5A89A

Crystal structure of the riboflavin kinase module of fad synthetase from corynebacterium ammoniagenes in complex with fmn and adp(p 21 21 21)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
HFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Structural Insights Into the Synthesis of Fmn in Prokaryotic Organisms.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 37
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5a89A00
1MRZA 2VBTA 2VBSA 2VBUA 1Q9SA 5A88A 2OYNA 1T6ZA 1N05A 3CTAA 5TRDA 2P3MA 4UZEA 3OP1A 2I1LA 4UZFA 1N08A 3ZUGA 1S4MA 3BNWA 1NB9A 1NB0A 5A89A 1T6YA 5FNZA 1P4MA 5FO1A 1T6XA 2X0KA 1N07A 2VBVA 5A8AA 5FO0A 1N06A
chains in the Genus database with same CATH superfamily
5THXA 2C4UA 4P25A 4WZTA 1QGZA 1XFOA 4RLZA 2BM0A 1EWYA 2WSSA 3OEHA 3JU4A 5IYQA 3U6KA 3W5VA 4Z4UA 4ACAA 4B3FX 2V7QA 1SKQA 1BJKA 1KZLA 1RQRA 2XZOA 1UD2A 1R5BA 2V7TA 3GVJA 3WNCA 5BSYA 2ZTNA 4XORA 1YHQB 5DS0A 2WPDA 2ZXIA 3Q38A 1KC8D 1UD5A 4LBYA 3CW2A 1T6YA 2VJIA 2VBVA 2XNCA 4Z4RA 4M0LA 2Z6BD 4HIZA 4QFMA 4BPRA 1W34A 5TV2A 1VQ9B 4OOXA 3LNNA 4QHYA 4DQKA 1H8EA 1WORA 1Q7YD 1KJZA 2ZL7A 2WYRA 3I55B 3ONUA 4OOVA 1WOSA 5J3OA 1GJRA 1N08A 3E1YE 1GR1A 1G7SA 1EFRA 1HVXA 4EH1A 4WZEA 2RC5A 4Z1MA 3A35A 1M1KD 1TLLA 1GVHA 1VQNB 3B8HA 4RD4A 3QFSA 1WTHD 2BGJA 2ZTGA 3Q39A 4KKSA 4RPBA 3KEWA 1ZM9A 1WDTA 1FNDA 1N8RD 4RD6A 1KMHA 3QFCA 1H8HA 2OTJB 1XE1A 4XKWA 4NCNA 2W6IA 2OBTA 4GQNA 4RCYA 5H59A 3ASRA 5DSZA 1BLIA 2X53S 1VQ5B 2ZL6A 2X8KA 1VQKB 4DQLA 1K8AD 1BMFA 1DDIA 3A3GA 3WQZA 4PC2A 4RCZA 2QN6A 2X85A 3CXCB 1ZM2A 4OPVA 1KTVA 4OOSA 3ZPNA 4P3YA 2ZBUA 1KK2A 1UMKA 1FDRA 4M1KA 1G7TA 1UD8A 2F4NA 3LO8A 2NV4A 3B82A 1K9MD 1BX1A 4R71A 3ASTA 4XLCA 3ZIAA 3CTAA 2ZITA 2BVNA 1ZUNB 4Y9RA 3I56B 1V0EA 4RDLA 2GK7A 3Q6QA 5IYNA 5IK2A 4UZEA 1WOPA 2QDXA 1XQBA 4YAFA 4QV2A 4ZGNB 1KK0A 2C5HA 3BCFA 3FPKA 4PAAA 1N0UA 1R5NA 4X06A 4NBSA 1VHOA 4E0FA 3E20A 1XB2A 2WZPP 4CQJA 3CD6B 1NRKA 4WZKA 2FVGA 4K1XA 1YJNB 5LMZA 4U9UA 2D9RA 2C5BA 2J7KA 3OFNA 3QE2A 4PC6A 3AVYA 1D8TA 4P22A 4G1VA 5A88A 4JMQA 5HKKA 2V7VA 1JA1A 4G1BA 3AVWA 1W0KA 4NNJA 4F7DA 4ZCMA 2XOKA 4XM3A 3SJPA 1JJ2B 4G6IA 2CNDA 3SJZA 3CPXA 3CP2A 4RM0A 4KKTA 1E1RA 1EFTA 1HZEA 3W2EA 3D26A 3WBJA 2DOGA 2EIXA 2GJPA 4QUZA 4Y7CA 2X3UA 3AVTA 1VJSA 4ZGQB 2GK6A 5J35A 5AN9A 1WPCA 1YIJB 1KD1D 2QTLA 2QMUA 4B43A 3CCMB 1BPLA 2WR8A 5TR9A 1VQOB 3ZBUA 1MRZA 1WP6A 4ZV4A 1PJ6A 4M53A 4XMYA 2VNIA 2QE7A 2HCJB 4X05A 3V76A 1FRQA 3OAAA 4ZCIA 3OJWA 1H42A 4G7XA 1DARA 2VZLA 2NPFA 1VQLB 4LBWA 1QX4A 2BPOA 1G7CA 4TMZA 4UZFA 2RC6A 3VMFA 2X6XA 3OOCA 1EP2B 3HAGA 3SLDA 1NB9A 1W9XA 4TMTA 2OK8A 2BF4A 3MHPA 2CC2A 2DCUA 3G05A 3WNBA 4X0CA 4G7WA 1YJ9B 2CK3A 3P26A 1E62A 2XZPA 3G4SB 1KK1A 1QFZA 2CBXA 1UD3A 1IJFA 4XLFA 1R5OA 3I1FA 4J0QA 4RJLA 4XLAA 4Z4ZA 4KKUA 3CC2B 4M2LA 2LZJA 1I7PA 2PMDA 4YEJA 3CCJB 2PIAA 3ASPA 2QEXB 2E1RA 3GQBA 5CDFA 4RDJA 4YAOA 2OTLB 3R6JA 1M90D 5A89A 1E3XA 4P12A 1W87A 1YI2B 4TMVA 3MMPA 5HZBA 4P6YA 1OB2A 2ZL5A 1COWA 3BC9A 1F60A 1W2BB 2W6JA 4B47A 3CCVB 1YX2A 4FXUA 3QSYA 4X7CA 1Q9SA 1TTTA 4X7DA 4AVZA 3RY8A 3AVUA 4Y9UA 1N0VC 2ZBVA 3WYAA 2ZZQA 4AF6A 3A8IA 2X6WA 3AVVA 2CW5A 4XN3A 3LQ6A 4P26A 3V7AA 4MYTA 2E1BA 2V31A 1JB9A 2R9VA 1S0UA 3BH4A 1Q81D 1A8PA 1DG1G 1BX0A 2C78A 1P4MA 1V0FA 1YLOA 2PLFA 3PENA 1I8DA 2Q6LA 4G5GA 3W2IA 4L8JA 1QUFA 4N3NA 3T51B 3GVLA 3A1PA 5GV8A 1PJ5A 2VJJA 3FKSA 1ZM3A 2XGJA 5FL7A 3WXMA 2DERA 3CMMA 2VNHA 4II3A 4TMXA 1F20A 1FNMA 3J81k 4TKOB 1IJEA 4P6VF 1ELOA 3CMAB 4XOTA 4XLEA 5FIUA 3WBKA 3GIRA 3ZUGA 1VQMB 4DK0A 3CB4A 4PC1A 3OZWA 2HMAA 2WJVA 4PABA 4YAUA 1QFJA 2M5SA 4XQFA 4M4SA 1S72B 2YWFA 1QGAA 1EP1B 1E1QA 3CESA 3ISXA 3ONYA 2WJYA 4FN5A 4UZUA 1FRNA 4WZLA 2JDIA 5HZAA 3QFRA 4TT3A 3OEEA 3CRZA 3CC7B 1HA3A 1OGIA 5F4OA 5EMNA 3AVXA 3VNUA 3SKBA 3T56B 1EFUA 3W2FA 1QGYA 1FX0A 1K28D 3OKXA 1S4MA 4DNRB 4Z4WA 2GPJA 3OW7A 4ASUA 1ZM4A 1T6XA 3Q3AA 2D3LA 4RD2A 4XR6A 4C43A 1VF7A 4XL9A 3ZBTA 3H9NA 4ZCLA 3PA2A 3AGPA 4HE6A 2ZXHA 3FJOA 3CCLB 2OBSA 3ZZ0A 1KQSB 3OJXA 3DDYA 4YXWA 1YJWB 1N05A 2BN4A 2ZZGA 4XNFA 3CCSB 2XZLA 1E3ZA 1OGJA 2OBRA 1QVGB 4FK8A 3ES9A 4TSFA 4X7EA 1WSVA 1BQEA 2I1LA 4XONA 3OW2B 4YAWA 1V5VA 5HXBA 3BNWA 1B2RA 3H94A 2ZZFA 3G6EB 2HLDA 2X6YA 3VR6A 4IW3B 3FPPA 1E63A 1Y0YA 2BMWA 4P1VA 1IHMA 2Q6OA 2JIZA 5F4MA 4AC9A 2V7XA 1G7RA 1E64A 1FNBA 3JQQA 1H85A 1DDGA 1AIPA 2DIEA 1WU8A 1T5EA 4PC3A 4B3XA 1KK3A 3W5UA 1QUEA 5IYWA 3GSIA 2GJKA 5TRDA 1AMOA 1IB0A 4RDKA 1VHEA 4B4DA 4RPDA 2VYQA 2AHOA 3ASSA 1OHHA 5IYRA 4TN1A 5B6IA 3NE5B 3MCAA 1W35A 4P3IA 4WWVA 3LQEA 1JNYA 5H5JA 5KW9A 1W0JA 2JJ2A 3A8JA 5FO0A 3W2HA 2F43A 4P2NA 1NBMA 2YWGA 4XKVA 4C0SA 1KRHA 3JQRA 2C2WA 3KL9A 1VQ6B 3CMEB 2B7BA 3ASQA 4MYUA 4Z4SA 1Q82D 1T6ZA 2F1MA 4UAJA 4OP7A 2XEXA 3OPOA 4OPSA 4PGOA 3Q6RA 2CF4A 4ROXA 2GQFA 2R6HA 3BCDA 4YELA 3ZZTA 3BQJA 1VQ4B 1GAQA 1E43A 3PUMA 1CQXA 2ZZEA 1K73D 2BM1A 3W5HA 1QG0A 2GJRA 4RD1A 3VO2A 1J9ZA 3OZVA 3VNVA 2OK7A 2CRVA 3CCEB 3U6BA 4X07A 2XNDA 2QA4B 4Z4TA 2C77A 2D3NA 1SKYB 2VBUA 4P9SA 5F4JA 4LBVA 4RD3A 3AGQA 1PJ7A 3ZC3A 4DNTB 1CNEA 1WSRA 3SLNA 4B44A 4QVAA 1EXMA 5DN6A 1Y0RA 1OB0A 4X7FA 3P27A 2V4DA 4XD7A 4XOPA 4XN0A 2EFGA 1CNFA 2DY1A 2V7UA 2F1LA 4PC7A 2YWEA 3CCQB 5FNZA 1EP3B 4AF7A 3CP8A 2JN9A 2X0KA 1N07A 3QFTA 1OB5A 1QH0A 3ZZUA 5A8AA 2DYIA 1VLYA 4DK1A 1N06A 2B7CA 1VLOA 2HDNB 3OE7A 2VBTA 3GVKA 4YALA 2DETA 2VBSA 5BSXA 4N3GA 3T53B 1GO2A 2DEUA 4LBZA 3G71B 2D74A 2JJ1A 2OYNA 3BY1A 4XLHA 5GV7A 2VNJA 4B48A 2C4TA 5FA6A 3CPWB 3CC4B 1I18A 1RQPA 2V7WA 5KSWB 1GAWA 1UD4A 1QVFB 1FNCA 4II2A 1TVCA 2QGGA 2VNKA 4Q7JB 4WQMA 1B23P 1Q86D 1VQPB 1NB0A 4QVJA 2KVOA 4OPOA 1VQ8B 1JA0A 5IYPA 2BGIA 5L46A 5TY0A 3PVDA 3OZUA 1EFCA 3WY9A 1D2EA 5JBQA 3W2GA 2FX3A 1D1NA 3B78A 2Q6KA 4YHBA 2QTZA 3R6KA 1VQ7B 2WZNA 3SEJA 3CCUB 3PUNA 4Z4VA 3PA1A 3CCRB 1UD6A 2P3MA 4X8IA 1YITB 3OP1A 4TMWA 2GREA 1PKVA 1E79A 3VO1A 4B3GA 1MABA 3JQPA 2XNJA 3A8KA 2BSAA 2PE3A 3A3BA 3LVBA 5E6TA 1NDHA 3BY2A 4FWTA 4Z4YA 4H9GA 4LC0A 1TUIA 1U2RA 2Q6IA 5FO1A 4ACBA 5KNLA 2BV3A 3U2QA 2B5OA 4HE5A 3WNDA 1NJID 2YWHA 1QFYA 4RD0A 1SM4A 1WOOA
chains in the Genus database with same CATH topology
1MRZA 2VBTA 2VBSA 2VBUA 1Q9SA 5A88A 2OYNA 1T6ZA 1N05A 3CTAA 5TRDA 2P3MA 4UZEA 3OP1A 2I1LA 4UZFA 1N08A 3ZUGA 1S4MA 3BNWA 1NB9A 1NB0A 5A89A 1T6YA 5FNZA 1P4MA 5FO1A 1T6XA 2X0KA 1N07A 2VBVA 5A8AA 5FO0A 1N06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MRZ A;  2VBT A;  2VBS A;  2VBU A;  1Q9S A;  5A88 A;  2OYN A;  1T6Z A;  1N05 A;  3CTA A;  5TRD A;  2P3M A;  4UZE A;  3OP1 A;  2I1L A;  4UZF A;  1N08 A;  3ZUG A;  1S4M A;  3BNW A;  1NB9 A;  1NB0 A;  5A89 A;  1T6Y A;  5FNZ A;  1P4M A;  5FO1 A;  1T6X A;  2X0K A;  1N07 A;  2VBV A;  5A8A A;  5FO0 A;  1N06 A; 
#chains in the Genus database with same CATH topology
 5THX A;  2C4U A;  4P25 A;  4WZT A;  1QGZ A;  1XFO A;  4RLZ A;  2BM0 A;  1EWY A;  2WSS A;  3OEH A;  3JU4 A;  5IYQ A;  3U6K A;  3W5V A;  4Z4U A;  4ACA A;  4B3F X;  2V7Q A;  1SKQ A;  1BJK A;  1KZL A;  1RQR A;  2XZO A;  1UD2 A;  1R5B A;  2V7T A;  3GVJ A;  3WNC A;  5BSY A;  2ZTN A;  4XOR A;  1YHQ B;  5DS0 A;  2WPD A;  2ZXI A;  3Q38 A;  1KC8 D;  1UD5 A;  4LBY A;  3CW2 A;  1T6Y A;  2VJI A;  2VBV A;  2XNC A;  4Z4R A;  4M0L A;  2Z6B D;  4HIZ A;  4QFM A;  4BPR A;  1W34 A;  5TV2 A;  1VQ9 B;  4OOX A;  3LNN A;  4QHY A;  4DQK A;  1H8E A;  1WOR A;  1Q7Y D;  1KJZ A;  2ZL7 A;  2WYR A;  3I55 B;  3ONU A;  4OOV A;  1WOS A;  5J3O A;  1GJR A;  1N08 A;  3E1Y E;  1GR1 A;  1G7S A;  1EFR A;  1HVX A;  4EH1 A;  4WZE A;  2RC5 A;  4Z1M A;  3A35 A;  1M1K D;  1TLL A;  1GVH A;  1VQN B;  3B8H A;  4RD4 A;  3QFS A;  1WTH D;  2BGJ A;  2ZTG A;  3Q39 A;  4KKS A;  4RPB A;  3KEW A;  1ZM9 A;  1WDT A;  1FND A;  1N8R D;  4RD6 A;  1KMH A;  3QFC A;  1H8H A;  2OTJ B;  1XE1 A;  4XKW A;  4NCN A;  2W6I A;  2OBT A;  4GQN A;  4RCY A;  5H59 A;  3ASR A;  5DSZ A;  1BLI A;  2X53 S;  1VQ5 B;  2ZL6 A;  2X8K A;  1VQK B;  4DQL A;  1K8A D;  1BMF A;  1DDI A;  3A3G A;  3WQZ A;  4PC2 A;  4RCZ A;  2QN6 A;  2X85 A;  3CXC B;  1ZM2 A;  4OPV A;  1KTV A;  4OOS A;  3ZPN A;  4P3Y A;  2ZBU A;  1KK2 A;  1UMK A;  1FDR A;  4M1K A;  1G7T A;  1UD8 A;  2F4N A;  3LO8 A;  2NV4 A;  3B82 A;  1K9M D;  1BX1 A;  4R71 A;  3AST A;  4XLC A;  3ZIA A;  3CTA A;  2ZIT A;  2BVN A;  1ZUN B;  4Y9R A;  3I56 B;  1V0E A;  4RDL A;  2GK7 A;  3Q6Q A;  5IYN A;  5IK2 A;  4UZE A;  1WOP A;  2QDX A;  1XQB A;  4YAF A;  4QV2 A;  4ZGN B;  1KK0 A;  2C5H A;  3BCF A;  3FPK A;  4PAA A;  1N0U A;  1R5N A;  4X06 A;  4NBS A;  1VHO A;  4E0F A;  3E20 A;  1XB2 A;  2WZP P;  4CQJ A;  3CD6 B;  1NRK A;  4WZK A;  2FVG A;  4K1X A;  1YJN B;  5LMZ A;  4U9U A;  2D9R A;  2C5B A;  2J7K A;  3OFN A;  3QE2 A;  4PC6 A;  3AVY A;  1D8T A;  4P22 A;  4G1V A;  5A88 A;  4JMQ A;  5HKK A;  2V7V A;  1JA1 A;  4G1B A;  3AVW A;  1W0K A;  4NNJ A;  4F7D A;  4ZCM A;  2XOK A;  4XM3 A;  3SJP A;  1JJ2 B;  4G6I A;  2CND A;  3SJZ A;  3CPX A;  3CP2 A;  4RM0 A;  4KKT A;  1E1R A;  1EFT A;  1HZE A;  3W2E A;  3D26 A;  3WBJ A;  2DOG A;  2EIX A;  2GJP A;  4QUZ A;  4Y7C A;  2X3U A;  3AVT A;  1VJS A;  4ZGQ B;  2GK6 A;  5J35 A;  5AN9 A;  1WPC A;  1YIJ B;  1KD1 D;  2QTL A;  2QMU A;  4B43 A;  3CCM B;  1BPL A;  2WR8 A;  5TR9 A;  1VQO B;  3ZBU A;  1MRZ A;  1WP6 A;  4ZV4 A;  1PJ6 A;  4M53 A;  4XMY A;  2VNI A;  2QE7 A;  2HCJ B;  4X05 A;  3V76 A;  1FRQ A;  3OAA A;  4ZCI A;  3OJW A;  1H42 A;  4G7X A;  1DAR A;  2VZL A;  2NPF A;  1VQL B;  4LBW A;  1QX4 A;  2BPO A;  1G7C A;  4TMZ A;  4UZF A;  2RC6 A;  3VMF A;  2X6X A;  3OOC A;  1EP2 B;  3HAG A;  3SLD A;  1NB9 A;  1W9X A;  4TMT A;  2OK8 A;  2BF4 A;  3MHP A;  2CC2 A;  2DCU A;  3G05 A;  3WNB A;  4X0C A;  4G7W A;  1YJ9 B;  2CK3 A;  3P26 A;  1E62 A;  2XZP A;  3G4S B;  1KK1 A;  1QFZ A;  2CBX A;  1UD3 A;  1IJF A;  4XLF A;  1R5O A;  3I1F A;  4J0Q A;  4RJL A;  4XLA A;  4Z4Z A;  4KKU A;  3CC2 B;  4M2L A;  2LZJ A;  1I7P A;  2PMD A;  4YEJ A;  3CCJ B;  2PIA A;  3ASP A;  2QEX B;  2E1R A;  3GQB A;  5CDF A;  4RDJ A;  4YAO A;  2OTL B;  3R6J A;  1M90 D;  5A89 A;  1E3X A;  4P12 A;  1W87 A;  1YI2 B;  4TMV A;  3MMP A;  5HZB A;  4P6Y A;  1OB2 A;  2ZL5 A;  1COW A;  3BC9 A;  1F60 A;  1W2B B;  2W6J A;  4B47 A;  3CCV B;  1YX2 A;  4FXU A;  3QSY A;  4X7C A;  1Q9S A;  1TTT A;  4X7D A;  4AVZ A;  3RY8 A;  3AVU A;  4Y9U A;  1N0V C;  2ZBV A;  3WYA A;  2ZZQ A;  4AF6 A;  3A8I A;  2X6W A;  3AVV A;  2CW5 A;  4XN3 A;  3LQ6 A;  4P26 A;  3V7A A;  4MYT A;  2E1B A;  2V31 A;  1JB9 A;  2R9V A;  1S0U A;  3BH4 A;  1Q81 D;  1A8P A;  1DG1 G;  1BX0 A;  2C78 A;  1P4M A;  1V0F A;  1YLO A;  2PLF A;  3PEN A;  1I8D A;  2Q6L A;  4G5G A;  3W2I A;  4L8J A;  1QUF A;  4N3N A;  3T51 B;  3GVL A;  3A1P A;  5GV8 A;  1PJ5 A;  2VJJ A;  3FKS A;  1ZM3 A;  2XGJ A;  5FL7 A;  3WXM A;  2DER A;  3CMM A;  2VNH A;  4II3 A;  4TMX A;  1F20 A;  1FNM A;  3J81 k;  4TKO B;  1IJE A;  4P6V F;  1ELO A;  3CMA B;  4XOT A;  4XLE A;  5FIU A;  3WBK A;  3GIR A;  3ZUG A;  1VQM B;  4DK0 A;  3CB4 A;  4PC1 A;  3OZW A;  2HMA A;  2WJV A;  4PAB A;  4YAU A;  1QFJ A;  2M5S A;  4XQF A;  4M4S A;  1S72 B;  2YWF A;  1QGA A;  1EP1 B;  1E1Q A;  3CES A;  3ISX A;  3ONY A;  2WJY A;  4FN5 A;  4UZU A;  1FRN A;  4WZL A;  2JDI A;  5HZA A;  3QFR A;  4TT3 A;  3OEE A;  3CRZ A;  3CC7 B;  1HA3 A;  1OGI A;  5F4O A;  5EMN A;  3AVX A;  3VNU A;  3SKB A;  3T56 B;  1EFU A;  3W2F A;  1QGY A;  1FX0 A;  1K28 D;  3OKX A;  1S4M A;  4DNR B;  4Z4W A;  2GPJ A;  3OW7 A;  4ASU A;  1ZM4 A;  1T6X A;  3Q3A A;  2D3L A;  4RD2 A;  4XR6 A;  4C43 A;  1VF7 A;  4XL9 A;  3ZBT A;  3H9N A;  4ZCL A;  3PA2 A;  3AGP A;  4HE6 A;  2ZXH A;  3FJO A;  3CCL B;  2OBS A;  3ZZ0 A;  1KQS B;  3OJX A;  3DDY A;  4YXW A;  1YJW B;  1N05 A;  2BN4 A;  2ZZG A;  4XNF A;  3CCS B;  2XZL A;  1E3Z A;  1OGJ A;  2OBR A;  1QVG B;  4FK8 A;  3ES9 A;  4TSF A;  4X7E A;  1WSV A;  1BQE A;  2I1L A;  4XON A;  3OW2 B;  4YAW A;  1V5V A;  5HXB A;  3BNW A;  1B2R A;  3H94 A;  2ZZF A;  3G6E B;  2HLD A;  2X6Y A;  3VR6 A;  4IW3 B;  3FPP A;  1E63 A;  1Y0Y A;  2BMW A;  4P1V A;  1IHM A;  2Q6O A;  2JIZ A;  5F4M A;  4AC9 A;  2V7X A;  1G7R A;  1E64 A;  1FNB A;  3JQQ A;  1H85 A;  1DDG A;  1AIP A;  2DIE A;  1WU8 A;  1T5E A;  4PC3 A;  4B3X A;  1KK3 A;  3W5U A;  1QUE A;  5IYW A;  3GSI A;  2GJK A;  5TRD A;  1AMO A;  1IB0 A;  4RDK A;  1VHE A;  4B4D A;  4RPD A;  2VYQ A;  2AHO A;  3ASS A;  1OHH A;  5IYR A;  4TN1 A;  5B6I A;  3NE5 B;  3MCA A;  1W35 A;  4P3I A;  4WWV A;  3LQE A;  1JNY A;  5H5J A;  5KW9 A;  1W0J A;  2JJ2 A;  3A8J A;  5FO0 A;  3W2H A;  2F43 A;  4P2N A;  1NBM A;  2YWG A;  4XKV A;  4C0S A;  1KRH A;  3JQR A;  2C2W A;  3KL9 A;  1VQ6 B;  3CME B;  2B7B A;  3ASQ A;  4MYU A;  4Z4S A;  1Q82 D;  1T6Z A;  2F1M A;  4UAJ A;  4OP7 A;  2XEX A;  3OPO A;  4OPS A;  4PGO A;  3Q6R A;  2CF4 A;  4ROX A;  2GQF A;  2R6H A;  3BCD A;  4YEL A;  3ZZT A;  3BQJ A;  1VQ4 B;  1GAQ A;  1E43 A;  3PUM A;  1CQX A;  2ZZE A;  1K73 D;  2BM1 A;  3W5H A;  1QG0 A;  2GJR A;  4RD1 A;  3VO2 A;  1J9Z A;  3OZV A;  3VNV A;  2OK7 A;  2CRV A;  3CCE B;  3U6B A;  4X07 A;  2XND A;  2QA4 B;  4Z4T A;  2C77 A;  2D3N A;  1SKY B;  2VBU A;  4P9S A;  5F4J A;  4LBV A;  4RD3 A;  3AGQ A;  1PJ7 A;  3ZC3 A;  4DNT B;  1CNE A;  1WSR A;  3SLN A;  4B44 A;  4QVA A;  1EXM A;  5DN6 A;  1Y0R A;  1OB0 A;  4X7F A;  3P27 A;  2V4D A;  4XD7 A;  4XOP A;  4XN0 A;  2EFG A;  1CNF A;  2DY1 A;  2V7U A;  2F1L A;  4PC7 A;  2YWE A;  3CCQ B;  5FNZ A;  1EP3 B;  4AF7 A;  3CP8 A;  2JN9 A;  2X0K A;  1N07 A;  3QFT A;  1OB5 A;  1QH0 A;  3ZZU A;  5A8A A;  2DYI A;  1VLY A;  4DK1 A;  1N06 A;  2B7C A;  1VLO A;  2HDN B;  3OE7 A;  2VBT A;  3GVK A;  4YAL A;  2DET A;  2VBS A;  5BSX A;  4N3G A;  3T53 B;  1GO2 A;  2DEU A;  4LBZ A;  3G71 B;  2D74 A;  2JJ1 A;  2OYN A;  3BY1 A;  4XLH A;  5GV7 A;  2VNJ A;  4B48 A;  2C4T A;  5FA6 A;  3CPW B;  3CC4 B;  1I18 A;  1RQP A;  2V7W A;  5KSW B;  1GAW A;  1UD4 A;  1QVF B;  1FNC A;  4II2 A;  1TVC A;  2QGG A;  2VNK A;  4Q7J B;  4WQM A;  1B23 P;  1Q86 D;  1VQP B;  1NB0 A;  4QVJ A;  2KVO A;  4OPO A;  1VQ8 B;  1JA0 A;  5IYP A;  2BGI A;  5L46 A;  5TY0 A;  3PVD A;  3OZU A;  1EFC A;  3WY9 A;  1D2E A;  5JBQ A;  3W2G A;  2FX3 A;  1D1N A;  3B78 A;  2Q6K A;  4YHB A;  2QTZ A;  3R6K A;  1VQ7 B;  2WZN A;  3SEJ A;  3CCU B;  3PUN A;  4Z4V A;  3PA1 A;  3CCR B;  1UD6 A;  2P3M A;  4X8I A;  1YIT B;  3OP1 A;  4TMW A;  2GRE A;  1PKV A;  1E79 A;  3VO1 A;  4B3G A;  1MAB A;  3JQP A;  2XNJ A;  3A8K A;  2BSA A;  2PE3 A;  3A3B A;  3LVB A;  5E6T A;  1NDH A;  3BY2 A;  4FWT A;  4Z4Y A;  4H9G A;  4LC0 A;  1TUI A;  1U2R A;  2Q6I A;  5FO1 A;  4ACB A;  5KNL A;  2BV3 A;  3U2Q A;  2B5O A;  4HE5 A;  3WND A;  1NJI D;  2YWH A;  1QFY A;  4RD0 A;  1SM4 A;  1WOO A; 
#chains in the Genus database with same CATH homology
 1MRZ A;  2VBT A;  2VBS A;  2VBU A;  1Q9S A;  5A88 A;  2OYN A;  1T6Z A;  1N05 A;  3CTA A;  5TRD A;  2P3M A;  4UZE A;  3OP1 A;  2I1L A;  4UZF A;  1N08 A;  3ZUG A;  1S4M A;  3BNW A;  1NB9 A;  1NB0 A;  5A89 A;  1T6Y A;  5FNZ A;  1P4M A;  5FO1 A;  1T6X A;  2X0K A;  1N07 A;  2VBV A;  5A8A A;  5FO0 A;  1N06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...