSWA 5IJ0A 2ZR9A 4KIFA 4KVZA 4OH7A 3ADOA 1NX9A 4XM3A 2WHPB 4BN4A 1IM8A 4MTLA 3UMYA 1SC3A 2C9MA 2PL5A 4LJ9A 4KREA 1WS6A 3CSDA 2CXNA 5ARBA 4R1SA 2YXBA 1XUOA 3ZDRA 2B5VA 4Q3AA 4ZT7A 3UJNA 2DEUA 2Z5LA 3PD1A 3ZGYA 3FE2A 1QC5A 4KITB 4HVLA 5LUAA 5FOSA 3DT6A 2C99A 2OP0A 3CO5A 4NYJQ 4RVFA 1XMVA 5E0OA 4O3MA 3UAOA 4A2PA 4YBRA 1Y98A 1ZSVA 2GERA 5HRAA 1CT9A 3EX7C 4JXJA 4I55B 1SCQA 4EM6A 2QTBA 1N2GA 1RIIA 2YH2A 4JLSA 2IY7A 2QTCA 2XZLA 2WQ6A 1FW6A 4Z4GA 2N3ZA 3K0KA 1OD6A 3E61A 4INAA 5GJVC 5CM2Z 1JIKA 2GSDA 2RE8A 3GVLA 1OKKA 1I1HA 1UBCA 3MJCA 2BDUA 1FDTA 1LRKA 4ABTA 1A04A 4X7FA 1NZJA 2BMJA 1LF5A 4BE9A 2CZGA 2E6UX 5DSZA 4IUYA 2HRDA 4JVNA 5JADA 1PTKA 2FSVC 1ZIOA 4L4ZA 1TXGA 5CLLA 3HFJA 2BYTA 1RZVA 3ODGA 2OV6A 3AIOA 1NHGA 5A06A 1GV0A 4GO1A 2IUFA 3D3NA 1QONA 5ER9A 3WAKA 3WQHA 4D96A 5CR9A 3UAGA 4EJSB 1B26A 4JELA 1JAHA 5KSWB 4YIKA 5E38A 5P8WA 2BGWA 3MC1A 4HDRA 4B40A 1UBSB 3ZHYA 2B36A 1UPTA 3ZLUA 2PFSA 3OEHA 4X91A 1RHUA 5I48A 1EP9A 3E5HA 2WD7A 4QU0A 2HLNA 5CPFA 5JCJD 4QRIA 2GX6A 4IIHA 4MUAA 1K7SN 1H0HA 1XCMA 3FTQA 2QNBA 4D4HA 1X3LA 1L7BA 1LK0A 5E4FA 2E0IA 2D1FA 2CVOA 4DCVA 3KKNA 2X19A 5JSFA 3M2PA 3SJCA 1E0AA 3HKEA 3E7XA 4FFNA 5COQA 1DZIA 2KM1A 1UXJA 4DQUA 2W22A 2ZWVA 4HAWA 2HGZA 4BGEA 4R7GA 4UTPA 2H48A 4OP1A 4YJFA 2P77A 3PFHA 1M9NA 1FPMA 1MFZA 1J9ZA 2WF8A 2X3FA 4JI8B 5IXJA 4OTZA 1PJQA 1AN9A 4J0DA 1QIHA 2FMHA 4PRZA 4LMRA 3VR5A 4I99A 2EDAA 4L2IB 4F2WA 3AOEC 1GGNA 3OP4A 2NSYA 2P2NA 1OC2A 1TQDA 3LV8A 2F67A 4UHJA 5IDXA 4UNRA 1E7SA 4LVUA 2YJ6A 7REQB 1XFOA 5JAHA 4P3IA 2VJIA 3U3XA 2I78A 1EHYA 1XZPA 2AX4A 5CXUA 3X1XA 5D84A 1ZX1A 2R62A 2WMNB 4PCUA 2JB9A 1XGKA 3WYNA 5JO0A 2LBPA 3HZHA 2PR2A 3AFIA 2B1QA 1HURA 2FW7A 3CKMA 3IP9A 2Q4OA 2OM2A 3OIGA 3LO5A 4J1TA 4OUDB 1P3DA 4IX9A 1VKRA 3MSXA 3W7BA 3TQRA 3ZWYA 5HIKA 4CTKA 5IJ0B 1AQJA 2CEKA 1I3MA 4BLTA 4BNWA 2W6ZA 1FIUA 4WOCA 3ZGOA 5ESRA 2Q4DA 4AWAA 1NOJA 3DAHA 1UC9A 2P6OA 4K40A 3A4LA 5BQFA 1R6AA 3KVVA 2QMZA 2Y68A 1JHQA 3OF3A 4Q3DA 3BWEA 4OQPA 1XR3A 3PUXA 4H9GA 421PA 3ZCSA 4YLYA 3U3ZA 3PX2A 2OV1A 1J1UA 4UMVA 3PQCA 5JDCC 3PXGA 2WMDA 1CERA 1KJYA 1VPTA 1LRJA 1QC5B 4KXNA 1NRKA 1JXMA 1T4BA 2R1VA 3RVQA 5IJZA 4X8MA 4V0MA 4IUCS 3UT6A 4RIEA 5H83A 1LVHA 4QQRA 3NHWA 4AJKA 5JDIA 2O3TA 3L0DA 1F60A 1DC3A 1DGQA 3KXPA 4I5IA 3V9AA 3LGAA 1K8ZB 2EZ8A 2BFFA 4HVTA 1J9GA 2XB2A 5A3QA 4AU1A 2ILTA 2PXXA 3GFGA 3G9TA 4NAHA 3NBQA 5CK4A 2XAAA 3DM9B 3ECCA 3O0DA 1VKJA 3EVGA 1YZKA 3PYLA 3V4OA 4EW2A 3LPCA 1X70A 4UTZA 1Q0HA 3KUDA 3PC8C 4HDCA 1JN0A 2K5UA 4M88A 2B4YA 1H8HD 3TTXA 3RYFA 1CUCA 1RZ3A 3G23A 5KSOA 2C31A 1XVLA 3RJ9A 1VLQA 3QWAA 1YZUA 3DBLA 1RPJA 1JJFA 1W581 4HWGA 1EINA 2A1TS 5JPDA 3HB0A 1OVMA 5K5EA 3HKCA 4GG1A 1UKBA 2WUVA 3DWEX 3L8YA 3MWJA 3GYBA 2PMWB 4RGBA 2KB0A 2AQHA 2OLJA 3UBMA 5BNFA 1YVRA 3WNCA 3EWAA 4NJMA 4F84A 2GBIA 3HCDA 1JR3E 1PUJA 4MA5A 2P9FA 1J09A 1IHPA 4PRYA 4UKDA 5EMHA 5IDYA 1AV7A 2X8AA 3S2ZA 1OI7A 1EK5A 4DIUA 4AG3A 2ZE6A 3L8HA 2IDKA 1N0UA 3TIVA 2OXRA 1EX9A 2BSAA 3KXDA 2RC5A 3CCLB 1VA5A 2F9LA 4Q39A 4F91B 4B3SB 5DCLA 1NJFA 4NDAA 2WD7B 5THKA 3OZEA 2CVQA 1FFEA 3CRMA 5ARDA 2YZKA 3W2HA 1U80A 3CTAA 3QY0A 3AG6A 2QM3A 2ADOA 5GIOE 4ALJA 5E9QA 3JVDA 4Q16A 3HLTA 2V7BA 3NUGA 2PN1A 5F73A 5HEKA 1P9OA 1UFVA 3BDVA 1AA9A 4KUGA 1NJID 3HVKA 1JTEA 1IY8A 1IWBB 1GTJ1 1HEYA 2QQGA 2VDNB 4W1RA 4D8TA 2J48A 1CUSA 1SUEA 3IP1A 1RRGA 4TL8A 1Y6FA 1OXVA 2DVMA 3S3TA 1QOQB 1I5OA 1C1YA 2OAQ1 2POQX 4HNAA 2BHNA 2GO7A 1NM5C 3WGYA 4HDNA 4U7HA 5IKPA 1E92A 2CKDA 2Z2XA 4HQLA 3U4IA 1G8SA 1NMXA 3LDFA 3AK4A 2XF8A 1RABA 3QENA 1XAIA 4OJYA 2QEXB 3AILA 3JQFA 5HJEA 1ATIA 4M2LA 1EJ6A 3RRNA 4S1TA 4DKXA 4C87A 4E1BA 2GILA 2Y27A 3B6MA 4YRGA 4ZCTA 1J5XA 5EXEA 5C8VA 2ZJ6A 5LSAA 1ADFA 4QNRA 4KQGA 2ZRMA 4W63A 2PVCA 3AJRA 4M7PA 3V8RA 5CLFA 4R0NA 4JJFA 2C4TA 1VM6A 3I1IA 1K6MA 5EVJA 1NZDA 1KE2A 1ZK3A 1L8QA 3WL6A 3TQQA 5DN6D 3DAOA 1RFLA 2CDNA 2HIMA 3A0RB 5B6IA 3L8MA 3M1IA 2XADA 4OOFA 5ISMA 4D25A 1JEYA 4HH3C 3CEAA 3QPAA 1U65A 5JYDA 3QIVA 4A1OA 1SG9A 3KHSA 5ICSA 4BGIA 5EIBC 3PFGA 3ESBA 1CJMA 1SHLA 3S1AB 2QF7A 1R15A 5HXAA 1LVUA 3KYJB 5JSQA 3PLAE 4MKGA 3T9EA 1N7IA 1N2ZA 3SJPA 4DV7B 5E4TA 4BAUA 5TMEA 1KFKB 1QYCA 3AL2A 4MYHA 3CW9A 5KQPA 3ZTWA 1FFDA 3KUUA 4BV2A 3NHSA 3VOSA 2BFFB 1OFGA 2WSBA 2ZUEA 2A9OA 1RYNA 2JHGA 3RFTA 1MX5A 2CLKB 1IQPA 3NPAA 4X6YA 1GYRA 3TQSA 4DLZA 2HMTA 4UHBA 1P4HA 1KJWA 2BGLA 1LK7A 5IYQA 1PFYA 3PF9A 2FUG6 5FL7D 3V1NA 2D7JA 2WU3A 1DLJA 1B8PA 1GUFA 1YDMA 2C4WA 2IYVA 1V5WA 4EFMA 3AF5A 1FP4A 1NW6A 5KNBH 1ZD9A 3PVCA 1VHTA 1UMKA 1F0KA 1H2EA 1QG4A 2BZ0A 2QRMA 3RYFB 3A4YA 4ALLA 4CT5A 2XGJA 3W3ZB 5ALZA 1XQVA 2WJAA 1NYRA 3MINA 4XSVA 3ZZNA 5C1PA 2YJ5A 2F90A 2XUZA 5B57C 3PJDA 5BSTA 1IEQA 5LMNB 4YO8A 1YR1A 1C3OA 5IC6A 3OQIA 2P4HX 4MUKA 4U7FA 5IRCD 3KOWA 3SC6A 3U3DA 2X8LA 3AEXA 4NCIA 1GT6A 3P4XA 4O1MA 3EZGA 2H9AA 2KBEA 2WC1A 1P72A 4JBHA 4QOHA 5GV8A 1XMPA 4HLQB 3ZGLA 1EH5A 3DQPA 4CJXA 1EHIA 4JQYA 4EHFA 4XRGA 2GF2A 1FMFA 2G71A 3BRQA 3AW9A 3NVMB 4IV5A 4WAUA 3LXRA 4RTRA 1U8XX 1UMCA 1G8FA 2G9QA 4D1YA 4LSGA 3KJZA 4W9NC 5E6SB 2G0TA 5F78A 1USWA 1YBMA 3VR6D 4RZIA 1L4FA 3NYRA 2YINC 4BEBA 1W96A 2FP4A 4H16A 1V3UA 3JQ9A 4LG1A 3VR3A 4L8JA 1EE2A 3GA0A 4AULA 2Y77A 2EIXA 1WP4A 2I1QA 4QPJC 1GJRA 5EMMA 2PYDA 4UAVA 3R7WA 4X00A 5A4KA 3QVGB 5A6VA 1K63A 4NZMA 1JSRA 5FEUA 4RQTA 1WR8A 5LDDC 4FFBA 2CJFA 5G0TA 3DLIA 1NQUA 1Y9EA 3OWOA 3CCRB 5HKLA 3W3AH 3QEJA 3I2IA 5KOJA 1IVSA 1WY7A 3E2MA 4YMHA 3N5CA 3WDMA 2X6YA 1REQA 3W2IA 1JR3A 1IHYA 1SCKA 2NTEA 2QRKA 2QVZX 2ZYDA 3BOSA 4QUZA 3KEOA 1Q1ZA 4J2OA 1BOFA 1VHEA 2C9ZA 4JQZA 4R1QA 1BVRA 2F9MA 3PUYA 3C3PA 1H2BA 2R9VA 1HE4A 2Q2WA 3F6EX 4G2TA 4HNAB 2QYOA 4PGAA 3FUWA 1C9NA 3RIHA 3UHFA 1E6LA 2C4VA 2Q50A 4KGZA 3Q7SA 3MLAA 4MYRA 4AWBA 4EA8A 3CW2A 5HNKA 3NJRA 2PIAA 4GUDA 2JH8A 1YH3A 2RG7A 3F8SA 5HF9A 2QUZA 4H4CA 3W0LB 1LLDA 2DQ4A 4FUQA 5GVSA 2DUWA 3F46A 3KV3O 3ZVMA 3ZV3A 2JAHA 4MJ3A 1A50B 3ZGVA 3FKQA 1YZGA 5JRZA 3PGMA 1TTQB 2REXB 3FYHA 1HYHA 4S1VA 3L1KA 4E0BA 4EO9A 4MPPA 4FOPA 2C2ZA 2B34A 3VU1A 5JECA 1KY4A 2VDJA 4V0SA 1NNSA 1LPOA 3DUWA 3AVWA 3ML1A 1WF6A 4L4SA 3W8NA 3WJAA 5MN6A 4BFLA 2D62A 2R4TA 2A84A 4ARAA 5FBZA 2YYSA 3H2HA 4JFRA 4IIYA 3K9CA 2AVDA 3R23A 1PJLA 3FOEC 2H5EA 2CUNA 3ZDQA 3USCS 2XMBA 3V8VA 4ZVMA 3OCWA 1N2BA 3NALA 4LRYA 1YJAA 3S81A 1RRFA 3LKBA 1ZL2A 2WSYB 3LTNC 3VNVA 1QG2A 4PZEA 5DGXA 1IDN1 1KVUA 4C0HA 2J6BA 1GA4A 1K98A 3IAS1 1FTYA 3JALB 4HTFB 4IDNA 3H8SA 3NGMA 4O8ZA 5D1NA 2D8MA 3A1DA 2R8PA 1N1MA 4NJEB 3N8GA 5FOUA 3FY4A 4N8SA 1G7RA 1WXQA 1G9XA 1JXOA 1QNFA 2HJHA 3FDIA 4AY5A 2H00A 5JMPA 1BVYF 4JKIA 2DQSA 1FP4B 4UNQA 2LW7A 5GONA 4PXAA 3NASA 1E2KA 1HOXA 2R1ZA 5CBKA 2PZLA 2J67A 4XVQA 2BBSA 2VCEA 1KY2A 1N1DA 1GN8A 2IU3A 3M5DA 1E0SA 1C1DA 1SULA 1O0SA 5MHTA 1ZAKA 3WQQA 1HMPA 1A97A 3PSAA 5K3AA 3LUFA 2R5NA 4CLXA 4OSPA 4CCSA 1LW6E 4YDRA 1K5HA 2LD4A 3M3PA 1MJNA 1E9DA 2HU5A 4GE0A 5FR2A 3T34A 1DI0A 3IL2A 2ZRBA 5DM4A 5LFAA 2J0VA 1E3SA 4KYIB 3S2GA 3K9LA 4W8OA 1GPAA 1EIWA 1EKXA 4LY3A 3PCXA 4D4GA 2PKQP 3DDHA 1L5LA 4QULA 1SXGA 4RA6B 5EKUA 1B8NA 2Y1FA 3UK0A 4Y1EA 4GDFA 1UMCB 2GZAA 1EX6A 4MAFA 2GRUA 1W48A 3BHMA 3NWBA 4X85A 3T7AA 2JVJA 1W0JD 1RADA 1G20E 1Y0YA 4ZI5A 4OGLA 2GHTA 3CB2A 5DGDA 1P62B 4XN0A 4Q4JB 1M34E 5EZSA 3VYVA 3WGGA 4GMDA 3WLHA 1XTSA 3JAKB 1THTA 3R7WB 3ZXSA 1TGYA 1OBOA 3LUJA 3PVDA 1VFPA 3IOMA 1UFKA 2VYVA 4IMJB 4INPA 1UMDA 1G98A 5ALNA 3I5MA 4D56A 1UL1X 4F5WA 1E60A 1RACA 3PWKA 4GXQA 4M1ZA 4QBGB 3SMQA 1BDHA 3Q3EA 1KQSB 3ZBTA 4R7TA 3JYOA 1REQB 4LXQA 4JAVC 3MWKA 2WDZA 2DPMA 2JAQA 4KE8A 4LX8A 3V32A 2QM0A 3EOBI 1U0JA 1J70A 2WTNA 1IG0A 1H0SA 3CUYA 3A1VA 4WK6A 4YCAA 2I2XB 3W5JA 4AS2A 2OAEA 5AR1A 3QXJA 4G0MA 4I0WB 4ATNA 3HBFA 1NBWB 4BWGA 4NNJA 3GZNA 2CNWD 3I01A 5EQFA 3Q3CA 2IHVA 4LZPA 1AY0A 5CB8A 3PNOA 3LPNA 3R20A 2IW1A 2QRHA 4ZQGA 5K3FA 5KTOA 1AS2A 4BYMA 1TTHA 2D6FA 3SE0A 1DAOA 1B6TA 1XTZA 3ACBA 3IAM1 1UPFA 4MR8B 1H5QA 3AHJA 5A03A 5AW3A 1NPTO 2JARA 2QL7A 1N9ZA 3GMDA 4UXHA 1GUZA 1KQ3A 1L7AA 2F1JA 4JL6A 4E21A 3K30A 2C4MA 3LZDA 3AOEA 3K53A 1PQPA 2GBLC 1TYBE 3LRXA 3MFYA 3UGTA 2E49A 3X3HA 1GTG1 4CFSA 4PIMA 1SOVA 4Z4ZA 2XRZA 2ZB7A 3Q39A 4YV1A 3EZ7A 5L6MB 5LYYA 5JYEA 3RRZA 5LKAA 2R0QC 3V6MA 4ZVTA 2FRDC 2FPGA 2JFUA 2XB8A 3ZGNA 1PBNA 3WV5A 1G3QA 1JQLB 3AEYA 4LRUA 4Q7KA 5IT0A 3OLQA 2C57A 2UZAA 2YRFA 1SUWA 3FUVA 3LAWA 3MERA 4H77A 4E09A 1RYZA 4Z4UA 1Y63A 1I3CA 3AI1A 5HF6A 1PI3A 1R7RA 2D2FA 1PIWA 2UVDA 1V96A 1K3TA 4M9RA 4NFYA 1ARZA 2NUAA 5H3CA 4W7SA 3SQMA 3MTIA 4KKSA 4IHAA 2Q3FA 3KFLA 3KPYA 3DOIA 2Q3HA 2WYHA 4OAOA 1QG6A 2EW2A 1DQNA 1UMBA 2E4YA 4HP8A 4RH0A 4WQMA 3DWGA 1BMFA 2G25A 1CULC 1ZK4A 3KDAA 1JA9A 1GEEA 5HA5A 5GONB 1X7GA 5SZIA 1U2RA 2VJBA 2FMKA 1E2IA 3T4PA 4L8VA 1WCV1 3H1BA 2FR1A 1G5HA 1WUYA 2GN0A 3D6FA 5KTTA 4R8VA 3AF4A 3PA2A 2ZI3A 3DAYA 2YWHA 5GONF 2C78A 5JDCA 4ZARA 1ZD1A 1VDMA 1FF9A 1E5VA 2Z8YA 2J7KA 1TM1E 2F17A 1Z8NA 2X6RA 2WFZA 5DHFA 4N5NA 1M6VB 1RLIA 3MWDB 4Q37A 4PC3A 3L8CA 3ZQ6A 1IBRA 1Z6YA 4FI3C 4FNOA 2JAWA 2YFKA 1MJ5A 2DCMA 3IBGA 2HD4A 2HNAA 3IPYA 1O96A 4OL9A 5BOSA 4PE5B 3L0YA 4LVNA 5EIAA 4BL5A 2CSXA 5G2OA 1RAHA 3KOMA 2OMKA 4G5GA 3PL1A 1E6WA 4EGSA 4BKRA 1Z4QA 4OJKA 4YV7A 5CNJA 3ZHTA 3L8FA 3PFBA 4PW0A 4Z0PA 1U9YA 4EEKA 3KUXA 3QM1A 1V16B 1KBQA 1ZD3A 2HPAA 3BG5A 4Q00A 3U9TA 4CW7A 1AUOA 1PKEA 1X77A 3LY5A 4L5IA 4DUGA 2HZBA 5I7OA 3NCHA 4KQHA 4TMKA 1JIVA 4HDMB 4S2EA 3FWYA 2FOIA 1U2EA 1PS8A 4OVKA 3TNDA 4UU0A 2EX0A 3L9XA 3TQTA 5GJBA 1KYWA 3FTNA 1JDJA 1WNFA 4LC0A 2H07A 3CZ4A 3FSGA 3OOJA 5AOBA 5BMVA 4FCCA 4CKEA 4G9EA 1L5RA 1P7ZA 2K2QB 1U7OA 4G9BA 4TRNA 5CVVA 1M2VA 3C3CA 3ZKWB 4RYDA 1V35A 1FUIA 3L4KA 3BFVA 4P08A 2IIVA 2IOYA 2W00A 3BWYA 4RSRA 3MGCA 1T8SA 4L57A 4GHWA 3VUFA 4CIYA 2D7DA 4G5OA 2OFOA 1ODKA 1HXHA 4IQGA 1T29A 4C20A 4D26A 1Z2CA 1L8AA 4TSKA 2O2HA 4MHOA 4V24A 2CJYA 1JU4A 5EY5B 4ZU3A 1BQEA 3VPDA 2OENG 2QG9A 1ZUNA 4KQMA 3J80A 2FW8A 2NO6A 3PFFA 1PJTA 2J3QA 1WXGA 4K9KA 3F73A 3H2BA 2ZYWX 1GU1A 3CC7B 4TVSA 3T7TA 3B89A 1Q0UA 5GV7A 3D0RA 1KYIA 1RWXA 5BSVA 1LPBB 1NIJA 3KQTA 3DV2A 3II6X 5IVIA 1HDZA 3SQLA 3AVVA 4GQBA 5J4KA 2XWSA 1NVEA 2A30A 2IGBA 3JWPA 1G20A 3F5QA 1KEVA 3GZNB 3P0EA 4FD2A 4JLAA 4WE3A 3CLRD 2GTIA 4R69A 2FZVA 2FPIA 1M34A 2CWWA 2QUAA 3LBNA 3RAPR 1DC4A 2B78A 3CWQA 3FVWA 4ZGBA 2FDXA 1MAWA 4KTTE 2PUBA 3V8NA 4D9HA 1PWYE 1HK7A 3R9IA 2JGAA 2I99A 3D7LA 1SUAA 4WY2A 4RAOA 1GPH1 3L7BA 4CG2A 3HS3A 2C2YA 1OB2A 2NG1A 4OHBA 4KSBA 4WKBA 2V1XA 1NM5A 2QX6A 2WAYA 1P2BA 2Y1OA 1TLLA 2X8WA 3AL3A 4YCCA 3PU6A 4LBVA 1C3JA 3H4IA 4LJ7A 3PRHA 4XQGA 2FPGB 4K9SA 4X44A 5EE9A 1A9QA 1WSRA 1UDBA 2J1LA 1X80A 1VYUA 4NATA 4R71A 1ISRA 1GRRA 3WLLA 4DSAA 4Q02A 5KCMA 2PV0A 4F3CA 2JJ2D 1QVZA 4ML3A 3W1WA 3OESA 4BTEA 1NU8A 5IBPA 1ZJ4A 5ARCA 4OPOA 3KR1A 4MEJA 5EYPB 3E22B 2NUAB 2HQOA 3TZHA 3UTDA 3RBXA 4BJHB 3ZDBA 3CNHA 4UEOA 5FOVA 2AF3C 1TEZA 2P69A 4HH1A 2P9YA 4LBYA 2DERA 4RY2A 2HO5A 4MMYB 1UMBB 1MXFA 4A5OA 3JQAB 1V8BA 5FUMA 4L8GA 2B0CA 4PN7A 2I3AA 1Z33A 3I3SR 1W9HA 3U56A 1ZGHA 4OI1A 2GAFA 1NQWA 5FPTA 4E32A 1NXQA 1U0TA 1N32B 3H8WA 3ONUA 1E7WA 2X9GA 1P3Y1 3VZDA 5AJVB 3VU3A 3MHPA 4C4YA 5KYXA 5JAPA 4DEXA 2OCPA 5JJIA 3MIZA 3D54D 4WZZA 2HBYA 1GFSA 4G8CA 5K6RA 2NZYA 2O2GA 3UT0A 2IP1A 4HMPA 1IHUA 3RTAA 1BIFA 4JB8A 1KWKA 3O9VA 4PVCA 4GBJA 5FPSA 4CEHB 2XUJA 1CC1S 1P0PA 2QSYA 1L5ZA 1XNGA 3O8OA 3EW7A 4QDUA 4RANA 1H4TA 5EJFA 5BOSB 2Q3MA 3KPWA 3MG9A 4LYDA 3TQCA 3I6BA 3HO1A 1KPHA 2RHGB 4H60A 5LVAA 3I9V1 5BYJA 4Q0MA 3DZ8A 4A15A 5D00A 3BRSA 5F52A 2A0XA 5T67A 1BX0A 1ULAA 1I4EB 3RIEA 4PSCA 4TTPA 1P7PA 3FROA 3B12A 3PNLA 1ZVQA 2J5KA 1J22A 3GLUA 4ILKA 4QDOA 4EFNA 4C7VA 4YGXB 3B1ZA 1FDVA 4B8YA 3J81A 1KAOA 2JJ1D 2PS3A 4UE6A 2C4UA 1DCKA 5DBFA 1NBMD 5DTQA 4OLHA 5BMVB 4FQ8A 5JAIA 4CKEB 4KOAA 3H7IA 1KI2A 1M2VB 3FYTA 4CPDA 3VKHA 5AW9A 3AP2A 2LCFA 4HB3A 3QYAA 3ZK8A 1IIRA 2F48A 3BA6A 3O1LA 2SKDA 1ONPA 3I4CA 1M6NA 2W6OA 3FMVA 1JHPA 4XLZA 5TNXA 1JTVA 1G8JA 1Z5PA 3MN1A 1VRWA 1O5IA 1CTQA 2B4AA 3NBFA 4TS3A 4EJ2A 5TPZA 5FUBA 3KHUA 4PFQA 3D9QX 1N0IA 1NR1A 1QXSA 4LWPA 3PRKE 3CMCO 2DWCA 3V7YA 3U7GA 1Y80A 5CPBA 5BWMA 4W9NA 4D4IA 1L4BA 3OOEA 3BIFA 1XZ8A 3DZJA 1HYEA 2P27A 3CUSA 3OLXA 2P5SA 3E4CA 4LXTA 4WSOA 1G4UR 2PBZA 1G20B 4IV0A 3UG7A 5TB5A 1GFIA 1BO6A 4HTAA 4XDZA 1P6UA 1TX4B 2FPIB 1FJXA 1DO2A 2I54A 1OZFA 1LDNA 1ND6A 4PABA 4NMXB 3T0FA 1OZHA 3AUJB 4L8FA 3ONEA 3IMKA 4GX1A 3FIUA 1DAHA 1SGWA 3I83A 4JT2A 1IOVA 2QAGA 1R6XA 1KJZA 1AGNA 1NVTA 2BCGY 1RXWA 2AA3A 4B3GA 4U9HS 4IR7A 3TK1A 1VKOA 1L1FA 1SB9A 1TKBA 5B58T 2DWPA 1WCYA 1K9VF 4JROA 4MS4A 4RSHA 4X7PA 2X8JB 3OM8A 2BFNA 1T1RA 3AG5A 1PR6A 3WK8A 4ASUD 4QJIA 3BFKA 3O2NA 4B2PA 3ZQKA 1KRXA 1BHJA 4OSOA 2P3QA 2QEQA 3G5AA 1VL8A 4ROXA 4GOND 2ZL5A 4Y2SA 4B3XA 1ST3A 1X80B 3ZCTA 5MDHA 3THYB 2YJ3A 2IZ0A 4KO3S 2CKMA 3W4IA 4URWR 1YRHA 3RBZA 3EEQA 1SC9A 4AZ0B 5FTWA 3RHTA 5KNCA 1PVOA 2WJ4A 5HXBA 1GKIA 1P0QA 8AT1A 4WLUA 3EF0A 2ISSD 4N47A 4BE7B 1PLJA 1GQFA 5FX2A 1U4OA 4WHMA 1NSFA 1W46A 2VOJA 3N2LA 2HUPA 3QXGA 2WUFA 5H70A 1Y82A 5FUYA 2GK4A 3DMRA 1HDYA 3KJHA 4GRAA 2IHKA 5HZKA 2CL6X 4WXHA 2ZW9A 3B36A 4KXMA 4L22A 3VGPA 2VAMA 2RG1A 4PPFA 3GFOA 2ISQA 2GEFA 3PVZA 4KIUA 3K1YA 1RPAA 3OUZA 2UUCB 3UJAA 4DLWA 4LCEA 5TT1A 3Q9LA 2GPNA 3W6OA 1QF6A 1QB7A 2H4YA 2DHRA 2UZ1B 1VSBA 2VHYA 1IYZA 1L5OA 3STYA 3O8OB 5BSRA 3C41J 1I0ZA 4QFMA 2ZTMA 4OJTA 5AVUA 2DBQA 1VFNA 1Q83A 4YALA 1BDBA 2A5JA 3ZQ4A 1EUQA 3PXBA 5EHGA 3ET4A 4P4GA 5B2EA 3I4LA 2L17A 2X6QA 3MWEB 4OIFA 4WESA 2FW9A 2SICE 5DH9A 3MTGA 3EWNA 1DEXA 1PNRA 1DJOA 3WL8A 3FJ1A 1TM7E 4ONEA 3OEWA 2ZIXA 2I2WA 1QGDA 4FLMA 1RRCA 4G36A 3OO1A 3KTAB 6REQB 1JQDA 2OP1A 1L9KA 2GK7A 5BYBA 4IO1A 1KPGA 2CXXA 4EKGA 1D6MA 1SPXA 1YNOA 1DAKA 3ESYA 5DNCA 3I5AA 2P3MA 4RD1A 1EDBA 3BIJA 3WB9A 4KR9A 4HQ0A 3I64A 2WAMA 2XVMA 1DX9A 1JFFA 2XRMA 3AEUA 4W5TA 1EK0A 3VFDA 3HBNA 2FDCA 1VE5A 2C82A 1K75A 3PFIA 1TTPB 4IZOA 1FVXA 2HF8A 5KNBA 1CVIA 3JCZA 3KYCA 3R0IA 4NP6A 5D7BA 1RKBA 4MWOA 1T5EA 1DP4A 3OEED 4G0ZA 2RGDA 2JIZA 5DBOA 2OWDA 3V1MA 2O2XA 3RADC 3F9CA 3PVSA 3IJ5A 3NHRA 4DF3A 4MB6A 4GKJB 3T9DA 1GPMA 2YMMA 3DFIA 2QBYA 1Y3CE 3D7KA 2Z9DA 3A7DA 3A6KA 3QKWA 3L4BC 5LDHA 2DFNA 2GARA 1NKSA 3OQBA 5FTNA 1VSQA 5H1YA 3R7NA 3KU4A 4UPEA 1TA0A 4GI7A 2XQKA 4RD0A 1O8CA 2WLSA 2VS1A 2VJYA 1OWOA 4L73A 1UPCA 1ZM9A 1EWTA 3IRUA 4AG6A 5FOQA 1U7TA 5JANA 3U60B 3UCEA 1QP7A 4BVFA 5TVGA 3F5DA 1UEIA 4P6YA 2QAGB 2I9KA 1N0HA 2JAOA 5IDVA 5AKEA 2OCLA 2FLWA 2R4UA 4FFMA 4NBKA 5GGXA 3RBAA 5J2UA 2J9ZB 4DFDA 4EUFA 4MS4B 2Z2ZA 1EGVB 2A9PA 3RASA 2QGZA 4JL8A 1YQGA 1V0JA 2QRPA 4RCVA 4RMNA 4DLXA 5K7SA 3B6KA 3GP8A 1EIZA 2IYLD 5JU6A 2GJSA 4C7JA 1MT0A 5KTSA 3AVXA 3D0OA 2EYQA 2HQRA 3I2KA 3WBBA 1K7XB 4ZTBA 3O8CA 2J9RA 3IQXA 4FM9A 3GRUA 2VH5R 1OA0A 4QT4A 4DRXA 3I9OA 5BW8A 1ZWKA 3EQ2A 3HYSA 1Z6TA 1I9CA 3U3RA 4ZMBA 1K8YB 5JH7A 4X3PA 1QVVA 1DRWA 3VR2D 9ATCA 4GMFA 1XKQA 1VPVA 5SICE 1NE2A 1Q6YA 2PGXA 3FWZA 5CVJA 5EXSA 3A4NA 2QY9A 4E5DA 2UUAB 4FT4A 2RGAA 3JVVA 2WOOA 2I87A 2IWRA 4AY2A 1CEYA 2R3SA 1VC2A 2JLZA 1QRDA 4U9IS 4FNAA 3GY0A 3RFXA 2AR9A 2FG7C 1BHSA 4K0KB 4MYSA 2BM8A 2O2YA 2YXPX 5LLSA 2O3UA 3TOSA 7AT1A 4YMLA 4LDQA 2JIPA 2JLQA 5AT1A 4GNKA 2GQFA 3LO8A 4OATA 2YHSA 2CL5A 3PB3A 3U37A 4EIWA 5CEEA 5EZYB 1EFCA 5JQWA 1I7SB 4X05A 3KL2A 4MIEA 2H7XA 1IN8A 2Z43A 3E3OA 4WFKA 3MCAA 1JFLA 3ABSB 3DOFA 4WK2B 1U1CA 2IEBA 5EZYF 4YP6A 1TC2A 3R0JA 3MJVA 1NXTA 3C14C 3SIXA 2KWIA 2NVUA 3T5MA 4HXFB 4P1ZA 2PM8A 4PYLA 4Q05A 5HGJA 5BWLA 1U8EA 1P2GA 2VIIA 1FFGA 3D8UA 4WESB 3SZGA 1M2NA 3UQYS 2NSHA 4QGGA 4BWYA 1C3VA 2VZEA 3CBGA 3Q7IA 3H5RA 3UHAA 3EIXA 3TTYA 3UUEA 5JIBA 3PR1A 1EYZA 1U1FA 4R8SA 3O8LA 2GXAA 1ZITA 5FH9A 5HOQA 1DFHA 3H18A 4ZXFA 1XYGA 3RRFA 1Z0AA 2NV4A 4FS8A 4UBLA 4CDMA 5CITA 4MV1A 4DMHA 3IO3A 3ZV7A 1YOVA 2GEVA 2G6BA 4A0RA 3H8VA 1HG1A 2L42A 1B3BA 2ZYIA 1JFFB 2Q28A 1ILEA 3DBOB 4UHHA 3UMFA 5FI3A 1M6HA 3V8QA 1AT1A 3URKA 2EL9A 3A6ZA 3RO7A 2QX9A 2YJ4A 5MGBA 4FMCB 1OLXA 1XZDA 2P9QA 2FUEA 2WM8A 3HGTA 2ZU0C 4NOLA 2R96A 4R1MA 3EZ6A 1K0UA 4FMCF 4NH0A 4AJLA 4Y6QA 3SWWA 4QXAA 1FEZA 1UD5A 3NRCA 1XMXA 3Q98A 4HHEA 3JVUA 3KQPA 5EIXA 3IA2A 5TQ2B 4ZYXA 5ENVA 4B4OA 4E7PA 3FPFA 2DX7A 1AO0A 2MYPA 5KJFA 2IUYA 4EL0A 1E2UA 4NCXA 1L5VA 3K6SA 4B8WA 4CIAA 3ZXYA 4QT0A 2PSHA 4I7EA 5FWYA 4QO8A 3SBEA 3A26A 3HB9A 5ALVA 1ND5A 3DD1A 1BWQA 5J2UB 3I05A 4RDKA 3KALA 1T2CA 1KI7A 2BE9A 3FPJA 2BM9A 1A7UA 2ZSHA 3HCAA 4TYMA 3CH7A 1XMQB 2W0MA 3CUWA 4L28A 3ZUGA 4G0WA 2NYVA 4X7CA 4YBZA 3Q0EA 3WGVA 1ZG3A 5C81A 4D8UA 5FAKA 4DB4A 1J8MF 1I0IA 3AR4A 2ZJ7A 1XMIA 2JCGA 4O0LA 3WHLA 3GUVA 4Z1MA 3GRZA 1U8YA 4XEHA 1SIOA 3L7KA 1HLDA 3BD7A 1C30A 2ODEA 2YFHA 4N48A 4A4DA 2YZMA 1E9CA 1QHEA 1N06A 1HKHA 2X0FA 1E9EA 2XKJE 3WWDA 3K8QA 4FFWA 1NWCA 2NU6A 1RHKA 1IQ0A 1D6NA 1RP7A 2Y9PB 3MCZA 2W6CX 3O4IA 3R40A 3SU8A 2AFIE 1V39A 4B5LA 1MORA 2PH7A 2O8DA 5JH7F 3G6EB 2CBGA 3ZBUA 2GETA 3EEIA 3IDAA 3FLEA 1MIOA 2N1MA 1YASA 1S3IA 4X84A 3M6FA 1OXMA 2V8BA 5CHYA 4FHFA 2ZYVX 3RGGA 5KS2A 3VKVA 3DAFA 3R2JA 2QQFA 2IEYA 2PANA 1IZ8A 1BHO1 3TWOA 4KNWA 3KKKA 4ALIA 2BHSA 4IVQA 4D0RA 1KDYA 4AT1A 1EESA 4YWJA 1FLVA 2YNMD 1O94C 1J42A 1QZUA 1DVRA 4Q66C 2OXTA 4AP6A 3IP5A 3RRMA 3V9PA 4DXAA 5BWCA 2X58A 3HRHA 5LD2C 4Q19A 4WZEA 2UUPA 4UUBA 3SYLA 1A96A 1D6SA 1GPKA 3ASQA 2AEJA 3KOOA 4LHXA 4PN3A 2M5SA 1QMPA 4D3ZA 5B6JA 1GHTA 5KVCA 4EYSA 3TRDA 3OTGA 2ZWOA 3BJRA 2NVUB 5GY7A 3T3PB 3EG5A 3AH8A 3NG1A 4KN9S 4YONB 1TZJA 4BMOB 4F8JA 3NYQA 3TIIA 3KTDA 4M89A 3CRNA 3WK6A 5TR9A 2JGDB 4RQAA 2WU4A 2D1TA 4K9RA 4G84A 3H3FA 4KC0A 3DEKA 2A1UA 2QUBA 1JHDA 3KAPA 4N7MA 4XCQA 5JASA 3ILSA 4Y2HA 2W2VA 3UB2A 3KUCA 4YMTA 4R2LA 4RY9A 3BBPA 1Y6GA 3IUEA 4M8IA 4BO5A 4JC5A 4DR1B 1YB4A 1MUUA 2BCEA 3TMYA 2X8KA 3KQHA 5ADVA 4Y2RA 1COWA 1PJCA 3E03A 1E94E 4WNCA 3WL7A 1Z5VA 4I1VA 4P4NA 3TO5A 2X8BA 4GAEA 4EPTA 2D7CA 4RU1A 2EBFX 2GKSA 1G0OA 1FJGB 1T4CB 3FYUB 2JGRA 2OAGA 2G04A 2D1SA 2XB9A 3DKPA 3O3OB 5EMNA 1NXSA 3EZXA 4YMVA 3TIFA 1JR4A 5IF9A 4B87A 1N75A 2IDJA 2OEPA 5AJUA 1XEFA 2AOVA 3GRAA 1NW5A 3F71A 1H1LA 3GGPA 4FSDA 2AOTB 5SYMA 4A0GA 3HJAA 2AKYA 4ED9A 2JHCA 4DDWA 1PSWA 4BQPA 5B7PA 4D8WA 2XYRA 4P7FA 4MR7B 2Y0DA 4YV2A 1KSFX 4GLOA 1BWRA 3S68A 2HHAA 2B3TA 4BV3A 3KT8A 4BUJA 2XCSB 3E9CA 1OXTA 2GPWA 4OAPA 5DLDA 1Y7LA 2KVOA 2HCTA 1TUGA 4B4VA 3UYLA 3TGPA 4HFNA 5DNUA 4JDUA 1QHHA 3CSUA 2CLOB 3EZ2A 2Q3CA 3HR7A 3P9XA 3PIRA 5IJ9A 2VNIA 1EFPB 2BHTA 1Z25A 2XYQA 3HNRA 4WY8A 2YZ2A 2R8RA 3U26A 3ZIAD 4I5EA 1DLIA 4K6FA 3TDNA 1JQAA 1T9GS 3RC9A 3IERA 1V4NA 5FWYB 1NC1A 3QHPA 1Z75A 1NUSA 2QS9A 3TAUA 3CUTA 5HQ3B 5ADWA 2OBLA 1SOMA 1ESMA 2GD2A 3RSHA 4M0FA 5DIFA 3WR5A 3RK4A 5IXYA 4TL7A 1X6VA 3OOHA 3H0CA 4COKA 3ACDA 2EFYA 2PS1A 1NYTA 3GG2A 4MVJM 5DV9A 3NP9A 4Q7EA 4OUKX 2DYIA 1PL0A 1GG5A 3V4RA 1EXWA 3PUWA 3JPYA 5I5GA 4IRMA 2LZ0A 1X74A 2XDQB 3HG7A 3EVNA 1UP7A 3LY9A 4BRZA 4JJEA 4DMLA 1XDWA 3S55A 3ZQJA 5L3SA 4U39A 2IYFA 4Z54A 1TADA 3P9PA 3HL4A 4MJ7A 3ETJA 2JGMA 1OH5A 1NMQA 4WIAA 4ENTA 2NU6B 3QOYA 3SFTA 5IUNC 4CM9A 5E7QA 3DFMA 2PGAA 2DF8A 2HX1A 3GAFA 4FFOA 1XA3A 2BFAA 1JX6A 4HQ6A 3Q8XB 1QFZA 5ALGA 3F98A 4CM6A 1EJBA 4EI9A 3LT5A 4DMUB 2O8DB 1M10A 1JDPA 1MIOB 3GV0A 4UBMA 5AI8A 1E8DA 3LT2A 2FEMA 3OOYA 2FQ1A 2WSMA 4O4HB 4IKOA 2GPAA 4J75A 5HE8A 4EMUA 1DEKA 1LK5A 2ZYAA 4O4HF 4PZCA 4KQ1A 1K4MA 3X43A 2I4TA 5DJ5A 1QFJA 3L18A 2IPMA 1I8TA 1CW2B 2G63A 2ZUCA 3D8HA 3ZV6A 4ZFNA 5IT9A 2R2GA 4YAIA 2YXNA 5JH7B 3WLRA 2GEJA 1LPNA 1NMZA 2ZSKA 3PHGA 3C15C 3H11A 4OGFA 2V4ZA 3FOBA 3S8MA 3ZY6A 2ZM5A 2Y67A 1UINA 3KAQA 4MEBA 1RI4A 2MSCB 5FLKA 3P52A 2FSSA 4CXMA 4ZVVA 2I76A 4RHUA 2PAFA 2EGHA 2OGWA 3GT3A 1HT3A 4N1AA 3NH6A 4G0PA 3AO0B 4X0CA 1QIGA 2AFIA 3K3PA 4HQOA 4KXQA 4DSOA 5CDFE 5L4NA 1NUPA 1XNQB 4AD8A 4UCWA 3PICA 5J58A 2JPDA 3GSIA 1G3MA 2VK2A 4ZYWA 3WA7A 2I6SA 5HSGA 4IFBA 1LBSA 3ZLVA 1R4MA 5CBPA 1LX7A 3Q3IA 1Y4UA 2Q5CA 2JI6A 4L8WB 1QFSA 3BL6A 3WTBA 2BPOA 5A62A 4LW8A 4B4KA 1YI2B 2PK3A 4BO9A 2JI7A 3N05A 3VNQA 3EXAA 5KW9A 2ONCA 3E2IA 5K8TA 2GZ3A 2PSSA 1J39A 2YASA 3JU3A 1CR0A 2QD5A 4PEVA 3LRTA 3MCTA 3QFRA 3P2MA 4ZO9A 2JFVA 4JH0A 4BCDA 4C4ZA 4EY6A 1H1LB 4J8PA 3VNAA 2IEZA 2IYWA 5EMJA 4IJ5A 2FQWA 3VJKA 4MQBA 3QTTA 1Z16A 1CBUA 3UH1A 2DB3A 2V7WA 1U3UA 2PT9A 3TS1A 3HB7A 1JPNA 1QZZA 3NLLA 4RXMA 1W0KA 5D5QA 4BZWA 4PX3A 2GZSA 1A8QA 2YXDA 1TU3A 3GJZA 1C3EA 4PU0A 1FMJA 1FYVA 3PR3A 1NOKA 3SEAA 4A0SA 3J7AC 2A4KA 4BX8A 4XYLA 5IJ9B 5I7SA 4AIRA 2VQ6A 2QY6A 2BTOA 4R1TA 3QE2A 4WWVA 5G4KA 4EG1A 5KYWA 1KI4A 1QRAA 4UASA 3RU7A 5JI2E 5LBIA 1PO7A 5AJTA 1ADCA 1CUDA 2HA5A 4QXPA 4YRJA 4R8RA 1SXJB 2ATXA 2V7TA 2Z1DA 3JU4A 4KX5A 5LC1A 5M3BA 2O8NA 2J0SA 2IEAA 3BRWD 3MAJA 3TW4A 4OHFA 1FTSA 2BBWA 3L4SO 4HG2A 4WKOA 5FNVA 3WKCA 3T38A 2HSEA 2O4UX 1KKUA 4DJEC 4HBZA 3WNZA 4X0EA 4BLOA 4Z4EA 1F0PA 5BSUA 4XX1A 4OLAA 3DMGA 1BD4A 4ZV7A 3UAVA 4ZCIA 1W0CA 4DC1A 2ZWPA 2GDJA 3LF1A 1QV9A 1XK7A 2W0SA 4LHWA 3GC6A 2JLAA 1N77A 2QDKA 2VG8A 4TTJA 1NVVQ 2ONKA 5ICCA 3CPSA 2TS1A 2JFPA 4WXYB 1KE1A 3AUUA 3HJGA 4RO0A 3A3OA 4BBAA 5HM8A 3QU9A 4E51A 2E4ZA 4RTMA 2EKQA 2WZQA 2IVZA 4KL8S 2ZAYA 3TFWA 4F46A 3LLSA 1AB5A 6AT1A 3TLGA 1DMRA 2F1RA 1E3JA 3A8TA 4QX6A 4YQEA 1AHIA 4Q5IA 1T9ZA 2QMUA 1RQXA 3D2AA 3MGGA 4G1VA 1AK1A 3QLUA 5AXBA 1Z4PX 4FBGA 4BTVA 3LC1O 3TNFA 1CJCA 1Q16A 2FWPA 2H51A 3N8HA 1EWRA 5IK2A 4C43A 4KODA 1GUYA 2J45A 5KINB 1JQ5A 4I9GA 3FVRA 2D3NA 4OGWA 2XCQA 4OX9B 5BNZA 4IJMA 3TRFA 5DNWA 4II3A 3P0JA 2P9TA 2MTBA 2X9QA 3GK3A 2CE7A 3GZ4A 2IU0A 2FEXA 5BVHB 1P4RA 2B9VA 1DBPA 4RV4A 3GPLA 3B1JA 3RVPA 2F3SA 1ORHA 3G2QA 1E99A 1SHUX 1AG9A 4Q01A 5DHTA 5LNK6 4ZVQA 4YI3A 4IJVA 4KTVE 4BTLA 4D80A 5TV2A 3V4PB 3WFJA 3KSRA 1N9GA 3NONA 3B6ZA 5EHXA 3LNNA 1KO8A 3OKAA 1TMOA 4AIIA 3SF8A 1I2DA 5J43A 4B34A 4E4RA 2AFIB 4EFDA 4PZ0A 2VBGA 1EBBA 3NJ4A 2GDZA 1FRZA 5TRDA 1ZJYA 2E18A 4NQRA 4PO3X 1RBMA 4RYLA 2QG6A 3GUHA 3RS5A 4ENVA 3I52A 3AEKB 4NCHA 4Q7JB 1IRXA 1Z0FA 5EIFA 3EXG1 2QE6A 4BO0A 1L0BA 4MS1B 4H7KA 3S7ZA 3VNRA 4L6AA 1R4MB 5CBPB 3S2EA 2H1FA 3CN9A 3LGXA 4WN9A 3P94A 5G41A 3WGTA 4CLHA 5DYTA 4TYWA 4OQXA 4CIWA 1GTVA 2V6JA 3UJ3X 4NU8X 4M36A 1X7YB 3QVKA 3U4GA 3RSFA 2WF6A 3IXLA 3RVJA 1T4MA 2PSDA 4AK9A 4XWOA 1TDJA 3PQ5A 1XB2A 1FYDA 3FF1A 1YE3A 2GASA 4ARZA 2CF6A 1T1EA 3CZRA 3A1PA 2GWHA 2HLPA 2Z8XA 3DNFA 3ESRA 4LJKA 5JSKA 3VBCA 1SO8A 2UXDB 3IP8A 4ND4A 1VQ6B 5CNIA 5CXSA 3D2LA 4CUJA 3W2GA 2C95A 3FWHA 3U31A 4KFSA 1L4EA 5HUHA 3BHJA 2EJCA 3FCAA 5DF1A 1L7QA 2YHAA 4FVTA 3KTFA 5CTJA 4WK4B 4WXPA 4BVEA 3HABA 4F38A 3HR8A 1RS0A 3MA0A 3A1CA 5CDFA 1XL0A 2OC4A 4IWNA 5JEEA 4JIMA 1E9SA 1KI8A 3TNJA 1BYIA 4FLEA 1CF4A 2OHGA 1DQYA 3DTVA 4DIBA 2XQGA 2COUA 3QPDA 3A6GA 1UBHS 3L6EA 4FDMA 2ONYA 5J3OA 1J25A 4R2JA 4L7QA 4JSRA 3N0RA 5GM1A 1MRSA 3OPOA 4CLOB 4F4UA 4GUAA 2C29D 2G4LA 4P33A 3HBLA 3FF4A 3EXFA 2DGDA 4YMWA 3SN6A 4CV3A 5BXQC 5EJ7A 5LYJF 2OY0A 5EGNA 1UBGA 3FKSA 2XVZA 3EGVA 1IEVA 2V3WA 3NC0C 4FYYA 1PU2A 1FVHA 2ZYUX 3MTQA 1JIQA 1YULA 1WXIA 4PS1A 4TLBA 1DCTA 2OYRA 2WP8J 4BB6A 1LI5A 3HN7A 1OT5A 1KWGA 1YCDA 3ZHRA 2QL6A 1MB3A 3MMPA 1M2EA 2V54A 3LSYA 4FOSA 4M9QA 4N3BA 4JMPA 1PFWA 1W5EA 4CLEA 5SZHB 5AXDA 4MGIR 2X5KO 4RTOA 3FPGA 4YCNA 4MQFB 1QH8B 1J1ZA 1VRVA 2B8JA 4ZK6A 3GIWA 3NBMA 4EUHA 2PCJA 3RYTC 3RK0A 1XCBA 4BLSA 1T2UA 4C14A 5JSUA 2QLJA 4HVCA 1I2AA 2MSDB 3DE4X 3RAFC 5EL0A 5JAOA 4J2HA 4BBZA 5LP1A 3N86A 4AURA 3IPAA 2WIBA 2PPVA 2YW2A 4HO1X 3CCSB 1BCRA 1LTHR 3O4VA 2XDAA 1YQQA 3I8OA 3MTAA 1PNOA 4WBSA 3ZLJA 1KARA 4A6PA 2JS7A 2JIMA 5LXTA 3ASUA 1LW7A 1VKNA 2GNOA 3ETDA 3OPVA 5CUQA 3OFJA 4OPVA 4Y0NA 1LDMA 5H80A 2C92A 4R1NA 3R3XA 1S4MA 4MQEB 3UKOA 1SBYA 2RAFA 4HNQA 4FWTA 3NDBB 1J0XO 4XORA 2FEPA 4MGEA 2OSBA 4P6VF 2I7CA 3GT0A 4KFUA 4DUYB 1GDDA 1QIDA 1N9GB 4W9RA 5ALKA 1P1RA 2GN6A 2YDXA 3B1VA 5JD4A 1BWSA 3G3EA 3SF8B 5JT1A 4TWZA 5E9JA 1IBCA 4YJ3A 4JYMA 2JLWA 1HRDA 5DTRA 4KGXA 1SVIA 4MYUA 3G88A 5IAKA 3WV4A 2ZI5A 5B3JC 2XGMA 1JHUA 3V8PA 1TKAA 3GLRA 4W5HA 4MRNA 3RODA 2NT3A 1EDDA 4MIKA 2VNSA 2VVTA 4YTEA 4AJEA 2X7HA 1FMLA 1B00A 1JZSA 1N2XA 3AIMA 4HGPA 4ZEVA 3QW2A 1O94A 3AR8A 2J3MA 1EFRA 3Q1LA 3IP7A 2Z1MA 1TPYA 5JCXA 2W6QA 1SBNE 3KL9A 2WPNA 4F6LA 4RTNA 2CWDA 4HDOB 3OM1A 1DUIA 1OZ0A 3ZYZA 3OHSX 2PJRA 3DVAB 3NIWA 4HUTA 5F1YA 3ZH2A 2XMCA 1ZWLA 2IBMA 1XZMA 3HN2A 4TKMA 2DTXA 3VH4A 4EY5A 1MC1A 3BXPA 4PHHA 5AKXA 4CF5A 1IBKB 1QMGA 3NBZC 3FSJX 4OMDA 2YQZA 4UVGA 4KPFC 3BQJA 4COOA 1I01A 1XXHE 2ZSFA 2RH9B 4QHSA 5JS8A 2C5LA 4BVGA 4YCSA 2COKA 4FUTA 3OTWA 3H5TA 2WJVA 4AZ3A 1E64A 4C6RA 1YS1X 4N6GA 3T3GA 1QPBA 1D07A 4Q9JA 2J0EA 3TQHA 5DX1A 4B45A 4EJ6A 1JJAA 1UFRA 4L07A 4O2AA 4DHEA 3PEFA 3U4HA 3WGIA 5JZBA 3PUVA 3K4PA 1HE8B 2VRNA 4DW8A 4E1AA 4PG7A 4UM5A 4P34A 3NTOA 4JXZA 4PZPA 3OQHA 1P2SA 5P21A 4V1CI 5EP3A 4HNTA 1R0SA 3D6UA 2C5SA 3EPPA 3P2JA 3ST7A 4A0QA 1IBMB 2C0PA 1OGYA 3JRXA 3PUHA 4ICIA 1VOTA 4NU6A 4ZOCA 3KL4A 4B7UA 2BF7A 2R25B 1QO0D 1VE3A 3S6JA 5C8ZA 3BWVA 1ZRMA 2E21A 3RBVA 2ACKA 4A2CA 1DC8A 3VSEA 5DE3A 1HNXB 3Q0TA 4UTRA 5F9HA 5AFSA 5BSWA 3IR6A 4J49A 1V5IA 3MJTA 4EI7A 1MEJA 1NF9A 1T6BY 1IUNA 1WOMA 4RM0A 1DG3A 3JWGA 4MPTA 3A1SA 4Y2YA 5CX4A 3G13A 3NAGA 3K1ZA 3HGQA 3S2YA 2BD0A 1L5MA 4QQNA 1HZEA 2OBXA 1WB6A 1F4VA 3E1SA 4QE3A 3GX1A 4CTJA 4RZXA 1J0EA 1UXGA 4KO4S 4LXGA 4U7GA 4UFOA 2VTBA 5CAEA 4Q9LA 4M60A 1S7CA 4KRYA 3K0FA 3ID6C 3IEPA 1KO4A 4Q9HA 7ADHA 3A3GA 1HDEA 1Z2EA 4R05A 1R2QA 3ROQA 1A8UA 3TLMA 4EATA 1PV2A 2DUJA 2G4VA 2WMOB 2BZGA 4AY3A 1HA3A 3JYLA 4CMKA 4Z4QA 2O0KA 1FUKA 3H6HA 4OK3A 4MYTA 1XG5A 1LQ2A 5CW2A 4H3VA 1M90D 5EC8A 2OTJB 2BMAA 1FMCA 3U7IA 1PL6A 1LDYA 3IDZA 4L02A 1WM1A 1O4VA 4CN8A 2AJ8A 2ZXIA 4RSMA 2V59A 3HKBA 3LF2A 2J9FA 4IJ6A 4BMCA 4FEEA 4EVRA 3RS2A 1JS1X 1XLWA 4OY3A 3WOHA 1FTWA 4KRFA 5AW4A 3DLBA 4AKGA 1I18A 2QPAA 3EC2A 1IY2A 1YK0A 1XCLA 1W85A 2IYNA 2NU9A 3OX4A 3DJFA 3QTLA 4HN4B 4RIHA 4Z7NB 1V48A 5TX7A 3VHRA 4Q3LA 1TYAE 4MH0R 1C4WA 2PSJA 4Y9DA 5J35A 3CCBA 1CHDA 4B5KA 4YJ3B 5KX5A 2H5IA 4X1YA 1WL8A 2C1EA 5HDQA 1DJQA 3SLDA 1N5LA 3EFBA 3DYIA 3F5SA 2IBSA 5E9AA 1U7PA 4QELA 5DK6A 1FXWA 1FFHA 4ETNA 3NNSA 4TTAA 2FPXA 2RHJA 2WK1A 1PVDA 1JPJA 1U31A 1UF9A 3K70C 1T6XA 2TYSB 3I5YA 3V4LA 2OG1A 3P9RA 2Z1NA 2CJPA 1B6SA 3SIRA 2WKRA 4UBJA 2WYIA 3F7OA 3WJ1A 4IXNA 1Q44A 2Z83A 2CRVA 4JBXA 4KPUA 1QU3A 2GN4A 4XIJA 1YC5A 4DCCA 5BYAA 3A2LA 3A8IA 1DU4A 4Q48A 3LLCA 3AW8A 2ZI9A 4MITA 4FFSA 4ZXPA 2AI3A 2VPPA 4X9XA 1AMOA 2D5LA 1R9NA 1EUCA 1PD1A 3G2NA 2IS1A 3KSUA 1F2TA 1ZSYA 4NZNA 5KVQA 4XWWA 1Y0RA 1KEZA 5ECYA 5JTUA