5A89A

Crystal structure of the riboflavin kinase module of fad synthetase from corynebacterium ammoniagenes in complex with fmn and adp(p 21 21 21)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
HFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into the Synthesis of Fmn in Prokaryotic Organisms.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
total genus 37
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5a89A00
1NB0A 2I1LA 2VBUA 1P4MA 2X0KA 5FNZA 1MRZA 1NB9A 4UZEA 1T6XA 1Q9SA 5TRDA 5A8AA 1N05A 3ZUGA 2P3MA 5FO0A 3CTAA 3OP1A 4UZFA 5FO1A 2VBSA 5A88A 3BNWA 2VBVA 1N06A 1N07A 2OYNA 1T6YA 1S4MA 5A89A 1T6ZA 2VBTA 1N08A
chains in the Genus database with same CATH superfamily
1PJ5A 1QGAA 4Z4YA 2VBUA 4RM0A 3ASPA 4AVZA 3BY2A 1EFCA 1QUEA 1V0FA 1V0EA 2VNJA 4G6IA 4OPVA 1VLYA 1UMKA 4FWTA 1VQ6B 4RD2A 3WXMA 2P3MA 2BM0A 4TKOB 4UAJA 2V31A 4E0FA 5EMNA 1QGZA 3AGQA 3A8JA 3ZZUA 2XEXA 3D26A 4P3IA 4XLFA 4ZCIA 5E6TA 2WJVA 2EIXA 2QMUA 2V7TA 4ASUA 1QFZA 4G1VA 3VNVA 3T53B 1R5OA 1Y0YA 4Z1MA 2ZBVA 5IK2A 1OB2A 2WR8A 1JA1A 1SKQA 2R9VA 2OK8A 4ROXA 4L8JA 2NPFA 1XE1A 4ZGQB 2XNJA 3LNNA 1UD3A 1W0JA 1UD2A 3V7AA 4FXUA 3CW2A 4XLHA 4UZFA 1VHOA 2GJKA 5HKKA 5IYPA 3CMAB 4WWVA 1I18A 2QE7A 4X05A 1KK1A 1F60A 4NNJA 2DERA 1WSVA 2PIAA 3QFSA 3VNUA 4P6YA 1QH0A 4UZUA 4RJLA 1T5EA 3ASSA 3AVVA 4ZCMA 3V76A 2J7KA 1KJZA 4B3FX 3CCQB 5BSXA 1BX0A 4GQNA 3CPXA 1E64A 1SM4A 2DOGA 2YWHA 2VYQA 3VO1A 1Q9SA 2M5SA 2ZL6A 5TRDA 1MABA 2X85A 4P1VA 4DQKA 4XN0A 1E62A 1I7PA 3Q38A 4Z4WA 4LBWA 1HVXA 4MYTA 3CTAA 2HLDA 4WZLA 3CCSB 1NBMA 1JB9A 3ZZTA 1E79A 4NCNA 1YI2B 1TTTA 5A88A 3GVJA 2WYRA 3BNWA 3U6BA 3BY1A 2E1RA 2C4UA 1XFOA 1KK3A 4KKSA 1GR1A 3OFNA 4Z4TA 3FKSA 3WBJA 3VR6A 4QUZA 4XONA 3FJOA 3W2HA 1OB5A 3JQPA 4FK8A 4RD0A 4ACBA 2Z6BD 1RQRA 5F4MA 4ACAA 4TT3A 3WNCA 1UD5A 5A8AA 3WNBA 3CCJB 2CNDA 4OOSA 1G7RA 1QVGB 2X8KA 1EXMA 3DDYA 5KSWB 3MHPA 4WZKA 2ZZGA 3CMMA 2W6IA 4XD7A 1OHHA 3OEHA 4G7XA 1WORA 1IJFA 3U6KA 3A1PA 2BSAA 2LZJA 2PE3A 1N06A 4XOPA 4YAWA 4Y9UA 3LVBA 4P22A 3WQZA 3W5UA 1FDRA 2VBTA 4PAAA 2I1LA 2NV4A 1KQSB 1E3ZA 1CNEA 4HIZA 4OOVA 2QEXB 3AVXA 3OKXA 4RDJA 1BLIA 2WZPP 2C5BA 3W2EA 3OJXA 1K73D 1H8EA 4NBSA 4RCZA 1SKYB 1HA3A 5FO0A 1FNMA 2CRVA 1FX0A 4X7EA 1IHMA 2RC6A 1Q7YD 2DIEA 2XNCA 3GSIA 2VBSA 4RPDA 2X6WA 4XLAA 3CCVB 5GV8A 3GVLA 3B8HA 4EH1A 4C0SA 2JDIA 4DQLA 3GIRA 2BGIA 5CDFA 2D3LA 3W2FA 4YEJA 1VJSA 2GPJA 2ZZFA 3CP8A 1N8RD 3ASRA 2D3NA 2BM1A 3RY8A 1VF7A 4LBVA 3WY9A 1BX1A 3A8IA 1MRZA 4X7FA 4Z4UA 1YJ9B 3ONUA 1YIJB 1YHQB 2XGJA 1VQ7B 4OPOA 3OEEA 2DYIA 1RQPA 3NE5B 3CP2A 4P26A 3CD6B 1Q81D 1YITB 1I8DA 3CPWB 1G7SA 3LO8A 4TMZA 5DS0A 1QVFB 2B5OA 2OK7A 5FA6A 2ZL5A 1WDTA 4J0QA 4PC7A 3BH4A 5J35A 5IYQA 1OB0A 5THXA 1EP1B 1N07A 1DARA 2HDNB 3W2GA 2FVGA 1E3XA 2QGGA 2ZITA 4LC0A 2OTLB 3OZVA 4II3A 4XM3A 3W5HA 3JQQA 1FNCA 4FN5A 4OOXA 1P4MA 2F1LA 3VMFA 1IJEA 3PUNA 1UD6A 1VQ8B 2BVNA 4ZV4A 1UD4A 1FRNA 1AIPA 1TVCA 4RD4A 1U2RA 4B47A 4PC1A 2F1MA 4QVAA 4XORA 5F4OA 1FRQA 2E1BA 3OPOA 2GK6A 1D8TA 4Z4SA 4K1XA 1G7TA 1KRHA 2V7WA 2QTLA 4Z4ZA 1FNDA 2BV3A 3ISXA 2Q6LA 1GJRA 3SLNA 2HMAA 4PC3A 1OGJA 2GQFA 3SJPA 3PA2A 1DDIA 4RD6A 1QFJA 4Z4RA 3ZBUA 4XL9A 2BF4A 4F7DA 1BPLA 1GAQA 3LQEA 2JJ1A 4HE6A 3B78A 1VQ4B 1E43A 4YXWA 3OAAA 3CCLB 1KMHA 2VJJA 4RDKA 3CC7B 3OW7A 5B6IA 3MMPA 1WU8A 2XZLA 3H9NA 1TUIA 3Q6RA 3CC2B 4TN1A 1DDGA 2V4DA 2X6YA 1E1QA 1VHEA 4H9GA 4TMXA 4P9SA 3AVWA 2ZXHA 5HZBA 3PENA 2V7XA 4P3YA 4B3XA 1YLOA 2DY1A 1D2EA 1NB0A 1BJKA 2CBXA 4TMTA 4R71A 4OP7A 4LBYA 3CCUB 1FNBA 3U2QA 1H42A 1N05A 3ZUGA 1A8PA 4MYUA 3OW2B 2XZPA 2ZZQA 5AN9A 3W5VA 3A35A 4X0CA 2FX3A 3W2IA 1W87A 1KTVA 1M90D 3Q39A 3QFRA 3WBKA 5DSZA 5J3OA 1W2BB 1WTHD 1ZM9A 5L46A 2R6HA 1WPCA 4P2NA 4P12A 2PLFA 2OYNA 4QVJA 4XQFA 2ZTGA 1M1KD 4Q7JB 3SEJA 1YX2A 4XNFA 3R6KA 4PC2A 4C43A 1E63A 5TV2A 1T6XA 4WZEA 1PJ7A 1N0UA 3GVKA 1KK0A 4WZTA 4M2LA 4AC9A 1R5BA 2QA4B 5FO1A 3SKBA 3I55B 1KK2A 3ES9A 3OJWA 2ZZEA 3CCMB 3PUMA 4TMWA 4X06A 2C77A 3CESA 2C78A 4PC6A 4XN3A 2X6XA 2XZOA 3SLDA 3CCEB 3CC4B 4QV2A 2VJIA 1CNFA 3FPKA 1YJNB 2OBSA 2YWFA 3ASTA 3CRZA 1BMFA 3WYAA 4ZGNB 4CQJA 1EP3B 3P27A 4M1KA 3BCDA 1W35A 2OTJB 1EFRA 1ZUNB 2BMWA 3PVDA 2VNIA 1ZM3A 2F43A 4YAUA 3KEWA 1QG0A 1GVHA 4P6VF 1B2RA 4B4DA 3AVUA 1H85A 3I56B 2WSSA 3BQJA 1KD1D 2VBVA 1S72B 5TR9A 1KC8D 4B44A 1EFUA 4B3GA 3ZIAA 4DK0A 4G7WA 3WNDA 2XNDA 3OE7A 5HXBA 1NRKA 4X7CA 3QSYA 1H8HA 4X7DA 1F20A 1W9XA 2WZNA 4YELA 1PKVA 1WOSA 4TSFA 1QFYA 2YWGA 4DK1A 3B82A 5KW9A 3CMEB 2DCUA 3ASQA 2V7VA 1VQKB 5GV7A 3QFTA 3ZC3A 5H59A 4AF6A 1WP6A 3AVTA 2QN6A 4XOTA 4U9UA 1VQ9B 2JN9A 1VQ5B 3JQRA 3AGPA 4BPRA 1WOPA 2BN4A 3QE2A 4KKTA 4II2A 3AVYA 3CB4A 5JBQA 1Q82D 3QFCA 2DEUA 1VQMB 4X8IA 4IW3B 1NB9A 5HZAA 3OOCA 2CW5A 3FPPA 4QHYA 5H5JA 1XQBA 2ZBUA 2BPOA 2XOKA 2B7BA 2EFGA 5DN6A 5FIUA 1DG1G 3E20A 3G05A 2DETA 2BGJA 2ZXIA 5BSYA 4AF7A 2HCJB 4LBZA 1VLOA 4PABA 1K28D 4YHBA 1WOOA 4RCYA 1WSRA 3PA1A 1QGYA 2Q6OA 4HE5A 1S0UA 1B23P 2CK3A 3Q6QA 2V7UA 3R6JA 2OBTA 2ZTNA 1ZM4A 3SJZA 1NJID 4B48A 4XLCA 4KKUA 5FL7A 2B7CA 5IYRA 3KL9A 2JJ2A 1BQEA 3I1FA 3J81k 3G6EB 3CCRB 2RC5A 4P25A 5TY0A 1YJWB 1N0VC 1CQXA 1UD8A 2QDXA 3OZWA 3ZZ0A 1JNYA 1TLLA 2CC2A 4XKVA 5KNLA 1R5NA 2WPDA 4X07A 3OZUA 4RDLA 1OGIA 4M4SA 4XLEA 1IB0A 3OP1A 1VQPB 4PGOA 3CXCB 2JIZA 2OBRA 2GJRA 4DNRB 3G71B 4ZCLA 1GO2A 2D74A 1QX4A 4QFMA 4N3NA 4Y7CA 1Q86D 3MCAA 5LMZA 1NDHA 1G7CA 1GAWA 2CF4A 2AHOA 5IYWA 2X0KA 2ZL7A 1W34A 4TMVA 2GJPA 4YAOA 5FNZA 2WJYA 1Y0RA 3GQBA 2PMDA 4XKWA 1KZLA 1XB2A 3E1YE 3HAGA 4WQMA 3G4SB 1JJ2B 2V7QA 4YAFA 3Q3AA 3A3BA 1W0KA 1EP2B 1EFTA 1K9MD 4RPBA 2X53S 1VQOB 1VQNB 4DNTB 3A8KA 4RD1A 1J9ZA 3T51B 4M0LA 3T56B 2C2WA 1PJ6A 4Y9RA 2Q6KA 4OPSA 2VNHA 1T6YA 2QTZA 4N3GA 3BCFA 3LQ6A 1E1RA 2C4TA 1ELOA 2X3UA 4XR6A 1D1NA 1EWYA 3A3GA 4G5GA 4UZEA 3JU4A 4G1BA 2YWEA 1VQLB 2VZLA 3VO2A 2D9RA 1HZEA 5IYNA 1V5VA 4Z4VA 4XMYA 1JA0A 4RD3A 2Q6IA 4M53A 3ZBTA 1K8AD 1AMOA 4RLZA 4B43A 2W6JA 1ZM2A 3H94A 2KVOA 1COWA 2GK7A 3ONYA 1QUFA 4JMQA 4YALA 3BC9A 3ZPNA 5F4JA 1S4MA 2C5HA 1T6ZA 3P26A 5A89A 2VNKA 1N08A 2GREA 2F4NA
chains in the Genus database with same CATH topology
1NB0A 2I1LA 2VBUA 1P4MA 2X0KA 5FNZA 1MRZA 1NB9A 4UZEA 1T6XA 1Q9SA 5TRDA 5A8AA 1N05A 3ZUGA 2P3MA 5FO0A 3CTAA 3OP1A 4UZFA 5FO1A 2VBSA 5A88A 3BNWA 2VBVA 1N06A 1N07A 2OYNA 1T6YA 1S4MA 5A89A 1T6ZA 2VBTA 1N08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB0 A;  2I1L A;  2VBU A;  1P4M A;  2X0K A;  5FNZ A;  1MRZ A;  1NB9 A;  4UZE A;  1T6X A;  1Q9S A;  5TRD A;  5A8A A;  1N05 A;  3ZUG A;  2P3M A;  5FO0 A;  3CTA A;  3OP1 A;  4UZF A;  5FO1 A;  2VBS A;  5A88 A;  3BNW A;  2VBV A;  1N06 A;  1N07 A;  2OYN A;  1T6Y A;  1S4M A;  5A89 A;  1T6Z A;  2VBT A;  1N08 A; 
#chains in the Genus database with same CATH topology
 1PJ5 A;  1QGA A;  4Z4Y A;  2VBU A;  4RM0 A;  3ASP A;  4AVZ A;  3BY2 A;  1EFC A;  1QUE A;  1V0F A;  1V0E A;  2VNJ A;  4G6I A;  4OPV A;  1VLY A;  1UMK A;  4FWT A;  1VQ6 B;  4RD2 A;  3WXM A;  2P3M A;  2BM0 A;  4TKO B;  4UAJ A;  2V31 A;  4E0F A;  5EMN A;  1QGZ A;  3AGQ A;  3A8J A;  3ZZU A;  2XEX A;  3D26 A;  4P3I A;  4XLF A;  4ZCI A;  5E6T A;  2WJV A;  2EIX A;  2QMU A;  2V7T A;  4ASU A;  1QFZ A;  4G1V A;  3VNV A;  3T53 B;  1R5O A;  1Y0Y A;  4Z1M A;  2ZBV A;  5IK2 A;  1OB2 A;  2WR8 A;  1JA1 A;  1SKQ A;  2R9V A;  2OK8 A;  4ROX A;  4L8J A;  2NPF A;  1XE1 A;  4ZGQ B;  2XNJ A;  3LNN A;  1UD3 A;  1W0J A;  1UD2 A;  3V7A A;  4FXU A;  3CW2 A;  4XLH A;  4UZF A;  1VHO A;  2GJK A;  5HKK A;  5IYP A;  3CMA B;  4WWV A;  1I18 A;  2QE7 A;  4X05 A;  1KK1 A;  1F60 A;  4NNJ A;  2DER A;  1WSV A;  2PIA A;  3QFS A;  3VNU A;  4P6Y A;  1QH0 A;  4UZU A;  4RJL A;  1T5E A;  3ASS A;  3AVV A;  4ZCM A;  3V76 A;  2J7K A;  1KJZ A;  4B3F X;  3CCQ B;  5BSX A;  1BX0 A;  4GQN A;  3CPX A;  1E64 A;  1SM4 A;  2DOG A;  2YWH A;  2VYQ A;  3VO1 A;  1Q9S A;  2M5S A;  2ZL6 A;  5TRD A;  1MAB A;  2X85 A;  4P1V A;  4DQK A;  4XN0 A;  1E62 A;  1I7P A;  3Q38 A;  4Z4W A;  4LBW A;  1HVX A;  4MYT A;  3CTA A;  2HLD A;  4WZL A;  3CCS B;  1NBM A;  1JB9 A;  3ZZT A;  1E79 A;  4NCN A;  1YI2 B;  1TTT A;  5A88 A;  3GVJ A;  2WYR A;  3BNW A;  3U6B A;  3BY1 A;  2E1R A;  2C4U A;  1XFO A;  1KK3 A;  4KKS A;  1GR1 A;  3OFN A;  4Z4T A;  3FKS A;  3WBJ A;  3VR6 A;  4QUZ A;  4XON A;  3FJO A;  3W2H A;  1OB5 A;  3JQP A;  4FK8 A;  4RD0 A;  4ACB A;  2Z6B D;  1RQR A;  5F4M A;  4ACA A;  4TT3 A;  3WNC A;  1UD5 A;  5A8A A;  3WNB A;  3CCJ B;  2CND A;  4OOS A;  1G7R A;  1QVG B;  2X8K A;  1EXM A;  3DDY A;  5KSW B;  3MHP A;  4WZK A;  2ZZG A;  3CMM A;  2W6I A;  4XD7 A;  1OHH A;  3OEH A;  4G7X A;  1WOR A;  1IJF A;  3U6K A;  3A1P A;  2BSA A;  2LZJ A;  2PE3 A;  1N06 A;  4XOP A;  4YAW A;  4Y9U A;  3LVB A;  4P22 A;  3WQZ A;  3W5U A;  1FDR A;  2VBT A;  4PAA A;  2I1L A;  2NV4 A;  1KQS B;  1E3Z A;  1CNE A;  4HIZ A;  4OOV A;  2QEX B;  3AVX A;  3OKX A;  4RDJ A;  1BLI A;  2WZP P;  2C5B A;  3W2E A;  3OJX A;  1K73 D;  1H8E A;  4NBS A;  4RCZ A;  1SKY B;  1HA3 A;  5FO0 A;  1FNM A;  2CRV A;  1FX0 A;  4X7E A;  1IHM A;  2RC6 A;  1Q7Y D;  2DIE A;  2XNC A;  3GSI A;  2VBS A;  4RPD A;  2X6W A;  4XLA A;  3CCV B;  5GV8 A;  3GVL A;  3B8H A;  4EH1 A;  4C0S A;  2JDI A;  4DQL A;  3GIR A;  2BGI A;  5CDF A;  2D3L A;  3W2F A;  4YEJ A;  1VJS A;  2GPJ A;  2ZZF A;  3CP8 A;  1N8R D;  3ASR A;  2D3N A;  2BM1 A;  3RY8 A;  1VF7 A;  4LBV A;  3WY9 A;  1BX1 A;  3A8I A;  1MRZ A;  4X7F A;  4Z4U A;  1YJ9 B;  3ONU A;  1YIJ B;  1YHQ B;  2XGJ A;  1VQ7 B;  4OPO A;  3OEE A;  2DYI A;  1RQP A;  3NE5 B;  3CP2 A;  4P26 A;  3CD6 B;  1Q81 D;  1YIT B;  1I8D A;  3CPW B;  1G7S A;  3LO8 A;  4TMZ A;  5DS0 A;  1QVF B;  2B5O A;  2OK7 A;  5FA6 A;  2ZL5 A;  1WDT A;  4J0Q A;  4PC7 A;  3BH4 A;  5J35 A;  5IYQ A;  1OB0 A;  5THX A;  1EP1 B;  1N07 A;  1DAR A;  2HDN B;  3W2G A;  2FVG A;  1E3X A;  2QGG A;  2ZIT A;  4LC0 A;  2OTL B;  3OZV A;  4II3 A;  4XM3 A;  3W5H A;  3JQQ A;  1FNC A;  4FN5 A;  4OOX A;  1P4M A;  2F1L A;  3VMF A;  1IJE A;  3PUN A;  1UD6 A;  1VQ8 B;  2BVN A;  4ZV4 A;  1UD4 A;  1FRN A;  1AIP A;  1TVC A;  4RD4 A;  1U2R A;  4B47 A;  4PC1 A;  2F1M A;  4QVA A;  4XOR A;  5F4O A;  1FRQ A;  2E1B A;  3OPO A;  2GK6 A;  1D8T A;  4Z4S A;  4K1X A;  1G7T A;  1KRH A;  2V7W A;  2QTL A;  4Z4Z A;  1FND A;  2BV3 A;  3ISX A;  2Q6L A;  1GJR A;  3SLN A;  2HMA A;  4PC3 A;  1OGJ A;  2GQF A;  3SJP A;  3PA2 A;  1DDI A;  4RD6 A;  1QFJ A;  4Z4R A;  3ZBU A;  4XL9 A;  2BF4 A;  4F7D A;  1BPL A;  1GAQ A;  3LQE A;  2JJ1 A;  4HE6 A;  3B78 A;  1VQ4 B;  1E43 A;  4YXW A;  3OAA A;  3CCL B;  1KMH A;  2VJJ A;  4RDK A;  3CC7 B;  3OW7 A;  5B6I A;  3MMP A;  1WU8 A;  2XZL A;  3H9N A;  1TUI A;  3Q6R A;  3CC2 B;  4TN1 A;  1DDG A;  2V4D A;  2X6Y A;  1E1Q A;  1VHE A;  4H9G A;  4TMX A;  4P9S A;  3AVW A;  2ZXH A;  5HZB A;  3PEN A;  2V7X A;  4P3Y A;  4B3X A;  1YLO A;  2DY1 A;  1D2E A;  1NB0 A;  1BJK A;  2CBX A;  4TMT A;  4R71 A;  4OP7 A;  4LBY A;  3CCU B;  1FNB A;  3U2Q A;  1H42 A;  1N05 A;  3ZUG A;  1A8P A;  4MYU A;  3OW2 B;  2XZP A;  2ZZQ A;  5AN9 A;  3W5V A;  3A35 A;  4X0C A;  2FX3 A;  3W2I A;  1W87 A;  1KTV A;  1M90 D;  3Q39 A;  3QFR A;  3WBK A;  5DSZ A;  5J3O A;  1W2B B;  1WTH D;  1ZM9 A;  5L46 A;  2R6H A;  1WPC A;  4P2N A;  4P12 A;  2PLF A;  2OYN A;  4QVJ A;  4XQF A;  2ZTG A;  1M1K D;  4Q7J B;  3SEJ A;  1YX2 A;  4XNF A;  3R6K A;  4PC2 A;  4C43 A;  1E63 A;  5TV2 A;  1T6X A;  4WZE A;  1PJ7 A;  1N0U A;  3GVK A;  1KK0 A;  4WZT A;  4M2L A;  4AC9 A;  1R5B A;  2QA4 B;  5FO1 A;  3SKB A;  3I55 B;  1KK2 A;  3ES9 A;  3OJW A;  2ZZE A;  3CCM B;  3PUM A;  4TMW A;  4X06 A;  2C77 A;  3CES A;  2C78 A;  4PC6 A;  4XN3 A;  2X6X A;  2XZO A;  3SLD A;  3CCE B;  3CC4 B;  4QV2 A;  2VJI A;  1CNF A;  3FPK A;  1YJN B;  2OBS A;  2YWF A;  3AST A;  3CRZ A;  1BMF A;  3WYA A;  4ZGN B;  4CQJ A;  1EP3 B;  3P27 A;  4M1K A;  3BCD A;  1W35 A;  2OTJ B;  1EFR A;  1ZUN B;  2BMW A;  3PVD A;  2VNI A;  1ZM3 A;  2F43 A;  4YAU A;  3KEW A;  1QG0 A;  1GVH A;  4P6V F;  1B2R A;  4B4D A;  3AVU A;  1H85 A;  3I56 B;  2WSS A;  3BQJ A;  1KD1 D;  2VBV A;  1S72 B;  5TR9 A;  1KC8 D;  4B44 A;  1EFU A;  4B3G A;  3ZIA A;  4DK0 A;  4G7W A;  3WND A;  2XND A;  3OE7 A;  5HXB A;  1NRK A;  4X7C A;  3QSY A;  1H8H A;  4X7D A;  1F20 A;  1W9X A;  2WZN A;  4YEL A;  1PKV A;  1WOS A;  4TSF A;  1QFY A;  2YWG A;  4DK1 A;  3B82 A;  5KW9 A;  3CME B;  2DCU A;  3ASQ A;  2V7V A;  1VQK B;  5GV7 A;  3QFT A;  3ZC3 A;  5H59 A;  4AF6 A;  1WP6 A;  3AVT A;  2QN6 A;  4XOT A;  4U9U A;  1VQ9 B;  2JN9 A;  1VQ5 B;  3JQR A;  3AGP A;  4BPR A;  1WOP A;  2BN4 A;  3QE2 A;  4KKT A;  4II2 A;  3AVY A;  3CB4 A;  5JBQ A;  1Q82 D;  3QFC A;  2DEU A;  1VQM B;  4X8I A;  4IW3 B;  1NB9 A;  5HZA A;  3OOC A;  2CW5 A;  3FPP A;  4QHY A;  5H5J A;  1XQB A;  2ZBU A;  2BPO A;  2XOK A;  2B7B A;  2EFG A;  5DN6 A;  5FIU A;  1DG1 G;  3E20 A;  3G05 A;  2DET A;  2BGJ A;  2ZXI A;  5BSY A;  4AF7 A;  2HCJ B;  4LBZ A;  1VLO A;  4PAB A;  1K28 D;  4YHB A;  1WOO A;  4RCY A;  1WSR A;  3PA1 A;  1QGY A;  2Q6O A;  4HE5 A;  1S0U A;  1B23 P;  2CK3 A;  3Q6Q A;  2V7U A;  3R6J A;  2OBT A;  2ZTN A;  1ZM4 A;  3SJZ A;  1NJI D;  4B48 A;  4XLC A;  4KKU A;  5FL7 A;  2B7C A;  5IYR A;  3KL9 A;  2JJ2 A;  1BQE A;  3I1F A;  3J81 k;  3G6E B;  3CCR B;  2RC5 A;  4P25 A;  5TY0 A;  1YJW B;  1N0V C;  1CQX A;  1UD8 A;  2QDX A;  3OZW A;  3ZZ0 A;  1JNY A;  1TLL A;  2CC2 A;  4XKV A;  5KNL A;  1R5N A;  2WPD A;  4X07 A;  3OZU A;  4RDL A;  1OGI A;  4M4S A;  4XLE A;  1IB0 A;  3OP1 A;  1VQP B;  4PGO A;  3CXC B;  2JIZ A;  2OBR A;  2GJR A;  4DNR B;  3G71 B;  4ZCL A;  1GO2 A;  2D74 A;  1QX4 A;  4QFM A;  4N3N A;  4Y7C A;  1Q86 D;  3MCA A;  5LMZ A;  1NDH A;  1G7C A;  1GAW A;  2CF4 A;  2AHO A;  5IYW A;  2X0K A;  2ZL7 A;  1W34 A;  4TMV A;  2GJP A;  4YAO A;  5FNZ A;  2WJY A;  1Y0R A;  3GQB A;  2PMD A;  4XKW A;  1KZL A;  1XB2 A;  3E1Y E;  3HAG A;  4WQM A;  3G4S B;  1JJ2 B;  2V7Q A;  4YAF A;  3Q3A A;  3A3B A;  1W0K A;  1EP2 B;  1EFT A;  1K9M D;  4RPB A;  2X53 S;  1VQO B;  1VQN B;  4DNT B;  3A8K A;  4RD1 A;  1J9Z A;  3T51 B;  4M0L A;  3T56 B;  2C2W A;  1PJ6 A;  4Y9R A;  2Q6K A;  4OPS A;  2VNH A;  1T6Y A;  2QTZ A;  4N3G A;  3BCF A;  3LQ6 A;  1E1R A;  2C4T A;  1ELO A;  2X3U A;  4XR6 A;  1D1N A;  1EWY A;  3A3G A;  4G5G A;  4UZE A;  3JU4 A;  4G1B A;  2YWE A;  1VQL B;  2VZL A;  3VO2 A;  2D9R A;  1HZE A;  5IYN A;  1V5V A;  4Z4V A;  4XMY A;  1JA0 A;  4RD3 A;  2Q6I A;  4M53 A;  3ZBT A;  1K8A D;  1AMO A;  4RLZ A;  4B43 A;  2W6J A;  1ZM2 A;  3H94 A;  2KVO A;  1COW A;  2GK7 A;  3ONY A;  1QUF A;  4JMQ A;  4YAL A;  3BC9 A;  3ZPN A;  5F4J A;  1S4M A;  2C5H A;  1T6Z A;  3P26 A;  5A89 A;  2VNK A;  1N08 A;  2GRE A;  2F4N A; 
#chains in the Genus database with same CATH homology
 1NB0 A;  2I1L A;  2VBU A;  1P4M A;  2X0K A;  5FNZ A;  1MRZ A;  1NB9 A;  4UZE A;  1T6X A;  1Q9S A;  5TRD A;  5A8A A;  1N05 A;  3ZUG A;  2P3M A;  5FO0 A;  3CTA A;  3OP1 A;  4UZF A;  5FO1 A;  2VBS A;  5A88 A;  3BNW A;  2VBV A;  1N06 A;  1N07 A;  2OYN A;  1T6Y A;  1S4M A;  5A89 A;  1T6Z A;  2VBT A;  1N08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...