1GR1A

Structure of ferredoxin-nadp+ reductase with glu 139 replaced by lys (e139k)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKKMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP+ REDUCTASE
molecule tags Oxidoreductase
source organism Nostoc sp. pcc7119
publication title Probing the Role of Glutamic Acid 139 of Anabena Ferrodoxin-Nadp+ Reductase in the Interaction with Substrates
pubmed doi rcsb
total genus 88
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2001-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1gr1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1gr1A02
1IJEA 4Y7CA 3CC2B 1EP3B 3P27A 3WY9A 1OGJA 4FN5A 3CD6B 3OZVA 3U6BA 1YIJB 3QSYA 2DETA 2PMDA 1R5OA 3I56B 4ZV4A 1FRNA 4Y9RA 1G7CA 4WQMA 3LVBA 4B44A 2AHOA 4RCZA 1VQLB 2E1RA 1G7SA 2B7BA 1J9ZA 3U2QA 4YHBA 1BQEA 1EWYA 1W34A 4RD1A 1YJNB 4LBWA 2DERA 1VQ7B 2QTZA 2YWGA 1VQMB 1N0UA 1H85A 5GV8A 1B23P 4TMTA 4PC2A 1F20A 1QH0A 3CC4B 4PC6A 3CXCB 1BX1A 4U9UA 4PC3A 1VQ6B 4Y9UA 3JQPA 3ZBUA 3CMAB 4LBYA 3WNCA 1VQ9B 1DG1G 1TTTA 2BM1A 1QFJA 1QUEA 3A1FA 5TV2A 1JJ2B 2RC5A 3B82A 1GVHA 1NDHA 2J7KA 1ZM2A 3OJXA 1E63A 1DDGA 3V76A 3LYUA 3AVVA 3WBJA 1KK1A 1VQNB 2VNHA 1JA1A 1D1NA 3W2FA 3ZBTA 1EP2B 2C78A 4YAOA 4RD6A 1U2RA 1GJRA 3CCQB 1VQOB 3G4SB 1FNCA 5H5JA 2BGIA 2XEXA 4F7DA 3WNDA 1IJFA 3AVYA 4PC1A 2C77A 4B43A 1QGYA 1EFCA 1R5BA 2VNIA 2B5OA 1ZUNB 1YI2B 5EMNA 1CNEA 1N8RD 2YWHA 3G6EB 3CC7B 1VQKB 2YWFA 1DDIA 3LO8A 2OK8A 3MHPA 1QFYA 1K8AD 3VNUA 4YAFA 3AVWA 5THXA 4PGOA 1EFUA 3CCUB 1ELOA 4YAWA 4QHYA 3AVUA 3LRXA 2BMWA 1K9MD 4RD0A 4IW3B 3ES9A 3QFTA 4M2LA 1NJID 1B2RA 1W2BB 1UMKA 1QGZA 4PC7A 1TVCA 1KK2A 1DARA 5TR9A 3PENA 2QTLA 1QVFB 1R5NA 4ACAA 4YALA 1EFTA 1OB2A 1GAQA 1YHQB 4RD3A 4TMWA 5GV7A 4R71A 3JQRA 1S72B 4YAUA 2FX3A 4MYUA 1TLLA 4P6VF 2GQFA 2XNJA 4B3XA 3WYAA 2NPFA 2D74A 1W35A 3CCEB 1YJ9B 4MYTA 1SKQA 1VQ4B 2RC6A 4M4SA 2HMAA 2QA4B 3B8HA 1FDRA 2DY1A 2BN4A 1KC8D 5KSWB 3AVTA 2X3UA 4J0QA 1AMOA 2QMUA 4LC0A 3I55B 1K73D 1BJKA 1OB5A 4DQKA 2R6HA 2PIAA 3W2GA 4NBSA 2BM0A 1CQXA 4ZCIA 4ACBA 1KJZA 1TUIA 3QFSA 4ZCMA 1F60A 3J81k 2BVNA 1Q81D 1VQ5B 4B4DA 3VO1A 2XNCA 2DCUA 3CRZA 3W5UA 4HE6A 1BX0A 1KK0A 1WDTA 3MMPA 4RCYA 1YJWB 1QUFA 4B47A 1GAWA 2CRVA 4K1XA 1G7RA 1W87A 2BF4A 1JNYA 3QFCA 1GO2A 2BSAA 2HDNB 2OTJB 3E1YE 1FRQA 3VMFA 1QX4A 3CCLB 3WNBA 3CW2A 4TMVA 3CCSB 1ZM3A 1VQ8B 4LBVA 2BGJA 2QDXA 4NCNA 3W5VA 4UAJA 3CCVB 1FNBA 4P3YA 2VYQA 4HE5A 1M90D 4ZGQB 1FNMA 3VO2A 4AF7A 4RD4A 3I1FA 3P26A 2VZLA 3QE2A 1I7PA 4TMXA 4TMZA 1Q86D 2B7CA 1ZM9A 1GR1A 4G1VA 3OJWA 1EP1B 3ZZUA 3CB4A 1KRHA 4B48A 5DSZA 4M1KA 4RJLA 5HXBA 5TY0A 1ZM4A 1KQSB 2DEUA 2BV3A 3MCAA 1IB0A 4N3GA 1KTVA 3E20A 4TN1A 1FNDA 4FK8A 1D2EA 3G71B 4DQLA 2OTLB 1Q82D 4ZGNB 2PLFA 1D8TA 3B78A 4N3NA 3JQQA 3OW2B 1M1KD 3OZUA 4ZCLA 3AVXA 1G7TA 4M0LA 2VNJA 2BPOA 3FPKA 1EXMA 2EFGA 4H9GA 2ZITA 3W5HA 4AC9A 1CNFA 1XB2A 3CMEB 1JB9A 4C43A 2GPJA 4Q7JB 3SJZA 1E64A 1E62A 5FA6A 3CPWB 5H59A 1QGAA 2QEXB 4EH1A 4BPRA 2EIXA 1JA0A 3AGPA 1KK3A 1AIPA 1N0VC 4G1BA 1YITB 1QVGB 3CCMB 3W2IA 3VNVA 1Q7YD 3WBKA 2QN6A 3U6KA 2HCJB 4LBZA 3W2EA 5JBQA 1VQPB 3OZWA 1XE1A 3FJOA 1KD1D 1H42A 3CCJB 2YWEA 1S0UA 3W2HA 4QFMA 1OGIA 1A8PA 2OK7A 1SM4A 1QFZA 4G5GA 2VNKA 3WXMA 4RD2A 3CCRB 4C0SA 3ZZ0A 4FWTA 5AN9A 1HA3A 3ZC3A 2CNDA 1QG0A 3ZZTA 3AGQA 4M53A 3QFRA 4AF6A
chains in the Genus database with same CATH superfamily
4RS4A 3T7EA 1DC3A 1E69A 4DKXA 2J5XA 2XQFA 3VKVA 4BV3A 3VR6H 2H52A 2OQ2A 3JQGA 1RJDA 4I9HA 2Q3FA 3MMSA 2IEGA 4LTDA 3SLRA 3V42A 5EHXA 1JFRA 3DB1A 3ZHQA 5FTJA 1XNGA 2WY2D 2W83A 4HQRA 5JDIA 3M3PA 3NKFA 3HVJA 3UYLA 2P2YA 3VH3A 2J46A 5AI0A 3WMWA 1SQSA 1L9XA 1BEZA 4ONEA 2Z5FA 2QRPA 1O6CA 2OOKA 2RMKA 1O9BA 3LM8A 2W6ID 4QRIA 2QBYA 3OETA 3A3NA 4CG3A 3W79A 3IQXA 3ICCA 1ZNWA 3L5OA 4NFSA 3HCFA 4ZV4A 1TQ6A 3AH8A 4NNJA 1H94A 3TNYA 2OBSA 4G6IA 3HP4A 1PT7A 2HA7A 4FZ5A 4B4UA 4Z7OB 3OF3A 4LDNA 5IC5A 5HM6A 4RCZA 3QEOA 4KQKA 4C2BA 4FHCA 1PEAA 3DQZA 4RK4A 1VLVA 3BJMA 4QUEA 2ZZMA 5JXGA 2D0PB 3ICEA 1UKZA 1DJLA 1KYWA 5LJLA 4RD1A 4X8OA 1JAXA 4I4TB 1RE0A 5ICGA 1G20E 3PQ3A 1CEYA 1C3LA 2HSDA 4KBYA 4MVWA 3VDQA 4ZHQB 3ESBA 5BUZA 3SFTA 4CCYB 1KOFA 1JE1A 4ZIRB 1Y3CE 3A8IA 3CYFA 1UDXA 3N2ZB 3PPXA 4ISBA 3VOTA 1TVKA 2EBWA 2ZRQA 3GNLA 3UXYA 1PDWA 3OKPA 4EIWA 3R5HA 4OFBA 1OLUB 1K7SN 3PXCX 3SHFA 4Y2XA 4XX0A 3AIOA 5IXJA 1FMLA 1H9BA 3OOHA 3E9NA 4NICA 3P9RA 2BELA 3PE6A 1JFLA 1ZGJA 3O94A 2IZ6A 2WM2A 5AK3A 3TRHA 4MLDA 2DC1A 4DUZB 3R6DA 1M2EA 2ZBQA 4V0ME 3ESRA 5LQKA 3E2MA 3GG2A 3RJ5A 1E3EA 4MS1A 2GNOA 1U3VA 3IP1A 4QBHA 2AFIB 1B1AA 2G82A 1GCGA 1Q0TA 1HEUA 2FVYA 4Z49A 4S1PA 3WJ2A 2UZ1A 4J1TA 5ARCA 3K9BA 4ZVTA 3O0DA 1G1MA 3HJRA 3IR7A 4GXTA 3R7SA 4JJ6A 2JAXA 3DMFA 4FINA 1AUOA 4CHTA 5KOIA 5IYZF 1V2GA 2H4XA 3B3AA 1C80A 4U7PB 1A4RA 2AF3C 5DCWA 2Q1XA 4RV4A 1FVOA 4S04A 5U1PA 5CNMA 4ZXPA 2FOXA 3FWKA 3IEXA 4JN6B 3ED1A 4F12A 3UTCA 3NUQA 3KPUA 4LVNA 2JD2A 2A9VA 3AYZB 3V76A 3OCXA 4BNMA 1E6WA 4CWAA 3ZY3A 4QC2A 1T2CA 3TR5A 2ZT8A 3SS8A 3L9WA 4H3KB 4HVTA 4WBNF 3BTUA 3ZV6A 2AJTA 5BUSA 4F92B 5E4FA 2EW2A 2AN4A 5AKYA 5AOVA 4WZEA 1JBQA 1VSVA 1IOVA 2X6QA 3JQ9A 2GBPA 1J0AA 4ZC1A 3C4VA 1BEUB 2FFAA 2P2LA 4HDAA 3B70A 1D0IA 4XSVA 3RC8A 5JJLA 2R84A 1XROA 2IEDA 4U2KA 2QN1A 1JT9A 3CT4A 3DJYA 3T15A 4CTJA 4GSYA 1NX6A 3QLEA 3O0TA 4G0PA 4I4TA 5IJZA 1N1EA 1YE8A 4YT2A 1MIOB 4OGWA 2LZ0A 3FYSA 4ZYUA 3KVNA 1DT5A 2HMYB 4OHUA 1I7SB 1G0OA 3BXGA 5EIOA 2Q6KA 2ADOA 3HY3A 1KDPA 4PLTA 1N9ZA 2CNWA 3JASB 2ECKA 2VJAA 2GEUA 2PG3A 4DC1A 1OI2A 3SEZA 3GFTA 1F12A 2OHGA 3KVRA 1X15A 3CP8A 2FUEA 2JLWA 2AEEA 4XLCA 3O9ZA 2NOAA 3K2QA 4KODA 1P1BA 4RK7A 2FB9A 4PPNA 3NHUA 1C2TA 3RQSA 3HM9A 2G1PA 2WKSA 1MF7A 2FZVA 1I3MA 5E6UA 4KQHA 3PHHA 4JUDX 1A8HA 1DPGA 4PAWA 3DBHA 4NKRA 5EMNA 1ZJJA 2YJNA 3BQNB 3HS3A 5F9FA 1U04A 2ZTVA 3GJ4A 2ZDHA 4NV1A 1V8BA 2NO0A 1PG0A 5DNAA 1T0UA 4A2CA 4B7AA 2YWHA 3DR5A 2YYYA 4QDKA 3DLCA 1LLDA 2EZ9A 3EG5A 4L6AA 4OKSA 1U5AA 2X9NA 4D9MA 1I5EA 4ZAFA 2JIQA 3HB1A 5CTJA 1YOVA 5T41A 1M1NA 4JNKA 4C89A 1ECPA 1OAOC 2GAAA 3L8FA 4TMYA 5F33A 1TZ2A 4YRDA 3V7WA 5DWVA 2XQGA 1NJ6A 1Z35A 2QAGC 1E94E 4N8SA 4FILA 2CY0A 3Q3GE 1R50A 1FJHA 4JJEA 3IE1A 4RY9A 3QE9Y 1XD2A 3KSZO 2GILA 1TMOA 3N2KB 4QHYA 1M2OB 1KEUA 3TZCA 4Q37A 1DL5A 4L76A 1W19A 1CYDA 3F9CA 3GJ0A 4WXRA 5B12A 2QN8A 5KZMB 1OXMA 1YASA 2GPBA 1TNDA 5LA6F 5C7OO 1TYZA 4AZVA 1Y7TA 3GLIB 4FM9A 4X94A 4F5WA 1KMHB 4RD0A 2DYKA 4XM3A 4KWEA 3BFJA 1RQ2A 1QOZA 3ZDAA 1PW5A 1ULAA 1CPYA 3TM4A 2HAEA 2E55A 1E3XA 1E2GA 4DDMA 4UTNA 2K2WA 3E81A 4X6XA 3IVRA 3V4PB 4PC7A 1YMVA 2IIBA 3R0VA 5CXUA 2ZYGA 4EB6B 1J33A 4HRXA 4JI8B 1IY8A 1QGED 4G8CA 3HKDB 4UBJA 5FA8A 1U7OA 3OJOA 4RLHA 4D9HA 1TEZA 1H4TA 3Q2KA 4E5YA 1I30A 4EGAA 4I4IA 4YALA 1OYVA 1A77A 1H1TA 2VF7A 5ENZA 3ETCA 3R9XB 1RYMA 5AKJA 3NT5A 4TMWA 2JFZA 2P9QA 3LNTA 4B2PA 1I3LA 2NXJA 4MS4A 4OF4A 2HIAA 2HNKA 3M2TA 2HLDD 3KZXA 3REQA 3FIJA 1WHSB 2XMCA 1R6TA 1BCSB 2B5WA 2JIOA 3EASA 1L5RA 1WQ4A 2GZHA 2P5SA 2H5IA 2R5WA 1NR5A 1DUVG 2GQFA 2VPYA 3OQHA 4LHVA 4MQ6A 3FSGD 3BCFA 4Z1OA 1FJXA 4XWAA 1KPHA 1J4AA 2A9PA 4JD5A 3RABA 1U9IC 3VSEA 1P19A 2EJBA 5EHNA 4ZVSA 4D3XA 1ZAYA 3HE3A 2NUPB 3I6QA 1C3OA 2IHZA 4HQKA 4D80A 3ABSB 4BBAA 1T1JA 4OIMA 2I7TA 3GRRA 1M6EX 4TWJA 3ZPNA 4PANA 2ZWVA 3N74A 4KQWA 1Q7GA 4DM3A 1IVSA 4E51A 3KKMA 1EGVB 2PR2A 2E4UA 1E32A 2XQVA 1SOVA 2CNKA 3PDWA 4OQEA 1VQ4B 1FS6A 2PUHA 4RKRA 3T7CA 1B0UA 2CDBA 1WOMA 2JGLA 4HNAB 5FAXA 1O0CA 5DBGA 2QPTA 3TQCA 1XMPA 3OZ7A 2DY1A 4EPYA 1SXJE 2VK4A 3FRIA 2DG2A 2JLCA 2QRMA 5JC1A 2I7XA 4MUMA 4B7ZA 2IEAA 4X20B 1ZJ4A 5JPCA 1MZPA 3SC2A 3TZ6A 4DLWA 5C7LO 1FYXA 1VBNA 1QG2A 2ETXA 1TIPA 3QEMB 2P30A 4J75A 2OGZA 4Q66C 4X66B 3TTVA 3VTKA 1K73D 4KAFA 1LB1B 5JNVA 2W90A 2G77B 4WESA 2W2QA 3GAZA 4ZCSA 2EL9A 3PRKE 4HQ0A 1XRNA 4X7CA 4RJTA 3M4JA 5KAPA 1L7VC 1ZUIA 3RS3A 4Y6OA 2G9QA 2ZJ6A 2DR3A 4WCFC 2J4CA 3GZNB 3K72B 3MA0A 1J25A 4UE2A 5CT9A 4NY1A 2BGKA 4P92A 1RXSA 2QPAA 3VC1A 1KE1A 1RLMA 1P7YA 2GETA 1G9SA 2ZRLA 3Q6MA 3BH4A 2CDCA 2X22A 4UBKA 2Q0HA 4WCDA 2L18A 3TLAA 1S1MA 1RMTA 2R7NA 1GZUA 1E3DA 1E1MA 3PE3A 1K8RA 1FA9A 1JDZA 5DT9A 3U44B 3O95A 4UTXA 1R9NA 4X1IA 1LJUA 5F7XA 5BN5B 1R6VA 3SC6A 3MTEA 2OAP1 3RYTC 4D4IA 1S02A 1R0CA 4EMTA 4X7EA 3BXPA 4DDTA 2A9JA 3E9YA 4UXJA 4B8WA 1H5QA 5ANRB 4NCKA 5A7GA 3A8KA 3MGBA 3RS9A 4EHNA 1ZVQA 2XWSA 4V39A 3WYDA 1KK0A 2YVKA 3MMPA 2VSFA 2AOTB 1ES9A 4GLLA 2GZSA 2IK8A 3KM0A 1HKUA 3IBSA 3IP8A 2MCFA 5DBEX 2XUQA 1VA4A 2NV6A 2Q49A 1QGUA 1O96A 5DNVA 1M10A 2ZT5A 3RK0A 4URHA 2Z3VA 3ZZ1A 5L6LB 3QFCA 1GFIA 1ORIA 3R3XA 4MWBA 1OJLA 4XASA 2BSAA 1V3VA 3DTVA 1PTJA 4HWTA 2W2OA 1ECJA 3EZXA 3PXUA 1TQDA 3FNIA 3EAQA 4RPBA 4MV5A 4Y2RA 1YJ8A 3WQZA 3CO5A 3TIIA 1YTUA 1E1QD 2RHOA 2PKCA 2RG1A 4FSDA 4P82A 4OFXA 1ZD1A 3WBBA 2DTDA 3JQAD 3MC1A 1C81A 4JELA 1PEDA 2WP0A 1L4YA 1MC1A 3DL0A 4JHLA 3WHPA 4P2GA 1UP7A 3DC7A 4D3ZA 3UEOA 1O7JA 2Q3LA 3ZK8A 3E84A 3FDIA 1FX0A 4WE3A 4FOTA 3KPYA 3NIFB 3NLLA 1XCMA 1VJGA 2C2XA 5CM9C 3ZGYA 4DMFA 1LC0A 1R4MA 5BQXA 3LX6A 1DPFA 4PYJA 4MGEA 2I6QA 2RI0A 3L41A 3L8YA 3AINA 2FP3A 4O4LB 2RJOA 4BVLA 1DKQA 4Q05A 1MV8A 3GJ5A 2B0CA 2GJPA 2R9VA 3I1FA 3DW3X 3UJ3X 1VHDA 1D6JA 1KKMA 1CY8A 3RHFA 5F4MA 1T2AA 3JWGA 3QA9A 1A76A 3QX8A 4OLJA 3WRYA 3KJHA 2R8EA 3VXKA 5JSFA 2B6HA 3NB0A 2RGCA 4JLSA 4PZCA 4CM8B 4YMVA 2ZJAA 4C0JA 3R9KA 5A5DA 1GR1A 1W2HA 4Z86A 5LQAA 1L0BA 3Q5EA 4KQFA 4RLFA 3K53A 3U3MA 4TRJA 5HKKA 4MGYR 1R4NB 4W99A 1YIAA 4Y1RA 3TJZA 4Z4TA 1JA9A 1UJMA 4QZVA 3IL2A 4B75A 4L6IA 3COZA 3MPUA 3JYNA 3MTDA 2IHJA 5LQRA 1F1BA 1VHOA 4TYYA 3CZ4A 3L7DA 1IB0A 1SC6A 3UJPA 3NHRA 4L4SA 4LY9A 3Q6RA 1F7VA 1R3DA 3ASPA 3EZNA 4KGDA 4X8LA 2FFQA 3ZEAA 4D9EA 1LI5A 1W6UA 2NAFA 5C18A 1MCZA 5JAZA 5FWYB 4MP6A 4FKMA 4Q00A 4BFXA 2D3WA 1G21A 2GZDA 4C7XA 1GRRA 5TPZD 3RWOA 1LSUA 4F6LA 1QE3A 3HZOA 3K4QA 2XYRA 3PF9A 3A6JA 4OOVA 4BNUA 1AXRA 3CU5A 1YVPA 1KP2A 1JXQA 1S2DA 1WUJS 2Z83A 3ETGA 5CB0A 5ESDA 2LR0A 4NK4A 1OT3A 4RZ3A 1MOSA 1IUKA 4J2TA 3K7EA 1DFGA 1LBIA 2BFOA 3N2LA 5TLSA 1NIJA 4AY2A 2C9YA 5ITWA 3T5BA 1U2DA 1P74A 1LVUA 1V43A 1ZKDA 3H8JA 3HMKA 2YMPA 3FHOA 3U4CA 4DNFA 2V8BA 5HJ5A 2FPPB 3LY8A 4PLGA 1A4XA 1E2NA 4QU0A 5JSUA 1YFJA 2N9UA 1D0VA 1N8TA 2XB6A 4QOHA 1XU7A 3ZCRA 2EL7A 1AK9A 3Q12A 3TKLA 2Z4SA 4MW1A 4OKNA 4KIJA 2ZJFA 1TTPB 5LP6B 4GXRA 5EQJB 3DDUA 4OG2A 3SF8B 3LP6A 1VL8A 1EE9A 5AW5A 3EN0A 5C2JB 5FXMA 4KE9A 5KSPA 1IN1A 2FEWB 5K3EA 3S2ZA 1FLDA 1FTQA 1YQXA 1XB2A 3FR7A 4H60A 4QWMA 4DCNA 4LYDA 4DQXA 3C43A 3CUSA 2ZE6A 5AYVA 2RHTA 4C2TA 4BE9A 3EBOA 1MH9A 1QDEA 4KGZA 1CUWA 1XO1A 3KQKA 3FMGA 2IH5A 1GRQA 5K8TA 2C2YA 1KFCB 5ECYA 1GZ4A 1NVXQ 1YHZA 3S1SA 2NMVA 1IC6A 3D4PA 3V8BA 3OJEA 4DJJA 2P77A 5AXCA 1OLOA 4AN4A 1YBVA 1YOBA 2R44A 5IBPA 4GL2A 5BNZA 4N48A 1YS9A 1A9ZA 2VI5A 5FHQA 3RUDA 1NI4A 4MI3A 4RULA 4ZOCA 4YEDA 4P26A 3ZCUA 3NHAA 1F8FA 3AGPA 1OWMA 3KWFA 3QWIA 1D1PA 1SKAA 3CY6A 1L7MA 1VG0B 4O4LA 4P3PA 3MSCA 1YHYA 4FGJA 4AUMA 2H1OA 4I9NA 3B51X 3BZUA 1VSTA 1S3IA 1AC5A 2LCIA 2NTVA 4TS9A 1TYEB 4EHHA 2J1LA 3V6LA 1OIVA 3W2EA 1EKXA 2APJA 3TTSA 1F8XA 4EYSA 1KD1D 3AFIA 2GEKA 3UF0A 1ZS9A 3QOFA 1MR3F 3BH6A 4CMJA 4HCJA 2WYHA 3Q6NA 3Q9NA 5B3JC 1S0UA 3W9UA 3JATA 2JKVA 1JGTA 3GD7A 2HH9A 1OHHD 1UJ2A 1YZFA 1Z68A 1CEXA 3G89A 3C14C 4WN9A 3VR6A 1BIFA 5F9MA 4FBLA 4MUBA 3SZRA 4PGHA 1DRUA 3ZDDA 3F0TA 2V4MA 4J0CA 3ZZ0A 2PX8A 2VUIB 3L1VA 5FWNA 3EGDB 5EKTA 1QS0B 1K8QA 4JJAA 1XNHA 2BUBA 4R7GA 4CEHB 2CWDA 2FSSA 2HT6A 5C3UA 6ABPA 5LVAA 3BTVA 4LYGA 4KYTA 1L9KA 1WDKA 2OBXA 2UAGA 3O8NA 4LQ4A 1II8A 5CLHA 1XNQB 2RH8A 3CC2B 5KVAA 2N42A 3TCKA 3FUUA 4F4JA 2A1TR 1OUMA 1OC2A 4G0ZA 4RIFA 5MFPA 2POQX 1DC8A 1R1DA 1Z74A 3DZDA 3JAWB 1W5EA 1ZW1A 2CLDX 4RIHA 1ATIA 2GCNA 1TZKA 4IDQA 4N18A 1J97A 4UHHA 5FLKA 5C4IA 5IABA 5LZ4A 4URVR 5L7WA 1T0HB 1R5OA 3KL9A 4BMOB 1A8IA 1R6DA 1RC8A 1O54A 2BHLA 3I0ZA 3TIXB 4AJ9A 4JH0A 2G5TA 2GN2A 3R5KA 4JOCA 1HQYE 1VIYA 1XT6A 2H2FA 2GJAA 2J9RA 2VBCA 2P69A 3BYZA 3EMKA 2CL6X 4FS8A 2CJWB 4A6EA 5SZJA 1CZHA 2OG1A 1XHLA 2DJ5A 1URPA 1GV0A 1GSIA 4OEHA 4Q1DA 1SB9A 1XVAA 3T7RA 3TVYA 4E5UA 2Z6QA 2DT5A 2J3QA 2QIOA 1Q5PA 4UVHA 3H13A 1P1JA 3VDNB 1ZQ1A 1ZCAA 1WXIA 1SEVA 4IXMA 2JFXA 1MO5A 4CF5A 1ZVMA 4NAHA 5GVSA 4MDYA 1ZDMA 1JR3E 1Q77A 1ESCA 2QMOA 4DRXA 2IU0A 1K3TA 2P4HX 3FCOA 3TEFA 1KO7A 1DAEA 1OIWA 2GJKA 2WHEA 3VZDA 3VZPA 4TM8A 4BGIA 4EFKA 3LP5A 3NWPA 4K9KA 1ZOSA 4QYTA 1UZLA 2EEPA 3I5UA 5FTMA 3WLQA 4E07A 3D2CA 3ROXA 1PSWA 4WZKA 1MG5A 1NKSA 1U2GA 4J7UA 1WSDA 1F6BA 2PR7A 2DMRA 4PGMA 4U4AA 4LTMA 2YN2A 3HDVA 1SIUA 4BQRA 1VGQA 2ZR8A 2NU6B 4BQIA 4DYDA 3N5CA 4FYVA 3K2BA 3LK7A 3I2HA 4QNNA 1AF7A 1J0DA 3CC4B 1NXTA 1VPLA 2O1SA 1EIZA 3QQ5A 4JYPA 4CF4A 4NULA 3MJSA 4KMOA 2BFDB 2QT9A 3R0QA 4GBGA 4Q82A 2J31A 2I7VA 2BMJA 1Z9BA 1UD3A 2PV7A 1G5FA 5J4HA 1KMNA 1V8FA 3UMYA 5C5CA 1E2KA 4A5OA 1JSCA 4FCTA 4ON9A 3THYB 4LG1A 2FY8A 4V0SA 4AD8A 1P7WA 4CIWA 4ENUA 1G2IA 1YB2A 4MUXA 1JIQA 4U6QA 4M9ZA 3TNJA 3B6MA 1F9AA 2WF5A 3NPMA 4L9AA 3RH0A 1K6XA 1WTCA 1TJPB 5JVDB 1YMUA 3QPDA 4D3FA 4E5MA 4EDFA 5IAKA 1BDHA 5KYUA 5IDQA 2Z0MA 2W2VA 5HIMA 2EQ5A 2R7LA 3T1OA 4B3BA 5ECWA 4C3UA 4CIAA 5JISA 3NM5A 4CM6A 2OBRA 1DDGA 5DB4A 3LYUA 5AD1A 1L7AA 2JKZA 3SBDA 5KQSA 1H1LB 1QHNA 4HB2A 2Y6UA 1GCAA 1WB4A 1WVIA 2GPYA 3OO1A 5JZ9A 4GSLA 4X24A 4CFSA 1QBGA 2XSZA 4ZZ0A 2D2IA 2Q5FA 5IFKA 4MWOA 4PRKA 4JVLA 4M76B 1A95A 2UYCA 4ZYTA 5NULA 2RK3A 3GMIA 5K4HA 2DWUA 2E49A 2MIIA 2Z1NA 3FMVA 1RXCA 4QVJA 1K7FB 3G6WA 1X80A 4KZKA 1UWLA 4FYWA 4L72A 3V55A 5I47A 5JCJD 1QZ3A 4K8RB 2RK4A 3MJHA 4HDKB 1VPEA 4UUOA 5J40A 4NWIA 1L5SA 4JYZA 1ISHA 1RPTA 1KY3A 1AHHA 1JEQB 3A4TA 2XGMA 2VBUA 4GMKA 2PKWA 2WM8A 3IVGA 3FKSA 5D87A 1SHZA 3GLGE 3THWA 2NM0A 1JWAB 3LJKA 2C83A 3NALA 4GKBA 3ZLUA 3ZWAA 3VYWA 1KYIA 4QNMA 1V37A 4F72A 3A2MA 3D7LA 4X6UA 3ZUGA 3ADOA 1NMQA 1V11A 2ARKA 1E4OA 3LUBA 1PWEA 4ZVOA 5HCUA 4AKHA 2ZSFA 1U6JA 5CDFE 2FLVA 1MDFA 3FVTA 3GEBA 1W75A 1YS7A 1GCOA 5FV4A 1CUSA 1YGPA 1L4MA 3T4XA 1FS4A 1QNFA 2XTAA 4L5YA 4MP3A 1R0KA 4MJXA 1GZ7A 2ZQ5A 4MEAA 3HYSA 3QH4A 3MGAA 4AWAA 1YDEA 4Q6BA 3UMBA 1V47A 5EQTA 1F0PA 5KINB 1UXKA 4NOMA 4UULA 5KWJA 3D31A 3PC3A 5ICSA 3DXFA 5M5BA 4RMNA 4AXBA 1ZIPA 2DR2A 5FI1B 3QJGA 2C5GA 1AURA 3PLRA 2BEVB 3BRWD 1B6GA 3KUDA 3MINA 4WH0A 4EUFA 1LZLA 4PN7A 1F5NA 2DOKA 3SEJA 1T4MA 3IV6A 4B2LA 3Q3HA 1CIPA 1TAHA 3EHEA 3F3KA 3OEED 4Q93A 3TSAA 4UNRA 5KX5B 1E6UA 5L3VA 3AIMA 2WQ7A 3A1PA 3AWDA 4G0NA 3N53A 1TPYA 5JASA 2WZPP 1K9MD 2TSYB 5DM60 1NVEA 2FFRA 3AWIA 2E18A 3R7WB 2YJ4A 4YJKA 3FTFA 4XN0A 2IZ5A 3OJCA 1SHUX 1NJID 1H2BA 1T6NA 2O23A 2COEA 3I12A 2IY7A 4KQXA 1B2RA 2RBKA 2O8BB 1JR2A 1W2BB 2TMYA 1OC4A 1QHIA 1XZPA 2ICAA 3AB8A 4BLQA 5EJ5A 4ETWA 1ZOOA 1O89A 3RBXA 1V4BA 1Z4LA 1DP4A 3PFCA 1ZJWA 3FHJA 3BC9A 1PNVA 3NBUA 4Q4AB 4O4JA 4LHXA 2R6ZA 1Q1AA 1KERA 2WIKA 3ABIA 3BQ9A 4ITUA 3M1IA 2CFRA 2HW8A 3IAXA 4JFRA 3REQB 4J0FA 4GPBA 2AOVA 4J6FA 2JJ1D 3FCYA 4N5LA 3S2GA 4IG9A 4BN5A 4DLTA 4DJ5X 1Z8HA 4NJMA 4LYAA 4MYUA 1SXHA 4ZQBA 1QPGA 3L4BA 2RHWA 5H7XA 3W7BA 2MYUA 1E3ZA 1XAHA 4ND1A 1KGDA 1NURA 2Z4RA 2AN5A 1JHOA 1TK3A 2ZZKA 3DTVD 3NYQA 2CD7A 3BL5A 1UMDB 4KOEC 4CQMD 4JI0B 2CD9A 5IYPA 3KX2A 2NPFA 1YBFA 2GNPA 5CK4A 3H0EA 1OZ0A 2Y76A 4P08A 4R8LA 3B20A 3SY8A 3OQIB 1TVKB 3T35A 1F14A 4H4EA 5CDHA 1X42A 2OFXA 2I4LA 4NZPA 2ID9A 1ZGBA 2QG9A 3AFHA 4QOJA 1T9KA 2XMPA 2AL7A 4XWWA 1DT3A 3DV9A 4MP8A 4RTJA 4NQRA 2PRZA 5LOVB 5D1NA 1D8AA 2CBXA 1VLMA 3IC5A 4BVGA 5JJ5A 1CF9A 1U6KA 1UEJA 1ZIYA 2M1XA 3WA6A 1K28D 3FTQA 3OWOA 3EF0A 3GJ8A 4IOMA 1GR0A 2CEAA 1PX0A 3T9DA 5KNDH 1JLLA 1CT9A 4F3CA 2C3UA 3A6ZA 2NQ8A 3G6KA 4PTYA 2RGNC 3RRNA 3EC1A 1K66A 5LP6C 2ZZGA 3BFVA 4NDZA 1MHTA 5HJ7A 5FH9A 2RSLA 1U0JA 4CDMA 4KUGA 1KFBB 3BWCA 4FI3C 5KVSA 3C70A 2JLZA 3WLMA 1YK1A 4I1OA 2PRSA 3ZV5A 4UAUA 4CT0A 1M2FA 1N0IA 3O2JA 3U9SA 1W1WA 3B5EA 4CEJB 3GO4A 4CI0B 1J1UA 2NUPA 4BOYA 4BCDA 1EFPB 4F8YA 3G1TA 1SKYE 2GWRA 2VP9A 3IVAA 3UJ8A 1TUIA 2QD1A 3S2UA 5ITVA 1V45E 4ZI5A 4ZCMA 3Q2OA 5J23A 4ZMSA 1ACLA 5FWXB 3TVTA 1IAQA 2EXXA 3F3YA 1RZRD 2R2AA 3DDSA 4MZDA 9GPBA 2MMGA 2FPGB 5AJZA 3KQNA 3TOSA 4W6ZA 2A0FA 4WK0B 1IZ9A 1DIOB 4IDBA 3VBCA 4CFZA 4CYMA 2YBEA 2P4UA 3U4MA 4DLZA 1U02A 3DV2A 4COOA 4BJ3A 2XQJA 2R4TA 5DTIA 4Q9LA 1ISGA 2BFEA 4TS3A 4D9GA 1K75A 2O8BA 1WDTA 4LF5B 2PMWB 2HV8A 2XODA 3LPAA 4IJ5A 2H17A 4XONA 1LA2A 4RIIA 4WAUA 1FU8A 2CSUA 1C5KA 1TO1E 2ZIWB 3WGUA 3I0MA 4FD2A 3ST7A 5LMZA 4ZPXA 3FBWA 3Q8MA 1NASA 3DMRA 1I7DA 3M5DA 3U3OA 1ZUWA 1RAEA 5A1TA 1Z5OA 2Q7OE 3G68A 2X8JB 1DO8A 1EDEA 3I72A 3IQGX 3KFLA 3PNKA 4YDHB 3ZTWA 1T26A 3PX2A 4OU5A 3HCNA 3BQJA 4ZT5A 1FPMA 3IQWA 4HH1A 4CUJA 4HK4A 3RYHB 2JGAA 3HWWA 4O4HF 3HLTA 3KXKA 3UXMA 5JXHA 3UKOA 4K9LA 1S9DA 2D1QA 1XJQA 3BSFA 3JWPA 2MYTA 3PKZA 1EVYA 1LVHA 4HEJA 1UC4B 3CGGA 1NMSA 3QPWA 1QP7A 3JSAA 4HBGA 4X1KA 4LXIA 4AP9A 2Y1DA 2X9QA 5B1YA 1M8FA 1OVGA 1ZW6A 4UE3S 5J5VA 3T12A 3O8LA 4PWZA 2XB2A 1E79A 4R84A 3T9BA 4MQMA 4WECA 4FFMA 3BWMA 5JV5A 1SBZA 1E2QA 1D2CA 4CM9D 1GU7A 4BN0A 5HWSA 1PNTA 1OZAA 4QUKA 2ECQA 1P7CA 2QRUA 2RGXA 3PSHA 5ALSA 3Q0TA 3X2SA 1RBQA 4JR0A 2OV4A 4XUEA 2O7RA 3BRQA 3EDYA 3HAGA 1JJVA 4GOND 1XMQB 2VK1A 2W5UA 3JAKB 1TUBA 3NXSA 1XTRA 3LQ1A 3NIDB 5I5GA 1JF8A 5BOSA 3KSAC 1XTIA 4PRZA 2BI8A 3VAYA 1NAIA 1MLDA 1W8IA 4GEKA 3V32A 4DDVA 1DCFA 2DEUA 5KVCA 1AMNA 4YDQA 5CIWA 4FZ3A 1K7YA 2H1LA 3MMNA 4WZAB 5LQMA 2YNMA 4ER5A 4S1VA 1AQNA 1JTVA 4KUEA 4N01A 3GFRA 2QU8A 4KJZA 4HH3C 1GPNA 1RWPA 1PL6A 1HYEA 4FHZA 3PGVA 1NN1A 4Z0NA 1VB3A 1RR6A 3V7YA 1J2UA 4PYLA 5FO0A 3M1AA 3OICA 3WKDA 3AKDA 3HKDA 1UEXC 4N3BA 1EK2A 1SVLA 2VPZA 3H6HA 3MRSA 4EWLA 3I53A 4IIVA 2RONA 3BJIC 3UWOA 3HUEA 1X6VA 1X3LA 1I1HA 4GGOA 4HDSA 3CMMA 5BSYA 1MJGA 1O95A 1XEXB 5JC8A 4R2LA 2VPQA 4Q16A 5IMSA 2EFDB 2FEAA 4AF8A 5JAIA 4YRLA 4Y9SA 1X1SA 5JECA 1QP8A 4INPA 2V7BA 3JARB 2FEPA 4HGZA 4V3BA 1SD5A 3FPHA 4PPQA 5THKA 2CBZA 3ICPA 2B9EA 1GPH1 3WX0A 1IPHA 3ZDFA 4D6PA 6ADHA 1VHJA 1YIDA 1UT6A 2F67A 2GAOA 3S5JA 3W78A 1WHSA 4DANA 1X14A 2C3YA 2G25A 5KYGA 3KTFA 1J8VA 4ZO7A 4KLZA 1XVUA 3QVMA 2CMFA 2H4YA 3U3DA 5JS1A 3NS7A 1GPMA 3B6IA 4AC9A 4DLUA 3QIAA 3CSSA 3T7IA 3TSZA 5TMPA 2P9YA 4LOHA 3RC3A 3OIYA 4PVCA 4IFBA 4DIDA 3GT7A 2BBSA 2D2VA 3OT4A 3OD1A 3P94A 2VHZA 4YXWD 4ZICA 1Z73A 4LAFA 4IDFA 1RI3A 1Y33E 3GJ7A 3RYHA 2WT4A 1U7TA 5T6MA 4XLZA 4HNUA 1JHPA 2JLRA 5GGYA 2JFQA 5ETJA 1ESDA 1OKKA 4EFMA 3LZDA 2F4NA 5EWJA 2AFHA 4XQCA 1KEEA 5F3RA 2YIJA 4ZKDA 1CZRA 1NBME 1UBMS 4QG7A 3WK8A 5AVKA 1MC4A 5LL6P 2AOWA 4YJFA 4JT2A 1NJ5A 3PUWA 4NENA 5I8ZA 3LXMA 4BO5A 5FDFA 4MAMA 4PG6A 3SSMA 1DOAA 2B82A 2ZJBA 2A5GA 4LKRA 3DZGA 1HMPA 1KOLA 3TUIC 5F2NA 3AYXB 5LD2C 3LSYA 1ZFNA 4IQFA 2W7TA 4MRAA 3ESDA 3LG2A 4F3KA 3BD6A 3VR3A 4RTMA 1NOJA 3MJCA 2G5GX 1G8PA 4AZ3B 3MCZA 1PJ4A 3EVZA 1CDOA 1NTRA 4MW2A 2XUGA 1A2KC 2ENWA 1LLCA 1NWHA 1ULZA 2C59A 1CETA 1GFSA 4PBRA 5DFAA 3U7RA 2PQ0A 3BGWA 2WQ6A 1NYTA 3T7KA 3UO8B 2EG9A 4OTZA 3RGWS 2OZLB 2OK7A 1UBSB 2P2GA 3CLSD 3L7JA 3L6OO 5FT9A 1RZ3A 2A5JA 2VHQA 2ZR7A 3GUUA 4M1MA 1PKEA 3TXAA 2W4QA 3OOEA 3ZCXA 1V6AA 4CKBB 3SEFA 3KSMA 3I2GA 3SFZA 4EVIA 4R1NA 4LRXA 1SOWA 4X20A 4L0MA 2CNDA 4Q3KA 5DPMA 1QG6A 2Z2XA 4LVCA 4NP6A 4OAPA 1ODIA 4HNQA 1G59A 5D3ZA 1IZZA 1GP2A 3GIRA 3MTIA 2DUJA 1UD8A 4FOOA 2NPIA 4PYOA 2ATEA 2FX2A 2G4LA 4IJVA 5B30A 4AUKA 2JJYA 1LLFA 1XZNA 1NGSA 1RAHA 2JRCA 2YWBA 3HGTA 5BNFA 2Y1KA 3ZU2A 4ENPA 1PFWA 2OLJA 1YCHA 4J7CA 1FW8A 4R9VA 2E4ZA 4OV6B 3OZVA 3AEUB 3ESYA 1P5RA 4WZBA 121PA 4CLXA 5JAOA 2HTEA 5EPUA 2O1XA 4M3NA 3WISA 1C3XA 5HS6A 2AMFA 4KXMA 2DHCA 5JG7A 4AJLA 5ALHA 2IBMA 4GNKA 3G2IA 5DGIA 1K0FA 2PT6A 4PRYA 1O95C 4REOA 4CQLB 5BW8A 4KIUA 1RPZA 5HUHA 3KKPA 4Y2VA 5G0TA 4CMEA 4Q3CA 2YXLA 5EN4A 2WSIA 4YT4A 1MA0A 3F6EX 4H0CA 4UEOA 7ABPA 4I99A 1UWVA 3GL9A 5CA1A 3ER8A 2Y0EA 1P3Y1 3BGSA 3NBYC 1YRWA 3GLKA 1USUA 4LDRA 3E3AA 5DW3A 5I9SA 4P1VA 5TS2A 7ADHA 1OE0A 2FG7C 1H2XA 2ODPA 1DEKA 2YZMA 4NV3A 5ALYA 1MKYA 1O96B 3RIYA 1J24A 5DZSA 4H31A 3M9LA 4C04A 1UMBA 3QKWA 1WABA 3E2PA 5CGQB 1RKQA 4MR7B 3ND9A 3ONEA 5J2TF 5SV2A 2ZIGA 3G9XA 3CKKA 5B58T 3ZWPA 3VVCA 4C6SA 4EABA 1HG0A 2FLKA 3U49A 3AU9A 1O0SA 2JS7A 3OLQA 3QTLA 4L8YA 5JALA 4PO8A 3RK1A 1B2LA 1N2OA 2R6JA 3QELB 5TQVA 4BDTA 5TRDA 3D3EA 2XNSA 3DXYA 3PKIA 1Q16A 2P6MA 4HGNA 5FYQA 3UPDA 2B37A 3Q8KA 1RFGE 3RUFA 3TF5A 3EPHA 3WWDA 3DPUA 4AY4A 4M8LA 4G5QA 1U2ZA 4ALMA 2BI4A 4Q9IA 4ADSG 1DX6A 5MN5A 2YUTA 1QP4A 1JPJA 2BZSA 2DTXA 3ZR4B 3NR2A 4QL3A 1JG7A 1L7OA 4GE0A 2HF9A 1I3OA 3UT6A 1PF7E 3V2HA 4U5XA 2ZANA 4B85A 4AB1A 3PNVA 5D86A 2VJJA 5IW8A 1KMCA 3O1IC 1JEEA 3IQHX 3U5TA 3QMMA 1U4NA 4GZ6A 4Z6KA 4JVSB 1T5SA 1GVHA 2FPPA 2AK2A 3EJWA 2AQ8A 2G0TA 3U7EB 1CZLA 3KT6A 5CA0B 1AHNA 1N2JA 1WNTA 2FPGA 3PNMA 2BHRA 4OHCA 1RU3A 1K3UB 1J09A 4CW7A 1ZONA 4PZYA 4IUCS 1RI4A 1C41A 1IHPA 1SBCA 2QQGA 3DOHA 4Q39A 5D7NA 3PVCA 1RJGA 1VKNA 1KK1A 5ERGB 2P3SA 4JB8A 3KOUA 3SYNA 3IAAA 3FYTA 1UM9B 1CY7A 1A4UA 4KV7A 3T5AA 1TU0A 3P0JA 4N3AA 1IUOA 1CS0A 4I6EA 4LDZA 4EEXA 3IMFA 3SVZA 4F9GA 1PFVA 2CLCX 3FM9A 3W3AH 4ZCRA 4C06A 2I78A 1PK9A 1GUBA 1U2RA 2V74B 4EJSC 5LNK6 2JFWA 4QJIA 3G13A 2H1SA 4YUZA 4O2LA 3EEOA 4YMTA 1ECLA 4KYVA 3C6BA 4RZXA 3ZI7A 1LQUA 1SPXA 2FV8A 3UCXA 1OV4A 4HMPA 1GTMA 1TVMA 1Z06A 3E27A 1K1EA 4KQGA 4IDNA 3PKJA 2CLFB 1QTNA 4D9IA 4DK1A 1T4CA 2VS1A 4MPDA 1XTUA 1Z38A 4HDKA 2CW5A 4QICA 1EGQA 2V3VA 4YMSA 5FR2A 1PL8A 1ZGGA 3U1VA 4ZOLF 2ESRA 2C77A 2JEOA 5I7RA 5AJWA 1YL7A 1RQ7A 1YL5A 3OM0A 1WOSA 1NL3A 3CEHA 4GOMD 3IAFA 3WIOA 5JEDA 4X07A 1I2CA 3FY4A 4DIKA 1OI3A 5A4IS 1GAJA 5HHTA 1ZUNB 4HEA6 4IDEA 3UJAA 1S7CA 4U0KA 4BIIA 3ZNPA 2VJMA 4LY6A 3AM4A 4O2RA 4P36A 4D97A 2BP7B 1EUCB 3H2SA 4OHVA 3T9AA 5BN3B 5BQ3A 1D07A 1UK9A 1ML3A 4AM8A 5B7NA 5A0VA 3HEBA 1VQKB 1YTLA 4WLUA 2GK7A 4O4JF 3ELWA 2DIEA 1BCRA 1Z0IA 3IO5A 4UTVA 3U7FB 1DE0A 3LO8A 3B9PA 3F8SA 4HD8A 3PD1A 3QKRA 1GLVA 1GNRA 3V6MA 3OZIA 4KQJA 4BXOB 4WDRA 4WZBE 2WMYA 3UV3A 1OTXA 1VRWA 3PLNA 1K6JA 3MWEB 2W11A 2C92A 1EUDA 2VR1A 3A1VA 3E8MA 1NHWA 1IZYA 2WWWA 1OY1A 3OLCX 2NADA 2EZTA 2X23A 3DLIA 5IYRA 1P39A 1SIBE 2PX0A 1E9RA 4OX9B 2ZBGA 4H15A 2ZXHA 2FPLA 1TUBB 1XBTA 2OC4A 3AZOA 1RABA 2GD6A 2ZIFA 3F5SA 3EQ9A 4RVHA 3UB4A 3I9V6 5F7ZA 3SLDA 4DDHA 1SK9A 1ZD3A 2ZIZA 4DUGA 4M2LA 5ESWA 3DQQA 3IDSA 1OYWA 3PDIB 1VYVA 4WI1A 2DCMA 2HL6A 1T13A 4RYDA 3T3NA 4XQGA 4I66A 1TKRA 4J1QA 4QG3A 2IITA 2QM3A 2I9KA 5FOTA 2BDUA 3AVQA 1M2NA 3GVLA 3L93A 4IH4A 1N2SA 1IWBB 2C8LA 4LHWA 2UXCB 4ZV9A 1C8VB 2C29D 1XEXA 5EY5B 3EFOB 1QF7A 1E1RD 1PG2A 4CKCB 2I6TA 4JI5B 1NF3A 2X8BA 1HEYA 1MABA 1E7WA 2DPXA 4HYEA 1GZDA 4NU6A 3FNGA 1YHQB 1T5IA 2OZEA 4KMRA 2RG7A 1WZUA 1U98A 1NYQA 1YS4A 4NTZA 4Z3KA 3GLVA 3D1LA 1Y3HA 2VCHA 3DONA 3U61B 4DGSA 3G2KA 1RKVA 1UQUA 3ABQB 1AQ6A 3SIXA 3WJ1A 1MO2A 3AESB 4QO7A 2JBAA 1CRWG 5KDDA 1JQJC 1NULA 4Q4HA 2B8WA 3HB5X 3OUTA 4JA2A 1A8UA 3HFSA 3H2HA 3IVMA 1JKIA 3PUYA 4PLHA 1AKWA 1F48A 1MIOA 5L95A 4CI9A 2LXNA 5C5EA 4EK9A 4LCJA 4BMPB 1LI4A 2YX1A 3O92A 4M89A 1RC0A 4L9WA 4OUDA 4LV6A 3DLBA 4R0VA 3GSIA 1CZUA 4DQ0A 1BXRA 3W3AD 1QV7A 5KYXB 2PX4A 3BVPA 1Z0FA 1SVUA 4BMDA 3EWIA 5K3SA 1YE3A 1NZDA 4WK2B 1JR4A 1QV9A 2QJRA 1C7ZA 1UPAA 1J99A 4NPAA 3IT3A 1RAFA 3KALA 5TPWB 1WE2A 4FC6A 5EFOA 2DOGA 1OGYA 3JYHA 3ODGA 3SZGA 1HE3A 1E9AA 1MBZA 1N33B 4NBNA 5SZIA 1TJYA 2OV8A 4N5NA 4EHDA 4Y98A 5CFMA 3TWOA 2OB2A 1W0JD 1FTYA 1G0NA 1TAGA 3DPIA 3I9JA 3HZZA 3RM3A 1F7UA 1OASA 2N47A 4R1QA 1ZO8A 3N0XA 1MZVA 3CLTC 1B76A 4C87A 3PPVA 2JFFA 2QN2A 2Y77A 1NVFA 3LCVB 4JJKA 3GLGA 1DCTA 1N9GB 1I33A 2RGRA 3C3XA 2QXUA 3MIZA 5CIQA 3DFFA 5COQA 4PBSA 1GNTA 1W96A 1T8PA 2EC5A 3KOXA 3Q7IA 4PZPA 1DRKA 4BX3A 2FPMA 4UHEA 4W1QA 5AT1A 4XVHA 1BE6A 2EX0A 2M2IA 4MR8A 1MC8A 1H1LA 3NTUA 1FFAA 3EMVA 4ZANA 1I3NA 4MMXB 3ECCA 1X9GA 4MO2A 2BISA 4IV8A 1FP7A 2QB5A 2VJOA 4MVJP 4ETIA 1I7QB 3R2JA 1SCUB 4HFMA 3KV3O 5DNDA 1YJBA 3AQ4A 5I9NA 3U3ZA 1EM6A 2PS0A 2OGSA 4V2IA 3TRJA 5HQ3B 1JLLB 1H0RA 4NSNA 4CF3A 5JQGA 2HRCA 2GKOA 2CUNA 2V0CA 3HUFA 3JQEA 4FE3A 2RHMA 3RVJA 3VPHA 4ZI7F 5EL0A 5L51A 4PS1A 2B7LA 4OHXA 2H4JA 2VP4A 1GAEO 4NYMR 1AE1A 5G53C 2CXXA 3M83A 3PQ5A 3IB6A 1H3NA 3ZBPA 4R9RA 1OLSB 2GBFA 5D3KA 5BW5A 3EOZA 1PR3A 1TCUA 3ESZA 4NCXA 3SX4A 2ZP1A 1HG1A 5EE0A 3UAZA 3ICQB 1Y5MA 5L8VA 3PXGA 2VJDA 1AJEA 4FZVA 2Q07A 4JQZA 5ARDA 2HMVA 3D0KA 4BNKA 4ZOQI 1M54A 3BFPA 5E6SA 4FU0A 3O1JC 1KWGA 4TMFA 4OHFA 5CHYA 2DQYA 3QVLA 5CX1A 3TGLA 3S2IA 1A2BA 2QD4A 5TGZA 1B3BA 4HJRA 3VNAA 4DNQA 5HKAA 3I28A 1Z4IA 1C4XA 4RPGA 3QG5A 4IVRA 4RS3A 4EG0A 3NVDA 4BZQA 2PE5A 2OCKA 2N3ZA 1JHMA 1QIDA 2ZCUA 1C30B 4EW3A 3ZY5A 3OLWA 3BK1A 4KO3S 4Z4IA 2I6SA 4ARIA 1RJ9B 1WY7A 4YVFA 5F9HA 3J80A 4BC1A 1Z2OX 1QVZA 1K4KA 2Q4BA 4BC0A 2Z5LA 4CGZA 1F4LA 5J4YA 3BCHA 2MHCA 2QNBA 1E2FA 2AZDA 1L5HA 2QG4A 2SNIE 4EARA 3AEZA 1UL1X 2O2HA 1TA4A 3QBDA 4UBNA 5ALXA 4NESA 5FOUA 3QE2A 3NDIA 4TMXA 4C30A 4ZGBA 3ANXA 3OECA 3HYNA 3KB6A 1MMFB 2FZ4A 2DP4E 1UKAA 5E7IA 2R00C 3EH2A 1F0YA 1SD1A 2XB4A 1G8GA 4CQJA 3I01A 2OBFA 3LHKA 3DP9A 4PO9A 1UXOA 4WNCA 2GHQA 3TFWA 3W0LB 3LC2O 4XD7D 4YONB 1J1IA 1R74A 2UUOA 5IH7A 3T3HA 1UBLS 2O50A 2O2JA 4FFVA 5JO9A 3KQYA 5SICE 1ZJ5A 4WJZA 1I36A 3AVOA 4EQZA 4GHWA 5E2AA 4UCQA 4BJ5A 3OAAD 2JIZA 2BV3A 3MCAA 4JKYA 4CZ2A 2AW3A 2Q29A 3UJDA 5FPKA 4K9RA 2NTNA 2J7PA 1G6KA 3ESQA 5HUJA 1LI7A 3F7OA 3MRXA 5EXDA 3H1PA 1FNNA 1LUAA 2ZL5A 4G8BA 4JP2A 2O3TA 1VLHA 1P1RA 3MN1A 4QYIB 1IATA 1WB5A 1ZSVA 3NOVA 4M0DA 4X41A 2QVLA 5EZ5A 2JLQA 4KUHA 3C7CB 1DBRA 1MB0A 1BA2A 4BIMA 2DT8A 4G63A 2H9AA 4I1SA 4TVBA 4U8HA 5JBNA 1PJSA 5FPPA 3HPQA 1RWXA 1W5AA 2I03A 4HLDA 5FADA 1F3LA 1QO7A 2XBUA 3TYXA 1SCUA 3MUOA 3T3MB 3CVUA 3IFSA 4YRSA 3LWZA 3ZXYA 3HFRA 3PXBA 3G1UA 4JODA 1BTOA 2I1QA 2ZJ2A 3R8XA 3H42B 4IH9A 4RK0A 4YS6A 4Z9XA 3TZEA 3ZBQA 4XWTA 4NBKA 2Z98A 3RWBA 1LDMA 2CUKA 3BM5A 3E5MA 2O2XA 1Y9AA 4MA5A 1QANA 2W6IA 1THTA 3C24A 4P8RA 5AO9A 4N47A 5BWLA 3S8EA 1RHQA 1RWVA 2AYYA 5DO9A 2P9HA 3KJNA 3M6AA 3ZTTA 1QYXA 3WV4A 3IJPA 1M1ZA 2FWPA 4ITRC 4XWOA 1Z15A 2ZAGA 1Q95A 1T9DA 1VJ5A 3KQQA 1XQXA 1RZUA 4FPXA 4LZWA 5M34A 1BYIA 4PN3A 1VXOA 1FMJA 3ENZA 3KUCA 3C1OA 5A02A 2Q21A 3K6SB 4BNYA 5EA2A 1J7JA 2IZ0A 3O84A 4LJ8A 5G40A 1G38A 3WJ7A 1QYDA 1E64A 4GICA 4O2BF 3SHQA 4QUGA 3K05A 1ECGA 1N5MA 3BF8A 5GVRA 4DTIA 1T36A 1Z3CA 3P0RA 2CFIA 1KAQA 2H1WA 4ETMA 1XVLA 1T3LA 2XYHA 3IDOA 3EXAA 4R5MA 3U0BA 1HNXB 4AN1A 3OWXA 3L05A 4MRMA 1JEAA 2B0JA 5TE9A 2RHBA 3LYHA 2X8WA 3IUPA 4BRWA 4NENB 5TGDA 4FN4A 1VYTA 2Z8YA 4J0EA 3UBMA 2OV3A 5BR1A 1ZGAA 2OO5A 4OMCA 4TRNA 4H1WA 4OQXA 2VF5X 4FQ5A 1KAOA 1Z25A 1EX1A 2HU5A 1U8UA 2AS0A 2XLBA 3HLYA 1DIBA 1IQPA 3JWEA 2HY7A 3PK0A 4QLOA 5C1DA 1PWXA 4PYNA 2YQ5A 3T53B 2HSEA 1VG8A 1C29B 4JT8A 5GPBA 5K0ZA 4MARA 3VX4A 5IANA 1Z29A 1ZH0A 2Y67A 1DIAA 1PGNA 1MRNA 4TXJA 4YELA 4OXIA 4AZ0B 4QFMA 3A26A 3QQPA 2ZRJA 2I80A 2OG2A 4BS9A 2A3RA 2RE8A 5DM0A 2B6NA 3WLSA 2PGJA 3THOA 1SVSA 3PGLA 4KU4A 4ZJUA 2IZ7A 1I4DD 4I5GA 2NZ2A 3MWYW 3RS0A 2WZQA 2VAWA 1HA3A 3USCS 1V6SA 4BUZA 1EAMA 1W94A 3ZC3A 2YJ6A 3FUTA 4CQMA 2I87A 3D6FA 4DUPA 3CLUD 4XI9A 3LC1O 1NBOA 5EQDA 4X1YA 3O90A 3B2QA 4F9TA 1KMHA 1NVVQ 3COSA 2DPGA 4MWDA 2HM7A 2J09A 4MJ7A 2GZMA 4OQZA 4F1KA 3UGJA 2WAAA 4LXUA 3SAJA 2Z6VA 2I22A 2R47A 2OA0A 1W5TA 5JFTA 4FOSA 3AC0A 3LL4A 1JU9A 1I01A 3CD6B 1M8GA 2E9SA 3MWFA 3WYGA 4BDSA 3C85A 3EZGA 3NHKA 5MDHA 2DWQA 3WYCA 1XNRB 3LHDA 2HMTA 1T43A 3EZ6A 4L4RA 1C0LA 1KZ6A 4PRLA 3W8EA 4V0LA 1RCTE 2WF7A 1MXHA 5DTJA 1ORTA 4ZCQA 4JBNA 4BNDA 1L5ZA 1F4VA 5E0OA 5K0SA 4WQMA 1WHTB 3AU8A 4BMSA 5FFNA 2GF0A 1M0WA 2DULA 3KVOA 3AG6A 3BL8A 4QPZA 4KH1A 2ONCA 2FX5A 4BQQA 1DXOA 1M3SA 1PJ7A 2UZ4A 3I2KA 1T1GA 2WJYA 3U2QA 3K71B 2ZSJA 2BHTA 5D6NA 3U62A 3BCRA 3PYLA 4OH7A 5I5EA 4M9SA 1Z88A 2FR0A 2MTBA 2R8XA 4UUPA 3VR2D 1JKFA 2GEBA 3NDBB 1NSTA 5IAAA 4QVAA 4IOLA 5JWOA 2OBMA 1NTOA 3C7AA 4PF1A 1JQDA 4XGRA 4S1OA 4F0JA 2CLMB 3CKMA 1GNQA 2C88A 1AQJA 2CF6A 4RA9A 2H0QA 1PSZA 4A8JC 3I04A 1XQ9A 1G4HA 3JX9A 3AM5A 3F67A 4MB6A 5FPYA 3SJCA 3W5JA 1YZ3A 1YQTA 3FA2A 3R6JA 2F1KA 4P84A 3E1GA 1UJ4A 4TMTA 4L57A 2JGFA 1OFHA 2NO5A 2GDJA 4RHYA 5IBCA 4QPPA 3LT0A 1IVNA 4EFDA 3DMNA 3ZG6A 1RLTA 2Y1EA 3HMQA 3MRVA 2D5IA 1AUPA 3AEQA 3PNPA 3SJAA 1TC1A 2FFHA 2P91A 2W9XA 3HV2A 3PQ4A 5DU2A 1ZUD1 4E2FA 3HA3A 4KFUA 1SNYA 1M1YB 2X9GA 4K6HA 5AIAA 4OI1A 1LSSA 1ZRMA 3O4HA 5HE9A 4BWFB 1M34A 2QRVB 3THXB 4KMMA 5IKXA 4AKGA 2C9OA 3GQVA 3RVMA 1NNI1 2ANCA 1SKYB 1CFJA 3CZAA 2G9RA 3FRJA 3T3GA 1TTTA 1KL7A 1FRVA 2M98A 4TQGA 1CY0A 1NPTO 2IUFA 3QJ5A 2QI9F 3JQ6A 3A11A 1E7MA 2HXGA 4Y2QA 3QNWA 4IDAA 2CFSA 3OJXA 2E1PA 2X6XA 3DL4A 4I0WB 2PUVA 1AD2A 5T4EA 1SA0B 1C50A 1E3SA 3GLFA 1DU4A 5T64A 1AV7A 3AVVA 1H22A 5J4LA 2OESA 1JKMA 1V3QE 3GJ6A 4WCFA 4JOSA 4JVNA 2ZRCA 3C5HA 3DVSX 3HWRA 3VYTB 4RZHA 1SURA 3PA8A 1P1FA 1ZIDA 2IIQA 4G67A 2W6PA 4GP7A 3PGA1 4IV5A 2WYUA 2QLBA 4X1IB 5AHKA 4CKWA 5L3QB 4GLOA 1OOEA 4QTTB 2W6MA 5LPNA 2I2DA 1HT3A 2A84A 1HX7A 5B55A 2PJRA 1GNLA 4KX5A 1R9GA 5AVTA 1GPJA 3OFVA 3VSDA 2P4QA 3A3GA 2JFUA 2OV1A 4R68A 1R12A 3L1KA 3JVIA 1L7PA 3CLRD 4ENTA 3BXXA 1GGMA 2VNSA 3VTFA 5LU9A 3AFOA 2ZJ8A 1R6AA 5F7JA 5ENVA 5GIPE 3H3FA 3RW9A 3OLZA 2Q9CA 4ZYVA 4PC1A 3UV7A 2VUHB 3CRVA 5CLIA 3T94A 3GMTA 3OQOA 2V4DA 5AR1A 4P12A 4E14A 2IGTA 1JR3A 3AP1A 2HDHA 4YLEA 5K0TA 3NPAA 3SLNA 1QHHA 4LE2A 4P33A 2ZL7A 1GTL1 3NGXA 1ZYUA 3P5BA 4MEJA 4TT3A 2BKEA 4OA5A 4WIAA 1YI2B 1L4FA 1Y89A 1GT91 2A1UB 1KH2A 2EBUA 5DIFA 4BKUA 5LR6A 1K27A 2OV6A 1I2MA 3HBAA 4QYIA 3C98A 1YI0A 3MGGA 3RSHA 2PGAA 2PRYA 4HGOA 1S8AA 4Q24A 4HYQA 3A0RB 4C0WA 1DDIA 3KYIB 2GWHA 3PHGA 3NG1A 3THXA 1M34E 1NBHA 2WIAA 3HXMA 3AF3A 2P1DA 4OHYA 4ZD6A 1KI6A 1L4GA 4LV8B 1E60A 1VFPA 1N3YA 2OO3A 3NO4A 4MPJA 2CYCA 1JFTA 2K7ZA 3O3NB 1W46A 4FYYA 1J06A 1O57A 4N7BA 4PGGA 5CYFA 4D25A 3CJTA 3AVWA 5U4XA 4I1RA 5TMEA 1BXKA 4URWR 3CCUB 2F1IA 1KY2A 3T7DA 3A1SA 3F49S 4KLNA 1H05A 3TB4A 1P29A 4N8DA 3SYRA 2WU1A 3HGMA 2WJIA 1LQTA 3RDPA 1JLMA 2OD7A 1RYDA 1LV8A 2QR5A 3IA7A 3I39X 3LY7A 3CLSC 2D8AA 4PGFA 3SZMA 4F6RA 3GZTB 3FTDA 1JDVA 3I8OA 2NUTA 5C8YF 4DJAA 2XXAB 1GU1A 1R3UA 1EX7A 4CIBA 4B6GA 2Q4EA 5HRUA 2VYCA 2Q4TA 2ZBRA 1NVMB 1KQFA 3BOSA 2PRIA 3TMKA 4OYRA 3E22A 3MM4A 2BJHA 6REQA 3QFFA 1O4WA 1Q84A 1TT5B 1N7JA 2C99A 2J9GA 1AKTA 1T5OA 1VG9B 2Q3EA 3W3AA 4BASA 4BQOA 5LQUA 1Y8CA 4DN6A 3R9WA 2GO7A 3K5HA 1K9VF 1QH8A 4YASA 3SDSA 3TN7A 1C1YA 4OP7A 3F7TA 1WEHA 2A9RA 2V6MA 4ES6A 5JWRA 2C3MA 1N8NA 4QDJA 1WCYA 3DMTC 5CPBA 4RZQA 1LD3A 3C6YA 2FZKA 3GLHE 3N6XA 3OE5A 3W9YA 3VR6D 2OZKA 3JQRA 4H6VA 4JLNA 4BO1A 5KPDA 1BKYA 2B3DA 4R9NA 3TTYA 3UK1A 1NVGA 2JDID 4ZARA 1W1IA 1E0DA 1KXZA 3C5WP 3ZNOA 1VPVA 1D2AA 2I4RA 1PFKA 3WL3A 1QKIA 1T3ZA 4C5BA 1GA1A 2X4DA 3DNFA 3RFTA 3IAM6 5FTLA 3OPQA 2IPXA 3ZUPA 2HU7A 3MTJA 1W35A 4H7KA 4WY8A 4J03A 3CCEB 2J41A 3DTNA 4QARA 1SQGA 4RVUA 2VP5A 3HKCA 3LA6A 3KZNA 1T29A 1I4OA 1WCXA 3TFQA 1ISFA 2VHXA 3BORA 4M1EA 4PTZA 5F2OA 4B9EA 5K05A 4CGYA 3PJFA 3RR2A 1SKQA 2X8LA 3B3GA 4MW9A 5JQGF 1ENYA 4R16A 1I1QB 4V1CA 3BD9A 2WJ4A 1FDRA 1B73A 1TM2A 4PZDA 5KSOA 4P7BA 3DGFC 4EENA 3OCVA 2K6GA 4MRSA 2GKSA 4YB8A 4L73A 3WB2A 3MWKA 4FYHA 4GG1A 4II7A 1FRFS 4IOKA 2IP1A 1TM4E 1G8HA 4ENRA 1QHHB 2XZPA 4HAYA 2FE1A 4JU9A 2P78A 4E5VA 4R1PA 1A7AA 3W2TA 1G60A 1N9GA 2VLBA 3SOZA 2G6TA 4WRRA 2AJBA 2ZXIA 4FS3A 3IOYA 4YQFA 2QWXA 5KKNB 1YLOA 3IPLA 3H6KA 5MGNA 3Q15C 4JEMA 4F4HA 4U9HS 1CUYA 1YQWA 1HSOA 1P7VA 3DZIA 5JS7A 4NXNB 3MTQA 3FBTA 3OKXA 3MG9A 3MINB 3HXOA 4DV7B 3L1UA 3A3BA 1XC7A 4QYSA 3CCBA 3IEPA 2CVOA 4J0KA 2WKPA 1PHPA 5KUTA 3AR9A 4QBFA 4HYYA 4H17A 2XIJA 3LI2A 2WZBA 2JLBA 4HIZA 1XI2A 1P0MA 1HZJA 2C3PA 4MQUA 2H51A 5EIXA 3COJA 1ZXLA 2PPLA 3G0IA 4WFJA 4BEWA 2V7WA 1U0TA 3NH6A 4Y1GA 5JDIC 2HQ1A 2WFZA 4DLAA 3DMDA 1AMUA 1PJQA 4W8HA 2YZNA 3D3JA 1W59A 4HGPA 2H2IA 3EGDA 4IWXA 3Q41A 3BWVA 1RAGA 2NO4A 1BVRA 2ON6A 3WGQA 5E7JA 3RI3A 2CEKA 2HJWA 4K1XA 2YZ2A 4N5HX 2Y66A 1NXXA 3T7AA 3FWYA 2DKOA 1U7DA 2BF4A 2VBVA 2OE2A 4PAMA 2C7RA 1GO2A 3KSDO 4LGYA 5H02A 2EFCB 3MLAA 4OVKA 3PC8A 4TTIA 3RRXA 2A9OA 1Q0ZA 4UZEA 2GNAA 1D4OA 2SICE 3MERA 4G56A 3N8IA 4UEKA 4NBVA 3E4CA 3QPVA 2OZPA 3DE6X 3UYKA 5CB4F 3TGPA 4I4TF 4WADA 1ZR4A 4RWEA 3A3OA 3CCLB 1ZAKA 2CXPA 3WNBA 2AOUA 1TGVA 2XDAA 4BQPA 5JZVA 4X64B 5KSZA 1SU4A 3ETLA 3H5NA 2NGRA 4MR9A 4G26A 1GIAA 1LV7A 4NYMQ 2BGJA 3GDOA 4YLYA 4A2QA 1U2GC 3B1ZA 1N1MA 3WGMA 3QUAA 3LGSA 2DLDA 1QPBA 5BV8A 4CLOA 1AX9A 1QBKC 1RJ9A 4FGZA 5L3SB 1G6HA 5IC6A 3KKQA 4INJA 5LZ5A 3KHUA 2UVPA 3FF1A 4G5FA 5EIHA 3VO2A 5G1PA 2PGLA 4U2EA 2CBGA 4DCMA 4D41A 2CF5A 2P35A 3PUHA 4E4YA 3FZQA 1LNSA 3AEXA 3N87A 1FUKA 3QBEA 4JS0A 2WU0A 1I7PA 3SZUA 4F4UA 3SVLA 3DSRA 4DRXB 1XG5A 4Y7DA 3C15C 2AF4C 3ULKA 3Q6QA 4CM7A 4QPJC 4CIVA 1ZM9A 4B4OA 4N0DA 3OPMA 4HNVA 4RY2A 5AVZA 4G1VA 4DTCA 3ZZUA 4IH1A 4KEAA 3P19A 2ZUEA 2HHJA 1VLYA 2JZNA 2XVYA 2CMDA 3BXFA 3S68A 3WVNA 3WDLA 2WHPB 2HWUA 5F4OA 2WW8A 1M2OA 5M29A 2QL9A 3HV0A 1J8DA 1DGQA 2A0YA 1L8QA 3NXKA 3NHFA 4MNTA 5FUMA 1SVWA 3MSXA 1D1SA 3UK2A 2WUDA 2N1BA 4QOFA 4X61A 5FHRA 4OMDA 1YVDA 4J16C 1ZESA 2WIFA 5F35A 1VIVA 4WBNB 4DMHA 1N6PA 4TKLA 1KQPA 1PZFA 3UKJA 1Z4QA 1BRMA 1TJ4A 3K32A 4M99A 4ZQHA 1D2EA 3O38A 3BB4A 4OB7A 4E1AA 3DXZA 3L6CA 4M9RA 3PIDA 2VK2A 1O95D 1ADBA 2FVXA 1GGHA 3JCZA 1ZL2A 16PKA 3KETA 4Q1BA 4GYKA 4N1AA 1W0CA 2CL5A 3MUFA 4YI5A 4R8MA 1TEHA 4RKYA 1QNLA 3O8QB 2HBRA 4JAVC 4G5HA 4Y0NA 3OW2B 2AZ4A 2WM3A 3DWFA 4KNYA 4XD7A 1T2DA 3D0RA 4WFIA 1BU5A 1G8MA 1HO3A 3WAJA 2I9PA 2YW2A 3OBBA 2VWQA 3P8ZA 3W8FA 4PSAA 3FWZA 2WJVA 3HKEB 3T38A 4NIMA 2X8AA 5EHZA 3FMIA 5FR1A 4MH0R 4OATA 1IAVA 1EHIA 3GVJA 3V33A 1V4NA 1EUYA 4FXPA 4KFTA 3UIEA 4BCBA 1G66A 1WZIA 2EZ4A 4PG4A 4D0RA 4Q7JB 1I32A 1B93A 5KS2A 1E2JA 1QFMA 3JVUA 4GBJA 2X77A 2CFOA 1UXGA 5AJTA 4N0EA 4XH9B 1E43A 5CVEA 3K1ZA 3WMEA 4CR6A 3VYRB 5ALEA 2UXDB 1YACA 3WQHA 3S1AA 2CCKA 3TLMA 3VHXB 3NFRA 4C05A 2OCIA 3FPPA 5LOVF 3JYPA 3ZE0B 4XLAA 1BQ3A 1UAGA 2B3TA 2QU7A 3QGMA 4DA4A 1AIPA 2CJPA 1UBTS 4QSMA 5IMBA 3G2NA 1Z37A 4HDOB 4P3KA 4DEYA 2Z30A 3QJYA 3HU1A 3P97A 1CJUC 2A8YA 1P45A 2QMZA 4IZHA 1QRDA 3OPYA 4PTLA 1V4VA 2VQ3A 1DEHA 4O25A 4IGKA 1JI3A 2AJLI 1QE0A 5KTPA 5JBQA 2WWFA 4O08A 3OZWA 1SBHA 1T9GR 1RBYA 3GGJA 4AZ0A 1DRVA 1OR8A 4RJ2A 1CQIB 1RZRA 2XDWA 2Z8ZA 1XYYA 1KIAA 3BAFA 4I50F 4DV1B 5ARBA 2JFNA 3H9EO 4MV8A 4K9SA 5AI4A 1X8JA 2WHPA 1U8CB 5KJEA 1XQYA 3GZJA 1OH6A 2V3CC 3RRMA 3I62A 5BYAA 3BSSA 2PKRA 3DMHA 1Y6FA 1ISRA 4MDEA 2PH7A 3L7NA 4OXYA 1FDTA 1Q6ZA 1HDEA 4EHIA 2CJWA 5ITZA 4NVRA 4U7JA 2PCLA 4FEGA 4FYXA 1CTQA 1ZCBA 1HDOA 5DW0A 1KSJA 4AAYA 1H3FA 2ACVA 3HRHA 4EUKA 1A1SA 2VWGA 4L5BA 4TS1A 1TKAA 4PEVA 1M66A 1Z6AA 2FR8A 1CF2O 1H8ED 3Q40A 5CH3A 5KNCD 3G82C 2W6OA 1Z7YA 2IEYA 3A9SA 3KQWA 1QXSA 1Z6QA 2JLXA 2ZVDA 1I6MA 2FYTA 4HWKA 2YR0A 3I9MA 2W0MA 2ZT6A 3QHQA 4E32A 3JAWA 1I9GA 1XXLA 4JHXA 4XEHA 3KAQA 3P27A 4X45A 5BMVF 1QDUA 4TGLA 5B5SA 3ELYA 5DNUA 4E4TA 1PBTA 4ILKA 1KVRA 4EG5A 4GDMA 3LT4A 2ZS7A 4U7FA 1SMKA 1MRZA 2B20A 3ZY4A 1KZ7B 3QSYA 5IF9A 5KYTA 4JX9A 4KL8S 2GN4A 2ZPAA 3IB3A 3I56B 1SBNE 3K8QA 1W30A 2XCSB 4WEOA 1P0FA 3RG2A 3ND6A 1E9FA 1CY2A 3N05A 3H18A 4PY2A 3OOSA 1AK2A 5ALLA 3ROKA 3SZ3A 3WR5A 1GN9A 3VC2A 2XVZA 1I1NA 3P7MA 3NBQA 1COWA 2GPAA 2PLRA 3KKLA 5DX1A 4JUIA 4IX1A 5GADl 4B6JA 2ZIXA 4EKDA 3LKZA 3MW8A 4S0XA 4RFLA 3WRXA 5K5EA 1M5UA 4WLVA 5KHLB 1BQEA 3L0BA 3O4VA 5I51A 3LX4A 1UZUA 2XGGA 3HKEA 5TJ9A 5F4JA 3UHOA 1PNOA 3ELDA 3GC6A 3FSEA 1P75A 1RPAA 3U5ZB 2JAPA 1BCRB 2F4VB 2RAUA 2YFYA 4UJ5A 2FHPA 1O1YA 1RJWA 1SOMA 2GMWA 2IU3A 4PX5A 5K9ZA 5D5QA 1HYBA 3ZD6A 4U7DA 3COYA 3F6CA 3VYVA 4UM5A 1EUCA 3DDZX 4RA6B 3RGGA 2GA8A 4K2AA 3LGXA 3LUAA 4P22A 4ED9A 1ESMA 5FWXA 4PO3X 1H85A 5GV8A 1W48A 1YJ5A 3IEKA 2Y8EA 4EKYA 2YL2A 4Z7QB 5CFRA 1M2VA 1BN7A 3D6VA 3ZVLA 3I30X 3WL5A 3NU1A 2ZOSA 3SEAA 1WXFA 2PYZA 3FCCA 1LCIA 3C45A 1HDCA 1O0BA 1ETHA 4LF9B 3A7DA 1QCDA 1WEKA 1WHTA 1C9DB 1DJOA 2VDRB 3IS3A 2E1BA 1EUDB 3OOWA 3IUJA 5BSKA 3KC2A 1NJFA 1N2CA 1XLTC 2WFMA 1KOGA 4JLJA 5KOJA 1DXQA 1M2WA 2HPZA 3G05A 1J1ZA 1UBUS 2UZ3A 4JWKA 3I2FA 2WWGA 2F8TA 1QHXA 1A2QA 5JNRA 5A9SB 1OX4A 1E4EA 4PXYA 3THYA 1FL9A 3LRPA 4IP0A 4WGGA 4B4VA 4B7XA 4RHTA 4BATA 3FTPA 2MJLA 4RVGA 3E18A 1VC2A 4RTNA 2PUTA 4LF4B 4DUYB 1XZCA 1FFDA 3C8ZA 1JJ2B 2QT1A 3ESXA 3K09C 4KHZA 3UK7A 4YRMA 1XKXA 1V6CA 4AJPA 2ZZEA 3AV0B 4MGIR 3G88A 2X6YA 4JP8A 4TXHA 3R9XA 4FYPA 1MVNA 3NAZA 1B16A 1I4LD 3F71A 3FN4A 1W4LA 2ONYA 2O7QA 3G2MA 4KPFC 1P0QA 4YRPA 3UW1A 5CVCA 2O8EB 1GUFA 4HZUA 4JXJA 3GRKA 1F3OA 3HL4A 4ALLA 3KTAA 4IIDA 4N39A 3DEAA 3KWLA 2O3QA 2BMDA 4KVZA 4M1SA 2DHEA 3OEHA 2XW6A 4EYGA 2K7FA 1EGAA 3X1ZA 1K4YA 3H4VA 2Q1TA 1EP2B 1DTWB 1ENOA 3PGMA 1Y5IA 3K9QO 4UATA 2VJIA 1WXGA 4HSEA 4B73A 3STHA 1MX1A 3KEOA 4HTFB 1X7GA 4TYQA 2H00A 5AHOA 1YRYE 3OEWA 3TTXA 4R2KA 4EF4A 2ZLBA 4DLNA 1V48A 4DMCA 2N46A 4A92A 2WU4A 3WKBA 2P75A 4PG5A 2O2YA 1TADA 1UBHS 1UKBA 2H63A 3RYIB 1SUPA 2QX7A 1OU4A 3PVDA 2C8VA 3IBCA 2BGIA 4FJ0A 2WILA 4IMJB 4JLWA 1BMTA 4OIFA 3VJMA 3C87A 1SH7A 4PNZA 1XCJA 1ZI8A 2R1UA 2ZI7A 1M72A 4P3OA 4XWYA 1C9YA 4Z4YA 1H2AS 4HTAA 4UNNA 4YR7A 3CW9A 2PZGA 3C3AA 1R5BA 3OCYA 3O2NA 4ZO4A 3V8VA 5A5EA 4US2R 2PNFA 5EZYF 2VH1A 3EGWA 3ZV4A 1RP1A 2C4WA 2XOKD 3T4EA 4EZIA 1GKKA 2INGX 2WYVA 3TW6A 4G0UA 2C2MA 3B9BA 3INGA 3LCMA 4MTCA 2V5UA 2VP3A 3K15A 4F71A 3CA8A 1YCGA 1QWSA 4WTOA 4BO6A 5JYDA 4F4DA 3H6GA 2WOOA 2GZRA 2BUAA 4GPEA 1C9JA 4G5OA 1OBOA 6GPBA 1GL6A 2B4TO 2ZKLA 4IGIA 4D0SA 4JVOA 3UK0A 2NSDA 3FMOB 2HQOA 1Z36A 3RNOA 1L1EA 3AZQA 1KEPA 4R51A 2ZE8A 1V3TA 2IT1A 2V9PA 1T36B 5EC8A 4N9WA 2GTHA 1BHO1 1MO3A 4P83A 5THXA 1A0OA 3DAPA 3LT2A 3DHVA 3O3OB 3Q8XB 4R31A 1SZCA 2GEVA 5E9QA 4YAWA 5LM3A 2D1YA 1CSEE 2C4KA 3ZHZA 3Q7TA 3FCUB 1O3YA 4CDGA 1C7IA 5K3AA 2KLBA 3VKWA 2HDWA 3JVVA 1Q17A 2JDIA 4Z9FA 5E3IA 1ZRSA 3MJEA 4IJ6A 3S1LA 4GP9A 5G0SA 4EATA 1N3LA 3JWIA 2G63A 3ELUA 2PX5A 4PIMA 10MHA 3EXG2 5HZKA 1P4MA 1ULTA 5TMDA 3EVAA 3AUSA 4UTRA 5BMOA 1OF1A 1WXDA 2BBWA 2DH5A 5BV7A 2HHAA 2Q5EA 2WSBA 5A3SA 2C95A 5LP6F 2J3MA 1TA9A 5DSXA 4EX6A 1NRKA 3KKNA 3IPAA 4EFLA 1BS2A 1SG6A 1J39A 4OMFG 4AX4A 3EFBA 5E4JA 4QUZA 1J2EA 2EHDA 5AJYA 3OIVA 2QXYA 4AYXA 4ZEWA 5C52B 3K8YA 1P9WA 4H3HB 2WJGA 4RKQA 4I36A 3LQRA 2OFPA 5BN5A 1W36D 5I9BA 5IUJC 2MSNA 3DVAA 4YV1A 3BK2A 2GD2A 4XAQA 1X8XA 1GQYA 3MQFA 4I4NA 4B33A 1J0EA 2HR1A 4WOBA 4Z0TA 1MXFA 3C3CA 3PPIA 4RL4A 2QDKA 3DFUA 5DTRA 4WHMA 4E46A 4F4CA 4P5DA 2P9BA 4JDPA 5LDDC 2Z9DA 3BMOA 3DWIA 3AM1A 1ZLYA 1YCDA 5JCXA 4H77A 2Z8YM 2C4NA 4ZXFA 1V0EA 2XCLA 2QSYA 3ANMA 3CS3A 4ND6A 4AMVA 3X0DA 4HMQA 2AUNA 2XCOA 4KLRA 2HJSA 3FKQA 4KNVA 4S24A 3HCOA 5C1BA 1YFLA 4Q1VA 1E5LA 2C04A 1QKKA 1NRJB 5FOVA 1QQTA 1X19A 4MJ3A 3HJFA 1CUZA 1TT5A 3FPCA 4DT1B 3EY4A 5JOQA 1KC8D 5CMLA 4XYGA 4B71A 2IYWA 5B3KA 2BFEB 1ZKMA 3BH7A 1XD2B 3S2YA 1V5WA 3OESA 4JBXA 2ZWIA 4R1MA 2R11A 3DE7X 4FJ1A 3IBFA 3CEMA 2G3YA 5IDWA 3LV8A 4M38A 4GBMA 1UOEA 5CH8A 1SCAA 4NI5A 3QXSA 2TYSB 1RIIA 1XPUA 4PX2A 1AKMA 4EB8A 4L16A 5G4KA 4D8UA 1UBFA 2VRWA 3AF4A 4RF2A 2QRQA 4GKKB 1TA0A 3CISA 4J94A 1YCFA 4C4TA 2DSNA 3K2EA 2IDKA 1PV2A 2BDTA 4XDHA 1ETUA 4TTTS 4XORA 3GCWA 4IOJA 1NVKA 1USKA 2OZLA 2WHYA 1GPLA 2JFBA 2FSIA 3KEFA 2OPBA 4QAJA 2JAQA 3A04A 5EE5B 3ONUA 1DEXA 4U6NA 3OLYA 3T34A 1J2JA 1E66A 5F77A 5DRTA 1F0KA 2VDWB 4B4DA 2ZVPX 2IZ1A 4L1KA 1AVTA 3VO1A 2BEWA 3C8UA 3STVA 3N0TA 4YP5A 5K8IA 5DGCA 3UJHA 4ME6A 1X39A 2HWXA 1K08A 3LXRA 1Q0QA 2VHJA 3TTTA 4D9KA 4AJ1A 1OX6A 5FNVB 5BN4A 4YRBA 1ZOPA 4DV6B 1DAMA 4OKIA 1W87A 3KZCA 2V65A 4YJHA 1XPRA 3OP1A 3LPLA 4PFSA 3FWHA 1WZEA 4Q19A 4CLEA 3HO1A 1Q0LA 3AR5A 3P32A 4BNIA 5L6MB 3ZTYA 1E96A 3D02A 4WKPA 1J22A 3V8NA 2IBTA 1Y7PA 1PVOA 2OTJB 2BH9A 4CNBA 2X2FA 3D4IA 1ML4A 1N5KA 2JL1A 2YWCA 3EEIA 1MAVA 3A31A 4J0JA 3A9UA 1NPYA 3AZPA 1P8AA 2H5LA 2NSYA 2QAGB 2JCXA 4YIKA 2F2TA 3N28A 2IXBA 3H5TA 1FMFA 5JFGA 2OD2A 2XYGA 2FOIA 4FEAA 4RKEA 4W7HA 4DSUA 1GTG1 2BF7A 4AS1A 2BKUA 3RT1A 4JJZA 3M5WA 4GX2A 3FI0A 4RENA 4DE5A 1B6RA 1E99A 4DCCA 2GBCA 2GRUA 3TL6A 5B1DA 2O2IA 3GLTA 1PJBA 4W5WA 4WK4B 4W1SA 1AT1A 4PZ0A 2C4VA 1X1RA 4Q4DA 4G23A 4RPJA 3HK2A 4QBIA 3RIGA 1M9NA 3MT8A 3W6PA 5KYXA 4MI9A 3KG2A 1KPIA 3HR7A 1XL1A 1E4YA 1G8YA 2FG6C 3DKPA 3LNCA 4JX8A 2PRJA 3T0GA 3Q0IA 3PTZA 4LCBA 4TSRA 1NP3A 3EMBA 1GFWA 3TSOA 1JZSA 1UP4A 3FFAA 1Y6ZA 2XWQA 1KVUA 2PWPA 3IQDB 2JJ8A 4YCCA 4L7VA 3ISXA 4EZBA 1ONSA 2HJ9A 2QVYX 2FN4A 2H2GA 4O6VA 3R5JA 1EP1B 1QPZA 1Z0KA 4Q9AA 2A59A 1MW9X 1Y6JA 3DEHA 1AK1A 4FWBA 1DC5A 2IUUA 3RVDA 1X7YA 1KRXA 1C9NA 2FZCA 1T3HA 2OECA 3T1TA 2HPAA 2WUEA 2AEFA 2YYSA 2PZMA 3RB8A 4PW0A 4MV3A 4RH3A 4TZ0A 1XCPA 1XZHA 1ZWKA 4NBUA 1G6OA 4N4AA 4L3VA 3T56B 4KITB 3S7ZA 5IPFA 1RLIA 1EK1A 4UPDA 5D3MB 3ONDA 5K3BA 5THQA 3TOZA 4FSHA 2I8CA 2Q1UA 4QJ4A 1XMOB 3N8GA 4HVLA 1U80A 5B4UA 13PKA 3UJ6A 4WKBA 2AMYA 2AOTA 3KEQA 3HB9A 2LCQA 3SJ7A 1U90A 3V3KA 4FK8A 5KQMA 5AICA 1TM1E 3BZBA 1M2GA 3KZMA 3AXTA 3EZYA 2VJQA 4EPWA 1JLKA 1KBQA 2FPWA 3NETA 4AJHA 5DEOA 3WMRA 1IBKB 1N2BA 1A9OA 1J49A 2FRXA 1F2TB 2GT1A 2OGWA 1LWOA 3EW7A 3A2NA 4L22A 4Q7KA 4LZAA 4M0EA 5KOHA 1D8TA 1SCJA 1V16A 4BQFA 2ZYTX 3ICOA 4HAWA 4MPRA 4QFDA 2FU5C 1T4BA 4Q1AA 3M3DA 2H48A 4PWYA 2OPHA 3PEVA 3DD5A 2VYVD 2YC4C 3GLSA 2J0QA 3R20A 5JCPA 5JCOC 3B36A 4FT2A 3HZRA 4Q9KA 2W6ZA 3PHLA 2BT4A 1XR3A 1ZSNA 2G8NA 3P0FA 4TKVA 1UKCA 2C7GA 5AFSA 1GXSA 3LWDA 3Q4GA 1KI9A 3QVOA 4L8GA 3FOEC 4GPIB 2MYPA 4UUNA 4E0FA 3UT5B 2EFHB 5TVKA 6CHYA 4Z4QA 3GW8A 4CKZA 5TC4A 4MRPA 1CNFA 3HZHA 5KAMA 2HRZA 1QRUA 4C6TA 5EMJA 2I2AA 3ENNA 3JVDA 5IDXA 1MX3A 3QRWA 2IOFK 3OBIA 1ZA2A 4UHFA