1A8PA

Ferredoxin reductase from azotobacter vinelandii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
257
structure length
257
Chain Sequence
SNLNVERVLSVHHWNDTLFSFKTTRNPSLRFENGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVQNGPLTSRLQHLKEGDELMVSRKPTGTLVTSDLLPGKHLYMLSTGTGLAPFMSLIQDPEVYERFEKVVLIHGVRQVNELAYQQFITEHLPQSEYFGEAVKEKLIYYPTVTRESFHNQGRLTDLMRSGKLFEDIGLPPINPQDDRAMICGSPSMLDESCEVLDGFGLKISPRMGEPGDYLIERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of NADPH:ferredoxin reductase from Azotobacter vinelandii.
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords NADPH\:FERREDOXIN OXIDOREDUCTASE
total genus 76
structure length 257
sequence length 257
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1a8pA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1a8pA02
2NPFA 1Q7YD 5FA6A 2DY1A 1R5NA 3QFCA 4TMVA 3G71B 1YJWB 2QTZA 1XE1A 1VQ6B 4FK8A 3QE2A 2FX3A 3FPKA 1EP2B 1KK0A 2EFGA 3SJZA 4B3XA 1FNDA 1KK1A 3B8HA 3CD6B 1KC8D 4P6VF 1EFCA 1K9MD 4YAUA 3E1YE 4PC1A 1QGAA 3G4SB 3CCQB 1YHQB 1Q81D 1F20A 4ZGQB 2CRVA 3QFTA 4WQMA 2QEXB 3WBKA 3I55B 1E64A 1N0UA 4ZCMA 3CRZA 1W87A 2HDNB 1JB9A 3FJOA 3OZWA 3MHPA 1TUIA 1OB5A 1BJKA 1YIJB 2VNIA 4M1KA 1AIPA 4B43A 1SKQA 3WY9A 2C78A 4M53A 2OTJB 3AVTA 3OZVA 2QMUA 3B82A 1ZM3A 3LVBA 1GAQA 3CMEB 1FNBA 3PENA 3U6BA 1KK3A 1M90D 4YHBA 1H42A 4M2LA 2VNHA 3CCJB 2HMAA 2OTLB 1NDHA 2E1RA 3MCAA 3ZBUA 5TR9A 4MYTA 2PIAA 4QFMA 4AF7A 5AN9A 3U2QA 1R5OA 1ZM9A 1FNCA 4F7DA 4PC2A 1YJNB 3I56B 1B2RA 4TMWA 1QFJA 1D8TA 1F60A 3QFSA 1VQPB 4B4DA 2OK8A 4ZCIA 1U2RA 4G1VA 4HE5A 3B78A 1VQLB 4YAWA 3AVVA 4YAOA 1EWYA 3CCUB 4ACBA 1E62A 1TLLA 1EP3B 4R71A 1QVGB 3AGQA 2BVNA 1QGYA 4Y9UA 3P27A 2HCJB 1M1KD 4BPRA 4K1XA 1VQMB 3CPWB 4RJLA 1VQ7B 4AF6A 1I7PA 1W2BB 4QHYA 2RC6A 3W2IA 5THXA 5TY0A 3ZZUA 3CC4B 1K73D 1QH0A 4M4SA 1OGJA 1ZM2A 1HA3A 3WNDA 1B23P 1QG0A 1CNEA 4ACAA 1DDIA 5EMNA 1VQKB 1BX1A 4PC7A 4RD1A 3WYAA 1ELOA 3W5HA 1FDRA 3G6EB 3W2GA 1QGZA 4M0LA 4RD2A 2BGJA 3AVYA 4EH1A 4Q7JB 2DCUA 1IB0A 1Q82D 1KQSB 1NJID 1DG1G 1G7CA 3CB4A 5JBQA 3LYUA 1UMKA 1YITB 2GQFA 1BQEA 1ZUNB 1VQNB 1GJRA 3JQRA 5GV7A 4YALA 1JNYA 4YAFA 2C77A 1H85A 3ZZ0A 1QUEA 3VO2A 4TMTA 1VQ4B 1W35A 1KRHA 5DSZA 3LO8A 1QFYA 2D74A 3WNCA 1EP1B 2YWGA 1GVHA 2B5OA 1R5BA 3A1FA 4DQKA 1GO2A 3JQQA 4ZGNB 1XB2A 2QN6A 3OJXA 1Q86D 3WBJA 3CXCB 3ZC3A 2XNCA 1N0VC 3ZBTA 3JQPA 1KTVA 4HE6A 3LRXA 4ZV4A 4G5GA 1W34A 3V76A 1ZM4A 5KSWB 4FWTA 1CQXA 4PGOA 4PC3A 1G7TA 3J81k 2PLFA 5TV2A 2QA4B 1BX0A 2DEUA 3ES9A 2DERA 2QDXA 2VYQA 4LC0A 2PMDA 4G1BA 3WXMA 3QFRA 3OJWA 1S0UA 4LBZA 1TTTA 4J0QA 1VQ5B 3AVUA 1QVFB 1VQ9B 4B44A 2BPOA 3E20A 3VNUA 1G7SA 4MYUA 2DETA 4NBSA 1OB2A 3CW2A 2AHOA 2BN4A 2XEXA 5HXBA 4AC9A 3CC7B 2VNKA 1N8RD 4NCNA 1S72B 3QSYA 2BV3A 4ZCLA 3VNVA 1EXMA 2YWFA 2BMWA 1VQOB 4B47A 3W2HA 1A8PA 4TMZA 3CCMB 4RD6A 1VQ8B 3CCLB 1EFUA 1IJEA 3P26A 3CMAB 4Y7CA 1OGIA 3CCRB 4RD3A 4FN5A 3VO1A 1QX4A 1DARA 4LBVA 5H5JA 1WDTA 4U9UA 4RD0A 3W2FA 1QUFA 1KK2A 1GAWA 3OW2B 5GV8A 3WNBA 4TMXA 4TN1A 2EIXA 4N3NA 1KJZA 4C43A 3W5UA 4RCYA 2BM1A 1AMOA 4N3GA 4LBYA 5H59A 1G7RA 2J7KA 1SM4A 3AVWA 3CCSB 2X3UA 3VMFA 4Y9RA 2B7BA 3AGPA 2VNJA 3AVXA 3U6KA 1FRQA 1FRNA 2CNDA 3W2EA 4H9GA 2RC5A 2BM0A 1IJFA 4IW3B 2OK7A 4UAJA 1JA0A 1D1NA 2VZLA 3I1FA 4B48A 4P3YA 2BF4A 3MMPA 1EFTA 3ZZTA 2GPJA 1K8AD 4PC6A 1YJ9B 4LBWA 4RD4A 1J9ZA 1E63A 1JA1A 3OZUA 1YI2B 1JJ2B 2B7CA 2ZITA 4DQLA 4RCZA 2XNJA 1KD1D 1QFZA 1TVCA 2BSAA 4C0SA 2YWEA 1DDGA 3CC2B 1FNMA 1D2EA 2QTLA 3W5VA 3CCEB 1CNFA 2BGIA 1GR1A 2YWHA 3CCVB 2R6HA
chains in the Genus database with same CATH superfamily
1Z15A 3TCKA 1QVRA 4KKSA 1SVIA 2QVBA 4K46A 1GV1A 1NYTA 2WT9A 4HAXA 3TTXA 4BVJA 1CS0B 5ICMA 4TRJA 4U8HA 4R4JA 4DTCA 1ZAYA 3C4QA 3NHFA 1JKIA 2N1MA 3A7EA 3RUDA 3ZWNA 1TYAE 5K3AA 1U2GC 3GIWA 4A1OA 3DMRA 2H7CA 1OIXA 1W75A 3LT5A 4CV0A 4EKGA 2WVJA 3D5EA 1W4ZA 4AT1A 2VBVA 3HR7A 5JQGB 3I62A 2MJLA 3SS9X 4AP5A 4CG2A 3KQYA 5E4YA 2QE7D 1VQ6B 4A10A 3AHCA 2HMUA 4FHZA 1O89A 1X80A 1EWRA 4IKOA 1CY4A 2WWWA 5I7FA 3RYCA 4DR1B 1WXFA 3NIBA 3DKKA 5E9JA 2C94A 2IYUA 4GW3A 1ULSA 1YOVB 1KK0A 4XXHA 3BSYA 1PAUA 3AQIA 1UMCA 2F8LA 2GO7A 3KJEA 3GH3A 4G5QA 4IWNA 2AZTA 2AUTA 4KDFA 1BKSB 1JJVA 2MMGA 4Q7EA 2G5GX 2CDBA 2WU1A 4PS1A 5I47A 3WP1B 3D4IA 1RPTA 2ZR7A 4YUWA 3JAMA 2AK2A 5KQLA 1E79D 4DDHA 1XKQA 4IDGA 3D4LA 3SC2A 3G4SB 2OAP1 4I9FA 1AXRA 3QE0A 4I08A 3ZLUA 1MJNA 4M1MA 2A94A 2IEDA 3ESXA 1BGVA 2P2YA 3LF2A 3N6XA 4NNPA 3UWPA 5ALHA 1DUSA 1N4DA 1QS0A 2G36A 4GT1A 4AXBA 4WY8A 4BASA 2V9PA 1ZUD1 2XUJA 1EQUA 4Z6KA 4ZTZB 1MA3A 3HDQA 1W8DA 3H9BA 3QFTA 1DV1A 1E5XA 4X24A 4KPFC 2K6GA 4WQMA 2R84A 4IINA 2X8BA 3GT7A 3I55B 1Z68A 2IOQA 3A31A 2BFBB 3EGEA 4RK0A 4ND8B 1RXYA 2FUNB 5DLYA 4DLSA 4MQUA 4Z4YA 4FZJA 4MI3A 1BWRA 3KVRA 2EKLA 4PAAA 3PFIA 1YA6A 1XL1A 1IHUA 1T43A 3I9LA 1A04A 2VHQA 3RUCA 3UZUA 3W0LB 1YIJB 1ENZA 3MWEA 1PWXA 1YB7A 3EVDA 3I6IA 3IBSA 1Z45A 2Z9DA 3TIFA 4M87A 4E88A 1X7ZB 1B6TA 2FOLA 3X2EA 7AT1A 4PYIA 4ESOA 5CVDA 4TRRA 4M0KA 3OX2A 3ETJA 4GYJA 1VHOA 4GOLD 3RHZA 2M6LA 1OVGA 2VF7A 1U7DA 5A3QA 2D3NA 2HUNA 3D6FA 5IDXA 2QHXA 5K03A 3U6BA 3KKLA 2WJYA 2I0FA 1SZCA 5JJ5A 1VFNA 5DCLA 3WGTA 4CMKA 13PKA 5AVJA 4QGHA 1QRAA 2DT8A 3OF3A 5AM0A 2OLJA 2WWFA 3QU9A 1QIMA 1NNUA 2J6CA 3ETGA 1G66A 1G8GA 2DOGA 1H5QA 2YFYA 2JDIA 3F6PA 4WKPA 4XTCS 3FH0A 5GZ6A 3VQTA 1MG5A 4QL3A 1JPVA 4JN6B 1Z63A 3HRIA 3MG9A 3OP4A 3TE6A 5TR9A 2QTTA 1EWKA 2OHXA 3IILA 1XZAA 2Z2YA 3NNNA 5JANA 5ALKA 5JXJA 2H4WA 2P6MA 1NKTA 3X1ZA 1PJ6A 2CBGA 5FR2A 2PZKA 3B1KA 3REQB 3FNEA 4DNTB 5E1OA 2GJAA 2O1EA 2R6DA 5GY7A 4HQRA 5GQSA 5EVJA 5KB3A 3A35A 2RJ3A 4ZRMA 1P0CA 4PZUA 4HGRA 4TWJA 1AZTA 4WIAA 1P45A 1ONNA 3BMOA 2VUUA 4RWEA 3MCTA 1W6UA 3NTQA 5B57C 2VPQA 1OFIA 4G7WA 4QICA 6Q21A 3BXPA 2AKEA 1U2RA 3A4LA 1SU4A 3EEBA 2O3UA 4GC9A 2P0AA 4XIGS 4ZI7F 1Q7CA 4IG4A 2PVCA 5C7LO 1Y1TA 4RPIA 4HE5A 2Q1TA 3CWCA 3P9CA 3G82C 4MVYA 4G5YA 2WG2A 1XEXA 4TUYF 2FUG1 1FFWA 3PHLA 3QI2A 4L73A 4MAMA 4N18A 4XJTA 2X8JA 3IQDB 3KB8A 4R01A 4JXXA 3E2MA 2I3DA 3D4PA 3NYWA 2HLPA 4GM0A 2AN9A 2VTEA 3LUKA 4NU8X 5TMBA 2QG6A 1ONPA 5D5HA 1F7VA 1NVKA 3PPYA 1WDKA 4UM7A 4L8FA 3A8KA 4B3HA 3CKKA 3HVUA 2IS6A 4MQ6A 3H94A 3BHIA 2QXTA 2O2GA 3P27A 4KQ2A 3JXEA 1PI3A 3E70C 1QO0D 4GWLA 4HDNB 4R83A 4JEMA 5FPTA 5FT9A 4AO6A 3FSGA 1PYDA 3DUFA 3L82B 4HDSA 3RI3A 1G2PA 2HSDA 4RGQA 4RIEA 2H52A 1VYTA 4KC0A 4L4SA 5IBRA 1FLDA 4Q9HA 5MN6A 2IKQA 1KBZA 1E4YA 3JQGB 3NATA 1J0XO 1QXSA 5KYXB 3HBAA 4G4JA 2QBYA 2XT0A 2ZYAA 1ND5A 2ATCA 3QKTA 1NBMA 1USKA 3DZ8A 4U2EA 1QR6A 3DEAA 3KFLA 3ROGA 5HCIA 5D5QA 2WA1A 5FAKA 3CC4B 3P71T 3IUBA 1G63A 4HLQB 3U4DA 5KVVA 4CQJA 1GPDG 1KGSA 1FP6A 1ODFA 2I7DA 2Z3VA 1OGJA 4KQKA 4PICA 5CYFA 3ZS8A 1ZM2A 3P9IA 1HORA 3VFDA 4JFAA 1Z16A 1QG0A 5DMHA 1M7HA 2ZYVX 4D0NA 1KFCB 3H18A 3QM1A 1BFUA 2QBYB 2A33A 4X7BA 3OCCA 5T57A 4AG5A 1ODIA 1U94A 1NVXQ 5G41A 1QYIA 3HSSA 2UDPA 4D4MA 4YV2A 1A97A 3IBYA 3OLYA 3Q7PA 4WXEA 3LBIA 1SKMA 3QJGA 4YDHB 4RD1A 4W8OA 3U09A 4IFTA 3EK2A 4E5NA 1YRLA 1XLVA 3KSRA 2VPWA 3TMKA 4CN8A 5BNWA 5CFPA 1PLJA 3OJ0A 3JD4A 4GQAA 1LV8A 3C6ZA 1T1JA 4OXYA 4RGYA 2CD7A 1WP6A 1UBGA 1YVDA 1P7WA 2Q3HA 1OLOA 2R25B 1N2EA 2RGXA 3B6KA 3NONA 2O8CA 5IG2A 3BGSA 2R68A 3T1NA 3IUJA 1Q82D 3FLEA 4G0QA 4R2KA 4E15A 3LLSA 3RVQA 2XAAA 4P4LA 3E5MA 2Q1SA 3I01M 1G5FA 1VIAA 2F3SA 5KSPA 5EIFA 1R0KA 3R6JA 1GRCA 3FG9A 2WHRA 1GAEO 4X85A 4EJSC 2UU9B 1L7BA 5JQGA 2OCAA 3DT8A 1QGED 3GP5A 2PT9A 1B73A 4HPXB 1KJIA 2EARA 2RHTA 2YQ5A 2QJFA 3QELA 4RETA 1DZIA 1E9BA 3RNLA 1CY6A 2P4HX 2H5LA 1XZGA 3C3EA 3ANTA 3K2IA 3ND6A 1QO7A 4RK7A 5EWLA 2I6XA 5CCEA 3T7CA 3JQ7B 1VF7A 5BRJA 5KC9A 1F4VA 2GT1A 3KPUA 4BFTA 5JFGA 2Y6VA 5HPYB 3ZZ0A 1I0IA 4RNDB 1EDBA 3SQNA 2IXBA 3ZU6A 4ZZ3A 4O4JB 5CFQA 1RAEA 2IEYA 3C24A 1ZH2A 2QWXA 3TPCA 4RLFA 2XOKA 3CGGA 3WKBA 4BQNA 4PIPA 4UHDA 2CYCA 4JYMA 3VZDA 4MKGA 5IXYA 4MR9A 4AF8A 4ZDIA 3NDPA 1T1EA 3I64A 4P32A 1SY7A 5ERXA 4ENVA 2BMDA 3U3XA 2VDKB 3JWPA 4YUAA 2C3PA 3U44A 4ZARA 5IN4A 2ZT7A 4H3VA 4ABTA 1N6NA 2ZJ6A 3T7JA 1R6DA 3NVMB 3DNFA 4FZ5A 4YR7A 1FU7A 1V0EA 4B3GA 1SB8A 3EFBA 4GR5A 4A92A 4FHEA 5JD3A 1BDIA 1FDSA 3K1YA 4BFVA 5DHTA 2PZJA 3TG2A 4WZBE 4BX2A 5GAJA 1MA0A 2GO1A 2C9CA 5H82A 1K7CA 1DJLA 1RKVA 4XX1A 4GEGA 1UD5A 5C80A 4JKIA 4JZYA 2EWWA 2Y6UA 2XHEA 1QOPB 1XXHB 1YA4A 2V5VA 3HPRA 1AG9A 3JY6A 1R15A 2RIPA 3PDUA 4EHHA 2FZLA 4AN0A 4U39A 2PZFA 3FYDA 3GEBA 4Q1BA 1F1BA 3VR3A 4B4UA 1YZTA 1H2FA 4COOA 4D9JA 4E12A 3TUIC 3COVA 4MW0A 4KOEC 3H19A 5AI4A 4D8WA 4M9XA 4QREA 2FY8A 2IEGA 3BH4A 3V3TA 1HLPA 1Z25A 3A11A 1UBUS 3ABZA 5ANRB 3S40A 1RQ2A 2HK6A 4HD8A 4B3DA 1V1RA 1S8OA 2JCSA 3DBLA 3PKIA 3HDJA 2W7TA 1GY8A 2HDOA 3TQSA 4EW6A 2OGTA 2OOSA 5FTNA 1XMQB 1XZNA 4EHNA 4F3YA 5JS6A 1U8XX 4KGZA 2DPXA 2H18A 3P2KA 3G6KA 4KO1S 4Q48A 4AY6A 1LF0A 1NHGA 1SOWA 4LBZA 3L18A 3QPCA 1HH4A 2E21A 3HKEA 1YL7A 3VU1A 3SICE 3ZHCA 4DC0A 1V16B 3GLUA 2KI5A 3QOWA 4H31A 4M0UA 2KBEA 1F38A 3EH2A 1I2ZA 5AVRA 3U44B 1KZ1A 1YVRA 2W8BA 3FDJA 4GNKA 4IV0A 3ZVMA 1U8YA 3NAZA 3Q7SA 3VJLA 3VH2A 4RHCA 1G1MA 2LKCA 4LGCA 3V6MA 3O92A 5IYQA 1DC4A 3AJEA 1QAOA 4IBOA 4RMHA 1I24A 1P8AA 1NQAO 2H2FA 3CRQA 1UF9A 3NNDA 5K1ZA 1JILA 2VHUA 2WIAA 4QGSA 2G76A 3LX5A 2VAPA 5HTKA 1E0SA 1HY3A 2J5QA 2O1WA 4QYXA 4WY5A 4AJEA 4BLSA 5K8JB 4L8JA 5TRDA 2QLBA 3E5NA 1P5ZB 4REQA 3AX6A 2ST1A 4JU9A 4UD2A 4UMVA 1TAHA 4D26A 2GSDA 2XV1A 2B0CA 4RXTA 4R7TA 1L5KA 5AI0A 4KIWA 4F71A 3COSA 3JZFA 4XDGA 5G53C 3TFQA 7ADHA 2VNKA 3QQ5A 3U56A 2XUIA 1JR6A 3KFVA 5ULLA 1MRSA 3SQDA 4ZODA 1Z18A 2WNHA 1H2YA 4BJHB 4YCJA 1N0WA 4QHTA 1Z2EA 1Y4SA 2GHIA 3HCFA 2YWFA 4Y8VA 5AM4A 1YJCA 2ZL5A 2H3HA 4TSFA 2I4LA 2W2LD 4K9MA 2NU8B 5TLSA 3QQPA 1UP6A 4MGKR 4QQNA 4L75A 1FB5A 4MS3B 4HNTA 1Q6YA 1AO3A 2Q0QA 5AJWA 3F96A 1DU4A 1RYNA 3LVQE 4BJ1A 3HZZA 1H66A 3VSCA 1Z5ZA 5DV9A 1JQ3A 2QTVB 4YV7A 2WNSA 1SIWA 3EAGA 3WQSB 3R7BA 4EZBA 2OCLA 4G86A 4IIVA 3WIVA 1TUGA 4DW8A 3D3QA 3LA8A 3RD5A 4HDOB 4MRSA 3JV7A 3GV0A 4WA7A 3DW1X 1DC3A 4XYGA 3PFBA 3FF1A 3H3JA 1JPJA 4Q47A 3QHAA 3WL3A 3NDJA 5HS6A 4G26A 2JGRA 2WUDA 1WETA 1W46A 1LI7A 4BVLA 4RORA 3NEJA 2I7VA 2YOGA 3L84A 3OU6A 4M0PA 3ZDQA 2MINB 5F3WB 2Q41A 3R0XA 5TMDA 1V4BA 2YXBA 2O8NA 4P0QB 2F1JA 4J9UE 1SRQA 4N6NA 3RBXA 3KEWA 2FW0A 4KGXA 3WGOA 5A5EA 1QH9A 5KVAA 1OLSA 2AMFA 2AQ8A 5SY9A 1BJRE 3I01A 1C0KA 4MUMA 3JQEA 3K9NA 1IWOA 2EBUA 1DWUA 1SVUA 1QKKA 3UJ9A 3RW9A 3LZCA 1VKRA 3EG9B 4OJTA 3SF8B 4ND1A 5B37A 5KKCA 1TLTA 3L93A 1PWHA 4UKDA 3SU8A 3OQVA 2ZS9A 1N8NA 3C3DA 1YDEA 1MH9A 2C7QA 3RHSA 4M3NA 4QAJA 1KAGA 1ZK3A 2A0UA 2C7GA 5TNXA 3SZMA 4DV6B 1J0BA 3CEHA 4MCIA 4OSOA 3AEKB 4CNBA 1YS6A 3KR1A 2I3ZA 5EZYB 4HDNA 1UK8A 5HG0A 2Q4RA 3Q85A 3O8QB 3AVWA 4Q4JA 3NGLA 1XHLA 4IDNA 5B1YA 4G36A 4L27A 4RLSA 2WM9B 1ISFA 3DZIA 1EFVA 2R5NA 4F3KA 4C0LA 4A8JB 3EYAA 4XKJA 2C88A 3PQDA 3ESBA 1Y63A 2ZANA 5H9WA 3QTLA 4YREA 4DANA 4JQCA 1DIHA 3LHSA 3PQ8A 3IQWA 4ZMBA 1YH3A 5DO9A 1RHMA 4HDCA 4H9GA 2X7XA 3ISVA 3M4XA 1P31A 4PO3X 1IJFA 2SCUB 2OOKA 1ETUA 3DL0A 5IKXA 5A5VA 4FQ7A 2EZUA 3L0SA 1NF8A 5MN4A 2L0XA 3PCTA 2BGTA 2JIQA 4O2AB 4TKUB 3H2YA 1PGJA 2QRNA 2K2WA 3CWZA 3IBFA 3OOEA 4YP0A 2VR1A 3W6PA 5K0GA 3DDWA 3CRW1 1IIRA 5CB0A 3FFWA 4B33A 1Z37A 2Q9AA 4LZJA 4PZZA 1K8QA 5JJIA 2IS2A 4RD4A 4ALIA 3SE0A 1BS1A 4CDRA 3T1VA 2ZVJA 3GEEA 2P5UA 3FPFA 3AOEC 1S2NA 3L5KA 3R6GA 2Y4OA 2IFTA 3AEUB 4ND6A 4EGSA 4ZKDA 4D3DA 3A7DA 2PS1A 3NM5A 3GLGE 4RCZA 1HQYE 2PT7A 1PZMA 3Q88A 3INYA 5JY6A 1WV1A 3H8WA 1ZXLA 3N2NA 3PNYA 3PE3A 4J7UA 1XQYA 3MTIA 1E2UA 2WD7A 4MCJA 1QV6A 1SIUA 4IF6A 4IH4A 2C5BA 1D2EA 1TF2A 1ZRNA 2Y67A 1ZLYA 4LE1A 3W5VA 1XQVA 3OFKA 5DW0A 3QYAA 4EY8A 1ZBDA 3LCCA 5EXXA 2BGIA 1AHNA 1O5OA 4YLYA 1X80B 3UUWA 1D0IA 2PX6A 4TX1A 3BS4A 1KVRA 2X8KA 2VH5R 3Q1KA 4JYCA 3S2EA 4HQFA 3SIRA 4MQEA 3T6KA 2FDXA 3FNGA 3VU9A 4JODA 2QRUA 1Q11A 2FZWA 1O9BA 3P2EA 4UFOA 4F8JA 3D6JA 1PT7A 2RGEA 3IEUA 4O8ZA 4R1TA 4EHJA 4CEJA 1FYVA 4C4YA 4GGOA 2PS9A 4DEXA 1OWPA 1WUJS 1SVNA 4B8WA 3PTAA 2KBFA 1JWBB 4UM8B 5T7BA 3G71B 2OZLA 1RI2A 2X2PA 2IIBA 3V7WA 2CLEB 2Y9PB 3QPUA 4LAFA 4DQUA 4QU5A 2IY9A 4PR3A 4XASA 4QJBA 5JO9A 1V1RB 1C50A 5CT6A 1SOAA 2FVGA 1ECJA 1JQ5A 2VBUA 4V0MA 1EA5A 4LXTA 5ENVA 5CIQA 2VCEA 2OQIA 3ASVA 4C7VA 1D4ZA 3E8MA 2MDTA 5ALGA 3PI6A 1DKMA 3SJZA 4K9DA 1QRDA 5G2OA 3KXPA 4I1IA 3ZXXA 3FYUB 4G56A 3FFTA 4GYKA 3RU2A 3DOJA 1YS4A 4QE3A 3P9QA 1KC8D 3BK2A 4MV7A 1Z13A 4NV3A 4FXUA 3K0FA 1E96A 1RQNA 5F4MA 1MO3A 3BGDA 4JBWA 4JI6B 1ABEA 2OCPA 4WFKA 1L6IA 3L6RA 3NOVA 3RTAA 4EGAA 4QNMA 5AESA 4A73A 4ZGWA 2GVNA 5FUMA 1CEEA 3AR9A 3R41A 3O31A 3CCQB 1DBWA 1S01A 2LP4Y 5CA1B 2H5EA 3TOCA 3KVVA 5EINA 4YFYA 1UBHS 5L45A 2CSUA 1NPDA 4G0OA 1YE3A 2H2AA 1K3UB 3P97A 5J63A 2A0YA 3T5MA 4YRSA 4RSGA 4GICA 4Q7QA 4I1PA 3F5SA 2C96A 5HJEA 1VPEA 1QCZA 3I58A 2YY5A 3JALB 4WEOA 1OPXA 3BE8A 1NZJA 1PJ7A 4BFXA 4G5HA 4J0IA 4J2HA 4RY2A 1BXGB 2W83A 4BMSA 1IN4A 1QJCA 3T5GA 3C1UA 5K0ZA 2BI7A 3CZRA 3O4GA 1TM5E 1V2HE 3MTJA 4FOTA 1LI4A 1H65A 1XLWA 3IURA 1DKRA 2P0YA 4JA2A 4O3FA 5AVSA 3TLYA 5IARA 3LQQA 4LUCA 2YIMA 3NHWA 1KRWA 2QJOA 3WHLA 3UBMA 4DCPA 3DDNA 2E87A 2XMDA 2YHUA 1XCBA 3OICA 5AVZA 3UJPA 4FS3A 1V8FA 1RXSA 2GJ4A 4H7FA 4M53A 1DCMA 1GEEA 3CUKA 2A3RA 3LQYA 5KNBH 4FZVA 4MULA 4FSDA 3TQCA 4OPVA 2Y27A 1ZM3A 2ZDHA 4KYIB 3MJEA 1YKFA 4C4TA 2I2AA 4LJ5A 4PABA 3EXIA 4QWMA 4L9WA 1TZJA 2P9YA 2ZE8A 4R05A 2BEWB 3QF7A 2RARA 3U4QB 4OGWA 1KDPA 3TLAA 1AOXA 1ENYA 4M38A 3G9TA 4HNVA 1KAEA 4BU1A 3CCJB 2CZQA 1Y6FA 5L3ZA 1XV5A 3JS5A 1T4MA 5T4HA 4L8LA 1GN8A 1TX4B 3VO9A 2JI6A 5HJ2A 3WGZA 3GEDA 1TJ4A 2ZSAA 3EF3A 1TVKA 4MDYA 5IHPA 2ROQA 1XVIA 1CQPA 3K8ZA 2J6IA 4FFPA 1DPFA 1JAXA 4INPA 3D2BA 2JHFA 1D1TA 5EY5B 1Z39A 5EMLA 1H0SA 4PRKA 4S1OA 3DHWC 1K08A 1E1CB 1RE1A 4KK3A 3S99A 2PLAA 4F8YA 5J4KA 4YPFA 3GRAA 3VDMA 1EJ0A 2NZWA 1DBSA 1PSWA 3ZE9A 3D0RA 4MRNA 3AVPA 2HB6A 2CVQA 1VB5A 1PR1A 5IT9A 2NSJA 5CX1A 1KAHA 1X7YB 5BOSA 4JNCA 4OCZA 5LWHA 2WA2A 1O8BA 1RYEA 2R00C 3K5IA 4EY7A 4WESB 4YCDA 1VQPB 1U81A 3WK7A 2WYVA 4MPPA 2OK8A 2IHBA 3Q11A 5FBKA 1YGYA 3F90A 5E8JA 2D2IA 4MQMA 3OM8A 3W7AA 4ZEVA 4LF5B 2GEDA 3UJHA 1QC5A 4R2MA 4ZVQA 3WKCA 5JNWA 1C9JA 3CLUD 4DJEC 4CF7A 5HHTA 4AIIA 3A28A 4Y0AA 5CGZA 1L4EA 3BY1A 1O3YA 2LTAA 4WD3A 3CVJA 1J6UA 4JJ6A 1ZK0A 2XTJA 2QLNA 4UZUA 5JSHA 2FF7A 5JG7A 5IC5A 5ESRA 5AI8A 3DHVA 4GLOA 1KI4A 3SEQA 4V0ME 5FWAA 5JFTA 1UFOA 2DWQA 4MINA 3J7TA 3KV1A 4YNBA 3L04A 4AUKA 1G38A 3FRIA 3U5ZB 1XTUA 4EJSA 2GHQA 4RXMA 5FUQA 3ZCVA 3PKZA 4DCOA 3CMMA 3WP0A 4M1ZA 4MQLA 4MR7B 1ZUWA 1YR9A 3RJMA 3K0SA 1N78A 2IYXA 2FMFA 1S5PA 5T4EA 2ZBQA 4Z51A 4WOKA 4CKEA 4Q00A 1DAMA 5CM8B 2L19A 2JEOA 1M1NA 2ZS8A 4Y2UA 4Z9YA 3JVIA 4BNJA 3R9IA 5ARBA 4NOKA 3EPKA 1RBZA 3TNFA 1C9NA 3W2IA 1NNSA 2XMPA 4UHHA 3RBAA 4RHTA 5IKEA 1HT0A 4MGEA 1IN8A 3FWYA 3C1TA 3U3DA 2Z5FA 2AX4A 1SEPA 2H92A 5IKPA 5LPNA 2C2ZA 3UMBA 1KEVA 1TE2A 2KW5A 3K05A 3WA7A 4I50B 2QRVB 4CTNA 4I99A 1ONSA 4JVOA 1Z0UA 1Q1AA 1M66A 4KFSA 2BBOA 3V8PA 1NBHA 3CX3A 1GZ3A 1I01A 1UP4A 3K1AB 4YO7A 3KTAA 1Y80A 2Q21A 3L92A 4GBMA 3D7LA 4BYGA 1XLUA 1CY8A 3USZA 4QPZA 4Q1FA 3IDOA 3R6DA 2ECQA 5AW9A 1L5NA 5J2TA 4C0KA 1TGYA 1YOBA 2MHCA 1KHHA 4C04A 4PLVA 1NC1A 3CLUC 3ZU3A 4BGIA 1DLJA 2BAGA 1XRJA 1TFUA 2WI8A 2GJ8A 3EIEA 4PSAA 3GBVA 3MRVA 3T5DA 1BHQ1 1POWA 2PLRA 3C3PA 5CAEB 2I1QA 4J2OA 3TQIA 3AJ8A 3X1YA 4UFPA 4CI9A 4M1TA 4Z4FA 1XLTC 4E2FA 1M0TA 2GBGA 3EA4A 3JZMA 2FPPA 2WUEA 4ZCPA 4KR7A 3AP3A 4ZIRB 3SZ3A 4YCMA 1Q19A 3GLFA 3TCXB 5J58A 4GBED 3NHBA 4HDKB 2OBXA 3V4PB 4AVYA 3U3OA 4KAJA 5I8WA 3DOIA 1VRVA 1F2VA 1XU4A 5AIAA 5ALZA 4N5HX 3UFXA 1MDFA 4II3A 1OXXK 2ZBRA 4KE6A 2H4JA 5TC4A 2I7CA 1EWTA 3AY7A 2ETVA 5JBQA 3SE7A 4BKOA 1OJ7A 1X8XA 4FFDA 2JK0A 1T3LA 4ZYZA 3RVPA 2I6FA 1JKFA 2L82A 5IAJA 1SK9A 1JE1A 1QK4A 3N8IA 5MDHA 1GNQA 1YQWA 2MSWA 5D5PA 4QVJA 4WKNA 5BUZA 4U5XA 3PC7A 5ITZB 1EK6A 4JJ8A 1RC8A 1EMDA 4XJSA 4WWVA 1KQGA 4FUQA 3K0CA 4PXYA 3SF8A 4JI5B 1B41A 1ZIYA 1JLMA 2PGXA 1BMFA 1EP1B 2TMDA 1DAGA 3C8HA 3ICOA 3QU5A 3R4CA 2OYRA 1K6MA 1YASA 3A4TA 3HM2A 3GGDA 1KWGA 1GPYA 2Q1UA 3FTCA 3G5LA 4B7AA 3EIOA 5JATA 1I3NA 2ZPTX 5FHQA 1V41E 2CJXA 4N3CA 4OHKA 4TT3D 3TDKA 3WMEA 5J2UA 2B3TA 4Z4TA 4BO3A 1QKJA 3VPFA 2VBIA 4ZEWA 5BNIA 1HDIA 1TUBB 2GN4A 3DKPA 3M6FA 5F12A 4LQDA 4KQHA 3JATA 4U3JB 1HT1E 1U7TA 3D54D 2Y1FA 3LV8A 3V4SA 3R7AA 4IDPA 2FUG6 1TXGA 2REQB 4TS3A 5C3MA 2AFHA 2TS1A 4XFKA 4K6GA 4YQZA 3LNNA 1FOEB 3CO5A 2JLUA 1BWQA 1WCYA 3LX4A 3OQNA 4Q03A 2GPSA 3H2BA 3OE5A 1POXA 4DNRB 2F8SA 1JU3A 1BCSA 1NQWA 3ITKA 3K0AB 2NO9A 3QXSA 4MR8A 3T4UA 4GOOD 1YAJA 3TE7A 1ZNXA 3D8TA 3OJCA 4P1ZA 1JZSA 3OCUA 4R8LA 3UPTA 3HI6A 1Y1PA 3UXYA 3R6KA 1WJGA 2J3JA 3DLPX 4NEQA 1B16A 2ONCA 4TVOA 4W5TA 1HNWB 1UC9A 2MR6A 1E7QA 1H0RA 1ZVJA 3KJXA 3H5IA 4NF2A 4F84A 3IEIA 3KXIA 3RVSA 4C30A 3WYEA 1GG9A 2WSLA 1J90A 1U5AA 3QKRB 1E3JA 2IOYA 1VMIA 5C18A 4KH1A 5C1DA 4CR8A 3TD9A 3ABIA 5CT8A 4LSMA 5J9FA 1DEOA 3A9TA 5FAXA 5K6RA 4N7BA 2DPGA 5EZ6B 4NOLA 1I4OA 2P3MA 2W6JD 3QXCA 5TPZA 4H6WA 3STXA 3UFBA 5ESWA 3Q9UA 2AQIA 1DRVA 3GQBB 1RYMA 3UGKA 1NFRA 4EYKA 4Y2RA 4TMKA 4KWIA 5B2FA 2PJUA 3QBJA 1O4VA 2NQ2C 3RC9A 1WQ1R 2VT6A 1PL0A 4W5JA 4YBRA 2E7ZA 2C99A 4E03A 1W30A 1XE3A 4CMCA 1W0KA 2ONKA 5DWQA 4CN9A 2BN4A 1G6HA 1EPUA 3T7EA 5FOTA 4WA8A 4HX5A 1RACA 1T9BA 1XCJA 3RUHA 4AC9A 1GD1O 3G2JA 5G0TA 4MVJE 3DDOA 1M8JA 2KLHA 1J99A 3L77A 5HZMA 1GPKA 1YI0A 4OUDA 1XPOA 1JEQB 2AC7A 4BVHA 1QH8B 3AEKA 3KUCA 3M3HA 4B47A 3KYIB 3X1DA 4F46A 3LUFA 1XZ8A 4ZU6X 4Q6WA 4KP7A 3GD5A 2ZTUA 2PWAA 2Q6VA 4X95A 4RJKA 1BW9A 3RRFA 1YQXA 1P44A 2OUKA 3EXHB 3R77A 6CHYA 3CCLB 3ERCA 1Z6ZA 4NH4A 4CMIA 4QELA 4FXOA 2GN6A 2XUHA 3BRCA 3HYTA 3PQ5A 2PKYX 4KFCA 2HRCA 5JH7A 4HWOA 2ZZFA 4HO1X 5DNWA 5CIWA 4F6LA 2AZ4A 5EL0A 3QGMA 4CDMA 1E0AA 5FBRB 1WHSB 2P7IA 3NYRA 1NW5A 5EXEA 5H81A 3AL0C 4YTEA 4A6EA 4HUQB 5AVOA 1U65A 2VWPA 5CA1A 3FZGA 1YQ9A 4IG9A 5GM2A 3GLKA 4P3XA 4R2IA 5I9TA 1T1GA 1QAMA 4ZT6A 1DARA 4LBVA 2GNPA 2PD4A 4FJ1A 2GBLA 4MHOA 5J2TF 1B8UA 2DIEA 3RTBA 4DCJA 4CXMA 4RY0A 4PN7A 1W36C 3CJRA 3DHEA 1WMEA 3QUCA 4FFSA 4QM6A 1C0LA 4MDHA 2B99A 1VRWA 4G4IA 4AZ0B 5GOTA 2OQRA 2QPTA 2OBNA 2XOKD 3AO0B 3WADA 1IEWA 2CVFA 2GEVA 1A76A 2CY0A 4PYRA 5AP9A 2AF4C 3X43A 1ZISA 4YQFA 3CR7A 1ISGA 3HN7A 5FKJA 3QIAA 4QBKA 1I3LA 1Y8QB 1MOPA 5CB4B 2LR0A 4OHFA 4CPDA 1KL7A 1Q1GA 3VR6H 1I1OA 4XLEA 2IDJA 3EOBI 5KNCH 5KHOC 2DMRA 3LWDA 4U2DA 5DXFA 4OK5A 3ROTA 4ARUA 3ZY5A 5K5EA 1P1FA 1ZC3A 3DAGA 2QJTA 5JE8A 5EWLB 3IT1A 5IYZB 2CNNA 1A5ZA 3GJ7A 3HY3A 4OXNA 4PEVA 1K86A 5H59A 1OAOA 2D1YA 2N46A 1TU0A 2ZYTX 1VL0A 3BMXA 3NJ4A 4G3XA 3NIWA 4JJEA 4Z2YA 4RTQA 1Y82A 3B1WA 3MIIA 3K0BA 1UBLS 3WO0A 4E5VA 2QTBA 5T67A 3KL9A 2JAXA 4NBVA 2P40A 1KOLA 4HDKA 1Y7TA 3OLWA 4X6UA 1KIAA 4RM2A 4WXMA 5EAIA 3DC2A 2C3UA 3PQ4A 5EHGA 2HU7A 3AFGA 2FMUA 3FHOA 2VJKA 4GOMD 4QTXA 1TRHA 2YV2A 4DJ5X 3GUUA 2CKDA 2Y1XA 2AJTA 5EFOA 2BM0A 4JR0A 1ZC4A 4Y0NA 1YC2A 4BNVA 1ATZA 1PUIA 3BREA 3GVPA 1NXVA 2ZB7A 3PUIA 3R3ZA 1MC5A 2EJVA 2I03A 1SCQA 3RAEC 3HU1A 3GDWA 2GLTA 2IODA 4RSRA 2RKOA 4MHTA 4ZDWA 2RFLA 4DA9A 4AZTA 1QYCA 4X7EA 4FT4A 1T3HA 3LQ1A 1Q12A 3TTUA 2FQWA 4DC9A 1W4BA 1WP9A 2QEQA 4U7TB 4XB1A 1ZHOA 2ZT6A 5TEWA 1V16A 3F2IA 2WDZA 2LE0A 3IIIA 3U3ZA 2QTGA 2VDPB 3CCFA 4PO1A 1II8A 2VN8A 3VSBA 1OYOA 4V39A 4ALMA 5KZMB 4DR7B 5L3QA 2SKEA 2WD9A 1R0YA 3CRVA 3D1VA 1XYGA 2WHQA 3BDVA 4IGFA 4P5PA 2ZCUA 2EKQA 5DPMA 2P6UA 1UBMS 4BGDA 4H4CA 3PUNA 4PZLA 4H7IA 3CP8A 5AW0A 4K9LA 4L57A 3COZA 2D2EA 3A70A 3PFNA 1YI1A 3GZJA 4L8GA 5LQCA 2B2CA 2ZXEA 3DT6A 4FTWA 2ZJBA 3QWFA 1GR1A 4PONA 4QX6A 3TZQA 1E20A 1HYQA 5EJFA 1TO1E 2FNAA 4UD6A 1KZ6A 2ACKA 2IUYA 1PE0A 2R6GA 2ZYWX 4DQDA 4P2BA 1NSYA 1FYXA 1OZAA 3UY4A 4LF6B 4DAEA 2GPBA 1RXVA 1J1UA 1EZ1A 2L69A 3BFKA 4ALJA 3L8DA 4ZJUA 3UXHA 1B6SA 4JLOA 5LQDA 4MUKA 3I2KA 1GDTA 5EGNA 1P4SA 2EKPA 2WKPA 5HOQA 1H5NA 2JI7A 3WSTA 4DSTA 4KRYA 3KQUA 2C9OA 1HYGA 2IHTA 2X4GA 5E1MA 3GMTA 1FFDA 2IPOA 3AFHA 2E5LB 4AKIA 1CB7A 2R4UA 3V2GA 2VTVA 2Y76A 1OFTA 1NHWA 1YZUA 1XDUA 3OD1A 4GGMX 4OXQA 1ODKA 3TSCA 3V8NA 3DEYX 4HKTA 2WE7A 4PBTA 4Z4SA 1OKKA 2BFBA 4BUJA 5FL7A 3PEVA 3P9SA 3V4VB 3T99A 3ZHOA 4UPEA 1EUQA 1QONA 3GH1A 3H9QA 3DTYA 4XKWA 2YYAA 1AA9A 1J8YF 2CMHA 4O29A 2ILTA 4P6VF 4YDSA 2GFHA 2HTFA 3AC0A 4ALNA 4DMMA 1EFCA 5KVCA 5L3QB 4RTOA 1A9SA 4B2YA 1TYCA 2HO4A 2VJAA 3E1YE 1B42A 1RMQA 3KKEA 4MYDA 4OLFA 4JYZA 5EWMA 1L9KA 3KEFA 1PQUA 2OZPA 3ZIAD 4CEHA 4R1UA 5KMGB 5TVKA 2PE3A 2QTCA 2XNKA 1UKVY 3I6ZA 3OIVA 2LIVA 4K05A 4ZOCA 1E61A 3UT5B 3W4KA 4XLZA 1JIUA 1OAOC 1F20A 1RM3A 3ZWCA 4RJTA 5ALDA 5BN4A 1JVNA 3SIWA 1E3MA 3QFFA 3VOSA 4WXYB 3ZXSA 4X06A 3NUZA 5I4KA 3MUOA 3WL6A 4GVLA 1NUUA 1V1MB 1JG3A 2O5RA 3FBGA 2D3WA 2GTHA 4O2LA 5LDHA 1GPJA 4ZCMA 2V74B 2EWMA 4HDQB 4L2IB 2Q5CA 3O2QB 1U7UA 4YIHA 5T6MA 1MZVA 4D3SA 4IICA 1R88A 1U5BA 2AMJA 3LPLA 2PBLA 4XYMA 5AOAA 2JFOA 2JD1A 5EP4A 3G7UA 3PQFA 2W9XA 3K73O 5CT5A 1AIPA 5JWHA 5C34B 1E58A 4JV5B 3WLMA 3GNLA 4NBTA 3BK7A 4KUHA 1OI7A 3OZVA 4D0RA 3B82A 1JJBA 4Q4HB 3QF4A 2B1RA 3EW7A 2I55A 3CKLA 2IKSA 3QG1A 4BLRA 4O5OA 3ZXUB 4EFKA 2CLSA 4C9BA 2ZRNA 1E3QA 1UMDA 2RB4A 3KDPA 2F3UA 5K45A 3SXJA 4H0FA 1U2DA 4YROA 3OO1A 1TZMA 1UQUA 3LFHA 2QDKA 4IXNA 1FUUA 1HQCA 2WVHA 2E1RA 1JHXA 3EUAA 2VCHA 4RO0A 3S2FA 1KAOA 4Z7NB 3O75A 5E0KB 2VSXA 1LBHA 2ZJ0A 2QTNA 3OCXA 2BH2A 4MYTA 1XJCA 1LS1A 4ZDKA 1X7XA 3ASUA 4LJ4A 3ECSA 4GMHA 2O54A 2XF2A 4KE9A 4K86A 2AOTA 5GZ1A 3FCUB 3HCEA 2OV8A 1D8AA 3LIIA 2VWGA 3PQEA 1T8RA 4FYXA 3OU7A 4A6PA 1YJNB 2O3RA 3I2YX 3DYVA 4TGLA 3USES 2CUTA 3BD7A 4HNGA 3SQLA 2VYVA 1ILEA 2WK1A 4EO9A 4TQGA 5AVVA 3QFSA 1NMYA 5FWYB 4BX9A 4RAOA 4DNOA 5KNCA 1LZLA 2QP4A 4N1AA 4QARA 5HA5A 1XCPA 1OA0A 4R1OA 5COQA 3UV7A 5L3SA 2JW5A 3QEBZ 4CFZA 1A7AA 3P2JA 1JJIA 2YXDA 4A8PA 4DUPA 2BIFA 3V8BA 4PSUA 5JJCA 5KYTA 4XDYA 4BE7B 5M7EA 1FFGA 3B78A 4JUFA 4YMIA 3AHGA 3G7NA 4JC0A 3VPHA 4C20A 4DRXB 1VQLB 5HFNA 4CKBA 5JD5A 3EXHA 5FO1A 3B52X 4EG1A 1GA1A 1OLUB 2X3FA 1YFKA 1MB2A 3DW3X 3NFYA 1E62A 3HYCA 1Z4JA 3CPXA 4OJNA 3QTBA 1LDBA 5GVRA 1NQVA 3EEIA 3LPAA 1UMDB 5E7IA 2J6BA 2ZDQA 3REFA 2H1VA 1CBUA 5KDLA 3HWX1 1S02A 4KODA 1HMYA 2ODNA 4J4TA 3T0FA 3UJ7A 1N07A 2XUKA 2H8KA 5EP2A 2XWQA 5BUSA 4FBMA 3ZX4A 4DDKA 4GMFA 8MHTA 3KQWA 3U9SA 4BNXA 4YMWA 3OZTA 3WK4A 4B5KA 2ZUDA 2VHCA 3HC7A 3WWDA 5K6TA 2O2IA 4R2JA 1CS0A 3G2LA 1WEKA 3FUXA 2WEKA 4B7CA 3IE1A 2FZ5A 2WZCA 5SY4A 2NO5A 4Z4CA 1EGAA 3DVQX 1C8LA 1IVYA 3LHKA 3TL2A 3RC8A 4M99A 1NBAA 2O8BA 3L7CA 4B09A 1I36A 4UCFA 2HPVA 4UCWA 2ZSKA 2CE2X 3PFWO 3HB7A 3M4NA 3FNHA 4HXEB 5CW2A 5JDIC 1JU9A 4J7CA 2V45A 4OM8A 1P72A 1S3GA 4M22A 4MUFA 4WFQA 4MHSA 3SVZA 5K6AA 2EP8A 3HDHA 2EZTA 3NG1A 1L5LA 3F71A 3IR5A 4E6PA 4L8YA 4E2YA 4EENA 5JMTA 1T13A 2OKCA 4MARA 5I6DA 1NOKA 3ZHYA 2GILA 1B14A 4HG2A 5HBGA 2BJVA 1M8PA 2Z5GA 1WTCA 3F98A 4BAGA 4AJ1A 3OY7A 2GBLC 4JX8A 5A4IS 1I7QB 1FFSA 1VE6A 4EL0A 4LJSA 3GLIB 2D7JA 1CE8A 1Z29A 2M32A 3WLJA 1J5EB 3QUTA 4J2TA 2UYGA 4XE5A 1FX1A 2WPNA 3SXPA 2QQFA 4XKVA 3WDKA 1V3UA 5JCOA 1KDVA 1IBCA 4P0PB 1RM0A 1GIAA 4OAPA 4BKUA 1RCFA 2FH5B 4QRHA 5DLEA 3D2AA 1Q91A 5F7ZA 2BGJA 2F67A 2DFLA 3AI7A 2ZRMA 3HXPA 1LW7A 3EGWA 5KOJA 2DR2A 1YK0A 3OZAA 2VF8A 2QL5A 2ZJFA 1V7ZA 3UHPA 2IQ5A 1KQSB 2P90A 2GCGA 2NPOA 4B3BA 4F1KA 2O8CB 4EY4A 3WBBA 1GTVA 1GZSA 4I1OA 3L1IA 1BQ3A 4O2RA 2O4UX 3MT8A 4V38A 4ZVMA 121PA 1GDHA 1UMKA 2YC4C 3EGVA 5A06A 4JB0A 3NFRA 1W6RA 2IP4A 3WYGA 3TLEA 2G40A 4PWYA 3EPPA 4M0FA 3BFVA 3RB8A 1PR3A 1QVZA 2W93A 4HGZA 4OO3A 4ZFNA 2VJDA 1I32A 2ECKA 5LYJA 3HJNA 3CF2A 3R0IA 1H8ED 3QEMB 3TZHA 1O94C 3ZU5A 3OP1A 1RBMA 3RIGA 2IY8A 2ZIAA 1ZS9A 1VQ4B 1YS9A 3C7DB 3DKVA 2V7TA 3EIXA 4EYQA 4A36A 5H9VA 1H05A 1OZ0A 1LJUA 3MBIA 2B1JA 3P0IA 1QFYA 2H59A 3T4XA 4NMHA 2Q5HA 4YXWA 3L1KA 1P2GA 4TL8A 5FDFA 4JITA 2QUZA 2M6KA 4AMGA 2EX1A 1N2SA 2FJUA 5DT2A 3BILA 3TNLA 4LGYA 1Y98A 1TVMA 5ERYA 2WHPA 3SHTA 2PEYA 1C4WA 1HBJA 3GYBA 5MN5A 2OQ2A 1GCGA 2BI8A 1I1NA 2AYYA 2GEKA 2HJWA 1UINA 2P7HA 3O91A 2QN6A 2XWSA 5C1IA 3RYCB 3V4RA 3ZVNA 2GASA 1NASA 2ORIA 2V0NA 5H16A 3IJEB 4MJLA 3RVMA 1QKIA 1L7DA 1PS8A 2HCBA 4ND3A 3ZJTA 3HXLA 1H3FA 5LIRA 4UMEA 5FL7D 4XI9A 4ZVOA 1RKXA 2GN0A 1G8SA 1GXSA 4MWCA 5DW3A 1N2BA 3IGFA 5DHSA 1Y6QA 3V1LA 1XKXA 5KKNB 4DIEA 1P77A 2FXVA 1F2TB 3LUCA 3FWNA 7REQB 4CIYA 1QF9A 1G4HA 3BAZA 3DBVO 1KETA 3NV9A 4BLQA 5LU8A 3ZIUA 4G67A 4X6XA 2PUFA 1C30A 4D9EA 4XSVA 5G0VA 3F6SA 1G7TA 5KJ1A 3U48A 1FFEA 3SCZA 4D6PA 1LZKA 1WNTA 2VDMB 4ER5A 4ZJYA 5I9IA 2W6ID 2G83A 3EMKA 2VDOB 1W19A 2A7XA 1DIOB 2FQQA 2FFAA 3DTVA 3IVRA 2DERA 5F73A 4HHEA 3O84A 3LYAA 4BQRA 3CONA 1IONA 2DBRA 2EDAA 4LC0A 3IRVA 4N9QA 5I7RA 1CFZA 2WPDD 1GXSB 1N6KA 4A9AA 2GYUA 3H0CA 3PGA1 3SHFA 1JHQA 3SAJA 3K92A 4UAVA 1VE1A 4QULA 3TIXB 1H2EA 4BCBA 1DIGA 2AR7A 2OCKA 1AN0A 2MSDB 1TTTA 2W6ZA 3KWMA 1EXNA 1NIPA 3QK7A 2B8JA 5B1SA 1GKKA 1HYEA 3T4EA 1M2OB 2XXJA 4KWCA 2B4RO 4N40A 2GCOA 3RIHA 2WUWE 4LJ9A 4OMUA 1JRLA 3EFOA 5KCMA 2C7PA 2IHVA 3QVUA 1LCIA 4MTCA 1Q92A 4WFJA 3RRNA 1GWNA 3ILHA 2J09A 1M8GA 2GD2A 3BRSA 4I7EA 4IJUA 2BFOA 3SGLA 4JI4B 3DAHA 3BE4A 4PZ9A 1S7CA 3ZWQA 4D4GA 1AUQA 4FUTA 4DFDA 2VTDA 2QPAA 2AJ8A 4IHJF 2ZT8A 3ZI0A 4AJNA 4TQ9A 5HK9A 3RU3A 5IN5A 2YKGA 2DETA 1K6IA 1N34B 4G0VA 3IHWA 2GZAA 2J9RA 2REBA 2Y93A 5AJTA 5DX1A 4JYAB 1DAFA 2HU8A 3ETNA 1MAHA 1C4KA 2WF7A 1OHHD 2QKYA 3FJYA 4IO1A 4QVIA 2J4CA 2P9JA 4UULA 2P6NA 2WIFA 4EVSA 1YKGA 2PGDA 1YFJA 4DSOA 4XQGA 1RKUA 2MR5A 2FOXA 4I36A 4QUGA 4G09A 1OF1A 3WQBA 1KPHA 1WHTA 3E35A 3PRYA 2DFKB 3QG5A 4OFZA 1L4LA 3UB3A 4EB3A 2JLYA 3HN2A 4CYMA 2OZKA 3H99A 2D4HA 4YAGA 4K6HA 2ZU6A 3Q72A 2WU4A 2VVTA 5L95A 4TZ0A 3OWHA 3FAKA 3VNBA 4NFHA 3DWGA 5B3JC 2HF7A 3AI2A 2XKAA 3ORYA 2L42A 1LF5A 1N06A 4W82A 4AULA 4YRPA 1LBTA 2PKQO 3D7KA 4CMIB 2IYVA 2NZUG 4LRQA 3KJGA 5HZKA 5KQRA 3BTUA 3R24A 3SKYA 3VZBA 4XJXA 5IDQA 2P2GA 5DP2A 1IRXA 3AXTA 5IZCA 2IEIA 1DI0A 5JVDF 3RIYA 1U5CA 2VHXA 3IQHX 2ISSD 5KI6A 3WGVA 3R1IA 2TMYA 4NCHA 3OLCX 5FFNA 4E51A 1CDEA 5FPYA 1Z6GA 2GZMA 4BMYA 4BIMA 3DG9A 4OFXA 3ZGLA 2QZJA 1Y7PA 1G8PA 2AR0A 1VG0B 2NYVA 3VC7A 3LHIA 5I4IA 4JJIA 1IK6A 3OPYA 1KEEB 3KAQA 4JAVC 3L4KA 1KK2A 2HPAA 3UPDA 2YWRA 2WSYB 4B2LA 3OW2B 3GLHE 1VHWA 4RTMA 1UMBA 1BFKA 1K3FA 2ECFA 1TF5A 4FYHA 2JANA 1DWPA 4MQFB 3F2VA 4TMXA 4BU0A 1IHXA 1RWQA 1UXIA 2DHCA 3KP1A 4X07A 2B2NA 4K2HA 4Q4CA 4MYSA 1R4NA 1P1HA 2NACA 4J0FA 5IDVA 4OTZA 4JNKA 1E2PA 1TIBA 2I2BA 2O05A 4QDUA 1BRTA 4B3CA 3BXEA 3RQSA 1ML4A 3OX1A 3SR0A 1YV9A 4FP9A 4AY4A 3FOEC 3JYPA 3BWEA 3ZCRA 2XUGA 3G79A 4EG5A 5C4MA 5FNZA 3PXCX 4AY2A 4Y6SA 2I7TA 5C53B 2P91A 1I0LA 1P7VA 3W5SA 1LDEA 5BYKA 4EKIA 4WLNA 5BPFA 3VR0A 1QB7A 2OE2A 1QHYA 3WRYA 1UCFA 4GZLA 3EIQA 2EYUA 3N74A 1E2LA 4E5PA 5JWOA 2X3UA 1V8ZA 4GBJA 3VMFA 5TQ2B 2GR9A 3F3YA 1SUDA 2HA5A 2I87A 3DNMA 4P86A 1K66A 5FLEX 4HMPA 1FRNA 2AOXA 2P6PA 3EDRA 4RESA 1LVGA 4PLTA 4XGRA 3L41A 4KO8A 3FXAA 2TRSB 2WW8A 5JH7F 4PINA 1NONA 1UT8A 3VKFA 4M0DA 4IW3B 3LRPA 3R3WA 4UAJA 3DXYA 4FFBB 5AHRA 3T5CA 2FN3A 2NTVA 4GI7A 4S24A 3WLKX 2X5JO 3RT9A 3WTCA 3MGGA 2VUHB 2O2DA 2XGOA 4S3MA 3TPFA 1KEWA 2BISA 2VJNA 5HUHA 4FVTA 3E1KA 5FQNA 3TLCA 3HUDA 2JA1A 1JKXA 4NMWA 4X0EA 2BEVB 1XZCA 3DE4X 3M0EA 3PUWA 4BMNA 5AVXA 3T1TA 4G6IA 2Y2UA 2GD0A 2CLLB 3I28A 3LQ4A 2VI5A 3N8HA 1DEHA 1NP3A 5G3YA 2XNJA 4WL0A 2EP7A 1C4XA 4CQMD 3HKCB 1Q21A 1T4CA 5BXYA 3A6DA 5A2QA 3IEXA 3C85A 3KK0A 5LXTF 3GVKA 2WV9A 3P2MA 2QTAA 2ZWOA 4NU0A 3ZLTA 4LMBA 1VCNA 1HTWA 4AYXA 2MMCA 1SZPA 1WSAA 2D2VA 1IZZA 3LL7A 3BHJA 1UD4A 3LBNA 5EIWA 4XVHA 1U9YA 3S8MA 4CGZA 2BEJA 2CF6A 2OHHA 4PIVA 1JHAA 3RFVA 5IPFA 2NPFA 3RYTC 4C2TA 1XRMA 3ZK9A 2CXRA 5CRIA 5HF5A 1J24A 3AEYA 2WC1A 4TV9A 2R1TA 3X1WA 2DY1A 3FZNA 1RHKA 1TEXA 5AHWA 3H9EO 5D3MB 1N92A 2VK1A 2OB2A 3UW1A 1C2TA 3K4HA 5KTOA 1SKYB 4DK1A 3NBMA 4N54A 4WLUA 4EHIA 1OILA 2J33A 3F3MA 3I6YA 1B1CA 2Q2VA 4O2BF 1V1JA 2RI6A 1CWUA 2AXPA 3GT4A 4FKBA 4BZXA 3ND7A 4DQ0A 4LC1A 1NVUQ 2IYFA 3IAEA 2PVSA 4RH3A 3V1MA 4FK8A 2J7PD 4G1MB 4HADA 4ROSA 3GR6A 3ZVLA 4AIRA 1CUYA 1V9CA 4I0WB 4AKEA 5IMSA 5JXWA 1I8TA 3K0AA 4MR8B 4EGCB 2JI4A 3QLVA 4NU6A 4FCCA 1JPUA 1KKUA 1R8JA 2DFTA 3RGWS 2QUBA 3D0OA 1T0UA 4O1IA 4DA8A 2VJCA 1P2DA 3GNSA 1M6HA 3ILVA 3IV6A 1H1LA 5FTWA 3Q3CA 1L4UA 2IHKA 4IIHA 3K31A 5HEKA 2WWGA 4Q02A 2ZXFA 1MT0A 2JFYA 4B83A 4Z53A 4EW2A 3I05A 3G8CA 3THYB 1JXAA 3PD7A 5AJXA 5KYUA 2FEWB 1R0CA 4HN4B 3EDOA 5C81A 1W93A 3OEWA 4KGDA 4TMYA 1QP4A 1MJGA 4ZI2A 1SKAA 3MGBA 3WB0A 4D98A 3N0TA 1CEQA 4W8GA 4LCBA 4FYIA 1FSSA 5INTA 1X7WB 2PL3A 4EF6A 5DGCA 3AKYA 3MT0A 1H23A 3AUFA 5A71A 1U3CA 4XIIA 4B35A 2GDJA 3GG2A 5A4AA 2WWVD 3TFOA 1WD5A 1S2IA 4PLFA 5LM3A 1HFWA 3WLHA 4W6ZA 2REXB 5CUQA 5AH0A 3RAPR 1ZU4A 1QDLB 5ISMA 4BZWA 3AQ4A 4AS2A 3ZHVA 2VKTA 3F8SA 3IUPA 4QT0A 4MS1B 1ZCJA 1Z73A 4Y6GB 4A2PA 2G0NA 2IDZA 4LJRA 1SXQA 1YRYE 3OZFA 1Y8RA 5A89A 2F64A 4QVGA 2A4MA 3H04A 2VRCD 2VQ3A 3QPWA 4PZDA 4UM9D 1GL7A 5KTPA 1EE1A 2PD3A 3L3BA 4HGPA 5AK4A 5GM1A 2OTJB 2QF7A 2J30A 2QD1A 1Z5OA 3MT9A 4XWKA 1A77A 4URXR 1FFXA 3VC2A 2JJ1D 3K9GA 2HRBA 3A9WA 4YRFA 1FNBA 2Y1DA 3UTDA 1W36B 3V42A 4B3SB 1BMFD 1PLLA 1XNGA 3NYIA 3OX3A 4KAFA 3VISA 3QOFA 3L8FA 3MTEA 1O96B 5ITWA 4B9EA 1H42A 1FTGA 1L7MA 4FMCB 3I2IA 5C31A 1CRQA 2GEBA 4NBUA 1PJQA 4A5OA 3AW9A 2HA6A 4DSAA 4ZAZA 4HS4A 1TW3A 1W36D 5H3HA 3FPCA 1RTTA 4W7HA 2X0EA 3NUGA 1BDBA 3QMMA 4W63A 1AMNA 3HB4X 4LNAA 5BMVF 5AW8A 2UUAB 1WG8A 1NQ5A 5L9AA 1OUMA 4LNUB 1MV8A 2FFJA 4N0PA 4WSOA 1D03A 3ZHZA 1PDWA 3ISTA 2ZXHA 2I66A 3LZ6A 2R6CA 2YHAA 4RVDA 1BVYF 1KPIA 3EVTA 3CN9A 4LSZA 3LP5A 3I56B 3AF4A 4WCVA 1D2RA 4KRGA 2WPDA 4ZVLA 4AYWA 4HVTA 4ZI7B 1XNRB 4HQOA 4J1SA 1TC1A 2QIOA 3WG9A 3IXMA 2BUCA 3IVMA 4CIAA 4E5YA 5K01A 3GNQA 4Y30A 3ZOKA 5EJ6A 1GQFA 2QM8A 5LNK1 3S2YA 2IH2A 2PUWA 3C7AA 2PMKA 4E2WA 3PHIA 3PFGA 3PIIA 3I9V6 4QVAA 4KQ9A 3K70D 5AI6A 4MUEA 3DMYA 4Y6OA 3HXQA 2FMTA 1T2NA 3R7WB 2XRMA 4YAOA 1US8A 1GTG1 4MUIA 4U9HS 4P58A 3SEJA 1QG2A 1UKBA 4DSZA 2O6LA 3P9RA 2A5FA 4ZYVA 3QMPA 1Z74A 4ZQBA 1DHRA 4AURA 1SOMA 2AXEA 4CLHA 3I3SR 1VKOA 3LGAA 1VIYA 1LPMA 4IVQA 4PCAA 3V34A 4ZEMA 1KMHA 1DOHA 2H9AA 1OX4A 4RF5A 4W1RA 5GP1A 2G3YA 3WHPA 5JTTA 4A03A 3R0ZA 4DV7B 1VFPA 4HEQA 3UQYS 3R8XA 4E6EA 2LVBA 3KQKA 1L8XA 2FN4A 3EUWA 1JDUA 4L0DA 1W5EA 4F8EA 5F23A 1FSGA 3MYYA 4IDFA 3NWOA 3LPDA 4EJSB 1K0FA 3BIJA 4RVCA 1I7PA 4M6WB 1L7OA 1Y1RA 4LEIA 2ZAYA 5T6BA 2ABWA 3FYCA 3IRUA 3Q6IA 5GTDA 2R62A 1L4HA 1R37A 4FS8A 2LZ0A 3VTZA 4Y0VA 4KVGA 3PPWA 2FWIA 3LWZA 2CLCX 3ONNA 4AUNA 1X9GA 2QXYA 1PGOA 2HK9A 1MJ5A 4BV9A 4KOAA 3NW9A 1H8EA 3GBPA 4DWJA 3QVXA 1XPRA 4X05A 5SYAA 4AD8A 4PW0A 2PUTA 5BO5A 1J2RA 5FWYA 3B53X 5THQA 3RREA 4RKYA 1BMDA 3DQPA 3H5WA 4GXTA 1V6AA 3TQOA 2XADA 1OLXA 2PGLA 1A2KC 1KEUA 1P2UA 4OQMA 3AOGA 3FCAA 3G7SA 3F3KA 4R16A 4XLLA 3WGMA 3WC4A 4BN4A 4Q4DA 4UHKA 4EFNA 2RD2A 2WT8A 2BGRA 3Q5DA 5JAUA 3ETDA 1LQTA 2HX1A 3DUFB 4HAOA 1UEIA 1Q0TA 4J7AA 4UDXX 3Q5GA 3REOA 2IHNA 4EK9A 1KQ3A 3UATA 1B76A 2GMWA 1R6BX 4UXHA 1XQWA 1N5IA 2DTEA 3WWOA 5ICFA 5H83A 3ZCPA 4Q7JB 3TIIA 1IB0A 2I62A 4BQFA 4X3PA 3K6JA 2VDJA 3DE2X 4IL5A 1GARA 5F2KA 4G0WA 2BFDA 2CSXA 1LPNA 5IXJA 1MJFA 2Q4DA 4KXLA 1TYBE 2CUNA 2ZQZA 4L08A 3WIDA 1B00A 3L8YA 4KLNA 4URYR 3EXFA 2JGFA 4Y1EA 5E6RA 4DABA 1CUXA 2YZGA 2FETA 4FNGA 3EAQA 4IFIA 4UUOA 4MGIR 4N65A 1ZA2A 4B40A 4JMLA 1BA3A 2O8EA 4JZKA 4J75A 1UPFA 4IZHA 1AC5A 4J8PA 1K88A 1EFPB 4BFSA 4Q5IA 3EZLA 2O2JA 4D02A 4H1WA 3M6MD 2HYIC 3OCYA 5CXSA 1UXJA 1WPRA 1WF3A 1ID1A 4YIKA 5IYRA 3UAZA 3CLKA 3Q8KA 2HT1A 3Q9LA 4YI3A 3WDSA 4OQLA 5DK4A 3ZQUA 5JXHA 4JI2B 5TJHA 5J1SB 5CFOA 1TA4A 1SCUB 5CNIA 3ZN2A 4INZA 1JWLA 3PICA 1HDEA 2VHEA 4P83A 4X1YA 5TS3A 3QMVA 5SY6A 5TIIA 4K3VA 2W0MA 2BRUA 2NTYC 3N28A 1ECGA 1KI2A 4CHTA 4DQKA 1XTRA 1UFRA 2EGGA 1ZGGA 2VTBA 2IZOA 1Z06A 4XWTA 1L8OA 4CKWB 2VP0A 3KV3O 4MDEA 3EX7C 2PZGA 2J3MA 5ALRA 5L46A 2ODWA 4LIPD 5CBPB 4KZKA 3OJFA 5KMGA 3A2KA 3KZXA 4PPNA 4P8RA 3W5JA 3RO7A 5IYZF 3BH7A 1O57A 1RKQA 1WXWA 2X76A 4G07A 1PQPA 1YE5A 3AUUA 3B20A 5EZ5A 4BPBA 1TA0A 2OGWA 3IP9A 4BQQA 5C5EA 3WGHA 4UDOA 4Q7MB 1I4DD 1WKVA 3D3EA 4KX5A 3VYVA 3JZIA 2IXEA 1ZI9A 3JTMA 2RHDA 3GFVA 2FP4B 1SVOA 5LDGA 1CETA 3MMZA 1X7XB 1WVGA 3FGOA 5DN6A 2FSVC 2A9RA 3SZUA 2RG1A 2DEUA 1HTBA 1MENA 2RGWA 4QOIA 5BT9A 3L7IA 2CEAA 4AQDA 4CF5A 1GPH1 4DYVA 4YRBA 1RYZA 2K5UA 3F7TA 4M7RA 9ATCA 2PFKA 1PNRA 3F74A 1YDFA 2PMDA 2ZIXB 1AKNA 1O6ZA 3CO0S 3Q7IA 4L4RA 4O6VA 5ALFA 1F8UA 1ULTA 2DY0A 3HYLA 1XMJA 3RODA 4QWWA 1U4OA 3BHMA 3FB1A 4NZOA 2Y8EA 1BCRB 4Q37A 4B4VA 1EDEA 4JUAA 4TLCA 1XJQA 4X91A 2A1UA 5F2EA 5JXGA 1PFKA 5A04A 5T3YA 1A9XA 4QODA 4Y1RB 5M5BA 2IBTA 2B4QA 5K0TA 4WT7A 1E8MA 1W4LA 2WIBA 2X1MA 2NW6A 1J2JA 1C3OA 1DBPA 2HLHA 3B9PA 3N70A 4RVFA 4UXIA 3UGJA 1MFPA 3V33A 2HC9A 2OHOA 2P30A 3TXXA 3PVCA 2F1OA 4WX2B 2Z1DA 1LI5A 3DVAB 4HNAA 4KLZA 5D1NA 4BO5A 2BUBA 2ZU0C 2DYKA 1P5FA 3AR8A 4ITRC 4EHAA 5BSRA 1IQUA 1F6DA 3OOHA 4KBFA 4MV9A 5EMMA 3RANA 1AKRA 2ZRFA 1ZI8A 2B3DA 2QU8A 2XJ4A 1N77A 4Q7KA 1PJAA 3ZI7A 2JAPA 3UOGA 2AHOA 1KWKA 4M1SA 4JEUA 3FVRA 1N8SA 2XEXA 1R8XA 3ADOA 3HYRA 1R12A 4KU4A 3H1TA 5GONF 4RDHA 4DEYA 4KIJA 3CC7B 3JZDA 3MPUA 5A7FA 2O2YA 2WJJA 5LU9A 4WACA 4RIIA 3AVOA 5BYBA 1F3OA 4YRDA 1CUEA 3KCNA 4JX9A 4B0PA 4BGUA 1A3CA 3DZCA 3WK5A 4FC6A 4EWLA 4YJ2B 4D6YA 1CLUA 1HE8B 1RYBA 1FNSA 2LXNA 2VG8A 5JWRA 1KYQA 1E7YA 3O3CA 3TGPA 5I7OA 1L3IA 1N0IA 2H54A 4N8EA 4ZZ1A 3RSZA 3P26A 1U2SA 3ENQA 4RA6B 4PGMA 4R1PA 2PXCA 2UVQA 4DM4A 3IV9A 5K8VA 2BKLA 4JKOA 1HR0B 3BMQB 4OATA 2Q3EA 3MWGA 3A9RA 3QBTA 4JYPA 3S7ZA 2Z5LA 3QWAA 1NWCA 2QQ5A 2IIVA 4L4XA 4CM4B 5BSHA 2CJFA 3BKXA 3H2HA 4FFMA 1CQJB 3JD0A 1LJLA 2CLKB 2XUQA 1D7AA 3DM9B 5EZYA 1OQAA 4I1SA 4KTVE 2BOVA 1ZGJA 5D1HA 2PUVA 4AXXA 4C7OA 3C6YA 1T2CA 3DE0X 4W5QA 1GR0A 3AF2A 1T0HB 1ZH0A 1WOOA 5AKLA 2JHGA 2V98A 3L7KA 1VL1A 3AB7A 2C58A 3OMWA 3FAZA 4OKNA 1ZXBA 5L4LA 3ZWDA 4DA0A 1YU6A 3HCOA 1P1CA 4XIJA 3OKPA 3BH0A 4IQFA 2VUTA 2XOEA 3TH5A 2Q6LA 1L1EA 1DQNA 4GMGA 4U7WA 1QYXA 3FTQA 2NO0A 3T3DA 2FPIA 1L7NA 3A4YA 5KQMA 2W90A 1PJ2A 3BM5A 4K6CA 4EG4A 2Q8PA 2I34A 1JDJA 3QHPA 3E1GA 3KHSA 3L4SO 3EPJA 5A0TA 4PVCA 4OK6A 3C2QA 4R2LA 2JNWA 5F4OA 5GPBA 4ZOEA 1JG6A 3BD6A 3H3FA 1P73A 1W0JD 2H3EA 2XE6A 4JUBA 3V9AA 3BT7A 3F78A 3OEHD 4ISCA 9ABPA 4LBYA 3LQEA 4P4SA 4F9EA 1LY1A 2PR7A 1LK0A 3G85A 3NTVA 1P9LA 1X1EA 4QO8A 1UOPA 2PM8A 4QTTB 2BJWA 3ROZA 4UTPA 2D1QA 4CE6A 3TB4A 3TNYA 1UZMA 1JR3D 1ZY2A 1N5LA 2EJWA 1N75A 3U6KA 1P91A 4UVIA 1AXGA 1ZX1A 4PLGA 3T06B 4XM1A 3W05A 1WZ2A 1XP5A 3D6MA 3N2KA 4LWQA 1EGMB 1MHPA 2FUKA 3SJPA 2XCOA 4MROA 3UHOA 5B3AA 4FSXA 3NTUA 2DQYA 1J2UA 2O48X 3HGTA 1U6IA 3KSDO 2GCEA 1K9VF 2BF4A 4S1PA 1N2GA 2F90A 1P60A 2W2OA 4DPLA 1IC6A 4PYJA 2PSEA 1T5DX 2ZAIA 3VNRA 5KUTA 3ZJUA 5AHOA 3V8VA 3KTFA 2ZTLA 2AHRA 3BY2A 1E63A 1H0KA 2GZ2A 3F8WA 1RFGE 1JW9B 1NU8A 3FPAA 3KQMA 1ISHA 3QIVA 4O4IB 5E2IA 3SC2B 3IP1A 2HGSA 3LP8A 2FGJA 1FP4A 1NBWB 4MI9A 3TLGB 1WBBA 1U2GA 2WYWA 1PJSA 4OX9B 2AI2A 1KD1D 2EKZA 4CM8A 1T2EA 1DIAA 2A3NA 3CTMA 2OO5A 3HCCA 4MJ7A 4QBFA 5C46F 2Y0CA 4FNOA 5BR8B 4PLYA 1N5OX 5J40A 1SG0A 5F21A 3I45A 3QEKA 4TTTS 4UNRA 3U7EB 4P93A 2DUWA 1WUTA 2E3JA 1NA5A 2W2LA 3HXTA 2P5TB 4LDZA 5JRDS 3DCIA 3RR2A 4D4LA 2G5CA 2ARKA 3SJBA 2W2KA 4BUCA 1GSIA 1UPTA 1NUAA 5KNCD 5ER6A 2PUGA 1V0FA 1JG1A 2MU1A 4TUYB 4P92A 4QUAA 4H35A 1H4SA 2YWHA 1E1KA 1KI7A 2D59A 2W11A 5I5GA 4BDSA 3CLRD 3PX7A 1SELA 3K6SB 1JIIA 5DBOA 1WNFA 2HNAA 3NASA 4PQYA 4HAWA 1T1SA 2ZEJA 1B8NA 5D3KA 1UPXA 1JHZA 1XFAA 2C5GA 2IPLA 4X41A 1MX1A 5CEJA 1Z5VA 3HKDB 1WBJB 1Z6PA 3CZ5A 2OO5C 1AU9A 1E59A 1QIFA 3B1JA 2P78A 2ZT5A 3ZWMA 4LSGA 3TL3A 1UR5A 2UYYA 4XNFA 4WMLA 1P17A 3P4YA 4KI7A 1K5PA 1BEEA 2YS7A 1OXBB 5SICE 1FBNA 2JGMA 3CX8A 4N76A 5A9SB 5G4LA 4ZQIA 4DCMA 3ICQB 4K8RB 2C5LA 1VZ3A 4LW8A 4O02B 4YQEA 2YDYA 4FR2A 1ZNQO 2X4DA 4RDCA 4UNQA 1XG5A 4BZQA 3P32A 5BORA 2VJQA 3MWKA 3EPRA 1R50A 1C7QA 3VZPA 5IT4A 2Z8YM 3SHWA 5JADA 1RLUA 2IPMA 4WZKA 1WP4A 2ZRGA 3I42A 2JEYA 1PCXA 4HL6A 5I3CA 3ZGZA 3MC1A 1DXYA 2WU0A 4JR1A 4FHGA 3UENA 4AZVA 2P9QA 4KMRA 4ARZA 4BNUA 5DTQA 4C7MA 2J9YB 3GVLA 2QXUA 3S6JA 2JAUA 1BTOA 1JSXA 2YRXA 5EEGA 3N3AC 4CCSA 4Y2GA 1KIFA 3FNFA 1EX9A 1NXSA 1OV4A 1X9HA 2D13A 4OG2A 4DUGD 5B6JA 1ZM7A 1ZWKA 1MNAA 4HSGA 4FEGA 4AJ2A 4PSVA 2EV9A 4YP7A 4KMSA 1Q17A 3E58A 3UO8B 2GEJA 3L7DA 5LMNB 4DHEA 3WBKA 2JFFA 1FXSA 3GCWA 5C9ZA 5F33A 3R5TA 1DVRA 1Y42X 3BB4A 2HDNB 4GO1A 5DZSA 4AWBA 1A0OA 3BXXA 1RKBA 2VDUE 3EVBA 4BVAA 1D2MA 5CFMA 4XQEA 3JU3A 1H4VB 4HH3C 1WTHD 4UZEA 5ICCA 1DBQA 2EVWX 4OYLA 1Z28A 4J49A 2I4RA 5EYPB 3C6QA 1M0EA 1P5RA 4YJ2F 4AYTA 1KARA 2HOQA 3ZK8A 5H3LA 3EYWA 2C8KA 2ZGVA 1TJ5A 4O4JA 2PV7A 4XVCA 2SKCA 5DHAA 2ZCJA 1UEJA 2IVZA 4WZBB 3UT6A 2F8TA 3PC3A 5M34A 4QOGA 3MCWA 5F4BA 4BXOA 4YHBA 2E2WA 4LYYA 5EJ2A 3KJNA 2C2YA 2VQFB 5FEMA 1TU3A 4FGWA 1JF8A 1R9GA 5BVGB 2EIHA 4Z4IA 3VOTA 4R5MA 3MCAA 2P41A 3GOQA 4WCDA 5E9QA 1TEHA 1JYSA 1XEFA 4PGAA 1QE0A 2V6BA 2GSWA 1W59A 3H5VA 4G5OA 2GREA 2P67A 5ALYA 2RGGA 2XNSA 3THXB 1AQIA 4WCFC 2YFQA 3V80A 5KTMA 3PX3A 2VSFA 1Z22A 2ZDGA 3KCQA 4TLMB 4NOMA 1ZM9A 2W2VA 1FW8A 1U9ZA 3PQCA 4OBEA 5DIZA 5LBUA 5B4VA 16PKA 1XCGB 1VSUA 2FSVA 1CR6A 2I76A 1E3EA 1O87A 3KQQA 4X45A 2R4QA 4ZCSA 4E2ZA 4TN5A 2NM0A 3PUHA 1V8OA 4OXXA 3RQIA 1RYYA 3I04M 4EUFA 3ON5A 4GLLA 1SQGA 1YJXA 3B85A 4Q9IA 4UUAA 3RAGA 1PJLA 2B7LA 4ZCIA 2AEFA 2VJMB 3QXHA 4ROTA 3OZGA 4MV8A 4ATNA 5K4HA 3B9RA 4YJ3B 5TGZA 2BWJA 2GJPA 4URVR 2C4TA 2GF2A 4TV8B 2C92A 3N5CA 1BYIA 1FMJA 3LCMA 5A4FS 2AX3A 4J91A 1Q1QA 3BL8A 4DNFA 2NVUA 4L8WB 3KT0A 3LGSA 2RHCA 4P82A 4EFMA 1EVJA 1QO0A 2RB5A 3AV0B 3L7OA 2BFFB 1Y1SA 3NT4A 1DAOA 2WJWA 2G17A 1GP2A 2GAIA 3DOHA 4GL4A 4DIDA 1EZZA 5IYNA 2FMHA 3WB2A 2V54A 1CQWA 4Z99A 3TBFA 5A9TA 3R9WA 4F5EA 2JRCA 5KPDA 2PMWB 2J45A 3RH0A 3NZEA 4IVPA 1GYQA 1ZBQA 2C1EA 2Q1YA 3T7RA 1PR2A 2BP7A 3JARB 3RRXA 5CDUA 1KVTA 3OZSA 4ZYYA 4OYHA 1SKYE 1A96A 4MPDA 4NY1A 1RXCA 3W04A 4Q1AA 4BP8A 3DAFA 6ABPA 4C6RA 1W8IA 1Z62A 4XIYA 3KZVA 2LZJA 2RC6A 4HB4A 4KXMA 4BAUA 4JFRA 2QENA 3PJDA 4BVGA 4RDXA 1RAFA 4L8VA 2BF7A 3C6KA 4BUZA 3WKEA 3P4UA 4JLUA 2XVXA 2YXNA 3GIRA 5AT1A 5J4YA 3VO8A 2IYWA 1TMOA 3OEHA 2H1CA 4MS4A 4CG1A 1X7WA 1TZCA 2OVFA 3M1YA 5TEVA 4I55A 2XLBA 2LDBA 2Y2VA 4MICA 3ILYA 1CUGA 3MJCA 4YJ3A 1PHRA 1DS6A 2M1ZA 1W52X 3W5AA 4X1KA 2C0CA 3EQ2A 1S2OA 3G02A 3GVJA 3O4FA 3GF4A 4WDRA 3HAGA 1VHEA 1NN5A 1XN1A 2BCJQ 3GRUA 4C0XA 4KITB 3VAZA 1XTIA 3G1WA 2FZ4A 5EOVA 5EIHA 2YINC 1QP0A 4QBGB 2H9YA 1HDXA 1D4AA 4ZI7A 1N2XA 3BMNB 3UK0A 3AEQA 3MBKA 1U8EA 3AFIA 2FV8A 4XN0A 1XD2A 3IALA 3ICWA 3KG2A 2FLWA 2YJ5A 3HWRA 3UYKA 2AOWA 2Q3CA 3EDQA 2OMKA 1UJ4A 3PZRA 2J9ZB 4LWZA 3GLHA 3W5DA 3ONDA 2I8CA 3BJIC 3I6BA 2RE8A 2FE4A 1JLLA 4IDHA 4UEWA 1DX6A 1QWSA 2AG0A 4B4OA 4YPOA 3GLGA 3GEGA 3ZD6A 1U0SY 2YVAA 1U4SA 3GJTA 3RRZA 1G7CA 3HP4A 3LYHA 2FRVA 3MIZA 1ES9A 5A7HA 3USCS 4ZCRA 1A27A 2AS0A 1BQEA 1GJRA 3AF5A 2QLJA 2WAYA 1J1IA 1V11B 2X41A 4NEHB 4X60A 5JMPA 2ZI4A 3DKRA 1D0VA 3T9BA 1GUBA 3NT2A 1H85A 4XRGA 3A6PC 1PD1A 1MX3A 1F48A 1FUEA 5F4ZA 3M9LA 2R6JA 4A15A 1Z07A 1ZA1A 1GAJA 2XB9A 4DLAA 1W35A 3OOYA 3AV3A 4FPXA 1Q16A 1H94A 2HNKA 4TWRA 1U31A 1EH5A 3WGYA 5HS4A 5EYPA 1S3FA 1Z83A 2BKEA 2EEZA 2YWGA 1T4DA 2B5OA 2OBMA 5CXUA 5HM8A 5E6SA 3BCUA 4RFSA 4TTIA 1KTIA 3LSYA 3R0JA 1RYHA 4DMUB 2WQ6A 4UW9A 1OXKB 1E79A 4IJWA 4US2R 2HU2A 1XB2A 2G9NA 2H7XA 4LXQA 1EI9A 4R9VA 4YJGA 3VYRB 3EEYA 2P6OA 2Z6BD 1R6AA 3A3YA 1KVQA 3FMPB 3QW4B 1Q86D 2CFRA 1QC5B 1RWBA 3ADCA 2QRKA 3HE3A 2AE1A 5EKSA 2J5RA 3GA7A 5C5DA 1MQAA 5ICEA 2NZ8A 3O0DA 4ZK2A 2J0VA 1ISSA 2I1VB 2RAUA 3OFSA 3VR6A 2Q27A 4IR7A 1TJPB 1XKTA 1YCDA 5CB6A 3JRXA 5KTTA 2A14A 3Q6MA 4HQ0A 2VBTA 4XQCA 1JVBA 2VK8A 3H9UA 3AR4A 2BZ1A 1YB2A 2OEPA 1CQXA 4PGOA 2QA5A 1T10A 4PC3A 2XD4A 3IB3A 3K7EA 3MWJA 4IVNA 4OMFG 3TTTA 4CCWA 4RKFA 2ZYRA 2Y71A 2FOIA 3AHHA 4U8GA 1X42A 4YXFA 2YHIB 4RQUA 1LLFA 5T5QA 4ZVSA 3ZQ4A 2KX7A 3WZ2A 4E70A 1KDTA 1YQDA 3E7FA 2ZJOA 3NAGA 4IIJB 4KAAA 1EU1A 2MYUA 3U3JA 4X1YB 4U6SA 3MJ4A 2VQDA 1UC5B 3NEAA 1XYYA 2OSBA 1IAVA 2ZJ2A 4MOWA 4RH1A 1WB9A 1SCDA 2IJGX 4IF4A 1J8QA 5FORA 4BKPA 1PJ4A 3O4RA 3KR0A 1P4AA 1K7FB 3H6KA 2XD9A 1ZGZA 5K0NA 3VNSA 2GJKA 2IE8A 5F5XA 4PSCA 2JL1A 3DE1X 5NLLA 3WKDA 3DHYA 1GV0A 1KR5A 5J4VA 1KI9A 2KVOA 1KP3A 4GX1A 4EVIA 5IX8A 4IIJF 4MO9A 2UZ0A 5LLDA 1KS2A 2OCGA 1M3SA 5IF3A 5FOSA 5ALTA 2XCSB 3ZY2A 1YR7A 1O5TA 1UANA 1G8JA 4FQ5A 2C7RA 5TQ0B 4Q6BA 3TECE 2XYRA 4NCKA 2JJ2A 1G60A 1ZJ5A 3GUCA 5CTAA 4DDWA 1T6ZA 2DTXA 3NBZC 4PX3A 5EKTA 4IDDA 4UDNA 2D1RA 3UMGA 3IKTA 4L15A 3G0HA 3IPAA 3ZNNA 1Z6TA 2FQXA 4AJIA 2E6UX 1R00A 3SZRA 1K8ZB 5ELMA 3C43A 2XUOA 1RWPA 1DAEA 3DUWA 1OIWA 3HA2A 3IE0A 4IGKA 2V5AA 4K9NA 3G8YA 3L6OO 1GQSA 2E5WA 4B73A 5LQKA 4CL0A 1XTJA 2FFQA 3AESA 2VEOA 2OM2A 1LS6A 1KYYA 3GLTA 1MN6A 3PS9A 2WILA 2FEMA 4BRZA 5I51A 3O26A 3WJ7A 1VI6A 3BSFA 2GXSA 1ZU5A 4ZPJA 2NYRA 4H59A 4X93A 4JI3B 4A2CA 3A04A 1UIRA 4KXNA 1HDRA 1Z5NA 1YFLA 4HAIA 2O52A 1V9SA 3P52A 3RKUA 2HQOA 3ODGA 2FSIA 4V3CA 1U7WA 1H3EA 1P3DA 1QK5A 4TTVA 5DF1A 1A5TA 5JYEA 3H6GA 1IULA 3MD0A 1VA5A 3LKDA 2QS9A 3CXRA 3W8EA 1M2JA 2HRZA 1U0JA 3FWKA 2C0PA 4UUNA 3D8NA 1U28C 1H2XA 4XLHA 4Q3CA 1VHTA 3VX3A 3WQZA 1SBQA 2GM4A 4HDRB 2ODQA 2WM8A 4YGYA 4S05A 2UYHA 2XMGA 4RE6A 4Q4AB 3OKFA 2C82A 1J0CA 3EBPA 2FRXA 2EATA 3Q41A 3FM9A 4YP1A 4C6SA 1XXLA 3OOWA 2PA3A 4RJJA 3HG7A 3VSAA 1Y3IA 3CV3A 3QF4B 2RH9B 4P4UA 5JFOA 4HFMA 2VZ0A 2HQBA 3K53A 1YZLA 1C41A 4F21A 5ECWA 2O7QA 1B1AA 3KT6A 5GV8A 3U3KA 3SVLA 5JS1A 5BUQA 1IN5A 5CPBA 2QX7A 3PNVA 4FGZA 2VXCA 5KOYA 5EJ8A 3T7AA 4N3NA 2O2EA 1QE5A 5AUPB 1QRUA 4XCQA 1ZJJA 2DB3A 3KXKA 2O0KA 2ZSHA 3ZWPA 5ES3A 2HADA 3PQ3A 4HX2A 4C43A 5ALNA 4JLBA 5DVZA 3C6MA 3T56B 1OTHA 4FFVA 4JLSA 1EFRD 2G8LA 3Q9SA 2P8SA 3W5UA 3JAKB 3VKWA 1J70A