1GR1A

Structure of ferredoxin-nadp+ reductase with glu 139 replaced by lys (e139k)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKKMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP+ REDUCTASE
publication title Probing the Role of Glutamic Acid 139 of Anabena Ferrodoxin-Nadp+ Reductase in the Interaction with Substrates
pubmed doi rcsb
source organism Nostoc sp. pcc7119
total genus 88
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2001-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1gr1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1gr1A02
1JNYA 1Q86D 2YWFA 4Y9RA 2OK8A 4M1KA 1CNEA 3CCQB 1EFUA 1QFYA 1KC8D 2XEXA 3W5HA 1FNCA 1OB2A 1NJID 2AHOA 1E64A 4YAUA 1OGJA 4PC3A 4ZV4A 1XB2A 3QFTA 2QN6A 4AF7A 2BV3A 4FN5A 5EMNA 3W5VA 1VQ5B 4ACBA 2VNHA 5JBQA 3ZZUA 4U9UA 1F20A 3G6EB 3OZUA 4TMVA 4NBSA 1CQXA 4AC9A 4Q7JB 4PGOA 3MHPA 3AVXA 4FWTA 2B7CA 4BPRA 1EP2B 1KK2A 1EFTA 3AGQA 3B8HA 5DSZA 3VMFA 4TMZA 4PC7A 3LYUA 2HCJB 3W5UA 2PMDA 1H42A 4QFMA 1VQ8B 1VQMB 2BMWA 4YALA 4B44A 5GV7A 4DQKA 1K73D 1J9ZA 4RD2A 1FNBA 4ZGNB 1W2BB 3B82A 2E1RA 1R5BA 2X3UA 3I55B 1BJKA 3QE2A 1E62A 2QTLA 1S0UA 2B7BA 1DG1G 3CCJB 1GO2A 1JJ2B 2VNKA 2VNIA 1FNMA 1YI2B 3ZZ0A 1WDTA 3OW2B 3P26A 2BM1A 1EXMA 1YJNB 4PC6A 3VNVA 1M90D 3WBKA 2J7KA 4C43A 4YHBA 2OTJB 4M4SA 1KD1D 3LRXA 2QEXB 1Q7YD 3OJXA 1KRHA 1NDHA 1TUIA 2NPFA 3CMAB 1N0VC 2BF4A 1UMKA 2OK7A 2QTZA 3PENA 2CRVA 1QFZA 4YAOA 3G71B 1E63A 3JQPA 3LO8A 1FRQA 1G7RA 1AIPA 1EP3B 3VO2A 1SKQA 4G1VA 3WBJA 3VNUA 3WY9A 3W2HA 3SJZA 3CD6B 1DDIA 3AVYA 3AVTA 1QGZA 3CC7B 1ZM2A 4B47A 3P27A 4B3XA 3CXCB 1AMOA 1TVCA 3CCMB 5THXA 1ZUNB 3A1FA 1YITB 5H5JA 3AGPA 2HMAA 5GV8A 4ACAA 3B78A 3W2EA 2BSAA 1QG0A 2BVNA 4HE6A 5TV2A 1VQ7B 1QVGB 2QMUA 5AN9A 2C77A 4RD1A 3ZC3A 1XE1A 3WXMA 4C0SA 1IJFA 4HE5A 4YAWA 3W2IA 1M1KD 3JQRA 5HXBA 1K8AD 1BQEA 2PIAA 4R71A 3QFCA 5TY0A 1VQPB 1B23P 4N3NA 1N8RD 2EFGA 1QFJA 1JB9A 1HA3A 1N0UA 2R6HA 1QUEA 1D2EA 1GAQA 4TMTA 4F7DA 1ZM9A 3CRZA 3E20A 2VNJA 1G7SA 3V76A 3FPKA 3QFRA 2CNDA 4TMWA 1OGIA 2DERA 4Y9UA 4RJLA 1IB0A 1W35A 1B2RA 2DY1A 2C78A 4M2LA 3WNDA 1QX4A 2YWEA 3CCSB 1ZM4A 2OTLB 3ZBUA 2ZITA 3CMEB 1KK0A 1VQOB 3WYAA 3G4SB 1VQNB 3I56B 1TTTA 3MMPA 4M53A 2DEUA 1A8PA 4ZCMA 4P3YA 1Q82D 2YWGA 4M0LA 4RD6A 4QHYA 1EWYA 4TN1A 4MYTA 4LBZA 4RCYA 3AVUA 1W87A 2PLFA 1Q81D 3CPWB 4LBWA 3FJOA 1DDGA 1F60A 1ELOA 1SM4A 4LBYA 5KSWB 3J81k 3JQQA 5TR9A 1KJZA 4N3GA 4LC0A 1G7TA 4DQLA 1YJWB 3W2FA 1JA0A 3U6KA 3U6BA 1FDRA 1VQ6B 2FX3A 3CW2A 4ZCIA 4MYUA 2DETA 2BPOA 1K9MD 2XNCA 3CCUB 4B4DA 2B5OA 2BGIA 1D8TA 1VQ4B 1FRNA 4NCNA 3QFSA 3AVVA 1JA1A 1BX0A 3E1YE 2BN4A 1QGYA 4H9GA 4TMXA 2BM0A 4RD0A 2RC5A 1G7CA 1KK3A 1H85A 1R5OA 3OJWA 3W2GA 4RD3A 1U2RA 3WNBA 4LBVA 1GR1A 2YWHA 4UAJA 2VYQA 3VO1A 4PC1A 3CC4B 1I7PA 4G5GA 1GJRA 4K1XA 3CC2B 1YJ9B 1R5NA 1OB5A 1EP1B 4ZCLA 2QA4B 3LVBA 3CCLB 2VZLA 3QSYA 1YHQB 1BX1A 1YIJB 4P6VF 4RCZA 4YAFA 3U2QA 4G1BA 2QDXA 1TLLA 1KQSB 3I1FA 4B48A 1QVFB 1VQKB 2D74A 1GAWA 3CB4A 1VQLB 2DCUA 3CCVB 1D1NA 2RC6A 3CCEB 3WNCA 4ZGQB 1KTVA 1W34A 3CCRB 3ZZTA 1QGAA 2HDNB 1QUFA 3OZWA 5FA6A 4PC2A 1KK1A 3OZVA 4RD4A 4EH1A 1IJEA 3ZBTA 1DARA 2XNJA 4WQMA 3AVWA 4J0QA 2GQFA 1ZM3A 1FNDA 4Y7CA 1EFCA 4AF6A 3ES9A 1QH0A 1GVHA 2BGJA 4IW3B 1CNFA 4FK8A 1VQ9B 2EIXA 2GPJA 3MCAA 1S72B 4B43A 5H59A
chains in the Genus database with same CATH superfamily
4JKIA 3OKAA 2VF7A 3DC7A 4A2QA 4O5AA 1XFDA 2OK8A 3BHMA 1DNPA 4N0QA 4A26A 5J23A 2HLHA 2MDTA 1DIOB 1MAAA 1T9GS 2AK3A 2UZAA 1AKTA 4M38A 4XIFA 3E9YA 3ZS8A 3IKVA 4R40A 4G0YA 4E4RA 3UFBA 3O4RA 3LAWA 1CQIB 1DRJA 3E6AA 2P2NA 4GOXA 4RHFA 4ZVTA 1NT4A 4EPVA 1UK7A 2AHOA 4MWGA 2WMNB 4OBBA 2XJ9A 4QX6A 1AF7A 2QMOA 1C3EA 3R5XA 3AILA 4XGIA 1GU0A 1MLDA 1SQ6A 4BC1A 3EEFA 4YV7A 4UQOA 1SBIA 5A0TA 3JZDA 1E2FA 6REQB 3GBSA 4HQKA 1AN0A 3GPCA 4WKCA 2H4HA 5DHRA 1E5TA 4EA7A 2CB9A 1XJ0A 2QG9A 3WRYA 3BCDA 4TXMA 2BFCB 3LPCA 1IHDA 3LFUA 4ZJYA 4Q93A 1C0LA 1WD7A 2O14A 4E2XA 2HV9A 4QG3A 3COZA 4M1WA 1P1BA 2CV2A 2XI4A 4IIVA 4KZPA 4HPJB 1NU8A 5BUCA 5MHTA 4FBMA 5BSWA 1XAJA 3TFQA 4C30A 2H08A 2FW8A 4IJ5A 4JJZA 4EG7A 1OCEA 1OY1A 3GO4A 4XQFA 3FI9A 1FVHA 1PWHA 2RHCA 4YJ2F 5LR6A 1GD1O 2B7CA 4NONA 4N8DA 3X1YA 1KP9A 1LY1A 2IHNA 1JLHA 4J3JA 3KP1A 5A9TA 1Y8QA 4G4IA 2VF4X 1LXCA 5TMEA 3H87A 3LYUA 3OE5A 1ODIA 3QTBA 2JLUA 5EHQA 5HOQA 2PMDA 3AUSA 4U7DA 4B3TB 5ALHA 2JFOA 1H22A 2C00A 3QKTA 2CHEA 4FUQA 1DTWA 3RBXA 5GV7A 2IF2A 5F77A 3SEAA 3V4RA 4DEVA 2FEKA 3E23A 3HRIA 4HH0A 2ZBGA 3LD9A 2DTXA 2R62A 4MR9A 3T7KA 4DM3A 4YX9A 4KWTA 4LJ6A 5SICE 4NNJA 2RCYA 2WU0A 3NC0C 4JS0A 3V34A 4Z4CA 1D6NA 5JD6A 3L18A 1NYTA 3U49A 4M49A 3RS5A 4KV7A 2GN4A 3MWEA 3UM9A 3WHIA 4G0ZA 3LLVA 2WWIA 3URKA 3LYLA 1OVMA 2WW8A 1VFPA 3TM4A 4H7EA 4C7OB 1QHEA 3A6LA 3TQHA 4Y9TA 1Y6QA 2AG0A 3OZXA 3D3WB 4QDJA 3DYVA 4GL4A 4RJKA 2QUZA 2QL7A 1YLOA 4UUMA 4GRIA 1NIPA 1PFWA 3BCFA 1F2DA 2AC4A 2NU9B 4D9JA 1OLUA 3FNIA 1AKEA 3DL4A 1MEOA 4KIFA 5F51A 2ZM5A 3K0AB 4N0DA 4KN9S 1MH9A 4P83A 4YRTA 3G2KA 4O5OA 4DPMA 4OLAA 2QTVA 3VO8A 3PIIA 3ZHRA 4X7DA 5IKPA 1V11B 5JH7F 3WDKA 4XJXA 5FA5A 1U0OC 2RHOA 4NCAA 5CAEB 4FHCA 2AXPA 3JQ9C 4WK4B 2VHEA 4KWIA 5BSMA 5IXSA 3KQKA 4J2OA 1PR1A 5E0OA 5ECWA 5HKLA 3V6LA 1C81A 2AX4A 3PE6A 4BCBA 3KD3A 5D51S 1JG2A 3MCVA 1AURA 1QP8A 1ZSYA 2KW5A 3FUUA 3P9KA 2H92A 2O23A 3QKSA 3KSRA 1XRMA 4Q6WA 4REQB 3W3AH 1EVQA 1RXIA 4RHXA 1T9DA 3IP8A 1FVFA 4TMYA 2C8JA 3OG9A 1KD1D 2J5KA 3GG9A 3P9IA 3CX8A 3IELA 1G0OA 3S55A 3NVMB 4GGOA 2V4DA 4DRXA 1NDHA 3TSWA 4AJEA 2XDWA 5EXEA 1XDBA 2QL5A 2VP5A 3PNPA 4ZVKA 4EOGA 3DOJA 3WAKA 5A5DA 2I9KA 4BMOB 2IE0A 4D8WA 3WL5A 3CT4A 3P5BA 2DKOA 3H5LA 1A9YA 3TOZA 4RMNA 1C8LA 4MUEA 3B3GA 3HTXA 3N87A 4PZPA 2I7XA 3A7DA 2XUZA 5AW6A 3T9BA 1G2PA 5GVSA 1U2PA 2GO7A 2V6MA 3PXEA 3OU2A 1FQKA 3B9BA 4DIBA 4FGLA 4KPEC 1Y3BE 4KR9A 1JQ5A 3ILVA 2A8YA 2H00A 2XYQA 3MTDA 1F14A 2P9GA 4AM8A 5KCZA 2WUDA 4DB4A 3REQB 3TO5A 2NTJA 3MWDA 3PF8A 3ZDQA 3ZJVA 2GZ1A 1FB5A 3O2SB 2BKEA 1IN6A 5AJUA 2WPDD 4Q9DA 1U9JA 2R8ZA 2GPSA 3UB3A 1PS0A 1WA5A 2BI8A 3C3PA 4EG8A 1XV5A 5ALVA 2YW2A 4PYQA 5IF9A 1DLJA 2JRCA 2DY0A 4EHHA 3MG9A 5ICMA 3N86A 1NVEA 1T34A 3DONA 3KLMX 4L4YA 3F6CA 3HU3A 5IJWA 1DX4A 4UBLA 3O8CA 2ACWA 1R6XA 2LDXA 1JXMA 3FNQA 3GRFA 4N0MA 1YRQA 4F3NA 3KJFA 3WNZA 2HOQA 3DWIA 1DO0A 1IEVA 4B3FX 2RAVA 2B9EA 3KKKA 3ASPA 1W5SA 3AGPA 2E89A 2IT1A 2VRBA 1UFVA 3GK3A 1Z82A 4Y2VA 2JIQA 4NCHA 2GETA 2O5CA 3MINA 3EXAA 4Z49A 1TT5B 2AI2A 3CUWA 1Z0DA 5AVQA 2X4LA 3I9OA 4HQ0A 3VFDA 4LHYA 3CE9A 4CKXA 3DXZA 3D31A 4RUKA 3I12A 2XTZA 3HNOA 1OMOA 1XEFA 3L8GA 5DCWA 1OGYA 1YB7A 3KE9A 1WO8A 1WXFA 1Z4LA 2JGKA 2YWXA 3U3RA 4J2HA 5EMJA 5AD1A 4X45A 4JDUA 4YJ3A 2PIAA 2IZ1A 3FHTA 4KCGA 1VIVA 1JQAA 2AF4C 2H63A 3AVPA 3FHOA 3HR8A 1U94A 3WLEA 2W2MA 1TRKA 1ZMBA 3AUTA 3GMIA 3TD6A 4ZEOA 4XLHA 1T8WA 2PYZA 1QCCA 5G0SA 2PZ8A 4O3MA 1W0KD 2HX1A 4FW8A 4KH0A 3GLGE 3QF4B 2IX9A 5WRFA 1D2EA 4JUFA 2PUVA 4Z0NA 5KPJA 2PGXA 3LT2A 1XZKA 1SIBE 1QZTA 3W8NA 5JNLA 4FM9A 4IQ0A 2ZAGA 1LPBB 4AS3A 3V76A 1WEKA 1BWPA 2OM6A 3CJQA 3AR9A 4RH3A 2CUNA 3VPCA 1Y9JA 3I6BA 1YJ5A 3K16A 4EJFA 1ZCAA 1GSOA 1VJ5A 2OHVA 3EGOA 1X1RA 4QWWA 1SVLA 1NLMA 2CBXA 3MJTA 5CPFA 2ZK7A 5K3OA 4OU5A 2IS6A 1D2HA 1GQSA 1HYHA 2X0NA 3IO5A 2HZBA 4JJKA 4OK3A 5GONA 3R7AA 4F92B 5AESA 4Z4WA 3LC0A 3W6OA 1EB9A 2NSLA 2FPPB 3FF4A 1Z33A 2R8EA 4EQZA 3CJRA 3HPRA 1LPMA 3K35A 5A5EA 4XLTA 3OQJA 3LDAA 1SUPA 1WMAA 2GREA 3GP3A 3QU5A 3CMEB 5E9QA 5K1ZA 3Q38A 1VQOB 1ISRA 1KBOA 2CNWD 3DA8A 2IU0A 1WULS 2FPMA 3CR7A 4W4TA 3AF3A 3QWHA 1OASA 3I56B 1P2GA 2ISSD 1A8PA 1CCWA 4X8MA 5ALWA 1NUQA 2HPVA 4HH3C 1Z7BA 2HQ1A 4A8JB 4TWIA 4HYYA 4NENB 2XRMA 4D44A 1E1RA 2ZB4A 2FMFA 4GI7A 2RH4A 4TN1A 2ZRKA 3C5EA 3VM6A 2RGGA 2ZG6A 4MYTA 2ZSDA 2NYUA 3SBEA 2Q4TA 1TF7A 1NW9B 1WG8A 2PLFA 1FPQA 3HNPA 3M49A 1ZNWA 4V1CB 4Z54A 1DDGA 1E9DA 1NOIA 3K1AA 4HB0A 4DDMA 4QUIA 3WB9A 1XG5A 5KNDA 4N41A 2VKQA 3FCSB 1P1JA 3H7IA 2BKVA 2ZRQA 1JE1A 4OJTA 5FI1B 3WK7A 1QS0B 4TSRA 3NEJA 4NCJA 3JQQA 1SULA 4P92A 2QPOA 4RHTA 4RTMA 3A4VA 1YR1A 1TT7A 4FMPA 5JG7A 1JWAB 4Y9SA 2V5UA 5BQOA 1NQWA 4GOND 2Q8NA 2X6RA 1YUBA 2PL3A 4YRJA 2GCOB 2DUUA 1CS0B 3OOCA 1M2OB 4PLFA 3S0JA 2EHDA 2OECA 2ZVQX 3BXEA 1WXGA 1W48A 1ZDMA 2W5UA 2IGTA 1JDNA 3HCBA 3RREA 5DN6D 1SKBA 2C2XA 4B4OA 4BX8A 1EPUA 4DLXA 3JQCA 1IJKA 2H0RA 2OBBA 1ANKA 5IG2A 4L2IA 2WVJA 1P6UA 5AI9A 2VDLB 1UQUA 2P2YA 2JCVA 4XPIB 3MEQA 3WV5A 1M7HA 1DADA 3EXFB 2X0DA 3FZNA 4B4DA 6AT1A 4EHLA 1HEIA 2KPOA 4G65A 2W6QA 4JSTA 1X15A 1T5OA 4OBXA 4W7HA 4DIEA 2VBSA 5IYWA 5EI5A 1D8TA 2CXQA 2YVQA 3HVKA 4LGVA 1NVVR 1UC4B 3HN7A 4XTCS 2G83A 4YBRA 5DSTA 2H1WA 3QXHA 2M5SA 2YVUA 2BEWB 4DUGD 4DR3B 1TU4A 4CVNA 1NB0A 4BNJA 2A9KA 1XKLA 4PBTA 3NDPA 3PUYA 2OCDA 1CW2B 4BO4A 1T6YA 1QGYA 4BVEA 2VF8A 4R8VA 4RPKA 3ZD8A 1G2IA 3KB8A 2R7AA 4HNSA 3WWEA 4RD0A 1ENZA 2B2CA 5CFPA 4MYRA 1J56A 3EVGA 2M32A 5DTEA 4JHLA 3WR5A 1G6HA 4AZTA 1OXBB 1HXHA 1LK7A 2HPZA 4QVIA 4MYDA 2CCJA 3UG7A 1JALA 5CM9C 1D9XA 4MWSA 4OQQA 2QGNA 1AK2A 3F7NA 3IL2A 1L7XA 2QE6A 3BH7A 3VO9A 2ZBVA 2VZ9A 1UBSB 3WIUA 2VP9A 4QPCA 3CR8A 1U2RA 1N5MA 5JV5A 1RWPA 4LI3X 4XVCA 4S05A 3HH8A 1DAHA 4DJ5X 2O4CA 4DCUA 3KKPA 2CJWB 2VPTA 3K96A 3P94A 1R4MB 4C1BA 4XGQA 4QXQA 1P0QA 3PFCA 4I50A 3BL6A 1DC7A 1DBQA 4GO1A 2Q9UA 1BFDA 4G5OA 1H3NA 4YI3A 3TOVA 4R8SA 4B9EA 1HUQA 1L3BA 1KQOA 2PV7A 4O4LA 2W37A 3SE0A 1U0TA 4G5GA 1G9XA 1JQKA 1XHFA 2RGBA 3GGPA 3HN2A 3LHIA 4PZUA 5K0GA 4UUOA 2V8BA 2XUQA 2XNDD 3DS8A 4G23A 4D0GA 3MRXA 1GKUB 5DYWA 1YJ9B 4FDAA 3C14C 3CURA 2DQSA 1FTYA 1W52X 1IRXA 1DHTA 3I92A 1FOEB 2IZ7A 4B82A 1OXSC 1UMDB 2GZ2A 1T0IA 1RYNA 5LNK1 1ONPA 2H51A 1EH5A 2JLCA 1LVHA 1P2FA 3FHJA 1DVRA 4BJ1A 4U7JA 1NQUA 2W2VA 4E14A 3QVMA 2XTJA 3DL0A 1TCCA 2KS6A 3WL6A 1MX5A 3D7KA 2ZBQA 2QA4B 3KPUA 5CK4A 2P2LA 1OAOA 3FBTA 1P2SA 1OZFA 1ZUIA 3FNGA 4AF8A 3CIOA 1NATA 1IAVA 1KQ3A 4W7IA 5KNBD 5TXGA 5KCMA 4D9IA 2X53S 2AWOA 5KYUB 1W47A 4CM8A 3EX7C 3IVAA 2ZAYA 4OF4A 2HJGA 2R5WA 2PN1A 1JHUA 1ZD1A 1VF7A 1PT9A 2HF8A 1TUBA 5ALEA 3WLNA 4EGCB 1IWPB 5JCOA 3VPSA 1JEYA 4IINA 2VPYA 3DDWA 1GR0A 2XHZA 4FFSA 3BIFA 3V7WA 4QYSA 1RTKA 4CF6A 3U3OA 4YMVA 2O2IA 1AQIA 2WTEA 4RXMA 3ZXYA 1RP1A 3LHFA 2QTCA 1TQHA 1SIUA 3DZGA 4TS4A 5I7FA 5A05A 1QVRA 1TQ6A 1U5CA 1G8AA 3NTRA 3PV0A 4UM7A 4YRCA 1KZHA 1P29A 3H2HA 2BHLA 1P0FA 2OGTA 2OZVA 3EVAA 4LXYA 5EXPA 1U7OA 3CZ5A 4ER3A 2AN9A 4G09A 3M0EA 3HV2A 5JU6A 1P5HA 1GQOA 2VH2A 2ZI5A 2JAQA 3I4CA 3Q7TA 4HMPA 3ZK7A 4M8SA 1R9MA 3C16C 4TV8F 4UE2A 5BNFA 4AY3A 2BHSA 2PSFA 4BFWA 3VDQA 3THXA 3RK4A 2VXYA 3OZWA 5JAPA 2Z8ZA 4E33A 3Q15C 1E9AA 4ZYLA 3HFRA 1XEAA 2CKMA 2XLBA 4KR3A 1UBJS 4KNWA 4WKNA 5EXSA 3M6VA 3UV7A 3TL3A 1N5IA 2REQB 1JIVA 4KPGA 4AS2A 4YCMA 2P6RA 3DZDA 1XC7A 1EUDA 4PLPA 1IY8A 4M1YA 1TFUA 3T1TA 1ZA2A 2JRLA 3MT9A 3NO4A 3NV9A 5C1IA 4JI4B 4Q9JA 4U9HS 4G36A 4IJMA 3KWJA 4OHVA 2Q7DA 2I3BA 4MS1A 1F9EA 3A1PA 2BEJA 4P5DA 4E7PA 4ONEA 4RTNA 2WIBA 4HPWA 2XXBA 3M89A 3EZ9A 3GCWA 5IYZF 2YBDA 2GA8A 1IY0A 1NUAA 1LU9A 2ZI4A 1GKYA 3HM9A 1QH0A 2CXXA 4OHUA 4W63A 4ABTA 1OV4A 2FWNA 3EC2A 4C0HA 2FKAA 4FK8A 2B78A 2NYAA 3KJZA 1B0ZA 1EQUA 4GVLA 3TINA 2R8PA 4AXBA 5C9ZA 4Z4ZA 4I3FA 3BMCB 1WAMA 3E53A 2A92A 2ZGVA 1O96B 4E1VA 2UXDB 1RWVA 3H04A 2A5LA 3S5UA 1NA5A 3NNDA 3T99A 4WLEA 1NVFA 4MKXA 5AM2A 1DJPA 1W46A 2GUWA 4AJHA 1RWMA 1ODSA 3KIPA 3DP7A 3IVMA 4BO7A 1WDMA 4RTOA 4IF6A 1KC8D 3RTAA 4EHNA 1S8OA 1G66A 1GRQA 1VHEA 5EQDA 4NI5A 4V03A 1O94C 2YJ5A 3DNFA 1SD1A 3TLEA 3ZDBA 1Y1RA 2HXGA 1SVNA 3NCHA 1E1DA 4R81A 4FC7A 3CH7A 3ISXA 4Z4SA 3OUZA 4Q3KA 2JLXA 721PA 4X7PA 3A3YA 1BCSA 4W1PA 2JK0A 2VDOB 2WIAA 5BUSA 1O87A 4FXUA 4QNMA 4RV4A 4N48A 2GTHA 2VDWA 5CYPA 4MQ6A 1AQYA 3INYA 1FRVA 1N25A 4TV8B 1C0EA 3P9ZA 1OGJA 3EYAA 3E61A 2IHBA 4BNGA 3SHVA 2K6GA 1Z37A 4OHRA 5G0VA 1QQ5A 3JCZA 1MUUA 4LYFA 5DLPA 5DU2A 3L49A 3RFVA 3RUAA 3BE5A 1Z36A 4WJLA 5JAOA 4BGUA 2ZE5A 1ZH2A 4MH0R 2O05A 3UWDA 3HI6A 3C6QA 4PHGA 1GZ4A 1Q7RA 4PNHA 2B6HA 1Z28A 5HFAA 5SV2A 3F47A 3VDNB 1Z5ZA 3ADPA 4A03A 3E58A 4WWVA 1C7ZA 1HGXA 1Z5GA 5TQVA 1J07A 1FMFA 1E4OA 1GNLA 2JIMA 4B6RA 3K8OE 4C6SA 2ZETA 2D5IA 4WXHA 3F71A 1TZCA 2P3QA 4B2LA 2QAGA 3A6HA 3A1UA 1D4FA 2PBRA 2Y1FA 3FPSA 3Q0TA 2CXOA 4LNHA 3ECSA 2Z2XA 3RIHA 3LUFA 1EFTA 4YPOA 3DKVA 3AB8A 2BFWA 4B0PA 1KZ4A 1OTHA 1Z2PX 1IHMA 4X7EA 3OIVA 4IG4A 1JJFA 5DLEA 2X86A 3O84A 4PGHA 4IGEA 3TSOA 3TZKA 3IEVA 2B4RO 3S4YA 1X7WB 2NU8B 4RE6A 3EA5A 3I6MA 4MW0A 3WLIA 4DNTB 2GT1A 1JLMA 3R9WA 1I30A 4FU0A 4OMCA 2C0QA 1BROA 1S2MA 3MOSA 1RC1A 5TS3A 3UOWA 3EXHA 4Q9HA 3VPAA 1U3TA 5K8LA 2JARA 4NE2A 1VYHA 5EVJA 1FVOA 3T53B 1EX9A 1GPNA 1CT9A 3OPXA 4OPOA 3PUXA 4E5PA 3BQJA 2PBFA 4MV0A 3T1VA 2E1RA 2XZPA 3HCEA 1DU4A 3OQVA 4KBGA 5ALTA 5E4JA 2DHQA 3BXZA 2W42A 2GDJA 1E62A 4O2BF 4PHCA 4YREA 3X1XA 1AUVA 4JC4A 4LSMA 4I1OA 4RACA 5CCBA 3CLTC 4IOJA 1CZRA 2GEJA 1BA3A 1HDIA 3WGUA 2FWRA 3NM4A 2ERCA 2ZSBA 3ED1A 5EQJB 2B1RA 3GDFA 4PZCA 3VHQA 1ECFA 1B93A 2QRQA 1DG1G 3I2HA 3RVSA 3T3GA 3NNNA 4X05A 3BMQB 1GO2A 3BICA 3G88A 4RTKA 2C5GA 1SK8A 2SICE 3M8KA 4QVJA 2D62A 1VBFA 3KFLA 2YR0A 4J3NA 3QBJA 4TL8A 4OD0A 3IHWA 2RGNA 3EMVA 2GH1A 4BNHA 2RHMA 4LF9B 4J7CA 2V8OA 4AO7A 2ZRHA 3I2GA 4JIMA 5JZMA 4WCFA 1ECCA 4YC7A 3H6HA 5A62A 1Y89A 3VSBA 1FIUA 4R9SA 2BM1A 3RYHA 1T5IA 5LWHA 4EFKA 1P7CA 2WD7A 4S0ZA 1N9KA 3OOYA 1HDYA 4XWGA 1PN3A 2ZJ4A 5B6PA 3WL3A 3O38A 1BGVA 1U0LA 1U0FA 3NAZA 4EHIA 2BFEA 3ZHCA 3PNSA 1K5HA 1SZCA 1BLIA 4C08A 1W2GA 2PQ6A 2VHCA 1XXHE 1ZK2A 1PT8A 2XBUA 2QEXB 5JQWA 3VDMA 3AIKA 1KRHA 1DXQA 3E3MA 5EOVA 4YB8A 3HFGA 4GOKA 2FMUA 4BFTA 1VZ3A 1NW7A 5B30A 3MCWA 3WIVA 1P75A 3Q3AA 5BNWA 4F9GA 3CR3C 2O8CA 1K68A 2V3VA 4RLQA 2Z6BD 4UTRA 4HGOA 1E2MA 1RLUA 3OQ1A 3DO6A 1OYWA 3UCEA 1THTA 4X1KB 3C74A 4LJ4A 3JPWA 3DM9B 1RWQA 4UCWA 3RHFA 4PSKA 2OEPA 3HMKA 3I8XA 4JZKA 4PE5B 4BQPA 4U4AA 2NV0A 3PHIA 4M9SA 2HSWA 1FRQA 5FFFA 1N9GB 2VHVA 2FZEA 4YUXA 2NYVA 1Z4PX 2ZQZA 5DZSA 3PTAA 3JAMA 1I2AA 4LF7B 1CP3A 5HXAA 4RJJA 1U4NA 4K0KB 3A6PC 2XKBA 4DVJA 1U63A 4X6UA 1LF5A 2Q9BA 1OJLA 3H1BA 2QN3A 1N75A 2INGX 4HDKA 4XKJA 1HOXA 3BD6A 3K6KA 2H06A 1P5ZB 4MS4A 4KGVA 4B3IA 2EEPA 4DJFC 1H3FA 4YT8A 2WSMA 1EJ0A 4UMDA 1J22A 1AA9A 4OXIA 1CY8A 1FFXB 1PJAA 1Q3KA 2ASEA 621PA 4X64B 4A2PA 5BR8B 3M33A 1E3DA 2MMGA 3PD0A 3VH3A 4Z4GA 1QYWA 3OBBA 3N1UA 2BMFA 1WD5A 2JCYA 3CXRA 3D54D 1SPXA 5JAUA 2ILVA 1Q0PA 3A9UA 2AMJA 2H1CA 3BK2A 5EGNA 4B3XA 3EGWA 4PYNA 1K6XA 2F64A 5G1PA 3HACA 2ZBPA 4S3MA 3EB9A 5ISMA 3RVOA 3QIAA 3TK1A 3V42A 3I39X 4TOIA 2XF2A 3UMRA 4F21A 2LKCA 2I54A 3BPSA 2CLSA 1U6IA 4LDNA 5HILA 3C8MA 1NXVA 3SHOA 1M5TA 4GYWA 5C1PA 3S2GA 1C4OA 4E5NA 3M9LA 5J58A 1E1RD 3X1WA 2P0AA 1O6FA 1E3WB 2QTGA 3L06A 1AQLA 4I1YA 4E2YA 4X1YA 5KTYA 5HNKA 3IMFA 3P32A 2JLBA 3SQOA 3ZWNA 1Q3TA 4AMYA 4JLPA 4FFOA 1UFQA 3N2EA 3SSOA 1CUDA 4QAJA 5J35A 1Y1PA 2FWIA 1RJGA 2HSEA 2BRUC 3FWKA 3D2LA 2QMUA 1CJVC 1HNNA 3HKBB 4KXWA 5E8JA 5AVRA 2QJWA 3ZC3A 3DEZA 4L1KA 4UUNA 3KAPA 3GEPA 1DWUA 2JJ2D 1I6LA 3DPUA 2QGZA 3IR7A 5JFGA 2BFBB 3B5EA 1KEUA 1ECPA 2ZTMA 4HUJA 3CPHA 4PCLA 1YT5A 3ONWA 5F4JA 2Y93A 4DPKA 4HIZA 1VQPB 2O2JA 1TMOA 3W9SA 5JPCA 3QX3A 1PL7A 2W98A 2WLSA 4I8XA 3A2MA 3R7BA 1JB9A 2F59A 1UBFA 4JUDX 2A3NA 2XHEA 3HA5A 3LQ6A 3PUIA 3Q7QA 4WBSA 1QG4A 4C4TA 2X4IA 4X07A 1ZUWA 3UPUA 4U00A 1A96A 4ZO9A 1GAQA 1DG9A 1UT8A 2W48A 2AOTA 5JRZA 5LD2B 3EDYA 1MEEA 4KXNA 3NUGA 4NYMR 4QU5A 4ERXA 4OX9B 1HOTA 2Y1EA 1AV7A 2WZQA 5CDUA 2V0GA 3W8DA 3WO1A 5LQKA 4RJLA 1GPMA 3A8KA 1NJFA 2QUIA 1Y7TA 2C0CA 2ZYWX 3P45A 4MULA 3ENWA 1TD9A 1IUKA 2WLTA 5HFNA 3SYRA 1GUBA 4AU1A 2OTLB 1TADA 3ESXA 5TRTA 1Q7BA 2FSGA 5JBNA 2ES4A 3BJRA 3O90A 1V6SA 3QMVA 2BT4A 5EUMA 1C0KA 2KLBA 1NNSA 1DINA 3PE3A 4MV4A 2JGNA 3OPQA 3NP9A 1CEXA 1D6SA 4UXHA 2IU3A 3QVKA 1IU9A 1SN7A 3VR2A 3KQTA 4NY1A 3ISJA 5FUBA 3LVRE 5JXWA 4IHKA 2EKZA 3ZR4B 3W9UA 5HRUA 1M8GA 3NB0A 3OZGA 1QH9A 5E9JA 2QGFA 3QKUA 1GKLA 2XDQA 3NBZC 2ZRDA 4C1NA 3S40A 1CTQA 3TMAA 1M0TA 3DQZA 1RXCA 5CVVA 3E9ZA 2B82A 1H8HA 4L07A 4CM6A 4AS1A 5KINB 1YA4A 3N7TA 3HCDA 1PZXA 1IONA 4B4KA 1LK5A 4L28A 3AVUA 3E7XA 3KT8A 3K70B 5FT9A 3HB1A 3CPWB 2D0IA 4LBWA 1LV7A 3PUVA 2HF9A 4UUQA 3BZWA 3WICA 4BFSA 3OD1A 1NXWA 5TE9A 4H1TA 4QT0A 3M3HA 1WM1A 3AFIA 4P34A 2IOHA 3R3WA 3UEOA 4YR9A 4JLDA 1NYRA 5CFZA 1O97C 3KT6A 1WHTA 4AW9A 3J7AC 5F35A 2ACKA 2FRDA 3HEMA 4PXYA 5TR9A 3I0MA 2WG0A 3FROA 3GLHE 3IGFA 4HWKA 4N5MA 2X8BA 5LB4A 1E98A 2J3IA 4IBOA 3TLXA 1O5OA 4DMCA 4JP3A 5BYAA 5KKNB 1ZESA 3H5WA 4TKVB 2C3YA 3C1OA 4G0NA 4WNYA 4XOTA 3U6BA 4ARCA 1I6MA 2HPAA 1ZCFA 2GO1A 1WZEA 1Y3IA 1IHPA 3DLTA 2XGSA 3O26A 4BECA 3W5DA 3TVYA 5HUJA 1E89A 1I01A 2DBQA 4CQMB 5FTLA 5IKXA 1DMRA 2B0JA 4AJPA 3BCRA 1O0CA 1D0IA 4N03A 3OT1A 4V0OA 5BQ5A 3RVBA 4NHEA 3CONA 5KYXA 4U8GA 1Z0JA 5H83A 4WCVA 3NWBA 3RT9A 4X8OA 4QIHA 5MN5A 4E11A 3FD8A 4Q7QA 4N6NA 5FD8A 3X2FA 4G5QA 3TZCA 3DZKA 4ZZ1A 1EM8A 4E5MA 2JLVA 1U3DA 4TV9F 3QLVC 3GC6A 4QO7A 2F8LA 3LFHA 4EG1A 1FRNA 4NCNA 5AKZA 3NWEA 3UPTA 1XAIA 3IALA 5IX8A 4K8RB 1HG1A 3EVBA 1QJCA 1T10A 3MBOA 2XA1A 3GFQA 3C3WA 5MN6A 4J2TA 3RVQA 4L4XA 4MVXA 4US0R 2YHBA 2ANBA 3ROEA 1WCIB 4JB3A 3O4HA 1X1EA 3SNKA 3HDVA 1TCVA 3GOHA 3ZD9A 1BDBA 4QNNA 1MX9A 3PD7A 1QFXA 2C9BA 3R09A 2NU6A 3T7SA 5M5BA 2Q27A 3LRTA 4RTLA 1C7QA 4XDYA 1E3EA 1GVNB 2I5PO 3KXKA 2V7WA 1JYEA 1P0CA 2A0YA 2YKGA 1JSXA 1Y6RA 3Q5EA 4XR9A 1M2KA 2X7HA 3LX5A 5LQJA 4J49A 1J0EA 1WUTA 4XVHA 2YWHA 4QLBA 5HZGA 1VJ1A 2XMGA 4HAIA 2QR3A 2UUBB 1AZTA 1KS2A 3L02A 5AI6A 3COPA 1QHHB 4B6PA 1GJRA 2X2OA 2IUTA 2UV8A 3JYPA 5BW5A 4LOHA 3SE7A 5DYNA 2ZI3A 1RYZA 2AMFA 2WYHA 1AKUA 4K1LA 5EZYA 4JLUA 3WGIA 4FPXA 3RBVA 4GUAA 4GLBA 1AHHA 1L7AA 3RRXA 1QRRA 1THZA 1NRXA 4DCMA 1C5KA 4JXKA 2B8TA 4RVUA 2PZFA 2ZRCA 1LLQA 4CL3A 1CHDA 2QD1A 3UQZA 1VMDA 2YDXA 4QGFA 3L8DA 4HL6A 4NH4A 3HV0A 3N8IA 3LC2O 5DYIA 1GYPA 4AP9A 4FGKA 1U5BB 4JEUA 5JS2A 2EP8A 3LC1O 3OU7A 3ONEA 5EWJA 2ORED 1X7ZB 3AYZB 1NKSA 1DKQA 2ZXFA 2I8LA 4NFHA 2ZTUA 4B76A 3LCVB 3DC2A 4LCEA 2PHZA 2Y1DA 4ZHQF 3E7WA 4TV9B 4JUBA 5BRNA 4KJZA 1QNLA 4Q5IA 1FLNA 5KWVA 3U7EB 3KZMA 3VHLB 3O75A 4HUQA 1TZ2A 4JT4A 4Z4UA 5AUNB 4RM2A 1D4OA 2RHTA 4NU8X 2GR9A 3HU2A 2IVZA 2D74A 3IERA 4FKZA 3T51B 1NMQA 4DSOA 1RHUA 3CB4A 3LH5A 3AOEC 5AI0A 1QZXA 1XXHB 3JQGA 3G9ZA 4F2GA 4DA4A 5HZAA 2Q5OA 3BT7A 2XOKD 2VYFA 5FUWA 4TQUS 4JLSA 1A71A 4JJ8A 1HK7A 3DFMA 3JR7A 5AH0A 4JL8A 4MPTA 2AG1A 3O94A 4RV9A 4UM8B 3WNCA 1MOZA 4NPAA 1KTVA 1VSTA 2MYNA 1F3LA 2LRHA 2C3PA 4OTZA 2C4UA 4LUCA 2X13A 4DXHA 3A2KA 1L7NA 5AUPB 4PXAA 2B4QA 3HYNA 3SDBA 1L9XA 4N5DA 9GPBA 3UIEA 2ISQA 3LM8A 5FA6A 1GT91 1KZLA 2JI9A 4M9RA 4BV3A 2GXSA 2WQ7A 2V5VA 3I01A 3H1TA 3ILHA 4BKPA 5KQSA 2H18A 2PKQO 2ZRGA 1E1KA 3ZV3A 1DPGA 3QRWA 5JQGF 2BTEA 1NSFA 2OFPA 2PX5A 1PQ4A 1V96A 2C2WA 5AOAA 5KYKA 2FPIA 1EYZA 2YN0A 1OXMA 1I13A 2O07A 3B51X 1SY7A 1TJ3A 4LZLA 4F45A 1R0WA 1XRLA 4AT1A 4RD4A 2MR6A 3UT6A 4W9MC 3RUFA 5K8IA 3MT8A 3PQ3A 2VP4A 1JFLA 1GPBA 1JHQA 1AZWA 3IKTA 2Z57A 3SQMA 4ARUA 3SIRA 1DAOA 2FRVA 2PUHA 1ZM3A 2HJRA 3TTXA 1VKZA 1TA4A 5ENDA 1PQUA 1U0RA 4FGSA 1SUFA 3ZGOA 1V7PC 4II3A 1L4LA 1P2DA 2Y9PB 1R4NA 4MMYB 3I30X 2D2FA 1WVMA 3VGPA 1I7QB 1GGFA 1SXJD 2E9SA 3FR7A 2ZYGA 1VQ9B 5AK4A 1JHAA 1Z0AA 5FUVA 1E7SA 4ARAA 2VK1A 3KL2A 5LIPA 1P2TA 2HA7A 3IEKA 4NYJQ 3W9BA 5CITA 1Y3FE 3G1WA 1ZAKA 1WXQA 4E13A 3SDZA 1Q1EA 1EWRA 4FSXA 3T35A 5CK5A 1WCYA 1SUWA 1CJBA 3WMFA 2JJQA 3G49A 5BN3B 3QYAA 3PR1A 1Q86D 1NN0A 5BOVA 4WX2B 2SHKA 3I4FA 1G8MA 5I51A 2JH3A 1YOBA 2REBA 4GXTA 4OUKX 5ALSA 1LDBA 3HUDA 2HXYA 2Q6TA 3MMZA 4YROA 3IURA 4RJTA 1FMLA 2XSZA 1GDHA 1PK7A 2LIPA 4K9PA 2ZUWA 1Q14A 3ASYA 3KZXA 1COZA 2C1ZA 3D64A 2FWAA 4S1WA 5JFTA 3EGEA 4F2PA 4X60A 2F17A 3OOSA 1Q19A 4WY5A 1T5BA 4UE3S 1MB4A 3I73A 3U17A 3E2MA 2GD0A 3EWSA 1QGUB 5G2OA 1X1QA 1BQ4A 1TTQB 4DMUB 1R16A 2QTFA 2O54A 5DB4A 5DM4A 3IPYA 4MCAA 3KJEA 1GA4A 5IAKA 7AT1A 2ZS8A 3F9IA 1MJHA 4I5IA 5K3DA 4IR7A 5JEDA 3O6VA 2AN3A 2JLQA 3VMMA 2BV3A 3ESYA 1S1MA 3UOGA 4ZHSA 5B36A 1VQ5B 1P17A 2VNHA 3PI7A 4EZIA 5AW4A 1PJ5A 2VXCA 4J7XA 2HT1A 1OSNA 1TW2A 4WN9A 4JT8A 3HS3A 4V0RA 3RRZA 1RM4A 3A14A 1ILEA 3C6MA 1AS2A 1EXNA 2AYZA 3DVAB 4FS8A 1IG3A 2RB5A 3I1JA 4FFPA 3CZAA 4G37A 3ZHTA 4MPPA 2Z4TA 3C3MA 4ZAXA 4WZBE 3EY4A 3RW9A 5DHFA 3S2FA 3SC6A 4Q4CA 3GJQA 1M2FA 1T2EA 3TRDA 3A32A 4Q19A 4A8JC 4CF3A 2X5OA 3DOEA 4PC7A 2X3FA 3E27A 3D8TA 4BJHB 4ZXFA 2QUJA 3AERA 3TKYA 2P1RA 2O2HA 5ADVA 1EGVB 2QW0X 4DNQA 1N5RA 1U3WA 1PBNA 5IBRA 4DQKA 1PAUA 1WKCA 3IIKA 3O93A 5IN4A 1E4EA 1ZK4A 2R1VB 4RFSB 1ZSNA 4R9RA 3R24A 3U0VA 4DV6B 4KO2S 1KE2A 2I4NA 3TJZA 1XCLA 2D0DA 4Q9AA 4ES6A 1XKQA 2RGXA 4KBFA 1UR5A 1UPUA 1WZCA 1W2BB 2DX7A 4M1QA 5LZ7A 1LLFA 4V0SA 2OPHA 2RB4A 5E1OA 1CJCA 4LCJA 4ZJZA 1E5DA 3I5YA 1Z08A 5KTKA 1YJXA 4BB5A 1TC2A 3RV3A 2WU8A 1F2TA 5CXUA 3TMYA 3TNFA 2QY9A 4D98A 1Z4OA 1L6IA 1HPLA 3L6DA 3WK8A 2GARA 1A9RA 1J2UA 1KR2A 2VWQA 3IP6A 3L1VA 2B9VA 1K4KA 2R5FA 3JQ8B 4RW0A 5K3FB 2AFIB 2ZWIA 4URHA 3ZE2B 4JYMA 3I45A 2V98A 4B6GA 1N6IA 5COQA 1SXIA 1PO7A 3SZOA 5C8DA 3BJIC 4KKVA 3CP2A 1OFVA 2FUG1 4I55F 4Q3DA 1ZN7A 1LBHA 1K2VN 1RABA 5TGTA 2VNKA 2VNIA 1R3UA 2JAHA 3KVOA 3OJCA 4RM3A 2PCLA 4KTVE 3FMGA 4D8UA 1EFKA 1R7RA 2QRKA 1N2GA 4S2EA 4ZVNA 2ZUCA 3OW2B 1XR3A 5JT1A 5CB6A 5KS2A 4YEJA 2YL2A 3CLRC 3JQEA 5IRCD 1MO2A 4KI7A 3AI3A 3IO3A 1URPA 1CC1S 3U1VA 2RSLA 3NKVA 2CL6X 3F3KA 4PLHA 5HZMA 2IYRA 1K3TA 1FUEA 2J7KA 4C43A 1T8TA 1U9YA 2AHRA 2BZ1A 5KYVA 5DULA 4KC0A 4PRYA 3CZCA 3VDRA 3ZH9B 5GINE 1D5CA 1KAHA 2QTMA 3LUCA 4M4SA 1XTTA 2B61A 3ETEA 4OJYA 2ECFA 3OZAA 4KVAA 4KPFC 3S8MA 1J1IA 1I2MA 3ZEAA 4EW2A 1N2CE 1RZ3A 4QJBA 5T8KA 3SKVA 2AIRA 4EA6A 2NPFA 3ISVA 5FWAA 4ESOA 2XGMA 5IJAA 3NHRA 2WYIA 2YMMA 4O29A 5ESRA 3R7NA 5CNJA 4N5IX 5C8YB 2CF5A 5ILOA 3HCNA 4RJ2A 1JAZA 4AO6A 2ZTGA 1D1QA 1S2NA 3PXXA 3UGQA 3ZZ1A 3I9LA 4AY2A 2X8WA 3ET4A 1QFZA 3EBLA 3L1IA 3GRKA 3G71B 3HY3A 1KORA 3JQFC 3QXGA 3W3ZB 5DISB 4D74A 2GN1A 3CPXA 2IGBA 2JFNA 4MIOA 4BCDA 4EJSB 4F4JA 5B1HA 1DB3A 1ND6A 1UKBA 3S3TA 1UDXA 5K01A 4AG5A 2X7JA 3GAFA 3V5NA 2E4VA 2O8FA 1JH9A 2ID8A 4ESEA 4G1VA 3E5MA 2FSHA 4UMFA 5IH3A 2NP6A 2VT3A 4YJHB 2C4TA 4OOVA 3SJZA 1UFOA 5J9FA 3WGKA 2AEJA 4GFDA 2ZL5A 5TVGA 1C3OA 1GSAA 5F3WB 4F84A 1DXYA 2XB4A 4EDFA 4KN8A 1IATA 4URUR 5T3YA 4JI7B 1IY1A 5J2UF 1ZJ5A 1SCNE 3TGLA 1Q0LA 2QF7A 3VNAA 6CHYA 4J7UA 3AL2A 1YQ9A 3G2JA 3GLQA 3NV7A 3VZBA 3ZW8A 4MRAA 4CWAA 1OQAA 3LXUX 3ZE0B 3K20A 1OPXA 3ORHA 1G6OA 1IQRA 4GIBA 2V6FA 2Q50A 2A4MA 1PTJC 2VOJA 1RKBA 2CYBA 3EXIA 1ADBA 2C8KA 3JYLA 2CC2A 3IQDB 1QHNA 1RYMA 3CN9A 3NT5A 2LPMA 3FPEA 2OENG 1CZOA 3NDJA 2W71A 1Y3CE 3ANTA 4GEKA 5DGXA 4D82A 4NDAA 1NP6A 2GZHA 3CVUA 2W6CX 3QI2A 1Z4IA 5KWJA 2YZKA 3JZFA 3OTIA 4R6WA 2VJLA 1G5HA 4WY8A 4K8OA 5DKFA 5ESWA 5IZ4A 1ZI8A 1N4AA 4N3BA 1AKVA 2D6FA 4HDNA 3MELA 1WQ1R 3JYNA 3ZHZA 2GPBA 3MWYW 2G9NA 3AUXA 3DTVA 2H9AA 5G53C 2YOGA 4QYIB 2FJUA 1SEVA 1FFDA 4IMRA 2VXOA 3VPXA 4IGAA 3QFCA 1GFSA 1TVMA 1SQGA 2VYVA 4BRUA 1ONOA 3AF5A 1P6QA 1XBTA 4RTSA 5HIAA 2Z6AA 4GKAA 2VTEA 1KZ6A 1NJSA 2WYUA 5AW8A 1G8JA 3FPLA 2XXAA 1V1MB 1V3VA 4J0DA 5EGSA 3ANLA 5I9BA 2JGIA 3V4ZA 4UFOA 1VL8A 1IB6A 3OC0A 1BW9B 1K4YA 3I01M 1GTVA 2YJZA 4RFVA 2QG6A 4WK2B 2H4JA 2Q45A 1MC4A 3GMTA 2BE7A 5C7LO 1FYWA 4Z4RA 4KXLA 3PXGA 4JCOA 1KXJA 1C41A 1U28A 1FXSA 2BFPA 4UAUA 1X0VA 3JD2A 1PD0A 2AG8A 4JZYA 5K0NA 2CEKA 5FOVA 4MTCA 4UMEA 4HSEA 2XVYA 1FQJA 2BEVA 5PGMA 5EY5B 2C78A 3KTOA 5E4FA 3A8TA 1Y42X 3EA4A 4IVRA 3F4KA 3QWFA 5CURA 1QX4A 1MAWA 3C3JA 4RNDB 3G9UA 1HL3A 2W8BB 4UJ3A 5CJPA 4BZQA 2DKNA 5A4DA 5J3OA 2QROA 1NG9A 4UOZA 3A3NA 2OHXA 4JGGA 3V4OA 4RIEA 3L7IA 4YRDA 1BJRE 1P1CA 2I4OA 2WAYA 3RYCA 3PC7A 1MTZA 1OD6A 4FKMA 3RASA 1B0PA 3A4TA 3CRNA 5JC1A 4J0FA 4K9KA 3L7DA 5G4KA 5CHYA 4RCVA 3M5WA 1YJCA 3T7EA 3MMPA 1M1NB 1L7BA 4WNIA 4QG7A 1JSCA 1DRKA 4FBGA 4X8LA 5L46A 2VAXA 4E7OA 1FTGA 4ZAVA 4HAXA 3W4KA 5C8XA 1AX9A 4P3YA 1Q82D 2ZJ7A 2IXBA 1AZLA 2FEWB 3FRHA 3KX2A 1M6NA 3F7OA 2OKCA 3HHPA 1PGQA 4KUEA 4LK2A 4U7TB 2AW5A 1SCJA 2PG3A 1TVKA 1Z2AA 2GD2A 1T36A 2A9QA 1NXQA 1Z13A 3IT0A 2FN9A 4QICA 1INLA 2FZLA 3G8YA 1V3TA 2BI7A 3RS7A 3PPYA 3ABIA 4L5AA 5B1EA 3REOA 2OYNA 3NRBA 3LW7A 3PWTA 2DECA 2WT8A 3LS2A 4TVSA 3J81k 2LXNA 5EIFA 2VDRB 2P7HA 3AEXA 4WBNB 1EK6A 2M98A 4Z9XA 2HNKA 4OL9A 3HKCB 4POOA 1PS8A 1RKVA 2Q2QA 3ICVA 4LC0A 2W90A 1D7OA 1ADYA 2J45A 1XNGA 3FY4A 3IA2A 2YJ4A 1NG1A 3CWZA 3LNCA 5CB4A 2H8GA 2V59A 2XR1A 2NV2B 1N2IA 1AUXA 3KE8A 1H0HA 2QXUA 4HG2A 5FWDA 4Z6KA 4UTOA 3U4CA 3R5HA 5CDFE 4CF7A 2CWWA 3FZQA 2E1PA 2ZXHA 1L5SA 1HDZA 3HVRA 1G8YA 1N9ZA 1WSWA 2O2DA 1WMFA 1D0VA 4DNFA 1XZHA 2Q29A 4CM3A 2NXJA 2ZZEA 1JAYA 1M6VB 2H1SA 4MWEA 4QGAA 1EWTA 2I3DA 5KNBA 3O4IA 1DEAA 2BGIA 4LRSB 4MDYA 1PX0A 2FOLA 5K0SA 4PR0A 4EI9A 2C5AA 1FRZA 2DYKA 1B41A 2G88A 3PNOA 2QP9X 4IFEA 4Q4AA 4NJEA 3L5OA 4FQ8A 5K4AA 4AN1A 3D6MA 2HK9A 1ONSA 3MGAA 2F3RA 4OQYA 3H9NA 2M6LA 4J4TA 4DF3A 3MUOA 3ZE7A 1D2MA 3VZSA 2R4TA 2PGNA 4JOQA 2UUAB 5KAMA 3VR6D 2WHXA 2BN4A 3N3BC 1XKXA 4OA5A 2VA9A 1K5DA 3NBXX 4X9XA 2NTEA 4WZBB 3ZV5A 3DXFA 3KEMA 4N3CA 1KQGA 821PA 1IE3A 3AKDA 4Z8XA 3RAGA 1EFRA 1R4ZA 3OZTA 3RRNA 5JYCA 4BP1A 2E4XA 4YJFB 1EWQA 1HV8A 4J9VA 3RF6A 2ZI9A 3LP5A 5A0VA 5SYNA 2W22A 3BXGA 3EVFA 1G60A 2COEA 3ZY3A 1ODFA 1QPBA 2JFVA 3HXTA 4B75A 3PU6A 3AINA 1GOTA 4Q1DA 1T0PA 3H9UA 1JIJA 5AHKA 2PANA 5KQPA 2HMTA 3EFOA 3OSZA 2XT0A 1Y8RA 2VHZA 3WISA 5LP6B 1GZ7A 1DQPA 1GV1A 1U9CA 5D84A 4ZJUA 4DN6A 4CM9A 4MIKA 1NJ6A 4XX0A 1VCMA 2XLCA 3D8RA 4JR1A 2PUEA 5M3BA 1ZEJA 1XEWY 1E2HA 1NXOA 3B6ZA 4L0MA 4ZFNA 2P6NA 2O7SA 2QVLA 3CWCA 3FX2A 1JHVA 2GN0A 3NYQA 1G1MA 4M8LA 4YJ3F 7YASA 4B80A 5IFLA 3KKQA 4IAOA 3E22B 4PHFA 5JYEA 3H99A 3KJXA 5BWOA 1FTSA 1NGSA 3OFNA 3A6ZA 3TUIC 1U98A 4YAIA 4EY4A 2WU1A 3GRPA 1ZPDA 2XMCA 3PHHA 3QUAA 3ZE6A 3HXKA 4YRGA 2F8SA 1RYHA 3K53A 4US1R 2LCQA 4E22A 3U1BA 1E96A 2WPNA 3U31A 5K99A 3EQ9A 5I8PA 1E2GA 1XNJA 1YHZA 3EVTA 3OKXA 3W1WA 1FXWF 4NBWA 5A9SB 1C2YA 1ZVQA 5EIAA 1QYRA 4ZCLA 3PDIA 5B4UA 4BLPA 4DV2B 1I2CA 4NMLA 4R5MA 1A76A 2EP7A 3WIDA 4MGEA 1E92A 4BKUA 1QO7A 2J31A 4LJSA 5EP3A 4LC9A 4YMWA 1IMJA 3I1IA 1AT1A 3L0IB 4AQ7A 1YVDA 4YAFA 2ZUFA 3B7GA 2BTQB 2L82A 3BRWA 3U2QA 4MVJF 2BFFA 1QC5A 1ZRMA 1M2JA 1VLMA 4PGAA 1TUEA 1O7JA 1ZGHA 1Z8DA 3DR3A 4XQ0A 4CTOA 1W6RA 1RMYA 3OEWA 1OTYA 3EAGA 4JMLA 2QK4A 1E3JA 2OFFA 2HTFA 4WOPA 1O5IA 1KI9A 2XSZD 4F60A 3ASTA 3OJFA 4X97A 4ZI5A 2YY6A 2JIOA 2Q21A 2VK4A 3IB3A 4GQNA 3RK1A 5FHRA 1M34A 4X7FA 1S3SA 1KY4A 3W5CA 1IXSB 1N2CB 3OEEA 2OBNA 1RI1A 1NSTA 1RJ9B 4MJ7A 4OH7A 2BZ0A 1E9BA 1JVBA 3LIIA 4QKQA 1GNPA 1F17A 2FGKA 3GNQA 4M54A 2Q41A 1XNRB 1EUZA 1RAHA 1E7YA 3K5WA 3M6LA 4R8LA 4MGIR 1IN8A 4MGYR 2V7VA 3U1TA 3PF9A 2ACEA 5DHTA 2P91A 4GC5A 3ZCPA 1E2BA 1N8NA 4FJ2A 4L16A 1G38A 4GD3Q 4IDGA 3UHJA 3YASA 5A4IS 1YIOA 1L6RA 2OWDA 2RK3A 4HN2A 3BXPA 2E4YA 1NIJA 2QN9A 1KK1A 4GX1A 2C88A 2UZ3A 4L8JA 1R0CA 2KB0A 2ZRFA 3FDZA 5D3QA 4AKGA 1EVZA 3HFSA 1K7XB 2IYZA 2NSHA 3C1AA 4HBGA 4TUYA 5CB8A 5AK0A 4CZ2A 3LW8A 4YJKA 3BJEA 2G06A 1BEUB 1BWSA 2HMYB 3DFZA 4DQDA 2JBAA 5M29A 4E88A 3DMTC 1I7LA 2OV4A 4KQJA 4CM4B 4QWMA 3MBIA 3V1KA 1J21A 5HOEA 1Y1LA 1ZQ9A 1G3IA 1W9XA 2KI5A 2G5TA 4EI7A 4HUTA 4Z9AA 1E7RA 1PT7A 3SS9X 5E6SB 4C9BA 4L73A 1XYGA 3NOOA 4CKBB 4EYKA 2YINC 1UZNA 4WHMA 4WXYB 3FMOB 3RBZA 4AXXA 5JTUA 3ZD6A 5BPHA 3QW2A 4D92A 3G0OA 2UUPA 1YZGA 4BB9A 2H0AA 2LWIA 1SCUA 3IOEA 5T5QA 2A1UA 2E85A 3ETGA 1JTEA 1N7JA 1VECA 2DFNA 1JKIA 4K26A 5E7QA 3AW8A 3RWOA 4F8EA 3PX3A 1WY5A 3PKZA 3NBFA 5IBQA 4DTIA 4LWPA 1JI3A 5ITZA 2R79A 3L84A 5BWLA 5D01A 3GARA 1W73A 2J4CA 4C87A 4WXMA 3RAFC 3O03A 4HFRA 4X66B 3K0FA 2VP6A 5TQ2A 3QX8A 1Q1AA 3F4LA 4Y6GB 5D3MB 3UMFA 1SC4A 1Y4AE 4XUGB 3NBAA 3ESCA 4NBNA 2R60A 3NM5A 4MRNA 5EXXA 3RU9A 4QT4A 1F4LA 3Q1KA 5F4BA 2N3ZA 2VJAA 2HEIA 4R2HA 4Y9RA 3KHUA 1TQDA 3D4LA 1C0PA 3WS7A 3A3BA 4DNXA 5KDDA 5HM6A 1A9OA 1J8DA 3FAKA 5EHIA 5FL3A 3V80A 2AMLA 2QUAA 4DG9A 1E94E 4NDZA 1YD7A 3UV3A 3PZBA 3VA7A 1AB6A 1UXOA 1CUAA 1KS9A 2VLBA 5LD2C 4UVDA 3ETNA 5FYDA 3ZU4A 4ZOQI 1AB5A 4ASUD 4ZDWA 1TL7C 3N2GA 1GY8A 2H11A 2IDMA 3ITEA 4UATA 5KU1A 2OLKA 3DB2A 1L1QA 3F1KA 2OBRA 3GN2A 3I05A 5JWOA 1GPUA 4QA9A 4YRKA 5F4OA 1XHEA 5ALQA 4RPHA 2QN6A 2FH5B 2WHPA 4FFLA 3AT1A 3BIJA 3OA2A 1NDQA 3OLQA 2BUBA 1JR3E 3MF4A 4BWVA 5I3ZA 2K7FA 1OH7A 5K3AA 3K32A 4XTRA 2DF8A 1R8XA 3C48A 1RQPA 1HETA 2WJ4A 3G6WA 4ZVOA 3QHPA 2X40A 4R84A 3AEUA 4JK3A 4HT3B 1XROA 2IH2A 4IVQA 3TOXA 1B8OA 5CGZA 3UUEA 4KV9A 3EUWA 2J3EA 5I8WA 4LRXA 2C2GA 2W2KA 1NQOA 4OSOA 4P32A 3ZWWA 2A9PA 4DZZA 3CF0A 1KK2A 3N2YA 3M1YA 3PQCA 1KOFA 4Q00A 4XIJA 4AVYA 1FJXA 1WWKA 3M9XA 3NH9A 1EJBA 4UUAA 3RVLA 3TCXB 4DQXA 1TEZA 3IVGA 3ILXA 1UMBB 3L3BA 3AIIA 1DTSA 3AOGA 4OHXA 1DQYA 4TTSA 1RHMA 2DOGA 3N70A 4BGEA 1G5IA 4B79A 4BKRA 4MS3A 4U02A 2V55B 2MCFA 3K70C 2ZYDA 3S81A 1WDWB 5ELMA 4DQVA 1Z8HA 4KUGA 3IV9A 3ENQA 2WNHA 3QY0A 2BKUA 3V33A 3VJLA 1DC4A 2NO5A 1RLMA 4ISCA 2QRUA 2G71A 3PTZA 3DZJA 5F7XA 3K09C 3OP4A 4JI3B 4QLAA 2Y1KA 7GPBA 2WABA 1V8FA 3X44A 3A1NA 1MX1A 4AYTA 2W6JA 2WA1A 4JJFA 4ZI7A 4GPAA 1NV8A 4WZLA 4C6RA 5CD9A 3JQAB 2HREA 3C15C 3R41A 4WOJA 1QHIA 3B7PA 2P9TA 3O2JA 1V9SA 5F5XA 4BV2A 4Z5XA 2IU6A 3OFVA 1GTZA 2GPNA 2ZT7A 4MARA 4Y3UA 4ZREA 3SMQA 1X19A 4H4CA 3TRJA 3RR2A 3UY4A 2W0SA 1KJNA 1I3CA 1RXEA 1TEVA 3ANSA 3O9MA 3GJYA 1T5SA 4KSCA 3D6NB 3MLEA 4LXQA 1J24A 2G6BA 2ONKA 3T1NA 2ZXIA 1XP5A 1TJNA 3AHDA 5CT4A 3RSQA 1YFLA 3Q88A 1CR1A 2O3SA 1N5LA 4LHXA 3E35A 3AFMA 1TM5E 4OMFG 2OXFA 1HKHA 1P4MA 4TXJA 2WM8A 4EIWA 1NBOA 2NG1A 2IH5A 5KJFA 3FWNA 4CIXA 3Q9NA 4KQ1A 5KSZA 1BDIA 1A1SA 3STUA 3TQRA 5TIIA 4I4TF 5B2ZA 4I14A 4EY8A 1IEQA 3G2NA 1CQZA 3GVHA 3EW7A 3QU9A 4ZOAA 5IYZA 1D2GA 1WRBA 2B94A 1X80A 3ROTA 4WAUA 4I3HA 5KTRA 1LZLA 3QPAA 5F3DA 1JYSA 1Q1QA 4QDKA 3LQKA 1GA6A 1IBCA 2BJWA 1ETHA 3FSEA 3BORA 1PQWA 5JR3A 4OATA 1M73E 1RC8A 1U3UA 2IEYA 3LRXA 3S2IA 4DIOA 2K2QB 4PPNA 2HA6A 1Q7YD 1BSVA 1TUGA 3FCUB 1XQ1A 4F5WA 4IFTA 2BHNA 2GJ9A 1Q7EA 1LA2A 2H2HA 2QORA 2NLOA 3QVLA 3H2GA 1N57A 3LK6A 3R8XA 2XB2A 4DW8A 4K9NA 4FW9A 4ZT6A 2J87A 1LI4A 4KOEC 4HQFA 5HWSA 1YRWA 3UG6A 4XCVA 2QMEA 4B7AA 3O8DA 2I3ZA 2LW7A 5AJHA 1T5TA 2H8KA 1Z35A 3A1WA 3OLVA 1RWOA 2GSWA 2Z9CA 2XWQA 3TEMA 3U4QB 3HCPA 3P9SA 4IH4A 1W49A 5F5NA 1D7AA 4B1FA 1XQWA 4H4EA 4CLEA 1SKQA 1HLPA 1KZYC 3Q3HA 1U3GA 5H16A 3Q3VA 4DNOA 3JASA 3TL6A 1QLWA 1DKLA 1LNQA 5C1BA 2G1UA 3P0IA 1H1LB 1Z0UA 1QDEA 1GXSA 5HCNA 4ZXPA 5GJBA 5JO0A 2F8MA 5JD4A 2WG2A 3KOOA 5DX8A 2CLIB 2EATA 4XDGA 4DQUA 2P77A 4PO3X 2SKEA 4PLCA 1TZJA 4GLLA 4LNUA 2ZB7A 4ITVA 4GMDA 1QGZA 4FEGA 2CVPA 1YIAA 4BU1A 1BGXT 3A6JA 2P3LA 3DLPX 5CFOA 5I7OA 3UAYA 3ONVA 1NHWA 3FYDA 1YJBA 1T1RA 5JADA 3DBLB 2Q3EA 1K89A 1RW4A 1JV2B 2GVNA 2J0EA 4B09A 1UBRS 2UVQA 4RKQA 4IWYA 1QVZA 1RE0A 3UMSA 1DUIA 2TMGA 3ZVMA 4C01A 5BRAA 2O8BB 2PRKA 2NZVG 2WF8A 3PXAA 1YITB 2VT6A 4ZOEA 4EA9A 5BO5A 1HNZB 1XZGA 3GJ4A 3RJTA 2TYSB 4Y2JA 5AVWA 4JEIA 3VR6H 3WNVA 5JISA 4MKRA 5ECYA 2GZSA 3VNRA 2IP1A 3G05A 3NR2A 4MX8A 1EE1A 1OT5A 5IDQA 5JZVA 2G7ZA 5J1SB 2CSXA 2GF9A 5C31A 4HXFB 2VQFB 1HLDA 2QRVA 4CF4A 3OEHA 5AN9A 1LQ2A 3DCIA 2C77A 5TMBA 5ELLA 1RBQA 4PYLA 3AJEA 2EBWA 5JHHB 1T4BA 1RXVA 2A0XA 5HXBA 3ULKA 3VH4A 4AJ4A 1DI0A 1UPFA 1HQCA 1HEYA 4RZ3A 4C78A 4URXR 2VRNA 1Z7GA 5BSHA 4DIFA 1EUYA 1N8RD 4F0JA 4CKWB 3D3NA 3EXG2 4JYZA 2EG5A 2G82A 1ZXLA 4V0QA 1GGKA 5C34B 3Q8LA 5IC4A 2VWGA 1LNSA 2AEMA 3IQEA 3PR3A 2P90A 2W58A 4WNAB 5L7WA 1E0AA 2WTXA 3CZPA 1G5RA 1G5PA 2YHUA 1PZHA 3FCYA 2QHXA 4G1FA 1QLJA 2ZWOA 1UM9B 4D9FA 4PG8A 4F7DA 4B3SB 4OAQA 1VLZA 5KYWB 5FKJA 4ZYWA 4BQSA 4HGRA 1XVLA 1SOVA 2AG6A 5NULA 1Q0QA 1W30A 5C53B 1BWQA 3BSFA 4URVR 1UOOA 1F2UA 2NO6A 3ZKWA 3JZAA 5IKOA 4CKEA 4M60A 3FBGA 1MENA 3A8IA 2NNLD 2IP4A 3MJCA 3R6KA 1VIAA 2Q8QA 1T2FA 2FMIA 1L5NA 4YRZA 4ITRC 1UWLA 1ONNA 4M55A 1CJMA 1JPUA 2D3WA 2YXDA 5I9LA 1K75A 1XPOA 3RYFB 3BHIA 3DTNA 1UF9A 1E61A 3R5KA 2Q3BA 4Q66C 4QXPA 2BFDB 3PEYA 1EFRD 2VYCA 3GVCA 4KH1A 4DS3A 4EMUA 1OBFO 1TCBA 3FUWA 1VQNB 1JDUA 3LBHA 4LN1A 4X7BA 3TWOA 1VJSA 1GGMA 4EJ6A 3VXKA 2BGLA 3A1SA 1I1QB 4MCIA 1RYBA 2E3JA 2HWUA 1C9KA 1XALA 2RK4A 5U9CA 1H2XA 3AUUA 4RTJA 3PX7A 4M0LA 4XIGS 5LOVA 1VHOA 1LX6A 3LUKA 1BA2A 3CNNA 2YHSA 5EEHA 3PUMA 1Q44A 4HVCA 2OB2A 2XKJE 2AN4A 5AOCA 2YUIA 1CY4A 2XZOA 1GEEA 3CISA 2GXUA 2F43B 3E2IA 4WOKA 4C76A 4YUAA 1H65A 3AONB 4L8GA 1KDRA 4KPUB 4K6FA 4PPYA 4YP6A 3R76A 3RAJA 3KTAA 3VR5A 5AVXA 4CN8A 3RJ9A 4LJRA 1LDNA 4LBYA 4OSEA 5CDHA 4ER0A 1ZMOA 2C5SA 3KYDA 3OFND 2QMZA 4FN4A 4IHJA 4X6YA 2ZREA 4IZ6A 5CXXA 1KJZA 3WQSB 2M6RA 4PINA 3BFVA 1U2EA 1NUUA 1R0ZA 3BHNA 4DQLA 1NP7A 1Q17A 2QW1A 3PJEA 2F3PA 5K0ZA 3HFJA 3HP4A 5DBEX 1XPJA 1FDRA 4F5EA 1UXHA 2YXPX 3USZA 5CHEA 3OE7A 3FFAA 4EL5A 2OG1A 3HCAA 3NUZA 2RDMA 4WLFA 5F2NA 1ZFNA 5I4BA 2IEZA 1ORHA 3UJHA 1GUDA 4CLOA 4OJNA 2BISA 4K2AA 3ORQA 1K9MD 4WL0A 3I2YX 3HVJA 4KIGA 2G25A 2QX6A 3BRWD 3Q4GA 4M0PA 1DJMA 5H9VA 2HWYA 2DPYA 2GCEA 4JVNA 4C4RA 4IIGA 1RADA 2LVBA 3WXBA 1AE1A 4TSFA 1E5VA 1WPGA 3DOHA 3HYTA 3KDAA 4OMDA 3U62A 3BEOA 4EEKA 4S1OA 4X71A 5B55A 4GYKA 3UJNA 2E4ZA 5JD3A 2NZ2A 1KPIA 1RWNA 2Q1YA 1JR4A 3LQ2A 1YB6A 3II6X 4DLTA 4EYEA 5BORA 1KIAA 2B30A 2WVHA 3CVOA 4CQJA 1JA9A 5E6RB 4EITA 4GQAA 3DQPA 2AQHA 1O89A 1XZEA 2EJBA 2J5QA 2VPIA 4UHEA 1LS1A 3H42B 3A1VA 3ZYCA 4KR6A 3G9XA 1ZAYA 3CG0A 2VPPA 2P62A 2HHHB 2PU5A 4UTZA 4MCJA 1HEUA 3V4FA 1JG1A 3CFYA 2BDEA 1NOJA 2YRFA 4PGGA 4RPCA 3SC4A 1OA1A 3K9QO 5JS7A 1I5RA 1M2EA 3HJAA 3MS2A 4MW7A 2ZBDA 4BVJA 2CE2X 4BVLA 5FDFA 3HRKA 1PR0A 5FLEX 5EYPB 5TF0A 2OXTA 5J4YA 5CA1B 4MGHA 2JGDB 4EKYA 3K71B 1AUQA 3GFBA 3RC3A 1J5PA 16PKA 1T5HX 1VCHA 2EZ4A 3UUGA 1YVPA 2VPXA 2A94A 5COBA 4UHHA 4RETA 2MSEB 3GUVA 3JD3A 3L93A 5I45A 2OFXA 4EJ0A 2DIEA 2F7SA 2CFRA 2FN3A 4GYYA 5CGQB 4F85A 4RGQA 3I6QA 1J25A 3PC8C 4M7RA 2LP4Y 4IUBS 2M6SA 4CMEC 1A9SA 4QOFA 2ET6A 1ZK0A 3MD9A 5KNCA 3AB7A 3VU8A 2X6YA 4MI9A 3GLIA 1QX3A 4UDNA 3ZDYB 2DXIA 4KQ9A 3MIZA 4NBLA 4NFLA 3RG2A 3VUEA 3OSUA 3NX4A 4G4SO 4ILEA 3IRVA 2JHAA 4OQXA 2E4WA 6ABPA 3SZMA 3CXUA 3T3EA 3H86A 2FR8C 3IEXA 1TYZA 2V03A 5KZMB 5AQ1A 2CXSA 3U4DA 1US8A 5K8JB 2WYVA 4R2XA 2BGMA 2JIBA 4HDCA 1P0MA 1IXZA 1JDBB 1YHNA 1BXRB 2Y68A 5FULA 3DMDA 1BE1A 2Z1DA 3BE8A 5B7PA 3D59A 2WFZA 4Q82A 3DE1X 4UM9D 4BXOA 4NZ9A 4JASB 3KR2A 4IIJA 3QUQA 5K0JA 1GL6A 1HSZA 2A14A 4EUHA 3OPVA 5DM1A 1A8QA 4WZTA 1S8AA 1T2NA 1YQWA 2OQIA 3L8CA 3Q1LA 2FQWA 4HXEB 5DOZA 4LTMA 3SQLA 5IASA 1A4UA 3QU7A 3TJRA 3NWJA 3ZHSA 4EJSC 3IQWA 3COYA 4OOFA 4HDQB 5CP8A 3U39A 1B76A 1V7CA 2P69A 5B1DA 1YZKA 4DANA 4FT4A 5C8VA 4CI9A 1NMZA 1QQ7A 1D1TA 1KDVA 4BX9A 4EDHA 3UICA 4BDSA 4F4UA 1QGAA 3EE6A 3I9KA 4HHEA 5EZQA 2HDNB 3UXYA 1D03A 1W7AA 2A1TS 3RABA 4WPGA 4IH1A 2O5RA 1M1YA 4PC2A 3WLTA 3AHIA 3AL3A 4QV2A 4LQLA 2PT5A 5AI4A 3GL9A 4N9WA 4NOKA 4DDTA 3N8GA 2H5LA 1GKIA 2C4VA 3HVUA 1W36B 3F67A 1PJQA 3C8DA 1NXXA 1PJTA 3TW8B 3NORA 2ID4A 4RA6B 1IJEA 1KOGA 1PX2A 1XYVA 2V96A 4YRLA 4HNUA 5B53A 5AKEA 3E81A 4R51A 1C30A 4Q21A 2MSCB 3B5JA 4WADA 2GAFA 2ODEA 1ULHA 5JVDF 1RPJA 1YDFA 1VXRA 1X1DA 1AG9A 5KDOA 1O8CA 1QKJA 3CNOA 2XUHA 1KEPA 2B36A 3RH0A 4QVGA 2PD3A 4UBMA 4D79A 4DCVA 4EAAA 3JVIA 4MV9A 5KX5B 2PA3A 5AJXA 3GLFE 1V26A 3ROGA 3LXXA 4YV0A 3CO0S 1J39A 3DAGA 5I48A 5DCUA 1F1BA 3KCQA 2XVAA 2Q2VA 3WWCA 4D9HA 5ERXA 2RIRA 2BMDA 3I83A 3VC7A 2NZWA 3Q7IA 1ND5A 2GB4A 1FU4A 3A04A 3F0TA 3OZBA 5JSZA 2O7RA 6LDHA 5IMSA 3R5JA 4R2MA 2X76A 1YZUA 2XODA 4IX1A 1R6VA 4X7MA 5L3QA 2PS9A 3JSXA 4RS4A 2W6JD 4OP3A 1WUYA 5P8WA 1PJ7A 2YWFA 3SYTA 4DDVA 2Y99A 2P9HA 2X77A 3G23A 4NXNB 1ZD9A 1QH1A 3IEUA 3NHJA 2QZZA 1H9AA 3FKSA 1JJBA 3DHYA 1YJ8A 3M70A 5FPSA 1EFVA 2IWHA 3TLKA 1VQ1A 1MB3A 4I0WB 2OZPA 1Z47A 5DSXA 3U44B 2QMQA 1WV0A 1J06A 4NZPA 3CLSC 4N3AA 4TVBA 2DR3A 3G5AA 4CBVA 1NJID 4EVQA 2B4KA 2EYUA 3ZLTA 4MROA 2X1LA 5JI3E 1XZ8A 4WI1A 3VZQA 5GZ1A 1XZIA 2PWYA 3OKCA 3WQHA 2BP7A 1A97A 1ZI9A 3SOZA 3RIGA 3EFHA 3ZE8A 4KO3S 4OV6B 3THOA 2RG7A 5EG5A 1OIVA 1E8MA 1ZD8A 3WRWA 1V41E 4RMJA 3OHPA 2G09A 2VZ8A 1ZGAA 5LA6F 1K5PA 2DZDA 4R1PA 3FFXA 4QTZA 2L0XA 1VIMA 1XWFA 2JFXA 4BJ6A 3N5KA 5EXDA 2VUSA 2RHJA 2BOVA 3QKWA 2E6UX 4P7KA 4GPEA 2D9RA 2F1HA 4MO9A 5BVHB 4ZIRA 5CIYA 1DDOA 3AH8A 3N2KB 4BE4A 1MHTA 4AC9A 3QNMA 4PIMA 2X8AA 5EIBD 1B3RA 1XI2A 3Q7SA 4ARBA 2HM7A 2QYSA 4ADSG 2B0CA 2C3MA 3ABRB 3NTOA 1IN1A 2HK7A 3K31A 3EJWA 1UEIA 4J90A 4W5HA 2X6TA 4KDRA 4A6EA 5K45A 5T3UA 2IXAA 4ZHQA 3B8HA 1OXXK 4XFJA 2QB5A 1A2QA 1L8LA 3MJ4A 3PDHA 4HEJA 4C6TA 3PFBA 4U6NA 5IYRA 2IPLA 4LYGA 2EGGA 2A9RA 1DOHA 3ASVA 3LA6A 4EPYA 1MZVA 2VJMA 3I42A 3S5JA 2I62A 4NKRA 4KFTA 4QOEA 1VG1A 4DY6A 5CA0F 1EESA 1PTKA 2O8BA 2VT2A 3Q7EA 3GAAA 3TI7A 1L5HB 1NOKA 1UD2A 2VDKB 5JJKA 3LF1A 2ECOA 1J1ZA 1KFEB 4BEVA 3DWGA 4DEYA 2GK3A 3A3OA 1BDJA 2O9JA 3IP3A 1XLUA 4ZGNB 3AETA 2NV4A 1KJJA 3BK1A 4GSKA 2PKQP 2G76A 4KVFA 4Q7LA 1DCFA 2QYTA 3O8NA 4LHZA 1IPEA 3SJUA 1RC0A 1FYXA 1P19A 1Q7CA 4U0KA 1NR7A 1GQFA 1I80A 1LBIA 1XX6A 2NOAA 3O3NB 2QDKA 1GPJA 1LBQA 1U5AA 2QL6A 3FSRA 3K72B 5DLYA 3CS3A 5FOWA 4JAVC 5UKDA 1QYIA 2E49A 3DT8A 4E1AA 1SJ9A 1SQFA 2DUNA 1Z6YA 4PZ9A 4HDSA 3HDHA 4OBWA 2NXNA 4M88A 2W6ZA 3FWHA 1D6JA 2NP7A 4O3FA 4XD7A 1IL0A 1ZKDA 2A4KA 2BGUA 4GWLA 2SCUA 1BXZA 1XU7A 3EAFA 1Z2OX 2BEUA 3D0OA 3THWB 5J5AA 4HEA6 1OYOA 2PX3A 4JA2A 2MU1A 4ER7A 1MW8X 4AWXA 3ND6A 4CFZA 2CFCA 1SOWA 4EQ6B 1O94A 2AVNA 3QBDA 1H6CA 4BYGA 1GGJA 3AHEA 2VIIA 3WA7A 1CUJA 1KMQA 3ZHXA 3WYDA 4HNTA 1J20A 2ZKLA 3EWIA 4QBTA 3UFXA 2R1TA 4MQLA 4NPCA 2XRZA 3WK4A 3OPNA 1CJSA 5CM8B 3SLRA 3AY3A 4IFBA 4K2HA 4FJ1A 3V3KA 3OF5A 1YXMA 4NWIA 5AVVA 2JLSA 1HLFA 2UYOA 3LT4A 4AP6A 4FFNA 5TQ0A 1ID1A 2GK6A 2A33A 2CUZA 4HQLA 3OEHD 3R5SA 4DREA 4OJMX 2NIPA 1WKBA 2NZYA 1TE2A 2Y0DA 3FPJA 2OTJB 3E9NA 4IPTA 1QVAA 5A71A 2Z3WA 4GP9A 4WESA 4WRRA 4YDRA 5EMKA 4CL0A 4DDHA 4EECA 2WQZA 2XD9A 4R6XA 4QUBA 4EUSA 4XQCA 2PJUA 3BKWA 3M2PA 1BRTA 2WICA 2YMLA 3S1AA 5IW8A 4PHHA 4Z1MA 4IILA 4GE0A 3OQBA 2H7XA 2JJ1A 3WADA 5ITSA 4G8CA 2BLNA 3JWIA 1JVNA 1KHTA 5LP6C 4MVJP 3BFJA 5DXJA 4DV3B 1GQRA 3WJAA 1N1GA 1V37A 3KYCA 2OLEA 3JWGA 4I19A 1RR6A 3JATB 5G40A 4OXYA 4ITUA 4IWNA 1R66A 1CF9A 2IIVA 1YDMA 3ZY6A 2HJ9A 4DJAA 2XB9A 4OXXA 3K7EA 1AIPA 3KL4A 4U7PB 2QE7A 2ZL7A 1CETA 4IDBA 3RV4A 3FB4A 3LQEA 4ZK2A 5D6NA 3AHCA 4L27A 1J0BA 4LQDA 4DZTA 1GL3A 2W6IA 2JFZA 3INNA 3IP9A 2HDWA 2HYIC 3R9IA 1K9SA 4G85A 4YYZA 1BG6A 2Y6UA 3HKDA 1QXSA 2JI4A 3R3SA 4E3ZA 4GRDA 3VAYA 2X4GA 4KREA 5A6SB 2X3YA 2GAJA 1ZQ1A 5LMCA 3U61B 5LIRA 1F4VA 1C80A 4UZEA 4WOBA 4YMSA 4F4HA 3RT1A 1LKZA 3FTCA 2P3MA 3NYIA 4MW5A 1Q7TA 4RVHA 3MZ0A 4ALMA 3O2NA 4A5SA 3I04A 4UTNA 4LGMA 2N75A 1ZJJA 1EVIA 5CJJA 3WWYA 1KYZA 2ZZQA 4IMIB 4UBJA 3UAZA 4RPLA 4LK3A 4BRZA 2VH5R 4KK4A 1GRCA 2EKBA 4BWFB 3CIFA 1P7ZA 1VG9B 5TPZD 2NNWB 4G84A 2JW5A 3OURA 5IXYA 3DHWC 1X1AA 3ZWBA 2PT9A 2VSOA 4L3VA 3T5BA 1FTQA 1Y7LA 2QRMA 3ILYA 4DWVA 1CQJA 2GGSA 4PS1A 2AR9A 2B1JA 3UWMA 1ZIPA 1K2WA 1V16B 2G70A 2P27A 1SVSA 1V45E 3CT6A 2GCGA 4FE4A 3V1NA 3VR5D 3LA8A 3SBOA 4JQYA 5JFOA 3M5PA 5IP5A 1TYAE 4PYKA 3L92A 4YUZA 2ERYA 3MJFA 1GPYA 2YXLA 1SAYA 2WJWA 3DBHB 1XTIA 4KQEA 4A0FA 4RVFA 5M04A 2X22A 1RPZA 1SXQA 2D06A 4CDRA 1DZ3A 4GOLD 5C5IA 4Y0NA 4ENSA 4POAA 1TM4E 5E9WA 5ALZA 1OYVA 3KBBA 2QU7A 5LYJA 2BCGY 2RAFA 4XKVA 1UBUS 5ADHA 5IJ9A 5KMGA 3ZPNA 1MABA 1ISGA 1MNQA 3HUFA 3SLKA 2QLBA 3T5MA 1U2TA 4O4JB 3UYKA 3ZGXA 3TF5A 1A5BB 1NW5A 3BXOA 1Y37A 4U8HA 1Z2EA 2PGIA 4MUGA 4BX3A 4CG0A 4BEBA 1KFBB 1VPTA 3A36A 2I7DA 3M82A 3ECCA 1H0RA 4I55A 3Q8KA 5FR2A 3MFYA 4ILKA 3QU2A 4AJ2A 1J97A 1NKTA 3OO1A 2NO0A 3KFVA 3LU1A 4DCOA 4LYJA 1IB0A 5BSUA 3K1ZA 1IBSA 2GRUA 3FNBA 1H5UA 3ODPA 5FPYA 1UK9A 1JLLB 2HRBA 1XZCA 3HDGA 3CCSB 1ECJA 2NZUG 1ZM4A 3GJ0A 3IAS6 3H94A 2ZBRA 3PCRB 3PHBE 4FIZA 4LC1A 4XQEA 5A3QA 2I80A 4JLKA 5KKCA 1XKTA 3EXEA 4MSUA 3U19A 3EH2A 3IT2A 1KK0A 3HJBA 1M2VA 1Z62A 3KVYA 1VI2A 3MERA 5BUZA 3PA2A 5EPUA 4V0ME 4KAXA 4ZC8A 3ZDRA 5TPWA 3GCGA 4E5YA 3OIFA 4NABA 2EQBA 2FHPA 4M1SA 4ER5A 3K8YA 3AI2A 2I99A 3HADA 3IAAA 5I7VA 4B6QA 1CWUA 4NV3A 2ZTHA 2EQAA 2ZIFA 5ECDA 4P4SA 2DT5A 2AWNA 2DPXA 1SBHA 2G4LA 2ZSJA 3CYFA 4HJRA 5SZIA 1Q91A 2YIDA 3S2ZA 1EGMB 4RCYA 4QDTA 3VHXB 5CLJA 2Z6QA 3S29A 3DLHA 1MZPA 3U7QA 2FLKA 4QZVA 4FYKA 2O0LA 4ZPXA 4DM4A 1QGOA 4IMJB 4IDPA 1ELOA 4EYOA 3OAAD 4W5QA 5L4SA 1SM4A 1T8SA 2VBIA 3FFTA 1WOMA 5A03A 3AZQA 4XUDA 1MGPA 5LZ4A 2WK1A 4MUNA 1MF7A 4L5JA 4W6ZA 1VL0A 4JA0A 2OXCA 2NUAA 3CRVA 3MTAA 1RPTA 3D7LA 3P2EA 4WZAE 2OCKA 2BRUA 2ZWAA 1AOXA 4M0MA 1VQ6B 3IV6A 4TLMB 4E5KA 1EUCA 3MWGA 1OFUA 1KVTA 4EGJA 5TB5A 3ITKA 5DBIA 4C03A 3OZRA 2OT3B 2B37A 1VBNA 1F5NA 4MQBA 1YRLA 1S2IA 2DETA 2YJTD 1R64A 1LZKA 1N2JA 3GD7A 3IAXA 3LDHA 5DWDA 3RFTA 4DA0A 4EA8A 2MSLA 3QVUA 4K46A 4P36A 3UHOA 3BE4A 4RK0A 4CMIA 3HZHA 3F6PA 2DTDA 5LZ2A 3U7JA 1NSYA 3D02A 1XJQA 1EIZA 4UNQA 7REQB 4TZ6A 5ER6A 3LBYA 2J32A 4M7WA 4MVCA 5AHRA 1Z6TA 2H85A 4QELA 3SG0A 2DR2A 521PA 2DFTA 1Z0FA 2OBXA 3Q72A 1Y8QB 2ZI6A 1F7UA 2AOUA 2VZ0A 2AVDA 3ICQB 3PYLA 1PDWA 2Q7XA 2YWDA 4NVRA 4FKBA 4TSKA 4V3BA 5LDHA 1DTWB 4H9GA 1F3OA 4HZGA 3LBNA 1CF2O 1PVVA 4KXUA 3T7JA 2O8EB 5KOHA 5J2TA 4MR9B 1DAKA 2KMLA 3OWOA 3HB0A 4XB6B 4G0UA 1IAQA 1D2NA 4M0KA 1GEGA 1PR9A 1SG9A 3QI7A 4Z9BA 3WRXA 4B32A 1FMCA 4BQRA 1TX4B 1KDZA 3CVYA 1LPOA 3HY4A 5TMPA 2AGVA 2JFHA 3RQSA 3MWKA 4CNBA 1LWOA 3R6GA 1GTL1 3FPBA 1GM5A 2G4VA 1MB2A 2BMJA 3DDZX 4C7KA 4BGIA 2J0UA 1R10A 4M6WA 1A77A 2VP3A 1N2BA 2OBFA 1R1DA 1USVA 3PPVA 4UBKA 3T5AA 1CUIA 4EENA 1WBDA 5EJMA 2NQ8A 4U7WA 3OF3A 1T4CB 3DEAA 4EZBA 2HCTA