1HVXA

Bacillus stearothermophilus alpha-amylase
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
483
structure length
483
Chain Sequence
b'AAPFNGTMMQYFEWYLPDDGTLWTKVANEANNLSSLGITALWLPPAYKGTSRSDVGYGVYDLYDLGEFNQKGAVRTKYGTKAQYLQAIQAAHAAGMQVYADVVFDHKGGADGTEWVDAVEVNPSDRNQEISGTYQIQAWTKFDFPGRGNTYSSFKWRWYHFDGVDWDESRKLSRIYKFRGIGKAWDWEVDTENGNYDYLMYADLDMDHPEVVTELKSWGKWYVNTTNIDGFRLDAVKHIKFSFFPDWLSYVRSQTGKPLFTVGEYWSYDINKLHNYIMKTNGTMSLFDAPLHNKFYTASKSGGTFDMRTLMTNTLMKDQPTLAVTFVDNHDTEPGQALQSWVDPWFKPLAYAFILTRQEGYPCVFYGDYYGIPQYNIPSLKSKIDPLLIARRDYAYGTQHDYLDHSDIIGWTREGVTEKPGSGLAALITDGPGGSKWMYVGKQHAGKVFYDLTGNRSDTVTINSDGWGEFKVNGGSVSVWVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Crystal structure of Bacillus stearothermophilus alpha-amylase: possible factors determining the thermostability
pubmed rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 181
structure length 483
sequence length 483
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1hvxA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hvxA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hvxA01
4ZEPA 3OG2A 2TAAA 4AMCA 2WZHA 4MB3A 4DWSA 1WZLA 3DDFA 2VI0A 3CHCA 3SCTA 4X0VA 1ITXA 2CIPA 4HMEA 3VMPA 5GPRA 2DT0A 4R27A 3GXNA 5DMYA 3BUBA 1J18A 4A3YA 3LPPA 1GVIA 1QHZA 1QI3A 3BVUA 3HU7A 2WXDM 4IUGA 2VURA 4AZBA 2OW6A 3WF3A 2FHBA 2DSUA 2PB1A 1GQLA 1R85A 2DEPA 5JIPA 4U3CA 4LPCA 2OLHA 3MO4A 2XIBA 4MB5A 4W88A 1CPUA 1J0JA 2BHYA 1GJUA 3UETA 1MW0A 3BAJA 1V02A 4FF5A 3AICA 3VM7A 4JFWA 2J8GA 1W2VA 1CECA 2WSKA 1ISYA 3W27A 2ZUNA 1UR9A 3AS0A 1E6QM 3PZ9A 4TTUA 4QDMA 1KXVA 3WQWA 3AYRA 4K68A 1FHLA 4H41A 4HA4A 3A4WA 3CC1A 2WANA 5D8WA 3GNOA 2ZX9A 2PWGA 3A3HA 3CBWA 5GQBA 3FW6A 2XFRA 4JHOA 3A21A 2VCAA 3KLKA 3N11A 2ZUVA 1BQCA 4CN1A 1G9HA 1WNOA 4PMUA 1VIWA 1UQYA 4NX0A 5ABHA 1RP8A 3WF4A 4D72A 1K9FA 3W0KA 4ACZA 2WHLA 1CGXA 1E6NA 4BQ4A 5HBFA 2VOTA 1SYTA 2XVLA 1KWKA 1E1FA 4ATLA 1MFVA 3CZKA 3UERA 3AMKA 2BY2A 4D6JA 4JKLA 1N82A 3AMDA 3WEZA 3K4DA 1OINA 3A6OA 1VBUA 4DWSD 3BCFA 3CV5A 1W3HA 2PWFA 1GOKA 1QNRA 2VRJA 4NSBA 1E72M 1UD2A 2JIWA 3ZT7A 1TFVA 4MJ2A 4GKLA 4Z2JA 1WO2A 2W67A 3A47A 3K1DA 1HJVA 2VCCA 1HX0A 3AXHA 3EMQA 4AY1A 1XSKA 4DWSB 4J3WA 1CXKA 2VR5A 3AS2A 3U5YA 1E6RA 4D6IA 2XVNA 3ZMRA 4UOZA 2WK2A 2EACA 2DSZA 5D9PA 4BA0A 5A8NA 5JUVA 4W87A 4FLOA 3OLIA 2O92A 1UD4A 3K8MA 2NT1A 3VDAA 1X6LA 1E6PA 1R75A 3WD2A 4CU6A 1UOKA 5CG0A 1W32A 4PN2A 1C8QA 3KEHA 3RJYA 7A3HA 2EO7A 1J0KA 1JZ5A 1E0XA 3ARVA 4UFIA 3THCA 2VZSA 1P6WA 2D0GA 4DUXA 3WD4A 1JNEA 2D73A 4TVCA 1V0KA 3TTYA 3MU7A 1CDGA 1UG6A 1IT0A 1W9DM 5DT7A 3PZMA 2VX7A 2EPMX 3IAPA 1PZ2A 5HNNA 4CCCA 2CPUA 3WMCA 1HVQA 4QCFA 1G01A 5DT5A 1HL8A 4DO4A 3U7VA 1ZB5A 2EABA 1W91A 1M53A 4MJ4A 2CHOA 4V27A 1TE1A 3L4WA 2CCRA 1G0CA 1VB9A 3EJQA 1AMYA 4JAWA 2FHFA 5FOOA 4MDOA 2VRKA 2XHYA 1QHOA 1B3XA 4E8DA 1UKTA 3FHAA 1DWGM 1WDSA 3PZOA 3VD4A 3ZIZA 3EJUA 3D52A 2WPGA 1H41A 5KEZA 2PC8A 1W3LA 1J01A 1OGGA 3QOMA 5D9MA 3MUIA 5FKYA 3O9NA 4PMYA 1EHAA 1UWIA 1J0HA 4ACZB 3L4TA 1FP8A 2BVTA 4AZIA 3ZT6A 4QP0A 3BVXA 1FP9A 1AQMA 3PZQA 1R7OA 1JDAA 1Q6CA 1UH3A 1BYDA 1EO7A 1KCKA 1A3HA 1OCQA 3DX0A 5M5DA 5A6BD 4UOQA 1C7TA 4Z2IA 3CMGA 4CU7A 3K8LA 2VCBA 2QF8A 1ECEA 4AZ5A 1L8NA 2CNCA 4UQDA 3WD1A 2QV4A 1LG1A 1EOMA 1TG7A 1B31A 1KCLA 4BQ5A 4LGXA 1V0NA 2QLYA 2F8QA 4PUDA 1LJYA 5IHRA 3K4AA 4W8AA 2CERA 4FLRA 1BAGA 3QGVA 3KE0A 3AHXA 1GOWA 1E40A 3UG3A 4B3LA 4BZYA 1OM0A 1ITCA 4F8XA 3HG5A 5CGTA 3KWXA 4H2CA 4UR9A 2WWDA 3VM5A 2DT3A 4HTYA 3KLLA 3HN3A 5ABGA 3AQUA 3NDYA 5A3HA 2GJRA 3TTOA 4J3VA 4FNRA 3GM8A 3GYCA 2CHNA 3WUEA 4GO8A 2BS9A 1BTCA 1CYGA 3SCRA 1WP6A 3H54A 2YA2A 5M03A 1VRXA 4A3HA 4LYQA 3O6AA 4W8LA 4KGLA 2XYLA 1K9TA 2FH6A 2Y8VA 3CZLA 3MUZ1 1UD3A 1W2PA 1HIZA 3BUIA 3BSHA 4OGZA 4B9YA 1CGUA 1OT1A 1VENA 2VT0A 1C8XA 4LX4A 3RIKA 2V5DA 1DWFM 1I1WA 4JL2A 4AZCB 5A2AA 5LYRA 4D1IA 2XN1A 2YA0A 4FLSA 3WF0A 2UY3A 4FNQA 5BXTA 2RGLA 2WYSA 4QCEA 3AIBA 3SUSA 3U7BA 3AIWA 3AIEA 3AYSA 2XWDA 2G3JA 2ZIDA 2NSXA 2WLYA 3SURA 3WY2A 4QLKA 2VVSA 2VL4A 4CD5A 4DM2A 3DX3A 1WDRA 1BLIA 2UY2A 2E9LA 3UR8A 4ZENA 4UCFA 1QBBA 4OZOA 4HOZA 1J0ZA 2X2HA 1UWQA 2YIHA 4AZ7A 4CU8A 3EJPA 5A94A 4PBGA 3W6LA 4MTVA 2YL8A 1ZBKA 5E09A 3F4VA 1TQUA 3VD3A 1EDQA 1DEDA 4GZIA 2NT0A 3VDBA 4DO6A 5CQ1A 2QPSA 3AIVA 2XM1A 2OWXA 4MAVA 4MNJA 4TUFA 2JIEA 2WVTA 3WMBA 4NZCA 1E9LA 3DYPA 4UFJA 5JBEA 3VNZA 3SCUA 3BMVA 2VTFA 4U5IA 3VIFA 1EDGA 1J0IA 5I24A 3TP4A 5A8PA 1BG4A 2D3LA 1GPFA 2G4FA 1VBRA 2Y8KA 1I75A 4QLJA 2D0FA 3W53A 1B3YA 3W6MA 5BCAA 3WH6A 2GDUA 1H49A 4AYGA 2A3BA 3PBGA 4Q7NA 1HKKA 1UD6A 4BF7A 4FNSA 3WL1A 5A6MA 4U31A 1H09A 2F61A 2PBOA 2WMGA 4E8CA 1M01A 1XSJA 1GOIA 2IUZA 5A6SA 1SMDA 2PWEA 5EMYA 3PZUA 4LXFA 1XV8A 4L4OA 3EDEA 3AMLA 1Z32X 1JZ8A 1LL6A 3L2LA 2X2IA 2WMJA 4N42A 1XD1A 2W62A 1XRVA 4JL1A 1VFUA 2OSXA 4GO9A 5I0DA 1MFUA 5AC5A 1UUQA 4HU0A 3CZ8A 3T09A 3U5UA 1XYFA 1E4MM 2WKGA 2VC9A 1BGGA 3UG5A 5IFPA 1JYXA 1JNDA 2XUCA 2QPUA 5D9OA 3GDBA 3WH7A 4HU8A 3UEQA 4FMVA 3DX1A 2BV9A 3ZJKA 3FAWA 1V3JA 3PTQA 1HP4A 3VIKA 4ACYA 2BHZA 1B3ZA 1KXQA 3EDDA 4JIEA 3BSGA 3DC0A 4V28A 5CPQA 3WQVA 4DM1A 4YHGA 7CGTA 3IAQA 3GBEA 4PMNA 1UR2A 4UQCA 2XJ7A 1J12A 1FA2A 1CXFA 1KBBA 2DGAA 3AZTA 4S3KA 4WJXA 2YL6A 1GUVA 1PIGA 2DH2A 1C93A 4GIAA 1PS3A 4TVUA 3W38A 2V5CA 1TUXA 2D3NA 1NWRA 3WNKA 1E71M 4Z2HA 1CXHA 4ZE5A 4NZFA 1Q6GA 3VIOA 1FH7A 1TVPA 3WH5A 2ZXQA 1J0YA 5I77A 1NM9A 3ARTA 3S5YA 3BUPA 1W9BM 2VVNA 3BC9A 4AXNA 4P7QA 2WC4A 4PMDA 1KWGA 4KRUA 1GQIA 4WIWA 5CJ5A 3LX9A 3LXBA 1NH6A 3CIVA 1PPIA 2J77A 2X09A 4H04A 5IDIA 4CD4A 3VD7A 3T2QA 1B9ZA 1VFMA 1JYVA 1GOQA 4OOZA 3W81A 2FYVA 2Y2WA 1QWNA 3POHA 4PMOA 2DIEA 4UTFA 3D4YA 3F5JA 1OGBA 3OGRA 4AD2A 1E3ZA 1H2JA 3GXDA 1VEMA 4C7FA 3H53A 3CLWA 2W91A 5D8ZA 2Y5EA 5A6KA 4CCDA 2YDQA 1MW3A 2IXUA 1TZ7A 3NDZA 4EK7A 3ARZA 1J10A 2Y4SA 3MANA 2G8ZA 5ABFA 3VINA 4J3SA 1VAHA 4JHZA 1LWJA 4URIA 3WNPA 3PZGA 5LA0A 1V3IA 3VIJA 4EANA 5E1QA 1HXJA 1ZJAA 2WVVB 4GI8A 3OIHA 2YA1A 1IV8A 4PCTA 2Q8XA 1E4IA 1R46A 1ZS2A 2VJXA 1GJWA 2CBVA 1JZ2A 2ZWZA 3BH4A 3MMUA 3G6MA 1V3HA 4IPNB 3A5VA 2J7BA 3U57A 3FY1A 3THDA 3SCVA 3WH9A 1JI1A 3VOCA 1HXKA 3AIRA 2WMKA 2E8YA 1GVYA 2J79A 4HP5A 2UY4A 1U30A 1ESWA 1ISWA 2XWEA 3OLEA 3WF2A 4BCEA 1E70M 2WB5A 1C90A 2WVSA 4GQRA 5IHSA 5GNZA 1QI2A 5E70A 1H5VA 1FH8A 3G6LA 3D50A 1TQWA 3UCQA 1CXLA 3GH4A 3VGDA 3T08A 1BGAA 2WMFA 4D1JA 2WBGA 3VNYA 1GNXA 3RJXA 3CTTA 3EMCA 1TA3B 3A24A 4Q22A 3T2OA 3A4AA 2ZUMA 4AISA 4HOXA 3NSNA 3JUGA 4LYRA 2GUYA 3CZJA 1GCYA 4RE4A 3EDFA 2VZUA 1RD6A 1HF6A 4PMZA 3OGSA 1B2YA 4M29A 4D6CA 4AIEA 1JXJA 1KR0A 4HPHA 4BQ3A 1RPKA 3AOFA 3ARQA 4J3XA 3MKKA 1QW8A 5AYIA 3ECQA 3VX1A 3MS8A 4JCMA 1H1NA 2FH8A 2YFOA 3GTNA 3ARUA 1HKJA 3AISA 4PTVA 5HXMA 3RPMA 3S2CA 4W86A 1CGTA 4J27A 3WQ5A 1YQ2A 1CWYA 4TTGA 1JAEA 1QHPA 1X6NA 5ABFB 2FGZA 1NWTA 3DECA 4F9DA 3L2MA 1GORA 1NOFA 1QNQA 3VU2A 2ZICA 4N0RA 1UQZA 1PBGA 1GQJA 1GONA 2G41A 1UHVA 1DP0A 1PX4A 2EQDA 1FFQA 4XB3A 2JFEX 1UH4A 3WY1A 1WB0A 3CUIA 2EJ1A 3WUBA 3NUKA 4GINA 4YN5A 4FNTA 3K46A 3LPGA 2J7DA 1UASA 2Z1SA 1DWAM 2JE8A 4PTMA 4CUCA 2F2HA 4P8XA 2QMJA 3S5ZA 1XGZA 2VRQA 3ZJ8A 1JF6A 2YLAA 1K9DA 4CN4A 3LRMA 1JDCA 4MAZA 1QI4A 4C7DA 1JZ3A 1ODUA 4JFTA 1VJSA 2X2JA 3BLPX 4ZE4A 3QOKA 1V03A 1JG9A 3VILA 1ZBWA 1W1TA 6TAAA 1B3VA 1DWIM 2YDSA 2E40A 1UWTA 3ALGA 2ZX6A 5C8BB 1MYRA 1HNYA 2EADA 4B9ZA 2B31A 2X0YA 2J7GA 1Q4NX 3DHPA 4ATWA 1HJQA 2BXYA 4DWSC 3N18A 2O9OA 1R8LA 4MNKA 1QNOA 2D2OA 1ZL1A 5IXEA 3BMWA 2VZOA 4W85A 1G1YA 3WEOA 3CZGA 4OOUA 3BLKA 1BHGA 3W25A 1AQHA 4MPKA 2D22A 1KTBA 2VO5A 1UR0A 3PTMA 3WELA 2D23A 2F7RA 5HOSA 1BPLA 4PCSA 1O7AA 5BROA 4HPGA 3SUVA 2J4GA 4Z2LA 1KQYA 1UR4A 1V08A 1UWUA 2ZE0A 5HDRA 5CPTA 1LL4A 4Z2KA 5CLWA 2GDVA 2WVUA 3W24A 1R34A 1YHTA 1QNPA 4OIFA 4AZ6A 2XVGA 3E1F1 4PEEA 2VQTA 1I1XA 4J3UA 1E73M 3ZR5A 1E15A 3VUPA 1SZNA 3PN8A 1EHNA 4P8VA 4EE9A 4D6FA 3MSGA 4YPJA 3WDRA 4HA3A 5E6YA 2WHJA 4C7GA 3MI6A 4PTXA 2BVDA 3WBAA 3BAIA 1B3WA 4UQ9A 1ZJBA 1KQZA 1HJWA 3IGUA 3WFZA 5FCZA 2W63A 3LMYA 3VGFA 4DUVA 3M46A 1G5AA 3EJTA 1HT6A 1TCMA 3WY3A 3UG4A 1RH9A 5LA2A 3WDHA 3WDIA 4CGTA 2GSJA 3IJ8A 4M24A 2ZOXA 3VDCA 4P8WA 1JYWA 5A69A 2J75A 3B9DA 3CZNA 2BY3A 2O9TA 3EBVA 1LL7A 1ZU8A 1FFRA 3I3BA 2F7QA 3WKZA 4X9YA 3WNMA 2XG9A 3WQ4A 5I23A 4NI3A 2V3DA 1WDQA 3N12A 5CXPA 2F18A 4DO5A 2W92A 2XN0A 5C70A 4TOQA 3TTSA 2XFYA 2J8FA 3WDQA 4F79A 4NXSA 3ZJ6A 4JFSA 1CENA 1E55A 1EH9A 1UA7A 1CBGA 2YBTA 2PI6A 3NSXA 3ARWA 3MV01 2ZXBA 3ARPA 3DYMA 2EXOA 5CLTA 3FHQA 2DSWA 1E1EA 2F1AA 5I2UA 4XX6A 4FK9A 4AMXA 4PMRA 1UWRA 2XIIA 3WF1A 4QFUA 2PF0A 1C91A 1XHGA 1W9XA 2VZTA 1DTUA 5BXSA 1K9EA 2ALWA 4XV0A 1BPLB 3VMOA 5AC4A 3PHAA 1CGWA 2ZX7A 2WCGA 4HMCA 1UZ4A 1KGXA 1FHDA 4M56A 1WZAA 3LRLA 4AEEA 3CMJA 1EO5A 3KL5A 2ZX5A 2ZUTA 4J3TA 1QI5A 1D7FA 5HPCA 4GI6A 1EOKA 1TQTA 3ZSSA 2CXGA 2YOCA 2WNWA 4MNMA 1JFHA 2X0HA 3WQ8A 4UOJA 3WMSA 3LXCA 2XSAA 2ZXDA 3LXAA 4AZGA 3RM9A 3GBDA 4WF7A 2XFFA 4TX6A 4GI9A 3SCSA 1UH2A 3IANA 4LQ1A 3OB8A 2UWFA 1WCGA 2DH3A 1JZ6A 1NP0A 3ZJ7A 2VR4A 3CUHA 2C0HA 4MB4A 3D5HA 4Y7EA 3WDPP 3QHMA 1E56A 3L4VA 3M7SA 2WHKA 2XTKA 3VDHA 2WZEA 2OSYA 2C8NA 5BYWA 2V3GA 3BAWA 2D1ZA 2E9MA 3DX2A 3RM4A 1E6SM 3KL3A 3OZPA 1AVAA 3OGVA 2V3EA 1QI0A 3WENA 2F7OA 3DX4A 4U3AA 1H11A 4H8UA 3IJ9A 1F4AA 1H0IA 4HZ8A 3WN6A 3IJ7A 4W89A 4XZWA 1V6XA 1KFWA 2WLZA 2EPKX 3DDGA 3WUFA 5M3WA 1VF8A 2FDMA 3AHZA 3FXYA 4YHEA 3HG4A 5I3DA 3HJEA 1XD0A 2WAGA 1B30A 2J7FA 1UKQA 3RM8A 1V0MA 3VGBA 4E2OA 3DHUA 5D4YA 2YLLA 3TONA 1KGUA 1JAKA 1BF2A 3F5LA 3S6TA 1XYZA 1W9UA 4AEFA 4OJYA 3W37A 3SCWA 2OSWA 1OSEA 2W4XA 2BXZA 3AHVA 2W61A 1E6ZA 3B9AA 3NIYA 9CGTA 3RDKA 3MUY1 1LG2A 1M7XA 2O9RA 2EAEA 5KZ6A 1ISZA 2XM2A 3W4RA 3N17A 3GXPA 4B3KA 2CKSA 4W5ZA 1NWUA 1WPCA 3AI0A 2VNCA 2DQXA 3APGA 3EJRA 2O9PA 1W1PA 1WZMA 4UZSA 2DDXA 5DEZA 2WZIA 2XPKA 2CYGA 5BXRA 5EB8A 1UKPA 3ARRA 3VD9A 1PX8A 1QNSA 2BY1A 3RCNA 1XH0A 3WNLA 1W1YA 3KZSA 3NYDA 2YFNA 1UA3A 5I78A 4AMWA 2G3MA 3IK2A 1V3MA 3K8KA 1L0PA 4JCLA 4WKFA 2EPOA 3GXMA 2XSBA 1WKYA 1HN1A 5I6SA 3ZSTA 1MW2A 4WKHA 1ZBVA 3PZIA 5LA1A 1PIFA 1QW9A 2YL9A 4UFHA 1QX1A 2WMIA 4IISA 5F7UA 2CBJA 1JDDA 3T2PA 1PX3A 5E0FA 1CXEA 4UQEA 3VPLA 1E4NA 1UYQA 3VIPA 1CGYA 4KRTA 1EIBA 4M1RA 7TAAA 5DF0A 3ALFA 1SFSA 2PWDA 2BVYA 3OLDA 3ARYA 3AZSA 3N9KA 5AY7A 5FL0A 1XCWA 1JI2A 1HL9A 2DIJA 3L4YA 3AMGA 2WW5A 1S46A 3BUDA 4R5EA 5FIPA 1SR0A 2DPEA 5CPSA 2GJPA 5I79A 5CGMA 1KR1A 3MMDA 3AROA 3WSUA 4NRRA 1C7SA 1MW1A 8A3HA 4JFUA 3QHOA 5A8QA 3W26A 5I5RA 3BUQA 4J28A 3VGGA 1WDPA 3CHDA 1R7AA 5DO8A 2GJXA 5BXPA 4TXEA 1NP2A 1A47A 1V02E 2CESA 3I3DA 3MSDA 2GFTA 1KTCA 4KWUA 3HG3A 2FGLA 1HJSA 1MQPA 2MANA 2WBKA 1CEOA 4H8VA 3WBEA 4OBRA 3PZTA 1QOXA 1E3XA 2XGIA 5HPOA 1XH2A 1V0LA 4NRSA 4EAMA 4H7VA 3AHYA 4A4AA 1UR1A 3MV11 4D71A 3LRKA 1NQ6A 4PMQA 3PZVA 2IXVA 5BRPA 3WY4A 2ZUUA 1UKSA 2JALA 4JZ5A 1NARA 1TMQA 2F7PA 2BFGA 2X2YA 2G3NA 2YL5A 3W29A 3GNPA 3GZAA 1QWUA 3VGHA 3GXFA 3GH5A 1EXPA 1LQ0A 3ZM8A 3SCPA 3SUUA 5A8OA 1GHSA 3VMNA 1F4HA 2WWCA 1E0WA 1PZ3A 1US3A 2DT2A 1KBKA 2CBIA 1ODZA 2YJQA 4PSPA 3GXTA 3WNOA 6CGTA 1XC6A 5ABEA 1GQKA 1UD5A 3DYOA 5CSYA 2AOSA 1BVZA 1TR1A 3D51A 5A95A 1GZJA 1WE5A 4MDPA 2IGTA 4GXPA 4NF7A 2YDRA 3N1AA 3FAXA 1VEOA 1K6AA 2OYMA 4W7WA 3ARSA 2WMIB 3HMCA 2EBNA 4CCEA 1ISVA 3MMWA 1VFFA 3OA5A 4W5UA 4MB1A 4UZUA 4JFVA 1MXGA 4GQQA 3AS3A 1NOUA 3EMZA 3CZEA 1JFXA 2CITA 2CETA 1WZKA 1EQCA 4PUEA 1H0GA 5A6BA 1HWWA 1OIMA 1JZ7A 4AIOA 3D4ZA 3SUWA 3N04A 3W28A 4UQBA 1E43A 3CUFA 2ZUWA 1IZKA 5A6AA 1MXDA 3AS1A 3LPFA 1E6XM 3WD0A 2J7CA 2XN2A 3EDJA 4ZXLA 2XGBA 4EKJA 3ZQ9A 3WL0A 2GJXB 3CZSA 1KXTA 1HJUA 1GOOA 3AFBA 2J78A 2CBUA 4AD1A 4AZHA 3BXWA 2A3EA 2AAAA 2RGMA 3GXIA 3L4UA 1DWHM 4RE2A 3FNDA 2Y24A 4UFMA 3WFLA 3QR3A 3GNRA 2F1BA 1V6UA 3A4XA 4B15A 4PYSA 1H4PA 1V3LA 2X1IA 1W9PA 1BYCA 4JKMA 4XUYA 5JBDA 2J25A 3QHNA 4M80A 4CN6A 4U2YA 1Q6DA 3J7HA 2D0HA 4FNUA 2HISA 3CPUA 4F9JA 3AJ7A 4P7NA 5CZKA 1DWJM 3BAXA 4RL3A 2DSKA 4UNIA 3VO0A 4LYPA 4AZCA 4ZFMA 3CGTA 2QHAA 1ZBCA 3AZRA 2WCSA 3BAYA 4V2XA 2X8RA 5FD0A 1GHRA 2J62A 4CD6A 1J11A 2DSVA 1OGSA 4IPLA 5A2CA 3RO8A 1RP9A 4W8BA 1H3GA 4W7UA 1G94A 1BG9A 4NZJA 3MUAA 4AD0A 3N13A 2BY0A 2WCAA 1FH9A 3L4ZA 5A2BA 8CGTA 3N15A 3CUJA 1PEZA 3LPOA 3ZO9A 3CHEA 1UZ1A 2E0PA 2J74A 4UQAA 1CIUA 3I3EA 1HTYA 5E9AA 1TQVA 1CZ1A 5BWFA 1UR8A 5AYBA 1UKOA 1JL8A 3FN9A 4CKQA 4HMDA 4GZEA 1XCXA 3VX0A 4CD7A 4M8UA 3SIMA 2VUYA 2JF7A 2A3HA 2YBUA 1M03A 4HOWA 1NOWA 1V6YA 1TQSA 3EYPA 3EJSA 1UD8A 1HJXA 2C7FA 2QMKA 1PAMA 1V6VA 1CNVA 2E3ZA 1E4LA 1B1YA 2XVPA 3WQ6A 1W1VA 2ZX8A 4P8UA 1HKIA 4PSRA 4AD4A 1JD7A 5JBFA 2OYKA 3WH8A 4ZXOA 4CVUA 1CTNA 3BAKA 4ML4A 5GNYA 3UESA 2X05A 3BVTA 3L4XA 2ZXAA 4L4PA 3SUTA 1ISXA 1TVNA 1LWHA 1CLXA 4U5KA 5EBAA 2OYLA 2BHUA 3WDJA 2Z1KA 3TTQA 4FLQA 2XVKA 2EPLX 4KMQA 2J7EA 5A6LA 4WKAA 1W9VA 3SCQA 2FE0A 4MNLA 5BRQA 1OWQA 2HVMA 3SCNA 1VEPA 1X1NA 1SMAA 3ARXA 3RILA 5IFTA 4F66A 3SEPA 5EFDA 1R86A 1MQQA 4RE3A 4BQ2A 1MVYA 3M6DA 2A3CA 4W84A 3TOPA 4U2ZA 4AD3A 2GVYA 4FNPA 2CEQA 2W66A 3NSMA 4HZ7A 2OW7A 3AHTA 3EDKA 1OD8A 4PRWA 1WAWA 5D9NA 4CVWA 4PMVA 3D3AA 4BS0A 1BYAA 1V3KA 4D6EA 1OT2A 4GZJA 5C71A 1EA9C 1W3JA 2VZVA 1CLVA 5EFFA 1R33A 2DT1A 1V6WA 3CHFA 4AD5A 2D24A 4QLLA 5FL1A 1QBAA 2EEXA 1MQRA 1JXKA 3HZ3A 4D6GA 4H8HA 4KH2A 3VIHA 5A8MA 1JZ4A 1KGWA 4PTWA 3O2LA 4W93A 1Q6FA 4KGJA 2WKLA 1OD0A 4P7RA 4B16A 5JIWA 1IZJA 4X0NA 3T0AA 3VTRA 1LF1A 1BYBA 1LLOA 3H55A 2VX4A 2E4TA 1HVXA 1E5JA 4MADA 1BSIA 2AMGA 1OIFA 1QVBA 3OLGA 3AMCA 2BNJA 3F5KA 2WHMA 1O7DC 1C92A 4TX8A 3M07A 3OBAA 3T0BA 5ECUA 5A1AA 2NW0A 5GNXA 3OZOA 1OB0A 2VX6A 1KXHA 2VMFA 1HP5A 2GK1A 1Y7VA 4AWEA 5M17A 4TVDA 3AIUA 2EPNA 4HZ6A 1QPKA 1U2YA 4AYSA 1E5NA 4OBSA 3RMEA 4OUEA 1O6IA 3WUGA 1HKMA 3PTKA 3AXIA 4UFKA 1BVNP 1B90A 4P7OA 5A6JA 5TD4A 3VSUA 1FOBA 3VIIA 4HA1A 4S3JA 2CKRA 3WD3A 3SCOA 1XH1A 1W3KA 4WSJA 2FHCA 4Z2GA 3II1A 1CGVA 5E0CA 3AIQA 2OWCA 2JEQA 4J7RA 1MWOA 4D6HA 2PWHA 3VD5A 1R87A 2JF6A 2WVVA 3A23A 4WSKA 3VSVA 3NJ3A 3ZR6A 3BVWA 3A22A 3VSTA 5DFAA 3KL0A 3WEMA 2J7HA 2WSPA 2VQUA 4UFLA 1JYNA 4JKKA 3AXXA 3T0DA 1JD9A 3TV8A 1VJZA 2ESCA 1EQPA 4CD8A 4AC1X 5CSUA 2J47A 2PBGA 4E4PA 3CO4A 1C3FA 1C8YA 2WMHA 1XSIA 2UY5A 2V38A 1PJ9A 3CUGA 4IM4A 1NWSA 1U33A 1R47A 1CXIA 4U33A 2WC7A 1EDTA 1JF5A 2G3IA 2JEPA 2OWWA 3CH9A 3W82A 3POCA 2ZUSA 3BVVA 2YKKA 4P7LA 1JGIA 3GH7A 4XZBA 3B9EA 1AQ0A 5E6ZA 2WC3A 1TA3A 2VX5A 4AW7A 2E8ZA 4WLCA 4DUWA 1US2A 4PMXA 3WNNA 4ATDA 1EGZA 1E0VA 4AIUA 1D3CA 1J9YA 2ZWYA 1B0IA 1DHKA 6A3HA 4M81A 1UWSA 1M04A 1D2KA 3B8SA 1KB3A 3NCOA 3PZNA 2W5FA 1Q6EA 1GOMA 1OBAA 3VVGA 3WIJA 4D6DA 2D20A 2GK1B 3BCDA 4W7VA 1JIBA 3TA9A 3BLBA 1GW1A 4OKDA 3ZT5A 1T0OA 1VFOA 4NXKA 2E9BA 2WM0A 3ZOAA 3BGAA 3VIGA 4GPNA 4WK9A 2V3FA 3VIMA 4QAWA 3VKKA 3HG2A 3UR7A 2A3AA 4M82A 1BFNA 3VGEA
chains in the Genus database with same CATH superfamily
3OG2A 2Q8LA 5TK2A 4ORIA 4X80L 2ENQA 2DOCA 3UYPB 2GSGB 3BE7A 4YSEA 3IE9A 4OLWL 5I74C 2DJ4A 4KOCA 2YR3A 1CIDA 2BVUA 3GGWA 2ZBUA 1TG8A 3UJSA 4ZMWA 3TJXA 2CUAA 1U8PA 3VXRD 1NCWL 5JIPA 2VDQL 4F3FB 4L23A 4AGQA 1QLRB 3GFYA 1NBMA 4QG9A 2OLHA 1E4XL 1BQ5A 3TZVD 5ICXB 3JV0A 4RX4D 1AI1H 4RRPG 1FV1A 4P2VA 1J2WA 1E6QM 1LQAA 3ZKNC 4QMEA 1NLBL 4GUHA 2NX5B 3DIVA 2Z0BA 2IO5A 3S5NA 3FW6A 2IGLA 5AW9B 4OQ1A 3WF4A 4EIUA 3VWKD 1A5FH 1R0AL 3DHDA 1QBMH 4ATLA 1SEQH 4KV5F 2XIQA 1ZGLB 2GJ6A 3EOTH 1P6CA 1Q9OB 3A6OA 4PR4A 3RGHA 1O5KA 4D2JA 4JANA 4TVPD 4LF3B 3TFCA 1OAKL 2MNRA 4WI4A 3ARFB 3WFHB 4EPSA 4WU7A 2GABA 1VH7A 3EMQA 4BWTA 1CXKA 4APXB 1SO5A 3UACA 1RZIA 5GJSL 2O5NA 4PJIE 2QKIB 3LEXB 5GGTH 4LV4A 2NT1A 1E6PA 4CQ8A 1OL0A 2BSTB 5CZSA 4WV1A 4RDJA 1W0JA 4LVEA 2XZAL 3RJYA 3ARVA 1JNLH 5EBMA 4GQNA 1EKOA 3QNZA 4PW4A 1ZLUH 4PV8A 3TTYA 2KZ1B 2KLSA 5JHMA 1YNKL 2X42A 1KLUA 4JYDA 3HHRB 5EL1A 3U7VA 3CVBA 1G43A 2W07A 3LEVH 2DWDB 2HFEA 2CE6A 3ZGHA 4MJ4A 1VQNB 5GJPA 1R3TA 4RFOH 4IBTA 5DRIA 4OCMC 3O4OC 5ICZA 2B1HL 1MHEA 5EIVA 1BWWA 4MD4A 4GAGH 1Y6MR 2Q8AH 3RVXC 1LEGA 1YBQB 3WL9A 4DK3A 2DMBA 1ECYA 3OAYH 3QEGH 4R3SB 4WK0B 1M7IA 2JXMA 4MZYA 4P2AA 3HIJA 1C5BH 5EIIA 3V4UH 3HMXL 4OU3A 1EHAA 2WYRA 5DANA 2YWYA 4B5UA 7REQA 4ZQTA 3R18A 4QP0A 3HPXA 3OF6D 1KCKA 3QFJB 5A6BD 1O0VA 1CFMA 1NEPA 4HIHA 2UY6B 3H2AA 3F6JA 4X9GA 4RDLA 4Y9NA 4G6AD 3V5OA 2EG8A 4KQ4L 2ZC8A 1Q9KB 4F93B 3T0XA 2R1NA 3STBA 1V0NA 4KK6D 4IS6A 4PUDA 3ZDWA 1MFCL 4OAWA 4XVTL 5IHRA 2H3NA 1N8ZB 1IGJB 1W2KT 4JN2A 3S5OA 1LT7A 2R91A 2FSEA 1WOOA 3BSZL 4DHLA 1OW0A 1ET8A 1OM0A 3JRKA 2CNDA 1KLYA 3P73A 2DD8L 4YDJB 5AKVA 5IMMB 4LYKA 4O2CB 1SDYA 4LU0A 1ORQA 4LBEA 4WSHA 5G4EA 2ESVD 2ZFAA 4F2UA 4PR5A 3WEBA 2ZC1A 2UVFA 4M8QB 3G4SB 1J6OA 4PJ5E 4M6VA 3BICA 1B4JH 4EAYA 4X6EA 2OXGB 1OT1A 3P0VL 4B9YA 5D2LF 5IZ7A 4QYAA 3KOYA 1XBZA 5EU6B 3WF0A 4UC5A 4WU5B 3UO1H 4LBSA 4B5SA 4NHCH 3N2OA 4QCEA 3AIWA 4O15A 4UTUA 5I3JA 4DM2A 1EEYB 3DRTB 3SYCA 1TWIA 1LWIA 4Z1YA 5E09A 3KPSD 1IAKA 2NT0A 1M3IA 1XJBA 1Q72L 3TEVA 4TUFA 4HX1B 3OKDA 3TE9A 5DJCA 1GYAA 3CK0H 3R19A 5IR1B 5IFHH 3WHE0 1KY6A 4NO0B 4JG1L 5C9WA 1SXZA 3MY9A 2BIMA 4OD1H 1W37A 1XUUA 4BXSV 1F0LA 3IAGC 3EO0A 4MG4A 2EPHA 2FX8L 2IUZA 4TN9A 2QDXA 2PWEA 2X4SA 1S9WB 2QCEA 5IVOA 2WQPA 4K8RH 3ZTJG 3U2SA 1Y18B 3KBVA 1RLDA 1L5GA 4G80B 2NNRA 3U5UA 3T09A 2WKGA 1BZ8A 1OARL 1BBDH 2P49B 2XUCA 4O10A 1CG9B 1JVKA 1YDOA 1P4IH 5DHDA 4NT6A 5I71C 4GY4A 1D6VH 2H1LM 5GRUH 3FU5A 1KTLA 2OOFA 3GHRA 1KD0A 4OKVA 1GMIA 3I68A 2RKXA 2XU2A 1OF0A 3WSQL 3CFBA 1KRHA 3O8XC 1PUDA 2DZVA 1CXFA 4S3KA 4GUPB 4LSPH 2PP3A 5D1QD 2GBUA 2V5CA 2DUAA 2H3DA 3WH5A 2ZXQA 2G5BA 1UJ3B 4IJRA 4NHVA 4FFWC 1MJ7H 4G8FA 5F7FA 2AABL 2CLIA 4M1CD 1NH6A 3UZEC 3ZKSD 4XHJC 1RUQL 3KXQA 4JB9L 2X09A 2FLMA 4R85A 3CVHB 1H61A 3KPPB 3A0OA 1G4TA 4C56B 5EOQL 3V4LA 1DJYA 1WVZA 2CW5A 3HQOA 3GXDA 3IKKA 1UFUA 1H19A 3W7DA 2J1ZA 3NVDA 1S2UA 1NFDE 1BJKA 4OJAA 4W4QA 4Z7VE 3FLUA 4HU4A 4URIA 4E4UA 2VH5L 3M1BA 1JCMP 2WVVB 5JW4M 1NGZB 1CW2A 2X6UA 3D0AA 2K7QA 5F72S 4ZODA 4LBAA 4JNMA 4XZMX 2Z6JA 3KPNA 1EK3A 4HJ0C 1C9DA 2J7BA 4QTHA 4S3EA 2HTLD 3MSYA 1SZGA 4HKBB 5G1MA 4PI2A 1U30A 4BGLA 5IBXC 4FL4C 4ZRGA 3C5SB 1BKHA 4PUJA 3E6FA 3LRSB 4JD4A 3PVDA 4L4TD 5J5RA 1WK0A 5F0MB 3NG5A 1H5VA 5D4HA 5FOBA 2ZUQB 2TRHA 3JV5A 5I75B 1BGAA 2E27L 1UZ8B 3RJXA 3O4LD 1K72A 1LJMA 1PLGL 1W72B 1TU2B 2BW4A 5H35A 4IXHA 1YPXA 4ROXA 5FWQA 1FJ1B 1FIGH 1HI6A 1OYAA 4BQ3A 5C07E 4KFNA 4O02H 1OHLA 5EO1B 2YFOA 3WKQA 1IKNC 1HKJA 3TJEL 2R69H 5EC1B 5ESQB 1HKVA 4X5LA 2I5GA 4TTGA 3CAKA 5GZNC 5ABFB 1TUFA 1AS7A 2IPGA 4ONHA 7XIMA 3DNKA 4E5XB 3B06A 1QO3A 4K3EL 2N1TE 1FYTD 5K9OB 2OKMA 4H9TA 1GONA 3PWAA 3KPOB 4F7EA 4OM0L 4QYOB 1KM5A 3WY1A 1WB0A 3CUIA 2BNRA 3WLJA 1X9RA 1DSFH 3W5HA 4O52A 3UBPC 3W7IA 1MUJB 3SDCC 4TRPH 4FTVE 3ASWA 1B2WL 1MG3C 3OX8A 2IH9A 4P5TA 3MBFA 5KYYA 3PFQA 4JFTA 1BVWA 1RXOB 4W4OC 1Z5HA 1IGYA 1ZBWA 5LMZA 2ZG1A 1JTTA 4PJHA 2IMNA 3BIKA 1AIFA 4NKMB 2ZOLA 3N18A 4R4ND 2O9OA 3C2VA 3PPFA 3W86A 4PRIE 4QLWA 4GY1A 4W85A 1VESA 5DEGB 5IQ7L 3CZGA 4A3UA 4GH7B 5AUMA 2HV5A 5BXFB 1XL9A 1XGTA 1U9KA 1LP9F 2D3VA 3CHOA 4UU9B 3RL2B 3VA6A 3S2JA 4HK3N 2EE2A 5C7ZA 2CNYA 5DQJB 1CD9B 3BQUB 1GS7A 1ID5I 3FF8A 4Q4QA 4K7FA 3V4VH 1I9JL 2VKWA 1JCNA 2JTDA 2AK1H 2FJHB 1KIQB 4NIKB 4KEZA 1XAKA 2OXNA 1HJWA 1JB9A 4O18A 3AY4C 1K28D 1KTDA 5I1AA 4PJDB 3IJ8A 4F8QA 1ZE3C 3RAJL 5IVZA 4FX8A 4WW2C 3S6OA 1DE4A 2J6VA 4GYKA 2CK2A 2F7QA 4GRWB 4GYJA 3MBDA 1AD0B 4G7YL 3MXWL 2B0SL 4S3CA 5AYUH 3ME0B 4ZPVA 3PSVA 4M43L 3LZRA 1TJGL 1OCNA 3K5XA 5HYEA 2PDWA 3NO3A 3IGXA 3AB0B 1GS6X 3IGLA 2DV6A 1L9OA 4HLZG 1IM3D 2FQGA 3JT0A 4MD0B 4G1EB 1K5WA 2YCJA 2R83A 2WXFA 3BG3A 3D2UD 2MH4A 1G6RH 2XIIA 3CNYA 5HUOA 1MREL 3I50L 1NGXA 2XG4A 1Z2KA 4UQ2A 3RA7L 2OLAA 3MBWA 5I7GA 1KGXA 4J3OH 1CICD 5B3SB 3JSSA 3TA6A 3HRZB 2ZSVB 2MOVA 2REQB 1B4TA 2OZ4A 2I57A 3O6KL 7PAZA 4FYTA 1FHVA 1SHXA 2FEJA 4YAWA 1QKZL 2BZ7A 2CRYA 5DFWH 5CJ8A 2Z31A 3GG8A 1JFHA 5FDYA 3LXCA 2OI9B 4C5YA 3A35A 4MA3B 3LKOB 2QFRA 1I7UA 3NCEB 4Z0JA 5J3OA 2ED7A 3OGCA 1VCGA 3B83A 1XIJA 1VLWA 3HC4H 4AQ8C 3FUIA 5T3ZL 4N8UA 3ZRCC 5J6GB 3BW3A 3T8VA 1JZGA 4HSOA 2GYSA 1KCUH 3H2QA 2B9AA 4UTWA 1FI8C 1IGSA 3UC2A 2YK1L 3CUZA 3R10A 5DLCA 5JIDA 3C2RA 4YHBA 2WLZA 5DSZA 4MD5A 1FGVL 4WWVA 5IMOA 3NFPA 2AJXH 4AEHL 1T83C 2BH0A 4EZLA 3WS6C 1BQKA 3L4CA 1KK2A 2OKTA 2V2TA 4UTCA 3E6HB 3VGBA 3THML 4AX6A 4ZFGH 3RB7A 5IW1B 4OOSA 1ME9A 3ASSA 2W61A 3C6EA 1E6ZA 3B9AA 4MYPA 2FPYA 2ZYHA 3WFCL 3ATYA 2VP8A 4EZMA 4ZW7A 4M4PA 2HVJB 2VNCA 2GQHA 5LKNA 3APGA 2ZA3A 4UZSA 2VQ4A 4M8VA 4AE0A 2WNNA 4PVNA 3TYCA 2QE7A 1KULA 3K8KA 4JRXD 1LGVA 2E7MA 1L0PA 1GG0A 3G1HA 5I6SA 4HN4A 3ALXA 4PRPB 4WI0A 4ADSA 3BKYL 1ZBVA 2NXIA 3PA1A 5FK9A 1HXYA 5GJTL 3CFCH 3VH8A 1JPFB 2YGQA 4QHUA 2CDEA 1C16B 5INDA 4CW1B 4UQEA 3VPLA 3V5DA 1HYSD 2AQQA 2X4NB 3L48A 3VUAA 3QARA 3UOAB 8PAZA 5C3LD 1E0UA 1OFDA 2GJPA 5FUCC 1A1NB 1X7FA 1GCFA 2LQRA 8A3HA 3MJ6A 5DDHB 2DF3A 4HIXL 2NW3A 5MEQA 3IE4A 4EBQL 4PJAB 1D6EB 5I03A 1EERB 2IPTL 4YE4L 4IT1A 2WINA 1C8PA 3OVPA 1R2RA 4DF1A 1FNMA 3KXFB 5TF0A 3LNFA 4H7VA 1IIGA 3MV11 1JHKH 4YFDB 4MZRA 4X7DA 1AO7B 1E64A 3UABA 1AGBB 3DKLA 1SN0A 1EP1B 1FUNA 1JQXA 1ADWA 3MLVH 2E7LC 3NEVA 1XINA 4CMHB 2I9UA 1BQLH 4PCFA 3SUUA 1CFQB 4ODXB 2GJ6E 3Q38A 3QQ4A 3RFZB 1KN2H 1W54A 2FEDC 4PSPA 5HPMB 1HKWA 1UD5A 4X9HA 3NIFB 1H7XA 1UURA 2WKOF 3APFA 3GXUB 3FAXA 3ATZA 1PWLA 4Z1DA 1PDKB 1NOUA 2X1SA 1VQMB 2JK2A 3CZEA 5E2JA 2ZXGA 2QEZA 1OIMA 3PAZA 3QE5A 3MV7A 4BFKA 3VNJA 3C5ZD 4XONA 1LROA 2F8IA 4L8DA 4WEMB 3SDDB 3SO7A 3ZKXC 1KIPA 3EDJA 4F0MA 5J1TC 4IW3B 1GOOA 1SDDA 4DKFH 2J78A 3TYZA 1X9UA 3Q13A 4Q4OA 4PLOB 1MFEL 1TTIA 5M7QA 3TC3A 1R19A 3WFLA 3NPSC 4MYWB 3QR3A 2F08A 4Z8FH 2BASA 2EKGA 4XUYA 1PZ5A 5K9XA 4CN6A 4ZMNA 3K6NA 3G22A 3C2SA 5E94A 5FJOA 4HUMB 1KPVA 3AJ7A 4HAKA 5D7KD 4XX5A 4L9LC 1K5NA 1WUEA 3OKOB 5ERWB 2X8RA 2WZAA 5D7LB 4TVPH 5IJKA 3CYJA 1WFOA 3GMMB 4IQDA 1BG9A 1BXXA 4IPIA 1RALA 3K6SA 2IQTA 3N13A 1I2QA 3L4ZA 2NXZD 4U1JB 3VE7A 1LXMA 2OMXA 3TN4A 4G2DA 4LCVA 5E9AA 3PJNA 1O12A 3IGAB 4X7CA 1FYHB 4YHIB 1BG1A 4LP5A 1BGXL 5AYBA 1UKOA 1KJZA 3D26A 2VN5A 3F7KA 4Y5XB 1W5PA 2DQEL 4GNJA 3SIMA 3NCBB 2PETA 3ARGA 3RPIB 3WK0A 2JF7A 1HINH 5C7XH 2AKRB 2OL3H 3P4OB 4YVPA 5I6XB 1SJHA 3A8KA 4Z0XA 4Z3HA 1I2NA 1NAKH 3W73A 4K07A 2XBTA 1W1VA 5KSWA 3SKOA 1UENA 3U0PB 3STZB 3L5MA 3I6RA 4HS6B 5IHUH 2NW2A 3BVTA 4NNYB 4P5MB 1XGUB 5DD5L 2AFNA 3MQIA 4G8AC 2MIZA 3O63A 3HNSL 4NQQA 1CE1L 1OC5A 4C6BA 4JQIA 1YE4A 1MSPA 4ZMYA 3BHBA 5DMNA 4P4KD 3RGVB 1OD8A 4Z5RB 5J89A 2BNUA 3R4IA 3G6JB 3ZN6A 3B4UA 3QEQB 3VCNA 4DEFA 4F40A 3GRBA 3LQZB 5H2BA 5C71A 2EDKA 4V33A 4RRPA 4RZBA 4KT2A 4EUPH 5I8KL 1PYMA 4AT6A 2EEXA 3WIIH 1A6UH 3CUXA 5A8MA 4EPKA 4O0KA 1H8HA 5D7JA 3FPXA 3FTGB 3DUSA 2PF8A 3QQXA 3VTRA 4LSSH 1LLOA 3A4EA 1R3HA 1QVBA 2NTFA 2ISWA 2YCLB 1S7RB 3OVUB 3Q6FA 1OCBA 2AK4D 1T0PB 3PY2A 1R3LA 2WMPB 1QEXA 4Y16B 4YSDA 4PRNA 4OZIB 1U2YA 3ZE1F 1WKDA 2F15A 2AXHA 5I8OL 4ZQOA 4XBJA 4YTQA 3AW5A 4G8IB 1NJ9A 3W7HA 3W0WB 4YLQT 4PJBB 3FKSA 4J3OG 2BDNL 3QXDB 4P2CG 1CUOA 3QF0A 1OTUD 3HR5B 5KVGE 1MWOA 5HGAA 1UOWA 1FCGA 3MREA 3C8HA 1INEL 1YTKA 4KJYB 1YN7B 2VXUL 1WEJH 5G2HA 5F4MA 4YYFA 4XMUA 3SDYH 3FN0H 5I5JA 1JYNA 4JKKA 1MNSA 5KWYC 2HRPH 4LJ3A 4YK4B 5E6IB 1RY0A 4GUFA 5L88H 4DN4H 4BFAA 2GUOA 4BFEA 2C7UB 3JVGC 2Z7GA 5HHVL 1HGWA 3S48A 1XVSA 3DV6A 2ZKYA 1AFVL 4N8VG 1Q9LA 2RH9A 3S3BB 3U9UB 1EXGA 1QRNB 4XISA 1G4SA 1S6NA 1SM4A 4AIZA 4Z7UB 2JQAA 5BW7A 2V68A 1OABA 6A3HA 3MRJA 5DK3A 1ACXA 4X61A 1OPGL 1SN5A 4MQXD 1ZLVK 1AH3A 1FZJB 1GW1A 4E42B 3ZT5A 4F0LA 1RHHA 1E9PB 3CWGA 3WNDA 5I0YA 2PD9A 4IGBC 3QIBA 3ZY7A 2R1KA 1N0LB 3S37H 4X6CA 4Y2DA 35C8L 4NN5B 12E8H 1FFPA 3CU1A 3DJZA 4HNUA 1A80A 3NYKA 4JRFA 3T05A 1M2OA 3EH4B 3QGKC 3LPPA 4EXKA 3MTWA 3IGFA 5BUAA 5KANI 3HFMH 2QUVA 3TO4D 1I3GH 1HXMB 4KZ0A 1FRQA 5IEHB 3DH7A 2OSLA 1E6OL 4TPRH 1TFHA 3UYOD 5T3XD 4KJPC 2AL1A 4GO6B 3I02A 5J57B 1Q38A 4P3IA 3T2LA 4B9CA 1CT5A 3FFOA 1XDMA 5IHBA 4C83B 4NQTA 3C5JB 3X3FH 3GSVB 5CEYB 4FNLH 4ZPTA 3NSCA 1CBVL 2WJ7A 4GOAA 4P2RA 4JHOA 2ARWA 3QUXC 3OM3B 1VQ8B 4C8XA 1WNOA 4BRVA 1OGTA 4UM8A 2I60H 4JFPA 1T7XA 5F1NA 3GSOB 5CSGA 1SJAA 4MMZA 4IJ3C 3QMRA 2MPAH 3WHXA 2WYTA 5FF6A 2JCCE 3FH8A 4OZGF 1TFVA 1PZDA 3GIZL 3L3DB 4LVBA 3L68A 5LNSA 2PN5A 4FQHB 3AGWA 3CW2A 4UOZA 4UAOB 2DSZA 5JUVA 2BNRE 1K7FA 3L9YA 3SB0A 1MCNA 2DY3A 4CU6A 3STEA 3VXMD 3KEHA 4NJAL 2FT7A 2IQAB 3IN2A 4PBXA 4IMLA 1P7HL 4JO3H 1IT0A 5B39G 3RU6A 3QK0A 2XZQL 4P26A 3IFLL 4X4YB 3LKNB 4US5D 2DVUA 2LU5A 3MRGA 1G0CA 3FONB 4MDOA 1G7IA 4GISA 4NRYA 1H41A 3R7RA 1MDAA 3NE5B 2G4JA 1J0HA 2Q3ZA 4TQTA 2DEWX 1OCQA 4O57A 5I1LB 4ZVJA 3WD1A 2QAPA 4R7NB 1EOMA 4UM9D 4PRAB 2XXGA 4I0PC 3JV6B 2VDRH 3ARDD 2NY0D 4PGJA 4UMBA 2HFFB 1LE5A 1A53A 3U82B 3GDCA 3QHFH 3CS2A 1OOWA 2ZF9A 2FYMA 3RVTD 3O3RA 1UVQB 3WX7A 3LKQB 3NDYA 3GJFH 5JQ6H 4HU3A 1TJHL 4APQA 3GM8A 5C0RH 5D2NA 1QK2A 3KNBA 4KPHL 4AF6A 1CYGA 1G7UA 3S1XA 2YA2A 1ZALA 5ICYB 5IV2B 2XWJA 1EANA 5AKSA 4L80A 4NCDA 2Y7OA 3LCGA 4JIPA 1Q86D 2WSDA 4PJ8D 1GYWA 3OODA 2V5DA 4R97B 2WJFA 3D48R 4KKUA 3C9NB 2I9TA 1MI5D 2ATKA 1QCWA 5T5NG 1AOHA 2WLJA 2C14A 4XIAA 4EN3B 3QI9D 3OQRA 2VEFA 3GQBA 2VVSA 4KK8D 3HKZA 4LB8A 4O8RA 1SQ2N 3ASOB 4JQXA 4G6JL 4HOZA 2X2HA 5CIPA 1A0QH 2PTVA 4MTVA 1HCYA 3NJMA 4B2DA 4YE0A 3VD3A 4GZIA 4E2BA 2PUQT 2NTSP 5ETUB 3ULSA 3O9WC 4HJSA 3ESOA 5K9CA 4J4PA 2YRPA 2XWRA 1F3XA 4M62L 1XO8A 1J0IA 3TP4A 5AHIA 3VUSA 2D3LA 4G7EA 4QXWA 2G4FA 1DE6A 3MRLB 3WKPA 4OJDH 2D0FA 3TF7C 3RVVD 3WH6A 3F64A 4HFWB 3LQGA 2BN4A 2PBOA 1IVTA 3GSNB 1P0SE 1XSJA 1FC1A 3PZUA 2GK6A 1JGMA 3E3HA 2P4AB 2FJUB 2ZZGA 2OXHB 3B2UC 2QQNH 2FT6A 4LNVA 5ABDE 5C0DB 3GHEL 4TNWK 3PV6B 3FFCE 3MRIB 3PHOA 5GSVA 2HJKA 2A0LD 2GC4C 1LYXA 2V5KA 1RZJL 3RHWF 1FWJC 2YEZA 2EINB 4LNYA 3WH7A 1MRZA 4LCIL 1EJ6A 4YFLF 1A14L 1CLZH 3FAWA 1G5GA 4N02A 5H8DA 3CG8A 4FZEH 5J3HC 15C8L 5IW6A 7CGTA 4UQCA 3GNXA 4PN6A 1JPGA 3B8TA 4OIBA 3AQYA 2OMUA 4ZYKA 1TTCA 3VRLE 1JEZA 4IKLA 1I7ZA 3U83A 5ISZB 3W75A 1CXHA 4XCYA 2MTAA 5GGTA 1N55A 3FJNA 4KY1L 1A4CA 4Y9OA 5HYJD 1Q94A 1XLDA 4B3FX 2HX8A 4M6OL 4U6VH 1W5NA 3NQBA 3P84A 1ZHKB 1YNQA 3KLAB 4ZXBB 1G7JA 1PPIA 3DSNA 4H04A 3MRMA 3L9CA 4O9HL 5AW6B 1YY8B 4IRJC 3NCMA 5FA4B 3KLHC 1XYAA 5KINA 2Z1WA 2ICEA 5CZXC 4KFPA 3H53A 3IIVA 2YDQA 4EK7A 2Q8BL 1IO4C 5AKQA 3SJVB 1WBYB 4J3SA 2J6WA 2AZUA 2CUMA 4NRZA 2CRZA 3OIHA 2OEJA 2R1YA 3DA0A 3L5JA 3QEUB 4FXGB 1LDPH 4WWKA 3WV0A 5IHZA 2X87A 2NX1A 3L3KA 1OGAB 2WUCH 1W0WA 3U57A 2CG9X 4HPYL 2CSPA 5M1TA 3SGZA 1YNTB 3EYUL 1H1YA 4IP4A 2WWMD 1GTEA 2VIRA 4UUJA 1RSCA 4IBUA 1FQ0A 3DMMC 3PG8A 3OPZL 2BNQB 1WAEA 1YDPB 5BJTB 2EYRB 2WMFA 4E9XA 1E0TA 5DC9B 2J72A 5DMIH 4DNTB 2Y63A 5TRDA 3PWIA 1IC4L 1ZLVH 1N5AB 3EKCA 2C3XA 3QT2A 4PMZA 2HT3D 2X3CA 3GKWH 5D03A 2NWSA 5HHOB 1XSOA 4XP4H 4YUEH 1HSBA 3DPBB 4UMGA 3CV2A 1TVLA 1SUXA 5KSBE 3MV7E 3D3FA 3Q65A 2XPZA 4CMMB 2FFCA 3DOSB 4XOPA 3I6LE 4HIIB 3QZMA 5DN1A 2IPUK 5C2CA 2EYSB 1QXLA 3L2MA 5I1CH 3MBEB 4YL2A 4JGNA 3INPA 2AF2A 1NCUA 4WKXA 3U2EA 1A7OH 3TBWA 3B43A 4GLRH 3UTZA 5IHHA 3KPLB 3SBRA 1UM5H 1QTYT 2J20A 3WUBA 1T1XB 3K46A 2AXJA 4N6RA 4LALA 2HLDA 1JOIA 1KQSB 1RQPA 2HX9A 5JO5B 4GSRA 1C12A 1A5CA 4MAZA 1U2CA 1ODUA 3P62A 4XN4A 3NYZA 3IDMB 5HDQL 2F7IA 4DERA 5BS0A 2E40A 1XR9A 4JTHA 4NJ9H 1UWTA 3GSWB 2F8XC 5K4ZA 1MYRA 3VW3L 4QITA 4ATWA 1HJQA 2D3JA 4QHYA 1AHWB 4I2XA 4O5LL 4AFYA 4WFFD 5KOVC 4DN3H 4PJCF 2IALB 5AN9A 4NAFB 1QO2A 1BF6A 2ZDRA 3S6CA 4HWNA 4LVHB 5KSAC 3BX7C 1JGVH 2Y1AA 3WJMA 4XLAA 2EDYA 1B9BA 5CLWA 5FXCH 3HW7A 1ZT7A 1A9EA 4HWBH 3NPUA 2WVUA 2EC8A 4EE2A 2Z8RA 1FKXA 3UWVA 1QNPA 2LLNA 1OEZW 3B2VL 4PEEA 4B7IA 3MKGA 1ED3B 3W2HA 2CRVA 4FFYA 5GRXG 2PW2A 4KRLB 3DFYA 5CJQL 1SW7A 3GB6A 3U7AA 3QJFA 3W2GA 4FQQA 4LSQL 3VXSD 3QXAB 1RI8A 5ESVB 4LEEA 3FRUA 4JE4B 1FXPA 1JYWA 4HALA 1KT2B 4LDCA 4R0LC 4UMAA 1BBJA 4OPVA 5GGSB 3WIAA 2V5LA 4FKKA 2E9JA 1U1JA 4RCXA 3L3JB 1IGWA 3HAEH 1PLAA 4HEME 4EP8C 1KYFA 1QYGH 3BDYH 2JB5L 5KAQG 1CENA 1MAMH 4AQZA 3ITOA 1KMHA 1D7CA 3LQAC 3HUJA 1E63A 5AZEL 1I7RB 4TO8A 2R1MA 1BECA 4U9UA 1E1EA 2F1AA 4YYCA 4NQED 5CC5A 1NBZB 4KZEL 1XHGA 3PE9A 4HU2A 4YZFF 5E51A 3W72A 5AAWC 3V6OC 4WO0A 2EZ0C 1UOVA 4XGZA 4X98B 2PYFB 1XQKA 5A43C 3FX4A 4PJ9A 3Q01A 4MMWA 4M56A 3MV9D 1MJJB 3FTSA 1A1MB 1EOKA 4CVXB 3EG9A 5I1EL 2NR6A 4UOJA 1NDGA 4WF7A 2XFFA 3IANA 3CDZA 2C0HA 2HS8A 5AHNA 3HIZA 3RNQA 2Z2AA 2OK0H 2D1ZA 5IYRA 4H3DA 2FGBA 1YEHH 5SV4A 4NC2B 2E1BA 3FQ1A 1H11A 4I13B 2YXFA 5GRJH 3IJEB 2XA8H 3O15A 1GKQA 5D72H 5FGBA 5J11C 3HG4A 4POZD 5M2FX 4O02A 3N06B 4JYFA 4DF0A 3TONA 1ZAIA 5A16B 2Q76A 5DURB 5KANG 3IKCB 3FUKA 3NIYA 1B4LA 4XUGA 4I7VA 2Q7YA 1CURA 1WZMA 2LW3A 1IRAY 3ZDXB 1PX8A 3SDAC 3MRFB 1KYDA 4I9JA 1SM3L 1RZFL 1UA3A 3M8OH 2B59B 1ZLPA 4TYUA 1ZMYA 1K8ZA 4WENB 3Q4DA 4BEUA 3LQMA 3L3OC 3ECVA 3TWYA 3FH5A 1SDAB 3PJWA 4UDTB 3MJWA 1QX1A 3P4MB 2CBMA 3T2PA 2PCPA 4X6CE 1VYSX 4ONGH 5LB1A 3B82A 3G8RA 3BKCL 3MOBH 2KHAA 5ALBL 4H9UA 4M1RA 3LTYA 5C9UA 3ALFA 2PWDA 2VLMD 3ARYA 4TUUA 2VEPA 1XRFA 4IL0A 5ID1B 3GK0A 2VZLA 3T0CA 3US1A 5L2KD 3RB5A 4ZBJA 2CM5A 5I5RA 2VXVL 1WDPA 5EEXA 2NNXA 4B4HA 2CESA 2HLAB 3I7RA 3PJXA 2X0UA 4F20A 3P3BA 3DTUB 5HY9A 1HJSA 3LKSB 3QP3A 1MQPA 1CEOA 1GY1A 3S36X 5LVEA 4XCEA 3PWPB 3QRGH 3LRKA 4PM1A 5D09A 3MBXH 4KKSA 3FTYA 3L5WB 2QCLA 1TLMA 4P2RE 1JUKA 4H44C 4M7TA 3V4VA 2P8LA 1F11B 3WQEA 1QR4A 4MGXA 1PTDA 3O6LH 3RZCB 2R2HA 1E2WA 2V2DA 4ZFCA 1IFHL 1XC6A 3EBGA 3RUGA 4NY2A 5DJXA 5LDUA 2IGTA 1N18A 5GGUA 2NNAB 4K7YA 4NNXA 1ZXQA 3D69B 1GGYA 1RULL 4MB1A 1JK8B 3QQ9D 3EMZA 5HK4A 2X4TA 2L4OA 2WLLA 3PREA 3JTBA 3NEHA 4PUEA 3HN5A 2ETWA 4QGCA 3LD5A 1JZ7A 1CI1A 4XPBL 2H9AA 4ONVA 1S4MA 1E43A 5J1AB 4NZUL 5T3XH 1A4KA 3INOA 4XN5A 2YRBA 3FS9A 4I87A 4KZDL 2FYYB 3PB0A 5CEZD 1LWRA 3P14A 3MLUH 1RPUA 2CH8A 1DWHM 1ADOA 1QHQA 3T9PA 1BYCA 1F07A 5DA0B 1TJIL 3L5AA 3GSXB 1Q6DA 1DN0A 4UZEA 3KS0J 1DWJM 1YEGL 5AOIA 3KVKA 2Q09A 1JHLH 5E00B 5JPMB 2AV7B 4CD6A 1X5LA 4NCNA 3ES9A 5C7VA 2YDAA 5D2WA 2WQRA 3UADA 1FH5H 2BY0A 2B8OT 2CDGB 3FCTA 4F7TB 3IN0A 5IY5B 4N8VA 5BV7L 4H20H 2ZA2A 3A3XA 4HA0A 4UT9L 2VBTA 2PW1A 3F7YA 2VC5A 1AIZA 1PVHA 3WXWH 3OO2A 1X5IA 4RD1A 2OJZL 4HIEA 5CEWA 3OKYA 1NBCA 1M03A 1CFVH 1DJGA 2WZ0A 4XVDA 3NDYE 3PG2A 3RLUA 3GT6A 1PMYA 1BM7A 3QIWA 2FX9L 5D2NE 1AQDA 3EF7A 4PRDA 4YTRA 3OC5A 1IXNA 3SE4C 3ZUNC 2G9KA 3RX8A 5T1LD 3IIXA 2RFXA 5EZOH 1E6JL 2AQSA 5C08B 1B0GA 3W02A 4JZJC 3W9EB 3U0WH 4PWJA 3IMBA 3EAUA 3V9CA 2EPLX 2ZCKH 1G7HB 5CZVH 5HHPB 2I56A 3H2EA 1JJ2B 4HF5L 5BRQA 3FQNA 1X1NA 1CI3M 1SMAA 5BRZD 3SEPA 5EFDA 3ASTA 1MQQA 3ZVHB 4BQ2A 4S1DC 1PCXA 3Q2DA 3UDWA 4L1BA 1QLFA 4JHAH 2E1RA 4MDIB 4H6RA 1REQA 2Z7YA 1S7TA 3NJLA 2H8ZA 3HTWA 4P9HH 3M7WA 1E7UA 1UJTA 2DTML 3NL6A 4D6EA 2KDYA 4FQ2L 5HHNB 4QRPB 1EVTC 4JDVA 3T77B 5D5MB 4PJGA 5IB2A 2YWFA 5FL1A 4AC4A 4GVFA 1YN6B 1VJIA 3VIHA 4PTWA 4GMTL 4YVXA 4K71C 2Y07H 3W2DH 3T1FB 2W38A 3SKNB 5JIWA 1IZJA 1YXCA 3W70A 3B56A 5MEPA 3CLEH 3ZHNA 3OKNA 3E5BA 5GGVL 1ADSA 2BOCA 3BPOB 4CSTA 5I00A 2DWEA 2V5YA 4XN8A 2VX6A 1K7XA 3WJZA 2Q0ZX 1YG9A 2NYYD 4HUWA 4HZ6A 4ZB5A 1WBZB 4OUEA 2WBJB 2ZONA 3RTQC 5I1DB 4UFKA 1B90A 4F8LA 1GGCH 1T0MA 1I8MA 4UAJA 1DKWA 1W87A 3M0HA 2EIMB 4WUUB 5D7HA 1HIML 3VRIA 4UT6L 2ONEA 5HYFA 3CXFA 3TA3B 2OWCA 4QVJA 5TQ0L 4BQCA 1ITBB 4GBUA 3LGGA 1YVLA 4R3UA 2YKLL 3GSRB 3HJ0A 3FGCA 2CD0A 3KL0A 1Z9SA 3CX5K 2NDGA 5JDSB 4XMXA 2O1AA 3ZPDA 4N0YL 3NFSL 2AI0L 1T0NA 3LGEA 3S3JA 1A5AA 1HSAA 5BV7C 4ZI8A 4ODSH 1KBIA 1J8HD 5B39A 5D7IF 5CC3A 3TJHD 4IIQB 1PJ9A 5AG8A 5L9FA 3U1SH 3VXRA 2W65A 3KPMA 4O58L 3TZVA 3UIZA 4RX4A 5FUZL 2R0KH 2X4OB 5CUSL 1DVFD 3RY6C 4KKRA 1TPXC 3FKKA 4QXUH 3U48A 5JLZA 3U7YL 2ZWYA 1D2KA 3Q06A 1FHUA 5KVDH 1A4JB 1EJFA 3VWKA 1RJYA 1SVZA 2XXCB 5JXQA 1OSZB 4OKDA 2BWQA 2IAMB 4M0LA 3VCCA 1JF1B 2N1KA 3L7RA 4X4MA 4AVJA 4KJQC 1ACZA 3CTLA 2FVNA 3O6YX 2ZNXA 2F53E 3VMPA 1VFTA 2C1GA 1D5MB 4XPFH 4L05A 1CFTA 2XQBH 3GBLA 3AYTA 4OFQA 4LLYB 3E3QC 5E1HB 5IQOA 4RAHA 3U4EB 4DBDA 1BA9A 2PSNA 2VEKA 2PB1A 4NJIA 1MHHB 2DEPA 4B44A 1FWXA 3L5HA 2LTQB 4WHYH 3VFRB 1GJUA 2K0RA 5JH2A 5HJLA 4LVFA 5I16A 3HV9A 4H1LB 4Q4EA 2ZUNA 2D74A 4L65A 4QDMA 2IWKA 4XD4A 5B1BB 2J9ZA 5A2FA 4KI1A 3HZKA 2XTJB 1EF2A 2C26A 1NBQA 5B1AB 5AYQA 1SQMA 2WANA 5T26A 5LDSA 2GT9B 1CB2A 5F7AA 1FIEA 4A6GA 4NX0A 4QHLB 4PGEA 4ACZA 4MAYB 4AX3A 1E1FA 4LBYA 1FNGA 5CC6A 3AMKA 3ASQA 1QP1A 3IF1B 3SGDH 1A0EA 4IQEA 3KRZA 5HDBB 2QPFA 3IDIA 3FKRA 1E72M 3OF6A 3KW8A 4TLSA 2CK0L 3PJUA 4LCRA 1VLIA 1WIPA 5T1KD 2VCCA 2VR7A 1HX0A 2Y0SA 2V82A 1IGFH 2FUQA 4W87A 4RGOL 4HHAB 2Q6LA 4YSCA 2GAZB 1PEWA 3K8MA 4M7LT 2HFGH 4WSGA 1VHNA 4MLIA 5KYXA 3GDRA 4WEBL 1JZ5A 5CU5A 5GHWH 5LGKA 1CT8A 1TTPA 4N6FA 4DUXA 3QS2A 1COBA 1VHPA 3K2KA 1IEAA 4KETA 3V36A 5SWSA 5BS0E 3MTRA 4L37B 2ESVA 2YXXA 4IKNA 2V2WA 1RPQA 2IS7A 1TSHA 2D7TH 4JFZH 4I2XE 2CCRA 3W76A 2FHFA 5A3IC 5LCVL 1QHOA 1B3XA 4BK9A 1TZGH 4YAQA 4XAPA 32C2A 1IM9D 3CLFH 1W3LA 4P49A 5B4MC 3TSDA 5MI0B 3P67A 1BQRA 3NQ2A 2ZKXA 1JDAA 5M5DA 2HUEA 5CSBA 4Q6YA 1MHPL 3NJVA 3H1ZA 3WE6B 4D8PA 2V7XA 2CPCA 4BQ5A 6REQB 3ZHDA 2F8QA 3H2PA 1XF3A 3VSQA 1I53A 2CERA 2DQUL 2UXTA 1DFXA 3KPSA 2W81C 3QORC 4HUKB 3W88A 1N5YL 3UG3A 3CJJA 3RZWA 1IWBA 2Y7MA 1KB5L 4W9HC 9XIMA 4WAFA 4Q2ZA 5MKGA 3PGCB 3BVNA 1ELOA 2JWYA 4Y7CA 4J3VA 4CDHA 3ZX1A 2VR8A 3BLEA 4BCYA 4D9RE 4RE0A 4X9FA 2IPUG 4Z78B 4IDLA 4FD0A 5C5YA 3ARBD 4J9JA 3SCRA 4UBDD 1U2HA 3KPQA 3AGVA 3L7EA 2E46A 2UZXA 3UTTB 1D8CA 2QDWA 4JO4L 2DBLL 3MOAL 2K3TA 2NY2C 3HUJE 1VENA 1YQVH 3MHUA 4GRLB 3H4XA 4PGBB 3DKHA 4GKSA 2OZ8A 1ET7A 4JZNB 4LVOB 3MO7A 2DUZA 4P61A 5K9QI 4TNVK 2RC6A 3LIZL 3OXRA 4XNUH 1JVLA 3SUSA 4G71B 2G3JA 1ZWIB 3WY2A 1Q6LA 2UY2A 4B5VA 4Z4VA 2OTWA 2BXVA 1P5UB 2I9LB 2JGYA 5CP7A 1EFRA 4RAUA 5CQ1A 3ZYZA 4QUOA 3V95A 4ODHL 4MAVA 4G72B 4NQCD 3DYPA 4BQ8A 1R3QA 4HUUA 5D1QA 2ADFL 2GTWA 3VNZA 2X30A 4LLDA 1AXIB 1VBRA 4F58L 3GZ3A 3W11C 4XBPA 1KBLA 3SGUA 5BCAA 2WWNA 3BH8A 4UILL 4UV7L 2GW5A 5D1XB 4O4YH 4FQXC 1U3HB 4LUYA 3A13A 1U95A 1GW6A 4AUJA 1M01A 2IAND 3RKDD 1NGYA 1SMDA 3O0RL 3CASA 1XLCA 3EDEA 2Z9TA 2WJ5A 3BDKA 4XXCC 4Z77A 4N42A 4XPGL 1EBAA 3B9OA 3H23A 2R0ZH 2DEYX 1D5IL 2CCVA 3DGRA 1RK1B 2FR4B 1AMOA 1IAMA 1WOAA 4H9XA 1T40A 5KVFH 5BQ7A 2QTVA 1CB4A 3MUUA 3WK1A 3GDBA 3CDFA 1W35A 2BV9A 4C6MA 1QPXA 4NQXA 3P2DA 3CB4A 1ALDA 1D5XA 1G6VK 2DDQL 5FF3A 2R29L 3QUYC 1UR2A 2E1WA 2DGAA 2ZJSL 4G1MB 2N0MA 1WOBA 4B5WA 5DK0B 1JV5A 2V2XA 1IARB 1FAIL 5EPMB 1HE8A 1X9LA 1E71M 3QWOA 4L4TA 4NHUA 5GISH 3PPGA 2XG5B 3X17A 3WE1A 4GSDH 4N0UA 2VFIA 4IGHA 2A77H 2ZVRA 3H42H 4PVLA 3O4LA 2J43A 3MMEB 3IRZA 3FRPA 1X5MA 3UH8A 4L5ZA 4MMXA 3GIYA 2BFVH 4MDJB 1IEXA 1WDWA 3WLNA 1FNFA 3DX6B 2FNWA 4AZ8B 1URZA 1PLCA 1XIWD 1I3UA 43C9B 3O41A 3WLTA 5A6KA 1EEZA 2Y4SA 3MANA 3REVA 1MVFA 2BVPB 4YSUA 4J8QA 1EAOA 4XO9A 2YA1A 3W1AA 4O00A 3QJAA 3F65A 2L04A 1FC2D 1YHPA 4RISL 1FYTA 3FY1A 2IFFL 3BESR 1ASQA 4KXBA 1FO0A 4TV6A 4HOMA 1YC8A 3DVNA 3P7YA 1A8ZA 1GYMA 1OF2A 4NJKA 5CZRA 4ERGA 3QZNA 2Y36L 3KP0A 1DBKL 1PY4A 5FO8A 1SGKA 2F6UA 4M8RA 2XFGB 2A6IB 3VGDA 4B41A 1Z41A 1U58A 2ARJA 1WIUA 3RUGE 4ZO8A 3P80A 1UJPA 3CCHB 4LHJB 2Y5TA 4K9JA 3FBQA 4WHYG 3MA9L 4DHGA 3NAVA 2X4QA 1DUZB 2VE6A 5AL8A 5KS9F 5D2YA 4PP2A 1V05A 1ZSDB 1B4EA 4HS8L 3LCXA 1SM9A 1FCCA 5DC4B 1ONRA 1U1HA 4FFVC 5DSCA 3UYRL 2NZ1A 2GY7B 3T3PE 2IV8A 2H41A 4HFUL 2PC4A 5EU3B 2AJZA 4ZTXA 4LBRA 1DUYB 4XNYL 1QNZH 3LEYL 5FGRA 4M93C 1VLXA 3MZNA 3CCVB 1CF8L 4PYGA 2O6DA 1G9MH 3RRAA 2W1NA 1U8OA 3EA1A 4GNKB 2X70A 2NQ3A 2NY1B 4X63A 4QSHA 2VRQA 4YHMH 4A7UA 4KTYA 5C6WH 2XISA 3T8LA 2DI8A 2OMZA 5F1UA 4KNQA 1N8FA 1NAML 4X7SL 1XDTT 4ZE4A 5FO9A 1E8XA 3GJFK 4BSWA 1R30A 3Q1SH 1OHHA 2HG5B 3L6FA 3D2TA 3VNMA 4DQWA 4HWUA 3KCOA 3T2NH 2VYOA 1YYCA 3X1BA 3G0XA 3GTXA 3PXLA 1LOQA 2CO7A 5IXEA 4ANWA 4A7QA 3S2MA 3U6WA 1KGJA 3CFEB 4JDEB 1AQHA 4MPKA 4S0TD 2VWEC 3U0TB 4PIBA 4W9TA 5J13C 1EP2B 4F0SA 4PH8A 1OAQL 3VD2A 1IM3A 2VW4A 3N2JA 2KZBA 4IP7A 2W0FA 4Z2KA 2XV6B 1INDL 1A6VL 5FECB 3IU3B 4F7PA 5CEZH 1QSZA 1EXMA 1BQHB 4GMSH 1XDJA 4INFA 4HA3A 1FNSL 5FL7A 1UC4A 3DVGA 5DY3A 3A4JA 2BVDA 2YWZA 4UQ9A 1N0VC 2XN9D 3O3DB 4P57B 3US0A 1JGLL 4OCYL 5TY0A 4JGUA 3SKJL 4DUVA 3UG4A 2FSDA 3WDHA 1WX0A 3HI1A 1NMAH 2XC8A 1S38A 1H0DB 3CBKB 4D8LA 3I3BA 4HUNB 3WKZA 1KN4H 5EO9B 4B53A 2VDLB 3TBTA 2XN0A 4WRHA 2J8FA 4QOKA 5CEXB 1E55A 4Y9MA 2ZZ4A 4XZIA 3WQDA 4PJGE 4XPHL 1RCOB 1VSCA 1X8FA 1XYBA 5BWAA 4W9KC 5IEKB 1NQKA 4ZUSB 3TN3A 3UVIA 4XNMA 4JX5A 2F54B 2VZTA 5HULA 3WJXA 4XV0A 3RN6A 1ZJIA 2XZZA 2NY5L 3AWOA 1VADA 3SM0A 3ES6A 4A8LA 3W87A 5HNUA 4AEEA 4Z0SA 1HESA 2EIDA 1EZ2A 4S1RH 5TE6L 2NZ9C 4GAAA 4C6QA 4AVHA 2I1OA 1C08A 2XSAA 4HNNA 1Z89A 3X2QB 5JQIB 1AZUA 5J5EA 4W81A 3JV4B 1UWGL 3TWCL 4JRXA 1I85C 3D5HA 2CR3A 4XH2B 4W9FC 3QHMA 2WZEA 3RG1C 4KCUA 3RM4A 4N6QA 4EI6A 1IFRA 4ANUA 4MSWB 5JHLH 2CIKA 1Y5WA 3MLSH 3BG9A 1Y1UA 3MJ9H 3IJ7A 5LNRA 4XLFA 1ROWA 2IG2L 1S7WB 1L6YA 3KL9A 1GGUA 3M6YA 2RFGA 2KPNA 4FXLA 3ZDYF 2N4IA 1R5BA 3JTSB 5CILH 2IPJA 4K7PX 3W7PA 3VXRE 2QQKL 1OSPL 4F7CA 3SCWA 3T4AA 3ZLFA 1HEZA 1LG2A 4Y1AD 1SLXA 3ZL4L 3P2BA 3HGOA 2O9PA 3BPWA 2I1LA 1RL1A 1B57A 1VA9A 1EHXA 4Y1SA 2WXQA 5CPMA 1AQKL 1E2ZA 5HI5D 3GXMA 2C19A 1E27A 2Q8ZA 1HN1A 2C9PA 3NPXA 4RMRA 3I9PA 4QRTA 1QW9A 4X4ME 3X13A 4ALAH 2ICES 3ZZQA 5HVHB 3WJJC 1K8DA 1VZHA 2NUWA 1RZGB 4TVPE 4JY8A 3S8HA 4KRTA 1RVFL 5IVXF 3P0YH 4OM1H 4FULA 3BXNB 1VFLA 3CDGB 2OO0A 3PUEA 1NEUA 5I79A 2A9AA 1I8IA 1LP9B 1FDJA 4MQTB 3X11A 3EJYC 5F9JB 5AG9A 4ABVA 3GB7B 4TUJB 3CQKA 3AREB 1S5IH 1YPZA 3FSTA 2SFPA 4Z4TA 2NY5C 4HWBA 3MR9B 5TF1H 1TZZA 2SODB 1YNYA 3HS9A 1TE6A 1PZUB 4D71A 3VXQA 3N85L 4DCQB 1NDZA 3WUWB 2WNQA 3LZLA 1VGAA 2WXRA 4ZD3H 3U4BL 4CDGC 2EYTA 3GXFA 1FVPA 4P23D 5JPNA 4YBLB 4TNGA 5L8LB 2HLFC 3NIDE 4MY9A 2YBGA 4L8CA 1GHSA 1FNCA 2QDVA 2ZKWA 2H32B 4I5BA 2AOSA 5JYLA 3TBVB 1FNHA 1JUEA 3K71A 4HCDA 3QEZA 1GZJA 3C3NA 4MDPA 4A3QA 4TNEA 2G2RA 3QH3A 1OGJA 3M0IA 1H8OA 3HAEA 4UZUA 4R83A 2YBRB 3X12A 2PTTB 3V0TA 4LO9A 3UGXA 4GAJH 2CITA 3OWRA 1Q9WB 5DRXB 3W28A 4UQBA 3ANVA 4UR8A 2LAAA 4A1RA 2HLEB 2VABB 2IDUA 1EPFA 3BN9D 4K2UL 1VBJA 1OV8A 1PJWA 4QT5B 5BOPA 4QY8B 3EHBC 5TBOA 1XFOA 5SWSE 4WTQA 2P8MA 5HMEA 4HWZB 2ESVE 2W5PA 1TV7A 4Y5YC 3MLTA 5D04C 4H0LC 2YD5A 4UFMA 3G77A 3G6AA 4L1LA 1BX2B 2MQ0A 1V5XA 4JG0H 4PJHE 2ZYSA 4FNUA 2AQ3A 3CPUA 3N1MC 1DIEA 2X6YA 4LIQL 2P46B 1AGFB 5TDPB 4AWSA 4WTZG 5F2IA 1AXTL 1J11A 2CLRA 3RO8A 2HPOA 3UWYA 4LK4A 3O0FA 2OX5A 5K9QG 4QRRD 5IIEB 2H1XA 5K4XA 4P4KA 3VI3A 1ZTMA 3KPSE 1KJVB 3L95B 4HHGA 3UWUA 2W60B 3R6KA 3FN9A 3QKZA 3JZUA 2J73A 4NP9A 5CGYD 1B5TA 4NVTA 1RJZB 4GT0A 1KPUB 2FJFA 3DTXB 4FWTA 2XWXA 3QO0A 3CVDA 1HOCA 1ZXKA 1MH5A 3CQHA 4WZEA 2Y8UA 3IT8D 4X6BB 1E4HA 1OM3L 4ML4A 2X05A 2F74A 4OW6A 3WS3A 1T5XB 2VL5A 4DVBB 1PB0A 1TVNA 1LWHA 4GP8B 2FIKB 2FPVA 1SR9A 2KQNA 2Z1KA 5H91A 3RLVA 5A6LA 3CVCA 3C0QA 3D6GA 2VGGA 3RILA 4LASH 4GLRI 1GOXA 4E0CA 2CJ3A 4JZOB 1Z9NA 2ZD0A 4Y4HD 4Y4FB 1Z9LA 1THFD 2X89D 3P40A 4O50A 5E1IA 2PZNA 5IFJB 3D3AA 3A3WA 3W2UA 4GH1A 4KH9A 1A5UA 5FV1L 4IU3B 3CHFA 2F19L 1WYJA 4PC1A 2F7FA 5FJUA 5LN8A 5D1QE 1T04A 5F4OA 4U1HA 3O2LA 1R5VB 4KGJA 4B16A 3ROLB 3QKEA 1NZRA 1U8HA 4DVRL 3CHVA 1HL4A 3R06A 4GCXA 4OU1A 4MADA 5DMKA 4AGMA 4V11A 4WJ5A 2A9ML 3EOBB 2WHMA 1JWUA 3E49A 3BPLC 5GNXA 3FFDA 4YDIL 4IQJA 4AYSA 1O6IA 4EUPG 5JIQA 2HBXA 4AWTA 1DQWA 4EI5C 1HQRA 5A6JA 4GP5B 3CDYA 4N9GB 3RWIA 3VIIA 3H22A 3MACH 4NQDD 3RVWC 2PP1A 4MIMA 3UTSD 2FHCA 3CWHA 2VLLA 4PS8A 3N42F 5F44A 2KL6A 4YCPA 1R87A 1EL3A 2XQYK 4ZB2A 4DK0A 2XH0A 2Y72A 5HQLA 2O6PA 2WSPA 2UWEA 4FQIH 3SE9L 3S88H 2HVKB 4EAEA 3TV8A 3IJHA 2WLNA 3TTEA 2E3VA 3WMPA 1EZVY 1UB6A 1WDDA 5HYQA 3TO4A 1E4JA 3HV8A 4BFIA 4L4TE 2FJKA 4PRRA 4U33A 4KRPD 5J06A 1EDTA 3CH9A 5AFDA 2ZUSA 1EJOH 4N2KA 4OD3L 5I74B 4F9LC 2VNJA 4N0UE 3MX0A 2CLVA 5IOPA 5DWUL 3O4LE 5IM51 5IB1A 4XODA 4GG6A 3LH2L 1P7BA 4ATDA 2QELA 1NFBA 4LF2A 1WF5A 4E5TA 3OAAA 3OPSA 3TO2B 4W6WB 4WVXA 1OCCB 1IR1A 4UANA 3WLWD 1LEIB 3QCTH 1AP2B 2H90A 3BZFB 4PBDA 3O1NA 3ZIMA 1AXSB 3CAWA 1V4YA 3W7RA 4FLHA 1DOSA 2JIXD 3ULUF 1Z69A 5F4WA 2TAAA 2YAPA 3O6FC 4H25A 5FDWB 4W6YB 4HCRH 3V0WH 1UYWH 4TOYH 4RNRA 4WUKH 4ZMXA 5CBAA 4IRSC 1FYTE 2NV4A 4I3SL 5T9CE 4B9PA 3H26A 1U83A 4A7GA 5PTDA 1V55B 2OW6A 2WM1A 3P61A 4OPSA 3TT1L 3TR2A 2VAAA 3MO4A 3FU9A 1CPUA 3ZBTA 1YX1A 5KJ4A 2YD3A 4BFNA 4G7VH 1UG9A 2DWYA 4J35A 3IPEA 3KX6A 4LPUA 1KXVA 3G1XA 3PLYA 1UBSA 2JKLA 1ETJA 4GQZA 1HHKA 1M90D 3ET9F 3UZWA 3ABMB 4KKBD 4US5A 3CN2A 2YUWA 4CN1A 5F7HA 3O2VL 5ESAB 3GUTA 2VOTA 3KYKL 2H6OA 3CV6A 2ZA1A 5AENA 4XNXL 8XIAA 1TCDA 2KLRA 1S7QB 1KG0B 5IDZA 3LQAL 2G95A 3E2RA 5H1WA 5K3VA 1XG4A 2WXJA 1P7QB 3S8GB 3LZFH 1JPHA 3ZVVA 1KZYA 2ACRA 4Z2JA 1J8RA 4M19A 2MSPA 2VDPH 5BOZG 4IMKA 2CGRL 2PR9A 5DD1H 5BMWA 1RZKH 3RY8A 2NVDA 1SYVB 4IBLT 3ZMRA 5D38A 3ARDA 4CC0A 4GXWA 4HEPA 2OAAA 5DLMH 1C5CL 1R75A 4DTGH 3H9YA 5G2IA 2CMRL 2UZ9A 2ZZFA 3RWGA 4A66A 2WOYA 4DH2A 1W0KA 4LY4A 3PAVA 1P2CB 4MA7L 2BSED 1KCRL 4G70B 1SVDA 3SGEH 4AC9A 1XIHA 3PZMA 4UDUA 4PB0H 3L3HA 5HNNA 5DT5A 1G01A 4DO4A 3ULVC 1ZB5A 2R56H 2DU2A 2VDQB 3FU6A 3BGFB 4M1DL 1RH8A 2NMSA 5DXWA 3KGUA 3RF9A 3TPUA 5TK4A 1DWGM 1TZHB 1EVUA 2JFCA 5HSFA 4PJ8A 5DQ9A 2OMNA 1KFBA 4BWWA 4QNPF 1UWIA 2NPFA 4XXDA 4UTTA 3ZT6A 2ABBA 2FQDA 1DQJA 1SXBA 4HKXB 4WO4D 1OX4A 1MI5A 1A3HA 1Q7MA 3O06A 4V1DB 1N26A 5T8GA 1AA1B 3CSYB 4JFXA 3QI9A 3QNYA 2J13A 3SDXF 3PCYA 3PWJA 1OK6A 4G9DA 4NZRH 1K4CA 3FRPG 1MZRA 4ISVA 4RVBA 1AR1D 2WIIA 1I82A 4P2QD 1U8NA 5BO1L 1ITCA 3B0YA 4F8XA 1J48A 5CGTA 3IFPA 4H2CA 5CD5C 4K6AA 4PTNA 4PRHB 4XOCA 2VDNL 3P9LA 3G5YA 4LUIA 1D7KA 2FGWL 3WFEL 4DJFD 1QVOA 4FNRA 1FVEA 2CHNA 3QVAA 3C6LD 3IDNB 1WP6A 2E47A 2E6QA 4Z7WF 4QOKE 3WUZA 1GVHA 3B9KB 4LBUA 1N12A 4Z08A 4ERSL 1HIZA 3V5KB 2VT0A 5HMSA 4XN3A 4BKNA 4JCWA 4PJXB 1IT9H 3RWFB 3QJQB 2AEQH 1VKXB 3F7JA 3OR6A 5C0GA 3VNVA 4EOWH 3OXSA 4L3AA 2FQFA 4WTWA 4X6DA 5KVMC 1YDNA 1U42A 2E9LA 3H3KA 1J0ZA 2J8UF 5J04A 4CU8A 4WI6A 2JELL 3F4VA 2DY2A 4JN6A 3UR5A 4JFFB 3OGOE 3TURA 3RIFK 3FB5B 5I71B 5HNRA 4U1SB 2Z93B 4JRXE 3WFBL 4L3FA 3DGDA 2QCMA 4AV4A 1EUNA 1B3YA 4RXGA 2R4SH 5HYJA