5A89A

Crystal structure of the riboflavin kinase module of fad synthetase from corynebacterium ammoniagenes in complex with fmn and adp(p 21 21 21)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
HFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Structural Insights Into the Synthesis of Fmn in Prokaryotic Organisms.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
total genus 37
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5a89A00
3BNWA 4UZFA 1NB0A 1T6XA 3OP1A 1S4MA 2OYNA 5A89A 2VBVA 5A8AA 1NB9A 2VBTA 1N06A 5FNZA 4UZEA 2I1LA 1MRZA 3CTAA 5TRDA 2P3MA 1T6ZA 5A88A 5FO0A 1N07A 1T6YA 2X0KA 5FO1A 1P4MA 1N08A 2VBUA 1Q9SA 2VBSA 1N05A 3ZUGA
chains in the Genus database with same CATH superfamily
3SJZA 2GJKA 3W5HA 4Z4SA 4RM0A 5AN9A 4XKWA 2J7KA 1VJSA 4TN1A 2ZITA 5A8AA 3OKXA 4U9UA 4X07A 1Y0RA 4M4SA 4YAOA 1QGZA 3R6KA 3PA2A 2VJIA 5IYRA 1UMKA 2P3MA 1T6YA 2WSSA 3QE2A 4YAUA 3GQBA 4ZGNB 1BPLA 2C2WA 1CNFA 4HE6A 4LC0A 4ZCLA 3VNVA 3W2HA 1WOPA 4B3FX 4MYTA 3SLDA 3CXCB 1WORA 2WYRA 3ZZUA 3ZZ0A 4DK1A 3LO8A 3OEHA 1R5BA 4RJLA 4G1BA 3VO1A 3Q3AA 4JMQA 1AIPA 1XB2A 3OZUA 2DCUA 1ZM3A 1QUFA 5A89A 1E79A 5HXBA 4II2A 1TVCA 3ZPNA 4KKSA 5TR9A 1R5NA 1XQBA 3OW2B 1S72B 2DOGA 3T56B 1WP6A 3CPXA 2QTLA 3CC7B 1T6ZA 3Q38A 3AVUA 3CPWB 3GVLA 4XMYA 3G05A 3CP8A 4RD0A 4HIZA 2EFGA 3W5UA 4RLZA 3ONYA 3CC2B 3CP2A 2ZZQA 3CMEB 4YHBA 4P26A 1VQ7B 1UD4A 1W87A 3MHPA 3ASPA 1E1QA 2BSAA 2C5BA 2JJ2A 5GV7A 3DDYA 4YALA 1JB9A 4NCNA 1E63A 2FX3A 2AHOA 3ZC3A 1SM4A 2X85A 5A88A 3CCVB 4YAFA 1FX0A 2XEXA 1N0VC 2C77A 1MABA 4RDLA 2QTZA 4RPDA 2GJPA 4II3A 1QG0A 2VBSA 1VQPB 3WBJA 3ZBTA 1G7TA 2YWFA 4YELA 3ZUGA 1VQ6B 3JQPA 3CD6B 2NV4A 3BC9A 4B4DA 3QFCA 1DARA 2D3NA 2E1BA 2ZL5A 4FN5A 1S4MA 4XN3A 2V7UA 3CCUB 1OHHA 5KW9A 4XONA 1KD1D 4XLAA 2CW5A 3VR6A 3E1YE 1N06A 1QFJA 1UD5A 3FKSA 3BCFA 3ES9A 2VNJA 4WZTA 1VQ9B 2VNIA 1VLYA 2ZL7A 1G7CA 1R5OA 1SKQA 3I55B 4RDKA 3BH4A 2CF4A 1V5VA 3ONUA 3G71B 3CCQB 3VMFA 1A8PA 2WR8A 3KEWA 1Q9SA 4ROXA 5HZAA 3HAGA 3WNBA 3PUNA 1KK3A 1FNBA 3Q6QA 4B44A 4PGOA 1Q7YD 4UZFA 4EH1A 4NNJA 4P6YA 1UD3A 2CK3A 4PC3A 1DDIA 2C5HA 4PC7A 1K28D 5HZBA 1W2BB 2F1LA 3GIRA 3CMMA 1BMFA 1GAQA 1HA3A 1VF7A 2KVOA 2ZXIA 3JU4A 5IYQA 3V76A 1VQOB 3CESA 4XLEA 5DSZA 4X06A 1RQRA 1FNMA 1U2RA 1P4MA 2CBXA 1KZLA 3OE7A 1QVGB 2BGIA 4QVJA 3OOCA 5FL7A 1ZM9A 3SEJA 1GO2A 2QMUA 3PENA 1W0KA 4HE5A 1QFYA 1BLIA 1KTVA 2Q6KA 4YEJA 1EXMA 2PE3A 3CCJB 1YJNB 2JIZA 2XZLA 3Q39A 1KJZA 3LVBA 4P22A 3ZIAA 4C0SA 3U6KA 4LBZA 2ZTNA 1G7RA 1WTHD 1K73D 2F43A 3OJXA 1FRQA 3LQEA 1VHEA 5JBQA 1JNYA 4ZV4A 5DS0A 4C43A 2F1MA 4OPVA 2X0KA 4P12A 4P25A 4MYUA 4J0QA 4ZCMA 4QFMA 1Q81D 3ASRA 1TTTA 2B5OA 4M2LA 1HZEA 2ZZEA 3A3BA 3W2EA 4WZEA 1ZUNB 3AGPA 4PABA 3I1FA 4XKVA 1UD8A 4LBWA 2D3LA 3CCMB 3QFSA 3VO2A 1V0FA 4NBSA 1UD2A 3BQJA 2ZBUA 1FNDA 1G7SA 4XLHA 3R6JA 2DEUA 1EP3B 1YJWB 4G7XA 1VQ5B 1YITB 2XNJA 5BSXA 1IHMA 4DQLA 2RC6A 4OOVA 2DY1A 4FK8A 2YWGA 5FIUA 5LMZA 3BY2A 2XNCA 4XORA 1K9MD 2X6XA 4P1VA 2OK7A 2E1RA 4TMZA 3WQZA 3QFRA 5IYWA 3VNUA 3W2FA 3FPKA 4Y9RA 1SKYB 1YX2A 1IJEA 5GV8A 1VQMB 1T6XA 4KKUA 2OTJB 4XNFA 3W5VA 1BX1A 2BF4A 1QGAA 4X7CA 3GVJA 2VZLA 4ZGQB 3CCLB 3A1PA 2VBVA 4TMVA 2ZZFA 2DYIA 1OB5A 3A8IA 2I1LA 4H9GA 4OPOA 4X7DA 3Q6RA 1N07A 1S0UA 4G5GA 2GPJA 1EP2B 3OPOA 3WXMA 1WDTA 2M5SA 5F4OA 1YI2B 3P26A 2BM1A 5H5JA 3FPPA 1W35A 3OFNA 5EMNA 4XLFA 4AF6A 2QDXA 2C4TA 1ZM2A 1FDRA 2Q6IA 3AVTA 4N3NA 3ASQA 4X05A 4DQKA 4K1XA 1N0UA 4LBYA 2OYNA 1DG1G 2V7XA 1NRKA 2VBTA 2V7VA 2DIEA 1IB0A 3PVDA 4UZEA 1MRZA 3ZBUA 1XE1A 3SJPA 2WJVA 4X8IA 5FO1A 4PAAA 1T5EA 2Q6OA 2V4DA 3D26A 2GK7A 3OZWA 2VJJA 4XD7A 4WZLA 1IJFA 1HVXA 4Z4YA 3A35A 4QVAA 2HCJB 2V7TA 2W6IA 1WSVA 2X3UA 2B7BA 2PMDA 4UZUA 3WYAA 1VQKB 3BNWA 2OBTA 1NBMA 3QSYA 4TT3A 1E3ZA 4XM3A 3WBKA 1KMHA 1E62A 1RQPA 4P9SA 3ISXA 1PJ7A 1ZM4A 4ZCIA 3WNDA 3CRZA 2QGGA 4OP7A 1CNEA 4R71A 5FA6A 1H8HA 3CTAA 3CCRB 2OBRA 1EFUA 1QUEA 1EFRA 1J9ZA 1PKVA 5THXA 4B3XA 2JJ1A 2F4NA 3B78A 3WNCA 2PIAA 3PUMA 4ACBA 1JJ2B 1E1RA 3ZZTA 1B2RA 4QV2A 1KK0A 1YJ9B 1OGJA 4XLCA 3V7AA 1UD6A 3OP1A 4UAJA 5J3OA 1E3XA 4Z4WA 2WJYA 1QVFB 1VQNB 3CC4B 1TLLA 2BPOA 1NB9A 2LZJA 2X6YA 1K8AD 1GR1A 5BSYA 1AMOA 2BMWA 1QFZA 1GVHA 4B47A 4Z4VA 3I56B 4OPSA 4TMWA 5TY0A 2BGJA 2BV3A 4QHYA 1BX0A 4G6IA 2R6HA 1I7PA 4RDJA 1N05A 1BQEA 1PJ6A 1D8TA 3JQQA 2QE7A 4RD6A 2WZNA 4FWTA 4XOPA 4OOXA 1VHOA 2V7WA 1ELOA 4DNRB 3PA1A 1E64A 3H94A 2DERA 2OBSA 1OGIA 2ZTGA 5KSWB 3GSIA 4PC1A 4AVZA 3MCAA 4XOTA 4BPRA 3SLNA 5FNZA 2VNKA 3AVYA 1FRNA 1CQXA 4FXUA 5TRDA 2GREA 1VLOA 4B43A 1Q82D 1WOOA 4L8JA 3AVVA 1N08A 1QH0A 3AVXA 5H59A 5L46A 2XZOA 4P3IA 2Q6LA 1EFTA 3LNNA 1WSRA 4KKTA 1W0JA 3CW2A 4WWVA 1QGYA 1DDGA 1Q86D 1WU8A 3OZVA 1W9XA 2XNDA 4TSFA 1JA1A 4ASUA 1JA0A 4P3YA 4AF7A 1EFCA 5CDFA 3A3GA 5IYPA 4M1KA 2OK8A 4X7FA 3T51B 4Z1MA 2GQFA 4DNTB 1WPCA 5J35A 1D1NA 5FO0A 4Z4UA 1VQ8B 3ASTA 1WOSA 5KNLA 3MMPA 4RCZA 4LBVA 1V0EA 4XQFA 4Z4RA 3ASSA 3A8JA 2XGJA 3RY8A 2PLFA 2RC5A 4RD2A 1EWYA 1E43A 4F7DA 2ZXHA 1M90D 3KL9A 2FVGA 2JDIA 4TKOB 2BM0A 2QEXB 3AGQA 2X53S 2D74A 3H9NA 3CCSB 5F4JA 1FNCA 1YLOA 4X0CA 1VQLB 1N8RD 2CRVA 1YHQB 3OW7A 2HMAA 2V7QA 5TV2A 4CQJA 4IW3B 4TMTA 1I8DA 2ZL6A 2GJRA 4XN0A 2QN6A 3NE5B 4Z4TA 3G6EB 2GK6A 2NPFA 3JQRA 1BJKA 3OJWA 3B82A 3CB4A 2VBUA 2Z6BD 4YAWA 2ZZGA 4Z4ZA 3G4SB 1GJRA 3P27A 4X7EA 1GAWA 1F20A 1KK2A 4G1VA 2YWEA 4YXWA 3CMAB 1TUIA 4G7WA 5HKKA 3GVKA 2OTLB 2D9RA 3OAAA 2CNDA 5E6TA 3B8HA 3QFTA 3BCDA 1F60A 1COWA 4Y7CA 2CC2A 3W2IA 2HLDA 2XZPA 4B48A 3CCEB 2QA4B 4WQMA 4AC9A 2C78A 2X8KA 3FJOA 4M0LA 4ACAA 2BN4A 1VQ4B 5IK2A 4OOSA 4P6VF 2YWHA 3WY9A 4XL9A 4P2NA 1OB0A 4Q7JB 4M53A 1KQSB 2C4UA 4RPBA 3BY1A 2BVNA 4RD4A 1EP1B 2V31A 2JN9A 3W2GA 4Y9UA 2B7CA 2VYQA 4WZKA 4XR6A 2EIXA 3A8KA 2X6WA 3J81k 3AVWA 1NB0A 3E20A 2DETA 1YIJB 1KC8D 3LQ6A 4GQNA 4PC6A 1H85A 2WPDA 1M1KD 4RD3A 1NJID 4E0FA 3U2QA 2W6JA 4N3GA 1QX4A 4RCYA 2XOKA 2WZPP 3U6BA 5DN6A 3OEEA 2ZBVA 1Y0YA 2HDNB 4DK0A 5B6IA 4PC2A 5IYNA 1D2EA 1NDHA 1XFOA 1H8EA 5F4MA 1H42A 1KK1A 2VNHA 4RD1A 4B3GA 1W34A 1B23P 2R9VA 4TMXA 1PJ5A 3SKBA 3T53B 4QUZA 1I18A 1KRHA 1OB2A
chains in the Genus database with same CATH topology
3BNWA 4UZFA 1NB0A 1T6XA 3OP1A 1S4MA 2OYNA 5A89A 2VBVA 5A8AA 1NB9A 2VBTA 1N06A 5FNZA 4UZEA 2I1LA 1MRZA 3CTAA 5TRDA 2P3MA 1T6ZA 5A88A 5FO0A 1N07A 1T6YA 2X0KA 5FO1A 1P4MA 1N08A 2VBUA 1Q9SA 2VBSA 1N05A 3ZUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BNW A;  4UZF A;  1NB0 A;  1T6X A;  3OP1 A;  1S4M A;  2OYN A;  5A89 A;  2VBV A;  5A8A A;  1NB9 A;  2VBT A;  1N06 A;  5FNZ A;  4UZE A;  2I1L A;  1MRZ A;  3CTA A;  5TRD A;  2P3M A;  1T6Z A;  5A88 A;  5FO0 A;  1N07 A;  1T6Y A;  2X0K A;  5FO1 A;  1P4M A;  1N08 A;  2VBU A;  1Q9S A;  2VBS A;  1N05 A;  3ZUG A; 
#chains in the Genus database with same CATH topology
 3SJZ A;  2GJK A;  3W5H A;  4Z4S A;  4RM0 A;  5AN9 A;  4XKW A;  2J7K A;  1VJS A;  4TN1 A;  2ZIT A;  5A8A A;  3OKX A;  4U9U A;  4X07 A;  1Y0R A;  4M4S A;  4YAO A;  1QGZ A;  3R6K A;  3PA2 A;  2VJI A;  5IYR A;  1UMK A;  2P3M A;  1T6Y A;  2WSS A;  3QE2 A;  4YAU A;  3GQB A;  4ZGN B;  1BPL A;  2C2W A;  1CNF A;  4HE6 A;  4LC0 A;  4ZCL A;  3VNV A;  3W2H A;  1WOP A;  4B3F X;  4MYT A;  3SLD A;  3CXC B;  1WOR A;  2WYR A;  3ZZU A;  3ZZ0 A;  4DK1 A;  3LO8 A;  3OEH A;  1R5B A;  4RJL A;  4G1B A;  3VO1 A;  3Q3A A;  4JMQ A;  1AIP A;  1XB2 A;  3OZU A;  2DCU A;  1ZM3 A;  1QUF A;  5A89 A;  1E79 A;  5HXB A;  4II2 A;  1TVC A;  3ZPN A;  4KKS A;  5TR9 A;  1R5N A;  1XQB A;  3OW2 B;  1S72 B;  2DOG A;  3T56 B;  1WP6 A;  3CPX A;  2QTL A;  3CC7 B;  1T6Z A;  3Q38 A;  3AVU A;  3CPW B;  3GVL A;  4XMY A;  3G05 A;  3CP8 A;  4RD0 A;  4HIZ A;  2EFG A;  3W5U A;  4RLZ A;  3ONY A;  3CC2 B;  3CP2 A;  2ZZQ A;  3CME B;  4YHB A;  4P26 A;  1VQ7 B;  1UD4 A;  1W87 A;  3MHP A;  3ASP A;  1E1Q A;  2BSA A;  2C5B A;  2JJ2 A;  5GV7 A;  3DDY A;  4YAL A;  1JB9 A;  4NCN A;  1E63 A;  2FX3 A;  2AHO A;  3ZC3 A;  1SM4 A;  2X85 A;  5A88 A;  3CCV B;  4YAF A;  1FX0 A;  2XEX A;  1N0V C;  2C77 A;  1MAB A;  4RDL A;  2QTZ A;  4RPD A;  2GJP A;  4II3 A;  1QG0 A;  2VBS A;  1VQP B;  3WBJ A;  3ZBT A;  1G7T A;  2YWF A;  4YEL A;  3ZUG A;  1VQ6 B;  3JQP A;  3CD6 B;  2NV4 A;  3BC9 A;  4B4D A;  3QFC A;  1DAR A;  2D3N A;  2E1B A;  2ZL5 A;  4FN5 A;  1S4M A;  4XN3 A;  2V7U A;  3CCU B;  1OHH A;  5KW9 A;  4XON A;  1KD1 D;  4XLA A;  2CW5 A;  3VR6 A;  3E1Y E;  1N06 A;  1QFJ A;  1UD5 A;  3FKS A;  3BCF A;  3ES9 A;  2VNJ A;  4WZT A;  1VQ9 B;  2VNI A;  1VLY A;  2ZL7 A;  1G7C A;  1R5O A;  1SKQ A;  3I55 B;  4RDK A;  3BH4 A;  2CF4 A;  1V5V A;  3ONU A;  3G71 B;  3CCQ B;  3VMF A;  1A8P A;  2WR8 A;  3KEW A;  1Q9S A;  4ROX A;  5HZA A;  3HAG A;  3WNB A;  3PUN A;  1KK3 A;  1FNB A;  3Q6Q A;  4B44 A;  4PGO A;  1Q7Y D;  4UZF A;  4EH1 A;  4NNJ A;  4P6Y A;  1UD3 A;  2CK3 A;  4PC3 A;  1DDI A;  2C5H A;  4PC7 A;  1K28 D;  5HZB A;  1W2B B;  2F1L A;  3GIR A;  3CMM A;  1BMF A;  1GAQ A;  1HA3 A;  1VF7 A;  2KVO A;  2ZXI A;  3JU4 A;  5IYQ A;  3V76 A;  1VQO B;  3CES A;  4XLE A;  5DSZ A;  4X06 A;  1RQR A;  1FNM A;  1U2R A;  1P4M A;  2CBX A;  1KZL A;  3OE7 A;  1QVG B;  2BGI A;  4QVJ A;  3OOC A;  5FL7 A;  1ZM9 A;  3SEJ A;  1GO2 A;  2QMU A;  3PEN A;  1W0K A;  4HE5 A;  1QFY A;  1BLI A;  1KTV A;  2Q6K A;  4YEJ A;  1EXM A;  2PE3 A;  3CCJ B;  1YJN B;  2JIZ A;  2XZL A;  3Q39 A;  1KJZ A;  3LVB A;  4P22 A;  3ZIA A;  4C0S A;  3U6K A;  4LBZ A;  2ZTN A;  1G7R A;  1WTH D;  1K73 D;  2F43 A;  3OJX A;  1FRQ A;  3LQE A;  1VHE A;  5JBQ A;  1JNY A;  4ZV4 A;  5DS0 A;  4C43 A;  2F1M A;  4OPV A;  2X0K A;  4P12 A;  4P25 A;  4MYU A;  4J0Q A;  4ZCM A;  4QFM A;  1Q81 D;  3ASR A;  1TTT A;  2B5O A;  4M2L A;  1HZE A;  2ZZE A;  3A3B A;  3W2E A;  4WZE A;  1ZUN B;  3AGP A;  4PAB A;  3I1F A;  4XKV A;  1UD8 A;  4LBW A;  2D3L A;  3CCM B;  3QFS A;  3VO2 A;  1V0F A;  4NBS A;  1UD2 A;  3BQJ A;  2ZBU A;  1FND A;  1G7S A;  4XLH A;  3R6J A;  2DEU A;  1EP3 B;  1YJW B;  4G7X A;  1VQ5 B;  1YIT B;  2XNJ A;  5BSX A;  1IHM A;  4DQL A;  2RC6 A;  4OOV A;  2DY1 A;  4FK8 A;  2YWG A;  5FIU A;  5LMZ A;  3BY2 A;  2XNC A;  4XOR A;  1K9M D;  2X6X A;  4P1V A;  2OK7 A;  2E1R A;  4TMZ A;  3WQZ A;  3QFR A;  5IYW A;  3VNU A;  3W2F A;  3FPK A;  4Y9R A;  1SKY B;  1YX2 A;  1IJE A;  5GV8 A;  1VQM B;  1T6X A;  4KKU A;  2OTJ B;  4XNF A;  3W5V A;  1BX1 A;  2BF4 A;  1QGA A;  4X7C A;  3GVJ A;  2VZL A;  4ZGQ B;  3CCL B;  3A1P A;  2VBV A;  4TMV A;  2ZZF A;  2DYI A;  1OB5 A;  3A8I A;  2I1L A;  4H9G A;  4OPO A;  4X7D A;  3Q6R A;  1N07 A;  1S0U A;  4G5G A;  2GPJ A;  1EP2 B;  3OPO A;  3WXM A;  1WDT A;  2M5S A;  5F4O A;  1YI2 B;  3P26 A;  2BM1 A;  5H5J A;  3FPP A;  1W35 A;  3OFN A;  5EMN A;  4XLF A;  4AF6 A;  2QDX A;  2C4T A;  1ZM2 A;  1FDR A;  2Q6I A;  3AVT A;  4N3N A;  3ASQ A;  4X05 A;  4DQK A;  4K1X A;  1N0U A;  4LBY A;  2OYN A;  1DG1 G;  2V7X A;  1NRK A;  2VBT A;  2V7V A;  2DIE A;  1IB0 A;  3PVD A;  4UZE A;  1MRZ A;  3ZBU A;  1XE1 A;  3SJP A;  2WJV A;  4X8I A;  5FO1 A;  4PAA A;  1T5E A;  2Q6O A;  2V4D A;  3D26 A;  2GK7 A;  3OZW A;  2VJJ A;  4XD7 A;  4WZL A;  1IJF A;  1HVX A;  4Z4Y A;  3A35 A;  4QVA A;  2HCJ B;  2V7T A;  2W6I A;  1WSV A;  2X3U A;  2B7B A;  2PMD A;  4UZU A;  3WYA A;  1VQK B;  3BNW A;  2OBT A;  1NBM A;  3QSY A;  4TT3 A;  1E3Z A;  4XM3 A;  3WBK A;  1KMH A;  1E62 A;  1RQP A;  4P9S A;  3ISX A;  1PJ7 A;  1ZM4 A;  4ZCI A;  3WND A;  3CRZ A;  2QGG A;  4OP7 A;  1CNE A;  4R71 A;  5FA6 A;  1H8H A;  3CTA A;  3CCR B;  2OBR A;  1EFU A;  1QUE A;  1EFR A;  1J9Z A;  1PKV A;  5THX A;  4B3X A;  2JJ1 A;  2F4N A;  3B78 A;  3WNC A;  2PIA A;  3PUM A;  4ACB A;  1JJ2 B;  1E1R A;  3ZZT A;  1B2R A;  4QV2 A;  1KK0 A;  1YJ9 B;  1OGJ A;  4XLC A;  3V7A A;  1UD6 A;  3OP1 A;  4UAJ A;  5J3O A;  1E3X A;  4Z4W A;  2WJY A;  1QVF B;  1VQN B;  3CC4 B;  1TLL A;  2BPO A;  1NB9 A;  2LZJ A;  2X6Y A;  1K8A D;  1GR1 A;  5BSY A;  1AMO A;  2BMW A;  1QFZ A;  1GVH A;  4B47 A;  4Z4V A;  3I56 B;  4OPS A;  4TMW A;  5TY0 A;  2BGJ A;  2BV3 A;  4QHY A;  1BX0 A;  4G6I A;  2R6H A;  1I7P A;  4RDJ A;  1N05 A;  1BQE A;  1PJ6 A;  1D8T A;  3JQQ A;  2QE7 A;  4RD6 A;  2WZN A;  4FWT A;  4XOP A;  4OOX A;  1VHO A;  2V7W A;  1ELO A;  4DNR B;  3PA1 A;  1E64 A;  3H94 A;  2DER A;  2OBS A;  1OGI A;  2ZTG A;  5KSW B;  3GSI A;  4PC1 A;  4AVZ A;  3MCA A;  4XOT A;  4BPR A;  3SLN A;  5FNZ A;  2VNK A;  3AVY A;  1FRN A;  1CQX A;  4FXU A;  5TRD A;  2GRE A;  1VLO A;  4B43 A;  1Q82 D;  1WOO A;  4L8J A;  3AVV A;  1N08 A;  1QH0 A;  3AVX A;  5H59 A;  5L46 A;  2XZO A;  4P3I A;  2Q6L A;  1EFT A;  3LNN A;  1WSR A;  4KKT A;  1W0J A;  3CW2 A;  4WWV A;  1QGY A;  1DDG A;  1Q86 D;  1WU8 A;  3OZV A;  1W9X A;  2XND A;  4TSF A;  1JA1 A;  4ASU A;  1JA0 A;  4P3Y A;  4AF7 A;  1EFC A;  5CDF A;  3A3G A;  5IYP A;  4M1K A;  2OK8 A;  4X7F A;  3T51 B;  4Z1M A;  2GQF A;  4DNT B;  1WPC A;  5J35 A;  1D1N A;  5FO0 A;  4Z4U A;  1VQ8 B;  3AST A;  1WOS A;  5KNL A;  3MMP A;  4RCZ A;  4LBV A;  1V0E A;  4XQF A;  4Z4R A;  3ASS A;  3A8J A;  2XGJ A;  3RY8 A;  2PLF A;  2RC5 A;  4RD2 A;  1EWY A;  1E43 A;  4F7D A;  2ZXH A;  1M90 D;  3KL9 A;  2FVG A;  2JDI A;  4TKO B;  2BM0 A;  2QEX B;  3AGQ A;  2X53 S;  2D74 A;  3H9N A;  3CCS B;  5F4J A;  1FNC A;  1YLO A;  4X0C A;  1VQL B;  1N8R D;  2CRV A;  1YHQ B;  3OW7 A;  2HMA A;  2V7Q A;  5TV2 A;  4CQJ A;  4IW3 B;  4TMT A;  1I8D A;  2ZL6 A;  2GJR A;  4XN0 A;  2QN6 A;  3NE5 B;  4Z4T A;  3G6E B;  2GK6 A;  2NPF A;  3JQR A;  1BJK A;  3OJW A;  3B82 A;  3CB4 A;  2VBU A;  2Z6B D;  4YAW A;  2ZZG A;  4Z4Z A;  3G4S B;  1GJR A;  3P27 A;  4X7E A;  1GAW A;  1F20 A;  1KK2 A;  4G1V A;  2YWE A;  4YXW A;  3CMA B;  1TUI A;  4G7W A;  5HKK A;  3GVK A;  2OTL B;  2D9R A;  3OAA A;  2CND A;  5E6T A;  3B8H A;  3QFT A;  3BCD A;  1F60 A;  1COW A;  4Y7C A;  2CC2 A;  3W2I A;  2HLD A;  2XZP A;  4B48 A;  3CCE B;  2QA4 B;  4WQM A;  4AC9 A;  2C78 A;  2X8K A;  3FJO A;  4M0L A;  4ACA A;  2BN4 A;  1VQ4 B;  5IK2 A;  4OOS A;  4P6V F;  2YWH A;  3WY9 A;  4XL9 A;  4P2N A;  1OB0 A;  4Q7J B;  4M53 A;  1KQS B;  2C4U A;  4RPB A;  3BY1 A;  2BVN A;  4RD4 A;  1EP1 B;  2V31 A;  2JN9 A;  3W2G A;  4Y9U A;  2B7C A;  2VYQ A;  4WZK A;  4XR6 A;  2EIX A;  3A8K A;  2X6W A;  3J81 k;  3AVW A;  1NB0 A;  3E20 A;  2DET A;  1YIJ B;  1KC8 D;  3LQ6 A;  4GQN A;  4PC6 A;  1H85 A;  2WPD A;  1M1K D;  4RD3 A;  1NJI D;  4E0F A;  3U2Q A;  2W6J A;  4N3G A;  1QX4 A;  4RCY A;  2XOK A;  2WZP P;  3U6B A;  5DN6 A;  3OEE A;  2ZBV A;  1Y0Y A;  2HDN B;  4DK0 A;  5B6I A;  4PC2 A;  5IYN A;  1D2E A;  1NDH A;  1XFO A;  1H8E A;  5F4M A;  1H42 A;  1KK1 A;  2VNH A;  4RD1 A;  4B3G A;  1W34 A;  1B23 P;  2R9V A;  4TMX A;  1PJ5 A;  3SKB A;  3T53 B;  4QUZ A;  1I18 A;  1KRH A;  1OB2 A; 
#chains in the Genus database with same CATH homology
 3BNW A;  4UZF A;  1NB0 A;  1T6X A;  3OP1 A;  1S4M A;  2OYN A;  5A89 A;  2VBV A;  5A8A A;  1NB9 A;  2VBT A;  1N06 A;  5FNZ A;  4UZE A;  2I1L A;  1MRZ A;  3CTA A;  5TRD A;  2P3M A;  1T6Z A;  5A88 A;  5FO0 A;  1N07 A;  1T6Y A;  2X0K A;  5FO1 A;  1P4M A;  1N08 A;  2VBU A;  1Q9S A;  2VBS A;  1N05 A;  3ZUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...