1HVXA

Bacillus stearothermophilus alpha-amylase
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
483
structure length
483
Chain Sequence
AAPFNGTMMQYFEWYLPDDGTLWTKVANEANNLSSLGITALWLPPAYKGTSRSDVGYGVYDLYDLGEFNQKGAVRTKYGTKAQYLQAIQAAHAAGMQVYADVVFDHKGGADGTEWVDAVEVNPSDRNQEISGTYQIQAWTKFDFPGRGNTYSSFKWRWYHFDGVDWDESRKLSRIYKFRGIGKAWDWEVDTENGNYDYLMYADLDMDHPEVVTELKSWGKWYVNTTNIDGFRLDAVKHIKFSFFPDWLSYVRSQTGKPLFTVGEYWSYDINKLHNYIMKTNGTMSLFDAPLHNKFYTASKSGGTFDMRTLMTNTLMKDQPTLAVTFVDNHDTEPGQALQSWVDPWFKPLAYAFILTRQEGYPCVFYGDYYGIPQYNIPSLKSKIDPLLIARRDYAYGTQHDYLDHSDIIGWTREGVTEKPGSGLAALITDGPGGSKWMYVGKQHAGKVFYDLTGNRSDTVTINSDGWGEFKVNGGSVSVWVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Bacillus stearothermophilus alpha-amylase: possible factors determining the thermostability
pubmed rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 181
structure length 483
sequence length 483
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1hvxA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hvxA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hvxA01
1VENA 1DWHM 2BY2A 3S5YA 5M3WA 3AHVA 2XM1A 5A8MA 1RD6A 4CU8A 4UR9A 1UKQA 1Q6EA 2W91A 5LYRA 3W0KA 5KZ6A 3WL1A 2DSUA 3D52A 1NQ6A 3SUTA 2E9MA 3VIJA 4D6JA 3QHNA 1MQQA 1QNPA 1V6XA 1KR1A 4PMVA 4U31A 1KWKA 4D6CA 2CNCA 4WKHA 3VDAA 4X9YA 1V08A 3QHOA 4JCLA 4PUDA 1R7OA 3D3AA 1WP6A 4TOQA 4CU7A 2OYKA 3KE0A 3VGFA 3ZJ7A 1GCYA 1WCGA 3L4UA 2VURA 2BS9A 4KRTA 1XGZA 1EH9A 2J78A 1QWNA 1PBGA 1UWQA 9CGTA 2EJ1A 2E3ZA 3PZGA 3SCRA 2PWFA 2XGIA 1VFUA 4NX0A 3VM5A 5C70A 1DHKA 1HJQA 5A1AA 2F8QA 1GQKA 1J10A 1R34A 2VR5A 3LRMA 1V3KA 4OKDA 2PB1A 4F9JA 1KXTA 2OYLA 3CUIA 2ZUMA 1OGSA 1FH9A 4M82A 2Z1KA 2G4FA 2F7PA 2XGBA 1H11A 4PMRA 1KBKA 4JFVA 3BGAA 1CXEA 1EXPA 3AICA 3MANA 1ITXA 2W92A 4AZCA 3OGSA 1JNEA 2W67A 1CBGA 1HL9A 1OIFA 2X0HA 3A4XA 3AZTA 3L4VA 2IXVA 5HPOA 2WXDM 3VILA 4MNJA 3SCQA 5ABFA 1BYBA 2CHNA 1B3ZA 1E4IA 2YL9A 4J3UA 1C93A 3ARTA 1B31A 1LLOA 1MW0A 3NYDA 4OZOA 1V6VA 2XIBA 4CU6A 2ZX5A 4D6GA 1E9LA 1QNRA 4NF7A 4AZ5A 5AYBA 1K9EA 3AHYA 3AXXA 1Q4NX 2YFNA 2J7GA 3CLWA 1V3JA 4HZ6A 1V0KA 3NSMA 4PSRA 2X05A 3AZRA 3SUSA 1QBAA 3HZ3A 1GOOA 1J12A 5A6JA 2PC8A 5AC5A 3G6LA 5A6BA 3VIOA 1VJSA 3VVGA 1ZS2A 4MB3A 3CPUA 2XIIA 5I2UA 4JFSA 4BCEA 4P8VA 4D6FA 4QAWA 3NDZA 1L8NA 5GNZA 3VDBA 2Y5EA 3CIVA 2WHKA 2NW0A 1ECEA 4UFJA 3FHAA 3EJPA 3BAJA 3I3BA 4GI9A 1E6SM 3SCSA 3RM4A 1UWUA 3A24A 1PZ3A 1QNSA 3WF1A 3GZAA 4TVDA 5F7UA 2YL6A 1XYFA 4UOJA 3CBWA 4P7OA 3U5YA 1LL4A 3EDEA 2VTFA 4D71A 1A3HA 3FHQA 2WM0A 4UFHA 3OB8A 3VD9A 1E6PA 3BLBA 3HG4A 3IK2A 1GVYA 4DWSC 5M5DA 1LWJA 2XJ7A 2VR4A 5ABEA 1OM0A 2DT0A 3N15A 1KTCA 4IUGA 1UD8A 3SURA 1TR1A 1H4PA 1JGIA 4B3LA 1TCMA 3W28A 3EJRA 2CBIA 1CGVA 2ZUVA 1M03A 4ZXLA 2YA0A 2E8ZA 4EAMA 3VD4A 4P8UA 3F4VA 3BAIA 1FOBA 4HA4A 4LYPA 3MUZ1 1A47A 3EDKA 5JIPA 4U2ZA 2ZWZA 4JKMA 1P6WA 1NWSA 4JHOA 3PZUA 2BY0A 4FLQA 1E5JA 5A95A 4W88A 2J47A 1I1WA 1TZ7A 2VZVA 4LYRA 3WBAA 1AQ0A 5JBEA 4ZENA 2J62A 2GDVA 3EMZA 5GQBA 3ARRA 1ZBKA 2WMIA 3BAWA 5EFDA 1C92A 1U30A 1PX8A 3FW6A 4HP5A 2VRQA 2G3MA 3WD4A 7TAAA 1R85A 1NWTA 2CYGA 5BCAA 4BQ3A 4GINA 1H5VA 3VKKA 3WH9A 2RGMA 1XV8A 5HOSA 4D1JA 5BRPA 5I77A 3TTQA 3MI6A 1JIBA 4TTGA 1CEOA 3LRLA 3WD1A 3GNPA 2E4TA 1DWGM 3D51A 1ITCA 2Y8VA 1OWQA 1V6UA 5I23A 4JFWA 3ARPA 2X8RA 3LMYA 1GUVA 3CZSA 1CXIA 1G94A 3GBDA 4GO9A 3N13A 1QVBA 2BNJA 3DX2A 2V38A 4CN4A 2WMJA 3S6TA 3AIQA 2ZXBA 4LQ1A 3TP4A 3B9AA 3AIBA 1HWWA 3RJXA 1E4LA 2X2IA 1J01A 3AROA 3N04A 2D73A 1ZBWA 1WPCA 4QLLA 2DPEA 1WDSA 1KXVA 1FFQA 3S2CA 3W6LA 1UYQA 3BC9A 2XFRA 1XD1A 2B31A 4GKLA 1JYWA 2YBTA 1TFVA 4UTFA 3RPMA 2VX6A 1FA2A 2E40A 3AMGA 4A3HA 4FNRA 3K8LA 4LGXA 3BUPA 1J0YA 1J9YA 4GZEA 2F7OA 3U5UA 3W6MA 2QLYA 3WY4A 4J3SA 1XCWA 3WY3A 3VSVA 4YPJA 2BHYA 2Z1SA 4MNKA 3L2MA 4M24A 3ARYA 1E40A 4OGZA 2XVGA 1ZBCA 3UCQA 1TQWA 3KL3A 2FE0A 2XVKA 1BGAA 1TVPA 2TAAA 4CN1A 2A3BA 1WKYA 1JFHA 3BSGA 3VIFA 4OBRA 2J74A 3BMVA 3T2QA 3AMLA 1W1PA 4AD2A 4AY1A 1IZJA 3EDJA 1JZ3A 1J0HA 1UR9A 4BF7A 3WUFA 2O9OA 3ZT5A 1UD6A 1CNVA 2HVMA 1JD7A 4ACZB 1UD5A 2QPUA 4FNPA 3SCUA 1KR0A 1OT1A 4HZ7A 2G3IA 2WCAA 2BXYA 1VEPA 1G1YA 1KQYA 2WZEA 5I6SA 2E0PA 4OIFA 4CD8A 4XUYA 2XVPA 3MS8A 3L4WA 1OB0A 1K9FA 3M46A 3DX1A 1H41A 4Z2HA 4JFUA 1KTBA 2JFEX 3RM8A 1XRVA 4GZIA 1EQCA 3ECQA 2DEPA 4LYQA 3T0AA 4AC1X 3RILA 1KB3A 3RIKA 1GJUA 1HVQA 4LXFA 1CIUA 4RE3A 2PBGA 3IGUA 3WUGA 4J7RA 2FGLA 2XFFA 3PHAA 4GQRA 2XG9A 2YL8A 3BUDA 2CERA 3GYCA 1PZ2A 1J0IA 2CXGA 1C7SA 2XWEA 2V3FA 3AS1A 1CXHA 1R47A 1HIZA 3FAXA 4UQ9A 3SUUA 2OWWA 2WAGA 2FH6A 5IXEA 3CGTA 4AYGA 3OLGA 4MJ2A 3SEPA 1UWTA 3VGEA 3BUIA 3OZOA 3GBEA 3LPFA 3OIHA 3DYOA 1EGZA 3VUPA 2J7HA 1XH1A 3HG3A 1EHNA 2ZXDA 2F7QA 5E9AA 5HXMA 3WEOA 3GXTA 4V28A 1LF1A 4H8HA 3RJYA 1VFMA 5FIPA 1C90A 3T2PA 4A4AA 1GOIA 4TTUA 1CGYA 4A3YA 5A2CA 3WQ5A 2WMHA 3VMOA 1UQYA 1TG7A 2D23A 3BMWA 3EMQA 1E4MM 4Z2GA 1VFFA 4CD5A 1BPLB 3LX9A 4H04A 1W9VA 3BVVA 3HG5A 2VZOA 1XH2A 3W82A 2VUYA 2CEQA 1E71M 1BG4A 5ABFB 1HNYA 4W84A 3NSNA 2EQDA 4IPLA 2ZUSA 3WD3A 3AISA 2V5CA 3GXMA 2EACA 4CCDA 3WFZA 3AMKA 4B9YA 2CKRA 5A3HA 5BYWA 4HU8A 2W63A 2ZUTA 3VTRA 1IZKA 5A6MA 1QI5A 4M56A 2O92A 1B3XA 2VRJA 3ZR6A 1CXKA 3W26A 4P8XA 1C8XA 4DWSA 4H41A 1QHZA 2F61A 1EDQA 1JF6A 5CLWA 4RL3A 1H2JA 3CTTA 2D0FA 3WDHA 1DWIM 1HP5A 1R7AA 4Z2IA 3M07A 3B8SA 3DYPA 1UR2A 4AZ6A 2UY3A 4AZGA 4AYSA 1V0LA 4K68A 3IAQA 5I79A 2JIEA 1DWJM 1US2A 1W32A 3CUHA 3IJ9A 3CZKA 1B90A 2WB5A 3UEQA 3WEMA 4MAZA 3GXNA 2D20A 3GDBA 3WF0A 1VBRA 1UD4A 4UCFA 1QI0A 3I3DA 4H7VA 1B9ZA 4HTYA 4LPCA 3THDA 2XVLA 1XSJA 2WKLA 2V3EA 1UZ1A 3EJTA 2QMJA 4CVWA 1WO2A 3T2OA 1CPUA 2PF0A 3CZJA 4S3KA 1MFUA 1C8QA 2IXUA 1E0XA 5DFAA 2D22A 5E6ZA 2IGTA 5CSYA 1U33A 5A6BD 3VGGA 2Y4SA 3A3HA 3RO8A 3WUEA 1BG9A 3B9DA 1OINA 1MW2A 1K6AA 3WIJA 3ZO9A 3DHUA 2G41A 2PWDA 1N82A 1UKOA 4R27A 3GM8A 4B9ZA 1ISYA 1UH2A 3KEHA 2UY5A 3DHPA 1Z32X 1OGGA 3EMCA 4WKFA 5IFTA 2A3EA 2WHJA 1CTNA 6A3HA 1C3FA 5ECUA 4UQAA 3ZSTA 3AYSA 4E8DA 4MJ4A 2FHBA 3BVXA 4KRUA 3GXIA 3WNMA 2JEQA 2ZICA 2F1BA 1MVYA 1HF6A 1UHVA 2WSPA 1BYAA 1LQ0A 4U3AA 1KFWA 1J0ZA 3HU7A 2O9TA 3AMCA 4UQEA 3BAXA 1H49A 3EJSA 2J7CA 3K4DA 1EDTA 4J28A 1HJVA 2Y8KA 2DIEA 1FP9A 1GHSA 1E6XM 1NH6A 1O7DC 1E0VA 3POCA 1PEZA 1JAKA 3OG2A 5BWFA 3AHTA 3WQ8A 3GH4A 1QI2A 1DWFM 4PMOA 3OZPA 3SCNA 1W1YA 4FF5A 1LWHA 3KLKA 2WBKA 4AISA 2OWXA 3CZGA 4CUCA 2X2JA 4CGTA 1KQZA 2EADA 2J25A 2PI6A 4PMQA 4EK7A 3WDRA 5A6LA 1M7XA 3AYRA 4MPKA 3WDIA 1BVNP 4AZBA 2VNCA 3EDDA 3ARSA 2IUZA 1NOWA 4PMUA 1H09A 3U7BA 4ATLA 2J8FA 1ZJAA 1B0IA 3K46A 4XX6A 3VM7A 3VO0A 3IANA 2Y24A 4U2YA 2YIHA 1AQHA 1BGGA 3UESA 3ZOAA 3WH6A 3WNOA 4HMDA 4JKKA 2W5FA 4EKJA 1QBBA 3RDKA 4QCFA 2A3CA 3WDJA 4PRWA 2GJXA 3BVUA 2YKKA 1EDGA 1SR0A 1JI1A 1G9HA 1TE1A 3WH7A 6TAAA 2YDSA 1MQRA 4PMNA 2XTKA 4HMCA 3U57A 1CLVA 3SCOA 1E6NA 2J4GA 4XB3A 8CGTA 2J77A 1E3ZA 2W66A 4JHZA 2X2HA 3BAYA 2NT1A 4MB5A 1MW1A 1E43A 2O9RA 1EIBA 2DT2A 3F5JA 4GI8A 2VCBA 4IM4A 1VAHA 4PCTA 3TTSA 1IV8A 5FL1A 2WCSA 3TTYA 1VIWA 4CCCA 5I5RA 4W7VA 1US3A 5FL0A 1GHRA 5FKYA 4YHGA 1HJSA 1UUQA 2VOTA 3ALFA 4D72A 1UZ4A 1D3CA 2DSZA 4TX6A 5DT7A 2WLYA 2A3AA 1T0OA 3WEZA 1UKPA 4MDOA 3PZOA 3LXCA 4WJXA 5C8BB 4TVUA 4QDMA 4J3WA 1VBUA 4GXPA 3G6MA 3WQ4A 2G3JA 2O9PA 2CKSA 4CKQA 5BXRA 2J7FA 4E2OA 4JCMA 5JIWA 4WKAA 2OW6A 4PBGA 1GPFA 1TQVA 1XD0A 3A6OA 6CGTA 2VX7A 1WNOA 2VT0A 2EPOA 2VX5A 3AXHA 3BLKA 4P7LA 2DH2A 1RH9A 2WNWA 3GXFA 4NRRA 1CGWA 3MMWA 3VIIA 1GNXA 3W4RA 3WF2A 4ZFMA 3VGBA 3AIRA 1H0IA 1HKMA 1MFVA 2XYLA 2D3LA 1SMDA 1Y7VA 3LXBA 3DC0A 1UASA 3ARUA 1CGTA 3PZVA 3FAWA 5E70A 1KXHA 2VRKA 2WCGA 1ISZA 5TD4A 3ZIZA 3AIVA 3L4XA 3GNRA 4JKLA 3BXWA 4PUEA 1ZU8A 3VSTA 4W5UA 2OLHA 1BAGA 3WL0A 2OYMA 5D9PA 3WQVA 3DDGA 1AVAA 3WKZA 4CVUA 3D4YA 3F5KA 5GPRA 3WNKA 3CC1A 4UQBA 2FYVA 4PMZA 3FN9A 4J3VA 1B3WA 2WWDA 5I24A 3PN8A 3BLPX 3II1A 4DM2A 4H2CA 2QHAA 1CWYA 4P7QA 3WSUA 4DO5A 4AWEA 4E4PA 4OOUA 5CGTA 2BVTA 2CIPA 1MXGA 4AXNA 2JALA 4X0NA 4F9DA 1V0MA 4W85A 1W3HA 3ZR5A 3CH9A 4WSJA 4U33A 4M81A 1PIFA 3S5ZA 3MMDA 3OGVA 2EPMX 3A21A 3SUWA 1W2PA 1LG2A 1E5NA 4JL2A 2VI0A 4QP0A 3PTMA 4UQDA 5DEZA 3NJ3A 3WELA 3AI0A 4J3TA 5CPSA 1R87A 3RMEA 4ATWA 3W29A 1W9DM 4AMCA 3AXIA 5IHSA 5JBDA 3TTOA 3QHMA 1E6RA 1GOQA 5FCZA 1FH8A 3M6DA 1WAWA 3WY2A 3LRKA 3W38A 3E1F1 1QHPA 1ISVA 1BQCA 1HP4A 4QLJA 3NUKA 3LPOA 1KGUA 1JYNA 2W62A 1W1TA 1ZBVA 3WF3A 1NM9A 1ESWA 4UZSA 3CHCA 1K9TA 1HX0A 4BQ4A 1W9BM 4FNTA 4UFLA 1E3XA 1EA9C 3DX0A 5D9OA 2RGLA 5HDRA 3LPGA 4Z2LA 4N42A 1QI3A 3KL0A 1E4NA 1HKJA 2DSKA 3T08A 4FK9A 5A94A 2ALWA 3VIMA 5CG0A 1KCKA 1CGUA 3OLEA 2VMFA 2NSXA 1E15A 4B16A 2QPSA 4AZ7A 4ACYA 1HJUA 1AQMA 1CGXA 4KGJA 3WF4A 3NIYA 3GH7A 4W89A 5E1QA 1O6IA 1CYGA 2XN1A 3UG5A 2VZTA 2ZX6A 3SUVA 4M8UA 1RP9A 1YHTA 1K9DA 3EDFA 4FLSA 1XC6A 2BVDA 2YL5A 3HMCA 1JYXA 2D2OA 5JBFA 2UWFA 1JXJA 4AZIA 1W1VA 3KLLA 2GK1A 3PZIA 2ZX9A 1CDGA 3W53A 4NSBA 5CQ1A 1V6WA 3D5HA 1I75A 2J75A 1HL8A 1QI4A 2F7RA 1TQSA 3WDPP 3VGDA 1NWRA 2GSJA 3QOMA 1VRXA 4NRSA 1HT6A 3WMCA 3WUBA 1UA7A 3A47A 1FH7A 3GNOA 2WC7A 1CECA 3JUGA 2VQUA 1CXFA 2XN2A 4TX8A 4W7UA 4TUFA 8A3HA 2D0GA 2CBUA 5JUVA 4IPNB 5AY7A 3GH5A 5A6SA 3VOCA 4ZE5A 4MAVA 4U5KA 2X2YA 4JFTA 3TONA 3RM9A 1KXQA 1W9PA 5BROA 3VD7A 5E6YA 5A8PA 1B2YA 3PTKA 1UR1A 3O9NA 3EJUA 4QFUA 4CN6A 1OD0A 4WSKA 1JL8A 3PZQA 1OSEA 2DDXA 3UETA 3WQ6A 5DO8A 3VIPA 2ZIDA 2DH3A 3CUGA 4UQCA 4AD3A 2D0HA 5HBFA 2J7EA 2ZUNA 2WHMA 3T09A 3ARQA 3W25A 3TA9A 4R5EA 4W87A 1MXDA 5AC4A 5A8NA 1OT2A 4U5IA 4JAWA 2CESA 2C8NA 4ZE4A 1QW9A 2XN0A 4WLCA 1E1EA 4DWSB 2MANA 3N1AA 3ARXA 3DYMA 4JL1A 3PZTA 1BPLA 2EO7A 3BAKA 1PX3A 4MB4A 2AOSA 1NARA 3ZJ8A 3EBVA 3AJ7A 1XSIA 1E55A 1RP8A 4GZJA 4AIUA 2BHZA 2VCCA 3L4YA 3LPPA 3AIWA 1ZB5A 2CBJA 4UOZA 3NCOA 5GNYA 1JI2A 5HPCA 2WZHA 3AHZA 3L2LA 4AD5A 2WYSA 4YN5A 3VU2A 3GTNA 5D8ZA 4X0VA 1I1XA 1FFRA 4P7NA 3W81A 2UY2A 2WKGA 1E1FA 4AD1A 1HXKA 4FLRA 3L4TA 4GPNA 1EOKA 5IFPA 4NXSA 3HJEA 2DT3A 5I0DA 3ZMRA 2WZIA 3WNPA 1XSKA 1WDRA 4CD4A 1W91A 4DO6A 2GVYA 2VJXA 2WMIB 1M53A 2JE8A 4PYSA 1UWSA 1JAEA 2ZOXA 2EPKX 3VDCA 3SCVA 3N17A 2A3HA 5CGMA 1F4HA 3NDYA 2BY3A 1UKSA 1HJXA 1VEOA 1ODUA 1RPKA 2FHFA 3MV11 4AZHA 5LA2A 4DO4A 4D6HA 1HJWA 1GZJA 3WENA 3UG4A 5BXPA 4AMWA 3ZM8A 3BH4A 5A6KA 4S3JA 1PAMA 1ISXA 4P8WA 2BY1A 3VGHA 4N0RA 1JZ6A 1O7AA 1V3LA 2J79A 2D3NA 3DECA 3BCFA 3IAPA 1MW3A 1GOMA 2BFGA 5I78A 1GOWA 1JFXA 3WMBA 2YDRA 4HA1A 1D7FA 2FGZA 2G3NA 3VX0A 3A4WA 1WDQA 4Z2JA 1DEDA 4MNLA 4J27A 1V3HA 2VC9A 3A4AA 4NZFA 3J7HA 4RE2A 4DUXA 2BHUA 3AIEA 7A3HA 1GQIA 2CBVA 1UD2A 3IJ8A 2WANA 5DF0A 4UNIA 2PBOA 2C7FA 3CZLA 4AW7A 1NWUA 3BSHA 1G5AA 3OLDA 2OSXA 2EABA 3WN6A 3CZEA 3PZNA 3QOKA 4U3CA 1CLXA 4WK9A 2CCRA 2BV9A 4Z2KA 1KBBA 4BS0A 5CPQA 3MV01 4MDPA 1UR4A 4C7FA 1R8LA 3AFBA 5E09A 4ACZA 2F2HA 3HG2A 3N11A 4PTVA 4UFMA 1GOKA 1CENA 1M01A 5DT5A 1X1NA 2XSBA 5IHRA 3EYPA 3ZT7A 1TMQA 3L4ZA 4PEEA 2ZXAA 4D6EA 4EANA 1X6LA 1C91A 5A2BA 3K8MA 4BA0A 5A8OA 1BLIA 3VNZA 3FY1A 1LL6A 2CETA 2D1ZA 1U2YA 4IISA 4FNUA 1TUXA 1JDDA 2PWHA 2OWCA 2HISA 4WIWA 1HXJA 5A8QA 3ZT6A 5CZKA 1VFOA 1HKIA 3CHDA 3CMGA 2ZXQA 1H1NA 3ARWA 1QPKA 2WMKA 2WLZA 3QGVA 3A22A 4HOZA 1OBAA 2PWEA 3MMUA 7CGTA 3UR7A 1W3KA 2EPNA 3LXAA 4E8CA 1V03A 3QR3A 3BCDA 4W8LA 1DP0A 4FLOA 5D8WA 1E0WA 2XHYA 3TOPA 3ZJ6A 4HU0A 3VX1A 1LG1A 1QWUA 4W86A 5A2AA 4RE4A 1WZLA 5CLTA 3N12A 1QNQA 5ABHA 2QMKA 4PSPA 2YLAA 1JNDA 3UR8A 1PS3A 2VL4A 3WFLA 1ZJBA 1OCQA 4OJYA 1HVXA 2J8GA 3WH5A 1XHGA 1PJ9A 2GFTA 1W2VA 3T0BA 1GORA 4D6DA 2XSAA 4GI6A 2DIJA 2ESCA 2BXZA 3WH8A 1R75A 4AD4A 2OW7A 4PMYA 1JF5A 1UH4A 3CZ8A 1E6ZA 1UG6A 5CPTA 4XZWA 3SCWA 3PZMA 1HKKA 3CUJA 3VNYA 1CXLA 1YQ2A 1GQJA 3MUY1 2EXOA 4NZJA 4V27A 2WVVA 1TVNA 4W5ZA 1JZ5A 2OSWA 3W27A 1SFSA 3DX4A 3T0DA 2ZX8A 4JZ5A 2AAAA 1QOXA 4P7RA 3NSXA 2FDMA 1MWOA 1XYZA 3FXYA 1SMAA 5HNNA 1BSIA 1J11A 1V6YA 1B1YA 4HOWA 3I3EA 3BVWA 1GJWA 1KCLA 4YHEA 2DQXA 2CHOA 2J7DA 2DSWA 1R86A 1Q6DA 4PMXA 3AS3A 2YA1A 3UERA 3AZSA 2WVTA 1TQTA 1BYDA 1MQPA 4Q7NA 4MNMA 2FHCA 2WK2A 4D1IA 3OLIA 4KMQA 2GJPA 1WZMA 4GO8A 5ABGA 1KGXA 4HZ8A 5BXTA 1JZ7A 3N9KA 1SYTA 4HMEA 3AS0A 3CHFA 5I3DA 5D9MA 1LJYA 2G8ZA 1DTUA 1LL7A 1PIGA 3DDFA 2VQTA 3EJQA 4GQQA 1NP2A 1QNOA 1WZKA 2YA2A 4OBSA 1UR8A 1XH0A 5AYIA 1VJZA 2E9BA 3FNDA 3OGRA 2X0YA 4H8UA 1WE5A 4F66A 4NZCA 4BQ2A 1VF8A 2FH8A 4UFKA 1E56A 2Y2WA 3PBGA 3WY1A 2WSKA 2VZUA 2V3DA 4ZXOA 3WMSA 2VO5A 3W37A 1E72M 3A5VA 3BVTA 1J0KA 3AHXA 4B15A 1B30A 3SCPA 3HN3A 3VD5A 4F79A 4XV0A 1G01A 5E0FA 3KZSA 1ISWA 1GONA 4AEFA 2YBUA 1JZ4A 1H0GA 3SCTA 2ZWYA 4ML4A 1V3MA 1L0PA 4Q22A 2GJXB 1UWIA 2OSYA 1W3JA 3VIHA 2ZE0A 3CHEA 1KGWA 1EHAA 1QX1A 2YLLA 1QW8A 3K8KA 2DT1A 1W9UA 4MB1A 1Q6FA 3UG3A 1M04A 4XZBA 1E73M 4W93A 1BHGA 1MYRA 3WNNA 2GDUA 5CXPA 2JEPA 4TXEA 3VPLA 2GUYA 2QV4A 1E70M 3D4ZA 4OUEA 1QHOA 1GW1A 2W4XA 1KWGA 1BF2A 4PTMA 4DUWA 1TA3B 2XUCA 3F5LA 2EPLX 3AQUA 5LA1A 4NXKA 4AIOA 3GXDA 1EO5A 2WMFA 5GNXA 5EFFA 3BUBA 1B3YA 3ARZA 1BTCA 1Q6GA 2F18A 5LA0A 3WD0A 4H8VA 1FHLA 1UOKA 4HOXA 4V2XA 2WWCA 4HA3A 2X1IA 1NP0A 2ZUWA 3AMDA 3RCNA 5M03A 4ZEPA 1UKTA 2DGAA 4AZCB 4UFIA 4AEEA 2EEXA 3PTQA 3AIUA 3VD3A 2YOCA 5CSUA 1J0JA 4URIA 1IT0A 1C8YA 3ALGA 4DUVA 1TA3A 4AIEA 1V0NA 1JD9A 4DM1A 1EQPA 1FHDA 3M7SA 4B3KA 1JDAA 2E9LA 1EOMA 1SZNA 2XVNA 3MU7A 4KH2A 4AMXA 3WQWA 1V3IA 2V5DA 2XPKA 4C7GA 2ZUUA 3OBAA 2F1AA 1JG9A 4MADA 1X6NA 1JZ2A 1E6QM 2VX4A 1S46A 1W3LA 4W7WA 2YFOA 4CCEA 2CITA 2CPUA 4FNSA 1UH3A 3CUFA 4W8BA 2ZX7A 5IDIA 3VMPA 1R46A 4KGLA 3VSUA 3D50A 4Y7EA 1V02E 3WBEA 3H55A 1BVZA 4EE9A 5DMYA 4PTWA 4FNQA 1ODZA 3OA5A 1JZ8A 3KL5A 4ATDA 1ZL1A 1XCXA 1BYCA 3PZ9A 5M17A 4CD6A 3VINA 1J18A 2YDQA 3KWXA 2XFYA 4W8AA 4L4OA 2JF6A 1H3GA 4OOZA 2WBGA 3CO4A 1B3VA 3VIGA 4BZYA 3MSGA 3WD2A 1PPIA 3ZSSA 1HTYA 1UD3A 4M80A 3BUQA 4PMDA 2V3GA 2XWDA 1OIMA 1JDCA 2DSVA 1VB9A 4TVCA 1UWRA 3O6AA 4L4PA 1JXKA 2VCAA 1Q6CA 5E0CA 4M29A 1OGBA 4F8XA 3W24A 3O2LA 1NOUA 2YJQA 3MKKA 2WMGA 2PWGA 5KEZA 1GQLA 1PX4A 5CJ5A 2BVYA 4C7DA 2X09A 5FOOA 2WW5A 3WNLA 4UZUA 3VMNA 3APGA 4PN2A 3U7VA 3TV8A 1UA3A 5D9NA 4HPGA 2WVVB 1WB0A 3DX3A 3ARVA 1D2KA 2WC4A 2E8YA 5BRQA 2VVNA 1NOFA 4M1RA 1OD8A 1VEMA 1HN1A 5A6AA 2VZSA 1GVIA 5BXSA 3POHA 3K4AA 3ZJKA 3CV5A 1UR0A 1AMYA 4JIEA 4LX4A 4PTXA 3CZNA 2D24A 2WVSA 4NI3A 2QF8A 3MUAA 2JIWA 2UY4A 3MSDA 3GXPA 4AD0A 3IJ7A 4J3XA 2WHLA 2XM2A 2GK1B 4GIAA 1G0CA 1JYVA 4BQ5A 3WDQA 4WF7A 3N18A 3B9EA 3H53A 2W61A 4D6IA 1FP8A 2C0HA 1F4AA 3AS2A 2EBNA 5EMYA 1W9XA 4FMVA 2NT0A 3H54A 4CD7A 2WC3A 2AMGA 4KWUA 2GJRA 2WVUA 1WZAA 4UOQA 4HPHA 1DWAM 2EAEA 1C7TA 4MTVA 1R33A 3VDHA 2Q8XA 4QLKA 1BFNA 3SIMA 1UQZA 1WDPA 4QCEA 3THCA 1EO7A 3MO4A 1V02A 5A69A 1CZ1A 3AOFA 2JF7A 4PCSA 5EB8A 5D4YA 5EBAA 2J7BA 2VVSA 1TQUA 3K1DA 3MUIA 5C71A 4DWSD 3A23A 2WPGA 3CMJA 5FD0A 3VIKA 3ZQ9A
chains in the Genus database with same CATH superfamily
3RITA 1VENA 1GYMA 1DWHM 3OIXA 1G43A 2EIXA 3G6JE 4M4RA 5K9OA 1XF4B 4HETA 2XM1A 2V8MA 1KIRB 3QA3B 4CU8A 5A8MA 3K72B 4H8WL 4OT1H 4PJ5B 1HWHB 4ABQA 4BEQA 2IWGA 3WBKA 3D52A 4QHNA 3UZEA 2BC4B 4ALAL 4E9SA 3NFSH 3ULUD 5FA4A 5A3ID 1MQQA 1BXVA 2Z28A 1XX9C 2DUXA 4HXAH 3B6SB 1XF0A 2F15A 4O51B 2W9LA 3P9WB 4WY7H 4LSDA 4DEPC 5T3ZD 1PO9A 4TUKL 4RPPA 7XIMA 4HCGA 4L1TA 1CURA 4GA8A 4I87A 4ADGA 1UA6H 4KTDL 1L9PA 4MCZA 2BGSA 3ULUC 1U8LB 4AV4A 2R0LH 4W9FC 1O9VA 3H42L 4QGTA 3P8IA 3VA6A 3QUMB 4IMGA 1S2VA 2Q6LA 3IFPA 4MJ6B 3Q65A 2QAPA 3IRPX 2KERA 4FG6C 4G70B 1R7OA 3DTXB 4RGND 4ZUSB 1LEGB 3BISA 1YPZE 3QR1A 2GBUA 4TOQA 3D2UD 4EJ1C 4TRPL 5HVHB 2OYKA 3WJYA 2B59B 4IJ3C 4PGEB 4RMTA 4YDLC 5E6UB 5FF2A 2I5IA 5F7KC 4PRHA 4RX4A 3OMIB 3VGFA 3QV8A 1ZLPA 4QQ3A 3FGCA 4BZ2A 2F7FA 3L4UA 4TMXA 1VLXA 3GE7A 1PZCA 2V30A 1EFCA 4ZUWA 3A3XA 3G1SA 1JS4A 1QWNA 1KB9K 2V6HA 3MRJA 1CICB 2H7WA 2HH0L 2Y0SA 3MRNB 3DGDA 4JKPH 5HDLA 2Y22A 5CEXB 3SCRA 3MA8A 1HCFX 1X8FA 1N0UA 3UXAA 2CKBH 2G5RA 4MFHA 4KK9C 5C70A 3TJ4A 4A2SA 2XOTA 3FO9B 3ZU8A 3CFEA 4PV8A 1CF8H 3LKNB 3PUOA 4F4RA 3TIDA 4GIRA 4MNGE 3IMSA 2HKFL 3ELQA 1AR1C 3ID7A 3U2QA 4K3JL 5DT1L 3BLEA 1V3KA 2ZWNA 3P69A 1H1ZA 1H7NA 2QAFA 4CADA 1BJ8A 3TO2A 5D5MB 1I9RH 3D26A 4Y8EA 1MAKA 1L9SA 4G8EA 4PJ5E 4OGAC 2PB1A 1IE5A 2FWLB 3PGCB 3WTUA 4MNMA 1OGSA 1IQDB 1FH9A 5GIRB 4F15C 1MEXH 2ZVIA 3BEWB 1G9NL 3C6LB 1WBYA 4HKBB 2XGBA 4F8TA 4UTWA 3N1MC 4JO4L 4ZRGA 3GS4A 1V0EA 4JFVA 5H8DA 4QM1A 4X3ZA 3WJMB 4TKWA 4F58H 4XKYB 2W92A 4JO1L 4EDXB 4L9XA 4AZCA 3BT2H 1MCLA 3KDMA 4YSTA 2FFCA 3ILQD 5GS2H 2R91A 4Y8FA 5GGVY 1NGWA 1PG7X 2AFNA 5E8PA 4LKCB 3VILA 3H2OA 1XGRB 4KROC 3U9PH 4IBWA 3TMQA 4M5TA 4S1DD 1AG6A 1H3WM 1NCDL 4DJED 5ABFA 2QTLA 1FC2D 2K45A 1R3TA 3S4TA 3GF8A 1TCRB 3ZX1A 3VSQA 1EJRC 2CLKA 2L04A 3U2IA 3VXMD 3PFMA 5T3ZE 4Z1YA 3NYDA 4DYEA 4P2AA 1V6VA 2XIBA 4CU6A 2QNEA 4LUYA 3ZDXB 4JQ4A 4UB0L 2J8TA 1OCRB 1DV7A 3WEXB 1ZHLA 2CZ5A 1QNRA 2X7LA 3P9MA 1U3HC 4Q0XH 5AYBA 3AHYA 4JM2D 1AJZA 4N6RB 3AXXA 4U1NA 5DD3H 2YFNA 4XAZA 3RCMA 1REQA 5EZLB 3CLWA 3HRZC 5FFLA 2J7GA 1CDIA 4ZFQA 4HZ6A 1PZDA 1K5NA 4NKCA 2WNGA 4HS6A 3B3DA 3AZRA 1NFIB 4KJPC 1DSFL 2VISB 5DHVH 2XHNA 1YY8B 4LQFL 4L4TB 1GOOA 2DZUA 2QDXA 5ENLA 1JGDA 2F58L 4P4KA 1T0NA 3SE9L 5C0BE 1J9SA 1D5MB 1S5HA 3BKCL 3CPUA 4MB3A 1PDKB 2XIIA 5HGDB 4IRSA 5AYUH 4WXYA 2OCJA 3W71A 3M0XA 3BHBA 3VFVA 2R6HA 1L6XA 3G6DL 4HWZA 4PM1A 4Z7NB 1O5XA 2EIEA 3GFUA 3FU8A 3VDBA 2KS0A 3UYPA 1TXKA 4ZFFA 4RLIA 4UFJA 3PNUA 1A9BB 2NYYC 1UIOA 3CYVA 1BZ9B 5FA6A 2CDEA 4IXXA 3FUIA 3NEHA 3P5YA 4XBGB 5G5DB 5IQ9B 1S38A 3L23A 3VQLA 1HGWA 6XIMA 2UXGA 2HTLD 4NZTL 1I85A 4WCJA 1XIDA 4D8PB 4NIYE 1A2YB 3O2WL 4APQA 3M9YA 2NWRA 2Y1ZA 3BP4A 3ZZSA 1DTNA 2CLIA 3P62A 3VYLA 3KCPA 4UOJA 3AVEA 3P4NB 4GFSA 3DJTA 3IJEA 3R7QA 3SQSA 1BX2A 5TH2A 4TQTA 3MR9A 5BMWA 1QATA 3TOYA 2G4GA 4A67A 1JNNL 1T6VN 4F27A 1LL4A 1I1CA 5DJ0A 3OKXA 3EDEA 1RERA 5AHFA 1AHMA 4M1GH 4WI6A 4IG2A 4IOSA 5INDA 4G9DB 4LAKA 3HFML 3QS2A 1M9SA 3OB8A 2ZWKA 2NW3A 3ATDA 1CICC 1XBRA 3STGA 3SFKA 4XN3A 1MRCL 3SADA 4FOMA 4E9WA 3G6AA 4N0UA 2K6ZA 4BRVA 4D0CB 4IGSA 4RPDA 2Y7MA 1LWJA 3NIDB 5M5DA 1YRKA 3K2UH 2ZVRA 3GMQB 2EIDA 3GAYA 4PW3A 3CXDH 5MEQA 2IAMA 2IFFH 3H3PL 2JXMB 3REVA 5K59E 3WS3A 1UD8A 2E5CA 4YOKA 3GUWA 2DJSA 4AQZA 1FH5H 3HI5L 2VMDA 4OAWB 5BXSA 4YIWA 3NYKA 4ELKA 1YNPA 1M03A 3B8HA 2IBGA 5ENWA 4MNGB 4UNTA 1EEUA 4UTBA 1PQZA 1F3JA 4DBEA 4IPIA 3P4MB 4EAMA 1AHWB 5DJCA 4P8UA 3F4VA 4CNOA 5AUMA 1JQXA 1KMHA 4HH9B 2YWHA 2OMVB 4PJXB 3TYGH 1T7YA 2R1WB 3MRRA 4H5SA 1A47A 4W70A 3UZQA 4C60A 1WAAE 3VRJB 3AM8C 1KCSL 1KBIA 4EXBA 4GG6B 4U2ZA 2ZWZA 3L8QA 4JKMA 1KXQE 4FRWA 4AVZA 5HZBA 1D5IH 2XXCB 4J8RA 1NWSA 2Y85A 3PZUA 3P0VL 4GXVH 3C09C 2AQPA 4P25A 4GY1A 2ZG3A 1WTHD 1J8KA 3MYPA 1KFCA 2K1MA 3RKPA 2J47A 3SSZA 3V4BA 1NKOA 2HVJA 4IOFD 4XVJH 4HUXB 5C0AB 1LUCA 4UBDD 2XACC 3FZUC 4F7DA 1TZ7A 4RDKA 3F00A 3P81A 1RJLB 2ADAA 2BMBA 1L0YA 3P2DA 2Z1BA 4PJ8B 1UACH 4J3OH 4JYEA 3LOTA 3ZW3A 3APTA 4Z5RB 3GSXB 3QTGA 2E5DA 1OTUC 3M4HA 1TZOA 4F8LA 2NXYB 3CDZB 4LKXA 5GQBA 2V68A 3EMZA 4XLFA 1PNDA 2OAAA 1YMYA 3B3IA 3UIYA 3ARRA 4N7QA 3EOTL 4PHXA 3H2FA 4GHRA 1R17A 3BAWA 1C92A 1EBAA 1U30A 4QEEA 3FW6A 4WY0F 4XMUA 2VRQA 3CFJB 5F71A 1YPZF 4G8AC 3Q2NA 5JXAH 1EXUA 2FQEA 2J8OA 3QDJB 2GIXA 3WD4A 3B8UA 1NWTA 3H2AA 5I1CH 2CIKB 2JI2A 3CIAA 3LQZB 3LN5A 3SEJA 1YC8A 5HOSA 2NXZC 2ZZ5A 4TT3A 2OBGA 5I77A 1OAKL 1VQPB 5D4JA 3MI6A 1ELOA 4OLEA 3VXSA 2BIOA 3VFMA 4G59C 5DDHB 4X7TB 2FKPA 3NXLA 3FTSA 3AREA 1UMLA 1WDAA 2E4TA 3FB7A 1CS6A 1XDTT 3OPSA 3QB7C 1MZRA 2CA4A 3CB8A 1UM6L 3ARPA 2X8RA 4JJHA 5FUZL 1YN6B 2XU9A 4JM2C 1GUVA 4PV8B 1D9EA 2PN5A 3N9GH 1G94A 4POZD 35C8L 5BW7C 2YRZA 3GBDA 3ULVE 3EXSA 3RRXA 3ESUF 2DB8A 2EDBA 4S0SD 4DYJA 1P7HL 2Q09A 2CG9X 5C0FA 3T2LA 1B88A 4HJGB 2BVUA 4I2XA 4TOYH 2NOYA 5F7HA 2OJPA 2WMJA 3QKEA 5C2BH 3TASA 4MJID 1NC4A 4QTHA 4HU2A 2ZXBA 5SX4I 3TP4A 2O93L 2FSEB 1U21A 1RK1B 2FZMA 3B9AA 3VRLF 5AOMA 3KDNA 4RDVA 4PWKA 4XCNA 3SQBA 3FB5B 3NABL 2IG2L 5EN2A 2R1MA 2H8PB 3HPJA 3RI5F 2W27A 1E4LA 3CJPA 5DS0A 2P80A 2ROXA 3AROA 5EZIH 1UUMA 3N04A 4LU5L 1OHHA 2FZ8A 1S7WA 4M43H 4YSUA 4U6VL 3KPPA 1OK0A 2AKRB 3GUTA 2OQLA 4GKNA 1FKWA 4JYFA 2EE2A 3KBJA 2B2XH 4PL1A 2K3TA 2E46A 4BCZA 2XSKA 1EWEA 4KZCA 3GIZL 2DQWA 3BC9A 1PD6A 5CUSL 2VWSA 1TVBB 3PWNB 5FYJD 1PD1A 4GKLA 3ZRCC 1JYWA 2ZA2A 1MF2L 3LU2A 1TFHA 5BW7A 3PHQA 4UTFA 4B43A 1GZGA 2IQDA 4Q2ZB 4Q8QA 5IM51 1B4LA 3HV8A 3GRWA 3RPMA 1MFBL 4GBXB 2OMYB 1P0EA 4L4TE 2VX6A 2KT6A 4X2UA 4JFQB 4NP9A 4U1IB 2ISVA 2HTMA 5J3OA 2JB5H 1XF2B 5I74C 2W60A 3UTPE 1KJMB 3H1ZA 4HIEA 5AKVA 3SQOL 4LGXA 4MVAA 2F8VA 2V5RA 1NC4B 2BZDA 2ESVE 2PLCA 5EEZA 3WSQL 3CN4A 1KWGA 1H60A 3HR6A 4JHVA 1XCWA 1RPXA 3GIPA 2Y7DA 3F2DA 2QSQA 3U4AA 1WFNA 4RD6A 3VSVA 5HVHC 4UMBA 3N55A 4ZQKB 1UJTA 4LARH 3ZKXB 2BPBA 3SAZA 2IV9A 1IVTA 2E5EA 1EGMA 2IPJA 3NEOA 1RZKC 5U4NA 1NF7A 2P45B 3PBVA 1A7NH 1TQWA 3KGSA 3KL3A 4WKZB 1F97A 4IKKA 1VBJA 1XDJA 3IJDA 4U10A 2R69H 2XVKA 1BGAA 4J5NA 1BF5A 2BSSA 3MO1A 3WFAA 3OYZA 2ICES 1E4XH 3BSGA 3NA4A 5KINA 3KW8A 1A3RH 1ONQA 2GIYA 2J74A 3G71B 5DLCA 1WAEA 3BCJA 2XBZA 4MAYC 4JVUA 1FNFA 2JK5A 1VHNA 4E5XA 1NAKL 5AZEH 2EE3A 1J0HA 3NQEA 3DRTA 1M65A 1J2BA 4OI9A 1KJMA 1T0NB 2R0KL 3NJXA 5DC4B 1QO2A 4UIKL 3QQ9D 1CQXA 2DM2A 3IDUA 3QAQA 3MNVB 2HS8A 3OVPA 2HVMA 4JJ5A 2ZL5A 1VQLB 2IOIA 1QUNB 3OP1A 1VFBA 4HZAA 3FZUD 4ONGL 1JHLH 2QPUA 2B16A 2DQUH 4KK8D 1PL9A 3CEUA 3MLZL 4XUGA 3SCUA 3BEVA 3CNYA 3SBFA 4B5ZA 1U8JB 4H40A 4TNVK 3DI2B 3WG7B 4DP9X 1LDPH 3GLAA 3OW2B 2EPHA 3QUZA 2WCAA 1VEPA 2DQTL 1W0VA 3GSRA 4FC3E 3I9GH 3MRLA 5DZOA 5ESAB 5I66B 1KQYA 3WYZA 4ODVL 3ZR4A 1A6WH 3L4WA 4GH7B 3N40P 4MDIA 4NKMA 4UIMB 4HHAB 4GAYA 5EFIB 5DJYA 4BM7A 2OTDA 3BFWA 2CCLA 4E4UA 4APQB 4TLUA 4NO2A 3WFEH 2F6KA 4WZKA 4FZEH 3W56A 3KDOA 4PVNA 3CLEL 2RQ8A 1KTKE 2A4ZA 3WIIL 4HQVA 4GRLA 6TIMA 1FRNA 3E1YE 3QDGA 3TAKA 4OI7A 2WB7A 1EQCA 2DEPA 3PVFA 1K6QH 1AGEA 4LIQH 4ZCMA 1KB3A 3CT7A 1MPAH 2JJVA 1GJUA 4K0OA 1HVQA 3H70A 3KVMA 2WXFA 1CGSL 3QDJD 1T7XA 4J7RA 5EEUA 4K9EC 4I0PC 1FC1A 3QZPA 3L12A 2QCDB 2VSDA 3SZKC 2QUVA 2XG9A 3L5LA 5GGTA 4XKWA 4JTLA 1LK3H 3JV5A 3BUDA 3E9UA 2ACSA 2CERA 2MNJB 4HSOA 5C9JB 3HVDA 1U8OB 2Y3NA 4UMGA 2DT3A 2X16A 4DVOA 2V3FA 3RLGA 4AT6B 1SY6L 2XQYG 3BP5A 4K2UH 1FBIH 1NKRA 2BZCA 1OYAA 2N3JA 2O6DA 5GJSL 3V4UL 1NKGA 3DMMC 2IQ9L 3QUKA 1A3XA 3O3BA 4UQ9A 4Y9PA 5HJXA 2WAGA 5IXEA 3CGTA 4OZ4A 2J8UB 3PWJA 5BJTB 3O45B 4MJ2A 4HUXA 1WFJA 1UWTA 4GVGA 1GYUA 1I9IH 4WFHE 3L3GA 5HDWA 1K4CB 3WO4C 4PC6A 4Q8VA 3BUIA 3O11A 4AC4A 3GBEA 4R7LA 3CLFL 2OOFA 5HQEA 1AQKH 1M7IA 1OD9A 3WXWH 2B7DT 5DVPA 3VUPA 1GOGA 4MJIB 4BFRA 4MA3B 2J3SA 3UJEA 3ZIAA 3LM3A 4U1SB 3H23A 4GABA 4H6RA 3WEOA 3GXTA 5J3HD 1ONXA 1MCOL 3I9IA 2DERA 4H8HA 4F7EB 1CI1A 1VFMA 4GQNA 5I3GA 1A80A 1WISA 4H2HA 4I4WA 4A3YA 1YTEA 5TDNB 1E6OH 3IN2A 2ZOLB 3MV8B 1FZJB 4KVCL 4X6BB 3EMQA 1E4MM 3F58H 5J3HC 5CINL 3COOA 4AKOA 2XWRA 5I9QC 4LSPL 3CCVB 1BPLB 1R3WA 1H51A 2OMAA 4CD5A 4PJFB 1KEML 5DMJB 2QQKL 1QNVA 4Y2OA 4C83B 3BGFB 4FIQA 1VPQA 4ES4A 2I26N 1NEPA 2YXOA 5E5CA 1FLTX 1L9MA 2Y3AA 4GMTH 4BK5A 3O45A 1XH2A 3W82A 4NYYA 3GKZA 2VUYA 2A9AA 1E71M 1IEWA 4OSUL 5CM1A 3HS8A 4ZTPH 1O12A 1UC6A 4GEJA 3FH7A 1Q0YL 4PGBA 3AISA 2YWZA 3QNZB 5F9WB 5FR3A 3F1QA 2AV7B 2P24A 4C43A 4N9GA 4NHCH 3WFZA 4OGYL 2BWQA 1Q3NA 2F5BL 5JR1L 2W63A 1GS8A 2ESVA 3HMJG 2GITB 5KTLA 1E2WA 5CKAA 1IZKA 3S3PA 3R6IA 2BPOA 4NHVA 4NCNA 1PZ0A 4N4QA 1CCWB 4M56A 2VRJA 4QEGA 2YB4A 3MJ7A 5GRVL 4HWBA 1QFYA 3FBKA 5AYTA 4AGQA 5LDUA 2GVGA 4OLUL 3W26A 1QR4A 4UU9A 1LMKA 5EO0A 4H41A 4MA8H 4PLOB 2ZRWA 5BOEA 5LA0A 4K1XA 2YD0A 1WDWA 3C9NA 3DG7A 1FLRL 4NQEA 5HHPA 5FPIA 4FX8A 3B9KC 1I7TA 5CLWA 4AOFA 1OM9A 2WXJA 1E5BA 3UYRL 4N90E 3VRIA 4ONHA 4AIBA 1DDHB 2ZPKH 3IS1X 1DWIM 1KBWA 1VGEL 5C09A 3OKOB 5GGRY 2WZPD 3V5DB 3DYPA 3CMEB 4JHWH 2VEIA 3RYSA 4AVKA 4AZ6A 4MX7B 3Q2DA 2QEJA 2DTSA 4WDXA 2LABA 4ODUA 3QO1B 3TR9A 1HILA 1DWJM 3SJVD 1US2A 1N6UA 4MKNA 3IJ9A 4OGQC 3A6CL 2BJMH 5CG7A 5C7VA 5C0JA 1N4XL 3GVWA 4MLSA 3L9EA 4PP2A 3WEMA 4MA7L 4H8WH 3ONUA 1VQOB 1AS7A 4U0RC 3DWTA 4HC1A 3T44A 4ES8A 1GKRA 2VYQA 1HU8A 1VBRA 4UCFA 4ALAH 1WTLA 4H7VA 1KJ2B 4XNZC 2N1KA 4XI5D 1FRBA 1BVNT 1XB3A 4IMDA 3VNMA 4WY7L 1H5BB 2CLRA 3WJSA 2E4FA 4TUKH 5T8GA 1D5ZB 4U6XB 4A39A 1XSJA 4M7KL 3U2SA 1WX0A 5F7DA 1LYXA 2BSCA 2OCZA 5DC0A 1E8ZA 3CXOA 2GJ6D 3IUDA 3KX6A 5D4YA 3SM0A 1UZ1A 5CD3B 2R0LL 2QTEA 2CBPA 4YK4B 4BD4A 4M7ZB 5L4IA 1YJ9B 3C60B 2RJHA 5CEWA 4EO5A 1CPUA 4GVIA 3ABQA 4Y4KD 3CFDA 3ANUA 4JG0H 2PF0A 12E8L 3P9LB 1W2BB 3KXFB 3K71B 1I0BA 2NUYA 1IAIH 4WI3A 3CE1A 1HSAB 5JDSA 1KFAH 3FT3A 4H6KA 4NZ5A 2ZKHL 4NM8L 2Z92A 3QMTA 3I9PA 4S3KA 1MFUA 4AQAA 1NIUA 1BFOA 1KBPA 2ABAA 3T0EB 3UJIL 4LOCA 4ZFOL 3OYXA 4POYA 5H8UA 4FQIL 5TIMA 4S2BA 1MLCB 5CSYA 1U33A 3VGGA 3X17A 4X9IA 5DO2C 3VOHA 1BG9A 2GJJA 4RRPA 2Y63A 4WV1C 3B43A 2G4EA 1OINA 4HHMA 1XR8B 1HNFA 1G6RL 4AHPA 2PWDA 4ORGB 3V18A 1N82A 3TLRA 3UTPD 1W3IA 4NQCA 4ZOAA 4JFFA 2FZ9A 2GQFA 2APBA 2PXYB 4H8WC 1FH2A 3MYJA 4M7ZC 4ZMVA 1EXHA 2Y89A 5GXBB 3EA3A 4RJEA 2HKFH 2NY0C 4DPQA 1BECA 1Z32X 2DZSA 1OGGA 1T1YA 3C6SA 1BZDA 3CCUB 1DE6A 1C8PA 2P53A 4WKFA 3QI9A 3M1CA 1T7WA 2X7LB 3OF6A 5CSZA 2WLIB 1SFHA 4X0KB 3VGAB 1L6WA 2IIJA 1FZKB 2VEFA 2OI9B 4O4WA 2FX3A 3C2SA 3DDMA 1FNDA 2IMNA 3GC3A 5ECUA 4HK0B 3UIZA 3P84A 4E8DA 4MJ4A 3G04B 4GBDA 5LG6A 2B1HL 1ZXKA 2QVTA 1MEXL 2ZD0A 3BN3B 5J7CC 4Z4YA 1K8XA 2JEQA 3ANVA 1FUNA 1AO7D 2F1BA 2VUOA 5A2KH 5KZCB 2J27A 1ZGLB 3OVUB 3N9SA 2C9QA 2PD9A 4DAGH 3B2MA 1BKHA 2KPNA 5LNWA 2E6YA 3DFPA 2ADGA 1O7SA 3BT2L 5FKAB 1AGBB 5IROA 4G1VA 1LQ0A 1GZHC 1UT9A 1XB8A 5KVFL 4U1GB 3LGGA 3NZ1A 3EA2A 1J0ZA 3IIZA 3R11A 4CEXC 3HU7A 4YXGA 3JT0A 1BW8A 3QYNA 1HZLA 3T6CA 2NZ9C 1DVTA 3EJSA 3RL1B 5H6HA 5C0EA 4JTKA 4AF0A 4FFYH 4BV1A 5HANA 1EB3A 3AUJA 4B48A 3GR4A 1ADQL 1CJYA 4XSMA 4BKLA 2DIEA 3OJDB 2YHGA 3SR7A 4NQVA 1IKNA 3FCSA 4LHQB 5G1TA 3BFOA 4PP1C 5EKYA 2A6KB 1AG1O 4Y0GA 3EO1B 1H85A 4UILL 3X1EA 3POCA 2NY5C 4C6OA 5T3XL 4TN9A 3LRSA 1IQ8A 4N0FB 1TMHA 3TEWA 3OG2A 4UB0H 4PUBH 3RVXC 4CSTA 3QFTA 3II3A 3BIKB 1Q8AA 3GWQA 3EGSB 3SCNA 4XMXA 3WK3A 3OL2A 4K3ZA 3L4CA 4Z4TA 3IETA 2BMWA 3KLHC 1TX2A 1LWHA 2YMXH 3KLKA 1XYBA 3RMJA 1JMXA 1KENH 4PJ9B 1OE2A 2AQNA 4B9GA 2KC0A 4ZMWA 4F5CA 4DGYL 1QK0A 1TPH1 2X2JA 4MRCA 2QULA 5IM7A 4JTTA 2ADGB 2BCKB 3QZEA 4ZQCA 4U1GC 3RP1A 1MOEA 3WE6A 4TTDD 5F9WC 3KBVA 2FB3A 4EK7A 1I7RB 4NUPA 4S3BA 4U6TA 1JCYA 3WDRA 2DQIH 5I1LB 4XH2B 1ZE3C 1BDYA 1TUPA 5KUKA 1UROA 4WDWA 4JRXE 3FOKA 2A4AA 2FL5A 5IEKA 1HXMA 1QSEB 3KPSB 1YXYA 3MJ8B 4N4PA 3WJLA 3MLWL 5E7BA 3LD8B 5ESVA 4S39A 3W3BA 1W0KA 2PP8A 1H09A 4JNYA 4DGIL 5D33A 1ZANL 1BXXA 3L1FA 5EB9A 1NB0A 4GUPA 2VH5L 3BGFC 2DUZA 3TA3A 3USZA 3L7FA 3B56A 3HO8A 4RGMB 2A38A 4PJCB 4XX6A 4KWVA 3BVJA 4JY4B 4R2GB 5A40E 3BWUC 1BVWA 4YU1A 2ICWA 3S8HA 4KPHH 1IL1A 4H26A 3WHXA 2AV1A 3HHRB 3LB6D 2YCLB 3LMZA 3MQTA 3HI6L 2WR8A 2QCMA 4J8RB 4NKIL 1NDMA 4XBPA 4OUUB 3Q9PA 4XZ4A 4AHQA 3JVGA 4U0QB 1CFQA 3HUJF 4XPFH 1AQHA 1AFVL 2HX8A 3P1VA 1RZKH 4AGOA 2G2RA 4OKVB 2HLEB 5JOPD 1QR1B 5H37H 1FUYA 1FWCC 5AYZA 5LMZA 3W7NA 4PJEE 2PR4L 3GB7B 1EP1B 5A88A 4WIQA 3W2IA 3ZOAA 3SDDA 2OGYA 2NQZA 2FFIA 4NQ1A 3UXLA 4JZ5A 5MP6L 4FO4A 5LCVL 5JXEC 1MI3A 4UV4L 1MRCH 1AD0A 2MJWA 1QPPA 4G1MB 1IGYB 2BIPA 3AACA 4QO1A 4WUUB 4Y9GA 1NAL1 2YPLE 3MLUH 2GJXA 2C15A 2YKKA 3HG0A 1EDGA 3QQDB 5E0QA 1P4CA 3CXDL 1R3YA 2TODA 2IFFL 3KCLA 1G9HA 1TE1A 1G7PB 3WH7A 1ILUA 5F9DC 1FH5L 5I1AA 5I76A 3DCPA 2YDSA 4U1MB 2QJMA 3U57A 5B38G 2IAMD 3SO7A 2HVOA 2RUSA 1CLVA 2CSPA 5ISZD 1E6NA 4XB3A 2ACRA 2C3GA 4PY7B 2YCLA 1HKFA 1D5BB 1I3RA 2QADB 3GMMB 4MBOA 2VDML 2VKWA 3T5WA 2BVWA 5CEYA 3P30L 3GJFA 3JV0A 5EDSA 1XGYH 2QSCH 5FFOA 1GVQA 1CFQB 1U0QA 4XO9A 1TO3A 2GGIA 1QSEE 2X2HA 3KPSE 5IFJA 3MSYA 5T26A 3EHBB 2BH0A 3PWVB 5GSRA 3U6RA 3UBFA 1KTJA 4WDTA 1RZQA 1DBJL 3MBXL 3TXZA 1XIMA 1OK8A 2E86A 3ZUCA 1E43A 3FO2B 1KM2A 1X4XA 2CC2A 1KCRL 2P1YA 4B3GA 1CE6A 1T5XA 4X5WB 5JIMA 4HK3N 2FO1A 2O9RA 1EIBA 4XD3A 3PWUA 5E9NA 2DT2A 2FTWA 4GAFB 4PJAB 3IJLA 2V33A 4X8JA 4HD5A 2HWZH 2X4PA 1VAHA 3TTSA 1QOPA 4OM1L 4N8VG 4PCPA 2EIBA 2ZRUA 1MJJB 2V9RA 3NGBB 2I5YH 1NCJA 1L4IA 4MDRA 2DJMA 3TEXA 4F2TA 4F0SA 1KB5A 3BG3A 3ZE0E 5BWAA 4OF3A 3BZFA 4B27A 1U8PA 4TS6A 3E2QA 2EXSA 5EU7C 1U93B 4Y5YB 1LEKA 5DZVA 2GSIB 4ZPTB 4CCCA 3N14A 3ZE2F 4OFKA 4A63A 5EMMA 1IAKB 1RZIB 3JQOB 3MCAA 4X7EA 2DYPD 3IJHB 1XFBA 4G6CA 1ZHKA 5FKYA 3D2UA 1FDZA 1RQBA 2DWDA 1XLFA 5L8LB 2VOTA 5KBPA 2G2PA 3ALFA 4HS6B 4D72A 4OLWH 4FAAB 1DLFL 3D07A 4KERA 4XBMA 2J1KA 3GT6A 5I1CL 1OZMA 3MZTA 1T20A 1D7BA 3BO8A 4ODWA 1T0OA 4EN3D 1TIMA 3QPYA 3REQB 4E2DA 1G9NC 3SCMB 3EWCA 1EJOL 3JQQA 4ERSL 3UU0A 2CDGB 5I8EB 2VUNA 4WJG3 1A5KC 5CZXD 3NGFA 2F74A 2A21A 4Y5VC 3NJFA 4IGBC 3O6FC 5B1KA 43CAA 4JFYB 4GXPA 2Z92B 1ZA6A 3WQ4A 2CLLA 2CKSA 4LBAA 1FN4B 3DK0A 1ONRA 3JWNG 5BXRA 3W74A 4BH7A 2XIQA 4CQ9A 2DBJA 1ND0B 1TITA 2WTOA 3DVGA 3F7YA 4E2OA 3RU6A 3WLHA 3S5LA 3RNKA 5FW8A 4Z4SA 2H47C 3LERA 3N29A 1W72A 1ZLWK 3SBWC 1YZZA 5BOFA 5FO9B 3YPIA 4TVPH 3QPXH 3RFZA 1BM3L 2CO7B 2OW6A 4U6HB 2UZYB 3HNTL 2UXFA 4H20L 1U93A 1GPFA 3F2BA 3S47A 1IHMA 1F8TL 2CBQA 4X7EC 4B95C 2FNBA 2NY2D 3A6OA 1LORA 5C2BL 2VDLB 1WNOA 4B5UA 1FNCA 3DVNA 3AXHA 3QXDA 4IOSD 2RDUA 4P7LA 3NP4A 1CNFA 3TU9A 4LSRH 3PUEA 2OZNA 3M0LA 1RH9A 5BNKA 4IBTA 5IOPA 1TVHA 3FB6A 3W4RA 3WF2A 4CQAA 1A1OB 1P4LA 2YBRB 3HJ0A 3RY6A 3VGBA 3LHWA 3CCLB 4NFDA 4HJIA 3NFUA 5INDB 3D3VA 5C97A 2MTPA 3KBSA 1SMDA 3W1NA 4M43L 3L54A 3NQ6A 1ZIBA 2OO0A 3Q48A 3LXBA 4KJPD 2UZPA 2XZQH 1CC3A 1U8HA 2B2XL 3F64A 4LCQA 4LUTA 2HDNB 3ZZUA 3OZ9H 4HKJA 3W1TA 1B0RA 1IGCL 4WJ5B 1G4PA 3T05A 2YEVB 4NASA 1R9FA 4KWWA 5E70A 3PY2A 4MXVF 8TIMA 1LLAA 1U42A 2FX8L 2OKOA 2KUTA 1DVFB 4EF8A 4EF9A 4DFIA 2C1GA 3VE0A 1K77A 1D7DA 3FH5A 2XX1A 5D2LB 1JVKA 3BH9A 4ZZ9A 2WCGA 1JPGA 5TD4A 3H21A 4P22A 2CA3A 4MAYA 5L88H 1X7TA 1T6ZA 4L8DB 5AVVB 2I9TB 4IBUA 1J2WA 4JKLA 1L3WA 3CAKA 1O6TA 4OHQA 1VPOH 2XYCA 3GPSA 3VSTA 4UMAA 3MLRH 3TNBA 5TQ0L 4L1DA 2OYMA 3OBEA 4NC1E 1UZ8B 4X50A 1GAFL 3MKVA 1KCVL 2YYTA 4LARL 3RWGA 5CMAA 1R6WA 1XL4A 3WKZA 1TMCB 4MXQD 1GOFA 1ZEAH 3QUZC 1DJYA 2XYBA 4GG8A 3IJ6A 1RVFL 5TGBA 2DQMA 4AYBA 3PWIA 1A7NL 4Y1AA 3U0PB 4UQBA 2R14A 4NCC1 1B9BA 5J5RA 4JMNA 3CP8A 2F08A 5HHNB 2PDXA 4J3VA 2WWDA 2YCEA 4PC8A 3PN8A 2I56A 3II1A 1E4XL 4RAVB 2B3RA 2E75C 3QUYC 2EEFA 2ZBTA 4DM2A 2X1TA 4GY4A 5I6NA 5F8RC 4PLJD 2APFA 1MCWM 2QLVB 3EFDH 3D48R 5CAYB 1CL7I 3LLFA 4OOUA 5CGTA 3FB8A 4AKQA 4PGCA 4E41A 4PV9B 4BDVB 3VD2A 3L7FB 2ZT9C 3A8JA 4IP7A 1A22B 3D25A 3ARGC 3AITA 1A4BA 4NIKB 3QEQB 4C4UA 4RQQA 4X0NA 5CBAB 1BBDH 1RK6A 2UZ9A 3VNJA 3R10A 1W3HA 1TTJA 4UBDC 1GJRA 1QSEA 1AKJD 3KPSA 3CPRA 1JHLL 4BY3A 3CWHA 3CSTA 3OZLA 3MLZH 2ZXHA 3QEGH 1C9DA 3GDMA 1A3WA 3ITTA 1XUUA 3C2EA 3NPSC 4OQVA 1MCIA 2DQTH 2FJFB 4P5SA 4TU1A 3I9GL 4ZSOE 3SUWA 7REQB 2HMCA 4ODVH 1HKLL 1DCLA 1A6WL 2V9QA 1E5NA 4Q89A 5I0VA 1QNIA 3ZIYA 1FDYA 4UR7A 4F2EA 3WHXB 4Q7IA 1GGOA 4CJ0A 3QORA 3NJ3A 3V79C 3ALXA 4FZEL 3NIFB 3THQA 3AI0A 2VE6B 3B9VA 4C6IA 1LO5A 5KVDH 5CJOL 1U2HA 3E5BA 3F4NA 4AMCA 1VQMB 5IP4A 3MW7A 3U9UA 1AOZA 1J96A 1OP4A 1WA1X 2DZPA 2GY5A 4KV5E 2DP3A 2VSCA 3ONBA 4LIQL 4N1EA 3ASNB 5C2XA 5E94B 5TK2A 3VH8G 1LLZA 5F1IA 5HDQL 2EDFA 1FO0L 1E6RA 1TENA 4RZCA 2YW3A 3NRQA 2GYIA 1EERB 3LDVA 4P23C 1WQ5A 3UJSA 3M6DA 3H4XA 3IB4A 1WAWA 3W38A 1DLHA 2WTRB 1BQCA 4HPOL 4I2XE 4ZTEA 5DEGA 2C2WA 5KSVB 3NUKA 2V81A 3LPOA 4HGWB 1MSSA 2VISA 4MNQA 1PTGA 1JYNA 1BRLB 1SXCA 2FQDA 3HTWA 2AKRA 5I1AB 2NUWA 1EPVA 2AGTA 5ACMA 1Z89A 1ZBVA 2ZQKA 2JV6A 3WF3A 4K2UL 4CW1A 4ZX3A 4LF3B 4B0MB 4E9RA 3D12B 4NSKB 2KZHA 4LRSA 3CHRA 4UZSA 2VKXA 1AQ8A 3CHCA 2PYFB 3ITXA 2MPAH 4OCWL 1AH1A 1EK3A 4DB7A 1ERNA 5LIYX 1QR7A 4OTKA 5JMUA 2WHVA 4HEME 4UFLA 1E3XA 3DX0A 5D9OA 4F37F 2OEMA 3AB0C 1S2AA 3HQOA 4A8IA 1OGJA 4GT0A 5HY9B 1IB0A 5L4MA 3P0XA 4A68A 4HYRA 2Z6BD 1I7UB 2NY2B 1ACCA 1I9JH 2VDRB 4H44C 3T08A 5K1NA 1JCNA 1YADA 3JR2A 5A94A 2QDDA 4JPSA 3T56B 3VIMA 1ZHBA 4HNOA 5CG0A 3DO7A 1KCKA 2E1WA 4Z4ZA 4DHLA 3QUML 2EDXA 4YZFE 4L0ZA 2C5BA 1B9KA 3VVWA 1HXYB 1E15A 3NZRA 4IMAA 1A8ZA 5D7JC 4RISL 4JPKH 4ZX6A 3GZPA 5KBLA 2CZNA 2NYYD 3MR9B 1CGXA 4JR9L 5ELIA 1O5KA 3L0GA 3JWOL 1E6OL 4Y9NA 3WF4A 2MEJB 3A4DA 4H6EA 2QGHA 3T3MB 1OZUA 2XJKA 2VDHA 2R2BA 3EOOA 4W89A 4DJEC 5CC7A 1CYGA 5CINH 2A74A 3QH3A 4IKIA 4LSPH 3ITOA 1KEMH 2QSVA 5KYUB 3IDGA 1RP9A 3SSGA 1K9DA 2BG5A 2PYFA 1XC6A 3ABKB 2VLRB 3CH1B 3MRIB 5IFAL 5JW3L 1AD4A 2BVDA 1DQXA 3V76A 1ETJA 3HC3L 4QT5A 3FQXA 4WHTB 5GS1B 4DJMA 5BO1H 3ECWA 1KG0A 4WO4A 1H7OA 4AQ8A 2QDGA 2UWFA 1JNHA 4L9YA 4QVJA 4OLZL 3U0TA 1Y5XA 4IIBA 1OB1B 4OSUH 5F7LB 1JXJA 1SW3A 5CEZD 4LBVA 1BVKB 1G6VK 2HFFB 2WB1A 2YD6A 3O2DA 1V7YA 1PMYA 1FVCA 1BJ1J 5AVWB 1MN4A 1NC2D 1BQLL 2X4NA 4PMJA 4NHCL 2C1IA 3T4AB 1BFSA 4WZEA 3ZYOA 3HB9A 3B0XA 5FJRA 3DV4A 3MDJA 3CO4A 1M1SA 3N6YA 1JWSB 5D7JA 3DDYA 43CAB 3P9MB 1LWIA 4ML9A 1LNUA 1FDRA 1E9YB 3B2PA 3MLVH 5E8OB 4X98A 4F7CB 4K7PY 3HI1A 2VLME 1ND0A 1K5NB 1KM3A 1I75A 4DJEA 4XPAL 5HNRA 1ECYA 2EUZA 4WW2A 1EZVY 1IEAB 1D9KD 3QM3A 4YHIB 1XIHA 3J8F7 3GMPB 1VRXA 5KYNA 4KNQA 3WEXA 3O9WD 3O1NA 3TCEA 2PKDA 5KSWB 5AWNH 2IH9A 3BGMB 1I3GH 1OCOB 1UA7A 3GHEH 4LOEA 5LXXA 1S7XB 2WXQA 1FH7A 3GNOA 4GRLB 2DI9A 4IBSA 5DVMA 4AQ8C 1ODAA 1X7QB 2VC2H 2P47B 2VQUA 2ZPKL 2YSWA 4QXTB 4Q8NA 5DURD 4Z1PA 2VDNB 4BR1A 1T83C 2RIKA 5TE6L 1J8RA 3QUXC 5TF1L 3LZFH 4O1DA 4QROA 4TX8A 3LH9A 4FMFA 4QXUH 1QUMA 1ADOA 5AW2B 1B6UA 2D0GA 4XAPA 1MREL 3F7LA 5AY7A 5LBSH 4HEPA 3WBJA 5DCCA 3GRIA 3STCA 1GGBL 3T4AA 1EKOA 2BJML 2YXVA 3W73A 1IUZA 3LM7A 4U5KA 4N1HB 2C34A 2X2YA 1V0FA 3TONA 1AKJB 1FCGA 1S9YB 3HMXL 3HHSA 1F2JA 3RM9A 1KXQA 4WWOA 5GGSB 4X83A 1R3QA 2WINB 2ALAA 5EFDA 1IWBA 4ORIA 5FYKD 5J6GA 4PB5A 5E6YA 1IEBA 3C6LC 5BROA 3UWUA 4BF9A 3R7MA 1KTDA 4YNYA 3PP4L 4IIFA 4M1KA 1D6EA 3PTKA 3LTSA 5FO1A 3W2GA 3F5WB 1CW2A 3O9NA 3MUUA 4QFUA 4W86A 4RNJA 3VOIA 4WSKA 4LCCA 4HS8L 1JL8A 4G80B 4R26H 4UT6L 4DP1X 2I07A 2PTDA 3MCNA 1YJDH 4Z0SA 4KRMB 4RAUA 3UETA 4I3RL 2E76C 4FCAA 4L8DA 2I9TA 3QG7H 1TZZA 1BV8A 2A79A 1X5XA 2PDWA 2VDOL 3O4LA 4LCIL 1NJJA 2VELA 3RGVA 2X7VA 1TV8A 4XLHA 1M6OA 3BMXA 4HIHB 5KVEE 3CCMB 4GMSH 4XNYH 2LLNA 1Y6MR 2D0HA 2HT2C 4R9HA 12E8H 5CHNB 1JPIA 1SO3A 3WJJC 3DIDA 4KZDL 4YIQA 1IAIL 4OFIA 3B0YA 4H25A 1UOZA 1KFAL 2J9ZA 3ARQA 1IEHA 1ZFJA 4LL4A 1EP2B 3TA9A 4URKA 4FXFA 4W87A 4MNGA 3RYMA 3ABSA 4WFGE 1KIUB 5SWQA 5SV4A 1F6YA 1NQKA 6XIAA 1OT2A 4PD4K 5HP5A 1C5DA 2DJLA 3DX7A 2CESA 5H2BA 3MDUA 4JAWA 3STZA 2D7QA 3CDGB 2A5UA 2ZBVA 3CUZA 3D08A 2Y07H 3BPOC 3REWB 2IAMB 1E1EA 4N6EA 4QGYA 2YPVA 5D72L 2BNRD 3QRHA 4MNQE 2W94A 4DVBA 5EOCJ 1YX2A 2OVLA 5ECVA 1ZLSH 3K1KC 4R34A 1BPLA 1ZJIA 3M0KA 1LO4H 3K6SB 4QJ3B 3PG2A 5LUMA 1E55A 1FNGB 4PTTA 1RP8A 3PWAA 1WIOA 5M94B 2X6BA 4PG9A 3QF0A 5BPPA 2FJFA 2BHZA 1KCWA 5LHEA 4AQEB 3GSUA 4HSCX 4OY9A 2WO2B 1FGNL 1P69B 1B4RA 1JUBA 1FHNA 2JKLA 5KG9A 2CBJA 5GNYA 5IW1A 3H6JA 1E4XI 2OMBA 3QZWA 5BO0D 1YRRA 3M0YA 1JTPA 1KJ2H 2IVFC 3RG6A 1SOQA 4HIHA 2WZHA 4UCGA 4I18A 2AJSL 3SE4A 4DEPB 5IKCB 1KFGA 4A2DA 1H7RA 3H7RA 1I2PA 2JBMA 1JVOA 5DD1L 2F1LA 1LD9A 3J07A 2W79A 1FFPA 1DL7L 2CHWA 4MS8C 1SRDA 4WZHA 4GYBA 5I17B 2ZAHA 2WIIB 1MY5A 1XLGA 3W22A 2G0LA 1U3HD 4N2DA 1XZ0A 1QVFB 5FV1L 1S2TA 3ZL4L 1HXKA 4MYXA 5CCHE 4IK6A 2TRYA 3I55B 2ZKMX 3CX5K 4WNJA 3BGGA 3HNSL 4IP4A 2ZUXA 3B5GA 4M93C 3M41A 5IFPA 3LN5B 3V0JA 5HHXH 2ZSWB 3HJEA 1W72L 5IEKB 4HUVB 3KBHE 1QP1A 4GSDH 4KI5C 5M95B 2ZADA 1LO0L 1WV7T 1PIIA 2OU4A 2X1RA 1GS7A 4PR5B 3UEZA 4ADUA 2DWSA 2NNXA 3VRIB 1OX4A 1P7KA 4EZJA 5I19H 1EMTH 4F2MB 2HKHH 2RDTA 1M53A 1G4RA 1ED3A 1T80A 2JE8A 3SCMD 4A6YB 3MRHB 3P67A 2BNQD 3Q37A 1G7SA 2X1XR 4NKOB 5EC2A 3QLDA 4MFDA 3QZLA 5F3BA 3MMEA 3IGHX 1IL1B 4NG3A 4ALDA 1GIGH 4GW1B 1AZZC 5AVYB 5MI0C 3ZWSA 2J5LB 3ONCA 4GE8A 3OW7A 1F4HA 3UMNA 5IB1B 3KWVA 2BY3A 1UKSA 3HTLX 3W11C 1M3IA 2AQ2A 2JQMA 2JJTA 3L95A 3EYQC 4EI0A 1GAWA 1CFBA 2NQDA 1HFUA 1ODUA 2CUHA 3MV11 4PUBL 5H37G 1Q9SA 2XEXA 2BOBA 3U6XA 2Z31A 2WXNA 1MG3C 1NDGA 3BE1L 3UZEC 4DO4A 5LA2A 4D6HA 1NCAL 4F8PA 2AJZB 1UWGH 1Q81D 1DBAL 2JJUA 3B2VL 3Q3GA 5DD5H 5GSVA 3UG4A 3WENA 4CSSA 5BXFA 2RKXA 1KENL 2BIQA 2X6AA 4ZPVA 5EU4A 5BXPA 2M26A 2V5YA 4DF0A 1AW2A 5J11B 1UM4L 1KLFA 3BH4A 2WUCH 2ZOWA 4OFPA 3GU1A 3IVSA 2VDKL 2BV3A 4CVXA 3FHEA 1PAMA 1LOLA 3TYDA 4RDLA 4NX5A 3QUZB 1ISXA 4LGSB 1RA0A 3GVGA 1PHQA 4FZIA 2DQIL 4C4KO 1KY7A 4N0RA 3VGHA 1E4WH 1JZ6A 2E1BA 1IB5A 2VABB 3SKMA 4JY5H 1O7AA 4I9JA 4RCAA 4MQTB 3FFDB 5SWSE 1IGWA 1CX9A 4QXIA 4M61B 3SJZA 5E6SB 3UAFA 4BSJA 5CIPB 4DCQB 4EIZC 2D3JA 3MLWH 4GG6E 3IDGB 1HFBA 1QWKA 3VUSA 2GCYB 2H1LM 4LVEA 4TTDC 3BQVA 3H9SA 4DGIH 2FPTA 1FVEB 1ZANH 3FYOA 1ZTMA 3BCFA 4ZO8A 2F1MA 5JPMC 2BVPB 5DUPL 4WHTA 1MW3A 3WHE0 1KC7A 1E2ZA 4XP5H 2BFGA 2CJSA 2Y36H 3FF7A 4GBXA 5I78A 4OZFG 3Q01A 3WMBA 3N9RA 1OTSC 3IN0A 1Y18A 4IQHA 4ELMB 3C0JA 3N1GC 4IGMA 3HR5A 5H2ZA 3JXAA 1L9QA 3GNXA 4TMZA 2VR6A 5HMEA 3ZL1A 1A02N 3LVEA 5FLVA 3HI6H 3IEBA 4OF0A 1AR1B 4NKIH 4NZ8A 1WDQA 5LN4A 1JHKH 4J27A 1ACXA 4NZFA 5IJDC 4DUXA 2BBFA 2ZF8A 1AFVH 3KPMB 1RZKL 2VDMB 1H63A 5EU4B 4RNHA 1EWYA 3AIEA 3RHWK 2HPIA 3TPUB 5I8KL 3O8XB 3NR0A 2N0MA 3FJOA 4M53A 1NPUA 2XTLA 1G4EA 4Q74A 4W6XB 4DKEH 2C7FA 4EAEA 1MJJA 3A67H 1KM0A 4LLMA 5LCVH 5I2IA 4UV4H 3HOJA 4L61A 4TMBA 1DUZB 5JIQA 3C4UA 2P5PA 4FFZA 3BSHA 4YBHA 2LAGB 2NNAA 3KBEA 4YHIA 2OSXA 4XPHH 3L7RA 2ZZEA 1N3NB 1A6TB 2EABA 4N5UA 2J6EA 1OFPA 3GGWB 3L6FA 4PWHA 5GIRA 2OQJB 4ROQA 5K9XA 3KJ4B 2X4TB 5FO7A 4R0LA 1X7IA 2QL1A 4OLYH 3UPBA 1TV5A 1MCQA 4LRNL 2BV9A 1RFDL 4IJ3B 4F7CA 4A22A 1RY8A 3SB3A 1Q9LB 5E1GA 1MFEH 5FA3B 1VCBC 3U1SH 3ZDYE 3MA7B 1SO4A 4HT3A 4BS0A 1OAUH 4OV5B 1SFTA 3NWRA 3MRMA 5MEPA 1DPMA 3O6YX 3Q2CA 1GGTA 5K1VA 3MV01 1NELA 2QVMA 2C9VA 4AK1A 5LGJA 1A4KA 3T4YA 3UTTE 1IC4H 2VDMH 1UR4A 4UTHA 1N59A 2HVNA 5FGBC 2XWZA 1ZA3A 2XIMA 1NMAH 2JWYA 1TTRA 1AZUA 1I1FB 1E3FA 2NTSP 2YBGA 1DFBH 1N08A 1F4WH 2HUHA 2YAOA 3MBED 4WI9A 4ACZA 5KWYC 2VD8A 5IB3B 2EILB 2ED8A 1SHWA 3ZHDA 3KOZA 4UFMA 3GG1A 3FCTB 3QEQD 3MBXH 4FG2A 3MT1A 3O63A 4RWYL 2VYOA 5L2JA 3RVUD 1X1NA 2XSBA 4E5XB 3MTXA 1DVSA 1KCRH 3PGFH 4I3SH 1JRHH 2FJGA 2OXGA 1VFSA 5EEWA 1YKWA 3ZT7A 3NQDA 2GTZA 3CSGA 3L4ZA 1JV2B 2ZXAA 5T9CE 2NNAB 4KKAD 3CCSB 3LCWA 2O5YH 3QJRB 3KYMA 4PJHE 1XGUB 2CR3A 4M9PA 4Z7OE 5A2BA 4H9ZA 3K8MA 2DOGA 3EO1A 3EOAA 1TV3A 3VNZA 5GGSA 2ZNXA 3EGDB 3QDME 3GSNA 4PJIE 4RLDA 1LBLA 3FO1B 3FY1A 2NY1B 1U3HA 3WLBA 2GUBA 3W01A 4C65A 5LIXX 3TBYB 1HHGB 4GJIA 4YE4H 3S5OA 1AHKA 4AITA 3QDMD 4QTGA 3NPSB 4E4FA 2XQBH 4LEXH 4NKMB 4GY0A 5D1QE 4XNBA 3QC3A 3S98A 5BV7H 4J5VA 1KYFA 4ZXBB 1FZMA 3IMBA 2UBPC 2PWHA 3C2FA 3FX4A 3VNUA 2WQUA 2Q6IA 4PTUB 4YDVB 4IW3B 3WI9A 1E1CA 3LEYL 1LUCB 5C0BD 3TJEH 2C3VA 4RCZA 1KELL 2VNIA 1MIEL 2NMSA 3AWFA 5D6DA 4D0BA 1HKIA 4QHLA 3CMFA 3CHDA 3TM6A 4IRSC 4P2VA 1BEUA 3FCTA 3FC8A 4FNLL 1NDZA 5LDSA 1YQVH 2J12B 3NDZE 5L4FA 2VZ3A 5IJKA 4ELDA 3S5LG 1XRFA 1W34A 3C9NB 3GR7A 3TJPA 3ZHNA 4MNHA 3W7HA 2H6OA 2P8MB 2XETA 3CH8A 3ES9A 1CWVA 2VQ4A 4OCXH 4XXCA 1IXNA 3P2VA 5K3VA 4HJ0D 4JFED 3STBA 1FFTB 4WTWA 1V03A 3QE2A 1K1DA 2JJWA 2WPBA 1ES0B 3BCDA 1NLDH 2M5SA 3QR3A 2F54D 4X8CA 1INDH 3ABGA 4Y1SA 4QVAA 3QPXL 2X6UA 3K0YA 1BM3H 1T6MA 5DU7A 1UUSA 2WKOA 4RAHA 3TOPA 3VXMA 1XL6A 4H20H 1HHGA 2OXHB 2AV1B 3FFOA 3V0HA 1LG1A 5ITBH 2HT4C 5EMJA 1MDTA 2H45A 5FLUA 1IBGL 1SLWA 3H56A 5A2AA 4BQ8A 1P0NA 3AUOA 4HK3J 5LIWX 2CRZA 1I1AD 2QQLH 1H42A 2E7BA 4PSPA 1ADDA 1J05A 4O28A 3FPKA 2ITCB 2WOYA 1PS3A 4LLWA 5B7FA 3MSRA 1R0MA 1IC1A 4QOKA 3AWGA 4X05A 2G3XA 2V5LA 4KDTC 5D1XC 4M8VA 4WCYL 1OCQA 4XOTA 2DW5A 3IK4A 3L3HA 4LAMA 1O6VA 25C8L 2FBJH 1JXGA 3GIVB 4JVPA 4R4FL 4R90H 3WH5A 3BURA 3BQJA 5KYWA 1P84J 1RZFL 3M1BA 5AHEA 4G2DA 1ZTXH 4PCKA 2V7TA 2ZUQC 4N8VA 4ZI8A 1GORA 1G7JB 1MEIA 1WWCA 3OZ9L 2TPSA 2XSAA 5I00A 2B9BA 5JHDE 2OP4H 2WSSA 1WXJA 2BXZA 2Q9OA 3DROA 1E30A 2JSFA 4KRPB 3FOMA 4NI8A 5AB3A 4EZKA 2DPKA 4PRDA 4W6WB 4QS6A 2JKSA 1U8LA 3P0YL 1S9VB 3SDYH 3QIUB 5L88L 2AVGA 5ID0B 3A3WA 1E6ZA 3MJGX 3L95B 3NSCA 1BD2E 3EJYD 1JRCA 3T65A 1AIPA 1H3TA 3VWKC 1A4MA 4B0MM 3OBKA 1JXDA 2L4OA 5GZNC 4FSAA 2OZ4A 5TQ0H 3ZRSA 1XX1A 3PUGA 4I13B 4QRQB 4ZG1A 1HKKA 3CUJA 2DQEH 4O0KA 2ZYSA 1POJA 1FNBA 1S7TA 2PF8A 1NBZA 4WEMB 2PTZA 2D7PA 3WTXA 1P9MC 2PRLA 1YQ2A 4MXWL 1GQJA 3Q39A 3MUY1 3EYFA 4NRZB 1SJHA 3C8DA 4XQ6A 1WHOA 4GYJA 3W27A 2D03L 1RVFH 2HP4A 2W6JA 3T0DA 1GR1A 3HC0A 4PGJA 1RZJL 4D3CH 1L7TH 1FGVH 2X1PA 2HMID 3BDXA 3PV6B 4XBJA 1YEGH 2E9GA 4O18A 3BUYB 4Z7NF 3FQNB 3WS6C 5K9KB 4KZEH 2PE4A 3WXVH 2NVDA 3FRPG 1OC5A 1J11A 1MCBA 4Z0BH 1V6YA 1PXGA 2RR3A 4FQXC 5EOTB 3CV1A 2WP3T 4ZPVB 2GKIA 1UCTA 3CBRA 1WBYB 3OAYH 2EDRA 2VWEC 3GHRA 5LAXB 1RL1A 3T8VA 4TV6A 4N02A 2CO3A 2Y62A 1V7ML 3NZHH 3B83A 4G8FA 4LYKA 4WXZA 4DI8A 3F2CA 5D8JL 1BZ8A 1Y07A 3R1GH 5BV7B 1Q8JA 4JPGA 3UXKA 2J2ZA 4JDVA 3QIBA 4BJLA 4PMXA 5AYYA 3AS3A 3IGFA 1MUWA 2AEWA 4X22A 2X40A 3U6WA 1PJ5A 3IKKA 4DCQA 3C8KB 5MEOB 5FUCC 2YDAA 1KYDA 4LLQB 1TQTA 4JZOB 1BYDA 5DSCB 3BZEA 2BIMA 2F6AA 4JE4B 2DOCA 4MJIE 4ENZA 5HYJA 3EFOA 3SDCA 1E5AA 3KPMA 4G8GB 1DQQB 5DRNA 3COTA 2WK2A 2L7JA 4UF7C 3KBNA 4DWDA 1HKLH 1MRQA 3RIAF 5ABGA 1FTXA 4GOAA 1S3TC 4PJIB 4FFYA 1DBBH 4TNEA 3F7YB 2LHAA 5HYIA 3WUBA 1RK7A 5JW4N 3DRTB 4P12A 3G5XB 3ULSB 1EJ7L 5C3TA 2H6PA 3WFHB 1E42A 3R8HA 1IAOA 1KLUB 5TFSL 1UJQA 5HGAB 4LC6A 5KVDL 1N3NA 3AXKA 4Q4RA 2J6VA 1ZHLB 3SO3B 1WH0A 2VMCA 1AK5A 3VZYA 4ZQOA 8PAZA 2HJLB 1S4IA 4M6OL 4X9BA 1COBA 4OOXA 1V7AA 2HE5A 3VB9A 4JY6A 1O0VA 4Q8OA 2ODHA 2QUNA 4NNPL 4WW2F 5SWSD 5C07A 5HDQH 4EI5A 3UBXI 1HHKB 4QUZA 4NRXB 4P99A 4PHZA 3V4VB 2FVMA 5DMKA 4S2SA 2J56A 4XMKL 4RMQA 1SQMA 1R5BA 5HHVL 3V55A 3H4HA 4DP2X 5BUPA 3L9RA 3QJTB 2VQTA 4HPOH 4G7XA 5JYMA 2NV1A 3DKHA 2ZXEB 4M8RA 1WZKA 4ZFZB 1QNOA 3RX5A 3P14A 1T03H 4JANA 4UTIA 3FQRB 2VJ0A 2YA2A 3EFOB 3SDCB 3C2AL 1ZENA 2ICSA 4JS7A 4Y9AA 4AB4A 4W9EC 5AAWC 1XH0A 4JR5A 3G08B 2NY0D 4BXSV 3IS0X 4XCCL 3DJ9A 4BHUI 5DC9B 2HT4D 1GT8A 2NY7L 2X6CA 3WQDA 2PO6A 3OGRA 1N5YL 5FGCB 1TSHA 2MHAA 3OEHA 4OV6F 3UTSA 4F66A 3H4WA 5CU5A 1E9OB 3ZBMA