1GR1A

Structure of ferredoxin-nadp+ reductase with glu 139 replaced by lys (e139k)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKKMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the Role of Glutamic Acid 139 of Anabena Ferrodoxin-Nadp+ Reductase in the Interaction with Substrates
pubmed doi rcsb
source organism Nostoc sp. pcc7119
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP+ REDUCTASE
total genus 88
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2001-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1gr1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1gr1A02
1ZUNB 1QUEA 4B3XA 4C0SA 1N0UA 3ES9A 1B23P 3OW2B 3CB4A 2OK7A 3WY9A 4PC3A 3I55B 1HA3A 1FNMA 3E20A 4B4DA 2BMWA 3CCMB 4RJLA 3W2GA 1BX0A 1GR1A 2VNIA 1CQXA 1G7CA 1YJNB 3P26A 2NPFA 3CCJB 1W35A 4WQMA 1YHQB 1N8RD 5TV2A 1SM4A 1W34A 4TN1A 4G1BA 4M53A 5H5JA 2YWHA 3CCEB 5GV7A 3WYAA 1YJ9B 3W2FA 2VNJA 3JQQA 4FN5A 3WXMA 1VQPB 2OK8A 3MMPA 1NDHA 1TTTA 4RCZA 3JQPA 1QUFA 3U6BA 1N0VC 2B5OA 4ZCLA 4ACAA 2BF4A 2ZITA 5H59A 3B8HA 4HE6A 1S72B 1GVHA 4PGOA 1Q86D 1BJKA 1YI2B 1F20A 1KK2A 2OTLB 5THXA 3U2QA 1A8PA 1GAWA 2E1RA 3ZZTA 2RC6A 5TY0A 1ZM4A 1IJFA 3FJOA 2BVNA 4UAJA 1QH0A 1M90D 4M4SA 1JNYA 2VYQA 5EMNA 1AMOA 1EP3B 1B2RA 1FRQA 1YJWB 3CMAB 2YWEA 2HDNB 1GAQA 1H85A 1F60A 1DG1G 1KK0A 4F7DA 1E62A 1ZM3A 2AHOA 2X3UA 2D74A 4P6VF 4M1KA 1QFYA 2QA4B 3QSYA 2B7CA 2XEXA 4AF7A 3OZWA 1QFJA 3AVTA 1K9MD 1QGAA 4EH1A 2VZLA 3CCVB 3CD6B 1EFTA 1QG0A 1OB2A 4Q7JB 3P27A 4AC9A 4TMTA 1M1KD 2BGJA 1D1NA 3OZVA 3G4SB 4Y9UA 3AVWA 2QN6A 4BPRA 1K73D 2XNCA 3PENA 3ZZ0A 1VQ5B 2VNHA 4N3GA 1BX1A 1KC8D 1DDIA 1KK3A 3LO8A 4DQKA 2J7KA 1WDTA 3WNBA 3CMEB 3FPKA 2DEUA 4Y9RA 4ZCIA 3E1YE 2PIAA 1ELOA 5FA6A 1D8TA 4LBVA 3I1FA 1FNDA 1TUIA 1VQOB 3LVBA 1NJID 1EWYA 1EFCA 4LBWA 2YWGA 1G7RA 2CRVA 3AVYA 3W5VA 3VO2A 5DSZA 4PC6A 4B47A 1KD1D 4IW3B 3WBKA 1VQ4B 1R5OA 3JQRA 1VQ6B 3CC2B 1FDRA 3G71B 2QDXA 1W87A 1KK1A 1I7PA 1XE1A 3ZC3A 3VO1A 5HXBA 3CCRB 2HMAA 3B82A 3CC7B 2QEXB 1FNCA 2HCJB 1BQEA 3LYUA 4FWTA 1TLLA 1CNFA 3J81k 3CCSB 5KSWB 1KJZA 1U2RA 1R5BA 1KQSB 3MHPA 1Q81D 3WBJA 2BV3A 2BGIA 1EXMA 1GO2A 4ZGNB 1JB9A 3QFSA 1QGYA 1IB0A 4YALA 2RC5A 2R6HA 3AVUA 1OGJA 4RD6A 3OJXA 3WNDA 4P3YA 1YITB 1AIPA 1FRNA 2BM0A 1ZM9A 2BPOA 1OGIA 2XNJA 3VNUA 1EP1B 4PC7A 3W5HA 4ZV4A 4AF6A 3W2EA 1ZM2A 2QTZA 2YWFA 5TR9A 3VMFA 3CRZA 4N3NA 3W2IA 5GV8A 1EFUA 1XB2A 4ZGQB 3I56B 2OTJB 2VNKA 2C78A 2QMUA 1DDGA 3CC4B 2DERA 1S0UA 2DY1A 1VQNB 3B78A 4TMZA 4YAWA 3QFCA 3V76A 2FX3A 3OZUA 3ZZUA 3AVVA 1Q7YD 1QX4A 3QFTA 4QFMA 1QVGB 4MYTA 1VQMB 3LRXA 1SKQA 4TMVA 1JA0A 1R5NA 3CW2A 1Q82D 3U6KA 3OJWA 1JJ2B 1DARA 4TMWA 4ZCMA 3CXCB 1KRHA 2EFGA 2BM1A 3G6EB 4RD0A 4C43A 2PLFA 1OB5A 4G1VA 2BN4A 1K8AD 4HE5A 1J9ZA 4M0LA 4M2LA 4B48A 4RD4A 2C77A 1KTVA 4RCYA 4U9UA 3ZBUA 3MCAA 5AN9A 3SJZA 4G5GA 4TMXA 3CPWB 3AGPA 3QE2A 4Y7CA 4B43A 1IJEA 3A1FA 4LBZA 1E64A 4RD2A 4ACBA 1JA1A 4LBYA 4MYUA 1VQ8B 4PC2A 3ZBTA 4YAOA 1EP2B 3W5UA 1YIJB 2CNDA 4NCNA 2QTLA 1W2BB 4B44A 3WNCA 3W2HA 4DQLA 2GPJA 3CCQB 3AGQA 4R71A 1VQ9B 1G7TA 4RD1A 2DETA 2DCUA 2PMDA 1H42A 1FNBA 1E63A 4YAFA 3VNVA 3CCUB 1QVFB 1GJRA 2BSAA 4FK8A 4QHYA 4RD3A 1QGZA 3CCLB 1D2EA 4YAUA 3QFRA 2B7BA 3AVXA 4YHBA 1VQLB 1TVCA 4H9GA 1QFZA 4J0QA 4K1XA 2GQFA 4LC0A 1VQ7B 1UMKA 2EIXA 5JBQA 1G7SA 4NBSA 4PC1A 1VQKB 1CNEA
chains in the Genus database with same CATH superfamily
1WEKA 1YC5A 2QSZA 1MX9A 3GMSA 1RI1A 1JN0A 1KBOA 3RU7A 3RS3A 4JLNA 5IYRA 3B7WA 1SBQA 1OT5A 1Y63A 4IGFA 3ZHCA 1J1UA 2IP1A 1QF9A 3OW2B 2EW2A 3DOFA 4XUCA 2N1MA 4GM1A 1FDUA 1FTWA 3K2BA 4HDMA 2C58A 3PS9A 1ESDA 4TWBA 4U2FA 3SXUA 1MOZA 4DLPA 3AP2A 1QHYA 3DA8A 1I6LA 1VL1A 2IGBA 2EW8A 3AH8A 3V33A 4YCCA 1JG2A 4BQOA 4RV9A 3AI2A 4XJXA 2K7FA 3NTOA 2CB9A 3MD0A 3R9IA 5C9ZA 3QXSA 1TFUA 3RSZA 4A0GA 1QDLB 3L92A 4XM2A 1NE2A 2GZDA 1U7ZA 1R6TA 4RJLA 3L4BA 2GB4A 2YC2C 4AQYB 2I5PO 3HA7A 4ZEWA 4ALJA 1J2RA 3DFIA 1V6AA 3KB8A 3K0SA 3I72A 5CLFA 1Y89A 2H9AA 3PI7A 3C8HA 4ZRNA 4YFVA 4WOJA 2HJGA 3R41A 2VPYA 4MRMA 1N8RD 1YZHA 1PYOA 4K6FA 4EATA 1MT0A 2GN1A 1TCAA 1N77A 1K88A 1XDDA 2FRVA 4NRDA 3SDSA 1NJ1A 1R0LA 1T13A 2RB5A 2AQIA 5JZOA 1Z5VA 1KVRA 2VPPA 2R96A 3GY0A 2YJ4A 1SPXA 2MOKA 3PWZA 3DAPA 2J0UA 1H4TA 5EMLA 3PUNA 1V16A 2R6CA 5L51A 2E85A 2PA3A 3LNCA 4IX1A 5ILGA 2BZGA 2P2YA 2VK8A 3AFHA 3PF8A 3DHWC 1CUIA 2H5EA 3G8YA 2QGNA 3IIKA 3IT0A 4RK7A 4WN9B 1CB7A 3D8RA 5I01A 3KUUA 5D01A 4BNXA 3UYKA 1IUKA 2DJ5A 4ID9A 2FHPA 3LO5A 3TPCA 4YJ2F 2INGX 2QEQA 1LY1A 3A6LA 3N6VA 4IIYA 4TRJA 2OB2A 4MUMA 3RRZA 4A2CA 4GXTA 3CF6R 2WAAA 3HUDA 4A2PA 4E2FA 4UC0A 1VQPB 3PQDA 4OGKA 5DNUA 4YP5A 2ZIVB 2O2CA 1GT91 4HP8A 3VHXB 1PF7E 3ANMA 4KQ9A 4IDFA 4MUFA 1ZNZA 2UUCB 2ZCVA 3FOAA 1QVRA 2JIDA 4JD5A 5ELXA 1J9GA 1KJJA 4XX0A 1PEAA 1V4BA 1E18A 4O4LF 4Z8XA 3QVXA 2JI7A 3AKEA 3IQDB 1JILA 1CDZA 2HH9A 4H4CA 4WECA 5JS6A 4WTOA 1ZD9A 3C24A 5IYWA 4FCWA 3ZY2A 4G1FA 2J32A 3KKOA 5KKCA 3HR7A 3AEKA 1Q92A 2K87A 1S2IA 4BBPA 4BS9A 1FF9A 1MEOA 1WHTA 1PJ5A 2R1VB 2X42A 2H2WA 3M6VA 4AMYA 3VJKA 4S05A 3IL2A 4FYPA 1WNFA 2GD6A 4R4JA 1DC3A 5TIIA 3VSEA 4HYTA 2ZI6A 3HS3A 5JW6A 4UQOA 4QT4A 3PIIA 3LKDA 4QUJA 2GA9A 2G9RA 4OGGA 2KB0A 5L3SB 3KJXA 3R6TA 3IA7A 1WCV1 3ANSA 1TADA 3G23A 3OPXA 3MTBA 3R09A 2FCAA 2V9PA 4HVAA 4JBXA 1KP2A 3GCZA 3GO4A 3IXMA 3S4YA 1W7AA 4ZALA 4QREA 1YIDA 2D06A 3ZI0A 4DSTA 1YO6A 3C4JA 1T8UA 1U11A 5JSZB 5IM4F 1KAGA 4PG5A 5CLGA 2CYCA 3MS4A 2XKKA 5K0FA 4MW1A 1YBVA 2DG2A 1DT3A 5DBHX 4YHHB 3FUTA 4DCOA 2CEAA 1OFUX 4NX2A 3B6EA 4R1SA 8MHTA 2UYCA 2GJ8A 4FOLA 4A4DA 1G16A 4L6IA 3SJCA 4D42A 1TTPB 1XQXA 3ZE8A 2ZT7A 2PVCA 5CPFA 3UPDA 2V0GA 3OTGA 3HQ4O 3QLUA 2FPOA 4HDNA 3TMAA 3WP1B 2JKZA 3I5XA 1JDNA 2ODQA 3IAFA 1Q77A 3KDSE 2GPYA 4KQMA 2AVNA 2QL6A 3VNSA 3IOYA 4HWTA 3A1NA 3SKBA 2X13A 2HDWA 1JBEA 1T3GA 3GFQA 2CXUA 1G2QA 3UOWA 2FSFA 1UFOA 4BMPB 2X8LA 5CITA 2QLFA 4D9HA 4AIRA 2YMMA 2JI4A 3GFOA 4KFTA 1KSJA 2PN1A 2VBFA 3BREA 1L5VA 3S2UA 2YS6A 3E3AA 3R5JA 4KWCA 3H75A 3KEOA 3HYLA 4KHZA 3SCZA 3UA3A 4Z4UA 4F8JA 4BNYA 3LZCA 2VBCA 3PHBE 5IANA 1RBQA 1PD0A 1H2AS 4R1NA 1T3SA 1XVLA 3ESQA 2WT9A 4U8HA 3SDBA 3Q8MA 1BROA 3M82A 2WP8J 4JXZA 1Z2PX 1T4GA 3GBPA 3ZNQA 2X6TA 1QM5A 1F0YA 5FNVB 3V34A 1SRQA 1Y48E 3HY4A 3T3PB 2VQEB 2CDCA 3E9ZA 1SCBA 4EA9A 1PBTA 4IH1A 4EFDA 4LI3X 3NDJA 4MROA 2OGUA 1PBNA 4W99A 3SOZA 1V26A 1EE1A 1TCUA 3CO5A 2NWQA 4LJ6A 5A5DA 4IOJA 4NHEA 4JUBA 3AW8A 2QVCA 3VNBA 2W6OA 1KVQA 2YH2A 3F71A 5CBKA 5J23A 1WDTA 3IE2A 4URHA 5J4LA 1IMJA 2P6UA 3QY9A 4L5JA 4L75A 3ELYA 4BE7B 1S2OA 4RFLA 4DA4A 2OYNA 5LQKA 4IMJB 1O6ZA 1MV8A 2B2NA 3FDJA 4C5BA 1AQIA 4KR6A 3JD1A 3U37A 3STHA 5ERXA 2X0NA 4LF5B 3QLJA 3Q9SA 4BU0A 1JPUA 4KIJA 5LL6P 2IW3A 3MWKA 5C1IA 2NUAA 3I1FA 1LPOA 1RZ3A 1AO3A 1FOEB 2O0KA 3NTRA 1KU6A 3K73O 5FORA 4YP9A 4EEZA 4M89A 4DSUA 3MTJA 3U9SA 3WTCA 3AY0A 1N25A 4Y2SA 4HDQB 4PFQA 5JXWA 3IP3A 1X15A 4TM8A 2VBVA 3W6OA 4EHDA 1RWMA 2X0KA 4TS9A 3FHOA 3D5TA 3NP7A 1Q15A 3RW9A 4AS3A 1XAHA 4F56A 3FTDA 5KNDD 1IN6A 3E3LA 3JARB 3ROQA 1PWXA 4B81A 1O54A 4H08A 1AGYA 3I6QA 3HB9A 1A2OA 1A7KA 1WPQA 2WFLA 3ZHUA 5I7HA 1RRPA 3OOYA 1FFXA 2M5SA 5EINA 2CBXA 1EIWA 2GLUA 1K97A 2UZIR 2YVUA 5A6VA 3IAEA 3G89A 3USCS 3QW2A 3IURA 3UGJA 3LBHA 5BN3A 1EMDA 1GZVA 2XUKA 2Y68A 4MLDA 3GG9A 5JIBA 3T1YB 1ZC3A 5KNCH 4UHBA 1FFBA 2XZPA 2WTMA 5LYYA 3RT1A 4RF2A 1PW7A 4RMJA 5D2CA 1VJ0A 3RYCA 4EYEA 1T5TA 3QLEA 5SICE 3BH4A 5AW2A 2H1WA 5JAHA 4DJ5X 2QD4A 2PH1A 1YRBA 1FNCA 1Y34E 4ZYZA 1P73A 2QV0A 2J1LA 1J2TA 4JZKA 4UPDA 2P91A 2J6CA 5AXDA 4MR7A 1IBLB 1NUTA 2IODA 1MB2A 1RAAA 1RABA 1VKJA 3KR2A 3NLLA 3WE7A 4AQDA 5K20A 3W8NA 1Z5WA 1O0CA 2W58A 1Z74A 1XTRA 2P4UA 3NJRA 1LW6E 3QOWA 2IOQA 2O5VA 1X1DA 4UCFA 4E0FA 2FP4A 2PH3A 4WCFB 5A1TA 1VRWA 3CVWA 4CRWB 4FJ2A 1Z12A 4LMAA 3WA7A 3U9LA 2Y2VA 4RZHA 5LMUB 2GZAA 2DB3A 2QL9A 1G55A 3PUIA 4Q24A 4WY5A 1G5RA 1GNQA 1O77A 3UJ9A 4FWBA 2UDPA 2W5UA 3FPLA 4LRYA 4JP1A 1YH3A 2D1SA 1RD4A 3F3SA 3RRFA 3OX1A 3UOAB 3VR1A 2WBLC 4DA9A 5AH0A 4M0EA 1ZIDA 2PKQP 3WQHA 5LLSA 5IJ9A 2OLKA 2GZMA 3PDJA 2XTMA 4M8SA 4O3FA 4OHMA 4TV9A 1CG6A 4QT0A 2ZIXB 1GL3A 2JBAA 2XMZA 3EFOB 2HCRA 3PJDA 3CINA 2VJCA 4S1WA 2CK3D 3DDSA 2Z83A 3E5HA 2B3TA 4ZOCA 4LWPA 4YEJA 3WICA 5F98A 1FRNA 3N3AC 1TM1E 5K3AA 1OZAA 5JD4A 2FETA 1LBHA 3AEQB 2BT4A 2EBWA 1CKEA 2XNJA 1VMKA 2HD4A 3BCSA 3OP4A 3OSZA 5E7IA 5FP0A 5T4HA 2W6NA 4MKFA 1ENOA 1WUTA 5DT2A 2DBVO 3KLOA 4EYGA 4ZJYA 5IG2A 3GXBA 3PFNA 5TF4A 4CL8A 1AS0A 2FK7A 3AQ4A 3UYLA 3DKIA 2C5SA 5TR9A 1LC0A 1IOWA 2GR9A 3KSRA 1PNVA 4J0GA 5A6SB 2QBYB 1V7QA 2O5EA 4OXQA 1PEDA 5ALEA 5A9SA 5JEDA 1ULZA 1KFEB 3VZQA 5HZAA 1GTMA 1UPTA 2W37A 1DV1A 1QO0A 2ZBDA 3BPSA 4FMBB 4NG4A 4Q05A 3AHIA 3WIDA 3IDAA 2QGGA 3IQIX 3QLTA 4RLQA 3RSQA 5BYKA 2XYRA 4GR5A 2RJ3A 4JP8A 4Y67A 5EIOA 3VYVA 1XUOA 4FHCA 4JIGA 2BGWA 5ALUA 2ACVA 4IDEA 1S3SA 2BM8A 3WYGA 3AB8A 5MN5A 2DY1A 4I4TB 1SQ5A 3I2FA 5FNVA 1JG6A 3IV6A 3HYTA 1TYBE 3HMKA 4MVJH 4BY9E 2B4RO 2FW8A 1HY3A 1VG8A 4WXMA 3UHAA 2UV8A 1U3GA 4JJIA 2B4AA 3ZCSA 2B35A 3N87A 2FX3A 2OO5A 4NBNA 3LCJA 1OAOA 2F6RA 2O4CA 3DSRA 2OVFA 1ETHA 2O7RA 1REQA 3K9HA 4YH1A 2VYNA 4BP3A 5CHYA 4F4IA 4TWZA 4AZWA 1OIVA 2A9QA 3O8NA 9ABPA 2IZ1A 3ILSA 4UBNA 1BDBA 5J35A 2PSDA 4ND8A 4PLCA 3FJ1A 4OM7A 1P75A 4DNPA 1XTKA 4FIDA 2QZSA 4FE7A 4PZAA 3T1OA 5EKDA 4KQXA 5AVVA 1D4FA 4G3XA 2XWSA 1UBRS 1G8HA 3QE3A 4HRYA 1DKOA 2BM1A 3TLYA 1T4CB 2PL1A 5DTMA 4BFWA 4HDSB 1XEAA 2ZWAA 1PZXA 1KMMA 5EJ2A 3GLFB 1KZ4A 3Q3CA 3WOHA 3H4IA 4MAMA 3UFXA 4BVJA 5KSPA 4CF3A 3OO0A 4ZD6A 5CNJA 2XYVA 1M7BA 5K2MA 4X8OA 4GPTA 1F4LA 5FBVB 3N28A 4E5VA 1K8AD 3KZXA 1WDKA 4I9FA 4NV3A 4US1R 5KYUA 1V3QE 2XVYA 4N8EA 3D81A 2WOJA 1T5SA 3UJ7A 3ASQA 3IODA 2VDOB 4CE6A 4H7IA 2GHTA 5BN5A 3QUCA 5B64A 3JD4A 1CUBA 4I08A 2EX1A 3AEQA 4OJNA 5BUCA 2DHCA 1SUCA 3T53B 2JFUA 3DTVB 4Z9FA 1Z88A 3TNDA 3GUYA 3M5DA 3VYRB 1X39A 1I8DA 3W79A 1JTEA 4KO3S 3M5PA 5JZVA 2I2BA 1XA0A 3TSWA 2ERCA 3IQZA 1QYWA 1TW3A 3RH0A 1EM8A 5AJWA 3VU9A 3KEFA 3OAAD 1YC2A 2WVJA 1KTIA 3CLTC 4JASB 4U9UA 4X0CA 1ZLXA 5LQJA 1V39A 3E2PA 4L08A 5DKFA 1JZQA 1I4WA 2OYRA 1S3IA 1XA3A 1Z3IX 4MWZA 4PGFA 4LV6A 3GLSA 2E5FA 3IUYA 3VZPA 1UBGA 5ALWA 5BWCA 4RMNA 1VL0A 3LXUX 3O0DA 3GLIE 4AURA 4MIOA 4NEGA 1JKFA 3EOZA 4WZEA 4MYUA 1G2PA 4XLTA 3BRWD 5JLAA 3RHFA 4WJKB 1J07A 4CM9A 1TMYA 5FXMA 1UIRA 4AJIA 3OOHA 1PRYA 4Q6WA 2QVXX 3HJGA 4NPAA 5K3SA 5A0TA 2YX1A 3GVCA 2BKXA 4KXQA 4CWAA 1FTYA 3A9CA 4QPJC 1RKBA 3BGVA 4WBSA 1O5TA 2FJ0A 4HS4A 4G37A 1B2LA 1DCMA 1NW7A 3HDVA 1QMGA 4DCUA 1SNYA 4MVJM 4JWTA 4CKXA 3GWGA 5CJJA 4R05A 1YE8A 5FWAA 3WJ1A 1CS0A 3NBQA 4PWYA 2HCFA 3LD9A 4QBFA 4ZK6A 5F5LA 3H6KA 2ZE8A 6YASA 4UHEA 1EKXA 3GJ3A 3AJ8A 1ILEA 2SKDA 2HRCA 3D6AA 4HQLA 4NYMR 4KGDA 1MXHA 2FW0A 1DEXA 1VLVA 1XRMA 2OPHA 3ZXSA 3HPQA 4DMUB 3H1BA 3OWXA 4BNKA 1GJRA 2BSAA 2FDXA 2KLBA 4BO6A 2DX7A 3VC3A 4ZPXA 3MW8A 3NASA 4RPBA 1BIFA 4Q9IA 3GLIA 1MJNA 2CF4A 2WD9A 5DASA 4E3WA 5AK4A 1QYIA 1X7ZA 4KXMA 4HPXB 3FNGA 3B2QA 2VUSA 1D2EA 3Q7PA 4ARZB 1E7QA 2VAVA 3RVPA 2AFIA 4HC4A 5DLYA 4AY4A 2A9PA 3CW9A 4BP8A 2PJRA 3KAKA 1XD8A 2DFLA 2QN8A 5HILA 4AKSA 4C7MA 1AU9A 5CGQB 5EZ6B 4A0FA 4ER7A 5M2QA 1RPTA 1IMOA 3E22B 5JY1A 1QHHB 1V1JA 2PEZA 4YEDA 4ZZ3A 2ZS8A 1F12A 1I01A 4B4WA 5ENVA 1PFKA 4YO8A 1OXSC 4FGKA 4CEIA 4UAVA 4J9UE 3ZNNA 5KYUB 4U2DA 2YZ7A 2NV2B 4G5HA 4B45A 1WSRA 2AXEA 3LUAA 3O4HA 5LCXA 1UMKA 1ECLA 2EIXA 1V3UA 4O4JF 4ENSA 1KQFA 3IHKA 3L7KA 4J4BA 3TF5A 1R8YA 3VKGA 1A9TA 4NBSA 3CNEA 5EG5A 1JDSA 1ITZA 1BS2A 1ZUHA 2RHGB 4FSXA 4MQ6A 4RXMA 3BIWA 5FPYA 4B3IA 3H13A 1E3TA 1X38A 5BQ5A 2RIRA 2WE7A 1XHEA 3RSCA 1US8A 3RG2A 5LDHA 3AY6A 3B52X 4IIBA 4R1OA 1PG5A 3IAM6 2JPDA 2R3SA 1HBJA 4URYR 3UMBA 4N39A 3K4HA 2P8SA 1N32B 1IZ0A 2F3UA 1HLPA 3T15A 3GLGA 1GM5A 1JQBA 1G42A 1D8AA 2QT1A 4M9SA 3AIIA 4ZCRA 2VJBA 3OSUA 4YJFB 5AM3A 4JJFA 1GILA 2V7QD 4P12A 3GRAA 3LCRA 1T0HB 2NVWA 4JXKA 1EVLA 3RI3A 3GIRA 2YVKA 2AOUB 4AN1A 3B70A 4MHTA 2AE2A 4YCDA 1RWOA 2EKZA 2PYIA 3LE8A 4MO9A 3DOUA 4FE3A 1Z5PA 1J8QA 2FV8A 5KO2A 3A4LA 1S7GA 1BCSA 2NU6B 4A23A 3LLMA 1N0IA 1TM5E 2GA8A 2VNIA 2RGYA 2X86A 1G7CA 1KNQA 2YJGA 1VPLA 3FH0A 3IOBA 4JJGA 4N1AA 3CCJB 4G63A 1RI3A 2FEAA 1KE2A 4BLPA 2FUG1 4KR2A 2VPXA 3DAHA 3KAQA 4KR9A 1MX1A 3LPAA 5DWQA 1DGQA 3NCTA 3IBYA 1NUHA 1U3TA 3KVNA 2EP8A 4QDTA 3IYLW 4CV0A 2GT1A 5KTYA 3TB6A 1D4AA 2ES4A 3OOJA 3HHPA 3BY2A 1RRGA 5CAEB 3U3KA 2P3SA 5CAEA 1C0LA 2FX2A 2ZPUA 2GSWA 1VYUA 3AC0A 4ND7A 2CXNA 5FPSA 3QPCA 1ZGZA 2GBGA 3NFRA 1XCOA 2ZJ7A 3BE5A 5G0WA 4P4GA 4UPVA 1YB7A 3RKSA 5MGBA 4FGUA 2G9UA 3NRJA 3VZBA 3D7RA 1QRRA 1EINA 4A6XA 4Q5IA 2I8LA 3D3JA 2BKAA 4LY6A 4AUKA 2YVQA 3A2KA 4DIDA 4GX0A 3MMPA 1V43A 2PFKA 3MLAA 1ISRA 4F9TA 4O1MA 2NO1A 3R4VA 1VIYA 1NR1A 2YYZA 1H5QA 3CE9A 3L0IB 4JENA 4ETMA 4JT2A 2ZCJA 1Z2OX 3R3HA 4GLOA 1B7GO 2O3QA 3KLPX 4XD7D 3U39A 3H0CA 4GI7A 4Z9XA 5HUQA 1OV4A 3U40A 1ND6A 3MFQA 5JVDA 3DXFA 1JWBB 4KPFC 2XODA 3ROFA 1GAEO 3IJRA 1AS2A 1O95A 1EX6A 2N1BA 1POXA 2GZRA 4UUMA 3LUPA 4JLVA 1PT5A 1O2DA 5DLPA 3AK4A 4UZFA 5BR8B 1Z38A 1W48A 2F7SA 2CVOA 4BRWA 3BBLA 1QK5A 1JDUA 3MWEB 2H63A 1ORVA 4CCWA 5IT4A 1GTG1 3CIFA 3I12A 2AOXA 3ELBA 2UKDA 4GOND 4BLVA 1E1LA 1V0EA 1QYDA 3K0CA 3OQBA 5DX8A 4D80A 4TKZA 4KQCA 4MO2A 5DF1A 3HYRA 4BO4A 1SVOA 1TM7E 1G3RA 3KHUA 2AXNA 5BT9A 4CMEC 3UGQA 5EJ8A 3MGKA 5JMPA 3UAZA 1CS4C 1NBIA 3BTUA 3C3CA 1QH0A 1CVLA 1FJXA 3JQ7B 3C87A 4PICA 3HV0A 3G9QA 1OI3A 2HSDA 2JCYA 3DFMA 2XWPA 3QTBA 4QOFA 2E82A 4EUKA 5E4TA 3NKVA 4CV1A 3NZEA 1LVGA 4F3YA 1WOMA 2G1PA 1B2RA 1YJAA 4C7KA 2Q1UA 1G6OA 3B6KA 3UJAA 1Y8ZA 4R8LA 1SCNE 4D9BA 4EELA 4KPEC 2EJWA 2RGWA 3E58A 3UMJA 4W1RA 1F2TA 5FPQA 4U02A 4DA7A 3WRYA 4AMZA 2QP4A 1VHDA 3EDRA 3V9PA 1QGOA 4X24A 3R76A 5KYVA 3FCOA 3HJFA 1Y9ZA 2Q3HA 4L85A 3A2LA 2FNAA 3L40A 2VRNA 5CX1A 3FVVA 3TMYA 4BJHB 2MR6A 1MB9A 3KOYA 2GZ2A 3E7DA 3EMKA 5DZSA 4NYMQ 5EJMA 2CSXA 3QSYA 4QVGA 1Q83A 2JEOA 1S1CA 5T3UA 1RJ9A 4JDUA 4REMA 4AG5A 3MN1A 1ZONA 1DIRA 1MTOA 3QF4A 1LI5A 4FILA 3ZLUA 1R4AA 4HQKA 4ME6A 4NL4H 1UUFA 1Y6ZA 4ITRC 5IYPA 3IBSA 5DHPA 4F97A 3HXKA 1MAWA 1QWSA 3BOSA 2ILTA 3MUOA 2O2XA 2FOXA 2HFJA 3AEZA 2WNSA 1A0OA 1DO8A 2GNOA 2GBIA 2D54A 3DW1X 5JJCA 1Z3CA 4Y2TA 2E21A 4XVCA 3LCCA 2DE0X 1UBCA 1R8XA 2VJJA 2YY7A 3SEJA 2ZVJA 1SUEA 3HFGA 3PDUA 2X0EA 4ZHQA 4B4KA 2FR0A 4D4KA 1ZOPA 1WBJB 1X94A 1BH2A 1MB3A 3S81A 3IEKA 2Q2VA 521PA 4DM7A 3OO1A 2FPUA 1R9JA 1OYYA 3PENA 2BFDA 3FMGA 4HD8A 2Z6AA 1L7NA 4HWKA 1HYHA 1QG2A 4HYQA 2RHJA 4XYEA 4CG1A 1TFRA 4QU0A 5CT8A 4XIFA 3RVNA 1L7OA 4TV8F 1GPUA 5K4AA 4J1TA 3GAFA 3EXHC 4OK5A 4R5HA 5JMOA 2QYTA 3PSHA 4FYYA 2PLAA 4F7WA 4K5QA 1XTBA 3NIGB 3RQSA 4YCLA 4M6WA 3EA0A 2GCPA 2IYRA 1S2LA 4U2BA 4D3DA 2QENA 1T3TA 4N65A 4BASA 2YL2A 4L07A 1CY4A 5CJPA 1TXGA 2C9OA 5KYWB 2Z6QA 2ZIFA 3L4EA 4EIWA 2B8EA 1NLFA 3JWEA 1LK7A 4D6YA 4J9VA 3I6ZA 3UGTA 4LW8A 1U7OA 3A4MA 2YW2A 1EJ0A 4HDRB 1O96A 1G8SA 2EWMA 3NBFA 4U9HS 5FUBA 3HM2A 2TMDA 1NN3A 1FSGA 4LXQA 2VJOA 3SS9X 1M2JA 5FV7A 3KE8A 3AKZA 1A4RA 3J80A 1Q1GA 1CRWG 3KWJA 3PNMA 3QPWA 1D6JA 3BWMA 4PN3A 4RXTA 1NMZA 1VP3A 3HUTA 4BYMA 3QJGA 3OA0A 5M04A 3KB6A 1EJ6A 2CUKA 2WPDD 3I05A 2XRZA 1PR9A 2ZZQA 4EAAA 5EP4A 2AN5A 4ZWNA 2EKLA 4BTVA 2PSFA 1YR3A 4AP9A 5L4NA 3HKDB 1RHJA 4HDNB 2ZYTX 5JECA 4NKRA 3OT1B 1D6NA 5C8DA 2YZ2A 1CS0B 3JQFA 3KTDA 4FMDF 4PBTA 3ER9A 2X0DA 2HRDA 2B1RA 3RVRA 2IPLA 3ICVA 3H9NA 2RFLA 1XVIA 2O7QA 3K9WA 4PZPA 3X1YA 4P7GA 3JQCA 5D5HA 2XXAB 2P2ZA 5C31A 1SOWA 1JG7A 1H8HD 3ZVRA 3IPYA 4MJXA 1AV7A 4EI9A 4M1EA 3SX0A 2AMJA 3EXIA 4OQNA 5A62A 1E2PA 3IESA 1N8SA 3GPBA 4X92A 4ER5A 2AZTA 3THYB 4KUGA 2WYWA 1M5UA 2QRVB 2WSSA 2V6BA 3KJZA 4MVWA 2B83A 5M5BA 1A9QA 2DWUA 1XZEA 3C1OA 1LLDA 2YXDA 3PC6A 3PI6A 2WAXA 1ZH4A 3IBTA 3W1EA 1MOPA 2CMGA 1DWOA 4N7JA 1POWA 4X85A 4C6TA 2XBLA 1MGOA 5JPCA 2IEDA 5JFOA 2R7KA 1WCYA 4XIIA 2G07A 3ZQ6A 1Z08A 4KW7A 1X1BA 3O90A 3EGVA 2MYPA 1KI9A 3HTXA 4FKMA 4NMMA 1VJTA 2FFAA 4GQNA 1AY0A 3DE6X 4IVPA 3TIIA 4EB8A 3FVQA 1PZEA 3EVBA 3JRWA 1Y1KE 4HPJB 2X6YA 5HS6A 2AKEA 4LF9B 4A73A 4G2NA 3O4GA 5ESXA 2G82A 3AEKB 1V41E 1L5HB 1BXRB 1WOPA 1P0MA 1E98A 3DTNA 3RS5A 4CEIB 3T9BA 1N2SA 5REQB 1WULS 4FLEA 5HKKA 1C4XA 5T5QA 1W25A 5C81A 4XYLA 3ICPA 4DC1A 3ZUGA 3WNDA 1RIFA 1KFBB 3MBOA 4P3YA 3MUNA 3QENA 2XNKA 3QKWA 4MP3A 4PLYA 2GEDA 1JE1A 4W1PA 1IEWA 1SKUA 4G5FA 1BWQA 3BHNA 5BXQC 1RRVA 1LDGA 3M70A 1HE1C 1C3LA 4RPKA 1KMHB 3FNBA 4B4VA 1GSAA 2IXTA 4FTWA 4TVBA 2VF2A 3MEQA 1AQYA 1ZQ1A 3M1LA 4FBMA 1UKVY 4W82A 2FPPB 2J3LA 5SZHB 5JSZA 3FKQA 9ATCA 1RS0A 1SXJB 1YI8A 1ZCZA 2QPTA 2UVPB 3BWEA 3GLQA 1FDVA 4HXYA 3S1LA 3LFTA 2P9GA 2Z4SA 4IIXA 3PLRA 2YYSA 2FPIB 3E9CA 4BATA 1PJ2A 3DR5A 4OU5A 4XR9A 1NRWA 4TSKA 1K1EA 2VF4X 4PO1A 5HP4A 3SZMA 3RADC 1H0RA 1Q7BA 1H6BA 4FEGA 3N0VA 4EKYA 1JKJA 1RTKA 4AWXA 2G83A 1XD9A 3KZ1E 2AFRA 3LBYA 1MFPA 4XLLA 1ZK3A 4MYDA 1BMTA 3PUMA 2Q4DA 2OXIA 3GZ4A 1ESMA 4JL6A 1E7SA 5G3YA 4B80A 1NNI1 3CISA 2F1JA 3VX4A 2XGJA 4CM8B 1LQTA 3H6GA 4D4HA 4ZAVA 4AKIA 1JTVA 2XTZA 4RJ2A 3EUEA 3KZMA 4ZI2A 721PA 3CONA 1VCHA 4AJNA 1U1EA 1C0EA 1USUA 2Q5CA 4ZXPA 4DMKA 3OJEA 1RYBA 3ZZUA 4RVHA 2UUBB 2B4TO 2G40A 2A5YB 5EXDA 2R4UA 1WVGA 2FE4A 2I34A 3B6IA 1YB1A 4I8XA 4II7A 5CDTA 3P9IA 2J3KA 1TTQB 4EG1A 2ZRAA 4QSMA 2VP3A 2VDQB 1W1UA 2WYVA 4IX9A 1GUFA 2P41A 1QCDA 1XK6A 1IXYA 2XT6A 4FYHA 2ZYDA 1IHXA 5CFMA 1HK7A 1I51A 3D2BA 3OMLA 2J3DA 3U6KA 1DIHA 1P9OA 3IP1A 4ZVRA 5K0EA 1ADJA 1I6KA 2YY5A 5IBQA 3HP4A 4N82A 3K7EA 3BDAA 3GPCA 5E6RB 1GA1A 1QRDA 1PZMA 3T3DA 2ZZFA 4KL8S 3L0BA 2O8BA 2Q5OA 3NAGA 1RT9A 2Y1XA 3I58A 3R7WA 4F5YA 3ZD7A 3F3KA 2R44A 5FI1B 2IBTA 2OCYC 4MIYA 2QE7D 2PXAA 3VTZA 4EO4A 3KFXA 5E3JA 2QLMA 1TQHA 4LMBA 1C3OB 3DUFB 3PPVA 1XDUA 1TC1A 5TRDA 4D9EA 1XDSA 4RY9A 3GT4A 2Q2WA 3OKPA 2ZVDA 4LHXA 4C7XA 1U2QA 2X23A 3HFSA 2ZUVA 4RHUA 5BSEA 1KERA 2RH8A 3OE4A 1P33A 5EWLA 3WDLA 4E94A 2IOHA 3TBKA 1KMCA 1YDWA 1WW8A 3PFWO 5EKXA 2UUAB 1OH6A 3OW7A 3IAUA 2J6BA 2H7XA 1I3OA 3L0CA 4G67A 4ZMBA 3H9JA 3DUWA 3GPDG 4LYHA 4V03A 3LBNA 2WW8A 3AI3A 3PLAE 1DAPA 3BHJA 2RD2A 1B4DA 5CA0A 3OCVA 4X05A 5AXBA 4GBMA 5BWNA 2FVGA 1CJBA 2VDNB 1KMNA 5HS4A 1AOXA 1NBAA 3CRNA 4CZ2A 3NYWA 3ENWA 3QVMA 3V97A 4X7EA 1AKQA 1XVAA 2XQFA 3NBUA 4JN6B 4UHDA 4CM4B 3U1TA 2CYBA 4ZJPA 5IJ9B 5F5XA 5IJ0A 1AKRA 2HLPA 5K4GA 3AIKA 1A5AB 5B2FA 3I61A 1W2GA 1A1VA 1XFAA 4LBZA 3CN9A 3LLVA 1E6KA 3K2IA 3L82B 1ULHA 3RRYA 1L7RA 1OVMA 2PV0A 4FOSA 2WFLB 5I3CA 5BSGA 3KHKA 4XQCA 1GG8A 1T9CA 4NFLA 4IM7A 2G04A 3ZQ4A 3KNZA 4BN0A 4BO3A 1GZ6A 2JJ2D 4DA8A 2RE8A 5IAAA 3ORYA 3PEYA 3EPLA 3RRNA 4JU9A 2VDWB 1RC1A 3D5EA 5DISB 5IVPA 2OXTA 1FDWA 3G68A 3P2EA 3GJ0A 2DETA 1DADA 1W5SA 3EXAA 2OCLA 2FZCA 5HJ7A 1BGVA 2O7NA 3KAPA 2H57A 1RWPA 2Q0QA 2XQVA 1EDBA 4OQDA 4P33A 4ZQFA 4YP6A 3GP5A 1XMQB 1ZSYA 4CN8A 3GRUA 2I1VB 4IV8A 3M4JA 5FLXA 2P9TA 1WUHS 3ADKA 3NIWA 4JB2A 4GEGA 4JJ8A 1D6SA 1TT5A 1Q0LA 2C3UA 2HA6A 3LUHA 4C04A 3HACA 1JIXA 1NQOA 2IW1A 4FKZA 1DB3A 2WFMA 3PUYA 4QHYA 1IBCA 1ZN9A 4RPGA 3KHSA 4ZA2A 4A2WA 4NJEB 1FNSA 4D5EA 1SD1A 1V2GA 2JDID 4LWOA 4ZGBA 1NVDA 3BWYA 3G9ZA 2FDRA 3DZGA 4MS4A 4NI5A 1TMOA 3EEQA 4EGQA 1F6BA 3SBEA 4Y2UA 1I4OA 2B7BA 3BZUA 1GNPA 4MPJA 4C01A 1GD1O 1MQSA 1W2WB 1COWA 3C3AA 3O73A 4EGFA 4U2EA 4QYTA 2HEIA 4LYYA 1YRYE 2GEKA 1AA9A 1YDHA 3I9V1 4EJMA 2PKYX 3EZ7A 4FMPA 1QBKC 2WMYA 4GBJA 3O4JA 3NHFA 2JBHA 1E2NA 3LWZA 2BMDA 1ZOSA 2IVZA 1C7FA 3HGTA 1NVMB 3NNDA 1Y0YA 5A5EA 1V45E 4CM3A 1HF3A 4C2UA 1S02A 1X1TA 5ISMA 4KXXA 4WERA 1ONPA 2A9FA 2YFYA 5IX8A 4G4SO 1GPWB 2R6GA 3ZTYA 4JI1B 2UYHA 3MRSA 1NJ8A 2H4ZA 1JFSA 4QRHA 1ZUNB 2B2XA 2QZ9A 2R62A 2AFVA 3OTOB 3FYUB 3N39C 5HMMA 2MSLA 3WKBA 4CDGA 4RENA 3DFUA 1UQRA 3BWCA 3B1VA 3B9RA 1Y9DA 2OP1A 2CDBA 1HE2A 4K9PA 3RBZA 3V2IA 2JAWA 4LOJA 5DGXA 2WB2A 2ENUA 2HSGA 2QUBA 4D79A 4PC3A 3KYJB 4KXLA 1SCKA 1J20A 1P4JA 4NAVA 1B1CA 3OFKA 2HA0A 4KWIA 4XFJA 3B2NA 4NG5A 3VOSA 1I4EB 2A94A 2ZUEA 1P1FA 4Z4CA 1J7KA 1Q50A 5FYDA 2V58A 5KWVA 4GEKA 2J0SA 3EGXB 2ROQA 3LUJA 2R86A 3HDGA 3RAGA 2JFOA 5C7OO 5LU8A 5H70A 3O26A 3QBDA 3AKYA 1KO1A 3OU7A 5G0TA 3JZDA 4CLDA 1R6BX 3CX3A 4ADSG 3WWDA 1FUUA 1YJNB 3QEBZ 3KLBA 2IIBA 3SAJA 4QECA 3Q8KA 4RSGA 4OHCA 1JE0A 2AB0A 4KJXA 2BZSA 4PG8A 2Y8EA 1YUBA 2HPAA 1JLRA 1WZUA 3DBHA 4UBJA 1ENZA 3VC1A 4I8DA 3I09A 1FFEA 4JB3A 3PXEA 2R2AA 1NPTO 1WLSA 4J90A 3AF1A 2JIQA 3GGOA 4K03A 2EGHA 2IE0A 4PEVA 3K1AB 3CUUA 2F1MA 2PPLA 4MWEA 3ND6A 5H5JA 1VLHA 2C00A 5CUQA 3PGVA 4QNMA 3P2OA 4TQ9A 4F86A 5L9AA 3IILA 4CF4A 3Q9NA 4MQLA 1CY7A 3JY6A 2EZ9A 4G41A 5L95A 5AVKA 2G17A 1FP4B 1LSJA 3WXMA 3K96A 3N8KA 4GDMA 3FROA 4LXIA 4RDIA 1R0YA 3LC1O 4CTMA 3RFXA 1BFUA 2PD6A 2ZDHA 4PLHA 4ZVMA 4NOMA 1FJ2A 3ODGA 3T5TA 1UBSB 2DY0A 2ZLBA 5A0FA 2HW8A 1IVSA 3A6KA 1FSZA 2A92A 3JQPA 2VWPA 5DI9A 2DSNA 5LB4A 4N8DA 4U0KA 2IYYA 2AI3A 1W88A 4O4LA 2Q3BA 2G1UA 1LNSA 2PNJA 3BCRA 3DZJA 4FINA 3UB2A 1SKAA 5B7QA 5H59A 2LKDA 1O5IA 3CPJB 4BMZA 4CVNA 1UBHS 4EGCB 2Q7DA 3P52A 3SHOA 4BLQA 2PMEA 3U49A 1JXQA 5AXAA 2OFXA 2CHVA 3VU9B 1EWKA 2CVZA 1JS1X 1SK9A 1ZC4A 3CJTA 3WKAA 3ZHYA 4QNRA 3FOWA 1ZVKA 1SEPA 3LC7O 3L18A 4C5CA 1KK2A 2NUBA 3IJPA 4RSHA 5E3HA 3NVMB 4FWIB 4DJFC 3QQ5A 3KQYA 3TQFA 3RC3A 3G3EA 2H1OA 1K63A 1QNFA 1Z6GA 4TT3A 1MJFA 3V8EA 1J9EA 1M1YB 1SXPA 1MVLA 4M60A 2HQBA 1N07A 1QH1B 2MINA 3I4FA 3M6IA 3PFHA 4I6GA 1BW9B 2B25A 2AK2A 4HB0A 1OZ0A 4AUNA 4R8SA 2QRQA 2BVNA 3R5HA 1B14A 1B76A 4MPTA 4DLWA 1A97A 3DDHA 1E3LA 2PUGA 1HE3A 2LNDA 2XZDA 4AJPA 4YI5A 1E0SA 4TSRA 4RMIA 5MHTA 3JZIA 4CGZA 4N7MA 3TTYA 5LIPA 1SCJA 1VSBA 4IKPA 4JP3A 3GGCA 4LQDA 4BJ5A 4AY3A 1DELA 2DPXA 4LGCA 4O4IF 2C92A 1SO8A 4A92A 4NYJQ 1ZD5A 1N5KA 2IHKA 2NLOA 2WWGA 4WUVA 3ONFA 4B79A 2YWEA 4PNZA 2QA5A 3TD9A 4EK9A 3TQCA 1SUDA 2X77A 4Y9SA 5DHUA 2QW0X 1W0JD 3RM3A 2NV6A 2PVSA 1QORA 2IDJA 1ODFA 3HZZA 3UA4A 5J2UA 4A03A 2ZRNA 2FXIA 3OM9A 5ALPA 1UZLA 3AR4A 4MUIA 4NYIR 5FTMA 4EY5A 1R0KA 4FGJA 4TKUB 1JHOA 3KZKA 4M99A 3ROKA 1U5CA 4P6VF 2QN7A 3CSDA 4Z4HA 2VRWA 3RRXA 1DC5A 3Q10A 5M34A 4OVKA 3H8SA 1NFQA 2B4QA 5E8RA 4DMLA 5CBPB 2FMIA 2X9VA 3PGXA 4Q34A 4P2NA 1FTSA 3JYQA 3Q12A 4ZDJA 2ZYHA 4WCVA 5EMHA 1ILWA 5IEJA 1M1NB 2M2IA 3FMOB 2VO1A 3TXYA 4L0DA 3T5MA 3X1MA 5IKEA 2QUZA 3CD6B 2QN9A 3GEDA 4D7AA 3U44B 3GK3A 4L9RA 3V1LA 1UOQA 2J4CA 3JARA 1N78A 4HJRA 1E89A 3H1PA 3BILA 3K32A 3O0TA 3HPRA 4LY3A 2J3QA 3D02A 3NHZA 4ENRA 1D1NA 1Q11A 4Q3AA 1Z45A 3VPBA 1E4YA 4G8JA 3MMSA 4O4LB 5I9LA 2PKRA 2PZGA 1L5LA 3LW8A 2R1VA 3PUHA 3UJBA 2C5LA 1C9YA 1Q0SA 1U7TA 3Q8LA 3GQBA 1G21B 2IIPA 1K7XB 2BTOA 1DDOA 2IUYA 4NIMA 5ECGC 3W6UA 3PUXA 1BA2A 4OPMA 3NQ41 2AEFA 1XLTA 2VP9A 2R751 3TAHA 1EK2A 1HZZA 2GD2A 2IE8A 1MO3A 3MT0A 1Y9AA 4K9DA 4MCIA 5ALXA 1EFRD 2D59A 2JLCA 3BH6A 2BUBA 5FBLB 1SZCA 3SJPA 3V7UA 4R54A 3T5GA 1TLFA 1KZYC 1JQAA 1P1JA 2NO6A 4HNSA 4Q16A 2O2IA 3OE7A 1W4ZA 4Y9RA 5BMVF 1UC9A 1FFAA 2VHEA 4ZI7A 1T15A 3U0BA 4YP1A 4CKBA 1DCTA 3EYAA 3KLNA 1AKUA 4OTZA 1IQUA 4K6OA 4KRXA 3T9CA 1R9GA 1WPRA 2H52A 2J7PA 3AFMA 3SXPA 1RACA 5BR7A 1QIFA 1SU8A 1NXXA 5FUVA 1SIWA 1MABA 4YJ2B 5JMTA 3A3OA 5BN1A 1K8XB 3UWMA 2QXYA 5HKBA 1AE1A 1DC6A 1U7PA 4I1IA 1HMPA 3ZK7A 4F4HA 3R3YA 1WCWA 3MC1A 4LZLA 5IJ0B 3I5MA 3IPLA 3VKWA 4CHGA 2FUKA 4PTLA 9MHTA 1XI2A 4ZYLA 2X4GA 4TXNA 3D8TA 1K5DA 1QTIA 2CRVA 4L02A 2KHZA 1YB2A 4WA7A 4CMBA 1XXLA 4FC7A 4GMDA 3SLNA 3S68A 1A3CA 1Q1BA 3FPPA 2JHAA 4HLUA 4AO8A 3PPXA 3WRVA 1IQRA 4RESA 2MSWA 3O3OB 4ZQGA 1E5DA 4GQAA 4LOHA 4DOMA 4AY5A 1GPJA 1GQYA 1IZYA 2R97A 4F12A 3KJEA 1TAQA 5DM1A 5AJTA 4HRXA 4DLKA 3MWGA 2X0RA 4X93A 4RELA 1W4LA 4AN0A 3ME5A 1RM5A 1U0HC 1QHIA 4Z7QB 1C3EA 1YD7A 3L4SO 1J99A 2Q3MA 4LHSA 1QYVA 4K3UA 1N5MA 3Q6IA 1SFRA 3ZW8A 1ZK4A 4G0NA 3OF2A 3QUTA 1AB5A 2VP0A 4LJ9A 1NI5A 4ARAA 5DGHA 3PNVA 3HDHA 5FPPA 3IPAA 1NSYA 4LZZA 1UWVA 4F21A 1SH7A 4MI9A 1Q84A 4O5OA 4NBRA 2QXUA 2QLNA 1FP1D 3EGOA 4N4AA 4E4TA 5L45A 3AHFA 1SKMA 3OCJA 4ILEA 4B35A 1KQSB 1T1SA 2J87A 2YVLA 4TS1A 1R0CA 4WMLA 4WOKA 4CLHA 4NY1A 4UM9B 5JH7A 1GIAA 1CUVA 2BGIA 3THRA 4Q9KA 3RRMA 3LPNA 4GMXA 1GO2A 2X5KO 3KFVA 2VEDA 3PQCA 2Z2ZA 4AP6A 2B8NA 4B32A 4I1PA 1Y9EA 4RDCA 1SQFA 4L2IA 4YALA 2BFWA 4YRKA 1J2YA 4ROTA 2ONJA 4X62B 3T06B 2H4WA 1RXWA 4EA8A 3EUFA 3COVA 2ZTMA 4NK5A 1L4LA 1TIBA 1UJMA 3AVUA 2ZIUB 5CDSA 2VH5R 4FYWA 4JP5A 1FVFA 1T35A 5SY6A 5K8LA 4XWTA 3A1VA 3UJNA 3N53A 4G65A 3TTUA 1DG9A 1GGFA 1YGYA 1T2CA 2QRNA 4IEIA 4MULA 3VNAA 1A9OA 4BVHA 1YZLA 4NJOA 2V98A 2OLEA 3CPSA 4I99A 3SC6A 5I4IA 5DLEA 1RCTE 4KEAA 3W5SA 1FRVA 3KLMX 1YU9A 3IJ5A 5I5GA 2UVQA 5DX0A 4EUFA 4HV4A 2PZBA 3CE6A 1QXSA 4LGVA 3OQOA 5L7YA 4AKHA 2EQ5A 1I4TD 1V11A 2JNWA 3L1IA 2ZSKA 5AW3A 5HQJA 2POQX 3C1UA 3RANA 1Z34A 1B0UA 4JNKA 3B51X 3ZDQA 5D3MA 1UWCA 2QTZA 4LDNA 3QITA 1ZG3A 1T9KA 2YR0A 5CDGA 2JLXA 1M34B 1KETA 5LIRA 1NMEA 3E0QA 4CGYA 1YACA 4D8UA 1Z68A 4YMHA 5TJHA 4L4SA 4RFSA 3I56B 1VF7A 2EW1A 3EGWA 1IXKA 3KUXA 3AM4A 3N2ZB 4ZVOA 2X4LA 1ZIYA 1E3ZA 3TOXA 1A9ZA 3R9XA 3H04A 1T1IA 3DTVA 3JWJA 4I4LA 1DXHA 4X1IB 3UPTA 3QU7A 3UUEA 5BSVA 2IGTA 3EJ6A 1WU8A 4YWJA 4EKDA 5ABPA 1YZNA 1MORA 4G0ZA 3JYPA 3UJDA 2J07A 3U4QA 1VJGA 4GPBA 3WLEA 4B73A 5IBCA 1XR3A 2DQSA 4FZVA 2X6WA 1TUBB 4WUTA 4WXPA 3BTOA 1IIBA 3NMUF 2C29D 2AUMA 4MRVA 4L78A 2OBFA 1K5GA 3BGDA 2OO3A 2QM8A 4DCCA 4JKYA 1DHTA 3G7UA 1FX1A 2HHAA 3DVLA 3MXTA 1LLQA 3L41A 4E2XA 2JA2A 4G1EB 1RXYA 1UOOA 5FOQA 3OLCX 4JLAA 3ZQJA 5B36A 4F8YA 1TK3A 1JJ2B 2G1JA 2EJBA 4H1TA 2CLIB 4Q3DA 3FFWA 3O3CA 4YJ3A 3LCVB 4J16C 4ZU1X 4DDMA 3OD1A 5LBIA 1U1DA 1XBTA 3F6SA 1GPAA 4ND1A 3AY7A 1FTGA 3I2YX 3D3QA 3G6EB 3G0DA 5AI9A 1KR5A 5C0OE 2Y3IA 1WF6A 2YXLA 4O0MA 3U3OA 3DFZA 1F2UB 2HSWA 3PYXA 1N2OA 3WK7A 3Q9UA 4IGIA 2FJUA 2FQXA 2AE1A 4J7AA 3SIRA 4XCXA 5B1HA 4QXOA 3WC4A 3I9V6 1II9A 1VHQA 5LYJF 1CEEA 1HT1E 3L7BA 3LFUA 1SGWA 1PNTA 1U3FA 2VBGA 4IJVA 3WHPA 1X1SA 1UANA 3ESAA 2HBRA 2MU1A 3D6HA 2I6SA 3FWKA 4HGNA 1TOAA 2LRHA 3GD5A 4KBYA 2P4QA 4UTZA 5EXXA 5EYPB 7AT1A 1YRAA 1JBQA 1GPKA 3JTEA 5F76A 3MCZA 3RUDA 5ED4A 4JR1A 1QP7A 4MV9A 4UE3S 5KJFA 3LPMA 4C30A 4CEHB 2V7UA 1L1EA 2VAWA 1T9AA 4KVGA 1TEZA 3BE8A 1K89A 2A7QA 2HJVA 4RW0A 3JQAA 2HQ1A 4FHZA 4PBSA 2VQSA 2DH5A 3BXGA 3KHTA 2V0NA 3G2IA 1OLXB 3L49A 5FF9A 4U00A 5JCXA 3BORA 1NBEA 4B2IA 5K99A 4B6JA 3MCAA 1KC1A 3I30X 5ED0A 4TMXA 3CPWB 2HF2A 2WILA 3GLUA 3IMCA 2C2HA 4WLOA 4CNBA 4CPDA 2X15A 4XWOA 1FA9A 4PG6A 2D13A 4F2PA 2O48X 1MD9A 4Z1MD 4L27A 3DNMA 1N2JA 4V0ME 4XJTA 1RRMA 1N34B 5BSHA 2GPWA 3F5SA 5T57A 4FQ7A 1PS8A 4QVJA 2W6IA 2ONYA 3G6WA 2ZPAA 3L6DA 4PC2A 2X1LA 3O6VA 4X3PA 3F6PA 3CX8A 2EDAA 3UHPA 3WZLA 2BAGA 5EEHA 4E32A 1D04A 1SXJA 1DAGA 3IIEA 4MYHA 1TA9A 1Y4UA 2C4KA 3WNCA 4IBOA 4JLUA 2GPJA 1UXKA 2WJZB 3UH0A 1TYDE 1N92A 2OCPA 4OP1A 5LZ7A 5BR1A 3C3WA 5EJ4A 5KTRA 3KZOA 3S27A 4CM4A 1TAGA 4CMKA 4EY4A 4ZV9A 3QYPA 3CZAA 1ZVVA 3PFGA 1IBRA 2LTAA 4JJAA 4JU8A 1PSZA 4X44A 3T7DA 1FBTA 3B6ZA 1P2SA 4BMYA 3CCUB 3GLGE 1RLMA 1H0HA 2AJ8A 2HXGA 1GZDA 5GPBA 5ESWA 1XNHA 1E0DA 1GA4A 2ZR9A 3K5HA 1Q57A 4EO9A 3EXFB 5LM3A 4H3HB 1NQ5A 2C9BA 4I1SA 4V0MA 5AOVA 5A88A 3T4EA 3U44A 4FZRA 3DO6A 4B6RA 4YAUA 3IKJA 1ZITA 3ROPA 1Z73A 3S28A 2B69A 1CBUA 2CK3A 2N3ZA 4YPOA 3TKYA 4LHVA 2GO1A 5CCXA 4JLMA 2V1UA 2ZTHA 2VRCA 4KE8A 4RS3A 4NMXB 3ZHZA 1RW4A 2VJMA 3H5AA 5ICFA 2QUKA 4YFYA 1AQJA 2ZT5A 4JVNA 5CT6A 3HFJA 1CZHA 5DTIA 2Q5EA 4FFMA 1RYDA 3LUBA 2P67A 4MKZA 1NY5A 1VSTA 3A9UA 3DJFA 1YQQA 5I7FA 3GP8A 1UKCA 1IPFA 4X7BA 2LVBA 3ILVA 5HG0A 4YCNA 3GFFA 3MAGA 5EIAA 3ROZA 5KS2A 2A86A 1M33A 3AY3A 5F2OA 5TMPA 3ZDAA 1XMJA 1XA4A 3TE7A 2DPHA 1RHUA 2E4WA 1JHVA 3B53X 1LQ2A 2QTVB 1QQTA 3QX9A 2ZIWB 3PQEA 1Y42X 2PMBA 4X97A 3FXAA 2XF2A 2C4NA 3NDBB 1G8MA 2VPZA 2IQIA 2XUGA 1Z82A 1XD2A 4KBGA 2GPNA 2C07A 3H1EA 4D8VA 3TSOA 4FYXA 1ID8A 1CJVC 1L1RA 2WJPA 3LXXA 2VZEA 3IT1A 1N7HA 4AS1A 3NGLA 4J91A 1RDFA 2OR3A 1ABFA 1FDOA 4RV5A 4FKBA 3TW6A 4F4JA 4A26A 1T9GS 4U1RA 4GYJA 3DDYA 2XKJE 3KQWA 2N42A 1E2EA 1E9DA 2FWNA 1UWLA 1E77A 1XXHA 2VJLA 3JASA 4MDFA 5AW4A 2Q4BA 1VZ3A 3W2GA 4BWYA 1JSXA 1X9HA 4HB2A 3CLTD 2A3NA 3EVGA 4LJSA 4EMTA 3E8MA 3LY7A 2OV6A 1NC3A 4FFNA 2O59A 2XOKA 2QYSA 4R1UA 3U9TA 4WQMA 2ID7A 5IN4A 2HX1A 4V0RA 4F6LA 1WE2A 2VDJA 1A2BA 5FB3A 1J25A 3EG9B 1SM4A 1LBQA 3G8CA 3SYMA 4B84A 1Q95A 1EK0A 3DHEA 5D86A 2Z5FA 3AM5A 4NCKA 2B94A 3GQVA 1RYEA 3A6EA 3UB4A 5EI5A 2NX2A 1LVHA 4L9WA 5YASA 5CFLA 4O1HA 2OFPA 2ZSDA 2QT0A 3IAAA 2CDNA 4LPSA 3FMIA 3OFNA 4EVQA 1YJ9B 1UMDA 5EZQA 4HFJA 1TRHA 3EXFA 3VNQA 3U5TA 2QTWB 621PA 4MARA 4Q4HB 2PMKA 1BMDA 3B7GA 1OREA 1GT6A 1RWWA 3E2MA 4NCIA 1N6RA 4WNCA 1YQXA 3V2GA 4C07A 4N03A 1YFZA 4L72A 1JTFA 1R27A 3DQQA 3P9QA 1IUPA 2V6JA 1EGVB 2ID9A 4Q4AB 2Z3WA 1X14A 5AICA 5LP6A 1WXWA 1N2EA 3NATA 5BYAA 1JPJA 1ECPA 1DC8A 2FSPA 4LCEA 1A50B 5JY6A 2R0QC 3FB4A 4ACAA 1KY3A 2BFEA 5FFMA 4D9IA 3ANTA 5C4IA 4K8OA 2ZQ5A 1MX5A 4QOGA 1HEUA 1VCOA 2WZDA 1SUIA 2J4FA 2EBFX 2R84A 3KDAA 4DFDA 1TMGE 3BQMB 3EISA 3M8KA 5T4BA 1JKIA 4C0AC 3T1QA 2NPIA 4HTAA 4QOIA 5CB4B 1OTHA 4I5EA 3TEJA 2E6KA 4PLWA 2VPWA 1VIAA 3MS2A 2P79A 1DTWB 1OH7A 1G5HA 1A8PA 2GPBA 4NHOA 3EOBI 4LK2A 3TW8B 1M0EA 2OORA 1KZ6A 3A1SA 2WHEA 5ES3A 1FS6A 1SOVA 3VHXA 4WOBA 5JNWA 4EJFA 1M5TA 1NNUA 1ZJWA 4OLHA 2AWOA 3F90A 1EQ2A 2J3IA 1I3KA 1KI3A 1ZUWA 3VKUA 1RCFA 4AX4A 4MNTA 2HL6A 2HOQA 1CRZA 4XGIA 4YRJA 3R0VA 2IEGA 1UD5A 4OP3A 1QOPB 5HKKD 1W36C 2OD2A 1DFGA 1CZLA 3AKCA 3PYLA 3C3YA 1V2HE 3WFIA 1E2LA 3IDFA 4F85A 2FSVA 4DLBA 1QQAA 2QJFA 3PEFA 1E9FA 3N7UA 3RS8A 4KYVA 5T67A 2O3JA 2B6HA 2WHRA 5LOVB 4QM6A 1M2VA 2JHFA 4JROA 5CW2A 2B21A 2VJYA 1Q7GA 1T29A 4F9FA 4QRDA 2DYIA 1NVGA 1JQJC 3PT9A 3VZRA 5E0KB 3ZPXA 1ZM3A 5DP1A 4FFPA 4HGPA 3UAOA 3R9XB 5EUBA 1S2DA 1YGPA 3PNYA 2W0MA 3WQZA 4RX1A 4HUTA 2PEYA 4FNMA 2M1ZA 2DJIA 1QFYA 3TDMA 1PVVA 1UMDB 2XEXA 1QV9A 2Q3DA 1O1YA 4H1HA 1JW9B 3HCPA 4TLEA 1QFJA 1WLYA 3TGLA 2IPXA 2Y6VA 3ZBQA 1D2AA 1ZMTA 2QGZA 3SMVA 3ECAA 2QI9F 5JTTA 2NG1A 1VE3A 4MZDA 1F17A 1Y8QA 4MQEA 4YDHB 4YWHA 1EFTA 2ZRFA 1RXEA 1TEVA 2ET6A 3CEJA 4MS4B 5DFAA 5TARA 3VMMA 4HNVA 4NJMA 1AA6A 2UU9B 3S44A 3ZDFA 4GYWA 4LJAA 4OPOA 3GFBA 3HVIA 4E5YA 1CVRA 1EDDA 2EFJA 2LWIA 1VL6A 3ZGVA 7MHTA 1Y5MA 3NVDA 4HSGA 2HHHB 1IFXA 4WK4B 2QN6A 3UT0A 1VI6A 4KMMA 3F6YA 4Q1AA 3EFBA 5E6UA 1CSEE 3FSGA 3KT6A 1T4BA 3L7AA 3H5VA 3K20A 2ZSUA 2H7VA 4PIVA 1GNTA 1NQAO 2WKSA 1WV1A 1XMXA 1Q6YA 2EARA 1AG9A 2VHXA 3CKMA 3DCNA 4NBWA 4URZR 2OZLB 5A05A 1BE8A 2JD1A 3MMZA 4L2IB 3W6PA 5H82A 2X6QA 3IIMA 3LG2A 1U9ZA 3PRKE 5DLDA 2YXEA 4O4HA 1M1YE 1ENPA 1HURA 1Z5UA 2NSHA 4N0EA 3T3IA 3R5FA 4E5DA 3OJOA 1YS9A 4F84A 4EF4A 3TTWA 5HZHA 1C2YA 4HLQB 1XAGA 1QMPA 3QFHA 3FPKA 2X0IA 3JQ7A 4YUZA 4C88A 3PFKA 3OQMA 4FFDA 1BDIA 2QQFA 2IP2A 4U7DA 2X9GA 2QG4A 3E9YA 3EUAA 4IJWA 5ALYA 4MWTA 4HNAB 3RWMB 2Q2OA 2XBMA 1I7NA 2B5WA 1HQDA 5LVAA 1DJLA 3EWIA 1DWUA 2JS7A 1FNDA 1J70A 3KXIA 4N18A 3LBIA 3SC2B 3B13B 5A4KA 1AQNA 4B4UA 4Z4EA 4WKOA 1UBKS 1Y8CA 4QNNA 2I6UA 1VI2A 4L6AA 4F5WA 4XM3A 3TFQA 4B3TB 2WSBA 4HX2A 4BNMA 2C5FA 1U3DA 3EJWA 3N2LA 3GLTA 3PPWA 2K2QB 4IJUA 3OQIA 1XOIA 5EKUA 4RXUA 1T2FA 1T9GR 3EMVA 5HF5A 1PSDA 1Z07A 2GEBA 5JZ9A 3DEHA 4NSNA 5JS2A 1RAFA 2HHJA 4V2IA 2L69A 3BH0A 3SEFA 3BTSA 4HX9A 1BZYA 3DBLB 3RIHA 3EC1A 4M54A 2XWQA 1NW6A 4N40A 4OBXA 5IKOA 1K2VN 2A58A 2WTBA 2CXPA 3K8ZA 2LCQA 1DBIA 1FUIA 3V4SA 5BPHA 1NVVQ 1UBUS 3G0GA 3IDOA 1U8XX 1Y7IA 3A1PA 1YZ3A 4LCBA 3G2LA 3ICCA 1AKVA 1RZUA 7GPBA 3TECE 4RTOA 5AI5A 5KCMA 2RG7A 5HKLA 4DY4A 1N9GB 5AVXA 2AJLI 3ZC3A 3HB4X 3RK1A 4BGEA 2Z5LA 4E4RA 2R8BA 2OAGA 4ZAYA 5KB3A 4A8TA 1NW5A 2W6ID 2WZBA 2PZEA 3NYRA 2WUGA 2JRLA 5DW3A 2NXEA 4CTNA 5HWSA 4G6ZA 2V59A 5E1OA 5CB4F 5MN4A 1PWHA 1NV8A 2I2DA 3KT3A 3EXEB 4AO6A 1DBVO 4BV9A 2OHJA 3FPFA 3N2EA 1QJCA 2FQ1A 3VFDA 5FHRA 1EGAA 3U48A 2D5CA 3U81A 3L6CA 5K9ZA 2ILVA 4M1QA 3QA9A 1P1KA 2YV4A 3T8YA 3VPCA 2IC5A 5ILQA 1WCXA 4MB6A 4RA6A 1NNEA 3GCWA 1MQ8B 4Q9LA 1IG0A 4N7BA 4ZEXA 2H7CA 4MW4A 1YWGO 4UASA 5LQUA 4R3UC 4RIIA 1M1NA 2REBA 2WVHA 3D1JA 3HA2A 1G8PA 2K7ZA 3UKJA 3MJTA 4G5QA 1CP2A 1KXJA 2NNWB 1HM5A 3WWPA 3AR8A 1NULA 1YR6A 1EK1A 2A78A 3CWCA 3D9QX 3I4LA 4FYKA 4FD2A 4JLBA 4L8VA 4HKTA 4R68A 2AZMA 4J3JA 4CL3A 4EG6A 5A8AA 1Q0QA 4ZP1A 1E2FA 4MUGA 4L8FA 2PMWB 3WGZA 5I7WA 1JAIA 3UWKA 1AIPA 1DG3A 2B61A 1RQRA 2H0RA 2I67A 3BXOA 1KO8A 4D3YA 5AI4A 4E5UA 3KQLA 5IYZA 3JZMA 1RJGA 3MWFA 4MJLA 3W2EA 2XVAA 3CT6A 2NO7A 2SKCA 3A1DA 1V8FA 1PJQA 1KO4A 3GFVA 3KQVA 2BIFA 1ZCJA 4AG6A 5AD1A 3FMPB 5DW0A 3PVDA 2ZCUA 3KTFA 1G6HA 3D6VA 5JSKA 3HN6A 1P1BA 2BI8A 1SBYA 4EHIA 3GLRA 3BEOA 2AJBA 2Y1EA 2JLVA 4WVFA 4BXOA 1YZVA 3W2IA 2A35A 3A31A 3QVVA 1RJFA 3M6FA 2HJ9A 4OHWA 5D00A 3ICQB 5FR2A 2WPNA 2VNKA 3TN7A 4KITB 2QXTA 3HFRA 3WVNA 1PV2A 1JUDA 1FCJA 2CD7A 3GT0A 1MG0A 4HBZA 5U4XA 4C0LA 4KU4A 3ND9A 3NWEA 1L5NA 1G2IA 1ZIPA 4U2KA 2JEYA 1G4AE 2AOUA 4ARIA 3C5VA 3B5JA 2H9YA 3E27A 3HN2A 2A84A 4DCSA 2AFIB 3MQ2A 4V38A 2QRKA 4NENB 5B3KA 1LDBA 3UN1A 5DHTA 5KYYB 2EYQA 1BPLA 1VSQA 2FJPA 1FLAA 1XZ8A 1KJNA 3H9CA 4QFMA 4IDQA 4KRYA 2JLSA 2ZT6A 4YO7A 3SGLA 4ZYTA 1LPPA 2HLDD 2NYAA 4DXHA 5EZYF 1FU7A 1NR5A 1F2TB 3OUZA 4QZVA 2C2KA 3K1JA 2GF2A 3UQYS 4B33A 4CL0A 4UD2A 3VR6A 1OV6A 4G4GA 1ZSVA 1R5NA 1NMQA 2A0WA 3FSRA 4GL2A 1BWRA 1ULTA 3Q6RA 2CFOA 2C88A 2ZS7A 3GJTA 3RU3A 1XC7A 5AW6A 1U7XA 4C20A 2JG3A 2BFCA 1GP2A 2OKGA 3TLAA 2Z8XA 2W6JD 1KRHA 2PUWA 3WYNA 5EKTA 4DQXA 1ZD3A 1EI9A 3VISA 5JC1A 1O94C 5F1OA 5EIFA 4YROA 4KP7A 1YTUA 4OYYA 1BMFA 2CLDX 1D7AA 2CN1A 3VKFA 4JJEA 2XMCA 3RS2A 4RH0A 4HWOA 4R1QA 1CEYA 3T7SA 4DK1A 2DFDA 5FX2A 4P82A 3GZJA 2WWVD 4PNEA 1SC4A 3W9YA 2AG8A 4S24A 1Q0PA 2F3RA 2RGRA 4LRTB 2HREA 2PKCA 3GZNB 3U19A 1DLJA 3FKJA 2XCRB 3PL1A 4TTPA 3ZEAA 4MRRA 4FNOA 5CDFA 1PLJA 1Z18A 2HRBA 2OYSA 4OXKA 1EUCB 1HT0A 1U94A 3FIJA 4Q93A 4I3HA 5K3OA 2O3RA 3N75A 2I80A 1G18A 2H17A 2RG1A 5JVDB 1KE1A 5LP1A 1HMYA 5IC5A 3V6MA 5INTA 3PD7A 1S3FA 4P9SA 2CF6A 2JGAA 3EOAI 2IU6A 4D0SA 1PJSA 5KTPA 3ICEA 1E6MA 2QL7A 2R6ZA 3EEYA 4WZZA 5DT9A 2IHZA 1E9SA 3LY5A 5EIEA 3PQ3A 2CFSA 1NJSA 2J3HA 2RSLA 2W2LD 2OORC 5KWIA 1EFPB 1XWWA 3ZU3A 5CIYA 4MUKA 2I2CA 3WLKX 5KX5F 4B43A 4IF4A 1IJEA 4XDZA 3CFYA 1E64A 1PKXA 1S1MA 3LHFA 1GTL1 4A6DA 5F3DA 1YSCA 4WW0A 3VDQA 3JQBA 1CJMA 1AUOA 4EHFA 4D82A 4K6HA 1SCIA 3GRVA 4ZN6A 3ZBTA 1UF9A 3FG9A 2QRGA 3L6OO 2IYPA 3LC2O 2G8LA 1Z5ZA 5FTNA 5ALTA 1TQ8A 1C1HA 2VRBA 2XY4A 5JE8A 3WGHA 5K0TA 2WQ7A 3RIYA 5DNCA 2HFKA 3AFIA 3OCYA 2HK7A 1VG1A 1XXHE 4Q03A 2IZOA 3I01M 3PR1A 2HRZA 3TCKA 3LSTA 1Z0AA 3KKLA 2DCUA 1DS6A 5LP6C 4NZ9A 5ERGB 1AHHA 4RE5A 3TX2A 2H1IA 5EWJB 4OHFA 5FOWA 4YMLA 5JAMA 5AK3A 5EOVA 1L3BA 3BCFA 1QIGA 1TF7A 4DR2B 2OL4A 1PL0A 3X2EA 2PL9A 4TKVB 1KQ3A 1OI2A 3IUNA 4WXEA 1CFZA 4R2XA 2V5AA 3NI2A 2Y0EA 3C8DA 1NU8A 4B3CA 1LVUA 1S9DA 2VDLB 3O8BA 3S2YA 1I0IA 1VB3A 4TV8A 3U4CA 4H4DA 4BRSA 5BWMA 1JKMA 3BB3A 2BMFA 3HSYA 3AONB 6NULA 4YHBA 1QRAA 1U3UA 1WKVA 2YZKA 1E3QA 2ON6A 2E1BA 2RCNA 2W2NA 3AU9A 2CJFA 5I4KA 2Q8PA 5JTUA 1V9SA 3IEMA 1M2OA 1BRMA 1V1MA 2DR3A 4L15A 5TGDA 1Q5PA 1C4WA 1Z35A 1LQUA 2FLVA 2X8JA 5HFNA 4I5FA 1XZDA 4QU5A 3V8BA 5K0NA 2FFHA 1ML3A 3QA3E 1JLKA 1YA4A 1BYUA 2NYUA 5MN6A 2ESRA 4KDCA 3KJNA 1L7DA 4TMYA 1F1JA 3KEQA 4WN3A 3RC1A 1MF7A 3MUFA 4DEYA 2BFMA 5JNVA 3S8EA 3F46A 1RJEA 3VR0A 2WKQA 3I52A 3AJDA 5FOXA 1RC8A 2YIVX 3PHCA 3I9MA 3DYIA 1TU4A 1DTWA 1EX9A 1BHO1 1Q3KA 1RR6A 2WG2A 2PXXA 1QIMA 2PT9A 4F3KA 3N76A 3SVZA 2XUPA 4GKVA 2P2LA 3KXKA 3TEFA 1T1RA 3IERA 4S0ZA 2HT1A 2DQZA 3SVTA 2G0AA 3KQKA 2JZOA 3TWOA 1FJHA 2NIPA 3I55B 2WIDA 4FLMA 2XXAA 1BXRA 5JYDA 5HK8A 4EF6A 4DCNA 2JZCA 5M29A 2HWWA 4HH4A 4RZSA 5CMLA 3WYEA 2Z58A 4RGBA 4KFUA 2PZLA 5AXCA 2H3EA 3FD8A 1XWIA 4XQ9A 4RK1A 3OIFA 4B4DA 1M2KA 1O8CA 7MDHA 2Q2QA 4S1PA 1Y1TA 3JXEA 3DEAA 4KO4S 3T35A 3IT2A 4DB4A 3MNFA 2W4IA 3STVA 4JYPA 1K0FA 1OBCA 1YQUA 2CMKA 4QLBA 1FFCA 2RCYA 1JPNA 3B6MA 3LCUA 3NYIA 5BWBA 3ZD9A 5HW0A 2YMPA 2D2VA 3VXKA 2Q07A 5HSGA 1P0IA 2XUHA 1PV1A 2ZI9A 3IE0A 1VHTA 3K71B 2R2GA 1KVSA 3ANLA 1JHAA 2QX8A 2X22A 3FDXA 2AQ8A 4NU6A 3H9BA 1W34A 3G02A 1ZMXA 3HBMA 3ZWVA 1PTJC 2POCA 4UTNA 1GFSA 3PCXA 1ZFNA 2XMRA 4DSZA 2OZEA 4N3CA 5F9HA 3Q0TA 1YQEA 4ITVA 3R8XA 1KAMA 2FQWA 1XCLA 3A26A 1PQWA 3ZCRA 4IUCS 5KOIA 3DT9A 1Z0IA 3SQMA 1UJ6A 4A8JB 1Z26A 3O5AA 2P2GA 1O0SA 4QDKA 1IHPA 4RANA 1AUPA 3BYZA 2YQZA 3BB4A 5CYPA 3DHVA 4B74A 1P72A 3D8SA 4ZCQA 1ZJ5A 1YZQA 1A04A 4K9MA 4L28A 3T7EA 3HV2A 4BFZA 3BJEA 3AR2A 4HZUB 4TQGA 2EJCA 3UXHA 1Z7YA 3UCFA 3L7NA 1KIAA 1W5BA 3NRCA 4CT0A 5F4MA 3NW9A 4F46A 4NZMA 1RM3A 2W8BA 3J7TA 2F00A 1CRQA 3NHPA 4CU2A 3ZH2A 3UHJA 4RUKA 1N7GA 3OZCA 3UK0A 3VPFA 4N0QA 1VYHA 5A7GA 4ERXA 5TC4A 3VJMA 4EMBA 1TVEA 4IXTA 2CF5A 5H0IA 1PFWA 4MDYA 2PT7A 4DQUA 4MV7A 1S72B 5EFOA 2FWRA 2Q9CA 1IWBB 1XDWA 2DBZA 3HKBB 5F2EA 3FHLA 4BNWA 4EPVA 4YMVA 5FH9A 1BJKA 2B4YA 3W5JA 4ZOAA 2XB8A 1F20A 1QH1A 2MINB 2ZSAA 1PZFA 2EF1A 2QS9A 2XX3A 4LZWA 3W7AA 3RVJA 1UJ5A 4CIDA 3QVTA 4LGYA 3V46A 4OOEA 2EERA 3VTFA 1TVKA 2XUJA 2X3FA 4FFRA 4AO7A 3EWSA 5DNAA 2HRRA 4P7BA 3LRPA 3WAJA 2YIMA 5EIBD 1QHGA 4ZKEA 1KZ9A 3GJSA 3IB6A 3OQPA 3SKVA 4MXDA 5JASA 4DMCA 1WXIA 4HB3A 4R6XA 2GJRA 3T9AA 2JLAA 4RGVA 2ZIZA 4J0KA 1KORA 2VYQA 4OXNA 2YQ4A 4B09A 5HXAA 1IBMB 1H1LA 1LLCA 1RBYA 1Z4IA 4EQ6B 2CV2A 3RSSA 3N5KA 3W06A 4W5NA 1FRQA 2BFOA 5IT0A 3R0QA 3AX6A 1XLWA 1EVIA 4OMDA 1PE0A 1Y0RA 1DU4A 2H54A 2VJAA 2VKQA 3L01A 5BUQA 2I2XB 4OKNA 1KGSA 4XQGA 3ROTA 3UANA 4BGVA 1R5JA 2GD1O 4D3ZA 4P35A 1DG1G 3C3KA 1H05A 2WNHA 4P2BA 5IBPA 4EWLA 1TQ6A 2ONKA 1GGNA 4LNUB 1UBOS 3FSEA 5J43A 2ZR8A 3S7ZA 3DL0A 4FMCF 5AM2A 1YDEA 1WPCA 3V7YA 3EIOA 4HZGA 4UJ3A 2QA4B 1BWPA 2VJKA 3B1FA 3GFGA 3UBMA 2N75A 3R7FA 1VECA 4I1UA 2FRXA 3O2SB 1AV6A 3OJ0A 4FXUA 4RM2A 2QROA 2W6MA 3UK2A 4X6YA 2FMKA 2AMVA 2P0YA 1V95A 5BYBA 3CCVB 4GRDA 4X1KA 2IHYA 3ETGA 1ORRA 2C4TA 4M1WA 3W3ZB 3NV9A 3QK7A 4I1RA 4BV8A 1A8UA 4XLFA 1OB2A 1N5OX 1I2AA 1C3JA 1NG1A 1CZNA 1Q3HA 1Z7EA 2J9FA 2FF5A 4GR4A 3EY9A 2G0NA 4Y2JA 2C2OA 5E9JA 5FRDA 3WBBA 2IZ7A 4HMOA 2OG1A 5CFRA 3HYNA 3CR3C 2B34A 4L50A 4RWEA 2WV7A 5JS1A 4XXHA 3U7GA 3HYSA 1P5ZB 3KQPA 3QOYA 1K73D 4OKIA 4J7XA 4EVIA 2QD5A 5AKXA 4GPZA 1TA0A 5GOTA 5LSAA 1O6BA 1VYVA 4IQ4A 2QG9A 3VQTA 4N3GA 1QV6A 5DTRA 2UYGA 3I1YA 2MSKA 3U17A 2BP7A 3TR0A 3PE6A 3WHIA 4DQKA 1TA4A 1YE3A 2IYXA 3E4DA 4B2LA 4C5AA 5AK6A 2OC9A 3BMQA 1RWXA 4HHEA 2YWJA 3DMGA 2RK3A 3OOWA 3GFTA 1ZN8A 4QLAA 3UXMA 1TVKB 3EHDA 4AT1A 5IFLA 2DEUA 3FSGD 3L8EA 1XZLA 3KS9A 2I87A 4M0PA 4RNDB 4J07A 2NSJA 3SNKA 5J59A 1YHYA 1T5LA 2VAMA 4QUGA 4F11A 2ATEA 2PIAA 2YHIB 1EUQA 1XTZA 2ZAYA 2G9ZA 1E59A 1SPBS 5FLYA 8ABPA 3HJCA 2GBLC 5DWVA 1GUYA 3AIMA 2VSFA 2Y9PB 1EFPA 4ND4A 4PLGA 4Q1DA 3WYCA 1Y4DE 5DCLA 2FFJA 5LFAA 4B6SA 3JCZA 2DHEA 2NT4A 1BD4A 4LE0A 1CQWA 1E2MA 1PSWA 1N5IA 1SUAA 2DKNA 5JJBA 1AGRA 2YJTD 1URPA 3HCBA 3HP7A 1NVTA 4I6JA 4XOTA 1R0ZA 3M33A 3MWYW 4BAGA 5GZ1A 5LOVA 4WV3A 4KI7A 1PJ3A 2RGUA 1QFSA 2JLWA 1D4ZA 3FZQA 5CLQA 3VO2A 5DSZA 2FPGA 2I2WA 4BFXA 4LZPA 2WSSD 3PQ5A 4PAQA 2NXWA 4LSMA 4HBGA 3C15C 3I53A 1VMAA 2J09A 4E14A 1UMBB 2PWPA 4Z0HO 5LBTA 2WF8A 4JX8A 2Q4EA 4MS3A 2KBFA 3N5CA 3UZUA 4R9NA 2GZSA 4Z1MA 1CUXA 1OLXA 2C5EA 3WGQA 3KG2A 4EPWA 3ZCPA 3BJZA 3H1TA 3GP3A 2EGUA 1HOTA 4XPIA 1HG1A 4KTTE 3IPXA 4UDOA 1P6QA 2VK1A 3IUBA 2X41A 4PN7A 3LYUA 5IJZA 2F9MA 1UJ4A 5ECDA 3MWJA 4EUEA 4B7CA 1U4SA 4Z54A 2GFIA 3EAGA 5CT4A 5HM8A 1SXJD 4QJ4A 5ELMA 4KKXB 3P0RA 7REQB 4ND8B 4Z4YA 1NFFA 1HDEA 1SBHA 4LAFA 4W5JA 3QPDA 3WISA 1DBSA 4DC9A 2ZRKA 5CDHA 1RVDA 2JW5A 3C7CB 3NOOA 1BMQA 1VIDA 2GCOA 4D46A 5HOQA 3KL9A 1NOJA 3IDQA 3X44A 3QJYA 3OH8A 3U3ZA 3PNPA 4UUPA 3OKFA 3AV3A 3HY3A 3AUUA 1X19A 1I32A 3IP9A 3SHTA 4LJLA 4WESA 4B6OA 1JHZA 1Z39A 3H2YA 3THSA 2ETXA 1JU3A 1WVIA 2V1XA 4R83A 5A9TA 1MV5A 2IU3A 1NVXQ 4MUNA 1LKZA 2H2FA 2IHBA 2PZMA 3ISTA 1CUJA 1N9KA 2P5TB 3PEUA 3T0GA 2AX3A 2PZFA 3KOOA 1GUDA 4MR9A 5DN6D 2D3LA 1EUZA 4R9RA 1WBBA 4RTQA 2VHWA 1NU6A 1I4DD 2AN1A 2VNSA 3ZTTA 5AVTA 1Q9SA 1CJUC 3JRXA 4LXYA 2Z9DA 2ZB8A 4KNWA 1ZH0A 4YV7A 2QJWA 3CLRD 3LLSA 3OWHA 5EJAA 4H3VA 1IAVA 3SYKA 3UV7A 1BC5A 4JSTA 1XQWA 4Y1RB 2LD4A 2VBTA 3GGSA 3JWHA 4NATA 1AHIA 4GR9A 1I6MA 1TJ3A 2FSGA 3H16A 1HSZA 2ZREA 16PKA 3NPMA 2WJGA 4FSHA 2I3GA 4IEFB 3RHZA 5DN6A 5I9BA 1TIKA 3ZVNA 2QG6A 1XEWY 3C1TA 2C9CA 5KPDA 1ZHFA 2Y93A 5L3SA 3TNFA 4EDFA 2B0JA 2C2MA 4HRVA 1CVIA 4WHMA 4K9NA 5EUMA 1BVYF 1S4QA 3W8DA 2VYVA 1KEEA 3EPHA 1RVV1 3M49A 5LD2C 5I7OA 3ETLA 1VOTA 2I4IA 3L6EA 5E9QA 3L4JA 2LE0A 4C22A 5KWJA 2RKOA 4ZXFA 2HTFA 5K6AC 4XWYA 1GPNA 4E5PA 2I1QA 3GJYA 2XA9A 3T5BA 5A89A 2FXVA 3FPSA 2VZ8A 1Q14A 3DXXA 2SICE 3BUSA 5J1TB 3V76A 4FNAA 2FEKA 2ZKLA 3DFFA 3EIHA 3Q4GA 1O97C 4G56A 4ZU3A 4OI4A 3TTTA 1SKYB 1QFMA 2BFNA 4KQGA 3VR5H 3CV3A 4N48A 2AS0A 3WLLA 2REOA 3B3AA 5BW8A 2WTNA 4WLEA 3UXEA 1K7CA 2Q29A 1DAOA 3L8YA 1XKTA 1RPJA 3CZCA 3L93A 3MD9A 2Z3VA 1K9VF 2O3UA 2ZFUA 4G9GA 3SQLA 3SS8A 2P90A 5CA1B 2C2GA 3FNFA 1JA0A 2R66A 3JAKA 2XEDA 1JQLB 1MEEA 3DULA 3PDWA 4G5RA 2FMXA 3EXEA 1ZZEA 3CQ9A 1LDMA 3KYCA 4TVKA 4PIMA 1WXHA 2D0PB 4HZUA 1PT8A 3VU8A 4BYGA 4EPYA 5L3ZA 5J4KA 5KTTA 2O0LA 1JHUA 3GN2A 2DOKA 2EQAA 2VTVA 3OZBA 4H0NA 1I1NA 4AJOA 3SZGA 1EFHA 1IL0A 4ZARA 3WLMA 2JJQA 1WNTA 3LX6A 3Q88A 1SQ0A 4JEHA 4V3CA 4RVNA 1E43A 3KWFA 4A0QA 3A70A 4C43A 4DRXB 1EZZA 2YCBA 3CJRA 1UK9A 3B1ZA 3D4PA 3GA5A 5CX4A 4E2YA 3O92A 4HQOA 1DWQA 1IOLA 1QLWA 3G6KA 1XYYA 4R2KA 4GYYA 2IWRA 3I32A 3E61A 5LZ9A 3CMMA 3AEUA 5CLHA 3O84A 2ECFA 5JARA 4EZEA 3QV2A 2BL4A 3ZV6A 3J81A 4FN4A 2AN3A 2H31A 4FPXA 1PIWA 4PR0A 5LA6A 4D0LB 5AW0A 1OE0A 2XIJA 2MMGA 3LWBA 1O94A 3CPHA 1HQCA 3ELDA 4M55A 1C7QA 3UMVA 3P94A 4ER3A 4FHFA 1NYQA 3DC7A 4IDNA