1A8PA

Ferredoxin reductase from azotobacter vinelandii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
257
structure length
257
Chain Sequence
SNLNVERVLSVHHWNDTLFSFKTTRNPSLRFENGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVQNGPLTSRLQHLKEGDELMVSRKPTGTLVTSDLLPGKHLYMLSTGTGLAPFMSLIQDPEVYERFEKVVLIHGVRQVNELAYQQFITEHLPQSEYFGEAVKEKLIYYPTVTRESFHNQGRLTDLMRSGKLFEDIGLPPINPQDDRAMICGSPSMLDESCEVLDGFGLKISPRMGEPGDYLIERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of NADPH:ferredoxin reductase from Azotobacter vinelandii.
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords NADPH\:FERREDOXIN OXIDOREDUCTASE
total genus 76
structure length 257
sequence length 257
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1a8pA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1a8pA02
4WQMA 1W2BB 4C0SA 2BM1A 1IB0A 2VZLA 3CXCB 2DEUA 2ZITA 4Y7CA 4YAWA 1YJWB 2QTZA 1TVCA 2VYQA 4QHYA 1AIPA 3MMPA 4HE5A 3VO2A 3WYAA 4DQLA 1OGJA 3B82A 3AVUA 1VQOB 4FWTA 3LVBA 4YALA 1G7TA 3W5UA 3E20A 1W35A 3JQQA 3AVYA 1Q7YD 1UMKA 3W5VA 4NBSA 1FDRA 3MHPA 4PGOA 2PIAA 3QFSA 4LBZA 1I7PA 1J9ZA 4NCNA 3G4SB 1JJ2B 5KSWB 1FNMA 4P3YA 1D1NA 3AVWA 2FX3A 1QH0A 1Q86D 1EP3B 4EH1A 1QUEA 4RD3A 4M0LA 1QGZA 1Q81D 3CB4A 4AF7A 1K9MD 2OTLB 2E1RA 2HMAA 3ES9A 3QFRA 1IJFA 3WXMA 2PMDA 3CW2A 1D2EA 1VQ6B 1VQPB 1KD1D 4IW3B 1JA1A 1FNDA 1EXMA 3E1YE 1DG1G 1CNFA 3B78A 1EFUA 1KTVA 2OK7A 4LC0A 4J0QA 4B4DA 1ELOA 4ZCLA 1EFTA 2DY1A 4PC1A 1QG0A 1R5BA 1N0UA 3I1FA 1BQEA 3JQRA 4B43A 3I55B 2R6HA 3CC4B 3OJXA 3J81k 5THXA 4G1BA 2D74A 2NPFA 2EIXA 1GR1A 3WBKA 2VNKA 1YJNB 4RCZA 4PC6A 3U2QA 3VO1A 2BGJA 2BMWA 2QEXB 3OZWA 3CCJB 2C78A 1A8PA 3W5HA 3WNCA 3W2GA 4H9GA 1KRHA 1EP1B 4AF6A 4B44A 5H59A 4F7DA 3CCVB 1YITB 1TUIA 5TY0A 1KK1A 3QSYA 3W2FA 1VQ4B 4YAUA 4C43A 4B47A 2BGIA 4RD4A 1NDHA 3ZZ0A 1H85A 3WNDA 3AVVA 1EWYA 1FRQA 1GAWA 4RD1A 1B23P 2RC5A 1KK2A 4RD0A 1FNBA 1KC8D 1CQXA 1VQ8B 4TMWA 2DERA 4FK8A 2OTJB 4LBYA 4B3XA 2HDNB 4TMZA 5GV7A 3SJZA 2GPJA 3CCMB 1YHQB 3CD6B 1DARA 3CMAB 1E62A 2BV3A 3OZVA 5JBQA 1M90D 3LRXA 1K73D 2BPOA 3G6EB 3ZBTA 1WDTA 4G5GA 1GAQA 2HCJB 1G7SA 4R71A 3WY9A 5TR9A 4PC3A 1DDGA 4LBWA 2J7KA 2QN6A 1F20A 2QDXA 1TTTA 1ZM3A 2BM0A 1KK0A 3ZBUA 2PLFA 1JA0A 1S0UA 2EFGA 3CCRB 1DDIA 2B7CA 4TN1A 3P26A 1N0VC 4ZV4A 2OK8A 1IJEA 2VNIA 1ZUNB 1VQ7B 1QFZA 1S72B 1EP2B 1VQLB 4RCYA 2VNJA 3CMEB 4M4SA 4Q7JB 1E63A 1OB5A 3AGQA 1ZM4A 2QMUA 4K1XA 3CC7B 4YAFA 1QVGB 1H42A 1W34A 1KJZA 4DQKA 2BVNA 4RJLA 4BPRA 4TMTA 3WNBA 1R5NA 3FJOA 1D8TA 2BF4A 4PC7A 1OGIA 2C77A 4YHBA 3CCSB 4M1KA 3AVTA 3QFCA 2YWGA 1FNCA 1QX4A 3W2HA 2RC6A 4YAOA 3U6KA 3CRZA 1GO2A 3AVXA 3ZZUA 1N8RD 3CPWB 3OJWA 4P6VF 5DSZA 4N3NA 1AMOA 4AC9A 2DCUA 1TLLA 2YWEA 4Y9UA 3VMFA 2XEXA 4ZGNB 1VQMB 4G1VA 1G7CA 1W87A 1QFJA 3CCQB 3ZC3A 4QFMA 5TV2A 3A1FA 3JQPA 3P27A 3MCAA 4MYUA 1VQ5B 1FRNA 2CRVA 3CCUB 1KK3A 1YJ9B 1BX0A 4ZCMA 3W2IA 1E64A 3WBJA 4ZCIA 4RD2A 3LYUA 5H5JA 4RD6A 1GVHA 1VQKB 2X3UA 1KQSB 2B7BA 2B5OA 1EFCA 1QVFB 4HE6A 4ACAA 1SM4A 4M2LA 2XNCA 4TMXA 1QGYA 5FA6A 1B2RA 5GV8A 4B48A 2QTLA 4M53A 4PC2A 1OB2A 3PENA 3FPKA 3V76A 4TMVA 3CCEB 1XE1A 3QE2A 3ZZTA 5HXBA 2DETA 4LBVA 1ZM2A 2GQFA 4FN5A 1YIJB 4ZGQB 1Q82D 1BX1A 1XB2A 1SKQA 1QGAA 4ACBA 1M1KD 1K8AD 3U6BA 2QA4B 3QFTA 3B8HA 1G7RA 1GJRA 1VQNB 2CNDA 3VNUA 1BJKA 1QUFA 5EMNA 5AN9A 1CNEA 2BSAA 1YI2B 2BN4A 1NJID 3OZUA 1VQ9B 4U9UA 2VNHA 2AHOA 1JNYA 1QFYA 3CC2B 4MYTA 1U2RA 3G71B 4N3GA 2YWHA 3OW2B 1ZM9A 4Y9RA 1JB9A 4UAJA 1HA3A 3VNVA 1F60A 3I56B 3AGPA 2YWFA 3CCLB 2XNJA 3LO8A 1R5OA 3W2EA
chains in the Genus database with same CATH superfamily
3UJ7A 2ODNA 4RGYA 3CNNA 2I3AA 4DA0A 3W7BA 4YDQA 2BSQA 2VF5X 2CUKA 4O4JB 2VAVA 3U4IA 1H05A 3IAM1 4RV9A 3RGGA 1YS1X 1Z5NA 3G8YA 2Q29A 2Z57A 1TKCA 4UBMA 5KYUB 3L40A 3OI7A 2AKYA 1A3CA 3OLZA 3S2IA 2PH3A 1FUEA 4D0GA 4DCPA 2GYUA 1WXDA 3O4HA 1AHNA 3E03A 3K53A 4WN9A 3CPEA 2Q6KA 1WU7A 2E4AA 3IAHA 3ROKA 4EHDA 3TVTA 1H6DA 2MMGA 1TZ2A 3PQ6A 4N0QA 1DV1A 4KYIB 4J90A 4X54A 1QPBA 3G1UA 3R3UA 4I2NA 4IMIB 3DMNA 2V59A 1CY0A 1TQ4A 2IJGX 5ERGB 4ESVA 2R1TA 1VM6A 2L82A 1F06A 1Z07A 3C5EA 1WMAA 4C4XA 1GNTA 3RJMA 4RULA 4YCBA 5AXAA 3BH7A 4LUCA 4P31A 1KC1A 4U5QA 2GUWA 5G0WA 2GPNA 3HY4A 2AOTA 2FVYA 2NVUA 2CNOA 2ZRJA 1K3UB 1JYSA 2EV9A 3Q1KA 3RAJA 1QJCA 2UUAB 5B2ZA 2PIAA 5B7QA 3BA6A 3MUEA 4G4JA 1I2AA 3G4SB 3TR0A 2ZI5A 3ZHYA 1SURA 1VLQA 3CYFA 5ESRA 2JK1A 4TWRA 3KB8A 4DMKA 2FX3A 4IIGA 1G20E 2VKTA 3AI1A 1XXHE 2Y66A 2O48X 2AH5A 2DY0A 1TEVA 3MWLA 4AUKA 4CV1A 4QUBA 3PQ7A 1LJLA 1RKBA 1OXVA 2V4ZA 1EFVB 2Q62A 3M6MD 1PFKA 3IUEA 3OLWA 4B5KA 3E15A 4I19A 2IYSA 4CE6A 2YUIA 3FFBA 3VYSB 3C8HA 2I22A 2IXEA 3MGAA 4KVZA 1A50B 2HA2A 3AEUA 2FW8A 2UZ3A 3DS8A 3TXAA 3CTAA 4YT2A 4R5HA 3KEOA 5EI5A 3LDFA 1UDCA 1HZEA 1P44A 2J07A 1KOLA 2CNLA 1GTRA 2XYGA 2VAWA 5ER6A 2L42A 2O23A 2QU7A 4TGLA 4B87A 2G07A 5LDDC 1ZN2A 4YGXB 4ENRA 2I8LA 3P4XA 1ID1A 1OKKA 4OATA 3HB7A 4UTPA 2OCIA 3KP1A 1CWUA 1NJSA 5J1TB 3FFAA 1PTKA 3SF8A 3KUCA 3EVBA 5DX1A 4JDUA 3ANNA 4CXMA 1LDBA 3ANXA 3CKKA 2XMDA 3AQ4A 1AGPA 1Y0YA 1VJGA 5KQRA 1TGYA 3DYIA 1F7UA 4KKSA 1BXZA 1I36A 5BWOA 4ZRMA 5DCLA 4B6SA 1T2DA 2HEIA 5ALNA 5LP6B 3HVHA 3TO5A 5ED4A 1QG0A 1WZUA 1GTZA 1ZD4A 3A6GA 4QBKA 3OU7A 4DBZA 3UATA 3NX4A 4BX0A 5AVTA 4BLRA 5LU9A 1PYDA 2C1XA 3HRKA 2A7XA 3I3SR 3O94A 4L4XA 4TS3A 5ALKA 2VT2A 2AS0A 3GLVA 4YI5A 4AIRA 3MMXA 4EHLA 1Y63A 4UJ5A 3ML1A 1K06A 2A1UA 4IDNA 4EGJA 1VG0B 2QD1A 4IKPA 4BBZA 1T2EA 3K92A 5B30A 4HC4A 1E8MA 2OLJA 1PL7A 2GF0A 4I4CA 3VNAA 3WBKA 4AMGA 1A9OA 3JW8A 1GQOA 2I87A 3NNNA 4N01A 5A0FA 4DAEA 3UK0A 2IU4A 4OMCA 3GLFB 1C81A 5CA1A 1N6HA 1GLGA 2NADA 1RHKA 1GG8A 3VISA 1Z15A 1V47A 3HBAA 6ABPA 1RKUA 1KFBB 1TYAE 2HWWA 5IEBA 4BBAA 1MHPA 2AG8A 1VE1A 1VHEA 1Z6AA 3WNCA 1Y6JA 3KELA 4GPIB 3EIQA 4ZVRA 5CM9C 2OAEA 4KOAA 2EATA 5GGXA 5JWOA 3M6UA 2PT5A 5KZMB 3KJIA 2A67A 1EP1B 1N1EA 4BFYA 1TU4A 3FTPA 3PC4A 3L8YA 4GX5A 3TFOA 3D7MA 1Q16A 2OCGA 2H1CA 4FKMA 4N5NA 1OWLA 4NESA 3LC1O 3HACA 4MRVA 1DOZA 5CRIA 1RLUA 4KXQA 2P2ZA 1EXDA 2A1IA 3IYLW 4X24A 5KAMA 1CLEA 4KSYA 4NY1A 5C5IA 1X1RA 1A4UA 1NLYA 1N33B 4RVDA 3KOWA 3I6MA 4A16A 3N6RA 1H3EA 4OHYA 2V31A 1OX4B 3GEGA 4MKHA 3N2NA 4J03A 1M6VA 1T6NA 4BFUA 2FSGA 1P6XA 3IR7A 4B47A 3HBJA 4Y6SA 3VNSA 3WTCA 4D4GA 4WY8A 3RAPR 3L06A 1DEHA 5IZCC 1YR6A 1ZRSA 4JUIA 4PLHA 1HURA 2OHOA 3MJCA 1O96A 3RVBA 3QUBA 5F1PA 3N87A 3CRNA 3TPZA 5KYXB 1MQ8B 1DXOA 2FMFA 4QDKA 3SSNA 4Z4WA 4ZOCA 1LK5A 4I5EA 4JGBA 1OX5A 4MV0A 2O59A 3NALA 3FG9A 3A2LA 3M4ZA 4ZQGA 4AX8A 4AD8A 5AJUA 4LWQA 2LV8A 1MORA 1SC4A 4TYQA 5JAMA 2E5WA 4OPOA 2AMJA 1TZCA 4Q3EA 1MO5A 1JPNA 2AI1A 5SZKB 2HWXA 5ERYA 1SRQA 4FSHA 3HYRA 5E3IA 4BYMA 5LOVF 3TGPA 1H6BA 4QUGA 1UP4A 2OBBA 3H3XA 4H7KA 5IS2A 1DQYA 5HBRA 4FX2A 4K3UA 3GBPA 4ZICA 1PJQA 1O8CA 2BFBA 2IDKA 4XKJA 3CMAB 4S1TA 3UQYS 1BFUA 1FXUA 2NZ8A 4TL6A 1RIIA 1L2TA 4MUXA 3SSOA 5A06A 1G38A 5BVHA 1D6JA 1RXYA 1T0HB 1QCZA 4FYYA 2A5FA 4ZU6X 1GYRA 3UTCA 5AJZA 3SLNA 3QW4B 2ZAMA 3AZQA 2VJJA 4MS4A 3BC9A 3PHJA 4P5PA 5CH8A 5EC8A 1F2UB 3VA7A 2XZPA 3ONDA 1ZN9A 1FVXA 1WXWA 1C1DB 1QK5A 3WWCA 3X1DA 2AN3A 4DXHA 4GICA 2ACVA 4MWSA 3EXFB 1L7VC 4GFDA 1QV7A 2P2GA 2Z5FA 4FYIA 4BMOB 3K73O 5PGMA 3HDGA 3E9RA 1YHNA 1FBNA 2RARA 3NHZA 4XLTA 3QK7A 2GDZA 4NG4A 4MVCA 1A82A 2EWVA 1C1HA 3A6DA 4YRLA 3UFXA 2CMHA 1MT0A 2AMYA 5LZ2A 4M0KA 3SBEA 3W4IA 4ZHQF 2ZEJA 1E8NA 2PX3A 4RY8A 4YJHB 5AKHA 2EP5A 4Q39A 4JCCA 3HU1A 4XRGA 2KLHA 4KR2A 5K01A 1QV6A 3KS9A 5GVRA 1JWAB 3IXLA 1XXLA 3ZDEA 3P26A 1YR8A 5BT8A 1Z6ZA 3LFTA 4KIWA 1R9NA 2R8BA 4FQ5A 4RWEA 5LBIA 2G70A 5FWYA 1TMYA 2Y1FA 3KAPA 3V4VB 2WD7B 3JYLA 4E4YA 1QP0A 2X8WA 3WZ2A 3UGJA 1GZ4A 3NNDA 3RJ9A 2AN4A 4QOJA 3KQSA 3I64A 3OEYA 1GRVA 1H2WA 2Q1UA 1QVAA 2OCXA 3FCEA 5CLHA 3CZPA 4GH5A 1G5TA 2GZDA 3BREA 3OY2A 3P2MA 4IFIA 2QVCA 3L18A 4BL5A 5F7OA 1LBQA 1QGOA 3R23A 1VF7A 1KJZA 4XRRA 1HTWA 2ZE8A 2BVNA 1G98A 5ALDA 3EIOA 5EWLB 5HF6A 2CXXA 3TOCA 3ABRB 4UPEA 1UM9B 1CY6A 4FS3A 1O3YA 1FSFA 2ZJ5A 2F1RA 3QV2A 1GPWB 3ICPA 4NJMA 1NNLA 4PCAA 3U48A 1SG9A 1E2BA 1QGUB 2IYNA 2OHJA 4RELA 1GRCA 2O57A 5LYJF 3GUZA 4WXHA 1L5RA 5BR8B 4D9HA 3BSWA 3V34A 4FFDA 2CJWA 1B76A 2E37A 2SBTA 2WTMA 2XR1A 3QP9A 5JHHB 1HX7A 5E6RA 3O31A 4CR6A 2PSSA 2B1QA 3EVDA 5D1HA 2NUTB 3EZFA 5AT1A 1K6XA 4S1WA 4BVBA 5B6JA 4HN4B 4ZD6A 4AZ3B 1XAIA 4ZOLF 3SYNA 3KHKA 5A71A 4S1NA 4ENUA 4E5KA 2O2IA 1QX4A 2VF2A 1EE1A 3AIOA 4TXHA 4YJ2A 3UAYA 3T12A 3AVXA 4L72A 2F48A 2X5OA 5K2OA 2CLOB 1PR1A 5IJXA 3RU7A 5I9IA 2O4UX 4OOEA 2XLBA 4Z54A 4IIFA 4MEAA 2REQB 4AJ2A 2PANA 3U7EB 4D92A 2GB4A 2WJ3A 1YI8A 3ORFA 4YRQA 5DGIA 4X93A 4B33A 5M7EA 4FDLA 2HLPA 2ZREA 3IQHX 4JP8A 2O9JA 3IHWA 4RAQA 1R37A 3OCYA 1ADFA 2NU8A 3OQ1A 4PIMA 5EVCA 4P34A 4RHEA 4WZAA 1KPIA 1N5RA 3T94A 3HVRA 5DF1A 4QFMA 1VI5A 4WSOA 4N5DA 2JS7A 2B8WA 3O1JC 4FE4A 3RBVA 2PMEA 1UAAA 3MD9A 1YR2A 2B4QA 2IYZA 3SZUA 4AULA 1B00A 3N2EA 3R24A 1RXIA 2DLDA 3DP7A 3MCAA 1TJNA 2R2AA 1IZ8A 2ZBGA 1MB3A 3K2BA 1DP4A 3NAGA 1QORA 4L50A 4C20A 1VIAA 4X7DA 1XZMA 4OJKA 2DFPA 1HYEA 3U17A 1FU8A 4ZHSA 1QTIA 3C85A 3WAKA 5E9JA 4D46A 1JPVA 4AT1A 1V0EA 4KXMA 1SBQA 2CLDX 1EPUA 5FULA 4CM7A 4JH0A 3CZCA 5HZBA 4DLAA 2BFDA 1PVOA 4CZ2A 4CL2A 3EJ6A 2IYAA 1G20A 2RBEA 2Y0DA 4LQDA 3IUQA 2GQ0A 5B12A 3W8NA 1RYDA 3HKCA 1H2BA 1OX4A 4H6XA 4KYUA 2C92A 1UXHA 3M5CA 4RQTA 3EFOA 4AJPA 4QU8A 2XUIA 4IEEA 1E1QA 4LC1A 4LTDA 2GKOA 2PKCA 2ZXEA 4J75A 5IVIA 2OQVA 4F85A 2F1JA 3TNJA 4CI9A 1DFHA 1ZMTA 2GNPA 2H59A 1SM4A 1E5LA 2GLXA 2Y1CA 2F9FA 3EAQA 4K9PA 3UB2A 3LDGA 4CTNA 4W5JA 1G19A 4UQPA 1V8FA 4EL5A 2FEXA 1XL0A 3IOBA 4KWEA 5C7IO 1Q83A 1X8JA 4GE0A 3L07A 2RGAA 4RESA 5KYVA 3OJCA 1YULA 2IY8A 4J4HA 4U2FA 2Q4TA 4JQYA 4P5DA 5FFFA 2JIZD 4JLKA 2C31A 1NV9A 4GG1A 5AMXA 4ARBA 3FPKA 4QTYA 4MDFA 1AXEA 3VJLA 1GLNA 3NJRA 4FU0A 1DWPA 4LNAA 5FRDA 4DUZB 1U8AA 2F3UA 2WVGA 1Y42X 2J3LA 3I73A 1MA0A 4X1KB 4XB2A 3LX4A 4DY4A 4COKA 1L9KA 3IAS6 4YROA 3RC3A 1R0ZA 2J08A 2PRSA 3JARB 3K9WA 1ULZA 1YVPA 1C0LA 3TLGA 1K6IA 3OLXA 5BW6B 1QDLB 3O84A 3OE5A 5K1ZA 1YS6A 2C7GA 2DUJA 1PVDA 2ZBEA 1RQ2A 1GPH1 3DFMA 5TQ2A 3S1AB 4ZYLA 1G8MA 2F9MA 3NM4A 1AV6A 3U9SA 3KLOA 2HKIA 5FI1B 3DE4X 4HF7A 1VG9B 4UBNA 3UTDA 4BWGA 2FQYA 2A1TR 3IQZA 1JG6A 3FVVA 4UE6A 4DIDA 2W6JD 5L6LB 4LFAB 1GTVA 2O54A 1C1DA 4B3HA 1HDGO 3F6RA 1ZA1A 3E4DA 2WWYA 2FEPA 3AT1A 5TXGA 4FB4A 1YMQA 2ZRAA 1N8KA 3GHYA 1X94A 4MMXB 3A9UA 3AM3A 3WNZA 1KGSA 1RYZA 4BVJA 3EDQA 4XTCS 2W2VA 3HCOA 5LP6F 1JAHA 3UFXB 3OJEA 1PV1A 2EEZA 2IK8A 2VBCA 3T56B 3OKCA 4MPPA 5CD1A 1KFKB 3EQ8A 1C50A 1XA4A 2N46A 3KSMA 1H1DA 2IA5A 1LLFA 4OYRA 4QJIA 4QYTA 4KNWA 4UD6A 1QS0B 5EMNA 4MRRA 3JSAA 4QC2A 5EMMA 5FLEX 1GLVA 1Z4KA 5EQJB 2BEJA 1LS6A 3TE6A 4Q9LA 1VJ0A 1E5DA 4KK4A 2OB2A 3NORA 4K88A 1XNHA 4TT8A 4U9UA 1GRNA 3P20A 4A2PA 1JNYA 3AZPA 4RTQA 5HA5A 1XP8A 4LFCB 2PBRA 2MINB 3ZE8A 5JNUA 2ZSKA 2CKMA 5F33A 4C7JA 3BEDA 3ZH2A 2IXTA 2BI8A 1TK2A 4FZVA 5LBUA 3AILA 3B12A 5A3QA 3DBRA 1H4QA 1A4RA 5CVCA 4C4ZA 2B3TA 3OFKA 3HSYA 2ZM6B 1JQAA 1KDPA 1RHRA 1ZUNA 2D1TA 2HV8A 4I3GA 4MI9A 4D9KA 5FO0A 1C3VA 3VNVA 1NQWA 1YL7A 3CF6R 3MJSA 2VP0A 4JSYA 1TQ2A 4DLBA 3BIJA 4R68A 3ZKWB 1YZQA 4PTYA 5HPYB 1J8VA 3N7UA 4DIKA 1GAXA 2RG1A 3E7XA 4DE5A 5I6DA 4LSZA 2Q4OA 1QBGA 3EZXA 4XQEA 1L4NA 2C5AA 1E4YA 3GA0A 4ICIA 3G9ZA 4XM1A 3V33A 2GGSA 3QOYA 1WUKS 3TQTA 3ZV4A 3UV6A 4UU7A 2NSDA 4D56A 3KQQA 4IKOA 3KL4A 3BH0A 2RH4A 4FOSA 1J0CA 4ALNA 1PZXA 3HJBA 4V0LA 3BL5A 3CXCB 2ZSAA 1JU9A 5LXTA 1HDEA 1G0NA 1Z7YA 3PC2A 3ZNPA 3TMAA 5BWNA 1N4AA 1MA3A 3S1SA 2QZZA 4W5OA 4P9SA 1T9GR 1QG4A 3ZHTA 4KLCA 1TAQA 3ADOA 1UP7A 4NICA 4TTQA 1GUYA 2NO5A 3HZZA 2WHYA 3EA0A 4MRSA 5I7SA 4EI8A 3GUVA 1XXHA 1OGJA 2OE2A 4I1IA 3GJQA 1CNMA 1QRDA 1RJDA 4QU9A 5KWIA 1VQOB 1JNXX 2BBSA 4PHCA 4HT3B 3K4HA 4DLZA 2I7TA 1G7TA 4M0UA 5GADl 3L02A 2PRKA 3JQQA 3F6SA 4ZQHA 5B2FA 1V3QE 3O8QB 2XCLA 1FNSA 3M5WA 3PFKA 3IIIA 4M55A 5EP4A 2NU8B 2VZEA 3OZ7A 4LIPD 3TDNA 2H85A 5KVSA 4JKYA 3X3HA 5M29A 1TVKA 2WUEA 4GVLA 1KAGA 1QP7A 4CEIB 3IULA 1I4LD 1IM8A 2OORA 3DBLA 4JR2A 5CR9A 1WXQA 1Y5NA 4LRQA 3P0FA 2G25A 1WSBA 2O1WA 4JLVA 4RV4A 3V42A 1I7PA 1LTKA 5E2AA 4IZ6A 3BMNA 4ZTBA 4S3MA 1AXGA 3N2ZB 4V24A 5E1MA 1PGNA 4BB5A 1U9JA 4BFVA 3R0VA 1GV1A 3GRCA 4HGRA 3U3MA 1FSPA 3O4GA 2OBMA 4C07A 5C7YA 5KNLA 1TMOA 2G4LA 4X7PA 5IKXA 3NQ41 2C7VA 2TYSB 3PQEA 2B30A 4ZO7A 4AF7A 1XTIA 3DM9B 4WXPA 1JFLA 3R4VA 4AWBA 3ES9A 3NC0C 4Q3CA 2XADA 1TC1A 2EZUA 1W5AA 1QVRA 3NPMA 5C80A 3WXMA 3WQQA 3L7CA 5CFQA 2ZVQX 2RH8A 7GPBA 2ZB3A 4EECA 6ADHA 3HQ4O 2NO1A 1XRQA 4M8SA 4D4HA 2D1YA 3PCRB 3T06B 2I2CA 4RZHA 2OPBA 1V9CA 3L7NA 1QCCA 3EFOB 5KX5A 2LZ0A 3ZJVA 3ROTA 3PX2A 3ZVRA 2YFKA 3NYIA 3LS2A 5KJ6A 1E3ZA 3V8EA 5IVKA 1YRHA 5JNLA 1R16A 3DLPX 1TAHA 5FOVA 4X0CA 4G9GA 1KTVA 3CUKA 2EJVA 3N70A 3PSHA 3UJ6A 1TYDE 5E7IA 4UAUA 3IODA 1C8KA 1TT5B 3DKKA 3TUIC 1W52X 3KKLA 4MQ4A 3ETNA 2E21A 2ZSDA 3PT5A 3AERA 4ND3A 5AJHA 5FQNA 5K6TA 4R16A 3HJHA 4ZCLA 3JASA 1M2KA 4HLUC 3ONYA 1J56A 2HU2A 4RGVA 4CQLB 3DCIA 1KYVA 1Q11A 3PUVA 4DZRA 5G40A 4RK7A 2CFTA 4NNPA 3C15C 1BOOA 4B43A 1GILA 2UUBB 5BUSA 3KNZA 2ZZEA 1V35A 1I3MA 3OFND 1MH9A 3E9QA 1GNPA 3QMPA 3B7PA 1H0RA 1NRXA 2P9TA 2WVJA 3HO8A 5DGXA 3KXLA 2PKWA 4TLEA 1B3BA 4MV6A 4XB1A 1Q44A 4YO8A 4R3UC 3NKFA 1CJVC 2O5CA 3UMMA 3COWA 1JE0A 4FYJA 3NPAA 4EATA 5GPBA 4DR6B 1FMCA 1EUQA 1R27A 3EH1A 3QNMA 4HGZA 3BRCA 5A7GA 2WLTA 3SFVA 1ECPA 4G0VA 3VR4D 2RGGA 3KB1A 3ZBQA 2R6ZA 1TCCA 2I8CA 3ABQB 4ZEWA 4GOMD 4A8JC 2X9QA 4EHIA 5JC1A 4LF7B 3FMGA 4J16A 5NLLA 1FMFA 4TTPA 1SU7A 1ESMA 2I9KA 5JRJA 2B8EA 3QFHA 3R75A 4EUEA 4PYNA 1YBVA 1AZTA 3O8RA 2CMGA 1MMFB 2DU8A 4RVHA 3LO5A 4HFNA 4NJEB 1Q1QA 1BWQA 3GGCA 1YVUA 3MWGA 4NMLA 1SQ6A 2WV9A 5T8KA 4C76A 2BGRA 2DH6A 2OBSA 3KT6A 3OTGA 5ERXA 1W1IA 3WO0A 4YDHB 4AN1A 3LNTA 1NLUA 3C6KA 1SCKA 4DIUA 4OGFA 4F1JA 1OHHD 2VYND 1Z83A 2Z5LA 3H0CA 3LLSA 3V4LA 5AUNB 5DNEA 3TJRA 2J3MA 1HLFA 1SB9A 1R1DA 1EDZA 2VCEA 4CQMB 1L4YA 5A4FS 1PU2A 1DO2A 2JFFA 2J4CA 4WK0B 4PLPA 1UC9A 4F93B 1ZICA 5A5FA 3T3OA 3QTTA 4BNDB 4EKDA 2GO1A 1LWNA 2R65A 3SJCA 3O8OA 1JSZA 3BY2A 1AHHA 2FZLA 2WNIA 2DBVO 4TV9F 3QF4B 3TZ6A 4FHFA 2XNDD 4JMPA 1NN0A 2AZDA 3MCWA 3D7RA 4NCIA 1M2VB 3CLTC 3MM4A 2OGTA 3MJVA 3QKUA 3LL7A 1VKRA 4DA8A 3N0RA 1WSVA 2ZSUA 5AW2A 1QIFA 5ALOA 4GPEA 4ZYXA 5C81A 3HVKA 5B3AA 5B53A 4N7MA 4JI6B 4ZYZA 1DC5A 1INLA 1SXJB 1TAGA 2QD2A 1IN1A 4FFLA 2EFCB 4R1QA 1EWQA 3H4VA 3PU6A 2RONA 4INAA 4MLDA 4WMLA 1JYEA 2ZU0C 2JCBA 4C2UA 3HNPA 4HLQB 2I9PA 4RACA 5A6SA 1BMFD 3I9V6 5CUQA 4IPTA 2BFCA 5DKFA 2W2MA 5EKUA 4RMNA 1QRSA 2Y99A 3G2QA 4GWLA 5JE8A 5C1IA 3C6ZA 3VKFA 4C01A 4C0WA 3QG1A 1SG6A 2XJ9A 3EZYA 4CMBA 2HYIC 2J0SA 1LWOA 1XNQB 3MC1A 3R6DA 4C4SA 1CX9B 2UVPA 4I1UA 3CD6B 1T0JB 2QROA 1J5PA 2XE4A 1R4AA 3DZGA 4ZQCB 4WK4B 5BSRA 2LIPA 2E5LB 1EGAA 2EGUA 3I32A 5A4MS 2GTPA 4IWXA 4AG6A 1NR5A 2CHEA 4FX5A 4Q66C 3ZCRA 3ZBTA 1FIUA 3VC7A 4MPJA 3JQ8B 3FDFA 3RABA 2RHDA 3FB4A 4NCXA 4XR4A 4DG9A 3HB1A 2G9UA 4QLAA 3ZDCA 2V4MA 3C3EA 2AK3A 1ZISA 3ZK7A 3ND8A 3UUGA 4CDNA 1TMGE 3M3PA 4UFOA 3EXEA 2IYYA 4GMGA 4WZBE 4FOTA 1FE8A 4KDEA 1U7XA 5FL3A 4RLFA 2D2IA 4LBWA 3VSDA 1IN7A 4XIJA 4EVSA 1UOEA 5CB8A 2K7ZA 3MZ0A 4JY7A 2JI4A 1MNQA 5I7EA 1NKVA 5DOVA 5F9HA 4H15A 3R5KA 4LDAA 3TLBA 2Y05A 4V1CB 3DTVA 5CYFA 4HL6A 4PHGA 1MBZA 2FMIA 2CF4A 4GXQA 2YRXA 1J2TA 3M4YA 4Z4IA 5TARA 3ROZA 1AQ6A 2G5TA 2RAVA 1G2OA 2HK7A 3N8NA 1V1JA 2N1BA 1NI3A 3L4EA 2NYUA 3TZCA 2I4RA 3TZQA 1NVGA 2JH3A 2V9PA 2PZGA 4MKGA 1Q1AA 5AI8A 1E5TA 3QWFA 3KQVA 1G5RA 1YOVA 3HI6A 5AUQA 1J21A 1R4MA 3CT6A 2PYZA 3JQAA 2VNIA 1P9NA 1IH8A 1P0PA 4XTRA 2PUTA 4KO1S 1QFZA 1S72B 2RMKA 4ARUA 2PY6A 5EQTA 2WICA 1G3QA 3PC3A 3K16A 1O9GA 4E33A 3EUEA 4DCUA 1ZM4A 4UEKA 1GNVA 1V8ZA 2VH2A 2CK3A 1EE2A 2FYTA 4Y2GA 4KGZA 1QVGB 3BRSA 1ZNXA 1UK8A 1QTQA 4PZ0A 3NTVA 1V1RA 1EM8B 1TJ4A 3QWIA 3Q3AA 1VKJA 1O94D 2Q8PA 2JJYA 1JEJA 2PX0A 1Q0PA 3I5MA 2CSUA 1SUCA 2QX8A 5JNRA 3LOQA 2C54A 1YSCA 1SHZA 4KE6A 4ENWA 1P2DA 2XZTA 4OHUA 4ZODA 1WL8A 3OC6A 2OA0A 2XCSB 2A9JA 4L6IA 5I9BA 5LP1A 4LHYA 1E4EA 2WZNA 3UBMA 5CPBA 2R66A 1NY5A 3GRZA 1ZY2A 4OK6A 5SV2A 1RRKA 1U98A 1FP2A 3W2HA 4G0YA 4H31A 2NZYA 2Z3VA 4M1YA 1KDVA 4CPDA 3K0SA 3ORQA 3STUA 1EFAA 2GZRA 2YJ3A 4TZ6A 1W75A 1T5EA 3B3QA 4WDQA 2NACA 2E82A 1B2LA 4R98A 1XMVA 2JEYA 1P2UA 2QPTA 3DZJA 3MW8A 2PWAA 2IYTA 1OI2A 1XVUA 3VAYA 1J07A 4TUYB 1X7ZA 3K8YA 1FRVA 1G9TA 3LLUA 1XMQB 3HBMA 1MKYA 2NX2A 2I5PO 4PN7A 4YYZA 5BSYA 1Z29A 4D9JA 4E5MA 2HMTA 2XZDA 1Z2DA 3HVJA 3JVUA 4CEHB 3C3XA 1T34A 1Q2XA 3NM5A 1UC8A 3IIMA 1QZ3A 3VTAA 1WMSA 3WLPA 1TD1A 2GJKA 1JEAA 3GW8A 3L7MA 4M6WA 3LPCA 3QTLA 2HEGA 4LYJA 1DUVG 3TRJA 1SRRA 5FTKA 3CV3A 10MHA 2GEVA 1UMCB 2CLKB 4O08A 1VPDA 2QRGA 2WT4A 5AICA 4CHTA 4R0NA 5C2JB 1IPHA 4TKVA 3BH4A 2F2TA 2IGBA 3PG5A 1H9CA 1SCJA 3PXBA 3IT0A 2D54A 2ERCA 4D42A 3FA2A 2ZUFA 1DBSA 1A5BB 3HG7A 3PGMA 1CJCA 3OECA 3HWSA 4PNEA 1VQ5B 1YQQA 3CZ9A 5EN4A 3DT8A 2PO5A 3QTBA 4HNUA 2R1ZA 1QVVA 3PUIA 3A1DA 4MA4A 4PG6A 4HEA6 1BDMA 2TMDA 3AR3A 4JV5B 3E9EA 1XU4A 1XCGB 2DECA 2ZZQA 1PQ4A 3FB1A 2P2YA 2IH4A 1EJ0A 3O2SB 2XUQA 5BV8A 2EOAA 3Q8WA 4G1EB 4HDCA 4ID3A 3GI1A 1DXQA 4HUQA 4JFAA 1HO3A 3PQ5A 2Y6VA 2CXPA 2EKLA 2NYAA 4DV7B 3BRWD 4Z9BA 1TE2A 4Y30A 3D3KA 5KS2A 2V7PA 2O06A 1U7WA 4X20A 4FMDB 5CTAA 5J47A 3L0CA 2FWPA 4GNRA 3MT7A 3SSMA 2V7WA 5L3QB 2BDEA 2GN9A 2RHJA 4DLLA 1ZCAA 2QVZX 2RKOA 2OYNA 4B17A 4DS3A 4ACAA 3V1UA 5BSFA 1OLXA 3P4YA 3GJXC 4NU5A 4QDZA 1LSJA 1KZ9A 1Z9BA 2D2VA 2DPHA 4MR7A 4IX9A 2GAIA 2HL6A 1WCV1 1I2BA 5EZ6B 4ITUA 4WFQA 3U1BA 4ER6A 1SXIA 1U7HA 2AVDA 5LD2B 4FKZA 1E69A 1QYVA 1UPFA 1WMBA 2OCDA 2CNWD 2VPXA 3RS5A 3ZHBA 5BWCA 5J23A 1SBZA 5HG0A 1DQNA 4X00A 1ZKMA 5CFNA 1N78A 4M53A 3GLKA 5FPHA 1RHQA 4JLUA 2ATIA 4UNQA 2Q8NA 1D5WA 1JP7A 3DE7X 4H7DA 4CEJA 4EBBA 4XPIB 3R0JA 1LC3A 1I2CA 4JB0A 5GJWC 1NXSA 5JALA 2FV8A 1BWSA 1DC7A 4WXEA 2J6HA 1OI7A 2V0CA 5TX7A 4NBVA 4E03A 2VXBA 1EUDA 1YH3A 3LPDA 5CLGA 2E89A 3PQ4A 2BKEA 2C3OA 1EFKA 2O0MA 1Y0BA 1TA0A 4LXTA 4MO2A 1Z6GA 2HJ9A 4C0HA 4CF7A 3GLFA 1UBJS 2FMHA 1NW6A 2EFYA 1I3CA 1K0FA 2XH8A 3NHBA 1CZHA 3PWSA 1Y7LA 1N6LA 2AV6A 1HQYE 3QKRB 4O25A 4IHJB 2Q5OA 1Q1GA 3V1TC 4ENPA 4R84A 3E7PA 2XB8A 3P9PA 1VA5A 1P75A 4YUZA 3E81A 3AUYA 1GTL1 1SELA 4FI3C 4TM8A 1I80A 4DG8A 4C7MA 2YOHA 3EIFA 1JHXA 3B3AA 1ESCA 1QF7A 3EXEB 4V0SA 3WX0A 3RFFA 1SKQA 1SUBA 2Y0PA 3PXXA 2ASVA 4CKCB 3QEBZ 4DA7A 1FUIA 1SOVA 3BQMB 3NETA 1JTEA 1EWTA 4W6ZA 2QA4B 5D01A 2NNWB 1E3DA 4AS1A 4L9SA 3U4HA 3FOZA 2JK0A 3MJ4A 4DMCA 3LTEA 3UWPA 5DVZA 2R96A 1RYFA 4LYDA 4O0MA 1W4LA 1G8JA 4G25A 3P71T 4I08A 3S2EA 3VVCA 4KQXA 2BZ1A 1C9EA 3D8BA 1O57A 1DV2A 1SBNE 2IV3A 3RHTA 4DILA 3WIDA 4OLAA 1NQOA 4NENB 5HF9A 2B4RO 3V3KA 1UBMS 3KWMA 2UU9B 3WLRA 1UAGA 3QZUA 3KEGA 4TV8A 2RI6A 1XFAA 1USUA 1HGXA 1W88B 1HDRA 2A4MA 2F8MA 2L17A 2LDXA 4FGSA 4O59O 2J5RA 1T9DA 2J5BA 1U2RA 4BWFB 3L6BA 3ZWPA 1W47A 2YWHA 3TKYA 5JYEA 3NB0A 5A4JA 1II8B 2VXCA 3BWYA 1J00A 1Y7PA 3Q7EA 3R74A 4HQRA 3FUCA 3E9YA 1KVRA 1PQPA 1JEYB 3UWSA 1P4GA 3QVOA 4EEXA 4RENA 3WNVA 3MSCA 3IP5A 3SEJA 1NQAO 1PTJA 4CL3A 3E22B 1Q7BA 4P7BA 4YNBA 3UPUA 1NJGA 5F2OA 3P19A 3PITA 4DRXB 1B7GO 3OOJA 3TRKA 3RT1A 1ZIPA 3BWEA 4JENA 2QN1A 2BD0A 3M5DA 1E4EB 1BCRA 2JDID 2Y76A 4C0SA 2WEKA 3G2LA 1C7RA 3LGXA 3MINB 1Q50A 2YXLA 4L3WA 1SNYA 1K92A 4OXYA 4RVUA 2KVOA 1NXVA 3MAGA 3T3GA 4YP9A 3F8WA 4BGUA 4CL0A 3UW3A 5JJBA 1LH0A 3RAFC 3FWZA 1LBEA 4OAPA 3I5UA 4HH1A 1P7ZA 1K7CA 5ARDA 1NMQA 2Z58A 1G3RA 2EL9A 4PO3X 2VDPB 4M8KA 4YEJA 5F4ZA 3NKLA 4BQEA 4C3VA 2JAWA 1BE0A 3C6BA 3REGA 1NX6A 1Z88A 2BHRA 2DR0A 3DDNA 4FJ2A 3FNGA 5F98A 3T5MA 3OZSA 2HR1A 5JCJA 4E0BA 2XRYA 1SC6A 2JGDB 2GSWA 1KEUA 5ESXA 4EA8A 1Z47A 3HCDA 2OY0A 1P45A 4JOCA 3IEKA 3PVCA 3PIIA 1LX7A 1MIHA 5ALLA 3TEMA 1I13A 2CVPA 4IDCA 4BP1A 2ATVA 4B46A 4DCVA 4DL9A 4BXOB 4GDFA 4DCTA 2JCGA 1FNMA 2BUBA 3TQOA 1XK6A 2VDWB 3AVWA 5F76A 2GCOB 5IYWA 1VCNA 2Y6UA 2I6UA 1G6KA 3K1TA 4IJKA 1U1CA 1UEIA 2A4KA 4PPYA 5DNVA 3H8SA 4K28A 4EH1A 3ZIUA 1LK0A 2OKGA 4MYDA 1DT3A 5DP1A 2BONA 1MIOA 1QGZA 1NDUA 2ODWA 3DW3X 2PGOA 1Y3FE 3GPDG 1KF0A 3AR8A 4FMPA 1PR2A 1YZKA 4RADA 1PKXA 4N5LA 2AOTB 2C4MA 4AUEA 1E98A 1FTYA 1UDBA 2RI1A 3KALA 3L6UA 4YRJA 2NP7A 1RAHA 4N7BA 3RVDA 2NZXA 2WJWA 3UT5B 5CIYA 2IYXA 1RXUA 2CCGA 2X2PA 3GBVA 4KXYA 2WAYA 3FCOA 3ZD7A 4CCAA 1J33A 1T13A 5AHWA 1A97A 2DBZA 1YQXA 2YMQA 5CNMA 2FZ4A 4B81A 4L16A 4OKIA 5DYNA 1F12A 4GEGA 2H2IA 3UJ9A 2AC4A 2C5LA 2HAEA 3MG9A 3EMKA 2FJ0A 4NEHB 2Q3CA 4MGKR 1X1QA 2CWDA 2HSDA 1XEXB 4U9HS 1ZA2A 2IT1A 3VVBA 4H1WA 1KY3A 4EHFA 4XCVA 2I99A 5JXHA 4YECA 5BMVB 3C3JA 4MDEA 3ESBA 4MTCA 3WL4A 5FPQA 2XIQA 2M6SA 3BWXA 4PYOA 5JPIA 1PYGA 2WTEA 1N3IA 4B3GA 3EAFA 2OB1A 4QNMA 1NR1A 1XHEA 5FI5A 3PT9A 2D0IA 4JR1A 3TIXB 3A4IA 3QU2A 5JU6A 4UXJA 4BP9A 4HB2A 5D6NA 2XVYA 5CLIA 4X85A 4CM5A 4O29A 5IN5A 1UFQA 4YRDA 2ZBDA 1W48A 4G4GA 2WDZA 4OBXA 4GPBA 4CMKA 3HA5A 3TTTA 5JQGB 2XOXA 3IHKA 2OAQ1 1HY3A 2B2XA 2DGDA 3MD0A 2C00A 1ZN8A 2IYRA 3OPMA 3ZDDA 1SHJA 1KMQA 1U8XX 4C89A 3MS4A 1Z4PX 1ZD5A 3RWMB 2HN9A 2O2DA 4JJ6A 1KYIA 3PQDA 1S2IA 2YIJA 1M5TA 2DPMA 2Y68A 1J9EA 2QKYA 3F0TA 2XVZA 2NSYA 3LXRA 1X2EA 1G4AE 4S24A 4XVCA 2IXAA 2ORYA 2RJ3A 1VHWA 4RCZA 4BQFA 2DKOA 2B99A 3KJHA 4Z0HO 1ZG3A 1PBTA 3FNEA 3RSCA 3LOUA 4MLPA 5C53B 1OH8A 3WYNA 2V8OA 2QP3A 2JIRA 3IEUA 4LCJA 2I65A 3D3QA 3R6GA 3COJA 3ORRA 1SD2A 3W04A 3ZHVA 3W2GA 1Q20A 4FFOA 3WYDA 5K05A 1RLTA 2WTNA 5EZ5A 3M3HA 4CKBA 2KBFA 3ZHCA 3KZMA 2GJ9A 2ON6A 3AB8A 2GNOA 4QFBA 1WIWA 4B44A 3LG2A 4NEQA 1UJ4A 3CCVB 1QG6A 4LDJA 3U7JA 4C6TA 3FHLA 1WOMA 1YC2A 3OLYA 1JLMA 3IJEB 3NATA 5HVNA 3UXHA 2WNSA 3GJ6A 4R8KA 2VK8A 4KYTA 1V8BA 2PT9A 4QBTA 2XUZA 3S44A 4RL4A 3GOHA 4BE9A 2D3LA 2ET6A 4NENA 2GF9A 2H7CA 2FG7C 3P2IA 3NIBA 4ISCA 3RC8A 1K63A 3OJFA 4XIFA 1ZCBA 3DEYX 5ALIA 4C06A 1MO4A 4Z9AA 2WF6A 4F3TA 1VQ4B 2FSVC 3PFBA 4OXIA 2V74B 2X4IA 4BATA 4JBXA 3WK6A 3D0KA 1ETHA 2YCBA 5EXTA 3HZRA 1QC5A 3HCFA 5BSMA 5JEEA 2ZL7A 2GZSA 2IUYA 1EA7A 3GGPA 3EIEA 2EXXA 5EIBC 2IQ5A 2OGUA 1ZQ9A 4NX2A 4CLHA 2J3DA 2RHOA 4PVCA 3L04A 4P3PA 2RH5A 1Q7GA 2ES4A 2NU9A 4Q7EA 4UNNA 3L1HA 4IOMA 3RBXA 4Z4ZA 1ODFA 3UENA 3PXCX 4P7GA 4KDRA 3I28A 1ZONA 4KLZA 4RIHA 1EU1A 1PJCA 3WWPA 4K9DA 3TEFA 4Q16A 1E7RA 4RHUA 5B1SA 5IFLA 5LYJB 2BKVA 1AKVA 4L4RA 5FHQA 3E0XA 2WM2A 3PNLA 2ZT7A 3A25A 3KUXA 4KSBA 4LBYA 2B1JA 1IONA 1TB4A 3MBKA 4L76A 1TK3A 1BFDA 1U63A 3J7TA 5EMHA 1GXSA 1WLYA 4WECA 3TLGB 1JHRA 2JGFA 1KAHA 2OM2A 4Q4JA 1E2UA 3EQ6A 1TO6A 3GRFA 3HJTA 2O1EA 4BKRA 2ZI3A 3NTUA 3IPCA 3ONNA 4M99A 1U7TA 3EY4A 3JWHA 2WSBA 1CQZA 4MQUA 3SLGA 3G2HA 1DKQA 1JBQA 1IG0A 2VG8A 3O26A 4NCBA 2EP7A 3G6EB 1YJCA 3H6HA 1EZ4A 3OSUA 1A72A 4IH4A 4M1QA 4LJ9A 2DKFA 4FHZA 3LW8A 4AU1A 3I58A 4FE3A 4FLFA 4YB8A 1I8TA 1PTJC 4PX5A 3DYVA 2IHTA 1Q84A 1R18A 2QG9A 4LJSA 2W0SA 5TR9A 2PAFA 3IEPA 1OZHA 4RYDA 2IWRA 3ZBPA 4F5DA 4ZMBA 2OQ2A 1LV7A 2BMFA 3L1VA 3LW7A 3WLOA 4E46A 4EB3A 3FPJA 4F71A 3EHDA 4CJXA 1N7GA 3ZEIA 3GT3A 1T3ZA 3B6IA 1EJ6A 2JHAA 3PR3A 4PXAA 3I1YA 2GXUA 5K0TA 3M7IA 1YVEI 4C7OA 2GX6A 2M32A 4JAVC 4DIFA 4FWBA 1KK0A 2VDWA 3R9WA 2PZMA 1K4YA 1ZLXA 5E8JA 4M1OA 1OFUA 2NQ8A 5IYZB 2PEYA 1Q3HA 3P9XA 4J3NA 1QGED 2EP8A 2J32A 2OC9A 3SOZA 2QTGA 2NUPB 3N8KA 1ABFA 3PUHA 3QSGA 4KIUA 3QX8A 5AKKA 3SC2A 3WDKA 1G5HA 1JPJA 1RI1A 3KSAC 2ZTHA 1MGPA 3C3BA 3VV3A 3LQYA 4QGHA 3UVEA 1ISPA 3G2OA 3DG9A 4L4SA 4OB6A 4EI7A 4TTAA 5B7GA 5H8WA 4OXQA 1MOSA 1ZUNB 2ZPAA 1L5GB 3WBBA 1ZW1A 2OAP1 3BRWA 3RYCB 4RPLA 5JWHA 2RKBA 2QMUA 2QJOA 1OWNA 5B7NA 3CC7B 5AVOA 1KI7A 1T9KA 3SQNA 4KQKA 1H42A 3EA4A 3FZNA 4JBIA 1M54A 3LUKA 4RK1A 1C8BA 1L8AA 4WCFA 2Q3HA 4TSFA 2I4NA 1J23A 2CXUA 1TFRA 4JT4A 1XZHA 4WCVA 3VYWA 3F4BA 1R4ZA 3GVLA 4PO9A 2H31A 2ZUSA 3IP1A 4FMCF 4CM8A 4AVZA 4Q1EA 1UXGA 2BFFB 3L7IA 1C5KA 3JU4A 1OGYA 4ZREA 2P8JA 4IIHA 2IOFK 2D2EA 5SYAA 5A3RA 4BMNA 4REOA 2C77A 4LXXA 3ZIAA 2YZ7A 1S4MA 5D1NA 3AM1A 1RWWA 3GN2A 1KZHA 4HATA 2FWAA 1YVRA 3TD6A 2NXNA 4ECAA 7ABPA 2YWCA 1ECGA 1O0BA 4JI7B 1DWOA 1O08A 2C88A 2G0NA 1E1RD 2IEGA 3B1KA 1VIYA 3QX3A 1BJTA 5EWLA 2WU1A 4QTTB 2O8FA 4M54A 4S1VA 3U4DA 4EPWA 4BECA 3DFIA 3U6KA 3DOUA 4IVPA 3STXA 1OH5A 2ZJ8A 3D5TA 2IXGA 1U4NA 3OJWA 4QSMA 3TXYA 4IH1A 3WKCA 4N3NA 1N1MA 3PEFA 1T2FA 4L3VA 1LLQA 1P7WA 5IBQA 1BEEA 2DCUA 1AUPA 4S0XA 4PBRA 4URUR 3T38A 2W4MA 1GPKA 5IYPA 4I1YA 1Y7HA 2OCYC 4IUYA 5KOHB 3OEHD 4IS3A 5K0CA 2XNKA 4PYKA 2O8VA 3OJOA 4LZZA 3W5SA 5KNDH 1XL1A 4AQYB 1W87A 4HH4A 4JGIA 1YZVA 2V96A 1ZL0A 3ETEA 1QFJA 3HVUA 1XJ0A 3L5OA 5A4IS 3S8YA 4Y6OA 4LRYA 1YQGA 5FUXA 1TF2A 3F49S 3RD5A 4DAOA 4OLHA 3FCSB 2Y3IA 2AFIA 3HCBA 2B83A 5FJIA 3U7QA 2X9LA 4HS9A 2HNBA 1H2XA 4ZQBA 1FY2A 1PZFA 2VA8A 3BFPA 2Y4OA 4HKTA 3MB8A 1XRMA 3P27A 5F3WB 2DZDA 3KL2A 1J0DA 1TEHA 3PHBE 2QXTA 3BAFA 4UU8A 3V2HA 4C5BA 3U4QA 5LLSA 3HDQA 3OAAD 2Q5LA 2H9IA 4EG3A 1YDMA 3CH5A 4MWTA 4UPDA 4D0SA 4MVJM 2PX5A 3FUTA 3GVPA 3CT4A 3O4JA 3K20A 1J6UA 4WOCA 4UMEA 4EFMA 2VEDA 3BRQA 1QHGA 1JMYA 1VFNA 2AC7A 3C1OA 4IFEA 2EJWA 3G89A 2DQZA 2JBWA 1YGPA 1T9HA 3LYUA 3WMGA 1JJIA 2VSFA 2QLJA 4QJ5A 1U0TA 2PD6A 3JALB 2BHNA 2H07A 3PHLA 4CDMA 3NBUA 4K9QA 5EUQB 4CIBA 1XPRA 1TYEB 1A9ZA 1ZUWA 1O0SA 1U1IA 3D3JA 3WOHA 4BVGA 2D1SA 4CR7A 2DBQA 1DAFA 2WUWE 4X84A 4D9MA 1RKXA 2R48A 1KSJA 3U1TA 4IWNA 4KXLA 5J2UA 3OTHA 3N2LA 3LRTA 4RIGA 5C1BA 2HZBA 2NM0A 3COZA 2NU6B 2WA2A 3R5TA 2UYCA 4PRYA 4CUJA 3C97A 3V2IA 3JZMA 2BTQA 1BH2A 2XOEA 5J5CA 5JNVA 1O77A 1R6TA 2P68A 2YNMD 4H59A 3SYLA 3Q3CA 1SQ0A 2AEEA 1G20B 2LGJA 2W6ZA 3FOWA 3G13A 3W5IA 4F9EA 4YHHB 2TS1A 5M2QA 4QRDA 1LK7A 4US1R 1Y9AA 2V97A 2GCPA 1U7OA 1HDZA 3KQUA 5AWFC 4XDGA 1VLVA 3DKRA 2BKXA 1PFQA 2ID4A 2YXEA 1DEOA 3E5NA 2AKAB 1BQ3A 1FNNA 3PYXA 4MB2A 4WY5A 4BN0A 4C9BA 3D8SA 1V4NA 3KUDA 2FUG1 2WB2A 3KOUA 1T1RA 2I2FA 4EX7A 3KOYA 2FZKA 5L8VA 1YL5A 3FUUA 1NVAA 2PXXA 4HNHA 1V7CA 3CE9A 5H80A 1E4OA 3H1GA 1NI4B 4FWIB 4JT2A 1BX3A 2AB0A 1SWVA 3CJRA 4PY2A 5TMBA 1L8LA 1BS2A 3OKFA 5JZOA 3MS2A 4B73A 1E3WA 2PLRA 4YRAA 3TLXA 1UJCA 3T99A 3V1MA 1T5IA 4WKCA 1VBNA 1DIOB 1S8AA 4BTVA 3ESZA 3FOEC 2JHFA 3H0EA 5CT4A 4YP7A 1EUYA 2AJ8A 4UAVA 4PICA 1I18A 1BG6A 5D3MA 5EEGA 3ODPA 2GFQA 4P6YA 2QWXA 2ZYHA 3B3FA 2PD3A 4IUDS 1QGAA 4FMCB 5H9WA 4NAHA 3SHTA 5I3ZA 1U0BB 2H1IA 3K0BA 3IV6A 1JDPA 5I47A 1T3GA 3MMNA 4BY9E 3E3MA 4Y6RA 4ZP1A 3O95A 2X8LA 4LZOA 4B09A 1G7RA 1QZUA 1QQ7A 2EARA 3Q11A 1FL9A 2FVXA 3HLKA 3MRXA 2RGBA 5FTNA 1IPFA 1HSZA 3ZUPA 4NE9A 3WR5A 3V1YA 3JQ6A 4RMGA 1UXIA 1RI5A 1WTAA 3O8OB 3SBOA 3T35A 1US8A 3JZFA 2HZ7A 2G80A 3OUUA 3HXOA 3TWOA 4WZBB 1HLGA 3HFJA 2O4CA 3M6VA 1C3OB 2A86A 2YNMC 2R7NA 1COWD 5G1NA 4CIVA 2FPKA 1TZMA 5EY5B 2IS1A 1F38A 4Z7JA 3H19A 1GZVA 1XQ6A 1ZZEA 4I6JA 4JA0A 4UHKA 1JZSA 4DVJA 3M2TA 3T52A 1VL6A 2QMZA 3IE0A 4J0HA 1F5SA 4NPAA 4YS6A 5E6UB 1U28A 2CDNA 2YINC 1Y89A 2C59A 2C9OA 5IYRA 1ESZA 3RYCA 3ECAA 1A9YA 4Y9RA 3D59A 3OF3A 3LQFA 1VC2A 3C8DA 1Z0IA 1U31A 2CLLB 2HWKA 2NTYC 2YJ6A 3A27A 3NIFB 5H3LA 1HA3A 1D9ZA 1ZOIA 4F60A 4N39A 1YBFA 5G0UA 1SC1A 1JG3A 1VE9A 4GQBA 1L4EA 4OCZA 3TTUA 2PKRA 3CGWA 3WL3A 3ZXXA 4NYIQ 4PPGA 4BJ5A 5AVRA 2XGSA 4ZTUB 3OZCA 5T5QA 3CLUD 3TCKA 3SLDA 1Q5PA 3O1HB 4O4HB 4TL7A 4OQEA 2YVQA 3BPSA 2OBLA 4PYQA 1R5OA 4Z1OA 1D4FA 2DT5A 2RCNA 1Z6XA 1DRVA 3SX0A 3B8EA 4XARA 2G67A 1PJRA 5EYPB 4MK4A 1KNXA 1PL6A 1WQ4A 3VYVA 1PK9A 2BM1A 4N7JA 4A0GA 2A3NA 2QTMA 2Y1EA 2L19A 3IX7A 4P1VA 1AE1A 2H63A 3D0RA 4FBGA 1G8GA 1R6UA 4TXLA 3ROFA 2O8FB 4PYJA 3IESA 2ENWA 1BA2A 1YDEA 2ZSHA 3F4KA 3MMPA 2DWQA 2FX5A 1C3XA 1YCDA 2I78A 3PHHA 1UBSB 3HCEA 2W98A 3KE9A 4IDBA 4P35A 1LC0A 2PS1A 5KQPA 2YHAA 3OQOA 2Y1GA 1QP4A 3ZX5A 2Q2WA 3PE6A 3AVUA 1YS2X 3O8NA 2ZB8A 3IUBA 1L1FA 5K3DA 1M0EA 4R51A 2I7VA 2X7XA 3EFEA 4KYVA 1QSGA 3WISA 4FQ8A 2X9NA 1UMKA 2QQFA 3P4UA 1OH7A 1BXKA 1JG7A 4EPXA 2EW2A 3TL3A 1UWCA 3A14A 3W5VA 1CUAA 4ER5A 3MHPA 1NBIA 3O9MA 4LYEA 1JJ2B 1DO8A 1WUIS 2LKCA 3T1NA 1U3CA 4D9GA 4DF3A 5MF6A 1T29A 1VLHA 4DW8A 3O2NA 3KKPA 3TLZA 1UJ6A 1YMUA 1RWQA 2PWBA 3K5HA 2GK6A 3W9YA 1R4MB 3IVXA 3K8QA 1HF3A 1J0EA 1VKHA 3GAZA 3S3TA 1GFIA 2V0GA 1QVWA 4CLDA 2X53S 1U9IA 4DKJA 2JFYA 2QI9C 1WSDA 1Y5MA 4MQEB 3EPJA 1YK1A 5EA2A 3TOVA 3M83A 3WLSA 4CFZA 3PX7A 1SUDA 2A0WA 2PMDA 1IHXA 4Y67A 1JG1A 3TDKA 1ZMBA 3JWPA 9MHTA 2MU1A 4DMMA 1HT0A 3E1KA 2Q2NA 1XSEA 3R7SA 1Z5OA 2AC2A 1GIAA 3K0CC 3MMZA 4D0LB 2C9MA 1KD1D 1K5DA 2NPIA 1BFKA 2R4TA 4J1QA 4QBFA 3V6LA 5LIRA 2VHEA 1FXWA 2XBUA 5P8WA 1D0IA 1X2BA 3SHOA 3BWDD 3G9UA 2QW1A 3EGWA 4PYMA 2COUA 2V7VA 4MA5A 1MOPA 1A77A 3DO8A 4Y6PA 2PQMA 3UJCA 4M9SA 3R77A 3D7NA 4RTLA 1I6LA 1SCUB 2XBMA 1S2LA 3U62A 3IT2A 1B6GA 4KV9A 1BXRA 3DE0X 3SCZA 5ILQA 3WKEA 1Z0SA 1N8NA 1TQ6A 4B4DA 2G9ZA 2FETA 2X41A 3AHEA 5HEKA 3T5TA 4HVLA 2J0QA 2XVAA 4HAOA 2FSPA 1LD3A 5BYAA 4L2IB 4HLUA 4Q1FA 1EAYA 5CJ2A 4DLKA 3KL9A 4PC1A 2AI3A 5K0ZA 1GZUA 3QJGA 3RVMA 1N0UA 4QBIA 1D8AA 4G1UC 1U8FO 1Z16A 4R8VA 3LZCA 4PLFA 5HR5A 3T1HB 1EX6A 2XUGA 5EMLA 1RI4A 1Z37A 2ZRQA 3NBXX 4X60A 3G8AA 2ZJYA 1SOUA 1P39A 4HFRA 4PZDA 1O5IA 1GM5A 2IYUA 3RHZA 3TR6A 1YD7A 2XGGA 3KYDB 4JR0A 1DL5A 1H6AA 1KEEB 3S81A 1K7EB 2MJLA 4E2ZA 3FGOA 3IJ5A 4B6FA 3CONA 4URVR 5ALWA 1T35A 4LS3A 1QMGA 5SICE 2BKLA 5LQKA 2YWDA 1PJ6A 3H0KA 5B3JA 2XMPA 1TU0A 4KIJA 5A3VA 1KTIA 1IEVA 3LFHA 1L7AA 1XZKA 4TQUS 1JDJA 4QQKA 4EYGA 2REXB 5HRAA 1FQKA 2OXRA 2BI4A 1Z4IA 2J3QA 3HBNA 3D6JA 2GA8A 3O9VA 4GI5A 2H2GA 2AEJA 3ZW8A 2VCYA 2VT7A 1NBMA 1IY2A 3IC5A 3SR3A 1D4ZA 1C4OA 1SXHA 4BX9A 1SKYE 1MTOA 1WV1A 2I1WA 4W5RA 1Q17A 4I4NA 2W2PA 3L8HA 4KN6A 1WW2A 1G16A 5DT2A 4RJIA 1KQFA 1NY6A 5KQSA 1HXHA 1UKEA 1QFMA 5F7XA 3RRYA 2QUKA 2QLFA 2UKDA 4P3NA 4D9IA 4UVIA 4K86A 1FLDA 1EQUA 5FYQA 1E2IA 2X76A 4WT7A 1LF0A 1U9YA 3DEJA 3LCMA 2RHMA 4HNRA 2YY5A 4EJSC 1TEZA 4PPQA 2CC2A 4L22A 1GAJA 1N0WA 2OORC 1US8B 1C41A 1H23A 2P9QA 1P62B 1DAIA 3ETHA 1VYUA 3HU5A 5D5QA 5SZJA 1Z56C 3U37A 1ZGAA 2CV1A 5L4NA 4RNCA 1NLMA 2B69A 4X1IB 1ITZA 3QMVA 4RV5A 4WE3A 3VC1A 2Z4RA 4TN5A 1UANA 1DNPA 2NT4A 3OPVA 1QH8B 1VIVA 3SZOA 2Q9CA 4GUAA 3V8BA 1JHOA 4YAUA 2WJ4A 1IBMB 2WILA 1OLSA 3ZCTA 3ZZ0A 2IS4A 1L7DA 1H85A 4UVGA 2EDCA 5KPDA 2JGAA 3M1YA 4G9EA 2XITA 1MHTA 4OFZA 2CV0A 2EG9A 3GA5A 2JGNA 3HNRA 3U4MA 4B3BA 4EKGA 5IDXA 1NBOA 3QXGA 2XTJA 4D0NA 2FGJA 3C7CB 4R2HA 1VQ8B 3AUUA 2IXBA 3E82A 2JGMA 4M49A 3WHKA 3DEFA 5JD4A 2ZI4A 5BSXA 4Z2YA 1IJKA 3WDSA 2BI7A 2XLCA 1EK1A 3IOEA 4J0CA 1KDRA 4Y2XA 5CBKA 1NN5A 3PQFA 3L0BA 1IHMA 3SX4A 2NXWA 3W8DA 3W5BA 3C6XA 5EYPA 5KWEA 5EKTA 1YB6A 4A0FA 3LDUA 5KTMA 4DJAA 3FWKA 2HADA 3WZMA 3B52X 4BUCA 1R66A 4RM3A 2QTRA 3UWMA 4WZAE 3I2IA 4H3VA 4IIBA 1NBEA 4C4OA 4FJ1A 1A5TA 4NAUA 4YEDA 5MFPA 5K0EA 4HUTA 2JFGA 4CFSA 2FSIA 5BV7A 2VRCA 4RUKA 3SS7X 4B6GA 1H4TA 4LHEA 1U7DA 1ZGBA 1NW9B 1XMPA 2X22A 3CX3A 2VJYA 4PFJA 3SPXA 1L3CA 4F12A 4GKJB 3MIIA 3GQBA 1TKBA 2BCEA 1AVTA 3FNFA 2QP9X 1YI1A 2XB4A 4N0EA 5AW9A 1X6VA 3RYIB 4HAUA 4CLEA 1E61A 4I50A 4MJLA 2FGKA 4FPXA 4UTNA 1PJZA 2RGUA 2W2XA 1D6SA 2FWIA 4TTRA 1Y5RA 2UZ1A 2I03A 3D02A 2C7BA 1UL1X 2XD4A 3NEPX 4FGWA 1FDSA 4LGYA 4YRIA 3BA1A 2VYFA 3WSWA 1ZM3A 5GAJA 4IQ8A 1AKTA 1RYMA 2JD0A 2YICA 4L1KA 1UZUA 1LBTA 4UD2A 5B1DA 1N05A 4NC9A 2XZLA 3ESAA 1WSRA 1NVEA 1W88A 4CM4B 4X64B 4HQKA 1KZ1A 4O5AA 3T7RA 1XLWA 4R7GA 4FGZA 3ASPA 2YBDA 2ZVDA 5HIMA 2ZANA 3SWWA 1NQVA 2XCRB 4HWTA 4PSCA 2V0NA 3TSYA 2HJWA 4XYLA 1EESA 1P5ZB 1P9RA 4OXNA 4D3SA 3DPIA 4YJ3F 3BZWA 5BSKA 2DWUA 2OGZA 1MLDA 1VXRA 2D9RA 2IZ1A 3BFVA 3L4SO 1U8EA 1MTZA 1KYTA 1FU4A 3NP7A 4V2UA 3WIBA 5C51B 4NPCA 1GITA 2CLFB 3CMEB 4R2LA 3ACBA 2C5BA 1T8PA 4HYEA 4LI0A 3UANA 2TMKA 4K1XA 1KH1A 3CH7A 3Q39A 5FBHA 1GVNB 4RSGA 1A8SA 2KI5A 4YAFA 1NWCA 1V6CA 3ELYA 1Z08A 3K15A 3QITA 3QKTA 4NHOA 3UH0A 5KYTA 5F3DA 1BDIA 1X9HA 4TKUA 2DG2A 1TYZA 4KDFA 2QRZA 5KBYA 1QOZA 1SCUA 2CWWA 3JYPA 4MUEA 1E3LA 4Q0MA 1D8TA 2NUAA 3WC4A 4PZZA 1T0UA 2CHVA 3JAKB 2ZJ4A 3X1XA 1ZEJA 2R84A 1WUHS 4EY4A 2VHCA 1HFWA 1GUDA 5G4KB 1FQJA 5BQ5A 4BLQA 1RCTE 4MKIA 5CD9A 1DMRA 3E5RA 3KR0A 4L6CA 3T9BA 1VL1A 2Q3BA 1Y9EA 2BKUA 2V8BA 3WRVA 2UUPA 3SM9A 2Z04A 2C4VA 4ONEA 5T64A 4XKWA 5JC8A 1N1DA 3GEMA 2JN9A 1IEQA 2FOIA 3DKVA 3VUFA 1HRDA 5AOVA 1O03A 2X2EA 3H86A 2A94A 1KDZA 3DF7A 3KLPX 1XEWX 2ATEA 3NHAA 5ALPA 1NFFA 4WBSA 1DELA 4C30A 3KQPA 5MGNA 3JWEA 3LZ6A 4GSYA 4JJ4A 3TIFA 5EPOA 4IHJF 4YRBA 3O3CA 2GXAA 3KTFA 4F4DA 1OFTA 3MAJA 5J35A 1U9CA 4HPJB 5DZSA 1O9HA 2XEXA 3ZQKA 1V43A 1H2FA 2GD1O 1Y1PA 2JLQA 4JELA 4FFBB 2H4JA 1A7UA 4DLUA 3KKMA 3VV2A 4Q82A 1IEWA 3ADPA 2Q45A 2ZTUA 1H0SA 2QG6A 3BGWA 5FX2A 1XCLA 1WVMA 3F67A 3UAWA 1LNZA 2FPGA 2XWSA 1GQQA 6REQB 4EY8A 4TLDA 3EX7C 2ZR7A 2QHXA 1XTTA 2PIDA 4OUDA 3ZY3A 1SA0B 4NMWA 1KP3A 3OVMA 3AKDA 2WU4A 5DMXA 3KVYA 4XM0A 4Y1RB 5DX0A 3ZE0B 3TAUA 4E7PA 3I3OA 1EFPA 4KTVE 4WFJA 4BASA 2CEAA 1E1YA 2VUIB 4ZCMA 2OFPA 1DCTA 4OU4A 1KXJA 4JXJA 3QE9Y 1E6WA 3UJ3X 4UPVA 4IIJB 2LVBA 2Z2JA 3I9NA 2OCBA 2Z0MA 4OTZA 2HU7A 4TKVB 2YJ4A 5FOUA 4QREA 3EC1A 2W83A 3RS2A 5TSDA 1QK4A 4EHAA 3I6IA 1M6NA 4H7EA 4K1LA 4D2IA 2JHPA 1CFJA 2H8KA 1MEOA 3BMXA 3GFFA 2RKWA 3O21A 3QOWA 4NBRA 4ZTZB 3G79A 2IUFA 4F72A 3IJPA 1UBEA 4C88A 5BMVA 2ZDQA 2JVJA 2BAGA 1L5HB 2EW1A 2HRCA 3Q2KA 1WWKA 4EPVA 2VHZA 2J7PD 5FOWA 3UH1A 2BGNA 4N5IX 3ZQUA 4BJ3A 3CNEA 1CUIA 2IQIA 3OIGA 3VFDA 1JSRA 3X1WA 2Q7XA 1BU5A 3A35A 4Z1MA 2ATXA 4HAWA 1SD1A 4OD0A 4CIWA 4I4IA 1YIAA 4LGVA 5IRCD 5CW2A 1WW3A 2PRIA 4FDMA 5ALXA 4PQEA 3QY0A 4US0R 1TGVA 3V76A 1JKFA 2Z8YM 2ABWA 3E3AA 1DIRA 2WHEA 2QXUA 4L73A 4YONB 1IB6A 1OLXB 3IKTA 3A6EA 3NUGA 4MJ7A 4BU0A 1L6IA 3TL2A 3VKUA 1V9LA 1QKKA 1T2NA 2AUMA 1FC0A 1PZNA 1B6TA 1BYIA 3ESRA 1XGKA 4LNUB 5FBQB 1BKYA 5GOTA 5DYTA 5KHAA 1L5LA 1U6KA 4BO1A 4B3JA 5A1TA 5FNZA 1A69A 5COAA 2AQHA 2P3QA 1JQEA 4ZRDA 5EZSA 3THOA 3QPUA 1YB7A 4UNPA 5EWMA 4GX0A 4DM7A 1CQJA 2X8JA 3A70A 3SYTA 2HT6A 1JN0A 1EM6A 1I5RA 2QVXX 3CUUA 3GMIA 4BLPA 3L0YA 3Q38A 2G6TA 4K2HA 2YDYA 1JW9B 5COBA 3NG1A 1RWVA 3VBCA 5AW1A 3FTEA 2CDRA 3T5AA 1DTEA 5AO9A 2EEPA 3I0NA 3WIUA 3D8UA 5E0KB 2OGWA 4PF1A 3C5WP 3TVDA 3V1KA 4EGAA 4F21A 5HZGA 1FDWA 2O8BB 1TK9A 1Y48E 1GJRA 4MGHA 1VQNB 3LUGA 1IULA 5EZYB 4BCDA 1EK6A 1P29A 1BJKA 2M5SA 1AT1A 2BLLA 1GOTA 1LEHA 4HQ6A 3A1VA 5TT1A 2HCTA 2NLOA 4JI5B 4XEUA 4IVQA 4U5XA 2XKBA 4JCOA 1CNEA 1HYQA 3DBHA 5H3HA 2JZCA 4J4TA 3RS9A 1LI4A 4RM0A 1N2ZA 1YBMA 5CFRA 1G8HA 4I5IA 5KO2A 3VYUB 4WJLA 3R5FA 1D0VA 5KTNA 2Y2VA 3BBLA 2Q4RA 4IZOA 2WD8A 1J2RA 1C30A 1T0BA 2FJUA 2WTAA 3DVLA 4AZVA 3EPKA 1GGEA 3EEYA 2W48A 3AX6A 2QTFA 3DOJA 3WO1A 1K4KA 5DNUA 1VHDA 3GVCA 3ZPXA 2XDWA 1WCIB 3H4MA 3OFSA 1ONBA 4JL5A 5A5EA 4MAAA 3I6YA 4NDZA 1IBKB 2R5WA 5LMUB 4DHEA 3SIRA 3UHOA 4C0AC 5LZ4A 2EFEB 1XP5A 4XOPA 1DIBA 3DV0A 4WBNB 2SCUA 1OAAA 1OKKD 1WEKA 2VJOA 3HXLA 3I2GA 4U7TB 3TG2A 4QUIA 3H17A 4RL6A 4DJ5X 2GM3A 3SU8A 1QCYA 1XYVA 4D1YA 3WKBA 5DNAA 1YQTA 4Q4JB 2CMKA 4ZI7A 1LPNA 3RNOA 1L8OA 2VPYA 3OMWA 2RD2A 4O4IA 4QBGB 3TDMA 1F4PA 1FFBA 2QENA 4JQOA 4YRZA 5ES4B 2Q1YA 3UJNA 1PLJA 1TA4A 1Y7TA 3F3YA 4XJTA 5IT4A 3FUWA 1LV8A 2BGTA 4BFSA 5HNKA 2GJPA 2BTEA 2NQTA 1FTWA 5CDFA 1Z28A 4P38A 1UBTS 5BN3B 1TVCA 1QHHA 2VJMB 3BIWA 4W99A 3RRNA 4CU5A 5AVVA 4WADA 1AIPA 1M0SA 4KWIA 5JAOA 2WG1A 2H4ZA 4U8HA 1VMIA 4O4JA 3I9OA 2VPQA 4TYNA 4NK5A 1F2DA 1SUEA 3CLRC 4IZHA 5LR6A 1R9JA 4O1HA 4FZJA 3UOGA 4YREA 2QL6A 1JE1A 3EZGA 4C1NA 1HLDA 2BM9A 2WUGA 4O33A 2VTBB 2QPOA 4K9LA 3STTA 2FOXA 3N5KA 1C29B 1PEAA 4E2WA 4HNAB 5T6MA 2OSBA 1W0JA 1AHPA 3FMPB 3IKVA 4CKWB 3R7WA 3E9NA 3FBGA 4EFDA 3TB6A 3PKZA 3OTWA 4L02A 4QDUA 2ZE5A 3PJFA 4I2VA 3SQXA 4PABA 4PAWA 3VOBA 3R3SA 4CN9A 1SD5A 5DM2A 2RI0A 4LBZA 3LVRE 2C9DA 4I4TF 2GM4A 1Z22A 4P81A 4HQNA 1ACJA 1J99A 3CZRA 5BP7A 2M1XA 1Q86D 4F11A 3S68A 2PMFA 1ZFNA 3OIYA 4Y1RA 2BFNA 1BH6A 2V65A 2PLNA 3A6HA 4H60A 4W1PA 3TQIA 1PWYE 4R69A 4XD2A 2IHBA 4IVRA 2E85A 3I39X 5AJTA 5HMLA 5H1YA 5AM3A 3MT9A 3MUOA 4MUAA 4BP3A 1JLLA 4F4HA 3U5TA 2AKEA 4G2NA 3QU7A 1LQ2A 4BFXA 1L4MA 4FS8A 3TSWA 4JEUA 4ZZIA 1BDJA 1VP3A 2P2NA 5AM1A 4G0ZA 5L95A 3AFMA 3K0FA 2ZW9A 4FDAA 2AI2A 2NTVA 4PANA 4ZVUA 3RY8A 4H1VA 4PSDA 2ZWAA 2P3MA 1DIHA 1FSSA 3UUEA 4B6QA 3IV7A 2I1LA 2ZJAA 3PEVA 2EJBA 5FWAA 3SKVA 1H65A 2R6GA 4PQGA 3VZBA 2AG5A 3MTBA 2DHRA 1GL9B 4YJ3A 4EHKA 1E7MA 4QJBA 4DEXA 5LBTA 3WDMA 2H4YA 1AX9A 2IPLA 3R09A 4JJ7A 1H0KA 4PZPA 4YC7A 2VTVA 5DCWA 4ZVMA 4BFTA 1XZLA 3Q7QA 4EAQA 3QG5A 1OA1A 1KOJA 3ZGNA 2B78A 2XA2A 2M6LA 4UNRA 3HN7A 3K6KA 2BMEA 1PL0A 3K0EA 5CA0B 2IXDA 3PFGA 4DHWA 4YPOA 2XGJA 3SYRA 4PGHA 5JSZA 4OHKA 1BROA 1RRFA 4OV6B 5DYIA 4RZ3A 3RUCA 3TSOA 3VBEA 4ESOA 1NI5A 4ASUA 3OX3A 2JRLA 4KLAA 4AXXA 3VNRA 4HRAA 2WE7A 4Q3DA 4RLSA 2WHPB 3GMSA 4L7VA 3ZWKA 1U8UA 3EEIA 1X1CA 1Z5GA 1ENZA 2CBZA 1JXAA 4TOIA 3NHRA 3FRIA 3AEXA 4XEHA 2JIQA 5D85A 2ZQYA 3CLSC 3D2LA 1RR6A 3WK5A 5KIAA 1Z8DA 4RLZA 1LPBB 1QO0D 1X0XA 2OD7A 4O8ZA 1GR1A 4ZI7F 1JLKA 1HTBA 2H1RA 4JB8A 2WG0A 4W4TA 2IP1A 3EMVA 4JI8B 4NOLA 4OLBA 3PGJA 4JNCA 3WS7A 2OD9A 3OZWA 4FJ0A 4MUFA 5CH3A 1PGQA 4AMVA 3SVTA 4HAVA 3QLUC 4H9GA 5FBRB 4BNFA 3ZHQA 1KRHA 2D5AA 2E6UX 2QX6A 5L3SB 2RK4A 4Z4HA 4TV9B 1HE4A 1LQTA 3VAZA 3VKWA 1A2OA 2B1GA 5EZYA 1XMSA 2QN9A 3V7UA 1GTMA 5IYZF 5JYCA 1AUQA 2JFZA 2ROQA 2ILVA 1ISIA 2A5JA 3II6X 4DCNA 2OXTA 3I62A 3CO0S 4XX0B 3KQLA 2VBUA 1XZDA 3HYTA 3N7AA 1HC7A 3E5HA 2HPZA 3HJAA 3KD3A 3A3NA 3P7MA 4G1FA 1YU9A 3E8SA 5EUBA 5EIOA 4F3CA 4F86A 2ZUWA 2I6QA 4EUKA 5FP0A 4YV2A 3SXJA 1TIKA 2Y93A 4FOOA 4G6IA 1PAUA 2ADMA 3OPYI 1EEHA 4RQBA 1OLUA 2NYVA 4LV6A 1HE1C 5EKSA 1M1NA 4V0ME 4I9FA 3T4XA 4BFWA 5C5EA 5HQTA 5IVPA 3K1AB 5G2OA 1NDHA 4EG1A 1N2CA 1V48A 1EWYA 3GUYA 3H94A 1IYZA 1DUIA 4B3CA 1SULA 4NH4A 1RWKA 2HQSA 3K9CA 3PWKA 2GO7A 1Q1EA 3GSIA 3BK1A 4DIOA 1UWKA 2WIGA 4RXTA 1P0MA 2J6IA 1PFWA 2IUEA 1FQOA 1QLJA 1Z7EA 2QRNA 1N2GA 2ZYGA 3GLQA 5A9SB 2QGNA 3SDSA 4EFNA 2GD6A 1CQPA 2GDJA 1YT5A 2HK8A 2WWVD 2D1FA 1JEQA 4FFPA 4B34A 1CZRA 3OIFA 4JYPA 2WOJA 3MJHA 3LXUX 4KMMA 3EBLA 1F6BA 4OHBA 1S8OA 3WSTA 2QE6A 2GEFA 2ZS9A 3ND7A 2QL7A 4M89A 3S2UA 3NWEA 3EASA 2C3MA 3KUKA 1VKOA 1XI2A 5AKZA 1UD5A 2E2WA 3J7AC 2E6KA 3B1YA 2H52A 3I9V1 3HBFA 2D5BA 2XQGA 4MS1A 4QX6A 4RK5A 5CK4A 1X7XA 2X14A 3EVAA 1SN7A 1XHLA 4LJ8A 2O07A 3VJRA 2CNWA 1NNUA 4RSMA 3ZY5A 3G5LA 2D7CA 5EIHA 1ZSNA 2WF9A 1UD6A 4BB6A 1LBSA 1IY0A 3ZTTA 3O90A 4K0RA 2BFOA 3K4QA 1V5IA 1R0XA 5DMHA 2QN7A 3A9TA 3G88A 2GBLA 4A5SA 1P31A 5T7BA 5DE3A 1O89A 2VEOA 3PGA1 3C43A 3CO5A 4WJKB 3E3OA 2PV7A 2YRFA 3R7WB 4UFPA 4HH0A 4Z7QB 1JIJA 1K0UA 1VRCA 4OFWA 4QEDA 4U2CA 3R0IA 3TKAA 4YUWA 3L0SA 4Y9TA 3REOA 1VJCA 2IITA 2V6GA 3GNQA 4OFBA 5F64A 4IV0A 2MSEB 2QM3A 1KE2A 3UHAA 3HKBB 1NU6A 1JIQA 3A0UA 4B3MB 5DGHA 3OD1A 1ZYUA 1JA0A 4ZCQA 1RACA 5T4HA 3RK4A 3AJ9A 4GLBA 3S7ZA 1T3TA 4R2IA 2VQSA 5AK0A 5BQOA 5ALQA 3RTAA 5TIIA 3B85A 4FD2A 2C9ZA 4OYHA 1UZNA 3WGQA 3DZBA 2VSQA 3LUBA 1L5NA 3ZWQA 4ATNA 1WB5A 2LPMA 4II7A 2FTKE 4PTLA 1I3LA 2V45A 3MMSA 1CXZA 1YRBA 4DMFA 2V5AA 6YASA 1E2KA 2AX4A 1MOQA 4MQFB 3RV4A 3A3YA 4MCIA 4JVMA 4P4TA 2WYOA 4RANA 5DXAA 1DTWB 5B36A 3MJFA 2WUFA 1NVUQ 2GLTA 1D2MA 1MRSA 3SYMA 3K9BA 4OY3A 1YHZA 3ZDRA 1OB5A 3S99A 3Q6NA 1LPOA 4YR7A 1MEJA 4FW9A 1GYPA 4RZQA 2FPIA 4O2AB 2PYDA 1W34A 1KAQA 1PT5A 2JH9A 3B9PA 3T0IA 5FWYB 2ISQA 5JLJA 2I34A 2AJCA 2R6CA 3EJWA 4TMTA 3HY6A 5DNWA 4MUGA 1B0UA 1KBZA 3RGWS 3H5TA 3T5BA 1R5NA 4WASA 3ZWNA 1QF9A 4CG3A 4ODIA 4KODA 3H3FA 4QQFA 1A8QA 3CW9A 4ZQFA 3GC6A 2PH7A 5E38A 5BW8A 3ELBA 2P7HA 1G41A 2X9GA 4DN6A 1R12A 2JH8A 4BCCA 1W94A 1BQ4A 3OZBA 1SC3A 1QYRA 2ZSBA 4X45A 1WD7A 4O4LA 1WD5A 3SG0A 3NOQA 3OZTA 4XN3A 2I7DA 3QPBA 5AP9A 3OE7A 5GJCA 16PKA 3IIEA 3AF6A 1L7RA 3U31A 1Z75A 3N8GA 2ZRMA 1BXGB 1G3UA 1DFIA 3TTVA 1ESNA 4H27A 5AI9A 1GV0A 2WJVA 3QXHA 5JY1A 2HF7A 1N5OX 4ZMSA 5HBGA 4Q9JA 1OIXA 2ZM5A 2QSJA 4X7EA 2BRUC 3KEWA 2QNIA 4KX3A 1B8VA 1CTQA 3T7TA 4CHGA 3EGDA 1XLUA 2ODTX 3VMFA 1Q7TA 3TZBA 1N2HA 1JI0A 3U0BA 1LU9A 2ZIXA 4DPKA 1Z73A 2FFRA 3EGXB 1RWPA 4IICA 1U0SY 5HIKA 2WJYA 5ADUS 5DULA 1UD3A 5TGTA 4CQNA 4BV9A 2X4DA 2WW8A 4WVFA 4IOLA 3DA8A 5F9FA 1OREA 1QM5A 4AO7A 5KEIA 1AB6A 3K72B 3OJLA 4KRGA 4JI1B 1PZGA 3WK4A 3T61A 3A1FA 2BFPA 2WPDD 4EGFA 3CTPA 4IG9A 3ECCA 3OE4A 1NPDA 4WD3A 2FB9A 3BVPA 3IAS1 3CCCA 2GHIA 4CLOB 1P7CA 3E35A 3LXMA 4YRSA 2CRVA 3DE5X 3CUTA 3FDIA 3NVDA 3UWKA 2YTZA 4AS2A 1N34B 1BJRE 1FTNA 4RQAA 4XLCA 3VKGA 5F1OA 1T6ZA 1QZTA 1YQEA 3RRMA 4PZEA 2P11A 2XVMA 1BWPA 2GN1A 1U1DA 4J0JA 3UCFA 4B79A 1YNOA 4RD6A 1IJBA 1EVZA 4LYYA 2WZBA 1JILA 4MWDA 1Y4UA 2ZRBA 1C7ZA 4FBMA 1D2RA 2X0JA 1ZP6A 4X92A 5FD8A 3TPCA 4E6PA 4WA8A 4GKKB 1Z6YA 1COZA 1BXRB 1LSUA 5LQDA 3RRBA 3TX6A 1FX1A 1NASA 3FYUB 4GI3A 1RYNA 5A5VA 4I6EA 1VDMA 1MDBA 3ETGA 4Y6GB 5KAPA 3P2OA 3STVA 4PQYA 5FPKA 3BQJA 1FP1D 3MSXA 5HQJA 3W3AH 4E31A 4JL8A 3F7OA 1W9HA 4HYQA 2O2EA 4LHXA 8AT1A 3IQDB 3L9XA 2WR8A 2FMTA 4NQRA 2C94A 3LBIA 1II9A 1XD2A 3D6MA 3ILVA 5ITSA 3U19A 2SICE 521PA 2DM6A 2QIOA 2PUBA 2OO7A 1JEQB 3R8CA 2CVZA 2KWIA 3RADC 4ZOBA 3MT0A 3MWKA 2PJZA 3UWDA 3Q72A 4M87A 4KH1A 2Z6BD 4YBZA 4AY5A 5C32A 3T3IA 1IWBB 2J1LA 3LT1A 1LFDB 4JJFA 2P9CA 4B35A 4JXXA 1BO6A 2P7IA 4EY6A 5EJEA 1L5QA 5C18A 3JYQA 4H7FA 3ZWBA 4F4UA 1GYQA 1T3HA 4OL0A 2F55A 2ZBQA 4IYJA 3DQPA 2XTZA 2IUUA 1F17A 5K6RA 1CUCA 5BMOA 3PD7A 4XM2A 2QLLA 5BXYA 1OYYA 2WB4A 4OQXA 1L5YA 3BULA 2WJZB 3NHUA 4F4IA 4GR5A 5AM0A 2JHGA 2LW7A 4DYHA 2QJTA 1OYWA 3FPEA 3JARA 4G01B 2A59A 2BMJA 3KDPA 4NECA 3WIEA 2EL7A 4R1UA 4CMGA 3IQWA 5AW8A 3FN4A 1E9EA 1RVV1 2QZ9A 4LVNA 2O2SA 2A9FA 4PYRA 4R9UC 2GAAA 3PUJA 1NL3A 2B2CA 3VZQA 2VPIA 1DB3A 5I9TA 3E9CA 3BHIA 5IUNC 3H16A 2X0KA 4XR9A 1NQTA 2YZ2A 4KX5A 2X0DA 3WIVA 1T4CA 3G59A 1U2PA 1DI0A 4NZ9A 2ZIEA 2AR9A 3X1JA 5JY6A 1NTOA 3R6LA 4MYCA 4TLAA 2E49A 2QBYB 3U0VA 3WA6A 3ASQA 1DBIA 3E84A 3I92A 1KMHB 1QYXA 1A2QA 5AN9A 4B75A 1DJQA 1HKHA 4UHBA 4A6XA 4HAYA 1KETA 1T36B