1HVXA

Bacillus stearothermophilus alpha-amylase
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
483
structure length
483
Chain Sequence
AAPFNGTMMQYFEWYLPDDGTLWTKVANEANNLSSLGITALWLPPAYKGTSRSDVGYGVYDLYDLGEFNQKGAVRTKYGTKAQYLQAIQAAHAAGMQVYADVVFDHKGGADGTEWVDAVEVNPSDRNQEISGTYQIQAWTKFDFPGRGNTYSSFKWRWYHFDGVDWDESRKLSRIYKFRGIGKAWDWEVDTENGNYDYLMYADLDMDHPEVVTELKSWGKWYVNTTNIDGFRLDAVKHIKFSFFPDWLSYVRSQTGKPLFTVGEYWSYDINKLHNYIMKTNGTMSLFDAPLHNKFYTASKSGGTFDMRTLMTNTLMKDQPTLAVTFVDNHDTEPGQALQSWVDPWFKPLAYAFILTRQEGYPCVFYGDYYGIPQYNIPSLKSKIDPLLIARRDYAYGTQHDYLDHSDIIGWTREGVTEKPGSGLAALITDGPGGSKWMYVGKQHAGKVFYDLTGNRSDTVTINSDGWGEFKVNGGSVSVWVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Crystal structure of Bacillus stearothermophilus alpha-amylase: possible factors determining the thermostability
pubmed rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 181
structure length 483
sequence length 483
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1hvxA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hvxA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hvxA01
2W61A 3O2LA 3CUJA 2WVVB 1F4AA 1GOMA 2QV4A 3VIMA 1SMDA 4IISA 1W2VA 1C91A 3BLKA 4H41A 3CHEA 4ACZA 1KWGA 1R46A 3ZT6A 3U5UA 1BYAA 2A3AA 3MUAA 4FNQA 3LRLA 1NWUA 1C8QA 2XSBA 1O7AA 1H41A 3AIUA 3T0BA 2EQDA 2D22A 1H11A 4D1IA 2J74A 2X8RA 1FHLA 5LA0A 3APGA 3AIBA 3K8KA 3VDAA 1RD6A 4W88A 1R85A 2UY4A 1QBBA 2VZTA 2J4GA 5C70A 1XSIA 2WZIA 2DT1A 1I1XA 1X6LA 3CV5A 5A6KA 1UA7A 3WQ8A 1NWRA 3NSXA 4CD5A 3RJYA 4HA1A 3AS3A 2YBTA 1Y7VA 4LQ1A 1TE1A 1UR8A 2XHYA 1J0JA 4UQCA 3A23A 5JBFA 2C0HA 1HJQA 4AZ7A 4DO4A 3CC1A 1TQTA 1D3CA 4P8VA 2YLAA 2OW6A 2D0GA 1LWHA 3WL1A 3L2LA 4ZFMA 4BS0A 2XVNA 3VIPA 3ZJKA 3S2CA 3BSGA 1QWNA 3KLLA 3VGBA 2BY1A 3BAIA 3BUIA 1J0IA 1CLXA 2A3BA 1E3XA 4OIFA 3UCQA 4Z2GA 2CESA 1LL6A 4M24A 2FHFA 4TVCA 3KLKA 2A3HA 3M7SA 2VX6A 2J7HA 1QI0A 3QOMA 3SCWA 4BF7A 1ZS2A 4DM1A 1RPKA 4AIEA 1UWQA 2D24A 2G8ZA 4EE9A 5BRPA 4CN6A 1I1WA 5IDIA 3GBDA 1JF6A 5A6BA 4PCTA 4LX4A 2XIIA 1H0IA 3EJQA 1R75A 4IM4A 1ZU8A 1WE5A 3IJ8A 3OGRA 2DT2A 3WQVA 4UQEA 2J7GA 3PZOA 4EK7A 3ZR6A 2OSXA 2WVTA 1QVBA 4HPGA 5LA1A 1IV8A 1UKOA 2CBIA 3POHA 1ISVA 1W3KA 1UQZA 3NSNA 4P7RA 2BNJA 5CJ5A 5M5DA 2XYLA 4J3VA 2W62A 1UQYA 1TQUA 2GJPA 3M6DA 1EA9C 4UFIA 3W82A 3EBVA 3SCTA 4AISA 4N0RA 5C8BB 4KH2A 4AMWA 4OBSA 4U5KA 2XVGA 3VO0A 3VD9A 1E72M 3ZT7A 3PZUA 1BHGA 3PTMA 4W85A 5DMYA 1GHSA 3CZNA 1E6ZA 4QFUA 4OZOA 4DWSA 1M03A 3HU7A 3CZSA 4PMOA 3WMCA 1O7DC 1WCGA 4A4AA 1E71M 5ABEA 1AVAA 5CSUA 1KXQA 1V3MA 2W4XA 1NOWA 1CBGA 4KGJA 1GOIA 2CIPA 2OYLA 1R7AA 2ZX6A 4HOZA 5E9AA 3MSDA 1PS3A 2A3CA 2X1IA 5CXPA 3CZ8A 4PTVA 2ZUMA 1WZMA 1V03A 3TA9A 1KCLA 2XIBA 1FP8A 1N82A 5C71A 3PZGA 4RE4A 4B9YA 3GTNA 2W91A 3DDFA 1EO5A 3K46A 4PUDA 3WEMA 2DH3A 4BQ2A 1A3HA 2FYVA 2VR4A 3BMVA 3RPMA 3W25A 3VGEA 3W38A 4XZWA 1HJWA 3BAWA 3N1AA 4P7QA 3AOFA 5GNZA 5FL0A 3SCSA 1ITXA 4FNTA 3CHCA 2XGBA 2OWCA 1C93A 3GM8A 4MTVA 2QLYA 4GQQA 1EOMA 1TG7A 3AHTA 3KEHA 4JFSA 4LPCA 2VZSA 3WH5A 4BCEA 3BCFA 4W7VA 4TVUA 1H3GA 3VMPA 3CZJA 5A94A 3LRMA 2Y4SA 3WNNA 1WAWA 1AQ0A 1KBKA 1SMAA 1Q6EA 2JF6A 5DT5A 4UZUA 4DWSD 4EANA 1XHGA 3I3DA 1ISZA 4AEEA 4MADA 1V6UA 2GK1B 3FW6A 2VRQA 1G1YA 2EEXA 4AZGA 1GOOA 3IGUA 1QNPA 3LMYA 4D6EA 5FCZA 5E0FA 4WF7A 2WK2A 1MQQA 2CERA 4DWSC 2DIJA 4OJYA 3AYSA 2BY0A 3BVTA 2F8QA 3W0KA 3BUQA 1C7TA 1J0ZA 3ZQ9A 4MB1A 3WMBA 4NF7A 3MMWA 1PPIA 3WFZA 2QMKA 1GJUA 4W84A 5ABHA 7CGTA 3IJ7A 2WCGA 4ZEPA 4D71A 1WNOA 2CPUA 4IPLA 1OGSA 3I3EA 5E70A 4D6HA 1T0OA 1J0YA 1DWIM 4V2XA 1TVPA 3AMKA 5FL1A 3ECQA 1BYBA 1BYCA 3TOPA 1GOWA 4PN2A 4UTFA 1U33A 2EAEA 4D6CA 2D0HA 1OBAA 1ESWA 5JBEA 4H8HA 1L8NA 1CXHA 2WMKA 2DT3A 5I23A 3LXBA 3AHZA 5A8NA 2XVLA 1UZ4A 3AYRA 4C7FA 5A6AA 2J75A 2J8GA 2XTKA 4DO6A 1UZ1A 4Y7EA 3AIVA 1QW9A 4JFVA 2ALWA 1AQMA 2WKGA 4AD3A 4DO5A 2GFTA 4P8UA 3WY3A 2CBUA 3HJEA 3BXWA 2YA0A 2X09A 2DSKA 1KTCA 2IXUA 2X05A 1XCWA 2D73A 1LQ0A 1OIMA 2VTFA 2BY2A 5A6JA 3BAXA 3SUSA 1D7FA 5DT7A 3B8SA 3FAXA 1UWRA 4CU7A 1JZ2A 4PBGA 2VNCA 2YIHA 3VU2A 1IT0A 4Z2HA 3DHUA 3VNYA 2X0HA 2BV9A 1KCKA 4QDMA 4HZ6A 5I3DA 1JXKA 5ABFA 4W7UA 2EACA 1TQWA 4JKMA 4JFWA 4OOZA 5A6SA 1WZKA 1ZL1A 3CH9A 4F9DA 1HL8A 3BSHA 4M8UA 1ZBVA 3II1A 4LXFA 2YL9A 4W87A 1SYTA 2Z1SA 3ARRA 3WD0A 1UD4A 4CN1A 2WC4A 6CGTA 2DSVA 2WAGA 3DYMA 2RGMA 3AZTA 7TAAA 3BUDA 1HXJA 3EJTA 3AMDA 3LX9A 1H2JA 1OD8A 1OD0A 3VPLA 3SCOA 1VENA 3E1F1 2UY5A 2W63A 1V0MA 4NXSA 3RJXA 1VBRA 2YJQA 1VIWA 4UOZA 2D2OA 2WLZA 2AAAA 1QI3A 1IZJA 1HP4A 4AC1X 4AD5A 4D1JA 2HISA 4URIA 4OUEA 2WHLA 1EDTA 3GXPA 5GNYA 3TP4A 2YDRA 3OGSA 4P7OA 3VMOA 3PZTA 2YOCA 1KWKA 3WH7A 3WNMA 4P7NA 4MAVA 4CCCA 1CIUA 2J7EA 5CPSA 4WK9A 5D4YA 2ZUTA 1UASA 3FN9A 5BRQA 4MJ4A 1ODZA 2DPEA 3M46A 1KGWA 2EXOA 3WUGA 3AJ7A 4GI8A 1R47A 1VEPA 1UR4A 1UYQA 3AHYA 5A3HA 4UFLA 1HN1A 5JIWA 2DGAA 3WY1A 3A24A 3ZSTA 1V6YA 3EDDA 3CHDA 4AWEA 3ARSA 3PTKA 1U2YA 1XYZA 3GXIA 5FD0A 1H49A 3QHNA 1B0IA 2J7BA 3AS1A 3D3AA 4U2ZA 3GNPA 2D3NA 1US3A 1MQRA 2WXDM 3NIYA 4JFTA 4AYGA 1H1NA 4HTYA 2IGTA 1V6XA 2Y24A 1GOKA 1TA3A 1XGZA 4PUEA 1XYFA 1JZ5A 3B9EA 1KBBA 3WD1A 1LG1A 1B9ZA 2WKLA 1UG6A 4QLJA 2O9RA 3CMGA 3HG2A 4M29A 4WSJA 1UWTA 1VRXA 3EMCA 4AW7A 4WIWA 1EHNA 4GQRA 2TAAA 4J28A 3FNDA 3WFLA 2YDSA 3JUGA 3WY2A 1EIBA 4MB4A 4FNPA 4ZE5A 1DHKA 3D50A 1E0XA 4S3JA 4H7VA 2VR5A 1CECA 2EPNA 1UWUA 3WH9A 2BHUA 2GSJA 3VGDA 3PZVA 2NW0A 2QHAA 3N17A 3HN3A 1E3ZA 2WMIB 4AZHA 3PTQA 3N15A 4B15A 1JZ7A 1PX8A 4QAWA 5IHSA 2PWFA 4JIEA 1CYGA 1MFVA 1W2PA 5A6LA 4CKQA 5HXMA 4CGTA 1HTYA 5A8MA 1UR2A 2AOSA 3M07A 3VD3A 3OLEA 4PCSA 2OLHA 3A21A 1W9PA 2D3LA 4PSPA 3WDHA 3VX1A 2DT0A 2F1AA 4L4PA 2O9PA 3ZIZA 4QCFA 5A95A 1KXTA 1ZB5A 4EKJA 2Z1KA 3EDKA 1EO7A 2VCCA 1BVZA 2G3JA 1WP6A 3AXHA 4H2CA 2G4FA 1JYVA 3U5YA 3FHAA 1E6QM 1JIBA 1DWAM 3WQ5A 3WNKA 3O6AA 3VVGA 2CYGA 3W24A 3BAKA 1B2YA 2V3GA 1ITCA 5TD4A 4PMQA 3CHFA 1TZ7A 3W4RA 4RE2A 1PIFA 4M1RA 4GXPA 3K8MA 3GXFA 4V27A 4FLOA 4ATWA 4D6DA 3D52A 2EPMX 2DDXA 3W29A 1BGAA 3KZSA 4JL1A 4UZSA 1EHAA 5BXPA 2F61A 5A69A 1DWFM 2ZUUA 4Q7NA 2EBNA 4GI6A 3ZR5A 2EPOA 1J10A 3SCNA 1OT2A 1B3VA 4ATDA 3U7BA 1GUVA 1E40A 1BPLB 1K9EA 4J3TA 3WNOA 2YL6A 1UWIA 1QNRA 5D9MA 1NQ6A 5HOSA 1A47A 4HZ8A 4U31A 1YHTA 4E2OA 4UFHA 5D8ZA 4LYPA 3VSTA 3T2QA 3VIIA 3CUGA 3SCVA 4CCDA 1EQPA 1UKPA 5HPCA 1QHZA 5CLWA 4HMCA 4PMZA 2GJXA 1JL8A 4PTXA 2VVSA 2YBUA 4HU0A 3TONA 3WF0A 3NDYA 3GH5A 1Q6GA 4YHGA 3VIGA 1BFNA 3AI0A 5A6MA 2BHZA 3TTQA 3SUUA 5M3WA 1CXIA 1HKJA 5FIPA 1C90A 3HG3A 2GK1A 3MV01 4TX8A 4MB3A 2WZHA 1PZ2A 3UETA 1GCYA 1Q6DA 1V6VA 5I5RA 3ZJ8A 2XWDA 4AZ5A 1B30A 1JDDA 2FDMA 1MVYA 4WLCA 7A3HA 1K9FA 1TMQA 3CPUA 2J79A 1ZBKA 3GXTA 4CU6A 4N42A 1GZJA 3SCRA 4W5UA 4E4PA 1RH9A 1E0WA 2D23A 4DUWA 1J0HA 4JKKA 4PTWA 2DEPA 2JEQA 1KR0A 2VO5A 2VCBA 2ZIDA 2VQUA 1VBUA 3MS8A 4JL2A 3WQ6A 4XZBA 4QLKA 1CXKA 1FHDA 4D6JA 3W26A 3RILA 3LPGA 1G0CA 4ACZB 4JFUA 3QHMA 2EPKX 4YHEA 3OZOA 2NT1A 3MUY1 2ZUSA 2DSUA 3D51A 4GZEA 2WVSA 1M7XA 4F66A 1CLVA 4WJXA 1UR1A 3S5ZA 2DH2A 2ZX9A 3PN8A 3DYOA 1VEOA 3VD7A 2VX5A 2OW7A 3WH8A 4CCEA 5CGMA 1PJ9A 2WM0A 4UCFA 1HWWA 1TCMA 4OGZA 1VF8A 2BVYA 3W53A 4L4OA 4XX6A 1QI4A 2FH6A 2O9TA 4DUVA 2OWXA 1OT1A 2YFNA 4S3KA 2ZOXA 3ZJ7A 4AMXA 2XFYA 3CZGA 1KGXA 4JKLA 4F9JA 1HP5A 4ML4A 1EH9A 3F4VA 2JEPA 4AY1A 3UR7A 1VAHA 1UR0A 1O6IA 1E55A 2CKRA 3PHAA 3N12A 3ARTA 3BVVA 2XN0A 4KGLA 3SCUA 2X2JA 2UY2A 5BROA 3AICA 5I77A 3T08A 1EOKA 3AMLA 1E0VA 2G3NA 5AC5A 3VIKA 1G5AA 4EAMA 1JYWA 3VNZA 3RIKA 2F7QA 1GJWA 1PBGA 1GQLA 4XB3A 3ARWA 3W6LA 3FY1A 5E1QA 3CIVA 1NH6A 4HZ7A 1W1YA 2F7OA 3N11A 2BVDA 4ATLA 1CGWA 2CEQA 4CUCA 3VGFA 3QOKA 4XUYA 1X6NA 1KB3A 3VIHA 1U30A 1ISWA 1FA2A 2EJ1A 3WELA 1QNSA 3T0DA 2VC9A 3W28A 3ARQA 1VJSA 3EJSA 2ZXQA 1MYRA 1E4LA 1QX1A 2X2IA 5DEZA 1WKYA 3TTYA 4GZJA 4HA3A 5LYRA 3OBAA 1LLOA 3WQ4A 2J7CA 3CMJA 2VRJA 3G6LA 1CEOA 1PAMA 3OIHA 5IXEA 1JZ8A 6A3HA 2XG9A 1NOFA 3OLGA 3WD2A 1PZ3A 3K4AA 3DDGA 3GBEA 3LXAA 2F2HA 1ZBCA 4UFJA 2DIEA 1W9UA 4TUFA 3SCQA 3WH6A 2C8NA 4ZE4A 4H8VA 4NZJA 3PBGA 1LJYA 4AD4A 4GI9A 3CUFA 4AIOA 4UFMA 2VZOA 3NYDA 4M56A 1CGTA 4Q22A 3PZMA 3LPFA 3TTSA 1OWQA 1E4NA 2ZXAA 3LXCA 4JZ5A 1MFUA 1W91A 1WZLA 1ODUA 3BH4A 3BUPA 5CG0A 4AZ6A 3VIOA 3MUIA 2FGLA 1XC6A 4C7DA 4GO9A 2GDVA 5BXSA 3TV8A 3HMCA 4MNLA 3WF4A 3KL3A 3EDJA 1J9YA 2BFGA 3T09A 3GH4A 2RGLA 3QGVA 3U7VA 1BLIA 1JD7A 1B90A 3ZMRA 1VFFA 3WSUA 3SUTA 1NWTA 2CHOA 5A8OA 5M03A 4U3CA 3AHXA 4UQDA 4NI3A 2UY3A 4AZCA 4PMYA 2WVUA 1UKSA 3NJ3A 3WF1A 4V28A 1UA3A 3MKKA 3KE0A 1RP9A 3OLDA 1CZ1A 4CVWA 4A3HA 4HA4A 2FHBA 1C3FA 1X1NA 4BA0A 3THCA 1CGYA 2F7PA 1MW3A 1HJVA 2VVNA 2JIEA 1QI5A 2EABA 1XD0A 1BF2A 3MSGA 4U5IA 3BLBA 5GNXA 4B3KA 3AHVA 2VURA 4PEEA 2WHJA 1KQZA 3I3BA 4AD2A 1OIFA 3HG4A 1R87A 3TTOA 1E73M 1MWOA 2WMGA 1V3IA 3VKKA 5CPTA 1JDAA 2ZXDA 1BG9A 1KGUA 3EDEA 1HVQA 2VQTA 2J62A 1HX0A 3BAJA 4HMDA 1OM0A 2OYMA 2BXZA 1CNVA 3BVWA 2WVVA 5JIPA 3CUHA 1GVIA 1G9HA 1KXVA 3S5YA 2J7DA 3ARZA 3ARVA 2J47A 4X0NA 2WNWA 5BWFA 3LPOA 3MANA 1OINA 4FMVA 2A3EA 3GXDA 4LYRA 3VUPA 2ZXBA 4ACYA 3DX1A 3F5KA 2VMFA 1V3LA 2Y2WA 1BAGA 4J27A 1OCQA 1W1PA 5HDRA 3EJPA 2ZICA 1V02E 4U2YA 1UHVA 3AZSA 1E6PA 2IXVA 3VGHA 3F5JA 4HP5A 5A2AA 1R86A 3S6TA 1GVYA 2E0PA 1JYXA 1OGGA 1UOKA 4NRRA 3WF2A 1HJXA 1HIZA 3FXYA 2E3ZA 1CGVA 4W8LA 2OSYA 1CPUA 5BXRA 3AMCA 3BVUA 3UG5A 1QI2A 3AISA 1DTUA 1M04A 4U3AA 1W3LA 3EJRA 2WBKA 4DUXA 5KZ6A 2WMHA 1JDCA 3AROA 1E1FA 1HNYA 1BTCA 1B3WA 3PZNA 1GONA 4Z2IA 1HF6A 2BY3A 2XUCA 3WQWA 1M53A 1M01A 5DO8A 4HPHA 5EFFA 4GIAA 2FHCA 5AYBA 3VINA 3RMEA 3VSVA 2PC8A 4JCLA 1LL4A 1W9XA 3L4VA 2YDQA 2D1ZA 1XCXA 4GPNA 1I75A 3MMDA 1K9DA 6TAAA 3T2PA 3MV11 1NARA 2ESCA 5CGTA 4M80A 1VEMA 3UR8A 1LWJA 3BAYA 3ALGA 1E70M 3UEQA 2YL8A 3ARYA 3WMSA 3VM5A 1W9BM 4P8XA 1CDGA 4D72A 1CXLA 4RL3A 4PMRA 3CLWA 2VL4A 5E6ZA 5D9PA 1NWSA 1Q4NX 1JFXA 4DM2A 4HOWA 2WMJA 3QHOA 3WBAA 2WC3A 3WN6A 3AIWA 2BHYA 1E56A 4W93A 2XFFA 3WIJA 5E0CA 4TTUA 4FNUA 5A2CA 1JGIA 2E9MA 5IFTA 3F5LA 1UKTA 1G01A 1WB0A 5EBAA 4NZCA 1J01A 2CBVA 3PZQA 1TR1A 3VM7A 1FFQA 2J77A 1L0PA 3VDCA 5ABFB 1MQPA 1V3JA 4FNSA 3FAWA 4AYSA 5BXTA 1GOQA 2XM2A 3DC0A 3ZO9A 4WKAA 2Y8VA 1UUQA 5A1AA 3AZRA 2DSWA 4B3LA 1QWUA 3WY4A 4PMXA 1MXDA 3AXIA 3H55A 2ZUVA 3MI6A 5A8PA 3D4YA 1JNDA 1VFUA 1HJSA 1CENA 1ISYA 4UNIA 2WC7A 3A4WA 1UKQA 3N13A 4TXEA 4NSBA 2GJRA 2BS9A 3U57A 1C7SA 3CGTA 4OKDA 2YA2A 3OG2A 5A8QA 3WENA 3HG5A 1V3KA 2IUZA 1HKMA 5EMYA 1KTBA 2VX7A 1HKIA 3T2OA 1TQSA 4JHOA 1JZ6A 2YKKA 2C7FA 2G41A 1EDGA 2WWDA 2BVTA 1UD8A 3DX4A 3RM8A 3SEPA 2PWGA 4FLQA 2E4TA 3GDBA 3KL5A 5AC4A 3A47A 3RM4A 2VJXA 2OWWA 1PEZA 2VI0A 5BCAA 4Z2JA 3DHPA 4TTGA 3K4DA 1JI1A 3VIFA 4MNJA 1E1EA 3GXMA 3W81A 2E8ZA 3OGVA 1XH1A 4HMEA 3BGAA 1Z32X 3CUIA 5F7UA 3PZ9A 3VTRA 5D9OA 2CCRA 4W8BA 2CHNA 3L4XA 5D9NA 2DSZA 1B3ZA 1BG4A 5EB8A 4HU8A 1UD2A 2ZWZA 1QW8A 1R33A 3BCDA 1OSEA 4GKLA 1FH8A 4JAWA 1VFOA 3VDHA 1VJZA 4U33A 1P6WA 1ECEA 4AXNA 2V3DA 2EPLX 1W1VA 1JG9A 1H4PA 2QF8A 4UQBA 4AMCA 1PX3A 3B9AA 2WYSA 5FKYA 1QOXA 3WBEA 1QPKA 3W6MA 2PBGA 3QR3A 1TA3B 1Q6FA 1QNOA 3A22A 1XSJA 4YN5A 4ZENA 3WDIA 1DWGM 3D5HA 1NM9A 1JF5A 1CGXA 1TUXA 1J12A 2UWFA 2X2YA 2FGZA 1UD6A 3AS2A 2WANA 4OBRA 5E6YA 3VD4A 2G3MA 1US2A 3CBWA 3A5VA 9CGTA 1UD5A 2JIWA 1J11A 3BMWA 1XRVA 3GNRA 3VDBA 4D6IA 4CVUA 4GINA 1DP0A 1CTNA 2J8FA 2Q8XA 4MDPA 2WLYA 3WUFA 2CNCA 3IAQA 2EO7A 4J7RA 4PMUA 2Y8KA 5DF0A 1UH3A 2FH8A 4W86A 4W7WA 1UD3A 4TVDA 3VIJA 3WF3A 4F8XA 1WDRA 4IUGA 1B3XA 3SUVA 3NCOA 2F1BA 3DX3A 3CZLA 3ZT5A 1HKKA 1V08A 3WDJA 1E15A 3OB8A 1QHPA 3WUBA 4B16A 4R5EA 5I24A 2ZX8A 4PMDA 4PMNA 1V02A 1W9DM 3GNOA 3L2MA 3LPPA 2XGIA 2J78A 2XJ7A 2O9OA 1E5NA 4F79A 4QLLA 3N9KA 1J0KA 3SCPA 5HBFA 1H09A 4PTMA 2VCAA 2OYKA 5EFDA 1XD1A 3W27A 1JYNA 3EMZA 3AIQA 4OOUA 1B3YA 3IK2A 3WNPA 2PF0A 4K68A 2B31A 4M82A 3WEZA 4J3XA 2WW5A 1ISXA 4CD7A 1OB0A 1ZJBA 1JAEA 3L4YA 3HZ3A 2E9BA 5CLTA 3THDA 2MANA 2WCAA 3VOCA 1W32A 3SURA 1J18A 3O9NA 2GVYA 1GQKA 4KRTA 1QNQA 1W1TA 1EGZA 2XM1A 4AEFA 2XSAA 2VUYA 3WDQA 1ZBWA 2PWDA 3L4ZA 4B9ZA 3ALFA 5A6BD 2V3EA 2GUYA 3MU7A 4P7LA 1JZ3A 3BC9A 2V3FA 4PRWA 1QBAA 2W67A 1MXGA 4KWUA 5CPQA 1JAKA 4D6FA 4AZBA 2QPUA 3KWXA 5M17A 4AD1A 5FOOA 4CU8A 4AIUA 2Y5EA 1XH0A 4D6GA 1TFVA 1B1YA 1CWYA 4WKHA 1ZJAA 3RCNA 3AFBA 3MO4A 1CXFA 1E6NA 3LRKA 3G6MA 1TVNA 1HXKA 3AQUA 1WDSA 4MPKA 1R8LA 3UG3A 5I78A 2GJXB 1C92A 2VT0A 2XFRA 1HT6A 1TQVA 1DWJM 1BSIA 3KL0A 5I0DA 1H5VA 4FK9A 4E8DA 4MNKA 2NSXA 2VZUA 4LYQA 2XN2A 1W3HA 4MDOA 1E6XM 1JD9A 2WZEA 4TX6A 2G3IA 2JF7A 4ZXOA 1DEDA 2DQXA 1MW2A 1E5JA 1JZ4A 1LG2A 2ZUWA 2WBGA 1PX4A 3IANA 4MB5A 1E9LA 2XWEA 2XVPA 1QHOA 3AXXA 5KEZA 5IHRA 3AS0A 4R27A 3SUWA 3OZPA 3ZSSA 8A3HA 1WPCA 2ZE0A 1WDQA 5JBDA 3CO4A 3GXNA 2YL5A 4TOQA 3A6OA 2YFOA 3A4AA 3FHQA 4M81A 4KRUA 4HOXA 3POCA 2JE8A 4DWSB 4E8CA 2X0YA 4CD8A 1WZAA 2F7RA 3WL0A 1GPFA 5GQBA 2OSWA 1BQCA 3T0AA 3ZJ6A 1UWSA 3EMQA 4Z2KA 1PIGA 2GDUA 5HPOA 1SR0A 1G94A 3MMUA 1E6RA 1FH7A 1NP2A 4NX0A 3BLPX 1EQCA 3SIMA 4CN4A 1EXPA 4PSRA 5IFPA 1W9VA 5I79A 5D8WA 5ECUA 1V0KA 3N04A 1FH9A 2CBJA 3H54A 1XV8A 1AMYA 2VZVA 4C7GA 3L4WA 4YPJA 1CGUA 3VMNA 2W66A 5JUVA 5CSYA 4NZFA 3VX0A 2HVMA 4LGXA 8CGTA 1BGGA 3BVXA 2YA1A 4RE3A 4MNMA 3ARUA 3WDPP 2X2HA 5CZKA 1C8YA 2ZWYA 4FLRA 3AIEA 1B31A 1V6WA 5LA2A 4FF5A 3DX0A 1E4IA 3N18A 1MW1A 4AD0A 2J7FA 1KXHA 3WEOA 3VD5A 2PWEA 4IPNB 3MUZ1 2D20A 2PWHA 2WPGA 4BQ3A 4WSKA 2E9LA 4GO8A 3L4TA 1GQJA 3RO8A 4MAZA 1E6SM 3ARXA 3J7HA 1NOUA 3OA5A 5AYIA 2WMFA 2CKSA 4CD4A 2JFEX 2WMIA 4UFKA 1NP0A 3K1DA 2YLLA 2J25A 3ARPA 1LF1A 1RP8A 5BYWA 3GYCA 1MW0A 4X9YA 4JCMA 3DYPA 2E8YA 5I2UA 1KQYA 5ABGA 1C8XA 3DECA 4ZXLA 3CZEA 5HNNA 2WSKA 2F18A 3EYPA 4JHZA 1EDQA 1GORA 2W92A 4QCEA 1JI2A 1R7OA 2WHKA 3UERA 2PB1A 4P8WA 3VILA 2ZX5A 3NDZA 2NT0A 3ZM8A 2V5DA 1D2KA 3NSMA 3WKZA 2FE0A 1HL9A 2ZX7A 2XVKA 3WDRA 1GW1A 2WSPA 2JALA 2QPSA 4WKFA 4Z2LA 3A4XA 1KR1A 3EJUA 4CD6A 2QMJA 2O92A 2VRKA 4BQ4A 3AIRA 4H04A 1DWHM 2PI6A 4J3WA 1W3JA 2XN1A 1JNEA 4BZYA 1GQIA 1V0LA 1SZNA 4J3UA 3GH7A 3B9DA 1BYDA 1FP9A 1GHRA 3H53A 1YQ2A 3OLIA 3DX2A 4FNRA 1VB9A 2CITA 2VX4A 3UESA 1V0NA 2CXGA 1H0GA 3ZOAA 3WD4A 3CZKA 5DFAA 4GZIA 4UQAA 3IAPA 3UG4A 4MJ2A 4W5ZA 4FLSA 1BPLA 1BVNP 2EADA 4UOJA 1E43A 1KFWA 2WCSA 3AMGA 3IJ9A 1F4HA 4UR9A 3BUBA 4J3SA 4X0VA 2CETA 3A3HA 4QP0A 3CTTA 2WB5A 2BXYA 4UQ9A 2WHMA 1OGBA 5CQ1A 4AZCB 2ZUNA 3GZAA 1VFMA 3D4ZA 5I6SA 4H8UA 1K6AA 5E09A 1XSKA 2XPKA 4W8AA 1K9TA 3W37A 1S46A 4UOQA 2V5CA 4A3YA 5A2BA 2WWCA 1UH4A 1FOBA 1V3HA 1WO2A 3RM9A 1Q6CA 1CXEA 4NXKA 1FFRA 1IZKA 3WUEA 1R34A 2V38A 4PYSA 4KMQA 2W5FA 1UR9A 3NUKA 5GPRA 1E4MM 1AQHA 3L4UA 3EDFA 1UH2A 1LL7A 4AZIA 1SFSA 1WDPA 3PZIA 4XV0A 1JXJA 3VSUA 1HJUA 4NRSA 2VOTA 2AMGA 2D0FA 1XH2A 4BQ5A 3VGGA 5AY7A 3K8LA 1GNXA 4PMVA 3WNLA 3WD3A 4W89A 3RDKA 2PBOA 2E40A 1HVXA 1JFHA
chains in the Genus database with same CATH superfamily
2W61A 1ZM4A 2NX3A 4NNXA 1EHLH 4OPVA 4GG8B 3BUYA 5CO1A 3KJ4C 1D5RA 4ELMA 4I87A 1N07A 1SLUA 3MC5A 5GS3A 3ZPNA 2A6JB 1O7AA 2V31A 3WQPA 5KSBA 3T0BA 2PXYC 4N8UA 4XAWL 2ICEB 2BNQD 2E28A 2GCYA 3K8KA 1SXNA 1IT8A 3FOKA 2R0LH 4XSMA 5T5FH 3OKKA 1MCHA 2PYEE 3RJYA 1QTWA 4A1RA 2CDFB 4NAQA 1VFAA 3PHOB 5JBFA 2X38A 4RD3A 4DTGH 1ID2A 4LL4A 4UQ2B 1EEZB 4C5ZA 1TQTA 4QNPF 3NZUA 2MOGA 3W70A 2YB4A 3AG1B 1VADA 5IVXE 3UBFA 3VKBA 5D1XB 2CKBL 2EDMA 2JKXA 1IGMH 1IARB 4P46D 4FERA 2DLFH 4UQ3B 1AYOA 5IW6B 5C7ZA 3SDCA 3IF1A 3KLKA 1SOSA 2XZ9A 4IOFD 1WZ1L 3SCWA 3V0EA 2FPYA 1RPKA 4M6AA 3UJ2A 3WLLA 3WLSA 2VENA 4LCVA 3WD5H 4B5UA 5ALCL 1AGFA 3NIDB 1ADOA 3RZCB 2OSXA 1EZVY 5E00A 4ODVH 1K5WA 1JTPA 3BV7A 3LDBC 1UQZA 1L6YA 1IFRA 4AXKA 3JV5A 1QH0A 2GJPA 1TG8A 5KBDA 4BE5A 1EJFA 4QROA 3A4DA 2W60B 2C9SA 4PMEA 4IOSA 3NYKA 1RHHA 1TETL 1N5AB 4JQIA 1LDSA 3GSIA 1G9ML 5DDHB 2HVJA 2ZUQB 5I8KH 3SFKA 4WO4B 1VGEH 2IPTH 4YL2A 1ADQL 1V3MA 1A0QL 3A67L 3SDCD 2VBTA 3TCLA 5HYQB 3MSDA 1PS3A 2DI7A 3KX6A 3QJUB 2HTKC 4M5YL 1J88A 1NAKH 3WFCH 4L8SC 3IRZA 3Q6FA 3PZGA 2MCG1 2JKTM 2H1PL 4P2AA 4OLXH 4PRPD 3BMVA 1HJWA 2QDWA 2WUCL 5GNZA 5D1XE 1UBSA 4M51A 3GDMA 2WYHA 3TTEA 3L81A 2QA4B 1JVOA 2JTDA 4J3OH 3UBXI 4JTDA 3QKEA 1XCTB 3MRPB 2IOOA 4YWGH 4IOSD 5B4MD 4R7OA 1LNUB 2B77A 1OYAA 3WYRA 4IEFB 3JQQA 2INZA 4XKVA 4HKPA 5IBXC 1V6UA 3UZQB 3NIDE 3FW6A 3AM8A 5D1QD 3RLGA 1XEUA 1NSJA 2QJHA 2WO2B 1GGIL 4N2EA 4V33A 4XP6H 5E0FA 5G5DB 1QWGA 3G05A 2KPWA 4WF7A 4GOSA 2FL5A 4HWBA 3CD6B 5DVLA 2J6EL 3SKOB 3KOFA 3O4OC 4UWMA 4ONGH 2WCGA 2OK7A 1I3RB 2ZRYA 3D0CA 4IPLA 4UIMB 4D6HA 4KTEL 4GRLC 1TQCC 3QO0A 1T8XA 3GSOA 2FLBT 3AMKA 5FL1A 1MHPH 1GOWA 4AC2A 1TO4A 2WMKA 2DU2A 3UBXA 3T71A 2CIKB 4LSPL 5FYLE 2J8GA 2O26U 3CJJA 3UU0A 3B7SA 1QW9A 2K1MA 2WKGA 1EWEA 3QAZC 4B41A 1X5AA 4YLQT 2X09A 3WFEL 2WJDA 1Q9OA 3QJRB 2CFFA 1ACYL 3FCUB 3O8XC 1XCWA 1U3YA 1MDLA 3BAXA 5DTFB 1G4RA 3AW5A 3H8NA 3NSYA 1PKQA 4JQIH 4OCRH 4P4KC 1URIA 5D5MF 4UI2A 2H26B 3KVMA 4PBGA 4KQ4L 1XF3B 4LKXA 3F58H 1TV2A 3O6FB 3NEVA 4RMWA 1M1BA 2X0HA 1RUSA 3W7EA 1VQLB 2QGEA 2OTWA 2EACA 4K94C 2ZC8A 3CH9A 3LSBA 1PWLA 4H1LG 4PGCA 2VJ8A 1ZUNB 1O7VA 4LMQE 1MZYA 4TQIA 3H3PL 1FRGH 4YCOA 1HXJA 3KS6A 1OD8A 4M7JL 3SCOA 2PETA 3MBEC 3PCYA 1N67A 4YDIL 1UJTA 4MKNA 1QI3A 3FRUB 5I1LA 2EVIA 2FSDA 4ZZFA 3B34A 3KH4A 3VFPB 3TP4A 2GWGA 3OAUH 3AREA 2ZYHA 3I02B 1CIUA 1BSLA 1XR8A 2CZVA 3DX9A 1UASA 2GC4C 1EFCA 4AVNA 1AGBB 1XH3A 4MWAD 3WY1A 1QK2A 2O7SA 3CHDA 4YE0A 1U2YA 2FB3A 4LRSA 4NM8L 2J12B 1IXQA 3WMPA 3GNPA 4FQHB 2JK2A 3S8HA 2HT3C 3H70A 3BPLC 4N0YH 4S1QL 3CFIC 2WWMC 2NZLA 2PP0A 3VOHA 1XLDA 3ZVHA 1UWTA 3LLFA 5EEZA 2J1YA 3TBYA 1WBXA 4GQRA 3H2PA 2WNQA 3KD4A 1GYCA 3VW3H 5ELIA 4JO5A 5I74B 4JDBA 4Z0SA 3HG0A 6PCYA 3ASTA 3ARED 2NW0A 3CXCB 3ULVH 1T2XA 3APCA 1ZLUH 4PW3A 2QUUA 1OQOA 4GY0A 3FTVA 3OLEA 1RPQA 1BRLB 4LU5H 3N1QC 1T4WA 3AG3B 1SZGA 1RU9H 1NFDB 1WHOA 3HG1D 4PTUA 1S7TB 3ZIZA 4X7TA 3D18B 5LGJA 4NNCA 2YWZA 3AXHA 4A2LA 1JIBA 5DMKA 3WQ5A 2JKSA 3S1GA 2Z8SA 3KLDA 4XVJH 4DJEC 1AUSL 4NWUH 4PMQA 1FRQA 3QUKA 2Q7AA 1UA6L 3MDWA 3GHBL 3LZQA 1LK2B 4LDCA 1R9ZA 1VACB 3ZDXE 4RRPG 1BX2B 3RFZC 5CSBA 1S7RA 3F12A 2EPOA 4GAGH 2O6CA 5E6IC 1XLJA 1H3PL 4AGMA 2XH4A 4LUSB 4F9PA 1JHLL 1UWIA 2ZTGA 3PWNA 1EJ6A 2RD0A 4FXUA 3VWJB 2PTWA 4HT1L 1FDRA 3W7JA 2REQA 4PCYA 5IVOA 3EOAA 3B03A 2QJDA 2ZA3A 1GO2A 3W2DH 1FAKT 4AQ1A 4KETA 3BP4A 3MV01 4H8WC 5MENE 2X0UA 4PP1D 3C5ZC 3TJ4A 3SE9L 4QPEA 1CT8A 3UL4A 1V7AA 2VZ1A 1RZ8A 3TA3C 3ABLB 4CU6A 3EJCA 1XF5A 5IB4B 1E0WA 4IX2A 3OYZA 1XHHA 5ETUB 4GFTB 4LL1A 3UZYA 1E5CA 1NFDE 1NAMB 4I5BA 4L1LA 2EEAA 5K9JH 4ML9A 2DSUA 1ONQA 4XP1L 4LLVB 3D12B 1JCYA 1B6DA 1TENA 2Z29A 1D8CA 4ZG1A 3RVTC 3EOBA 4X50A 4Q4MA 3MRLB 4LHUG 4M03A 1JV5A 4PS3A 1PJ9A 5DANA 1IT7A 4KJWD 1EP1B 2OCZA 4Y2DC 4L4OA 1E8YA 2O55A 4Q9CA 2JKEA 3FYOA 4NO2B 2Z4TA 3SYPA 5EC1B 3OZWA 7ODCA 2YQBA 2D4FA 4YBLC 4WY0B 1QXLA 2AJUL 1E0VA 4FXKA 1OO2A 5JOFA 4OLUL 3DFSA 1TTAA 3U4AA 1DQKA 4EAMA 2F7QA 1PBGA 2DQIH 3QJZA 1EJ7L 3G5YA 4F92B 2C3VA 1MG3C 2HJKB 3VH8A 1ETZA 5I1KL 1TPXC 3NIFF 5GRXG 3L9RA 3RHWF 4G71B 4D8LA 1CLOL 4XMYA 3DOPA 1J8HA 3T77B 4K1GA 5LYRA 1TVDA 3OBAA 5L2JB 1G7SA 4ZOEA 1FCCA 3PQYA 4XMKH 1K8IB 6A3HA 4IFOA 3OIXA 3N2CA 2VLRB 1M9WA 3DDGA 5AVNA 4PB0L 1XB6A 2MHAB 4JUTA 5AEAA 3C2EA 2LLLA 2VSCA 5I5JA 3QEGH 2JB5H 2Y6TE 2GDVA 3HFML 3TCSA 3NR0A 3DVNA 5D72L 1Q86D 4WY7H 5BZXA 3A6CL 5EBMB 5A8OA 3SADA 4UMSA 2BNUA 5LHEA 4GW1A 2A38A 1QYGH 3L3OA 4Q9QH 4HH9A 3NG3A 1N0XH 3CBRA 2ITCA 3UCCA 5FF2A 1YEKL 2DBJA 3NOIA 1QSEA 2ZUYA 1BF2A 5CEXB 5GNXA 3QXVA 5KSWB 2WKOA 1D5MB 3PS6A 3I3BA 4X5XB 1LDPH 3UPCA 2WO3B 3C8NA 4AD2A 2YMXH 3TTOA 1GVFA 1LE9B 4G7YL 1JDAA 4BFKA 4R90L 1OM9A 2O61A 2Y7LA 2NXYC 1P5UB 4BQ9A 4N4PA 5JUEH 2OMXB 1ZTMA 4JFFA 3NACH 1YNKL 4P4RA 3R94A 1A1OB 6XIMA 5BWFA 3WLNA 3GXDA 3PJSB 2AC0A 3JRKA 4GNJA 3BZFB 1W0MA 1RCYA 3MRJA 35C8L 2KT6A 4C54A 1DLFL 4JTEA 3T65B 5DWUH 1UGKA 3PL6B 5PAZA 3QWNA 4PLNC 5D7KE 4JY5H 1G7JA 1UVQA 5AOJA 2GTZA 5MI0B 3AMCA 1QI2A 4GMTL 4H7CA 3P0XA 1QVOB 3PG2A 1I2NA 2K8QA 2XUCA 3ESUF 3GBNH 1M1SA 5CGYC 4DIAA 1TLLA 2PEVA 1BBJA 3CYVA 3A1PA 3ZLQC 4ZX4A 1RV8A 1W9XA 4S39A 2CJSA 4KQ0A 4P2OC 1PVNA 4HHAB 4MMYB 1GZGA 3NXLA 3QJHA 2H3NA 4JFFD 4YE4H 1KRBC 3FQUA 1A4JA 1R2SA 1RXLA 4OB5H 3WN5A 4GAJH 3UH8A 3JV4A 1VPOH 2QN6A 1S7UA 3QHTC 1IWBA 5AB1A 1R5WB 1GCFA 4A35A 2L04A 4OOVA 2WXOA 1E56A 4TL5A 5G4MA 2VXSH 4MCYB 4XX1E 1CLYH 4QD2E 4NZCA 2ZWSA 3IGHX 5E6TA 3DK0A 3FDGA 4R34A 2XKSA 5CEZH 4WZLA 4N2NA 3ZO9A 5A1AA 2V2TB 3VDGA 5LNGA 4ZD3L 1CENA 4Q8OA 3C0LA 3AWFA 4Z95L 2IQ0A 2OPJA 3CGTA 4O52A 3OKMA 3IE4A 2L3BA 4L80A 5LGHH 4QRFA 2G3XA 2X85A 3J8F7 4R9XA 2OO0A 2YKLH 3B2MA 1NDGB 4NY2A 3G5ZA 4PRAB 2PZNA 3LS5L 4L3AA 4O0QA 2C14A 3ZK0A 1IEQA 4WW2F 2VCOA 4KUZL 2PXYB 4EIGB 1U8CA 4E9TA 1NSNH 5T1DH 1ANUA 4XD3A 5TDPA 2QVNA 3GSUB 3W2GA 2WQPA 3HS9A 2XGZA 5IBTH 2J7LA 2IMRA 4M5ZH 1E9IA 4PZVA 2QF8A 3IMBA 4GH7B 3LH9A 5AW5B 4F58L 1N06A 5ESQA 2PBGA 3V4VB 1KYAA 1ITUA 2RQEA 3PBMA 5KS9B 4JNXA 3X13A 3BZJA 5CNHA 3VD4A 1G7LB 1Q82D 1A7BA 3N5AA 4II3A 1V54B 4MCZA 2EG6A 3ARDB 1QQDB 4PC1A 4WTQA 1BP3B 2OMUA 4WI7A 3O4LA 3ATDA 4Y1AD 4RMBA 4KRPD 4UMGA 2HX8A 4OVUA 3VFOB 1T1WA 2J78A 3LKSB 1WK0A 1WITA 4PJ8A 1T0MB 5LG6A 4J0QA 4FQCH 1BQRA 1W17A 4TQHA 2IDUA 3W27A 5D1ZC 3CXDH 3EMZA 3U9UA 3KNBA 2VHLA 5KTEL 2CO7B 3CFDB 2NQ5A 2FVGA 3NPUA 1IAMA 4MVAA 4IQHA 5AW4B 1MJ7L 2BNRB 1FL5A 2BVOB 3VOCA 5FX3A 1QO3A 4KK9C 1QNQA 2VUYA 4L6DA 3RQ3A 1ZBWA 3ABOA 1DE4A 2AJXL 5CJXA 4JPIB 4MD0A 3W83A 1SSDA 5JHLA 5TRDA 1QBAA 4O2FB 4R5XA 1T1YA 2FBOJ 3CL7A 4KTDL 3L5IA 3O4LD 1UWYA 3S8WA 2DQEH 5HJBA 4CSPA 1XH0A 4FXLA 4D6GA 4ZMOA 2FMOA 2C5DC 3W2UA 4RM0A 4ZA0A 4P5KA 4EF3A 3OPSA 5TPWH 3AQUA 2NW2A 5B8CC 1C92A 1TCRB 2ZF9A 4M62L 3G71B 3B0YA 5I0DA 1H5VA 4K8RD 2VQ4A 4LYQA 2BLFA 1FVEA 1B4LA 3Q05A 5ISZE 4B9GA 2O4QA 3GSXA 4F40A 3BOLA 3PABA 5BVPH 3UWQA 2X3CA 2J66A 3GXNA 3LIZH 1FHGA 2YS4A 3ICJA 4D9LL 1HAWA 4X4YB 4JJ5B 3NGFA 1F6LL 1TJGH 2I5YH 2B4CH 2ACSA 2R6HA 4PB9H 2GDUA 5HPOA 5T3ZE 3KS5A 3O4OB 4ZXBA 3LO8A 5F1IA 1R3KA 3BJLA 4LLQA 4B9KC 5DMIH 2XSXA 3L68A 2Q9OA 3D0VB 4GRLB 3KRSA 1TQCB 4A7QA 4ZPTB 4QY8A 1V6TA 3QO1A 2CBJA 3RX8A 3WBDA 3MBXH 1Q6QA 1F8TL 3L4WA 3R25A 3GM0A 1CGUA 2B59A 3GMQB 4UTCA 3E2SA 8CGTA 2VXUH 2EUVA 4RE3A 1FL6B 5AHLA 3QNYB 2VFEA 2EXYC 1VHPA 4FLRA 3AIEA 5PTDA 5LA2A 1YEDB 3QZLA 5E94B 4DGYL 4GX9A 3KPSE 3QAZB 5FF4A 3K5SA 3KVPA 1CDUA 4WSKA 3O8XB 3FB7A 3IETB 3NZ1A 3GIZL 3NSFA 3F6LA 3I4KA 2ZAIA 1KK2A 4URKA 4GIOA 4WUUA 1Q0YL 4EZLA 4B43A 1U9KA 3QRLA 3DUSA 3DSFH 3V5KA 1TUIA 3BUTA 3WYZA 1PG7L 4BFGA 4MIMA 2H2PC 4KZDH 3QFJA 3DECA 4ZXBD 4ZMWA 4YJZL 5JHLH 1AH1A 1SFLA 3E6HB 5FEPA 5TQ2H 3DIDA 4L5FE 2ZNXA 4N9CA 2NT0A 3ZM8A 2OU4A 1MF2L 2EECA 2JALA 4FG4A 2A1YA 1R5NA 5A88A 3TN5A 2XVBA 3MBEB 3KVKA 3NPZB 3DFHA 5I02A 4X6BA 4NKMB 5B22A 1NCCL 2AXFB 2FO8A 2CUMA 3OLIA 1VB9A 3U4BH 1R3SA 2ZCZA 4X4ME 1GVSA 3UP1A 2O6PA 2GSIB 4XP9H 3WS3A 3RXZA 4KUCD 4AU0A 1IWPA 1A4KA 2WCSA 4HK0A 1TUPA 3OZMA 4QP0A 1MCPH 5A40E 4JR5A 1WAUA 4JG1H 1RCXB 2WXQA 3D4ZA 3TFXA 3QFJD 2OP4L 2XPKA 3UJFA 1H15A 4A3YA 3NJKA 1YJDH 2C91A 5I1EL 2WV8A 3EGDA 1NCWL 4XZUA 3SQBA 4EACA 5CAKA 4GBUA 2RDUA 3GR8A 1H9VA 2E5BA 1KY7A 2HJLB 3TS8A 4QVJA 3B0UX 5EC2A 4OIBA 1AHWA 3Q2LA 3ONCA 2JSFA 4NJGA 3ZHLA 5T5NG 1M56B 5CLXA 4HLEA 5CEWA 5LGXA 2PZ0A 1F4AA 3HS0C 8FABA 4TF4A 4UB9A 4XOPA 2ZPKH 3H12A 4WJEA 4GXVL 1KWGA 4AF7A 4MNHB 2QEJA 2XSBA 1SLXA 4KZEL 1M6UA 2NDFA 2YPLD 5EMUA 4YGVA 2J74A 3GMOA 3WK1A 2LLEA 3BJSA 5IQMA 1DSFH 4OZFA 2DBLH 1H3XA 2WZIA 2AQTA 4QRPA 2IPWA 2IQDA 3S7GA 3QQ3B 3TBTA 2UYLA 2YBTA 5LGKA 1J0JA 1I3UA 4E5TA 2YCLA 4TR9A 4DK6A 1I7TA 1QNZL 2YLAA 1U8NB 4ACAA 4HS6B 1HSAB 2V5SA 3L5WB 4IHOB 2TMDA 4P3YA 1QWNA 3MHGA 4HIEB 1T1XA 5IIEB 5F3FA 1LL6A 1C8VA 3N3MA 3RFZB 5DJCA 3REQA 4QO1A 2VX6A 4I18C 3DVIA 1C12A 5E6IB 2G8ZA 4EE9A 2OR8A 3W7LA 1XGYH 1JWMB 2B7QA 2RR3A 4DN1A 3VQ2C 3U6KA 3N9RA 2P8MB 4AY7A 1ZU8A 3N2MA 4R7XA 3QSYA 4HK6A 1K4DB 4KVNL 2DM4A 2CHZA 4QRPD 4P7RA 3QNXA 2Q6KA 4WOQA 1PFCA 1F11A 1U6AL 3KM8A 4LSTL 1EUNA 4HCLA 3O9WC 3C5ZB 3NQEA 4I88A 5ADPH 1JF1A 3EWWA 3R2GA 4DYKA 4FR6A 1FH5H 4W85A 3H2WA 3QK0A 1PDKA 1LEKA 3LKPB 4P61A 4X7EC 1OAUH 5ICXB 3UWZA 1S7SA 1WAAF 2NSMA 3TWCL 5GJSH 3FXIC 4PTVA 4FQJH 1U3NA 4ORGA 4A38A 5DRXA 3JT2A 4DJFA 4JYFA 3EGSA 3U2EA 4V1DB 4TXVB 5T1LB 1JCKA 3QFSA 5EU6A 2R1KA 1HAUA 1W8OA 1D9KC 4XZWA 3QLDA 3N1AA 1MRCL 4ZMGA 3CTAA 4LCWE 4Y2DB 4MTVA 5IGXL 2VERA 3FQ4A 3BRDA 3NOYA 3M17A 5CZVH 2NYYC 4PCNA 2Y23A 2VE6A 4OZFH 4UC5A 3WH5A 4JDTH 1CYXA 3CZJA 1JNYA 4XOBA 3DX6A 3PY9A 4WDXA 1X7SA 2V67A 1J86A 4YBLB 5DT5A 2ZKHH 3T0ED 2YSWA 3I3DA 1IM9A 4EIVA 4ZFOB 5IYWA 2CUAA 4DZ5A 1G1YA 3QFRA 1Q9LA 4UBDC 1KLZA 1VRDA 3NFSH 4RDJA 1DJXA 4OTXH 4MX7B 4HIIB 3CK0H 3X3FH 3VFSB 3MWAA 1YY8A 1XQLA 1JE6A 2C1OB 1SFJA 3ZQ9A 5IYPA 1MLCB 1TPXB 2MRYA 5JHAA 4MXVF 7CGTA 3WNBA 4K8GA 1T83A 2X6UA 3V1HA 1IKNC 1RJLA 5D71H 1CE6B 1H6FA 1DWIM 3ITYA 3LCIA 4BHUI 5FLUA 2AQRA 1TTUA 2P43B 2V6AA 2PNDA 2X12A 4GAFB 1NFPA 4YHPB 4UIKL 3NJMA 2I26N 4R4NC 3PXHA 4ASUA 2H2SC 2YXOA 3OP1A 1M5WA 3MNWB 1ZHKB 4L9LC 5GGVH 2X1TA 4X6CF 1IM9D 1PG7W 3ZZUA 1H8LA 1OGTB 1D7FA 4OZHA 3OGCB 4YR6A 3S37X 4X7SH 4UTWC 3L1OH 2X1OA 3S1WA 4Q89A 4F9LC 3O3BA 3K1GA 4RMRA 4C60A 1GQNA 4PV8A 3FYPA 3R13A 4QKXB 4ORZC 4JKMA 4X99B 5I19H 1M90D 1T1ZA 4HUUB 3B8UA 1T7XA 1YYML 4JQXC 2PYFA 2YL9A 4XC3H 1J05A 1INQA 2ZYRA 4OZ4A 4PGEB 2JXMA 4ZNCD 2WJEA 3CCSB 4BHUA 4XAKD 5F89B 4TRPH 7TAAA 1XGUA 1C08B 3DGCR 2DRUA 2NXYB 2IMMA 3VFUA 1AJZA 4XCCH 3BVNA 4YHNB 4YWSA 2VDLB 1XDLA 3RJXA 5EBLB 1W34A 3EWZA 4CQ8A 1KBIA 1KTLA 1RK1A 4CMMA 2QTVA 1ZLDA 1YC7A 1WFMA 5I3FA 2B7PA 4HKZA 1J96A 3U9WA 3EXSA 1TIMA 2OTUB 1MREH 4ZUVB 1S5IH 3R0KA 4MJ4A 1CBVL 4MAYD 3GQBA 2B4GA 3RU6A 1ODAA 4RR4A 1H3VA 2VO8A 1W5NA 3V0VB 5A2JH 3ZSTA 4PS4L 3HR6A 2XZCH 3FONA 4WFED 4KK5D 4B95C 4G3YL 5DJ2A 5KBKA 2P5WE 5CKAA 1XT5A 3GXIA 1QZ1A 4YNYB 2B0SL 1WWAX 4BH7B 7TIMA 1EGJA 4XOAA 4LEEA 3RU8X 2C3XA 2JLPA 4ADIA 4TYUA 1U8QA 4IMLA 4P2OB 4BUHA 1XBVA 1MWAB 1YNLL 4O4VA 5I8EA 1NOLA 5LSMA 2NUWA 3VC6A 3FNDA 4PCPA 1RUAH 4DBSA 1DQQB 4TSFA 3EYQC 3I6EA 4XKWA 3BW2A 4F4RA 5C3LD 1F41A 1WS8A 1HEHC 3MYPA 3ETBJ 1A4CA 2A7PA 3VXOB 4RZ5A 3LBMA 3F7VA 5A8MA 3GMRB 3VVWA 3GS6A 4EVNA 3TF7C 1JGUH 2AL1A 3MV9A 2FZBA 4HPXA 5JXEA 4EX4A 4JTKA 3CMOH 5BS0A 4H2CA 3QFCA 43C9A 1P0BA 3WKML 2V30A 4MJIB 1ZT1B 1GVHA 1SKYB 4HUVB 3FTWA 3K4ZA 1VDGA 1YEEL 5LWYH 4OFYD 4DKFL 2DDXA 3MGAA 1N68A 1QSZA 5AKTA 3FYYA 5H8UA 2ZRUA 4PJDB 3QN3A 3OWEA 2VEIA 2WZ6A 5IFHL 1QD0A 4LPYA 2BZ7A 3G5VA 4J3TA 3BESR 2YL6A 1GOXA 1U8JB 4FABL 3EFOB 4UFHA 3MV8E 3VUAA 5EUOF 5I71C 2AEQH 4Y5YC 5ABTA 3LH8A 1UKPA 5E08H 1KNWA 3LZRA 1X44A 5CLWA 3UNDA 1KJMA 4WI4A 4ZSOA 4NZRH 4CSTA 2FTYA 4GXMA 3FULA 5DRNA 3CDGB 3MV9D 3AI0A 5JXED 3SJZA 2I9TB 3GK8L 5BS0D 1FLTX 3X12B 1WX0A 4E2DA 3E12A 5D7JD 4KIEA 2R39A 3WBWA 1ET8A 2DIKA 3NESA 3ZRFC 1TJHL 4N42A 1MPAH 3PNWB 3B43A 3QSRA 4E4PA 5EF0A 5AD0B 1EGJH 4OGYL 2D23A 4N20A 3PFRA 1UZDA 4F8TA 4LWWA 4OQ1A 2H8XA 2F6AA 2V0AA 3OJDA 4RUBA 4D6JA 4JFUA 4IW3B 1C8PA 2IAAC 4RBPH 1ZVYA 2BCKA 4JN8A 1SXBA 3OKXA 3L2NA 4OLVH 5TGBA 4WJXA 4YGAB 2ZX9A 4YMZA 4X8GA 3HE7A 5F6HI 3KG5A 4MJIE 4CCEA 1CF8H 3NQMA 5L2KD 1HKVA 3FPYA 2DJLA 4FYQA 3U4KA 1K8DB 2R24A 3Q48A 2ORBL 1RY0A 1NWOA 1R3HB 5IREA 3I9IA 3I1FA 2CK0L 4GFSA 4K55A 5FSDC 3N44B 4GBXA 4KGLA 3M64A 1BZ9A 2Z31A 1E4HA 1H1ZA 5C2BH 2QIWA 1XZWA 4OLYH 3U2OA 1TTCA 2CO1A 5CC3A 3NEHA 4TMVA 3P02A 3L4CA 1QFWM 1CGWA 1YVLA 4YBQC 3D4CA 3VIHA 4PTDA 5FOJA 3ONUA 3EJSA 3TBWA 5HMFA 3S3BB 4ZAKD 3HE7D 1QSFD 1CB2A 1DQTA 4RISL 5DCBA 1NVMA 1IEAA 3Q2WA 2JLLA 3QV9A 3W1TA 4Z0BH 3W56A 3CH8A 4ZTXA 1ORSA 3BO9A 2DIEA 5J9PA 3V0SA 1LTXA 4M2LA 2HP4A 4GBXD 3H9SB 1UQSA 3BH4A 2Z31D 3VNUA 4L0PB 2XA8L 4JIPA 4C7DA 4AG0A 2JELL 3GSVB 4TNWK 5IMMB 1S9YB 2KUTA 5D2NA 1B90A 2FWUA 1W8SA 3GVQA 2DLGA 1OW0C 2UY3A 3AJXA 2AQNA 4IRJA 5CZXD 3MXWL 3M44A 1AIFB 2XDFA 5I6PA 3L5AA 2W6IA 4DNLA 1EVUA 3TH3T 5HNUA 2F7PA 2JIEA 4OPSA 1VQ5B 2X6AA 1S7WB 2Y2YA 5FO2A 1UT2A 1N6QH 1WXZA 3ZU8A 1PZBA 1NCOA 3NCJL 4IPIA 2ZAHA 1P4LB 2MCAA 4LAJH 3VKKA 5KYUA 2UZYB 5EA0H 1DEEB 4AOFA 1E27A 4IBSA 4N25A 5T5FA 1XQ4A 3ARZA 5BUGA 1XYLA 3H2AA 1A64A 1MCEA 3DJ9A 4FXJA 2HT2C 4IRSA 1AZNA 3F7PC 1PL3A 4XVSL 3AXKA 2UBPC 1ZK5A 2INFA 1MNUL 1CURA 5FM5M 3LY6A 1UHVA 4R7LA 3NEXA 3CCJB 5HDBB 1GVYA 2Z25A 1M6OB 4LUIA 2V7VA 3RKDC 4ELMF 4PJIF 3MZ2A 3MRIB 1SEBA 1KACB 5E5UB 3W1QA 3QZWA 3MI2A 2XG4A 3AROA 1HI6A 3H9SE 3QIUC 2XH7A 1U93B 1HGWA 1ZQ5A 2Q6ZA 1Q2RA 4I0KA 4YAQA 3FT1A 1PL9A 1JERA 5AYBA 4L8DB 3N2TA 4H19A 3GU2A 1JCVA 5DT1L 5BQ7A 2X2UA 4GS7C 5IVXB 2WOQA 3C61A 3SE8H 3VM5A 1CFTA 1SVCP 4RL3A 5IYNA 3MYOA 1OHLA 2CC2A 1ZE3H 2Y9RT 2VUNA 4JRFA 3U1PA 4AWSA 1RJPA 1GPOL 4M7KL 4ONHB 2XFWA 2BOCA 4R2GD 2BWDA 4ZS7L 1ZNNA 2VDOB 5IESL 3HUJE 2WGNB 4BXSV 3FOMA 1EJRC 1CB7B 5ACMA 4QTFA 2DIAA 4F8LA 4PWJA 2XXGA 3AG4B 3AAZB 2PGRA 3V7AG 4DQWA 1QWUA 1YEJL 4Y2WA 5LAXB 4Y4HC 5GRWA 3K2GA 2WC7A 3ZWTA 2WTRA 4TXEA 2BS9A 3ABSA 3IRCA 4YUEH 3W5MA 3G3DA 5EMYA 3EWUA 4L1SA 5CIPB 5HDBE 5SV3A 3HS0B 3AWEA 2Z1BA 2KDYA 3NSJA 2WXRA 3QV6A 3TWBA 4LVEA 5JQ6L 4YSPA 3B7TA 1XEDA 5TQ0L 3EWDA 4FG6C 3WLWC 5F3HB 2DSZA 4FTDA 2ADFL 4Z1PA 1QW8A 1R33A 3GTVA 1ITQA 3U2CA 2WJ7A 1PZSA 3N9GL 2B7DT 1W8NA 4FAAB 2NZIA 4MJZA 1HZEA 3BKYH 1POKA 1SSGA 3C5JB 5HY9A 5HDOA 4P5SA 5EKYA 2HFGL 4LLMA 2EIJB 4K2UL 5GS1C 3FFCA 5E6YA 3N2BA 4XPGH 3OJMB 4QOKB 3HAEG 3VDBA 5BXFB 2O7QA 5LIUX 1J5DA 3QUXC 4I9AA 3BQJA 4I18B 3CZFA 4J3OD 2Y1HA 3DX3A 4XN2A 4PMDA 3IEBA 4IU3A 1GTHA 1W9DM 4A39A 4LT7A 3O06A 2GIMA 1XIDA 4ZUUB 1R5YA 5JDSA 3SCPA 1ILUA 3CV1A 4PVLA 1VQ6B 4LV9A 2K8MA 4PJXA 2P5EA 1KIPB 2Y7QA 5LGYA 3F7YB 4I0PB 4BZ2H 3M5YA 3IS0X 4CD7A 3ABQA 3L4YA 3O9WB 4NQTA 1QLRA 3GLDA 4M5TA 2MANA 4RDQG 4AEFA 1VLXA 1H8OA 1QEWA 3FFCD 1NC4A 3HCVB 4XCNA 3CPWB 3L5XH 2YJLA 3OKLA 3CDCA 2YCIX 4QHNA 2V3FA 1WBZA 1PKMA 1PKOA 4Q4IA 3WE1A 2HBVA 2VFFA 1AIPA 1L5GB 4LP5A 1SUJA 2OELA 3CB3A 1KIRB 1VBGA 4F7PB 2GJKA 2WCPA 3G9VA 4H9MA 1N7KA 4XN1A 4QDWA 3H85A 1R8LA 4NAFA 1HOCA 2VT0A 5IMLA 3IVSA 3G4SB 4HJTA 6PAZA 1DJGA 1NFIB 4QOKE 2YAFA 1FNSL 4JM2C 3SBFA 2ZT9C 4X4XA 5IT2L 4QIRA 4IP7A 2Y06H 5D2LA 4MB5A 2MNRA 3BJFA 2D2JA 4PQXA 4ZMAT 1DBMH 4HX1B 8A3HA 3AXLA 1HNFA 1VFBA 2VKWA 1RFDH 5I76B 3MKVA 3KAAA 2A83A 3FHQA 4M81A 3IMRA 3SSZA 2JE8A 4RGMC 1IAOA 3FF7A 1MRFH 1WZAA 5GQBA 2EDKA 2OSWA 3QZMA 4OECA 4Z7NB 2R56H 5ENWB 4S1DD 3GIYA 1HJBC 2IH3A 2Z91B 1GIGH 1BOGB 4O19A 1H7RA 1PNDA 3CCEB 2APSA 2H47C 5MEQB 4LIQL 3S37H 5KN5B 3FJLA 4Y9AA 5HULA 4C7GA 4JTIA 2DWDB 1C5DA 3KZPA 5CSYA 3MJ7A 4GAYB 2FWLB 2QPXA 5EDXA 2GQ9A 1Q7YD 2EG7A 2X2HA 1EFZA 3IJEB 1P1XA 4L9LB 4PJCE 2NQJA 3GI8L 2DWEA 2RJGA 3LDVA 2QZQA 2DEXX 5KETA 1QBLL 3ID7A 3QJQB 3VUSA 2QPDB 3BRFA 3W11C 5I1IL 1UOZA 4DJDA 2EFGA 2LLNA 4H25B 2V5JA 3MNVA 5I1DB 5ABGA 4ZXLA 4I9WD 2ICCA 2GUOA 5KVFE 2WSKA 2PUZA 3AACA 4DN3L 3VYPA 3SPJA 3SQMA 1SJHB 1ZHNB 3N25A 1EERB 1USQA 4LF3A 3FJ4A 2RFGA 3QDGE 3DRTA 1L2UA 4K1WA 4RNRB 4Q6KA 3ULVD 3NURA 2GHWB 3TC9A 3AIRA 3QZAA 3HC3L 2I27N 4PC6A 3UTSE 1TVBA 2Z27A 3ERPA 4K6AA 3BGMB 4FNRA 4Z7NE 4JDEB 4NVTA 2KLRA 4ODXA 5FUZL 4Z77B 1GYUA 3WD4A 3CZKA 2ZQKA 1GGCH 5EZJB 4MD5B 2ACRA 4NBYB 2NY2D 3ZDXB 1XIEA 3RU8H 4UOJA 4G1EA 4M3JA 1AGDA 5CQ1A 4XNBA 3ABRA 1U8OB 4OZIE 1BF6A 1AI1H 1KIUB 3RY5A 4NNYB 5AVZB 3IWVA 3UYCA 4HKBB 3QEUA 1CTOA 3GYRA 3CVBA 1FOBA 1EV2E 1FG2A 1J9QA 5HI4D 2VW4A 2DYIA 3TLQA 2I07B 3EEZA 3ZKXC 3UOAB 4O58L 4R0LC 3LNIA 3T40A 1SFSA 5MENB 3S4SB 1NCJA 1XRTA 3FRPA 3WNLA 4NP4H 5EOCJ 1KBGH 3PNRB 4Q97A 1JFHA 3KLAA 5G4OA 3QPYA 3S48A 1R3JB 1UXSB 3DFPA 2Y7SA 1HEZB 3W1MA 3C4UA 2QEZA 3TNMB 3MGTA 4DUOA 1R46A 1BYAA 3M8OH 2HVNA 2B81A 4Y4KC 2HLAA 1ADDA 1DFBL 4KXDA 2NY5H 1P4BH 2YQGA 2D22A 2BSTB 5CHNB 2BWIA 3MR9A 1ZALA 2GSHA 4RMSA 5DD5L 1WAEA 2UY4A 5DMJB 5FYKH 3KBSA 2J4GA 5C70A 1HZHL 4XCFH 2DT1A 4XP5H 3I75B 3ZTEA 2C0HA 1OCJA 2Y2TA 3V6OA 1K8AD 1PLCA 1PJ6A 1DBBL 5IJKA 3D8MA 4MYUA 1JRHH 2BG5A 4Z7WA 2R51A 4XZ9A 3DO7B 3S2CA 1EBHA 1UW9A 2OJPA 1X9RA 4XNMB 2CRIA 4B5XA 3A35A 2XQBH 1KK1A 3PDOA 5D4JA 4MSWB 4MA7L 5FECA 1CF1A 3FU7B 3DX5A 4BF7A 3OJVC 5EFIA 3CIQA 4AVOA 2LAAA 2HVKA 3EO9H 4G5AA 3QW3A 1GAFH 3RG6A 3PWUB 3QUMB 2HN7B 5I71B 5G2IA 2DT2A 3UJJL 4UQEA 1JUFB 5A2KH 3RVUD 5C0FB 4LSUH 3V0WL 3MLWH 2ZOKB 2QHLA 2CR0A 5K39B 2FVMA 5D7SH 3NJFA 4PUMA 1UQYA 2FAUA 2ZOUA 2O4EA 1A5FH 3V8CA 4D2NA 3UYRL 5CD3B 3LU2A 4OBSA 3L7FA 2GSEA 3VO0A 3ZT7A 4WU5B 5ERWB 3SQLA 5KUKA 4QFUA 4I3RH 1XVSA 4GNKB 2DYSB 3FQRA 4I0CC 3FPPA 1AOHA 1X5KA 5C0GA 5C0EB 3LN3A 3AG2B 4U7MA 2ADIB 2CZFA 1WBYA 1S1RA 1N59B 1OSPH 2ZUMA 1V03A 4ONOA 4RE4A 2HEJA 1S0UA 5F71A 1YG9A 3GTNA 4GZ7A 4P5TA 1I8IA 3WEMA 4HW6A 1N2RB 5JPMC 1OK0A 5C97A 5H6HA 3O2DL 3CHCA 1JHTB 3MREB 1HH6B 2Y1AA 3U0WL 4LPCA 4NUGL 4OFKA 1JCMP 2OR9L 4B9FA 3LKRB 4ZMNA 3ZHDA 3RAOA 1BJ1J 4Y5VA 4E9LA 2VLJA 2Q8BL 4C6JA 5D8JH 4H5SA 4YLWA 1RLBA 1KB5B 2V5BA 4OBTA 4PB5A 2W6JA 1GYVA 1MQQA 1P0DA 1E9ZB 5BV7H 2Z2AA 4I6VA 4PRDB 5J6HA 1EXHA 3MMWA 4RQQB 4MMWA 3R7MA 3QZEA 3U9IA 2CPUA 4EE2A 1EJUC 1EHLL 3O3DB 4I9MA 1NMCC 4C43A 4DVRH 4Z0JA 3TH6A 2DUXA 2E6QA 1KC5H 1O75A 2CK3A 4PH8A 2E9IA 3MRMB 2D0HA 5ALBH 4LPUA 4KQ3H 4MNGE 4C7FA 5TH2B 4ZQMA 5EZIH 3AIVA 3BUVA 1RZQA 4DO5A 1S2VA 4HNCA 3TPUA 2VLJD 2DSKA 1JJKA 4DPQA 4XBGA 4W9CC 3QNZB 5D2VA 1CD0A 1MVFA 4NPYA 4DTGL 2EDFA 4LB8A 3SKNB 4JFPA 1EEYB 3RVWD 5LUMA 4IGBC 4AHPA 4BHYA 3EAUA 4DQAA 1RK0A 3QAQA 4KZCA 1IGML 1J8HD 2DLFL 1XGQA 4LVHC 3PQYD 2P7TA 3RL1A 5ICZB 1FWIC 1YI2B 4Q4QA 4BZ1A 4DZIA 5C08E 3PHQA 1XJBA 3NDYE 5I6NA 4XAGA 3FKRA 4P9MH 4HMNA 1PZUB 3L1FA 3EXTA 1QR4A 5HR6A 4JOMA 1ZAJA 3WD5L 5HVFB 5J6GA 3P4LA 1JZIA 2J5WA 4B44A 1H19A 1FUNA 4Q6IA 3MBWB 1I7UA 3VO1A 4ODVL 4A8IA 1EP2B 1V7MH 3H21A 2VDIA 5FA3A 1FWRA 5CEZD 3HPLA 2BMKA 3FFDA 1CD1B 1T22B 5IK2A 3VMOA 3WH7A 3C6LC 4P7NA 5KZCD 5DHVB 3JTBA 5IQ7H 4IQEA 3RY6C 4HCRA 1QSED 1BX1A 3T53B 4FQIH 3TU6A 3K5RA 3FQWB 5I8KL 4LAUA 1VGEL 1GC1H 2PGWA 2QF7A 2IPTL 3STCA 1T8QA 3W2NA 1AH4A 2OMNA 1Z9AA 3NAAL 4U28A 3PTKA 5JIDA 2DL2A 1CFSB 3KYMB 5EMJA 5FD0A 1H49A 4YHOH 3QIUB 2J7BA 1PF3A 1US3A 1TTJA 3WFCL 3CWNA 4HTYA 1HHGA 5AN9A 4PUEA 1JZ5A 4OLXL 1S7VA 4HIXH 4LLAA 1CU4L 4YFLI 3UY7A 3CQFA 1T40A 1I8MA 4GS7B 4G1NA 1A3RH 1ERNA 2CALA 3DX7A 1NM4A 3NJHA 5KSUA 4J40A 3REVB 2EPNA 1ZUAX 1OPOA 3G5XA 5T33H 4PG9B 1E3ZA 2P24A 3IDJB 1NGYA 3N15A 3L1EA 3C2AH 3K6IA 5EPDA 4AM0A 1RVGA 2VWTA 4JY9A 2V7HA 1KLYA 3PBWA 1U3HA 3VD3A 1A1MA 1VQKB 2BSAA 2XYBA 2Z93B 4GQPH 1KYDA 1B0GB 4U6XB 5KYWA 4UUJA 4EI5A 1N0UA 1D5ZB 2BO0A 1EO7A 3L6FB 4I2XA 4Y4HB 4WCJA 1E6QM 3GVWA 5ID1A 3DENA 1J79A 2O5ZH 4BZ1H 3VVGA 1LXMA 4YSEA 3TF4A 1ZLUK 1ZGLM 1LO3H 4WTXA 3KJ4B 5GHWH 1XRSA 4ATWA 2X9ZA 3HGRA 4MVBD 3BXNB 1MHPL 2EYTB 3WTXA 2C15A 3OO2A 2NNRA 4QXTB 1NEZB 3I6KB 2V2WB 2EE2A 4Z7OB 3F03K 4ZMLA 1BPLB 2C9RA 5F8RC 3B6SA 3ARFA 1WUFA 1TELA 3BFWA 1FVPA 2N0KA 3MA7A 4BDVA 1KPUA 4FXGC 4LBYA 1PCWA 1T89A 5JIQA 4CCDA 3O2VL 2GK7A 3LKNA 4G2DA 1FFNA 2XIJA 1A6PA 2E74C 1U3HD 3FO9B 3H9HB 1ZM9A 4JQIL 4O4WA 3LIZA 4HCRH 2R2BA 3KPLB 3BEVA 4QRQB 3F58L 4EI5D 1HKJA 3MUJA 1A49A 3IFLH 4D0BB 1PZ2A 3D08A 1Q5MA 2XWDA 5FYKU 1UOWA 2LU4A 2O6EA 5ISZB 1Z48A 1RUKH 2AMUA 3CPUA 4FP8L 4LRIC 2DW6A 4NPJA 1XYBA 3HC0A 4W5UA 3CM4A 4QTIL 3THQA 1J0HA 3SB3A 2UZXA 4XWGH 3V79C 3QUXB 1KR0A 1UUMA 1FRGL 2OFJA 4FADA 4HD5A 1UZ6F 2ISWA 3LPGA 1N9PA 3ZKMC 4FQXC 2VFDA 1YBQA 2IJ0C 3LDBB 3ARFD 5C0QA 4J5VA 4RIRA 3BH9A 3UC0L 3EPMA 3UADA 1HINH 4PGDA 1M7IB 3FQYA 3I9GH 1U8HA 3OAUL 2XI9A 3ZE1F 1KTNA 1F2JA 4YXGA 4PJFF 3D39A 1K85A 4JPKH 5C09A 4GMEA 4HNUA 3M5ZA 4QAIA 4FQ2H 1ZIAA 4P9HC 4AMXA 5I3HA 3O1NA 4N5ED 1HP5A 2XICA 4IL2A 3TQVA 4AY1A 3MJ9H 1VAHA 4Z7OE 2GLKA 5KYXB 5JQHC 1QUFA 3EO0B 3OXSA 4HWBL 2BTMA 3UBGA 2YUXA 1MCQA 2NYZA 3AVYA 3AMLA 4L8SB 4JG5A 3GE7A 1ZA6B 3KPSB 1CZ8H 3ULUH 1E2WA 1PW3A 2FVKA 1R5IA 2Y36H 1GJWA 1XR9A 3MKGA 4PJ8D 1AH3A 5CKSA 2F7OA 2QQNL 1UXWA 4CUCA 4MDJB 1XCQA 4KUCF 4PJGB 1BQGA 2VC9A 3VW3L 3KR3H 5DHYB 4JXCA 2ZXQA 5MHSE 3H9ZA 1S39A 4UM9A 2R2CA 3IFNH 4OVVA 1O5KA 2ITDA 3ULVL 4IG2B 2K7PA 4JM2B 3QEHA 5DJYA 4HKJB 1OARH 1KGCD 4A63A 4K5PA 3MV7A 1LJYA 1RQRA 2CA4A 4LU5L 3DPBB 1RU9L 2V4DA 2WJFA 3Q44A 4WJG3 3C0JA 3HMCA 5D96C 2ISSA 2BM1A 4JM4L 2Z34A 4XVJL 2PCEA 3C60C 4RGMB 1URZA 2JB6B 2YBRB 4NI3A 3NCBB 4H8QA 1N0LA 1SDDB 3VXSB 4U3HA 1BVLB 4B4FA 4Q6YA 4ZUSB 4UM9D 4GAGL 2VURA 1KTRL 4MCNA 1SF3A 5F8QC 2WMGA 1B0WA 4MWFB 4X63A 2GFBB 1R3LA 3MV7D 4JW3A 1X5HA 2GGGA 4P4KB 5C3IA 3BOVA 4A8RA 3QY7A 2J6WA 5DMLA 4FHBD 1KXVA 4GG8A 4PJGE 3QMRA 4MD4B 1RJQA 3DN5A 3KPMB 1LBFA 4JFOB 3H7VA 2R59A 2A6JA 1XZ0B 2ICEA 1NDMA 3BQ5A 1XF1A 3Q5TA 3ANYA 3F5JA 2CLEA 1HJXA 4RA3A 3X2QB 3AVVA 3C6SB 2DJXA 2BF4A 5H8DA 4XD4A 5FFLA 4P48A 2CDFA 1ZKAA 2WXPA 4I7ZC 4XAYA 3HZYA 1QLEB 1TTPA 1U95A 2PMZA 5K9JL 4UQ2A 1EEZA 4LNYA 1R38A 3AABA 2H0FA 2ZXCA 2V7XA 1BAFH 2AXWA 2AJYH 2YDQA 1GKQA 2B16A 3BE1H 3I6LD 3NO1A 3DRQA 4UQ3A 1YMHB 1K9DA 5IW6A 3AQYA 3L9YA 5AVWB 4WUUD 5CGTA 4A04A 5E8DH 1LWJA 4KEMA 3ARYA 3QBUA 2Y3AA 4PJ5E 4P8XA 3QQNA 4JEJA 3VXSE 1ASQA 2VL4A 1UWGL 1Z9OA 4HOWA 3RR1A 3WBAA 1CFQB 4XIMA 2BHYA 4TNWF 4OPOA 2FSEA 3RZCA 1K02A 1A5MC 1T5AA 5HI3C 3BPLB 2VXTH 1L0PA 3B2DC 4YSCA 2DQIL 1B23P 3B56A 3H55A 4ODWB 1WC7A 1KMHA 2CHRA 3D4YA 2W60A 4R0LB 1N5AA 1UKQA 2E5CA 2GJRA 4LMQI 1R3IH 4NC1C 5DDHA 1G4EA 4WO4A 2Z24A 4GKNA 4XMKL 1R19A 2Y89A 1FC2D 2J43A 3ZKSD 4G9DB 2DJUA 2N0MA 2HV5A 3GKWH 1DPMA 1X39A 3E8UH 3LERA 1H60A 4Y4KB 2KHAA 1XR2A 1SGJA 3GXMA 3OGVA 4ESKA 5FO9B 2UXFA 5HNTA 1EFQA 3UJRA 3QEGL 2ZWLT 2JB5L 4LSBA 5EB8A 4NKIL 4YHYC 2V7TA 3IDGA 5GGTA 1M1KD 2CA3A 4WY7L 1P6WA 3U83A 4LCWB 1BWWA 3EYOB 1JG9A 1PX3A 3VCLB 3KM2A 3MRPA 1QPKA 4Y8FA 5D2WA 3QR3A 1N0XL 3TR9A 3K91A 1LNUA 4IEFA 3SY0B 2FGZA 4R88A 4WO4D 1A8PA 3WS6A 3UZQA 4WFGD 4BK5C 5B1CA 4MDPA 3D87B 3T0TA 1LDPL 1ZV5A 3N43F 5G5DA 3QDJE 4PMUA 2QCCA 4IUGA 3SKOA 4B16A 2QJMA 3PV7A 2ZZ3A 2WGXA 5JUEL 2LOEA 4ILSA 3NACL 1YJWB 1X5YA 4U10A 4HE5A 4N2DA 1I3RA 4LOFA 4F79A 1MO0A 1Q3NA 1R9YA 4HK3N 2RMNA 4EPKA 1U8IB 4JQVC 4DB7A 2RKXA 3KVLA 1KFKA 2WLNA 3QQ4B 4PGZA 3TA3B 2ISFA 1TEYA 3ILEA 1EPXA 3WEZA 1NMBH 1R3QA 2CIKA 2Y5QA 5CR1A 5K7JA 3U30C 3KDMA 3VXME 1J18A 4K7VA 3T8QA 2ADAA 5ITBL 5D70H 2A4CA 3VOGA 1UCWA 5DTFA 2XPZA 2WZ0A 4YXLH 3GBNL 1Y18A 2YC1B 4PWIA 2A6NA 2H26A 5EZOH 1WORA 1XF3A 1ZEAH 3HTLX 1IB0A 3QWQB 4ALAC 1L9MA 4J8RB 4NRYB 5MKGB 2XWXA 4AD1A 3TNOA 1DDGA 4AG4H 1CWYA 4RPQA 4YE4L 2Z4QA 4OZHF 5FYLH 2W79A 3G6MA 2YUWA 4XOEA 2HK1A 4ZB0A 3QW9A 4OB5L 4WK4B 4L9YA 2WQUA 2GJXB 1QG3A 4HNNA 3GSRB 2SEBB 4HEPA 4I89A 4MDOA 2GBTA 4N2OA 2NY6D 4ROXA 1BM7A 4M0LA 3OR7B 1FHNA 2X6XA 5CD5C 1Q9KB 4H83A 5GGTH 5HNRA 3QJXA 3ZE0B 4DFHA 4KC3B 5IHRA 2Z0IA 3FRUA 4Q4SA 3VFPA 3V6FB 3UAJA 3R58A 4DJFD 3OKOA 1PIIA 5F72S 3A4AA 5E7FA 2WWKT 2H1XA 3I02A 1RSCA 5EU6D 2MPAH 2P8BA 3CAFA 2HX9A 43CAA 2H3KA 4H1LB 5T9CE 1RZJC 5LGHL 3W88A 3MMUA 3Q01A 4NZTH 3B2PA 1NP2A 3E0GA 1TT6A 2YKLL 3AUOA 5IFPA 4PB3A 2J1WA 2YRBA 1NMCB 4FQHA 3S5OA 1NQBA 3W9DB 2P5WB 2HQAA 2A9ML 3EX1A 5JUVA 4LRNH 4UV4H 5DA4A 1OY3B 2YA1A 4G6AC 4LSVH 1NSNL 3SI9A 2VM8A 2VJ0A 1IBGH 2FTWA 3EJYC 3BV4A 1MW1A 3OXRB 3CXHK 4M5ZL 3CCUB 2BSRB 3MUZ1 1I1RA 4BQ3A 2A7NA 4YL9A 3TJXA 4JY4A 5I82A 4GO8A 4G6IA 1FZOA 4P5MB 3UAJD 1RIUH 1M71A 5AYIA 4ES8A 4IGBB 3VWKC 3USBA 1IGYB 4QRTB 5BYWA 3GYCA 2VAAA 4JANB 4UNLA 5I2UA 3L7EB 4LVHB 3E74A 1BRLA 1DVUA 4M6PA 1X7TA 1NFDA 4HJGB 3ZE0E 3PPFA 3TR2A 1NBVL 3D18A 1UC5A 2WZPP 3WDRA 1PCSA 3N40F 3BVDB 3PPSA 1TZGL 3MROB 4UB0L 1CFVH 1TPUA 2I9UA 4QGTA 5KBMA 5IOKA 4FQCL 2N1KA 1V0LA 2ZUXA 1GRWA 4WHYG 1P7BA 4J3UA 1L7TL 2VMEA 3B9DA 3CXDL 1VACA 5TK2A 1KEMH 1BX2A 1M2VB 4QHLB 3JWNH 3GLEA 5SWSB 3C6LB 5JOPE 4B9IA 4WGXA 4LUSA 2V9UA 2WQAA 3IJ9A 1F4HA 3WQCA 1D7DA 4XLHA 3O7UA 4F33B 1OGBA 4LF1A 3MV8B 1K3IA 1RZGB 1S46A 1IEWA 2OMZB 4UOQA 5GGRA 3S88H 4XVOA 1Z6JT 2WWCA 1R6WA 3RVXC 3V0IA 4MMZC 1CL7H 1FN4B 1T2JA 2DQEL 3TC3A 4J4PC 4C6IA 1AANA 4PW4A 3L4UA 1L9QA 4CEUC 5DUJA 1F07A 1I45A 5TPWL 3NMEA 4YSDA 5IB4A 2IKHA 4ZT1A 5DZOA 3Q67A 3PDDA 2NUTB 1NCGA 3FPXA 5ETUA 1MFEH 1UXMA 3P30H 4GB9A 3VIMA 3VFTA 1W2VA 4X6FB 1FZMB 3W9ZA 1CDJA 1J8RA 3U1SL 4M7ZC 3DETC 1NWUA 3OHXC 4HT3A 3NM1A 1H41A 2OULB 3AIUA 1FHVA 4JPWL 2AZUA 1FHLA 4HG4K 2OBGA 1TYJA 3MRLA 4RPBA 4MHBA 1AG1O 3SN1A 3RF9A 4XTRC 1XSIA 4ONFH 3O05A 1EP1A 4LOVA 3GD1C 5CUSL 4JDZB 2QW5A 1LP9F 4O1AA 1TJGL 2I5YL 2B4CL 3QFEA 4KJQC 2V5MA 3PUCA 4NO2A 5EC1A 5SWSE 1XBZA 1KN2L 5DMIL 2BGQA 4ZFMA 4IKLA 4WY0A 4OM0H 2BK8A 1XIHA 1AD9B 3MGOB 4HYTB 3MSYA 4UTJA 1EXUB 5EDSA 4QX4A 3MBXL 5JW4Q 3UCQA 2Z0BA 5FIEA 4R97C 3AGWA 5IROC 3B2UC 1T20A 4KRLB 4HE6A 5CJBA 4LHUB 2HJKA 5IBLD 5BRPA 4K8RL 1WCBB 3FU5A 5GS2H 4X7FA 4LX4A 5K9QG 4M6QA 1XFOA 4FXGB 5KMYA 1PHWA 1REQB 3HIJA 3T77A 4Z3FA 5LA1A 3S98A 1ZSDB 1OSZA 1K1DA 1K8IA 3SKJH 1BD2B 1WRFA 2BODX 2N01B 3E3HA 4HHWA 3DSFL 2VLRA 4KH2A 1H9DA 3S0PA 3QUMH 5JHLL 4P5UA 1UZ8B 1OTSC 4ES9A 1BHGA 3IAGC 1JZHA 2KX9A 8PAZA 1H8NA 1E6ZA 2VITB 2KQNA 4DWSA 5TQ2L 2XXCB 1XMEB 5D2TA 4AVKA 3LG3A 3ZHFA 1JNHB 1WCGA 1AVAA 1PYMA 3FB6B 2GAZB 5I15H 1CBGA 2FO4B 4KGJA 3WLIA 3V52H 5CBEB 1T66D 5IUSA 2CLHA 5EBMA 4TV6A 4FQXB 5IJDC 4G7SB 5D1ZB 4UYQA 2R0KL 2QVMA 3P77B 1Q45A 1EO5A 3K46A 1NAMH 3S3GA 2FYVA 1F4WH 3CV7A 5CEXA 4AL8H 1HU8A 4JLRB 1EWDA 4XP9L 5J7CC 5KSWA 2XGBA 1D5MA 3GM8A 4X5XA 4PEKA 1PYWB 1LE9A 1I9JH 3WSQH 1MCPL 3SY1A 4AC4A 4H01A 4JG1L 3GMLA 2OMXA 5L8KB 4RAUB 3QDME 4AH7A 3HZMB 1HZYA 4DWSD 1P6AB 5CPOA 2Y61A 2APBA 1ZJHA 5IFAH 2GK1B 3IIOA 3PJSA 2QKIC 2W5PA 4M43L 3BZFA 4D6EA 3EHBD 5CP3H 4YXHH 2WK2A 2ZXIA 1IGWA 2FVNA 1D1NA 5B8CB 3V5OA 1BD2E 3PL6A 1IVLA 5DZLA 4XPFH 2WINB 1OGJA 4RAVB 1J6OA 1R0MA 5HANA 3WFZA 4C65A 2VDPB 2EO1A 4Q8UA 2WSRA 4LVGA 1QVOA 1J0YA 4BI5A 4WFHE 3RNQB 1KB5H 1TZAA 1L6PA 4FYRA 1TJ0A 3UZEA 2PP7A 5JBEA 3LXBA 4HHAA 2DBLL 4MMYA 4GW5B 4C6EA 2PCPA 4ZSTA 1BVOA 2PDGA 5D4IA 3NA9H 4LY4A 4JHUA 1OIMA 2NQDA 1R5WA 5D96B 4ENEC 3FAXA 3C60B 1KT2A 1A3XA 1AQDB 1G9NH 5BPPA 1X5MA 1S6NA 4HV8B 3U2IA 3HUJB 4JFWA 1EWHA 2V2TA 4M8UA 2EEDA 1HCFX 2EDHA 1SYTA 4XHJD 1BAWA 4Y4FC 1XGYL 4XWOC 5KVDE 2KH2B 1BEUA 5IHWA 1H2JA 3EH2A 3S3SA