1GR1A

Structure of ferredoxin-nadp+ reductase with glu 139 replaced by lys (e139k)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKKMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP+ REDUCTASE
publication title Probing the Role of Glutamic Acid 139 of Anabena Ferrodoxin-Nadp+ Reductase in the Interaction with Substrates
pubmed doi rcsb
source organism Nostoc sp. pcc7119
molecule tags Oxidoreductase
total genus 88
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2001-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1gr1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1gr1A02
3E1YE 3V76A 3ZC3A 3OJXA 4QFMA 1NDHA 1QGAA 1M1KD 3G6EB 4YAWA 1CQXA 3CPWB 1QVFB 3VNUA 1VQOB 2AHOA 4RD2A 1QFJA 4RD1A 1ELOA 1KK3A 3JQRA 1ZM4A 2PMDA 4C0SA 1Q86D 2QN6A 1QFYA 1H85A 4G1VA 3W2IA 3VNVA 2QA4B 2YWHA 4NBSA 4M4SA 5H59A 1BX1A 2C77A 4FN5A 4IW3B 4TMTA 1G7RA 1G7SA 2XEXA 1YITB 4RD3A 3ZZ0A 4B44A 3A1FA 2DCUA 3OW2B 1G7TA 2OTLB 3ZZUA 1VQNB 1H42A 4C43A 1TLLA 1FRNA 4RCZA 2C78A 1FNDA 2HDNB 5TY0A 3W5UA 3ZBUA 1IB0A 1VQMB 2NPFA 1QGZA 4Y9UA 1WDTA 2J7KA 4LBZA 3AGQA 5HXBA 2YWEA 3CCUB 4DQKA 1VQ6B 1K8AD 1BQEA 1I7PA 1G7CA 2BSAA 4PC1A 4PGOA 4ACBA 2E1RA 1A8PA 4YAUA 1B23P 2VYQA 1JJ2B 4P3YA 4N3GA 5EMNA 3CCVB 1OB2A 1VQKB 2VNHA 2D74A 3AVYA 1TVCA 2RC5A 1ZM3A 1GVHA 1EXMA 2X3UA 3CCJB 2PLFA 1KJZA 1S0UA 1N0VC 2BVNA 2QTZA 2QEXB 3AVTA 1GJRA 2DY1A 1F60A 1GR1A 3JQQA 1DDIA 3W2GA 3MCAA 4B3XA 4NCNA 4PC7A 1DARA 5KSWB 4BPRA 1QUFA 1VQPB 3LRXA 4ZCMA 3QFTA 1R5OA 4F7DA 4G1BA 3W2FA 3SJZA 1KK0A 2R6HA 4G5GA 5AN9A 1YJ9B 1AIPA 1UMKA 3QFCA 3FPKA 1K9MD 3MMPA 4N3NA 5DSZA 1KK2A 2GQFA 1R5BA 1W34A 1VQ7B 1EFCA 3OJWA 4B4DA 1U2RA 2QMUA 4WQMA 1QVGB 3U2QA 4RJLA 1Q82D 4TMZA 4H9GA 4ZCLA 1IJFA 3VMFA 3ZBTA 3B78A 3W2EA 4B47A 1ZM9A 3QSYA 4PC2A 4R71A 3CB4A 1BJKA 4HE5A 1IJEA 1BX0A 3QE2A 1S72B 3CMEB 1FNMA 3W5VA 3G4SB 1CNFA 3U6BA 4DQLA 3VO1A 1D1NA 5FA6A 1OGJA 1XB2A 2VNJA 1KQSB 3WBJA 1SKQA 1EWYA 2BN4A 2BPOA 1YIJB 2BGJA 1YI2B 1KC8D 4RD6A 3LO8A 4FWTA 3CCRB 1QUEA 1JB9A 3CCQB 4Y7CA 1JA0A 2VNIA 4P6VF 3G71B 5TR9A 3ZZTA 3I55B 1VQ5B 3VO2A 3P26A 3CCMB 4Q7JB 4RD0A 3WNBA 1GAQA 3WBKA 3W2HA 1DG1G 2QTLA 5GV8A 2OK7A 2OK8A 1CNEA 4TMVA 3CXCB 1N0UA 1JA1A 4RD4A 1N8RD 1QGYA 1K73D 2B7CA 3CCSB 2B5OA 3CCLB 2DETA 2BV3A 4RCYA 4TN1A 5H5JA 1KRHA 3CC2B 1GAWA 3I56B 1Q81D 1ZM2A 2BF4A 4B48A 2HCJB 2VZLA 3J81k 4YALA 1FNCA 4ZGNB 1TTTA 3FJOA 5THXA 3AVXA 4ZCIA 2HMAA 1M90D 2RC6A 2BM1A 1EP3B 2YWGA 2ZITA 1QG0A 1OGIA 4J0QA 3WYAA 3WNCA 4TMWA 2PIAA 3CD6B 3OZVA 4YAFA 1GO2A 1W2BB 2OTJB 1KTVA 3B8HA 4M1KA 1NJID 4QHYA 3B82A 2BM0A 3WNDA 1D8TA 4YHBA 2EFGA 2XNJA 3E20A 3OZUA 2XNCA 1XE1A 2CRVA 2BMWA 4PC3A 4ACAA 1OB5A 1QX4A 4UAJA 1KK1A 1EP2B 1W35A 1YJNB 1J9ZA 1E62A 3U6KA 1F20A 4AF6A 1VQ9B 3AVUA 3P27A 4LBYA 1W87A 3JQPA 1JNYA 4MYUA 2DEUA 4ZV4A 4PC6A 2VNKA 3ES9A 3LVBA 4U9UA 4LC0A 4ZGQB 3QFRA 4M53A 3WY9A 3CCEB 2BGIA 3MHPA 5JBQA 1E64A 4YAOA 1SM4A 3AVVA 3LYUA 1R5NA 1FDRA 5GV7A 4HE6A 4AF7A 3CW2A 3QFSA 3I1FA 1FNBA 4M0LA 1AMOA 4EH1A 4K1XA 1VQLB 1KD1D 1HA3A 4MYTA 2CNDA 1DDGA 3PENA 4M2LA 3AGPA 4Y9RA 2B7BA 2DERA 2QDXA 4B43A 3CMAB 2GPJA 1E63A 4LBVA 1VQ8B 1EFTA 1QH0A 1YHQB 4AC9A 1EFUA 1QFZA 2FX3A 4LBWA 5TV2A 1TUIA 1D2EA 2EIXA 4FK8A 1EP1B 3AVWA 1B2RA 2YWFA 3W5HA 1VQ4B 3CRZA 1FRQA 3CC7B 4TMXA 3CC4B 1YJWB 3OZWA 3WXMA 1Q7YD 1ZUNB
chains in the Genus database with same CATH superfamily
4PGGA 2R4UA 3IIMA 2D06A 4X6LA 1FUUA 1WP4A 2FWBA 3C1OA 2PLWA 2RGYA 3FCOA 1NVVR 4M98A 3B12A 1TQ8A 2EGHA 1UK8A 2FZKA 1NDHA 3AT1A 5B1HA 1QB7A 3H4VA 1VL2A 5DASA 3TQOA 2EVWX 1M74A 2Q0XA 3DBHA 3QU5A 2HWXA 3DE4X 1OAOA 2CL5A 1E5QA 1UT8A 1VOTA 4O8ZA 5EG5A 4C3UA 1YAJA 5CLJA 2VJLA 2H1IA 3V46A 1I5OA 4TMKA 4UHCA 4B3BA 4CKCA 3D7MA 2C97A 1QQ7A 4EYEA 5HKKD 3FPHA 1LX6A 1MGOA 1U9IA 3PC2A 4L5YA 4H3SA 4Z4CA 3AB3A 4TKOB 3UUWA 4C9BA 3L8FA 2OPBA 4MMZB 1BTOA 3M1IA 5B4UA 1KK3A 1EP9A 1T1IA 2XMZA 1MOPA 1MMFB 4M88A 4RM0A 5CAEB 1I3MA 2IBSA 2Q1SA 4RPGA 2GI4A 4ZYTA 4FKZA 2H4JA 1MAUA 3HAGA 3W77A 4ERNA 3AUUA 1ZGCA 1RXSA 2JGEA 3U62A 2JLUA 3P71T 1QYVA 5TF0A 1XDZA 4CUKA 1P61B 4HDMB 3G23A 2ZE5A 2VBUA 1HQCA 3F96A 2SECE 4QYWA 1Q20A 3GA0A 4D4LA 4OB8A 2A1IA 3VISA 3FGNA 1XTZA 2JGDB 1E98A 3GLKA 1PR3A 3NETA 3KWMA 4OX9Y 3OZIA 1Y1TA 1UPBA 1MAHA 1G9XA 4HDNB 1S02A 1RWVA 1RZ3A 1HUQA 1XEXB 2E4VA 3PNLA 4IL5A 3OM1A 4ITVA 3R1IA 5FWYB 3IAAA 2OCXA 2NNWB 4HQKA 1AURA 4UM9D 2IE8A 4F5ZA 4IP0A 4TKVB 5EMMA 5JJ5A 1F5NA 2QJOA 3JTEA 3IR6A 4XAQA 4Z9BA 4KQ6A 2XMSA 1XYGA 2XA2A 5TF4A 3NXSA 2XV1A 1TRHA 4AM8A 3ZVKA 3PNPA 4TXNA 1GGNA 3OTGA 2OV8A 1T6XA 1RT9A 4ZTUB 4URVR 1WL8A 4F1WA 3EEIA 1A8SA 3IULA 4RMIA 1FRNA 1SBTA 3PVCA 1BCSA 5KZMB 4RH0A 5LKAA 1CUXA 2PKQP 4BE7B 3QNWA 5A4AA 1M0EA 3ETJA 2ZVDA 1BGWA 2MSWA 1B6SA 1M6EX 3QPUA 4AYWA 4CCYB 5CGZA 4NU6A 3Q2KA 3NHPA 4ZVUA 1I30A 3T7DA 3D8HA 5DHTA 1WDTA 1KH3A 1OZFA 3FSEA 4O1IA 5DSXA 1O9GA 4WZAA 1EFAA 3A1TA 3AF6A 4X61A 4G7XA 5E2IA 3RFVA 2EDAA 3EG5A 2VFAA 1NVAA 1CQIA 1SUPA 2P68A 3IL2A 4LHYA 3NTRA 1IDOA 4OATA 2NT4A 2ERCA 4JX9A 3PPIA 5LOVF 4HDSA 4QPNA 2BT4A 4C4YA 1E3WA 2ZI9A 4GOND 4WFIA 1Q83A 2XA1A 4UZSA 1M6VA 2X1MA 3L6OO 1M1YB 1T5OA 4ZEWA 3VR4A 4C6TA 3BM5A 3KTAA 5F23A 3CWZA 4HVLA 2C9YA 3FBTA 4LG1A 3NIFB 1X70A 4QPCA 4REOA 1VP3A 4N3GA 4NP6A 3ZUPA 1XR3A 4TTQA 4U7GA 2VTDA 5CLGA 1PWXA 5AJXA 3U4DA 3Q7PA 2D0DA 4JGGA 3URKA 5H4GA 1QTIA 1H1LA 3AVYA 1SBYA 3AW8A 3KJHA 4O08A 5KX5B 2VRCA 4TKLA 1X8XA 5HS4A 3JR3A 1JLLA 3IUQA 4KPUB 3X1XA 4MK4A 1MZVA 3QWAA 1FYDA 4CZ2A 3G5MA 3FROA 4URHA 5ALQA 3FPPA 3QKIA 1SXPA 2ZT5A 4G63A 2I3BA 1N0VC 3OCJA 4LTMA 5C8XA 3QUAA 4EJSB 4HN2A 4PX2A 2Q3FA 2E4YA 5J4HA 1EA7A 2QE6A 1D4ZA 4BU0A 5HZBA 3LVQE 4S24A 3BGDA 3WNZA 2Q3HA 3F4LA 1ZH6A 2WABA 1U28C 4PLWA 4ZZIA 4NCNA 2D62A 3ONDA 5JXHA 3HO1A 5KSWB 2DT5A 3QNMA 4O4LA 4AJLA 5DOVA 2W4MA 4DF3A 4DIMA 1LU9A 5DYGA 5J58A 5LQCA 3K70B 5FO0A 5JCJA 1RPJA 1RTKA 4NPCA 3UOGA 1DC4A 2ZFUA 2UUBB 2OXIA 3DLIA 2RDMA 3OHPA 3NZEA 1EGMB 3OIWA 3RASA 1ZAYA 1NRJB 4OQFA 2AT1A 3OCWA 4J1QA 4EG1A 4YT8A 3RE1A 4F6RA 3C3YA 1QTQA 3UJ9A 3ROEA 1ESZA 3AB8A 3EYWA 4D80A 1A5ZA 3GSIA 4QPJC 3VDQA 2WF6A 1STOA 3U4HA 3B36A 3K6KA 2ZR0A 1U0HC 4JN6B 2J9XB 3QFCA 1J8DA 1GNPA 2BAGA 2EG5A 1E92A 2I4NA 1E9RA 3KL9A 4K6OA 3ER9A 4N3NA 5DSZA 1H1TA 2FAXA 2FOIA 1Y3FE 2FPSA 2JCGA 1ICIA 3JASB 3MQ2A 3PBKA 3OPQA 4LC9A 3BXEA 3VJMA 2X0NA 3C48A 4WD3A 2JFFA 4F4UA 4Q6WA 4A92A 3LK6A 1X38A 2Y2VA 4YONB 4PQRA 4ROXA 2OOKA 3AG5A 2A5GA 2NYVA 1C1XB 1XNHA 4E5SA 3ICOA 1T8RA 2CLFB 2XMRA 4XIFA 3TFWA 3TZLA 3G8CA 1B1CA 2YVKA 2QMZA 2GUWA 2A2ZA 1IEVA 2CJPA 4EO4A 2DQ4A 4Z9AA 4QX6A 4YN3A 4IIGA 1OILA 2PZ8A 2VYVA 5BNWA 3H5LA 3L8CA 3VDXA 2WTBA 5FOQA 1I0LA 1PYGA 3S8MA 4C07A 1MIOA 1OLOA 3KB6A 3QEBZ 4QTYA 4M9UA 1VJ5A 4AI6A 3SYLA 2HRDA 2V54A 4ZGBA 4K0KB 2GJRA 2ZDHA 3EN0A 4RK0A 1W5AA 2X9VA 4LN1A 2CB9A 3I28A 2ZJ6A 4M54A 3P5BA 4G0MA 5H3HA 2B4YA 1RR6A 1WB9A 2RIRA 2RGUA 3GJ0A 5JROA 4PFJA 1ZGZA 4V0QA 2ZB2A 5M34A 4EI9A 2F9LA 5CHEA 4L08A 5EMLA 3FHTA 2BEWB 4WZTA 1C0PA 4E0FA 4TYPA 1N7IA 1M2FA 3FPFA 4JLJA 5E6SA 3K09A 5DN9A 3H3XA 4A0QA 3B3QA 3H9QA 3SHWA 4K87A 3W6ZA 2J9FB 2OCGA 1FJ2A 2CBGA 2ZKLA 1VPLA 3CEAA 1W44A 3NIBA 4OJKA 2IEZA 2ZUSA 1I4TD 1ZUHA 3VH4A 4YAEA 3X1YA 3B51X 1Z4LA 1DG3A 2MYNA 3OIGA 5IKXA 1HNXB 4O1HA 4KXXA 5E2BA 1V39A 3K8QA 4KQHA 2P0EA 3KT6A 3MTQA 1XEWX 4HATA 1ZN9A 4NAUA 4B40A 1NZDA 1RRPA 2HSZA 3MJEA 3PUNA 2ZJ8A 4HZUB 1JQDA 3Q12A 3SNKA 2UXDB 2XMGA 3MAGA 3PIRA 5TEWA 3RTEA 1M34A 5C1BA 5KQGA 3UY4A 2AG8A 4TZ0A 4NZ9A 4A23A 1QYXA 4ZK2A 3V2IA 2G4LA 1C7EA 2XGOA 2PBLA 4P4GA 2J3EA 2PL9A 2QY9A 3PNBA 1EE2A 3HEBA 3BEDA 4IUDS 3CE6A 3PJDA 2PCJA 3BTSA 2F62A 3Q6IA 1F06A 4I14A 2O8CA 1T9HA 2ODWA 4O4JB 4F71A 1UM8A 1RXYA 4F04A 1NL3A 4DA8A 3A6HA 4P4LA 5BSVA 4EG6A 1CUZA 1M33A 1WOMA 1WDWB 3WLIA 2WTNA 2QVYX 4HLDA 2FVXA 5GIPE 5AMXA 5KNBD 3CCMB 1KO7A 4TKMA 1VJSA 3DPSA 3CH7A 3L41A 4PVDA 5HCNA 3ZVLA 5M29A 1X1DA 1ZH0A 1F9AA 3NO4A 2ZBGA 3GLTA 3NR2A 4JXJA 4K40A 4Q5IA 1WW2A 1P39A 2RAFA 2GYUA 3KKQA 1U0SY 2YHIB 3IV6A 1WOPA 2PSHA 4Z0HO 2Z2IA 4GW3A 3RLFA 4C0HA 4LX8A 1E7SA 2QR3A 3DL2A 1Z2NX 5FL3A 4WKNA 5DI3A 3OQ1A 1NDQA 4U6NA 4ZYWA 3RSOA 2NACA 4K6FA 4LYJA 4OOSA 1I9CA 4DR1B 4ZT5A 3L04A 3KXLA 2P7IA 1EBBA 4FW8A 1LDYA 1YKSA 3R3SA 4O59O 1EGHA 1OKKA 2Y6UA 4FNAA 4OP2A 1F38A 1OAKA 1UH5A 4JU9A 5TEVA 5DF1A 1Z0KA 3R0JA 1IY8A 4U7DA 3CT4A 1U8AA 2O7QA 4HBZA 5IC4A 4E3ZA 1N6NA 1TQHA 1P7PA 2CFSA 2PVCA 2VZ0A 4I2VA 3EVEA 5AHKA 5A05A 3BF8A 4HLUC 4RPLA 2B5OA 3E3AA 5EJ9A 1EX9A 2GR9A 2ZUCA 4YI5A 2WYVA 3GJ4A 3IJPA 3VPSA 3PZBA 5K3AA 1DLIA 4YDRA 2HDOA 1BDBA 1E4OA 2FNAA 3BJIC 1SCUA 3FNQA 4I50F 2EARA 2ZCVA 2IV2X 3E03A 3L4KA 2X0JA 1DRKA 4PYIA 1N8KA 1X6VA 5BQPA 3C87A 3OIDA 2OO3A 5IAAA 4B09A 2PWYA 2VZLA 5CXSA 2WP0A 1SA0A 1Z8DA 3EA4A 3MAAC 4ZO7A 1TF2A 2G28A 3ESBA 1JU3A 4ESVA 4KNVA 2OG2A 1NV9A 3PDHA 1CW2B 2WIDA 3DOJA 3QF4A 2AOTA 4ZQHA 3ZWMA 4QGGA 1YI1A 2R48A 2WWTA 3A35A 1H2XA 2LKCA 4ZVQA 5EFOA 2FR1A 2I1WA 5AJTA 3ZZNA 4KXNA 4NYMQ 2Y1LA 5KVVA 4UTOA 4NZMA 5IVPA 1V1RB 1PVOA 1DAIA 4YUZA 4RENA 4C76A 1YOBA 4BX2A 4FXOA 3LCVB 2FDXA 4NEHB 3KWLA 4FHZA 4J0QA 1T2CA 3UH0A 4WINA 4BQRA 1I1HA 2BGNA 2NYRA 4ZDKA 3F47A 4BNTA 3CD6B 1KEUA 3AFNA 1NKVA 1RMQA 3E1SA 1GCUA 2A59A 1Q0HA 1WCV1 3AMVA 3K0CC 3L02A 1R50A 2W2NA 3GG2A 3MJRA 3E9MA 4CETA 4GU5A 3BB4A 5BOSA 5LVAA 1OIXA 4KAJA 4C0WA 2XTAA 4UVDA 3B8HA 1FFGA 2CMKA 2OD9A 3ZY2A 1KIMA 2ILTA 5JECA 3MGGA 1DQRA 5GJVC 2WAAA 121PA 3UT5B 2WU0A 4JJ7A 2J85A 5K0TA 3CLUD 4OI4A 4IDCA 2RD2A 4JKYA 1ZK1A 1NZFA 3U4MA 4GS5A 3U40A 2IT1A 3GJ7A 2AXQA 1DAFA 3GEMA 1SUBA 3TX2A 2BMFA 3V1LA 1FB5A 1UC5B 3OVMA 4HFMA 4PNHA 1J33A 4D7AA 3BIWA 1G41A 3NTVA 3F6CA 4KIWA 2R60A 5HE9A 5EIOA 4Q16A 2Z0MA 1OCEA 2P9FA 4FHDA 5FYQA 1FTSA 2W9XA 1KK1A 1VHEA 2ZB8A 4RHEA 3LQ6A 2VHUA 1AX9A 4BO6A 5MHTA 1HEIA 1SQ0A 1YZGA 4AYXA 1ZI9A 2TSYB 1WTCA 1I4WA 1K2VN 4MRAA 4B0OA 1S01A 5F9FA 4P9NA 2AJTA 2YJTD 3O94A 3BFVA 1QOPB 5DTMA 3H8JA 3SBEA 2VPQA 1Y5IA 2QVZX 1T4BA 5CEJA 5KOYA 1H6DA 5AKXA 4FJ0A 1Q21A 1BQ4A 2Z5GA 4DDWA 5CDSA 1ZN2A 3ZPNA 2JD0A 3B48A 2TS1A 2P8SA 3IAXA 3X2FA 1IOWA 1EAMA 4EHKA 1PFGA 4UM9B 2GEBA 3BK7A 3DBLA 4NSNA 4OB7A 3F0TA 1EK1A 4GC9A 4O4HF 3H99A 4TQAA 4E1AA 1ODSA 1L4EA 4HTFB 4FDLA 2IOFA 3H17A 2AYYA 2BRUA 3IT0A 5HQJA 4F2WA 4US1R 4XD2A 2E21A 4LJKA 5IKPA 4DHEA 2A0FA 3KCQA 2PS0A 2WJHA 5JMWA 3CN9A 1EK6A 3IR7A 1GN9A 1P7VA 3FTCA 4Q7QA 1JMYA 1DMRA 1N6HA 4XSVA 4OFZA 1H3EA 2VSXA 4PAMA 3SVTA 1KQPA 1RCFA 2C2OA 5JD5A 1B8NA 5GV7A 4Q1VA 4X8LA 2ASEA 5FX2A 2Z57A 3FDXA 3KQTA 3TGWA 4L3OA 2ORYA 1EEXB 2BKUA 4MXDA 2AB0A 3DT8A 2XRFA 3TNYA 3S8YA 2P6UA 4RETA 1FNBA 2X8JA 4EY4A 2QM0A 1YHYA 4KK4A 4EA6A 1NW7A 2EKBA 2Z8ZA 5I7RA 2Z30A 1TU0A 4PHHA 4XQCA 1TA0A 2YIMA 16PKA 1ISPA 2ZYSA 1JHPA 3B9RA 1W1UA 3HDJA 3NBYC 5FF9A 4Z1MD 3LF1A 3OW7A 4KDRA 4Q1CA 1KVRA 1YCGA 821PA 2YFKA 3HUTA 4BC1A 3EXHB 4AMZA 4FC6A 3TINA 4NF2A 5L6MB 1TQ6A 3A6GA 2OILA 4JQCA 3P45A 3ADDA 1E63A 1PFQA 3OFJA 4QVKA 3R9KA 3WC4A 1GPUA 2V7TA 2ETXA 2PYDA 4DWOA 4CGYA 1BFKA 5AP9A 4BJ5A 4DVGA 3PUJA 4J2HA 1GGFA 5ITSA 3KK0A 5MFZA 1K8ZB 1JLSA 1L7NA 2FPXA 4AD8A 3M82A 4PSKA 4QXMA 5JRDS 3QVLA 1U6JA 2NSYA 1XQVA 1FSSA 4BQNA 1XLTC 1I6KA 4P7GA 4IJVA 2IZZA 2B25A 3DW1X 3KAPA 5DPMA 1FRQA 4ZJUA 1NJ8A 3PEYA 5G40A 4IFIA 1I51A 4LYGA 2OXTA 5JYDA 1BEUB 1MVNA 4F3YA 4YRJA 4DWWA 1L7OA 4HEJA 5COBA 3OZWA 1DZ3A 5J2TF 3UJBA 5EJ8A 1PT8A 4ZT2A 4TM7A 2WU8A 3CF6R 1UDBA 1GPYA 4MULA 4N9QA 3AXSA 4PE5B 4EJSA 2P8JA 4XWAA 1WD5A 3G2HA 2Q28A 3ICPA 3K32A 1SAYA 4C4AA 3O2NA 3A9TA 3WLLA 4QEDA 1HKUA 4QFMA 1JG7A 2W37A 5SY4A 3PGA1 3G13A 2UUCB 3EPKA 3BMQA 4IHJF 3R5TA 4D8XA 2UYYA 1HE4A 1JIVA 2YJZA 3PF9A 3TTTA 2IU0A 5EMKA 4MP3A 3IB6A 2CL6X 4QHTA 4ENPA 2ZW9A 1UAAA 4O4IA 4LZLA 4RM3A 4YHHB 4NQRA 4LVCA 3CN7A 5C18A 2YZ2A 3IT1A 3IV7A 3KBOA 1WSWA 4IF6A 1E9AA 3THYB 3WK9A 4RD1A 1H2HA 1NX9A 2IZ7A 2GQ0A 1GSAA 3KYJB 1JIUA 1K6IA 2A94A 5CDHA 4U2KA 5A0TA 1SQ5A 1ZM4A 2ZUUA 4D2IA 3FYHA 5CLIA 5DV9A 2NU6B 2VWPA 3R3UA 5B4TA 3EIHA 3THXB 1GAXA 3KE8A 4ZVTA 3DKKA 2FPKA 2VAXA 2VA8A 3UCFA 2JB9A 3NHUA 4C3OB 3INGA 4WI1A 5KYYA 1GWNA 2W2PA 1H6AA 3VZSA 2O8BA 1Z0JA 3KQQA 3P7MA 1XCPA 3C8ZA 3TECE 1BA2A 1YWGO 2BUCA 3KR9A 1OX4B 3AEQB 3KD3A 5D01A 5B1EA 3VAZA 2BR4A 5IC6A 3ZWDA 1KRXA 4TLEA 1NFFA 3B3JA 3HLTA 1JFTA 1EI9A 2QX4A 1KY5A 2PSFA 3EWSA 3HN2A 3JQAB 4RA6B 1X1QA 4RD3A 4QBFA 3OX2A 4E6EA 4X7PA 3TB6A 1Q84A 3DQQA 4EJFA 2PNFA 3P96A 3HCOA 5AQEA 4EPVA 5T6MA 2C1ZA 4BXOA 4ZGGA 1G7TA 3H2JA 4D9KA 2NPIA 2UKDA 4UEOA 1THTA 5DNCA 2VDRB 3LQ2A 1ZOIA 1M2HA 1ZIPA 3H9EO 4HQ6A 4B7CA 3HPRA 3OEED 1GTRA 2EZ9A 2IYAA 2NXJA 2Y9PB 1K7SN 3JQFC 5D86A 4BFSA 4JUAA 3JD3A 2HJRA 2QRZA 2C2MA 1CETA 1RC0A 2OV3A 3LHSA 4UHHA 3SU8A 3TJRA 1B6TA 5FAXA 5TY0A 3X44A 1POWA 1U4SA 5EJAA 1OT3A 5E4TA 2H85A 4WK4B 1HF3A 5CHYA 4ZPJA 4CODB 2DWUA 3SEZA 5HX7A 3P9CA 1UR5A 1U4NA 4EW1A 5TJHA 2PY6A 2XR1A 4JP2A 2IWRA 3J80A 3DNPA 4KMSA 3QITA 1YACA 3IUNA 4KXQA 4UHDA 4OAOA 5IZ4A 1RW4A 4A7PA 2G17A 2BE9A 3DP7A 3S29A 2EJTA 5ARBA 1FP4B 4GNKA 1G98A 4HDCA 2EHJA 3DTVD 1NBHA 3K9WA 4Q1AA 4EBBA 4AWAA 6CHYA 1K6JA 4J1SA 3W8DA 5B55A 3KT0A 4K9QA 2J3QA 1RPNA 3WL4A 4DDMA 3OIVA 2JEZA 4O2AF 1H05A 3ASTA 3I5XA 2J08A 2ZIWB 4M7RA 3ZJVA 3PWSA 4V03A 2CKMA 5BOVA 4W5HA 5TT1A 4PZLA 1N8NA 4YRBA 3V4PB 1XDWA 5FD8A 3RUIA 1G8SA 4FNOA 1FQKA 3RJ9A 1CUYA 3RRXA 3KELA 4FILA 1K63A 2FDCA 5A0VA 1XP8A 5BORA 3RIGA 3SMQA 4EFDA 3LWZA 2GHQA 1JALA 1SU6A 4G6ZA 4UEWA 1RLTA 3FUWA 4JJKA 4XARA 5HJ2A 2Q6IA 3OM0A 5FUWA 1ODTC 1VJCA 1ZOSA 5AM3A 2KBEA 1OA1A 2OHFA 1TQ4A 1S4MA 2RHWA 4K9RA 1JZQA 1FSPA 3AJAA 4LDAA 1GR1A 1GZVA 2XUKA 3LE8A 1BXRA 4HUTA 1K98A 3K6RA 5COAA 4YASA 1PS9A 3MC1A 3WLQA 1WUIS 4PRLA 5DHUA 3MW8A 1VGRA 4HAWA 3E2IA 3K09C 4E13A 1J8YF 1ST2A 1XPRA 1I2DA 2WWXA 3HJRA 5CIWA 5L95A 4N48A 1Z35A 1D2GA 3HP1A 1V7ZA 4NZNA 2QSJA 1PVVA 1S2LA 3A4LA 5AKLA 3F46A 3VKUA 4EATA 3VYWA 4KVAA 1QAMA 1Z4OA 1PR0A 3HACA 4OHOA 1D5CA 1KK0A 3P0IA 2IEIA 2IYZA 4OQZA 4MWGA 5IT5A 4LUCA 4ZO4A 3NCHA 1UZNA 1WKVA 3O9VA 4RJKA 3R75A 3I5YA 3FNHA 4MV5A 1TT7A 1ZGJA 5DNEA 4DB2A 4E88A 3SMVA 4BB9A 1Y8RA 3OZEA 4GVPA 4XTCS 4GC5A 1K9MD 5B7NA 2G5GX 4O5OA 3UB2A 4CMHA 2D2VA 1R10A 2DFVA 3A4MA 5DHRA 4UAUA 4BB0A 2IXGA 3VVBA 1K7YA 5K0JA 2YWCA 5AM1A 2WIFA 2B1IA 4NU5A 4O6VA 2CFCA 5FOWA 1AMNA 4F12A 5HJ5A 3P0JA 5C34B 2PX8A 3FFXA 2CXXA 4BUJA 5SZJA 3EW9A 4UBNA 4RJLA 2QJRA 13PKA 1BD3A 1FLVA 2QENA 2WF5A 4MW7A 3QLVA 2JBHA 1J1UA 1YRAA 4R0VA 5DXAA 3RFXA 5K99A 1PWEA 1ZMBA 2RGGA 2KJQA 3MWDA 1IMOA 1QRDA 1KVSA 1W88A 4RDHA 2O2ZA 4X6XA 2D13A 3VPCA 4PN3A 5A9SB 3E8SA 2AFVA 3A8TA 3IA2A 3LBFA 1XWFA 5KC9A 2WV9A 3KXDA 4I81A 3UMMA 2OXRA 3ZU4A 1MOQA 1RI1A 5EXDA 3K2EA 1XTQA 1IM5A 4W9NC 3MTDA 5FTMA 2C88A 2PFSA 1QMPA 2IYYA 1T2FA 2MYUA 3BBLA 3ZNQA 5E2AA 2I80A 2ZGVA 2EWVA 1J56A 1IEXA 2P2ZA 4C03A 1JLKA 1TT5A 2PV0A 2PZAA 5A0FA 3WIVA 2PMKA 3JZFA 3SQMA 3GFSA 4LY9A 2XYGA 1ZD1A 4AAYA 4KREA 2SCUA 2R1VB 2XXBA 2RG1A 1XA4A 1PT9A 3MLEA 3I23A 4QRIA 1PT7A 1UP7A 4OFBA 4PG6A 3RVRA 1OV6A 1NI4A 3R3YA 5DDIP 1YDGA 5GTDA 2Q3CA 4GIBA 3B38A 2WQ7A 3VU0A 5JC1A 3ZHBA 3I01M 3RAEC 1O4WA 3OPXA 1F6BA 1KDOA 2NO7A 2JA2A 4YDHB 4CM8A 5DSTA 2C9CA 2JGKA 3FB1A 3S2UA 4WJZA 1QKJA 3KR2A 1F2TB 1LC0A 1MO5A 3NM4A 3OT5A 3QU9A 4G67A 4P3OA 2V1UA 3IUMA 4Y0VA 3FSGA 3GCZA 4JLSA 4GBGA 2QYTA 3IJRA 5IJAA 3GJ6A 3TKLA 5JYEA 3ZDZB 2RMKA 4FSDA 4KMRA 1ZMTA 5SY6A 2FMFA 3K05A 3L46A 3RD5A 4G1UC 1G5PA 5FADA 1KVTA 2D5BA 1U2SA 2NO9A 4FR0A 1CUGA 1KR5A 2I66A 1F8XA 1NDUA 2QGFA 3L07A 5F4OA 5G0SA 5HM8A 3ESAA 4Q4AA 1JB9A 1L4UA 1CUDA 4RL6A 5ARDA 3FFAA 1MG0A 2J8ZA 1YQQA 1R2QA 4LHVA 1QGUA 3QVUA 3ZQ6A 3ZV6A 3BCUA 4E11A 4FMBB 4Z53A 3OCXA 4OJNA 3FHJA 1BAPA 3WNQA 4P5PA 1PL7A 4DG9A 3C8MA 1E6CA 4A2QA 5B36A 1UODA 3BN3A 1O0SA 5CBKA 2Q5IA 4FT2A 4MWTA 4N5LA 4ZQIA 2XHZA 3KSUA 1U2QA 4ND8B 3G7UA 4YCCA 5LLDA 4HWSA 2C7OA 3M8KA 1K06A 4BWYA 4FGSA 4Q34A 3SBOA 4G8JA 3LBIA 3ILHA 1N0HA 5CFZA 3KQKA 2JLCA 1I36A 3DUWA 1ZK2A 4OHRA 1NF3A 1NR5A 3W4IA 2B82A 4S1NA 1BN7A 4EYQA 1K3FA 2Q3DA 3AR5A 2VXCA 5HIKA 3K1TA 2J46A 5ALJA 2BFPA 5EQTA 1WF6A 4RZHA 2CDNA 3R5FA 4JH0A 1R0XA 3OH8A 2EFHB 3DULA 4QJ5A 1N2HA 2JJ1D 2W58A 2X58A 4JT8A 4QULA 2WY2D 3BBPA 4ABYA 1N6LA 4FBLA 3ZZ1A 4HH4A 4M22A 1IPFA 5DW0A 5B3JC 1RMYA 4RF3A 8OHMA 2QG9A 4O33A 2ALJA 1XEWY 2OZLA 3AM5A 1YR7A 3IDQA 2PRYA 1Q3HA 2ZJBA 3HYSA 1PG5A 1X0VA 2FLVA 1KOGA 1MENA 3RVSA 3DAOA 1E3DA 3BIJA 1NBEA 3DXYA 5K0NA 3DD1A 4LKRA 5C7OO 2EBWA 4MUMA 4BVJA 4OHMA 5AESA 4ZO9A 1CZHA 2OHIA 4Q7EA 5BYBA 2I3AA 2NXWA 2GYVA 3ANYB 2FEAA 2Z4TA 3TD9A 3WZMA 1HX7A 5LU9A 4P5DA 4DSUA 4UAVA 4B48A 3BTVA 3V8BA 4Q24A 4P9SA 2QOEA 3ESZA 5T4BA 4DUGA 1GZHB 5H80A 4BASA 3RS7A 2DFDA 1CVRA 4L07A 1E2KA 1PKXA 4YALA 1FNCA 3BHNA 3BKXA 2R6ZA 3D6UA 3ZU6A 1U3TA 4DLBA 1IAQA 2XGSA 3ZJTA 2VK2A 2DGDA 3IQFA 1E79A 4CDNA 5DNYB 3SJPA 4WVLA 2IXAA 3JQ9C 4EHIA 4HGOA 1RKQA 5D87A 3BFXA 1IN1A 5J63A 5LYJA 1IHOA 1U7PA 1W46A 3F5FA 1H8EA 4ZI7F 4FFMA 2WD8A 1JYEA 4QJIA 3VH1A 3TW8B 1LSSA 4OYYA 5DVZA 1VF7A 3EF3A 4BCDA 2FMXA 1T10A 3KKNA 1YQDA 3THOA 3TOVA 3GVXA 1NRXA 4YJFA 2EYUA 2F4NA 3Q98A 1UM9A 2F43A 1ZAKA 3R4CA 3VNAA 2AJBA 1OPRA 1FX0B 2W0SA 2Q6OA 1HZZC 3RFUA 3RUAA 4PYMA 4G7WA 1FXSA 1ZLXA 2Q5CA 3BXOA 1L5GB 2WHPB 2ZDGA 4QHYA 1BE8A 1HE3A 4KEAA 2E49A 1WQ4A 2BM0A 1YV9A 2HPAA 1SXHA 4OK3A 3OCZA 4OU5A 1RLUA 1H3FA 4MUBA 1LLFA 3QFFA 3EQ2A 4ZVMA 2XUJA 2XXAA 2AI1A 1TU3A 2VAPA 1KWGA 4YHBA 2BP7B 2MSKA 1THZA 4BTVA 4CMIA 3KOXA 1SBZA 2K7ZA 2IZ6A 2JHAA 3IO5A 3OPNA 4LV5B 4P80A 3TOZA 1F0PA 4XRGA 2W4QA 2J3JA 4O0LA 1SRRA 1U3GA 5LP6F 4RK4A 1QGED 1PL8A 3FPSA 2B34A 3H2GA 3HWWA 1ZEMA 4AJJA 3ZQJA 1AJEA 3IOBA 1K9SA 3FDIA 5F35A 1LRLA 3H04A 5EYPA 2R7MA 1K66A 4X6UA 2NUPA 4QXAA 2EEZA 1L1RA 1M6HA 4A8JA 1KDRA 2WM2A 3B7PA 1PJCA 4RHYA 2PE5A 1CFZA 3CG4A 4PPQA 4Y30A 4ARVA 1KJYA 3AXTA 3NWOA 2IIBA 3SOZA 2FSVA 1UBNA 3PD1A 4KBYA 3M5DA 5FI5A 3ZBPA 3E9QA 4AQYB 4FOOA 1NQTA 1UZLA 2AK2A 4N9WA 4H7IA 2V7BA 1ORIA 3PR2B 3MWFA 1A71A 3ILSA 2RGRA 4CFSA 2KE5A 2PZLA 1XE3A 3MTIA 1TJ4A 1W1IA 4I2NA 3NAGA 2HA6A 2VJDA 4M53A 5BQ3A 1K8XB 3FSRA 1ZBQA 2NTYC 4I36A 3RTGA 2C2XA 2CBXA 4M6WA 4WKGA 2BGIA 2JGRA 3OCCA 2Q0SA 1KVUA 1RFLA 1VDZA 2Y1FA 4ZT3A 2HV8A 4X1OA 1VA4A 1EUDB 1CY8A 4NCXA 3DO8A 4WH0A 2A3NA 4AVZA 1KP9A 2QT1A 3QEMB 1FSFA 1H0KA 1L7AA 2VT7A 3OA0A 4CKWB 3QYJA 5C5CA 4E5VA 3JU4A 2P2GA 2XY4A 1MPTA 2W6CX 4QPZA 2R68A 4GM4A 3L0ZA 3OX4A 5DGTA 4K9NA 1AMOA 2Y93A 3L4BA 3EK2A 4IH9A 3Q3GE 1W4BA 2VJOA 4R2HA 4PIPA 3F78A 4ADSG 4AJ2A 2RBEA 4BLQA 3LQKA 4RK5A 4CMGA 3RNLA 2PUCA 2NUAA 2X2FA 3DTVB 4JJFA 3K92A 3VZBA 3VHXB 1KJ9A 2C0QA 4GPEA 4ZV7A 3SSMA 3NIWA 3VSDA 4XD7A 3W04A 2JATA 3ZHOA 2V59A 1MFPA 5I7VA 4D0SA 5BRNA 5EVCA 2IW1A 4ZYUA 1Q0ZA 2JGNA 1PK8A 2Q0QA 2QMEA 2YCBA 2OAGA 4KW7A 4QUKA 1H66A 1YNOA 4DMGA 6REQA 4DLTA 2H11A 3E22A 1QFZA 1KI6B 4KQ1A 3HCPA 3ZOZA 4KN6A 3UHOA 3VZRA 2KI5A 2QUHA 1X7ZB 2PT9A 1NG1A 4LHWA 3ZDXB 4B3FX 4KPYA 4MPPA 2L69A 3AVWA 1B2RA 1QH8B 2IYXA 1Q12A 1Q2UA 1ZISA 3NHSA 4ENTA 3U44B 4AY6A 4R5MA 1E5DA 4ZI3A 3NNNA 4Z9YA 3FZGA 1JSCA 3DZ8A 5FJIA 3HG7A 2PKEA 2FF7A 4JXZA 3TX6A 3I6YA 2GS9A 3IRVA 3KZCA 5A06A 1WOSA 4B3MB 4ND6A 2PUWA 1L6IA 1PSZA 2YJ4A 3BOSA 2HSGA 4WPGA 3F90A 4K26A 5FQOA 4YO7A 1L8LA 3MELA 4KGDA 2I54A 2XLCA 3FUTA 4RF2A 4UXJA 3O8NA 5KWEA 3FDZA 4XM0A 1VMAA 4B4UA 2BZGA 3G0CA 3K6SB 2RKOA 1DOAA 1N4AA 5JQWA 4AICA 5K0CA 2BFCB 4IDQA 2IZ0A 3CEHA 3HEMA 3HV0A 3LPAA 5F2KA 3UHPA 1NJFA 1JSRA 1MHPA 4FGKA 5JG7A 1QVFB 5CK4A 5L7YA 4DBLC 4DV2B 2YFHA 1JJBA 4E7OA 5BVGB 4N5DA 5IN4A 3CNQS 2DXIA 2Y4NA 2EJUA 5LDHA 2ZVQX 3GFRA 1TGYA 3LQEA 1MH1A 3FTDA 3WK5A 2B7LA 4CM5A 1E1QD 4M83A 5C1IA 1SVNA 3I61A 3QMPA 4TV9B 2NU8A 3DHVA 4PQYA 3L4JA 3GNLA 3X3HA 1AZSC 3ITEA 3HP7A 4V3BA 5JXIA 3BMOA 4FZJA 1SHKA 2MINB 3H0CA 3PR1A 3SQLA 4Z4SA 3CVYA 1SY7A 2ATCA 5AI5A 3AERA 4OU4A 5AKEA 3BK2A 1I94B 1PO7A 1DBSA 4RIGA 2F00A 2DHQA 4MYHA 1SVUA 2ILVA 2BI4A 2JRLA 1K75A 5G1NA 4CCWA 4XKVA 4YAGA 4DPKA 3A3PA 3H19A 5GP1A 4WL0A 2ODBA 3E9NA 3EIUA 4HFJA 3DVLA 4KFRA 4L72A 4P4UA 5KW9A 1D04A 3I58A 4Q4LA 5F3RA 4F4HA 1UDAA 1E2LA 1N08A 4G0YA 2OGSA 1KETA 1W30A 2BZSA 5EIEA 5IDQA 5KWVA 3QV2A 4ZN6A 3A3KA 4UTRA 3FG9A 3NJ4A 3HWX1 4RSHA 4GVLA 1ZJ4A 2OM2A 2ZYAA 4HX9A 2DKFA 4KMMA 4KMOA 5U4QA 3SKXA 4RADA 3IIIA 1O94C 4C7BA 2WSSA 1U0EA 1MH9A 2BBWA 3JX9A 3V80A 4WZAE 4B4WA 3U1BA 3U9SA 4P1VA 3BDIA 2GCPA 2R8EA 2YH2A 4OHUA 2F8MA 3R8CA 3SXUA 3EFBA 5CTJA 2JN9A 1CDDA 5C0OE 4G5YA 2JCXA 1JLMA 4QZVA 5EWMB 4RXUA 4L4SA 3JALA 2QM3A 1RADA 4IG9A 3BF7A 3RIMA 4DT1A 4HNUA 2CK3A 4OYRA 4YJ3A 2P9TA 3D1LA 3T7AA 4ZOAA 3BT7A 3OA2A 3LF2A 4KBFA 3V8VA 1YXMA 2Z5FA 3DBOB 4FS8A 4BATA 5BPFA 1B41A 2F48A 1UD6A 2RK4A 5JWRA 5KJFA 3WGKA 1BVHA 4QVJA 5BUQA 1M54A 4M8SA 3OJ0A 1Z7BA 1A8IA 1K8AD 3R5KA 4LXGA 1WXDA 1YIOA 3OESA 1I7PA 4K6CA 4UE2A 2HLHA 3HJUA 4XQGA 3BJEA 3OP4A 5WRFA 4DC9A 5I9IA 1OLUA 3BXHA 4XQ0A 2CD7A 5FV4A 1G38A 2OO5A 5KOHA 3TI7A 3WJ7A 1Y6RA 4WKPA 3VBCA 3MRVA 1UK9A 4BKMA 2FXIA 5FFFA 5SZHB 1MEJA 1P73A 2TMDA 3HY6A 1X74A 4DV5B 3LQFA 3EWIA 1E7QA 4XOTA 3B1VA 2B4TO 4XYMA 1X7XA 4GVXA 2QJWA 2WD7B 4G4SO 4XR6A 3CSDA 2D74A 3D0OA 3N8GA 5ENVA 4JUBA 3UA3A 1R00A 3VR4D 4DWJA 1FW8A 4JFRA 5LQAA 3U7QB 5BSWA 2CXUA 5EEHA 3OT1B 4LSMA 5ED0A 2GARA 4H4DA 5KI6A 3U37A 3VVLA 4KHPB 1GUYA 4F91B 2ZPAA 2RK6A 5DULA 4M1WA 2ZI5A 3CURA 5HMMA 2ZSKA 2VPPA 3O0TA 1XL1A 3Q9SA 4IZOA 3BFKA 2QEXB 1IM2A 1P4RA 2VRCD 4DRXB 2BKVA 4FEYA 3RNOA 4UQOA 2FB9A 3GRYA 1JAZA 3CGGA 4V0KA 1AHNA 4W7IA 5K1ZA 3WJ2A 5A3VA 4E5NA 1N57A 3A9UA 4ETIA 4LOHA 4QDXA 3WYEA 4MX8A 4ARIA 2Q4EA 5LP6C 1DDIA 1XHEA 4Z49A 3MCAA 1QS0A 1XZCA 4OBEA 3CF0A 2JGFA 2VJMB 1Z7WA 1KJWA 2QTTA 3EH1A 1RQ2A 4FFBB 4HX2A 1C9MA 2PCLA 3TW6A 1E1RA 1CBUA 1YDFA 4RMJA 2RGCA 3LRXA 3ROXA 1N75A 3RODA 2NP6A 4DMHA 1D6SA 4IIHA 3ODGA 5E1MA 4ZZ2A 3OFKA 3TTSA 3VVMA 3HUDA 4BO8A 2CD9A 2NSHA 1GFZA 2X5XA 3GFGA 2DAPA 2N42A 2YQZA 4EPWA 2XBMA 2HK6A 3Q0EA 1PZFA 4ZVVA 4S2UA 4BVHA 5EZQA 2J30A 3FNIA 4TTRA 5K3SA 3C3DA 3WXBA 3MRSA 3N3AC 5TQVA 4IDOA 1J90A 5T8KA 3ZPXA 4B79A 1I2AA 3LLMA 2CUZA 2JLSA 1XI2A 3EXIB 5DX0A 4ZTBA 3GK3A 2RHMA 4TN5A 2GVDC 2LKDA 4WT7A 4UMVA 3BGWA 2OBYA 3HHPA 1EQ2A 1G5FA 4O2BB 4HC4A 1HWYA 3EQ9A 3ANLA 4C29A 1QIJA 2QNRA 2VBIA 3LT1A 1JIIA 1J00A 3GJXC 1TFUA 4TL7A 2HRBA 2Z3WA 3GJSA 3IEPA 1S8NA 4HHEA 4Y6SA 3KM0A 4YBZA 2PZJA 2HO5A 1TMOA 2I33A 1NX6A 1R4MB 3I1YA 4EKGA 1OVMA 3HSSA 1NZJA 3AOEC 5C5EA 2PG3A 2OBNA 5ITZB 3IV9A 2OYSA 2RSLA 3NRCA 5JCOC 3DQPA 4ALJA 5G0UA 1XVAA 4FJ2A 5JHHB 1ISIA 2ZR9A 5HE8A 4AN4A 3N7UA 4CM4A 3U1VA 2VF7A 4DABA 5JATA 3TNJA 2HWYA 3AFOA 3CZ9A 1GPLA 2M6SA 3PEFA 2RCYA 3W34A 4BMXA 1HORA 3PGKA 3OIUA 4OHKA 4ID9A 3D02A 4UKDA 4DMRA 4X7MA 1YJ5A 1JU9A 3QLUC 1M6NA 2YZ7A 1IHMA 1H0HA 2JC3A 3EXEA 4QXPA 2RK3A 1IJEA 3QVKA 1K8RA 2OCYC 1PDOA 3ZUGA 1Z88A 2QRKA 2J87A 4J0KA 3TFOA 3NUZA 5TE9A 4L6IA 1N7JA 2H1VA 2VDNB 3R9WA 4C4SA 3LX4A 2WUVA 1FFCA 2VBCA 3IHTA 2XUPA 3JATA 3L0OA 2XF8A 1ZQ1A 3FFTA 4Y9DA 1Z0SA 4XPIB 4QO7A 2OE2A 1M34E 1UQTA 4TLBA 2HA7A 3ZXYA 4UZEA 1JEAA 1JVNA 3H3JA 4E0BA 1ZUIA 2QY6A 1BROA 2QA5A 3H9BA 5F4MA 3MS2A 3TCXB 3REGA 4AVYA 4B6EA 5BUCA 4FN4A 1DWPA 2GCIA 2NLOA 4QPPA 1IY9A 3I92A 4B7AA 2A57A 3K0FA 3EGXA 1IMJA 2MR6A 1T3HA 1UADA 4I3FA 3LWDA 4KQIA 1SXIA 2PN1A 5AUQA 1T0HB 3T7JA 2VYND 2H9AA 4C4PA 1EWKA 1DIRA 4HGPA 3IKJA 4JP1A 3ZQ4A 5F5NA 521PA 4FFWA 2DZDA 2WOJA 4NYIQ 4BO1A 1ECGA 3DE3X 3NMUF 1A95A 1UFOA 1XZPA 5HCIA 1CUSA 1PX2A 2X5OA 4KPGA 4INOA 5DBHX 3O8OB 3OTOB 1U80A 5DM1A 2CL7X 4D81A 1O97D 3GOHA 3O93A 2O52A 2JJYA 1JH8A 1TTPB 3JPWA 5JFOA 5DISB 1W2GA 3N2KA 4P31A 1ISRA 3DH0A 1V16A 1RAHA 4CT4B 5I51A 4MYCA 3T5AA 2EIHA 1OXKB 2D1FA 1X1SA 4IDGA 4KN8A 4MI6A 3DWGA 3WNBA 4NAHA 3GN1A 3CPEA 2VKQA 4HKTA 2FEKA 4NI5A 3VR6H 1XZKA 4G6IA 1PGPA 5EWJA 4N39A 3A2NA 2VHWA 3FTQA 1YQWA 3SK0A 2CXNA 2F8SA 4OXYA 3WDMA 4ER0A 1JHZA 4DILA 2X7HA 3FRJA 1SWWA 3MLBA 3MCWA 4KKTA 3FNFA 3WFIA 2PMFA 3NE5B 1WPGA 1YBVA 3F6PA 4KX3A 3BK1A 1E9CA 3O91A 1LTKA 3LDUA 2XCLA 4RD4A 4P54A 1G16A 5ESWA 4URFA 1RRGA 5ERXA 1YA4A 2HT6A 3U5TA 4WXPA 2QL7A 5AK5A 3BA6A 3SLGA 2IA5A 4IJUA 2FOXA 3OUZA 3ZV3A 1DOHA 2P69A 1D9ZA 3QQ5A 4NOLA 5I8PA 4MVJF 1DWQA 1JLRA 2A78A 1KDYA 2PT6A 4QELA 2OUKA 5CB4F 1L7RA 2XDWA 1NXWA 3E9CA 1HNWB 4GXQA 5DNWA 3WMGA 4BHTA 4FGWA 1PHRA 5BWCA 3QLTA 4WBSA 1RLJA 4GP6A 2YVAA 4H16A 2Q49A 4WWHA 3V4VB 4Y6QA 4G1FA 4AMGA 1DEAA 2RHDA 2QL5A 2GXUA 3P4UA 3BQ9A 1DRVA 4Z51A 3A2MA 1K86A 3F5SA 4MW0A 3E3LA 5JLAA 4JS0A 2DYKA 4Y2TA 4A8JC 5K0FA 3L8GA 2Z9DA 4NE7A 2IYNA 3HWRA 5HOEA 4NBNA 1TTTA 1UZUA 1BH6A 1QJCA 5CM9C 2YXBA 4HADA 3GVLA 1A5BB 3H16A 3HZHA 3JQ6A 4TL8A 4UBIA 4YJDA 5ENZA 2Q6LA 1VSVA 2X0RA 3TTXA 4FCWA 1ITZA 3V97A 1KEEB 2AZ4A 4B80A 1FU7A 3PQ2A 2CFIA 2QV7A 3GQBB 1MPXA 1UL1X 4YLEA 1H2AS 1J2RA 1DKPA 3BEOA 4Q9KA 5IRCD 4IKEA 4U8GA 4B82A 3BQNB 4JZKA 4RDKA 1Z5WA 4GQIA 1Y98A 4N6NA 3CBGA 4LNUB 2KMLA 3HJTA 2FQYA 4XJXA 1E2BA 5BN5A 3W5JA 4YWHA 1P4JA 4ZI5A 2ORED 3RF6A 2BFEA 3IS3A 5EUBA 5BSHA 4DIKA 3QK7A 3R7WA 2AWNA 4LRYA 2RH5A 2GLTA 3RS9A 3E8XA 4J1TC 3SQDA 1O5TA 3OZAA 2C4KA 3MF4A 4RHCA 2FW8A 1XKXA 1VLYA 1L5FA 4QQNA 2ZUFA 3AP3A 2FJPA 2EFYA 3NV9A 4BX0A 4EL5A 5I7UA 2ZBUA 1EVLA 4EHHA 2MTBA 3TXYA 1APBA 1P1JA 3CNOA 4N5MA 1KQNA 3IELA 4ZJZA 2GZAA 4X07A 2MSNA 4KYUA 4EB6A 4YUXA 3D43A 3CMMA 1QVWA 4PO8A 5NLLA 3ESDA 3FIJA 3RYHA 4HV4A 3OEHA 3DBHB 5FXMA 1O89A 1OI7A 3AINA 3MNFA 5BW8A 4MSUA 1Z4JA 3AX6A 1FMFA 2XUGA 4NOJA 2GB4A 2X1HA 4HAUA 4HYTA 5JAQA 1LVHA 3Q6RA 1MLDA 1TB4A 1ENPA 3RV4A 4CKCB 4DA0A 2YW9A 1GOTA 3QEAZ 1YJBA 1N2CA 4G5RA 4BP3A 3AEZA 1Z38A 1CQJA 2FR8A 2YOGA 5ALPA 1C4KA 3PE4A 2AZXA 1UJCA 1HFKA 2ECPA 2PJDA 3ORSA 1AGPA 1KS9A 2XB9A 2NYUA 3QXHA 5HRUA 2GT1A 1Q11A 2YWBA 3WKAA 5HTOA 3LTNC 4IS2A 3IDFA 1LCIA 1SH7A 1VKJA 1KP3A 3LPMA 2C58A 2W2LA 3LBHA 1P4SA 1ZINA 1OSNA 4GI7A 3WGMA 5LJIA 1O0CA 4OL0A 3W1WA 1TEXA 5ES3A 4C3ZA 1SUWA 3VM6A 3BNWA 3PCTA 3V48A 5FWNA 2V55B 4OD0A 1QHHA 3KSRA 5KTKA 4KWCA 2Z04A 4EFMA 4PZZA 2SICE 1VJDA 5ALLA 4DEVA 3R7DA 4TZ6A 1RZRA 1RVV1 4JSTA 1SUSA 1M2VA 4MROA 4RUKA 1SHUX 3DEYX 1YZQA 2B8WA 1E64A 2QJFA 2R4TA 3DG9A 4XKJA 5K3FA 2JFHA 3GP8A 4P58A 3JWGA 2YJ5A 2VHQA 3CRVA 4GRDA 4KUHA 1ZNQO 1QZTA 2CHGA 3CVOA 4TWRA 2H2IA 3BH6A 1JG3A 1MJGM 4PRKA 2O1EA 3NC4A 1NNI1 3KLPX 4YJ2A 4F3TA 3QBDA 3A9VA 3AESA 2W2KA 5HIIA 2XYRA 2JIPA 4WBNA 3K2BA 1QOZA 3RT1A 3WAKA 4B75A 3PI6A 1O3YA 3REQA 3G8DA 4DLLA 3EPLA 4IDHA 2IHVA 3DE6X 4R40A 1U1IA 3B7WA 4YNBA 4RZXA 2FHPA 5KPJA 2C2KA 3VV2A 1MP0A 4BLPA 1VP9A 2WMYA 2B21A 4MUNA 4WZAB 3FR7A 4FFLA 1IDN1 3OOEA 3PPWA 4K6HA 2QDXA 1HETA 4E08A 4M0PA 3IDSA 5B2EA 1CQIB 3I5AA 4ZANA 2GM4A 2JAWA 3KZVA 2EYQA 5TQJA 2DHRA 3AF0A 5AICA 1HKHA 2A0KA 3BJRA 3DR3A 5I7HA 1E3WB 2VCEA 3K5HA 1V2GA 1LDEA 1YR9A 4JD5A 3ZWAA 3R6WA 3GLIE 3QH4A 3CBQA 3DXXA 4C6TB 3KTAB 4HB3A 4IMIB 3I05A 4D02A 2Z6QA 3HCRA 4YB8A 2Q21A 4UCXA 3BMXA 1LPNA 1GL9B 2YWFA 3HBAA 3P0RA 4FKMA 3TSOA 4Y7DA 4RTLA 1KZYC 2J45A 1ACMA 1XZQA 2CUNA 4ITRC 2O4UX 3F7OA 4LEIA 2O57A 3W3AH 2ISSD 4OIFA 2DUJA 1H1LB 2EHDA 1VLOA 3R3JA 1QV9A 4LF5B 3OZDA 1C3VA 4F6LA 5ICFA 4QT0A 1AUPA 3EDRA 3KO8A 3GAAA 3EFHA 4PLVA 1NI3A 1CUFA 2N3ZA 5B3AA 1DBQA 2H2GA 3V76A 3QJYA 3C3CA 2OBXA 4X1IA 4D3FA 3PQ6A 1FW6A 3OJXA 1WKCA 2NXNA 1N8TA 3DWFA 2GERA 5GONF 5LXTB 3KSAC 1P80A 3GEEA 4GDMA 2R66A 2GMWA 3G6EB 2GPYA 3ONWA 1Q7TA 1FYVA 1K4YA 4P81A 2UYOA 5LIRA 3PUWA 4L8FA 1TO2E 3HYCA 2FEMA 4CG0A 2H7XA 5AW0A 2WBLC 5BYJA 2WHYA 3I04M 1VHOA 2UZ1A 2FX2A 3DDUA 4O4LB 4WA8A 1TA9A 1TCAA 3OU7A 3A9RA 5LZ7A 5TGTA 3TSCA 3PTZA 2P6RA 1LNSA 1ML3A 5FQNA 4O0MA 1RJ9B 1USIA 1O58A 3A4TA 3G2MA 2DECA 4KQEA 3KB2A 2ZJ5A 3HCWA 3KYCA 1ELOA 4HMQA 3T38A 4NU0A 2A4MA 3I2IA 1TYBE 3GGGA 1VFNA 5C2JB 1JAYA 4F6RB 2ORIA 2XODA 1QFYA 2RJ3A 3HBJA 4MUAA 4J0CA 2JVJA 4KSYA 4KXLA 3Q2IA 4F9GA 4CXMA 1BDJA 3N86A 1F3OA 3HVKA 2Q29A 3DV9A 3V8QA 3I83A 3ROTA 4GKKB 3ZIAA 4MS1A 1HOXA 1PGQA 1ZFNA 1L3BA 1O8BA 3BREA 3GNTA 3IQZA 5B1DA 3MHTA 2YW2A 3B60A 4TLDA 1EK2A 4A2WA 1AU9A 1O96A 2BGRA 1E7WA 4W7HA 1MNQA 2ZETA 1ZIOA 4ND3A 4QWWA 4EL0A 4HWGA 1IQ0A 4AWBA 4B35A 4GPTA 2YZGA 4GXRA 4KLAA 1GL6A 1SUCA 2WSYB 3PUZA 4MKZA 3PLNA 2JIOA 3N8DA 4O4HA 5CM2Z 4B44A 4QLOA 2R7KA 3LOPA 2X8LA 4ML3A 4W5QA 1NOIA 2X41A 1SB8A 4Q9LA 4EHDA 2OCKA 3FZEA 2I22A 3E1GA 4I8IA 3SLKA 3T5GA 1MIOB 3SHFA 2OHJA 4Y2XA 3SHQA 4TKZA 3FLBA 2BBOA 2IHKA 5JY1A 4KNYA 1U7OA 4DLYA 3HCFA 2IP4A 5TMEA 1G64A 2AI2A 1PQUA 2F2TA 1EE9A 3NGLA 4BVLA 4X91A 1L7EA 4Z54A 4BLRA 2PWAA 3N5KA 4I9GA 2OESA 1IB0A 3OP1A 1YBAA 4TTIA 4LYAA 5EXXA 1C9YA 1UOQA 3I9JA 3MXOA 5IW8A 2C29D 4C0QC 2VHXA 5E6SB 1DRJA 1JDTA 3TW4A 1EK5A 2EF1A 4BNVA 2IDZA 2O7RA 2PX0A 1FS6A 2K7FA 3D3KA 2MDTA 2HFJA 1I33A 1VKOA 3T53B 2AZTA 3ZY5A 5AR1A 1I3OA 2OYNA 4IDFA 4UHFA 5C1OA 3RYCB 1RQRA 4NR0A 3H7IA 1A1VA 2RH9B 1K2WA 2ZJ3A 3I1IA 5A89A 3CMCO 4XI9A 3UK7A 2BSAA 3VO8A 4F5EA 4A15A 4ACBA 4DMMA 1X94A 4W1QA 4QQ8A 4LQLA 4CN9A 1TADA 2ZAYA 2FRDA 3KT3A 1XZBA 3MMZA 4RF4A 3TOXA 2C07A 4B76A 4OCZA 4DSZA 1SQFA 3ETNA 3RHSA 3UJNA 1BXZA 1JQAA 1NB0A 1TI7A 2VLIA 3L93A 4IM7A 4TQ9A 4E5UA 1M34B 5EMNA 2FSFA 1A76A 3AUKA 1YUBA 1BWRA 3CLSD 5ELXA 3EW7A 3NDJA 1L5WA 4IGKA 1XDBA 1CDOA 4IAOA 2XUIA 4PSCA 3MA0A 2R751 3GXBA 3I2FA 4LAFA 4PEVA 4C30A 1E3JA 3SCZA 3SS9X 5JDIA 3WYGA 5LN1A 3IHKA 3OEYA 1W8IA 5FUQA 5KHOC 2FKNA 5IDXA 3KQLA 4UM8B 4MTCA 3IDOA 2NWQA 3CO5A 1LS1A 4QDTA 2O8CB 2CNKA 4MP6A 1JT9A 3FD8A 1O03A 4GX0A 4C05A 1NUSA 2GBLC 2QTZA 1XA3A 1N2XA 2ID4A 3O4VA 2VRBA 3RREA 4E2WA 4LF6B 3LGAA 1OY1A 4G41A 1WUKS 5B7QA 4Y6GB 3SWWA 3HCAA 2XZTA 4C6HA 4AP5A 4F9FA 1RHJA 1KZ1A 4C5BA 1UEJA 2J41A 2X8WA 1C8KA 4JGIA 3TYXA 4D79A 5J47A 2HXGA 1TF5A 4IHJA 3SDBA 3Q38A 1A04A 1TMYA 2M32A 3T9AA 2JEOA 2DBVO 2XE7A 2EBHX 3G9UA 5DI3B 3HBFA 3PFCA 1Z36A 2FW9A 2I67A 5JC8A 1Q77A 3A05A 3E3NA 4G1BA 2QE7A 1GKLA 2NGRA 1KI2A 4OI2A 3T06B 2CYBA 4FPXA 1L7XA 3UAZA 4BNDA 4DPMA 3R76A 3A1PA 4EUFA 4NYJQ 5M3BA 2ZE7A 1UIRA 1M2JA 1CJMA 1ZGBA 4D97A 5ICEA 3JSAA 3HSKA 5L3ZA 3RPEA 2Z8XA 3N7TA 4IGFA 4DLZA 1GG8A 5GZ1A 4R2MA 4HEA6 1P2TA 1M2KA 1M7GA 1WRBA 3LP5A 1NY6A 1UMKA 3SN6A 1EDEA 1E9SA 2C59A 3FCCA 2JHPA 3VPFA 3U7RA 2OCAA 5IVIA 4DJJA 2B8TA 2GM5A 1XRJA 1XSEA 4PX9A 1SIBE 1KL7A 3KAKA 3NALA 5EIBD 4AJ4A 5AJWA 1RYYA 2IX9A 2BFOA 4ZKEA 4JP8A 3ZDQA 4IIJB 1I7NA 4B4DA 3I9MA 1SCUB 4BAUA 1P5FA 1Z0DA 5TS3A 1HEUA 3CNHA 3U2QA 4KFUA 4L73A 3UK2A 3WR5A 4REMA 4RDXA 4ZPXA 4G24A 3LNTA 4Q15A 1HOTA 2PANA 2W6QA 3KYIB 1P1BA 1SA0B 3VMMA 2HRQA 4MAAA 3DAFA 1LX7A 2J5KA 1JQLB 2JJQA 2Q1WA 1CJTC 4DAOA 3QF4B 4F3RA 4IDNA 3M7IA 2AOTB 3W2EA 2FUEA 2LZ0A 2OFOA 3PJFA 4H0FA 2BKLA 3U17A 221PA 3UA4A 4OFWA 4OXXA 1UXOA 3BXZA 3VKFA 1TW3A 5EXPA 2FUNB 3NAQA 3H2YA 2HJ9A 4PO3X 2J07A 2HHAA 3LUBA 5EVJA 5IKOA 4BAGA 3H4TA 4MW1A 1AN9A 1GRRA 2IUUA 1TTQB 2VJKA 5B6IA 4V38A 5TXGA 1IXYA 2FWRA 4OJYA 3OPMA 3I2HA 3QENA 3U49A 1GHTA 5JQGF 3AR8A 3DTYA 7REQA 3K1JA 1JF8A 1ZZEA 4H18A 1C1DA 2WJ6A 2DE0X 1MW9X 3ITNA 1E2JA 1FNNA 4YWJA 4B3HA 1QNFA 2GJ4A 2POQX 3EUEA 4ZICA 2CCKA 4GMHA 4JBNA 1CRPA 3FVRA 2FSHA 1TMKA 3L8YA 4Z9XA 4DIUA 2W2MA 5B37A 5BOSB 5LQUA 1IWPB 5HK9A 2GFHA 2J3DA 1V4VA 1XN4A 2C00A 1PGJA 1Z33A 4OX9B 3Q88A 3FF4A 4FCTA 1E99A 3FKJA 3BY1A 1DAPA 3D2LA 4GKAA 4BQIA 1A9ZA 4HNTA 3FN4A 1DTWA 2A0XA 3IURA 3FFBA 3JRNA 3MMNA 1CZUA 2ZRQA 3TD6A 3E3OA 5CA0A 4TTPA 3AIOA 3ROQA 1QCDA 2F90A 4JQYA 4KDFA 4ETMA 2Y8EA 1DXOA 1NRKA 2I6XA 4K9MA 2OV4A 2XCRB 1J8FA 2B4KA 3ONUA 5EHZA 4MDHA 3MZ0A 2EKDA 3B2EA 4Q18A 3S68A 2BGJA 5HQ3A 3R24A 4MDEA 4O2AA 1E3EA 3QY9A 2C03A 1Z13A 2WZCA 3FSGD 4MB0A 3VOAA 4F6CA 4BJ1A 3QYAA 2IEYA 2RKWA 3RU7A 4PO1A 2F55A 2BISA 1GCAA 2HYDA 3U13A 2GETA 2V65A 3DLHA 3UTCA 1WKBA 2B1GA 4ZT4A 5DM4A 5L4LA 2ZTHA 3OMLA 5DJ5A 1C41A 4QYIB 3ZZTA 3LCUA 4DLXA 2P6PA 1GQYA 3D4NA 4RYLA 4MPJA 3Q72A 1XTVA 4PGFA 4UFPA 1SC3A 4Q7JB 1N9GA 2R65A 2ZIZA 3A27A 3O47A 2ID7A 4AP6A 5U4XA 5L45A 1A5SB 3N28A 3RWOA 2G25A 1IIBA 1I4EB 4OA8A 4G5QA 3S1AB 4ZOEA 3L9WA 3T0GA 1DG1G 3LNNA 3HXPA 4GZ5A 3D2CA 2FWJA 1CY1A 4S1PA 3WYNA 4HQOA 4QUEA 4BWFB 4UTZA 3MMSA 3P4YA 2HBYA 5GV8A 1GZ6A 4HPWA 4OMDA 4OUDA 4RDCA 5BW6B 4UPDA 3WWPA 4CKEB 1GUZA 3UMSA 4XJVA 4F7WA 4MR9B 2J3IA 3SJCA 4BLVA 3NP9A 1C9KA 1CTQA 4CKZA 4I66A 3V4LA 2OB2A 4BQPA 2GPNA 4UU8A 4DC1A 4OO3A 2PSJA 1AKNA 1ZD9A 3HV2A 4XTRA 4YCLA 2JKZA 2JLWA 2HMUA 4BNNA 1M0TA 6ABPA 3W5AA 2I91A 4EFLA 4EZBA 4RTKA 4ND1A 2H57A 1MNAA 2X8JB 3KKEA 3O83A 4K3UA 3V7YA 2XQKA 1G55A 3A9SA 3DDWA 4DLPA 2VP4A 1P6UA 2ZVJA 4LI0A 2A1TS 2OZKA 3GT3A 3ITKA 3O8DA 2ERYA 1K0UA 3WK8A 1BW9B 3HYTA 4X92A 2N46A 1Q81D 3BH7A 3UG7A 4DGSA 3K73O 1OIVA 2DFKB 2X19A 2CT8A 3FUXA 4HLCA 1T6YA 4JC8A 4Z99A 2Q8QA 4MW9A 4U2GA 1SN7A 2Z2ZA 4WN3A 5K8LA 2YYYA 4DR2B 3A1EA 4G0UA 2GDJA 1WU8A 4GP7A 3Q5EA 1VKHA 4HYYA 3U9TA 5THXA 3AVXA 1SD5A 2A6PA 2OC4A 3DMRA 2WB2A 4CM3A 1ZC4A 1IEQA 2MWMA 2IW3A 3C4QA 4DUGD 1QXSA 2X9NA 2GZSA 2HF8A 3AIIA 1OE0A 3FKQA 4KWHA 9GPBA 2R00A 1N2ZA 3EGIA 3ESYA 3IO3A 2UYHA 1HM5A 1C3EA 3AQ4A 3FCXA 1CHDA 4I55F 4XIGS 1BYIA 4TXJA 3QVGA 1DHTA 1HV8A 2ZT8A 3FOWA 2W6ZA 4QQKA 5AXBA 1CUEA 2VQDA 2W70A 3T4XA 3L6DA 3P2OA 1B8VA 4B73A 3GLIB 2VF8A 2NO4A 1S7CA 3C7TA 1JI3A 3T1VA 3ICQB 1JAXA 1H8ED 4Y1FA 1H65A 5EUCA 5GOTA 3GPDG 4KOAA 1XAJA 4RVDA 1WMAA 1D2AA 1EHCA 2SNIE 2E4AA 4WCFA 2OBSA 2PYIA 5ULLA 2Z1MA 5T41A 1H2BA 4I8XA 4UPEA 2QPAA 4Y9TA 2BC9A 1U63A 2RGNA 3PJGA 2O20A 1GUBA 2OQ2A 1LQTA 3GYBA 2HT1A 2BYTA 2VJNA 3Q3IA 3RVNA 1XD2A 3BMQB 4P34A 4UUOA 1HBJA 3HPQA 3MUNA 4J0DA 1YC5A 3FLEA 1F8GA 4L5JA 2CVHA 2WSLA 3I42A 4IDBA 2PH1A 4M0UA 1RAIA 1TZKA 5EP3A 4EM6A 2YIJA 4G65A 4MA4A 1DZIA 3U81A 4INJA 3SM3A 1U0FA 3UK0A 4L3VA 2BDTA 3GUUA 3NNSA 3FYCA 5FUVA 4O4IB 1YVEI 3K71B 1W52X 4F4JA 4CLRB 4M1SA 4ZALA 4IHKA 4PC3A 1IN7A 3D2AA 5T5QA 1C2YA 2OBLA 1Q0UA 1EP2B 2OFFA 4QSHA 1GCGA 2QN7A 1FJXA 2IP1A 2J9ZB 2OLEA 2GOYA 2PVSA 4R8RA 4WNAB 1IFXA 3NHKA 2QPTA 1G3RA 1FEZA 9MHTA 2AS0A 2GRUA 1Y33E 2ZSJA 1R6XA 3KDAA 3ZDFA 4I4LA 3WKDA 3RRZA 4MKGA 1AF4A 1L7BA 3KVOA 5J4KA 3WWDA 4IV5A 5KYYB 1P29A 2E82A 1U7HA 3IMGA 4J4BA 5EE0A 3NBAA 5JS8A 4ZFNA 2XCSB 2O8BB 2VYCA 4LDNA 1ISSA 4EG8A 2VNKA 4DSOA 4YAKA 2JZOA 3GG9A 5LA6F 4X7FA 3QVJA 3MIZA 2WNIA 3REFA 4IXDA 4ZGQB 3I6ZA 4LDPA 3SKYA 4KPEC 3V33A 5K8CA 1U0RA 1WIWA 2WLSA 3MTBA 2ZT7A 3NP7A 5DB4A 3STUA 1T9GR 1TM7E 1INLA 2QRQA 4F2GA 2C2HA 4LXQA 3UV6A 4OLAA 3LYUA 1VL5A 1X8LA 2APJA 1Z4KA 5BSKA 1PF7E 2JAHA 3GY0A 2FI1A 2GAAA 4S0ZA 2QU7A 4BXOB 1ONPA 4X65B 4LRUA 2IY7A 4H6WA 4I4IA 2BCEA 3R5JA 3MJTA 1Y4SA 2E5WA 4Q93A 4BV3A 5AVOA 1L5ZA 2DJIA 4FEAA 1PNOA 2QTCA 3W3ZB 1HYHA 3COYA 1Z8NA 4M1TA 3LDFA 2F17A 4FFOA 5EJEA 2V7VA 2B20A 1QRRA 3WWCA 1YBMA 1MF7A 1JWLA 3MD9A 1GL3A 2FZWA 1HA3A 3CP2A 1FDOA 3QXJA 4UNSA 1HLGA 3NJRA 4NQZA 3PENA 2AOWA 5IEJA 4KWEA 4EENA 2HKIA 1Z6AA 3DDZX 1TAUA 3VFDA 4DK1A 2PKCA 3PTLA 4IKOA 4L15A 2IC5A 1UJMA 4N3AA 1II8A 3WWOA 1KEPA 4BOYA 1A2BA 1AG9A 3CWQA 1QWOA 4OQPA 3W6PA 3LX8A 1KDTA 1EFTA 3GEDA 3W7AA 3VU1A 5BMVF 4KQCA 4BQSA 4Y2YA 2Q3LA 1BDHA 4PRZA 2FN4A 2AHRA 2GZMA 3QI7A 3IPYA 4G4SP 3GDOA 3ONFA 4LHSA 2XTMA 4A2PA 2JL1A 3MVEA 4CDGA 1LRJA 3GLFA 2AKYA 1N6RA 3IVRA 1XQ6A 2ZQZA 2VH1A 2VUUA 3MTAA 4AROA 5AD1A 5BN4A 4D4GA 2RGWA 3FF1A 4BCBA 1T0JB 4A6XA 2Q4OA 2Z3VA 3I2YX 1V8FA 5JNTA 2R8ZA 3PRHA 4ZXFA 4PU0A 2IIVA 3P2YA 3WFJA 2W22A 4YLYA 4LHXA 3SJUA 4ZI7A 5M04A 2ZZGA 2C1EA 3SD7A 1ZD3A 1OC2A 2V74B 1OXTA 3KJNA 3BTUA 1Y9ZA 3KU1A 2ATVA 5INTA 1VBFA 3RF7A 5JISA 4AMUA 4AZ0A 1QGAA 1H4SA 3R3XA 4IWXA 3GLQA 1E5XA 1GGHA 5DYWA 4MQUA 4OMFG 4BCCA 2AMLA 1Q1NA 3OLVA 2CB0A 2P4EA 1KOLA 1SD2A 1E18A 1UMCB 3IMFA 2JGLA 1Y5NA 1BXRB 5L3VA 4DDHA 2JIRA 3ZNPA 3ICWA 2VO1A 4J49A 4YVFA 2Y66A 4A0RA 2P2LA 1KO5A 3ZLUA 1VGQA 1XPUA 1ORWA 1Y5MA 4IH4A 4J4TA 1UKBA 2MSEB 3ASVA 3TTWA 5JAPA 2ACVA 5BSMA 2ENWA 4OHCA 2HMWA 5A7HA 1XEXA 4QNNA 3ZWXA 4EGAA 3W2TA 5FWYA 4DV6B 1XZJA 5AOVA 1PV1A 4D96A 4JLAA 2ZR7A 4OGWA 2PLNA 5BSEA 3VPGA 4D74A 3D6AA 4IILA 1IULA 3SZGA 3DO6A 3L7DA 2H0RA 4RAQA 3ZWYA 3HTXA 1J07A 1Y8RB 4GPD1 2PMBA 1V0EA 3ZIDA 3N05A 2QAGA 1V48A 3WLFA 3WV4A 4IIYA 1LVGA 4AT1A 5MGBA 2VAVA 3LY5A 5I7EA 3NANA 2CE2X 5J5VA 3AY0A 1KXJA 1GVNB 2BGUA 4N5HX 1XZHA 2I6TA 3BE5A 1XF1A 5EE3A 3V4SA 1XAIA 3MM4A 3V8PA 4LF4B 1KRWA 4IWNA 3GPLA 1IN5A 4LE0A 4TTVA 1W4LA 4UCFA 3C7KA 2GZRA 5AFSA 1H9AA 1E3ZA 4ROSA 3LFTA 3UK1A 2GJPA 5KTTA 1F8YA 2PZMA 3GROA 4YRRA 6Q21A 1DU4A 2I4MA 3M5WA 4PF1A 3U4QA 2VPWA 2OTLB 1C8LA 3AF5A 4LQ4A 3MWDB 5C8ZA 1EG2A 1W88B 4DCNA 1UD5A 6LDHA 1TLLA 3QSGA 4FFDA 5T4HA 4ZGWA 1T9CA 2JW5A 4KC0A 4BJ6A 3CVWA 4G25A 4JXXA 4ZQBA 1U0NA 2YN2A 1QLHA 4NNJA 1ZCBA 3FI9A 3MPUA 4OOFA 3L7LA 3U31A 2J6BA 4MLPA 1ICEA 4TT3A 4YRTA 2WSSD 3LT0A 4D9CA 4AY3A 1JHYA 4PR3A 5A5DA 4NPAA 5F7ZA 7MDHA 1IPEA 4C0AC 3LKZA 4Y2UA 4TTJA 2I2FA 3GLRA 2DTXA 2R96A 1TT5B 4ENSA 1J09A 3BD8A 5CJJA 3WLTA 2NTNA 2QL9A 3QPAA 5G41A 3G1UA 2SCUB 1YB7A 3B1KA 4JQZA 2XKKA 4BGDA 5HKBA 2AUMA 4LIPD 3QEKA 3RS8A 1B76A 1NI4B 3N0VA 4AUMA 1CVLA 2WTEA 4LZAA 4BV9A 2EJVA 2P1DA 1WZ2A 3U26A 3V2GA 5EHQA 4CM8B 1NAHA 4RAOA 1EX7A 2BFAA 4A03A 2GZ2A 1F2DA 1Y6JA 3O38A 2FEPA 2IYLD 4JOCA 3UO8B 5K01A 1ETUA 1PVDA 3N0TA 4MVJI 3IP5A 1G5RA 2VYQA 4EF6A 4BNXA 1F12A 1GNVA 2HJWA 5HA5A 3MTJA 3A2KA 4LI3X 1VBMA 4PANA 2OXCA 3SICE 1SXJE 1DELA 1NIPA 3K15A 2VQSA 4MS4A 4L5BA 4CJXA 2R44A 2AN5A 1M1UA 4HS9A 1J6UA 1GZ7A 1ZH8A 3ZGNA 3RFTA 3W5SA 4DMFA 4LPKA 4Q4AB 3DFMA 1WTHD 1BCRB 3EHEA 3EIQA 4A8HA 4OSPA 3ASQA 4WSOA 5DCYA 3T9CA 4D3YA 3OLQA 1S0UA 1S3IA 4B3RB 4FMDB 4JLBA 5IARA 3TLZA 1RYBA 1PNQA 1NWCA 4LA4A 1QGUB 1WX1A 1SKUA 3E23A 3S4YA 3OQVA 4AK9A 5C7IO 1UFKA 2X86A 4BBJA 1RJEA 1SELA 1C8VB 1EM8A 3TVTA 2R2AA 4IUYA 2QVGA 3PA8A 3MT0A 2WHQA 1VSQA 4PZEA 3QWIA 3ST7A 1G8GA 4RTJA 3QELB 4P92A 5KCZA 4DOMA 1GFIA 4QTZA 1T3SA 3X2EA 3ZU5A 1KIFA 4RU1A 5IXYA 2C0CA 1DARA 1SXJD 3QVTA 5KOJA 2E6UX 2ZR8A 1XYVA 3G0DA 2ZXFA 4U00A 4TSFA 4FQ8A 1S2OA 3RU9A 4NYIR 1TUGA 1NPDA 3QFTA 1FZQA 1HDOA 1U5CA 2PUHA 2B1RA 3U60B 1FDSA 2LCQA 1WMBA 2DB3A 3ETDA 3W2FA 1UP6A 4FONA 4G4JA 4HZGA 3VSAA 3V5NA 4XSHA 4JL8A 4WNIA 4BMCA 1E1RD 1B14A 3A3YA 4F86A 2C5EA 3CV3A 3MILA 1SZJG 2OVBA 5HXAA 3KB8A 4Z4YA 5JH7A 4F72A 4G5GA 3PA1A 5AN9A 1XVVA 1VI5A 4G1CA 2OZLB 3HFJA 1KH2A 3ABSB 4B81A 4PSVA 1KI1A 1E8DA 3UG6A 2VWHA 2WIJA 3P2IA 1P45A 4OXKA 5H0IA 3VZQA 1ZKDA 3CKLA 5CM8B 3QU2A 3NFYA 2EBUA 3QFHA 3AR6A 4IH1A 2G76A 2DLCX 1WVMA 4O3FA 1EDOA 3O4HA 3F2VA 2OSVA 1R6AA 4IO1A 3AJDA 3DPUA 4S04A 1GKIA 3BC1A 4H3VA 4URYR 3K31A 1ZCJA 4LE1A 4A27A 4P22A 3GRKA 2WJWA 4REQB 1XVIA 2OORC 3ZDBA 1NC1A 4Q4CA 1RLIA 3OQOA 3A04A 5C4MA 3ZE1B 4AUKA 1XMXA 1X1TA 3LUKA 4NBWA 1PJ6A 3MCVA 3PHJA 5KQRA 1A88A 1G9TA 2HIMA 3B1JA 1L9KA 3CX3A 5JSFA 1E2PA 4HQNA 4Q3AA 2PPVA 2WFMA 1EJBA 4MRSA 5BWOA 1QZZA 1R8QA 4GX1A 4X60A 3H1AA 4RKRA 1D1QA 2ENUA 1Q7GA 2H08A 2HWKA 3NW9A 5FL7A 3AR7A 1GGMA 2O06A 2RHRA 5TPZA 5LYJB 4NCHA 5HFJA 2WYUA 1RWQA 4OI1A 1E61A 2KQUA 3ORFA 1AUVA 1NYRA 1O8CA 5CVVA 4LRWA 5IC5A 4LXUA 3N74A 3RH0A 4IZ6A 3L0DA 2YWDA 2H17A 1FNMA 3F7MA 4P93A 4NCAA 3UC5A 3QBTA 1CNFA 4RGQA 2ECOA 4YJFB 4OHYA 2VK8A 3TQFA 2F43B 1KWKA 1S3GA 1DAMA 4RA9A 1YFKA 3EGEA 1UJ4A 1UT6A 4L4XA 1BIFA 4TUYA 2ONKA 3UWKA 2VSNA 1NXOA 3KU4A 4L0CA 5DYNA 5HVNA 4XMYA 5AHOA 2V7XA 1AQNA 3NDBB 2XYVA 3I0MA 2D5LA 1Q50A 3R0VA 4DN6A 3M70A 3NBQA 5ALKA 2Z1DA 4KKVA 3ZIUA 5JJIA 2VF2A 2CVFA 3VR4H 4CMIB 1M7BA 1P2DA 4WFJA 3TH5A 5JS1A 3HZZA 3X2SA 3DZBA 2CJWB 1JIKA 4IKPA 2XE4A 2B69A 4IINA 2BPOA 1G3QA 3P9ZA 2HIHA 3OJFA 4RD6A 1E3LA 1POXA 3QVOA 2Y05A 4JLVA 4P4SB 4WY5A 1BWQA 5I9TA 1Z9BA 3G0OA 3PT5A 3DLBA 1SUFA 4H7KA 3OOSA 4BNKA 2DWOA 2BSQA 2CZCA 5CCDA 4E5MA 1H2EA 5JT1A 4L28A 3H9NA 3GOQA 5EYPB 5KX5F 5GADl 4ZCRA 2NUPB 2ZWOA 5LZ4A 1U9YA 5LP1A 4DCJA 2Y2UA 2DVMA 2PRJA 3NWEA 3D8UA 4N49A 3U39A 421PA 3T5DA 3PP8A 5J23A 2QLJA 3F8WA 5JJCA 4MV8A 1N3LA 4Q3CA 1WAMA 3IUEA 1TCCA 3H5RA 4N8DA 3TTVA 4AJIA 1NYQA 4GGPA 5FOUA 2PEZA 1XNJA 3I37X 5JNWA 4U2CA 3KSZO 5CX4A 4D4JA 2HJVA 1V5VA 1MRNA 3OE1A 1F2VA 3PLRA 5IUNC 1FU4A 1ZICA 4RWZA 2OSBA 4M6WB 4LMAA 1XJQA 3SR3A 5IJZA 5ADWA 3BSFA 3AL3A 3GMSA 2CVZA 2KB0A 4OYLA 4RM2A 1KI3A 1VGVA 2NTVA 3A0UA 3DMGA 3PHLA 4CTNA 1YASA 1A9OA 5C1PA 4DUYB 2GAJA 1CT9A 3I4CA 3ZX5A 4IQ0A 5D5QA 1K8QA 1TK9A 3DZHA 2XGMA 2L42A 3BXXA 2FCRA 3E7DA 3IXQA 3LH5A 4NE2A 1JJIA 4F11A 3N2ZB 1LLQA 3VR3A 2XH8A 5BUSA 1WP6A 4XFKA 3BX1A 1B15A 1MJNA 4JI3B 2G1JA 1V8PA 3RRFA 1EDDA 2O2CA 4NXNB 5KKAA 1MX3A 2BLNA 4DKXA 3CYFA 1TC1A 3VHLB 4BFZA 4MYRA 5BWLA 3CLRC 1G5TA 3RUDA 3EEOA 4EQ6A 1AC5A 1GV0A 1YQEA 2FZCA 1XXHE 2NUAB 1SBQA 1EX6A 3KEMA 4W5WA 1BS1A 1FCJA 5SZIA 3P5SA 3TM4A 4DYDA 4OL9A 4J07A 1XEFA 4UC0A 1J5PA 4ZGNB 5HZHA 1UJBA 2XTJA 1KP2A 3G2LA 5GZ6A 3I3SR 3LKBA 1WZIA 2RJNA 4MJLA 1B73A 4KXUA 4QECA 3E22B 1FUIA 2O54A 3X1ZA 1SVOA 2AG1A 3HU2A 3PFWO 3ZY4A 1AO3A 3CJRA 2GWRA 4FC7A 4XLEA 1N3IA 1QVZA 2NUBA 5HKKA 2Q2QA 4DPLA 4CM7A 1QG0A 3CJQA 1WR8A 2CXSA 2ZRGA 4CL3A 5AUPB 2JIZD 5HJEA 1DO8A 4GBED 2F1OA 2VDOB 2BMJA 3TCNA 1YZFA 3DEFA 1VQ1A 4DARA 5JR3A 3DLTA 1U1FA 2IK8A 2NZXA 4Q66C 3FWKA 3KWJA 3BWCA 3ITDA 1G20A 3NH6A 1GP2A 2ZYIA 1KO1A 3GPIA 3PC6A 1P0MA 4HVAA 5D5HA 2SHKA 1W5TA 1OASA 3FDZB 3ZN2A 3CPJB 3M6UA 2IYWA 3X43A 4RVCA 3BRQA 3MSXA 4NKRA 3EG9A 4AJNA 4OTZA 1CJSA 3CISA 4TRJA 3ZEAA 4RS3A 2A3RA 5HG0A 1GG5A 4OJQA 1RWOA 1N92A 3L84A 4RSRA 5E1BA 3L7OA 2XUHA 5THKA 4NBKA 2BKAA 3CUVA 3TAXA 2C7BA 1KI4A 3K6JA 4LXIA 3SEAA 2CLSA 2LP4Y 4I0WB 2H0AA 5TVGA 1S8AA 1MD9A 2FW7A 3OEHD 4HGQA 3T7CA 4CR7A 4EAQA 4L8JA 5FAKA 4BKOA 3OCUA 1UC8A 4QM7A 4LXYA 1KEWA 4CIYA 1N34B 5ALYA 1PEDA 5DH9A 6NULA 3HM9A 3QUCA 4PGMA 2WE8A 3T1OA 2NU8B 4UVGA 1W93A