1A8PA

Ferredoxin reductase from azotobacter vinelandii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
257
structure length
257
Chain Sequence
SNLNVERVLSVHHWNDTLFSFKTTRNPSLRFENGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVQNGPLTSRLQHLKEGDELMVSRKPTGTLVTSDLLPGKHLYMLSTGTGLAPFMSLIQDPEVYERFEKVVLIHGVRQVNELAYQQFITEHLPQSEYFGEAVKEKLIYYPTVTRESFHNQGRLTDLMRSGKLFEDIGLPPINPQDDRAMICGSPSMLDESCEVLDGFGLKISPRMGEPGDYLIERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH\:FERREDOXIN OXIDOREDUCTASE
publication title The crystal structure of NADPH:ferredoxin reductase from Azotobacter vinelandii.
pubmed rcsb
total genus 76
structure length 257
sequence length 257
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1a8pA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1a8pA02
3W2HA 1VQKB 3QFRA 2BGIA 1VQ6B 3AVYA 2BF4A 1WDTA 4RD4A 4ZGNB 1EFUA 1S0UA 4K1XA 1VQNB 4TMVA 1GJRA 1G7CA 2OK7A 1AMOA 3W5HA 1IJFA 2EIXA 3VMFA 1W34A 4R71A 1QGAA 4J0QA 2X3UA 1F60A 1CNEA 3VO2A 1CNFA 2BSAA 1W87A 1BX1A 3QFCA 1VQOB 3W5UA 3CCQB 4C43A 1U2RA 2YWFA 4M0LA 1DARA 3AVTA 4PGOA 3U6BA 4ACAA 4DQKA 4Y7CA 1TVCA 4YAOA 3LO8A 3WBJA 4ZCLA 4MYTA 3WNCA 1EXMA 4ZGQB 2OTJB 1F20A 1ZUNB 3ZZ0A 4Y9UA 1QFYA 2BV3A 2C78A 1GVHA 1D1NA 4N3GA 5JBQA 3ZC3A 1FRNA 3CCMB 1QGZA 2CRVA 4TN1A 1G7SA 3B82A 5TV2A 1E63A 1KK2A 1EP2B 2XNCA 3FJOA 3OZWA 4PC1A 2QDXA 3QFTA 3SJZA 1DG1G 2QA4B 5HXBA 1JJ2B 3E20A 2E1RA 2EFGA 2R6HA 3WNDA 3AVXA 1EFTA 1H42A 2CNDA 1QH0A 2VNJA 4FN5A 4YAWA 4NCNA 4B4DA 1M1KD 3CC4B 4TMTA 3LVBA 2PIAA 3AVVA 1GR1A 1R5BA 3CD6B 4AF6A 3ZZTA 5EMNA 4RCYA 4RD0A 3ZBUA 3G4SB 2BM0A 3CW2A 3V76A 4B44A 3WXMA 3VNUA 4HE5A 3MHPA 1VQ9B 1QG0A 1XE1A 2BMWA 4N3NA 3WYAA 3VO1A 2VYQA 1KRHA 3B8HA 1UMKA 4IW3B 4ZCIA 1D8TA 3CCSB 3AVWA 2PLFA 3P27A 1IJEA 1KK0A 1BJKA 1EFCA 1B23P 1SM4A 1Q82D 1QUFA 1JB9A 2HMAA 3W2IA 1Q81D 1OB5A 1KC8D 3CMAB 4TMXA 2FX3A 3FPKA 1KD1D 1BX0A 4LBZA 3CCRB 4G1VA 2QEXB 2PMDA 2BN4A 4AF7A 4C0SA 1FNCA 1E62A 1GAQA 2QMUA 3ZBTA 1Q86D 2BPOA 5TY0A 3WY9A 1ZM9A 1ELOA 4RCZA 2YWGA 3J81k 1QFZA 1YJWB 5H5JA 2YWHA 1B2RA 1YHQB 5GV8A 3OJWA 4QHYA 3G6EB 4YALA 5KSWB 1A8PA 2HCJB 2AHOA 4LBYA 4BPRA 3CC7B 1VQMB 1R5OA 2C77A 3I56B 1VQPB 1S72B 1VQ7B 4LBWA 2HDNB 1N0UA 4M4SA 1YJ9B 1QVGB 1FNBA 1K9MD 3LYUA 3AVUA 3CCLB 2DY1A 2DCUA 1FRQA 1VQ8B 1G7RA 4F7DA 2QTLA 4EH1A 1FDRA 1KJZA 1ZM4A 4TMZA 1YI2B 1JA0A 3CPWB 2B7BA 4DQLA 4UAJA 1I7PA 3CB4A 4NBSA 1EP1B 3P26A 1D2EA 1DDIA 4B47A 3W5VA 1KK3A 3OW2B 2BM1A 1YIJB 1SKQA 1XB2A 1NDHA 1J9ZA 2D74A 3CMEB 4PC7A 3CCUB 4QFMA 2RC5A 4M2LA 4M53A 4ZV4A 1R5NA 4RD1A 2XNJA 2RC6A 3I55B 3OZUA 1N0VC 1TLLA 5DSZA 2VZLA 4M1KA 5FA6A 4ZCMA 4FK8A 4PC2A 3CCVB 1QFJA 1JA1A 2DETA 2GPJA 1EWYA 1EP3B 2J7KA 2VNIA 1TTTA 3OZVA 3PENA 1ZM3A 1Q7YD 5TR9A 4P3YA 4B48A 4RD2A 1M90D 1FNDA 1CQXA 1GAWA 4U9UA 4P6VF 1QGYA 1QUEA 4TMWA 3WBKA 1DDGA 4FWTA 2VNKA 4RD6A 3CXCB 1E64A 1VQ5B 1IB0A 2GQFA 3CCJB 2OK8A 3AGQA 3W2FA 5AN9A 4MYUA 1VQLB 4AC9A 3I1FA 1OGJA 3WNBA 2DERA 4PC6A 4LC0A 3U2QA 5GV7A 1YJNB 1G7TA 3JQQA 2DEUA 1OB2A 4YHBA 1ZM2A 3G71B 3VNVA 2XEXA 1YITB 3QSYA 2YWEA 1VQ4B 3MMPA 2B7CA 1FNMA 4HE6A 4ACBA 4YAUA 3QFSA 2B5OA 4H9GA 4B43A 5THXA 4Y9RA 1KQSB 1K73D 3W2EA 2BGJA 3AGPA 1OGIA 4WQMA 3CC2B 3CCEB 4YAFA 1K8AD 1KTVA 3LRXA 1KK1A 1BQEA 4RD3A 1TUIA 2QTZA 3CRZA 4LBVA 3A1FA 1QVFB 1GO2A 3JQRA 4B3XA 3ES9A 1NJID 4PC3A 3W2GA 1JNYA 4RJLA 1N8RD 1AIPA 4G1BA 2ZITA 1W2BB 1W35A 1QX4A 3JQPA 2BVNA 3ZZUA 5H59A 2OTLB 1H85A 3U6KA 2VNHA 2NPFA 3E1YE 3MCAA 4Q7JB 2QN6A 1HA3A 3B78A 3OJXA 3QE2A 4G5GA
chains in the Genus database with same CATH superfamily
4BNYA 3COZA 3LY5A 3TQTA 3W2HA 1GZUA 2GNAA 3N3AC 5SYAA 3BXPA 1RWWA 3MWGA 2WZNA 4G0NA 5EJMA 3WK4A 1N5DA 1Z7EA 1VE1A 2Y1GA 3GWZA 2EDAA 3JWHA 3VSAA 4CU5A 4QWWA 2CY0A 1N8KA 1TT5A 4WOBA 2D06A 1AHPA 4MLZA 1G18A 3GIWA 4QRHA 1PF7E 4BB0A 2HIHA 2GUGA 1S4QA 2WD7B 3LXXA 5DSTA 2JAOA 3BH6A 5B3AA 1DADA 4WNIA 3DVAB 4RTOA 1ZX1A 5JNUA 1RBZA 4LHEA 4WLNA 3E7PA 3DDUA 2PT6A 4OGWA 3WWOA 3HQ4O 1GNTA 3ZV7A 1J1UA 2AFVA 2C58A 3NAZA 2R6ZA 4FBLA 5IU6A 2RGWA 4X7CA 1M1UA 5JJ5A 1JV2B 2FA9A 1XE3A 2JJ1D 5F3DA 4GC5A 4Z49A 2NUTA 3TD9A 1M75A 2BH2A 4NG4A 2PEYA 4YBRA 4JLWA 2RH8A 2ZWAA 1ID1A 1W36D 2DUNA 2HLNA 4I50A 3JAMA 1QGDA 3EFHA 3FVQA 5KTTA 1BKYA 1N0WA 2PRJA 5E6SB 4TSKA 4XLEA 2BFCB 3A9SA 4FD2A 2PT7A 2J3JA 5AQEA 4CN8A 4PNEA 4M9QA 4FMBB 1QZ3A 2RJ3A 5F5NA 5KYUB 2AMVA 2VLIA 1U0JA 2A57A 4Q16A 1N6PA 3O2SB 2E5LB 1DI0A 4AS2A 1MFPA 2G40A 4OJYA 1NGSA 3VPFA 2VDRB 4M0LA 3D7NA 2AD5A 2HBRA 4Z4ZA 1ESZA 2NZUG 2ZYSA 3ZDZB 4ZZIA 3C3MA 1IBMB 3D8RA 5AOVA 1FFXA 4ZYTA 3SIRA 1NXOA 4RL6A 2FEAA 1QFMA 3PWZA 1L7NA 3DOUA 4ND5A 4OAPA 5D5HA 1ENPA 2XMGA 3K8QA 4OLFA 1VHLA 2QGZA 4K9NA 1E9DA 3PDHA 3KCQA 2RE8A 2K4MA 4OX9Y 4WLFA 1JAZA 1QGED 1IN1A 2WIKA 1VHWA 2YMLA 1BXGA 4HI0E 3DHEA 3GEIA 3TM4A 4NZOA 5C4MA 5HJEA 4FMPA 2PLNA 3LZDA 1OLUA 2FG5A 2GASA 2K7ZA 4HAOA 2IBTA 1OASA 1KZHA 4EKNB 1MC4A 2QJTA 5LIPA 1SXGA 3DLTA 3JQFA 3M4XA 4XUDA 2Z5GA 3GEBA 3ZX4A 1OX4B 3DBRA 3VJLA 5BN3B 3REGA 3WLEA 5JSQA 1AMNA 3FHTA 2ZBFA 4FTWA 4P7FA 2ODPA 3JARB 3RVQA 3QF7A 1UD4A 2W11A 4UCQA 1GN8A 4ZALA 4W8GA 4NZZA 1PFWA 3CPJB 5SYNA 2RK6A 3HG7A 1W5AA 3ZE0B 3GUUA 5AIBA 5A1TA 3A3BA 1YS1X 4H16A 5EIBD 3RSOA 3ZCQA 1JLHA 1MG0A 5L3VA 3ZJUA 4QT4A 1B6GA 4YEJA 1Z18A 1T5SA 3RWMB 2G72A 2O2JA 2VNSA 1E1KA 5F9MA 1X39A 4EQZA 1WE2A 2F1KA 3E27A 3SHQA 4M8IA 3BC9A 5KQMA 4OO3A 4Q0MA 5AKXA 3P1JA 2ZAIA 3ZYCA 4WD3A 5JVDA 2SICE 5FBQB 2JFQA 3S27A 1S4MA 3S5JA 1Q7BA 3HJGA 5B12A 3L8DA 3WO1A 3S7TA 4BQRA 4EGQA 4EW6A 2JCYA 3AUJB 3KAQA 2M6RA 5FI0B 1N7GA 2VP3A 1U7PA 3QG1A 3AUFA 3KQWA 4AJLA 2YJGA 3CH4B 2GN6A 2OZLA 2IH5A 1TPZA 1RE0A 2XUZA 5EGNA 4JI3B 4HWSA 4D9NA 1JYSA 1VHEA 4JK3A 3ZHTA 4C0AC 4MDFA 4TM8A 3STXA 2WJVA 1S3GA 2JJQA 2XXBA 4RLQA 3FSGD 3IPAA 3FZEA 3O26A 4MQBA 3TL2A 2IZOA 5KOIA 2HLDA 1O95A 5F21A 1IMOA 3RRBA 3CUEF 3PRJA 1K98A 2OD9A 2BHRA 2ODAA 2REQB 2NO4A 1B3BA 3BK1A 1R0RE 3TLKA 5C8YB 1RRGA 1TO1E 1W59A 2JIRA 3OCCA 2FZKA 1QYIA 4YDSA 1YL7A 3GGSA 1VMEA 3T15A 4R2MA 2G17A 3ZGVA 3DZFA 1ULBA 1XDSA 1Z08A 3IIEA 3LY8A 1E66A 3B9PA 4QXPA 1GG8A 4C05A 3LUJA 1X7WB 3UAYA 5CEEA 3Q8LA 1FMFA 1JSRA 5FWYB 1VOTA 5SZJA 1NQWA 2OZVA 1PSDA 1Z0SA 5ADVA 3KZ1E 2P2CA 2X7HA 2VYQA 2Y1XA 1Q7GA 4JYMA 4IFBA 5DRYA 3SFTA 3VR5D 3OEED 2W58A 1E2JA 1SUPA 1ZK1A 1QG2A 3E9DA 3JZAA 4A0HA 2PY6A 4BUZA 1B8OA 3C5HA 4RV9A 1F7UA 2R8PA 2YWDA 1Q1QA 3CCSB 1QYDA 2L82A 2GTPA 3TXXA 1M1XB 5JS7A 4K2HA 3IIKA 5AW8A 2YYSA 2WZPP 5EMMA 3Q9SA 1X1EA 1C14A 1E9SA 1KSFX 2B69A 4FXOA 4GOXA 1W4CA 3LS2A 4IZ6A 4O4JF 4QPCA 3TR6A 5K0EA 4I5GA 3PDWA 3MMNA 5CVEA 3EEBA 2VHJA 4EZIA 1X8XA 5LMZA 1U3CA 1OAOA 4MWEA 1L8LA 4F5DA 4TKVA 1FRVA 2HMAA 3W2IA 1L4NA 1ZD8A 4R2JA 3S1LA 4DLZA 2DFPA 3PGA1 4HVTA 3SKVA 4X60A 2H59A 3G2MA 2D3WA 4QNRA 5IS2A 3QX7A 5EJEA 5CFPA 3WA7A 2Q5IA 4XVQA 3TVDA 2A86A 4LRUA 5UKDA 3FPJA 3ONVA 4AT1A 3ASYA 3HKCA 5CA1F 1JWLA 2AWOA 1ZINA 4D9HA 3OKFA 1E18A 1G2OA 2IYAA 3TUZC 5JU6A 3VNAA 4B7UA 2NO7A 1C7IA 3DTNA 1G38A 1HDYA 2E6KA 3J7TA 3TSZA 1NI4A 5J4YA 1DAPA 1M5UA 2DFKB 2YYAA 3GGDA 2LXNA 4QOGA 4EG1A 2I78A 1FJHA 3H4IA 1RFLA 3AIIA 1HQKA 4QXQA 2QD3A 1T9AA 3HB9A 3SE0A 4JJKA 4RTKA 5THKA 2O3SA 4HDOB 1B2RA 1VKOA 4RDHA 2XRFA 1GA6A 5GV8A 2X5XA 3AY0A 1UC4B 3PFHA 3Q40A 3QW4B 4BQSA 1K92A 3PE3A 2IXFA 3V7AA 7MDHA 3T5MA 5HWSA 1P0IA 1Z83A 2AZ4A 4LMRA 5ILGA 5A5GA 8ATCA 2WU4A 3FFXA 4JSRA 2EG9A 3P9YA 4RC9A 5EQDA 5I51A 3H42B 2B25A 2IJGX 1E9RA 2WWTA 3AERA 3PBKA 1NVWQ 3HZOA 4GLBA 2VL7A 4UUPA 4U6NA 1Z5NA 3VC1A 5L40A 3IQXA 1G8YA 2V7GA 3NORA 1V5IA 4B7AA 1KOLA 5J4LA 3P9NA 4LDRA 1KDYA 5ILOA 3H1BA 1U6JA 1CY1A 3ADBA 2P9BA 5AI0A 3G2KA 2XD4A 1Y82A 2AQKA 4QL3A 4QUHA 4CKEA 1W9XA 5JO0A 2VT2A 2ZRCA 4P0TA 4IDOA 2AF3C 5TSDA 4KACA 1QQTA 3T9BA 2R87A 3H1FA 4QATA 3FW1A 3ONNA 4NTZA 2GPAA 3NS7A 2X0KA 3WFIA 4KQWA 1MO5A 2JBAA 4V2UA 3LC1O 1T9GS 5ADHA 2AOTA 3IXQA 3KQSA 2O2YA 1CZOA 1WXEA 1X8LA 3MWDB 3ML1A 2HRZA 2WFAA 2GBCA 1A9RA 1ZM4A 1OV6A 4I4LA 4UHDA 1WCIA 2DOKA 1S2IA 1VJ5A 5FA5A 1UZAA 2GOYA 3SEQA 4BNHA 5BPFA 1P1RA 4CG0A 3L40A 3OY2A 2ZSKA 1U1EA 2NUPA 2XR1A 3NIWA 4G2NA 3VC7A 3PUJA 1M0SA 1OFTA 2H4YA 4PSKA 4WXHA 4XFDA 3H6GA 1C3JA 1EZZA 2PMKA 4U2CA 3AEZA 3B8EA 4HDMB 5BRJA 4DT1A 1DKPA 2VYVA 3L6CA 3GD5A 4AG5A 1VHQA 2WTAA 3QENA 3SSAA 3H1PA 5CDTA 1N6KA 1Y4ZA 2UYOA 3MCTA 3IELA 1H2YA 1M7GA 1SVUA 1DZIA 4AZ0B 3TFOA 2FZWA 2HCBA 4GLJA 4AN0A 1Y7IA 4TWJA 3ONYA 2YINC 2QJFA 3CX8A 4MHSA 1XCPA 4KXYA 1W9HA 4DCJA 1FJGB 1EIZA 5IKPA 4LMBA 4AKHA 4C06A 2R5FA 3RAJA 5JDIC 16PKA 2XODA 2ZIGA 5EINA 4O5AA 3IUSA 1Y8QA 3A31A 4NMWA 4ZFNA 4Y6QA 3G5LA 4XWKA 4OIFA 1L3CA 3D3QA 1R50A 1FP6A 3AESB 3AHDA 2NWQA 2KHZA 3ADDA 4BFUA 3KKEA 2QA5A 1J09A 1ZUNA 2BGRA 5JAMA 4EQ6B 1WSBA 1YKFA 2QJWA 5LLTA 3A8JA 5IAJA 3PR1A 1QH1A 1E1CA 3WGMA 3BH4A 3KR2A 3JV7A 2M9MA 2Y9PB 3LCJA 1VE7A 4JDUA 1KRXA 5CA0F 2J3KA 3F1LA 3F6EX 1L1RA 4CEHA 4ONEA 2AHRA 3DCYA 1AF4A 4BFLA 1WU7A 1P17A 2PUDA 3C4QA 4D3DA 4RVNA 4RJ2A 4UMFA 1NBMA 2R44A 4B3IA 5KQLA 2H2DA 1HNXB 4KEAA 5HJ5A 4G0PA 1ISSA 2ACWA 2WWIA 2NTVA 4G7WA 4Q02A 5LP6F 2JEZA 1MQ9A 5DS0A 1L8AA 3WL4A 3H9QA 5G3ZA 4EB0A 5DFAA 2JHGA 2J5KA 1OYWA 3S99A 5EEHA 3WGJA 1XHFA 1GAWA 4XZ3A 5TT1A 3ED5A 2LTAA 3U26A 3IOEA 3RI3A 3U3ZA 2Y1CA 2JATA 4RGQA 1YQTA 3U7IA 5BV8A 4V3CA 1UKEA 4EOGA 2VA8A 5I7SA 2D1RA 1U8FO 2IXAA 2C7VA 3FRHA 2JD0A 3C98A 1M9NA 1EVIA 3AKDA 4JJAA 4P7GA 4LMPA 1WZIA 1L8XA 1Y8RA 1YL5A 1O0SA 1U2SA 1TCVA 3RVNA 3DO6A 4EHDA 2PRIA 1Q6YA 1DQZA 1PV4A 1J0BA 1OXMA 1VBKA 2I2DA 1XQXA 3WLTA 1RAHA 3ANXA 1RCFA 4OLHA 4IGFA 3K9GA 1ESDA 1XMPA 1J24A 1TECE 2HK6A 4UHEA 3TTWA 5M5BA 1L3BA 3PDJA 2D2VA 1S89A 5CDSA 5HRAA 1BS9A 2GZAA 2ID9A 5B3KA 3GLUA 3CCJB 3FCOA 2OK8A 1LXCA 3WC4A 3EA0A 2Z58A 1Z56C 3M81A 2XCRB 4Z4CA 4OI2A 3DZIA 1VPTA 4S1VA 2PQ2A 1C1XA 4Y0AA 4HD8A 3O94A 4NR0A 1TF7A 2MDTA 2UXDB 3RSGA 3PQ4A 1M0WA 1R6AA 1ULUA 3ESAA 3HUDA 4DB2A 1SUAA 4C4XA 1VQ1A 5KPDA 3BD9A 3T9CA 3UWDA 1RAIA 5G1OA 1CZUA 1CUGA 1HV8A 3R20A 3VZPA 1R74A 1CE8A 2QY9A 2X7XA 2YQ4A 3C97A 4LWQA 1HC7A 3NNSA 3W3AA 1BHJA 3P9QA 5LKRA 3PHLA 3AH8A 4LDQA 3G71B 3P7MA 2FOXA 3HJFA 3DF7A 1JEEA 1HNNA 1TAUA 3H11B 4OQFA 4MVJI 3JQCA 1FW6A 2GZ1A 4UEKA 3IMGA 4HE6A 2D9RA 2F7SA 1GGKA 3BD7A 3RT7A 3MJFA 3R8CA 1HE5A 3W5IA 1KO8A 1PQWA 4K9MA 4Q03A 5IHPA 3DZJA 4WESA 5DP1A 2O8CB 1ZG3A 4KPFC 1PFQA 1NZJA 4OJTA 4B43A 2RGNC 3ISXA 1JAYA 5CDYA 4V24A 1R4ZA 4ZDWA 1ODKA 1U7UA 1XMVA 2GESA 3OSZA 3QLVA 3SEAA 3AQIA 2C4WA 2W6NA 3FIJA 4R5MA 4X93A 3W1EA 3WYBA 1XROA 2E49A 4M1MA 3W5AA 5U4QA 2Z3WA 1EI9A 1W4ZA 2FSVA 4X20B 3CRNA 2NVWA 1H9CA 4CMCA 5MN4A 3L8EA 1GFIA 5BQ3A 5B7NA 4B32A 5LA6F 3GDGA 5GQSA 1X9GA 3QPWA 3T1VA 2KBFA 2W2OA 1Z35A 1N4DA 4F9TA 4F06A 1YZFA 3DHYA 4AZWA 1Y3CE 3A27A 4GM0A 3TQIA 5BR4A 1KTVA 4RF3A 1ZH4A 1MMFB 4JQSA 1FF9A 3TCXB 1ECBA 1K3FA 2QZJA 3JALA 4M0MA 3KFLA 1UC9A 4RVSA 1F0YA 1G66A 4LECA 5HK9A 1KJIA 1SMKA 2HH9A 1OJ7A 5AKJA 4Z54A 4B46A 4IHJF 5BWMA 5LR6A 3JRWA 2GLUA 5EL0A 2XCQA 2HK8A 3C0KA 4C6HA 3N0WA 1DLJA 3Q6MA 1NQXA 1Z33A 4HTFA 1RJ9B 4AJEA 1CY6A 4PC3A 2AUMA 4CL8A 1QRDA 3FFTA 4AUMA 5AI4A 3EZGA 3W8NA 3PDIB 5BSXA 3SZLA 1M83A 4Z1MD 1T5HX 4M9ZA 4EI9A 1N07A 1QQ6A 2C4VA 3IVXA 4FIZA 5JWRA 3U3OA 3LV8A 1JSLA 1I9GA 1K5PA 3TKYA 1QH9A 2XYVA 3ZI7A 4H31A 2WMOB 4WFJA 1SEVA 2DY0A 3M5PA 4R9NA 3V1YA 1NF2A 2B7LA 2GK3A 2IBMA 4G6IA 1Z5WA 4KQGA 3SYTA 2VP4A 1Z4JA 3TDNA 4EJ2A 3JQAA 5IJ9B 4AQ7A 4BZZA 4CV3A 3PYMA 1X94A 2YC2C 2YXEA 4WZAB 3GNLA 1TCBA 3FWKA 1AKEA 2GCEA 2TYSB 4Q3AA 5FOVA 4M9SA 1DHTA 4MICA 2PUGA 4P36A 3SBOA 1K8QA 3HXMA 2CNWD 3FYTA 4H6WA 4OOSA 3B78A 4TYPA 2ENWA 2JFPA 3IJPA 4I1UA 4MARA 4QU8A 4RZHA 5EXPA 1DJQA 3ICCA 3LLSA 5AVTA 4AKTA 2VSFA 1TEXA 1Q7RA 3GN1A 2H29A 4BUJA 4E1VA 4FFOA 4E08A 4DC0A 2HRBA 1C3EA 3UUEA 3EVBA 1AVTA 3R6LA 4RSGA 3G2PA 5AI5A 2CVFA 5DGTA 3NWBA 3IVGA 1YS9A 3KLBA 1RIFA 4J7AA 1GDHA 1IG3A 3OPVA 5JH7A 2VPZA 1DCMA 2Y6UA 4TL8A 2HT6A 3PEWA 3G9QA 1EFUA 3DT8A 1D6MA 2Q49A 3FNBA 5LM3A 3DBLB 4BN5A 2OGUA 3IALA 1PZEA 3U3DA 5ALLA 5HOEA 4J90A 1WB6A 4U7TB 5K0SA 1OZ0A 4FYJA 2XLBA 4NFLA 3OIYA 2XE6A 3PHIA 3VGPA 3ZVMA 4DBLC 1E7WA 5CP8A 3OC6A 3W06A 2VKTA 4GWLA 4K6GA 3SC6A 3NJ8A 4MHOA 3QVJA 1NU8A 1MXHA 2EOAA 4MIEA 5JANA 5K99A 2GA8A 1ONNA 1QG4A 4R2WA 4URUR 2G07A 2Z1NA 5ALOA 3BEOA 1ECLA 4MI6A 4HDRB 3GGJA 2YICA 4P34A 1G8KA 3IO3A 4Q12A 1J8VA 3LOUA 2ZJOA 1BX1A 1ISIA 1M6VB 1MF7A 1MPXA 3GFVA 3DMRA 5L4LA 3RGGA 3AEKB 1MOZA 1PL8A 1WEKA 1RAAA 3F6YA 3G89A 4TTPA 4FNMA 4D92A 4YMVA 2ISQA 2WWYA 4UE6A 2P0EA 1U2GC 1MAAA 2ZOSA 5EVJA 4C4PA 1VE3A 2FN9A 4DA6A 3I34X 2VATA 2Q7XA 3D3EA 4UTRA 2C99A 3JPWA 4NP6A 1OHHA 3AVTA 5FUMA 2QAIA 2VJBA 2FK7A 5SY6A 1WTHD 1YDGA 2FWRA 1L7EA 2QRQA 3GCZA 4PZUA 3CSUA 1G8MA 2QMZA 3BZUA 3I01M 1H0HA 3ZGXA 1GGVA 3L8YA 3D6HA 2GAIA 4NU0A 2HMYB 4PNPA 2BUBA 1PYGA 4CQLB 4XGRA 5JZSA 3UGQA 2XITA 1DX9A 5BVGA 2WV9A 1ODTC 1TQHA 3OMWA 4LFAB 1Y0YA 3MUNA 2CZGA 2JA1A 5KOYA 3QOFA 4WEOA 5AW4A 1O94C 4XX1A 5AW0A 1AV7A 3FPEA 3F46A 1VYHA 2CHVA 4JKIA 1PWZA 5GJCA 2IIVA 2H2IA 3K9FC 4D9JA 5GIPE 4ND1A 2BV3A 3G88A 3T4UA 1IEQA 2O8FB 1Y3BE 1QF7A 2AFHA 4IUCS 4N5IX 3W6NA 4UVEA 3G8AA 4K46A 3STHA 4IYRA 1P5HA 3F5FA 3WQBA 1FLNA 3TLGB 3QEBZ 4DLTA 4Q7QA 1T29A 2XE7A 3R3YA 3CNHA 4ER0A 2FPUA 2EZUA 3NPMA 4L4YA 4OCZA 5MDHA 1UZUA 2CF6A 1A88A 4BVFA 1LJ8A 3VHQA 1RYBA 2HCRA 2C2WA 2FW9A 3BULA 3LY7A 3ACBA 5CNIA 4Z3OA 5B1IA 4J6FA 3R41A 3MTGA 1Z37A 1UT6A 4EDHA 2QJOA 3PIDA 4D9KA 1CRPA 4JJ7A 1ZGGA 2AN3A 2WUDA 2BMVA 3SLNA 4CLHA 2JIPA 3IV7A 1JIUA 3ENNA 3WGHA 4FFBA 3ED1A 3GT0A 4BCBA 3GNSA 2BE7A 4YIHA 2VSOA 1QJ4A 4LJAA 2KW5A 1UK9A 1K7SN 2IX9A 3JYNA 4NX2A 4ZOEA 4C2AA 4UDXX 4OYLA 4QJBA 4YRQA 4CLOA 1DOAA 2DUUA 1YRAA 5J23A 2IU6A 1UKZA 4NE7A 1QE0A 2RHMA 5JCJD 1H93A 1O6ZA 2P9JA 1JDTA 4PONA 1I3LA 1B8UA 1YQWA 3PXDA 4RK1A 3H0CA 3UY4A 3EG5A 2BHNA 3UV7A 3CNNA 2HRQA 3D0OA 2PSDA 1JW9B 5I9TA 1E2GA 3OPQA 4WXRA 3EARA 3FOCA 2OYNA 5TX7A 2X86A 1KJ8A 5EUCA 5DTQA 4LHXA 3HCOA 3KYDB 4FHGA 2IHYA 4IX9A 5DKFA 1BCSA 4R0MA 3ZYZA 3LVQE 3MTBA 5CB4F 2XBMA 3RRXA 3CVJA 1AQIA 3QUAA 3QPDA 4HX5A 1NIJA 3VO1A 3EEQA 5AVJA 1GL7A 5L4SA 3P0FA 1N08A 2Q2QA 2SCUA 1GSOA 5AJXA 3IDQA 1VB3A 3FAKA 4NENA 5IABA 1NMEA 1ONBA 4L9SA 4MH0R 1P1KA 3A3NA 4BGUA 3IQFA 5AM2A 3RKUA 1P0MA 4QGGA 4FCVA 1WSRA 1Z82A 2CZCA 4YJGA 3KOOA 5HQ3B 2YVQA 4I9UA 1OPXA 3QX3A 2Z1DA 3BZBA 1H2HA 3SFZA 1M7HA 2RJNA 4HK4A 2C5HA 4ZREA 3FMPB 3DFFA 2C07A 4PWZA 1JP7A 2WVAA 3OSUA 1NXXA 2GNOA 4ID9A 2Q62A 3TNDA 4F56A 2Q0QA 5LKAA 3ZCSA 4KWHA 2O59A 4O4JB 2NYAA 1CZKA 1MQSA 3T3HA 1HE1C 1JZTA 3M4YA 4OSOA 4UXJA 1OFIA 3OQIB 4WBXC 5EJ8A 3IBCA 1XX6A 1CT9A 4XLAA 1NW8A 5K8UA 2FX3A 1BGVA 2PYIA 1ZHHA 3SQOA 4PZEA 3L6UA 3X43A 3LKBA 4WUTA 9ATCA 1LW7A 3HWSA 1JQLB 2DULA 2GJRA 3SJPA 2FEKA 3KZKA 4LISA 4YI5A 1KSHA 4BLPA 4NOKA 4LYAA 2JIBA 5J9FA 1I0IA 4OHVA 4V1CB 1OWNA 3OMLA 4HEA6 1E62A 1UANA 1EMDA 2B8EA 4X8MA 3GJ3A 2AXNA 3NRJA 1FFWA 4FXPA 4W5HA 3T9DA 3C2QA 1OH7A 4KO1S 2VJDA 1LGYA 3MT8A 1JEOA 2AUTA 4RCZA 3H1GA 2HWWA 2P67A 4G23A 4D3SA 2AMJA 2B8NA 5TQ0B 2Q41A 5JADA 5KC8A 1JIJA 1G291 1DAGA 3C6BA 2WV7A 3GJYA 3I9V6 4NZPA 4F9FA 5CEJA 4U7GA 3I0MA 4HYTA 2Q5HA 1RPTA 3FHCB 5IVKA 2H3EA 2R751 4DXDA 1NDUA 4DCVA 1P9RA 2VPYA 1MNAA 2FKNA 2ZDHA 1FFBA 2PQMA 3E84A 3GJ4A 3HVUA 5LQMA 5GZ6A 4Y1RA 5BOVA 3CVWA 1G4AE 4QOJA 3CIFA 1YJ8A 4LE0A 4IQFA 4LY6A 3RYIB 1Y81A 1GQYA 3CZCA 3K96A 1G3IA 2DT5A 2PS0A 3BB4A 4HAXA 2O2GA 4IEEA 4LBWA 4RDKA 2FLVA 1DP4A 3P8ZA 4MI3A 3UTCA 4ATNA 3L49A 5LUAA 2Q5EA 4JBGA 5AJZA 5IDQA 4WN9B 3NM5A 4TQUS 3ZU6A 3K5IA 4GYJA 4OGKA 1QVVA 1GZHB 2EGHA 3DNMA 2Y4NA 4UW9A 4YYZA 5JAZA 1OQAA 5E8JA 5I4BA 1DX6A 3REQB 1AMUA 4HFRA 2PSEA 1QTQA 3R0JA 1VLHA 2WD7A 2W9XA 2BFDA 2I2XB 4LYFA 5KNDD 1FDTA 3UENA 3DVAA 4OYHA 1E96A 1V96A 4QQNA 4F7DA 2DWUA 2QTLA 4K8RB 1GGMA 4D0LB 1DXQA 4M1TA 3X1ZA 3R3VA 1NV8A 2WM3A 3BXHA 4JT4A 5EG5A 1XQBA 5F33A 3KLNA 4Z86A 2XA1A 2IYEA 3NXSA 4UTZA 4JIGA 1BX3A 1Y3DE 4NG5A 3TPFA 1MJGA 3OQJA 4TLEA 5CURA 5FOWA 4LV6A 1D3AA 1W4LA 2VQDA 3GMSA 1WG8A 2KE5A 1S2DA 1N0HA 2B7BA 4NBSA 5E6SA 2BSQA 1L5OA 2QQGA 2P6RA 4RTSA 2BFCA 3FDIA 5DPMA 5C7YA 1RWVA 1U2EA 2G71A 4ROSA 2PKEA 1RI2A 5C1DA 1D2HA 2XOXA 2Y1FA 1ZJYA 4GP7A 4O08A 5KYUA 2JLUA 4DV6B 1RM4A 3DTVB 1VBFA 3M6LA 3JR3A 3H65A 2P7HA 4J75A 1KAMA 5A7GA 1MX9A 4X7FA 2P90A 2TMYA 4ZA2A 2VAMA 4E2FA 2VDLB 4CQNA 1EYZA 1CZRA 1RTKA 1VHOA 1USKA 2QX4A 2ZT7A 1B41A 3REOA 5LQKA 3QPCA 5FAXA 3M9WA 4KIFA 4L16A 1PJ2A 4KSYA 4A5OA 2FG7C 3INGA 3MOSA 4K6HA 5GONA 2RC5A 4M2LA 1R00A 1E3TA 1X42A 2JIQA 2ZAMA 3TVYA 4YELA 4PQYA 2YR0A 2Q7DA 4HYYA 1FTWA 4L8JA 3S2ZA 1Q0HA 4CV2A 1KO7A 3K0KA 1HEIA 1N0VC 1WUIS 1Y5IA 4YO8A 3UW1A 5H4GA 4JGGA 3CEJA 3DVRX 4NVRA 3T1QA 5B7PA 4PU0A 5TPWB 4MUHA 3QXGA 3K20A 2FJPA 1UBCA 4G4GA 1ZCFA 4PG5A 2G09A 2JGDA 1GNSA 2VKQA 2IF0A 4PLWA 4S3MA 3NAMA 4OXRA 4F3RA 1NYTA 1E9AA 1PVVA 2ZRLA 4BC0A 1MW9X 1XV5A 1A5BB 2C0QA 2EFYA 2QG9A 5AI8A 4OOVA 3U31A 1OX4A 1DRWA 1QR2A 2XBLA 3U80A 1UQRA 5BN3A 1F4LA 2FEXA 4RKRA 5CJPA 3JARA 2GPJA 3MBKA 4EUHA 1YCFA 3PXGA 4F4IA 2DPHA 5HMLA 5CA0B 1SHKA 1RBMA 2C8KA 4F3KA 2ZZMA 4CT0A 1NY5A 1T5TA 3FB4A 3HR8A 4UBKA 3UHAA 3WMWA 5IH7A 4WZEA 3OM9A 2ZI9A 3LUGA 5AHXA 3MG9A 4WZKA 4QV2A 1D9ZA 3ELBA 3RS5A 1ID8A 1TK2A 4LYGA 3FDZB 2WW8A 2C7GA 4X7MA 3BAZA 4PLCA 4KRYA 1KQNA 3SS7X 4BWYA 4COKA 3LCRA 1XZ8A 1YQUA 4REOA 5TT0A 2QUAA 3KPYA 5LP6B 4D5GA 3CKYA 1YDHA 4ZVPA 3GUHA 4E0BA 1IBLB 4EL5A 3RNLA 3G0CA 1OBOA 1Z28A 4KIJA 4O4IF 4AJ1A 1JVBA 3B3QA 2IHJA 2RGXA 4KQ2A 3J81A 5G4LA 4FMCF 1OV4A 3CLVA 3DE0X 4NMHA 1GTL1 4E15A 2L0XA 3QXSA 3EN0A 4GZLA 4YP7A 2HJSA 5HQJA 3TCNA 4WJKB 5A05A 2WY2D 4QODA 1Z17A 3FTEA 3VBEA 3VSEA 1YS4A 4QOEA 3D3WB 1SWVA 4UVGA 1FX1A 2YQZA 2NU8B 2G08A 2ANBA 2R8EA 3BB3A 3JD1A 1PWXA 4GKAA 3SJUA 1VP9A 1CETA 2J0SA 1L7OA 5TJ9A 4EYKA 2YBDA 2IHKA 2ZATA 4EM6A 2REQA 4F2PA 4PSDA 1TA4A 3RSSA 4DWVA 2Y8EA 1XU4A 4K6FA 4W5OA 2JG3A 3V2UA 2WJPA 2WHPB 5B3LA 5HIAA 5CM9C 2CXPA 3QELA 1NFRA 4PTYA 3K4QA 4TS4A 2JFFA 1CS4C 1GR0A 1RWQA 1MEEA 4ZJZA 2D8MA 3IBTA 5JT1A 1X7WA 3A1NA 4G89A 1WETA 1GRRA 3G8BA 3KSBC 5IUKC 5AKIA 4CWAA 3HSKA 1YE3A 1QE5A 1OB2A 3HA2A 3EC2A 4C4OA 2P3MA 1EVKA 1W2HA 4LTMA 4OOFA 1SC6A 4U2BA 2X7JA 3SDBA 1E7QA 3MCZA 4YHBA 1MZPA 2NU6B 3EZYA 2AEEA 5ETJA 2RKWA 2YDXA 3R0XA 4RX1A 1YS2X 1XVLA 2A8YA 2OGWA 2VI5A 3BXOA 3KG2A 1J22A 4W7IA 4EPWA 4NWIA 3FOEC 4FGJA 4O59O 1ZIOA 5BSMA 5JTUA 2J9XB 2GF0A 4K6OA 5DYTA 4ED9A 5HFNA 3DE4X 3P9RA 3PT5A 4GX0A 3R23A 4UEWA 1MP0A 5BW6B 3WYGA 5JDCA 4X44A 2AKYA 3EGEA 1OZAA 3AB8A 2O2CA 1FUEA 2HMWA 4MRPA 3UMGA 4H9GA 2QN7A 4N49A 5BSFA 1GDDA 4ZVSA 2ZB7A 2QI9F 3KWFA 1WXWA 3UA3A 2EP5A 3LT1A 3I5XA 4UCFA 1NNSA 4NEQA 1AKUA 3RFXA 4P8RA 3UK0A 4KNVA 4LJ9A 3U48A 3I8OA 3IMCA 4JP3A 4KWIA 2HAEA 2NVUA 4PYLA 5G1PA 2A5YB 5IM5A 2JGIA 2H08A 3OZTA 4L0QA 2P7IA 1HE3A 3K5PA 1L4FA 3FCCA 4J29A 4Q4AB 5KAMA 1DCKA 3SLRA 1Y4UA 4KODA 5IANA 3GCGA 3Q8KA 3DL0A 5KNBH 3M83A 2HHCA 4EGCB 4XQ9A 2X4IA 4OQNA 4FFLA 3HS3A 5H3HA 4ZJPA 1D03A 2EX1A 2G8NA 2QIPA 3CG0A 4XVRA 5IARA 3Q2OA 5LA6B 4ETWA 1M0EA 2BFOA 2E4AA 5SZIA 5BXQC 5JYCA 4MTLA 2IUUA 4OH1A 3HU3A 3QNMA 5KX5B 3JD2A 2RI0A 3QPUA 3NTLA 2QUHA 1CP3A 3DHNA 4RPLA 5CVDA 4F1WA 2V1XA 5AUNB 1HLFA 3MFQA 3HEAA 3G2HA 3MTQA 4UPVA 1IUOA 1M5RA 4KMSA 4DAOA 2UU9B 1P9NA 3IKVA 3B2QA 1JIXA 4INOA 1JT2A 1WSDA 4IHJB 4X97A 5BYJA 5IAOA 3FCXA 1E98A 2P0AA 4JQYA 4G1BA 4MR7B 4URZR 5ALGA 2BI7A 2HU5A 2J3MA 3CLHA 4ZHQB 4KE8A 3A28A 1U7DA 3ONFA 2G06A 1RTTA 5B36A 1XJCA 2QN1A 3NC4A 2GFHA 2HDHA 4X85A 5GJVC 3RRYA 1L5MA 2GRAA 1VFPA 2XSZA 3QV1A 5ER9A 1OTXA 5KX5A 3UW3A 7REQB 1GCOA 1YJBA 3DO8A 2DX7A 4W1SA 1T5DX 1PU2A 4QUGA 1ZGHA 2UVPB 2XB6A 1JVSA 4R83A 3PNYA 1NQOA 1GPBA 2JFGA 1EX9A 3L6OO 3VSDA 3IQZA 1QAQA 3Q8WA 1ZCAA 1E8MA 1NW6A 3CKMA 2ZQ5A 2B20A 4FIDA 4JHXA 4D56A 4AS1A 1XU9A 2BC9A 3GGCA 4JP8A 4RTMA 4KR6A 2P30A 3MWDA 1KSGA 1NVXQ 1FSSA 1NI5A 2QIOA 4TVSA 1VCIA 2AMLA 2R84A 2VP5A 4QQRA 3WRXA 5IT4A 1XD2B 1GUYA 1Q7EA 2VDMB 5J47A 2Q5LA 3AILA 4B3DA 1SBYA 1L1EA 1JWAB 4C4SA 2IS1A 1YGYA 2VDPB 1T4MA 4HWGA 3PC8A 4UBLA 1KQPA 1P2TA 3A2MA 3TK1A 3TLMA 1AS0A 1XVUA 3NX4A 2C9OA 8MHTA 4AI6A 3ZV4A 1IG0A 2PV7A 2ZYRA 3PC7A 2HV9A 2ZBRA 4HDMA 5A5EA 3SWWA 2X0NA 1T5LA 1QPZA 3LGXA 5L8VA 1DAHA 1JDUA 3QLUA 1RKUA 5LWHA 4FDLA 4CR6A 1GG9A 3RK0A 4BQQA 4AZ0A 1VLZA 4TPKA 2EV9A 3A0RB 1DO2A 2JIZD 2QX6A 2WG1A 3AVOA 2OPBA 1VJSA 1W0JD 5ICEA 2CBZA 2Z2IA 3RABA 2C9ZA 4RORA 1IJFA 5EIXA 1OLXB 1IJKA 3RVKA 4HXEB 4BRSA 1M2VB 1YI1A 2PO7A 1VSTA 4KW7A 5JARA 3M49A 2E37A 2IYVA 4HSGA 3ECAA 3EQ6A 1NR5A 4ZKDA 2D0DA 3AESA 5BN1A 3FVVA 3KJEA 5DNVA 1VE5A 2R8RA 1UKBA 4KXNA 4YJFB 4YFVA 4EQ6A 1EGQA 1QHIA 2W6ZA 1KS2A 2Z9DA 4II3A 4DR3B 2QW0X 3PKJA 3FNQA 4R0NA 4ITRC 3ZQUA 1YL6A 3JQFC 3FZQA 3ZHXA 5IT5A 1ZLXA 3AL2A 3Q0IA 5EOVA 4JL8A 4CF4A 5I8WA 1U2RA 2CGEA 3H84A 1RMTA 5A1JA 3TLXA 2FDRA 2XYGA 3PIRA 1R10A 1M1YB 4W5WA 5B1SA 2EIHA 4QHSA 1YTLA 5AP9A 1XKLA 5DGXA 3FHJA 1TRKA 3WIOA 3KEWA 2DSNA 3BXEA 3DWFA 5LMCA 1MX1A 1KJ9A 1VHTA 1ML3A 3ADPA 4WSOA 5E2AA 3RSFA 3ZWAA 5LYJB 4O8ZA 2HPHA 4DB4A 1ZHOA 1BVYF 2F62A 3RJ5A 5C52B 4AMVA 5F35A 4DIKA 4K6MA 5FUYA 2V4DA 3EAGA 3TZ6A 4DDMA 3D0KA 4A91A 1M74A 1N2CE 1CBUA 3QGMA 3NC1C 2HXGA 3ESXA 1Z9BA 1II0A 2Q0HA 4DLYA 4BEVA 1ZGJA 2O5RA 4U7FA 3T52A 3UB2A 2CC2A 1N7JA 4GP6A 4I2NA 5AKKA 1CF2O 4GI2A 5J40A 4C5BA 3BY1A 1GA4A 1IOLA 1OLOA 4FJ1A 4P83A 2QP9X 4D0GA 5A9SA 2PQ0A 1ZOIA 4KXQA 1QOQB 4CFSA 4BMNA 4ZC8A 4C3ZA 2PFKA 5FAKA 3CZ5A 3FRIA 1SOAA 2FZGA 2OT3B 1LCIA 1SK8A 3LP6A 2JJMA 4QECA 3ZXSA 6REQA 2QF7A 4PYJA 4BO5A 2C2YA 1NUPA 1ZICA 2VTBB 3OO0A 2ECKA 3BB1A 1NP6A 1QHHB 4FKMA 3SHVA 4E09A 2HNKA 4LZNA 2Y67A 3SYNA 2NXNA 1EQUA 1O95C 1YXMA 4KLZA 4LWZA 4X45A 1XA4A 1C8LA 1UJ2A 3W90A 2DOGA 4AYXA 5JI2E 5G0UA 3LP5A 3GG2A 3F1KA 3B85A 3RFFA 5KYXA 2NPOA 2NP6A 2EXXA 4YMSA 1Y3IA 3EQ9A 4JCOA 2H17A 3E20A 1J25A 2I87A 2RAVA 5GWXA 3O3MB 3B6EA 3SN6A 1XZCA 3H5AA 4XMYA 4YDRA 5EWLB 3VM6A 1TIPA 4AYTA 1TM7E 4EI8A 3KXPA 2DQKA 2Y05A 3TPZA 1ZIXA 3O91A 5EKXA 2FCRA 2I3BA 3DKRA 2VNJA 4OFXA 1WXGA 4M9CA 5JFTA 3MM4A 1YR1A 2NAFA 1LPSA 4RPJA 3GJSA 3LG2A 2K2QB 2FHSA 1QF6A 4XR6A 2VXOA 10MHA 3RSQA 2UAGA 2QJRA 3G05A 3P5SA 2YQ5A 3CGGA 3H11A 1NQVA 1PX2A 2IEGA 2OGZA 2IEZA 2EG5A 4MYRA 3O75A 2OVBA 1GR1A 2EHJA 4PPQA 5AK5A 5HFAA 3WVNA 2GJ9A 1XMXA 2H5LA 2VT7A 3AKYA 4KO2S 1QXSA 4TMKA 3QVGB 1L7QA 5EFOA 1OAOC 1RZRD 2O8CA 2LCFA 5I7AA 3LGAA 3ZGYA 4R7ZA 1PFVA 3OM8A 3V76A 1Y1RA 2QS9A 3KYBA 3PJFA 3ZWQA 1IVNA 1Z0JA 3SQNA 2YHIA 4PFJA 4FQ7A 3IX7A 2QMQA 3O2QB 3H5WA 1DBPA 3T7JA 1QB7A 1DTEA 1V0JA 4HLUA 1W2WB 4NV0A 5ALEA 1QRSA 1H0KA 3LPAA 4ITVA 4JLVA 5KYVA 3R7WB 4B4UA 4BKOA 5CB4B 4GBMA 1W5SA 4X20A 5KTNA 2OKGA 1IZ7A 1OSNA 4D25A 2P9HA 5GVSA 2NUBA 1TIBA 1PJAA 2O2EA 4MX8A 2HKIA 2IWRA 1JU3A 4OQMA 2XB2A 4HXGA 4JR2A 1A1SA 3IAFA 5C5IA 6YASA 1EAMA 1K7XB 2QRMA 2IFTA 4LHYA 4OQDA 1WPXA 2ZZFA 1CF9A 3LX6A 1XBTA 4I14A 1G6KA 3DPIA 2V96A 2LIPA 3NHMA 2VYNA 4N03A 5AM5A 4YUWA 3MJ4A 3GPDG 5F9HA 1MB0A 2CVOA 1I7NA 3DBIA 3EHEA 3FUCA 1O7JA 1AQYA 1R6BX 3GFRA 3KQQA 2LR0A 1M6HA 1P77A 1Q0PA 1TAGA 3OG9A 1ZJWA 4YWHA 5CFZA 3VPHA 3BGSA 3JU3A 3N70A 2PFGA 2JGJA 1L6IA 3DUFB 2QPAA 5BUSA 3BGVA 1LX7A 1RJ9A 3FPKA 3T7CA 4LBZA 1XTQA 1Z6TA 1BFDA 4MGYR 1GZVA 3QNWA 4UHBA 4O29A 3FKSD 2RH9B 3PDIA 4KAXA 4YRJA 1OXTA 2BKUA 3WLOA 4QGSA 1JHAA 3REFA 5JS2A 3IAEA 2QEXB 1HL3A 3NBZC 3QV2A 4LF8B 3KDAA 3K70D 4EAQA 3GJ7A 3NTRA 5BQ5A 1W85B 2Y99A 1XZHA 3ZBTA 4P1ZA 1YVPA 1PFKA 4Q3DA 1UEIA 2D2FA 3AKCA 2HMUA 4LGMA 3A6KA 3ACDA 3VPCA 2XKJE 4MYDA 4PAQA 5IJ9A 2WU3A 4FGLA 3I4FA 3PZRA 3Q8XB 1ZY2A 2WJ3A 2LGJA 4ILEA 2XUQA 4M8KA 4C9BA 1TDJA 4P33A 4WZAA 4IGIA 3ZIUA 4MWSA 2WABA 2C5FA 4A2CA 1VPEA 1XZFA 2VVTA 4ZT6A 3HBFA 3KEOA 3QJ5A 1M2FA 4J0IA 3JQEA 4AMUA 3KWLA 4PYRA 4BPRA 3LHSA 5IYPA 1O3YA 4XOTA 1RHKA 3R77A 2PRYA 4MJ7A 1LD3A 1UBHS 4Q5IA 1GLNA 2OUIA 2OG1A 2FDXA 1YJ9B 1ZD4A 3M4NA 3O38A 4TOIA 4X7RA 1FYXA 2P78A 1ISJA 4JGBA 3ZW7A 2BYTA 2ZAYA 5CA1B 2IYXA 1TFUA 1F5NA 4X62B 3CE9A 1WBJB 3OWOA 2PUVA 1H05A 3KQNA 4KGXA 3V8QA 3VKFA 4AZSA 5ENZA 1QGUA 2D1YA 3AC0A 4X24A 1FTGA 4CMJA 1SY7A 2SKDA 2CFRA 2AH5A 1CJVC 4RZSA 5E6UB 5I7UA 3BORA 1WOSA 4HNVA 1KA9H 1E43A 4BV3A 1VYVA 3L3BA 1XDBA 1UBKS 4QTYA 2IKSA 3EQ7A 4RANA 5KVCA 1JA0A 4XKJA 5DBFA 1BDMA 2I54A 5G2OA 3RF6A 3VQTA 1AO0A 3I6QA 1NWCA 3T3OA 3BRWA 3TINA 4RVOA 4HDRA 3HXPA 4IIBA 5ALDA 4GEGA 4Q15A 4D99A 2Q21A 1D2EA 3UAWA 2V6BA 3QKTA 1YZQA 3G9UA 2JHAA 4U9IS 1IN5A 3H2IA 1UBJS 4FT2A 1EBUA 4QNMA 4TV9F 4X94A 1QLJA 3EASA 3UJNA 1B0PA 2YVUA 3BCRA 3KQKA 3DFMA 3TIVA 3ZD7A 1F0KA 2WDPA 3IGFA 1EXNA 4OHFA 3YASA 4YRCA 2JKVA 2WD8A 3I6MA 3PL5A 4W99A 4B35A 1OT3A 1XA3A 2ZZEA 3AG5A 5COAA 5KHAA 4E70A 5BT8A 2J67A 4RS4A 2H16A 2IS2A 2A5DA 1E60A 4M53A 3F49S 1Z13A 4V3BA 3WB1A 1E2MA 1N5JA 2QNBA 1YZGA 4TWBA 2R0QC 2VJCA 2Q6VA 1WJGA 3ZXYA 4CQLA 2HUNA 4EF6A 1NATA 4PO8A 2C2GA 1Y33E 1SZCA 1HZJA 3GPCA 4YBZA 3QE3A 3CZ9A 1Y98A 2IL1A 2VWPA 2REBA 3SC2B 5DSZA 3E0XA 3PF9A 3ZK8A 3UJPA 1G5IA 1O9GA 1YBAA 2KMLA 3Q11A 4H7IA 4LI3X 4XSGA 4XVUA 2XTZA 3AM3A 4K9DA 4RENA 2WHXA 2O8FA 3WYNA 2C97A 1ZXXA 4PR0A 4A73A 4L8FA 3OFND 1XOIA 4B8YA 1L4HA 3FZNA 4BE4A 1JA1A 2Q6OA 2JFVA 2HRDA 4KQXA 4UD6A 4HNSA 1EWYA 3TLGA 1DC4A 2QGNA 4GLOA 3RVSA 5TRTA 1T9ZA 1NRIA 3QXXA 4O0MA 1QH8B 2I33A 4CM6A 4F5YA 1NLYA 1Y9AA 4ZO7A 4AKIA 1ZN2A 1I7LA 4X65B 3NBQA 1JG4A 4DR6B 1Q7YD 4D6YA 3GNQA 2GVDC 3BCSA 4B48A 4IHQA 1HFWA 2FPGB 3KE9A 4BNIA 4EARA 1KH3A 1ZI9A 4XFJA 4LK2A 3LDGA 5IM4A 4UM9D 3OPMA 4U9UA 4JWTA 4BAUA 4PM4A 1E2BA 1D0SA 4IIXA 2IPAB 2XOKD 1JQDA 1XZAA 4BGDA 4TMWA 2V55B 2HIAA 1HYGA 3HFRA 3URMA 4B7ZA 2G1KA 2IW3A 4NBKA 5E38A 3GPIA 5K2MA 5K8IA 1KNXA 3NH9A 4URHA 3DJYA 1NR7A 2X0RA 3I0NA 4U7DA 2X40A 2J1LA 4O4IB 3RS7A 4OUDB 1AXGA 4KUHA 1DPGA 2HWYA 3F9IA 1IL0A 1GNLA 1K66A 1YBHA 1WW3A 3P0RA 4CEJA 1GPH1 4FMCB 4HFMA 4I4IA 4Q18A 4HX2A 3K0CA 2XGMA 5K0TA 3JVUA 2OBXA 3E9YA 2D4AA 1ZO8A 1GDTA 1DAFA 1N3YA 1KVTA 1T5EA 2ZRGA 1KMHB 3B20A 3DP7A 3PSHA 2I7XA 2FJ0A 3UK2A 2IHZA 5DNCA 1NF8A 2EKZA 1A8UA 4XTRA 5IKMA 4NHEA 3SJCA 2C03A 3SLGA 2K6GA 4MRAA 4BKMA 3RR2A 2PLAA 4OHUA 2X9QA 3VX4A 1TYDE 3I1FA 3ESYA 3LF2A 6NULA 5F2EA 5JBNA 1I7QB 3S2YA 2CXTA 3GUYA 2C2KA 4TTRA 1K0FA 2JKYA 1UKAA 4MLPA 5CX1B 3QLVC 3KYDA 3PTZA 4OHRA 2WTEA 4MPTA 3U2QA 3OJEA 4ALKA 2P6PA 1U9ZA 4YP5A 1GGFA 2FSVC 2KS6A 1YA8A 5CTAA 5EERA 4DPKA 5CD9A 5HHTA 1JKFA 1K3UB 1RQRA 1Z8DA 3BMXA 1T1SA 5GM2A 1CY8A 1WVMA 2GX6A 3I12A 3UJDA 1T1GA 4JP1A 3KYCB 1I2AA 1YITB 4J0HA 4FLMA 3IQIX 2CFCA 2FSPA 3SVTA 5IAEA 1FYVA 1A4RA 1UFOA 4J1NA 1LBIA 2VNAA 3HM2A 2E4UA 4US1R 3Q7IA 2X4DA 3IRVA 4PW0A 5HQ3A 4YAUA 4NBLA 3CR3C 4Q24A 3JZMA 2D8AA 5AOBA 3TAHA 3UFBA 4MW4A 1RHQA 3EIOA 4GOKA 3TLAA 1V2GA 4EP1A 3A2KA 2OB1A 4ZO8A 4U8HA 3ANNA 3I1IA 4MJLA 1DL5A 4N0EA 4QQKA 4M8SA 2WG0A 1GFSA 1A9PA 3O9VA 4KGVA 2HQOA 4UUAA 4EY8A 2BHTA 3HV0A 4I55A 3ID6C 2OHJA 4L5BA 1E59A 4LRXA 3OQIA 3L7CA 2JFUA 1P1FA 1WY7A 4GSYA 5GM1A 3RARA 2YZMA 4GNKA 3HO8A 3WB9A 2AK2A 2W8ZA 5J4HA 3WG9A 3CLRD 3GVKA 3HBJA 5DIFA 1H23A 2BGLA 3FRJA 3C4JA 4Z2AA 3FETA 1ARZA 3HRHA 2AJDA 3IVCA 4LNUB 4V1CA 4F1KA 2I4MA 5I4IA 2J46A 1NUAA 3BUSA 1U8ZA 1U99A 1UFKA 3IEMA 2Q6KA 3QHPA 2AI1A 4BLQA 3RV4A 3T4PA 3JZIA 2XKAA 3GLGB 2H2GA 1QRTA 4JBYA 2ISSD 5TQ0A 2VYFA 3CXRA 3RDPA 5JO9A 2R48A 3UHJA 4UZSA 3KCNA 2GFQA 4NL4H 5H9WA 1KWGA 4M87A 3PXEA 5TB5A 4M22A 3PCRB 4J9VA 1MAHA 4P3IA 2XUDA 1HEYA 3JQRA 821PA 4P12A 4XB6B 3W0LB 1I6KA 1Y9ZA 1I36A 4LOJA 3ZCPA 1KI7A 3RYIA 1PDVA 3H1EA 3BK7A 1XZEA 4CEHB 5FUQA 3LLCA 4EK9A 3WYEA 2XUHA 1FL9A 5CJ2A 1N3IA 3R2JA 1ZRNA 3U3XA 4WN9A 1VB5A 4HPJB 4W7HA 1YQQA 4BUCA 2ILVA 1BD3A 4U2EA 3TOZA 3VPXA 5T57A 1I24A 3NATA 4OQPA 3REQA 2CDCA 5BV2P 4LG1A 1R5JA 1R7RA 3HWX1 2ZJBA 5T6BA 2UZIR 1R8SA 5I7WA 2RGUA 3IJEB 4PCLA 1T2EA 1Q77A 5BMVF 1YGPA 3BE6A 4IDQA 1NXSA 1JEJA 1M2GA 3IJ5A 4PAMA 3ZS9A 5LZ7A 4X8IA 3LKDA 3FWZA 1UR5A 3G8DA 4DM3A 1DBRA 3C1UA 3NOVA 2IHUA 1E4YA 3QVWA 5JHHB 2OGSA 5JAQA 3CUSA 4BMOB 1BHSA 1S3IA 1QHSA 2GT1A 2IPXA 3MT0A 3WGGA 1W4AA 3OO1A 4DEXA 3O8DA 5TMPA 1DKRA 1Z7YA 3F2IA 4G0WA 1U7WA 3K1TA 5B3JA 1VQKB 3ZWYA 1UBMS 4NMLA 2BF4A 1T2CA 2PKXA 2X5KO 4GH5A 4QGAA 4LZZA 4ZD6A 4BNJA 4CMGA 3IP8A 1X1TA 2PX4A 3E5NA 1SVWA 4H1WA 2XF8A 3DTVA 1VQNB 4JH0A 2IWHA 1E58A 3LUDA 4DLVA 5AICA 4TMVA 3RHFA 3T7IA 4RF4A 1VYUA 3NHLA 3V4OA 4GRIA 3ZIAD 1EM6A 1VA4A 2OAEA 3O31A 4FEAA 1U28A 1X1CA 5JBIA 4AMGA 1BPLA 4K5QA 1IPHA 5JS1A 1DO8A 4HMQA 5KTMA 5HM8A 1JXQA 4M8NE 1PW5A 2BJHA 1U8EA 1WXDA 1XWWA 2GR9A 1FEZA 2ARKA 2C5BA 2XJ4A 1GGEA 5F4OA 3SR4A 5KQRA 4C2TA 1F8YA 1PGJA 2J5RA 4J0QA 5I5GA 1GPWB 1GT6A 1W5BA 3D5QA 1M6WA 3E3AA 3NVMB 4G5FA 1AKQA 3HKEB 1TVKB 2GH1A 2J32A 3GFBA 3FYUB 2BSAA 5E4FA 4HH3C 3X3HA 3LYAA 2P75A 5TPWA 1UD3A 3C7KA 1VSUA 3AFOA 4HC4A 1NU6A 3D8SA 3R3JA 1ZUD1 4H0NA 1S02A 2MSLA 2QSZA 3IR6A 4EUKA 5CCXA 1LBQA 3GGPA 1ZI6A 4L8YA 5IJ0A 1QIGA 2HIMA 4XSVA 4C22A 4E2ZA 2QDKA 3EF0A 1JAIA 1RYDA 4RM3A 3U40A 3UK1A 1J1IA 2GYWA 5MFZA 5TEWA 1R4NA 3BRSA 3EPPA 3VYVA 3RUHA 1UADA 4NPCA 4XWWA 4OIMA 2M6KA 3OE7D 4KLRA 3U7RA 3ZG6A 2F67A 721PA 1WXHA 3WBJA 3ZVKA 3Q6NA 3A14A 1CUVA 3GVPA 5JISA 2XUKA 3GFSA 2A5GA 2UUOA 3FDZA 2G36A 3HBMA 1M8GA 2A0YA 4FYKA 4PZAA 4ZVVA 3RRZA 4BLUA 1DRKA 4ZI7F 1PHPA 4AG6A 1D1QA 3BXFA 4PABA 2PZMA 2EEPA 5IN4A 1FP7A 3KPJA 3QMMA 2ZM5A 1WKVA 4RH1A 3T5CA 3TFWA 4GOJA 3GLGE 1B6SA 1C80A 1RS0A 3UB3A 3L7BA 1CUWA 2Q9CA 2B94A 5JBQA 3DZDA 4JUIA 3ZC3A 1FRNA 1KF0A 3K35A 2DVMA 1W8IA 5A06A 3HNOA 4BVEA 2LVBA 4G5SA 2WMNB 2OAP1 3D7LA 4W7SA 3C5CA 3JVDA 3RHTA 5E0OA 4S1TA 4UUNA 2H1IA 3IVMA 3B82A 2GXAA 1N32B 2NTNA 4BQEA 4P54A 3RUPA 1OILA 4YK7A 3RD5A 2JJ8A 2QM7A 3D3WA 3VNRA 1JQBA 1I2DA 1SIBE 2X2EA 3K1JA 3OZWA 5EMKA 3R7AA 4DIUA 1P73A 2OPHA 5BSRA 1YSCA 2IYTA 1LI4A 2YV2A 4FYWA 1PW7A 1FVFA 1SUWA 3V9AA 2G25A 4R7TA 2F4VB 3B53X 2CE7A 4KR0A 2JJ2A 2OYRA 4JMPA 5BV7A 1ZAYA 3A1DA 4AJOA 1E1MA 4GDFA 2WHPA 4FBMA 4BFWA 1RI5A 3H2ZA 4BO2A 4JLBA 5KOJB 4Z4FA 1LF0A 2XRMA 1YZHA 2YJZA 1G64A 3ZLBA 5DE3A 1IDOA 3RVLA 3DFUA 4WCVA 2FPKA 3AM4A 2W6MA 3EX7C 1P1BA 1RAEA 3DPUA 3A6EA 4BMPB 1SKMA 2QUZA 3RC9A 1I8TA 1Z22A 2EGGA 3NYWA 2ZZGA 2G9UA 1IAVA 4UZEA 1U02A 5ED4A 2C2OA 5FPHA 3ZE7A 2PWPA 4AJ9A 2PWZA 4HT3B 3Q2KA 1QHFA 1A95A 4DG5A 4KO3S 5JJBA 2JAUA 4H6XA 5G41A 4RABA 4Y6GB 4QDJA 4Q3EA 5CRIA 4DDUA 3B12A 2IV3A 3RVOA 2XZDA 4ZI5A 2PO5A 4RCYA 1GNPA 1JR3A 4JVMA 3ZNPA 2LZJA 2J3LA 4TRNA 2XNDD 2R4TA 3WBFA 4JI4B 2V9CA 2O2XA 4EHFA 2DCMA 5KIAA 4IG9A 4QG7A 2HSDA 4U0JA 3ZKWB 5KEIA 1H69A 3HZHA 1RWOA 2VF8A 3JTMA 2ZI3A 1EFLA 1SCUB 1TZCA 2FMUA 4NZ9A 1KO4A 1TQ8A 1RM0A 4Q4HB 4OL9A 3SZMA 3B8HA 3OZXA 1LS1A 4F4CA 2QTCA 3TH5A 1M66A 1ULTA 1NUTA 3B1KA 2Y1WA 3W8FA 1D2CA 3G5UA 1U2QA 4Q4AA 1T35A 3KT3A 1X7DA 1GPAA 3AVWA 1JL3A 3KOMA 3RQIA 3HUTA 3UMSA 3W77A 3ZX5A 1LU9A 2OLJA 3D8UA 2YY5A 3AP3A 1DWPA 1XEXB 3AY6A 3AOEC 3DD1A 2XYQA 4G9EA 4KWEA 3NHSA 4FW8A 5LQSA 3WV4A 4A2QA 4M0KA 5LA6A 1DWOA 1P5JA 1V7CA 3P2KA 5JSYA 1O89A 1JIIA 1K4KA 2NUAA 2Q29A 3PUNA 1E6KA 3KYJB 4C7XA 2REXB 1I2MA 2XT6A 4X06A 4YN3A 4Q3CA 5JY6A 2CLIB 1IOZA 1DBIA 1GZ4A 1Y1QA 1TJPB 2PKRA 1WTAA 3LU1A 1D5WA 3EIEA 2ZBUA 2GETA 1Q6ZA 5FBZA 4DCCA 1PZMA 2EARA 3MC1A 2QZ9A 2JI6A 1BX0A 4I8IA 2GK7A 2Q9BA 1F6WA 1RSZA 4FMDB 1I2ZA 4MR7A 2NN3C 2NG1A 1C9YA 3ENVA 1QVAA 1RHUA 3I2HA 3K9HA 2WG2A 2PU5A 2ZQYA 2PMDA 1UBUS 2E9SA 4PAGA 3URKA 3BWVA 2COEA 4ZHQA 3STYA 4ZAFA 3PFWO 4YPFA 2BN4A 3AHGA 3U37A 4MRVA 3IH5A 3BL6A 1C1HA 4WXPA 1U0HC 3G2OA 3LVRE 4BVJA 4BN4A 3RAPR 1TYCA 2QMEA 4YT4A 4ZCRA 7REQA 1ZM9A 2JLSA 4KN5A 3NDIA 4DUGA 2FMTA 3PUIA 1ZKMA 4RTRA 2UVPA 2IZ5A 1RWKA 2Y76A 2UV8A 1F4VA 2Z6UA 4KR7A 3TN7A 1IK4A 2QQ0A 2AXPA 4AW9A 5CGQB 1NPTO 1ABBA 4BU1A 1AKNA 1ZJ6A 1CUFA 2BZ0A 4EF4A 3OJ0A 3OJOA 1PSZA 2G76A 5TEVA 2FGJA 4HS9A 1XK6A 3L7LA 1ICEA 3ZE6A 2ZRFA 1K4YA 1Z6QA 2M98A 3ICOA 1XD2A 4FR2A 3GRUA 2C77A 2I7TA 2WYOA 3NMUF 4DLKA 4FEYA 1S72B 1DDOA 2I6QA 2IUFA 4HRYA 2C2HA 5JAUA 1LQ2A 4DV1B 1SXQA 3ETEA 4CIXA 1UC5B 2Q6IA 2E4XA 4HUQB 1C9EA 3ILYA 1CFZA 1UIMA 5JALA 1MA0A 3QIVA 3GGGA 4G56A 3ZJVA 2DGDA 2H0RA 4RZXA 1QVGB 5JYDA 1W36B 1OTHA 4UKDA 3ZPNA 5FV7A 1SU6A 4TV8F 1IY2A 1VZ3A 5TS2A 4YRGA 3AVUA 1JDBC 2JPDA 2VHVA 2A9OA 2WWGA 3Q8MA 4XWOA 3OU2A 1G9SA 1O77A 3N39C 2DCUA 5EJAA 4BBPA 2G1PA 1XR3A 4BS9A 3M1LA 2C9MA 4A2WA 4U2FA 3FMVA 4EH1A 3HR4A 2F1RA 4UMDA 4IAOA 1RADA 3A10A 2NPIA 2YRWA 1OLXA 3GIRA 1C7RA 5ER6A 1M2VA 2M6LA 4YR7A 2COUA 2RHBA 1D0IA 5DNWA 3TLJA 3NHFA 2Y3IA 2X22A 4MV7A 1J97A 4HAWA 4K88A 5CVUA 3MQ4A 4MQFB 4KPGA 4B9EA 1JHMA 4WRRA 2CKDA 4YJFA 4C0HA 2XMSA 4YCJA 4GBED 1YVDA 1HZEA 3P26A 1U8TA 2MSEB 5DX1A 3SDSA 4XE5A 3L0CA 1PWHA 3E23A 3R4VA 4J3FA 3LTNC 2GI4A 4Z4GA 3MRSA 2WIAA 1VLLA 1QCCA 5D1HA 1B8NA 2ZXEA 3ELYA 4JKYA 4RA6B 4HPWA 4QX6A 1II8B 1WB4A 1IN7A 4JYCA 2QE7A 1P6XA 3G9ZA 1BW9A 1CEXA 3ZQ4A 3A26A 1M1YA 1XHLA 1GTVA 4Q4LA 4FC6A 5ED0A 3DT6A 4QFMA 3N0RA 3KSZO 3NHAA 5CXUA 4G2TA 1NRWA 5T6MA 4ASUD 2I76A 3DDOA 2C7OA 5LYJA 5A5DA 3ZHCA 3R7NA 3R5TA 4KIUA 1N9GB 1R0LA 2EERA 3P9SA 1NE2A 4K03A 4QTUB 1N9ZA 1K7FB 4TXJA 5D5PA 3JZDA 4JB2A 3SI7A 4RDCA 1PR5A 2H0AA 1RXUA 2HMTA 1SUSA 3RROA 1BA3A 1THMA 2Z04A 5E7IA 3I9KA 2WSSA 2YIMA 3ISJA 4P84A 3N7UA 4I5IA 3TLYA 2PIDA 2WWRA 5LQDA 4YWJA 2XTNA 4HNRA 1X7ZB 5IYNA 4G86A 3B1VA 4CDGA 3B9BA 5GVRA 4QVAA 2B6NA 5DYYA 1DIGA 4HGRA 2NX2A 2HWXA 3KPWA 3OZDA 3PLRA 3IUYA 3DPSA 2P9EA 3KJXA 5IULC 1HYHA 2VTBA 4QUZA 3KJNA 4WECA 4YRTA 5T4BA 3K1YA 1QFXA 1R0KA 2B2NA 3VU8A 5EMLA 1TVEA 2PBFA 2B83A 4RESA 3Q3AA 2OTCA 4XJSA 3BD6A 3PEFA 3PXUA 4NE2A 4Q6BA 4HZGA 4QEKA 3RTAA 4P9NA 3FYDA 1NDQA 1B2LA 1E7YA 2GHTA 2Y1DA 3LBAA 5B30A 2I66A 3R44A 1P0FA 1AGRA 4PRKA 3UQZA 3IXLA 5EWLA 4LW8A 5LBTA 4MO2A 1FLVA 1VRVA 5EP1A 5B4TA 4MA4A 3UT6A 1F48A 4S0ZA 4IRXA 1XZDA 1VCOA 4MCIA 1XMOB 2ZRAA 5A3VA 3UMFA 1VRCA 1HFKA 4PYIA 3DVSX 2R1UA 1VJRA 1P0QA 3F67A 1MRZA 1SXJA 2AVDA 4FGUA 4JBLA 3TPCA 1YRYE 4OA8A 2MR5A 3RS2A 4ARUA 5EQFA 3JX9A 2ZBQA 3R8FA 1FJXA 4D7AA 1YDMA 3IHTA 1P4GA 1KVSA 4G4JA 4LNHA 5NULA 1X7YA 3AUTA 2YNMC 1XJWA 2PMCA 1NJSA 2G80A 5JDCC 5K4AA 3LNNA 3CSDA 3H6HA 3PUWA 3ROZA 3F5QA 4IUBS 2CBGA 2F3UA 4O0LA 3JSAA 3VHXB 5ICMA 3QVGA 4CGZA 4P86A 1Z4QA 1V8BA 2GVNA 1SBTA 2NU7B 3HJBA 4V0QA 5E8RA 2YV3A 3EXFB 1OAKA 1WXIA 4Y2JA 4XM0A 4E07A 4E2XA 2J5QA 2BSXA 1XMQB 1TOAA 2UZ1B 1GPKA 4GPEA 2XUAA 2IZZA 4RGVA 3VPBA 1XJ0A 1AA6A 3O8OB 5JAIA 4TTQA 4MV0A 3A4TA 3EIHA 1MAUA 3OX2A 1MIOA 2GBLA 4LRSB 1RZ3A 3R7WA 4Z6KA 5CB4A 4IJVA 4PPGA 5LXTF 2O2ZA 2OXTA 2J7PD 5CYFA 3SQLA 1YK1A 4PCUA 1SHZA 4AN1A 1AO3A 3WDMA 4QFCA 5H4HA 2OSBA 4YUAA 1L7AA 3C1TA 3ROTA 3PCXA 2YY7A 4Z0PA 4MUBA 4JELA 1FXWA 1KJYA 3GRVA 3WAKA 4UHCA 4D3FA 4DG9A 1U8XX 3GXOA 4NU6A 3EFEA 3ZDFA 3BWDD 3CJRA 3L79A 1YVEI 2NSDA 1JLKA 5A3SA 3RYTC 2XUIA 4UFPA 4LXIA 4RS3A 4FOSA 4KQ9A 3KFVA 5D86A 5DGCA 1OB0A 4OD0A 2C9YA 3MAAC 4X00A 2V7WA 2CUZA 1CQIB 2VC2B 3C15C 3AJAA 3OU7A 3W7AA 1D7AA 5I7RA 2YXNA 3U9TA 4MB0A 4RACA 1CPYA 3I09A 1KGSA 2C4KA 1IB6A 1FBTA 5MHTA 2QT9A 3KOUA 1GV0A 1PN3A 3NWOA 2ZJFA 2ET6A 5FBWB 3TNFA 1YF3A 2I2AA 1Y9JA 1M7BA 3WHIA 8ABPA 2A9VA 1DQSA 3KD2A 4O2AF 3QY9A 2AXQA 4ZCTA 1F7VA 2O52A 3OTIA 2R66A 3GV0A 1T2UA 4Q3LA 1KK1A 3U44B 2C5GA 3B3FA 1DSSG 3I9LA 2QTZA 4ZYYA 4BO8A 2QVGA 2WF7A 4EW3A 1KI9A 3G79A 3FDJA 1F06A 2BTOA 3D4OA 1GNQA 1MDBA 3CCBA 5FEUA 1CG6A 3M7IA 1IEVA 1DEAA 1OWPA 1L4KA 4G26A 3WFJA 4D9BA 4IDPA 5HKBA 3KE8A 2E89A 3W2GA 1UXJA 2PX2A 3QP9A 4RJLA 3TW0A 1AIPA 4MVJH 4PEVA 1RWMA 4PHTA 5AUOB 3PC8C 1XZBA 4HR7A 5GZ1A 4PGGA 5T7BA 4MMXB 1ORHA 1AN9A 5GGYA 2FPIB 1JPNA 3FWYA 4CMHA 3ZD6A 1R9JA 4IO1A 2YL2A 1W88B 2PLRA 4P3NA 3WL6A 2ATCA 1IVYA 3QLUC 5CA1A 1GARA 1T3LA 1ZH0A 2BKLA 2XI4A 1V16A 4GUAA 4RPIA 5BSWA 5LN1A 5KU1A 1XRLA 2GPBA 1P4MA 4R81A 4QPNA 2HU2A 4J03A 5GOTA 5HFJA 2G82A 2DR0A 2OG2A 3A1SA 3I73A 4M8LA 1A1VA 1OD6A 1HKUA 1ZRMA 2GAJA 2OMEA 4O2BB 1VIYA 3Q3HA 1A7KA 2FYTA 2JL1A 3R76A 1TKCA 4MWOA 4C4TA 4E46A 2C29D 5C80A 2QOEA 5BMVB 4W6QA 4D80A 5HZMA 1E2UA 1G98A 1EDBA 4HB0A 2V59A 3UKJA 2WVHA 3X1WA 2G67A 4ZCQA 4MW6A 4F0JA 5K0JA 2FF5A 4KN9S 4G5RA 1ZUIA 3D59A 2DPXA 1SBQA 1MFZA 5C81A 2I4TA 1EWRA 2OP0A 1HMYA 3W3ZB 4EA6A 5A9SB 3CVXA 2BBWA 1WDTA 3Q6IA 1C7EA 1G5FA 4JT8A 1IQPA 3FH0A 1QV9A 1R16A 3WLFA 2OO5C 3HRIA 1UPFA 1HMPA 2YN4A 5EZQA 5L3QA 4GI1A 3GOHA 4LXGA 4OG2A 3E70C 1YFKA 2YXLA 4L78A 1JKMA 3HNPA 3VMFA 3DWIA 1Y48E 2J3EA 2IDKA 3VTAA 4YV7A 1KEEB 2G28A 3PE4A 4M1YA 3L2OB 1NVTA 1SUEA 4A82A 2IIQA 3PI6A 4YRFA 3ZNOA 1IXSB 2TMDA 2FWNA 3AR2A 2PKYX 3DOOA 1T8RA 3AQ4A 4TSFD 3VO2A 3SC2A 4B2PA 3NCHA 1E2QA 1I3OA 4WFQA 5F3RA 3VR6H 1R18A 4LE2A 4A26A 3VR2A 4BB9A 4CUZA 1XRSB 1YZNA 3E4DA 4WBNF 2C4TA 2UKDA 4CM3A 3VKHA 2WJZB 1E2EA 2PZJA 4B83A 5EE1A 4REQB 1C9DB 3ZY2A 5KVVA 1CUIA 4LTNA 3RVPA 3ENZA 4Y98A 1ZK2A 2N1BA 3UGTA 4UZUA 1VLVA 5AO9A 1VGVA 3PZBA 3ZI0A 3D4IA 4U9HS 4J1TA 5F9FA 4KPYA 1Q17A 3OA2A 1ZCJA 4J3JA 4PZPA 4JI0B 1SO8A 3DFIA 1S1MA 3W5BA 1RM3A 1VGRA 1CQJB 2FWIA 2FPGA 1QKIA 2VHQA 1A9XB 1Z68A 2G8LA 2W2XA 5BSYA 1I6MA 3CVOA 4OXXA 5DTRA 3V4PB 3ZWXA 4XRRA 2NV2B 5I7HA 1Y3AA 2ZDQA 3F6RA 2QNRA 2EL7A 4LDZA 3UMJA 3EIXA 4XLFA 1QIMA 3EGDA 1XQ6A 4N41A 3AR4A 4GXNA 3T3DA 2OFFA 1NUUA 3BGOS 2XQJA 1QWSA 3CRQA 5EYPB 4ZI7B 1E77A 1Q12A 2G5TA 3RTGA 4MYHA 1VE9A 2VR1A 3DXZA 2Z2XA 2AN4A 1PJCA 3IHWA 4RAQA 4H3SA 3SC4A 3K7EA 3KZCA 4BLWA 4ZQCB 4D4LA 3HDJA 4PANA 3JSXA 1A27A 1KAQA 1WV1A 4OUDA 2FUKA 3M1AA 3V80A 5EKSA 4OHZA 4E2WA 2H5IA 5I9LA 1FLDA 1K08A 1H1LB 3GARA 5JCOC 1U04A 3TMAA 1NG9A 4BY9E 1TC1A 1Y63A 2Y0CA 1ZMRA 2FPSA 3FE2A 4X3OA 2XCLA 4MV5A 1V1MB 5KYKA 1Q7TA 1E4EA 1KU6A 1PE0A 2FFAA 4BDSA 2C3YA 2QA4B 2MT9A 2PWAA 1U3UA 3IMFA 5DNAA 5CVTA 4LDJA 4P4TA 4BO1A 2IVZA 2EKPA 4X7EA 4MQ4A 3EXHA 3TZQA 1T9HA 4JENA 1J0CA 1L4EA 3DWEX 3ILSA 3KZMA 5KVQA 1SELA 5CX1A 2R6HA 1P0PA 1J8QA 4NS1A 2E5FA 4BEWA 5K8VA 1BXKA 3QWIA 4IPTA 4JBXA 4IIEA 3T3EA 3IUQA 1NLMA 4YH1A 3T1YB 3BKWA 1YIOA 3B7WA 4HLUC 1G21A 5H70A 4BE9A 1P2UA 2POCA 1VG0B 2PKCA 3OETA 1P45A 4A5SA 2V7BA 3IL2A 3MEQA 3PGXA 1M5TA 3DYVA 3E9CA 4LJLA 4TT3A 4X1YB 3WLLA 4TZ0A 1LQUA 1E2NA 2XQGA 5HPYB 4YCDA 4JI7B 2F90A 3G0GA 1AGYA 2R7KA 3G7UA 5EHXA 1R8XA 2NYUA 3BIJA 1V7QA 4Q9JA 2Y9MB 4X7DA 2WHEA 4AZVA 5JCZA 3BFPA 1R5BA 1XUOA 2OXFA 1T9CA 1WB5A 1NRJB 4RZ2A 4XUEA 1SCQA 5B37A 4EHAA 3PJEA 1X7GA 2CVZA 2H63A 5DEOA 1KYYA 2UZ3A 5KTRA 4IH9A 1GKUB 4L28A 4N39A 2C4NA 3WL8A 4UCWA 3U5TA 1MD9A 4HE5A 4EYOA 3AETB 3A4VA 4MKGA 2JFHA 4EJMA 1J5PA 1JMYA 1N2HA 1Q5PA 2D3LA 1TM5E 2ZEJA 2XW6A 1AXEA 5DISB 1YJ5A 1D1PA 1KERA 2G7ZA 1NVVQ 3OLCX 4IJMA 4CLDA 3W79A 3GBSA 2HCTA 3E7DA 4ZCIA 1DBVO 4F6LA 2NO5A 4PG4A 1USVA 5JE8A 5HZGA 1Y8ZA 2Y2VA 2O50A 1KARA 4CTMA 1NBIA 4HQNA 5F98A 3Q41A 4PSVA 1D4ZA 4LNUA 3SSOA 3ESBA 4MGKR 3CZRA 1K7CA 1QB8A 3DR5A 2WT8A 4QBHA 1KR2A 1V4NA 2WA2A 4TT8A 1OIXA 3TLBA 1BCRB 3GLGA 2PS3A 1N1EA 3OLZA 1MX5A 1KZ4A 3IDAA 4OP3A 5CEFA 2O6HA 4RCVA 4EVSA 3PVSA 2QRVA 2VP0A 5AWFC 1EE9A 3KT8A 2H2AA 4QOSA 3T9EA 4HJRA 4CFZA 2QVLA 5K8TA 5H8WA 2WYWA 1PJBA 2GLTA 4F8JA 2XGGA 3TR5A 4TTSA 4CKWB 1YBMA 5AVOA 4EO7A 1V39A 2OCGA 4K9RA 4DOMA 1QZXA 3LPMA 1J8YF 1E1NA 4NEGA 3U3RA 3EQZA 2QSUA 4CODB 4DEYA 5LD2B 1QHGA 2LPMA 1I0ZA 2X8AA 3O3CA 1Y3HA 3M6FA 4TWZA 5EXDA 3FTCA 3CWZA 4RDXA 1E1QA 1PJ6A 4G8CA 9MHTA 3Q7PA 1FNCA 2R2GA 1QONA 2TS1A 3JWIA 4NATA 1M2OA 2O05A 2P6MA 4PX9A 5ECDA 3WGYA 4YT8A 2ZRMA 3PXXA 4PHCA 1RJGA 4L4XA 4D9GA 1Z25A 3L1UA 4B4OA 3MGKA 3O8BA 3WNQA 3D2AA 2J6HA 3IUPA 4D8WA 5DN6D 5H5JA 1V41E 1CQWA 3V3KA 3GLIB 2BJWA 3K0AA 3H19A 4US0R 4Z0NA 3VNQA 1LC3A 2V6FA 3T8YA 2GPTA 3ZH9B 3KSMA 4JQZA 4QRIA 2AA3A 3N74A 1AZWA 2GN4A 2CBXA 1QCZA 2HOQA 3WE7A 3N86A 3EQ2A 1VQMB 3DL7A 1VKZA 1O97D 1OC4A 4DWOA 2XYRA 2HDNB 5TF4A 3T0IA 5K3FB 1UM9A 1RM5A 2C83A 1MJNA 2F9LA 4QU9A 5IT0A 1EQAA 4GQIA 3D64A 3EG9B 2QM8A 2HA0A 3D2LA 2C95A 3IE1A 2GFIA 2XPCA 1WKBA 4YDQA 5DOVA 5BUCA 3EGXA 1QIEA 5KMGA 1YU6A 1NLZA 5CHEA 5CLJA 3NU1A 4HYEA 4BE7B 2IV7A 2O54A 4QM6A 5A04A 4F3YA 3L82B 3PXCX 3E5RA 2H4ZA 4CU2A 4H60A 3Q3EA 4Q1FA 3WLMA 3CZ4A 4B6QA 2VOEA 5BW5A 2MSWA 1UWVA 2ZYAA 4FX2A 1SCDA 1GGJA 2CWWA 4GDMA 4EFKA 3S2IA 2GGSA 2WWFA 2PGAA 1ZL0A 2QY6A 3HKEA 1TVKA 3I04M 3ZGLA 3Q7TA 1LI5A 3FYUA 4LXHA 4P4UA 2X0DA 2P35A 4X66B 1E1RA 2NZ2A 2CSUA 2JVJA 4TMFA 3GT4A 4JVNA 4BNWA 1DDIA 4ER3A 4NIMA 1JRLA 4DNRB 2VBIA 4N5DA 4O5OA 2B0JA 4XPIB 2O19A 1TYBE 2AOUB 3F78A 4L8WB 4OTZA 3VYRB 1KK3A 1M67A 4I1RA 2BZ1A 1DELA 1V1RB 3EF3A 2WWHA 2X9GA 3Q7QA 4H15A 4AM8A 3CRRA 3CF2A 4RM2A 1OKKD 1BLIA 3KJHA 1N8NA 4FGSA 2FWBA 4ZV4A 1M2HA 1O97C 3L6RA 4KKXB 3HE3A 5LZ5A 4C0LA 1XQWA 1ZNXA 3GW8A 2H1VA 3F5SA 4Q39A 4GFDA 4D5EA 3GLFB 1RFGE 3DBOB 1SBNE 1TLLA 2H1FA 2VEOA 3C7DB 3WSTA 4HVCA 1H4TA 1KH2A 5B6JA 3M9XA 5AW2A 4D98A 4FOPA 5A03A 3TQFA 3MPOA 1F1BA 4CNQA 4EHHA 2BF7A 1PNQA 3GLVA 5LOVB 1SQSA 2YCLA 2QUBA 1U9YA 4FK8A 3A8KA 1Q3KA 5LCXA 1H0RA 1D09A 3DQZA 2UXCB 3FPSA 2AMFA 2DHCA 2V6GA 2JI9A 4PX2A 2FOIA 4YNBA 2ZJ3A 1U1DA 4DK1A 1NL3A 1ZZEA 5KI6A 3RSLA 5J4KA 3R3UA 1Z45A 2X9VA 1C3OB 1UXIA 3ABOB 2FU5C 3IUJA 4PFKA 4RY0A 4CT4B 3K0CC 2IPLA 3OAAD 3C16C 3D2CA 5K5EA 3E22B 1T0JB 5BWCA 2ZR7A 3P71T 4PVCA 1ZNQO 2H92A 1M2NA 1S96A 1X7XB 2X3YA 1T2NA 3KTAB 3UJBA 1NVBA 4DLNA 4MRMB 5H7XA 3VNSA 1UDXA 2ZB8A 3CLSC 4EMBA 1E9EA 2NSLA 1RRVA 1W5TA 2QQ5A 4GRAA 4MUFA 4TTJA 3ZWBA 2N3ZA 2FP3A 2NTEA 2R3SA 4YUYA 1HQYE 3OFKA 5AVWA 1RWNA 1FMJA 4P31A 2JN9A 1XZNA 2SNIE 4FVTA 4KXMA 3EPJA 4CHGA 2UYHA 4FWTA 4LQLA 1FB5A 4RK7A 1XRMA 2QYHA 2W2LA 3U49A 4KKSA 2J0EA 3EULA 4GGOA 1YAJA 1HX7A 1RLJA 3M6IA 3PPVA 3VDXA 1R2QA 2JLYA 4QXMA 3B1JA 4LN1A 1WHSB 1Z5VA 5CNJA 3EIQA 4DARA 2GQFA 3HH8A 4JVSB 4R9UC 3I23A 3UJHA 4C7OB 2Y0EA 2B82A 3IA7A 1PSWA 1FQKA 4C0BA 1PL0A 3H99A 2PEZA 4R1PA 5KYNA 2FCAA 4WGGA 3WGOA 4BV8A 5JNLA 4EHBA 4N48A 3G2JA 5L3RA 2Z83A 3AV3A 1SKAA 4JB8A 1R88A 2VH1A 4B45