1HVXA

Bacillus stearothermophilus alpha-amylase
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
483
structure length
483
Chain Sequence
AAPFNGTMMQYFEWYLPDDGTLWTKVANEANNLSSLGITALWLPPAYKGTSRSDVGYGVYDLYDLGEFNQKGAVRTKYGTKAQYLQAIQAAHAAGMQVYADVVFDHKGGADGTEWVDAVEVNPSDRNQEISGTYQIQAWTKFDFPGRGNTYSSFKWRWYHFDGVDWDESRKLSRIYKFRGIGKAWDWEVDTENGNYDYLMYADLDMDHPEVVTELKSWGKWYVNTTNIDGFRLDAVKHIKFSFFPDWLSYVRSQTGKPLFTVGEYWSYDINKLHNYIMKTNGTMSLFDAPLHNKFYTASKSGGTFDMRTLMTNTLMKDQPTLAVTFVDNHDTEPGQALQSWVDPWFKPLAYAFILTRQEGYPCVFYGDYYGIPQYNIPSLKSKIDPLLIARRDYAYGTQHDYLDHSDIIGWTREGVTEKPGSGLAALITDGPGGSKWMYVGKQHAGKVFYDLTGNRSDTVTINSDGWGEFKVNGGSVSVWVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
publication title Crystal structure of Bacillus stearothermophilus alpha-amylase: possible factors determining the thermostability
pubmed rcsb
source organism Geobacillus stearothermophilus
total genus 181
structure length 483
sequence length 483
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1hvxA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hvxA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hvxA01
5CSUA 3WF1A 3IGUA 3BLKA 1B3XA 2FDMA 2VX5A 4MNLA 3WNLA 4CVWA 4PRWA 2AOSA 7A3HA 1IT0A 1PPIA 3MUAA 3L2LA 4QP0A 2XM2A 5CG0A 1VEOA 4NXKA 1E5JA 2VRKA 1W32A 1R34A 2EPNA 3VIJA 5A3HA 1QNOA 2XUCA 1LLOA 5IFPA 1J0ZA 1UD2A 1UKQA 2V5DA 2YBUA 5HXMA 3ALGA 1UR1A 1D3CA 4AZIA 1BF2A 1GJWA 1WKYA 3WDPP 3RO8A 3CH9A 4BQ4A 1XYFA 4A4AA 1BGGA 2CHOA 5BYWA 1JD9A 1VJSA 2IUZA 3G6LA 5CLTA 1B2YA 4DO4A 4D6EA 3WIJA 1CGYA 4DWSD 2WAGA 1OM0A 3CO4A 1EHAA 1MYRA 1TZ7A 3WQ5A 2BY1A 1C8QA 3CZJA 2YDSA 1Q6FA 3T09A 2FGLA 3UCQA 1H11A 3E1F1 2GJXB 1EQCA 1BVZA 1VEMA 3WMBA 3SCRA 2WZHA 2VZOA 1FOBA 1GPFA 4LGXA 4NXSA 4AD4A 4H8UA 2XM1A 2VCBA 4C7DA 4TX6A 1SMDA 1KBBA 2X1IA 3AISA 1ISZA 4AY1A 3FHAA 1R33A 3VD9A 1PIGA 1GVIA 1G9HA 3KL5A 3NSXA 1B31A 4RE3A 2WM0A 3SCNA 3LX9A 3CMGA 4DO6A 3AI0A 3ARQA 4NZCA 1UR8A 3WQ8A 1CTNA 3N17A 2XVGA 2OYLA 1OIFA 1E0VA 4GI6A 3ARXA 3ZT5A 1VBRA 3ARSA 1HF6A 1TA3A 4W5UA 3W0KA 1UA3A 5HNNA 1JF5A 3BC9A 2WZIA 1HL8A 2QHAA 4HOZA 4PMQA 2VQTA 3PZIA 4U3CA 1UH4A 3U7BA 3ZJ6A 2X2JA 3W38A 1FH9A 3BVXA 2XVLA 4IUGA 3PZUA 3S6TA 4NSBA 2WXDM 2O9TA 1AQHA 1UZ1A 3D52A 4AIOA 1B0IA 1CGUA 2V3DA 3WFLA 3DHPA 3VDBA 3WH7A 4ZXLA 3WD1A 1JAEA 1Y7VA 1S46A 5JBDA 1CGXA 3IAPA 1H2JA 3AJ7A 5LA1A 4B16A 3VSUA 1AQ0A 4EE9A 4P7NA 3ZQ9A 2OYMA 4H04A 3DYOA 1JI1A 3WF3A 3CLWA 3RILA 3SUSA 4J3VA 1NOUA 4AIEA 2YOCA 2O9RA 4GIAA 1UKTA 3K46A 4MNJA 1ESWA 4PUDA 4NX0A 4EANA 2F7RA 3BVTA 1UWTA 2QF8A 3OLDA 1FFQA 3EDDA 1NWSA 2NT1A 3VPLA 1UR9A 4OOUA 3VSTA 3CBWA 5JBEA 2DT2A 2BVDA 2GDUA 3OBAA 4J27A 3MV01 1X6LA 2AMGA 2BHZA 2J78A 3SEPA 3TONA 1V3HA 1VEPA 1M53A 1I1WA 2XJ7A 2FHFA 2ZUTA 1QNRA 1Q6GA 4HA4A 4PBGA 2J75A 4GO9A 4UFHA 1J0HA 5DT5A 1B3WA 3HG2A 1W2PA 1QOXA 1D2KA 4JKLA 2GJPA 5CQ1A 3U7VA 3EYPA 3BSGA 1W3JA 1YHTA 4MADA 3L4TA 3KL0A 3WD3A 2F7OA 1KCKA 4V27A 4D71A 4MB3A 1CYGA 5FCZA 5HBFA 3WH5A 4C7GA 2WVVB 3W27A 5LA0A 1DWAM 1QW9A 1NM9A 2XWEA 4PN2A 4P7QA 1F4AA 2CIPA 3II1A 1GOKA 1RPKA 1E3ZA 2EABA 4AXNA 5C71A 1XCWA 4GZIA 4XZBA 3WD0A 3WH9A 1QWNA 1H0GA 2V3FA 2J7EA 1V3MA 3N11A 4F79A 1EOMA 1OSEA 1UKPA 3WF4A 3SCWA 1DWHM 3MMDA 5A69A 1QHPA 2DPEA 1XD1A 5E0FA 2CERA 3W53A 1C8XA 2V3GA 4NRRA 3WMCA 2WCAA 4GKLA 3WY2A 4F9JA 2TAAA 4FNSA 1MXDA 3GNOA 4AMCA 3N15A 2BY0A 1K9TA 1FH7A 1WE5A 4X9YA 1V0MA 2VRJA 1OGGA 1JXJA 3FNDA 4PMRA 4FLRA 4HP5A 2E9BA 1GJUA 4FNUA 2GVYA 1G01A 2VVSA 2VZUA 2F1BA 4UFIA 1LL7A 3BVWA 3OLGA 4V2XA 2WMIA 4CKQA 1E6SM 2VX6A 4GI9A 4PMVA 4Y7EA 2NT0A 1QHOA 5A6BA 3TV8A 3W6LA 1W3HA 5D9NA 3RM4A 3QGVA 3W24A 1E6QM 2XN1A 2ZXDA 4GQRA 3VDHA 4UOZA 3DECA 1KWGA 2Y24A 2YL9A 1NH6A 5M17A 3SCSA 4OBRA 2A3AA 1E6NA 3WL1A 3CUJA 1W1VA 1V6XA 1GHSA 1W91A 4GZEA 1MWOA 3EJQA 2J8FA 1VJZA 2JEPA 5A6BD 3B9EA 2QMKA 5HPOA 1QWUA 1WZMA 3APGA 1JDCA 3FN9A 3CHDA 3NUKA 1HIZA 3AIVA 5BWFA 3AIEA 3K8LA 1BHGA 1HT6A 2W67A 2XN0A 1TE1A 1JXKA 4CU8A 1J10A 2X09A 2ZICA 4OJYA 2UY4A 1R75A 4AZ7A 1ZBWA 2CETA 2ZUWA 4OUEA 1TQVA 2D0FA 3WNOA 7TAAA 2CHNA 4IPLA 1QI0A 2O9PA 3VIHA 4ZENA 4NF7A 4JIEA 1CGWA 4WJXA 1CXLA 1E9LA 1UKSA 3A22A 4YHGA 4FK9A 3ZOAA 2W66A 2DSUA 2XVKA 2X2IA 1EO7A 3VGGA 1G94A 3S2CA 4H8HA 5I78A 2DSWA 1HJWA 3B9DA 2WMKA 4JKKA 4XX6A 3WY1A 2E9MA 4UFJA 2AAAA 1H5VA 3IJ8A 3ZT7A 3FAXA 1MW0A 3BGAA 1CIUA 3AFBA 1MFVA 4Q22A 3VOCA 2F2HA 4GI8A 1CLXA 4HA3A 2WCSA 1V3IA 1E73M 3VMPA 1JG9A 1QX1A 2O92A 1PX3A 1D7FA 1CWYA 3IK2A 1HWWA 3POHA 1WNOA 3A47A 3BSHA 3GH7A 2E4TA 2EACA 1TQTA 5IXEA 3ARVA 4XUYA 3BXWA 1M01A 4W89A 1K9FA 2Y5EA 3TTSA 4QAWA 1VFUA 2VOTA 4FNRA 2WW5A 4M56A 4B9ZA 3PTQA 3WNNA 2WNWA 3RCNA 2YA0A 4AEEA 5BXTA 3UR7A 3MI6A 4P7LA 4OOZA 2VI0A 2DSZA 3WDRA 2YLAA 4JFUA 5IHSA 2D0GA 3CZKA 2ZWZA 1UASA 1C93A 1E1EA 1FHLA 3WH8A 3BCFA 1CLVA 2XGIA 1W3LA 4UZUA 1GQKA 3RJXA 1CNVA 3PN8A 4F66A 1DWGM 4UQEA 2ZIDA 3LRKA 2XSAA 1V03A 3AZRA 5FOOA 2F18A 3NSMA 2PWFA 5CPTA 2EJ1A 2UY3A 3IANA 4KH2A 5FKYA 2J74A 1KXVA 2J79A 2VR4A 3UR8A 4TUFA 3GYCA 2OW6A 2W92A 1LQ0A 2BFGA 4J3WA 3VX0A 3CV5A 2WC3A 3AS3A 5F7UA 3WNMA 4U5KA 1GOQA 1VRXA 3DYPA 2CNCA 3LPFA 4JHZA 4FF5A 5E0CA 1VAHA 4BQ2A 3WBEA 3HU7A 3VTRA 2VZVA 2PWHA 2YA1A 5A2CA 3NJ3A 3L4ZA 1CGTA 2V3EA 1U33A 5FD0A 1GCYA 2XIIA 3K8KA 1WZAA 4N0RA 2IGTA 2OYKA 3CTTA 6TAAA 3AIWA 1MFUA 4HMCA 3TP4A 3CPUA 3DC0A 4KGJA 2JF6A 3POCA 4MNMA 3AZTA 2JIEA 3PZTA 4RL3A 1J9YA 1KXTA 2ZXBA 5DT7A 2CESA 1W9VA 4P7RA 2VT0A 2Y8KA 3LXCA 4GO8A 5DF0A 1U30A 5JIWA 3T08A 3ZJ8A 5DFAA 4AZHA 1V6UA 5LYRA 1BPLB 1TQWA 4XB3A 1LWJA 5A8PA 2FHBA 1ZBVA 1E1FA 1EGZA 1HJUA 3HMCA 1MXGA 3JUGA 3J7HA 4AD5A 2D0HA 4AZCB 2ZOXA 4ATDA 1J0IA 4MB4A 4DWSA 3PZVA 3ALFA 2WVTA 1XC6A 3FAWA 3T2QA 3TTOA 3UG4A 1L8NA 3QOMA 4HMEA 1Z32X 3UETA 3AXXA 1PX4A 1ZS2A 1E5NA 3N04A 2Y4SA 3A3HA 4NI3A 3W6MA 4FNQA 4MJ2A 3N1AA 1GOIA 1C90A 3ARUA 1QBBA 1PJ9A 3W81A 1K9DA 5JUVA 4U3AA 1UHVA 4U2YA 1E15A 1WDQA 3GZAA 1W3KA 3RJYA 4AD2A 1TFVA 1HKMA 4QLJA 2NSXA 1XGZA 1V02E 2EQDA 3VNZA 2OWXA 1KCLA 5AC4A 3N18A 1OB0A 3NSNA 2J8GA 1BYDA 3AROA 3GXTA 3WFZA 3CUIA 5ABGA 3T2OA 2D20A 1QPKA 5A2AA 2X2HA 1GONA 1VFMA 5AY7A 3U5YA 2J62A 3N12A 2V5CA 5CZKA 3A21A 1BG4A 5KEZA 1JYVA 2A3HA 3L4VA 4PTXA 3CUFA 4LX4A 5ABFA 3PZQA 3CC1A 5GQBA 1JI2A 4AMWA 2D3LA 4X0NA 2BVTA 1HXJA 3K8MA 1IZKA 3WUFA 4KWUA 1H3GA 5I3DA 4A3HA 1OD8A 2PBGA 5GPRA 4RE2A 1DTUA 1ITCA 2XN2A 2XPKA 1J11A 5FL0A 3VINA 4LYPA 4BA0A 1V0KA 1HNYA 1E6RA 1KB3A 1C8YA 3WUEA 1HL9A 1LWHA 1JDDA 3MU7A 4QCEA 4J3TA 3BMVA 1SZNA 2WANA 1KGUA 1JZ4A 3H53A 2ZX9A 3VIIA 4W87A 4QCFA 1SMAA 4JHOA 4NRSA 2XIBA 4MPKA 1FP9A 4D6JA 3OIHA 4DM1A 4TOQA 1OIMA 4BS0A 2BS9A 4WSJA 4AMXA 3MUZ1 3LXAA 2W62A 3TA9A 4CCCA 3EMZA 3AMLA 1QI3A 4YHEA 1GZJA 7CGTA 3MSGA 1EXPA 1XRVA 1E71M 4ATWA 1QHZA 4CD8A 2X0HA 4ACZA 3A24A 1O7DC 4W8AA 2VQUA 3WELA 3AMDA 4LQ1A 4B3KA 5C8BB 3F5JA 4PMXA 2ZXAA 2EADA 3A23A 1PEZA 2A3EA 5I0DA 3VGDA 1LL4A 1KR0A 4PMDA 1WCGA 5A8NA 5FIPA 1UR2A 2JE8A 3WNKA 2YFOA 5M3WA 4CUCA 2CXGA 3FY1A 1HJQA 1I75A 4M29A 1TMQA 5I6SA 2EPOA 1EH9A 3M6DA 1Q4NX 1OCQA 1XSIA 2F1AA 3WMSA 1Q6EA 3OZPA 1W9BM 3IAQA 5A8OA 2JEQA 1ITXA 2WB5A 2RGMA 3MSDA 1UWUA 3T0BA 3GXNA 1NWTA 3SUUA 3AS2A 3W82A 3EMCA 5GNXA 4ZXOA 3MMWA 3EMQA 4ML4A 1R8LA 2PWDA 3VM5A 4W7VA 4H7VA 1QNSA 2VO5A 1UD5A 4JFSA 4ACYA 2PWEA 4FNPA 2WPGA 4FNTA 2ZE0A 2WLYA 1UR4A 1AQMA 3BVVA 3VIGA 3BUBA 2ZUUA 2GJRA 1UWSA 1HX0A 4EKJA 4WIWA 2YDRA 3H55A 1I1XA 3W26A 4ATLA 4CU7A 1KQYA 4M8UA 4PTWA 1BQCA 4QDMA 4HOWA 3ARRA 1WAWA 4JCLA 1O6IA 1NARA 3QHNA 4CCEA 5A6MA 4FLQA 4M81A 1WDRA 1BPLA 3VO0A 3D4YA 4AD1A 3F5KA 3EJRA 4M1RA 3VUPA 5DEZA 5EBAA 1J0JA 8CGTA 4CD6A 2ALWA 3TTYA 3QR3A 1QVBA 1GW1A 1HKIA 5LA2A 3EDFA 1V08A 2IXVA 4CU6A 4KMQA 3UG5A 4TTUA 4W84A 5D8ZA 1WB0A 2GK1B 1JGIA 1B30A 3K4AA 3NIYA 1J0YA 3TTQA 4E4PA 1NP0A 3VNYA 3FHQA 1M7XA 3SCQA 3LPPA 4FMVA 3VGBA 1KGXA 4OIFA 2W61A 2J47A 1E0XA 1JNEA 3HN3A 2WVUA 1GUVA 2Z1KA 4AYGA 3H54A 5E6YA 1A3HA 5I77A 1E43A 3WNPA 4TVCA 1VBUA 1B3ZA 1CPUA 3ZJ7A 1VIWA 4W88A 3SURA 2WLZA 3A4XA 4JKMA 3WDJA 3BUIA 3D5HA 4LPCA 1CEOA 1VFFA 4HA1A 1UA7A 4M80A 2GJXA 3LMYA 1OWQA 3MUIA 3WDIA 2QV4A 3AIUA 3WUGA 1LG2A 3GNRA 1W9XA 3AICA 5BXRA 4EK7A 3L4UA 1JL8A 4WF7A 3WD2A 1FH8A 3BAWA 3BAJA 3FW6A 2J4GA 1R7AA 1KFWA 3ARTA 4LXFA 1C3FA 4E2OA 4PMZA 3VU2A 2WC7A 4PCSA 2IXUA 3SCTA 1V02A 2RGLA 2JIWA 1MQRA 1UYQA 3CHFA 3KZSA 3PBGA 4JZ5A 4C7FA 2YL8A 1OGSA 5BXPA 5C70A 4Z2IA 4EAMA 3ZT6A 3CUHA 2GFTA 4DO5A 5ABHA 3DX1A 1Q6DA 1QI2A 4P8XA 1ISXA 2FYVA 4DUXA 3A6OA 4P8UA 4DWSC 4J3UA 1E6XM 1R87A 1E6ZA 5JIPA 3KLKA 3WQWA 1HVQA 1B1YA 2GSJA 2QPSA 4K68A 3VD5A 4U31A 2VNCA 3GM8A 1H09A 2ZX8A 3TOPA 4W8BA 3VIPA 4E8CA 5CPSA 1K9EA 3CZLA 2XGBA 4PUEA 2DH2A 2UWFA 2J7DA 3WENA 2WMJA 4J7RA 1ISWA 3VIMA 3D4ZA 4R5EA 4AWEA 2EXOA 4CN6A 2WBKA 3WQ6A 3DX2A 3VGEA 2ZUSA 1OT2A 4U33A 1ECEA 2E9LA 4W8LA 1UQYA 4AZ5A 4WLCA 1JYXA 1TVNA 2ZUNA 1ISVA 4WK9A 1B3YA 4W5ZA 5CSYA 5HDRA 4OBSA 5DMYA 1C91A 1C92A 4OKDA 3WEMA 1W9PA 4W85A 3WF2A 5IDIA 3VIKA 3EJSA 2YBTA 1QI4A 1FA2A 4D72A 1E55A 2JFEX 4X0VA 4U2ZA 2FHCA 4ZFMA 2WHLA 3MUY1 1W1PA 4TXEA 1ODUA 2C8NA 5E9AA 1TA3B 1EOKA 3AMGA 1UUQA 1EQPA 1MW3A 3ZSSA 3NDYA 1OGBA 1EDTA 3A4AA 4HPGA 3LPGA 2EPKX 1US3A 1SR0A 4Z2HA 2OWWA 3ZR5A 5A95A 2J7HA 2A3CA 4HU8A 1E70M 2X0YA 1RH9A 1JAKA 3VVGA 3GXFA 4FLOA 2D1ZA 1W1YA 3U57A 1CBGA 3DDGA 3SUWA 2VZSA 2DT0A 4AISA 4U5IA 5M5DA 4N42A 4YPJA 2WVVA 3CZ8A 5I79A 2XFYA 3PTMA 2YKKA 2CEQA 1OINA 4AZ6A 3UERA 4W7WA 1KGWA 2Y8VA 1JIBA 2PWGA 1M03A 4QLKA 8A3HA 3O9NA 4GPNA 3SUVA 3WQVA 2D2OA 2J7CA 2WYSA 4CD4A 3EJPA 3AS1A 4TVDA 3BCDA 1HTYA 4RE4A 5E6ZA 2G41A 4S3JA 1P6WA 5BXSA 1JFHA 5D4YA 4PSPA 2WHKA 2E0PA 4Z2GA 4F8XA 3AIBA 2UY2A 3RIKA 1AMYA 1EDQA 4JCMA 3ECQA 2WC4A 3CZSA 1XD0A 2OSYA 2J7FA 3VD3A 3GBDA 2GK1A 2WMFA 2XVPA 4HZ6A 4UQDA 1WDSA 4A3YA 3L2MA 3VIFA 5HPCA 2EPMX 1XH2A 1V6YA 3VM7A 2ESCA 4AD3A 1WDPA 1KWKA 2CBIA 2VJXA 2E8ZA 3GXPA 3AHVA 1XH0A 1DWFM 5CPQA 2YIHA 4R27A 1J18A 4UCFA 5A6SA 3EJUA 1W1TA 3OGSA 3EJTA 1ZJBA 3UEQA 1CECA 3I3EA 3BUPA 2VMFA 1CXHA 1H41A 2Z1SA 3SUTA 3CHEA 2G8ZA 1CZ1A 1T0OA 1J01A 4Q7NA 4UQBA 4TVUA 3S5YA 5IFTA 5A6LA 3T0DA 1Q6CA 4URIA 3AOFA 3NDZA 3O6AA 2OWCA 1R85A 1ZBKA 1XV8A 1HN1A 2WZEA 1HP4A 1PBGA 2FE0A 5JBFA 1BFNA 3VIOA 1MQPA 3O2LA 1WZKA 1TCMA 2G3MA 2EBNA 5CJ5A 4H8VA 4IISA 1KBKA 4AZBA 2J77A 1JYNA 3OZOA 3WEZA 4HZ8A 1V6WA 2VURA 2G4FA 3A4WA 3AMCA 1ZL1A 1RP8A 3CZGA 1FFRA 5IHRA 1OBAA 3THDA 4AC1X 4MAZA 3WQ4A 2WCGA 1ZB5A 4D6IA 1GNXA 5E70A 2BY2A 1GOOA 1ODZA 3DX0A 4MDPA 2W63A 1KTCA 1OD0A 1E4IA 2J25A 2D23A 2OSXA 1W2VA 1JZ6A 3BAYA 4UQ9A 5EFDA 2YFNA 1HJXA 2XSBA 5A2BA 1E6PA 3DDFA 3FXYA 3T0AA 2WMIB 4W93A 2X05A 1BTCA 3L4XA 4D6FA 3AZSA 4PTMA 4UZSA 5D8WA 5DO8A 4CD7A 3CMJA 1EHNA 3GH5A 2PC8A 2PBOA 1VENA 1B3VA 3N9KA 1MW2A 3MANA 3OG2A 3PZMA 1UD6A 3WY3A 3KLLA 2PF0A 1QW8A 1UH3A 3PTKA 1L0PA 3M46A 2BY3A 1G5AA 3HG5A 3CHCA 5D9OA 5BROA 5CLWA 3ARZA 1R86A 2QLYA 3NYDA 3PZOA 3UESA 4UFLA 5ABEA 1X6NA 4UNIA 4HPHA 4UOQA 4D6GA 3BAIA 1HP5A 1BVNP 4S3KA 3BLPX 5ECUA 1TR1A 1V0LA 4IPNB 3N13A 2HVMA 4PYSA 4F9DA 3W28A 3GDBA 1M04A 1IV8A 4BQ5A 1AVAA 1BAGA 3LPOA 3IJ9A 1PAMA 5A6AA 1JZ5A 1R7OA 1ISYA 2VC9A 1JYWA 1PIFA 1U2YA 1V3LA 3PZGA 2E8YA 4Z2LA 2E40A 3WN6A 1QI5A 1TVPA 3CIVA 4H41A 3SCOA 1E3XA 1PZ2A 4TX8A 2FGZA 1VB9A 3F5LA 3BLBA 3I3DA 3U5UA 3VDAA 1G1YA 1GOWA 2F8QA 1HVXA 2WHJA 1ZU8A 1KQZA 4JAWA 2QPUA 3MO4A 1BGAA 1BG9A 1UWQA 4E8DA 1KTBA 2D3NA 3AQUA 3GNPA 1JF6A 1E4LA 1JDAA 2CYGA 2EEXA 4LYQA 1SFSA 5EB8A 4Z2KA 3SCUA 3QHMA 2CBUA 3LRLA 2VZTA 3GBEA 4L4PA 4H2CA 2F61A 1QNPA 1JD7A 3LXBA 1VF8A 1W9UA 1JZ8A 1US2A 2PI6A 2WHMA 2W5FA 1WPCA 4KRTA 4TTGA 2D22A 3HG3A 2MANA 2Q8XA 2NW0A 3UG3A 3AHTA 2V38A 2DH3A 3RPMA 3CGTA 5AYBA 1HXKA 1RP9A 3CZNA 1CGVA 4MNKA 3GXDA 4AW7A 2WWDA 1GHRA 1UG6A 1UZ4A 3ARYA 2BHUA 4KRUA 2ZX6A 1R47A 4JL1A 2WSPA 1JFXA 1LL6A 2HISA 4W86A 2OSWA 2WWCA 3ZO9A 2WKLA 1UR0A 3DHUA 2EPLX 2CKRA 2XYLA 1XSJA 4PSRA 2E3ZA 5E09A 3AXHA 4UQAA 2CBJA 4B15A 5I23A 2J7GA 1TUXA 1DWJM 4ZEPA 2CKSA 1F4HA 2WMGA 4P8WA 4MTVA 5A8QA 1GQLA 4MAVA 1H49A 3VILA 5M03A 4MB1A 4AEFA 4YN5A 3MMUA 1H1NA 2ZX7A 1E0WA 3WD4A 4UOJA 1V6VA 1R46A 1CXIA 1GVYA 4AZCA 4UQCA 1H4PA 4WKHA 3WKZA 2ZX5A 2VRQA 1EA9C 3GH4A 1WP6A 2DQXA 4M24A 3VSVA 2BVYA 2ZXQA 1XSKA 1LF1A 1W9DM 3OB8A 4IM4A 4DUWA 2DDXA 2VX4A 1XH1A 5AC5A 3AHZA 5GNZA 5D9PA 3D51A 2X2YA 2G3NA 2JALA 4KGLA 1GORA 5BCAA 1V3JA 4DUVA 1JNDA 1FHDA 3F4VA 1UD4A 3AXIA 1EO5A 2YL6A 2WBGA 1HJSA 2VUYA 1PS3A 1HKJA 5TD4A 4D1IA 5I2UA 1IZJA 1NOWA 2EO7A 3OGRA 4HMDA 5BRQA 1E56A 4ZE4A 5CXPA 1TG7A 5I24A 1C7TA 3WDHA 3ZMRA 2UY5A 1BYCA 4HOXA 4PMNA 1NQ6A 4AYSA 4MB5A 4NZFA 1GOMA 1UH2A 4QFUA 2DSVA 3VD4A 3RDKA 1PZ3A 4W7UA 1FP8A 2F7PA 2XFFA 1JZ2A 2WKGA 2BXZA 4CGTA 1EDGA 2BNJA 1TQUA 2YL5A 3AYSA 5EMYA 4HU0A 3WUBA 4AZGA 5HOSA 4P7OA 1GQJA 3VDCA 2O9OA 5D9MA 4LYRA 4JL2A 2XG9A 4P8VA 5AYIA 4D1JA 3VKKA 2ZWYA 4PTVA 3OLEA 2YA2A 4DWSB 1MVYA 1V3KA 1UOKA 3NCOA 5KZ6A 1X1NA 1DEDA 2XVNA 3BMWA 2W4XA 3GTNA 3ARPA 3OGVA 1QNQA 4HTYA 3SCVA 3W4RA 3HJEA 1A47A 1HKKA 3RM8A 3AS0A 4CN4A 3VD7A 2XHYA 3G6MA 5A6JA 4PMYA 2G3IA 3EDJA 2WK2A 3L4WA 5A8MA 2A3BA 4QLLA 3BVUA 2BHYA 3B9AA 1NWUA 4GZJA 2GDVA 3M07A 1OT1A 6A3HA 2DSKA 3AHXA 3MS8A 1CENA 2ZUVA 4OZOA 2VL4A 1EIBA 3KWXA 1CXKA 5FL1A 1NOFA 1CXEA 3ZIZA 4AD0A 1KXHA 3W29A 4BF7A 2DEPA 4GINA 3PHAA 4M82A 2VCCA 4FLSA 5GNYA 5E1QA 4JFTA 2VVNA 9CGTA 1BLIA 1O7AA 1RD6A 4BZYA 2WMHA 5ABFB 2PB1A 1WZLA 1DP0A 4D6CA 2WVSA 4D6DA 1YQ2A 3SCPA 4XZWA 1CXFA 6CGTA 1LJYA 2YJQA 2JF7A 4DM2A 3EBVA 4CD5A 3BUQA 3PZ9A 2B31A 4D6HA 3EDEA 3QHOA 3RMEA 2CCRA 2X8RA 1V0NA 2VTFA 5A94A 1BSIA 1MQQA 2D73A 1XHGA 3WH6A 3B8SA 2GUYA 3ZM8A 3KE0A 1WO2A 3BAKA 4UTFA 4BCEA 1KXQA 4UR9A 1SYTA 3VGHA 1K6AA 4J28A 4HZ7A 4XV0A 3AHYA 1JZ7A 2VX7A 3I3BA 1DWIM 3MV11 3AIQA 3OA5A 4PCTA 3GXMA 1C7SA 3T2PA 3THCA 3D3AA 1HJVA 1B9ZA 1JZ3A 4PMUA 1GQIA 3QOKA 3HZ3A 4L4OA 3AYRA 4BQ3A 4GQQA 2XTKA 3W25A 1TQSA 4ACZB 4CN1A 1LG1A 2W91A 2DGAA 4WKFA 1PX8A 2DT1A 3AIRA 3ZSTA 4UFMA 5I5RA 4B3LA 5EFFA 4CCDA 3EDKA 2FH8A 1VFOA 2FH6A 2BXYA 4PEEA 3VMNA 1UQZA 4CVUA 3AMKA 2VCAA 3DYMA 5BRPA 3MKKA 1E4NA 3BH4A 2Y2WA 1DHKA 3D50A 2YLLA 3PZNA 3A5VA 2YDQA 2G3JA 2OLHA 4UFKA 1UD3A 1ZJAA 1UKOA 1MW1A 3LRMA 3KEHA 2C0HA 3CZEA 4J3XA 2DIJA 3OLIA 3S5ZA 1UWRA 3K4DA 1J0KA 4GXPA 3BUDA 3WDQA 3WBAA 2BV9A 5CGTA 2D24A 4J3SA 1E4MM 3VMOA 1UD8A 4JFWA 2DT3A 1BYAA 1NWRA 3GXIA 1E40A 5A6KA 4OGZA 2QMJA 2DIEA 2F7QA 1KR1A 2CBVA 1N82A 3KL3A 4WKAA 1ZBCA 3L4YA 4MJ4A 1G0CA 3WF0A 4JFVA 2WSKA 2CPUA 1NP2A 3BAXA 4WSKA 3K1DA 3RM9A 2EAEA 3DX4A 4AIUA 4Z2JA 1CDGA 3WEOA 2XFRA 3IJ7A 4V28A 3M7SA 2OW7A 2CITA 3ARWA 3SIMA 3ZR6A 2XWDA 1J12A 3WL0A 3ZJKA 3WSUA 1BYBA 5A1AA 3VGFA 1XCXA 1UWIA 3CUGA 1H0IA 1E72M 2J7BA 4NZJA 3W37A 1XYZA 1B90A 3VX1A 4B9YA 4MDOA 4PMOA 3HG4A 3WY4A 4ZE5A 2VR5A 2C7FA 3DX3A 1QBAA 5CGMA 2ZUMA
chains in the Genus database with same CATH superfamily
1KJ2H 3HLKA 3O9WB 2AMXA 1IT0A 3MUAA 3LGGA 3PNUA 5ESVA 4K9EL 3O4LB 4UM9A 4POZD 1KMHA 1ZFJA 1Z41A 3P0VL 2QELA 3CH9A 4NJHA 1DQIA 1TVHA 3D2UB 1WV7T 1NAKH 2FLRT 2ZZ7A 2BY1A 4W4NA 3H26A 2I26N 4PP2B 4CSSA 1EQCA 4NNPH 4KVCH 2H3BA 1QLFB 4G42B 2WYHA 2YN5A 3QP3A 1N5AB 3U6RB 2OK0H 3CN1A 1A6WL 2ZTBA 1I1RA 3N1GC 4YO0A 4EACA 3TC9A 1XGDA 1V05A 1XR8A 1EJ8A 1S7SA 3SLNA 5KMYA 1HILB 1B0GB 4XPGL 2J6EL 3EXRA 1YO4A 4H01A 3IBEA 1CTMA 2IXQA 3VYOA 2A0LC 4XLFA 3GKWH 5DRWA 1ZHLA 4U1MB 3R6IA 2KQMA 5IM51 3P9WB 5E0QA 1UH4A 1A7QL 2WKOA 2IW0A 2O9TA 3GSWA 2GK0A 2XV6B 3D52A 4R7OA 4CW1A 2G60H 3BZFB 2AC0A 4UV4H 5GRUL 3WD1A 4KEMA 5F7LB 2R56L 1H2JA 4N0UE 2R51A 1F74A 4EZMA 1ID2A 1CC3A 1A9BA 4RH4A 2APTA 3I9AA 4WJ5A 2YMOA 1MFEH 2OCCB 3CLWA 3HC3H 4IJCA 5FFLA 3KH4A 2ZKHL 2A77L 1K5NB 1N2RB 5ISZA 1T6VN 2H3XC 3MBWB 4AENB 4Z3TA 4A67A 2PE4A 3CW2A 4OQTH 2CHWA 2R9HD 3VNIA 4NAQA 1CCZA 4K2UH 1SGJA 4Y4HC 2F8XC 3EG9A 4YFLI 1A3LH 3T3PE 4O2CA 2GLKA 1AHKA 5DA0B 5BV7L 1JZEA 3T0CA 4ZT1A 4V27A 4OF7A 5FCZA 2DKMA 3C6SA 1X5IA 3I85A 4LSDA 3BKML 1UPPA 3LZOA 3BW3A 1CI1A 2CIPA 5JYMA 2JIXA 4R83A 3QSTA 3LY0A 3SCMC 4XMWA 2OMVA 2Y25A 3IPFA 2QQNH 5DZNA 4MQTB 4KCTA 5D2XA 3MLZH 2YSSA 2H41A 3ARGA 3OKMB 2FRGP 3AW5A 4PVBA 5DN6A 1VLXA 1MVUB 1POKA 1DVZA 1AGDB 2PIAA 3DFQA 3U9UB 3OAYK 1KLGA 4PMFA 5E8NB 4OI9A 1K9TA 1HSBB 2CNZA 1OAJA 3DXAD 4NCDA 1AJ0A 4HK0B 2WYZA 4CKQA 2YAEA 2XNCA 3RQ3A 4UC5A 4N1HB 4RCAA 4R26L 5D1QC 3STCA 2E1WA 2PDIA 2EIXA 3EAKA 4QHUB 2XQYG 4WDUA 1TPXB 3UZJA 5IR1A 4JQIA 5LGHL 5ITFB 2BGSA 4GZEA 2RB8A 5HPOA 2E4FA 2JB6A 1KB5A 5L9FA 1WC7B 4UANA 1Q1JL 3VI4B 4W9ZA 5KVMC 5DUML 4H8WL 4YS4A 2ITEA 3ELFA 3W88A 4FX7A 3U2IA 3CPLB 2D0FA 3IARA 1ZHAA 3ZX1A 4WHYH 4MJIE 2A21A 5DHVB 1S7WB 4TQTA 3VXUE 5DZVA 3MHZA 5TF0A 2Z4TA 5DJYB 1B2WL 4U1LA 3HN5A 4XMPL 4IBYA 1A6AB 2DLIA 5EFIB 2PE3A 3MLUH 4XOBA 3QV9A 3QDJB 3X3FH 3GHUA 1YY9C 2AGTA 4LF2A 1U2HA 3WN5B 4IUOA 1CLZL 3SZKC 3NP3A 3EWXA 3U83A 5H2BB 4M56A 4A2LA 3PGCB 4N0UA 3RCNA 3HE6D 1FVEA 2OJPA 1G1CA 1VPOH 3VE0B 4A22A 3SDYL 2YLAA 4JFUA 1C8PA 4FQIH 4RR4A 1UASA 2VERN 4FQHA 3BZJA 4ZR8A 1P84K 4L23A 4A7GA 2MEJB 1VIZA 4Z3GA 3L3OC 3HAEH 3WK3A 2LFGA 3BYTA 4IK7A 2FQFA 2O55A 1YYLL 2XOTA 2OW6A 4UT6A 3ZKNC 4QRRB 3ID7A 3K6DA 3TW7A 1N12A 1JV5B 4QS6A 4JHZA 5IEKA 5E0CA 2V2TA 2WKJA 5TBOA 2OMTA 1R5IA 4GIYA 2BGQA 2EXWD 1RK1B 4LUSA 1F1DA 3GT6A 1LQBC 1X9LA 1DZBA 5IVXE 1G7MB 4ICCX 6TAAA 3B56A 1MFUA 1GVFA 3CPUA 1EP2A 3TCLA 3UT0A 1JEZA 3PQYD 1VZHA 4ZMWA 3W71A 1H0DA 5DT7A 2C79A 2DIAA 1JB9A 4ODXA 4M4PA 3N42F 3KLHD 5EIIB 1XWYA 5GGQH 3G04A 3VFVB 4QUZA 3DX6A 3DVNA 4HUXB 1RLCL 3CQPA 3TNNB 4C6OA 1S5IH 2C19A 4G7XA 2UXTA 5HD8D 2LLNA 5BOEA 4HISA 2HVKB 2V2DA 2HVNA 4Z18A 2JNZA 4LT9A 4AWTA 1JTTA 1FPTH 1GGTA 4HG4K 2Z91B 1OW0C 5GGVH 1TNMA 2G9HB 3CJPA 4FNQA 4HIJB 3SDDA 1J5IA 4RDWA 4PJ5B 3UACA 3W81A 5C9ZA 4Z4ZA 4UTAA 2GSEA 3IXAA 5KSUB 1XIGA 3MO1A 3JZYA 4FXFA 3OAWA 3KBEA 1XIMA 1WISA 1RBLA 3QARA 3MBED 4PREB 1GGCH 4YZWA 5K7JA 4LVFA 1F4WL 3L4VA 3L17A 3ZZ0A 4HNNA 1S3KH 1OFDA 3NPZB 1F2JA 3PXLA 3UROR 3APMA 5DURD 3GAYA 4R53A 3DHFA 1O9ZA 5ACMA 1T7WA 3WS3A 1L9QA 3F64A 1VR6A 1H3PL 3BXNB 3MT1A 4FQ1L 3NZGA 1J11A 4MJIA 3VINA 3AUJA 4FHAA 3VXUA 6PAZA 3G5WA 3UWUA 3V0TA 1A8ZA 4WENB 3BFOA 3C5JB 4O8AA 4PV1C 4US6A 4F91B 2V30A 4Y7CA 1MLBB 5AYUH 1FP9A 3M47A 5D1ZD 2VEGA 2XETA 4AMXA 3TA9A 5D96C 4BH7B 4AMAA 1YLVA 1CQYA 3H9ZA 1XRVA 3VJ6B 1E71M 2VAJA 1MDLA 1CF8H 1LL4A 4JO4H 2V2XB 3GRWA 1IKNA 4MDRA 4IU2B 1ACCA 2YD9A 4Y4HB 3GO2A 4IQEA 3BZEB 3GLZA 4PJCE 3VI3B 4C0SA 1A3WA 2JEQA 1WG3A 5JHBA 3GXNA 2ZC1A 2ZAGA 1OGTB 1EJSC 2XXFA 3ZL2A 3S2NA 5TE6H 2GSMB 5K9QG 2V8ZA 2PWEA 2WLYA 3TC6A 4AY7A 4FTVE 4XORA 3SCMB 1GZHA 3DGCR 3S5SA 1GGIH 4NIYE 3EO9L 3K7UA 3DGGB 4B3GA 6XIMA 1LO2H 4N1CA 5IVXA 4F7CA 2H7WA 1BPLA 2E6AA 2Y7LA 1IFHL 2CLZA 4DYJA 3WXVH 1I1AA 4KO9A 5EBAA 4C55A 3UG5A 5D8ZA 3OB0H 1WB0A 1QKZL 3SRFA 4ZXBA 3W72A 4IBWA 4LLUA 3TXZA 4AYGA 3F7PC 2DYPD 4XRCB 4TVCA 4E9LA 3GY1A 4N0FA 3T56B 4YDMA 3PC0A 3WLNA 7PCYA 1BAFH 1KIRB 4YBQD 3SE9L 2GJXA 4RCZA 1TTPA 3MZNA 2ZJSH 3VFCA 3GIVB 3H23A 5E4IA 1QUNA 4DGYH 2JXMA 2PPEA 5D02A 2IXUA 2HVBA 1M2OA 4JG0H 1L6FA 3NJNA 2P50A 4C7FA 3CBJB 3QYCA 1KBGH 5F4XA 1A64A 3RIAF 3SDCB 1JF1A 4RDQF 3DX1A 4GUIA 1IGJB 2ICWJ 1S7RB 3KLKA 5F7EH 1MUMA 4RETB 3RPDA 1NAMH 3NJLA 4EN3D 1A6VH 2XISA 4YJ5A 1VFAB 4U9UA 4Z7NB 1KELL 4NJ9L 4ERIA 3IJ6A 2OYNA 4PHXA 5BMXA 1KK0A 3SBRA 4DRSA 1F8TL 4CN6A 1EEUA 2WMPB 1S2TA 3AQXA 3ESVF 5GS0L 1O5DT 4LU0A 2H1PH 2F08A 4OBSA 4N2EA 1A3RH 2B9BA 1E4XL 5KVDE 3CHOA 3A67L 5FSDC 2IFFL 3TLRA 4ZFMA 2OMYB 3MUY1 4JW3A 3IIOA 4G11A 1US3A 2XN9D 1SR0A 1K2DA 1GH7A 2FAUA 1S7TA 1BZDA 4AYMC 3QWOA 4NRZB 4FLOA 1DQMH 2RHEA 3HBLA 1IBGH 2VDKH 1CBGA 3L3OB 1MJJA 3LNEA 1Z9LA 4X8XA 2N56A 1KM0A 1FXPA 4DJDD 5L4IA 5JHLL 4GKNB 2VXUL 4PJCA 5F2LA 1Y6NR 1KGWA 4W4OA 1TNNA 5HULA 1Z9SB 1AIFA 4QLKA 3KYOA 5AVXB 1YDPA 1NUDA 5LCVA 2G4EA 3C08L 1ZDQA 3RYMA 3ICJA 4UQ3B 3VRLF 1SXZA 3IU4H 4LDCA 4HKJB 1D7KA 1KTRL 2QKSA 1HHHA 3VABA 5LKYA 4FTVA 2GJNA 4XVEA 2WC4A 4L9LC 3FBKA 3VD3A 2JIZA 2XVPA 4HZ6A 3G6AB 3EX3A 2WNKA 5IMKB 2WWKT 3L3IB 1IT9H 2JJWA 3QFCA 3LM7A 3CVHH 4HNLA 3VXOA 4JDYA 3ABKB 1LP9B 1CE6B 5DY2A 4KHTH 5CPQA 2YIHA 1XIDA 4L6OA 4RMUA 1J18A 3EF4A 1BX2A 1VQMB 1PQZB 1W1TA 1PU0A 1BFOA 4U1GC 4AVNA 2R1WA 5TQLA 4Y1AE 3DROA 5DD3H 4QE4A 1J9CT 1T0OA 2QDHA 4QM1A 3RAJL 3PWNB 2JCCB 4I1PA 4ONGH 4HK3N 3IU3A 4ZODA 1P48A 1HP4A 4MD0B 3B5GA 1WZKA 4N8UA 1ZV9A 4TNWK 2OX5B 2J77A 1JYNA 5GRWA 2VURA 4G6AD 5IMLB 4XMLH 1L6YA 5FF0A 4JZNA 2WSYA 2OEKA 4TV3A 2X4RB 4V33A 2E09A 2O5NA 2UZPA 5FA3B 1UP0A 2UX7A 4O13A 1EJXC 4K37A 1Q63A 3T4CA 3UYRL 4Z78B 4LSUH 3UDWA 3GQBA 1OE1A 4TV6A 4JZJA 4BCXA 5T1LB 4JHMA 4XWOC 2NW3B 3ESUF 4DP9X 2ZDRA 4I0KA 3O06A 1E6OL 3DO4A 4XOCA 3CHCA 1UR3M 2WNXA 4F7PA 2GGJA 4JS3A 3GEFA 5KJ7E 5KOMC 3O6FD 4GYPC 1DUZA 3BAIA 5F4WA 5ECUA 3F12A 5DDHB 1MRZA 2Q3OA 5D05A 5EO9A 5I6PA 2EYRB 3V0AC 3M0KA 3CZFA 3RNDA 1A80A 4QAMB 1PAMA 1X4ZA 5D96B 4C6QA 4NGHH 1JNLH 1DBBH 4KFZC 1NCTA 3F5LA 2DQDH 5F6IC 2DW5A 3I3DA 3CMMA 1ZM2A 4I9MA 2LU7A 2HKAA 1PF3A 4D9LL 1C9WA 5KVEE 4ZMAT 5HQEA 4OV4A 2CYGA 1P7QB 1P1VA 2CBUA 3WIFB 3KRUA 1IWPA 4WI9A 1OO2A 5FFGA 1VF8A 1US2A 2PI6A 3KJ4C 3C60A 1W2KT 2TYSA 4XOPA 4KJQD 2MANA 1UUMA 4MM1A 3RWHB 3FB5A 4ZI8A 1HAWA 2DI8A 3RPMA 4OIIL 4GB9A 3FQTB 1VQTA 3QYQA 4M19A 1BD2E 4M7JL 4NUQA 4ZOAA 5C0FB 4FHBD 1UG6A 3GX9A 3TVAA 1JFXA 3TJEH 3P5ZA 1XGEA 2WWCA 3GFYA 5CC5A 3U2OA 1UR0A 3RHGA 1RFDH 3SB0A 5L0QC 2IH9A 2XINA 2J7GA 1ZMYA 4XVSH 3WCZA 5IG7A 4CA4A 1ZPTA 2O5YL 1RZKL 1XIBA 3QEQD 1TTFA 5H8UA 5BMFH 1R46A 1CXIA 3NZ1A 4ABUA 4NJAH 1MCEA 5J12B 1KBWA 4QXVA 5DQJB 1FL3A 3WE6A 2BIQA 3MP3A 4Q8QA 5TH2A 4GA8A 4B3FX 4Y1AA 3D51A 1ME7A 1LK2B 5DJDA 2VLJE 7XIMA 5IFAL 4ENEC 3CFIC 1VADA 3BP6B 3MRCA 4P3IA 2P0OA 1FH5L 1NOWA 4I48B 4OB5L 3W2NA 5J89A 5DJAB 1K8ZA 4JVUA 4ZMXA 2ROYA 4HOXA 4GAJL 4A6YB 3JWDH 1MCCA 5DJ0A 3V9EA 3QHFH 4JQIL 4UB0H 4WDIA 2BXZA 1MNUL 4UIKL 1UM4H 2OX1A 1KEGL 1TWWA 2GIXA 4UTLA 2MCG1 3D48R 1FNGB 1PG7H 4ZSTA 3NCOA 1QO3B 2XVNA 3GTNA 1IQ8A 3ARBA 1QVOB 3IMVA 4WHDA 5DMKA 4YDNA 1EBHA 1Z7AA 1ELOA 1MPAL 1XR9B 5A6JA 1NEZG 2VDQB 5JNYA 5L2KE 4TMCA 4CBPA 3P1VA 3CMFA 3UJJH 1HKFA 4J4KA 1N18A 3MCLH 3W2FA 2VDHA 3NEHA 2R69A 1NOFA 3GJFB 3W29A 3SQBA 2DUXA 5GNYA 3T6XA 1HINH 1JJ2B 4C1NB 3EB4A 4PJBE 3TC3A 4DP7X 2PTTA 3BWSA 2O61A 1FNHA 3KAAA 3GK0A 4XO5A 1NBCA 1B4KA 3IJYB 1I3GL 4YHIB 5FO7A 2VLLB 2WWKO 2BERA 6XIAA 6CGTA 1B3JA 1LJYA 1VRDA 5KVFE 4OFYA 4HLEA 1LDSA 1JPFB 3BD4A 2EKCA 2Q8BL 5EN2B 4G9FE 1H1ZA 2YD7A 5K9QI 2VDLH 1PDKB 2IPWA 4OM0H 1NC2A 5B3SB 2P28B 4XB8A 3SO7A 4XV0A 4O5LH 3U36A 3ME3A 4E5TA 3EOBB 4AGOA 5F9WC 5CCHE 4GG8B 2DVUA 3MRLA 4UT6L 3KVJA 3L9BA 5FJIA 2ADFH 3T0EC 4N8CL 5IK3A 2FMOA 5HVWA 4B3LA 4HQQL 5DRNA 2K78A 3MKKA 5HHME 2OV0A 3QNXB 2NUTA 5CJOH 1BD2A 3LCFA 4L9LB 3C2AL 4S1SH 3QJSB 4PBWD 5T1KD 4H6KA 4OZFA 1QATA 2HH0H 3H7RA 2BNRD 1S5HA 4G59C 1NMBL 2AFNA 2BWQA 4DW2H 3W7GA 2YZ1A 2DMBA 1YNKH 4U1GB 1BZ8A 2H8PA 3BWAA 1RALA 4K3HA 3CUPA 4FRWA 2VR9A 3RL2A 1LEGA 1CU4L 3PP3K 1F5WA 2VWEC 1SHSA 4JFZH 4P8QA 4U3XA 4JFDE 4B5UA 4DP1X 4DGIH 2VH5L 4GXVH 4UM8A 3UL4A 1T04B 1OEPA 2A74C 1KLZA 1QGYA 2OW7A 1R3VA 4FYQA 4HWUA 3F00A 3CFBA 2BMBA 4G8TA 4X7SL 3QUZC 4YIWA 1UWIA 1W72H 4K5PA 2VLJA 1FWRA 4WR3A 4NZJA 4UQIM 3VX1A 3WY4A 3UBXA 2VR5A 5SWSD 5DFWH 2EXYC 3NIDB 4IOSA 3E3QE 4MNLA 4UTAL 1RZFH 1EHKB 3UJIH 4AKPA 2JQXA 2VRKA 3CFDA 3ULUC 3ZTEA 2EPNA 1WCBB 1LLOA 1UD2A 3WKMH 4XKYB 1UKQA 4BK4A 4NKIH 1QVGB 3FU7B 4GRWH 2GZXA 3WUWA 3DX5A 4GW5A 4DN3L 3MLYL 4UTMA 5BVPH 1UPMB 1DVFA 4BFRA 3LEVL 4CADA 2X4OA 1RJZB 2YYTA 3ZRCC 4HWEH 4BFJA 3NQ8A 3GSRA 4L8BB 1B57A 2P3ZA 5GRVL 4LBEA 1VYPX 1P7HL 5F1UA 2P52A 3S5OA 2XXMB 1FO0H 2PGWA 2ZOLA 5L2KA 5ID1B 2A5HA 3TVMA 2VC6A 5K9XA 1UR8A 4YHKH 3X11B 4FG0A 1OIFA 4NRXA 4F7TB 4S10A 3RFRA 5D7SH 1R3IL 3EXJA 2YLHA 2CLFA 4Q4MA 4NB7A 4IMFA 1OD7A 5F6IB 2QHAA 4PJBA 3FNKA 4EZLA 1G7LA 3PZUA 1WYJA 1UGNA 4NSBA 2WXDM 3MJ8A 2R94A 5HKKA 3VXSD 2WOBA 4DP4X 3ENLA 4JDBA 1KB9K 5EBLB 2CLMA 1D5BA 3WBKA 1B5TA 3IAPA 3VFSB 1IAIH 1DO5A 4G9FA 1FWNA 3OR6A 3GRWL 3UCDA 3KJ4B 1N05A 3SB3A 5KYWA 1QFWL 3GTHA 1C5CH 2ZZFA 4Z77A 3MA7B 2ZCLL 4EANA 1SEBB 3S1VA 1OAUL 1R0MA 3CD6B 4RX0A 4AQ8A 3VSTA 1MCKA 1AL8A 2XWCA 4UDTA 7PAZA 3YPIA 1IIKA 5DU7A 3PAJA 5L0QB 4HA4A 1Q0YH 3IE4A 4MS8D 3FCPA 4L9DA 1VGKA 3CFTA 2QCMA 4AXKA 2Z7GA 4O17A 1VPXA 4P7QA 4ZW5A 4Y9OA 3UJ2A 4AXNA 4CQ8A 3VB9A 4LO9A 5DJXA 2F74A 2JGYA 2FZ3A 3WH9A 1U8JB 3SE6A 2V3FA 4EBQL 3MSPA 3ZC3A 3GHBL 1HKLL 4XT1C 2QHRH 2GY5A 4JFDA 2CERA 5B6IA 1IGTB 4PV9A 4NX5A 1AZCA 1E9QA 3FNDA 1YEEL 3H3PL 1G01A 3RUGF 5CCJA 3JT0A 5CHNB 3H24A 1J2WA 1SU5A 1QHOA 4FZEH 5DZPA 1XG4A 3PL6A 1W3HA 1Q7MA 1Y65A 3DECA 4WUUE 1T22B 1W1VA 2QQLH 3CUXA 2WXGA 1UJ3C 2CD0A 3R19A 3CUZA 3EW3B 3KTXA 4HMNA 3O8XD 3CHDA 3W7DA 2W6IA 4Q4RA 4UR8A 5T3XD 5FYKU 4KKZA 3DGRA 5DLCA 4D2JA 1G84A 4OJYA 1MWAB 1D5MB 5ENWA 2VM9A 1ZBWA 4J6RH 5B7EA 3D0AA 4KOBA 4MYWB 5EZJA 3VACA 7TAAA 1W5OA 3QCUH 4JTIA 4DTGL 3B40A 1E0OB 4GLRH 5JHDB 4JYEA 5EMNA 2C3HA 1FLRH 4NO5B 3H7BB 4QXUL 2VYQA 4FQXA 3PGDA 2VDOB 3E6HA 2RC5A 3FQWB 3V4LA 1CB7B 4O51B 5LAXA 3QDHA 1ZHNA 4JFYA 4ZUWA 5EWIH 1P69B 1MLCA 3QQWA 1HEZB 4AH2B 4YALA 5G1TA 1L9WA 1NIBA 4K3GA 1AACA 3GH7A 4XNDA 4REQA 2HK1A 1W1ZA 1TQTA 5IXEA 2VOTA 1E0UA 5F3BA 4IRJA 2ZOOA 3H42L 1WFMA 4OT1L 5BXTA 1JZDC 2CLVB 5F9WB 2G50A 3OQ3B 4PCYA 3FFDA 3ZDYF 2HX8A 5ADOL 3T0EB 3VRLE 2A9DA 4PGJA 1N2VA 1E62A 5I8OL 3X1GA 2YD1A 1EP1A 3FQ2A 4BUGA 4IS6B 4A2DA 4Q7BA 1T2XA 5LCVL 3VFOB 4UI2A 1I85C 4DSYA 1KIQB 3U6BA 1KXVA 3K5RA 3UR8A 2VKXA 4PY7B 3VXQB 4Q8NA 4MCYA 3D2TA 1H3XA 1BJKA 4B5EA 1VAHA 5CLYA 3WQZA 4H88H 4H00A 2XTJE 2MH4A 5KSAC 1WTLA 1I9RH 3NCXA 5DD0H 3VWKD 3V95A 3AIWA 2EICA 3D69A 5I3JA 4HMCA 1U92B 4ZB2A 5TTRA 1HWHB 1QTYT 3S5LA 2QAFA 3AAMA 1M71A 5SWQB 2FT6A 3QUZB 2VT0A 5FPIA 4WO4D 3GQYA 1XFOA 2P8MB 4XVTH 1U30A 2B0SL 2OR2A 2HFGH 4J9JA 1R0AH 3MDJA 2XG4A 3ETSA 3PRZA 1J0IA 4DIXA 3WFCH 25C8L 2XGJA 4Z4WA 1F11A 1Z32X 3QXVA 3GNDA 3A3HA 1OK0A 4MJ2A 2HFEB 1MFMA 1UUOA 1AZZC 2ICEB 4U2YA 5E6IB 4Q6KA 4DEPC 4WUUA 4F20A 3MCKA 1RUKL 3CUIA 2CGRL 3EYQC 1HZHL 3RWDB 4M7TA 1YI2B 2ICWB 2F58L 4PS3A 5GQBA 2D3LA 4X0NA 3FCUB 5AW2B 3OP2A 4G3YL 3SRKA 1OHQA 4RNFA 1XZWA 4KWUA 5AOUA 1GKQA 2DQJH 4ZFCA 2C9SA 5B1JA 1BJ1H 2IEPA 1PKLA 5HJDA 3L1OL 2WLLB 1Y0LB 4WWKD 4N2LA 4IEFA 4BA0A 4LSRL 1NCWL 4K8RC 3MXVH 4P6YA 5KVDL 3PBUA 4W87A 2GBUA 4LOUC 4FEMA 3U79A 4GAYB 3F2BA 4LEFA 1OX6A 4PRIB 1ES0B 3P4OA 1IAIM 3PYCA 2CKNA 1T7LA 3IN0A 5D2LB 3B2UD 3TBWB 5DWPA 4UT7L 4ZNCD 3EX6A 5CBEA 2Q6WB 1LBLA 3NOEA 3B7SA 4C5ZA 2B4CH 2ZSVA 1FNMA 4JO8A 1DBMH 3HKZA 4FOMA 1OX4A 2B15A 1GSMA 2VWTA 1G1OA 3KBSA 1SJXA 1I75A 4M29A 4I8YA 4XMTA 1YZZA 3C8KA 3CYVA 3BZ5A 1AQDB 3Q67A 3WTUA 1CD1A 3QJFA 4C59B 3AS2A 4R34A 4ZXOA 3EMQA 4Z0XA 2VGBA 5EDSA 4RAVA 1A4JB 4JFSA 2YWFA 5BZWA 2YEZA 1LO4L 4GSXA 3AY4C 4AUYA 1QG0A 4LCYA 3BKYH 4G6KH 2NXYD 3BD3A 2IH3B 1UWSA 2K3TA 4NAFB 4I18C 1JPHA 3CFEA 2RD0A 1O6IA 1DBJH 2YQBA 4CCEA 4FQJH 4DKEH 1F58H 4FLQA 3VO0A 5IW6B 3VFTA 3EJRA 4ICNA 2MQ0A 3BVDB 1BFTA 1HKIA 2EG7A 1V93A 5E2UL 5HGBB 1N07A 3QIUA 1YEYA 1ND0A 1I7ZA 2W61A 1KTLA 4BQCA 2WVUA 3U30C 3AJXA 4C6FA 2N0KA 4HC1H 1AO7E 2BFVH 4QHRA 2QPXA 4NNJA 3TIEA 3QC3A 4KROB 5HYJB 4M5TA 3WDJA 1GPWA 3MJ9L 2R1NA 1E7VA 4JTDA 2XBZA 1SO4A 1N08A 5FLUA 1OWQA 3BIKA 1A4LA 1WICA 1UJ3B 3L4UA 5IVZA 4JGUA 3V6ZA 1UB5A 5ADPH 3S9ZA 2J4GA 2FZBA 3G6JB 1EUNA 5DZOA 1U8CA 2DTSA 4AJ0A 2XNAA 1XCQB 2ITDA 2GSGB 2F53D 3LN4A 1OHHA 4PUBL 3PBGA 1ZV5A 5B7YA 3MBXL 4M4SA 5HHNB 2GGIA 3U2JA 5DS8B 5I1CH 2VE6B 5DS2A 5CINH 1TPXC 4XI5C 2EZ0C 3DVGA 3KZPA 2R69L 1QRNB 3O4OC 1FKXA 3O3EA 2XTSA 3QUYD 2DWYA 2D03L 2BCKA 4ZFGH 4Y4KC 1N7MH 1BQ5A 2ZZUT 2X3UA 4NHCH 4JPVH 3ONUA 5T3XH 3PXJA 3WQ6A 2FPYA 1WU8A 1NLBH 3LNNA 4DYEA 2E9LA 4A1RA 4LYKA 3CQFA 1TVNA 4WK9A 4K94C 2FMNA 4GNJA 2PLMA 4PCPA 5IDIA 3OAZH 4HFWB 1S2EA 5GGSY 5KVEL 4KKAD 1NGPL 2WHLA 2GOUA 4XNAA 5E9AA 4F9LA 4JJHA 4MCZB 2FVGA 4HPGA 4Y16A 5HR7A 2R2EA 2F1LA 1KA9F 5A95A 3WQOA 1ZANH 3WN5C 3FN0L 2BZ7A 2Q87A 2XIMA 1RZQA 2E47A 3A4EA 2P0IA 1KZYA 2D1ZA 3IFLH 4Y19B 3R0DA 4KNTA 4ZSUA 2I69A 5AVRB 4QKXB 4TTDC 1VCGA 5I79A 5EU5A 1OINA 1JULA 5C0ND 2DW7A 2ZOKB 1JPGB 4FI4A 3SE8L 5T26A 1Z5HA 4CD4A 3T53B 5GJSL 3WNDA 2YZ8A 3IKCA 5ID0B 3D46A 4DEFA 3SBFA 4B5SA 5BXSA 1NFGA 5LNGA 3R4IA 5AYZA 5I9QC 2X1XR 4Z2GA 1AMYA 1MFAL 4HUNB 2QHLA 4UCGA 4G2AA 4RLDA 3G8EA 2X6AA 3M1OA 3GW0A 1KWKA 4E0RA 4AU0A 3GXPA 2EDYA 2NY1D 3ZZTA 3W7MA 2XZCL 3MNVB 4XPAL 1QR1B 1KO0A 3VTTA 2A85A 3SUTA 2G8ZA 2MCPH 5CD5C 4JYFA 5H59A 5EO1B 3REQB 1RQ5A 4FQ2H 2QUUA 2FTWA 1RH8A 2APVA 1AO7A 4H8VA 3EADA 4JPIA 4RKAA 3AMCA 3RLUA 1F6AB 2W9DH 3CZGA 1X7QB 3N44B 4M6UA 3STGA 2B7PA 2WD0A 4WSHA 4DEPB 2DJ4A 4QNEA 1RVFL 4XNXH 2W27A 3GZOA 4UTBH 1HJXA 5DI8B 4XP1L 4U6YA 6ALDA 1R3SA 1G43A 2QVMA 3HVDA 4MY9A 2QIWA 2ETWA 4KRPC 4BXSV 1UIPA 4GG6F 3V0VB 3VTMA 3ROLB 3WG6A 4FP8L 2FJKA 4M3JA 1BDYA 2TSYA 1MREL 4RWYL 1ETJA 1CDIA 3AT0A 3KX6A 4J4PC 2AVGA 3WMLA 3FGCA 5HYSG 4LBSA 2ZKXA 1H7PA 5CLWA 4OOXA 1QBMH 2F5BL 3VFPA 5IOBA 3CCRB 3OAUL 5AYYA 3ES6B 4GY0A 3GG7A 4ZUUA 3PZOA 4UNIA 2XH7A 4N3TA 1HP5A 4KKLC 3L0GA 4FQLL 3TBVA 3ZE2F 5GGRY 4BQ5A 4NQSB 1KCVL 1XGUA 5KVFL 4QY8B 4WJEA 2CUAA 4XCCH 1ZTXH 1JZ5A 3BKJL 3GBNH 3HGOA 2X41A 4AM0A 4OWGA 4Q9QH 2P8CA 4BXVA 1II4E 4F8QA 5EU6B 4LGPB 3NFNA 2Y7QA 1T21B 4Q74A 1A9EA 5AB0A 3SCUA 3FO2B 4R7NA 2GK2A 4ZMYA 2HJKB 2DS4A 4H1ZA 2JJUA 3UAAA 4L4PA 1N6QL 4ZO9A 4I89A 3C09C 3NQBA 3KXFB 5IBUG 4X3ZA 4RQQA 2KZHA 1UZGA 3EKZA 4IOTA 3AHTA 1TV7A 2VP8A 1PKYA 4WU5A 5IIEB 3L65A 1CGVA 5GJNA 3PG8A 2PFHA 3FSWA 2GWNA 3BESR 5DCCA 4I18B 2WSPA 2HISA 5DWUL 3EKGA 4JAMA 5IYWA 1CFSB 1Q2SA 5EEYA 3QNYA 1KIUA 3AXHA 3KPPB 1TU2B 2IAMC 3TN6A 3AXLB 4MTVA 1H85A 5I00A 1ROCA 1GQLA 4YAQB 3B06A 3FKUS 3MCNA 4TLSA 5D8JL 3RUGE 4H0GA 2G5UA 4K5NA 4AZCA 3FVMA 4LP8A 4W9FC 3DX7A 3GAKA 3U30B 4WGHA 4M24A 4ALAC 1N0LB 3LHWA 5INCA 1FV1B 1JWSB 1MHPL 3ATAA 2VC2B 3EBIA 4F2MB 1NCNA 1PS3A 1HKJA 2P1YA 2HYMA 5TD4A 1E56A 1Z3GL 8RUCA 4ZE4A 5D55A 3CCHB 1UB6A 4JPKH 1ACYH 3HPJB 4TOYH 3KPLB 3EJJX 3BARA 3W00A 3SJVE 3JV5A 4N5UA 2BNJA 4MFEA 4EIVA 1R6VA 4E5XA 4PL1A 1YMMB 4NP7A 5CP7B 2X4TB 4G5AA 2PP0A 4UDUB 1X5ZA 1IO4C 4Y9MA 2H9AB 1AZ2A 5DEJA 1INQA 3STBA 1K3ZA 3HE7C 2CIKB 3G1DA 3VA2C 4KK9D 3XINA 1TJHH 2AXGB 1DEDA 2YWZA 5F9JB 1S7QA 3BJTA 3O4OB 5DRZB 1H19A 2H6PA 1E4WH 3SCVA 4YFEA 4Y4KB 3EOEA 5B3JF 6FABL 4AIXA 4XVUC 1K7EA 3B97A 3PFUA 2BX5A 3SDCC 4KXZI 4K7PH 3AHXA 4ILSA 3NACH 1TG8A 3LLXA 5FL1A 3X17A 1KKOA 5HHOD 3U2EA 1K6WA 1M1XB 5JORB 2VVNA 1H51A 3DX8B 1NCHA 2QJIA 5ABFB 3LS4L 3P2BA 2PB1A 2NVDA 3UTZB 5LAPA 3SCPA 4D0BA 1UJPA 2PLTA 4C83A 5CBAA 4D6HA 2FD6L 2WGNB 3DK0A 3WYZA 3H4FA 1N0UA 1M41A 1NIAA 3RTLA 4Y6GA 1XL9A 3Q6QA 3LNMA 4F2EA 1SYTA 4H26B 2X5PA 3W9ZA 1F42A 1XF4A 3AIQA 2NNAB 3CPGA 2NPLX 4IK6A 2OTDA 3QH3A 1JZ3A 4M6NH 1MNZA 3VKDA 4DOHE 4PU2A 2P48B 3M7WA 4XAPA 3B9KC 1BLNB 1TQSA 4ACZB 2DZXA 3ZSTA 4NO0A 1CF1A 1RIVH 2FH6A 5EOCH 1M3UA 4K3DL 2CWXA 4Q6YA 5I9QB 3UTQA 3GE7A 3II3A 1TMHA 4AK1A 3RNQA 4RDJA 4DF0A 2X12A 1NAKL 3TURA 2Y7FA 4C91A 4J3SA 3MV8B 5FDWA 3HZMA 5DHYB 4O12A 4DP2X 4PRPB 3WBYA 2DIKA 3EA3A 1HOCB 2FYYA 3ATFA 1R2RA 3RUGA 3PPEA 2Q3AA 4MJ4A 4RGNE 1A4KB 1H8SA 1NDTA 1WAPA 1V5JA 1SJBA 2RFGA 4PCKA 1B3OA 3VGFA 1E72M 4ZE5A 3QHTC 2C9RA 3VYNA 5EF3A 1RHCA 2NXZD 4HX1B 1K5WA 5C0EB 1FZMA 3NDOA 2NWRA 2NX3A 3EH5B 3L2LA 1E5JA 3RB7A 3MSYA 1FLTX 5FM5O 2QIIA 1BIIB 2G60L 3SJVA 2PDNA 5EUOF 3ZDZF 5HXMA 2EEDA 3ZE1F 4KRPB 1D5IH 1LO5B 4BZ2H 2IQ9H 3T78A 4LLAA 3G6LA 3N40F 1KQSB 1E9OA 1U8HA 1MFEL 5C0AB 3CZJA 4X5WB 1Q6FA 2FGLA 1U41A 1A1NA 5DS0A 3ZS4A 1M4KA 3PB2A 3WMBA 4KZDL 3SCRA 3G77A 1MY5A 3MLRL 2E74C 3PIQA 2MNUA 4EAYA 1KBBA 1WEJH 4Z3FA 3VD9A 4LLDB 1U8QB 2EVIA 1MY7A 4K2UL 3ZYZA 2QVTA 3LKNB 3N3EA 3SKNB 4AC4A 1K28D 1X97A 3NXFA 3MAWA 4NKOB 4Z1BA 1TIUA 4I5XA 4YCPA 4UV7H 2CIIB 3MRJB 2YUWA 2PDPA 4ODVH 2V69A 2DQTH 2RH0A 4XWGH 3OAAA 5C09E 4XAWH 2ZKYA 2W94A 4JRXD 4KAQH 1AQHA 2HT4D 4P5UA 4YAWA 5I1EL 1ILSA 5A2KH 2L7UA 3TNBA 1JAEA 3T8LA 4MCNA 1QLEL 5DFVC 3OVRA 2O4MA 1YCSA 2PTYA 4M43H 3WJMA 3MFGB 3C09B 2W0UA 4XNMB 3KMDA 3K46A 2WXNA 4P4KB 4XO6A 2YMXH 4NX0A 4P4RB 1MUJA 4OPOA 3R0NA 4D8PB 1KJVB 1W6LA 4GK8A 3FYIB 1H8NA 4UT9H 5HY9B 1E4KC 4GOAA 4UQ2B 4EI5D 4PWHA 1NJ9B 1Z0NA 1EO8H 1NCAL 1FWBC 1QEWB 4UFHA 1KDIA 1B3WA 2Z7KA 3WJWA 2IAMB 3CIXA 3BSGA 4NQVB 5LBVA 3FRUA 2EDHA 3UTSD 4I3SH 1KCKA 3SY5A 2ISFA 1SFHA 4OTXL 1IAOA 2DKUA 3GIZL 4APQB 4PN2A 4N9GB 3ZIYA 3MROA 5IFJB 3ULVF 1N6VA 4OUOA 4NLHA 4NT6A 5D70H 1YJWB 2CUIA 2QUNA 3T1WA 3IUHA 3DKHA 2AJXL 1XGQA 3GMQB 4PUUA 1JCJA 3LQAH 2PABA 3W7CA 4PE8A 4QRNA 4FN0A 2V3GA 2Y7OA 2AEIT 3VD0A 4XNBA 5J6GB 1XIHA 3W39B 5J12C 2Q0ZX 2UWEE 5HP5A 1DEEA 3QFJD 1VZGA 5K9JL 1KFBA 3SN0A 4HXAH 4PMVA 1E28B 4RX4A 1Z7JA 3TV8A 4AUUA 3V7MA 4YDVA 1XRSA 3HE7B 4PC1A 2BSRA 1HW6A 3D05A 3TV3L 1WD9A 5JYLA 2Y24A 2QVIA 1XE1A 4OBRA 1TTUA 2EDOA 1QBLH 3QPKA 2VL5B 4HF5L 1QYGL 1COWA 3OZ9H 5KYYA 1VJZA 4QR6A 3QQNA 1QWUA 5BSYA 3JRKA 4PGCB 3LU2A 2W60A 3CL8A 4LF3A 3L3KA 4FWTA 4FQIL 4JTUA 2PXYC 3OF6A 4GPVA 1WAEA 1KRCC 3GLDA 5DJ6A 3BSMA 2PLKA 1SLVA 4BHUA 3W5MA 1PTAA 1WJ3A 2FATL 2I9LB 3EGDB 4F33A 1JWMB 2VLRB 3DFYA 4XH2A 3UTPE 1IGIL 5H94A 1HXYB 2IQAB 5MEND 3KBVA 3B7YA 2XQYK 4XLEA 4UZFA 1H6TA 4HS6A 4GBXD 5J5EA 2EXTA 2K1MA 2ZONA 4B27A 2YPKB 3UZEA 2VDMB 3EJYD 1H60A 5E2TH 1QA9A 4QG9A 2J2ZA 3KW3A 3SGEH 3K91A 1UOLA 3O05A 4GVIA 5LHEA 3AFBA 3VOCA 3BDYH 2ZAIA 3UZQB 5C09A 4OCXH 2MHAA 4GUPA 1PX3A 1D7FA 4MWAE 1CWYA 1S2AA 1AD1A 1TZHA 3NNTA 1KV5A 1CBVL 3ARVA 4DETA 1YPFA 3LPWA 4QAWA 4YL9A 3C5QA 2A6JA 1Y07A 3M0XA 2R1YB 3OXRB 1GZGA 3T07A 3ZDXB 3T9PA 3IETA 3B9KB 3FEQA 2WTRB 3FN3A 5GGQL 5BZDB 3DDYA 2EUVA 1C93A 5E2VL 2CM6A 2HT3D 3KDNA 3WH8A 1S5IL 3SDOA 3USZA 3NJHA 4FEZA 4NM4H 2BP3A 4QRUA 1BGXH 1OTSD 4HKXB 1FORL 5CZXD 4RJLA 4XP6L 2IKGA 2CBQA 4J5VA 1UXWB 4XCYB 2C7UB 2D7TH 1JPEA 3M7FB 1MRFH 4BQ2A 1CNEA 3FUDA 1MRDL 3VTRA 5T1DL 3QG7H 1GCYA 1XH3A 4IIQC 1XXFC 2W0LA 1DPMA 3BH8B 3QSRA 3EH4B 4KZ0A 4IFKB 3Q2VA 1HXMA 4WRLA 2IKJA 4FCHA 1P4LA 4QAIA 2I1LA 1LNUB 2HNEA 1TSRA 4AX6A 1WTHD 4NKDB 4UTWC 4ZFOB 5DFAA 5K9KB 3BW2A 4D0DA 5E6RB 1T4KA 2PCEA 1QX4A 3A8KA 4WZ9A 4E9WA 1CTOA 1V5VA 1CK0H 2BOBB 5FYKD 4X5PA 2XIJA 2UWEA 2Z34A 4WK4B 4MZYA 4LHUB 3GWJA 3T2QA 4GG6E 1ZQ5A 4G56A 1RZJL 5B7ZA 3OEEA 2UZXA 4L3CB 1F3DJ 4P2RD 2XHNA 3GYRA 2ED9A 2FZ9A 3CAKA 5D6DA 1CE1H 5H8DA 2VJIA 3ZTCC 2B81A 2H45A 2DZTA 1W3KA 3RZCC 1AZ1A 1XGZA 4KX8A 2EQDA 4HKBA 3QUXC 5LO7A 3N18A 4R33A 3PJTA 1CF8L 1FCCA 1F6KA 1G6RA 2F54D 1K8DA 3FQRA 2PTZA 4PJHF 1JHTA 2DN7A 3ZE2E 3N12A 2LU3A 5TDPA 5KEZA 1I8AA 1Q85A 2XKSA 5HHQA 3EO0A 4OCWL 2WZAA 3QXDA 2OSLA 5C7ZA 5JXQA 4R90L 2FO4B 3H2NA 3NT0A 5D30A 4U3SB 3M0IA 1OSPH 4YVPA 2YEQA 3HKFA 1RHHA 3RVTD 1SPDA 4D9RD 1RJQA 5C07E 1IE5A 1IIHA 4W9EC 1JDDA 2D2HA 1GGIL 5IYNA 3H53A 4Y9AA 3VO2A 3C5XA 5E7BA 4TOQA 1MJ7L 2XZ9A 3KPRD 3Q94A 4MWAA 2OXNA 5AW0B 3SR7A 1QI3A 2A7BA 3CBKB 1QHZA 3A24A 5EORL 3U2SB 2EADA 3A23A 3NL5A 5I0DA 3V4PB 3MYJA 5A43C 4GP5B 3EFDL 1UR2A 2PDJA 5FIPA 3T1GA 1SOQA 2Q6IA 3WNKA 2A1YA 1DIDA 3P14A 1TMQA 1EH9A 5IFHL 4C57C 5C5YA 3DIFA 3WFEL 1RU9L 3T0BA 4RISH 1NWTA 1A0QL 3LHUA 1KOAA 2XC8A 4ADJA 3OBEA 2PWDA 4H7VA 4J40A 5HGAA 1GQNA 1HL5A 1CFTA 3UH8A 4NO3A 4CNTA 3S2AA 2ZJSL 4HUUB 3S4TA 5C0DB 4J1OA 4NI8A 2X4PA 3BPNC 3S7GA 2V31A 1HX0A 4O02B 3TJHD 3H55A 2MQ3A 3CWNA 1KBGL 1R5VB 4FYRA 5F1KC 2IDSA 2J66A 4JUSA 1CBJA 1WDRA 2Z0IA 1MAMH 5DEZA 1H15A 1BIHA 8CGTA 4CD6A 3MCOA 1Q9LA 4LEBA 1CJYA 4MMWA 2D9CA 1V51A 4S3BA 5EOTA 2GC7C 1NAML 4KMQA 3IDJA 1JGIA 5E5RB 3MJMA 3JV6A 5HYQA 4HSAC 3V5KB 3OKEB 4WFFE 5FO0A 3D6GA 3WXWH 3HZVB 2OBTA 4DLFA 3WLWC 3GUWA 3VMFA 4XOAA 2H32B 4KVPA 4CMMB 2GREA 4GG6A 5KJRH 1MELA 4JEGB 3SBPA 1LG2A 3UWYA 4U1IA 1U3NA 2YK1H 4GXFA 5D4QA 4MBOA 4TLUA 3FW6A 1P7TB 5AAMA 5E23A 1FCBA 2PXYB 3MJ9A 3KBNA 2ZXWB 2EH7L 3VW3H 1PNDA 3K4ZA 2GFBB 3P0YH 1VGAA 2MOGA 5AB2A 1L7TH 5J1AB 2AJVH 4NENA 1EC7A 1SZFA 1KYOK 2Y8UA 1OM3H 3A6OA 4DWSC 1RZMA 2Z1VA 5C08B 1B1YA 3L3JA 2VC5A 4OM1H 5MKGA 5E7FA 1EP3B 3FSAA 4M6MH 2WQUA 2XPYA 2DH2A 1RUPH 3PF2A 3MGTA 1U8IA 4U4MA 2EO9A 3C6LD 3OJMB 4HN4A 1IEQA 2BS8A 4I77L 3NFUA 3UP6A 3SO3B 2IH1A 5C07A 5CSYA 3MMPA 5DMYA 2K6ZA 1C92A 2UUDK 4IPJA 3V4VB 2YBTA 5HHVH 5B39G 3EUUA 4D72A 2I5QA 2BVOA 1W1PA 1EJ6A 4KHTL 1CX9A 5BQ7B 1FDLH 1S7VA 3L66A 4QIRA 1SN5A 4KHXH 2PP7A 4PB0H 4I13B 5D7JA 3KWVA 5BW7A 3GXFA 43C9A 2EFGA 4HUVA 4HS8H 1DLHB 1XGRB 4AVKA 2J9XA 4LNRA 4CLMA 5C9JB 8A3HA 5I18H 4TVDA 3SY0B 1HTYA 2VDRH 4FFZA 1HHKA 4XSLA 2WZ5A 1W0MA 5IGXH 4PJ9C 1ADQA 1NBMA 3TO4C 4IIQB 5IOKA 5CIPA 4JQ2A 1ETZB 1RK0B 5J8LA 3ERPA 4ZOEA 1ELSA 4XPFH 4PJEF 3QY6A 2TMDA 3ASNB 3M64A 1XH2A 2P88A 4N4QA 4MUZA 3UAJC 3NN8A 4AGQA 3EJUA 1PZDA 5IHWA 3HRZB 2WN2A 4H6QA 4RPDA 3P77A 2COVD 3LCLA 1K77A 4IMDA 5EUOE 3ZDZE 4V11A 3QEUA 3FA3A 4XZMX 3A9BA 2QS8A 4B5TA 1L0YA 2PGRA 3ABMB 3B82A 4P5TD 4CQJA 1NA8A 3FT2A 3GKZA 4KZEL 5FR3A 3RZCB 2XYBA 1JNLL 3QUXB 4LKXA 5E08L 2WV8A 2ZWNA 5CJQL 2DWDA 2DTML 1BKHA 2DQDL 4Y9RA 4IBUA 3S47A 4R3SB 5FYKH 2X6XA 4MSSA 2RAMA 2NV2A 1X5AA 4EIUA 2PGFA 3I6GA 4UZSA 1OP4A 2ICEC 4K39A 3O6CA 1PTZA 5E6IC 4NIRA 3L2NA 2PDHA 1I82A 2HJFA 5D7EA 3IS4A 1KTKE 5JW4Q 2YCLA 2PCPB 2IANB 3T42A 1P1XA 2P5WB 2ZT9C 4NRYB 4G70B 2C9UA 1W8NA 4L8DA 1KM1A 4DK5A 1KGCD 4G8FA 2WJVA 4N8VG 1O6SA 3GI8H 4L3EE 4EAEA 4HS3B 1NJID 5KBPA 3L7RA 4FOUA 4Q2ZA 5ALCH 2VC9A 1V3LA 2C3VB 4YR6B 4NWTL 3WN6A 4X0KA 2CMRL 3CCVB 3D0VB 1A6UL 1PZ2A 2FGZA 5K4XA 4OLYL 5IOPB 2D31A 2BW4A 1KBPA 4YXLH 4XR8C 2QPUA 3Q6FA 4HCIA 2ISSA 4X98A 2BVPB 3ZVIA 2W65A 3VWJC 3AACA 4UBDC 3GBEA 2UXFA 5L2JA 3IDIA 3DVFA 5I1DB 5IROD 3CYJA 2DUAA 3LSBA 1WPCA 4XN2A 1FN4A 1J96A 4P5RA 3UG3A 4FGMA 4JN7A 3ULVE 1JUKA 1MEIA 3SKJH 1KNWA 5LBSL 2QTZA 3BPNB 3FRPB 2WLIA 3GXDA 4R9HA 1U4EA 3IPEA 4TMPA 3EEZA 2BHUA 3F6IA 3EBAA 1KPVA 3D06A 3BJLA 2NR6A 2XYLA 2E3ZA 3OOQA 2K70A 5FHAH 1YXYA 3LK6A 1GXEA 3SDAC 4XK2A 4F4RA 4JRLA 5FO9A 4ZW6A 1OCWL 3ZN6A 1RI8A 2XNDA 5A8QA 1H49A 5AAWA 1R3RA 5LIUX 4AEFA 1KRBC 1LEIB 2EDEA 5F89B 3LN5B 4ZFFA 3GXUB 4O2EB 1Q7YD 4AL8L 3GB6A 4G6CA 3BGFB 1G0DA 2I07B 1RK5A 1ROWA 5T1MB 3MJ7B 4RGMC 1XQ4A 4UTCA 2AKMA 5BXFA 4PS8A 5G4MA 4UF7C 2CO4A 3MCLL 2F8OA 3HHSB 5EUOA 3KLAB 4B0MM 4E41D 2B2XL 4P49A 4XZ4A 4AGLA 3IRPX 4K3ZA 1F86A 4Q14A 1SVDA 4JG1H 4ENLA 1MDRA 5LXVA 3GUGA 4B7IA 4QCIB 5F3HB 4CSTA 4L1WA 3I1FA 1GZPA 4X6DF 5E00B 2XFXA 2J6VA 4KROC 2DD8H 2XX0A 4WAFA 3GSOA 5CGYC 5DLLA 3OLEA 4HV8B 3Q8AA 2NCMA 4DWSB 4TU1A 5KZ6A 3ITLA 3CLFH 3BMWA 4X5LA 3MLXH 1T7ZA 3BSZA 3OHIA 1DSWA 4GHRA 1IGYB 4L5ZA 5CDFA 1EJVC 3B9OA 1C9DA 2ZRWA 1RMFH 3AS0A 3BAEL 2BNQE 4HZLA 1TJRA 3QC5X 1R3LA 4P9MH 1YQVL 2WZPP 3MS8A 3LV3B 2ZUVA 5SX4H 5K39B 5IM7A 2OTUA 2QADC 2QZQA 3NGFA 2WM1A 5SWZB 1CDCA 3O2DH 3JYCA 1J5SA 2XX1A 3F4CA 4BFGA 1TZ8A 3FQ1A 4KK6D 3COTA 2AV7A 4NQEE 1PZ1A 4L3EA 2LV4A 3TFXA 1TR9A 4YSTA 3WKPA 3TBBA 5GSRA 4DP0X 3QHOA 2BDQA 4MAYA 3UQNA 4JFFB 2GSIA 1HCVA 3FOMA 4M61A 5D7IF 2YWYA 3PULA 1OF2A 1TWIA 2AKRA 1Z5YD 4JFZL 43CAA 5D7LE 4XN4A 2R1KA 2C1PB 3DURB 5HVHC 3V0FA 4NERA 3CVDA 3ZKXC 3FT4B 4EUPG 3RI5F 1SVZA 3ZVVA 1LQ2A 1EEYA 4PJIF 3MRMA 2Z31D 1RUQH 1XFCA 1TCRA 4JN6A 4PJ9B 4LK4A 2A83B 3TO4B 4HIXH 3QQDB 2BXYA 1XYAA 4NWUL 1PHQA 5F0JB 3VMNA 1VP5A 2VCAA 5BRPA 3IYLW 1E0TA 4B41A 1BQEA 3I6LD 4LLVB 3A5VA 4AW4A 4A8RA 2G3JA 3F4DA 1JGLL 2BDNL 3C86A 2HMIC 1IEBA 5IW3A 3VXPB 4BI7A 3Q5YA 1KJ2A 1PO9A 3AGPA 5CEXA 3AO0A 4E42A 3CZEA 3OLIA 3GLCA 4GXPA 5SWUA 3CPRA 1DN2A 4B9GA 1ALDA 1M68A 3UEZA 4JFWA 4AQ1A 3K6NA 3OJWA 1T03L 3BCJA 3DESA 3TAOA 2CBVA 3P3SA 3FS2A 4LCUB 1HNGA 3RWGB 1OSYA 3IGXA 2DFAA 3ULSA 1SXCA 2P3YA 5B1KA 5JOPD 3CMOH 3ZR6A 3ZJKA 5BZAA 4AGMA 4YX2H 2VQ1A 2UYLB 1B0WA 1E8WA 4P3DB 3VZYA 1Z89A 2X89A 3JV4A 1BEYH 5GISH 5BWAA 5CH9A 1AGFA 3IGUA 4PRWA 3WNLA 3N4AA 1YPIA 4PJHE 4Z7WF 2IF7A 5KYUA 4N8PA 3IMRA 3EX1A 3ALGA 1D3CA 2FGBA 1GYLA 1G6RL 4K7FB 5CJ8A 1U22A 3O11A 1CDUA 1FVCA 5C7HA 5GS3A 1B2YA 2K8QA 1CGYA 1C8VA 1MFCL 3ZXWA 3WQ5A 3AREA 1BWVA 1H5BC 5C0CE 3BVNB 5AUMA 4XZNX 1TLLA 5KN5A 1E9YB 1QUMA 5EZIL 1SMOA 5EBWB 3RWIA 4TL4A 4WV1B 3A8JA 3KGTA 3U0PB 3GRBA 1UJQA 2AW2A 2BSED 1MCIA 2BNQA 3GSXB 1QFYA 5LBGA 5KBDA 4ZUSB 5KG9B 4AVHA 2FR4A 4DO6A 1R6WA 4GI6A 4M62L 2BLFA 1HF6A 4QE5A 3O3UN 4XMXA 1UA3A 4QTFA 2IBBA 3BVXA 4NQEA 2XVLA 1KCRH 3CEUA 2ZZGA 2ACUA 4AGNA 3RU6A 1EFXB 3WFLA 4JM2B 3NMEA 3VWJB 2WJDA 4RBPH 5CCKH 3VH8G 5DMIH 1S46A 3SODB 3KEWA 1IKFL 1RK7A 1KT2A 5DRCA 4ZRGA 4QGTA 3JR2A 2XRAH 2YO3A 2VR6A 2AXFB 5D7LA 3MRBA 1O6VA 3KUMA 3SO5A 2X4NA 4CNOA 1DQJA 4ZW3A 1UB3A 2QF8A 4XBGA 4ZZ9A 4ONOA 3TFCA 2I32A 1RZIB 1OTUC 3Q2WA 3ANUA 2VDNL 1KNOB 1YY8A 1Q82D 1QR7A 4G7EA 3BP5A 1VEPA 1LYXA 1RUMH 2VJ8A 4TQ8A 4C6JA 3QGKC 4OLUL 4MJZA 4W9JC 2C13A 3TZNA 4MAUH 1D2KA 3SDAB 3B0XA 1W3JA 2ATSA 5C9KA 4GQNA 2MFNA 5F4MA 4GQ9H 1R3KA 4X7CA 3UTTD 3GSUB 2KYIA 3FFCE 1HJCA 2WCPA 3BPCA 3W27A 2X1UA 1FZKA 2IIJA 4NSKB 1NM9A 2R1MA 2NW2A 1XZ0A 4FMFA 5I76A 2IPTL 3AG1B 1ZVHA 1D6EB 2DWEB 5DFTA 1A8JH 4RGMB 4KPHL 3IRCA 4E9RA 3JWOL 5U4NA 3H2AA 1XL6A 1C5BH 1ZVSB 4I8DA 1QFUL 4K15A 3RBGA 3WF4A 4D8ZA 2OMZB 1MF2H 5A69A 1JVKA 3FQXB 1C8XA 3TX4A 3A1PA 3SPVB 4R4NC 3H1ZA 4ZW7A 2BY0A 2AJ3B 5IMMB 4DX3A 1WE5A 4B4DA 1KZLA 1EDHA 4GRWF 1JUBA 3IXTB 2AEPH 4HWZB 4F58H 2R24A 4V2CB 1F0LA 1E6JL 1U95B 5JO5A 3UABA 2WMIA 3KR3H 4KBPA 5FM5M 1DDHB 5AL8A 2YAMA 4ODUB 1MRCH 4PJHA 1ONXA 2VDGA 1JRHL 3GI9H 3TN5A 3OU8A 1ZSHA 4MX7A 5JH1A 3W7EA 1J8SA 3QI9A 3W2DL 2OL3H 1VRSA 4JGJA 1V6XA 4MNQB 3WTWA 5G5IA 5DUJA 3B9EA 3CSYA 5JIQA 1WZMA 3BT2H 3FN9A 4W70A 2HLAA 1B4JL 3CHQA 1SPQA 5C0CA 1JGUH 1S7XB 2TRHA 3DGDA 3B4NA 2YB4A 2AQNA 1UZDA 2QADB 4FAMA 1BOYA 1R75A 3S36X 4F7MA 4LCSA 3OZYA 4IIFA 1MZHA 2ZUWA 2ZYIA 4OUEA 3NOIA 4LUIA 3C5SA 2O9PA 3TLLA 1DYSA 3VIHA 5HI3D 4WJXA 3VCCA 4PULA 3TN0A 2X2IA 2WUBL 1LORA 1D8CA 4XPHH 4XX6A 3IJ8A 1BX0A 1IC1A 2HZGA 5G4WA 1HGWA 3D85D 3HAEA 3X1FA 4NZRL 5ILTH 1OAXH 1Q8AA 4L4TB 4ZVJA 1WHPA 4A7UA 1JG9A 2O72A 3POHA 1NFDF 3RPIA 4LOFA 3Q05A 3NQFA 3OMAB 1M01A 3C9NA 3Q1EA 5HVHB 3ZKXB 5E99L 3RU8X 3VUAA 3UR7A